3BAJA

Human pancreatic alpha-amylase in complex with nitrate and acarbose
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
total genus 172
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bajA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bajA01
3A22A 1E70M 3HG3A 5BXPA 4J3TA 1V0KA 3AOFA 5EMYA 1H2JA 1BVNP 4ZE5A 3DX0A 2J75A 3FAWA 3WUBA 3N18A 3VINA 3BGAA 3ARVA 2FH8A 4BZYA 2DSZA 1XSIA 2FDMA 1U2YA 1HNYA 3SCWA 4E8DA 4MNKA 1C93A 2VZVA 4HP5A 4H04A 1QI0A 1KWKA 1J01A 1UQZA 4CD4A 4JFSA 3L4ZA 1JGIA 2DH3A 1U30A 4CD8A 2J74A 2OWCA 4UQAA 4AW7A 3DX1A 1D2KA 3N9KA 1W32A 3RM4A 1CECA 2ZWYA 1G1YA 3AXXA 1JAKA 2XM2A 1EIBA 5ABHA 1UKTA 1JF5A 3EDFA 1M7XA 1QVBA 3THDA 1JL8A 2AOSA 4HTYA 4URIA 2ZUUA 2WNWA 4UFJA 4OUEA 3B9AA 1RD6A 5BRQA 1GQLA 2FHCA 3CZNA 3MO4A 5JBFA 3L4VA 2F8QA 1W1PA 1XRVA 1PBGA 4M24A 4C7FA 1CXLA 2XVGA 1GQJA 3RO8A 2E0PA 1HTYA 4UCFA 4X0VA 4XZWA 1TVNA 2A3AA 3UR7A 3L2LA 4AYSA 4KH2A 4P8WA 2DT2A 2BNJA 4RE2A 4F8XA 1HJXA 2VC9A 3AMGA 3QHOA 3WUFA 4PTMA 2D20A 1K6AA 2FHFA 2W92A 1ITCA 3F5JA 3CUHA 3W82A 1LG1A 2WC3A 3ALGA 3AMKA 1JD9A 2VRQA 2BHUA 1XHGA 1EOMA 3TTQA 2YBTA 1PIGA 2DQXA 3PN8A 2PWFA 1JZ2A 4FF5A 1TA3A 1M53A 1PX4A 3WY2A 2FE0A 5GQBA 5I3DA 3VO0A 4D6JA 3CZGA 3VIKA 2PWEA 2CBVA 1DWGM 1VFOA 3NYDA 1OWQA 4IPNB 2VR4A 3AJ7A 5A6MA 1JFHA 4LXFA 4GIAA 3SCRA 4EKJA 2F61A 3L4UA 2WZHA 1RP8A 5CZKA 3RM9A 2Y24A 2XVPA 3LPFA 3WDQA 5I6SA 4JL1A 4ATLA 4AEEA 3WBAA 2JEQA 4MTVA 1UYQA 4AZCB 1MW2A 1E15A 1K9EA 5BXSA 1GPFA 3AHTA 4XZBA 4U3AA 3WEMA 3FY1A 5BXRA 1NP0A 1AQHA 4PMRA 3CPUA 2O9TA 5HPOA 3KWXA 1UH2A 2GFTA 5JBEA 5KZ6A 3WD4A 1BFNA 2HVMA 3OZPA 4AZGA 1TUXA 2WVVA 3GDBA 1UUQA 3SUUA 3AZRA 3SURA 2WSKA 1MQQA 5HXMA 3QOMA 3WEOA 1QI3A 4UR9A 3CUFA 3LRMA 3LX9A 3CZKA 1CLVA 4IUGA 3WF4A 4NXSA 2PWGA 3M07A 1YQ2A 4IISA 2EBNA 3THCA 3WDHA 1GNXA 2BV9A 3T0DA 4JKLA 1UR2A 5M3WA 3AIUA 3VGBA 2GK1B 1JYNA 5D8ZA 2IUZA 3NIYA 3W24A 1CEOA 1ISWA 3GZAA 3DX3A 3W6MA 4NRRA 3N11A 4AYGA 3N1AA 2F2HA 3U7VA 1RP9A 1KR0A 2JALA 1R7AA 5LA0A 3TONA 5E9AA 1FH8A 2NW0A 3UETA 3VDHA 2E8YA 3AZSA 3WF2A 3ARPA 3DDFA 4UQDA 2QMKA 1NQ6A 1XC6A 2GJXB 2W4XA 1EO5A 2ZX8A 3VGDA 5A6JA 2VX6A 4EE9A 3CZSA 4W8BA 1BAGA 4YHEA 2WVTA 2XN0A 2J25A 3FW6A 3CBWA 2CETA 3OLGA 1UG6A 3EBVA 1X1NA 4D6GA 4X9YA 2D0GA 2F18A 1NWTA 5A6BA 3VPLA 3OLIA 1B9ZA 2D22A 1PZ3A 2BXYA 1QWNA 2BHZA 4PN2A 4GINA 2XIIA 3WMCA 3B9EA 1CWYA 3WD2A 3FHQA 5ABFA 3WY4A 2WCGA 1H0GA 3L4YA 2Y8KA 4AIUA 3A3HA 2C0HA 4U33A 2YDSA 3VD5A 3QOKA 5HOSA 4PRWA 1QW9A 3WH5A 2VR5A 1C8QA 2E3ZA 2YFOA 3BCFA 1MW3A 1NOWA 5FIPA 3SCPA 1WDQA 1UD2A 1DWHM 3ARSA 1C8YA 3ZM8A 3BUIA 4HOXA 1E5JA 1EQPA 4JKMA 3WL0A 5IFPA 4EANA 4OBRA 4PMQA 2VNCA 3VDAA 3BVXA 4UQ9A 5CPTA 1KTBA 2YOCA 4ZENA 2VO5A 1ZBVA 3ZJ7A 1B3WA 3VD7A 2CESA 3AMDA 5A2BA 3MSGA 1KR1A 1UR4A 2WYSA 1QI2A 1MFUA 1J0KA 3APGA 4Z2HA 1VJSA 3VM5A 4BQ2A 2EPKX 3EMZA 2DSWA 2WMHA 1ODZA 5A6SA 1FP8A 1V6UA 2DGAA 4FNQA 3O2LA 2VMFA 1CTNA 3VIPA 2XHYA 3VOCA 1MWOA 1QW8A 4LYRA 1KWGA 3ZQ9A 2J7DA 1LL7A 3GYCA 4JAWA 4W7WA 3RJYA 1E6PA 3PZVA 3VTRA 5C70A 2JE8A 2ZICA 5EB8A 1W9BM 4QAWA 2Y8VA 2ZX9A 1E73M 1SR0A 1V02A 3S2CA 3W0KA 4PMDA 3CGTA 2QPUA 1C92A 2CKRA 3AIQA 4CUCA 4N0RA 4L4OA 1UR0A 1UZ1A 1JDDA 1OGBA 3AICA 1GONA 4AD1A 2VRJA 1HJWA 5A8NA 1R33A 1BVZA 3GBEA 4H41A 2XGBA 3T09A 4QDMA 3AROA 5BROA 4JFVA 2EAEA 1WO2A 2WHLA 3PZMA 3PBGA 1HIZA 3AXIA 1XD0A 2J7GA 4DWSB 4FNUA 1MFVA 3ALFA 3I3EA 3NSXA 4CCCA 4F9DA 4OJYA 1I1XA 4NZJA 2DSKA 3TTSA 1WCGA 3POCA 3HG5A 2VZUA 2XWEA 1WZMA 4FNSA 1VEOA 2D24A 2QMJA 3WD0A 3CUJA 2IGTA 4ZEPA 4TX6A 1SFSA 3MANA 3LMYA 1WZKA 1JYWA 4LYQA 1Z32X 3EMCA 4K68A 2OSWA 1F4AA 1OCQA 5CG0A 1B3YA 3GXTA 2QHAA 2YJQA 4OZOA 5I77A 5M03A 5I24A 1J10A 4MNLA 3RPMA 4OBSA 3OBAA 4PMZA 1CXKA 3WY3A 5I0DA 1CIUA 4B15A 1UWUA 3VX0A 3CTTA 4Z2KA 2EEXA 1E55A 4AZCA 3VMPA 3ZSSA 1BGAA 2DEPA 4W8LA 1HX0A 2J77A 1UWQA 4MPKA 3CZEA 2XSAA 4PBGA 5I78A 2XWDA 4DUWA 4AIOA 4W5UA 1JZ6A 1JFXA 4H8UA 2OWXA 2F1AA 3PZQA 1XH2A 3N12A 3U7BA 1B3ZA 2BS9A 4M81A 1UA7A 1WKYA 4XV0A 3D5HA 5A6BD 3G6LA 4AMXA 2D3NA 3ZT6A 5CPSA 1TQVA 3K8MA 2D73A 3GNOA 4LX4A 5DT7A 3BMVA 2WWCA 3HU7A 2CITA 1TZ7A 2OW6A 4ATDA 1V6YA 4HPGA 3EDKA 4TVUA 4UZSA 1PZ2A 1GQKA 2EPMX 4AMCA 1V3KA 2VI0A 5A8MA 1HVXA 4P7RA 1UR9A 2GJRA 4MJ4A 4RE4A 1UKPA 2X05A 3SUWA 2GK1A 2ESCA 2OYKA 4QP0A 1MW1A 3KLLA 2WK2A 3ZT5A 1EXPA 3N17A 5FL0A 2RGLA 1IT0A 4WIWA 1JZ8A 1V6VA 3UEQA 3A4WA 3SCTA 1DHKA 3BLBA 5CXPA 2J8GA 3WEZA 1QOXA 3EJTA 1VAHA 2OSXA 3VIJA 3AYSA 3PTKA 3TTYA 4GI8A 2WAGA 4NX0A 3DC0A 4MB3A 3PTQA 2GJXA 1ZJAA 1E71M 1ZU8A 3D4ZA 2J8FA 2VOTA 3BVTA 2BY1A 4E4PA 2D23A 1JD7A 3BAXA 3K8KA 1V03A 4GI6A 3VMNA 1SMAA 4AD0A 3W53A 1J0ZA 3IGUA 5IDIA 1E4LA 2BHYA 3RMEA 2Y5EA 3AS2A 1MQPA 3IJ9A 1QNRA 4Y7EA 1LJYA 4GQRA 2XVNA 2ZWZA 2WM0A 3WH9A 3WIJA 1PJ9A 3MI6A 3ARTA 2YA0A 4S3KA 1GCYA 2VT0A 4UFLA 2XFRA 5BYWA 4MB5A 4H8VA 1H3GA 3GXNA 4NSBA 1QI5A 4FNRA 4U3CA 2CKSA 3KLKA 4YPJA 5GNXA 1E9LA 1CXHA 1UD3A 3WDRA 1H4PA 3CV5A 2XG9A 2BY2A 4MB4A 4TOQA 3OGVA 1W9DM 1OIMA 4FNTA 2WHKA 4CKQA 3GTNA 1GHRA 3ARXA 1US3A 1QHPA 2X2IA 2Z1KA 2QF8A 2TAAA 3U5YA 2YLAA 4E2OA 1T0OA 2DT0A 1ISYA 2OLHA 2DSVA 