3BAJA

Human pancreatic alpha-amylase in complex with nitrate and acarbose
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 172
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bajA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bajA01
4D6JA 1MXGA 1SFSA 1XCXA 4DO4A 2DSWA 3RJYA 3DX0A 4U2YA 4W7VA 3VGFA 5KZ6A 1FH7A 5DEZA 2F1BA 1BLIA 3L4VA 1UZ4A 3AIWA 2F7PA 1ISYA 1UG6A 1GJWA 1JDAA 2YLLA 1KB3A 4AMXA 1DWHM 4PUEA 3BLBA 3L4UA 3L2MA 4DM1A 4AIEA 1CXKA 4PRWA 4W85A 3GXPA 4HTYA 3T0DA 2E9LA 3SCOA 2J7EA 5I24A 4TX8A 4CKQA 4U5IA 2VVSA 1W2PA 4XZWA 2ZX9A 3AOFA 4AZ6A 3PZNA 3WD3A 4UQBA 3NIYA 3ZR6A 3T2OA 1JI2A 3IANA 4LYPA 3OGRA 5DO8A 1UYQA 1MYRA 3FW6A 4U2ZA 2XFFA 2XIBA 1UA3A 5BXSA 3KLLA 1JDDA 3H55A 2QF8A 3I3EA 4X0VA 1JZ5A 2XM1A 1EIBA 3JUGA 1X6NA 4WKFA 8CGTA 3O2LA 1GNXA 3DX1A 2RGMA 4QLKA 5A6MA 4AD1A 2WWCA 3VILA 3BUDA 5ABFB 1LG1A 1KBKA 1EDGA 2YDQA 2WLYA 2Y2WA 3BCDA 1V6XA 4NXKA 1GQKA 1H11A 1UOKA 2FGZA 1GHSA 2WPGA 2J7DA 2AOSA 3VD5A 3EJRA 4OUEA 5CZKA 3CZJA 1QHZA 1CLXA 4M81A 1UWIA 5A6LA 5A94A 2WB5A 3KL3A 4A3HA 1CYGA 2IXVA 4FLQA 2F7RA 4OBRA 2OW7A 3FAXA 5D9MA 1VFMA 4MNKA 1K9DA 1PZ2A 3AYRA 1N82A 4HA4A 2F8QA 2WSKA 3BAXA 2ZXQA 4KGJA 1VFFA 3OLGA 3U5UA 4MJ2A 5DFAA 4S3KA 1HL9A 2J79A 2ZICA 5I6SA 1PZ3A 3TA9A 1HVQA 1V0LA 5ABFA 6TAAA 1JD9A 2D23A 1GONA 1DP0A 3KZSA 2X0YA 3AIBA 1K9TA 1NOFA 4P8UA 1TQWA 3VD9A 1BFNA 1TQVA 2CHOA 1E6SM 4ZXOA 7TAAA 3WQ6A 1Q6EA 3EDKA 3AXXA 5LA1A 1V3HA 3DDFA 3WQVA 3CBWA 4JKMA 4GI6A 2VL4A 3SCTA 4D6GA 2AAAA 1DWGM 2G4FA 3BUIA 4J3VA 3WEOA 1UKPA 1CGXA 5F7UA 1J11A 3W28A 2GFTA 4KH2A 2E3ZA 4UFHA 3WH9A 3SCUA 1LWHA 3SCWA 3WL0A 2DSKA 2YDSA 4DWSC 1BVNP 5HOSA 3AQUA 1V3MA 3WFZA 3W37A 3AMDA 4MB3A 1TA3B 3UERA 4PTMA 5JBDA 1CDGA 2FHCA 1BYCA 4QLLA 1UWTA 2WAGA 2ZX7A 1HVXA 3W38A 2WVVB 4ML4A 2W63A 3FXYA 2EADA 1OBAA 4ZENA 1ITXA 3MKKA 1BGGA 3ECQA 2ZE0A 3S6TA 2GUYA 4CN1A 4UFMA 4GINA 1R86A 1EH9A 3CGTA 4M24A 3VIHA 4HU0A 4Z2IA 1HJUA 3WUFA 4PMRA 4XV0A 5M3WA 2WC3A 3WNMA 2O92A 2WHJA 2WZHA 1W1YA 1B3VA 3K4AA 3MMWA 3OBAA 4FNSA 3AS1A 3AS3A 3CV5A 4UQDA 2G3IA 4OOZA 3CZEA 1LL7A 4PCSA 2A3BA 2VQTA 5E0CA 1KCKA 3VIFA 1V3KA 4HMCA 3MUY1 2WMKA 1XH2A 5IFPA 3ARSA 1JAKA 3DYPA 4V2XA 3BUBA 5A6BD 2WVVA 3CZLA 4B15A 1RP9A 5GPRA 3T08A 4CU7A 3WDHA 4AEEA 1OGGA 2XGBA 4UOZA 1GW1A 4AMCA 5FD0A 4TVCA 3CUJA 5I23A 3CZSA 1G5AA 4GI8A 5FIPA 1UQYA 5AY7A 3W26A 2YIHA 3CHEA 3DYMA 4NZCA 1LL4A 4AD5A 2FH8A 1TG7A 4M29A 1UR0A 4LYRA 1Z32X 2G41A 2F18A 4AYSA 1EQPA 2JF6A 2WANA 2BV9A 3AIUA 1M53A 2YKKA 1GQIA 2PC8A 1W1PA 3EDEA 1JYNA 4H8HA 5A2AA 4MB4A 3LPGA 5CPSA 1XHGA 1KCLA 3QHMA 4YPJA 1ESWA 3OB8A 4NSBA 2D3LA 4D6IA 5E6ZA 5D9OA 3EDFA 3PHAA 2EPKX 1E4IA 1BYBA 4J3XA 3CH9A 3MO4A 2EAEA 4WJXA 4ZFMA 1E71M 3PTMA 1JGIA 1DEDA 3IJ9A 4ATWA 2W61A 4XUYA 1XD0A 1V03A 1V02A 2ZWYA 3LXCA 1HP4A 2CBJA 1QW9A 1PAMA 4PMZA 1Q6FA 2WLZA 3G6MA 2PF0A 1HP5A 3WEMA 4Q22A 4U3AA 4CVUA 3GH7A 5I78A 1BSIA 3EMZA 1UD5A 3SCSA 3WN6A 5CPQA 4WKHA 3THCA 3AISA 2VZOA 1LF1A 1W9BM 1T0OA 4HMEA 4JFTA 2WSPA 4J3SA 4WSKA 1ZB5A 2JEQA 3VU2A 3PZIA 4UZUA 1KR1A 4JFUA 1UKOA 1XD1A 2RGLA 3FNDA 2YBTA 4HMDA 2EPNA 4PTXA 1EOMA 3CZNA 3VIOA 4HP5A 4X9YA 1ZBVA 3EJUA 3WF1A 2V38A 2XSBA 1F4AA 2XPKA 4PMYA 4RE3A 2BXZA 4FLSA 3PTKA 2ZUTA 1BTCA 2O9TA 3CO4A 2EPMX 1E6PA 3S5YA 2WHKA 2VR4A 2DSUA 1J10A 2AMGA 1CGWA 4BQ4A 1QOXA 2FE0A 4AIUA 4JL2A 4GXPA 4PSRA 1VEMA 1B30A 1LQ0A 3MV01 4TVDA 3UG5A 1C90A 3WY4A 1B3YA 4DUVA 3AXHA 1E55A 3RM9A 5D9PA 3H53A 1AQHA 4Z2JA 1KXHA 4HOZA 3CMGA 1JNDA 2VX7A 1HJWA 3SIMA 4LPCA 2XN0A 2ZUUA 5BXPA 4WLCA 5A8NA 2J8FA 1JAEA 1NWRA 2UY2A 1JZ2A 2VO5A 3CIVA 3VIGA 5DMYA 1BAGA 3WNOA 4W88A 1H0GA 1I1WA 2WZIA 2OWWA 2FYVA 3RDKA 3M07A 4PTVA 1LG2A 5D8WA 3MS8A 3QR3A 1M01A 1VFOA 2W91A 4FNTA 1VENA 1EXPA 4CU6A 1CECA 2J7HA 1FH8A 1FA2A 1KQZA 1J0IA 1JZ8A 2CYGA 3OIHA 4AZHA 3VX0A 1CEOA 4CCEA 3T2PA 4P7LA 3ARQA 1TVPA 4N42A 3WH5A 3GXIA 1OGBA 1E5NA 4D6EA 3VX1A 4UQCA 2IGTA 1UWSA 2E9BA 3WDIA 2CPUA 1U30A 1AQ0A 1JZ6A 3MI6A 4LGXA 2XVPA 4D1IA 2ZIDA 1LLOA 3B9AA 1CLVA 2DH3A 4RE4A 1TVNA 4V28A 3LRLA 3J7HA 4W7UA 3BAYA 2VTFA 1SMAA 1R85A 4FF5A 3VVGA 3NJ3A 1JXJA 3A47A 3DDGA 3N18A 1R46A 3ZT7A 2HISA 4BF7A 3A21A 2WHMA 2DGAA 1OD8A 5FKYA 2JALA 2DT0A 3EJPA 3WDRA 2YJQA 1H5VA 3WBEA 2VNCA 1FFRA 1QI4A 1E15A 3WSUA 2XN2A 5LA0A 3VGDA 2W92A 2D2OA 1E1EA 2WMGA 2CHNA 1JF6A 4KRUA 2JF7A 3AIQA 3W4RA 4WF7A 1WZMA 3BMWA 1J0YA 2ZOXA 3O9NA 4UCFA 1VAHA 5I2UA 3A4AA 3W82A 1E6ZA 1XH1A 2WW5A 1DTUA 4ATLA 3L4ZA 2EXOA 4LQ1A 4BS0A 1EHAA 1E73M 3A24A 3AHZA 3BVUA 1BYAA 5BROA 2F1AA 3KLKA 4QAWA 1H4PA 3GH5A 2VURA 4GQRA 1NWUA 2E8YA 1D7FA 3K46A 2J75A 1TQTA 6A3HA 4QDMA 1HNYA 3OG2A 1KXQA 5E1QA 2JIEA 3HG5A 3CHCA 1C92A 1HL8A 3T0AA 2CKSA 4WK9A 4B3KA 3WL1A 3CTTA 4HPGA 4NF7A 3WNKA 2ALWA 3AS0A 4OBSA 3WMSA 3VD4A 1DWJM 2XHYA 1W32A 3D4ZA 2NT0A 5HXMA 4J27A 5CSYA 3VPLA 1Q4NX 2Y8KA 2D0HA 3VMNA 1K9FA 3EJTA 1ISWA 1OWQA 4UQEA 3PN8A 1US3A 4JKKA 2JE8A 2VRJA 1HJVA 4P7OA 1JF5A 1HXKA 3CZGA 4M8UA 3QOKA 4D6HA 1BPLB 4Z2GA 4PMNA 9CGTA 4QFUA 1J0JA 1X1NA 4BA0A 1E9LA 1PX3A 3AHYA 2GJRA 4AC1X 1ISVA 3WF3A 2GJXB 3BAWA 1HKKA 3WF4A 1UR4A 1UH2A 2Y8VA 1UD4A 