3TA9A

Beta-glucosidase a from the halothermophile h. orenii
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
449
structure length
448
Chain Sequence
AKIIFPEDFIWGAATSSYQIEGAFNEDGKGESIWDRFSHTPGKIENGDTGDIACDHYHLYREDIELMKEIGIRSYRFSTSWPRILPEGKGRVNQKGLDFYKRLVDNLLKANIRPMITLYHWDLPQALQDKGGWTNRDTAKYFAEYARLMFEEFNGLVDLWVTHNEPWVVAFEGHAFGNHAPGTKDFKTALQVAHHLLLSHGMAVDIFREEDLPGEIGITLNLTPAYPAGDSEKDVKAASLLDDYINAWFLSPVFKGSYPEELHHIYEQNLGAFTTQPGDMDIISRDIDFLGINYYSRMVVRHKPGDNLFNAEVVKMERPSTEMGWEIYPQGLYDILVRVNKEYTDKPLYITENGAAFDDKLTEEGKIHDEKRINYLGDHFKQAYKALKDGVPLRGYYVWSLMDNFEWAYGYSKRFGLIYVDYENGNRRFLKDSALWYREVIEKGQVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glycoside hydrolase family 1
publication title Expression, purification and preliminary crystallographic analysis of the recombinant (beta)-glucosidase (BglA) from the halothermophile Halothermothrix orenii
pubmed doi rcsb
source organism Halothermothrix orenii
total genus 162
structure length 448
sequence length 449
chains with identical sequence B
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ta9A00
2BFGA 3L4ZA 5AYBA 5A2CA 3PZUA 3N1AA 2JE8A 3WELA 1S46A 5BYWA 1BYCA 3FAXA 3UEQA 2BVYA 1K9DA 2W63A 3A3HA 3MV01 4XUYA 4ZXLA 4HOZA 1JD9A 1F4HA 4WSJA 1JDCA 3UG4A 3O9NA 4H7VA 4DUXA 1GOKA 4Q7NA 2YA0A 1GOOA 4CGTA 3CUFA 2WVTA 1V3LA 9CGTA 1MQQA 4WSKA 1V3HA 1C8XA 1J0IA 1JIBA 1H0GA 2ESCA 5FKYA 3TTYA 3ARWA 2D3LA 4LXFA 4E4PA 3N13A 1HP5A 4P7QA 2ZX9A 3BSGA 1ODZA 4PUDA 1QI5A 3L4UA 1B3YA 2OWWA 1UUQA 2V3FA 3L2LA 4R27A 1BAGA 4OJYA 1ISVA 1WE5A 5BRQA 1MFVA 2YBTA 1OT1A 1N82A 2D1ZA 1BLIA 2WMFA 3QGVA 1DWAM 5M5DA 2WVSA 1V3JA 2XGIA 1JZ7A 3UCQA 5E70A 2BV9A 3ARRA 4FLRA 3VIKA 5I0DA 4ACZA 1IT0A 1JFXA 4WK9A 4AWEA 1D3CA 3EDEA 4HPGA 1TA3A 1UYQA 3WNPA 1H2JA 4W93A 4UFHA 2WCSA 1JYVA 3WD3A 4GPNA 5JBFA 4UFKA 1LL6A 2YIHA 3VIJA 3VPLA 4CVWA 1VFFA 1GORA 1G94A 3SCVA 4UFLA 4MB5A 4CN1A 1TE1A 1HKMA 1J0YA 1O7AA 2X0YA 3SEPA 4CCEA 2VQUA 2YDRA 1RPKA 2VCCA 4D6DA 4OOZA 1CGUA 1WPCA 5JBEA 1NP0A 4B3LA 4JKLA 1CGYA 3M7SA 5FL1A 4JFVA 4CU6A 2YBUA 2XVNA 1MYRA 1HVQA 5CPTA 1G1YA 3LPFA 1MXDA 2OYMA 1NM9A 3CH9A 1SFSA 2DGAA 2A3HA 1VFMA 3NSXA 1V03A 4IPNB 2WHLA 2DSUA 3TONA 3PZGA 3PZVA 2O9RA 4KH2A 4W8AA 5FL0A 3GDBA 2BY1A 3GXDA 1TR1A 4MNMA 1D7FA 3MANA 4K68A 4W87A 3VX0A 1Q6CA 4IPLA 2UY2A 3OLEA 1H4PA 3WF4A 4JCMA 4WKHA 2X09A 4TVDA 3WQ6A 3ECQA 2WZHA 2XSAA 4MNJA 2PBOA 4IUGA 4MNKA 5EFDA 3AIBA 1BYBA 1BTCA 4BCEA 1CWYA 1QPKA 3N9KA 3QR3A 3SCNA 3W53A 1E1FA 2FGZA 5ABHA 2GJXA 3DHUA 3CZLA 1VENA 2V3DA 3AROA 4PEEA 4W7UA 3PZTA 2YL5A 3VO0A 2GK1A 4AZGA 1GUVA 4AD1A 3TTOA 4CVUA 5DT7A 4FLSA 1WAWA 2E9BA 4HZ6A 2PBGA 3W37A 3U5YA 2EPOA 3FY1A 3AZSA 1BHGA 4XZBA 3TOPA 1FHDA 1MW0A 2O9OA 2GUYA 1MWOA 2VR5A 2XSBA 3AIUA 2ZXBA 2EEXA 1AQMA 3TTQA 4ATLA 3VM5A 3L4TA 4CD5A 2VOTA 2WBGA 3U7VA 2EXOA 4BQ5A 4MJ2A 5E09A 2PB1A 2WYSA 3EMQA 2IUZA 1OIMA 3WFZA 1OB0A 4DM2A 4N42A 1XCWA 3SUTA 3VOCA 2E0PA 3G6MA 3W28A 3VNYA 4PTWA 5FCZA 1E9LA 1F4AA 4CD4A 4ATWA 2WVVB 4AIEA 3AMGA 2OWCA 4D1JA 1V3IA 1MW3A 1W9PA 2XM2A 5BCAA 5M03A 4L4PA 3WN6A 1Y7VA 2BVTA 3KE0A 4GO8A 2W66A 2V5CA 4X9YA 2W4XA 2XWDA 4XV0A 3U57A 3VGFA 4KMQA 2WHMA 4F66A 4MPKA 1PZ2A 3SURA 5A1AA 3QHOA 1CXIA 3WL1A 5EBAA 4Z2LA 3B9DA 8A3HA 1QHZA 4BA0A 4UZSA 2ZUTA 1BFNA 4AZBA 1XSJA 1BYDA 1VEMA 4TX8A 2NW0A 1QI3A 1OBAA 2A3AA 4AIOA 2BHYA 3OA5A 4ZFMA 1C92A 4JKKA 3WD0A 3AXHA 3AIEA 2X1IA 4X0VA 1JYNA 4D6HA 5KZ6A 1CNVA 2VRKA 5BROA 3POCA 3A4XA 4QCFA 3WD1A 4AISA 1NWUA 2HISA 4EK7A 3VD4A 5I23A 3WNKA 4C7DA 3LPGA 1B90A 4U3AA 1GOMA 1MFUA 2XM1A 1TVPA 3OIHA 1PX4A 1GVIA 5FOOA 1ITXA 5GNZA 1GW1A 2WNWA 3I3BA 4CD6A 1BG9A 1E4MM 4AZHA 2XFFA 1GOIA 2CEQA 2Y8VA 1XH1A 1QHPA 1GCYA 3LPOA 3GNPA 1UWSA 1OD0A 4Z2JA 1M7XA 3VIHA 1TCMA 5FIPA 4KRTA 1GQJA 2G3JA 4M80A 4UOQA 2XIIA 3BCDA 1J10A 4W84A 4D6IA 1UD3A 3EDJA 1GJWA 3MO4A 3MUAA 5GPRA 1ZS2A 4JCLA 3AOFA 1KXHA 1W3KA 5HPCA 3ZSSA 4EAMA 1E6QM 3LMYA 1TFVA 2PF0A 3GBDA 1UR0A 2ZUWA 3SIMA 4AD0A 3AHVA 2XVKA 1C8QA 3DYPA 4V28A 1BVNP 2WSPA 4DUVA 1UH3A 3BAXA 4GZEA 3WIJA 1E43A 3ALFA 4S3JA 4W7WA 1NOUA 4QAWA 1VFUA 4S3KA 4N0RA 1V0NA 3N04A 3VIIA 2J78A 4CU8A 1DP0A 3VVGA 1UKSA 5I3DA 5CXPA 3W24A 3WENA 1VEPA 2QF8A 4D72A 4UQ9A 3OLGA 3ARUA 3ALGA 1UD4A 4JL1A 4WKAA 1XHGA 2HVMA 5GNXA 1EQPA 2XFYA 4M8UA 1EDTA 1VEOA 4F9DA 1V6WA 1HF6A 2CXGA 1PJ9A 1RD6A 1B31A 1W1PA 2VI0A 3BXWA 3SUVA 3MS8A 3WQ4A 7TAAA 2YL8A 1ZBVA 3VDAA 1CGTA 5CQ1A 1UD8A 4XX6A 2G3MA 1GQKA 4CKQA 2D2OA 1L0PA 2VJXA 1UWQA 3OLIA 4TTGA 2CBVA 1KGXA 4PMNA 3QHNA 3NIYA 1E71M 5BXPA 5LA2A 4WKFA 7A3HA 2G3NA 4JFSA 4QLJA 4AD2A 3T2PA 2VX6A 1ZBKA 4HOXA 1FP8A 1H0IA 2JFEX 1NOFA 2AMGA 3SCUA 2VTFA 4PCSA 3KWXA 4HU0A 2G8ZA 5A6KA 1JFHA 3WBEA 1R8LA 5BWFA 3VGEA 3WMSA 1QNQA 2QHAA 2ZUSA 2FH8A 5ABFB 3EDFA 3FHAA 3SUUA 3AIRA 3VTRA 4Z2IA 4U2ZA 2J77A 1CXLA 3CTTA 1Q6FA 3PZOA 3W27A 4E8DA 3VIFA 4OBRA 3GXFA 2ZUUA 1FFQA 5F7UA 2BVDA 3AIVA 1WDSA 3CUGA 2WVVA 1UKPA 3WQWA 2DSVA 2XTKA 1UWTA 2ZX6A 3MU7A 3SCWA 1E73M 3AZRA 1OCQA 1UG6A 1QI4A 2EJ1A 1JZ6A 5D9OA 1IZKA 3RM9A 1JYWA 2XGBA 4TXEA 4HP5A 3T0DA 3B9AA 2BNJA 3ARZA 2E3ZA 3WKZA 5CLTA 3BH4A 1CGWA 1AQHA 1JF5A 4PMRA 2DT1A 1R7OA 4LYQA 2C8NA 1CGXA 2J7CA 4KGJA 5IHRA 1EA9C 1HNYA 