3BAJA

Human pancreatic alpha-amylase in complex with nitrate and acarbose
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
total genus 172
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bajA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bajA01
2X09A 4J7RA 4B3LA 4CU6A 5A6SA 3L4UA 1MYRA 2WLZA 1DTUA 4J3TA 2CITA 5A6BD 1A47A 1ISXA 4HPGA 1KB3A 4PMOA 4MNLA 2X05A 9CGTA 2UY3A 3WUFA 4LX4A 3RIKA 1J0ZA 1BPLB 5A2BA 5BXSA 2WNWA 1HL8A 4PRWA 2BY1A 3CTTA 3WQ8A 2WSKA 3QHNA 1V0MA 4R27A 3WY1A 3AS3A 2E9BA 2CBUA 4UFJA 2J79A 3UERA 1VEPA 2JALA 3PZUA 4DM1A 2VCCA 1IZJA 1JG9A 1UZ4A 3MUIA 1CBGA 1V02E 1QWNA 3OLGA 3MUY1 1UQZA 3TTSA 4AEEA 4QP0A 2BY2A 4PTVA 1V6WA 3DX2A 1E4LA 1ZL1A 3PTMA 3AMGA 1TE1A 3GNPA 3DX1A 1ZBVA 2XM2A 3MUZ1 1R7AA 2VNCA 1UWQA 5D9PA 4GI8A 3O2LA 5TD4A 5A94A 4E2OA 1NOFA 3CIVA 5D4YA 2E8YA 1QPKA 4UOJA 3QHOA 3WDIA 3AYRA 3KWXA 4AIEA 2EPMX 4AD3A 2D23A 4DWSD 4H04A 1HVQA 1WP6A 5E70A 3UG5A 1W1PA 4W8LA 3TONA 4WIWA 2XYLA 5CGTA 3RCNA 4AMWA 4M81A 5DT7A 3ARQA 5CSYA 2GFTA 1GW1A 4J28A 1GNXA 2D0FA 3BLPX 2IXVA 4PMQA 3NYDA 3L4YA 4BA0A 1V3LA 1XHGA 1W9BM 4UQEA 1BGAA 3W26A 1V6YA 2EXOA 1UD5A 3S5YA 3VSTA 1GQKA 2CESA 4P7LA 1QBAA 3W81A 4M24A 3AIBA 1CXLA 2G3JA 4S3JA 1LF1A 1HT6A 5HPOA 2WWCA 1WPCA 5CGMA 3FAWA 1YHTA 2WMIA 3IJ9A 4CN1A 2OLHA 1WZMA 3EJSA 6CGTA 4H41A 4LGXA 2J7GA 5BROA 3W4RA 2EAEA 3UESA 1OIMA 2J8FA 4OZOA 4ZEPA 1GHRA 2PWEA 2X2HA 4ATLA 2XWDA 3A21A 1D3CA 3GH4A 5JBFA 2WYSA 3WNMA 3EJPA 3ZQ9A 4UFLA 3H54A 2F18A 2WM0A 3ARTA 2G3MA 2D73A 4TOQA 1HTYA 2YDRA 2XGBA 1TG7A 1ISVA 3LMYA 2E8ZA 4MNJA 4OUEA 3AYSA 1C8XA 3WDHA 1EIBA 1KR0A 2JIWA 4KRUA 4OBRA 4EK7A 1DWIM 4CD6A 3WNPA 3BLBA 4CVUA 2XFFA 1E4IA 4PMXA 2WMIB 3A47A 4DUVA 2GJRA 2YA1A 1QI0A 5D9NA 5CPSA 3WH6A 1GQLA 1VF8A 4Z2GA 1B9ZA 3W29A 3W38A 1H3GA 2OW6A 3FHAA 4JFWA 3ZT7A 1C92A 2J78A 1EHAA 1CXEA 2QPSA 1UHVA 4B9YA 2VX6A 3SCPA 3ZT6A 2PBOA 3ZR6A 4FLOA 4PTXA 3WF1A 1E6QM 4JFVA 1VBRA 2DT2A 3AMLA 5A6AA 4AZCA 1E70M 4CN6A 4JHZA 3BCFA 1EHNA 1VEMA 3VIFA 1OWQA 2YA2A 3ALGA 2X2IA 4PSPA 2ZXDA 2JEPA 3VIIA 1E6RA 4QAWA 1CGWA 1ECEA 3GDBA 1TA3A 1JDAA 2YFOA 2ZUTA 1NM9A 1W9UA 4PUEA 1HXJA 1HN1A 4YHGA 1HXKA 1V3HA 2D3NA 1IZKA 1ESWA 3CH9A 3UR7A 4AY1A 3CZSA 1HJXA 2DIJA 1GOOA 2QHAA 2WVTA 3WDJA 4UOZA 2VX7A 2YL5A 2EPLX 3WH8A 4ZXLA 2CETA 1XD1A 2ESCA 2XN2A 1V3KA 4MPKA 2EADA 1CIUA 1NH6A 4R5EA 3LX9A 3FHQA 2OSXA 4AMCA 4GI9A 1E6SM 4UNIA 4E4PA 5A95A 2ZX9A 4ATDA 3CUGA 4TUFA 1J0HA 3VGDA 4RL3A 4P7QA 4MNMA 4XV0A 5HOSA 4BQ3A 5JIWA 4EE9A 3SUWA 5DMYA 2A3HA 2CIPA 1JZ6A 1MW0A 1HJWA 4ZE4A 1W91A 2J4GA 2ZUWA 4P7OA 1MW3A 2O9PA 2E3ZA 1EGZA 4DUWA 1PX3A 4C7GA 2JEQA 3CHDA 2A3CA 4OIFA 4J27A 4TVUA 4YPJA 4MJ2A 3KZSA 2C0HA 4UZSA 3WD3A 1GOMA 4TTUA 2ZIDA 3GM8A 4GI6A 5I24A 1B3YA 1JZ2A 3AXIA 1BVNP 3CLWA 1D7FA 1HL9A 2XIBA 1HKKA 1MXGA 2WXDM 2BXZA 1AQ0A 1B3WA 2QMKA 1DWHM 3WIJA 1P6WA 4CUCA 1OD8A 5A6KA 1BSIA 2VR4A 2ZUSA 1B3VA 4D6IA 3A5VA 4GZJA 4W7UA 3PTQA 3OGVA 2F7PA 1UR4A 2E4TA 2WC4A 1M01A 1HP4A 4W85A 3EDKA 2OWWA 3OLDA 2X1IA 4CU7A 2W61A 3CMJA 4N0RA 3OGSA 3T08A 3AROA 1IV8A 3K8KA 1ODZA 2D20A 4XZWA 2PWGA 3BUQA 4KRTA 1JNDA 1W3HA 1KWKA 3ZIZA 1BVZA 2W63A 2XM1A 4CCEA 2AAAA 1UWIA 3MUAA 1TZ7A 3L4TA 3SUTA 5A8NA 3DHUA 2V3GA 1UH2A 4GZIA 1EOMA 3ALFA 1NARA 5I0DA 3WY3A 2WMFA 1E3ZA 3I3EA 3GNOA 2VOTA 2HISA 1UA3A 3VGFA 3CBWA 1XSKA 5I5RA 1FHLA 4LQ1A 1H1NA 3AOFA 3IAQA 4PUDA 2ZOXA 2VTFA 4HMEA 1R7OA 1JXKA 2Y8VA 3EJUA 3CZ8A 4H2CA 1UWUA 2PBGA 5M5DA 1J9YA 3VUPA 2E0PA 2AMGA 5F7UA 3BUDA 1E9LA 5JBDA 3VIHA 3GXNA 2VT0A 4MB3A 3VX1A 2OYMA 2WHLA 1JXJA 1OB0A 1NWSA 1UKOA 2WBGA 1RP9A 5IXEA 1Q6FA 3GZAA 1CXFA 3PZ9A 1JAEA 3OLEA 1LLOA 2BHUA 1W2PA 1LWHA 2IGTA 2GDVA 1UD6A 3PTKA 1K9TA 1CZ1A 4GQRA 1WB0A 3VD4A 3WH9A 3WMSA 3T0BA 1E56A 5BRQA 3IJ7A 2CERA 2EQDA 3EJRA 1QI2A 2FGLA 3AISA 3N15A 1K6AA 1BQCA 4HA4A 1XD0A 3WFLA 1QNRA 4PMUA 3GXTA 3WD0A 1QHZA 3CC1A 2PC8A 1E40A 1UYQA 3AJ7A 3CZGA 4DWSB 1HWWA 1C7SA 1WAWA 5DFAA 2BS9A 1GCYA 1QNQA 5IFPA 2FGZA 2V5DA 1R33A 4FLSA 2DSWA 2XG9A 5BXTA 2WKLA 4P7NA 3VX0A 3SCWA 4J3UA 2YBUA 3OIHA 5A8PA 3H53A 2EABA 3VDBA 5FD0A 5HNNA 2JE8A 1V08A 1JD7A 1FH9A 4NZJA 1AQHA 3N11A 4F9JA 3PN8A 1OM0A 4Q22A 3WL1A 4HPHA 3A24A 1XV8A 1UASA 2UY2A 3S2CA 3AIQA 1H11A 4LYPA 4LYQA 2YJQA 3M6DA 1ZB5A 4ACZB 5ABFA 1M53A 3VDCA 1AMYA 3N13A 1GQIA 5I23A 1PBGA 4BCEA 3MS8A 5BRPA 3HG4A 4AD4A 2NT0A 4B16A 4CCCA 4LXFA 1BYBA 1GOWA 2XSBA 5GQBA 3AS2A 4K68A 1JL8A 2J77A 4KGJA 4PMZA 3AI0A 4UFMA 2QPUA 3UG4A 2G4FA 4OOUA 1QHPA 5A6BA 1W3KA 3T2OA 2GK1B 4NRRA 1V3JA 1BHGA 4JFSA 3VO0A 5CQ1A 5ABGA 1GONA 4D6EA 4WJXA 1BFNA 5EFFA 1O7DC 3BCDA 2PWFA 5FIPA 3UR8A 4AISA 3UG3A 4UZUA 4W86A 1E6PA 2F8QA 3W28A 1JIBA 4WKFA 1EQCA 2FH8A 2W67A 3BVWA 4A3HA 3K8LA 1TFVA 2Z1KA 2ALWA 3PZGA 4GZEA 4BQ4A 1QW8A 2VURA 1D2KA 1GVYA 4D71A 1LL7A 2J47A 2ZUUA 4E8DA 3BVTA 4CVWA 3HJEA 3OB8A 3WEOA 1ISZA 1WZAA 3RM4A 1HP5A 4W8AA 4DO6A 2WZIA 2OSWA 3AS0A 4KH2A 5ECUA 3LPOA 5A3HA 2X8RA 3EDDA 3K46A 1J11A 2UY5A 1HVXA 2BVYA 2W91A 3FXYA 1MQQA 3NDZA 2VMFA 4PMDA 3A4XA 1WE5A 3GH7A 1VB9A 2J62A 1FH8A 1FHDA 4WF7A 2W4XA 3W27A 1UR9A 4F9DA 1QI3A 2XIIA 5EBAA 2OWXA 2DGAA 