1E1FA 4CGTA 3WKZA 1J0HA 3F5KA 2VRQA 3KWXA 3MSDA 3VKKA 3MSGA 1BYDA 1UQZA 5A6AA 1UR9A 2ZUMA 5BXRA 1HJXA 1FFQA 3CMJA 4FLRA 3QOMA 3VGHA 3A23A 1NH6A 3WUGA 3LXBA 3DX4A 5JUVA 1H0IA 2PWGA 3CUHA 1UD3A 1GQJA 3D50A 3SCQA 1B3ZA 2WMFA 3T0BA 3RM8A 5HDRA 1BVZA 2DT2A 3VIIA 2DDXA 2B31A 2J7BA 1ZBKA 4AYGA 1JG9A 3NSNA 2WM0A 3OGVA 3L4XA 2VCBA 5CJ5A 2FDMA 5BYWA 3VM5A 2UY5A 3POCA 3UG4A 4AXNA 1V6YA 2VVNA 2XVKA 3NCOA 1W1VA 3AJ7A 4U3CA 2C7FA 3WQ5A 2J4GA 3WUEA 1E43A 4MJ4A 4U31A 4E2OA 1WDPA 2VZUA 2BNJA 2XYLA 3FHQA 2GJXA 2D73A 1A47A 2FHFA 2OSYA 2WC4A 2X8RA 1CXIA 2XWEA 2WMHA 1MWOA 4GO9A 4NRSA 4J3WA 1E0XA 4D6DA 3M7SA 1E4LA 4M82A 1NQ6A 2CERA 5A6BA 1B3XA 2ZX8A 3BGAA 4HZ6A 5IHSA 3DHUA 4XB3A 1FHLA 3VGGA 1R34A 3SURA 4NXSA 4IISA 1CNVA 4PEEA 2CCRA 2E9MA 3EJSA 2WCGA 3GXDA 1XYZA 2A3HA 2FHBA 4MAZA 4W5ZA 3WFLA 4PYSA 2GSJA 2YFNA 4PN2A 3SCVA 1CXLA 5ECUA 4S3JA 1JFHA 1ZBWA 2VX4A 4PUDA 2EACA 3THDA 3WNPA 1WO2A 1KFWA 3IAPA 3VUPA 4W89A 1UR2A 3GNOA 2BVTA 1BHGA 1TZ7A 3N04A 2A3EA 1OSEA 3WDJA 3ALGA 5BXTA 1B1YA 4MDPA 2UWFA 5GNZA 4MDOA 4UQAA 5D4YA 4CD7A 2PWFA 1TR1A 3K4DA 2W67A 1E0VA 1I1XA 2VC9A 3TP4A 1MQPA 4EANA 2JFEX 4MTVA 3A22A 3ZSTA 4H04A 1WZLA 3U57A 2EPLX 1XSKA 3N13A 3SUVA 3FHAA 5A8PA 3G6LA 2VQUA 3WD4A 3DX2A 3LRKA 5IFTA 1UH4A 1JYXA 2GK1B 5I5RA 2WCAA 1GUVA 2XVNA 1QBBA 1FOBA 3WDPP 2OSWA 1V3LA 1G94A 4MB1A 5A95A 1HJQA 2OLHA 5M5DA 3VD7A 2J7GA 5M17A 2JEPA 1MW3A 4B9YA 1WE5A 1WB0A 2OW6A 1CGTA 1JD7A 1DWAM 4W5UA 2Y4SA 3UCQA 4GQQA 4D6FA 1KWGA 3SUTA 4TUFA 1K9EA 3E1F1 2X2JA 4CCDA 1W3JA 5CSUA 2D24A 4DO6A 2J7FA 3HMCA 3HJEA 2Y24A 1R7OA 2DSZA 1AVAA 3VIPA 3BUPA 4PMVA 2VT0A 2G3JA 4UFKA 4FNRA 2EEXA 4QP0A 5CXPA 1QWUA 4R5EA 1JZ3A 4Q7NA 4W7WA 4HA1A 1OT1A 1Y7VA 2ZXBA 1NP0A 1JZ7A 3BVXA 4PMUA 2VZSA 1TMQA 2EABA 2XUCA 3POHA 2GK1A 2A3CA 3PZUA 4GKLA 3A4WA 5ABGA 1UUQA 3LPOA 4P7QA 2V3EA 4PMQA 5E09A 4V27A 1L8NA 1DWIM 1PPIA 2F7QA 4P7NA 3GM8A 5FCZA 4PCTA 1PJ9A 3FY1A 1G9HA 4UFLA 1UZ1A 4H41A 3W6MA 3AMGA 2Y5EA 3N9KA 2YA1A 3W53A 4DWSD 2YLAA 2XSAA 2Q8XA 3WF2A 1W9VA 3W0KA 3D51A 4PBGA 1C91A 3KE0A 1CGUA 3HZ3A 1KTBA 3NYDA 3K8LA 1ODUA 4TTGA 2YA2A 4JIEA 3UR7A 1HX0A 2G3NA 2D1ZA 3ZSSA 4FNQA 3MANA 3OA5A 4CD5A 1UKQA 3HG2A 4IM4A 2V5CA 2X1IA 3M6DA 4CVWA 1E6XM 2X2IA 3IJ8A 3O6AA 1OIFA 1Q6DA 1ZJAA 3PZVA 1R75A 4PSPA 2XN1A 1WPCA 3T09A 4W8LA 1SR0A 3GDBA 1XSJA 1C7TA 1W3LA 4Y7EA 1HKIA 1V6VA 2CXGA 3VSTA 1EGZA 4Z2HA 4QCEA 1O7AA 1J0ZA 1J18A 4JAWA 1GOIA 2VCAA 3LXAA 3ZR5A 3AIRA 3VTRA 3U7VA 1HJSA 3TTQA 2WYSA 3QGVA 3ZIZA 2YOCA 1RH9A 5D8ZA 1NOWA 2WCSA 1QNRA 4W8AA 3CZ8A 2CNCA 1MW2A 2BHYA 1ZL1A 3UEQA 1M03A 4J28A 3IK2A 3F5LA 5C8BB 4NRRA 2ZWZA 3GXMA 3VDCA 4W86A 1ZU8A 3BMVA 4BQ3A 3NDZA 3PZQA 4MB5A 1QNPA 5HNNA 2PBGA 1QNQA 2O9RA 5TD4A 4NI3A 2EBNA 1KGXA 4CCCA 1B2YA 2ZXDA 2CIPA 2GJPA 5GQBA 4MNJA 4A3YA 4MAVA 5LA2A 3VD3A 3ZJ6A 1DHKA 4DUXA 2QMKA 1G01A 5BWFA 4EKJA 3N12A 2TAAA 1ODZA 4XX6A 1EO5A 3AHTA 3W6LA 2G3MA 3A3HA 4ZE4A 2XG9A 1C8XA 3AHXA 4OJYA 2UY3A 5BRQA 4ACYA 2WMIB 5IHRA 2WKGA 3F4VA 4F8XA 4L4PA 2W4XA 3OGSA 3QHNA 5AYBA 5BCAA 3VDHA 1NOUA 3PZGA 1J9YA 1M04A 2XGIA 4JHOA 1QNSA 3VGEA 4IUGA 5M03A 1KQYA 3MMDA 5ABEA 1V0MA 1BF2A 3VSUA 4KRTA 2W62A 1UKSA 1QI5A 1JFXA 3VIMA 3CHDA 1QWNA 1GVYA 4P8WA 4D71A 1S46A 4MNLA 3APGA 3SCRA 3CHFA 1KR0A 1NWSA 4AIOA 2VZVA 5A6JA 1O7DC 1GOOA 1CXHA 1H49A 4RE2A 4ATDA 4JFVA 1W2VA 3LPPA 1CENA 4CN4A 2BXYA 1PEZA 2BS9A 1XRVA 3II1A 5A2BA 4GIAA 1WDRA 1BGAA 3NSXA 2CITA 4MPKA 1KXTA 1QVBA 1V08A 4CD8A 5KEZA 4Z2LA 2WMIA 3VIKA 4B16A 1WNOA 4PMDA 1EQCA 3DYOA 1JDCA 2PWEA 3A4XA 3AIEA 1VFUA 3ZQ9A 3HG3A 5EBAA 4AD4A 1I75A 3GBDA 2YDRA 4LX4A 5JIPA 1TUXA 3LRMA 4EK7A 1WKYA 5CLTA 3EMQA 3AMCA 3N11A 4JFWA 1JZ4A 2WVUA 1JYWA 3N1AA 2BHUA 3TTSA 1EO7A 4DM2A 4WKAA 4M56A 1R8LA 5AYIA 4GI9A 2VZTA 2OYLA 3ZM8A 3T2QA 1QI3A 1W3KA 3FN9A 4QLJA 1QHOA 2BFGA 3I3BA 3W24A 3N15A 2VR5A 1MQQA 2VRKA 3VOCA 1ECEA 1E3XA 3A6OA 3PTQA 1ZJBA 1V3IA 4HU8A 4NZFA 2DIEA 4E8CA 2UY4A 3D52A 3K8MA 3PZOA 4UOQA 2PI6A 3BXWA 1W3HA 7CGTA 1WAWA 1IZKA 2VUYA 4CD6A 4PMXA 3CUGA 4J3TA 2X0HA 2QMJA 3PZMA 3ARPA 2J78A 3WD2A 1UWUA 2WXDM 4P8VA 3VMOA 4KWUA 5IDIA 3VDAA 4D72A 1CXEA 1Q6GA 4OZOA 1EOKA 1CIUA 1TCMA 2WHLA 1CPUA 3VM7A 5JBEA 1OT2A 3LX9A 1GORA 3BSGA 3DC0A 1WCGA 4TTUA 4E8DA 1XV8A 2XFYA 3VNYA 1NWTA 1CWYA 5ABHA 5D9NA 4CD4A 1UWRA 2IXUA 2D0FA 4H2CA 3RO8A 4E4PA 1LL6A 2J74A 1IV8A 1CGVA 2ZUSA 2XVLA 4OKDA 1VBUA 4AZ7A 4AZCB 3RILA 2BY1A 2J77A 2QV4A 4JL1A 3WEZA 5FL0A 1MQRA 2E40A 2PWDA 1UASA 4H8VA 1B3WA 3EDDA 1B0IA 4MNMA 4OGZA 1GOMA 1MVYA 1E56A 5A8MA 3ZT5A 5A3HA 3D4YA 1V6UA 3MUZ1 5EMYA 2VCCA 4P7RA 3D3AA 3BVTA 3RJXA 1VBRA 4B3LA 3WNNA 3VMPA 2D3NA 2D22A 1GHRA 3ARVA 3WY1A 2QPSA 1E6QM 1BG9A 3ZMRA 1E72M 4FMVA 3CZKA 3UESA 5CQ1A 4AMWA 5A6SA 3AYSA 2CBIA 2NW0A 3WY3A 2X05A 2WNWA 2FGLA 3L4WA 4WIWA 1PIGA 2CBVA 2CESA 2F2HA 3ARXA 1E5JA 4F9JA 1C8YA 4AZCA 1XC6A 4U33A 1LJYA 2WKLA 3SEPA 3AZSA 1SYTA 2Z1KA 1CGYA 2OYKA 4AW7A 2ESCA 5EFDA 1WP6A 3GNPA 5A1AA 1CBGA 1H1NA 1XCWA 4BQ5A 1U2YA 1IT0A 3S5ZA 1Q6CA 1UHVA 1GVIA 1OM0A 4A4AA 1H3GA 4YHEA 3H54A 2XIIA 3GZAA 1OB0A 2V3DA 3WQ4A 1MFVA 1TQUA 4CN6A 4AISA 1VJSA 3AZRA 5FL1A 3UR8A 