4L1GA

Crystal structure of the bc1960 peptidoglycan n-acetylglucosamine deacetylase from bacillus cereus
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
214
structure length
213
Chain Sequence
WTPFSWVEKYAYAFSGPYNKAEVALTFDDGPDLEFTPKILDKLKQHNVKATFFLLGENAEKFPNIVKRIANEGHVIGNHTYSHPNLAKVNEDEYRNQIIKTEEILNRLAGYAPKFIRPYGEILENQLKWATEQNFMIVQWSVDTVDWKGVSADTITNNVLGNSFPGSVILQHSTPGGHLQGSVDALDKIIPQLKTKGARFVTLPSMFQTSKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidoglycan N-acetylglucosamine deacetylase
publication title An unusual alpha-carbon hydroxylation of proline promotes active-site maturation.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 79
structure length 213
sequence length 214
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4l1gA00
4L1GA 1NY1A 2VYOA 1W17A 4NZ3A 3WX7A 1V6TA 2NLYA 5JMUA 4NYUA 2I5IA 4NY2A 4NZ4A 5BU6A 4OUIA 3CL8A 3VUSA 2DFAA 2W3ZA 2QV5A 3CL7A 2C1IA 4M1BA 2Y8UA 4LY4A 4WCJA 2C1GA 3S6OA 4U10A 4F9JA 4NYYA 2CC0A 3QBUA 4NZ1A 1W1A1 2E67A 2XU2A 3RXZA 2IW0A 3HFTA 4F9DA 2J13A 1Z7AA 1XW8A 3CL6A 4NZ5A 2C79A 2C71A 4HD5A 4V33A 1W1B1
chains in the Genus database with same CATH superfamily
5A1AA 2VWTA 3B0YA 3GVVA 2YJQA 3STGA 5BRPA 1XFBA 3CMFA 4NAEB 1YPFA 3WH8A 5F2IA 3EKZA 2GDVA 3GKFA 2OZ0A 5DXXA 1XD0A 3UYCA 1F8MA 4I6VA 4N9BA 1YW1A 5FKYA 1ZCCA 1TPDA 4DY1A 2E1WA 3DHDA 4AAJA 2R1NA 2OGJA 2JKEA 4XD5A 3EWCA 1VENA 1GW1A 1B3YA 3QN3A 1R7OA 4ZFMA 1H63A 1A53A 2QUMA 1HG3A 3S8HA 3WK2A 4AD4A 2Q3OA 4AZ6A 3E6EA 4GHRA 4R34A 5DBTA 1I75A 4AY8A 2EGZA 3T9PA 4C1NB 3WMLA 1S2UA 3TTOA 3BGGA 4XG1A 4GWEA 8A3HA 4C60A 4AHOA 1XPYA 1T6MA 3C0LA 1A5SA 1PV8A 1QXLA 2YFOA 4BWLA 3PUOA 4DLFA 1QJWA 2A79A 3M6DA 3UVIA 3LI0A 1FWGC 1I6NA 2OJPA 3AHVA 3GU1A 4JTJA 4IXHA 4KRUA 3T40A 3GTXA 4IMFA 3I6RA 5DBUA 2J4GA 1BVNP 2Z25A 3OYXA 3QGAC 4HCDA 5JH1A 2V5LA 5EGRA 3WQVA 2ZVRA 5FSDC 2X05A 4LUIA 4NX5A 3T0TA 3VX1A 5CSYA 2ZRVA 1VPYA 3ES7A 2W91A 2PDUA 2Z28A 3EAUA 5ECVA 3KOXA 1VFHA 2TRSA 4ZB5A 2V5JA 4LCQA 3EA2A 4A05A 1L0PA 1S2CA 3BLEA 2A3BA 1LBLA 4JL2A 3OG2A 1GOOA 3ITLA 1S39A 3AIBA 4NL1A 3KCOA 4ILSA 3MSDA 1A0CA 4QDWA 4AZGA 5XIAA 5CZKA 1Z89A 1TPUA 4F3HA 4L61A 5ENLA 3DH7A 4I8YA 4FOUA 4YPJA 1VYPX 1E73M 1EFZA 3B9DA 3DFSA 2BGSA 2FVLA 2OYKA 1E1EA 4LAMA 4DUVA 1ZJBA 1JDAA 2XWEA 3AHYA 3SRFA 4I6KA 2YBVA 1CPUA 4M24A 3DHUA 4JTFA 4WRHA 1WKEA 3UNDA 4LNCA 2ABAA 1H7OA 2F6UA 2D69A 4CNUA 1FDYA 4QJ3B 4LRSA 5C9ZA 1JZ4A 3EDFA 2OT0A 3RLVA 3DFQA 3VI2A 4OOZA 3AIRA 1M04A 5I3JA 1NWTA 1R85A 1AFSA 4POCA 3VGBA 5BXRA 2PB1A 3L4YA 4HCLA 3BOFA 2WHKA 3RF9A 2QCEA 5HNRA 1HW6A 1TTIA 1BF6A 1JCTA 4Y8FA 2HISA 2VC5A 4EVZA 4LS0A 2NX3A 5A95A 5FOOA 3SAZA 3GDKA 1Q6QA 4RPQA 1ZP4A 2NV9A 2JFEX 4YJ5A 3QZ6A 3CHEA 5DMMA 3VDAA 1CCWB 4IIFA 5GNYA 1A5KC 2IKHA 1J2WA 1DHKA 4C6BA 4NJKA 4GUHA 1YTEA 2EKGA 2WVTA 3QMTA 3AHZA 3APYA 5FACA 2I9UA 2Y8KA 3CC1A 1SFTA 1UZDA 3GVWA 3ME3A 4JEQA 2KX9A 1V7AA 2CYGA 4L56A 1AQ0A 1FCQA 1JUBA 1EF3A 1JYXA 1ZJAA 1YRRA 5D9NA 1GVOA 3TWAA 1WAUA 4ML4A 2X42A 1O6IA 2DFAA 5HJYA 3EWZA 3DYPA 3CV2A 3QHNA 2XG9A 5EA9A 4LC8A 2HWGA 2XFWA 3WUFA 1A5BA 3W83A 4QEHA 4JD4A 3SRKA 2ZICA 4ZVJA 1R30A 2PGWA 3W1RA 3UXAA 1KXVA 4XKMA 1XH1A 3L7RA 5DFAA 3PTKA 1OB0A 1GYMA 5AYZA 1OZMA 4EPEC 3KBSA 4RZBA 5C2XA 1J4EA 3PJTA 3L4UA 4GNKB 3ES8A 4W7VA 2WWCA 4UFIA 3W7EA 4QJ1A 2FPTA 4LNYA 1CTNA 3HBLA 3E02A 3PAOA 3C8FA 3VZXA 3SQMA 3VXGA 1QHOA 5HATA 5LNRA 3GNRA 4G6CA 4XVDA 3QW4B 4JTEA 1E6ZA 5LHEA 4ZOAA 3EKLA 3W7HA 4CUCA 3H8AA 5AN7A 1UHVA 4JTIA 1ODUA 3AISA 4RKAA 2C91A 5HXMA 3E5BA 2AMXA 3YPIA 1Q6DA 3NVDA 3GC4A 4ICMA 4MYAA 4M56A 1VBHA 1UOZA 2ODOA 1EJVC 4YHGA 1QI0A 3WQEA 1MEIA 3BAYA 4LW7A 1ESWA 1C8XA 3G1FA 3CV7A 3UJSA 1IEQA 4QJ4B 1ZS2A 1FP9A 1V3HA 1OFAA 2V5BA 4TV5A 3DGBA 1TB3A 4ALDA 1KCKA 3G1VA 1JRCA 1S5TA 1VFUA 2E28A 3ABOA 3Q65A 2RAGA 1F7BA 1WX0A 4C6DA 1GORA 3O05A 1A5CA 3CH0A 1JCNA 4LYKA 4PMUA 2AL1A 2FZ9A 4J40A 4GX8A 3L9CA 4PC8A 4AQLA 1MSSA 3LRMA 4RUBA 2WZTA 3U7VA 3OO2A 4FNUA 4W8BA 4TUFA 2ZX5A 3TQVA 3F4CA 2HTMA 3M0YA 2A6LA 1MI3A 4K7VA 3PTQA 5LXEA 2A3EA 5AHLA 5K9XA 2ZZ3A 4DNHA 1P7TA 5AECA 1HKIA 4GIEA 5D2TA 4LVAA 4QE1A 5MKGA 3EPOA 4F0MA 3IEBA 3A9BA 4PB4A 3GHRA 4GI6A 5CBIA 4ZR8A 4KWSA 1S46A 2BHUA 3UZJA 1XV8A 2A5HA 3DG3A 2OKTA 2J8TA 2DEPA 1U22A 1R3TA 5GVJA 3P7YA 5AB3A 5LSMA 1L8NA 2QCDA 1CGUA 2F38A 4CNNA 3B9EA 1XIFA 1H7RA 1J10A 3TN6A 1A5LC 3G1HA 4JTUA 3PTMA 4A8IA 3WQ4A 4U2ZA 3M07A 7A3HA 1E0UA 1POJA 3PB2A 4HN4A 1B3XA 4CD4A 2ZX7A 3ZT6A 1GONA 2P5NA 1RBOB 3OBEA 3SGUA 4GD0A 3FKKA 4CCEA 1AJZA 1HKVA 2CZDA 2YZ5A 3UG5A 4YVVA 3NXFA 4HZ8A 1EGMA 3SUTA 1G7UA 3PZVA 2JEQA 3TDFA 2BHYA 2J8GA 2QT3A 3OLEA 3FSTA 4ZB2A 1UPPA 3GR8A 2EPHA 2FGBA 2OCZA 3LHWA 4DJDC 4XZIA 1QTWA 1PYFA 1XYAA 1X6NA 2DZTA 4Z2JA 1R86A 5DX7A 1ADSA 2YA1A 3R79A 5M1TA 3TV8A 3GDRA 1ZTVA 3R0KA 4O0ZA 3KAOA 1A50A 3RX4A 1CGVA 1P7TB 5BU9A 4ZTXA 5DRIA 4IOTA 1E1CA 5MKGB 2ZUVA 4IMAA 4OUIA 4GY1A 4PEKA 2VQUA 3WD4A 3MUXA 4CD5A 3B06A 1K70A 3LGGA 1JF5A 3S9YA 4WIWA 4YL2A 1S5NA 2W6RA 4XZNX 1ZJIA 1J8VA 4D6JA 4GI8A 5A6JA 2QCDB 1FWAC 1OJXA 3AU2A 1CDGA 5D2VA 1H5VA 4LXFA 1Y65A 3D6NA 4D8LA 2X1SA 3FKRA 1DXIA 4J7RA 3FW6A 4EF9A 1UH3A 2V81A 4F48A 3R25A 