1OSEA 3VMOA 1QNPA 1UG6A 5CZKA 1W9PA 2HVMA 3AIVA 1UKTA 5E1QA 2J7FA 3ZJ6A 4FLRA 4TVDA 3VOCA 5CJ5A 1R85A 4J3SA 3VVGA 2WB5A 3T2PA 2CHOA 2F61A 4FNUA 2DIEA 1ISYA 1TQUA 2XVGA 3MSDA 4AWEA 2CPUA 5BXPA 4NZFA 4MNKA 2G3IA 3T09A 1WDRA 1CXKA 2XN1A 1JZ7A 1M7XA 3VSUA 3ARZA 3WENA 2F7OA 4D6CA 3VIJA 2DEPA 2C8NA 2XFYA 3MO4A 4W8BA 4LYRA 1KGWA 3O6AA 2CXGA 2WZHA 4GXPA 4WKHA 1JYNA 3SCVA 4AD0A 4MB5A 3ZOAA 1CGUA 1BAGA 2GJPA 3DC0A 2YDSA 3T2QA 4JIEA 1CLXA 3BAYA 2BV9A 2VZVA 1XYZA 4HA1A 1W1TA 1DHKA 3VGEA 2FDMA 5FOOA 4PYSA 3VILA 2D0HA 4Z2LA 1TMQA 1J0IA 1WKYA 4DWSC 4TVCA 4AZGA 1J0JA 1FH7A 1U2YA 5ABHA 3U57A 1OBAA 2EPNA 3WQ5A 1MVYA 3WEZA 1GPFA 4U5IA 3VD3A 1LL6A 3WUGA 3W6LA 4HP5A 4HZ8A 4CU8A 2NT1A 3GXFA 3W6MA 4DO5A 2GDUA 4OBSA 3M7SA 3T0AA 4NRSA 1BG4A 3B8SA 2V5CA 1JI2A 1I1XA 1LQ0A 1VFUA 1V0KA 1TQWA 2Y4SA 2XVNA 3HG3A 5E09A 1LG2A 1CTNA 5E0CA 4QDMA 4NX0A 5BCAA 1GJWA 1PZ3A 5A69A 1MW1A 3RPMA 1MFVA 3RJYA 1NWRA 1XCXA 1MQRA 3ZR5A 1JDDA 3ARSA 2OYLA 1V02A 3ARPA 1K9FA 2RGMA 4U5KA 1TQTA 3SCRA 2YL6A 2X2YA 2QLYA 2J7BA 1G01A 3VMNA 1KXHA 1VFFA 1O7AA 3L4VA 3AIRA 1FFQA 3DX3A 3WH5A 4FF5A 3U5UA 3EBVA 2ZE0A 2F7QA 2Y5EA 5BXRA 2WC3A 3PZVA 1SMAA 3IGUA 4AIUA 3BVVA 1WDPA 4UQ9A 3A4WA 4U2YA 1CWYA 7CGTA 2X2JA 4CGTA 1UWSA 4GO8A 1ZU8A 3GXPA 3N18A 3L2MA 4EAMA 3BXWA 1B3ZA 1TA3B 3KLKA 1JZ4A 5A8QA 3ARYA 2AOSA 4H8VA 1SFSA 1NP2A 2ZX8A 4JKKA 4JKMA 4U33A 5LYRA 4BQ5A 5BWFA 4XX6A 4FNSA 1Y7VA 4MB4A 1VJZA 1GUVA 3MANA 4D1IA 2WW5A 2QV4A 3BUIA 3VTRA 1LG1A 2W5FA 1FP8A 4AD1A 4HA3A 1ZJAA 4WKAA 1JF6A 1UR2A 1KXVA 3KL3A 2YOCA 2WVSA 3QOKA 4JKLA 3ARVA 2EACA 4ML4A 1OT1A 3CZJA 3CZNA 3DX4A 3L4WA 2YLLA 3LXBA 1PAMA 1J10A 2D0GA 4MJ4A 1E0VA 4FNPA 5DEZA 2DDXA 1W9VA 2DSZA 3CO4A 3VDAA 3O9NA 3GH5A 1J18A 5HDRA 4JCMA 4AC1X 4EKJA 1I75A 2G8ZA 3EMQA 3BUBA 3S6TA 4PTWA 3GBDA 5CPTA 1KCLA 1G9HA 4P7RA 4E8CA 1PZ2A 4FNRA 4IPLA 1UKQA 1W9XA 3K8MA 3VIMA 1E43A 3WQ4A 3F4VA 3AMDA 1C8YA 2J7EA 4JAWA 5BYWA 2J74A 3CZKA 4CD8A 2ZX5A 4AZBA 5FKYA 1MXDA 2E9LA 3WF0A 1TQVA 4GPNA 3B9DA 2XHYA 3KL0A 3D3AA 3ZM8A 2F1AA 1SR0A 3DECA 4PMYA 1QNSA 2W66A 3HN3A 2PWHA 3BH4A 5A8MA 4W87A 2OW7A 2DPEA 3AHYA 3SCNA 4GKLA 1VFMA 4UFHA 5EMYA 3LPPA 4PMRA 1CGTA 4JHOA 4MAVA 3SCQA 1KGXA 3N9KA 1CYGA 4HZ7A 1JDCA 4WSJA 2OYKA 3WN6A 3MMDA 4ZE5A 4WSKA 2O9OA 1PS3A 4H7VA 1EOKA 1KBBA 2XTKA 3VKKA 2X0YA 3RM9A 1V6XA 2WCAA 3WY2A 3ZO9A 4QFUA 4AIOA 3UETA 4ACZA 4AZ5A 1F4HA 4RE2A 1VJSA 1C8QA 2WCGA 1DWFM 1NWTA 3KLLA 3CHFA 3LPGA 3PZQA 2WANA 4UFKA 2DT3A 3SURA 2B31A 4AZCB 4TX8A 3WF2A 4HOZA 4B9ZA 2IUZA 4M29A 1E3XA 3GTNA 1CNVA 4J3XA 1J12A 3WUEA 5C71A 4P8XA 4AZIA 2PB1A 2YBTA 5CLWA 2XPKA 3F5LA 3WQWA 4RE4A 5DT5A 3ZJ8A 4AMXA 1US2A 3SIMA 4GQQA 1TVPA 1R46A 1PIGA 1XGZA 3HZ3A 2GSJA 5A1AA 2J7CA 2WVVA 4JFTA 3WMBA 1CGYA 1GHSA 5D8WA 4MDPA 3EMCA 1JYWA 3LRLA 3FW6A 4UQBA 1FFRA 3GXMA 4P8WA 5ABEA 1KBKA 4P8VA 4MB1A 1E6XM 3SUVA 8A3HA 1B30A 1JZ8A 1BG9A 4QCFA 1FP9A 1VEOA 5E0FA 4PN2A 1XH2A 4BS0A 3WBAA 3VMPA 4JCLA 3UEQA 3IJ8A 1KXTA 4UOQA 3VINA 3GXIA 2WHJA 4IUGA 1NOUA 4NXKA 4FNTA 3RILA 2F2HA 1Z32X 3WY4A 5I3DA 1CLVA 1CPUA 4W88A 3PZOA 1OT2A 3S5ZA 4B3KA 5AC5A 2YKKA 3WEMA 4U3AA 3WSUA 4Z2HA 1W3JA 2F7RA 3D5HA 4CCDA 3A4AA 4AD2A 3D4ZA 3SCUA 8CGTA 3BSGA 5LA2A 2ZWYA 4UQDA 3APGA 2C7FA 2EO7A 3F5KA 3N12A 3WNKA 4BZYA 3NDYA 2XJ7A 3EDFA 3BVUA 3W0KA 4CKQA 3VD9A 4TTGA 3QOMA 3VNYA 1VFOA 4HOXA 3BAIA 3CGTA 1XYFA 1ZBWA 3EDEA 2ZWZA 4MAZA 1W2VA 2JFEX 4UQAA 1XC6A 4CN4A 1C91A 1EH9A 3BGAA 3WKZA 4OKDA 4TX6A 4PMNA 3NIYA 4NF7A 4C7DA 3OGRA 3EJQA 2VCBA 5A2CA 1W1VA 1PX8A 1CXIA 1UD2A 4NI3A 3ZT5A 2O9TA 2Q8XA 1R8LA 4YHEA 1Q4NX 3DX0A 3MSGA 1E4NA 2CKRA 1E6ZA 1H4PA 3L4ZA 1UQYA 4AEFA 3D4YA 5GNZA 3T0DA 2WVVB 2FHCA 1E6NA 2CCRA 2XUCA 1DWAM 3BAJA 3WF3A 4GIAA 5I77A 2CYGA 4OOZA 1C93A 1KFWA 1H5VA 3A23A 2ZX7A 1KXQA 3TV8A 2CBJA 3ECQA 1VBUA 3WUBA 5KZ6A 3VSVA 3WELA 3FY1A 1R87A 4B15A 4BF7A 1Q6CA 3J7HA 1JFXA 2D2OA 2V38A 5AC4A 2WHKA 5A6JA 1G94A 1GZJA 1HNYA 2VZOA 3VIKA 3U7VA 5D8ZA 3TP4A 1CGXA 3DDFA 4D1JA 4XB3A 4U3CA 2XFRA 2TAAA 2EPOA 2G3NA 5AY7A 1VRXA 1UOKA 1H0GA 2YFNA 2VZUA 2BY0A 1E71M 4D6GA 4W89A 1R86A 4U31A 3WNLA 3WD2A 3OLIA 3ZSTA 1UKPA 4QLLA 4BQ2A 4U2ZA 6TAAA 1HKJA 1J0YA 4JL1A 4V28A 4MDOA 3NCOA 1UD8A 3W82A 1FOBA 3FNDA 3G6LA 1JGIA 1QX1A 4JL2A 1EXPA 1DEDA 1WZKA 4HMCA 2VQUA 5GNXA 3U5YA 3E1F1 3VGHA 1CDGA 2J75A 3A3HA 1B1YA 3D52A 1G5AA 3M46A 3AZRA 2RGLA 4X9YA 3PZIA 2GVYA 4HZ6A 3OZPA 1TCMA 1GOKA 3N04A 1SZNA 3ARXA 4HMDA 1WDSA 3QR3A 2BFGA 3BC9A 3GNRA 1OGSA 1C7TA 2ZX6A 3VIPA 5M3WA 1QNOA 1PX4A 5CSUA 1XRVA 4URIA 1E72M 2DH2A 4HU8A 3D51A 2DSKA 5E9AA 5AYBA 4AYGA 4UCFA 4M56A 1KR1A 2WHMA 3AHVA 2ZICA 5EFDA 1BF2A 3RMEA 1HF6A 2VZSA 2VO5A 4AZ6A 2WLYA 3HG2A 4WLCA 1EO7A 1BLIA 2WC7A 1V6VA 1XSIA 2WPGA 5JIPA 1R34A 1W32A 1FA2A 2UY4A 3MKKA 3A6OA 4EANA 3EYPA 1ISWA 1QOXA 3POHA 3KEHA 2VZTA 3BAWA 1G0CA 3WL0A 1UD3A 3AMKA 4M8UA 1JZ5A 1TR1A 1U33A 4PCSA 1L8NA 1UA7A 1PEZA 3MMUA 4L4OA 3A22A 1UWRA 3ZSSA 4ZFMA 3VIOA 2YIHA 2ZXAA 5M03A 1KCKA 2QF8A 1ODUA 3EMZA 5IHSA 1WNOA 5DO8A 5IDIA 4HU0A 1ZBKA 2Z1SA 4Y7EA 5LA0A 1DWJM 3BVXA 4FMVA 1OIFA 1LWJA 5ABFB 1PJ9A 1NQ6A 2A3AA 4W5ZA 4GO9A 3WQVA 2XN0A 