4XK2A

Crystal structure of aldo-keto reductase from polaromonas sp. js666
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
344
structure length
317
Chain Sequence
b'SMEHRYLGNSGFKVPALGFGTGLFDVAGARRIIDICLDAGVNLFDTADVYSNGASESILGAALKGRRDKAIVSTKLSLRIGEGPNDVGSSRHHLIAATNAALQRLDTDYIDILQLHAFDAMTPVEQVLGTLDDLVRAGKVRYIGLSNFSGWQLMKSLAAADRLGLQRYVANQTYYSLIGRDYEWELMPLGIDQGVGAIVWSPLGWGRLTGKIRRGFAPPVDDERLYRVVDAMDEVALETGKTLPQIALNWLLQRPTVASVLIGARDEEQLMQNLGALGWQLTTEQVARLDAASAVTPPYPYYPYWNGQFAERSPVAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo/keto reductase
molecule tags Oxidoreductase
source organism Polaromonas sp. js666
publication title Crystal structure of aldo-keto reductase from Polaromonas sp. JS666
rcsb
total genus 118
structure length 317
sequence length 344
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4xk2A00
3UG8A 1HQTA 2IQDA 3CAVA 3COTA 1RY8A 1YNPA 2PF8A 2IPWA 3N6QA 3LQLA 3BV7A 1S2CA 4FALA 3LBOA 1Q5MA 1IEIA 3LENA 3S3GA 5HNUA 3V0UA 4JQ3A 2PDGA 4YVXA 1AZ1A 1PZ1A 3UFYA 4JTRA 1XF0A 1ZGDA 3G5EA 2PDPA 2R24A 2J8TA 4LB4A 3F7JA 4GABA 1X98A 4HBKA 1QWKA 1VP5A 4WEVX 3LUTA 4QR6A 4PRRA 1Z89A 2IKJA 3B3DA 3RX4A 3M0IA 4NKCA 4G5DA 5C7HA 4JQAA 4GQ0A 3LZ3A 2PDUA 2IPJA 2FZ8A 2PDHA 4L1XA 2IKIA 4JTAA 4GIEA 2IPGA 5LIYX 1YNQA 5JH1A 5LIUX 4DBSA 4JQ1A 2ISFA 4GCAA 3V0SA 2CLPA 1GVEA 5LIWX 4XO6A 4PMJA 3BCJA 4HMNA 1K8CA 4FAMA 2INZA 3VXGA 3CMFA 4WDTA 2PDNA 2FVLA 3GHUA 3CASA 4Q3MA 4RPQA 3MB9A 3UZWA 4WDUA 5AZ0A 1R38A 3WCZA 3ERPA 3RX3A 3UZZA 1EKOA 1X97A 3GHRA 1ZSXA 2FZDA 4DZ5A 1AH3A 2PDQA 1ZQ5A 3EB3A 2I17A 4WRHA 3DN5A 5DANA 1AFSA 1S2AA 3UZXA 2IQ0A 4JQ2A 2VDGA 1LQAA 1MI3A 2BGSA 2WZTA 2PDYA 3R58A 3GUGA 4LBRA 1LWIA 3NTYA 4JIIX 2HV5A 1T40A 4GQGA 4PUWA 5LIKX 4LB3A 3UGRA 3LN3A 2WZMA 4JTCA 4DBUA 3C3UA 1AH4A 2HDJA 2I16A 2DV0A 4JTQA 2PDWA 1XJBA 2PDIA 4ICCX 2PFHA 3ONBA 4IJRA 4YVVA 3U2CA 1S1RA 3UZYA 1X96A 2BGQA 2NVDA 2F2KA 3LQGA 2PDXA 4PUUA 3RX2A 4EXBA 1PYFA 3R8HA 1VBJA 1ZUAX 3O0KA 5HNTA 4XAPA 4ASTA 1Z8AA 3MC5A 2P5NA 4LAZA 4PRTA 4FA3A 2PDJA 4H7CA 3M64A 4PR4A 2IKGA 2ACQA 2IKHA 4L1WA 3V36A 1XGDA 2PD9A 3EAUA 3KRBA 1OG6A 2PDKA 2HEJA 4XK2A 1AZ2A 3P2VA 2C91A 3CV7A 1A80A 3UP8A 3Q65A 1S1PA 2HE5A 3Q67A 3N2TA 2FZBA 2QXWA 1SM9A 4Q7BA 4XZMX 2HVOA 3R8GA 3H7RA 1QRQA 2PDFA 3EB4A 5HA7A 5LIXX 3R7MA 4XZLX 4JIHA 1YE4A 4AUBA 3QKZA 4IJCA 3R6IA 3GHTA 4WDXA 2NVCA 1J96A 1T41A 5JH2A 2PDLA 4IGSA 4JQ4A 3G1RA 1EXBA 3ONCA 4GACA 2ALRA 2FGBA 2PDCA 4QX4A 1Q13A 4H8NA 4F40A 2IPFA 3FJNA 3FX4A 1RALA 4XZNX 1AH0A 2PZNA 3LZ5A 4XO7A 4WDWA 2PDBA 2DUZA 5AZ1A 3H4GA 2F38A 3UWEA 2DUXA 3R43A 3WG6A 4YS1A 2R9RA 2FZ9A 3D3FA 4XZHA 2BP1A 1MRQA 1Z9AA 3O3RA 4XVEA 3WBYA 2A79A 4YVPA 1M9HA 1JEZA 3BURA 2ACUA 4LBSA 4JIRA 4JTDA 2PEVA 4QXIA 1Z3NA 4XZIA 3DOPA 1RY0A 2AGTA 4FZIA 4LAUA 4I5XA 4XVDA 2HVNA 3M4HA 1PZ0A 5M2FX 1PWMA 1IHIA 3V0TA 1ADSA 4YU1A 4MHBA 4R9OA 4EXAA 1EF3A 3LEPA 3H7UA 2ACSA 3T42A 3BUVA 2IS7A 1C9WA 1PWLA 3R94A 1UR3M 4GA8A 3UYIA 2PD5A 2PDMA 1US0A 1MZRA 4OTKA 1EL3A 1FRBA 3WBWA 3CAQA 3GHSA 4WGHA 4DBWA 1HW6A 2INEA 2ACRA 3WBXA 2HE8A 3V35A 3LNMA 4QBXA 5KETA 3LD5A 1YE6A 4ZFCA 3CV6A
chains in the Genus database with same CATH superfamily
2FHFA 4DF2A 3GDTA 1LLWA 2OO6A 2WJDA 4BS0A 2DDXA 4WCJA 2V67A 3GC4A 1PCKA 2D3LA 2J75A 3OTRA 1JCLA 3OVQA 1IWBA 4EF8A 3M47A 1J0YA 1D8WA 4KEZA 4Q8NA 1Q7ZA 2BV9A 1HP4A 3T81A 1SZEA 3NOEA 4M19A 3U4AA 4J3SA 1XD1A 1XRVA 2V5JA 3VDGA 3VKJA 1K03A 3G5EA 2PDPA 1F7BA 5DXXA 2R1NA 1FHVA 7REQB 3E74A 1XYCA 1KQYA 3SIZA 4PL1A 4WXZA 4AEEA 3QSTA 3SFKA 4F0SA 4LX4A 4H9TA 3RX4A 1LUCA 3ORWA 3AXHA 4C5YA 1LLZA 3MI6A 5MHBA 3PTMA 2E9LA 1HL8A 2OODA 3AXIA 2R6OA 1BXBA 1X6UA 4DEFA 1S38A 1K70A 4R27A 4M3PA 4UTWC 1N8WA 2PTWA 1I0DA 5FSDC 1JRBA 3QHOA 2AL2A 5I02A 4AZ7A 1T0OA 2GLKA 3MZNA 3V1HA 4DJFC 1W2PA 4AZCA 3ARPA 1M65A 4QJ1A 5TD4A 2GZXA 2W3ZA 4BQ4A 1JYNA 1SW0A 2NUYA 3WNLA 2ZRXA 4KIEA 1FCBA 3CL7A 2PB1A 3UF9A 4HNCA 3NQ6A 4NJGA 1DQUA 3ERPA 3AHZA 1TTJA 4X22A 4UFHA 3FJ6A 3GHRA 5EKYA 1A3XA 2FZDA 2WBKA 1OJXA 4IMAA 1EPXA 3SFWA 1IT0A 7REQA 1JCTA 1ZQ5A 3PFRA 2BOFX 3CUGA 3CUIA 1VQTA 4H2HA 3RO8A 1PB0A 1ZJAA 1J5TA 2CEQA 4S2CA 2PRHA 1AFSA 2P76A 1SMDA 2J6VA 4LALA 1RBAA 2VDGA 3N25A 3VGHA 4NRSA 2PDYA 3HG4A 3ZLFA 3W1AA 3EDKA 4MJMA 2O4MA 4NVTA 2C3ZA 2XIOA 1ISVA 2HVMA 2C6QA 4P7NA 1QATA 4Z08A 4DBUA 4UMBA 4PUEA 1EUAA 4N9EA 4ZCWA 4QNEA 5A6KA 1Y7VA 1AH4A 3I4EA 3LXCA 1F3EA 2FZMA 2PDWA 5F2IA 3BQ6A 1I2NA 1C8QA 3J7HA 1VPYA 4PSRA 5IBXA 5HAOA 3VDHA 5L9FA 1TJ2A 1KM2A 1X96A 3RCNA 2F2KA 4AIEA 3WK1A 4PUUA 1MQRA 3VYLA 5D30A 1PYFA 1RBOB 1CXKA 1DXIA 3GVVA 1OFBA 4XB3A 1MW1A 2OT0A 2DT2A 2OT1A 2X2GA 3WNOA 5HNTA 3TH6A 4S3EA 1Z8AA 1O5KA 3MC5A 4FA3A 4H7CA 3HV8A 1BYDA 2ICSA 1OF6A 4HSOA 4ERAA 3ITCA 1XGDA 4RKAA 1XDMA 5C7VA 1XUUA 3RLUA 1CCWB 3URBA 1E6QM 3UXLA 3SY1A 2HE5A 1W56A 4GY1A 4S3KA 2XWDA 1ONRA 3G77A 2BB0A 1FWSA 2V6AA 4CNSA 5GJMA 1JI2A 1DWAM 3QQ0A 4MG4A 1C29A 1E5NA 1RUSA 2V3EA 3QKZA 1WDPA 4IJCA 1BWVA 4O8AA 1DJXA 3WDJA 1H0GA 1TQJA 4LAKA 2WVUA 3UGVA 5D8WA 2QT3A 3QLLA 4JS3A 2H6RA 1LRNA 2KAUC 4GUGA 1W1VA 4JY8A 4NJKA 1XIFA 2QPSA 3W1NA 3GVQA 1HJUA 2ZDRA 3BLKA 1GQIA 5FF2A 1LBMA 5C71A 1A5AA 4X60A 7ODCA 