3BAJA

Human pancreatic alpha-amylase in complex with nitrate and acarbose
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
total genus 172
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bajA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bajA01
4FMVA 2ZX9A 4NZCA 3HG5A 4DM2A 4JCLA 1B9ZA 1GORA 3WN6A 1JFXA 3KL3A 1HKKA 4D6IA 1UZ4A 3GXTA 5CGTA 4AIUA 4CVWA 3ZT6A 4M56A 1B2YA 3VSUA 1NWUA 2JEPA 3M7SA 5FOOA 3EDFA 4JFVA 1VFMA 1RP9A 2ZXBA 3BVVA 3AROA 4UQAA 3AFBA 5EBAA 1XD1A 9CGTA 1C3FA 2V5DA 4DO6A 1IV8A 3WNMA 3L4YA 1WZMA 5AY7A 1PIFA 4GXPA 1XD0A 1V0KA 1HJWA 4TVCA 1C93A 5M5DA 4GO9A 1EHAA 1E4NA 1H4PA 4NF7A 1KWGA 3MKKA 3SUVA 4H8HA 5GPRA 4AW7A 3OGVA 1M53A 2AMGA 3OGRA 3O2LA 3PZ9A 3WKZA 3CO4A 5I2UA 2RGLA 3IJ7A 1JZ6A 4AZHA 2O92A 2WLZA 2UWFA 1UR8A 1ZL1A 3OLEA 1J0IA 1XH0A 3WMCA 3NJ3A 4AD0A 2QV4A 3CUGA 2DSUA 5LA2A 5ABFB 3OIHA 3OZOA 4M8UA 4U2YA 4F79A 5FL0A 4EKJA 1DWJM 2VZSA 3SCPA 4AZ6A 4CU8A 2ESCA 1KWKA 4EANA 2G3JA 2J7BA 1ODUA 4NXKA 4MPKA 2CITA 4DWSA 4V2XA 3TP4A 4AIEA 1UWUA 5FL1A 3CTTA 1CEOA 1ESWA 3DX1A 2EEXA 1HJVA 4DWSC 3VD4A 1FFRA 1CXKA 2JALA 4P8XA 3BVXA 1E0WA 3VX0A 3ARSA 1ITCA 2WHKA 4Q7NA 3L4ZA 3NDZA 3F5KA 1W9PA 3B9EA 1XHGA 4CU6A 4Z2IA 1G1YA 1XV8A 4JHOA 1E9LA 1UZ1A 2J7CA 3H53A 2CHOA 2E9LA 3GXNA 5IFTA 5A2BA 4AEEA 2CBJA 4CGTA 4CN1A 2VJXA 5A8MA 3RM4A 5EFDA 1UH4A 4MTVA 4HMEA 5A6KA 2JF6A 4WK9A 4ATDA 1QW9A 3ECQA 1GPFA 1E15A 2XN2A 1US2A 4P7NA 5CLTA 1Y7VA 3ARYA 3TONA 5A1AA 4W8BA 4W7VA 4AMXA 3QHNA 5ABEA 2CKSA 5HOSA 1NM9A 1BLIA 3AS2A 1QNQA 2VZOA 4MAVA 3BXWA 1R86A 2VVNA 2XPKA 4PCSA 2OYKA 1UUQA 1I1XA 3RILA 2J7DA 1GJUA 1B3ZA 5TD4A 1H41A 3RM8A 1V3JA 2ZXQA 2VZVA 5CSYA 2DH3A 1WCGA 1NP2A 2GDVA 1CBGA 4UQ9A 2CNCA 3ARPA 4HZ6A 1LWHA 2ZUNA 3GXMA 4WLCA 1H0GA 5FKYA 2IUZA 2DT1A 3HN3A 1C8XA 3UG4A 2C8NA 3CZKA 3ZJ8A 3SCQA 2DDXA 3S6TA 1JGIA 4AZGA 4EAMA 4R27A 1KTCA 3ZJ6A 3WY4A 1UKTA 3PZGA 1EQCA 2VCAA 3EJSA 3AIUA 3GH7A 3ZJ7A 1G01A 1OCQA 2WB5A 1XGZA 2WMGA 1V02E 1PPIA 3OLDA 2O9OA 3WENA 1FHDA 4GPNA 2YL8A 2GUYA 2BXZA 2E9BA 3AICA 4H8UA 3AYSA 2OYMA 1HKIA 5BRPA 3EJPA 3WH8A 1JZ3A 1WKYA 3IAPA 2W92A 4D6JA 1WDPA 2JIWA 1W3LA 4ZEPA 2CIPA 2X0HA 3RDKA 1KXVA 1R7OA 4TX8A 1KR0A 3WY3A 3VGGA 2YFOA 3GNOA 4W93A 3UR7A 1VF8A 1EO5A 1HP4A 2WMJA 1J10A 1SFSA 4W7UA 2X2JA 2EADA 1ISZA 2PB1A 3A24A 1V6YA 1UH3A 3A5VA 1TVPA 4HZ8A 1MW1A 1UHVA 2UY3A 1CECA 3WUGA 4UFKA 3H54A 2XGIA 2DQXA 3VO0A 4C7GA 3WMBA 1JYWA 4HZ7A 5JIWA 1UYQA 3VILA 2ZOXA 2ZE0A 5A2AA 5I6SA 3ZR6A 3BMVA 4UFIA 2W61A 2Y2WA 1JAKA 2GSJA 5A6SA 3DYPA 2VQUA 4AWEA 2G8ZA 1V3HA 4CD6A 4MB1A 1D7FA 1DWAM 3KEHA 1QI5A 2PWFA 5E0FA 3CUFA 4GZEA 4V28A 4WIWA 5E9AA 4QCEA 1NWRA 4B16A 4AZBA 4A4AA 2CBVA 5C71A 2O9TA 3ARXA 1QBBA 4MNLA 1JYVA 4AMWA 1W3JA 1GQIA 2ZXDA 2O9PA 3EDDA 3MANA 3KL0A 4DWSD 2BNJA 4QP0A 3A22A 4ZE5A 4CD8A 2VX7A 1YQ2A 5E0CA 1XYZA 2Q8XA 1R7AA 3AHVA 1DWIM 1UD5A 3ARTA 3ARRA 4YHGA 3VIKA 2CXGA 1UWRA 4PTWA 3ZQ9A 1GOKA 3F4VA 3CHEA 4FLQA 2Y5EA 4J3UA 3SCOA 1OT1A 2OSXA 4RL3A 1JDAA 2FH8A 2ALWA 3AS1A 4FNPA 1KCKA 2O9RA 1N82A 3FN9A 4KH2A 3MO4A 2XWDA 5A8QA 1US3A 1KQZA 3ALFA 2VCBA 3BMWA 3WD3A 4BS0A 1PX8A 4W8LA 3II1A 1UWSA 1H2JA 3FAXA 1MQQA 2WMHA 2DT3A 3WDRA 5I24A 3VPLA 4N0RA 1QW8A 4BQ3A 4AD2A 1H49A 1TQUA 4NI3A 1J12A 5IDIA 3QHOA 5FIPA 2WVSA 1HJSA 4W84A 1R34A 3TOPA 2ZXAA 3VGDA 1FH9A 1UR1A 1ISXA 5I3DA 1J0ZA 3AHYA 1U2YA 1VIWA 4E8CA 1W3HA 1RP8A 1UD6A 4XZBA 3VIJA 3LPPA 1C7SA 1E56A 4HU0A 4CCDA 3BC9A 1B3XA 1MW3A 2EO7A 3BAYA 3K1DA 5DO8A 5E1QA 2PWHA 5A8PA 2QPUA 1E1EA 2EPNA 2BVTA 1E3XA 2VNCA 3ZSTA 4Y7EA 1LQ0A 3RJYA 1JF6A 1O7DC 2VZUA 4J7RA 1UQYA 5JBEA 1NWTA 4NXSA 3W6LA 1KQYA 4UZUA 3N13A 5I23A 3MV01 3WNOA 3VD3A 4URIA 4CN4A 1MW0A 1E6QM 1ZBVA 3NIYA 2X09A 3T09A 1SMAA 2G41A 2CKRA 1WB0A 4AZCA 1ECEA 2JF7A 3WNLA 3MU7A 4GI9A 5I0DA 2DSZA 2W91A 2EAEA 3IAQA 1JZ4A 3T2QA 4XUYA 5A6JA 1FFQA 2YDRA 4LYRA 2XWEA 2YA2A 4GZIA 5BXSA 1UR2A 5I79A 4FNQA 5AC5A 2BV9A 1EOKA 5M17A 3QR3A 4DUWA 3WFZA 4CD5A 5BCAA 3L4TA 4JFTA 5IXEA 2BY0A 1JI2A 1O7AA 2VRQA 1R75A 1HTYA 4AYGA 4OBRA 3U5YA 3WF1A 1KCLA 2EPMX 2XVGA 1MXGA 4JIEA 1D3CA 3QOMA 1QBAA 4X0VA 5BROA 3MUAA 1GHRA 4UOZA 3SCRA 1U33A 3AIQA 3MMDA 1KTBA 1UWIA 2WCAA 3CGTA 4PSRA 5CPSA 1JG9A 1GHSA 3WH7A 1E55A 1Q6FA 1R46A 3N11A 2OW7A 1HIZA 2XFRA 1OGSA 1OIFA 3HG4A 3IGUA 2WHMA 1LL6A 4IM4A 4KRUA 2OLHA 3E1F1 4PBGA 2V3DA 3MUY1 2PBOA 3CC1A 1BVNP 4JCMA 1NOUA 3VMOA 4QDMA 2WMFA 1MFVA 3D4ZA 4M24A 3L2LA 1C8YA 2WVTA 2WXDM 2J4GA 4D1IA 4KWUA 3LRKA 1B90A 4UFMA 1VJZA 3CPUA 1BYCA 4UR9A 1A3HA 1JDDA 2VUYA 4MJ4A 3WDQA 5A6BA 2YA0A 3TV8A 2WMIA 2UY2A 1H5VA 1IT0A 5D8ZA 4LXFA 1CXLA 4LQ1A 1BYBA 1OM0A 3WDIA 1FHLA 3B9AA 2WVVB 2EJ1A 1J18A 1F4HA 3VNZA 1UKOA 1VFUA 4HP5A 1EO7A 4B9ZA 2ZIDA 1TFVA 3CIVA 1VB9A 3DX0A 3DYOA 7CGTA 2EPOA 4D72A 1MXDA 4HA4A 4PMVA 2Y24A 2FH6A 4M29A 4WSJA 3W26A 4CD4A 5ECUA 2WVUA 4CCEA 1MYRA 4BF7A 3GXPA 3LXAA 4M82A 1AQMA 1Q6DA 1IZKA 3WMSA 3VIPA 2FHBA 1CTNA 1LL7A 1UQZA 4TVUA 2OSWA 5DT7A 4TTGA 1G94A 3W28A 1UOKA 4AZ7A 2E9MA 3ZO9A 1CNVA 1KB3A 1H09A 4D71A 3K8MA 2A3EA 3POCA 2DPEA 1TMQA 4J28A 4XB3A 3WDHA 2VR4A 4PYSA 1UA7A 1CGWA 3WFLA 2E0PA 2W62A 1X6LA 