2PWHA 4K68A 2MANA 3I3DA 1OGSA 2QHAA 4FK9A 3L2LA 2DH2A 3WH8A 3L4YA 3PBGA 1C7SA 2FH6A 4TOQA 1CZ1A 1C8QA 5CGTA 4UTFA 1K6AA 3S2CA 3ZOAA 2JIWA 2J62A 2WBGA 3WELA 4J3UA 1VEOA 1KGUA 2OWXA 1O6IA 4DWSB 1E3ZA 1OIMA 3RPMA 4AZIA 4KGLA 1X6LA 3MMUA 3LPFA 1E6RA 1OCQA 3BC9A 3AMKA 3HN3A 3VIJA 2XJ7A 3VNZA 3IAQA 1W9UA 3GXTA 5GNYA 3AXIA 2DIJA 2WK2A 1MFUA 2EO7A 2BY3A 3WH6A 2EPOA 1QI2A 2J25A 1UD2A 1IZJA 2YL9A 4HZ8A 5A8QA 2J8GA 3GYCA 2DSVA 1W9DM 1W1TA 3D5HA 2XFRA 3MU7A 1W91A 2OSXA 3IGUA 4JCMA 4PMOA 1MW0A 2C8NA 5I0DA 2BHZA 1JXKA 2V5DA 2F61A 2PB1A 4AY1A 3AIVA 1RPKA 2ZX6A 4EAMA 1ITCA 3BSHA 1UD6A 2YL6A 4UR9A 1VRXA 1WDSA 2VX6A 1JL8A 3RIKA 3OZOA 2Z1SA 1FH9A 1SZNA 1GPFA 3AICA 3WUBA 1VJZA 4DWSA 2DT3A 3ARWA 2DEPA 3CPUA 3ZJ7A 4R27A 2J7CA 1KBBA 5A6KA 3NDYA 4N0RA 6CGTA 5I79A 4YHGA 5DF0A 5HPCA 2W5FA 4W87A 3WY2A 2WC7A 3MUAA 4DO5A 1NARA 2F7OA 3DHPA 1GZJA 4C7DA 2GDVA 4BZYA 3ZJKA 3TTYA 3HU7A 3WH7A 3WF0A 3PZTA 4W8BA 4UZSA 3VINA 1JNEA 2CEQA 1B90A 4ZXLA 3SUSA 2DQXA 3WQ8A 3ARRA 1E0WA 1V3JA 1HTYA 1ZS2A 1UWQA 4Z2KA 1TE1A 1TA3A 1YQ2A 2DPEA 4GZJA 4NX0A 4M80A 1GOKA 2NT1A 3BAIA 3AZTA 5EB8A 3SUUA 3W25A 4EE9A 5C71A 2WBKA 1EDQA 1B31A 1XH0A 2DT1A 4NZJA 1VB9A 5CPTA 1XGZA 4HOXA 1R7AA 1R87A 3LMYA 2XM2A 4UQ9A 1CTNA 1RP8A 1HKJA 2BVYA 1HWWA 1WZKA 3VO0A 1E4NA 3N17A 2CETA 3EYPA 1KGWA 1YHTA 2W66A 3GNRA 3GTNA 4D6CA 1PS3A 2QLYA 1OINA 1V0NA 1KWKA 4GPNA 4LYQA 4PTWA 1C93A 1EHNA 8A3HA 4W84A 3AI0A 4BCEA 5HPOA 4L4OA 4LXFA 1VF8A 2O9OA 2J47A 7A3HA 2YL8A 4GZEA 2ZUNA 5IXEA 3TV8A 4F79A 3WDQA 1EA9C 3WQWA 1PX4A 2EQDA 4AD2A 3GXFA 1NM9A 4GO8A 3VGBA 2PBOA 1BG4A 3AFBA 1UR1A 1HIZA 3ARYA 2WWDA 5LYRA 3B8SA 1VIWA 1GOWA 3WD1A 2XVGA 3L4TA 3BH4A 3U7BA 1KXVA 3VSVA 2OYMA 2WZEA 3A5VA 3NUKA 1FP9A 3ZJ8A 1G0CA 4AEFA 4OOUA 4GZIA 1XSIA 1ISXA 1CXFA 4C7GA 3BUQA 3BLKA 4TVUA 3GH4A 4UOJA 4UFJA 3EDJA 1QHPA 4HPHA 1EDTA 4UNIA 5I77A 1JIBA 4HZ7A 1P6WA 1U33A 4U5KA 1HKMA 1GCYA 2D0GA 1V02E 4KMQA 1M7XA 4DUWA 1H09A 3RMEA 3PZ9A 5A69A 3BCFA 1HF6A 2WVSA 3AS2A 2E4TA 3ARTA 4JFSA 5CGMA 3CLWA 3SCNA 2BVDA 1HN1A 3ZT6A 3OLIA 1D3CA 2ZUWA 1L0PA 4FLOA 1FHDA 4J7RA 1V0KA 4JZ5A 5E6YA 3WMCA 3OLEA 1E40A 1QX1A 1A3HA 1ISZA 2YL5A 3BVWA 1AQMA 1QBAA 4AD0A 1AMYA 5AC5A 2VOTA 1J01A 4AZGA 3BLPX 5A2CA 4AZBA 5CG0A 3EBVA 4CUCA 3CC1A 3MV11 2OWCA 3F5JA 4IPLA 3SUWA 1JI1A 3WENA 4UFIA 3NSMA 1D2KA 1E4MM 1DWFM 4F9DA 2XWDA 3DECA 4X0NA 2ZXAA 3BAJA 2VI0A 5DT7A 2A3AA 5AC4A 2GVYA 5CLWA 1H41A 4HOWA 2YBUA 4CU8A 3FAWA 4ZEPA 2C0HA 2WMJA 1MW1A 3EMCA 2X09A 1ZBCA 2O9PA 3TTOA 4JHZA 2YA0A 4MADA 1OD0A 2EJ1A 5JIWA 2QPUA 3UG3A 2NSXA 3W29A 3KL0A 3HG4A 3WMBA 3ALFA 1UH3A 1J12A 1QPKA 5A8OA 4TXEA 3OLDA 3BAKA 3KEHA 2CBUA 1R47A 4M1RA 3OZPA 5BRPA 4P8XA 2ZX5A 1W9PA 3DX3A 3RCNA 4AZ5A 4FNUA 2IUZA 3CUIA 4H7VA 1HXJA 1UD8A 1UKTA 3W81A 3WIJA 1RD6A 2G8ZA 1LWJA 3W27A 4IPNB 4C7FA 4TX6A 5C70A 3EJQA 3ZO9A 3SCPA 1FP8A 1G1YA 3RM4A 1GOQA 1QNOA 4AWEA 1H2JA 1WZAA 3UETA 3B9EA 2BY0A 3TONA 1W9XA 1UR8A 1E6NA 1VEPA 2X2YA 3WD0A 3GBEA 5E0FA 4W93A 5JBFA 1WDQA 1BQCA 2E8ZA 4ZE5A 4AD3A 4XZBA 1V6WA 5FOOA 5I3DA 2VMFA 3B9DA 1SMDA 4JCLA 2YFOA 2VX5A 3M46A 4H8UA 3K1DA 2HVMA 2V3FA 3AMLA 3ARUA 2GDUA 4RL3A 2E0PA 4WSJA 4F66A 3CUFA 3KL5A 2ZUVA 1TFVA 3MUIA 5GNXA 4ACZB 3GXNA 3QHOA 2D20A 1PBGA 5EFFA 2WVTA 4FNPA 1MXDA 1QW8A 1NP2A 2V3GA 1F4HA 4B9ZA 3WNLA 2VJXA 4JKLA 1PIFA 4D1JA 4QCFA 5DT5A 4OIFA 3WBAA 1JYVA 3U5YA 3BVVA 3VDBA 1B9ZA 1KTCA 1TQSA 1GJUA 1C3FA 4URIA 3TOPA 4YN5A 1QI0A 2XTKA 3K8KA 1GQLA 1R33A 3IJ7A 4HA3A 2CKRA 5E9AA 5E70A 1HT6A 5HBFA 2BY2A 1E70M 1J0KA 1US2A 1PX8A 3AROA 3ARZA 4BQ2A 1UA7A 3AHVA 2X2HA 4ACZA 1XYFA
chains in the Genus database with same CATH superfamily
2D7TL 5BUGA 4LSUL 4ZFGH 3VYPA 3S9DB 2QJJA 2YMTA 1UTDA 4H00A 4DELA 1M2OA 4CC4C 4AIEA 5E8OB 2C9UA 5MEOB 4W85A 1S2AA 1OFPA 3B3BA 4P2OA 2O1AA 2Q3ZA 3QORC 2QJHA 3J8F7 4P4KA 7PCYA 4A2EA 5TE7H 2E9IA 2X4NA 4XPGL 1JI2A 4AIXA 3S37H 1HL5A 1UA3A 3V4VB 1JDDA 3AM8A 5BZDB 3M45A 3M5ZA 3T3MB 4WIQA 3VILA 5FUCE 4XMXA 3ZKND 4XN2A 2NQCA 1H6UA 2RMNA 5E1AA 5DQJB 4RDWA 4PR5A 1KCUL 2AERT 3HV9A 4P2QE 5CZKA 4O9HL 1CLXA 3PWLA 3JR2A 5I16A 3QI9B 1LM1A 2J4WH 1M1XA 4HSOA 3D0AA 3WL9A 3LZ3A 4HNVA 1DUZA 1K9DA 1AQFA 5DXXA 1I0BA 3DV6A 5F7FA 2RCSL 1AO7E 1F8IA 2E86A 4XZHA 2YPVA 1K4DB 4MNHB 1X5ZA 3NQDA 1TPVA 2DM7A 5I6SA 1TOXA 5DS1A 3IK4A 4G72B 3CV6A 1P4UA 5F9OL 3KS0H 4POYA 1E6SM 5C2BL 4QHMA 3T4YA 3HZVB 4GAAA 1E28A 5HDBF 1KFBA 2DQUH 5IIEB 4M1GL 4H5SB 2P1FA 3RNKA 1EWEA 1PG7W 2MNJB 4E41A 4GMEA 3VYNA 1FZOB 1S7WA 1BVNP 4XVUD 4WDXA 4R0LC 1QSED 4RFOL 1FWSA 1CDGA 2ATKA 2OKMA 4I18A 4KK6C 4ODWB 1N8WA 3UH8A 4PCFA 1SDDA 1MWAA 2C9RA 2EADA 2MQ0A 3S6TA 1XGRA 4W4OA 1M7JA 3HG1A 5KZCB 1XGPB 3DLQR 1QQDA 2Q8LA 4MAUH 3ZDWA 3D85A 4KMTL 2BIQA 1ZLWH 2YQ3A 3UTQB 3M0MA 1IE7C 5FYLL 2CG9X 5IMLB 4R4ND 3WNMA 2P8LA 1B57A 3G1HA 2X28A 4LT9A 4AWTA 5KETA 3CZEA 1NAKH 4KKLC 2YD3A 3FQRA 1KTDA 3HPZA 4UIMA 2PRLA 1JWMA 2DW6A 3PWJA 1MF2H 3SO7A 4CU7A 4RA3A 2Z93A 4GI8A 3GZ3A 3IXAA 3RWFB 4ZMXA 4JANB 1DBML 4POCA 3BIAX 4I1PA 3CFEA 1OE3A 2CCWA 4AYSA 5KVDH 2J66A 3VAVA 2CLKA 1ZRUA 2VFDA 3QCUH 4CQCA 2Z1PA 4MG4A 3R7MA 1E4IA 4N2BA 