4L1GA

Crystal structure of the bc1960 peptidoglycan n-acetylglucosamine deacetylase from bacillus cereus
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
214
structure length
213
Chain Sequence
WTPFSWVEKYAYAFSGPYNKAEVALTFDDGPDLEFTPKILDKLKQHNVKATFFLLGENAEKFPNIVKRIANEGHVIGNHTYSHPNLAKVNEDEYRNQIIKTEEILNRLAGYAPKFIRPYGEILENQLKWATEQNFMIVQWSVDTVDWKGVSADTITNNVLGNSFPGSVILQHSTPGGHLQGSVDALDKIIPQLKTKGARFVTLPSMFQTSKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidoglycan N-acetylglucosamine deacetylase
publication title An unusual alpha-carbon hydroxylation of proline promotes active-site maturation.
pubmed doi rcsb
source organism Bacillus cereus
total genus 79
structure length 213
sequence length 214
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4l1gA00
2C1GA 4M1BA 1W1B1 3VUSA 4NZ4A 1W17A 3CL6A 1XW8A 4L1GA 2DFAA 2C79A 2QV5A 4NZ5A 1W1A1 4LY4A 4WCJA 4OUIA 3S6OA 3WX7A 4HD5A 2Y8UA 3CL7A 4NZ1A 2XU2A 2VYOA 3HFTA 4NY2A 4F9DA 4NYYA 3CL8A 2I5IA 2E67A 3QBUA 1NY1A 3RXZA 4V33A 2IW0A 5BU6A 1V6TA 2NLYA 4NYUA 2W3ZA 4U10A 4NZ3A 5JMUA 2J13A 4F9JA 2C71A 1Z7AA 2C1IA 2CC0A
chains in the Genus database with same CATH superfamily
3M7SA 3QC0A 3S3GA 4FNUA 2WHMA 2JKPA 1EIBA 1EQPA 5D9NA 5AZ1A 1ADDA 1GTEA 4WJXA 4G7EB 4US5D 1JYVA 4EWJA 1WZLA 4ZO9A 4JAWA 3BAYA 4IGMA 4UCGA 1LOLA 4Y8FA 1MW2A 4BA0A 3T8LA 2OSXA 1TRDA 2GOKA 2DVUA 4TX8A 2CFFA 4PGLA 1V6YA 4HK6A 4CLMA 3WF4A 4LBSA 1KM0A 2BX7A 2JBMA 1Y65A 2IQTA 1TREA 1PKYA 1TO3A 1KWKA 4MWAB 2PBOA 2ZUVA 1Q85A 1C7TA 5CPOA 2V5DA 1PX4A 3VC5A 1AW2A 4YMZA 4B5UA 1TIWA 4JTJA 1W1VA 3UA4A 3CZEA 4MJ4A 3NQMA 1P6CA 1UZ1A 5LIXX 3QQ0A 3DZ1A 1TE1A 4UMAA 1OSEA 4I6VA 3SCOA 4C65A 4INFA 1VPYA 4O0ZA 4N6FA 4JFWA 4GO9A 4YYCA 1LBMA 1O60A 2DORA 2DP3A 2RDWA 5FJRA 5A69A 3MUCA 1ELSA 3TE9A 3VKCA 4P7NA 1MRAA 1WV2A 3EKLA 3DESA 6REQB 3U48A 1DJWA 3U2ZA 3VD4A 1GPWA 3ZSSA 3I3BA 4QDWA 1OF8A 2C14A 5BMXA 1MVYA 4W8BA 4XKYB 3MU7A 4JIRA 2ZZ6A 3MCOA 3BXWA 4CCEA 4FLQA 4TX9A 3G1HA 1DWAM 5HINA 1E6NA 2AOSA 1X8CA 3E96A 4GJJA 4E4PA 4EX4A 2P10A 1U83A 3N2XA 3HJEA 1IQ8A 1UPPA 3NQ8A 3AHZA 1GVSA 3SB0A 2JEQA 2X1SA 4PMVA 5BRPA 4HT3A 4GY0A 1NQ6A 4IFKB 1GVIA 1Z7AA 2YDSA 1DTUA 5B7YA 5CGTA 2OYKA 1FWRA 2Y5JA 1I4NA 5FEPA 4AC1X 5A8NA 1BF6A 5DELA 3NQCA 3IEBA 4GH1A 4MLRA 5CQ1A 5DCDA 3U7BA 1EP1A 3RIKA 3IJLA 1V3JA 3W71A 4LOCA 1EPXA 4C6KA 1R38A 5HUOA 3K8MA 2BHYA 2JEPA 1T41A 1HXJA 4DO6A 4MDOA 4S38A 4A3UA 2VR4A 1C8XA 3U2CA 4JTDA 3V75A 3KX6A 2YZRA 5GQBA 1ADSA 3BURA 2FTYA 4TTUA 3ARZA 3WD4A 3LHUA 2OKTA 1SMAA 4DBSA 3POHA 1G1YA 2DZTA 2YB4A 4LH8A 1K6AA 1BAGA 4AISA 3H4WA 5A95A 3ARRA 2FDSA 4Z2JA 1FCVA 1SFTA 3BOFA 2ON3A 4GWEA 3STPA 2C15A 3GH4A 4BR1A 4ICMA 1QI2A 2VEMA 4N9DA 1AMYA 1XGDA 4GX9A 3CPUA 3IJ6A 1IEQA 4KEVA 2DJLA 4LVBA 4F2BA 1TRIA 1UG6A 2J7GA 5CZ0A 3WFLA 1W37A 4Y6GA 2W66A 2NZLA 4PBGA 3QKZA 1R5YA 2EEXA 3MQTA 3AWNA 4ALDA 1WAWA 1F3WA 4GZEA 3RDKA 4R9OA 3LK6A 2PRHA 1O5QA 1HT6A 3R11A 2OWCA 6XIMA 3SY1A 1OFOA 2UWFA 3BW3A 1NARA 1HZYA 4F9DA 2Z6JA 4D6IA 1UWAA 1VS1A 4LAKA 3GDKA 7A3HA 4UMBA 3RCYA 4O17A 2V8ZA 4OVXA 1N8IA 3KE0A 4ORMA 4AF0A 1R7OA 9XIAA 1U22A 4W7WA 4AG0A 3KEHA 4FF5A 2X16A 3W1UA 1WUEA 5HMEA 3CQKA 3WMBA 5FJUA 3VNLA 2GQ9A 4K8HA 3GC4A 3KBSA 1DJYA 1CIUA 4P7RA 3PP7A 5BXTA 4M51A 3KW3A 4YHGA 1JFHA 3UPBA 1FBAA 1WKEA 3NA8A 1TZ7A 1PWLA 4L1GA 1BTCA 3G6LA 3OZOA 4UQ9A 4HPXA 1MSSA 4EKJA 1NDWA 3KOXA 1TPVA 3D47A 5D38A 4ML4A 1UQYA 4S3AA 5JMUA 2X09A 3GXTA 2XSAA 4B3LA 4ADTA 4BZYA 2P88A 4BY3A 5K9XA 2YDQA 2VP8A 1DOSA 4Z2IA 1EYWA 3EBVA 5TNVA 4F0MA 3AHVA 3SCNA 5D30A 1AH0A 1ISXA 2ZZ2A 3P8IA 4BCEA 3C3UA 4PUWA 1WDRA 4A3RA 5A6JA 3QM3A 5FJOA 1Q13A 2O4MA 1ZBVA 4J3UA 2ACQA 4J3XA 4ZOBA 1IEVA 1IGSA 4W8AA 1Q6QA 4B9ZA 1LQAA 3SRKA 3LQGA 5I06A 3B8TA 3ZVHB 2W3ZA 2LLEA 4AEOA 3UWYA 3SCSA 1B4EA 2ZX5A 4D2JA 1TB3A 1J2BA 3P7YA 4ZEPA 3W00A 2B4GA 2XFYA 2YA0A 4DI9A 5FAJA 1UWSA 2YR1A 1KRAC 1WO2A 2YYTA 3N3TA 4S3KA 2VEIA 2VFHA 3EMCA 4TR9A 2ZX6A 2OQYA 3U5UA 4DRSA 3E0FA 3W7IA 4NZFA 1ZU8A 1WBJA 1UMLA 1QHPA 3HTWA 3IIPA 3U5YA 3GG1A 4YIWA 4C1KA 1F61A 4J28A 3K30A 5CCZA 1Q6EA 1BQGA 4ZXOA 3EYPA 1EOKA 2HISA 3H23A 4KWSA 1M53A 2BVTA 4JHMA 3S46A 1E6SM 3SCVA 4O1FA 3B04A 4DZ5A 2DZXA 3I10A 2W92A 1S5WA 3FVMA 3JVAA 2W9MA 3MMUA 1BYAA 3N17A 4Q6XA 1D7FA 4A8LA 4MUPA 4A3YA 3E2RA 3LCLA 3BLKA 1TPC1 3UCDA 2INEA 3DXIA 3TN4A 3QYSA 4V15A 4O14A 1JCNA 3TLLA 1BVNP 1R6WA 3PY2A 4NYUA 3WLJA 4HNCA 1DWGM 1VYSX 4Z1BA 4E2DA 3UXLA 4K38A 1QATA 1W3LA 1XLBA 3OIHA 2GJLA 4WDUA 1XPYA 3EX2A 3AAMA 3HO8A 4PMQA 3NSXA 2DU2A 2V2HA 3W84A 5EFFA 5AZ0A 2DVXA 4IP4A 1XRSA 3Q4DA 2J7FA 2NQJA 2VQUA 3MV11 2QAPA 4E2OA 2KAUC 3WO8A 3EOOA 1XIFA 4AZ7A 3TSMA 1XLHA 1IXOA 2PP0A 2Q01A 5CSUA 4XD5A 1I1WA 1KBBA 1WYIA 4UTTA 2UZ9A 1J0YA 2WMHA 4NASA 3MWAA 1XDLA 2BGQA 4H8UA 1RALA 3DDMA 3KHDA 1PYMA 3BARA 2UY3A 4G6CA 5A94A 4W8LA 4FOJA 4GIYA 3DYPA 4NNAA 2J75A 2ZKMX 3ITVA 5C6MA 4XKYA 1D2KA 3ZLGA 4PB3A 2QCEA 2VX4A 4B9YA 5C9XA 1K9EA 2TPSA 1ICSA 4W88A 4ZQCA 3HGJA 3O6DA 1KWGA 3RX3A 4FP1A 1TPWA 4JY9A 4AVFA 3T9PA 1UUMA 2V0TA 2Z1WA 3BSHA 5A1AA 3KP0A 3MS8A 2FB3A 3IRDA 3E49A 1GJWA 4Z42C 2GQAA 2GLKA 1KQYA 9RUBA 3N2MA 2YFNA 1SJCA 2B31A 3P84A 3FA4A 