3BAJA

Human pancreatic alpha-amylase in complex with nitrate and acarbose
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 172
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bajA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bajA01
5A2AA 2VT0A 1ITCA 1HJQA 2VCAA 1PX8A 3POHA 1Q6EA 3RCNA 4IPLA 4NX0A 3EMQA 1B0IA 1HJUA 3TONA 3WNMA 4KGLA 2DGAA 1UWQA 2B31A 1DWHM 3T09A 2XYLA 1JNEA 1HKJA 3W29A 5JIPA 5AC4A 2WKGA 4IPNB 3RM9A 4CKQA 2Y8VA 1CBGA 2GVYA 2E8YA 1PJ9A 4X0VA 2WVVA 3K46A 1DWFM 3SUTA 2VUYA 2F7PA 1Q6GA 3VNZA 2VZUA 2VQTA 4DWSA 1TUXA 3TTQA 1LL4A 3WQ5A 1E5NA 1PX4A 2VX7A 2WANA 2VTFA 1D3CA 2OLHA 5JBFA 5BYWA 4GQRA 1E0WA 1PX3A 1X6LA 3ZR5A 3IAQA 4M82A 1FOBA 3VU2A 1HIZA 1CTNA 2J4GA 2FE0A 1QI2A 3CZKA 3GH4A 4ZENA 3VIMA 2WCAA 3GTNA 1GOIA 5HXMA 4A3YA 5A94A 1C3FA 2VZOA 1WE5A 2CBUA 4DUXA 2WZHA 1E72M 1B9ZA 2WHLA 3VD4A 2AAAA 3KWXA 3EMCA 1LJYA 2WNWA 3VD5A 2JE8A 2EPNA 4S3KA 3A5VA 2YJQA 2GDUA 1CXLA 1TCMA 2F2HA 3LRKA 3PZ9A 2D1ZA 3AXIA 5DF0A 1A3HA 3CZSA 5A2BA 1E71M 3ZR6A 3D50A 3HG5A 4W8LA 1GVIA 4MAVA 5GNYA 5AYIA 2VVSA 4WKFA 3J7HA 1OB0A 3BVWA 2J74A 4AW7A 3K8LA 3TTOA 1EA9C 2ZUSA 1QVBA 4JHOA 4FLQA 1GHSA 1W1YA 3F5KA 3WH8A 4PCTA 1MW0A 4UR9A 2YDQA 2VRJA 3VM7A 4AZ7A 1OM0A 2RGLA 3WNOA 3LXCA 5A8PA 3VKKA 1QNOA 3BC9A 1UKOA 1UD2A 4DM1A 4QLJA 2PBGA 3UETA 7TAAA 2DSVA 4NSBA 3VGFA 2X2HA 4PMZA 1GCYA 4CU8A 4GIAA 1H2JA 2ZX5A 2PC8A 1E6NA 1FH7A 1KXVA 2EABA 2QPUA 3LPOA 5A6JA 3ARSA 3N04A 4XB3A 4AMCA 1PZ2A 1H41A 4L4OA 1H0IA 3VIFA 1SFSA 4HPHA 4LYQA 2DT2A 5HNNA 3AMGA 5IDIA 3BUBA 2J7HA 1NWTA 1XD0A 4DUVA 4MB3A 3BAIA 1CGUA 3BUIA 4W7WA 2ALWA 1UWIA 2VX4A 4B9ZA 1CDGA 3AI0A 2CITA 4PRWA 4D72A 2G3IA 4HMCA 1E15A 3THDA 4E8CA 3CC1A 5A6AA 1W9DM 3AIVA 2F1AA 1GW1A 5HPCA 4GO9A 1H0GA 1OGSA 4AD5A 5HOSA 3APGA 2E9MA 4NRRA 2CXGA 3CUGA 1JD9A 3LXBA 1RP8A 4MB1A 1VJSA 1M04A 4BQ5A 4WIWA 3EMZA 1LL6A 4GKLA 2VURA 5E70A 3BUPA 3A4XA 1JZ4A 3CUHA 3BSGA 4H2CA 1MYRA 2WMFA 4PEEA 4UOZA 2D0FA 4HPGA 1Q6FA 4J3WA 3RO8A 4GPNA 4BA0A 4XZWA 1HVXA 5A1AA 2G3NA 4QCFA 3DYPA 2D0HA 3ARTA 1GOQA 1ISXA 3VD7A 1Z32X 3VIOA 1UWUA 2WLZA 3FXYA 5GQBA 5IFTA 2ZUVA 1K9EA 2GK1B 3MUAA 3RM8A 1GZJA 3GXMA 1SZNA 5IHRA 1KWGA 1UA3A 1D2KA 2V5CA 3AZTA 4P7QA 4HZ7A 2XN2A 5BRPA 4J27A 3NSNA 3WEZA 3CO4A 1MFVA 5E1QA 1EXPA 1I1WA 2DQXA 4PTWA 1TQUA 5GNXA 3VIGA 2VL4A 1KFWA 3BCFA 4D6EA 2AOSA 3ZT5A 2EACA 2V5DA 4URIA 3MS8A 3RM4A 3SCRA 3BAJA 4N42A 1LQ0A 1MXGA 3FW6A 3VO0A 4JKKA 5CPSA 2BVDA 1ZBWA 5CSUA 1BGGA 2BXZA 3SIMA 4XV0A 2WHJA 1VF8A 3CHFA 2YIHA 2PWEA 1V0MA 2WPGA 2IUZA 3TTYA 1O7AA 4CUCA 5CG0A 2E4TA 4PTMA 3SCVA 1CEOA 3AROA 1EGZA 3VX1A 1RD6A 1JZ8A 4NZFA 3WNPA 2XWEA 4DWSD 3SCWA 3ZSTA 1UQZA 1PS3A 4BQ3A 4XZBA 3AOFA 4NZJA 2FYVA 2YA0A 2V38A 1BSIA 1XSIA 4P8XA 2G41A 5A69A 3CH9A 4P7LA 4Y7EA 5D9OA 4W86A 3L2LA 4LGXA 1EDGA 2FHCA 3F5JA 5JBEA 3D4YA 1K9FA 3L4WA 1VBRA 2PWGA 2CIPA 4UFMA 3N17A 4TVUA 5BXTA 1QHOA 1VJZA 3E1F1 1MQQA 1ZBKA 4HP5A 1AQMA 3WF2A 4ACZB 2EEXA 5KEZA 1TQWA 2GK1A 3MV01 1CENA 1UUQA 1VFFA 1HTYA 1E4LA 2Y8KA 1ODUA 2F61A 2W92A 3W53A 5LYRA 2DPEA 3IK2A 2JEPA 1UWSA 4OGZA 1UH2A 3H55A 5A2CA 4FK9A 1BPLB 1YHTA 2CPUA 2WAGA 3BLKA 3K4AA 2NT0A 1J18A 2ZUMA 3L4UA 1UHVA 3LPFA 4QFUA 1UA7A 2CHNA 4FLSA 3N11A 2GUYA 3TP4A 2CEQA 2UY5A 1KBBA 5BXRA 5ABFB 4JKLA 1BYDA 1UR1A 3WH9A 2ZIDA 3BXWA 2ZUTA 1E55A 3VX0A 2CKSA 3RMEA 4TUFA 4AXNA 3NIYA 4FNUA 4V27A 4U2ZA 2Z1KA 1GUVA 3W24A 1TZ7A 2J77A 5I24A 1JFHA 3SCPA 2YDSA 2ZX9A 3MMUA 4HZ8A 4Z2HA 4YHGA 2EPOA 2XUCA 2E0PA 3S6TA 4J28A 3WNKA 3SUWA 4W89A 4NF7A 3QHMA 2JIEA 2XSAA 3S5ZA 4TVDA 1UH4A 2CNCA 1E56A 1PAMA 1QNSA 1CGXA 4UZSA 5JUVA 3AS1A 4LQ1A 2CETA 4TTGA 1DWAM 3A3HA 1HF6A 1SMAA 1L8NA 3CZJA 3GZAA 5D9PA 4EKJA 1UZ1A 3F4VA 3SUUA 3GNRA 1XYZA 2Q8XA 2J78A 1GVYA 4ACZA 4PMXA 1AQHA 2O92A 4OUEA 1HXKA 4AZHA 4TXEA 1OD8A 4UFHA 1R33A 1AQ0A 2WMGA 2Y2WA 3FHAA 5DFAA 2WHKA 3QGVA 5E9AA 3AMCA 3AXXA 2F7OA 4H7VA 3OZOA 4CD6A 1XSKA 4AD1A 3MV11 2VR5A 3CIVA 2VX6A 2XVNA 1F4AA 1V3JA 1QW9A 1TQSA 2WXDM 3S5YA 3VGHA 3ARRA 3UG4A 4TX6A 5M3WA 1DTUA 4MB5A 5A6BA 2V3DA 1VRXA 2VRKA 5HPOA 2BVTA 2XVGA 3FN9A 2BY0A 4D6CA 3UESA 5ABFA 6A3HA 3HG3A 4AD2A 3TV8A 1KB3A 4CU7A 1X1NA 1UYQA 1UR9A 4AIUA 2VC9A 5I5RA 2QMJA 1O7DC 2JEQA 2D0GA 4D6GA 1CGYA 4CD8A 1VENA 5BXPA 4DO5A 4BCEA 4Z2GA 1CZ1A 1W3JA 3IANA 3CPUA 3GXDA 1UR0A 1TR1A 1KQYA 2ZXAA 3AZSA 1OT1A 1SR0A 1U2YA 1TMQA 3KL5A 2PB1A 4JL1A 3WUFA 3UG5A 4ATWA 4GZJA 2IXVA 1E4IA 3ZM8A 3I3DA 2W67A 2ZOXA 1KXTA 3B9EA 1H11A 1WNOA 2J75A 1IT0A 3WSUA 1K9TA 2V3GA 1WDQA 1EQPA 4UOQA 2GJRA 1LLOA 4W93A 5GNZA 4CN1A 4HTYA 4UFLA 4NI3A 1CNVA 1ZJBA 1DWIM 4BS0A 4E8DA 1WKYA 1CXIA 4MB4A 1BYBA 1V6XA 1XGZA 1V02A 3MMDA 3ZJKA 5A6KA 1QWNA 3A23A 2JF7A 4W5UA 1LG2A 3AJ7A 4AC1X 9CGTA 1MW2A 3L4VA 2EPKX 3AZRA 4UQCA 1MWOA 3W25A 3OBAA 4M56A 1A47A 3IJ7A 2EO7A 2RGMA 2BY3A 2E9LA 4F9JA 3WKZA 1KGWA 5DO8A 4JIEA 1KWKA 3ARQA 4F66A 4B15A 4QLLA 1Q4NX 4JFUA 1W91A 3U5YA 3AIUA 1QW8A 5E6ZA 1HP5A 3GH7A 2W61A 4D6HA 4RE4A 5JBDA 5CSYA 1JZ7A 1WPCA 4F8XA 2QPSA 2WW5A 1CYGA 2ZUNA 4WJXA 3VSTA 5D8WA 1EOKA 5AC5A 4MNLA 3KLLA 2WHMA 3WEMA 1OIFA 3OLGA 4DO6A 5C70A 2BVYA 4MNKA 4XX6A 