4WOZA 2D24A 4QM1A 2C8NA 2A6NA 3MCOA 4CKQA 3ABXA 3AXMA 3DX5A 4H01A 4Z2KA 4P8UA 1EO5A 4D6FA 4HQVA 4CCDA 2HZGA 2PLJA 1TPVA 4JY9A 3WK3A 1J9YA 5M3WA 1UA3A 4RDVA 1SFJA 3STPA 3CHVA 4DZAA 1GG1A 3ITCA 2UV8G 1XGEA 1E71M 5E0KA 1O4UA 1SO4A 2ZWYA 2C0HA 2QDDA 4M8UA 2F7FA 3G18A 3NGJA 2VT0A 4Z1DA 1H60A 4ATLA 1R6WA 2DT0A 4S3CA 1TX2A 3VDGA 1ISYA 1E1CB 3CPRA 4LPCA 4UFMA 2C19A 1FWFC 4WR3A 3C6CA 4MOZA 3AYRA 3JZEA 7ENLA 2WVVA 3UG3A 1YXYA 4GG9A 2I1OA 3FEMA 4LAKA 1RAKA 5AVHA 4R88A 2J78A 2V2HA 2JGYA 3KDNA 4FLOA 4JTDA 1BTCA 1X1ZA 4OTKA 2PTYA 4GVHA 1W0MA 3ELFA 4M7TA 4BK9A 1UZ4A 2R6OA 1WDPA 3WJYA 1TMQA 1W3JA 5LNWA 3F4NA 1GJUA 2P1FA 3CHFA 4PBFA 5CBJA 1VBRA 3F4VA 3B8IA 1KFWA 5HINA 4ZSTA 1DIKA 5T9CE 1C91A 4QE5A 1OSEA 2VGBA 5LA1A 1EOKA 1GJPA 4UNKA 1CLVA 4Q6XA 2XM1A 1J18A 1DJIA 3SI9A 4UOJA 1F6PA 2DT3A 3GVGA 2WMJA 2VCAA 3L5MA 2WSQA 4B5TA 3CPGA 1XC6A 1O1HA 3UPWA 3VD9A 3TH6A 4O50A 1VFMA 1SJAA 4GUIA 1R3WA 2R94A 4GKTA 5B80A 1F74A 3GDMA 4AWEA 4Y9NA 3BE7A 2FYMA 4Z1YA 3ID7A 2Z00A 3MKVA 1OQFA 1HUVA 5E5CA 4TOQA 4O8RA 2WCAA 5AC7A 2P3EA 4JHOA 1LROA 2NQLA 2CWXA 4QGCA 3AS1A 4G5DA 2J7CA 4WDWA 3DKJA 4DB7A 1DJWA 1V6YA 2DH3A 3HGOA 3A23A 4MG4A 3MJYA 3BO9A 3L65A 1M3UA 1EIXA 4AIUA 4CCZA 6CGTA 4MY8A 2WMHA 1W3KA 4GH3A 3BG5A 2YL6A 2WSYA 2WVVB 4KBXA 3II1A 1FWEC 5DT7A 4OFCA 3P6LA 3GVQA 1KBJA 4DUOA 2YLLA 2G3FA 5DMLA 3UY7A 2Z26A 2V82A 3TVAA 3W2MA 4IJRA 1OGGA 3S4TA 3WH7A 4BS0A 1MQRA 4P5UA 4Z2HA 3S1WA 3VAVA 2BOFX 2GUUA 3T0DA 4MZ8A 3ARPA 3BTNA 2WK2A 1K77A 1KRBC 1K9FA 3DHPA 1YPIA 1RJRA 1TTJA 2X7VA 5HWNA 1EQPA 1P0DA 4PTWA 4JYFA 5I0DA 3WNLA 1ODZA 3MI2A 3NZ1A 2YDQA 3S2MA 4FXSA 1SYTA 3R43A 1AG1O 4CQ9A 1VR6A 2V2CA 3TR9A 1XJBA 1R0MA 4D72A 1X1OA 1TTPA 3QH2A 3H26A 2XN0A 3P8IA 5FEWA 3WBEA 1ONRA 5EB8A 2R1PA 3EXRA 3SN0A 1D9EA 3B8WA 4PYSA 2QKFA 3WK1A 4AD1A 4PA8A 3M5XA 3NAVA 1UD3A 1I1XA 4P7OA 4YMZA 2FH8A 2TYSA 3RDKA 1JCMP 4AU0A 3F2BA 4JCMA 3A4JA 4E2OA 2VEFA 5U4NA 1UWQA 5CSRA 5K3VA 4YCOA 4GI9A 1ML1A 3SCTA 2PP1A 1V51A 2CHNA 4P8XA 1GG0A 3NL3A 4BF9A 1Y5WA 5KZEA 1GOWA 4S3FA 1J0ZA 2ZFAA 3S5NA 4E5TA 4JHZA 4ZFCA 4A3RA 4AYSA 4RE2A 3HQ1A 4LAZA 1X6UA 1Q6EA 3BCJA 4OECA 4G7EA 2QVNA 3SECA 3TEVA 4J3XA 5AYXA 3GG7A 2XIJA 1JYNA 4PTNA 4XK2A 4GC4A 2R24A 1WV2A 4W89A 2PBOA 3QMSA 4GYKA 1MDLA 3ABQA 3R2GA 3UXKA 1XX1A 2G4JA 4DXXA 3CUFA 2PC4A 3PZQA 4PBEA 3VA8A 1UA7A 1W56A 1ZBCA 1T40A 4X2PA 3B40A 3WNKA 4ZXLA 2FMOA 1E4IA 1KQYA 3BGJA 3RRXA 2O9OA 5PTDA 5LIXX 4LVGA 5CGQA 4C1KA 5AYBA 1J0JA 5CKSA 1Z6KA 4DNMA 2FJKA 2X0YA 4AC7C 3NZGA 4JFTA 4Q8VA 4C6FA 4E38A 3BMVA 3K8LA 1HKJA 1G9HA 5C5YA 3GYEA 2NV2A 3GU2A 5REQA 3BQ5A 1KQZA 3R0UA 1AJ2A 4NXSA 3ZLFA 5DXYA 3BAIA 2DQWA 3UZYA 3D5HA 3KE0A 4PN2A 4CQDA 1KV5A 1NF0A 2AOSA 2CW6A 4I9TA 3NL2A 3EPNA 3ATZA 3M0MA 3HB9A 2C71A 1Z42A 2J7EA 2J7DA 3FXYA 1KBIA 3CV6A 4KERA 3W1PA 4CD6A 2OMAA 5GNXA 4UTHA 3BLOA 3VCRA 3UFYA 5I3GA 4YHEA 3S5SA 5BMXA 4ZBCA 2VUNA 3W7QA 4KEMA 5F2LA 4DO6A 4A2SA 1CBGA 2FHFA 3V36A 3KZPA 3W2JA 4HNVA 4G7EB 1K6AA 3NDOA 4U33A 4WK9A 3M43A 2FZMA 1V6XA 1PSCA 1OFEA 5ABHA 2NQJA 1UJQA 4ZQMA 5TD4A 4GABA 2B7QA 1YNPA 2WCSA 2DZVA 3QR0A 3H24A 1TPH1 3KHDA 1Q6FA 4P7RA 1ZP3A 2YSWA 4JAWA 3TKFA 3SY1A 3GH5A 1B57A 1UR1A 4LX4A 4NKCA 1QWGA 3QF0A 2E5DA 1QI4A 2V38A 1A4MA 1W37A 1TZZA 3F03K 2EJAA 3R89A 4JBRA 3I7SA 2VEIA 3VMNA 3G22A 3N4EA 3NQ7A 1WKDA 1KC7A 3PAJA 2A21A 4XX6A 5REQB 4QNWA 1W9PA 4AD0A 3GFZA 5D8ZA 1O60A 1DQXA 3WD0A 4H2CA 1TKKA 3W24A 4QDPA 5G4EA 2Y2WA 3LA4A 2C13A 4OU1A 1VFTA 1XCFA 1VS1A 2WBGA 3TCSA 3NUKA 3M0XA 1RALA 4G2DA 3TAOA 4H1ZA 4NZCA 1E9ZB 1JDFA 1DHPA 2VEKA 2HK1A 2B4GA 3OGRA 4MWAB 1DL3A 4ZOEA 1W9XA 2TMDA 5C8BB 3ANUA 1IEWA 5L9FA 3U4AA 2ZUMA 5B7ZA 4QG8A 1KM3A 1DJHA 1XICA 3QYQA 2D20A 6TAAA 1FXPA 3IIPA 1YEYA 5G1YA 5C9WA 3CEUA 2O92A 1BF2A 4HNCA 3VZZA 1IZCA 2NXHA 3BVJA 1FHDA 3N2BA 1VJZA 4UQBA 3QPYA 1HZYA 5HJXA 3PSVA 4JIHA 1VC4A 3CO8A 2YYUA 1M41A 1SSDA 1MW2A 1DTNA 1MEWA 3FN9A 3OB8A 2Z1XA 4ATWA 4UFJA 3RJYA 3WH9A 2WZHA 4MDPA 3PFMA 1H7WA 4X3ZA 4B9YA 3WLSA 3N17A 4NUWA 1PVNA 2A2IA 4RNIA 2INEA 1RH9A 1O5KA 2GJPA 1XYBA 4ZGYA 1W1A1 1LLZA 2ZYFA 4A3QA 4UTLA 5CCZA 3TW6A 5AYYA 2NVDA 5I23A 2JE8A 1B3OA 3UG4A 1J5SA 1FWJC 3LI1A 3T1GA 2ZRYA 3HGJA 1TWWA 3E12A 3OBKA 3A13A 1EIBA 2OODA 4FP1A 2FQIA 3U2EA 3ALFA 4L1GA 3M0JA 4Q4MA 3QKZA 4J3ZA 2CXGA 3LHZA 1XLMA 1SO6A 2VC9A 2YBUA 1GHSA 4S1FA 3I68A 1SSGA 4PCPA 1BG4A 4Y90A 3TXZA 4AIBA 4D6DA 4KEUA 4GY7A 3H2FA 4XAZA 2XFYA 1M65A 4RZ4A 1L6FA 2QPSA 1V3IA 4IMEA 1QFEA 2OX1A 2WLYA 2CNCA 3B0XA 4UQ9A 1M7OA 2V3GA 3A5VA 2WKJA 3QV9A 4AFYA 1TQXA 4G1KA 1KR1A 1W1TA 2VELA 3ZR6A 3QY7A 1EB3A 4DIAA 4Q4PA 3B8UA 1MW1A 4EE9A 1OFRA 4XBJA 5AC6A 5H8MA 1TQJA 1EPVA 3TA6A 4E6MA 4LF1A 2WSRA 2VL4A 1E15A 3NQGA 2PDMA 1EA0A 3V18A 2FTPA 2WJZA 1EJ7L 4M6VA 2Q8LA 3KL5A 4FNRA 3TWBA 2VCBA 2PGRA 3EDKA 2J79A 3DAQA 4F2UA 3P82A 5I77A 3NXLA 2ZVIA 2TAAA 3DFNA 3RO8A 3B8VA 1JYWA 4J27A 1O7AA 2XH7A 3BAJA 1XH0A 5FJJA 1LT7A 4WSJA 2ZQ0A 1J0IA 4GOAA 1A80A 4W86A 4A8RA 1MUCA 3C56A 3RM8A 2Y5SA 3KLKA 4L4OA 4XUYA 4DJFC 3IIVA 1PAMA 2CLOA 1X1NA 3WBXA 1C9WA 4M7SA 3HPFA 1A5AA 3TC3A 1ZPTA 4C6QA 4HSHA 4CGTA 4DZHA 5J5RA 3NGFA 2ZA1A 3MSRA 1NOFA 3CUZA 3TMLA 5BWFA 2WJEA 2HMCA 3FFSA 