1TJPA

Crystal structure of wild-type tryptophan synthase complexed with 1-[(2-hydroxylphenyl)amino]3-glycerolphosphate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
267
structure length
267
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title On the structural basis of the catalytic mechanism and the regulation of the alpha subunit of tryptophan synthase from Salmonella typhimurium and BX1 from maize, two evolutionarily related enzymes.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 99
structure length 267
sequence length 267
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2004-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1tjpA00
1ICPA 2X1SA 5D04C 5F2IA 5A5WA 4PL2A 3T44A 3HG2A 1XDLA 3ELFA 1O4UA 3MHUA 2YCEA 2V8ZA 4JDYA 3FOKA 4JDBA 3L2IA 1RVGA 5E93A 4JGDA 2A6NA 1C9DA 3CIXA 4ZVJA 1LZOA 2JKPA 3WJYA 5KITA 2NUXA 1M7OA 1TPVA 4ZQOA 3M41A 4Z0SA 4RKAA 3BK0A 4XTDA 1KM4A 1OFEA 1ML1A 5K9DA 4JYDA 2QUVA 2RH9A 1YDNA 2TYSA 1PCKA 3PBWA 4E2DA 4N2YA 3G1DA 3VKJA 3W7DA 3IVUA 3MW7A 2HS6A 3MBFA 1QAPA 1TCDA 3A5VA 4B5NA 4LTSA 2RKXA 5BMXA 4NJKA 1TJRA 3LCWA 2C14A 4FNSA 2J24A 3IIZA 3TSDA 3S5OA 2Z2UA 3PSWA 2OT1A 5CPOA 1MEWA 4NJGA 4A2RA 1ALDA 1XKYA 3E96A 5E1QA 3UZJA 3KHJA 4LC8A 1A5CA 3P74A 3QMSA 4WZHA 1IXNA 4UTUA 1TTQA 5D33A 4O14A 1N55A 2E09A 3S42A 3MP5A 3LCHA 2YGYA 1J2WA 3N2XA 3CIWA 3R13A 3TMQA 3HGOA 2Q8LA 1G4TA 1AG1O 3W83A 3DI0A 3P80A 3P61A 5F1VA 3GAKA 2ZZ2A 2A4AA 4FNPA 1B9BA 1KLZA 1VRDA 2WPBA 2BTMA 1O94A 1JCLA 1JCMP 1GYLA 3TMLA 2QCDA 4HPXA 5D37A 5AC7A 3G1AA 5FI8A 1SFLA 2V0TA 5G4WA 2E1DA 3PC0A 2VC6A 4LWWA 2ALDA 3STFA 1SZNA 2X1UA 2GPTA 2P0OA 5E0KA 4CQAA 2RHGA 1KFLA 4ADTA 4Y96A 3T4CA 1MZHA 4N6EA 3W6YA 2H6RA 4AVFA 3HB9A 3R5EA 5D05A 3LI0A 1Q6RA 3TJXA 3LRKA 2G95A 3TV8A 2OX1A 5IM51 4GJ1A 4I9AA 3UWQA 1BEUA 2V30A 4O0ZA 4RV8A 1WX0A 2NWRA 4Y6GA 3F4NA 4IOTA 2JKEA 2PE4A 1OABA 1JQXA 2Z6IA 5LNUA 2X1TA 2P10A 3IIVA 1KFBA 5J5DA 1GPWA 3NPWA 4MOZA 5G5IA 3QSTA 1QR7A 1LRTA 3NL6A 4O1DA 1JUKA 3M0ZA 3BW3A 4UFJA 3LX9A 2AGKA 3C3NA 4UTIA 1FWNA 2NUYA 3WK3A 4U28A 4CQ8A 4M5PA 4TU1A 