3TA9A

Beta-glucosidase a from the halothermophile h. orenii
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
449
structure length
448
Chain Sequence
AKIIFPEDFIWGAATSSYQIEGAFNEDGKGESIWDRFSHTPGKIENGDTGDIACDHYHLYREDIELMKEIGIRSYRFSTSWPRILPEGKGRVNQKGLDFYKRLVDNLLKANIRPMITLYHWDLPQALQDKGGWTNRDTAKYFAEYARLMFEEFNGLVDLWVTHNEPWVVAFEGHAFGNHAPGTKDFKTALQVAHHLLLSHGMAVDIFREEDLPGEIGITLNLTPAYPAGDSEKDVKAASLLDDYINAWFLSPVFKGSYPEELHHIYEQNLGAFTTQPGDMDIISRDIDFLGINYYSRMVVRHKPGDNLFNAEVVKMERPSTEMGWEIYPQGLYDILVRVNKEYTDKPLYITENGAAFDDKLTEEGKIHDEKRINYLGDHFKQAYKALKDGVPLRGYYVWSLMDNFEWAYGYSKRFGLIYVDYENGNRRFLKDSALWYREVIEKGQVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression, purification and preliminary crystallographic analysis of the recombinant (beta)-glucosidase (BglA) from the halothermophile Halothermothrix orenii
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
molecule keywords Glycoside hydrolase family 1
total genus 162
structure length 448
sequence length 449
chains with identical sequence B
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ta9A00
4CCEA 5AC5A 4D6IA 5ABEA 1ISVA 1JF6A 3RIKA 4W7UA 4GI6A 3OGRA 1ZB5A 1G1YA 4PMVA 3ZJ8A 3MMDA 3QHOA 2UY5A 3AHVA 1GOOA 1XV8A 4WKFA 1QW8A 4JKMA 4B15A 5IDIA 3WUFA 4CN6A 1PX8A 3QOKA 2W5FA 2V5CA 4ACYA 2GK1B 1QNPA 3MU7A 3BAJA 3A4XA 2A3EA 2DH3A 1HKMA 1CXHA 2ZUWA 4RL3A 5A3HA 5I2UA 2JE8A 2XM1A 4MB5A 2EO7A 1Q6CA 3RM8A 1V0NA 3RCNA 1BAGA 1HJUA 2YA0A 2JEQA 1WZLA 2G3MA 2WMIB 2E0PA 2E4TA 4AZ7A 3VIHA 1W9UA 5CQ1A 2E9MA 1HN1A 4PMNA 5FL1A 3BC9A 2ZX8A 2J77A 4J3VA 3WF2A 2DT0A 4AXNA 1UR2A 4UZSA 1ZBCA 5A2CA 4WLCA 4D6CA 5ABFB 2G3NA 4WSJA 4CD7A 3U7VA 4OKDA 4B3KA 3MV01 1JL8A 5CPTA 3WH6A 4OZOA 3AHZA 5HOSA 2UWFA 2FHBA 2ZOXA 3RJXA 4UQAA 2YKKA 1HVXA 4PTWA 2WYSA 2VQTA 4AC1X 4W7WA 3KL0A 5TD4A 1BYBA 1DWHM 2WSPA 1C90A 4OUEA 2DT1A 2E8ZA 2Y2WA 5HPOA 4HU0A 2VR4A 3WQ8A 2WW5A 4OJYA 4UFMA 1OT2A 2MANA 1KR1A 2X8RA 4BCEA 1TVPA 3CZLA 4U33A 1KBBA 2D0FA 4M81A 1CIUA 3HMCA 2YOCA 3AXIA 4HMEA 5EFFA 2J7HA 3VUPA 2YDQA 1RH9A 3SUWA 2WBGA 3ARVA 4HZ8A 1O7AA 1V08A 1QI2A 1V3IA 3W25A 4GO8A 4DUVA 3N12A 1G0CA 1HJXA 3VD3A 1WZKA 2D3LA 4W86A 3W27A 3K1DA 1CGYA 3FN9A 2ZXBA 1RD6A 3T0DA 3WUEA 2WKGA 1MW0A 2YL5A 4D6EA 3S2CA 3WEOA 5JBFA 5A6MA 5FL0A 4MNKA 1XSKA 4XV0A 1NQ6A 3ZO9A 4AZIA 2GFTA 1R87A 1GJWA 2WHJA 1CGXA 2VL4A 4JKKA 3UERA 2DPEA 4HA4A 1UG6A 1MVYA 2J7GA 1FHLA 1VJSA 4JL1A 1GPFA 1J0JA 4AEFA 5A6AA 3ARRA 1IV8A 3VIFA 3J7HA 4KMQA 5A8OA 1DP0A 3VX0A 4D1IA 1ISXA 2DQXA 2X2YA 5CJ5A 2BXYA 2DSUA 3QGVA 2Q8XA 1K9FA 1JZ8A 1CWYA 1OIFA 4AD3A 3WQVA 4EKJA 3ARZA 5IHSA 3G6LA 2OYKA 2W63A 3AIEA 2AOSA 3WF0A 2WVVB 3N18A 4JZ5A 1LWHA 1E6PA 1J10A 2ZUVA 3DHUA 3TTSA 4F66A 1V0LA 3A4AA 4ACZB 4LYPA 4TUFA 5FKYA 1GUVA 4P7RA 4M24A 3CUFA 4W8BA 4P7QA 4W93A 4FK9A 4M1RA 3KE0A 3O6AA 3O9NA 4X0VA 5DT7A 3AS1A 2X0YA 3RO8A 1JZ6A 4TX6A 5CPQA 1E5NA 1W9BM 2VX6A 8A3HA 1GOKA 3QHMA 3WN6A 3WQ5A 3VGBA 1GW1A 4UFLA 4CU7A 1VB9A 1DHKA 2DSWA 1NM9A 4Z2HA 1CLXA 3LPGA 3UG3A 1MQPA 1GQIA 1MYRA 2D1ZA 5F7UA 3W6LA 5IFPA 2PI6A 3WDHA 5KEZA 3VDCA 2WHKA 2WMFA 4IPLA 3UCQA 1SYTA 1BFNA 2EPLX 1WE5A 7A3HA 1WNOA 1XCXA 2WLYA 3OLDA 2VTFA 4K68A 3SUTA 1QBBA 3GNPA 1C7TA 3DYMA 5CGMA 2VR5A 4WKHA 4WIWA 2A3CA 1VBRA 2ZUNA 1TCMA 2A3HA 3AZRA 1UD6A 1MWOA 1B3ZA 9CGTA 1GOWA 1E4IA 1XYZA 3FHQA 2DSKA 3AMDA 4KGJA 1E6SM 4AEEA 3BMVA 4HPGA 3AMLA 3GZAA 3MSGA 1WB0A 2VZSA 4X9YA 2WVVA 1L8NA 3F4VA 4JHZA 3WF1A 1TE1A 3VPLA 4OBRA 4PMDA 4UQEA 4UFJA 3A4WA 4UR9A 1J11A 2QMJA 2Y5EA 5DO8A 1BG9A 2O9OA 4D6JA 2AAAA 4PUDA 2Z1KA 1OGBA 4PMXA 2OLHA 3LPPA 1X6LA 3BLPX 1CLVA 3ZR6A 5C71A 5JIWA 3GYCA 2VMFA 1NWUA 4M82A 1LQ0A 3WEZA 3GH4A 1V6YA 2V38A 3NIYA 2WC7A 1OB0A 2WWCA 3WELA 2GJXB 2J47A 1MW3A 4MJ2A 1W9PA 5BXSA 1Q6DA 1R7AA 1UKSA 1QI5A 4F9JA 2WZHA 2XWEA 4D72A 1DWGM 2ZUTA 1C3FA 1W3HA 3EBVA 5KZ6A 5M3WA 1CGWA 4P8VA 4QAWA 1PJ9A 2XFRA 3MUIA 4YHGA 1JZ5A 4BQ2A 7CGTA 2YJQA 4PTMA 4BF7A 4MAZA 3VD7A 1H5VA 4PEEA 5DT5A 5DEZA 2JIEA 5E6ZA 5FCZA 1VFUA 3W82A 1JNEA 2BV9A 2CETA 5HPCA 1EDGA 2CBJA 3OLEA 2W66A 4DWSD 3SCQA 1BSIA 3NDZA 2HISA 3T2PA 1XC6A 3AROA 3TP4A 1NOFA 3F5JA 1GHRA 1Z32X 3EMCA 3I3BA 4PCSA 4CGTA 2DT2A 1GOQA 1JF5A 3WD0A 4CUCA 1MQQA 3ARTA 2D20A 2XWDA 3WENA 1UOKA 1J0KA 1OBAA 2PC8A 5CXPA 3NSMA 1UH3A 1W1TA 5GNXA 1OD8A 3PZTA 1EQPA 4CCCA 3RILA 3SCTA 4UFKA 1EQCA 2QPUA 1ODZA 1WDSA 5D9NA 4CU8A 4DUXA 1KWKA 4PRWA 1TVNA 2D23A 3FXYA 3GXDA 3OLIA 2XM2A 3N13A 1HXJA 1Q6FA 3POCA 1X1NA 2AMGA 3PTKA 4D6HA 1HNYA 2ZXDA 3OB8A 3W81A 4UZUA 4C7FA 4V27A 3CGTA 1GJUA 4NI3A 3VIJA 3ZIZA 2VOTA 2XPKA 5I78A 1B3YA 3UEQA 5BROA 4JL2A 3MUY1 4XX6A 3OLGA 3WNOA 1A47A 1PZ2A 2D0HA 2XVPA 1MXGA 1HKKA 3L4VA 1VJZA 3CHCA 1IZKA 5E0CA 3ZJ7A 1D2KA 3L4ZA 4HU8A 4MDPA 3U57A 3CBWA 3BCDA 5ABHA 1E6NA 1QI3A 1EOMA 1UH2A 1UR8A 2G4FA 3AIBA 3D3AA 4WKAA 3VIOA 4HOWA 3OGSA 3ZT7A 2VX7A 1BQCA 2VO5A 1JZ3A 2OWXA 3VGFA 3MUZ1 3G6MA 5EB8A 4AWEA 2DGAA 3TTQA 4ATLA 6TAAA 1JDCA 1C8YA 5CZKA 4BQ4A 1NWSA 4PBGA 5E6YA 1W3JA 1CZ1A 3AZTA 3CTTA 1H11A 1CDGA 1P6WA 1QNRA 3VTRA 4JIEA 1K9DA 3HN3A 4P7OA 1EHAA 5A69A 3PZ9A 3DYPA 3GM8A 4JCMA 3PTQA 2BHYA 3VM5A 4U2ZA 5AYIA 1I1WA 4GINA 1JZ7A 1UKPA 3PHAA 3SEPA 2D0GA 1K6AA 1QW9A 2YDRA 1B3XA 