1TJPA

Crystal structure of wild-type tryptophan synthase complexed with 1-[(2-hydroxylphenyl)amino]3-glycerolphosphate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
267
structure length
267
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
publication title On the structural basis of the catalytic mechanism and the regulation of the alpha subunit of tryptophan synthase from Salmonella typhimurium and BX1 from maize, two evolutionarily related enzymes.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 99
structure length 267
sequence length 267
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2004-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1tjpA00
2ZRYA 5F4WA 2OX1A 3ZWSA 2Y7FA 4ZZ9A 3S5OA 2DZXA 5D38A 4MY8A 3NM3A 3P80A 4A3UA 3LXAA 1R2TA 3MBDA 1LRNA 1HTIA 2VFGA 2WSRA 1N55A 4YWIA 2E5DA 3NPUA 1SSGA 1PCKA 3L0NA 2V8ZA 4O11A 4L4LA 3LTPA 3PB0A 3IIOA 4YLWA 3GB6A 1FWTA 1F76A 4JYEA 1SZEA 3M41A 4YXGA 3M0ZA 2P0OA 1L6YA 3O07A 1SO3A 4Z1CA 3NQMA 2CLOA 3BW3A 4MZ8A 5LHEA 1S5VA 3M1ZA 1LBMA 3PBVA 2ABBA 1QPRA 5F1VA 3LHWA 3UXAA 4A2RA 3QRHA 3KXQA 4PL1A 2AGKA 1RV8A 2X2GA 4DO6A 1GVOA 3BLIA 3TXVA 4XKYB 4DPQA 1PS9A 1H1ZA 4OBTA 3VKJA 1K7EA 3BPWA 5FF0A 2XFWA 4KWVA 2FIQA 1R46A 1GTEA 2J9XA 1SO4A 3B03A 4MZ1A 3W7PA 3NEVA 5HWJA 4H4IA 2Z6JA 3CHVA 3N9SA 3GXTA 1EIXA 2HSAA 5AHMA 2QKFA 5C54A 1LOQA 1EP1A 4PA8A 3CT7A 5K9XA 2E5BA 2QCGA 5C2XA 1YLVA 3C4UA 1FWRA 4NJJA 2JKPA 2YXGA 3DH7A 2BX7A 2E6AA 1WBJA 2QCCA 3HG2A 4IXXA 3W87A 1LRTA 4O0ZA 3W73A 3S6DA 1JULA 4CCDA 3LI1A 2ZZ7A 2HMCA 1SFJA 3NQFA 4PFMA 4JTTA 4NJGA 2VC6A 3SY5A 4OQVA 5D33A 1SSDA 3EX1A 2Y7EA 3A5FA 3P5YA 3QF0A 3W3OA 2QDHA 2CWNA 3DFOA 4FX6M 1OYBA 1AG1O 2NX1A 3AJXA 4IPJA 3VCRA 1F7BA 2YDAA 2ZZ3A 4IUOA 4O14A 3MUXA 1M5WA 3O05A 3S0CA 4S2CA 1ZJIA 3C2FA 1NF0A 2NX9A 5LGXA 3PG9A 3S8HA 3C2RA 4FNSA 1TPH1 3MP5A 4WXYA 1F05A 4O15A 4Z0SA 1I2RA 3SSJA 1XDMA 4R33A 3TMLA 1YTDA 1K7XA 1OYCA 4KFOA 1K7FA 3TW6A 1OFDA 4I7WA 4QJ1A 4RV8A 4Z1AA 4FIQA 4UFMA 2W0UA 3DZ1A 3F03K 1D3HA 3BG5A 2QCNA 3O63A 5G2HA 1G4SA 5D2WA 4FF7A 5D32A 4MKNA 3TC6A 1IXPA 5AC6A 2TSYA 2YW3A 2ZQ0A 3R8RA 1GYLA 3M44A 5F4XA 5HINA 3M5YA 1G4PA 5FESA 3QQ1A 3TDFA 2E6DA 1JR1A 5HULA 3HGOA 1KFEA 2EF9A 1KFJA 1H7RA 5HUPA 3LHVA 4LV9A 1LZOA 1XL9A 1IXQA 3OVRA 4RXGA 4AF0A 2ZRZA 3S5ZA 1ZCOA 3M5VA 5BMXA 1W5MA 3NVTA 1YDVA 2EHHA 1T96A 2CLLA 4LRSA 2ZA2A 2NUYA 4EF9A 2X1UA 3JRKA 4ML9A 1UJPA 2JK2A 1ME8A 3LCWA 2PCQA 4XQ6A 5BRBA 3PUEA 5K9DA 2RDTA 2J9ZA 5L9FA 1SU5A 4J9JA 3KRZA 3ZFHA 2PE4A 2FPYA 3DAQA 4UR7A 2VFDA 4PCFA 5IBXC 3ELFA 1OG0A 3O15A 5LNUA 3DKLA 4WY0B 3TU9A 2ZRUA 2ZZ2A 3R5EA 5F2IA 1FQ0A 1G7UA 1JCMP 1KV5A 3R12A 4DO5A 1KM1A 5DY2A 3STEA 2XN1A 4GBUA 2I1OA 3HOJA 4BR1A 3UZJA 4CNOA 4JN6A 7TIMA 3HG5A 2YCEA 3QW3A 4O0KA 4JTLA 4UIOA 1H60A 2JKAA 2O7QA 3G3MA 3LXCA 4MZYA 3BGJA 4LTSA 5AFDA 1FCUA 4UCGA 1NFBA 1XDLA 1FXQA 1JCNA 3VI2A 4TIMA 1TV8A 3HG4A 3VFLA 5LNSA 3EB2A 4MY1A 1W8SA 4EOUA 4ZQPA 5CPOA 1TSIA 1VS1A 2OMAA 4OT7A 1GT8A 3O1NA 2NWSA 4GFSA 1TPUA 1ZAJA 1AW5A 1D9EA 4LS1A 3B0VC 3TROA 4O1CA 1LM1A 4DPPA 4BI5A 2ZBTA 3GNDA 4WXZA 4O52A 3C2EA 1I2PA 1S3HA 4ORMA 3N19B 3OVQA 1GYNA 3W7NA 1XBYA 3H53A 1ZFJA 1OK4A 5E93A 5FF4A 3CIWA 1V5XA 5AYXA 1X8FA 3MI2A 4NT0A 6TIMA 4JS3A 3TIMA 5D2XA 3NPXA 3PUOA 3FJ6A 1W56A 3E49A 1L6WA 4R34A 1ICQA 1OFPA 3W88A 2DORA 5HNRA 2X30A 3NQ7A 1X7FA 4WD0A 1UBSA 2ZDRA 2EPHA 1GVRA 3P61A 2QCHA 4ORIA 5D03A 4FO4A 3FKKA 4IJBA 5D2VA 1LTDA 3GLCA 3C8FA 4GUJA 3LRLA 3GKAA 3QSRA 3C3NA 2E6FA 1TMHA 3CTLA 1P1XA 3G24A 3L68A 1XM3A 3H54A 2A85A 1FWNA 3E0IA 4EF8A 1VRDA 3E12A 1YPFA 3QQ0A 4JDBA 1KLZA 3R89A 3RMJA 4JTKA 1O60A 4GUGA 3W70A 2JGQA 5LNRA 2A7PA 5KZEA 3NA8A 3GYEA 4A22A 2B4GA 4JEQA 3OBKA 1GPWA 1ME9A 1H51A 4IMCA 1VCGA 2ZRVA 2ZFAA 4IWWA 4IGHA 3IGSA 2WJZA 3NQ2A 3L67A 3L21A 5LGZA 1Q45A 2YX0A 3BLEA 1Q3NA 4FNUA 4MLRA 3P84A 3KVMA 2R91A 1TJPA 1KV8A 3RLVA 2X1SA 1FCQA 1VH7A 3E02A 2GVJA 3BW2A 2NXIA 3NQ6A 3TXZA 2NXHA 1AW2A 1GJPA 3ATYA 4E0CA 3NYZA 2FPTA 4R7JA 3NO5A 3G1VA 4K36A 4UMBA 1F74A 4XWUA 1JUEA 4MPQA 4TO8A 1IIGA 5KTLA 1KW1A 3P60A 2B7QA 5KMYA 3DBPA 3GIYA 3W7KA 8TIMA 4WOQA 2QCDB 5G1TA 1EWEA 3P82A 4Y6GA 2DU2A 1MSSA 2R14A 1BWKA 1QPOA 3MHFA 3TKFA 1XBVA 3LRMA 1B4KA 4O16A 5GVJA 4UTWC 3NR0A 4UMCA 3NQAA 5K4XA 3SIZA 1MEWA 3PY2A 1JVNA 3TA6A 3QFEA 3S1WA 2CW6A 1GG1A 1T99A 3GDLA 4A2SA 3NDOA 1H7NA 1I2QA 2H8ZA 3N9RA 4ADTA 2E77A 5EA9A 2DJLA 4NX5A 3W7DA 5A5WA 1LBFA 3Q58A 4K39A 4IMDA 4FIRA 1P4CA 4JX5A 1UB3A 2A1YA 1CI1A 4X9SA 1W31A 3A5VA 1O95A 3N34A 1W37A 3BG3A 4Y96A 5EBUA 3G1DA 3U8GA 4DF0A 1EX5A 2LLEA 1TPDA 5D37A 1DQXA 2E5CA 4I7UA 4UFKA 3K30A 3O6YX 4P61A 3W7GA 3BG9A 1QNVA 1ADOA 3QC3A 3FJLA 1OHLA 5HWNA 4MLJA 3G1YA 4JX4A 3N3MA 3SGUA 3NL3A 4RX0A 1J2WA 4HPXA 3PBWA 4AVFA 3O8AA 3LBMA 2JKEA 2WNNA 3HBLA 2QDGA 2X1TA 3H55A 3T44A 5CG7A 3MI3A 3LTSA 2ZCGA 1EP3A 1ICSA 3W2KA 4ADSA 1ZAHA 3ZR4A 2J27A 4ZVJA 1HFBA 3IGUA 1HO4A 3A23A 5I3HA 3W83A 3L66A 1NAL1 1XC4A 1QDSA 3RF9A 3T4CA 1VGAA 3G0XA 4L4MA 1VQTA 5CZJA 3EX3A 3LB0A 1G67A 5DBTA 2GJNA 3S42A 2VENA 3NQDA 3W71A 1PE1A 3CEPA 4NX0A 5AHFA 5CKSA 3UY8A 5DXYA 2R8WA 5BOOA 4FEZA 2Q8LA 3EWUA 3UPBA 4MOZA 