4L1GA

Crystal structure of the bc1960 peptidoglycan n-acetylglucosamine deacetylase from bacillus cereus
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
214
structure length
213
Chain Sequence
WTPFSWVEKYAYAFSGPYNKAEVALTFDDGPDLEFTPKILDKLKQHNVKATFFLLGENAEKFPNIVKRIANEGHVIGNHTYSHPNLAKVNEDEYRNQIIKTEEILNRLAGYAPKFIRPYGEILENQLKWATEQNFMIVQWSVDTVDWKGVSADTITNNVLGNSFPGSVILQHSTPGGHLQGSVDALDKIIPQLKTKGARFVTLPSMFQTSKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidoglycan N-acetylglucosamine deacetylase
publication title An unusual alpha-carbon hydroxylation of proline promotes active-site maturation.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 79
structure length 213
sequence length 214
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4l1gA00
2I5IA 4LY4A 4F9JA 1XW8A 2C79A 2QV5A 4NYUA 1W1A1 1W17A 2XU2A 2IW0A 3QBUA 4L1GA 2C1IA 3CL8A 4U10A 2E67A 4WCJA 4NY2A 4HD5A 4OUIA 3CL6A 2DFAA 3HFTA 3VUSA 2W3ZA 1V6TA 4NZ4A 4V33A 1NY1A 2J13A 3CL7A 5BU6A 1Z7AA 4F9DA 4NZ5A 4NZ1A 2Y8UA 4NZ3A 3S6OA 4NYYA 1W1B1 2C71A 4M1BA 3RXZA 3WX7A 2VYOA 2NLYA 2CC0A 5JMUA 2C1GA
chains in the Genus database with same CATH superfamily
4XVDA 3TLQA 1Q3NA 4C1LA 1K70A 4UTWC 3FVDA 3BMVA 3E0IA 3CT2A 4HHLA 1Z32X 1RR2A 3MUZ1 4O13A 1VJSA 3Q58A 3T4WA 3CXOA 3ZT7A 1WZLA 2C15A 1A0CA 1NM9A 2Q71A 2ACUA 4GNVA 5JH2A 4IIGA 4KH2A 4ZEPA 4PB4A 1JCLA 3P8JA 4KMQA 3URAA 5A6LA 4P61A 4RR4A 1F9CA 2Y5EA 2NV9A 3V0UA 2RGLA 4XZ9A 4ZSUA 3UR7A 1GW1A 3QYQA 4XAGA 2G50A 4US5A 4TVUA 4DXKA 3SM0A 1GNXA 3ZLGA 3ONBA 2FMOA 3W1TA 4GFIA 3F4WA 3WUBA 2YCKX 2WNWA 3SB0A 1ME9A 3KBSA 3QEZA 2VT0A 3NG3A 4MKSA 3W1LA 4M0XA 4GYPA 3PTMA 2PDYA 4EANA 3O6AA 6A3HA 1B3OA 2ALRA 1E56A 1XH0A 1RJRA 3TYUA 2W62A 4KW2A 4NNAA 3CZKA 2VZUA 4D6JA 2NT1A 2POTA 4FXJA 4RUBA 3S1UA 2VFGA 1W3TA 4X9SA 4UB9A 1RBAA 1UG6A 1YDYA 3ARXA 3WF0A 1VLIA 1OF6A 4UTJA 1FWFC 3WK2A 5I3JA 5I77A 1N8IA 2YBTA 2W79A 4MPQA 2GQ3A 3PPFA 2CKSA 3BW2A 3EGJA 3DHPA 2QCMA 5FEZA 4LUSB 2Z4GA 2BVTA 1GT8A 3FVMA 4CKQA 4FR6A 1NP0A 3NAVA 1DTNA 5TD4A 3WQ8A 4BF5A 4GRSA 4QFUA 2D23A 1S1RA 2WZMA 2CBVA 2QYGA 1HJXA 5CAKA 3UPBA 5D37A 1TUFA 3WQPA 3UZJA 4L9XA 4CCZA 1KM2A 4UTWA 3EPNA 1HUVA 4P8VA 1QW8A 1W5NA 3A22A 2V5BA 3RNDA 3KWXA 1XGDA 2Q09A 3W7LA 1KLYA 3ARWA 5TNVA 5C70A 1PJ9A 3LCIA 1HP4A 2QCGA 4GA8A 3FJNA 1PKYA 1J6PA 3DX5A 2UY2A 2VR5A 3R6IA 1B1YA 1XD1A 1JCYA 3T81A 1W1ZA 4RZ6A 4J3VA 3HV9A 3BE7A 5AHNA 3EWWA 2MNRA 4TV5A 4XKMA 7REQA 4DUVA 1MRQA 3VGFA 1LLOA 1EO5A 2GQ8A 2PDWA 3VE7A 3NL2A 2C1IA 4CU7A 1BG9A 4LC8A 3MYPA 4BF9A 5BXSA 2V5CA 3RRAA 4PMNA 5G4WA 4U3CA 4BK9A 4EACA 5EU9A 3NTYA 2C13A 4L1GA 4HA4A 3N4EA 1J5TA 3SECA 2QUVA 5AC4A 4ZE4A 4RPQA 3TAOA 5HATA 5D8ZA 2Y63A 3UR5A 4KRZA 4CD6A 4R7OA 3ARVA 5KZDA 1FWRA 1ZQ5A 3LK6A 1EJRC 2J77A 3BZGA 2AL2A 2GPTA 1F3WA 3L4XA 1TZ7A 2E4TA 2I14A 1MI3A 3TYBA 1IZKA 3NZQA 1KV5A 2Y0FA 5LSMA 4DAIA 3UETA 3W2JA 3C2YA 3KOFA 3UF9A 5HPOA 2WZTA 4JNYA 1G6CA 4DB7A 3MKCA 4KCWA 3S2NA 2WHLA 2V3DA 4ZE5A 2J75A 3NQGA 1BKSA 1FWCC 3IEBA 4GZEA 4C91A 4Q6XA 4HCDA 3AXIA 3Q94A 4L4PA 1JPHA 4H41A 1LRQA 1HKVA 1AW1A 1IZCA 1GQNA 2E1WA 4IIHA 4JN6A 4BI6A 3PHAA 1OADA 3ZM8A 4LUTB 4H19A 4XZHA 2WQDA 2PTXA 3HA1A 3A3XA 1LG2A 3EX6A 4D8ZA 4QS6A 3KEHA 1OCBA 2G37A 2GVJA 2X1RA 1H5YA 2JEPA 3B9NA 2I1OA 2XG9A 5EBUA 3ZSTA 2X8RA 4Q33A 4ADTA 3O6CA 1XINA 1EDTA 2QDHA 3F2DA 1EH9A 1J6OA 3VI2A 1E55A 3QV7A 4W4QA 5HMDA 3ANYA 2IXVA 1UJPA 1OB0A 4J3XA 3M44A 3S46A 3CV2A 4NT0A 3EWCA 4XVEA 1HJVA 1QPOA 2OVLA 3R0UA 4NJJA 1VF8A 5IXEA 2DSKA 1I4NA 2IPWA 3EXTA 1EXPA 4DJDC 1P0KA 1H0IA 2XVLA 3V35A 1X8CA 1F6YA 3UXAA 4BEUA 1V6TA 2H3BA 1DPMA 4IX2A 4GYJA 2X0HA 5DELA 1PZ1A 3TROA 3GVRA 3SDOA 4NILA 1NVMA 3VZYA 1KNWA 1Z42A 4Q8PA 4Y9OA 4RXGA 4JAWA 3W88A 1FFRA 4JTAA 4LS1A 5E9AA 2WPBA 5DLCA 4H2CA 2GVEA 5HWMA 2D2GA 3CWNA 2O9TA 1DVJA 2R9RA 1UKOA 4HMNA 1EX5A 4HVXA 3W1AA 5TBOA 4F4RA 4Q8QA 1PCWA 2F6KA 2VX7A 4A22A 4ACYA 2G4FA 3E6EA 3SCOA 1UP3A 5KEZA 2E8ZA 4S3BA 5CH9A 3S4TA 2REQA 4XB3A 3IAPA 4DJED 3M43A 1CNVA 4C6EA 1QBAA 1BXCA 3NDYA 5H6HA 1UH2A 3GXPA 4PRTA 1EC9A 2PLMA 4N9CA 4QHRA 4L5ZA 4M8UA 1DE5A 3W7GA 1J79A 4DUXA 4PMZA 1XYCA 3MHUA 1OCQA 2X41A 1LROA 1TR9A 3TN3A 4Q6JA 4RE2A 2OGYA 4C6NA 5D9PA 3GXMA 2FZ8A 2OZ8A 4CU8A 1FWIC 3L66A 3FAWA 1SJDA 3GNRA 3DG7A 3C3UA 3MPGA 2VR2A 1FRBA 4H8NA 2E6FA 2GDQA 3QHOA 4J35A 2Z7KA 1MQPA 5JVLA 1GQJA 3TCEA 4IJBA 1QAPA 1FWEC 1DYSA 3LXBA 2A3EA 2TYSA 4KESA 4K7VA 1RPXA 2C7FA 3VIIA 1JPDX 3M46A 2J7CA 1QDSA 3AMKA 4ZODA 4BI7A 3GVQA 4AD3A 5LIKX 5F4WA 5K9CA 1JQXA 2HXTA 2OOGA 4GWEA 3VNLA 3LXCA 1A0DA 1KXVA 3I6RA 4M1RA 4PTXA 4JTIA 3EMQA 1A5BA 3CL8A 3CS2A 1A4MA 3NWRA 1TMLA 3TZNA 1HKMA 1UJQA 3OBKA 2AKZA 4LCRA 3ARUA 3I3DA 1E43A 4ZGYA 1LL4A 4C65A 1W1PA 2QJNA 1Z6KA 1JRCA 3NJ3A 1W0MA 3TW7A 2Z6IA 1RP9A 5AC6A 1JGMA 4ZQOA 3DHDA 3NZRA 3TW9A 3N34A 2CLPA 4UQ9A 3PZNA 1ISZA 5A69A 1ZJAA 5BROA 3WEZA 1ISVA 3PBGA 1A49A 1PX3A 3MI2A 1K8ZA 4A3RA 3GHTA 3WLOA 5A8NA 1X1ZA 2G3NA 3DU0A 1ZB5A 4PRWA 3VCNA 4E8GA 1NSJA 4RZBA 2VI0A 4NXSA 3I3BA 2WNZA 2V63A 3WLLA 3LBMA 4RNJA 1AZ2A 1R7OA 4FO4A 4AZCA 3H7UA 4AVFA 1FWWA 5DRIA 2ZWYA 2AGTA 1KQZA 5FF7A 1Q2RA 2YSWA 1JVNA 3P74A 3H2AA 4F48A 3LX9A 