4L1GA

Crystal structure of the bc1960 peptidoglycan n-acetylglucosamine deacetylase from bacillus cereus
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
214
structure length
213
Chain Sequence
WTPFSWVEKYAYAFSGPYNKAEVALTFDDGPDLEFTPKILDKLKQHNVKATFFLLGENAEKFPNIVKRIANEGHVIGNHTYSHPNLAKVNEDEYRNQIIKTEEILNRLAGYAPKFIRPYGEILENQLKWATEQNFMIVQWSVDTVDWKGVSADTITNNVLGNSFPGSVILQHSTPGGHLQGSVDALDKIIPQLKTKGARFVTLPSMFQTSKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unusual alpha-carbon hydroxylation of proline promotes active-site maturation.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
molecule keywords Peptidoglycan N-acetylglucosamine deacetylase
total genus 79
structure length 213
sequence length 214
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4l1gA00
4HD5A 3WX7A 2VYOA 4L1GA 4NYUA 1V6TA 1XW8A 3HFTA 3RXZA 2C79A 4NZ3A 2I5IA 2IW0A 3CL6A 1W1B1 4V33A 4F9JA 2E67A 4F9DA 2C1IA 4NZ4A 2J13A 3S6OA 2C71A 2C1GA 4WCJA 2DFAA 2W3ZA 1W1A1 3QBUA 3CL7A 4NY2A 2Y8UA 1Z7AA 2QV5A 4NYYA 2NLYA 3VUSA 2CC0A 2XU2A 4NZ1A 4NZ5A 4OUIA 3CL8A 5JMUA 1W17A 4M1BA 4LY4A 4U10A 1NY1A 5BU6A
chains in the Genus database with same CATH superfamily
4PE8A 4WOZA 3M0LA 1JFXA 4LEQA 4YWSA 2QF8A 1AQHA 3MMDA 4DI8A 1XV8A 1GONA 3S6OA 1ITCA 2YBUA 4LB3A 4ILSA 3RMJA 1VIZA 1HJUA 3L4TA 3WNLA 1CLXA 1G69A 1TKKA 3N2OA 3F5LA 4CVUA 2Z7KA 3R0UA 6REQB 1R6WA 3SCRA 4NAEB 1QNOA 1RHCA 3RJXA 5I02A 4S3KA 3LDVA 4PL2A 3C3NA 4NVTA 1VFTA 1XF0A 3E0FA 4RK8A 1EUNA 2WCGA 4CEXC 3PFRA 3C3UA 1I0DA 4TQTA 2ISVA 2NVAA 1XISA 3GWQA 4BA0A 1E0XA 1V77A 3TJXA 4GVGA 1MI3A 1RCOB 4CU7A 1E70M 1HKVA 4JYEA 4LUYA 1M6JA 2PRMA 3N73A 3MQTA 4EVZA 4WCJA 3SZ8A 4A8RA 1C92A 4AZIA 2DW6A 3G1VA 2G3FA 1OCNA 3WFLA 3VXGA 3W7IA 3OVRA 3AALA 3HFTA 1FFRA 1WKYA 4LYKA 1HP4A 3VE9A 2XN2A 4AYSA 4NJKA 4WKHA 5HQLA 3AI0A 4UNKA 4HK5A 4IX0A 3DC8A 3WYZA 2NSOA 4LGXA 2HVOA 1DL3A 4B91A 1W32A 4ZOCA 3VOJA 1E56A 1RUSA 1FCBA 4A3QA 1LG1A 1IWPA 1XBVA 1XKYA 1VQTA 5IDZA 5FF4A 3E96A 3THDA 5E9AA 1JI2A 2MUCA 4URIA 1HKIA 4H6RA 2VI0A 4WUIA 2GVJA 4DLFA 1W17A 3WLQA 1J10A 3CHVA 3R11A 4CNOA 3MJYA 4MLJA 4N42A 1CLKA 3UZJA 3UZWA 1RV8A 3CQ0A 1F6PA 3UWZA 2WM0A 3P80A 3WQ5A 1S46A 2ZRWA 1NELA 4JTUA 2QR6A 1MQPA 4GI6A 1GOMA 1JPKA 1KRAC 4PEKA 3S2LA 4A8IA 5FJTA 2WSPA 1O5QA 2VTFA 2Z6IA 3VABA 4FAMA 3QMTA 2J74A 1ONXA 2J9XA 4LW7A 4ACZB 1RZMA 3PANA 1AH3A 1XC4A 2P8CA 2VO5A 3MV01 5H6HA 4OJYA 1W1PA 3MCOA 1VH7A 3A47A 2A6NA 2BGSA 1RXOB 3XIMA 1TELA 5JVLA 3GYCA 1QK0A 2OKOA 3LOTA 1UBSA 3B9DA 4HZMA 4C6CA 3SGZA 3BJSA 1KA9F 1KWGA 4HCLA 1XLJA 3SRDA 1A5KC 3II1A 4QNEA 1R3WA 2C7FA 1ZP3A 4M56A 3VI2A 3OEXA 1JXKA 2J27A 4GZEA 2WMKA 1UIPA 2I1OA 2CETA 4O12A 3AXMA 3LCFA 4HCDA 4OGZA 1GHRA 3ITYA 2R91A 2VOMA 3BK0A 5DX7A 1CLVA 4DO5A 4F0SA 2W61A 3RCMA 3KVLA 3FKRA 4XBSA 4DJFC 2WW5A 2ZZ5A 3DKJA 3U5UA 1YBQA 5HXMA 3BLFA 1FWEC 4H9TA 1PO9A 3AO0A 4GNJA 5DY3A 2FDSA 2V2DA 4WJ8A 5CJNA 2GJXA 2A0NA 1IQ8A 3VIFA 3ECQA 3VKDA 4UFIA 5TBOA 1YNYA 3LQGA 1H63A 2RDTA 4W8AA 4D1IA 5LNRA 1KR0A 3VKKA 3ITGA 4NZ4A 1GVFA 1UA7A 3CAKA 3ZOAA 1EH9A 3ME3A 3B3DA 3TC3A 2HBVA 3G3DA 1XX1A 1JDCA 2OWXA 2V68A 3S0CA 4I7VA 2VXNA 4UC5A 4U2YA 5DXYA 5TD4A 1IGSA 2QAFA 1L8PA 4IP4A 1UWQA 2E09A 1JCJA 3NQ2A 2YYUA 3GIYA 3R43A 4DBUA 3AOFA 4KRUA 4QTGA 1F4AA 3SN1A 5DT5A 2DIEA 4IXHA 3PY2A 3OLIA 1Q6GA 3N18A 4B5NA 4FSAA 4RZ4A 1BG4A 4CQCA 4DNHA 2QULA 3SECA 3OODA 3TSDA 4IMDA 3GK0A 1QPQA 3EX3A 3E3HA 3VMPA 1IXQA 3KRUA 4UIOA 4Q6XA 3FW6A 3TVAA 3ZVIA 1KBIA 5K9XA 1A3HA 1H5VA 3NZPA 1FCQA 2FGZA 4GINA 1BXNA 4C7FA 2WVVA 4PSRA 3T05A 1L6YA 1M7OA 4H8VA 5D9OA 2CERA 1TPVA 1MW3A 4IM4A 4TX6A 1OZMA 1YDVA 4NZCA 1KFCA 3TWAA 2PDCA 3HZ3A 3TLLA 3V0SA 4R7JA 4MZYA 3EMCA 1XCWA 3VKJA 4XTIA 4RXGA 3MY9A 2J8FA 4GZ7A 4PTXA 3EOEA 3SQMA 1KXQA 4C6IA 3NL6A 4Y8FA 4YVVA 1R8LA 1M7JA 4CU8A 3UA3A 1QCWA 4KW2A 4J35A 2G5WA 4WY0B 2VX6A 4HPJA 4U28A 2GGJA 4UTUA 1RBLA 3OHIA 4W7UA 4TOQA 4QX4A 3B9OA 3CS2A 4BQ3A 1QI2A 4JKMA 1VR6A 2TRSA 4ONVA 3C5QA 2PZNA 1RQBA 3ZSSA 1DJWA 1TPUA 2DU2A 1XH2A 4GFSA 1EO5A 2OX4A 3OQEA 3SCOA 3KHJA 1YE4A 4AWEA 5BXPA 1EYEA 3NWRA 3E2RA 1NFPA 4NNAA 3PULA 3REQB 1V3JA 3W1QA 2WZHA 1JCTA 1QOPA 3S2MA 4JIIX 1KM2A 3ARYA 5CSRA 3VDGA 4J1OA 4LRSA 3ABSA 3PS7A 3E02A 3LRKA 1B9BA 1OGSA 5AKQA 3MZNA 3WF2A 2PBGA 4CNNA 1Z89A 2X1SA 3M6YA 1J12A 1XICA 3MCNA 4Q32A 1Q7QA 3AXIA 2GVEA 1GUVA 1QPRA 3BXWA 3I6EA 1PPIA 2YA1A 1J9YA 2VC9A 1I2RA 2H9AB 3WDIA 3PWIA 1E4LA 4E6MA 3VIJA 2CLKA 3DFQA 2VELA 3T0BA 1UZDA 1MFVA 1PB0A 3BJTA 2KZHA 1XYAA 2VR2A 3LHUA 1JQVA 1TA3A 3PSWA 2PFHA 3EDJA 4GZIA 3WBWA 2WPBA 2VGFA 1GOQA 5HINA 3C2EA 4JHMA 1PZ2A 6XIAA 2PDBA 1AUSL 3ARXA 3QBUA 3M0KA 1YTDA 3B8UA 4DO4A 3LCIA 3GRIA 4A3UA 4QHRA 2ZYFA 4JHZA 4JCLA 2OSXA 1DWHM 2GJPA 2J77A 1TZ7A 4RE3A 4TX9A 3G0SA 4W8BA 1K9FA 2XM2A 1J0IA 4PA8A 1CZ1A 1FP8A 3APTA 2YL6A 3UJRA 2WNZA 2GLKA 3JZEA 1Z48A 5AYXA 4BWLA 3UXDA 1W1A1 3DFSA 1RAKA 2FB3A 2PLJA 4YTRA 4KIEA 3BW4A 4H9VA 5BU6A 1YKWA 4LS0A 1I1WA 4Z1CA 3IIVA 5LGXA 3IUIA 2ACRA 1GVRA 1U1JA 1SR0A 4DLMA 1PTDA 1LM1A 4Y7EA 4GYJA 4DBEA 1VPQA 4UQEA 2OMAA 5CBJA 3O06A 1GVEA 4V1XA 3ZWTA 3AXKA 2X1TA 1W8SA 1IE7C 2QPXA 1XKJA 3P6LA 4E2OA 1ITQA 4OKDA 3VA8A 