4DJDA 2CZEA 4PU2A 3GDRA 1SO6A 3PTMA 4HK7A 4ATWA 4K5NA 4ZUUB 3QUYB 3UL4A 1FHNA 4HKXB 2PF0A 2PPEA 5FEXA 3PG8A 2NY3C 1SZRA 4LSPL 4CVUA 2WLHA 1GGCL 2MTPA 5JZ7D 6FABH 4LESA 1QPPA 3THCA 4LEXL 2D31B 3IETB 3C5SA 4P23B 5IM51 1IEWA 1UVQA 4XXCC 1J5TA 3RPDA 3LHAA 4J3SA 4ZOCA 3I2CH 1S7RA 3WHXA 1XD1A 3MRFB 4XZNX 5IQ7H 4JE4B 4PTXA 3CVHH 2X12A 4LCCB 5EOCJ 4RE3A 1XAKA 1U36A 3V5KB 4IMFA 4N6RA 3P9LA 3WQGA 1WBZA 4RFEB 3MV01 4OD3L 3KR3L 5G55A 3WY4A 4DUVA 1QSZA 3F12A 4Z2JA 5EZJB 4KNSA 4ZYKA 3ILPB 2FVLA 4L1XA 4F0SA 5BXPA 2EDOA 1LO5B 4LASL 4WLCA 4OZIA 2MEJB 2X4PB 3BW3A 2OI9B 3QJOA 1CDHA 5D2WA 5F1KC 4UTLA 3LMJH 3ZXWA 2FYMA 3SDAD 1ZK5A 3U36A 1T5XA 5A6TC 4JW3A 5INDA 1W0VB 2G30A 4IBYA 1VENA 3SE8L 1HK6A 2VDQL 3O6MH 5EIIB 3UEZA 2CGZA 4HB7A 3JV4A 3U7WH 3O2DH 3HUJB 2DN7A 5E4IA 4D1IA 3IYLW 2DQFB 3IVUA 2YPLD 3LRLA 4FL4C 3DMMD 3J7HA 5AOLA 3L1FA 4G82A 5KOMC 2QCDB 1HFBA 3BAYA 2I5GA 3PY9A 2CO4A 2V9TA 2PPAA 3A47A 2MMXA 1CE1L 1IFRA 4HBCH 2BDQA 2VXNA 3EJPA 1F2JA 1DUYA 5LVEA 5G1TA 5I09A 1G6RH 1RK5A 1AXIB 5AL8A 1E15A 4PA8A 3WSUA 1C16A 4P9HL 5D8JL 5T8IA 4ECNA 2A9AA 1WZMA 2WLIB 2BPBA 2NY6C 4MNQD 2X4NB 4QT5B 4LVOB 4LQ1A 2NLJB 5JUEH 1OVZA 1NCWL 3E6FB 4EI0A 1H4PA 3TJHD 4H6RA 1D7FA 5SWZE 4PULA 1I3GH 4GIEA 4O16A 1SUHA 3HG5A 4X9SA 4GSRA 3U83A 2EC8A 5FA4B 3NQ8A 2JI1A 4XQ6A 3PQYD 4EXKA 1BLNA 2PPFA 5FB8B 3ES6A 4WV1A 3ALPA 1M1XB 3BG3A 4RNIA 2Z8WC 4JN2A 2GT9A 1ISWA 1ZQ5A 1X1OA 1D5ZB 4DHLA 2J9XA 2OR2A 2VDOB 1NFIA 2HJPA 2FBJH 2GJRA 3NRQA 4NC1C 3WF3A 2YPVH 1UR4A 5KMYA 2OZ4A 1QK2A 3WKZA 1DJWA 2AEWA 4ZO7A 5F7DA 5HAOA 4DXKA 1YZZA 4CEXC 4JJ5B 4RGMB 3URNA 4HUVB 5E2WL 3W5NA 1YY9C 4RMWA 1Z9SB 5E8NB 1RSCA 3UCDA 2B31A 3G5ZB 3NSNA 1S7WB 4ZMOA 2OOFA 1I9RL 4OAWA 1CLZL 2XQBH 3WFBH 1UXWB 4AEIH 4OCWH 3RTQB 1NUDA 5C6MA 4IKJA 4HIBA 4RXGA 3CZUB 3NZSA 4X2UA 2VLKB 1ZHLA 4GO9A 2YZ5A 1MWAH 4CBPA 3EOEA 5KYUB 4J3WA 5F88B 3ZBMA 3QDME 1QQDB 1BGXH 1PKMA 4PYHA 4H6QA 1B54A 2X42A 5J89A 4JEGB 4IRJA 2V5RA 1KNWA 5FOBB 3REQA 1OADA 3SKMB 3SBRA 3EJCA 4F2MA 4HWEL 3QNZB 1UUMA 2A3HA 4JLRB 4Q9QL 3WMLA 1KTDB 1FHGA 1X7IA 2XPGB 4UIMB 3BHBB 1JWMB 2CHXA 4IIBA 3B4UA 4AFYA 2VE6A 5EORH 4M6QA 3IXAB 3JBG7 2QIWA 1BHGA 5G4MA 5BXTA 1LMIA 5AZ0A 4JG5A 5I5MA 2UWFA 1T6WA 3K4DA 1LK3L 2Z2UA 3WJZA 1A9BB 4PUNA 4OT7A 1SVBA 4X6CF 1AZNA 4WI0A 2QL1A 4Q7IA 4YTUA 3LRKA 2X7WA 4HK5A 1UB5B 3NCEB 1BTMA 4UINL 2ADIA 3RJQB 1NBCA 2WJ7A 3LD8C 1TJHL 4UT6L 5JDJA 1Y8BA 2KT6A 2Z26A 1OX5A 2FLBT 3LNDA 3BT0A 1QPNA 4OCYL 3FNKA 1NEYA 2BDNH 5CJNA 1IEAB 3BZJA 4Q7NA 3VYLA 4BWLA 4BBWA 1UENA 1FLRL 1NP0A 2B14A 4L1LA 1F45A 2BOGX 5D2YA 4DPRA 2WWMC 4NQDB 3GJFA 5L2JA 3CSFA 4OLZH 1W3NA 4FZEL 4A2LA 1EP2A 4WY0A 3TYDA 2WNZA 3ZE0B 4UAHA 4KCUA 3MPCA 2BJML 4G70B 4PCTA 3MLXL 5IHZB 3EBGA 4UFLA 3PBUA 4L18A 3N9KA 1VPXA 1T7XA 2XSAA 5T3ZD 4I13B 1SN5A 3QIBC 1I8MA 4AL8C 5F96L 4Y9MA 4G8FA 4RWHA 3R94A 3F12B 5DWUH 1HX0A 4UXDA 3MANA 4CD5A 5I0WA 2Q01A 2PW1A 1M4KA 4EN3A 4OZIB 4AV5A 1TTBA 1ZV5A 3SAZA 1Q6DA 4OH2A 1OFEA 5D30A 1SBSL 5DD5L 3HZKA 3OKMA 4U1JB 1V6VA 3NSCA 1MI5D 5HNUA 4A7GA 4P5TC 4DK6A 3F2BA 2JQZA 1BAWA 3DFSA 3EH4B 3T0VA 4R5XA 3DOSA 4J28A 2PMZA 3KRSA 5T9CE 1RZGB 5TD4A 4YDZA 2QQNH 3FSVA 3VD3A 4KQ0A 2FD6L 1OHZA 2QMKA 1JVKA 1S1PA 3D3VD 3IKCB 1BIIA 2QCCA 2P53A 1C8XA 3EWZA 1S1RA 1GVRA 2WMIB 4Z7QE 3F4VA 3FUKA 3UX9B 2Q6WB 3ZDYB 5BCAA 3PZGA 4F9LA 3VGEA 4IUGA 4O2FA 1GEHA 1JFXA 1OAUH 3U4KA 4GYBA 1RKRA 1IEIA 4WFHE 4MNLA 3GJEB 1WG3A 2V5SA 2IQ0A 2J2ZB 5F9DC 5BS0E 1JWSB 2RJMA 1PEZA 5C0GB 1LO2L 4FDWA 1WDRA 1BGAA 1LBLA 1N64H 5KYYB 4TSBH 1QVBA 4HGXA 1WNOA 2DKMA 4BF5A 4HD5A 1A22B 4LX4A 2BERA 1N0XH 4FI8A 1BLNB 1RK6A 4EI5C 3R1ZA 4TV3A 5XIMA 3QZPA 4N6QA 3P2DA 4IRZL 4JN2B 4NZFA 4OQVA 3INUL 5G1YA 1BZQK 2IKIA 4Z7WA 4HHAB 5AVSB 3O6CA 4MCZA 3ULUD 2R94A 1XBVA 4IIQA 4P8VA 1EAJA 4EDXA 4X6DF 2DYPA 4OZOA 1EOKA 3F05A 1Y6NR 5F7DB 1S2CA 2OZ4H 1GORA 3OD3A 4RAUA 2JELH 1MCQA 3ITVA 2OT1A 3KHOA 1XCTA 3V0AC 4LSQH 5DC4B 1BKHA 2IOIA 4IBZA 1UZGA 2R24A 2RIKA 3SDDD 3H2NA 5D71H 5FV2A 4AZ7A 3P3YA 5I1AB 2WW8A 2XU2A 2CHWA 2PWDA 4PJIE 2V37A 1EHXA 4H8QA 3JTSA 2B77A 4FF9A 4WW1A 1CLOL 5DBTA 3IACA 1K3ZA 3KXFE 1XMEB 4MWAB 3LY0A 4WSHA 3APCA 3D3AA 1LEIA 1ZHLB 5GSVA 4O02B 3VCLB 2CLOA 4ZOEA 5CGQA 3VXSB 3UESA 5EOTB 5JYLA 4AMWA 2ICWI 1K3IA 3HI6H 1NICA 2AK1L 2C3HA 4IRJB 4NBYB 1P6BA 5GJPA 3LRGA 2FGLA 1HNFA 3GS4A 2R1LA 3IRZA 1YTEA 4K7PH 1UJ3A 1A6TA 5EPMA 3BD3A 3PUOA 3L08A 1OM0A 4YHEA 4D8LA 3U0WL 3LKQA 2VE6B 4C1NA 2XETA 1MFVA 2WKJA 4J4KA 2EE0A 5KANG 4X5WA 4ZMWA 2QHAA 3L4YA 4JFHE 5CGTA 2OXNA 4UTFA 4Z7VE 5IVXA 3STPA 3VH8G 4XI5D 1KGUA 2WQSA 3OPZH 5EO1A 1WBJA 5FJUA 4DWSB 4ZS6C 4EAYA 2P1YA 4RFNB 4WI0B 3L3OC 1PCKA 3N1QC 4PW4A 5HVHB 5T3ZL 1KFAH 3TWYA 1U92A 2HH0L 5C5YA 4DX3A 2YGYA 2ENPA 4U6YB 3C9NA 4Z7IA 1W9DM 1W1TA 5GISL 4AHPA 3MGTB 1XYLA 2A7NA 1SZFA 2AXWA 2PPGA 5I8KH 3O4LB 4L37A 5ADPL 3FQ1A 2YW4A 5IK3B 3H9HA 4B9FA 3TAKA 3CQQA 3ZJ7A 3S3CB 4TVPE 4AYFB 4L8SC 4N0RA 1JGDB 3RURA 5JIQA 3RI5F 1EFQA 3RNQB 3GJFB 3DHPA 4HNNA 3BQ5A 3WF0A 4AEHL 3GJFH 1TELA 1B90A 3KTCA 3SUSA 1AG6A 3I65A 5IROA 1RV6X 3A12A 4Z2KA 3NIDF 2PSNA 3CZFA 2XWJB 1GOKA 1JZDC 