3TA9A

Beta-glucosidase a from the halothermophile h. orenii
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
449
structure length
448
Chain Sequence
AKIIFPEDFIWGAATSSYQIEGAFNEDGKGESIWDRFSHTPGKIENGDTGDIACDHYHLYREDIELMKEIGIRSYRFSTSWPRILPEGKGRVNQKGLDFYKRLVDNLLKANIRPMITLYHWDLPQALQDKGGWTNRDTAKYFAEYARLMFEEFNGLVDLWVTHNEPWVVAFEGHAFGNHAPGTKDFKTALQVAHHLLLSHGMAVDIFREEDLPGEIGITLNLTPAYPAGDSEKDVKAASLLDDYINAWFLSPVFKGSYPEELHHIYEQNLGAFTTQPGDMDIISRDIDFLGINYYSRMVVRHKPGDNLFNAEVVKMERPSTEMGWEIYPQGLYDILVRVNKEYTDKPLYITENGAAFDDKLTEEGKIHDEKRINYLGDHFKQAYKALKDGVPLRGYYVWSLMDNFEWAYGYSKRFGLIYVDYENGNRRFLKDSALWYREVIEKGQVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoside hydrolase family 1
publication title Expression, purification and preliminary crystallographic analysis of the recombinant (beta)-glucosidase (BglA) from the halothermophile Halothermothrix orenii
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
total genus 162
structure length 448
sequence length 449
chains with identical sequence B
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ta9A00
1G9HA 2XGIA 4FLQA 3MMDA 1UD4A 3BSHA 1JYNA 3G6LA 4OOZA 2Y8VA 3WNOA 1G1YA 5C70A 1E6XM 3MUIA 2BXYA 3BC9A 2XTKA 3SCUA 1C8QA 4UOJA 3BAYA 2W5FA 1CENA 3MUY1 2VNCA 4W85A 4W8BA 4MTVA 1OT2A 3SCQA 3PZ9A 1UD6A 3WH7A 1CGUA 1B9ZA 5JIWA 1AQMA 2ZX7A 2JIWA 3AZRA 1E56A 1UZ1A 4X0VA 3WUEA 3LPOA 1HVQA 3W81A 8A3HA 2XWEA 3ALFA 1CTNA 1Z32X 3OLGA 1ISZA 2J7GA 4U2ZA 1UKQA 2A3AA 1EDGA 4QLJA 1ZBCA 1UH2A 1SMAA 1JDAA 1E4LA 1JZ4A 4MB4A 1B0IA 1HF6A 4MADA 1ISVA 2XVLA 9CGTA 1K6AA 3IAQA 4BCEA 3VIHA 3L4WA 3VIFA 3T09A 4CD5A 1NOWA 5IHSA 1UR1A 2EPKX 3L4VA 5BRQA 2FHBA 4EE9A 2VURA 1W1VA 2WCGA 2J78A 2DT0A 4WLCA 5A69A 1P6WA 1RD6A 3UERA 1L0PA 2WKGA 1ZL1A 2EO7A 4HZ7A 1UR2A 2BVDA 1H2JA 3IAPA 4H2CA 3CUJA 2WK2A 5C8BB 1R7AA 1DWJM 3MANA 2FDMA 2WCAA 3T2OA 2YOCA 2OYMA 3ARUA 1W9DM 3IANA 3L4ZA 1KQZA 4D6CA 2FGLA 2EBNA 3ARPA 5A8QA 1U30A 5CPTA 4CN4A 2OLHA 4M82A 1MXDA 1GVIA 2D0FA 5CSYA 5LA1A 3T0BA 1W9BM 2G3IA 2E8ZA 3RJXA 2WWDA 4U2YA 4YHEA 2PC8A 2WW5A 1E6ZA 1UH3A 2V3DA 3D3AA 1EO7A 1SMDA 4W5UA 1J0KA 1E71M 5E0FA 4ZENA 2XPKA 4CVUA 3DHPA 2CBVA 3ARWA 2XIBA 4QLLA 5D9PA 4B9YA 4W84A 2YIHA 3TP4A 5LA2A 2W91A 1HKJA 2CKSA 5F7UA 3PZIA 3W29A 4AZBA 3NSNA 3A3HA 1QPKA 1PJ9A 1FH7A 3MV01 1F4AA 1WO2A 2WSKA 5M5DA 3AISA 2VCCA 4LYQA 2BV9A 3MMWA 1OD8A 1V0MA 3VIPA 3OZOA 2F2HA 4QFUA 4ATDA 2J7BA 4D72A 1UWSA 4U5IA 2ZUMA 3N11A 2TAAA 4GQRA 2FH8A 5HXMA 4S3KA 1UKTA 3ZO9A 4BZYA 2D3LA 4F79A 3BXWA 2VMFA 3U57A 3BH4A 3K8MA 4OBSA 4DWSA 4CCCA 4DM2A 3MKKA 4MAVA 5EFDA 3VD3A 1KFWA 2GJXA 1VB9A 1NQ6A 1BTCA 1BYCA 1KR1A 4RE4A 3OLEA 1ZJAA 1BPLB 1W1PA 3ARXA 1V0LA 2WHMA 1UD2A 2WMKA 1NWTA 2EPOA 1CDGA 3AXIA 3GNPA 1H4PA 4W89A 1W9XA 2VUYA 2WC3A 3VM7A 2OWCA 2VO5A 4PRWA 4J3SA 1BYBA 4DUXA 2WXDM 1TVPA 3KE0A 2VL4A 3WKZA 1PEZA 3M46A 3T2PA 2VCBA 1VJSA 3ECQA 5AC5A 4W88A 5I6SA 3PHAA 1FA2A 4L4PA 5DMYA 4ZE4A 5M3WA 2DIEA 2J74A 1DWHM 4JFTA 1C91A 3GXMA 3WQ6A 3AICA 4X9YA 2WBGA 4M81A 3CZEA 1QI5A 1EHAA 1LF1A 1PX3A 3AYSA 1B1YA 1GOOA 2J8FA 4U33A 1NWRA 1XCXA 1EOKA 2CCRA 2CIPA 2XFYA 4HPGA 3E1F1 1FH9A 2VT0A 3W26A 2YBTA 1WDRA 3U7BA 3CIVA 1CXHA 2Y8KA 3A4AA 1E6SM 2YL9A 1I75A 5JBDA 1W2PA 2YA1A 4U31A 2QPSA 4PTXA 1V3KA 2VZSA 2VX7A 2GK1A 3WNNA 4CCEA 3N04A 2WC7A 4ACYA 3WN6A 2XFFA 5LYRA 2WMIB 2EPMX 1MFVA 1MW1A 4XV0A 4MNLA 1XYZA 1JIBA 1AQHA 4YN5A 3FAXA 5CZKA 1QBBA 3OGVA 1SR0A 5A8PA 4UR9A 1D7FA 2IXVA 3VUPA 4TUFA 2UY3A 2VTFA 4B16A 4ACZB 3LPFA 4BQ3A 1JL8A 1AQ0A 3O6AA 3FAWA 1C90A 1JXJA 3SCVA 2WZEA 4LX4A 2VX4A 3ZOAA 2XVNA 3SUUA 1MFUA 1RP8A 3VKKA 3FHAA 4BQ2A 2WHKA 1HX0A 5A2BA 1OGSA 1Q6GA 1CWYA 1JZ7A 2A3CA 2ZXAA 1LG1A 1KGUA 2WSPA 3SCTA 3WDHA 4EKJA 3PZUA 1C92A 4D71A 2WM0A 1WNOA 2W4XA 5A8NA 4J7RA 1GVYA 3AHYA 4P8UA 2PI6A 2GSJA 3K4DA 4J3UA 4MAZA 3GXFA 3CMJA 4IPNB 3RMEA 3WF4A 3L2LA 1KWGA 2ZXQA 1G94A 4HZ8A 1OCQA 1I1XA 2J75A 5A2CA 2WMGA 1SYTA 4CGTA 1BF2A 1OGBA 1KB3A 1E6PA 3VIGA 5TD4A 2D1ZA 1W3HA 3SUTA 2HISA 2VZOA 4FK9A 2WMJA 3ZMRA 2OSWA 3EMCA 3GNOA 3N13A 3KWXA 1K9TA 2C7FA 5KZ6A 2VJXA 4PEEA 4N0RA 1KGXA 1B3VA 1FFQA 1RPKA 2BY1A 2E9BA 2XM1A 4PMUA 5A8OA 1DHKA 3WD1A 3EDJA 4GIAA 3MUZ1 5I5RA 2RGLA 3F5JA 1CXLA 2XJ7A 2GUYA 3GH7A 4CD8A 1XD1A 2QF8A 4W7WA 3ZQ9A 3SIMA 1GOWA 2EPNA 4LYPA 1XCWA 2JE8A 1KBBA 5M03A 3UG3A 3BAWA 2NW0A 1FHDA 3WUGA 3W0KA 1HL9A 3B9EA 1JYXA 2A3EA 4JL2A 4UFMA 1TCMA 4PMYA 1Q6DA 3F5KA 3VX1A 4YHGA 5I3DA 1M03A 1UH4A 2GVYA 4PMXA 4JL1A 5CJ5A 4FLOA 1JYVA 1A3HA 1X1NA 3ARSA 3VX0A 2D24A 1LLOA 3HJEA 2BHZA 1QOXA 2BVYA 2VCAA 3EMZA 3WDRA 4WF7A 3SURA 4PSPA 3T08A 2WAGA 4HU0A 3APGA 2ZUWA 1JAEA 5I24A 3W6MA 4H7VA 1LG2A 4KWUA 1EDQA 5GPRA 1UWUA 2E9MA 1CGWA 1E15A 1V3IA 4NSBA 1JGIA 4TX8A 3DYMA 4PN2A 1WKYA 4IUGA 3VTRA 4AD5A 2PWGA 3UETA 3WY1A 2PWEA 3CUIA 3AHTA 5ECUA 4AD3A 2YA2A 3BCFA 2CBJA 1HKIA 2WCSA 4JKKA 4BA0A 2HVMA 4GZEA 4P8XA 4M56A 5I78A 2ZXDA 3W4RA 1UD5A 1MQPA 3CUFA 1BHGA 1J10A 1KXHA 4GPNA 1OINA 2JEQA 1FOBA 3I3BA 4MB1A 3LPGA 4JKMA 3QOKA 3WH9A 4JFSA 3GBDA 2BFGA 2E0PA 3GH4A 2WB5A 5D8WA 4R27A 2VOTA 1UR4A 4GZIA 4WJXA 2ZOXA 3OZPA 1ECEA 1LL7A 4IISA 4ZXOA 2FH6A 2QPUA 1DEDA 2AMGA 4M8UA 4TOQA 4C7DA 5GNYA 3PZVA 4CVWA 1UZ4A 