2WSPA 1B1YA 3AYRA 3OGSA 3VX1A 3POHA 4BQ3A 3VILA 3KZSA 5HBFA 1I1WA 3T2OA 1UHVA 1JYXA 4AD5A 2WVUA 1HXJA 1Q6GA 5AYBA 1R87A 4HU0A 4FLOA 1GOOA 3VSVA 1EGZA 1QNPA 4D6HA 3UG4A 3D52A 1HP5A 4HOZA 4H7VA 4F9JA 3EMQA 2WKGA 2XVLA 3WKZA 3G6MA 3WNKA 2VCBA 3CUIA 4D6DA 2FH6A 4U5IA 5JBDA 8A3HA 2A3BA 1QX1A 2F7OA 2CBIA 1J11A 5CLTA 4DWSC 1R47A 1XV8A 1KCLA 2QPSA 4PSPA 2C7FA 4M8UA 2IXUA 4HA4A 4P7OA 2WZIA 4B9ZA 2XFFA 2WXDM 3TOPA 1KCKA 2Y4SA 1V02E 3VNYA 3TV8A 3WD1A 3H54A 4RL3A 4HA3A 3D50A 1ISVA 3AQUA 5A2CA 1GJUA 4DWSA 1OIFA 4XX6A 4AEFA 3SUSA 1B3XA 2WB5A 2XN2A 2IXVA 2G3JA 2YL8A 3ZOAA 2VCAA 3K8LA 5A94A 5DF0A 3SCSA 2WC7A 1QBAA 3VD3A 2UY4A 1BF2A 2WMFA 3AIWA 3PHAA 1ZBCA 5DT5A 1N82A 3VGGA 1CNVA 2VVSA 1EO7A 5AYIA 1U33A 4AZIA 1OINA 4DM1A 5I5RA 1JIBA 2X09A 3WF1A 3LRLA 1XSKA 1OBAA 1IZJA 3BCDA 2EPLX 3WN6A 4D6EA 4CCEA 4BCEA 4Z2GA 1BSIA 3TA9A 1W2VA 2UY3A 3VNZA 1W9UA 4GZJA 1VFFA 1M04A 4L4PA 1UQYA 2J7CA 4HZ8A 3PZ9A 4V28A 1KQYA 4JKKA 1HKKA 2DIEA 1NARA 5A95A 1ITXA 4ACZA 4UFIA 3AIRA 2WBKA 4FLRA 4MDOA 5ABEA 3DYMA 3NDYA 1W3KA 3VU2A 1R85A 1VF8A 1MW0A 3CHFA 1MXDA 4TX8A 5IHSA 3QHNA 4DO4A 1TCMA 3I3BA 1GOMA 3UERA 4CU8A 3EJPA 1UWTA 2GUYA 3WNOA 1GW1A 5I79A 4X0NA 4UFHA 3BXWA 4W88A 5CGMA 1E6XM 2JF7A 3GXDA 2VX5A 5BXTA 5E70A 2D1ZA 1WDRA 4WKFA 4W8AA 3W37A 3PZGA 4H2CA 1OGSA 1AMYA 3VIIA 3BAWA 2XJ7A 1G01A 3ARZA 1C90A 1HJVA 1CPUA 2CIPA 3AHZA 3VDCA 3A5VA 4ATWA 2XPKA 4DM2A 4NI3A 1FP9A 3B8SA 2BY0A 1RH9A 2X0YA 3OLDA 1HF6A 1Q6DA 4S3JA 1R75A 2ZUTA 3CUGA 3ZJKA 1FOBA 2YDQA 3W27A 2ZE0A 4PUEA 3GXIA 2CBUA 3WD3A 1H41A 1KGXA 2VQUA 3CMGA 2NT1A 1ISZA 4JFUA 4CN6A 3L4WA 3SCVA 3W26A 2E9BA 5ECUA 4TXEA 1L0PA 2F7PA 2PI6A 5JUVA 2CBJA 3MV11 4V27A 4WKAA 4XB3A 2EPOA 1OT2A 3CHDA 1AQMA 2WWDA 4B3LA 4AMWA 1QNSA 1E0WA 3EDJA 1TG7A 2V5CA 8CGTA 1UR1A 3KL5A 1XCWA 3BH4A 1B0IA 2X0HA 1NP2A 3RM8A 4PTXA 4AZ7A 3O6AA 1EDGA 1DP0A 3AI0A 2V3EA 4GXPA 3FXYA 1ESWA 5FKYA 1KB3A 3MSDA 1B30A 1AQ0A 2BVTA 3BUBA 1CENA 1GOIA 1W9VA 2EQDA 3ZSTA 1KBBA 2CHNA 3W38A 2VRKA 4J3WA 3AISA 1E5NA 2YL5A 2DPEA 1E6SM 4CVUA 3IJ8A 3K1DA 3VGFA 4PMNA 4DWSD 4YHGA 4AXNA 1BHGA 5A6AA 1PAMA 4W5ZA 4MAVA 3H55A 3WSUA 5I2UA 3AMLA 1NOFA 4FLQA 4LQ1A 4KMQA 1J0IA 3VKKA 5EFDA 2FGLA 1UWSA 5GNZA 2GDUA 1BQCA 4ML4A 1KFWA 4Z2LA 3WDJA 4PMXA 4NRSA 2EXOA 2ZOXA 1H1NA 3S5ZA 3SCUA 1IV8A 3A23A 4DUVA 3WH7A 2FYVA 4UFKA 1KXVA 4UOQA 3B9DA 1HL9A 4WLCA 1Q6CA 3DYOA 1VBRA 2JFEX 4TUFA 4TTUA 1W9XA 3ARYA 1EHNA 3CO4A 3WH6A 4PMVA 4MDPA 1HVQA 1LWHA 4WK9A 4U2YA 4B9YA 3SCQA 4H8HA 4XUYA 4CGTA 4UFMA 1DWFM 3OGRA 1QI4A 1OT1A 1KXQA 3WQVA 1O7AA 2WKLA 2A3EA 4CU7A 2WMJA 4J27A 1KBKA 4PUDA 1E0VA 2WLZA 3AFBA 2UY5A 3MMWA 1NWUA 2O9OA 4ZXOA 1BG9A 1ZL1A 3PTMA 1OB0A 4QCEA 1NWSA 3GNPA 2XYLA 3NSMA 3F5KA 1E0XA 3U57A 4AC1X 4BF7A 1C7SA 4U2ZA 4KRTA 3CZLA 3AMCA 2FGZA 3WELA 3AS1A 2XFYA 1LQ0A 1A47A 5A6KA 2RGMA 1YHTA 4MJ2A 2DSUA 2F7RA 2ZXDA 2WHJA 1JYVA 2WHMA 2WW5A 1JZ4A 3WMSA 3W6LA 2YIHA 3SCNA 1UH3A 3MUIA 2GSJA 2BVDA 3BSGA 1E6QM 2YL6A 5BWFA 2XVKA 2C8NA 4IM4A 3ZJ6A 3GXFA 4JCLA 1TR1A 3VD9A 5GNYA 1R34A 2PF0A 2UWFA 1VJZA 2PC8A 2WMKA 3GH7A 2YL9A 1W3HA 4A4AA 1H5VA 1C8XA 4CN1A 4WSJA 4FLSA 3WQ6A 1R7OA 4TVCA 3EJQA 3KE0A 1Y7VA 1HWWA 1Q4NX 1E6ZA 3WL1A 3HJEA 1DWIM 1TQWA 1HXKA 3W81A 1V3HA 1CZ1A 1C91A 2D2OA 1E6NA 4JHZA 1EHAA 1WPCA 1FH7A 2F7QA 3NSNA 4AZBA 4FK9A 3WF0A 2Y2WA 1CGXA 7A3HA 3N15A 1J9YA 1UZ4A 3FN9A 1DWJM 2WVSA 3WMBA 2PWDA 1K9DA 3N13A 3T08A 3T0AA 6TAAA 1VENA 2W91A 1VRXA 2XGIA 2J7BA 3L4XA 4BA0A 4AZHA 2G8ZA 1NH6A 2NSXA 3CH9A 1WZLA 3S5YA 1PEZA 2OW7A 3LXAA 1HKMA 5C8BB 2XUCA 4WSKA 1TFVA 3AIEA 1FA2A 2X8RA 4P7QA 2ZX5A 4P7LA 2VURA 1J0HA 4W84A 4A3YA 1LG2A 4PCTA 2D3LA 4GO8A 5DO8A 1BYBA 4Q7NA 5IXEA 4DO6A 1E40A 4GPNA 4PMUA 5HDRA 1CXFA 4U31A 4MNJA 1X6LA 2VX7A 5A3HA 4CD7A 4OKDA 1KGWA 4CCDA 4W7VA 1US2A 1I75A 1SMDA 4C7GA 3K4AA 3PZIA 1VIWA 7CGTA 1V3MA 5A8OA 1XYZA 5A8QA 1TMQA 3SIMA 2NT0A 4Z2IA 1TQUA 1G0CA 2CCRA 3VIMA 1UD5A 2DT3A 4AZ5A 1UH4A 3WDPP 2BY3A 1UKQA 1UOKA 2WCSA 2O9PA 1ECEA 1E4MM 1GOQA 2V5DA 5EBAA 2CNCA 4MAZA 3I3DA 3PZUA 3MU7A 2OWWA 3WQWA 2E9LA 5E0FA 3T0BA 2W62A 2J78A 3IANA 4CD6A 2WANA 3BUQA 4F66A 2OSYA 3W25A 4HA1A 1XSJA 3A21A 1E1FA 5CQ1A 3WH8A 3UESA 1ODUA 1H49A 2X1IA 2CXGA 1HJUA 4QCFA 3WNPA 4B3KA 1GVYA 3WY1A 1P6WA 2B31A 3UR8A 4M82A 4M29A 1R46A 1V3JA 2BVYA 3DYPA 4JL2A 5AC5A 2G41A 3AHYA 3GM8A 1JI1A 4R5EA 5IHRA 3PZOA 5E1QA 4PEEA 5I23A 3CLWA 1JI2A 3WNNA 1HJSA 1XD1A 2ZUSA 5A2AA 1W9PA 3ARUA 4P8XA 2EADA 3ARQA 3TTOA 3AHXA 2ZUWA 3VD4A 4KGLA 1TQTA 1KXTA 4GZIA 4HZ6A 3WQ8A 1EH9A 1QWUA 2ALWA 3WDIA 3VIFA 4PYSA 1JDCA 4AISA 4MADA 3VIGA 4D6FA 7TAAA 1NWRA 2VCCA 1GOKA 4AZ6A 1V3LA 1GOWA 4D1JA 2WBGA 3SUTA 4DUXA 3WQ5A 3A4XA 3CHCA 1E3XA 1B2YA 1G5AA 2EJ1A 2PB1A 1LL6A 4P8UA 3RCNA 4QLLA 3OLEA 4M80A 2X2HA 3HN3A 3T2PA 4HZ7A 2V3FA 4WKHA 4J3XA 3ZO9A 5E09A 3WFLA 2X2JA 3CIVA 1FFQA 3LXBA 4HMEA 4E8CA 1W1YA 4LPCA 3LRKA 1MYRA 1M01A 1FHLA 1O7DC 1JDAA 2OYMA 3D4YA 1J12A 1BYDA 1S46A 3PZTA 1QHOA 2UY2A 1CGVA 2WMGA 1C7TA 1TQSA 1WE5A 1W2PA 1LWJA 1WNOA 3AZTA 3KL0A 5CJ5A 4A3HA 1XGZA 3BVUA 2J7EA 1QNQA 1VFUA 1WDPA 1V0NA 1PX3A 1E43A 2ZXBA 1HKJA 3WQ4A 3LXCA 2PBGA 