3TTYA 4PMXA 3ZSSA 1GOMA 4MAZA 1CGTA 4M80A 1FA2A 5D8WA 2BHZA 3CBWA 3WUFA 2J79A 1NP0A 3CUIA 1K9TA 2JE8A 2BVYA 1V03A 1B3WA 4CN6A 1E4MM 3EJTA 1LG1A 4UQEA 1HKMA 4WSKA 3WQ5A 1R8LA 2VVSA 5KEZA 3DC0A 2VI0A 5A3HA 2F18A 1W3KA 3WY1A 1ZJBA 1GZJA 3A47A 5ABHA 1UR0A 3DYMA 4JL1A 3SCWA 5I78A 1W91A 3VKKA 3HJEA 4AY1A 1V02A 1EDQA 2PC8A 4PMZA 1R33A 2XYLA 4H41A 3AZRA 3N17A 3KE0A 1CPUA 4KMQA 3MUZ1 1QWUA 4UCFA 1CGXA 3EMCA 3W27A 3MMUA 3WD0A 1SZNA 1OWQA 2ZUVA 2OWWA 1X1NA 4HOXA 4PMRA 4IPNB 2D23A 3PHAA 5A95A 3T08A 4S3JA 1TQTA 4DUVA 1HKJA 5CXPA 4NRSA 1VBRA 1PBGA 3A21A 4ACYA 1EDGA 2XGBA 4HTYA 2WM0A 4KRTA 4CCCA 3K8LA 1E6XM 1BQCA 3AHZA 2VURA 3FNDA 4OGZA 2J7HA 1JF5A 2WSKA 3SCSA 2YLAA 1E0XA 1W1VA 4W5UA 3RM9A 3W29A 4RE2A 2ZUUA 4HMCA 1J0KA 4U3AA 1GONA 1RH9A 3ZOAA 5CZKA 3SUUA 2VL4A 3LX9A 2QMJA 3J7HA 3W53A 4PRWA 2F7QA 3U5UA 2D3NA 4KGJA 3N12A 1CXFA 5BXTA 5CQ1A 3UEQA 3GDBA 3U7VA 1QI3A 2WPGA 5EFFA 5HDRA 1UKPA 1PIGA 2F1AA 2OWXA 5DMYA 3PZMA 2FGZA 4U2ZA 4DWSB 3W37A 3VIOA 1V6WA 1KBBA 3SUTA 3ARZA 1JZ5A 4BA0A 3EMQA 1NOWA 3VVGA 3HU7A 2J74A 3POHA 3VM5A 3QGVA 4MNJA 4ZXLA 4CUCA 2PWDA 4NSBA 3B8SA 4PMYA 4PTVA 1RPKA 4MDPA 1PZ2A 2PWEA 3OLIA 2XJ7A 3MMWA 3PTMA 1E72M 1WE5A 2ZUMA 1R47A 4JFSA 3UCQA 1OGBA 3OB8A 3T0BA 1V6XA 4MNKA 2WZHA 1MW2A 1B1YA 1V08A 2XN0A 2CESA 1JYXA 3OBAA 3AXHA 3L4WA 2E3ZA 3GH4A 1CYGA 1CXEA 2WAGA 3VD9A 1O6IA 3PZOA 1HNYA 3ZMRA 5FD0A 1BTCA 1HXJA 2C7FA 3WF2A 3ZIZA 4K68A 4LYPA 1EH9A 1W9BM 1J0HA 1JNEA 2AOSA 4CKQA 6TAAA 3AJ7A 3PZIA 3WEMA 3O9NA 2WHJA 1MQPA 3OLGA 3D52A 2WMIB 1OGGA 1HJXA 4OJYA 2E4TA 1E71M 3BSHA 2D2OA 4H2CA 1B3YA 3UR8A 2A3AA 4Q22A 2F2HA 3VIFA 1J0YA 3VNYA 3VSTA 2CPUA 2NW0A 3VOCA 4OOUA 1FP8A 4AD1A 2G3NA 2W67A 3WQ8A 1QVBA 5AC4A 1BHGA 3WDJA 1GNXA 2PBGA 3ARWA 1QI0A 2YIHA 2IXVA 1TR1A 3T2PA 4QAWA 1ZBCA 3G6LA 3GNRA 4W5ZA 2VZTA 3LRMA 2E40A 3WBAA 4D6HA 4HU8A 1KXQA 3THCA 5CPTA 2VOTA 2HVMA 1HJUA 1E6ZA 1TUXA 1JD7A 2XVPA 3W25A 4AD4A 3S5YA 5D9PA 3F5JA 3VGFA 1AQ0A 3ARUA 2ZUWA 1PEZA 4HOZA 5A6LA 5IHSA 3ZT5A 5A8NA 2WC4A 4MADA 4ZENA 3CHCA 2W66A 1T0OA 4H8VA 4AD5A 2YL9A 5A6AA 2YL6A 4B15A 2A3HA 5EMYA 4W89A 1I75A 3VGBA 4DO5A 3PZTA 3QOKA 2IGTA 4FLRA 3AMCA 1VEPA 2UY4A 4UFHA 2X2YA 4GKLA 3UG3A 1HL8A 3HG2A 3NDYA 5E09A 2YOCA 4Z2JA 4J3SA 3NUKA 2ZUSA 3AS3A 1W32A 5M3WA 1XSJA 2WCGA 4AYSA 3BLBA 1M03A 3DDGA 1QX1A 1WZAA 3WQ4A 2WANA 3HG3A 4DO4A 2A3BA 1OBAA 1OINA 1PX4A 3WELA 4TVDA 3BVWA 4AEFA 1V0NA 3GM8A 1GOWA 1QNOA 2J8GA 3AZTA 1WO2A 3S5ZA 2DSKA 7A3HA 1P6WA 5D4YA 3T0DA 4HPHA 2WKLA 4OOZA 4Z2LA 1OSEA 4D6DA 1FOBA 2VX5A 4HA3A 2OYLA 5CJ5A 2QMKA 1XCXA 1ZJAA 2G3MA 1SR0A 4KGLA 3OA5A 2VX6A 4GI6A 1KXHA 2WHLA 3SCNA 1UWQA 4C7DA 4GINA 3BAIA 4A3HA 4EE9A 1W2VA 3D3AA 1BSIA 1J0JA 3I3BA 1V6UA 1WDQA 4IISA 3VU2A 2FE0A 5DF0A 2YKKA 2B31A 2W63A 3D4YA 3AHXA 4PMNA 1QWNA 1K9DA 3PBGA 4UQCA 3RCNA 3WSUA 3KLKA 3WF4A 4D6CA 3AXIA 4PUDA 2PWGA 4E4PA 2EXOA 4HA1A 5A8OA 2GJRA 2ZUTA 1GOQA 3CH9A 3W38A 3LPOA 2EPLX 1EOMA 1W1YA 3LMYA 1WZKA 5IFPA 4M1RA 2UY5A 4PUEA 4QLKA 4OZOA 2FGLA 1KFWA 4PSPA 3CZSA 2FHCA 1JXKA 4NZFA 4GQRA 1B0IA 3L4VA 1KGWA 3PZVA 3W24A 1VAHA 3PTQA 4AD3A 5DEZA 4FK9A 3GBEA 3WIJA 4DM1A 2XTKA 3CMGA 2OWCA 1VEMA 2DGAA 3EJQA 3W81A 5D9OA 3BAWA 2XM1A 3GXDA 5BRQA 3LRLA 4F9DA 4W85A 3FAWA 1CLVA 4UQBA 3S2CA 2XFYA 1ZS2A 2WLYA 2BXYA 2GDUA 1TQWA 4AZIA 3AMGA 2VTFA 2VQTA 4UTFA 2CBIA 1ZB5A 2ZWYA 3EYPA 4AXNA 1ISVA 1E6SM 2XVNA 3D51A 1QNSA 2D0HA 3DX4A 3BUDA 2VT0A 2PI6A 3MSDA 1EDTA 3N18A 3U7BA 2XG9A 1BAGA 1FP9A 3UETA 1NARA 2JIEA 7TAAA 1GOIA 1MFUA 3ZR5A 2WYSA 1K9EA 2J7FA 1QI2A 4X0NA 3LXBA 3AIBA 3RIKA 5CG0A 1U30A 1VFOA 1HXKA 1ZBWA 2F61A 1R85A 4FNRA 1E6PA 3EDJA 3AZSA 4P7OA 1WAWA 3WNKA 3KWXA 3N04A 1VENA 1BG9A 3VTRA 3VMNA 1ITXA 4P7RA 4U3CA 4LYQA 1IZJA 3BAKA 2DEPA 1CGYA 4V27A 2J7EA 1G9HA 4E8DA 2WNWA 4GIAA 3W6MA 1E5JA 4X9YA 4HOWA 4U5IA 1HX0A 1DTUA 2V3GA 1JXJA 4ML4A 4JFWA 2ZWZA 5GQBA 1JFHA 2CBUA 4LX4A 3CZJA 2G4FA 1K6AA 4HPGA 1PAMA 4UFJA 5GNYA 2J8FA 4WJXA 4F9JA 4XX6A 3GXIA 2XSAA 5IHRA 2X2IA 3BUQA 3F5LA 4OBSA 3EMZA 1KXTA 1MQRA 2X8RA 4Z2KA 1BGAA 2CCRA 2QLYA 3CLWA 3VX1A 4ATWA 1V3MA 3BCDA 4FF5A 4IPLA 5EB8A 2BY3A 3AS0A 3NCOA 5C70A 4CVUA 3AMKA 1LLOA 3APGA 2EPKX 3NSNA 3M07A 2BVDA 2E8ZA 1R87A 1JIBA 4MDOA 5JBDA 1V0LA 2F7OA 1HP5A 2OW6A 1VFFA 2XVLA 1BYAA 4DUXA 2WKGA 3A3HA 1CDGA 4ZE4A 4W86A 3VD7A 3VDBA 2J25A 1DWFM 4CD7A 4D1JA 5CLWA 2WC3A 4R5EA 5LA1A 2CERA 4WKAA 5CPQA 3SEPA 3VINA 3GXFA 1MWOA 1EQPA 2GJXA 2NT0A 2HISA 4FLSA 5A6MA 1UA3A 1A47A 2V3EA 2ZX5A 2GJXB 3PN8A 3SIMA 3ZJKA 1GCYA 1CGVA 1KGUA 1XH1A 3A23A 1PJ9A 3BVUA 3BH4A 4E2OA 1GW1A 3VDHA 4BCEA 1JZ2A 4GZJA 3DHPA 3CV5A 3PTKA 1QHZA 2XIIA 3IK2A 4OUEA 2J47A 1CWYA 4LGXA 3RJXA 4LPCA 1V3IA 1DEDA 1NQ6A 2BFGA 3WNNA 1PX3A 3DECA 1ZU8A 2WBKA 1W1PA 3BUBA 5A94A 1GUVA 3AOFA 2GVYA 2D73A 5E6ZA 2J78A 1HN1A 4P8WA 3MUIA 2F8QA 4GQQA 1GOOA 4YHEA 4MB5A 4RE3A 4PTMA 2WZIA 2OSYA 3I3EA 4AZ5A 2X0YA 5I77A 4JHZA 1CENA 2NT1A 1XSKA 3U57A 1V6VA 3BSGA 4U31A 2A3CA 3FXYA 5CGMA 1M04A 1QNRA 1X6NA 1CIUA 4XZWA 1TQVA 2V38A 1UH2A 5HXMA 4J3VA 1H1NA 2YLLA 3AISA 1WZLA 2DIJA 4WKFA 1FH7A 4TOQA 2Y8VA 4A3YA 1Q4NX 3KL5A 5A2CA 3VIIA 3VDCA 