3A5FA 1DKWA 4FHAA 3Q37A 1FWSA 1FCQA 2H90A 4BI5A 2Y85A 1ICQA 6TIMA 1GEQA 2FDSA 3O05A 4MY1A 5LNSA 1LOQA 2QCEA 4K37A 1LROA 5FEXA 2QCHA 1A5AA 4CCDA 2ABAA 3M6YA 5F2MA 4DO5A 1B3OA 2CLKA 5FEZA 3IIOA 4QSHA 4ZQNA 1UUOA 5K7JA 1T8XA 3TDFA 4PFMA 5AC6A 4K38A 1YYAA 2PCQA 1F6KA 4RLIA 2VXNA 5FEPA 4JNMA 1UBSA 4O18A 4RXGA 4XKYA 3STEA 3DHDA 3W2JA 2J6XA 3K30A 4RR4A 4MLJA 1Q6QA 2YDAA 3SI9A 1FUYA 3GNDA 2RFGA 4JIQA 4NXKA 4A3UA 5AHFA 1W5OA 1HFBA 4AMAA 4Z1AA 4MZYA 2ZRZA 3QMTA 5F4XA 3W7QA 4N6FA 2QCGA 4MUZA 2VFGA 3DFQA 4ADSA 3HGJA 4AXKA 1FQ0A 1J4EA 1G4PA 3NQ7A 2B7QA 3EX2A 2ISVA 3NQAA 5I3HA 4UCGA 5EA9A 5D03A 3NQCA 1GTHA 3ABSA 1P4CA 1W3IA 3BARA 4NX0A 2E6DA 1SFJA 3SFKA 4MY8A 2NLIA 1H7RA 3UWYA 1OG0A 4Y90A 4I7UA 4YMZA 4MIMA 2QUUA 3LHVA 3LHWA 3THQA 4N02A 1YTEA 1BKSA 3QPYA 3TE9A 4QISA 1OFQA 3DI1A 4O19A 1YDOA 3O6DA 4O12A 2J9XA 2NX9A 3PB2A 3STGA 5CSRA 3GDMA 3KOFA 4JTTA 1UUMA 1AW2A 3GR7A 3NL3A 1VGAA 3W1XA 3CLMA 1VLWA 2OJPA 3FJLA 3E49A 2KZHA 1YTDA 3C4UA 3NO5A 1AL8A 3BGJA 3GDRA 4O28A 3EX6A 1H62A 4N4PA 3SGZA 2PURA 2I1OA 3KXQA 4Q32A 4K8EA 3C8FA 5H2ZA 1X7FA 1U83A 2VENA 4MKNA 3YPIA 4IXHA 1SW7A 3ATYA 1P1XA 1XM3A 1RR2A 2WO5A 1W3NA 2C3ZA 3TJLA 3UPWA 1LP6A 1O95A 1PE1A 2A7RA 1KLYA 3SZ8A 4P61A 5CKSA 3RU6A 5HWNA 1P5BA 1RQBA 2V81A 4LUJA 4CQ9A 4Y8FA 3LV6A 2Z1BA 3QQ1A 3GZ3A 3CPRA 1R47A 4MFDA 1QCWA 5DELA 1VYSX 3IVSA 5I3GA 3HF3A 2A0NA 5U7SA 2J9ZA 3VI2A 4FXSA 3R2GA 4FNQA 3M47A 3CHVA 1O60A 1W37A 3BLFA 4ZQCA 4UFMA 3EXTA 4O4VA 4N9CA 2B7PA 3OVRA 2Y7GA 4BI6A 4Z0JA 3LHTA 4R53A 4TMCA 5C54A 2ZZ7A 2DZUA 3W1NA 2H8XA 3LDVA 5EYWA 1K02A 3L5LA 1K7FA 2FB3A 3W2MA 4AF0A 1NF0A 3EXRA 3MP4A 4O17A 3RNDA 4UR7A 3WJSA 3TUUA 5K9XA 1YXDA 5D2YA 3TCEA 1EUAA 2E6FA 3Q58A 4UTTC 4W9TA 4RZ6A 3EKZA 5K4ZA 3R12A 3DH7A 3G1FA 3KFTA 4S2CA 2XN0A 1GZGA 3G0UA 1EIXA 2PC4A 4MJZA 3TNOA 4IXXA 1HTIA 2B7NA 1FWTA 3MHGA 3C6CA 5EMUA 2V2DA 3CU2A 5EY5A 1OF6A 3TXVA 1EPXA 3DFOA 1S5VA 4CNOA 2EAWA 4Q4KA 1F73A 4MY9A 3W71A 1LRNA 4WY0B 2PRLA 4Z1BA 4UTLA 4I7WA 4IQLA 4NNCA 3BVJA 2NUWA 3M9YA 3W75A 4LW7A 1UB3A 3W7PA 1IF2A 3BO9A 4R7JA 1N7KA 4UMAA 1KV5A 3EX4A 3H55A 1QO5A 3WK1A 