3TA9A

Beta-glucosidase a from the halothermophile h. orenii
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
449
structure length
448
Chain Sequence
AKIIFPEDFIWGAATSSYQIEGAFNEDGKGESIWDRFSHTPGKIENGDTGDIACDHYHLYREDIELMKEIGIRSYRFSTSWPRILPEGKGRVNQKGLDFYKRLVDNLLKANIRPMITLYHWDLPQALQDKGGWTNRDTAKYFAEYARLMFEEFNGLVDLWVTHNEPWVVAFEGHAFGNHAPGTKDFKTALQVAHHLLLSHGMAVDIFREEDLPGEIGITLNLTPAYPAGDSEKDVKAASLLDDYINAWFLSPVFKGSYPEELHHIYEQNLGAFTTQPGDMDIISRDIDFLGINYYSRMVVRHKPGDNLFNAEVVKMERPSTEMGWEIYPQGLYDILVRVNKEYTDKPLYITENGAAFDDKLTEEGKIHDEKRINYLGDHFKQAYKALKDGVPLRGYYVWSLMDNFEWAYGYSKRFGLIYVDYENGNRRFLKDSALWYREVIEKGQVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression, purification and preliminary crystallographic analysis of the recombinant (beta)-glucosidase (BglA) from the halothermophile Halothermothrix orenii
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
molecule keywords Glycoside hydrolase family 1
total genus 162
structure length 448
sequence length 449
chains with identical sequence B
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ta9A00
1GW1A 4JZ5A 3QOKA 1CYGA 1J0KA 3L4UA 4BF7A 3ALGA 1E43A 3BLKA 1UD6A 4Z2JA 3MSGA 3WN6A 1C7TA 4WKHA 2Y2WA 3LMYA 2QMJA 4URIA 2EEXA 2XGIA 1JAKA 5CZKA 1GJUA 1GQIA 3WQWA 2FHCA 4N42A 5CSUA 2XG9A 1E4IA 1UD3A 5HPOA 3CHDA 4OOUA 5HPCA 1QI0A 1NM9A 2X0YA 1CBGA 2QF8A 2ZIDA 4HA1A 3WF0A 1UD5A 4H2CA 3PHAA 4AIEA 3T2OA 1CXHA 2WC4A 3VGGA 1P6WA 3CUJA 1XD0A 3N17A 1KBBA 4WK9A 1XH2A 4OIFA 2J4GA 1KCKA 3VD5A 1OIMA 4FMVA 4OZOA 1JGIA 7A3HA 2YOCA 1F4AA 3WNNA 5IHRA 3B9AA 1JFHA 1UA7A 3FAXA 4PTXA 2XM1A 3WY1A 5FKYA 3MU7A 2UY4A 1HX0A 3N12A 2V38A 1GQKA 4TVCA 2UY3A 4W7UA 3ZJ8A 3SCSA 2VVSA 4J28A 2CXGA 2VX4A 3SEPA 2VNCA 1S46A 2W92A 5A8MA 1KXHA 3RIKA 2J7CA 3U5UA 3A4AA 3ZR5A 2E0PA 3VKKA 3NUKA 1Q6EA 3OG2A 5A6JA 1I1XA 1Q6FA 4HU0A 3CIVA 1CXFA 1E56A 1QI4A 4F66A 1V6VA 1V0NA 2XPKA 1XHGA 3AISA 3T0DA 5D9MA 1N82A 2XVLA 1H0GA 4MAZA 3W38A 4GQRA 5TD4A 1HKJA 5BXSA 3AOFA 1E15A 2WK2A 2ZX8A 1EA9C 2O92A 3WKZA 2J7GA 1NWRA 3WENA 3W28A 4ZENA 1V6YA 4IISA 1U33A 1NWTA 4CN1A 4KH2A 4LXFA 1GHSA 4MNLA 1ZBCA 1E1FA 5A6BA 2V3GA 2CHNA 1B3ZA 4HA4A 3VO0A 3U7BA 1Q6DA 3AIQA 4MB1A 3WH6A 1UR8A 1UD4A 3THDA 3SUTA 3LPFA 2ZE0A 2EJ1A 3EDJA 1BYBA 5IHSA 3MO4A 1OB0A 4DWSB 1H11A 1VFOA 2OWWA 3AHTA 3VIGA 3WD3A 3F5JA 2VT0A 4MB3A 2NT1A 4MADA 5IXEA 3UERA 2WCGA 3DYOA 3RCNA 1V3LA 2EXOA 1CDGA 5D8ZA 4RE4A 1EIBA 4EK7A 5BXRA 1QI2A 3CZEA 5GQBA 3ZIZA 4B3KA 4XV0A 5BYWA 2GFTA 1V3HA 2AMGA 1BPLB 5ABFA 4UQ9A 2VL4A 2OLHA 1IZKA 2XTKA 4R5EA 1GOQA 3AQUA 4P7OA 2CEQA 3UR7A 3W53A 3ZJKA 1B30A 4TTUA 1PEZA 1EHAA 1QI3A 1CXKA 1GUVA 4GI6A 3L2MA 1TMQA 2CIPA 1E9LA 3AHXA 1EXPA 1FH9A 1GORA 5HXMA 5F7UA 3IANA 4CD6A 1WZKA 3K4AA 4AD5A 5A6BD 3VGBA 1NWUA 5AYIA 4HMDA 1E5JA 1E6SM 4HZ7A 3K4DA 5IFTA 4BCEA 4XUYA 1ECEA 1D3CA 2ESCA 1VEMA 1JZ2A 1LQ0A 1HP4A 2NSXA 3G6LA 1QOXA 3SURA 4FF5A 1V3IA 2WMHA 3DYMA 3OZPA 3RPMA 1J10A 2CCRA 1WKYA 4HU8A 3QHOA 3N15A 4KWUA 1I1WA 1E5NA 4NI3A 4GI9A 8A3HA 3BGAA 3AMKA 2VZSA 4AMCA 3QOMA 5E6YA 4U3AA 3F5KA 4W85A 3PBGA 2D3NA 4YHEA 3RO8A 2VX7A 1G94A 1NOUA 4GZIA 2O9RA 2ZUVA 4J3SA 2X1IA 3VU2A 1V3KA 3DHUA 4D6CA 2VTFA 4QCFA 3GTNA 4AD0A 3GXDA 2OSWA 1V0LA 2VQTA 1H4PA 2G3MA 4PMUA 4WKFA 1W9XA 4UQDA 5HNNA 2VRKA 4U5IA 2C0HA 3QR3A 4F79A 1QHZA 1W1TA 1M7XA 4P8VA 2CBIA 1XRVA 2FDMA 2WMKA 2WKLA 4QP0A 5JBDA 1DEDA 1FH7A 4YPJA 2AAAA 2VR4A 3NIYA 1ZS2A 2UY2A 1BAGA 4ZXLA 1XYZA 2FGZA 1KQYA 1M53A 1Z32X 2PWDA 1UH3A 1V02A 3M07A 2DSUA 3QHMA 1W3HA 2GDVA 4NSBA 3DC0A 1DWAM 2VOTA 3VGFA 3CZKA 4AZIA 3OIHA 1CGTA 1H0IA 1WO2A 1E71M 4D6GA 4NRRA 1ZJBA 1H5VA 1BQCA 4TXEA 4GO9A 4AEFA 3FHAA 4ACZA 1ZBWA 3WL1A 4H7VA 4W8BA 5CJ5A 2WCSA 5A6MA 1ZL1A 3A47A 4GO8A 3VX0A 1LL4A 2CERA 1LL6A 4F8XA 4X9YA 1QNRA 4KGJA 4L4OA 4J3TA 1GQJA 1MW3A 5CPQA 4H41A 2JE8A 1OSEA 1XGZA 1W9BM 3PTKA 4D6IA 4PCTA 1PPIA 2BXYA 1UKPA 1JYXA 3WD4A 5EFDA 1MXDA 3BAJA 1J9YA 1TE1A 1UKOA 2VMFA 3GYCA 2YJQA 4PTVA 3GDBA 2YLAA 2G41A 2ZWZA 4C7GA 1B3WA 2JIEA 4JIEA 1KCLA 5A69A 2VX5A 2BVDA 1OGSA 5FCZA 1UQZA 4PMYA 2WC7A 4QLLA 4TUFA 1B90A 4AD4A 1JNEA 4CUCA 3VD7A 3WD2A 1UR2A 3GH5A 1J01A 3SCNA 1DWJM 1E4NA 4B15A 1E4LA 4W87A 4GXPA 1TVNA 3CO4A 4UOJA 3ARQA 4IPLA 5I3DA 4PMZA 2OSYA 1BSIA 1KXVA 4ATLA 4HOXA 1AQ0A 3VGDA 3ZJ7A 2WHMA 2DSVA 3UCQA 2J7HA 3AFBA 3U57A 6A3HA 5EB8A 2PWGA 2O9TA 2WVVA 3VIKA 4B9YA 2YKKA 2XVKA 1TA3A 3SCVA 4Q22A 2J7BA 3L4TA 1B3XA 1O6IA 2WNWA 1B0IA 3ARPA 1UUQA 4ZFMA 5I2UA 4JKKA 2DSKA 3GZAA 1B31A 1HJQA 2FHBA 5ECUA 1WB0A 3PZ9A 5JBFA 3N13A 1WPCA 4TX6A 2NW0A 1JZ3A 1C3FA 1JL8A 1OWQA 3L4WA 1BTCA 2VR5A 5KEZA 2ZUMA 4PBGA 4W5ZA 1HJVA 1RH9A 3MUY1 2IXVA 5E0CA 2V5CA 3VIFA 2JF7A 1MW1A 3OGVA 4UZSA 4BQ4A 8CGTA 4Z2KA 4HZ8A 4HPHA 3CHFA 1WDQA 2BY2A 1ZU8A 3WNMA 2BNJA 4LQ1A 2A3BA 2EPOA 2Y24A 2D2OA 3K8KA 3PTQA 4KGLA 5C71A 4WSJA 1OGGA 3WF1A 1KB3A 4AZGA 5A8NA 1JDDA 4JKLA 4X0NA 1WZMA 1MXGA 4E4PA 4AD3A 4M56A 3VVGA 3GXIA 2QHAA 3OBAA 3WUBA 4TTGA 2JFEX 3K8LA 2BY1A 4JKMA 4XZBA 4CKQA 5A2AA 1UWSA 4C7DA 3VD9A 1J12A 2CETA 5I23A 1XYFA 1VFFA 2GUYA 3AICA 1HT6A 2ZXQA 2OWCA 3GBDA 3VM5A 1LL7A 4IUGA 3MUAA 3M6DA 3T0BA 4KRUA 3U7VA 1WE5A 1FFQA 3D3AA 1KQZA 1W32A 3KZSA 2ZX5A 3KWXA 1QHOA 