3SI9A 1SUXA 4Z08A 1LBLA 1S5TA 5I3GA 3GAKA 5TIMA 2J24A 4WX2A 2V5BA 2VEKA 3KHJA 3W1RA 1KTCA 2CLFA 4DBDA 1O5XA 2YW4A 3CB8A 2VEMA 3STCA 4E2BA 1VYSX 4YMZA 1CW2A 1TTJA 1FDJA 2QCFA 4ICNA 1XUZA 5D2TA 1ML1A 2QAFA 4LT9A 3MP3A 3S1XA 2G96A 3TSDA 1D3GA 1WOBA 1H1YA 3M7WA 4JIQA 3T7VA 1RZMA 1YXDA 5TBOA 3EKZA 5KZMA 3M9YA 3TR2A 2CZ5A 3P5ZA 4M6QA 2FTPA 2BZNA 1I4NA 3HIJA 3T78A 2FB2A 3TV8A 3G8RA 3GKFA 2ZTJA 1YDOA 2ZZ4A 3M43A 1LRQA 3HPSA 5I3FA 4UTHA 3MBFA 3NZ1A 4DF1A 4RZ5A 3KVKA 3YPIA 2V2DA 3I65A 4LVGA 5CPNA 1K8ZA 4M5PA 3P62A 4N9DA 1WOAA 4H3DA 1C29A 1SR9A 2Z2UA 3N2XA 3B04A 2DJXA 4NZJA 1GOXA 1C8VA 4LWWA 1KM6A 5I3KA 4WUIA 1WYIA 1VYPX 3GR7A 4DELA 3NG3A 3STFA 2QR6A 4HSNA 1L2UA 3P8JA 4JGDA 5AC8A 2RDUA 1RQHA 3CWNA 1ZENA 4AWUA 3PS7A 1TJRA 2AAMA 3EWYA 3IIZA 1G6CA 3IV3A 2ALDA 4PL2A 5DELA 5C5YA 1TTPA 1H7OA 1C9DA 1YXYA 3BARA 3U2OA 3FFSA 4PC8A 3PB2A 4CCCA 3VE7A 3PWAA 4TU1A 3QPZA 3UPWA 1EUNA 2ZRWA 1Y0EA 1FDYA 4JTFA 1JRCA 5CZSA 1JCXA 1LP6A 1VCFA 3TW7A 4RKAA 3IEBA 4N6EA 3NNTA 4JY9A 1YTKA 1QCWA 3M47A 5G1YA 1RQEA 3IIXA 3UY7A 4QAIA 3N73A 4JIPA 2DZPA 4QNEA 5EMUA 4OV9A 3W86A 2WOQA 1LLWA 2KZHA 1Q6RA 1LOSA 1QMLA 4GRSA 1RQBA 5AYYA 1KFBA 4JY8A 2DZWA 3L5MA 3HG3A 4MFEA 2DZTA 2TMDA 1BKSA 1TB3A 4UTTC 4WZHA 1EA0A 3M5ZA 1IGSA 2XN2A 1FX6A 5HUOA 2Z1BA 1JUKA 3B4UA 3BK0A 3EX4A 3W2UA 1K02A 1H7WA 2HS8A 5HQEA 4XTIA 3C2OA 3O06A 1OFEA 2FLIA 1TREA 1JQXA 5F2LA 2QUVA 3G8EA 3A21A 3N2MA 2ATMA 3M16A 4GC4A 3GX9A 3CPRA 1K3UA 5FF2A 3CEUA 5FEPA 3GDTA 4YCOA 5L6UA 3BV4A 2C1HA 2G97A 1TPFA 3KRUA 4GNJA 4OU1A 4O8RA 5DCDA 2HS6A 1A5BA 5IM51 1W1ZA 6ALDA 5AB3A 3W2JA 3W2MA 5CPLA 3M5XA 3W07A 1DJQA 1MO0A 4FB7A 4JTJA 4AHPA 2CLHA 1B9BA 1VHNA 2FPVA 2QAPA 3HB9A 3KVLA 1GVFA 2A6NA 3W7MA 3PSVA 1XXXA 3OG3A 4M7SA 4MJMA 3GVGA 1UUMA 3GK0A 4UFLA 5FEZA 3W1PA 3NM1A 4DXVA 1K03A 4M6VA 5EKYA 3VE9A 2DZSA 4GUIA 1IIHA 2OT1A 1P5BA 1J4EA 3GAYA 3S1VA 4TMBA 1JQVA 4QIUA 3MW7A 3C61A 1YXCA 1ZY9A 1NSJA 3Q2DA 2WV8A 3R2GA 1UASA 4KFNA 3S5NA 2NWRA 2QCLA 1VLIA 5KZDA 1SZGA 3PC0A 4LC6A 3B0UX 4M19A 1W3TA 3WJZA 3L0GA 1M7PA 3I68A 2E1DA 3WJWA 1EEPA 3NPWA 4UXDA 2CFFA 3EXRA 1F6PA 3VNDA 1UCWA 3LCFA 3NL5A 2QUTA 3LERA 4S2BA 4O19A 1PHQA 2B7PA 2QF7A 1HG3A 1H62A 3O6CA 2VFHA 4HPJA 4O13A 3LX9A 1TQXA 2EGZA 1KTBA 1A5SA 1FCBA 1O5KA 1HO1A 3B06A 4HKPA 1SO6A 4NQ1A 4FNRA 3WJYA 1YYAA 4AHQA 2XN0A 2VFIA 2CZEA 1QO2A 3W76A 3G1SA 4AWSA 1W3NA 3TH6A 1JRBA 4UC5A 1DOSA 3E9AA 4QITA 3BW4A 5LSMA 2VEIA 5LKYA 4FX8A 1YPIA 4ZQOA 4O1AA 4LS2A 4R53A 1DHPA 3W7LA 3OEXA 3DFNA 5CZ0A 4UTTA 3LHUA 2RH9A 5KITA 2ISWA 3BO9A 4DQWA 1K8XA 3CLMA 3GXNA 4BWLC 5CSRA 1NVMA 2RHGA 3LCXA 2CLIA 5SWUA 1OX4A 4UNKA 2FB3A 4AB4A 3OVPA 1MEHA 4O57A 5C6MA 1SZFA 1V7YA 2NXGA 3NQVA 4CQ9A 5CGQA 3TQ0A 1KM2A 3LXBA 2DP3A 2VELA 2ATSA 3P67A 4Y90A 4UNLA 2WNQA 4A29A 4JYDA 3EXTA 3QW4B 3W1LA 4K38A 1Q6OA 2CZFA 3LLFA 3TSMA 1AMKA 1U83A 1W5OA 2Y6ZA 1L9WA 4IPIA 3W74A 1QOQA 5A8GA 3F4NA 4MJZA 5D02A 2GVGA 2V5LA 4ZQCA 5D04C 4JTGA 3L65A 4DF2A 1EUAA 5LZLA 3B8DA 2NV2A 4RLIA 3T55A 2B0MA 3HGRA 2FDSA 3UZ5A 4IMFA 2A4AA 4HT3A 3DFQA 2OCZA 1OVDA 4LS0A 2YPIA 4CCEA 2YFOA 1I45A 4OE7A 2J88A 3W7EA 5I3JA 3W1NA 4UMAA 3SR7A 5AHNA 4Z1BA 1E51A 1TYGA 5F2GA 2H8XA 2Y63A 3W1AA 4LY8A 2NUWA 3WFAA 3SZ8A 2VEPA 2C13A 1AL7A 5U4NA 4FXSA 1H5YA 4O18A 1ZAIA 1AW1A 5G4WA 1W5PA 4BI7A 1VZWA 3C2VA 2UV8G 5CZTA 1EB3A 5IBXA 4UUIA 3TUUA 3P74A 3LHTA 3RU6A 1XBXA 5HWMA 4QNWA 1TV7A 3IVTA 1Z42A 3LDVA 3WK1A 1W3IA 2YR1A 3TC7A 3UWUA 1LYXA 2V2CA 1A5CA 5G2IA 3UWVA 1OJXA 1OFRA 3W85A 3QMRA 3TE9A 1CX9A 4AAJA 5AC7A 2NV1A 4UR8A 2A21A 3DHDA 2FJKA 2CU0A 3TCEA 3SGZA 3F4WA 5F2MA 4HNTA 2J6XA 4O4VA 2H90A 4UFIA 3G18A 3C0JA 4GJ1A 3USBA 4Q4KA 2BWGA 3SECA 2ZZ5A 3C52A 1WXJA 3NAVA 4IQLA 2BSLA 1LORA 3ATZA 4NJKA 2ISSA 1KM0A 3GDMA 3UWZA 3S1UA 2GOUA 1WA3A 1I2OA 4AF0B 4POCA 3FYPA 5KINA 5F4SA 3KFTA 1L6SA 3DFSA 5G5IA 3CM4A 4Q33A 4B5NA 5LHFA 5EYWA 1FUYA 2YFNA 5EY5A 4GUFA 5LNVA 5T26A 3ANYA 4LVFA 1DORA 4XUGA 3BVJA 4N4PA 2Y7GA 3QMSA 2C3ZA 1TTIA 4O50A 4WQ6A 2VOMA 3G0SA 4QQ3A 3DFPA 4K37A 2YSWA 3LTYA 3TQKA 1KM4A 3W6YA 3G0UA 2PC4A 2Y89A 4P2VA 3C56A 2Y61A 5FF7A 2GPTA 1X6UA 1X1OA 3LCLA 1DJNA 4XZ9A 1NEYA 2YYTA 4UFJA 1SQ7A 4PEKA 3FS2A 1SW7A 1TV5A 4BWLA 1I2NA 4NNAA 4AWTA 3UYCA 3R13A 1G7VA 2G5WA 2ZRXA 3MHGA 1YADA 4O53A 3EEGA 3MYPA 1R2SA 4N9BA 4C1LA 3P81A 2ZA1A 2VXNA 3QPYA 4UTLA 1F73A 2QJGA 1DKWA 4JTIA 4MFDA 5EPDA 1NF7A 5K2ZA 1H61A 3W1TA 4AXKA 1QWGA 1XUUA 4MYAA 2A0NA 1GZGA 2WO5A 3ABOA 1R2RA 2QCEA 3MWAA 3TK7A 5D09A 1W5NA 1O94A 1BWLA 3W9ZA 3HPXA 4ALDA 4UTUA 5AHLA 5HMSA 1TPWA 4HSOA 3KAOA 1GWJA 3GDKA 1LOLA 3SFKA 3QSTA 4X22A 4FNTA 1WX0A 1Q6LA 4CNNA 2Q3OA 3HPZA 4ADUA 5FEXA 2QEZA 3BGGA 2Y7DA 4Y9AA 1T8XA 1TTQA 3LCHA 4LVBA 4DBEA 3FIGA 2NX3A 4M7TA 4O12A 3SJ3A 2Z6IA 2BXVA 3LRKA 4UFHA 4O54A 2WNZA 3G1XA 2R94A 4AH7A 4LC8A 4JTHA 2C0AA 5G4EA 3RK8A 2PRMA 2J9YA 3DFTA 4FNPA 1BTMA 1G4EA 1SPQA 1KFCA 3PF3A 4JTSA 1M6JA 2VKZG 1N7KA 3FLUA 1TPVA 3JS3A 5K7JA 1N8FA 3THQA 3L5LA 3OA3A 3P8IA 1GVQA 4I9AA 3W75A 4K8EA 1OX4B 4HIBA 1RVGA 1TO3A 1KFKA 4BFAA 4UTMA 3PULA 4O1BA 4N9EA 3V75A 5J5RA 1GEQA 3L0KA 4PTNA 4CNPA 2B7OA 4I7VA 3WJSA 1SZNA 3ZWTA 5TQLA 3OIXA 4MVAA 1AL8A 4UTWA 3QZEA 