3TA9A

Beta-glucosidase a from the halothermophile h. orenii
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
449
structure length
448
Chain Sequence
b'AKIIFPEDFIWGAATSSYQIEGAFNEDGKGESIWDRFSHTPGKIENGDTGDIACDHYHLYREDIELMKEIGIRSYRFSTSWPRILPEGKGRVNQKGLDFYKRLVDNLLKANIRPMITLYHWDLPQALQDKGGWTNRDTAKYFAEYARLMFEEFNGLVDLWVTHNEPWVVAFEGHAFGNHAPGTKDFKTALQVAHHLLLSHGMAVDIFREEDLPGEIGITLNLTPAYPAGDSEKDVKAASLLDDYINAWFLSPVFKGSYPEELHHIYEQNLGAFTTQPGDMDIISRDIDFLGINYYSRMVVRHKPGDNLFNAEVVKMERPSTEMGWEIYPQGLYDILVRVNKEYTDKPLYITENGAAFDDKLTEEGKIHDEKRINYLGDHFKQAYKALKDGVPLRGYYVWSLMDNFEWAYGYSKRFGLIYVDYENGNRRFLKDSALWYREVIEKGQVEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoside hydrolase family 1
publication title Expression, purification and preliminary crystallographic analysis of the recombinant (beta)-glucosidase (BglA) from the halothermophile Halothermothrix orenii
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
total genus 162
structure length 448
sequence length 449
chains with identical sequence B
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ta9A00
1D3CA 1PZ2A 2OWXA 3AMLA 4D71A 4UFIA 1QBBA 4V2XA 4QDMA 3VNYA 1JIBA 2BY3A 2V5DA 4CD4A 3BC9A 2EPLX 1VB9A 2XFFA 3AISA 2OYLA 2YDQA 4BQ4A 1SMAA 5BXTA 2ZXQA 1Q6EA 3T2OA 3W38A 4WSJA 3CHDA 2C8NA 3VIIA 1MQQA 3WQ5A 4F9DA 1V0NA 4CGTA 3D5HA 1UQYA 4ZXLA 3ARTA 4GI9A 1GUVA 1E0VA 1TA3B 3WF0A 1VF8A 4PMDA 3OLGA 1H2JA 4CD5A 2CBJA 4LXFA 1H09A 2E9LA 4OIFA 1MXDA 2V3EA 2J74A 1HJXA 3PZMA 2WWDA 3AXHA 5A8NA 5AY7A 3BAYA 3M46A 3ZSSA 2ZXDA 1IZJA 3AIWA 3WF2A 3CZKA 5BCAA 1OT2A 2BS9A 2XVLA 3GNRA 3A4AA 2Y2WA 2OLHA 1UR9A 4C7DA 1UA3A 4D72A 4HOXA 4P8UA 2WC4A 1FFRA 1QNPA 4D6CA 1R86A 4HZ8A 1JZ7A 4QCFA 3W6LA 1W9DM 1QI2A 4GO9A 3VUPA 3GNPA 4DWSD 1BHGA 1CEOA 1VIWA 1BG9A 4MNLA 1EOKA 2ZUNA 3APGA 1QW8A 1ZBCA 1W9PA 2G3NA 3U5YA 4MNKA 1TMQA 2G4FA 1B90A 3EDFA 3S6TA 1C3FA 4FLOA 1E6PA 4Y7EA 1GORA 1QI3A 2NSXA 3OB8A 3WUGA 1MQPA 1US2A 2WWCA 1NQ6A 4P7LA 4UZUA 4AISA 2VRKA 8CGTA 5LA0A 1UH2A 4D6EA 1HX0A 5I2UA 4OJYA 3LPPA 3LPGA 4Z2KA 1JZ2A 5CGMA 4LYQA 2GJXB 3T2QA 4WKHA 1GOQA 3SCOA 1ISXA 5HPCA 1EDTA 4UQ9A 3VGDA 4E8CA 1C90A 1R8LA 2VMFA 4GZEA 1AQHA 3PTQA 1GW1A 5D4YA 4MJ2A 4CCDA 2WMFA 4AWEA 1WNOA 1X6LA 1PX3A 4ACZA 2AAAA 4W84A 1NH6A 2E9BA 4MJ4A 1JZ8A 5GNXA 4LYPA 5F7UA 3DYOA 1CLXA 2G41A 4AD0A 3GBDA 4GO8A 1HF6A 3K8KA 3LPFA 4BZYA 1WZLA 4U3AA 2XVGA 3AIRA 3VIFA 2WC7A 1VRXA 3NUKA 4BCEA 3VDBA 2BHZA 9CGTA 4FMVA 1ZJBA 1WZAA 1KBBA 3OZOA 1RH9A 2GUYA 1VBRA 1UKPA 2A3EA 3UETA 1QBAA 1XSKA 2PWDA 4MDPA 1C91A 1PEZA 4Q7NA 1JXKA 4HMEA 5A2AA 4WKAA 2WSPA 3T0AA 1UH3A 1J0YA 2W63A 2J77A 4MB1A 3PZGA 4HA1A 5BXPA 1B3VA 3QR3A 4CCCA 2CBVA 2VQTA 1RP9A 2CBUA 3ZIZA 1QI5A 3GM8A 3SCSA 2YL9A 3VPLA 3PZIA 1IZKA 2ZWZA 1H0IA 3CHFA 2YA2A 1Y7VA 5A95A 5A2BA 4DWSC 2HVMA 3MANA 4AIUA 2CKSA 2J7CA 4AZCA 3AI0A 2BY1A 4JIEA 1EQPA 3N11A 2C7FA 1PJ9A 1WDRA 1WP6A 2CCRA 5A6MA 3CUFA 1ZB5A 1FH7A 1CXHA 2DSVA 1U30A 1WCGA 3W26A 4A3HA 4JL2A 2X05A 2A3CA 3WQ8A 5I24A 3MMDA 5JIPA 1C93A 3ECQA 3OGRA 5IHRA 1B1YA 2WMGA 1NP0A 3ZOAA 1BYAA 1W1PA 3W4RA 1DP0A 4S3KA 3S2CA 3WFZA 4AD5A 3BAJA 4AIOA 1XGZA 1HL9A 3W25A 1CXEA 4KWUA 5DT5A 1GOIA 1UWUA 1LLOA 3ZR6A 2O9TA 3UG4A 3CZEA 4JFWA 4P8VA 4D6FA 2QV4A 4NSBA 3TTQA 3K8MA 2QHAA 3WEOA 1W9UA 1C7TA 2VZTA 4YPJA 2FGLA 1E3ZA 4GPNA 3VVGA 2BVDA 5D9OA 3WF3A 2VX5A 3VMPA 2YJQA 2X1IA 1TCMA 2V5CA 5CLWA 1V3HA 1TR1A 2XG9A 4UR9A 3TOPA 1AMYA 4GKLA 4UFJA 1UR8A 2O9RA 3WD4A 2Y24A 1VFMA 2JALA 3HJEA 3OBAA 3SCUA 3SCWA 2YBUA 3UR8A 3VX0A 1UKSA 1ODUA 2A3HA 1Z32X 1VENA 2AMGA 2JEQA 2Q8XA 1EHNA 3F4VA 5BXRA 1OWQA 1XRVA 1GQKA 4WSKA 4U5IA 1KXVA 2VVSA 1F4HA 2ZUWA 3BSGA 4PMZA 4PTMA 4Q22A 3GXFA 3VGFA 2GK1A 2DSKA 4MTVA 4MNJA 4B3KA 3FHQA 1AQ0A 7CGTA 1U2YA 1B9ZA 1Q6GA 5I78A 4ATDA 4ACZB 2VI0A 3A6OA 4P8XA 5JBDA 2WANA 4D6JA 2VQUA 4ZXOA 5A8PA 3BAIA 3AROA 2Y8VA 4F66A 3VMOA 1OBAA 2FH8A 5ABEA 3EMCA 1W91A 4MDOA 3WQ6A 2YKKA 1KR1A 4ZFMA 3EMZA 1LG2A 1B30A 1J12A 4JAWA 1UYQA 1JNDA 2YIHA 2IUZA 4QP0A 5CLTA 2VJXA 2W91A 3WDHA 1FA2A 1E0XA 2GSJA 2NW0A 1HXJA 5I23A 1CGUA 3SCTA 5CSYA 1W3JA 1J0KA 1TE1A 3MUAA 2EPKX 2E40A 4UQCA 2CHNA 4KMQA 3VNZA 3OIHA 2EPOA 3OGSA 2D20A 2GDVA 2GDUA 1YHTA 1L8NA 1I1WA 2XWDA 5GPRA 3ZJ6A 1V6XA 3ARVA 3DHPA 2UWFA 1UA7A 3W6MA 3OLDA 1ZS2A 2G8ZA 4E2OA 2WLZA 1B3XA 3VOCA 3PZOA 1V3IA 2O9OA 3AMDA 4F8XA 2WKLA 3CMJA 1KCLA 5D9NA 1P6WA 5CPSA 2ZUSA 4M80A 4GZIA 3DC0A 2CBIA 3WMCA 5LA1A 3CIVA 5IHSA 2BXZA 4HMDA 6CGTA 3BSHA 1OIFA 1ODZA 1LQ0A 3MUIA 5ABGA 1BFNA 2XGBA 4AMCA 2RGLA 4PCSA 4AD3A 1KR0A 4Z2JA 1E6QM 3TTYA 4YHGA 4XV0A 3FY1A 4W8LA 3VGBA 2J7GA 2NT1A 4TOQA 3VD4A 4OKDA 1CTNA 1W1TA 1UKQA 1UOKA 4PMQA 5ABHA 1C8XA 2JE8A 3SCVA 1WO2A 2J75A 4YHEA 1Q6DA 1A47A 1B3ZA 1JF6A 5E9AA 2F61A 1DWHM 4J3SA 1LG1A 1US3A 3PN8A 3L4TA 4UNIA 1GOMA 1UD3A 3POCA 5FKYA 3M07A 5A1AA 1KGUA 2D0GA 1DHKA 5ECUA 2YA0A 3ARUA 3G6LA 2PWHA 1H11A 4EAMA 4HPGA 2VC9A 3TONA 4UFHA 2OSWA 4Z2IA 1KB3A 3AS1A 2OSYA 4EKJA 1V0KA 1BSIA 2VX4A 4UFMA 3MO4A 3ALGA 3RM9A 3SCQA 1E56A 5EMYA 5IDIA 1KXQA 2XVKA 3WH9A 1KWGA 2ZIDA 3N12A 2BHUA 2VCCA 2C0HA 3NJ3A 4NRRA 2D22A 4PMNA 2WHKA 4M24A 1BLIA 5IXEA 4CU6A 1J0IA 1JYVA 1CENA 1E71M 2A3BA 4W8AA 4JFTA 2BNJA 3SUSA 