3VNJA 5ABGA 1MXSA 4V15A 3NEHA 3NL3A 4KETA 1VCFA 1E3ZA 3GH7A 3REQA 4YJ5A 1TV8A 3LSBA 2YYUA 1G69A 4ZR8A 5HNTA 1V03A 3NOEA 1F74A 1DQUA 1U5HA 2YL5A 3MB9A 2JE8A 3AWNA 5M3WA 1HTIA 3MO4A 1D3CA 2OT1A 1DXIA 5CG7A 1B0IA 1XLIA 1OX4A 3M9YA 4H6KA 3T44A 1SFJA 1W6TA 5TAOA 2G41A 4GG9A 1W17A 2HBVA 4IFRA 3VGHA 5LA1A 3VNMA 3GDTA 1HKKA 2VX6A 1JAEA 1QUMA 1TZ9A 3OGSA 3P2VA 2E25A 4AMCA 4ZO9A 1UWTA 3VMPA 5BXRA 2DT0A 4QJ3B 1TPB1 3N3TA 1C29A 3W6YA 3AJ7A 2CETA 3DG3A 5CC7A 4IJCA 1UD6A 3CUJA 1O5KA 3SSZA 1UWUA 1Q13A 1JL8A 1EDGA 1DOSA 3JS3A 1T5AA 1OJXA 2Q02A 2A3LA 2OOFA 1H61A 3ARRA 1XYAA 4M3PA 3TC6A 1K3UA 4TVDA 4W7UA 3O3RA 4FX8A 2ZUMA 1V6WA 2CWXA 3OHMB 3SGGA 2ZADA 4HP5A 4LTSA 5BRBA 3W70A 2OG9A 3N4FA 1ZFJA 1A5CA 1DQWA 1FWAC 3EKLA 3OU8A 1EWEA 2ZQ0A 4YCPA 1IT7A 1Q65A 2CXGA 1UH3A 5A6SA 3S9YA 2PD9A 3WLHA 1OFAA 1WX0A 3BJFA 3Q45A 1K9FA 3OP2A 3ALFA 2VCCA 3AMLA 1DIOA 3QZEA 3V4BA 3W7RA 1PIIA 3S9ZA 1TPFA 4MY8A 5FJRA 2ZE0A 3B0XA 2ZCGA 3K4DA 2QLYA 3MQTA 2HTMA 3M6DA 3OLEA 3CJPA 4G9PA 1KRBC 1JZ2A 3N04A 1B31A 3OTRA 3MI3A 1K9EA 1FDYA 2ZXDA 1SU5A 6REQA 2UWFA 3CHEA 1SW7A 3SRFA 2XVNA 1E9ZB 1VC4A 1YTDA 5EMYA 3P61A 2DVUA 2W63A 1S5NA 2FZDA 1QNSA 4AD1A 4MGGA 3B8UA 3DC0A 1R2SA 4CEUC 2NLYA 3VD7A 3GW3A 5F1VA 3WLJA 5EGRA 3WYZA 2PDFA 5I07A 4H7ZA 5GVJA 3B0PA 1L6FA 1E9IA 2OKTA 4O1FA 3WFZA 5FSDC 3CQ0A 3WBWA 5XIAA 4N02A 2ZX7A 4A29A 4J9JA 1T6MA 5CBBA 5BOFA 2CERA 3M41A 4HNUA 4IMCA 3AU6A 3NYDA 2Y62A 4OTKA 3RU8X 4DEFA 1OX6A 3A24A 3GE7A 1BYCA 4LSBA 4H83A 1JGIA 3P5YA 1XKYA 3VIOA 3LDVA 2WAGA 4R53A 4L4OA 3RXZA 2PP0A 1E0TA 2XIMA 4I5RA 2VJXA 1A0EA 5FEPA 4JN8A 4NG3A 2BP1A 2X09A 1XCWA 5BWAA 2PCEA 1VBRA 4AD0A 1PUDA 1H7PA 1LWHA 4DYKA 2PP3A 2VXNA 4EPDC 3B9AA 4DWSB 4S3CA 1BGAA 4B5NA 5AHEA 5A6BA 5JMUA 4JTQA 2VFHA 3WN6A 3BW4A 1V51A 4LBUA 1ISYA 2H3DA 1EUAA 4JTUA 4GIEA 1SSDA 1MZRA 2F8QA 2WVUA 4XD4A 2XFRA 1OY0A 4CQ8A 4DELA 1AL8A 1KWGA 3VD9A 4EKJA 3LQGA 3BAWA 4M24A 3SCTA 4JHOA 1GQIA 1PTAA 1FWGC 1XLDA 4UTLA 3QY8A 3QM3A 3TXZA 1DWIM 4PUNA 2QEZA 4AIOA 2OGJA 3FAXA 3TK7A 5HR6A 1BRLA 2ZZ3A 1E6SM 3M5VA 2WCSA 1W3JA 3UESA 5FL0A 4IPJA 2NUXA 1LLWA 5FF0A 1JCNA 4UTTC 2WJDA 1ONEA 4NZ1A 4Q4OA 3TA6A 3M07A 4JY8A 3MHFA 3THAA 1E0XA 4AZ7A 1MDRA 3L4VA 4HK5A 1VBUA 3HGRA 4CQDA 1P1MA 1B3XA 1JJKA 2DZVA 1XYZA 1UD3A 1F3TA 4P8WA 1OG0A 5I3KA 1EHAA 1MEWA 4ML9A 1HJQA 4JIPA 3PBWA 3M6YA 3O9NA 3CV7A 4DJFC 3WMBA 3FS2A 3S6DA 4AISA 3NQVA 2J7DA 1JNEA 3ITXA 4KEMA 3YPIA 4WEVX 5D9MA 4PUUA 3GNXA 4RE4A 3O16A 1ONRA 3FX4A 3GWQA 1WOAA 4GC3A 4KWOA 1XDMA 4BZYA 2XM1A 1PTGA 2Z1WA 1HW6A 3VMNA 3CAWA 3W1QA 2CW6A 1LORA 2VEFA 3KE0A 1F76A 4GBDA 3T7VA 3CAQA 3FEMA 1Z7AA 2QUMA 2Z29A 2J8FA 1NOUA 3GTXA 1H11A 4GINA 4LBRA 4AB4A 1L8NA 5FACA 2CITA 4EXBA 4CU6A 1XQKA 5DXYA 1ZY9A 3LHTA 1YDOA 4XZIA 4R5EA 3S5OA 2PDUA 3ZWSA 3CUFA 3W7KA 1DWAM 4HNNA 3VILA 1EIBA 2B7NA 3AIEA 4C6MA 2V0TA 1LWJA 3MMWA 1M68A 1HO4A 2DZBA 1VLWA 1I1XA 1ZL1A 5KSWA 1ODUA 4Y9AA 1LG1A 4BEQA 1FCUA 1KRMA 5I79A 2Y24A 4H04A 1VFOA 1LCOA 2ANUA 2BZNA 2WM0A 2YL9A 3U5YA 5CAHA 4GQBA 1FP8A 1TYGA 4HN8A 2H90A 2A7PA 3KTCA 1JFXA 5CEWA 4UTTA 3IANA 2C1GA 2E28A 3U2OA 1MNSA 1QNPA 5C6MA 2PDNA 4ATDA 4DWSD 1RSCA 3G1AA 3SSJA 3IJIA 4MG4A 3VCRA 1Q2SA 3WLPA 3CNYA 1QRQA 1V02E 3T8QA 3ZJ8A 1ADOA 4EVZA 3QGVA 5K9DA 3LCLA 3UNDA 2PLKA 3INPA 3CK5A 4G2DA 4YHEA 3W28A 4TO8A 4LVDA 4DJFA 4D6DA 3WNLA 3R0DA 3MT1A 4Q8UA 1LUCB 3U6WA 4ENLA 2DUXA 1JULA 4G56A 4O0QA 2BWGA 1V6VA 1QXLA 3C0QA 3UG4A 1AW5A 1A50A 1JXJA 4OJYA 3LI1A 1H7OA 2A6NA 3RFAA 1B3ZA 4MYXA 3E3HA 3PZMA 2NVDA 4D1IA 3L5LA 5FKYA 2XIQA 2J6VA 1CI1A 1VFHA 1RXOB 2VWSA 5HWNA 4CQ9A 4L4MA 5KTLA 1NWRA 2GWNA 3KZSA 1U1UA 3H2FA 2PWHA 2W4XA 4NF7A 1BAGA 2WC3A 4C1NB 2Y70A 3BLLA 3N9KA 3TMLA 1TTJA 3EWUA 4G5DA 1KM1A 3HFYA 3VTRA 5F1UA 1R5YA 4CD8A 4AQLA 3OZOA 1ADSA 3T9PA 3L7RA 2PU1A 1IEWA 3IIZA 3V1PA 3C2OA 3IJ9A 4IIBA 3ZJKA 2HK1A 3EOUA 3TZFA 4EWND 1OT1A 4ASTA 1ESWA 4AIBA 4L6OA 1NF0A 1VEOA 1GOMA 3UR2A 3EZ4A 4ORIA 1SGJA 4MFEA 4Z1BA 3CUIA 5D03A 2WMKA 3D47A 3WCZA 2TPSA 2X1SA 2FMNA 1ZBCA 1LYXA 4HCLA 3SRKA 1DXEA 4NRRA 3F2CA 3V3WA 3TQ0A 3W85A 2GGIA 2BOGX 3G1FA 3N73A 2ZX6A 5I3GA 1FHVA 3W01A 1E0WA 4MOZA 3QFWA 2YFOA 3PM6A 4E5TA 3VPLA 1PDZA 3N9SA 1E5NA 1RVGA 1XYLA 1TJ2A 3T07A 2WSRA 3GTFA 4GY0A 3WLIA 3PZOA 1UWRA 2WVSA 4Q4RA 2VDGA 1ZRQA 3P60A 3BMXA 3ITOA 3CHVA 4GVIA 3LRMA 3STCA 3I7RA 2ZXQA 2QXWA 4A8IA 4UFLA 2WMIB 1EX1A 2NW0A 3W2UA 3OHIA 4PMXA 1YE6A 2YCLB 2GSHA 3BW3A 4RV3A 4I8YA 2ZC8A 4C6KA 1YLVA 2G96A 3UZZA 1K4GA 1NH6A 3O6YX 2EHHA 1NOWA 4PMJA 5AC7A 5CPLA 1E1FA 4LB4A 1VYSX 1MMFA 2V68A 1WKEA 1XRTA 4N2YA 4ATWA 3EWYA 4O1AA 5HWJA 5JIPA 1NTHA 1DJGA 1R46A 1Z8AA 2OQLA 5C54A 4O8AA 3OQ8A 2J62A 3RF9A 5F2GA 3APGA 3WG6A 1W8SA 2PWEA 2BGNE 1RHCA 2WVVA 3L2MA 1M7XA 1RQHA 2QVHA 4URIA 4K68A 3WD2A 2ZA1A 4EK7A 1UKTA 2DW7A 1K8YA 3CTTA 3HMJG 1CB2A 1I6NA 3FYYA 3AI0A 3RLVA 2WBGA 3WMSA 1KC7A 4Y7EA 3BAIA 1CLVA 4O52A 1FFQA 3PAOA 3FKRA 4RPPA 1R47A 4JOMA 1POKA 2PFHA 1Q5MA 4ILSA 1Z44A 3CT7A 2OPJA 3FN9A 2FH6A 3EEZA 2BOEX 4ZTXA 4OKDA 2YLAA 2XVPA 1A47A 3TX9A 5LNWA 1C8QA 5E6YA 2ZXAA 5MF5A 4NVTA 2GVGA 1GVYA 4TXEA 5HNRA 3LPOA 3QKZA 4JTSA 4PMVA 2VC5A 3BG9A 2CLHA 2JK2A 2WZIA 2Z2BA 3PWIA 1O66A 