2WKLA 4AW7A 1J12A 5HNNA 3CO4A 3SCPA 4J3WA 4PYSA 3NSMA 1JAKA 4P7OA 5HPOA 2EPMX 3KZSA 4W8BA 3W6MA 4RE3A 3NJ3A 3WSUA 2JEQA 2DSZA 1V6YA 4JIEA 4NZCA 2DDXA 3FAWA 4J3XA 1QNRA 2QMJA 3PTMA 3D3AA 4RL3A 3ZJ8A 2OYKA 1OGGA 3A47A 1FHLA 1ZJAA 3RIKA 4P7NA 2ZUVA 2Y4SA 3B9EA 5A95A 3F5JA 4P7RA 1VRXA 3WDRA 3W4RA 2ZXQA 4MAZA 1HJUA 1XH2A 4TUFA 4YHEA 4C7FA 3CZEA 3VGBA 5A94A 2FHFA 3BLKA 4AY1A 1EO5A 4IISA 2WHKA 4JHZA 1EDQA 1W1YA 4M56A 3MMUA 5M17A 1CENA 4M1RA 4V27A 2BXYA 4U5KA 4PRWA 2ZUNA 4MADA 2WANA 4B9YA 3WF3A 1A47A 1QBAA 4P8XA 4AIUA 3WDQA 3PZQA 5IDIA 5A8NA 4OKDA 3UESA 1DTUA 1PPIA 1HXJA 1I75A 2J8FA 3WUGA 2A3CA 3A4AA 1JZ5A 3WNNA 2DSWA 1K9EA 3K8MA 1B3WA 4HTYA 1XH0A 1E40A 2E8ZA 2OWXA 2WLZA 2VQTA 3TP4A 1BF2A 2E9MA 3W26A 2VCAA 5HXMA 4D1IA 3WF0A 2D24A 2PC8A 1ISZA 4F79A 4YN5A 3W6LA 2QPSA 2VVNA 3VGGA 2PWDA 2OSXA 3AZTA 4LPCA 4MTVA 2J75A 5E9AA 3AMKA 3VGDA 1E72M 2VZSA 2CBJA 3EYPA 1L8NA 4BS0A 2VRJA 1G0CA 2QPUA 2OLHA 1UKTA 5M3WA 1CXEA 3DHPA 3NUKA 1W9BM 4UNIA 3ZSTA 3B8SA 3T2OA 4HPHA 1UWUA 3VD9A 1P6WA 3GH7A 2JIEA 4B15A 1V08A 4U31A 4EKJA 2CCRA 3K4DA 4PTXA 5A6AA 4TTUA 2DSKA 1KQZA 4JFUA 3VD3A 4LGXA 4NRRA 7CGTA 1HJVA 2XG9A 3K8LA 4D71A 5GNYA 1WDRA 5HOSA 4GKLA 3DC0A 4LYPA 3KL5A 3RM4A 1UA3A 1TZ7A 3OZPA 3SUWA 2FDMA 5ABFA 4NF7A 2X05A 3CUIA 1E3XA 1OWQA 1UQZA 1TG7A 1Z32X 2FHBA 2EBNA 1B3XA 3CHDA 3WUFA 1CZ1A 1SR0A 4ACYA 1EOMA 2ZICA 4UZUA 5A2BA 2VZVA 6CGTA 1WZLA 4OOUA 1UKOA 1B1YA 1CYGA 4AZ6A 5IFPA 5A8PA 1KGWA 1E6PA 2MANA 3ZJ6A 3K46A 4WJXA 2A3EA 3W82A 1ZJBA 3ZO9A 1V0LA 3WEOA 3DYOA 3KL3A 1E0WA 1J0KA 2F2HA 4HA3A 3L4WA 4Y7EA 1Q6GA 3M07A 1QW9A 4GZIA 4UQEA 1KR1A 3VINA 1KCKA 3FXYA 1R7AA 1K9TA 4D6FA 1J0JA 1CXFA 3VDHA 4AZCB 3VDBA 1MW2A 2VO5A 1NH6A 4TOQA 1E4LA 1KWKA 3GBEA 1KB3A 1HKJA 2WWCA 5DO8A 1UD2A 3ZJKA 3ZT6A 2D23A 4PMVA 5A6LA 1CBGA 3GXIA 3MUZ1 4GINA 3HU7A 1UOKA 1V6UA 4NSBA 3I3DA 3OG2A 2ZX8A 2CYGA 2WHJA 1XYFA 5D8ZA 3MSGA 3N15A 2VX5A 2EO7A 3VIMA 2CERA 3ZJ7A 1VJSA 1WB0A 1SMAA 1XV8A 3AIQA 1CGVA 3VIGA 1EGZA 2C7FA 5DT5A 1SMDA 1QBBA 2J7FA 1V3MA 3CZJA 2CITA 1FH9A 3HJEA 1UD6A 3WEZA 2CETA 4NI3A 1G01A 2CESA 3WDHA 3S2CA 2VZTA 2WMGA 3MUY1 2YOCA 3N12A 3PHAA 1LL4A 3VX1A 2XVPA 1IV8A 1M03A 3WNOA 3IAQA 3WUEA 5ECUA 2E4TA 4W7VA 3RDKA 2VMFA 3EDKA 5D9NA 1H5VA 5A6SA 4NRSA 1X1NA 4AC1X 1V02E 3PTQA 1GOWA 1QNSA 1US2A 1XSKA 3J7HA 3OGRA 2WSKA 4MB4A 4PBGA 1V0KA 1UR1A 1WP6A 4CD8A 2WC4A 1OSEA 3N18A 2J7EA 1W2VA 2JIWA 2XIBA 1KFWA 4KWUA 3BLPX 2WMJA 3WDPP 1QNPA 1UZ1A 5A69A 3MUIA 1FP9A 4TVUA 1AMYA 3A4WA 4UCFA 2BY0A 3CUHA 3AXXA 4UQAA 4MAVA 4MB1A 2YL6A 1E4IA 1JL8A 3L2MA 4H04A 3LPPA 3EDDA 3RJYA 1OD8A 3T2QA 4ZEPA 1MW1A 5I78A 3CHEA 3AS1A 2EPNA 1XSIA 1W9DM 2W91A 3SCTA 4AD4A 4BQ2A 5CJ5A 4Z2HA 4PN2A 5E0CA 5I5RA 1V02A 1E0XA 4DM1A 5A3HA 5A6JA 3EMCA 3ZM8A 5C8BB 1LJYA 3CZKA 5EMYA 2J4GA 1W91A 2JALA 3G6LA 2RGMA 4LQ1A 4OIFA 5HBFA 1ZBCA 1ZU8A 2UWFA 4UFIA 1OGSA 3CIVA 5JUVA 2WK2A 4J27A 2J8GA 3PN8A 1VFOA 3DECA 1ITCA 1K9FA 1V0MA 3NCOA 3AMDA 1B3VA 1XD0A 1CXHA 1W9UA 4GIAA 4LX4A 1AQ0A 1GONA 2Z1SA 2DQXA 1V3KA 4PTMA 2DH2A 4UFMA 4D6EA 1PIFA 1QI2A 3CBWA 2VC9A 1JDDA 2BY3A 1B2YA 4FF5A 3ARVA 4HA1A 4M82A 2PI6A 1E1EA 1VJZA 1KQYA 2O9PA 2Y24A 1GPFA 3WH8A 2DIJA 3VMNA 5CG0A 2JF7A 3MMWA 3NDZA 3GZAA 1EOKA 2UY5A 1LL7A 4DWSB 2NT0A 3GH4A 4YPJA 2ZE0A 3N11A 5I6SA 1KGUA 1HKKA 4MJ4A 3VIPA 2F8QA 1NWTA 5AC5A 3FHQA 4UR9A 3GTNA 3CHFA 2AOSA 5I77A 2G3IA 1R85A 1OGBA 4B16A 5DMYA 4IM4A 3CPUA 4J3TA 4J7RA 2J7GA 4KRUA 4QDMA 1R87A 3SCQA 4RE4A 4V2XA 3EMZA 2O92A 2FHCA 3T0BA 4J3UA 1JNEA 1HP4A 3BMVA 1UHVA 4AZCA 3FNDA 3BAKA 4JAWA 1FOBA 4QCEA 3T09A 2J47A 4UOZA 5D9MA 1XYZA 3AJ7A 1BVZA 2JF6A 1Q6DA 3GYCA 2CBIA 1NWRA 3WD4A 5EB8A 1YHTA 3ZR5A 3PZ9A 4E2OA 4R5EA 3CLWA 3GH5A 1EQCA 3WF2A 1VBRA 5CGTA 2WCGA 3PZMA 1GHRA 3OLDA 3ZMRA 2PWFA 1JZ8A 4FLQA 4U3CA 2D22A 2OSWA 4GZJA 2CPUA 4AD5A 1VBUA 2J79A 1XRVA 4OBSA 2ZX5A 1ESWA 4EANA 1DWFM 3OGVA 3WEMA 2DT0A 4BF7A 3N17A 1R86A 1B0IA 1WDPA 3BMWA 2YL9A 2XVGA 3UR7A 4GI8A 4KGLA 3WH7A 1GZJA 3WD2A 3IK2A 3CHCA 1UKQA 5DF0A 4HMDA 1C91A 2WVUA 4AMCA 5IFTA 4GO9A 4MDPA 4PMYA 3II1A 2WCAA 3VMOA 3L4XA 5A6BA 3CZ8A 4HZ7A 1C93A 2CBUA 2VZOA 1UWRA 4H2CA 2VURA 4WLCA 3ZIZA 2VX4A 1KXTA 5ABGA 1HKIA 5CLWA 3MV11 4CUCA 1G5AA 4TVCA 1TMQA 1CXKA 5GQBA 5E6ZA 3UETA 3THCA 1ZB5A 3K1DA 1OT2A 1W3HA 1V6VA 1WZAA 3AISA 1CDGA 2TAAA 1PX8A 1US3A 4DUWA 4FLOA 2WM0A 3AIWA 2YKKA 2XUCA 3VIOA 3WBAA 1NQ6A 3IANA 1NWSA 1HIZA 5JIPA 1CTNA 1HJQA 2XVLA 3WNLA 2NSXA 4WIWA 4J28A 4C7GA 2DIEA 1W2PA 3HMCA 2CKSA 3WH9A 1H49A 3VM7A 3IJ7A 4RE2A 5E0FA 1J01A 2WMIB 1JXKA 1RH9A 3WDJA 5D8WA 1WZKA 4XB3A 5BXSA 1JXJA 4W5ZA 1KBKA 2XJ7A 2V3GA 3TA9A 3WMBA 5EFFA 2WWDA 3OZOA 4FMVA 4H8UA 5DEZA 1JG9A 1MQRA 3M46A 3ARXA 2WZIA 2XYLA 5A2AA 3PZIA 4EE9A 1JZ2A 1JZ3A 2ZXAA 3A6OA 5BRPA 2VRQA 1EDGA 1ZBWA 2YA1A 3UR8A 3WF1A 2WBKA 5AC4A 4J3SA 4Q22A 1QVBA 1HJXA 4W5UA 3SCRA 3OB8A 1TVNA 5CGMA 1DEDA 3WQ8A 2D20A 1UH2A 2WW5A 1EHNA 2GDVA 2IXVA 4J3VA 2WXDM 1E6NA 5I24A 6TAAA 3NYDA 1QNOA 4CN6A 1JZ4A 4PMUA 4F9JA 2EPLX 4W89A 2CHOA 5A6MA 3AHYA 1JNDA 4JL2A 3FN9A 3WNMA 1BGGA 1JAEA 3AHZA 1G9HA 2GVYA 1DWJM 5E6YA 5D9PA 4GQRA 4DWSA 1J9YA 1LWJA 4AEEA 1HJSA 4DWSD 1QW8A 3U7BA 4B3KA 1PEZA 5AYIA 4PMZA 3MMDA 2ZX7A 3RJXA 2OSYA 3WY1A 