1M5WA 2PDPA 1I0BA 5LA0A 2DQWA 4AC1X 3MO7A 4FNQA 3B05A 1HVQA 1Q6RA 1V02A 5EBUA 1EP1A 4DJDC 2JK2A 4IQDA 1F76A 3CZJA 1VC4A 2VFGA 4H9YA 3AROA 3N25A 3W1TA 3H2FA 4H9ZA 4O11A 3V18A 3K30A 3MV11 1UMYA 1W5NA 2QW5A 2L5HA 4YVPA 3KL3A 4E2DA 4QQUA 3M5YA 3KS5A 4DF1A 4GOAA 1CYGA 1OIMA 2ZA3A 3MP4A 2QPSA 1VFLA 2I57A 2J66A 3IAPA 3P5ZA 1RH9A 1QT1A 3VIPA 4M81A 1A5NC 1NOFA 1ZRQA 3CV7A 1C9WA 3W75A 3AYSA 1GQIA 1TPFA 1F61A 4PUMA 2WBGA 3E0VA 2BVYA 4JTDA 5H91A 1TTQA 3HG5A 5EA9A 4US6A 2AGKA 2ZA2A 3LMZA 1ODUA 4QIUA 4MHBA 1CXEA 2GQ8A 5CXPA 1ALDA 3TE9A 4FNSA 3E6EA 2P0OA 2FHCA 1KRBC 2VMFA 3TW7A 1MRQA 3H53A 3H21A 2G3JA 3W85A 3RLUA 2R6OA 4O1CA 4QXIA 1GKRA 2XFRA 4I9TA 3LCGA 3ENLA 3TN4A 2ZZ2A 1U33A 1B54A 3IEBA 5J8LA 2WANA 3W23A 4DYEA 7PTDA 3FIGA 4KFOA 2GGGA 3F03K 1RJPA 3QV6A 3S6TA 3RGTA 2ZC8A 4B92A 5AC8A 1VD6A 1G1YA 2VEGA 2X0HA 5FF3A 2Y89A 1FOBA 1UROA 1H7OA 1UB3A 2VFDA 4DELA 2VFHA 4K7YA 4V1YA 3SN4A 3OLEA 3A5VA 3CEPA 1UCWA 3NEHA 5BW6A 4LBSA 5FA5A 1GPWA 3PUDA 2Y63A 1GOOA 3GVQA 2E6DA 1GW1A 4HYRA 5H1WA 3LERA 2OZ3A 2QCCA 1UKSA 1U5JA 3B9EA 2VEMA 3L2LA 2G0WA 3PPFA 1AW5A 1NAL1 3OOQA 1S2AA 4DO7A 4GFIA 3NGFA 2NQ5A 3W7OA 2VEFA 2WHJA 4CQ8A 4HHHA 3R13A 1DKWA 1IT8A 4QR6A 1EF3A 1JDFA 3HO8A 4C65A 4ZSTA 1FWNA 3WDJA 3PJXA 3RLGA 4M80A 4IGSA 1E9LA 3HJZA 3R0KA 1ZHAA 1Q65A 5HNRA 1HO1A 3HURA 3O05A 2PA6A 4JQ3A 1MRAA 1ADSA 2WJFA 1XIJA 1QJWA 2IPJA 1CXKA 1NH6A 4PR4A 4IGMA 3O15A 1TJ1A 4I9JA 3P62A 4DJFD 3NYDA 3S6DA 1CI1A 1L6SA 1HF6A 5C9WA 3FDGA 4GWEA 2MANA 5C9ZA 3B40A 3R2GA 1RPKA 4O15A 4RL3A 3HPAA 3BE7A 1G6CA 4IIHA 1ITUA 4B2DD 3W0KA 2VX4A 4JQ1A 3CXOA 3R10A 4G1NA 3MWCA 4QG8A 2HJPA 3N04A 4J3WA 4GACA 3SRFA 4US5D 3QW3A 4XZBA 1EO7A 4Q7IA 3NQDA 3UJFA 3EMQA 3JR2A 1OGBA 3BC9A 2I9EA 1LBFA 2CKRA 3SSZA 4MB5A 1VLIA 4EACA 5I77A 4JD4A 4RE2A 3I10A 2HROA 2WV8A 1IEQA 3E5PA 3N1AA 4J3SA 4C6NA 4QG9A 3BG3A 3NG3A 3LI1A 2XH7A 1Q4NX 5ECUA 3GD6A 1TUXA 3OA5A 3ZXWA 1GORA 1QDSA 1T99A 3KTXA 2ZDRA 5GQBA 5K9CA 3R8GA 5XIMA 3SY8A 4DPQA 4ENLA 2ANUA 2PGRA 3APGA 4UR7A 4NJIA 1L2QA 1KRMA 1OZQA 3RFAA 2BGQA 1R0MA 1ZAJA 1Z6KA 4O8RA 4L4PA 4BS0A 4Q7BA 1WYIA 3P81A 4IISA 4GUHA 2YBTA 5DCBA 1BTMA 4QNWA 4AU0A 3W29A 4BQ2A 2XH4A 4R9OA 3PM6A 1N7KA 4AIUA 1FKXA 1H60A 4QS6A 1SUXA 4PUEA 3CO8A 4ATDA 4JTKA 4MJ2A 5E0KA 2POTA 4YTUA 3GDMA 4QISA 2A2IA 5A5WA 3UYIA 4H6EA 2VT0A 2Z28A 1P1XA 2YCLA 4AMAA 3M0JA 1TJPA 4S2BA 3EXRA 4U10A 5AC7A 5A6KA 1WAWA 1IXNA 1RR2A 4TTUA 2O4QA 1W3TA 4ZENA 3C4UA 3VZYA 2QDGA 5TIMA 1V3IA 3BVJA 1GTHA 1GVSA 3TU9A 3W1LA 4CEUC 3PTDA 4GGHA 4QLKA 2VZSA 5DCEA 4AY8A 3QH2A 3ZFHA 3ZS4A 5EMUA 3QN3A 3ARQA 5HWJA 4UQBA 4GO9A 4HHPA 1J2WA 2X05A 1UMLA 3O0KA 5FJIA 3VUPA 4QE4A 3FGCA 1T6MA 1C91A 4DF0A 3ZR6A 4N9BA 5CSYA 4GGBA 3UXIA 2BVWA 2IQDA 3GDRA 3N4EA 1IXPA 5I3GA 3VGHA 4HMNA 5E70A 1Y5WA 4X22A 4JKKA 1EZ2A 3BV7A 1ZSXA 3UQNA 3DZ1A 4DIAA 4W89A 1GNXA 2B4GA 3GY1A 1YHTA 3WDRA 1I8JA 4M7TA 1IV8A 3U48A 2G4JA 1N55A 3QPZA 4UXDA 3VE7A 2IQ0A 1J0YA 1LQ2A 3MO4A 5CG0A 3WIJA 5BOOA 4LVGA 2TYSA 3CHDA 1IT7A 1TUFA 3OJGA 3WNOA 3C6CA 5M03A 3F4NA 1KBBA 3TKFA 4BWLC 1E5NA 2XUCA 5JIPA 3B06A 1O6IA 1OK6A 4DWSA 4Q8OA 3V1HA 1FFQA 2WAGA 3EDDA 1TZZA 3W7JA 1FHUA 1LJYA 3IK4A 3IWPA 3EKGA 6TIMA 4UTKA 1ZAIA 2BBFA 1IR2A 1GEHA 2PWEA 2I14A 1LCOA 5HANA 1TWWA 3EA3A 3PFMA 4IGHA 3GZ3A 5CC5A 1SM9A 2EJ1A 4ZQCA 3U57A 4B5SA 4ZB2A 1S5NA 4W86A 2H8XA 3WQCA 1M1BA 4NIRA 4O19A 4I7WA 2FVKA 1H7NA 1RA0A 2YOCA 2Q6ZA 2DSVA 3ZR5A 3NO3A 4ZOBA 4IIFA 4JN6A 1KD0A 3SCQA 2CHNA 1KCLA 1ONWA 1E73M 2YW4A 3EPNA 3GAYA 4HSOA 1K9EA 1NFGA 2ZTJA 3KVJA 1JFHA 5AN7A 1JGIA 2J62A 4X2RA 5I07A 4UNIA 1YXDA 1SZEA 2H3BA 3OA3A 3RX3A 2VGIA 3K4AA 2XDFA 1NU5A 4OWGA 3AFBA 4JN7A 3L21A 3UXAA 3WQOA 1AMKA 2DSWA 1A4LA 4LF1A 4NJJA 1THFD 3V36A 5AHNA 1P48A 1YMYA 3IRDA 2YL5A 4UWMA 1D3GA 1GOWA 4DZIA 1JULA 4O54A 1KW1A 1PHWA 3C8FA 4Q8QA 3PBGA 1KNWA 1Z41A 3GNPA 2Y4SA 2HBXA 1PKLA 3RRAA 4N0RA 3P67A 1HKMA 3I6TA 3M0MA 2WNNA 3GTNA 2XZ7A 4WJXA 4D1JA 1JAKA 3FJNA 1ZQ5A 1XRSA 1F73A 2DSKA 1NWSA 3HQNA 1R47A 3IGUA 2D2GA 2WSQA 3MI2A 3EBVA 5CCZA 5HAOA 5G5IA 3TWBA 2R14A 4L5ZA 3WFZA 1W1YA 3GQYA 3ATZA 5HQMA 2OG9A 3QLLA 2O0TA 1EJUC 3WQ8A 1RY0A 4DVOA 4L6OA 2UWFA 5D03A 3M64A 3DFTA 3QC3A 4RV8A 3PB0A 4MSSA 2VJXA 2ZRUA 3TJIA 1EA0A 3PJTA 1B57A 1BQCA 1S5VA 3OGSA 4Y90A 4AD2A 4F79A 1F3XA 3AS1A 4AF0A 2J78A 3BDKA 2WK2A 1OADA 4WF7A 1LUCB 4LSBA 3N12A 3B0UX 4R27A 2RJGA 4ZR8A 4LS2A 1XS2A 2Z4GA 3ARWA 4JGDA 1W0MA 2CBUA 3AQUA 3QV8A 2NLYA 2P76A 2X09A 4CN6A 1D8WA 5KEZA 1F8MA 4CN4A 3T2OA 3EX6A 4PTNA 3DC0A 4YYFA 1E72M 3JRKA 1SMAA 4V15A 4MNKA 3NIYA 3AMDA 1OC5A 3AMCA 5M3WA 5AC5A 4OUIA 1E4MM 2A3LA 1TG7A 4KWVA 2XINA 3UP8A 1IZKA 4WZHA 3DFOA 1BGGA 2GVYA 4ZO6A 1BQGA 2HXTA 1Z69A 2J6XA 4HNVA 1GG0A 3FY1A 3BMXA 4XVEA 3AIUA 3FEQA 3HPZA 2ZE0A 1X6NA 3MDUA 5FJPA 1XUUA 1E51A 2PZ0A 3AIQA 3C2RA 3WDPP 2BOEX 5A8GA 5M17A 1UKPA 1DHPA 1H62A 4BZYA 1X6UA 1VP5A 4UTHA 1TRIA 4DZAA 3WH7A 3W7DA 2DVXA 3GTXA 4N4PA 3U3HA 2OQYA 5DRIA 1ME8A 2PP1A 1QNVA 1QI3A 4UFJA 4HNUA 3VM5A 3FA3A 2Z1WA 4KWSA 3N2CA 4KKXA 4RE0A 2HVMA 1FWIC 3RAOA 1E6XM 4Z2GA 1HXJA 4ZXLA 3MYOA 1SYTA 3NVTA 1T40A 5HUPA 3AHVA 5J5DA 1R30A 1DIEA 4H3DA 4YU1A 1G5AA 1QWKA 1BSIA 1VFSA 4H7VA 