2BX7A 1WZKA 3UP8A 1WBHA 4JPGA 1K4HA 4JY9A 4AC1X 2O9PA 3AISA 2OJPA 3AIQA 3W3OA 3WH9A 4ZOEA 3VOFA 2QDEA 1LQAA 1M41A 2TODA 5HINA 5A3HA 3I4KA 3ES7A 4Q8VA 1KFWA 1J0IA 3PN8A 1PVNA 1RD5A 3NPWA 2E68A 4XD3A 1U2YA 4UCGA 5DY3A 1PWLA 3W02A 3AU2A 4V1YA 1E72M 3B4UA 3R89A 4F0KA 4ICCX 3N4AA 2I9EA 3W0KA 3BG5A 3DUGA 2R1PA 3FJLA 5HJYA 1ZBKA 1ZHAA 5G1MA 2BLEA 2FGZA 4Q4KA 1CZ1A 4P8XA 3ABZA 3CHDA 4LF1A 4B9ZA 1GYLA 1XLFA 2XISA 4WSJA 5G2IA 4HOWA 3AYRA 1Q6CA 4AEFA 2XGIA 1J0YA 2C16A 1XKJA 4C5YA 1EOMA 4E8CA 3SADA 4RL3A 3BL3A 2O4MA 4HK6A 3NPXA 3ARQA 1OK6A 3OJGA 3W07A 2YDRA 1G67A 2C3ZA 3UGRA 3TOPA 3CO4A 1KM6A 3A64A 4GK8A 2VFEA 1NWSA 2GYIA 2YB1A 3SCWA 3GH4A 3O05A 1TRDA 1XICA 1C92A 3LPFA 4US5D 4JDBA 2YXGA 2E8YA 2ISSA 2PUZA 1F8IA 4PMOA 3DAQA 3E96A 4AUBA 4HMCA 4PULA 1E6PA 4DJEC 3MUXA 1XLAA 1XH2A 1UMLA 1LRNA 1VIZA 1S46A 1SW3A 2QCNA 2MUCA 2VD8A 2HS6A 3ABOA 3L2LA 3UJ2A 4IMAA 4LUSA 1X38A 1EWDA 4JS3A 1Q66A 3HPSA 4UQAA 3DECA 5E0KA 4ZFMA 4PTMA 3FIGA 4XIMA 1UD4A 2X2GA 3ELFA 2Y7FA 4HPGA 4GI9A 4WJXA 5E6ZA 2JIWA 3GHUA 2HMCA 4ORMA 1J9YA 4LEQA 1PWMA 2D0GA 3E5BA 2C0HA 3MW7A 1UD5A 4WKFA 4AY7A 1PKMA 4TQTA 1RLCL 4BWLC 3SQLA 1KR0A 3QR0A 1NARA 4BQ4A 4B3ZA 4QTGA 3VNDA 3LMYA 1YHTA 1JDEA 3LHVA 4ES4A 3TEVA 5CSUA 3LUTA 3B06A 4DF0A 4XO7A 3G24A 2VGBA 2X0YA 4FZIA 2GOKA 4Z08A 1PZ3A 3D0CA 1PBGA 2YX0A 1WB0A 1NOFA 2VUYA 4ZO7A 1W31A 4NXKA 4XK2A 5DMYA 3TTQA 1OGSA 4DYJA 2ISVA 1R2TA 1TPWA 1FBAA 2WJEA 3AHXA 3H21A 4HHPA 4FAMA 1WXJA 1W5PA 3AROA 3LPPA 4ZA0A 1Q6DA 1WXYA 3RHGA 1E51A 1Q6QA 4GUJA 4H8UA 3QH2A 4XSLA 3DCPA 2GSJA 2ZZ7A 3DXIA 1BWVA 1VPXA 1J18A 3R79A 1D3HA 2Z7GA 2IPGA 5CGQA 4JIHA 4IICA 2HVNA 1FKWA 1UC4A 1W37A 2NSOA 5T91A 4AZ6A 4DJEA 3G1XA 4Q8MA 3A4WA 5I3IA 1KXTA 3ABXA 3MDUA 1BG4A 1I2PA 3B8DA 1GZJA 3R1ZA 1TV4A 1W1YA 4JTDA 1ECQA 3M0JA 1HJSA 4ACZA 1TUXA 2INFA 1WV2A 3QKEA 1AJZA 2VRQA 1G1YA 1HZYA 4WZHA 1IIGA 1ZJIA 3OA3A 5G5IA 2HCVA 3AS1A 3GB6A 3TSBA 3PJWA 4GGHA 4BWLA 1PL9A 3D3AA 3DG6A 3G5EA 4BFAA 4K1WA 1L9WA 1SJCA 4FNQA 3CV6A 1GTHA 1TE6A 4FNUA 4FXSA 3R0KA 3VNIA 4YXGA 4A3HA 3I68A 1V0KA 3NM1A 1J0JA 7ENLA 4TTGA 3VFCA 5M17A 1KCKA 4LUTA 3TN5A 3WBEA 3P82A 4WOQA 1ITUA 4NAFB 4MWAA 3TR9A 2CLKA 2C79A 1UKSA 4QAIA 4DHGA 4FNTA 3QQ0A 4YL2A 3R5EA 2E5DA 4TVCA 2NUWA 4C60A 2IKGA 1SM9A 1D9EA 2X2YA 4JR5A 1R3WA 1XBYA 3EA2A 1SR9A 2P3ZA 4U5KA 3G3MA 5AHMA 1H49A 3PSVA 2DSWA 2P76A 2NVCA 2O9OA 2W5FA 3IUIA 3O8AA 3LCFA 2ZA2A 3GHRA 1B9BA 4ECLA 1PE1A 1OYCA 3HM7A 5JXQA 1HKWA 1OIMA 4HTYA 1WCGA 4YIWA 1GCYA 3OOQA 2QJJA 4HYRA 5REQB 4Z2GA 3B03A 2AAAA 4LX4A 4PEKA 3VINA 3AOFA 4E6MA 4CNSA 1UD2A 1TJ0A 5D32A 2XGZA 1Q7ZA 2OU4A 3PPCA 3TYEA 4F0RA 4Y9PA 1XC4A 1UQYA 1H1YA 5F2LA 5A2BA 3GG1A 1QCWA 3GBEA 1BWLA 2NXHA 2XGBA 1KB3A 2OQHA 4HZ7A 2FFIA 4CN1A 5LA0A 3IS4A 4IHCA 1YXDA 4CNNA 3AHTA 3W26A 3WBYA 1Q6FA 3KHJA 3ITLA 1ZALA 4GVGA 4JQ1A 3S5YA 4DAFA 2OB3A 5ECUA 1IF2A 3CMJA 4H2HA 3MKVA 5D4YA 3OIHA 2B81A 4DUWA 4JX6A 3GZAA 4NZFA 4N42A 4NRSA 3GC4A 4K7YA 3VC6A 4LAUA 3CMFA 4CN6A 2CHNA 4YVPA 4JL2A 4GX8A 4WHBA 2J9YA 5HR7A 3W81A 5J8LA 3UWZA 4D6EA 2XUCA 3KVJA 5MHBA 1F2JA 3A13A 3MVIA 4M6QA 4QE1A 4JEJA 1OHLA 4F79A 4BQ5A 3AFBA 5L9FA 2Y85A 4E4UA 3K4WA 1UCWA 5AKQA 3U2CA 1AZ1A 1SSGA 3O06A 2B7PA 4OUEA 2Y7DA 1JCJA 1DWFM 4AF0B 2BHYA 2WCGA 4PCNA 3UXLA 4LAOA 1OCNA 3Q67A 1QPKA 3NIYA 4LRTA 1A3HA 1XYFA 4D2JA 1JZ6A 3EDDA 1NF7A 1T40A 1Q8JA 3LLXA 4JN7A 4UFKA 4LUIA 3STGA 2Z26A 3W7PA 3TYDA 3K13A 2D3LA 3MMTA 4YVVA 3JW7A 4JFSA 3LSCA 3QLLA 1E9LA 1OFDA 3IJLA 3KX6A 2J25A 3N2TA 3SCQA 3D6NA 4KT2A 3BQ5A 1BHGA 1M03A 2GGGA 5GJPA 1O6IA 3E74A 3SAZA 4GI4A 2INEA 3W87A 5FIPA 1KRAC 4XBJA 4M6UA 5H8UA 4MJZA 3ID7A 8TIMA 4JNMA 3CTLA 3DKLA 1QWKA 1EGVA 3G3DA 3UA4A 4X3ZA 1TA3B 1ZTVA 3L0GA 3DBNA 2WPGA 1JYXA 1NDZA 3MV11 1QJWA 3BCDA 4OWGA 3HQPA 3I3EA 3A3HA 2E7FA 3IK2A 1QI5A 3B8IA 5I09A 4UQDA 3LBCA 8A3HA 5CGMA 3J7HA 1UR4A 4JTLA 3WF2A 3O15A 1JF5A 3VDHA 1HL9A 4A8RA 3URQA 3ATYA 3H2NA 3ZFHA 3W25A 1TV5A 5C2GA 2GUUA 2PU0A 3AIWA 3M0VA 3DYOA 2XWDA 1TPC1 3PAJA 2VZVA 3UA3A 2R6OA 2GZXA 3OVPA 1ELSA 1KCZA 2D0FA 1F7BA 4IP7A 4IP4A 4MFDA 3HU7A 1PPIA 5E0FA 2DT1A 1YRRA 5J5DA 4KGLA 1MVYA 4B3KA 4QNEA 4EPKA 1H3GA 3G6MA 4QX4A 3SCUA 2VQTA 3R2GA 3IGHX 4U3AA 1PIFA 4O19A 4X0VA 2QPUA 1UIOA 3MI6A 4GI6A 2YCIX 5D30A 3QW3A 4IGHA 2YB4A 2QJGA 3C2RA 4MKNA 1MQQA 3P67A 4HNCA 3F4VA 3QOKA 3FKKA 5EFFA 1UMYA 3C4UA 2FJKA 4R9XA 4WLCA 5C0QA 1Q6GA 2XVGA 2ISFA 1QI4A 1LQ2A 3N3MA 1FWJC 2PGWA 3VKAA 4FIRA 3JZEA 4EF9A 4L4LA 4DLMA 4UQCA 3T0CA 4MZ1A 1AH0A 4FP1A 2NSXA 2E40A 2DZAA 3SJNA 1OK4A 8XIAA 3BGJA 4K38A 4NIRA 3BICA 3V0SA 1BYBA 3DGBA 4IMEA 5C9WA 1XIMA 1GKQA 1W3LA 4G1KA 3NCOA 3UPMA 2G3MA 3HG5A 3WQ4A 3ECQA 1U83A 3OEXA 4GUGA 1K7XA 4AX6A 1EJWC 1IR2A 8CGTA 1R9XA 1AQ0A 3DERA 4HGXA 1SW0A 3GU9A 1DWJM 2EKCA 1OZMA 3T05A 4WUIA 1LRTA 3CZGA 2C18A 3CLWA 1FTXA 1TV7A 2FGBA 1U5JA 2OELA 1BVWA 1F61A 1RH9A 4HCHA 4UC5A 3IVUA 1RPKA 1ZCCA 3RYSA 3BG3A 1JAKA 1WZMA 3BOLA 1TPEA 3CBWA 4GVHA 3K30A 3NO1A 2WXDM 1L0PA 4D9PA 3F4NA 3SR7A 1GOIA 2HPMA 4WX2A 2V81A 2GGJA 2VKZG 1TPVA 2BG5A 3QV8A 3WQGA 1ZPTA 3WDQA 3W7EA 3CQIA 3IIVA 4K3ZA 2ZRXA 3GU2A 2VC6A 4UIOA 3W38A 1J93A 4DWSC 2VQUA 2CC0A 4D6GA 1Y7VA 4WJ8A 2WB5A 