3BLIA 5LGXA 1OFOA 1H7OA 1ZCOA 1L6YA 1MSSA 5LHFA 3TU9A 3UQNA 4AH7A 3PUOA 3FJ6A 4M6QA 3BG3A 2RDUA 2V5BA 4IMGA 4OGZA 1DL3A 3GXPA 4JEQA 4OV9A 2EGZA 2Y7DA 2DU2A 3G0XA 3L5AA 1D3HA 2VFDA 1OVDA 4QNWA 2VELA 1KFKA 1Z41A 2OZ0A 1PHWA 3I7QA 4GRSA 3LBCA 1JJKA 1QWGA 1LLZA 3C52A 1O5KA 3IIPA 1LBFA 4R34A 3MI2A 1OJXA 4BWLC 3DZ1A 3SJ3A 3M5XA 1XBZA 2QCNA 2WNNA 4LS1A 4Z1DA 4UFLA 5AYZA 3IEBA 1Z42A 2Z6JA 5BNKA 4JTUA 4HN4A 4LRSA 1RZMA 4ZZ9A 3NQ8A 1L6WA 2OCZA 1EX5A 4IMFA 5FESA 4O1CA 5F4SA 1H1ZA 1RQHA 4QJ1A 1H7NA 5AYYA 3LTSA 1YLVA 5HUPA 4JS3A 5CG7A 4O16A 3H54A 4M19A 3HO8A 3HPZA 1I45A 3LCXA 1G4SA 3MI3A 3HG5A 5DY3A 2F7FA 5K2ZA 3O15A 1KM0A 1KM2A 3W1MA 4LNYA 1LBMA 3P62A 1G4EA 4O52A 1JVNA 2E5CA 3VFLA 1H50A 3HJZA 2HSAA 1W8SA 4D2JA 1F7BA 1YTKA 3S1UA 1WYIA 5CSSA 1SPQA 2ZZ3A 2FFCA 1UASA 4MVAA 4AAJA 4YL2A 1Q45A 3LTPA 5HMSA 2QDHA 2ATMA 3B05A 2BWGA 4JTHA 3USBA 3TW7A 3W7GA 2ZA2A 4FIQA 1HG3A 3W2UA 3IV3A 4FNRA 4UIOA 2ZZ4A 2BX7A 4X3ZA 4IMDA 2DP3A 3NPVA 2VOMA 1AK5A 3GB6A 4RJEA 3M7WA 1Z44A 2ZQ0A 4L4MA 2DZXA 2QAPA 1H7WA 3MYPA 1TQXA 4CCEA 4QQ3A 3BLEA 5KZDA 2ZZ5A 3KX6A 2GQAA 3LERA 2CZDA 3LV5A 3BW4A 5DCBA 1GTEA 3P84A 1OFDA 4BFAA 5SWUA 1TPFA 2ZBTA 3NAVA 7TIMA 3TC7A 3NL5A 1IGSA 3KVKA 5CGQA 2CLFA 3JRKA 4HNVA 2A6LA 4LT9A 2VEMA 1TIMA 3ZFHA 2YZRA 1JCXA 2H3DA 3O6YX 4NZJA 1AL7A 1KV8A 2DZSA 3S1WA 2NXHA 4JYEA 3INPA 1GG1A 3ABRA 3ZWTA 2R14A 2V2CA 3P7YA 4FNTA 3EWZA 1VJIA 2TPSA 4QITA 3O16A 4N9BA 4MZ8A 3PF3A 3GVGA 4WUIA 3NXFA 4X9SA 4NNBA 5HULA 3NDOA 5CZTA 4HHPA 1TV8A 3N34A 3NL2A 4O0KA 3MUXA 1OX6A 2QJIA 2GJLA 1SZGA 2ZA3A 3EB2A 3ANYA 3GYEA 3JS3A 3QZEA 4OWGA 4OE7A 4NT0A 1QOQA 3BW2A 2TSYA 1QFEA 3GXTA 4M7SA 4EVZA 4NJHA 3W7RA 2G5WA 3ABOA 3HPXA 4A21A 1LCOA 1W1ZA 3FS2A 2YXGA 1X8FA 4M7TA 4N9DA 1YADA 1BWKA 1VPXA 2EKCA 1E51A 3PBUA 2Q3OA 2YFNA 1BTMA 3QF0A 5AB3A 2X16A 1PIIA 1FY6A 3P5ZA 3G3MA 5D32A 3DFPA 4O1AA 5D09A 3UWUA 2GOUA 2QF7A 4XBSA 2OMAA 1TTIA 2V2HA 3NPXA 5D02A 3HQ1A 2WNZA 4BF9A 3LCIA 1FDYA 4UTJA 1F74A 3W85A 5K3VA 4G1KA 4UR8A 4JN6A 1KW1A 3NYZA 3W7NA 3NM3A 2DZPA 2Y63A 1XI3A 4HPJA 4LOCA 4KFPA 1QPQA 1K7XA 5AHEA 3OG3A 3IRDA 4FIRA 