1KRCC 1EO7A 5G1YA 3GU1A 3H22A 3M5VA 2E9BA 2EPKX 1FKXA 3BW4A 1EP3A 2TYSA 3CV7A 1XICA 4IMAA 5LNSA 2VVNA 1EGVA 1HGWA 3LS9A 1S5MA 5DT5A 1E6PA 1P6BA 2J8GA 3G3DA 3PBYA 1EEXA 3PNZA 3IGXA 2WLZA 3P3BA 3LPOA 4LC8A 3PTDA 3RN6A 3SRHA 4AY7A 3PPCA 4MZ1A 1IT7A 1TFVA 3WF3A 5A5WA 5CLWA 1ONXA 4RE2A 1ONRA 1VFTA 2J9XA 3R94A 1GQKA 4MB3A 2A4AA 3FEQA 1OFBA 2WMFA 4Y9NA 4WX2A 3MKKA 1TWIA 4LCSA 3L2LA 1UR2A 4U10A 1LWIA 1JRBA 3KBVA 1ONEA 3ARUA 3OHIA 2F6XA 3QN3A 3I4KA 3VIMA 1Y8BA 3W3OA 1O95A 2YLLA 3A4WA 4GCXA 2XSXA 1XQKA 1DP0A 1WZMA 2WBGA 1B3XA 3LG3A 4C6PA 4K8EA 1RA5A 5LSMA 3OLIA 3APYA 4CQ8A 1OJXA 1M65A 2FGLA 4WZHA 4QHRA 2P76A 3IIOA 4GFIA 2WV8A 3PUDA 4KIRA 5G4WA 3BG5A 5DMNA 1VH7A 3W1XA 4QQUA 2EG6A 4WQ6A 4ERGA 5AC4A 1GKPA 4CVUA 1KBKA 1FXQA 1J6PA 1OK6A 4TVCA 3BJSA 2QGYA 2WBKA 1ML1A 4ZFCA 5FEZA 4GGHA 4PE8A 5F7UA 3MI2A 4NNCA 4FK9A 3BG9A 1W1PA 2QW5A 1JDAA 3II1A 1K70A 3U4AA 1YBQA 4V2XA 2WHJA 2G4FA 2JGQA 4RDVA 4LUJA 1EC8A 2CZVA 3GXDA 4C6FA 2NUYA 3FJ6A 3BLDA 1KO0A 3AMCA 3W1LA 2HK1A 2QIIA 2J24A 2EQDA 2NSXA 4JFTA 2WZEA 1M1BA 2EBNA 2XGIA 2E7FA 3VGFA 4AIEA 1QTWA 1K7XA 2DT1A 3ZO9A 1H0GA 2FIQA 4HYVA 4KQNA 1RY8A 2DZUA 4UNIA 3C2OA 2Y1HA 1V03A 3EWYA 4IPPA 4MJMA 3N2BA 5ABHA 2PDNA 3GSMA 3OU8A 1TA3B 2WKGA 4AZ5A 1RCXB 2FGZA 1QOXA 1RK5A 3OVRA 3URNA 1G6CA 2GUUA 5HMDA 1NY1A 4GQBA 3STGA 3V3WA 5JBFA 1CGWA 5BXRA 4TX6A 3AJXA 2Q09A 2RUSA 1EDQA 3W22A 3RK8A 1T40A 4D1JA 2I9EA 3ICJA 1NWTA 3N19B 2HTMA 4ZTYA 2FTWA 1KD0A 1GOQA 1ZJHA 1VFHA 2J27A 4NT0A 4PMDA 2OYLA 4Q8PA 3PZVA 1JRCA 2ODOA 2EPMX 2J62A 1JULA 4QEEA 3ZVHA 1DYSA 3KFTA 9XIMA 1M5WA 3F5LA 4G7FA 3SRFA 1JL8A 2BVDA 1BRLB 1H7PA 3SCPA 1Q6FA 3ZJ7A 2ISSA 4C7FA 3O6YX 2RDTA 4N0RA 4C6NA 3N3MA 3WY1A 2BTMA 1E9ZB 1XYFA 5AECA 1P7TA 1K03A 3EPNA 4DNHA 4DX3A 3WF1A 3DERA 3IJQA 1W9XA 3GW3A 4IXXA 3U2EA 4QSFA 3BSGA 2OTDA 4FX7A 4TXEA 5DRIA 1EX5A 1Q45A 4RR4A 3PSVA 3FKRA 3GFZA 4H8NA 1HJSA 5KMYA 2D1ZA 2J9ZA 2F8QA 3LLDA 5CZKA 3C4UA 1P0NA 3A22A 1J2WA 4JQ1A 4QFUA 1JF6A 3BV4A 3B03A 1CBGA 3CHCA 1XC6A 1TIMA 2YSWA 2V5BA 2VRKA 1T96A 3DFOA 3K2GA 2V5LA 4PODA 3FAWA 1OX6A 1PX3A 1T0OA 3CYJA 3IVTA 2BMBA 3BANA 4W85A 2IPFA 2NW0A 2GUBA 4MKNA 1Q2RA 5CZTA 1GQLA 1ISYA 2Z7GA 2YZ5A 3QR3A 3SGGA 3SECA 1E1CA 1S1PA 4R7WA 1Z89A 4J3VA 1NSJA 1E0TA 2V3DA 2VEKA 3SUUA 3VAVA 2EHHA 4AMCA 3S2JA 1EO5A 1RJQA 2I9UA 3T55A 4IG2A 3TQPA 3WLMA 4Q8NA 4IFOA 4UOZA 4I5UA 3CZGA 2YCLB 1VCFA 4NG3A 1LUCB 8RUCA 1O6IA 2RGLA 3Q2DA 3HQ1A 4H8HA 1BPLB 4A2SA 2BXYA 1DXFA 3MJMA 1S39A 3DFSA 4HNTA 3TOPA 1AK5A 3PVFA 1Q8JA 1YRRA 4HYRA 4MNMA 4Y9AA 4F0KA 2NT1A 3DCPA 3G2GA 2QDEA 1TPUA 4AZ6A 3B8SA 4LYRA 3LM7A 4GKLA 1BYDA 3HG3A 4M6UA 3CQJA 4X0VA 1K7EA 2XFRA 3H24A 3SAZA 5CPNA 4DZAA 1LT8A 1G4PA 1JR1A 5G5IA 3UVAA 3AOFA 2CCRA 4OTKA 1OX5A 3CV2A 4MWAC 4NILA 2WSQA 3DFNA 1WNOA 1O4UA 3IIVA 1Q6CA 1TWSA 1QDSA 1D3CA 1UWRA 3MHUA 3S5NA 2Q8ZA 4Q32A 4WXZA 1EJTC 3S5YA 2ZWYA 3A24A 3FA5A 1U1UA 5A6AA 1V0LA 4PMZA 1CGTA 1U1HA 3H7RA 4NI3A 2XN0A 1PIGA 2WYSA 4KBXA 3ISIX 4C6QA 2JALA 1Q6RA 4LB3A 3WFZA 3L4UA 5IFPA 3CIXA 2CZ5A 5IM51 1MNZA 5EMUA 2WVVA 1MO0A 1EUNA 2DIKA 1HKJA 5H8UA 2TAAA 2ZZ5A 1Z6KA 4PH6A 2MUCA 1X1NA 3F4WA 4GQ0A 1U1JA 3B0UX 4WKAA 2D24A 1T6MA 4RZ5A 1XW8A 1XLAA 3C0SA 3TCSA 4AIUA 4GPNA 4O11A 3BQ6A 1AW1A 1SJBA 2OQHA 2WPBA 1IR1A 5A8MA 4HPNA 2BS9A 2HBVA 3FDKA 3LTPA 5E0KA 3W1QA 5HR7A 1BVZA 3EWCA 3SUSA 2O9TA 3PBMA 3UY7A 1U2YA 3OG3A 3F4DA 4OWGA 4ICNA 2Y89A 2XFWA 3M0ZA 5JXQA 3B4UA 1S2CA 1DQXA 3DC8A 1Z44A 3AIRA 4KW2A 4H9TA 4JCMA 4ZFMA 3AC0A 3QH2A 5BW6A 3QY8A 4RE0A 4YVXA 4ZVJA 1UIOA 1AQ0A 3ZWSA 4DAFA 3GTNA 1E5JA 3A64A 4XKMA 2QCCA 3WLSA 2A85A 2NQLA 1AMKA 4WD0A 2E5BA 3H2CA 3LU2A 3VYLA 4C6EA 3PFRA 1EKOA 2OEMA 3UEQA 2QV5A 2YPIA 4DO4A 4DWSA 3WDRA 1EJVC 4FI4A 1FOBA 3CHDA 4LVGA 1EEPA 3G24A 1XLCA 3UG4A 2WHKA 4FLSA 2GGIA 4D8AA 4K1GA 3E3HA 2VM8A 3N13A 1H1ZA 3GXNA 1RH9A 4X60A 4LUSB 1US0A 1JQXA 4XTDA 4MSSA 3AICA 4DF0A 1RQHA 3ZWTA 2J74A 1XKYA 4C7DA 2O4QA 2FGBA 2ABAA 3A5FA 3M0JA 4XZNX 5T26A 1FWHC 2MNRA 3R12A 1VZWA 1KB3A 3GVWA 1TCMA 5A6KA 2X8RA 1JUKA 4HPJA 1BWVA 2XGBA 2WMIA 4LRTA 4WF7A 1Q6GA 1V0KA 3NYDA 4GO8A 2OOGA 1K8CA 4LS0A 2G3MA 3BGJA 4M8UA 1SZEA 4Q8QA 3FY1A 3TONA 4HSHA 4WGHA 4D6DA 5H8MA 1AVAA 3MI6A 3T40A 3TKFA 1S5NA 4JTLA 4OBRA 3UWWA 2DPEA 2DT2A 4IPIA 4HU0A 1OYAA 5HPCA 4JTEA 4H7ZA 5D9PA 4O28A 3RU8X 4C6BA 5HMFA 3HG5A 1R3YA 1KFWA 3W83A 1X6NA 2CETA 1J93A 3H26A 4ERAA 2BOGX 4I3GA 2IKGA 4K68A 1VBJA 4L9XA 2O7SA 3TYEA 4HHLA 1WUFA 5K4ZA 3DBNA 4CU8A 5I0DA 3F7JA 1J79A 1UWUA 3R10A 3AXXA 2QMJA 5BOFA 4B92A 1G9HA 1LRNA 1ME8A 3GG8A 1JAEA 3NEHA 4W86A 5JIWA 2Z26A 2CW6A 4Q8VA 3V0TA 3G77A 5A8OA 3ABSA 1B5TA 4S3GA 4U2ZA 2VGGA 3WLOA 3WNNA 5JU6A 1TWZA 1GVFA 4IF2A 1JPIA 3M9YA 3O07A 2Z29A 2R94A 2PS2A 3EB4A 4JTIA 1XIHA 4L65A 1CWYA 3O9NA 3BE7A 3HGRA 1K9TA 4UBPC 2R8WA 5C7HA 4UQCA 3H7UA 1KTBA 4N6EA 1UD6A 4Y90A 1VIWA 2PAJA 4WSKA 4AD3A 3SQLA 3E5BA 1E3XA 3WUFA 1OT2A 2BGNE 3H70A 2E9LA 3FV9A 1HJQA 1GKQA 2VZTA 5HWJA 1CECA 4NZ5A 5I78A 4HMCA 1VIZA 3J7HA 3PS7A 1DWIM 3AJ7A 4GC4A 3OLEA 4MZYA 3XIMA 2OOFA 3GH5A 2A3LA 3K8LA 3V36A 1SJDA 4B5XA 4R7JA 4IGSA 4PMJA 3HBLA 3WF2A 5AYBA 1QOPA 4O1AA 1MDLA 5BNKA 4WXYA 3INPA 3W85A 1OM0A 2PTYA 