2QLYA 1BGAA 4W88A 1R7AA 1GVYA 4CN6A 3NSMA 1C90A 2GSJA 4AEEA 1UR9A 2UWFA 1V6WA 1GOMA 1UG6A 4IM4A 3ZOAA 1BVNP 1SFSA 5FOOA 4OBSA 3LPGA 4MDPA 1LF1A 1PIFA 1BYAA 3W82A 1BG9A 4AIUA 4UTFA 2EO7A 1KXQA 1W1PA 2A3CA 4B16A 1VEPA 3VTRA 1JD7A 3B9DA 1M03A 2D3LA 3A3HA 3VNZA 3W6LA 3APGA 1ZB5A 2WVTA 1XC6A 1W3JA 3AIBA 2XWDA 3S6TA 1JYWA 1ITXA 1JXKA 3OGRA 5A6AA 3CPUA 5BXPA 3VUPA 1H1NA 1JYVA 1HNYA 1EO5A 1TVPA 3BLPX 2XM2A 4A3HA 4GZJA 1H2JA 1AQHA 4J3XA 4AZCA 3SCWA 2ZX6A 1GOIA 3ARSA 2E9MA 4BS0A 2XUCA 1HN1A 3HJEA 5AY7A 1J0JA 2WMGA 1OT1A 1FHDA 3A4WA 4XZWA 4PRWA 3AMDA 3SCTA 3RJXA 2EQDA 3VM7A 2GDUA 2D1ZA 1PX8A 1EQPA 1VAHA 3L2LA 3WSUA 5DMYA 1VRXA 2W61A 4PN2A 2YL5A 3BCDA 3W0KA 3PZVA 1NP2A 1LLOA 3NDYA 3M46A 4P8XA 1EO7A 1GJWA 4HZ6A 1D2KA 2XJ7A 4ACYA 2YIHA 2VO5A 5DT5A 1G1YA 1CEOA 3AXXA 3ZJ6A 2VJXA 3ARYA 3LPPA 1R7OA 3ARTA 4M80A 4CD8A 5LA1A 1DTUA 2VZUA 3ZT6A 1TUXA 2ZXBA 1VFMA 4E8DA 1US3A 4TVDA 2DGAA 1EGZA 6TAAA 1I75A 3CMJA 5A8QA 3WDHA 3WDPP 4UFJA 1U2YA 3UESA 3TOPA 1WZAA 1E40A 2PC8A 3ZM8A 3VDHA 3ZT5A 2GK1B 3BAYA 4LYPA 4YN5A 3L4YA 3GNOA 3TP4A 5I77A 5A2BA 1EH9A 1V6XA 3IJ9A 4K68A 2Y8VA 3ZQ9A 3I3EA 1UWQA 3SCOA 3EBVA 4LYRA 2W4XA 5D9OA 4P7RA 4FLQA 1UQYA 1ITCA 5A8PA 3PZNA 4CGTA 1FH8A 1DWFM 4DUWA 1TZ7A 2CHOA 5EMYA 3WH7A 4HA3A 4PYSA 3D5HA 2F8QA 4MDOA 2VRJA 3WEZA 2PBOA 3T0AA 3VIHA 2EBNA 2BHYA 5BXTA 3CZ8A 3RM9A 1GPFA 4U2YA 2CBUA 4GKLA 1OIFA 1W9UA 2W67A 2RGMA 1V3JA 2CNCA 3WFLA 2J78A 3CZLA 3O6AA 1BG4A 3W29A 1V0MA 1J11A 3LPOA 3PZTA 4JL2A 1C7SA 1VJSA 1WZLA 2J79A 3ARVA 4QAWA 2PBGA 1W9DM 1VIWA 3AS3A 1QNPA 1J0ZA 1UD2A 1W9PA 3WNLA 2ZX7A 2DH2A 4AZHA 2VZVA 2WMJA 4NZCA 3SCUA 1UWRA 2BY0A 4CN4A 1W1VA 1FA2A 3FW6A 3VIIA 1DP0A 2HVMA 1QHPA 2XVGA 2GK1A 1J0YA 1XCXA 1V08A 2WWDA 4UOQA 3PTMA 1EDTA 1ISXA 3CMGA 1HL9A 1UWIA 4JFWA 3MANA 3VNYA 4DWSC 4Z2GA 2DQXA 3OA5A 3W4RA 4KMQA 1SYTA 1J0HA 1ZBKA 3CHEA 1GVIA 3AS0A 1XD1A 3L4VA 1E6XM 4M1RA 3WMSA 3CZJA 1C8XA 3HMCA 1TCMA 3VMPA 4D6FA 4PEEA 2WC3A 4MB5A 2J47A 3WNKA 2ZX9A 3WF2A 4R27A 4MAVA 3WEOA 1GQLA 5D8WA 1OD0A 1UKQA 2YL6A 3IAQA 2YLLA 3AYSA 4PMNA 1Q6GA 4D1JA 5CGTA 1HKMA 1YHTA 3BC9A 2AOSA 2EPNA 2WM0A 5CSYA 5I5RA 4H04A 1JDAA 3TTSA 2YA1A 2C8NA 1O7AA 3T08A 1AMYA 2XVPA 4GI8A 2WXDM 3EDEA 2GJXB 3MMDA 2O9OA 2WVVB 4CCEA 2DT3A 1CGXA 1SMAA 1NH6A 4DUXA 2V3EA 3ZR6A 1A47A 2YDRA 2CPUA 1OGBA 1C91A 5FIPA 3IJ8A 4PTMA 1V3MA 2VRQA 1UKTA 2WSPA 3PZIA 3MKKA 2XSAA 2DT2A 1B3YA 3ZO9A 1BYDA 3DECA 4UR9A 2YDSA 1EDQA 3AJ7A 5CLWA 7CGTA 1VF8A 3NCOA 1TFVA 1HXJA 2E4TA 5M3WA 3WDQA 5I6SA 3EMZA 1BFNA 1JDCA 4IPNB 4E8CA 3N04A 3ZSTA 3ARWA 2UY5A 1H49A 4V2XA 2O9PA 4TVUA 3M7SA 2JEQA 1JYNA 1QNOA 3AIRA 2ZUNA 3WQ4A 2PWEA 4N0RA 2YL9A 1G9HA 1UWUA 5HDRA 3AIUA 1VJZA 3W24A 5IFPA 1GOWA 1KWKA 1CNVA 3WQ5A 4F9DA 1NARA 5I78A 2Q8XA 4JFUA 3SUSA 2J77A 1XSIA 2V3DA 5LYRA 2WCAA 2WBKA 3WUEA 2XIBA 4MJ4A 3BH4A 1ISZA 1FP8A 1E3XA 1EDGA 3W26A 1JFXA 2WW5A 2F2HA 2ZUWA 3AXIA 3HN3A 4QLJA 4ACZB 1JZ4A 4PMOA 3AHVA 3GXFA 4UFLA 3WEMA 4B3LA 3GXMA 5CGMA 5GNZA 1JZ8A 2ZUSA 4JCLA 2D0HA 4QLKA 4M82A 3EYPA 3CTTA 2DSZA 2EPKX 2VX6A 5ABGA 2WZHA 2WYSA 2QPUA 3THCA 1TA3B 4D1IA 4DM1A 4HP5A 1JAEA 1GOKA 4AZCB 2PF0A 2VQUA 3IJ7A 1M04A 1RD6A 4LPCA 4LGXA 1RP9A 1PBGA 3AZSA 2YBTA 1MQPA 4X0VA 5BRPA 4C7FA 2WHKA 2OYMA 1UH4A 2DT0A 3EDFA 3WMBA 2DIEA 3O2LA 1CGYA 3WMCA 1UH2A 4W93A 3EDKA 3O9NA 1UR0A 3AI0A 5JBEA 3WUGA 3UR8A 1BYCA 3BAKA 2WBGA 1FOBA 3K1DA 1KGXA 3MSDA 4UZUA 3UG5A 1CZ1A 3VDBA 1JG9A 4U2ZA 1XH1A 2D22A 3WDRA 1E6QM 1C8QA 2X0HA 2EPMX 2B31A 4P7NA 2G8ZA 1PAMA 4F9JA 1JXJA 4MPKA 2WMIA 5D4YA 1GCYA 4PSRA 1UD8A 1RP8A 2WWCA 1R85A 5AYBA 5M03A 2PI6A 4CU8A 1E3ZA 3ZT7A 5A6LA 3WQ8A 4CVWA 1SMDA 1JZ5A 3POHA 3ARXA 4P7LA 3BCFA 2Z1SA 1KR0A 3VOCA 4HMEA 1M01A 3I3DA 2GJRA 4WKAA 5DF0A 2VI0A 3BSHA 1NOWA 3VDAA 4QCEA 2XGBA 4RE2A 1CIUA 4GIAA 4LX4A 1FFRA 3W27A 4DUVA 1XV8A 4PMQA 2OYLA 1EOMA 1W91A 4DM2A 1KFWA 1DWGM 1OT2A 4WIWA 4D6HA 2XHYA 2WZEA 1UZ1A 4HOZA 1OINA 4JCMA 3UEQA 4V28A 3SIMA 4EANA 1G5AA 1W1YA 1UR4A 4UQEA 5E9AA 4JL1A 1QVBA 1X6NA 2PWHA 2WMFA 1ESWA 3VMNA 1R86A 3FY1A 3N11A 4AZBA 1GZJA 4AD2A 3GH7A 2X8RA 3MUIA 4UQCA 5I79A 4MTVA 4OUEA 2BHUA 1PJ9A 1HJUA 3AHZA 4J27A 1CENA 1MQQA 3WDJA 1RPKA 6CGTA 1XCWA 2EPLX 3N1AA 4MJ2A 2W62A 1MW2A 4H8HA 1CLVA 4W5UA 4CD4A 4U5KA 4UFKA 1MFVA 1HJSA 4JFVA 1K9EA 3RMEA 5JUVA 4FLSA 1JF6A 5DFAA 4FLRA 4CVUA 4QDMA 3SCQA 3WH5A 1BLIA 1WNOA 3TTOA 2VZTA 5IDIA 4E2OA 5I24A 3VD4A 1B2YA 3A6OA 1GONA 2DPEA 4RE3A 1UYQA 3U5YA 2E9LA 3L4XA 3TTQA 3FNDA 1OBAA 2VCBA 1E70M 3PN8A 3QGVA 4CD5A 1B1YA 5E70A 4WF7A 2A3HA 1UHVA 1G0CA 1X6LA 3VINA 1E1EA 2XYLA 3IK2A 4PUDA 3NYDA 4AW7A 4YHGA 2GVYA 5CLTA 1JIBA 4UFMA 3ECQA 1U30A 2VZOA 5M17A 4W7WA 1MYRA 2CKSA 2DH3A 5BROA 4AZ6A 4GZEA 1HIZA 5A8OA 5A6KA 4TOQA 1PX4A 2FGLA 2DSWA 2XFFA 3MV01 2G4FA 2X09A 1ISVA 4PMDA 2WLZA 4AISA 1CECA 1OD8A 3AIVA 4NRSA 2FHFA 1DHKA 3ZSSA 3PZQA 3BXWA 3VPLA 3W25A 4FLOA 1E0WA 1CGUA 1NOFA 3GBEA 1WDPA 5A2CA 3DYPA 4AZ7A 2VUYA 3VD3A 3MMUA 3BMVA 1HVQA 1E6RA 1UR1A 3SCRA 2JEPA 2X05A 2XFRA 3AS1A 1UA3A 3IAPA 2JALA 5CXPA 1X1NA 5GNYA 3RJYA 3AXHA 4ZE4A 2W66A 3A4XA 3BSGA 3L4ZA 2WVSA 1CXIA 1YQ2A 1ODZA 1V03A 3WDIA 1CLXA 2WKGA 4JHZA 4RL3A 1XH0A 3T09A 4PCSA 3CUGA 1IT0A 3CZGA 4CD7A 3DHPA 1QI5A 2VURA 3VIJA 