2WKLA 2WXDM 3WBAA 5ABFA 3HJEA 1AQ0A 4IISA 1JI1A 2C0HA 4H8HA 2VX4A 5LYRA 2XGIA 3PTMA 1GZJA 3VO0A 2C8NA 2CBVA 2W4XA 1VBUA 2ZXQA 4PCTA 5BCAA 3UESA 6A3HA 2BHUA 1KR0A 3WDIA 1B90A 1BYDA 5JBEA 1J12A 4JKLA 1E0XA 1K9TA 1CGTA 1QVBA 1GORA 1PAMA 2Z1SA 3B9AA 5E9AA 3WBEA 3AFBA 1QHZA 1J18A 1OT1A 3QOMA 3EMZA 3SCUA 1HL8A 4E4PA 4AD0A 3ZM8A 4R27A 1IZJA 2O9RA 4WJXA 1DWFM 2ZX7A 4CVWA 4QCEA 3VIPA 1ZJAA 3WMBA 5D8WA 4AYSA 1KWGA 1G94A 4HP5A 4W8LA 3U5YA 1UWRA 2QHAA 3IJ7A 3TTYA 1FP8A 1H41A 4S3JA 4PMRA 4UQCA 2V3GA 2WAGA 5DMYA 3AHXA 2VZOA 1GOMA 1H2JA 3GXFA 3M6DA 2WVSA 1BGGA 3AMCA 4AZHA 2XTKA 3BAIA 2VCCA 4D6FA 1ZL1A 4YN5A 1NARA 3AIWA 3OZPA 3WDJA 4CD4A 4TOQA 1D7FA 4HPHA 3WQ4A 4AZ6A 3WD2A 3F5KA 5HNNA 3VDBA 1W91A 4Z2GA 4J3UA 1VEMA 4F9DA 1K9EA 4B9ZA 3WNLA 2XVKA 1US3A 3EDJA 4R5EA 3WNKA 4W8AA 2WMIA 2X1IA 1E40A 4PTXA 4GPNA 1WPCA 5GQBA 1JYXA 3PZMA 1ISWA 4ZXOA 1OWQA 5AC4A 1UKTA 4BQ3A 1SR0A 1JZ2A 1E72M 1UA7A 3LPOA 3AS2A 1MXDA 2WVTA 2CHOA 4TXEA 1WDPA 1CTNA 1EOKA 1F4AA 4F79A 3K4DA 2BS9A 2XHYA 3SUUA 1C92A 4D1JA 4HZ7A 2BVDA 2FHFA 1W2PA 3K8LA 2VT0A 2J7CA 2XVLA 1QNQA 4AIUA 2BY2A 1XCWA 5C70A 1US2A 1UD2A 1HJQA 2FGLA 3GNRA 4UQBA 3K4AA 4XB3A 1IT0A 3VGDA 3W24A 1JDAA 1W3LA 1QNSA 2WCSA 1CGUA 4LGXA 1J0YA 3BAWA 4MNLA 4NRSA 4ACZA 2YIHA 2VX5A 2ZICA 1TFVA 2HVMA 4J3WA 2EXOA 2GSJA 2FHCA 3BMWA 1XGZA 3L2LA 3SUSA 4GQQA 1W3KA 2Y4SA 2CPUA 2VURA 1GHSA 4PSPA 2PF0A 1BHGA 5A6KA 3W0KA 1EGZA 1JI2A 3AMKA 2NT1A 2G41A 1V3KA 2VVNA 1E0WA 2YLAA 2E8YA 1HL9A 5HBFA 4D6GA 1W2VA 1HT6A 3MMUA 4P8UA 1KCLA 1L0PA 3SCVA 3AISA 3VMPA 1UR1A 2PWFA 3WDRA 1WZAA 1KCKA 3ZR5A 3TA9A 3KEHA 2XIBA 3FY1A 1EO7A 2CNCA 1WO2A 1V3LA 2NT0A 1VFMA 3FHAA 3ZJ6A 4W88A 2J8FA 2PWHA 1TG7A 4X0NA 3U5UA 3VM7A 1UD8A 1BYCA 1E6RA 4B16A 1TA3B 1S46A 4D71A 2WVUA 2W67A 5BWFA 4J3XA 1E0VA 1EHNA 2WMHA 1W32A 1M53A 2J4GA 1VFOA 3F5LA 5FD0A 3CUJA 2XJ7A 3WNMA 3PZIA 1H09A 1V02A 4A3YA 4GXPA 3S6TA 2BNJA 4CD8A 4PN2A 5M03A 2WNWA 4FLOA 2XG9A 4P8XA 1MFUA 3ZMRA 3L4WA 5EBAA 4JAWA 4GI9A 3WH7A 4LQ1A 4N42A 4GZIA 5A6BA 1NWTA 3ARUA 3VOCA 1UQYA 3UR8A 4UQ9A 4AIEA 2EPOA 3CH9A 3WMSA 2V3FA 1J9YA 1HP5A 3SCWA 1CNVA 3VDHA 1UUQA 5A95A 1MW2A 1JDDA 1KQYA 3WNPA 1CXFA 2J25A 1WDRA 5JBDA 2PBGA 3RM4A 4EE9A 2WWDA 1PX3A 3WQWA 2BXZA 3VD4A 1CXEA 2DDXA 3GDBA 1B31A 3RDKA 4GZEA 4TVCA 3W38A 4MB3A 3T09A 2E40A 3AMGA 1VAHA 5A8NA 3AICA 1V6WA 2DEPA 2YL6A 1UKOA 1SMAA 1GCYA 1AQHA 2OSXA 1E55A 1FH9A 3D5HA 2QV4A 5BXRA 1H49A 1DWJM 1EDQA 1J0ZA 1E71M 4AZCB 2CEQA 4GQRA 1OIMA 2XSBA 4WF7A 3ARWA 1UWTA 1KXHA 1TA3A 4BQ5A 4H2CA 3CIVA 4DWSC 4DM2A 1V0KA 4LXFA 2XVGA 3VNYA 2O9TA 1UWIA 2BY3A 3MANA 1XD1A 4QCFA 3GH7A 7TAAA 2ZIDA 1PBGA 3CUGA 3MUAA 1CECA 5A8MA 1E6ZA 3DECA 4B3LA 1NH6A 4EANA 2GJRA 4GI8A 3II1A 1U30A 1GONA 4Z2IA 1BGAA 2GK1A 2ZXAA 1B9ZA 3SCNA 1FOBA 3VDAA 3OGVA 3EDKA 2IUZA 2CBUA 5BYWA 4HMDA 4A4AA 1UR0A 2RGMA 3CZJA 1R7OA 5A8PA 5C8BB 4MPKA 3UR7A 1XRVA 3SCOA 4WSKA 3SURA 2WPGA 2X0HA 4U3AA 5LA2A 3AYSA 3L4XA 4E8DA 3ARQA 1KQZA 3NSNA 2OWWA 3TONA 3W53A 4CD6A 2CYGA 4DWSA 2OWCA 1C7SA 3ECQA 1JZ4A 3VINA 1G01A 3OG2A 4JFUA 3K8MA 4UFHA 2YA1A 3AHTA 1LL4A 1R86A 1CENA 1O6IA 1ITCA 2BY0A 5E70A 1W9VA 5FOOA 1X6NA 1M7XA 1E6XM 4GIAA 3POHA 3VD5A 2CERA 4U5KA 4MNJA 1VEOA 3NDYA 4W7VA 2XUCA 4FLSA 2D3NA 1DWAM 2DSZA 4M29A 2ZUUA 1JAKA 4MTVA 5I24A 1LG1A 3I3DA 4Z2JA 3WY1A 1M04A 1I75A 3RPMA 1UYQA 1E43A 4JFTA 4WK9A 4UFIA 3WD3A 2Y8KA 1W1PA 1EIBA 3AXHA 2UY2A 3CMJA 4H41A 5JUVA 3O2LA 4PMUA 1FHDA 3AIUA 5LA0A 1VFFA 2BVTA 1E1EA 4IUGA 1BPLB 1E4LA 4AD2A 1U33A 1VF8A 2WC4A 3ALFA 3ALGA 3BLKA 1NOWA 2V3DA 3VX1A 4HTYA 3MKKA 1ISZA 3N17A 5E0FA 1EDTA 1LL6A 4U2YA 4F8XA 2XVNA 1BTCA 5CSYA 3CZEA 1XH1A 2J74A 4W87A 2VC9A 3DHPA 3BSHA 4P7NA 2CCRA 1UKQA 1V6VA 1R8LA 2WM0A 2NSXA 5BXTA 4XUYA 4MNMA 2JALA 2J7EA 2ESCA 2EPMX 1I1XA 5E09A 4XZWA 1DTUA 1V02E 4Y7EA 2CKSA 4MB4A 3NSXA 1JYNA 3WFLA 1ESWA 3T2QA 3L2MA 1XSJA 1EXPA 1J0IA 4BZYA 3BAYA 3ZSSA 1M01A 2EEXA 3OZOA 3TOPA 5IFTA 1C93A 1LJYA 3AIQA 4CKQA 4J3TA 3UG4A 1V3JA 3N9KA 1B0IA 3EDEA 1UD4A 2CXGA 2OYLA 4PMOA 2V3EA 1QHOA 3K8KA 3I3EA 4RE2A 4ZXLA 2IXVA 5CSUA 3WH9A 2XYLA 4D6DA 4P8WA 4TVDA 2WBKA 4HMCA 3OA5A 2FH8A 3AI0A 4AZCA 4QP0A 4Q22A 4ZE5A 4AZGA 4JCLA 1LF1A 5FIPA 1TZ7A 3PZQA 3THCA 2ZX9A 1E15A 4IM4A 2J75A 5I79A 2F61A 3LPFA 3CZKA 4PUEA 3BXWA 4QFUA 2WZIA 1TUXA 4B9YA 4UCFA 2VQUA 3CUIA 1CXIA 1ZBKA 5DFAA 2EJ1A 4V2XA 1AVAA 2JIWA 3PZGA 1KXQA 1SMDA 1GQKA 1E4MM 4M56A 1B1YA 1UWUA 3N15A 2XFFA 3CLWA 1UH4A 2PBOA 1UWSA 1B3WA 5CPSA 1HF6A 5D4YA 4EAMA 1UHVA 2DIEA 4CVUA 1H3GA 4BS0A 5I23A 1JXKA 4DM1A 2GVYA 2CKRA 2VRJA 2G8ZA 3QR3A 4H04A 4FMVA 4UOZA 3WKZA 1RPKA 1JXJA 1CXKA 2IXUA 1F4HA 1HJVA 1HJSA 2WMKA 3HU7A 2YBUA 4DUWA 1GOIA 1OM0A 4FLQA 2PWGA 1PEZA 3DC0A 2G3JA 2ZUMA 4AD4A 5A6BD 2VZVA 4MADA 1U2YA 1KFWA 2RGLA 3WQ6A 2C7FA 1ZU8A 3WSUA 1JNDA 1XD0A 3NYDA 4GO9A 5M5DA 3AQUA 2CIPA 3PBGA 3FW6A 3B8SA 3ARXA 3AHYA 5ABGA 3L4UA 4URIA 4AMCA 2JFEX 1QNOA 1WAWA 4GKLA 4U5IA 3VGHA 3VIIA 5M17A 3NUKA 2E3ZA 2OSWA 1AQMA 4NF7A 4QDMA 4A3HA 4ZFMA 1PZ3A 3CMGA 4P7LA 3VIKA 2GJPA 1W1YA 5CGTA 3SCSA 1HP4A 2XGBA 5BXPA 8CGTA 1H4PA 1BVNP 4IPNB 2G3IA 1V3MA 1MFVA 1E70M 2GJXA 1WCGA 3RMEA 4TX8A 2FDMA 1TMQA 3KWXA 4AD1A 4AW7A 2JF6A 1OGGA 3BH4A 3SCPA 3T2OA 4LYQA 1EA9C 