5KMYA 2VOTA 2HPIA 2XIMA 2H90A 1OT1A 4F3HA 1EJSC 2GJNA 5A1AA 4UWMA 3NAVA 1K02A 1KBJA 2JIEA 4WDWA 1R30A 1H7PA 3WZ0E 4LC8A 1NWTA 1QCWA 3M9YA 3UWEA 3HFYA 3TA6A 1W54A 4R7WA 5FF0A 2Z6IA 4M6QA 4QS6A 4PODA 4TV6A 4D71A 1HJXA 4QSHA 3NZQA 4S2BA 1N7KA 3RITA 2P1FA 4IISA 2QUNA 2PGEA 3NO3A 5IBXC 2CXEA 1LL4A 1F9CA 2OELA 1S39A 1SFTA 1TZ9A 5ENLA 2DZPA 1JNEA 3S2MA 3GU2A 2XSAA 1FWGC 4RZ5A 4GBDA 1VEMA 4I5XA 2J77A 4J7RA 4XVDA 5KZ6A 1JULA 5FI8A 1H2JA 3IJ6A 1X38A 2OLHA 3A6OA 4O1BA 3W9ZA 3F4VA 4A3RA 1PTDA 5DEZA 2ACSA 4JTJA 1L2UA 1GZJA 1QUMA 4MM1A 1QNOA 3GC2A 3A64A 5GNZA 2B7PA 3KTCA 2OEMA 2ATSA 2Z2AA 3N6JA 1MDLA 4DBWA 3EGJA 3CU2A 4GYFA 1OZMA 3TTEA 4H9YA 4B5XA 1T7LA 2X0YA 1ZL1A 3DGRA 5BRBA 3S5OA 3BXWA 3M5YA 3S9ZA 1DEDA 3MCMA 3CGTA 5K4XA 2EG6A 1YKWA 2DSWA 4Z2HA 2DH2A 1QI4A 3II1A 2QCDA 1IXPA 2PI6A 4IZGA 3E6EA 1TB3A 3QZ6A 3PAJA 2ZWYA 3BV7A 2ZC1A 1AJZA 2MUCA 1B3WA 2XFYA 1V7YA 4O1FA 1Q5MA 3TAOA 4PYSA 5LNSA 3VM7A 1AD4A 4DXVA 3BMWA 3W7IA 2FPYA 3PSWA 4I5UA 3TYCA 2YXGA 3FEQA 3E1F1 1ECEA 1EB3A 1B4EA 4LRSA 3UWZA 4QE1A 4F9JA 3JRKA 1B9BA 2XHYA 2Q71A 1XV8A 3VIGA 1XFCA 1U5HA 2DW7A 4G1NA 1CENA 1NQ6A 3K13A 5B7ZA 4AMAA 2PCEA 3PUDA 1Y0EA 3M0IA 2Y70A 3FKRA 1UCWA 1ZFJA 4IQDA 3GS6A 1UKQA 1OWQA 4HNOA 5AN7A 1N8FA 3NQBA 1ME9A 3OJGA 4ZVJA 4LANA 1EC9A 4IH3A 4ZR8A 1EDGA 3M5VA 2Y1HA 3S83A 2AGKA 3K4AA 2I1OA 1YXCA 5FAJA 5DCEA 1G94A 5FEXA 1E1CB 3DBNA 3V0SA 2CLPA 5AHLA 1GVEA 4KCWA 5LIWX 2NQJA 3ATYA 1PE1A 4C6LA 1BGGA 3VDCA 2OYMA 4UTTC 4UNIA 3WDIA 1QPQA 2VQUA 1K8CA 4WY0B 1OCQA 1LF1A 1VENA 2DT3A 4B91A 2PLJA 2UY2A 1FWEC 4HNLA 1KW1A 5FD0A 3KBWA 5AHFA 3I6RA 3E02A 1FWFC 1XPYA 5BMWA 3DG7A 3F5LA 5LNRA 2GJXA 4M82A 2FTPA 3MU7A 1EDQA 5CC6A 4J5NA 4UQDA 3GFYA 4M8UA 3ISIX 4AB4A 1DPMA 3U8GA 3HPZA 2X09A 1E0XA 2I9UA 3WH7A 4KMQA 1JUKA 4GY0A 3NL2A 3ZWTA 3VO0A 3WQGA 2IMRA 2HV5A 3RN6A 4B5TA 4D6HA 4IP7A 1QT1A 3UGRA 3LN3A 3L0GA 2ASHA 2Z1WA 2HDJA 1NOFA 3CL8A 3AZTA 3QGVA 4I7WA 1WKDA 2ZQ0A 9XIAA 1TG7A 1KBIA 3G1DA 4G1KA 5KZMA 3OVGA 3EOUA 5CPLA 1ADDA 1ZTVA 3G1HA 2EPHA 2Y7GA 3E0VA 1XFBA 3QHNA 4GY7A 4NIRA 3ALGA 2OWWA 4W8AA 3GAKA 1MEHA 2B0MA 3QR0A 1F8MA 3UCQA 4GVIA 3GNPA 1XLEA 1NFPA 4C1NA 1LORA 3KRZA 1LDCA 4ASTA 3VINA 1FWCC 1XISA 3WO8A 4FXSA 4KKXA 2IKGA 2Y88A 3QN3A 1P6CA 3B8IA 1E4LA 3C2RA 3RPDA 3ZR4A 1L9WA 3HU7A 4H9MA 5LYRA 4C6DA 5CBJA 5A6JA 1JZ4A 5HWMA 4H00A 1C8VA 3WLIA 1S1PA 2GPTA 4WK9A 4FLOA 3VD7A 3W4RA 1G7VA 4OWGA 4O14A 1I1WA 4U3AA 3LRMA 3EB4A 2FKPA 8A3HA 4H7VA 1NDZA 3V4BA 5G1YA 5CC3A 4K3ZA 1FH8A 3GHTA 5DCDA 2Z6JA 4LWWA 1NY1A 2E4TA 1ZAIA 3N15A 1DJQA 3W28A 3AQUA 1WE5A 1XRFA 4MJZA 4AIOA 1KO0A 1R3YA 3B03A 4ML4A 3ABSA 4CD4A 2HCVA 4DUOA 3P3BA 3W26A 3D47A 1O12A 4DIAA 3NR0A 5SWUA 1JCJA 3SW6A 2OQYA 4BQ5A 2V5KA 2QV5A 3W73A 3MKCA 3VOIA 1FHUA 3WK0A 2E28A 3BAXA 2FVKA 1Q6FA 3AHXA 1UD2A 2Z00A 2ZUSA 2CLIA 4HZ7A 1H62A 3WEMA 3NEHA 3DDMA 1XLKA 3K4WA 1TSIA 1DJHA 2D24A 4QIUA 1M04A 4I5RA 4XBKA 4AQLA 1K7XA 1Z3NA 4A3YA 1Q8AA 4X61A 1S2UA 4MFDA 2NXHA 4IOTA 1RD5A 4EKJA 4TIMA 1LTDA 2QUUA 2YDRA 4XKMA 3ZT6A 3B0UX 2XIIA 3OZMA 4XTDA 1XG4A 3FV9A 1TPEA 4Z2JA 1PWMA 3PB0A 2ATMA 1RK5A 1R3QA 3CTTA 5C55A 1UOKA 3ZJ6A 3NQVA 1EEXA 2POTA 3T42A 4J2PA 1ZBWA 1C9WA 5HNRA 3S1UA 3PNZA 3LTPA 1EJVC 3P60A 2A3LA 4YL2A 1ZP4A 1YYAA 4P8VA 4FR6A 1XQKA 2XVNA 5CLWA 5EMKA 1AQHA 2C0HA 1OYCA 1ITCA 3BO9A 3UWQA 1GZ1A 1JCYA 1F2JA 3THAA 3I6TA 1FX6A 4D6JA 4AU0A 1WUEA 2HNHA 3IGXA 2PGWA 3VFLA 4MB5A 5MF5A 2YA1A 1U22A 4ZSTA 1MEIA 2BXYA 4V2XA 3W07A 3O6DA 3JZUA 4GUFA 1S5NA 3CAVA 3CYJA 4XIAA 4QLLA 5HUOA 4NYUA 3HTWA 1KCLA 3N17A 3EZ4A 4H6KA 1OCBA 5E9AA 3I7SA 1CYGA 1S5VA 2QHAA 4W88A 1Y5WA 1LJYA 1PAMA 2QCNA 1W1YA 1BRLA 1NWRA 4QCFA 1L6FA 2AMGA 1L2QA 5BCAA 5HK4A 5HNUA 1EUNA 2CBUA 2BXVA 4JXCA 3W2KA 5CAKA 4C5ZA 4JQ3A 1AZ1A 2QR6A 4QEEA 1K7FA 3DHPA 1GWJA 5EL1A 2I14A 4LB4A 3T05A 1GOMA 2Q8LA 1J8VA 1KRAC 3L7RA 3APTA 1V7AA 1ZBCA 3AIEA 3W2JA 5FJIA 1VFFA 2HISA 4CU8A 4UTHA 1GVSA 2ZUNA 1V6UA 3NGFA 4PUNA 2BMBA 9CGTA 4REQA 3TMLA 3NQ8A 2WHMA 3DGBA 4G5DA 1JZ8A 2J8FA 1QK2A 4DB7A 3QZAA 2Y85A 1R3RA 3A5FA 1CWYA 1FUYA 2GYIA 3SCTA 5D05A 3PG9A 4UFLA 1GVIA 4F0MA 2YXOA 3W1RA 3RDKA 1MQPA 4NZCA 1OFDA 1P0DA 5I79A 3SQLA 3KL0A 2VDIA 3GR7A 4HCHA 4GH3A 1ESWA 1SYTA 1WKFA 5G1TA 1W6TA 3MT1A 4F2UA 3AMCA 1OD8A 3KVLA 1JFXA 2X1TA 4L4PA 1XYAA 4HZMA 3MBDA 4JFTA 5EFDA 1CNVA 3DHDA 2ZTJA 3VMNA 3MJYA 3U9IA 3QPZA 1R38A 3CV1A 4FLRA 3UZZA 2JKPA 3M0XA 2V8ZA 4B9ZA 4DJDA 3EX3A 2NW0A 3SRFA 4ES4A 1QPRA 2YBTA 2ALDA 5CXPA 2BTMA 4NI8A 2A4AA 4C6BA 4M5PA 3OLIA 1UC5A 3NQCA 2CCRA 3VGDA 3BPWA 3NJ3A 4HMEA 3N2XA 1MI3A 3IEBA 4Q4PA 4K7YA 1KKRA 1LWIA 3CJPA 4UTJA 3K4DA 4JN6A 5E93A 4D1JA 4PUWA 3HPSA 3GQYA 1LRQA 2KX9A 1M5WA 3GDMA 3OZPA 1NFGA 3TN5A 2DQWA 2VFDA 5H8PA 5E6YA 4FS9A 3SRHA 4RX0A 1G6CA 1MNZA 3AZRA 3WLJA 5IHRA 1RJPA 2G3NA 1C91A 3ITXA 3BAYA 4JNMA 3BGGA 3WH5A 3PULA 3PBYA 4L65A 4PCNA 2FTWA 3WF0A 2C19A 1B57A 2HWGA 5BRPA 3HQ1A 3CMGA 1GJWA 4HU3A 1XLAA 1E15A 5H6HA 3D6NA 3FAXA 1V03A 3H54A 4YIWA 2PAJA 3T2PA 4DUWA 4DF0A 1XLFA 3IJ8A 4L1WA 4H1ZA 4ORMA 3NVTA 2AL2B 1E0UA 1JIBA 5A6BA 2FDSA 4POCA 1TR1A 2FH8A 4GYJA 4NZFA 3POCA 3EKZA 3VIPA 3S6DA 2WCAA 2J74A 3U7VA 3M0ZA 2WNWA 3RPMA 2FZBA 1GYNA 1GQNA 1PSCA 