4IOTA 3LHZA 4BF9A 5U7SA 3CU2A 3Q94A 4RJEA 3FEMA 4O10A 3PBUA 5FF3A 4ZL1A 2Z0IA 3QH2A 4N9CA 3G1HA 3W7IA 4TMCA 3S9YA 5BW6A 1DQWA 4MUZA 4RXFA 3RNDA 1IXOA 1TRIA 5HJLA 3AO0A 3A24A 3MI6A 3F1QA 2Y88A 1HUVA 3MP4A 1MXSA 3Q37A 2QJHA 1YDNA 2B7NA 2EAWA 2HTMA 5HR6A 3QMTA 1WAUA 4QSHA 3SW6A 3D0CA 4O28A 4AEOA 1KM3A 1H7XA 4A21A 3PR2A 3W7QA 3UNDA 3MYOA 4NU7A 4LUIA 4JNMA 4KFPA 2E09A 2WPBA 3NQCA 5HR7A 1OF6A 4HHPA 1H63A 3GR8A 3NQGA 2X16A 2Y62A 3QM3A 3W7JA 1TQJA 3IIPA 5DBUA 4JXCA 4KKXA 4K7VA 1H50A 1F2JA 3FA5A 1M7OA 4LUJA 3CC1A 3EWZA 3ABRA 1OX6A 1S5WA 4LVDA 3L2IA 1X1ZA 2TRSA 5FI8A 1FWSA 5AHIA 4OWGA 4BI6A 3P7YA 3W84A 4W9TA 4MY9A 2OT0A 2V30A 2ZA3A 1EWDA 4NXKA 4QM1A 1A5AA 2WSYA 4WOZA 2G95A 3DI1A 3W23A 1DBTA 3G1FA 1LCOA 4YL2A 4RK8A 2V9DA 2ZTKA 4OGZA 4WY0F 4JTEA 3LCGA 2VFFA 4Z0JA 3OHIA 4IMGA 4LRTA 3RFAA 1KM5A 2JGYA 3IVSA 3GNNA 2E6YA 2A5HA 3W1XA 4WJEA 2W6RA 3B0PA 1XBZA 5F1UA 3UWWA 3TMQA 3EWBX 1TPEA 1EPXA 3UWQA 4IX2A 3IGXA 3WK0A 2QCDA 1OFQA 3FOKA 5LNWA 3I7SA 5DN1A 4FX7A 1VPXA 2FFCA 1UUOA 2C19A 5ABTA 4ZQRA 4CQAA 5D05A 4PODA 5K4ZA 4XBSA 1Z41A 4UTJA 1FBAA 3G1AA 3HGJA 1B57A 1OYAA 1TCDA 2QUUA 4YCPA 4Z1DA 4O1DA 4DO4A 2Q3RA 3C6CA 2O7SA 1SW3A 3IRDA 3NZRA 1B3OA 3NQ8A 3N14A 4RZ4A 2NZLA 1WDWA 4AMAA 3TX9A 3HJZA 3UD6A 2H6RA 3DU0A 2OJPA 3KRSA 1QPNA 2H3BA 3JR2A 1FWWA 4LV4A 2ZZ6A 1G69A 3GZ3A 1Z48A 3PG8A 4X3ZA 2EKCA 1A50A 1RR2A 1FY6A 2CZDA 2C15A 1O4UA 1VR6A 2H3DA 1VLWA 4X2RA 4C1KA 4AHOA 1GTHA 3A9IA 1P0NA 3EX6A 1GG0A 3O16A 3ABSA 3QJAA 4Q32A 1ICPA 1PL9A 3DKJA 2OZ0A 2A2IA 2P10A 2GJLA 3EWWA 3KVJA 1P0KA 3TQVA 4NXSA 1QOPA 5FEWA 1R30A 5CSSA 4GUHA 1JCJA 1OFAA 5C55A 4XTDA 4NVTA 4JR5A 1R47A 1WV2A 3LGEA 3CIXA 3FYOA 1SFLA 2JBMA 1XKYA 3NXFA 4OV4A 4HNUA 1T0OA 1KBJA 3DXIA 3LOTA 4HNNA 3U6WA 4E38A 1ALDA 3MHUA 3WK2A 2QCMA 3HQ1A 4RZ6A 2WQPA 4U4MA 3PVFA 5BNKA 2PURA 5DCBA 3TFCA 2CLEA 1THFD 3A22A 3I6RA 5E0KA 5EL1A 1TRDA 4GWEA 2GUUA 4ZQMA 3W7RA 1VC4A 3NQEA 1OX5A 1BEUA 5AHEA 3QYQA 3PUDA 3NOEA 4S1FA 2WKJA 2A7NA 1IF2A 3TNOA 4JX6A 1B4EA 3TFXA 1SO5A 4JICA 3S5YA 1Z44A 3NL2A 4EVZA 4IX0A 1I8JA 4JDYA 3TJLA 5K9CA 2YYUA 3TJXA 1TIMA 5DCEA 1PVNA 1HL2A 2BTMA 3LCIA 1XFBA 5K3VA 1KA9F 3GDRA 4EIVA 1KBIA 2C6QA 1JJKA 1VJIA 5G2WA 3CQ0A 5H91A 3W22A 4HN4A 2NLIA 4CLMA 4UTKA 4N02A 4QISA 5J5DA 1PIIA 4GXMA 3W7CA 1JUBA 3W1QA 1DL3A 3LM7A 3L5AA 1ZHAA 2V2HA 2CLKA 3I7QA 2C18A 3PAJA 4PH6A 3INPA 1GQNA 1VHCA 2I14A 3B05A 4MYXA 1F5ZA 2D73A 2A7RA 5DLCA 3M6YA 4EWND 3UXDA 3LBCA 2V0TA 1KTNA 4FNQA 3STGA 2RKXA 4XKYA 2GQ8A 5DXXA 1OABA 4ZQNA 4CQ8A 3EXSA 3ZS4A 1IXNA 1GVSA 1LDCA 3TAOA 2GVLA 2C14A 3E96A 1U5JA 5DY3A 3EX2A 2F84A 1ME7A 3MMTA 1KFLA 2X1RA 1OFBA 2VFEA 2V82A 4O4WA 1JCYA 1LLZA 1QPQA 3IVUA 3CWOX 5CPMA 4E2DA 3QEZA 4LU0A 4DEFA 2P1FA 1PCWA 2CLMA 3WK3A 3UQNA 4LW7A 1PV8A 4UTIA 4K7YA 4K6AA 3W2NA 2ISVA 4ONVA 1F6KA 2AQWA 2GQAA 4XBKA 2TPSA 1K8YA 4NZFA 3G3DA 2YZRA 5AN7A 4LVAA 1DV7A 1OK6A 2QJIA 1H7PA 1QR7A 1A53A 3W1UA 1XCFA 1W0MA 4JTUA 4LOCA 1XI3A 3HF3A 3V1PA 1MZHA 1VYRA 1SW0A 3NGJA 5AOUA 4NJHA 3LI0A 5I3IA 4NNCA 5D30A 3BLFA 2A6LA 1W54A 1W5QA 4IXHA 2BLEA 3IIVA 2C16A 4MIMA 1EP2A 5D2YA 3PM6A 5BMWA 4RR4A 3NL6A 3EWXA 1MEIA 1G4TA 2TYSA 3MO7A 3UWYA 2YGYA 4ZMGA 5MHBA 1ZALA 2V81A 2WSQA 1YTEA 2RDWA 3TAKA 3NPVA 3PBYA 4HNVA 3KX6A 3FKRA 3DENA 3EKLA 3W2LA 2DZUA 1LROA 4NJIA 3MJYA 2PRLA 1KLYA 1DVJA 1RD5A 2GQ9A 4JYFA 2Y70A 1Q6QA 1JCLA 3LV5A 3KOFA 3LHYA 3W1MA 3ABQA 4KWWA 2ZZ1A 4K8HA 2FQIA 4N6FA 1QO5A 1OFOA 2PRHA 4FXRA 5H2ZA 4OHQA 1TPC1 2Y85A 3LV6A 4GE8A 3G22A 3PSWA 4FHAA 1ZNNA 2RFGA 3T40A 3RLUA 3HGSA 1FDZA 1TPB1 3DGRA 4NNBA 1ONRA 1QAPA 2DZVA 4D2JA 4G1KA 3W7HA 3HMJG 5AYZA 1J5TA 4BK9A 4Y8FA 1WQ5A 4N4QA 4U28A 4JD4A 2E68A 2ZYFA 1AK5A 1RPXA 1FCVA 1WBHA 4N2YA 4TR9A 3HO8A 4RCXA 1OF8A 4IMEA 3O6DA 3TSBA 4NUWA 5E1QA 2W79A 3THAA 1PHWA 3WJXA 2Q8ZA 4WY0A 2I9EA 3I7RA 3GXPA 4TX9A 5KSWA 3W7OA 3DHFA 3L9CA 2ABAA 1QFEA 1FXPA 4O17A 2NUXA 2F7FA 1VCVA 4M6PA 4LNYA 2IQTA 3DI0A 3LLDA 3W72A 4H6KA
chains in the Genus database with same CATH superfamily
2BDQA 4V28A 3WLHA 3VK5A 2OX1A 1P43A 2E9BA 1VFTA 4LYRA 4ZOBA 5D38A 3TN3A 3WL1A 1WKFA 1US2A 3GHSA 2HROA 4MY8A 4WHBA 4A3UA 4ZOAA 4KBXA 4H7CA 3LXAA 1QUMA 1X6LA 4KETA 1PCKA 2OPJA 8CGTA 2ZOXA 4L4LA 3LTPA 4YLWA 4JYEA 3QR3A 4YXGA 2P0OA 3O07A 4Z1CA 1DPMA 3NQMA 3ABZA 1UWSA 2XGZA 1LBMA 3UU0A 5CJNA 3D46A 4DBWA 3VAVA 2NQ5A 4A2RA 1KQZA 2AGKA 1RV8A 2X2GA 3O2LA 1JGIA 2NVAA 4BQ4A 3BLIA 3TXVA 3BMXA 2XDFA 1UWAA 1H1ZA 1EGMA 1PKLA 1HZYA 3BPWA 1XLKA 4KWUA 1R46A 1XPYA 3RUBL 1ZBVA 1SO4A 2O0TA 4MZ1A 3VKBA 3FSUA 3NEVA 4DYKA 3URBA 1EJSC 3ZJ6A 3N9SA 3AICA 1IYXA 2HSAA 4DJFD 2PDGA 3CT7A 2X8RA 2YDSA 4GQBA 3RITA 3C4UA 3AU6A 2QCCA 2XISA 4ERIA 4O0ZA 3EPNA 4IM4A 3AISA 1JULA 3LI1A 2BMBA 2QPXA 2ZZ7A 3J7HA 3NQFA 3WUGA 4MKSA 1FA2A 1UKQA 4JTRA 3T2PA 3NSNA 4OQVA 1SSDA 1KXQA 2PDLA 1RLCL 2CWNA 3ZT7A 4C1NB 4ZOEA 3VCRA 3TEVA 4IUOA 2ZZ3A 1PO9A 3O05A 3AROA 3S0CA 4S2CA 1ZJIA 1XYCA 1IR1A 2NX9A 2IQ0A 3C2RA 1EZ2A 4FNSA 4WXYA 1VRXA 3R43A 4O15A 1W3LA 2C1GA 1I2RA 3SSJA 3TMLA 1YTDA 1K7XA 4ZGYA 2J74A 2WHJA 3TW6A 1GKPA 1I1WA 2DUXA 4Z1AA 1KRAC 2AQOA 5J04A 3QHMA 1W3KA 5LYRA 3HZ3A 3BG5A 1LG1A 5D2WA 5D32A 4MKNA 2PDJA 