4XK2A

Crystal structure of aldo-keto reductase from polaromonas sp. js666
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
344
structure length
317
Chain Sequence
b'SMEHRYLGNSGFKVPALGFGTGLFDVAGARRIIDICLDAGVNLFDTADVYSNGASESILGAALKGRRDKAIVSTKLSLRIGEGPNDVGSSRHHLIAATNAALQRLDTDYIDILQLHAFDAMTPVEQVLGTLDDLVRAGKVRYIGLSNFSGWQLMKSLAAADRLGLQRYVANQTYYSLIGRDYEWELMPLGIDQGVGAIVWSPLGWGRLTGKIRRGFAPPVDDERLYRVVDAMDEVALETGKTLPQIALNWLLQRPTVASVLIGARDEEQLMQNLGALGWQLTTEQVARLDAASAVTPPYPYYPYWNGQFAERSPVAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo/keto reductase
publication title Crystal structure of aldo-keto reductase from Polaromonas sp. JS666
rcsb
source organism Polaromonas sp. js666
molecule tags Oxidoreductase
total genus 118
structure length 317
sequence length 344
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4xk2A00
2WZMA 4WRHA 4WDWA 3KRBA 2ACQA 4YVPA 2FZDA 4OTKA 2IPJA 4GQ0A 1EF3A 4ZFCA 3LENA 3R7MA 4JIRA 4L1WA 2HEJA 4GACA 4PR4A 3D3FA 4WDTA 3UGRA 3F7JA 3ONBA 5JH1A 4WDUA 4LBSA 3LQGA 4HMNA 4LB4A 2ACUA 2IKHA 3GHTA 2HE5A 3Q65A 1Z9AA 3LQLA 3U2CA 3H4GA 1YE4A 4QBXA 3G1RA 1RY8A 3LBOA 3WBWA 4JQ2A 1A80A 1LWIA 4YU1A 2FZ8A 1UR3M 5KETA 1IEIA 2PDJA 4RPQA 4PUWA 3S3GA 4HBKA 3EB3A 3V0UA 2DUZA 2HVOA 2ALRA 1RALA 2BGSA 4DBUA 4JTCA 1HW6A 4GCAA 1Z3NA 3O0KA 1ADSA 3BCJA 3R43A 4Q3MA 4L1XA 1YNQA 1S1RA 4YVVA 3MC5A 4JQAA 2PDUA 3GHRA 3WBXA 3C3UA 2FGBA 3Q67A 5LIUX 4EXAA 3UZZA 5LIYX 2R24A 4WEVX 1Q13A 2F38A 4NKCA 4QX4A 1Q5MA 3CV7A 2PDKA 2NVCA 2IS7A 2FZ9A 2AGTA 1VBJA 2PDIA 4LB3A 2PF8A 4FZIA 4XO7A 3GHUA 1FRBA 4XVEA 2PD5A 4PUUA 2PDNA 4FA3A 1AH4A 4H7CA 2PDXA 2PDBA 4JTDA 2PDQA 2IQDA 2I17A 3WG6A 4YS1A 2BGQA 3RX2A 3WCZA 3CAQA 3RX4A 3DN5A 3FJNA 3MB9A 2WZTA 1Z89A 3LZ3A 3M4HA 3V0TA 1YNPA 3LN3A 3EB4A 3N2TA 2PD9A 1MZRA 2IKJA 1AH3A 1MI3A 4XVDA 4FAMA 4XO6A 3UZYA 2F2KA 4XZLX 2IKIA 3VXGA 4PMJA 1PWMA 1AZ1A 5LIKX 5C7HA 4XZIA 4GIEA 3V0SA 3GHSA 4WGHA 2FVLA 2P5NA 4LAZA 3UG8A 2J8TA 2PDGA 3NTYA 1EL3A 1C9WA 1QRQA 2ISFA 4H8NA 5HNTA 2DUXA 2IQ0A 5LIXX 1SM9A 1RY0A 4GA8A 1PZ0A 1XGDA 5JH2A 4GQGA 4LAUA 1T40A 1Z8AA 1EXBA 1XJBA 3G5EA 5HA7A 3UFYA 3FX4A 3V35A 2HDJA 4XZHA 4G5DA 3CAVA 3N6QA 3UP8A 1QWKA 1T41A 4AUBA 4PRTA 1PYFA 4QR6A 4QXIA 3BV7A 1LQAA 1X98A 3RX3A 4JIHA 3UZXA 3M64A 4DZ5A 2PDFA 4PRRA 3V36A 2PDYA 2PFHA 2PDLA 2HV5A 3COTA 4R9OA 1S1PA 4IJCA 3WBYA 4JQ1A 3CMFA 2INZA 4XZMX 3CV6A 3R6IA 3LEPA 1GVEA 3ONCA 1M9HA 4ICCX 3UZWA 2A79A 1J96A 1ZUAX 4FALA 2ACSA 3BUVA 3R94A 4JTRA 3LZ5A 2ACRA 2CLPA 4JTAA 3LNMA 1X97A 2QXWA 1K8CA 4MHBA 4Q7BA 2BP1A 4XK2A 3R58A 1YE6A 2DV0A 2IPWA 4EXBA 3T42A 1MRQA 2R9RA 5DANA 4JIIX 4JQ4A 5AZ1A 1XF0A 2PDPA 1AZ2A 3B3DA 1X96A 2C91A 4JQ3A 4DBSA 1ZQ5A 2PDHA 1EKOA 2VDGA 1VP5A 1PWLA 4IGSA 2PEVA 1S2AA 2PDCA 4DBWA 2HE8A 3EAUA 3H7UA 3CASA 4JTQA 2INEA 5AZ0A 3LUTA 2PDMA 2I16A 4YVXA 2IPGA 4XAPA 2PZNA 2PDWA 2IKGA 3H7RA 3BURA 4F40A 4IJRA 2IPFA 5HNUA 1OG6A 2NVDA 1US0A 3R8HA 5M2FX 4WDXA 1IHIA 2FZBA 4I5XA 3O3RA 1JEZA 4GABA 3GUGA 3M0IA 3R8GA 1AFSA 1HQTA 2HVNA 1R38A 3P2VA 1ZSXA 4ASTA 3ERPA 4XZNX 3QKZA 5LIWX 1S2CA 3DOPA 3LD5A 3UYIA 1ZGDA 3UWEA 1PZ1A 4LBRA 1AH0A
chains in the Genus database with same CATH superfamily
1GTEA 2YBVA 5A8PA 3PY2A 4BWLA 3WD3A 1LORA 4F0LA 1H50A 4LW7A 4C7GA 4ACYA 2PODA 1R2SA 5FF2A 3L4WA 4IPJA 4JIRA 2BMBA 4PL2A 4XTDA 3CAKA 4XKYA 4YJ5A 4FEZA 3SUWA 1T7LA 3MKVA 5JH1A 1S5NA 1EA9C 2NXIA 3EA2A 1M41A 5GNXA 1AJ0A 1R87A 3PUOA 2C7FA 1W8GA 4UCGA 3WD2A 3AYSA 1YYAA 3WNMA 1QW9A 2IQTA 4ML4A 2HE5A 3MU7A 4GXMA 1WAWA 3MW7A 3AHXA 3Q65A 1JZ4A 3NL3A 4FP1A 3H4GA 3CEUA 1MW1A 3EOOA 3LBOA 4R7OA 1KB3A 5H8PA 4OV4A 4Q4PA 3TWAA 3PWIA 3CO8A 2GFTA 5EFFA 2VEKA 4PUWA 1GQJA 1I2OA 2HVOA 3WUGA 7ODCA 2PI6A 1AD4A 1GNXA 5KZEA 4X2RA 1TV3A 4GQRA 4GC4A 3DKJA 2FMNA 2QVHA 2J25A 1ADSA 2OOFA 3G8EA 9CGTA 4GZIA 4AMCA 2Y8KA 1KA9F 8RUCA 3B0PA 1NWTA 2P8CA 3GHRA 7REQB 2E3ZA 3GX9A 3UA4A 4ZSTA 1JCXA 3HPAA 4AY7A 4FK9A 1B2YA 5LIUX 2OEMA 2WW5A 2PLCA 3AWNA 4NF7A 3C2FA 1VFLA 1ZZMA 3M0YA 1T96A 4PBFA 3W1QA 3WD1A 2FZ9A 5CPNA 3W1AA 3RO6A 1O5RA 1QVBA 4F2TA 3WDQA 4PUUA 4AFYA 2Y7GA 4BQ5A 1NWRA 2Z1BA 2PDQA 1HO4A 3EDJA 1OFDA 5JVLA 1TYGA 3HGSA 2V68A 5CBJA 3HGRA 1M53A 3W6LA 3FJNA 4U5IA 3MP3A 3UWQA 2BV9A 4MOZA 2FFIA 1V3IA 3VTRA 2CYGA 3DX5A 4KIEA 3T4WA 3TLLA 4QJ4B 4LEQA 2YL9A 1JPDX 1S2VA 1W54A 1R9XA 4CNTA 1AH3A 2JF6A 3KP0A 3UR5A 4DRSA 1Z7AA 2W61A 4EF8A 3RYSA 4QROA 2A0NA 4D8AA 4OHQA 4AEOA 2RUSA 1EFZA 3ZIZA 1GW9A 5HANA 3IK2A 3JR2A 1SUXA 2FVLA 3GG7A 2Q09A 4QE5A 3GC2A 2PP3A 1EDTA 4PEEA 2CU0A 1NJJA 4IPNB 1WOAA 2WMIB 4CNNA 4ZQMA 3G0SA 4PB4A 2WKGA 1BRLB 4W89A 1H11A 4F9JA 4ZE4A 1OADA 2RGMA 3FXGA 1J5TA 3BAWA 2JEQA 4J3VA 3W25A 3O8AA 3EMCA 2BOEX 3W7GA 4JTTA 3PN8A 1JYVA 2DFAA 3CK5A 3V35A 2Y0FA 1OHLA 2O7SA 4JXCA 3M43A 3ABSA 3N73A 3PG9A 5LXEA 4I5UA 4L9XA 1F2JA 4JIHA 5BWFA 3W75A 1YW1A 4DZ5A 3LERA 2YR1A 3EPNA 2NX9A 2PFHA 2PRHA 1XQKA 4LUTB 3NDZA 3W2NA 3ZFHA 1TQXA 3PJTA 4PB5A 1R3WA 2BGNE 3LGDA 5D9MA 3TYEA 3IVSA 1NF7A 2G3IA 2PGFA 1ITUA 3AXIA 3UNDA 1FWNA 4HYWA 3G0UA 1Q6OA 4G9PA 2UY2A 2QNEA 1B3VA 3TJIA 1VPXA 1FWGC 5C9XA 1TVNA 4PTVA 4MB3A 3MSRA 3P74A 4FALA 2WKJA 3R94A 1JI2A 4DJFC 4GFIA 3DFPA 4DYKA 