3RPMA 5A6BD 4Z2GA 1BVZA 3FHAA 1MVYA 3VMPA 3AMLA 4PMUA 3CMJA 2D3LA 1UR4A 2EBNA 3BLPX 4QFUA 1E40A 2YA1A 2DSWA 1V3LA 4W87A 3EDKA 4WKHA 1UKSA 1TZ7A 1HVXA 4B3LA 2YJQA 4BQ5A 2PF0A 3IJ8A 2V5CA 2XVKA 1TE1A 3SUSA 4IUGA 3TA9A 5AYBA 3WUEA 1CXHA 1OT2A 1W9UA 1ODZA 2XSBA 4L4PA 1GVYA 2CEQA 2D0GA 4UZSA 3ALGA 3ARVA 5LYRA 4GI8A 1WP6A 4XV0A 3AIEA 3BGAA 1JZ8A 1V0MA 5BXPA 1UR9A 4D6FA 3G6MA 3W82A 4JFUA 4JKKA 2WSPA 4UNIA 1H11A 2ZX8A 5BYWA 3UG5A 1M7XA 3CZLA 3L2MA 2VX4A 1LL4A 1OIMA 5A69A 3KZSA 2D20A 4JL2A 2YDQA 3CZGA 3MI6A 1DHKA 3W4RA 4FNTA 1SYTA 1GVIA 1H0IA 1K9FA 4F8XA 3FW6A 1EA9C 2E8YA 2MANA 1KR1A 5KZ6A 4NRRA 3B9DA 3VIMA 3A6OA 1F4AA 1LG2A 3BVTA 3SURA 2BHYA 2VMFA 1RD6A 4PMQA 1HL9A 3OG2A 4U5KA 5JBFA 2EABA 3BLKA 3A4WA 1E5NA 4JAWA 1OD0A 2D1ZA 2VCCA 1Q6EA 1UASA 2BY1A 2J77A 4TX6A 2Z1KA 4TUFA 2CYGA 4ZFMA 3K4DA 1WDRA 3TTOA 3M46A 3IANA 3CZNA 2F7PA 4YN5A 4CU7A 5HNNA 3MV11 2VR5A 1W2PA 2EACA 5HPCA 1W9DM 1E4LA 1WNOA 3WH9A 4H04A 3TTQA 3NSMA 3EDEA 3NSXA 1BGGA 5ABFA 3WH6A 4P8UA 2EQDA 2AAAA 2YBTA 3GZAA 3TTSA 4ZXOA 1QHPA 4AC1X 5D9MA 1NH6A 1C8QA 5D9NA 4J27A 1DP0A 1V3KA 1LWJA 1XSIA 3GTNA 4EK7A 1E6RA 1GQJA 1QI4A 1VRXA 2NSXA 2VRKA 1JNDA 3MS8A 1B31A 1JL8A 2GFTA 1JAEA 1JYNA 5BWFA 1C92A 1VJSA 5F7UA 3O6AA 3AIVA 4U33A 3WD4A 4OKDA 2GK1B 3T2OA 4JZ5A 1BFNA 3VSVA 5E70A 2WZEA 5M03A 2GK1A 1CLXA 3K8KA 3LPGA 3CHFA 4L4OA 3WQ6A 4ACZA 3DX3A 1QOXA 4WF7A 1TA3A 1JZ7A 2W5FA 2IXUA 3WY2A 1BYDA 2C0HA 4P8VA 6A3HA 2DSVA 3CZ8A 1HWWA 4TXEA 2D24A 5JIPA 4J3TA 2RGMA 4Z2HA 1JDCA 2Y4SA 1J9YA 1TQSA 8A3HA 1B30A 1XH2A 2YBUA 1TVNA 4PMDA 4MB3A 1M01A 1BPLB 3AIRA 3T0AA 1UD4A 4QCFA 2WC7A 1XCWA 3WL1A 4P7LA 1Q6GA 2WWDA 4TTUA 3BAJA 4S3KA 1J11A 3HMCA 5GNZA 1W1TA 1EXPA 5LA0A 4UOQA 5HPOA 5ABGA 3SUWA 1L8NA 3FHQA 4BQ2A 2WBGA 4W7WA 3VM7A 1HJQA 3VIHA 2XHYA 1H3GA 2YL5A 2JFEX 3AMDA 3BUIA 1E1FA 2XM2A 2J7GA 3AIWA 4MNMA 4D6GA 4UFLA 5JUVA 4M81A 2FHFA 4UOJA 1AQHA 3VD5A 3WDPP 3PZNA 1VEOA 3OGSA 3W0KA 5I5RA 1JD9A 1HF6A 2VC9A 3WL0A 3PZQA 2CETA 2CHNA 1NOFA 1E6NA 4P7QA 4NX0A 2XUCA 3JUGA 3HZ3A 3MSGA 4AZCB 3I3DA 3GBDA 3AHTA 1WPCA 3PZUA 1E73M 2WWCA 1JI1A 2TAAA 2YFNA 1QHOA 1UD3A 1OD8A 3N1AA 3A4XA 2WCSA 5AYIA 1UD2A 4N42A 4QLLA 1XRVA 3WQVA 1C91A 1W9VA 2X05A 2ZX7A 4BZYA 3FY1A 3ZM8A 4B3KA 2QF8A 3VGHA 4UQDA 1EGZA 1BG4A 4B9YA 4PCTA 4PTXA 2X2HA 4YPJA 4HMDA 4JKMA 2D22A 4JKLA 5C8BB 3EJUA 1AMYA 4J3XA 5FCZA 2VRJA 3GYCA 1LF1A 1CXIA 2BY2A 3K46A 4QLJA 3GNPA 8CGTA 2DT0A 1UG6A 4GO8A 1UWTA 2DT2A 1CGUA 3L4UA 1E43A 3VIGA 1BF2A 3KLLA 3N15A 4PMOA 1E3ZA 4RE4A 4AISA 1QNPA 1Q6CA 2BS9A 3WQWA 3WNPA 3AI0A 3WF3A 1AVAA 4FNSA 1UKQA 2D0FA 3D50A 3BUPA 1KBKA 1E70M 3VUPA 3SCUA 3WEOA 3WUBA 1OB0A 3CHDA 4H7VA 3SCTA 2WW5A 1C90A 3BAXA 3NYDA 4PN2A 3AQUA 1CZ1A 1GQKA 3K4AA 3UESA 3GH5A 6CGTA 4FNUA 3WF0A 1QPKA 2WMKA 1B3VA 2G3IA 2FDMA 2Z1SA 2WVVA 5BXRA 3WBEA 3M6DA 1TCMA 1D2KA 3LXCA 3RO8A 1G0CA 1LJYA 4MB4A 2ZX6A 4BQ4A 1VBUA 4W8AA 1HT6A 2BHUA 1G5AA 5CSUA 2QHAA 2Y8KA 1S46A 4W88A 3WD1A 1ISWA 2J75A 3WEZA 3N9KA 5DT5A 4FLOA 1SMDA 2XIBA 3WH5A 1UD8A 3OZPA 1GQLA 3AXXA 3H55A 2XN1A 1Z32X 1EHNA 3ZT7A 4OIFA 3L4XA 2XFFA 1DWGM 2F1BA 1E0VA 2QPSA 1ISYA 1PZ3A 4PEEA 3IJ9A 2X1IA 1HVQA 1GJWA 5GNXA 2WK2A 3EJRA 2V3FA 2DIEA 3QHMA 2ZICA 3UERA 1EIBA 4ATLA 3A4AA 1KGXA 3EBVA 2F7RA 3WD2A 2JEQA 1W9XA 1ZBKA 4D6EA 5E6YA 1I1WA 5HBFA 3CZEA 4F66A 1NWSA 3AYRA 1XYFA 2DH2A 3VGEA 4AMCA 2FYVA 4AIOA 3DDFA 3BCFA 3THDA 2J62A 3ARQA 2W4XA 3CUJA 3LPFA 1E4IA 1WDSA 4ACZB 2YDSA 1FH8A 1DWHM 1YHTA 1C7TA 3DHUA 2GJPA 1TA3B 1PS3A 5DFAA 1TG7A 4C7FA 2VO5A 3CUHA 4NZJA 4J3WA 4MJ2A 3DX2A 3SCVA 3VDAA 1L0PA 3RMEA 1J01A 3D5HA 1XC6A
chains in the Genus database with same CATH superfamily
2NY3B 2ZX9A 4FMVA 3QEGH 4YDLC 1N5AA 2X70B 3HG5A 4GKSB 1GORA 1CJYA 1KV5A 3KL3A 3UX9B 1DN0B 3ZE2F 4K38A 4D6IA 3GXTA 4JFOB 1X3DA 4GG8B 4C54A 4ZBCA 4AIUA 1BZ9A 2W9DL 2YUWA 4GMTL 4Q2ZA 3HN5A 3C60A 4X2UA 1FFPB 4X8CA 4CVWA 1WXZA 3MRIA 4Y5VB 1ACXA 3VSUA 4FS9A 1SDDB 4Y4HD 4G8GD 1CC3A 4IRSD 4PB0H 4PRIE 2H2SC 3EX4A 1BD2B 2ZWNA 4LLWB 4JFVA 4A1RA 3GHEH 3ARDA 1H3XA 2IQTA 2JCCF 1RP9A 2R29H 1OVZA 1Q0YL 3BVVA 2EUVA 1UP2A 2FVKA 2OT1A 4LLQB 2YZ5A 4AL8H 4U0QB 1NIFA 3AAZA 5KSBA 2UV8G 4Q14A 4LEBA 4MQXC 3WNMA 5ADPL 3H2CA 1GC1H 2BINA 2I07B 3L1FA 4PGCA 5F97E 3FUIA 3CFTA 4GXPA 5AY7A 1XD0A 2BK8A 3T4AC 1V0KA 2X4QA 1FTXA 3QUYC 1C93A 1E8ZA 3I6KA 4PWHA 2FEEL 1ZHNB 1KT2A 1QMLA 1ZGLP 3V8OA 4HEMA 4YXKH 1KTLB 2ADJA 3MKKA 1KWGA 1MCOH 3HEIB 5L8JB 3SUVA 4H8HA 3WLTA 5KYNA 5E9XA 2BWQA 4O58L 4AW7A 3VFWA 2FVMA 1TU2A 4PJBF 4B9JA 4MKTA 1M53A 2AMGA 1R3HB 1SOSA 3O3DA 3EFFA 4JRYB 2YD2A 4JHVA 3O2LA 3OGRA 5DO2C 2WZAA 1WIOA 1PDKB 1DVFC 4JPGA 2HT3C 3DENA 3LDVA 1YA5A 4WENB 4F9PC 3IJ7A 2RGLA 3SFKA 1NIDA 2O5XH 3F7QA 5GGTA 2B8OT 4D0CB 1KM4A 2O92A 4I7UA 1H15B 4AZHA 1RCQA 5DRZB 1S9YB 1T6MA 4X6CA 3OLEA 3TZVD 4DERA 4YYCA 5ACZB 1JHKL 5DN1A 2PCPA 5DCCA 3WEXB 1XH0A 5CBEA 3X17A 3ZVVA 1ZIBA 2BZ7A 4RX4D 5BWAA 1EBAA 1U3ZA 5MI0B 4XCNA 3VTAA 4QHUB 2OX5B 3SKUD 3GLAA 3D07A 3MX0B 3V0IA 5I15L 1AW1A 2Z34A 1U22A 3QZMA 4WD0A 5BOEA 5LA2A 5LJYH 2C5DC 2JTYA 2H1PH 2KX9A 1KYFA 4NSKA 1NGQL 2EYSB 3U79A 3UZVA 1W5MA 