1KCLA 2X2YA 2YA2A 1PAMA 3IJ8A 1CIUA 2DEPA 5LYRA 2BS9A 3VD7A 2PWEA 3EBVA 4ML4A 2W5FA 1UD5A 1M04A 1WO2A 2VX7A 3O2LA 4PSRA 1CLVA 2XPKA 1GVYA 3SCOA 3NDYA 2W62A 3S6TA 3JUGA 1NP2A 3IJ9A 1ODUA 2D0HA 1MVYA 1RP9A 4UQCA 1CLXA 1UR9A 3RMEA 3RPMA 2B31A 2W61A 3ARYA 2IXUA 4XZWA 4D6CA 1JYXA 1OM0A 2D3NA 5CSYA 3VU2A 1ISYA 1B9ZA 4AXNA 1BPLB 2GDUA 2V5DA 5I79A 3WQ5A 3WDIA 4E8CA 3WH6A 4ZENA 1CEOA 1DHKA 2GSJA 1E6SM 2YJQA 4HA4A 4UQBA 3ZQ9A 1C90A 2D0FA 3ARPA 4A3YA 1GOQA 1WDQA 4H8VA 2XWEA 1ISWA 4L4OA 1PX3A 3BAIA 3ZOAA 1OIFA 1JD7A 3GM8A 3AI0A 3ARSA 4HZ8A 4PTVA 1E6ZA 4AZIA 3CUJA 3BAWA 3OBAA 4TX6A 2DT2A 1OINA 4AEFA 1AVAA 4JZ5A 3CMJA 2VVSA 4PCTA 1ECEA 2D0GA 3BAYA 3AS0A 2QV4A 4HMCA 3THDA 4F8XA 2CHNA 3ARTA 3W81A 4ZE4A 1UQYA 4Z2GA 4LYRA 4GI9A 1O6IA 4PMOA 3AHXA 2O9TA 4P7LA 1VF8A 4D6JA 3UERA 3RCNA 3F4VA 1UR2A 3PBGA 4QLLA 3CGTA 1J0ZA 1DWIM 1LF1A 2AAAA 4U33A 4W8LA 2YLAA 3FW6A 3UG3A 1E0VA 1WNOA 5LA1A 5D4YA 2UY3A 3CMGA 4A3HA 3VD5A 3RILA 2CIPA 3BCFA 1KXVA 2J7BA 4MB3A 3F5LA 2WMHA 2XHYA 3RM8A 1UZ4A 3NSNA 3E1F1 1H11A 4WF7A 5JBDA 1B3ZA 1JI1A 2WC7A 2WPGA 1H3GA 1FFRA 1JDAA 4PMQA 1I1WA 1VB9A 1NOWA 3AS3A 2E8YA 1KWGA 2CNCA 1VAHA 1U30A 1JF6A 2A3BA 2V3EA 3APGA 4U2YA 5A8OA 3W29A 2FGLA 2WMIA 2W92A 5LA0A 2J62A 3VDCA 4HU8A 1HVXA 3SUSA 2DPEA 1KR0A 3PZNA 3K8KA 1J0HA 1U33A 1KXQA 4AZ7A 2BHZA 3MSDA 3KEHA 4JHOA 1I1XA 4W86A 4OZOA 4AZ5A 2X0HA 1XCXA 3SCSA 3W25A 3WL0A 1M53A 1E56A 1A3HA 2EPKX 3UG5A 2XFRA 1LQ0A 1DWGM 2FH6A 4OUEA 1E6RA 2BHUA 3VGHA 1C3FA 3AS2A 4M81A 4ATDA 8CGTA 1XC6A 3W0KA 1WCGA 4A4AA 5C71A 4PUEA 1E5NA 4MDOA 1BGAA 1E5JA 4GQQA 2WC3A 3QOKA 3GNOA 3WH5A 2J7HA 3QOMA 1E6XM 3QHMA 3TTSA 4B9ZA 2ZOXA 3PTKA 2Z1KA 2PWHA 2RGLA 5A8MA 2J25A 1E3ZA 1GHSA 3GXMA 4X0NA 1QOXA 1TUXA 4PMDA 5AY7A 3RO8A 3HN3A 2WMKA 2VR4A 1WZMA 1UWIA 4ZE5A 1XD1A 2VL4A 5TD4A 1W9VA 2GJRA 3K4AA 1E55A 1HT6A 4QLKA 5KEZA 2X8RA 3AMLA 2WKGA 1FH7A 3VILA 1M01A 1W3LA 4DWSC 3M6DA 4P8WA 3AXIA 1C8YA 2WZEA 4U5IA 3IAPA 1MQPA 1PBGA 4CD7A 1EO7A 1D2KA 4GI6A 1GNXA 2BXZA 1VIWA 3WFLA 2QLYA 4W88A 2Y8KA 3AYRA 4ACZB 1PIGA 1TA3B 3T0AA 1GJUA 4HOWA 1V6XA 4D6GA 1HL9A 5ABEA 1GQIA 1YQ2A 2VUYA 5BXRA 1E15A 1FH8A 2GFTA 2J74A 1J18A 1UA7A 1H1NA 2WAGA 4MNLA 3AFBA 1ZL1A 2YLLA 4BZYA 1ISXA 3ARQA 1EHAA 3AICA 4UQDA 1X6NA 1JI2A 1DWHM 3CZGA 2G4FA 1EH9A 1LLOA 4JKMA 1EXPA 1NARA 1GQLA 4PSPA 2BY2A 1PZ3A 5BXTA 1QHOA 2V38A 1W3JA 2Q8XA 1LG1A 3WMCA 3DYMA 1B30A 1BSIA 4HMEA 3D5HA 4W85A 1C7SA 1XGZA 3F5KA 4QFUA 3L4VA 1UR8A 3BC9A 2VNCA 1IZJA 3BGAA 4FK9A 2DT3A 5CZKA 1J11A 1E4NA 2ZXDA 2VZUA 4CCCA 1BQCA 3BSHA 2VCBA 3BAJA 1HL8A 4M24A 2NT1A 1JGIA 3AHTA 4H41A 1HJWA 2J7DA 4M29A 3KL0A 1KBBA 1FA2A 3ZR6A 1HN1A 3POHA 4AYSA 2ZWYA 2VT0A 3ZT5A 4AD3A 1SYTA 4BQ4A 3AQUA 1QI0A 4JFTA 1EIBA 1BYAA 5CPSA 1W1VA 3WUBA 1Q4NX 4ZXOA 1CPUA 2WLYA 4CN4A 2CKRA 1LWHA 2EQDA 2GJXB 1WKYA 2YDSA 4GXPA 2DH3A 1HX0A 1K6AA 4QP0A 3OGSA 3MKKA 4BQ3A 4PMXA 2GK1B 3I3EA 2Y5EA 1CECA 1W32A 4CU7A 4P8VA 2Y2WA 1U2YA 2F61A 5I2UA 2QMKA 2G41A 1X6LA 2C0HA 2ZUMA 3W38A 5CSUA 4UTFA 5HDRA 5A6BD 4CCDA 4URIA 3VMPA 6A3HA 1W1TA 2YDQA 3VUPA 4YHGA 2UY4A 4UOJA 2ZWZA 3O6AA 3VNZA 1RP8A 5IHSA 5CPQA 4JFWA 2ZIDA 4P8UA 4UFJA 1H09A 3AYSA 3WQVA 1UH4A 1Q6EA 4H8HA 1MXGA 3L4YA 1C7TA 2GJPA 5C70A 5A8QA 3GNRA 4Z2KA 1UR4A 3ZT7A 2W67A 1H41A 3AMCA 5DFAA 1BG4A 2JEPA 2PWGA 1LG2A 2WB5A 1E70M 3U5UA 3VKKA 5IXEA 5FD0A 5JIWA 3T08A 2E40A 2OYLA 1W9XA 2E9LA
chains in the Genus database with same CATH superfamily
2PDKA 5AYBA 4HU3A 3PZUA 5BYWA 4ZB5A 2FKPA 3UEQA 1KFLA 2Y7DA 1XBVA 4ZXLA 4KIEA 4WSJA 2OODA 5ABTA 5DMLA 1H7RA 1KFEA 1F2JA 1R6WA 4DUXA 1K8ZA 1LQAA 3GTXA 2OEKA 4QJ1A 1L6WA 1MQQA 4MY9A 4M7TA 1V3HA 1C8XA 7ENLA 2VDHA 3B06A 1UUMA 3F03K 1H0GA 3TTYA 3LG3A 1AG1O 3INPA 4QG8A 4OQVA 1SU5A 3AUOA 1HP5A 2QCNA 3BZJA 3GFXA 3LGGA 4PUDA 2VD8A 1QI5A 3L4UA 2V2HA 3QY7A 1UUQA 2V3FA 3L2LA 4R27A 1DIDA 5D05A 3UPBA 1WE5A 2ZQ0A 1LCOA 5D2TA 4HYWA 2YBTA 1N82A 5BNKA 1O1HA 1DWAM 1V3JA 2FB3A 3QH2A 3CK5A 2V68A 1IT0A 1JFXA 1A5AA 3EDEA 4HPGA 1TA3A 3WNPA 4W93A 2QW5A 4Q4RA 4GQBA 1VS1A 4GPNA 1GOXA 3NOYA 3Q94A 4PUUA 4UFKA 5E9XA 2YIHA 1NAL1 4JX4A 2E5BA 1QRQA 2ZE3A 2GVGA 3ATYA 4UFLA 3OQ8A 3H6OA 2PWUA 1TE1A 1HKMA 1O7AA 3SEPA 4LH8A 4Q8PA 1QMLA 5DX7A 5FEPA 4CCEA 2ISVA 3EB2A 3TMLA 2VQUA 3LV5A 4OOZA 2ZC1A 2IQTA 1EZWA 2VEFA 5B7YA 4JKLA 3M7SA 1H61A 2NWRA 5F1UA 4CU6A 5LNRA 3LGEA 4AB4A 3O0KA 5D2WA 2I1OA 3LPFA 4KS0A 1XYCA 3DN5A 2OYMA 1NM9A 4J3ZA 4DXXA 1J6PA 1MRAA 4JBRA 3TONA 4FSAA 2IMRA 4DNHA 2O9RA 4KH2A 5FL0A 3GDBA 1AJ0A 4FO4A 3GXDA 2Z2AA 4IMDA 1D7FA 3VX0A 2DJLA 3OLEA 3U4AA 3UZYA 1U1UA 4TVDA 3BG9A 2WZHA 1KFKA 4MNKA 3QBUA 1BTCA 3PR2A 4Z17A 3N9KA 3SCNA 3W53A 2WSYA 5LHEA 2FGZA 2DZVA 1VENA 4L9YA 2V3DA 3AROA 1YE4A 3O8AA 5E0KA 4QAIA 3MVTA 3LCLA 3M43A 3I7SA 4XIMA 3KCLA 4WXZA 4CVUA 1BEUA 3KOXA 2E6AA 2EPOA 3RUBL 1MW0A 1OABA 5C0QA 4XVEA 1FWGC 2ZXBA 3TTQA 2PMQA 3RG6A 5JXQA 1TKKA 5G4HC 3U7VA 1R2RA 3IEBA 3K2GA 5E09A 2PB1A 1WKEA 2WYSA 2PDJA 3NM1A 1OB0A 3CUZA 5D09A 3S2LA 4HYRA 3VNYA 4GJ1A 2GGIA 3UBPC 2OT1A 4X22A 2ACQA 1XUZA 2Y88A 4AIEA 2OWCA 2ISSA 1MW3A 3C0LA 2FFIA 4Q7IA 4NAEB 5BCAA 3N3MA 4L4PA 4JTTA 3M41A 2BVTA 3QFWA 3KE0A 4WOQA 2W66A 4UTMA 2W4XA 2A0NA 3P81A 3N73A 3SGGA 1XGDA 2I5QA 4GFIA 