3WUGA 1JXKA 5E6YA 3AIVA 1CXEA 1B3VA 1EDQA 2J7FA 2CYGA 3D51A 1PPIA 3LPOA 3GXMA 3EJRA 1MQRA 1VBUA 1ZBKA 1TVPA 3K46A 2VZSA 2D0HA 4NXKA 3CHEA 4TTGA 3VVGA 1ISXA 1J18A 2BFGA 2Q8XA 4AY1A 4PTVA 1HKIA 5ABGA 2VUYA 5CSYA 1CGUA 3HG2A 4HMCA 3EJUA 2VJXA 3GH5A 3BAYA 4RE3A 1JZ7A 2XN1A 1KQZA 3MUZ1 1QPKA 5FD0A 4ZXLA 2W5FA 1ZS2A 3D3AA 3VUPA 3MS8A 2BXZA 1OD0A 3WNMA 6A3HA 1KTCA 1A3HA 1BLIA 1AVAA 2EABA 1E3ZA 5HNNA 1SZNA 3OG2A 3EDEA 1DWAM 3II1A 1JAEA 2QLYA 1EQCA 4B16A 1J0YA 3RDKA 5LA2A 3IJ7A 3RILA 3CZ8A 1EA9C 3ZR6A 1W3JA 1GHSA 2J79A 4OIFA 2D0FA 2W66A 4GQQA 2J47A 5FOOA 1E56A 2J62A 2ZX6A 4EAMA 4TVDA 2JF6A 3T2QA 4AD3A 4Z2JA 4D72A 1TE1A 3DDGA 4D6IA 1W91A 4NZFA 1V0MA 3EJSA 4JZ5A 1E1EA 1C3FA 3ARRA 1BYAA 1VEPA 2WCAA 2A3CA 1PX8A 4WF7A 1D3CA 2W67A 3VMOA 2O92A 4WJXA 1CGWA 2WMIB 3SEPA 3W29A 3BAJA 5F7UA 2HISA 3OZOA 2WPGA 3IAPA 3AIBA 4C7DA 1V0LA 4JFWA 1H0IA 1ZB5A 1Q6EA 2A3HA 2J4GA 1K9FA 2JEPA 4GZEA 5HPCA 1JG9A 4FNPA 2DT1A 1KGUA 1Q6FA 3A6OA 5LYRA 4W7UA 4UQCA 1GUVA 2VQTA 1LF1A 1UKSA 4UOZA 4QLJA 1E4IA 3SCOA 3GH4A 1VFMA 3WF3A 1PIFA 3HG4A 1CGYA 3KL3A 4AIEA 5BCAA 5A6LA 5E6ZA 5GPRA 2VL4A 3FNDA 3S6TA 1HT6A 1V08A 4J3VA 1CLXA 3BAKA 1G9HA 1QNOA 5DMYA 2VZTA 3BUDA 2CERA 1CBGA 3HMCA 2AAAA 3DHPA 1DEDA 3BLKA 1ZBWA 1VB9A 1CDGA 1HJQA 3ZJ8A 3M7SA 1ZJBA 1W3LA 4FMVA 2DIJA 1H09A 3RJXA 1JXJA 3AS3A 2PBOA 3W4RA 3UG3A 1W1VA 4QLKA 3VIHA 3UG5A 2WLYA 3WNLA 1WB0A 4U5KA 2CPUA 3NUKA 4EK7A 5A69A 1SYTA 3AXHA 5M5DA 1DTUA 4MNMA 1OM0A 4GI9A 3LPGA 2O9RA 4P7NA 2ZX7A 5BRPA 2QV4A 5D9OA 3PZNA 4W89A 1E6RA 5FL1A 1QBBA 2W63A 1R8LA 3W28A 3N04A 1V3IA 4GKLA 1LL4A 5CSUA 4OGZA 5TD4A 1NM9A 5IFTA 1UKOA 1BGGA 3VM7A 4J3UA 3EYPA 2G4FA 4BQ5A 3QR3A 1CYGA 3ARWA 1JNEA 2V38A 1RPKA 1E72M 3VIOA 4ACYA 2EO7A 2F1BA 4OOUA 4JCMA 1JNDA 3FAXA 2G3IA 1FH9A 1QHZA 3ECQA 9CGTA 3MKKA 2Z1SA 3OA5A 4D6CA 3K4DA 1WZAA 1GVIA 1V6XA 2ZUMA 1FHDA 3U5UA 3DHUA 1XH1A 1GJWA 4N42A 3A47A 2CHOA 1G94A 3ZT7A 2VX4A 4F79A 3BVWA 1UWIA 1WDSA 2V3GA 5KEZA 3UCQA 3VSTA 1X6NA 4ZE4A 2ZIDA 5D9MA 4NF7A 3H53A 3JUGA 4Q22A 3CMJA 5D9NA 3WENA 4IPLA 2GDVA 1MVYA 2YKKA 4NZCA 1BYCA 1W1TA 4BS0A 3GNRA 1M03A 1TA3B 2DH2A 1UD8A 4PMYA 1EDTA 3ZIZA 3DECA 1HP4A 1UASA 1B90A 2EPNA 4LYPA 1JZ3A 4JHOA 1JZ5A 3BVVA 1XCXA 3FHAA 1UD6A 3QHMA 2ZXAA 3A4AA 4V2XA 4AD2A 4KRUA 3AHVA 4CN4A 2YA2A 3A24A 1K9TA 4DO5A 4LGXA 3M6DA 4AD4A 4CD5A 4UQEA 2CEQA 2YBUA 3IK2A 5C71A 2GVYA 4HPHA 1UR8A 3EDDA 1HL8A 4W85A 2VZOA 4UZUA 5CLWA 2YA1A 2YDRA 3VGEA 1EOKA 1D7FA 4HOWA 1XYFA 4W87A 4CU6A 5EFFA 1MXGA 2DDXA 3ZMRA 1PS3A 1H11A 2E8ZA 2XSBA 4P8VA 3WBEA 2MANA 2XM1A 3ZR5A 1GZJA 2GJPA 3GXPA 1GQIA 3MUAA 3WFZA 3NCOA 4HMDA 4PMOA 4W86A 4ACZB 1UD4A 3MMDA 1R86A 4OOZA 4D1IA 5A1AA 4AWEA 1OSEA 4QFUA 4UQBA 2WVVB 1WAWA 3RIKA 4M1RA 1CXIA 4KWUA 3F4VA 3DX2A 5DFAA 4JFTA 2YFNA 2FHBA 1CGTA 1XH0A 5D4YA 1L8NA 1BPLB 3GBDA 5DEZA 1WP6A 5D8WA 3LPPA 3MUY1 1V6WA 4W93A 1E4NA 4JIEA 4J7RA 5CPQA 3OB8A 1BG4A 1NOUA 2PWHA 4YN5A 4D71A 5AC4A 3O9NA 2E9MA 3DX4A 2X2YA 3E1F1 5A8PA 2E4TA 2WMIA 3F5LA 3BUPA 2W61A 1O6IA 5FCZA 3L2MA 1B31A 4KGJA 4BQ4A 3M46A 1VEMA 4UOJA 1J0JA 3L4TA 3VDBA 2G3MA 1GORA 5E0CA 3HZ3A 2VVNA 4J28A 3KEHA 3BC9A 1UA3A 2EACA 3MMUA 3IAQA 4HU8A 3NJ3A 1JF6A 1LLOA 3OIHA 2V3DA 1BTCA 4J3SA 5AY7A 3SUVA 2JIEA 2XIBA 4PSRA 3BMWA 3QGVA 1F4HA 3BLPX 3MV01 1IZKA 2G3NA 2ZXQA 4GO9A 3CC1A 1OGGA 3BSHA 3J7HA 1OD8A 4UNIA 3CZJA 1KXHA 5JIWA 5LA1A 4ZFMA 3NDZA 5M17A 3WUEA 5ABFB 3AS0A 2XTKA 4CVWA 4PCSA 3BAIA 2WC4A 2WZEA 6CGTA 1FFRA 3TP4A 4M56A 2VTFA 3VSUA 5CGTA 2JIWA 4UTFA 2YLLA 2ZUVA 4R27A 2ZUNA 1HN1A 2E40A 3VGHA 4MB1A 4PTWA 2J7HA 5JIPA 2OYLA 2AMGA 5D9PA 1UWRA
chains in the Genus database with same CATH superfamily
2CPCA 2QV5A 4ADJA 1U21A 2IV9A 1TJ1A 3IGKA 2V5TA 1I7TB 1SYVB 2H1XA 2XX1A 4ZPTB 5E08L 3RX5A 5IB4A 4MLJA 1BJMA 4JIQA 2WXFA 1XSIA 2BIOA 4D94A 1C93A 3OG6B 3DIFA 1YEEL 1YX1A 4JFSA 1BXVA 2Q7AA 4NLAA 2J74A 4JDEA 4S1DC 1H3VA 5T1KB 4N8VB 2XM2A 1WGOA 4B2DD 4V11A 3RPIA 1JF5A 2B4CC 3P9LB 1OFBA 2NY7H 2P46B 5B3JE 4GOAA 5E8DL 4POZD 1W1PA 3BP6A 3IPBA 4WRHA 1U8HA 3C2EA 3D39E 3BKJH 1NGQL 5DJCB 3H0TA 3K6SB 2MOGA 5GGUB 1CYWA 1IXQA 2VC9A 2ITFA 1K6AA 1D5RA 5B8CA 3VNJA 1EOMA 4R4BB 2DQTH 3K91A 1MO0A 4O0KA 3GIPA 3OR7B 2FE0A 1RZ7H 5FCUL 1K72A 1R38A 3GO1L 1XX9C 2PWEA 1MFMA 1AIFB 4XK2A 4Y4HD 3LKSB 4PBVC 1GPWA 1RP8A 3QQ3A 3VVWA 3M5XA 4BWTA 3LNGA 2FQDA 1GVOA 2JEQA 3W9EB 3NQKA 1OC5A 2DEXX 4K3EL 3N6QA 3CEPA 2VLKB 4ONGH 5GS2H 1JWSB 2XRAL 5C0DA 2H9GA 1C9WA 5ITFB 3VNLA 3EGXB 2EECA 2BIPA 2PETA 4ODHL 1QI3A 3F01A 1WFUA 3LX9A 3USBA 1UM6H 5AAPA 3FQUA 4F7PB 1A7PH 4JM4H 4LLVA 3FQNB 4IEFA 4LCWA 4JZNB 3OM3B 5CD3A 4JVUA 3DC8A 3FB7A 5TDPA 4HOMA 4NRRA 5EUOB 1JV5A 5LA0A 2NW0A 3DVIA 2BH0A 5CJNA 2VHLA 4YC2B 2G2NA 4WDIA 1WYIA 4NO3A 3FW6A 2WB7A 3OB0H 2W95A 1X1NA 2PR4H 3M88A 4G9FB 4CLMA 1QWNA 1KCUL 1B57A 1CZ8H 3S2MA 1GAFL 2E9GA 4XBMA 4GINA 3HGJA 4P4KC 1UB3A 1CWYA 4LRIC 2AEQL 4ODTH 1HYSD 1J5OH 3C6LD 1NL0H 1IM9B 2IDFA 1G7LB 4GIEA 1G9NL 1EO8L 5F7EH 4KFZC 4PRIA 5FAAA 4EANA 3MC0A 4LSTH 1CLZL 3MLYL 5FM4A 3R10A 4ZENA 2BVPA 3B4YA 2XXGA 4LPYA 2CO6B 3NAVA 2ED7A 1KR1A 5FF6B 2NNFA 1JP5A 4NQEB 4PB9H 