2XN1A 1HKIA 3VINA 3WF1A 3IGUA 2EBNA 4M80A 1CLVA 2ZUWA 2XTKA 1DEDA 1OWQA 3ARYA 5A8MA 4RL3A 1NWRA 3SEPA 1W32A 1JF5A 2WSPA 3EJTA 3K1DA 1HVQA 4J3SA 3VVGA 4D6DA 3WN6A 1E6XM 4PTXA 2HVMA 3H54A 1E70M 2A3EA 2YLAA 3ARUA 1GOMA 1GQJA 4YN5A 3M7SA 4UCFA 3AHXA 1GQIA 3WUBA 2JIWA 1HX0A 2EJ1A 4Z2JA 4ZEPA 1V6UA 2Y4SA 2F8QA 2FH8A 1JDAA 2PF0A 4CD5A 1TA3B 1ZU8A 1CXFA 1HP4A 1VEOA 2ZX6A 4E4PA 1PZ3A 3OGSA 1W9PA 1OBAA 5A8NA 4MTVA 1DP0A 2YL5A 1DWJM 4H41A 2J7GA 4AZIA 4WLCA 3W27A 3D4ZA 4J3XA 4KMQA 1CGWA 2ZXBA 2OSXA 1P6WA 4AYGA 4ZE4A 3WD3A 4M29A 2YL6A 2ZWYA 3WMSA 1W3KA 2DH3A 2WVTA 3BUDA 3OA5A 3BAYA 1B31A 2ZXQA 4MPKA 3N9KA 2DT3A 2BFGA 1UKQA 2XVKA 4Z2LA 1GJUA 1EOMA 3AQUA 1VFOA 3NDYA 3II1A 1VBUA 1LF1A 5CQ1A 3WL0A 3VDHA 3MMWA 3PN8A 1C93A 1J11A 2VX5A 1GPFA 1IZJA 4AIEA 3MO4A 2E3ZA 3T2PA 3BH4A 4PN2A 2V3FA 3QR3A 4W84A 1UASA 5I2UA 3WF0A 3CMJA 4RE3A 3K8KA 4EAMA 5A6LA 4AISA 3BAKA 3PZUA 2BHYA 5A8QA 3WELA 4UZUA 1M01A 3LRMA 3CUIA 1B3XA 3SUVA 1BG9A 4X0NA 1E3XA 4JL2A 2J7DA 5A6BD 5D9MA 1QI4A 3ZQ9A 3HZ3A 1NWUA 1TG7A 4AZ6A 1KXHA 1QNRA 2TAAA 5CPTA 5DT5A 1SYTA 2WKLA 3ZJ7A 3AIRA 2VZTA 4CU6A 3THCA 2JFEX 1R7AA 4JFWA 2NSXA 4GZIA 2WBKA 3RIKA 3CLWA 1N82A 3WY1A 3N18A 4FF5A 1B3ZA 4CCCA 1V0NA 1EQCA 2ZWZA 2OYKA 2XGBA 1JI1A 3M07A 1NP0A 5BROA 4K68A 3OLDA 5FL1A 1GHRA 1TA3A 3G6MA 4JFSA 4JFTA 2WVUA 3GYCA 1ODZA 3LXAA 1GORA 1ZS2A 1OIMA 5CLWA 2WSKA 3HMCA 3DYMA 1E6QM 1XRVA 3ARXA 2X05A 4UQAA 1UH3A 2BY2A 5E0FA 4OBSA 1E4NA 1XYFA 4JKMA 1OD0A 3AS0A 5FIPA 3BAXA 2ZX8A 3PTKA 2XFRA 5FKYA 3WMCA 5A8OA 3UR7A 3ARZA 1GOOA 2ZUUA 4M24A 3L4XA 1JFXA 2V3EA 4PMDA 1J0IA 1ZB5A 1QI5A 3MSGA 4NZCA 5I6SA 1FFRA 1EO7A 3VGGA 4CVWA 1HL8A 3AHTA 3ZSSA 3WDJA 2WC3A 1R47A 4HOXA 1J01A 4NXSA 3BCDA 1W2PA 2W4XA 3WDRA 1J0KA 2JF6A 2J7BA 1US2A 2EADA 2FDMA 1V08A 2O9OA 1QI0A 2XN0A 1QHPA 1PEZA 2NW0A 2CBJA 1HKMA 3CUJA 2CESA 1CECA 2D22A 1ISVA 1GONA 2VZSA 4GO8A 2DIEA 4XUYA 2UWFA 5CPQA 3SCTA 2O9TA 2BHUA 1R87A 3VMPA 3ZT6A 2WCSA 1E6RA 2E8ZA 1ZL1A 8CGTA 1HNYA 5F7UA 1T0OA 4D71A 5IFPA 3QHOA 5HDRA 3DECA 2PI6A 3EJPA 3WL1A 3DHUA 5BXSA 5LA2A 4ZXOA 3PBGA 1G01A 2WM0A 4AMWA 3WQWA 4DUWA 1TVNA 4D1IA 3T08A 3RJYA 2XFYA 3CHEA 1V3IA 1E5JA 4V2XA 3FAWA 5A6SA 4TTUA 1W1VA 3W26A 2EPLX 1R46A 2X1IA 1YQ2A 1TQTA 3BVTA 1EO5A 2BY1A 2XWDA 3CGTA 2WC4A 3AIEA 4W5ZA 1NWSA 1GNXA 4W7UA 1VFUA 4A4AA 3AXHA 2QF8A 2CYGA 2WZIA 3MKKA 3KL3A 1C8XA 5D9NA 1JG9A 4TOQA 4AY1A 4MAZA 3WH6A 5DT7A 4B9YA 5M03A 2F7RA 3EDFA 3A4AA 3A6OA 1FP8A 3T0AA 4J3TA 3A22A 1QWUA 2YFNA 1RH9A 1KGXA 3DHPA 1UWTA 3VD3A 4R5EA 2WLYA 2X2IA 3DDFA 2CERA 3BLBA 3NSXA 5C8BB 3K4DA 3NUKA 3EDJA 4PSPA 4JCMA 2WCGA 3ZT7A 1E1EA 2OSWA 1FA2A 1HKKA 3EYPA 3PZNA 3CUFA 3SCQA 3TTSA 4F79A 2XM2A 2CBVA 5AYBA 3EDKA 1JYVA 3BVVA 1VEMA 3VD9A 2WBGA 4TX8A 1I75A 3OB8A 2BS9A 4JAWA 1GQKA 3N12A 3VDBA 2J7FA 2ZX7A 1C7TA 4H8HA 1IZKA 1V3LA 2YLLA 3RJXA 1QBAA 3SCUA 2W5FA 3RPMA 4OKDA 3WDQA 3HN3A 1MW1A 5ABHA 1KXQA 3FY1A 5IXEA 2OW6A 3WQ6A 3GXNA 1G5AA 3WIJA 4JCLA 3L4ZA 5CGMA 1PIGA 4W87A 3UG3A 3GNPA 4H04A 1H3GA 4Q22A 3WD2A 1R86A 4FNPA 1BAGA 3KE0A 3MU7A 3ZJ6A 1XCXA 5E09A 4IM4A 4PMVA 1JYWA 3UR8A 1QI3A 1V3KA 5A3HA 1OT2A 4FNSA 4IUGA 1JZ3A 2PWHA 2FHBA 1E4MM 1J9YA 2W66A 1UKSA 1H49A 1B3VA 4QLKA 1E6SM 3U5UA 4AZCB 3VSVA 1VFMA 4GZEA 1RPKA 4DM2A 3VDAA 2WMIB 5M17A 2YOCA 3L4TA 1BTCA 2WZEA 2WYSA 2J79A 3VIJA 3LRLA 2C0HA 1JD7A 1WZAA 1L0PA 3AIWA 1H5VA 2X8RA 1W9XA 1OSEA 3AMLA 1JDDA 4JHZA 2DH2A 1R34A 1WZMA 3FNDA 3AMKA 2C7FA 1E3ZA 3LMYA 4UOJA 4FLOA 2D2OA 2WMKA 4AIOA 3PTQA 5I78A 3ARPA 2OWXA 4AYSA 1DWGM 3MSDA 5FCZA 4U3CA 5EFDA 1QX1A 3RDKA 2BNJA 1MFUA 5E6YA 3AYSA 4N0RA 1JZ5A 1WDSA 5GPRA 3W6LA 1JGIA 3RILA 5EFFA 5KZ6A 4H8UA 2FGLA 1B3WA 2WMJA 1WP6A 1FP9A 2C8NA 1QNPA 4V28A 2VNCA 1C8QA 3N15A 3BVXA 2QMKA 5ABGA 3WNNA 3O2LA 4C7GA 1D7FA 3HJEA 2ZXDA 4MDOA 4EE9A 3WDHA 2XVPA 3DX0A 3AISA 3AHYA 4P7NA 3VDCA 1RP9A 3NJ3A 2J8FA 4D6FA 1W3HA 1TVPA 2XSBA 3T0DA 3LX9A 3WBAA 3VTRA 4UQ9A 2GJXB 3CTTA 3NYDA 2DSZA 4PYSA 4DWSC 4NXKA 4WKAA 1WCGA 4MDPA 1HJXA 3VPLA 3D51A 5A6MA 3CBWA 3QOMA 3HU7A 2VI0A 1JXJA 1W9UA 4Z2KA 3ECQA 4U31A 2EQDA 4CN4A 1UD4A 3ALFA 3BMWA 1XH2A 2VRQA 3VMNA 1E73M 2DSWA 4QP0A 3WF4A 4AZCA 1Q6CA 3MUZ1 3LPGA 2WMIA 4B3KA 1BHGA 4OOZA 4LPCA 4LYPA 4MNMA 2VZVA 1J12A 3AHVA 2DSUA 1BYAA 2F7QA 4CD7A 2VR4A 1GQLA 3B8SA 1TFVA 1NP2A 1BF2A 1G1YA 3A4WA 1XH1A 5DEZA 3W6MA 4J3UA 3W38A 3WFLA 3PHAA 4W7VA 3GH5A 4MADA 1VEPA 2D20A 3G6LA 1VIWA 1MXDA 4OBRA 1HWWA 4S3JA 3VIKA 5CZKA 1JF6A 3KZSA 3WY3A 3WQ4A 4U33A 3DX4A 3CZLA 4PUDA 3GXTA 1H4PA 3IJ8A 2FHFA 1V3MA 3EJUA 4CCDA 1X6NA 4J7RA 2E40A 2A3HA 3WD0A 2VJXA 4AZ5A 3O6AA 1SMDA 2PBOA 1UD3A 1M7XA 4BF7A 1CXEA 3BSHA 1U30A 2MANA 1FH8A 1UG6A 5I3DA 4AD4A 4P7OA 5BRQA 1ECEA 4MJ4A 2YA2A 1NOWA 4MNJA 1OINA 1WDRA 4F9DA 3WDIA 1W9VA 3MUY1 3NDZA 4RE2A 4U3AA 1EDQA 3CHDA 3VMOA 2VVNA 3GBEA 4LYRA 1CGTA 2GJXA 2XJ7A 2FH6A 2YA1A 1VB9A 2X09A 2DT1A 1B30A 3AMDA 2AMGA 1BVNP 2VQUA 1EDTA 3AYRA 5CLTA 7CGTA 4PCSA 4PMOA 4LXFA 1QOXA 1V02E 1WAWA 4ML4A 1W3LA 1B1YA 1QPKA 4HA1A 2XVLA 3ZIZA 2CBIA 1US3A 3CV5A 1S46A 3OLEA 5DMYA 4WKHA 2G4FA 3D3AA 4AD3A 4QDMA 1UD8A 2VCBA 4ACYA 2BHZA 1HJWA 5CJ5A 