3MSGA 1JZ3A 4UOQA 4J3XA 4AMCA 4EAMA 1NH6A 3QGVA 4R5EA 3WD0A 1EGZA 3AROA 3A6OA 3VMPA 2IXUA 2J79A 3WDQA 3AJ7A 3AMLA 1J0ZA 4H8HA 5JBFA 4QAWA 1FHLA 2D22A 1D3CA 1FH8A 1GOIA 1JNEA 2DSKA 4AEFA 3RO8A 1H41A 1M04A 5CG0A 1H5VA 1QI2A 1O6IA 2BHYA 5EMYA 8CGTA 3POCA 1OB0A 4B3LA 1NOUA 2WMIA 4MDOA 3UR8A 2PWDA 5E6ZA 3CH9A 1JXKA 1OBAA 4AWEA 1GHRA 4BS0A 4UQAA 3WQ5A 1QI0A 4W8LA 1O7AA 1E3ZA 5JBEA 1QI3A 2WZIA 5I2UA 1DWAM 3D5HA 1J0HA 4ACZA 4UFHA 4L4OA 3EDFA 1QBAA 2FHCA 5BYWA 1J18A 6CGTA 1CGVA 2J77A 3TTOA 3VNZA 5CLWA 2G8ZA 3WUBA 1W3KA 3N15A 4AD0A 1R7OA 3B9AA 4AYSA 5A6BD 1V6XA 4URIA 1JD7A 5E6YA 1HIZA 1PX8A 1R85A 1PIFA 3OA5A 3G6MA 5ABHA 4IM4A 1WDSA 4BQ4A 2WBKA 1DWFM 2DIJA 1CZ1A 1J01A 3ZJ7A 2CESA 4MJ4A 3KL0A 1ZB5A 3AIWA 3AIQA 2CPUA 1K9FA 4JZ5A 3HMCA 3GYCA 4V28A 1NP0A 2BY0A 1ODZA 3N17A 2NT0A 2ZX5A 2WMHA 1E1FA 1GUVA 1XHGA 5CSUA 4UNIA 2VX6A 3AHZA 2W67A 4OKDA 2FHFA 1WZKA 1E3XA 4LPCA 3RM4A 1SFSA 1OD0A 3PZOA 1M53A 4ATWA 4CN1A 1C8XA 2WVTA 3VVGA 5CQ1A 3W37A 2UY2A 1WZMA 5IFTA 4QDMA 3VMOA 2X09A 4H41A 3PZNA 1JYWA 1QHPA 1TG7A 3A4WA 3L4TA 1KCKA 2QMJA 5CGMA 5I79A 1WDPA 4MNJA 5FL0A 4DUVA 4OUEA 4HMCA 4WKFA 3I3DA 4A3HA 3WSUA 2G3JA 2G3NA 4UFIA 1TUXA 3WMCA 4D6JA 3PZGA 4HU8A 3K8KA 1BQCA 2J47A 2VZTA 4GI8A 4YPJA 3M07A 1QNPA 2ZX9A 1GJWA 3WMSA 5D9MA 4DUWA 2X0HA 3OIHA 3CPUA 1IT0A 1CIUA 3S6TA 3WFLA 5BXPA 4CN6A 5BXSA 2WANA 3POHA 1EA9C 2JF6A 2W66A 4E8CA 3VDBA 1TZ7A 2EXOA 1E0WA 3THDA 1E40A 1NP2A 1VFMA 2V5CA 4PUDA 3VIMA 3SUSA 3AMGA 3W53A 2XUCA 4P7LA 3SCOA 3GH5A 4QLKA 4E8DA 5EFFA 5FIPA 2F8QA 4CKQA 2D3NA 2DDXA 4U3CA 3WIJA 1X6NA 1ZBWA 1LWJA 3WQ8A 3ALGA 1BVZA 1XGZA 4UQBA 1HJUA 1PX4A 5ABFB 4WIWA 1OGGA 3WF0A 2YKKA 4BF7A 3SUVA 1UQZA 1VFFA 3TTQA 5A95A 1RH9A 3CTTA 1H49A 4W7UA 1W3JA 4RE3A 3GZAA 1JF5A 3UEQA 3FXYA 4ML4A 1JG9A 3VM5A 3NSXA 1OWQA 3GNRA 3CZLA 1J0IA 5EB8A 2V5DA 4E4PA 3O2LA 1TE1A 1TA3A 2E8YA 1LQ0A 3WENA 1Y7VA 1JAKA 3MUAA 4A3YA 4AC1X 5HPOA 1H0IA 3CGTA 2IUZA 1E4IA 2VVSA 1QW9A 3AZTA 1GORA 1C7SA 4MNKA 1W91A 3T2QA 3BCDA 4HA1A 2YL5A 3WD2A 2RGMA 2CEQA 4CU7A 3JUGA 4F9DA 1XH2A 1B3XA 5IXEA 3AI0A 3DYPA 1HNYA 3AQUA 3N1AA 1UG6A 3TTSA 4UQEA 2OYLA 3VDCA 1PZ3A 2YDQA 4CD7A 2V3EA 3CHEA 4PTMA 1HJXA 4J3WA 1IZKA 3OLDA 2UY5A 1WDQA 1ISYA 1GOKA 1HJQA 3MSDA 2QV4A 2O9TA 1EXPA 1VF8A 2D20A 2GJRA 3VGFA 2WHLA 4QCFA 3VGDA 3OBAA 4M24A 3CUHA 1E6NA 1CECA 2J25A 2G4FA 1BSIA 3WD4A 1CXIA 1N82A 1XD0A 4AD2A 3FN9A 3VGBA 2PB1A 1CXFA 2F61A 1W9VA 2DPEA 1AMYA 3K4AA 3RM8A 2A3HA 1TVNA 3WBAA 1XSKA 3VILA 3AIBA 4GI6A 1H09A 2FGZA 1JF6A 3WF2A 4AZGA 4UQDA 5DFAA 3AYRA 4HOXA 1E73M 1UR9A 1OIFA 4CU6A 1UKOA 1MW3A 3I3EA 4GXPA 1GONA 1DWGM 4HTYA 4EK7A 4PCSA 1ISXA 2G3MA 1UWTA 1PBGA 5ABEA 7TAAA 1PPIA 5A6KA 2O92A 2C0HA 2J62A 1V08A 2JEPA 1JFXA 3VPLA 4HOZA 2X2YA 1VENA 4QP0A 1CBGA 4CD4A 4PMRA 3B9DA 3AIVA 1DTUA 2GDVA 1XV8A 4PMOA 1UOKA 1XC6A 3U7VA 4A4AA 4HA4A 4PMVA 4UCFA 1V3MA 4WKAA 3QOMA 5AY7A 5AYIA 4P7OA 3BMVA 1GQIA 3BAKA 2J7CA 4P7QA 1QNOA 3CMGA 1HKKA 1ZU8A 4TTGA 2XSBA 4GZJA 1MVYA 1JI1A 1XRVA 2WZHA 5D9NA 1QI4A 3EDKA 5A94A 3UCQA 4UZUA 1MXGA 2PWFA 1VEOA 3W6LA 1JDDA 2VQUA 4KRTA 4ZEPA 3ARQA 4U3AA 3WNLA 4P8VA 1G0CA 1JZ6A 1E5NA 4FLSA 3ZR5A 4KGJA 4OIFA 4HPHA 1US3A 2BNJA 2WVUA 4UQ9A 2OYKA 1NWUA 1BFNA 4AXNA 3AHXA 3N18A 1PIGA 1C93A 1ZJBA 3HU7A 1B90A 3VMNA 1W32A 4C7GA 1E4MM 1V3LA 4V27A 4XZWA 1C8YA 2YDSA 3AFBA 2Q8XA 3VD5A 2QMKA 3LMYA 2B31A 5DO8A 5GNXA 5CXPA 2YLLA 1OM0A 3AMDA 4PTWA 3RDKA 3A4XA 1KQYA 3WDIA 3SCSA 3L4XA 1FFRA 3WELA 4HMEA 4AISA 1CXEA 4NF7A 1YQ2A 1F4HA 1R87A 5E9AA 3GTNA 4X0NA 2OWXA 4B15A 4HOWA 1QHZA 2UY4A 1U2YA 4MPKA 4H8UA 5IFPA 2WLZA 1V6YA 4Z2KA 4Z2JA 2YL8A 4H04A 4DWSD 3F5LA 2YJQA 4W7VA 4WSJA 3OB8A 3VGEA 1E4NA 1J0JA 3CHDA 1KXVA 1LWHA 3DHUA 4MNMA 1V6UA 4Q7NA 2DT3A 2JIEA 2YL6A 3CO4A 4JCLA 3TOPA 3MS8A 1JI2A 4D6EA 4N42A 3ARYA 1V3HA 3S2CA 3MO4A 2W63A 1YHTA 4WSKA 5I23A 2WKLA 1V02A 4CUCA 2J7HA 1V6VA 5A6AA 1HVXA 2CBUA 3OGRA 3T0DA 3M6DA 3UESA 1V02E 2ZUNA 1JFHA 1TA3B 3ARVA 4GO8A 3F4VA 1H1NA 5ABFA 2EEXA 3VNYA 1CXKA 1NWSA 2BVTA 1UR0A 4PYSA 1B30A 2VZUA 1W9PA 5DEZA 2CHOA 3NSMA 3WUFA 4MDPA 3CZJA 4JHZA 3BLKA 3FNDA 4W93A 5JUVA 5HPCA 1E0XA 1BAGA 1MW2A 4D1JA 4J3VA 4TTUA 5A6MA 3WL0A 2OSXA 1EIBA 2BY2A 3WD3A 3UR7A 1VFOA 3EYPA 2JALA 4PMNA 1A47A 4HP5A 1CPUA 2XIIA 1KGWA 2DT1A 2W62A 1J12A 1QNQA 1V6WA 4LGXA 1GQKA 4K68A 3CZKA 4KMQA 1VJZA 3VDAA 1B31A 3OLIA 2PBOA 1U33A 1QNSA 4NRSA 2J7DA 3AMKA 4AW7A 4ATLA 3DYOA 4OOUA 1UR8A 5BRPA 4GINA 3DC0A 3WBEA 7A3HA 3VU2A 1GCYA 3NDZA 1PZ2A 4UFJA 1UD8A 4D6FA 3MU7A 4FLRA 1GNXA 3WL1A 4W5ZA 1L8NA 3WEMA 1EQPA 5JIPA 5FCZA 2X8RA 1NM9A 3N12A 3AIUA 1MQQA 3MMUA 4PCTA 1JZ5A 1CGXA 2WVVA 1KXTA 1WZLA 5DT7A 1GPFA 4PMZA 2DEPA 1BVNP 2NT1A 2CXGA 3WNMA 3EBVA 4GI9A 5FKYA 1J0YA 3VD7A 4DM1A 2GFTA 2ZUUA 4JFUA 4AIOA 1NARA 2DSWA 3WDJA 2WNWA 1BYAA 3ZJ6A 1JZ8A 3THCA 2ZXBA 2DSZA 2XGBA 2BHUA 4D6HA 3W24A 3ARRA 3RM9A 1XSJA 2QLYA 1V03A 4P7NA 1JNDA 5BCAA 1HP4A 5BWFA 2VI0A 4Y7EA 2GJPA 5D9OA 3ZJKA 2D0GA 3WMBA 5I0DA 2WYSA 1LL4A 2ESCA 2CETA 2DQXA 4LQ1A 3AIRA 1EH9A 1FP8A 3QHMA 1E9LA 3WEZA 1GQJA 5HNNA 3OG2A 4DWSC 3ZM8A 2OWWA 3RCNA 1PAMA 4V2XA 4AIUA 1UD3A 5BXTA 2O9OA 1AVAA 4TX6A 3VOCA 3WF3A 3VD4A 3BAIA 2WC4A 1HJWA 2YBUA 1D2KA 5E09A 2QHAA 4AZIA 4LYRA 