3HG3A 3VIMA 4O0QA 4W8AA 3AU6A 4LEFA 2EF9A 1XRTA 3H2OA 1KV8A 1VLWA 3APGA 3SCSA 2PI6A 4ZENA 1KBBA 4LQ1A 2EO7A 4NF7A 1KA9F 4C6MA 7TIMA 1LZOA 4J9JA 1D8CA 2VZUA 3EWUA 1PPIA 4S39A 1KM6A 3N4AA 1WBJA 3WQ6A 4AMAA 3SCOA 4DO7A 5A69A 4ECLA 4LBRA 3R13A 4WZHA 4N7QA 5D37A 3N3MA 4UQAA 2WOQA 2CBVA 2P88A 4WOQA 3I3BA 2NZLA 4MUZA 1P5BA 4KESA 3GAKA 2NVCA 3LHYA 4AIOA 1NSJA 3U8GA 4H04A 3OA5A 4IJCA 5HA7A 5AFDA 1W5MA 2VWSA 4FZIA 2NT0A 2G95A 3CLWA 4B5WA 1PHWA 3PPFA 4DJDA 1XG3A 1XINA 1BTMA 4R7WA 1QR7A 4W4QA 3W6MA 4BHYA 1LLOA 3TOPA 4PCFA 1SJDA 2CKSA 3IIOA 4U2YA 3BC9A 3TR2A 5EY5A 2OXNA 1CLXA 4EXAA 1E51A 4YVPA 5FF7A 3VMPA 3OQEA 1B5TA 1ADOA 3W1UA 3VUPA 4LH8A 4Q3MA 2NXIA 1A49A 1BPLB 1ONWA 3UZWA 3CQ0A 4O53A 1IT8A 1LP6A 4JQ1A 1GTEA 3DOPA 4FR1A 4A4AA 1UMLA 1NDZA 4DYKA 2GZXA 4S38A 4MSSA 4GZIA 4UTMA 4HIBA 2VENA 4FEZA 3AI0A 5M17A 3T8QA 3KBNA 4Z0SA 2NT1A 4LEQA 4OQVA 1PJ9A 1FHLA 4PFHA 1CEOA 2PD5A 3E2QA 3N9KA 1A5MC 2YZRA 1F2JA 3WLHA 4S3KA 3PPGA 4PR4A 3GX9A 1UP2A 4JYDA 1C9DA 4LVBA 2XH4A 5IOBA 1VFFA 3UERA 3W1TA 1PCWA 5JIPA 1RLCL 4UB9A 1Z9AA 3PZUA 2BZNA 1VBGA 4MYXA 4J4KA 1B9BA 1IV8A 3T8LA 1XS2A 2HRWA 4B4HA 4EK7A 2C16A 3QRHA 3G8RA 1VGAA 1CGWA 4HYVA 1EJWC 4HYRA 4DJDD 5D9MA 4LS1A 1V02A 4RDWA 3U7BA 2PDWA 1AZ2A 1ZAIA 4IJBA 2BXYA 1S3HA 3HG2A 4M1RA 4W84A 1OHLA 1XDJA 4NI8A 3C2VA 3VNIA 3VVGA 3HZ3A 2VRKA 4UXDA 4IX2A 4FR6A 3IAQA 2DVUA 4NU7A 4EIVA 5DCBA 2NWRA 2O9RA 2OQYA 2DV0A 3LV5A 1H11A 1PXGA 4HJWA 1BGGA 1XBXA 3EKGA 3W25A 1NQKA 3VIOA 1FXQA 1K8YA 1DE5A 1LWIA 3IRDA 4GXPA 4IGNA 4JTCA 3UY8A 3PTDA 1XYFA 1BYCA 4NP7A 5LA2A 2GQ3A 2V30A 1W5OA 3NSNA 4TV6A 5FSEC 4GQQA 3PZOA 2QULA 4H6EA 3KX6A 4ZO7A 2QF8A 3IK4A 1XBVA 4MJ4A 5GNZA 3W3OA 3BAKA 3TLQA 5LZLA 4AEOA 2QXWA 3NPXA 5E0CA 4YYCA 4PODA 1ZAJA 2W67A 1JD7A 1TR1A 3GNXA 5I3DA 2NXGA 5CQ1A 3QZEA 2AL2B 4K6AA 1ZHAA 2VQTA 3HPSA 1ZSXA 5LNSA 3W75A 2DGAA 3OZPA 3HO8A 4H9UA 2B7OA 3W84A 3U57A 3UD6A 3S46A 1SFSA 1AZ1A 4WKAA 1RQHA 1RY8A 4QP0A 3ENLA 4TTGA 4S3EA 4FLRA 4HA1A 3TIMA 1GQJA 1J0KA 1KTBA 1VD6A 7TAAA 1RR2A 4KGLA 1AW1A 2VVNA 1R9ZA 4L80A 3QQ1A 3L2LA 1NDVA 2BFGA 1XGZA 1SFLA 1EJRC 3U0HA 2XM2A 1LWHA 1MMFA 4CNSA 5KTLA 2ON3A 5HULA 1WE5A 1BXCA 3VFCA 1H7PA 2F2KA 3V4BA 3RU6A 1E9IA 3KTXA 3L66A 1XCWA 3M7WA 4HHLA 3LGEA 4BCEA 1YDYA 1T5AA 1H1YA 1Q8AA 2C1GA 4JFWA 4XWUA 3GU9A 3UGVA 4HB7A 1JZ6A 4PUNA 3D3FA 2Y7FA 3QLDA 1F5ZA 4RNFA 1EDQA 2A85A 3CAWA 3IGSA 3LPFA 2IKIA 3KDOA 3NO5A 4N02A 3GXFA 2E6FA 3RLGA 3P0XA 2PA6A 2QMKA 3IV3A 3OG3A 4S23A 1AW2A 1IE7C 3ITYA 1UWIA 5XIMA 4AMCA 1FWNA 2Y88A 3A6OA 1GEQA 3UR5A 1V7YA 4M0XA 3S6TA 4RLIA 4PMZA 5FAJA 3UWUA 3NTYA 3W7MA 3CTTA 2FIQA 1XUUA 1I0DA 3MMTA 2OVLA 1UC4A 3A9IA 2E68A 4IMGA 5ABGA 3I7RA 4NJIA 3VE7A 3UZZA 1JL8A 3KP0A 4M6UA 3NQDA 1Y8BA 1GYLA 2F6KA 3R8RA 4MMWA 1WAWA 2O56A 3WFLA 2V5KA 1DQUA 4KMQA 3CS2A 2HVOA 1Q5MA 2VHLA 4NZ4A 1QMLA 3GTFA 3K4DA 3GD6A 5LIKX 2BSLA 4YLWA 4WDTA 5CPOA 2W63A 2E67A 1E6NA 1RHCA 3DC0A 3T78A 4ZOBA 4JL1A 3IJQA 1T0OA 1VHNA 1MDRA 4KQNA 4O14A 4O1BA 3KOZA 1T7LA 1V3JA 3LCXA 1KGUA 5DEZA 3VZYA 4PUJA 3OVRA 4JX4A 3GR7A 3V3WA 2IPWA 4CQCA 1SPQA 2VRQA 3ZJ6A 5AC5A 4C7GA 1ICSA 3S83A 3P14A 3AUOA 2D2HA 1L9WA 4H6KA 3IIXA 2FFCA 3S2LA 3WQPA 2NX9A 3UP8A 2YCKX 1DWIM 2GGEA 3Q67A 3QBUA 2ICSA 3M0IA 3PZMA 1XYCA 3NQ2A 5I09A 3NFUA 1FCUA 2JF7A 3A3WA 4IPLA 3HPXA 3MV11 3EMQA 5CSSA 3VUSA 1QNSA 1N82A 2ISSA 4KF1A 2ZZ1A 3VDHA 2Y61A 2VCCA 2REQA 3TMQA 1KO0A 1G4EA 3H7UA 1KFCA 2PU0A 3ZS4A 2C7FA 4UMAA 4HKPA 3RPTA 1YADA 1E4MM 2C1IA 3AROA 1G1YA 3F4DA 3NQBA 3H7RA 4KETA 3TZFA 2HVNA 5DCEA 3SN4A 3O6DA 2IW0A 1XSIA 2PS2A 4H9YA 4UOQA 5I78A 2CKRA 3KOFA 4E4PA 1TZ9A 4CEUC 4WJ8A 2XGIA 5EL1A 4P8VA 3WQ5A 3TTSA 4IIGA 1AQMA 3NR0A 5LNUA 2J24A 3N13A 4GX9A 5K9DA 1UZHA 2ZUSA 3HOJA 4GJIA 4A22A 3N18A 1SZGA 3PK7A 4JFSA 1B1YA 3MZ2A 3UR7A 1TWZA 2YPIA 4WCJA 3RCMA 5HQEA 2XN2A 3N2MA 3SO7A 3PUEA 4QRNA 3WF0A 1Q4NX 1V8EA 2RH9A 3M0ZA 3RLHA 3RMEA 1KGWA 1EBGA 3H4GA 2B0MA 3VIFA 3O6AA 3RGTA 1T96A 4M81A 4Y8EA 2CLHA 2HSAA 2V9DA 3HQPA 5FF3A 3IJ7A 4HMDA 1UROA 3BW4A 1KFBA 2FKPA 4W5UA 3JVAA 5C71A 1VZWA 4RNHA 3PBVA 3BK0A 3TONA 2IKJA 5G2HA 1XLFA 4I5RA 4V1XA 4MLJA 5H2ZA 1TVNA 3VNKA 7REQA 4LF2A 1FFRA 4V2XA 1RCXB 4Y9AA 1UD2A 3L21A 2BMBA 4H9TA 3EGJA 3SUUA 5I3FA 3F2CA 1CENA 4IM4A 5C7VA 2ZX8A 1IIGA 2GOUA 4LY8A 2DIKA 5CZJA 2G3NA 3P61A 1P1XA 4IXXA 2GOKA 3ONCA 4GZEA 4KWUA 2GSJA 1Z44A 3LYEA 1OVDA 4AVNA 4DO5A 2HNEA 4PMVA 1M9HA 4GCXA 3SGGA 4HA4A 1SJBA 2VDIA 1JPMA 1H7NA 3G3MA 3W86A 3LBCA 1E72M 1KXHA 1PX8A 4XSLA 1BSLA 3DHFA 2IPFA 3CUXA 1FWBC 5F2GA 3STFA 1TV3A 3EWBX 3G1SA 2C1HA 1H09A 3W22A 3Q2DA 1IGSA 1R3QA 3SCVA 2OEMA 1QW9A 3WEMA 1LYXA 3LCGA 1DEDA 2DZXA 1W9UA 2FLIA 4MPKA 5AC8A 4NT0A 5I2UA 3NZRA 2HBXA 2WZMA 3VKJA 2OT1A 4AZCA 4Q4QA 2ASHA 2GWNA 3SBFA 3CAQA 2OG9A 3LBOA 3Q4DA 2AAAA 3ZM8A 4HNLA 1UC5A 1U5VA 1NVMA 4IQJA 4ORIA 1GCYA 3ARZA 4JHMA 2ANUA 4UTUA 1SMDA 3FHQA 1M68A 1GEHA 5G5IA 3WQCA 4C6IA 4Q22A 2CHRA 1UD8A 3LPOA 4ZZ9A 1UW9A 1YLVA 3BICA 3GW0A 2E4TA 2XHYA 1Q13A 4X60A 3JUGA 2ZXQA 2VGFA 5BW6A 2QDGA 1ME9A 3HTWA 4NNBA 7REQB 4ZO8A 5AVNA 3OODA 5BNKA 4FSAA 1XRVA 3GBDA 1OGBA 1HVQA 4ES4A 2OOGA 3IV8A 5A2BA 4C6JA 1GPFA 2R1MA 3RJXA 2QAPA 3BUVA 4H7CA 