4CCEA 4YPJA 3L2MA 1I1XA 1ESWA 3VIIA 2UY2A 5AY7A 1JXKA 3A24A 2X2YA 1UD5A 5JIWA 2WC7A 1UWRA 3AS2A 1PPIA 2VCCA 1KGUA 5FD0A 4W85A 5FOOA 4GQQA 2OSYA 1V6VA 4PMNA 1BGAA 1V6YA 1J0JA 2BXYA 3DX2A 1QHZA 1JNDA 3AIBA 2PWDA 4FNTA 1LG1A 3AIQA 2JALA 3B9DA 4H8VA 2UY4A 3OGVA 3SCSA 1LWJA 1KBKA 2D73A 4DO4A 1UQYA 3ARVA 3EDDA 1QBBA 2BV9A 4AD0A 5CXPA 1UR8A 4AEFA 1BQCA 4B3LA 1KR1A 3M46A 1ZJAA 1BLIA 2Y24A 1AVAA 3BAWA 1HT6A 1IV8A 2J7EA 3K8MA 1KCLA 3GXIA 2F1BA 4CD4A 3VSUA 3CHCA 2VOTA 4OIFA 3WD4A 3U7VA 5EMYA 4PBGA 3SCOA 3DX1A 6TAAA 4WK9A 5A95A 4UQEA 3GDBA 2EAEA 3OIHA 7A3HA 1JZ6A 1ITXA 5ABEA 1W1PA 1MW3A 2QV4A 2D24A 5BWFA 1J0YA 1E1FA 2J25A 1ISWA 3WH5A 5EBAA 5LA1A 1WDPA 3D5HA 2YL8A 4BQ4A 3U7BA 4U5IA 1NOUA 4GXPA 1XV8A 2J8GA 1OCQA 4D1JA 2CHOA 3SURA 3LPPA 3B9AA 3NSMA 3VIHA 1GJWA 4AMXA 2DIJA 3CMGA 2X0HA 1B90A 5I23A 3IJ9A 1FFQA 4C7FA 4AZBA 2CCRA 1E40A 2YKKA 2F18A 4PSRA 4J3VA 3PZMA 3ZMRA 4UFIA 2QHAA 2W63A 3NCOA 2YBTA 3T0BA 1F4HA 4HMEA 4P8WA 4KH2A 5IHSA 3OG2A 2A3BA 2PWFA 4W8BA 6CGTA 1JAEA 4M1RA 5HBFA 1G9HA 4W8AA 4UFKA 2OYMA 2XIIA 3SCNA 1H1NA 2WWDA 4FLRA 4PTVA 5ECUA 2OYLA 1OGGA 3MANA 3PTMA 5M5DA 1EHAA 4U5KA 2DDXA 4B16A 4FNRA 2X2JA 1G94A 2ZE0A 5I79A 1MVYA 2WWCA 4ATDA 3KLKA 2G8ZA 4EANA 4KRUA 3HG2A 3DC0A 2ESCA 3KL0A 1XCWA 4UQDA 2XIBA 2EXOA 5EB8A 1ZBCA 1FH9A 2GJPA 3SUSA 4HMDA 1E6ZA 3PZIA 3FHQA 3UERA 4Z2IA 2HISA 1WB0A 1JI2A 4GI9A 3S2CA 3VNYA 3T2OA 3WY2A 3UCQA 4LX4A 4GI6A 3GXFA 3WEOA 1WZLA 1JZ2A 1HJVA 3VUPA 2YFOA 3ALGA 1NQ6A 3WH7A 3WUEA 3ZO9A 1TE1A 3N1AA 2J47A 1NH6A 5I0DA 2EPMX 4MJ2A 1PIFA 1Y7VA 3VILA 1WZKA 2CKRA 3CZGA 2W62A 4BZYA 3WNLA 4HU0A 2XPKA 4NRSA 4QAWA 3GM8A 3CZEA 3BUQA 2WMHA 5D4YA 3POCA 2GDVA 1R7OA 4OZOA 2D23A 1FHDA 1XSJA 3WUGA 1UR2A 1JAKA 1G0CA 3WQVA 3TA9A 4KGJA 1E6PA 1V0LA 3W82A 4WSKA 1UZ4A 1V0KA 2A3CA 1XC6A 1B3YA 2O9RA 3T2QA 4A3HA 4PUEA 1J0ZA 3JUGA 4C7DA 1CWYA 2J7CA 1C91A 1R8LA 3PZQA 3EBVA 4D6IA 3MI6A 2D3LA 3GXPA 1HL9A 4Q7NA 2NT1A 4HOWA 3FAXA 1R85A 1HXJA 3MUIA 5I77A 1TQVA 2YL9A 3W81A 3WMBA 2G3MA 3TOPA 4PMQA 4W88A 1W9BM 1CGVA 3BGAA 3EJSA 1AMYA 3W0KA 1C7SA 3AS3A 3WENA 3GBDA 3BVUA 4JFVA 3CZNA 4P8UA 2DEPA 2G3JA 1UD6A 1WO2A 3WD1A 1NARA 2WVSA 3PZTA 1NOFA 3OZPA 3VGBA 1UKPA 1M53A 4M81A 3VM5A 5BCAA 1GOKA 1C92A 4PMUA 3WDPP 1ISZA 1CXKA 1CPUA 1K9DA 1NM9A 4ZE5A 4AZGA 3PZOA 1C90A 3W28A 1JDCA 2D3NA 2O9PA 3VGDA 4U2YA 4FMVA 1BYCA 3QOKA 4M8UA 4GI8A 3AHZA 3H53A 3I3BA 4ATLA 2OW7A 2OWCA 4OOUA 4BQ2A 1MQPA 1KTBA 3ZJ8A 3DX3A 1E43A 3M6DA 1C8YA 3CZ8A 2Z1SA 2E9BA 3W4RA 4X9YA 3WF3A 1J0HA 3EDEA 4HA3A 4AWEA 5E0CA 1PBGA 8A3HA 3WBEA 1XD1A 1BG4A 2XG9A 3DYOA 3WQ8A 1EH9A 2OWWA 4CVUA 2VO5A 3A47A 3BMVA 1DHKA 4CN6A 4WF7A 4EK7A 2ZICA 1M03A 4UTFA 1EHNA 1GOWA 2W91A 3EJQA 2GSJA 1XH0A 2DT0A 1KR0A 3GNOA 4UFJA 1JL8A 4PMYA 4FNQA 1U33A 2J62A 4UNIA 4PMRA 5LA0A 4OJYA 1W1TA 3ZOAA 1ISYA 3VIPA 3BLPX 3ARWA 4JZ5A 3O9NA 4HZ6A 1VAHA 1BFNA 3AFBA 5D8ZA 2WB5A 2A3AA 3F5LA 1UR4A 2WK2A 1KCKA 2XGIA 3I3EA 1H09A 1E0VA 2UY3A 1CXHA 4ZXLA 1HJSA 1CLXA 4GINA 3W37A 2XM1A 2XHYA 1V3HA 2YDRA 1ZBVA 4ZFMA 2Y5EA 1JYNA 2WVVB 3N13A 4HU8A 5CGTA 4KRTA 2IGTA 4DWSB 3OGRA 3L4YA 3PZVA 3DDGA 4WSJA 3QHNA 1R75A 3IAPA 3AICA 4KWUA 4P7RA 1Q6DA 1W2VA 1JIBA 4UQBA 4D6JA 2XFFA 1V6WA 1OGBA 1BVZA 2YBUA 3UEQA 4QCEA 4E2OA 4L4PA 3VGEA 4IISA 5C71A 1E9LA 1QNQA 1B2YA 2GFTA 1LL7A 1JYXA 3KEHA 3D52A 3WY4A 4R27A 4CGTA 1O6IA 4HA4A 5FL0A 2VMFA 1KQZA 3PZGA 2IXUA 3U57A 3EJRA 2FGZA 1J10A 1FHLA 2DSKA 1MQRA 4AEEA 3OLIA 3VOCA 1V03A 3WFZA 1UOKA 5TD4A 1K6AA 1EIBA 4TVCA 1XHGA 1LWHA 4HOZA 1UKTA 3HG4A 1HN1A 2QLYA 3A21A 1CIUA 4P8VA 2X0YA 1KTCA 4YHEA 1E0XA
chains in the Genus database with same CATH superfamily
1V7AA 1SYVB 1IM9D 3CVIL 2C3HA 1QUMA 2DTML 3ERXA 4NX0A 3STZB 1E9YB 3LHTA 1SHSA 1HJUA 4JQ4A 5F9JA 1SFLA 2QSCL 2M2DA 2BFVL 4KXCA 2LGNA 1HG3A 1WD9A 4NNXB 2Q87A 3RM9A 2E9GA 5CGBA 1OYAA 4P99A 4QTHB 1E6JH 5EU9A 1KG0A 3VFNB 1YMMD 3D85A 4PRPB 5KWYC 3Q2CA 1QNIA 1SGKA 3LZQA 3MRNA 4QWWD 4Y9CA 3RFAA 1YNPA 2E77A 1F58L 2Z2AA 4TX9A 4L4VE 2IQ9H 1J1XH 1GOIA 5HXMA 3HTWA 5F7EH 4IDJH 4QI3A 4JN6A 1UT1A 2BZ7A 2A73A 3UCCA 4TNVK 1B9ZA 3CX5K 4N86A 4H44C 3GTXA 1AKPA 1XSOA 3EA3A 4WEMB 6PAZA 1CXLA 2YN3A 3S9IA 2OMTA 4IP7A 3OKMB 1GVIA 3WKQA 2YD0A 4IPIA 3L3GB 5AYIA 4WKFA 2WYHA 4HIXL 1EJ8A 4N2LA 2PCPA 3FT3A 4S1SL 1QCWA 3EW3B 3NA4A 2E9WA 2VCOA 1MW0A 4UR9A 5I73C 5E8DH 3BLDA 2XZQH 1EZVX 1UD2A 1SW7A 4EN3D 1IGIH 4ZW5A 3BKYH 1TCRB 2QIWA 1O9VA 2VJ0A 3QQ0A 3PG8A 1HNFA 4WWOA 4AQ1B 3ZZSA 1T66C 1J2BA 2ED9A 5BQ7A 3GSXA 2E59A 1IGWA 4NO0A 1KPUB 5E9DA 5C09B 3BAIA 4E2VA 2G2RB 1LLZA 2XN9D 5C07D 4D72A 3QIUB 1XBZA 4FL4C 2VLRB 3LPWA 1OGSA 4FEMA 3LXBA 2PDGA 1R5YA 3BN9D 2Q1EA 1CFTA 2VURA 3UBGA 3BUPA 3QBTB 4TNFA 1KUMA 1XLLA 2CR0A 5IW1A 3S6DA 1NFIA 4R96A 5E2JA 3VD7A 4JQVA 3UJJL 1UWUA 1K4CB 1KM1A 3D25A 4JRYA 1FWSA 1FNSL 2IWKA 3FH8A 1NFDB 2V5CA 2O5YH 1S7QA 4UV7H 4B4FA 3NSNA 1MFVA 3IF1B 2QCDB 4XUGA 3NAAL 4ORZC 2WN2A 1IFRA 1TTGA 3ZT5A 4H1LB 4RVBA 4UANA 2VAAB 1TTUA 1CFSB 4PRHE 3QQWA 3D0AA 1S2TA 3HE7A 1T20B 4MQTB 5F3HB 2YIHA 2WPGA 5FJJA 4LHUG 4YFDB 5MI0B 5CG0A 1CEOA 4P4KC 1OB1A 4L1SA 3OF6A 4PJ9C 2IDFA 