4JEQA 3BANA 4AU0A 4UWMA 5A1AA 3B8WA 3WK0A 4IL2A 3UVAA 1XIEA 4Q8UA 1QI3A 4FOJA 1Z42A 4AIOA 2O7QA 1C92A 3HPAA 1VYRA 4X0VA 1CNVA 1H7PA 3I10A 3VD4A 5LIKX 4WVXA 2WZTA 3WNKA 5AC7A 5J5RA 2R82A 3RR4A 2XM1A 1PX4A 4E3VA 5FOOA 1RJQA 4QJ4B 4KWWA 5A6TC 3LSCA 4K36A 1GW1A 5EMLA 3G2GA 3NQFA 2HMCA 4LAZA 1AQFA 5A5WA 1Q7MA 3S8HA 1SJCA 1AW1A 1P6BA 2Z1BA 1TMHA 4WX2A 1FHVA 3LPOA 1UWSA 3FVMA 3GNPA 4Z2JA 2YBVA 4F0SA 4UOQA 3QV7A 1ICSA 2C18A 4W84A 4GZ7A 3FYYA 3MO4A 4G8TA 3WQGA 4KBXA 1JJKA 4KQNA 3AOFA 4CQDA 3TJLA 5FF3A 4IMFA 1MNSA 1W17A 1MEIA 4H3DA 3LMYA 2PF0A 4A8RA 3GBDA 5E1QA 2Z6JA 4CLMA 1NQKA 2POTA 1C8QA 4PL2A 1ZGDA 2HTMA 4DUVA 3WIJA 1E43A 3KLLA 5EYWA 1NOUA 4G1KA 4XBJA 4S2BA 1VFUA 4S3KA 1GZ1A 4N0RA 4UNKA 3N04A 3VIIA 2J78A 3KVKA 1BWVA 2DVUA 2FPTA 2QF8A 3OLGA 3EA2A 4NVTA 2I5GA 4KWVA 5HNRA 2PZ0A 2V5BA 4WKAA 1XHGA 3UR2A 2OPJA 3GR7A 3MZ2A 3R0DA 1A5KC 2XFYA 3VYLA 1CB7B 1XBXA 5F4XA 3EWYA 2HPMA 1HF6A 1TWZA 1F3EA 3V3WA 2HK1A 1OX6A 3BXWA 3D47A 3WQ4A 2ZRUA 4V1XA 4N7QA 1CGTA 1SFLA 3CL8A 1YYAA 3CJPA 5SWUA 1MRQA 4MZYA 3O07A 2QDDA 1KM6A 1X8CA 3OLIA 4D8LA 3PNZA 1YTEA 4WKFA 3EWBX 1U5VA 2HE8A 2G3NA 3MKCA 3GHUA 1ZBKA 2CFFA 4H4IA 1UMYA 1FP8A 1H0IA 1K7XA 2YPIA 5AFDA 2YCJA 3FYOA 3KWSA 3M64A 3WBEA 1D8WA 1N55A 4NNBA 2QHAA 3TFXA 3S1UA 4LRSA 3FHAA 3COTA 5EMJA 3L68A 4DO5A 2EG8A 3CTTA 3PZOA 4WDUA 4L7ZA 4OBRA 1OFOA 2ZUUA 1XLDA 2I56A 3VOFA 2WVVA 2NVDA 1UKPA 2DSVA 3BLFA 3IUIA 4Y6GA 3H12A 3R43A 5KSWA 3QY8A 1UWTA 3H2OA 4RDYA 4K37A 3RCMA 3AZRA 1OCQA 3CV6A 1JYWA 5XIMA 3LSBA 4GUHA 1J96A 4HP5A 3B9AA 2BNJA 3MJMA 1RQHA 3FLUA 3W7DA 3R8GA 2CLOA 5CLTA 2W0UA 3BH4A 1CGWA 3EWDA 4EPKA 4PMRA 1R7OA 3LHUA 4Q33A 2Y8UA 3VNMA 2VHLA 1ZP4A 4RV8A 1N8WA 2INEA 3H2EA 1OX5A 1EA9C 4LUSA 2F7FA 2WKLA 1TTIA 3CL6A 1EJRC 5HNNA 1JVNA 3AU6A 2OR2A 1KRCC 3NSMA 1JAKA 3TNOA 2EPMX 4AWSA 1G4SA 3KZSA 4LTSA 4W8BA 3SRHA 3NQ7A 3ZLHA 1O60A 1GG0A 2VFEA 3R4IA 1KTNA 1I8JA 2X1RA 4NZCA 3FAWA 3W3OA 3I6TA 3PTMA 1K8XA 1R9ZA 1W1ZA 2ODOA 4JN7A 4ILSA 4RL3A 3OTRA 1U1JA 4BFAA 2ZUVA 3C0SA 1ONEA 1V5XA 1VRXA 1OFDA 4P7RA 1JGMA 4KIRA 4MAZA 5EGRA 2KX9A 2V9DA 3CV1A 1G67A 3S4TA 3HIJA 5I00A 3CPRA 3VOJA 4IISA 4GLEA 4A29A 4LUTB 1YNQA 1LBFA 4E3TA 2Q09A 3N6HA 4M1RA 4V27A 1RLCL 4U5KA 4GY1A 1VHNA 1QW7A 4XD3A 3TTEA 1XPYA 4B9YA 3WF3A 1AW2A 1QNVA 2YFNA 5E93A 1SW7A 1I2OA 4G56A 5IDIA 5A8NA 4OKDA 1DTUA 2A3CA 4JN6A 4JNMA 4YWSA 3TKFA 1BRLA 3ZS4A 1FX6A 2HS8A 4RNJA 4FF7A 1Q4WA 2YCLB 5D2VA 1BF2A 3RK8A 2O56A 1E0UA 4IZGA 2D24A 4UXDA 5HR7A 2Q8ZA 1REQA 3NXFA 1AA1B 2ZZ3A 4DEFA 3IGUA 3LTPA 3UA3A 2OSXA 4LPCA 2J75A 2HXUA 2JGYA 4O17A 5AHEA 5KZEA 2F9RA 4Q8NA 1L8NA 4IL0A 4LV4A 5CPOA 1UKTA 1CB2A 1G4EA 4AX6A 3CQHA 4DBSA 5HR6A 5CH9A 1W9BM 2PPGA 3ZWTA 1S39A 3T2OA 1UWUA 2RHGA 5D32A 4ROQA 3NDOA 3LUTA 5LGXA 2H9AB 4U31A 4TTUA 3CTLA 3S9IA 4UR8A 2X41A 4DYEA 3ICJA 5DCBA 3VD3A 2G95A 3CB8A 3PTDA 3SY5A 4FA3A 2DVTA 4LGXA 4O16A 2IPWA 3UJFA 3KZPA 3VZZA 5HOSA 5XINA 2C3ZA 3JZUA 3UWQA 3IRSA 1UA3A 1TZ7A 3REQB 1R3YA 3QMRA 5H91A 2B7QA 1VFLA 2NXGA 3WLHA 3B97A 2FMNA 2FHBA 2Z1WA 2BOFX 1CZ1A 3DFYA 3FGCB 2C6QA 1PE1A 1EOMA 1PKLA 4UZUA 3MC5A 4DIAA 1EF2A 1CW2A 3I65A 2A6LA 1JCJA 2PDWA 4V33A 4S23A 1RBOB 3CO8A 4GUFA 4EF9A 2MANA 4NX5A 3K46A 1WXJA 3KP1A 3L65A 1TVLA 4F48A 3WEOA 3DYOA 3W07A 1E0WA 1J0KA 5G2HA 5I3GA 1QCWA 2QPXA 3M07A 1QW9A 3BV4A 4XD5A 4C60A 1E9ZB 3FXYA 4CNTA 1XLIA 1K9TA 4D6FA 1ECQA 1J0JA 3GBEA 2WJEA 1ZAJA 4GINA 1UOKA 2NV2A 2J9XA 2FVLA 4NSBA 4MZ8A 1UP3A 2CYGA 5D8ZA 2A7NA 4YYCA 3S42A 2OKOA 5RUBA 2V0TA 3EEZA 1XV8A 3AIQA 3BARA 1CGVA 2XH7A 3CAQA 3G18A 2AKZA 4KEMA 2NQJA 6ALDA 3R1ZA 4ZVJA 2J7FA 4H01A 1MUWA 1KCXA 1L2UA 1DYSA 2GSEA 4EPEC 2WMGA 4EF8A 4GXWA 2ISDA 1UW9A 2I7GA 3PHAA 5DMMA 3WNOA 5CC7A 1XG3A 4H6EA 1V8EA 5CPNA 4I5UA 3GIYA 3FCPA 1KFCA 1H5VA 3KOFA 1I2RA 1V02E 4LUSB 3EB4A 3P8IA 2ZZ1A 1QNSA 1US2A 2FZMA 3GVRA 4TMBA 4HNTA 4YCOA 1TWSA 1VD6A 1WP6A 4CD8A 2WC4A 1OSEA 2J7EA 1P6CA 1KFWA 4R33A 1UC5A 4US6A 4Z1DA 4UCFA 3ITOA 3W02A 1CLKA 2BY0A 1XFCA 5I09A 5CKSA 3H7UA 4XAPA 1IE7C 4YTQA 3CU2A 5K2ZA 4O0KA 4LCSA 1JL8A 4H04A 3LPPA 2NV1A 1WYIA 3EDDA 1ZJIA 2CU0A 3GXNA 1PWLA 3N4EA 1XIIA 4A2SA 3T2QA 3PANA 3CLMA 1A5NC 5I78A 2VR2A 3CHEA 1PZ1A 3AS1A 2QYGA 3CYJA 1OYBA 4UTLA 4U4MA 1Q6OA 5I5RA 1V02A 3R5EA 5C8BB 1LJYA 3FJ6A 4Z42C 4Q7BA 2JALA 2YXGA 2RGMA 1SJDA 4GE8A 4LQ1A 1ZBCA 2UWFA 1TZ9A 2VXNA 2WK2A 2CZ5A 1VC4A 1A0DA 2HDJA 4MLJA 1RCOB 4MHBA 3DECA 1ITCA 5IDZA 4H9MA 4ZO6A 2NX1A 2YW4A 1P0DA 1CXHA 3QJAA 2Y62A 3A23A 1OC6A 3B0VC 3CUXA 1GONA 2Z1SA 2DQXA 1V3KA 2DH2A 3G1XA 2CZEA 2D2JA 4L4MA 2D73A 3B8DA 2NX9A 5K9CA 1JDDA 4XAZA 1V93A 1PKYA 3VFLA 4JQ1A 1ZFJA 4HBKA 4L6OA 1TV8A 5LKYA 4HHHA 3WH8A 3RHGA 3UA4A 3VMNA 1KM0A 5CG0A 3W1LA 4AFYA 2NT0A 3E6EA 9RUBA 2DZPA 4XSLA 1KGUA 4MJ4A 3VIPA 3KBWA 4W4QA 3TXZA 2DVXA 3CHFA 4GY0A 3R58A 2AGTA 1A5MC 4RW5A 2J7GA 4KRUA 1XXXA 1R87A 3SCQA 3TCEA 4RE4A 2WKJA 4RNFA 2IPFA 4QGCA 5DBUA 3T0BA 3BMVA 6ENLA 3FNDA 3LBCA 3WCZA 3BAKA 4JAWA 3WLRA 4Y90A 4I5XA 2IS7A 1LRTA 4Z1BA 2J47A 1DIEA 3QPEA 1H7XA 2ZZ4A 1Q6DA 4K2SA 5LXEA 4LVBA 3CLWA 1XGEA 3WF2A 4O52A 1Q7ZA 4C6JA 3S1VA 3ZMRA 2E7FA 3P62A 4ZR8A 1CI1A 2D22A 2YGYA 5AECA 3TSBA 1VBUA 2J79A 3LRKA 1DJIA 1ESWA 2OO6A 4ML9A 3N2BA 2DT0A 3O6YX 