3APYA 3N40P 3SSJA 4WVRA 5ABFB 3GRWL 3WYZA 1NC2A 4WGHA 3SQSA 4LBEB 1FYHB 4M7KL 3SBWA 4KMTL 1H7WA 3OJGA 1J9QA 2Y07L 4L8DB 3VFUB 4N6EA 4RUBA 3K0YA 3QH3A 4M8UA 1KBGL 4H8WH 4U2YA 4XD5A 4ZS7H 2N7BA 4F79A 1DWJM 3X11A 5HUOA 1WAAF 2VDPH 4NOFA 3SGKA 5I1GL 4ZYKB 3W11C 1NDVA 5IQOA 4UMBA 4CU8A 4WTZG 3S9DB 2ESCA 1B6DA 4OCWH 4EANA 2OJEB 3BW9B 3MBXH 5K59E 1WWWX 3U82B 3TWBA 4MS8D 4NRZA 2Q10A 1ODUA 3C3UA 4NXKA 3LQAH 1MJUL 3NJFA 1X7QB 3LM3A 3ARGB 2CITA 4DWSA 4L29A 4IMCA 1Z5HA 1RZ7H 2OMZA 2VDKL 4M1DH 3GHSA 5IM51 2NPLX 3H2AA 2H3NB 3MV9B 4FG4A 3BDYH 4XC3H 9PCYA 4Z1PA 5BZDA 5JHDD 4BK8A 1ESWA 1IWBA 3UJJH 3HQOA 1JGVL 4S1QL 4K7PY 4RAHA 1HJVA 4YS4A 3X2QB 4HX1A 1FDLL 2BTMA 3CJPA 1CXKA 4ES9A 5MENE 2JALA 3M0JA 2YN3A 4NGHH 3P4MA 1ED3B 5MEND 2E6YA 3MRHA 4CNOA 3CN2A 3LIZA 5AZUA 5EFIB 4HUWB 1BF6A 3ARSA 4H25B 4NPYA 1EPXA 1O5PA 1U8OB 2NY6D 1ML0A 3KNBA 3O4LA 2WHKA 4X5LA 4LJ3A 4PE8A 4N86A 4U1KB 5LHEA 3KPRA 1A5CA 3NDZA 1OPOA 1TJMA 3W1UA 1TG8A 1M2VB 2D31A 5CBAA 1D7KA 3F5KA 1HSAB 2XFWA 4N8VG 3UZZA 4ZW3A 3LI0A 4QXTB 1WC7A 1XWYA 1MEIA 4JHOA 2UWEF 1E9LA 4LT7A 3SOBL 1MNZA 1J1XL 3ASNB 3FUEA 2CHOA 1B2WL 2YXVA 5FXCH 2QGHA 2QIWA 1FYTB 3S83A 1U36A 4JTAA 1S3KH 2DL9A 3C75A 1AE6L 1CFSA 1QFWL 5HI3D 2AFNA 4O2FB 4L1WA 3P54A 4OT7A 1ZZMA 1QSED 3WZ0E 3LZNA 4NUMA 4CGUB 3FUDA 4IWWA 2VXQH 4W9GC 2O26U 4BQ8A 1RAKA 1NEUA 4Y6GA 1K72A 4NKDB 1Z3GH 1Y0LB 3SYCA 5GGSB 4MWAE 3MCMA 1U42A 4AVKA 4EO5A 4Z3IA 4O2CA 1KGCE 5FOBA 4YC2B 4KPLA 4P2VA 4Q6XA 5IMLA 4N0UA 5KW9H 4HMEA 5EU6E 4ZMYA 1JK8B 2WZMA 2YD4A 2XBZA 3HI6H 3V5HB 1XGDA 3N34A 1YY9D 4DKEL 4NYLB 1QW9A 1XDMA 5HPMA 3Q2LA 2CO1A 4AUUA 4C59B 1H61A 3KLHD 4X60A 3ZL4L 3S34H 4B4HA 2HCZX 4OKVA 3I68A 3R12A 4P7NA 3DX6B 4LLMA 1VDGA 5MEPA 4NQSB 2E68A 5DQDL 3E2RA 1OQOA 3FMGL 4KZEH 4H6EA 4BY3A 3AU6A 3BISA 4EN3C 2V2WB 2XTJE 4QRTA 5J1AA 3O0RL 4LL9A 4N25A 4WWKA 3H8NA 3VFMA 1YNQA 4PGDB 2PGFA 3N6QA 4B5NA 4WUKL 1DIDA 2BSTA 3CMOL 3O1NA 1T7ZA 4NWTH 5CH9A 3PWPE 4ZOBA 4JTLA 4PY7B 5DD5H 3UTPD 5DVOA 5DHVB 3VFSA 3AGWA 5HWMA 4KQ0A 3AS2A 2V0AA 5AW8B 1VKXA 3S2MA 3V79C 2KDGA 4PRHD 4XAKE 5AYUL 1LO2L 1NGZB 3PWUB 2YPLB 1OCCB 4KNSA 1GC1L 1JP5A 2FO4B 3QSTA 3MJ6A 5BRZD 4LEXH 1I1XA 1UUQA 2NV2A 1B3ZA 5C5YA 4UBDC 3V4VB 1C9SA 5EO9B 2OFJA 5KWYC 3FK4A 1JFQL 5F9DC 3SJVD 2C15A 3MCKA 4GIOA 3HHSB 3DHFA 4XIAA 4YL2A 1RK1A 1AIFB 3QS3A 2ZXQA 3LN5A 4R97C 4WEVX 3W7RA 5D1QE 1OK8A 4LOCA 4W9JC 1UENA 3D6GA 1WCGA 3AW5A 4UR8A 4NQXB 4HJGB 3CVHL 2NTFA 3WN5C 1CBGA 4UQ9A 1GYLA 3BHBA 3ECVA 5D7SL 1AJ2A 2A73A 3NH7L 5DEFA 3UJJL 3QPYA 4TNVF 2UVEA 1A6PA 3Q5YA 4X0KA 3QEGL 3G5ZA 3UG4A 4U4IA 4LASL 4F9PA 1C8XA 3QNXA 3TJPA 3ZJ8A 2BCMA 5PTDA 4PJHA 4OZIE 5G4OA 4DEPB 3NL3A 3FUNA 1XIGA 4EAMA 2WOQA 1GMEA 2PGRA 5I1DA 3V6FA 4NFBA 5B7FA 3U2JA 2VCAA 3MV9D 3HTWA 5F7FA 3EJSA 1M6JA 2P24A 3E12A 3U7YL 1AD9A 1L4IA 1JGDB 3ZJ7A 4FP8H 3GSOA 1G01A 3T6QC 1URLA 1OGAD 4JHBA 5E2UH 1OCQA 1KFGA 3NIFF 2D7MA 2HYMA 2GK0A 4IBQA 1CICC 1QD0A 1CU4H 1XGZA 4XVJH 4XP5L 2WYHA 2HQAA 1XT5A 3LHAA 5TE6L 1OPGL 4ES8A 1NOLA 4AYEC 3QY6A 5D70L 3NIDE 3K91A 1HXYB 4NUJA 4Y7OC 3RY6C 1KM3A 1PKQE 1I8JA 2DQDL 3BLFA 3W1NA 4X9IA 1KCSH 1S7SB 1Q0XL 2HLEB 3EBIA 3M86A 1NCCH 4FJYA 2R8WA 4HK6A 3E5PA 4CNUA 4FP1A 1RZIA 2P8LA 1U1UA 2G60H 4NQCD 3H1ZA 1BX2A 3UROR 3PQYA 4IGBD 5DK0A 2BSRA 4AZ8A 5AHLA 5IJBC 1TWSA 3SDCD 4DWDA 2EDMA 3CSFA 3EJPA 4DETA 3ITXA 3WH8A 3IAPA 1II4E 1WKYA 3MA8A 3S35L 4XP9L 3WTVA 4D6JA 2HPMA 2G0KA 1HU8A 4MLSA 3BCJA 3GC2A 2W1NA 4GVIA 1BQLL 2W0UA 1BFVH 2XN9A 4ONHB 4BXSV 3NZRA 1SQ2N 2X0HA 5TE4H 2TYSA 3AT8A 1U8MA 5ESAA 3CDZA 3UCDA 3NZGA 1JVNA 1R7OA 1D9KC 2CKBB 5JW3H 5IFAH 1KR0A 4R8WL 1F45A 3L3GB 4AEHL 3HZYB 3LKOA 3NPZB 3S9ZA 3VGGA 4FQ1L 3GNOA 1JPSL 5IW1B 4XTDA 3HBPA 3RWFA 3T40A 3UAJC 5MP6H 1EO5A 1NCDL 5EZJA 4L9ZA 5HHPA 3D8MA 4I77H 4JN1H 1A4MA 3ITCA 2BSED 1J10A 2DICA 3V4VL 1IAOB 4MA3B 3S6CA 4FA8A 2WQPA 1JV5B 4W7UA 3T0EC 4A66A 4GKOA 1ZHAA 1WDAA 1UCWA 4YPGB 2BP8B 2EC9U 4DELA 4BFGA 3IS0X 1UH3A 1WAPA 1H51A 3FH8A 3IJ6A 1UHVA 2J88H 5A7EA 4PJDA 1F4XH 3BWAB 3CVHB 4L9DA 2ISDA 1O5XA 1WXYA 2UY3A 5I1CL 2V5BA 2A6JB 2B1AH 4A8RA 3H54A 5LXXA 1CF8L 1AE6H 1QFWH 2Q20A 4PJEF 3GKWL 3HS0B 2FB3A 3CVIH 2VIRA 3P2BA 1JYWA 4HZ7A 3V7PA 1UWAA 3LV5A 1BD2A 1Q45A 3QXBA 2CO7A 3KHJA 2B39A 3VKAA 2KC0A 5A2AA 2DV0A 3EADA 3NRFA 1NGXA 3CN1A 3DXAA 4GBXA 3O2VL 4JX4A 5I6SA 3SSZA 4GRWB 3WG7B 4HJ0C 2W61A 1XIIA 4BK5C 5IESH 2C1OB 4C1NB 3G3MA 3VXRB 2I85A 2FJKA 4CQ8A 1V3HA 2X4QB 3V7MA 4ZUWB 1A4AA 4AUJA 1W56A 2VXNA 2CDEB 4HXBH 2QAFA 4YS1A 4TN9A 2PXYD 2R27A 4MHHI 1D7FA 1KT2B 1DWAM 4LVNB 3B3IB 4JN8A 1W3TA 3RU6A 4D2JA 5F9AC 4K2UH 3RWDA 4N9DA 4AGMA 1N7MH 2VLJE 4I9MA 3PL6A 4GAYA 3O6LL 4M5TA 1NWRA 2EKGA 3DWTA 4I5UA 4J3ZA 4YSCA 1Q5MA 5JXQA 3S8GB 4X4ZA 1G4SA 4XVUC 1EF2A 1QRKA 4DI9A 4RFEA 4Y7MA 1RPUA 3L3JA 3TE9A 4YLQT 2C26A 2OGYA 4P5MB 3ULUL 4A4AA 2NX5D 3M1CA 4X3ZA 1TPH1 2X6VA 3T6CA 2XIOA 4Z1YA 2F8OA 4X6BA 8PAZA 1SEQH 4UUJA 1S9YA 1E5AA 3ESMA 3OR6A 4P2QA 4LUTB 3CFQA 1C1EH 4X8XA 1GQIA 1DV7A 25C8H 3LD5A 2ZQKA 3KYKH 4LEOA 2ZXDA 3WFHB 3QK0A 2ICWJ 4OLWH 4QHUA 2CKBL 2Q8AH 1RUAL 1T83A 2Y8UA 5D7LE 3UBXA 2J73A 