3POCA 2FHFA 1GVIA 3AICA 3AIEA 3LRKA 1KTCA 3AHXA 1OD0A 2OWCA 1CXHA 2W62A 4MTVA 1B31A 1E0WA 3SCOA 2D1ZA 1ZS2A 3HU7A 1UKSA 6A3HA 2O9RA 3SCSA 1TUXA 1HKMA 4D6DA 4UTFA 2WAGA 2VX4A 1WZLA 4ZENA 1JI1A 1W3LA 1E5NA 1UZ1A 3VPLA 4Z2JA 3SCTA 3WNNA 2BVTA 3MU7A 2Y24A 3VM5A 5EB8A 3TOPA 5HPCA 2F1BA 3AXXA 1OGBA 2WMHA 1US3A 3AIWA 1JZ3A 1EO5A 3WH7A 1V0LA 3WF4A 3VGGA 4DUXA 3G6MA 1MQPA 3NJ3A 1BYAA 3W24A 4A4AA 3PZMA 3TTQA 5E6ZA 1B2YA 3B9AA 2D24A 2DQXA 5I78A 2GJXA 3LXAA 2DT1A 1OCQA 3UCQA 4UFIA 4D6FA 3CZEA 3B9EA 1T0OA 1JFHA 1E5JA 2CBVA 1LL4A 3THDA 3IK2A 3CUHA 4X0VA 3NSXA 1MW2A 2EEXA 2JF6A 7TAAA 3M07A 1JD9A 4W93A 4IPNB 1B0IA 1HJSA 1C3FA 3MI6A 2VX5A 3GYCA 1UR1A 1E15A 4N42A 2GUYA 2V3FA 2WKGA 2CNCA 3PZNA 3OG2A 2VCAA 2FYVA 1G1YA 2FH6A 3OZOA 1IT0A 4F8XA 1SMDA 1BTCA 1HJUA 3VD7A 1J01A 4PMVA 2J7HA 3RDKA 4Q7NA 5A6LA 1E0XA 1VAHA 5HXMA 3II1A 5CLTA 2WK2A 3W53A 1KQYA 2PWDA 3WQ6A 5IFTA 3L4XA 1H49A 4WK9A 5HBFA 1UR8A 3GXDA 3D50A 3WNOA 3DYOA 4F66A 3WFZA 1S46A 2JF7A 4AYSA 3CUJA 1HKIA 5A8OA 2VUYA 3JUGA 1E73M 5D9OA 3SEPA 1U30A 3ZJKA 1E1FA 3ARUA 1JYXA 1X1NA 4DWSA 1JF5A 2ZXQA 3H55A 2CEQA 3CHCA 4V2XA 3BMVA 5KEZA 3BAXA 2VL4A 1WDQA 1X6NA 4C7FA 1K9DA 1UD4A 2E40A 5CXPA 2GJXB 2BXYA 1GJUA 2MANA 1WO2A 1V3IA 4AD5A 1HJQA 2EPKX 4AZHA 2VRKA 1EDGA 1NWUA 2PF0A 2BHYA 3W37A 2VC9A 5GNYA 3SUSA 2YDQA 2YA0A 4FNQA 1GQJA 2DSUA 2WBKA 4XUYA 2CKSA 1CEOA 3ARWA 3AHZA 4PCTA 5FCZA 1TVNA 4IM4A 2FE0A 5C70A 4XZBA 2UWFA 1QW9A 3LXCA 1C90A 1E1EA 3CUIA 3F5JA 4X0NA 5C8BB 4CD4A 4Z2KA 1JNEA 3RO8A 4S3KA 1WCGA 1ZBCA 3TA9A 3BAKA 3VNZA 2VQTA 1ITCA 2O92A 4QLJA 1V3MA 3K4DA 3BMWA 2PI6A 1Q6EA 3PHAA 1V03A 2J7DA 3DYPA 3IANA 1RPKA 1KWGA 1SYTA 2DSVA 4P8UA 1ITXA 1QI5A 1EQPA 2G41A 1KGUA 4KGLA 3K1DA 4QCEA 2BY3A 2ZUVA 1B3XA 2WZEA 5I79A 2WVUA 1EDTA 4Z2IA 2DH3A 2VRQA 4W7WA 2D22A 2A3EA 4F79A 1NOWA 4PBGA 1HX0A 2CBIA 4KWUA 1EDQA 1DWGM 1A3HA 3NSMA 5FL0A 3U7BA 4J3WA 4ACYA 5I2UA 3AFBA 4UR9A 4FLQA 1QI4A 3L2LA 4PSRA 2WMGA 4NXSA 4W5UA 3AZTA 1NP0A 4MADA 4TXEA 4CD5A 3K4AA 5AYIA 2XVPA 3N17A 3LPFA 2NW0A 3HG5A 2IXUA 1UR0A 3I3BA 3KE0A 4RE3A 2NSXA 4NSBA 1PPIA 1VIWA 3PBGA 3VDHA 4DM2A 1R75A 1XH0A 2BHZA 2CHNA 1F4AA 1MWOA 4FK9A 3WD1A 1H2JA 3I3DA 4H8UA 4D72A 1H0IA 3IAPA 3TTOA 1AQMA 4M80A 1DP0A 2YL9A 4J3VA 1W1YA 3PZTA 2XVLA 1TQSA 2X0HA 4KMQA 3CV5A 1BYDA 2WCSA 3HMCA 3SUUA 2E9MA 1M04A 2XGIA 1MFUA 3TTYA 1QHOA 1N82A 5M17A 3VU2A 1JAKA 3CZLA 3MV11 1AVAA 2WWDA 1K9EA 1I1WA 1H09A 1OGGA 1HJVA 2EJ1A 1Q6DA 4HTYA 4UQCA 3QGVA 3VGBA 2J8GA 2JIEA 3MMWA 1UWTA 3VIGA 1E55A 5JBEA 3KL5A 1KQZA 4LPCA 4D6JA 3AS1A 3NUKA 1O6IA 1QBBA 4OGZA 1L0PA 2FHBA 1RD6A 3THCA 4W7VA 3BLKA 3DHPA 5A2AA 1OINA 1YQ2A 1ZJBA 5D9MA 2BNJA 2ZUNA 2EBNA 4DO4A 3ARRA 2DT0A 1BGGA 2WMJA 5IHRA 3OBAA 1XSJA 2VVNA 3W25A 3GBEA 3AMCA 3FAXA 2W92A 2ZUMA 2VI0A 4JZ5A 4M82A 3LRMA 5CPQA 3DDGA 3CUFA 3WDRA 2Y2WA 1B90A 2BVDA 1XH1A 2VJXA 1UH4A 2WSPA 2Y8KA 1KTBA 4ATWA 3BUPA 3RM8A 4PTMA 2OSYA 3CMGA 5E6YA 1EA9C 4AXNA 4YN5A 2VVSA 4HOWA 3EDJA 1J0KA 4A3YA 4M1RA 3AZSA 4NZCA 2VRJA 2YL8A 5DF0A 4GINA 4CD7A 1M03A 1W9DM 2XWEA 1HIZA 4PEEA 2XSAA 3CPUA 4JFUA 3VD5A 5LA1A 4AW7A 1QVBA 1CENA 2J25A 4L4PA 2D3LA 1GORA 1JYVA 1UUQA 2V3EA 2QMJA 3ZJ7A 3AXHA 4AZ7A 1PIFA 4D6HA 1CGVA 4H8HA 3DYMA 1H41A 3VM7A 1Q6GA 3AQUA 3RJXA 3WMCA 1RP8A 5JUVA 3WBEA 2GK1A 3AHTA 3NSNA 1GOQA 2YLAA 1V6UA 2VR5A 3ZMRA 3FN9A 2V3DA 4W84A 3EJTA 4ZXOA 5I6SA 5CG0A 1VENA 7A3HA 4QLKA 1CECA 1X6LA 5FL1A 3WD4A 2A3BA 5A6MA 3WDPP 1UH3A 4V27A 3N1AA 1QWUA 1GOIA 1LJYA 3OA5A 3MV01 1V0NA 4OJYA 1R47A 3WDQA 5GPRA 2ZXBA 3AIUA 4IISA 1XCWA 3BSHA 3QHMA 1BYCA 3CHEA 2XVKA 1E4MM 2WMKA 1RH9A
chains in the Genus database with same CATH superfamily
1F58H 2X09A 3H3BC 4ADJA 3L4UA 4EPSA 1SYVA 2D7TH 2RHGA 5AOLA 4M61A 3VXRD 4HCRH 1A47A 4N5EC 5B8CC 3LB6C 4O4YH 5D1ZB 4ZW7A 1KB3A 1ISXA 1JWSB 4N2HA 3GMNA 2GUOA 4EZJA 4PMOA 1UVQB 9CGTA 5BO0D 3WUFA 5E2TL 4DN4L 3OC5A 2YLHA 4DVRL 3CFBB 3Q8FA 5DVMA 3U6RA 5C0NC 5C2UB 3Q45A 1CLZL 3KPSE 3QQ9C 4KJYB 1HOCB 3ARFD 1E9ZB 5IB3A 2V4LA 1KYUA 2E75C 4I5UA 1JQXA 2RKXA 4PREA 5HI4D 2BY1A 3CTTA 3V6BR 4F9PA 4ZO8A 5SV4A 2NQJA 3DVGB 3NAVA 1HXMA 1RJZB 2XN9E 3OJDB 3QISA 4Y9CA 4YHKH 5EBMA 3WY1A 4LAMA 5M2FX 3CIAA 1LRTA 4PTNA 3ARGA 3APCA 3MNMA 2Q8BL 4IK7A 2J79A 3V1PA 3VFSB 2V8MA 2PW2A 2CLVB 4UTAL 1A66A 2AJZA 2EH8L 2IH1B 4FKKA 3SODB 2AK4B 1SW0A 2JALA 3FSTA 5DMGC 2PR4L 2J6WA 3R0DA 5T1MB 15C8L 4Z0SA 3HVDA 1TKWA 4WUIA 3VXUE 3MUIA 3QEQA 1CBGA 1HHJB 1ULVA 2BLEA 3OLGA 4P2QD 3VRIB 2F54B 4AC2A 2FRGP 4TMBA 4AEEA 3EUUA 5DQDL 4QP0A 1TPXB 2Z7GA 5I1LB 4PR4A 3DX2A 1FDYA 3PTMA 3B8UA 2ZFAA 1YXDA 4Q6XA 5FDWB 1E1CB 2NRDA 2ZOUA 4ENLA 1TE1A 4MJZA 4S2CA 3MO1A 4C4UA 1KM1A 2VEGA 1HH6B 1KBGH 1RQHA 3PQYE 4PJ9C 5AC6A 3E2HB 2PYFB 3DTXA 5AKQA 1XGUB 3ZXWA 2W79A 3G1HA 2GZXA 2KS0A 4A66A 4EN2A 3UZQA 3FZUD 5FUOH 4Q8UA 1R7AA 2IFFL 2Y5QA 3U2EA 3I6KB 3QUYD 4GI8A 1A4MA 4M5YL 3O2LA 4GABA 4HEMA 1F90H 1GC1C 4ZPVB 4XWOC 1OFPA 1THFD 5D6DA 5JW5B 4TQHA 4LOUC 1KXTB 4X99B 1VBGA 3ANUA 4UOJA 2ZNWA 3TYGL 1WV2A 4DAGL 3L9CA 1PZ5A 3QHOA 5JHDA 1FWBC 1QWKA 4MMXB 4XZMX 1L6XA 1WCQA 2EPMX 3FRPB 1AD9A 1SXSA 3QPEA 4XNYL 4H04A 