4AY1A 1W9XA 3WDQA 2X05A 5CLWA 3AZSA 3A3HA 4E8CA 1LLOA 3AOFA 3BSGA 1FH8A 3CPUA 1BYAA 5CLTA 4W5UA 1H1NA 3M46A 4CN1A 2DH2A 3ZOAA 2F8QA 3BAKA 1KGUA 2VRQA 1KXTA 2TAAA 1QI0A 4UOQA 2D2OA 4XZBA 4UNIA 5A2BA 1OSEA 1Q6EA 3MSDA 3N11A 3CO4A 1EH9A 1PIFA 1HKIA 1JAEA 1ITXA 1JG9A 1AMYA 4Z2LA 1MW1A 4KH2A 4PMQA 3VMOA 1UD5A 1VEPA 2VZTA 3IJ8A 3GTNA 3DYOA 4W84A 3FAXA 2WK2A 1ODUA 1V0MA 1YQ2A 3WEMA 1BG4A 4L4OA 5GNZA 3APGA 4ZENA 1CPUA 1XYFA 4CU6A 4J3SA 2QMKA 3TTOA 1J0HA 1JGIA 4KRUA 4UQDA 1Q6GA 5D9MA 2D24A 4MB1A 1BF2A 3A47A 3PZVA 5D9PA 3L4YA 5AY7A 3T0BA 2WMJA 1GQLA 3M07A 1NOUA 2OYMA 2JEPA 3AIVA 3VD9A 1ISYA 5I77A 3IANA 3WFZA 2Y8VA 4HA1A 1CBGA 4HZ6A 4OOZA 3ARPA 1XSIA 4M80A 1V6XA 3AS0A 5EFDA 2A3AA 3GBEA 2WC3A 3WH5A 4H8VA 3ARSA 5I5RA 3ZQ9A 2W92A 4L4PA 1QPKA 2BVYA 4NRRA 4AISA 4RE3A 5HDRA 3K46A 1QBAA 4LX4A 1FA2A 3T08A 3NCOA 2EBNA 2JF7A 2V5DA 1B30A 1WP6A 2CHNA 1OGSA 1JYVA 3OBAA 1PIGA 2YL8A 5A6SA 2WCGA 1JFXA 2UY3A 2EQDA 1JD7A 2J62A 2OSYA 2WCAA 4ZE4A 2VI0A 2BFGA 2J78A 4AD5A 1HJWA 2ZUSA 1E1FA 5D9OA 4NSBA 4QLLA 4ZEPA 2FH6A 2WB5A 4OIFA 3WUGA 3A6OA 2PWEA 3EYPA 5A6JA 4H7VA 4PYSA 4RE4A 1ZBVA 5A6LA 4J28A 1PPIA 4OBSA 1W1VA 3GNOA 1OD0A 1ZJBA 2VNCA 3W37A 3CHFA 6CGTA 4U3CA 4Z2KA 1QI4A 1UD3A 1CXLA 4HA3A 1NP2A 2J8GA 4J7RA 5BRQA 5I6SA 3W26A 2J7FA 4PSRA 3N04A 1CEOA 1E5JA 2W62A 4MJ4A 1BVZA 4DWSB 3PZUA 1DEDA 2YBTA 2PB1A 3CHDA 1UR4A 3WNNA 3E1F1 4LPCA 3PN8A 3EDFA 2A3BA 1A3HA 3KL5A 1JD9A 1GQJA 3NJ3A 2B31A 5D8ZA 4YPJA 3SUVA 3W4RA 3GH5A 2QLYA 3BGAA 4FF5A 1B3VA 1LWJA 1W9DM 1J01A 4N0RA 1JIBA 2DIJA 1E9LA 3WH8A 3GXIA 4NZCA 3QHNA 2YL9A 3WD1A 3EDDA 3OIHA 1V3HA 3LMYA 1TR1A 5I0DA 3BAXA 4CCDA 1UWQA 4TTGA 3L4TA 4W89A 3CHEA 4OOUA 2VRKA 3UETA 1D3CA 3VGGA 2ZX5A 4JFWA 1KXVA 1Y7VA 3VGEA 3CUHA 2WMGA 4UOJA 3WUBA 1VENA 3IJ9A 1UZ4A 2BY1A 5A94A 1UA3A 3ZJKA 2DT3A 5BRPA 1HVQA 1H0GA 5AYBA 1OCQA 4CN4A 4QLJA 1PX4A 2J7DA 3KL3A 2YA2A 3MO4A 3WF3A 2QPSA 4YHEA 3W6MA 1E3XA 1JFHA 1MQRA 1ZBWA 3CZ8A 3SCRA 5IXEA 2VJXA 5CG0A 2F2HA 3IK2A 3WDPP 4C7GA 1NP0A 2CITA 3VIMA 1RP9A 3JUGA 1DWIM 3W28A 1RP8A 5LA1A 1WZMA 3WD4A 1KB3A 1SFSA 4LYRA 4PTVA 1GNXA 1EO5A 3VMNA 4AIOA 1VRXA 3FNDA 1UQZA 2WSKA 2PWDA 3AS3A 1QOXA 1KGWA 4JFSA 2ZWYA 2J79A 3ZT5A 2XFYA 1V6UA 3GXMA 1E6QM 3IAPA 4PMYA 1CGVA 1QHPA 1H0IA 1G5AA 3N1AA 1VIWA 1B2YA 2GDVA 3AJ7A 2VVSA 5IHRA 4JHOA 3UG5A 1FFRA 3CZGA 1LG2A 1ZS2A 5JIPA 5GPRA 1HKJA 3WL0A 2ZE0A 3RM9A 3WMCA 2XIIA 1XHGA 3AYRA 4U31A 3GBDA 1V03A 2J7BA 1FP9A 5A8QA 1N82A 2O9PA 2ZWZA 4UTFA 2O92A 4EK7A 3WF4A 4C7DA 1C91A 4QLKA 3RJYA 1KBKA 2X09A 4CD5A 2EPNA 1GVYA 5HXMA 4TVUA 4KRTA 3VU2A 2WANA 2YDSA 1FFQA 5A2AA 2FGZA 2WZEA 1CYGA 2E9BA 1WDQA 3M7SA 2W61A 4J27A 4S3KA 4KGLA 2XSAA 2NW0A 4ATDA 2VZUA 3WIJA 1UZ1A 5GNYA 3FAWA 1E4NA 1FH7A 4HOZA 2EPKX 1E73M 3B9EA 3W29A 2W91A 1WKYA 2BHZA 3T0AA 5I3DA 2QF8A 4JFVA 3EMQA 3VKKA 4MDOA 3THDA 1HX0A 3VIGA 2CBIA 3AIRA 3SIMA 2WLZA 3IAQA 4MAVA 4M8UA 4FLRA 1OINA 3MV11 3MS8A 2E9LA 3VNZA 1JYWA 1Q4NX 1M03A 3KZSA 3VILA 1XH0A 3WL1A 1HIZA 2UY4A 3AXXA 3MMWA 4ATWA 4E2OA 2ZX6A 3U7BA 2CESA 4ML4A 4H8UA 3B9DA 1NWRA 2GUYA 5ECUA 4HOXA 1C8QA 2DSVA 3BCFA 2GDUA 4AZ5A 2Y24A 3PZOA 4KWUA 5A1AA 1KGXA 4W5ZA 2YLLA 3VVGA 1ECEA 1G9HA 4GZJA 1E56A 1R85A 4PMZA 5DF0A 1LL7A 1C8XA 3ZT6A 4BA0A 4AZBA 5EMYA 4TTUA 3PZNA 3ZSTA 2WHMA 2VCBA 2D22A 1YHTA 2WHLA 4W85A 1E3ZA 1XH2A 4V28A 1UR9A 2VUYA 1BLIA 2VCAA 3ARYA 1GVIA 4Q7NA
chains in the Genus database with same CATH superfamily
2F9RA 3IUHA 4CCEA 1E0UA 3MP5A 3CH0A 4C1KA 3MHGA 4QNWA 4D6IA 3VC6A 4O4WA 4CNUA 3DKLA 4W7UA 4GI6A 4DO6A 1ZB5A 5E1QA 4PMVA 3MMDA 5KZDA 4Q8OA 2UY5A 3NFUA 1DV7A 5D2TA 3G1XA 3O1NA 3T9PA 5AHFA 1XV8A 3TYDA 4QSHA 1QW8A 4MYXA 4B15A 4JTGA 4O1EA 4CN6A 5H1WA 3QOKA 1QNPA 4HMNA 3UZYA 1XRTA 2DH3A 1TR9A 4TMBA 2ZUWA 4RL3A 4ZB5A 5A3HA 5I2UA 4MB5A 3TNBA 5A8GA 2JEQA 3L66A 2QJGA 3VIHA 3S9YA 5T26A 2YCIX 3BC9A 1OX4A 3A5FA 3B8IA 5AZ1A 3WF2A 1A3WA 2CXEA 4R34A 1UR2A 4UZSA 4WLCA 4D6CA 2H9AA 2PDLA 3HGOA 4Q4KA 1OADA 4WSJA 3FV9A 3U7VA 1JL8A 5CPTA 4JN8A 3H2NA 2OQHA 1YKWA 2HJPA 4N6FA 1X7IA 2Z25A 3QPEA 3KBNA 2ZOXA 4C60A 3RJXA 3IIPA 1Y65A 2OOFA 4C6QA 2AL2A 1TTJA 4HHLA 1EX5A 5TNVA 4RNJA 3UA3A 3KL0A 3UA4A 3UXAA 4L7ZA 3NGFA 2OGYA 1DWHM 4UTWC 4HCHA 4OUEA 2BXVA 5A6TC 2VFGA 2NQLA 3QEZA 5HPOA 3LBOA 4I5XA 1J2BA 1XC4A 2PDIA 2PDGA 1X8FA 5EGRA 1SZNA 2MANA 3UWZA 3QGAC 2X8RA 1TVPA 3CQJA 4GH1A 4ZVJA 1EUAA 4O0QA 3AXIA 5CH9A 2WKJA 5EFFA 2J7HA 4LS0A 2PTXA 2WBGA 4MWAA 1QI2A 1I6NA 4DUVA 1FKWA 1K8CA 1W1IE 2D3LA 3EEGA 4W86A 2RHGA 3GVRA 3GZ3A 3EWXA 1VCGA 3S1XA 1RD6A 2J6VA 3T0DA 3NG3A 3Q2DA 3W72A 4AB4A 3EA1A 1MEIA 1KM6A 1XSKA 3VNJA 4YMZA 1R87A 4J3ZA 2VWTA 3A64A 1CGXA 3EWUA 3UERA 4AMAA 3JR2A 6ALDA 3WK2A 2J7GA 2PWVA 1DQUA 3PB2A 1VJSA 1J0JA 2DU2A 4S23A 3ARRA 3W1RA 5AYZA 3LXAA 4NI8A 4F0MA 1BWKA 4PEKA 4KS0A 1SU5A 5A8OA 4K37A 4UIOA 3JU2A 5IBXC 1DJWA 1PKNA 2BXYA 2DSUA 3QGVA 1K9FA 1JZ8A 4EKJA 3ARZA 5IHSA 2A6LA 2AOSA 3C0LA 3WF0A 2WVVB 2DZUA 2OODA 1E6PA 3DHUA 4M51A 2XN2A 2BP1A 3GVQA 3N9SA 1WYIA 1A5KC 5EMMA 4E3TA 1EP2A 4JD4A 3RK8A 4P7RA 3BVJA 2DP3A 2UZ9A 4IFKB 4GUIA 2GQ3A 3GIPA 4HN4A 1H63A 2CWNA 4OV4A 4GHRA 4M7SA 3AS1A 3FYOA 2B7OA 1AW5A 3QHMA 3W7IA 4CU7A 1K4HA 1VB9A 1DHKA 1NM9A 3UVIA 3NPVA 3WFAA 