4L1GA

Crystal structure of the bc1960 peptidoglycan n-acetylglucosamine deacetylase from bacillus cereus
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
214
structure length
213
Chain Sequence
WTPFSWVEKYAYAFSGPYNKAEVALTFDDGPDLEFTPKILDKLKQHNVKATFFLLGENAEKFPNIVKRIANEGHVIGNHTYSHPNLAKVNEDEYRNQIIKTEEILNRLAGYAPKFIRPYGEILENQLKWATEQNFMIVQWSVDTVDWKGVSADTITNNVLGNSFPGSVILQHSTPGGHLQGSVDALDKIIPQLKTKGARFVTLPSMFQTSKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unusual alpha-carbon hydroxylation of proline promotes active-site maturation.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
molecule keywords Peptidoglycan N-acetylglucosamine deacetylase
total genus 79
structure length 213
sequence length 214
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4l1gA00
4F9JA 5BU6A 4U10A 3VUSA 3S6OA 2C1IA 4NZ1A 1W1A1 2C79A 3HFTA 2CC0A 4NYUA 2QV5A 3RXZA 1W17A 1W1B1 2W3ZA 4LY4A 2J13A 2XU2A 3QBUA 4OUIA 4V33A 1NY1A 4L1GA 2E67A 2NLYA 3WX7A 4F9DA 3CL8A 2Y8UA 4NZ5A 5JMUA 2C71A 2DFAA 1Z7AA 1V6TA 4M1BA 2IW0A 2C1GA 2I5IA 4NZ4A 4NZ3A 4WCJA 3CL7A 4NY2A 1XW8A 4NYYA 2VYOA 4HD5A 3CL6A
chains in the Genus database with same CATH superfamily
1MEHA 1Q7ZA 1E1EA 4ICMA 4HNCA 3SGUA 3KCLA 4HMEA 2WC3A 1TV8A 2YW4A 3LM3A 3GDLA 5C55A 1BLIA 3KRBA 4ZSUA 3WNPA 4WSJA 3IJLA 1AFSA 1E6QM 5FA5A 4Y96A 5EU9A 2NSOA 3BICA 2XIQA 4IQEA 3PFRA 4UTIA 2TAAA 3F5JA 3FSTA 4S2BA 2YFNA 3CV1A 2POZA 3WL1A 4G56A 4WDWA 2CEQA 5DRIA 3BDKA 1P7TA 4YNGA 5LXXA 4EPKA 2OO0A 3MP3A 7ODCA 3K4DA 1FH7A 2OOFA 4A05A 2GVYA 5BWFA 2VX7A 1H5VA 3H23A 3O2LA 4KEVA 3D5HA 1RHCA 1GVYA 3BMWA 1SR9A 1EEPA 3U2EA 5AKQA 2IQDA 4GY1A 3ZXWA 1QPOA 1V6YA 3AXHA 2O56A 4CQ8A 1YADA 3AHYA 3PUOA 4XSMA 1AJZA 4AQLA 3ZS4A 1XSKA 2Y7FA 2ZFAA 4C6IA 1KM5A 1PE1A 4HT3A 4TUFA 1Z42A 2B31A 4IIFA 4WOZA 3DYPA 1AW5A 4LYPA 5IOBA 5FJRA 4JY8A 1F6PA 2XYLA 3GNRA 2ATMA 4QDWA 2YB1A 4TTUA 4ASTA 1TJ0A 4IGNA 2WMGA 4MAZA 5E0KA 4DZIA 3BW2A 3BTNA 3EKZA 4C6CA 1KFBA 1R85A 4Z42C 2O9PA 5BMXA 3CQ0A 3U2CA 3W1XA 5BXSA 3T0DA 3WEMA 2NVDA 1GPFA 3LHYA 1XUZA 3CIXA 1XH0A 1M41A 4GYPC 4R7WA 1AL7A 3RPDA 3VIOA 2CYGA 1G4TA 1TPFA 1O68A 2EG7A 1P48A 1G7VA 4GFSA 4AWEA 4DO4A 3O16A 3T8QA 3SCOA 4PTMA 4N6EA 3NOEA 4K7YA 4WDXA 4F2UA 1OFQA 1MDLA 3GFXA 3UR8A 1WKEA 3CH0A 2E40A 1W32A 2WNWA 1CGUA 3FJNA 5AHFA 3WFLA 1LLOA 2DH3A 4QQUA 3MHFA 1H11A 2TSYA 2IUZA 1R7AA 2PDFA 4K8GA 5K7JA 1VBJA 4BQ5A 1PTGA 1QPRA 4WEVX 5A6BD 4WJXA 1ISVA 3OW1A 1EJ7L 3PBVA 1S2CA 4TX6A 3AMDA 2NVAA 2D2GA 1OK4A 1XG4A 2H90A 3GHSA 6ENLA 1FWGC 2ZXBA 2W61A 3TFCA 1EP2A 3ITXA 5I06A 1A5SA 4DPQA 3BO9A 3WD4A 4W8BA 3WYZA 4GC3A 5D38A 2JGYA 5E5CA 4MVAA 4U3CA 1E9YB 4MZYA 3KE0A 1DWIM 3OPSA 3APTA 4H1ZA 2XUCA 1O5KA 2J9YA 4DPPA 1U30A 2WQDA 4WJ8A 3GDKA 1TVLA 2ZZ4A 2E4TA 4I5UA 4GHRA 3W7HA 3Q67A 3GR8A 4HA4A 1KBLA 2E6FA 5DMYA 3K8MA 2D0FA 1A49A 3SCSA 2HVNA 2YDSA 1W1VA 4I7VA 3HGSA 3NQVA 3RRAA 3WLIA 2YR1A 1GOKA 5GQBA 4DBSA 2OEKA 3A3WA 4A3QA 4IWWA 2BXZA 4K6AA 3A5VA 5DQPA 3PZGA 4GCAA 4DYKA 5G2WA 1QI3A 3V36A 2QVNA 4K37A 4I9TA 3CHCA 1QHPA 4CCZA 4UOQA 2AMGA 3VNDA 3WNMA 2PDYA 3T08A 3VCRA 3NGFA 2ZKMX 3CQHA 4JTLA 3JR2A 3A4WA 4PUUA 1EGVA 1WPCA 3CQIA 1JCTA 1Z69A 2BDQA 3IPWA 4ZSTA 3NQMA 4XX6A 3SCVA 2JGQA 3SFWA 1Q6GA 2P50A 2V69A 1E72M 4BY3A 2BOGX 5FF0A 4CN4A 4E2BA 3NFUA 3TKFA 1LWJA 3GWQA 4O0KA 1W31A 4UR7A 1QNVA 2H3DA 1VKFA 4C60A 1XFCA 4E4FA 1SO4A 4ATWA 2VEIA 2GGGA 2QCEA 4KFNA 2J88A 1Q2RA 5ABTA 3KVLA 1GG1A 4J28A 4MF4A 3TYZA 5DMLA 3QN3A 2YL5A 4ROQA 2Z2AA 3EX6A 2QDEA 4H3DA 1ZBWA 3Q4DA 3UP8A 1LRNA 3OODA 5FEZA 4S3BA 3QZEA 4TX8A 3LZ5A 4GZ7A 3ARWA 5LNUA 3KOZA 2V5LA 2NUYA 3G18A 3PULA 1NSJA 5A2CA 5HAOA 1Q66A 1US3A 2QUTA 4JTIA 3GG7A 4AD5A 3OZPA 1KXHA 4O0ZA 4CU8A 4DN1A 3PZOA 1XH2A 4TVCA 3UGRA 3LPOA 5GNYA 3S9IA 3B40A 4I7WA 5F1VA 5J8LA 4E8DA 1VBRA 1Q6EA 3TTEA 1Q5MA 3G0SA 2WMKA 2W92A 3BAYA 4EWJA 1BYCA 2CETA 3CU2A 4JDYA 4XG1A 2ACUA 1NIUA 2F7FA 3F2CA 2B81A 2QDDA 3DAQA 3GC4A 3D47A 2NQLA 4O1AA 5A69A 4IX0A 1UH3A 2HTMA 3AIRA 4JN7A 4IFKB 1WZKA 3AU2A 3WF1A 2WMIA 2W3ZA 2P3EA 1MZRA 5G2IA 3GXTA 4GO9A 1PKYA 3CIWA 4Q7IA 1VFOA 2X8RA 4Z2JA 3WQGA 4MPKA 1S3HA 3L5MA 4E3VA 1SJCA 5REQA 3PAJA 4S38A 3W1NA 3EAUA 1CI1A 1E0XA 1JF5A 2QCLA 3E38A 1NVMA 1EA9C 1OCNA 1VBUA 3PPGA 2ZOXA 3CL7A 4B5UA 1IZCA 1GHRA 2B7OA 5IM51 4UTMA 1QAPA 2W62A 3MUZ1 4AVNA 4E2DA 1LQAA 3VDBA 2CLEA 1K9TA 1MQPA 2X05A 4D1IA 2QJNA 1E0UA 2CXEA 2Z1WA 4U2ZA 2ZRWA 3HO8A 1V6XA 1VLIA 1UUQA 4GXWA 2E1WA 3VD3A 4PUKA 2WYSA 3LCGA 5FEPA 3ZT7A 1DIEA 1QWGA 4UB9A 3IV8A 3UFYA 1OADA 2PRHA 1ZBKA 2GOKA 4CQDA 3IJ9A 1E1CB 4HJWA 1DIOA 1EBGA 1MW3A 1GTEA 3B05A 4CVUA 3KEHA 3BZGA 4IMCA 1LDCA 4KFPA 1HFBA 3NA8A 1KFLA 4QROA 1F7BA 5A95A 3WQOA 1DJHA 4Z0SA 4GABA 2YDAA 1S1RA 4DBUA 1J0JA 1UP3A 3NURA 2PWUA 2OLSA 4V1YA 4CQBA 1REQB 2OSYA 3LPPA 4XD5A 1E6ZA 2TRSA 2XSBA 3GRIA 5HUOA 1E6NA 1H1ZA 5D30A 4AZ5A 3MZNA 1JRBA 4P7LA 2VR2A 5K4ZA 2G4JA 1POJA 3KM8A 1S5MA 4KERA 1VHCA 3ERPA 2EEXA 4KWWA 2J7CA 3V0UA 4LXFA 1GQLA 1JFXA 3RK8A 3GH7A 2VC5A 4PTDA 3GY1A 4QAIA 3NZRA 2PS2A 2OJPA 2V68A 4ZFMA 1F3XA 4FO4A 1W2PA 2D2HA 3NDZA 4DWSB 4BQ2A 5IRPA 5LYRA 4LUJA 3WQ5A 2QGHA 2XPKA 1K03A 1MO0A 3ZO9A 4PMRA 3NQEA 3W38A 