1HVQA 1WP6A 2FTPA 5FW8A 4YXHL 1O5KA 3O0FA 5C6TH 2BMKA 5IJBC 2RDXA 3V4BA 2B1HL 3E9UA 2XZCH 3SDDB 2CO6B 3RCNA 3GBLA 3OJDA 3WUWB 3S88H 5CSYA 3GINA 3P9MB 1QAWA 4QAMB 4EAEA 4N8VG 2O5YL 3MFGB 3AW5A 3L0KA 3BLPX 5FYLH 2CXEA 4HJWA 4JO8A 1NUDA 1AY1H 1BYOA 1V3LA 3Q1SH 5FYLE 4QJ4B 3HLAB 2WZTA 3MX0A 1NFIB 2EP6A 4R4BB 4DAFA 4ONOA 4X9FA 2VYOA 1H15B 1BGAA 4G1EB 4MNQE 3VRLF 3TXZA 1UD5A 4ZTPH 4X4XB 1QXLA 3QYMA 5JOPD 3D48R 3L2NA 1V7YA 1F86A 3FYOA 4NQVB 4Y2WA 1WFTA 1IMHC 3RTQB 1LXMA 1VESA 3KHQA 4KXZI 3VOIA 2OTDA 2YMXL 3NA9H 1QK2A 1U8KB 1P7TB 4OLYH 2HE5A 3VCRA 3KGSA 2DQCH 3NJVA 2XXGA 4LCIL 4Q8BA 1OQFA 2A9NL 2WJEA 5AC7A 3VH8A 1U3HA 5IZ7A 4MNGE 3N14A 2WWCA 1PTZA 3KR3H 4OW6A 3IKCB 3KRBA 3OKLB 4RNRA 5HGDB 3VGAB 4JOMA 2KPWA 2WMIA 2Y70A 4CN1A 3TFKC 5TE7L 4WV1C 5EZPA 1OLZA 2PLKA 5DCBA 3CN1A 2XICA 5H6HA 2ODHA 3GSWB 5BROA 1QKZL 2CGYA 4LDOB 1FWNA 2PGEA 1F4YH 2X1QA 4ZS6C 3PJTA 4PMEA 3FU5A 4XVTL 4Z23A 3DGDA 4TLTA 3F6IA 3DBPA 5AKTA 4L7ZA 5HA7A 1NGXB 3G5YA 1CT5A 1J2WA 2ILLA 4A7GF 1U0QA 4GJJA 2PWEA 3EJZD 3WBWA 4O02A 3MLTA 1D3CA 1ZXQA 3RVXD 1S5HB 1TCRA 2IQ9L 5HGAB 2MOGA 1CQYA 3FU6A 2PTXA 3H22A 1OX4A 5BU9A 5AVHA 4FSAA 2IXQB 4WY7L 5B7ZA 1TPB1 2O5NA 3MV8D 3CH8A 4ODXB 3MUXA 4YS1A 2WM0A 4N8VB 3ARTA 3D69A 4ES8A 1HSAA 2XBTA 2VDKB 3LS5L 3RNKB 3BDBA 3THML 4TSCL 2C1HA 3AB0B 2I5YL 2D73A 4IIQC 4MJ6A 2V2WB 3B4NA 2WXHA 4IKKA 4G5ZH 1R0AL 1W0WA 2HLAB 2J5LB 2PTVA 2Q7AA 3HURA 2WWMD 2XGBA 4HS8H 1ISVA 1YIXA 4FMKA 1ALDA 4MOZA 4OUEA 4UAHA 3JVFC 3AYSA 3KYKH 4KRPD 1EIBA 3HI5L 1KR0A 3LS4L 3D46A 4KRUA 1LOLA 4MY9A 4HV8B 1M2VB 2WKOF 4F27A 2XFGB 3D85D 4OVVA 4CVXB 4N3UA 1LBLA 1NMCB 3BKJH 3WJJA 2IOMA 3FRPA 4DKDC 1SO3A 1F0LA 4KZCA 1QOPA 2I7OA 2VISA 3N2MA 4LMQE 2OT0A 1KPUA 1H5YA 2BCKA 4CVUA 4Z3EA 4HNVA 2FVMA 3H2EA 5D2TA 3WQEA 2C4XA 2FNBA 4W9FC 1NDGA 3G5VA 4DJDD 2Y7NA 3A47A 4R8WH 4D9PA 2GJRA 5TK4A 2YA1A 3PAUA 4YK4B 5C08E 5C0CE 4BZ2A 7FABL 4ANUA 2JK2A 5DC9B 3KTSA 3SGDH 3VXUB 1F97A 1NAKL 5ICXA 4POCA 3OPZH 4W81A 5MERB 3UCCA 4C6LA 1H3GA 4IRJB 3FHAA 4E41E 2ZZ2A 3EYQD 3MLYL 3WKQA 3D05A 3QQ3B 4I0PA 2QJDA 3DARA 2Y85A 4PJBE 2J78A 2VDRL 1ZVYA 1PKOA 2QPSA 1UHVA 5IG7B 1NMBH 2ZRXA 4IEFB 2VX6A 2FBJL 3ME0B 4M7LL 4XP1H 5D7SH 3KLHC 3SYPA 2PBOA 2CJUH 1HHGA 3WK1A 4Z1YA 3WF1A 4KY2A 2H32B 2WN3A 4HJJH 5LHFA 5I6PA 3NDZE 5JHLH 4JHZA 2SODB 4N8VA 3O0LA 3VCLB 4CN6A 5GS1B 3UVIA 2B0MA 5LNUA 2DYSB 5D71H 1FN4A 5KBNC 1KB9J 4L5FH 3ZKNC 3QLDA 3PBWA 4OCXL 4UQ2A 1Q9WB 3FRUB 1T83A 4WK2B 4YHOL 4KQNA 3BP5B 5HULA 4QRSB 2YA2A 4K71C 1BQSA 2OZ4L 2X2IA 3FYIB 3LDBC 3ALGA 2JEPA 3VIIA 2ADGA 2JKJA 3HE6D 3NIGF 5GGRA 5C8JB 3IS0X 4XXCA 1OIOA 4TLSA 1CGWA 3UOAB 2O4MA 3GB6A 2DWTA 2GTQA 4YHLH 4DW2H 3IRCA 3T2NL 1QVOB 4QT5B 5EA0L 2ICWI 3NTCL 3VG0L 2Z92A 1PDYA 2X9XA 2G50A 3J2PA 1BYNA 1FGNH 3OP2A 1XIWA 2QQNH 3O41A 5EZJA 3GI9H 1J5HA 1RJYA 1EP3A 3GR7A 3OZMA 1G6RB 5CEYA 3VSQA 1FBAA 1NGXA 3G5YB 4NZRH 1XUUA 4PBDA 1HN1A 1XR8A 3T65B 4O02B 2W0UA 2XRAH 3IJDA 2DIAA 5FHAL 5DSCA 3CH9A 4AY1A 3CZSA 2DIJA 1DQTA 1OX4B 3GJEA 4O00A 4JM2D 4CADA 1KY7A 1MFAH 3D0LA 2Z9TA 3D0VB 3PWVB 3WDJA 2QHAA 5FSEC 5GS3A 1S7UA 3UIYA 4V1XA 3I50L 4N20A 1DBAH 2R69L 5KANI 3O6YX 3AWGA 4EOWL 2FMOA 2Q3RA 3NZPA 3OX8B 1XICA 3UGVA 4YE4L 1C8VA 5C2CA 5LXEA 2MKWA 5HJLA 1JZHA 5DK0B 5IIEB 3FQTA 4JQIA 3V6FA 5I1CL 3NL5A 1NH6A 1MG2C 4XMKH 4R5EA 1SEQL 1NFDF 3LX9A 2BP8A 3EFOB 3ZRFC 3SY1A 4ADUA 2HTMA 4N24A 1W0VA 2TSAA 4JFOB 2P44B 2R4RL 4MA1B 4Q58C 3N3MA 4BI5A 4E4PA 1P4CA 5CMAB 3PAOA 2ZX9A 4X7CC 1L6FA 4YL2A 1NEZB 4ATDA 4MMYA 5G2HA 1J0HA 4G1MB 4RL3A 3EGDB 3KXFA 1DN0A 1T2QL 1YLBB 3BV4A 1O9WA 4CVXA 4I9WE 2CA4A 3PSVA 3HB3C 1XLGA 3DJRA 3NABL 4QXTB 3VTAA 3W72A 2DTMH 3GHEL 3B8YA 5B21A 4JANA 1EJOH 1SJDA 1JGMA 1SR9A 4PRDB 1MFEH 1I85A 4HWUA 2W9DH 1M1XA 4P05A 3N1FC 3PG8A 1BXXA 2OR9H 2EXYC 5K3VA 2ZUWA 4P5MA 2XVBA 1GG0A 1RVKA 3QTGA 2ZCKH 4P7OA 3AADB 5C0IA 1X5AA 2WYTA 3EIFA 1Y6NR 4RGOL 4U6HA 3BI9X 5C0BD 1ZEAH 3CZFB 9PCYA 5E4EC 2D69A 3KVDD 2XWBB 1FCQA 3SJ3A 1MDAA 3V0HA 4B92A 2XV0A 4GW4B 1J7VR 2FB4L 1R3HB 4KJPD 4GXWA 4C7GA 4NZUL 3TO2B 5LVEA 1UUNA 3O2DH 4EN3C 3I84A 3DI1A 4Z0XB 4P2QE 1FNGB 4IOIA 3PL6B 4S1SL 3W7RA 2E5BA 1I4NA 3DX8B 3IETA 1KLZA 2CHRA 3KUMA 4FQJL 2C1OA 1DL7H 3SDAD 5HYSB 5D96C 3NIFE 5G4NA 1N8FA 3NTCH 3VG0H 1AQFA 1Q13A 3QZNA 1RL1A 1WAAE 3N6QA 3WD3A 4I89A 1E4KA 5DTFB 5IM51 4X42A 3LVTA 5DQ9A 1YEYA 4L29A 3D85B 2AKZA 5IK3A 3S3BB 3VYOA 1DLFL 3YPIA 3RWJA 5DJ8B 2J4WH 3BW9A 1T3FB 4X8XA 4QRRA 1JZ2A 1C8PA 1B3YA 3GFYA 1LLAA 3NQGA 5AZ1A 3W7PA 4WTZG 3EBAA 3AXIA 3ZTNL 3MJ9H 1TNMA 1BVNP 4YHOH 1UMYA 4YUEL 1MI5A 4UYPA 4R2GB 4FDWA 4Y7OC 4KRZA 5HYJD 2R2HB 2XN9A 3KJ4C 3MXVL 3RCYA 2BXZA 5IHLB 4TIMA 5C9JB 3BPNB 3UPMA 3RTLA 5ICZB 2FFIA 1IGFH 5JQ6L 2GEEA 4MWAC 4BR1A 2HLFD 3A6BH 5AW2B 4FFZL 2AS5M 3FU7B 4JS3A 4YTUA 5CD3A 3WIJA 5IJKC 1A3LH 2L7JA 2V7NB 3GJFB 4HFUL 5F4XA 3G5XB 3KCWA 1AW5A 2ZZ4A 3WU1A 3QJTB 1WSST 2QUVA 4BKSC 4KNUA 3IDUA 3A5VA 3GJEB 3NVTA 5EDXA 5ICUA 4W7UA 3OGVA 2F7PA 4HIJB 3T0EC 4PB0H 4EIUA 5MKGB 1UR4A 2ARJQ 3NG5A 3WFHB 1EAOA 4KW2A 4KK8C 3UYOD 1M01A 4BEQA 5I1GL 2JXMB 2ZAHA 4K1WA 4HUXB 4XCNB 3QRFM 4P49A 