3BAJA

Human pancreatic alpha-amylase in complex with nitrate and acarbose
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
total genus 172
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bajA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bajA01
1TUXA 3WQWA 2YL8A 3MSDA 1XH1A 1NWRA 4QLKA 1VAHA 2ZX9A 3TP4A 3VSTA 4W8AA 3GBDA 1MW0A 2Y24A 4F8XA 1GOMA 2CHOA 3T0BA 2YL6A 1QPKA 1EGZA 3MANA 1HXKA 1VENA 4J28A 1MYRA 4PCTA 1XSKA 3PTKA 1GW1A 2X05A 1QOXA 3K46A 2OYMA 1OGBA 4B3KA 6CGTA 3MO4A 1XRVA 2X0HA 3SUTA 4P7NA 4X0NA 3S5YA 1UR2A 4A3YA 1AMYA 4W7VA 5DEZA 1K9FA 3LRLA 1LJYA 4CD7A 4D1JA 1XC6A 3IANA 4LX4A 4LYPA 4MB4A 1M53A 1XYFA 2V3GA 1H2JA 2ZUSA 1HL8A 1C7SA 3LPGA 1CYGA 4N0RA 2BXYA 4URIA 3N04A 2VOTA 1TFVA 3MMUA 3VIHA 1YHTA 4MDPA 3VGEA 1OWQA 4D71A 2ZIDA 5ABGA 2J7CA 5A2CA 3PZTA 1JYWA 2ZX8A 2UWFA 2WC4A 2D2OA 4CD8A 2YDRA 2FGLA 2VX7A 3CBWA 1WP6A 3PTMA 1UZ1A 4C7GA 1H4PA 1WNOA 5CJ5A 3BUPA 2DSWA 1TCMA 1MQPA 3VMNA 1ZBCA 2W63A 1UD2A 3N1AA 3TA9A 3KL5A 3CUGA 4PMUA 2WSKA 3AZRA 2GVYA 4PMQA 1J11A 1UR9A 4AD2A 1WZAA 1FHLA 3BAWA 3OGVA 1JXKA 4TOQA 5BWFA 3LMYA 4KWUA 2A3AA 1K9EA 3UERA 2GUYA 3VUPA 2G41A 2BVDA 2WVUA 3SCOA 3ARRA 3EJQA 1E0XA 1W3HA 2F61A 2ZE0A 2DDXA 3N13A 4H04A 3LPFA 2WC7A 3WNMA 2CBIA 1AQ0A 3CZLA 3VIJA 2MANA 2BHZA 3SCTA 1JFXA 1FFRA 2IXUA 4GXPA 2VZVA 1UD5A 5AY7A 4FLRA 2VI0A 4RL3A 3WDHA 3KL3A 3SCWA 1AQMA 2E8ZA 3AIVA 1V3HA 5IXEA 1TR1A 2BY1A 1V3KA 2WWCA 2A3HA 4AMXA 3AHTA 2QLYA 5KEZA 1QBAA 1GCYA 3N17A 3AMLA 4AC1X 1MW3A 3AS3A 2UY5A 1U33A 3BVWA 2XVGA 3LRKA 3BSGA 1BGAA 2E40A 5FD0A 1QI3A 2VVNA 1US3A 4AEEA 3IGUA 3OZOA 3N15A 3U7BA 3OGRA 1HJSA 5I3DA 2UY2A 2C0HA 1H0GA 4PTXA 1V3LA 3WD3A 5ABFB 4DO5A 1QNOA 1C92A 4P8VA 5M3WA 1GQIA 4BS0A 2XHYA 4OBSA 5I5RA 2V3EA 3A6OA 1E6XM 2CYGA 4UFHA 4CN4A 2J7FA 2CBVA 1CLXA 1UOKA 5BXSA 1J0HA 1ISVA 4L4OA 4P8WA 1KR0A 4GI8A 3RILA 3IJ7A 4GZJA 4DUVA 1TQSA 1JDAA 4UOZA 3MS8A 1VB9A 2D0HA 2AMGA 3VM7A 4BF7A 5E09A 3BCDA 4U3CA 1HP5A 3OLEA 3CMGA 2YIHA 2G3NA 4HZ7A 3VDCA 4WIWA 3W28A 3BMWA 1DEDA 3ALFA 3OG2A 3N18A 3WH6A 1TQWA 4XX6A 1GPFA 4ZE5A 3A3HA 2DEPA 3KE0A 1UR0A 2ZXDA 3CPUA 1MW1A 2XYLA 1H3GA 2F2HA 2VL4A 4V28A 3PZGA 1JXJA 1FH9A 1UQYA 1EH9A 4U5IA 4D6HA 8CGTA 1W1YA 3O9NA 4J3SA 1O6IA 1DWHM 1HIZA 1BVNP 3QHNA 1E3XA 1KFWA 2W66A 1ISXA 4OGZA 2AOSA 1CENA 1F4HA 3EDDA 2VQTA 2VZSA 2CNCA 1OGSA 1EQPA 2D1ZA 4P7QA 3CZEA 2F1BA 1C3FA 3WQ5A 2ZX7A 2EPKX 2W91A 4TVCA 1UKQA 1ISYA 3NCOA 2BHUA 3EJUA 3OZPA 3K1DA 3W4RA 2O92A 5FIPA 5E70A 4AZHA 1EXPA 5A1AA 3IJ8A 4AWEA 3U7VA 1UD6A 5FL0A 2J8GA 1HN1A 1E3ZA 2DIJA 2WKGA 1VBUA 3ARYA 4GZEA 1UH2A 3KEHA 2VRJA 4MNMA 3QHOA 2JF6A 3BAJA 2VR5A 3L4VA 3CHEA 2D23A 5ECUA 3SCUA 1QBBA 1DWFM 1R7AA 4NZFA 3AMKA 4W5ZA 4U2YA 3BAIA 1FH8A 1E15A 3NSXA 3WF0A 2FHCA 3WFZA 2XFYA 1E70M 2NW0A 1R46A 2Y4SA 2Z1SA 2WMJA 1GQLA 1MWOA 3AICA 2FE0A 4JL1A 1CXLA 3WL1A 1UR1A 4U33A 3RPMA 1GOKA 3WQ6A 1J0KA 3MUY1 3W0KA 3N9KA 3AQUA 4FNTA 4AZCB 3POHA 1LWHA 3VD7A 3DECA 1JDCA 3WD0A 1DWIM 1W91A 1OSEA 1V6XA 5BROA 3CH9A 3WY2A 4GPNA 2WB5A 4GO8A 1DP0A 4TTUA 4AIEA 3ZO9A 1TZ7A 1DWJM 2XUCA 1G01A 4E8DA 5KZ6A 2C7FA 5AC4A 1G5AA 1YQ2A 4LXFA 2QPUA 2WXDM 9CGTA 4PMOA 1H11A 3AIEA 2XVKA 3ARVA 3AXHA 1V6YA 4S3KA 3AHXA 4WKHA 1QI0A 5EMYA 3F5LA 3WH9A 4J3XA 1UKSA 1SYTA 2FDMA 8A3HA 4HA4A 1E43A 5I23A 3W53A 4D6CA 1HKMA 1C93A 2NT0A 4PMRA 5AC5A 4B15A 1HP4A 5I2UA 2WHLA 3WEOA 5FCZA 2J62A 2GJPA 4NRSA 4GQRA 4JKKA 1SFSA 3WN6A 1E4IA 1CDGA 4CCDA 1RPKA 3IAQA 3OLDA 3AIUA 3EJTA 4AZBA 1GJUA 3MUZ1 4QCFA 2V3DA 3EYPA 3AROA 2OW6A 4WSKA 1VEMA 1XD0A 1JZ5A 4XB3A 1J18A 1UD4A 2D3NA 3BUIA 3WENA 4TUFA 3BCFA 5BRPA 1NOUA 5TD4A 3AHZA 2XIIA 3WDJA 2XSAA 1NOFA 4CN6A 3EDEA 3VSVA 3A4XA 4AIOA 4AD3A 1NP0A 1UR4A 4H8HA 5BXTA 4X0VA 1MFUA 2E9MA 1B2YA 3BLKA 3VM5A 1PX4A 1PZ2A 4JKMA 4JFTA 3D51A 1WDPA 4UQBA 4B3LA 5M5DA 2GJRA 2RGMA 4MNLA 1M04A 5DMYA 2X2IA 4AMCA 1LWJA 1JNEA 4QLJA 2B31A 3EJPA 4OIFA 3S5ZA 2DSVA 5DT5A 3VD9A 2EACA 3VX0A 2PWDA 1UA7A 1QNSA 1TQVA 2WCSA 1UWUA 3WNOA 1V3MA 3K4DA 3DC0A 4J3TA 1JZ8A 3BXWA 2XPKA 1OIFA 1LL7A 4Z2LA 2ZOXA 1MXDA 3NJ3A 1BYDA 1PIGA 3BVXA 1H5VA 1XGZA 2FHFA 2WHMA 1NQ6A 1OT1A 1IV8A 3FAXA 3VGBA 3A4WA 1UKOA 1E0VA 4EAMA 4WLCA 3LRMA 1UHVA 4PEEA 3WUBA 2VX6A 3ZJ7A 4PMVA 4WSJA 3UCQA 4JFUA 3ARQA 5CSUA 5DT7A 1EDTA 4H41A 4FLSA 1E72M 1ZU8A 1ODUA 3W6LA 4U31A 1J0IA 1PEZA 4HMEA 1SMAA 4WKAA 1P6WA 4ACZB 2BVYA 1BF2A 3VX1A 4AD5A 1MVYA 5CLWA 2CEQA 4J7RA 4UQ9A 3GNRA 2Y8KA 3BAYA 2FGZA 3HG4A 2J77A 1H0IA 3WQVA 4LYRA 5A8PA 1I75A 1VJZA 3W29A 3WEZA 2E4TA 3DX3A 1QVBA 1UKTA 4HOWA 3VKKA 1CTNA 1KXQA 3GDBA 5CG0A 3BAXA 1TG7A 3HZ3A 1CGYA 2EPOA 3EDJA 1J01A 3ARTA 5A95A 2NT1A 1B31A 2BXZA 3AS0A 5GQBA 3OGSA 3DX2A 3QR3A 3BC9A 3L2MA 3UR7A 1G0CA 4AYGA 5E9AA 4OOZA 4DM1A 1JZ4A 4J3UA 4CCCA 1NM9A 3J7HA 4U2ZA 5D9OA 3H53A 2PI6A 1KGWA 1VIWA 4JKLA 4KMQA 2YJQA 2YOCA 3S6TA 2YLAA 5ABHA 2WMIB 5CLTA 5HDRA 4W84A 2WK2A 4TXEA 4JFVA 1FP9A 3WF4A 1V0MA 4FNSA 1M01A 1BPLB 2BY3A 2PBOA 1KB3A 5E1QA 4ML4A 4YPJA 3MI6A 3AXXA 1EO5A 1LL4A 4AZ6A 3BLBA 4H8VA 1C7TA 1UG6A 4DO6A 3CHCA 1CBGA 3D3AA 5A8QA 1E4LA 1Y7VA 3W25A 1JAEA 1HJXA 1W3KA 2ESCA 4UZUA 