4KGJA 3CYVA 2PE4A 2X2YA 1UP3A 3VOIA 2VKZG 5HQLA 2YA2A 4L4PA 1M03A 2FZNA 1OYAA 4L4LA 5E9XA 3MBDA 2VXNA 3G2GA 1H61A 4M51A 2OFJA 1EA9C 4D9PA 3EWXA 3VFLA 3PG9A 2PZNA 4WY0A 4WX2A 4I7WA 1J0HA 1OK6A 2X16A 1TWDA 4H9XA 4M19A 4YTUA 5CC5A 4DVOA 1GVEA 1KM1A 1WO2A 3M46A 2PLCA 5ABFA 2VOMA 4JR5A 4Q32A 2G8ZA 3S1XA 3K8MA 4GUJA 1Z48A 4Q8PA 3LCFA 4ERGA 4KFPA 3U6WA 4RW5A 4AZCB 1IEVA 2IPGA 1UD6A 4K1WA 4XAGA 3RNDA 3HQNA 3QV6A 5A6LA 4CQ8A 2X1TA 2CZFA 1OCQA 3E0IA 3OP2A 3QQ0A 1CX9A 2ADAA 1WB0A 1XH2A 4L7ZA 2QYGA 1JZ8A 2JIWA 4FLSA 5AC4A 1WP6A 1OC5A 1G67A 2JIEA 4UFHA 3BV7A 3MKCA 4XV0A 4O4WA 3BSHA 4L64A 3WJSA 3GY1A 2VFGA 1EX5A 4DJFA 1QW7A 3MYOA 3SFKA 8TIMA 4KFNA 5HMSA 1H1NA 1JPDX 1TV7A 1RP9A 1GUVA 4D6CA 4CU7A 1UPMB 5I79A 2RDXA 3WLMA 1SR9A 1GPWA 2PTWA 1X38A 2V8ZA 3DG6A 4Q8UA 4RK8A 1X7FA 2ZC8A 3WDPP 5F4SA 2IQDA 1KXQA 5LIWX 2C6QA 3FVMA 2WPBA 4ZQOA 3G8EA 1GKPA 3E9AA 2ATSA 2BS9A 3BAXA 1EHAA 2Y89A 1E9LA 1SO5A 1WYIA 4YWIA 2NQ9A 1H62A 3KEHA 3O63A 4WY0B 2OWXA 1YXDA 4C6LA 4RXFA 5FJTA 2NX1A 2GK1A 1U33A 1Q6RA 2EKCA 4FB7A 5SWUA 2PWUA 1JFHA 1NDYA 2W92A 3VKAA 2V2DA 1ONXA 2DSVA 1E0XA 3AYSA 3LQGA 4XSMA 5ABFB 4TXEA 4C6PA 2IMRA 3CMGA 4K7YA 2BVTA 4LSBA 4D8ZA 4GBUA 5F1UA 1TVPA 3EX3A 3PANA 2C0AA 1TMLA 1XYMA 4IP4A 4GACA 4Q7NA 3HV9A 5FJIA 3SUVA 5CGMA 1ZJHA 2WNQA 3LCIA 5A8GA 3PM6A 1E1FA 1TO3A 2Z1SA 2QIIA 5BMWA 4J5NA 3TFCA 1P6WA 3SQSA 4DUWA 4I3GA 4K8GA 2VOTA 4E2BA 1OCNA 4QAWA 2Y24A 3AMGA 4H8HA 4GQBA 4X0NA 4MNJA 4ONVA 4KCWA 3B3DA 5C7HA 1NWSA 4E4UA 2J13A 4Z08A 5I3KA 3ZWTA 3NQMA 5C2GA 4F0RA 4DJFD 1C8QA 2V3DA 4P7QA 1FHUA 4XD3A 4MJMA 8RUCA 1UUMA 1UR9A 2V69A 1H0GA 2PDBA 3KVLA 3IRSA 1JYVA 3HV8A 3FAXA 3WQWA 5D03A 3N9SA 2P53A 3GHTA 3QQWA 4GJJA 4QS6A 5I03A 1XKYA 1Z41A 1XLKA 3IJ9A 3GNOA 1O5XA 5DY2A 1UR0A 1WA3A 2B31A 1QI2A 1MW3A 3P0WA 2BY0A 1B31A 1XKJA 1O66A 2G50A 2GVLA 3R7MA 2GLKA 2GQ9A 1L6WA 4NYYA 4N9EA 3VCNA 2XH2A 1MFUA 4Q8QA 4D6EA 1WQ5A 3DBNA 4BQ3A 3NG3A 2GK1B 3W4RA 2FGLA 3TU9A 1ZALA 4G7FA 4M80A 1TYGA 4Z2LA 2Z2AA 3H2AA 1N55A 1WKFA 4OT7A 4LANA 3FOKA 3WL1A 1VFOA 1EUNA 3RHGA 1BHGA 1AUSL 3NURA 1YIXA 2WMIA 2ZWZA 3XINA 3HPZA 1XIGA 3BLIA 4JIPA 3TSBA 5EU9A 1D8WA 1MYRA 2J62A 3PB0A 4WDXA 3W7OA 4ML9A 2VX4A 3MUCA 5GQBA 3AXXA 3MI3A 1FUYA 3SN1A 3TA9A 2A7RA 4A3HA 5F4XA 1JF6A 4XTDA 2EPNA 3P80A 4F0KA 1X98A 2R8WA 3Q37A 4B4FA 5FF0A 1UBSA 5CPTA 2VC7A 1QHZA 1ZNNA 2IQ0A 3S42A 2XVGA 1BKHA 3L12A 2QCMA 4CN6A 1GVQA 3WNNA 3Q94A 2ZZ2A 4NNAA 2C79A 3HIJA 3ZT7A 4LRTA 1LORA 2YKKA 5CJNA 4RR4A 5BU6A 4IGSA 4Y9MA 1TMHA 3UNTA 4DWDA 1NM9A 1XM3A 2XFFA 3BCFA 3VOJA 3SJNA 2R14A 4RV3A 3NYDA 2ZUNA 2VX7A 4O57A 3AIEA 3JZUA 4HZMA 2GFTA 1K3UA 4Y2WA 3AIUA 4Q6JA 2GJXA 3LPGA 3T55A 3N9RA 1CW2A 2ZKMX 2E77A 3W87A 2J7HA 1QNOA 4IZGA 2QJJA 2V68A 1DYSA 3SDOA 2NQ5A 1DIOA 4QBXA 1VB9A 1GZJA 1TWSA 3MT1A 3WH5A 2WMIB 5U7SA 2PDYA 1DJZA 3IVSA 5DMYA 3M41A 5JU6A 1PX3A 4TMCA 2GJNA 3L4VA 2PDHA 3NPWA 1TR9A 2QPXA 3I4EA 3L2MA 2PDJA 4OJYA 3TJIA 3EXSA 4NZ3A 3HA1A 3KOWA 3SIZA 4DXVA 1EL3A 2WMKA 2CESA 4EAMA 1PTGA 1TPFA 1JDCA 3ARQA 3T09A 4JQAA 1ZQ5A 1SW3A 4C6OA 3TTYA 2Y5JA 2XVPA 1QNRA 3NL6A 1WNOA 4C6NA 4HHPA 2VR5A 2DT2A 3WDHA 5I06A 1GVYA 1VEOA 3FJNA 5EMUA 5IXEA 4L1XA 3VKKA 4FMVA 3BANA 5DF0A 4MKVA 1LTDA 4INFA 1ONEA 3W6YA 4Z2GA 3EWWA 1XYZA 4Y9OA 4V33A 1L6YA 1PB0A 5I3IA 1QDSA 1LOSA 3LZ3A 3S2NA 3MWCA 3TQKA 2ZE0A 1KFEA 3W01A 4Q7IA 4AVOA 3MHGA 2Z2BA 3W7DA 3VNZA 1OCJA 2GJXB 2I16A 1Q7QA 3VMOA 2F61A 4E8DA 2CITA 5HR6A 4RE0A 2XVLA 1Q6LA 4YTTA 5G4HC 1NELA 2Q8ZA 2YIHA 3GG8A 1KWGA 3M5VA 1RXOB 1O94A 4C90A 2XGBA 5HBFA 1JZ5A 3MP4A 3QY8A 5G4WA 3SJ3A 3FLUA 4S3GA 2XWDA 2UZ9A 2ZOXA 3ARVA 3DBPA 1FWWA 3CQHA 3GE7A 3F1QA 3N2XA 3SRDA 3GS6A 2H8XA 4HA3A 1F8IA 4E2VA 3LY0A 3O0FA 4GRSA 3L23A 2BXVA 4D2JA 5J5DA 5K7JA 2Y6ZA 1WZLA 5CAHA 5KMYA 3RX3A 5EBUA 2ISFA 4KCTA 1ZL1A 1SM9A 2J27A 4QE4A 5FJPA 1C92A 3V1PA 1H1ZA 3DI1A 2J7FA 5EMJA 3TYUA 3W1NA 4WUIA 3A24A 2ISVA 3HU7A 2Y70A 5I5RA 3FNDA 3N73A 2VDHA 4XAYA 3EOOA 1VPXA 4PSPA 5L6UA 4HMEA 3WD3A 3RAOA 4FXRA 4MAVA 5FJUA 2VVSA 4K68A 4IG2A 5T91A 4H8VA 1OIFA 3DGRA 4K39A 5BOOA 1JQVA 5JXQA 1YHTA 4KRZA 3T2OA 3L67A 4IQLA 3W7JA 1OC7A 4FNPA 3QPZA 5HPOA 4UMCA 3VIHA 5IDZA 2HPIA 3WX7A 3KHJA 1V3KA 5HNTA 1VBUA 3EA1A 1T41A 4HHHA 3SR7A 3GC2A 1DIEA 1WOBA 3REQA 3EX4A 3HPAA 3EB4A 5LXXA 3E0LA 3EDDA 3W38A 3UU0A 3A4AA 3SCWA 1R7AA 1GK8A 4MAZA 5D2XA 4QISA 3UCDA 1MVYA 2WWDA 3IJ8A 5I24A 3W1AA 3GUGA 4U4MA 1CGXA 2G96A 1OD8A 3OEXA 3O2LA 2XGZA 1FWHC 1OM0A 3CB8A 3UWYA 3AHXA 3PVFA 4XIMA 3IJDA 3NDZA 1JUEA 3VNYA 4NRRA 5C9UA 5CZTA 3TSMA 1DWAM 4MJ2A 5C9XA 3MS8A 1FX6A 4L9YA 2DZPA 3EX2A 2FH6A 1C7TA 2E6DA 3P62A 3G0XA 1F07A 3GAYA 2J6XA 3W00A 4IPPA 5CC3A 5AZ0A 4TTUA 1TCMA 3W28A 1KBLA 2HNHA 5FEPA 2G4FA 5IDIA 4K2SA 2ZTJA 5H8UA 3W70A 3FS2A 4IG2B 4IL2A 3LK6A 3FIGA 2QR6A 3EOLA 3QV8A 1O1ZA 1WBHA 2UY3A 3NWRA 1EPXA 3HJZA 1V93A 1LOQA 5AOUA 2YDRA 4F0SA 4UC5A 3WLIA 3W0KA 5HJLA 3NQCA 1K7XA 4JTKA 3OBAA 1PIGA 5JH2A 3DESA 2PWDA 4XAPA 3REQB 4RX0A 5A6BA 3PUGA 1QPNA 2HPMA 4P8WA 1F6YA 4GO8A 3D46A 3U5YA 2Y7EA 3JR2A 4I9AA 3GBEA 6ENLA 1SZEA 2PD9A 5LYRA 3MTWA 3LHUA 3UBPC 3SCRA 2GQAA 3THDA 1XDMA 1J93A 4L9ZA 3QY6A 5D04C 2ACRA 2EQDA 3WENA 2PDKA 3D3AA 4AHPA 