3MANA 2MNWA 3NR0A 2ZQ0A 2H9GB 3NSDA 1E0OB 1IIKA 2EJAA 2F0CA 2VW7A 1M1XA 1Y1DA 2V4LA 4WGWB 3M5XA 1SPQA 4O02L 4RIRB 3MLZH 3TGXA 2WLLB 2R69H 1A22B 4TS6A 1G0XA 1NC4B 3AHVA 3FEQA 1UD5A 2Z91A 3WUWG 3VXGA 4YHGA 3N42F 3GIYA 4IRZA 5FFOA 3VIKA 1GOXA 3WFEH 4YHLH 3VFVA 1DFBH 3V1PA 2MSPA 4HWBH 3PBMA 1G84A 4F2FA 2OTPA 4DQWA 2R2BB 4A7GF 1GOKA 3F4VA 4NNPL 1CX9A 2YRLA 3W3OA 2VXSH 2DIAA 4NRZB 4NRYA 4Y5YA 5LVEA 4FLQA 2EGZA 3HGJA 4JTSA 2BIMA 3ECBA 3XINA 1OT1A 3CJJA 5KZCB 1WTGT 2XQ0A 1IGJB 4OB5L 5I6XC 2P26A 4RW5A 2FH8A 5D7JB 2ALWA 1A3LL 4AH7A 3WLOA 3AS1A 3S3PA 4FNPA 1E6OL 1GSMA 4LF3A 2O9RA 1A66A 4HX1B 4RMBA 2E74C 3FYYA 2K4WA 4IMLB 3MW7A 4OHQA 2ID5A 2R51A 4K23H 1ECQA 5IJDC 5IHZA 4KVPA 4RBPH 4DJMA 1B0GB 3WKQA 1FXQA 1US3A 2V63A 1XGPB 4ASTA 32C2B 3CFEA 3NJMA 4EN3B 3WD3A 2YAEA 4GUPA 5BMFH 2X9XA 4DYJA 2UBPC 4Q3MA 3II1A 2EEAA 2NQ3A 4XP4H 1SW3A 2UXTA 3OKKA 1H2JA 3WFEL 1ML1A 1RIHH 2WMHA 5I82A 2DT3A 3T04D 5KTEH 3HAEA 3KX6A 4O16A 5EU9A 1T8QA 3L2IA 5DMKA 3LLFA 5AVZB 2OMBA 2P8BA 1SFTA 3KLSA 2QYGA 3ES8A 3NZPA 2QQLH 2UX6A 1KC5H 3EF7A 1I8IA 3MYPA 4PGLA 1A6VH 2H32A 3NXLA 1TQUA 1YNKH 3DV4B 1XGQA 2R1WA 2VAAA 1J12A 4AYFA 1CK0H 5F96H 3CFJB 4MPQA 4QAIA 4WVXA 1BZ9B 3ZJAA 2CLZB 1HJSA 2GUOA 3MRMA 4J2MA 2OMTA 5DRXA 2NUTA 3TEUA 1Y1UA 3Q3GA 4MX7B 3ETBJ 3VGDA 5FO8A 3WJZA 5I3DA 1EEYB 1J0ZA 2IKJA 1KJ3H 4DP2X 3BGMB 4DBUA 5FA3A 5KYUA 1U8LA 3GHPA 1AD1A 2Y2TA 4CQAA 4XNAA 3LNMA 2A1WL 1W0WA 1UD6A 2P5PA 4XZBA 4S11A 1SJEB 4OV5A 2LFEA 3QUYA 3ARDD 4G7SB 5IVXB 5T5FA 4IG2B 2WY3B 3QZWB 1WUNT 2I1OA 4CCDA 2NY3C 4O02B 1EANA 4YDLB 2EZ0C 4KO6A 1DANU 2CJTA 4NP9A 2UY6B 3AT0A 2HSIA 3QZOA 1B3XA 3MJMA 2EO7A 4WFED 1B4JL 1SMOA 1TDQA 3TYCA 3S3SA 2BLEA 2J8UE 5E1QA 3II2A 4ABVA 3D18B 2VGGA 4L4VD 4WWKB 4PTTA 2BGQA 2Q02A 3BV4A 4YK4B 1TZOA 2VNCA 4XN1A 3B8TA 2BSTB 3KVDD 4V2BA 2HK1A 4HUMB 5C09D 3E2SA 2Y06H 5G4NA 1V6TA 4HGKC 3SPHA 2VZUA 4ZO9A 5DHVA 4Z18A 3JUZA 3NACL 3VFSB 1UQYA 3BP6A 1Z44A 3UVAA 1I9JH 4Y2LA 1FLTX 4K3HA 2UZXB 1FCUA 4YE0A 1VADA 4XGZB 2Y62A 3NAAH 3NCCB 4ICWA 2UYLB 4YHNA 1AL8A 5I23A 3QIWD 1RY0A 4Y5XA 3FTZA 1OFDA 2PTZA 2YPLA 3R1GL 5C0BD 3VXTB 2W9MA 4JTDA 3WNOA 5T1KB 4U1MA 4AJWA 3VYNA 4CN4A 1MW0A 1RJCA 2WQRA 1JPKA 3CH1A 4TOYL 1TZIA 1H5BC 2C14A 3HC0B 3GZPA 4LK4A 1VBGA 2G41A 1D5MA 4MKMA 4CSZA 4GVFA 5JW4Q 1JZIA 5CZSA 2NQLA 4LVAA 3LN5B 3UXLA 2LU7A 5KZ6A 3WNLA 3BKCL 2WZ5A 4N0YH 4TVPH 1XGRA 3TQVA 1GEQA 4G6KL 2N59A 2BP0A 3NSYA 4HJGA 3FQWA 1JCYA 1XQ4A 4XAYA 2Y6SD 1EGVA 2W91A 1TQCB 3H9SA 4M7LH 1UM4L 3PZTA 2P48B 3G5ZB 5EBGA 3L7EB 5IBTH 3X3FL 3QNXB 1RA5A 1C08B 3S1UA 1LT7A 3R6IA 5DMGD 4L0YA 3U8GA 2YA2A 5C0CD 4F7TB 1TEFA 4M6NH 1UR2A 5BXSA 3N0AA 4IBYA 4FNQA 4HBKA 5AC5A 1IFHL 4XMTA 4Y8AA 1KB5A 2OT0A 1XBYA 4O8RA 1HO4A 1EOKA 1YUKB 2JKEA 5M17A 1WDWA 4JFTA 1AY1L 5CJOL 4WOZA 5ECVA 3ARGA 1PZ5A 2JLPA 3RDTD 3IXAB 3MRLB 4G42A 4FKHA 3WBDA 1XINA 4QG6A 4N8UA 4OF3A 3IU3A 1UXWA 2VLRB 2Y36H 2IFFL 3VCCA 1Q8MA 2EDDA 3EH3B 2DWSA 2DQFB 3P4MB 4RMVA 4QBXA 4RISH 3EGJA 3TPKA 2AKRB 3KR3H 1MWAA 4X5RA 5H2BB 2YGPA 1JCMP 3AIQA 3TA3D 4JO2L 4JJ5A 2VXTH 3MMDA 1OV8A 2PCFA 4Z76A 2QUUA 1HHJA 5F88A 3D3VA 4XWOC 5G2IA 2WNNA 2HTKC 2VXQA 1AZ2A 3LCIA 5CPSA 3SPIA 7ENLA 2FSEA 4LS0A 3VXQB 5A2LH 3ZE2E 4TVPD 4ZSOE 5JDSB 3B9NA 2DQEL 4OD1L 4QXTA 4XP5H 2ZSWB 3NYKA 3FTUA 3C2YA 4PZVA 1A1OA 2OW7A 3P5YA 1HIZA 2CKBA 2ARJA 1NIBA 1TPUA 1A4CA 1CFSB 3HG4A 5LDUA 3MJWA 2WHMA 1LL6A 1EHXA 3QCUL 4MFEA 3WHXA 4JZJA 4ERSL 4KRUA 4ZB2A 1OM9A 2F74B 3KPLB 2Q7NA 3B3BA 4LAQL 5GXBB 2JI1A 3AWOA 4GJJA 5DT1L 5BVJA 5IFHH 3BO8B 2R0ZL 2AQWA 4KFNA 4QDMA 3RG6A 3N5AA 3O6FC 4XRCA 5F0PB 4JFZH 1MNSA 5T3XH 1LP9A 1C8YA 2BP8A 4IX2A 4XVOA 2DVUA 2J4GA 3SDAB 4UT6H 4D1IA 3AB0B 4OLVL 3U4KA 4R84A 5DO2D 3AU1B 3ISWA 4YHZL 4YSUA 4DBDA 5LQBL 1XYMA 3VFOB 1S7VA 2NYZA 4UM9B 1M6UA 4CCZA 2A6JA 4PB9L 2WQUA 3PNWB 4UR9A 2ITDA 2CMRH 3LBCA 3WDQA 4ZFCA 3H3PH 2DJMA 2YA0A 3N0PB 2ZF9A 3KS0H 2IANA 3TV8A 1ZVSB 1FWEC 2WMIA 4QS6A 4JRXB 1MCLA 3VFMB 4QRTB 5J1AB 1INDH 2XI9A 1UYWL 2AL2A 1W72A 1IT0A 2YZRA 2CRIA 2OJ1A 3B9OA 4LRSA 3GPSA 5KANI 1BYBA 2CZNA 4B5EA 3EOTL 5D8JH 1OM0A 1TJGH 4JTTA 8TIMA 1FHLA 1YECL 3D69B 4XOBA 3B8UA 8FABB 5F3BB 1GZ1A 4XHQA 3RY4A 2BS8A 4Q4IA 2EO9A 3SY0B 3OYXA 2MPAH 1EO7A 2BLFA 3QJFA 4YWGL 5DVPA 5G4MA 4HK5A 5HR7A 2V6AA 2DIKA 1VB9A 1FZJB 4ZXBD 3IIOA 1JHTA 2ZOKA 1THCA 5FEPA 4HNVA 1YDYA 3EKCA 2CM5A 2Y24A 1ZK9A 4POYA 1CGSH 2G5RA 2H1XA 3DBXB 4M29A 4I9TA 5DQDH 5G1TA 4HLJA 5C2UB 2DJ4A 5FJPA 4O53A 1S7RA 1U95B 4CCEA 2QTVA 3LKRA 5CSZA 4E9YA 3ZL4H 2FPYA 4AQ8C 3MRRB 4OW6A 3FF7A 3GXPA 3N40F 2NTFB 1ZD6A 4M82A 4EZMA 3GSMA 1MQKH 1CE1L 2GIXA 4MA1B 4RGNB 1PO9A 2QVNA 1Q6DA 3SB0A 4REQB 2C34A 3VIPA 2I25N 4HSOA 1TVBA 3UPCA 2IBBA 3ECUA 1VGKB 1CTNA 2VFFA 1UQZA 2B7DT 3WFHA 3MROB 4OLYH 5C92A 2GHZA 4YE4L 3VFLA 2G5BA 1I31A 2ERJB 4MAUH 2YEQA 5C09B 2OSWA 3X12A 4DPAX 2JQAA 5BOZG 2WD0A 5K9DA 2FATL 5D1XC 2HK0A 2HT3D 3SM0A 1SUHA 2RQ8A 4RGND 3NZUA 1H5BA 4YSEA 4HU3A 2WINA 3BV7A 3PJLA 4E38A 3V10A 5B7ZA 2X4PB 3ISYA 3TZVC 5FHAL 4D71A 3K8MA 2J2ZA 3VAVA 5J1TC 1VKFA 2AGJL 3BH9A 2WLLA 1KJMB 1TMQA 4OFQA 3ATYA 2WLKA 4XB3A 1FL6B 