3UG5A 5BXRA 4OZOA 4U5KA 1W1YA 3PTMA 2E40A 1ODUA 3RILA 1HP5A 3IJ7A 2VQTA 3TA9A 2NSXA 4Z2IA 3PTKA 4RE2A 5HDRA 3VIOA 1I1WA 1UWIA 3VD9A 1G5AA 2ZUSA 3NCOA 3W82A 3ZT5A 1KWKA 2CERA 3WEOA 3PZMA 1BLIA 2VR5A 4S3JA 1J9YA 1V0KA 1JD9A 1WZAA 4J27A 4B3KA 5FD0A 1W2VA 2Z1SA 3PN8A 4H8VA 4PTVA 3HN3A 3QR3A 2A3BA 1WE5A 3W28A 1KR0A 4JAWA 4PMQA 5IHRA 3K8LA 1UQYA 1W1TA 3PTQA 2X05A 3SUWA 5I77A 3EDEA 2CHNA 2GDUA 4TXEA 2C8NA 2O9PA 1DP0A 4AZCA 3CLWA 3KL3A 4FMVA 1V3JA 4XZBA 3WH8A 4C7FA 4Z2HA 3ARZA 2XM2A 1BG4A 1ITCA 2XVPA 4CU8A 4LXFA 4PMDA 5A8MA 3VIKA 2CBIA 3RPMA 1C3FA 2EJ1A 1OSEA 2XWDA 5CGTA 1MW0A 3ZR6A 1HJVA 1GOQA 5A1AA 1R8LA 3VIJA 2WLYA 2VX5A 1HKMA 2WWCA 1EQCA 3O9NA 5LA0A 4W87A 1XYFA 3QHOA 1E1EA 1DWIM 4JKLA 3CUGA 3AOFA 4EANA 1E6RA 6A3HA 2XSAA 2J7EA 1UWQA 2XVGA 3VDHA 1UKSA 3VGHA 1B3ZA 5GQBA 1UYQA 1UWRA 1BGGA 1QNRA 3BSGA 1Q6CA 3B8SA 3NDYA 3BAJA 5D8ZA 1J11A 1CYGA 1HJSA 3NJ3A 3AS1A 1E72M 5KEZA 1K9DA 1VBUA 4MB5A 4FF5A 2XG9A 1WCGA 3KZSA 3WNKA 5C71A 3WQVA 4Z2GA 1KBKA 3WFZA 1HL8A 4MJ2A 3IJ8A 3WQ4A 4NI3A 2ZX6A 3K46A 1V0NA 4D6IA 4M80A 4AZ5A 4JFVA 1TMQA 1ZBKA 3PBGA 4JFWA 4JIEA 4B9ZA 1GW1A 1EOMA 1Q4NX 3ZT7A 1VFUA 2J7FA 4ZE5A 3PZTA 5D4YA 3ZT6A 2WVVB 4F8XA 2WHJA 1GHSA 4KRUA 3AS3A 2ZUTA 4D6GA 4P7RA 2EPLX 2DSUA 1G01A 4CCDA 4AZ6A 1JDCA 4XUYA 1TR1A 5CPSA 1BG9A 3SEPA 3GDBA 4WK9A 1HXJA 2CYGA 2VR4A 4GKLA 4F66A 1GZJA 4PUEA 7CGTA 3RJYA 1H11A 3EMQA 1UA7A 1WB0A 5BROA 5EBAA 3FW6A 4UFKA 2PWHA 1R86A 1TFVA 2E9LA 2PF0A 1QHOA 3AHVA 1E5JA 1US2A 1GQLA 3CHFA 1VEPA 1UA3A 5A6LA 2ZICA 1Q6EA 2D23A 4M1RA 1QVBA 4HMDA 2X1IA 1MWOA 4AEEA 4GO9A 1CGYA 2E3ZA 2BXZA 1UUQA 5AC4A 3GXIA 2OSYA 2Z1KA 1WPCA 2ZUVA 4W8AA 4D1IA 4P8WA 4UQCA 3VINA 1CLXA 1CNVA 1IZJA 1OT1A 3QHNA 1E6QM 1QW8A 2Y4SA 1W9UA 2Y24A 5A6BA 3CHCA 5AYBA 1E43A 2YDRA 2D2OA 3IK2A 4JHOA 3ZSTA 3AS0A 4J28A 1ISWA 2Y5EA 1GOMA 6TAAA 2JF7A 3AXXA 3A47A 3AIEA 1VEMA 2DGAA 3L4UA 1OIMA 5GNZA 2VC9A 3TONA 3N9KA 2WMFA 3T0AA 2UWFA 2VRKA 3DECA 2VRJA 1EDTA 1E55A 4GQQA 1CGTA 3KEHA 5M17A 2ZWYA 4XX6A 4NRRA 5HOSA 3MV11 3ARTA 4TVUA 4UTFA 4F9JA 2CITA 3WNPA 3L2MA 1WAWA 2BS9A 3W27A 5A6JA 4XB3A 1XH0A 4AIEA 2X0YA 1X6LA 3OGSA 3WH5A 1UHVA 3VO0A 1M01A 1Q6FA 3GXDA 5A3HA 3GM8A 4AY1A 3M7SA 4AZCB 1B2YA 2DSVA 3AZSA 2O9RA 1VRXA 1H0GA 2D0HA 1KXQA 4CD6A 5CPQA 4UZSA 1K9EA 1EHNA 4W86A 3BMWA 1B3YA 3SCWA 1BYDA 5FOOA 1ZBVA 2J8GA 4NZCA 1VBRA 4HA3A 4AZ7A 3BAXA 2V3FA 1NOFA 1H3GA 1EO5A 3SCNA 3FHQA 4Z2LA 1B3WA 5CLTA 4M29A 4OBRA 1IV8A 2VRQA 2VVNA 4KGLA 1CEOA 2VZVA 3PZQA 2W92A 1KCLA 2XHYA 4ZXLA 4OJYA 2EQDA 3BGAA 4DWSB 3L4YA 3TTYA 3WQWA 2GJXB 2WPGA 4D6DA 1VAHA 4PBGA 2BY3A 4UFLA 1CLVA 3WDPP 3ZSSA 3CZGA 3WF1A 4AZHA 2YA0A 3EDDA 3IJ9A 2YLAA 2ZIDA 3AS2A 1RP9A 3AXHA 3BLPX 3W25A 2CNCA 4RL3A 3SCPA 2G41A 3VIIA 4WKHA 2MANA 3LPPA 4KH2A 3CBWA 2DT2A 4AD1A 2XFRA 3AMCA 1E0VA 2DH3A 5DF0A 4AD4A 2E4TA 4QCEA 4PSRA 3KL5A 2XYLA 2WVSA 3II1A 2W61A 3ZJ8A 5FL1A 4JCMA 1FP9A 1HT6A 2ZE0A 5IDIA 3ZIZA 1WP6A 2Y2WA 4TVDA 1ZS2A 3J7HA 1XSIA 4BQ5A 5DT5A 3SCRA 2ZX8A 3W38A 1HN1A 4TVCA 1XH1A 2ZWZA 3U5UA 4HZ6A 1C7TA 1JZ2A 4MB3A 3NYDA 3NUKA 3NIYA 1W3LA 3RIKA 1LJYA 1GJUA 1MQRA 1BGAA 3WH6A 2V3GA 3UG4A 1ESWA 4J3TA 5E70A 5A6SA 2JFEX 1MYRA 4ZFMA 5A2AA 5ABGA 2XVKA 4IPLA 1M7XA 3CZ8A 3GBEA 2AOSA 1LL6A 2PBGA 2AAAA 4UOZA 3FY1A 5E0CA 2V38A 2GK1B 1UKPA 3U5YA 1S46A 2CKRA 4Q22A 1ITXA 2DH2A 3K1DA 5HBFA 3VGGA 4E2OA 1E70M 1VIWA 2J4GA
chains in the Genus database with same CATH superfamily
2XGIA 4FLQA 1UD4A 1FBAA 1TPDA 2V8ZA 2BXYA 3SCUA 4UOJA 3MUXA 3N4FA 9RUBA 4G5DA 3TNBA 5M2FX 4GWEA 4DX3A 4WD0A 4YYCA 3QPYA 1B9ZA 1QPQA 5JIWA 2JIWA 2A79A 4R7JA 3NA8A 3LPOA 1HVQA 3PWAA 8A3HA 1U1HA 3MYOA 3OLGA 1ISZA 3WJXA 5C2GA 4YJ5A 4U2ZA 2CLFA 1EDGA 1CI1A 1E4LA 5I3JA 2F6KA 3LTSA 5EYWA 3B4UA 1Y65A 5DRCA 2G3FA 1B9BA 1AD4A 4IWWA 3CO8A 2PDYA 3KM8A 1F6KA 3EX6A 3IAQA 1A5MC 1PTAA 3L4WA 4RDZA 2QGYA 3T09A 5IHSA 5GJNA 1UR1A 2BB0A 2CLHA 2WCGA 1YBQB 1IGSA 1N7KA 1JCMP 2QEZA 3UERA 3STFA 1L0PA 1MMFA 3C2FA 4HZ7A 2EO7A 1UR2A 2BVDA 2G37A 1RQBA 5HWNA 3GVQA 2OYMA 2OGJA 3N2XA 3P3BA 3RMJA 3L4ZA 5KMYA 4O17A 2OKOA 3BICA 4IIBA 4ZMGA 2ATMA 3W7PA 2QCGA 2FGLA 2EBNA 5A8QA 1U30A 2Q09A 5CPTA 2OLHA 1EJTC 3T9PA 1MXDA 1F6PA 1FWBC 3P8JA 1VZWA 2HBXA 5LA1A 1SW7A 4UMCA 5AHMA 3PBYA 4XKMA 1W9BM 3NL2A 4Y9NA 2Q6ZA 3RJXA 3LCIA 4I8YA 2PC8A 2AQOA 3LCWA 4OQVA 2V3DA 4YTQA 1YPIA 1SMDA 1AW2A 1XIDA 4M51A 3FX4A 4HJWA 3RF9A 4Q8OA 1SFTA 3ARWA 3T42A 4QLLA 5KZDA 1H5YA 5D9PA 3H2EA 4HK6A 1PL9A 5LA2A 2W91A 2PRLA 2YGYA 3M64A 2CKSA 5F7UA 4NUWA 3USZA 5F2GA 1QPKA 1PJ9A 1FH7A 2XZ9A 4KFOA 1E9YB 3A5FA 2B7NA 2WSKA 4LAUA 5CJMA 4DXKA 4LYQA 3MMWA 1OD8A 4UCGA 1FDZA 2J7BA 3S83A 3HG3A 4MPQA 4GUHA 4U5IA 3N11A 2TAAA 1GZ1A 1U5JA 1UKTA 2D3LA 3TJIA 4F79A 3TAKA 3BXWA 2YFNA 1VIZA 1YIXA 3TC7A 4QIUA 3EX2A 1KBLA 1NQ6A 1BPLB 1W1PA 5FF0A 3ARXA 1V0LA 3UWWA 2INEA 4TO8A 1H4PA 1O68A 2OWCA 1V8EA 4PRWA 4CNTA 3MJYA 3KE0A 1FCQA 3WKZA 3M46A 3EWUA 1VJSA 4W88A 3CPRA 2Y62A 3D3FA 4IICA 4ZE4A 1F05A 2DIEA 3UWZA 2MNRA 2J74A 3OPSA 3IK4A 4GX9A 2PDXA 3GXMA 4X9YA 3DGRA 2IPFA 2PAJA 4E4UA 1T99A 3CZEA 3TQ0A 1B1YA 3KS5A 3LQGA 4IIDA 3E1F1 1A0EA 2VT0A 1I2NA 1WDRA 3U7BA 2OLSA 4MWAA 1I75A 1SZEA 2J9XA 1UMYA 2YA1A 3GD6A 2QPSA 4JHMA 1DV7A 2VZSA 