4F9JA 1AVAA 1PB0A 1H7WA 4RDWA 3WDIA 4BHYA 5H8MA 2DZUA 4F0LA 2FPVA 3RG6A 1R3QA 5CZTA 4TIMA 1Q6OA 3O1NA 2NLIA 1V7YA 1KBLA 1BRLB 1DJNA 3GG0A 1TV2A 5AB3A 4IPLA 3OODA 4QDWA 2R1KA 2AMGA 1I2RA 1J11A 4IXHA 2I7GA 5CQ1A 5KETA 1RZMA 4AC7C 4GKLA 1MFVA 2VVSA 2DIKA 5SWUA 1JZ8A 4XZBA 1DBTA 3LHUA 3O7UA 4Q7BA 3ZIZA 3R4IA 2D2OA 1UIPA 2BGSA 1RJQA 1R2RA 1VGAA 4JTTA 1KD0A 1JZ3A 5AHIA 1JI1A 1FH8A 3MSGA 3LHZA 2WLYA 3D5HA 1IIHA 3HZ3A 1KFJA 1KM0A 1H4PA 2J7FA 3KL0A 3VDBA 1E6ZA 3MWAA 3OLDA 2FIQA 2NWRA 3KOZA 2PBGA 3A5VA 3QTPA 3CPRA 1BYAA 5CJ5A 1WZAA 2NQ9A 3B8VA 2A3HA 2WK2A 1YPFA 2I5QA 4CNUA 2OLAA 1CXHA 1OEPA 3LRLA 3SUTA 4Y9MA 3PTQA 1Y5VA 1VEPA 4GZ7A 4U2ZA 3W83A 3MZNA 1S2TA 2WOQA 4C7FA 5C2CA 2YA0A 1OFQA 5D2WA 3PR2A 2NV1A 4XAZA 4AX7A 3O2LA 4S2CA 2VEKA 4FXRA 1Q85A 3N29A 4DM2A 4GXWA 2ZZ4A 3BJSA 3W7DA 1ODZA 1KLZA 5T8GA 3TR2A 1KTCA 5C7VA 4BS0A 3OGRA 3AUOA 1GYMA 4ZQMA 3TAKA 2BY2A 3VM7A 2C91A 2V2DA 5CPTA 3NL6A 5E0CA 3UERA 4DWSA 4Q22A 2NV2A 1XCFA 1T96A 1JQVA 2CZFA 1XS2A 2E9MA 5TQLA 3MO7A 3MZ2A 2DPEA 4O8RA 5A6JA 3WJYA 1TV3A 4UFMA 4B2DA 4PL2A 4I6VA 3VGBA 4S3JA 6XIAA 2NQ5A 2G8ZA 4POCA 2C6QA 5E70A 3T08A 4L64A 2AOSA 2VRJA 4I5UA 4ZVJA 1WAUA 3TSDA 3CH9A 4M6PA 1GHSA 3ZOAA 3ZSSA 2EPKX 3IUHA 3PJUA 3WO8A 3W7QA 2W3ZA 2WMFA 3M5YA 4QG6A 4Z1AA 3HF3A 2XSBA 1V6UA 4KBXA 3L21A 3Q4DA 5A6BD 4JKMA 3GDLA 4ZENA 4V1XA 3VNKA 4UR9A 4LWWA 3CZEA 1GJPA 1OFBA 3TV8A 1O5RA 3RPTA 4W89A 2D1ZA 3QRHA 2YR1A 5GNXA 2J9XA 1Q8AA 4IGMA 1CPUA 2YDQA 4AH7A 3W1UA 1OFOA 1JZ4A 2PRLA 4Z2KA 5U7SA 2DV0A 4FLSA 3JUGA 4LVBA 3HQ1A 1WDRA 3FA4A 3N2CA 3WD0A 4NSBA 4D1JA 3ITGA 1R3YA 3MP3A 1L6YA 4R85A 2DVXA 2EEXA 5LA2A 3BAYA 4X60A 3AZTA 4MB3A 2TRSA 4HHHA 1P6BA 3MTWA 2QJHA 5IM51 1V3HA 3QHNA 1P1XA 4C90A 2P53A 4HB7A 2VENA 4I6KA 1XBZA 3K46A 5A6AA 2OXNA 4N6FA 4K1GA 1DE6A 1L6GA 1OC5A 3CL7A 2DH3A 1OM0A 3STPA 4Q4MA 5XIMA 4AEEA 1GHRA 1GVQA 1F07A 3AIRA 3MCOA 2Z0IA 4AAJA 6TIMA 2A5HA 4JIQA 1XW8A 3RCMA 2P88A 1R8LA 4YNGA 1HNYA 5E9XA 3NSNA 3OG3A 2WYSA 4GUIA 3IJ6A 4DPQA 3M4HA 9RUBA 2WMJA 5BWFA 2BSLA 2ZRZA 4O18A 4ZBCA 1ZNNA 2IKHA 2PMQA 1IT8A 4PMYA 4ZQNA 3KCOA 1XX1A 4IISA 3MBDA 5ABFA 4UCFA 3RGTA 2IQTA 4EXAA 3KVMA 6CGTA 1TSIA 4QLKA 3H26A 1WA3A 2AQOA 3LNMA 4UOQA 3AZSA 1CXIA 4UFHA 1XL9A 2HQAA 4WKHA 2W9MA 4IL0A 3FEQA 3G1VA 2QW5A 4HU4A 5FA5A 1CGUA 3W24A 4DBEA 4HZ8A 3S83A 3NZPA 2E9LA 4S3DA 1VCVA 3W7MA 4RW3A 2GJNA 1FUYA 4MNKA 3FGCA 5A6KA 3UQNA 3PG9A 1MW3A 2CHRA 2FH8A 1JPIA 2OWWA 1R86A 2BASA 2CU0A 3PANA 4LVAA 1ME8A 3DN5A 3UJFA 4RDZA 2NX9A 3AC0A 1KGWA 2DQXA 1W91A 2NXIA 2QJIA 2V6AA 1EDQA 3H4WA 5D04C 2X42A 1P0NA 3C86A 4PFMA 3E12A 2DY3A 5FAGA 4PR4A 5LNRA 4MAVA 4IIDA 1OC6A 4QSHA 4MB5A 1ZBVA 3NUKA 3EA3A 4W9TA 3ARYA 5CZKA 3H70A 4H4IA 1ISXA 2IKJA 1AMYA 3DGRA 3GTNA 5C7HA 4C6BA 5CPSA 4LB3A 2YGYA 1EEXA 1LUCA 4GIRA 2E6AA 1IHIA 5LHEA 3BPWA 1XPYA 1IGWA 4LU0A 3KVLA 2PWDA 3UVIA 2QAPA 2QCFA 5AYXA 3RAOA 1AQMA 2POZA 1Y5XA 1J10A 3UCQA 3S5SA 1YBQB 1LM1A 3CEPA 3U7BA 1PS9A 2R82A 1JCMP 3QVQA 4PODA 2QIIA 4S3KA 2R14A 4LVFA 2KAUC 4MTVA 4FSAA 3URNA 3POHA 3GRIA 2IXUA 2JQXA 1XSJA 3M0LA 4DVOA 2EAWA 4OOUA 4CCCA 5I03A 2WVVB 3M0ZA 3AAMA 3QSRA 3VGGA 5A2CA 4GQ0A 3E1F1 5HPCA 3GIQA 1IXPA 3HGOA 1QHOA 4JBRA 4UR8A 3RLHA 5I3HA 3KL3A 2GJRA 2NX1A 4DRSA 1EO7A 4J1OA 4YTRA 3G6LA 5F2MA 5BMXA 4TOQA 2Y88A 4M7TA 1MUWA 1TO3A 4HYWA 4AW7A 2EG7A 4R7JA 1K6WA 4D6HA 1HP5A 3WJZA 4D8LA 3KL5A 3WENA 2ON3A 4GACA 2ZUUA 2B31A 2W67A 2PGFA 2QPXA 3GY1A 2ZWZA 3ZT5A 4Q8OA 3P0XA 5HMSA 1D2KA 4Q8WA 3EXSA 3CC1A 1ECEA 4UNIA 2XN2A 3LTPA 2PF8A 3WMCA 2PDPA 3RRXA 4OE7A 2WSKA 2Z1VA 4O15A 4PB3A 1V6XA 1US0A 2VTFA 2QJMA 2XSXA 2TSYA 2D69A 3LRKA 3ITYA 1C93A 4F66A 1CXEA 2WMIA 2ZTKA 2XFWA 1CT5A 1UHVA 1TWZA 1FP9A 3MMDA 3I6TA 1EEPA 3HB9A 2YCLA 3EPOA 5CBIA 1A5MC 5C55A 1DWHM 1KA9F 1B3VA 1P43A 3QMSA 1RJPA 3VO0A 4B15A 5FSEC 5AYZA 1I1WA 2HNHA 2Y8KA 3QPYA 1CB7B 1NDYA 1F6PA 4W87A 2NWSA 1TWSA 3L5AA 1WBJA 3I6EA 3WH7A 3LS9A 2XINA 4MY1A 4O50A 3CUZA 3CO8A 4UTFA 4WY0B 1S3TC 3VMOA 2GUBA 3R10A 1TPDA 5DBTA 4HT3A 2ICSA 2W61A 1SUXA 2UY4A 4GLEA 1HG3A 2WM1A 4RLIA 2ZA3A 1PXGA 5EBAA 3QR1A 4GC4A 3V75A 1FKXA 3T0DA 1QHZA 1B57A 4KWVA 2YXXA 4F40A 3VIPA 6TAAA 1TELA 4GOAA 3CHCA 2XH4A 2TAAA 5I6SA 3LEPA 1P0DA 3VDGA 1GOOA 2OEJA 3WL1A 1KBBA 1UYQA 5H2ZA 1OBAA 1IT0A 1OG6A 2IMRA 1VR6A 4R9OA 1GVOA 1XUZA 2AMXA 3VK5A 3FSUA 4M19A 3ICJA 3SUVA 1XLBA 1VFUA 3W9ZA 1WDDA 4W5UA 4OIFA 2GJXA 3ZT6A 3UG5A 1L2UA 5JH1A 3EKZA 4J5NA 4H7VA 1XD0A 1V3LA 3AS0A 4CNOA 1TWIA 4S38A 4QEHA 1QTWA 3W00A 2YA1A 4IGSA 3ZYZA 3RPMA 3NQ8A 1L8PA 3CASA 5H91A 1OINA 1ZCOA 3LLDA 3WF3A 2BXVA 2EGZA 2OO6A 1HKIA 1XXXA 4JYDA 3R13A 3STFA 2ZVIA 1GPFA 1NQKA 3H2CA 4J7RA 1GWJA 2X1UA 3KOYA 2GL5A 1EB3A 3GDRA 4E3VA 1KFEA 2BY1A 3AHYA 3FHAA 9XIMA 4XZWA 3WUGA 2J6XA 3CPGA 5EL1A 4JZ5A 3E2QA 3VE9A 3UWVA 3G0XA 1CGVA 1RA0A 5CBJA 4WXYA 4XX6A 3EDEA 2A0NA 3VXGA 4UOJA 2I17A 3N25A 4EP8C 2QV5A 7ODCA 2RFGA 4I9AA 4OV4A 2QV4A 3IVSA 4Y90A 2ABBA 1UR8A 3R43A 1S5MA 1AG1O 3WLQA 1XWYA 2BHUA 4NNCA 3EX1A 4F0HA 3GW0A 1PYMA 2HE8A 1W9UA 3TLLA 2QUTA 3K8MA 3N2XA 3WK3A 5LNUA 2J47A 2PGRA 1UR2A 1OWQA 4KCVA 1WOBA 2YJQA 1CYGA 1ICSA 1Z69A 3IJ8A 1KQYA 1HVQA 3QOMA 4REQB 4HSNA 3R8RA 5AVNA 4MVAA 