3PNZA 4M5ZH 5BU9A 3DX6A 1FP8A 1V6UA 4BUGA 3L17A 4L29B 3FQRA 3VXQA 4LS1A 3SPCA 1ZAHA 4UC5A 3CFJB 1INDH 4L4VB 1IIKA 3AITA 4IQHA 3BWUC 5I28A 1SR0A 2UZ9A 2FGWL 5AZ1A 2E7LA 4E9WA 1FCCA 5AG8A 5DC0A 4LT7A 5C55A 3L3DA 1H3TA 3T09A 2R8SH 1P2CA 1AANA 4GSDH 1YY8B 1HIZA 4UUJA 5IGXL 1E2VA 5DK2B 1BMWA 2HNEA 5EOQL 5LVEA 2WBJC 3EO0B 3UROR 3T65A 1YPZA 1WCGA 3BO8B 1WAAF 5EPMA 3DFNA 2B5IB 1TZOA 4KUCF 1EUNA 1OCQA 4ENLA 1TG8A 2JGYA 1KTRL 1ECQA 2BSEA 2UY6A 4YVPA 3NPSC 3B8IA 1KY6A 2AXGB 3VMPA 3O2WH 4W8LA 4MNQE 4PBGA 1CD8A 3JV4A 1Q6RA 4AYBA 3DETD 4RBPK 4AMXA 1PG7H 3O8XD 1XISA 3MUHL 2VE6B 4FG6D 4UZGA 3Q2WA 5DWUL 2WINA 3LOWA 1PZ2A 4I2XE 4KETA 4ECNA 4N22A 4JFOA 5E8OB 1Z41A 3IMWA 1KCVH 3B2UC 3ZVIA 2A73A 1NFDB 4QT5B 5CXPA 4XPTL 4ZQMA 3PTKA 4KMTL 1XF3A 3QUZC 1MCFA 3CMOH 3MNDA 1GZHA 3V5HA 4PJFB 3ILDA 2Z31A 3FF7A 4GWEA 2M1KA 3W53A 1WAAE 2AEOA 2BGNE 4JRYB 5T1KD 3GKWL 2FJKA 3UTOA 2F5BH 1PWLA 4Y7EA 1I1YA 1C08B 4N1CA 5F9JB 1ORSB 3UADA 3MI6A 1P9MA 3VFWB 1G0XA 3GEWB 4MB5A 2NWSA 3OKNA 3CK0H 4M9OA 5E93A 4N85A 1CBVH 4X6CA 4R83A 1R5VB 3OGVA 4L8BB 1B2WH 4FXKC 5K4XA 1SFTA 2JV6A 1S7UB 1QHPA 1XBRA 3W7GA 2Z1KA 2NNXA 2Q2LA 1Z7JA 2H9AA 3VXTA 5DEFB 1QRND 2EDWA 1F73A 2HRHA 3M5VA 3EWYA 4OD2B 4JUTA 1IGJA 4YGVA 1ZT7B 4Y8FA 3POHA 4JIIX 2XWCA 2GJ6E 1F05A 2WVUA 3OVRA 4MZRA 4LVNC 5JDJA 3TVMB 4TNFA 1Y0EA 3D52A 7FABL 2GTWA 1WOAA 3S6DA 5B7YA 2NTFA 4Y16A 1O6VA 5D1ZA 3SKJL 1U8OA 4QHMA 2X9YA 4DP8X 1JV2B 4E3TA 1XR8B 4DWSC 4U10A 5AAWA 1PKYA 3BDYH 4OCYH 1EPFA 5I7GA 3IV3A 4DKDC 4JPSA 4A7SA 4YDJB 4A8LA 5KS9A 3LNEA 3FT2B 1CFQB 4K7YA 2GITB 4Q6YA 3NNTA 5AOIA 4BSJA 3I7SA 1MVUA 3SSGA 4AWJC 3CLFH 4LGPB 1BZDA 2LFGA 4ZFCA 1KFAL 5LXXA 5AYIA 5HI5D 1U33A 1HZLA 3MB9A 4DM1A 2OMVB 4WW2F 1HEZB 4DF0A 1D6EA 3TA9A 1G7HB 4A2GA 1A8JH 4XODA 1XM3A 4I3SH 4F2ME 2VDQB 2WO4A 3G5YB 2DIEA 4OQ1A 4I6VA 1R17A 3ZDZF 3KGSA 3DFTA 1IEHA 4FLRA 4HVXA 1R9FA 3G1YA 2YC1B 4PJDB 3VU2A 1DQMH 4G9FD 5D70H 2B39A 4ZMOA 4MNGE 2ITEA 5F8RC 1I8IA 3EKGA 3Q43A 2DQJH 1XIHA 5C7XH 3BXWA 2NXHA 2NY4B 4OCWH 3I9GL 2A6IB 1IM9D 3LH2H 4H40A 3VIIA 3ZU8A 2I56A 3LCGA 2GGHA 5D2LB 3M86A 3L68A 3TCLA 4DLFA 2PWUA 3I9AA 1VBHA 1RH9A 4RDQG 4R9HA 3QQWA 4XBSA 3QORC 3HE7B 1M7IB 4JGUA 4N2DA 1FOBA 2P43B 4ZSOB 3GXIA 1KGXA 3FTVA 1T7ZA 4HUMB 4JFXA 2K0RA 2X1WL 3V9FA 5EOTB 4NKDA 3NG5A 1AQMA 1R3RA 4RE0A 5GGRB 1AY1L 4PTUA 4PRHB 3B2MA 4CC0A 3L9EA 5EF1A 4GYPA 3FFOA 4LKCA 1EDGA 2VR7A 4HAKA 3QG7L 3IPWA 3FXYA 3L0NA 3S9DB 5CCZA 3FFCB 1J5CA 3WYZA 4Z1CA 2ACUA 3KHOA 5E9DE 5JW5B 3AISA 1MKFA 1RV8A 4L9LA 4CVUA 5F1UA 2PZ0A 4XZ9A 2IG2L 3QO1A 1SO3A 3NRQA 2QZRA 4LSSL 3DSFL 2HXTA 4XWUA 1MDLA 2A99A 1B9BA 3F64A 1N6VA 2QKIA 2VLME 4LLMA 1KFWA 3NIDB 3SCUA 1OAUH 2X4NB 4UOQA 1Q6CA 4TSBL 1TUPA 1EHNA 2ZZ4A 3P81A 3HC0A 2QGDA 2ERJB 3B9KA 3SN6N 1GKEA 4UFMA 2V9RA 3CFKA 4HEME 3BOFA 3VFUA 1JRHH 2L0DA 1KBKA 1OL0A 1R3LB 1A5CA 1NFIB 3QNYA 4IG2A 3PFMA 4S3CA 4ZX6A 1HHGA 3O1NA 1XGPA 5BJTB 2HJLA 4I9JA 5GGSA 3GNPA 1ORQA 2WZ6A 5GZOA 4HHPA 4KO5A 2WJZA 3R11A 4JTFA 2DSUA 1ZLWH 2F6XA 3P9MB 2MUCA 5SX5K 5EC2B 4Y4KB 3KBFA 1KB5A 1X7QB 1J8HD 4M6AA 3OKEB 2E27L 5DC4B 4YHPB 1OF8A 3VU1A 2YIHA 4J3ZA 3PFRA 3G08B 3QXAB 1Q4WA 3KYNA 2Y36L 2XETA 2WO2B 3TBTA 3QIBA 2MHAB 4F8OA 4UTBL 2J66A 1MFCH 4BFRA 2ZRXA 1ZXKA 1EXBA 2BC4A 2Z92A 1NANI 4DF2A 4UDUB 4E3VA 5INCB 4OUIA 1V3HA 4ZX5A 4CDGC 5G5DA 4UTAA 1DYSA 3G22A 3S5SA 2BZ7A 4DBEA 4KKQA 3V0FA 3QPXL 4JRYD 4CKVX 2Q7YA 3AY4A 3FUDA 4C4KT 2XQBL 2WBXA 1BQHA 3RL1B 1HKLL 2G5UA 3SJ3A 1WZLA 1ZGDA 4Y4HC 2W1NA 3QDMB 3GGWA 4L4MA 2DN7A 1TO3A 1BYBA 5IQ9A 1JNLL 3ZUNC 5BS0D 1A5KC 3I4KA 4U31A 1F90L 4OAWB 1M71A 1CLCA 4NP9A 2ZFAA 5FFGA 1F6LL 1SFDA 3HAEA 1I75A 4ODXB 1FFNB 4WUKH 5A8QA 2V37A 5FA4B 4Y8DC 3RX2A 2JTDA 1VCFA 1GTNA 1MHEB 5EBAA 1U95B 3W0WB 3TVMD 5E2WH 4UQIM 3O0KA 1VS1A 3L95B 2XWJB 3NFPB 5I1KL 2X1IA 2R23B 1MCPH 1GVYA 3S36L 1FRBA 3WY1A 3QR1A 2ABBA 5ALCL 3S1VA 1OY0A 1BFOB 3SGJC 2O0TA 1IE7C 4Q8WA 5FFLA 3V0UA 5H91A 1MFEL 3LGGA 2F19L 2NMSA 2W38A 5K9OA 1ILSA 2OKOA 3GAKA 2BVQA 3CDGB 3LEXA 3TF4A 4Z3JA 2EDXA 4A7GA 1ZS8B 4X5XA 1HYSC 4D6FA 4AZ6A 5E5CA 5DX7A 3N85H 1U2CA 2XIJA 2JCCA 3SQOL 3F1QA 2WWOA 1RZGB 3E0IA 3NCJH 3LCHA 3MBWA 3OLEA 1W54A 5D72L 1P7TB 2XZZA 4G6KH 3R8BB 4U1JB 3O3RA 3LUTA 1E9PA 2QBWA 4N6EA 4JREC 3QARA 2EIZB 1O7DC 1JDAA 4KHXL 3T8XA 3JWNG 3SDXF 4U3XA 4HWBA 4YTQA 1C7TA 2YAQA 3QYNA 3GBNL 3OZMA 1LWJA 1IBFA 5GSVA 1E0TA 1RH8A 3IRSA 2WP3O 2AI0H 5PCYA 4H9ZA 3OYXA 5E6YA 1GGYA 3GXMA 4JJ5B 4PFHA 5D7IF 1DL3A 4PZVA 3IS0X 2VWEE 2BX7A 1KD0A 2YD0A 4XVDA 3ZE1B 2ZP0T 3CL8A 2IBGA 5FD0A 5D1QB 2GGGA 1OD0A 3RWJA 2ICEB 5DMGC 2CRIA 1SZNA 3CXOA 1JPGB 1NCBL 2EDJA 1JAEA 1R2RA 3PUDA 1RZFL 3PG9A 3UZJA 2AL1A 1RI8A 3RPTA 5IY5B 4ZAKB 3C60B 1ENUA 2X4RA 3LAFA 1TPFA 3SRHA 4PRHD 2XWBB 4LPUA 1K2DB 1TE1A 3V7AG 1A1NB 4LSVH 4IFRA 3RLGA 3HBQA 2WTPA 3T9WA 3L66A 3DH7A 1CGWA 2WZAA 4NC2B 4I1RA 5I1IH 3TAKA 4AW4A 4URKA 3WBWA 4XP4L 3WLKX 1MCEA 1E8ZA 5TFSH 3IWUA 4N0UA 1CG9A 4L4TB 4ZTOH 3QRBA 2V30A 3S5NA 5FUCE 1BQSA 2Y7SA 3GH4A 3FN0L 1DBJH 4HGMA 3EWUA 1I8KB 5A6LA 2IDSA 1VGEH 4DZBB 3ZTJG 3H24A 1FWNA 5FHAH 3RGVB 3BAKA 4NI8A 2AXFA 