3CHXA 2ADJA 3ORJA 3EDKA 5E0QA 1ZDQA 5JTWA 2OWWA 5DK0A 3QIBC 3U4BH 5IIEA 1XZ0B 1ZRUA 2X10A 4N90D 4UTBL 4OZIE 3JS3A 1GGCH 1BZEA 1NAML 3EFOA 3ZQXA 2A21A 3OGSA 1Z8AA 4R7WA 5E8OA 2P0OA 3AROA 2PRMA 4ODTL 2ZKHL 2Z1PA 3IUIA 4O1AA 3QKEA 4L48A 5GRVK 1Z9SA 2XU2A 3KCOA 5C6MA 1MH5B 3D06A 5FYJH 1G4MA 3QQ1A 2ICEA 2VN7A 3MA7A 4YS4A 1IEWA 3GKAA 1JZDC 5AHEA 1XBXA 3W00A 3HMXA 1F41A 2G0KA 3N91A 4NKQB 1UOWA 2XM1A 5I00A 3OKEA 5LNEA 1B0GA 1E5UI 1MHCB 2VLMD 4QXTA 3UJFA 4NZUH 1TZ7A 3V3WA 3L4TA 3BXNA 4IBQA 4LJ3A 2AQ2A 3F7YB 3LZFL 3EYVA 5MI0C 3SUTA 3WCZA 4K94C 2VMJA 3Q7JA 4L4VD 3DG6A 4DX3A 1TUPA 4Q89A 1MSPA 3ALFA 4GRWH 3N1PC 1E9QB 3LHWA 3WY3A 4OZFH 1TJGH 3FQ2A 1XH3B 4IS6B 1A4LA 3EBIA 2J24A 4KEVA 1KBLA 3A6CL 3BEVB 3I3EA 5C9JA 3GNOA 3LNPA 4Q8VA 4WJ5B 3UP6A 3US9A 1XSKA 4U1LA 2DD8H 4ONGH 4Y1AD 5C09D 3MDJA 4LQ1A 1FNHA 4LWWA 1O94A 2CK2A 3VI4B 1MDTA 2GGJA 5FJRA 3GLCA 3O6KL 3FT1A 3Q5OA 4NO5A 1KUMA 4P5TC 3P14A 4A22A 3IK4A 1XTLA 3ULSA 2UZXB 4PJ5A 3U36B 1JBJA 2GVGA 3TJEH 1M7IB 3UMTA 5C6WH 1MNZA 3G18A 4HVXA 4MXWL 3WE1A 1VDGA 3UBXI 4APQD 1YXYA 2YX0A 4XIAA 2YXXA 1JXFA 3NZGA 1UWUA 3FB5A 3UMNA 1J93A 3DXAA 4YL9A 5M5DA 3TSDA 3IIXA 3LLDA 2UY7A 4U1JB 4Y9BA 3V7MA 4JHBA 5H37G 3WN5C 3VW3L 3L7FB 2W07A 3FEQA 5DD1H 5C0BB 2PDPA 2IADA 1OX6A 4NUGL 2CJUL 2CKNA 3O6LH 1FE8H 4QD2E 4NUPA 5J5RA 5FKAB 3INPA 3FB7A 1RJCA 5E8OB 1TETL 4POYA 4FOMA 3DX6B 4TU1A 1JXJA 4XN5A 3WQPA 3WO8A 4F0MA 3U0PA 1A1NA 1WLHA 3EO1A 1UKOA 3L48A 1YRRA 1FL3A 1Q6FA 1S5MA 3TIDA 4FXLA 2I85A 1CXFA 3AJXA 3GZAA 4GI4A 1X9UA 4GLEA 1N7ML 5BUGA 3MRLB 4LNVA 5D2XA 3S37X 1TENA 3I75A 5CEZE 1GZQB 1S7XA 5DY3A 1OC6A 1SDDA 4K3GA 1MEIA 3A3XA 2IC2A 3EZ4A 2FYYB 3M17A 2WPBA 3M16A 4MHBA 4DI9A 3QUYA 3PTKA 3ZIMA 3KPMB 1K9TA 2B2XH 1T1XB 2Y06H 4JHAL 4HZLA 4MX7A 4ORGB 3CVHL 3C6LC 5EPMA 2OK0H 2OFQA 1K72A 1GW0A 2VR8A 5BRZB 1TCDA 5IHZA 1M3JA 1WB0A 1E9QA 4LVFA 3TDFA 4NYLB 5E5MA 1T03L 3ROOA 5EU4A 4BF9A 2Y7OA 4PBXA 4PP1D 2BJMH 3FTGA 2AJ3B 3QC6X 3GS6A 4FX6M 5BNXD 2CERA 2EQDA 3DI2B 5IMLA 2GUUA 2I5GA 3DVIA 4UBDD 4O10A 5ENLA 2JCCB 4KFZC 1U41A 3MNVA 5D1ZC 1HJCA 2ED7A 3WXWH 4LOCA 3KS6A 4XBJA 1H6FA 3JWDC 4HA4A 1IZCA 3D34A 4IFKB 1A7OL 1QNRA 4O16A 4FFYL 5ECVA 1FJ1A 3ULSB 1MQ8A 2QR0A 1TJHL 1XIWD 4O2CB 4Z7WE 3GXTA 3SJNA 3MJMA 4PJEB 3FJNA 1OGTB 3CC1A 1JHLL 3L5WA 4X60A 4B3ZA 2D2HA 2PYEE 3IDGA 4FFZA 4HHAA 1HKLH 1SQ2N 3UPAA 3S4SB 1E5YA 1HWWA 1ITBB 1C7SA 4UT7H 5DFAA 5AC5A 3RM4A 1IM3D 3OR6A 3C8NA 1JNLH 4R7NB 1E5CA 4KKNA 5T5FL 1U1HA 3LBMA 2EYRA 3HKZA 2DQFA 3G6AA 3QDJA 1KIRA 3KM2A 2TSYA 4FLSA 2XG9A 4HBQA 4R0LA 4K8RC 5DJ6B 4Y8DC 1KYAA 3EYVB 4YDKH 3B05A 2AQOA 3IWPA 1WFIA 4PLOB 1OP5H 4ADGA 3AUWB 1XGUA 3D12B 3P3SA 3S8WA 2OZ0A 4JUSA 1OW0A 4M03A 5A8PA 2ACRA 1M1BA 3G1RA 2EABA 2NW2A 2DY2A 1CFMA 2IAMB 3V4UH 2ZKMX 1QBLL 1G0DA 4N0UA 4AVJA 2BSTB 2AV1B 2OKMA 4NZ3A 5FD0A 1OB1B 5C0EB 3HEIB 4DPBX 4ALDA 1E4JA 3OPSA 3TN3A 4XCEA 5BO1H 4ZPVA 3EH2A 1S2UA 4PRHE 4RMQA 1M7DA 2P26A 1ZCRA 4GLRH 4LIQH 4K5NA 1AQHA 4TLUA 1NBQA 2ZPKL 2OKTA 4XUGA 3CFUA 3KGTA 4JG1L 1XIFA 5IVOA 4AV0A 3A24A 4YBHA 1OTTD 2YRLA 3U7AA 2WO4A 3X1FA 1UASA 1W6WA 3ABLB 5IHZB 2VO8A 5KJRH 4YSOA 3NQ8A 2NY0B 2ZSVB 1EBPA 4LOVA 5DJ0B 1G9EA 3TYCA 4HLJA 4O1BA 3SM0A 4QY8A 1P5UB 3NFSL 2YJQA 2E67A 5IMLB 1N7MH 2J9XA 3G6JF 3M7WA 4G7VL 2VDML 5I15H 1M53A 4IWWA 3P4NA 4PS4H 3KWVA 1NUNB 4XVTH 5D7IE 4JRWA 4Z0BH 1GQIA 1XIMA 1PBYA 1M6OA 5D55A 1G7JA 2Z7ZA 3JYBA 1K77A 2DZTA 5KAQF 3AU2A 3DIPA 4LSQH 1MDLA 1SHWA 3FUHA 4ZNEE 4NUGH 1GT8A 1K1DA 3NL2A 2IF7A 4CILA 3MS8A 3ZIYA 1JVKA 3BIKA 1FL3B 2NT0A 1Q0EA 3IJEB 4LL9A 2A74A 2RIKA 4CBPA 3HOGA 3I75B 1Y0EA 4RLDA 2ZRWA 2EYRB 5D02A 2EUWA 4UXDA 1JL8A 1DVFD 3SKMA 4R0LB 3VUAA 3ZVIA 1QZNA 2QPUA 3DJZA 4UFMA 1OE1A 1SY6H 2VC2B 2AABL 5D05A 3MYJB 2J56A 4LEEA 3UP8A 1H6TA 4JMXA 4QXVA 4YSUA 3VXRA 2VFFA 1R24B 2QTVA 4S3AA 3LH2L 2OGYA 3QJUB 1MWAA 1S2VA 2HNHA 2DD8L 4ONGL 3KG5A 5E5RB 5CBEA 3IUDA 1JCYA 1HQRB 1M2OA 1V3JA 2R29H 4X83A 4UIKH 1BEYL 1JVLA 3VYPA 5BV7L 4JFSA 5IB4B 2VFIA 1UACL 3AXMA 4E3TA 3OKLA 4XWOD 4WUUA 4QIUA 1QJWA 4MWAA 4Z76A 3UF9A 2ENYA 4NBYB 5CP7B 5EFFA 1CYWA 1ZTXH 1N9PA 3L4CA 1QFUL 5FJTA 1FO0A 4TUUA 4C57C 5TDPB 2VMEA 5GGTH 1OYBA 3QO1B 2F8QA 2OT1A 3W28A 4UDTB 4GRLB 4J5NA 5T1DH 3VI4F 4AH2B 1EQCA 4N2YA 3IU4H 2W67A 1QYGL 5GS0L 2KC0A 1MWAL 4YZWA 1EEXA 5KSWA 4HFWB 1WS8A 5FYJL 1B6UA 1PB0A 1KN2H 4JFHE 1D2KA 3OO2A 4ODWB 1GVYA 1ZLVH 3CLMA 4FXTA 2PUQT 4QHUB 1F00I 3O16A 3URAA 3FONB 4D8PA 1IFRA 1RY0A 4DJEA 3FOLB 3GLDA 1BJ8A 2ZE3A 1ZP3A 2ENPA 4JO3L 2YGPA 3QPKA 4IMKA 3HJEA 3QEHA 2QJJA 2ENQA 4LARL 1EYEA 5KW9L 1ISZA 3EO9L 1VFBA 3R12A 4MSWA 1E2WA 4MJ6B 1JGDA 1AO7B 5AALA 4GISA 1WBXB 2WYZA 2AV1A 4P8QA 4CLMA 2OX5A 3RX5A 3LPOA 4L1DA 2RDUA 2NXZB 2RQ8A 5A3HA 4OCWL 5HGHB 5J1TC 2X8RA 5DANA 1P4LB 3K2UH 4Q4RA 1PEWA 3NACH 2VDNL 1W72B 2DY3A 2UY5A 5JYLA 2FTWA 4X7SH 3SQSA 1A5CA 1NLDL 1KFBA 1WUZA 4HV8A 1GKEA 3KP0A 4WXZA 3KCPA 3VI3B 2YPKB 3FXYA 1OP3H 4UB0L 2AQQA 4Y6GA 5D2VA 1DSFL 2ZOLB 2VMFA 3PXLA 4PRIA 1ROCA 1TRIA 2Y25A 2CBMA 3N44B 1WE5A 4JJ5B 3SCMA 3OKOA 4JFED 3X14B 2APFA 1ESOA 1JGUL 4P2RE 3VFLA 1KPUB 5EWIH 3L7EA 3EKLA 