5JBDA 3N04A 2OZTA 4RDWA 3SCWA 1TTQA 2AQVA 4NXKA 2FJKA 2BSLA 1R3WA 1BYBA 4FAMA 3SO7A 5D2TA 4E4FA 4HZ6A 4Z0SA 2PTDA 2WO5A 1JCTA 4ZODA 3VMPA 2CNCA 1ZNNA 2GVLA 1D8WA 3DAQA 3WJXA 4MY1A 2I7GA 2WC4A 5KZMA 3CIVA 1SPQA 2C6QA 6XIAA 1W2VA 3WLKX 3LGEA 3BLOA 5HPOA 1LOQA 2ZXQA 4Q3MA 5BU9A 4DO5A 2GVYA 3PC0A 1RA0A 3B40A 3T0AA 6A3HA 3L2IA 3TC6A 2NQHA 1H7NA 4UFIA 3RG6A 1Q7ZA 1FWGC 1QBAA 3KRUA 2DIEA 1PBGA 4JEQA 2YL8A 2DDXA 2R1NA 2X1UA 4HGXA 3HMCA 4Z1AA 1AQMA 3P62A 2JF6A 3QFWA 4H6QA 5CLTA 1ZJAA 3IUHA 4E2BA 2I56A 1M6JA 3HURA 1A0CA 3RXZA 1SZRA 3N6QA 1F07A 3LENA 3E38A 3L7RA 1QT1A 4H19A 3P8JA 4IM4A 1ICQA 3MZNA 4FO4A 4NJKA 5IBXC 3W72A 4PN2A 2E3ZA 5DFAA 2C7FA 4RZBA 1UR8A 1K6WA 2E8ZA 2PODA 1Y5VA 1ITUA 5CAKA 3LRMA 3Q37A 4ZXLA 4Q4MA 1Z3NA 1NAL1 2FPVA 3I6EA 2ZUUA 1KM6A 2BHZA 1B90A 4J40A 3ITYA 1AODA 3W23A 5KITA 4HU3A 3TCEA 1G7VA 5GJMA 1B57A 4Z2GA 4DY1A 1T7LA 2VWTA 1CI1A 1EHAA 1UWIA 3W37A 3W1NA 2NXIA 1RQBA 2A6NA 4D6JA 4UR8A 1JZ8A 3D6NA 5FA5A 1NDVA 1O68A 4IQLA 4NUWA 3G1SA 4DBWA 3PZTA 3BAXA 3NQAA 3H12A 1SGJA 3QRHA 2FZNA 4U4MA 5F1UA 2WHLA 1E9YB 1WDQA 3I7SA 4OHQA 2BXZA 2CWNA 1FWDC 4KGLA 4LVDA 2PFHA 3TYZA 4O54A 3PBUA 4AEEA 3BV7A 1W8SA 1HJVA 1FWWA 2PDCA 3OOQA 4I7WA 1OX4A 1DE6A 3TMLA 1XCFA 3RLVA 5RUBA 4DJEA 2RJGA 2I5IA 2FZBA 3IK2A 2WPGA 3TW9A 5LNVA 1QNSA 3A4XA 1TX2A 3H54A 3BLEA 4D6FA 3NO1A 2Z27A 3NVDA 1GQJA 3CEUA 3SY5A 2XU2A 1LG2A 3K4DA 4XX6A 3W7RA 4KRTA 3BAKA 3KBNA 5HXMA 2R1KA 3KCOA 1H09A 2QAFA 1CLKA 1XH2A 3NDZA 1RBAA 1VKFA 2YKKA 1XM3A 1KM1A 2NVCA 4JTTA 1LLWA 4XO6A 5LIUX 4ZSUA 3O3RA 1VJSA 3WQ8A 3RPMA 4JGDA 2FZ9A 3AIVA 4CD4A 4A21A 1JI1A 4YCOA 3LCIA 2FHCA 1IYXA 1D7KA 1XBVA 2XZ7A 4RV8A 3HQNA 2OKOA 4J35A 4N42A 3PK7A 4FF7A 3AS0A 1XIEA 4U3AA 2Y7GA 3R0UA 1DL3A 3K13A 1PSCA 3L2MA 2YBTA 5LA0A 1V93A 3MPGA 3TYDA 5M2FX 2PDQA 2Y4SA 3TOYA 2VZOA 3MTWA 2DEPA 2BOFX 1JXJA 1CNVA 1EF2A 2W0UA 4ZTXA 1VFUA 5H1WA 3GHRA 5HAOA 2UY2A 3T1GA 4LUTB 2E9MA 4Z1DA 2CHOA 1F8MA 3ARYA 4CKQA 1ME9A 1J01A 3LCHA 2IKJA 1DJNA 4NJHA 2PDYA 2EG8A 3W2UA 2ZRVA 1V3LA 1C8VA 1OEPA 3EKGA 1EXBA 3PJUA 3ES8A 3NQ6A 3GDLA 2ZWZA 1A5MC 2VCCA 1LQ0A 3GFYA 1SFLA 1JUBA 1YHTA 2Y88A 3TWAA 1JZ3A 3M0XA 3APGA 4MHBA 3WLLA 1FDYA 1RV8A 3CT2A 1E6ZA 3WNLA 3A4AA 4PMRA 2EPOA 5I3IA 3ZT7A 1N2VA 2O92A 1AA1B 1M7PA 2CWXA 2WSKA 3R0DA 3UGVA 4JHZA 3M16A 2BBFA 3DFQA 2WW5A 3VX1A 2B7OA 1NWSA 2BVWA 2YCEA 2OODA 2D0HA 2OG9A 3GG0A 3WK3A 3LEPA 2WMKA 2G37A 4NVTA 4PA8A 3FCPA 4XZWA 4EF8A 1UKPA 5AC6A 4DJDA 3HMJG 4Z1YA 3EMZA 5LGXA 1UD5A 4KEMA 4M7TA 4NRRA 2REQA 3VXGA 3EWDA 4UOQA 3AUJA 2XN1A 4QLJA 2DZSA 3CTTA 3AS2A 3V5FA 5HQEA 1J6OA 4O57A 2DSKA 2B0MA 4B2DA 4I5RA 3C2RA 1QI0A 2H90A 2QCNA 4QG6A 1VEMA 3FS2A 3W7NA 1DWJM 1W3JA 3NNTA 2JFEX 3WD3A 4Q8OA 4UFKA 5IXEA 4AH7A 1GZJA 3QW3A 2PWVA 4Q8WA 1ISWA 1W5OA 2BY1A 2ZUWA 2DZPA 4PBEA 1MZHA 1I0BA 4HPGA 1B30A 3MP3A 4O15A 5K7JA 2YL9A 3U2OA 2W63A 1AFSA 4MB5A 3I6TA 1LWHA 3LGGA 3RAOA 4UNLA 4LSBA 2TMDA 2ZX8A 4MJZA 3EOSA 6PTDA 4OOZA 2HE5A 4A35A 4WY0B 1WA3A 3W07A 3MBDA 3U4FA 3M7WA 1BWKA 5BU6A 4C5ZA 4PMUA 1UZDA 1DIDA 3UWUA 1MDRA 5CC5A 3GXPA 2PB1A 4LGXA 1RVGA 5E6YA 2GK1B 1ZAJA 2YGYA 2QNEA 1LQ2A 3DHUA 3OA3A 5IRPA 4JKKA 3T2OA 3CM4A 1M41A 1GONA 1F9CA 4ZO7A 2QCFA 2PLKA 2PWEA 3C56A 4DUVA 1P1MA 4K1WA 2V38A 4CQAA 5AVHA 4H7CA 4GGBA 3WUBA 4ORIA 3RUBL 1DJZA 4EXAA 2FFCA 4KEUA 4RNHA 5DBTA 2R1MA 1L8NA 5A6LA 2QZRA 3EX1A 1GNXA 2BGSA 4RUBA 5KZ6A 1OQFA 2Z00A 4NU7A 3SCTA 4HA1A 4LBUA 1VYPX 4AHQA 3M0VA 4AQLA 4TTGA 3MSDA 3NO5A 3VIJA 2V81A 5I07A 3ZFHA 1XRFA 1H1NA 4Z17A 4DJFA 1HO4A 1W3IA 2FVLA 2INFA 2GDQA 3T0BA 4O18A 5CPLA 1NP0A 3S0CA 1L6FA 1RAKA 3B3DA 2E09A 1CGVA 5AC7A 2XISA 2PZ0A 2QJHA 1RY0A 3OBEA 1E6RA 1R3RA 4LXFA 3NL6A 1H62A 1CTNA 3H21A 1REQA 1QWKA 3ALFA 4HN8A 7TAAA 3GBDA 1SU5A 4NAFB 3LI0A 4MPKA 4BQ5A 2BG5A 4L1WA 1R9XA 4GZ7A 4L4LA 3OGVA 1B9ZA 4L5ZA 1CT5A 4LEFA 4JN8A 4IPJA 1EXPA 4PTDA 1KXHA 3HFYA 5LXEA 4AAJA 3EAUA 4UTHA 2Z1XA 4GG9A 3C5QA 1E4LA 1TV5A 3SN1A 3VKDA 5FSDC 4BI5A 1F3XA 1A4LA 2IPWA 3ARXA 1UUOA 4MFEA 5DANA 3UZJA 3W76A 4W5ZA 1R85A 1UH3A 3R43A 5FD0A 3O1NA 1PE1A 3FJ4A 2VDHA 3A4JA 3NSMA 1V6WA 4FB7A 2Z0IA 3ZT5A 5AHLA 3C6CA 1P0DA 2AMXA 4J4KA 1WAUA 4JQ3A 3DECA 4RNJA 1XG3A 3IJ8A 3N4FA 3W1RA 1VCGA 1VPQA 5D2VA 4GVGA 5CPSA 3N1AA 3S1GA 2HZGA 3MDWA 4LS2A 3N9RA 4AWUA 2AL2B 4LY8A 2DFAA 5HNUA 5REQB 2XH4A 3WDIA 3OZPA 3GKFA 2HDJA 4AVOA 4AVNA 3BQ5A 2QUNA 2VOMA 4AXKA 4IIBA 3FGCB 3HOJA 2BDQA 1DJXA 3EKZA 2ALDA 5LHFA 3N2CA 1YDNA 7REQA 4WDWA 1HUVA 1O5XA 2VGIA 3LV6A 3QLLA 4OBSA 1UB3A 3LLXA 5A2CA 3UESA 2WMGA 1UC5A 2FH8A 3WX7A 3PTKA 3WBAA 3NTYA 1KGWA 4PUMA 4ZO8A 2ZUTA 3OGRA 1LF1A 4JFSA 1W9UA 3WBWA 4AX6A 1FH9A 4ZQRA 1KM2A 1M7XA 4NX5A 3NG3A 1AW5A 1JYNA 3PUOA 1KKRA 4CD7A 2PGRA 2VEGA 4HCDA 3CZ8A 4Q7NA 1BWLA 1HW6A 1TMHA 2J6XA 1KGXA 2PU0A 2CLMA 1UP2A 2JIWA 2YOCA 4FOUA 1PUDA 3STFA 1TTPA 3LHZA 1VBUA 2FB2A 1SSGA 3UCQA 3NIYA 3RJYA 3QTPA 2VEPA 4HIBA 3WIJA 1FY6A 1OFQA 3NZRA 2A1YA 3W7HA 2CKRA 4IJRA 4F79A 3WF0A 3TR9A 4DEFA 3E2VA 5J8LA 1TSIA 1H63A 2Y7EA 2WKLA 2VZUA 3AIBA 3DKLA 1FKWA 1AUSL 3O7UA 4R9XA 1VC4A 1TTJA 2R91A 4HZMA 3AQUA 4RK8A 5I3GA 5LIKX 2QJNA 1IT0A 2YB1A 3EXRA 1K02A 1VYRA 4IP7A 1XRTA 2XIMA 1GW9A 3HA1A 3JRKA 