1QNSA 2YL8A 1W1VA 3AZTA 1G01A 4J28A 3T09A 3SCNA 1MXGA 2CHOA 4TX8A 2J79A 3UG3A 3SCRA 4DM1A 1VFOA 1XHGA 4GQQA 4NRSA 1G5AA 1BYDA 4LQ1A 1RPKA 3A4WA 3AIVA 4C7GA 1NOFA 3CZJA 3HU7A 3IAQA 1XD0A 1CGXA 2YL5A 4AEEA 4B16A 2D0FA 3KZSA 3TTOA 1KQZA 3W24A 4D1IA 4CKQA 2VURA 1BYCA 1BYBA 3GH5A 3MMWA 3DECA 3OA5A 4X0VA 3ZSTA 2WCAA 4UQDA 1EHAA 1ITCA 2Y4SA 4UOZA 3AFBA 2DDXA 4QLLA 5CPTA 1B2YA 3AXIA 3WUBA 2X8RA 2DSUA 2BXYA 5D9MA 1QHPA 3OG2A 1OB0A 3CUGA 2JF6A 2WAGA 2PB1A 2WLYA 4Z2HA 5TD4A 3MS8A 3VGEA 1WDSA 2QF8A 3ZT6A 1OGSA 2XM1A 1EH9A 3K8LA 1TFVA 1CZ1A 5AYIA 2YA1A 4UOQA 1QOXA 2WVVA 4W7WA 1JZ6A 3OGVA 2JEPA 1E3XA 5A8QA 3CTTA 5D8WA 2WMIB 2Y8KA 3EDKA 1OM0A 2J25A 3TA9A 1UH4A 1E6ZA 1UD2A 5FL0A 2G3IA 1NOUA 4N42A 4W93A 1ECEA 5JUVA 3WD0A 2D1ZA 3BLKA 1V02E 3AMKA 2EJ1A 1D2KA 3O6AA 4H8HA 3N1AA 4EANA 1BTCA 1SMDA 4GI8A 1MW0A 1O6IA 4R5EA 4JCLA 4JL1A 4W89A 4FLRA 3K4DA 2XIBA 5E6ZA 3WNNA 3U57A 3ZJ7A 4P7NA 3N9KA 1GJUA 4JFUA 1EIBA 2QLYA 2ZICA 5E0FA 1QPKA 2WZEA 1RP8A 3B8SA 2XFYA 1BGAA 2VVNA 4F79A 1O7AA 3GDBA 4UOJA 3VX1A 2BV9A 4IM4A 2QMKA 1GNXA 1KGXA 2ESCA 3B9EA 4AZIA 2GVYA 3ALFA 4U31A 4KRTA 1JFHA 1R7AA 5JBFA 1E1FA 5AC5A 1HJSA 2WCGA 3PTMA 4D6IA 4W7VA 4BS0A 3TP4A 3T0DA 1JDCA 1W3HA 3LPOA 4M8UA 5M03A 4C7FA 4GIAA 4PEEA 4X9YA 3OLEA 1EO7A 3GTNA 5FL1A 3RMEA 1VBUA 1J01A 2HISA 1EQCA 2CEQA 1GHSA 4Z2GA 1M53A 3CPUA 3WY1A 3FHAA 3THDA 4CCEA 1V0MA 3PHAA 2X2YA 5FIPA 5GNZA 3WQWA 2DSZA 2VCBA 3ZJ8A 3PBGA 3VD9A 3T0BA 3BLPX 3AHTA 4BQ3A 2X09A 2E4TA 4B3LA 1J9YA 3EYPA 5A8MA 1FHDA 2PBOA 1FH9A 1PIGA 4NF7A 2D0HA 5HBFA 3CUHA 4M81A 5DF0A 2JIWA 1BVZA 5DO8A 1WB0A 3KL3A 4U5KA 5HOSA 3ARXA 4ATLA 1S46A 3RO8A 1PBGA 4MB5A 4RE4A 4W86A 4TX6A 2ZX6A 4TTUA 5CPQA 2FHBA 4AEFA 2NT0A 1H49A 1UR4A 1D7FA 4UFLA 2EPMX 4IUGA 4XX6A 2ZX8A 3IAPA 1TZ7A 2J78A 4HA3A 1ITXA 1K9EA 3WNMA 3VM5A 4W88A 1NARA 3GXMA 4M29A 4HU8A 2D2OA 2ZUMA 2BFGA 1UQZA 3VDHA 1OSEA 2W67A 5D9PA 3BAWA 3CUJA 5A6BA 4JZ5A 1SYTA 4QLKA 3M6DA 4GZJA 3N15A 4URIA 1E6NA 4OOUA 1NP2A 5BRQA 1I1XA 4B15A 5C70A 1W2PA 1E4NA 7A3HA 3D3AA 1HP5A 3AZRA 1BVNP 3QHOA 1E1EA 5A69A 1VAHA 2CESA 4HPHA 2J7HA 1W3LA 4CD7A 5EBAA 4PMRA 3ZT7A 1NWRA 1BG4A 1HJWA 3VD3A 4IPNB 2PI6A 3OLIA 5E6YA 2QPUA 1E55A 3ZJKA 1R7OA 3AHVA 1E4MM 2X0YA 4E4PA 2WC3A 4CN4A 1W3KA 3NSXA 2G3MA 4MPKA 1V6UA 3WN6A 4TVUA 3VMNA 2CPUA 3MKKA 3RJXA 1MW1A 1V02A 2EQDA 2XHYA 4AW7A 5I79A 1JZ4A 3AS3A 4GXPA 3WQ4A 3DYPA 3KE0A 5IFPA 1E40A 1UWTA 1V3LA 1WDPA 4NI3A 5GQBA 4OUEA 5HPOA 3CZLA 4PTWA 1JZ3A 4BA0A 1FH8A 1H41A 1C7SA 2DT1A 1X1NA 1GONA 1JD7A 1DWIM 4W7UA 3WMSA 4ZE5A 4V28A 2VRQA 4PSPA 2PWGA 4AZ5A 4WJXA 3WH7A 4UQAA 3AYSA 3O2LA 1YQ2A 4J3XA 3MMUA 4L4PA 2JFEX 4AZ6A 4MB3A 3TTSA 3VILA 1JI1A 4CVWA 4UQBA 2WVTA 3UG5A 4GQRA 3THCA 3L4XA 1LWHA 1UWQA 1TVNA 1G9HA 2EO7A 4KGJA 4JKMA 5ABFA 3ARZA 1FOBA 1W1YA 5AC4A 4P7RA 2TAAA 3N17A 4W87A 5AYBA 1FP9A 4PUEA 2YLLA 1HT6A 1AVAA 2DT3A 3AZSA 1NWSA 2O92A 1J18A 3L4UA 3CLWA 1UUQA 3PZVA 1W9BM 2Z1SA 4J3WA 3O9NA 2VX6A 3I3DA 2XVPA 2VL4A 1UKTA 4MNMA 2J7BA 1HJQA 4DWSA 4W5UA 4S3JA 3B9AA 1V3MA 1E4LA 1GHRA 1UD6A 1JL8A 2XSBA 3U7VA 2FH6A 2J62A 1E72M 2UY5A 4W8BA 5I77A 1UG6A 3W81A 3AOFA 3L4YA 3KL0A 3BGAA 2PWEA 4EE9A 1ISYA 1V6WA 1HKIA 1HVQA 1UR0A 1G94A 2WNWA 2CYGA 2WPGA 4TTGA 1MFUA 3CO4A 2DT2A 4U2YA 2WZHA 3RM8A 1UR1A 1DEDA 2DIEA 4UFKA 4UCFA 3CMGA 1GZJA 2FHFA 3L4VA 1EDQA 5A6AA 1V03A 1CXKA 2EXOA 1E70M 1JAEA 3K1DA 2FHCA 2UY4A 4PBGA 5EFDA 1TA3A 5I0DA 4AZCB 4TUFA 3W29A 5A6JA 4ZENA 3LMYA 3GNOA 1GCYA 4JHOA 3HMCA 4W85A 4NZCA 2ZUTA 1ZU8A 4X0NA 1XYFA 1ESWA 3EDEA 1JF5A 6TAAA 2WMHA 2XSAA 3K4AA 2ZOXA 3OZPA 1K9FA 1HNYA 1OD8A 2OSXA 1BAGA 2WMJA 4PMUA 3BCDA 3KEHA 1IT0A 1TG7A 4A3YA 5HXMA 2VRJA 3WF1A 3MU7A 2E0PA 3GH4A 3RPMA 2XPKA 4QFUA 2ZUVA 4HMCA 3VGGA 2CIPA 1QVBA 1Q6FA 2GJPA 3CZ8A 2EPNA 4KGLA 1W2VA 1PAMA 3GYCA 3F5KA 3CBWA 4P8WA 4B9ZA 3ARWA 4AIEA 2A3AA 3NIYA 3UR7A 5JIWA 5A94A 1CWYA 2W62A 4H7VA 3MSDA 2DH3A 3WSUA 1JDDA 3W53A 2PBGA 3IK2A 5HDRA 1NOWA 3WBAA 1LJYA 5FCZA 5E70A 3VIKA 4UTFA 2DT0A 4WIWA 2AOSA 3WL0A 1OT1A 3WUEA 1HKMA 1W9XA 2J4GA 1MW2A 3ARQA 2VTFA 1LL4A 3ZQ9A 1UWSA 2V3DA 1UD4A 3T08A 1BPLB 4HZ7A 1W32A 1JZ5A 3A3HA 1UKOA 3SUUA 1B31A 2GK1B 1Q6CA 1CIUA 5ABFB 1C8QA 2J7EA 2WVUA 1CPUA 4DUXA 1E6SM 2PF0A 4AZHA 1VFUA 1V6YA 5M17A 2ZXAA 4PTVA 8A3HA 4RE3A 3QHMA 1GVIA 1E43A 2E8ZA 2DSWA 3DHUA 4CVUA 2WHJA 4M56A 4MAZA 4DUWA 4HOWA 3VIMA 1H1NA 1E0WA 3VIHA 2CNCA 5D8ZA 3AMCA 4BF7A 3AHZA 2GFTA 2UY2A 2XTKA 3SURA 1ISZA 2VR5A 4FLQA 4AD2A 3FAXA 4D6HA 4WKFA 1QNRA 2MANA 2WBGA 4HZ6A 3WIJA 3VIOA 4M1RA 5GNYA 3U7BA 3VTRA 1WAWA 2BVYA 4U2ZA 3RILA 5CXPA 4H8UA 5A3HA 3B9DA 1H5VA 2VUYA 4AZ7A 3WEZA 4PRWA 2DIJA 1I75A 4DM2A 4J3TA 3ZR5A 5BROA 3KWXA 3UESA 1BF2A 4PMOA 1M01A 5KEZA 1KQYA 1NWTA 1MW3A 3ARSA 1EO5A 1HJUA 3AJ7A 3A47A 4QLJA 3GH7A 3U5UA 1W9VA 2D24A 3MV01 2V3GA 2VX7A 3QOMA 5CSUA 3BCFA 3GZAA 2XUCA 3T2PA 2JIEA 5BYWA 1XCXA 5A6LA 4CN6A 3L4ZA 2YOCA 3FAWA 2QPSA 1C92A 3GBEA 4N0RA 2WXDM 3FNDA 4PUDA 1XH2A 4RL3A 1TVPA 4CUCA 1CGTA 4ACYA 1FP8A 5C71A 3VIPA 1VJSA 1LL6A 3I3BA 1K9TA 3WNPA 1KGWA 3EDJA 3WNOA 3W28A 5LYRA 3L2MA 3VDCA 2ZXBA 3IJ9A 1UZ1A 3AMGA 3PZQA 1MWOA 3MUZ1 4W5ZA 1CXLA 1B3WA 1JDAA 5KZ6A 5E09A 1XSJA 4CU7A 1MFVA 4D1JA 2XVNA 4ZE4A 1CNVA 3POHA 