3EMZA 3C0QA 1HL9A 5EBAA 2BX7A 1XC4A 2PZ0A 1F3XA 1PKMA 3SSJA 1I60A 2V63A 3EB3A 4WGXA 4ADSA 1VEPA 1FH7A 2HS6A 1B3WA 5F1VA 1WXYA 1TJ2A 5IBXC 2RUSA 4LVFA 3EWYA 4GVIA 5CJMA 3LSCA 4D71A 1KM2A 3ITGA 5BRBA 2OWWA 3S47A 3MVTA 4MFEA 1UQZA 2VNCA 4JS3A 4HNUA 4RZ5A 4ZXOA 4GYPA 1U1HA 4BA0A 1QI5A 5I07A 4I8DA 2HVMA 4KIEA 3ZT5A 1HKKA 4WQ6A 3V7PA 2DT1A 2WW5A 3OIHA 1GOMA 2WB5A 2PEVA 3V0UA 4BQ5A 4O0KA 4IP5A 1VRXA 3VKBA 1Q7ZA 2QJMA 3BLDA 5HUPA 1IYXA 3NM1A 4A21A 3T4WA 1KCLA 3CHDA 2JKPA 1V03A 3ZO9A 4IIHA 3O1NA 5DY3A 5CZSA 3KRZA 5A6BD 4OZOA 4FK9A 4PMJA 3S9ZA 4FOJA 5MHBA 3P84A 3ALGA 2P10A 1HL2A 3N2OA 5A6MA 1TJ1A 4QJ5B 4A6GA 2BODX 1NP2A 1G4PA 3P67A 3H70A 1S5WA 2O4MA 1C7SA 3CIXA 2Y63A 4GCAA 1QNPA 4XB3A 1ITCA 1DPMA 3LU2A 2ZZ7A 2Z27A 3KW3A 2A3CA 2PRLA 3UVAA 4H7ZA 1NY1A 3AYVA 1Q85A 4MZ1A 5EFDA 3TN4A 1IWBA 2TSYA 2AAMA 4Z1AA 1P48A 1HFBA 1GQIA 5A8QA 4KEVA 1XQKA 3LNPA 1Q8JA 2FDSA 3KBWA 1MWOA 3BURA 5HNUA 3KP1A 2DU2A 1CLKA 1FWDC 4LV9A 3TW9A 4JKLA 3ZWSA 4IIBA 4PMYA 3U5UA 3OGVA 1US2A 3RN6A 2E3ZA 1M5WA 1TPWA 1OX5A 3E1F1 3KVMA 2E9LA 4GI4A 2PWVA 1NFPA 3E38A 3WUGA 3GLCA 4XD4A 1P0KA 4R7OA 3K1GA 1ISWA 4JIEA 1OFQA 4EPBC 3R0DA 6A3HA 2PRMA 1EQCA 2ACQA 3W7NA 3H21A 1UMYA 5AKQA 3HMCA 1TG7A 4IUOA 1XBYA 2E09A 4FNQA 1WOAA 4A3YA 1ZZMA 1UH4A 4S3BA 1VYSX 4TX8A 1RCQA 2I17A 4R27A 1E0VA 1R5YA 2YCLA 2ACUA 2ZX6A 3WDIA 2Y4SA 3NOEA 3AS0A 4RJEA 5AHFA 3OIXA 4XBKA 1EBHA 5CEWA 3S1UA 3MYPA 3RFAA 3RCNA 1E6SM 3WLJA 2PGEA 3ORWA 3SFWA 4UFLA 1LWJA 3A3XA 1R2TA 1Y7VA 4H9ZA 2WYSA 3RO6A 5IHRA 5DQPA 4MM1A 2ZZ5A 1H4PA 2XZ7A 1Y0EA 2QMJA 3W2NA 1B3VA 1IF2A 4C7FA 1RQBA 4S3DA 5BOFA 1AVAA 3JS3A 1XDLA 2UY2A 2XIQA 3GXTA 4IPIA 8CGTA 2OSYA 3WJZA 1UD4A 4AZBA 1RK5A 2OELA 4F2TA 3DCPA 1I2OA 4NAFA 3MANA 3KZSA 4DI9A 2L5HA 1M6JA 1BG9A 3VU2A 3WKZA 5IFTA 3UJ2A 4HK6A 1KCXA 3RPMA 1E55A 2DZSA 3N3TA 1G94A 1PZ2A 3DDMA 3PWGA 4R9OA 2NUXA 1EC8A 3WEZA 3N4FA 2OZ3A 3WG6A 2J88A 3HFTA 3VOFA 4XKYA 2G0WA 1F3WA 3EYPA 1IEIA 4S2CA 1BXBA 4NIRA 4BQ2A 3B8DA 4JKKA 1DVJA 3GVRA 3BJSA 1IXOA 1KFLA 2PWFA 2YCLB 5KINA 4HCHA 3C61A 4U5IA 2RHGA 4H7VA 4M5PA 4XZMX 3IPWA 5AHIA 1DJGA 4H6QA 3FV9A 1JAKA 1XWYA 1N2VA 4GYJA 4LTSA 1JQXA 3SY8A 3SADA 2P76A 1JXKA 2OQLA 3UR8A 4LV4A 2XSBA 3M5YA 1K8ZA 4Y6GA 1RD6A 1PX4A 1NWRA 3ZZ1A 3F5LA 4EPKA 3HG5A 3INPA 3VK5A 2W66A 5TIMA 4YS1A 1UZ1A 5JBEA 2J77A 4HPXA 1GVFA 1BSIA 3I6EA 4UCGA 3ZJKA 1EYWA 1FP8A 3NQFA 1KFJA 4YXGA 1Z8AA 3AO0A 3KBMA 3CH9A 1BQGA 1M7XA 2FGZA 3FK4A 4HGXA 1LLWA 3GSMA 1JPHA 1WDRA 4PUKA 1G7VA 2ZRXA 2PTXA 1CI1A 4NAFB 1K4HA 3IK2A 5A2CA 3UJFA 1LQ0A 4F4RA 3VE9A 4B92A 1KLZA 4GPNA 2CLLA 2E0PA 3TAKA 4AWSA 4J1OA 4UZSA 1PZ1A 1LG2A 3W74A 4J3VA 2X0HA 5C70A 4E8CA 4RDZA 1R3YA 3WJXA 1EDGA 2E8ZA 1IEXA 2YA0A 1DOSA 1EUAA 4B5SA 3I3DA 3CQKA 1LL4A 3UT0A 2ZUWA 3FX4A 1MXGA 2GGHA 4AXKA 4XKYB 4O1FA 1QNVA 1UH2A 3QMRA 1B0IA 3QZAA 2CXEA 2MUCA 2ZZ4A 3NCOA 1EJUC 1RJQA 2JEPA 3HFYA 2Z24A 4U31A 2IKGA 3EWDA 4W5ZA 2I5QA 3HN3A 4JNMA 1W3HA 1W91A 4JZ5A 3BXWA 3SIMA 1VLIA 2VTFA 4GNVA 4J3UA 4FHAA 2O9TA 4A3UA 3GWQA 3C2EA 1PKLA 4IIDA 3PNZA 4GKLA 3R1ZA 1TPC1 1Q2SA 4AD5A 4HK7A 1C29A 3ZR5A 4D1IA 3E2RA 3LENA 4JPGA 3M16A 2GJLA 2POTA 3NQVA 4K36A 1DP0A 5A8MA 4CLMA 4OGZA 1VCFA 1KNWA 4BI6A 2FTYA 4KWWA 2CZVA 3THAA 2HXTA 5HMEA 2CPUA 3N12A 3NA8A 3SCQA 1RZMA 4C91A 2DPEA 1TRDA 3WLKX 3LD5A 3BAWA 4QLKA 4H9VA 1NOUA 3W76A 1W1B1 1YPXA 3UXLA 2QJHA 3CZGA 1KKOA 2PU1A 4A29A 5JMUA 2DH2A 1XLGA 2WAGA 3VO0A 1FRBA 3IVTA 2PLKA 1JI2A 1J11A 4OBTA 1ALDA 2PWHA 5CPSA 3SCNA 2ABBA 1IHIA 3AZRA 3LXAA 4PB5A 3QPEA 1YKWA 5T8GA 2P0OA 1P0BA 3UEQA 5ECUA 1SJCA 1KFKA 4OHQA 1XIHA 3V5FA 1M7JA 1P0EA 1XL9A 3W1QA 4BKNA 2I7GA 1EF2A 3ZFHA 2BBFA 2DW7A 1R9XA 1G6CA 5KZDA 5A8PA 4P2VA 1AH4A 1NAL1 5E0FA 1Z32X 1UWRA 1H3GA 3S6DA 4HK5A 4RV8A 4AVFA 4IGHA 1E0TA 4WY0F 3O6CA 4LBSA 1KGXA 3L4TA 4XZ9A 2CETA 1OD0A 2OO6A 3LTSA 5F2MA 4B16A 4CN1A 4ZMGA 3C2RA 4O19A 3ARWA 2VDGA 3U4FA 5GJPA 4UQCA 1SGJA 2C14A 1MXDA 4C1LA 2G97A 3IAPA 1TWIA 1K7FA 4I7VA 3WBAA 4JDYA 3TYCA 1FBAA 3POHA 1FWCC 2GGJA 2VI0A 3AMKA 2GJRA 3LEPA 4MY1A 2IXVA 2INFA 1RA0A 3V35A 1VEMA 4RPPA 4A35A 1RJPA 4AZHA 3C2YA 3PWAA 1VAHA 5D30A 5LKYA 1SO3A 2XDFA 1L8PA 1E6PA 5CGTA 1E56A 1GZGA 2WZIA 1RVKA 5HMDA 3KVJA 3LM7A 3CNYA 3R58A 3WQ8A 2W27A 3M0VA 3SQLA 3GR4A 3S6OA 4WEVX 5I3HA 1SZNA 2WM0A 3TYAA 3TK7A 2VD8A 4UNLA 1PE1A 5E6ZA 5KZMA 2CLKA 3GO2A 5CC6A 1EXPA 5H91A 1EO7A 1MO0A 3WCZA 4D6IA 4F2BA 2DORA 1F05A 1UBPC 4XZLX 2H8ZA 2P0IA 4FX7A 5F4WA 3GYCA 3AXKA 5FIPA 3N11A 2CFFA 2ZTKA 4C6EA 1V6VA 4M82A 3QKEA 2BVWA 2F84A 4W8LA 3FYYA 1X96A 3T2QA 4EWJA 3AWNA 4N42A 1TPB1 4MB5A 2WJDA 5A94A 1XHGA 4K8HA 2EPLX 2HBVA 2WKLA 3T0AA 2WSPA 1FHVA 1VIWA 2E25A 4Q4RA 4RNJA 2PFHA 1FWSA 2OZTA 2XYLA 4GBDA 1RVGA 2WKGA 3CB3A 4UR8A 4R7JA 2D2GA 4IGMA 3KS5A 4AISA 1UR4A 4KW2A 2QNEA 1WDQA 3RPDA 3PF3A 1JVNA 1C90A 1X8FA 1TA3A 4JTAA 1OY0A 4UTWC 3GFYA 9XIAA 3EX6A 3VNJA 1UJPA 5I02A 1TPEA 2PF0A 2QHAA 4QG9A 1NJJA 3G1DA 3N6HA 3DG7A 3OGSA 4K3ZA 1UP0A 3CZLA 2WNWA 1A3XA 4GH1A 2OEJA 2Y5EA 3TE9A 3TW7A 1DJYA 3EPMA 5J8LA 4GIAA 4JTSA 1YMYA 3LHTA 3GFXA 3M64A 1RD5A 3OA3A 2W62A 3FY1A 3WF4A 2VFFA 4FO4A 3V75A 4HOXA 3W1MA 3W7IA 5C0QA 3DENA 5DN1A 1OINA 3I10A 2Y62A 