1UEMA 2XWEA 5D1XE 4KKLD 4I2XB 4GBXC 1UJ3A 3HZMA 4LO9A 4UNVA 4B9CA 5MEQA 4J23A 4B50A 5F89B 4LGXA 1I1AB 1KM3A 2RH0A 3SYPA 3GSQA 3NDOA 5JBEA 2H2SC 5T3XH 2VDRL 3VZZA 2GUBA 5BXTA 1MHHB 1A3XA 3OPZL 5HJGA 3O4OB 1MQQA 4R88A 1WXJA 4EIVA 3UF9A 4ACZB 1WUNT 3FO0L 2Y8KA 1N4XL 1FBAA 1KZQA 1A6VL 3KJ6H 4N1EA 5DVKA 1PYMA 4M5ZL 4NJIA 1G43A 1O7SA 1CT8B 4KK8C 3RVTC 7ODCA 2HLFD 4ZUWA 5B3JF 3AUVA 3GKFA 2AGJH 2JKNA 5G4WA 5D1QA 4L8BA 5ABFB 4JKLA 4OI8A 2I16A 3U9WA 4FXKA 2FO1A 5EOCL 3ZGIA 5D2LA 4MNGB 2FYYA 1F2QA 4WFHD 3KPNB 3TN0B 1OZQA 2Z1KA 1X5YA 1FL5B 2NW2B 1OCWL 1RK6A 1QXLA 5HP5A 3WTWA 3HPLB 4Z2HA 5K9JH 1HO4A 2APVA 3PK7A 3MMTA 4MZYA 4QHPA 4MS6A 2ZOUA 1QEXA 1UWXH 2CWRA 3CX2A 1W37A 2G30A 4Y1AB 1FQ0A 2AEQH 3IEAA 2BOCA 1ZHKA 3RWIA 1T1WB 2WKOF 4H7CA 3QC0A 3ARBB 2J78A 2O92A 3CSYA 1JPIA 1FHNA 3ZZ1A 3P0XA 4H7VA 1NGYA 2Z2BA 2KZ1B 1NFDF 1F4AA 4H1LG 3EYOB 3TV3L 3VGHA 5DCDA 4MB5A 4KW2A 3DK2A 1GVQA 2QZQA 5L2JA 1X8CA 1S6NA 3CDFA 3KPSD 1QSFD 2D0GA 4KI5E 3GMRA 1LTDA 3EUDA 3SN4A 3CPUA 3VXNB 3PNWA 3QFDA 5KOMC 4OLWH 5HHMB 3ZM8A 3AG3B 1RH8A 1F2JA 3APTA 4WSHA 1GVEA 3SY1A 3QZEA 5BMFH 3PFUA 4N22A 4C6OA 4IGBC 5ISZE 4PJGA 1BYBA 1UZ6F 5A6KA 5CF3A 2YD6A 2HK1A 1CFNB 5DTFA 3W0WE 2DUZA 1JUKA 3IDXL 3ILQC 4AC1X 1S78C 2P5PA 2NY0D 3W25A 4MY9A 2OXGB 1YYLH 1E1CA 3FL7A 4JDTL 4G82A 1WHPA 1EO8L 4Y6GA 3OYXA 3KW8A 2QDDA 3AIUA 1UPPA 3GH7A 1MHEA 4P9HC 1L6WA 1A4CA 4YLBA 3W07A 1CYGA 4REQA 2ZWSA 2ZZ2A 3VSTA 2I7GA 5KG9B 3EOEA 1OIFA 5DJAB 1PY0A 1KFCA 4XVUC 3PAUA 2RDTA 5ICYB 3V6FB 3K6FA 4S1RH 2HT2C 1OWQA 3IB4A 4JIIX 4TNVF 4WQOA 5FLVA 3SYCA 2FZMA 4WNSA 3H54A 1S9YB 4JM4H 4AHOA 2FQIA 2AJZB 3UAFA 5E24E 3RCYA 3BWAB 1VGKB 1I8MB 3KOYA 4WDIA 1XGUA 1Y6MR 2V5SA 1W9PA 1M6OB 2GZXA 1U3HC 4NQEB 1CN4A 4DJEA 3UWEA 1S2EA 3BW3A 3OVQA 1MI5B 2DH3A 1EJXC 5H37A 4PFEA 4RZCA 2RH9A 5E8OA 4NQDB 3EBAA 1EBHA 5T8IA 1I7RB 3BW4A 5BVPH 2PLMA 3QKZA 2IAAC 4JJOA 3MO4A 1EFXB 5FJIA 1W0MA 2C3VA 3GSOB 1NBVH 3BAKA 3U2ZA 2FSEA 4LOEA 2KQNA 1F6AA 5FB8B 2KLTA 2EC9U 2WPBA 4A2FA 3W9EA 3FT1A 4LUTB 2B9BA 1X96A 5CZSA 1WAEA 1E6JL 1R7AA 2NSXA 3LKSB 4N4QA 5J6HB 3N18A 4FF5A 5SWUA 3S1XA 4P57A 5C7VA 2FCBA 4NYLA 4GYJA 1GHRA 4YHMH 3QYSA 1XMEB 1N9PA 1KM5A 4KROB 4IDJL 1DIEA 1UWEH 3KYKH 2EUXA 3FB5B 1K7EA 2P3ZA 4F27A 3WQGA 4OZFH 4X9SA 2E47A 5FV1L 1QNZH 1C16A 3RCMA 1MEIA 1W5PA 3ARZA 3L4XA 3S88H 4YHIA 2YDAA 4YVUA 3OG4B 5I6SA 1G7LB 2OG9A 1CF8L 2ZWLT 4AWTA 2ZXCA 3HS0A 4HOXA 4FR6A 5GSRB 3TEWA 1VPXA 4HIBA 3BCDA 3FCSB 5GS1C 2YD1A 5E8DL 2VEPA 32C2B 5DUPH 4HD5A 2XZQL 4NSKB 1GYCA 4XXWA 2CBJA 2ZXGA 3BKYL 4QWWC 1HGWA 2CESA 3KFTA 2VZSA 3LRSB 2CRIA 4KZCA 4FTVB 4XTDA 4PTUA 2GJNA 2WCSA 2NYYD 3AT0A 2R4SH 5HDRA 2CAKA 5FYJH 5JH2A 1HWGB 1VD6A 2I9EA 2VXNA 1JVNA 5FA4A 3CVDA 3TA3A 3X13B 2UZIH 1CDHA 2B16A 5K3VA 4M8QB 4EAEA 4CNIB 2PDHA 2HH0H 3HHSA 1PZBA 4D8LA 3QT2A 1MFBH 5FWRA 1MNSA 1U42A 2OMZB 5GRXG 3EDFA 3ARDA 3N43F 4PV8B 3CHOA 2Q6WB 4IYKA 5B3JE 3PNUA 4BK5C 1YPZA 1EC8A 4RV8A 3C6EA 3HVDA 1HH6A 4EN3C 2OQYA 3DIVA 1ZLUH 5IMLB 3ZQWA 4JDVA 5KBPA 4NDMB 1HSBA 4LLWA 4ZMOA 5C09E 3MSRA 2O5YL 1YN7A 5D71H 2WBGA 3VQMA 2BS9A 2VLRE 4H8HA 1N5AB 2JB6A 3SECA 4ODWB 4AITA 1DOSA 3A6BH 4NNYB 4OKDA 3HN3A 5DURD 3P30H 3TSBA 4FNPA 5JIKA 2Y23A 5HVHB 3BN9C 5I6KA 5IMKB 2PD5A 1SFHA 3MCLH 4JPIA 2V4LA 2JKJA 4L3ED 5AYYA 2VWTA 1NFDE 3VDAA 4Y2LA 2QAPA 3NWRA 5T3XL 2ACRA 3RDTD 1TVLA 3MRGB 3ILDA 1IF2A 1TJXA 2CJUL 1V27A 4KOCA 4Y7OC 3CFDB 1HK6A 3HM7A 4FXTA 5GPRA 3W6LA 3QO1B 4OFIA 3BP4A 3KJ6L 1G0XA 1FP9A 1QNPA 3RWDB 5FDWB 3WNNA 3ARGB 4IBUA 2JKEA 2AGJL 4I2XE 3CXOA 5CPNA 2GJ6A 1DQVA 3SSZA 4XWGH 3AISA 4HTBA 2J8TA 3NJ3A 3S47A 2ERJC 2J57A 4D6FA 2VLMD 3N41B 1T4WA 5JO5B 4AB4A 1BXXA 1E9OB 2NY5H 1AZ2A 1E5AA 1M4KA 5F70A 3B9NA 4KKLC 1JE6A 1ZAJA 3VPLA 1BF5A 2VI0A 1UZ6E 1DFBL 1W9UA 4C65A 4K71C 2RJMA 5K9JL 4XBPB 2ROYA 5CLZA 3ELAT 3W57A 1NAMA 3OHMB 1XF2A 1PSCA 3KHDA 2AEQL 4NBZB 1BF2A 3UABA 2NNAB 3W6MA 3NZ1A 2B1HH 2DY2A 1VEPA 3L67A 4DZ5A 3EH2A 4CMHC 5AAMC 3D2UB 3CZLA 1U58A 3Q58A 1MXSA 4BKNA 3UWZA 3M0MA 4ZB0A 5EOCJ 4MNGE 2HLFC 4IBYA 1MVFA 4D0DB 1BOGA 4A2EA 2ODOA 2DF3A 5T1KA 5EU3B 3VCNA 5FO7B 2MANA 4FXGA 1UG6A 2X6VA 1YY8A 2OPJA 4BSWB 5D7JD 4HU3A 1NOWA 4L18A 1BV8A 3NDZA 4PJAB 1XYCA 4EMZA 2H6PA 4D7PA 2F15A 4XN5A 5BOZG 4H5SA 4Y1AE 1AO7D 4LMQE 5TGBB 2WJZA 4MGGA 5LAXB 1Q9WB 4XD5A 1IUZA 3UPBA 2VABB 3W2KA 3LM3A 3L2MA 4QBXA 2XQ0A 3I4KA 5C2CA 5BMFL 3C2RA 1Q94A 1ENUA 1ONQB 5F6IB 4B53A 4HKBA 1N10A 4JHAH 3FFOA 4D3CH 4HCRH 1NC2A 1IGTB 3E38A 3BD4A 4ERSH 1RHHA 2A77H 1UQYA 2IQAA 3LSCA 3EZJB 1XR8A 3U6RB 3LGDA 1YYLL 2D9CA 2HFGH 3OMAB 4LB3A 4ACPA 5HHME 1T5XA 3KCPA 4PREA 1R24A 4ODUA 1JWMA 2F1BA 1LTXA 2VD9A 3QH3A 1BPVA 3W7CA 3OAZH 2JCWA 1ITXA 4K5OA 5SWSD 5C08B 1G7MA 3QCTL 4H00A 1T7YA 1UQSA 4XVJH 2YL8A 1OL0A 4S1RL 4U1SB 2HVKA 5CUSH 3IKCB 1H1YA 4XGZB 3WL9A 4QHMB 3EPMA 2AI0L 3T0BA 3L3OA 4OFYD 4ADTA 2NY0C 4M1RA 2BP8B 2NCMA 5ECUA 3ZDWA 2IDTA 4JO3H 3PTMA 4U5KA 1D2OA 5K9QI 4XB7A 1XH3B 3GC5A 4EPDC 4AG0A 2NY2B 3HG2A 3EB2A 4K3HA 3U1SH 4K1GA 3ZFHA 4FXJA 1DBJH 4WEVX 3LZRA 1RJQA 3SUSA 5IB2A 3IDMB 2VC5A 5BVPL 2E56A 4PJAF 3IUDA 3ZLQC 2GAZB 4PV1C 