4MAVA 4XUYA 1VEPA 3AS2A 1ISVA 4FK9A 1J10A 3WH8A 5E0CA 3AS0A 3K46A 2J47A 3WKZA 1CYGA 3QGVA 5A6SA 2WHLA 1NWUA 2OYMA 2WZIA 5CJ5A 4GINA 2VO5A 3N04A 6A3HA 1CBGA 1JGIA 3BXWA 1BQCA 3I3EA 1UWRA 3WH5A 1CGVA 3RJYA 7TAAA 3WMBA 3NDYA 5CZKA 2VNCA 1E6XM 4E8DA 4XZWA 4Z2LA 3RDKA 3ARRA 3WUFA 3WFLA 5A8OA 4ATWA 3AIBA 1XH1A 4V27A 4DUVA 2DPEA 1ZBKA 1G1YA 3N18A 3WNLA 4MB4A 1WKYA 3W0KA 1CGWA 2IXUA 2YL6A 3MSGA 3WDIA 4PYSA 3II1A 3F5JA 2WCSA 2W61A 2OWWA 3WQVA 1MQRA 3RCNA 1JYWA 3AIEA 2YDSA 1FHLA 1HKJA 2D23A 1N82A 3VIJA 3VKKA 2Y5EA 1OIMA 3SUVA 3SIMA 1J0JA 4OBRA 1E9LA 1ZL1A 4A4AA 1EDGA 2ZUUA 4KH2A 1JFXA 3WL1A 2VZVA 3J7HA 2W4XA 4OOZA 1UR2A 2IXVA 5I5RA 1GVYA 3VU2A 3WDPP 3FN9A 1HVXA 4HP5A 3GXDA 3G6MA 4CD8A 2X0HA 3MUY1 4JFSA 4LPCA 3E1F1 1GOKA 3SEPA 4PMVA 2G3JA 2XFRA 2YDRA 2JF7A 3VO0A 3PTKA 3WELA 1KCKA 2UY3A 1VJZA 4PCTA 4TVDA 3SCPA 1JAKA 3WEMA 2XM2A 1CDGA 2E8YA 4CN1A 1OINA 3GXIA 1H3GA 1GQIA 1M04A 2J7FA 3WNKA 1GOOA 4UQEA 1PIFA 1XSIA 3W82A 1PX8A 1WZKA 4R27A 3IJ8A 1UD8A 2VCAA 5C8BB 1XV8A 2WVVB 1HL8A 3ZT5A 2E9MA 3QOKA 1BGGA 4MADA 5BXSA 4P7OA 3UERA 3RIKA 1HKKA 1H0GA 1G0CA 1F4AA 4BQ2A 4J7RA 1QNQA 4GI6A 5DMYA 2BY2A 2J7DA 5EFFA 4FF5A 1XH0A 3AQUA 1M7XA 1OGBA 1DWAM 1J11A 4H8VA 3AHXA 2BY0A 2WMKA 4LGXA 3QHNA 4AC1X 1E5NA 1VFFA 1QHZA 3WF4A 2CETA 1CLVA 5DEZA 4TVCA 2DH2A 4PN2A 2XYLA 5DFAA 1XCWA 4D6DA 1A3HA 1TUXA 1VEOA 4QAWA 2WVSA 1HP4A 4PSRA 2QMJA 2WBKA 1JG9A 2RGMA 1ZJAA 2CITA 2W66A 4HU0A 4HTYA 1DWFM 4WK9A 1UD5A 4EK7A 4H41A 5EB8A 1WE5A 4B9YA 2J8GA 3AXXA 1K9DA 4JKLA 2D3NA 1HN1A 1CGYA 1ISWA 1KXHA 3EMQA 1IV8A 4F9JA 2ZE0A 3DYMA 3L2LA 1LL7A 1EGZA 1HJVA 3HN3A 3VINA 4OZOA 1WDQA 1KBKA 1B0IA 3W27A 4AZGA 1EOMA 4XZBA 1MYRA 2ZX9A 3BAKA 4AD1A 3AYRA 4J3UA 4KRUA 5A2CA 5I6SA 2CKRA 4J3VA 2DQXA 2EBNA 2XWEA 1KWKA 1M03A 2CXGA 4PMYA 2YBTA 3AIUA 3BH4A 1RD6A 4JCMA 4K68A 1H4PA 1JYNA 1GOWA 3BMVA 5FD0A 2D3LA 1GJWA 3SUWA 5I3DA 1K6AA 2PWFA 4M82A 5LA2A 1AQMA 4JHZA 4IPLA 4LX4A 4ZEPA 2XJ7A 1OGGA 3RM4A 1XC6A 5FOOA 4CU8A 3M7SA 1DWGM 1NM9A 3FW6A 2F2HA 1EXPA 1UZ4A 2ZWYA 4WLCA 4AD4A 2VOTA 3UEQA 3VDAA 5BWFA 3ARYA 3WH6A 3WBEA 2DGAA 1SR0A 2WB5A 3WD3A 3PZ9A 3KL5A 4D6GA 3ARPA 3NSNA 2O9PA 5M5DA 4AYSA 2VZOA 4WF7A 3NSMA 1LF1A 1JYXA 1PX4A 3CH9A 4U33A 2ZX5A 4UZSA 2V38A 2XGIA 1QI0A 3CHEA 3PZNA 4LYRA 2WM0A 4JKKA 3WENA 4HOZA 1R87A 1JI2A 1JXJA 1UHVA 2XIIA 1V08A 1LWJA 1B3YA 1CECA 1CXFA 3WDJA 3JUGA 1DTUA 1E15A 5CGTA 3VD7A 1X6NA 1XD1A 1V0LA 2WYSA 2WMIA 3NDZA 3CHCA 3NYDA 5JBEA 2FGZA 1OCQA 2FDMA 1U33A 2BVTA 5IFTA 4CD6A 4ML4A 3SUTA 5DT7A 3FXYA 1KFWA 1OD0A 1HIZA 2DEPA 2F8QA 3PZTA 2V3FA 1ZBWA 3WDQA 2PC8A 3VD5A 2J8FA 3F5LA 3BAXA 3N13A 4AXNA 1V3KA 4OBSA 5A6KA 2W92A 2WW5A 2OWCA 1V3JA 2WK2A 1L0PA 1E4IA 4BQ5A 1SFSA 1QHOA 1E73M 5CG0A 1EA9C 4IISA 1V6VA 2CERA 4YN5A 2WKGA 5BRPA 3ZM8A 1ZBVA 3WD2A 2OYKA 3VIGA 2GJRA 4PTXA 3A4XA 1GQJA 1WPCA 1KXTA 1WZMA 4XB3A 1UWIA 3WDRA 1FFQA 3ZMRA 2VZSA 4U3CA 1JD9A 2Z1KA 3PZUA 1QI4A 1MVYA 2GJXA 3CZGA 2VZUA 1GPFA 1E5JA 3BMWA 2VT0A 1PZ3A 3W37A 1J0ZA 4J27A 2YLAA 1GQLA 3VGHA 5A6BD 4TXEA 1QW9A 5CQ1A 2BHYA 3IANA 3VM7A 3L4WA 3ZO9A 2WSKA 3CUIA 4AZBA 1PPIA 1J0HA 4L4OA 4HA4A 1JNEA 4JFVA 4AY1A 1R85A 2W5FA 2ZX7A 2EEXA 3AICA 4P7QA 1Q4NX 2WHMA 1QNOA 3EDDA 2E3ZA 3UCQA 1DWJM 3WD1A 4H04A 3IJ7A 4H2CA 2B31A 4RE2A 3MV11 3NCOA 4FLSA 1VEMA 4DWSB 1E6RA 4PMXA 3AIQA 1CXIA 2VR4A 1C8YA 3AHYA 3CGTA 1XYZA 3EBVA 5HNNA 4QCEA 5M3WA
chains in the Genus database with same CATH superfamily
3T0TA 1XIMA 3V5OA 4MZ1A 3VNYA 4X63A 4CD4A 3N4EA 2E28A 3XIMA 2WNQA 3S2NA 3TYZA 2YDQA 2IS7A 1SMAA 5BXTA 4ZSUA 1IYXA 4JTTA 4KQNA 3WJSA 5C6MA 2ISSA 2GQ3A 3GHUA 2VFIA 3CHDA 2C8NA 3BDKA 1MQQA 3WQ5A 1H60A 1FHUA 4CGTA 1TO3A 4JHMA 3LENA 3ARTA 1MUMA 1E0VA 4GC4A 1UPPA 3WF0A 4PMDA 3C0SA 4CD5A 1S2VA 2PURA 3W7LA 3MSRA 2H3DA 3LSCA 2VC7A 1P0EA 1W3IA 4MHBA 3ZSSA 2ZXDA 1US0A 4B90A 2CLFA 1ME7A 1OEPA 1OT2A 1TELA 2PRMA 2BS9A 2XVLA 1R9XA 3SZ8A 2WSYA 3A4AA 3URBA 4M1BA 4C7DA 1MDRA 1GK8A 3LHYA 4D72A 2CZ5A 5LZLA 2D69A 3APYA 2FFCA 1R86A 3S0CA 1HO1A 1W9DM 4GO9A 3W1AA 4LUSB 3KVMA 3NWRA 1OFEA 3QLDA 3H70A 4O17A 4IF2A 4RXFA 1VIWA 2QCFA 4MNLA 4W9TA 5EBUA 1QFEA 1IIGA 1ZBCA 2G3NA 3U5YA 1SO4A 4Q7IA 1TMQA 2OT1A 1EC7A 3CPRA 3N29A 2NSXA 3OB8A 3DFPA 3TJXA 1X7FA 4MWAC 3CT2A 4XWUA 2X0SA 3TX9A 1HX0A 1OCJA 3W7QA 3G1VA 4DJDC 7ENLA 4PE8A 2XN2A 3P5YA 3LPPA 4ZB5A 1JZ2A 3NQ6A 2DZUA 1PTAA 2Z2AA 3KBJA 1PCKA 1GOQA 4AVNA 1SR9A 2XISA 2PDQA 4N9BA 1EDTA 4GZEA 3L2IA 4PCFA 1KLYA 1NDYA 4MJ2A 4HNNA 3TC6A 1WNOA 1X6LA 3EX1A 3ABRA 1P0BA 2E9BA 5T91A 4LYPA 3DYOA 3WQEA 3GBDA 3UZWA 1HF6A 3LPFA 5D32A 2GSEA 1I2NA 3DCPA 3S1XA 3C61A 9CGTA 3OQ8A 1WZAA 3AC0A 2GJNA 3OZOA 1RH9A 2AKZA 2JK2A 3SIZA 1UKPA 3VOHA 1IQ8A 4ZO9A 3UETA 3ABSA 2PWDA 4MDPA 1C91A 3C2YA 4HCHA 1EP3A 2QAPA 5LNSA 1J0YA 3DFOA 4Z0SA 4FALA 1B3VA 5HINA 5CBJA 2CBVA 2VQTA 2CBUA 3GR4A 3SCSA 4IXXA 3PFMA 3PZIA 4A2SA 1BQGA 2CZEA 2YA2A 5T9BG 5EKYA 1A49A 1NF0A 1HG3A 3KCOA 3C6CA 3MANA 2CKSA 3P67A 5AZ1A 4JIEA 1EQPA 3N11A 3IPWA 3O7UA 2PTXA 3WQPA 1WDRA 2J88A 3OYZA 1KM4A 4GUHA 3RUBL 1E51A 3CUFA 1ZB5A 4IGNA 4GQ0A 4F2UA 1OFDA 4Q8MA 4H00A 2DZPA 3UR5A 1YLVA 4A3HA 3DKLA 2X05A 2A3CA 2A2IA 1HKWA 5E9XA 3MMDA 3S5YA 5JIPA 2PU0A 5D38A 3R0KA 1BYAA 3W4RA 4AD5A 