3EB2A 3DFHA 3PY2A 1W5OA 1EPXA 1F3EA 4MHBA 5HQLA 3QSTA 3C5QA 3VDCA 3IGSA 1KGUA 4HPHA 4PBGA 4PUDA 3QC0A 1W9BM 3FXGA 4FX7A 1CX9A 3OA5A 2NX3A 3TVAA 4S3AA 4RZ5A 1EJ7L 3H4GA 3HPFA 1PCKA 3ITVA 1SO4A 4OBSA 1AFSA 3WZ0E 3WLSA 4YHGA 1FHLA 3ALGA 3N2BA 2FPYA 3T09A 4PMRA 3E0LA 3TYAA 3BAXA 1AA1B 5D2TA 5LIXX 1YDNA 3VCCA 1T99A 5HMEA 5CZJA 3PB2A 1XG4A 4US6A 4ACZB 2WMGA 2H8ZA 5MKGA 4Z17A 1RY8A 1SJBA 1OX5A 3DKJA 1B30A 3N6HA 2CWNA 3R8GA 4IOTA 1RV8A 1XLEA 3A4XA 2QCHA 3KVKA 3WQOA 3VOIA 4YWSA 2WC7A 4IM4A 3ZR4A 3WLTA 1TCMA 4GCAA 4H6QA 3M5XA 3NZ1A 4C6CA 3HGSA 2Q3OA 4M81A 3PP7A 4IP5A 4HOZA 1V0NA 5A95A 4R33A 2OO0A 4TV6A 4UBPC 4PC8A 3B9DA 2VC9A 3N2MA 1XH1A 4PA8A 1OFPA 2VMFA 5EMUA 3T6CA 1TG7A 2XH0A 2X0SA 1GKPA 2JF7A 4MWAB 3C8FA 1HFBA 3BLPX 4M6VA 2R1NA 1N8FA 4B90A 2QUUA 2DW6A 2NXGA 4I8DA 1LTDA 2DSZA 4JKLA 3TJ4A 5D8WA 2XIIA 5I06A 4Y9NA 3AXMA 5CLWA 3FHQA 4PEEA 4GXPA 1UR1A 3BOXA 1MDLA 4BCEA 3IARA 3UCCA 2QGYA 3CLMA 2Q8LA 3FV9A 4JFWA 4W86A 1ITCA 2VEMA 3K8LA 3O6DA 1HVXA 5C2XA 4FX6M 2ONEA 2YFNA 3LNPA 5L6UA 4IXXA 1EZ2A 4HSOA 4S3GA 4GI8A 5A8OA 1FWDC 2D20A 2FDSA 3GNNA 3LB0A 4PMQA 3VYLA 4P5UA 4AFYA 2VZSA 4JIIX 2PLCA 4KPLA 2OCZA 3RDKA 3SQMA 3R58A 5HUOA 4AZBA 1A3WA 1OC7A 3WD4A 4OT7A 1PIGA 4OBTA 3WLRA 4PYSA 3CPUA 2X1TA 1TR1A 1ZZMA 1D3GA 4OGZA 1X1NA 3OZPA 3Q2DA 4E0CA 3GR8A 1UPPA 3GR4A 1XBXA 5AOUA 5DX7A 4ML4A 1GVEA 4S1FA 4NI3A 4FI4A 3VNYA 3UWQA 1BXBA 1W2PA 5BXTA 5GJNA 2OYLA 1HO1A 4EPBC 4RX0A 2X16A 1ZAIA 4DBUA 4M51A 3O0KA 2AKMA 3SRHA 5BRQA 1XM3A 2FZBA 4PL1A 4DX3A 4QIUA 1MNZA 2WKGA 1R3RA 4GPNA 4N4QA 3C2VA 3PWAA 4NAFA 3W27A 2OZ0A 3T2OA 2CIPA 4B92A 5LYRA 1ZUAX 4FLRA 4AHQA 1H63A 2CZDA 2V2CA 1JPKA 3T0BA 3R11A 4F9DA 1QNQA 1IEXA 1TJRA 3LG3A 1MW1A 1KXHA 4O10A 4AMAA 1IXOA 4O17A 4UQBA 4NP7A 2DZSA 2E09A 1REQB 1JXKA 9CGTA 2ZC1A 2F38A 1E15A 4NKCA 5A2AA 3KS5A 3UW6A 1W3KA 4CVUA 3GKAA 2EPOA 3NO3A 2VFIA 3NZGA 4MWAD 4Q7IA 4K8GA 1WDSA 3WD3A 3SIZA 2CLOA 3JRKA 5REQA 1BQGA 4U28A 5FJOA 1JEZA 2Y8UA 5FD0A 2E6DA 4K6AA 2GWGA 3M0HA 3SCPA 4KWUA 4DQWA 1N55A 3BGAA 3RJXA 1GOKA 1A5AA 4M80A 2CNCA 3H22A 2JGYA 4L6DA 4GGBA 3V0TA 5K4XA 4AY8A 2BXYA 1W9VA 4XTIA 3W84A 4QROA 3GFYA 3DOPA 2J27A 1KFLA 5IHSA 3NSMA 4ADSA 5A8QA 3S2CA 4L61A 4RE0A 3GO2A 3MP4A 3BLDA 1C7TA 2QMJA 1W5MA 3BK0A 2CLLA 3TTEA 3RO8A 3TYZA 4DO4A 3TA9A 1VYRA 4AEOA 4Z1CA 3R8HA 3ISIX 1XLHA 3MSDA 1GEHA 1QPQA 1GORA 4NL1A 3V16A 2D22A 3H23A 3NQ7A 1XC6A 3AUJA 5F2IA 4B5TA 3AHZA 4BR1A 2V5JA 2J79A 4L6HA 2RGMA 1EYEA 2D24A 1XHGA 2QCDB 1XI3A 2J66A 4HU8A 5CG0A 2YIHA 3N6JA 2HNEA 2VCAA 1N82A 3CH0A 1GPWA 1RQBA 3C0SA 5FF3A 3M0KA 4GVFA 4DO7A 1XR2A 3RK8A 4GKTA 4WF7A 1XP3A 3MUCA 4AF0A 2ATMA 2F2KA 4QP0A 1E1CB 5GQBA 4Q8TA 1OF8A 4E2BA 4FOUA 3E0VA 1A5LC 3O63A 1P7TB 1FWHC 4YCOA 3CZJA 3NDZA 5HANA 4DBWA 4WOZA 2WSYA 1JI2A 4JEQA 3SUSA 5JIWA 3U3HA 3WLNA 3QYSA 5D2XA 3WQ6A 5M03A 3G1SA 3DFNA 2PWUA 2BVYA 3APYA 2QAFA 4AXNA 5CC3A 3PTDA 1LLZA 1RCXB 4A2SA 1RK6A 4D71A 3MJYA 3IIOA 3S1VA 4G1NA 2F84A 2NQLA 2CKRA 2E0PA 1X6LA 2C71A 3VOHA 5AZ1A 3PTKA 1DIDA 3T55A 3OPSA 3P80A 4WXZA 4X63A 4W7WA 2X30A 4O57A 1TA3A 1RQEA 3CWHA 3LTSA 2H8XA 3EOSA 4ONVA 5DANA 3GAKA 4JYEA 2L5HA 1EA0A 3IPWA 2ESCA 4J40A 4GNJA 1XSKA 3QPEA 3WX7A 5CC6A 1JYVA 1UKPA 5EA9A 4DZAA 5C8BB 1MWOA 4AWSA 3NR0A 1K8XA 2JFEX 4Z2IA 4DXXA 5A1AA 3L4TA 5EB8A 2J13A 1W9XA 2ZUVA 2FVLA 2BXZA 5F4SA 4DO6A 2ISDA 3QV6A 1CXKA 4TU1A 1RCQA 1JUKA 3MU7A 4A05A 3GM8A 1GOQA 1YXYA 4D6IA 1ZP4A 4RKAA 4W7VA 3K4AA 5DEZA 2EKGA 4QNWA 1RLDA 3PZGA 1RD6A 3NDOA 3NGFA 2J7EA 4S23A 3F7JA 3SCNA 3VIMA 3LCGA 3TN6A 5D9OA 1YQ2A 2B4GA 2WKLA 4AYSA 3PUDA 4YPJA 3WL0A 1OIFA 2WC4A 1E5JA 3TSMA 4C6IA 1VS1A 4PBEA 3TTSA 3FXYA 3VGEA 2OR2A 1O1ZA 5BCAA 3TFXA 5IRPA 3LGEA 2P3EA 3LCXA 1QPRA 1VIWA 3LU2A 4DF2A 1BGGA 3KBJA 3E49A 5IOBA 1XIEA 4S3EA 1EA9C 2PDHA 5M1TA 2OEMA 4H9UA 3SIMA 1IXQA 3AXXA 4S2BA 4PB5A 1JD9A 4LYQA 1TJ1A 1EKOA 1KXQA 1S3HA 4U5IA 3LZ3A 1HF6A 3COTA 3LBOA 1LBLA 5HMFA 3GXIA 2AQVA 4YVXA 1FWTA 3VOCA 1OQFA 4HMEA 1QI0A 1KBKA 3S3GA 1LT8A 3KOXA 3P6LA 3W6MA 3KP0A 1JZ7A 2QUNA 2BMBA 4U33A 2ISWA 1JZ5A 1YPIA 2HZGA 4WQ6A 1QMLA 3URBA 4GJIA 1O7AA 2PCQA 3LENA 3HV8A 4UNKA 4W8AA 3WNPA 2YL6A 4HJFA 3PUEA 3AMGA 2ZX8A 4JDYA 2EBNA 1TKKA 1EP3A 1T8QA 2HVMA 4WDUA 4R88A 4WDWA 1IWBA 1WQ5A 4NZ5A 3EDJA 4MWAE 1WP6A 4I90A 2A21A 4K36A 3IK4A 1VFFA 4JTKA 4ADUA 3TFCA 1LOSA 4X2PA 2W91A 3L4ZA 4NX0A 3V7PA 1VBJA 2V3EA 4CQCA 2PPGA 1W1IE 3I7QA 3STEA 5I23A 3OBEA 3W7OA 2FPTA 3VZZA 3HPZA 3BSHA 2CBJA 3TC7A 3JU2A 1T41A 1EF3A 2NQHA 4WVXA 4N6EA 1PSCA 2OODA 4MNJA 1U1JA 3ZR6A 4R7WA 3RMJA 1VHCA 3BLEA 1IEVA 3G1YA 5CXPA 4K37A 3CAVA 1B2YA 3C3NA 3RITA 2ZX9A 3SY8A 2E9BA 4J2PA 4C6DA 3MSRA 2WNNA 4HQVA 2FHFA 4C5ZA 4NY2A 4BY3A 2I56A 4KCTA 1E71M 2DZXA 3SFWA 3N9RA 4EAYA 2A7NA 1U33A 3VZXA 2H6RA 3ZWTA 2V3FA 2XU2A 3WF1A 4J27A 2HJPA 1RCOB 5AHFA 1YTKA 3GX9A 3FDKA 4EAMA 1UC5A 5C9RA 3KFTA 1MRAA 1MW0A 4NYYA 1GK8A 2Y6ZA 5CGTA 2H9AA 4MB4A 3CQHA 1E6QM 4WCJA 4PTWA 4LBSA 4PE8A 2PSNA 3G77A 1JF6A 2GLKA 2FQIA 2EQDA 1B90A 4ZMGA 3ZVHA 4OFCA 2XPKA 1I8JA 1DHKA 4ERGA 1YW1A 1KO0A 4LFYA 3O07A 4JTCA 1MUCA 2IKIA 5CZ0A 4IWWA 3DFYA 4YYFA 1VFTA 1UZ1A 4INFA 4N9EA 4AVOA 2A3AA 1AQHA 3MY9A 3GS6A 4IG2B 