1OFRA 3GNNA 3WQVA 4B5NA 3SI9A 3QTGA 3AXKA 1XUUA 5E1QA 3WELA 2AQOA 3WYZA 4C60A 2GVGA 5K2ZA 3PNUA 3KOWA 2GGEA 1CW2A 3W6MA 1H61A 3ANVA 4CNTA 1IV8A 4O4WA 3C0QA 4I9TA 5CPTA 3CS2A 1Q6LA 3O6CA 3STEA 3IGUA 5FOOA 3BLPX 3BG3A 3LB0A 2PPGA 4NY2A 1TELA 4Q4OA 2F6KA 3M0MA 1MI3A 2NUWA 1H7XA 1YYAA 3IAPA 3VIIA 1T8QA 4JFUA 3CNYA 5EB8A 4RNFA 3UPWA 2ACUA 4JDYA 4JZ5A 3D0CA 1EZ2A 4UB9A 4HOZA 5HULA 3QHOA 2Y8UA 2QPUA 2A5HA 4QAWA 3UG8A 3ARQA 3BJFA 2HMCA 3VE7A 5CZSA 4HYWA 1TPEA 4FX6M 4KESA 4S1FA 3TDFA 3RU6A 3RX4A 1ZRQA 1EJ7L 3G1YA 3NQBA 3EEZA 2ZDRA 1FWTA 1BG9A 1QPRA 2POZA 4FSAA 1DV7A 1UD4A 4QXIA 1CLVA 2QT3A 4HQVA 5BRBA 3EB2A 1UR4A 4ZQNA 4DIAA 3I65A 5FJIA 4HSOA 3T4CA 4AZCB 1I1XA 5DQPA 4X9SA 4BS0A 4WY0A 4MGGA 5M17A 3TLQA 3P5ZA 1PS9A 4PCNA 5HNNA 1GVEA 3CGTA 2C0AA 3UJFA 4RPPA 1G0CA 4XZIA 4QBXA 3GAYA 3M4HA 3C2VA 3K1DA 2PDMA 1JZ5A 3VC6A 5EBAA 3RGTA 3G0XA 1I2QA 5C9ZA 4KETA 2Z1KA 3DFPA 5BWFA 1DHPA 2QDHA 3KRZA 2YJQA 2QLYA 3TTSA 1E0UA 3M44A 3LHVA 1DWFM 1F3EA 3UNDA 1JD9A 3S2NA 2RAGA 1AD4A 5C7VA 3R7MA 4LV4A 4HMNA 3C2EA 5LZLA 1M03A 4FNTA 2HE8A 2XJ7A 2XHYA 3TIMA 3WQEA 1R2SA 4JQ4A 1Q65A 3MZ2A 4E2VA 1UJQA 2ATMA 5HWMA 3NQVA 3OB8A 5DEZA 4PBFA 4AHOA 3VIHA 3R79A 1W9PA 4HPHA 1WDDA 3NPVA 1RHCA 3EWZA 2C13A 2WOQA 2C19A 3CQIA 4W84A 5CSRA 1JZ6A 1BSLA 5A6SA 3QHNA 3GTIA 3LHTA 4J9JA 1BLIA 4L1XA 1AJ2A 3TSDA 2VX5A 3HGOA 4AW7A 1YKWA 1UYQA 5DCBA 3TYUA 3NL2A 2VDIA 2V2DA 4FALA 5A8PA 2NQ9A 2DQXA 2NVAA 1M7OA 5CG0A 1TMQA 2FPTA 1R8LA 2NX3A 1EQCA 2JKAA 2GL5A 5M03A 1YW1A 1FCUA 4M6VA 3L0KA 3PTQA 1W5QA 1XLEA 1VFOA 2CEQA 4N9EA 1FFQA 1UOKA 3FXGA 4LAMA 4XVDA 2EXOA 4PYSA 1Y5XA 3UR8A 4XAGA 1Z41A 2F61A 2EO7A 1J12A 4K2SA 3SRDA 1XP3A 5E9AA 1Q2SA 3W7QA 4IGNA 1VGAA 1U5HA 4KERA 1Q4WA 3FYYA 3RCNA 1IWAA 1S3HA 3STCA 3GX9A 3B8IA 3A3XA 3A6OA 5FJPA 3URBA 4NZ4A 4Y7EA 3NURA 3UXAA 1J18A 5JH2A 2YFOA 3BH4A 1JIBA 3L5MA 4ADSA 4UTFA 3AIUA 1TVNA 3AIQA 1MXGA 1VBRA 2W5FA 3OQ8A 4M81A 2XVGA 3BL3A 3U3HA 1EIXA 2GGHA 5E70A 2AGKA 4CD5A 4Q4KA 5CXPA 3GC5A 1TVPA 3T0CA 1FTXA 3USZA 1RK6A 2YW3A 2ZVRA 5DY2A 2VURA 5REQA 3BDKA 3IUIA 1IXPA 4H4IA 4EAYA 4EVZA 1V4YA 3GXIA 3UWZA 4MWAD 4PCTA 3JU2A 4WUIA 1WZAA 2X1IA 1XIGA 1US3A 4WHBA 1I45A 4B4FA 3RJXA 4UFHA 3UZ5A 1EDGA 5EFDA 1W1TA 4TIMA 3N9SA 3GVQA 1J0ZA 4WOQA 4NKCA 4CU7A 3ZS4A 2ZRWA 1NU5A 2X0HA 1UP3A 1ZPTA 4IUOA 1KFJA 1C8YA 1PKNA 1GOKA 3WH7A 2DJXA 3E12A 4BF9A 4KFNA 4AWEA 3YPIA 2H8ZA 2ZX9A 5KZEA 4CNUA 1GT8A 1ME7A 3W1TA 3OBKA 4FLRA 2OO6A 3F4NA 4ZB5A 3TN3A 3BCDA 1THFD 3N4AA 3O0KA 2V63A 2DUZA 1E55A 4O1CA 3NGFA 1TE6A 1MEWA 3VILA 2IS7A 1E4IA 2ZZ1A 1DIEA 3VD7A 2WXDM 1SZFA 3WD0A 2P8BA 4IIEA 1E4NA 5G2HA 3PG8A 4UQAA 4C6DA 1V02E 3NCOA 1AG1O 1YXYA 2OO0A 3OGSA 1CENA 2RGMA 1B3WA 1P6WA 2HCVA 2QCDA 5LYRA 4D8ZA 3VCCA 2XVKA 5JVLA 2VC5A 1C92A 3RX2A 3UERA 1EC7A 1XPGA 5HUPA 1MQRA 4YN5A 4DBDA 3WN6A 3WLHA 4LB4A 1UKTA 3FIGA 4H04A 1H11A 2XN2A 3R25A 4GJIA 1QNRA 3MUAA 4BK9A 1QVBA 1LWJA 5I23A 3KDNA 1A5AA 4JTSA 3EDJA 1A47A 3MSYA 5C9WA 4AD5A 3L23A 3TK7A 2Q8XA 3IRSA 2AKZA 1RPKA 5H8PA 1MUMA 3UU0A 3KS6A 4C6CA 3WNMA 4I9AA 1HKWA 4MJ2A 2WQDA 1YNPA 2PMQA 3KBMA 1GEQA 4FXRA 4B5SA 2PUZA 2QYGA 3LNMA 4LV9A 2P0IA 2GSHA 4AY8A 2E1WA 4QDPA 4O19A 1YPXA 4NL1A 3MV01 4WY0F 3SADA 1A53A 2NLYA 5FEWA 4KMQA 1S1RA 5HQLA 4IP5A 3F5JA 3E6EA 1HF6A 3CWHA 1M3UA 1FHUA 3WLQA 3NZ1A 3PTMA 4GXMA 4S3BA 5C54A 4WJEA 3MP5A 3LQLA 4C1NA 2V5JA 3LX9A 1W3TA 1G94A 2PP3A 4KCTA 4X2RA 1B9BA 3WJYA 1P5BA 1GG0A 3JR2A 3QOKA 4QG8A 5ABTA 4K7YA 4GA8A 2ZRZA 4Z1CA 4F2UA 4FLOA 3THUA 5BMWA 1Q7MA 3POCA 4EANA 4BQ4A 4AZCA 1HFBA 2OPJA 3E9AA 3EA3A 3M6DA 3OVGA 1R9YA 4OV4A 1MW3A 1I6NA 4LRSA 4LX4A 1RQEA 1CXHA 1SYTA 3LPFA 1X8FA 3M07A 3P67A 4IMFA 1CGXA 4KCUA 5I77A 3PF3A 5XINA 2G3IA 2QV4A 3WDQA 2CIPA 5FL0A 2I16A 1UR0A 4ATLA 1UOZA 3SQMA 2Z24A 4RE4A 1HVQA 4YTTA 3PBGA 1OF6A 4DI8A 1NVMA 1FCQA 4OU1A 2R14A 1WQ5A 2PTZA 2PLMA 4LAUA 3HFTA 3HPFA 1E9IA 3VNIA 5CBJA 4O0QA 2P5NA 3TYBA 5ABFA 3LHYA 1H3GA 1TR1A 3B9NA 4IJCA 4JXCA 1GGOA 3BTNA 3VO0A 5EMKA 1GYMA 2X2GA 3W29A 1QI5A 3TXVA 5FF7A 5CGMA 1E73M 1NFBA 3GDBA 1UASA 4PCSA 4IOTA 4CN1A 3RM4A 1U5JA 1F8IA 1JI2A 3IANA 5LHEA 4GQGA 3I7QA 7ENLA 5LIYX 1YDOA 3V18A 1JCYA 3W86A 2DGAA 5ECUA 4ASTA 4U5KA 2PWDA 3PPHA 3LA4A 3LHWA 5I5RA 1DXEA 3I6RA 2ZXBA 4TO8A 4E8GA 3UA3A 1QW7A 3CV6A 4QS6A 1PVNA 1NEYA 1Q6DA 2X05A 4M6QA 3IIZA 2ZTJA 1SZGA 2ACRA 5PTDA 3QYQA 3EA2A 1BXCA 1SO3A 2DSWA 3GIYA 3VI2A 4JTRA 5D37A 1B2YA 1VFSA 3ZR4A 4GIRA 4D6CA 1FHVA 2R9RA 3TNBA 3PZIA 1XYCA 1M7JA 4IIGA 4Q4SA 4DBEA 3PZMA 1XIDA 2WWCA 4YU1A 4W9TA 3VMOA 3ZVIA 4HJFA 3S47A 1AL7A 3ELFA 3TU9A 7CGTA 3RCMA 3GU9A 3MWCA 4LUIA 3UR7A 4PUUA 2DH3A 1J11A 2ISWA 1L2UA 3MSRA 2QIWA 5E93A 3DI0A 1DJGA 2YBVA 3E1F1 4M80A 3FOKA 3LCFA 2POTA 1K77A 4XVEA 2E40A 4XB3A 3T42A 3QXBA 3H55A 2BY3A 4DXKA 1TQJA 1JGMA 4UFMA 4HA0A 5CJMA 4DM1A 1W9DM 2E6AA 3VIKA 4XV0A 1X38A 5IFTA 3SGZA 3WD2A 5LNWA 1MYRA 3VX0A 5AC5A 3ZJKA 5CGQA 4YLWA 2X1RA 2OX1A 2Z4GA 2NSOA 3UPMA 2NV2A 3N15A 1J96A 2GJPA 3MKCA 4X63A 3UJ2A 3APTA 4FX8A 4PB5A 2QPXA 2PCEA 4UTWA 3GTHA 1FWJC 3QR0A 1ZP4A 4DYEA 1KFBA 5HR6A 4AXNA 4Q8TA 3QGAC 1K4GA 2ZE3A 3CUZA 5FJJA 2WNWA 1XBYA 3A13A 3RR1A 1K9DA 3P5YA 3T6CA 3SCUA 5HBFA 