5DN1A 1D9EA 5LNWA 1OYBA 3CB8A 4PODA 3FKRA 3W9ZA 3W7IA 3H53A 3E12A 3R89A 3B04A 4NU7A 4PC8A 2ATSA 1H7PA 4UTTA 4UTHA 1IIHA 4A22A 3P67A 1ZAHA 5C5YA 2GJNA 4WX2A 3NQFA 5D2XA 2TRSA 2A7PA 4O50A 3W7EA 3LI1A 5AHLA 1KA9F 4JTIA 3CT7A 4C1LA 3NR0A 2C0AA 4QNEA 3DFTA 3KVLA 4N9EA 4JICA 3PVFA 1SSDA 1VCGA 1EP1A 1ME7A 3EWYA 4UFIA 3U2OA 1OK6A 5HWJA 1M7PA 2AQWA 1KM6A 3W2KA 2Q3RA 4FO4A 3QFEA 2NX3A 1AW1A 1OX4A 4JX6A 5FF3A 3I65A 3FYOA 1YPFA 4FX7A 3D0CA 2QDGA 4TR9A 3E0IA 3I68A 4UUIA 4YWIA 1KTCA 2QEZA 4GFSA 1FDZA 4DBDA 2ZFAA 1KTBA 5D2TA 1M5WA 3UNDA 4YCOA 3S1VA 2PRMA 4O53A 3MWAA 5HUOA 2FQIA 1OF8A 4NUWA 2I14A 3QRHA 1VYRA 1KBJA 3C2RA 3S9YA 1OHLA 1LLWA 5D2VA 4LUIA 2CLLA 1X6UA 4BWLA 3ZWSA 4GWEA 3W74A 3W73A 2IQTA 4LVDA 2ZTJA 1DQWA 5HWMA 3W07A 3W84A 1Q3NA 1TRIA 1W54A 5KINA 1VR6A 2GQ8A 1TYGA 3WJWA 4WD0A 3W1PA 1ONRA 5T26A 3HBLA 1AW5A 1NEYA 3L9CA 4DO6A 1R2RA 4FB7A 3F1QA 3LM7A 1C8VA 4O15A 2QCCA 4IPJA 4XQ6A 4O8RA 3NA8A 2W0UA 4X2RA 2QJGA 1FBAA 1LYXA 3M43A 1GT8A 2GVJA 3A24A 2BXVA 3N9RA 4OT7A 3UYCA 1JULA 2WSQA 5HNRA 4ICNA 1PCWA 3BGGA 4UTWA 5AFDA 1ME9A 5C2XA 3SSJA 2Y88A 1EB3A 3ATZA 1HUVA 1N8FA 2QCDB 1ZHAA 3GNNA 4JX4A 3QEZA 2VKZG 3W7MA 3GKAA 1XFBA 1G7VA 2A2IA 5I3FA 1H1YA 3GXNA 2Y7FA 4POCA 4H3DA 4MZ1A 3HMJG 4LV4A 4E2BA 4ZMGA 4O11A 4K8HA 5BRBA 3C2FA 2YW4A 4O10A 1F05A 4ZQPA 3W1TA 2CLOA 4M6VA 3DHFA 3LB0A 1A53A 3W1UA 1VLIA 3P5YA 3TAKA 4DPQA 1H60A 5KTLA 1W3TA 2WV8A 3N3MA 3WJXA 1B4EA 1EEPA 3EX3A 1RPXA 1R2TA 3S6DA 1A5BA 4MYAA 1NFBA 3P81A 3IGSA 5DLCA 1W31A 3LRLA 4RZ4A 2LLEA 3G22A 2H3BA 5C55A 3DKJA 3EWXA 2G97A 2GVLA 1J5TA 3PUEA 4CNPA 4AHPA 1K8ZA 3M5ZA 4AB4A 4QM1A 4HSOA 1LBLA 3M1ZA 2CLMA 4PCFA 4O57A 2B0MA 5DBUA 3OIXA 4YXGA 2JBMA 2R8WA 2TMDA 4OQVA 3W7LA 3W7CA 1R2SA 1GOXA 4GUIA 3STCA 3UWWA 2WSRA 3S8HA 3RMJA 4JTGA 1PL9A 2ZCGA 4S1FA 4Z08A 1VYPX 2A21A 3DBPA 2C16A 3GDKA 4JTJA 2HS8A 3O6CA 3Q2DA 1FCBA 3W70A 4MYXA 5DXXA 3QQ0A 3NGJA 4CCCA 1GWJA 3L0KA 3QSRA 1QDSA 4KWVA 3OA3A 4DO4A 1FX6A 4XKYB 1NSJA 5TIMA 3HGRA 3TKFA 1YDVA 5EKYA 3KVMA 2NX1A 4NJJA 5KSWA 3N2MA 3VNDA 2VEIA 4RK8A 4LS2A 3HG4A 4Z1CA 1XCFA 1DVJA 1IXQA 3N19B 1TPDA 