2TMDA 3SQSA 2ZDSA 3P3BA 4QG8A 4GIYA 3W1MA 5ABFB 3HIJA 4H9ZA 1NJJA 4AWUA 2VGFA 3UEQA 2PRMA 1GQKA 2C8NA 3E2VA 3BANA 5A5WA 5C9ZA 2KZHA 3W86A 4OUIA 3H2OA 3UXIA 1O95A 3GKFA 4ALDA 1DP0A 4H8HA 4E4FA 3UG8A 1ISWA 2PODA 1GKRA 4TUFA 3P62A 3BLKA 1YX1A 3FGCB 1EIXA 1BSIA 4E38A 1DEDA 2VEPA 1XLCA 2DH2A 5DN1A 4IPNB 4MKVA 4JHZA 4QDPA 1MO0A 2V2HA 2Z6JA 1KRCC 1POJA 1SVDA 4B2DD 1I2QA 4RDVA 4DZHA 4B4HA 3H8AA 1H7XA 1UR3M 2QDDA 4BI5A 4LY4A 4P8UA 5G1TA 3USZA 3GZ3A 1J0ZA 1V7AA 1NEYA 4XBSA 1TIMA 3DDMA 3T2QA 1RAKA 2QCCA 5FEXA 4A3YA 4K39A 2PURA 1YEYA 4QISA 3D3FA 2VD9A 4A3QA 1KTNA 2DIEA 2CESA 3TE9A 2OEKA 2QHAA 4G7EA 4UUIA 4JYFA 3UZ5A 3HBLA 1MW2A 3DBPA 2VGGA 1ZJBA 1OFEA 4LY8A 1HGWA 1K9DA 1PEZA 2QQ6A 4A6GA 5BXPA 5I2UA 1C90A 1US3A 1B9ZA 1ENUA 4PFHA 3VVGA 3LMZA 1DKWA 4DM1A 4UTUA 3CGTA 4PZVA 3GTIA 4Q4QA 4XG1A 3U5UA 1J8VA 2JKEA 2NZLA 2DZWA 5FJIA 4MPKA 5CSYA 3SBFA 4N9BA 1KV8A 3VGDA 3H54A 3W1PA 3VIKA 1V6YA 1X6NA 2HRWA 3HJEA 4L56A 5AN7A 1X7FA 1GG0A 3BH4A 1J01A 4QJ4B 4O4WA 4QE4A 5KZMA 3PULA 3FLUA 3L0NA 1M65A 4JTRA 3AMCA 1K7EA 2XSAA 1BEUA 3B40A 1IEIA 2P0IA 2CLEA 2F7FA 4HA0A 3ARSA 1EYWA 2HVOA 3GLCA 4DI8A 2ZZ6A 2OZ3A 2MANA 3RLGA 4OECA 1TVLA 4LS2A 4ZOCA 1Q4WA 1ZBWA 2GK1B 1XRFA 3GNPA 3RM4A 4LF2A 2B7QA 3TOYA 1VPYA 3GNDA 1HQTA 5EMMA 4UTHA 4MUPA 2XFYA 3E2SA 3WUEA 1E6XM 4RE3A 4FIQA 2E67A 4IFOA 2PD5A 3M0MA 2BFGA 1SFTA 4M29A 2OMAA 3WJSA 1TMHA 1NDVA 3KS6A 4HYVA 1TX2A 4PCFA 4OOZA 1XF0A 5IFTA 3AWOA 1EHNA 1QK2A 4IQEA 3F1QA 3AYVA 5D09A 1IQ8A 4IPIA 2FYMA 1XPGA 4W93A 3ITTA 5K9XA 3IRDA 5BU6A 3B97A 2V5KA 5CJMA 3WDHA 4KWWA 1SMAA 2ABAA 5AHLA 4G8TA 1HGYA 1US2A 2VO5A 1GW9A 3LHYA 4MJ4A 1K6AA 4GYFA 2FTWA 4JTJA 3WDRA 2P8CA 1ZU8A 2P50A 4GNKB 1KFKA 4WSKA 3NQAA 4UFIA 3T40A 4LOCA 2EG6A 3BOFA 1YBQA 1W5QA 3IJ7A 3RUBL 1WDPA 2C1HA 4NNBA 3U48A 1AD4A 3II1A 4IF2A 3WH6A 4KEZA 1AW2A 1X8FA 4DBSA 4YU1A 1JCXA 2JBMA 3HJZA 2DT2A 1XRSA 5BU9A 3I65A 5KZ6A 1DXFA 4HTBA 4F0MA 1I2OA 2O0TA 1GYNA 3SI9A 1UZHA 4GYKA 3KUMA 1BFNA 1WKFA 3D46A 1XYMA 3M0YA 5T9CE 2A7RA 2ASHA 2VOMA 3BVJA 5AZ0A 1OYBA 2UZ9A 1SZEA 1FHDA 1O4UA 4U10A 3UPWA 3GFZA 2WWDA 3AJXA 4RNHA 2ZE3A 4XAYA 2P5NA 4EPEC 2PC8A 5DCDA 1AUSL 3LM3A 8RUCA 4ZZ9A 1CGXA 3LCHA 1XGEA 1XIJA 1AODA 2VNCA 3B8WA 4R3UA 1JDFA 1MEIA 2ZXBA 3LV6A 3CL6A 4QCFA 1OVDA 3L0KA 2XN1A 3TJIA 2PZNA 3AXKA 2ACSA 1YKWA 3PF3A 3L2IA 2EG8A 2AAMA 4UMBA 4AHPA 3BZJA 2GOUA 3QZ6A 4M7SA 3BLOA 3FSTA 4D8AA 4DPPA 1JD7A 2GJXB 1E9YB 1UBSA 1UOKA 4ERAA 3KZPA 1TB3A 4C6OA 2W27A 3VX0A 1U30A 3W1NA 1RA5A 2WMHA 4W5ZA 3HQOA 1M5WA 1PZ0A 2EPLX 1JCTA 4YS1A 2NQJA 4MNMA 5FJUA 5CKSA 2DJXA 5HOSA 2PA6A 2OZTA 2HE5A 4NASA 3F4CA 1TX0A 4IMGA 2ZUWA 3G22A 3C56A 3S6OA 3VNZA 3DEQA 4GY7A 2Y8VA 3WK0A 3VIHA 1WE5A 2Y1HA 2R24A 4O14A 1Y0EA 4LCSA 4WY0F 1JRBA 2EPNA 2PLJA 1UP0A 5CJNA 4JTFA 1D7FA 4MMWA 4DN1A 3UYCA 3BWWA 3LI0A 3EKGA 3G1RA 5LXEA 1QO5A 3BGGA 4JX4A 2BVWA 1H60A 3FW6A 1LOLA 3XIMA 4QXIA 1PX4A 1M6JA 2Z2UA 3TNOA 1E73M 3EOLA 1F05A 1EQPA 4WY0A 1BYDA 5HK4A 3N11A 1GOXA 4MADA 4XIAA 2WKJA 3W29A 2CBIA 4LGXA 3PNZA 1PKNA 3W6LA 1H0GA 5J04A 2VWTA 1VBGA 4J3TA 2WSPA 2DZTA 4EE9A 3IGXA 2VDHA 5IFPA 1RALA 4V28A 2OWXA 4NZ3A 3B04A 3VDAA 5DFAA 5EMJA 4RJEA 3SFKA 3KBNA 5BOOA 4JIRA 1QI2A 4JGDA 3NL5A 1VENA 5BW6A 3AICA 4JFVA 2QVNA 2BY3A 1G9HA 2PTZA 5K4ZA 3NQDA 4LH8A 3G2GA 2XZ9A 3QQ1A 4PBFA 4DNHA 2PBOA 7XIMA 3DESA 3PFRA 1QO2A 3WLMA 2Y2WA 1I2NA 1FWNA 3TC3A 4B3LA 3EOEA 3UY8A 2QNEA 1GOWA 4QEEA 3RILA 2JF6A 1VD6A 1TPUA 1JYNA 3S8HA 3MANA 4KQNA 5A6TC 2XIJA 3S5ZA 1KW1A 3EA1A 3CZLA 3W2NA 1VEMA 2VEGA 4A21A 5MKGB 3AQUA 4ZQRA 4RW5A 2Z00A 2J88A 4TMBA 4LV4A 1XQLA 4CGTA 3QLDA 4HA3A 1RK5A 4FNPA 4LC6A 1S2VA 3ORWA 4MSSA 2V3GA 3N14A 2XWEA 4P7RA 1GVFA 4DJDA 3ZVIA 4PCTA 2QT3A 4BQ2A 5JQ9A 4GUHA 4PGLA 3S42A 1TTIA 4FALA 5GNYA 1XV8A 2YLLA 4J4KA 1P6CA 2XTKA 1CECA 5KZEA 1H1ZA 3PBUA 2NT0A 1QFEA 2VELA 3K1GA 5I78A 1GVIA 4L65A 5LXXA 3A21A 3KTSA 3TNBA 2ODOA 5C9UA 2EF9A 4H6EA 4O16A 3PZUA 1G7UA 4HA1A 4HPJA 1KFBA 1M1BA 1P0EA 4UNLA 4NAEB 3EPMA 4ZSTA 1HX0A 1QI3A 4PUJA 2XZ7A 4A8LA 4F3HA 5CPOA 3W7CA 4O1EA 3NQFA 1BWKA 4HNLA 4MWAC 1TTPA 1V5XA 3FA3A 3NVTA 5A8PA 1XISA 3MP5A 7A3HA 2OLHA 3UWWA 3VX1A 2VR4A 1NFGA 4CNTA 1S2WA 4WDXA 4KCUA 2A79A 1G5AA 1FXQA 3E02A 4REQA 1H1NA 4LAZA 1ZAHA 5DXXA 4AZIA 3R12A 4E8DA 4LXFA 2DEPA 1VYPX 1VCGA 1I0BA 3QY6A 3L4WA 3IIXA 1JPMA 3THDA 3GU1A 1ME7A 1OSEA 4GE8A 3DYPA 2WQPA 5EMKA 3UWYA 4IUGA 3K2GA 3GQYA 4Y2WA 4MY9A 3S2JA 1ICQA 3GUWA 5LNSA 4M82A 2GJLA 1UOZA 2GGHA 1FWBC 1XG3A 4LUYA 1IR1A 4IPPA 3IJDA 3N15A 3N6QA 3EX3A 1YNQA 1YMYA 2RAGA 5HA7A 3SURA 5D38A 2WSQA 2HPIA 3WQDA 1BD0A 1OGBA 4M56A 4NQ1A 5BRPA 1PO9A 2CPUA 2HXUA 4TMCA 4C6LA 3CAKA 1SMDA 3GIYA 1O60A 3S6TA 4TX9A 4AHOA 5E93A 1R87A 1SO3A 4K2SA 2YDSA 4IZGA 2SFPA 1FDJA 3AZRA 3RO6A 3ERPA 4I9JA 4O4VA 1M7PA 4FLOA 3W75A 1XIFA 2PDQA 5FJPA 3CUGA 1V08A 3GHSA 2VC7A 1A53A 2PTWA 1K9TA 3FJ6A 2DQWA 5IBXC 5GPRA 1C91A 3QZAA 2DUZA 1S5TA 5CPMA 1DJZA 1TFVA 3LZ5A 1A5KC 4P2VA 3W1XA 1WDQA 1CXLA 3IGUA 2EO7A 2PTYA 2YXOA 3PPGA 4AWEA 4XWUA 3LD5A 3CB3A 1MEHA 1EPVA 1UWQA 1CBGA 3GG8A 3B3DA 3M64A 1G4TA 2G3FA 3WFLA 4Q3MA 5T26A 2FHCA 4HMDA 5GNZA 1R3VA 5A8MA 3WQ5A 1XIBA 1CXFA 4JFUA 3N17A 1S39A 