3CMJA 3GTIA 4AIUA 4CN1A 2NQHA 1M7XA 5LIXX 1DE5A 3QMTA 1R87A 3S1GA 2WNQA 1JPIA 2RDXA 2OMAA 1SU5A 3BLFA 3GYCA 2WNZA 4IGSA 5AECA 2G5WA 3CWHA 1FH9A 4N9BA 4G56A 4E3VA 4GACA 3BAIA 1UZ4A 4ICNA 1F5ZA 1OC7A 3UR8A 3WK3A 4F40A 1O60A 1RCQA 1QMLA 1UA7A 1UR1A 1TPDA 1DTUA 1MW3A 4LNCA 1TREA 3EA1A 4QG6A 4AZ5A 2CLOA 3S2CA 5CPNA 2PDBA 1M03A 3W71A 3W85A 2ZXQA 3L65A 5KITA 5AZ1A 1A5MC 4NAEA 1RXOB 2DGAA 5A69A 1LOSA 4ZOAA 3TN6A 3TK7A 5FJTA 3WG6A 1FH7A 3EPOA 4IMEA 1IGWA 2BP1A 3TU9A 3EMCA 4ZXOA 4WZHA 2OQHA 3U5UA 4AC7C 1HF6A 1S2TA 4WX2A 2YCLA 4DO6A 1FWNA 1JEZA 5AB3A 4ZQMA 1IXNA 3PSVA 4KBXA 3WBAA 3OPSA 3OGVA 1OFAA 1PIIA 4XD6A 3WK2A 3GDKA 4NAFA 3W25A 3D46A 3IGSA 3E12A 4GJJA 2PZ0A 3RU6A 4PB3A 3MHFA 2C8NA 1WOBA 1VFLA 3VOHA 3RM9A 9RUBA 3FJLA 4EXAA 2OXNA 1AK5A 3DCPA 3BUVA 1LBLA 4DM1A 4XTIA 1LP6A 4KWUA 1D9EA 2NX1A 4ILSA 3GVGA 4A05A 1VS1A 3DESA 1KFWA 2AQOA 2EG8A 3IJDA 3RM8A 1A5UA 2WBGA 4K2SA 1V6VA 4RLIA 4AF0A 1Q6GA 1RJRA 3ZJKA 2BHYA 1AMKA 1XLBA 1V93A 3NQAA 1H09A 2I9EA 2XIJA 4GI6A 1XYFA 4WQ6A 1S5WA 2RUSA 1NQKA 4NI3A 3FAWA 4JTLA 2Z1BA 3CPGA 2VCCA 1RY8A 3AJXA 3TROA 4QEHA 2NQ5A 1TV8A 4CNUA 2J7BA 4OBSA 4P61A 4AY1A 5K7JA 4E4PA 2NXGA 3IGUA 4RDYA 4JFVA 1DL3A 3F5JA 3UYCA 4J35A 4GXWA 4RUBA 1PZ1A 4UOQA 4JTRA 5AC5A 1SZNA 4UZUA 3E3HA 1FTXA 1UWUA 3IRSA 1ML1A 3BE7A 1KR1A 3LUTA 4QR6A 4IFKA 1ZNNA 1LM1A 2HNEA 3SJ3A 4AEFA 1VB9A 3CNYA 4MNKA 3KVKA 5JBFA 3CIXA 1PPIA 4HU4A 4GQ0A 3K30A 2OGJA 3G1FA 4CUCA 1W1A1 3DYOA 2IKIA 1YTEA 1YNQA 3WH8A 2VJXA 3JZEA 3GDBA 4H6QA 2A3EA 4AHQA 4C6CA 4PCFA 3M5ZA 5AHNA 1LG1A 3DC8A 5BROA 4GGHA 2Q8ZA 4HMNA 1LQ0A 4B16A 1Y5XA 1A5LC 4HTBA 2YFOA 1K6WA 4TOQA 3A22A 4R3UA 4L6OA 3CT7A 2YGYA 4RCXA 2ISVA 2ABAA 3AO0A 2PBOA 3P5YA 5HQLA 4UMAA 4Y9MA 5G1MA 5IOBA 3ZT7A 1B54A 4PZVA 3KXQA 5I6SA 3CH9A 2UBPC 1ZAJA 4MKVA 3LM3A 1U5JA 1RLCL 4FHAA 4CU7A 4Q8PA 3LHYA 4AD0A 5CPOA 3UZXA 4OQVA 1UPPA 3B8DA 4D6EA 3MYOA 3AIUA 4WVXA 3QPEA 4JBRA 2ZZ7A 2BGNE 4MKNA 5A6SA 4W89A 1W91A 1XX1A 1VBHA 1FDYA 1J2WA 1PS9A 4AZIA 3MVTA 2F2HA 1E55A 1W3TA 3TOPA 1HT6A 1W3LA 5E5CA 3QQ1A 1XR2A 3DFTA 5M3WA 4EWND 1X1OA 3T0AA 3CIWA 5D33A 3TQVA 3WBEA 3RX2A 4NXKA 2A21A 1DIOA 2WJZA 3WMLA 3CBWA 2G3FA 3BAKA 1SO4A 3LB0A 4O50A 3O0KA 4KCVA 2DY3A 2XVGA 1XLLA 4W4QA 5DRIA 1GVRA 2P5NA 1AVAA 2PDJA 3TW6A 4GG9A 1Q6CA 1W5NA 1W3JA 2WCSA 3SGGA 4LXFA 2OEJA 4RDWA 4QJ5B 3C5QA 4UQAA 2BFGA 3VC6A 1AZ2A 2OSWA 5K9CA 5E9XA 2WVTA 6ENLA 1KFCA 4XUGA 5A95A 3UR7A 1XINA 3KRUA 2UZ9A 3W70A 1JXKA 2WHKA 3S5SA 3HV9A 2VD8A 3QMSA 4M1RA 4DY1A 4QG9A 4IG2A 3QR3A 4HOXA 5EBUA 3CQIA 1E4NA 2EPNA 3WNMA 4OKDA 4W86A 2TSYA 1SUXA 4DJEC 4MUZA 4GX9A 1PX3A 2F8QA 1OK6A 1SJDA 4TX6A 1UWAA 1W2VA 3CS2A 1YX1A 2QIWA 5M5DA 5FL0A 1XBZA 2Q6ZA 4BCEA 3E96A 2Y5EA 2IPFA 1TMLA 2PF0A 2V63A 3CH0A 4NY2A 3W37A 3A4WA 3GW0A 1IGSA 4XO7A 1VCGA 3W7LA 1W9UA 4MIMA 2CLMA 1NDVA 2ZICA 1B3ZA 3AYTA 4AAJA 1KLYA 4PB5A 3FOKA 4L56A 1FWIC 5DMMA 3WN6A 3I3DA 1ENUA 3WD4A 3WBYA 1TZ7A 2DORA 2W9MA 2VGFA 2ZZ6A 4DN1A 3CHEA 8XIMA 2PEVA 1JDEA 4UTIA 3MI3A 2VWTA 3LG3A 2WHLA 3G1XA 5CSRA 3HA1A 4GHRA 4QE4A 3R1ZA 1VZWA 4LUSA 5FF7A 4UOZA 5CGQA 4ZQCA 3GFZA 1B31A 1UIPA 1W8GA 3S2JA 1OQFA 3AIQA 5FEZA 3GSMA 2VGIA 3KCOA 1O68A 3WQDA 2J9YA 4LRTA 1EGVA 3NQ7A 2JEQA 1F05A 3CLMA 3N2CA 1QPOA 2FHBA 5C2XA 4ADTA 3TTQA 2E09A 2O7QA 2FTYA 4I9JA 1JYXA 1LWJA 1PX4A 2GWGA 2ZRYA 1ZRQA 3ARXA 2ACRA 5K9XA 4KEMA 3WUBA 2WVSA 1DIDA 1GVYA 3TXZA 1YDOA 3L2IA 3SUSA 3GBDA 1JF5A 1IEXA 4W84A 3BG3A 4JTHA 1NM9A 3M46A 4PTXA 2AQWA 3IVTA 4ZOCA 5BWFA 2VUYA 2ZX7A 3EKGA 4IFRA 1N2VA 4MZ1A 3SGUA 5A2AA 4CVUA 2O92A 2NQ9A 2IPWA 1OFOA 5D37A 5I5RA 3BWWA 4FF7A 3UA4A 1WXYA 4JFWA 3OZOA 2X1RA 2YW4A 4UTTA 4GCXA 1DORA 1IEIA 3CWNA 3JU2A 4ECLA 5HMFA 2WMGA 1XLHA 4YVXA 4UTUA 3K46A 3CLWA 3OG3A 4NZ3A 3EWDA 4QHRA 1BXCA 2W66A 3STFA 3S8HA 4YTSA 1P1MA 4ZBCA 1RA0A 5FEWA 2GGHA 5DMYA 4D6FA 3MPGA 2E40A 4IIEA 4HSNA 1U33A 4HYWA 3RCYA 4I6VA 2E6DA 2Z2BA 3PBGA 2OQLA 3ARZA 4L7ZA 3HM7A 3RJXA 1HKWA 3R79A 1W1PA 3W81A 3UWWA 2FGLA 3DEQA 2FZ8A 1UR4A 3GIPA 3UPBA 1MMFA 4J28A 3L23A 3P7YA 3MUZ1 2YA2A 2YCJA 3CTLA 4C6KA 3PZOA 2A7RA 2VENA 3QBUA 1OX4A 3OLEA 1JZ6A 3S6OA 3RILA 1DOSA 3BLOA 3NYZA 1JFHA 2E1DA 3KBNA 3I7QA 4IMFA 5M1TA 4TQTA 2WWDA 2UY4A 3CASA 3TUUA 4Z1AA 4GC4A 3FHQA 3MB9A 5E1QA 4JHOA 5D9MA 3JUGA 3MWCA 3VM5A 2ZA3A 2HK1A 1XGEA 1GKQA 3ZOAA 4L61A 4Y9PA 3IIVA 4MB3A 3L67A 4LTSA 2DH3A 5G4WA 3H2AA 2ESCA 2C1GA 2CKRA 3EB3A 1F3XA 4RW3A 4I7VA 3KL3A 4B5SA 1WXZA 2VO5A 1UR0A 1ISWA 4US5A 2G4FA 3KOFA 4UQBA 1EF2A 1FWAC 3WLKX 3HJEA 1GTHA 3NA8A 1SZGA 4RR4A 1HKMA 4IFOA 5DT5A 3HG5A 1EBGA 3T6CA 4HNNA 3FGCA 3NZGA 4N4PA 2QPUA 1ZBKA 4LYQA 3WEZA 2PURA 4YTUA 4JZ5A 2DSVA 1BHGA 1DJGA 3HOJA 3M0JA 3NZ1A 3QHMA 1PTGA 3W2MA 3HMCA 2PLCA 3WLQA 3N1AA 3TLLA 3GDLA 3RLVA 1QHOA 4WKAA 1VBUA 1KA9F 3WQ6A 4LV4A 5F7UA 4B3KA 2E8ZA 3C2OA 4CCDA 6PTDA 3UU0A 1EJRC 4AC1X 2E5BA 3VGFA 4IGNA 2ABBA 3MTWA 3P8IA 3L4YA 5HANA 2C1HA 4PRTA 3IV3A 3U4FA 3NQFA 2GSHA 3EXRA 2ISWA 4GWEA 4N9CA 5EFFA 2VGGA 3W84A 1SJAA 1W9XA 1Y8BA 1L6SA 2JGQA 2NV9A 3E0FA 3AXXA 1KC7A 2ISDA 3PWGA 1WDRA 4GZIA 4Z2KA 1JF6A 5LA2A 1KRMA 2VP8A 2C7FA 3O2LA 3N2TA 1GKPA 1DJWA 1H0IA 2PLKA 2H9AA 4IX0A 3R8GA 1PBGA 1VCFA 3SUWA 1ITQA 4B4FA 4HA4A 