5J9PB 5CPTA 4NO0B 3SN1A 2PA6A 1I8MB 1HKJA 2E6PA 3QC5X 4G8FB 3BGFC 1T6VN 4NCC2 2Y6ZA 2PDWA 2GCYA 1FRGL 2OMZA 3H3PH 4F7TA 4Y4KC 3MRNA 3AI0A 4HWNA 3V6ZA 1X9LA 4ADSA 4KV5F 1X5XA 3WQWA 3KDMB 4NGHL 3IMUA 2ZZ7A 5D7JA 3RGBA 4A66A 1TJPA 5DS8B 2GTZB 3P69A 3QE5A 1OSYA 4P2RA 3CB3A 2RB8A 3NQKA 5JOPE 4Y5VA 1XSIA 4PP1D 4YQXL 3TH3T 2CA4A 2I9LA 1KM5A 1KBGH 1H3PL 3DO4A 4L4VB 4GJ1A 3OSKA 4Q89A 5G2NA 4JPWH 3DJZA 4F80A 1UG9A 5E51A 3O06A 3V0WL 4APXA 1J8KA 2AEOA 4EOUA 4P48A 4E9SA 2VDKB 1IWPA 4NO5B 4PW9A 5KTEL 1LZOA 3LEVH 5BOFA 4PRHD 2DS4A 2ZC8A 4O2FB 3EYSL 1UM5H 3ULUL 2XZCL 4U6TA 1U8OB 2PYEE 3E3QC 1E4MM 2IPUG 3WBXA 1M1SA 2X4UA 3BAJA 4IOFC 2ZA1A 2AXGA 2GVYA 3HQ1A 1U95A 4GG6B 2QKFA 3EYUH 1FL5B 3O3UN 3E74A 1XCFA 4QNWA 1FIGH 4TM9A 3ALFA 4HUMB 1EHKB 2P5WD 4M1RA 1QSFE 3DX3A 4EF3A 3X14A 1UD8A 4JO8A 3EG9A 3DK2A 1E4WL 2SEBB 3P77A 1PMYA 3EJQA 3GW3A 3WFEH 1QNOA 4I9AA 1W0WA 1HEZA 5AZ2H 2WGXA 2VDNH 4PFMA 1E6NA 4GYPC 1CCZA 1F8TL 1KM1A 4KK8C 4G5AA 3IDMB 4MCZB 3D4GA 2VMFA 1RQ5A 2F38A 4C58B 4EDXB 1W5PA 3PB0A 2QJNA 1IIIA 4MNGA 3QHOA 3N55A 5E08L 5GS1A 2ZZUT 4LTSA 1TYJA 2AZAA 1MXDA 4KKAD 2ZYHA 2RAMA 1JYVA 5I8OL 1TZGH 4WZHA 1A1NA 2Y07L 4LRSA 3D05A 1C3FA 4YDJB 4LLWA 2IAMA 3E6EA 1P5UA 4WW1B 3O3DA 3VI3A 1LEIB 2WJDA 1M71B 4BEIA 1GAFL 3QR1A 3AHVA 3TN0D 5EUOA 3SPIA 3BUTA 3G5EA 1ISYA 4DN4H 4AJWA 4HJWA 5KUKA 1MRDL 2DQIL 1G7PB 3OMIB 2AMUA 3OVRA 3SCOA 2X89D 1QTPA 1SFTA 4CKQA 4MA3B 1SY6L 4RLIA 3ES8A 3WD3A 3FA5A 4TLSA 25C8H 4LOUC 1L9RA 3FW6A 3ARFB 3HS0B 2PC4A 3FA4A 1BJ1J 1VJIA 1WA1X 1OGTA 2Y7SA 1KB9J 3T2NH 5LXXA 1UOKA 3VFCA 3IS1X 2UZIL 3BIKA 4RGOH 1RVFL 4Q6JA 1CFNA 3IU4H 3FYPA 1FNLA 2BCMA 1NINA 3M0IA 5DHVA 2QYGA 3IJQA 1JZHA 4OJAA 3NN8A 2F7RA 5HGDA 1WK0A 1HKLH 1ULVA 5F89A 4ZNEA 5HYSA 3PFMA 2NR6D 5LGHH 2M8XA 3ERXA 3QUXC 4PY8J 1FCUA 2EJAA 1I7ZB 3ARBC 2EVHA 6TAAA 3NQVA 2D23A 4XPTH 1U3HD 3LI0A 2FIKA 2X0VA 2NV9A 5FF7A 3PPFA 4KXAA 2Z8RA 2DORA 5CH9A 3LKRB 3NJJA 4QO1A 3WQ6A 4G6KH 3U0PA 3KEDA 2Z34A 5EU6D 1BZ9A 2AAAA 2G4FA 4FFVD 3RFZC 1Q72H 1UKPA 3HIZA 4Q0XL 4U1KA 3WH9A 3RFAA 3GVGA 3CX5J 4HYRA 4N2DA 1FY6A 1A66A 5E2UH 4QDWA 2ICSA 3C0QA 1OAZH 3PBYA 4X83A 1B3OA 1D9KC 5IWLC 1AACA 2ZE0A 2IBGA 5IQOA 5JOEA 1E42A 3EKZA 4S1SH 3PS7A 3OBKA 3US0A 4W9ZA 2NY1D 2OMZB 4F7TB 3GHEH 2RGSA 5DJZA 4XV0A 2DKUA 3MRNB 4FQQB 4KK9D 4F20A 4PE8A 2O92A 4H26B 2XBDA 4FNSA 5D7JB 1Y5WA 3LXUX 2PFHA 4ZA0A 1N8ZA 4P2RB 1KIPB 4OLUH 1GGUA 5GJTH 3G6JB 2LLNA 2PU1A 1HHIA 1AD4A 2K8MA 5I02A 3TCTA 4R9XA 4Y9NA 4TSCH 5AVWB 2XGBA 1YG9A 1P2CB 2ICWJ 5FIPA 1DL7H 3SJVD 3TBTA 4MFDA 5DVPA 1F07A 4Y8EA 3OKDA 5IB1A 1XKJA 1UR0A 4FIRA 2CLVA 3P82A 4QITA 3QR0A 5I1LA 5KSVA 5GRWA 4BSJA 12E8L 4H8HA 4I9WD 3UT0A 3WG6A 4NSBA 2E1DA 4OUIA 1CT5A 2FJUB 4Z3EA 1QWGA 1KM4A 1XYAA 3T8XB 2BP0A 3RWJA 4KETA 1QW9A 1K4HA 1HP5A 4U1LA 3FB8B 1WEJL 3S2JA 4TV6A 2QV2A 5I17A 5EC2A 4PCYA 1JZFA 3RY6C 3Q8CA 3UTTA 2VZOA 3VGAB 2BMKA 5TQ2H 3I9GH 4NQTA 5FGBC 1DQLH 2DQMA 4KITB 5MEQB 3TVMB 2FSEB 3ESVF 2EIKB 2QULA 2A9CA 1IJNA 4U4IA 1UKOA 3AUOA 5LGYA 1W72A 5D7EA 1XLGA 4X9YA 3C6LC 3CVDA 2X30A 3EG9B 2Y7MA 3SO3C 2GGGA 4OLYH 3P77B 4JPKH 2DSUA 2V5LA 1U4FA 4JDTH 5KVEL 1F1DA 1A4JA 2H26A 2Y3NA 3IDJB 3MJ7B 1CICA 5EU4A 1D3HA 3W22A 2Y5TA 1TEGA 4C6MA 2EG7A 2BVEA 4J2XA 1KM0A 4KFMA 1BXCA 2V8LA 2P43B 2NNAA 4YSTA 3L3JA 2INZA 1H0GA 3CFBB 1URIA 3ULVF 2FEEL 1E0TA 3MS8A 2D03L 4L8DA 1EXPA 5HUOA 2EDHA 1FA2A 2EYRA 1A1MA 2H3NA 1D7BA 4PREA 2DEWX 4C54A 7PTDA 1R2SA 2D7PA 4LLWB 1KLYA 1E5NA 2IAMB 1G69A 2IGTA 1F4WH 1GYCA 4KRPD 4KHXL 3EX4A 1OD7A 1W5MA 1JNNL 3AG4B 5J4MA 2VEFA 1ASPA 2EDJA 2VITA 4P3CL 2OZ0A 1F0LA 1CBVL 3BZEA 4WCYL 5EUOB 2NY4B 3L3GA 1SQMA 1JXJA 1JVOA 3OAWA 2OA9A 1QFPA 3FFCA 4KIRA 4YR6B 1OD8A 4V2CB 4UYQA 3SDYL 4G9FA 1FQ9C 2GITA 1KELL 3ZZQA 3EJJX 2WMGA 2Z25A 1Q8JA 5EBGA 2JF7A 4PWHA 3BOLA 2MOVA 2PTDA 2ZXWB 1FN4A 2WM1A 4HUWB 3BQUA 1OP3K 3EXJA 2FJKA 2F68X 3PWAA 2EXOA 4BS0A 1Y0LB 5EU9A 4LRIA 4S2CA 1C5BH 3RL1A 1OW0C 1KENL 5D2NC 1W16A 1P0KA 5KANI 3GH5A 3HOJA 4Q9BA 1TV5A 4P0DA 2VENA 3EXLA 4ALAC 2BWIA 3SGEH 3CN4A 4E9RA 3OKKB 4K15A 2OMWA 1NLDL 3QFJA 1A50A 4AQ1A 5FJTA 1LDPH 3B9NA 3WNKA 3NQCA 5DHVH 1Q7QA 3VD4A 3S2MA 2N1KA 3OKOA 5HGDB 3N3MA 1IC4H 4GBXA 5F89B 4TTDC 3PJWA 3CV7A 2GSMB 3OB0K 3ESPA 1IQ8A 2AI0L 4LWWA 3W1MA 4NQXA 2BP1A 4MTMA 4ZK8A 5PTDA 4Q33A 5EEVA 1H8SA 2DY3A 4NQEA 4M7LT 1KBWA 4Z7NF 3WF4A 4YHZL 2FBOJ 3KJ4B 3G9AB 3HC4L 4B4FA 3IU3A 1I85C 3THUA 4QO1B 1HSBA 4XPHL 5A40E 5GIRB 5IB4B 5DO2C 5DC9B 1O4UA 3LXBA 2WQVA 1W56A 1SUJA 4JKPL 3KP1A 4YXHL 1N70A 1CD0A 4M3HA 1QFUL 3QB7C 4ZUVA 5K9OB 4N2LA 1MFCH 1W1VA 4CNNA 3WUEA 1JNHB 5D2VA 1ZHKA 1K70A 3LCLA 2BNJA 3MNWB 2GJXA 1YEDA 4B90A 3PNUA 1MKFA 2DQJH 1MVFA 5I18H 2Z00A 3SYOA 4NRSA 4WW2C 1ZT1B 4JFEE 4JFDE 4NNXA 5LNDA 2ZRWA 4IOTA 5E6IA 1S2VA 4DJFD 3BG9A 3BP5A 2BS8A 3NK3A 2HWGA 3SQOH 1AGEB 4YWSA 4OR1A 3EOAA 3DHUA 4I2XE 4LALA 4QCIB 3P14A 3RA7L 5TNVA 2GJ6E 2IQDA 3CK0L 1XYZA 1US0A 1GTHA 1FO0A 1ZHAA 4UM8B 5CJBA 1BQLL 4IGSA 3GIZH 4X99A 3AREA 2EACA 3UPMA 4I0PA 3I50H 3WXVL 2ISDA 4B5XA 4NAFA 3F7KA 2A3EA 2A38A 3OKDB 1Y6MR 5AZ1A 3SDXF 1I8LA 5KSVB 3DX5A 5I9QB 4P46A 