6PTDA 1TQJA 1VFMA 4IMDA 2QDGA 3GD6A 1NP2A 1W3HA 4ZXOA 3WF4A 3OYZA 3GIPA 1T7LA 4W85A 1GVSA 3BV4A 2WLZA 4UTIA 2G95A 4FLQA 2FZNA 3VKCA 4UFJA 2YL8A 2C19A 3C6CA 5LKYA 3BARA 3GBDA 1S2UA 2WHKA 3U9IA 1A5NC 3BUVA 3QGKC 5TF0A 3FYOA 3G1HA 4PMDA 1K8CA 1F5ZA 4FPSA 4FOJA 1LF1A 3LA4A 3W2LA 1JUBA 3SCVA 1E6RA 1KBIA 1CDGA 4L1XA 5E09A 1MYRA 2WJZA 4D72A 3DI0A 4W8BA 1KBJA 5H8PA 3WKZA 3PBMA 3H55A 3EWBX 1H7NA 4NJIA 4B5SA 4GJ1A 3U8GA 1DL3A 3KBMA 3PZIA 7CGTA 4F8XA 4JL1A 4FMVA 5JBDA 3FYPA 3C8NA 4S39A 1A5SA 3V5CA 4QR6A 2ZRWA 1JDCA 2Q01A 2VYOA 4S3FA 2RH9A 2I5IA 3B0VC 5AC5A 3UU0A 5FJJA 1AJ2A 4W88A 3LV5A 1SO5A 3F5LA 3G8RA 4TX8A 1KCLA 3HURA 3FA5A 1GEQA 3ZQ9A 1XLMA 2Z25A 3ARPA 3I4EA 4HU3A 5IBXA 5FI8A 1LZOA 4ZO6A 1AH4A 1FCVA 2DUAA 4YTUA 3KRUA 3QTGA 2VHLA 4RCXA 2PDBA 2DSUA 3BAJA 1UD8A 1Z9AA 3B0YA 1K77A 1UKQA 2R1MA 1H51A 3LXAA 1YE4A 5DT7A 3KRBA 3PZ9A 2HDJA 3HOJA 3MVTA 1FY6A 3ZS4A 4AZGA 1QU4A 4MDOA 3RX4A 4ZCWA 4B4FA 3RIKA 5LIYX 1EUNA 2Y7EA 2RDXA 1CGYA 1REQA 1EJSC 1OT2A 4MDPA 2FKPA 2AQWA 3MUY1 2BVDA 1LJYA 1A5OC 4LALA 5E1QA 3VU2A 2GJPA 4WGHA 4XD5A 3WNMA 1SYTA 3DHFA 4A35A 4H9TA 4M5PA 4KS0A 3PBVA 2PDKA 2OX4A 1C7SA 3P84A 1YXCA 2I9UA 2QCEA 3A5FA 4NYUA 2ADAA 2HS8A 3VFLA 1YNYA 3Q65A 3LM7A 3T0AA 2Y89A 2VGIA 1UP2A 1Z41A 3H6OA 3ZLFA 1NU5A 1FVPA 4GUFA 1Y65A 2Q8ZA 4H00A 4X61A 3F2BA 1G0CA 3P0WA 3U0HA 5ABTA 5IDIA 3W7HA 3CUHA 4MNLA 1TRIA 3TP4A 2BNJA 4Z0JA 4NZ4A 1FH7A 2ZUTA 4OQVA 4HNVA 2EPMX 4ZTYA 3LYEA 1XIIA 2QMKA 4M1BA 4CQBA 1ONWA 3U57A 4HPXA 1JDDA 5JBFA 3DFSA 3KXQA 4CNPA 3WQWA 4HZ6A 4XKYB 4PUWA 3S9IA 2Z1BA 4MM1A 3QPZA 4G6CA 2OTDA 4PSRA 2O56A 3QHMA 4TTUA 2VM8A 5DCEA 4IFKB 3PJTA 1H7RA 1VJIA 4IQLA 1JUEA 3P5ZA 3UXDA 4XQ6A 4ZB5A 3VKDA 1UH4A 4KKXA 1C8VA 2Q6ZA 1LBMA 3BQ6A 3EXRA 2E6YA 4MIMA 1IZJA 1MSSA 3M47A 4GD0A 1WAWA 2QCDA 1CWYA 3BXWA 3A9IA 3AIBA 3OG2A 5G2WA 4U31A 4H8VA 1Q7MA 4LEFA 3THQA 2QF8A 4EXQA 4IGNA 5AYBA 1DJIA 2DORA 1O94A 4DI9A 4R27A 4Z2LA 3KAOA 8XIMA 3AS2A 3G0UA 4FB7A 1JR1A 1R3TA 2FLIA 5J5RA 1E1CA 2CZVA 1V3MA 4KEUA 1CGWA 4HPNA 3Q37A 4IL2A 3R94A 4NJHA 2I16A 2XYLA 3LPGA 1P7TA 2A3CA 1PAMA 4LJ3A 3TCSA 2J4GA 1I9CB 2DZPA 2PDXA 3IV8A 1O68A 4JX5A 3VOJA 3K1DA 2BTMA 5DO8A 2W6RA 1AL7A 1EC7A 3OQEA 4XISA 2ZZ5A 3LGDA 1Y5WA 1O12A 5HNNA 2CZ5A 3QY7A 3UJRA 4AIUA 2D2HA 7TIMA 1I45A 2X1IA 9XIAA 1LQ0A 4J2MA 5A6MA 4AD4A 4ROQA 3WQCA 5E5CA 2PDCA 1VFSA 1EJTC 1PHQA 2RDTA 3THUA 3GDKA 3GXTA 4EX4A 3LY0A 6ENLA 1NQ6A 3KW3A 3TIMA 1JFHA 2JALA 2Y4SA 5HXMA 2W0UA 3P93A 4J3ZA 5C71A 5HNUA 2J7GA 2DU2A 5I00A 2FVKA 3QBUA 3BC9A 3VA8A 5FCZA 3EBVA 3TW6A 4LRSA 4WIWA 1W8GA 4H01A 1C8YA 1BVNP 1XLLA 3VOGA 2V82A 3EX2A 3L9CA 1A80A 4JHMA 2I57A 5CSRA 3V36A 4BQ3A 3ZO9A 4FK9A 5EMLA 3UY7A 4HN4A 1VP5A 3NSXA 5D33A 4QLJA 1E4MM 1S5VA 3ABQA 2PDMA 1E1EA 3KDOA 2HK0A 3T4CA 3GC5A 3R7MA 4V33A 2A85A 4Z42C 4GHRA 2C14A 4WSHA 3CMGA 3NOYA 3F5JA 5KITA 2QPSA 3ZJ7A 2INZA 1W3IA 2YCEA 1PDYA 1EP1A 3DFPA 1BVZA 3WEOA 4HZMA 2FHBA 2WCAA 2D2JA 3HMCA 3B8SA 4CCEA 2CFFA 3CQJA 4Y8EA 5AFDA 1W54A 3RMEA 2E5CA 4J3WA 3RR4A 4Q8NA 1QOXA 1J12A 5F4XA 2O4QA 3A3WA 2R91A 4Y8FA 2GUYA 3MCNA 1W1TA 1FCBA 4UTKA 4YMZA 4F0SA 2WO5A 3WELA 3WFAA 3L67A 4U2YA 4GQRA 3DHUA 3BV7A 2XH2A 2OSYA 3M7WA 1TVPA 1QW9A 3UG3A 3UZWA 3U4AA 2ALDA 3E5PA 4IQJA 2GQ9A 3MWCA 1EJUC 2J7HA 1EC8A 2OWCA 2PE4A 3SCSA 3KRZA 4H9VA 1SZFA 1G01A 3S2LA 1ITXA 1HJUA 1X96A 2PAJA 1HJWA 1XBVA 1ZSXA 3OGVA 3VIGA 3JZUA 4AYGA 2YCJA 2BBFA 3WDPP 4KWSA 4ICNA 4IJRA 1SZRA 2WV8A 2YPIA 2H9AB 1G7VA 3NA8A 2Z1XA 2R1LA 3GVWA 1UWIA 2YZRA 5B7YA 1BTCA 1K02A 4FA3A 3VD3A 3WNKA 2DP3A 3ZVHB 4MYAA 4D6FA 5CPNA 2XIBA 3TWAA 4F2BA 2EJAA 2WVTA 7TAAA 1UPMB 1DORA 3GH5A 4I7WA 2HISA 3E0FA 4AD2A 3W37A 4DBDA 1EBGA 5HBFA 3N19B 4H9XA 5AECA 3WBXA 3SN0A 1QATA 2FB3A 3P8IA 4HU0A 2WZHA 1Q63A 1JG9A 3ANUA 1UZ4A 4PTVA 3TXVA 3CV1A 4KEVA 2FJUB 1RY0A 4UMAA 3NQ2A 1AH3A 3BCFA 1RUSA 2IPJA 1Q6EA 3BMWA 4BJHA 4YTQA 3A23A 1G4SA 3SRDA 3M0XA 4JTEA 1P4CA 4RZ4A 3R25A 3QW4B 1PYFA 4U4MA 5BOEA 3N12A 4EOUA 3MUIA 3W23A 4IIEA 3TDFA 5A94A 4O1DA 4Q32A 5IDZA 4ZXLA 5LIWX 3G1DA 5G4HC 4QDMA 2G97A 3HG3A 4FS9A 4WKAA 4QM1A 3O0FA 3ZXWA 2R94A 3GDMA 1E0UA 3ZMRA 2HBXA 1EZWA 3JR2A 4IX0A 1H50A 1NWTA 3B4YA 2A4AA 4A2RA 2G4JA 4XZLX 3KOWA 1SFSA 1S38A 2X7VA 1F4AA 3ME3A 3AIUA 2PDJA 1BQCA 3CUXA 3KHDA 3DFQA 1D8CA 2DSVA 4FNSA 3QMRA 1B4EA 3EWZA 3ONCA 1QNOA 3VIJA 4O28A 3GXFA 3QR3A 2Y5JA 4IMFA 3HQNA 1B54A 3IIPA 4G7EB 3GG7A 1B3WA 3H4XA 4HKPA 4NJGA 4H9MA 1CGTA 1X7IA 4CVWA 2BHZA 1FHUA 2W92A 1UW9A 4B16A 2FTPA 2ZICA 3WQEA 1VKFA 1ADDA 1J5SA 4KFOA 3DZ1A 1M53A 4JKKA 5FEWA 3AS3A 1Z48A 3MCMA 1CIUA 3RR1A 4E2VA 2Z1SA 1E6NA 3I7SA 2VFDA 3GYCA 3KLKA 4XD6A 2QS8A 2WHMA 1VPQA 3BJTA 2PS2A 3EDFA 4XAFA 4IG2A 2P1FA 3RX2A 4FOKA 1V0MA 1VAHA 3UT0A 3DC8A 2CLMA 1X39A 4UZSA 1DJYA 1GZ1A 2RJHA 1UUMA 3L23A 3QFEA 2WHJA 3M0IA 3OVGA 2VP8A 2ATSA 1QOPA 4CD7A 3MC5A 3QQWA 3MA8A 2V67A 5DCBA 1W9DM 1H5VA 4GQGA 1E4NA 3TQVA 4PH6A 4AY1A 4QAWA 2CHOA 4O0KA 2YW3A 5AYIA 1YADA 3TQPA 1KWKA 1A4LA 1V93A 2OX1A 1ONXA 4GMEA 3UR8A 2F6UA 4HOXA 4I7VA 4YYCA 1FOBA 1C8XA 1UA7A 1VRXA 1DJXA 3W73A 1WUEA 1F3XA 3EB4A 3UJSA 3BAKA 3CZ8A 4XO6A 3T2PA 2XIOA 1E4IA 2Z27A 3DFTA 2Z2AA 4F2UA 4OVXA 4GZIA 5LHFA 1LWIA 