5CSYA 4W88A 1X6NA 3SCQA 3GZAA 3BUBA 1ZJAA 3AZTA 1AVAA 3WF1A 2J79A 2O9RA 1VEPA 2XM2A 5CPSA 1ISWA 3ALGA 4W89A 4D6DA 3RJXA 5BCAA 4UNIA 1JDDA 1KQYA 5C70A 3VMOA 2EABA 1QI5A 1CXHA 4YHEA 3AXIA 3TV8A 4P7OA 1IT0A 1QI4A 1ZBVA 4EE9A 3ARPA 5A3HA 3WMBA 5HPOA 3AMGA 2VX5A 3KLLA 1FOBA 5I0DA 1TVNA 3HN3A 3T2OA 3BVTA 4E2OA 4QFUA 3WELA 3AIRA 3SCVA 3AIWA 3VDAA 1BVZA 4TX8A 5JBFA 5A8MA 3M46A 4RE3A 3CUJA 2D20A 3MUAA 1B3VA 2GK1B 4C7FA 4IPNB 2XFFA 3BMVA 3FAWA 4W85A 1KXHA 2F7OA 2CBJA 4DWSD 3DDFA 1OBAA 1C8YA 4WK9A 1U2YA 2QPSA 1I1XA 1JGIA 3CO4A 1UZ4A 1W1PA 1D3CA 1HKJA 1AQHA 5AYIA 3WQ4A 3HG3A 4DO4A 1J12A 2A3CA 2WCAA 3G6LA 2J75A 2VCCA 1SMDA 1WAWA 3M6DA 1JYNA 2GJXB 5DF0A 2HVMA 1KWKA 1QI2A 4UFMA 1HL9A 4PSPA 3AI0A 5I24A 4EK7A 1W1VA 1UWSA 4TVUA 4MB3A 2F8QA 1PAMA 1J0YA 2E0PA 2CBUA 1OCQA 3WUFA 1KGXA 1JZ2A 3HG5A 4DUWA 3AFBA 3PZIA 4PRWA 3FHAA 1WDRA 1VFMA 4P7RA 4OKDA 3WH8A 3WH5A 5A6LA 2YDSA 3AYRA 4NXKA 1OGGA 1HJWA 3AMCA 2E9LA 2GSJA 4MAVA 2YA0A 1EHNA 3K8KA 4UCFA 4CGTA 1KWGA 2XWDA 3EMZA 4NSBA 2D22A 4CU6A 3EJSA 4BQ5A 3OA5A 3MU7A 1MQRA 3KZSA 1QHPA 5D9MA 3CUIA 5HBFA 3OIHA 4NRRA 5EFFA 4UFLA 2D3LA 1XCXA 1R87A 1JD7A 5A8OA 4EANA 3ZIZA 2D73A 3GH4A 4CD6A 2VMFA 4KGJA 2JIWA 5D8ZA 1V0LA 1VRXA 4K68A 4WF7A 2PF0A 1PPIA 1R34A 1BHGA 2PWFA 2YA2A 4A4AA 2XVLA 2TAAA 5E6ZA 5A2BA 4W7UA 3LPOA 4NZCA 4AZCA 3I3EA 5JUVA 2EBNA 3RCNA 2C8NA 1H41A 2J8FA 1CIUA 2ZUMA 1QWNA 1TMQA 3MMDA 2X09A 3WKZA 3DHUA 1H09A 4OOUA 4AXNA 2WC3A 1UQZA 3VOCA 4JL2A 3DHPA 1LQ0A 5A69A 4JHZA 3WY3A 3JUGA 2XN0A 2ZX6A 3SUVA 3NDYA 3WY1A 1UR8A 1H1NA 1MQQA 3ZJ6A 3SUSA 3W26A 2VUYA 4ZENA 3GXNA 4Z2GA 3VGHA 4XZBA 3EJRA 2OWCA 4MJ2A 1B3ZA 2VTFA 4CU8A 4EKJA 2BS9A 3SEPA 1EA9C 1OD0A 3VD3A 3FW6A 1VF8A 4YN5A 4OUEA 3WDRA 4MNJA 3VD5A 1E4MM 1D7FA 2RGLA 2A3BA 1GHSA 1A47A 2BY2A 1PX8A 2CXGA 5A6SA 3GXDA 6TAAA 3GBEA 2W4XA 4AW7A 5C8BB 1HKIA 1RD6A 2Q8XA 1UWIA 3GXIA 4PUEA 2OW7A 5I6SA 2OSYA 3LX9A 1K9TA 4PYSA 1NH6A 3MV11 2ZXQA 3ZM8A 1W2VA 3CZSA 4R27A 4ATWA 1XD1A 4LQ1A 1E1FA 3B9EA 1B9ZA 1TQTA 2WVSA 3M07A 4HPGA 2WMKA 2WHKA 2XGIA 5E0FA 3KL0A 1WKYA 3WF3A 2X2JA 4HP5A 3K8MA 1XSJA 4OZOA 3WIJA 3VIFA 3U5UA 1HKKA 4NX0A 4OJYA 1JAKA 3SCRA 3WDIA 1E6ZA 1Q6GA 3CZ8A 5HNNA 4JZ5A 3KLKA 1JI1A 2WANA 1WE5A 2E8YA 4RE2A 3CTTA 4QP0A 4MTVA 3DX1A 3VILA 4HMDA 2CPUA 3EBVA 4JIEA 4OBRA 1L0PA 3GM8A 4JAWA 1EOMA 3GXPA 5A6AA 1KBBA 5A6JA 4F66A 1E4NA 3UG5A 2ZX5A 3RDKA 3CHFA 4FLOA 3L4YA 1ECEA 1V08A 3EMCA 1GZJA 1PBGA 1NP2A 1V02E 1K6AA 2X8RA 3PTQA 3VDBA 1CGVA 1HJUA 2CETA 3VIMA 4DWSA 1E6PA 1C8QA 1JF5A 4Z2JA 1ITXA 2ZWZA 1QW8A 4X9YA 3EDKA 2DSKA 3ZSSA 4FNUA 5E6YA 3GYCA 1ZL1A 2D0GA 5LA2A 1CXKA 2VRQA 3CUHA 4JHOA 4V2XA 1BYBA 1OM0A 1XCWA 1M7XA 3PZOA 2VVSA 3ARSA 1KTCA 3T0AA 4D6JA 4D6GA 3UETA 4Q22A 2Y8VA 3NDZA 2OSWA 3FN9A 4UFJA 1W3LA 4QLLA 4UQCA 1ISZA 1GVIA 1JFHA 4HTYA 3AIQA 2EO7A 4W8LA 3DX4A 3H54A 2DT3A 2V5DA 3CC1A 4H8UA 3BAKA 1ZBWA 2XFRA 3OBAA 3WFLA 2EJ1A 1N82A 1M03A 4U3AA 3BH4A 1ZJBA 1G1YA 1QNPA 1VEOA 1X1NA 1E5NA 3FNDA 1T0OA 1KTBA 5JBDA 1V6WA 5GNZA 4AD1A 1CGTA 3CZGA 2VC9A 3RM4A 2JF7A 4PN2A 2J7BA 2EXOA 1EIBA 3ZR5A 1OT2A 3CZNA 3U5YA 3PZUA 2OSXA 3ZMRA 3O2LA 1E40A 3VIKA 3PZNA 1KXTA 3HU7A 1JD9A 3S2CA 4PTVA 2V38A 3MV01 4GKLA 3A23A 2XTKA 3WUEA 1O7AA 1GVYA 3VVGA 4LGXA 4PSRA 1PJ9A 2YKKA 1V6UA 5CGMA 3OLIA 5E0CA 3VDHA 2WMFA 5BRQA 3VSUA 1HTYA 4TTGA 3BUDA 4CD4A 2NSXA 1R75A 3BLPX 4E8CA 1WZKA 3B9DA 5EFDA 2PB1A 3ARZA 5ABFA 1B30A 3VNZA 5A94A 2PWGA 1GHRA 2QV4A 4UOQA 3L4WA 4QAWA 3WY4A 3VO0A 1E6NA 4IPLA 4FNRA 7CGTA 3PN8A 2G3MA 3DX0A 1W3JA 1BGGA 5F7UA 5CPQA 3CGTA 2W92A 4CN1A 2JIEA 4KGLA 5I78A 1E9LA 2E9BA 4A3HA 2FHBA 2XJ7A 2G8ZA 3ZSTA 4KH2A 3T2QA 3WQ8A 3A24A 2DSUA 1ZS2A 3WNLA 4Y7EA 5DO8A 3HG2A 4KRUA 1BYAA 3AISA 1E56A 3VGDA 1NARA 3U57A 3W6MA 1HXJA 1QX1A 3GXFA 3LXAA 2XSBA 4ZE4A 2QHAA 3PBGA 5A6MA 1ESWA 3ZT6A 2JEQA 2VQUA 1B3XA 1WDSA 1EQCA 3N12A 1BG4A 3A5VA 3T2PA 3WD2A 3VGFA 5D4YA 4FMVA 4DM2A 4IUGA 1SZNA 1PX3A 3FHQA 3CV5A 5CZKA 2XWEA 1OIMA 3G6MA 1Z32X 3GXMA 1IZJA 1UWTA 4DUXA 4DWSB 3FXYA 3T09A 4ZXOA 2UY3A 4XZWA 5A6BA 2VR4A 1RP9A 4CU7A 1CGWA 1BSIA 3BVUA 4D6EA 1W9VA 4BQ2A 2WM0A 3HMCA 1GOOA 2VCBA 1C91A 3AIBA 1XV8A 1GQJA 4PTMA 1G94A 2WLZA 3AYSA 2J7DA 1VFFA 5HPCA 4MJ4A 1H49A 5FOOA 3VTRA 4NZJA 1MXGA 3WBEA 1US2A 2ZUUA 2F18A 3AMDA 1B3YA 4MB5A 3NYDA 3UG3A 2XGBA 3CMJA 1UH4A 2IXVA 2GDUA 1NOWA 3GNOA 2WCGA 1O7DC 2BV9A 3ECQA 4E4PA 2OWXA 2D24A 5C71A 2O9OA 1BAGA 3MUIA 4MNKA 4C7DA 5A6BD 2F7QA 3L4TA 1E6RA 2QMJA 4GINA 3A21A 3AS2A 1VFUA 3NIYA 1GJWA 2D0FA 5BXRA 5AYBA 3D50A 1CXIA 4AD4A 2DQXA 1UA3A 1FP8A 5LA0A 2PWHA 3BUQA 2GDVA 2E3ZA 4ZFMA 1V3JA 2EQDA 3LXBA 4FK9A 1E55A 2WAGA 3DYPA 2J74A 5FL1A 3A4AA 4H2CA 4P8XA 4XV0A 5GNXA 2ZUNA 2WZHA 3HJEA 2OYKA 1LL6A 4MB1A 4MAZA 1W9DM 3TTOA 3MKKA 2XVNA 5CQ1A 4B9ZA 3F4VA 3SUUA 2VURA 1E5JA 1Q6DA 1CNVA 2FH8A 3D4YA 4PCSA 3I3BA 2X2YA 3W24A 3WDQA 4UQEA 3NSMA 2JE8A 1JI2A 1A3HA 1JZ7A 2DT0A 2DGAA 3SURA 2XG9A 2CERA 1UD8A 3WNKA 3AHVA 2YBTA 4YHGA 5FKYA 1WZLA 4B16A 4ACYA 1LF1A 4D1IA 5A2AA 4AZGA 4Z2HA 1CGUA 5EBAA 1C8XA 1X6LA 2EEXA 3VINA 6A3HA 4M1RA 1KXVA 3DDGA 2OYLA 4AZ7A 1B1YA 2WMGA 2WHJA 3L4XA 3W38A 