2VX7A 2RJGA 2GJLA 3WNNA 3N04A 3WQFA 1IXOA 1U5VA 2EPMX 4RDYA 1VYPX 4YN5A 2QR6A 3VKJA 1QBBA 5XINA 4UR9A 1D7FA 4TUFA 2ZQ0A 3QY7A 4O57A 4B16A 2V6AA 2D73A 1XLFA 3LPFA 4IPPA 1JL8A 2JKPA 1YTEA 3O6AA 1JXJA 1Z48A 3SCVA 4JTTA 2VX4A 1XLCA 3LBMA 2XVNA 2ZA2A 3R58A 3VKKA 3FHAA 1E9IA 3OU8A 1W1B1 1GGOA 1FXQA 3QSTA 3IJ6A 2WHKA 1OGSA 1JZ7A 4Z0JA 2PTWA 1P7TB 4G56A 3LCHA 4K36A 4O15A 3WDHA 4EKJA 4IPJA 3PZUA 3GFXA 3O0KA 2PLJA 4D71A 2POTA 1WNOA 1AL8A 4J7RA 5J8LA 4P8UA 4XZMX 2PI6A 5FA5A 3UGVA 5SWUA 3RR4A 1BRLA 3NPVA 5I3IA 1P0NA 5D38A 4IPNB 4XZNX 3RMEA 3L2LA 4YVVA 1KWGA 4IG2B 3S4TA 2X1TA 4ICNA 2J66A 5HNTA 1OCQA 1I1XA 3MDUA 4Y2WA 3IV8A 1BF2A 1OGBA 4GFSA 2OXNA 1E6PA 1YBQA 2PTXA 1FHUA 1JDEA 1W3HA 4F0LA 1FWWA 4GOAA 2AMXA 4DNHA 3N13A 4WOQA 3FJLA 3DI1A 4MSSA 1FFQA 2XM1A 4HBKA 2OQLA 4PMUA 5A8OA 3QY8A 3ONCA 3QJAA 3EDJA 2PC4A 4HN8A 4WOZA 4CQDA 2FZBA 1XD1A 3O6DA 3ZQ9A 1G7VA 4LNCA 2Q71A 3BG9A 1XCWA 3GUGA 1KBBA 3UG3A 1LOLA 2RJHA 5LHEA 4RZ6A 3LDVA 3UXDA 5EU9A 2PD5A 1PCWA 4HNNA 1JYXA 4CQCA 2B7PA 2A3EA 2V68A 1B54A 1YLVA 1M03A 3LERA 5BW6A 2BDQA 2GVYA 3W2LA 4XWUA 3V5OA 3NO5A 2D24A 1LLOA 2ACUA 1VD6A 1QPRA 3B05A 2VCAA 5T26A 4WF7A 4YWIA 3SURA 4HU0A 1PTDA 1GYNA 3G3MA 1P0DA 5I24A 4O1BA 3TR2A 4Y96A 1EWEA 5GPRA 1UWUA 4AXKA 2I1OA 2GGHA 3DYMA 4PN2A 4DO5A 5C0QA 1TCDA 3DH7A 2PWGA 3UETA 3LA4A 1QR7A 1NDVA 3WO8A 3AHTA 4LVGA 2AGKA 3E5BA 4PEKA 3G0XA 3EWWA 4O19A 5LGXA 5ECVA 4OFCA 3ITOA 2ZXDA 4JQAA 1EBGA 4IT1A 4GPNA 4BF9A 1LDCA 2JEQA 1EJWC 4M6PA 3LI0A 3QOKA 3WH9A 3TN5A 4AVFA 2Z1BA 3GBDA 2NQHA 3GYEA 3ID7A 2X1RA 3EA1A 1Q63A 1QJWA 1EP2A 1THFD 3DXIA 3TSDA 5D8WA 1MSSA 4BI6A 1ALDA 4GZIA 4WJXA 1TWZA 2ZOXA 1VPQA 1BF6A 1ECEA 1T7LA 4M7TA 4ZXOA 2FH6A 2QPUA 4B5UA 1DEDA 1GG1A 3CQ0A 4EXAA 3PZVA 2R1KA 5RUBA 1YDVA 3EA2A 2GPTA 3MSGA 4GJ1A 4M19A 4H9MA 1MZRA 4EAMA 1EGZA 3A6OA 4K39A 4KFPA 5I3GA 4R9XA 3AJ7A 3R4IA 3UJFA 2YR1A 4E5TA 4B5VA 2D22A 4PZVA 4AEFA 2DSKA 1JNEA 3RO8A 1DHPA 1H41A 3GC4A 3C3NA 2Z27A 3S1VA 2PU0A 4LUJA 2E7FA 1XBXA 1J6PA 3K13A 4GKTA 4OBTA 5EMYA 8CGTA 3SR7A 1KA9F 3CH9A 1DJNA 1OBAA 1QI0A 4BI7A 4WDWA 5JMUA 4BWLC 3GDLA 1J0HA 1QBAA 3VC6A 1KM6A 1EX5A 1Y8BA 3DHDA 2J77A 3M0KA 2PGEA 2PDFA 3HZ3A 4WDUA 2BVWA 2O0TA 1LBLA 5CLWA 4IMGA 4NL1A 2FLIA 1R7OA 4R88A 3GVWA 1V6XA 4URIA 1JD7A 1L8PA 8XIMA 3THUA 1Z9AA 3UR5A 1Y5VA 4IM4A 3U48A 4BQ4A 3SQSA 1P7TA 4O0KA 3KBNA 4GYKA 3ZJ7A 1HUVA 3KL0A 1ZB5A 4C90A 3PR2A 2PDUA 3G22A 2QDDA 3W2KA 4JZ5A 3GYCA 4K3ZA 1NDZA 2OX1A 3GDTA 4GY1A 2P10A 3N73A 1AZ2A 2BY0A 2Q3RA 2NT0A 1E1FA 1GUVA 1M7OA 4UNIA 3QV8A 3LHVA 3W1QA 2FHFA 3LNMA 3PG9A 2ZFAA 1PE1A 2VD8A 3CB3A 4ZGYA 3C2EA 1RK6A 1TPVA 3UZ5A 3RM4A 1YNPA 2VHLA 3VNDA 3PZOA 4LV4A 5CSRA 4KWWA 3THAA 4ATWA 4CN1A 5CQ1A 1EJRC 3B3DA 1TWWA 5C55A 2VFEA 2GQ8A 1ZPTA 1JYWA 1UZHA 3BLEA 1A0DA 3REQB 1QHPA 1TG7A 3A4WA 2X41A 1KCKA 2P88A 4MY8A 5CGMA 4G1NA 4MNJA 2Y70A 3CHVA 5FL0A 1VHNA 4DUVA 3B0PA 2QVNA 4A3HA 4RX0A 4N02A 1TUXA 3PZGA 2BOFX 3BZGA 3P60A 4GI8A 1T8QA 4DBEA 3EKLA 4OHQA 5D9MA 4LCRA 2X0HA 2X7VA 3MMTA 3NNTA 3QVQA 1TZ7A 1DXEA 4PA8A 3CL6A 3THDA 1RAKA 1TWSA 4TR9A 1E40A 1NP2A 3R6IA 2V5CA 4PUDA 4O18A 4MUZA 2ZC1A 1LWIA 3GH5A 3SO7A 1ICPA 2F8QA 3CIXA 3DKLA 1LWJA 3GKAA 3LCLA 1ICQA 4WIWA 3W85A 1PKNA 3GE7A 3RNDA 3TTQA 2Y8UA 5A95A 5C9RA 4W7UA 4Q6JA 3N14A 3E2RA 3GZAA 3FXYA 1S5TA 1U83A 5HJXA 2PCQA 1XIFA 4JTEA 5EB8A 2V5DA 3QR1A 1TE1A 3KBMA 4NXSA 1EGVA 3I4EA 1LQ0A 3WENA 1YNQA 3G1VA 2AKZA 4PRRA 3AZTA 1XP3A 1GORA 1W91A 2HK0A 3BCDA 4IXHA 4HA1A 4NZ1A 2YL5A 3A23A 3WD2A 2CEQA 3JUGA 3DCPA 1B3XA 5IXEA 2PZNA 3DYPA 3EX4A 1JCXA 1FWGC 2CLLA 1UG6A 5HWJA 3VDCA 1ADOA 1ECQA 1PZ3A 4L6OA 4CD7A 5TF0A 3KOWA 3PB0A 1QAPA 4J3WA 1Q2RA 1KBJA 3P5YA 4L4LA 2UY5A 3GZ3A 4O4VA 3CEPA 1EWDA 4KRZA 1HJQA 2ODOA 2O9TA 2PDIA 4Q4PA 3R12A 1EXPA 1VF8A 5DY3A 2D20A 3VGFA 2WHLA 1PKLA 4M24A 3CUHA 3IGHX 2J25A 3NQAA 2D2JA 4GK8A 4TV6A 3WD4A 2PWUA 3U8GA 2PB1A 4HPJA 3GQYA 2HE5A 1M1BA 3CT2A 1CLKA 5HWMA 5CGQA 4XSLA 2ZBTA 5AZ0A 4FXJA 1H09A 1UIPA 1JF6A 1C9WA 1TQXA 3QV9A 4G8TA 4UQDA 5E1QA 1OIFA 4K7VA 1WKDA 4DPPA 3NQFA 4KETA 1QU4A 2FZMA 1TE6A 3VNIA 4FX7A 3VAVA 3H26A 3KRSA 4YIWA 3SFWA 1FWCC 3INPA 4PFHA 1V08A 5H8MA 1W3IA 3VPLA 4HOZA 5K2ZA 4QP0A 4QG6A 4CD4A 3CV6A 3SSZA 2PDLA 4Q3MA 2WNNA 3AIVA 1DTUA 3QYSA 1LQAA 3FS2A 3FXGA 2BXVA 4I5UA 1K70A 1XC6A 3EOLA 2OKTA 4RKAA 4PMVA 5D37A 4UCFA 1B5TA 4WKAA 3QOMA 2QCNA 3BAKA 3C52A 3LSBA 4NJGA 2VEKA 4P7QA 3STGA 4XZLX 2ZZ7A 1YXYA 1P5BA 3RK8A 4KKXA 3M41A 3EA3A 3QV6A 2HVNA 5A6TC 4RPQA 1XRVA 4TQTA 1Z89A 3QTPA 2O56A 1L6YA 1XBVA 1QI4A 4RXGA 4ONVA 4JPGA 5A94A 4ADTA 5B80A 1JGMA 3BSMA 1WXZA 5EMJA 1W5PA 1JDDA 3EEZA 4B4HA 4ZEPA 1JZ6A 4LJ3A 3ME3A 4FLSA 2XH0A 4ZB5A 4HPHA 3PANA 1US3A 2BNJA 4UQ9A 2OYKA 2P8CA 2DIKA 1BXCA 1ZJBA 3HU7A 4FEZA 3VOFA 4K1WA 1AA1B 1W32A 4PE8A 1PXGA 4YVXA 3AFBA 2B31A 3REQA 3IVUA 4L61A 3EEGA 1FFRA 4HMEA 4E38A 1YQ2A 1F4HA 1W5NA 3F1QA 4X0NA 4JX5A 2OWXA 1WKFA 4ZQOA 5IFPA 1V6YA 4LH8A 2Y85A 5LIUX 4Z2JA 3G18A 3M5ZA 4H04A 3F5LA 2ALDA 2HPMA 5D2YA 2HNHA 5D2TA 3WX7A 5GJPA 1J0JA 1KXVA 3DHUA 4MNMA 1T5AA 3PK7A 3CO4A 3TOPA 2C91A 2MUCA 2PWVA 3ARYA 4N42A 4EVZA 2QDEA 4DJEA 1GVQA 5I23A 2WKLA 3DDMA 1NFPA 4RDVA 4AWTA 3AXMA 3RUBL 1HVXA 3OGRA 2H8XA 3T0DA 3WK1A 