5C70A 2CWNA 4IL0A 3LG3A 2OR2A 3L67A 4WGXA 3W7RA 3W72A 3HG2A 3QW4B 1SJBA 2P3ZA 1JZ8A 4ZGYA 1MQPA 2XINA 2PA6A 3ZJ6A 1SQ7A 2R9RA 3ARSA 1VCVA 2DH3A 1VFOA 1I45A 2B0MA 2BLEA 4GJJA 3H2MA 3KS6A 3OYXA 4H9XA 1J9YA 2Q3OA 2R1LA 1OEPA 4UTFA 1PWLA 3MKCA 4Q33A 4HPJA 1GKQA 3QJAA 2HCVA 3KL0A 5I3DA 3EAUA 4KPLA 4Z1YA 3E2VA 4GBUA 4NHVA 3ANVA 3BQ5A 2XM2A 2O4QA 3WDHA 2PURA 3E6EA 3GUWA 4PEKA 3VE7A 3CT2A 1JCLA 1S46A 4H8UA 4JTIA 3APTA 4NU7A 5HWJA 3WLRA 4AC1X 2ZOXA 1XYBA 2J7CA 4Y8EA 3TN5A 3UXLA 3VIGA 1UJPA 4L64A 2X7VA 4W88A 3IPWA 1RHCA 1HKWA 4GYPA 2E6AA 5M2FX 4RJEA 2DZSA 4KFPA 2YA1A 4AYGA 1J0YA 1G4PA 9XIMA 4AIBA 4MLJA 2Y2WA 2BY0A 1L6YA 4AZBA 1CECA 4GO8A 2X1TA 5XIMA 1E9IA 2ZUUA 1GOXA 2CLLA 1K9FA 4IGMA 4UFJA 2JKEA 5H2ZA 4W7VA 5FJJA 3OBEA 3OB8A 4S3CA 4GXPA 4ZO7A 3MZNA 3DGRA 1XSKA 3MVIA 4NJIA 4H8HA 5HATA 1L6GA 1EDQA 1H7WA 2CHOA 3ABZA 4GX8A 4UTMA 3CUJA 3MZ2A 1ITQA 3OLEA 4GUIA 1EBHA 4IMDA 5AHMA 3EX2A 4WDTA 1HJWA 4A8NA 1Q6CA 4P7LA 4BEQA 3K4DA 1BQGA 1F6KA 2Y88A 3AISA 3A9IA 4EIVA 3PTDA 1G94A 5T26A 1PHQA 1TV5A 1E9LA 2QR6A 4EP8C 1RVGA 1MDLA 1K9TA 4NYUA 5LZLA 1RY8A 2HRWA 2QYGA 2XM1A 5C0QA 2R91A 1W5QA 2WJDA 1EQCA 1MUWA 1IEIA 3EWXA 1PZ2A 2PDJA 4M51A 4DUOA 3QYQA 3KZPA 4HBKA 1FX6A 4FHAA 4WSHA 5G1MA 1NVMA 2X2GA 2C18A 3TYAA 3DFQA 1E4LA 1A0EA 4V15A 1JAKA 1UC4A 1QFEA 2QAFA 1F61A 2JALA 3H2EA 1F73A 2FH6A 4ZOCA 3K2GA 3MC5A 3RIKA 1REQB 3LCGA 3OVQA 4NIRA 2D0FA 3KCOA 2FGBA 2WM1A 4S3AA 2XIJA 3CZ8A 1PYMA 2F38A 1QOQA 3N1AA 3I6EA 2DZAA 3PF3A 3WQFA 4M1BA 3QVQA 5AOUA 5FAJA 4GJ1A 4M1RA 4S3FA 4NZ3A 4LB3A 2NQJA 2PDNA 3NWRA 4DVOA 4IFOA 4JCLA 4X61A 1DIEA 3V1PA 3BOFA 4RLIA 5LA0A 3NZPA 2XH2A 2YDQA 1DORA 1DIOA 2EG7A 4AD5A 4P8VA 4UZSA 2BBFA 3DFHA 3UZJA 4IUGA 4C1LA 4US6A 3GIQA 5J04A 3V0TA 2XFYA 4J5NA 2FHFA 2J7HA 3CHCA 4CQAA 1NU5A 4DUVA 2NLIA 4W8LA 2VR5A 3L12A 4S1FA 3BAIA 4PUDA 3WBAA 2NV2A 3AYTA 1XLLA 3UZYA 3VXGA 1DWHM 4K8HA 3PZGA 5LNUA 3H53A 4ILSA 4OV9A 3ITYA 3RCMA 3PBUA 3LV5A 3NUKA 4LAZA 2YDRA 1DWAM 3LPOA 3CUZA 3KOFA 3G1XA 4K7VA 2HXTA 3GZ3A 3IEBA 2W66A 4D6JA 4S3JA 2IQ0A 3GDBA 1W9VA 1E55A 1LL6A 2YCEA 4CEUC 2RAGA 3QQ0A 4GI8A 3VKKA 2I5QA 4XKMA 1YIXA 1HGWA 4HA1A 1E3XA 3B8VA 3C2RA 3M16A 3ZXWA 2DH2A 2HMCA 3HZ3A 5FCZA 1JQXA 1G4EA 3QGAC 5A8GA 4QQUA 3W4RA 3BAXA 2OX4A 3EXSA 3W53A 1LWJA 4ES4A 5AVNA 3SY5A 1PTGA 4HZMA 3CTLA 1LQAA 1OC7A 3RF9A 2WJEA 4DN1A 1LT8A 1RQHA 1DVJA 3BMVA 4ZSUA 2XWDA 3V5CA 1W3TA 1XLJA 3GG0A 1S1PA 1JVNA 5FAGA 3QLLA 4L65A 2GUYA 4GNKB 1SO4A 3GDKA 3F5LA 1XCFA 4P8UA 3KL5A 5A6SA 1GWJA 4ORMA 1UOKA 1E4NA 4O15A 5D38A 3ZQ9A 2OWCA 4EPEC 2E6DA 3LV6A 1AW5A 5DMMA 5G4WA 1WXJA 1OYCA 3QQWA 2ACRA 5DLCA 3EWBX 4O18A 1FHUA 1W31A 2R8WA 5I24A 4NAEA 5AYXA 2CITA 4AWUA 1LG2A 1JAEA 3I3BA 1ZAJA 3WQ6A 3NOEA 1VGAA 2GWGA 3LYEA 3N2OA 1F3WA 2DSWA 2E09A 1TV4A 5CC6A 1LCOA 2O92A 4L4OA 2AL2B 2G3FA 4KW2A 2ZWYA 1PCKA 3FA3A 2ZX9A 3LK6A 4ZXOA 2XH0A 1MRAA 4ZA0A 1XKYA 3HIJA 2F9RA 1WDQA 1E1CB 1W17A 3EXTA 4TUFA 5G5IA 1KBBA 2UV8G 3BG5A 1BVNP 4D6EA 3P0XA 5HWMA 3AXXA 2NQ9A 4F2UA 2B7NA 1EB3A 1T8XA 3T2PA 4WIWA 4JFUA 2D2HA 2VUNA 3VDBA 3LM7A 3T08A 2R1PA 3BURA 1R86A 4E0CA 3GZAA 3KDOA 4E8GA 3KLLA 4MLRA 1EJXC 2OVLA 4F0RA 3E96A 3W26A 1IHIA 2VEIA 4FIRA 3VGHA 4U5KA 2Z27A 5JBEA 3S6DA 4JIQA 2W91A 3TNBA 3TW7A 1PIIA 1KGXA 1EOKA 1ZSXA 3APYA 4IG2A 1EJUC 4C91A 3GNNA 3QPZA 4XZNX 4O19A 3O6CA 1IYXA 5EMUA 4LBRA 2ZWZA 5T91A 5REQB 4GO9A 4AIEA 4UTJA 1EYWA 2GUUA 4AZIA 1NOWA 4UFKA 1FA2A 2ZUMA 2DT2A 1FWRA 4HGXA 3QHOA 3W71A 1L2QA 1QW8A 4Q4MA 2VC6A 3C86A 1VENA 3QFWA 2ZZ2A 3NQVA 3NDYA 5E09A 1LM1A 3JVAA 3EEZA 1KKOA 1H49A 5I5RA 3OODA 2VQTA 3UEQA 4I8DA 1FWAC 1EGMA 4YNGA 1Z9AA 4RNFA 4PH6A 3U2CA 3EWUA 4ZL1A 1NFBA 5IOBA 1TV2A 2OLSA 1EC7A 4PCPA 2Q8ZA 2FZ8A 4HMDA 5CAHA 1NFGA 4MNLA 5KZDA 2BG5A 2CWXA 3AXHA 3O06A 2NV1A 4HTBA 3SN0A 3ZLHA 3RILA 5A5WA 2ZZ7A 3LLFA 4TMBA 2X1UA 3S5ZA 1OCBA 4C6EA 1J01A 3MV11 4LCRA 5EMKA 2H9AA 2QIIA 3MYPA 4NY2A 3PG8A 4DI8A 2WLYA 3LMZA 2PDUA 2GVYA 3GR4A 3C3UA 4EANA 2HPMA 5KMYA 2BSLA 1Q65A 2XPKA 4EXAA 4CUCA 4A35A 2DDXA 3ZT5A 4JTJA 3CUHA 4AVOA 5DT5A 2X1RA 1BTMA 2WQDA 4I6KA 4NAFA 3SUTA 2ZC1A 3C52A 3VIFA 3CEPA 2YXGA 4LT9A 3IJ7A 3OZOA 3CTTA 3WMBA 1XFCA 1EGVA 4NX5A 3FDKA 1VS1A 3VNZA 3RX2A 2JEPA 1KM5A 3DN5A 3ANUA 4C65A 1TWZA 3E9AA 2WZTA 5HMSA 2YA2A 1B5TA 3M4HA 3QHNA 3RCNA 5HMFA 1GTHA 2ZFAA 1O1ZA 3BG9A 1TUXA 2BS9A 2J13A 4ZEPA 1HP5A 2VFGA 4HK6A 2HBVA 3P5YA 1HJQA 2E9MA 2GGHA 3T81A 2PCEA 2Y8VA 2V5CA 1W1IE 2OQLA 5AC8A 1NIUA 4UFMA 2C71A 3IJIA 3N29A 2VFIA 2ZKMX 4Z2JA 4AH7A 4MIMA 1V6TA 1UD3A 3P93A 2ZZ4A 1E15A 2DT3A 1OFOA 3GNPA 2BY2A 5HNTA 2DSKA 3EDDA 4C1NA 4F4RA 3R1ZA 1VIWA 5RUBA 4ZENA 3TV8A 2E77A 1Q85A 3HPZA 4MB1A 3W83A 3JZUA 1H7XA 2YPIA 3SCUA 5BXSA 3UFYA 1FP8A 1ICQA 3WL0A 1JULA 3AYRA 5A94A 3F5JA 1DTNA 2J6XA 1QWKA 2AAAA 4XWUA 4I9MA 1Q6RA 4Q4SA 2QV5A 4LGXA 3DERA 4W9TA 5A6JA 3UXKA 3HMJG 3M64A 4B90A 1E9ZB 3ARVA 3W24A 4GVGA 3TWBA 4GY7A 4US5D 4PRRA 1YDYA 1KXQA 3V36A 1VHNA 4GIAA 4OIFA 3SUVA 1ZJIA 3HJEA 1SO5A 4JQ1A 3PC0A 3CMFA 2Q8XA 3BANA 3TR2A 3AMGA 1DP0A 4IQDA 1GVEA 4PN2A 3P0WA 2PRLA 4LFYA 4MPQA 3UWVA 2DT1A 2A79A 3U7VA 4KWOA 3AS1A 3V4BA 2DJXA 2OYLA 5MKGB 5FF0A 4HPHA 2ZTKA 4GMEA 3W6MA 4QQ3A 4LC6A 2A5HA 