1CLXA 4JTUA 2IPJA 3UG3A 1GQIA 5F7UA 1A0CA 3H2EA 5G1YA 7ODCA 4IX0A 5KEZA 3D3FA 3VDCA 2ZBTA 4BHYA 3UCQA 3B06A 2EPLX 1WE5A 1XCXA 4LUJA 3R5EA 5D32A 2W6RA 4K68A 3E0IA 4JQAA 3SUTA 1QBBA 3R25A 5CSRA 4GYKA 3DYMA 4WIWA 2ZUNA 2A3HA 3AZRA 4ZOBA 4C6FA 4O17A 3NQ7A 4A29A 1V8EA 3FFSA 3GZAA 4GC4A 4LFYA 1UB3A 1WB0A 3NL6A 3N34A 4CNOA 1L8NA 4F2UA 3WLLA 1OK4A 3LNMA 3A4WA 3KHDA 3IS4A 3DZ1A 2YYUA 1JGMA 4NJKA 1XPYA 3BLPX 3UGRA 1CLVA 5JIWA 1L2QA 3DERA 3GYCA 4RV3A 4WX2A 2C1GA 3TDFA 1LQ0A 3WEZA 1LTDA 3GH4A 3NIYA 3WELA 1R3SA 1PTDA 2GZXA 1R38A 4DF1A 1W9PA 2Q01A 2HV5A 2GL5A 1D3GA 3MWCA 4F9JA 3TOYA 4HYVA 1DWGM 3QR0A 3S0CA 1W3HA 3EBVA 4N4PA 1QU4A 2B7QA 4KFOA 2HMCA 1PJ9A 4BQ2A 7CGTA 3IGHX 3LK6A 4BF7A 4NNCA 2P3EA 3E12A 2ZE3A 1QO5A 4GABA 2X1UA 5LIXX 4H3DA 5DT5A 2IQTA 3M0JA 3H23A 1W3NA 1R3RA 5MKGA 1TWZA 1BQGA 2XIJA 2NLYA 5HPCA 3UWEA 1SUXA 3NO1A 2CBJA 1QK2A 3T55A 1BSIA 2HISA 1AG1O 3T2PA 1XC6A 1A49A 1JQVA 2AQVA 3WBXA 1KLYA 3F5JA 4DZHA 5BU9A 3I3BA 4PCSA 4CGTA 1JF5A 4CUCA 3SY8A 3NQ8A 3UXDA 1OBAA 3EPNA 5CXPA 1UH3A 4J4KA 4UFKA 4Z17A 3EX4A 1EQCA 4QJ4B 2QPUA 4DIAA 1A5MC 1FY6A 1ODZA 1WDSA 2HE5A 4DUXA 1TVNA 1KM2A 4HTBA 3FXYA 4DJEC 3I6RA 3L65A 1UMYA 3R43A 3Q67A 4C6IA 2P0OA 2JK2A 1DKWA 3QRHA 1W3IA 1FTXA 1X1NA 4DVOA 5CC7A 3V16A 5FJTA 4D6HA 4JQ4A 1IEVA 2Q8LA 4UZUA 4ZBCA 3C6CA 2QCMA 3L5AA 1GJUA 1W54A 4O1FA 5I78A 1B3YA 4LAKA 3MUY1 4XX6A 3OLGA 1ADDA 1A47A 3NAVA 5CZSA 1PZ2A 1HKKA 5E9XA 1YBQA 4KW2A 4B2DA 3EGJA 4BFAA 1FWCC 3BCDA 1Q6RA 1QI3A 4S38A 3WLIA 3K5XA 1EOMA 4LVAA 3D3AA 3AIBA 1OYCA 1EFZA 3U3HA 1H7NA 2XH7A 2H3BA 1H7OA 3N25A 3MUZ1 5D02A 4MM1A 4L65A 5JU6A 2A85A 3Q45A 5CZKA 2Z6IA 1W3JA 4BY3A 4QS6A 5LHFA 1XISA 3HG5A 1QNRA 4JIEA 4A3UA 1K9DA 2HS6A 2VFDA 3U0HA 1FWAC 3PTQA 2BHYA 2WJZA 1XQLA 3RX2A 1WUEA 2DFAA 2NXIA 5G1MA 1EF2A 1BD0A 3T6CA 1B3XA 4Q7IA 1PB0A 1GVOA 2WXDM 3LZ5A 3WBAA 1AQ0A 3ITXA 4IISA 1JI1A 3S47A 2XGIA 3PTMA 4CNSA 1E51A 3N19B 3TMLA 3W7NA 4DJDC 1B90A 3HBLA 1A3XA 1M7PA 1IGWA 1E0XA 4DJFA 4Y8EA 3WJZA 3G2GA 3WBEA 1MNZA 1OT1A 3QOMA 3SCUA 2VDIA 1TPVA 3REQA 4B5WA 5D2YA 3EWYA 3LRKA 4WJXA 2ZX7A 1K7EA 2QIIA 5LHEA 3PWGA 3TFXA 4AYSA 4HP5A 1KWGA 4W8LA 3S2LA 2QHAA 4MY8A 2JKAA 1H41A 5DMYA 1ZQ5A 1IXOA 1PYFA 3QQ0A 4NAEB 1H2JA 3GXFA 1FWNA 3F4NA 2O7QA 3AMCA 3C56A 4DX3A 2XTKA 3BAIA 1CI1A 2VCCA 3DG7A 3GG1A 1NARA 3AIWA 3WDJA 3WQ4A 4AZ6A 1EC9A 5LNSA 1MSSA 1FCUA 1W91A 4J3UA 2Y7GA 3IGSA 3E0LA 3WNLA 3OZYA 2ALRA 3HG4A 4R5EA 3WNKA 3R94A 2PDPA 5C0QA 2X1IA 1E40A 3KBSA 3PPFA 4PTXA 3MUXA 3H2MA 3B8WA 1SZRA 1DJXA 2WSYA 1OC5A 5I3GA 4K7YA 1I2NA 4BQ3A 4KT2A 1JZ2A 3LPOA 3AS2A 3DN5A 1WDPA 1CTNA 3P0XA 1F4AA 1SVDA 5I7GA 5AOUA 5I3FA 4E4FA 2BVDA 2Z4GA 1NIUA 3K8LA 3C2FA 3HPSA 5CAHA 4AIUA 2AGTA 2HK1A 3E0VA 1UD2A 3H21A 4XB3A 3E38A 3VGDA 3LTPA 1JDAA 1KCZA 4QHRA 3KHJA 2Z7KA 1DE6A 5ABTA 1P43A 5FJUA 1J0YA 3W1LA 3BAWA 4GXWA 4MNLA 2PTYA 2WM1A 4FXJA 4J3WA 3P8IA 4GQQA 2V2HA 2CPUA 4PSPA 2PF0A 3W1TA 1EGZA 3EZ4A 5C55A 1P6BA 1V3KA 3HIJA 4UTTC 3CLMA 2QAPA 5HBFA 4D6GA 4AY8A 4WHBA 3MMUA 4Q6JA 3TH6A 1UR1A 4ZQNA 5XIMA 1OY0A 3WDRA 3ZR5A 2IPWA 3FIGA 2W9MA 3TA9A 2DORA 2Z0IA 3KEHA 1VS1A 2XIBA 5D09A 4JQ1A 1RQEA 1EO7A 2CNCA 1WO2A 3R0UA 3DC8A 1AFSA 1I0DA 4XTDA 3FHAA 1KRCC 2J8FA 4C5ZA 4JGDA 3O63A 3PPGA 3ABRA 5U4NA 1TA3B 4QG6A 4F40A 5C2GA 4J3XA 3IJQA 2FB3A 1Q63A 3XIMA 4F0RA 3WNMA 4JTQA 4NXKA 5CPNA 4A3YA 4Q4QA 4ALDA 3M43A 3M5VA 3BOFA 5EBAA 2V67A 3WH7A 2F7FA 4LQ1A 3CQIA 4GZIA 4Q6XA 1NWTA 3ATYA 1K02A 2ZQ0A 1JCJA 3VOCA 1UQYA 4AIEA 4IWWA 3OPSA 3I65A 3WMSA 2V3FA 1HP5A 1H5YA 3SCWA 1CNVA 4NZJA 4DI8A 1UUOA 1F3TA 1W1B1 1M7OA 1K6WA 2X30A 1TWDA 1F76A 4DZAA 4AVFA 1JDDA 3AUOA 1BVWA 1WDRA 2F6XA 3RM4A 2X41A 1DIKA 3STCA 3WQWA 3VD4A 3GDBA 4GZEA 4WOZA 4DPQA 3T09A 3AMGA 3TC6A 1QFEA 3P8JA 4ORIA 3CO8A 3IGXA 2YL6A 1ONXA 3NL5A 4NZFA 3EKZA 4J35A 3GR8A 1AQHA 2OSXA 4A8LA 2QV4A 2IQDA 2R8WA 1VYRA 4F0LA 4ZOAA 1XFCA 5G4WA 4AZCB 4W9TA 2CEQA 1EJSC 4GQRA 3ARWA 1NVMA 1UWTA 1KXHA 1OCJA 4XZIA 4BQ5A 1EP1A 3BG3A 4H2CA 3VZYA 3AU6A 4DWSC 2Q71A 5E93A 4L64A 3VNYA 1XDLA 3LTYA 2BY3A 4G8TA 4QCFA 3CUGA 3C8FA 3RAOA 1Q3NA 2FMOA 3DECA 1NH6A 3HGSA 4YTSA 4GI8A 2GJRA 1GONA 1XS2A 4GQGA 4GUJA 4H00A 3ZLFA 3C0JA 3OYXA 2QCCA 2IUZA 4DRSA 5A8PA 4MPKA 3SURA 2WPGA 4JYDA 3AYSA 3L4XA 5HR7A 2ISVA 3ARQA 3NSNA 2R1MA 4E2DA 4Z0SA 2NQJA 4CD6A 4F4RA 2OWCA 1TIMA 5C54A 4DHGA 3WBWA 3OG2A 4XKMA 2IQ0A 4UFHA 3IJLA 2YA1A 4IGNA 2OGJA 1R86A 4AAJA 2BY0A 5E70A 5FOOA 4GG9A 4AVNA 4MNJA 1QOQA 3NDYA 2D3NA 3WZ0E 4RW3A 4M29A 4HHHA 3RLVA 4FXSA 5I24A 3TN3A 4UMAA 3I3DA 3KCLA 4Q8TA 4HJWA 3WY1A 1WKEA 1UYQA 1E43A 4JFTA 4WK9A 3GXNA 3WD3A 1ITUA 2Y8KA 1B9BA 3ISIX 3AIUA 1AA1B 3KOYA 1VFFA 3NDOA 4LUSA 4IUGA 3BLKA 1D3HA 3TW9A 3MKKA 1ISZA 1LL6A 4F8XA 4U2YA 4AH7A 2CLLA 1OFRA 5CSYA 3GNDA 3UZXA 2PDWA 3SN4A 4K8GA 3TYBA 3VCRA 3KM8A 3EB2A 4KRZA 3DFHA 1UKQA 5BXTA 4XUYA 4MNMA 2DZBA 2BTMA 1QPOA 5I03A 1YLVA 4GVIA 2EPMX 4O12A 3O06A 4S3FA 3V18A 4MB4A 2HVNA 1IE7C 3QPZA 5G1TA 1X98A 4ASTA 3PG9A 3AJXA 1IEIA 3L2MA 1EXPA 4B5NA 1AZ2A 4NUWA 4X2RA 2GGEA 4PH6A 3P3BA 3GQYA 4BWLA 1C93A 5E0KA 4FO4A 3W01A 5EMJA 2GJLA 1W5NA 3RO6A 1UD4A 4LUIA 5K4XA 1BSLA 3DG3A 2DZSA 3L9CA 4I7WA 1QHOA 2ZDSA 3I3EA 2CLPA 5AN7A 2FPYA 1LLZA 4HMCA 4YVPA 