1MRQA 3GW3A 3M6DA 3UESA 1RCQA 3F4VA 3MKCA 1H1NA 4GG9A 2EEXA 3KX6A 2BVTA 1IXNA 1W9PA 2CHOA 1TJ0A 2W9MA 4ZL1A 1RJQA 4HHLA 1WXJA 1EBHA 4NZJA 5JUVA 1E0XA 1O5RA 3SECA 2ABAA 3CASA 2NUXA 3TOYA 3HQ1A 3G1FA 1EIBA 3UR7A 4MOZA 4ZQNA 3QKZA 4KEZA 2JALA 3GVRA 3CAWA 4DJDA 4PMNA 1A47A 3PULA 5KSWA 5CSSA 3GC5A 4I9JA 1AZ1A 3BW2A 4JOMA 1ITUA 1V6WA 3PJTA 3SSJA 3A9BA 1TMHA 4ML9A 4H6QA 3C2YA 3VDAA 1J5TA 1FTXA 1U33A 4E3VA 1QNSA 3DFQA 4AW7A 3UQNA 4DYKA 5BRPA 3DC0A 3OQEA 7A3HA 1XDLA 1GCYA 1PDZA 2TRSA 2A1YA 3VNMA 1TO3A 4FLRA 3N6JA 4TIMA 4FX8A 5LNWA 1L8NA 3N19B 3W71A 4X2PA 1EQPA 3W7KA 5JIPA 4UTJA 5FCZA 3N12A 2J9YA 3TW6A 2ACSA 1KRCC 3MMUA 4P5UA 1OFRA 1JZ5A 3CV2A 1KXTA 4L1WA 4CEXC 1GPFA 2GYIA 4ZQRA 4NI8A 2ATSA 2NT1A 3BUVA 3EBVA 3VD7A 3JZUA 3WLPA 5DCDA 4JFUA 2CC0A 1Z8AA 4OGZA 3URBA 4ZTXA 1XWYA 1JZ8A 3MW7A 4JX4A 4C5ZA 1VLIA 1XLHA 3W24A 1M7PA 3WLLA 1VHCA 1VFLA 1GVSA 4P7NA 1HP4A 3Q45A 4LAMA 1XGDA 4Y7EA 5D9OA 5I0DA 2WYSA 1LL4A 2ESCA 3CU2A 2WJZA 3AIRA 1G4EA 3VFCA 3UVIA 1GT8A 3CWHA 5K4ZA 1GKRA 1GQJA 5HNNA 3LBOA 3OG2A 4YTTA 2FKPA 1JRBA 2OODA 3XIMA 5IOBA 4AIUA 1UD3A 2O9OA 4US6A 3VOCA 4F0SA 4QE1A 3BAIA 4UWMA 1VC4A 1HJWA 1NIUA 3IVSA 4ZBCA 2VELA 9XIAA 4LYRA 2FVMA 3TN4A 1NY1A 3VNKA 2OLAA 3B40A 2NSXA 4YTRA 3OBKA 3PTKA 4KWSA 1M6JA 3H8AA 3VIOA 3V0UA 2PD9A 2PGWA 2VDGA 2BBFA 2I5GA 3JS3A 1G5AA 3NCOA 1KWKA 3ZT5A 4PMJA 3NXLA 3PZMA 1C29A 4ZZ9A 5BOOA 1JD9A 1WZAA 4GUFA 4MUPA 5FD0A 2A6LA 4IZGA 2PPGA 2Z1SA 1TRIA 1R2RA 4IH3A 3L66A 3QR3A 2H3BA 4XG1A 1ZQ5A 2OT1A 3B8VA 4DJFA 1WE5A 1KR0A 4IGNA 3FDGA 4PMQA 3KOZA 3A21A 4UTTA 5E5CA 1E51A 4J1OA 3PTQA 1TB3A 2R14A 3LU2A 5LNRA 1LUCB 1VR6A 4CNSA 1KBIA 4ASTA 3Q2DA 1EJ7L 3KL3A 3MP3A 4KEMA 5JVLA 4XZBA 4UTMA 4WX2A 3MCNA 3W00A 3UA4A 1XYBA 3TYCA 2XM2A 1BG4A 1ITCA 5FJUA 2HROA 5A8MA 3M43A 5G2IA 2ZZ2A 3IRDA 1QDSA 2PURA 5T8GA 1GOQA 4HHPA 1KCXA 1A0CA 3T4CA 1XPGA 4MFEA 1XYFA 1WYIA 3AOFA 4QR6A 1E6RA 6A3HA 2QCMA 3PNUA 4QEHA 1UWQA 1XINA 1OFOA 2PFHA 2XZ7A 2YCLB 4UUIA 4HPXA 1A4MA 3FVDA 3LLDA 5GQBA 1UYQA 4Y8EA 5G5IA 3UPWA 3BSGA 2VGBA 3B8SA 4JICA 1G69A 4K2SA 4AYGA 1OJXA 5D8ZA 2AGTA 3G1XA 3M0HA 3P0XA 1JCTA 2KAUC 2QS8A 1XLAA 1Q13A 1A3WA 5DMLA 4QQ3A 3S46A 1R3WA 3U2ZA 1S3HA 2WJEA 4IIGA 4BI5A 2ZVRA 1HL8A 3FKRA 3IJ8A 3WQ4A 1XF0A 4NI3A 3MP4A 1L6SA 1V0NA 3SQMA 2C14A 1TMQA 3TFCA 4B9ZA 4IQDA 1VFUA 1GW9A 3S2JA 3O8AA 4YMZA 3C8FA 4F8XA 4O50A 1KFEA 2WHJA 2V9DA 3BK0A 4IMDA 2ZUTA 4LS1A 4MWAE 3BLFA 1ZSXA 4BF5A 1OK6A 4A05A 4CCDA 3R0UA 2EPHA 3LBCA 4MGGA 1TR1A 4IJCA 2QJIA 4IXXA 3TYDA 4JIIX 3GDBA 4WK9A 1RCXB 3GU1A 3GHSA 4GKLA 2G5WA 4PUEA 1XQLA 4X61A 3KHDA 5HQMA 5BROA 3B9OA 3AU6A 1R30A 2NWSA 4HZMA 2NQ5A 1R86A 1T40A 1TFVA 2E9LA 3N2MA 3IJIA 2PF0A 3BW3A 3AHVA 3FCPA 2Z4GA 2E5BA 2EAWA 2NVAA 1WOAA 1G67A 4BK9A 3QQWA 2XIJA 4JIQA 3EOSA 2D23A 2VOMA 4FAMA 3K1GA 1NEYA 1SZRA 1XLIA 4HMDA 2X1IA 4PR4A 4Q33A 2OTDA 2E3ZA 1TQJA 2VFHA 1S38A 1OCBA 2PA6A 2OSYA 4D1IA 3R7MA 3UXKA 3RRAA 2V2CA 4WJEA 1W9UA 5A6BA 3QLDA 4Z08A 1WBHA 1UP2A 3E0LA 3DUGA 4J28A 1FCVA 3DERA 6TAAA 5GJMA 4B2DD 4Q8PA 2JF7A 4JNYA 3BTNA 1VEMA 1IHIA 1BVWA 1ONRA 4HNTA 3RXZA 2F84A 4S3DA 4NNCA 1E55A 1EZWA 1L9WA 1CGTA 3ES8A 4GQQA 3PC0A 5M17A 4XBJA 4XX6A 3MV11 2RKXA 3CQKA 5DQPA 2JGQA 5AVHA 1S2UA 1O60A 2OMAA 1IEQA 2IPGA 3UWEA 4Z1CA 1YMYA 3BW4A 5LIXX 4HKPA 5A5WA 1RV8A 4AIEA 2X0YA 1IWAA 1ICSA 1OFAA 3IJQA 3HJZA 1M01A 4JDBA 1Q6FA 3GXDA 4XBKA 3GM8A 4AY1A 5H8PA 4AZCB 1B2YA 4CD6A 4Y9MA 1F8MA 1H0GA 1OG6A 4LVBA 4QJ4B 2PMQA 3VC5A 1F3WA 2DZPA 1BYDA 4LWWA 5FOOA 2J8GA 4HA3A 4AZ7A 4D8LA 4GVIA 2V3FA 1NOFA 1W56A 1W0MA 4POCA 1EJVC 1XDJA 5HNRA 3W7GA 1IV8A 3W1NA 3F03K 2HK1A 4YTSA 3CYVA 3H4WA 1CEOA 1W1A1 1KCLA 2XHYA 3ABQA 1TTQA 4ZXLA 3NGFA 1TPUA 2EQDA 3LCGA 3PJXA 4DO6A 1KKRA 1Q7ZA 3TTYA 2DZWA 2VD9A 4D6DA 1J93A 4PBGA 3ZSSA 3F4CA 3S5SA 1ZJHA 3EDDA 4EACA 3IJ9A 3TYBA 3AS2A 2EG8A 3BLPX 2B7QA 1ZRQA 2AKMA 3TYZA 1VS1A 3NQDA 1D3GA 4I5RA 3SCPA 3TCSA 2YZ5A 3H23A 2Y7FA 2A2IA 3VIIA 2DT2A 4UMAA 3KBSA 3O15A 1E0VA 2DH3A 2HRWA 5FEZA 4PSRA 3II1A 3LYEA 4OE7A 3TWAA 1HT6A 2ZE0A 1YX1A 2IKIA 2Y2WA 1A5NC 4BQ5A 2ON3A 4DYEA 2P50A 2ZX8A 5AHEA 1GOXA 2IQ0A 4UNLA 1HN1A 1MO0A 3VFLA 4X3ZA 3PBMA 1JZ2A 4MB3A 2ZC8A 3NYDA 3NUKA 3C2OA 4XD6A 3SM0A 2R82A 1GJUA 2DU2A 5E70A 1UB3A 3T7VA 1OY0A 1MYRA 3GR7A 4DO4A 1KM1A 2Z2BA 2XVKA 4GABA 4IFRA 3CZ8A 2PBGA 2XFWA 1ZJIA 2R24A 4H9VA 1QPNA 1DVJA 3FY1A 2QDHA 5FAGA 3W3OA 4LOCA 2CKRA 4Q22A 2QW5A 1XS2A 4HYWA 4QG8A 2ZTJA 3VKBA 1BXBA 3MMDA 4XD3A 2V30A 3G6LA 2Y8VA 1UBPC 5C70A 1E6XM 3SBFA 3KS6A 4H00A 3BC9A 3S5ZA 1C8QA 1FWDC 1N2VA 3RITA 4W8BA 1CGUA 3KHJA 1AQMA 3AZRA 1ME9A 1XQKA 3EPNA 3LLXA 3WUEA 1F74A 3A3XA 3W81A 2XWEA 3ALFA 1RJPA 1X7IA 2E5DA 2J7GA 4EWJA 4QLJA 4ZO7A 4N9BA 5HMEA 4MB4A 1EJUC 2VWTA 3PBUA 3HO8A 3NPXA 3H6OA 2PRHA 1QWGA 4YVPA 3UWQA 1XM3A 6PTDA 3VIFA 1E0UA 3MDWA 4CD5A 1NOWA 3M6YA 4GQ0A 5E93A 4IX2A 2EPKX 3DKJA 4EE9A 3WQEA 3KDNA 1W1VA 2J78A 5A69A 1P6WA 5K9DA 3KOXA 2WKGA 3O6CA 1ZL1A 5AZ1A 4GGBA 4CLMA 3RLHA 3IAPA 4H2CA 3MANA 3VOJA 3T2OA 4H8NA 4EOUA 1OX5A 3O7UA 2DVUA 3OEXA 5D32A 1Q7MA 1NF7A 4PRTA 5EMKA 4S2BA 3SRFA 2D0FA 3OZMA 5CSYA 5PTDA 2OZ0A 3MWAA 4XD4A 1LRQA 1X1ZA 3GNDA 3T0BA 2HS8A 2G3IA 5DCEA 2QDGA 3VCNA 4N2YA 4YHEA 1TIMA 5TBOA 