4GUHA 4ZQMA 5HJLA 2J9YA 1DHPA 1IIGA 3PUDA 1I8JA 1OFRA 3ZR4A 3W1LA 1T96A 5K9CA 1K3UA 4JY8A 3LGEA 3U6WA 2A1YA 2HTMA 3W76A 1WBJA 1XBXA 1F2JA 3W7JA 1QPOA 2WNQA 3HOJA 1Q6LA 1HO4A 1NVMA 1P0NA 1OK4A 1OFBA 3O07A 1FCVA 3GLCA 4JTFA 5BW6A 3E02A 1QNVA 1GVFA 5AHIA 3DGRA 2WOQA 3VE9A 3W2LA 4YLWA 5ABTA 1R30A 3ZS4A 3DENA 1F5ZA 4JR5A 2Y6ZA 2R91A 3HGSA 3L0NA 3TROA 3MJYA 3ABQA 3FA5A 1ZAJA 2C13A 1TREA 1EUNA 5DXYA 1LM1A 3TAOA 1W5QA 4JTKA 1L9WA 3T55A 3TQKA 3W23A 4DQWA 4Q33A 3G1YA 3M44A 3L0GA 4IX0A 1LORA 3N14A 2YYTA 4GUFA 3W87A 1TPH1 3W7KA 2E5DA 3DXIA 4TIMA 4EOUA 2EHHA 2FPVA 1ME8A 3QW3A 1WBHA 3EWWA 3DU0A 4U4MA 5BOOA 3NQDA 5G2IA 1CW2A 1BWLA 3LTYA 5LKYA 4O1BA 3KAOA 3TH6A 4AHOA 2FPTA 1XXXA 2YSWA 2YX0A 1UCWA 2YYUA 3VE7A 5D2WA 3LLDA 1G7UA 1SO5A 4FXRA 5CPLA 1MEHA 2WQPA 1MXSA 2WSYA 4NQ1A 3G1SA 2Y7EA 5G4EA 3B03A 2CU0A 3MBDA 1F76A 4KKXA 3CM4A 1XBVA 1YXCA 3CWOX 5AN7A 4UTWC 2G96A 1OFPA 1W5MA 3W72A 4P2VA 5G2WA 4GUJA 1W5PA 2XN2A 4K7YA 3T78A 4NNAA 1PV8A 4GC4A 3TK7A 1OX5A 1QO2A 3NZRA 1DJQA 3LBMA 3CQ0A 4FNUA 4J9JA 2O7SA 3T7VA 1ZY9A 4EIVA 1RD5A 3F03K 1H5YA 1XBYA 4AF0B 4PL1A 1S5TA 3PWAA 2NV1A 1XDMA 2OT0A 1K03A 3RLVA 4BI7A 1DV7A 2ABBA 3G8RA 2YW3A 3UY7A 3PBYA 3OHIA 5L6UA 1CX9A 4WOZA 3IGUA 2DZWA 2VEKA 1XL9A 3NNTA 3QM3A 5AYXA 5U4NA 5IBXC 2ISSA 2Y61A 3L68A 5BMWA 3O1NA 3OVQA 1HL2A 4KWWA 1QOPA 2BLEA 3QMRA 4A2SA 4WQ6A 3NQEA 5I3IA 1M6JA 2VFIA 3TSBA 3HIJA 3S0CA 3NQ6A 1OFAA 3M5YA 4ORMA 2QR6A 4FX6M 1I2OA 3GAYA 1A50A 5CZ0A 2FLIA 1I2QA 2C18A 3G24A 4XUGA 2FB2A 2VEPA 5KZEA 2X30A 4PH6A 3O06A 1GVQA 1H63A 3SW6A 3LXBA 1ICSA 4UFKA 5TBOA 2Z0IA 4RX0A 2YPIA 1GQNA 2JGQA 2ZRWA 3IVTA 1SW0A 2E77A 2GQ9A 3L65A 1SO4A 1A5SA 5LNRA 5TQLA 1C29A 3EXSA 4GUGA 1DBTA 3PBVA 5F2GA 3B0UX 3V75A 4K36A 2JK2A 2CZ5A 2H8ZA 4UMCA 1JUEA 1VHNA 5F1UA 2I9EA 2DJXA 3I7RA 2FIQA 4OV4A 3BPWA 1TSIA 3G0SA 4L4LA 2ISWA 3I6RA 2B4GA 2GVGA 2ZRYA 5HR6A 3R8RA 1KFCA 2WJZA 2VFEA 4JY9A 1ADOA 3EKLA 3PAJA 3LCGA 5DCEA 3LRMA 1VQTA 4K39A 4UTKA 4GBUA 4H6KA 4WXYA 3I7SA 2ZTKA 4MPQA 1XUZA 1LRQA 3UPBA 1EP3A 3WK0A 1WDWA 3O8AA 5D38A 1CI1A 3W2NA 3S5YA 4KFOA 4DEFA 3TQ0A 1WOBA 2CFFA 2BSLA 