3V6OA 3P8IA 3DPBA 3S0CA 1G0DA 3T2OA 3WY2A 4AQAB 3VXOA 4GI6A 4MAYB 3GSRB 1NBVL 1KV7A 3QZBA 4Q33A 3MCKB 4U6TA 1A5SA 3USZA 1TPXC 4NM8H 4I5UA 2CKRA 5C8JA 3S2LA 3FU6A 3QGAC 4FEZA 4I6KA 2WB7A 1XLJA 4NQEE 3QEGL 4C57C 4I0PA 3W82A 1MI5E 1UZ4A 3ZYJA 3G5XB 2OFJA 3TBBA 4NQDE 4YHML 1OD7A 2V0AA 5D7LA 3C5ZA 3UXFA 1ZDSA 4JZJC 2OMVB 3BGMB 2IDSA 3KYKL 4M8VA 4Y4FA 1UXSB 3UADA 4R0LB 4EOWH 4JFVA 2UV3A 4YHYC 1WLHA 3QN3A 1QNZL 3P9WB 5BCAA 4DVBB 5JYLA 3MP5A 3P4OB 3S88L 2VDLH 2NX5A 3VAEA 3G1YA 4Y2DB 5E2WH 5LN8A 2Y2YA 3Q43A 4MUPA 4U1GC 1XLIA 3EGDA 1T1YA 2OXHA 3UGEA 43CAA 4NZRL 4LVHB 4WI0B 4DEUA 5DUPL 5DGRA 4CAGA 4H8WC 3WBXA 1G0YR 2VRAA 5HINA 2ZONA 3HIJA 3OP2A 4KQ3H 4UTFA 3SPGA 1KV8A 5DMLA 3CPLA 1FNAA 4GMSH 3BIBX 5FYJL 3NVQA 4UNIA 4KTGA 2LABA 3EYVA 4PMRA 3TNMA 1F45A 2UUDK 5DJ2A 1ZEAH 2ZYHA 2UZIL 4PJHB 3QUYB 5JPMB 5HUOA 1CLXA 1P6CA 3JWDC 4LKXA 5HNTA 2BS71 1VKXB 2V2CA 4FR1A 2K1MA 4IOTA 4IMLA 1A4MA 1GAFH 2IGTA 2ZYSA 1MFBL 1AMXA 1N8ZA 3FQUA 4DBWA 1D3HA 3SW6A 3IAPA 3AICA 4JQIH 5E99H 4G8AC 2RHEA 1T2JA 1RZFL 3QULB 4FTVE 3KVKA 3U6XA 3NURA 2YB1A 1FFPB 4IP5A 4ZPVB 4J4PA 3KEHA 3DTUB 3V5DB 1ZLVK 5MENA 1B6UA 4RGND 4OHQA 2NYYC 3FQRB 5HHQA 5TD4A 1URIA 5D71L 1CDBA 1K6AA 1XLDA 3GVQA 1XHGA 3O8AA 5DBTA 2FNWA 4DAGH 2X0YA 2NX1A 2KYIA 4K3JH 3LCGA 2YPLB 3A6BL 2DQUH 5D7IF 3TIDA 1Z0MA 4GIEA 5LIWX 2ARWA 3Q1SH 2KBGA 3SKMA 4Y4HB 3KMDA 4J2MA 1X9QA 3V4UH 3RB7A 1PLAA 2XU9A 3T09A 1OFBA 4JTJA 2PXYA 4IPNB 3VXSB 5JIIA 2E8YA 1REQB 2VXVH 5CP7A 1AKJB 3GMOA 1E9PA 5EC2B 1I7ZB 1S9WA 1X5ZA 3BLIA 4ZUTA 3TTQA 1XGYH 3B34A 2FL5B 1X6LA 3IAQA 4GW4B 3KGUA 4MMWA 4NKMA 3WO4C 2INEA 1SVCP 1UMLA 3UY8A 4DUXA 2XXGA 3FFCA 4V1DB 4YSTA 2GBVA 3B2VH 3MTWA 1I9IL 2AL2A 4HIEA 3CEPA 2WXQA 1ZT4B 3R8BB 1PZCA 4JHMA 3IARA 3ARFD 3GQFA 1KFJA 1BM7A 1P7KA 4YHOH 1XLGA 1TIUA 3IDIA 2NY5L 5B3NA 1R6WA 4IZGA 2XX0A 3V8CA 4HEME 4PJHF 3EO1B 1NWPA 3R8GA 4DP9X 4ENLA 4WFGE 4QHNA 4KESA 1I0BA 5DLCA 1VCVA 3BFOA 3OXSB 5DVMA 3RDTC 2ED8A 3FBKA 4PN6A 5HY9A 3U46B 3F01A 1E6NA 2DLTA 3JTBA 1HYRC 2E68A 4EEEA 3B04A 1SFSA 5HNNA 1N2RA 1NANI 3LEVL 2B1HL 3I74A 4RSVA 3M0JA 3BGFC 4DXKA 2FQEA 3TQ0A 5DA4A 4AQEB 2CITA 1JSYA 2HRGA 4JDEB 2OM5A 2EE6A 3W83A 4Q4QA 4GO9A 3TO2A 4KPHL 4BFKA 3R94A 2BOBA 1IXQA 1XF3B 2ZVRA 2C7UA 4B5XA 5HATA 4WJKB 3QO0A 1PF3A 2V9DA 2B7NA 1DDTA 5EZLB 3ZRSA 4W9ZA 4WO4D 4KV5F 3QDGD 3CAVA 4XI5D 2J13A 2QDEA 3OWEA 4FG2A 4FG6D 4OFVA 1K7XA 5JW4R 1KJ2A 1MZYA 3SBPA 4QIUA 1EXPA 4LVOC 5DZNA 1RUAL 3T6WA 4NO3B 1HCZA 5CEZD 4FQHB 2AOSA 1NBQA 3HS9A 1SDYA 2VQ4A 3C2AL 4CADA 3STLB 3UG8A 2G9KA 4G43A 4MA3B 5E7FA 3O15A 3I75B 4JHAL 2PWEA 1UC5A 4D3CL 1MEXH 4PJAE 4HCRL 2CUMA 3MV8B 2TYSA 1EGZA 4ERSL 1KBIA 2A77L 1ZXKA 3HAEH 3MT1A 5JHMA 4PCNA 5D7JC 4ELKA 1IM3A 2GVEA 4DWSD 2HFGL 3W1PA 1WWAX 4BQ3A 3IT8D 1T41A 3WUZA 1HHJB 4K7FA 5B1JC 4W86A 4S11A 4DF2A 4FA8A 3UYRH 3MRPB 1LEIB 5H2BA 4XMPH 3IPFA 3K13A 1JGDA 1XO8A 3DO3A 1M7OA 4XVJL 2PP3A 4LAKA 4KX9A 4L23A 2J1ZA 1AZZC 2WQUA 4OGZA 4APXB 5CUSL 5J56B 4KWVA 4KHTL 5FF0A 4IKNA 1UA7A 1X7TA 4I9WE 2JMRA 4K7PY 2CEQA 3ESPA 1JFQL 3CL6A 2ZOKB 1FRGH 3MVIA 3BXWA 3O07A 6PTDA 2NQLA 3E02A 1LO4L 1CR9H 4QPEA 4JO3L 1MCFA 2HE8A 1U8LB 1SJEA 5C08E 4JQ2A 3SUWA 5IQ7H 4AY8A 1E5CA 3PCYA 4B7LA 3U1SL 4F7EB 1AJZA 3S5ZA 3SJVD 3F5WB 5ICZB 3NEHA 5M95B 5AVWB 4TTGA 1AR1B 4XZLX 3SUUA 2YRZA 3TK7A 5D2VA 2JIXB 3APMA 2DAVA 2IPKB 1MPAH 4NN6B 5DFAA 1AW1A 3PJXA 3H2OA 1R0MA 2ILLA 3GIVB 3TH4T 1OCOB 3OKYA 2VR5A 3UAEA 1V3JA 1DQWA 5M3WA 5DS2A 4BFIA 2K4WA 3FFDA 2YAHA 1JUEA 1A3ZA 4B5EA 3XINA 2PP7A 1PV8A 3S3JA 3UDWC 3AUJA 5FW7A 1VDGA 3ABSA 4D6GA 2ISFA 1X3DA 3R7MA 3RX4A 1U8KB 1NANH 2X9WA 4XIMA 4MZ3A 3ECWA 3UG5A 4YDLB 1G1KA 2A5HA 2J4WH 1X38A 3O3EB 4K4KA 3ILPA 3PPSA 2QV2A 1T4KB 4XO5A 4EOWL 3GGWA 3H9SD 1XC4A 1I3GH 4P5UA 1W80A 3VACA 1RY0A 1RZ8A 4CA4A 1AZCA 1K9TA 4JKNA 5IB4A 4QTFA 4NN7C 1IL1B 1BVLA 4ENED 3PJTA 4KO9A 2VDLL 3SODB 4N3TA 1KDIA 1ZWIA 2EEFA 5E2WL 2ADIB 3V6ZB 3TVMB 4P5MB 1EVUA 1MWOA 4TN9A 5C9ZA 1C29A 3GVGA 2YYTA 2BY3A 4ZFCA 1DEEA 2V5TA 3PL6A 5J11B 2R24A 1QR7A 3ARQA 1XPGA 2FT7A 5G4EA 4GS7B 5C0ND 1OD9A 1JK9B 4KQ3L 3DJRA 3EOBA 4TM9A 1Z7JA 2HZHA 3QPQD 3IFPB 4GMSL 3KGTA 4GNVA 1XBVA 3S46A 5A43C 2I7SA 3ZDYB 4Z7WB 5CD3A 4JFDA 3UYOD 2DM4A 3SR7A 4HUXA 3BDYH 1VRDA 1FZKB 4PRHB 2NZ9D 2O6DA 4IOSD 4S0SD 3EJTA 1HVQA 1GAFL 4PEKA 1E70M 2BRQA 3OX8B 4J40A 2EYTB 5B38B 4JQIL 1OHLA 5E99L 2ZZ5A 1E4JA 5D1XB 1KV3A 5ENWB 2FH8A 2PF0A 1XGRB 3AYTA 1KIPA 3SE3C 1VEOA 2XJKA 1ZJIA 4MTVA 2YL5A 2E86A 3DN5A 3D4ZA 4KMQA 1SSDA 3CJPA 2DV0A 4KUZH 4MKSA 4RPPA 4NRZA 4G8FB 1B31A 4PJHE 2HCVA 4LFYA 2OYPA 4MPKA 5H37H 1YY9D 4CSPA 5KYYA 4DAGL 3VW3H 4K3JL 1FN4B 1MVUB 1J11A 4ZMTA 5F2FA 4MFEA 3CYJA 1WFUA 4M93C 3WF0A 4UU9A 1YLVA 1LBMA 4AISA 1YHPA 3V4UL 1T89A 3RJOA 2OZ0A 4ZO7A 3P7YA 2PYED 2VXVL 1IAIH 1TG7A 3MRHA 2Y1HA 4G80B 2YD2A 3DJTA 3OPZH 1XGYL 1TJ2A 5FI8A 3LM7A 3I6GB 4X9HA 3R8RA 3KDMA 2P8PB 2G0WA 4P9MH 2OGJA 3WS3B 3RVXD 5IFJA 4RGNC 3DV4B 4YLQT 1N4XH 3REWA 4YPGA 2OELA 2YPLE 1KM6A 3AWOA 1YNTA 4FQ2H 3MROB 4M5ZH 2XZ9A 2CG9X 3B2VL 3GSMA 4KV5E 1LORA 1KIRB 3V4VB 4KTEH 1DANT 3RL1A 4JKMA 4E5XA 3AS0A 