4PMDA 3WNNA 4P7LA 1W2PA 3AJ7A 1F4AA 4CKQA 1GQKA 1V6VA 4FNPA 3WNPA 2EADA 1UKPA 1W9PA 4B9YA 1VBRA 5GPRA 4D72A 3F5JA 1V03A 2A3EA 5CGTA 2F1AA 1CLVA 2BNJA 1XSIA 1R8LA 2XN1A 2HISA 4W8BA 2WZEA 1JZ6A 4AZ5A 2W5FA 4BA0A 2ALWA 1V0KA 2WVTA 1CXFA 4UZSA 1UWQA 2GFTA 5DFAA 5CXPA 2IUZA 1EDQA 1TA3B 3B9AA 2YL9A 2J7GA 3TTQA 1JL8A 2WWDA 2WVVA 3QOKA 2VX4A 4HA1A 4WJXA 2WSPA 3N11A 4J3WA 2JALA 5HXMA 2DIEA 2X0YA 3NSNA 4V27A 2VZOA 4M56A 4HPHA 1J0ZA 1IZKA 1XHGA 5LA1A 5JIPA 4M24A 2YA1A 4M82A 1V3IA 4AISA 3WL0A 2CIPA 1NWUA 1JYVA 1MFVA 3SCNA 4M80A 4R5EA 2J7HA 2WYSA 4PMZA 2BVTA 1E73M 4GO9A 3PZVA 1DWGM 2V3FA 3ZQ9A 1ZB5A 4MADA 1GOQA 1ZBKA 3BVVA 4CD5A 1U30A 1ITCA 1W9BM 2Y5EA 3AS1A 4TX6A 2VRKA 2CHNA 2XM1A 2DT1A 1KGUA 3VU2A 5JBEA 1XH2A 1PZ3A 1R47A 3ZJ8A 3D52A 3T08A 3WBAA 1BTCA 5M03A 3POCA 1HF6A 3BGAA 1EO7A 3VGGA 1XYZA 3DYOA 1DHKA 1TE1A 1CEOA 3VIPA 2YL5A 2BHYA 4CVWA 4BQ3A 4F79A 5IHSA 4HZ8A 2CKSA 2WKLA 3TONA 4H7VA 1OB0A 3L2LA 1G9HA 7A3HA 1XH0A 4HU8A 1NWSA 4HZ6A 3TTSA 1GONA 2XIBA 3WD4A 3GNPA 1GOWA 4M29A 1R7OA 3APGA 2OLHA 5CPTA 1BG9A 1KQZA 5IFPA 5BXPA 2VNCA 4AZIA 3W37A 1L8NA 1Q6FA 3EDFA 3TTYA 4U5KA 5D8WA 3T0DA 1KR1A 1WCGA 1SR0A 5M17A 4BCEA 4PUDA 1FH7A 1J0JA 4TVDA 2CCRA 5EB8A 2VO5A 4PMNA 2DH3A 1V02A 4D6FA 3PZQA 2QF8A 4RE4A 4BQ4A 3THCA 3FY1A 2Y2WA 3CIVA 3PHAA 2EAEA 2EPLX 1FFQA 3MMWA 4W86A 2VCAA 1DTUA 2CESA 5HOSA 1OD8A 4LYQA 1WDQA 1CXEA 3GH7A 2ZUVA 1NWTA 3VD4A 4Z2IA 1UUQA 2XN2A 4PMXA 2WMIA 3UR8A 4PTWA 5A6KA 2WLYA 2GJXA 3M7SA 4P8UA 4W87A 1QHOA 5LYRA 1I1WA 3ZJKA 1UWRA 3CLWA 1CECA 2J47A 4XUYA 5IDIA 2ZUTA 4UR9A 2WVVB 1QWUA 2DT2A 1KBKA 1HNYA 1HX0A 2O9PA 1FA2A 2GK1A 3H55A 4HMCA 1TA3A 3F5KA 1CGXA 2F7RA 2JFEX 3TOPA 3A47A 3UG4A 1W32A 2YBUA 1EHAA 4GQQA 2XVPA 1PS3A 1QW9A 7TAAA 4UTFA 2J7EA 4HA3A 5I79A 2WW5A 5GNYA 4NI3A 1HWWA 1WZMA 2DPEA 1J9YA 4Z2KA 2YLLA 1BYCA 3AZSA 1W1TA 3IJ9A 3RJYA 1QNQA 3OLGA 1ODZA 1BQCA 5JIWA 1C90A 3K4AA 4W93A 4W7WA 3OB8A 1MW2A 2UY4A 3IK2A 2EPMX 4UFIA 3WSUA 1WPCA 3WH7A 1CZ1A 4GIAA 2JEPA 3SCSA 3UESA 1W9XA 1JZ3A 3QHMA 3VMPA 1TVPA 3D4ZA 3K8LA 1RH9A 2V5CA 4FF5A 2FH6A 1HVXA 1HT6A 1HJVA 3AOFA 4W5UA 3CZJA 1E1EA 5IHRA 2OWWA 3ARWA 1RP8A 2BFGA 2EPNA 3VIIA 2PC8A 4DWSC 5IFTA 4QCEA 4MDOA 2QMKA 2WZIA 3RMEA 3W82A 2O9TA 4CUCA 3NUKA 3WUGA 5ABEA 3RIKA 4KRTA 4WKFA 1EDGA 3B8SA 2ZXAA 4AMWA 1BFNA 1KCKA 3UEQA 1OINA 2FYVA 3E1F1 3PZMA 4UQDA 3ZT5A 1UYQA 1D2KA 4CVUA 4CCEA 2YDQA 2VZTA 2ZUWA 3DYMA 1E6SM 1B0IA 4NXSA 1GORA 4AD0A 1JG9A 1WO2A 3II1A 2WNWA 4J3VA 2X2HA 3W81A 4FNQA 4HU0A 4S3JA 3VIOA 4J27A 1LG2A 2DH2A 3QOMA 4UQAA 1J10A 3WDPP 4LPCA 1CPUA 2YFOA 2CKRA 3VPLA 4JCMA 2W67A 1WB0A 4M8UA 1Q4NX 4HOZA 4AY1A 2WBGA 3D5HA 1KCLA 4M81A 1DWAM 1JIBA 1JF6A 1TQUA 1K9DA 2G3IA 2ZWYA 2W61A 3MSGA 1S46A 1V0NA 3BSHA 1W9UA 4ATDA 3W27A 1Q6EA 3CHDA 4FLQA 2WBKA 3VNYA 3ARUA 3IAPA 4D6IA 2F7PA 4NF7A 1Q6CA 4GI6A 3GXTA 4UOJA 3GH5A 1LG1A 4UFKA 2YFNA 1CWYA 3WMCA 3RM9A 2G3JA 1UASA 3THDA 3WD1A 3L4ZA 4F9DA 1QNRA 3VIGA 3AHYA 2J4GA 1PIFA 2X1IA 4L4PA 2VZUA 1BLIA 1FHDA 4QDMA 1HJQA 3WF2A 3WEMA 1E0WA 3PZ9A 1R86A 3A22A 2CITA 2VJXA 4MPKA 4ACZA 4PMYA 2PWEA 4Q7NA 3QGVA 3GTNA 5A8NA 1VFOA 3ZR6A 3SUWA 1LLOA 2WMHA 1JYXA 1E71M 1QHZA 4AEFA 1E6QM 4ZEPA 3CZKA 1GOIA 2BY0A 4JFWA 4JFSA 2AAAA 2W62A 1VJSA 2ZICA 2Z1KA 3WMSA 2VT0A 1UH3A 2J25A 3CUFA 1R85A 1HVQA 2IGTA 1B90A 3ARXA 5I77A 3SIMA 4F9JA 2G4FA 4JCLA 4AIUA 2ZXBA 2J78A 3EMQA 4N42A 2PBGA 3SCPA 3RO8A 5D9NA 4AYSA 1GNXA 1R33A 1JNDA 3I3DA 4GZIA 4ATLA 2WPGA 4PBGA 3ZOAA 4IM4A 4GI9A 4IISA 1UD3A 3ZT7A 1B3WA 1GUVA 3LXCA 3KWXA 5D9PA 3O6AA 2DSZA 4ZXLA 5BYWA 4BZYA 3RM8A 4HOXA 3L4UA 3LPPA 1EOKA
chains in the Genus database with same CATH superfamily
3DJ9A 1FH2A 2X4SA 3M8OH 3USZA 3WQWA 1YEHL 2YL8A 3MSDA 3FF8A 2EGZA 1MFDL 3IDIA 3OEXA 2VERN 1YDPA 4MD5A 4R7XA 5IEHB 2ZKWA 1R1CA 3EEGA 1I7TA 1ZT4A 3IDJA 3TP4A 3U36B 4AFYA 1H3UA 3UZQB 2J8UF 5AW2B 2Y24A 4F8XA 2H6OA 4KK8C 3T0BA 1GOMA 2ESVD 3DFYA 1QPKA 3FCTB 3KBWA 5A2FA 1FC2D 4J28A 3GDRA 4PRPD 1NSNH 3T2NL 2WM1A 1MYRA 4LNRA 4XCNB 3DIDA 1XSKA 4NQSB 4MLSA 4ZXBD 4TMPA 4FYRA 2WJFA 2ISWA 5AHIA 4LCWB 4DGYL 3BANA 2Z4QA 1IQWH 2OG9A 4BKNA 2LFGA 3ZYOA 1R3HB 2P8MB 1P0SE 1QOXA 1Q0YL 3K46A 2HKHL 2IQAB 4MLIA 3Q67A 3ARGC 6CGTA 1ZEAL 4YMPA 1XDLA 5JR1L 1J5HA 3KZPA 5BZAA 1UZHA 3GIVB 1SQMA 3IU4H 5D7JB 3CFKB 3QJQB 4L65A 3QXAB 2Z7KA 1YNKL 5GRYA 2Z28A 1WJ3A 3SUTA 2XV3A 1IIGA 4XVJH 5AHNA 5FEWA 3RX8A 2X87A 1RSCA 4AGLA 2XSXA 1UR2A 3N19B 4YDNA 1I3RB 4A3YA 1U8CA 1VS1A 3KPNA 4PAZA 4G8AC 4LESA 1FBIH 4W7VA 5IOPB 1NCAL 3E0WA 4KTDL 1K4CA 4H88H 1K9FA 1RJLB 1RXLA 3IGFA 2ARJA 4CD7A 4JN1H 2J24A 3H4XA 4XSLA 4D1JA 1XC6A 3AT8A 3IANA 1TLMA 4HNOA 1O1ZA 3KVPA 4GS7B 3ANYA 3MQIA 1LT8A 1M53A 1PTZA 1A5NC 3BLDA 2V3GA 5HI4D 3E5PA 3T0XA 3HBZA 3EYUH 4WWKB 1FWSA 1IBGH 4Z3JA 5SX5K 5CLZA 1CYGA 3I6LD 2GJZA 2BXYA 5IQ9B 3N04A 3IK4A 3P3RA 1VGEL 2A5UA 3NEEA 3MMUA 3I85A 3LIZL 3APYA 1M05A 2CLVA 2NQ3A 4HFUH 3VGEA 1ZDSA 3ZE1E 3F4WA 4JIIX 5B1JA 3VKBA 2CHZA 4YR6A 2F5BH 3LEVH 4L3CA 4U1SA 4WFED 4L3EE 4FFVD 4H5SA 5D9SA 1IXNA 5LNWA 1LGVA 3FU9A 3MUGB 4ZB2A 1GVOA 4IBWA 2ATSA 1H3VA 3P8IA 4WI3A 2UWFA 4UM8B 3P2BA 