3OPSA 2J7HA 2DIEA 5AC6A 3GU2A 4S3AA 3E0WA 3M44A 5F4XA 5HINA 4BEUA 1G4PA 3TDFA 2HPIA 4JQ2A 4G2DA 3HGOA 4NAEA 1KFJA 1H7RA 1EJUC 4LV9A 4DYJA 5FJTA 4Y2WA 2Z4GA 4HK6A 4AF0A 4AX6A 3S5ZA 3AHVA 4TTUA 1W5MA 1DJZA 3NVTA 1U1JA 1A3WA 1BWVA 4LRSA 1W2PA 1GONA 3BWWA 1H1NA 3JRKA 4PCTA 3T8LA 3OGVA 2OLHA 1ME8A 2PCQA 2QNEA 3ITLA 5CC5A 3WF1A 2RDTA 1ONEA 5L9FA 3HN3A 4KCWA 4J9JA 5XIMA 2X09A 3ZFHA 2ZXAA 4YTUA 5IBXC 2CETA 3O15A 1PIGA 2WCAA 1R9XA 1FWBC 4AFYA 2ZRUA 3W27A 1FQ0A 1G7UA 5CC3A 2ZX7A 2I1OA 3HOJA 3HG5A 5CZKA 3QW3A 4M1RA 1ZZMA 3QV9A 3FXYA 4UIOA 3G3MA 5B80A 1TUFA 1E1EA 1KXHA 1XDLA 4TIMA 1UQZA 1TV8A 2OLSA 5LNSA 4L80A 4I6KA 4ZQPA 4DN1A 3NZGA 2OMAA 3R25A 4YTRA 4OT7A 3O1NA 2NWSA 1V6TA 5C2GA 1HJVA 1TPUA 1D9EA 1CGUA 3W02A 3B0VC 3A13A 3TROA 4E8GA 2V67A 4W7WA 3MT1A 4E3VA 2ZBTA 1TZ9A 3C2EA 4M56A 3OVQA 1GYNA 1ZFJA 2Z7KA 4JIIX 4KESA 2MNRA 5FF4A 2R1KA 4CNUA 3GUGA 2ASHA 1X8FA 2I7GA 4QEEA 3DHPA 3P14A 1JI2A 4JZ5A 1TVNA 3FJ6A 1EHNA 4B3KA 3E49A 1L6WA 4XAYA 3RLHA 1OFPA 2DORA 5EU9A 3WLNA 1JZ3A 5CPQA 3NQ7A 2XH4A 1OCQA 3IS4A 1QBBA 3K13A 4MNMA 1I9CB 3SUTA 3I6TA 4IJBA 1AVAA 3S1GA 4ZOCA 5I6SA 4DJFC 1WPCA 1XDJA 1VRDA 1EPVA 1TMLA 2X7VA 4EAYA 2VEFA 1M01A 1B3YA 2OZTA 2XVGA 3EOEA 4Q8TA 3GH7A 3UT0A 1RP9A 4TTGA 3V0SA 7REQA 4KIEA 1E9IA 2WBGA 1W9PA 1TV2A 2OO6A 4KRZA 2CCRA 1BFNA 4EACA 1Q45A 1IEQA 2YX0A 1R3WA 1DJHA 1Q3NA 3BLEA 4G5DA 1DXFA 4AIEA 5A8NA 3H7RA 1TJPA 3CYJA 1KV8A 1VBUA 2PDWA 1JZ5A 4FZIA 2J7DA 3WDHA 3E02A 4HNCA 3TXZA 2NXHA 3ATYA 2G3IA 5DANA 2GGHA 2OEJA 4CKQA 3AXMA 4XWUA 3MTWA 1WDPA 5A3HA 1BSLA 4WSKA 3W37A 4YTQA 1GVYA 4M82A 1OSEA 3GYCA 4R3UA 3E2QA 2ALRA 1UHVA 2R14A 4GLEA 4Y8EA 3MHFA 5ABEA 4EPKA 2NSXA 2PDIA 1XBVA 4KPLA 1B4KA 4QJ5B 4UMCA 3NQAA 2V69A 2OWXA 1CLKA 1Z8AA 3SIZA 1MEWA 1OIFA 3S1WA 1V6YA 4CNTA 4NAEB 1H7NA 2H8ZA 4ADTA 4U5KA 3WUEA 3ARWA 4FR6A 3S9IA 4XIAA 4FIRA 4AZIA 1RBOB 1UB3A 4YN5A 1W31A 1N82A 5DMLA 4AD3A 3R58A 1JYWA 5JIPA 4DF0A 1EX5A 2E4TA 5IFTA 1JZ6A 4NF7A 1NFPA 1EOMA 2LLEA 4I7UA 1CENA 1F3TA 1QNVA 2XVPA 4HVXA 1ADOA 1CCWB 1W3JA 4K2SA 2INFA 2E9LA 3HU7A 2QW5A 4AVFA 3HBLA 5CG7A 2ZCGA 5CSUA 4JFSA 3WSUA 2GL5A 1U1HA 1ZAHA 5EB8A 2J27A 3VZZA 2YL5A 1CXEA 1UD6A 1XC4A 3LEPA 4RL3A 2XSBA 1W1YA 2E25A 3T9PA 4L4MA 2X40A 3VZXA 3AS1A 2Y8UA 4PZVA 3EX3A 3LB0A 4A3QA 1G67A 3CO8A 3NQDA 4MM1A 2I57A 2FVMA 4M24A 2R8WA 2Z2AA 3AU2A 4GIRA 2O55A 4MOZA 4Z08A 4ZCWA 1D7FA 4JL1A 5TIMA 3DG7A 1WKEA 1QT1A 5A2CA 1JL8A 2ON3A 3KHJA 1E56A 2VEMA 4YMZA 3GG7A 4PMVA 4ICNA 3UR8A 1XUZA 1ML1A 2QAFA 1AQHA 4JIQA 1GYMA 1TA3A 3RIKA 2VC5A 4UCFA 2ACSA 1HL8A 2CXEA 1D8WA 2OODA 5TBOA 3EKZA 4A3HA 5KZMA 1BTCA 3TR2A 1DWGM 4GD0A 1PTAA 4M6QA 1UUQA 2E40A 3TV8A 2ZTJA 5AVHA 3UW6A 1UG6A 4GNVA 1V6UA 3QQWA 5BXTA 4D6JA 4UWMA 4W89A 4DM2A 1KD0A 2YCIX 3KBMA 3I65A 1BXCA 4N9DA 4GJJA 4AXNA 2Q8XA 4H3DA 2Z2UA 2OYMA 2VDHA 3B04A 5C9ZA 4NZJA 7REQB 4QFUA 1KM6A 3QTPA 2QXWA 2AKMA 4WUIA 1WYIA 1XKJA 4ATLA 3NEHA 1L2UA 4DI9A 4JGDA 1NM9A 1IZJA 1JD9A 1GVIA 1CTNA 4JHZA 1DTNA 2AAMA 1EJWC 3VIHA 1K8CA 3IV3A 1PZ3A 1RH9A 4RE4A 1C9DA 3BARA 1O6IA 1W8GA 3FFSA 5I23A 3APYA 4CCCA 3QR1A 2B31A 2HNHA 3UPWA 1E43A 2ZRWA 1IZCA 5M5DA 3I3BA 2PEVA 3WD4A 1F07A 1R9ZA 2H9AA 1VCFA 1QK2A 3IEBA 3WNPA 3RJXA 3VO0A 3ZQ9A 1QCWA 5T9CE 5GJNA 3MS8A 4OJYA 1RQEA 4US5D 3N73A 2DZPA 5EMUA 3A9BA 3W86A 2WOQA 2PDXA 2R1LA 1QI2A 5AYYA 4JY8A 2CWXA 4HK5A 1BF6A 2DZWA 3HG3A 3CZGA 2Y5EA 4F9DA 1SJCA 1IGSA 3IGHX 1XF0A 1WO2A 2HV5A 2Z1BA 5CXPA 1JUKA 2C1IA 1A49A 3QHOA 3B4UA 3BK0A 4XB3A 1IZKA 1H7WA 3W24A 1ONWA 5C8BB 5H8MA 4BHYA 3UERA 4H6RA 3IARA 3A21A 3N13A 4GC4A 1UROA 2OTDA 1K3UA 4H2HA 4OUEA 5L6UA 4ASTA 3VD4A 3KRUA 1QATA 4GNJA 4OU1A 4M1BA 4O8RA 3FX4A 3VX1A 1DIEA 3N18A 1A5BA 2PDCA 3CTTA 1O5RA 5AZ0A 1V7AA 3IV8A 5AB3A 3W2MA 1BYBA 5JXQA 4XBJA 1R38A 3MY9A 4PEEA 3AWOA 4AHPA 1ZU8A 5AZ1A 1VHNA 4NYUA 4G7FA 3H12A 2X0HA 2VDGA 1MUMA 4GISA 3W7MA 3FJ4A 3U4AA 3GK0A 3NM1A 1FFQA 5EKYA 6ENLA 2OT1A 2PGFA 1J4EA 2IKGA 3S1VA 4IPLA 4EWJA 1JF6A 4D72A 4JCLA 2V5KA 3VIIA 3ZYZA 5HNTA 4ATDA 3B0UX 1PZ0A 4M19A 2WANA 4C6BA 1BQCA 4CU8A 4QAWA 1P6CA 3VIGA 2A3HA 2VR4A 4RE0A 4LAZA 1ESWA 1F6PA 3VNDA 3UF9A 3LCFA 5JH1A 4UOQA 2WW5A 4O19A 1ZB5A 1V8EA 3VD5A 3WDRA 1S2VA 1Z3NA 1BF2A 3BOLA 4JFTA 1CWYA 4JQ4A 3VOCA 1B2YA 5DQPA 1ZJAA 1GNXA 4W5UA 1BVNP 2FMNA 1TA3B 2XIOA 4FNRA 1YYAA 3H21A 4B5VA 4JIHA 1BGAA 1MFUA 3WLRA 2CZEA 1QO2A 3W76A 3K4AA 3APTA 1B9ZA 3TH6A 4CD5A 1V3MA 4B91A 5LKYA 4FX8A 1F3XA 3SQLA 3TYEA 3JZEA 2J4GA 3U57A 1S1PA 3LLXA 4CD7A 5KITA 1PDYA 3GXNA 4BWLC 1NVMA 2RHGA 5CSRA 5C9XA 2REQA 4AB4A 4JFWA 4O57A 5C6MA 1V7YA 4E4PA 2NXGA 2OOFA 4JAWA 5BWAA 4CQ9A 4GG9A 1ZP4A 2ATSA 3MJMA 4Y90A 4WKAA 4A29A 3EXTA 1Q6OA 1RY0A 4UZUA 1AMKA 2GJXB 4QLLA 3W01A 2WB5A 3SUUA 1Y7VA 3W74A 1E4LA 5A8GA 4MJZA 1CGWA 1AH4A 2V5LA 2PDYA 2NVCA 5DO8A 5LZLA 3B8DA 1VPYA 2C79A 4DAFA 3SO7A 4RLIA 2VUNA 3CUIA 2G3JA 3S46A 2H9AB 1A47A 3IUDA 4CCEA 3RHGA 1I45A 3W82A 4GPNA 3W7EA 2VD8A 5I3JA 1OD0A 4Z1BA 1E51A 3UP8A 5FJJA 1HNYA 4LY8A 1FWGC 5U4NA 3CUGA 2J7GA 1AW1A 4UUIA 3P74A 5AECA 3RU6A 1NY1A 2J66A 2V3FA 5FKYA 3L4TA 1SGJA 2GQ3A 3BLKA 4P8XA 1PXGA 3TC7A 2XFYA 2AMGA 3LA4A 1OFRA 2NSOA 1YE4A 4B90A 2A21A 3DHDA 2FJKA 