3VXSE 3VFLA 3EH3B 3S42A 3O3RA 2IH9A 4MMZB 1UACH 1ZA6B 1OCWH 1F02I 3ZDYF 4Z7WF 3MNVB 4MKNA 3WDRA 1SOXA 4UAHA 3C86A 5PTDA 4JTKA 5DZ9A 1S3KH 4CKVX 1MNUH 1EANA 5DMNA 4V1DE 5BU9A 1NQBA 5B8CA 5CC5A 1TJMA 1DXEA 1BQSA 1O6SB 3BICA 3LG3A 3IDGB 1CDCA 3GLDA 1DUYA 4R7VA 2YBRA 3TV3H 3FTGB 5E6SB 4NP7A 3F05A 3TESA 3MUCA 1EGMA 4R7LA 3ARFC 3NR0A 4YN3A 4DI8A 3UYPB 4PGCA 2CYGA 3SY6A 4AY1A 1KD0A 4IICA 1H7XA 2OK0H 3HN8A 1U8HB 5KZCD 5D32A 5IY5B 4LU0A 1RH9A 3RLSA 2CDFA 1TPFA 4AUBA 4WO0A 2CERA 3C09C 4H6KA 1NQKA 1W3NA 2WLIA 3WMQA 2WO3B 4NQCB 3TKFA 4JFHE 2OSWA 2NV2A 1IQWL 1FA2A 3UPRA 5EGRA 3SCQA 4G5AA 3VUAA 5C6TH 1E8WA 1GGTA 3PABA 3FB8A 3QV6A 2GQ9A 2VXSH 1W0VB 4NAJA 3WLHA 3OR6B 3UBXI 2HWZL 4FXLA 4H20H 4KCUA 4XMKH 1XQLA 2IG2H 1JNLH 3KBPA 4L9LC 2COVD 4NUJA 5CGMA 4JDTH 1MEXL 4IGMA 4IM4A 1M9WA 4XBMA 5KYXA 5DRNB 4X4MA 5FM8A 1SU5A 5EFIB 4LNRB 4ZX6A 1E9IA 2PPFA 3PBMA 4WO4C 5IHZA 2F54A 4XI5C 3VIJA 2NDGA 3UYRL 3KPQB 1B3IA 4FG6C 3AIWA 3MDUA 4XMPL 2AEIT 2DH2A 1YAIA 2Y61A 4WGKA 1ADQA 3ARPA 4AYSA 3C6LB 3MSDA 4X3ZA 4LEBA 5CJQH 1EXUA 1CX9A 4A7VA 2R1XB 2IJ0C 5LBVA 5KYUA 2EAWA 3S96B 1K3IA 3VFSB 3MV8E 3D47A 2VNCA 3PWLB 3MW7A 2A4EA 2KI6A 4C7GA 4TMPA 5L0QC 3K71B 5C0EB 1FRGL 3AHYA 3QNXB 2W0UA 3G6JF 1U4FA 4OZ4A 3NYDA 4DWSC 4MVBD 1CR9L 1I1YA 1I2QA 3O0LA 4MDPA 4X8JB 3WBWA 2EIBA 4HPYH 4P2RA 4XPTH 1UD4A 2A6DB 3VWJB 2DSWA 2YK1H 3BP5B 2Q7YA 2Y69B 4TXVB 3IU3B 4Z1CA 2WXNA 2WMIA 2H4EA 4M1DH 2ALRA 4L8SB 4N8PA 4MDJA 1NAMH 5D1ZD 1YXYA 3L54A 4K3GA 5G2NA 1YTKA 4GJJA 4O2FB 2PO6B 2Y85A 4NZ3A 2YPKA 2PZ0A 1MPAL 3IJ8A 1H6TA 1L9NA 1TLKA 2E40A 4GC4A 1RBAA 1OKEA 4HUUB 4UNLA 3WD0A 4YHLH 2ZUQC 5DY3A 1R4XA 1DVJA 2WV8A 3C75A 3L1OL 4EDXA 3QHZL 2YA2A 1W9VA 3FUKA 4YSUA 3VTTA 3GBEA 5DWPA 4F57H 4GXFA 3FVMA 3BPOC 3EGSA 2GC4C 4G7VH 1XIJA 4D8OA 3KRSA 4MG4A 4N90E 4K9EC 5EH1A 3DKLA 2QLVB 2J4WL 5H6HA 1S46A 2G9HB 3QS2A 1UD8A 1HZKA 4AIZB 4JFQA 3O9WB 1I3GL 5JW4N 4YPJA 3PPCA 4W9JC 3O3DA 1CF8H 1SSGA 3QP3A 2JKAA 5EF3A 1RK1B 3UD6A 4RMTA 3WK0A 2VM9A 4AE1A 1TPH1 4GSXA 4XTIA 3P73B 1G4EA 4HLJA 5DK0A 1XLFA 1DJSA 5DQJA 3UMTA 2PCEA 5EZPA 1IGSA 4M6VA 4U1NA 4PFMA 5ICXB 1X7FA 1XB8A 4QRRB 3J2PA 3PPGA 1A9EA 5EMYA 3FTYA 4HKJA 1JCNA 3UAJD 2X4OA 2CIIB 4ZZ9A 4U1HA 1XR2A 3S2NA 3DV6A 1OF0A 3BZFB 3V7PA 5I0WA 2Y7QA 3BDYL 1NOUA 3QORB 2ZQ0A 1TTIA 1OCQA 4PRIA 4ENEC 1PTAA 5AVRB 2MMXA 5I23A 2FPYA 4DXVA 4PYHA 2G3XA 5A2KH 5F1SA 3C6CA 4G8TA 1BYPA 4RQQB 5KJ7E 1G9HA 4QYOA 2DMGA 3IXTA 3ULUF 2ALDA 3SCNA 2QUVA 4U6VH 3BKML 3QEZA 1MCPH 2XINA 2AL1A 2NVAA 1QR1B 5D7HA 3SE4A 3U30C 3ZDYE 4Z7WE 3VJ6B 5C0NC 4KUZL 1YEFH 3M5XA 1JRHL 3QPQC 4YFLF 4L3CA 4I0CC 1FH9A 2GJPA 3QUZA 1IT9H 3IE4A 5L8KB 3VW3L 4ALDA 5CILH 2R69A 4PM1A 5FA3B 2QFRA 4PGZA 2ISWA 1LRQA 1NCUA 2NZ9C 1LK3H 3QFJA 2F8VA 1AZBA 2YFOA 3WH7A 3D3VA 4J8QA 1EF3A 1ZE3C 1BKSA 4NIRA 4U3SA 2NXYD 1G9NH 2RQEA 1IAIL 3KPSE 1R7OA 4OZOA 5KZEA 4NZ1A 3WUGA 3AXKA 2CJUH 2E7LC 2VQ1B 1UXWB 2Q3RA 1F1DA 4P46D 1ADSA 5AEAA 3EZ8A 4XX1E 5IK3B 2OPCA 4YNGA 4P9ML 2N4IA 3TWYA 3MOQA 1O66A 3GIPA 4NQXB 4E41D 2R1PA 3WMBA 2VR6A 4FQ2L 4AVHA 3EJSA 1L2QA 1YY9C 3QIWA 4ZBCA 5HYQB 5EMMA 4MRCA 2GTWB 2GGIA 5IBXA 1WO2A 1GOXA 3OW1A 4KTEL 1NOFA 4OUUA 1UKPA 2AXFB 1R3LA 4FZ8H 3BVNA 1JUFA 3VGDA 2HPTA 1UACL 4RMVA 4CVXA 1DFBH 4V33A 1N19A 1M41A 4NENB 3S8GB 2QV5A 1QFEA 1WBYB 5HMEA 2ZA2A 1DVQA 3WF3A 1J0HA 4JY8A 4NP4H 5TJWK 1S3KL 1ZGLA 3GO1H 4A38A 5D93C 1YEYA 3WBEA 1MNUL 4Z0JA 3ECBA 1P2CB 3RVXC 2QQNH 1UROA 1ZP3A 3OHIA 4A22A 4HPNA 5KOVC 5I1LA 1A6AB 1ADWA 4BFFA 5I76A 5IFHH 4KRNA 3ZOAA 4RDBA 5DD6A 4BWUA 2C15A 4C1KA 5DHMC 4FJYA 3HG1D 5D8ZA 1LYXA 4JTUA 5FKAA 1KFKA 1UR4A 1VA9A 2QPDB 4E68A 3T65A 2Z0IA 2MEJB 5EKYA 1T04B 3UZXA 4IU3A 3UZWA 3BD3A 3D34A 4M7LL 3DDGA 1YE6A 4YYCA 5GGUB 1W2VA 1J86A 3PWPD 5DANA 4NQVA 2OK0L 1SQMA 5H8PA 3Q3GB 4KUCF 2YBUA 1A22B 4L4PA 5C71A 1E9LA 1KJVB 4BH7A 2HN7A 4CVZA 3OQ3B 3K6SA 3WNJA 1J10A 5AUMB 3VCLB 5C6TL 1JJUA 3OODA 2VXSL 2AXJA 3V36A 1FUYA 4WI3A 2VT0A 4CC0A 2F6UA 2YEVB 3UTSD 1HJQA 4H20L 1VZGA 4XMKL 2IG2L 1JNLL 2DWDA 5GGSY 2R0LH 3HB9A 1PKLA 3EMQA 3UBHA 3TONA 9RUBA 4EI5A 1ONEA 2XYLA 4MD0B 1NGXA 2PGWA 3VE0A 3DFHA 3E0IA 3QJAA 4JHWL 4NPYA 2EGZA 1RA0A 4NQCE 2VQTA 1TUXA 4WWKB 2BP0A 5LGXA 1TELA 2HP4A 2VX7A 4BRVA 3N14A 5JBFA 3W23A 2LFEA 1OP4A 3QCTH 1ZT1B 2EIZB 2DDQL 4YDJA 3LB0A 1CTNA 1FL3A 3HMXA 3L3HB 3LNFA 2UXVA 3DI1A 3SJNA 1P1VA 4B6ZA 2E6FA 1Q2RA 3I9GH 3H4WA 2OA9A 5CJQL 3TO4D 5LNSA 4DN1A 4Y19A 4CNUA 3SB3A 3T9PA 5I02A 2R2HB 2AI0H 3QAZC 1XYBA 4CEXC 3UJEA 3QRBA 3TFXA 2H5UA 1KBJA 2C79A 3GY1A 3RGVB 1R3RA 4LFHD 3O3BB 3RZWA 1NDMB 4KKPA 4AM0Q 1HHIA 1EA9C 1D3GA 4LVNB 1LLWA 4RFEB 2VRJA 4OZGA 5A8PA 2RBLA 4HPYL 3NRFA 4XPTL 2CZVA 3F00A 3UETA 2YK1L 2X16A 4YCOA 2BNUA 2NLIA 4M1DL 5DN1A 3F4NA 3N43B 1SBBA 4OUOA 5J6GA 1NAML 2BLEA 4GLRI 5HDLA 4JANB 2EVJA 4BKLB 2R39A 4LL1A 1CDGA 3WNIA 4A39A 3EAUA 3SDAA 1S3HA 2F1AA 1WK0A 5FOBB 1QO2A 3QEGH 4HIIA 1G67A 4HXBH 3DRTA 4YHLL 2WLHA 2EE9A 2ICES 1A9BB 2YWZA 2FAUA 2C16A 1B4KA 1QRNB 3QJQB 1MYRA 4MVBC 3HUJA 3LQZB 1EAQA 4X7TB 4FZIA 1OYCA 4F57L 4N6QA 1GOQA 4F2FA 1ZHNB 3FK4A 4YTQA 3B0PA 3MUUA 4ES9A 