3KE0A 3ARZA 1HF6A 3RILA 5A94A 4CCDA 1C92A 2WB5A 1HKKA 3VIPA 2ZUTA 5BCAA 2DIJA 3CUIA 5HOSA 2X2YA 3W37A 2C7FA 4GQQA 1E6ZA 4M24A 4J3VA 1B9ZA 3UG3A 1KWGA 1UOKA 2E9BA 1W3KA 1DWHM 4MNMA 3PZMA 4WSKA 4B9ZA 3J7HA 2WHLA 3TTYA 4M29A 4PMRA 3WF3A 3B9EA 5DT7A 4CCCA 2V5DA 3WBAA 3N9KA 2QV4A 4AD1A 1ISYA 5ABHA 4D6JA 5BRQA 5GNXA 1J0IA 2J74A 1HVXA 4OJYA 4ATWA 4M81A 2MANA 1H09A 1B3VA 2CBVA 1W9VA 3K8MA 5E0FA 1BF2A 4MNJA 1LG2A 3WELA 5C70A 2ZOXA 1MVYA 2RGLA 2GJXA 3CUFA 2J7EA 2QMKA 2J75A 1XSKA 4EAMA 1CGWA 4UQAA 5E09A 1KXTA 1WDRA 4Z2IA 3KEHA 1CPUA 2BY3A 3N18A 5FL0A 1K9DA 2ZXDA 2BFGA 1UZ4A 2IXUA 3RM8A 4AC1X 4P7QA 3HU7A 4QFUA 1E6PA 4H8VA 3FHQA 1R87A 2QPSA 3AYRA 5E6ZA 3VILA 5DEZA 2NT0A 2OSXA 2D23A 1KBKA 1ISWA 2JIWA 4ZEPA 2FH6A 4MB4A 2DDXA 4LYQA 3OLIA 1L8NA 2YDQA 1JI2A 3KL0A 1TR1A 5M5DA 4UFIA 3CBWA 3POCA 5GPRA 3RM4A 4J7RA 5EBAA 3VMOA 3WL0A 1R8LA 3F4VA 3UETA 2W91A 3VIMA 3EDDA 1NWSA 1VENA 2D20A 5I0DA 5FD0A 3WH9A 4W8AA 4ATDA 2TAAA 1LJYA 1J18A 3AIWA 2J62A 4UCFA 2WANA 1KR1A 3MS8A 5AC4A 3TONA 2CBJA 1NP0A 4PTWA 3WF4A 2BV9A 1VFUA 1HJWA 4BQ2A 5ABEA 3F5LA 4AXNA 2E3ZA 2BXZA 4U33A 1A3HA 1E6NA 2WHJA 4OOZA 1W2PA 4PUEA 1FP9A 4JHOA 4GINA 4A4AA 2Y4SA 1AVAA 4AZ5A 1PZ2A 3UG4A 2DEPA 1PZ3A 1C8YA 3SUUA 1MW0A 9CGTA 3ARRA 3WNPA 3WD0A 1VEOA 4UQBA 3AZTA 4EKJA 5JIWA 5FL1A 2WZIA 3KL3A 1CWYA 4AWEA 1ZBVA 1W3LA 3WIJA 1C93A 1H3GA 5HBFA 1KGUA 1OCQA 4NF7A 3FXYA 4L4PA 4Y7EA 3BAIA 4Q7NA 1WDSA 3MV11 3NJ3A 2V3FA 5D9NA 1CXEA 5AC5A 1VB9A 1E4MM 2YBUA 4W89A 1LG1A 3WUFA 2YA0A 4OKDA 3MUZ1 3OLGA 3T2PA 5D9PA 2PWFA 1E0VA 4J3UA 1US2A 3OLEA 1LWJA 3BMWA 1CTNA 2WMIB 4W84A 3AHYA 4PMVA 3I3BA 2DT1A 3CGTA 3NSNA 2E8YA 2VC9A 5A1AA 3OGSA 4CU6A 1E72M 1Y7VA 1BHGA 1QW8A 4Z2HA 3GNRA 1QNSA 4U3CA 1VBUA 4HOWA 1FHLA 2JF6A 4TX8A 3CLWA 1K9FA 3W6MA 4MNKA 2WVUA 4DWSA 5A3HA 4OBRA 3AZRA 1MQRA 2D0FA 4UFHA 1EHNA 2W63A 1V02E 1H41A 1AQMA 2CKRA 2VCAA 1QBAA 2XSBA 3RDKA 1JZ6A 1GHRA 1JF5A 1BVZA 3NSXA 2CESA 4BQ3A 3WD1A 3GNPA 3OZOA 4P8UA 3G6MA 3AROA 3ARUA 1WP6A 5ABFB 1WAWA 3E1F1 3WQVA 1JI1A 1HL8A 1PX3A 2OWXA 3WFZA 2PB1A 4AYSA 3AMLA 1Q4NX 2CYGA 3GM8A 4HPGA 2A3EA 2ZICA 1DWIM 4XX6A 5BWFA 1HKIA 2G3JA 3VX1A 1GOOA 4S3JA 5CPSA 3B8SA 5EFFA 1W2VA 3WNOA 7TAAA 4ML4A 1QPKA 1E0XA 3CHCA 3NDZA 5A6SA 1UWTA 3WH8A 4W86A 4CU7A 1XSJA 3K46A 3SCPA 3PZGA 1UKSA 4JFTA 3JUGA 4A3YA 4ZE5A 5CQ1A 1PIGA 1BGGA 2E8ZA 2A3AA 1CGVA 3WBEA 2J25A 1CXLA 4HTYA 1ZJAA 5A95A 3CH9A 1QW9A 3BAXA 2VCCA 3EMQA 1WCGA 1SR0A 3VGHA 1NQ6A 2BS9A 3FN9A 3ALFA 2J8GA 4D6EA 2W5FA 4D72A 3AIEA 4H8UA 4JFSA 2G3NA 2WLYA 3FAWA 2ZXAA 3SUWA 4UOZA 3S2CA 4W8LA 1JZ7A 3SUVA 4DWSD 2Y8KA 3AMGA 3VIOA 4P8WA 4PMXA 4EE9A 4BQ5A 2BHZA 2J7DA 4BA0A 2J7FA 2WAGA 4JAWA 3T2QA 3QHNA 2F61A 2J8FA 1V0KA 4AY1A 5C8BB 2YA2A 3WQ6A 2WPGA 1MWOA 1KGWA 1E55A 1JD9A 3KL5A 2BVYA 2CITA 1K6AA 2XVNA 3VDCA 1JNDA 2XWEA 4PSPA 4ZXOA 3AS2A 4Z2LA 3TA9A 5LA0A 1LWHA 3VGEA 1IZJA 4WLCA 4D71A 4W7VA 1HJXA 5CG0A 1L0PA 3PZUA 2XIIA 2GJPA 2ZWYA 2WSKA 4WJXA 5KZ6A 4J3WA 2XFYA 1HP5A 1V6UA 2YL8A 3W81A 4M8UA 2E40A 4HMCA 4UNIA 1K9TA 1F4HA 2Y5EA 1VBRA 4S3KA 2OYKA 4D6DA 2D0GA 4BZYA 2ZUUA 2BVTA 1D7FA 3AMCA 3ZMRA 1OM0A 3PZOA 1TG7A 1E73M 2IUZA 1EQCA 3CUHA 1QBBA 1GNXA 4GPNA 5DO8A 3OB8A 2VVNA 2G3IA 1Q6CA 3BAWA 5JIPA 4U31A 2Z1KA 3EMCA 2FH8A 3MMWA 4V27A 1G01A 4XB3A 4FK9A 2HISA 4AIOA 1MFUA 1IV8A 1EOKA 5CPTA 1QNQA 3II1A 2D24A 3GH4A 1ODUA 5LA2A 4KRTA 3OLDA
chains in the Genus database with same CATH superfamily
3HO8A 2KX9A 2ZCGA 4JDBA 4HCHA 3H53A 3BOLA 3MSGA 3KUMA 4RNHA 1T0OA 1MNSA 1C7TA 4WKHA 3S5NA 3RU6A 1GQIA 3WQWA 3LXCA 2ISFA 4WD0A 3UPBA 3G5EA 3A22A 1SSGA 2DORA 3UJ2A 1UD3A 1WXYA 2Y5JA 3OOQA 3TW7A 2OXNA 4L65A 4OOUA 1H7XA 1NM9A 4IIBA 2ZIDA 1E9YB 1Z3NA 4H2CA 5KITA 2FDSA 4L1XA 4XD4A 1GVQA 1CXHA 1PCWA 1YEYA 3G1SA 1JCTA 1HTIA 3NGFA 3BW3A 1EP1A 1KBBA 1XH2A 4OIFA 3WYZA 1R0MA 4TR9A 2EAWA 3VD5A 1P0BA 3MMTA 1QUMA 1SFLA 4LY4A 3STGA 2Y63A 4OZOA 3NQ7A 2HSAA 1ONRA 2YOCA 1F4AA 3B9AA 4RZ4A 4ZOEA 3FAXA 3M4HA 1GVFA 5ENLA 2UY4A 4REQB 2V38A 3FYYA 4ERAA 4XVDA 3QPEA 2ZVRA 3SCSA 3B4YA 3PB2A 3U2CA 2FZBA 3TJXA 1KXHA 4AHQA 2Z25A 4K8EA 3RIKA 2XN2A 2HK1A 4Y8EA 4HU4A 3OZMA 1Q6FA 3IIPA 3PVFA 4LU0A 1EX1A 5B7ZA 2AGTA 1V0NA 1XHGA 3AISA 5D9MA 1TWZA 2XVLA 4N4PA 4MAZA 3ELFA 3W38A 4N02A 3AOFA 1F74A 4JQAA 2FZ8A 1NWRA 4ZENA 3GU2A 3FJ6A 3DOPA 4B91A 4I9JA 2FMNA 4GOAA 1PKMA 3NVDA 4LB4A 4FI4A 4PEKA 3G2GA 1ZBCA 1Q7QA 4XBKA 2QCGA 3JZEA 4HA4A 1Q6DA 5AHMA 1UD4A 3NO5A 3SUTA 3G1DA 1RZMA 1TB3A 1HFBA 1C9WA 3PWGA 4FNTA 3VABA 3K5XA 5CZTA 4DWSB 1DJHA 1VFOA 3P82A 3F5JA 1X97A 2VT0A 1YYAA 4DI9A 4R7OA 3RCNA 3E0FA 1FWTA 2W9MA 2ZTKA 4LUJA 4RE4A 5JH2A 2BP1A 3WBXA 4QROA 1QI2A 5BYWA 3GG8A 1V3HA 1XLBA 2PGFA 3R10A 2PDHA 4Y9PA 4BJHA 4HIBA 1GOQA 3E5PA 1K03A 1EYEA 3M0LA 2QCMA 4P7OA 3N34A 2R1NA 1PEZA 1M5WA 1FWDC 1XDMA 2YFOA 5DCBA 3L2MA 1FDYA 2Q8LA 3BQ6A 4JBRA 3EWYA 4CD6A 3K4AA 4UTLA 1PTGA 3VNKA 4AIBA 1E5JA 4GYPA 3CUXA 1ECEA 4ZO8A 1VEMA 1L6SA 2PLMA 3FGCA 1HP4A 2NSXA 3G6LA 4UTJA 2YZ5A 4FF5A 5ABTA 4FXSA 3KDOA 2CCRA 5H8MA 3QHOA 2NVCA 3N15A 2HNHA 3PPFA 3FX4A 1E5NA 4NI3A 3AXMA 3DC8A 1GKRA 2X1UA 2VEFA 2TPSA 3W2NA 2C1GA 4AMCA 4JTEA 5E6YA 4F48A 4DNHA 3P93A 4W85A 3TAOA 2D3NA 2ATSA 3AYVA 3RO8A 1JCYA 1NOUA 3LGGA 