1KBBA 5C70A 3SGZA 3GVRA 1RUSA 4HNTA 1J2BA 4KCVA 5HNUA 3UJRA 5JU6A 5A2BA 1F4HA 4CEXC 3ZVHA 4Q4KA 1RALA 1V0LA 2POTA 4IQLA 1RD6A 4NJKA 5IDIA 4FMVA 5I77A 1WA3A 3UJ2A 1QI5A 1ZTVA 5F4SA 2Q71A 3DC0A 1L6SA 3WN6A 5G5IA 4Q33A 4B5NA 4AU0A 1FUYA 4PTMA 1BYDA 1DIOA 2NT1A 1D3CA 1VBJA 5CPTA 3KM8A 2PF0A 3BVJA 3V5CA 3QMSA 1MUWA 4QQ3A 3DFPA 1KCZA 3UCCA 3WH9A 3LTYA 3GS6A 4UR9A 3W6YA 4CN4A 1LL6A 3HJEA 3WQFA 4P2VA 1KBLA 1WKYA 2Y61A 4M80A 3AXHA 4GY0A 3WF3A 3LCLA 4Q8NA 5AVNA 1SW7A 4FXFA 3UYCA 1YADA 3LZ3A 1E5NA 4C1LA 2ZA1A 2VXNA 1F73A 1DKWA 1HKMA 2FZMA 3BTNA 5IDZA 3IJ6A 3TC3A 5JBEA 2PP0A 4MYAA 1R2RA 2QCEA 5D09A 1O94A 1OZMA 4HSOA 3F2BA 3KAOA 3SCSA 2O56A 2O9TA 4FNTA 4AYGA 3HPZA 1P0DA 3UZWA 5FEXA 3UG8A 3BGGA 2Y7DA 3KOYA 3LS9A 3LCHA 3QZ6A 2G3MA 2NX3A 3EDKA 3SJ3A 3B8WA 3BMVA 3W6LA 4BA0A 4O54A 3ZT6A 1J18A 2R94A 4JTHA 2C0AA 1EDGA 2J9YA 2NQZA 5D9OA 4Z42C 1SJDA 1N7KA 1DEDA 1UD8A 1F3EA 3FLUA 5K7JA 3AQUA 1N8FA 1J0KA 1E3ZA 3PJUA 3UEQA 3W75A 2WPGA 2REQB 4K8EA 5D8WA 1RVGA 1TO3A 4N9EA 2OEKA 3V75A 1GEQA 3L0KA 1SZNA 3ZWTA 2BBFA 2C91A 1AL8A 3LHZA 3RO6A 4DWSA 4QE4A 3PBUA 3GBEA 3B8UA 1S38A 3LN3A 4MB4A 3G1HA 2PS2A 1DQWA 4MUZA 1J0IA 3FA3A 4LSBA 3LQLA 3UZXA 4C6PA 3MI6A 3F1QA 4QE1A 3WLIA 5HBFA 3AHYA 3M4HA 1YDNA 2B7NA 2OZ8A 4S3JA 3H7VA 2VHLA 5AYIA 3RM4A 1AZ1A 3PFRA 4GZ7A 4NRSA 4O28A 1VFUA 3AMDA 5LIKX 4A21A 3UZZA 3PR2A 3MYOA 4NU7A 4KFPA 4B9YA 3QM3A 1X6NA 1XIFA 3MANA 4GQRA 4UQCA 1H50A 3QYSA 4BZYA 3ABRA 1S5WA 1ZS2A 3L2IA 5FI8A 1FWSA 1UR3M 3A4JA 1TJ0A 4NZCA 4U5IA 5EFDA 4BI6A 3P7YA 2XGIA 4MY9A 3LUTA 2YDRA 4GK8A 1V93A 2FTYA 3URNA 4NXKA 2PTZA 3F4VA 4WOZA 2G95A 4AD0A 3DG6A 3DI1A 1R7OA 2J25A 1FKXA 4F4RA 2ZWZA 3ZVHB 2ZTKA 4Q8VA 1PTGA 4WCJA 2WZIA 2V5CA 4IMGA 3RFAA 1A0DA 3KWXA 3OGRA 2JGYA 4UQDA 2A5HA 3W1XA 4WJEA 4AIUA 1XBZA 2OLAA 3S5SA 1TPEA 1Q2RA 1IV8A 2PTDA 2QCDA 3FOKA 4GYJA 3I7SA 2GLKA 3M0LA 4IICA 2P8BA 4FX7A 1VPXA 2FFCA 2P53A 1NWSA 5D05A 3N1AA 4XBSA 4GVIA 4UTJA 3MKKA 1EJTC 3OU8A 1QHPA 3N04A 1G9HA 1KFWA 2QUUA 1K77A 4YCPA 4DO4A 3NDYA 4U10A 1SW3A 3IRDA 3IAQA 1VF8A 4DVOA 4GI8A 4RNHA 2J8TA 3O0KA 4RZ4A 4AMAA 1C91A 4LYQA 3HJZA 3UD6A 4I90A 3DU0A 3M07A 4B2DD 5HOSA 1W1TA 3WBEA 3W00A 4C6FA 3TW9A 4B5SA 4LV4A 3GHTA 1G69A 3GZ3A 4X3ZA 2W92A 4L6OA 1A50A 3AYVA 5A69A 3S47A 1HF6A 5ECVA 1FY6A 2P76A 2C15A 2H3DA 4C1KA 4TVCA 1JYNA 1WDQA 1R6WA 4MWAE 3O16A 2DUZA 1E0VA 1IWBA 1W1IE 1ICPA 1MW2A 2EPLX 2P10A 4X9YA 2IS7A 2VR5A 1J11A 1QW9A 2VWTA 2PPGA 3H6OA 3TQVA 4HZMA 4LF2A 3D6NA 1JCJA 3BSGA 4XTDA 3LGEA 2I5QA 3FYOA 4GZEA 1SFLA 1ZL1A 4E38A 1JG9A 3MHUA 4QG6A 4QLJA 3VDAA 1XPGA 4QCFA 4WDWA 3HQ1A 2WQPA 3TLQA 1W9XA 2PURA 2PDFA 1NOUA 4AZ7A 3TFCA 1NFGA 3PZMA 4GI4A 3H2NA 3H70A 1XYBA 5EL1A 1TRDA 1IQ8A 3LG3A 4GQQA 1E5JA 4J2MA 1BEUA 3QYQA 4HP5A 3IACA 1UZ1A 4GMEA 3ORWA 2A7NA 3TZNA 2BXZA 3TFXA 1SO5A 3LPFA 4PBEA 4IX0A 3CAKA 4JDYA 2YYUA 2YOCA 3FVMA 1XD1A 1V02A 2W63A 2C71A 2VRJA 1KA9F 4EIVA 1ISXA 1TE1A 1D8CA 3WQ8A 5H91A 3W22A 2XTKA 4CLMA 2E7FA 5CGTA 5J5DA 3W7CA 5BXPA 3WBWA 5HAOA 2VJXA 3I7QA 1FHDA 1GQNA 1EC8A 3B05A 4MYXA 1IEWA 4GX9A 4XAGA 2D73A 3M6YA 3UXDA 3WD2A 4D8ZA 4LAUA 4JOMA 3STGA 4XKYA 2GQ8A 1JZ4A 1PBGA 1IXNA 1GVSA 2C14A 1WE5A 2VVSA 3MMTA 3AIRA 1Q6EA 3SRHA 3RN6A 3E0LA 4O4WA 3WD3A 2UY5A 1JCYA 2YJQA 1TWSA 4HNOA 1QPQA 1EQPA 5CPMA 3CWOX 1NELA 2PWHA 4WLCA 3W38A 3AXXA 4NKCA 7ENLA 2P1FA 3OP2A 1R7AA 4PMRA 3WK3A 1UD3A 3UQNA 2VO5A 4K7YA 1EH9A 2PTYA 2ISVA 2AQWA 2GQAA 3CQHA 4AD2A 4EAMA 4P8WA 1IGWA 4H2CA 1FP8A 1R86A 3TOYA 5FJOA 4GH1A 2JFEX 4JTUA 4LOCA 4UQBA 4AD4A 1UW9A 6PTDA 3LD5A 4S3DA 4NJHA 3LI0A 1W1A1 4M6UA 5D30A 3FYYA 4LNCA 1JPIA 1T5AA 4OVXA 1EP2A 3PM6A 4GIEA 3KHDA 4HHHA 3UWYA 3C0LA 5MHBA 2EG8A 1ZALA 2WSQA 2CITA 2RDWA 1NDZA 3PBYA 4HNVA 1J5SA 1EO5A 1LL7A 3FKRA 3KOWA 3W2LA 3LM3A 4HMEA 2RGLA 3RMEA 2BB0A 4NJIA 3MJYA 1FTXA 1KLYA 2VCCA 1YIXA 3KZSA 1EXBA 1ISYA 1E0WA 2ZZ1A 4S3FA 4XZWA 1OFOA 4OECA 5PTDA 1ISVA 5FJUA 2DT1A 4D6EA 2Z29A 3LV6A 4GE8A 3G22A 4FHAA 1XRFA 1GUVA 1UKPA 3HGSA 3DGRA 4JKLA 1ONRA 4AZ5A 4EXAA 2DZVA 1ELSA 4UB9A 1MW1A 4PTXA 4D6CA 2GYIA 2AGTA 4W87A 3VVGA 3UJFA 4U28A 1CB2A 1AK5A 3RILA 1FCVA 4TR9A 5I09A 1OF8A 4JIRA 3JW7A 1PX3A 1TR9A 1V6WA 1RJPA 3THAA 1PHWA 2Q8ZA 4WY0A 2WYSA 3AMKA 1L8PA 3W7OA 3DHFA 2JQXA 4LCQA 3V4BA 8RUCA 4L6DA 2PTWA 2NUXA 4LFYA 4M6PA 3SURA 1EGVA 3LLDA 4XVEA 3K2GA 2OG9A 2CPUA 2XFFA 5F4WA 4N42A 3ZWSA 4XO7A 4OBSA 4NZ3A 5BWFA 3BOXA 4PCNA 3NM3A 3B9OA 1BRLA 1R2TA 3MBDA 1L2QA 4FAMA 2RDXA 1N55A 4LCSA 1PKYA 3GFYA 1TZ7A 4L7ZA 1C93A 3ES7A 3BLPX 2Z28A 3ES8A 2YDQA 2BOFX 4O11A 1BHGA 1GOMA 3PB0A 3IIOA 3BUVA 3PNUA 4AIOA 1O12A 2VRQA 1H4PA 3ENLA 1J01A 3BW3A 1A5MC 2VMFA 4PUMA 1ZBCA 4CQBA 2ZWYA 4W5ZA 3PBVA 3CQJA 4MNLA 1ZPTA 3QRHA 4HK7A 3FGCB 4XKYB 4DPQA 1PS9A 4AC7C 2JEPA 4U33A 1KRCC 1K7EA 3WMLA 1XH1A 3G5EA 5FF0A 2PDMA 4H04A 2J7EA 4PN2A 1WZAA 3B03A 2YXOA 4TVUA 3W7PA 1D7KA 1JFXA 4KGLA 5GPRA 2UY3A 3GXTA 5AHMA 4GIAA 3QC0A 3HTWA 4A8RA 4HCDA 3AZRA 1EP1A 3VIMA 2DDXA 2GSHA 2A3CA 2VI0A 5C2XA 3C8NA 1YLVA 1FWRA 4NJJA 2JKPA 1Q65A 3KTSA 2HCVA 1A5LC 3DECA 4IXXA 1LRTA 2WK2A 2PGWA 2FTWA 4PB5A 2Z00A 3PWIA 1SFJA 4PFMA 3CK5A 2VC6A 1SJAA 2V6AA 1U2YA 3A5FA 4RDVA 1YQ2A 3W3OA 