4R7WA 2WNZA 1AODA 1F3XA 2ZX8A 2J27A 1UIPA 4JNYA 3OGSA 3G0XA 2G4FA 4I7UA 1MEIA 4Q8NA 3MSDA 3A4XA 1PE1A 3F4CA 1FP9A 2VEGA 3EPOA 4JL2A 4X3ZA 2ICSA 3TK7A 2XN0A 1QNSA 1V3MA 4DIAA 2PWGA 1PO9A 4RCXA 1XFBA 2C91A 3EBVA 1XL9A 2QQ6A 4HOZA 4H8VA 4A3HA 3W76A 3W38A 1NFPA 4NL1A 3VMOA 1P5BA 2VGFA 3MMTA 2E68A 3M5XA 3RFAA 4UTTA 2DUAA 1KRCC 3H21A 4PMRA 1FQ0A 3URNA 3AMLA 5I3FA 4AAJA 1GUVA 3M07A 2AKMA 1HL2A 3TZNA 1W37A 4KESA 4JYDA 2PCQA 4OVXA 1CXLA 3BJTA 3D47A 3W7JA 1US0A 1CGXA 4R5EA 2XVPA 1DIDA 3B40A 1C9DA 4ATDA 2OZTA 4IFKB 1VLWA 3L4TA 4E38A 3KWSA 1CCWB 1UBPC 4S3KA 4DO4A 2JE8A 3F4VA 3WBEA 4CCEA 1E6ZA 3R8GA 3ZSSA 1L0PA 1Q66A 1EZWA 3A21A 1VQTA 3NO3A 1RLDA 5JIPA 3WJZA 1IGWA 3P2VA 2GVJA 4PULA 4PGLA 4D8LA 1UPPA 1US3A 3U48A 2WLZA 4LNCA 1JQVA 1JZ3A 3L0NA 4QRNA 5DXYA 3SSZA 2H3BA 2HNHA 3U7BA 1PZ1A 2ZA3A 2Z1WA 4RZ4A 4GH3A 3TN6A 2DSVA 2V3DA 5EPDA 2F84A 3CYJA 4OOZA 4LUSB 1M6JA 3HF3A 2GQ3A 3UG3A 1JNDA 1POJA 3CQKA 3BZGA 1IWAA 3O16A 5KTLA 3WLJA 1FCUA 3TJ4A 1E3ZA 4E2OA 4RE3A 4WY0F 5LYRA 3O9NA 4Q6JA 4E4FA 4NNBA 3VNJA 2FJUB 1LTDA 1JDDA 5A6BA 2J7GA 4HT3A 1YTKA 1J4EA 1Q6GA 3L7RA 3DHPA 2D3LA 3CL7A 4ROPA 3S3GA 1RCQA 3UPBA 1OX4A 3EA1A 2POTA 2G41A 1PKMA 1PIFA 1E6QM 5A8NA 4HPXA 4UTWC 3O0KA 1NELA 1IXPA 3WJYA 1P6BA 5CJ5A 4MWAB 4JKLA 1HFBA 5DY3A 3NNTA 1O4UA 1QASA 4YWIA 5ECVA 1GVQA 4OQVA 4HU4A 4IPLA 1PX3A 1S5WA 1HKIA 4Q4QA 3QKEA 2R24A 4PTNA 4WSJA 3UWZA 4KWWA 4NKCA 4QX4A 5DCEA 1HX0A 3W1XA 2FIQA 5FL1A 1WQ5A 1H4PA 5D32A 1I60A 3UESA 5IXEA 4TTUA 1O12A 3IV3A 1J2BA 2OZ3A 1A5LC 1QTWA 3T1GA 1R3RA 1K7FA 4RW3A 5AC7A 2BXZA 4E2BA 3SGUA 2VZTA 1F8IA 1UP2A 5I3JA 4OT7A 2D69A 4PTMA 1GZJA 4BHYA 2WNNA 4NNAA 4WF7A 4PTWA 1XIIA 3M7SA 4CVUA 3DESA 1KM0A 4NZCA 4E4UA 3P67A 2XGIA 2Z0IA 3WNNA 2NX3A 1BD0A 5IBXC 4C1KA 3GU1A 2PD9A 2OB3A 3CV1A 4XSLA 3POCA 5CZJA 1EPVA 3LCHA 2B31A 3VZXA 4GNVA 5A2AA 4NVTA 4XO6A 4J28A 4AHQA 5EY5A 3E5BA 4AEEA 1PKYA 4DJEA 4CD8A 3W1TA 3ARPA 3V0SA 3B06A 1WKFA 3WQCA 3LXAA 4DWSA 1JF6A 3NQ6A 2EG6A 2P5NA 4X22A 5D33A 1UUOA 4CNSA 4AY1A 4BF5A 4I8YA 1WPCA 4BJHA 2J8TA 2O4MA 4DWSB 3W82A 3CQIA 3T4CA 3ZSTA 1SW7A 1Q6EA 3A3XA 4NZ1A 3VCRA 4PC8A 1YEYA 4N6EA 2G95A 5EBAA 2CLKA 2QMKA 2VZVA 4H1ZA 3GAYA 1LBLA 3LMYA 1D3GA 2ZUSA 4UTHA 3WH5A 4ORIA 4YYCA 4GNJA 4MUZA 1U2YA 1ZFJA 4JFVA 1R6WA 3S6TA 2PUZA 3N14A 3BW4A 4NASA 1F6YA 3N9SA 3EMQA 3FSUA 1HJUA 2YB4A 5FSEC 5CGMA 1F8MA 5CPOA 1ZENA 5H1WA 3UERA 4FNQA 5CPTA 4GKLA 4HU3A 1DQUA 2CETA 5DRCA 4OBTA 2FH8A 2FGZA 4KS0A 3SO7A 2LLEA 4GIYA 4PRTA 2FFCA 4QXIA 4ZB2A 3THAA 1MVYA 1YDNA 1X98A 4WK9A 4O1AA 4KMQA 2Y5SA 3VCNA 4H9YA 1PEZA 3B9OA 1BHGA 3W7LA 3GK0A 4GYPC 1QO2A 1GEQA 2XDFA 1KC7A 1AMKA 5KZMA 2UBPC 3NFUA 1K77A 5CPSA 4XZMX 1IXQA 3SRKA 3VKCA 4H7ZA 3TAOA 4KCTA 4P8WA 1UR8A 6XIAA 3WF1A 1KRAC 2OGJA 3HPXA 2A7RA 1BWKA 4L6HA 2OT1A 4P7QA 1KTBA 2BB0A 2JKPA 1W9XA 3CIXA 5E6YA 1QNVA 4V1YA 1UR0A 5D04C 1XKJA 3P7YA 5CSRA 1BG4A 3FGCA 4TOQA 1K8CA 1EWEA 3KBMA 3GXPA 4Q7BA 3WH6A 5BXPA 2HROA 4O14A 3FSTA 1DJNA 2CZ5A 4DZIA 2W5FA 1BVWA 5AC5A 3AZRA 2QDHA 4GH1A 3VUPA 2WMHA 2NQHA 2OU4A 4IGNA 2ZRZA 1GORA 2QDDA 4NRSA 4MDOA 2Y7FA 1DWIM 4GZ7A 2PE4A 2DIEA 3P80A 3KLKA 3UWWA 4I7VA 2PB1A 4QG6A 2PEVA 3AOFA 4FF7A 4EAMA 4DBWA 4M5PA 1QPRA 2CLMA 5AZ0A 4A6GA 4WY0B 5LA1A 1R3VA 3CZJA 4GBDA 3GQYA 3N2CA 5BCAA 4AB4A 1ZJAA 3AIQA 1HO1A 1TIMA 1TKKA 1W5MA 3H7RA 3GO2A 3VX1A 5KEZA 4HZ7A 2C1IA 2CZDA 2WVSA 4F40A 4UR8A 3NVDA 3IJDA 4JPGA 1AQMA 3L0GA 6TIMA 1BPLB 5I0DA 3CM4A 4XISA 3ZR5A 4MNMA 1XYMA 2DORA 4HYRA 3ZOAA 4U31A 5AYIA 5I7GA 3H24A 4PYSA 4KEVA 1UUMA 5ABFA 4MWAD 1HJSA 4Y2WA 1ME9A 3LDVA 1AMYA 1W91A 2WXDM 1W9BM 3WL1A 1KBLA 2DU2A 3LHZA 4IM4A 3APGA 3RM9A 4GYJA 3UWEA 3NZGA 2YIHA 2WSRA 4O16A 1UIOA 2GWNA 4XD6A 1HIZA 1QUMA 3HB9A 2FZDA 4O1FA 3VZYA 5K3VA 2Y6ZA 1EF3A 1O1HA 3MS8A 4JNZA 3VD7A 4GACA 4RPPA 2V81A 2HSAA 3WLPA 5A2CA 1G67A 3OP2A 2C15A 4Q8PA 1LQ2A 3FYPA 3ZS4A 3W84A 1XIFA 4FNTA 5BOFA 3BSGA 1YDOA 3EPMA 4HMNA 4KGJA 4I7WA 4CQ8A 4HNUA 3QZAA 2ACUA 2IKHA 3GHTA 2Z25A 1V4YA 3W1NA 3NQMA 1W3NA 4QDPA 3S0CA 3TDFA 3EDKA 1YBQB 2B7PA 3KTCA 3G1RA 3CQHA 2J9ZA 1LWIA 3NSXA 1KR0A 3L0KA 4EVZA 1J79A 2EPNA 2E9LA 2IXVA 3T0TA 3DI1A 4RPQA 1FWIC 3EB3A 1J5SA 3DEQA 3W2JA 3QMSA 1Q7ZA 3QYSA 1HW6A 2X05A 3WK0A 3G77A 3AI0A 2YSWA 4LTSA 4QS6A 1DE5A 2PS2A 4L1XA 1YNQA 3CWNA 3TYCA 4NG3A 3TSDA 3ARWA 3VE9A 3W02A 1FBAA 3BLKA 4ALDA 5DCBA 2XN1A 4ZO9A 2GLKA 4O0ZA 1E71M 5F4XA 1EJWC 1V6UA 3K1GA 3UJSA 4ZB5A 1JF5A 3ARTA 3PUEA 1H51A 1OIMA 3DFNA 3IGHX 3EKGA 3SN1A 3WJWA 2ZQ0A 2NVCA 2XH4A 3T0CA 1E4IA 2A6LA 5C7VA 3GD6A 1X7FA 1VBJA 2ZDSA 4DXKA 7PTDA 3UGVA 4W86A 2VFFA 3NQ2A 4AF0B 1Y8BA 1A5MC 4AZHA 3AJXA 4HPGA 4I9AA 2VC5A 2OSXA 5K9DA 3CUGA 1GJUA 5CLWA 3I6RA 1QMLA 4HNLA 3GBEA 2D22A 1DHPA 2DSZA 3LCWA 3LA4A 3KBWA 3OYZA 3TX9A 3I7RA 1GVSA 5EU9A 3S46A 2Y1HA 4RXFA 3FY1A 3HFYA 3PWAA 1XYAA 4XBJA 4A21A 4ZOAA 1IZCA 1SJDA 1EHAA 4JDBA 3PFMA 2F2KA 3MYOA 1NH6A 1P7TB 3GIPA 4PMVA 4GIRA 2V3GA 3F2DA 3NPWA 2PPGA 3QGKC 4QNWA 4KQNA 3R0UA 2QPSA 2ZRYA 3MI6A 1ODZA 2FTWA 3BLFA 3ITLA 5HK4A 3TYDA 1A5OC 3KRUA 4C6IA 1XBZA 1H09A 3T8LA 2PWUA 2V0TA 4N0RA 2YJQA 1QNQA 2GJLA 5FOOA 1F5ZA 4G7FA 3P6LA 1P0BA 1SZEA 3NR0A 3FJ6A 5C55A 1TTIA 1VYPX 4DHGA 1XLFA 2E6YA 