1KRMA 1QNOA 2VZTA 2CERA 1NMCC 3CS2A 4J2XA 4MDIB 5F1VA 1BZ7A 3DOSA 2NX5D 3V9CA 1WS7A 2QUUA 4RXGA 4QROA 4RA0C 3O3EA 5FF3A 3MCLH 1D5XA 4K8GA 3IT8D 2BBFA 4MNMA 4GI9A 1SJBA 3WHXA 5BRPA 4M6OH 4W89A 4JKPL 1QBBA 4A8IA 1B9KA 4WI3A 5ID1A 3ARGA 5TD4A 4ES9A 1OW0C 4NO5A 3OKDA 1KLGB 5E4EC 4Y4KD 3M0KA 1K7XA 3W02A 3GSNH 1LLZA 3UMTA 4ERSH 2VR8A 2VC2B 4ZQPA 4QDPA 4JCMA 3HGSA 3O16A 2Q6WA 3C4UA 1EJWC 4KK5C 1EMTL 1DVFD 2RALA 2E5BA 5TDNA 4MCNA 4PJEB 2BVWA 5H2BB 3PGCA 1FNGA 5JH1A 3GIZH 3OX8A 1INQA 1U3NA 4PGDB 4Q4SA 3UO1L 5D9MA 4RZBA 3H53A 1UATA 2Q6ZA 3WIIH 1UJPA 2AKZA 4Y5YA 3HNTH 5FA3B 1JHKH 4C58B 4WTQA 1NFAA 2Z0UA 1W16A 3KHJA 3PJTA 2BNUA 2YGYA 3TEYA 4KRLB 1UXWB 5IVXB 4I5BA 1P7HL 4RAHA 1HILB 2YPVL 2X4OB 3UY8A 4ADIA 3MRMA 2FL5A 4RMSA 1YYML 3D7PA 4M7TA 1F13A 1JMXA 2PDKA 1Q6OA 4LPXA 1OOWA 2E7HA 1XCQB 1OFRA 2DQFA 2VN4A 1B54A 1KFGA 1G7MB 4AQ8C 1NDMB 3R06B 3FT4A 4LESA 3LOTA 1UOWA 1TETH 1B88A 2MANA 1O60A 3D0VA 1GQIA 2YAEA 3MUAA 1O4UA 4OOZA 5C9JB 4G1MB 1N0LA 1UR3M 1PUDA 2WVVB 2J9YA 1EEZB 2KZWA 3W0WD 4XTDA 2OI9B 5T5FA 2VDPH 1KJ2A 5KAQG 5LDUA 4ZMAT 3GBDA 2X7WA 4ZUUB 3O6LH 4XBEH 3QDGA 5DHXB 3NP3A 3QIUC 4XPAL 2DQIH 5HI5C 5J11C 4MUZA 1ZK5A 2V9TA 4UQ3A 1Y65A 1J4EA 5HI3D 3T5WA 3QWOA 2XZQH 3UWUA 2AJVL 4HWNA 4QHPA 4IDJL 4LAOA 4S1FA 4LTSA 1ICPA 1NDTA 5K39A 1VEMA 3NH7L 4HUVA 3CL7A 5IHLB 1UFUA 4UR7A 2J8UB 2J1ZA 4OB5H 3TO4A 4KXBA 4HU8A 4XISA 4R2GC 2BIMA 2KL6A 3RX9A 4YTRA 2QQKH 2DVUA 3ETBF 4O58H 4YHYC 3QF0A 1O1HA 3GUWA 4JFZL 4CVWA 3FMGH 4C1KA 1QFWM 3TP4A 2QCMA 4P4KB 2Y7DA 1VCAA 4F0SA 3ABSA 1UEMA 3FGCB 1T4KB 4HKJA 1V0KA 2RBLA 3S3JA 5EMYA 1WAPA 1F4XL 5DRNA 1P5VB 3VINA 5D2TA 3IBEA 1Z44A 1IJNA 1U2YA 1VSCA 4MNKA 1QPRA 3Q8CA 2INFA 3D2UB 4XBPA 4L5FL 3TBVB 3HPJA 2AL2A 3FS9A 4AM0Q 2O93L 2P5EE 1CBJA 2OMZB 3A13A 1EIBA 4OWGA 3FSOA 5AECA 3PNRB 4TQEH 3FOMA 1M7XA 2AOSA 3GTVA 2R94A 3MLXL 1G4PA 3U8GA 5F7NC 5BRQA 3FCTB 3I02A 3NFUA 4Z7VF 5C0FB 2YD1A 3WI9A 1YECH 5DURD 2KHAA 4KBXA 4ZAKD 1XO8A 3P2VA 3CUHA 5D4QA 4X7FC 1HJBC 4EPDC 3AMKA 2VRQA 4L3EB 4XI5D 2NCMA 4QHNA 1B0RB 3UXKA 5E1AB 2PWFA 5JHLL 1PX4A 2ARWA 1XB3A 1II4E 2ADJB 4HD9A 3F4NA 1SO4A 1JXDA 2WBJB 1X5YA 4NENB 3Q9PA 3PWIA 2ZKXA 1CC3A 5I8OH 2ZYSA 2BFVH 3SI9A 5F44A 1ZIBA 3GRWL 4UNLA 4CDHA 3LV6A 1UYQA 4HUXA 1IC5H 1X7TA 4GY7A 5BZXA 4Z7NF 4U6XA 3NPSB 5KSVA 1MWAL 1TTGA 3RB7A 4PMRA 3CPUA 2IBZX 3GR7A 5EGRA 4ZUWA 1JTPA 1NDGA 3LS5H 1EZ2A 1CQYA 3G6JE 4E41A 2VRAA 3B5TA 5TGBB 2WQPA 3ZKQD 4X6DF 3SN0A 1MELA 2QHRL 3BW3A 1AGCB 3EYUH 3MR9B 3WDHA 3MRNB 1DQDL 3S3PA 3E2RA 1E4XL 1HOCA 1PZ1A 2BMBA 2CDEA 1YEGL 3IVSA 3HI5H 1YLVA 4Z7VE 5EO1A 1FH8A 3VDHA 4Q8TA 3DARA 1YADA 3MVTA 4O9HH 4M00A 1A6AB 1OOAA 1T7YA 3ONCA 1XC6A 3OAWA 3NRPA 2JLPA 4W8BA 5CGQA 1BAGA 3MQIA 3K30A 4OGXH 1JNHA 2OELA 2D0GA 1NWTA 3JZ7A 4OZFH 3VW3L 2EH8H 1VC4A 4PVBA 4Z0BL 1SHSA 3MJ8B 3RY5A 4DJFA 1HS6A 1T5XB 3R1GL 5FJRA 4J2QA 3A3HA 4GGBA 4K38A 3ARFC 4S1DD 5DZAA 3L65A 4ELKA 4HOXA 4FQ1L 4DPPA 4XGZA 1FWWA 2HKHL 4PUUA 3SE8L 1Z89A 4IIBA 5I19H 4Z7NE 3QC6X 1A6UL 3UBHA 3B2VL 2ESVE 4N3UA 5SWSD 3WS6C 1JHLH 5HATA 4X6DE 3LJ3A 4FXKB 4OKVA 2MNJB 2C71A 1KXTB 4JAMB 3VFSB 1LL7A 2X89A 3PR2A 4CNPA 1N4XH 1CFVH 1ADSA 4Q9QL 4WU5A 2WLHA 3FIGA 4G71B 1YC7A 5GGQL 1V02A 3CGTA 1HHHA 4LVNB 4AC4A 3C2AL 5I18H 3HZYB 3JYBA 4L4OA 5IV2A 4CSZA 1V55B 1W8NA 1JGUH 3JWNE 1BWLA 1U8QA 5A8NA 2XNAA 1U22A 1ZMYA 4BWWA 5GS1A 3RWEA 2Z93B 4DWSB 4TM9A 4EEEA 1DZ0A 2OTPA 3CFEB 1CDBA 2VDQL 2EPHA 3EXTA 3I6SA 1M9SA 3ABOA 2EDLA 5E0QA 3CFCH 3PU7A 4UIMB 1WHOA 4IBUA 1DIKA 4A6YB 4X4KA 4MBOA 4ZEPA 1SFSA 4JM2F 4AGNA 4C5YA 3HW7A 1HSAB 2N56A 3DCPA 3CN2A 4MA3B 3FJNA 3RPMA 1I60A 4KKZA 2Z7UA 2NSOA 5EZLA 1IEQA 4KJYA 4JDBA 3JYCA 1BGAA 5I78A 1KW1A 4NKIL 4ZOCA 4IT1A 2BS9A 3TBYB 2EAWA 1IEAB 3AREA 1MIML 3RTLA 4IGSA 3QFGA 1DJWA 4IOSD 5K1VA 1W6WA 1GQKA 2EPMX 5BMFH 1HVXA 2VISA 4YAQB 1MH5A 2YMXH 3DVGA 4MJ4A 1LD9A 1I1FA 1UKPA 3SUWA 4JY6A 3O6KH 5GJTH 1HXYB 1GKPA 4Y5VA 3CH1B 4JN2A 3A4WA 1QJWA 1KBVA 3VIJA 3WO8A 1I3RB 5JMUA 4W9GC 3B7SA 4B4HA 1WWCA 3MRIB 3PM6A 5F96L 5G55A 5EG6C 1ZU8A 2B81A 3BVTA 4UM9A 1QFOA 4HT1H 3D2UD 3UGXA 4D0BA 2ZRUA 1SMAA 3QORB 3BCJA 3S5LB 1E4LA 5FYKD 2MMXA 5JW4N 4YHIA 2CU9A 5B39B 3AS2A 3IJ9A 1ZSDA 2WHVA 4ICNA 4HYWA 5J3HD 3FK3A 1DJZA 4HIBA 4LS0A 4XCEA 1NPJA 4PRPD 2PDMA 4UFLA 4DW2L 3V0WH 3TAOA 2YHGA 2GBUA 2L7QA 1NMAL 4FNRA 3ZMEA 1DDHB 2O1AA 1CFNA 3I84A 5F8QC 4FNTA 2WHKA 2F7FA 3WN5C 3ULAB 1EFXD 5J8OA 5TJWK 1KN2L 1KM5A 2TAAA 3T6CA 3T8QA 2VFFA 1JPMA 1RVKA 5EZIH 1UWXH 1QNIA 2DSVA 2YAPA 4F7CA 5H37G 1I1WA 1EGJH 2WBJD 2D31A 3VAEA 3FS2A 1W1ZA 5TF1H 1RU9L 4Z7WA 1ACYL 3LD8B 2O6FA 4XX5A 2DRUA 3CUIA 1IAIM 1PG7X 1YEIL 3H9SB 3HV9A 1FC1A 4XZIA 1MNNA 3V52L 8A3HA 1G1KA 2OZ3A 4DN4L 4MQ7A 4XOEA 2YXGA 1EXHA 1GJUA 2YWYA 3IRCA 2C14A 4BKLA 3HMXA 3N73A 4IICA 2G3JA 2YL8A 1MJ8H 5DRZB 4DEPC 2B1AH 1XVSA 2X4SA 5CUSL 4JGMA 1HHJB 2DWSA 2PYFA 3AIWA 1J8VA 3PWPE 4GAYB 1ID5I 1P0SE 2E46A 2QQLL 5AYQA 3UWQA 7REQA 3LRLA 1M7JA 1DVFC 4D6EA 2B1HH 2EKGA 2YAFA 5EA9A 3L3GA 4FQXA 5EF2A 4H8PA 3T2NL 1A25A 3R0UA 5K7JA 3B2UD 3K2UH 1E9QA 2BDNH 2QNEA 3B3DA 3QUZD 1WCBB 1W6TA 3V4UL 3NOYA 