4MB1A 1I2RA 3W6YA 1FDJA 1XCWA 3CO8A 1QU4A 2O9PA 5T8GA 3WH6A 1WA3A 3VX1A 2WSKA 3GXFA 2J88A 4HN4A 3I68A 4PSPA 1ZU8A 1PEZA 2PWVA 3H2EA 3ONCA 3MSGA 1KWKA 3LBCA 1D7KA 1UQYA 2W63A 2G95A 3GY1A 5BOEA 1O5QA 3PUOA 3UR2A 3NPUA 4IT1A 3UVAA 4KWOA 1JI1A 1WZMA 1Y65A 1AH0A 3PZ9A 4TMCA 1V0LA 3NL6A 3N9RA 4ONVA 2P53A 3O07A 1DQWA 3MCOA 3WF2A 4JX5A 2WSPA 1XYMA 2QPXA 3KOWA 5REQA 4UTFA 4E2DA 4V33A 4P7OA 3EX4A 2E67A 2XPKA 4FK9A 1SMAA 1Z9AA 4UR8A 3MKKA 5U4NA 1XSIA 2VWSA 3WFLA 4Y9OA 2YCKX 2Y4SA 2ISSA 3BURA 1Y5VA 3M7WA 4UQEA 2VC9A 3LOTA 3UVIA 1YLVA 3TW7A 3UWUA 1L0PA 3LGEA 3A4XA 2DEPA 1RY0A 4A8IA 4FZIA 4Z1CA 4MGGA 4MWAC 1WKYA 3OLGA 3M4HA 2GDUA 2V5DA 3ABXA 1DKWA 3N14A 3UY8A 3WNNA 3SSJA 4YU1A 2WXDM 4R9OA 1EF3A 3FA3A 5C54A 3KM8A 4OIFA 4O0ZA 1TPH1 3U57A 3N2OA 4NASA 1E9IA 1PWLA 1S3HA 3PPGA 3FW6A 3TSMA 3UNDA 1OZQA 1LBFA 4BEUA 1XLJA 1X6LA 3NNTA 4WJEA 1YADA 4HB7A 1YPIA 4PCTA 3GTFA 1SO5A 3REQB 1VGAA 3Q94A 5CQ1A 4S23A 1TTIA 3WELA 3AWNA 3GNDA 4JIQA 3G1YA 2BHUA 2CHOA 3MBFA 2G3IA 1VFOA 2JBMA 3ITTA 2PP1A 3CHCA 2YZ5A 4BR1A 1Q8JA 3TZNA 2QMJA 1VAHA 1FWRA 6XIAA 1HL9A 3H7VA 2QAPA 1XICA 5CG7A 3LRLA 2F61A 1XH0A 2A2IA 3QFWA 3WSUA 1M7JA 2PF8A 1SJBA 3W7NA 2ZXBA 4HMDA 4ACZA 1W5MA 2QVNA 4PBFA 1CXEA 4K8HA 4ALDA 2ODOA 1LUCB 3LBOA 3IJLA 1PKYA 1GPWA 2OYLA 3B0XA 1E1CA 2W67A 1AL8A 2NWRA 1U1UA 4JNYA 2Y7FA 3LTYA 2PDGA 2V5BA 2J66A 1E3XA 2ZRUA 2RDTA 2QDDA 2Z0IA 2OZ3A 3RRAA 3A3WA 4WEVX 5GNXA 3O6YX 2CW6A 4OBTA 3DENA 3W7CA 4LT9A 4O54A 3AJ7A 3HQOA 3LGGA 3MMTA 3VIOA 1KQZA 4XSMA 5AYZA 1OIMA 2E5DA 1FCVA 3P0WA 3C2FA 3H2FA 4QAWA 4TV5A 4DZHA 4NNAA 2Q01A 3P84A 4Y7EA 3FY1A 4Y96A 2VR4A 4GIEA 4MWAD 4MWAA 4INFA 3U2ZA 3WQ4A 4V1YA 4DYJA 3MUCA 4CQDA 2FB2A 2GQAA 1BWKA 5MKGA 3OBAA 3WDQA 4TTGA 1M41A 1YDVA 1YTKA 4OV9A 1BSLA 4BKNA 1ALDA 4HSHA 1GCYA 2VGBA 4ROPA 1H7NA 3UJEA 4AWEA 3VGEA 2DVTA 7TAAA 2B7QA 3SCPA 4AD5A 4E8GA 1VC4A 3NM1A 1E51A 3S5ZA 3LERA 1JVNA 3KUMA 2RGLA 2Z1KA 1OD0A 4RJEA 4P5UA 2WQDA 1QFEA 3RGTA 4O1CA 3TC3A 4QQ3A 3WMBA 4ZA0A 2WZEA 5GQBA 3ITVA 2I17A 2GVGA 4PTWA 2ZZ2A 3UQNA 4G8TA 5CSYA 1FHDA 3DN5A 2AOSA 3LHVA 1ZS2A 4DWSC 3KHDA 4V28A 1DXEA 3MHUA 5CCZA 3KLLA 7A3HA 4BJHA 1C7TA 3R58A 3LMZA 3W27A 2CLFA 1M7OA 1XD0A 4W5ZA 3VGBA 2WKGA 4K7VA 2C15A 4TO8A 4KWSA 3WX7A 3VGGA 3E2VA 4LB3A 3FA5A 3TCSA 3VIIA 2IQTA 3VX0A 1REQA 1I4NA 4F48A 1WZAA 2ZFAA 4KS0A 3SUUA 2W0UA 1R9YA 3LMYA 1G4PA 4XWUA 4ZO6A 4YVVA 5G4EA 1HTIA 2BDQA 2AKZA 3LNPA 3QFEA 4WXYA 2J7DA 1D3CA 1M3UA 1VPQA 1TTPA 2QF8A 1TR9A 1KFKA 1FDZA 3URQA 4W5UA 2PS2A 2VELA 5DBTA 2WHJA 1BG4A 3WLRA 1HXJA 1QVBA 4PA8A 4L64A 4YMZA 3PAOA 4GBUA 4WUIA 2F84A 4JKLA 3F4NA 2WQPA 1Q3NA 1R3SA 1DWGM 5F1VA 5LSMA 3ARUA 1WOAA 3M0KA 1SO6A 3EEGA 4HD5A 4X2RA 2OZTA 4AW7A 2DZAA 1E6SM 3QYQA 5D9OA 2V3GA 1K9EA 1W9DM 5D9PA 2DP3A 4O1EA 2QCCA 3B4UA 3STGA 3LV6A 3UBPC 2V38A 3VD9A 1W5PA 4KH2A 1HKKA 2EXOA 2WV8A 4C7FA 3V5OA 2R1LA 3AAMA 3TSBA 2F6UA 3TV8A 1FWTA 3VIJA 3EPNA 1B90A 3MMWA 5KINA 3LXBA 4GYPC 2ONEA 3CPUA 4H83A 4Y9AA 4LAOA 4C6EA 4H8NA 1DWFM 1A3WA 1J12A 4RV3A 1GORA 1Q2RA 2HRWA 1CGVA 1IF2A 4Z17A 3BICA 3KFTA 4Q4RA 3ES7A 3KDNA 2AKMA 1RALA 8CGTA 3M0MA 3SCOA 3NURA 1V3LA 5LZLA 1SVDA 4Q4KA 2A3AA 1LROA 2XSXA 1H11A 4PUMA 4O17A 1VBRA 4MZYA 5BXSA 2XINA 4Q33A 4DYEA 4KFOA 2OR2A 1A5SA 1NH6A 2HBXA 3SGZA 3GXDA 3TWAA 3ANUA 3H12A 3O3RA 3UJRA 1V0MA 2ZZ3A 1KRBC 3OQ8A 4PUDA 3FA4A 2GQ8A 1E70M 1JPHA 2B7NA 3DZ1A 1PZ3A 4CKQA 2EPKX 2GWNA 2HMCA 1T96A 3UXAA 1PCWA 1PZ0A 1GHSA 4QAIA 3U2EA 1PHQA 3TQKA 4XD3A 4UFKA 3LU2A 3OGRA 5CKSA 2AL1A 3TJ4A 4W7UA 4KERA 4AWSA 3G18A 4NT0A 1SFLA 4ACYA 5GVJA 4FB7A 4ZB2A 4CD5A 2VFIA 4C6JA 1XXXA 1RV8A 4K6AA 3CHVA 5LXEA 3LLDA 3KZPA 3BCDA 3NYDA 4S38A 3QV8A 1TV5A 3VCRA 1S46A 4DAIA 2NUXA 2X0SA 2OEKA 2NUWA 3WLPA 3MI2A 2O7SA 5HWJA 5TF0A 4GXPA 4PMYA 3OB8A 4KEUA 1NFBA 2FFIA 1ONXA 3S1XA 3VI2A 3VIHA 1UD8A 3UJSA 2O4QA 3CZLA 4PMQA 1B2YA 4PCPA 3KDOA 4Y9NA 4K8EA 4H41A 1R0MA 4GUIA 5AHMA 3VKKA 1Z6KA 2Z28A 3OA5A 2VXNA 4TXEA 4AHOA 1KXHA 1AW2A 3LENA 4NUWA 3VILA 4WY0F 3XISA 1RP8A 5BW6A 4Y6GA 4PFHA 4GO8A 2Y62A 3DECA 2O55A 3MDUA 3K8LA 3FSUA 5CC7A 1XF0A 4JEJA 4A3QA 4BY3A 3AU6A 1RZMA 1K8XA 3MS8A 3PHAA 1JYVA 3KWXA 1PX8A 3O63A 1M1BA 1TV2A 1WPCA 4WKFA 3N13A 3EWXA 1TO3A 1PO9A 4X3ZA 5DBUA 3H21A 4MY9A 2YDQA 1UQZA 3B8UA 5E0CA 4RXFA 4NXSA 1X1ZA 3S5NA 2QUTA 5C7HA 2ZE0A 4JD4A 4S3AA 1DV7A 3EDFA 1VFMA 2BY3A 3UPMA 2XTKA 1QAPA 4W93A 3L0NA 1UWQA 5AOUA 1G4SA 5LIYX 3MZ2A 1ZHAA 1US3A 1H7RA 2X0HA 1UUOA 1UG6A 1UD6A 3WLMA 1BGAA 1C8XA 1XKJA 2QGYA 1G7UA 2YKKA 3I7RA 4O11A 4WDTA 1R85A 4DUXA 1V0KA 1XM3A 4AZBA 4DPQA 4LVGA 2VEIA 2GVJA 3FYYA 1E0WA 3HB9A 1W5QA 1YXDA 3BJTA 3FEMA 3QMRA 4IIGA 4H8VA 3EB2A 3VKCA 3G2GA 4WSHA 3PUGA 1TRDA 4AY8A 3CEPA 5I00A 1BKHA 2GOKA 4RE4A 3GYEA 3TWBA 3KAOA 4FNPA 3MO7A 4Z42C 4MMWA 3ARVA 2GVLA 1XCFA 1XP3A 1X6NA 5BYWA 1VPXA 2O9OA 1WP6A 4QITA 4DWSD 2J78A 2OOGA 1P0NA 1NDYA 4G2DA 4IPNB 1KXVA 4FPSA 2DV0A 5LGZA 1F3TA 3U7BA 3GK0A 2NQLA 3L5AA 3H2OA 4IJRA 4LUTA 3SR7A 1RH9A 4JTTA 3NO5A 4WD0A 1V08A 4BQ2A 1PUDA 3P80A 3PBWA 4JTIA 4BI6A 1A5NC 3W7KA 1KBLA 3BC9A 4U33A 1P4CA 4LAZA 5FL1A 1E72M 3U2OA 4KIRA 1TTQA 1JCNA 4ZL1A 2ACQA 5AVHA 4Z1DA 1UROA 3FYPA 4EAYA 3OOQA 3KRBA 2OKTA 2Z29A 