5I8CA 3NQEA 3K91A 3V4VL 1TQBC 2VB5A 2K45A 4P3DA 2EIKB 2NTSP 2W4XA 3JTSB 4TVPH 4YAQA 4NWTL 4Z1DA 3HHMA 1BD2E 3TFKD 4KT2A 2K78A 5CP7A 3ZWTA 4KHTL 1OPGH 1IEHA 1O12A 1CICD 1W72H 2TRHA 5I6NA 4YO0B 3JV4B 5KOMC 2Q7NA 2FNWA 3CH1B 2C91A 2QKIB 5AUMB 1FG9C 2EYTA 4WWID 1IU1A 2VXTH 3RQ3A 2XIIA 3TNMB 4B6ZA 1O4UA 3GIZH 3QC3A 4LU0A 5EBAA 2C9RA 5IG7A 4LY4A 1B3JA 4HIPA 3GG7A 1OSEA 4GKSA 4KWOA 4PJFA 1YCSA 2JELL 1EFXB 1AZ1A 1POKA 1Q66A 2DLTA 2XH4A 1MPAL 1Y07A 2DAVA 4OCLC 4ADIA 4A8LA 4MCYB 3CU1A 3TYDA 5IESL 1BGXH 2D4FA 1F76A 4JO4L 1KRAC 2BZCA 1EEUA 4LGRB 3AIVA 4PU2A 5E1QA 2YW4A 4FI4A 1XF5A 3AACA 3B34A 3QIWA 4Z7UA 1LTDA 3H8AA 2VERA 4KRPB 1XWVA 3KPNB 4HLZG 2Q8LA 2IVFC 1EUAA 1YQVH 1EO8L 4QE4A 3SB0A 5TDOB 4QHMA 3C60C 3VOCA 2GQAA 4J3SA 4UT9H 5F6HJ 5HGHA 4F5CE 2DW6A 4W9KC 3VWJA 1GGOA 3B6SA 2NQ5A 4N68A 3DURA 2WB5A 1Z66A 3T2PA 5I3KA 4FNUA 5E1AA 1IXNA 5D7LB 1WIPA 4JRYB 4P5TA 3CJPA 2W9EL 2LHAA 3BZEA 2XVGA 4ZBCA 4NPJA 3R1GL 4JTGA 3Q5TA 4IOSD 5KUMA 5CU5A 3E6FB 1IBZA 4HZ1A 1U83A 2G4GA 5EMLA 2HN7A 4HUCA 4O58H 1OK0A 1M7XA 1VKXA 1EJSC 2WZ5A 2OS7A 2BIQA 2YYUA 1QFOA 3N50A 1UXSB 5B7YA 2F7OA 1IGJB 4P46C 4XC1H 1JGVH 3RBSA 1NWOA 4IMCA 3RTQC 1LOQA 4D6CA 2BVPB 2PD9A 2ZA3A 2BOBB 3DMMA 4MD0A 5H91A 1PFOA 4M0XA 3VKBA 1KGWA 4X8JA 1J8VA 3O8AA 4CVZB 2CXGA 3B9KD 1T20A 3R1ZA 4RV8A 4U1HB 4WI3A 3MX0B 4GG8A 5EO0A 1KCBA 2OTPA 3GB7B 2GY5A 3S98A 4WKHA 3FK3A 1SYSA 2CHZA 2L7EA 2CLKA 1RAKA 3WQCA 1T2JA 2NY3D 4HQQL 4M62H 2WZAA 4CGUB 4JFOA 2OMUA 2IKGA 2PDCA 4G5DA 1AKPA 5H94A 1BFOB 3DC0A 2WYIA 3W9DB 3KMDA 4G9FD 3IV3A 3HRZA 2LU7A 3WLKX 1K7EA 1ED3B 2CA3A 4CQDA 1UT9A 5T91A 4XNZB 1MCOL 5F3FA 4Z3JA 1J2BA 2DN7A 4QHPA 5GJNA 4C5ZA 5CIPH 1CLXA 1DBKL 4G3YL 5CP3A 1RV8A 2BV9A 5JVLA 5LNWA 2A9DA 2Z2UA 5KYXA 1EFXD 1JUFA 1X5XA 5D7JD 4BSVA 4FABL 2A3LA 2ZUYA 2DB8A 1OAZH 3GSNA 4HA1A 2P5NA 1KRMA 2PCEA 3I9IA 1U8OB 1FWTA 2WWMC 1WRFA 3FT4A 4M43H 3GHEH 4XHQA 1ZGDA 2FDMA 4QRUB 3TN0D 3LN3A 3MDWA 4M7SA 3VE9A 1ONQB 1HILB 4Q6IC 4XZ9A 4APQB 3R7QA 3PIQB 1A5LC 5I16B 1CT8B 2R27A 5DQJB 4BJLA 2BVQB 4BZ2L 3MYOA 2QADB 4LSRL 3BW4A 1LO3H 2XCMC 4TVCA 1JUEA 3BHBB 1XIHA 4KEUA 3QR1A 2QGCA 2JJSC 4JIQA 4NCC2 3QCVL 4FZIA 1YEKH 4MA1C 2DV6A 2DQUL 3NIGE 3MLTB 1T89A 3KYNA 2EPNA 3NOYA 3QQ4A 3U57A 3L3HA 2GVJA 3D9AH 3OF6A 2YCEA 1K7FA 3K5RA 3RYMA 4RNIA 1U8CA 4H88L 3WLNA 1UXSA 4GGHA 3MGOB 4U5IA 2JKPA 2FT8A 3OQEA 4LUIA 4MY8A 5DR5L 5T1KA 4UTMA 3TX4A 4XVJL 4Y9NA 4JB9H 4W9JC 3B8TA 4OF8A 1AZZC 1SJHA 4IGBC 3DUUA 1UXWA 1FCCA 3EYQC 1AGEA 3H3PH 3KPNA 5EZIL 3KVKA 1CD1B 4AGPA 5LQBH 3G1FA 3SDCD 4NRSA 3SN0A 1I9EA 2V5CA 4CNPA 1WX0A 4E8GA 1TVHB 2PEVA 1SO5A 2WHVA 3VFPA 2H2PD 1S8DA 4K8RL 3QJHA 5D7EA 2FEEI 2Y4SA 1KBPA 1AC0A 3GF8A 3WFCH 4DEWA 4N8PA 5I18L 5HR6A 3SE8H 2MUCA 4Y2LA 4QDMA 2TSBA 5A16B 1QTSA 1GJWA 5BCAA 4P07A 3OJGA 4N2LA 4TUOA 3JBG7 3L1FA 2X4TB 4F2ME 3PP7A 5A69A 1ND0B 4MLRA 4WJ8A 3RPMA 3GSOB 1MFVA 4H83A 1XCXA 4TSAL 1MQRA 4H7ZA 2OXGB 3EFFA 4MLJA 4AEOA 4CNIB 3ZR5A 2NR6C 4LSVH 4U49A 3MRKB 3ARSA 5DMKA 2OYLA 2EXYD 2X44D 1LE9A 4GX9A 4YX2H 3OWRA 5CCKH 3CC5A 2CW6A 4K5MA 5CJOL 3XIMA 1T40A 4FQQB 4A6YB 3L0GA 4LTSA 3MLWL 1DQQA 3UWYA 2XDHA 2X2YA 3D33A 4Y4KD 3WFHA 2WLLB 5C6TL 5JHLL 4MNGB 1SPDA 1G01A 3L6FB 1CDHA 1VFFA 2P7TB 3L1OH 4X0KA 4OV5A 3P30H 3M0JA 3NEHA 1RZMA 3INUH 1O7AA 5EO0B 4HLEA 1I9RL 1ZZMA 3AIRA 3DFOA 3U3HA 1WIOA 2HLEB 3B4UA 2Y69B 4O2EA 5H2BA 5J5EA 2E7CA 4ZFOA 2WTPA 5AW6B 3ME0A 5JXEA 5F1UA 1T66D 4LP4A 1LO0L 1FUYA 4KO7A 4DH2A 4LCCB 1JCLA 3EBVA 5C0CB 4I7WA 5FYKD 4M48L 2ZE0A 5HANA 4XVSH 3PUDA 5T1KB 3JWNE 3OAYK 2WC3A 1TJHH 2Q6ZA 3AXKA 1OFBA 5H8MA 3LJ3A 3MXWL 4H25A 3VXMA 1FDZA 4XTIA 1UROA 1WKDA 4BKNA 2XFWA 1SJHB 3Q6GH 4L3EE 4AIUA 1KELL 5FAAA 4OLWL 2KPNA 1NFPA 4OSUH 3A4WA 5H37H 3IBOA 4U2YA 3KWSA 4Q8NA 4G6JH 1CWYA 3BYYA 4LF1A 4ONFH 3D6GA 3ZGIA 3C5SB 5FAGA 4U0RB 4NRZA 5AB1A 3N18A 2YPVL 3FSZA 1S8DB 4NJAH 4DK5A 1NIUA 2DZXA 4PS8A 2R69A 1DJYA 4FCAA 2C7UB 4H4NA 4WV1B 5DMGD 3TEZA 3ROLB 2DDQL 1F4XL 1B3ZA 5A8QA 1IKFL 5I71C 5I30H 1TDQA 1YYMH 2Y07H 1P53A 2Z31D 2ZX8A 4NB7A 4OSUL 5F1SA 1IC4L 3CSYB 3MRCB 2J6VA 2EYSB 1DZ0A 1FNSL 2A9BA 1CICB 1JPTH 4EUPA 4AEIL 2INFA 2VLRD 1WWWX 4JM2B 1BZ7A 3DPBB 1MCHA 1A7BA 1Y7VA 3UJEA 4JZNB 4EBQL 4L18A 4UBPC 1A1OB 5AAWA 5E08L 4R88A 2CHXA 4JRYD 3WIFB 1U1JA 4G2DA 5FO8A 2CBPA 5DK2A 1CTOA 4EO5A 3AQYA 1WG3A 1S7UB 2H2SD 4M6ML 4P99A 1F45A 3OKDB 3MRJA 3SBWC 3UAJC 4NEHB 4XBPB 4KK8D 3QNYB 3DH7A 4ODHH 4IU2A 1BQLL 3ARDA 5DVPA 3PDGA 3BPOB 4JTRA 4AD1A 5ABFA 4PJIB 1AGEB 3GZOA 4AWJC 4ECNA 2V9TA 3L9YA 1BRLB 3E0IA 1FRBA 1GXEA 3JTTA 4W9TA 3Q8CA 1CTMA 4KC3B 12E8H 4YDLC 5DUPH 4C4KT 4F9LC 4MKSA 5D04C 3C9NA 3BAEL 4JFPA 3KL3A 4MS6A 5E4OA 5F7WC 2HAZA 2WVSA 1U8QA 3RZCB 1CU4L 3W6YA 5KSAD 4LDEB 3TCEA 2ARJA 4FKEA 3GRIA 4C54A 2H3KA 2A4AA 4Y4HA 3H2OA 1JFQH 1R3RA 4HJGB 4R9XA 1XVSA 2PYEA 1UB5A 3GSOA 2OR8A 4Y5XC 1J9RA 5CN2A 2DDXA 3DIVA 1W9VA 3A6CH 3ZFHA 4EF9A 4HK7A 3AG4B 3TWBA 4C6CA 2BOLA 3A13A 1KC7A 4UMGA 4DQOH 1I8UA 5J6GA 3QBUA 4GC4A 3ROLA 1GGUA 4V33A 1R3JB 3S48A 3N2BA 2YWZA 2OSLA 3E3QC 1CDJA 1OP4A 2HJLB 4JG5A 4OLYL 4BFOA 2AEQL 1PY4A 1BM7A 2XWBA 5GZOC 