4D9PA 4LYKA 1ZFJA 3FEMA 2H3BA 4E4UA 1UHVA 3LXAA 1YDVA 3C86A 2QVHA 3WJWA 3BO9A 1PL9A 4O50A 5BZAA 2ZZ4A 2GUYA 3N18A 2J88A 3LOTA 2PDUA 5AOUA 1OYBA 3WMSA 3GYCA 3BWWA 2PGFA 1I0DA 4X61A 3FK4A 3CAKA 4CCCA 3VFCA 1GCYA 2NX9A 3QHMA 3QMTA 4W4QA 3S5ZA 4M1BA 1W32A 1PJ9A 1VR6A 3NJ3A 1ODUA 1A3HA 1EH9A 2XIBA 3UG5A 1YPFA 2ALRA 4WR3A 3R8HA 1VLIA 4YVVA 3NZGA 5I79A 3WJZA 4D6HA 4JPGA 1RP9A 2I17A 4BI7A 1Q6OA 2J4GA 1N8WA 1X1OA 1TVLA 1VAHA 2XVPA 3UF9A 3UJRA 2Z2AA 1G67A 4ZA0A 2EAWA 2G3FA 1Z32X 4HP5A 5TAOA 3CTLA 3S9IA 1HJUA 4HK7A 4DUOA 3EX4A 3GVRA 3PZUA 1WKDA 2DVTA 4N4PA 2EKGA 2CLEA 2OB3A 5I3FA 3W7OA 4FMVA 5C0QA 3N4EA 4OV9A 3RLHA 3OVQA 4YS1A 4AZGA 2WB5A 5A8QA 4JDBA 3MYPA 4ERIA 2DW7A 5HANA 2Y0FA 1YBQB 5K4XA 2PDLA 3W7DA 1TZZA 3G3MA 4DB7A 3MVIA 3VDAA 5ABGA 2NUXA 3W81A 4OQVA 3IACA 3KTCA 3K46A 5IHSA 1VF8A 1VBGA 4GK8A 1H0IA 4H7VA 1DTNA 1XUZA 3CUHA 3ITTA 4ZO6A 2J7DA 2QF8A 3RILA 2FHBA 1IEXA 3DYOA 1D3HA 2E67A 4J3ZA 2XDFA 4LT9A 3VPLA 4S3DA 1EHNA 2VWSA 4C7GA 4DWSD 3W6YA 4NX0A 5CH9A 4B5WA 4GQQA 1LRQA 3LPGA 4L4PA 2XSBA 3N2OA 2PTWA 1ZALA 1W6TA 5AHFA 2BY2A 4ZQPA 4A2RA 3NEVA 1ZSXA 3BW2A 3C8NA 1F4HA 2PC4A 3WK2A 3HPZA 4RZ4A 2R1LA 1WDSA 3WNPA 4QQ3A 3HG2A 3P80A 4YWSA 5A2BA 3ORWA 3UFYA 3G22A 1H7WA 6ALDA 4HOXA 4IMDA 4R27A 1F6YA 4MVAA 4RDZA 5XIAA 3ZLFA 4ECLA 1UKQA 1XCXA 1KGUA 4UXDA 4MLJA 3SUVA 1J10A 2JE8A 3M41A 3ARWA 1BQCA 1C91A 1TJ0A 4E38A 2GWNA 1PV8A 4OIFA 2DZVA 1ITCA 1KTNA 4X9YA 5EMLA 3FAXA 3KTXA 1PO9A 2ICSA 3CEPA 1XYLA 3NZQA 5DMYA 2P3ZA 2Z7KA 1KQZA 1FDJA 3TW6A 1P7TB 3NL5A 1DPMA 4YL2A 3NPUA 3CHVA 4RW5A 1JDDA 3VOHA 2YCIX 4O16A 3F4CA 2VXNA 3CV1A 2ZXDA 5EA9A 3P6LA 1QNPA 3A12A 1BG4A 3NL3A 3KL3A 3GBEA 5H6HA 1OHLA 3CUIA 5DMLA 3PWGA 1UKOA 3OYXA 2CBIA 4GNJA 3IJIA 4HMEA 1LJYA 5I3DA 5TBOA 4OJYA 1XYZA 3LPPA 4QLLA 5AKQA 2OEJA 3B0XA 1XIBA 2PF8A 3TJIA 2E6DA 2CU0A 2OU4A 1O1ZA 5AHIA 2XH0A 4M6PA 3MHFA 4L80A 1B31A 3ZQ9A 3GHTA 5LKYA 2J66A 2ZUNA 4MNJA 4KWVA 4IL2A 1BYCA 2WZIA 1E1CB 3G1AA 3IK4A 1DXIA 5FSEC 3K8KA 5G4HC 4IL0A 2C3ZA 2O9RA 4C5YA 2VCBA 1HIZA 4LNYA 2Q02A 1UUQA 2J6VA 4RNIA 4URIA 2NT0A 4IG2B 4F0HA 3UW6A 1GZ1A 1MW1A 2PDHA 1XIMA 1CXFA 2PD5A 3WK1A 1BD0A 3BAJA 4OT7A 3VUPA 3UG3A 1JVNA 4PUNA 4CNPA 4GUJA 2XH2A 3PB2A 1E71M 4ZB2A 4EF9A 3OYZA 4YNGA 1ZGDA 4KWWA 3SUTA 1ZBCA 3TUUA 4LEQA 1IXNA 2AAAA 1R3TA 1UWTA 1XH1A 4C90A 5DCEA 2A7NA 3OP2A 3AHYA 3L5LA 1XGZA 2FJUB 4F8XA 3S5OA 3EEGA 3VABA 1H50A 2CPUA 3KVKA 1ZS2A 2AL1A 3AZTA 4GCAA 1SSDA 1MEHA 3GVVA 4J3SA 2QHAA 4AMAA 1CXIA 4LTSA 4FNQA 5EKYA 3WLIA 1QWGA 3UJSA 2ZFAA 3V5CA 1ZP3A 4UC5A 2IW0A 4HK5A 4R85A 3GNDA 3QQ1A 3UETA 4S3EA 4HOWA 2CC0A 4RXFA 2RHGA 5EMYA 3IV3A 4CCDA 3E0WA 5D09A 1W1A1 3MW7A 1XC4A 4PZVA 1KFKA 2WVVB 2ZADA 3EOLA 4R53A 1XJBA 4W87A 3PN8A 3WG6A 1RJRA 3T08A 8A3HA 4A3HA 3TA9A 3MA8A 1R46A 2GDUA 5DLCA 3VUSA 5FEXA 1RZMA 2ESCA 4O13A 4MY9A 1FCBA 2Z1VA 3VNJA 3N73A 4IPNB 3ARPA 3K4WA 1Q5MA 4C6LA 1XH0A 1U30A 2VZVA 4DQWA 3LN3A 2VD8A 4QG9A 1S2UA 3VDHA 4MPQA 3G6MA 5HOSA 1Z8AA 1CCWB 1G69A 4JTQA 4KCWA 1GOMA 5CC6A 4DYJA 2TODA 1G4SA 3WEZA 4HNVA 4MOZA 4YTSA 1YLVA 4NP7A 4WEVX 2Z1BA 3TP4A 1MQPA 4D1IA 1W9VA 3W74A 2Y61A 1UZHA 3U7VA 3GNOA 4GVFA 3AYVA 2B7PA 4LYQA 4UTUA 3TAOA 1GQNA 1NDYA 1NWUA 2IUZA 4MAVA 3C2FA 4V28A 4MFDA 3EWBX 1E72M 1JGIA 4DXXA 2C79A 4DWSB 4OKDA 3GZAA 1OGBA 3CHFA 1XLJA 2I5GA 3WLPA 4JX4A 4ONVA 4IJBA 2JQXA 3TN5A 1L9WA 1X98A 3I4EA 1LZOA 1V6TA 1FA2A 3K1GA 4UMCA 2D2JA 4Y9MA 3LTYA 4MADA 3VKKA 3RYSA 1VFFA 2EJ1A 3ANUA 1JZ7A 4S39A 4XBKA 3WLNA 2CZDA 5D8WA 3LBMA 3XINA 4N7QA 2G8ZA 2F84A 2PURA 1UH2A 1KV8A 4BFAA 3PZNA 2X1TA 3VM7A 5BXPA 1OK4A 2R1PA 4QJ5B 3PAJA 3ZIZA 3B06A 4LANA 4I8DA 1I9CB 1ESWA 3S83A 4UTMA 5HATA 1FWNA 2OJPA 2WMIB 4NHVA 3KRSA 5D9OA 1R2TA 4AD1A 4JX5A 5AVNA 3F1QA 1H7RA 2QCLA 3VE9A 4D6EA 1XG4A 4JX6A 2GOUA 4ROQA 4D6GA 3Q58A 2F38A 2OWXA 1KM5A 5I2UA 3LGDA 1HKMA 5FIPA 1AL8A 3H2EA 3VDBA 4QLKA 1W91A 2MANA 3NM1A 4XK2A 5LNUA 4DJED 3URQA 3M0YA 1NFPA 2QUMA 1BEUA 2ANUA 2ATSA 1M9HA 1C90A 1S2WA 3AROA 3U0HA 3ABOA 4P8XA 2V3FA 2E0PA 4C6OA 4J5NA 3QJAA 3RM8A 2YIHA 2OYMA 3PJWA 3UGRA 1UMYA 3S4TA 5MKGB 3G8EA 1RJPA 4O8AA 3REQA 4F9JA 2DT3A 3U8GA 3F03K 2OEKA 1F74A 3KXQA 3V4BA 1A3XA 1GJPA 3LMZA 1O5KA 1I75A 3FFSA 1JD7A 3CK5A 2OT1A 2QULA 1MZRA 3UZXA 3OBAA 3UYCA 4WSJA 2FYMA 2QR6A 2GJXA 2GGJA 4ZB0A 3W82A 4JIHA 3MP4A 1QUMA 3QV6A 3GTFA 3RO6A 3W7PA 3SIZA 5D02A 2NV1A 3VU2A 3SFWA 3BPWA 4KFOA 1HKKA 3VCRA 5SWUA 1BXBA 1DHKA 3R13A 3TTQA 3W2MA 2VUYA 2CYGA 1ZL1A 4OGZA 3DYMA 3BGAA 2ZICA 3OEXA 3BZGA 4H6RA 2VFFA 5K9CA 2YDAA 3SW6A 3EPOA 1XFBA 4H41A 3NO3A 4QIUA 1XX1A 1IZJA 3SR7A 2A7PA 3SFKA 1W5MA 3WQDA 2RFGA 2XH7A 2PSNA 2CLIA 3E5PA 1QI3A 5HDRA 3S5SA 4CQDA 4H01A 4XSMA 2BB0A 1JPDX 3ARVA 2ZRXA 4AIBA 1FWIC 3JZUA 2WJFA 4KPLA 1BXNA 3GNRA 1VHNA 1PPIA 4DLFA 5D9MA 3RFAA 3OO2A 4GMEA 2VGFA 1KCKA 4GQRA 3W9ZA 3W7CA 2VR2A 1GOIA 1UW9A 4IX0A 3T81A 4GLEA 4S3CA 1Z48A 1B3VA 4GHRA 4TUFA 3URAA 1S3TC 3QBUA 3B9EA 2Q8LA 2PDIA 4S3JA 4N2YA 1TQXA 4ZQOA 3KAOA 3N29A 2A2IA 2VFIA 1PKMA 3AHTA 2WM0A 4IIFA 1OZMA 2B7NA 5D2YA 1BSIA 3WBXA 1OCQA 4I9JA 4U5IA 4DJDD 2Y62A 3MMWA 1K1DA 1JNDA 2QCMA 3EWXA 1PZ0A 2J7HA 4WRHA 4O53A 3THDA 1CLXA 2J25A 3OLDA 4RE3A 5DMMA 