4WGXA 1XHGA 2WC4A 1LRTA 4RXGA 1E73M 3W82A 4E8DA 1ZCCA 3Q65A 3QY6A 1MUMA 1IZJA 1FXQA 5JVLA 3CB3A 4UFJA 2WJEA 4GRSA 5TAOA 3MSRA 1PKLA 2XVKA 1K9FA 3HJZA 5HA7A 4IMCA 5IDZA 4IGHA 5T91A 4JIHA 4ZEPA 1RVKA 5BXTA 1NP0A 3PZQA 1PJ9A 2J7CA 3N4AA 2XVLA 3UW6A 1V51A 3PPCA 5TQLA 1J18A 5G2IA 2ANUA 4XKYA 2YCLB 3AHYA 2NVCA 3O1NA 3RHGA 1QW9A 3VNYA 2PDLA 1QW7A 3C0SA 2NXIA 2YL9A 3IIPA 4J3TA 5F4XA 2X1UA 4PH6A 3KHJA 1NTHA 2DIEA 2YW3A 1EWDA 4LQ1A 1SPQA 2QDHA 2G50A 4LVAA 5HXMA 3V18A 5FF4A 2OWCA 2KZHA 2PZNA 2CXGA 3U5YA 5HBFA 3W6MA 5EMMA 3ARRA 3W00A 1OM0A 1RVGA 2DUZA 4IM4A 3P93A 1GZGA 5AKQA 1IQ8A 3GU1A 4C6QA 5GNYA 2R9RA 2GVYA 3SCWA 4RZ4A 1LT7A 4UXDA 1XYLA 3VIFA 3GXTA 3W88A 3TEVA 2WCGA 3MVIA 3NPXA 4D9PA 2W62A 3GNOA 1OC5A 3CPRA 3VC5A 3WQVA 1EXPA 3LV5A 1J0ZA 3B0VC 4CQ9A 4IMDA 4LYPA 5FJUA 3HG3A 4DWSB 2QUVA 2GGGA 4ZE5A 5K2ZA 2WZHA 4CD8A 4XZIA 3L4TA 4P2VA 2WWCA 5EMJA 1K8ZA 2WM1A 1R3VA 5DELA 2TODA 3ARYA 4J40A 1V3MA 3OHMB 2DZXA 2WLZA 2GSJA 4N42A 2PWGA 1OEPA 1YPXA 3L66A 1UWRA 1KBKA 5AC4A 3QY8A 4UTLA 2IS7A 1AUSL 2TMDA 4KEVA 4GO9A 2WMIA 3SURA 3UYIA 3CYVA 4GZJA 5EMLA 2PDMA 3AIBA 4K37A 1NARA 5FESA 5K9DA 2Y7DA 4EACA 4GGBA 5I3HA 2ZXDA 3CWOX 5A8GA 3CZJA 1EJXC 1OHLA 2HE8A 2I7GA 3STCA 4JX4A 3LNMA 2A3HA 4AZ6A 1BQCA 2IUZA 4ERGA 4LS2A 1YE6A 1EDTA 4MYXA 5AYBA 1DVJA 2G97A 1XSKA 1HQTA 1S2VA 1UH3A 3TC7A 1NEYA 1VJZA 1E4MM 1RSCA 1KM6A 3I10A 2WM0A 4EP8C 3V5CA 3KBSA 1TV3A 5DLCA 3LLFA 4IX2A 4Y90A 4AX6A 3VOJA 4GC3A 2CLEA 3W1LA 3TQ0A 4IIBA 4EXQA 2I57A 4PCSA 3I3EA 3WFAA 3A9IA 3VMPA 2RH9A 4DZAA 3K1GA 3N04A 3F7JA 3ZR6A 3G1VA 1XIIA 3A4AA 2MNRA 3BAWA 3PY2A 4LY8A 3LI0A 4S3FA 4D6DA 5B80A 1JD7A 2CITA 3B40A 4DVOA 3HMJG 1KNWA 1RCXB 3H70A 1K6AA 4V1XA 3GTHA 1OFPA 2JFEX 3P62A 3B05A 3S9YA 2V68A 3N4EA 4K38A 1JPMA 6A3HA 1SJCA 4JQAA 5F2GA 5CPTA 2PDUA 1H63A 3SIMA 4A21A 4DO5A 4LYRA 1U1HA 1P0KA 2ZADA 2E6AA 2XU2A 4N2YA 5LXXA 4QRNA 3H8AA 5BU6A 3AMLA 3DIPA 1FWDC 4XO6A 3KTSA 4EPBC 5FIPA 1QNQA 3BCJA 1SFJA 3CB8A 4ZXLA 3F4WA 3HPAA 3SCQA 2JKAA 2BHZA 5IFPA 3PBMA 1CX9A 4RPPA 3KVJA 5C9ZA 1TKKA 3M6YA 2VR5A 3QW4B 4JYDA 3F1QA 4MF4A 1MQQA 3VUPA 4H2CA 5C8BB 5DX7A 1RCOB 1MO0A 2VEGA 2XN1A 3BMVA 4DXKA 3UR5A 3USBA 3W29A 1HGYA 4HU0A 4O4WA 5LA1A 1VBGA 1O5XA 3L2MA 4CQAA 5DANA 2ZX8A 4C1LA 3NXFA 2CHRA 3KZSA 2YLAA 1YMYA 4AEOA 2BG5A 4IIFA 4JCMA 3CQHA 1UKPA 2Q09A 4ZQOA 2D69A 3GU9A 2LLEA 1QBBA 3L5MA 1CGWA 2W79A 1I2QA 1TPUA 5IFTA 7CGTA 3N4FA 1PTAA 5F1UA 4RL3A 2QCDB 3NQ2A 2QEZA 1OB0A 4CNTA 5CJ5A 1B1YA 4RDZA 1TPWA 2HROA 4JN8A 3GG7A 2OKOA 3WF1A 1RQEA 4HA3A 1E1EA 1FWHC 2PFHA 2XFFA 1KV8A 4D6GA 4AD3A 5A6AA 1OYBA 4GISA 2QCMA 4E3TA 3PTKA 1BYAA 5ECVA 3B4YA 5IXEA 1O95A 4PTDA 5BOOA 4GQQA 2YB1A 5CJNA 3PS7A 1AL7A 2HXTA 3NPWA 1U1JA 3RYSA 2UWFA 3O6AA 2XFWA 4PB4A 3LA4A 3GR8A 3TJIA 4D1IA 3N9KA 4N0RA 3AMKA 5C9UA 3NXLA 1HVXA 2PDKA 3MSYA 1KD0A 4FSAA 3F4DA 4TUFA 3P81A 3N9SA 1XCXA 1CDGA 2ZUVA 1GYLA 1QXLA 1MUCA 4EE9A 1SM9A 1W0MA 2PLMA 3SUVA 4MWAE 1J0KA 1J5SA 1P6WA 3HPXA 1PVNA 1YEYA 4XX6A 5CC5A 2NV2A 5HMSA 2CKSA 2A0NA 3NL3A 4JHMA 4XZLX 1E5JA 4D2JA 5IRPA 3EMQA 1VIWA 2J7HA 1J6PA 2ZVIA 3WQPA 1GPFA 4YCOA 4LW7A 5BNKA 1J96A 5CGTA 3S2NA 1T41A 2CERA 1EXBA 4IPLA 1C3FA 2TPSA 2VFHA 3FYOA 2PDCA 4UMCA 3EX6A 5HQEA 1EC7A 4C7DA 1YRRA 1J11A 2H8XA 3E2SA 1UB3A 1G4TA 2F6XA 2D2OA 3VNZA 2BASA 2GGIA 1CXLA 1M53A 1EIXA 2X05A 4HTYA 4QISA 4YLWA 4HGXA 3GUWA 2A3CA 4LUTB 2F7FA 2ZZ5A 4A8NA 4XZ9A 3VE9A 3AIVA 1UJPA 3R43A 3SY8A 5CZKA 3M16A 4MLJA 2CPUA 1BD0A 4BI7A 1REQB 3ITOA 2PP3A 3AS3A 4GFSA 3AYVA 3JS3A 2A79A 4QLKA 1XSJA 2V5CA 4PTVA 2Z7GA 2XH4A 2ACUA 3BW4A 4GI8A 5XINA 4ZTXA 4JKKA 4UQ9A 4AYGA 3CUXA 4GJ1A 1J0IA 2A5HA 2B4GA 1V77A 4LU0A 3DOPA 2AGTA 1H7OA 2FPVA 3R11A 5D09A 4DAFA 4WR3A 1X7FA 4C90A 4CNNA 5LNUA 1FP8A 3SCSA 5L6UA 3MCNA 3PUEA 1QO5A 4JTEA 5CH9A 1VEPA 2CESA 5LA0A 2DUAA 1QI3A 2CZDA 3R94A 4ZB5A 1XUZA 1JDFA 3ZSSA 3KBJA 1TMHA 4AFYA 1VRXA 3H53A 2OCZA 4OTKA 1VR6A 2NX3A 1IXQA 5I3GA 4U3CA 3UXIA 4DJFD 2QVHA 2INEA 1GEQA 2XISA 1DJNA 5FOOA 1TMQA 1RP9A 1XS2A 4GLEA 1DP0A 4H3DA 1YIXA 1L6YA 1LWHA 2C16A 3WLTA 4J2MA 1GOIA 3UY7A 1GOWA 4O4VA 2IQDA 2WVVB 1U30A 1TVPA 2BS9A 4UCFA 1IWPA 2D2GA 3R8RA 4QFUA 4O1DA 1AQFA 4J9JA 3RU8X 2JEPA 2EPMX 5F4WA 2V82A 1PHWA 4F4RA 3NFUA 1K4GA 3KW3A 3LCLA 4F9DA 4M51A 3FN9A 3S3GA 1ZY9A 4RE0A 2Y8UA 3SADA 3ARQA 3ZFHA 4Q4MA 1CXFA 3AI0A 1HKIA 4B2DD 2R24A 4FNRA 4GABA 4OUEA 3AWOA 3IACA 3VOFA 3JR2A 3QTGA 2J7EA 3C8FA 4OOZA 3S9IA 3GH5A 2QQ6A 3TCEA 3UG5A 3GIYA 5BRQA 2E9MA 1EJ7L 1R9XA 3WQCA 2R94A 1PL9A 4JFUA 4FXJA 1J10A 1MFUA 1GUVA 4UFMA 4ATLA 2NSXA 2HPMA 1IEQA 2A6LA 4HHLA 4YTQA 3C52A 3TTSA 4U31A 2EPOA 5JU6A 3MUIA 3U0HA 1R47A 2PUZA 4N4QA 5DF0A 3GW3A 1HJSA 2NWSA 1I8JA 1AW1A 3DFYA 3VA8A 1UR2A 4GFIA 1TPFA 3CMFA 4DUVA 3DFOA 4S1FA 4GVFA 1D2KA 4UOJA 3NEVA 3WYZA 3L4ZA 3UZWA 3WUEA 2GUYA 3WF4A 1OINA 2W4XA 4QGCA 4WF7A 2HS6A 3EDJA 3SM0A 1H1YA 4LS0A 3GVRA 2XG9A 1R3TA 4DM2A 1XWYA 4JTUA 4HNVA 1BTCA 1OX6A 4E6MA 4KCTA 5ABTA 2EHHA 2EJAA 3IUDA 4OJYA 4P7QA 1QDSA 4HHHA 5HULA 4LBRA 3U6WA 4ATWA 3C86A 4LUIA 1OGGA 2YL5A 4M7SA 4C7GA 4IUOA 1EYEA 1HNYA 1K1DA 5D38A 3LHUA 3RMJA 4EWJA 2REQA 1FFQA 2W27A 4H04A 4DXXA 2C13A 4LJ3A 3U3HA 7TIMA 3MMUA 1KLZA 3W3OA 