4KWOA 1GYNA 1UWSA 3W6LA 7CGTA 3S1GA 1GOXA 5A6KA 5DCDA 3LDVA 3WDRA 1KXTA 2OX4A 1L6SA 3SUSA 4HSOA 2Y8UA 1DQWA 3WMBA 1JULA 4YVXA 5D33A 2A7NA 3WUEA 4UQEA 1CXLA 3IJIA 4Q4KA 4TU1A 5FF2A 3IS4A 4B9ZA 4F0LA 1MEHA 1M53A 1BWLA 3QC0A 4EACA 4N4QA 3W1XA 2AGTA 3OHIA 1YXCA 3N6JA 3N04A 3WLOA 1EX1A 3NYZA 3DC8A 1I9CB 2H3BA 3A4XA 2WC4A 5CLTA 4HN8A 2OR2A 3I4KA 3U3HA 5A5WA 4YTQA 1I2RA 4B3LA 6PTDA 1V3LA 4I90A 1QPOA 1EJSC 3SCUA 4J28A 1HJXA 1TA3B 1MQPA 3CQJA 3WNMA 3MJMA 4R3UA 3EDEA 4JIQA 5K4ZA 3BMWA 5FAGA 4EF8A 2G5WA 3TLLA 3VYLA 1AD4A 3S0CA 2EPOA 1ZRQA 2I14A 2YYTA 1FFQA 1SR0A 3MCMA 3TTQA 1HVXA 1TX0A 3QC3A 3W7PA 1L2UA 1OEPA 4ROQA 4Z17A 5BCAA 1J0YA 2J9YA 1MNSA 2WO5A 1QPRA 3H54A 4AC1X 4NZ1A 2DVTA 1DWGM 1RBAA 3R8GA 1FWIC 3S9IA 2DUAA 4A8LA 1AH3A 4ZSUA 3URQA 4DRSA 5FL0A 5EPDA 2A3LA 4PTDA 2E6AA 2INZA 1PKNA 1NFBA 3IIZA 3MC5A 2XH0A 1OWQA 3PPHA 1XUZA 1WUFA 2KZHA 1OBAA 1W9BM 2ESCA 1UCWA 1REQA 3CQIA 3E3HA 2NSXA 3GIQA 3VIJA 3RYSA 1TSIA 4LC6A 1QO2A 3DFTA 1NWUA 5CZ0A 4EAYA 2CEQA 3E2VA 4N9CA 2X2GA 4HMCA 5D4YA 1GWJA 2PRHA 3GIYA 4PULA 3LERA 5IBXA 1GJWA 1QBAA 3UW6A 4C5YA 2WNNA 4EX4A 3EOSA 1XSJA 4M29A 3AAMA 1TJPA 2E9BA 3RM4A 2CZ5A 3VKDA 3LN3A 1JG9A 4DF2A 1XLEA 4HMNA 4B15A 1FCVA 3WZ0E 1Q2RA 3QGKC 3BJFA 2RJGA 4ZOCA 1HF6A 2NUYA 1KD0A 4MZYA 2Q8XA 1H49A 5JBDA 4FA3A 4UTKA 2ZUTA 4HD5A 2YB1A 1CGTA 1PWMA 3JRKA 3EB2A 3LQLA 1V0NA 3PN8A 4NNCA 1GVRA 1Q66A 2WZEA 4JCLA 3IVUA 2G3MA 5HQMA 4DAFA 1QNQA 3AWOA 5HNNA 2VFIA 3V5CA 2BY2A 4GO9A 4EP8C 2PSNA 3TX9A 3V1HA 4GQRA 3FVDA 1HO1A 1GHRA 3L4WA 3DU0A 4CU6A 2PDXA 1Q63A 3BSMA 1US3A 4GUFA 3KWXA 1QPKA 1EOMA 3CXOA 2VZOA 4JX5A 3PFRA 4KWVA 3LLFA 3K46A 1QASA 1QAPA 2NSOA 4MWAC 1VHCA 1PDYA 2D0GA 2YDAA 4Q8TA 3IGHX 3CLMA 1ISXA 1VPQA 3C86A 1REQB 4TX9A 1B90A 4H4IA 1JZ2A 3F7JA 1FKXA 3S5OA 1FKWA 4HYWA 3EBVA 1QW8A 3W29A 3PZTA 3SY5A 3QV7A 1HJQA 2VFHA 3MZNA 3C3NA 4MADA 1EDTA 4GIYA 1CIUA 3WLNA 2JBMA 1NTHA 1PKYA 2GPTA 1PZ3A 3F4WA 3FA3A 4OOUA 1F61A 3PJXA 2CWNA 2F9RA 1EHNA 4JQ2A 1CXEA 3B9OA 2VYOA 3OVQA 3OLGA 4DX3A 3MWAA 3B8TA 3M7SA 4TVCA 3R4IA 4TX6A 3H4XA 1BWKA 2GUBA 4QG6A 4BI5A 3E2SA 3OVPA 2BVDA 1JEZA 3WELA 1TE6A 3G0SA 3THQA 5A8OA 5K9CA 3TN3A 4X61A 5A6TC 2PAJA 1XIJA 3B04A 3AIWA 3MP5A 1YE6A 3W81A 1WKYA 1R3SA 4PCTA 1OZQA 3ERPA 3VPLA 2DIEA 3LSBA 4N6EA 3PBMA 1FTXA 3LTPA 1XXXA 4DM2A 1I2PA 4TQTA 3ABSA 1HXJA 2OPJA 4M1BA 4XZHA 2OLHA 3NDYA 4HTBA 1MZRA 2GDUA 5CPNA 3GG0A 4QX4A 3TYBA 3LX9A 3VIIA 4ZB0A 4BY3A 1RP8A 1VCGA 1KBKA 3AS2A 3CIVA 1VF8A 1EZ2A 1G69A 1KCZA 4KRTA 3F5KA 4HZ6A 4JTRA 1XP3A 1ZLPA 2Z6IA 5B7YA 1ICPA 3LCHA 2BWGA 4CQBA 4XUGA 2ZRUA 1A5UA 4CNTA 1ENUA 1X7IA 4PTXA 3WLPA 4O10A 2OYMA 1W5PA 4MJZA 1ZENA 2WHJA 2C18A 4PUDA 3M0HA 4QEEA 3QJAA 3SURA 4C6KA 3ZVIA 4K37A 4UFKA 2P3ZA 5E9AA 2PP3A 5HDRA 1LF1A 2F6XA 1UR8A 2D2OA 4CN4A 2BVYA 4ZL1A 2EPMX 3EMCA 4DZIA 5K4XA 1W1ZA 2W4XA 3RK8A 4IX0A 1OFDA 4NG3A 3P74A 4N2YA 3TOYA 3WQDA 3DN5A 3LRLA 3LHVA 1MW0A 3PBGA 3G1YA 2NVAA 1GOKA 3VIGA 2EJ1A 3VX0A 2H6RA 3AUJA 2AQWA 1K03A 1UWUA 3M6YA 3H4WA 5G2IA 4X22A 4F66A 3S3GA 1OX4A 3VNDA 2PWEA 3H55A 2HS8A 3WSUA 3AICA 1HP4A 2OB3A 3ARSA 1O95A 3W7GA 4DM1A 6XIAA 3TQPA 2X0SA 2D1ZA 1BYBA 1S3TC 5HPCA 3FA4A 5EMYA 2CLMA 2LLEA 2VZTA 5FA5A 1WZMA 3GIPA 1N8WA 4HBKA 4ORMA 5BXTA 4AG0A 1E5JA 4FALA 3CWNA 2X1IA 3HMJG 4NJJA 3WL0A 2BNJA 3UXIA 3G77A 4FX8A 3AIVA 2GSHA 2JK2A 1V77A 2I5IA 5AYIA 4WHBA 4Z1CA 1HP5A 2WBKA 1SVDA 4QIUA 2JALA 4JN7A 3AIQA 2ISDA 1K4GA 2PDPA 3D47A 1AQHA 1RUSA 2J47A 4PL2A 3C5QA 1VFLA 1GQKA 2FZBA 1E40A 1OF8A 2PWGA 2P8BA 3FJLA 3VOCA 2EG8A 1N7KA 3WK0A 1AMYA 3GB6A 4PMXA 5HR7A 2VMFA 1W1IE 3PP7A 2FPVA 3PZIA 5DLCA 1ZFJA 2NV1A 3L0GA 2B7NA 2D22A 4TR9A 2R82A 4WJXA 1B9ZA 3R8HA 1OGSA 4JFVA 1OX4B 4UCFA 4IICA 2E6YA 4CQAA 5CLWA 2OKOA 3C8NA 1ZBKA 2IUZA 1LRTA 1XRSA 4UR7A 1PIIA 5D2YA 1V3MA 2QCGA 2YCIX 1V6WA 3KS6A 1QK2A 3ARXA 5G1MA 3VILA 3V5OA 5HOSA 3RILA 5K2ZA 1U1UA 3F5JA 4LOCA 1E3ZA 4HHMA 8XIAA 1Z7AA 4M3PA 4QQUA 1GOQA 1PIFA 2B7PA 1P43A 2NLIA 4REQA 4TO8A 4D1JA 5D9PA 4H41A 3CZJA 1IGWA 4PUUA 1HT6A 5M03A 3ITOA 4Q8WA 3K8KA 3LLDA 4ICCX 4XVEA 3H53A 2YCJA 3UQNA 2OWCA 1W32A 2HK0A 4O1EA 2WCGA 4R33A 3A22A 1W5QA 3BDKA 1AH0A 3AXHA 3CEPA 4GVFA 3GZ3A 2OSWA 1FQ0A 1BRLA 1BEUA 4LT9A 4JQ4A 3NZPA 3K13A 2XVKA 3VC5A 3B8SA 3KL0A 4O4VA 3E0WA 3RMJA 1ZY9A 1H7XA 3WEOA 4ZQRA 3UA3A 1BXNA 2WSKA 1OG6A 4UWMA 3MW7A 1LRNA 3VM7A 3S2CA 1CECA 3VIKA 2Y8VA 3P5YA 4ZQPA 3FHAA 1UD5A 2FMNA 4LAOA 2XINA 2WC3A 3PG8A 4IL0A 1EWDA 4HP5A 3MHFA 4V28A 4PRRA 1KM4A 2W61A 3I6TA 3WF2A 2B81A 1R9YA 3T0CA 3UJEA 4W88A 3UESA 3W72A 1O68A 2Y1HA 3T44A 2ZZ6A 1JFXA 2QGHA 3U2CA 2GUYA 3ZXWA 2E8YA 1W1PA 4HU4A 4QQ3A 1C8YA 2Z4GA 1JR1A 3FAWA 3C3UA 4ATDA 3KTSA 2OLSA 5F7UA 4IHCA 3ZOAA 1I8JA 1V6TA 1W3TA 1AD1A 3LUTA 3RU8X 3POCA 3TUUA 4HNTA 2Z7GA 1EXBA 2G3JA 4FAMA 3T7VA 1SW0A 4REQB 1CZ1A 2E5CA 3ITTA 1BLIA 3ARTA 1I45A 3O06A 1PZ0A 4E4FA 1M01A 2GVGA 4JDBA 2XVNA 1LT8A 4Y9PA 1FDJA 1ECEA 1RY0A 3W53A 2CLEA 2C3ZA 4GZJA 4IUGA 1HJVA 4YN5A 1AK5A 3GZAA 4WJEA 1H51A 1BRLB 5H1WA 1K9DA 2CIPA 4AEEA 4IPJA 4DF1A 4GC3A 1XG4A 3ZYZA 4DZ5A 1FDZA 1XQLA 1YBQA 2DP3A 1QPQA 3ARUA 1ADDA 3BARA 3C4UA 4KEZA 3WN6A 4U3CA 3AS3A 4W7WA 3OQ8A 3OW1A 4JTTA 2P50A 