3UG8A 3KXQA 2PDYA 2PDHA 4WZHA 1B0IA 2YL9A 2XVGA 3DFTA 3BLOA 5FJJA 2ZYFA 3QMTA 1G7VA 3W7QA 2OLSA 3FJ4A 1PUDA 3R6IA 2PTWA 4XAGA 2WVUA 4ZBCA 4C1LA 4G1NA 2CHRA 2WCAA 3L4XA 4HZ7A 2Y89A 3RLUA 3ENLA 4PC8A 1LRQA 3W00A 4DAIA 2VX4A 4Z1AA 2EJAA 1QU4A 5GQBA 1CXKA 2YB1A 2G37A 1BD0A 2DJXA 1ZB5A 4C6BA 4OV9A 1IIGA 1YDNA 1ZP3A 4DUWA 3M0YA 4J4KA 4WDTA 2WM0A 3IANA 1NWSA 3HG4A 4HPJA 4O0ZA 1R30A 1A4MA 4WIWA 1MZRA 4CNUA 4C7GA 2DIEA 3FV9A 1N2VA 5DCDA 3TYDA 2CKSA 3WH9A 3A12A 4O1DA 3VM7A 3IJ7A 3BLLA 5FJIA 1TPUA 3VCRA 2DY3A 4RE2A 1J01A 3DEQA 1D7KA 1QPQA 1VJIA 1WZKA 1H50A 1JXJA 4XBSA 3ZR4A 1RHCA 4XISA 3B8UA 4Q4MA 3KFTA 4L6DA 5EFFA 1K70A 1AL7A 4ZL1A 1TPB1 2FJUB 4H8UA 2V5LA 2I9UA 2WZIA 2XYLA 5A2AA 2PLJA 4EE9A 4LSBA 3A6OA 2A7PA 1ONXA 1EDGA 2YA1A 1DJZA 3PB0A 4J3SA 1T99A 5G1YA 3W76A 1TVNA 2YCIX 1DEDA 1W5PA 1FQ0A 4JTUA 3TXVA 3TYAA 3WQ8A 4JDBA 1C8VA 4LUYA 4GYPC 1A5OC 2QCDB 6TAAA 5G4EA 4CN6A 1F6KA 3V5CA 4JIPA 1M6JA 2QJNA 3BQ6A 3RX4A 1OF6A 3EZ4A 1BGGA 1R3VA 4JY8A 2BP1A 1VPQA 1EX5A 2GVYA 1NTHA 1QPRA 4GQRA 4DWSA 2PF8A 1NF7A 3C8FA 4AEEA 2E1WA 4J5NA 2F6UA 3U7BA 4B3KA 3R13A 4PMZA 3BCJA 2EF9A 4RDVA 5G2WA 4U28A 2EGZA 2ZX7A 3KTCA 2OSYA 1DJNA 3N14A 3IVTA 1TV7A 4O1FA 4IJBA 2P88A 1ME7A 5LYRA 4LBUA 3VD7A 3EBVA 2PDUA 2W5FA 1UD5A 4FOUA 4QQUA 1M04A 3ZZ1A 1F9CA 3HQOA 1WO2A 2PLCA 3CAVA 3O2LA 4PSRA 3W2UA 1QDSA 5FI8A 4NHVA 3WLTA 1GVYA 1DV7A 1P0BA 2W62A 3JUGA 4LRTA 3IJIA 1ODUA 4AIBA 1MVYA 4X2RA 3SQSA 1RP9A 4JTSA 1JCNA 1JDEA 2B31A 2W61A 3N2CA 2BG5A 1OM0A 4QDWA 4XAFA 1YIXA 1CCWB 3EOUA 4LAMA 4CNPA 3WDIA 3WH6A 1WXYA 4GVGA 4L1XA 3FA4A 4RCXA 3ANUA 3HGOA 2OZ8A 2PE4A 1XLJA 1C90A 4HNNA 1O4UA 1VBGA 2XWEA 5AHMA 3W87A 3W74A 2UZ9A 5C9UA 4DXVA 3WG6A 1HGWA 1ZRQA 2VWSA 3BAIA 4DPQA 1OIFA 2ZTJA 1ADDA 2GLKA 3RRAA 1VFSA 4XWUA 3AI0A 4O15A 4FI4A 4FP1A 3WQFA 1E6ZA 3E02A 3G1HA 3CV7A 3HURA 1EJUC 4TX6A 2DT2A 3ZVHA 4ZFCA 2X1UA 2YXOA 3EB3A 1TTQA 3AO0A 3LZ3A 2R91A 1O6IA 5CCZA 1VF8A 4B90A 1D9EA 3RCNA 2CZDA 3RXZA 3LHTA 2X7WA 3PBGA 2CLKA 4QLLA 1F74A 1LF1A 4U33A 3LLFA 4JTLA 3CMGA 4A3HA 1K7FA 3BCFA 4O1BA 2OQHA 3E1F1 1H11A 3LBMA 3NQAA 3DFPA 1B3ZA 1XYAA 1LUCB 3LCXA 2G5WA 3UXDA 1MI3A 2WPGA 1H3GA 2J24A 1VB9A 1LDCA 3NL3A 1F05A 4GWEA 1QXLA 5LNUA 1JF6A 4NZ3A 3W29A 2E1DA 4I8DA 4O13A 3GQYA 2P3EA 3PB2A 5LA0A 4M6VA 2QUVA 2PDLA 2DPEA 2YYTA 2JKEA 1J0HA 1KXQA 1DJGA 3NQ6A 1R46A 3S0CA 3MSDA 3KEHA 3I7QA 3K1GA 1VPYA 4YNGA 3DFOA 2QEZA 2X0HA 3SCSA 1H60A 3WL0A 2IKGA 2EPKX 1WA3A 2XFRA 1VR6A 2WJDA 4C6EA 3G1VA 1E6RA 2BHUA 1Q85A 1C3FA 4M81A 4LALA 3CQ0A 3L7RA 4IHCA 1UBSA 1BGAA 3GUGA 3F2CA 1Z3NA 2BGQA 3U2EA 3ZXWA 1I4NA 1E6XM 2XH0A 1NU5A 2Z1KA 2ZA2A 3V1HA 2VDGA 1IWBA 1ITUA 2AL1A 2FZBA 1MSSA 1S2WA 5A8MA 3S5OA 5EMMA 4EP8C 1GHSA 4QS6A 1KTCA 4GUGA 4NYUA 1OVDA 1TV4A 2VR4A 3NURA 4ZE5A 1XD1A 3JS3A 3T8LA 3MT1A 5TD4A 3Q4DA 3K4AA 3LY0A 1E55A 1HT6A 4QLKA 3MP4A 1NELA 1FH7A 3M6DA 1JULA 3AXIA 3ABSA 4U5IA 4A3QA 2AL2B 4CD7A 3LDVA 2CWNA 3P67A 4JS3A 3ITVA 3WLNA 4FX8A 2A3LA 3AYRA 1F6PA 2PGEA 1WDWA 4D6GA 1NDYA 1YQ2A 3IWPA 2NUYA 3O6CA 4RNHA 1E15A 1XW8A 2J6XA 4JTIA 3N6QA 1H1NA 4O8RA 2WAGA 1S5MA 3DHDA 3R2GA 4MNLA 2YLLA 3DFSA 4PCPA 4DYKA 1EHAA 1JI2A 1T0OA 1EXPA 2V63A 4PSPA 3CPGA 2BY2A 3WQDA 3R94A 5BXTA 2V38A 2Q8XA 4LEQA 3EXSA 1KD0A 3WMCA 2DFAA 3DYMA 1LLWA 4AXKA 3F5KA 3MSYA 4WY0F 4HVXA 1OZMA 3OVQA 3PFRA 5DBTA 4MFEA 3BGAA 5M2FX 1GVFA 1GEQA 5CZKA 3MI6A 2WNNA 2ZXDA 4QIUA 4H6RA 3M44A 4M24A 2CZFA 3SY8A 1HJWA 2J7DA 3WJSA 4B3ZA 1FCBA 4UBPC 1B9BA 3S47A 5CZJA 3ZT5A 4AD3A 1SYTA 4BQ4A 4RZ5A 5CEWA 4DJED 4C1NB 4F2BA 5CPSA 3WUBA 3HPXA 1Q2RA 3NQBA 2TPSA 4YTRA 5I03A 2CKRA 1EJ7L 1ITQA 2BLEA 2QIIA 3W73A 3WBWA 3PBVA 4NJJA 1RCQA 4QE1A 2YDSA 1X96A 2DH3A 4YCPA 2REQA 3E38A 4DRSA 2QUUA 1RVKA 1J8VA 2Y2WA 3S2JA 3M0KA 2C0HA 2QDGA 3N29A 4WY0B 3WLMA 1FWTA 4URIA 4S3DA 6A3HA 2YDQA 1SVDA 4MUZA 3G1YA 4YHGA 4UOJA 3VNZA 5IHSA 1HKWA 4YLWA 4E6MA 3PUOA 3AYSA 4KFNA 1POKA 3IIOA 3TW7A 3KBJA 3L4YA 4O28A 2YSWA 3A64A 3SGZA 1UR4A 3U8GA 1FBAA 4O1CA 4HN8A 3AMCA 1BG4A 2NQHA 1WAUA 4FOKA 2R8WA 1DJWA 1OFQA 2VC5A 2VP8A 1E0TA 3H21A 4NZFA 1LWIA 5BU6A 1TR9A 4M19A 1XIDA 1BYCA 3BW3A 3M0JA 5L9FA 2GGJA 1B5TA 1UIOA 2BVYA 2W63A 3A3HA 2GVJA 4HOZA 2YB4A 4NIRA 3V7PA 3GUWA 3UG4A 4FIRA 2QJJA 4Q7NA 3L9CA 3TU9A 1GOOA 2WVTA 9CGTA 4WSKA 1B57A 2ZTKA 2ATMA 4R53A 5FJPA 1JIBA 2ESCA 5FKYA 3ARWA 5BOEA 2D3LA 1TJPA 1OCJA 3A3WA 3QGAC 3W1MA 4O57A 1B3YA 4D8AA 2OWWA 4B5SA 5CBIA 4AHOA 2AMXA 5BRQA 3G22A 2PP0A 1OT1A 2D1ZA 3QLLA 1MEHA 3QGVA 2WVSA 3OYXA 1NFBA 3UCQA 1E51A 5E70A 2BV9A 3ARRA 1JUEA 3VIKA 4WK9A 1H2JA 1V51A 1TIMA 1VPXA 4IFOA 7REQB 3VK5A 1UZDA 4ZQCA 3W2MA 4CVWA 1VFFA 5JVLA 3L2IA 3GR4A 3WQCA 4DJFC 1TWDA 3KBVA 4CN1A 5AZ1A 2Z1VA 2OJPA 2X0YA 5AOUA 1FWBC 4DBUA 4NQ1A 1PDYA 2VCCA 4D6DA 1I45A 1WPCA 1NP0A 4B3LA 3EPNA 3GIQA 3IK4A 5T9CE 3NO1A 3L67A 4JFVA 4GHRA 4O1AA 2XVNA 5CPTA 1FVPA 4FR6A 1G1YA 2ZZ6A 2QZRA 2XH2A 2X2GA 3CH9A 5F2GA 4FB7A 4CEUC 2QCGA 3PS7A 3SSZA 1FWJC 3VKAA 3IGSA 5FEWA 1QOQA 2WHLA 2GJLA 3DI0A 3PZGA 5BOFA 5KMYA 5LNWA 4KRZA 4W8AA 3NZPA 2BY1A 1TR1A 1AH0A 4US5D 4W87A 2I16A 3UT0A 3UXLA 4A8IA 3R8HA 3VE7A 5LIYX 2QNEA 4WKHA 2X09A 3WQ6A 4IPIA 2XSAA 3P2VA 3RMJA 3G1SA 2PBOA 3VOIA 1XRSA 4ECLA 3GFYA 3AIBA 1QAPA 2JBMA 