1LZOA 1E0UA 3PDDA 4G7VL 3ULUE 3RM8A 3M86A 1MFMA 4LLDB 5E4IA 1W8SA 2GY7B 3QV8A 3EJJX 5D1ZC 4PBVC 3DIFA 3VCCA 4YMZA 1N70A 1KJ2H 5LGYA 3QCVH 5T1DH 4HPXA 3M4HA 1AZVA 2VDKB 4FYTA 4G1KA 1XZ0B 3EOSA 1DJGA 3RM4A 4GX9A 1AQKL 4KKZA 5SWZA 4OD2B 1E5UI 3CSGA 4NZRH 1VF8A 3WOVA 2EIJB 2ZFAA 1SQ2N 4NHCH 1W1ZA 1G1CA 3AM8C 2V33A 3UTTD 4UTKA 1LXMA 1UP2A 1A0QH 3WNPA 4L37A 1HHHB 2TPSA 1OWRM 1BSIA 4NYYA 4N2KA 4HH9A 4B90A 2XACC 2X70A 1UG9A 2IDCA 3BSMA 2P44B 5IG7B 4DEWA 2VC7A 1ZLEA 3B2UD 1RHCA 4RFNB 1MQKH 4Q6IB 3MHGA 2YS4A 3WF2A 4JGDA 3QQDA 3E12A 3AW5A 3H3PH 2VMEA 2SEBA 4UV4L 4Q8TA 1MZZA 3IBEA 1BPLB 4HBKA 4O1DA 3BLKA 1ICTA 1RZFH 1GTFA 1QAWA 5BS0A 3WK1A 4L1BA 4H9TA 4Q89A 1H1ZA 4N2DA 4FA7B 4QRRE 4BUGA 2F68X 3V5KB 4U6VL 4FNUA 4U2ZA 1MCPL 3UJIH 3W24A 1OV8A 2J77A 4QOKB 2Q3ZA 2WXMA 4NKDA 2EPOA 1KY7A 4JFOA 1T2XA 3IS1X 2BC4A 2PUZA 1V79A 4Z7VB 5FM5M 5IT2H 1YEFL 1NC4A 4KRPB 2XTJD 5I17A 2WUCH 3UAJC 1E56A 3KLAA 1V5XA 3RA7H 3SGKC 4LQ1A 1IT9L 2PTTB 4N2EA 5L2KE 3N4AA 5CILL 1GIGL 3JW7A 4PGBB 4X50A 3S3BB 2ZDRA 1LK3L 5DXXA 5T1LB 4JNXA 3OQEA 1BZ7B 3AITA 4CD6A 3PF3A 2VEMA 2WXDM 3N55A 1MO0A 1DTUA 1G9NL 5HPOA 2XVGA 2BNRD 1DVXA 3WD5H 2R6OA 4P23A 3DOIA 4PV9A 4CJ1A 3VWKA 5D4IA 4ZI8A 2VC9A 2UY6A 1S7TA 3F6IA 5HANA 4BCEA 2WTOA 4GLRH 3MJ6A 1S1RA 2Z31D 1I9IH 3WIFB 4FSAA 4RX0A 4WW2C 2DFAA 2NNCA 1ID2A 3KPRA 3FRPA 1YEWA 5DJ6A 3QQNA 5FX3A 5AQ0A 3LDVA 4KVCH 2BTMA 2DIBA 1XR9B 5FFLA 2K9UA 4FZ8L 1EHKB 5J57B 4LPWA 4ZB2A 3RWEB 1VFBB 2Z0UA 2Y7DA 2NXYC 2HROA 1C9SA 3HN5A 3W7HA 4UQCA 3OBAA 3C5JA 4NP4L 4X2UA 4C6PA 4P46C 5BV7H 4ZVJA 3GO1L 3FKKA 2V6HA 2ASHA 4PJCA 3PWVA 2XXCB 2QQNL 3CFEB 2J7LA 1KIUA 5LIXX 3LEVH 4TQEL 1JHTB 2HFTA 4F33A 3P9MA 1O9WA 3DOSA 3GI8H 1I8LA 1A49A 2EKSB 3JTSB 4DPCX 5IFHL 2D31A 3VG0H 1QFWH 1LO5A 4KPHH 3ZTJG 4ODXB 4RNRA 3VINA 5HJLA 1O5XA 4I4WA 4JYDA 5LXXA 2ZUWA 2XTKA 3NESA 4FADA 4Z7VF 1A4KB 2KZKA 3NTCH 5ID1B 1A14H 2V9TA 4KY1H 4PJIA 2IH1A 1Q9OB 4A2GA 1KT2A 2TSAA 2CM6A 2Y7OA 3T8XB 5I73B 1KYOK 1YEDA 3QHFH 4A6YB 4WGHA 1TOXA 1CXFA 4LKCA 1XGPA 1H63A 2ZX6A 4E4PA 3K7UA 3A4JA 5ADOH 1IGFL 1RUAH 4X4YA 2IXQB 4KJYA 4WTXA 4PBWD 2PW1A 3RY6A 3OHXA 1UBSA 1LYQA 1GVOA 1SJHB 1J5TA 3AQUA 2EKJA 3C2AH 1NGZB 3EG9A 3U0PB 5CQ1A 3IRCA 3MMWA 4FL4B 2EDRA 5KYWA 3ESMA 3MNMA 3QF0A 1CTOA 4XP4H 2R0LL 5I2UA 1OF6A 2G75A 3CMJA 5DD3H 3WELA 1CD1A 3GSUB 3VFMA 5C2UB 4JL2A 1WGOA 2ZYFA 2EXSA 1JVKA 2WZ6A 3T0EA 4RDVA 4X0KA 3GLZA 4F8LA 4V1YA 4EPKA 1WC7B 1V6TA 3TCLB 3UTPD 3R0DA 4HCDA 4QRQB 5FL1A 1TA3A 4LYKA 2JKXA 3QHTC 1IEQA 3BZ4B 4BK9A 3L48A 3NQMA 3I9GL 4MYPA 4KHTH 2OB3A 1BF6A 1JFQH 4IGHA 1OG0A 4XQ6A 2HPIA 3P4NA 5T91A 3WMCA 1KB5B 5A8OA 4TTDD 2VGIA 4JFZH 4P4KB 5TDOB 2V3EA 1LO4H 3LGEA 4PJ9B 1L6ZA 5CHNB 1JPKA 3VI2A 3L16A 4GBXB 2R1NA 3H8AA 5F4WA 4XXDA 2DZBA 4BR1A 3NTYA 5IEHA 3ABZA 3R12A 3VXUA 3BTNA 2P5EB 3QJOA 3RRAA 3VABA 2F84A 4XWOD 1R5IB 1Z6KA 1J8HA 3G8EA 2WXFA 4YZWA 2XISA 3VFOA 3P0VH 2BZNA 2AV7B 3IMVA 3ASOB 1GONA 1E4HA 4C55A 2O9TA 1IR1A 2ISVA 3RFZA 1W1IE 3NZQA 1H50A 4K23H 4NILA 3WL1A 3FGCA 1Z9SB 5LA2A 2ZSWA 1BAFH 3LN4B 3TO4C 3UGXA 1IIGA 5DCBA 3MV9D 2UYLA 1QOPA 3FONA 4TTUA 1MJJB 4LLAA 1W1VA 4B4HA 1YQ2A 3BVTA 3CHRA 4PUKA 2XWDA 3MRQA 4W5ZA 3BK0A 2X1XR 4HXBL 5EDXA 2P76A 4U1JB 2WLMA 3SGJC 5D7IB 2BERA 1EAPA 2HJLB 2MOVA 3QEQD 3FQYA 3QWRA 3DTXA 2OOFA 1JK8A 3VFUA 4HZAA 1QWUA 4H9UA 4UTTA 5LBSA 4JB9H 4DI9A 4GIOA 4UTMA 3K4DA 3NJLA 2BVOB 4X83A 3SZ8A 4FN0A 5IJKA 5AW8B 2CU9A 3VFTB 1W3TA 3U2JA 1X4ZA 1P1ZB 4TX8A 3LLDA 1KJ2L 2V2TB 3QCVL 5T1DL 2DZEA 1MRDH 2BX7A 1XIDA 5EC1B 2CUHA 1OE3A 4HWNA 1AQ8A 4ORGB 1YTEA 3KHOA 1QRNE 3NJGA 4HUMB 2Y62A 3ZLFA 2BNQA 5DJYB 2QQKH 1PIGA 3MVSA 4NHCL 4C6NA 2WLLB 1BX2A 3UR8A 3EX2A 1UCWA 2A1WH 3QDJA 5J89A 1W1A1 3DHDA 1P7HL 1A0QL 3GDRA 1H49A 1ELSA 2Z64C 5KZDA 1P4BL 4ENZA 4PJ7B 1HKFA 3DO4A 3B9KA 4ZQKB 3RTQB 5HYJB 4KKQA 5IRPA 1H0DB 1L0PA 3ROLB 1MQKL 2EIKB 1E3ZA 3O6FA 1BKHA 1QLFA 3PTQA 4BK4A 1ZK9A 2P5WB 5ANMA 2J8OA 2X10A 4X6CA 3H3PL 4IGBB 2FDSA 1I8KA 2CLLA 1B3WA 1K8ZA 3BQUA 3S3PA 1QACA 5DK2A 2IMNA 4US5A 3T8MA 4GGHA 1EHLH 5TFSH 1JHLH 3GRWA 3PWJB 4RA3A 1HUVA 4ZQNA 4Y5VC 3ZUCA 1C5CH 1T21B 3UJIL 1JNHB 1I8JA 3QPKA 1GZGA 3IWVA 3KXFA 1KFLA 1LDPL 1CL7L 2K3TA 2ZD0A 3MUZ1 4MRBA 5IT2L 2GYIA 3WQPA 3R4RA 3IV8A 3B2UC 1YUHA 2WUCL 4FERA 2QR0A 3P4MA 3RA7L 2PP0A 4WOZA 4U6XA 4AKOA 2VR2A 5MKGB 4UI2A 5LJYH 3Q0HA 4N2MA 2EDDA 3CPGA 1ZGDA 4NZ8A 4OKVA 2A6JA 4EF8A 4J1UB 5DFVD 4R3SB 3GG0A 5F1UA 5EO9A 1FFNB 3QW9A 3P8JA 3FSWA 3UZJA 1P5UC 3DX6A 4WD0A 1CFVH 4NC2B 4QOKE 4YXKH 1S8DB 5C7HA 3PG9A 3WD5L 1CS6A 3TBSB 2IFGA 4ZQTA 2IDQA 4Z7VE 3AWGA 1U3HB 1TWWA 3MUHL 2OSLB 3IJLA 1X6UA 3EKGA 2H3NA 1L0XA 1JPGA 4K7YA 3MMEA 2YA1A 4HKXA 3CFKA 4Q4OA 1VB9A 2W65A 2AMGA 1EDTA 2XTJC 3LN9A 3FT0A 2WIMA 1WAWA 3CUPA 3P61A 3HURA 3E0LA 4RWYH 4XBJA 5CAKA 2G4FA 1I53A 4J3ZA 4U1IA 2FEJA 3U36B 3ITYA 2EUWA 4PJ7F 3N42B 2X2YA 4KVCL 1CG9B 2N0KA 3NCBB 4RDYA 5CIPA 1KGUA 3QI9D 1Z2KA 5HYSA 4MJMA 3MSPA 3LHZA 5DVOA 3PE9A 4JTTA 5EN2A 4KMTL 5GRVK 2V37A 5ENLA 2VEIA 3QC3A 2XG4A 4L48A 1ACZA 1Z1WA 5MERA 3RF9A 1PDYA 1EEZA 3MOAH 1M7UA 3I02A 2PAJA 4QRUA 1VFAB 4FNLH 5BV7L 