3EMQA 3CAFA 4NNPH 3IFPB 3QORB 3EX3A 3S6TA 1P84K 1VA9A 1HQ4B 1WK0A 2Q3XA 5CPTA 4MA7H 3V5KA 4ZG1A 4FFTA 5EU5A 3TO4C 5B3SB 5B8CA 3SCNA 3S5LG 4FHKA 4OQ1A 4FNRA 2WXRA 3KM1A 5DRXA 4ELDA 4MNQB 1W9XA 3GI8L 3KBPA 4ZRGA 1X1OA 3KOZA 3O3AB 4ZFFA 5JHAA 1NBZB 1EJUC 1BVLA 5IW6A 2JV6A 1SZRA 3LY0A 3F4VA 4N1HB 3ATYA 1S7VB 4JAWA 3V0FA 5BYWA 4NQEB 2VN5A 2ZSWB 3Q1SL 3N40F 5JIIA 4HHAB 4QNPE 4KHXL 4A2HA 2ICSA 1YKWA 3VXMB 3RB5A 4PG2C 3OW1A 2NUYA 2F74A 1WDWA 1FFOB 2B4CC 5EL1A 1A64A 3KPRD 5E6UB 1FIEA 1KCRH 3GDRA 3UO8B 4ZUSA 3DUSA 1C5CL 1BQ5A 2FJUB 4D8LA 5FKYA 1NGWB 2ZKYA 3M41A 4YBQD 3GUTB 1SFLA 2Y5TB 3KL0A 3O7UA 3IE9A 4U1GB 3ZYJA 5ID1A 1QNSA 3LHUA 3HN3A 2DM2A 3OMNB 1WFMA 5HUPA 2CKBB 3S36L 2ARJB 2YBRB 3BH4A 4EZMA 2OW7A 3ZTJG 4CMMB 4FABH 3HLKA 4AM0A 3H4HA 5HHVH 5ICZA 1J5IA 1VFMA 4OZHB 5IOKA 3IEBA 4H9YA 4RXFA 2X6UA 5EPDA 4MAVA 4NG3A 1QOQA 5LHDA 1CYGA 1ZVHA 2EKGA 2IIJA 4IMLA 4NGHH 3O9WB 1I0DA 4GS7B 4PM1A 4R53A 5J06A 1PLBA 2FECI 4PJHA 5J11C 4LBRA 2O9OA 4OM0L 4RPPA 4E38A 5JOEA 3CUPA 5CEXA 2YD5A 3T55A 2HJLA 5TH2A 3VA6A 4ZB0A 3T4YB 5A2IH 3PQYB 1H5BB 1P1MA 1YE4A 2CKBH 3VKCA 3UETA 4HUXA 4XCNA 2ORBH 1F4HA 1NGPL 3OAWA 2PTZA 2JJSA 3WKML 3MP5A 3NSYA 1I3UA 1XZ0A 4P9ML 4W9ZA 4ZDHB 4YLWA 1M6OB 1SN2A 5GGQH 3W7IA 3DRTB 2ZCHL 1RUQH 4DOHB 1KNOA 1UGKA 4ODSH 4LKCA 4OT7A 5CCZA 1DQJA 3TBBA 3V6ZA 1UBSA 1DWFM 3LKNA 2OP4H 3KLLA 5G2IA 5E2WH 4LPVA 1W72L 2WANA 1EPFA 2WTOA 1L9MA 2GBVA 2B31A 3SURA 5MENE 2BOCB 5B1JC 3GC5A 4C6JA 2IMMA 4K37A 2DI9A 4ZMZA 4OVUA 3AU1B 5LQBL 3L3JB 4HJGA 4QYOB 2R2BB 2BPBA 2Q8BH 4HOZA 4XD5A 3ZL4L 1CB4A 1VH7A 4ZUSB 3BDYL 4FXFA 2CK0H 3W0WB 1CNVA 1RUQL 3QRBA 4WTZA 3FO9B 2N59A 3OXRA 4N26A 4Z95L 4YMPA 1RJRA 3WUEA 4G8AC 3BH8B 1FCVA 4AZIA 4C6NA 5IHBA 4LEFA 3PSWA 3C2OA 4U28A 2O5ZH 5CINL 5CLWA 3F5LA 2YXMA 4RE4A 5FFLA 2FZ9A 2I60H 2PW2B 4U0QB 4K55A 2CDFA 4KMTH 4X6CE 5E4EB 2IV8A 3KLSA 5F7DA 4TR9A 3R4DA 4QKXB 3U4AA 3SIMA 2GK2A 3A3YB 5D2WA 2R1PA 1IGCL 3B3BA 2IPTL 1HO4A 4UUJB 4ZMNA 4AJ0A 1P0NA 1CVSC 4J4PA 4MNHB 2V17L 4K3HA 4ONHA 5A1AA 2WVVA 1G7MB 4ELMB 1YDYA 4Q4QA 3LIZA 1EX1A 3D3VB 2QSCH 1TZ9A 4S3DA 5EF0A 2W1NA 3EAKA 2V2CA 1IBFA 1JYWA 2VKWA 3W7LA 3CUPB 2YMTA 5CEXB 4NM8L 3FW6A 2FPTA 4P4RA 4OZFB 3ZKND 4FF9A 3GXMA 3K81A 4BFFA 5J57B 1C5BL 1KBKA 2NXYD 4MB1A 2ATKA 2R0LH 3RZCC 4D3CH 1UWAA 1W5MA 1DSWA 3MBXL 5BVPL 3K72A 1RLCL 1A5SA 1JZ8A 1UZ6F 2WY3B 3QS3A 4A7UA 1OX5A 3DSNA 3HNTH 1XH2A 2QHRL 4M1GL 3W0WD 3WBAA 4BS0A 1ZD6A 4ABUA 3W56A 1PG7X 4NRYA 4IG2A 3LZFH 2DQ6A 2XSKA 5EBWA 1HWGB 1RH8A 4R4NC 2R8SH 1CLCA 1DYSA 3IV8A 3PWPA 4JLRB 4NC1E 5F1NB 5I1HL 2QL1A 4LEOA 4Z08A 1EJ8A 3IGAB 3NCWA 3SUSA 3VINA 3FUFA 3SPIA 2YN3A 4NXKA 4FNTA 4DPAX 3RILA 1NCAH 2F2HA 3BJ91 2AQSA 3WY4A 1IQDA 1CLVA 2ZYRA 3NYKA 3OHXC 4JQ2A 1CPUA 1UP2A 4YXGA 5IW1B 3PZOA 2JKTM 3MLZL 3S5ZA 4B3KA 1OYCA 2V81A 4GMSH 1MHPH 4U4MA 1AGCA 3T2LA 3ZO0A 2YKKA 4AVOA 4JM2C 1M3IA 3VI3F 4N85A 3KCPB 3P0YH 4URKA 3HZKA 1JULA 4EVZA 2IPFA 3ETSA 3VA8A 3GLZA 2VDNH 3VFUB 1NCCL 2CCLA 1A21A 1ZHKB 2J8HA 3GSRB 1WTGT 4KTEH 3S3GA 1VSCA 3BQVA 3D4ZA 4KI5D 3SCUA 3VE0A 2C16A 8CGTA 5DUBB 3BSGA 4P2OD 5D9SA 2ZWYA 5LA2A 2WJDA 5HGGS 5CZSA 1NCOA 4XP9L 2EO7A 1WHPA 3ESUF 2DQTL 1FDJA 4S1FA 3TU9A 4ENEC 3PP3H 3UIZA 4PVLA 1D9KC 2GITB 1L9WA 3EA2A 1PLGH 4K3ZA 1QQDA 4WQOA 4KJWC 1DDHB 4FLHA 2Q02A 3CK5A 2H9AB 1I4FA 3VFNA 3W0KA 3LB6D 5F0MB 4JTCA 5DJXA 4BBWA 2MOQA 4OB5L 5DUMH 3QI9B 1VFOA 4HOXA 4FTDA 5DBUA 2VWTA 3HG1E 3TNNB 3KXFD 2RHEA 1YLVA 1GYUA 4CNNA 4AZGA 5I8EB 4HS3A 1OW0C 3RDTC 5JW4R 3CFKA 6ENLA 4UQAA 2VLJD 1TV4A 1C91A 1XC6A 2XZ9A 1UT2A 3N34A 4QS6A 2FSEA 1VS1A 4OKDA 1UC4A 3N4AA 4PMNA 2Z1XA 3BPCA 3OGRA 1TRDA 3EJQA 3PHOA 5E2WL 3SGEI 4NJIA 1SZGA 2P5EA 4O4WA 3EUDA 1DQKA 1SHSA 4MZ8A 1U8LB 2C34A 5TGBB 3CK0H 3S4TA 3B0YA 4QNWA 3TWAA 3NOIA 4JG1H 3RPBA 1F3JB 2H8XA 2OCZA 4IQLA 5D1ZI 2Q8XA 3TW7A 2NV2A 3JT0A 4WFHD 2BBFA 3PBYA 3EPNA 2Y9RT 3KPSB 4R9HA 4WHTA 5LGKA 4NPYA 2D3VA 1E4NA 2E09A 4PS4L 3EXSA 4AEFA 3D4YA 3GKZA 4NJKA 4O51A 3IS4A 1NIFA 3NQ2A 4KCUA 4TQIA 3S2MA 4BELD 5BS0D 4GMTL 4ZFOL 5IMOB 3RUGE 3CU2A 3IMBA 2HJFB 4GIAA 4GW5B 1BMWA 2YB4A 3STEA 4AC7C 4AB4A 4OZGF 3TA3D 4P4RB 4IOFC 2R0WL 3T0VA 2IQAB 3A23A 3BEWB 3ATEA 4PJ9D 4EVNB 1P0KA 1V8EA 2ZX7A 1IJNA 4GUPA 2HTLC 1H8NA 2EG7A 4LUSA 4C58B 2EGZA 3ZMEA 1JNLL 3LKRB 5DD5H 4D9RD 2V7HA 1LEGA 1BSLA 5BOEA 4JDBA 4GK8A 4WGXA 3NCMA 3WUBA 4WO4D 3DOPA 4JFFD 2P46B 3CVHB 2X4QB 1YTKA 2ZDSA 2F53B 1FYHB 1QFWI 1CQKA 1QRQA 1CFSA 3IBEA 3J7HA 3QUZD 4CVZA 1Q6CA 1KELH 4YR6A 1M68A 2WGNB 5AC4A 5CZ0A 2WHKA 3PWAA 2GOUA 4ZW8A 3KW3A 4AQLA 1DFXA 1RURH 1SYSB 2X89D 2JH2A 2ZXEB 3SZ6A 3OXSA 5GJTL 1KM6A 1C5CH 1X7SA 2VC5A 4M9OA 5D8ZA 1CGXA 1P5BA 1KV8A 1HOCA 1OEZW 4N2CA 4U3CA 2HFGH 3AQDA 3EEGA 1N68A 4P23B 2EPOA 1QKZH 5GSVA 3SPVA 2V5RA 4JE4B 1H0GA 1GKPA 1OCRB 2K6ZA 3E7JA 2VZUA 3PGCB 2I25N 4I4WA 4XCYB 3NAAL 1E71M 5CSZA 1KTKE 2AVGA 2Z7UA 3O2WH 4FEIA 4GRSA 4ABWA 4Y90A 4DZBB 3WD2A 3CVHH 3UTSA 1WYJA 2F8VA 4FXKC 5CBEB 1R3YA 1XCTB 3C60D 4G70B 1UA6H 1UKPA 3FFSA 2E4FA 4QLLA 3LGGA 4U2ZA 4PFMA 1A7NH 1A9BB 6TAAA 2W59A 1HKJA 4N4PA 1YNLL 2V2HA 2YAHA 1G7QA 3QEQB 5T1DL 