2Z2UA 1UD2A 3O6YX 3DCPA 4Z2GA 4UNLA 1EHNA 1B1YA 4OU1A 2V6AA 2VC7A 4UQBA 4Z1AA 4LVAA 4P8VA 3SCPA 1W8SA 4FXSA 1YTEA 1HF6A 1NJJA 1OM0A 4WY0B 4HIBA 4P8WA 2R82A 4LUIA 4F79A 4AZIA 1CIUA 3OGSA 5T8GA 2EXOA 4M82A 4HZ7A 3R25A 2C0HA 4Q8QA 3PBGA 1CXEA 4D8AA 1UWQA 2YGYA 1IQ8A 2X1SA 4CCCA 3QPZA 2AL2A 1QPKA 3UXDA 4K8HA 4ZL1A 4UFHA 1IXQA 1LRQA 5BRQA 1KV8A 4GA8A 3U5UA 1X7FA 2FTPA 1UQYA 2FMNA 2OQLA 3ZLFA 4P7RA 3M0YA 1UPMB 4AC7C 1TV2A 2PC8A 3E5PA 1S38A 2YYTA 5AHNA 1V6VA 5CSRA 4ADSA 4B9YA 2ZYFA 3EWUA 4GI6A 4I8YA 3ZVHA 1BXCA 5G4HC 5AYYA 3UWQA 3WNOA 4GINA 3ZLHA 3M5ZA 4JTQA 1IR2A 1KRMA 2C1GA 3M07A 1JDAA 4IPJA 1MDRA 4MDPA 3CYVA 4H83A 2O7SA 2VUNA 3ITLA 3KAOA 3P61A 1OZMA 1IHIA 1DHKA 5CJMA 4AY1A 4YCOA 4GD0A 3VD5A 1UD3A 3KTSA 3KWSA 4W7WA 4XBKA 4IGMA 3H24A 5TNVA 2V3FA 4M5PA 3TR2A 3PZNA 3IGUA 4M81A 3VKCA 5K9CA 4G8TA 1SO5A 4RUBA 5DMNA 1H61A 2FZNA 4PMXA 1ZNNA 4BWLA 3WQ8A 3H22A 4S1FA 3XINA 5D2VA 5CG7A 4EWND 4X2PA 4ZODA 2Z6IA 1FDZA 3LGDA 1V6WA 3GSMA 2P0OA 4M80A 4C1NB 1R0MA 3OQEA 4J3ZA 3V0TA 3C0JA 3P7YA 2BB0A 1R3QA 2YYUA 1D9EA 1DE6A 4IFRA 4HU3A 5IBXA 4LAKA 4DZHA 3M4HA 1EPVA 4XUGA 1XC6A 3E2VA 2QNEA 4PRWA 3B8DA 4GFIA 3ZZ1A 3SY8A 3H2MA 1UC5A 3VO0A 4FF5A 4QRNA 1BGAA 4Z1CA 2I57A 3W7JA 2VVNA 2WW5A 1XF0A 1BG4A 1S3TC 1K6WA 4C6MA 3A3HA 3STGA 3M44A 3RF9A 2D3NA 3UCDA 2GVEA 2PDPA 1Z44A 5A1AA 3IJ8A 1KKRA 4LC8A 1QR7A 2YB4A 2ZADA 3S5SA 2Z1XA 2DQWA 3NQFA 1D7FA 1XIHA 2BG5A 4YVVA 3NXFA 5FJJA 3ABSA 3UEQA 1J6PA 1EWEA 3EPNA 1B9ZA 1WXYA 3K8LA 1IYXA 3TH6A 3KOWA 2BOFX 4WCJA 3RJYA 2QJHA 1R30A 3TW9A 1JPKA 1TZ9A 4IG2B 3BG3A 4JTFA 3T55A 1TWDA 3KS5A 2YZRA 1GZJA 4JPGA 1K8YA 5C7VA 2OYMA 4TR9A 3PZVA 1IZKA 5HNRA 3P74A 3MMTA 1DJIA 2EPOA 3C86A 1QWKA 1RY0A 1NFBA 4H2HA 1C3FA 4RE3A 4JQ4A 2FKPA 4B5VA 4QG9A 2J75A 2A3CA 3A3XA 3L4ZA 1EJRC 1RBAA 1P0DA 1HP5A 2PP3A 3ANUA 2E68A 1E9IA 3QSTA 1DWJM 4DRSA 1DVJA 5FSDC 2GJXA 2VCAA 3GZ3A 1R3YA 2X41A 1S39A 4HB7A 1W3JA 4FR6A 4ZR8A 2Y0FA 3MV11 2ISSA 1IEWA 1EBHA 3B4UA 3K13A 3GYCA 4RR4A 4JQAA 5I0DA 1NM9A 1R7OA 1Q2SA 3AXKA 2QIWA 1JD9A 5FAGA 1ME9A 3QJAA 1CLVA 3OLEA 3FVDA 5JU6A 3FKRA 3VOFA 3N9SA 4B3ZA 3VIGA 3UR5A 3S2MA 4POCA 2OSXA 1XLDA 4BF7A 5ABFB 4MNKA 5FF7A 2VD9A 4MGGA 3OVRA 4KW2A 5AHEA 3TA6A 4HNUA 1RQBA 3DFSA 5A6SA 3LHTA 3U5YA 1U2YA 1B3WA 4D6GA 1JIBA 4I5XA 4C90A 1EIXA 1ZQ5A 4Y9NA 4F3HA 4H19A 4ZQNA 3THDA 8XIAA 5EYWA 1OCJA 2DJXA 3HZ3A 1ISYA 4XD3A 4XWUA 1AW2A 3R0UA 3NSMA 4Z17A 3WLOA 3APGA 4NRRA 1G94A 3M9YA 1PTAA 4M6UA 3N17A 1X8CA 3MPGA 1UASA 1CEOA 1VENA 3IIPA 4PFHA 1RSCA 3MYPA 4AVOA 4WXYA 3OLIA 3W01A 3BAJA 3MU7A 4PMYA 4CNPA 3KP0A 4GGBA 3TW7A 5EKYA 3FAXA 2OZ0A 1B4EA 4PN2A 2VFIA 3MP5A 1R3TA 1CXIA 1PKMA 4O14A 1XS2A 3TJXA 5KZ6A 3PB0A 2SFPA 3LXBA 4LUSA 2IPJA 2VX6A 3GW3A 4X61A 4H9TA 3CIVA 3G0XA 3QRHA 3H8AA 3CV7A 1W0MA 4MYXA 3TOYA 4F2BA 2EPLX 1C9WA 2WOQA 5D2XA 4C1KA 1XG3A 4NZFA 1M03A 3SFKA 4LAMA 2MANA 2H9AA 4KH2A 2G3FA 3W7GA 4OHQA 3DESA 4B15A 3GR4A 2J13A 3DYOA 3VM5A 1AD1A 4AD4A 5GVJA 1EXBA 1VJIA 1VIZA 2QVHA 2JF7A 3O0FA 1SZGA 4JTSA 3S5ZA 1QXLA 4Q33A 4ZENA 1TA3A 1W1ZA 2Z1BA 4HA0A 3G8RA 3ZJKA 1UOKA 1PV8A 3CT7A 1X1OA 4KWOA 3ARPA 1EA0A 3IVUA 2YA2A 3CWHA 2A3EA 3EKGA 1V3HA 1UD5A 3HN3A 3PG8A 3SUTA 4UQAA 1WO2A 1JG9A 1RPXA 3CUJA 4LUTB 1A3HA 3Q37A 3EX3A 5EA9A 2F61A 2YOCA 2RDTA 4FALA 3TROA 4K68A 3S1WA 2FIQA 5CPTA 4WHBA 2NV1A 5DMMA 4ZGYA 4OGZA 4Z0JA 1F3WA 2IS7A 4RZ5A 4H01A 4HTYA 5EB8A 3W53A 3NO1A 3SJ3A 3VYLA 4DJFA 4I8DA 2B4GA 4L80A 4KMQA 5I78A 4BJHA 4A8IA 4I6VA 1V3KA 5K2ZA 1DJWA 1K8CA 2RAGA 2DW7A 4A2SA 3GDMA 4IPPA 5AZ0A 3BAXA 3LQGA 1DP0A 1W9VA 4ERIA 2V5KA 4GC4A 1ONWA 4XO7A 4LTSA 2PP1A 5JMUA 4QLLA 5BOOA 3IUDA 4UIOA 2YBVA 4XVDA 4GQBA 3OA5A 1QTWA 3WLRA 2HSAA 1SGJA 2ZUSA 2A7NA 4GQRA 1FCBA 1UC4A 3U6WA 4LF1A 1A4MA 1R38A 4RE0A 5A8GA 3W02A 3NQAA 2VC9A 2G37A 4B5NA 4M19A 1CECA 1QW9A 1LZOA 3TOPA 2ZC1A 3WQPA 1LLWA 1JCXA 3RR4A 3AYTA 4NRSA 1YLVA 4KRTA 3WNKA 3W1TA 3VGBA 4LYQA 4D2JA 3AWOA 4MNMA 3RIKA 1X6UA 4FXRA 3TYDA 4O57A 4U3AA 4ZO8A 3TDFA 3GHTA 4LEFA 4CU7A 2C79A 4JTDA 3ME3A 3USZA 2ZRZA 4DAFA 4R9OA 2GSHA 1ZAHA 1S1PA 4GY0A 4GZEA 4DLFA 4JHMA 1WDRA 4B4HA 2X1UA 3ARZA 4H7VA 2RFGA 4K3ZA 3CUXA 2I7GA 3WLPA 2Q8ZA 4U5KA 1SFJA 3QTGA 3A13A 1JRCA 4O18A 3OU8A 3QV8A 1X97A 1VFTA 4O52A 4PCSA 3PZQA 5L9FA 1SMAA 1K8XA 1KGXA 3W85A 4X60A 1IT0A 3BMXA 3KFTA 1ME7A 3LHWA 2WM0A 3DI0A 3M5XA 3SIMA 2DU2A 2Y7EA 1RPKA 1QHOA 2YX0A 1Q6RA 3ES7A 2GVJA 2OX4A 2GGIA 1XYAA 5AVHA 1CBGA 3G1SA 4LS1A 4U4MA 4CN1A 1OGBA 2BGQA 5DELA 1TJ1A 1QVBA 5HPCA 1VEOA 2JK2A 3M1ZA 1M7PA 1J0YA 3T78A 1ODZA 2XJ7A 3GB6A 3QHMA 4O1FA 1WE5A 4M1RA 1DTUA 3QZ6A 1JDEA 5BRBA 1VZWA 1FFRA 4TV6A 2XGBA 4JCMA 3OO2A 5BWAA 1KWGA 1KCZA 3IGSA 2BGNE 5I3HA 4N0RA 4PEEA 1XQKA 3WJXA 1TV5A 3A21A 4CVWA 1FX6A 1M7OA 5AYZA 1Q8JA 3WUBA 2EPNA 3M6DA 2DIKA 4HK5A 3P80A 1W1B1 3PJTA 4RX0A 5FCZA 1W5PA 1W91A 2C8NA 1M7JA 3M0XA 3MT1A 1GJUA 1R2TA 5KINA 3DBPA 1NQ6A 3LTSA 3LRLA 4NNCA 1XX1A 4M6QA 2F9RA 3T44A 2DZPA 3BGJA 3TQPA 1KM3A 3VNZA 3SI9A 5I3FA 2XH7A 3IIXA 1PX3A 2XIOA 3QYSA 3W6MA 1PDYA 4RDVA 1E73M 3CHFA 3N25A 2PAJA 4J3VA 1UR8A 4HHPA 4B2DD 5HWJA 3VKDA 4X22A 5LIXX 2FJUB 3PG9A 1BWKA 1V0KA 2KAUC 1BF6A 4AC1X 4RV3A 1TG7A 3W70A 1AZ1A 