2PU1A 3U6WA 4I5UA 2YW3A 1PTGA 4Q32A 1B4KA 1W56A 1O94A 1LF1A 5IM51 3PZQA 1YEYA 3LHZA 4DJDD 2ZX9A 1E15A 5F2GA 4JTLA 2J75A 1AZ1A 3FA3A 3WK0A 3LPFA 2FVMA 2QV5A 3BXWA 1VFSA 1HKVA 4IIFA 3T4WA 1R3VA 3DOPA 4WRHA 4V2XA 2JIWA 2OT1A 5PTDA 1IHIA 3W07A 1Q8JA 1E4MM 1QOPA 1CX9A 3N15A 2YZRA 4Y9MA 5T9BG 5CPSA 3CHVA 2XISA 2DV0A 4XBJA 4DJDA 5CC5A 5MF5A 4BS0A 5I23A 2BWGA 3S3GA 2VRJA 4M3PA 1DJGA 3H54A 4H04A 5BOFA 1RPKA 3DIPA 1CXKA 1F4HA 1HJVA 3TIMA 2WMKA 3HV8A 3KDNA 5G2HA 2RAGA 5TAOA 2CWXA 3QTGA 2BGQA 4LY4A 1OM0A 3BTNA 1PEZA 3OVRA 4OE7A 2G3JA 2J27A 3ZWSA 4B92A 1XLIA 1AD4A 3VCNA 1TTQA 2XIQA 1J6PA 3BJFA 3APYA 1K7XA 4PTDA 5M5DA 3FW6A 4MZ8A 1DQWA 3C4UA 1KFJA 1QNOA 3BGJA 4GGBA 5M17A 2E3ZA 4IF2A 4MWAD 4QDMA 4A3HA 3SR7A 1Z3NA 2FZBA 4GFIA 3HQPA 1H1YA 4XSLA 4L6OA 3LDVA 1JCTA 2NX1A 1HP4A 2XGBA 3QQWA 2PURA 1NAL1 3F1QA 4IPNB 1OFDA 2G3IA 3RX3A 1N2VA 1E70M 2FZ9A 2GJXA 1XJBA 4AD1A 3GTXA 3WDQA 3AYTA 1Z69A 2X05A 3FJ4A 2NUWA 3N73A 3BQ6A 3U2EA 4FR6A 1LLOA 4IQLA 1BYAA 2A0NA 4HNTA 1H1NA 3H53A 2BODX 3ZOAA 2NQ5A 3BAKA 1KGUA 5FESA 1U5HA 2VRQA 1TV2A 3KTSA 4KWVA 4WD0A 1QO2A 1QMLA 2HXTA 1AL7A 2OFJA 5A2BA 3U2ZA 4XVDA 1Q6EA 3HPXA 1TV8A 1S5TA 1HKIA 1AMYA 4CQAA 3S6DA 1MW1A 4KH2A 3VMOA 1UD5A 1U1JA 1YDOA 2VGGA 1SFJA 2A7RA 2VZTA 3GRIA 1KFBA 2VDHA 4O13A 2I5GA 2A3LA 1EEXA 1OC7A 4KEVA 4HCDA 3MCNA 3EKLA 3LCLA 2G96A 2BDQA 1WA3A 4CU6A 3BLIA 1IT8A 4J3SA 1T8QA 2G5WA 1JGIA 4UQDA 3RGTA 3A47A 5D9PA 3PZVA 3Q4DA 3UCCA 4HU4A 1LWIA 2PC4A 1NOUA 4MPQA 3WFZA 1LDCA 1S3HA 2CLKA 3S1VA 3TU9A 1XYLA 1XSIA 1KTBA 4PR4A 5EFDA 4JTCA 1H51A 3BG5A 3LCIA 3AALA 3BLFA 3TC7A 3P61A 3R89A 1I45A 2ZRUA 3CM4A 3ZQ9A 2W92A 3V5OA 1KD0A 4G2DA 1P1MA 1YTEA 4NX0A 4LX4A 1YDVA 2X1TA 3T08A 3UR5A 4LEFA 2CHNA 4ZTXA 2QAFA 4Q8VA 1L6GA 1JYVA 3WJYA 3TZFA 3V7PA 4O1CA 1OEPA 2EQDA 5D2VA 2OSYA 2Z7GA 2RDUA 4ZE4A 2VI0A 3GFZA 1HJWA 5D9OA 4NSBA 4QLLA 3G0UA 3TAKA 5EA9A 1XDJA 4IIEA 4OIFA 5A6JA 3GR7A 1ZBVA 4UTIA 5A6LA 3R79A 1W1VA 3BV7A 4RZ4A 4MVAA 3CS2A 1ZJBA 3W37A 4FF7A 3PBUA 6CGTA 5AC8A 3N2MA 1NU5A 2Z27A 3W70A 2OZTA 4Z2KA 4GIRA 3WLPA 1CXLA 1XCFA 2J8GA 2ALDA 5BRQA 3FGCB 3BJTA 3GS6A 1CEOA 4GY0A 1P48A 2W62A 1BVZA 2NQ9A 3BLDA 3WLNA 2YBTA 2PB1A 1SW0A 3WJWA 3KBVA 1L6YA 3DI0A 2NV2A 3WNNA 3E1F1 3LV6A 4LPCA 4P2VA 2YB4A 4IJBA 1A3HA 3EX2A 3W1PA 4WDXA 1I9CB 4JIRA 2RDWA 4YPJA 3SUVA 4GY7A 2ACUA 3GH5A 2QLYA 2QCHA 3BGAA 3O6CA 4FF5A 3HB9A 1B3VA 1LWJA 3WQOA 4P61A 5KTLA 1KKOA 3GXIA 4NZCA 3EDDA 4LYKA 1TMHA 3G0SA 2PGEA 2ANUA 2GGHA 3L4TA 2C6QA 4AU0A 3HFTA 1GJPA 2VYOA 3ENLA 2ZX5A 1WOAA 1KXVA 1Y7VA 4JTJA 3W23A 3CEUA 2WMGA 1MXSA 3IJ9A 2YZ5A 3TV8A 1HZYA 1OCQA 4MUZA 3LA4A 4K7VA 3ME3A 4QLJA 1XRSA 3CIWA 3NQGA 4MJMA 3VI2A 4XVEA 3EWZA 3G1YA 3VKCA 3WF3A 3QYQA 3ZR4A 1E3XA 1ZBWA 3CZ8A 2VJXA 3AYVA 2Z6JA 3DUGA 4KETA 3N3TA 1NP0A 4MY1A 2CITA 3OOQA 4W4QA 5DX7A 3HGRA 4JIPA 4QDPA 3SIZA 2DW6A 1RP8A 4FP1A 2YCEA 4LVDA 1WZMA 4GXMA 3EWDA 1SFSA 2FVLA 3BUVA 4BI7A 3P84A 4C65A 4DJFD 1UQZA 3BV4A 4FPSA 3OYZA 2WSKA 5HWNA 3AS3A 1PZ1A 2Y62A 1B4EA 4IQDA 4D9PA 1WXJA 1EXBA 3C2RA 1KGWA 1XIIA 4JFSA 3ZT5A 3WCZA 3GXMA 1XBZA 3LGEA 5HMDA 2NVAA 2JQXA 2J24A 3LI0A 2OT0A 1VIWA 1XLMA 2VVSA 1B2YA 3Q37A 3T81A 5IHRA 1F74A 3QN3A 1FFRA 4J5NA 3OBKA 4L4LA 1ZS2A 5K9DA 3PP7A 1FWTA 1JR1A 1TV4A 2XIIA 1DL3A 1ZRQA 3AYRA 1Q4WA 1OG0A 3FS2A 1P0DA 3P81A 3SJNA 4NQ1A 1VPXA 3LGDA 1FDZA 3WF4A 1C91A 3RJYA 1KBKA 1U1HA 4CD5A 4KEMA 1GVYA 5HXMA 2XZ7A 3W76A 1J5SA 2FGZA 1WDQA 3T8QA 2NW0A 4ATDA 1K03A 3OU8A 1UZ1A 4J2MA 3MPGA 3STPA 2EPKX 4ZSUA 3R4IA 2HXUA 2BHZA 3C86A 4R53A 4JFVA 2G97A 3VKKA 2DZTA 1ZTVA 3EOSA 1E1CB 2Y5JA 3GKAA 2P3ZA 3O8AA 2CBIA 3AIRA 4DBUA 1S5WA 4FNSA 2BZNA 1DE5A 3HFYA 4DXKA 4MAVA 3HPFA 4XKYB 2OMAA 1J2WA 4LAMA 5EKYA 1M3UA 2ACRA 1HIZA 1NJJA 2UY4A 2Y6ZA 3PVFA 2GDQA 2OZ3A 2EG6A 3TJXA 3TXVA 2Y5SA 3IIZA 2X40A 5D04C 2GUYA 4POCA 1C8QA 3NM3A 1N8IA 3BCFA 1YIXA 3KTXA 2C1IA 4AZ5A 2Y24A 4KWUA 3BGGA 4IPPA 4W5ZA 3S6OA 3GC2A 2O56A 4GZJA 1R85A 1ZPTA 1YTDA 1QAPA 4H19A 5EMYA 4WDTA 3PZNA 2WHMA 4GUHA 2VCBA 5CKSA 1YHTA 3G3MA 4W85A 1E3ZA 3HG2A 1UR9A 3HA1A 4JX6A 1ONRA 3GC4A 1YE6A 2X42A 1GKQA 3N6QA 2ISFA 1OX6A 3N6JA 1ONWA 2PU0A 4KEUA 2D2JA 2QF7A 1JF6A 3RIKA 3EOLA 3OGRA 1UIPA 5LNWA 3KP0A 4AY7A 1UCWA 1ML1A 2I17A 2PP0A 2BBFA 4WKFA 4JKMA 3IEBA 5IDIA 3KXQA 4DAIA 1PX8A 4Z1DA 2W5FA 4ACYA 3D46A 4NAFA 4ZO7A 4IICA 3O16A 1Y5XA 3A22A 1EZWA 2Y85A 1F05A 1OG6A 1WZLA 2F84A 4LWWA 4K36A 4AZ7A 2Y88A 3MDUA 5FL1A 1UC5A 1WUFA 5F2LA 3T78A 3E0FA 2X16A 4JYFA 5KMYA 5A2CA 3KVJA 4R88A 3QPYA 3CC1A 3TQKA 4HPJA 2G3NA 4H6EA 4CD7A 4I7VA 4B3KA 3MV01 2H6RA 4ZQOA 1W17A 2DZVA 2FMNA 7TIMA 1TZ9A 3LGGA 5K3VA 5CZ0A 2Y7DA 1FWHC 2YKKA 1A5AA 1XKYA 3QV6A 1LRTA 4QDWA 2VQTA 4AC1X 4GYJA 1O5RA 3ZWTA 1BYBA 3EA2A 5CBIA 1S5MA 3C3UA 2E8ZA 4EPEC 2VR4A 4REQB 2JKPA 3UG8A 4OJYA 3DFTA 4UFMA 4XD4A 4BCEA 3HMCA 5M1TA 2YOCA 2UBPC 7REQA 4HMEA 2WV8A 6TIMA 3VUPA 1RH9A 3SUWA 4HZ8A 1V08A 2PMQA 1ME8A 1V3IA 1W0MA 1G0CA 3N12A 4UTKA 3OIXA 5DLCA 1D8WA 3K1DA 5BOEA 2OX4A 2Z1VA 1CGYA 4H7CA 3FN9A 4MF4A 3QMSA 3QC0A 4HKPA 4D6EA 1EB3A 3KBWA 3WEOA 5JBFA 5B80A 2NLIA 3K2GA 3UR2A 4MNKA 3TQVA 4XV0A 4BKNA 3O6DA 1YRRA 3OW1A 1NDYA 1EJUC 5C7VA 4JKKA 2NZLA 1WKFA 1RSCA 3KRZA 1MVYA 2OEKA 1RQBA 4AEFA 4K8HA 