4NZ4A 3QYSA 2XIOA 3TEVA 4DJDD 1SO3A 3QMSA 1E1FA 4G5DA 2GJXA 1HZYA 1KLZA 1T96A 3QF0A 4KWOA 1T40A 4AZGA 4R7WA 5C2XA 2HWGA 3B04A 4AD1A 5DT7A 2E9BA 3NAVA 5AYYA 4HZ6A 3W37A 3FY1A 3SI9A 1FHDA 4MVAA 2GUYA 2VR5A 2XSBA 3AIUA 1AQMA 2OGJA 4ATLA 1NIUA 2YW3A 4I6KA 4L1WA 4CD5A 1F3WA 1IQ8A 4L64A 3U2OA 5C7VA 4MJ2A 3GG1A 4OWGA 3EMQA 1SR9A 2C13A 4M5PA 5D33A 3NL5A 3A21A 3HFYA 3W85A 3VOCA 3G6MA 4PB3A 4PTWA 1OADA 3MWAA 1ZAIA 4ATWA 3AMGA 4D1JA 3W83A 1W9PA 2QT3A 3C2OA 1DVJA 3WN6A 1A5UA 1Y7VA 4A22A 1TV2A 4RV3A 3FDGA 4Y8FA 3VGFA 4F66A 4MPKA 3SURA 3QHOA 1CXIA 4O14A 1JQXA 5EBAA 1QK0A 4I8YA 5F4WA 3XIMA 4Z2LA 3N19B 4IIHA 3GWQA 3M16A 3M7WA 4A3RA 4ZSUA 1XSJA 1VEMA 2MUCA 3QPZA 3T81A 2NW0A 4RPPA 1XUUA 1PKMA 2LLEA 1A5SA 4NX0A 3B3DA 3AXHA 4M6QA 4D6HA 3POCA 5TIMA 1NWUA 4EK7A 4HK6A 3VABA 2ZZ7A 3QR1A 4C7DA 3LPGA 4U3AA 4FALA 4RLIA 1WBHA 1TVPA 3OIHA 4I5RA 1GVIA 3F4CA 1XL9A 5GNZA 4JPGA 2ZVRA 3MO7A 4PUKA 4CD6A 4M1BA 1E4MM 2NX3A 2TRSA 3FSTA 2Y8VA 4LC8A 3NQ8A 3K4WA 5REQB 5EL1A 2DZUA 1ALDA 3KM8A 2WNQA 2D69A 3ID7A 3GSMA 3PY2A 1M7XA 5FIPA 4BJHA 4KRTA 4M80A 4WD0A 1W5QA 3SFKA 4ZQRA 1J10A 1A0EA 3MI2A 1QPOA 3MSRA 3MUAA 4Y9NA 4ORMA 4O4WA 3GXTA 2PTZA 1W3KA 3TAKA 2HVOA 4GYPA 4YYFA 1KRBC 2EKGA 4A05A 3NL6A 3M0ZA 2DZWA 1K7EA 1UR0A 1L9WA 1L6YA 5J04A 1P1XA 3O63A 1R2TA 5LSMA 2GYIA 4S39A 1RBAA 4YMZA 4GZEA 2P8BA 3WLQA 3ALFA 4W7WA 6REQA 2ACUA 3UR5A 1UASA 4LAKA 4B92A 1DP0A 1HG3A 1D3HA 4MPQA 3WENA 3NQMA 4GX9A 4D72A 3TN6A 1UD4A 3UZ5A 3ME3A 1EDTA 1GT8A 1V6WA 3MBDA 1PJ9A 1B31A 1W1PA 2VI0A 3W1UA 3OHMB 4LVDA 2YL8A 1ZBVA 3U9IA 5HINA 1W5OA 3KLKA 4AEOA 6XIAA 1W5MA 5CQ1A 1UD8A 4E8GA 4B4HA 5HQEA 4CKQA 2NWSA 1AH4A 4H9XA 5MKGB 2CBVA 1KGXA 1YADA 4PMNA 2VM8A 3HQNA 4K1WA 1M65A 3NIYA 2Y0FA 3NM3A 4QLJA 5I06A 1TRDA 1OQFA 3UU0A 4LS1A 3W88A 1NOFA 3VNIA 3W7NA 3SCUA 2QUTA 2VTFA 3KWXA 2P1FA 3BV7A 3VGEA 1RK6A 3SADA 1QNQA 1QATA 2DP3A 2ZUSA 2FH8A 4G7EA 1A53A 4O53A 4AG0A 1M3UA 3GU9A 3AIRA 2Q3OA 4ZOCA 2J77A 4B2DA 3IS4A 1KBJA 2WOQA 3VIFA 3IIZA 3FOKA 4Q4PA 4K3ZA 5KTLA 3TWAA 1VIZA 3TQVA 2ZX6A 5C55A 4GX8A 4DPPA 2ZDSA 3TWBA 1QI4A 3U6WA 8XIAA 3T0DA 3A24A 5FEZA 3HA1A 4S2CA 4XO7A 1SO4A 5AKQA 3WKZA 2NQZA 4O18A 4ZCWA 2P53A 4QRNA 1W3IA 5F2LA 3L0KA 1MZHA 2J7CA 4JX6A 4OGZA 1HNYA 2FDSA 1RBLA 1TWWA 1J12A 1CT5A 2NV9A 4LCRA 3CO4A 3YPIA 4GYJA 4J40A 2YCKX 3SCPA 3AU2A 7ODCA 5LNSA 4RE3A 4FAMA 1S2VA 3KOZA 2OX4A 2NQ9A 2DSZA 3GVWA 1JQVA 1V6YA 2H8XA 4JQAA 3EOSA 2R94A 3D3AA 2OYKA 3W70A 3A47A 1TYGA 3P60A 1LROA 3GY1A 5A95A 3MHUA 3WDRA 5G2IA 3W4RA 1P0NA 1DTNA 1UPMB 2XSXA 5A94A 2XIJA 2WJZA 2NXIA 3S5SA 2TSYA 1EDQA 4PH6A 5M17A 1W31A 1YX1A 3S3GA 4Q6JA 3GHTA 4XKYA 3QTGA 2BODX 4MADA 3G77A 3PP7A 2MNRA 2IQ0A 3K30A 1A47A 1QBAA 4P8XA 1Q3NA 3UESA 1PPIA 3MCOA 4XAYA 4D2JA 2DSWA 1K9EA 3K8MA 3F4NA 1PHQA 1W1A1 3BGJA 1E40A 2OWXA 2HEJA 3LM7A 3TP4A 5CC6A 3BPWA 3W26A 2ONEA 2PDGA 2ZRYA 5EKYA 1DJQA 1IT7A 1ISZA 3QGKC 5C6MA 3HG3A 4F79A 4YN5A 3WO8A 4PBEA 3W6LA 2VVNA 3VGGA 4RDWA 2QCMA 2GGHA 2VZSA 4JICA 4DO4A 3B8TA 4H7ZA 1OCNA 1G0CA 2QPUA 5DLCA 4UC5A 5K4XA 1JPMA 1SJAA 5M3WA 4Z1CA 3DHPA 4O1EA 1QK2A 3P8JA 4GGBA 3GTFA 3ZSTA 3TV8A 4HPHA 4C6PA 4GK8A 1L6SA 4DXKA 1HTIA 3OBEA 1UZHA 4B15A 2CCRA 3K4DA 1QR7A 4C6DA 4IPPA 4PB5A 4KEZA 3M47A 3T1GA 3R12A 5D02A 4NRRA 2H3BA 5PTDA 7CGTA 2FTYA 2XG9A 3N6JA 3EWWA 2R1LA 1O5RA 4H00A 1WDRA 4XD4A 4PZVA 1RAKA 4GKLA 3KRZA 4QSFA 2PRHA 3KL5A 4NKCA 4B5WA 3MW7A 1EEXA 3U2ZA 3D6NA 3SUWA 2FDMA 2X40A 5ABFA 9XIMA 4BWLA 4HCHA 3HB9A 1G69A 2VGGA 1TG7A 3PWAA 3H2CA 1XFBA 1RR2A 3CHDA 3WUFA 3AXMA 4HT3A 3QSTA 1H7OA 2VFHA 6CGTA 1P0KA 4OOUA 4N4PA 1UKOA 2HBVA 4AZ6A 4HZMA 2D2GA 1E6PA 5CPMA 4IP4A 4HA3A 3L4WA 3AWNA 4Y7EA 4QITA 1IXOA 4GZIA 1EB3A 3NA8A 3AYTA 3P93A 3RPTA 4W9TA 1R5YA 3VDHA 4AZCB 5AZ0A 4GXMA 1IEQA 1KWKA 4XZMX 2WWCA 1HKJA 5DO8A 2PTYA 4Y9MA 4MYAA 5CZTA 5AC6A 3GXIA 4S38A 3HU7A 4AWUA 3MUCA 1V6UA 4JTQA 1O1ZA 4I9AA 4DNMA 3MSGA 1PHWA 1RUSA 1T8XA 3O06A 3LHWA 1ADOA 3SN4A 3VIMA 2CERA 1VJSA 1SMAA 2O0TA 1TJ0A 3GDRA 1EGZA 3O15A 1QBBA 2Y5SA 3W2JA 3WEZA 2CETA 2J6VA 2OEMA 3WDHA 2C15A 3WLKX 2YOCA 1LL4A 2XVPA 3WUEA 1FWIC 1DE5A 1VCFA 1X6UA 2E4TA 1FUYA 1QWGA 1EJTC 1PCWA 2PCEA 4QROA 4MWAB 2PGFA 3EKZA 5A6SA 1O66A 1X1NA 4AC1X 4AVNA 1XRTA 3PTQA 1XSKA 3GS6A 4MB4A 4PBGA 3O6DA 4ONVA 1UR1A 3TMQA 5TBOA 3N18A 3W6YA 1W2VA 1YBQB 3BLPX 3WDPP 3MUIA 4HPNA 2Z25A 1AMYA 1XLBA 3QRHA 4JR5A 3UZXA 3P6LA 3CUHA 4UQAA 1FWWA 1O5QA 4MAVA 4MB1A 1ZALA 2YL6A 2DZTA 4EAYA 5CAKA 1ZLPA 1E4IA 4AY7A 3IV8A 3L2MA 3QV9A 1EPXA 3EAUA 4JTAA 4RW3A 1LP6A 4ZEPA 1V6TA 4WSHA 2EPNA 1F8MA 1OYAA 1W9DM 2QJGA 4AD4A 4Z2HA 4PFMA 4PN2A 5A3HA 1X7FA 3ZM8A 3NEVA 2ABBA 2CZVA 3VZXA 3CIWA 4LS0A 1W91A 4I6VA 1W8GA 4OIFA 5HBFA 3K5XA 5DCEA 1ZU8A 4UFIA 1OGSA 1Y5VA 3EX1A 3L0GA 3IJQA 1S5WA 3Q67A 2J8GA 4NU7A 2CW6A 4IIGA 3EOLA 1VFOA 3S1GA 4WDWA 3LCIA 3NCOA 1UCWA 1WKFA 1UC4A 4HIBA 3GDKA 4LX4A 2QCEA 4C6FA 5CBJA 1R9XA 4D6EA 4TX9A 1PIFA 4DJFA 3TAOA 4FF5A 3NEHA 4HA1A 1SZGA 2E28A 2ISFA 2PI6A 3E96A 1E1EA 1VJZA 1KQYA 2OQLA 4YTUA 5HATA 1XLLA 3AWOA 1VYSX 2JF7A 3MMWA 2UY5A 3KVLA 3GH4A 3AYVA 3QKEA 3V1PA 5DRIA 4BY3A 4PCFA 3LTYA 1NWTA 3FHQA 4UR9A 4G7FA 3N9RA 5I77A 2G3IA 5DXYA 3VKDA 4B16A 3P0XA 4X9SA 4LAUA 3N9SA 4J7RA 3TYZA 