1JGMA 3U8GA 2O9RA 3PC0A 4J3SA 5I3FA 3Q37A 1V3KA 5LIWX 4JX4A 2VTFA 4AD0A 4DXKA 2G3MA 4EX4A 2WPBA 3MCNA 1XLFA 3UWWA 4AH7A 4U5IA 3QR3A 1W1TA 2CBIA 1XRVA 4IZGA 2WKLA 5JBDA 1DEDA 3BLOA 2XN0A 5DCEA 5DRIA 3M0KA 1TJ2A 3R12A 1MZHA 2FGZA 4ZQMA 2P8CA 4GVHA 1M53A 1Z32X 1W0MA 1UH3A 3QMSA 3RR1A 3EX6A 5CZ0A 2B7PA 1B4EA 4XUGA 3F03K 1CX9A 3DC0A 1DWAM 4FXJA 4Q8MA 1FWAC 3CZKA 3RUBL 1AQFA 4F0RA 1H0IA 1WO2A 3ATYA 1Q65A 3MA8A 1BQCA 2HRWA 4ACZA 4KESA 3WL1A 1U22A 4M6PA 1V93A 1WAUA 4GO8A 3VX0A 1LL4A 2CERA 4MGGA 1ZY9A 4KGJA 1ZALA 1UIPA 1J79A 1GQJA 3IGSA 4H41A 5AYXA 4IQLA 1W9BM 4L9YA 3RITA 4D6IA 4PCTA 4BY3A 1L6FA 1Q7ZA 5EFDA 3HG4A 1MXDA 2ZZ6A 4DY1A 4XSMA 3SAZA 2J9XA 1DXFA 3D6NA 1B3WA 4JS3A 3DBNA 1A5CA 1KCLA 1F3EA 3MI6A 3W7LA 2NUYA 2VX5A 2OQLA 3LN3A 1XPYA 1OGSA 5FCZA 1QPOA 1UQZA 4MLJA 1B90A 3NFUA 3PJXA 1ZTVA 3GG7A 1OF6A 1J01A 3G22A 4JIHA 3BLDA 1XIDA 2ZTJA 2HROA 2B81A 4W87A 4GXPA 1E9ZB 3CO4A 4R53A 3ARQA 3PF3A 5I3DA 2OSYA 1BSIA 4ALDA 2WHMA 2DSVA 1QNVA 4BFAA 4PBEA 3U9IA 3W7GA 1H62A 4OGZA 3KRSA 5EB8A 4I7UA 2PWGA 3LRKA 2O9TA 2WVVA 4B9YA 4RNFA 3EKZA 1K77A 1DJGA 1ZJIA 3W76A 3LRMA 1B3XA 1O6IA 2G0WA 1AA1B 3BVJA 3SDOA 1B0IA 3QR1A 3FYOA 3LHVA 3R8HA 3GZAA 4IL0A 3AXKA 1R3YA 3HV8A 3N13A 1WPCA 1JZ3A 4KWOA 3FS2A 1BTCA 1Q6OA 3B03A 2ZUMA 4DAIA 1RH9A 2I17A 4GQGA 3MUY1 1EBHA 2J66A 2JF7A 2VXNA 1EA0A 1O5QA 1MW1A 1NF7A 3OGVA 4ROPA 4YS1A 8CGTA 1D8CA 1P5BA 2QJMA 3EEZA 2VOMA 3E5BA 3M5VA 1EUAA 2EPOA 3PTQA 3V1PA 1KB3A 3SQMA 2Z7GA 3LD5A 4WQ6A 1R38A 1LCOA 3LB0A 2O7SA 1DV7A 4AD3A 1Q2RA 1F9CA 2XH2A 4I8DA 3GC5A 3GXIA 4FSAA 4CNUA 2BY1A 1UWSA 1J12A 3AICA 2NV9A 2ZXQA 3GBDA 4FNRA 3VM5A 4CLMA 2WJEA 1AW5A 3M6DA 1P0NA 4KRUA 4IFRA 3D3AA 1XIJA 2ZX5A 1RBOB 1BGAA 2P50A 3BW4A 4CN6A 1YBQA 4AEEA 2UWFA 4NZFA 3VZXA 3ZS4A 4YMZA 1UG6A 3ZOAA 1BVNP 1I45A 5FOOA 2Q71A 4B5VA 3LCFA 4GMEA 4GJJA 1OJXA 1SZEA 1KXQA 4HTBA 1W1PA 1TWWA 2DUAA 1K4HA 4B16A 3LM7A 3GW0A 1QW7A 1M03A 3DG7A 3W6LA 4QISA 4N6EA 4XD6A 3APGA 1XC6A 5K4ZA 5EA9A 1TKKA 4CEXC 5K9CA 2XM2A 1TVLA 1H2JA 4J3XA 4NU7A 3TFXA 4AZCA 4LBUA 3SCWA 2ZX6A 1GOIA 3H7VA 1HGWA 5EMMA 4IFOA 2PLCA 3M43A 3AUOA 2Q09A 2GWNA 4C1NB 3GXPA 3U2ZA 3GUGA 3IUHA 1R3RA 3AMDA 3SCTA 3RJXA 4GFSA 3NZGA 4MVAA 3NM1A 1FWIC 1VAHA 3L2LA 5FAJA 2W61A 3Q65A 2PWVA 3O06A 3G1HA 3WLOA 1NP2A 4XG1A 3NDYA 3M46A 4GBDA 1EO7A 1GJWA 4HZ6A 1D2KA 2IPGA 3W9ZA 3UWUA 1CEOA 2BLEA 1R7OA 5TIMA 4LCSA 5DXYA 1F3TA 2VZUA 3SGZA 2ZXBA 4IP4A 1EGZA 6TAAA 1I75A 5A8QA 3WDHA 3WDPP 3TOPA 3H8AA 3EA2A 3BWWA 3R5EA 3RFAA 1SU5A 4DZAA 3BAYA 4L56A 3KBNA 1EEXA 2QCCA 4HMNA 1EJRC 1TX0A 3ZXWA 4EPEC 4LAKA 3BUVA 1X6UA 1NELA 2JGYA 2HDJA 1GEHA 3EBVA 4NX0A 3IJDA 4P7RA 1VCFA 4OTKA 3A5FA 1UQYA 3CQIA 1FH8A 2CHOA 1XX1A 4KWVA 4HA3A 5BWAA 4MDOA 2P3ZA 2E6FA 3WEZA 4K2SA 5BW6A 2FJUB 3CV6A 3S5YA 3VIHA 2EBNA 2BHYA 4ONVA 3CZ8A 3NWRA 3W7IA 2BGQA 3ANUA 3TYEA 4CEUC 4KRZA 1OIFA 3M1ZA 4F3HA 1AJZA 2CNCA 3R8RA 3TQVA 5G2IA 4ERIA 2Y7FA 3LPOA 1VJSA 1I4NA 4HU3A 3W70A 3OU8A 4QAWA 2PBGA 3JS3A 3AS3A 1QNPA 4DBEA 4IP5A 4ORMA 1UD2A 4L6DA 4MHBA 2VGIA 3OYXA 4MZ1A 3TJIA 1UWRA 3GNNA 1Y0EA 3ZVHB 1FA2A 1DP0A 2XVGA 4DF0A 2WWDA 1V51A 1NAL1 4OV9A 3UZXA 1A3XA 2Z28A 1GZ1A 3CMGA 3WBWA 1OVDA 3T7VA 1KV8A 1W6TA 1KRBC 3IACA 2ZQ0A 2UBPC 3STFA 1SYTA 4O1CA 1ZBKA 1ZNNA 2C1IA 1E6XM 2A7PA 4KCVA 1WBHA 3CZJA 1C8XA 3HMCA 3W2UA 4HNCA 2ZDRA 1TWSA 3AU6A 2IQ0A 2J47A 1S1RA 1OK6A 2VDIA 1H7NA 2YL6A 4KEVA 4PMNA 1DE5A 5CGTA 1HKMA 3NDOA 1YHTA 2G4JA 2AOSA 2WM0A 5AVHA 5FJUA 5EKYA 3QC0A 1MO0A 1N8FA 1W3NA 1DBTA 3I7SA 4ZQOA 1ZFJA 3W1TA 1KTCA 3UBPC 2O9OA 3U6WA 3VC6A 2PFHA 2DT3A 1FDZA 1S2TA 4DUXA 3IWPA 2C18A 3GUWA 2F7FA 3NZPA 1A47A 2YDRA 1Y65A 2CPUA 2NXHA 4PTMA 1JRCA 1GJPA 4Y9OA 3MVIA 1V5XA 1M41A 2YDSA 5CLWA 1OX5A 4X63A 1VYRA 3RR4A 4PULA 4Q7BA 5AHLA 3EMZA 2BGNE 1EPXA 3FSTA 2NUWA 3TOYA 3ITCA 1BXNA 4JTDA 3M0HA 3ARWA 4Z17A 4AF0A 3UXLA 1JYNA 3L23A 5HDRA 4S3CA 4H6QA 4FEZA 2A21A 3B04A 3GC4A 1YBQB 4V15A 3V5FA 2OR2A 4MJ4A 4L6OA 2PD5A 1Q8AA 3KOYA 1EDGA 3R11A 4ACZB 1OEPA 2F2HA 2WW5A 3HN3A 3CT2A 4Z1YA 4PMOA 2R6OA 4UFLA 2CLMA 3PPCA 1AH0A 1VZWA 2PE4A 1XQKA 4JCLA 2EHHA 2HEJA 4E6MA 1XF0A 5DXXA 4RNIA 4O1FA 3MP3A 1VJIA 2VX6A 2WYSA 2QPUA 1O60A 4C6JA 4DM1A 3BSMA 3FDGA 4AZCB 4B2DA 4LPCA 4OHQA 4F40A 1R46A 3LSCA 5CSSA 4GY1A 1SQ7A 3WLLA 3DFOA 3AUJA 1DE6A 5EPDA 2OYMA 3WMBA 2DIEA 2RFGA 1CGYA 4GHRA 4M19A 3NQVA 1UR0A 5JBEA 3WUGA 3TMLA 2QVHA 3UY7A 1FOBA 1EGMA 3K1DA 4UZUA 1OF8A 4QEEA 3VDBA 4FZIA 2XSXA 2D22A 3WDRA 1E6QM 3TH6A 3UT0A 1PAMA 1QOQA 1RALA 4O15A 4F9JA 1JXJA 4O13A 1F73A 3GLCA 5AYBA 2PI6A 4OFCA 2QAPA 3L2IA 3ZT7A 4TU1A 1JRBA 1SMDA 4MPQA 4Y9AA 3F2CA 4UXDA 1KR0A 3S2NA 3VOCA 1M01A 3S9ZA 1ZP4A 4J4KA 5DF0A 4AWTA 3QYSA 4PUMA 1NOWA 3DBPA 1BXCA 3VDAA 2XGBA 3WLIA 1J93A 2VDHA 2CWNA 3LYEA 3W27A 2OEKA 5I03A 3CMFA 3VNJA 1DWGM 1KFWA 4JCMA 4BHYA 4FF7A 4G2DA 4AY7A 3SIMA 4LVFA 1UR4A 2W0UA 3T55A 4JNZA 4IPPA 2PWHA 2WMFA 5MF5A 3SY1A 3VMNA 2CZFA 5TBOA 1T40A 1GZJA 2OOGA 3UJEA 4F0MA 4MTVA 4NJHA 2REQB 3PY2A 4ZCWA 3TX9A 3L65A 4EWND 4QIUA 5BOFA 1XCWA 4EF8A 3E02A 2X40A 4MJ2A 1F76A 1MW2A 4H8HA 1QPQA 4GCXA 3WCZA 4W5UA 4U5KA 2V5LA 5JUVA 1K9EA 1UMLA 4DPPA 4LWWA 3R7MA 3AWOA 5DFAA 5HMEA 4FO4A 4QDMA 3TTOA 5IDIA 1X98A 4MUPA 3VD4A 