3WK3A 2YR1A 5CC6A 3RYSA 3A12A 4NKCA 1K4GA 3VIFA 3J7HA 4KMQA 2QGYA 1GVFA 1M1BA 4D1IA 1ISXA 3W2KA 2DQXA 4MUPA 2DJLA 2Q8XA 4C91A 4AD3A 3WQVA 1DXFA 3G6LA 2OYKA 1J10A 1MDRA 3BICA 3M16A 2SFPA 5KZEA 4FALA 1DQXA 3VKDA 4NJGA 3NYZA 3A4AA 4B3ZA 3G1DA 2QVHA 4ACZB 1A5LC 3W7MA 3RHGA 4LYPA 1GK8A 3QMRA 1UJQA 1LQ2A 2PDXA 1H60A 3CUFA 3DX5A 4W8BA 4HCLA 3L7RA 4P7QA 4L9YA 2WJEA 4L1WA 2R91A 1ZNNA 1H7RA 1JZ6A 2ICSA 4TX6A 1YXCA 1W9BM 1GOKA 4JNYA 1MEHA 3VGBA 1GW1A 1G6CA 2ATMA 2V5KA 2DSWA 2GWGA 4ZO9A 3FSUA 3PJWA 3LPGA 4NY2A 4ZCWA 3L0KA 5HQEA 1MYRA 3VXGA 3UQNA 3W6LA 5HJLA 1WQ5A 4IPLA 4RDVA 2I5QA 2O0TA 1BFNA 4C6CA 5JMUA 4GC3A 1C7TA 2YYTA 4AWUA 2VR5A 4C6BA 4WKHA 1MWOA 9CGTA 1GOWA 1KBLA 3H4WA 3FHQA 2DSKA 3AMDA 4TU1A 3TMQA 1E6SM 4KGJA 4AEEA 5B7ZA 3BMVA 4NT0A 4HHPA 2H90A 1LCOA 4X9YA 4WXZA 4O52A 3F4VA 4JHZA 3UJRA 1TE1A 3VPLA 1U1UA 4PMDA 1LT7A 1PVNA 4UR9A 2X0SA 1J11A 3OVGA 4MYAA 1GOXA 5DO8A 1BG9A 3BQ5A 3VZXA 1MUWA 4Z1YA 4HGXA 4LAOA 4PMXA 2HPMA 1X6LA 1P1XA 4XAPA 4BEQA 3VKJA 5REQA 4O8RA 2VMFA 1O5KA 1VPYA 1LUCB 2R1LA 2Z1WA 3T8LA 3WX7A 1O66A 3SZ8A 3FEMA 4AXKA 3UP8A 1X97A 3RFAA 1YYAA 4C6OA 3GFYA 1UKSA 5I09A 1UR3M 2XWEA 4D72A 1FHUA 4LRTA 4B2DD 1EUNA 3MYOA 5IOBA 2VC7A 2HWGA 3QZAA 4QAWA 2XFRA 1JZ5A 1EJVC 1SZGA 2NXGA 1ZENA 2YJQA 4PTMA 1WKDA 2PCEA 4EPBC 1VLWA 2E1WA 1H5VA 2DZXA 4QSFA 3WQPA 1YBQB 5BNKA 4NX5A 3MO7A 3VUSA 3VABA 3A9BA 3W82A 3RR1A 3W1UA 1JNEA 2VOMA 2BV9A 3RMJA 1VCVA 3KTCA 3N2BA 2W66A 2YFNA 1C9DA 4LSBA 3S5NA 3AROA 5I02A 2P50A 1L6SA 3DAQA 4RNFA 2XWDA 3WENA 1UOKA 2PEVA 1AW2A 1J0KA 2I5IA 2VENA 2GVLA 3QYSA 3C2EA 5GNXA 1EQPA 4CCCA 4UMBA 3GAYA 2AKMA 3SFKA 1XLCA 2D73A 4QNEA 3L5MA 5D9NA 2VHLA 1IGSA 1U83A 1TJRA 1YDYA 4O8AA 4DF2A 1KFLA 3LSBA 5CPOA 3GXDA 5EBUA 1W3TA 1UP2A 1HXJA 5J8LA 3FK4A 1F5ZA 1TWIA 4LALA 2C91A 5F4XA 2AMGA 2HE8A 5EMUA 3OEXA 4A6GA 3OB8A 3QY8A 1PHWA 4O18A 1EJXC 5DXXA 3SB0A 1GZ1A 2PLKA 2YGYA 1EL3A 3UEQA 2PDNA 1RPXA 3L5LA 4MGGA 4KCTA 4H9YA 4LNCA 2POZA 1EIXA 3CMFA 4G1KA 3CHCA 2RUSA 3MCMA 1SZEA 3UNDA 1D2KA 3GD6A 5F4SA 3CBWA 3CYJA 1KW1A 3ZXWA 1V7YA 4UNKA 1KNWA 2GQ9A 3VIOA 1UH2A 3E0WA 3ZT7A 5BZAA 3NTYA 1SJBA 3TWBA 1EBGA 1XGDA 3MMTA 3GAKA 3BSMA 5EB8A 5HATA 4AWEA 1XR2A 2EG7A 2WSRA 1XIDA 2VGBA 4H7ZA 1JDCA 1C8YA 1Z89A 1TJPA 1XYMA 4PBGA 3DEQA 4HT3A 1CZ1A 1PO9A 1QUMA 3R2GA 3SGUA 4XBSA 3QC3A 4QRNA 3HN3A 3L23A 8RUCA 3SAZA 3GM8A 3UWQA 3RNDA 4L56A 1C8VA 3EX6A 1EJTC 4GINA 1W5MA 1UKPA 3FKKA 1ZAHA 2YDRA 2WKLA 3EA3A 5FAGA 3HM7A 4BF5A 1GVRA 5LYRA 3DBNA 1IYXA 4UTTA 3DENA 2C8NA 2CBVA 1VBUA 1T7LA 5BCAA 3C61A 5C2XA 6A3HA 1UP0A 2G95A 4QR6A 2BHUA 4LBUA 2FPTA 5LXEA 1ICSA 3CAKA 2X1RA 3MQTA 3NPWA 1GORA 5AFDA 4GYPA 3S2JA 3B9AA 5E9AA 4S3CA 4XIAA 3LLFA 3TXZA 4JTHA 1J18A 1JVNA 5M2FX 3EMZA 4E4PA 1HL8A 3NZQA 5CPLA 4AD0A 3ZM8A 4R27A 1XBVA 3LXCA 4LF1A 1JEZA 4JBRA 3UT0A 5BOOA 3TROA 5FI8A 1ZJAA 4IL0A 4JTRA 1TWSA 1GWJA 1T6MA 3U5YA 3IJ7A 3QQ1A 2XFWA 2Y61A 4PMRA 2V3GA 1BRLA 2VKZG 4YWIA 4PZVA 3M6DA 1BGGA 4ICMA 1V79A 1J93A 1PL9A 4GJIA 4CD4A 4TOQA 4EPKA 3BG9A 3CWHA 1L6FA 3R8HA 1O5QA 4QGCA 3M9YA 3WD2A 1IIGA 3F5KA 4JDBA 3LCXA 2Z24A 4F9DA 4B5XA 3HURA 3S9ZA 3PBVA 3EWWA 2DZAA 1A4MA 1TUFA 4GPNA 3DFOA 3M64A 2NSOA 3PZMA 4ZXOA 4UUIA 5AC4A 1UKTA 4DYJA 4X3ZA 1SR0A 2QIWA 1UA7A 1MXDA 2CHOA 1EOKA 1J8VA 3MB9A 4WQ6A 3K4DA 3S5ZA 1OVDA 2XHYA 1C92A 4D1JA 1TV7A 1YX1A 3FVDA 4HZMA 3U8GA 2FHFA 1K70A 1W2PA 3SY1A 3S5SA 4CQDA 1QNQA 3KX6A 2BY2A 4L80A 1KM4A 2FGLA 3GNRA 4UQBA 3K4AA 1QNSA 2WCSA 4ACZA 2YIHA 3PG8A 3PPCA 1TFVA 2EXOA 2GSJA 2QZRA 3G0XA 4R33A 1W3KA 1X7FA 2OEJA 1GHSA 4XZNX 5A6KA 1QWKA 3R0DA 3W0KA 1RCOB 1JI2A 2NT1A 3KVKA 2G41A 2VVNA 1LM1A 4HSNA 1P0BA 1JPKA 1W2VA 3SCVA 4P8UA 1L0PA 3H6OA 1XF0A 2PWFA 4UWMA 4ICNA 1KCKA 3W87A 4GGHA 1EPVA 1GTEA 5H6HA 2YDAA 3FA5A 3FY1A 4IP5A 4JIQA 1V3LA 3LCFA 4XD6A 1FHVA 3ZJ6A 1UJPA 4Y9NA 2PWHA 3U5UA 1E0TA 3T40A 3VM7A 1OFEA 1E6RA 2HQAA 4C6PA 2HK0A 1E0VA 1W32A 1VFOA 3F5LA 5EPDA 5FD0A 1AJZA 3LX9A 4GKTA 3KBMA 3PZIA 1AH0A 1V02A 2DW7A 5LSMA 3S6TA 4CEXC 4CD8A 3PC0A 4PN2A 4JEJA 4H2HA 3R58A 4J2PA 5LZLA 3TW7A 5A6BA 2FZNA 2A2IA 2DVTA 4QJ5B 3K30A 1FCQA 3CH9A 3PJUA 2BASA 3W22A 1TE6A 4EWJA 3TKFA 1F8MA 1MW2A 3WK1A 3O0KA 4IP4A 1KQYA 2NWSA 3WNPA 1TQXA 1CXFA 2YCKX 2Y89A 1TMLA 4ML9A 2DDXA 1B31A 4ZL1A 5FA5A 3PB0A 4QXIA 2E40A 3R11A 2DEPA 3H26A 1SMAA 3VNDA 3CV2A 1ZGDA 3R7MA 1GCYA 3KUMA 1TRDA 2AMXA 1J0ZA 1FWFC 1O5XA 1OIMA 4WF7A 2C0AA 3IRDA 2NX9A 1DORA 1V0KA 2XVGA 2VEMA 1NDZA 4YVXA 3NQBA 3MJMA 7TAAA 4YTQA 2Z2UA 2ZIDA 2YB1A 3OHMB 4LUSB 4ECLA 3HTWA 3EOEA 1AJ0A 1U30A 1POJA 2XINA 3T1GA 4Z2IA 3OBEA 3E2QA 1B9ZA 3VDAA 4O1DA 1JUBA 3CB3A 4A4AA 1TRIA 3FYPA 3P14A 3CZJA 1RVGA 2GJNA 3MVIA 4R85A 5G4EA 4DY1A 4R7JA 3UPMA 3RCMA 1C7SA 1E9IA 4QROA 1QWGA 3WLHA 4QIUA 4HIBA 3UY8A 5D2XA 2QCDB 3QVQA 4HA0A 1CCWB 4JY8A 3TN5A 1O6IA 1PDZA 2A79A 1VLIA 5JXQA 1W9VA 3ELFA 3GIQA 1R9XA 3POHA 1FWRA 2CERA 4ILSA 4U5KA 3ABZA 4E3VA 1VEOA 2XUCA 4MLJA 3SW6A 4LT9A 2QEZA 1LG1A 5C2CA 4CNNA 3ITYA 1VHNA 1ICPA 4ZQCA 5DMMA 2E6DA 3JRKA 1BF6A 5JUVA 3VKBA 3PNUA 1FHDA 1DJZA 3P6LA 4PUWA 3BW4A 4INFA 5LIKX 1VF8A 5EU9A 2XDFA 2JGYA 3ITTA 4HTYA 1PYMA 3N17A 3L12A 1BTCA 4W87A 2ZRVA 3DHPA 2Q6ZA 3H4XA 4JIIX 4G7EB 4I90A 4P7NA 3DH7A 8TIMA 