3BG5A 3IDIA 2XWTB 3Q0HA 3ULUC 3RN6A 3P81A 5DD1H 4HJIA 3EOBA 1QATA 3TCTA 4JDBA 2FATH 2HFFB 3TTYA 1S7UB 5E56A 4PMXA 3T7VA 1LCOA 5D2NB 1CN4A 1AZRA 1BW8A 3ZKXB 3QMRA 4M80A 1EGJH 5LIXX 1TWDA 4M02A 4UV4H 1SFLA 4YGVA 1JTTA 3PXJA 3U30B 3QJOA 1HHKB 4X9FA 5CR8A 3GMLA 2FLRT 4P5TB 4XX5A 5AB1A 5K69A 2IMRA 4KFPA 3ZVIA 3OA3A 2BSRB 2JE8A 5D7JA 1AR1B 1SQMA 2BVYA 4URKA 4KFOA 1LMKA 2AC0A 4ZS6C 1ZANL 4UIMA 3ZKND 3DX8A 2FZ3B 1U3YA 1QPXA 1YPZA 2BNUB 5TDNB 1IJNA 2XN9B 2RACA 1HKMA 4AXWB 4X5XA 4JO4H 5IHZB 2FJUB 4B92A 1DOSA 4O2EA 1R8LA 3KBHE 2GEEA 5BUPA 1SFJA 3RGTA 3MBXL 3PSVA 5IQ7L 1W3KA 3SIKA 3WTYA 1XYLA 5KSAD 5KBMA 5FM8A 2VN3A 1ZGLM 3F4CA 3S8FB 4IMKA 3SUWA 2NWSA 3ZE0E 2G2PA 1UR0A 4GKSA 1CL7H 1U3NA 4JRYD 4D8ZA 1FCGA 5DMKB 2YPKA 4R2GC 1IFRA 1IARB 3VKKA 3GS4A 4BFRA 3RFAA 4K4KA 1EXUB 1YVLA 1I8IB 3GSNL 1V8EA 3C60B 4HWBL 4WEEA 3BO9A 3GRWH 4AY1A 3MRIB 3NZHL 4Y5VA 3DFTA 2GBTA 4PMZA 3V0HA 3TH3T 1G4RA 5A2FA 2DBLL 3PP7A 2ZZUT 3X1BA 2GUOB 3QXTA 4NWUH 3WIAA 5E24E 2OMTB 4Z3GA 4FKEA 3HQPA 3N17A 4UTLA 5CJQH 1JCVA 4J4PA 3ZYOA 1FX6A 3H3KA 3MUZ1 2VIRB 3MOQA 4HV8B 3QC3A 4J3BA 3QRFM 3MTWA 3DMMC 1KPVA 3OB0H 1PLBA 3EMCA 1RJLA 3DVNB 3WD0A 2H2PC 3NSJA 1JHKH 5JOPD 3MPCA 4S1FA 4O50A 1XF5B 2ZRWA 1W0WB 4AE1A 3DC8A 3MODH 5D1QA 3EPMA 2ZPKL 3OU8A 2L7QA 3CHSA 4HOXA 4PMRA 4PULA 1OAKH 4LIQL 4Q6IC 4IPNB 2GC7C 5IVXA 1LORA 4XQ6A 5G4HC 4S2SA 5J56B 3OVGA 1IEWA 3ZZQA 2DMBA 4S3JA 3FT0A 1XDTT 1HKJA 4GZ7A 3DFNA 3S5SA 3L1EA 5GRYA 1KTLA 1UFUA 5C86A 2G4JA 4P2OC 3A21A 1FF5A 4AQAB 1G7HB 1EXGA 4PJFF 5DD6A 1D3GA 1I2RA 1Q9WA 2OK0H 2XQYG 4PJ5B 1BBDH 4TV3A 4O58H 2ZA2A 4UTWC 1PUDA 4M6VA 3MWCA 1DLFL 3F58L 4XNXH 2J27A 2VURA 4F48A 3QNYB 2J7HA 2WSKA 1X4ZA 3BP6B 1W0MA 4J4KA 2F8XC 3MRCA 2X6UA 4RDQF 4MQTB 3GK0A 3W1ZA 3L1OL 4MYWB 1KEGL 1E0XA 2YLAA 4YHNB 4W5UA 4FTVB 4U6HB 3ZXWA 3EWYA 1MZRA 1I8MA 4GEIA 3XISA 4XO6A 4HMCA 5J13C 5K9JL 1FAKT 3MNVA 2AQSA 2E7HA 1RH9A 2DVXA 3IEBA 2VXTL 1CI5A 3ELFA 4LUTA 4D9RE 4DN3H 4PGZA 3O0KA 5CZKA 5DUML 5FC9A 1KTDA 1K4HA 3UO1L 3QSKB 1D2PA 2OXHB 4R7DB 5GSRA 1QOPA 5E4AA 4MJJA 5C07B 5HJXA 1ECYA 3H9YA 1TQCC 5K93A 3SJ3A 4OLXL 4KGJA 3NIGE 3QDJB 4OM1H 2ZZ7A 3RX7A 5I5IA 5F89B 3N12A 1F7BA 4YVUA 1F6LL 4YUEL 4FOMA 3UEQA 4OWGA 3FQUB 3FS2A 3U7VA 1DQDH 5DEJA 2B2XH 4Q9RH 4H83A 2Z4GA 4BI7A 5D33A 4QSHA 3UXKA 2CGZA 3FCSB 1XLIA 5EFFA 1J9TA 1NJ9A 3X11B 3QIUC 3FU3A 3OSKA 1AO7D 4ZVJA 3J8F7 4X9BA 1NFDB 4S0SD 4MVBC 5HVGB 4XPHL 1W72L 2FGZA 4A3UA 3MA9L 2HMCA 3T1GA 2NXYC 1R9XA 4EIUA 3BH8B 12E8L 3N44B 4B3EA 1RJRA 2BWDA 2OMZB 5KVEE 4RV3A 2Q01A 4I1RA 5T9BG 5E08H 1GT8A 1CO1A 3N50A 1WVZA 3QPXH 3ZE0F 1V6WA 3BKMH 3IXAA 3MRLA 1ADOA 4L5ZA 3ARZA 1KBJA 2FZBA 3EMQA 1DQQA 1LK2B 2DLFH 3MLRL 4U0RB 1FO0B 1UP0A 4MXVF 3W7QA 4EPKA 1TETL 1I7RA 3CX5K 2WO3B 1F00I 1RUKH 3FONA 2QELA 1LE5B 2IS7A 4U0RC 3MCLH 1LO5B 4JG1H 4PV1C 3BAEH 4Y9BA 5D6DC 1AW5A 4OUUB 1NMBH 3TX9A 5DRNA 3OWRA 2YEVB 4BM7A 1AOHA 3NGJA 4JJ5B 2G97A 1J8VA 4PTVA 1FNSL 3OAYH 3QEQD 1N0XL 3DUSB 1AOZA 4K8RD 1IAIM 4OZGE 4F5CE 1GYVA 1WE5A 4YXHH 4UU9A 3WSQH 5JXEC 4GRWE 2IWGA 2Q86B 5IGXH 1TV5A 1K6QH 4WOQA 1ADSA 3W01A 2G3ZA 4BK5A 1EFXA 1MVUA 1A1OB 3GPEA 3UDWA 5LXGL 5C6MA 2DYPB 1S5IH 4CLMA 1YEKH 4G7EA 4XAWL 2CESA 4AYFB 3EOOA 3MLRH 4LHUA 3L4WA 1KB5L 3L0NA 4MMZA 3M0VA 5LNWA 2PXYC 2YDAA 5T5NG 1O6IA 3PZOA 2I5YH 3UDWC 1QFPA 1OG0A 4Q4EA 4U10A 3DHJA 3UIYA 1HXJA 2JK5A 2C7FA 2FWLB 4BH7A 1YIXA 2DVTA 3ZIZA 1OX4B 3RA7L 4LNVA 3FB7B 1JVOA 4DP0X 1L6WA 4LCRA 1Q7MA 2XN9D 1KXQE 1R5WA 1T4WA 1J0HA 4HBQA 1TZHA 1YZZA 3ES6B 2AOSA 3K2KA 3LHUA 3MP3A 3ELQA 6TAAA 4HNCA 2ZZ2A 4UM9A 3VFOA 4IG2A 5EWIH 4HUXA 3RMJA 1QR4A 1RXOB 2KLRA 4MSWA 4XB8A 1MREL 1P4UA 3LZOA 5GJTL 1UXSA 2K7PA 3PNWA 1SZRA 3DERA 3QZ6A 1R2RA 5CSRA 1ZVSA 3BD4A 3GC3A 4IU3B 4YUEH 2WMIB 2E4TA 2DMGA 3FNKA 2PCQA 2VM9A 1E71M 3OB0K 2D2OA 5JIIA 1BVKA 4XN2A 3KXFE 4XHJD 4X9SA 4R2GB 4GP5B 2PN5A 3FDKA 4HSCX 2F2HA 3ZU8A 2W0FB 2RJHA 3QRLA 5FCUL 1N8IA 5AZ0A 2BVUA 4P4KA 5EDSA 3QWNA 1RU9L 4F80A 2QZ5A 4R90H 2XZCL 5D04C 2X44D 4IKKA 1AMKA 1FP8A 4GIYA 2XH4A 4AD1A 2RKXA 5E8EB 2PWVA 5AW2B 1CYWA 3WQ8A 5FDWB 3SDYH 4PLJD 5T1KA 1ALDA 3QDMB 3SGGA 2ETWA 3P9MB 4ZZ9A 4L9LB 1K7FA 4OBTA 4UINH 1GNXA 3ARWA 2PBGA 1JWSA 1TSIA 1KFAH 3HMWL 1D5MB 3FO2B 4PV9A 2BP5M 3PULA 5H8DA 4K23L 3CBKB 1Q90A 2YAQA 2FLIA 4N02A 5DXYA 2CK2A 3PDGA 4W5ZA 1LO4H 2VZTA 4ZPVB 5BV7H 1RHHA 3LRMA 4P2RE 3GYEA 3PJUA 2EDFA 5K4XA 4F7PA 5KTLA 5BOOA 3ZBMA 4D6HA 4XP1H 1OAQH 4X0KB 4Y8FA 2FZMA 1OAXH 1F8IA 4RETB 3THCA 1IJ9A 1LK3H 1NKGA 3H56A 3SB3A 5HGHB 5D37A 1J4EA 4A6YL 4JFFA 4ZFFA 5M94B 5A40E 4H8PA 3V6FB 1DJIA 2AJ3B 3F6JA 5AAMA 1C08A 4R7JA 1OSPL 3W00A 1AANA 1AQ0A 1AGDB 1JNJA 3ARUA 3OKOB 3GMMA 2DQ6A 3IJEA 2I9UA 1SM3L 3EXJA 4IJTA 3QXDB 5IREA 1PEZA 2QVMA 4H0IA 3CEUA 3UGEA 1A8JH 1F2QA 4A38A 1KB5B 2QNEA 5IHSA 2V5RA 1UATA 4Z7VA 2XH0A 5D72L 5FK9B 1X9UA 1G0DA 3TQPA 1U3HD 1GXEA 3DFSA 4ZENA 1Z3GL 1RBAA 3FJ6A 1UVQA 4WTXA 3G3LA 4I87A 3DCPA 3LN3A 4D9PA 5DJXB 2VFEA 2VQ1A 3EXLA 2W66A 1MFBH 4DQAA 2UXGA 2X38A 1FRBA 1AYOA 4H8VA 3T0CA 4QISA 4AD5A 3DRQA 1PZ0A 4S1RH 3O9WD 4YHYB 2XA8H 3SO3C 2YL9A 5A6AA 1FCQA 3MV8E 