3RWJB 1BQCA 1N8OE 2BSSB 3M46A 1NCWH 4PVNA 4NHUA 1MLBA 5FYKE 1KCLA 2VLLB 1KBPA 2Z31C 4URTB 3TS8A 4MJIA 3US0A 3GI8L 1IM9B 1MHCB 4ISVB 4OLZH 3VG0L 1QFWL 3NZ8B 3FQNA 5IROA 2V63A 4Z1YA 2BIHA 4PVBA 5C7ZA 3O8XD 4XCEB 4QE1A 3LPPA 2H90A 4M7JH 3NTCL 3T07A 1A14L 1JPFA 3ZU8A 4KY1L 5GS1B 1HU8A 3LEYL 2W63A 2X0SA 2YBTA 4IFKA 1DVUA 3L81A 1YMMB 3QHFL 4MSWA 5BRZD 4HJFA 3BE1L 3GMMA 4JW3A 1MQ8A 1IQWH 5KETA 5I79A 5ADOL 4EVZA 5IR1A 4H0HB 2FJSA 2YW4A 4WGVB 4KK9D 7PCYA 4PJBF 4F20A 1AH1A 2HWZH 5LGZA 2PF6A 1ZS8A 3GIQA 3JV0A 1CBJA 1BJ1H 3KYOA 3O6MH 4ZMLA 1S7SB 3F1QA 1MF2H 3QQXA 1A64A 2ADGA 4XP4L 3ZJAA 2R69H 1WZLA 5EPMA 4HLEA 1SXZA 2X4NA 5DD3L 4MJ2A 1ZXQA 4XRCA 3DMMD 1G7HB 4NB7A 1G6CA 2DWYA 2JJSC 3VVVA 2UZXA 4EN3B 1U95A 5EUKB 3LY0A 3N42F 1GSMA 1RZMA 1V0KA 2H1LM 1B3YA 4PUEA 1CWYA 3W02A 1HL4A 2OJEB 4Q8NA 3FAXA 1DQMH 1G9MC 3F4CA 1JRHI 1N8FA 2XH0A 3W81A 4ONOA 5J8OA 3RE0A 3BGAA 1AMYA 2XN9B 5C07B 3W2NA 1EIXA 4PRNA 3QZLA 2DBLL 2G3JA 3GPSA 3B8IA 4BFBD 1IILE 4DZ8B 3NCMA 5DEFB 1CPUA 4JFZL 2DI8A 3RNDA 3DARA 2HKAA 1DVFA 1AYRA 2R8SH 1LO2L 2EILB 2E5CA 3TUUA 4ZYKB 3I3BA 1IAII 5AKRA 2ZCGA 1C8YA 5D6DA 4UR7A 4YR6B 5I1KH 3P0VL 1BG4A 1EH9A 5JOPD 1QPXA 1H5YA 3SBRA 2WSRA 3KWVA 1XH0A 5C6PB 4K23L 2P45B 3DVGA 5CCKH 5HJ3A 5DDHA 4Z08A 4G8EB 4LSVH 1BAFL 3V4PA 5C2BH 1ISYA 4JZ5A 3WFBH 1T3FB 4NO2B 2B15A 4TQ8A 2BDNL 2Y6ZA 4W9HC 1F1GA 3H4GA 4TTDC 3L1OH 3QHZH 2ERJB 3HRZC 2P5EE 2CXEA 5CWSA 4X7EC 3QAQA 1UOZA 2IPJA 4L8DA 3OGRA 1OC6A 3MV7A 2VYRE 3QHNA 4NZTL 4K71B 5E6IA 3FQXB 1V6WA 4XWOC 1AHWC 4PWFA 4JB9L 2Z92A 2OKOA 3VNKA 4P49A 2RALA 3W2LA 3CH1A 4DUOA 4TOYH 3FHEA 1IAOB 2WBJA 1TPVA 1Z5LB 1PKQB 2GI7A 1QPNA 1FO0B 4CMHB 1TETH 1KTCA 2LLNA 1MRDL 1W6WA 1OGAA 4IU2B 2WMPA 1PX8A 5IQNA 3EX4A 5D7IE 4Z7UA 4B5VA 2QQKL 3D69A 2VWSA 4F5CE 3T8QA 2F2KA 3W1AA 2A1WL 3DROB 1HC1A 3FZUD 3E8VA 3OJDB 5FF6B 2R94A 4FIQA 3FB7A 1AW5A 3I6SA 1M3JA 1GK8A 3EO9H 2X4UB 3GBML 4UB9A 5D37A 5F0LB 3VU2A 3PM6A 4A63A 1QI2A 2PDJA 2QCEA 1EJVC 4ZO9A 1D9KD 5LNEA 2CBUA 3C9NA 1IAKB 1T7LA 1ZOXA 2AAAA 5C0JB 1AZRA 3KWXA 1ZVSB 1LJYA 1E9QB 4JBSA 3MJGX 4ZFQA 4WJEA 2AK4A 2D1ZA 5E08H 4GMTL 3U7AA 3JVGC 3T71A 1A3HA 5EF2A 1EHLL 3DUUB 5TFSL 4O11A 3BKMH 4XBGA 1DBBH 1MUWA 4DT2A 3CVCA 4N9BA 1JHLL 5IBTH 2BCKA 2OR8A 1U5VA 1FZOB 2B8OT 3TBTA 4PJ7E 1H8SA 3KPSB 1QSFB 3EB3A 5KANG 5HYJE 4AT6A 1C5CL 1QWHA 3TCEA 4ZQPA 2CHXA 1JRHH 3Q8EA 3VXRD 3LD5A 1PLCA 3LVTA 3WN5A 4HJUA 4CU8A 3ZMEA 2P5WE 1F6YA 1PVHA 3PP3K 2EABA 1Q6LA 1TWDA 3N04A 4NZ5A 4NQTA 2J7HA 1NWTA 1O1HA 4MB3A 3AXLA 5H35A 4AQ8C 2G3IA 1PZ1A 1F6KA 3PC0A 1KACB 2YQGA 2A85A 1KC7A 1H0GA 2NY0B 5CEWA 2AV1B 1CFVL 3LTPA 4OM0H 4YXKL 1ZENA 1ZSDA 5KSUA 2X2GA 2AQRA 3OA3A 3WEBA 2X4QB 4NAEA 1Q13A 4H2CA 2DN7A 1XL4A 4JQXA 4CNTA 5I3GA 4L4TA 1RLCL 3GXUB 2N7AA 5F7WC 4XZWA 4IOFD 4MXWL 3PHOA 4GNKB 3QSRA 3IGXA 4U28A 3ABQA 2YXVA 2VDIA 1UUNA 1OEZW 4C1NB 3SBFA 4P7QA 3ISWA 3MRCB 1UEYA 4J27A 5K9OB 3ETTA 4RWYL 3GIYA 3B2XA 2VL4A 1K8IA 4X6FB 5I16A 2FGWH 1KPVA 5E8NB 1JPST 2O56A 4Y90A 5C3IA 1TPXB 4KXDA 5DFVC 1MXGA 4C1LA 4O57A 1F3TA 4M6OH 4LEOA 1T0MB 3IFNL 1AY1H 1BZDA 2Z7WA 4FXRA 2ZOWA 4JUSA 2OQJA 1ZCRA 5B38G 4Y5XA 1BRLB 1AL8A 3WCZA 1RZKH 5D5MA 3KXQA 3MOAL 4LUIA 4KJWD 1JMZA 4LT7A 2BWDA 4FNLL 4WQ6A 3BQ5A 3ZW3A 4WK0B 2K6WA 3UZQB 1NCWL 1I1CA 4UM8A 4L65A 4JZJB 4C6MA 2YGVA 3F7VA 3G6JB 1AH4A 4KCWA 1FG2A 2CUAA 2CDGB 4ALAL 4GKZB 5KVDH 4XX1G 5TH2A 4BZ2A 3LKOA 4YHYB 4XKYB 1HL5A 4OLZL 3WYZA 3VOIA 3RXZA 4E0CA 1TYRA 4PB0H 5ACLA 1DJWA 2DPEA 1M05A 4M7LH 1UH2A 3T3MB 1HQTA 3QI9C 4M7JL 4XZUA 4HNLA 5T1MA 4U1GB 1TRDA 2GPZA 3RRXA 2GC7C 4LRIA 3NQEA 4C6FA 3AU6A 5LXVA 1E55A 3JR2A 2PETA 4AEHH 1QQDA 1UR3M 4XCNB 5EU7C 1OX6A 4MZRA 4QXVA 2N59A 4GVHA 5K39A 2RFXA 1ONWA 2JGYA 3DIDA 2NVDA 4BQCA 3LCXA 2Z1WA 3FTZA 1UH4A 2K0RA 1KO0A 4MHHG 2N0MA 1JGEA 2HUEA 1BMWA 2FB4H 4NC1C 5CZTA 3L9RA 1SMAA 1L8NA 3Q6GH 3GZAA 3O6ML 1UZ1A 2DIAA 1MF2L 1AQHA 4AZHA 3QUXA 3O8XC 2R69L 2FFCA 2DWEA 1YMME 1B4JH 4JHWH 2VM4A 2W79A 2XPGB 2PLTA 3AXXA 3TYEA 2JKRM 1TQSA 1NGWB 4F0SA 2R9RA 2PGEA 5A6BA 4QNEA 2R1WA 1SN5A 4D6CA 2DDQH 4AD2A 1UR9A 4K94C 3D0LB 3ULVD 4ODTH 4O10A 4HLZH 3VXQA 5K9KA 1QLRA 2Q5BA 2HWGA 3TJLA 3F83A 1J6OA 4KK9C 3UO8B 1DQML 3W00A 1BEYH 4YIQA 5CPMA 3OVUB 4NQQA 4POZD 5GS2H 1HQ4A 2H9GA 1E4IA 4EI6A 3GJFA 5TDNB 1TT6A 4MGXA 4RXGA 2DZWA 4EIUA 3CHXA 5FKPA 3UJFA 2K45A 4W9FC 4S2SA 2CZ5A 2GCYB 2C9VA 4GJIA 3V0WH 4L1HA 3ZJKA 3MRJA 2R8SL 3DMMC 5G55A 2R2EA 2C4FT 3V0SA 4M56A 4ZK8A 3ESVF 2E5EA 5EIIA 2VXQA 3ZKMD 3NSDA 2RGMA 3T3MF 1WX0A 3VD1A 4YBQD 3CQHA 1T83A 3SYOA 5I1KL 4GZ7A 3KOXA 2XN9E 5C07E 1QW8A 3WO4B 1SR9A 5KBDA 3VI4A 1LRTA 1JZ7A 1A2YB 1C8PA 4OECA 4ZTXA 5MP6H 4F8XA 3WQCA 3X1BA 5CCKL 4UXDA 1HI6A 1X9RA 4JZOB 4LSVL 5C2BL 1MFDL 1AODA 4TUOB 3WFBL 3OLGA 5J04A 2EG7A 5HD8D 5DURB 1FUNA 1MCHA 3I6KA 3FT4B 2IADB 1KTDA 2R4RH 5A8MA 5DHVB 3H2NA 1IEBA 4HNNA 4N8UA 4LAZA 5MEPB 5KS9A 3WN6A 2ICEC 4L3EB 1RLWA 2OTDA 1P0EA 1VHCA 3ARUA 1DQLH 3P93A 1GQIA 2HT3D 4AENA 4F9PA 1EB3A 3N4EA 5C7XH 2F8QA 3RDTB 2OX1A 1ZU8A 5HJXA 3STCA 1HP4A 1U8JB 1OBAA 2A6KA 3VXTB 3DG6A 4WLCA 1L9OA 1CB7B 1OTTD 4JRLA 4TOYL 5LIUX