3BLLA 3UXDA 4D6FA 2XIBA 2ZRVA 3ITTA 1TA3A 1V51A 4M7SA 1XICA 3SURA 4OJYA 3S47A 4FNUA 4GQBA 3VKAA 3AO0A 4C7DA 3B0UX 5KITA 2ISDA 1WYIA 1PYFA 3ZVHA 2YKKA 4LVFA 3CLWA 3WLIA 3RX3A 3WDRA 4K37A 3WQWA 4JTGA 2INFA 4O53A 2E1WA 1JGMA 1OABA 1SMAA 3WF4A 1E6SM 1E5JA 3QLDA 3I7SA 1GJWA 3WNPA 5L9FA 2INZA 3DBNA 1I8JA 5F7UA 3K8LA 2BXVA 1W8SA 2YL6A 3AALA 2DZPA 3M5VA 1UKTA 2ZUWA 3HGOA 4RV8A 2G97A 1E56A 1B54A 3B8UA 1F6PA 1V77A 2PWHA 3IIXA 3N2XA 2ACSA 3QGVA 4DJFA 2C1GA 1RLCL 4DQWA 3D6NA 1FFRA 2NLYA 4B16A 2HVMA 3M46A 4I6VA 3GTNA 4QIUA 1FH9A 1PTAA 5IRPA 3TW6A 4IISA 2DP3A 5CPMA 3BXWA 5JMUA 2HK0A 4LV4A 4X0VA 1V79A 4FOKA 1TMLA 4TTGA 2WVVA 3NZRA 3NSMA 2VVNA 5GJPA 1I4NA 3TTQA 4DJDD 1M01A 1Q63A 3W86A 1H3GA 3WH7A 1TPEA 1X96A 3EKLA 2VRQA 4ZVJA 1U5HA 2WKLA 3N12A 2ON3A 2QHAA 1AG1O 3GVVA 4J35A 3GG8A 3MSGA 3G1VA 2QF7A 1HJVA 3C5QA 4IQEA 1JCTA 1RJQA 4N02A 3HU7A 1NAL1 1KTNA 1KFJA 2W27A 4JGDA 3VKBA 1H41A 2OQYA 3EXRA 4C6CA 5BW6A 1UWUA 1QXLA 1I1XA 3A22A 1JUEA 3GIYA 1PDYA 2GGIA 3S5YA 2I57A 1KQYA 1V02E 2QDGA 3WD0A 3WMCA 4HD5A 3IIVA 2QV4A 3NDOA 4JKKA 1R3YA 4HVXA 3KXQA 4IJRA 3RLHA 4FR6A 1DHKA 3SCSA 4I5XA 3S2LA 3AUJA 3G8RA 2B7OA 1UWSA 3CXOA 1ZP4A 5EMJA 2CLHA 1I2RA 3AS2A 2VGIA 4QCFA 5D9PA 4XTIA 2RDTA 2PTDA 3EKZA 4CQBA 4JY8A 1KGWA 2JF7A 4JFSA 1OC5A 1CTNA 3DOPA 2ZBTA 4FLQA 2CHNA 3IJ6A 3N9RA 3DZ1A 3FXYA 1AUSL 2E0PA 4TX9A 3W87A 3MCNA 4HQVA 3WLQA 5BRPA 2V63A 2QCNA 3VU2A 5LNSA 4O1BA 1AW2A 5HWNA 5A95A 4WJXA 3U5YA 4Z17A 3VAVA 1JXJA 3ARXA 4IWWA 5C9UA 3SCVA 1ML1A 1LYXA 4REQB 3FEQA 1A49A 3BZJA 3RITA 4R3UA 3WF0A 4AYSA 1TZ9A 1ISWA 4M56A 4W84A 1UR3M 1JCNA 1IE7C 4WKAA 3QMRA 4GC3A 4YTTA 2C8NA 4J2PA 3GW3A 4JHOA 3NPUA 5DQPA 3CUIA 3BLPX 3ORWA 1S5VA 3C2YA 5D4YA 4MGGA 4CCZA 2CXGA 2CKRA 3TXZA 1N82A 5LGXA 3TP4A 3A4AA 4JS3A 4HSNA 5I3IA 1R85A 2V5LA 2RHGA 3SR7A 3W2MA 3NQ8A 5TNVA 1AD1A 3UF9A 4WEVX 2RJGA 4R34A 2V30A 3GFYA 3EMZA 1IZJA 4ACZB 2BWGA 4FXFA 2RDUA 2Q01A 4FZIA 2QCEA 1QBAA 3PAJA 3D3AA 3NJ3A 2H3DA 4L9ZA 3UYCA 1MUMA 3PTQA 2CZEA 1H60A 3S2MA 3IAPA 5D9OA 1CLXA 1SFSA 3WG6A 2QCCA 1E0UA 1LRNA 3LBCA 1KGUA 4YLWA 1TCMA 4A8LA 3MY9A 3CC1A 2WZEA 3C0SA 2NVAA 1KV5A 1FH8A 4YCPA 2JIWA 2V5BA 1LOQA 1YPIA 2MUCA 3N11A 4WOQA 1EDGA 4ZR8A 5A1AA 4QISA 1GONA 3M6YA 4RUBA 3A23A 4WQ6A 3DHFA 2FHBA 3FEMA 3EOSA 1L9WA 2O56A 3M0ZA 3B97A 1HXJA 1SVDA 3PUDA 4AIUA 2CHRA 5K2ZA 4PMOA 3O2LA 1U5JA 4F0MA 1HJXA 1FWTA 1HTIA 1WP6A 3DBPA 1TPVA 3DKLA 4OFCA 3VIIA 3VIMA 4MSSA 2EXOA 3QF0A 5KSWA 1P0NA 2PDGA 3PUGA 3WNKA 4V28A 1QRQA 1JGIA 1UZHA 4B4FA 2WOQA 6TAAA 4NJJA 5CC7A 3ANYA 4FXRA 4GFSA 1YNYA 2RFGA 3BGJA 4F79A 2EAWA 2OODA 2P10A 3BO9A 4HNTA 1QNOA 5FIPA 1MEWA 2VFDA 2W3ZA 3O1NA 2EKGA 5JH2A 2Y4SA 3PR2A 3XISA 2PSNA 3CT7A 3P3BA 4HHMA 1ZHAA 6PTDA 3VOGA 3OOQA 3DG3A 3G5EA 3RLGA 5HA7A 3UR8A 3LI0A 4KEMA 3AU2A 3UG5A 3N6QA 4HPNA 5E70A 5HR6A 3AFBA 3JRKA 4AWEA 2J62A 1TG7A 2XWEA 4AZ5A 3GTIA 1M1BA 3CB8A 4F0HA 1UC5A 4YTRA 1E51A 2MNRA 3MMDA 1IEWA 3HO8A 3DU0A 1EA0A 1N2VA 4ENLA 3TYBA 2X09A 2OT0A 1AJ2A 3AXKA 4UNKA 3BLIA 3TA6A 1C8YA 1XLCA 4AC7C 1WDRA 4HU8A 4GISA 4Z2GA 3GU9A 1E40A 2TAAA 7ENLA 1TWDA 2HQAA 3R10A 3K5XA 4ZCWA 4UOJA 1J96A 5SWUA 1ZUAX 5IM51 1JI1A 3EB2A 4MYXA 2NQ5A 3QXBA 4JFTA 3S1UA 1BKSA 2SFPA 3LNMA 2EG8A 3QV8A 3QZEA 4GGHA 4K7YA 4ADTA 4MHBA 4J4KA 4L7ZA 1EJVC 2DV0A 2OEKA 1W1A1 3G24A 2BHZA 1R7OA 2XJ7A 3FHAA 4UFHA 2W4XA 4CD4A 2I56A 2PDPA 5G4EA 1XPGA 4CNOA 4J3SA 7TIMA 1SPQA 3TUUA 2G37A 5T9CE 5A6LA 4NZFA 1FOBA 1BG9A 1VP5A 1OWQA 3UJEA 4NX0A 1P0DA 2ZUNA 4O0KA 2YFNA 5F4WA 3HJZA 3ZYZA 4PCTA 3VNYA 3F2BA 4IMAA 1CENA 3LUTA 3SIZA 2IPGA 4XAPA 1T6MA 3D5HA 3GDLA 1QK2A 2VCBA 4FO4A 2FHCA 1TFVA 1OX6A 4Y6GA 3IUDA 4NQ1A 3E49A 3NGFA 5BROA 1BAGA 2FQIA 3K8MA 4MMWA 3O15A 4UMBA 4J9JA 2NWRA 3E5PA 5HJLA 1L8NA 3WFLA 4EPDC 3BH4A 4JCMA 2FTYA 2TSYA 3W7HA 1QPQA 2EEXA 3G3DA 2QUUA 2QMJA 1XLBA 4B2DA 2J47A 2YCLB 3BARA 4Z0JA 1O68A 4FNPA 1Q6DA 1TV8A 2HVNA 3TCEA 1D8WA 2A7NA 3LNPA 3WX7A 4ASTA 1E70M 1A5AA 5KZ6A 4GVIA 1ZGDA 3EEGA 4UZUA 4RW5A 5CKSA 1JPMA 3CQJA 4LJ3A 4L6OA 4CQ9A 3S2NA 1BGGA 3W2KA 1ZCCA 1V3JA 4Y7EA 5DF0A 3GBDA 1X38A 4LRSA 4LYRA 1U22A 2V6AA 2IPJA 1MXSA 3TSBA 1X7IA 1VJIA 3LENA 1FFQA 4WXZA 3SEPA 3E1F1 4QHRA 1OBAA 3E0FA 3HTWA 3OLDA 4F48A 1E0XA 1Q6QA 2GOKA 1FWWA 3MUAA 1MXDA 3H4XA 5CJNA 2PWFA 1MEHA 1VFSA 4QE4A 2H90A 3LQLA 3G1DA 1YE4A 2C0AA 1ZU8A 5MHBA 4GY0A 1NEYA 2Y5JA 3WBWA 2XH7A 1NY1A 1QAPA 1UOZA 1XIHA 4Q8VA 4Q8QA 3H55A 1MMFA 4C7FA 4NI8A 2WAGA 4D6DA 3GAKA 3L2IA 1GKRA 1RALA 2BGSA 4DBUA 3WYZA 4JTCA 4ML9A 3F03K 1ZY9A 3GFZA 4YTUA 1G5AA 1J6PA 4JTEA 5I3HA 1VR6A 1LUCB 3KUMA 4Y9OA 2GDUA 3G2GA 5BOOA 4JFWA 4BKNA 4LANA 1G0CA 1RSCA 4MJ4A 3HQPA 5LSMA 3TAKA 4NJHA 4GD0A 4AD2A 1KQZA 5A6TC 3DFSA 3II1A 1Q13A 6ENLA 2PZ0A 2PGWA 3CV7A 4MZYA 1RCOB 2REQB 4QFUA 3SGGA 2IXUA 2VTFA 3NQCA 4K36A 5LGZA 2CCRA 4E6MA 1MXGA 1FCBA 1JIBA 4E8DA 3KBJA 5GVJA 2ODOA 2OYMA 1LBMA 1V3KA 1AA1B 4NNCA 1J10A 2IQDA 1T8QA 4JN6A 1XC4A 5F2LA 3ABXA 2BGQA 4L4PA 3ATYA 3UVAA 5AFDA 2JKAA 4PCFA 1V3HA 4ZOBA 1DJHA 2Y7DA 1MSSA 4DELA 4OBRA 3WQVA 3F1QA 1XP3A 3OIXA 2YCIX 3WLHA 3KTSA 4BQ3A 4GVHA 3V16A 3IUHA 3VOCA 3RHGA 2NT0A 4WHBA 1DYSA 1FWDC 4H3DA 3N13A 4Y9MA 3KS5A 5AY7A 2NSXA 3WQPA 2ZA2A 