4O1AA 2ENQA 3N13A 1S5HA 2F6UA 4C6PA 1T20A 1RJQA 1P5BA 3C5XA 4OM1L 5BQDA 2AK4B 2XVNA 3FTVA 3UYRL 4G6FB 4H1ZA 3HLAB 2FX8H 1N5AA 4E42A 4H1LH 1RLWA 5D5MA 2GUOA 3QC3A 2LFEA 5IFJA 1FC1A 4N20A 5LNUA 2BMKB 1H7RA 1XX1A 4QIUA 1JCLA 4UFKA 1TLKA 2BWDA 1XSOA 5T5NG 2E7LA 3BVXA 2CXKA 1NFDF 4GQ9L 3Q9QA 3JWDH 3V6BR 1NMBL 1PU0A 4AT6B 4ZSOE 3RJDA 1U91B 1W72H 3H2PA 3GM8A 2I07A 2WO3B 2MNRA 2P4AB 3E8VA 1PZ0A 5M95B 4X4ZA 4NPKA 4P57A 4E0RA 2A6KA 3B8UA 1CLYH 2E7MA 1SXBA 3SD2A 5GS0D 3NYDA 2VDPH 4MJIA 5CN1A 1ODUA 3OPSA 1S2WA 3H2AA 1T0NB 2KS0A 1MJJA 2NY2C 3N2JA 2XXMB 3ZTCC 2B0SL 2NNAB 3GO1H 3THML 2NY7L 3IFNH 1PB0A 4N0YH 3DETD 1I9CB 3L3JB 2WLNA 4DQAA 1W3LA 1KCSH 4M7ZB 4E2VA 3LXAA 1N7ML 2WYSA 4TULL 3H8AA 3MUHL 1B0WA 1A1MB 3CZ8A 1AKJA 3UEQA 5M7QA 2PDGA 4P4RA 2V82A 1Q9LA 3F5LA 4AQLA 1GMEA 2NRDA 4WJEA 1QNPA 3BW2A 1RJYA 4JTLA 1GHFL 2ZXDA 4D9LH 2GJPA 4GVHA 4MNJA 2BSTA 4ZMTA 3PV7A 1DHKA 4HSHA 4W70A 4M4RB 1NBYA 2NQZA 3LNFA 2VITB 1EO5A 5BQ7B 5MENA 4AZ8A 3HPFA 3BZEB 3OAYK 3NZRA 4O8RA 2ENJA 3S37X 2W4XA 4LL9A 3TZVD 3DBXB 2CRYA 3NQIA 5D32A 1QNSA 3TW6A 3AY2A 2IQ9L 4PJFB 1BF2A 3D25A 4JUSA 3RDTD 4R84A 3WK0A 1CI5A 3BQUB 3CLEL 5ERWB 1W6LA 3E9TA 1W2VA 4F1ZA 2WSDA 4Q4KA 3SBFA 1M9WA 3VXUE 3TYGL 4Z2LA 4PGLA 4XVDA 5LDSA 5BRZA 4LSVL 3PAOA 1ASOA 2WSYA 3B9KC 5ID1B 3VRLE 4X3ZA 3ZQ9A 5GZOC 4XR8C 1XF5A 1TUXA 3NCMA 5I1IH 2OMWB 2PEVA 3Q1EA 5DD1L 1DBAL 4NNPL 1EXUA 2PO6D 3RBSA 4GZ7A 3JZYA 3ONCA 3LSBA 4C65A 1QI3A 3N15A 3OKOB 4GW4A 3ZX1A 1AGFB 3SDCC 1A65A 2MFNA 4N4YB 3I85A 3CAKA 3ARGC 5L4JA 3T3PE 2V30A 3VOHA 2QCEA 3HAEG 3N3EA 5FF6A 3IFLH 4NQXB 3RB5A 2XZ7A 4PLJD 3PZMA 3ARPA 3ZKMD 2XFXA 3EGXA 4YDNA 2UZ9A 1FH5H 1A5CA 5K33A 3BSGA 4C4UA 5CWSA 1ZTXH 1FHVA 1TIWA 1G6RA 1UWRA 1RUKH 4H2CA 1KYFA 2J74A 1ZXQA 5FA3B 4OKDA 1S3KL 1YAZA 2NUTB 1CK0H 1T80A 2QEZA 3RRQA 2H90A 3EJYD 3QIUA 1BVLB 2NUYA 2DOCA 1B0IA 4YHLL 1ZHKB 4OGZA 4K0OA 2W80C 5L0QB 1YEDB 4JFXB 4QXGL 3BVTA 2ZYRA 1VBRA 5LXGH 3O11A 1TTAA 1OGAA 1MHCB 3ZMRA 5E6IB 5AUMB 3BP5B 4XP4L 1N8IA 4XIAA 4GKSA 2VLJE 4UT7H 2NTSP 3NJFA 3WKYA 1LLZA 4G8GA 1OALA 3W39B 2XISA 4UMCA 3H9SD 1MIEH 4XWOC 4Y89A 1E5JA 1TQXA 2YQBA 4FTVD 3EZJB 3S7GA 3EOOA 1SYTA 1Q8MA 4OECA 2OYKA 2VFFA 1FO0H 1U2YA 2NXIA 1IT0A 4DEPB 5IJDC 5I3HA 5FLVA 5DMKA 4I0PB 1BWKA 4XWGL 3GZAA 4HGWB 3S42A 2BCKA 4I87A 3DERA 1E51A 4LVHB 2EDKA 1FSKB 4L4LA 2JIWA 3E2HB 3K1KC 1FXPA 4JBSA 1KA9F 3ZE1E 1Q1JL 3JWOH 3WFCH 1T20B 3EWYA 5GS0L 4ZD3H 3UDWC 5D70L 3ID7A 4LSDA 2KLRA 5CPOA 3WH6A 3CNKA 1QI2A 1IKFL 1LP9B 4WJ8A 2H41A 3QH2A 3UYPA 4PJBA 3TT3H 3RZCC 4EAMA 3B5TA 1YEGL 4XAZA 5CGYC 4UR9A 3OZOA 2CLFA 4HIHA 3C09B 3OZKA 1HO1A 2R82A 4N2YA 2DT3A 3OXSA 1JHKH 3UJEA 4K7YA 3P4NB 1Z1WA 5DF0A 4YHGA 4W87A 1RHCA 4DO5A 2F7OA 2PTTB 5E4EC 1TYRA 5K5YA 3VWJD 5HULA 4AG0A 4W8BA 2C26A 5M2FX 3WKML 3ARRA 1V3JA 5F2MA 1UWQA 1E6OL 4YH6A 5BNXD 1TRIA 1EDQA 3APNA 4E0RB 4JKWA 4DOHE 5LG6A 1TV8A 1SFHA 3LMYA 2C19A 1XFPA 4JGJA 2GHZA 2NVCA 3TX4A 4MJIB 4D3CL 4ZW7A 3WLHA 2VC5A 1ML1A 5EWIL 2QLYA 2ATPB 3TCLA 3HMWH 5ICXB 4GD0A 15C8H 8A3HA 3ES7A 4OIBA 4GRWE 4L4OA 3W74A 5C0EB 4TQEH 1EA9C 3ZL1A 4N9DA 4R7NB 5HGHA 5FYLE 5I30L 2YPKA 1HIZA 5DT1H 5KWYC 2IO5A 4LY4A 3L4TA 3MA8A 2XH0A 4AJVA 1UWEL 2NDGA 1PLBA 1AKJB 4FE9A 2VHLA 4FG6D 3GBLA 4UFJA 3QPKA 1JIBA 3WUWA 4PJ8B 1RUPH 4NRXB 2BIIA 4IJRA 2GQ3A 4FQLL 2F54E 3V6FB 4RISL 5GRJL 1ADWA 2W65A 5C55A 4CKVX 1ZPLA 3BDYL 3ZT6A 4WGWB 5MENB 3ZXAC 4FLOA 1FHDA 3NEXA 5AC6A 1T4KA 3TNMA 3EX1A 1XF3A 4RZ6A 1EJFA 4JVPA 1GVSA 1U8HA 2JB5H 1YBQB 3CVHB 4H2HA 3T4CA 4HIIA 3QSTA 5L9FA 3K71B 5FYKU 1TZHB 1OCJA 1K02A 4X5XB 3T8QA 2FX9H 2Q87A 5HYFA 1L9OA 5IB3A 5IHUL 3EOTH 4O5LH 4OZHA 2RAGA 4OHQA 1EVTC 4TRPL 3C8FA 3UFYA 3N43F 2EUXA 1LBMA 3CSYB 4WWKA 1EJWC 2PGRA 2V4LA 4Z7AA 5I1HH 2VJ8A 4ZMYA 4MXWL 5IG7A 5FCUL 2BASA 2MCMA 5A8OA 3OLDA 3OZPA 1I1FB 3KDNA 4K9EH 3LV3A 1CC3A 4A6YA 2DTML 3IGHX 2NWSA 1DFBH 4ZAKC 3ZO9A 1JGMA 5KBMA 1GOQA 2XUWA 5EFIB 5CBAB 3UETA 2BY0A 3S3JA 1KFLA 1W9XA 2C18A 3AY4A 4M48H 1WCBA 1NIFA 4XNXH 3FTXA 1X7QB 4C55A 3H4WA 1MHPL 2R69A 4QEHA 3EX3A 4LOEA 4H8UA 4F0KA 2AVGA 1NSNH 1JPSL 3GRIA 3GXNA 1VH7A 2EC9U 1F3DH 4AYDC 2VZ3A 4MKTA 1M7PA 2ESVD 4GIRA 5CHNA 1XWYA 2VDLL 1YPZF 3G22A 1G6RB 1KB9K 5CSBA 2DUZA 1X4YA 2CALA 4P2OB 1QLEL 2PDPA 4DK5A 1GQLA 4P4KB 5I6XB 3LUTA 3PG2A 1JCVA 5EC1A 2DQGL 1CE6A 4O17A 3G3DA 4NZ5A 1EDYA 3TNBA 4NM8L 4OIIH 5E1AB 2TPSA 5KZ6A 4KQ4L 3WLRA 4H8PA 4PR5B 3BTNA 4DQWA 1L5GA 4AMXA 3KS6A 1E8WA 3N06B 3CHXA 2K6YA 4OGXL 3PWLB 4YL9A 5I16B 4FQPA 3BAEL 2C79A 3CWNA 4RPPA 3WL9B 3CFNA 3AOFA 3R1GL 1PDKA 1SHWA 4NJAL 3UADA 1DUZB 3P84A 4GQPH 5HHVH 3DV6B 5BW7C 3RTLA 5LIYX 2Z35A 5DMKB 1GT8A 4FABH 1LP6A 3FL7A 3CX5K 1JDEA 3WJJC 2BCKB 3TM6A 1QNVA 2WWCA 3QJHA 1EDGA 2BOBA 3ZK0A 2O5YL 3PF3A 2VXUH 4I8YA 3DFTA 4QHMB 3T4YB 2UYLA 3UTPD 1E28B 3DTXA 3VXRA 4HUNB 3AO0A 1SW3A 1QSEE 3RNKB 4PM1A 5HJXA 3IRSA 4GX8A 5D9MA 2IGFH 1KIRA 4BIKA 4E41B 4HHLA 1Z7AA 3Q2NA 2ICCA 4KHTH 3U5UA 4S3KA 1JGVL 5DC2A 1AFSA 2ATKB 4I18B 2Y7EA 3GC3A 4V11A 4MIMA 1D5IL 2WGNB 4PRPA 4HTBA 1SDDB 1MWAB 2G5BA 4Y4HC 3MJMA 1XGRB 3HG1B 1VF5C 1JJKA 4NC2B 4HIHB 4GNVA 