1IYXA 4XIAA 5A6TC 1TCDA 1XIMA 5GVJA 3IAQA 3TN5A 1KXHA 2JIEA 3C2YA 1GYMA 4ZO8A 3ES7A 4BF7A 3H7VA 4UZSA 1QASA 2O7SA 1AL7A 4PTVA 4AY7A 2QJGA 4HT3A 2V0TA 2DZPA 1V6UA 4KF1A 3NR0A 1CGVA 1B90A 3ABQA 1UPPA 3ATYA 3L5LA 3P84A 3N11A 4HPGA 4M24A 1ECEA 1LLOA 1JCNA 4PYSA 3TC6A 5DCDA 3BCFA 2R1MA 5AHIA 4V27A 3TMQA 3NPXA 4UTFA 3CUGA 2BB0A 2WCSA 5EMMA 3WN6A 2IKHA 4TVDA 1NARA 2FDMA 3GNNA 1S1PA 1OX5A 3PNZA 5DELA 3WBYA 3W2NA 3SQSA 4MNLA 1GCYA 3WJXA 5CEWA 1ISVA 4B3LA 3XINA 2W79A 4FS9A 1YPIA 5G4EA 2E77A 2Z26A 1QU4A 4GQQA 1AJ2A 2V67A 1UP3A 1EP3A 2YL9A 2ZX8A 3VNZA 1UH4A 1YQ2A 2GJXB 5HWNA 3VKCA 1UD2A 1K6AA 4H7ZA 1QFEA 5D9PA 5JQ9A 4KS0A 5LXXA 4Y9PA 3NZRA 1PTAA 4GKLA 4I7UA 4DWDA 1XGEA 1S2CA 3WH6A 2OYKA 2XIQA 2XGIA 3Q65A 2WSKA 1LUCA 2FPTA 1C8YA 1DYSA 1I2PA 2XYLA 4MM1A 4B2DA 4XKYA 2E6YA 2GSHA 3N2BA 2VENA 4GD0A 1AK5A 1DTNA 2PRLA 4XTDA 1TV4A 4US5A 4XZMX 3KCJA 3MZ2A 3WH8A 1SO6A 1H7PA 3BGGA 4D9PA 5HPCA 3U7VA 3OIXA 3JU2A 4UQCA 2HVNA 5D02A 4S3FA 2HE5A 4PCNA 2ALDA 4TV6A 2VFIA 2VCAA 3WD2A 3AYTA 5HMSA 4M29A 3CUFA 4M6UA 4NASA 4JS3A 3UCDA 4Y9AA 4L64A 4GABA 1OM0A 1JZ7A 4EE9A 3NQ6A 3PN8A 2ZVRA 3EWZA 1KM5A 4ZQMA 3E12A 2QJJA 2CLEA 3FA4A 5CPNA 1XGDA 1RQHA 3F4VA 4IHCA 1F3WA 3CTTA 1BEUA 1SO3A 4RCXA 2VFEA 4HQVA 2NQ9A 2QZRA 4LYPA 4AH7A 4D6IA 3W1PA 4EPEC 3QFWA 4RDZA 1M65A 4IIBA 3AS3A 1VFFA 1WKEA 3BLEA 7CGTA 4QS5A 3NPVA 1CBGA 1PS9A 1J6PA 1JPHA 3LPGA 1A53A 2O7QA 1NDVA 4OECA 3NDZA 3EX1A 3MHUA 4EOUA 3SEPA 5CPMA 3USBA 3AUOA 2AL2B 3G1HA 3SRKA 3FYYA 1ZNNA 2OZ0A 3T81A 3NJ3A 3GH5A 2HNHA 3T9PA 3DYPA 5I5RA 4G8TA 4GISA 4WKFA 1YDNA 2VOTA 5H8PA 4HN4A 1OEPA 2GUYA 1XYFA 3VM7A 1Y5VA 4E8CA 1F6YA 1XYLA 4M1RA 1L0PA 4X3ZA 1G4PA 3KLKA 1B1YA 5KITA 1FXPA 1V7AA 4F2UA 1TTIA 4XIMA 2HISA 3C2VA 1O5XA 4BI5A 4IJBA 1ZJBA 4PB3A 3APYA 4JIPA 3SJ3A 3T8LA 3SCUA 5KMYA 4A3RA 2YSWA 3BLOA 2VZVA 4XAPA 2NWSA 4BR1A 3CGTA 1KCXA 3IRSA 4IWWA 4AZCB 4PL1A 1DTUA 7TAAA 2RGLA 5IOBA 1DWJM 3ZO9A 1TSIA 3STPA 2G3NA 4JQ2A 1WBHA 3S1VA 2I17A 3WEMA 2YZ5A 4B5XA 4C5YA 2EPLX 3CLWA 4J5NA 3DYOA 2GDUA 2AGTA 4IGNA 3O6DA 1Q6FA 1J96A 1OT1A 4JYDA 1J18A 3EMZA 3S47A 1G94A 4RLIA 3WF3A 2CLFA 3WKZA 2QCGA 2IXVA 1OFOA 2V5KA 1KV5A 2FKPA 2Q8ZA 5A2BA 4DWSD 4E5TA 4JKLA 1T8QA 2YCJA 4JTFA 3M07A 2ZZ7A 1YTEA 3NZGA 4REQA 4DZHA 3HQOA 2PLCA 3KBMA 3NQCA 4N4QA 2NT0A 4Q6JA 2GUBA 4D8AA 1WE5A 1TPWA 3V0UA 4MPQA 5FAJA 2GPTA 5AECA 4HMDA 2B31A 5F1VA 1HL8A 3T7VA 1WKDA 3OO2A 2W9MA 4KGLA 4B3KA 2PEVA 4PUJA 1GJPA 3VAVA 3BMWA 3L7RA 3EOSA 3SY1A 3W2JA 1V02E 1E6PA 2ESCA 1FRBA 4IJRA 3V35A 3DI0A 3TYEA 2BVDA 4QITA 1EHNA 3SAZA 2YXXA 4MKVA 1XM3A 2DT1A 4GZJA 4A05A 1LDCA 4MGGA 4INFA 1SO4A 1CTNA 3AWOA 2TAAA 4PMQA 1J0JA 1I2NA 3S5YA 3RR1A 3YPIA 2HV5A 3ONBA 5CZKA 4A2SA 4QROA 3MP3A 4P7RA 1S5TA 1ONRA 3Q58A 3NTYA 3NURA 4AY1A 1XLDA 3T0DA 2YXGA 4B5UA 3BMVA 1DQWA 2WZMA 1GGOA 4OBSA 4Y9NA 3AXHA 3CL8A 3KBJA 7A3HA 4LY4A 4MB3A 1UWRA 2ZXAA 1RY8A 4GIYA 1VYSX 2YJQA 4DUWA 1K03A 3BARA 1POJA 1LL4A 2OEMA 4GYFA 3SGGA 4NF7A 2YIHA 2WMJA 4B9ZA 4CCCA 3JW7A 3LRLA 4J3VA 4YL2A 5HNNA 1JIBA 4GO8A 4LS1A 4FPSA 2ZKMX 3P60A 4PUKA 3PG9A 3W28A 3QXBA 2G41A 3QV7A 4LNCA 3QQ0A 5EU9A 3J7HA 3A5FA 3C0QA 3UA4A 4V2XA 2O4MA 5FAGA 3TOYA 3HGJA 4YS1A 2Z1XA 2RAGA 1AW1A 4PB5A 2PDMA 3HN3A 1U83A 1PCKA 3F1QA 4ZEPA 4BJHA 1B3OA 3E38A 2BV9A 1OFDA 2XJ7A 4ERGA 3T0TA 1Q2RA 1J79A 1PE1A 3S2CA 5PTDA 4JQ4A 2A3CA 4KWOA 1UA3A 1SZFA 1ZPTA 5LHEA 3LENA 1KCZA 2QAPA 3ZZ1A 3NQMA 5FACA 1G0CA 2DJXA 5BOFA 3CNYA 3O9NA 1P0KA 2XH0A 3W72A 3UG5A 3SFWA 3RRXA 4GUJA 2V3DA 3H7UA 3LG3A 1H50A 1XPYA 1LG2A 2E8YA 5DEZA 1DWGM 3QYSA 3KFTA 1VFOA 1QMLA 1N8FA 4S38A 1BFNA 1DJGA 3CC1A 3XISA 1TX2A 2EJAA 3CUHA 4LB4A 3G24A 3CZKA 4H83A 4QJ4B 4S3AA 2XGBA 4QSHA 1D8CA 5KZDA 4WXYA 2ZOXA 3AHTA 4MNMA 2JEQA 2ISWA 6ENLA 2W62A 4L9YA 4Y6GA 3P7YA 3M7WA 4IX2A 1JPDX 1KFEA 1Y5XA 3RXZA 2D0GA 3UBPC 3BOLA 2E5BA 1XIIA 2VKZG 1ZUAX 2ISFA 3KCOA 5I3KA 4ZL1A 5B7ZA 2WM1A 3M5XA 2DW7A 3GFXA 4MWAA 4DBDA 1YW1A 1DIOA 1J93A 3EWCA 1Q6CA 4HP5A 3IIPA 1VJIA 1OYAA 1VKFA 5EMJA 1XIFA 3LSBA 2O56A 4UR9A 3GIPA 4DAFA 2YR1A 1REQB 1RJQA 3DGBA 5LSMA 4QJ3B 2HPIA 3BZGA 5AHEA 1TB3A 4PCTA 3PZ9A 4JFVA 1EDQA 3E0LA 1MZHA 4YCOA 5FL0A 3NQEA 2EPNA 3IJIA 4N2YA 4KCVA 1O60A 4KESA 3EOLA 4CQBA 4U3AA 3LLXA 2B81A 4IJCA 1FXQA 4NZFA 1E9ZB 3ARZA 3H8AA 4NI8A 4LCRA 4UTMA 2IMRA 1BAGA 1A0DA 1ITXA 2DT0A 3NOEA 5FF0A 2V81A 2YB1A 3GKFA 3QVQA 3UZYA 2QVHA 1WO2A 3KXQA 2DQXA 5MF5A 2V3FA 4C6DA 4DXKA 3KBSA 2C18A 1TX0A 3E2VA 3L9CA 2WHKA 3OIHA 4WQ6A 4PTDA 4LBRA 4RDYA 1TV2A 3SSJA 1W1IE 3G1DA 2GOUA 3WLSA 3PVFA 5K9DA 2D3LA 1E6RA 4S3CA 3A6OA 3EXSA 4JTAA 2ZVIA 4D8ZA 4FLRA 4DI9A 2V9DA 3VNDA 1XG4A 3EEZA 4XAGA 4J3XA 3W24A 1LOLA 1GQKA 1SJCA 2J7EA 2PGEA 4EANA 4GBDA 5AYZA 2NXGA 5HATA 3KWSA 3VIOA 3VZZA 1GKQA 4XX6A 2CFFA 4BF5A 3PK7A 1G4EA 1BF2A 3RM9A 1MXGA 5I79A 4GUFA 2XTKA 3LBMA 2C0HA 1E1FA 1C9DA 4OVXA 2H6RA 4F9DA 2DZTA 4YCPA 3COTA 2DDXA 4DF2A 5IM51 3GVWA 3BL3A 2XIJA 3TAOA 4BFAA 3OVGA 1EX1A 3N9RA 5K4ZA 5GNYA 5D8ZA 2GVGA 4RW5A 1DJHA 4LALA 2F61A 2I7GA 2VZOA 3I7QA 3B9NA 2ATMA 3NEVA 4ZOAA 1WZMA 4N9DA 3EZ4A 2Y70A 4UMBA 1NDYA 3TONA 3V1PA 1V3HA 1O1HA 2DZUA 2YCEA 4EXQA 1SPQA 1VFMA 3AIRA 4GI8A 3U2OA 3H70A 2F9RA 1DORA 