1KM3A 4O54A 5J5RA 5CPMA 1JR1A 1Y0EA 3RLUA 4RZ5A 1VZWA 1FDJA 4DF2A 4WXZA 3L5MA 1DOSA 4TO8A 2NV2A 1VHCA 1OYAA 2E68A 3LHUA 1GVRA 1K8XA 4GXMA 3C2VA 1L6SA 3CEUA 3AO0A 2UV8G 3PULA 3G1VA 4DF1A 1SR9A 4UNLA 4PTNA 2CZFA 1SQ7A 4JTLA 2QAFA 2PRHA 3MYOA 3IGXA 5AHNA 1V7YA 2FTPA 1F6PA 2D73A 4DELA 3B4UA 4JYFA 1SSGA 1QPRA 3NVTA 1G6CA 3G18A 1Z48A 3NG3A 3NQGA 3NEVA 1PVNA 1WV2A 4LVBA 1H51A 3SY5A 3PS7A 3FIGA 2RDTA 1THFD 3KRUA 1SU5A 4HKPA 1K8YA 1OYCA 3THAA 2ZRVA 3QW4B 4HNTA 1JUBA 4AHQA 3TXZA 4OHQA 1MO0A 3BG5A 4FF7A 1S5WA 1L2UA 5I3JA 3EWUA 2E5BA 1SZEA 3P82A 3PB0A 1QPNA 2F84A 3TQVA 3UD6A 5KZMA 2QUTA 5KMYA 5FF4A 3FYPA 3QPZA 5CPNA 2CZEA 1TPUA 1W56A 1YXYA 1U5JA 2A7NA 4OBTA 4ZQRA 5CZSA 1I4NA 3SR7A 3MO7A 4FEZA 1TPWA 3TX9A 1R46A 4LVGA 2J88A 5FF2A 3MP3A 4LVAA 4XWUA 2CLEA 2QCLA 2QKFA 5EL1A 1JCNA 4IUOA 3W22A 4LS0A 4JIPA 2CW6A 1FWWA 3W1AA 4BR1A 4QAIA 1SO3A 1FXQA 5AHMA 4UXDA 4XBKA 1ZJIA 3TIMA 3QH2A 3PG9A 2ZZ6A 1LDCA 1KBIA 1DQXA 1TB3A 3MI6A 4AWUA 2HMCA 5H91A 3SECA 3FKKA 1GYNA 1T99A 1K7EA 3CTLA 3NOEA 4WY0A 4LRTA 5G2HA 1X1ZA 1WXJA 4IMEA 2XN1A 4XZ9A 1VCVA 1WOAA 1JCYA 4LC6A 3W3OA 4NZFA 3W86A 3DAQA 2V82A 4LY8A 4M6PA 1IXPA 1WQ5A 1WAUA 2B7OA 4O13A 3FFSA 4EF9A 4IGHA 3T40A 4TX9A 3QYQA 3W1RA 5AOUA 5EBUA 5LHEA 1EA0A 4GNJA 4HSNA 1W5NA 1S3HA 4JTSA 1VC4A 4ML9A 4KFNA 3NPUA 3TFXA 5L9FA 3OVPA 4MJMA 2VFFA 5HINA 1H61A 3LHYA 1V5XA 4IWWA 4E38A 5LGZA 3GDTA 3SIZA 3CC1A 3B06A 1KTNA 4AEOA 5F2LA 5AC8A 5I3KA 3A9IA 2YR1A 1GJPA 3AJXA 1LOSA 4K7VA 1FWRA 3LOTA 4WY0F 3DFNA 1TPEA 4DBEA 4JX5A 3N73A 2R94A 4ONVA 4NXSA 3LXCA 1RV8A 5DCDA 3TA6A 3RF9A 3C61A 3EX1A 1YPIA 4IPIA 3PR2A 4MLRA 3LHZA 4IX2A 4JD4A 2EF9A 2VFHA 2EPHA 3G1XA 1VH7A 3NZ1A 1PHQA 1O5XA 1GVSA 2C15A 4UC5A 2FPYA 3L66A 4QIUA 3PM6A 1JCJA 5LSMA 3HG3A 3O63A 2C6QA 3N9SA 5IBXA 4JTEA 3UWZA 4Y9AA 4ADUA 2NWSA 2ZZ1A 4NJIA 1VCFA 3TR2A 3M16A 4A29A 3FEMA 4RCXA 2DORA 4UNKA 2RDWA 1NAL1 5EPDA 3UXDA 4X22A 2X2GA 2E6AA 1RQEA 4O4WA 2E6YA 2ZRXA 3A21A 1OX4B 1EWEA 1XUUA 3MHFA 2CLHA 4N4QA 1AMKA 4AWTA 3NQVA 2JKAA 3B0PA 1UJPA 2YFOA 3C56A 5HR7A 1XC4A 3E9AA 3SGUA 2QJHA 1D3GA 4IJBA 3U8GA 1I2NA 1X1OA 