1KCRL 1KEMH 3D85B 2NSOA 1S3RA 1A21A 2TMDA 2CBQA 1SLWA 4C47A 2J5WA 2P8LB 3FU6A 1S7SA 3MRKA 3TXVA 2R9HC 2DSKA 3RIAK 3LKNA 4UNLA 1B4JL 3FQRB 3H2FA 4IBQA 3T42A 4R33A 2FB4H 1QEWA 3PWJB 4LSRH 1HVXA 3W38A 2KUTA 1ITXA 4D9RE 2BTMA 4Y16C 4B96A 2OJ1A 3FCUB 1RA5A 5GRUH 1NBVH 1CR9L 2Z93B 1AZBA 1NC2D 3CUZA 2PUQT 2F7IA 3CFEB 3HE6C 3CAVA 4UILH 5I74C 3K4AA 3MMWA 3MOBL 4UQDA 2G3IA 3BKJL 2CLPA 4XCFL 2GSGA 1OM3L 5K39A 3REVA 4DW2H 3ELAT 2X6CA 2QT3A 3MMTA 4NZRH 2LE9A 2HYMA 2F8OA 4TVCA 3QW3A 1ZNNA 4ZUWA 2YIHA 3KH3A 1PIIA 4HZAA 1Z32X 5I73C 2X1RA 2JF6A 2AXHA 2WCPA 3C5SB 3DNKA 1IM3A 1F2QA 1UVQB 1W1PA 1MNUL 1DVJA 1T4KB 4MLRA 1IC5L 1S7RB 1TKKA 3WHXB 1KUMA 2VDGA 2DMHA 4GXUM 4AHOA 1FBAA 1AA1B 1CDBA 5IQMA 1J8HA 1E50A 1GKRA 4FP1A 3GH7A 3HPSA 1ZE3C 5C08D 2JKSA 2WNXA 4N6RB 4PBXA 1G7LA 3P9LB 2C9QA 1ASQA 5IB3B 3NQEA 1WBZB 4AGNA 5FGCB 1BQHG 5D7LE 3NIDE 3RY5A 1RZQA 5C7XL 4ZYKB 4BFIA 3NPSC 3FB6A 4NFDA 4HMDA 4LJ3A 4B4HA 5E7FA 1SNRA 5K1VA 3T0XA 1FG2A 1HXYA 3JV5A 3OKNA 4EZKA 1CD9B 3U36B 1T5XB 4KV5E 4A6YH 5INDB 1PKQE 4BQ4A 3FT3A 1VEMA 1AHMA 1JZGA 4WWNA 3UG5A 2EDLA 1B3YA 2YPLE 3AXHA 4WNJA 3BLOA 3JV4B 3V0EA 1SXNA 1O0VA 1KCWA 3Q58A 3FJTA 1X5HA 2XN0A 3G5YA 5DDHA 2R69H 3HN8A 3FEMA 1DVFA 4K3ZA 4JTIA 1Q3NA 5TQ0L 4CQ8A 5HHXL 1A14H 1NGQH 2Q8BH 4GFTB 4NKOA 1Q9KA 3RDKA 1N5YL 3M07A 4KXDA 4JTAA 2R0LH 1M01A 2DM4A 1AY1H 4MNQE 5C7ZA 1FH8A 1DUYB 3HG0A 2DQEH 4AZHA 4NUPA 3TFXA 3KPSA 1C16B 3SRHA 3WBDA 3VX1A 4OI8A 3MT1A 1U30A 2XG5A 5HR7A 2ZG2A 3RPBA 1CE6B 4P59L 1TVNA 4V1DA 4JG9A 4K7PX 1MFBH 2BXVA 4ZTXA 1FF5A 4RWYL 2PF6A 4JRXD 3PSVA 1Q7ZA 4EZMA 1MCHA 5BV7L 1NKOA 4PY8I 1MCPH 3FTYA 1OCWL 3LEYL 4WUKL 3IPBA 5LN4A 1U5JA 5IFHL 4ZBJA 1H5VA 1TRDA 5IQ9A 3ES6B 3LZQA 4WV1B 4PUKA 2CHNA 4R85A 4FHBD 2F74A 3LCIA 4HJSA 1HKVA 1KTLA 1BA9A 2JB6A 3UGEA 2GT9B 1VAHA 2B9AA 1PDKB 1A6VH 4OFYA 4GXFA 4PC8A 4GUQA 4IKIA 2JH2A 2W0KA 2Z35B 2O4MA 5CLZA 2V81A 1NFIB 1V7NH 2VURA 1IC0A 1JGUH 4UNUA 2J75A 6A3HA 3QEQD 2FLRT 3TGXA 4WI8A 4FA8A 4B91A 1PKLA 1MSSA 3H2EA 1TVDA 4ODVH 1MFEL 2ZKHL 3ZY7A 3O0RH 4RMQA 5E9DA 1MEHA 2PR9A 1KN2L 1BFTA 3WXWH 5D4HA 2BP8A 4OAWB 2O6CA 4H20L 5C7HA 1URZA 5B4MD 3P9MA 3FMGH 2C1PA 3QGAC 1ISVA 2EUVA 4PRPB 3ULVD 4Q4SA 3EXTA 3MP4A 2G5BB 5J04A 5CCGE 1TTGA 3TA3A 3W0WD 5TK4A 1OYAA 1DQDL 4J3OH 1X5GA 1UQZA 3RLSA 3VGHA 3A23A 2KZWA 3WUGA 4WEUD 1BFOA 3WJLA 2PDQA 3REQB 2NUPA 4IFKA 3X13A 4F2MB 1Z0NA 4KZCA 4M5YH 4RNFA 3QI9C 2OM5A 2WZ0A 3AJ7A 3SQBA 1DIKA 3WIFA 4E2OA 2F53D 5KAQF 1DJSA 4Y5XA 4EP8C 5TPWH 3FZUD 1G6VK 1EC9A 5ITBL 5GRVL 4Z8FH 3AZUA 4F9PA 4D7PA 2UXGA 3A3WA 4YJZL 4QWWC 1INEL 1DO6A 2ZX8A 4J6RH 3SURA 2C9AA 4MKNA 2XIMA 1IGCL 1ZLPA 3I6KA 1NKGA 3PUEA 4H0IA 2FQIA 1F6PA 2GSJA 5B39G 2WZMA 3CHPA 4UB9A 1CXLA 3E7JA 2ADIB 4Y2DD 5HI5D 2HRPH 1BQRA 3THDA 3V0DA 2DWYA 5HMSA 1DVUA 1UXLA 2N3JA 3AITA 1TZ7A 1X4XA 4S1RL 4WDTA 1LQ2A 5GNZA 1GYAA 4JM2A 3K80A 1N6QL 3DBPA 3UJJH 3ANYA 1Q1PA 5IJKC 5L4FA 4OFIA 3SW6A 4KO5A 4A2RA 3WD4A 4JTHA 3KDPB 4ONFL 4FP8L 3A4JA 5L2JB 3LCWA 2X0UA 1ZGLM 1NMAL 5T3ZE 4WY0B 1AD9A 4W9EC 2QUNA 4U10A 1KWGA 5IVZA 2PDMA 5H4YA 3E1F1 2X2JA 4HH8A 3GUTA 4KTEH 3KVDD 2DSZA 3BUPA 5EMUA 2VT0A 3K72A 5KJRL 3UC0L 1KFKA 1ME8A 1JZ3A 3DKJA 2RH0A 5BPPA 3MLUH 1NDMA 3D0CA 2PW1B 4EN3B 1MI5E 1GVEA 2A3CA 3PZUA 1GSMA 4KDWA 3P2BA 2V3EA 2YCIX 4LPXA 3HZKB 3OKMB 4HZMA 1QTYT 2OMNA 2F7QA 1VKFA 4B0MB 4YVXA 3HFFA 2YB1A 2GL5A 5D72L 3SGDI 3H2MA 3DOSB 3FRUA 2IBZX 3C6SA 3D3VE 5I6LA 4HYVA 3IDYC 4OCSH 2X4TA 3N3TA 1WLHA 5A7BA 2NX5D 5LBSL 4XP1H 1LM8V 1DVFB 3N42B 1BIIB 2QUTA 5D33A 4LAZA 1XSJA 5F8RC 2PTXA 4NKOB 3LNIA 1Q9KB 4NHVA 1GOIA 5LGZA 4NY2A 3NIGF 3N29A 4ZMPA 3U7VA 3TTQA 1GVOA 4ONGL 1RH9A 5D8ZA 4MY1A 3BESR 4QF1A 2VD8A 1X5JA 3VWKD 3MNVA 5I19H 2XG4A 4S2SA 3UBFA 2ANUA 2SFPA 5GGSY 3GNMH 4ZS7H 4K8HA 2Q5BA 3TZFA 5BW6A 3FSAA 3NSYA 4C57C 1BBDH 3CHVA 3AHTA 4G3YL 2ODOA 4ZE4A 3PWUA 3QPQD 4D2JA 5T3XH 2WKGA 2ZCZA 1X5KA 4F3FA 3W2KA 5DJYA 2OI9C 2F2KA 4FQJL 4LF3A 3FJ4A 4KRTA 2JKTM 1KDJA 4Y1SA 5IQ9B 1ACYL 3ULVL 2F74B 1ETB1 3BOVA 2VDNB 1S46A 3APGA 5DD3L 2V7NA 1UZ6F 3ULUE 3FYEB 2RQEA 1N2RA 1T5AA 1SJDA 1NIAA 3II1A 4O4VA 1MG2C 4AEOA 5H8PA 4Z7WB 2QCGA 3DFOA 3G1FA 4LBSA 2VXTH 4IIQB 4GAFB 3CN2A 5E03A 4KZ0A 1VFUA 1N12A 2F9BT 1I75A 2DYPB 2CNYA 3UMTA 2K45A 1GPWA 4OF8A 4HJUA 4RAUB 2FWLB 4WKAA 1DQKA 1XCTB 2QQ6A 3ZR4A 3ITGA 1NWPA 2EC9T 1VCBC 1RIUL 4ZQMA 3W07A 1E3XA 3C60A 1V3IA 2PR4H 3RUGA 3BSZL 4C59B 2DQTL 3D52A 2DW5A 2BP8B 2VUNA 2B1AH 1R3JA 4NM4L 2BS71 4PRDA 3JTSB 5TE6L 2VUYA 3OQ8A 2C1PB 3TC6A 1UWUA 2A6LA 4ZO8A 4NKDA 4IW4C 5GSVB 3TA3B 1JK9A 2WNQA 4FADA 4EPDC 3LVEA 4UM9A 4XCNA 3HC2A 4W9TA 3ARDA 2W88A 1NCIA 1R2TA 4RMRA 1CWYA 1BFOB 4XBMA 5DEJA 3PWVA 5IQNA 1B88A 4HF5H 4XSMA 4YHKL 3WFAA 4E9XA 1TYEB 3TBSA 4EXPX 1UJ3B 4B7IA 1YEKH 1CT8A 1A6TB 5EPMB 1E56A 3GHUA 1O5RA 5MP6H 2VGIA 3LKQB 2AQTA 4C1NB 4C6KA 2D3NA 2HKHH 3BWUF 3RUBL 1QRND 3IMTA 4X5WB 1E6QM 5I1KL 1E72M 5C86A 5IJCC 4FMVA 4WXYA 3IUDA 5KUMA 1FNEA 3AYSA 3RKDC 2IV8A 4Q8BA 4WY7L 2N01B 5IVXB 1P6CA 4FQ1H 1O6SA 2N59A 5EO1B 3EFFA 4RGMC 2PD9A 5DMJB 5AW9B 2Z1KA 3ZKXB 1A9EA 2EH7H 3ZTNH 2JIXD 4DKFH 1U92B 5F6HI 