3ONBA 3AOFA 3BTNA 3KX6A 4IIHA 1B3VA 1EHAA 4JPGA 1KCZA 3UA3A 4AWTA 1HN1A 4OZOA 3UXKA 4CLMA 1YPFA 2VD9A 4GYPA 4DBDA 1W9VA 2V9DA 2WKLA 3EWZA 3UWYA 3EOSA 2CC0A 4OHQA 4GQBA 1EP2A 4ROQA 3TDFA 3GB6A 2D2JA 2FLIA 3BLIA 4HPGA 1XW8A 3PZMA 3R0DA 3N34A 1T99A 2QCLA 4NL1A 2FB3A 3V16A 3W1XA 4C6OA 1F4HA 3N73A 3WJYA 1AD1A 2DPEA 3SBFA 3O05A 2WK2A 1C7SA 4K1WA 3TC6A 4O28A 1SZFA 4DJFA 4O18A 4A8RA 4H01A 4A2RA 3L4UA 2BVYA 4F0RA 4DELA 3H7RA 4O57A 4QG8A 4N7QA 3OBEA 4Z0JA 3W01A 3PZNA 3R7MA 2QYGA 4H9UA 2DJLA 2ZTKA 1ZLPA 2XN0A 4ZO7A 4O8RA 2GVEA 3DYMA 2H8ZA 2QW5A 4R88A 3DX5A 4N9DA 3VZZA 3UWVA 2DT0A 4JQ4A 2ZZ1A 1FQ0A 8TIMA 3VIKA 5E09A 3RK8A 3OHIA 2XVPA 1FCUA 2P3EA 4H9XA 2ZDSA 2RJGA 3N19B 2GJLA 4XAFA 5CZSA 3CZ8A 3MUY1 2WC7A 3OW1A 4R9XA 1KTNA 4LNYA 4WY0A 3VD5A 5CGMA 5J5RA 1WDQA 4YHEA 3BOFA 3UESA 4GIAA 4MOZA 3TTOA 5HJXA 3WJWA 4HOWA 4Z2LA 3OVPA 3F4CA 4XAGA 1ZENA 4KPLA 4R5EA 2ZUWA 3FJ4A 2R1MA 4GIYA 4PMOA 4RNFA 1KM5A 3O0FA 1A0CA 3W83A 1K9DA 5CAHA 4JY9A 3VKDA 4PMZA 3NGJA 2ZCGA 3E38A 2VR2A 4EPEC 5BXPA 5JBDA 3KTXA 1KR0A 6REQB 2IXUA 4OV4A 4RE2A 1OCNA 4QXIA 1YW1A 3O9NA 5E0KA 3SCUA 3TAKA 3A12A 4PL2A 4FF5A 4NQ1A 2BY0A 3DBPA 2BBFA 2R14A 1FWBC 3MY9A 4ZODA 3SJNA 4LSBA 4X63A 1KCXA 3OGSA 4LVFA 1JD9A 2ZYFA 3BAJA 4MPKA 2FVMA 4PMUA 1W37A 2PU1A 3A3XA 1FBAA 4LCQA 1SW3A 3L68A 3L9CA 4DHGA 1CLXA 1JYWA 3TXVA 4DF1A 5A8NA 5D2XA 3EMZA 4L4LA 1UJQA 3TOYA 3PB2A 1SSGA 3A21A 1TJ1A 2Z27A 3UEQA 2GK1A 4DO7A 1O1HA 4K8GA 1Z7AA 3LCFA 3BMXA 5C9XA 2XM2A 3NSMA 4NJIA 4O1AA 3V1PA 3AXKA 3ICJA 3BSGA 1QNSA 1LT8A 3GFXA 5I09A 3L4WA 3S1WA 2PTZA 2V2CA 1FWJC 2VHLA 5FSEC 1FKWA 4X2PA 2C79A 1V8EA 3JW7A 1QNPA 4PMVA 2QCFA 2DZBA 1YBQA 5KSWA 3SN1A 3USZA 2VRKA 3B0PA 4GVGA 4B5WA 2A85A 5MKGB 3F5KA 4Q4OA 4AYSA 6TAAA 2PSNA 3C4UA 4YCPA 1OC6A 2I5GA 4IFKB 4IP4A 1QPNA 2E6FA 1PKNA 1YDYA 3A3HA 2Y89A 1VP5A 1KFBA 3B9OA 1CW2A 5C70A 3LCXA 3UJ2A 1AJ0A 3PTQA 4F79A 5XIMA 4GIRA 2FH6A 3QLDA 4JL1A 4MLRA 4P8XA 1WBJA 1PYMA 1GGOA 1N55A 3EWBX 5I03A 2GJPA 4BQ3A 2W6RA 3HO8A 1UWTA 1MFVA 3F2CA 3BSHA 4QROA 2IPJA 2RDUA 5D4YA 3TNOA 3Q45A 4M29A 1NF0A 4ADUA 3GIQA 1K3UA 2Y7EA 3ZM8A 4UNKA 1EYWA 3T4WA 1GK8A 1WB0A 3H22A 4D8AA 3ZJ7A 2DJXA 3NSXA 3WDPP 1IE7C 2WZIA 3BOXA 3EPMA 3W7QA 3CZKA 3QH2A 4I9AA 2E6YA 4U5IA 3L21A 1SO3A 3PF3A 3WQWA 1YXYA 3HGOA 3IPWA 4HK5A 3ZXWA 5BXRA 5EU9A 4MYAA 3VK5A 1XIDA 4W85A 3TZFA 1OG0A 4UC5A 3O7UA 4HPHA 4KW2A 3R12A 5BMXA 2PC4A 5XIAA 4ICMA 3PWAA 4CQ8A 3BZGA 4Q4SA 4G7FA 3WCZA 1VD6A 1EKOA 3OO2A 2E25A 4YTRA 1VHNA 4DO4A 1IIGA 3LK6A 2I5IA 3RG6A 3K1DA 1E6XM 3HZ3A 3WLSA 4E4UA 1GOXA 4M1BA 4U4MA 4C6NA 1R7AA 4AF0B 4U2ZA 4NILA 1QTWA 3H2CA 1UD4A 1Q7QA 2E3ZA 2RDWA 3NTYA 4ZGYA 2NSOA 2D23A 5LIKX 5AC8A 4XG1A 1R9ZA 4LAMA 3AC0A 4JTCA 3R89A 4KF1A 4NZJA 2VMFA 4AD1A 3LPFA 3NSNA 1XC4A 2GDVA 5KEZA 1JAKA 1G4EA 2J62A 3BG9A 1H7WA 2E9BA 5IDIA 1RHCA 3EA3A 1H5VA 4L6DA 3VKBA 3GZ3A 4RE3A 3GD6A 3LQGA 4QCEA 4YHGA 4R7JA 1J0HA 2OG9A 2YCEA 3A24A 3S1VA 2YXXA 4FP1A 4M56A 3R8HA 4D6IA 4W9TA 1TWSA 2G8ZA 1WDDA 1XL9A 4XAPA 1ONEA 3LCWA 3GZAA 1LCOA 4IPIA 1VFSA 4A8LA 5FJOA 5CG0A 3W1QA 2XGZA 1C90A 2AAAA 3SEPA 1HJQA 4Y8FA 3N2BA 3B9NA 1W1TA 2ZA1A 3KEHA 3K2GA 2DU2A 1EH9A 1BEUA 2YBVA 1Q4NX 3Q67A 4IG2B 3T09A 2QXWA 5FJJA 4HYRA 1A3HA 2DZUA 3UJFA 3YPIA 5AHIA 2I56A 4AIBA 3N6HA 5CZJA 2ZX6A 2VC7A 2BVWA 4LCSA 1QJWA 5T26A 1ICPA 2BXZA 4WDXA 4MDPA 5KZEA 3IJ9A 3P6LA 1H60A 5I06A 5REQB 3QKEA 4UB9A 3FFSA 5C0QA 5JMUA 5HUPA 1JDAA 4Q7NA 3CAKA 2PA6A 4TVCA 3T8LA 2NLIA 5AC6A 3VFCA 4B2DA 1KGXA 2FGZA 2VZVA 3PJTA 4C6IA 1F3WA 4DPPA 3KWSA 1K77A 3T55A 4MZ8A 1O5RA 3UCCA 4O53A 1NWSA 1LZOA 5I2UA 1ZALA 3W1PA 2P8BA 1XI3A 9XIMA 4FX7A 1FY6A 4NSBA 3ZMRA 4EANA 2VI0A 3A47A 4WJXA 3R13A 4IL0A 3VD3A 3GLCA 1JZ5A 2EPLX 4Q8MA 3N11A 3G6LA 5ABFB 1UW9A 2Y5JA 4K1GA 1Q4WA 2FDMA 2VNCA 1CLVA 5EMYA 4B90A 4S3BA 3PJXA 1I2OA 1O6IA 2HVNA 3RO6A 2BWGA 4AH7A 5M2FX 1RPKA 3M7SA 1IHIA 3V0TA 1ADSA 4MHBA 3T1GA 2QJNA 3INPA 1B3YA 3ME3A 1OGBA 1ZPTA 3QYSA 1GEHA 3VOGA 3LTSA 4HNTA 2YFNA 4J27A 3BARA 4L4MA 1US0A 4A4AA 5A8PA 1WNOA 3SDOA 1WZKA 3G8RA 4ACZB 1VYSX 2DFAA 1HW6A 4LF1A 2CWXA 4LVDA 2O9RA 1C93A 3WUFA 3H26A 3V35A 3B06A 4Z1BA 3TYAA 3RCMA 5FF3A 5AYIA 4QBXA 5KETA 3SCNA 3LD5A 2D0HA 2QLYA 3URAA 2X40A 3TMQA 4G9PA 3UG8A 2PMQA 4O0QA 1TFVA 1CTNA 1X39A 4WLCA 4DI9A 1F6PA 3PZIA 1W1B1 4OT7A 2GUBA 4A3UA 4HCLA 4TR9A 3MSDA 1ZB5A 2ZBTA 4GE8A 1S2CA 5C2GA 2D20A 4FOJA 3ZJ8A 3EDDA 3V7PA 3AYSA 1V6XA 1AW5A 5AYYA 2HTMA 3BL3A 3MV01 3UERA 1DWIM 1B5TA 3QPYA 1Z32X 3IIZA 3UFYA 1PIFA 1CGXA 6REQA 2WOQA 2GQ3A 3A4JA 3C0QA 4JTGA 2GGJA 2OZ8A 4HPXA 2AMXA 3MW7A 1Z89A 2IKJA 2NQZA 1G67A 2WMJA 3WLLA 3P74A 3S5YA 1X7IA 3PANA 4AMCA 4EPDC 2GQ9A 3EDEA 1EBHA 1OY0A 1UBSA 3THQA 2QZRA 4RZ6A 5A8QA 1ONWA 1ISYA 1W1IE 4O0KA 3C3NA 4QNWA 1A53A 1W32A 3LZ3A 3TYUA 3VNDA 1R7OA 1W5OA 2YSWA 1TJRA 4L1XA 1UKSA 3KRSA 1A5CA 1OX4B 4MY8A 3W02A 2D2HA 2IPGA 4HA1A 4ADSA 4PTNA 4EX4A 1BFNA 2EEXA 4CEUC 4DBSA 4HJFA 2E77A 2ZUUA 4DLFA 1HX0A 1EO5A 5D03A 1ODZA 1RK6A 4NHVA 1OGSA 3PP7A 4NRRA 3F03K 2XGBA 4XQ6A 2PP0A 3NDYA 3BQ5A 2FZNA 3Q4DA 4O10A 1V3JA 2CU0A 4HJWA 4DRSA 1MWOA 4KWVA 3UG4A 4EF9A 1SQ7A 3O16A 1NOWA 2FJUB 5FJPA 3PBUA 4PBEA 2J8GA 4RPQA 5G2WA 2F6KA 1UR8A 