4CD8A 2YDRA 3KM1A 4YDMA 5E5RB 2DZPA 4FQXB 4GYBA 3HE7C 2G60L 3PFMA 4G8GB 3DO7B 3PTMA 2R1XB 1AS6A 2N7BA 2DTSA 5C6TH 4HHLA 4LVBA 2I69A 4BV1A 2E46A 2R0ZH 4F1SA 1EPVA 3QQ4A 2C9SA 5T9CE 5EFIA 3LHUA 4GSRA 3TO2B 4RISL 4KXBA 1QVOB 2AQ3A 2ZOKA 2EPHA 2OZ8A 4UI2A 4HIPA 4H9XA 3MKCA 4DJFC 1TCMA 4OQTA 3H85A 3VXOB 1R0AL 1MQPA 3CDCA 4RFOL 3CUPB 3X3GL 2R8SH 3HUJF 3QCVL 1ZBCA 2CC0A 4DB7A 3WGVB 4F3HA 1A3ZA 1UD2A 4PJ8D 4R7WA 2N0KA 5DVKA 1LRNA 4IIGA 3KL5A 3MBFA 4I8YA 3T55A 4C6OA 4FP8L 3QDHA 3VXPB 4RGND 4L29B 3IJHA 3QC6X 3AZRA 2E76C 4RMTA 5HHMD 1UR9A 2QPFA 4KKCC 1BKHA 1WZAA 3DVFA 3HG0A 3QJOA 5EZOL 3N55A 2PYEB 5SWZB 1DBJH 3ZTJH 4UDUA 2FO1A 3MPGA 3BAWA 3LZLA 1K8YA 4PTMA 1JXKA 2A4ZA 5CEYA 1JCTA 4KWUA 4JIPA 2FZ3A 4PCFA 5D71H 2PYEA 3CDFA 2MPAL 4NNXA 2IAMB 3UERA 4DF9A 4K5OA 3CL7A 4ODUB 2G41A 1UXWB 3CO8A 4NAFA 3OKMA 1HSAB 3K72A 4GFXA 4QRRA 2JBMA 3CFTA 4IMLA 1H3TA 2F61A 2R0WH 4GMTH 2QKIA 4EVNA 1YLVA 3BG3A 1C9SA 2UZXB 3EPNA 5D2VA 3P0VL 5HSFA 1F8MA 1E4KA 2WC7A 4XO9A 4WHTA 3S3DB 3VWKD 2HJLB 1U8QA 1L9MA 4DW2H 3AM8A 1XIJA 1B2WH 3QZAA 4LS2A 1YMHA 3UYRH 4UDTB 1CT5A 3P54A 3SCTA 3BCJA 3M64A 3NXFA 1FFRA 2IXUA 1O5RA 3C8FA 4JIQA 1HGWA 4YTSA 1KFEA 2VI0A 3WKQA 2E8ZA 1BQLL 35C8L 5K59E 5HWJA 3M5XA 4DJFA 4JG9A 2AXWA 3MJYA 2BINA 4IP5A 4X7CC 4YHYC 1X7IA 3W2LA 4AMXA 5MEOA 2QLYA 1P5BA 2IEPA 3AHTA 3L5JA 4WWKD 4KC3B 4NO3B 2B1AL 3NRPA 2ZWKA 4HZ1A 2HPIA 1JRHH 4KKAD 1MW3A 2FJKA 4DWDA 4PP1C 1Q9OA 1BRLB 1RHFA 5FK9B 2QKSA 4L3FA 4OD1H 4KQ3H 5C55A 1NMCB 4NGHH 4HOMA 3G6MA 3IPFA 3L81A 1BGAA 3GT6A 2E40A 1G7VA 3LH2H 2HXTA 4OZFH 2OFJA 2UUDH 5GGTA 2AQPA 5IVZB 1XDJA 5CEZE 1FWJC 1KTLB 2OLAA 4FTVB 5B1CA 3OZOA 4UINH 3CQQA 3DX5A 4FXRA 3C2FA 4NIKB 2DQ6A 3TYFB 2AAMA 1JTOA 1SXSA 2X38A 5FV2A 2EIKB 1OAJA 1H3PL 3UWVA 3OGRA 5D03A 2VDML 4PL2A 3NP4A 3D39B 2C0HA 3P84A 3BW9A 4IGBC 3M5VA 4PTXA 1HWGB 4WEBL 3SGJA 3SY1A 5F7HA 4AHQA 4WHTB 3T3ME 1V3LA 3TSDA 4RWHA 4AMAA 2OMYB 3KDOA 5F8RC 4DO5A 4GRMB 2YSWA 1SQ2N 1V5JA 3NFSL 1C92A 4WI5A 1P5VB 2QSCH 2VRAA 2XZAL 3D08A 1UT1A 2W0FA 1SSDA 4QQ3A 4YWIA 3ECBA 2OX1A 5CJNA 1J5IA 3UWYA 2XHYA 4WI7A 5I5RA 4NKOB 5BJTA 1U93A 5F3FA 2AGKA 3TF4A 4CN4A 1YEEH 1MEWA 1UOZA 2CBVA 3QC0A 4L9YA 1G5GA 4UFHA 3I9GH 4HQQH 3QEGH 3KDMA 1XG4A 1TCRB 4G8IB 1TQBB 1CZ8L 4L05A 1FUYA 4P8WA 2X4SB 3JZYA 1F1DA 4FFYH 1MUCA 2AGTA 5IHHA 2OKOA 1OC5A 2QUVA 3VC6A 1YY9D 3SDXF 1TG8A 3P11H 4MMZA 4CJ1A 3TN6A 4XR8C 3T71A 4DUVA 1ADOA 4GZJA 4ZCWA 1TQSA 4G7SB 2EYTB 3FF7A 1JDAA 1U3HB 2NY5L 3UZQA 3MS8A 2Q8BH 3TVAA 3VM7A 4BF7A 4HDIB 3SSGA 4HUXA 4DN4H 2E27L 2Q2EB 3OLEA 3CMGA 3SE9L 5JYMA 2G3NA 3U4BL 5KVFE 1HOCB 3BOVA 4J1OA 1OB1B 1CVRA 1MIEH 4DGVL 1HUVA 4HZ7A 1IKNA 4LLUB 3ANUA 4Q4IA 5TFSH 1FNLA 5F89A 5J4MA 3ALFA 5LUMA 1N6UA 5EIIB 1XTLA 4ZOAA 4XX6A 3U30B 4KUZL 1GPFA 3HV9A 4YL2A 3QDJB 4WGHA 4Y2OB 3LERA 4YHKH 3V6FB 3TV3L 3FUNA 2A83B 4BA8A 4NLHA 3OZ9L 4QE1A 1MW1A 1CDBA 4HJGB 3SDYH 1M05B 3S2JA 1KC5H 4F8TA 4V28A 4YOKA 4RNIA 4XSMA 2R9RA 2APXA 1EH9A 2QCEA 4U5IA 1IMHC 1E2ZA 1JK8B 2RA1A 4JHBA 4KCWA 5DR5L 3HE7A 2Y6SD 3IDMA 5IVXE 5EWIL 1AHKA 4K94C 5FYLE 4A1RA 4OZFB 4FA8A 4Z3HA 3W73A 1DWHM 4YVPA 3NNTA 3FRUA 3BLFA 4Z0SA 4P2CG 5E1GA 3BVNB 4WCYH 2EDRA 5BZDA 4Q56A 2GL5A 1KFKA 2W66A 3DFPA 2NY1B 3TBSB 2X6AA 3KVJA 3C5SB 2N4IA 3O81A 4ZNCD 3R58A 5LG6A 3L9RA 5B1JC 3U4BH 5JPMA 3KG5A 1UG9A 4RDZA 1GZQB 1A14H 4O5LH 2FECI 3W9DA 3EDDA 3KPPB 2IFFL 4QWWD 5EUKA 2VQTA 4FJYA 1MAMH 3QZEA 4IMCA 4EAYA 1F2XK 3L1OL 5GGSY 2CNCA 1OGSA 2AEPL 1JNHB 2D1ZA 3RPIB 5A2IH 1HZLA 1O9VA 3BP7B 2YO3A 3Q0HA 5F9WC 1U8NB 4J1UB 4M9OA 1MLCB 4JFOB 5JW4R 5JHAA 3GNXA 3CZEA 3IFLH 1P7BA 1J1XH 4MHHI 5I1LA 3US0A 1SSGA 3HV8A 4Y4FD 4YHPA 1HXMB 2YSSA 3HC3L 2W91A 2EPKX 4TV3A 2R2HA 3JSSA 3MHUA 1UKQA 3MXVH 3OJDB 4JO3H 4EUPH 2BHUA 1W0WA 1AH0A 2C1OA 4R90H 4XNUH 1BYOA 1R3SA 3OZPA 3W4RA 1PKQE 4PJIB 5PTDA 1WWWX 3W1ZA 3I02B 2XYCA 1C29A 1UC5A 1HESA 4XGZA 4LSUL 3BK0A 4EDWL 4BELD 4MSSA 2Z1XA 5IBXA 5I00A 4R7DB 3D18A 1ZEAH 1UD6A 2FPTA 5CIPB 3S96B 5D5ME 1U3NA 2FVLA 1HN1A 3GSOB 1UM6H 2F74A 2FBJL 4FQJL 4S3GA 4N2AA 2R14A 4N4YB 2FVNA 3FO0L 2OQHA 1GYNA 2AF2A 3ISYA 3L7FA 1E8WA 4C6MA 1VBUA 1YY8B 3MDWA 4AGMA 3L45A 2FZ9A 1PZ1A 4Q4EA 1KACB 3QIUC 4D8LA 4MNMA 5I1AB 4PMEA 5DC2A 3QHOA 2JF6A 1OF0A 3AG2B 2BCMA 1MLBA 2VR5A 3MV7B 3LRHA 5D72H 1SVBA 3UJTH 4JO5A 3E0VA 3OM3B 3RI5F 1QBBA 4PH6A 2YEVB 2QVNA 2NSQA 2EDEA 2LHAA 3FUFA 4JQXC 4LV9A 3EX6A 1TSRA 4U2YA 3U1SL 5G1TA 4XIMA 4XRCA 3AB0B 5IW3A 1FWHC 3FSZA 3IU3A 1DANU 3R06A 3D4GA 3OSKA 4LLDB 2A4EA 4JFPB 1MDLA 5LHEA 1F58H 2VDPL 2CUHA 1XZ0A 2MKLC 1NF7A 1UZDA 3EXTA 3S5OA 2AK4B 3DBNA 5DELA 4EPBC 2OZ4H 1FO0L 4LVHC 4ODTL 1FWCC 1S9WB 5EIQA 5SV4A 1R46A 1X7QA 4FL4C 4ZZKA 2Y4SA 1TREA 1XUUA 4ZYKA 3HZVA 2QQNH 2XWTB 4KBPA 1LNUA 2XU2A 3P3YA 3NJNA 5E6RB 2QCFA 1N67A 1U58B 4KVCH 1ICTA 5AOIA 3ZY7A 4ML9A 3C09C 2B77A 1SZRA 1KENH 4POUB 2BSTA 2ZXCA 3IDGA 3QWNA 3NO5A 2GT9A 4P61A 3AU2A 1EMTH 4LLWA 4S2SA 4XP1L 5DJDB 5KYUB 3V8CA 1GZGA 3ULSA 5C9WA 3U2OA 4N86A 1BAWA 3DXAA 2CR0A 3AQUA 4HLZG 4AZCB 3O2DA 4WO4C 2R2EB 4YXLH 3LKOA 1BVKA 1N68A 1LWHA 2ZCZA 3JV4A 3TVMB 5B8CC 5I17A 1K4GA 5EO9A 