3EOBA 1E30A 3C9NB 3B8VA 4Y7MA 1RUMH 1XIWD 5JIDA 2A4EA 3MX0A 1U1UA 3AZRA 4K68A 3NJNA 3NGFA 3RTQC 4A8IA 4L37B 4YDIH 4JM2B 1LK2A 3H9HB 2YRBA 2EH8H 4N8CH 3EHBB 2KKQA 3MMUA 3TT1H 4Z7NE 3L9EA 4CAGA 2DJSA 4X61A 1YNPA 5K9DA 3BJSA 1XLMA 3HBPA 2V33A 3V4UH 3VFTA 1P4BH 3CZFB 2BHZA 1DSWA 2UY7A 1LT7A 4FQ2L 1FZKA 3AIVA 1I9EA 4MAYD 1F3JA 1UGKA 5L8LB 5I3JA 2QKIC 2HTMA 4MS8C 3OKLA 3K72B 1SZNA 1KTKE 4K94L 3C4UA 5D1XC 2GCYB 2HT3D 2JJSC 3KLDA 1VRSA 3LG3A 4A3RA 3Q2LA 4A63A 3V6ZB 3VCNA 3URAA 2A77H 2GDVA 3L2IA 7FABL 2EXWD 2CZ5A 4AQAA 4Z0SA 3QWNA 2A7BA 3T6ZA 1Q45A 1XGZA 1HH9A 2NYKA 2YD0A 4YX2L 4Y5VB 1DLFH 4HZLA 3TYAA 3C6SB 1C5CH 2NCMA 4N0UE 4DCQA 2I9LB 1YHTA 2ATSA 1QKZH 5EEZA 2X4TB 2WBXA 4BK9A 1J9TA 3SZKC 3B2PA 1C93A 1R3KA 5HPOA 2FEDC 1YADA 3RWCA 2ZTJA 4PRHE 5AW5B 3WDQA 4APXB 2QUMA 5LLIC 3EYOA 2R1KA 5IBUB 3VGBA 1U8LA 1GGBL 5LYRA 5J12B 2XVBA 3SDXE 4NT0A 4DRSA 1JS4A 3Q2VA 1KXVA 1LRTA 3R18A 1POKA 2H6UA 4QYAA 1CW2A 5J8LA 3OW1A 4N9OB 2LW3A 1XBYA 4QF1B 4H1LA 5JH1A 4JIRA 2IPUK 8XIAA 3L9CA 2XG4B 3FRPG 2NTFA 2X4UB 1GCYA 1V02E 4ONVA 2AXGB 5C2UB 4XO6A 1U95B 3RMEA 4Z7UF 1R1CA 1V8EA 5A69A 3BCFA 1BAFL 2KZHA 1HN1A 2OTPA 4YIQA 1FNHA 1J1XL 1IBFA 4QOKA 3PFUA 3TO4A 1IU1A 3OLEA 1E40A 1LTXA 1Z9LA 3ZLHA 3V10A 3OF6A 1GK8A 3EBVA 1ZD6A 3X14B 3LH2H 4BFJA 2J43A 1NFDE 1SF5A 2Z6JA 4KROB 2X1UA 3OL2A 4DZ5A 4EX4A 1W0WB 1HEZB 2NY0D 4PJCF 3PDGA 43C9A 4ZEPA 4F48A 2Z2AA 1L6GA 4RR4A 2WMJA 3L1GA 1E27A 3PAJA 4BHYA 1M6JA 1L7TL 1G4RA 3E8UH 2EJ1A 5SX4H 3PNRB 3VKCA 4QXWA 2WXFA 2AANA 1E8ZA 3HNSH 1T7ZA 3HCVA 5IGXL 2P88A 4MNGB 3VNIA 5GS1B 4XN5A 4L1HA 2CBPA 3GW0A 4LBUA 3V4PA 5E93A 3UY8A 1EUAA 4XVSL 2X1XR 4B95C 3TMQA 3RUGB 1A1NB 2YQ2A 4MF4A 2E8ZA 3MLVH 1L9MA 2WXOA 3EFDH 4JPSA 4AD3A 1P5UB 4FOMA 2FZ8A 3TF4A 5KVEE 2BIPA 1SMDA 1AKPA 2V8ZA 4N2MA 3O3DB 1J8SA 3AMLA 3VI3B 1J86A 1J8VA 3DGGA 4M3KB 1JK9B 4OLVL 5T91A 4DNLA 5EFFA 4XCNB 2DQHH 3A9BA 3WNLA 2VJXA 4JKLA 1ADQL 1PIFA 2CKNA 2DQWA 4PJEF 4RMBA 4Z95L 4RDYA 1FGVH 3W5MA 1KTCA 3PWVB 3N0PB 1XDLA 5DJ2A 2CAKA 3FPYA 5A6IA 3K8KA 1P1MA 4LKXA 1CT8B 3APTA 3PAZA 2HV5A 5HBFA 4GH7B 1UBPC 2XA8H 5CP7A 1P84J 2I27N 3Q0HA 1OGTB 3UTOA 4U2YA 1BLIA 5CZ0A 3O9WD 1GJWA 4XC3L 1FNEB 2YLLA 1AXTL 3BIKB 3FTZA 3W7JA 4C6DA 1CFNB 1S5IL 1O6SB 3BISA 1V8HA 5DHVB 2WP3O 1A9EB 3NN8B 3WAJA 1EBHA 2MHAA 1RAMA 4J9JA 3RVXC 4AC4A 2F6AA 5HYSB 3H55A 4LDCA 1ZANL 4ABWA 3HC0A 3MX0B 3STZA 4E9WA 2YDQA 2WLYA 5EU6E 1JRCA 4MWAC 3SR7A 2FIKB 3KH4A 1P4CA 5KBDA 1AZZC 2BVQA 3KLHC 1HFUA 2XXFA 1LO0H 1DBBL 1TQJA 3U0PB 5A6LA 1BZ9B 4MXVE 5KSWA 3OYZA 1WAAF 4GFIA 5HWNA 4Y19A 4ZB2A 4U1KB 3QDMA 3YPIA 2QLVB 5LG1A 1OK0A 1OK6A 1N82A 1NZRA 4QGTA 1IF2A 5E2VH 4A35A 1T7LA 4F4RA 2ARJA 2VC2L 2Q8AH 5B3NA 1Q85A 4D7BA 3SGZA 1RCQA 2AITA 3TA9A 4JAMA 5T1DL 4NJKA 2GC7C 1F3JB 3SKOA 2QXWA 3OKLB 3DROA 1BFNA 3UQNA 4ZXOA 3SY0A 5H8DA 4G7YL 3WQVA 4OI7A 3INOA 5TFSH 5DJZB 4WVXA 3W00A 2E3ZA 4DWSC 1G4EA 1A7OH 4G56A 4RFNC 2ZOOA 5HVHC 1SM9A 2O6EA 3K2GA 1N8ZB 4G8AC 3N73A 4AQAB 4A67A 3SJVE 2WAGA 1HHIB 2Y0SA 4XO9A 4YSOA 1DJHA 5I0VA 2KI6A 5FI8A 4HZLB 5I26A 1PG7L 4YXKH 4DCQB 4GINA 4I9WE 3TBTB 1ANUA 5IB1B 4TMCA 4WI3A 1DQQA 3U7AA 3H4HA 2CLVB 2WJFA 2KPNA 5I1LB 1HYRC 3I6LD 4JO3H 4DI9A 3N0AA 3P4OA 2WZHA 1W1YA 1B3VA 4ZGYA 4QM1A 1F90H 3TC3A 3GSUA 1U8LB 3JT2A 3PUGA 3FF8A 1GEQA 3P62A 3HFMH 3TCSA 3QS2A 3GHPA 3SRFA 2CLLA 1KCKA 4GS7B 5EOQL 2BP0B 4NDMA 2WVVA 3IN2A 1RP9A 3RWJB 3T08A 5HDBE 4H1LB 1TEYA 4ICXA 1GW1A 4U1LB 2QVIA 2NTFB 5I17B 2ZADA 5EC2B 4M43L 4AD5A 3UTTB 3IRCA 2VGBA 4U4MA 3AIUA 5D03A 3WTTA 1V54B 3C5ZA 4YIQB 2BOCA 4QOKB 4MB4A 2R8WA 5JHBA 1XHGA 1SJAA 2GBVA 3V95A 2WZ6A 3PHAA 5F6HJ 4J3XA 1A0DA 1WQ5A 4WJXA 1W72B 1E9QA 3P54A 1JGIA 1GVFA 5T26A 2OKOA 4QHRA 4TUUA 2HAZA 3VQLA 3B4YA 3UAFA 2GGEA 4XO4A 4AUBA 4XBEH 2FKPA 3AAZA 3Q48A 3WTWA 3SCMD 3VJ6A 3BD4A 3B5GA 4FMFA 4WKHA 2BP3A 2VDPB 4J8QA 4LF1A 3HTLX 1G9NH 1A4JB 4U1GB 2H26B 2YD8A 4NHUA 2J27A 2R1YA 1G6CA 1E27B 3OM3B 1CICB 1OZUA 4GSUA 4H40A 5EU4B 1R3LA 2Y5TB 1CDCA 1BP3B 5E23A 3W2JA 3GVWA 4IMKA 4AENA 3FNDA 5IBLD 3PCYA 2V38A 5ANMA 1F4AA 3S4SA 1WAPA 3MUCA 1QD0A 3BLIA 3BZ4A 3LPWA 2HFGH 4L8DB 3V4PH 2EYRB 4URTB 2H3NB 3ZE2F 3CIQA 3WIIL 5FSEC 3RHWK 4PREB 4PS4H 1T1WA 3EBAA 4PJXF 2Q7NA 3CQ0A 1G7VA 1UA6H 4HOZA 4UUJA 2J9YA 2ZUUA 1TETL 5L8JB 4LY8A 3L3KA 1XR9A 3CIVA 1YEFH 1OHLA 1ZWIA 4LVBA 3L3GB 1YQVH 4IQDA 3QZ6A 1LEKA 3FFCB 3NPXA 3MXVL 4Q4MA 1J88A 4N5EC 4G9FB 2GITB 3ARQA 1FWBC 1OGBA 1FN4B 1YE6A 2W9EL 3CJPA 2X9ZA 2QCNA 2XVPA 2W0FA 4ACPA 4NUGH 4G8TA 2NNFA 3VXTA 2QADD 3RL1B 4CVXA 2WWKT 3S0CA 2C7UA 3MBXH 1SMAA 3DDGA 2V6HA 3U30B 3DV4A 2WHMA 5CCKL 1MIML 4LP5A 5EOCH 4YBQC 3QFJB 1OSPL 4AQ1B 1FWTA 2P26A 3M0KA 3EJZC 4GUCA 4XE5B 4LCIH 1UZHA 4XPBH 2ITCA 2MHAB 4KI5F 1ZV2A 4GBXB 2FTPA 4LCVA 1FWCC 2FQEA 2VDRL 2HVOA 2XYCA 3HC0B 3BP7A 3SB3A 4LFHD 2QGEA 5KSAA 4OF7A 4NQEB 3T07A 2E47A 1KXQA 3IU3B 4PJIA 2ZVRA 4FKKA 3NAAH 4HJIA 1AFVH 4PUUA 4L9ZA 3DOHA 3WL1A 1HSBB 3QDGA 2XNAA 3ET9F 3LIUA 4OBTA 4H0LC 2ALWA 4E0CA 1IAMA 3E2VA 4EIBA 5C9XA 2K9FB 4J27A 1YUKB 5GZNA 4QG9A 1AR1D 3WKNA 3W01A 3EJTA 4UQEA 2A2QT 4NRZA 4ZUVB 3VDGA 3IDGA 1YPZE