1A0EA 3ZR5A 2NT1A 3CUHA 4M7TA 3RF9A 1TA3B 4GVHA 3GX9A 1P6BA 2FQIA 3WUGA 1V3IA 1ZSXA 4IIDA 1BG9A 1WV2A 1FFRA 4UTKA 3APGA 3SB0A 3DERA 4BZYA 4YYCA 4A3HA 4QDPA 3G0UA 1HZYA 3D0CA 3IARA 3PVFA 3WEOA 1J2BA 2ZRWA 1BLIA 1S2AA 3BW2A 1C92A 3WNPA 1M6JA 1EFZA 4HU8A 3E0IA 1XQLA 3MQTA 3LLXA 3GUGA 2JIWA 3B8VA 1V0NA 3GVWA 3SQSA 1EGZA 4FNTA 1WDWA 4UQCA 2YDAA 5F4SA 3CEUA 3DG3A 4GPNA 2VQTA 4PC8A 3FS2A 2PRMA 4JN7A 3WD3A 2I16A 4D6CA 1WO2A 4LBUA 2FYMA 1QOXA 1O1ZA 3QV6A 1PIGA 4ICCX 3W22A 5AVNA 4K68A 1JZ3A 6CGTA 1S1RA 1HG3A 3ZS4A 2BGQA 1MUWA 5EPDA 2PWEA 3MV11 3QSRA 4X0VA 1UR9A 2P3ZA 4XKYB 1MZHA 4FX8A 4ML9A 1O7AA 1X1NA 1HKVA 3C0LA 1H1ZA 1F74A 3DG6A 3S2LA 1BYBA 4FEZA 4IQLA 4CU6A 1RPXA 1YQ2A 3BJSA 2XM1A 4C1KA 3M64A 1W31A 2VZSA 4IQJA 1UMYA 2Z1SA 1SR0A 1W3KA 3QV7A 1UPMB 1OG6A 1Q85A 2VZOA 3OP2A 4B3LA 4XK2A 2C91A 2XGIA 3DH7A 1XH2A 1I0BA 3NG3A 2J9ZA 2WKJA 4FR1A 1AJ2A 3ZLHA 3NVDA 1QNVA 2CLKA 2HVOA 3G22A 1EGMA 1CIUA 2G37A 3IK4A 2YL6A 1KM4A 3QJAA 3E2RA 3OYZA 3SRDA 4DNMA 2Q3RA 3K8KA 4ZTYA 4AUBA 4CN6A 3PZTA 3HURA 1EQPA 1ZJIA 1NSJA 3LCGA 4FOKA 2VUNA 4LEQA 4OVXA 3W2UA 2J7FA 2HJPA 3VIMA 1EJWC 4REQB 3LPPA 4ATDA 3ABQA 2ALRA 3TYDA 1T8QA 4QX4A 4MVAA 3LCHA 2X30A 1L6GA 4JOMA 4IPJA 2YDSA 5KTLA 2RAGA 2BOGX 2WPGA 3FX4A 4CN4A 1SR9A 3CV2A 3LZ5A 1CZ1A 1J01A 2VX4A 1TWDA 5E70A 2NVAA 4QE5A 5HJLA 4QTGA 1UUMA 3TLQA 3NO1A 5LHEA 2JE8A 4MDOA 2W61A 5JBEA 1GG0A 2FZ9A 3FXGA 4JKMA 3AROA 3G0SA 1I9CB 3QOMA 5F2MA 4YXGA 1TE1A 2YOCA 2HK0A 3TN4A 1F07A 1Q66A 3CL6A 1CPUA 1G5AA 3THCA 3HIJA 5G4HC 5AHEA 1QO2A 3W87A 2Z7KA 4F2TA 3PM6A 3UZ5A 1E6ZA 4V15A 4CCZA 2WNNA 1P43A 1TZZA 2OLSA 2GL5A 3BCFA 3TFCA 2HQAA 3P61A 3KP1A 4G6CA 1E6RA 4M6PA 3LEPA 3H7UA 2YIHA 3GR4A 4FNUA 2XH0A 5I0DA 3QEZA 1G0CA 3B8SA 1UR3M 4GA8A 1EZWA 1CGTA 1KCKA 1G01A 3A9BA 3HGSA 4BK9A 1Q6OA 3L0KA 3GXMA 2X16A 3RAOA 1A4LA 5H8UA 2YLLA 1NU5A 1QOPA 1XIJA 3FHAA 1EL3A 3WBWA 3CAQA 4E38A 2ZWZA 3MP5A 2TAAA 3TONA 1MVYA 2BNJA 1J93A 1A4MA 3GXIA 4QJ4B 4BF7A 2Y5SA 3FK4A 4OOUA 4ORIA 3LYEA 1G9HA 3CC1A 3EX2A 1TWZA 8XIAA 5C6MA 3PK7A 3IJQA 1UP0A 1N8IA 1Z44A 1F6YA 1BPLB 1HJWA 3CM4A 3G1SA 3GG1A 3QVQA 2YYTA 3DFNA 1XLCA 4F66A 4I8DA 4JL2A 3N3TA 1P5BA 2VDHA 4WHBA 3VNMA 3EWUA 3UG3A 1N82A 3KBVA 3E49A 2Y0FA 1HJVA 1RD6A 1TJPA 1V5XA 1A5KC 4L80A 2QJMA 3TQPA 3B3DA 3G3DA 3AS2A 3LHTA 1F73A 5K3VA 2DZWA 1AMYA 3ELFA 3PJWA 1JQXA 4NJJA 3GAYA 3SRKA 4FX6M 4DQWA 2CFFA 4YTTA 3BLLA 1R46A 3NQDA 2Z26A 4PE8A 3RUBL 1XGZA 5G5IA 3MP3A 1NDWA 1XYBA 3W76A 2ZA2A 1WX0A 3VOCA 2Y8KA 1WQ5A 4JQ1A 1MXGA 4CD7A 2B7OA 1MSSA 4AWUA 2ISFA 1E3ZA 1CXIA 4GCAA 1WYIA 2FPTA 2YBUA 4ZOEA 2ZRVA 4MJ4A 5FKYA 5EMUA 1VEOA 2GJRA 1JDDA 2VEMA 1K4HA 2Z1XA 3ALFA 2FVLA 3W7MA 3WY1A 4US5D 1GW1A 3GKAA 2J7GA 1TV7A 3QRHA 3AZSA 4LS1A 1H1NA 4WSJA 1AA1B 3KOXA 3IVUA 4OGZA 1TX2A 1UIOA 2NX9A 4JDBA 5CSUA 2X1IA 4GI9A 5BZAA 3KBMA 3LDVA 3M6DA 2XZ7A 1YNYA 1Q45A 3IWPA 4LFYA 1ME8A 1IR1A 4KRZA 4JFSA 2ZUMA 3C2YA 4S3JA 4CNPA 2V81A 1QBAA 4JQ2A 1V6YA 1CB7B 3VZYA 4R85A 2QMKA 4H6EA 3RXZA 3LHZA 4W8LA 1YBQB 5B7YA 1T40A 2Q02A 1AODA 3H6OA 2QJGA 1TCMA 4EK7A 3VDBA 2WZMA 1P0EA 2P10A 4B5VA 4CEXC 3FKKA 4PFMA 1R3WA 1R86A 1YHTA 3GXPA 3ITYA 1DJYA 3IVSA 4A22A 4IMGA 5D04C 1UKTA 1H61A 1I1XA 3VTRA 2V3DA 2CBIA 4UR7A 3EA2A 1K7EA 4E4FA 4ERIA 1KM1A 3QGAC 1W9PA 4W8BA 3APYA 2WANA 3ARTA 2NVDA 2Z1VA 1Q6RA 2PDXA 3LPGA 1EP1A 4S3DA 5EA9A 3TVAA 1E9ZB 2CZ5A 4QM1A 3EBVA 3GRIA 4WOQA 3M44A 3LY0A 1NIUA 3CZEA 1JJKA 4QDMA 3P8JA 5T9CE 4FIQA 3TE9A 4TVDA 3BGJA 3OLDA 4WIWA 2GSEA 3ZZ1A 3H23A 1UC4A 2PD9A 4QQUA 4NP7A 1EZ2A 2PTXA 2PU0A 2ZRZA 2HEJA 4YN5A 2WAGA 3C61A 1I75A 4RK8A 4CVWA 3EEZA 2ZE3A 3W2NA 2H3BA 4MAZA 3ABRA 3A13A 4AVNA 5FACA 1QK0A 3UETA 3I65A 2Z2UA 5HR7A 2V0TA 1MXSA 3AYRA 5DN1A 2ZC8A 5PTDA 1L8PA 3ZYZA 3LM7A 3L12A 3R6IA 3MHGA 5LHFA 4FNSA 4NNCA 1XBYA 3ZWSA 2OVLA 2X7WA 3E5BA 1ITUA 4F2BA 3ID7A 3GNRA 1ADOA 3T08A 1AG1O 1XIGA 2QCGA 2WMHA 2OOFA 2ZIDA 3VKAA 3K8MA 5KZDA 4KESA 3NL5A 4I9TA 4FNQA 1JPDX 3SZ8A 4DWSA 3C8NA 1Q6DA 2L5HA 3RPTA 1TV4A 4G7EB 4XAZA 3E9AA 2XUCA 2OB3A 2Y8VA 4HOZA 1UASA 1P48A 3HPFA 5E0FA 2J13A 5CBBA 1I2PA 1GTEA 2X8RA 1Z41A 2E0PA 3OG2A 1IV8A 4DYKA 3MA8A 3QY7A 1C8YA 1VLWA 3M0YA 1SSDA 3WENA 1AQ0A 1VF8A 4JTDA 3ANVA 5F2LA 1R2SA 4QDWA 1BWLA 3T44A 3RJYA 4LAUA 3EWCA 3FCPA 3SQMA 3FDGA 4E2OA 3QF0A 4V27A 4KWWA 1T5AA 4GZEA 4GNVA 4A29A 3OA3A 4NZ4A 3AIWA 4JTSA 3TR9A 2EF9A 1EO7A 1Z42A 4PUKA 4GK8A 3NZPA 3Q2DA 2WMKA 1BF2A 4GOAA 1ICSA 4KT2A 3AALA 3RM4A 1IWAA 4CQCA 1FHLA 1JL8A 1HVQA 3SCRA 4H8UA 1KV5A 3TX9A 4IHCA 3B9AA 2EO7A 2WPBA 4G7EA 3N29A 5A6LA 1XIEA 1GYMA 4ZO9A 3I3BA 4MPQA 4XIMA 2GFTA 1PKMA 2P0IA 2NV1A 1EC8A 1VFHA 4E2VA 3JVAA 4XAYA 2CETA 3GXNA 4ZFCA 5J8LA 1CXHA 4HP5A 4J3WA 5D32A 4LV9A 3O6CA 2PCQA 4H9ZA 1DHPA 3BK0A 5ECUA 1WBHA 1UBPC 5JUVA 1ZZMA 3WKZA 4PMRA 1OX5A 3QZEA 1YTDA 3CIVA 1OVDA 4LVBA 3V0UA 5GJNA 1A49A 1D7FA 4AD2A 1BSIA 3UCDA 5AC7A 1M7PA 5IM51 4PBGA 1EPVA 5HDRA 5A94A 4NZ1A 2QDEA 3OQEA 4TX9A 2OX1A 1QWKA 2Q3OA 4HIBA 4Q8TA 5H91A 3ZQ9A 1MYRA 4ZB0A 1O4UA 4XD4A 5H8MA 3M1ZA 3P0XA 1EOMA 5M17A 2CZEA 3R25A 3TIMA 1TPC1 5ABFA 3M5XA 4OUIA 4PRWA 4NX0A 2VYOA 2CBJA 1BQGA 2PDHA 5D9NA 1SW7A 4Q8WA 1TVNA 2R8WA 1H5YA 5JH1A 3WJXA 4U28A 4HHMA 3EKLA 