1AQFA 1T8XA 3U2ZA 3WNOA 5FF4A 3SN1A 2QKFA 1Z89A 1XDJA 4CCDA 5IHRA 4UXDA 4MLRA 1OABA 1XFBA 7REQB 1C9WA 1M01A 4ZO8A 2GGEA 1B3YA 1QVBA 1MXDA 3G0SA 3PB0A 2V9DA 2XFFA 4A4AA 1XIDA 3CIVA 4LANA 4K8EA 1J0KA 3EEGA 4EF8A 3C2EA 3PJXA 1KCXA 3ITCA 2RUSA 1OCJA 5GJMA 1J0HA 3LN3A 4DWDA 2OYKA 2VVNA 3I10A 3K5XA 4XUYA 1GONA 5C9XA 2PDLA 4QGCA 3RPDA 3W4RA 5FOOA 3BSGA 3EMCA 2YYTA 1QNRA 3CWOX 3B9OA 4HNOA 4PSPA 1F4HA 2DFAA 4DIAA 1TREA 3HPAA 1HIZA 3P7YA 2P0OA 3RCYA 5HQMA 1TJPA 2AL2B 1YIXA 4B91A 3AALA 1JYWA 2FTYA 2VURA 4PCSA 7PTDA 2ACQA 1FDZA 1XLGA 4DF1A 4MLJA 3DFOA 4XZMX 3UBPC 4LQ1A 4PUMA 3UJEA 1OD8A 1VRDA 1KGXA 1C9DA 1NDWA 4LW7A 1KR1A 2YZ5A 2DGAA 4LVGA 1H2JA 3EYPA 1L6SA 3FJ4A 1F6KA 1FXPA 1AD1A 2GK1A 5G1YA 4GBUA 4ERIA 4ZQPA 4UR7A 3W72A 4P7LA 4N9DA 4C6JA 3TKFA 1EFZA 2CCRA 3N18A 3VABA 3APTA 1UB3A 2HWGA 3KWSA 3NQCA 4GQQA 1GVRA 5TIMA 4QITA 3TTYA 1CLXA 2WNQA 5F7UA 2A6LA 4JCLA 4ROPA 4GABA 4JIEA 2ZFAA 4CD4A 3A9BA 4K8HA 1FX6A 4EWJA 2VL4A 3W74A 5I7GA 3CU2A 4QCEA 5DMNA 1WNOA 3WSUA 1EGZA 4B5XA 3B05A 4QQ3A 4QE5A 2ZVRA 5CSSA 2ACRA 3T8LA 3WDJA 1XGZA 2X7WA 1NWUA 3OVQA 3TUUA 4N0RA 1TE1A 3VKJA 1LOQA 4L9YA 3P81A 1NELA 2RDWA 3FY1A 2D73A 4DYEA 1MFUA 3QMTA 3IWPA 4ICMA 2F6XA 4HNTA 3N1AA 3S1GA 1ML1A 1X97A 5HQEA 5CCZA 3NO5A 2XDFA 4UWMA 2RJGA 2CYGA 3TTOA 3H24A 4Z2HA 3V18A 2JKPA 5D2YA 1P5BA 1TQXA 1IWAA 3KP1A 1UBPC 1Y8BA 3PS7A 2UY5A 3WMLA 3KCLA 3NYZA 3SO7A 3SY1A 5I24A 3WH8A 4DLFA 3SUWA 3NEVA 4A8NA 2V5DA 3BURA 3B8TA 4ZOAA 3VKBA 2Y7GA 3HPXA 4NUWA 3F4DA 1V77A 4GCXA 3UWUA 3IJQA 1SJAA 1EL3A 3NPVA 1NFPA 4NZJA 4JTGA 2REQB 4KGJA 3BCJA 4XTDA 5EYWA 2Y61A 1V4YA 1W1B1 1BKHA 2PI6A 4GX9A 4H7CA 1WKDA 3FCPA 4C1KA 1X98A 1PZ2A 4J3UA 2KX9A 3THCA 3SW6A 3UZXA 3BDKA 1G4EA 3VM5A 3UCDA 1LP6A 1K03A 2XVKA 1OD0A 3C61A 2D0HA 4PCPA 4XUGA 4GFSA 1E0VA 5M2FX 4YTTA 4GO8A 1IE7C 1XIGA 3JVAA 4JTHA 4ZQCA 4IQDA 1D8WA 4IH3A 2ZZ2A 2FGLA 4HK7A 5CZSA 4QRNA 4PN2A 3MKKA 1ITQA 4JQ4A 1GG1A 5FAJA 3MV01 3UFYA 2OFJA 1FCQA 3NQ6A 3QN3A 4J3SA 3C2FA 3SEPA 4D6CA 1OGGA 1ICPA 3GSMA 4LYKA 1NY1A 4Q4PA 1SZGA 1XIHA 4L7ZA 3W71A 2BY0A 4E4PA 4JQ2A 5LGZA 4RV8A 4AZ5A 2C0AA 4HJWA 3EMZA 3HG4A 4UOZA 1MXGA 3UZYA 1S1PA 1VHNA 3HFTA 2ZBTA 3W7IA 2OSWA 3PFMA 3OZMA 1TVNA 3WBAA 3VC5A 1WYIA 2BDQA 1M9HA 5C5YA 2OT0A 4JICA 3U4FA 5LZLA 1YYAA 2XM2A 1G4PA 2PGEA 4Z1DA 4H1ZA 3NXFA 2YW4A 1VQTA 4Z2JA 5AVHA 3A12A 4AG0A 1XUUA 3RLUA 1UUOA 3AXHA 2P10A 2BODX 1YTEA 4Z0SA 1XLJA 5D2VA 3WNNA 2E3ZA 1KKOA 2PWVA 3C0LA 4OHQA 5K7JA 3S1WA 3ZLHA 2E5BA 2VZOA 2PTDA 3PUOA 1V8EA 1HT6A 1XFCA 4AZCB 4HD5A 2GQAA 3MJMA 3MSYA 3XINA 3SN4A 1XLKA 1FWSA 4JNZA 4B9YA 1PV8A 2VDIA 3M5ZA 1E40A 3MBFA 1UZDA 1IEQA 1VFLA 2QR6A 3L4YA 2GDVA 2HROA 4YTSA 3ANVA 1DHPA 4GY1A 3REQB 4MAZA 2WWCA 2ZZ1A 4GH3A 1GTEA 3MUAA 4I9TA 2QIWA 3LQLA 2F61A 1PHWA 3LCWA 3UGVA 2ZKMX 4ZB2A 4E2OA 1N8WA 4E2DA 1B5TA 1TCDA 1QASA 1RBOB 2WZEA 1OX4B 2JKAA 1XYBA 2FDMA 4QSFA 5A8GA 1V3KA 5FESA 2ZUSA 1X1OA 3S1XA 2ZTJA 5I0DA 1KM4A 3W2KA 4HHMA 5CC5A 1S5WA 3VD4A 5EFDA 1Z3NA 3TONA 3QXBA 1A5UA 4LT9A 3QF0A 3SJ3A 2Z24A 1UASA 4Y6GA 5HJLA 1V02A 3GVVA 5ABEA 2QZRA 4PUEA 3L12A 2J9ZA 4NAEA 3TJLA 1BSLA 1V79A 2DVTA 3SY5A 1L2QA 1U5VA 3NM3A 5BZAA 1N7KA 4DJDD 2BV9A 2IQ0A 1UWAA 4Q4SA 3E0WA 1J4EA 3S47A 5G4EA 5EY5A 3HO8A 3H12A 3W82A 4RNFA 4GZJA 2CLIA 1TTQA 3OZYA 2YA2A 4PRRA 4AWTA 4DXVA 3H2EA 3CYVA 4I9MA 1BF2A 2B7OA 2ZRYA 1W3NA 1UR0A 1O1HA 3EAUA 3TMQA 1R38A 2HEJA 4HSHA 3WK1A 3E9AA 3A47A 3PZQA 4CD5A 5U4NA 1SR0A 4GJJA 4AZHA 1EOKA 2DJLA 2V8ZA 1LDCA 3C52A 4WDTA 3NPUA 5LGXA 1NFBA 4YN5A 1Q4NX 3N2OA 2VUNA 1KFCA 3S0CA 1RBLA 4KF1A 1Q6RA 3CB8A 4JXCA 1EBHA 1E3XA 4O0ZA 2CZEA 4C7DA 2GVYA 4KRTA 3H2MA 5HULA 4KIRA 3KDNA 5CPQA 3RX3A 1SFLA 4O1BA 2B0MA 1W1A1 2EJ1A 1YPXA 3WQVA 4G7FA 1QWGA 3OYXA 3F5KA 5FF2A 1AMKA 2CLFA 1UQZA 2RDUA 3IVTA 3WEMA 2A2IA 3IRSA 5DRCA 1Q45A 2PDIA 1RVKA 4QLLA 1HL8A 2VEIA 2ZUNA 3NXLA 5DF0A 4DZIA 3CQKA 4L9ZA 3LHWA 3EX4A 1QPNA 5DY2A 4GISA 3OW1A 2D3NA 5JBEA 5M5DA 6REQB 2O7QA 2QGHA 3G8EA 3E38A 4RK8A 1M7OA 4CEXC 4E3TA 2J8GA 1KM5A 1O5XA 1AJ0A 4H6RA 3V1HA 3TWBA 4ZFCA 3QV9A 1V3JA 3BLIA 2O55A 4C7GA 6XIMA 1DJHA 4AIEA 4FR1A 3BO9A 4A3UA 3CYJA 1C3FA 2UY3A 3H7RA 2GVLA 1BF6A 2F2HA 1HKJA 3CIXA 1ZJHA 1CTNA 1J96A 4H3DA 1P48A 4H9YA 2YKKA 3FDGA 3MMUA 5RUBA 1DWGM 5AY7A 1KTBA 1R6WA 3ZJ6A 1HN1A 3AHVA 1WUFA 3IUDA 5HAOA 4LAMA 4C6PA 5T9BG 4JQ3A 4Z1YA 2BS9A 1DJQA 1QT1A 2BB0A 1LBFA 3PBYA 5HJXA 5HUPA 4WGXA 3PNUA 3SGUA 3GAYA 3RCNA 2V38A 1OYAA 3PG8A 1BLIA 4B5WA 4FXFA 3FOKA 4XZNX 3L5MA 1QOQA 1CENA 2VZTA 1DTUA 3AO0A 2YBVA 1U22A 1TPH1 1B4KA 3DYMA 2NVAA 3GXDA 4ZL1A 1SZNA 2G3JA 5I3FA 1PTDA 5BMWA 5KMYA 3M16A 4LCQA 4WD0A 2E77A 3QGAC 2FFCA 3DH7A 3AYTA 1ZAJA 4WK9A 1EXBA 1G94A 4AVNA 5D02A 5ECVA 3EOOA 4YWIA 2W66A 4CUCA 3M1ZA 1H41A 3V5FA 2J24A 3U7VA 2IPFA 4MF4A 2OKOA 4TX6A 1R30A 4ZB0A 3VUPA 3CEUA 4NI8A 1EJVC 4DO5A 4QQUA 5FL1A 3A4JA 5BNKA 5PTDA 3V5OA 4WRHA 1K7FA 4IT1A 3RJYA 3W2MA 3W76A 3OBAA 1K1DA 4C6FA 3SUUA 2O7SA 3IV3A 4O1CA 1EF2A 4N4PA 3KBVA 4NZCA 2NQZA 1CW2A 4X2RA 2IW0A 4J28A 2WW5A 2YBUA 3DENA 4O11A 2X05A 2VOTA 3WH5A 3GFXA 1TMQA 4GIAA 5I02A 5I3DA 2XN0A 1NIUA 4N7QA 3QC3A 3H7VA 2O92A 4KERA 1KKRA 4UQEA 1VJZA 1HXJA 3GC2A 3C0JA