4GHRA 2C9UA 2V9UA 5IQNA 3H12A 2V67A 5J5RA 3TC7A 3SPVA 3HA1A 1U9KA 2ICWJ 4AIXA 4EKXA 4DEPC 1U93B 2OM5A 3BH9B 1V6XA 5F7BA 2ADJA 3HZYB 3PUGA 2BVQA 4LSSH 4PRNB 4FL4B 3SYPA 2NUWA 3ZO9A 3GK8H 2XUCA 3KHDA 2DQEH 1D2PA 3VJ6A 4KTEL 3KMDA 1WEJH 2C7FA 1DQIA 2YC1A 4JRYB 1G5AA 4DQOL 1WD9A 1YEWA 2QPUA 3V0HA 3MNMA 4DPQA 1P5UC 4JW3A 2MOGA 1RPUA 1RZMA 5HINA 2FRGP 2BVPA 2G9HA 1T1WA 3DRQB 3ARVA 1VBHA 4UNKA 5HVFB 4GUPA 3IV8A 3KVQA 2MQ3A 4S3KA 3AHXA 3GS0A 5HJ3B 1P6BA 3BJFA 2JK5B 5EIVA 6PCYA 1UADC 1WBHA 5AENA 1EA0A 5EORL 2V2XB 1UKSA 3D85D 4JFED 3P69A 3LNDA 5I23A 3Q8BA 5IROA 3L5XH 3HF3A 1W3NA 2MEJB 4L4VE 3D33A 1TO4A 2HQAA 5I2UA 3WEOA 1B4EA 3FCUB 1MZZA 4NRSA 4XCCH 5KYUA 3K2MC 3D12B 3HM7A 4PUUA 1SFSA 4WI2A 1E4IA 4FYSA 1U5HA 2A0NA 1BD2E 5E23A 2YOAA 2C6QA 12E8H 3UWEA 1AXSB 4JFEE 1A5SA 5IESL 4V1DB 3GUWA 5KSWA 3EYPA 4LVOB 1B88A 3G9AB 4V2BA 2R7EA 4P5TB 4UWQB 3A3XA 4EI5C 1F9CA 1JZ5A 1HCYA 1XGRA 4UT7L 1A9BA 1OT4A 2I9LA 1SOQA 2QFRA 5FC9A 3K0WA 2LU7A 1CURA 1X1OA 2WKOF 3QJXA 4F2ME 3UNTA 2AK4D 3BUIA 4NB7A 1HILB 2ZCLL 4PG2C 4YHLH 3ITOA 4YLWA 4C1NA 5C9XA 1GKEA 1MF2L 2NY6D 4HGMA 4C5ZA 4YTRA 1NLBL 4OLVH 3UR2A 5M7QA 1HJBC 3NTCL 3TNMA 4YWGL 3I9AA 5T1DL 1VLWA 2ADYA 3MP3A 1PY9A 1T1ZA 3IETA 1TPEA 1PY4A 3BCFA 2J43A 4XCYA 4XPGL 2B3RA 3KW7A 5TD4A 3IRSA 2VDPB 3CYJA 3QNFA 1A4BA 2B2XH 3WDJA 4MJHA 4MF4A 1MOEA 5FYJE 2PDKA 3UGRA 3VFNA 3RVTC 3A4XA 1ONEA 2WTRB 2YSSB 4H8HA 1LDCA 1YN7A 2JNZA 4HLZH 4PGLA 3MRHB 2X7WA 3LD5A 1CICA 4PJ8C 4RDQG 5DUPL 2E9MA 3CWNA 1TITA 4RDYA 1MCFA 5K1NA 3V5HB 2NUPB 3VFSB 4ALAH 1PZ2A 3BZEA 1N8IA 5FJTA 3ZE0B 4CADA 3QIUA 3OZMA 1AQDB 4U4BA 1OCBA 1E9QB 2BOCA 1KGYE 3P3SA 2WJZA 1XIWD 2WAQA 2DQGH 2IH1A 1T0MB 3D18B 5DMYA 2C4FT 3T8XA 4OD1L 5I73B 5F9JB 3L3HB 1JNEA 1X7FA 2B31A 4W9JC 3TIEB 3V6BR 2ZPKH 4X6DA 5EEVA 4JFFB 4OIFA 3GC3A 5K3VA 1JGEA 1FO0H 8RUCA 4G83A 2IKJA 5EU6B 4W6YB 4WRLA 1WH0A 5T3XE 5C54A 2IV8A 3U4AA 4M8QB 5AFAA 1F11A 1NC4A 3VX0A 5FKPA 3AY4C 2PWDA 3CJJA 5LG1A 1TZ8A 3WE6B 1BWKA 4HQVA 4AX7A 1KV8A 1M7DB 1QNSA 4F9PC 1TQVA 2HFGL 5IFAL 3O8XB 3VOIA 3WNOA 1A5AA 1IGFL 4KKBD 2V68A 1V3MA 4IRSD 4O4WA 2IPGA 3CLMA 1F11B 4K3EH 4F58L 1AFSA 3O06A 4HPOL 4L8CB 1RIHL 3BXWA 3QH3B 3QXTA 3BGFC 4NC1C 1EX0A 5HGDA 4X6DE 3SRHA 4WZ9A 3UBPC 4HJIA 5JU6A 2ZOXA 3GG1A 3NJ3A 2VN3A 3FU5A 5MEOB 2YPLB 3QVQA 1I4FB 2IPTL 1XF2A 2XZQL 3EGJA 1N64H 4RFEB 3BVXA 4M7ZB 3N6JA 3BZFB 4Q6IC 1GTNA 3HNVL 2FSEA 3ZTDC 4L6DA 2W9EL 3ZE1F 3GI8H 4KNSA 1IFRA 5DD3L 3BP6B 3FAXA 3X3FL 2YHGA 1P6FA 2BRRL 1U21A 3QIUB 2I7GA 4EAMA 4WLCA 4NYYA 3UZJA 1DQJB 3MWAA 3ARGB 2H41A 2DIAA 3N42F 4RMBA 1UXMA 2I14A 1DSFH 2OU4A 5HK4A 3W1PA 1M6UA 4XNXH 3S3BB 1GZHA 4Q9BA 1ZNNA 2JTYA 4IIQC 2ZQ0A 3QW3A 4QTIH 4HCDA 3MYOA 2PGFA 3UCQA 3WQPA 2AV7B 3D6GA 4EVNB 4GMEA 4Q2ZB 5JQ6H 4LAMA 4S3BA 4HCRA 3T7VA 4FFTA 2AGJL 4YDZA 5IEKA 4QYOB 5KANG 4QJ4B 3O6YX 1NFGA 4PL1A 2IXQB 2P88A 4P46A 1EAPA 4FXKC 3OQ8A 1NGXB 4JFYB 4JPIB 2X4OB 4DP9X 2VKZG 1Q1JL 3U7YL 1SMAA 3AAZB 4YHNA 1AZ2A 3QW4B 3LYEA 2H8PA 2H2SC 1MFAH 3F64A 5TQ0H 1J9QA 4F7MA 3CPRA 4LVGA 3W22A 1O1HA 2BVYA 5I17B 1KN2L 5EZLB 5KJRH 1BF2A 1O0VA 3MRFA 2NXGA 4AD5A 5CGQA 1EIXA 1NTHA 5AW4B 5E6IA 5DZAA 4AUUA 5IROC 4B9CA 1P0KA 2CW6A 4OM0H 5BO1H 2K6ZA 4RV8A 5BOJA 3GKAA 5CJBA 5E6SB 2ZVRA 3FTVA 4WU5B 1MJUL 1TETH 5E03A 1RVFH 4JFEA 3VCNA 1QKZL 1VJZA 3R0NA 5E5CA 1F07A 2R7EB 4P5TA 3QISA 3W29A 1ZK9A 5MI0C 2DU2A 12E8L 1KGCE 1Q0XL 4BWUA 3SY6A 4LEEA 1UKTA 5KTEH 1QXLA 1IJNA 2CKBH 5GISL 3VXNB 2F38A 1BPVA 4HXAL 4XQ6A 5EB9A 3MLZL 4Y4KC 5ICXB 1AHWA 3GSXA 4KUCD 2N7SA 1HYSC 1KXQA 3THAA 5DYFA 3TBVA 4A2DA 1NFDF 5CG0A 5B7MA 4QRPE 3BAXA 2BVUA 3JWDH 3QXBA 2O30A 3T1FA 5CJXA 1YEDB 1CGYA 5FOJA 4M7ZC 5ACZB 2UVFA 3W2KA 1BJ1J 4JHUA 4GBUA 3ARFA 3NL2A 4UMAA 1GZHC 4XX1E 5JOPE 3A6BL 3GQFA 4KWSA 1S8DB 4QYAA 1DXIA 4X6BA 4GGHA 5ERWB 2GUBA 2IOMA 1NLBH 2NT1A 4WU7A 4WAFA 2W65B 3RB5A 5TDNB 3DGCR 1AZVA 4J2PA 4JO1L 3VXUE 1HEZA 4ODHH 4QOKB 1XX9C 3MCNA 2ZP9A 3FCSB 5DJCA 4K55A 1IAMA 4OOZA 3W56A 1MFEH 5JYLA 1KZQA 4NQXB 2DJLA 1E9YB 3FFOA 4L7ZA 1EBAA 2VR3A 1XG3A 1NGWA 3C4UA 5ACMA 1I1YB 1M6JA 1PG7H 3A4EA 4LSRH 2YPLD 3H53A 3W07A 3HI1A 1IKNC 4NHCH 5D32A 3UPMA 3B7TA 2GZXA 1JPST 2YJQA 4R7NA 2YOCA 5GJPA 1W72L 3GTXA 1J1OH 1YEJL 4NM4H 3WHXB 4PVBA 2I57A 3MLWL 5FF3A 3O0RL 2YLAA 2QSVA 2DLGA 3MJ8B 4LL1A 1T7YA 1U2CA 5TTRA 3RVXD 5JZ7D 2XIJA 3QNYB 1IB5A 2AJYL 1ONQB 1X9UA 3HS0C 4FZ8L 4JZJB 3RU6A 4EUPA 2DEYX 2XRAL 3C5ZB 2QQ6A 3WF4A 3BKCL 4LHUB 4PJ7F 2EDYA 5MKGA 1DR9A 1IAKA 2Y63A 1FL5B 2QVKA 4Y1AB 4MKSA 5L88L 3CWGA 1F05A 4PGEA 4LPWA 5CGBA 4N1CA 3B4YA 4YAQB 2BY3A 1YYAA 2FD6L 4YPGA 1NDWA 1M3JA 4YPJA 3BG5A 1LWIA 3K1GA 4LF2A 1CICC 2BNQD 3AVEA 1YRKA 2JWYA 2OJEA 3MV8B 1IC7L 4J12A 5C86A 3FJTA 1YIXA 3BLBA 1YXDA 1C7TA 1YG9A 4WTZA 2NY2B 3QORD 1QYGL 2N3JA 1M71B 3JZUA 1HHKA 2XXGA 4J3OD 2AXHA 2G5BA 1N6VA 5CIPA 4G2AA 1NUDA 2HFFB 1TJIH 3ME0A 3S96A 1JAEA 1TRIA 4N5EC 1HJXA 2OCFD 4JUTA 1CGSH 5LAXA 1W3KA 2K6WA 1SBBA 2QGBA 1DXFA 4MDRA 3MUCA 4HETA 5CSYA 1WAAF 3HIZA 5CJOH 4NAFB 4W88A 2VLJA 1T8QA 4LEOA 2OMTA 3BUBA 1KIPB 3P4MA 3LK6A 4QJ3B 4TNVF 5CR1A 3KRUA 3TNNA 3PWVB 2M1KA 