3AALA 3D3AA 1EO7A 3WJSA 4W5UA 1J0KA 2ZE3A 3KUMA 4ZENA 1GJPA 1Y0EA 5J5RA 2XIBA 3GXNA 2CZ5A 2ZA3A 4J2PA 4MZ8A 4AVOA 1S39A 9XIMA 1XRFA 2YIHA 2HWGA 2QIWA 3BGGA 1N55A 1HKJA 1VQTA 3B06A 5BU9A 3CK5A 2V82A 3W29A 3A3HA 1KTCA 1F4AA 1A49A 2VCCA 3UZXA 1V0MA 1F8IA 1SSDA 2F2HA 4L9XA 3RR1A 4DJED 2D69A 3MBDA 1ZCOA 3N3TA 1W3NA 4UC5A 5HXMA 1XCFA 2GOKA 3CTLA 1WA3A 4BZYA 1R3TA 3WZ0E 3V1PA 3QSRA 3FFSA 3UY8A 2VMFA 3U57A 3BH4A 1JCLA 3UP8A 4GUIA 2GVEA 4CCCA 4DM2A 3MKKA 1P48A 3VD3A 2G95A 3TQPA 5AC6A 3APYA 3W84A 3QBUA 4Y6GA 1BTCA 2Z24A 3W1PA 2F38A 2V69A 3S1GA 2BASA 2WMKA 4NJHA 3S47A 3AXIA 5BMXA 3GNPA 3NVDA 3BLIA 3RAOA 1CB7B 1W9XA 2VUYA 2WC3A 1K4GA 4J3SA 4DUXA 2BG5A 1TVPA 1O94A 4DJDD 2GJNA 4GLEA 4DYJA 2EF9A 3HQPA 4GRSA 1MXSA 4QNWA 4L4PA 4A35A 4XO6A 5M3WA 5D05A 1LORA 3EXTA 3GHUA 1DWHM 4MFDA 1GG0A 1VBHA 2RHGA 2DZAA 3QGKC 5I03A 3TLLA 1KV8A 2WBGA 3MHGA 2XINA 1QI5A 4XTIA 1G7UA 1PX3A 4CCZA 4CNNA 2J8FA 4S3GA 1NWRA 3GDMA 3OTRA 2XFYA 4ES4A 2ASHA 3B0VC 3W26A 3EWZA 1L6GA 3A4AA 1E6SM 3VNLA 5JBDA 1A5UA 5F1VA 1A5SA 5T9CE 5JXQA 1V3KA 3TC3A 3KCLA 3WN6A 1SJAA 5I09A 1QTWA 2YXOA 4JN8A 3NOYA 3IUIA 5CZKA 3OGVA 1SR0A 4LS2A 4LVAA 3W7LA 4BQ3A 1Q6LA 1AQ0A 3HBLA 3FAWA 1C90A 1AMKA 4AIBA 1B57A 1S1PA 2WZEA 4LX4A 3ZOAA 4ORIA 3F2DA 4Z1AA 1RP8A 3P14A 4Q4SA 4MLRA 7REQA 4YS1A 1CWYA 4QBXA 2ZXAA 5J5DA 3P6LA 3QPEA 3SCTA 4HSHA 2WNQA 4ENLA 4A21A 1R5YA 2WM0A 4AVNA 4B90A 3TCEA 4C6JA 3UYCA 4E2BA 4MAZA 2WSQA 5FJOA 3CMJA 3SDOA 3QLLA 3E0VA 3WF4A 1G94A 2BGSA 3PVFA 4HZ8A 4DJEC 2PP0A 1R47A 4R3UA 3KW3A 5A2CA 2E5CA 2WMGA 3C61A 3ES7A 1NQKA 3H7VA 5IBXA 2HISA 3IACA 4ZQMA 2P53A 3KWXA 1K9TA 1TJPA 5KZ6A 2VJXA 4IFKA 5TAOA 3V1HA 4N0RA 4LYKA 1DXIA 4HT3A 2WZMA 3P7YA 4GY7A 4PB3A 1RBLA 3VE7A 1JDFA 3W7NA 3F5JA 1P1XA 3W7EA 1CXLA 4NZ3A 1XLEA 2QF8A 5CPLA 1UC5A 3A4JA 3O06A 4DJDC 1BKSA 3CJPA 4LYPA 2JE8A 3A9IA 4ROQA 3UCCA 3BAWA 1S2VA 1X6UA 4KWVA 3I7RA 2CLMA 1PB0A 4DVOA 4MLJA 4O0QA 3F5KA 2V5LA 4YHGA 5I3DA 3L23A 5FESA 3W72A 4AEOA 1REQB 5CKSA 1YRRA 1S5VA 4GC3A 4JL1A 2TODA 1KNWA 4FLOA 1JYVA 1A3HA 3KOYA 3VX0A 3ARSA 3IJLA 4O14A 2BVYA 1HO1A 1JAEA 1X96A 2FMOA 3W6MA 4H7VA 1EDQA 1YXDA 2V81A 3G1SA 1BQGA 2KX9A 1V3IA 3APTA 3VTRA 4YNGA 3QRHA 1XYCA 3WY1A 4MG4A 4NY2A 2PLMA 4F0RA 3TMLA 4AD3A 4WXYA 5LIWX 4BA0A 2HVMA 4GZEA 1TV5A 1ZALA 2IKGA 3DIPA 2PDNA 4O28A 1MQPA 4N4QA 1PTGA 1KXHA 4XZ9A 4GNKB 1OINA 2VGIA 4XKYB 4B5XA 3W22A 5KZEA 3EX1A 4JFSA 4D9PA 4B3ZA 3M5YA 4EP8C 2E0PA 2FB3A 4TMCA 4KESA 3CPGA 3OVPA 4DBWA 4ZQCA 3DOPA 2ADAA 4GACA 1OFEA 4EPKA 4H6RA 1FWTA 5K9CA 3OZPA 3R10A 3QKEA 2ISDA 1LL7A 1IXQA 4A6GA 1UP0A 4YTUA 2ZVIA 4M8UA 5DCBA 4ZFCA 1UJQA 3SJ3A 1PCKA 2OJPA 3W6YA 1NH6A 2R1MA 3WD0A 1ZAHA 3AROA 3VMPA 2IXUA 2J79A 3NZ1A 4GYPA 3WDQA 1QK0A 4E2VA 2PUZA 3C0LA 1MUCA 4RE0A 4AF0B 3LNPA 1GOIA 3ZVIA 5CG0A 5FJRA 3GG8A 3LGGA 1H5VA 2F7FA 1OZMA 3V16A 1O6IA 4XIMA 3H4GA 1R2SA 2JKAA 4GNJA 3GU9A 2NXIA 3UR8A 2PWDA 1YYAA 4YWSA 2R1LA 3MHFA 1JXKA 1ZGDA 4BS0A 3WQ5A 4W8LA 3VOGA 1O7AA 1E3ZA 4UTTC 1IE7C 1YADA 4ADUA 1TJ2A 2WZIA 4JY8A 3D5HA 1A53A 2NQJA 4KFNA 5BYWA 1J18A 1PSCA 5HJLA 6CGTA 4Z0SA 1LROA 3DFPA 3ABOA 5CZ0A 5GVJA 2C18A 3TTOA 3VNZA 3WUBA 3M0IA 4GUJA 4AD0A 1X1OA 3VK5A 3W1XA 4C6NA 1XLLA 2QAPA 5A6BD 1IWPA 4JN7A 1YPFA 1HIZA 1R85A 1PIFA 4ZSUA 1WDSA 3Q67A 2WBKA 3NQGA 2DIJA 3UW6A 1CZ1A 4UTWA 3URQA 4XSMA 2YW4A 1MEHA 1XYAA 3MVTA 3AIWA 3HMCA 4US5A 4R7WA 1FUYA 4V28A 3UCDA 3H7RA 1C9DA 3GAYA 3W7IA 1ODZA 2WMHA 4IP4A 4O54A 1RXOB 4LAOA 1GZGA 1JR1A 5B7ZA 2W67A 2CW6A 3A12A 4GZ7A 3NOEA 3PSVA 4LPCA 3TMQA 3LI1A 1SFSA 2VDIA 4M1BA 4DXXA 1M53A 4O13A 2I9UA 3HQNA 2PSNA 3W37A 3GR8A 4Y9PA 4RV8A 3I6RA 3S8HA 3TE9A 4QDMA 3VMOA 2X09A 3F2BA 1QWKA 5I79A 3T81A 3W86A 2DW7A 1VJIA 2ZRWA 1SZGA 1V4YA 3BV4A 4OUEA 4HMCA 4NYYA 3WSUA 1I0BA 4OV9A 1F76A 1R2TA 4FNRA 4REQB 2DZXA 1V7AA 4A29A 3P84A 4GHRA 1QNPA 2ZX9A 4BHYA 3KOFA 3CV1A 1QFEA 1IT0A 1CIUA 4C6QA 2YCJA 3S6TA 5FJTA 1REQA 1D3HA 2JF6A 4PODA 1R3QA 4FXSA 3M5VA 5AYZA 1E0WA 3ZZ1A 4WXZA 1RUSA 4GE8A 4GC4A 5L6UA 1AG1O 4WUIA 2J6VA 3VIMA 3DHFA 3NO1A 3W53A 3AJXA 3T0TA 1UUOA 1EP1A 3B0YA 4OECA 4QLKA 5FIPA 4CKQA 3WIJA 1ZBWA 5HQEA 1OZQA 2YCEA 1BVZA 4UQBA 1HJUA 1PVNA 2IKHA 2AQWA 4BF7A 3KLLA 1AJ0A 3KTCA 1UQZA 1VFFA 3MYPA 3CTTA 3UFYA 1FHVA 4ML4A 1JG9A 3TA6A 1OWQA 4P2VA 1L6WA 4QNEA 2QKFA 2XIOA 3LRKA 4NX0A 2E8YA 4LC6A 2F6UA 1VPXA 2E1WA 1Y7VA 4O12A 4XKYA 1OFBA 4AC1X 1H0IA 4O1AA 2PDMA 3CGTA 3I4KA 1FCBA 1QW9A 3T2QA 5I02A 3IARA 3FV9A 3G2GA 1IEWA 4NHVA 4C5YA 4DIAA 3TUUA 4F9DA 4IQEA 3CUXA 2OOGA 1OX6A 4LCQA 4LY4A 1SZNA 3N1AA 3TTSA 4JY9A 2OYLA 1R9YA 4P61A 2V3EA 3CHEA 3P61A 3OLDA 2DY3A 5DANA 1L6FA 1UWAA 1GOKA 3MSDA 4QJ1A 3DG7A 2QJMA 2GJRA 4H01A 3VGDA 4HNOA 1E6NA 1CECA 1XX1A 4JIRA 1W6TA 2G4FA 2F6XA 2C13A 2Z00A 4AD2A 4UNKA 1F07A 1CXFA 3RM8A 3K4AA 2PDGA 2Z0IA 3CQHA 1ZLPA 2C79A 4Q7BA 3PAOA 1XSKA 2DW6A 3AIBA 2Z1WA 3STEA 5CPOA 3DZ1A 4Q4KA 4GI6A 2C3ZA 4H6EA 2FGZA 2DUZA 1YPXA 4G2DA 1UR9A 1EB3A 4BEQA 1GONA 3UJRA 4H6KA 3BOFA 5AKQA 3BE7A 2G3MA 8XIAA 3WJYA 4FNSA 1QOQA 4H3DA 2QAFA 7TAAA 4F2BA 2G97A 2J62A 2JEPA 2QCDA 2DP3A 1JFXA 3H7UA 1CBGA 3M0LA 3SZ8A 2I7GA 2QCEA 5AYYA 2PS2A 4ZOAA 2GDVA 3U4FA 4QSHA 1UOKA 1OABA 4FNPA 4QISA 1PHQA 4HA4A 3ZS4A 4XUGA 2NVCA 