1GT8A 2IKJA 4O1DA 2ON3A 3N11A 2X2YA 1K7FA 1UWRA 1HNYA 4E5TA 2Q8LA 3RU8X 4UTHA 3F4DA 5I3IA 4D8LA 1DXIA 4PODA 3W87A 3QHNA 3VK5A 2PWFA 1DWFM 3DFOA 2UY4A 3SJNA 2QCMA 2BX7A 2EPHA 2ZVRA 3EPOA 1OHLA 4FEZA 1N8WA 4YXGA 5GPRA 3W88A 1P0KA 2VGGA 1R9XA 2QEZA 4PMUA 4ZTXA 1XIGA 3HF3A 5ABFA 2HMCA 4GVFA 3OZYA 3GXFA 3T09A 4JGDA 5AHMA 1FCVA 3MUXA 3TMLA 4FLOA 3CQJA 2CZDA 2PLJA 1HP4A 1BD0A 4JXCA 2WHKA 5A6MA 3LPFA 1DWGM 1IWAA 3LA4A 4K8EA 4DVOA 1B57A 1JAEA 2VM8A 3B8SA 3DX5A 3U9IA 3QVQA 2QJIA 2NV2A 4FOKA 3L2IA 2BXVA 4QFUA 4UFIA 4IIHA 4Q8PA 3N6JA 3STCA 3K5XA 2R6OA 3W0KA 1UQZA 3WQCA 1ESWA 2A7RA 3NZPA 4GY7A 3QQ0A 1ISWA 1W56A 3D3AA 4HJFA 3A47A 5IHSA 4Q7BA 3TWAA 5FF2A 2NZLA 2PSNA 4PEKA 4DX3A 3SGZA 1P6CA 5AECA 4F66A 1C29A 4PUWA 5D2YA 1ZRQA 1C8YA 5T9CE 4PSPA 4O53A 1A5UA 4H4IA 3PWIA 1UKQA 2HEJA 3TQ0A 1IZJA 6REQB 2A3HA 2CLHA 2F2KA 1IF2A 4IG2A 4WXZA 3PM6A 3SQLA 4O19A 1JCMP 4NP7A 5T91A 2XIMA 3HPSA 3MSRA 3VIKA 2DIEA 3F5KA 3ANYA 4YYCA 2NX1A 3PNUA 5IFTA 3VGHA 4ADTA 4DO6A 3T6CA 2PLCA 4ZEPA 2W9MA 4UUIA 3AHVA 3ORWA 4W8LA 4O11A 2XFWA 1HKJA 3MKCA 2DVXA 2ASHA 2IMRA 1OX4A 1UZ4A 1E5JA 5FKYA 2X09A 1DPMA 3LX9A 3A6OA 1F3EA 3TYBA 5D9PA 3BG9A 3CM4A 3N6QA 1UUOA 3BOLA 3CWNA 3LMYA 4S3KA 2F6UA 2WVVA 3QMTA 2XFRA 4GYFA 4NJJA 2PDHA 3TTYA 2O92A 5HQEA 2CLFA 3VDGA 3FFSA 2Q8XA 3NSNA 1PS9A 1B3XA 5CBIA 1PEZA 1A4LA 3LTYA 4MFDA 1Y65A 1HL2A 2OYKA 4DJFD 2E8YA 4LUSB 1OIFA 1B3OA 3QHOA 3ZFHA 4LQ1A 2AL1A 3TXZA 3U48A 1K3UA 3GNOA 3IUIA 4IF2A 1PZ2A 3EPMA 3EOEA 4IZGA 1XINA 3I3DA 2C19A 5AHIA 4HU0A 1DEDA 4IUGA 2J9ZA 5HATA 2PWDA 3SUUA 4Z08A 3VKKA 3GAKA 4E38A 3AZTA 3FA5A 5CSSA 3HGJA 2VZUA 2DUXA 1MNSA 4LV4A 4AB4A 4AY8A 1F4AA 4A29A 3V3WA 2FVMA 1LOQA 1QBAA 1D8CA 1ZCOA 1IR1A 1TWSA 4FNRA 2E25A 2EPMX 2VNCA 2XN1A 4N42A 3CHDA 2ZXAA 2WVVB 5I00A 1KA9F 1KWKA 3KLKA 4ZBCA 2EAWA 4NZ5A 2CLLA 3U8GA 3UPWA 1I0DA 4BEQA 3E02A 5E0FA 1YQ2A 4Q22A 5H2ZA 1OX4B 1WAUA 4UFKA 1FFQA 5I3DA 3MO4A 3U57A 3VCNA 3WK0A 2GQ3A 1E56A 3C3NA 3C8FA 4QXIA 4UCGA 3GQYA 1K02A 4IIGA 1EX1A 3UA4A 2W67A 3HG4A 4IJRA 3UR7A 1LCOA 3NSXA 3S83A 5DO8A 3MBFA 3TR9A 2BMBA 1JL8A 4CD6A 1XLHA 1CGTA 4PZVA 1FUYA 4QJ5B 1OYAA 2E9LA 4HPXA 1C92A 1YDYA 1BEUA 2FZ8A 3K8KA 4O4WA 4PCPA 1TQJA 4IIDA 4WY0A 3IRDA 4HNOA 4A3RA 4N9CA 1EPXA 2XVLA 4FMVA 4GQ0A 5FIPA 3MJYA 1H7NA 2WAGA 2BV9A 4PMOA 3EXTA 2E1DA 1XLJA 4FB7A 4FLQA 5FOOA 3FJLA 3L0GA 1KBJA 1WKDA 1SR0A 2VP8A 3IGHX 3AS1A 4JYFA 2VZOA 1QI5A 5CPSA 1L6YA 3SSZA 4DWSA 4WD0A 2RJHA 2QYGA 3WH6A 4MTVA 4GNVA 1J5TA 1VBHA 4HYRA 4GUFA 3W76A 4CNTA 3DXIA 1ITCA 3U4AA 5F4XA 3STFA 3LCIA 1Q4NX 4JTGA 2Y5JA 2IQ0A 1QNRA 3OP2A 2YL8A 4UTWA 5CGTA 2PU1A 2EHHA 3ZLGA 3W72A 3DDMA 2C71A 3MVIA 4OV9A 1VFLA 3H4GA 2PBGA 3KOYA 2BBFA 5ECUA 3S5NA 1BYAA 5LNVA 3BLEA 4PUDA 4DWSC 1WCGA 1W3IA 4LBSA 3H54A 4IP5A 2JIWA 2C13A 1ITUA 2TMDA 4DNMA 1G0CA 3EWYA 3Q65A 1QOXA 4V2XA 1ZL1A 3WQWA 5DY2A 1AODA 2ZDSA 1GOIA 2GUUA 4IPIA 2CBUA 1XLMA 4QCEA 4Q6JA 3QR3A 3V35A 5AC5A 1D3CA 3RM8A 3TP4A 4NF7A 3A64A 4IL2A 2QPUA 3IEBA 2VENA 1PWLA 2BP1A 3LS9A 2CKRA 4MKVA 3WDHA 3TW6A 3GXIA 3DFHA 2CLKA 3WBXA 4UCFA 2OG9A 4W5ZA 2G3MA 3DHFA 3B8IA 4WF7A 1Q65A 1I2QA 3NVTA 5AB3A 4NI3A 2XDFA 4A8LA 3ZWSA 2VGIA 4NZ1A 3F2DA 4Y8FA 3CASA 4IOTA 3RRXA 4GPNA 3WG6A 3FGCB 3I4EA 5BROA 4IIEA 2Y62A 4W89A 3AXXA 1K9FA 4US5A 1GZGA 3SRDA 3VNIA 4UZUA 3TYCA 2OT0A 1SJDA 2D24A 3MYOA 2V5BA 2QJMA 2V63A 1BQGA 3EEGA 3KDNA 4A8NA 5DT5A 2OU4A 2JEQA 2FFIA 1HJUA 4JDBA 5CQ1A 5HANA 5SWUA 2JQXA 3WLKX 1YNQA 2UWFA 1F6KA 1I0BA 1O12A 5CLWA 2WLZA 5U7SA 3TX9A 4C6FA 1K6AA 4CUCA 2RDXA 3EWXA 3BLOA 4IMAA 1TA3B 1CW2A 3WLQA 1UKTA 1XLLA 3HM7A 1VRDA 3CZ8A 4INFA 1AJ0A 1N82A 3SY1A 1JUKA 2BVDA 1YIXA 2Z0IA 4S3EA 3SCQA 1OC6A 2KX9A 3R4IA 4HP5A 1E5NA 1UR0A 4TV5A 2BFGA 4O50A 2BY1A 4GH1A 1EJWC 3CAKA 2VEKA 1VBGA 4PR4A 1OQFA 3BJTA 4WVXA 4JIHA 5I2UA 4M1BA 3LV6A 4XKMA 4PCTA 3TCSA 3F03K 1SMDA 2GOUA 2FPTA 3H53A 1SSDA 2J24A 2YKKA 3TFXA 4ZZ9A 1SM9A 3VDCA 1XIEA 2ZVIA 3QOMA 2WBGA 4U5IA 2WLYA 3LUTA 3PK7A 3LD5A 3DU0A 3VC6A 1U1JA 3SR7A 5LIWX 2OMAA 1QK0A 1BYBA 1JXKA 3F1QA 3ZSTA 4CEUC 3GTNA 3W28A 3WL0A 3CQKA 4NI8A 1I1WA 5C2CA 1DJGA 3C0LA 5A6LA 2QCDA 5EMKA 3UW6A 4FX6M 1QBBA 1XRFA 2WZHA 3PY2A 2X0SA 3KRSA 3CAVA 1F6YA 2FHBA 2ZRYA 3GG1A 1EB3A 3XISA 3T2OA 1HJSA 3XIMA 3SB0A 3ZT6A 5DN1A 3APYA 2NQ5A 4AXNA 5I79A 1UOZA 5HMSA 2OR2A 1J0IA 1M3UA 4RDWA 1A3WA 1GOWA 5LNWA 3S1VA 3IIVA 3UBPC 3S8HA 3HQPA 3PJWA 2NV9A 5D04C 3REQA 2O7QA 3PTDA 2ISVA 2GVLA 2QF7A 3W7NA 1MEWA 1OFAA 3UXKA 1XCWA 1V02A 3AI0A 3GVQA 4LYKA 1ECQA 3I3BA 4K1GA 4O0QA 3EDFA 3WLHA 3W2UA 2ONEA 1O95A 2OT1A 4ZXOA 2NVCA 1V6TA 5CGMA 1E1CA 3L4YA 4HSOA 1XIIA 1F07A 3W9ZA 1QASA 5CAKA 1MRQA 1FWNA 2GJXB 4CCDA 2YJQA 3N3TA 3BL3A 1NWRA 1TFVA 1XCFA 3FOKA 1HVQA 1VPYA 1LL4A 3QSRA 2AQWA 2DSZA 5H6HA 5CC6A 4NILA 3WDJA 1UR1A 3SQMA 3BV4A 4DWSD 3GUGA 2E9BA 2VCCA 1FP9A 3CMGA 1VCGA 1GVIA 3VINA 4J5NA 5I09A 1YEYA 3BGAA 1FHDA 1EKOA 3W29A 1LT7A 4GRSA 1BXBA 1WOAA 2OKOA 3EGJA 3M0MA 3PB2A 4HCHA 3LCFA 4L1WA 5BOEA 2DVTA 5C8BB 3BZJA 1RJPA 5BU9A 4C6KA 3G1AA 1UB3A 4LUTA 4YVXA 4GZJA 1YDVA 3PUEA 3KBVA 1SUXA 1UHVA 1QOPA 4L56A 2ZWYA 2HK1A 1V3LA 3WMLA 5EMLA 2ZZ5A 3SRFA 2OGJA 4JTUA 3UWEA 1VYPX 3NDOA 1XIFA 2PB1A 