4UWMA 3CCHA 1NBYA 4IMEA 4ILDA 3ALGA 3VG9B 1DBMH 4W89A 3WLBA 5L9DH 5E9DB 4D6DA 3GSUA 1JDDA 1BF6A 1RZ8A 3QAQA 4GKSB 1B3OA 3VKAA 4W4NA 4Z7VA 1KQYA 3WE1A 4QYOA 4HD5A 4XNZB 1CXHA 4KZ0A 4YHZL 4Y19D 5KVGH 4JYFA 2FT6A 1DOSA 3SBFA 1S7RB 4DLFA 5C07E 3AXIA 1Q2SA 3RO6A 2F53D 2ONEA 3VOHA 4L64A 4DPPA 2VZ3A 1OCWH 3HQNA 3QSKB 3OKDB 3UFIA 1N7KA 1IL1B 3PNRB 3MCLL 3PJSA 4LVEA 1IT0A 1CLOL 3FU6A 1QI4A 5LNDA 2EDOA 2VQ4A 1YQVH 3K71B 3T44A 4AH2A 4A67A 4HKXB 3ARPA 3CFUA 5T1MA 4B9PA 2XHNA 4GNVA 4JS3A 5HPOA 3WMBA 2WNKA 3MRFB 2XKNA 4N6EA 2UY6B 4GKZA 4QXVA 3RU8L 2HEJA 1Z5YD 1TVNA 1T20A 2HK0A 1KXVC 2VX5A 1OHZA 4XNYH 3KOYA 3FCPA 1RURH 1VYPX 1CWVA 1WXZA 4LOUD 3S8FB 4Y9AA 3IKCB 4NRYB 3CXDL 3RE0A 3O2DH 1BVZA 3LHPH 3ENEA 3VDAA 2OT0A 5C0QA 5G5DA 1N8ZA 1PTAA 2NQDA 3M46A 3V18A 5IROD 3MGTA 4ZUVA 2Z8VC 5JIQA 2Z31B 1NANI 3MHZA 3QQ9C 3DHDA 5ICXA 1KYUA 5KBMA 1T5AA 3SCMA 3EAKA 2GK1B 4C7FA 2R69L 2VDKL 1V7AA 3B5HA 5A7EA 3BE1L 5E6ID 4MSWA 5IBLD 3ARBC 5EF3A 1VDGA 1YEDA 3F7VA 3FAWA 1MCRA 1F3WA 2FX9L 1KXHA 2F7OA 2BWIA 2MSPA 1ACZA 2V5JA 3S0PA 1XIWA 4FI8A 3QXAA 5DFWH 3ZGIA 4WK9A 1U2YA 1SDYA 3W1LA 3RVVC 3OKOB 2EG8A 1UZ4A 2AKZA 1KY7A 1HHJA 32C2A 3IS1X 4ONGL 4PU2A 1AQHA 3CAVA 2HJFA 5I1DA 3FCSA 5DJCB 1OLLA 4BI7A 3MLTA 4U3SA 4DZBA 4R9HA 1RJLA 1J12A 5C0EA 2I5QA 2EDTA 3MLYH 1S38A 1G7IA 3HRZA 5IZ7A 3IUIA 3MX0A 4UNTA 1QA9B 4NJ9L 1UJ3A 3F84A 4JO1H 4U6VL 1Q9KB 5AVSB 1QSEB 5DHXB 2CD0A 5DF0A 5CAKA 2OXGA 3CE1A 3M1OA 1YPZB 3HI6H 5DA4A 1A02N 2CNYA 3G5YB 1PE1A 4GXMA 2HT4D 5J8OA 3UH8A 4IK7A 1NGXA 3FB6A 4EK7A 5I75C 1NFDA 4Z6AT 4WJ8A 4O58L 1XLIA 4NUWA 1QAPA 5F89B 1ZQ5A 3Q44A 2XV2A 2Y1HA 3T78A 3Q2VA 4KJWC 2W94A 3QFJD 3AC0A 4P5TC 1AGDA 1TTCA 3CFIC 5AB2A 2J5LB 5E8DH 1Y5XA 1JZ2A 1EJRC 3I65A 1NCBL 2LVCA 4IW4C 1F2QA 4RAVA 2D8KA 4OKVB 3D46A 4XC1H 1WLHA 2OMUA 4PJGB 5KVGE 1LEKB 3QEHA 1EAJA 3FHAA 3O6FD 5FAGA 5BZXA 4DN1A 3CZFA 5EBMB 2X1TA 4LW7A 2VDOB 4J4PA 3ERPA 1H63A 5DCCA 1P9MA 2YZ5A 2DWSA 3CL6A 2E9LA 1F76A 1LE5A 1KC5L 1CVSC 3ZDXE 4OCXL 2CHWA 3QZNA 4MAVA 4Z7WF 1EHNA 2EEDA 4Y9EA 5B3NA 1QYGH 5CD3A 4N22A 3GY1A 4QXGL 5JHDE 4PB3A 1UWXK 2X1UA 1V27A 3IIVA 3R0DA 3VNDA 1SFHA 2B5IC 43C9A 5EOCH 5CPNA 2DWDA 1YBQA 3VOGA 4Y5VC 1MJ8L 1YN6B 2GUOB 2CK0H 2F0CA 3QC5X 5E24E 4WWID 1EX5A 3ZLGA 1JGDA 3QARA 2WOBA 3VI4F 2AJXH 2O7SA 3TCEA 3EKZA 3OA5A 3QUYD 3MU7A 4N5UA 2Y1AA 3HZKA 4Q89A 1US0A 3JT2A 2JKEA 3W1TA 3SDCA 3W1RA 5HBFA 4RAHA 4Q6IA 1I2OA 1Y8BA 4NRRA 3GMMA 5HHOA 4YZFF 1FO0A 3ZKMC 5FPIA 4NFCA 3G1DA 3V7AE 4IJ3C 4AE1A 2D3LA 1EC9A 3P11L 5B39B 3ITGA 1T21B 4N26A 2ZZ5A 1B0GA 2BIQA 2HXAA 4YDJB 1JD7A 2WD0A 1AP2A 3U6XS 4EANA 3ZIZA 4QHNA 1IVLA 2UZXA 3GH4A 4LRTA 5E6UB 4FMKA 1IM9D 2CUMA 4KGJA 4GD0A 1OJXA 4GG6B 4OZGB 1DLHB 3ARFD 4E42A 1VRXA 2MNJB 4ODUA 3KTCA 4TKWA 3QNYA 4PIRF 2GKIA 1T0MA 4OM1L 5C08B 3SN6N 5CD5C 5I6OA 1L3WA 2XT1B 1T4KA 5DYOA 4APQC 5LGHL 2FB2A 2AJSL 3QQ4B 1GYVA 4JHWH 4A04A 4P9ML 4YVNA 3OC5A 2DI9A 4M5SA 4GJIA 2ZKXA 5JUVA 4MYAA 4P23A 3RDTA 1QSFE 5IQOA 2DVTA 5E8OA 5IB4B 1KNOA 2MNUA 3SJVA 15C8L 3TO4B 5BU9A 4IMAA 1R3WA 1CR9H 4L3EA 2AEPH 3VW3H 5JIDA 1T8XA 3IWPA 2J8FA 3STLA 1XH3A 2EC9T 1CIUA 2GK0A 3RWDA 1UUNA 2GCYB 3V4BA 3GSVB 2YGOA 1JPTH 1CQYA 2X09A 4YHZH 4QHLA 5GJTL 2FJFA 3MMDA 3WKZA 3S2MA 1IR1A 3GU2A 1K5NB 1T6WA 1FI8C 4PB9H 5E5MB 4AXNA 3APFA 2NR6D 4O10A 2WC3A 3KYKL 3GF8A 5DZJA 4HJ0D 2CO7A 4H6EA 3M0YA 4JL2A 3C61A 3G1SA 3PSVA 3BH9A 4NEHB 3FO9A 2OJ1A 4HH8A 5GS2H 1S3HA 3TYFA 4DYKA 2IANB 3WY3A 4JTHA 1Q7ZA 3B9VA 2P5EB 1JGMA 2FZ3B 3WKPA 2D69A 4WTQA 4EDWH 1JHKL 3GHSA 3SUVA 1IE4A 3U1QA 3SDDC 1VADB 4I89A 4AQ8A 3WY1A 8FABA 1K77A 2NQHA 4GIYA 4PTUA 5BOFA 2AQTA 4L61A 1UR8A 1KN2H 5C09B 3RZCD 5HJ3A 4A8RA 3P0WA 1YVLA 4JFFA 5HI5C 1A6VH 1PD0A 1N55A 2VUYA 2RJHA 4MQTB 3ROLB 4M1BA 2B2XL 3NDYE 2V2WA 4QHMA 5T1KD 5I1JH 3NSFA 3FYEB 2ENYA 3GFZA 5IFJB 3VE0A 3PAZA 2B4CC 4M8QA 1JERA 4TRPH 3VGHA 2AHIA 1EZ2A 3MP4A 2OWCA 2VXUH 4PJHE 1B3ZA 3N2CA 4E6MA 2BS9A 4H8WC 4TVPD 5L2KA 3SEPA 1EA9C 2DZBA 5AEAA 2VR9A 1R3HA 4NY2A 4APQB 3VDGA 1XZ0B 4ZUSB 1RZIA 4WO4B 4ZFOA 5A2JH 1RSFA 4AVKA 5B38G 1CG9B 4UT7H 4YHML 4LKCA 2R1KA 4YN5A 3IAGC 4JFXB 3DROB 4RGNE 1KY6A 1B4LA 1KPVB 3C8KB 2A3TA 2F53A 4R0LB 3H2CA 3WNJA 4TNWF 4MNJA 1E4MM 4Z76B 1FHUA 3CB8A 4LFYA 4MJZA 3R1GH 4OFQA 5LCVA 2A3BA 2IPKB 3RWEB 5FW7A 1QQDA 5DJ2B 2RHEA 3WS3A 7PAZA 1ITUA 4MCNA 1GKPA 1AANA 3GBEA 5AQ0A 2W4XA 1K2DA 2AQVA 1BFOB 3BQ5A 4IQJA 3O0LA 3ISRA 2CO2A 2P47B 1ZJIA 3KRSA 1HKIA 1AIZA 1UXSA 3IRPX 4KPLA 4KK5C 4OCSL 3JZEA 3TYEA 2FJSA 3ARGA 4MYWB 1BSLA 1R2SA 3W1UA 1I2RA 2FIKA 3KHQA 4YBLC 3TU9A 3DXAB 1NMAH 3NABL 2ZOUA 3T3PF 4PYSA 1UXSB 4MHHG 4PHZA 3HPLB 1T66C 2XETA 4L4TB 2ZXQA 2PCPA 4RSVA 3CZSA 3F65A 4Y88A 3BW2A 4PP1D 4YMZA 3PHSA 5BQDA 2YR3A 3B9EA 1SR9A 1B9ZA 1YA5A 1ZVSB 1Q6OA 5HYJA 1IGTA 1IZCA 4DKDC 4RCXA 1M4KA 3SQBA 4UNLA 5K9JH 3WO3B 2OZ4L 4ODTH 3OHMB 2YL9A 1JZDC 4NRZB 1IM3B 1T3FB 1JHKH 1XSJA 3BVNA 3PK7A 3U0HA 5HYJD 1YTEA 1U8CB 3QFJB 2OPJA 4P2RA 1HQTA 2NXZB 5HATA 3WIJA 2J73A 3MSYA 2DQEL 5DD3H 4MCYB 4B5WA 1ZWIA 1HKKA 4NX0A 2EUXA 2EKJA 3FXIC 2MHAA 3NJXA 2YR1A 1DSWA 4TLKA 3SCRA 2PP3A 3MBEA 3AU1A 