3WFZA 3BAJA 4AIOA 4GIYA 1HL9A 1CXEA 2QCDB 4MY8A 1TREA 3HB9A 1UWUA 4JGDA 4WR3A 1LLOA 4ROPA 3ZR6A 3SGZA 3MUXA 4JFWA 4D6FA 2F6XA 4OBTA 1W9UA 1E3ZA 4L9XA 2BVDA 3CC1A 3WF3A 5CLWA 1UC4A 4V1XA 4UR9A 2OR2A 1EYWA 4R7WA 4UFJA 1UR8A 4UNLA 3HJEA 3OBKA 4RR4A 3SCUA 3SN1A 2YBUA 4LNYA 1UKSA 3ZWSA 4QG6A 2I5GA 3KUMA 3S2JA 1N8FA 2AMGA 5AVNA 3IGXA 3F4VA 2C1HA 4U5IA 1KXVA 4FX6M 3WK1A 4AXKA 3GXFA 3EA1A 3VGFA 4MNJA 2PWVA 3L66A 3WJWA 1NIUA 3URAA 3RLUA 6PTDA 1U2YA 1Q6GA 4ACZB 1FWAC 1RCQA 2VI0A 4P8XA 1M7OA 4ZXOA 3MI6A 2PWUA 2X16A 3BAIA 3ABQA 3LA4A 3JZUA 1AFSA 3GTFA 1DJWA 3VMOA 1IWPA 1OBAA 3IIOA 1TWZA 4AYGA 3RG6A 4ZFMA 1KR1A 5E93A 1EEPA 5ECVA 3R25A 5DRIA 4G7EB 4MMWA 4X60A 3B8VA 3WJZA 3H4GA 4ZMGA 4ZB2A 2GSJA 2OQHA 1Z8AA 5I23A 5KINA 1BEUA 4LAOA 1W3JA 4IIGA 3MUAA 1QNVA 3GQYA 3VNZA 3O6CA 5JU6A 3OGSA 3LXAA 3T42A 2ACUA 2V9DA 1QXLA 2DVTA 3FJ6A 3AXMA 1XG3A 5GPRA 3TN4A 4Y6GA 1F9CA 1Q8AA 1QJWA 1UMYA 6ALDA 3M0YA 1DORA 3DHPA 1UA7A 3MBFA 5G1MA 4LYKA 3OLDA 1RK5A 2HWGA 1OHLA 2WLZA 3R12A 3VOCA 1V3IA 3AMDA 1H7XA 4F8XA 3JS3A 4IJRA 2YZRA 4G56A 4Q4SA 3PBVA 1AZ1A 3UWQA 4DZ5A 4YVXA 6CGTA 3DBNA 3BSHA 1ODZA 1EWEA 3K1GA 3MUIA 4BKNA 1BFNA 2XGBA 1I8JA 3ONBA 4Z2JA 1YE6A 2AMXA 4XV0A 4W8LA 4DB7A 4FNQA 3VGBA 2A6NA 3VD4A 1CTNA 1W1TA 4HU4A 2QUTA 4Z1DA 3OHIA 1XBYA 4KS0A 1P7TA 1T0OA 3DBPA 3W74A 5LHFA 3WK2A 4DXXA 2F61A 4QIUA 1LG1A 4WDTA 1F3XA 3TYBA 3T78A 5MKGB 4DY1A 4DI9A 2VFHA 3L9CA 2P1FA 5FKYA 4GUFA 5A1AA 3ARUA 2PWHA 2QJIA 3UZJA 1DIDA 2ZZ6A 4GK8A 2OSWA 2YPIA 4Q8WA 5ENLA 1XICA 1BSLA 3AS1A 1OFOA 3BVJA 4GBDA 4KRZA 3IVTA 3JW7A 1BSIA 3O0KA 4H9VA 2XZ7A 4C5ZA 3W01A 4IFKB 3CUZA 2VCCA 3H21A 3NYZA 4PMNA 1BWKA 2QZRA 5XINA 5IXEA 3LCHA 1J0IA 1CENA 2A3BA 1RY0A 4W8AA 3S83A 2BVWA 1TJPA 2YL8A 1DQXA 4J28A 3P2VA 4R9XA 3GW0A 4WDUA 1MXGA 2CHOA 4TX8A 4L5ZA 2TMDA 5BZAA 4DM1A 1T40A 1VFOA 1BYDA 3R0DA 5M2FX 1H62A 4AEEA 4B16A 2D0FA 3CU2A 4CKQA 4Y9NA 3TR9A 2BGQA 1BYBA 4LCRA 3MMWA 2FZMA 3OA5A 3FGCB 3GC2A 3ZSTA 2Y4SA 3PULA 4QBXA 4LVBA 3GRIA 3GO2A 4QLLA 5CPTA 2QYGA 3LNPA 2C3ZA 3GAYA 2BXYA 2W0UA 1JCYA 2PP1A 4FAMA 3CUGA 2WAGA 1EEXA 3PPFA 3VGEA 1WDSA 2QF8A 1U5JA 2VGIA 2ZZ2A 1ENUA 4MWAE 1R6WA 2GVEA 1EH9A 5LNWA 1XIHA 2YA1A 2G3FA 1F5ZA 5C9WA 3LERA 4W7WA 3NZPA 4R33A 3VE9A 3CTTA 2WMIB 2Y8KA 1DIKA 1OQFA 3EDKA 1J96A 5DXXA 5FL0A 3TV8A 1H7RA 3U4AA 1VPQA 2D1ZA 3MO7A 2EJ1A 1RY8A 1K7FA 3O6AA 2CU0A 4EP8C 4DJEA 4IZGA 4LS0A 3P80A 3W1UA 5FEZA 4RZ4A 4UBPC 3K4DA 3N3TA 2BGNE 2QR6A 5F2LA 3WNNA 2YXOA 3FJNA 4YXGA 5LXEA 1KM2A 4JDYA 3SY5A 2HPMA 5E0FA 3H24A 4E2VA 1QPKA 2PAJA 3TFCA 4IP4A 3M5YA 3LM3A 4K8EA 3B8SA 3P82A 3QW3A 4UOJA 3VFLA 1OYBA 3LMZA 3B9EA 3AXKA 4K38A 1TIWA 1N8IA 2WCGA 4D6IA 4WY0B 4BEUA 3CMFA 3L5LA 3SECA 1I0BA 5EPDA 3PUDA 4R88A 1JQXA 3WYZA 4DO5A 5DMLA 4RV8A 5FL1A 2Q3RA 2CEQA 2VD9A 2CZFA 4GYFA 3MCNA 3FHAA 2FJUB 1WX0A 1V0MA 3PHAA 5FIPA 5GNZA 1OF6A 4HNVA 5K4XA 1M6JA 1ZAJA 2HCVA 2WZTA 2E4TA 2V67A 3EYPA 5A8MA 1FH9A 4NF7A 2D0HA 3V0UA 2A21A 5K9DA 2FGBA 5H6HA 5DO8A 1WB0A 3KL3A 3ARXA 2PD5A 3RO8A 1A5OC 4MB5A 4RE4A 2QCEA 2FHBA 4AEFA 4H19A 1BTMA 2Z1VA 2XH4A 3SI9A 3BLDA 3LOTA 1D7FA 1E9YB 1D3GA 1SGJA 3IAPA 3GTXA 4CNPA 3VM5A 3BJTA 3ES8A 4NJJA 4TR9A 4M29A 2D2OA 4GHRA 3TWAA 5KSWA 2ZUMA 3TYUA 2AAMA 1YYAA 3SGUA 2WO5A 4GCXA 1SYTA 3ABZA 4XQ6A 3N15A 3TW9A 1E6NA 3HFYA 5BRQA 4UTTC 1Q3NA 4B15A 2GOUA 2GWNA 1E4NA 1H61A 1GVEA 7A3HA 1V77A 3QY7A 5H91A 1Q7MA 3GG0A 1QTWA 3JR2A 4HPHA 3S9ZA 4MWAA 2PGEA 4AF0A 5EBAA 3EWZA 4PMRA 2NSOA 1NWRA 3WLHA 1S2AA 3IUHA 3G22A 2ACRA 1HJWA 3U2ZA 3VD3A 4PEKA 3OLIA 4X3ZA 3EX3A 4PL2A 1XYCA 4DJDA 1LZOA 1OC6A 1W3KA 4K7YA 3WN6A 3VMNA 2CPUA 5K3VA 1TJRA 3PVFA 1MRQA 1KM3A 2NQHA 2NQ9A 9RUBA 1XYLA 2KX9A 3BANA 4ERAA 4LEQA 1JZ3A 3E2RA 2DT1A 3E2VA 4OV4A 3P62A 4U4MA 2BODX 3A12A 2J6VA 4V28A 1UJQA 1WQ5A 2PFHA 4WJXA 4UQAA 3PJWA 3P8IA 5LIKX 4LB3A 4H6KA 1MI3A 4QRNA 4UQBA 3UG5A 4GQRA 1LQ2A 5ABFA 1TVNA 1SU5A 4W87A 5AYBA 4GE8A 1FP9A 3WFAA 3ATZA 2DT3A 1OC5A 1X7IA 5IRPA 2YB4A 2ALRA 1A5BA 1J18A 3L4UA 3FXGA 4JTGA 1UUMA 5CC6A 1XLAA 1J2WA 1QW7A 2XVPA 3F2DA 1TV8A 5JMUA 4JTRA 1E4LA 4KEUA 1UD6A 1JL8A 1K4HA 2FH6A 3S5SA 4GABA 1E72M 3UWWA 3AOFA 3L4YA 4FOJA 4C6LA 3QSTA 3G77A 1ISYA 3CHVA 1HKIA 5FF3A 1BXNA 2G5WA 1XRTA 4REQB 4YYFA 3EWUA 4C91A 3K2GA 3P0XA 1F3WA 1PCWA 2FZDA 4JTUA 2PP3A 4IP7A 2DIEA 1ZENA 4UCFA 1H51A 1JUBA 3L4VA 1V03A 1LT7A 1E70M 3K1DA 3MP4A 4XIMA 1QOPA 4O1AA 3GUGA 4PBGA 1TA3A 2RJHA 4TUFA 4O1FA 3W29A 3WLOA 3GNOA 5F2IA 4JHOA 3IUIA 3LRMA 3ZZ1A 3FS2A 3UP8A 3D3FA 2OQLA 3BW4A 1XRFA 1O12A 2W79A 4BEQA 5FF4A 3OZPA 4JS3A 3ES7A 4B4FA 3U6WA 2WMJA 3B0YA 3BCDA 1IT0A 3NXFA 5HXMA 1Z7AA 1I4NA 2VRJA 1ME8A 3WF1A 4XD6A 2G37A 1UP2A 3RPMA 4CQ9A 1RALA 4QFUA 2ZUVA 4Y9PA 1EB3A 4HMCA 3VGGA 4XD5A 3CZ8A 2GJPA 3OVRA 3W88A 3B0VC 3GXNA 4LS1A 1QATA 3ARWA 2GGIA 2A3AA 3NIYA 3L12A 3ITOA 3SJNA 3SY1A 3QGAC 5A6TC 3WBAA 2H90A 3KRZA 5HDRA 1LJYA 3B3DA 5FCZA 1B4KA 3R43A 4IWWA 4K1WA 3WL0A 3KVLA 3CAVA 3GS6A 1RAKA 3PFRA 4ADTA 2J4GA 1P48A 4LBRA 4F2BA 1CB7B 2OOFA 3V0SA 2TRSA 3JRKA 3SUUA 1SPQA 1B31A 2GK1B 1CT5A 3KCLA 5D30A 2V5BA 1IEQA 3LS9A 5M17A 2P76A 2ZXAA 4BF5A 3TVAA 1TCDA 7PTDA 3QHMA 1GVIA 4CQBA 4A35A 3ERPA 3O6YX 2WHJA 3HO8A 4MAZA 3R6IA 4ZTXA 1T96A 3MY9A 1H1NA 3W7IA 