3A6OA 1UCWA 3S4TA 3U5YA 2DW7A 3B06A 4LUYA 1LOQA 4ZQRA 2PDCA 1UP3A 3I4KA 1XRSA 2VCBA 3PN8A 4WF7A 5HUOA 1G0CA 3VINA 1KKRA 4PUDA 3LMZA 4UFMA 1M68A 4UNKA 2CKSA 3PWIA 1G67A 3LNPA 1XLIA 1HIZA 4HA0A 4TOQA 3C3UA 2ABBA 2J8TA 1EKOA 3WBYA 2G4FA 4G8TA 2OO0A 3MYOA 4E5TA 4YTSA 2CZVA 4AISA 5XINA 3AIVA 4NRSA 4JICA 3IRDA 1QAPA 4OVXA 3PZQA 2IS7A 1N8IA 1PZ0A 3ONCA 4HB7A 4KETA 3ZLHA 4QRNA 3NPWA 3VD3A 2GVGA 2Y89A 1B4KA 2X05A 1UOZA 2WQDA 3N19B 4B5UA 2RHGA 2IKJA 2JALA 5CXPA 1X1NA 3RJYA 3AXHA 3KZPA 4Q8PA 1FDJA 1YQ2A 3UQNA 4H7CA 4RL3A 3T09A 4PCSA 4L4MA 4GG9A 3VNLA 5AC7A 3CZGA 2OELA 2XN1A 2VURA 3ARZA 1HF6A 4B5WA 2QYGA 1FWNA 3M6YA 5HOSA 3QV7A 1K02A 4MM1A 1R47A 1LORA 1B9ZA 4US5D 4ICMA 3LY0A 2E9BA 1ITQA 3DI1A 3S47A 1X7IA 4YVVA 2ZYFA 2EKGA 4M29A 3B9EA 4M6QA 3BJTA 4QJ1A 5ABHA 4D6JA 4R7JA 4H8NA 3GNDA 3NQGA 4JTUA 1BWKA 4LVBA 2KZHA 3GKFA 2DQWA 4M81A 4HHLA 1R3WA 4O28A 2MANA 3LDVA 2BTMA 5LIXX 3LCGA 3C61A 1SFTA 1NF0A 3KOXA 5E0FA 3WELA 5C70A 3R8GA 2J7EA 2QMKA 1DXEA 2C91A 1CGWA 1XIBA 2HE5A 1KXTA 1ELSA 1ITUA 3UU0A 4ZVJA 1UPPA 3N18A 5FL0A 1TTQA 4QM1A 3BDKA 4CNSA 2Y8UA 3HU7A 2YYTA 4NJKA 1Q7MA 3UXKA 5M1TA 4PTDA 4LCRA 1R87A 3WK3A 2FH6A 3T44A 2YDQA 1JI2A 2GUUA 3GB6A 1ZCOA 3W83A 5GPRA 3RM4A 3DFNA 3VMOA 3UETA 2GOKA 1PB0A 4JN6A 5I0DA 4LV9A 1F3WA 1LJYA 1KLYA 3UCCA 1XIIA 2TODA 1M7OA 3UY8A 3SQLA 1LUCB 3T6CA 1XYMA 2BV9A 3N73A 1HJWA 3HF3A 1N7KA 1QK2A 3QY7A 4AXNA 2IQDA 4DLMA 2E3ZA 2TRSA 2DJXA 1E6NA 1CCWB 1FY6A 4EXBA 3OQ8A 3L66A 1NSJA 4V1XA 3W00A 2F9RA 5D37A 4DYJA 3UXDA 1PZ2A 2QKFA 1TPUA 3SUUA 4UIOA 3IVTA 3WNPA 1IXQA 4EKJA 5FL1A 3KL3A 1UPMB 1ZBVA 3WIJA 5I3IA 1OY0A 1S2CA 1C93A 1KGUA 4NAFA 2QT3A 3TQPA 1Q6RA 4Y7EA 3W7NA 4P61A 3BAIA 3KOWA 1WDSA 3NJ3A 2PTWA 5A5WA 2HE8A 1TV4A 2YBUA 1S38A 3RHGA 2YA0A 1KM6A 2VHLA 3CL6A 4JY9A 2CWXA 4NAEA 2BG5A 3GDMA 3EWWA 4O11A 1VYPX 4Q4OA 1LBFA 4PMVA 2Z1BA 2VC9A 2REQA 1E72M 2RAGA 1LUCA 2FKPA 4Z2HA 1V4YA 2PRMA 2JF6A 3LLFA 1K9FA 4MNKA 1CB2A 3NPUA 2WVUA 4MY1A 4OBRA 3L12A 4FB7A 3HV9A 4UFHA 3U4FA 2VCAA 4HCLA 2XSBA 3RDKA 1POJA 1GHRA 5G4EA 1W5OA 3V35A 3H7RA 4HNUA 4RDVA 2CESA 2CLOA 5I3GA 1EJSC 2DZBA 4PCFA 4O1EA 1WP6A 1AH3A 4ASTA 5ABFB 1FUYA 1X38A 3BK0A 3QGKC 1W8GA 1VPYA 4GY7A 2R8WA 1SW0A 1PX3A 5G4WA 3DGRA 3WFZA 2Y7EA 4GQ0A 4XZHA 3VOHA 2ZICA 2A3EA 1BRLA 5BWFA 3KCJA 3T07A 4IGSA 3OZYA 5EFFA 2DZXA 4ML4A 1IYXA 4ADUA 3CHCA 4NXSA 2GOUA 2VC5A 3H2AA 4W86A 3KVJA 2A3LA 3DENA 4A3YA 3ORWA 5CQ1A 1BGGA 1WXZA 4UTHA 5H8UA 2X42A 2J25A 3W2MA 1VQTA 1XUUA 3SN0A 2V2CA 1OFRA 1Q6LA 4HZMA 4XZIA 3CH9A 2PGRA 3BAXA 1VBJA 3UZYA 4S3BA 3CC1A 2P0IA 5LSMA 1SR0A 4RLIA 1SO3A 3EB4A 1XLHA 3ALFA 4D6EA 3PUEA 1OX4B 2AKZA 1DTNA 2ZC1A 3AIEA 4JFSA 2QCDB 1RUSA 4MYAA 4R33A 2WLYA 2J6XA 3KRUA 2ZXAA 3SUWA 1AW2A 2IW0A 4A3RA 4H2HA 5C2CA 1JZ7A 1TPH1 3RXZA 3AMGA 3DXIA 3VIOA 5CAHA 2YCJA 2O56A 2IPJA 2FZ9A 2J7DA 1QWKA 1V7AA 2C3ZA 1O95A 2J7FA 4JAWA 2QUUA 1V0KA 1L2UA 1MWOA 3NO1A 1K8XA 3VDCA 3IUIA 4S2BA 2XWEA 2WOQA 1YX1A 1KFKA 3S46A 2GSHA 3O0FA 5EMKA 1H7OA 1VCGA 4ZZ9A 1HO1A 1QATA 1HJXA 1LT7A 1ALDA 2FFCA 4FXRA 4NASA 3CIXA 2BBFA 5IBXA 2PODA 2XIIA 2AL1A 1FKWA 2FQIA 2XFYA 2YCLB 2YL8A 2E40A 1XDJA 3CWNA 4K1WA 4QITA 1OG6A 3NTYA 4S3KA 4TIMA 2ZE3A 1EZ2A 3C2YA 2BVTA 1MRQA 2CXEA 2NQJA 3EOLA 2QF7A 1XLMA 1E1CA 4C6MA 1EQCA 5DY2A 3HTWA 2OGYA 4GPNA 4DUOA 1NTHA 3W1XA 4BF5A 4V27A 1M7JA 3MMWA 3NA8A 3Q67A 3TJ4A 2HISA 3GVWA 4Q4MA 1IT8A 3L67A 3W7HA 4AIOA 4GIRA 1DIEA 5H91A 1MFUA 1XR2A 1QNQA 3GH4A 3UD6A 2PS2A 4JZ5A 3BJSA 3QOKA 3L4UA 3ALGA 3PBYA 3SB0A 1BWVA 1RVGA 3M0IA 4QNWA 1K3UA 1FWBC 1NFBA 2Y2WA 2EKCA 4ZO6A 3B9NA 1AW1A 5CZKA 1GJUA 1ZAHA 4N42A 2JKPA 1R3TA 3RX4A 1UR3M 2PP0A 1E4IA 1QJWA 2UZ9A 5HPCA 3A13A 3TMQA 2QF8A 4HA1A 3QH2A 1W56A 4GXMA 3GTXA 5HATA 4DXXA 3BLEA 1OYCA 3ITVA 4R34A 2J9YA 3CUJA 4QG6A 1WBJA 4WDUA 3EOOA 3BV4A 5HAOA 4RV3A 3BURA 1OIMA 2C16A 4FMVA 2NQ9A 4WUIA 2XH0A 2R1LA 4I6KA 2ISSA 4PUJA 5IHRA 2PEVA 3R58A 1JFHA 1UA7A 3WY1A 1NDYA 2DU2A 3MU7A 4L9ZA 3SZ8A 3TZNA 3UVAA 1GQKA 4XO7A 3IJIA 1PTDA 1EJ7L 2E6DA 4Q3MA 4W9TA 3QSTA 3F4NA 2FZDA 3B8IA 3TK7A 1GTHA 3U5UA 3A4AA 4AXKA 3ZR5A 4GUGA 3UWEA 3NUKA 3R79A 1F2JA 1I60A 5FJJA 3W7JA 4F66A 5G1YA 5HQMA 4QR6A 5FJPA 3T0DA 3B8DA 5T9BG 1OABA 3R0UA 2FZMA 3LTYA 3KCLA 4Y9NA 5TD4A 4A6GA 4XKYB 5EBUA 3DKJA 1EA9C 3WKZA 2Y88A 1KD0A 3CV2A 4O10A 3NL3A 2ZRXA 4IISA 4DNMA 4JTFA 4B90A 1W1A1 1NWTA 2E1WA 3MI3A 5LGZA 3RK8A 3GVRA 4GC3A 1RAKA 1VBGA 5AFDA 4MNLA 2QJNA 1E1FA 5A6BA 3F1QA 2WZTA 2CHNA 1B3ZA 3AIQA 1UR8A 5JH1A 4J1OA 3ABQA 3M0MA 3LPFA 4O8AA 3HMJG 4YNGA 3HQ1A 3MO4A 4H7ZA 1OFBA 4GNJA 4MY9A 2WZMA 3AHTA 4OUIA 3WD3A 4YWSA 4MB3A 1AFSA 3A9IA 4MADA 4QE5A 5IXEA 3UERA 3DYOA 2PCQA 1V3LA 5HNTA 1CDGA 4KCTA 5D8ZA 1AJ0A 3QMRA 1EIBA 5BXRA 5MKGB 1ML1A 5GQBA 4B3KA 3WQOA 4FR6A 1DIKA 2AMGA 4S3GA 3TEVA 1BPLB 4DLFA 3MW7A 5CC7A 1O68A 2OLHA 4ZQCA 3AQUA 3W53A 3UR7A 4I5XA 4H6EA 1B30A 2V63A 2VEKA 3JZUA 1XS2A 1L8PA 4LVGA 1J5TA 1BRLB 1QI3A 2PDNA 1CXKA 1GUVA 4GI6A 4S3EA 1TMQA 1ONEA 2DZWA 3S1UA 4LEFA 4NJGA 1E9LA 3AHXA 4LNCA 1EJTC 1FH9A 3IANA 4MY8A 4QJ4B 2E28A 4AD5A 3RLHA 3RCYA 3A5VA 4LS1A 2ZZ2A 5AYIA 4GYPC 3BQ5A 4HMDA 3FYPA 3G1YA 4HZ7A 1ZSXA 3ATZA 3M9YA 4BCEA 4I8YA 4GX9A 2QS8A 3N2BA 2ESCA 2RDTA 3O3RA 4KFNA 2V5JA 