2J4GA 2FH8A 3C8NA 1A5CA 1B5TA 3ENLA 3NIYA 1ODUA 3G24A 4FAMA 3CL6A 3SY5A 2A6NA 3EZ4A 3NPVA 2W0UA 1DJYA 2DZSA 3PPFA 3K46A 5EMMA 2V5DA 1KCXA 1TKKA 2J6VA 1PYFA 5JH1A 1T41A 3UY8A 3ZMRA 5DXXA 4LGXA 3H12A 2VGBA 1FWWA 3L4TA 4ZVJA 4Q4PA 3W86A 2UY2A 3O6CA 5CBJA 2QCGA 2ZQ0A 1EJXC 3DN5A 1SFTA 4JIRA 4F40A 3IGXA 1JPIA 4XTIA 2NT0A 1LORA 4NX0A 3JZUA 1ADOA 2PRLA 3W7CA 1TRDA 4D6JA 2VL4A 2YCEA 2DJLA 3G1RA 2DT1A 3W2JA 3QPYA 1B30A 1L9WA 5D05A 5I02A 2VOTA 1H41A 1UR2A 5LXEA 5T26A 4DIAA 2XN2A 1J2BA 5H1WA 2WCGA 4LUYA 3E1F1 1H4PA 2A7PA 1ELSA 3T0BA 2F38A 4XSLA 3DH7A 4F0LA 3DC0A 4MNLA 1NOFA 3P84A 5G4WA 1XIMA 4KT2A 3PZIA 2CW6A 2V82A 4GIEA 4J7RA 3W6YA 3N2MA 1XSIA 4ILSA 4JN6A 2I17A 4M7TA 2FB2A 3ALGA 3V1HA 3V18A 3V5OA 3AUJA 3Q45A 3UZJA 3THCA 3L4VA 2NT1A 1JZ3A 4HN4A 1X96A 3HJZA 2J7FA 6A3HA 2OWXA 3AAMA 3DHUA 3EA2A 4M29A 3T8LA 4I90A 2WJDA 4AZCB 3T05A 4N7QA 3G1FA 4DBEA 2QIIA 4KCTA 1UZ1A 4WSKA 3F5LA 3W00A 3WO8A 2BSLA 3L68A 4KWUA 2R91A 2QPSA 4YJ5A 1AMYA 1JCYA 4RK8A 5FJUA 2Q02A 1XWYA 4H6QA 2AKZA 5HOSA 1NDYA 2XN0A 2P1FA 3TYAA 1EUAA 3VIIA 1WDWA 3DG3A 3A4XA 2GQAA 3QY6A 3DFNA 3OEXA 4AF0B 3ISIX 2YZ5A 4URIA 3UETA 3THUA 4RE2A 4YTRA 2JIEA 2J79A 1PHWA 1PZ1A 3WKZA 2IXUA 4YCPA 1U5HA 2FVLA 4RNHA 3N2XA 5PTDA 1OY0A 3MA8A 3IARA 1TWWA 3OQ8A 5AVNA 1PVNA 2V81A 3SURA 4BQ4A 3SN0A 3LERA 4DUOA 2RDWA 4MY8A 4DB7A 2RH9A 3LPGA 4IJBA 3GXDA 1Q7QA 5CH9A 5EMYA 1D7KA 1J2WA 4HA3A 2B7QA 3SM0A 1TSIA 3MBDA 3MB9A 4LT9A 4BI5A 4L1XA 1J0HA 3BARA 4P2VA 2FB3A 5H8MA 3QMSA 2OYLA 3SDOA 3KBSA 3KUMA 4ORIA 3K1DA 4PL2A 1EP1A 3II1A 1S2AA 4JIIX 2OEMA 2Y8KA 1HGWA 4S23A 1YRRA 5CKSA 1KV5A 3E12A 5HUPA 3OVPA 1O5QA 2WZTA 2AOSA 3BAWA 4MKNA 4KKXA 5AC7A 1H1YA 3NO3A 1PL9A 1HKVA 4ZB0A 4H00A 4GO8A 4P8XA 4IIBA 1N7KA 2I5IA 4CNSA 1DHPA 1PHQA 2HS8A 5LZLA 4WX2A 3I6TA 1ML1A 3FYPA 1C91A 3BC9A 1CXHA 3B04A 3ITGA 1F5ZA 2G4FA 4MYAA 2E5CA 5A2BA 3WQFA 3O06A 4I9AA 3WD0A 4O28A 5TBOA 4D71A 2OX1A 2IPGA 4QITA 2H3BA 2ADAA 1V02E 3W1AA 3MJMA 4PMDA 1TPDA 3H7UA 3ECQA 3NDYA 3UZ5A 2NQJA 3VNKA 3W7QA 3RITA 1YXCA 1LG2A 2CZEA 4QDPA 1IXNA 1GUVA 2PDNA 1CXFA 4XZBA 3W75A 3B9AA 3A4AA 3U2OA 3H2EA 3P62A 1FWFC 3SN4A 1VYRA 3B8WA 5AYXA 1C9DA 4DZ5A 3VGDA 4R53A 2PWGA 1B54A 2PWHA 4GUGA 5C0QA 1OT1A 2Z7GA 1YNYA 1O60A 4GNKB 1NDZA 4F0KA 3AHXA 1RP8A 1HKKA 2ISDA 4DUVA 1RCXB 4MB5A 1XYMA 2PU0A 3TEVA 1QNPA 1VEMA 2WBKA 4A35A 3ARTA 2F2HA 1PKLA 1P0NA 1ZSXA 3W24A 1CWYA 1WBHA 1BXNA 4JNYA 2AMXA 4NYYA 5L6UA 2HNEA 1H7XA 5GNZA 3P3BA 5AHLA 2E5DA 4NAEB 1F8MA 1PZ0A 2ZTJA 1EX5A 1GJWA 3THAA 5H91A 3LNPA 3LGEA 3R10A 2ZZ2A 3T4WA 1RVKA 3EMQA 2FVKA 3ZT5A 2EGZA 1PJ9A 1NF7A 2FTYA 1N2VA 3L4XA 2Y88A 2X0HA 2RHGA 2ISWA 3HA1A 1VLWA 1I45A 2XHYA 4CQCA 4V33A 4JX4A 2YL6A 4MOZA 5C5YA 2XGIA 4CQAA 3TZFA 1KQZA 4EF8A 1FDJA 4EANA 2ALDA 3PJXA 1KKOA 1UR4A 5DEZA 5F2IA 2DT0A 3W1MA 1DOSA 1E4LA 2WB5A 3C4UA 2WKGA 3CLMA 5EMJA 3VGFA 3JU2A 1KFKA 4MUPA 1FH9A 5FL0A 1D3GA 2VFEA 3MKKA 1XR2A 2EG6A 3STPA 3N73A 2E28A 3EMZA 4WRHA 1TMQA 2D0GA 4HTBA 4GI8A 1NAL1 1UWUA 3MCMA 3UWWA 2UY5A 4A6GA 1OCBA 3BK0A 4ONVA 2QT3A 2VXNA 1OABA 1A0CA 2UV8G 3TJLA 3N04A 1A80A 2INZA 1DQUA 4Z2LA 3WDIA 5A6KA 2A3BA 1ZJIA 4CNOA 3GYEA 1OINA 3ES8A 2CHRA 4H8HA 4L65A 4E2VA 2J74A 3UWUA 4Q6XA 2IPWA 2HXTA 1T7LA 2CLOA 3IACA 4ZOEA 1LJYA 2G50A 3LCLA 3GR7A 4XV0A 4JHZA 3WX7A 2VX5A 4GI4A 1GGOA 3NQBA 2Y63A 2CPUA 1KB3A 4K39A 3UCQA 4C6PA 2X1IA 2VFGA 3ATZA 5HNNA 1TR1A 4PGLA 3OZMA 1SZRA 3E0VA 2FZMA 4GQGA 4MJ4A 1X39A 1XYLA 3GFYA 3PZUA 1ZLPA 1OGGA 3RM9A 4UFLA 2VC6A 3WLMA 3V4BA 3ITOA 1VFHA 1GHSA 5T9BG 3BAKA 4BEUA 3CUGA 2HJPA 3B8VA 3DFTA 4WLCA 3MUIA 4QDMA 2ABBA 8CGTA 2WHLA 1FWSA 2XSXA 2DDXA 3EB4A 3PBYA 1DE5A 1JPDX 4XVEA 1C7TA 4U10A 1H62A 3GNXA 2OTDA 3UVAA 4MZ1A 3LBMA 3TAKA 2HVMA 3FYOA 3RLGA 1ZJHA 4O10A 1US0A 3O6DA 4GBDA 4D6CA 2HS6A 3NYZA 4D6HA 3G1XA 4YTUA 1PSCA 4ZTYA 1XICA 1UCWA 3R6IA 4ICCX 3W84A 1V8EA 1HJWA 3AXMA 4X3ZA 1E6PA 4DAIA 2PDMA 3P93A 2A4AA 5REQB 1EZ2A 2EJ1A 2OO6A 4TTGA 2OCZA 5B7ZA 1TX2A 3W7KA 2ANUA 1XLEA 4J3SA 2HRWA 1HJQA 4HK7A 3VOCA 1R3VA 3WENA 1D8WA 4WZHA 3SUWA 3I65A 4DJDD 2PMQA 1FBAA 5G1MA 1EJTC 1B31A 3E0IA 3L5LA 3TSMA 4PB5A 1TPC1 3PHAA 4CQ9A 4RZBA 3RYSA 1L2UA 4GI9A 1RY8A 1W5MA 3KL3A 2DSWA 2XIIA 5EPDA 2XVGA 3BLKA 4O13A 4H2CA 3LXCA 1JUBA 1US2A 1E6RA 3RAOA 4GXMA 3U3HA 3SQSA 2W63A 4BHYA 3UZWA 1AMKA 1C8XA 2XH2A 3DUGA 1GONA 5JH2A 3JS3A 3RN6A 1JZ7A 2VTFA 1SO3A 2AKMA 1EHAA 2NLIA 8A3HA 2DSUA 4F48A 1Q63A 3E9AA 4ZQRA 3VUSA 4NSBA 3ITYA 4C7DA 3COTA 4KPLA 3SCWA 1Q4WA 1XFBA 4JNMA 4EVZA 4NG3A 4HZ8A 1L6GA 1CB2A 4LWWA 3NUKA 2XZ7A 3QV7A 3M0JA 2AAMA 4EACA 3BMVA 1YNPA 1EC7A 2OQHA 1GPWA 3AQUA 4F4RA 5A5WA 3E0WA 2PDLA 2W91A 2DEPA 2J7EA 2PC4A 4HBKA 1ZHAA 4L9XA 3KX6A 1ZPTA 4WY0F 1YYAA 3ZSSA 3QGKC 2AGKA 2A2IA 2CC0A 2WMJA 3N2BA 5HNUA 3SUSA 2WCAA 1EL3A 4MNJA 3ZIZA 1R2RA 3C2EA 4JTAA 1FCQA 3QMRA 3WDRA 3VD9A 3MO7A 3QFEA 3MSGA 1Q7MA 2V3DA 4EKJA 1UJPA 1ZAIA 2LLEA 3CUZA 3RDKA 4YTTA 1VFUA 2HNHA 3NQ2A 2C1IA 5A8OA 4CD8A 1H63A 4P5UA 3AZRA 4AEOA 4OTKA 2WPGA 4L6OA 1FTXA 1T8XA 1OZQA 4XD6A 3BVJA 3M16A 3MI2A 3PWGA 1HKMA 1X8FA 1AA1B 5F7UA 1SW7A 4GJ1A 1OEPA 1K7XA 1O4UA 1HL8A 1IE7C 2XVPA 1ZP4A 4O1BA 3GIQA 2QS8A 4YMZA 2EBNA 3D0CA 3CTLA 