2YDRA 1C90A 1XRVA 4FO4A 4BK9A 3PG8A 3E2QA 4RDWA 3WY1A 1OX4B 1SSDA 1JDDA 3RHGA 4WSKA 2XIOA 4RNHA 5IXEA 2NXHA 3VTRA 1ZBKA 5BWAA 3LXCA 1HFBA 3S5SA 5BXTA 4O1DA 2BHZA 4KWUA 1Y65A 3RIKA 5A6SA 3GVGA 1UJQA 3SIMA 4IFKB 5EMYA 1TQJA 3MCMA 3M9YA 2PD5A 4EIVA 4YVXA 4XISA 4U2ZA 4AEEA 1B3XA 1QRQA 2BTMA 3CH0A 4F3HA 1K9DA 3MW7A 1TV5A 2CKSA 1QK2A 5I7GA 5E0CA 2QQ6A 1A47A 2XISA 1P6CA 3N4AA 1UW9A 1P0EA 3OBAA 3N13A 2DUZA 4FXJA 1ISWA 4B5WA 3T6CA 2X1IA 2WJZA 3RO6A 3KRBA 2F38A 3GO2A 4JBRA 4YXGA 5CPOA 3E2SA 5LKYA 2Q8XA 2CU0A 1A4MA 3I65A 5E5CA 1PWLA 2QXWA 1HJVA 4NUWA 4KMQA 3WX7A 3OBKA 1R86A 3M5ZA 5F4SA 5I3JA 2PF0A 5FSDC 1OGGA 1I9CB 4DB7A 2GVLA 3QOKA 5CGTA 8CGTA 1ISYA 3DG3A 3GW3A 2HMCA 3WEZA 1E43A 2D3NA 1CDGA 2QGHA 2PWUA 3A13A 3TW6A 5C70A 3EOOA 3W88A 5A6AA 3O2LA 2D2JA 5D09A 3UU0A 3AUJA 4HU0A 2V6AA 1B9ZA 4B4FA 1EWDA 2CLIA 1WZAA 4HOXA 3W38A 1R3VA 3TTYA 2KX9A 1E15A 5AC6A 1TWSA 2PDHA 3RILA 3W1AA 1EF2A 1N8WA 1X1NA 5G1TA 1V3MA 4H2CA 2TPSA 1M3UA 2E9LA 1Q7MA 1MVYA 2HK0A 4LNYA 2XFWA 3NVDA 3GYEA 3BICA 4Q8WA 1NOUA 3AHZA 2NUXA 3VOCA 1JPIA 2EHHA 5DXXA 2G4FA 4CGTA 2REQB 4E4PA 1FUYA 1KR1A 1L9WA 3W74A 4R33A 4L7ZA 3UG4A 4XO7A 4IP5A 1J11A 2EPMX 1CGUA 4HNOA 1U5VA 3SI9A 1EPVA 3DIPA 3ZJ7A 3VO0A 4CVWA 2OOGA 1HNYA 1XLAA 4AX6A 3OB8A 5F7UA 3UY8A 3E9AA 1DXEA 3QKEA 4HTYA 4M5PA 4IFOA 4JX4A 3IJQA 4S3EA 2NUWA 2OYLA 1CGTA 1TR9A 1FDYA 3KHDA 3W7LA 3UGVA 4XAFA 1RLCL 4AUBA 2PDYA 2Z25A 2D1ZA 2IPFA 2YDAA 3HOJA 4GG9A 4ZCWA 2QCLA 3BAKA 4C6LA 1R2SA 4FLSA 1HKKA 3RF9A 2PMQA 2G8ZA 3A24A 4HU8A 2IPWA 1C3FA 4DYKA 4IMEA 2WB5A 2OXNA 3PP7A 3CV1A 1EIXA 2BG5A 2FFIA 4OOZA 3W1NA 3EXTA 1JJKA 1KM4A 4XO6A 1ICPA 1ECQA 4YHGA 1WDPA 2NW0A 4ROQA 1PKNA 4QQ3A 1LT7A 3IIZA 4X9SA 3OW1A 3W00A 3LPOA 1XLLA 3FA5A 4KFPA 3HPXA 2DZWA 1MW2A 4UQ9A 1WX0A 3TFXA 1CECA 1A0EA 5D9NA 4IT1A 4Z1DA 3SDOA 3WH5A 2PE4A 1KBJA 4LUSA 1SVDA 3QHOA 4O4VA 4O18A 1UD5A 1XLFA 2QHAA 3FJLA 1CGWA 4DWSC 4PUWA 1E6SM 5EBAA 5AYYA 1OX6A 1EDGA 4DRSA 3CZLA 2WBKA 3DI1A 2JQXA 2XWDA 1Q13A 3GSMA 4X61A 5EMLA 3ARUA 4I9MA 3D46A 3O6YX 3NGJA 4O0ZA 1QI4A 4JDBA 4E2BA 1HJWA 3VKAA 1IF2A 3KVMA 1EB3A 1W3LA 1JUKA 2PLKA 4IQEA 3BW3A 4ZZ9A 3GNOA 4RUBA 1PZ3A 3ARRA 2D22A 4CD4A 3UESA 3I3BA 2DUAA 1AD1A 4D2JA 4MJZA 3LCWA 4M0XA 4Z0SA 2BMBA 4RNIA 3S2JA 1BYBA 3ZLHA 3SCWA 3NZQA 1Q4WA 1P4CA 4JHOA 1NVMA 5FF7A 3SUTA 1BYDA 2WO5A 4OUEA 1EGVA 2CZDA 3KX6A 3AIWA 4U5KA 3VIGA 5D30A 4FI4A 1Y7VA 3S8HA 3ERPA 1PDZA 1RPXA 2J25A 4RZBA 1XHGA 2I5GA 2DEPA 3GG1A 1UP2A 2VC5A 1J8VA 3NAVA 3WNNA 4NAEA 1FCUA 2X2YA 3CJPA 3TLQA 3K46A 3LGGA 4QGCA 5A6JA 4ZQOA 4P8UA 1H7XA 4ZO9A 4S3GA 1EHAA 1TJ0A 2VR4A 3KOXA 5HOSA 3ICJA 3A3WA 1JR1A 3HQPA 3TYDA 3BOXA 4JX5A 1U2YA 4PMYA 4MY1A 3UZ5A 2AQWA 2W67A 1ELSA 2TSYA 5CLWA 5A8OA 2CHOA 3UGRA 3QTGA 3IJLA 3K8KA 1KLZA 3AWNA 2E6FA 2J75A 2J6VA 3G1SA 2RJHA 5F2IA 3GR8A 4PUNA 3P8JA 4C90A 1U1HA 3ISIX 4F4RA 3S1WA 3CO4A 1AQFA 3GM8A 2DT3A 4GY7A 5DO8A 3D6NA 1XH0A 2PB1A 3MUZ1 3WLIA 1WB0A 3TP4A 2FPYA 3H24A 3NUKA 1GEQA 1WDWA 3MMTA 1JI1A 5I00A 2JEPA 1QPKA 4ZFCA 3U0HA 4ZMGA 3LZ5A 4I90A 1X1ZA 1OF8A 4P7NA 1UBPC 4WDUA 1K1DA 4UMAA 1WUEA 1HGWA 3T4WA 4FNTA 1BD0A 3CUIA 1WAUA 3L12A 3TFCA 5G2HA 3W2UA 1OC6A 5BXRA 2YPIA 2CIPA 3NPWA 3EDEA 2YBVA 3FS2A 5MKGB 3IACA 3SUWA 1KB3A 1KTBA 2ZTKA 3LHWA 3FCPA 2QIIA 5REQB 3N2MA 2J7GA 1U30A 3DENA 1RSCA 3TUUA 2CCRA 2Y5EA 2YX0A 3GHSA 4MDPA 1UD3A 4MLRA 4JNMA 3LNPA 4AHQA 3CIWA 2POZA 1BRLA 1XSJA 1XGZA 1UC5A 2CWNA 3DESA 3T55A 2GYIA 3STFA 4DX3A 3SCNA 2VCCA 2Y5JA 4LQ1A 3GG7A 4YTTA 2DV0A 1QHOA 2PURA 3BAJA 5XINA 1IZCA 1H7WA 3DDMA 2OOFA 2D2HA 3CV6A 2AOSA 3WFAA 4AEFA 2ZUNA 4XZHA 4GUIA 1HQTA 5F4XA 4B90A 4BQ5A 1W5PA 1DQUA 4AZHA 2Y85A 3G2GA 2ZQ0A 3WF4A 3W4RA 4FOJA 2PDWA 3WSUA 2J7HA 2E8ZA 3NNTA 4JY9A 3S3GA 5F2LA 4ZGYA 1YYAA 3M1ZA 3ZJ8A 2I5IA 3WD4A 3UPMA 2YYTA 3R6IA 1J0HA 1ESWA 1YADA 2VC7A 3VIHA 5D4YA 3H12A 5I23A 4NRRA 2OJPA 1AVAA 1VGAA 5I78A 1PYMA 3FJ4A 3IJ8A 4G6CA 3WUFA 3U2EA 3PZMA 5AVHA 2ZZ6A 3QOMA 3VNJA 4DM1A 5A95A 3QEZA 4HB7A 5HR7A 4ZVJA 1W91A 1E0WA 2WPGA 2WWCA 3EKZA 4I9AA 3MKKA 3V5FA 1EEPA 4BEUA 4UFMA 4YTSA 4C1NA 4KRZA 1OCQA 8RUCA 3CZ8A 3C8NA 3ALGA 4ALDA 2F2HA 2A21A 3QTPA 3O63A 5DBUA 2BY3A 4AD4A 1X98A 5A8PA 1KWKA 2JF6A 3LUTA 1ISZA 1PWMA 4C6EA 4V33A 4ICCX 3FVDA 4OFCA 3ID7A 5C7HA 5BU9A 3STCA 5CPSA 4NAFA 3RK8A 1W3HA 8TIMA 3URAA 1A5LC 3NQFA 1ZCOA 5K4XA 3NSXA 2EGZA 1HL2A 1P0DA 4RXFA 3L5MA 1R3TA 4PC8A 5HNUA 1U22A 2BFGA 2V8ZA 5CBIA 2HRWA 2OVLA 4QAIA 2QUNA 1EL3A 5AZ1A 3M0IA 1D9EA 2P0IA 1XLKA 2A7PA 1X6LA 3WBEA 4A8NA 3RCYA 5M2FX 5E6ZA 2EPOA 1UKTA 4LH8A 4AW7A 1RJRA 4K6AA 1K8XA 1E3XA 4S3DA 1MEIA 3KL0A 5F2GA 1E71M 4HPHA 4NP7A 3I4KA 3W37A 2VHLA 3WH9A 3QV9A 1EDTA 4WD0A 3RU8X 4J4KA 1GTEA 2ZZ3A 1ICQA 4GNKB 2YGYA 2VZUA 2WC7A 4H9XA 3AJ7A 5KETA 2BDQA 4GC3A 1W3IA 2BLEA 2RH9A 4YJ5A 4AVFA 4UTLA 2NVCA 1HJQA 1WXJA 3LHYA 2X7WA 3O6AA 1V79A 4PMJA 3THCA 3TR2A 1RVKA 5BMWA 1FDZA 4LUSB 1YTKA 1OG0A 3LM7A 2PCQA 4ECLA 1G67A 4Z08A 3OZOA 4HNTA 1OFPA 1UQZA 3MUAA 4FLOA 4ZA0A 2C19A 4LANA 4AG0A 5HR6A 1V6YA 4DM2A 3T2QA 2EO7A 5CAHA 1W9DM 5DFAA 3IARA 3PZUA 2CBIA 4AMCA 2IUZA 3L65A 4QM1A 2G96A 4UTWA 4MWAB 5E09A 2BXZA 3ZVHB 3KTSA 3R25A 2OFJA 2WLZA 1KFWA 1A5UA 