4K3ZA 3R5EA 4LJ3A 4JNMA 2Q6ZA 3KLLA 4W89A 5DXXA 2R24A 1ADOA 4UUIA 1VBHA 3CZKA 5MHBA 1A4MA 3R2GA 2D2GA 1JF5A 3NWRA 1Q7QA 1KCZA 4B2DD 5A6BD 3VGGA 1KA9F 3VOFA 4CUCA 5C9UA 3KUMA 3KZPA 3GXMA 7XIMA 1QO2A 4HKPA 5GVJA 1HN1A 1H49A 1F6PA 2FH6A 2QUTA 1AZ2A 2ZYFA 4Y96A 1DIKA 4NZCA 4N9CA 4L6OA 3KVLA 4GZJA 1VCVA 2H9AA 3IVUA 4UTTC 2UY4A 4V1XA 1GVOA 5DRCA 4Q4PA 3COTA 3L4XA 4WLCA 1EC9A 2ZIDA 1MUWA 3GS6A 4UFLA 4XAYA 1VJZA 3U6WA 3W1MA 5FKYA 4KWOA 3AALA 5BWAA 4GD0A 4M19A 2HV5A 2OX4A 4KWUA 4LF2A 2WCSA 5HWNA 2TSYA 2W61A 4E8CA 4AYGA 2WJDA 4G1KA 2DUXA 4CNOA 1DEDA 3G5EA 4ZE4A 2DH2A 3ATZA 3I7RA 3E0LA 1O5RA 3AISA 4GUGA 3CMGA 3VFLA 3PJXA 3KVJA 3G18A 4EXQA 3T4WA 4BHYA 5TD4A 4H00A 2PWFA 1MNSA 3DFTA 5CBBA 3W70A 1XLMA 3SGUA 3BAWA 5JBEA 3RLGA 4A22A 4MUZA 3MCNA 1P4CA 3KWXA 4NQ1A 3B9DA 3S2MA 4UTLA 5XIMA 3WENA 5J04A 2OGJA 4WKFA 3WFAA 2BP1A 1OIMA 3GY1A 4FNPA 2IQ0A 4W7VA 1XBZA 4W93A 4PMNA 5ECVA 2YBUA 3EWUA 1E51A 1SR0A 2A3HA 3N9KA 1OCNA 3M47A 1K7FA 2X2YA 1DIOA 1P0EA 4GXWA 5CPMA 3BC9A 2IXVA 1CGYA 1K4HA 6ENLA 2CXGA 1I2PA 4UFJA 1VFLA 5CZJA 1ZTVA 1UD2A 3DBPA 2XVNA 1OX4B 3UP8A 4ENLA 4G1NA 4HB7A 4K36A 1J0JA 2HK0A 1WXZA 4DJFD 3N6HA 5D2XA 5CJ5A 3RMEA 3Q45A 3LRKA 3AXHA 8CGTA 2D2HA 1Y5WA 3QW4B 4P8VA 4R33A 3VGHA 4QNEA 2XIJA 2H8XA 1KTCA 2J9YA 1VRDA 4YYFA 1VPXA 2VFEA 4Q22A 2Y85A 3P82A 5F4XA 4GI6A 1JYXA 3SM0A 1UBPC 1S2VA 4UOJA 4QE4A 2Q3OA 2RJHA 4FXJA 4JTHA 3L9CA 3SQSA 3QZ6A 4TV6A 2C1HA 5HMSA 5B80A 5K9DA 4QDMA 1R0MA 4REQA 2J7CA 1I2OA 4YXGA 8XIMA 4GI8A 4QR6A 2DUAA 3WQFA 3PZQA 1R86A 1XS2A 2J77A 1SFJA 3NYZA 4I7VA 5BYWA 4NIRA 2O0TA 3IIXA 3V35A 4F0SA 3ITLA 1YNYA 4S3FA 4HZ8A 4Y9PA 2QJGA 4LCRA 1CEOA 2BOEX 3CAWA 2QJMA 4V27A 3CLMA 3W7KA 3V7PA 3LLFA 3BAIA 3LRLA 2Z2UA 3W2LA 1JFXA 3MY9A 1UBSA 3AMLA 1EDTA 3S8HA 3B0VC 4E6MA 3TH6A 1PHQA 1GOWA 3LDVA 5C2GA 5CJNA 5MKGA 3HB9A 1KR1A 2OXNA 4GNVA 3B9AA 5A3HA 3CL6A 4KF1A 4IX2A 4LF1A 1NP2A 4Q4QA 3B8UA 4F0RA 9CGTA 4WIWA 3LSBA 1IF2A 3W7EA 3FA3A 3WMLA 1C93A 5LNRA 1WPCA 3ENLA 3RPDA 3WUEA 3FLUA 2PDKA 2HQAA 3HF3A 3RRXA 4MYXA 2WZHA 4IT1A 4DF1A 3KP1A 3FYPA 5AYZA 1NDZA 2G95A 2NX1A 1OABA 3C0JA 2DW6A 3S2LA 3VD9A 5I3JA 1AH4A 4HNUA 3GZ3A 2C1GA 3HJZA 4Q7BA 1S2TA 4PR4A 2VFDA 4IMEA 2O9PA 5D03A 3RM9A 3MUXA 5EL1A 2REQB 1CX9A 4AZIA 2P53A 1JJKA 4CQCA 2Y8KA 2XINA 3CUJA 3QGVA 3NQEA 3ZJ6A 1TJ1A 1HO1A 3V1PA 4L56A 2EG7A 1TV8A 1TUFA 1UR9A 3W1PA 1KW1A 1W17A 3LXBA 4KRZA 5DXYA 5H91A 1IZKA 4CCZA 3LCWA 4H9VA 5EGRA 2RDXA 2C8NA 3N25A 1D3GA 1EA0A 1VLWA 2ZZ7A 2CLPA 3MT1A 2WC7A 3OA5A 3CIWA 4JTGA 4ACZA 4JY8A 3L66A 4IPLA 3QZEA 2PC8A 3A23A 2HVMA 1ZENA 2C91A 4YHEA 4IIDA 3DGRA 3L68A 2X0YA 1MXSA 4S2BA 2WVUA 3MCMA 3FNDA 1OG0A 3F2CA 2HRWA 1HL8A 3GB6A 2CITA 3UY8A 4NAEA 1WKFA 2EKCA 3UCCA 4CN4A 1TUXA 4B90A 2Z25A 2WCGA 1CB2A 4HD5A 1J0HA 1UWQA 5GNYA 1DQUA 1E4MM 2DIJA 2WZTA 1XLKA 3WH5A 5HNRA 3QR1A 3SSZA 3VVGA 4D8LA 1A5SA 1CPUA 5D04C 3BZJA 3OVPA 4KH2A 4M82A 4IFRA 5C8BB 2ZA1A 3AO0A 1E0WA 2CERA 2ZC1A 3O8AA 4P5UA 2VKZG 4HTYA 7TIMA 1YE6A 3GXFA 3R6IA 3E0VA 5F4SA 2CBJA 3TN6A 4GXPA 2P0OA 5G2WA 4FPSA 1E9LA 2I1OA 3B8DA 2BNJA 5C71A 3GUWA 3GNPA 3GDMA 1CYGA 4Q6JA 1WOAA 5C2CA 1QW8A 2HPIA 2FMOA 3OW1A 4CD8A 1LLOA 5D2WA 1LBLA 3EXTA 2V6AA 1AH3A 1K3UA 1TV3A 1NH6A 1QOQA 1PCWA 1SFSA 5E6ZA 5C2XA 3CO8A 2A7RA 1CZ1A 4DM2A 3GR8A 1KBLA 2DSVA 3E74A 1JZ4A 1OZQA 3DEQA 1FH7A 3TEVA 3MUY1 3UZYA 3TZNA 1X97A 1E1EA 3AYTA 1JNEA 2YLAA 2ZC8A 3CO4A 1PAMA 1ZUAX 1E0XA 4JEJA 5D4YA 1W5PA 1VJIA 4ZL1A 3TV8A 3N14A 1SW7A 3K5XA 4B5TA 5IOBA 4F66A 3LBOA 1UIPA 1L6SA 5I09A 1J8VA 1REQB 3LYEA 1P0KA 1OCBA 1A50A 2L5HA 3MUIA 2W67A 3S42A 2OGYA 3B0PA 1OGGA 1ISZA 4L6DA 2E28A 1QPQA 5JIPA 2GYIA 1YTDA 4TMBA 1KLZA 4S2CA 1PKLA 1E43A 2H3DA 2Y5EA 4JIPA 4M24A 1OVDA 1IEIA 3CH0A 1CDGA 5EMJA 1PTDA 3WQGA 3D5HA 1GOOA 1WDPA 3ABQA 1KFCA 4JL2A 3KM8A 3ZT6A 4G7EA 3S2CA 2VCAA 5LA1A 3OZMA 4JN6A 1BFNA 2HVOA 4OE7A 3M5XA 3ITXA 3W38A 4DZIA 1MMFA 4XIAA 1XKJA 2W4XA 1ZQ5A 2G96A 5LA2A 3N12A 4EXBA 3M64A 1L8PA 3PBVA 3N6JA 1YE4A 3L4WA 1BVWA 1QO5A 4JICA 4MWAA 1IIHA 4G56A 2IQDA 2PI6A 2FVMA 3NDOA 5CSYA 4RKAA 3GKAA 4JIIX 5HJLA 3A9BA 3W2JA 3QV8A 7REQB 2ZCGA 3NDYA 2PDWA 3QY6A 4E3VA 3V0UA 2YXGA 2A79A 3SIMA 4DWSC 3EOEA 4JYEA 3VKBA 3L67A 2GDVA 2YL5A 1EPVA 1YPIA 3PFMA 1OC6A 4RJEA 1EBHA 3E0IA 4K8GA 3W24A 4GIAA 4YJ5A 4AWSA 4RXGA 1JQVA 2FDMA 3KBJA 1W1B1 3NAVA 2QEZA 4HMDA 3UD6A 2WMJA 1TV2A 1EWDA 6REQA 2WSYA 2VC9A 2ADAA 2G5WA 4GABA 4AX7A 2ZUSA 1TPFA 1UP0A 4ZSTA 3R89A 3M0IA 3PULA 5KTLA 4MNLA 5HK4A 1XRVA 1VRXA 1LL4A 3R4IA 1QCWA 4JIQA 4EWND 2V82A 1M01A 3JZEA 3DG3A 1N82A 4RV3A 4IMCA 4LW7A 1ZB5A 2GSJA 3LCXA 3CL8A 4J7RA 4H3DA 4KIEA 1TV4A 4YWIA 1H5YA 3FDGA 3UR2A 1YADA 4IFKA 3IJ9A 2NQ5A 2PDJA 3UWQA 4H9ZA 4MDPA 4HHPA 2ZRYA 3EDDA 4ZE5A 4B3ZA 3CBWA 3CWOX 4MIMA 1MQQA 2VL4A 3H2AA 1YNQA 1IR2A 4FXFA 2Y6ZA 2WM1A 3EX3A 2YXXA 1A5UA 1TR9A 3USBA 1HG3A 1HX0A 3WQCA 4F2TA 2G41A 1V0NA 3R1ZA 1P48A 4P7QA 4QCEA 2E1DA 3GIPA 1MEIA 3V16A 1X96A 2QXWA 4MY8A 4DPQA 4JTFA 1FUYA 1L6YA 4B15A 1IWPA 3LZ3A 4JYDA 3CB8A 4DO7A 1GVYA 4NJIA 1QI4A 4JHOA 3NUKA 3EA1A 3O05A 5HNTA 4HCHA 1NM9A 4I6KA 1PXGA 1ENUA 3TW7A 3H53A 4H9MA 3L5AA 4GY1A 4HZ7A 2VOTA 1KCXA 4H2HA 4XAPA 4Z08A 2NQZA 2W91A 