1OGGA 4UTUA 5JXQA 4DAIA 2BASA 4PA8A 5C7HA 1NARA 1JXKA 2NX1A 4BEUA 2QLYA 2CLFA 2DT0A 3TR9A 2QDEA 3RLUA 1QI2A 3QTGA 1WZMA 3VK5A 4UC5A 4W7WA 2JQXA 5G2HA 3FYOA 4C6OA 2BX7A 1ESWA 4G56A 1EXPA 4ZFMA 3LCFA 3WF3A 4CN1A 2VD8A 3BVJA 4IIFA 1JZ5A 1Z8AA 4X2PA 4KERA 2X1IA 4LAKA 2XZ9A 3EWYA 6REQA 1EH9A 1QJWA 3BSHA 3CAVA 3NPXA 3CUFA 4C6FA 3BAYA 1XG4A 3MQTA 3AHTA 3PZMA 3P8IA 3NQ7A 4M0XA 4F8XA 1BF2A 1A5CA 4L1GA 3LPGA 1I9CB 1XWYA 2KAUC 1YMYA 2X41A 3L2LA 4D6IA 1OCNA 2P53A 5E9AA 1B1YA 2YX0A 1MW3A 3H8AA 1A5SA 5I07A 2XIIA 2OFJA 1TUFA 3WH8A 3CZEA 4NRRA 3TQKA 2ZRUA 4UQDA 4A22A 5HNNA 1P43A 5DX7A 1LWHA 3T8QA 3LLXA 1XIJA 2DPEA 2J7DA 1KFEA 4FI4A 3W7CA 3EOUA 3UZWA 2YFOA 3H26A 3ZT6A 1KXHA 2JBMA 3JZEA 1M3UA 3SGZA 4JTRA 2CLPA 2VDIA 2NV9A 2P0OA 1SSGA 1ZAIA 4FX8A 3USBA 3CAWA 4IXHA 5D37A 2NUYA 1OVDA 2Z1KA 5HPCA 4WOZA 1CXHA 3T42A 4GYFA 2RGLA 3DECA 4B5VA 3L68A 3UR2A 2QUMA 4JIIX 4DX3A 3EWDA 4XKYB 1EJSC 1NQ6A 2J7BA 4W93A 1JRBA 3B3DA 1S2UA 3OVPA 1CLVA 4X9YA 4JQ3A 3QHMA 5I02A 1PB0A 3HPFA 1UH4A 5BRQA 1FWBC 3BV4A 4JX6A 5D2TA 4AIOA 1WZLA 1K8XA 1GVFA 3FS2A 4PMQA 4HA3A 4B3ZA 4MZ1A 4O57A 1UQYA 2C16A 3ZVIA 3I3DA 3H7UA 1O60A 3MP5A 2RDWA 1RBLA 4CU8A 3NL2A 1ONEA 2I16A 1B0IA 1XYLA 1R3QA 2PZNA 4Z2LA 1KCZA 2POZA 3M0XA 5C2CA 1KCLA 3EX1A 1ZL1A 3MMWA 3T0BA 1R46A 1KNWA 5CZ0A 4EPKA 1H61A 4WDXA 3SDOA 3WQ8A 3G1AA 4HA0A 2D1ZA 2C13A 1MFUA 4RZBA 3OEXA 1OSEA 1OGSA 1QATA 2W67A 4NZ4A 4EPBC 4URIA 1WV2A 4GG9A 1XBVA 5CLTA 2WM0A 3OA5A 4MKVA 7A3HA 4FOUA 3ZJKA 3ERPA 4RV3A 1V6VA 3QKZA 3U6WA 1MFVA 1XRFA 3LD5A 3MP4A 1F07A 3TOYA 4DYJA 1V5XA 4K68A 5G1YA 2E1DA 1EGZA 3IS4A 3B0YA 5A3HA 2CKSA 3SW6A 4HMCA 4M6VA 2XIQA 1DQWA 4OTKA 5DELA 2VRJA 4Z0SA 4EX4A 4P61A 3R7MA 2HEJA 3UU0A 3BQ6A 1G4SA 1M7XA 1CGTA 1W9UA 1G7VA 4G7EA 3UGRA 5G1TA 1IR2A 5U7SA 3R8RA 3SAZA 1HKVA 4NUWA 4W7UA 2JGYA 1WO2A 2QCMA 1R9YA 1OG0A 3IACA 3W1MA 4CNUA 3PP7A 4TQTA 1K9EA 4N2YA 3CHEA 3PBMA 3CIWA 3PHAA 4UUIA 4IF2A 3MT1A 1QNRA 3AHZA 1OINA 3GC4A 4C6PA 3W07A 4XZ9A 3E02A 3CS2A 3STEA 3L23A 3V0UA 5CC5A 4K38A 2PTXA 3UETA 1RQBA 4UTWA 4Q8MA 3BCJA 3BAKA 3AXMA 5BRBA 3KBNA 1QHPA 3N34A 1E1FA 4EE9A 3RM4A 3WKZA 4J3XA 4AX6A 5TF0A 1UWRA 2OQHA 4RZ6A 4D6HA 1HP4A 2BZNA 2VD9A 5HQMA 1RAKA 2BY1A 3UZZA 3TW9A 3IV8A 3A5VA 1BWLA 1IZKA 3PPGA 1WDDA 5D8WA 4HCHA 2V82A 1JDAA 2C14A 2PF8A 1BKHA 4QS5A 1TZ7A 2QJGA 2PU1A 4AVFA 1VBGA 3VNLA 5BMWA 2XG9A 4DXVA 5H91A 3OZMA 3IVTA 4MWAE 4FNSA 4DF2A 3REQA 2R94A 5CEWA 4PTXA 3VGGA 1XHGA 4H41A 3W29A 4JTHA 4Y8FA 4QEHA 1J6OA 1XISA 5BU6A 4DUXA 2E28A 1UR4A 3AZSA 3N4AA 1M7PA 1TELA 1YNPA 3TC7A 5IBXA 3GH5A 2CBIA 3QY8A 2J74A 5LXXA 3OU8A 3STFA 2ATMA 1EZ2A 3SI9A 4ZMGA 4N4QA 2F61A 2J77A 3S5SA 1TJPA 4BA0A 4UNLA 3WENA 5HAOA 4GE8A 4GUJA 2FTPA 2YLAA 3IIOA 4O11A 1VH7A 1FY6A 3VC6A 3VDGA 3RGTA 1WKDA 3E2RA 3I4KA 2PGRA 3FJLA 4LS2A 2XISA 2GUBA 3GHSA 1RD6A 1R9ZA 5AHLA 2WSQA 1S5TA 2GDQA 4QP0A 2OKTA 4O8RA 2ZYFA 4P8XA 3UWYA 1VFMA 2DUXA 4HU0A 1ITXA 5M17A 2GJXA 3CWOX 4PODA 4O4VA 1LL7A 3SY8A 4B3LA 3MJMA 1YXDA 3TH6A 4ZTXA 1HZYA 4GA8A 2TPSA 2QCDA 4L6DA 2WC4A 3USZA 4O1CA 3CHVA 4GK8A 1WAUA 4FIQA 3TKFA 3NQGA 3OZPA 4LVGA 3SB0A 4XZHA 2O7QA 4E2VA 3UP8A 2P88A 1CGUA 1FCQA 3PANA 5HXMA 4GWEA 4FX7A 4GHRA 2P50A 2HJPA 4V27A 3BTNA 3WH9A 4U10A 1GT8A 3COTA 4I5RA 3WQ4A 3WBYA 2X0YA 3H2CA 2X2YA 1XX1A 5HINA 4S2CA 2DSUA 4JX4A 1C8QA 3QEZA 1V0MA 3MUXA 1D8CA 2BHYA 2XSBA 3PTKA 4N42A 5I06A 4FLRA 2I5IA 1M9HA 1UROA 3T9PA 2CNCA 1W2VA 3G1FA 4ZO6A 1CGVA 2ZC8A 3A6OA 3G6LA 3PNZA 1Y5WA 1YKWA 3NQAA 3BUVA 2TMDA 4IJBA 1KFLA 1WOBA 1F74A 3IAQA 1JYXA 1OT2A 2E8YA 2QUVA 2QXWA 1KBJA 2VGBA 1T0OA 2XGZA 4DPQA 1UH3A 1UBSA 1YE6A 2PWDA 4EXBA 3AC0A 1TCDA 3FDGA 4LYPA 3C0JA 1A5UA 5JBDA 1J18A 1XF0A 2C0HA 3Q2DA 1G01A 1SW0A 1AZ2A 4AD1A 1BQCA 2OJPA 2ALDA 2WNWA 1XYCA 1D3HA 4LWWA 3VOFA 3U57A 1TVPA 3L4XA 1IF2A 3MUIA 2ZXBA 1NWSA 2RH9A 1H1NA 1XIEA 3SCWA 3NM1A 1I6NA 1N8FA 3AZTA 3GXFA 3M6DA 1C7SA 4A8RA 3E0IA 3M5YA 1GG0A 2XGBA 3HG5A 3LPPA 2YA0A 4Q7NA 2CEQA 3NXLA 4YVXA 3SCTA 4M81A 3GDTA 3L9CA 1V6XA 2PDWA 3UW6A 4UB9A 4U3CA 3UXAA 3B4YA 1YADA 3UG4A 5E9XA 2GK1A 3W23A 5AN7A 3BICA 1WUFA 1HG3A 2QJNA 5EGRA 4LSBA 3AHVA 4YMZA 3ALGA 4HNOA 1B3XA 1QHZA 1EHNA 3W3OA 3W7MA 1W56A 2NQLA 2GGEA 3Q4DA 4M6PA 4BI6A 4M6QA 5AYZA 3KW3A 2YLLA 3CO4A 2XIMA 4A3YA 3QV9A 2E25A 1TRDA 6A3HA 1LT7A 5J8LA 3K8KA 4OUEA 2B7QA 4AWSA 1TR1A 4XUYA 4AZCA 3O7UA 5LIWX 3VKJA 2DZTA 4N9DA 3DENA 1UCWA 3EWWA 5PTDA 2VWTA 5JU6A 4XX6A 4JTFA 3RM8A 3KOWA 1FKWA 3TZFA 3WEOA 5F2IA 3LI1A 5HDRA 3ITOA 4E4PA 3NO5A 1XLAA 1Y5XA 2DZXA 3I10A 7XIMA 2VUYA 3HA1A 1OY0A 4TU1A 3ZWTA 1DJQA 2A21A 2XFWA 1EJRC 5H8MA 3CQ0A 3U2ZA 1ICSA 5FEWA 4WDUA 1DOSA 4TVCA 1EO5A 3I3EA 5CPQA 4O1DA 4GVFA 3ABQA 3ZLGA 5A8MA 1XH1A 3KHJA 4XD4A 1MYRA 4Y9PA 2J4GA 3AJ7A 5TIMA 3I6TA 1LDCA 4UFLA 1TTQA 3TSMA 1I0BA 4QBXA 5G2WA 5C2XA 1ZBWA 4YU1A 1TR9A 2Q71A 3IRSA 4G6CA 3N17A 1NP2A 4Y90A 4ICMA 4E8CA 3XINA 3VFLA 2EPOA 5H8UA 1TZZA 5AKQA 1NWUA 2WBGA 4XZWA 1V8EA 1QWGA 3KBSA 4JQAA 3E3HA 1VCFA 3WBXA 1XLIA 4M19A 3W2LA 2VEMA 4AISA 3LXBA 3QC0A 2VKZG 3TNOA 4C6QA 4K1WA 4XVEA 2PD5A 1X6UA 2PDXA 1RH9A 1QR7A 2RKXA 3PSVA 3SFWA 2HWGA 4IH3A 4JTDA 3U2OA 3RRAA 4B5SA 3LTSA 3AIUA 3I65A 1PDZA 3DYPA 2YZ5A 