2QDHA 1JFHA 2HDJA 2V3DA 4NILA 4E2OA 2NX1A 4IPJA 1F7BA 1L6GA 4GVHA 1E6RA 1TPH1 1F05A 2FJUB 1XDMA 2VZUA 4PMJA 4Z2HA 4MAVA 1OYCA 3DC8A 3MKCA 4IG2A 3FXGA 1OFDA 4I7WA 3NWRA 4QJ1A 3UA4A 3AAMA 3CUZA 3OB8A 3F03K 4IIDA 3R8HA 1GW1A 4FF7A 1W9UA 1FWAC 1CEOA 1XIMA 2YW3A 1M1BA 1Q8AA 2JF6A 1WZKA 3OZYA 3EPOA 4DUWA 1EZWA 2GWNA 1E6PA 4GI6A 5HUPA 5A95A 4D6HA 1XL9A 4H7VA 1IXQA 2XIQA 3PZQA 2Z1XA 1EGZA 3M5VA 1HJSA 2EHHA 3CAQA 4LAMA 4AVNA 3I6EA 2P50A 5I00A 4ML9A 1UJPA 1NDYA 1W32A 4XQ6A 2FZDA 3D5HA 1I1XA 5DT5A 2OSWA 2CIPA 2ZUVA 2VZSA 1SU5A 3KRZA 5E9XA 1HKVA 2VFDA 4C7FA 4ZSTA 1ECEA 4WY0B 3BOFA 1NH6A 5E6ZA 1XRSA 5F2IA 3A3HA 4I5RA 4DO5A 5DY2A 3STEA 3RCMA 4BR1A 4A4AA 1E9ZB 4REQA 4Y9NA 3FHQA 2UY4A 4F0LA 2JKAA 3LXCA 4LTSA 2D2JA 3NXLA 1FCUA 1MRQA 1FXQA 3K8LA 4XG1A 4C6QA 3QGKC 3QGVA 1A0CA 1DIDA 4F0HA 1W8SA 4EOUA 4AYSA 1VS1A 2QJNA 3SEPA 1BRLB 1UR4A 3LK6A 4GFSA 2E67A 3K8KA 3G1RA 1ZAJA 2X7WA 2WCGA 3ABXA 4WDTA 5ABFA 5BRPA 1LM1A 2XIMA 1IWPA 4BI5A 4O8AA 4JQAA 4WXZA 5CLTA 4O52A 3D47A 2DT0A 3W7NA 1XBYA 4EPDC 1O5QA 5CGMA 1OK4A 5AYXA 9XIAA 1J6OA 3MI2A 2IPWA 2YBUA 1UA3A 5D2XA 3NPXA 1DWAM 4QTGA 2ACQA 2ISFA 4G9PA 4ACZB 4R34A 5HQLA 1ICQA 2NLYA 3L4WA 2OVLA 1DE5A 1K6WA 2EPHA 2OKOA 1GVRA 3P61A 4ORIA 5D03A 5FOOA 4FO4A 3FKKA 4WJXA 2QULA 5A6LA 4WSJA 1BKHA 4PYSA 2E6FA 3CTLA 2G4FA 3L68A 4IGMA 5FA5A 5ENLA 2HZGA 3W26A 1A0EA 2A85A 1FWNA 3EMZA 4EF8A 4MNKA 1QHZA 1YPFA 3QQ0A 1KLZA 1RPKA 4Q7BA 1O60A 1VBRA 2A7PA 1E4NA 4YJ5A 2B4GA 1ME9A 1LLOA 1X7IA 1H51A 4LUSA 4WR3A 1M68A 2ZFAA 4IWWA 1FH8A 4IGHA 3IGSA 2QZRA 4NG3A 1OC6A 3NQ2A 1JNEA 4Q4RA 3UBPC 5DEZA 4TX8A 3SY8A 3WENA 3KVMA 1XYLA 2R91A 4H9MA 3THUA 1IEVA 2WJFA 3RLVA 1J93A 3QOMA 2X1SA 3W6MA 4YYFA 1EKOA 3M0HA 1UWIA 1AW2A 3NYZA 2FPTA 3N6QA 1UZHA 4R7JA 2B81A 1YW1A 3NO5A 2WKGA 2DFAA 4K36A 4UMBA 1TVLA 5A2AA 2XWDA 3AIBA 2A79A 1XICA 1KW1A 3P60A 2FMOA 1XLLA 1GW9A 3IJQA 3SUVA 2B7QA 5B7YA 5KMYA 4O1EA 4R85A 3DBPA 3GIYA 3AYTA 3KOXA 1E1FA 1EWEA 2VRKA 1XH0A 3E0VA 4Y6GA 2J47A 2DU2A 1MSSA 1FRBA 1QPOA 1UWRA 2PSNA 4KEVA 4J3WA 3H2FA 4XZIA 4TQTA 1G01A 2GSEA 1NARA 4DYEA 3TA6A 4GO8A 4PMUA 5DX7A 1GG1A 3E3HA 1T99A 3GDLA 4A2SA 4ZO7A 2HVNA 2BG5A 2E77A 2C0HA 4JL2A 3Q58A 4E2VA 3VD3A 3TYZA 4YYCA 3DIPA 3CS2A 4IMDA 1W9VA 4X9SA 1X96A 1Q4WA 3N34A 1TZZA 4Y96A 5EBUA 3P93A 1W1B1 1YNYA 2E5CA 2FGBA 3K30A 2WSKA 3O6YX 4P61A 3GTFA 2EPMX 3BG9A 3LNMA 2D2OA 3GHUA 1UKOA 2EJ1A 2YL9A 3G1YA 3OLDA 1Z6KA 4HYVA 3Q45A 4RX0A 1ODZA 3O8AA 3SQSA 3ZLGA 2JKEA 2WNNA 2EG6A 3H55A 1EP3A 1RCXB 2D20A 4B5TA 3COTA 3P3BA 2O4MA 4REQB 2OWCA 1Z7AA 1HFBA 1MQPA 5I3HA 5CCZA 3GD6A 3RM8A 3WLJA 1VGAA 2WVVA 1VQTA 5CZJA 3VGHA 4AG0A 2GJNA 1FKWA 3S42A 2VENA 1V79A 1E6ZA 2KX9A 4XD4A 3GTIA 3W71A 4V33A 3CEPA 4NX0A 4DLFA 3WNNA 5AHFA 3RRXA 4J3XA 3AIEA 1K9EA 3HV8A 5BOOA 4AW7A 2D2GA 1MI3A 4JIEA 2Q8LA 3EWUA 1F9CA 2BY3A 5ABFB 3WQWA 1HKWA 3GAKA 4O0QA 4W85A 2J24A 3WUBA 3WFLA 2V5BA 2VEKA 4DJED 3CHDA 1CT5A 3S3GA 4DBDA 3BDKA 2YW4A 3TWAA 3CB8A 3STCA 3DUGA 4NRRA 1TTJA 1FDJA 3VINA 4H41A 5D2TA 1PPIA 2G96A 3M64A 4OFCA 2GGJA 5HJXA 3M7WA 2PDNA 1E6QM 4TUFA 1RZMA 1YXDA 3BXWA 2OFJA 3DGBA 3M9YA 2E28A 2CZ5A 3P5ZA 4FP1A 5EMKA 1UH3A 3MMDA 5BXRA 4GIYA 2FB2A 3F4DA 4KIRA 3GHRA 2V38A 5I3FA 4WEVX 4DF1A 2OELA 3DX5A 4MKVA 4RZ5A 2V2DA 3RX3A 3TN4A 5CPNA 3F5KA 4P7RA 4UQEA 4C6EA 2ZC1A 4GINA 1WOAA 4A8LA 1C29A 5CC6A 3MSGA 4LUSB 3UVIA 1C8VA 1S2UA 5I3KA 1BG4A 5AC5A 3MUCA 3DHUA 2OU4A 2QR6A 1AZ2A 1UZDA 1DE6A 1IE7C 2BOGX 3FN9A 2RDUA 3BAWA 4TX6A 4HOZA 2YLAA 3TYDA 3PJTA 1H7OA 4EX4A 1NWUA 2DQXA 1VENA 2GK1A 2AOSA 5I06A 3R4IA 2Y8VA 4F0SA 4FOJA 2DEPA 1EUNA 4DJDD 1H09A 1Y0EA 1TWDA 2PGRA 1FDYA 4JTFA 4AC1X 5CZSA 1LP6A 3ARQA 3TW7A 2XH7A 3EOOA 1A4LA 7CGTA 3T2OA 4RW5A 3M47A 5G1YA 2JALA 3IIXA 4QAIA 4OV9A 4GXPA 1CXLA 1LOSA 1QMLA 1RQBA 5CSYA 4CNSA 3VKKA 3SCNA 1H11A 2DSVA 2TMDA 3GU1A 2QPUA 3OYXA 3CAVA 1XR2A 4UTTC 1B54A 3M5ZA 1S2WA 1FP9A 3SRDA 2XN2A 4XZLX 3JZUA 5FJRA 3CWHA 3TJ4A 3EX4A 4H9ZA 3W2UA 3ARPA 4CN6A 1K02A 2HS8A 3VABA 4HSHA 3WQ6A 3C2OA 5HMDA 4RDYA 1JQXA 5F2LA 2F6UA 4US6A 3CJPA 1QOXA 1KGXA 3BANA 2C1HA 1FWJC 4UOZA 4IIFA 2WHMA 2HS6A 2Q01A 1AD4A 2GVEA 1JEZA 4BY3A 1MO0A 4JTJA 1B9BA 3WQGA 1US0A 3HB9A 3THDA 2BHYA 3WH8A 1AODA 1HKIA 4GHRA 4J3VA 3QR0A 4UFLA 5FEZA 4DXVA 1N2VA 1K03A 2Q09A 4PUKA 3VE9A 2PLKA 2PDUA 1CGXA 1EF2A 4GQGA 2WVVB 2Z1KA 4K1WA 1JQVA 1DWJM 1YXCA 3VX0A 1AD1A 2YKKA 3ALFA 1SZRA 5FACA 2O9RA 3CZJA 1DJGA 4GA8A 2OSYA 1K4HA 4RUBA 3SUWA 1J12A 3WJZA 4D8LA 3BZGA 3I68A 4AISA 3OJGA 3WJWA 4DJEC 1EEPA 3NPWA 2I17A 3T8QA 3VOFA 1GQJA 2CFFA 3EDEA 1C8QA 4J7RA 2GVYA 1XISA 3GNXA 2QUTA 3LERA 1CGTA 3CXOA 4NAFA 3UG5A 1HG3A 1H62A 2GSJA 4CD8A 4H00A 1V6XA 3ZSSA 5D4YA 4O13A 3GM8A 1A5SA 2GOKA 4DZIA 1YE6A 1O5KA 3T0AA 4HKPA 4D8AA 4YIWA 4AHQA 1F6YA 4B5WA 3BSMA 3EPMA 2VFIA 4J3UA 4GX8A 3G1SA 4LB3A 3G2GA 1JRBA 4UC5A 5I03A 3EDFA 3ZOAA 5LSMA 3ZSTA 4HA0A 2FKPA 4ZQOA 4HBKA 4LBUA 2O9OA 3MSRA 1DHPA 3DFNA 3N12A 4QR6A 5CZ0A 2RH9A 1CPUA 2Z27A 3N2CA 5FD0A 3CLMA 4UNKA 5FAGA 4JHMA 2HWGA 3ARTA 1LQ2A 1AJ0A 2VYOA 3F7JA 5CQ1A 3W1LA 1EJXC 2CZFA 1UR0A 2BOEX 2Y6ZA 4IPIA 4DJDC 3WKZA 3VNKA 2GK1B 3L4ZA 5D04C 4JTGA 4OBRA 1U1UA 3L65A 1EUAA 1J6PA 