3QOMA 4B91A 5G2IA 1W1IE 1UCWA 2HWGA 4CEXC 4A8IA 4FR1A 4KRUA 3GH7A 1TJ2A 3DG7A 2XIQA 3CUXA 4MG4A 3QFEA 3CZJA 3TYCA 1D9EA 4OUEA 4L61A 1A5CA 1LDCA 3OJGA 5BOOA 3DHFA 3DX5A 2V69A 3SEPA 3VZXA 4CNNA 3QGKC 4UWMA 3SZ8A 3DI1A 1QHOA 4GUIA 2D22A 3R8GA 5KEZA 2R6OA 1HQTA 4MF4A 3AXIA 3EDFA 1R87A 1KFEA 3DU0A 4Q8MA 4U2YA 1LT7A 3LV5A 3P61A 2B7QA 1WXJA 2V9DA 3GW0A 2CKSA 1NF7A 4HCLA 1ZCCA 2VGBA 4QITA 1EYEA 4DWDA 3VOGA 1ZJBA 4XISA 1V3IA 5DBUA 5D32A 3OQEA 1KBJA 3UR5A 3EB3A 4O0KA 1EF3A 3G1XA 4W7UA 1V02A 2XGZA 2C71A 2VDGA 3TQ0A 3VTRA 3GRIA 4GUHA 3EZ4A 3VOJA 4GYKA 4GOAA 5E0CA 3BMWA 5EPDA 1EB3A 1AZ1A 2Y7DA 4PMXA 1HGYA 1E1FA 4CQBA 3BICA 1ZJIA 4JQ2A 3W88A 5JQ9A 3Q65A 2X42A 2YCJA 3EMQA 3GTXA 4US5A 1JZ2A 3UXIA 5T91A 5CG7A 3SJNA 1QPKA 5TIMA 1IHIA 3UQNA 3CB3A 2XYLA 4LC6A 1X1ZA 4JFVA 4L4MA 3FVDA 3QVQA 3O06A 2VJXA 3Q94A 5DY3A 1HVXA 1IT8A 1RCQA 4DF2A 4EP8C 1TG7A 4FOKA 5I03A 1UPMB 5FAGA 1E70M 4IIHA 2PGWA 3WQ6A 2PD9A 4AC7C 1GKRA 5I24A 4PTXA 2BY0A 1V8EA 1QR7A 5AHEA 4A8NA 1P43A 3GG7A 3ZM8A 2PRMA 1WB0A 3RRAA 1GHRA 1QFEA 2BODX 3ANYA 2IKHA 3L4VA 3UVIA 3BVJA 3NQFA 1T5AA 4R34A 3W7JA 3OTRA 3TMQA 3R8RA 1WZKA 3I3DA 2D0FA 1YXCA 1J4EA 4K39A 2C16A 4ILSA 1ISVA 2GJRA 3RF9A 3WQPA 1N7KA 4JQAA 2OZ8A 5AYYA 3I3EA 2PTXA 1Q8AA 1PZ1A 1JUEA 3NQGA 5FF3A 5I3HA 3S6DA 2CZEA 1W2PA 3WQ5A 3S6TA 4XG1A 3GM8A 4HNNA 3CH9A 3OPSA 3EGJA 1UA3A 1E40A 3T7VA 4IICA 3GUGA 1H1YA 1OINA 2IXUA 1FFRA 2EGZA 5FL1A 3BMVA 5LXXA 1FRBA 4HTBA 1QK2A 3D3AA 2HS8A 1XISA 1FHDA 3WH8A 4AD4A 4WSHA 2XFFA 2TRSA 3VIOA 3VM5A 2OFJA 4KEZA 1B3OA 4GRSA 3L12A 3HIJA 3DG6A 5M3WA 3GIQA 4M56A 4JIEA 4KCVA 2KZHA 4DPPA 4J1OA 5A6MA 3AHXA 3A5VA 3FJLA 1NTHA 4O1DA 1EUAA 2V2CA 4DUXA 1A3WA 3ABXA 3RNDA 3JW7A 5G1MA 1IGWA 1KKOA 1W1ZA 4DHGA 2HBXA 3ECQA 4QAIA 1VB9A 4JTUA 4XZHA 2HPMA 1FWFC 1ITXA 1GTHA 1KRBC 4DJEC 4G9PA 3E2SA 5LGZA 4IUGA 5IBXA 5GPRA 2X30A 3E2QA 3KS5A 4U28A 1DORA 2W79A 2INZA 3W53A 2WANA 1C29A 3TTOA 3E02A 4HHHA 3V5OA 2HXUA 2F9RA 4DAIA 1E3ZA 3G0SA 4ACYA 4PSRA 3S1VA 3M6YA 3KZSA 4G5DA 1HL9A 2DZWA 4L9YA 1KM3A 4DBUA 5AFDA 4FNSA 1XYAA 1NF0A 4J27A 1TMLA 5CPQA 2XM2A 4YCPA 2PU1A 1VEOA 1WP6A 2QKFA 3C0LA 4DUWA 2ASHA 1G4EA 3DC0A 1RD5A 5GNXA 1H5VA 2VRJA 1XD1A 4POCA 4HA4A 5EBUA 2ZXAA 4F0LA 1XDMA 4CD6A 2G0WA 2VX6A 2SFPA 4GJ1A 4J3TA 3QMSA 2A3CA 3T8QA 1TCDA 2FHFA 4DLMA 3ZOAA 1TYGA 2VD9A 3AS1A 3BLFA 3CAQA 4FIRA 2KX9A 3FSTA 1J0IA 1CGUA 1RBOB 4P2VA 3RPTA 1CXEA 4EPEC 5CC3A 3M5YA 3N11A 1EGMA 5ENLA 5KINA 3T2QA 3VKAA 5F2GA 2QCDB 1UQZA 4GYPA 5FACA 3WDJA 2J8FA 3BJTA 1XSJA 1I2RA 3VNMA 1X6LA 2FPYA 3VNKA 1UKSA 2QPSA 3OG2A 4Y8EA 3T78A 2QUUA 1SJAA 1UZ4A 4A6GA 2VELA 3TROA 3VGDA 4C91A 2P1FA 4AUBA 2C18A 2EPNA 3HQPA 1W3NA 4I5XA 1X6UA 3GE7A 1XFCA 3ZLHA 4MZ8A 1A5OC 1ZY9A 2O9OA 4NJGA 2G3NA 3AMDA 3P60A 1V5XA 4QM1A 3L0GA 1C9DA 3U57A 4WKHA 1R47A 3KL0A 4HNOA 3FXYA 4X0NA 2V3EA 3H6OA 2YCKX 4PRTA 4ZCWA 3MJYA 1LL6A 3NSNA 1O1HA 4QRNA 4IMGA 5G4EA 1US2A 8XIAA 1H41A 2Z28A 2VQTA 5IHRA 4L9ZA 2Y8VA 4DJDC 2XIOA 1JEZA 2XUCA 3RO8A 4C1NB 4PEKA 1HJXA 4FNRA 4GVIA 4AZBA 4DNMA 3TXZA 2XVLA 4PL2A 1Z9AA 1N55A 1XYMA 2QS8A 2VTFA 3GNXA 1SW3A 3TJXA 2Q3RA 2I57A 4OOUA 3WK0A 1XLDA 3FHQA 4CN6A 1A5BA 3PPFA 3V0SA 4O52A 4PRWA 1XHGA 2A3EA 2CZFA 3H2FA 1OYCA 1DWHM 4Q7IA 4YPJA 1NFGA 2Y24A 2E8YA 1W54A 3AMGA 4A3QA 3RLUA 1OC5A 3IJDA 1JPMA 2ZTKA 1I60A 1POKA 3KOYA 1ECEA 2ZUMA 4XWUA 3HV8A 1L6GA 3PANA 1XLIA 4O8RA 4V33A 4NRSA 1XIJA 2VT0A 1Y7VA 3D3FA 4MWAE 3W2NA 1X39A 4KGJA 3W7MA 1XLGA 5I00A 1RXOB 3WQOA 1RLDA 2OELA 1IZCA 3TQVA 3W28A 4PSPA 1TA3A 4RL3A 1BKHA 1BKSA 2D20A 3CL7A 1BF2A 1KCLA 1YDYA 1Z42A 3H4GA 4AWTA 3BSMA 3H7VA 3PR2A 3SN4A 4Z2HA 2VNCA 5ABFB 1XLLA 1E6XM 2HVNA 1FQ0A 1NIUA 4LAOA 3GU2A 1TTIA 5F2MA 1RCOB 1EGZA 4FR6A 3TC7A 3IV8A 4JR5A 3F5KA 4XQ6A 1SUXA 3F4VA 4NYYA 4DXVA 7PTDA 1NOWA 4I9MA 2UV8G 2OLHA 3THCA 3HV9A 2DQWA 1S46A 4A29A 4E5TA 4HU4A 4JYFA 1A5LC 1PB0A 1DBTA 1BRLA 2X40A 2CLHA 2GGGA 5D05A 1S2AA 3ZZ1A 1C7SA 1K8XA 2J78A 3MSGA 2XWEA 1PHWA 2D2OA 1LTDA 3B05A 1XV8A 1BTMA 4H8VA 2WJZA 4DN1A 4DVOA 2RKXA 2HXTA 2F7FA 3LTSA 3M46A 1GZGA 1AJ0A 4HA3A 3OHMB 4QE5A 3WUGA 2W27A 4R88A 1F2JA 2E77A 1R2RA 4DJFC 3VOIA 4IGHA 2WK2A 3QV7A 3NR0A 2Z6IA 2PGEA 1R7AA 3GK0A 1EL3A 3KOZA 1KLYA 1QW9A 2VR5A 2FZDA 4PRRA 3VNZA 4AFYA 2V67A 3S1WA 1Z69A 1GWJA 4FEZA 4BF5A 2PLJA 4HU8A 5KZDA 3CQHA 1GW1A 5AN7A 2FZ8A 3W02A 1UD8A 3VIGA 1E56A 1W8GA 1TPB1 2AQWA 4UIOA 3TTEA 3W1AA 4PMYA 5CSSA 1C9WA 1K9FA 1PTGA 4TOQA 4TVUA 3DUGA 1GORA 3TNOA 1XSIA 2ZVIA 1VFMA 1VP5A 3W6LA 3PUGA 4L6HA 4DELA 5DT7A 5CKSA 3EX6A 4PUEA 2YA2A 1SVDA 3SBFA 1RPXA 2A6LA 2GFTA 4WCJA 1J5TA 2YCLA 3NXFA 1Q4NX 1HTIA 1VENA 1C3FA 1XCWA 2CLOA 2V3GA 1LUCA 3UJEA 2CLLA 1SZNA 2BHUA 3M0HA 3ME3A 3QC3A 3K4AA 4FHAA 3W75A 1SO4A 2J47A 3VK5A 4GINA 3VGEA 2FTPA 1FX6A 2A21A 3AS3A 4QS5A 2Y7FA 3DHPA 5EU9A 1GEHA 3TSBA 4GIEA 5HJXA 5A6TC 1F7BA 3TFCA 1QPNA 4JCLA 5KSWA 3B4YA 4RZ6A 3IPWA 4EK7A 4UTJA 1V7AA 4JKMA 1AD1A 5L9FA 1XR2A 2WCAA 3WNKA 2CHNA 3AI0A 1IIGA 4S23A 3L4TA 3WH9A 4M0XA 4I7UA 3S9YA 3AUOA 3KTSA 1DJIA 1MW0A 4BWLA 5C5YA 1OADA 3A3WA 4UQBA 2VC6A 4QJ4B 1R9ZA 2WVTA 2Q71A 3IWPA 4OZOA 2PBGA 3G1FA 3IS4A 3VMNA 3UZZA 1B3ZA 4LPCA 2B81A 2EJAA 4IWWA 2FVKA 