2VGGA 3SURA 4GUIA 3M0VA 1V3IA 5AC8A 3G0SA 4NZ4A 1WKEA 1A49A 1KFLA 2Q3OA 1XIHA 4LRSA 4KWUA 4UCGA 3F4WA 2JQXA 3EX2A 4GI9A 4BKNA 4PBFA 4X60A 3H2CA 2NUXA 3FDKA 4F0KA 4O0KA 4FA3A 4YHEA 3YPIA 1PDYA 1RQBA 1AL8A 1IEWA 2CZEA 1FWJC 1LOSA 1NDWA 1MZRA 2ZUVA 5HANA 2X1IA 4GJ1A 3VU2A 3VKCA 5FSEC 3DHUA 3DEQA 3B8UA 1PIIA 3KCOA 3MHUA 1EFZA 4G5DA 1E0UA 1RLCL 1V0LA 3C2RA 1H4PA 4PMUA 4TX9A 4L7ZA 1QHZA 2NQZA 2FDMA 3ENLA 4YPJA 1FH7A 3LI1A 3WLMA 1LZOA 3N4EA 2VR4A 3D47A 1RQHA 1IR1A 1R2TA 2QCLA 4PGLA 1M6JA 3LS9A 4E4UA 4ZXLA 2H3BA 1JJKA 5HA7A 2FJKA 1A5UA 2PWDA 1XBVA 1KTNA 3S5OA 4RDYA 1TIMA 4GYJA 3VGFA 1LRTA 1V6TA 5G5IA 3TYDA 3LSBA 1PKNA 4DJEC 3OIHA 4FOKA 1J2BA 1E71M 4D6GA 4CNTA 1ZJBA 5D30A 2H90A 2QGHA 3M44A 2QNEA 2Z00A 2GGHA 1H63A 1Z7AA 3KBWA 1ZBWA 4H7VA 2P10A 3H6OA 1ZL1A 5IBXC 4HN4A 1Z9AA 4ZQNA 1LL6A 5LZLA 3NQEA 4L4OA 4J3TA 3GW3A 1PDZA 2DZAA 3GHSA 1WDDA 5D05A 2JE8A 1XPGA 3EAUA 4G6CA 1EJWC 1XGZA 2QCDA 2O7QA 2QDEA 3PTKA 1PPIA 2BXYA 2WJFA 7XIMA 4Q8QA 1GT8A 4JEQA 1WUFA 4UTWA 3OP2A 3GYCA 4PTVA 1CT5A 2G41A 1R3SA 1A5SA 1LROA 4JIEA 3XISA 1TRDA 4GH1A 4QLLA 1K6WA 4C60A 2OO6A 5G4HC 4AD4A 1YIXA 3MI2A 4QNEA 1JCLA 4R85A 3EOEA 4JIIX 3DI0A 3WD2A 1HW6A 4O4WA 3URBA 1DWJM 3EXSA 3PAOA 3DERA 4B15A 1E4LA 1R9ZA 4FP1A 1EC8A 3H26A 1I9CB 3R89A 1EF2A 5TNVA 4HOXA 2F6XA 3VGDA 2FPYA 1WKDA 4RDZA 1LLWA 5CPMA 5AHEA 4Z0SA 3VIKA 2XVKA 3E2QA 2J7BA 1JUKA 3B0XA 3ITOA 1QASA 2WNWA 4HSHA 4Y6GA 3CPRA 1LYXA 1UUQA 5I2UA 4BK9A 1UIOA 1B31A 2FHBA 4N9DA 5FF4A 4EIVA 4H4IA 2VFIA 5I3HA 1WB0A 4I90A 1IEIA 4RCXA 4TX6A 1YTEA 3ITXA 1JL8A 1OWQA 2EG8A 1ME8A 4YU1A 2DJLA 4PBGA 2IXVA 4H1ZA 4MJMA 3VIFA 4FHAA 3U3HA 4A29A 2FTYA 1YXCA 2D2HA 1YKWA 3XIMA 2A0NA 4Z2KA 3LBCA 3TLQA 3CHFA 1ZCCA 2CW6A 2A3BA 3K8KA 4KGLA 4DX3A 3L5MA 1OGGA 2H9AA 3WF1A 3DUGA 2V82A 4AZGA 4IGHA 4GI4A 3TWBA 4DJDC 1VFLA 1TYGA 4ML9A 1MXGA 3UNTA 1TR9A 3O07A 2ASHA 2XISA 4EOUA 4M56A 5CZSA 3VFLA 1IT7A 4R9OA 3WUBA 1E1CB 3PUGA 5AZ1A 4C1NA 4XZBA 4CKQA 4C7DA 3B4UA 3VD9A 2CETA 1T41A 5AECA 4NAFB 2AL2B 2GUYA 4PH6A 3BL3A 2XIOA 4PUNA 3TNOA 4IUGA 1IR2A 3FV9A 3MUAA 1OC6A 3T0BA 1WE5A 3S2LA 2Y7GA 1QHOA 4IMDA 1C90A 3O0KA 2OZTA 4UTKA 4AU0A 3GFXA 1F8MA 5B80A 5LIYX 1GOMA 1NDZA 1SFSA 4C6NA 4H6KA 2ONEA 1PIFA 3C5QA 1BG9A 4AIUA 4UTFA 4MSSA 3EXTA 1VEPA 3BO9A 4LOCA 3A3HA 1FQ0A 1N2VA 4REQA 1MRAA 3U4AA 1UROA 3CPUA 1H1NA 1RA5A 1EO5A 3MT1A 4GZJA 3N3TA 5T91A 3PJWA 1KRMA 1VHNA 4LSBA 2X0SA 2E9MA 2PRHA 1EPVA 3PP7A 2O0TA 4Q33A 5AY7A 3HIJA 2B7QA 1FHDA 3TFCA 1K7XA 3MBDA 2OX4A 1S3TC 4PRWA 4HNLA 3TSDA 1OYAA 5F2IA 4IJRA 2GDUA 1YNPA 1BSLA 1U1HA 5C2GA 1G69A 5DMYA 5DY3A 3UZ5A 2YL5A 2Z1XA 4XTIA 3VFCA 6REQA 4JQ4A 4M51A 3GYEA 4ACYA 4ZODA 2VO5A 4IJCA 5DT5A 1G1YA 1A80A 3ZJ6A 3ARYA 3LPPA 3TDFA 1EJUC 4M80A 1UP2A 1DTUA 5AOUA 2EG7A 1Q66A 3NL5A 4XSLA 3SSJA 3N4AA 4E8DA 3MBFA 1ICPA 2PDKA 3CMJA 3TSBA 1HGYA 3VXGA 1U2YA 1MSSA 4AY8A 1ZAJA 2OCZA 2GQAA 3UESA 4GVFA 3ZVHA 3ITGA 3ZYZA 4S38A 2GYIA 4LYPA 3W2KA 4YN5A 3GNOA 1VD6A 3KHJA 4Q4PA 1RJPA 4NZJA 4ZQPA 5A2BA 3FCPA 1KBIA 1QWGA 4NZ5A 2CU0A 3GVQA 3IJ9A 4K68A 4QG8A 1IGSA 1UWQA 3B9OA 3SCOA 5F4XA 4D8AA 5LNUA 4LYRA 2W4XA 4PB3A 4FLQA 2QJIA 3PZNA 1U1UA 1JQVA 1DWFM 5F1VA 4DUWA 5EMYA 1P7TA 4PYSA 4JNYA 3CL7A 1I0DA 4WJEA 2BXVA 4WVXA 3LRLA 5BXTA 1K1DA 4JHMA 3N4FA 2NXIA 3RM9A 3LK6A 1W9UA 3HA1A 4AHOA 3MHFA 1TELA 3WLNA 1T8XA 1WYIA 1FXQA 3O6AA 1V0MA 1DL3A 1J11A 3PZTA 3EWBX 1C7SA 4LC8A 4F0LA 3TJLA 1IHIA 1W9DM 1VIWA 2OEJA 3VOGA 1J0ZA 1M3UA 4JTTA 4HK6A 3H2MA 4KIRA 4FNPA 1R3VA 3I6TA 3WNLA 1QCWA 3KAOA 2ZX7A 4O12A 1XWYA 3FJ4A 2PU1A 2VZVA 2Y85A 4FX8A 4NZCA 1RBAA 3W1QA 1W1VA 3FW6A 2GQ8A 2W27A 4Q8TA 1QHPA 1XCXA 5LIKX 3PTMA 4E2BA 1XXXA 1JUEA 1HL9A 2PDXA 3TN3A 1MEHA 3CB8A 4NUWA 5DANA 3OA5A 3W4RA 1J0HA 3O8AA 3CHEA 1GVIA 2HPIA 5FEZA 3APTA 4M1RA 3WMSA 4GK8A 5K2ZA 3PWAA 4O1BA 4PEEA 1W1IE 2WC3A 3WNKA 2NX3A 1K8ZA 5D8WA 2PMQA 4ZTYA 1YPFA 3CJPA 1UKQA 4PFHA 3IAQA 3AYSA 1GG1A 3TV8A 4MWAE 2EPNA 2DP3A 4GUHA 5CSYA 5I5RA 3TTSA 1X96A 2YA1A 4US6A 4WOZA 2C8NA 1TO3A 1FCQA 3B3DA 4JXCA 4LCQA 2GJXB 2WVVB 4CCEA 3RX3A 3W22A 4D2JA 2PGWA 1UJQA 3RRXA 1A50A 1F6YA 1X8CA 3FIGA 1ME7A 5FIPA 1PL9A 3LU2A 4XK2A 1V3MA 2WSPA 3CQHA 4FS9A 5HMFA 4I5RA 3VOJA 3PZIA 4DO7A 4QJ3B 3ZO9A 2GVLA 1BYDA 3DECA 3G1AA 1FCVA 1P6CA 2V2HA 3BMXA 4RPQA 4PB5A 2HBVA 1CLKA 4E8CA 3M64A 2D73A 3P61A 2O9PA 3KLKA 3IGXA 1O1ZA 3FJNA 2PGEA 3AIRA 2ZUNA 3Q4DA 2GGJA 3AIUA 1RLDA 1FX6A 4OBTA 3NEVA 5HNUA 1CNVA 4F9DA 2Q8XA 1XSIA 5AYZA 4A8LA 2BB0A 3IV3A 2J6VA 6TIMA 4DHGA 1H5YA 3BH4A 4PL1A 4Y8FA 1JFXA 3AXIA 1JZ4A 4UTTA 4GWEA 3GIPA 3UJSA 4EXQA 4RNJA 4UTWC 4ADTA 1SZRA 3E9AA 3OTRA 4Q4KA 4N4QA 5GNZA 1JZ8A 1TPVA 1ADDA 2D0HA 1OFQA 4M82A 1NDVA 2ATMA 3VK5A 4RPPA 3TN6A 4JX6A 1XBYA 1GK8A 3TNBA 4AB4A 4D1IA 4JD4A 4I6VA 3IIOA 4JIPA 4B5SA 2A7NA 1XUZA 1VPQA 2VQUA 1RD6A 4LGXA 4GACA 1KBLA 3S0CA 1PBGA 4DZHA 3JR2A 1BQGA 1GVOA 1MQPA 5J5DA 3TQKA 1NU5A 3EDFA 1M65A 4PUKA 3LNMA 3Q45A 4Q8NA 3EOUA 5IOBA 3UR8A 3LLDA 1FWGC 4QTGA 3MSDA 1BD0A 3UG5A 1BKSA 3NZQA 1CZ1A 1JG9A 1XH1A 4JTIA 1T5AA 1HZYA 3SRFA 1C8QA 2EPMX 2HVOA 1Z48A 4QS5A 2I56A 3BANA 4MPKA 2DFAA 4LH8A 2V5BA 4PSRA 4A22A 1SO4A 2EF9A 4B2DD 2WWCA 2ZZ3A 1O94A 2FYMA 1TPB1 1SJDA 3SJ3A 4XD3A 5A6LA 4P7LA 