4RPQA 3RX2A 4MGGA 1QWKA 1B90A 3AS3A 3GBDA 5T91A 2E9MA 2B0MA 3HGRA 2FDSA 3UZ5A 2WHLA 3MCOA 2E0PA 4LS0A 2OCZA 1E15A 3C0SA 2J88A 3W1NA 2Y63A 2BVTA 2NUWA 3ID7A 1WZLA 2DZBA 4KMQA 3DOPA 1EOKA 1AL7A 3N11A 4FXSA 1H5YA 1WUFA 3ERPA 3C2VA 2UV8G 1EJVC 5CZTA 3TUUA 1UR9A 1XBXA 4EXQA 5HWMA 5LA0A 1TV7A 1G5AA 1UWUA 1XD0A 4L9ZA 2XM2A 2QQ6A 2CKSA 3UWUA 2EO7A 2PDBA 4H8UA 3UWVA 3U2CA 1CX9A 3MZ2A 4ZEPA 1MQQA 4GOAA 4F40A 3IAPA 2I5IA 3OBAA 3RU8X 2BY2A 3WLTA 3GG1A 3VOHA 3CHCA 2PC8A 4PB4A 1KR1A 4YWSA 3C0JA 1ENUA 1W9DM 4QBXA 1WXJA 3AUJA 4LBRA 2BSLA 1LORA 1KWKA 3ATZA 5CPSA 3B8SA 3OVGA 3Q4DA 4POCA 1ZP3A 2XZ9A 3EOSA 3KFTA 3CL8A 3DFSA 3PFMA 3VIKA 4FF5A 4AMCA 4HU8A 2GUBA 3B8VA 1GQLA 4LXFA 3PAOA 3OHMB 3ANYA 4LVFA 4JPGA 2Y7GA 1JGMA 3KBJA 4O50A 3MQTA 4WQ6A 2VOMA 3VIOA 5JQ9A 3MVTA 1W3HA 1REQA 3ICJA 3UWEA 1DJWA 3U5UA 2Y89A 1I0BA 3WQCA 3CUHA 5FF7A 2GPTA 1X1OA 1FWIC 1DJNA 3AMCA 4XZ9A 1VKFA 4NL1A 1GOKA 1WXYA 3FS2A 1TV5A 4BWLA 1I2NA 2VEGA 5RUBA 2GUYA 3R13A 1G7VA 3MHGA 4O53A 3VKDA 4Q8PA 3KBNA 3MYPA 1OB0A 4QQUA 1IHIA 4UTLA 3EKGA 1BGGA 4JTIA 4MFDA 3W1TA 4J4KA 4AXKA 2RJGA 1J9YA 3GUWA 3V7PA 4NAFB 1GZGA 1R3SA 3ABOA 1EX1A 3WO8A 2E8YA 2FVKA 1EC9A 4WF7A 3S2NA 1GWJA 3VNIA 3APGA 1RK5A 4L1WA 3C0QA 3UGVA 1LOLA 4X61A 5G1MA 4DY1A 4X22A 1WX0A 2Q3OA 4US5A 3MPGA 2PAJA 2R1NA 3MUY1 5A6TC 4PTWA 1TTQA 3FIGA 1PB0A 4O12A 3L4UA 2BXVA 3LRKA 2F8QA 2WNZA 1GKQA 1Q8JA 2HBXA 5CBBA 4R5EA 1RBAA 4EP8C 5G4EA 2W4XA 1DWFM 4JHOA 1SPQA 2DGAA 3PF3A 4B3LA 3AYSA 3CHFA 3DG3A 3JS3A 1CLVA 1GJUA 1EYWA 1WDRA 3OA3A 1GVQA 4I9AA 4MPKA 1A3XA 2CHNA 4BFAA 3VGGA 3GH5A 3PULA 3BL3A 4WJ8A 2IKIA 1ZUAX 5JBFA 4CNPA 3VIPA 5C7VA 2IKHA 3KL3A 3F2CA 4UTWA 3QZEA 2DH2A 4IOTA 1JZ7A 3QV8A 4QEHA 3PZTA 1QTWA 3FA4A 1RBLA 3SCQA 3VKAA 3Q94A 4HPNA 4L5ZA 4ACYA 4ZL1A 4DI8A 4RXFA 1TRIA 1QNSA 4W93A 2P5NA 5HJLA 5ABHA 4G1NA 2XU2A 5HANA 3AO0A 1XYAA 2KAUC 4IP5A 2A3EA 3MP4A 3RX4A 3ITGA 3Q37A 1FWFC 1C7SA 1C8YA 1XSJA 3TYBA 2HTMA 1NDVA 1WAUA 3B40A 3VA8A 3SCOA 4Q4OA 3KUMA 4UQ9A 2E09A 2WPBA 3NQCA 5HR7A 2BASA 1JPDX 2X16A 2Y62A 1S2AA 3W7JA 5DBUA 3WF0A 1XGZA 4JXCA 4HOXA 3FA5A 1M7OA 1V0NA 3CC1A 3T6CA 1JDDA 1X1ZA 4OWGA 4JKMA 3ZXWA 3TP4A 2G0WA 4W9TA 3V18A 4HB7A 1CZ1A 2ZA3A 1KRBC 1DHKA 4QM1A 3E5PA 2QVNA 2VZOA 2WSYA 5GNZA 2OO0A 1A5NC 4M29A 1DBTA 3G1FA 4HHLA 4OGZA 2I16A 3AJ7A 4WY0F 3L4XA 4JTEA 3LCGA 2VFFA 4Z0JA 3NZPA 1RA0A 1BVWA 1KM5A 3IVSA 3GNNA 1TJ1A 3LPPA 3B0PA 5F1UA 3OQ8A 3UWWA 3TMQA 2ZVRA 3UWQA 4IX2A 3WQ4A 5LNWA 1UH4A 4B4FA 3M0YA 4IQEA 3CUFA 4GZJA 1NOFA 3FY1A 1EIBA 5K4ZA 3K4WA 1FBAA 3MSDA 3FSTA 2Z1VA 1REQB 1NQKA 1B57A 3HGJA 1OC7A 2D2HA 5FIPA 4ZBCA 3MWCA 3KCJA 1W1PA 2PWUA 2NV9A 1HKKA 1MW3A 2VT0A 1EQCA 3N14A 2PZNA 1OGSA 1WDWA 2NZLA 3TX9A 3EA1A 1VJSA 3SN0A 4FALA 3CH9A 1GORA 4O1FA 1FWWA 3QKZA 2ZZ6A 3ZLHA 3R11A 1M7XA 1UD4A 1JF5A 5M3WA 2CZDA 4C5ZA 5D8ZA 3LZ5A 4RDZA 4X2RA 4QRNA 2EPOA 2HQAA 3S83A 1GTHA 4CU6A 2HVMA 4W86A 6A3HA 1P0BA 3BAYA 4DUVA 1VEMA 1OBAA 5FSEC 1GKRA 3Q67A 3RCYA 4J27A 1JPMA 2ZVIA 1MVYA 2A2IA 3IJ7A 3A4WA 4BS0A 2A3BA 2F38A 1P0KA 5A6JA 1AQMA 2UBPC 5CSSA 4NZ4A 1OFAA 3R6IA 5C55A 4NVTA 3NIYA 1R47A 1TFVA 2QF8A 3NO1A 3Q65A 2BVYA 1XKYA 4GGHA 4Q8UA 1T0OA 3DXIA 3ANUA 3PHAA 2QCMA 3BAIA 3PVFA 2CKRA 2WMIA 1SJBA 3DEQA 3T0CA 3PK7A 3VYLA 2CLEA 3T0BA 4PMYA 1P7TA 5EMLA 1PYMA 2XYLA 5E0KA 2OGYA 3QXBA 3WDPP 4GNKB 4GWEA 1XLBA 1S5NA 3HM7A 3B3DA 3PUDA 3NOEA 3MZNA 4FLSA 1XP3A 2WKJA 2D3NA 4L64A 4D71A 4JNZA 3PN8A 1OCJA 3VCCA 1Q6DA 2PTXA 4JX6A 3STPA 1EA9C 1B4EA 2QPSA 4FSAA 4BCEA 3NL2A 5HK4A 1TUXA 5K9CA 4LCRA 3GNRA 1PVNA 2BTMA 3LCIA 3S2JA 3WF2A 2FH8A 2C6QA 2YCJA 3SY1A 1JJKA 5G2WA 3SADA 4R7WA 3CQ0A 4HN4A 1GVEA 4C60A 5DMMA 4QISA 1PIIA 3CASA 3WEOA 3LM7A 3L5AA 5E0CA 2I14A 4MADA 3MMWA 4DWDA 4AD5A 1F5ZA 5H6HA 4LUTA 2V0TA 3OYZA 2ANUA 1KB3A 3F2DA 1XIBA 3XISA 4CQ8A 3EXSA 3CYVA 1HVQA 1FHVA 1A5OC 3E96A 1U5JA 4QGCA 2WC3A 1ME7A 3NGFA 1KFLA 2VCBA 5A8QA 1XIHA 3UFYA 1QASA 2J75A 1VFSA 4FLQA 3II1A 3WH5A 3IVUA 3RR4A 3EEZA 3QEZA 2QUNA 3SN1A 5B7ZA 4W8AA 4DEFA 1UP3A 3VOIA 1VBGA 2GGEA 4LW7A 4K6AA 1OGBA 5I5RA 1SM9A 1SR0A 1QVBA 2TPSA 3KBVA 3T09A 1E9LA 4C91A 5H8UA 1DV7A 1JDAA 5A6MA 1H7PA 3N3TA 1EDQA 3BH4A 2EPNA 5F7UA 1XCFA 1W0MA 1XI3A 2CBJA 3KS6A 3NGJA 5I79A 5I3IA 1EO7A 4GO9A 3WLMA 2FHFA 2YIHA 3QY7A 4NP7A 4DBSA 4IXHA 2BLEA 2C16A 1QI4A 1W9BM 4H19A 2TYSA 4YHEA 1XYMA 4OOUA 2YGYA 4ZMGA 1SYTA 5BXSA 2POZA 3TJIA 2Z1WA 3TAKA 3NPVA 3KX6A 4FLRA 2R6OA 3DENA 2DZUA 4H9UA 1HVXA 2VP8A 3PANA 2PRLA 3S4TA 3EWCA 1J0ZA 1JPHA 1Q6QA 1JCLA 3KOFA 3W1MA 3KBWA 4Y9OA 2NQ9A 1XLMA 1QO5A 3N4AA 2ICSA 4OHQA 3RLGA 1TPC1 2Y85A 3PSWA 4MDPA 2BFGA 2RFGA 3RLUA 5TNVA 1TPB1 1XLHA 4AY7A 2XINA 2YBVA 4G1KA 1GGOA 5AYZA 1J5TA 3I10A 3QBUA 1QW7A 4N4QA 4JD4A 2E68A 2VGFA 3OOQA 3WD0A 2D0FA 2ZYFA 1RPXA 4N2YA 1E3XA 2FZ9A 2VZVA 3QY6A 3T1GA 4IMEA 3O6DA 4OZOA 4NUWA 3ZJ7A 2Z25A 3ZR6A 3L4YA 2BGNE 2X0SA 3K8MA 4G6CA 1XLJA 4WSHA 1POJA 2ABAA 2WMIB 3E2RA 2XHYA 4AX7A 3BAJA 2FZBA 4O17A 1T8QA 4OOZA 4I5XA 3N25A 1P7TB 3PJXA 3OW1A 4W7UA 3KP0A 3LPOA 4B92A 3GFXA 3NUKA 3W72A 2GDQA 4H6KA 2ZRYA 3OLIA 4AUBA 2Y7FA 2X41A 4ZZ9A 3CV6A 4B4HA 2CZVA 2Y5SA 3S5OA 1JAEA 3WCZA 4I5UA 4QE5A 1LRNA 3QLLA 2VFGA 