3WMSA 3ZJ6A 4B90A 3ABRA 3DYMA 2EPKX 4OUEA 1O5XA 3UT0A 4X0NA 5ENLA 4F0MA 4E4UA 2QDHA 3VTRA 3VXGA 5D8WA 1FCUA 1Y0EA 5DT7A 4X9SA 5HNTA 1JYNA 2E0PA 4EPEC 3MHGA 3N19B 4EX4A 5EMUA 1TCDA 2ZICA 1L8NA 4CGTA 1P4CA 1Q6LA 4QISA 1X1NA 3W73A 1DTNA 4QLKA 1JF6A 3YPIA 1NDVA 1RP9A 4FNSA 4BA0A 5BRPA 2DH2A 3KL0A 1XC4A 2PDUA 2ZRVA 1DXFA 2V2HA 3NEVA 2W4XA 4QCFA 3N15A 2PD9A 3R79A 3S42A 3P81A 1OT2A 3N2TA 1TPWA 3NPWA 3QY8A 1BWLA 5IBXC 4G7EB 1A50A 1ENUA 3T42A 1MMFA 3BLLA 1HGYA 1SZFA 3D3FA 3KHJA 1I1XA 4H7ZA 3IK2A 1IGWA 4WIWA 4JD4A 3VU2A 4W7VA 1ZJBA 5I24A 1EO7A 3GHRA 2GZXA 3D6NA 4UNKA 1DJXA 3HQ1A 3LK6A 4JEQA 4JKMA 4P7QA 2OZ3A 4PUEA 4Z2KA 3AICA 1T8QA 1YBQA 4IMDA 4BF9A 5HWMA 1GJPA 4A2RA 5JVLA 4QR6A 2CKSA 1A5NC 2NUXA 3U0HA 3EDJA 4O8RA 3VDAA 4XIAA 2P10A 1W1IE 2YXXA 2PDBA 5KITA 3WF0A 3N9KA 3CEPA 2C3ZA 3WD2A 3H70A 2QZRA 4MJZA 3NJ3A 3V5CA 3GM8A 1PZ3A 2BVYA 4MHBA 4NHVA 1KM1A 4OUIA 5BCAA 4HNTA 5DCEA 2OGYA 4O4VA 2OLHA 4HOWA 2Z28A 3R8GA 1KC7A 3O07A 5HWNA 4DBDA 2FZDA 5A94A 4OBRA 3H2CA 1KGWA 2PZ0A 3TNBA 4EP8C 3WCZA 1UA3A 1GOOA 4EK7A 4C6EA 2WSRA 4NJHA 1G4SA 2V3EA 1L8PA 3G2GA 1MUCA 5CXPA 3VABA 4LYRA 3ZWTA 3P14A 2DSKA 3NVDA 5GJMA 1VH7A 4QTGA 1K4GA 2Z2BA 4Y6GA 3QZAA 1SSGA 3B9EA 4M7SA 3ONBA 3UWYA 2BTMA 3S0CA 3HJEA 2DVUA 2XM2A 1FDYA 1EJSC 3EYPA 2PWVA 3O15A 4D9PA 3BSMA 4Y2WA 4QE4A 1EP3A 1YMYA 1GTHA 3UPBA 1AL8A 1PIIA 2O9RA 2P8BA 1LUCB 3UYIA 4NJIA 3PNZA 2BS9A 3S6OA 1OF6A 1LWIA 1WDQA 1NQKA 4R34A 2Y2WA 4AZBA 1IT7A 3R8RA 3RLHA 4BKNA 1T96A 1ZBVA 3MP4A 3UZYA 4AMCA 3W7EA 4AWSA 1H50A 1EJVC 1MXGA 2D69A 4FZIA 2WANA 3BJFA 4HMCA 1TWIA 2FYMA 4LRTA 4FOUA 3T0AA 1OYCA 4MLRA 4YVPA 3PZ9A 5E93A 4AZ7A 3QR1A 3WH8A 2GJRA 3PTQA 1CGXA 1S5NA 4UQDA 3PTMA 1WXZA 4JAWA 1SFLA 3UGVA 3TA9A 3RMJA 1UBPC 2HPMA 1X6LA 4PMVA 4WOQA 4NU7A 3RCMA 1HQTA 4WQ6A 3EWWA 3BCFA 5LNRA 3C6CA 1RBLA 4LB3A 3RHGA 2NLYA 4JKKA 1E43A 2YCLA 2VD8A 4HHHA 4XK2A 4DI9A 2E6YA 3WSUA 2ZA1A 1TE6A 2OFJA 3FGCA 1VJSA 4AYGA 4U2YA 3T40A 2I5QA 3BGGA 4BR1A 3S1GA 4NJKA 3W4RA 4LANA 3U7VA 3CWOX 1H0GA 3KCJA 2VELA 4N9BA 3VOIA 3S46A 1WDSA 1Q3NA 2AQVA 3OIHA 2CITA 4AUBA 2XVNA 4ZXLA 4QEHA 1ZJAA 2ZWZA 1FH8A 2FDSA 1EWDA 1H60A 1IT8A 1TJPA 3EBVA 3UERA 5XINA 4FP1A 4QG8A 2PUZA 1GQJA 3HV8A 5CEWA 4PL1A 4LCQA 1ONXA 1OK6A 3SAZA 1CLXA 4AHPA 1EFZA 3VIMA 3HG2A 2ZRXA 3POCA 4L9ZA 1WXJA 1KFWA 4LVFA 1W2VA 4XZ9A 3HGRA 2FZBA 2DORA 1W5NA 1R3WA 3N34A 3UPMA 1VFMA 4P7NA 3LENA 1J8VA 2PI6A 3DOPA 3W7DA 2FMOA 4FLRA 3TN5A 3UESA 5FL1A 5EGRA 4J3TA 1R46A 3CBWA 2WMHA 4LBUA 1V93A 4MFEA 3R43A 5CZSA 3HIJA 1RVGA 2Q09A 2FH6A 3E3HA 4DJEC 1KRAC 4W88A 4M51A 1EIBA 1IEVA 1NY1A 1W3KA 3WMCA 1UROA 3OHIA 3W6LA 4BS0A 4H9VA 4ZQPA 4NZ3A 4ZA0A 4XKYB 4W85A 2OODA 3TSDA 2BY2A 4HYWA 1LLZA 2X7VA 3CLWA 3NCOA 1KD0A 2ZZ6A 2RGLA 5FEXA 4QSFA 3CHEA 4S3GA 3P60A 2JKPA 2GQ9A 2CLMA 5M1TA 3R2GA 1A5KC 4QAWA 1MRAA 3NQ6A 4C6DA 4IGSA 3QV9A 1ZGDA 3FIGA 2BXYA 2ZXQA 1W9UA 4EXAA 3KL5A 4XISA 1GW1A 2X40A 3AROA 2C0AA 3AJ7A 2QUUA 3FY1A 3MHUA 3SGGA 1NOWA 6XIMA 1UH2A 3T9PA 3AZSA 4NY2A 3ARSA 1OIMA 3OYZA 3QXBA 3SN1A 1JDFA 3KTXA 3WQDA 1U5VA 1XKJA 4W84A 2RDUA 1TR9A 1XGEA 1S5VA 1SJAA 3AYVA 4FPSA 1QT1A 3M0LA 2JKAA 1GORA 1HIZA 4D72A 1I4NA 4C6QA 3PAOA 2VOMA 4FS9A 2TODA 3FDKA 3WBYA 1W37A 2MUCA 1XYZA 1TIWA 1UMYA 4IT1A 2J6XA 3WEOA 1R47A 3IRSA 3L0NA 1P43A 4JFVA 3G3MA 1XLKA 3LBOA 2E77A 4E8GA 5HK4A 3MMWA 1MQRA 5F1UA 3DFYA 1O7AA 2H8XA 1H51A 3FXYA 1EEXA 3AJXA 2PGWA 1MI3A 4PRRA 4PH6A 4J3UA 1XDMA 2Z26A 4I9MA 5E6YA 2BLEA 3QEZA 1QNSA 1DQXA 3CV6A 1J18A 4C6OA 4QM1A 6PTDA 4ZQOA 3FCPA 1IXOA 1HKWA 3RXZA 3W2KA 1GEHA 1R5YA 2WZEA 2A5HA 2OXNA 2OLAA 3QLDA 2A85A 4ZE5A 2VDGA 3URAA 1HL9A 1QI2A 1RXOB 2C16A 2BVWA 3URNA 4HCLA 3LY0A 2P53A 4UZSA 1J9YA 3VMPA 2PDQA 2E67A 1QNQA 3OIXA 4GIRA 3W7IA 3PWAA 5BXPA 5IXEA 2CZFA 2A79A 4KEZA 4CD5A 4R3UA 2ALRA 2WQPA 1ZCCA 1LRTA 4UTKA 4JZ5A 1KFCA 3R58A 5J5DA 2WJEA 4G5DA 1D2KA 3QTPA 1M65A 4PCFA 3KP1A 3SBFA 1Q6OA 4LX4A 2YW3A 2ZC8A 4R85A 3SIZA 1Y5XA 4PBGA 4J40A 5F4WA 4C7FA 3MDUA 4QLJA 4AD2A 3MCNA 3NPXA 2NQHA 2Y8VA 3RR1A 4UQ9A 5LA2A 1YTKA 3M5VA 4L4PA 5AYBA 1EO5A 1EGMA 3TTQA 1CYGA 2HDJA 1N8FA 2DZUA 1MUMA 2PODA 3CHVA 4D6EA 1SYTA 1RALA 4JICA 4N2YA 5MKGB 1UIPA 4ACYA 3WNLA 3RG6A 3SCNA 3DGBA 2VGFA 4Q7NA 4Q8VA 2WK2A 1FWTA 4IP7A 4KCWA 4LFYA 4BI6A 1VCFA 2Z1VA 4RJEA 3LOTA 4NUWA 1KBBA 2ABAA 3CS2A 5F2MA 3T2PA 5C7HA 3FAWA 4BI7A 4EXQA 2Y85A 4V28A 3AUOA 4UTLA 4YU1A 3O6AA 4B92A 3GVRA 4MUZA 1QI0A 3CV2A 3AHZA 4C91A 4E0CA 5KZEA 4DHGA 2BHYA 3IVSA 4W4QA 1H09A 2PDXA 4JQ2A 3UYCA 5FACA 1BYDA 1M1BA 1YE4A 3PS7A 1HKIA 3OZOA 3UJEA 1J10A 3CZKA 3MTWA 4BCEA 1O1ZA 5M2FX 1K77A 4Y8EA 4ICNA 1KR0A 1VEPA 7PTDA 2XH0A 3HG5A 1VFSA 4UC5A 2YLLA 4ZO6A 3QC0A 3MI3A 1YPXA 3TTOA 2YCIX 3RCYA 3KCOA 4ZQMA 3I3EA 1YDOA 1BGGA 3VM7A 3VPLA 1TPH1 1JEZA 3B9DA 2EO7A 2INEA 3GG8A 5G1YA 1FWBC 4AIUA 1AQ0A 3L67A 4AFYA 3ZR4A 4YHGA 1SW3A 4KIEA 4JIQA 2CWNA 4UWMA 1BSLA 1KM2A 3FXGA 1QW7A 1C7SA 2PTDA 4FIRA 2JEPA 4OIFA 1FWCC 2WKJA 1EH9A 2J9XA 4KS0A 1OCQA 2QAPA 3IAPA 1Z48A 2FPYA 4KBXA 1ZUAX 4KEUA 4Q4RA 4IM4A 2QDGA 1H7WA 2CLIA 5CLTA 5B7YA 3KZSA 4FR1A 1DBTA 1A3XA 2VR5A 3GO2A 1VS1A 4Q4QA 1KXQA 1VP5A 2I14A 5E6ZA 5D09A 3R11A 3RO8A 3LLXA 3N13A 2AAAA 