1TV7A 3VWJA 3D07A 4JVWA 2OQYA 1ZRQA 2O6EA 2JELL 4H6RA 3UJ2A 4M6MH 1I7RA 3UJTH 2VXUH 2YX0A 4HKXA 4FZ8L 1BDYA 4I0CC 4NRXB 1YYLL 5ESVA 5HWMA 5HHVH 1MPAL 3E8UH 3QXTA 1RVFL 5FKPA 1G01A 3VNKA 1RZIB 3V4PA 5HYFA 3AHZA 3A5VA 1UJ3C 3Q0HA 4NI3A 1FP9A 4OV5B 1WFNA 4Y4HB 5DRXB 1H1ZA 3JWDC 1AXSA 1R5IA 3UIYA 4GW1A 4XMZA 2G0WA 1XIMA 5DTFA 2YDQA 4GJIA 1W1A1 2X9XA 1RA5A 5CC3A 5HHOD 3N1FC 4G42B 4E42A 5JUVA 2UUDH 4FI8A 3VE0A 2JI1A 1GGTA 1XW8A 1KTDA 4XXCA 5L0QC 5HI3C 5FECA 4HC1H 4AZ7A 4NHVA 3OL2A 3NQGA 2XBZA 3NSCA 4KZDH 1CENA 1R6WA 1KBBA 1HKFA 3ECVA 1AS7A 2DPEA 3NJLA 3BWAB 4OF0A 2GIYA 4O2FB 4DWSD 1YUHB 4YHGA 5KVDL 1S2EA 5B4MD 1BHGA 1X5IA 1VBJA 1OG6A 3EH1A 2PP8A 3MRLB 2ANUA 1A5SA 2KZBA 4KQ3L 1L0YA 4JIPA 1RLBA 2O5YH 2EXOA 2NY5H 5AYTA 4DUVA 1HL9A 2NLJA 7XIMA 4TUFA 2YEVB 2FWOB 3GMRA 1V10A 2AW2A 4P3DA 2QF7A 1DWFM 1IC4L 4OBTA 4IQLA 1BKSA 3HIJA 5IMOA 3U36B 4LHUA 4QE4A 4Y9GA 3UWZA 3M1ZA 4BI5A 1F3XA 2H6OA 3MI2A 3G6DL 4PTNA 3UTPD 1JHTA 1GIGL 2KLSA 3N34A 1C7SA 4X4ME 3NQVA 2BG5A 4JREB 2R69H 1A47A 3DX8B 5TK4A 2BNRE 3JWOL 2V7HB 1CK0L 4WI6A 3KOFA 3FU8A 1IB5A 3UPRB 4OZIA 1JZ4A 3B97A 3MJ9H 4GNKB 2XN9E 3INUH 4R88A 3ZJ6A 3GXFA 5I16B 1V8HA 4LQFL 1FC2D 1F6AB 5L2KE 1L6GA 4N2AA 4QG6A 1J1XL 1C8XA 3WD5L 5IHBA 1Q4NX 1WPCA 5BRZA 4XI5C 4LNRA 5C54A 3RHWF 4ZUVB 1HG3A 3TN5A 1UC4A 1VENA 3UCRA 4BA0A 1E67A 2QPXA 3G2GA 3SIKA 4Y90A 3LXAA 2GT9A 4JFHE 4PN6A 4W84A 4A3YA 3E02A 1SW7A 3FONB 2Q76A 1S7VA 4PJGB 2AJ3A 1OQOA 3KW3A 1MFAL 1M2VB 5HDBE 3RVTD 4Y1AE 3ZFHA 1YKWA 5JQ6H 1Q1JH 1VPOH 4PTTB 3VG9C 3ZXWA 2GVEA 2CCRA 1SHWA 1UD5A 1ZK9A 4XVTL 3UC0L 4BSWB 3QS2A 1QKZL 3BH8B 4PUNA 1ZLDA 4NAFA 3X12A 3ZE2E 2A2IA 3F7JA 1CI5A 3B3BA 3H9SD 5JA8B 3Q8AA 4JO5A 1NMCB 5HHQB 4OV9A 2VC2L 5A2JH 3O11B 4AG4H 5E6SB 5EU4B 4CVZA 4YPGB 4YVXA 4AZ8A 4PWHA 3Q05A 5I23A 2E59A 4RNFA 3V0GA 1W9PA 1QR7A 3W1MA 1LRQA 4P2RE 4BXVA 3IDXH 2B4CL 1EP1A 3C2VA 2NQZA 4BFAA 4O2CB 4ZMPA 1RK7A 2GTZA 3C52A 4OFPA 3VIFA 3MBFA 2DZVA 1LQ2A 5LAXB 4GMTL 3DIVA 5D7JC 5D09A 4P8UA 5EEYA 3T2PA 1CGSH 1MY7A 4FQJL 4I13B 4W9HC 1KLUA 2EKCA 1VERA 1BVKA 1NGXA 3T1FB 3LCWA 4DQOH 4IKLA 5TQ0L 3PFQA 1KEMH 5LGZA 1B6DA 1MCWW 1S46A 4PJBB 4WEBL 4PPTA 4BXSV 1V0NA 5IB1A 1QRNB 4EIUA 5AW0B 3CL6A 1HSBA 5AW4B 2PN5A 2CXKA 2XFXA 2B3IA 2CYGA 1IC0A 4ZFZA 1JSYA 3TYEA 4UINH 3NN8A 4F33A 5JHBA 2A77H 4N9EA 4XQ6A 1VZIA 5C0IB 5RUBA 1FL3B 4H19A 4LBSA 2I5IA 3CE1A 1G4RA 4YHLH 3TNOA 1NOLA 4G8FB 2I5QA 3FXGA 15C8H 1BLIA 2IADB 1A1MB 2OMWB 3OD3A 5IT2H 3IDMB 1G0YR 4NHUB 3S88L 3A12A 1CFTB 3MRQA 3VRJB 3GRIA 2FSDA 1LNUA 3S37L 4HXAH 8XIMA 1A3XA 1OZMA 1B4LA 4AD3A 3BZ4A 3QQ4A 3DDGA 1NGWB 2X6BA 1IGFL 1E1EA 1VQTA 1BYAA 2WLNA 3QY7A 2W67A 3VMOA 1QBLL 3SEPA 2PF6A 1DN0B 2ZA2A 3HLAA 5J11B 4DRSA 1HH6B 1ZB5A 2Y6ZA 1YBQB 2JEPA 4GZEA 4HYTB 1PSKH 2FJHA 1YEJL 1GUVA 4PJ9A 1UCBH 4P23D 3ABXA 3UAFA 1BX2B 3QUXC 2JB6A 2ZKHL 5BWAA 4R2GB 3RWIA 1TJ2A 2F53D 4MZYA 4YHYB 2OMNA 2BXVA 3IJLA 3D69B 4IRSA 2BSCA 2J6WA 4IU2B 1UYWH 1MQKL 1EJRC 2K6WA 4NQCD 2GWGA 1MNUL 4TQIA 5LCVL 2B7OA 3ATAA 4MCMA 3E0FA 5IKCA 1JGMA 1BQGA 3QCVH 4G5DA 1UKOA 4HIIA 4RETB 1KLYA 2XV0A 3DI2B 5J3HC 2AK4A 3VWKA 1CYGA 3M8OH 1P84K 2DICA 2ZRYA 4N4YB 2I9LB 1TWSA 5I1AA 1F6KA 1R9XA 2DLGA 1TTAA 1QHZA 3V9EA 9CGTA 2Z1SA 1YMMA 1L7IH 1PL9A 1IGCL 4X98A 4S38A 1UT9A 3VQLA 4C1NB 1GYMA 3KLAA 3IACA 4KK8C 5HJXA 5CILL 1P0KA 5CLYA 3QW4B 1OLZA 2VDOL 3QNXB 4POCA 4IJ3C 3D18A 5DMGD 4NPYB 2ZWLT 3PUUA 3AU1B 4X6BA 3L1OL 1M4KA 2WJEA 3LH8A 4GLEA 3OPZH 2VUOA 5DR5H 4M93B 4PS3A 3ZIZA 2J88H 1HP4A 4GXFA 4C56E 1MVFA 3FTGA 2IFFL 2ZZ5A 4KO9A 5F9DC 1ADDA 1SXSA 3H22A 4HSAC 1VGKA 4P99A 2J4WH 4QAIA 4OD3H 5C0RH 3IK2A 2B2XH 4I7WA 4W85A 1J8SA 2R0KH 3VXUE 4HHMA 2GFBB 5BV7H 1TKKA 2DDXA 1DQIA 1OCJA 5B7MA 4PWGA 1RFDH 5F7KC 4PJ6A 1OG0A 1JPKA 4WFGE 1F4YL 4IHOB 3WK1A 5SWQA 3ZL1A 1NY1A 3W9DA 1RUQH 3DX2A 4KTGA 4XTRC 2C9SA 3MLVH 4KZEL 5AYYA 3GU2A 1BIIB 3MZTA 4HBCH 1NC4B 3W1UA 2NXYC 2I9TA 1XGUA 4NEHB 5CIPA 3IRDA 1J8HB 3TYZA 5AB9A 3E1F1 4LDOB 3STZA 3PS6A 1A5LC 4Q4KA 4G6JH 4GB9A 1DLFH 5DHDA 4MLIA 3B7RL 1MWAB 4LCUB 3HPFA 4XXWA 2AKMA 2LU7A 2ZSWA 2QGCA 2Y7QA 5ADOL 1KT2B 1IZKA 1GCFA 2ZXQA 4GO9A 1NJJA 3J7HA 4GRWE 3V5KA 1KXHA 5ABFB 1HHIA 2AV7B 5CGTA 3VGHA 4WY0F 2YGPA 4TLSA 2AMGA 1A9EA 2E76C 4S11A 3SAZA 3A22A 2Z65C 1NIAA 2FZ3B 3CDFA 4KK5D 5BS0B 2IH8A 2E6PA 3ZGHA 3MLSH 3BG3A 2E9IA 5DJZA 3BDBA 4ODWB 3SQRA 3HPLB 1QRKA 2DH3A 4DJEC 4JHMA 3DX1A 3ASNB 3TX4A 2ZWYA 1EL3A 3QPEA 1UOVA 5D7KD 1SYSB 4A6YL 2Z4GA 2IKJA 2A4ZA 4US6A 2C7UB 1PU0A 5JBFA 3OHXC 3QJHB 4AENB 2ISFA 3MSPA 3MT1A 4UCFA 1L9TA 1FCUA 2GAZB 2Y2YA 1TVNA 2GHWB 3UWVA 2YBVA 5B4MC 3FO1A 4Z5RB 1HAUA 1S7TA 1FZKA 4B92A 3B0VC 5DQPA 3PULA 1FFOB 3FBQA 3RX8A 2VYOA 3F5JA 1LG1A 3D5OF 3QWRD 1OCRB 4LUSA 2P1FA 1ONEA 4UAHA 1RK5A 3QUMA 1AW2A 5DK0B 1F0LA 1GYCA 3PN8A 3TNNA 3PLYA 1X4XA 1JZ2A 3DGGB 2WM1A 3CHPA 1IL1B 3BDKA 1KELL 3E5PA 3EH5B 5D2XA 2AAMA 3X1NA 2YAHA 4PJIB 3QIUD 3I2CH 1EP3A 1U4FA 5GRZA 3RM9A 1NIUA 1GHFH 2LW3A 1EWEA 5T3XL 4OQTH 1E6OH 3NPXA 4AZCB 4N87A 3B34A 4MJMA 3L7FA 1RPQA 1GPFA 2YBRA 2BNQD 5EBLA 2CLLA 4G9DB 1T1ZB 2XFGB 5HVGB 4FXLA 5IM7B 5F97E 3I6KA 