5BRPA 1OD0A 4PRRA 2OU4A 1JD7A 4A6GA 3GU1A 3AISA 4C1LA 1AH4A 4M19A 3G77A 3FAXA 1PIGA 5ABHA 4AIBA 1RD6A 3B8TA 3ZT6A 3T8QA 1OHLA 3BUVA 1QUMA 3QGKC 1CB7B 5AYBA 5CZSA 4ZB5A 4UQAA 5CSSA 1NP0A 1RBOB 5BYWA 4CCDA 2GGEA 4WHBA 5DMYA 3H2AA 4NKCA 1XR2A 2QJMA 2VYOA 1XBZA 2F6XA 4Q4PA 1WNOA 5C54A 2DT2A 3JUGA 3EX2A 3VX1A 1JQXA 3M6DA 1H49A 2A4AA 4GVHA 2P1FA 1ZGDA 4FK9A 3W84A 1S1RA 3QR1A 3CYJA 1TE6A 1B3WA 1Q7ZA 2Z00A 2WMFA 3L4ZA 3WK2A 1R9ZA 4HOZA 5D2WA 3WQEA 3HB9A 1DEDA 3BSGA 3RX2A 2WZTA 3PZQA 4KQNA 1PDYA 3OZPA 3O1NA 1FWCC 3VMOA 3BWWA 1E0TA 4DPPA 2C16A 3VGGA 4O14A 2ISDA 3W01A 2VR5A 3TA6A 2Y24A 4ACYA 2OX1A 4IMFA 2XG9A 4FXRA 3W82A 3SY5A 1W5OA 4LC8A 1LQAA 4DUXA 4YTQA 1FH8A 3VCNA 3W22A 5H2ZA 4KGJA 3IJ6A 3S42A 1IEWA 4JFSA 1GQJA 4E4UA 5LNWA 5FIPA 1FCVA 4JIHA 1TYGA 3GS6A 3AICA 1UZ1A 1HG3A 1P5BA 1FX6A 5D37A 1VZWA 1H09A 2INEA 3B8IA 2IKIA 1DIDA 4HKPA 2PGWA 4D72A 3V4BA 1WOAA 1BVWA 1F5ZA 4PODA 3NDYA 1P43A 3Q2DA 4HU4A 3C0JA 4R85A 3TJLA 2I5QA 3VGEA 3ZT5A 2QMJA 1H5YA 1EXBA 2AL1A 4S1FA 3P14A 1BXBA 2FZ9A 3ZJKA 1MW1A 3CV2A 4DXXA 3ELFA 5E0FA 3KCLA 3Q94A 3TIMA 5IHRA 5JUVA 2EG8A 1WBJA 2X0YA 4O53A 3ITLA 4XZNX 5G1YA 3ZT7A 2Y1HA 3A4JA 3FAWA 3WBXA 2QT3A 1R9YA 1WZLA 4NNCA 3HGSA 1IIGA 4MFDA 1DVJA 3WLLA 1PIFA 2NWRA 5IFTA 4CNSA 4JDYA 4ZQNA 3BG9A 3KRSA 5A69A 2PTWA 3L5AA 2CYGA 5FESA 3WLJA 4P61A 7REQB 4GI9A 4ZODA 2C13A 3C2FA 4HZ6A 4FLQA 4S3BA 3DN5A 4JFTA 1KM3A 4L61A 2XPKA 1CEOA 2GOKA 4N9EA 2H90A 4P8WA 4D6EA 2XZ9A 4IIGA 3AXXA 4HZ7A 4NT0A 2FQIA 5LNSA 2ZA1A 4HK6A 5XIAA 5A94A 5LNUA 5FI8A 4GH3A 2PWFA 4KCTA 2EBNA 3A12A 2QIWA 4V28A 1CX9A 4RV3A 2UV8G 4DJDD 5LYRA 7ODCA 1UR2A 1VFHA 3FK4A 3U2ZA 4OBTA 1K3UA 3HV8A 2NX9A 3B0XA 1O66A 3LZ3A 7REQA 2A3BA 2QJHA 3EPOA 1YDYA 3A4AA 1S38A 4HA1A 2XIMA 2BY0A 3CQHA 1XLCA 4MWAE 3WLMA 1DWIM 2QPUA 2QUUA 1H51A 3M47A 3WEOA 3W07A 1NJJA 3E1F1 1RA5A 4AD3A 2CLLA 3KDOA 1OQFA 1TVLA 3AIEA 3TSMA 3ABOA 1H1NA 1WXYA 2NZLA 5FJJA 3M41A 2J9YA 4JNYA 3MTWA 4JTHA 1B0IA 1F05A 4W7VA 4QLLA 5FF2A 3VFCA 4O50A 4LVBA 3L4UA 2WKLA 1V7YA 2OEJA 3AZSA 1CGXA 2P10A 2ZZ4A 3U9IA 3NPUA 2J7BA 2PC4A 3DHUA 2HS8A 2HK1A 2DZVA 4Q8NA 1YE6A 3U4FA 4M51A 3A9IA 4K8HA 4PMUA 4JEJA 1Z8AA 1UPMB 2WJEA 4N7QA 1PZ1A 3PZIA 1US3A 1EBGA 2D0FA 3WF0A 2E0PA 5DT7A 1GVYA 5ABEA 2UBPC 3SUUA 2PTZA 2JF7A 1KBKA 5I3FA 3GU2A 2ODOA 4L65A 3LGDA 1ZBCA 4J28A 2HEJA 3MVIA 2C71A 3UETA 2BX7A 2FZMA 1ZP4A 2NXIA 2PAJA 4NXSA 3UJ2A 1W54A 4JQAA 5H8UA 5RUBA 3BV4A 3KE0A 5TF0A 4PULA 2Z0IA 4DO6A 4UMCA 1GPFA 2UY2A 3LXBA 1O5KA 1GG1A 4HBKA 2WHMA 4FX6M 2CLOA 3CT2A 5CSUA 2YLAA 1K4HA 1B5TA 1V51A 2YCIX 4E38A 4JTLA 4AWTA 3W2MA 3WG6A 4IF2A 1R2TA 1WQ5A 2X1RA 3MUIA 4WK9A 1XIGA 2V3EA 5G2IA 4Q4MA 1KKOA 3KBWA 3PAOA 3JS3A 5EB8A 3BW2A 6ALDA 1YXYA 1N8IA 3AZRA 1B4KA 1EJWC 4I8YA 1QOXA 3HA1A 1QBBA 2GJNA 4HYVA 2P3EA 2PS2A 1DE6A 3MWAA 1ZZMA 1NEYA 2C1IA 2EKGA 3UNTA 5C8BB 1F3TA 5ENLA 3QKZA 3BPWA 4PEEA 4CQAA 2YA2A 2OWCA 2WOQA 5HMFA 3UG8A 4IZGA 3G18A 3CLMA 4PMDA 1V08A 4A3HA 5FEXA 3LXAA 4O16A 2V2HA 3N9KA 4KBXA 1NWUA 4G7EA 4WX2A 1AL8A 4Z0JA 3CHFA 4LXFA 4NJHA 4JIQA 3C61A 4U4MA 4A35A 2QCFA 5E9XA 4TO8A 1Q45A 3V5CA 2ZUUA 4R9XA 1KC7A 3DX5A 2E7FA 3R5EA 2UY5A 2WMGA 3UPWA 1XP3A 2JIWA 4H9UA 1JZ3A 1RVGA 3BZJA 4WSJA 3ZMRA 4PUUA 1VJZA 4ACZA 3G5EA 2JFEX 1VCVA 2VRKA 4Q7NA 3MDWA 4C7DA 5BXSA 3KDNA 4NX5A 4D71A 1KM0A 1UR8A 2WWDA 4CKQA 4G7EB 3C86A 4K3ZA 2CZ5A 4C6QA 4FIRA 1VCFA 2E5DA 4GKTA 3W7NA 1TPB1 2W91A 3L66A 4I5RA 1J4EA 3W53A 3D3FA 1FVPA 4L4LA 4FALA 2W66A 3DG7A 2VVSA 1EC7A 2QV4A 1KQYA 1VPYA 3RNDA 3TTOA 2CLMA 4GIEA 3F2DA 2XN1A 3PPGA 3EWBX 3G1RA 1TWIA 2BXYA 1HW6A 4WDXA 1FWSA 9CGTA 2V2CA 2FZBA 4L1GA 4HMCA 1R2RA 1UR3M 2DP3A 3TZFA 1TE1A 2PI6A 3LQLA 1UR1A 3NSMA 4K37A 4GH1A 3UYCA 5C6MA 3N34A 4MYXA 5DN1A 1DHKA 3DG6A 4JTJA 5I0DA 2BXVA 2G95A 3AS2A 1MXDA 3L4XA 4RE4A 2B7QA 1YXCA 3P61A 4JR5A 4O4WA 4MJMA 4RPPA 1X38A 3PSVA 2WZEA 4EAMA 3OHMB 4YMZA 3RPTA 4NL1A 3GG0A 2NQZA 4JN8A 1O7AA 2ZICA 1TA3B 3PTKA 1LROA 3G8RA 1DP0A 4RDVA 1FWHC 4HTBA 3MU7A 3DXIA 1LL6A 3FYPA 1UD6A 2QS8A 4FF5A 1OIFA 3TH6A 5JMUA 3W7GA 2J79A 4MUPA 2OLHA 3VNKA 2GDVA 2X16A 4IPPA 2VNCA 1K02A 4KIRA 4LF2A 1W1B1 2Y7GA 2GGHA 3QGAC 1UZHA 1C7TA 3LCHA 1G01A 2X7VA 8XIMA 1EYWA 2RGMA 4KERA 3AU6A 3ANUA 1PCWA 4JTGA 4B4HA 4K39A 2YKKA 2E9BA 1BWLA 5KSWA 1DJQA 3K4DA 4MKNA 4HHLA 1W5QA 2BY1A 3UZZA 2F84A 4TU1A 3QR3A 1A80A 2QV5A 1XFBA 2J88A 3QQ1A 4GCAA 3FFSA 3SBFA 1TV8A 2FJKA 2Z1BA 3BSMA 5C9RA 4QCEA 3TNOA 3GE7A 3WLHA 4MVAA 3UXKA 1E4NA 1V03A 3IIXA 3VGDA 1MWOA 1UR0A 4XG1A 3QZ6A 2J8TA 1V3LA 5F4WA 2A1YA 1YNQA 3MB9A 1T7LA 2QCDB 1HIZA 4CUCA 1A5CA 3T42A 3WMSA 3TYUA 5FJUA 1V5XA 4FIQA 1XW8A 4GC4A 1JRBA 3I6RA 1D7FA 4QLJA 2FGLA 4DNMA 4UFHA 3TTSA 1OYBA 4WR3A 2OGJA 2OYMA 4JICA 5ABTA 3GUWA 3UWVA 3K8LA 4IXXA 5LZLA 2Y8VA 3K1GA 2CEQA 5IHSA 3B0PA 1FWAC 2GK1A 2OSYA 2B7OA 1S3TC 1Q66A 4YN5A 2QJIA 5A8MA 3IPWA 3C0SA 1DJNA 1ZAHA 2V38A 1F3EA 1YBQB 6PTDA 4HVXA 1L6GA 3L68A 4P7LA 4GQGA 3DH7A 4HSNA 3CZEA 4EX4A 4LAMA 3QY7A 3CIVA 1QI5A 1RCQA 3BJFA 5HBFA 4Q8UA 3R89A 8A3HA 1JZ5A 3HMJG 1NP2A 3W7RA 2OCZA 3D47A 4F0MA 1E5JA 1AODA 2FH6A 3ARVA 3KZSA 2ZX9A 4LTSA 3C52A 4M6QA 3M0YA 5D2VA 1CIUA 3LPFA 4ES4A 1JXJA 4W7WA 5CZTA 1M7PA 