1XGDA 1VH7A 2F84A 1PV8A 4C6DA 2RDUA 3ANYA 3AHZA 2GFTA 2UY2A 2V6AA 4EVZA 2XTKA 4UTWC 3SURA 1ISZA 4FLQA 4AD2A 4JIIX 3IACA 2NUWA 2ANUA 2WBGA 2UV8G 3VIOA 4HK5A 2EAWA 4EXBA 3WQOA 4R9OA 4N4PA 2DIJA 3BV7A 4NASA 1NQKA 3A9BA 3ZR5A 5BROA 2L5HA 2Y7EA 3HZ3A 3UESA 1SZNA 2PLCA 4PMOA 1U83A 4JTKA 2DZWA 5KEZA 4M5PA 2Z4GA 4QLJA 3A47A 3Q37A 3NO3A 2VWSA 3U5UA 3HGJA 1YXCA 1DXIA 4KIRA 5CSUA 1UIOA 3BCFA 2DVUA 1SO6A 1NEYA 2Z7KA 1UC5A 3BLLA 4A3QA 1ML1A 1YIXA 4ONVA 3GBEA 1WUFA 2WXDM 4RL3A 3ITYA 4NZ5A 4C6PA 4ACYA 1FP8A 3VFCA 3I3BA 5MHBA 1K9TA 3WNPA 1MNZA 3KDOA 3EDJA 1ZAIA 4I5UA 1TPVA 4B5TA 3IJ9A 4R34A 3WLKX 5I06A 2OVLA 4YCOA 1CXLA 3GFYA 5D2TA 3CNYA 5E09A 1XSJA 3FX4A 4CU7A 4GMEA 1LOLA 3VNKA 3UPMA 4MAVA 3BTNA 1VEPA 3SM0A 4MGGA 1J10A 4XKMA 3ORWA 1YBQB 4EX4A 2ZQ0A 1CYGA 3QGVA 5A6SA 1GVSA 4RDVA 5CH9A 4JX4A 1NWUA 1XUUA 2OYMA 3EWXA 1GEQA 1ADDA 4GINA 2FVLA 3BXWA 2NLYA 3FCPA 2Z6JA 4NAFB 3Q58A 1CGVA 1K8XA 4FNRA 4AU0A 2VNCA 4DPPA 3SADA 3GK0A 4XZWA 5KMYA 4DUVA 1G1YA 3B40A 3WNLA 3G8EA 2IXUA 4JYFA 3UCDA 1G67A 1W5PA 1KFJA 1K03A 2WCSA 5HNTA 4Q8VA 3FEMA 3IIPA 3B4YA 1MQRA 3RCNA 1JYWA 4IXHA 3AIEA 2YDSA 1FHLA 5FA5A 1K3UA 2BXVA 3O15A 2Y5EA 3PK7A 3HQNA 3SIMA 2VHLA 1DXFA 1TQJA 4I6KA 3E0LA 3HPAA 4GUIA 4DO4A 4YVVA 1K77A 1B4EA 1UR2A 3IVUA 1A80A 1EUNA 1VPXA 4JIPA 3VU2A 2Y85A 2POZA 1IZCA 4Z08A 4JFSA 3LG3A 2PDBA 3IJLA 1GVOA 1L6WA 4N7QA 4GQBA 4FIRA 2XFRA 2JF7A 4DXVA 1KCKA 2UY3A 3SCPA 4CNTA 3AWNA 1CDGA 1GKQA 3GXIA 1H3GA 1EL3A 3M0HA 5HWJA 4UQEA 3G5EA 5FF7A 3PNUA 3UWYA 1XSIA 3UZZA 1U5HA 2DZTA 2FFIA 1UD8A 3LQGA 5C8BB 1NY1A 1B54A 3UR2A 3FYOA 4UMAA 3K5XA 2ZRUA 5TQLA 1JDEA 1BGGA 1HKKA 1E0UA 1ONRA 5KTLA 1K1DA 4QXIA 1BRLB 2Y0FA 4O0ZA 3MCOA 4BQ2A 4J7RA 1RUSA 5DMYA 3THUA 4FF5A 1QWKA 4BWLC 4HQVA 1DWAM 3NO1A 1ONWA 4QE5A 1ZZMA 5AYXA 3ITVA 3USBA 1E5NA 4OE7A 5HQMA 2DH2A 3KOYA 3PAJA 4PN2A 3LXBA 3MHUA 4S2BA 2C91A 4D6DA 3KBWA 1A3HA 2ZADA 3DN5A 4YVPA 1A3WA 1IR2A 4KESA 2CITA 3PAOA 4C1LA 1AA1B 5EB8A 1AZ2A 2LLEA 4RZ5A 1VS1A 2J8GA 1JPDX 4WGHA 3M1ZA 1CGYA 2ADAA 1PKNA 4DWDA 4F9JA 4HN4A 1SFTA 1Q6OA 2DY3A 4R7JA 3DYMA 2NVDA 4QEHA 1SW0A 1WDQA 1LLZA 3A22A 1EOMA 4A8IA 3LRKA 2J9ZA 2V81A 2HVNA 2VFFA 3OVQA 2YW4A 3AYRA 3CTLA 4O0KA 5I6SA 3R7MA 3QVQA 4JTFA 2DQXA 4GNVA 1KWKA 3OZYA 4Y96A 4E3TA 4Q8UA 3RLHA 3PB0A 3VOJA 3AIUA 5JVLA 1RD6A 4JCMA 3B8UA 4K68A 4L6OA 1JYNA 4LUYA 5G4EA 3W9ZA 1GTEA 3EB3A 2D3LA 3LHTA 1GJWA 1YE4A 4PH6A 1AQMA 1GYMA 4JHZA 4QJ5B 3W75A 3RM4A 1XC6A 1TWIA 4E6MA 3H6OA 2XIOA 1FCBA 1DWGM 4Q4KA 1BXCA 1S39A 3BQ6A 3VDAA 3ARYA 3H7VA 3TWBA 1PHWA 2WB5A 4QSFA 2X2GA 3C8NA 3ARPA 2QT3A 1PTGA 3T7VA 5M5DA 3M0IA 5HR7A 3FDKA 4WF7A 1LF1A 2F2KA 4GH3A 1EJVC 1JYXA 2V38A 2NX1A 3PZNA 2WM0A 3CEPA 4H6RA 4LC6A 4HOZA 2PODA 5LNUA 4OGZA 3LHZA 1CXFA 3SAZA 4LF1A 1DTUA 3VD7A 2DP3A 1XD1A 3URQA 3UJSA 3CHCA 3WLPA 1OCQA 3R79A 1U33A 3UG8A 2BVTA 4LUSA 3SUTA 2G95A 5K9CA 4XKYB 3QF0A 2YCJA 5DT7A 1KFWA 2J9XA 1R3SA 1HIZA 2F8QA 3G1AA 1CX9A 4C6IA 1ZBWA 2ZC8A 5BNKA 1P0NA 1DJNA 4RPQA 1V3KA 2J6XA 2W92A 1MSSA 3UXIA 3TJLA 1FDYA 2VXNA 2WW5A 1V3JA 2WK2A 1L0PA 2GGGA 4H9XA 1H7OA 1SFSA 2WKJA 4ZO6A 4JIHA 1EC8A 1V6VA 3STPA 5BRPA 3FKRA 3ZM8A 3DFSA 1OG0A 4BHYA 2GJRA 3FLUA 1WPCA 4LCSA 3QJAA 4GVHA 1UWIA 1FFQA 5L6UA 5XIMA 3UXKA 4U3CA 2A79A 2QUMA 2QCCA 3PC0A 1GPFA 1E5JA 2R94A 3N25A 4J27A 1ZFJA 2YLAA 4TXEA 1L6GA 3SRKA 4AZBA 1PPIA 3NM3A 2ZCGA 4DO6A 4DXKA 3PB2A 4GYPC 4AY1A 2G0WA 2ZX7A 3OA3A 4IICA 1GGOA 4P7QA 4B5NA 3ABXA 2PDYA 1W54A 2E3ZA 4XZ9A 1W3TA 3HPXA 3W3OA 2W6RA 3VCRA 4FLSA 4IMAA 1UZDA 4AX6A 1CXIA 3AHYA 2PDXA 3CGTA 3E2SA 1BKHA 4HBKA 4QCEA 3NL3A 2OWXA 2XN1A 4XZLX 4V33A 1ZGDA 3H54A 4GFSA 2OFJA 5D05A 4MM1A 4V2XA 3KDNA 3UWZA 3N2BA 3BC9A 1I45A 3MP3A 4QJ3B 3JVAA 2VEKA 3R8HA 1KA9F 2W9MA 3B0XA 2FJKA 1XPGA 4FNPA 2ZXQA 1Q6EA 3W85A 2XINA 2WV8A 3VIIA 3C0QA 4O13A 4F9DA 1V0NA 1CW2A 3DHDA 1GUVA 2CLEA 1ZQ5A 3V35A 5EMUA 3OLGA 3VKDA 2R1NA 4IQEA 4XG1A 1UBSA 2CBJA 4LXFA 4PRTA 1H09A 3B8TA 3T4WA 1AK5A 2V3EA 2VWTA 1HJXA 3AXHA 2NVAA 4LRSA 4NX5A 2FZ8A 5AY7A 3QN3A 4IG2B 1IZJA 3KW3A 4HGXA 3CZKA 3TJ4A 2Y2WA 1H1YA 5GJMA 3SDOA 1JZ7A 2QCDA 4ERIA 1QI2A 2DW6A 3MWAA 3TE9A 4ROQA 4DRSA 2PU1A 3GNPA 1BHGA 3NQ7A 3IUDA 5IBXC 3APGA 3CASA 4B2DD 1W9PA 2BWGA 1U1HA 1XKYA 3F1QA 4IIDA 1XI3A 1VBHA 1K8ZA 3EDFA 1C3FA 3S6TA 3A13A 1VCVA 3SN0A 4GACA 1QI3A 2PDCA 3WUGA 1FWBC 1US2A 2INZA 1VC4A 4LH8A 4IIHA 4KCWA 4HHPA 3MW7A 5AVHA 4AC7C 3MMTA 4PBEA 2VRKA 8CGTA 1UH2A 1OFRA 4BY3A 3VCNA 1EPXA 3UVAA 4Z2KA 4UTWA 1EBGA 1MEIA 5CGMA 2Y5JA 3T2QA 4WKHA 4RNFA 3NQEA 3SCOA 5CZ0A 1LWIA 1JCXA 4E8CA 3EPOA 1B3OA 2VMFA 3PTQA 3CAKA 3A24A 4ACZA 1HKVA 1NH6A 1JZ8A 1CLXA 4AD0A 1AD4A 4GO8A 2FKPA 3KS5A 3PPHA 4JPGA 4J3ZA 1WZLA 4GNKB 2XVGA 2D2GA 1A5CA 2WC7A 4XVDA 4ZOBA 4BCEA 3DGBA 4UTKA 2BHZA 1AH0A 2PDFA 3AUOA 2NQLA 4H6QA 1RPXA 1TVLA 4G7EA 3R1ZA 3WJYA 5A5WA 3V0TA 1PEZA 1RBAA 5D04C 1RQEA 4CQDA 2WSPA 3CT7A 3T0AA 5C0QA 3N2TA 4MB1A 1LP6A 2GUUA 3GNXA 4HA1A 3RAOA 3QR3A 3BMXA 4HYVA 3N9RA 3ZIZA 2YDAA 3C0LA 3VPLA 2ZWZA 4NZFA 3CHFA 2DFAA 1Y7VA 5A95A 4GUGA 2EG6A 4AMAA 2HVMA 2J7CA 3TTEA 3E0FA 2BY1A 2DZBA 1WP6A 2CCRA 2A4AA 4Q6XA 1U5VA 4GJ1A 1Z6KA 3H2FA 4L7ZA 4JL2A 3W7NA 3U0HA 4FPSA 3W7HA 3VOGA 2O56A 3PP7A 3P6LA 3K4WA 2F6UA 