1G4TA 2EHHA 4TQTA 2WM0A 4YS1A 1R8LA 2NSXA 4YYFA 3I4KA 1GGOA 1AMKA 3JVAA 1UPPA 2ESCA 1TZZA 4TO8A 4OECA 1DTUA 5DBUA 2FFIA 3MW7A 4KF1A 4AIBA 3NSXA 5C5YA 3BMXA 5EYWA 1V51A 2TYSA 3PJTA 4LVBA 3T2QA 1XSJA 1Z9AA 3LCWA 2E67A 4BZYA 4C6MA 1MUMA 3AIQA 2HDJA 2XZ9A 3N9KA 4DELA 3KLKA 3VDGA 1FX6A 1SQ7A 3K8KA 4ZXLA 5HANA 1UPMB 4D6DA 4TVDA 1FVPA 2WBKA 1IF2A 4V15A 2VFHA 4ZE5A 3PWAA 3WQCA 4JCLA 1ZAIA 1UZDA 3GR4A 1XBYA 1VRDA 5AYYA 3UZZA 5I79A 1A53A 4RPQA 2C71A 3CZKA 3W75A 2WZIA 1DJIA 1O1ZA 4E8GA 2QPXA 4B9YA 4UCFA 1YMYA 3CUIA 1P6CA 1QPNA 1NELA 5DFAA 1MEWA 3IWPA 4DBWA 1HFBA 3LD5A 5ENLA 3G1VA 1XLGA 3PZGA 3ICJA 1FCVA 1IWPA 1J96A 1GQKA 2XFFA 3CLWA 1UH4A 3M5XA 2FIQA 1UWSA 3S2MA 4MOZA 4FXRA 1BXCA 1QR7A 3W7LA 1UHVA 2DIEA 4CVUA 1H3GA 4KESA 4DBSA 2AL1A 4LJ3A 2GVYA 4S39A 3UWWA 2G8ZA 3T07A 4S3BA 4HSOA 4FMVA 3SFWA 2PAJA 3TYUA 3E9AA 1Z8AA 4HNUA 3MWAA 2R14A 5BRBA 4S3GA 3NO5A 4DUWA 1GOIA 1F6PA 2PWGA 4LW7A 1UUMA 4IXHA 3A3WA 2ZUMA 3TA6A 1ZP3A 4AD4A 4NNBA 2PD5A 4J9JA 3PS7A 1U2YA 3FGCA 4PUMA 4B5VA 2RGLA 4Q4RA 1JNDA 1KCXA 4R9XA 3AQUA 3PBGA 1H50A 4H9XA 4C6NA 4C1NA 3AHYA 3QF0A 5ABGA 4URIA 3RPDA 2JFEX 4GKLA 3VGHA 3VIIA 3NUKA 2E5CA 1SO3A 2IKGA 1AQMA 4QISA 2V5BA 1D9EA 4O4VA 2QKFA 5DCBA 1TYGA 4P7LA 2GJPA 1S5VA 2GSHA 1RK6A 5CGTA 3UJEA 8CGTA 1H4PA 1EJWC 1V3MA 4MZ1A 4O28A 3CL8A 1P0NA 3QV7A 5T8GA 4ZOCA 4FX8A 4JTKA 3T2OA 1EA9C 3N9RA 1W9XA 4DYEA 5HAOA 3ZLGA 3CK5A 1FDYA 1TJ0A 1LOSA 4O53A 4H83A 5CLTA 2E77A 4NU7A 3M46A 3R6IA 3W1MA 2F8QA 3RRAA 2RH9A 3CV6A 3M4HA 1KXTA 2QJIA 4JQ2A 4XO6A 1QI0A 2CZVA 1YNQA 4QG9A 4XZBA 1QDSA 1XLLA 3C3NA 1OSEA 4H9ZA 3RXZA 4RXFA 3CO4A 3BDKA 2GUBA 1ITXA 1Y0EA 4PMQA 1DJHA 2F6UA 4F2TA 1M5WA 2Z1BA 3GTNA 4HNLA 4W84A 4DQWA 7ENLA 1EBHA 2EJAA 4PRRA 1ODUA 1V0MA 1BG4A 5GNZA 4ZENA 1R3WA 4DO5A 1CPUA 1YXDA 5DCDA 1MZRA 3E5BA 5FJRA 3ORWA 1BKHA 4DAFA 1KLZA 1J0HA 1A5CA 4MB1A 4Y8FA 3M0IA 1JPMA 2WMJA 3M07A 3EAUA 3AIVA 3NWRA 5GJNA 3VD9A 2AQWA 5I77A 3IANA 4PUNA 3BANA 4JY9A 3LI1A 4XQ6A 1CBGA 1IIHA 2Y7FA 1TJ2A 4OOZA 2OZ0A 2IMRA 3QBUA 1V6XA 3SQSA 2QR6A 2DUXA 4GBUA 1OFAA 1DIEA 3A9IA 4ZO6A 4L4PA 3TLLA 2VFEA 3A3XA 5FF0A 1UMLA 3AWNA 4RE3A 5HDRA 4L61A 1XRFA 2JF7A 1VD6A 4K1WA 2V5DA 1FWDC 4EX4A 5DN1A 2VR2A 4KEZA 1PIGA 3M0ZA 2YL8A 2WCGA 1JFXA 4XUGA 3R10A 2UY3A 2C1HA 1JD7A 3ONBA 2BFGA 3NOYA 4AD5A 3G8RA 2ZUSA 1E1FA 1U5JA 1G7VA 4ZEPA 4XD3A 3A6OA 3EYPA 2YX0A 2J88A 4PYSA 4EAYA 3NEHA 3VOJA 4J28A 4OBSA 4Q8WA 1OD0A 1IXNA 3W7QA 3GG7A 4GX8A 2V81A 3LXBA 2WQPA 2FDSA 1UD3A 2QCLA 5K9XA 4J7RA 1TIWA 3S9IA 1FWIC 4PSRA 3AU2A 1OYAA 2IPGA 2P10A 2OO0A 3RU8X 2VP8A 4RX0A 3GC5A 1F3EA 3QLLA 3LHVA 1DEDA 4GFSA 2YFOA 3CHDA 3PN8A 4FOUA 1B5TA 2A3BA 3T0TA 3UZ5A 4QE4A 1BWVA 3FDKA 3GW3A 1EX1A 3KL5A 2O55A 1JD9A 1T96A 1KO0A 3L0NA 1M68A 4XZ9A 3W4RA 5HNUA 1B3OA 3M1ZA 4GQBA 2G50A 1W9DM 3WH8A 1A0EA 1WXZA 4AEOA 5C9ZA 1V3HA 4PTNA 1P0EA 3LMYA 1JCLA 5HK4A 4EPDC 4Y9PA 1XFBA 2G4JA 1SJCA 3CHEA 4OOUA 2VRKA 2PLJA 3B0UX 3VGEA 4LANA 3I7QA 5DXYA 3EKGA 3N3MA 2PWUA 5FSDC 4I9MA 5CAKA 3EX1A 1H0GA 5XINA 5FF7A 3MBFA 1Q2SA 3OO2A 2J7DA 2OEMA 2XIMA 4UBPC 3MO4A 1F8IA 3W6MA 2GWNA 4YJ5A 2Z1XA 1JFHA 3SCRA 2PGFA 3IPWA 1EGVA 4I8DA 4F2BA 1TREA 5EMKA 3RPTA 1XLAA 4GNJA 4WGHA 1IT7A 4LVFA 4R7WA 4OGZA 2BVWA 3N2OA 2J6XA 3N4EA 4LYRA 1K3UA 3F4CA 2BGNE 3U4FA 3THUA 1EO5A 4N9DA 2REQB 2PF8A 3BARA 1AODA 1X6UA 1QOXA 4Z08A 2QCDA 4MWAB 2Z26A 3UFYA 1Q6LA 2ASHA 4BI5A 3UYIA 2XGZA 3SSZA 3GU1A 3QY7A 2WPBA 3GXTA 3N1AA 1G5AA 1RCXB 1QCWA 1XUUA 1I2QA 5HMSA 2ZTKA 3QZ6A 3KVMA 5GPRA 4KWWA 2ZE0A 3RM9A 3GBDA 4X60A 5KZMA 4NILA 2ZZ1A 1V03A 1T0OA 3IV8A 1KRAC 1N82A 2O9PA 1CB7B 2QUUA 3UD6A 2FZ8A 1RD5A 4XWUA 2RJGA 2X09A 2EPNA 4XZMX 4KRTA 2YDSA 1C9WA 1W6TA 2C3ZA 5DY3A 4MKVA 3HMJG 4M1BA 2CFFA 2WNNA 3WIJA 4ERIA 1B57A 5GNYA 1E4NA 1FH7A 4H6QA 3NQDA 1XIBA 1QXLA 3B9EA 3W29A 1WKYA 4H4IA 9RUBA 1VIZA 3GHUA 4MLRA 3NQFA 2BLEA 2PP1A 1IR1A 3ABXA 5HWMA 4MDOA 3THDA 3MP4A 5FACA 3IAQA 3DHDA 4IQJA 5TBOA 3AXMA 1Y8BA 1X1ZA 4M8UA 4FLRA 1OINA 5AC7A 1X1OA 3BLLA 2J9YA 3T44A 2E9LA 3R1ZA 1DXEA 4KFPA 1JCNA 1M03A 3KZSA 3PJXA 1XH0A 3VILA 3WL1A 3WQFA 3AXXA 5LNRA 4ATWA 3DBPA 5T9CE 3U7BA 5E5CA 1EC7A 4AX6A 3T7VA 3OP2A 4MWAC 4OQVA 5ECUA 4FS9A 4HOXA 2DY3A 3CPRA 2GDUA 3W74A 3AXKA 5A1AA 4TR9A 2YCJA 1XYBA 3W2UA 2YLLA 3QM3A 4LUYA 1Q7QA 4DWDA 1G9HA 3NL2A 2C15A 1E56A 4DLMA 5DF0A 1C8XA 4BA0A 4I5RA 2GPTA 3ZSTA 3TSMA 4H6RA 1O60A 2ZCGA 3PFMA 2G0WA 2VUYA 1RA5A 3ARYA 4KCWA 3EWCA 4QAIA 1ZZMA 5AC5A 1ZHAA 1Z42A 2WOQA 3QFWA 3DXIA 1VQTA 1S2VA 2A1YA 3KOZA 2IKJA 3ZJ8A 2XH4A 3FJNA 2HNEA 3AHVA 4IMEA 3C0SA 3W7HA 2FZDA 2O4MA 2V63A 2GK1B 1GVSA 4JR5A 3GDLA 5D38A 2A3EA 1NSJA 2VC5A 2XM1A 3KCOA 1Q6CA 2FB2A 3BJSA 1V0NA 1BAGA 2YA0A 1XLEA 3M7WA 1TVLA 3GU2A 1OFQA 1W9UA 1RJQA 4MKNA 2E9MA 2NXHA 3KOXA 4DJED 2ZX8A 3B0XA 4GBDA 3I10A 1M6JA 4IIGA 2E6AA 2J77A 1G69A 4WCJA 4AXNA 1ZBCA 4GA8A 1BRLB 3B8VA 5ABFB 4ADSA 1VFLA 4NXSA 1NY1A 5I3JA 3GU9A 4N9CA 3WH6A 3AHZA 3STFA 5HOSA 2C13A 4DBEA 2FHBA 6REQA 2PDYA 3FEQA 4UQAA 1HVXA 2WYSA 4EACA 4FA3A 3QW3A 4W7WA 5TD4A 3W73A 1IR2A 1C90A 2DT1A 3GTHA 2OR2A 2Y2WA 4HU0A 4FEZA 3WQ8A 2ZTJA 1MNSA 4CQBA 1BWLA 4AVOA 4R7OA 4RKAA 2YCLA 3QKZA 3CZLA 4RDYA 3BE7A 4GIEA 4U33A 3H70A 3CIXA 1WXYA 3S42A 1PKLA 