4GVIA 4V28A 4H26B 4RAUA 1A7QL 2FFCA 2EE9A 5IDZA 4NFBA 3NCOA 3W9EB 2OFJA 4M5ZH 1UJTA 5T1LA 3FS2A 1LEIA 4PJFF 5TDPA 4HQVA 1GC1H 4PBEA 3RN6A 4KKQA 1QX1A 4PRAB 3ABSA 3H7LA 4JG0L 2C19A 2I9UA 4UTUA 2C14A 1CFNB 4NO2B 5CJ8A 3BGJA 2J72A 2X70A 3DOSB 3UCRA 1CDGA 2OMXB 4JHVA 2YEZA 3D52A 3QYNA 2O1AA 1QMLA 1HGWA 2BXVA 2RGLA 3AZRA 3RPKA 4X5RA 4B5XA 4L4TE 4AUJA 3AY2A 3RWDA 3KXFE 3QXUA 2IPWA 5KBLA 4HZ6A 3QYCA 4RLIA 3X1BA 4XAKD 1INQB 2N1KA 1GOKA 4O52A 1SHXA 3N3EA 3GSUA 3N43F 4OCXH 1SZNA 1QVOA 1VFBB 4Y4FC 4PRTA 5F9WC 2ZWKA 1IAIL 1MEXH 1NFDB 2FAUA 2UZYB 3AAZB 3W02A 4MQXC 3FTWA 1UC6A 4LQFH 3PGFL 4ZS6D 1ZLWK 2BFGA 3UTPD 3BC9A 3ZR4A 2F8XC 4KFMA 2WNNA 1C7TA 2V5KA 4XAGA 3UXIA 3ABRA 1EXGA 2HT4C 3QJHB 3TVMA 2OO0A 3KWUA 2GBUA 4KITB 4M6NH 3FN0L 5TE6L 2DH2A 4Z78A 1MCJA 4FQCH 3JZUA 4TQEL 5E9AA 4FG2A 3VFTB 1PSCA 4CNUA 5B3JE 1OFDA 5GJMA 5HSFA 4WVRA 1W37A 3MRQA 3LNFA 5AYBA 3IVKA 4AYGA 5HTSA 4ACTA 4M56A 4NJ9H 4NQDA 2CNYA 1NPUA 3QDGA 4AFYA 2H26B 3IDXH 4CEXC 3QC0A 2PO6D 3IJIA 2IALB 5I1JH 3ISIX 3NJXA 3FVDA 2H9GA 1AL7A 1AA1B 4P4KA 4ENZA 3T42A 4NAFA 4W9GC 2VO5A 3JV6B 4AZ6A 2KQMA 3EBHA 3K2IA 3BVDB 4LP8A 4GMEA 2NVDA 2WLYA 5A7EA 3HG2A 3G08B 1OM3H 1AH1A 2WB1A 4MNGA 1TNNA 3B83A 1TMCB 1XLCA 3AT8A 4KRPC 4HZMA 3VW3H 4GVGA 2WC7A 5LG1A 4GKNB 1MLBA 3NK3A 3DFYA 4IOTA 4BGLA 1R34A 3W1PA 4M9PA 3QJXA 5DRZA 2AJXL 1IWBA 5CJMA 2XZAL 5I1HH 2Z2AA 4PB5A 1FO0L 5I28A 1NCJA 2GJZB 3ZDYF 3AXLA 3HI5H 2R8SL 2QCGA 3KEHA 4S0SD 4DNLA 2IBGA 4MLIA 3SDCB 5T3ZD 5IBUB 4P46D 4I9AA 4RRPG 5C07B 1XI3A 1E51A 4M48H 1G0CA 1CL7L 2DKMA 4LP5A 4H6KA 3WL0A 3MRBA 3TH4T 4PRPB 5CZVH 5M95B 1D5ZA 3O8XA 4IM8A 3GMLA 2ZJSH 1U33A 1RUML 3QG6A 4MMZA 5AFDA 4JY4B 5BZDB 5K9KB 3F8UB 4GW4A 1UWGL 4PJBA 3T9WA 3CEPA 3FKKA 4I7VA 2EUZA 3GU1A 2PPCA 3TVMB 4ZFMA 2P8PB 1BDYA 4H26A 2YIHA 2ZXAA 1INEL 4OF0A 5DJCB 1Y1UA 1KCKA 4JHWH 3TO2A 1A14L 4ALAL 1ODUA 3K80A 3HGOA 4ZYKB 1HL4A 1R4XA 4AQ8A 5IHSA 1OVDA 2X1WL 4FQLL 4CC4C 1LILA 2E28A 2ICCA 4YX2L 5CCKL 4DHGA 2WZ6A 5JQIB 1FHUA 1A4KB 1DWJM 4DP8X 2UVFA 5HHOB 4KROC 3PS7A 1OIFA 4XD3A 1JRHI 3D69B 5ICYB 1W6TA 1N2VA 5FA5A 1KBVA 4DXXA 3H3KA 5F7AA 1ME7A 4G6FB 1JK8B 2A9AA 3ESNA 4K7PL 5D8JL 5IJVA 3KP1A 4OQVA 1YAZA 3G22A 3POCA 1AXSA 5D5MA 1GVIA 1L9NA 3EZ8A 5IQLA 4Z7WF 1EZVX 3BQ6A 1CZ8H 1M05B 4DCQA 4U1MB 1FTXA 1Q65A 5HMDA 3HE6C 1MCSA 3OJ2C 4IBYA 2CGRL 4J1UA 5AW3B 1OAKH 2WB7A 1CLYL 1DQML 1MI5B 5FM5M 5LKNA 3KBWA 4GSUA 5JW4M 5ABTA 4MTVA 4LAKA 2DWXA 1E0WA 4AV5A 1AR1D 4IH3A 2Y36H 2D1ZA 4ZQPA 1DQVA 1UKSA 3SCSA 1N67A 2R2CA 3L3GB 4JO4H 1N8ZB 1HKMA 1TUXA 4EUPH 3QQ0A 4UTFA 3SADA 4O1FA 2VFHA 2CGRH 6TIMA 4XNZC 1HI6A 5I6XB 3NPSB 4ZENA 5CNHA 3MGTA 3FTYA 4H1LB 4H1ZA 4B90A 3T77B 2Z3FA 5MHSE 1L8PA 1M9WA 4LVNB 5EFIA 1E5NA 1NOLA 1L9TA 1FH5H 3SCTA 1RXOB 5J9PB 2BVTA 5DA4A 3VXUA 5LLIC 1ZA6B 3D18A 3V0GA 4IMGA 2Y24A 2NSOA 5I8OL 2BDNH 5EB8A 1BXBA 5HPCA 4YU1A 3RWFA 2ZOKB 3DC8A 5IROC 1OGBA 2BNRA 4ZUWB 2WMHA 4OTXL 5GGVY 1BMGA 1XL9A 2NX9A 2IPKB 4HK3J 4A3QA 1JZGA 3H9SD 2GTZB 1EO5A 2X4NA 5I16A 2I9LA 3WHXA 3EHBC 4YLBA 3ZN6A 4DUXA 1MQPA 4F0RA 5K59E 3G7TA 4LL1A 3VG9C 1T7YA 3W24A 3M0KA 4QO1A 3HG1D 1X5JA 2NNAA 2V37A 1SEQH 4U6TA 4ANVA 1OFOA 1WHOA 1TWIA 3I4EA 3VAVA 3TTQA 4UTKA 1LL1A 4PR5A 2X1OA 2VN6A 5J7CC 1FWSA 1U8CB 3TYGH 5HI3C 2D24A 3TNOA 4APXA 3BP5A 2ZZ6A 1KYOJ 3EWDA 2Y7QA 5DURB 1TMLA 1A6WL 3CVIL 1LDCA 4D6FA 2V17H 2XV2A 2O7QA 3KBJA 5GS2H 3MWCA 4JQVC 3WKNA 2GKIA 4JX5A 3K2MC 5EO9A 4N28A 5FA4A 1TZHB 2G2NA 3V5HB 3KLAB 4BGDA 3QTPA 5CPNA 1AYOA 4Z7NE 1NTHA 4MMZB 3WIIH 1LL4A 3HS0C 2UV8G 2XWJA 3UZWA 4CSPA 4WEVX 3HC3H 1Q8JA 2FQEA 4ERIA 2GAZA 5AVXB 4NQED 3MGTB 4XPAH 4XN2A 3L8QA 4AVNA 5HHQA 3KWWB 2VL5A 3O6FA 5AKSA 2XETA 2YBRA 4H8PA 3O8XC 2FD6H 1OGPA 4KX9A 1RJLA 4XCCH 1CCWB 3PREA 3H2CA 3S5NA 1B0IA 4Y5VB 1K7XA 1HJSA 5CGYD 4AF0B 4KTGA 1KFGA 2XXMB 3MI6A 2VX5A 2HPMA 5EBGA 3E2RA 4Y5YC 3C2YA 1EJRC 4AGMA 1UOVA 4NX5A 2V3FA 4O19A 5AVSB 4YHIA 1W3IA 1U8MA 4GQZA 4Y1AB 1LP9E 2OP4L 4DPCX 1EWDA 1MCLA 2X1RA 3SSZA 4F20A 4B53A 4HYTB 3RWCA 3NQ6A 4MY1A 2AW2A 5T33L 2Z26A 1GY2A 4HD5A 4PJ8D 3LZNA 4DCQB 1A5NC 3M5VA 1HAUA 2JCWA 1U22A 1KTDB 4JR5A 4F8XA 2WW8A 3HS9A 3M8OH 3QJQB 3H2WA 1A1NB 4X0KB 3P0XA 1VFTA 4XXWC 3UJTL 4GNKB 3BFQG 4B3VA 3OKMA 4MKTA 5J4MA 1S3RA 4GXVL 4FXKA 1UCBL 1J01A 2AC0A 4X6BA 5LUMA 4ZS7H 3O81A 1IR2A 1DQJB 1IQWL 1RSCA 2WNXA 3BK0A 4OTXH 2J7HA 3GFXA 4GY7A 5A6LA 1B5TA 1E0XA 5C9ZA 4TN9A 4NO0B 3NCYS 5HWJA 2XV3A 1ITQA 4PRBA 2A77H 2H2SC 2Z8WC 1A14H 3PGDB 3UAJD 5IQMA 1SNRA 5EC2A 1XZWA 4CQ8A 3K1KC 3APNA 4ZUUA 2NXYB 3V5HA 3W7HA 3T0ED 4WKZB 1U93A 3HBZA 2N7AA 5AYZA 4KDWA 2X6VA 3IF1B 4K73A 2NY2B 1SOXA 2Y1HA 2EF9A 4M93B 2IWGA 3RBGA 3LCYA 3CSTA 1BAFL 4WW2B 3DYOA 3PWPE 1QO3B 3SE4C 4F66A 3PBMA 1BIIA 4MXQC 1HQTA 2EDNA 1TSHA 1HKIA 1P7QB 4O2CA 5FYJU 4NI6A 4MGXA 3ONCA 3PL6A 5D9OA 4HU3A 4NPKA 4H44C 3G1AA 3UXDA 2VLRB 5GZNA 4L1WA 3L5WB 1LWRA 4N2DA 1JYXA 5IVXB 3DMMC 1EC8A 4O1DA 3FSVA 3ISRA 3BO8A 3S4SA 1JF5A 3GZPA 5JMUA 4X80H 3WS6C 4V2XA 2CU0A 1D2OA 1F4XH 1GGYA 1RIHH 3FBKA 3O4OC 3B9OA 3FA3A 1EA0A 2VL4A 3ET9F 4Y1AA 2WUCL 4FG6D 4UTBA 3WKMH 5JORA 3MCKA 1QWHA 4LCWA