1IR1A 3APTA 1B1YA 1GW9A 2RUSA 1NP0A 3ZOAA 2CFFA 1W3NA 3QM3A 4S3KA 3S2CA 2ABAA 2DUAA 3UWVA 1UB3A 3M47A 3W00A 4XZIA 5DT5A 2PGWA 3WLSA 2QS8A 3PUEA 5CPNA 3TDFA 3QYSA 2QV4A 2E5CA 5F2GA 1C7TA 2EGZA 4MKVA 2A0NA 4XAFA 3HQPA 1L6YA 4A05A 3VMPA 1RJQA 1TCMA 2V5CA 5M1TA 3UXLA 4ASTA 3KTSA 3WD4A 2O9RA 3USZA 3IIVA 1VFMA 2GUBA 1AW5A 2JALA 2OZ0A 1ICSA 1WBJA 2A3HA 1Q63A 1EJSC 3FV9A 4U10A 5BXRA 1EHNA 1X39A 1XRVA 1TB3A 1KO0A 1S5MA 3G8RA 2ZUWA 1OX4B 4DYJA 4LY8A 4Q22A 5FESA 1R47A 5H8PA 4H9YA 4Y9AA 2P0OA 5HJYA 3DKJA 1XLBA 3GIPA 1WAUA 7CGTA 3FEQA 5I78A 1QK0A 3TMLA 4ATDA 1B9BA 2VQUA 5A8PA 1IWBA 3AROA 4F66A 1XG4A 1L6SA 1YADA 4MDOA 3T55A 4NJIA 1JCTA 3EOEA 4MZ8A 5AC7A 5C54A 4DUOA 3IV8A 4JAWA 1JNDA 3F4WA 4GVGA 3EKZA 1E0XA 4LAUA 2NW0A 1C9WA 1CGUA 2E77A 1ZHAA 4EWND 1Q6LA 3DU0A 3FGCA 4UQCA 5EL1A 4CNNA 2R1LA 1W6TA 4KMQA 2DZVA 2O4MA 2D20A 2GDVA 1RLCL 3E96A 2PZNA 1L8NA 5I3KA 2Z6IA 3O1NA 3EPMA 2ASHA 2PRHA 3FA4A 1EBHA 1V6XA 2ZKMX 1Z44A 5BW6A 3OBEA 3UYCA 3W6MA 4BWLA 1YKWA 3W7PA 1XIGA 3R2GA 4E2OA 3PZOA 2OEMA 3CL7A 2HZGA 5D9NA 4M80A 4GZIA 4HJWA 1S1RA 3NEHA 4A2RA 3UQNA 4HMDA 3QW4B 5HK4A 5HR6A 4EF9A 2WQPA 4DAIA 1FXPA 4GFIA 1E6QM 1KRCC 3A4JA 3RNDA 4FSAA 3QTGA 1XLIA 1JRCA 1TV7A 2J7GA 1UKQA 1UOKA 1VYPX 4PMQA 4Z1BA 5ABHA 1C8XA 2JE8A 3MQTA 4YHEA 4NG3A 3T9PA 1A47A 8XIAA 5E9AA 3OVPA 3LCXA 3GG8A 4EPKA 1US3A 2VEPA 1DIOA 3GVRA 3QR0A 4L65A 3POCA 3LBOA 2D0GA 2YA0A 4Y2WA 1QASA 4WY0A 2IPJA 4GJJA 4HPGA 2VC9A 4MYAA 5CPLA 1FBAA 4XAGA 1J5SA 3U2OA 3EEGA 2VX4A 3MO4A 3RM9A 3SCQA 1E56A 5EMYA 5IDIA 1EP2A 1KXQA 2XVKA 3WH9A 3VKJA 2ZIDA 1JDFA 2BHUA 4PGLA 4L1WA 2D22A 3DG6A 2PDWA 2Q02A 1FWRA 2QDEA 3BE7A 3GFXA 4JFTA 3AZTA 1G01A 3SSJA 3LXCA 3SCNA 2FPYA 4PC8A 1FVPA 1X96A 1F73A 3BG9A 5AHIA 3UG3A 4FHAA 4M6UA 5E1QA 2VEMA 4NRSA 3KS6A 2QCMA 1WXZA 3TJIA 3CZJA 1P0KA 3H26A 1CGXA 2YL5A 3EWCA 4HK6A 4IL0A 1IF2A 2GOKA 5TNVA 3BG5A 5I03A 5LXXA 4V1YA 2DU2A 4K6AA 1BYCA 3NPUA 4XUGA 4IJBA 3LV5A 3W1XA 4S3CA 1ITCA 3PS7A 3VDGA 5REQA 3GU9A 3N2CA 1FQ0A 2NXHA 1LRNA 3NQDA 3O8AA 1XCFA 4IIEA 2X8RA 1QHPA 4Z1CA 3QZAA 4FR6A 3NPVA 1OB0A 5GJPA 3B4UA 2DW7A 2OODA 1EYEA 1EJ7L 3JZEA 1YDYA 3ZT6A 4GY0A 1DV7A 2AL2B 5AYIA 5C2GA 1Q7QA 2ZDRA 2SFPA 1JZ6A 2I9UA 4GVFA 2JEPA 1E3XA 1X38A 5D8WA 2VDGA 5HANA 4YTRA 4RZBA 2XIJA 2NUXA 4HB7A 3HPSA 3LHWA 1OVDA 5D2XA 2G3IA 3H2MA 1V02E 3AMKA 3MDUA 1D2KA 1XPYA 4H8HA 4EANA 1BTCA 4PZVA 1O6IA 3BO9A 4JCLA 1FCQA 2RDTA 3UJ2A 5E6ZA 5EU9A 2V68A 4P7NA 1TSIA 3T4CA 3W84A 1OF8A 2WZEA 4JQ3A 4QG9A 2XFYA 2VVNA 4J9JA 4UMBA 2ZZ4A 2QMKA 2WPBA 1GNXA 2ESCA 2IKIA 2V2CA 4AZIA 2GVYA 3A3WA 4U31A 5FAJA 1JFHA 2FMOA 3FK4A 4X2RA 1E1FA 4IPJA 5TAOA 3PTMA 4XSLA 4HNCA 1W3HA 1DVJA 3LCLA 4M8UA 5M03A 3N73A 3QV6A 2CLMA 1KTCA 1W56A 3UF9A 1EO7A 3GTNA 1VBUA 3U9IA 4N9EA 1EQCA 4N6EA 2Z1BA 1GHSA 4Z2GA 1FWNA 1M53A 3CPUA 1P43A 5C55A 3THDA 4CCEA 4EOUA 2X2YA 2I5IA 4XZHA 2JKEA 3VZXA 3WQWA 2FIQA 3UA3A 3PBGA 3ZJ8A 1OYCA 3T0BA 3TUUA 3VD9A 2P10A 5HQEA 3F4NA 1J9YA 2C15A 1PIGA 1VFSA 3BLIA 3PJTA 4IUOA 3T40A 4M81A 5DF0A 1BVZA 1PE1A 1R2SA 1XLHA 4W86A 4TX6A 1OADA 2G50A 2ZX6A 2DZXA 4ILSA 1LUCB 2NT0A 1H49A 4DNMA 1UR4A 2J8TA 5DLCA 1A3XA 2EPMX 4XX6A 4LAZA 1TZ7A 1ITXA 3UWUA 4UTUA 1UR3M 5C7HA 2Z27A 5SWUA 1HZYA 3GXMA 3DFYA 4GRSA 5D9PA 1V6TA 4QLKA 3M6DA 1IXOA 5IBXA 3TNBA 3NQ2A 3KTCA 5BU9A 2OQYA 5C70A 1GYLA 4Z17A 3C2EA 3D3AA 2V69A 4UB9A 1XBZA 1TPEA 3INPA 3CYVA 5HWMA 2VR2A 2VGFA 2CESA 4RNHA 1BG4A 2WSRA 4IPNB 2PI6A 4XZNX 4PBFA 4KFOA 1NFGA 3BUVA 4E4PA 1SM9A 3TU9A 3VNMA 2IW0A 4MPKA 3NVTA 4FF7A 3PJUA 3KZPA 3RX2A 4KFNA 2OLAA 1MW1A 1V02A 4US5D 4AW7A 5I79A 1FXQA 4HHHA 2OCZA 3C3UA 1IT8A 4GXPA 3WQ4A 1J93A 2A85A 3AWOA 3DYPA 3CB3A 2V2HA 1S2UA 5KZMA 5KZDA 1WDPA 4NI3A 5GQBA 3UJRA 1DJHA 4PTWA 1NELA 2QDDA 1C7SA 4WEVX 1WKEA 1GONA 1JD7A 4MOZA 4FXSA 3UGVA 4PSPA 4AZ5A 1AODA 1T6MA 1YQ2A 1M1BA 4JN7A 1KBIA 4IGSA 4QQUA 4O54A 4DBEA 2JFEX 4AZ6A 2QV5A 1JI1A 2WVTA 4X61A 1S5VA 4GH1A 3L4XA 3PBMA 3EGJA 1UWQA 2OZ3A 1G9HA 3LDVA 4JKMA 4L56A 3V16A 3FIGA 1FOBA 3WG6A 2TAAA 4PUEA 5BMXA 4HSOA 4I9AA 3VKCA 3AZSA 3WJXA 2ZYFA 3HG3A 3IRSA 1A4MA 4JNZA 4QX4A 2B7OA 3W7GA 3TSDA 1XLMA 4GVIA 2Z1SA 4ZFCA 3O9NA 3H2CA 3I3DA 2VL4A 1HJQA 3RF9A 3STEA 3VXGA 3O6DA 4S3JA 8TIMA 1GHRA 3U7VA 1O5KA 4AVFA 4B2DA 4XO7A 3TROA 4W8BA 1UG6A 4AIBA 4GOAA 4LBUA 3OIXA 2PWEA 1MDLA 3C2FA 2HXUA 1V6WA 3W22A 4B5WA 3Q2DA 4DJED 1G94A 2WNWA 2PPGA 4TTGA 3DG7A 4O19A 2PDLA 3RM8A 3OJGA 6XIMA 3TYDA 2Y7FA 2VEFA 1GZJA 1XDJA 2FHFA 5A6AA 1EDQA 1LTDA 4ZQPA 3QQ1A 4HCLA 2FHCA 1FWHC 2UY4A 4ZOAA 4AG0A 5I0DA 4O14A 3W72A 1KD0A 1EJUC 4ZENA 4UUIA 3XINA 1QDSA 1B5TA 1NFBA 2ZUTA 1ZU8A 3WLMA 4UNKA 3E12A 1XYFA 4IQLA 1S3TC 3EDEA 1JF5A 2HROA 3B0PA 2ZOXA 4O4VA 1PYMA 2NV2A 1F07A 1HNYA 3I6TA 4QNEA 3KEHA 1W1ZA 3CJPA 3E2QA 3DENA 4H01A 2G97A 3U8GA 4P61A 1Q13A 2E0PA 2XPKA 1LBMA 2Q8ZA 1PAMA 3GYCA 3C8FA 2ZRVA 3KRUA 1YNQA 4AIEA 4G5DA 2CHRA 4O1DA 3UR7A 1XDLA 1W8GA 3AYTA 1M68A 4DX3A 1Y5XA 2CXEA 3NQMA 4L1GA 4QS6A 1JDDA 4A8LA 1O4UA 4KW2A 3QPZA 5E70A 4Q4PA 4UTFA 2HMCA 2AOSA 1OT1A 1KFKA 4ZTYA 2GQ8A 1HKMA 4BJHA 1DHPA 1LL4A 3VABA 2VFEA 2NVCA 2NX3A 2V3DA 3T08A 2J9YA 3A3HA 1LBLA 4LWWA 2Y1HA 1WDDA 1O95A 1Q6CA 1QAPA 2PDPA 1OYAA 4DJEC 1CPUA 3KP1A 1GOXA 1E6SM 