2DY3A 4HMEA 3O05A 3BOXA 4QJ5B 2G96A 4U4MA 4HNVA 4RK8A 3KFTA 4QCEA 3DDMA 3L5LA 4O1DA 2NSOA 1RA0A 1VPXA 3BARA 1S39A 4K36A 4DUVA 1XV8A 4PMQA 4DM2A 4WIWA 4RZ5A 4D6HA 2XHYA 1DKWA 1UZ1A 2FLIA 3NM3A 3QV9A 2AMXA 4RV8A 1XBZA 4MMWA 4IT1A 5EY5A 5E9AA 4JL1A 5L6UA 4HPXA 1R86A 1GPWA 1UMYA 4AD2A 1MUWA 3GH7A 3PSWA 4EVZA 4LRTA 1PYMA 4UQCA 5I79A 5CSRA 1JVNA 1YNYA 2BHUA 3WLTA 3PM6A 3AHZA 4J27A 1MQQA 3BICA 1RPKA 2EPLX 1Q5MA 1K8CA 3VCRA 4CD4A 1MFVA 4C6PA 1HJSA 4JFVA 3RMEA 4FLSA 3N2CA 4KCUA 5IM51 4JNMA 4P5UA 1TQJA 3TU9A 4E2OA 4B3ZA 1SZNA 1GONA 4MF4A 3UA3A 1EXBA 4GRSA 3FNDA 5AHIA 1H7PA 1OBAA 1E70M 1B1YA 4PCPA 4AMAA 4JYDA 1UHVA 1P1XA 1XLGA 3MJYA 1E1EA 4ZOCA 4AW7A 5CLTA 2ODOA 4IXXA 1JIBA 3UXAA 2ZADA 3TE9A 1I6NA 1U30A 2VZOA 3MUXA 5EYWA 4XAGA 5AVNA 1QU4A 3M0YA 4RKAA 3WJWA 5A6KA 1PX4A 1MEWA 3B8WA 2DSWA 4UBPC 4CQDA 3PBVA 1ISVA 2OODA 1Q2SA 3LZ5A 1DHKA 2ACSA 3UF9A 5FF2A 3ZSSA 3N6JA 4YJ5A 3KVLA 3QJAA 3NO3A 3Q94A 3RGTA 1WDPA 3DYPA 2E77A 3THAA 3TZFA 1R2SA 2INFA 4INFA 3LTSA 2JEPA 3AS1A 3IAPA 5GJMA 3SSZA 4S23A 3BSGA 3A3WA 4IJBA 3S6DA 3OJGA 1BKHA 2Z2AA 2WO5A 2WKGA 4LANA 4L9XA 1UUMA 3CUGA 3MPGA 4N6FA 3I7RA 1ZENA 4CD7A 4BEQA 1HKVA 3B8TA 5FESA 3VIJA 3RILA 3PR2A 3CQ0A 3LV5A 3VIPA 4R3UA 2ZUTA 3W1MA 2X2YA 4IMCA 3W37A 2C7FA 1XG3A 4M24A 4J3VA 4HT3A 3UG3A 3LHZA 1P6BA 1W3KA 1ONXA 4MNMA 4B9ZA 2YCEA 5XIAA 2WHLA 4PMRA 4KWSA 3OVQA 5DT7A 2FB2A 4IIHA 4PRTA 4AD1A 2DZSA 5F2GA 3H54A 1J0IA 2R91A 1HVXA 1IGWA 4IX2A 2QIWA 4OJYA 3E0LA 4ATWA 4GY0A 1AK5A 1YRRA 5D2TA 2PZ0A 3GU9A 1W9VA 1W5PA 4IP7A 2FTPA 1OYBA 1IEXA 4AX7A 1PVNA 1TPC1 2F38A 2J75A 4US5A 4RXGA 2BY3A 1P0KA 1P4CA 2ZXDA 5HWNA 2ZC8A 4AC1X 5I02A 1E6PA 2Z4GA 3C0JA 3PG8A 5E6ZA 5DEZA 2NT0A 3O1NA 1ISWA 4JTCA 2R9RA 1Z6KA 1VCVA 1L8NA 5E1QA 3RNDA 3KL0A 1TR1A 2RUSA 5M5DA 4DBDA 3VKAA 1QK0A 2FMOA 1MUCA 3CBWA 4J7RA 5EBAA 5KETA 3URAA 2YSWA 1F7BA 4G1NA 3RYSA 5CBJA 2D20A 1JCNA 1XLJA 4I9MA 1RK5A 3NURA 3I6RA 4ATDA 1J18A 3ID7A 3MCOA 3ZWSA 1GKQA 2INEA 2XFWA 1D3GA 2WANA 4NG3A 1OADA 3PBUA 2E5CA 2OLSA 2XGZA 3WF4A 5ABEA 2BVWA 4WY0F 4JTJA 4CQ8A 3W74A 1U1JA 2BXZA 1OZQA 2WHJA 1W2PA 1FP9A 3SGGA 1UASA 3GDKA 4GINA 2Y4SA 4M7TA 3UG4A 5C9ZA 3IARA 3GSMA 9CGTA 1H51A 1W1ZA 4JTKA 1W5MA 3NQ2A 3TXZA 4G7EB 4OWGA 2AQOA 3E74A 2Z6JA 3MO7A 3MB9A 1KKOA 1W3IA 3UVIA 5KZEA 1AL7A 2FGBA 4AWEA 1H3GA 3B0VC 1OCQA 5FJIA 4K8HA 4Q7NA 1TUFA 1S3HA 2BX7A 3CK5A 5AC5A 4PB4A 2C13A 4H9TA 4W89A 3UR5A 5I07A 4OKDA 2V9DA 3CQKA 1E0VA 1V79A 4J3UA 1DXIA 2ANUA 3VOIA 1S2UA 3STEA 1LWJA 5LNWA 1PYFA 1SZFA 2QCNA 3M7WA 2F2KA 4MWAC 3G3DA 4W84A 2PAJA 5EMUA 3BG9A 3HZ3A 3PFRA 2E8YA 1AG1O 1WKFA 2BODX 5A1AA 2ZA2A 3HQPA 1VFTA 1BHGA 3ABXA 1QW8A 4K39A 1KM3A 4IIEA 4U3CA 1VBUA 1EP3A 4E3VA 1TCDA 3QR0A 3C6CA 1FHLA 4AYGA 2OZ0A 3NQBA 3QW4B 5C55A 4XQ6A 1DORA 1W3TA 5D2VA 5AN7A 4DWSA 4J9JA 3PTDA 1MQRA 1BWLA 1UP0A 5J04A 3W7EA 2I9UA 1EHNA 1H41A 3HQOA 3QKZA 1NY1A 4UNLA 1JZ6A 2YB4A 4XAFA 1BVZA 3WQFA 3T1GA 5DQPA 3UJRA 3WD1A 3EPNA 4FX7A 4C1KA 1RJQA 1SM9A 2QGYA 2Y1HA 4A3QA 1P43A 3WQVA 1HL8A 3EWZA 3GKAA 3G1XA 1Q4NX 4M6UA 3JU2A 5E9XA 3LCWA 4XX6A 3NXLA 3S83A 1HKIA 4E8GA 2QULA 3VX1A 5FACA 3SADA 1YDOA 4ECLA 1XLKA 7TAAA 2WNNA 3KX6A 3ZVIA 3GHTA 5D04C 3NDZA 5A6SA 4YVXA 2CZDA 3ABOA 1XSJA 1QR7A 1UKSA 3REQA 4JFTA 4H9XA 1ZJHA 3JUGA 5FI8A 4ZE5A 2PPGA 2J13A 4FOUA 4C5ZA 2E8ZA 2A3AA 1S1PA 3OW1A 3WBEA 3LQGA 4NP7A 5BOEA 1FTXA 1ZJAA 3MZNA 1QW9A 2GJNA 5CJNA 5CZJA 2J88A 2E5BA 1TV8A 3VGHA 3S2MA 1NQ6A 2BS9A 2A1YA 3W1UA 1MNZA 1QT1A 4FNSA 1RY8A 4UR8A 3L9CA 2W5FA 4C6QA 1JPHA 1XGDA 3QF0A 2PDGA 4TV5A 2KAUC 3FAWA 3P7YA 4UOZA 4W8LA 3UGRA 4DF2A 5CC6A 4P8WA 1Z42A 4LYKA 2R14A 4A35A 4KIEA 1GYLA 4H9VA 3QHNA 2WPGA 4NL1A 1KGWA 3PBWA 3P62A 1OFDA 2BVYA 4IFKB 1K6AA 4JTLA 5J8LA 4PSPA 3RPTA 3N6HA 3AS2A 4J3ZA 1GVSA 4Z2LA 3TA9A 5LA0A 2P1FA 1LWHA 3H4WA 3VGEA 1DYSA 4D71A 5CG0A 1VP5A 2DVUA 3PZUA 1D8WA 1EJVC 2BWGA 3M0XA 4F0HA 3USBA 1SJBA 2GJPA 4JYEA 3STPA 5KZ6A 3V4BA 2QCHA 4J3WA 3QQWA 1HP5A 5MKGA 2A4AA 5I06A 3W81A 1F6PA 4M8UA 4WSHA 2G95A 5BU9A 4UNIA 4K37A 1VBRA 5LNSA 4GYFA 4D6DA 1UJPA 2RJHA 4HVXA 3C0QA 3TIMA 2YGYA 1FWWA 4XAYA 4UTIA 3T78A 2VDGA 2QDHA 1OM0A 3KRBA 4XBJA 3P8JA 1TG7A 3EB3A 1F6KA 1E73M 2Y7DA 1QBBA 1O5RA 3NXFA 4LC6A 2XIJA 1ZP3A 1OQFA 1RQEA 4N9CA 1IWPA 2FH8A 4FIRA 3LCHA 9XIAA 4E0CA 4D9PA 4R7WA 3VKBA 4QQ3A 3II1A 2D24A 3S42A 5LA2A 4KRTA 3C0SA 1O66A 1GVRA 1GW1A 1BVWA 4BF7A 3AC0A 3ES7A 3BLKA 3RU8X 1UZDA 3WN6A 3LMYA 2QMJA 4URIA 5BRBA 2EEXA 1JAKA 2FHCA 3CB3A 4OT7A 8TIMA 2FVLA 5CSUA 3MKCA 1XLCA 3CHDA 1MI3A 5DBTA 1VR6A 1QI0A 2A7RA 1C9DA 1RXOB 4KEMA 1S2AA 3Q58A 1UD5A 5HULA 5ECVA 4GGHA 4WDTA 3CQJA 3F2DA 4E38A 3PHAA 4AIEA 3VNIA 5I3JA 4P2VA 3QEZA 3T2OA 3GFYA 2VFGA 4NYYA 3VGGA 2J9ZA 1HO4A 3SFWA 4LS2A 4WK9A 4HK5A 5H2ZA 3GO2A 3NQ8A 1KCKA 4B4FA 1DQUA 2ADAA 3AJXA 5DCDA 3TUUA 3H4XA 5LNVA 1JGIA 2Q6ZA 3UZZA 3WNNA 3MY9A 2GQ9A 3TYCA 4IOTA 1M7PA 5JQ9A 4IMEA 2OQHA 1XQLA 1HX0A 3N12A 4TVCA 2UY3A 4W7UA 3ZJ8A 2OFJA 3SY5A 2VVSA 4U10A 3E0VA 4J28A 1KC7A 1SO5A 1EC9A 1OX6A 1FWFC 2VNCA 1S46A 3ANYA 5A8MA 4LJ3A 3GVVA 2J7CA 1Q6EA 2I5GA 5FF7A 3N6QA 5I3KA 5A6JA 4KFPA 4CNOA 2C15A 2FIQA 3W2LA 2AGKA 3W73A 2XPKA 1A0DA 1N82A 4MKNA 1KTBA 2NZLA 4GQRA 4EPDC 1X7FA 1HKJA 3H70A 