1Z3NA 3LHVA 1JZ5A 3FJ6A 2WJFA 5TQLA 1OD0A 1CTNA 4WKAA 2PEVA 2HVOA 2BGSA 2QJGA 3WK3A 6CGTA 4H9UA 1Z8AA 3QPEA 3EWDA 4IUOA 3T7VA 3WELA 4KETA 4GNJA 3PZMA 3VA8A 3R1ZA 3WZ0E 2BVTA 5DCBA 3B0XA 4N9DA 3QKZA 3UWVA 4DUXA 3ABZA 3N2OA 2MNRA 3CZGA 3CUHA 3LBCA 3R0DA 5I6SA 4X9YA 4FIQA 4MM1A 4DBWA 4JCLA 5DANA 3QYQA 2NXIA 4S2CA 1WP6A 4G6CA 5D8ZA 2CLPA 3N18A 1J4EA 4QG6A 1TJRA 2UY3A 5CGQA 1Y8BA 1WBJA 3EXRA 4CU6A 1P6BA 4GBUA 4YWIA 2DFAA 4D6FA 3S4TA 3TIMA 2XZ9A 4RDYA 1EF2A 3IVTA 3ONCA 3VIJA 4ZB2A 1KW1A 3TYUA 2BZNA 2JE8A 1S2WA 4KWVA 1V79A 1L6WA 2OQYA 1HX0A 4GYJA 5LGXA 1PIFA 2VDIA 3LHUA 3VE7A 3M0HA 4WK9A 4QEEA 1H7PA 3VAVA 3SO7A 3K4WA 4L61A 4HA1A 3AMLA 3GVGA 4J9JA 3DGRA 4LEQA 4NAEA 2FHFA 1MQQA 4IPLA 4AWUA 4ES4A 3OBKA 1GKRA 3CGTA 3W1RA 3EDKA 2NW0A 3RO6A 1TYGA 3DKJA 2V0TA 1V0MA 2VZTA 4AU0A 4F8XA 4GWEA 3KBJA 4HZ6A 1E3XA 3WBAA 2OEJA 3EMCA 1NP2A 4MADA 2HBXA 3NQDA 3URBA 5CZJA 2I56A 2ZXDA 2POTA 3M7SA 3H26A 3LI0A 3AIBA 3N12A 1UH4A 1LF1A 2WSYA 4G1NA 2NXHA 1TPEA 3GTIA 3FNDA 6TAAA 1B2YA 2GQ8A 3ZOAA 1OYBA 5B80A 2B0MA 1V7YA 3HBLA 1EYWA 3ZR5A 4NAFB 3ZM8A 1NOUA 2R9RA 4IPNB 4D6DA 1P1XA 3VILA 1KBKA 3OG3A 3GLCA 2VHLA 4ERGA 1M53A 3W27A 1J01A 4DJDA 1FKXA 4AIEA 3PVFA 1MEIA 2QV4A 2VFFA 3FHAA 2XWEA 3BW4A 3RGTA 3G1DA 1E3ZA 3CZLA 4KCUA 2X2GA 1XKYA 3SADA 2EG8A 1K70A 2ISFA 3L2MA 4JFTA 2H8ZA 1JDDA 4L6HA 1OWQA 1TZZA 4P61A 3JRKA 3LCWA 2O9OA 3JVAA 4C5ZA 2FZ9A 4XO6A 3GVVA 3DHPA 3WH9A 2J77A 3BH4A 3S2LA 3O0KA 1E51A 4Q8NA 4UTWC 4ZO7A 3UA3A 2GL5A 4K7VA 3BJSA 1HG3A 1JQXA 3MWAA 5D9NA 4QIUA 1RCQA 4JQ3A 1E40A 2A21A 1JYXA 4AY7A 4UOZA 3UG5A 4NYUA 3WEZA 1CLKA 2WPBA 3WF2A 3KW3A 3E2RA 4G7EA 4ZB5A 3CEUA 3H6OA 3KBNA 2CERA 3WUGA 1R3RA 4CN6A 1IEXA 1JJKA 1DXEA 3C5QA 1WUFA 1JPHA 3EX1A 1NFPA 5C2GA 4Q8TA 5EBUA 4BWLC 1CNVA 2PCQA 3R12A 3WDQA 1G5AA 1KFEA 3NWRA 3N29A 2Y5SA 5HMFA 4MKSA 3S1UA 4GUHA 1XIJA 1JAKA 3HPFA 4XAZA 3FYYA 3N14A 2W27A 1RCOB 3SUVA 4XAFA 4MDOA 3NOYA 3WF3A 4REQA 1OBAA 3GD6A 3GKAA 4B9ZA 2Y61A 3USBA 4M6PA 3N4AA 2PFHA 4RNIA 5FF3A 4DY1A 1NF0A 3WQVA 4HMNA 5JBDA 5FJTA 1GCYA 4DO7A 1GOQA 4HVXA 3ID7A 1PXGA 3HOJA 2DZTA 3UWZA 3BLIA 2NXGA 4GK8A 1E0VA 1XLFA 1OG0A 2Q3RA 2BOEX 4JN8A 2BWGA 3LRMA 4IJCA 1VC4A 1TELA 3C3UA 3H7VA 1NTHA 4GYKA 3S9ZA 1F73A 4TX9A 3BQ6A 5TD4A 3WK1A 2DP3A 1Z9AA 1A0EA 3BG5A 4RW3A 2REQA 4O16A 2HZGA 4NKCA 1TVPA 3BCJA 4CD7A 3Q2DA 2CHNA 1TIMA 4OVXA 3R7MA 2Q01A 5DF0A 1QNOA 4ERAA 3QF0A 2ZX7A 4OZOA 1MFUA 1Q45A 1FWEC 2VQTA 3OYXA 3O8AA 2Z29A 1GZ1A 1JXJA 1RQHA 3QQWA 2HWGA 1FQ0A 4HNLA 4K36A 5BU6A 1TE1A 2X30A 5AYIA 5LKYA 1V0LA 3BW3A 4WKHA 1E1FA 2GJNA 4LS2A 4B91A 5C9UA 3FW6A 4DXXA 1V3JA 2NX3A 4QE1A 1MYRA 1ADDA 3DKLA 2P8CA 2KZHA 2DIJA 2R1KA 2WJZA 3NL6A 5E9AA 2ZTKA 3I4KA 1XUUA 3FHQA 3OHMB 2QKFA 4ACZA 1DJQA 3C2YA 4GG9A 3TSBA 4YS1A 1FWAC 3HPXA 5LGZA 3W7MA 3GXNA 3LM7A 4KFOA 2XWDA 3OBAA 4DF1A 6TIMA 1UD8A 3BXWA 1IIGA 2VWSA 4TVDA 1BVNP 3NZGA 3P67A 1W8GA 4GIYA 3WQ4A 1Z6KA 4PUMA 2G96A 3H2FA 5A8MA 1FY6A 5BNKA 4PC8A 3TONA 3WUFA 2XTKA 3A24A 3P5YA 1W9XA 1ITQA 3V75A 2GSEA 4LVGA 4ZFCA 3GU2A 4HSNA 1XGZA 1MUWA 1SW0A 4KRZA 3S5YA 4AX7A 3UZXA 4CKQA 1QO5A 4GX9A 1SQ7A 3N3MA 3GU1A 1U83A 1DV7A 2DV0A 1UZHA 2ZZ3A 3MZ2A 4TOQA 2WXDM 3CPGA 2DPEA 1IEIA 3OG2A 2Y4SA 3CT2A 3B06A 3B97A 3DECA 2E5BA 3L21A 1RK5A 1UKSA 5D02A 2PWEA 4JIEA 5CSYA 3TCEA 3SCTA 2YXGA 6REQA 3O63A 2GUBA 2YDRA 3I10A 3OLDA 2E09A 1JUEA 3PANA 3PUGA 5AFDA 2BHZA 4AMAA 1OF8A 2E8ZA 2CFFA 3N6HA 3DERA 4XZNX 1Y5WA 3KLLA 3DG7A 3CYJA 1G9HA 5HJXA 1ZAJA 1W9PA 4EXBA 3EWZA 4B3KA 2RGMA 3MUAA 4IP4A 1XL9A 3CH9A 3DI1A 3VNMA 3R94A 1WDDA 3W23A 1HXJA 6XIAA 1U1HA 1QI4A 3CPUA 1TPVA 3JW7A 5TF0A 3PF3A 1JYVA 1GEQA 1OX6A 2ZUVA 4UOJA 1LQ2A 4AHQA 1GG0A 2TPSA 3M0KA 5CBBA 3TMQA 1RH9A 4IH3A 1CGVA 1M9HA 3IJ7A 2QPXA 5D32A 1Z32X 3LLDA 3S5OA 3IAQA 3WUEA 4ZMGA 7CGTA 1E0TA 5GNXA 1VJZA 3UJFA 4AG0A 2YBTA 1CCWB 1FHVA 3EDDA 5U4NA 4YLWA 4DJED 5HMEA 2DQXA 4FA3A 5D03A 3P82A 3DEQA 5I23A 3K2GA 3LTPA 1O66A 1KTNA 4RPPA 3AC0A 7REQB 4X0VA 1MFVA 3R0KA 4Y9PA 4XBJA 1M04A 2ODOA 4PULA 3CNYA 4GMEA 2WSQA 1V08A 5KTLA 1EF3A 4E3TA 4R27A 4PYSA 1K9EA 3NEHA 4FHAA 2DT2A 4PCNA 3B0YA 4LJ3A 4OOZA 2J7BA 3H2NA 4AYSA 1JCNA 2QCDB 4DUWA 2GPTA 4JX6A 4UTFA 4BF5A 1GK8A 3AOFA 5HR7A 4WSHA 2X1TA 3GK0A 1KLYA 4RNJA 4RV8A 2ZX5A 5TAOA 4DXKA 1C93A 3I7SA 1VRXA 1AVAA 3ANVA 4LNCA 5ECVA 2FJKA 1BRLA 4M8UA 2WV8A 2YL9A 1XV8A 2WZMA 2DZXA 4UFJA 3NPUA 3P0WA 5FD0A 1QATA 3TZNA 5M3WA 2ZZ1A 3M5YA 4XQ6A 1J12A 3SZ8A 4EAYA 3BSGA 3R13A 3W2NA 1GWJA 1RR2A 3LG3A 1LWHA 2V9DA 3I7QA 2A6LA 2DUAA 3GZAA 4EPBC 4GOAA 1BWVA 3THQA 1XIBA 1BVWA 1W1TA 3PBWA 3VI2A 4C6BA 1UG6A 3TC6A 2ACQA 4ENLA 1OC7A 2PZNA 4PUNA 3FDGA 1E15A 3HQOA 5DRCA 2UBPC 4C6LA 5A6TC 3IIOA 2VJXA 2C18A 4X63A 4AIBA 1A5OC 4BQ3A 4MWAA 2Y7DA 2WO5A 4LBRA 3NNTA 1OJXA 4JNZA 4YHEA 4P7OA 1WZMA 4Y9AA 5CPQA 4AEEA 1XYBA 1FP8A 3HTWA 3GXMA 3U7BA 3NQ7A 4JEJA 2Q6ZA 3UF9A 4PTNA 1TZ7A 3GFZA 5I3JA 7TAAA 2YSWA 3MANA 3G1VA 2J7GA 2PF8A 2ZE3A 3L9CA 3I6RA 3WLTA 4XUYA 3GC2A 1RJQA 3AFBA 3FKKA 1X7IA 4OECA 4H41A 3DFPA 1VF8A 2RJGA 3AYSA 1AZ2A 1F8IA 4D1JA 3HQNA 3G5EA 5D2WA 1QPNA 3QM3A 4JHOA 2YPIA 1KO0A 1XRVA 4YPJA 4TQTA 3B3DA 3UR2A 3U2ZA 3WIJA 3GVWA 1AJ2A 4PFMA 2QW5A 4U31A 