2FZBA 1TPH1 2AL1A 1VFUA 5D2YA 4NAEA 1NVMA 3V4BA 2EKGA 1R30A 3KAOA 3V1PA 3W2KA 4I9TA 2Y6ZA 3F2BA 3VIMA 4Z0JA 3TKFA 1RJPA 1E0WA 4NNAA 3VIHA 1YTEA 3KTXA 2GL5A 1R3VA 3P84A 1J6OA 3VOIA 2NQJA 3E9AA 4WKFA 1QNRA 5LKYA 4ZQOA 1ZRQA 4M1RA 3W2JA 3VTRA 4U2ZA 3QMTA 5CXPA 4H8UA 4O12A 3B9DA 4XTDA 2GVLA 4AZ7A 3WEZA 2DJXA 2E67A 2GZXA 3QQWA 4DM2A 3GR7A 3EB2A 1V7YA 2GPTA 1AW2A 5AFDA 4L4LA 2XN0A 4ZO8A 1BF2A 4DBUA 3M0MA 1TMHA 1KQYA 3ARSA 3QR1A 4WUIA 1HJUA 1THFD 3GH7A 5C2XA 1A53A 1AMKA 1C9DA 4UR7A 5BYWA 4DF2A 4ZCWA 3L4ZA 4CN6A 4UR8A 3FAWA 2QUVA 1HFBA 2QPSA 3EXRA 3CV1A 2C16A 4FX8A 1G7VA 4OHQA 1HW6A 3GHRA 4CUCA 1CLKA 4IJCA 5C71A 3VIPA 5J5RA 1FTXA 4C6EA 3DXIA 3IS4A 4L1XA 3LGGA 1V93A 1ME9A 3TYCA 1TWDA 2FZ9A 4LTSA 3M0JA 1UZ1A 1XX1A 3MJYA 2DQWA 5KITA 1YDOA 4W5ZA 5KZ6A 2JGYA 2V8ZA 2QNEA 4HNOA 4LRTA 4IMGA 2BP1A 1PIIA 3AS2A 4X22A 3WH8A 2ZRYA 1H1ZA 1IE7C 2E1DA 3K46A 4I8YA 5HMDA 3A5FA 3WKZA 3S5NA 2WHLA 4CEXC 6A3HA 1CBGA 3SBFA 1JGIA 3PNZA 1UWRA 4J4KA 3WH5A 1W8SA 3NDYA 5CZKA 2GGHA 5FEPA 4Y9OA 4FX7A 4Z2LA 3RDKA 3WFLA 4MYXA 3RCMA 2Z2UA 1ZJIA 1EP1A 4V27A 4MB4A 1JPHA 4C6KA 1W31A 3WDIA 4PYSA 4WJ8A 3II1A 3E0VA 3NPXA 2OZ8A 4NI8A 4LALA 1T99A 3CV2A 3MT1A 3FSUA 4I5RA 3RPTA 3LZ3A 1HKJA 1E9ZB 5HJLA 4XVEA 4AEOA 1VYRA 1YTKA 1KBLA 1UPMB 1Q66A 3ZXWA 2AQWA 3G1XA 3SUVA 4O28A 4HSNA 1J0JA 4OBRA 4QDWA 5H8UA 1EDGA 4KH2A 1JFXA 3S6OA 1JVNA 2FB2A 1S1PA 3J7HA 1SZEA 2QDHA 4OOZA 3QYQA 1NDWA 3ZLGA 1I0DA 4LJ3A 1GVYA 4JR5A 4N2YA 3FN9A 1D7KA 1HVXA 3GXDA 3G6MA 4GIRA 5CBIA 3BW3A 1F2JA 2QKFA 4QG8A 2X0HA 1OX6A 1R3QA 4PMVA 3KBNA 2PP0A 2YDRA 6REQB 3PTKA 4PTNA 3SGGA 1VJZA 4PCTA 4ZA0A 2OKOA 4C6BA 3WEMA 5J04A 2E8YA 4CN1A 2E6DA 3W23A 4RW5A 1XLEA 1GOOA 1PIFA 3NQVA 4I3GA 4R27A 3PSWA 2XGZA 2QJHA 1K4GA 1M7JA 1E0TA 3LTPA 4K37A 4NJKA 1HL8A 4NVTA 1LOQA 2XZ9A 4O1BA 1WYIA 2E9MA 1A0CA 4GZ7A 3QOKA 4XKYA 1WKDA 3RX3A 3DFQA 4W4QA 3W70A 3M43A 1F4AA 2VGGA 4WD0A 2BY2A 1FDJA 2J7DA 5EFFA 3TCEA 3AQUA 4GGBA 3IJDA 2QUNA 2PCEA 2JKPA 4F0KA 3TOYA 4H8VA 2HBXA 2BY0A 4AC1X 5CPMA 5DEZA 3WQDA 2V5LA 5C9UA 2XYLA 4YTQA 5DFAA 3VC5A 4QAWA 1QPRA 1HP4A 2WVSA 3SQSA 2WBKA 1ZJAA 4XIAA 2YXXA 1Z42A 1UD5A 1EF3A 2P8CA 3A23A 3NQCA 1WE5A 3AXXA 3BCJA 2D3NA 3GSMA 4JKLA 5D33A 1ISWA 3LUTA 3M44A 3W83A 3GG7A 3EMQA 1IV8A 5K9XA 1EGZA 1MZHA 1HJVA 1OFAA 3UXAA 3HN3A 1SZRA 2POTA 1B0IA 4AZGA 4XZBA 2ZBTA 2QJGA 1MNSA 5FAGA 1MYRA 3LLDA 5F4XA 4QROA 4FA3A 3BAKA 1FWIC 4YCPA 4J3UA 2BLEA 2CKRA 3WLRA 4NL1A 1IXPA 2XWEA 5CGQA 4IIFA 2RKXA 4PMYA 4S3BA 1Q2SA 3W1PA 4C60A 3DI0A 3A21A 1H4PA 5ABTA 3CAQA 1TUFA 1GOWA 3FOKA 1TMLA 5IM51 5T8GA 4BI6A 3SUWA 2OOGA 5I3DA 5LA2A 3MBDA 1WXYA 2XH0A 4PB3A 4LX4A 2Y5SA 4GCAA 4DNHA 5LNVA 1OCBA 2E7FA 4TV6A 4H1ZA 1XIBA 3M7SA 1LROA 1NM9A 2F2HA 4Q6JA 1UZ4A 4MJZA 3CB8A 1U1JA 1S38A 3WBEA 2DGAA 3KL5A 4D6GA 1QU4A 2IKGA 2QPXA 1UCWA 4ORIA 4GGHA 2BTMA 4DVOA 4NXKA 5FJJA 3GB6A 2VZOA 2Y7GA 2PA6A 4QGCA 1QR7A 3CH9A 4IG2A 5D03A 2ZX5A 4MWAB 4LYRA 2OGYA 4PRRA 7REQA 3WENA 1TJ2A 2EG7A 4XBKA 1CECA 1B3YA 3JUGA 1GG1A 4RX0A 1V0LA 2FB3A 3NDZA 1ZSXA 4ZQNA 5JBEA 1Y8BA 5IFTA 4NILA 6ENLA 2VM8A 2ATSA 4GISA 7TIMA 1TV4A 4MY9A 3WDQA 3VD5A 2OEKA 3SY8A 3F5LA 5EMMA 2WJZA 2HDJA 4LSBA 2FDSA 3I7SA 4OBSA 1PSCA 2E5BA 2OWCA 2EF9A 1E4IA 4BQ5A 4CQCA 4FIQA 4YJ5A 3CIWA 1NFPA 3L5MA 2FLIA 1ZBVA 2OYKA 4KFPA 1KXTA 1OX5A 3THQA 3RU6A 1WZMA 4XB3A 1G69A 1QI4A 1MVYA 3ONCA 1AJZA 2VZUA 5FJOA 3BMWA 1PZ3A 3A9IA 1J0ZA 4HMNA 1GQLA 3VGHA 5A6BD 3OG3A 4ZO7A 2IPWA 3GWQA 3ZO9A 4INFA 4HA4A 1TPUA 2TPSA 4R3UA 5DANA 2CLPA 2EEXA 4PUWA 1TPDA 2B0MA 3CEUA 1Q4NX 3BLEA 1QNOA 4FOUA 4GY1A 2E6FA 1DWJM 4MVAA 1ADSA 3UA4A 4H04A 2ZTJA 3GXTA 5EMKA 2QF7A 3E5BA 4RE2A 2ABBA 1IWAA 1VEMA 1E6RA 4US5A 2VR4A 4YMZA 4Q4OA 3UY7A 5M3WA 1D3CA 1PZ2A 3EEZA 4D71A 1QCWA 1YPXA 2FMNA 5AHMA 2PUZA 3W7CA 3WQCA 1QBBA 4S3GA 4QDMA 5F2MA 2EPLX 2HRWA 1VB9A 3NQBA 2XFFA 4RUBA 3AISA 3GKAA 2OYLA 1C29A 1W0MA 4Z42C 4G7FA 4A3RA 3C0JA 3TXVA 3B05A 3WBXA 4WSJA 3OW1A 5KZEA 4GI4A 4L6HA 2E1WA 3KHJA 3D5HA 4CNSA 2X1RA 1UQYA 4A22A 2VDIA 4XD4A 1TA3B 2IQTA 3FSTA 2P50A 4GJIA 1VF8A 3CXOA 4QE1A 4MFEA 2RAGA 2KAUC 3F03K 2E9LA 4OIFA 3IJ6A 3HFTA 1U1UA 3PZMA 3QQ0A 5A8NA 3BARA 3DIPA 4IQDA 1EZ2A 1Q65A 1ZCOA 1P1XA 3WX7A 4UTHA 3AIWA 3WF2A 2ZDSA 2YYTA 5BCAA 3WK3A 1R0MA 4C6OA 1HO4A 1IGSA 2OLHA 3KBSA 1KM1A 1A0DA 4J40A 4P8UA 2VFGA 2IKJA 4D6CA 3E0IA 4HZ8A 1H50A 3MWCA 4QCFA 4I9MA 1V5XA 1P6BA 4A29A 4J1OA 3VUPA 4DWSD 3ZLHA 3XISA 1JQVA 4JDBA 4LVAA 2QXWA 2ZUNA 3WLTA 1XC4A 3RFAA 2QCHA 4MNKA 2G4FA 2YX0A 1D8WA 3D0CA 4MG4A 3M7WA 4Y7EA 1GORA 3WQFA 3NQGA 3COTA 3ZLFA 4JICA 4L9ZA 1NQ6A 3P3BA 4P7LA 4UZUA 2JQXA 4AISA 1UP3A 4S3FA 1TE6A 1EGVA 5LA0A 4NXSA 3LB0A 3TEVA 1E1CA 2QGYA 3R8GA 3UFYA 1GKPA 3LPGA 3NL2A 4ENLA 1XISA 3GDRA 4LYQA 2BMBA 2GJXB 4IFOA 1OX4A 2P0IA 1ISXA 2PLMA 3VGDA 1C90A 3RYSA 4LUIA 1TV3A 1R8LA 3UWEA 1AQHA 4LBSA 4YNGA 5D4YA 4CCDA 4F4RA 3TN3A 4AWEA 1PX3A 4ZB0A 2ZTKA 3MVIA 4W84A 3E5PA 3VKBA 3BLFA 3LTSA 1G6CA 2YCEA 1JEZA 3M5XA 2OXNA 3HGRA 3NZGA 3AIRA 1A5KC 1VRXA 1K8CA 1UW9A 3NUKA 4FMVA 1ZJBA 3W1TA 2HNHA 3EX4A 1KBBA 4NUWA 3KRSA 3OU8A 1QRQA 3PBUA 4Q33A 2A3EA 1QBAA 4Q7NA 2E6YA 1FWEC 3LI0A 4HMEA 4L64A 4J2MA 5A2AA 4S1FA 1FWCC 4WKAA 1GG0A 3F4DA 2OMAA 2P8BA 3IARA 3H55A 