4LCVA 4PVMA 3UJTL 4B91A 2A6JB 2PYFB 3SBWA 4PJXA 4L2LA 1ZANL 3ARDB 4Z95L 3NFPB 5IBUG 1KYAA 2R82A 3B4UA 4O51B 1FCQA 2BWQA 5DJXA 3CZ8A 1DANT 1U42A 3IACA 3CIQA 1SGJA 1NANH 3GB6A 2G50A 4WDTA 1RZKC 5DUBB 1VZHA 4FX7A 4IIHA 5F97E 1NCNA 3O3EA 2G2NA 2GYIA 1L6YA 2C9AA 2CLVB 1PZ5A 1BIIA 4BXVA 2NY2C 3BIAX 4OT1L 1EAOA 2Q87A 4ZSOE 2C7UB 3DPBA 2KLRA 5C2CA 2BSSA 4MDJA 2WKOA 4KKCD 4IIBA 4I85A 6REQA 1B4JH 3CVBA 3QJHB 3STEA 7REQA 4WDWA 2I5YH 3MXWH 4FFWD 1J5DA 2DYPB 1CIDA 4JIEA 4YEEA 2BSSB 4OZIF 2YXVA 4YIQB 2WJEA 5C0DA 4PJCE 4PGDB 2WP3T 1TV4A 4DJED 4Y5XA 4QTIL 3LSOA 1KV5A 5JOFA 3TIMA 2QEZA 3W7LA 1DSFL 7FABL 5A6JA 2GSEA 3QUMH 3UG5A 1EEZA 3U2SB 3KPRE 5EUOB 1Q45A 3BVJA 1W0WB 1SUXA 2WZMA 2VN7A 2E5DA 1FNHA 1MCCA 4JN2B 1Q9LB 6ALDA 1NKGA 3KBPA 2GW5A 2JKWA 5D8JL 5A6TC 3W2DL 2F7IA 1NC4D 1KN4L 3HFFA 5EUOA 2X8RA 2QQKH 2Y61A 4IJBA 2LLLA 5D2LB 3DA0A 3LS5L 3RDTB 1TQCC 1HJUA 4JQ3A 2YPKA 4PMJA 1XLHA 5KZMA 1XGUA 3HE7D 4UQIM 1I60A 1EJ6A 1A25A 1U3ZA 4JQIL 2VLKD 4OH2A 1DUYA 5JLZA 3CVHH 3PWUA 5JHLA 1JS4A 4Z2JA 1LMIA 1MHHA 4IJRA 3E0IA 1VCFA 4X9YA 3EDKA 1VF5C 5C92A 1PO9A 3V4UL 3IS0X 4FNUA 4JGUA 5E6YA 2ICWI 5LNGA 4V1YA 5DD5L 3RPIA 5ICYB 3NJHA 3VXRD 4KX8A 1LZOA 2D0GA 2LU4A 5J12C 2C0AA 1LBLA 5AVRB 1AP2B 3ULUL 2SFPA 2WWOA 3KPMB 1SJEA 5ENWA 5LN8A 2ZSWB 3TXVA 2J6VA 2XWTA 4S3EA 3HS8A 1XCWA 3DFOA 1GTEA 1N5AB 3M44A 3QEQA 3BX7C 4BHUI 3CHVA 1X4YA 2HLFD 5EC1B 4YQXL 3DXIA 4QS6A 3FUIA 3G08B 1KCWA 3IBOA 4PRAA 4D6JA 2R4SL 4KKZA 4F20A 2NXZD 2DEXX 2Z34A 3KTXA 4NT6B 3PWNB 2P28B 3QO1B 2HBXA 4Z1PA 2MPAH 1AK5A 1TVDA 2BNRA 3EH3B 4BRVA 2Y8VA 4Q7BA 4KCUA 1R9XA 3LTSA 4UFJA 4WXYA 1S5WA 1W3LA 4NQQA 4BK5C 3ZZLA 1ZTVA 1DL3A 3ELFA 4L1HA 1NKRA 1OK0A 1JZFA 3P4LA 4BE6A 4XVDA 1ISZA 3NSJA 1RK0A 1TFPA 3EBAA 3QEUA 5E9XA 3H9SD 4MLJA 1JFHA 4K3ZA 4FJZA 1BAFH 1F3JA 4AE0A 1L6XA 1SJHA 3BH8A 1Q0XH 3Q6GL 1MFCL 4M9PA 5KTEL 5LXGL 2BVQB 3PQYB 4PRNA 2PR9A 4M7KH 5EU3B 1GAFL 1SVCP 5DRNB 2FZDA 2YYUA 3OJGA 4NJKA 4W8LA 3VOJA 2FX7L 4UQ3B 3CC1A 4H8UA 4ICXA 3GZQA 5SV3A 5D1QA 5IBLC 3QRFM 2ED6A 5EO9B 2X4QA 3KPLA 4MVBD 4AMKH 4XBMA 1M03A 3H42L 1IM3A 3NTCH 3N4EA 4HPJA 4G6FD 4A8NA 1Z9SA 5E1AA 1VEOA 1OAYL 3LY6A 2EDJA 2NNAB 4MS6A 1X1NA 3UY8A 4UZGA 1LT7A 4L2YA 1BFOA 1P4UA 3HG1E 3LIZA 5H4YA 1AG0A 5TF0A 5GNZA 1FN4B 1GSKA 2VC9A 4H7CA 3T0EC 5BVPL 2ZKHH 3TWCH 5J9PB 1LOSA 3G5EA 4H1LH 1MFBL 1KIUA 4JHAL 4AXWA 1T5WB 4PJXB 1CD1B 4XC1L 3U5YA 3INUH 1UJPA 5IIEB 5LIXX 1FG2A 4O15A 1PNDA 5E2WH 4ZT1A 3RTQB 4XAFA 1ZA3B 4GKLA 1H1ZA 4XWOC 5DEFB 4UM9B 4HK0A 1O6TA 2ZKYA 3G0UA 5LJYH 1HEJC 3WUEA 1TNMA 1O7AA 3Q6FA 3Q8FA 4JDVB 5DJAA 3BUYB 1MJJB 2J4WL 2WAHA 2NX9A 4V2CB 3VD2A 4PS8A 1T3FA 1AQKH 2J55A 2RH9A 1PJ9A 3NN8A 3FT0A 4YSOA 4HJGA 5EU6D 3RIAK 2XZQH 2G97A 3HE6A 2PZNA 3BOFA 3PG8A 5J7CC 2G75A 4NGHL 5DSCA 2FZBA 3OG3A 5G1MA 2JGQA 4XMLH 3VRIB 4GP5B 4E36A 3GS4A 5TE4L 4JTSA 4NAQA 5C0AB 1JF1A 4LVAA 4CD4A 1DL7H 2HSIA 3OODA 4PB4A 3HG1D 3QEGL 2JTDA 3L08A 4NPYB 3WUWB 4LSQL 5K59F 1Y5VA 2NV9A 3TYUA 1WZKA 1IGFH 1HOCA 1FL6A 5EFDA 4EX4A 3ARZA 3H6AA 1HI6B 3ETSA 4KI5C 5A2LH 5I16B 2QULA 1IC7H 1CBJA 2FB4H 2ZNXA 2X4PB 4M93C 1OCWL 2BMKB 4A6YB 2VXSL 4WV1A 4CMHB 1FHNA 1VQTA 1J2BA 1GHRA 2ATMA 1VA9A 5BRZA 2Q0ZX 3L4WA 3JUZA 4QCIB 4MA8L 3TT1H 4ZFQA 3UAJD 5ILTH 4JK0D 3DPDA 2ZA3A 4JZOA 4PE8A 5BMFL 2K4AA 3D3VB 3TBCA 1PKOA 1N0XH 4NO0A 2F8XC 1E6NA 2APBA 3GC5A 4WHDA 4C56A 1B6DA 2EXWD 2G3MA 5FO2A 1NSNL 4GRLC 1A50A 2GQ3A 3DI1A 4N2HA 4QXTA 4C6FA 3CGTA 4NC0B 4QRRB 4DKEH 2NY4D 4NN7B 2Q6WB 3TJPA 4GG6A 3LEYH 3R8RA 2E9BA 4Y5YA 2OTUA 2BZNA 2HS6A 3FGCB 3QQXA 1NOLA 1AZRA 2WXMA 3P9WB 4ZAKC 1FCUA 3GIQA 4M6QA 1M7IA 5HHMB 2OCZA 4Y7EA 3FQNB 1U95B 5DR5H 2A1WH 4N8UA 3H2MA 1N59B 2NCEA 5CKAA 4LSTH 4ETYA 3RL1A 5E0KA 1GYAA 3OKMB 2UWEA 3HC3H 5E8OB 1FSKB 2V6HA 3F6LA 3HPJB 3GE7A 2AK1H 2N01B 3TC9A 3AISA 1RZJH 5I1KL 3H21A 1PQZB 3K3QA 2WXQA 4D9RD 5HDBE 1U8QB 2OS7A 4XP5L 3KBFA 1NARA 5DYOB 5IP4A 4XZMX 3MFFB 3HPJA 3WTWA 2XPZA 1T2QH 2VERA 1IXPA 3WLQA 1J9RA 2J12B 3GXFA 4QXUL 1YBQB 3GVRA 3VFPB 2QHAA 3IBEA 4ZFFA 5TGBB 5D1ZC 3E6FB 1ESWA 5CINL 2VWEC 3KPRD 3W11C 2BIHA 2HVJA 2VLKB 4BSVA 3LN4A 3VRJB 4PWFA 2ZYHA 5DJ0B 1TJXA 4X83A 2PDMA 2Y7FA 3N12A 3ONBA 3MLZH 1ETJA 4NNPL 3DJZA 1OP9A 2FJFB 2Y23A 4MAUL 1W5PA 1Z3NA 5D4YA 3BDYL 3Q5OA 5DXYA 4UDUB 5LB1A 3RCMA 2IV9A 2OJPA 3CV5A 2HJKA 4GC3A 3CTLA 2Z8RA 4Y89A 5ADPL 5CJQL 2RDTA 1Q72H 2CKBB 2UZIH 1OFBA 3WV0A 4JHVA 1Z32X 4GG8A 4ZS6D 3PWPB 1IZJA 3QE5A 4DUXA 3MYZA 1HJCA 1EJUC 3GSQB 3CFEB 4JQXA 2OEKA 3GK0A 2ZBTA 1CUOA 1F8TL 1OGAD 1Z9MA 2VR4A 5A6BA 3NSDA 4I9JA 3WXWH 4EJ1C 1DPMA 2ZZ4A 2DWXA 4P2OB 3UPBA 4Z7WE 3LOTA 4XXDA 1L3NA 2PW2B 4IG2B 3V0UA 4Z1AA 2VXTL 4R8WL 2PTVA 1QOKA 4LMQI 2WXIA 5DWUH 1UMYA 1FWWA 2AXFB 1JVLA 1G69A 1VGKB 3HMCA 5H8MA 1Z9OA 2PTXA 1XV8A 5T5FL 4ZVJA 4G8IA 1ZCCA 5E51A 2WLZA 5IKCB 5FYKL 2QIIA 3AYSA 4J2XA 4CCCA 4ELKA 5TBOA 3Q6GH 1XIHA 5I3HA 5LGXA 1RBAA 5DD1H 4MFEA 3FQXB 4XAYA 2X6BA 4LFHG 5HPCA 4ZXBA 1H49A 3B5GA 5BJTB 1OIOA 2E09A 4IQDA 3NQVA 1UEYA 2CRYA 4XBEL 2NY6B 2XIOA 2A2QT 3VTRA 3W71A 3TFXA 2ZG1A 4NZJA 1MXGA 4QRSA 1LQBC 4X7DC 5E5MA 4B9JA 5JW3H 1GGIH 2CZFA 