1BYBA 3WEZA 1T5AA 8XIMA 3TONA 4DNMA 3W85A 5D9NA 5GJNA 1R30A 3BMWA 5DO8A 3TEVA 4HIBA 1P6CA 3ZM8A 5EKYA 1SSDA 4JYEA 1DXEA 3UNTA 1XRTA 4PMUA 4LRTA 5AECA 1PHWA 2O9PA 1CXIA 7TAAA 1DEDA 1OJXA 2PP0A 3AYVA 2F8QA 2QGHA 4FAMA 2AMGA 4ZOEA 3L4VA 2WNQA 1PWMA 2VQUA 1XGEA 2VENA 4NAEB 4W5UA 1CBGA 1R2TA 1SZRA 1R2RA 3M0JA 4IOTA 1XQLA 3OVRA 3GXTA 4HB7A 3FIGA 5FJUA 1RR2A 4Q4RA 3P82A 2Z2AA 3AMCA 3TE9A 3UCQA 5I3GA 2L5HA 3ES7A 5HULA 3FHQA 4Q8WA 4DM1A 1ISZA 3QW3A 1IIGA 4PSRA 3RNDA 4ONVA 1ZS2A 2C1HA 5GQBA 1PZ0A 3M47A 4U33A 3PBYA 3FW6A 3RLVA 1YX1A 3VIKA 1ECEA 3BLEA 3NQBA 2PC4A 1XD1A 3C3NA 2A2IA 4M29A 1EO7A 3GTHA 1O95A 3IUIA 4LVBA 5CC3A 5AHEA 1UZ1A 5TD4A 3SM0A 2FVKA 2A3LA 4EWND 1OT1A 1RBOB 4KEUA 3W01A 3M0HA 3M41A 2FLIA 3FFSA 3W37A 2WC7A 4TXEA 1GOKA 5CGQA 4DBDA 3CPGA 3WQDA 2WO5A 5EMYA 1EX5A 2HV5A 3PSWA 5ABTA 4H04A 1UKSA 3O0FA 3KCJA 2I9EA 2QAPA 1SR0A 1K8YA 3JW7A 3VYLA 2G3JA 2OELA 3UJFA 3DFTA 4YIWA 2P8BA 4WSKA 4H9TA 3HURA 2B4GA 5E93A 1JCYA 1TJ2A 1HVXA 1GQKA 1WKEA 3S9YA 1J93A 2Z6JA 1XLMA 3AIWA 3OA3A 2VM8A 3DFYA 2IMRA 1JJKA 1XBXA 5CG7A 4IG2B 3H2FA 4ZBCA 3ECQA 2Y63A 3LCLA 1IV8A 4JTAA 2GSEA 2GVGA 3HM7A 2B81A 5AHFA 1YLVA 1K9DA 3DH7A 5CJMA 1XCWA 2DIJA 4MYAA 4L4LA 4H6QA 3PZNA 4M8UA 1K6WA 3UT0A 2XVGA 1EYEA 1MRQA 1OF8A 4KRTA 3E0VA 5ENLA 4D8ZA 2Y24A 3K1DA 3G18A 4LS1A 3UY8A 1G7UA 4MJMA 5I09A 3AAMA 1CYGA 1O5KA 3WJSA 4B4HA 1W1B1 1XRVA 1GZ1A 1KBIA 4HZ8A 4F2BA 3R0DA 4IGSA 4LVAA 4HHHA 3VX0A 5GPRA 2PDCA 1CGWA 2J8GA 3WELA 4GI6A 4XSMA 1CGYA 1NF0A 2J24A 3PZTA 4G1KA 3B8SA 4S23A 4QM1A 3GKFA 4N6FA 2VNCA 3PFRA 1LL4A 5CSYA 3AMDA 1JZ2A 3LU2A 2PWEA 4S2BA 1KCXA 4QLLA 4Z1DA 1P6WA 2OWWA 2H9AB 5EFDA 3N9KA 4KFOA 1P4CA 2OSWA 3PJXA 4ZB0A 4UQBA 2J6VA 1H5VA 3DDMA 1SR9A 3CYVA 4E5TA 1XDMA 3EDFA 4BK9A 4S39A 2WWDA 4LALA 4K1GA 1B30A 1VFHA 4NAFB 1KTCA 4MG4A 1V6YA 3DYOA 4FB7A 3B03A 3EX4A 1BYAA 1S2CA 3QRHA 3A5FA 2WVTA 1HKJA 1KFWA 4IQJA 3RJXA 1WDPA 3W27A 1B90A 4NYYA 3C6CA 1QO5A 1RQEA 1KXTA 4AD4A 2WZMA 4WDWA 3QOMA 2BNJA 3QTPA 4L56A 1FVPA 3H7VA 1ONWA 1VD6A 4KCUA 1AJZA 4Z42C 7CGTA 1XV8A 3TYUA 2WCAA 1M03A 4DO6A 3ONBA 1OIFA 1UHVA 4FSAA 4AXNA 4EOUA 1FTXA 3G3MA 5FL0A 2PU0A 1LLWA 3C4UA 3TXVA 4RXGA 4WLCA 4JAWA 4NSBA 3O6DA 2C3ZA 1C7TA 3WMSA 4A2RA 3PZ9A 3SFKA 4IIBA 4BS0A 5FI8A 2AGKA 5C9ZA 3EZ4A 3PTMA 1I75A 3VFCA 4L9YA 2ZX6A 2ALRA 1KXVA 2HS6A 3WLOA 5FJPA 2VURA 4C1NB 3B9DA 1TWSA 2FPYA 3M0LA 1ME8A 3T6CA 3LY0A 2CESA 3TVAA 2QW5A 3B9NA 4QGCA 3R43A 1FXQA 4Q3MA 1NSJA 1S1RA 1GOIA 1LRQA 1YHTA 4DWDA 4AQLA 2ZDRA 1X8CA 1CXEA 4PMXA 1DBTA 2FVMA 4EKJA 4OGZA 4E2DA 1DJYA 1GYLA 1M68A 2QGYA 3TMLA 5HMDA 2Y85A 3NL5A 6ALDA 2CLIA 2A1YA 4CKQA 1AQHA 3ZT7A 2ZTJA 3H70A 3M5ZA 1XUUA 2PDIA 3RR4A 3P84A 3GHUA 4KT2A 1Y7VA 4PBGA 3HFTA 3GNOA 3V7PA 4MFEA 2FZNA 1NTHA 4RR4A 1OFAA 1H62A 1XR2A 1XIDA 3UY7A 5A69A 1RD5A 4HMEA 4RE4A 3NXFA 2CZVA 1Q7QA 4DJDC 3FV9A 3OIHA 1AQFA 1PX4A 1VBUA 5ECUA 3MI3A 4UFIA 3BSMA 1PVNA 1SZFA 2PLJA 1CWYA 4CQCA 3EB4A 5DMNA 2RJHA 1DWJM 3R11A 1G6CA 3SRDA 3K13A 3U4FA 3VD4A 4H9UA 1FWHC 1K1DA 3MDWA 2IKIA 3S5OA 5LIKX 4IQLA 4KWVA 3FYYA 5I78A 1B3ZA 3KAOA 2AAMA 4EXQA 1VRXA 2EBNA 4AEFA 1QPKA 2F2HA 1U83A 4HZ6A 4ATWA 1OGBA 4M3PA 4NILA 1W5OA 3NTYA 3WSUA 1ECQA 3C0QA 1Q8JA 2WANA 5EMMA 2CC0A 8TIMA 5FSDC 1JPKA 4GINA 4UXDA 2WHMA 1PL9A 3O63A 1QNPA 3CIVA 4JHZA 3ABOA 4LOCA 4RNJA 7REQA 3QH2A 4GQGA 4YTSA 3CMGA 2G50A 4QLJA 1T40A 4A2SA 2A3AA 3BJFA 4PCSA 4TR9A 1WZKA 4WJ8A 1LROA 4QLKA 2WSYA 1E0VA 2ZCGA 3A3WA 3IJ8A 2NW0A 1OCJA 1VCGA 3B05A 3TA9A 2QJMA 3BCFA 4QR6A 1WCGA 4H7VA 3DG6A 1UYQA 4UWMA 2WHJA 4XAFA 4A3RA 3M0KA 4JN8A 4KBXA 2WBKA 1YRRA 2VOMA 2P0IA 5A6KA 1RJPA 1OQFA 1FDZA 1J0HA 2FDSA 1DIKA 3MPGA 4O54A 5EB8A 3POHA 1LZOA 2VHLA 4HSOA 1XH0A 2ZRWA 1CEOA 3IWPA 3GNRA 3E74A 3R5EA 2CERA 3W7EA 2QIWA 4AMAA 3FN9A 2YYTA 2X42A 1C92A 3KTXA 4ZO8A 4WXYA 1WA3A 2QKFA 3BAJA 3KRZA 4I9JA 3NG3A 3QMTA 1W3LA 1UR9A 2PBOA 3WLLA 4CD5A 1W1VA 4XK2A 3R58A 3WO8A 4QDWA 3NSNA 1UASA 4DUWA 2CBJA 3FAXA 1R3SA 5K7JA 4JN7A 4BI5A 5C5YA 2WMIA 1ELSA 4JQ4A 4BCEA 1JPIA 4IP7A 4C5ZA 1BRLA 1EP2A 3GXIA 3F4NA 4JICA 3MWAA 4Q6XA 4H00A 4DLMA 2F6XA 4H01A 1H1ZA 5J5RA 1E4MM 3KVMA 4DEFA 2EPLX 4B9YA 4DBSA 1DL3A 1FHDA 2R1NA 1JDFA 2ZXQA 1G1YA 1S2AA 3CUXA 1PTDA 4IPPA 3QR0A 4O12A 3ABRA 1EC8A 1DJZA 3TTOA 2OXNA 2V69A 2ASHA 3LHYA 1M04A 3R2GA 3T7VA 2BOGX 1OX4B 2VZUA 3ID7A 3OGRA 3QN3A 3S2CA 5CQ1A 2NWSA 1R47A 3OZYA 4P2VA 1W0MA 2Z29A 3A4JA 1HN1A 3THQA 2O9TA 1TIWA 4MY1A 2KX9A 4JYFA 3VD5A 4CLMA 4LUTA 2NVDA 2GDVA 4A3UA 1FH7A 4W85A 2ATSA 2P1FA 4N4PA 1C3FA 3AROA 2VVSA 1FXPA 2Z2UA 3W00A 3A9BA 1E6PA 2PGEA 1NQKA 5CSSA 1A0DA 4LAMA 1B3WA 4MB4A 1U5VA 3H22A 2JIEA 1RV8A 1WKYA 3RK8A 2V3EA 4UTKA 1ODUA 3WQOA 2A4AA 2OSYA 4ZTYA 3DCPA 4JTUA 4UBPC 3CV2A 3S1GA 2VEPA 5BZAA 2VX5A 3P8JA 1V02A 1XLHA 4U3AA 3HQNA 4QSHA 1ZAHA 2BVDA 1M7OA 1Q45A 2Z2BA 4AZ7A 1LQ0A 2GQ8A 5BU9A 4GUHA 3PK7A 3H2OA 3W74A 1K4HA 1P0EA 2PMQA 2XIOA 3TROA 3SY1A 2WHKA 2ZADA 3QR1A 3WNLA 4DPPA 1ZBCA 4LQ1A 2F6UA 1WDSA 5HUOA 4NXSA 3WUEA 4JQ2A 3L5LA 4INFA 3FAWA 2DEPA 2ZX7A 1ISYA 1KWKA 3LGGA 1TTPA 3EX6A 2YW3A 2BOFX 1QK0A 4LV9A 1VFFA 2AQVA 3OTRA 1XRSA 1UKQA 2E40A 4UR7A 5C54A 1PKLA 2OYKA 1X8FA 3VGFA 1PKNA 1J0KA 3SSJA 1I1WA 