3CPGA 4GG9A 1AUSL 3CL8A 3BK0A 3W7JA 2I1OA 1TRDA 3QKEA 1QI5A 3GM8A 2WJFA 2YL9A 1IZKA 2PDUA 3OPSA 1H0IA 3KX6A 1ADOA 4E4UA 5A2BA 4DWSC 1NSJA 1YW1A 3E49A 3UJEA 3S4TA 4AZCA 4WXZA 2H3BA 3KRBA 1PJ9A 1F05A 1XJBA 1VYSX 4K2SA 5A6MA 3WMLA 2DSVA 1CXHA 4BFAA 4EXQA 4JQ2A 5AC6A 3W26A 4LV4A 2AGTA 3SO7A 2UBPC 4PULA 3WQ8A 4NYYA 3S47A 1C93A 4G2DA 5IHRA 1OFBA 2WMGA 1NTHA 1W1PA 1DP0A 3UJFA 2XSXA 1QWGA 5AECA 4KWUA 4CQ8A 1GOIA 1P4CA 4B92A 3RR1A 2VGBA 3W02A 3N19B 1K7XA 4P8VA 4NSBA 4JTIA 4PUMA 3S1VA 3K8MA 2QHAA 3RCYA 2VZTA 4NZJA 4YPJA 2FGLA 4GPNA 3B8DA 2Q6ZA 5D9OA 3QV8A 4DJFD 3G1YA 4XBJA 1WV2A 2YJQA 1V3HA 1TR1A 2YYUA 4NT0A 3PUGA 3TOPA 1AMYA 1I2PA 1RSCA 1AH4A 1B57A 3NQ8A 1OK6A 4XO6A 3RLVA 3UR8A 4JTQA 1ODUA 3MC5A 3CUXA 2H9AA 1Z32X 1IT7A 1QPQA 1XGEA 1VENA 1HQTA 4ICMA 4DZIA 2R1PA 4LY4A 1NAL1 1OWQA 4YLWA 1F6YA 1V51A 4QNWA 2WOQA 2VVSA 1F4HA 3C4UA 4PMZA 4PTMA 2CWXA 4ORMA 2HQAA 2WNZA 2O7SA 4UTLA 1A50A 2B81A 3TQPA 3UU0A 4O0QA 1B9ZA 3A6OA 5JBDA 4HIBA 3WZ0E 3NEVA 4AHPA 4Q3MA 3CWNA 5C5YA 2Y8VA 2FH8A 5ABEA 4PMJA 2YCLA 2YKKA 3CWOX 3H4WA 3EMZA 1LG2A 1H63A 1AJ0A 4CNOA 5CPOA 4LT9A 1P1MA 1RJRA 2W91A 3WDHA 5FF0A 2CW6A 3UT0A 1FY6A 4Q4RA 4YS1A 4AUBA 1J0KA 3FJLA 2QQ6A 2PDNA 2EPKX 3TLQA 1BWVA 3TQKA 5BOOA 2A7NA 2O55A 2EPOA 2HTMA 3QZEA 2O4QA 4LAKA 3WLQA 2EPHA 3L65A 1KM6A 1Y5VA 2TODA 1UP0A 3I6RA 5TBOA 3N4AA 3ARVA 5HA7A 4F0LA 3P93A 1KFBA 2UWFA 3H7UA 4LW7A 1XYAA 3N6JA 4P5UA 1ZTVA 2AL2A 3SRDA 4DJFC 5H8MA 2FPVA 2WKLA 3O3RA 5G1YA 1KCLA 3EOUA 3MP5A 2BOGX 3DC0A 3PSVA 2CBIA 2RHGA 3WMCA 8RUCA 1VLWA 4ICCX 3CIVA 3RITA 1JPKA 1ITQA 2C79A 1LQ0A 2QUUA 5ABGA 3TQVA 2RGLA 4PCSA 1KR0A 2J13A 3GNDA 3LGDA 3OVGA 3TTYA 3LBCA 3HQOA 4ICNA 3NL6A 4GQGA 1WOAA 4TOQA 2GVGA 4OKDA 3AU2A 1ICPA 4DYEA 4TIMA 1WO2A 2J75A 3MJMA 1DPMA 1Q6DA 2Z25A 3OQEA 4B91A 4XAYA 5U7SA 3QC3A 4J3SA 1MRAA 3PG8A 3GC4A 2ISFA 3I7QA 4QM1A 1GOMA 1UD3A 3GE7A 1KGUA 3DHFA 1DHKA 4PODA 5ECUA 3GHSA 2INFA 3G6LA 3T6CA 3P81A 1H11A 1NF7A 4UXDA 4PCNA 4RKAA 4Z2IA 3EX2A 2REQB 1XF0A 3I6EA 2OSYA 4EKJA 4IT1A 3LBMA 1V0KA 3DC8A 3UNTA 1TJ0A 2CWNA 1I60A 1L8PA 1SJCA 5TF0A 1KWGA 4C1NB 2C0HA 4NRRA 3NJ3A 2WHKA 4H3DA 4YTSA 2QCLA 1BLIA 2WJEA 3L21A 5AKQA 4CU6A 1JYVA 3KVKA 3BJSA 3Q4DA 2BNJA 2P5NA 3SUSA 1QNSA 4TMCA 4NNBA 4Q8QA 4MUPA 1QK2A 4J2PA 3EB4A 2J79A 3NXLA 3SCRA 4LF2A 4KCUA 1XHGA 3FVMA 1RPKA 3A4WA 3W86A 3AIVA 4C7GA 4AB4A 1LUCA 1SJAA 1ELSA 1XIDA 4FEZA 3IAQA 1XD0A 1EF2A 4WDXA 3BZGA 4GNJA 3KZSA 3W73A 4DBSA 3GDKA 1PB0A 1Q5MA 3ENLA 1IEWA 2MNRA 3CK5A 1Z48A 1XS2A 3GH5A 3GKFA 4X0VA 3R11A 3O63A 2WCAA 4UQDA 3DUGA 4UOZA 4WGXA 3AFBA 1VRDA 4ZQMA 2DVXA 3CQ0A 1UBPC 1B2YA 3AXIA 5CG7A 1DQWA 2DSUA 1JUKA 3OG2A 4F0HA 3P8JA 3M41A 2PB1A 5HMFA 1DJYA 2WLYA 5AHLA 5F1UA 2V82A 4Z2HA 2QVNA 3L0KA 3LEPA 5TD4A 4JN6A 3MS8A 2YXGA 3IRDA 1OGSA 1L9WA 2ZRWA 4L9YA 2EG8A 1YTDA 1GVQA 1BD0A 3IGUA 1CZ1A 3PBWA 4EPEC 4LVGA 1VBJA 1QOXA 2WVVA 3OGVA 5A8QA 3CL6A 3BOLA 3OYXA 3N2XA 3QH2A 2QCNA 1FX6A 5T9CE 1UH4A 1SQ7A 1OY0A 1S2TA 2GSHA 1NOUA 4N42A 4W93A 1ECEA 4MFDA 3WD0A 5F4SA 1PKYA 3I10A 2BB0A 4KERA 2VKZG 1O5QA 3O16A 3N1AA 4WZHA 3S46A 1H7NA 4JTAA 1X97A 1QPOA 1Y5WA 4R5EA 3FA5A 4C65A 5HULA 4DLFA 3D47A 1BWLA 2XIBA 2X7VA 5LIXX 1UMLA 3U57A 2FYMA 4LAMA 2UZ9A 3ZJ7A 4K7VA 1W5QA 1GJUA 1PZ1A 1EIBA 2QLYA 3MI2A 3CYJA 5LIWX 1RP8A 3V1HA 4DAFA 4IM4A 1F8MA 1KGXA 5HUPA 3NQAA 2PTZA 4KRTA 1R7AA 1M41A 1HJSA 1LM1A 1A5SA 4FNSA 4W7VA 4BS0A 3TP4A 4S3DA 4GKTA 3T0DA 5E5CA 4JIQA 3R94A 3LPOA 4C7FA 4GIAA 5BOFA 2NV1A 4X9YA 4XK2A 2ZC1A 3UZXA 3OLEA 2IQDA 3RMEA 1J01A 2HISA 3PPCA 2R1MA 3ABOA 4Y8FA 2YFNA 3W7MA 1MUCA 1SZFA 2DSZA 4HHMA 3BLPX 4PTDA 5B7ZA 1I2OA 2E09A 2FTPA 2GJLA 1F61A 3AHTA 4BQ3A 1JJKA 3VC6A 1PO9A 5I00A 5JQ9A 1VHCA 5HBFA 1TTIA 2JIWA 1O5XA 2B7QA 5F4WA 4U5KA 4ATLA 4I90A 1S46A 3GTIA 4JY8A 2H6RA 4IMFA 2XFWA 3LSBA 4BF9A 1TR9A 3DFTA 3WO8A 4OECA 1RD5A 4D8LA 1DJGA 1PS9A 2J78A 2X30A 2A5HA 4HA3A 3REQB 1ZAHA 1CCWB 3WNMA 4LUTA 1ECQA 2JBMA 1RHCA 4W88A 2EKCA 2QIIA 1NARA 2J27A 4HU8A 2QJNA 2BFGA 2W67A 5B7YA 5A6BA 4JZ5A 1T8QA 4OOUA 3NG3A 2OT0A 5I7GA 1I1XA 4IMDA 3HM7A 3GNNA 1GJPA 1W2PA 3AZRA 3GTHA 3NOEA 4H9TA 3QHOA 4C6NA 1VAHA 1QOQA 2J7HA 1W3LA 2CLIA 4O18A 4V15A 4NY2A 4DF0A 4H9UA 2J24A 5EY5A 4HVXA 4WOZA 1XIJA 5E6YA 1E55A 4A8NA 3AHVA 3MYPA 4JOMA 1E4MM 1UOZA 3MCMA 2WC3A 2PCQA 2AGKA 3H22A 4AVOA 3S2LA 4CN4A 4DZHA 3QBUA 2YCIX 4H9ZA 1M7PA 3RJXA 4RPPA 2EQDA 1JZ4A 1SO5A 3AS3A 4JEQA 1FUYA 3LYEA 3KE0A 1O60A 5IFPA 1E40A 1UWTA 1F7BA 1V3LA 2I5QA 3CQKA 1BF6A 3CZLA 4OU1A 1GYNA 1FH8A 1H41A 3ZYZA 1X1NA 2ZVIA 4W7UA 4ZE5A 3MHFA 4YL2A 2ZA1A 3AYSA 2EJAA 4CLMA 4J3XA 4MB3A 3TTSA 3TAOA 1SUXA 3VILA 2OELA 1OC7A 3M6YA 4DYKA 3DZ1A 2NLIA 5K7JA 3ARZA 5I3IA 1FKWA 1OCNA 4FO4A 1RCXB 4P2VA 3W7OA 3DDMA 3KBVA 2O92A 4MLJA 1MO0A 1TRIA 3PZVA 1W9BM 2R9RA 4JYDA 3MB9A 1WXJA 3L0GA 1UKTA 3G0UA 2J7BA 1DJZA 4DWSA 4W5UA 2HE5A 4CCZA 3B9AA 5CC5A 2CC0A 2BOFX 3G1DA 5HNRA 2XSBA 2QCGA 2D2JA 4DQWA 1CI1A 5D02A 1PHQA 2J62A 2UY5A 5I77A 3VA8A 3W81A 3KL0A 3BGAA 1TYGA 4EE9A 3B8WA 4Z1AA 1XXXA 3HMJG 1HVQA 3NQFA 3GVVA 4X2PA 1TJ1A 3C56A 1LORA 1MFUA 3CO4A 4QHRA 1I9CB 2NWSA 3B9OA 3G2GA 3O05A 1FWJC 2DT2A 3RU8X 4OUIA 4U2YA 2WZHA 1DIEA 1PUDA 4UFKA 1G7UA 3G3DA 4F0RA 2EXOA 4RK8A