4Q8WA 4P7OA 4IQJA 1A50A 1TZ9A 1GQIA 2R6OA 4J40A 4J35A 1QNOA 3CMGA 5ABTA 1CX9A 4TTGA 2VFDA 1MVYA 4DRSA 3TJ4A 2PDHA 1OQFA 3UZWA 3HPSA 2V0TA 3QFWA 3STCA 4OV4A 2JGYA 2WZHA 4IF2A 3EDKA 3GDRA 1JUEA 3UCQA 3R94A 2NXHA 3NQ7A 3W6LA 4U3AA 5DXXA 5EGRA 3W23A 3WNLA 3BOXA 3BV7A 3ZR5A 4OIFA 2VUNA 3HPAA 3KVKA 3MWCA 5D04C 1BFNA 1PIGA 2FQIA 3S9ZA 3LM3A 3NZQA 5C9WA 1E4MM 4E8GA 3NWRA 3SFKA 3SB0A 2X7WA 3LMZA 1J6OA 2PGRA 3F4DA 2YLLA 3JVAA 3A4XA 5DMMA 3LLFA 5F4WA 4UTHA 3UWVA 3L4XA 1XRSA 3KFTA 3JRKA 3WMLA 1TPFA 4RR4A 1R87A 5E9AA 2PDWA 3PUOA 4IJBA 4REQA 4HOWA 2UY4A 2ICSA 2C1IA 4MPKA 4PTDA 4H8UA 1NU5A 1RHCA 1SW0A 2IPWA 5HNUA 4WSJA 3A24A 4I9AA 2VC6A 1LWHA 2YCIX 3QMTA 1V6UA 2DT3A 1XIJA 3LRMA 3VKAA 1V3HA 2Z26A 1YHTA 1TMLA 4KQNA 5KTLA 1U1UA 5DN1A 1FKWA 1XG3A 1V6VA 2CBUA 4V1YA 2GWNA 1JFHA 1TA3B 4PUKA 4XAZA 3WBXA 2EG7A 3AC0A 3VNYA 1B3OA 1CXKA 1NWSA 4H19A 1UR0A 1B30A 2VZUA 3S2MA 4C6BA 3DEQA 4MDPA 4JHZA 3BLKA 3EKZA 2FTPA 4W93A 4PB4A 4NAEA 4IP7A 3FJ4A 5E9XA 1M9HA 3WL0A 2OSXA 4FOKA 1RCOB 2BY2A 3W1RA 3WD3A 1VFOA 4FOJA 2P8BA 4C1KA 3TVAA 4HP5A 2XIIA 1KGWA 4AH7A 4YL2A 3UNTA 1J12A 1VP5A 3W7HA 4LGXA 1GQKA 1UC4A 4Z1YA 1B31A 3UZYA 2PBOA 3T6CA 4KS0A 3CC1A 2BSLA 4F40A 4ATLA 3DYOA 4OOUA 1UR8A 3CNYA 4GINA 1XYLA 4NU7A 3VU2A 1PZ2A 2QF7A 2QUTA 1ELSA 1GNXA 3P8IA 1JCNA 2OB3A 1NM9A 1JCYA 1EKOA 2YFOA 3P81A 3DFNA 3K4WA 2WQPA 1WZLA 3RFAA 3BPWA 2F9RA 4JQ2A 4PMZA 3S5OA 1DPMA 2WM1A 4IHCA 5I3FA 4F0MA 1IEIA 5FKYA 2FZDA 5KETA 2GFTA 3MKVA 1R6WA 2OEJA 2PE4A 3A22A 3THCA 2ZXBA 1U1JA 2BHUA 1RA0A 5D2WA 3ARRA 2GGJA 3RM9A 4O1EA 4C91A 3R11A 2VI0A 1LLZA 2D0GA 3WMBA 1XKYA 2C71A 1PIIA 2CETA 4LQ1A 5AVNA 2G0WA 3UXLA 3NPUA 4EPDC 3W74A 1E9LA 3L0KA 3WEZA 1QT1A 3B8TA 4GIEA 4XD5A 4V2XA 3LZ3A 3G1RA 1K03A 4V33A 3VD4A 4MIMA 2NVDA 3UG5A 4KPLA 4OZOA 3G0SA 1WUEA 2A0NA 3RILA 2Z6JA 1HP5A 3KP0A 3IJ7A 3ITTA 1P4CA 4Z2IA 3G3DA 1OX4B 4RE2A 3AYVA 4DZIA 1UWIA 6TIMA 3M16A 2CERA 2VR5A 4F48A 1T0OA 1J9YA 4M6QA 4K6AA 4LAKA 1SJCA 4J27A 3N2CA 4UXDA 2E09A 3PN8A 3QGAC 4H8VA 2ZZ3A 3V4BA 2O4QA 1EYWA 2W6RA 3H2FA 1XJBA 2PTDA 2A3BA 1Q65A 3AWNA 4IL0A 2WOQA 2RFGA 3PPFA 3R8GA 2NZLA 2XDFA 1KM5A 4I7WA 5HMSA 2X05A 1AJZA 1A5AA 2QIIA 3EDEA 4XAFA 3ZFHA 4TXEA 1DBTA 3M5XA 3N6HA 1JPKA 1IGWA 3WLKX 1DP0A 3T44A 3BWWA 4Q6XA 3CLWA 1S5MA 4FMVA 4GYFA 3W1LA 3CXOA 4UB9A 5G4EA 2DFAA 3ZYZA 1OVDA 3B03A 4UMBA 4O53A 1KLYA 2EKGA 4S2CA 2Y89A 2RDUA 4A2RA 2DJLA 1KFCA 1DORA 3ZR6A 1VRDA 1BWLA 1FWAC 2HBVA 2VX5A 3N34A 2CZDA 2EHHA 4B5NA 1KRBC 1TV8A 1DWIM 2VM8A 1IEVA 1UOZA 2XSAA 4RV3A 2XVGA 3DAQA 3N9SA 2E1DA 1UKSA 3E0WA 1IXPA 3VGHA 5AHFA 1GK8A 4U28A 5BWAA 4J3ZA 1J5SA 1Q6CA 1TYGA 5EA9A 3BAJA 2NV9A 1OYAA 1J11A 3LXAA 1HJSA 3NJ3A 1MUWA 3AS1A 1E72M 4F4RA 1OFDA 5HULA 5KEZA 1JPIA 2XIMA 4GYJA 1K9DA 1VBUA 4FF5A 5D02A 2R1NA 1MEIA 1WCGA 2VFIA 1GVOA 5I3KA 5K9XA 5IBXC 1VFSA 4Z2GA 2OGYA 5HJYA 2DJXA 1KBKA 2CWXA 4MJ2A 2NUWA 2QPXA 3BURA 3K46A 1TIWA 3CAVA 4AWUA 1ZBKA 3CL8A 1GTHA 2QJGA 1OFQA 4Z1BA 3M7WA 3ZT7A 3WFAA 2J7FA 3CLMA 5D4YA 3ZT6A 3MQTA 4AMAA 2WVVB 1Q7QA 1X98A 1AW5A 4KRUA 3VOHA 1RVKA 1XLBA 3BJFA 1G01A 3LCFA 2OT0A 2C0AA 1SSGA 2VFFA 4AZ6A 4KT2A 3NL5A 4MY1A 3ERPA 3ATYA 3E49A 1SJDA 1M65A 1HXJA 4EIVA 2CYGA 2J27A 3EWBX 3W87A 3W07A 3VI2A 4NILA 3LOTA 3AWOA 3NQBA 2QYGA 1AUSL 1H11A 3EMQA 1I4NA 4RZ5A 5EBAA 4UFKA 3FYOA 4ZO9A 1QHOA 1E5JA 1GQLA 1F61A 1UA3A 5A6LA 2ZICA 4HD5A 3PY2A 3T55A 1M41A 2GOUA 1MWOA 2ISSA 4GO9A 1H7WA 4LBUA 4US5D 5AC8A 1UUQA 5AC4A 5HMFA 1CCWB 3GXIA 3LCXA 2Z1KA 2ZUVA 4C65A 3OVQA 1K7EA 4P8WA 4UQCA 3UJ2A 1H50A 3QHNA 3UWYA 2Y4SA 4JEJA 3DI0A 7XIMA 1E43A 3OODA 2YDRA 3UF9A 2D2OA 1K8CA 4HK5A 4AX7A 1P6CA 3CWNA 3AXXA 2VDHA 1OIMA 2VC9A 3HPZA 2CLOA 7TIMA 3TAOA 3DFYA 3N9KA 4DBSA 2VRJA 1EDTA 1SR9A 1K6WA 3KEHA 3TC6A 5HINA 3ITVA 3ARTA 1I8JA 4R33A 5FF7A 2Y88A 4S3BA 2CITA 3ELFA 3KCJA 3WNPA 1ZTVA 2WV8A 1OX4A 5A6JA 2V67A 3PAJA 4K8EA 3GDKA 1EUAA 1X6LA 4PULA 2VEPA 4QEEA 3R1ZA 3OGSA 2P1FA 3TXZA 3WH5A 3UR2A 3HGOA 2UV8G 1UIOA 2INZA 3R13A 4XZHA 3WK3A 3M7SA 4CQAA 4FF7A 3CWOX 3AZSA 2O9RA 3NZRA 2QZRA 1K9EA 1W3TA 4WGHA 3S2LA 1B3YA 3SCWA 1S3TC 3RYSA 1ZBVA 1H1YA 2P5NA 4GYPC 3E6EA 3BAXA 2XIQA 1GQNA 3SRDA 1H3GA 1EO5A 3VZZA 3F4NA 2Q8ZA 3WCZA 5CLTA 2HXUA 3CAQA 2ONEA 4PCPA 1JJKA 5CC7A 2ZDSA 3D6NA 5F4XA 5T91A 4DWSB 4KEUA 5DMNA 3OVRA 3S2NA 2I17A 4JS3A 2BY3A 4UFLA 1CLVA 3WDPP 1ML1A 3CZGA 4AZHA 3R5EA 2YLAA 4ZOBA 3AXHA 2OO0A 1Q6OA 4W9TA 3LPPA 2PTZA 4KH2A 1NDWA 3CBWA 2IQDA 1EEXA 4PUUA 2V5JA 4K1GA 4QCEA 3KL5A 3S9IA 1NTHA 2W61A 3ZJ8A 5FL1A 4JCMA 1FP9A 3D47A 5FSEC 3L67A 3ZR4A 4KERA 4FALA 2RAGA 4MHBA 1CW2A 4UTWC 2C1GA 4PCFA 1XH1A 4LVFA 4HZ6A 4S38A 3B0UX 3M0VA 1W3LA 1B4EA 3IRSA 1BGAA 4M3PA 4RCXA 3PWGA 5CAHA 3QZAA 1AH4A 3TWBA 3LK6A 4J9JA 2YW3A 3O63A 2V38A 2GK1B 3GHTA 1UKPA 1Q6QA 3SAZA 1RK5A 1S46A 1ITXA 4GCAA 2J88A 4HHMA 4E2OA 2INFA 1E70M 1DJQA 1VIWA 3R0DA 3WLQA 1KO0A 2J4GA 1G9HA 1A3XA 3G77A 1OFPA 1SGJA 3TU9A 1OF8A 1JYNA 3QPZA 4OOZA 3WNOA 4GVFA 3MUIA 3BAYA 2W5FA 3R43A 3MUY1 3UXAA 3G1DA 2VNCA 2H8ZA 4MTVA 1FWJC 1OT2A 5CJNA 3SCQA 3PZ9A 3WH7A 3C86A 2BMBA 4GY0A 4WDXA 4HQVA 1DYSA 3U4AA 1J8VA 2ZX7A 1E56A 4X0VA 3V36A 3VZXA 1ZFJA 4XTDA 2H3DA 1CTNA 4FXRA 2NLYA 2B4GA 1TKKA 1UKQA 3NPWA 2PDBA 2VP8A 4ILSA 