4I3GA 1PX8A 2PWHA 4GJ1A 5LA2A 3GBDA 4W5ZA 1BLIA 4PH6A 5C2GA 2DSUA 3ES8A 2CXEA 2SFPA 2FJUB 5FJRA 4JXCA 1XSKA 2WCAA 3W2LA 2R24A 3VU2A 2AKZA 4ZSUA 1O12A 5IFPA 4AWSA 3N19B 3AMGA 1CENA 4KEVA 3D0CA 1RBAA 2VDIA 1IIHA 3NXLA 4UZUA 3KOYA 3NCOA 3P93A 3CAVA 1WA3A 2YFOA 4AD1A 3CHEA 3F2CA 1RP9A 1XBXA 4WGHA 3H23A 2XFYA 3VDAA 1EX5A 1I6NA 1BXCA 3FHAA 1VBJA 4Q8MA 3P3BA 7XIMA 6CGTA 1O4UA 3I7SA 1JG9A 4NYYA 3H26A 8XIAA 1NDWA 4O10A 2BWGA 2WHLA 3DCPA 5AVNA 1BGAA 1GQNA 1QPOA 4C60A 1FWTA 1KRCC 3L0GA 1H41A 4O52A 1DJXA 1XD0A 5AOUA 1CB2A 4MY8A 4QSFA 3FJ6A 4X0VA 4F0HA 4F66A 3C0LA 3E0IA 4IIEA 3BLPX 4LBUA 4PN2A 2OPJA 4R7WA 4EPDC 4NYUA 2PF8A 3GXIA 3H2OA 4QE1A 3SB0A 3VILA 1K8YA 3VD4A 1H7RA 4UTWC 2OT1A 5EL1A 1AMYA 4BHYA 3HGRA 1SW0A 4Z2LA 4LWWA 2FVLA 3PWAA 2XH2A 4C7GA 3WMBA 4XSMA 2DH2A 4NI3A 1M04A 1E4IA 1OFRA 2QCNA 5LHFA 4R7OA 4OTKA 2VEIA 1K8ZA 1J0KA 1ADDA 4AXNA 1FWBC 3L4YA 2XFFA 2P88A 1DJYA 3GHUA 4AZCA 1XSIA 1RLDA 3VNLA 4PUDA 3ZLFA 4Y9MA 2PDLA 2FIQA 2P50A 5IBXC 1GW9A 4OV9A 3OGRA 1XRTA 5HWMA 3WK0A 1QHZA 4AZ7A 3OTRA 3A64A 2J4GA 1YRRA 4CCZA 1E1CB 4X0NA 3IUHA 3PF3A 4H04A 4LEFA 3VYLA 3FGCB 5F1UA 1Q6OA 2DSZA 5FSEC 5D04C 3WD3A 1IWAA 1LBLA 1DWAM 1JPMA 2Y7FA 4LFYA 5CC3A 2IXUA 1W2PA 1KFKA 5AC4A 4IIDA 3OP2A 1P6BA 1D3CA 2BODX 1IEVA 4HK7A 3RM4A 3CQJA 1IR1A 3B4UA 2DIKA 1V0LA 1CXLA 4M82A 3BQ5A 2WSYA 3A4WA 4K2SA 4UR8A 1BYCA 2NUYA 5FEWA 3H2NA 4QEHA 5I3IA 2ACSA 4MWAC 5BROA 1XYCA 3GX9A 1Z32X 3ITCA 3A21A 5B7YA 2ZWYA 5BMXA 5SWUA 2G3IA 4DJEC 3W1UA 4JL2A 1K7EA 4AC7C 1QNSA 3B8WA 4FOKA 5ABFA 5A8QA 4YLWA 3PBVA 1UZ4A 4FF7A 2PTXA 1J6OA 3BGAA 2PDGA 3NL2A 3KEHA 2E28A 4DQWA 1AJZA 1NQ6A 2J8GA 2FMOA 4W4QA 3W1XA 1CGYA 2J9ZA 3LHVA 3H6OA 3QFEA 4HN8A 2X2GA 4IICA 2VM8A 3USZA 1AQ0A 5FL1A 2ZRVA 4O1EA 3WMCA 5DMMA 1BTCA 1EZWA 3DBPA 3T2PA 4ZO7A 1SQ7A 3RYSA 1SFJA 1XJBA 1ZY9A 4NAFB 1JUBA 3VNMA 2V5LA 3MJMA 1PBGA 4XUYA 5I09A 3G1XA 5EY5A 3CL6A 2A7NA 4CU6A 3QSTA 2X8RA 4EXAA 3W86A 3B03A 1RALA 1VFUA 4HNNA 1H11A 2WVUA 3DKLA 1PHQA 1SJBA 3EPMA 3KBVA 1TFVA 4DXVA 4C6OA 3UR2A 4FNRA 4Z2IA 3CMJA 4WVXA 1MUCA 4YYCA 2Y61A 4P8XA 3STGA 2EPHA 1FH9A 5HPOA 1JYXA 4FMVA 1K77A 5B80A 2ZUMA 3G1YA 1F07A 1K7FA 2DY3A 2Q8LA 4MWAD 3W73A 3SADA 3GXTA 5TAOA 1ODZA 1KKRA 4PMVA 4GXPA 1LT8A 4Q33A 2QCMA 3N2TA 4U5IA 2GGIA 4MUZA 3LTYA 3TK7A 4N02A 2XIIA 3P82A 1PX3A 2F8QA 1RK6A 3RU6A 5FEPA 5CZJA 3BSHA 5TNVA 1A49A 3TDFA 2BOGX 4EXBA 3WK3A 4IPLA 3B4YA 4Y9OA 1F2JA 3DFNA 3O6CA 4FOUA 4NX0A 4IL2A 5C2CA 1EGZA 3W81A 1XUZA 4W9TA 1IXOA 1OCJA 3H2MA 2XHYA 4WDWA 2F6KA 4QCFA 4UCGA 1WOBA 3F5JA 2PBOA 3PUEA 2ZRZA 3F5KA 4XBJA 2X41A 2ZUWA 2XWEA 1TVNA 5D38A 2AMXA 3T07A 3NQ7A 2DUXA 1X96A 3AU2A 1OB0A 4LC6A 4O13A 3DHPA 4O1FA 3SGUA 3OQ8A 3GU9A 3M44A 5H8MA 2QMKA 4YPJA 2WMIA 1GVOA 2Y0FA 3MANA 3IVTA 2ZX5A 3SO7A 3T08A 2V82A 4HHMA 2OLAA 4MZ8A 2JBMA 3BLIA 3URBA 2DGAA 3K4WA 3W6MA 1JRCA 2WMIB 2E9MA 2NLIA 3EWYA 3RCNA 1W9XA 3UNDA 1LLZA 2X40A 1HUVA 4QG6A 4PCFA 1UUQA 3DGRA 4WEVX 3LCXA 2ACQA 2EAWA 1QVBA 1JNDA 3CYVA 4GNVA 3M0ZA 1Y8BA 3MHFA 2OEKA 4PSPA 4E8GA 2EQDA 1K8CA 1C8QA 3VD7A 2IPGA 4GMEA 5M5DA 1PSCA 1TPDA 4XVDA 4WIWA 3PNUA 4JX6A 4JPGA 2HXUA 4DUVA 2V3GA 5EYWA 4QP0A 4N6FA 2C1HA 3PBYA 2VGBA 4K38A 3QMSA 4QDWA 3VDCA 2FHBA 2QUMA 1FH7A 1I4NA 1KM6A 3LB0A 4Z17A 1BKSA 4Z2JA 1PTGA 4Q4KA 1UD4A 1HVXA 3WJSA 2ZXBA 3IK2A 2J7DA 2ICSA 1B30A 4FXFA 4ML4A 4OOUA 3WK1A 4RNFA 2RDUA 5HDRA 2QEZA 1JCLA 2ADAA 4C6FA 1OF6A 1I1XA 2DZXA 3MPGA 3TZNA 3A3XA 5DANA 1UR4A 1KLYA 4HJWA 1K7XA 1YEYA 3TQVA 1FP9A 1OFEA 2P53A 2QUTA 2NX1A 3C2OA 2FZ8A 4F2TA 1VYPX 3EB3A 3PPHA 1PVNA 3AS0A 2VC6A 3S1UA 5A6BD 1OFBA 2D23A 1LWHA 3W70A 4F0RA 3OLGA 3FDKA 4H8HA 1R46A 5D2TA 1YDOA 5LA1A 1UOKA 1PV8A 1XCFA 4K8EA 3CQIA 4Q4OA 3W83A 1JZ4A 1MNSA 3FSTA 1VBHA 1BG9A 3RO8A 3W1MA 4AF0B 5FKYA 2PU0A 3VOHA 4OE7A 3QPEA 1ME7A 1XINA 3V3WA 4UFLA 1A3WA 1PYFA 1ZFJA 1MUMA 4Z42C 1IGWA 3CMFA 3ZYZA 2TODA 1BWVA 2GFTA 1IWBA 5JH1A 5T9CE 3U8GA 1S39A 1OFQA 1UH3A 3M4HA 3WL1A 3FKKA 1LBMA 2XSBA 1TCMA 3RN6A 2YCLB 3CQKA 4DEFA 4PGLA 2DZAA 3LV5A 3THQA 4MJ4A 1XC6A 4QJ1A 3NQGA 1T8XA 4J40A 4MAZA 3MT1A 3G0UA 2PDJA 2XN0A 1EEXA 5I24A 1DOSA 2GWGA 4PFHA 4ZE4A 1JDAA 4IUGA 3P74A 3ALFA 1GOKA 3UCCA 3R8HA 5C9UA 3OPSA 4I8DA 3DFYA 2NVDA 3FSUA 4JL1A 4M1BA 1PAMA 1BPLB 3MUXA 3TAKA 1XYZA 3V75A 3IV8A 4HCHA 3K2GA 3N3TA 2D20A 3G6LA 3U7BA 3UVAA 2ZXDA 3WNPA 3QHMA 1U1UA 2PTYA 1EOMA 4IH3A 2PDFA 5L9FA 2AAAA 3WUEA 2G37A 1SFTA 2Z6JA 2C3ZA 1W9VA 1VYRA 4A29A 5LIUX 3SCTA 1LWJA 4F2BA 1FY6A 2ZX6A 5CC6A 4DWSB 3NL5A 4B3ZA 1Q6EA 4C6JA 4K1WA 1W9UA 1Q63A 1R3YA 3A9BA 2IQTA 5LIKX 3VIKA 4BEQA 1KTNA 2BASA 2VD9A 4NJGA 4O0QA 1US0A 4H6KA 2HTMA 4MY9A 2PDNA 3W3OA 2WKJA 4JYFA 1KGUA 2ZC1A 1OINA 5CH9A 4DN1A 1J5SA 2ASHA 3U5YA 1QNPA 2YB4A 4P2VA 4WJEA 1H0GA 1V93A 1HZYA 3L67A 3SR7A 3HG3A 5HUOA 3WQ4A 3VC5A 3G3MA 1C8XA 1I60A 5D8WA 2JGYA 3WNKA 3WJWA 3PBMA 3DAQA 2DZBA 1L6FA 5CBBA 2PRHA 3GC5A 5CAKA 1R85A 1G7VA 3QHNA 2A79A 3GG8A 3T1GA 3CPRA 3PPCA 5T26A 2EXOA 1I75A 1MMFA 1BWKA 1DXFA 2QDDA 5CJMA 1IEIA 5T9BG 2W0UA 3TV8A 3IJ7A 5DQPA 2G50A 2OQHA 3CMGA 1DIKA 3AAMA 4P5UA 2HWGA 1LRTA 2DZSA 4XKYB 4JOMA 1N82A 4MNJA 4XZIA 3GW0A 1LYXA 2HE8A 2WQPA 3EYPA 3WQDA 2ZUSA 5LGZA 1US2A 