4DXVA 3OBEA 3P2VA 5K4XA 1FXPA 1KCLA 2WKLA 1PYMA 4KF1A 1ISZA 5CZTA 1GVFA 1AG1O 3HFYA 3TC7A 4KESA 7REQA 3GAYA 3GTFA 4AWTA 5HMDA 1TWZA 3BE7A 3RLVA 1R9ZA 1UMLA 2PTXA 3LMZA 1MXDA 3IJIA 1SO6A 3S6TA 1UPPA 3TLQA 3UG3A 4H8VA 1W1A1 3AIWA 3GH4A 1OC5A 2Y6ZA 2WVTA 4JTTA 4Q8UA 1KM4A 2XU2A 1HJXA 2G3NA 3WNNA 3GDTA 4BZYA 1OFPA 1DQWA 1G69A 5FJOA 4R88A 2ZUMA 3VZZA 2D73A 2D23A 1WDPA 4GVHA 1I6NA 1DWAM 1K7EA 1ISXA 2V38A 3MWCA 2GWGA 8XIMA 6ALDA 4J4KA 3EB3A 3LU2A 4GVGA 4QJ4B 4H9YA 1JVNA 1VD6A 4FSAA 1RJRA 2F6KA 2A0NA 5G2HA 1JGMA 4GUJA 2ZUUA 4XAGA 3VOJA 5KETA 2PURA 1BFNA 5F4SA 2WM1A 1U22A 3CO4A 2PF0A 2OWCA 2P5NA 2EF9A 4U33A 5HA7A 3G1YA 3F4WA 3WQ6A 4KCVA 1A5AA 4ZO9A 3KBMA 3HPZA 2F84A 3AALA 4JTKA 5C9RA 1K1DA 4J3XA 3E96A 4XZIA 1EJUC 3BSHA 1VFFA 3EB2A 3GKFA 2W79A 3ARRA 1N8IA 3KOXA 3PZTA 4A21A 1LOLA 2NUWA 2Z6JA 1KRCC 1TMLA 4Z1DA 4GH3A 4Q8OA 3KTCA 2JKEA 5ABEA 3VKJA 4NJGA 1XIDA 1MVYA 3A23A 1X1ZA 3IJDA 3L2LA 5KZDA 4N9EA 3WJYA 3TYEA 1TQXA 2QCFA 1I2OA 5FF4A 1JYWA 4B4FA 2WC7A 1L6SA 4Z2IA 3TU9A 1TPUA 3VKAA 4CNUA 1JI2A 3UXIA 1G01A 4FX7A 4AZCA 3LEPA 5FJIA 4EOUA 3CC1A 1XLCA 3G77A 4L1GA 3CAWA 5EFFA 3HGOA 4PTVA 4HPHA 5D4YA 3O7UA 1PTDA 2FPVA 5HDRA 3KHDA 5BW6A 2G5WA 1EXPA 1XM3A 1S2VA 2CIPA 1QDSA 1XDJA 1JD7A 1TV3A 5XIMA 4DF2A 2ZUNA 1XSJA 4GJIA 1T5AA 1WNOA 5C71A 2ZX6A 5M5DA 2GK1B 5FEWA 4NXKA 1MWOA 2VI0A 1WYIA 3NG3A 2BY0A 4WDUA 2QULA 4G9PA 1TB3A 3UJSA 3RPTA 3ARVA 4GLEA 3IK4A 3W81A 1P0EA 1WA3A 1TV4A 2X7WA 2R94A 8TIMA 4O1EA 1BTMA 3F4NA 1HZYA 3WLJA 1XW8A 2GJPA 2PA6A 5LIKX 3VZXA 3G0UA 4R7OA 4RPQA 4G7FA 3B0UX 1ZALA 4YIWA 1IWBA 4QHRA 3G3DA 1J0ZA 1DL3A 4IQLA 1UD6A 2ZX9A 4K38A 4C6NA 2R8WA 4GQQA 5DY3A 1JGIA 3B9NA 3EOUA 4C65A 3M47A 3IUHA 2GK1A 3VD4A 3KXQA 4NIRA 4JFSA 3UJ2A 5K9DA 1UWIA 2O4QA 1G6CA 4QGCA 4MB4A 1MZHA 2ACRA 3UNTA 5C54A 4F0HA 3V0SA 5HQMA 3LV5A 4H04A 3PSVA 1MW2A 1E4MM 5K3VA 2D0HA 3M0ZA 3PJUA 1GKPA 1H2JA 2I9UA 4ATLA 3E6EA 4F9DA 4O15A 1V5XA 4LH8A 2BY3A 4JTCA 4A4AA 2WNQA 3Q58A 3T2QA 3EX2A 2PDGA 4J27A 3NM1A 3A5FA 4R9XA 3QY7A 3F2BA 2E7FA 1DORA 3C2RA 3VZYA 1JCJA 3AMCA 1XYCA 3VNYA 2XH4A 1E6XM 4M56A 4ZOAA 1V0NA 3ITTA 1QPQA 1JPMA 2XIBA 4Q32A 4PMZA 3UZZA 3WF4A 1L6FA 3MS8A 2Y89A 1VIWA 2I1OA 3TAOA 3AS3A 2WCSA 1DJNA 5DX7A 4EF9A 2PDIA 1C90A 1PKNA 2ZUTA 2RKXA 4C6JA 3QGAC 1AQFA 5BZAA 4W5UA 1ITXA 2FGLA 2E3ZA 1J79A 1B90A 4US5D 1F76A 3W82A 1DKWA 1MXSA 4IQDA 2JBMA 1HW6A 2YDQA 1PCKA 1ICSA 1E71M 4NVTA 2J25A 4ROPA 3ICJA 4QBXA 4DM1A 4Q8MA 3TQKA 3VX0A 5LNSA 5RUBA 1EZWA 5JIWA 5CPMA 5A8NA 4JR5A 3W1QA 2R24A 3UG4A 2YBUA 4UTUA 1S2UA 1F4HA 2C7FA 2YA0A 3MV01 7A3HA 4E6MA 1BTCA 3OB8A 1W3TA 1ZS2A 4UR8A 3BAIA 2PGRA 1UKOA 3REQB 5ABHA 4MLJA 3RUBL 3WMBA 4MB3A 4AD0A 5C2XA 1CX9A 4DYJA 3OVGA 1F2JA 4QSHA 1S5TA 3MY9A 4J2PA 4WUIA 2AGTA 2Y1HA 1E55A 3CMJA 3STEA 3IS4A 2V30A 4PSRA 4US6A 2CCRA 3QW4B 1TO3A 1F05A 1A5BA 1B0IA 1TX0A 1H5YA 4RE4A 5JBFA 4C1NA 1HTIA 1GQNA 1HVXA 2D2JA 2J66A 5BYWA 3W1PA 2EJAA 2CXGA 5JQ9A 5MF5A 2FLIA 3KDOA 1XLIA 3DHDA 4Y9OA 4EAMA 4WKFA 4PB3A 4IMGA 3GX9A 4UR9A 4DJDC 4ZCWA 1W6TA 4FNUA 4GVIA 1SJBA 1M5WA 4IL0A 3ZR6A 1LT8A 3GU9A 5DBTA 3MI6A 2R1MA 2D20A 4OT7A 3M6YA 1DIKA 4FXFA 5IHRA 2V5JA 3ARYA 2J27A 2ZZ7A 2W66A 3KS6A 3L0KA 1LOSA 3W25A 2PTZA 1W5OA 3H2OA 5DFAA 4V15A 1BAGA 4B5WA 4IGHA 1CZ1A 4G1KA 3L5AA 4NNAA 4LAUA 3WFZA 2VRJA 3BOFA 3HV9A 4ZOCA 4MWAB 4YTSA 1DYSA 4B16A 4H7CA 3ZVHB 1V3IA 1PX4A 4N6FA 5A6JA 3EDEA 1I2PA 3OOQA 3MW7A 3P5ZA 1V4YA 1GOXA 4S3DA 2HCVA 3BURA 1SFSA 1Q13A 1W3LA 3TJ4A 3GNDA 3QLLA 1OSEA 3GH5A 2J8TA 4JX5A 2XM1A 1J0KA 2AL2B 3VC5A 3A22A 5LHEA 1F61A 2X0YA 3M64A 3AS2A 4PBEA 1X38A 4EPDC 5KEZA 2ZCGA 3OGVA 4O1CA 3CUIA 2DW6A 1O5RA 2FDMA 2ZUWA 5KMYA 5LIUX 4DJEA 4WJEA 1KXVA 5J5RA 1QCWA 1XBZA 3JUGA 1F3TA 3M0VA 4FNPA 3M43A 4JBRA 4GISA 3MCOA 2CESA 1RA5A 1BRLB 4LY8A 2PDCA 3HG3A 2WVUA 1XLBA 1BQCA 2XIJA 4JYEA 3VVGA 1YDNA 9XIMA 3W71A 1EC9A 1YTDA 2YCJA 1RV8A 4LF2A 1UUMA 5CPLA 3QKEA 2Y7GA 1CGWA 4LVDA 4GUIA 4MJMA 4HYVA 3C0QA 3TK7A 3OJGA 2O0TA 1KCKA 4XZHA 1ICQA 4ORMA 4QE5A 1CENA 1KLZA 1VGAA 4I7UA 5C9WA 2GVGA 1ZFJA 5G1TA 4GIAA 4PA8A 4KQNA 5D33A 3WQEA 1UJQA 4QS6A 3UY7A 1XBXA 4HPGA 2CBJA 2XSAA 3IANA 2VRKA 1R86A 1RA0A 3GBDA 3W7PA 4CEXC 1KFJA 5FSEC 1SZEA 3BLPX 3UJRA 4DI8A 2BASA 3EWCA 2QMJA 3C0SA 1XD1A 4ATDA 2FFCA 2J47A 4QJ3B 3NXLA 3L66A 3H7RA 3WJSA 3A9BA 2QXWA 1ALDA 4H8UA 1E0WA 1TTPA 4C7GA 2FTWA 1WB0A 4LAZA 4AH7A 3AIEA 5JBEA 4UQEA 1BG9A 1W5QA 3PP7A 1EDGA 2GGEA 4LCRA 4RW5A 5DCDA 1W17A 5F2LA 1OD8A 4ZQCA 1THFD 4KRUA 3KBWA 3WH7A 1IEQA 3TN6A 1AQMA 4HOXA 4H9XA 3AISA 3VFCA 2R1NA 4UXDA 3CMFA 4GE8A 1KTCA 4V1XA 3W07A 2G0WA 3KRUA 3UXLA 4HQVA 1M01A 1SZNA 2ATSA 5JXQA 1XYFA 4AHOA 1IWPA 3EXSA 3SW6A 4CD4A 5HJLA 1PIGA 2V3GA 4LVBA 4OFCA 3FX4A 4IHCA 1H3GA 3MMDA 5FI8A 4I3GA 2ZIDA 4FLSA 2NWRA 4L5ZA 4ADUA 5HXMA 3H4XA 3VMOA 2VRQA 1DWHM 9XIAA 4MSSA 2Y70A 3UU0A 2CZVA 1BHGA 4PMQA 1LL6A 4D6IA 2X16A 1I2RA 5E70A 1RK6A 2D22A 1I8JA 2QAFA 2PGFA 4JTHA 3EA1A 4MWAC 3BANA 1QFEA 5BOFA 3QQ1A 1LBLA 1ZBCA 2WVSA 2F6XA 2GWNA 1WUEA 3FSUA 1A0DA 3GDBA 1RD6A 4XIMA 3BLFA 4UTJA 3UXAA 3K4AA 2YA1A 3AO0A 3BWWA 2P0IA 3VDHA 5CPOA 4A22A 4F2TA 4NZJA 3SCRA 4NL1A 1PWMA 2UZ9A 4KIRA 4Y9MA 5D9OA 4IFKA 