1TSIA 3VKJA 1GQNA 4V2XA 2ATSA 3P82A 1XRFA 1TPVA 1E1CA 2BX7A 1UHVA 3O0FA 4L1GA 2OEJA 3A5VA 4QCEA 4XZIA 3T09A 2HROA 4H1ZA 5D9MA 1IR2A 1BVZA 2G3FA 1TPFA 3DFNA 3GYCA 2CBIA 5EB8A 1YHTA 4E2OA 4R5EA 3QC3A 4LS2A 1VBRA 3ISIX 5CGTA 3PZMA 1GHRA 3BMXA 2PWFA 4FLQA 2BXVA 4C65A 2TODA 3R0UA 1H63A 4AD5A 4CNOA 1XLKA 4NASA 4BF7A 3B9NA 3N17A 2PD5A 4GI8A 3LU2A 3BLDA 4KGLA 4REQB 2CLHA 2G50A 2JK2A 3FX4A 3WH7A 1B4KA 2PC4A 3WD2A 3GNDA 1FCQA 2PODA 1UKQA 4JQ3A 4HMDA 2OZ0A 2W9MA 5HWMA 4N2YA 4PMYA 1FKWA 2ZCGA 3VMOA 5A6BA 1JPKA 3CZ8A 3HFTA 2OGYA 2CBUA 1F3TA 4KCTA 4H2CA 4PTNA 4XBKA 2VURA 4YTSA 1KC7A 3W7KA 3NGFA 3F2DA 1FRBA 4TVCA 1YXYA 3CB3A 4DQWA 3UETA 3RFAA 3K1DA 2GGEA 1OT2A 2CLFA 1FXPA 3G0UA 3G8RA 4PL1A 2TAAA 1SW0A 3TR2A 1SZEA 1A5LC 1K4GA 2YKKA 3AIWA 3VIOA 1NQ6A 1ICQA 3L5AA 1Z44A 1HJQA 3E2QA 5FSEC 1VP5A 1X1ZA 4HU4A 1NY1A 4AF0A 2FPYA 2GJNA 1H49A 4EPDC 1Q6LA 5E0FA 2WMIB 3R8RA 1I9CB 1JCMP 3W7EA 1JXKA 3WDJA 3PM6A 5D8WA 2Z27A 1LBLA 3JU2A 3VNDA 2V3GA 3CT2A 4JYEA 3CS2A 1ZQ5A 2HXTA 3ATZA 2Z6IA 2PWVA 3RX2A 4FMVA 1SPQA 4K8HA 3ARXA 1GYLA 3PZIA 1JZ3A 2J9ZA 4IFKB 2ZXAA 2VRQA 3A9IA 1ZBWA 3S2MA 3M6YA 4Q22A 5HWNA 1QVBA 3OB8A 3S1XA 2Y7FA 1ZNNA 4JNYA 3P61A 4ZZ9A 4KEUA 1JRCA 2IXVA 4J3VA 4Y9AA 3E0WA 3DENA 1DQUA 1QNOA 3UP8A 1VKFA 1JCLA 3AHYA 5A8GA 3MHFA 4OFCA 1JAEA 5T26A 1TPH1 4D8ZA 3C61A 7XIMA 4TV6A 5D9PA 1WXZA 2PDBA 1HJSA 1KA9F 5H2ZA 3MKVA 3PPGA 3C6CA 5AYIA 1SO5A 4JEJA 3RJXA 3WY1A 4AQLA 3W22A 1YLVA 1S2AA 1PAMA 3H2NA 2QJIA 3O3RA 2E6YA 4JQ2A 1KM1A 2HBXA 2PWEA 4GA8A 1G7UA 2VFIA 1J93A 1Q45A 3UY8A 3M0HA 2PU0A 3CAKA 1ZCCA 1CLVA 2XPKA 3PAOA 4PA8A 3MP3A 3S6TA 2XFWA 3IJ9A 3TCSA 3W86A 5DY3A 3T9PA 5GJPA 1VQTA 3PSWA 5K4ZA 4UQCA 3LOTA 3W7CA 4IQLA 4JX5A 1UR9A 4IG2A 3UXKA 5TF0A 4DF1A 4D6CA 4ZOEA 4GRSA 5CSYA 4IGHA 5FF4A 1B54A 4UMBA 1ISYA 4F0HA 4X63A 3SR7A 4KETA 2V2DA 3WQ5A 4Q4OA 4ZENA 4GBUA 3CQIA 8RUCA 3UJEA 5H6HA 4A3YA 3EPOA 4QNEA 1K6WA 1XR2A 4Y8EA 1DJXA 1F6YA 4MM1A 5DRCA 4K6AA 3GC2A 2B0MA 3QM3A 2RDXA 3ARSA 3VC5A 4EXQA 5I02A 1F7BA 3CUJA 3OBAA 4HYVA 3VXGA 5FAGA 1SFJA 4X60A 3WJZA 1ECEA 2R14A 3ZFHA 2PP1A 4IMCA 3BAYA 3E5BA 2QV4A 3THDA 1EA0A 1BKSA 2CHNA 3MCMA 1M7PA 2GGGA 3AHXA 2O9TA 4D6JA 5E5CA 3NVDA 4HQVA 2Q3RA 4PUJA 1KRMA 3PWIA 5K9XA 3TR9A 1Q8JA 3V0SA 3RGTA 3CGTA 1DWIM 3UVIA 2AAAA 1BXNA 3FW6A 1E0VA 1WNOA 2UY3A 1LOSA 3ORWA 3RILA 2CIPA 1LLZA 4K8EA 3M5YA 1KXVA 1NF0A 2J7BA 3CWHA 3F5LA 3LXAA 3RM8A 3G24A 1PXGA 1UZ4A 2GQ8A 4K8GA 3T7VA 1DE6A 4K38A 3UXAA 1AODA 3VDGA 3T07A 3KS5A 3MDUA 4KW2A 1I1WA 1EJXC 5IBXA 4C6CA 3AS3A 4KCUA 2CNCA 3HPFA 2RDTA 3O05A 1U30A 2A3BA 5A8OA 3UNDA 2J62A 4HU8A 1KR0A 2FZDA 1EBGA 1TPC1 2FPVA 1HFBA 1OEPA 3HO8A 5HNUA 2BHZA 3WQEA 4Q8OA 4JHOA 1I1XA 4WRHA 2JKAA 4NJGA 1IF2A 1TIWA 4PUWA 1S5VA 1E56A 1A3HA 1Y8BA 5IM51 3NZRA 1X1OA 1DWGM 4OUEA 4QEEA 3FA5A 4QDPA 3AS2A 2Z24A 5FA5A 4F4RA 3ITTA 3TC7A 8CGTA 4TIMA 4A4AA 3GU2A 3CMFA 5C71A 2B4GA 4PUEA 4MDOA 4GQQA 2WC3A 1T7LA 4IGSA 3I4KA 4IOTA 3QOMA 1NEYA 1PB0A 3BW4A 3TTSA 3HG5A 3BO9A 4B9ZA 4MZ1A 2ZOXA 3PTKA 3H55A 1O68A 4TR9A 3A22A 4IJCA 3RF9A 2VFDA 2PWHA 3UPWA 3GKFA 3W7OA 2RGLA 3IIXA 2J25A 1U5JA 1FTXA 4MGGA 1DORA 1WKDA 4X0NA 4AHPA 1TUXA 4PMDA 3RO8A 3SO7A 4G2DA 3T78A 5HNTA 3ELFA 3TQ0A 2VL4A 3NPUA 1W9VA 4PMJA 3STPA 2X8RA 2WKGA 4ENLA 4ADSA 1M01A 2DORA 3S2NA 1PYMA 4DWSC 1S1PA 2OFJA 1XPGA 4XZLX 2UV8G 1GNXA 1O94A 2QIWA 2VENA 1KM2A 1KKOA 2Y8KA 4A6GA 3KS6A 4B4FA 4PFHA 4KFPA 1TA3B 1ONRA 1QT1A 4ZOAA 3ERPA 4HOWA 2Q01A 1GQIA 5CZSA 2E25A 2VUYA 3GG7A 5HA7A 1RXOB 2GFTA 4HGXA 2R24A 4JTKA 4DF0A 3B4UA 2WO5A 4UQDA 3P5ZA 2VDIA 2YCEA 2B7NA 4JKMA 3LENA 4JNZA 1PZ3A 4DBDA 3QZEA 1XLGA 1ZY9A 5BOOA 4W85A 1RCXB 5HJYA 1XGZA 1IZCA 2GWGA 3EWUA 4NAFA 4FK9A 3CAWA 2DT3A 1J11A 1FWDC 1E4NA 4R34A 1BQCA 3UCCA 3NVTA 2VC6A 3BAJA 1PCKA 1XISA 4Q6XA 2NT1A 3AHTA 8TIMA 1WUFA 3KL0A 3R7MA 1FA2A 3B4YA 3RU6A 3POHA 4A21A 1SZFA 4ADUA 3V36A 4LBSA 2ZDRA 4JFTA 1EIBA 2WQPA 1P1MA 4NJIA 3PJTA 2H90A 5FACA 2WLYA 2VELA 4DHGA 3G1FA 5DN1A 3OQEA 2DUZA 3UGRA 1RY0A 5G4WA 4DO6A 5H8UA 1S2TA 2EQDA 4L6HA 3D3FA 3VCNA 4UTJA 4QP0A 4DWDA 3LEPA 1A0CA 4BQ3A 3TX9A 3I3EA 2Y5EA 4UMCA 2QJHA 4CU7A 1SJBA 2ZUMA 4NNAA 3W38A 1Z41A 3P7YA 5T8GA 4YIWA 3NL2A 2HNEA 1W1TA 3LI1A 2R1KA 4Q32A 4C6OA 4L56A 3VUPA 2ZWZA 3O6AA 1NDWA 1R3TA 1RP8A 4JFWA 3QQ0A 4L61A 3URQA 4IX2A 4YVPA 1XIGA 2F84A 3G1RA 2YZ5A 5TNVA 2XN1A 1EJVC 4Z2KA 1SZNA 3CM4A 4XTIA 3ZT7A 1N8IA 1EUAA 4JTDA 3RO6A 4HNLA 2PWGA 3VKKA 1RALA 3WK1A 3T08A 5JIWA 2OYLA 3THAA 3M5XA 2I5IA 2BFGA 3L4ZA 5A2CA 1A4LA 5D38A 1ME8A 3WELA 4GH3A 3FAXA 4NNCA 1K9DA 4XUYA 3MV01 3OA3A 3V75A 4OT7A 1KRAC 1J5TA 1YNYA 3H7RA 3O9NA 4H7VA 1GOKA 4M51A 2YA0A 3CUFA 4A8NA 3VAVA 5AVHA 1U83A 3BLEA 4AVOA 3S46A 3WQOA 4LXFA 4XSMA 1XP3A 2L5HA 4P7QA 3OJGA 4AAJA 1ODZA 4NL1A 5FJTA 3FS2A 1EZ2A 5FJUA 1B4EA 4R7OA 1BAGA 4OJYA 1ISVA 2EAWA 5BMWA 1VCVA 4ES4A 3H4WA 1H5YA 3UWZA 1T8QA 1BLIA 2Z26A 2WMFA 4HK7A 5M5DA 4GJIA 2XGIA 1JZ7A 3IRDA 4FLRA 4NUWA 3KP0A 5I0DA 4ACZA 4AWEA 1LTDA 2QXWA 1UYQA 1DOSA 4UFHA 2WCSA 3WD3A 3W7MA 3E5PA 1LL6A 3ZYZA 2I9EA 3VIJA 3VPLA 1GORA 2FZ9A 3FKRA 4XQ6A 4FZIA 1KV5A 2GVLA 4ZQOA 2YDRA 2ZRVA 4IIBA 1CGUA 1H51A 3E2SA 5JBEA 5C2GA 3UPMA 2J13A 1CGYA 1W54A 3T44A 2YBUA 3UF9A 1FWSA 