1Q85A 3IUDA 1KXVA 4IOTA 5HQEA 3WLPA 1M03A 3UCQA 2Q09A 5KZMA 3IVSA 4LAOA 1QW7A 1HN1A 2JKAA 2GZXA 1J2BA 1TVPA 1UOZA 1M9HA 1MEWA 1AFSA 3CWHA 4LUTB 4MADA 2R8WA 4IP7A 4UCFA 4X63A 1PXGA 2ABBA 1ZBWA 4PBFA 5J04A 2VQUA 4HNLA 3O3RA 3GR7A 1JUEA 1F8IA 4PMNA 4UNLA 4A22A 4S39A 2PDIA 2VUNA 1SZGA 3NOYA 4JFWA 3W7QA 1UH2A 1TRDA 1POKA 2VEKA 5LXEA 3IIOA 2XVNA 3DEQA 1XLMA 1W9BM 1B2YA 2W6RA 1TWZA 2CLPA 1VEMA 3A3HA 3VUSA 4AD5A 3ZR4A 1QNQA 4KEZA 4AIEA 2GJLA 2QCDA 2LLEA 1AA1B 3EKLA 2PP0A 2Q71A 3VFLA 4NRSA 2BZNA 3S5NA 3GXNA 3W7MA 2BVTA 3K5XA 3KS6A 1WCGA 1CXFA 1T5AA 3VKBA 2WC4A 3PJUA 2VQTA 1H1YA 2RHGA 2ZIDA 1EC9A 4IFKA 1MFUA 3R8RA 4CNPA 1SGJA 4WSHA 3VC6A 1E3ZA 3F7JA 3H4GA 3WO8A 1W1VA 4L9ZA 5EKYA 5C2XA 4U33A 4XWUA 1OFAA 4LOCA 5AHLA 3C56A 1DE5A 1AQMA 1JAEA 1JCYA 2PWVA 4J2PA 1UQYA 2WVSA 1R3SA 1ZBVA 2ZXQA 3GBEA 2GL5A 2QF7A 2PCEA 1H4PA 1S2WA 3KM8A 1YNPA 4KT2A 3ONCA 1BVNP 1S5WA 2WVTA 4OT7A 5KZEA 1Q5MA 1SR9A 5DY2A 2P3ZA 1PZ0A 4WKAA 1F74A 3MP5A 4IPIA 3M7SA 1GYNA 3M0HA 1R9XA 3R7MA 2WZIA 2X1UA 4MYAA 4GI4A 3PZTA 5FCZA 3JVAA 3GXPA 3BAXA 2ALRA 3EA1A 4ZQRA 3INPA 4KEUA 3AHYA 1EJSC 1B4EA 5IRPA 1XWYA 3FXGA 4JZ5A 4GXWA 2PTDA 4KPLA 2VWTA 1Z9AA 3S1GA 3MHGA 4LV4A 2VDHA 1KM1A 4ZXOA 1XD1A 4GPNA 1XH1A 3KBNA 4TIMA 3NFUA 1MO0A 4XZWA 4DBSA 4LYRA 1CNVA 3KZPA 4PRTA 3OG3A 4R88A 1OSEA 4PMZA 3GDTA 1TV7A 4AHOA 1I2QA 3O07A 4KCWA 5A1AA 4P7QA 1TPEA 3AMLA 3MS8A 4TVCA 4GQRA 1S5MA 4E2VA 3FEMA 2WVVB 2Z2BA 4GBUA 1L2UA 1VBUA 1LP6A 4E8DA 4ORMA 1F4HA 2DORA 1PL9A 3W9ZA 3IJ9A 3R94A 1W3JA 3GC2A 3I3EA 3UR5A 4AZBA 4G7FA 3GNXA 1AJ0A 3VNYA 4AZ6A 1X1OA 3K13A 1VS1A 2VCBA 1ZJAA 3B0VC 4TMCA 4NZ1A 1B3VA 1EGMA 1TJRA 3Q45A 2GWNA 3OBEA 2C0AA 2D2OA 3BURA 3LEPA 1P6WA 3W87A 2A7RA 2OT0A 5GJNA 4LAUA 2GK1B 3P8IA 3PTMA 3S5OA 5DMNA 5TQLA 4QFUA 4JIRA 1VHCA 2VEPA 3TTEA 4UOJA 5K3VA 2AKMA 2PDKA 2CW6A 3I4EA 3DYMA 4HA4A 2EG6A 4KFNA 2VUYA 4E0CA 2DVUA 4H41A 1JF6A 3N9SA 2OQLA 1Q6QA 1XL9A 3WLRA 2R1LA 2YCKX 4POCA 1UD8A 3UWQA 2C91A 3SQLA 3MSGA 1H1ZA 5GNZA 3LN3A 4P8VA 3VOIA 5JU6A 3CAQA 4GJJA 1PUDA 4L4MA 4UBPC 2PD9A 3UY7A 3NQAA 2ZRYA 4IMAA 4XB3A 4RZ5A 3G8EA 2C6QA 4I5XA 3GC4A 4Q4RA 3NO5A 4EF8A 3WUBA 1NDZA 4D6HA 1GZJA 4GIAA 2EEXA 3CB3A 1LL7A 4EPBC 3H4XA 4NILA 3PJWA 4KETA 2IS7A 2CZVA 4GRSA 5JBEA 1VEPA 5AFDA 1R38A 1WP6A 2CHRA 3CWOX 3R79A 1CT5A 2XVLA 3LRMA 1A0CA 2VDGA 3KL5A 1R5YA 5EPDA 3EB4A 4TTGA 3WELA 4I6VA 5A6LA 3H7RA 3VCRA 5CGMA 4H9MA 4GY1A 4IPNB 1C7SA 1E6NA 1OJXA 3LGEA 3SIZA 5MKGA 2GSEA 1EJRC 4X2PA 3SM0A 3PWGA 4G1KA 3ZWSA 1UC4A 1F9CA 4RZ6A 4WXZA 1XRFA 3S4TA 2Q01A 3RLHA 3A23A 1QPNA 1ZJIA 4EP8C 1ISXA 3GXFA 3Q67A 4ADUA 1GT8A 4LV9A 3ANYA 1R3QA 1OD8A 4DJEA 1HKJA 5CG7A 4C91A 1VB9A 4REQB 3LTSA 4QDMA 3G1FA 4C6BA 2FMNA 3L0KA 4H4IA 3GDKA 1UIOA 4LRTA 3MSDA 1IHIA 1VF8A 2QDHA 1X8CA 3GDBA 1Q6LA 2UZ9A 3PUOA 1QHPA 4WY0A 4O17A 4UUIA 1FHLA 4JNZA 2O55A 2VX7A 2WSRA 3GXDA 1XDLA 1XLGA 1FWGC 3KW3A 1MW0A 1NIUA 3W71A 1Q3NA 3SW6A 1IEXA 4LYQA 1XFCA 4PBEA 2ZRXA 4EWND 1M01A 4TVUA 3GLCA 2A3HA 4AFYA 2G3MA 2B0MA 1FDJA 4GE8A 2J7FA 1SMDA 1EJXC 3GTIA 1UKQA 3S9IA 3URQA 1GVIA 3BG5A 5HK4A 4J7RA 3WDQA 4RPQA 5F2MA 4AVOA 1W2VA 5HJLA 1K9TA 3LYEA 3GFZA 5D05A 3PAJA 2ZADA 1XIBA 4H00A 3THAA 2J7CA 2PWDA 4EAYA 1TMHA 3MKCA 1PEZA 2AMGA 6XIMA 4CN1A 3ZM8A 4E3TA 4PCSA 2E5CA 1TZ9A 3W6LA 3T0CA 4E4FA 3S9ZA 4LUTA 1ZENA 4JY8A 4G56A 1LRQA 4MKSA 1VIWA 1ZS2A 2I16A 3UWUA 4C6PA 3PZVA 3EB2A 3G1AA 4MDOA 4R5EA 9XIMA 1EKOA 3DUGA 1B3YA 1XPGA 1Z42A 1ZL1A 1PJ9A 2W3ZA 1NWRA 3BTNA 4LUIA 4U31A 3RX4A 1XIDA 1W56A 3GXMA 2CC0A 2OTDA 4G2DA 5T91A 1RQEA 2E6AA 3GH7A 4MZ1A 3F4CA 3MSYA 4BI7A 4K7VA 3URNA 4O57A 3GHTA 4AD0A 3L0NA 2HZGA 3NDOA 4GX8A 3KOZA 3PHAA 2BHUA 2R1PA 1TJ2A 3CZGA 3VD9A 3VX0A 2PGFA 2J24A 1DV7A 3MBDA 2OLSA 4ZTXA 1Z44A 2D69A 4ZE5A 5BCAA 5CJ5A 1L6WA 2ZUVA 2VP8A 3BQ6A 5D2YA 2W63A 1HJSA 1TPH1 1UWSA 4JTEA 3QW4B 1XI3A 5FJOA 4BKNA 3ABXA 1DQXA 3PBWA 3VGBA 3WQVA 1XLIA 2FYMA 1DWFM 4W93A 2C14A 4ZQPA 4H8UA 2ISSA 1TPC1 3R1ZA 3V0TA 3AZTA 3ITXA 1J01A 2VWSA 3O16A 1JF5A 4FX7A 4H6QA 2RFGA 2IKJA 4LT9A 4U3CA 1P1MA 1QBAA 1X97A 3VNIA 1CPUA 5BRQA 3IANA 4C5ZA 2QCHA 5D2XA 5IDIA 5C5YA 1C93A 1UKOA 1OCBA 4JTIA 3TQ0A 2C8NA 3PUGA 3WD1A 3POCA 1RD5A 4PRWA 3V16A 3TTQA 1O68A 4LCQA 5EFDA 2INFA 4JEQA 3WQPA 3TEVA 3ZQ9A 2NX3A 3MYPA 2V5JA 4JTQA 4QEEA 5LIWX 4J3TA 4HYWA 4JFUA 5HA7A 1HO4A 2C79A 3VOFA 4KCUA 4IG2A 4Q4SA 2W4XA 3CT7A 3O8AA 4LY8A 5HJYA 4Y2WA 1IT0A 4W8LA 3WQFA 3HU7A 2Y2WA 3OZYA 3UWEA 1NFBA 5CQ1A 5LNVA 1MDLA 4HZ8A 3UR8A 3OYZA 3N6QA 4ROPA 2V5DA 1QATA 4FP1A 2V5BA 1DXIA 1Q8AA 2QJNA 4AISA 4DJFA 1TQXA 1EXPA 1E9IA 3R58A 4HIBA 4MAVA 1UUMA 3M43A 3QY8A 1LOQA 1UP0A 5CKSA 2CESA 1SU5A 3GFYA 1JL8A 2F7FA 5HJXA 3T44A 1D3HA 1ML1A 1K6WA 3SUVA 5E6YA 3VINA 2NV1A 4QJ5B 4A3YA 1V6WA 3NQ8A 5C55A 1LWIA 4IQLA 3HPFA 3RM8A 1X7FA 3CU2A 3CUJA 1G9HA 1WDRA 4DAIA 2O9RA 2YA0A 3THUA 1I2OA 4IL0A 1TWDA 3LNMA 1WZKA 4H7CA 2JE8A 4BCEA 1QNRA 5AHFA 3HMCA 2PPGA 4Z1BA 4DJDA 5D32A 3LA4A 4AX7A 3T09A 2OKTA 4D6DA 3FVMA 3CUZA 2QUVA 1KGXA 2AAMA 1M68A 2ZX7A 4PB4A 4MOZA 1HGYA 3FV9A 1QO5A 3CUXA 4FXSA 3R4IA 1CXHA 3REQA 1O94A 4FZIA 3QRHA 2Z7GA 3M5VA 2FTPA 3TYAA 4TXEA 2VGGA 1MSSA 4O28A 3CIXA 3VIIA 2OELA 1PX4A 