3VMPA 4TV5A 3GNDA 1LJYA 2D23A 3QPEA 1YPXA 3B8WA 1TTJA 2E8ZA 5BXRA 3RDKA 2WPGA 5C6MA 4M82A 4H19A 1GOQA 4PCNA 4O8AA 4WKHA 4RDVA 3SJ3A 4RL3A 2D73A 3LXCA 8A3HA 2PDBA 4RDYA 2I17A 4U2YA 3CAQA 3WN6A 2Z24A 5D30A 3LTYA 1LLZA 1C93A 2IW0A 4P7OA 3HPSA 1DJIA 3WD4A 4PUEA 4DZHA 1SU5A 1UUQA 2YCKX 2A3CA 1N7KA 1RBAA 6CGTA 1CPUA 4AD0A 4MDPA 5B7ZA 4IIEA 4G2DA 4XAYA 3TYZA 5IDZA 1A4MA 1ONXA 5K9XA 1RK5A 3C0LA 2WCSA 3NZQA 5J5DA 2IKJA 2I9UA 1V0LA 5CZSA 1RA5A 4JEQA 1E6NA 3FGCB 3H12A 3T2OA 1OK6A 2D3NA 3SN4A 4O10A 2X1SA 1OFRA 5MF5A 2CLEA 1TE1A 1IEVA 3R13A 1EUAA 1EC9A 4QTGA 3ES8A 3QQ1A 8XIAA 4IXXA 3GS6A 2GZXA 3T44A 2OX1A 4Q4KA 5B7YA 1E0TA 2JK2A 4PBEA 1QU4A 1SM9A 1XC6A 5D03A 1XDLA 4HKPA 5HUPA 3W81A 1K3UA 4BFAA 4MUPA 2DZVA 1S3HA 1UZDA 1BLIA 1MW0A 1D2KA 1REQA 1TB3A 2WB5A 3I4EA 1CNVA 5IFTA 3VI2A 5C9WA 1XGZA 3ATZA 1XJBA 2OO0A 3NEVA 4EK7A 3FX4A 2ZE3A 1F4AA 5I77A 1G4TA 1ZNNA 2J66A 3HG3A 1T41A 4XB3A 3ZLFA 3PPHA 3N3TA 4YPJA 3N19B 3GKAA 3MO7A 5A6BD 3C56A 2D20A 3QY6A 5TQLA 2WSPA 1UR1A 3RR1A 1L2UA 3P62A 1GGOA 3L21A 1FDJA 4H83A 4TMCA 1SJCA 1TWWA 2V5KA 3THDA 5FKYA 3VM5A 3GVGA 3VKDA 4UCFA 1D3CA 2VJXA 4C5YA 4YHEA 1CI1A 1UQZA 3JS3A 5ABFB 3N6JA 1DWGM 4KWUA 4NI3A 3L4ZA 3H23A 4H9ZA 3KHDA 4YN5A 3LRKA 2PTZA 4O50A 2J78A 2NZLA 1T99A 1H1YA 3T0DA 4XIMA 4X9SA 1FHLA 3GNXA 3A47A 5F1VA 3PZIA 2NT1A 3GWQA 1BXBA 2OO6A 4O1EA 3ZJ8A 1MO0A 3R25A 3A24A 1SFTA 1JG9A 3TJXA 4PUKA 1Y0EA 1V08A 5IHSA 3DGBA 4PUJA 5CBBA 1NDWA 2GGGA 3HV8A 2PRMA 3MBDA 2CBUA 4RDZA 1F76A 4GZJA 2XSXA 1VF8A 4Z2KA 5C9RA 4J1OA 1TPUA 1MUCA 5AHNA 1A4LA 3WLNA 1F05A 4JOMA 3ICJA 3WY1A 1ISVA 4LBUA 1V7AA 3WLKX 1KFBA 4CN6A 5M5DA 2EQDA 1ZB5A 1UWQA 3C2VA 3ALFA 3ARYA 1Z41A 5KINA 4JTLA 4JBRA 3HQOA 4DJED 5D2YA 2YW4A 1JFXA 4J3TA 2VT0A 1GQNA 1UJQA 3PBVA 2D2JA 1SMDA 5HNUA 1IR1A 1OG6A 4DWSD 2ONEA 3E2SA 3LX9A 1ZTVA 2ZZ6A 5FEXA 3WK3A 4FR1A 5E0CA 1IT0A 3SZ8A 3H2AA 3S83A 5DBUA 1THFD 4PE8A 1JUKA 3FA4A 3OHMB 1YXYA 3UPMA 3BOXA 9XIAA 5BNKA 3W73A 2QS8A 2QEZA 8CGTA 1LF1A 3VNMA 2DGAA 4M6UA 1W3HA 1AH0A 1Z48A 3R0KA 2ZUVA 4DO7A 1US2A 1TX0A 5HNRA 3V18A 5EL1A 2GSJA 5CZTA 4HJFA 2X8RA 2VZSA 1OFBA 3VINA 2V5JA 1AK5A 2FKPA 1H7PA 3D3FA 3R4IA 2XVKA 1JPHA 5I00A 2AL2A 4RNHA 4LX4A 4LBSA 3LQGA 3UVIA 2OOGA 1M65A 4MY8A 2PTYA 3KM8A 3N2BA 5CGTA 3BLOA 1X6NA 1UWTA 2ZRXA 1E1CA 1LG1A 4J3ZA 2VP8A 2HPIA 3VOHA 5LA2A 4US5A 1O6IA 4ATLA 1A80A 1WBJA 3MHUA 4S3EA 4TX8A 1XIGA 3P5ZA 5KETA 5A8QA 5I79A 1TRIA 1RPXA 3TCSA 4YYFA 4MAVA 1OZMA 1S2WA 2F7FA 3WMLA 4YTQA 1EBGA 1KLYA 1TREA 1PJ9A 5HR7A 3HG4A 1Q7MA 2Z7GA 3WFZA 3AQUA 2D24A 1R3TA 1XLEA 3GTFA 5FACA 3T40A 4DF0A 3FA5A 3Q67A 5LIYX 2Q6ZA 1PV8A 1W6TA 3GG1A 1D7FA 1TA3B 3N18A 2C6QA 2I1OA 1Q5MA 2R14A 4IPIA 3SRFA 3R89A 2AQWA 3CPUA 1CT5A 4XG1A 4JR5A 4Q32A 2VYOA 2BODX 2Y61A 1QI3A 4XO7A 3M44A 3ZVHB 1RK6A 3VDAA 3QY7A 4GI9A 4FA3A 1AH4A 3NQDA 3S1WA 4QG9A 3RG6A 4PRWA 3VGEA 3PZVA 1TMHA 1I2NA 4X63A 1XD0A 3WCZA 5REQA 2G96A 2ZVIA 4O0QA 3HV9A 3GY1A 1CB7B 1SW3A 1TX2A 3LCIA 1KM4A 3PJWA 3TC3A 2VWSA 3WIJA 1NOUA 3ME3A 3K4AA 4N9BA 5TBOA 3JU2A 1BTCA 2QCLA 3MUZ1 2W6RA 4UQAA 2W9MA 4DLFA 1FWCC 1XH2A 3PBGA 2X40A 3QBUA 2PLMA 2QCGA 3ZR4A 4I90A 1PPIA 1AZ1A 1IEXA 3EA3A 4W5ZA 1TJRA 3W88A 4HOXA 5HQEA 5AC6A 3E2QA 3QV6A 3UG8A 4HJWA 2QPUA 2MANA 4OWGA 4TIMA 3MO4A 1IT8A 4S3BA 2PP1A 4O52A 4MNJA 3WQGA 4NJKA 2WVVB 3P81A 1Q2RA 2XYLA 3B8DA 3BW3A 2E4TA 4K3ZA 3CGTA 3SQLA 3VA8A 3WDPP 2XN2A 2WYSA 4KCVA 1UMLA 4IX0A 1XGDA 4NP7A 2VMFA 2WMJA 4CCCA 5A8OA 3KRSA 3VNDA 4PB3A 4XD3A 4MY9A 4HK7A 2HDJA 4AZ6A 3KOXA 4G5DA 4XUGA 1GJPA 3VCCA 4B5TA 1DXIA 1LP6A 3PZUA 4JZ5A 2JGQA 2Q3RA 3T78A 2OZ8A 4AUBA 2DJLA 1GVYA 3KVJA 2EJ1A 2O9OA 4N9EA 4CD7A 2FJKA 4ICNA 2J88A 2PDFA 4GGBA 1EJTC 3GW0A 2QJJA 2X30A 4LCQA 4G1NA 1P48A 1SJAA 3CLMA 3DAQA 3GXMA 1XIBA 5M1TA 3BW2A 4MZ8A 1GQIA 3CV6A 1EX1A 3FK4A 1TE6A 4K39A 3OLGA 1MWOA 1Y5VA 1U33A 4GZEA 4GUFA 1GVOA 3GH4A 4LUIA 3VGBA 2WHLA 2OG9A 4GRSA 3N4FA 4Z1BA 2Y5EA 4WCJA 4Q8OA 4GQQA 1PZ3A 3RPDA 2GJNA 3IJ9A 2BHUA 3PPFA 1VEPA 2V3FA 4POCA 3CU2A 4IX2A 1ZBVA 1IXOA 5G2IA 3CH9A 3ENLA 4KWSA 2VGGA 2BXYA 3UJRA 3UA3A 3B9EA 3BG3A 4BQ4A 1K70A 5FJTA 2FDMA 4JTKA 3BMXA 5AZ1A 2ZX5A 4BY3A 4JEJA 4IMEA 2ZZ1A 3VIJA 1KBKA 4BF9A 1Z69A 2NSOA 1K8ZA 3M9YA 1B4KA 1ZQ5A 3E38A 4WX2A 4XZBA 1EKOA 2BVWA 3GLCA 3CNYA 2V67A 4N7QA 2AMXA 3FKRA 3HBLA 3NGJA 3UBPC 3TN3A 4Z1CA 5CZKA 4CQDA 4JTQA 3IANA 5ABGA 2YDSA 1B9ZA 3DIPA 3A13A 3AIVA 2GPTA 2QCHA 5HOSA 3FKKA 1K7XA 2VX6A 1J8VA 2IKGA 3A4WA 4IP4A 4OZOA 2NQZA 4Q7IA 4DF1A 5DEZA 1MNSA 5GJMA 4HA4A 1A53A 1GW1A 3VGDA 5FA5A 3SJNA 1OZQA 4ZQPA 1K7EA 3ITCA 2F6KA 1TJ0A 5D09A 4GABA 3NOYA 3M0IA 1OX5A 1XS2A 4HNCA 2HZGA 2QJHA 1FCVA 2D0HA 3ITVA 1OC6A 1G69A 1EJ7L 1AL8A 3U8GA 5H6HA 1IQ8A 2YGYA 5MKGA 1HKKA 3UQNA 1B31A 3UYIA 4AHOA 4LU0A 3JUGA 3ZJ7A 1GHRA 5FJIA 1BSIA 2EPMX 4AG0A 1IWPA 1GCYA 3SCPA 4CCDA 3C8FA 3SCOA 4UOQA 1A3HA 4H9MA 4BWLC 1RJRA 1KR1A 2ACQA 3MKKA 2CBVA 4IUOA 4M80A 4YVPA 1W2PA 3N15A 4GQ0A 3W7QA 3B0VC 3UWUA 3L5MA 4L1WA 1L6FA 3TFXA 2FB2A 3E0WA 4WVXA 1ME7A 3BK0A 3S6OA 1KFKA 3MCMA 1W1YA 1O7AA 2ZXAA 4GKTA 1KM6A 4LY8A 2ABAA 1W9DM 1TPDA 4HCLA 2GSHA 1PX8A 4R53A 1A50A 2G5WA 3UCDA 4NZJA 3GXNA 5CPLA 4UNIA 2VOTA 2NXGA 2VC7A 4IMCA 1JCMP 