4AWEA 3WD1A 4L61A 4IL2A 2HVOA 2E5DA 3MDWA 4ZB2A 4H9YA 3HFTA 3L0NA 3LNPA 4LUYA 1HKJA 2J13A 2XIIA 3GB6A 1FWTA 1F76A 1U22A 1SZEA 3S2LA 4WGXA 4MZ8A 1UR2A 5EMYA 4CUCA 5F1VA 3UXAA 2W91A 3UA3A 3KXQA 4PL1A 4LUTB 3SCUA 3TOPA 4DO6A 3AOFA 4JQ3A 3VC6A 1GVOA 3V5OA 1I6NA 3VUSA 1AJZA 4EE9A 2ZX8A 3NSMA 1UR1A 4OBTA 3KBSA 4B2DA 2YXXA 2XFWA 4KWVA 4YVPA 1BYCA 2FIQA 4QP0A 1XLDA 4BEQA 1GTEA 2J9XA 5BCAA 2EEXA 3PTMA 5JUVA 3I3DA 4NHVA 1BQGA 5HWJA 4H4IA 3WMCA 2WC7A 2QKFA 5C54A 2GJXA 1LOQA 2F6KA 5K9XA 2L5HA 4GXWA 4YTTA 2E5BA 1KGWA 2YXGA 3DH7A 2XZ7A 2BX7A 2E6AA 4H9XA 1WBJA 3HG2A 3SB0A 4LPCA 3EA3A 4PRWA 4DM1A 3S6DA 1TELA 3ARRA 4Z1YA 1Y8BA 2INZA 1J10A 1VIWA 5D33A 2Y7EA 3P5YA 2WVUA 1XHGA 4FX6M 3AJXA 2BHUA 2PI6A 3MUXA 1JDFA 1XX1A 1EXPA 3LENA 3IUHA 4KCTA 2BXYA 5LGXA 3PG9A 3S8HA 4IQJA 1JAKA 3MP5A 4Z0SA 3GVWA 4S23A 2YA1A 3DFYA 1MQRA 4ZE5A 3PZNA 2NW0A 2YCKX 4FIQA 4C6JA 4PRTA 3DZ1A 1D3HA 4HCHA 2QCNA 5G2HA 1G4SA 5M17A 2WLYA 1IXPA 3VGDA 1V3HA 1B1YA 3MCNA 1QXLA 1GYLA 4Z2JA 4J28A 1ZBKA 1KR0A 1W6TA 5DT7A 3M5YA 3KCLA 4Z2IA 5M2FX 3ITXA 3ECQA 4GFIA 1KFEA 1OCNA 4MG4A 3M7SA 5XINA 1C90A 1LZOA 4RXGA 2ZRZA 4LAOA 5BMXA 4LY4A 3WZ0E 1YDVA 1WDDA 2CNCA 2ZA2A 4J2PA 4Q3MA 4GZIA 4EF9A 2X1UA 3MC5A 3GC5A 2JK2A 4E3TA 1JYXA 2AAAA 3PUEA 2J9ZA 1JNDA 4MUPA 2FPYA 4D9PA 7A3HA 4UR7A 1XIIA 2EPKX 4PCFA 2F6XA 3QLDA 5LNUA 6CGTA 3TU9A 5A6AA 2ZZ2A 2QLYA 1KV5A 2QUMA 2UWFA 3PTQA 2XN1A 1ITCA 2VD9A 4CQCA 7TIMA 2E3ZA 1NWTA 1M9HA 2JIEA 4JTLA 1H60A 4A6GA 4MZYA 2O7QA 4GJIA 4MJ2A 3OZPA 3EB4A 5AFDA 2VGBA 2VVNA 4UCGA 1NFBA 2WHKA 2OR2A 4WDUA 1XWYA 1HJXA 3S6OA 3HG4A 4B5UA 1OGGA 4FPSA 4MY1A 1MW0A 4IPNB 5LA2A 2X42A 3HMCA 1YEYA 4C6LA 3GH4A 2R24A 3UGRA 4O1CA 4DPPA 3TVAA 2G3FA 1I2PA 3PPCA 2ZUMA 4ORMA 4IGNA 1P1MA 1O1HA 3TONA 5AC4A 4QROA 2QMJA 4F0RA 1V4YA 3KE0A 2J78A 2VX6A 5E93A 3ZT5A 2HEJA 3VGEA 4C6MA 4KWSA 4NT0A 4JS3A 3VZYA 3PUOA 1KXVA 2PDKA 3O9NA 1Q6GA 1BYAA 2OZ3A 3W88A 3H4GA 3V16A 2X30A 5I3DA 1X7FA 2NQHA 2QCHA 4UZSA 3SUSA 3OBEA 2GGIA 3LRLA 3GKAA 3QSRA 1TMHA 1P1XA 2F2KA 3G24A 4ROQA 5C0QA 3H54A 4HQVA 3TYCA 3ZJKA 3K1GA 3OLGA 3E12A 4JDBA 3RMJA 3BZJA 4JTKA 4ZENA 4GUGA 2J7BA 2JGQA 1H0IA 1L6FA 1UH2A 3GYEA 4JEQA 3OBKA 4GGBA 2IQDA 1GPWA 5FL1A 4IMCA 1VCGA 4GYPA 3W4RA 1V08A 2HJPA 1HP4A 8XIAA 1MDRA 2WJZA 4QLKA 2WZEA 4ICMA 1FOBA 1V6VA 3P84A 2QYGA 2R9RA 2AL2A 5LIYX 1WUEA 2UY2A 4FR1A 1VH7A 3BW2A 2CHRA 4E0CA 2XUCA 1DWHM 4MAZA 3G1VA 1CXKA 2DUAA 4MPQA 3POHA 3RGTA 3OO2A 5KTLA 2WC4A 3MU7A 5AYBA 1WNOA 2ZUWA 4AQLA 8TIMA 4WOQA 3T05A 5G1TA 3B97A 5D9MA 1VFOA 3PWGA 1YBQA 2DT2A 1BWKA 4WVXA 3U2ZA 4HA4A 4ZFMA 3TKFA 2PWGA 4ZB0A 2J79A 3LRMA 3K5XA 2F9RA 4I6VA 1UPPA 3LMYA 4MF4A 4O16A 3RAOA 1C3FA 4UTWC 3NR0A 3BCDA 3U7VA 1ITQA 3RXZA 4D6IA 4RZBA 1JVNA 1U5VA 2CW6A 1AA1B 3I3EA 3NDOA 4V27A 2RUSA 4E8DA 3W53A 4NX5A 1Q13A 3W7DA 4QSFA 1LBFA 1JYVA 1P4CA 2A1YA 1CI1A 1XQLA 2JE8A 1BSIA 1O95A 1W37A 3BG3A 4LBSA 3U8GA 2VR2A 2BGSA 3CUJA 2YBTA 2EG7A 1MDLA 3VMOA 3GSMA 1TPDA 3JUGA 5D37A 3DN5A 3R79A 2ACUA 3T4WA 3FJLA 1V51A 1W2VA 3T0DA 3WFZA 1NQ6A 5HWNA 3L4VA 4MLJA 4JX4A 2VGIA 1J2WA 1E71M 2QDGA 1BPLB 3WH6A 3F4CA 4XX6A 1ICSA 4ADSA 2P3EA 1TX2A 3ZR4A 4ZVJA 3IGUA 3W83A 3L66A 1NAL1 1Z89A 1QDSA 5HATA 3T4CA 3TN5A 4QJ4B 3L12A 3M46A 6XIMA 3HA1A 1R3TA 2V68A 1PE1A 1CLXA 5CKSA 1UR8A 3UY8A 1F8MA 1U30A 5DRCA 2WJEA 4FEZA 1ISWA 3HURA 3AMGA 5REQA 1LBLA 2XVLA 3O3RA 3L23A 2VX5A 1QNQA 4IIEA 1PX8A 4XUYA 4WX2A 3W1RA 1KTCA 1O5XA 1GOIA 2W3ZA 3VILA 4GKTA 2O92A 1CDGA 2WQDA 3QOKA 1VYSX 2QCFA 4X2PA 1E0TA 4HMCA 3S1XA 3TSDA 3RO8A 1POKA 5A1AA 4EPBC 1RK6A 4BQ5A 3UR7A 3CZ8A 2C8NA 2BY0A 2FTPA 3O0FA 2MUCA 2BZNA 1OQFA 4IFRA 3M43A 4D1IA 3PBGA 4JTAA 4DNMA 3CT2A 4UTHA 3MBFA 3NZ1A 2QV4A 4LVGA 1K8ZA 3ARUA 4M5PA 4QHRA 3P62A 2NQLA 3PPFA 4W8BA 3CZLA 2DJXA 1GOXA 2WM0A 4XV0A 4FK9A 4DELA 3NG3A 1Q6FA 1T7LA 2VDIA 3SCWA 4Q8MA 3STFA 4HSNA 3P8JA 4WKFA 3VD9A 2XWEA 4XZMX 5BROA 1RQHA 1ZENA 4TV5A 3ISIX 3PS7A 1TJRA 1XRTA 2AL2B 3EWYA 1FWDC 1G6CA 2J6VA 5DELA 1TTPA 4FLOA 1XCWA 3P6LA 1SVDA 3PWAA 1H49A 4W8LA 1XLIA 3WMSA 3M0KA 4U3AA 3BE7A 4FA3A 4M3PA 3GW0A 4UQAA 3AYRA 4RKAA 4IP4A 2YA2A 2GJRA 1YTKA 1CBGA 3HQOA 5CLWA 4JIPA 1YBQB 3CAWA 5CG0A 4WRHA 2DSWA 1LLWA 2KZHA 1Q6RA 4GRSA 1J0YA 1KFBA 4MJ4A 4YHGA 5HPOA 4MFEA 1R3YA 2DZTA 1H2JA 5ECUA 1UKTA 2ZX5A 1TB3A 3H2EA 1EA0A 4I9TA 2VM8A 2ZC8A 4Z2LA 1V0KA 2YCLA 3R0UA 3OGSA 5I07A 5HQEA 1P6BA 4XTIA 2DSKA 1OFEA 3PZIA 3N17A 3G8EA 1Q2SA 3N2MA 3ZR5A 2PBGA 1X8CA 4Q6XA 3GX9A 3VM5A 3CEUA 2P8CA 3KTCA 3GDTA 4YCOA 3BV4A 3QY8A 1GEHA 3GZAA 2G97A 1TPFA 5DCDA 1IR2A 4MNJA 4QXIA 4URIA 4C7GA 1UC5A 2YB4A 5M03A 4ZA0A 1U5HA 4HJFA 3MV11 2HXTA 1W1ZA 2BNJA 1AFSA 6ALDA 4XZBA 1JXJA 3KWSA 3F5LA 2CLHA 3QZAA 4AY1A 1TX0A 5HMFA 3NFUA 1GVFA 3GO2A 1H41A 1ZQ5A 2A6NA 4TXEA 3PSVA 2ZIDA 4M7SA 2DY3A 4MJMA 4V1YA 3GVGA 1FHLA 4HJWA 3W1PA 4L4OA 4RNFA 2A3LA 1XCXA 3I4EA 4GUIA 4I8DA 4TMBA 4QIUA 4GYKA 3SM0A 2WV8A 1HJWA 3R2GA 4X0VA 5BOFA 1LQAA 1BVZA 2VNCA 2V3EA 3S5NA 1X39A 2E8ZA 1TWWA 2NWRA 2QCLA 4Q4SA 1SZGA 3PC0A 1W3TA 1S3TC 3CZEA 3AZSA 2XFRA 2E1DA 3BGAA 2WMFA 1LUCA 2WWCA 4UXDA 5REQB 2RGMA 1DJXA 4RE3A 3TWBA 1UC4A 4JN8A 1Y5WA 4RV3A 3NL5A 4KS0A 3EAUA 1K9TA 3AIVA