3UJRA 4ZO6A 1S2TA 3PZ9A 2BGNE 1LCOA 3VTRA 1GVSA 3BZGA 3N15A 3WLLA 1WZKA 1HJWA 4GINA 3AYTA 2TPSA 2JF6A 3EOUA 2Z1VA 4HJFA 2O0TA 4IISA 1CB7B 1QOQA 3EOEA 7XIMA 3TJXA 2VZVA 1TV8A 2DDXA 1HIZA 2FZDA 9XIMA 1E6RA 6XIMA 4NJHA 3WIJA 4DHGA 3N1AA 1J2BA 1OYCA 2ONEA 1XGDA 1K8XA 3CK5A 1R2RA 3W37A 4X9SA 1M7PA 1X39A 4ACZA 2QUNA 1V08A 3W02A 2CERA 4B5UA 1LQAA 5C6MA 4UTWA 2E9MA 3UGRA 1FOBA 2OQHA 4XO7A 4QCEA 1J96A 3T08A 2VR4A 4QR6A 3O6YX 1PTDA 5LA0A 4AUBA 1E3XA 1JNDA 1W17A 3OHMB 3UWWA 4NQ1A 1RPXA 4XTIA 3VD7A 2ALRA 4CU8A 1PO9A 1V5XA 4FXFA 2OTDA 2XUCA 2Z1WA 2CBJA 4Q33A 4AY7A 3WDQA 1CT5A 1JZ7A 2AMGA 1QCWA 1TJRA 4O1AA 3MV01 1YBQB 2BASA 3G1RA 2O55A 3OOQA 4OBSA 4QCFA 5D9OA 4MHBA 3DYOA 3P93A 1F73A 1E6XM 1JDEA 3W7LA 1XLDA 3LV6A 1PS9A 3V0TA 1FVPA 2HROA 1N8IA 4DEFA 3BSGA 4GXWA 3W2KA 4DJEC 2EBNA 3OU8A 4W7UA 5TF0A 4PTVA 2BV9A 4O15A 3MVIA 3HURA 3ZLHA 4R85A 4MUPA 4GGHA 3H22A 1J6OA 3FSUA 3LGDA 4NSBA 4O8AA 3CPUA 3TROA 2NQHA 1HGWA 3OLIA 2Q6ZA 3MBFA 3LXBA 4IFKA 3UWEA 4ERIA 2HQAA 2PTDA 4OE7A 4DN1A 3B0PA 4ACZB 1H2JA 2G37A 2CLPA 1IXQA 4AEFA 3QR3A 4OV4A 2G3IA 2IXUA 3L5LA 1LQ2A 1ZUAX 2D3LA 2QW5A 2CLFA 4MB4A 1YDOA 1XCXA 1TUFA 3XIMA 4PH6A 1W6TA 1TV4A 3CGTA 4L1WA 1NDWA 3AJXA 3DFOA 3ECQA 3O7UA 2BP1A 4HPJA 3GNPA 1J12A 3SRHA 4MNLA 2NQZA 4YU1A 4I9JA 4XD6A 4QS5A 1THFD 3N19B 3DI0A 4M6QA 3M47A 5EMKA 3MP3A 2PGFA 2GVJA 4CVUA 4O13A 5EMMA 4MDOA 2CLIA 1US0A 1HX0A 1XI3A 4GISA 1CGYA 3H12A 3E49A 1VJSA 3MMDA 3AHTA 3UXDA 2WM1A 1WPCA 3B05A 3VM5A 3W2UA 3TC6A 5JIWA 4O16A 1TZ7A 4AZ7A 1U83A 1OFOA 1KKRA 3N29A 3P81A 2Q01A 2REQB 2PCEA 3W85A 3P5ZA 2IS7A 4O52A 4EWND 1GT8A 2W3ZA 4CNPA 5HMFA 1R46A 5FJRA 3MUZ1 3DIPA 1ISVA 3KRBA 3WQOA 1WUEA 3CZ8A 5LIUX 1VQTA 2VO5A 4IFKB 1UKQA 4DYJA 4R53A 2YB4A 3PBYA 5J04A 4C7DA 3LCWA 1YYAA 3W1LA 1WDDA 3BOLA 4TIMA 1EGZA 1DJXA 5HUOA 4UTJA 2AQOA 2PDIA 4IMCA 4FIRA 4KIRA 4U10A 4GYPC 4PMQA 4WGHA 5GJNA 4BZYA 1DXFA 1B3ZA 3CZEA 1DXEA 1XLIA 4PMOA 4BF7A 5JQ9A 2QEZA 5CH9A 3WF3A 2JKAA 2XIIA 1UR3M 3MDUA 4B90A 3H23A 4MB3A 2QLYA 2WC7A 3MDWA 1H5YA 2ZA2A 4NI3A 3QHOA 2QV4A 4LCSA 3EA3A 3O0KA 3WNOA 1XISA 5G2WA 1EC7A 1D7KA 4P7NA 3QHMA 3VCCA 2GYIA 3G1XA 1QBBA 1UKOA 3MSYA 1LL6A 4MWAA 4O12A 4LGXA 2TODA 1CXHA 3OZMA 1LL7A 2QDHA 3PZGA 3MI6A 1D3GA 3MO4A 3O16A 2BXZA 1TTQA 4DBUA 4DPPA 3EEGA 4H8UA 4NYUA 5AY7A 3S5ZA 3W9ZA 1JI1A 2EG7A 4PGLA 3TYZA 3V16A 3IUIA 1AA1B 3VABA 2CU0A 4AF0A 2RFGA 1YX1A 3MMUA 2FPYA 5FL1A 2VURA 3U48A 1FH8A 3MMWA 2XFRA 3W7CA 3P2VA 1ECQA 1EEPA 2WMGA 3BQ6A 3LOTA 1S1RA 1DE6A 3O15A 2XSXA 2W0UA 4UR9A 2W9MA 2YXOA 4GXMA 4HU0A 1B2YA 4KPLA 1G5AA 2HEJA 2KAUC 1ITQA 3N25A 1XLAA 3BOXA 2POZA 1HJSA 3NOYA 4WVXA 4MNKA 4JTHA 1H50A 2BOGX 5M5DA 3KXQA 1R2SA 4LUYA 2RJHA 2QJNA 3SCPA 4P61A 2DSWA 2OSXA 2CHOA 1WXZA 4GIRA 3KCLA 4HU3A 4S3AA 1GW9A 1LOLA 1KR0A 4O1DA 4FF7A 1K02A 2J9XA 1EH9A 3E96A 2GVYA 1GQNA 4DPQA 4QROA 3ANYA 4X0VA 4DUXA 3N6QA 5DT5A 3VC6A 1JCYA 4MWAD 4MIMA 1HJUA 1G4SA 1O12A 3CUIA 5JUVA 2PLMA 5DMNA 1QT1A 3IGUA 4GNJA 4BR1A 4EXQA 1JPIA 2C15A 3I3EA 2PDGA 4WXZA 1PCKA 2OGYA 2YFNA 3VD3A 3EX1A 1GGOA 5D8WA 1OF6A 5CG7A 3VOGA 1DIDA 3ZIZA 1UYQA 4V27A 4QHRA 1QHPA 3PY2A 4LS2A 4BQ4A 4WF7A 3ATYA 4F79A 4GLEA 2HJPA 2ZDRA 4AF0B 2NLYA 1G0CA 5DRCA 4JIRA 4UTTC 3W27A 3BJTA 1B54A 3OZOA 2FVMA 2MNRA 3OJGA 1D7FA 3VD4A 2Z1KA 2YL5A 3CV1A 1IWPA 2PF8A 4LUJA 4JYEA 3ZJ8A 3ZR4A 4HZ7A 3OLDA 5ABTA 4US5A 3IANA 3BW3A 3W07A 3MO7A 1A3WA 3QLLA 4CEXC 2QCFA 2QZRA 2FJUB 4PUEA 4CVWA 3THUA 3T2PA 4R9XA 3K5XA 2Q02A 5KZ6A 2O7SA 3WQFA 1SUXA 1OFBA 7PTDA 4RE3A 3CZKA 3WMSA 3FYOA 4RW3A 4J3WA 4HOZA 3K30A 4D6GA 3M5ZA 4L65A 3RG6A 4J2MA 4JEJA 1RBLA 4B3ZA 3CT7A 3N2TA 4AY1A 4OWGA 3MCNA 4L6HA 2D23A 4J3TA 2I56A 2WNZA 4AYGA 3P8JA 3BZJA 4O28A 5MF5A 3KWSA 2W79A 2J74A 1BQCA 3TFXA 1HNYA 4DBWA 1CB2A 1C8VA 3WLRA 2Z2UA 2AKMA 4H19A 5IFPA 3GXNA 1EP2A 3FDGA 4GQ0A 5HAOA 3SW6A 4BJHA 1JD9A 4IWWA 4MKSA 2QCLA 1DORA 1ME8A 1ZCOA 3E0FA 4DAIA 1W8GA 1YQ2A 3GRIA 4Q8MA 3KBJA 4Z2IA 1IZJA 4ZTYA 1JIBA 2F8QA 3OTRA 1TFVA 2V5DA 5BWAA 4QXIA 1W31A 3RM9A 1VYRA 4IMDA 1FWRA 3SB0A 2X40A 3V0SA 4JN8A 3DYMA 1XR2A 4MGGA 3ZLGA 2ZE3A 3AQUA 2QUVA 3FYPA 4US5D 1W2VA 3BPWA 4S3JA 2DW6A 2VUYA 2X7WA 2YOCA 2ISWA 1CXFA 3C2FA 1G01A 3L2IA 2WHMA 3R11A 3GDTA 3URBA 4RE4A 1PWLA 2Z1BA 5EKYA 3TXVA 3IGXA 4QLJA 2O4QA 4IPNB 1JGIA 2VD9A 3AXIA 4WXYA 1QK0A 2V3EA 2WPGA 3PS7A 4JXCA 1R3VA 1TV5A 4F0HA 1OT2A 1MQQA 3AALA 3PNUA 4WLCA 4AXNA 4MVAA 1XIBA 1A5OC 3MUAA 2J9ZA 5HANA 3OYZA 3KLLA 2BB0A 4QSFA 4WSHA 2DIJA 2FTWA 4NZJA 3LMZA 2QDEA 1GQLA 2ACSA 1SMAA 3MUIA 5FJOA 1F76A 1UASA 3FJ4A 1HN1A 1UG6A 2FHBA 1S38A 5EMLA 1VRDA 4W85A 3HGSA 5JBFA 1VKFA 3VDCA 1L6GA 3QTGA 1MUMA 4QAIA 4H00A 2BOEX 4HTYA 4DBDA 1XIMA 2WQDA 3BL3A 1K8CA 3EDJA 3IJLA 3CHCA 1J6PA 4BEQA 3NQ8A 1YTKA 3ZMRA 5EFFA 4HSNA 3VGEA 3ARYA 3B03A 2CC0A 3RXZA 1CXIA 3O9NA 2ZRZA 3QEZA 1OADA 1W5NA 4AHQA 2W5FA 2OZ8A 1UIPA 4NHVA 4B91A 2P8CA 3B4YA 2YDSA 4MKNA 4WKHA 3N14A 1JGMA 1EP1A 4B3KA 1FA2A 3P60A 4K8EA 4F9DA 5IHSA 3ITVA 4NRSA 3URNA 3BG3A 4LCRA 5ABEA 2XPKA 4TVDA 1TV2A 3CT2A 1K7EA 3K4AA 4MTVA 1CXKA 1H41A 3G1AA 3GKAA 2PPGA 2X1RA 5A8NA 2QJGA 3W7RA 3WLTA 2XN1A 1MRQA 3WBWA 1CNVA 4YTSA 4XO6A 3USBA 3ZSTA 3K4WA 2ZC1A 2PC8A 