1OK4A 3STEA 4B4HA 3GC5A 4WKHA 2VC5A 3URNA 3OEXA 1BKSA 1LL7A 1XC6A 2QS8A 3QXBA 3ZT5A 3P14A 1DIKA 3T78A 2I5QA 3DKLA 2PDNA 4O16A 3GTXA 1PZ2A 5CSSA 4H4IA 3BOLA 3ITGA 2E8YA 4FLSA 2A7PA 1CI1A 3TSDA 4AXKA 2X42A 3SN0A 4DJDD 1ECQA 5FAGA 4H8HA 3EOLA 4J3XA 3WNKA 2WYSA 5AFDA 1Z69A 2PDQA 1RAKA 3OU8A 1V3HA 1MW0A 2C14A 3C6CA 1UZDA 2D0GA 1Q7MA 1VCVA 3C2EA 3R10A 4BA0A 2IQ0A 2HZGA 1GKRA 3OIHA 4Z2IA 1H7XA 4I9MA 1ODUA 4M80A 1WUFA 1LG2A 4HPJA 3W7GA 1E43A 3KP0A 1FCQA 4LF2A 2VL4A 2JF7A 3VZXA 4CQBA 1KGUA 2QJIA 1QASA 4A35A 2R82A 4M6UA 5D2WA 2GJXB 1JZ7A 3PPFA 4F0HA 3G24A 4OFCA 2GUUA 3TYBA 4URIA 3VU2A 4HZ6A 1KM3A 4DJEA 4DJED 1TIMA 1OBAA 3QV9A 1XIHA 2WW5A 3GNNA 1UZ1A 7XIMA 5HWNA 3RLHA 3U2CA 2J47A 3ARSA 1JGIA 1IT7A 2PBGA 1POKA 1EHNA 4M6VA 4EXBA 1FA2A 3VE7A 4QSFA 1S5MA 4IGMA 2OWXA 1M68A 3TN3A 1DE6A 4P7RA 1XLDA 2G3JA 4HT3A 3KCJA 2INFA 4PR4A 4Q8QA 4GUJA 5D2TA 1OYAA 5EY5A 2EQDA 4AZGA 2D22A 3OIXA 2JF6A 2VRQA 2CZFA 3AHVA 4GKLA 3EAUA 2IW0A 3HBLA 2VVSA 3OYXA 3WQOA 5BOFA 4I6KA 3W86A 3KOZA 3RR1A 1C9DA 2UV8G 5IHSA 1KWGA 1FVPA 4GXMA 4F8XA 4Q7BA 3OVRA 3E2QA 1QRQA 1J9YA 2OFJA 2XWEA 3WLHA 2B31A 4HNUA 3R0UA 2BY1A 3SO7A 5I7GA 4OECA 1VKFA 3VCCA 3LHWA 3LXAA 4UTMA 3HG2A 3T8QA 1MDRA 1POJA 4MKSA 2P88A 1TVLA 3SUTA 1L8NA 4KGLA 2EBNA 2OZ0A 3MANA 1QHPA 2VCBA 2QDGA 1J0JA 1NF7A 3IAQA 3U48A 2P50A 4IPPA 1OFRA 4PGLA 2FGBA 3PTDA 1W8SA 5A6MA 2JK2A 1WDSA 3WH9A 2Z24A 5A8MA 4FMVA 3BLDA 3MUAA 2QJJA 3OBKA 2BVTA 2PE4A 3QM3A 2DT1A 3RLGA 4XZNX 4UBPC 3WLNA 2CYGA 3P82A 4IXXA 2J9XA 4E8CA 2P0OA 3BANA 3T9PA 4OE7A 5D2VA 1L6WA 3DFQA 4GZ7A 1E0TA 1R6WA 2E68A 4YS1A 1TX0A 3UD6A 4IICA 3EOEA 3T7VA 3ZSTA 4B5NA 3PZUA 4JICA 1QI5A 4DLMA 4HZ8A 5BU9A 2C71A 2VM8A 3C0JA 1M9HA 5FEPA 2VFGA 1WAWA 1E6PA 1ZAHA 1ISXA 4K36A 3FDKA 1WXJA 3VNKA 1HO4A 1TYGA 5CLTA 7PTDA 3W72A 1DTNA 2TYSA 4ZE4A 3S42A 1JAEA 5D8ZA 2VT0A 1GHRA 3ITLA 1P0BA 1DHKA 1GJUA 4AZHA 2VEFA 3PZVA 3ZVHA 4BF5A 2Y24A 1ZBVA 2BOEX 3KS6A 5G2HA 3QOKA 1IZKA 2PD5A 1HIZA 3GNXA 2AQVA 4XZBA 2ZKMX 5H2ZA 4GMEA 1FKXA 3F2BA 3AUJA 2RFGA 4KETA 4EPKA 1OCJA 3SECA 4LUYA 1J4EA 3A5VA 3WBXA 1OFQA 4KGJA 5I3FA 2VCAA 2PPGA 3HQNA 3PG8A 2X2YA 4NU7A 3T4CA 3BJFA 5EGRA 1H41A 1R5YA 3V5FA 2A3BA 3T0DA 4ZQNA 5HINA 4I7UA 3LBMA 3S0CA 1DWHM 2ZX5A 3TYEA 2VURA 1P7TA 3W7HA 5CPQA 4FALA 2OGYA 5I3JA 1IIHA 2Z25A 1E6NA 3QQWA 1VYRA 5CPSA 4C91A 3BLPX 3MUXA 2XIQA 4Z0SA 4MFEA 1AQMA 1ZGDA 1XLMA 3STPA 3CUFA 4HBKA 4DJDC 1NP2A 5TIMA 1TCDA 2H9AB 3G1AA 4D8LA 3M41A 4GD0A 3MP4A 3RIKA 1J6OA 4HCDA 2QGHA 4E0CA 2ZOXA 1BRLB 2DIKA 2J79A 1Q6QA 3DYPA 1W3IA 4HMCA 2DZVA 4D8ZA 4ZQRA 1UP3A 1XIMA 1KFLA 4J3UA 3SCVA 2BLEA 1KGWA 4M81A 1R8LA 4O13A 3Q37A 2UY3A 3B04A 1E9YB 4RDVA 3IS4A 2YX0A 4GNJA 1THFD 5FCZA 5RUBA 4JYEA 3TNBA 5DY3A 2A1YA 2OX4A 5HR6A 2YCIX 1EWEA 4TU1A 1ZJHA 4IXHA 4JAWA 3IUIA 4YYFA 2CZVA 3GHUA 2CLHA 2DSUA 2FMOA 4WOZA 2XSBA 4Q3MA 3W75A 4W7VA 1H51A 1V3KA 3P5ZA 3CXOA 1XKYA 3FVDA 3WJSA 5I77A 3GO2A 1BYCA 2WMIB 1JZ2A 5C9RA 4LYKA 4DZ5A 2DSZA 3TW9A 1QW8A 1JPKA 4OU1A 1B9ZA 1W3NA 4PEKA 5EBAA 4XSLA 2EG7A 3ABOA 1XDJA 1XIBA 3FIGA 1BTMA 1S3TC 3P67A 3MWAA 1U83A 3FVMA 3IIOA 1EX5A 4XUYA 2BGSA 5CZTA 4HHPA 3B97A 1HKJA 1OF8A 1ELSA 4UTWA 1KTCA 1I45A 3DKJA 4JIIX 4M24A 4JTKA 3FXYA 4LC6A 4P8UA 1E40A 2DW6A 4S3GA 1GQLA 2OU4A 3CHFA 1EOKA 3LSBA 4A2SA 4S39A 2RGMA 3CQKA 4BEQA 4JTQA 3O06A 2DZSA 2E7FA 4UR9A 3VNLA 1DWJM 3NDOA 1BXNA 3WMCA 3CT2A 2WSYA 1CT5A 4O15A 4W7WA 5A2CA 4L5ZA 3REQA 5A2BA 3WJZA 3TFXA 4HK6A 4MNLA 2OLAA 1IZCA 1JG9A 1LQ2A 1KXTA 3S6TA 4DWDA 1VBJA 4Q6XA 3PN8A 4AY7A 1H49A 1QOQA 3BG5A 2OO0A 1XRSA 1JNDA 1M01A 2RJHA 3LI1A 4B5UA 2P8CA 2CBVA 2PWFA 2Y2WA 3ABZA 1UYQA 1W1ZA 4JNZA 2QKFA 1IEWA 4PEEA 3BDKA 3NQMA 2WMFA 1ME7A 2DVXA 2J25A 2ZXAA 3M0HA 3WL0A 2JALA 1VHCA 3ZVIA 1H3GA 1BAGA 1O66A 1PXGA 5T9BG 4NNBA 3ZIZA 1I6NA 4C65A 3K5XA 3I6EA 3EYPA 2WSQA 2YL8A 7ENLA 2YJQA 3UXDA 1YE4A 3LCIA 2VFFA 5HNNA 1XRTA 4J3ZA 1HL2A 3QGKC 2SFPA 3FLUA 1HUVA 4YWSA 5JIPA 3G8EA 3VVGA 1GQJA 1UD3A 3WQFA 2QIIA 1KRCC 4HA0A 1F4AA 1JCMP 1GG1A 3POHA 1Q13A 1GJPA 2VEPA 1RA5A 3GG8A 3ES8A 5CZ0A 3PBVA 4MAVA 4MB4A 1DIEA 2BY2A 2OYKA 1BVWA 3R2GA 3R0KA 3EXSA 1NVMA 1TRIA 4RV8A 4JHZA 3KE0A 2JKEA 3H4GA 3WQ8A 3H55A 4FXRA 3QTPA 2DUXA 2FJKA 3NQEA 4DNHA 1DXFA 3EWWA 2JGYA 3NM3A 1VH7A 4AVOA 4PN2A 3LS9A 3D3FA 1KFJA 4FIRA 2PGFA 1MRQA 4GINA 1ITXA 3OODA 2CNCA 1BF6A 4XVEA 1PDYA 4B9YA 4JTFA 3HQPA 2QV4A 1UP2A 1W17A 3H4XA 5A3HA 5M03A 4ZSUA 3T0TA 1UWSA 1NOUA 5DCBA 1B0IA 3T07A 2PWHA 2BZNA 1LOLA 2IXVA 2O0TA 3CAWA 4GKTA 2GK1B 1TPB1 1F76A 2C0AA 4X9YA 4BWLC 3B8TA 4HPNA 5HOSA 1GONA 3MMDA 4AZCB 5C2CA 4UZSA 3CUJA 2WJFA 4TX8A 4UCGA 2QJHA 1QPKA 4Z1YA 4TVUA 3UZJA 2VZUA 3VAVA 3CUZA 4N6FA 2VX6A 5BWAA 1V6WA 2Y63A 1UA3A 4GH1A 4BHYA 3GHSA 2VZTA 1RR2A 4XISA 3IUHA 2YA0A 3H2NA 4QP0A 4J4KA 2E5CA 2Z4GA 2VEKA 1J79A 3S4TA 1Z48A 1DYSA 2C18A 2ZVRA 2FIQA 3EXTA 3WFZA 3GWQA 3EX1A 4TMBA 3DFHA 1GT8A 2V2DA 5A5WA 3SY5A 3KCLA 5CJMA 4Q7IA 2X7VA 3V3WA 5K4ZA 4H6RA 4KFPA 3FSTA 2YB4A 3VMOA 3N6QA 3LQLA 5DFAA 4P7LA 5DO8A 4IP5A 1CGUA 3ZO9A 1RJQA 1EEPA 1X8FA 4GI4A 4J1OA 1V79A 4C6MA 3H24A 3AFBA 1QNRA 4NYYA 3TA9A 3GBEA 8RUCA 1KBBA 3R4IA 3DAQA 4F0KA 4L6HA 3C2VA 1TE6A 1VJSA 2J8TA 3Q58A 2W91A