3TC3A 1LBFA 5F4WA 1M04A 2QJIA 4QJ3B 2XM1A 1TPH1 4UQDA 1ECQA 1XD0A 3WJSA 3FJNA 4H1ZA 2FKPA 4H9UA 1OFAA 2YL6A 1ZBKA 1ALDA 1YXDA 5T9CE 1QNQA 2EF9A 1I8JA 2D69A 4LVFA 4U3CA 4LUYA 1QPOA 3G1DA 3THAA 4UQEA 1FXPA 3ERPA 5FF2A 3EWWA 3PHAA 3DIPA 3SY8A 4CGTA 2ISFA 3A3HA 1UROA 3GC2A 1EBGA 3CC1A 3U9IA 5H2ZA 3DOPA 1JAKA 4TV5A 4WK9A 4RCXA 3KHJA 1PEZA 4UZUA 3N2TA 1H2JA 1GVRA 2NWSA 1LYXA 4YTQA 3KOFA 4CNSA 1XDJA 2AMGA 1Q3NA 5EMMA 4XD6A 3QV9A 3S1UA 4TVDA 4PUJA 2VEFA 2OCZA 4GYPC 1RBLA 1V3MA 1OBAA 3PBWA 3AYRA 3CPRA 2PLCA 4IXHA 3LBCA 2P8CA 3QF0A 1E6QM 3IGSA 4NJJA 3EXSA 3CJPA 4B16A 4PTWA 3FYOA 4PTVA 4B4HA 3GDTA 3MHGA 4QE1A 3W27A 2QJJA 5AHMA 4AEFA 3ABRA 4GYFA 1IEWA 3HZ3A 4XZ9A 1NJJA 1A0DA 2BV9A 1O7AA 2WNNA 3GR7A 4H6EA 2WLYA 3FW6A 1KRMA 3ONCA 2DZAA 1VQTA 2WNQA 4P8WA 1OCJA 1QU4A 3CASA 2WSPA 1TKKA 1SMDA 3TJLA 3FX4A 4ZBCA 4PCPA 3H2NA 3W4RA 2E5DA 3QLDA 5BRQA 4EOUA 1TX0A 2VHLA 2X7VA 3NQDA 1DQWA 4LUSA 4M7SA 1OG6A 2NLIA 1DKWA 2JK2A 4GNKB 3DN5A 5J5DA 4N02A 3SJ3A 1TV7A 4ATDA 2QGHA 3DFYA 4OUIA 4GH3A 3NQ2A 5E5CA 4MKSA 3W87A 3CUGA 5IDZA 3B8VA 2OZ0A 1ZAIA 4F48A 4QCFA 2BFGA 4I8YA 1YTKA 1JDEA 1AQFA 2VC7A 3AYSA 4WDTA 3G1RA 2WAGA 1AQHA 4RLIA 1R30A 4JTCA 3LCGA 3WMCA 4J2MA 1ICPA 1EFZA 1A0EA 3B9OA 3ITGA 2NVDA 2FMNA 2I5QA 1NWRA 4XAFA 3QQWA 3O2LA 2ZA2A 3NOEA 4GE8A 3BLLA 4ROPA 3CT7A 3TVAA 1DVJA 3FHAA 2VZSA 4FS9A 1NOUA 3CYVA 3VGBA 3DENA 4NSBA 5EY5A 4WJ8A 3DGBA 2V30A 2X7WA 1F05A 5AB3A 2RH9A 4ZZ9A 4BF7A 1GJUA 1JCMP 4ICCX 2O56A 4QEHA 4MAZA 3ZR6A 1H51A 3O16A 4QP0A 4EPDC 2OR2A 3H2MA 1C8QA 5IDIA 2IMRA 2Y63A 1WKYA 3GO2A 1XWYA 2ZA3A 1S38A 1LM1A 2HNEA 4JL1A 5DX7A 4XZBA 1LP6A 1X7FA 3ZJ8A 4PL1A 3VCNA 3QY7A 4KFPA 3WQ4A 3ZR5A 1K8ZA 4GZIA 2PWGA 3CZLA 2RDUA 1U33A 2JF7A 2G97A 4UCFA 5GNZA 4AZHA 1Q63A 4FA3A 1DJHA 1RR2A 1B0IA 2YA1A 1GOXA 1SW0A 1CB7B 2H6RA 3B8WA 3VKJA 5T9BG 4BI6A 3V1HA 4U33A 1B3YA 3FKKA 1F73A 1KXVA 1QK0A 4UZSA 1KXTA 5D8ZA 5BOEA 2QUVA 1FP8A 3KWSA 3ARTA 3HM7A 4MNKA 1DJQA 3UWEA 3GR4A 4IZGA 1OFDA 4G8TA 2V5CA 2ABBA 5A6BA 1LRTA 3IARA 4UR7A 1PZ3A 3ONBA 3BUVA 2D73A 2YXOA 4ATWA 4GISA 2J8TA 4IQJA 4L64A 3HGSA 1F76A 3ITCA 2HS6A 4PTNA 1GYLA 3W26A 2PP1A 1V3HA 1EX1A 3MO4A 3MMDA 3ALGA 3I68A 3WBEA 4LALA 4ZOAA 5AYIA 1PCKA 1QASA 4V1YA 4P8UA 2VI0A 1YMYA 1RLCL 4BEUA 2FFIA 1QNVA 3GAKA 4FXSA 4PUDA 4XBJA 3O6AA 4GX8A 2QMKA 5E9XA 3XISA 4CU6A 1V6UA 3T0TA 1R3SA 3L21A 5C70A 1E15A 3O0FA 4XD4A 3AZRA 3SN0A 3W01A 4EPKA 3MKVA 1MXDA 1QAPA 1HP5A 4EACA 2D23A 4GVHA 4EIVA 2J79A 2WNZA 3MDUA 3VDCA 4BEQA 3GDRA 5E09A 4LYPA 1TZ9A 3PZ9A 4PUKA 2BWGA 4Y2WA 4RDYA 3BK0A 2ZOXA 3AIEA 5D33A 4XAZA 1OY0A 5I3KA 4MTVA 2WKJA 1W56A 4XD3A 2GVJA 2E6FA 3P2VA 4CQ9A 1G4TA 4HBKA 3TAKA 1LORA 1FHLA 3EDEA 2DSUA 1H7OA 2OLAA 1UD3A 5CEWA 1KM4A 5ABEA 4JTAA 2ZZ3A 1TWWA 1B4KA 1N8FA 4Y9OA 4J3WA 1TJRA 4KT2A 5EYWA 3SDOA 4G2DA 4QSHA 2GPTA 3CAVA 3LI1A 4JS3A 4LAZA 1KNWA 1G5AA 1WE5A 4OECA 1ZLPA 4WOZA 4Q33A 4D72A 2UBPC 3QZAA 3HPAA 4PC8A 3GLCA 1FWAC 4IHCA 5U7SA 4QROA 3TR2A 3PJTA 1J0KA 3PB0A 1GUVA 1PDZA 4D71A 5TF0A 1JDCA 5LIWX 1ZBWA 4BWLC 1G7UA 1PIFA 2NV9A 4Z2KA 3CMFA 4BJHA 2E25A 3PZGA 1JCXA 3QPZA 4NZJA 3PAOA 3WKZA 4XIMA 2CLKA 1O94A 5L6UA 5B7ZA 2XTKA 3HPXA 4ZENA 4NXSA 3G1VA 2PEVA 4YTRA 1GVQA 5CAHA 1B54A 1JCLA 3PWIA 4UR9A 2IPJA 5C55A 4ZOCA 1XI3A 1XQLA 1LLZA 1HKIA 4FZIA 3G8RA 1ODZA 4GC3A 3S1XA 2ISDA 4Z2LA 1XIIA 4AU0A 2YX0A 3TYAA 1CXKA 3A9IA 3QPYA 1J9YA 4C6MA 3P74A 4JD4A 4GFSA 3GQYA 3KRBA 4QJ1A 7ODCA 1XLFA 4PCFA 4B3KA 1QHZA 2IKIA 4E8DA 4J2PA 1R3VA 4GI4A 3RHGA 1PWMA 6TIMA 3T0DA 4XSLA 3ABZA 1FP9A 4XZLX 1M68A 1XBXA 4OFCA 2Z1SA 3WL0A 4UTIA 1UH4A 3MBFA 3WZ0E 3THQA 4AD2A 4EE9A 3WLRA 4YTUA 4FIQA 5MF5A 5M5DA 2P50A 1YIXA 2PDGA 3SUWA 4MM1A 1VHCA 1W9BM 5TQLA 2HROA 1EWEA 1FWBC 1NELA 2J7BA 3REQB 2OQLA 2DT0A 3IJ7A 4LWWA 2GWGA 1MRQA 2PCQA 5T8GA 3IGHX 5AY7A 3M0KA 4R5EA 3ARSA 3SSJA 2ZRUA 1KC7A 2BLEA 1EJUC 4XZMX 1F5ZA 4U31A 4GKTA 2GVEA 4BQ3A 1ZZMA 4LVAA 4Q4RA 2YDRA 2G3JA 2NXHA 2GJXB 4Z0JA 4H6KA 4IH3A 3C61A 1FWSA 2E68A 3JUGA 3GHSA 3QEZA 5CBIA 1XGEA 3LNPA 4F4RA 1T8XA 4LFYA 3F2DA 3P0XA 2OSYA 3H8AA 4B5VA 3VZZA 4LU0A 2PZNA 3BOLA 1JG9A 1V6XA 4O12A 4A4AA 1W3HA 1KFLA 4X2PA 3EDKA 1O66A 4LUTA 1WOBA 1HJWA 3NPXA 3GVGA 4H2CA 2AAMA 2HNHA 2VFGA 2EPHA 2VMFA 1A80A 3PPGA 1MWOA 1V08A 3RMJA 4K6AA 3VNDA 2FLIA 5FF4A 5I7GA 1RVKA 3CXOA 1ZAHA 6CGTA 1EJWC 3SCQA 4QX4A 3DHDA 4E3TA 1QXLA 2Y70A 3ZSTA 3AIWA 3S6OA 1JDFA 3T05A 3F2BA 4HHMA 2VENA 3C8FA 2WWDA 1XF0A 5FF0A 5GJNA 2F2KA 4PFHA 1KXQA 4WVXA 1L2QA 1F4AA 1EOMA 3OIXA 3LXCA 2JGYA 5FI8A 2G50A 1PIIA 3WL1A 2BVYA 3AFBA 4QGCA 3L65A 3FSUA 1WCGA 1OD8A 4NZ1A 3AU2A 4ZGYA 1YTEA 2ZX7A 4TU1A 4JKLA 3ZXWA 3KCJA 3CMJA 4IQDA 4EAMA 1OWQA 2C0HA 1W3KA 3BMXA 1EZWA 2I14A 3B0YA 5I02A 2X0SA 1PDYA 2WVSA 3PG9A 3WH6A 1NQKA 2PWUA 1FVPA 1IXQA 2O7QA 5FCZA 4XBSA 3LSCA 4CVWA 5AC8A 3TWBA 2PDXA 2PRLA 2VUNA 1UR3M 3P14A 2A3AA 2PF0A 4BKNA 4M1RA 3EOUA 1VD6A 3VINA 2V68A 3ES7A 3MVTA 4JBRA 3NOYA 5U4NA 3WDPP 3BOXA 3BCJA 5M1TA 3SURA 3C2YA 3KL5A 3ZYZA 1F6KA 1RSCA 1W5NA 3UT0A 4M5PA 1XYBA 4E0CA 2J13A 2XWDA 2HEJA 4L4OA 5FESA 4C1LA 3ITOA 1SR9A 2UY5A 3PZOA 3PM6A 4A05A 1V7YA 2F6UA 3M0LA 1KR0A 1L0PA 2G4JA 2H9AB 3A21A 1OB0A 3CU2A 5BROA 4WGXA