1LF1A 3LV6A 3UG3A 5JH2A 1ZALA 4AB4A 3LX9A 2VFFA 4OV4A 3TYBA 2FVMA 3RITA 3T4CA 4F9JA 1QO2A 4A4AA 1UYQA 3NM3A 3N4FA 4HSHA 4C1NB 4UB9A 3KP0A 5G4HC 4Z1YA 1Z3NA 1D2KA 3HTWA 4IG2B 4PCPA 4IFRA 4GQBA 2YXOA 4BQ4A 1GYLA 3DFHA 1TV3A 2V5CA 1OY0A 3EDFA 2XSXA 4EWJA 3UVIA 3SCPA 3AYRA 5BRBA 1O95A 1BKHA 2DFAA 4GYPC 3GIQA 3R0DA 4F48A 4NHVA 4UTJA 4OBRA 1EC8A 3EEGA 4Q8VA 2DPEA 5E1QA 3ARTA 1W8GA 3W2KA 2XIBA 1NQKA 3N15A 2ZUTA 3EWDA 1VRDA 1YPXA 4W88A 4UOQA 5CZ0A 1GZGA 3FHQA 2ACUA 3E0WA 4NNBA 4XK2A 1LLWA 4WGXA 2Q02A 4XD3A 4FA3A 3VOGA 4XBKA 2OB3A 2FFCA 3LPPA 5AHMA 3QSRA 3DBNA 2BGNE 5J5RA 4IMCA 4X60A 3RPDA 1DBTA 1QI0A 4NQ1A 2O9PA 1A3XA 1W1TA 2XU2A 4W84A 1YX1A 1MEHA 4XUGA 3GTFA 4LX4A 1ENUA 1NF7A 2A3AA 2XM1A 2ABAA 2A6LA 2WMHA 4PMXA 1KFLA 3VK5A 3CWNA 4CD6A 4F8XA 5G4WA 1TIWA 3HQ1A 3L4VA 2XVKA 4ERAA 3DFPA 3GVRA 5D9MA 1PKMA 4FR1A 4K8GA 1G7UA 4S3JA 3ARPA 4M6VA 2DVTA 1F7BA 4M8UA 4CNTA 3KOWA 2ONEA 2PC8A 3WQ6A 1E1CA 1OYCA 5E93A 3AJXA 4LVDA 2QLYA 5CPLA 4QAWA 2E4TA 4PMOA 5LIXX 1JD9A 1TTJA 2PP3A 1T0OA 2NV9A 7TIMA 3E5BA 2VRJA 4HA0A 1MZRA 1UJPA 3IV3A 1E55A 4MPKA 1MQQA 2I56A 1A5AA 5G2WA 3HG4A 2Z29A 3UF9A 3LU2A 2PDXA 5HNTA 3S1XA 4AYGA 3K8MA 2GUUA 5CGQA 2E1DA 1YIXA 1FWWA 3WQGA 4XD5A 1XIEA 1KV8A 3MI3A 2AQOA 3LBCA 3TX9A 4W5UA 2WJDA 3EDKA 3AC0A 1I45A 3DHDA 4DY1A 4OU1A 4AZ5A 2VVNA 3KTCA 3QY6A 4WRHA 6TAAA 1XXXA 3E49A 3GKAA 3LLFA 1SFLA 1SW3A 1X8FA 2QCEA 3OU8A 5C7VA 3QQWA 3MSRA 3U4AA 1Q6DA 1N2VA 1E0UA 4WY0F 2AQVA 5C9XA 3N3MA 2YDSA 2XSAA 5D33A 1XLBA 1A5BA 1TO3A 1CCWB 2YLLA 3OG2A 3QM3A 4CD7A 4RW3A 4CCEA 3OYXA 2J13A 2JALA 3W25A 2HDJA 3QF0A 1U5HA 1M53A 4K68A 3PTQA 3TQPA 3LY0A 1UHVA 2EF9A 4AWUA 3NL3A 4L4OA 2CLHA 3HIJA 3I7RA 3RUBL 4OZOA 3BLDA 1R3RA 3EAUA 3OVPA 2GDQA 1W31A 1AZ1A 1K70A 3TMLA 4GVFA 3LTPA 3EOUA 1D7KA 2A3EA 2FLIA 1VHNA 3H22A 4HOWA 2FZNA 1V3KA 5DLCA 4DJED 3CB8A 4ZB0A 1JYNA 3K1DA 4B9YA 1FA2A 3W7HA 2X42A 1NY1A 3NXFA 4DYJA 3EWXA 3MUY1 1W6TA 1S3HA 3A4XA 4UTIA 4ORIA 1VENA 3LM3A 1FTXA 3LMYA 4GHRA 5I6SA 1XYMA 4OIFA 2ZBTA 1UWAA 2AL2A 1KO0A 3BGJA 4UTTC 3HFYA 4MMWA 5BWFA 1HJXA 1UWUA 5BZAA 3AHXA 1QXLA 4AQLA 1S2VA 5FOOA 2NQJA 1OBAA 1OK4A 1SZRA 5JBDA 2H8ZA 1FQ0A 4GYPA 1BSLA 3Q4DA 1JVNA 5LIYX 1QOQA 5MHBA 2WYSA 4RR4A 1Q8JA 2E68A 2O92A 4YWIA 5I2UA 5JBFA 2D0HA 3VPLA 4E3VA 4D6JA 4H01A 4NZ5A 4ATWA 3WUGA 1O1ZA 1GK8A 3TOPA 1E1EA 1JEZA 4HMEA 3LBOA 2WLYA 3D3AA 5JXQA 2YW3A 3MVTA 4XKMA 2CPUA 5KTLA 1EBHA 4KRTA 2BHYA 4AAJA 4O1BA 3MC5A 4XD6A 1HP5A 5A2CA 5I3DA 2OR2A 4RKAA 3V5OA 4MTVA 2GQAA 5DRCA 2Y8KA 3GH4A 1GVQA 4MF4A 3RLVA 3W1RA 3CK5A 4J27A 1GQLA 2BOFX 4DUOA 1V0KA 4RNJA 2ATSA 4J9JA 4ATLA 1XLEA 4BF9A 3TC7A 1KBLA 3IVUA 1XCXA 4Q22A 1VJSA 3TN3A 1A50A 2BS9A 2YFNA 1W1ZA 4R53A 3UFYA 3LHZA 4AXKA 1K4GA 2Z2AA 2EPKX 1R7AA 2DH3A 4F0KA 2WXDM 2A5HA 3VIMA 1SO5A 1CXIA 1QW8A 3L2IA 1VEOA 5GNXA 3CPGA 3LSCA 1XLHA 2QYGA 4LUJA 4C6MA 1HL9A 3VVGA 4ML9A 3IGHX 4A8LA 1KFBA 2Y88A 1EIBA 1C8VA 3W6YA 1TREA 2Z27A 2E67A 3CHCA 1WPCA 3VDHA 2CZEA 1RP8A 1JZ6A 3ZIZA 4HA3A 1QTWA 1XQKA 4J2MA 3IGSA 3NSNA 4QE5A 4ADSA 2TMDA 1QR7A 4FX8A 2UY3A 1XQLA 4J3UA 4LAZA 1MXSA 3LK6A 1R7OA 5AYIA 1FHDA 4GA8A 1P0BA 2EG7A 3VD3A 4D6CA 2ZFAA 2GQ3A 1JCXA 5GPRA 4TX8A 3M16A 4FNUA 5HMDA 3ORWA 5ABGA 1E40A 5HULA 3W7KA 1FWJC 5C0QA 2YZRA 4Q3MA 4GVIA 1OT2A 3H2EA 3UWYA 3WD0A 3RPMA 4CNUA 3FLUA 3RG6A 4FEZA 4GQ0A 3GR4A 5CPQA 2VL4A 3T0AA 5AY7A 1OC7A 4R3UA 3SFKA 1T96A 2OZ8A 4KEMA 1EQCA 4JCMA 9XIAA 4NSBA 4TV5A 4LCSA 3S5ZA 1JDEA 4A21A 1FKWA 4EPKA 3G6MA 3KLLA 3MI6A 2KAUC 1AZ2A 1IZJA 3CAWA 1VLWA 3NZ1A 4GXMA 1BRLB 1YLVA 3QGVA 3KVKA 3NM1A 3PZOA 3BAYA 4GX9A 2F6UA 4LPCA 3TYZA 2Y8UA 2V69A 1L8NA 3IS4A 2X30A 2P8BA 4L1WA 1MQRA 3RMEA 3B8SA 1HKWA 4XD4A 3QZAA 3CEUA 4A2RA 2RDXA 3DOPA 2VX5A 5REQA 3AYVA 3QYQA 3HPSA 1ADOA 3QC0A 3TYCA 5ECVA 1JGMA 3L23A 2HCVA 3PZGA 3T40A 3BCJA 3TROA 4AHPA 4XV0A 5A6MA 4NZJA 4D8LA 4C6KA 3POHA 2ZZ1A 3F4WA 1E0VA 3GTHA 2WKGA 2OGYA 3ITTA 4PBGA 2QNEA 3Q37A 3CASA 2GQ9A 3TW9A 3CL7A 3ZVHA 2H9AA 4S23A 1GWJA 2NQLA 4YNGA 5I06A 2R1NA 1ONEA 4Y96A 3BLLA 4ZOEA 1NF0A 4ZTYA 1VCGA 5CPTA 5L6UA 3O7UA 2RKXA 3WLKX 3KWXA 2D24A 3EWUA 5A2AA 4O0KA 4TUFA 3TA9A 4PTMA 6REQA 1KCKA 3BAIA 3N29A 3L4WA 4XQ6A 1X7IA 4XZLX 5FEZA 2JKEA 2QGYA 2HSAA 2UY4A 3DU0A 1P0NA 4Q8PA 3HGOA 4FR6A 3U2CA 3NA8A 4K1GA 4G5DA 3P0XA 4N6EA 3UR7A 2CWXA 3B04A 2FH8A 4YHEA 3WZ0E 1JYWA 2VRQA 1LORA 1OVDA 4QBXA 3NQVA 2W27A 4XAZA 2OODA 1NSJA 3BH4A 2YDQA 1KTCA 4L56A 4AZGA 1S2UA 3P0WA 3S46A 1F6KA 5I3HA 3RJYA 3VGFA 1P7TB 4EKJA 2PDQA 3W7CA 2Y7EA 3UJSA 2C1GA 3ZSTA 3VD5A 4CQDA 1DJZA 5I03A 4Q8TA 1H3GA 4L6HA 4ICNA 4FHAA 3R12A 1XG3A 3WQWA 4NZ3A 4CLMA 3UERA 3GAKA 2ZDSA 5CC7A 1R87A 5DMLA 4XAYA 1NWTA 4KWWA 4W85A 2DIJA 3FN9A 4I6KA 4F0LA 2PWGA 4Q4QA 2XVPA 2C15A 3GNRA 4HGXA 1VBRA 3RDKA 5U4NA 5M1TA 3E74A 3UEQA 1ZJHA 1C29A 3OGVA 3HBLA 4CD5A 4LVAA 3WNMA 1SJDA 2R94A 3KUMA 5K2ZA 1ZTVA 3SCSA 7ENLA 1EP2A 1M7XA 1DJIA 2ZWZA 2A85A 4JTCA 1HX0A 3W7PA 3TQKA 3OZMA 5BNKA 2E3ZA 3ABRA 3BANA 2Z1SA 1EFZA 3TSBA 1RCXB 3LS9A 3KP1A 1FWDC 4L6DA 3KAOA 3WBAA 2BNJA 1WUFA 4AVNA 4IMGA 1JYVA 1JCMP 4LJ3A 2V63A 4KH2A 1SFSA 3TXZA 2PUZA 2JGQA 3FX4A 1V6TA 2V30A 3BLKA 3PC0A 4FNPA 4RX0A 4R34A 1A5SA 3GNDA 2Z1VA