3CQKA 3B40A 4FS9A 4QQ3A 3W72A 1MYRA 1HVQA 3IUDA 1XKYA 2VOMA 3N25A 1EX1A 5CGQA 1SFSA 1I0DA 1VFMA 3NSXA 4YWIA 4IIFA 4KT2A 1MNZA 2VEKA 4IPNB 3RAOA 3W2NA 2XIQA 1VLWA 3PZVA 3UZJA 3ZVIA 4Q8VA 4N02A 3U4FA 5AB3A 3HG2A 3IGXA 3W84A 3MANA 4K68A 3BJSA 3BOLA 2QS8A 1Q6CA 2ABAA 3Q2DA 4IPLA 1H4PA 3WF4A 4A2RA 3ECQA 2FZNA 2VFFA 3EPMA 3GRIA 5G1TA 1VYPX 4H9TA 3A13A 1BYBA 3W7IA 4EIVA 4BCEA 1CWYA 1QPKA 3LCGA 3QR3A 2G97A 2HJPA 1DHPA 5ABHA 4GBDA 3OOQA 4FNQA 3DHUA 3FJLA 2BASA 3MI3A 4PEEA 4W7UA 3PZTA 5AHNA 1Z48A 3SB0A 1GJPA 1QPNA 3WMLA 2GK1A 2E5DA 1GYNA 2OT0A 4I90A 1WAWA 3S5ZA 1WOAA 2PBGA 2YFOA 3SZ8A 3U5YA 3AZSA 1OX4A 2Q02A 3TOPA 3SN1A 4IXHA 2QUMA 3LNMA 3VM5A 3TIMA 2R1MA 3L4TA 4IMAA 2VOTA 3M1ZA 3VCCA 2ZA1A 1FDYA 3EXTA 2FJKA 3WFZA 2E0PA 1FCVA 3DG7A 2PDCA 5FCZA 1KTBA 3KVJA 4CD4A 1JPDX 3QW4B 2WVVB 1GKPA 1V3IA 3KCJA 3STGA 5J8LA 1PO9A 3MQTA 3DG3A 1F76A 3WJYA 2OXNA 2XWDA 1YXDA 1F3XA 4XV0A 3U57A 3O7UA 4KMQA 1BXCA 2WHMA 3HV8A 3IV3A 1OF8A 1PZ2A 4FEZA 3VC6A 3HZ3A 4FXJA 3MUXA 8A3HA 4ERAA 4BA0A 2OOFA 3VUSA 3ANYA 2J9YA 4LEFA 2ZUTA 3Q37A 4N6EA 3GHSA 3PK7A 4TO8A 2J88A 3H2FA 2A3AA 2BHYA 3WZ0E 1PSCA 1UBPC 2XH4A 3WD0A 1H1ZA 2X1IA 2VRKA 3A4XA 1JPHA 4QCFA 3WD1A 4AISA 1EC8A 1B90A 3SSJA 1MFUA 4N4QA 1AZ2A 1ITXA 2FGBA 2WNWA 3I3BA 3DCPA 1LQ2A 4F0MA 2NLYA 4GFSA 4JIIX 1GCYA 3MB9A 3GX9A 3VIHA 1YDYA 3M0VA 5T91A 1GQJA 1YPXA 2XIIA 3BCDA 2GQ3A 3OP2A 1FWHC 3UCDA 2XINA 5U7SA 2D2HA 3MYPA 3EDJA 3PG9A 1EP1A 2X30A 3NQEA 2CXEA 5GPRA 4JCLA 2EHHA 1KXHA 5CZ0A 4Q3MA 3W7HA 5HPCA 3ZSSA 1E6QM 3NO5A 3NPVA 4AD0A 3AHVA 1BRLB 1IGSA 3L66A 4V28A 1BVNP 4F40A 2WSPA 3BAXA 3N3TA 4S3JA 2V82A 3MDWA 5B80A 3OODA 1V0NA 2P3ZA 4FIQA 3H22A 3GC5A 3VVGA 1UKSA 1REQB 5CXPA 2ZADA 4OVXA 4PULA 4WGXA 1IIHA 4UQ9A 4CQBA 3ALGA 5AHFA 1W1IE 4JL1A 1NDVA 4B5UA 3W1TA 3AJXA 1AH3A 2X7VA 3TZFA 4F9DA 1KW1A 2CXGA 1RD6A 3SUVA 3CHVA 3MS8A 7TAAA 4ICMA 4GUIA 3IJDA 4DYJA 2RJGA 4JYFA 2TMDA 1EP2A 1D3GA 4XX6A 2BZNA 1GQKA 3H24A 2D2OA 1XX1A 3VE9A 3DAQA 1L0PA 1UWQA 2V69A 1Q13A 4KF1A 1I0BA 4MSSA 4TTGA 4H2HA 3QLDA 3VZYA 1XDLA 5LA2A 7A3HA 3U48A 3T2PA 3WBYA 1MUCA 3LBOA 4EWJA 1XIFA 4UB9A 1G4PA 2Y61A 4ZO7A 2AMGA 3GAYA 4HU0A 2G8ZA 5A6KA 1R8LA 2PLKA 4EPBC 1RV8A 2VEGA 5BRBA 4HNOA 4DZAA 3O16A 1R47A 4TMCA 1Z8AA 3EA3A 1CXLA 1V4YA 3W27A 3EA1A 3GXFA 5JH2A 2POZA 4LCQA 3GDTA 3HGJA 3TUUA 4GIRA 4MYXA 4LU0A 1W37A 3QXBA 3QV8A 4QS5A 4E4FA 4NAEA 1UG6A 3RM9A 3B8IA 4TXEA 1YDVA 1V79A 1KFJA 3SM0A 1KLYA 3I4EA 4XO6A 3ARZA 2E3ZA 1KBIA 4DZIA 2AQWA 3B8VA 1XYLA 3GG8A 1SGJA 2WNZA 1CGXA 1X97A 2WV8A 1ZPTA 3F1QA 1RPXA 3HOJA 3I6EA 3THQA 2BOEX 1GW9A 4PYSA 4P7OA 3GD6A 3W6MA 4IT1A 4B5TA 4K1GA 3WSUA 3LGDA 2R6OA 3MZNA 3R79A 1Q7QA 1IYXA 3HGRA 2DDXA 4J3XA 1QNRA 2EG6A 2QMJA 5JMUA 1FHLA 2E67A 4RZBA 3RIKA 1J2WA 1DJYA 4P7NA 3QV6A 4GABA 3F5JA 3W2KA 2GOKA 2PRMA 4UIOA 4DF2A 4ZMGA 4ORIA 1XH2A 1XKJA 3CIXA 2ACSA 2IPJA 3CZEA 3W23A 3VGBA 3TSMA 3BLKA 1EO5A 4NZJA 1KBLA 1W1YA 3BDKA 4M56A 5HMSA 1CENA 2BXYA 3KOWA 4PRWA 5ECVA 2ZUNA 4A35A 1XG4A 4IQEA 5HQMA 4AIUA 5AYZA 3WDQA 2FB2A 3PZQA 4UTWA 3PG8A 1I75A 2J8FA 1VGAA 3A4AA 1ONWA 3WNNA 2P50A 4I7VA 1B3WA 2VQTA 1RJPA 2E9MA 3GW0A 5DY2A 4D1IA 4N9EA 2TYSA 1TWIA 2PC8A 2O4MA 1LOQA 3RX3A 3BW2A 2QPSA 5ENLA 4QJ5B 3AZTA 5E9AA 3AMKA 1Z7AA 3VGDA 1E72M 1RA5A 4ASTA 4H7CA 3FK4A 2CBJA 2FVMA 5I3KA 1IHIA 2V5KA 1Z6KA 4ZO8A 1W8SA 2HK0A 4GVIA 2E09A 3H70A 3HPSA 3NUKA 1K1DA 4H9YA 4UNIA 5EMKA 4EXAA 4YVXA 2NSOA 3B8SA 3CQJA 3EOOA 3IIPA 4GKTA 5EPDA 3PAJA 4EKJA 2PGWA 3DX5A 5A6AA 1EC7A 3SY1A 2DSKA 1UP2A 1J2BA 4JFUA 1FCUA 4Q4QA 4JD4A 4IX0A 4DN1A 3K8LA 2CLIA 3GHRA 2QDEA 3DUGA 2PUZA 3TLQA 1IGWA 2FMOA 1IXQA 3DC0A 3GO2A 4LYPA 1BWKA 1J5SA 1N7KA 3OZPA 1IEWA 3HQ1A 2X05A 2WM1A 1ICPA 3CUIA 1E3XA 4I9JA 3TW6A 3LS9A 2QCHA 1B3XA 2OMAA 2W79A 4EOUA 4Q4SA 3GVVA 2ON3A 2ZICA 1R38A 2JQXA 5CJNA 3CYVA 3LLXA 4F3HA 4R9XA 4QEHA 1WZLA 1CYGA 5IFPA 5TQLA 5A8PA 1EL3A 1KGWA 1EGVA 4U10A 2A3EA 3W82A 5CAHA 1UUOA 3ZO9A 1V0LA 2BSLA 2ZA3A 4LBRA 4KFOA 4P61A 4GACA 5CSSA 3VINA 1KCKA 5LZLA 1EGMA 4NT0A 3WQPA 1CXFA 4GISA 4R88A 5DANA 4TOQA 1KB3A 4LY4A 3ZJKA 2DZBA 4PMVA 2IPGA 4TV5A 4JIHA 5A6LA 1CBGA 3MUZ1 2YXXA 2JGQA 3I3DA 1ML1A 4G9PA 1TQXA 3E2RA 1XYFA 4HTBA 4LVFA 4RNIA 4IQDA 3KDNA 2VX5A 2HE5A 1F07A 1EF3A 4C6IA 2VFGA 2C7FA 5D04C 5DT5A 6TIMA 1SMDA 1FWFC 4XZHA 3WLJA 1V3MA 1DL3A 2C19A 3TN3A 2CITA 3IVSA 3C3NA 4NI3A 1G01A 2CESA 3S2CA 4MKSA 3MUY1 3N12A 4MFDA 3SQLA 2P10A 3JRKA 4HNVA 1IEIA 3KBSA 1M03A 3E74A 1BVWA 3RDKA 1I2QA 2VMFA 3EDKA 1S2CA 5D9NA 4LUTA 4NRSA 4HA0A 5EU9A 4NZ1A 4GIYA 4TQTA 1VLIA 4KKXA 1FY6A 4FNUA 1T5AA 3PSVA 1Y5WA 2JIWA 3OYZA 4OBTA 4KWUA 1QNPA 5A69A 1FP9A 2BB0A 1F61A 1GK8A 2PU1A 3D46A 4IUOA 4A8LA 2YCLA 2OZTA 4N6FA 3WLPA 2G0WA 4JDYA 1PWMA 3AAMA 1XCFA 2B7OA 1XLMA 4BHYA 3RJYA 2J8TA 3IPWA 3ITLA 4PCNA 4RXGA 2EKCA 4F0KA 5CJ5A 3BQ5A 3OHIA 4FNSA 3DKJA 1E0XA 1HL2A 5A6JA 3EMCA 2GQAA 3CZKA 4HCLA 3V0TA 5EMYA 3NXLA 1W0MA 3G6LA 1UPPA 4QR6A 1R3RA 2RKXA 2QKFA 3UW6A 1XBYA 1Y65A 4FR1A 3CIVA 5JUVA 3OPSA 4J27A 2H9AA 1W1B1 1IEXA 4LB4A 3DFQA 3DKLA 5HK4A 1PKNA 5BU9A 4CQCA 1V0MA 3KCOA 1B3VA 1ZHAA 2PDQA 3APTA 4PTMA 4UFMA 4ZB2A 2DU2A 3EX4A 5HJXA 3L23A 2EG7A 5FF7A 3NZGA 3TLLA 3CBWA 3LV6A 2VC9A 1DIKA 1OFAA 3DGBA 4HD5A