2ZDRA 2ZA1A 3EWBX 1GVOA 3W7HA 3PSVA 4H4IA 1ZENA 3IIXA 3DFSA 3KRSA 2BZNA 5A8GA 3B8DA 5F4WA 3BV4A 1PS9A 3CWNA 1MEIA 4EWND 1SUXA 5D30A 4EF8A 3W88A 1EWDA 4HT3A 3TSMA 5LNVA 2V9DA 4AWSA 1TV5A 3RFAA 3W1QA 4HNUA 3WFAA 4ZL1A 3S1XA 3PG8A 3W7OA 4K6AA 3JR2A 1KM1A 3C2EA 1WA3A 3P8JA 1KM5A 3V1PA 2NXIA 1KFJA 4PEKA 2AAMA 2Q8ZA 2C1HA 2O7QA 5CZJA 3NQ2A 5FF0A 8TIMA 3GX9A 3S5ZA 3TC6A 2ZYFA 4YCPA 4XTIA 1LOLA 3KVJA 1KFEA 4HIBA 1W0MA 3Q94A 1I2PA 1G69A 3RK8A 4IMCA 4C1KA 1TRDA 4LU0A 4WJEA 1B4KA 3L67A 1NF7A 1ZFJA 3F4WA 2Y70A 2A85A 1SW3A 5K4XA 2QCFA 5C6MA 1TPC1 4UFHA 1TMHA 2X1RA 3LCFA 4NX5A 5G1YA 3FLUA 5G1TA 5HQEA 3UY8A 3L21A 2W79A 2J27A 3CEPA 4UMBA 5DBTA 1JQVA 2DZTA 5FEWA 3UXAA 2FJKA 2V5LA 3A22A 1I2RA 4CLMA 3LXAA 1JRCA 1LTDA 1VS1A 4HNNA 1B57A 4WOQA 4NVTA 2DZVA 3G3DA 3OEXA 4LVFA 3P8IA 3BG9A 3GKFA 1Q6OA 4DXVA 4ORIA 3B0VC 3MMTA 2DJLA 2NZLA 1TTPA 2ZRUA 4DPPA 4OU1A 2JGYA 2QCMA 3PY2A 5LZLA 3QC3A 3GK0A 2Y89A 2CWNA 4E0CA 3WK2A 3G8EA 4I7VA 1G67A 1SO6A 1JRBA 1EP2A 4TMBA 1ZAIA 3GR8A 1ZALA 5DY2A 1QMLA 3GIYA 1SZFA 1TJPA 4ALDA 3DKLA 1TQJA 4S2BA 6ALDA 4PA8A 1IXOA 1DJNA 4LV9A 3GDLA 1HO1A 4JXCA 1ZNNA 5FF7A 3EEGA 4GE8A 2P1FA 1FCUA 1TO3A 1P0KA 3OBKA 2WKJA 2GUUA 4CNNA 4RXFA 2A5HA 3UWVA 5GVJA 3TFCA 4R33A 4FX8A 1H7XA 5MHBA 2W6RA 3NM1A 3QJAA 1T0OA 2C19A 3KRZA 2XFWA 3VCRA 3LLFA 3P60A 4BK9A 3C0JA 1GG0A 1DORA 3TW6A 3LCLA 3A23A 3M5VA 1FXPA 3G1HA 3S5NA 3WJZA 2CLIA 2NXGA 4MFEA 3C2OA 3NQMA 4DF0A 3UZ5A 2Y62A 1TTJA 3HPSA 1TV7A 4UTMA 1TPB1
chains in the Genus database with same CATH superfamily
1HZYA 3MWCA 3PZIA 4PL2A 3T44A 1O7AA 3GTHA 3ELFA 2EG7A 4IISA 1ISZA 5CZKA 3FOKA 5JVLA 1DIDA 4ZO7A 4YU1A 3VCNA 2OSWA 3SDOA 2X42A 2A6NA 2XG9A 1OZMA 3CIXA 5EFDA 3EBVA 1QT1A 1LZOA 4XK2A 5I6SA 4FOJA 4LY4A 4IIDA 2P50A 2UY3A 3CWHA 1NFGA 1TPVA 3BK0A 5G1MA 3WENA 5K9DA 1WXYA 4JYDA 4IJRA 1YDNA 4HYVA 3PBWA 2CWXA 4CCZA 3HPAA 4Q8VA 3W7DA 2C71A 2HS6A 2Z1KA 1QAPA 4GVHA 1AJ2A 3GHSA 2C79A 4LYQA 2DT0A 2C14A 4FNSA 3TSDA 3S5OA 3CUJA 1CXHA 2ZUVA 1Q85A 4NJGA 3AXXA 3GFXA 5FL1A 1MW2A 3KHJA 5FAJA 3P74A 1FKWA 2VCCA 2WCAA 2Z4GA 4QGCA 4UTUA 4QCFA 3VIPA 