4Y9NA 1XLGA 3CJPA 1VYSX 5K4ZA 4DJFD 3KFTA 3IRDA 4BF7A 5EBUA 4IIHA 1Z3NA 3P61A 4UQ9A 4C60A 3KOZA 3GE7A 1H7RA 3VZZA 1PS9A 3LTPA 5K4XA 1O66A 4YVVA 1LOLA 4H4IA 1E1EA 4HHLA 3D0CA 4MAZA 2I7GA 1ZCOA 1Q4NX 1UA7A 4IFKA 1B3OA 3GU2A 1Z44A 1UW9A 1UG6A 1TPC1 3OQEA 4Z2HA 3LHTA 1CXFA 3BCDA 3DHUA 4PFHA 3SECA 4Z1AA 2H8XA 3SADA 1HVQA 2EO7A 3A12A 1VFUA 1K4GA 4QSFA 4TO8A 1U1JA 3WK2A 2QJIA 3VD3A 4B5XA 3EDEA 3N3MA 3EYPA 5DMYA 3KX6A 1K02A 2QCFA 3L4YA 2PC8A 4AHPA 3AIEA 4MADA 1ENUA 1H0IA 3RX4A 1TPH1 3N4EA 4XAZA 1YXCA 1Z32X 4O13A 4JY9A 4J27A 3KP1A 4MKNA 1C8VA 2WJFA 1QDSA 2VXNA 3OQ8A 4LUSA 1VPYA 3UR7A 4LY4A 4AU0A 3G22A 1HGYA 1R8LA 2CLOA 2TYSA 1OCQA 4IGHA 3QSRA 1V0NA 2GJPA 2TODA 3G1HA 3DG7A 4KGLA 1X6LA 2Z1XA 2GGJA 1J12A 5CXPA 4GOAA 1AL7A 3BJSA 3QV7A 3GVRA 3UCCA 3B0XA 3KVLA 2RDXA 4S3DA 5JQ9A 1J0ZA 1SFJA 3BPWA 3TJLA 1QPNA 3LGEA 1YDVA 4I9TA 3WJXA 4XD5A 3W7NA 2E7FA 2VRKA 4JTSA 3W0KA 4PSPA 2ISFA 1U1HA 1TJ1A 2PAJA 4MB5A 4U2ZA 3CZKA 1V7YA 2G4JA 3RMJA 2OGYA 1PXGA 3TQPA 2YYUA 4MWAA 5LNVA 2Y7EA 2ZVRA 3G6MA 1XI3A 2G3MA 1KRBC 2UZ9A 2OKOA 4IICA 2GOUA 1EXBA 2G3NA 3QFEA 3CL8A 4ZQNA 2VFEA 1UKOA 1EP1A 3BGGA 1DKWA 2GL5A 2EHHA 1A5BA 2GVLA 1QI5A 3TQVA 1PBGA 1AW1A 5EA9A 4PFMA 3L5AA 5C2GA 2OLAA 3F2CA 3IGUA 3RO8A 5HJYA 3QZ6A 4JKMA 5I03A 1S5MA 3NCOA 1WBHA 3F4WA 1KWGA 3ZR6A 1P1XA 2W92A 4MNKA 4B5WA 4RE2A 1BFNA 3SQSA 4E3VA 3CWHA 4K8GA 3OVGA 3OLIA 4HN8A 4R9OA 2YL8A 1JNEA 2A3BA 2Z1VA 1ZLPA 1JZ6A 4IZGA 1V3LA 3W2UA 2W62A 1X39A 2P3EA 4MKSA 3RCYA 4TV6A 1CX9A 4QEEA 4CEXC 1KFCA 2ZICA 2J9XA 1ADOA 3ONCA 3FNDA 2VI0A 2CIPA 1KM3A 3M0MA 4OBSA 1P0KA 3NAVA 1A3WA 2ISWA 2J8FA 3WLTA 1J0IA 5FF3A 2VR2A 2XFRA 3N6HA 3VOJA 4D2JA 1I0DA 3VIOA 1Q2SA 2W79A 3W9ZA 1C91A 3GYCA 3GXDA 3LHWA 1NDVA 2Z6IA 1P1MA 2IPWA 1DTUA 1UPMB 2WMFA 1GZGA 4L80A 4JX5A 3KE0A 3BL3A 4DM2A 2DW6A 4DYEA 5IDIA 3Q58A 4MFDA 1JDEA 2DVUA 4B91A 1DQXA 4D72A 5U4NA 2J9YA 4IIGA 4IMGA 3CL6A 3IJLA 4C6LA 5FESA 1ZP3A 4QJ5B 4UR9A 4L4MA 2O0TA 1A47A 5AC4A 3UD6A 1XM3A 3ITXA 4A4AA 4UMAA 3EGJA 3C2EA 1B4EA 1B57A 3CHDA 3ITGA 1TV7A 3KVKA 4AY8A 2E5BA 1CIUA 3BDKA 4B9ZA 2VDHA 5B80A 3THCA 3MWCA 1TMQA 4WZHA 2TRSA 4R7JA 2IPFA 3AHYA 2VX7A 1S2TA 2OLHA 1FWEC 3RAOA 5T9BG 3KOYA 2YXXA 3OBAA 4HK5A 1B3YA 1OD0A 3GM8A 5K9CA 2DIKA 3K46A 1XIMA 1ZPTA 4OOUA 4A05A 2C79A 1GYNA 1QOXA 4TX6A 3GDMA 5BMXA 1EPXA 3EOEA 1GPWA 1UD5A 1SGJA 1UR2A 2GQ9A 4R88A 1VC4A 1OYBA 2CW6A 5E6ZA 2ANUA 3SCNA 2YBUA 3CZLA 1S38A 1VB9A 4F0SA 2XUCA 3HMCA 2OMAA 3KRBA 3GVQA 4AVNA 2CPUA 4ADUA 4LXFA 1H7NA 1I2QA 3F5KA 4CN4A 4P7RA 3W7PA 5AHIA 3SIMA 2J7FA 2PF0A 4QCEA 2DW7A 3GVWA 5A6AA 2CZFA 1TO3A 3AWOA 4AX7A 5G4HC 4CU6A 2I14A 3V5FA 4RE0A 3V5OA 4KETA 4IHCA 1PAMA 2UWFA 4WJEA 2P76A 4DNHA 1H7OA 4FMVA 4DBEA 1W5NA 1A0CA 3OBKA 4JIEA 2G8ZA 4MPKA 3MDUA 5JIWA 4IMFA 1PIGA 4WY0A 4ZXLA 3FOKA 5BOEA 3E0LA 4J40A 4B15A 3SUSA 5HQLA 4GCAA 3ELFA 2W0UA 1JZ7A 4PL1A 3SCRA 1RP9A 1QI4A 6XIMA 1GK8A 4D1IA 2OPJA 4KF1A 1XCXA 1ONRA 3NEHA 3O07A 4IFRA 3Q94A 2WMKA 1XYZA 3R12A 4FOJA 3LCXA 3N2MA 1M7JA 1BXCA 3M0VA 3OG3A 2VO5A 4OU1A 3WFAA 1DJGA 4FLOA 2HK1A 4WUIA 2A6NA 6REQB 2IS7A 3T07A 3CH0A 2AGTA 1EIXA 3RPMA 2EGZA 1HUVA 3HN3A 2CFFA 2WSKA 3EX3A 1HKMA 4H7CA 3LB0A 1E0WA 4WKFA 3LRMA 3Q45A 1UWIA 2Z7KA 1GHSA 1N55A 3V3WA 4NJGA 1Z42A 4DJDA 5FJRA 4YS1A 1PCWA 1KM2A 3MB9A 3VUSA 1FUYA 2WMGA 2NUXA 4ZZ9A 3GSMA 1BSLA 4RNIA 3E12A 1JYWA 2H8ZA 2Z1SA 4R27A 4Y96A 2HISA 5F2MA 3N2TA 3VOIA 2DZWA 3OO2A 3I68A 1DJXA 5M03A 1BF6A 3WDIA 5HMEA 3W7OA 3TTYA 2UY3A 1EOMA 3PB2A 1YBQA 4OE7A 4B2DD 4XZIA 3WLSA 4DI9A 1UD6A 5CSUA 1DXFA 1QT1A 3I7QA 1TVLA 1ADDA 3WZ0E 3OG2A 1GPFA 2EJAA 1IWBA 3J7HA 2A3EA 3VDHA 1XYFA 1C9WA 3KWXA 3DC0A 3URAA 2CXEA 4Q8UA 1GVIA 3CHFA 4J7RA 4P7NA 2A85A 2WK2A 1RPKA 3B4UA 2DQWA 3FLUA 3NPVA 3QM3A 3T05A 3H54A 4O17A 2ISVA 1UD8A 1JRCA 1NOFA 1VEMA 3BE7A 4LVDA 3U3HA 2QUTA 3AS3A 2QT3A 4V2XA 5DFAA 2GJRA 1TPWA 3ISIX 3PAOA 2AQOA 4GY1A 1XLKA 4D71A 3A64A 3NVTA 3RU6A 4C6DA 3SRHA 1H63A 3CPRA 1TSIA 3GFXA 3K30A 3MSYA 5I23A 4QNEA 5E0KA 5CCZA 1GQLA 4V1XA 4LUJA 1S3TC 3UZ5A 2HBXA 1RXOB 1WXYA 5E5CA 4AF0A 4JD4A 4UTLA 3SBFA 3VM7A 4AW7A 4C6NA 5FEPA 1BVZA 2YOCA 4E3TA 4J3UA 3V1HA 2XFFA 3URQA 2OEJA 4LUYA 1MW2A 3IK4A 4F66A 1KRMA 1MQQA 2YXOA 4GLEA 5F2GA 1UWAA 3L4UA 1NP0A 2YB1A 2PLKA 4GI4A 2PBGA 3GR8A 2Y70A 1P7TA 1OFEA 4QJ1A 3KZSA 1WNOA 5A2BA 1FHVA 5FF7A 1YTDA 2ZUTA 3WK1A 4FS9A 3B9AA 2EF9A 3GB6A 2JFEX 1U1UA 1D9EA 1GYMA 3O05A 1VHCA 1JYNA 1R0MA 4A29A 3ZMRA 4FLSA 1VJZA 1DPMA 2HNEA 3HGJA 3PZQA 4G7EB 3WDJA 1IXNA 4FX6M 3FVMA 3BC9A 2W63A 2O55A 2PDHA 4GUGA 1EUNA 3W7IA 2VDGA 3BWWA 4KKXA 3NYDA 1Q6LA 1VIZA 3NQEA 2V2HA 4H2HA 1GVRA 1F4HA 3Q37A 1ZJBA 3TU9A 1OYAA 2R1KA 4IIDA 3L2MA 3CASA 1K6AA 1HL9A 1UP3A 5LHEA 5JBFA 3LM3A 4R85A 1GKPA 4HHPA 1H5YA 3GR7A 4GJIA 4F9DA 2WC3A 1DJWA 3FJ4A 3EWCA 4KCWA 2X16A 3KEHA 3K4WA 2VC9A 4U4MA 3R8HA 3PB0A 2VL4A 2DVTA 5A6MA 1DV7A 2E9BA 4C90A 1CW2A 3QR3A 1Q6FA 3STPA 1Q3NA 1WZAA 3WLMA 1AFSA 1HQTA 2E5DA 3O6AA 4DB7A 3B8TA 3DC8A 1QCWA 5CBIA 3U9IA 1XDJA 3SUUA 3TLQA 4UTIA 2D2OA 1OF6A 3MUY1 2XVNA 4C6JA 2AL1A 3BLDA 4MTVA 3FVDA 3STGA 3REQB 4BR1A 3PJUA 4WRHA 1BWVA 1PSCA 4XAGA 3THUA 5GNZA 4V33A 1WX0A 2VELA 4J2MA 3SQMA 4HN4A 2YDAA 4ZFCA