2YL6A 2CKBH 2P8LB 1OQFA 4W89A 4Y9NA 4JM4L 1BX2B 1I75A 2ED7A 5KSAA 2IOIA 4LARH 1RHFA 2DIBA 5BZWA 3AYVA 3NIFE 4UT7L 4UILL 4ZTEA 1T03L 1XCTB 4GWEA 3RNDA 3Q2VA 4RDBA 3X1FA 2C3HA 4UFHA 4U6YA 2J1WA 4GKLA 4KNTA 1HL8A 3HG2A 2Z6FA 4QXGH 2ZOTA 4YL9A 1O9VA 5EUKB 4JFEB 1CF1A 4NO2A 4H44C 2ZZ5A 1FZOA 4GO6B 4PBVC 15C8H 1MFCL 1CFMA 4J3SA 3AABA 1L3NA 4IK7A 4MCZA 3K80A 3W2MA 1W17A 2WSRA 1L0XA 2NW2A 5F8RC 3L1GA 4O57A 2X7VA 2O4MA 5IW1A 1KN2L 4O2EB 5E03A 4WHYH 4BKLB 1PDYA 3DDGA 1BWLA 3IRSA 5EZJB 3OZLA 3HG3A 2JGYA 3TBCA 3CXDH 2CZ5A 1A4JA 1JGLH 1IC7L 9XIAA 2VR3A 4WFFD 1C9DA 5CIPH 3UC2A 4AZUA 4TVDA 2WXIA 3BVWA 2A0NA 5CKGA 4KDWA 4RSVA 4UV4L 3U4EB 3DHMA 2UY7A 2VP8A 4I7WA 4DBEA 2Y7QB 3FT2B 5B22A 1BBJB 4JQAA 5DEGB 2J8GA 3VXPA 1WO2A 4D2NA 6XIAA 3OR7A 5SWSE 3U4FA 3TX4A 5CNHA 4MUZA 1QSFB 3PUDA 7A3HA 5FO9B 1QABA 5J13B 1P6WA 4ELMF 3KYOA 4S2CA 5D4YA 4ECLA 1HESA 4HPHA 1K8CA 4WFGD 1O6VA 7PCYA 5IMKB 2PU1A 2EVIA 3RE0A 3ATAA 2ITDB 4A6YB 2GEQA 3QJHB 1AD0B 3UYRL 2VLKD 5D1ZI 4WI0B 1I3GH 2F5AL 2VX5A 1E4KC 1XEDA 4GT0A 5DJCB 1KPVB 1UC4A 2I57A 3NPUA 1XCXA 4YVVA 1ZANH 1H3PH 4PRAB 2J9YA 3K81A 2G3MA 1BM3L 2VX6A 3HO8A 4DY1A 3U2IA 2C1OA 3EOUA 4TUJA 1JNNL 3Q4DA 2Z7GA 1BLNA 3MRKA 5E00B 1ZUAX 3QJUB 4RNIA 3AWNA 4C7DA 2XSKA 1JRHL 2UZPA 3BAIA 3QUZA 1SVBA 1IXQA 4A3HA 1N6QH 1YNPA 2Y7MA 3B3IA 4KVNL 1W2VA 6TIMA 1Y5XA 3IIXA 1BSIA 2COQA 5CUSL 1YNLH 5E1AB 3BIKB 3ESUF 4J35A 4NO3A 4L8CA 4PJ5A 4HNLA 3R79A 3SO7A 2WV8A 4BBWA 1BG1A 1UEMA 2FE0A 2OMWA 5TDPB 3SGEI 3LHYA 3AZUA 4BEQA 4JE0A 3D4YA 1TTBA 3CX2A 2QXWA 4AK2A 4P5MA 5JW3L 5CAHA 3QNYA 4BGLA 1N2VA 1K9DA 2QKIB 4FEIA 3GUTA 2NQ5A 4Y2DC 3RVUD 3RCNA 1VPYA 2WOYA 4OLUH 1DQWA 2P76A 4XPFH 4V1DD 3BPOB 4FKKA 4L56A 5FLUA 2OJZH 4UUJB 5KINA 4M4PA 5FAAA 4NZUH 4K73A 4XCFH 5C9KA 1KV7A 1ETZB 3HUJA 3HLAB 4G11A 5L6YL 1B6UA 3CFMA 1NFPA 1Z9AA 2EXOA 2YGYA 3FFOA 4APQA 5D2NE 2ZA1A 4D9LH 3FIGA 3FOKA 5K9QI 5J5EA 5IJCC 2WWMC 2QCNA 1KCVH 1ROWA 5ERWA 2Q7YB 5EU6D 3UZEA 3FULA 3ABXA 1ZVHA 3BDKA 3GVVA 2Y7OA 3UTSA 2G75B 5KVMC 2F53A 4A3QA 3QXAB 2CLPA 2R94A 5D03A 4NN6B 3WEBA 3PUCA 5F9WC 3V55A 1M3IA 2I7GA 5IFPA 1MPAL 3BOVA 1Z6JT 3W87A 1U8NB 3O16A 4M1RA 1IIHA 2OZ4A 4MA8H 2CXEA 4QLKA 1IQWL 3I9IA 4PSPA 3HPAA 4X5QA 2Y61A 3QQ9D 4JX5A 3PGCB 4GQRA 4DN1A 2B7QA 2I9EA 3KEDA 3NP3A 1FL6A 5IM7B 2RUSA 3CAVA 3WK2A 3WQOA 1KGWA 4GIEA 3EOBB 1N0LA 3EYOB 4KWOA 4Y5YB 4XBSA 3QEQA 4AD3A 2YUVA 3CSGA 2X2UA 3ARFD 4U28A 3WIJA 1YTKA 2GFBA 2N56A 4KK8D 5IMOB 4DM1A 2VOMA 4S0HA 1E2VA 2XTSA 4HS3A 1ZTXL 1OX5A 3KBNA 5EU5B 3GMQB 3W5NA 4YIQB 2DB8A 4FXGB 4OM0L 1FDZA 1X4YA 3VFGH 2YZ1A 1INDL 5E93A 2N7AA 3WJXA 2DQGL 1A7PH 1LMIA 1UM6H 5ABTA 1AH3A 5B1BB 3ZKQD 3GJEA 5BUGA 1JNHB 4X5XB 1UACL 1IZCA 1QPNA 1I3UA 4Y8EA 3SDDA 3MTXA 1UURA 4UQBA 3L5IA 3PP4L 5E2JA 5E4EB 1ZS2A 1OCRB 2QDEA 3F7JA 1UA6H 1H7OA 2GDUA 5HGAB 3DUSA 4HISA 4Z7NB 5HYQB 4HIIB 3HAEB 2XWZA 4HQQH 1E65A 1OGTA 5T3ZH 4Q4MA 3QW3A 1ZB5A 1J05B 1U8IA 3H7BB 3HNSL 4GABA 4HHHA 1U6AH 5K9OB 1EFXB 4BZ1L 3VKBA 2K1MA 4GAJL 3UY8A 5IDZA 3MBWB 2ATPA 2VEPA 4G8GA 2NTSP 2IPKB 2CLZA 2J5LC 2R4SH 2GSEA 4UTHA 3OYZA 1PG7X 3C52A 1NLBH 1RFDH 4L5FL 5FYLD 3BUDA 1OLZA 2FUQA 4QMEA 1R19A 2C3VA 2JKNA 4BQ6A 1IWAA 2YMXH 3HE7D 4FHKA 2GCYB 2WBJA 4J1UA 2ICES 4UNVA 3G24A 1J1PL 3U7BA 1BAGA 4NUGL 4UUIA 1QSEB 1SY6L 7TAAA 1YYLL 4WJG3 2XV0A 1A25A 2RCSH 2F6AA 4KVCH 3ZR5A 1ZRQA 2WYSA 3BGJA 3MYOA 4IMEA 2OQYA 3U9PH 3S3JA 4LU5L 2OTUA 2HKFH 3LTYA 3AIBA 3WKYA 2EIJB 4W6XB 4G6MH 2PTUA 4O02A 5GRXG 3K74B 4HS6B 1HXKA 4HXAL 2QSCL 2OBGA 2X6AA 5D2XA 2Y25A 3NZ8A 3UBXI 1I9IL 1RZGB 4AVIA 1UM5H 3FB6B 4LGPB 4PGBB 4RAUA 4JB9L 4D0DA 2Z27A 3IE4A 3AZSA 4P7OA 3KWXA 4HKJB 4Y16D 3INUL 1E3FA 2P49B 3N04A 3R8QA 1PYWB 4HKBA 4JKWA 3V0EA 1JCLA 3SE8L 3GLCA 2CJ3A 3DEQA 3WL9B 5IG7B 1G0YR 2R23B 1VD6A 2APBA 5I74B 4P7RA 3DK0A 4G9PA 4ZSOB 3VH8B 1R3SA 5I1JH 1G5GA 4KJYB 4MDJB 1OKEA 5IEHB 3ZDZF 1TV2A 4AENB 5FF0A 3TC9A 1XBZA 4KUZH 4E8DA 4CMHB 4ZAKB 1LM1A 4RSYA 2MEJB 2ALRA 3W6MA 3TO4A 5H1WA 1NCBH 3OMIB 4YSDA 1H8OA 4C6QA 4LFHD 3CIWA 4RMUA 5FYJD 5HQMA 3GSXB 4Q8VA 3D0VB 2NNFA 5LBVA 4HFWB 4L9LA 5D1ZC 5BQ7A 4YHYC 5JA8B 1UOZA 1SBSH 2AL1A 4JX0A 5IHHA 4PY8J 2ZWKA 3VOHA 1UM4H 1SHSA 3EWCA 1F3WA 3C5SA 3WKML 3IARA 4QCIB 2EDTA 1P0EA 3B8VA 5MF5A 3LMZA 3Q45A 2YBGA 3M6YA 2QW5A 3NQGA 1BYPA 1W5NA 5TAOA 4M0XA 3A12A 3BN9D 1MI5E 4FOUA 3CZJA 4AF0B 4HJSA 1E2WA 1E9PB 2XCMC 3WIIL 3IFLH 4MNQD 4N2IA 4ZXBC 4ZNEA 4RZ4A 1ZK5A 2R9RA 2Z00A 5DU7A 3QPZA 2PDQA 1S7XA 3KH4A 4NZ4A 2A83B 1MKFA 1DSFL 3O8XD 4RX0A 4WJXA 3BZ4B 4NNYB 5C08D 1MDTA 4LQFH 5I2IA 2PP1A 1KXTB 3P11H 4XX6A 2V5JA 1HS6A 4Y1SA 2JIXD 1XLDA 2Z31C 1OTUC 4EQ3A 3F5LA 1CL7I 4OBSA 1X39A 3C5XA 2Z7WA 1MQRA 1MAML 4PJ9C 1BZDA 1JZFA 1PZ5B 2DWDB 4FXTA 4XNDA 2Y07H 1IM9D 4FI8A 4E42B 4Z7VB 2QLYA 3OJVC 2R8SL 2CCRA 4RGOH 4ATWA 5F21B 4MA7H 4L1TA 2PCXA 3AS0A 5F7WC 5C70A 3SO3B 5IOKA 4HCRL 2DQUL 5FV2A 2FSDA 4XX1G 2EPKX 4M7SA 2AQQA 2H1PL 2VDOH 2AJYH 3F2DA 2BVDA 3TF4A 3CN3A 3BZDA 1MWAB 4NQDE 1I2QA 3MV7B 3RHWK 2ZT9C 4MDOA 1B9KA 3E7JA 1V0LA 1EEZA 3OXSB 4N0UE 2UVFA 4X80L 4PAZA 5DFVC 2OMVB 2OW6A 1RJPA 4IRSA 4NJIA 1VFFA 2FSEB 