3PSWA 4NRZA 1ZEAL 1AP2B 3ITTA 3BANA 3SUUA 2W0FA 3HZVB 1ZT1B 4R2GD 1TYEB 1YAIA 1EEQA 1AD9A 1YQ2A 4MBRA 2OTWA 1I9JL 1DXFA 3O4LD 4JY5H 4QR6A 3GZAA 3DX3A 1MJJB 2DW7A 1LRNA 4AB4A 2H8ZA 3WLQA 1TV8A 3US9A 1TMHA 1XG3A 1A50A 2J2ZA 2GJZA 3UXAA 3GDRA 4HEPG 3T3MB 1TYGA 4L1TA 5FYJD 4R34A 3APTA 4HPOL 3BEVA 3JV0A 1EJ6A 4JOMA 2LU3A 2IPTL 2D22A 3T3PE 1PLCA 2ATPB 2NZIA 3OR6A 1MCDA 3RZCC 3P0VL 3UYPA 3ZQWA 1R3KB 4XBJA 4RFNC 4APQA 1H0GA 2Y8KA 1HC1A 2P80D 1C8QA 3RVTC 5CBIA 1SW0A 5ISZE 3ZVVA 5DA4A 3B0XA 2P5WE 2XA3A 4MJHA 3FKUS 3QVQA 3AVEA 5HHNB 3MC5A 5HMSA 1H3WM 5I76B 1UURA 2X6AA 1GGIH 4UB0H 4QO1B 4Q33A 4KS0A 4MX7B 1ZLPA 4JPKL 3WN5B 1ME7A 3UO8B 1QABA 3QQ1A 1Q66A 1DYZA 1NAKH 4IGHA 5KVFL 4KWVA 1QFWI 3OG4B 1BAFL 4JAWA 1MRFL 5ECVA 3O6FA 3DERA 3EXJA 1VP5A 4UT7H 3MRHB 3UZQB 4GYBA 4Z77B 3AIQA 4XP6L 4H4NA 1NAMA 2NX5B 4MQXD 4WCYL 1T0NB 4QRQB 2YD9A 3HGRA 3P4NA 2P28B 4MZ8A 5GGVL 2YCLA 2MFNA 4PH6A 1EKOA 2WHLA 1SMOA 5FF4A 2J7GA 4FFYA 1OQXA 3G8EA 5LN4A 3I3EA 3ZKSD 3DVNA 5PTDA 1X4ZA 1DL7L 5C5YA 1IEXA 3ZR4A 4TX6A 1H62A 4N2EA 1NC4D 1WZKA 3X14B 3V16A 1JYWA 4LYQA 2OSWA 1WS8A 3ZL2A 3DTUB 3UABA 3P3UA 2DJXA 2PUZA 1QASA 1DFBL 5BOOA 3WFBL 3WY3A 5HJLA 1UWUA 2R6OA 3MRDA 4JO1H 3US1A 3FU5A 2VDIA 2J44A 3LB6D 2Q02A 2DEPA 4YFDB 1DVFB 1UWQA 1EBHA 5BZDA 2OWXA 3IDGB 1IAKB 1AFVL 4KVCH 4YDLB 4AKPA 2CJUL 4PJHF 2HE8A 1KFJA 4EI6A 4R90L 3EDKA 1WZ1L 5JORA 4Y9MA 3EJYD 4UTBA 1BCIA 3L9RB 1RIHL 4O18A 3VTMA 2OFJA 5J9PA 1CICC 1ZD6A 4C8XA 3CHSA 3ABRA 2P53A 5C9XA 4FNLH 3ARFD 3W1NA 2PLKA 2J6XA 4GI8A 2WAGA 5KN5B 3W3BA 1IWBA 4ICXA 2GWNA 2IW0A 3V6ZA 2OT1A 3K8KA 3BHBB 5C08A 4GI6A 1H7RA 4AD0A 5GJNA 4BJLA 3DO4A 4PGZA 1KC5H 3FO9A 3SJVA 4XC1H 3RNKA 5IMMB 2XVNA 1L7TH 3C9NB 2MTAA 5KUMA 2M2DA 2QZQA 2ZJSH 3IEBA 2BP8A 2P7TA 3GXNA 5L6UA 5LNVA 3GTIA 3UZYA 4JHWL 5L0QB 3SBRA 3AY2A 4XN1A 5CU5A 4YNYB 3VQ2C 4QNWA 2P10A 2J6EA 2CDGA 4KEMA 4P23C 1R3HB 1FPTL 3B2DC 4K5OA 2YLAA 4B5ZA 3LLFA 1LO4L 2YQ2A 4HQQH 5J57B 4PJHE 2WSPA 4OLYH 4AYEC 4U1LA 5GGTH 4YXGA 3DN5A 3WMQA 1C5BL 5HJBA 3RWGA 4Z7QB 3BICA 2A83B 2OXGA 4LKXA 2PXYD 1SJEA 3QH3A 3OC5A 3WE6A 4B96A 4JDZA 5BRBA 3GG1A 5C9UA 1FSKC 3E38A 4L9DA 3RMJA 5J13C 3JUYA 5M95B 3CFBB 3HBPA 4HA3A 1ISVA 4L8CA 4DP7X 3QM3A 1AC6A 5EEUA 3IIXA 4G1EB 5CBJA 1F3WA 4TVPE 1XLMA 3C6CA 5D4HA 3UTTB 4RMUA 2WMFA 1SLXA 5FXCH 5JHDB 2AKRB 3CVHL 3SDDC 2AK1L 4N0CC 4WZHA 1XXDC 1V6TA 3VCLB 3OZ9H 5IW3A 4XVOA 4NUJB 5AYXA 4NU7A 3TN0A 1XF5B 3W70A 4LSRH 3D3VE 1P0EA 2RAGA 2PA6A 1BSIA 3N9GL 2Z1WA 4K3GA 2CKBA 4WSHA 4FXGC 3KVMA 3KPNB 3MGTA 4ACZA 3FRUA 2H4EA 3MSRA 3RU8L 2WGXA 2PGFA 2P5PA 4BFFA 5HR7A 2W9DL 5C2XA 5DURB 4KAQH 4TX8A 5IHSA 3UEZA 4WTWA 3UERA 4FCAA 4MHHI 3P73B 3QJFB 1FVEA 2IQ9L 2A9NH 5I66A 4ZGYA 1BF6A 3B7YA 2WLLB 3W37A 4LL1A 2E28A 2XJ7A 1FO0H 4DFIA 3ZKMD 1OB1A 3UJIH 1EAPA 1A8ZA 1ZA3A 4BQ8A 3B7UX 4HK3J 4EO5A 5D38A 1XGQA 2XPGA 1HF6A 3C5ZC 4JFQB 3HN8A 1B3OA 4NYLB 2CWXA 4N7QA 1IAOA 3TIDB 1MG3C 5KTEH 2E9BA 4TXEA 4OZ4B 3GO2A 3ES7A 3VG9B 4U1MB 4AMWA 4XZ4A 3IKCB 2BSRA 1ADQA 1OD9A 2X0HA 4YBLB 2CGYA 2YK1L 4US5A 3KRUA 4X50A 3TSBA 2WNGA 3VXOA 1GOIA 3W7NA 2EQDA 2XKNB 2CCVA 2IAAC 1I7TA 4ZA0A 3TA4D 4M1BA 4MFEA 2KQNA 4KITB 2QELA 2R2BA 4PMEA 4MA1C 4JTIA 3LS9A 1NOFA 4LCVA 3QNZA 3BZFB 4AY8A 3UGEA 5GNZA 1Q9OB 4HK5A 2ZKWA 3P4MA 5CC6A 4PJ5E 3B9NA 3E3QE 3U0WH 3O0RH 4N8CL 4RDQF 2KS0A 2IVFC 5KSBA 1DVQA 5LXVA 4LALA 3PPSA 4CU7A 5DJCA 1K3UA 4DZ5A 3D46A 5C2GA 4EDXA 4ZZFA 2X42A 4IJCA 1E4JA 4YZWA 3UU0A 3PTMA 2A21A 3HPZA 4UT9L 5SWSB 1WDWA 1XRFA 2XFYA 5EC1B 4UTTA 1RCYA 1DO6A 2EDQA 3OR7A 2C9QA 3MRKA 4MJIB 1PGRB 1TQBC 2Q3AA 2CR6A 3WFCH 3FT9A 4N8PA 1IQWH 4LT9A 1IAII 1G6VK 4H88H 1FYTD 4RZ4A 3UZVA 3W9EA 3GJFA 3GH7A 1T6MA 2YR3A 1FCQA 1W3HA 4NWUH 1H5YA 4AHPA 1LUCA 4JVPA 4EXKA 5ITFA 3W81A 3P40A 1CZ1A 1C91A 1JBJA 4OFDA 1C12B 1JZEA 1RURH 1Q63A 5HNTA 3BWWA 1XMEB 4JKNA 2CLRB 2XWTA 3TM6A 3DXAD 4MKVA 1VRXA 5PAZA 2KERA 4QGTA 4NOFA 3NQCA 1PKQE 5C8BB 4KNUA 4OCLC 4P7LA 3I6LD 4QTIH 4MLRA 1BM3L 1A0DA 3DXIA 3KAOA 2GQAA 1GQNA 3STGA 1WFTA 2IOOA 1A02N 5ESAB 4L1XA 1L6YA 3VXRB 3F7VA 2P24B 3B04A 4QTFA 2X1XR 1M42A 2P76A 5D7SH 7CGTA 4WCJA 1V3MA 3UDWA 5A8OA 2WWNA 2XV3A 3BDXA 2OMTB 1FNSH 2O9PA 4LNYA 3FUEA 5E0FA 2B0MA 3QRHA 3KVPA 3EH2A 4ADTA 2EDKA 1BZQK 3O2DA 1Z6JT 2OO6A 3FJTA 2Q0ZX 2WZMA 2MNUA 1ZHAA 2LLEA 3OF6D 4U4MA 4EIGB 1A0QL 4BHYA 3G04B 3EBIA 1EC9A 3VFOB 4LGRB 2N01B 2JNZA 2ZUSA 5DY3A 2GJLA 1FDZA 4FQLH 2QJMA 2TYSA 3VXPA 4L29A 3ZL4H 1N55A 3OKMB 1DUZA 3UTTD 3G6JF 5JHDD 3A3WA 2ORBL 1ZPTA 4GQ9L 1LYQA 1FVDA 3H4GA 3KPSE 3A4XA 4OV4A 1M9HA 1J2BA 5IW1A 4V2BA 4IIDA 2IBZY 2Z35B 3EJJX 2I24N 1GMEA 1R1CA 3HN5A 4PRPB 4P9HC 3NM3A 5CH9A 3ITCA 4XBKA 2X2JA 3CIVA 3LS4H 4JFDA 1EC8A 5DO2D 4FKHA 3UBFA 2X5PA 3LRKA 5GISL 3S9IA 5DK2A 1RZMA 3PZTA 3C5SA 3EO0A 4A7VA 1C5CH 1EFXB 2XTJC 5A2KH 3TV3H 1N8WA 2J7EA 1RK1B 3F7QA 4KY2A 1DBAL 2H1PH 2DQDH 4IJ3B 3KW8A 1HFBA 3OVPA 2Y62A 5EN3A 3ZZ1A 1XHHA 4H8WH 4Q8BA 1TWWA 4MQXC 2VJXA 4XAFA 1KPVA 2AXGA 5HGHB 1GYVA 4LVEA 1N8ZB 2W5FA 1GGUA 1NGPH 1KIRB 1AI1L 1QUNA 1V7ML 3C3UA 2FR4B 3VVVA 2VDOB 4P46A 1FH2A 1B3IA 4U6VH 3TW6A 1GW6A 1GH7A 3EO9L 