3PBWA 5AC7A 3M9YA 1UH2A 3VXGA 1JDAA 1JZ4A 2TMDA 1DE5A 1B0IA 5JQ9A 4MADA 3MTWA 2XVLA 4KCWA 4JQ3A 2EKCA 4ZB2A 3VIHA 4Z1DA 1SO5A 3N2OA 1AD1A 4H7ZA 4IMEA 3L4VA 3ITYA 5BRQA 2FHBA 1Q85A 4GH1A 1KFKA 4DWDA 2DT0A 4WLCA 5CPMA 2QJJA 1RD6A 4ALDA 2OG9A 1H2JA 2CZEA 1H60A 2WK2A 5C8BB 1DWJM 2FDMA 2WCAA 4KW2A 3WLOA 2F2KA 2DQWA 6REQB 2UBPC 4IG2A 3G8RA 4GGHA 3ARUA 1W9DM 1KQZA 5H1WA 3KTXA 4D6CA 3ARPA 3ZVHB 3IIOA 2YBVA 4KCTA 4CN4A 1HKWA 4M7SA 5FJIA 1GVIA 3LXCA 3LUTA 3EZ4A 4JQ4A 4LC8A 1HGWA 2E8ZA 4JIPA 3B04A 4RNHA 3ORWA 4U2YA 1ZZMA 2Q01A 3LTPA 1E6ZA 1UH3A 1ME8A 4A8NA 2A7PA 5E0FA 2NX3A 1SFJA 4CVUA 2AL2B 3DHPA 2CBVA 4OT7A 4MZYA 3C4UA 4F2TA 1DJXA 2FFIA 5AHLA 5M1TA 4B9YA 4W84A 2OZ3A 3TP4A 2NUYA 4Y8FA 3TK7A 3GKFA 1TRDA 3IPWA 3HGRA 2YX0A 3WK2A 4AZBA 3NSNA 2A7RA 1TTPA 1IF2A 1WO2A 5XIAA 3PUGA 3S1WA 2BV9A 3GUWA 2PDCA 3FVMA 3V3WA 4QFUA 4ATDA 4D72A 4UBPC 1ME7A 3QF0A 1EJSC 1VKFA 1EIXA 4GQRA 4L64A 3W01A 4PBFA 4S3KA 4DELA 3ZO9A 4XZIA 3HPXA 3TDFA 4IFOA 2ZDRA 3TX9A 4RNFA 3Q4DA 4OBSA 4DWSA 3N4AA 1Z44A 4MAVA 5EFDA 1KFWA 4I90A 3EAUA 1KR1A 1KD0A 1V6TA 3VA8A 2PF8A 4RE4A 3OLEA 2WHMA 4U4MA 2IS7A 3KAOA 1NWTA 1XG4A 3QR0A 1F5ZA 4W89A 1QRQA 2W0UA 3HTWA 4ZQPA 3DC8A 1VYSX 1FKXA 5C2XA 3B8DA 1TX0A 2CZFA 1PEZA 3T2PA 2VCBA 3ECQA 1K02A 2Z1VA 5AC5A 3V5CA 3PHAA 3QQ1A 1FA2A 4Z17A 3K5XA 2WSRA 4ICCX 2ZRVA 3W2JA 1UROA 3S0CA 5G1MA 1TPEA 3WQ6A 3AICA 1MDRA 5C7VA 4G7EB 1LF1A 1HZYA 3E5PA 3H2CA 2OOFA 1EOKA 2CIPA 4HPGA 1D8WA 2YZRA 1FH9A 2YBTA 4E2DA 1RQEA 3CIVA 2Y8KA 2C19A 4ICMA 1H51A 4DHGA 1X8CA 2YXGA 4YCOA 1W2PA 6XIAA 3PTDA 1FWNA 2DZBA 4LV9A 4MF4A 2GK1A 4CCEA 7ODCA 4QROA 2WC7A 4ACYA 2DUXA 4ZO6A 5LYRA 3GTFA 4V1XA 1KC7A 1MFVA 1MW1A 2BODX 1JIBA 3ITCA 3FAXA 1R9ZA 2REQB 3VUPA 3TTEA 2UY3A 2PLCA 4ACZB 4YXGA 5XIMA 1U22A 5HA7A 1WX0A 1OADA 4G6CA 3SUUA 1S2AA 1T96A 3JW7A 1F6YA 3BOLA 1HX0A 5A2BA 2XH7A 3A5VA 5LIKX 1LG1A 2WSPA 5F2MA 4JBRA 2WO5A 3SGUA 1C92A 2E6AA 4ZA0A 5A8NA 3GW0A 3DFSA 4J3UA 3BARA 3ABRA 3NTYA 1PKMA 1S2TA 2J9ZA 4NXKA 3WLSA 2PEVA 3RX4A 3VIGA 5TD4A 1WDWA 1QCWA 4GX8A 4O8RA 1YE4A 4FK9A 4HK7A 3O6YX 2OSWA 2YCKX 2C7FA 4WCJA 4PEEA 2BY1A 4S1FA 6REQA 2DVTA 1DHKA 3WD1A 4GIAA 3TSMA 4C6IA 5CZSA 2RGLA 1QATA 2GQAA 3ZVHA 3Q58A 2XJ7A 2GUYA 4CD8A 1P0EA 2ZZ4A 3T4WA 4JYDA 3UPBA 4AFYA 1V5XA 2NW0A 1A5CA 3IIXA 1OEPA 2O7SA 1XLGA 5K7JA 2GVJA 3G1AA 1KLZA 4UFMA 1TCMA 4DI9A 1ZAIA 4QITA 3VX1A 3C56A 5H6HA 1UH4A 3PSWA 4FR6A 3PUEA 4PMXA 5CJ5A 5C9UA 2P0OA 4Y9OA 3TQKA 2BHZA 4XVEA 4GBUA 1QOXA 3EMZA 4C1NB 3I6EA 4PSPA 2WAGA 5H8UA 1TELA 3APGA 2DZSA 2XU2A 4JN6A 4NNBA 2E9MA 1E15A 3CL7A 1GKPA 1IQ8A 2Z29A 3ANVA 2PDJA 4NSBA 5D30A 1IT8A 1EX1A 1JPDX 3N25A 4C6KA 4WJ8A 5ECUA 2OO6A 2OQYA 3BCFA 2HDJA 5K3VA 4UIOA 4CNPA 2WCSA 1P43A 4GMEA 3CMFA 3HG4A 3W4RA 1UD5A 3CUFA 4X2RA 1A5LC 4WDTA 4MYXA 3NQMA 1TPWA 1XXXA 3PPGA 3GG0A 2PU1A 2X40A 3GXPA 4JKMA 3ZLFA 3UXIA 5DY2A 1RPXA 4DAIA 2QUUA 2BFGA 3W1UA 5EL1A 2I14A 2I9EA 4NJIA 1CB2A 3GH4A 2WB5A 3TLQA 2QVHA 1TJRA 1Z69A 4C6FA 5BNKA 4DZAA 3TH6A 4MWAD 5BOFA 1QXLA 3UGRA 4G7EA 4TOQA 5L9FA 4CVWA 4QE5A 4QM1A 1JZ3A 3IEBA 4ZO8A 1P1MA 2QJHA 3OA3A 4B5SA 3ZWTA 2GSEA 4JTSA 2RDWA 3ZLHA 3R8RA 1K4HA 1SVDA 5AN7A 1J0ZA 4GQGA 4H8HA 3H22A 5JBFA 1FHLA 1V77A 3E12A 2GL5A 1M04A 4CNUA 5B7YA 3GNXA 1EC8A 1QI2A 2QXWA 2BHYA 4MKNA 3LG3A 3POCA 3UBPC 1OB0A 2BP1A 1NOUA 3PWIA 4AX6A 1I2RA 4MDOA 1UCWA 2VEFA 4XBSA 1L2QA 3QM3A 1PUDA 2REQA 5G1YA 4UQAA 1QI3A 3PPHA 2BX7A 3WYZA 4ACZA 2BGQA 3EDFA 2FHCA 1CGVA 4LBRA 1S2CA 5CC5A 4LB4A 2AL1A 4JIHA 1SZFA 1BRLB 1W3KA 3N15A 2ZA1A 1W37A 4AY7A 1G4TA 1UW9A 3T78A 3HQOA 1H61A 5CBBA 5ABHA 3G6MA 4JNZA 4AG0A 2V2DA 1DWFM 1LBMA 4MJ4A 4WEVX 2QCFA 2GVGA 2R8WA 3AIQA 2CPUA 2GDQA 1ZHAA 3VE9A 1K77A 1LT8A 4FO4A 1OCNA 4W4QA 1NP0A 3ITXA 5K4XA 3N17A 2ZX5A 3WQDA 1XHGA 1JVNA 1TSIA 2VX6A 1NJJA 1KRMA 4D8ZA 1XIEA 5CH9A 1PHWA 5TNVA 1DIEA 2FVKA 1MNZA 3V35A 4E0CA 1EFZA 3E96A 4KWOA 1DE6A 3FSTA 3RG6A 3K30A 3QTGA 3U3HA 3GG7A 1C8XA 2UY2A 1WZMA 5IFTA 4QS5A 3UY7A 4FHAA 1MEWA 2J24A 4H41A 3PZNA 1YW1A 3FSUA 5BMWA 2BLEA 4G7FA 3LB0A 1EF3A 2OZ8A 1BTMA 2ACRA 4WKFA 1WUFA 4GQBA 2IQTA 3MCOA 4L1XA 3GAKA 2G3JA 1TUFA 2LLEA 4H4IA 3S5NA 4UFIA 3K8KA 1BQCA 2VZTA 3GU2A 3O3RA 3MSRA 3M07A 2Y5SA 3BZJA 4LS0A 4MWAC 4PBEA 3OIHA 5CBJA 1AJ2A 3CPUA 4KEVA 5FJPA 1XLDA 5BXPA 4CN6A 1BD0A 3POHA 1FWEC 1EA9C 3Q94A 1GYMA 4NNAA 1EYEA 5C9ZA 1W5MA 2EXOA 4CQ8A 3QXBA 4V15A 4LW7A 2Y7GA 4C1NA 3B8UA 3MB9A 3SUSA 2XUCA 2ZRXA 4P7LA 2FMNA 4E8DA 5EFFA 1O5KA 3V0SA 3VKCA 3ALGA 5CPNA 1XGZA 5ABFB 4N6FA 1OGGA 3WF0A 2YKKA 1PWLA 1RH9A 3GG1A 1I60A 1H7PA 4GH3A 1JF5A 5LNVA 3UEQA 3TW9A 1YXCA 3VM5A 3NSXA 3GNRA 1BSLA 1J0IA 4E4PA 4K8GA 3HPFA 4H9XA 1EF2A 3MUAA 2QULA 5LNUA 3R25A 2IUZA 1E4IA 5JH1A 1O1ZA 2HVOA 3GRIA 3PBVA 3W2NA 1NSJA 4FXFA 4LT9A 2RGMA 3GC2A 2PDQA 2A7NA 3P67A 1XH2A 1QW7A 3AI0A 1TPB1 2D2HA 2R9RA 4O0ZA 1JUKA 2OPJA 2FTYA 1TV2A 2YDQA 4PTMA 1HJXA 3XISA 1IZKA 3IUHA 1S2WA 4ERIA 1WDQA 4L6HA 2HSAA 3W7DA 1R46A 1HKVA 2VEMA 1YDOA 3RX2A 1KFLA 3OBAA 3RCMA 4FNUA 4AB4A 4O16A 1BSIA 3U0HA 3LHZA 3VCCA 1CXIA 1N82A 3G8EA 3FN9A 3VGBA 3LHTA 2F61A 2A3HA 3BJTA 3W1AA 1XUUA 2R1PA 3GVVA 3NGJA 3I6TA 2YYUA 4JXCA 2DVXA 3VILA 3GNNA 3URNA 4N6EA 3NAVA 3HF3A 4HTBA 3SADA 3RCYA 1NELA