2DZXA 3PJWA 4H6KA 4MD4B 2DQIH 2OLAA 3PS7A 4OT1H 1TNMA 4XP4L 3TBWA 3PXHA 1F2JA 3QZEA 3TJEH 4R34A 4X4ME 4WFEE 2NXHA 5LIUX 3W7OA 2YD5A 1MRFL 3PJNA 4JFEA 4NO2B 4UU9B 4H9UA 1RZ8A 2R56H 4OGXL 4UYQA 5ESVA 1RHCA 3PREA 4JIHA 4D1JA 5HR6A 4Z0BL 1IB5A 4R5EA 1EX5A 1OC5A 2O4EA 5FCSH 4I1PA 1K7EA 4XKMA 2V67A 4WJEA 3V5DB 2K6YA 4UOW0 1JZEA 3WNJA 5CPQA 5LCVA 2W9EH 1MWOA 4JG5A 2W07B 2J9ZA 2PXYA 2QDHA 4MMWA 3Q44A 2NY1C 4PG9A 1GG1A 2H8XA 1K3UA 4PCNA 5J6HA 1P5VA 5JH2A 1E51A 1IEBB 4EX4A 5A6MA 4KCVA 5JVLA 1EZWA 1G9EA 1A47A 4UWQB 2E5EA 4HLZH 4JQVA 2FJGB 1PWLA 2ZRZA 6ALDA 4QD2E 2RTTA 2ZRUA 2P3EA 2FT6A 3A23A 4O9HL 2BVQA 1PJ9A 2PYFB 2W81C 3BH4A 3BVUA 3KHQA 4FXGC 4WGKA 5K39B 4E2OA 4F1SA 5B8CA 5IOPA 1JZ2A 2APWA 4R4ND 3O3RA 3UWQA 5BOFA 2AQTA 3GI9L 3VXPB 3CV5A 3PTKA 3IK2A 1MRDH 1MJ7L 3IKKA 2EPHA 3OAZK 4OUEA 2KT6A 3PGFH 2J47A 4WU5A 2Q3XA 4ELMB 1AMXA 4E3VA 5G2WA 5JHLL 4MSWB 3P0YL 3JW7A 2VDRB 3L7RA 3MFFA 4BINA 2VMEA 4Z1BA 1PY4A 1DEDA 4HUCA 4Y4FA 3P0WA 3PNUA 4GG9A 1JGUH 4NNCA 4X2PA 5FA5A 1J8HB 1N8ZA 1PKQA 3G1DA 1IR2A 4YBLC 4XSMA 1ZU8A 1GHFH 1W1PA 2MCG1 3B5TA 4OCMC 2OZ8A 4GC4A 5A94A 1M71B 4YHIB 3AOFA 4GKTA 2VFIA 4XVSH 4M00A 4J12A 1E28A 1A5SA 1TKWA 4XC1H 3JSSA 4D7BA 2FR4A 1NM4A 2F8QA 1E6JH 1U8JA 3R7RA 4H88H 2E9IA 4MB5A 1N3NB 3QIUD 2NZLA 3H9HB 4KO5A 1RZJH 1FI8C 3I3EA 4P46C 5LNEA 5AOJA 1MF2L 3HFML 4G59C 3S6OA 3RGHA 3ROOA 1P7TB 4IL0A 4L5FH 2KAUC 4YDZA 1AGEA 3T3PB 2RAMA 2X0YA 5L2KA 1XSKA 1W0VA 4NHCL 3DROB 4Z7AA 3QUYD 2LTQC 5HJYA 3BSGA 1S7WA 4U31A 3UJIH 1PD6A 2YR3A 2E1DA 3FXYA 1N59A 2CCVA 4R3UA 5FO2A 1BVNT 2ODHA 1FWHC 4HXBL 1LEIB 3WTTA 1OFRA 2XV6B 4LSVH 3KYKL 3B9KB 4HHWA 4NNXB 4LFHG 2I27N 4M6UA 4XZWA 4K71B 4XR8C 4WQOA 2K9FB 2WMPA 3JVAA 2DW5A 4J3VA 4U4BA 5FI8A 3AISA 3NBNA 3QH2A 2R24A 2BSSB 2G2RA 2VKZG 3L67A 2XN9E 4E9WA 4WKFA 1MCRA 1GYWA 1P4IH 3HKZA 3QPXL 3RYMA 4H13C 3TN4A 3BH9B 5TE7H 5IBLC 1LUCB 3H22A 3B7UX 5F6HI 5G2HA 1MFDH 3BP7A 4BKNA 2PDKA 3RPMA 3G04A 1RUPH 2XWTA 5HVHB 5JQ6L 1FNAA 2OM5A 3CHRA 3FCBA 4M7LT 3WFAA 3WLBA 4PMUA 1DQUA 4MQSB 2FWUA 4NC1E 3QNZB 5DD3H 3TV3L 2IADB 1BGXH 4QFUA 3WUWA 2GT9A 4MZ1A 3DRQB 1YN7A 4MZ8A 2DSWA 4WY0F 2P88A 5HDBF 3CN0A 4LSQL 4G9DB 3W39B 3MACL 1TF4A 1R5IA 4ZMGA 1EAPA 1NGYB 5DJDB 2I9LB 4D9QD 1P53A 3RU8X 3UXDA 3WLSA 4B3LA 5FYLL 2PF0A 5EU5A 5C07D 3W9EA 4QT5A 4BGDA 2V5CA 5F1VA 4UTUA 3EO9H 3I02B 3ZDZB 3MGOA 3T3ME 4JREC 1IBGL 2I56A 2NR6A 1AGCB 1SYSB 3U46A 2ATMA 4AWTA 4JG0H 2JKSA 3C2FA 1WFUA 1U5JA 1NDTA 5LGKA 1DJQA 3GKWH 1Z89A 1X5IA 1UB5B 1MJ8L 4L4PA 3RLHA 3C6EA 4NAMA 4AGQA 2D0GA 2J88L 3VXRE 4EBQH 3WTSA 3GDTA 5BS0B 4OJCA 3TK7A 3VOIA 3OVUB 3PHOB 1YSOA 1Z5LB 3I9AA 1HOCB 3LEYH 4MD5A 5D7HA 2R2CA 3U2SA 2F84A 4DN4H 1OZUA 1KYUA 1REIA 2BOGX 3AJXA 3C8HA 3EX3A 1S6NA 4XPBL 4PHZA 3ZDXE 3MZ2A 4LB3A 5BXPA 4I3RH 2EVHA 3RLSA 1UR9A 3V4VH 5DMIL 1Q0XH 3Q1SL 4GY7A 3HAEG 4JFUA 4Y9GA 3H2WA 2VENA 3L9BA 4NZUL 3G2GA 5IBUB 1U58A 4W68A 5I09A 5I6OA 2Z2BA 1D3HA 4NT0A 2CIIA 4UNIA 2IPKA 2ZX8A 4WWOA 2BWIA 4OLUL 4EUPA 3AGVA 4C6MA 3LS5H 1P4BH 4PV8B 1BZOA 5FO9A 1A6AB 2JKPA 4GJTB 2VLJB 1UCBL 4PUMA 3KZSA 5DHYA 2D20A 4E0RB 1BQHB 5DD0H 2V2HA 4Z7UE 2G37A 2NQZA 3W7PA 1YEHH 4GUFA 5L7XH 1B0WA 4LLQA 4RPPA 4D0BA 2IXQA 4LH8A 4NVTA 1NLBL 1RFDL 3SYPA 5DANA 3O11B 4LLYA 4XN8A 3EBGA 3TNMB 3U36B 3SJVB 5I1HH 1RBLA 3O7UA 4H01A 4R7VA 2K0RA 1EA9C 2IAMA 2E8YA 1WS8A 2AXHA 3E0GA 1HCFX 4YVNA 2I07A 4G2AA 5F3HA 5HI3C 5IEKB 3VFPA 4RJEA 3A6OA 1F4AA 4I13B 5C0GA 1BLNB 3QJTB 5D4HA 4H1ZA 3I6KB 3WI9A 4JJOA 2DZTA 1KCSL 5KOVC 5DJAB 2HWGA 2VMFA 4HPYH 4PGBA 4RAUB 1M42A 3KBPA 5D7SH 2ADJB 2WHVA 3A3YB 3FBQA 3UACA 5C2XA 1TZ9A 2F5AH 4HLEA 1VP5A 3DK2A 3FU5A 2OMWB 3VI4E 2R23A 4JAWA 2Z0IA 2XRAL 5HYSB 1POJA 3I85A 3KRZA 3NJXA 1HEJC 4QE4A 2VCCA 4KJYA 5KJ4A 1FN4A 4G8FB 5IMMA 3H0TB 5HHXH 2X1TA 3GHBL 1HK6A 3PUGA 3GUTB 2IO5A 2Z1KA 2OOFA 3B8WA 3M46A 4Z7VE 3PJXA 3TTOA 1H8LA 4CQDA 3TO4B 3JXAA 2R2HA 4Q7BA 1WHPA 1L9PA 2PCPB 5AOLA 3HUJB 3WEXA 5GS0D 1Z9PA 3PY9A 2JIXB 2VR5A 3IAGC 3KDOA 4WO4A 3VXNA 2NR6D 2WKOA 2XXCB 2VAJA 4XNZB 3QUHA 5C08B 5J11C 2H3XC 4GRMA 4K7VA 1BDYA 4PU2A 4ZK8A 3KRBA 4TKWA 2ABAA 2ZKMX 4UNLA 1ADQA 3FT4A 1CFVL 3V1HA 2IMNA 1NC2B 2NY0D 4I18B 3OBEA 1ZNNA 3QUZC 2BNRB 3AITA 3ZTJH 4C56E 2YLHA 2AI0H 2NXYB 4H9TA 1DQJA 1O6SB 1V3KA 1LWJA 4YSPA 4ABUA 2OQHA 2RB8A 3COTA 3LZ5A 4M9PA 5I3HA 2IC2A 3GSNA 1OY0A 3OHIA 4R4FH 1QFWI 3W57A 3GTXA 4M6OL 1R3LB 5I0WA 3F1QA 1QUMA 2IGFH 1KBLA 2VH5L 1JNDA 2YQGA 4ANXA 3R4DA 1B31A 1KNWA 3A3XA 3HV8A 4IFKA 1N67A 4YAQA 2FECI 5FGCE 1I7ZA 2NX5E 3Q06A 3QF0A 3WLQA 1QNIA 2DWDA 2XY1A 1ZJIA 1XZ0A 2OP4H 1X5FA 4U33A 3RTQA 3WFCH 5A7BA 4OSUL 4OKDA 3MV9A 4CBPA 4N2KA 2NY6B 5L6YH 1NZRA 2R0KH 1YMHA 5FHBH 4P49A 2AV1B 3T2OA 3FDGA 4JZ5A 1AP2B 3DN5A 1XRSA 2DWEA 1XVSA 2W59A 5E70A 3VWJC 1GH7A 1DHPA 2P42B 1IKNA 3EAKA 5GS2H 2FJHB 3VUSA 2Y23A 2HT2D 1BOYA 3AADB 4GG6E 3ATFA 3RAJL 5D7JC 3MV7A 4FI6A 1QOXA 3N9SA 1J86A 3ES7A 1S7TA 3VXSA 1AQDA 1EXBA 1JZ7A 3SDDB 3IK4A 2YPLE 3KD4A 1VQTA 1SJAA 1U3HC 2YPLD 5C0BA 4NZRH 1G7VA 4MD4A 1RV8A 2V7HA 1FIEA 3BIAX 3U30C 4UTAH 1UJPA 2C0HA 4P8VA 2QFRA 4IKIA 1X5HA 3N06B 1VCGA 3QUKA