3HRZC 4X80H 3NXFA 4HG4J 3W00A 2H6PB 2VKZG 4N1HB 2VE6A 1A1OB 3IMRA 4BZ1A 2YGNA 4Z2JA 4X9IA 4OHQA 4YHOH 3L5JA 3H6OA 3EJSA 3CHOA 1I2NA 1UXSA 4JM0A 4R4FL 1I1RA 5I8CB 2WPGA 1CVRA 4H9YA 3GFZA 3LB6C 3AIBA 4B9JA 1NTDA 4RV8A 3IJHB 3ZYIA 4GNVA 5ITBL 1Q6FA 5JQHC 4ZO9A 5C0JB 4P5MA 5CJQH 3SCOA 3IWVA 3TFXA 2FWSA 2IANB 2EG6A 3O4OC 3SB3A 2ZE3A 3QUZB 3FRPG 3EJYC 5AB2A 5TNVA 5F9JA 1WHPA 1TJXA 2AITA 3QFDB 4UV7H 4HHHA 4UXDA 4M0XA 1CDGA 3U7AA 1K3ZA 5JQIB 4D0DA 1DUYA 6XIMA 4TSCL 2X0WA 1Q5MA 3G9VA 4JO4L 3VD2A 4ZNEE 5D7JD 5EU7E 5HHXL 2ZX7A 3KXFB 1QMUA 5F72S 5HYSG 3MCYA 5DEFA 4M3KB 4KCWA 3WFEL 4D3CL 1LL4A 1ZT7A 1AS6A 3T0XA 1I8LC 4GVHA 5IB5A 4MJID 2EE6A 1AO7E 3QZWB 3NZQA 5HHOB 3TWBA 3HS0C 4O14A 2V8MA 5AVUB 3HUJE 1OQFA 2EO7A 3V75A 1PKOA 3FAXA 1C5DA 3BT2H 1FH9A 3F4WA 1SY6A 1XR8A 5D7LD 2ZUMA 4BEQA 5AYZA 1YN7B 4YDJA 3N44B 3UYCA 1F1GA 4NCC2 5T33L 1UW9A 1ZOXA 3P84A 3QDJE 3S98A 3OHXB 2DP3A 1MHPH 1Q72H 5AOLA 5CJBA 3A0OA 4O8AA 4R6UA 4JDYA 3DUSB 2C4FU 4I48A 1XIBA 1EDTA 3JWNH 3GLAA 2LVEA 2NQ3A 3JR2A 5EZJB 3D4GA 1AD1A 3AUWB 1G7JA 1EJOL 3CM4A 2PXYC 2OMUB 1XDMA 4ABVA 5IVNA 4AD4A 3X1FA 3RLUA 4X4XA 5LGJB 2YBUA 2HX7A 4JANB 4LE8A 1UR8A 3VXRD 4NKMB 4F1ZA 3EPMA 1ICTA 4ONFL 2YC1A 3ZR5A 2GJPA 4W86A 5F3FA 4G6AC 3FYPA 4R84A 3P14A 2DW5A 4Z1AA 4BCYA 2BODX 3V7AE 4PRTA 4PR4A 1CGTA 4JG9A 4Z7OE 1L8NA 1CR9L 2RDTA 4JR9L 3ATZA 4KKNA 1RZJH 2XI9A 3FU3A 2C3GA 5LG6A 1HEHC 2YSSB 3QUXD 2OOGA 2E4TA 2VC7A 1XBVA 2VEIA 3F65A 2W61A 1O6IA 1CDYA 1MHCA 2Q8BH 4RNIA 4HNLA 3E0WA 1KDJA 1XXXA 3LXUX 1IAMA 3M17A 1PFOA 3HE7A 2ROYA 2VVNA 5CWSB 3M4HA 3ULUE 3IAQA 3NJ3A 4ZSOA 5JW3L 2EH7H 4NIYE 5ICYB 3EUDA 1BTCA 3H42L 3RFRA 3TSMA 4F8QA 5EOTA 4BFEA 4Q7IA 3EAUA 3CDZA 2VGBA 5IFJA 3IYLW 1TU2B 1IU1A 3SKOB 3ULUH 2XPYA 5M17A 3LHAA 3ZKMC 2KMWA 3ZTJH 3AXLB 4D0CA 1GGOA 3RUBL 1LQBC 3LZPA 2ZUVA 3RZCB 2VEGA 2OMBA 3BYTA 4RFNB 2G3XA 2CK0L 3HLKA 4JFEE 3BKCL 1JFQL 3WUBA 3N18A 4BZYA 5C97A 2Y7EA 3OVQA 4A3QA 4KK8D 2XYBA 3KEDA 2ZCHH 4HP5A 5KAQF 4PLJC 5IJDC 2CLFA 4NJ9H 3CSYB 3UD6A 2VDNH 3RM4A 1MDRA 5A16B 4JTSA 4DGIL 5D30A 3STEA 3RJQB 1UKTA 3ZW3A 4PCYA 4URIA 2ZUUA 3B9AA 3VXSA 1RD6A 3ZDYB 3MO4A 4JTEA 5ICXA 4K1WA 3UZWA 1GQJA 2K78A 1R3LA 3FB5B 4R3SB 3GFYA 3W7HA 4PP2B 3VC5A 4HUWA 4ADUA 4X99A 3KP1A 4YNGA 2P8MB 5EC2A 2DQXA 2VERA 2A7NA 1IUZA 5EU6E 2ZDRA 2GB2A 2BW5A 4I77H 3VIKA 2X4QB 2Y23A 2VENA 1FBAA 4N2GA 1OWQA 4XTRD 4UDTB 4LXFA 2R0ZL 5DBUA 2MHAA 2WXNA 3GC5A 4N86A 1QFUH 4AV0A 1NTHA 2NXYD 5JOFA 1RUKH 4RLDA 4GYJA 4M3PA 5INCA 3ARBD 4P4RA 5DJAB 5BXSA 3GJEB 2F5AL 2JFCA 2O4QA 1KIPB 4XMVA 4NQVA 4O2EA 2GFTA 4CAGA 5JBEA 2IAND 3MHGA 1DIOA 3ZO0A 2VFGA 2EYSB 2VDKB 4A55A 5E4AA 2OZ8A 1P5BA 3GDBA 4EX4A 3SURA 3U46B 3DGBA 1XGYL 3WEOA 1A65A 4AYFB 1F4WL 3BQ5A 3PXJA 1RERA 2SFPA 3LZNA 2FKPA 5JQ9A 3THCA 3SB0A 1QLFA 3QDMA 2ODHA 3ORWA 2PDHA 4GG6A 5M3WA 2VFIA 5DMKB 1PCXA 1KG0B 1K7FA 1RP9A 1R7AA 4G56A 3M0IA 4K2SA 4OD1H 5D1XD 1WUFA 3KXFD 3DDFA 4UQDA 2A74C 4Z42C 4DGUA 4ZMZA 1DVZA 2ZRVA 2GVLA 2LGNA 1MREL 2VX6A 3S2AA 3ALWA 3EBVA 1G4TA 2Y25A 4A2MA 4K7FB 3TT3L 4Y2DC 4PJ7A 4F20A 3HM7A 2YBGA 4TUJA 4F27A 3L95A 4K5MA 4RUBA 4DJED 4Y19E 3UJSA 3U0TA 2YFOA 4IKNA 1WDQA 1BFOA 1C8YA 1B0GB 1JGLL 4PMQA 5LWYH 3MVIA 2N7BA 5KANI 2V2CA 2ENSA 1ZBVA 3ZJ7A 3RLHA 3QB7C 1J0KA 4A2EA 1VJSA 5AVWB 3V6FB 5T5NF 3RJDA 2VXQL 1A5UA 1WFMA 3AG2B 1AKJB 3IWPA 4B3EA 5CNHA 4P23B 3VOCA 4WI5A 3N2MA 5B1JC 3WYRA 3VTRA 3LZRA 3QV7A 4C83B 2RDWA 2DWDB 2N1KA 2UXGA 5KBDA 3DMMD 4PMDA 2EDHA 4PFEA 4E38A 1DJSA 4FEIA 2F53B 1R3IL 2X2UA 1V27A 4OCSH 5HDBF 4P5SA 2ZG2A 2PP1A 3BKYH 3LZ5A 5CCHE 4NQCB 4UMGA 1WIOA 3HIZA 5I8EB 3KDMA 4H6KA 4H25B 5J13B 2VDLH 3VI2A 3HI6L 4QXWA 1ASPA 1CL7H 2UVFA 1J7VR 4QNEA 2OAAA 3P7YA 4XO4A 1Z32X 4PD4K 3TFBA 4W70A 3ZE2F 3WXWL 5I77A 4JQIA 5I24A 1DSFL 5L4IA 5D1QA 4OCRH 2CJTA 4YXKL 4YXHH 3K2IA 4PMZA 3V1PA 4NJAH 5DO2C 5AFAA 2AGJH 3UC2A 3JRKA 3B9OA 4AIOA 3C60A 1VADB 1B3ZA 5TE6L 4G8TA 1YNTF 1FP5A 1D7BA 4C6IA 2H3NB 3XIMA 4FXGB 3GW0A 4MDRA 5JMRA 4LX4A 2NSQA 3CVHB 3FTWA 4Y2OB 2DL9A 1A1NA 2EDNA 1M1SA 3P30L 1AGEB 2GQ9A 2F58L 4XKMA 3RZCD 1GOFA 1CDIA 3N17A 3S3DB 3MYJA 1VIZA 2INEA 3VRIA 5I73C 5GRVL 1DHKA 3EJTA 3JBG7 1KBGL 4PRAB 1FL5B 4L4TA 4RW5A 4MB3A 4GI4A 4HIQA 3D4ZA 1I8KA 1NWPA 1I82A 3BAXA 3C5ZB 2NQDA 1A0EA 4ZR8A 4MDIA 2VDMB 4TV3A 2VDHA 2P0IA 2KLRA 2QIWA 3WIJA 3ANYA 1VACB 4PS8A 3KYMB 4APXA 2HG5B 5KVEE 3KLKA 4YPJA 3R79A 3EFDL 1UD3A 4DGVL 4ILSA 4BK5C 5F1NB 2UX7A 3ZYJA 5ES4B 1GHRA 3X3GL 1U8PB 4PL1A 5HYIA 3B2PA 1WKFA 2O55A 3MTWA 2I16A 5AENA 1T0OA 2D2CC 1O9VA 5KVEH 3RYSA 3J27A 3DHJA 1AW5A 5D04C 2HB0A 4MA1B 4ZUTA 5JLZA 4XE5B 1LZOA 1G6RH 3AU2A 2XG5A 3V4VH 1VPQA 1W37A 5FDYA 5E4EB 3V0DA 3RITA 5AL8A 1XV8A 5AKRA 5H2BA 1LCOA 2R0LH 2Y4SA 4WTZA 1FY6A 1GKOA 3WD1A 4GX8A 3C2FA 5IUCA 3Q1EA 1B3JA 1FZOA 3E0GA 5LIKX 2FJUB 3HG1D 1IBDA 4ICWA 3QI9A 3MMTA 5FA3A 3CQQA 4BWLA 5FWQA 1KCSL 2CGRH 3K8LA 1JMZA 1QBAA 4TMPA 2Q09A 3EPNA 2O5ZH 1ZBCA 2NNCA 1LE9B 2X4OA 4AZIA 3P3SA 4F58L 1JWMB 4RH4A 3I7QA 4D9RD 4CCEA 3L9CA 3L5XH 2JKAA 3QQ0A 4NQDA 5GRJL 5IJVA 3RE0A 2Z28A 1NLDH 2FEEL 3SGEH 3R06A 1CICD 2XU2A 4AF0B 5IK3B 4NVTA