2Y70A 4KERA 4N02A 4PREB 1US2A 5HGBB 3NXLA 3L12A 4U3SB 1B3YA 5I66A 4U7MA 5DMIH 5MP6L 2EAWA 3LSBA 3NYDA 4O4YL 2B15A 3OHXC 4QRSB 4CW1B 1S5MA 3KPNB 2XGBA 2IPTH 1QA9A 1FVDB 3CMJA 1HQRA 2DZEA 4K1WA 1XYAA 4LP5A 1C5CH 1NOWA 1PU0A 1REQB 2AL1A 1I8AA 2NY2D 3FB6B 3QORB 5L4IA 2BV9A 1QSED 1UT9A 5KSBA 5JIHA 4GIRA 1NY1A 3DXAD 1XAUA 3K81A 3VXGA 2A6KA 2D24A 2IDSA 2XXFA 2ZYIA 3QZPA 3SPIA 3CV2A 4MKNA 3TBVB 3KNBA 4YFLI 5KYWB 3M5YA 3GDTA 1W8GA 3UTPD 2F7QA 1E7UA 1MJJA 1HL5A 2F5AH 4M8VA 4JX0A 4QCIA 1IXQA 4HIHA 2QUUA 4JTTA 1KCXA 4F7CA 3NIYA 3F7PC 4A2LA 5JQ6L 3PWIA 1JUFB 4PJGA 1JNNL 3UJJH 4K3DH 1BOGA 1P4LB 5CU9A 1RXOB 1H3PH 3Q2LA 3MOAL 4YR6B 4K1GA 4YX2L 3AQDA 1PZBA 1Z5LB 2X4RB 3K2GA 3CVHL 4JRLA 2NY1C 1ZLSH 4GMSL 4L1WA 5C0JA 1NEZA 1X4XA 4J4PC 3GW0A 1NFDE 4NJGA 4ACTA 3H23A 2GDVA 4ZFMA 4WNQA 1X5FA 2EQDA 1SY6L 4POCA 1ZAGA 1NCCL 2B9BA 4LVDA 1L0YA 4PR4A 1UFGA 2P3YA 4GUGA 1LHZA 2VQ1B 3DYPA 4GE8A 2BZ7A 2XTLA 1Y6NR 1S5IH 1E9IA 4DAFA 3ZHNA 3Q3GA 3H2QA 3BO8A 1YN6A 2IQTA 5KG9A 1JRCA 1BG1A 4MB1A 1RFDH 4X5PA 5DANA 4Q7DA 1BVWA 3QM3A 3BO8B 5HY9B 1Q6DA 3QWRD 3L2NA 5EU5A 3NPUA 4M00A 3FB7A 4PCSA 5PCYA 2X2YA 1M2VB 1E9PA 5E99L 1S78C 4CSPA 2INZA 3SQLA 3HURA 5JHBA 4RKAA 3ZHKA 2P0IA 4S3AA 3VE7A 4AGNA 4X0KA 1U8HA 3BSZA 3SURA 2XG9A 5C7XL 5FDWB 4NAJA 1N19A 3AHVA 1GS7A 1WZLA 2YD0A 3GO1L 5ACLA 1TTJA 1YNYA 3PG2A 3VRIA 4ACYA 3PABA 2V5SA 2PPAA 1LF1A 5A2AA 1AQFA 1CGUA 3U4KA 1IBYA 4IP4A 3CVHA 3QPXH 3KWSA 4NO5A 2VABB 5C3LD 3V4PH 4HUUA 3ZKXC 2WQAA 4G7EA 5D7EA 3QTPA 3IRDA 4M1RA 4QXIA 3FGCA 4FXTA 2XTJE 2WWNA 3P3BA 4G9DB 2DN7A 1XLCA 3OJ2C 2DQJH 5IESH 2N56A 3O11B 1JV2A 4AZ7A 5DUPH 2AJZA 3F2DA 3HPSA 1B9KA 1BFVH 2QVIA 1MHHB 3IKKA 4GRLA 4R7NB 4RRPA 1PG7L 4P57A 4YSQA 4LBUA 1ZA6A 4C4UA 3OGCB 4R5VA 3G3LA 1LTXA 4I8DA 4L1SA 3GLEA 3VAVA 1FFTB 5HAOA 3FYOA 5IF0A 5BUPA 1C16B 1S5TA 2J88L 4WTWA 4CKQA 4JPGA 1DEEB 2VYRE 1KCZA 2NY4C 3MJ7A 2I5GA 2EADA 2JCCE 1LOLA 3RHWF 4ZQCA 3CHSA 1HKVA 2PO6A 4XX1G 5D1XA 5D7LA 4FE9A 3BW4A 4B9YA 2YQGA 3N2TA 5GPRA 3F5JA 2C15A 4MMYB 4E9VA 2A3EA 2J8UA 3A67H 3NIDE 4IRZH 5CGTA 2NXYD 5A43C 1CLVA 1H60A 2V69A 3MV7D 5F7FA 2XN1A 3SDYL 3SD5A 2HISA 1ECZA 2NXIA 1QR4A 1JZ6A 1M6OB 3KVKA 5D2YA 4ZL1A 3C6LA 1QACA 1VPOL 1N0LB 4ZW8A 1KGIA 2H1LM 4HUCA 3UF9A 4TTDC 3JTTB 3PB2A 4UTBL 4KETA 2ALWA 4U7SA 3IKCA 5CAYB 1V0KA 3CX5K 4UZSA 1UWQA 3I2CL 1FWXA 4GH3A 3KPQA 2R0LH 4KKPA 5DFAA 1RJZA 2XH4A 1JVOA 1QU4A 4P8QA 3A64A 5ITBH 3DGBA 1KIPA 4GRWH 1TA3B 2Z1WA 4FS9A 1U8LB 4OB5L 4APQD 4LAKA 4LYKA 4U4IA 1X97A 3U0PA 3UX9B 3SJ3A 4JYDA 3P4NB 3GMRA 4UQ2B 3NVDA 4WJXA 3UPAA 3DKHA 1DO5A 5L2KB 3O16A 1PZAA 1YTKA 4G9FB 3HFMH 1N9PA 2R29L 2CBQA 3QK0A 4AWUA 5AKRA 3EH4B 1EJFA 3A4DA 3D25A 4PCNA 4ZOCA 4AQ1C 4PRHA 2R1YA 3IF1A 4H1LA 1BDYA 4DZ8B 2GHZA 3BPCB 1R2TA 2EDXA 4FFYL 4M56A 4NYLA 4RFEA 1TJPA 4XISA 5JIPA 4BWLA 2PPFA 4XOAA 1I8JA 4M82A 4QY8A 3TR2A 3GHPA 3KPSD 3FDGA 4CNTA 4QXWA 3T8VA 5KZCB 1GGYA 2FBRA 5C2BL 3JS3A 3WL0A 5FF7A 3MREA 2CIPA 1Q8AA 3LKQB 2WLIB 4Y4KD 3FQ4A 4NP4H 3V4PB 3BQUD 3VI3E 8FABB 3QJAA 2J7HA 3NJLA 1ZSHA 5KZDA 3UP8A 1Z9SB 3ZKMD 4QSHA 4XMKH 1F6PA 2Z29A 5D37A 2AAVA 4RRPG 2GQ9A 1Q0EA 4IFKB 3PHQA 3QPKA 4NVTA 1T89A 4BFIB 4LY4A 2VC2L 4Z7NB 2WZ6A 2E6PA 4KFPA 3L48A 3U1SH 1DSYA 3GI8L 3T4AC 2W9EH 5K4XA 5DS1A 1JZIA 4JFHE 3NZSA 2AKMA 2P9RA 5KSBB 2V2XA 4M7LT 3UGEA 2XQBL 3BHBA 3L4CA 1IGTB 4HX1B 2PDWA 3RLHA 2P53A 3TZVB 1NIBA 2DQCL 4P3DA 4NJIA 2N1KA 4JPWH 4PHXA 3N9RA 4BKLB 1TPXB 4GW5A 1SO4A 5T1LB 4N2EA 3BHBB 2VRKA 3GVVA 2OTWB 4BD4A 3ATEA 4BZ2L 4KDVA 4CNPA 5D8JH 2WO3B 1C12B 3LDBB 1R47A 3ZJ8A 1AXIB 3DTXB 3D52A 4NHUA 3T08A 1A2YA 1PG7X 1XSOA 1BTCA 1IWAA 2JIXD 2P50A 1TO5A 3ESVF 2I85A 2ARWA 5IB5B 4OVXA 1K2DB 2W9LA 2ALAA 3BEVA 3U46A 2NR6A 3RU8H 1HF6A 1XYZA 4UV4L 1TE1A 2ACUA 3LTYA 4X6CF 4I9TA 2NOYA 4JR9L 4ZQMA 2VGBA 4A6GA 4JB9L 3Q2DA 1A9BB 1KRMA 4TUFA 1SJAA 1I1FA 4GK8A 3UXAA 5AOLA 2M83A 1G4TA 3NDZE 4HZ8A 3K80A 1WICA 2WKLA 5K9CA 1OAXL 4H7VA 2CXEA 1OB0A 3L2LA 3LQAC 5HI4C 3TNMB 5KVGL 1G9HA 1NPUA 1QSVA 4IWWA 7A3HA 3CSYB 3G5ZB 1NWSA 1JVNA 3QJFA 4G42B 2Y07L 5BS0A 5TDNA 4GW4B 3TTSA 1GONA 1VPXA 2WNQA 2IG2H 3GNPA 5I5IA 4EZJA 2GTWA 3AACA 4QRUB 2BZCA 1EZVY 3EWBX 1M7JA 3APGA 4FNLL 2QCHA 1UATA 1SOXA 5C0BD 4FHBD 2F6AA 4R2GB 2JXMA 4JQVA 4RA3A 3D39D 5JOEA 1VPYA 2UZ9A 4QRRD 3NGBC 5B22A 1KQZA 3QUHA 4L8DA 1O7DE 4L1XA 4G7VH 4XVTL 3X11B 5IFPA 2VNCA 2ITEA 4OCWH 2ADGB 5ISZE 4K9EC 4A21A 1A3XA 4IGHA 5LQBH 5DMKB 4OU1A 3TTYA 3QI9B 3QXVA 5JPNA 2WKJA 2HVBA 5BOPA 5F6HI 3CN1A 3N34A 2GI7A 4FTVD 3FDKA 4C6CA 1ASPA 2BTMA 1TPB1 4DF1A 2Q6ZA 2EIMB 2O5YL 1L5GB 1P48A 1UCBH 1AACA 3T8XB 2ED7A 4GYJA 4OV9A 2VO5A 3E8UH 3EFOA 1NAKH 3GSWB 4XVSH 4Q9QH 1MPAL 2CLZA 4PMNA 1X5KA 4HUVA 3SE3A 2VD8A 3TJ4A 4IEFB 1HCFX 4UUIA 1V02A 4D6FA 3D07A 5F7KC 1YMYA 3N0AA 4U7KA 4JPSA 5FB8A 3PWAA 3WX7A 2CLZB 2QQLH 1RY8A 4RE4A 1D8WA 3THCA 1QASA 2AP2A 4BQ4A 5AG9A 3BKCH 3K2KA 1ZFJA 3M43A 3BEWA 1QLFB 1J05B 3TBWB 4Z08A 4GNKB 1XF2B 3PHAA 4WI4A 2EXSA 1DEEA 1DQQA 1YYLH 3OZLA 4L3EB 1AH4A 2EPLX 4WOQA 2R4RH 1A0QL 2K4WA 5DJYA 3UFYA 3GNNA 1DTUA 4IKLA 1LYXA 3D1MC 3P0GB 2CESA 5HJLA 2QW5A 1YEFL