5MHBA 2PD5A 2HBVA 5HULA 1S2TA 1W9BM 4L4MA 2JF6A 4UMBA 5A8QA 3WY1A 1NH6A 3PR2A 4WGHA 1UP0A 3UQNA 1ZP3A 4UMAA 1Z41A 4DZAA 1UZDA 1RZMA 5MKGA 4H9MA 2Z00A 1W3NA 2XFFA 2CBIA 3H55A 1IXPA 4F0RA 2VEMA 4L4LA 3B0VC 2ZRUA 3WBWA 1XHGA 3IV3A 1XISA 3DBNA 2FGBA 3VGGA 2B7NA 4AZ6A 1ADSA 4PUJA 2H9AB 4AXKA 1A5LC 1TREA 4RLIA 3WFAA 1BKSA 3AU6A 5BXRA 2R1LA 4IXHA 1XJBA 4R5EA 3TN3A 1V7AA 4YL2A 3GTHA 3ARXA 2Z7KA 3AWNA 4ZE4A 3LXAA 4IMFA 4HD5A 3T07A 2HV5A 3R8HA 4IQJA 3W7OA 4RZ6A 4F9JA 2YFOA 3WLLA 2C1HA 4NXSA 5CZ0A 4AIOA 3VNJA 3EOLA 3N9RA 2X1RA 3SEPA 1GYLA 5BMWA 3TVAA 2Q71A 3PPHA 5C70A 3TNOA 1NP0A 5JIPA 2PP0A 3ATYA 3KRZA 2RUSA 5GJNA 4Y90A 4GCXA 1GVQA 1GW9A 5HINA 4EE9A 2DY3A 2Z27A 3HMCA 3MUY1 2VX4A 4PE8A 2XVKA 3VOGA 1WV2A 1HJVA 1RAKA 3Q94A 1KGUA 4OBSA 1KRBC 1G1YA 1UKPA 2FGZA 3QFWA 3ITCA 3OLGA 1M7XA 4XTDA 4PB4A 2REQB 1NFGA 2VZSA 2VWTA 1I2NA 1NWSA 3T4CA 1XBVA 3LSBA 1KTBA 2GJLA 2VFHA 4L4OA 1JZ6A 5EFDA 2VYOA 4UMCA 1Q6DA 4KEMA 2PPGA 3M7WA 1PB0A 1YKWA 4J1OA 5E1QA 3M0IA 4AEFA 2QQ6A 1J5SA 2ZX8A 1XLGA 3LN3A 2J78A 3P8JA 4I5RA 1B3VA 2C6QA 3FEMA 2DZBA 4H9ZA 1K8ZA 4OOUA 3MKVA 3T0TA 1HT6A 2PTYA 4NT0A 3KVKA 4N02A 3W83A 2INFA 3PC0A 4JFWA 5CSUA 1M68A 1Q6FA 4KGJA 5I3KA 1NU5A 3PSWA 4DEFA 4TMCA 1LM1A 4M24A 4TO8A 1U5JA 2Y8UA 1PCWA 1F74A 2VEPA 4BK9A 2XFYA 2WWDA 3C2VA 2DZAA 3GHUA 2VEFA 3QC3A 2CZ5A 3CK5A 2EKGA 3JZEA 3CAQA 2GDQA 4W8AA 4O17A 5E9XA 2C14A 3W2MA 4TXEA 2JFEX 1V3MA 1LBFA 3VKBA 3GIYA 5KZMA 1R3SA 1FKWA 1HO1A 5I3GA 3W37A 4A3HA 3CO8A 3DC8A 5CZKA 2DGAA 3MSDA 5H8UA 4W93A 2WNNA 2YIHA 3GC5A 3LLFA 2Q3OA 4QP0A 4B5TA 3AMKA 1E70M 1QRQA 4IISA 4S3FA 1NWUA 3B8UA 4Z1BA 1C8VA 4LU0A 3QR0A 2W5FA 2Z4GA 1E9LA 2HROA 3SRKA 1M6JA 1O1HA 2WHMA 3GNPA 3RM4A 3RPMA 4TMBA 1YXDA 4IX2A 2D1ZA 1R8LA 4RCXA 5BXTA 2GGJA 2PBOA 4QJ1A 1NDWA 4FI4A 2YCKX 1ZENA 3TN4A 1XP3A 4UFMA 1H0IA 1SPQA 3VCCA 5AN7A 1DIDA 3NZ1A 4FOJA 3IJ6A 1O6IA 4AAJA 4NZ4A 1RBOB 2PDKA 3M46A 3W1UA 4MY9A 3ARQA 2GGHA 4I6KA 4GZIA 3NM3A 1WOBA 4ACZB 1SU5A 3H21A 2ZA2A 2E9MA 1RQEA 5A6BA 2QCHA 5CC5A 1XPGA 1OX5A 3G8EA 4H6KA 1HO4A 1V51A 2CHOA 3H2AA 4AX6A 3E49A 1UP2A 3W7LA 3FK4A 4MWAE 3O1NA 3OTRA 3C61A 3B8TA 5XIAA 3TE9A 2VUYA 1QO2A 1XGDA 1KBIA 4CCEA 1GQKA 2G3IA 1OFOA 3SRHA 3BLDA 5GJPA 1P5BA 1JCLA 3ZJ7A 3ZYZA 1PX8A 3CJPA 3GIPA 8RUCA 1CT5A 5CJNA 3E0FA 2G3JA 4HKPA 1VHNA 3P8IA 1JNDA 4OKDA 4XAPA 3NR0A 3E0LA 4QQ3A 3FA3A 1BF2A 3ITVA 4LC6A 1FVPA 3LGGA 3UG8A 1GQIA 3VMNA 5CC3A 3TC3A 3LCHA 3PPCA 1P7TB 3RX3A 4ALDA 2OKTA 3LCXA 1IIHA 4F0SA 2ZBTA 3NTYA 2C15A 4YTQA 1D3HA 4MMWA 3A12A 3ALFA 1JZ8A 3VIPA 3M41A 3HU7A 1I75A 3HURA 3UVIA 4A3YA 3C52A 4JS3A 3RX4A 3P0XA 4OBTA 3QBUA 2QGYA 3F4CA 1QUMA 3WH5A 4XB3A 1R9YA 3GUWA 3E2QA 3RFAA 1POKA 1P0BA 4REQB 1CB7B 2X42A 1TUFA 3PTKA 3K1GA 2V67A 2BHUA 3H4WA 2QF8A 2QHAA 4Z2HA 2ESCA 1O94A 3GE7A 1TTIA 3NQGA 4LY4A 3W74A 4E8CA 2VR4A 3TUUA 1JDCA 2J7HA 3URQA 4HK6A 1E6SM 3EOOA 1EOMA 3NQCA 4PTWA 1W9DM 3A4JA 4LAOA 5K9XA 1EOKA 4AD1A 4G2DA 3G1HA 1PPIA 4O12A 1GVSA 2QMKA 3AYRA 3VIHA 5M17A 1AQHA 7XIMA 3S47A 4LRSA 1GYMA 3G6LA 5FJPA 2WNZA 2W6RA 1IV8A 5DBUA 1DJZA 3GW0A 3LQLA 1X98A 4HNNA 2JALA 4KGLA 2NX9A 4FK9A 4B3LA 1EGZA 3E2SA 4LPCA 1FOBA 1YPIA 2HE8A 3AHTA 4Z1YA 1MNZA 4X2RA 2Y24A 1JULA 4LS0A 1H7OA 3N1AA 3VOHA 1REQA 3LZ3A 4CNNA 1FWDC 1G7UA 3S2NA 1NELA 1T99A 3DG6A 3LRKA 4TIMA 4IXXA 1Q6CA 1WAWA 1W1YA 4DWDA 4S3CA 3WLSA 1UR3M 4AZGA 1AH0A 1GVEA 2WSPA 4PMJA 4W7UA 1Z89A 2IKIA 1OFDA 4A3UA 1X6NA 3RMEA 3NYDA 1F9CA 4FF7A 4OJYA 1KM6A 2BODX 4HSHA 1B4KA 4DO5A 3FLUA 3S2JA 2J8GA 4M0XA 1NEYA 4A8RA 1WKFA 4NASA 5EL1A 2WC4A 4XZMX 1Y5VA 1BKHA 1J11A 3O9NA 4DF0A 2VKZG 2HK0A 3UCCA 1J96A 3E5BA 1RLDA 4NAFA 2PDWA 1YPFA 1UWAA 2NQZA 1V77A 5HPOA 1YE6A 1A53A 5I7GA 1RUSA 4LSBA 5CAHA 4QNEA 3W3OA 1EUNA 1PO9A 2WSKA 3ELFA 2CNCA 4JQ1A 1T40A 4GGHA 3TTSA 5E0CA 3V16A 2OSWA 1QJWA 1BSIA 2ZA3A 1OG6A 1LG1A 5LIYX 2E6DA 3BUVA 3DIPA 4B2DA 2QV5A 2GUYA 5TIMA 1P6WA 3TWBA 2GSJA 5ABGA 3WDPP 3VNLA 4CLMA 1AH4A 4V27A 3TQVA 2NSXA 1QU4A 4E2OA 1QW8A 1XBYA 4WR3A 2V2CA 3TJIA 2WZIA 2H6RA 3NL5A 3MQTA 3OA3A 4PRTA 1UWSA 5I07A 4WGXA 3NL3A 1ECEA 3NGJA 4DLMA 4QNWA 3L4UA 2HQAA 4HGXA 1S5WA 4E4PA 5LA1A 4QS5A 3S3GA 4L7ZA 1L0PA 2PCEA 5CCZA 4Q3MA 2O4MA 3BPWA 4UQCA 1QMLA 1TVNA 3VE9A 1ZZMA 2FHCA 4HN8A 2I9EA 2J7DA 4JY9A 4JTRA 3RILA 1UWTA 1AW1A 3MSYA 4LB4A 4JIPA 1BVZA 5CC7A 3FV9A 1A47A 1CXKA 4DM2A 2QUMA 2XISA 5LHFA 1VQTA 3B0PA 2FQIA 4J35A 1Z7AA 3BV7A 3N4FA 1VB9A 3G6MA 3P6LA 3KVJA 3EOSA 2R14A 3W1LA 1FHLA 4OV4A 7ENLA 3KWXA 2QJJA 4R33A 4O54A 4IFOA 1VYSX 3VUPA 4AISA 4Q4KA 1W3HA 2OVLA 3FA4A 1UYQA 2VFDA 1VAHA 3HPAA 5M03A 3KVMA 1TUXA 4XBSA 5IDIA 2VT0A 4MWAD 5DLCA 3KZPA 4JOMA 5AC6A 5IFPA 2G97A 4DELA 1JZ4A 4HOZA 4O8AA 5D2TA 9RUBA 3NO5A 1OFBA 3V1PA 3W2LA 1HUVA 2QLYA 2P3ZA 1ZU8A 4U28A 4C1LA 1JNEA 1QK2A 5J04A 3B03A 4HHLA 3F4VA 1ONEA 4IICA 3HB9A 4M6VA 2J62A 3QV6A 4FNTA 1AD4A 1AUSL 3RNDA 2WMFA 1GYNA 2IW0A 1PDZA 4YWSA 4FNQA 3LDVA 2XINA 1BPLB 1CXLA 1XH1A 3WJWA 3PBUA 5AZ1A 1UR9A 4AZHA 4HCDA 1KM0A 3AIVA 3OGRA 3ABOA 4M3PA 4MIMA 4KWSA 4HNVA 1TMHA 2ZE0A 2CBVA 1G4PA 1ZY9A 2OZTA 4TVUA 2ICSA 3UNDA 2CWXA 1R87A 1VCVA 3O3RA 4C5YA 3FN9A 3NL2A 4LNYA 4MJ2A 2V5CA 3IIZA 3RJXA 4S3AA 3G22A 5IDZA