3LMYA 4GYFA 4E3VA 1JCXA 3M1ZA 1MXSA 5I7GA 1R3RA 1E4NA 3FDKA 4UUIA 1ELSA 3TSDA 3NNTA 5CPQA 1OFPA 2XIOA 3UWVA 1JDDA 2ZADA 2DSUA 2GSEA 5KSWA 1XIDA 3BLFA 4I5UA 4I7UA 1QI3A 1HGYA 1M1BA 3QOMA 5XINA 4QTGA 2CZEA 3NQ6A 4NILA 1UIOA 3B0VC 4U28A 5BRQA 4JKMA 3FA5A 4KKXA 3F2DA 1VP5A 3KFTA 3MQTA 4QFUA 1QATA 3WFZA 5DO8A 1XLJA 1XIIA 4JOMA 1P6BA 1Q3NA 4PTMA 4JNYA 2WANA 4A2RA 1UKTA 2AL2A 3ICJA 3W7KA 1VFSA 2BHZA 2GL5A 2AKZA 2VGIA 4O1CA 4L9XA 3NSXA 1AJ0A 5H8PA 2Y7GA 2YLAA 1LBFA 3H2MA 3TN5A 1I0BA 2A7PA 3ANVA 2VFDA 2ZA3A 5KITA 4GFSA 3BV4A 1A47A 2MANA 4OUEA 1KWKA 1XYLA 2Z7KA 3BCDA 1TUXA 1RV8A 2A3HA 5I00A 4GQGA 2R1LA 3CAVA 3SEPA 2DJXA 3UA4A 2PTZA 4XBSA 1PDZA 3DFPA 4D8AA 6REQA 2J75A 1T99A 1NARA 3MY9A 4MLRA 3UCCA 2FZ8A 4EANA 4Q8NA 3G0UA 1RLDA 1B30A 4B5NA 3NPVA 3LXCA 3AFBA 1FWTA 1U5JA 1JCLA 2FB2A 4LYQA 4DWSC 4Y96A 3FEQA 3C0JA 2Z0IA 3VGDA 1R87A 4IQDA 3AJ7A 1UR2A 1EWEA 3MHUA 5CBBA 2QCHA 1EP3A 3CL6A 1U1JA 3VINA 5BZAA 3L68A 2EPKX 1MRAA 1OT1A 1XLBA 3C2OA 4LUSA 1E4LA 2HV5A 3B97A 2YW3A 3MSGA 4Q7BA 1XF0A 3NIYA 2DUXA 3NEVA 4PUMA 9CGTA 3IJ6A 4HT3A 4ZA0A 3MB9A 4FXJA 1BVWA 2X09A 1ICQA 4QITA 4Z42C 3DEQA 1QVBA 4RL3A 3B9NA 3T07A 5DANA 3CU2A 3LNMA 3T6CA 2DSKA 1W8SA 3KL3A 4GUGA 1UKPA 1EKOA 1SW7A 3R5EA 3DKLA 3DUGA 5LGXA 3AZTA 1F9CA 3IUDA 5BXPA 1X6LA 2WVUA 2Y85A 4B5XA 3WQGA 4UTFA 2A4AA 4LVDA 2VP8A 3COTA 2GGIA 3GNNA 3ZVHA 2UY4A 3WMCA 1UOKA 1W54A 1RCOB 1ZB5A 2Q09A 2Y7DA 3UETA 3M0LA 3M4HA 6REQB 5E6YA 4JTQA 1W3IA 2XIMA 3RX2A 1PUDA 2V0TA 4DJEA 1KW1A 2WVSA 1K9EA 1O5RA 1R38A 3WY1A 2HCVA 5TBOA 5A6AA 4DBSA 3P3BA 4AH7A 3GDBA 3MPGA 4HU8A 2DJLA 2SFPA 1IT0A 1POKA 9RUBA 1HKWA 4I5XA 1EYEA 2QS8A 2J6VA 3PR2A 4LUSB 5M2FX 3STCA 4OBRA 1EJXC 4K38A 3CIWA 4D6HA 3Q58A 4C6CA 1XFCA 3CBWA 4JN6A 1WZAA 3DZ1A 1KB3A 3CM4A 1GVIA 2GGGA 3CL8A 2BLEA 2PDQA 5HWMA 3O8AA 2GWGA 3I7QA 1KRCC 4GZ7A 3NM3A 4RCXA 2QIWA 1IR2A 4O18A 2RDUA 2UBPC 5CPLA 4ZODA 3J7HA 2Q3RA 3EEZA 2PMQA 1WDSA 4XAFA 2GVEA 2YX0A 1IT7A 3T0BA 2YW4A 1T8XA 1NH6A 3CTLA 1OK4A 4HOWA 3KRUA 3NZQA 3QM3A 1KTCA 5FCZA 3QGVA 1W2PA 1HTIA 1JNEA 4LJ3A 3GTNA 2VZSA 4PE8A 1ZU8A 1A0DA 1OX6A 3ZVHB 4GFIA 4N4PA 4L6DA 3VGGA 3VOHA 3R6IA 1DKWA 3CL7A 2ZXAA 3BGAA 4GGBA 3PBWA 3S1VA 1XBZA 3DERA 3BMXA 3RCYA 3GUWA 4HA0A 1S2VA 3RR4A 2YBTA 4OKDA 4DJED 1D3HA 3BLKA 2HE5A 1V79A 4WD0A 1VJIA 1I1WA 5CAKA 1OG0A 5A6SA 4J3SA 2EEXA 2PDFA 4IQEA 4ACYA 3GTHA 5CXPA 3GDLA 2E5BA 4BI7A 4CD8A 1F3TA 1YDNA 1XW8A 3VNMA 2PP0A 1DWHM 2OLAA 3QXBA 3VIPA 1NU5A 3QYSA 4PRTA 3SGZA 2QCNA 4W93A 4E8GA 3GXMA 1K1DA 4Q8OA 4AIEA 2ZDSA 1EGVA 5LHFA 4LBUA 2ZX9A 2E40A 1OC6A 2QPUA 2YXGA 1U30A 3GH7A 1GNXA 2WJFA 2AQVA 3GNDA 1P1MA 3W88A 1XLHA 1J01A 1V0MA 3UWZA 3GTIA 3CWOX 1BD0A 1BVZA 2PDNA 4QDMA 1C3FA 2DZAA 4N0RA 1X97A 3PUDA 4LFYA 1ZGDA 3ZSSA 1IXNA 4JY8A 5GJMA 3SZ8A 1D3CA 3PWIA 4KCVA 3GXDA 2YXXA 3WNPA 4GY0A 3CUGA 4H9MA 4BWLC 3FCPA 3B0UX 3CMJA 3S5YA 3HG4A 3ARRA 4E2DA 4A8NA 1P0NA 3QVQA 5T26A 4LYRA 4FOKA 3TTEA 2OU4A 4DXKA 4O54A 3CYJA 2YCEA 2PURA 2H90A 1QRQA 4PRWA 1BWVA 3U2OA 4CNOA 3CO4A 3ZJ7A 3GG1A 4KS0A 1NQ6A 2VFEA 3PJUA 1IWAA 1B4EA 4PB3A 4AZ5A 2FHCA 2VX6A 4GK8A 4LY4A 4IIEA 5E70A 3AMLA 3UR2A 4B5VA 2WQPA 4HVXA 4XZBA 3OPSA 3A4WA 3IARA 2FFIA 1JUKA 3PJWA 5IM51 4NY2A 1U2YA 2XISA 2VEGA 3FGCA 3C0SA 3HQOA 3QTPA 3NL5A 5AHMA 2NWSA 4FF5A 1K6WA 2HDJA 3OZYA 1NFGA 1TIMA 4ASTA 2QUUA 1I2NA 2VGGA 1E0WA 4PFMA 4MWAE 4FI4A 4EXBA 3HJEA 3WD1A 3URAA 1QU4A 1VH7A 1YDVA 4G1NA 2GQ8A 1JAEA 2ATMA 4US6A 4TMBA 3L4ZA 2A0NA 1PTAA 4IT1A 4F40A 4BF5A 1D2KA 2XSAA 2YL9A 3M9YA 4HPNA 3USZA 3WFAA 5RUBA 2PBGA 4UMBA 3H2EA 4WKFA 3R10A 2O9PA 1XLCA 4L5ZA 1AL8A 4NASA 2YL8A 2QQ6A 1O5QA 3RR1A 4X63A 4CCCA 1E70M 4DYEA 1NF7A 3L4XA 3WJWA 3RRAA 4FLQA 4B2DA 4N9DA 5JVLA 2OEKA 4Y7EA 3UYIA 3H2CA 1I2QA 3T4CA 2I9EA 1AW5A 3RITA 5FEXA 4QLLA 4R5EA 4LUTA 3W26A 3H2NA 2EHHA 1GKRA 2XU2A 3VDBA 1IR1A 3KM8A 3LBMA 1TCDA 3NSMA 3A21A 3S2JA 4ZQNA 3A3HA 2VEMA 4Q4SA 3THCA 3GHUA 1AODA 1W9DM 3RUBL 3LPPA 1HKMA 1RK6A 4RXGA 3CASA 2RDTA 1E9YB 4L4MA 3W23A 1DTUA 1UB3A 4UTTA 2QCCA 3TCEA 2Z29A 3FGCB 3LZ5A 2PCQA 4IFRA 3EZ4A 4PCSA 1U5HA 1IZKA 2E1DA 3E74A 2QJIA 4ZEPA 5AZ1A 1P4CA 4H6RA 5C54A 1XSKA 5EYWA 3K1DA 2V5CA 3TNOA 5D09A 4UOZA 3AOFA 4NXKA 1DWJM 4H8NA 4IH3A 4KT2A 2EXOA 3QSRA 4FS9A 5A3HA 2DY3A 2OYLA 1A3HA 4PZVA 2D0HA 6TIMA 3MKKA 4JICA 1UUQA 2VEPA 2ALDA 3IUHA 4JQ3A 1ITUA 3T05A 1TJ0A 3VGFA 1OCBA 3PPCA 1IXPA 3IWPA 1Q4WA 3K2GA 1HO4A 2NW0A 1KRMA 3NQEA 4BFAA 4AWUA 2G41A 1MFVA 3M44A 2WHLA 3DFYA 1XLLA 2R9RA 4KFOA 4B2DD 1XD1A 1TRIA 2DZBA 1Q65A 4K1GA 1W9VA 4DF0A 4O11A 4AB4A 3QFWA 3TJLA 1MZHA 1E43A 1R47A 3AZSA 4NJGA 3XISA 3T42A 3BG9A 4FX6M 3QR1A 4G8TA 1MNZA 4YIWA 1SZFA 4LUTB 1AMKA 1DBTA 1FH9A 1ITXA 1Q7MA 3PULA 3UPMA 3TYDA 3D0CA 4LAUA 3Q45A 4PMNA 1W1YA 3QFEA 1SU5A 1F4HA 4E0CA 3R12A 1Z3NA 1Q6GA 2ZXBA 2ZBTA 5I6SA 1JJKA 3CUHA 4URIA 4UIOA 1ME7A 4G56A 1KRAC 3AMDA 2ZUUA 1IQ8A 1F6KA 2QV5A 2D73A 2OOFA 2DVXA 3PC0A 2ZXDA 5FEZA 4PUWA 4Q4OA 5CPMA 5E09A 3GXIA 1FCBA 2WXDM 4JGDA 2RGLA 1BGAA 4JTLA 4OVXA 2BY1A 1Q45A 4OV9A 4EPDC 2V67A 2E7FA 1ZAHA 3PHAA 1IIHA 3UZ5A 4KH2A 4PSRA 2H3DA 4JIIX 3LLXA 4F8XA 2QVHA 2WMFA 1EJTC 4LB4A 1TREA 1LRQA 1PBGA 2EG6A 5LNVA 1CWYA 2R1KA