2GLKA 5I3HA 3ARVA 4E6MA 3GTFA 1O7AA 3G22A 3W25A 4GO8A 1RCQA 1HJXA 1G4PA 2CLHA 4HPNA 3VD3A 1WZKA 3TN6A 3CNYA 3W27A 3W7CA 1XGEA 5K9CA 4EXAA 3HJZA 2ZXBA 2QCEA 3GKFA 3UZJA 4E5TA 1MW0A 4UTHA 3PFRA 3PM6A 3OG3A 3GDRA 5FL0A 4ZZ9A 1EJRC 4AZIA 4UR8A 4IQEA 1R0MA 1EC8A 1GJWA 1Q13A 2R82A 4LEQA 2WHJA 2VL4A 2E28A 3I7RA 2DPEA 1UG6A 1GEHA 3IRSA 1KBIA 1FHLA 1TPDA 4JL1A 3IUIA 3HQ1A 4LBRA 2ZA3A 1F3WA 4KCUA 3W7OA 1DP0A 1SZFA 2WSQA 2OZ8A 1UIOA 5DY2A 1OIFA 2I9UA 4H6KA 3ZS4A 3SBFA 4UTUA 2FZMA 4JZ5A 1LWHA 4EIVA 1KM5A 4AG0A 2ZUVA 1Y5WA 2D2GA 4F66A 4CNPA 2HBXA 4MJZA 4O54A 1EEPA 3LBCA 1CW2A 3BLOA 2GGIA 1V5XA 3CQHA 1GUVA 4M24A 1Q66A 1LUCA 4ERAA 4HK5A 4W93A 3O9NA 1LP6A 3CU2A 4OUIA 5CPQA 1PV8A 4H9TA 4QE5A 2OQLA 8A3HA 3WN6A 4I9JA 3WQ5A 3PAOA 4UFLA 1VC4A 3UJSA 3MC5A 5DANA 4O16A 4Z2HA 4GACA 4KIRA 3P5ZA 1DJYA 1AUSL 1OC6A 3WDHA 5F2IA 2WMFA 3XINA 1SYTA 5DRIA 2BMBA 5CG7A 1WDDA 4O1BA 3OLDA 2VTFA 2ZADA 2DUZA 3PBMA 2CLOA 4EF8A 2V30A 3CAVA 5CGMA 2A3CA 1VBRA 1TCMA 5KETA 1UD6A 3PUOA 4L9ZA 1SO5A 4CLMA 1PUDA 4O0KA 1XYZA 1AW1A 4HPGA 3MSGA 4NIRA 3R8GA 5HJYA 3O15A 2VZSA 1ZAJA 5HUPA 3WF1A 4MIMA 4OBRA 4UQEA 1JDFA 4UFJA 2Y5EA 5H8PA 4RR4A 2O9OA 3BOXA 2AAAA 4L1GA 1OGBA 4OV9A 2OLHA 3E2SA 2ZYFA 3ZR6A 3GG0A 2E68A 1TV5A 4JS3A 4KWOA 1XICA 3BCJA 4J40A 4LS1A 1ELSA 1O95A 1OJXA 4LRSA 1XUZA 2WC7A 2G37A 3V5FA 2J47A 4RLIA 1MW3A 3EOOA 4MJ2A 3CUXA 3NGJA 1JRCA 5BXSA 1R7AA 1UW9A 1QI5A 2WZHA 1GG1A 4JTFA 3MI6A 1C3FA 3BK0A 3LEPA 5KZ6A 3H12A 5M3WA 4FIQA 1CGWA 2BB0A 4D8LA 4P8VA 3MUIA 4YHGA 3BW3A 4MAZA 2X1SA 3SRFA 4GUFA 2OLSA 1YNPA 2ZZ5A 5G2WA 3UF9A 3B3DA 3W83A 1OQFA 1VKFA 5DEZA 2JIEA 1X8CA 5E6ZA 2AQOA 5FCZA 5K2ZA 4FI4A 1VFUA 3E3HA 3CTLA 2CETA 3RG6A 2VUNA 1N7KA 2XH2A 4LC6A 1XL9A 1EDGA 4RV8A 3OLEA 1QT1A 4Q7BA 4TIMA 3RITA 3LM3A 3TP4A 1GHRA 1Z32X 3EMCA 4A35A 3CL7A 1F61A 1MQQA 2GOUA 2VELA 2D20A 3NR0A 1OFBA 1HGYA 3NSMA 3M0VA 1W1TA 4LAZA 3PZTA 3SCTA 5I00A 5AVNA 4US5A 1VJIA 5I06A 1RXOB 2REQA 4CU8A 3FKRA 5LGZA 4GNKB 4QJ3B 1EZ2A 3RF9A 4RDWA 1RBOB 1R5YA 3UJ2A 2LLEA 1FUYA 3OLIA 2XM2A 3N13A 1XLBA 3W7JA 3W7DA 1ENUA 1Q6FA 3POCA 2QGHA 2B7PA 3NZRA 3PTKA 3T05A 1HNYA 3U48A 2VEGA 2ZXDA 3W85A 1UBPC 3W81A 3PULA 4V27A 4NAEA 3MUCA 3CGTA 5LGXA 3BZJA 3VIJA 3ZIZA 1NDVA 2VOTA 3V0UA 2XPKA 3NM1A 2D2HA 3V75A 4PFMA 2D0HA 4YYCA 1MXGA 1VJZA 4JIHA 3IGUA 5E0CA 3ZJ7A 3I6EA 1FWJC 1XIFA 3SO7A 4MDPA 2BOFX 3VKAA 1UR8A 4HOWA 1IEQA 3IJIA 2VX7A 1BQCA 2PPGA 2VO5A 3GVWA 5AKQA 3G6MA 2I1OA 4IIHA 1CB2A 4ONVA 3T4CA 2DGAA 4ATLA 3M6YA 3WQGA 1F6YA 1I8JA 1NWSA 1TPFA 4IMAA 3W6YA 3GLCA 3W2NA 3CTTA 3VAVA 1FDJA 1P6WA 2NWRA 4IFOA 4P7OA 3V35A 1DVJA 5A69A 3PZ9A 4JCMA 1YDNA 3VM5A 1YTKA 5L9FA 4U2ZA 5AYIA 3ID7A 1JZ7A 2E09A 3PHAA 3SEPA 2D0GA 1QW9A 4FZIA 5MKGB 1K7FA 4PUJA 3TYCA 5ABFA 3IJDA 1MUCA 1TKKA 1FXPA 2V2DA 3CASA 2C0HA 4H8HA 1VFHA 3UXKA 1GZJA 2W4XA 2ZXQA 4PCTA 3MI2A 3UESA 2AGKA 4A8NA 3TR2A 5JQ9A 1WV2A 3W71A 3LMZA 3WDIA 1KFKA 3TCSA 3SI9A 4WDUA 1JDEA 2VWSA 1TX0A 4IPIA 4AUBA 4HBKA 3GVVA 1H7WA 2Z1SA 2BG5A 2H8ZA 2HTMA 2WJFA 2YXOA 3AFBA 3LTSA 1ZSXA 3KDOA 4ZB0A 1DWFM 4QCEA 2PDHA 2RDXA 3VIPA 3FX4A 3P74A 3WMBA 5D8WA 2VDGA 1G94A 3ANYA 1UWRA 2QCFA 4EP8C 3A24A 5D33A 2PTZA 4ZA0A 1FP8A 2J9ZA 4S3JA 4UQCA 2QXWA 3WG6A 5BMXA 2WVSA 3FDGA 1DTNA 4AZHA 4FHAA 4YN5A 3OZPA 2OLAA 2QCGA 4UXDA 4NZ3A 3B8DA 4DNHA 1K9EA 2XVKA 3IACA 1N8FA 3EDJA 1LBLA 4G6CA 3WLJA 1FWGC 2EF9A 4GOAA 3ES7A 3M47A 1EWDA 1T40A 4YTUA 2PRHA 2PDCA 5JH2A 3CB8A 1ME9A 2WVTA 4TXEA 3WYZA 4RUBA 3MZ2A 5GJMA 3A4JA 2VT0A 2XVLA 3GWQA 3N6HA 1XCWA 1SJDA 1US2A 4O10A 1QW7A 1T5AA 3GE7A 1W3LA 1CGUA 4FNRA 4LGXA 2Z2BA 4IGHA 4IL2A 4NRSA 2HVMA 4IFRA 2ISSA 3ABOA 3OA3A 5I3KA 4A22A 2QUNA 3BMWA 4QITA 4UC5A 1VFTA 3EOUA 3EB3A 4LNYA 5AHNA 1F6KA 3WLQA 4F48A 2YCLB 1FWWA 3AMKA 3WLKX 3TEVA 4Y90A 2ZRZA 3WO8A 2E25A 2E8YA 1S2AA 6ENLA 2XN0A 2PDUA 1HL9A 4AFYA 3AISA 1OZMA 1YPIA 3O0FA 4XZLX 3DU0A 3V36A 4IMCA 1NFGA 1O12A 3VZZA 2NT0A 3AUJA 1VFMA 2QDEA 1FWSA 3G1AA 4W88A 3DFYA 1UD8A 3ERPA 1IZCA 1FCBA 3EXRA 1S46A 4Y6GA 4D71A 2C14A 4FNTA 3TJIA 1TJ1A 2WMHA 1M53A 4JN7A 2CZFA 3CUJA 3P60A 2XJ7A 1XP3A 3MHFA 1H09A 1R3TA 3VOIA 2BNJA 4JTIA 3QMTA 4TV6A 1ZJHA 1OABA 5M03A 2WNWA 4I3GA 5RUBA 1LORA 3L4WA 4Q4PA 5CC3A 3BPWA 1LRQA 4JAWA 4GI9A 2V82A 2ADAA 4N42A 3CXOA 3ONCA 4ZFCA 3UR8A 4UQ9A 4Q33A 1DHPA 4AF0B 4B4FA 3SQMA 1W37A 4Z42C 5CJNA 3FVMA 1J9YA 2YBVA 1KFCA 2DJXA 2HBVA 2R9RA 3MVTA 3UXIA 3P93A 3M0MA 1UOZA 4G1NA 2PA6A 5A95A 3I68A 5C6MA 3B03A 4DXVA 2F2KA 3B97A 2RJHA 2PBGA 2C16A 4CQ9A 2X2GA 3IJ6A 2CZ5A 2XIOA 4MWAE 5SWUA 1CLKA 2CZDA 4WVXA 3RDKA 1SO4A 3W38A 4MB3A 3FXGA 1VAHA 5A8NA 4XG1A 1V6WA 1ITQA 3E02A 2DZPA 1RBAA 3F03K 3ABQA 3KWSA 5IDZA 1A80A 3AC0A 3UW6A 1E55A 1FH9A 3D5HA 1DWJM 3QH2A 3WMLA 2FGBA 1SSDA 1E71M 5DMNA 4WR3A 2XSBA 1EYEA 2QJNA 3BWWA 3VCCA 3W2JA 3OVQA 2R94A 1AJ2A 2VGFA 4DM2A 1TQJA 4LXFA 2O9TA 1UWIA 4IMDA 4NZ4A 5BU6A 5AECA 2INEA 6XIAA 2XU2A 1MRAA 1VHCA 3GH7A 3VA8A 4AWSA 1PBGA 3NXLA 4MG4A 1CECA 5A8MA 1E6ZA 4B3LA 4GD0A 3REQB 1NFPA 1QK0A 2ZXAA 5FJJA 2H3DA 1FOBA 3OGVA 2CBUA 1S1RA 5BYWA 1UR0A 2RGMA 3QSTA 5C8BB 2ZZ7A 4RDZA 3V0TA 1NTHA 3UR7A 2OX1A 3TYEA 2X0HA 4G7EA 5LA2A 3WLRA 4IG2A 4O14A 4E8DA 5G2IA 3PY2A 2ZDRA 3DKJA 2W79A 2ZZ4A 4NG3A 3ECQ