5BXSA 3UZJA 2ZX8A 5F4WA 2O92A 3HM7A 4XVEA 4UB9A 3WENA 4E3TA 2XIQA 3EPMA 1GEQA 1U33A 2VEIA 4CN1A 5I00A 5H6HA 1FWRA 4KH2A 1WOAA 5HUPA 4LXFA 3VZZA 1Y5WA 3CIWA 3SRDA 1IWAA 2V3GA 1NVMA 1RR2A 2VD8A 3VO0A 1F05A 1TWDA 3TA6A 4JPGA 4MB1A 3WH6A 3THDA 1VKFA 2GWGA 2ZA3A 1YPIA 4C6IA 2PF8A 3EDJA 3ME3A 1BYBA 2FPTA 5IHSA 1YTDA 5AKQA 1T96A 2V6AA 2EPHA 2OWWA 2CLPA 2O55A 3DG6A 3TYAA 3CYVA 2NT1A 4OV4A 2V5KA 3I10A 3A12A 4MFDA 1TTPA 2YCLA 4YCOA 4LAUA 3GTHA 4S1FA 3ZIZA 2BMBA 4XV0A 1SUXA 5JVLA 2GFTA 3EX3A 3USZA 3SRKA 3EA1A 4F0SA 3FLUA 4DB7A 4IICA 4AHPA 2YW3A 2PTXA 1IZKA 2XTKA 3CL8A 2C1HA 5CKSA 2CEQA 3ZJKA 3ITYA 4IIDA 4F2BA 4WY0A 4TTUA 5FA5A 1EHAA 1TZZA 4H6RA 3GXTA 4MZYA 2WV8A 2X41A 1TJ1A 4DWDA 1PXGA 3UCDA 1I2RA 3BZJA 3E38A 1PKLA 1EXPA 4BEUA 4PR4A 1F07A 5F7UA 3KVMA 4MFEA 3VGBA 4A3UA 1E6SM 1Y5VA 2HS8A 3K4DA 5IFTA 4XUYA 1D3CA 3HGSA 5LNRA 1JZ2A 1LT8A 3LM3A 4K7VA 3LHYA 4AC7C 3OZPA 2HZGA 4U28A 4C6KA 1CB7B 1Y5XA 2JBMA 3V0TA 2VZSA 3OEXA 3W02A 4QAIA 2QCFA 1XDLA 3QOMA 4GBUA 4U3AA 3F5KA 2CLIA 4G9PA 5BU6A 1WXJA 4WGXA 5EL1A 3EWUA 2P5NA 4GZIA 3JW7A 5L9FA 3UWYA 3EOSA 3DN5A 5D03A 2ZZ7A 4D6CA 3GXDA 2OSWA 3E0WA 5HNNA 3VE7A 4QGCA 2VRKA 4F79A 4HHHA 1M7XA 1XYLA 1X39A 2V81A 2WMKA 1VIZA 2Z0IA 3P81A 3GDLA 3UWQA 2NV1A 3CASA 3NIYA 1ZS2A 4F4RA 3EX1A 2UY2A 3LG3A 2DVTA 1I2NA 3W6YA 1KQYA 3SN1A 1EEPA 4F2TA 1V02A 2DSUA 3QHMA 1RD5A 1ADSA 1W3HA 2PDIA 1PO9A 4NSBA 1KM4A 1XRFA 1VFHA 3HPXA 3COTA 4CQBA 4WCJA 3DESA 4NY2A 1CGTA 2GZXA 1SW3A 3UWVA 3W86A 2Q02A 4L80A 4PA8A 3BW2A 4TXEA 4S3FA 4GO9A 4AEFA 1XW8A 5CJ5A 2C79A 3A47A 1EJXC 7REQA 3L21A 2VWSA 4X9YA 4HYWA 2F84A 1OFOA 1MW3A 5CPQA 3LCIA 2ZA1A 2C19A 1UKPA 3WD4A 2Z1WA 1REQB 3BAJA 3UYIA 1J9YA 1TE1A 1UKOA 2B7OA 2VMFA 3GDBA 2ZWZA 4HBKA 3KBVA 5BMWA 2PSNA 1ME9A 2BVDA 4B5NA 4PMYA 2WC7A 4TUFA 3T4WA 1FRBA 4CUCA 3VD7A 1NJJA 1OCBA 3GH5A 1TTIA 3NGJA 4C90A 3FXGA 4LTSA 3GNXA 3MSRA 1PHQA 1TVNA 4C6BA 1HG3A 4IPLA 5CPLA 3HPZA 4PMZA 1A0CA 1KXVA 3QTPA 4ATLA 5HR6A 1VH7A 3VOFA 3ZJ7A 2R1KA 3UCQA 2QR6A 3AFBA 4AAJA 6A3HA 2DUXA 3AAMA 3SCVA 1TA3A 4L64A 2XZ7A 3FFSA 4K6AA 3L4TA 3OQEA 3TW9A 3G18A 4H9ZA 4O1AA 3BGGA 4WEVX 3BG5A 4PFMA 3W1RA 4ZFMA 1YLVA 1BF6A 4RXFA 3ZWTA 1Z69A 4GLEA 4PODA 3PZ9A 5HWJA 5LHFA 4NJJA 1C3FA 3L4WA 3CWHA 2NLYA 3UXIA 4QSHA 5KEZA 4Q8VA 4W5ZA 4GCAA 2V5CA 3GR7A 6PTDA 2ZBTA 2DVXA 3W87A 4ZSTA 4IX0A 3H12A 4UUIA 4UZSA 3EWXA 4HQVA 1L6GA 4BQ4A 5GJPA 3B0YA 4L61A 5FF0A 3KRZA 4HPHA 3DHFA 2BY2A 4B4HA 2OTDA 3KBMA 1YPXA 3WNMA 2BNJA 4LQ1A 2D2OA 4X22A 1KFJA 4MWAD 1JDDA 2VFDA 4X0NA 4NZ3A 4TQTA 1N55A 5AYYA 3PFMA 4HNOA 3LV6A 1EL3A 4G7EA 4AQLA 3LOTA 3VVGA 4QBXA 1BEUA 2YFNA 3SBFA 4TTGA 2JFEX 3R0DA 3K8LA 4JKMA 2PC4A 5A2AA 3B97A 3E6EA 4YWIA 4D8ZA 4H9MA 1YDVA 5I23A 2AQVA 5DN1A 4JX5A 1LL7A 1YDYA 3LENA 3WLQA 2FB3A 1LQAA 3TCSA 1FFQA 3WQGA 4K3ZA 1KQZA 2X16A 2ZZ5A 2QLYA 1H7WA 3LI0A 3NSMA 4MKVA 1UR9A 4ZO9A 2PDBA 3WQEA 4IM4A 4ADSA 2FFIA 2X2GA 1UW9A 4MDPA 3NR0A 2QVNA 1BYAA 2POTA 3E12A 4XBSA 2EO7A 2R1MA 3P5ZA 3LTPA 3WLJA 3B9DA 2D3LA 3TAKA 1S2VA 3IJLA 5KTLA 2WVTA 1QPNA 3AIBA 3W2JA 3NG3A 2XWDA 2QUMA 3C0LA 4IL2A 3S6TA 3HPAA 1JYWA 4UTTC 1HNYA 1SJAA 2VFFA 3BLPX 4A3HA 2RDXA 4Z1CA 4LUTB 2ISVA 4BS0A 2XUCA 1HN1A 4NHVA 3HJEA 3S5SA 3BJFA 5J5RA 2G37A 2WMGA 4IGMA 1OT1A 3B05A 2G50A 3N25A 3A4WA 3KVKA 1VLIA 4LUIA 3MDWA 2BOEX 3VM7A 3CAVA 6ALDA 4LS0A 1K70A 3EXRA 2NV2A 3UFYA 1EQPA 1YE6A 3WSUA 1RHCA 3SJNA 1GTEA 3BCDA 3W0KA 1PKYA 4K38A 3HBLA 1LLOA 3JVAA 1R3QA 3PNUA 3NQAA 2VENA 2XJ7A 3HGOA 4HKPA 4POCA 4FXFA 4O57A 2GQ3A 5C7VA 2QJGA 5LA1A 2Z2BA 4C6LA 1TUXA 1VFMA 2YX0A 3MJMA 2DGAA 2INZA 1Q6QA 2PTYA 4UFJA 4H19A 1B3OA 1VRDA 1Q63A 5TQLA 3VDGA 2ALDA 1O12A 1WZAA 2PC8A 1EBGA 3VDHA 4YL2A 1CI1A 3ZT5A 3K1GA 4Y9MA 1QOPA 4S2CA 3IRSA 4RE0A 5I77A 2W6RA 1EH9A 1V6XA 2PDYA 3UJFA 4KCWA 2Y8VA 3GVGA 4KF1A 1W17A 5D9OA 4Y96A 4HYRA 4RW3A 2OT1A 5A8PA 4YIWA 4CGTA 1RPXA 4GC4A 1HKWA 1ZQ5A 4I7VA 3NYZA 4I3GA 4MG4A 2AAMA 1PS9A 4LF1A 3FA3A 2VRJA 3RMJA 3PK7A 4HK7A 4GIEA 1WX0A 1Z44A 2GVJA 1EP2A 3LZ3A 2PU0A 4YTTA 1H60A 2CBUA 4GKLA 2W67A 4RDWA 1AZ2A 1A53A 1V3JA 3W3OA 3QVQA 4IPJA 3CZLA 3W29A 4JL2A 2HK0A 3ZFHA 1WZLA 2J79A 3ARVA 3UWZA 2QZRA 4IFKA 2VC6A 5FEXA 4CCZA 4O14A 3N2XA 1L6WA 5C6MA 4AZHA 1QFEA 2WMJA 1JCXA 2WSQA 2BY0A 3EX4A 3M0ZA 1OHLA 3ITLA 3QLDA 2HVMA 1H50A 7REQB 3G8RA 2GK1A 3QFEA 1J0YA 2GGGA 1XRTA 4UOQA 2VYOA 1EDTA 1ISXA 4O50A 5KSWA 3VNDA 3MANA 3SIZA 4HSNA 4DWSC 4BI5A 2DQXA 1GG0A 2LLEA 4KMQA 4A8RA 3I65A 2RKXA 1XD1A 1QDSA 3L4VA 1K7FA 5BZAA 2P8BA 1H7RA 2HS6A 1FKXA 3LUTA 2D69A 1KRCC 2Y61A 3HG3A 4NILA 2ZX9A 3MP4A 4DQWA 3MYPA 4MAVA 4MWAA 3WEOA 1GQLA 4C6FA 3DFSA 3R1ZA 3VCNA 7TIMA 1DJWA 1OD0A 3A4JA 5KZDA 3KP0A 1P0EA 4DO5A 4HN8A 3BC9A 5DMNA 3T0TA 3ZLFA 1KM2A 1JDAA 4HHPA 1XFCA 1AODA 2ZRZA 3HQNA 4Q32A 1W1B1 4DJEA 3P84A 1JEZA 3O63A 5D2WA 1TV5A 2V3EA 3ZR6A 4LALA 1OGBA 3CPGA 4LFYA 3WFAA 3RF9A 2GDQA 4LEQA 3IJ8A 2GLKA 4XTDA 1G4SA 3MDUA 3LA4A 4DI8A 2DT2A 1B3YA 4S3AA 5F4SA 1EDQA 3AJ7A 4GIYA 7CGTA 3NCOA 1TFVA 1JDFA 1HXJA 4GUJA 3WDQA 5I6SA 2NQLA 3DG3A 3O16A 1S5WA 1JDCA 3NVTA 4IPNB 3N04A 3AU2A 3H24A 9XIMA 2UY5A 1H49A 3PSVA 4V2XA 2JEQA 1QNOA 3WQ4A 1EB3A 4N0RA 2YL9A 3MC5A 4PUUA 1G9HA 1UWUA 1VJZA 5IFPA 4ENLA 1G6CA 3MP5A 1KWK