4HQVA 1MRQA 3T42A 2REQA 4GJIA 1LT7A 1J2WA 3UU0A 4Q4QA 3TMQA 3DG7A 1HJQA 3HGOA 4B4HA 1G4TA 3W83A 4JQ2A 1KCLA 3AUJA 1NWRA 3TYUA 4AD3A 2A4AA 1LWJA 4XO7A 1FWIC 1B9BA 2WPBA 2ACUA 3GHTA 1PZ1A 3NJ3A 3E3HA 4HPXA 2DY3A 5D37A 1W1A1 4W5ZA 2DIEA 1WZKA 1SFLA 3AROA 3TP4A 3PC0A 4JTQA 2W66A 3BLPX 2I7GA 2ALDA 4LWWA 4NRRA 1SZNA 2P0OA 4LNCA 5E0KA 2A3EA 3OLEA 6REQB 3A3XA 1MDRA 3U9IA 4N6EA 4A3RA 3AXKA 4AVFA 3BCDA 5D05A 1EYWA 1V3LA 2FJUB 2D24A 1OC7A 1CLXA 4HTYA 3UWQA 4F40A 2V30A 2EJAA 1QK0A 4IOTA 3GUGA 4HTBA 1OABA 4Q7NA 1JQXA 5LNUA 4W85A 1ZJAA 3URQA 1KQZA 3NPWA 4H9TA 5G5IA 2J25A 1QR7A 4O1DA 4H9XA 1JUKA 1WUFA 3ZVHA 2PP0A 1VRXA 4MWAC 3N2BA 4ZTYA 3WK3A 1NELA 1DKWA 4US6A 3Q37A 4WJXA 5DF0A 1E6PA 1EC7A 1FCQA 2H90A 6TIMA 2FDSA 4MY1A 4K37A 1GJUA 3GC4A 3M6YA 5TF0A 1B3OA 2HBVA 2CLKA 3IIOA 4QSHA 3C5QA 1UKQA 4H9YA 1UUOA 1T8XA 3WQEA 3CLWA 1IWPA 2VXNA 4B90A 5FEPA 2Z1VA 1UBSA 4XKYA 4RXGA 3STEA 2ZKMX 3W2JA 3K30A 1Q6QA 3PFRA 3AMDA 2RFGA 2ADAA 4A3UA 3KCOA 1W5OA 2BOFX 2HWGA 4AMAA 2ZRZA 4R9XA 4N6FA 4MGGA 5D4YA 3DFQA 3I4EA 1A5MC 2WCSA 3EX2A 2ISVA 5DT7A 3NQAA 3QTGA 1XLFA 4W93A 5D03A 1E70M 3EPMA 1E5JA 4HZMA 4WKFA 4GHRA 1SFJA 3UWYA 2ICSA 2GK1A 4HMCA 3QGAC 3ONCA 3VNMA 2QUUA 1LL4A 4EXAA 2ON3A 4JTCA 1RA0A 5LXEA 3Q65A 1MQPA 1OFQA 4O19A 5CLWA 2ZUTA 2J9XA 1ZRQA 1W6TA 3HZ3A 4IG2A 1VFSA 2BXYA 3R8HA 1GVEA 1I75A 5BU9A 3W1XA 1PYFA 3RJXA 2KZHA 2I5IA 1YTDA 2R1LA 1JD7A 2C91A 3NO5A 3EX6A 1E40A 1H62A 4P8XA 1NARA 1X7FA 2FTWA 1U83A 4MKNA 3BOFA 1SW7A 3ATYA 4Q8UA 1P1XA 1XGDA 4H8NA 4MSSA 1W3NA 4BJHA 3UPWA 3SZ8A 5HWNA 3RU6A 5CSYA 3RLGA 4KBXA 2ZE3A 3QQ1A 1QCWA 3GIQA 1VYSX 3HF3A 5IXEA 3SGGA 3NSNA 2Y8KA 4D6CA 3CHVA 4IIFA 3BLFA 2B7PA 2Y7GA 4Z0JA 2WVSA 3LQLA 4R53A 5C54A 2ZZ7A 3U4FA 2WANA 2DZUA 1TR1A 5EYWA 3L5LA 5E0FA 5C9ZA 1K7FA 2FB3A 3CTTA 3OA5A 3OP2A 1NF0A 3MP4A 4O17A 2INZA 1EJUC 1GEHA 2GUBA 2FGBA 5K9XA 1R9XA 2Y4SA 3TCEA 2QVHA 1BF2A 1X6LA 2E25A 3LK6A 4EP8C 4RZ6A 3AAMA 3R12A 3DH7A 3EPOA 3C8NA 2XN0A 1X1NA 3G0UA 1EIXA 5BROA 1UBPC 4MJZA 3TJ4A 2FFIA 3B9DA 3GM8A 1HTIA 5DANA 1SZRA 2V2DA 4JHMA 2DZAA 2ZXAA 2VX5A 4ACZA 1UWQA 3PNUA 3TXVA 1EPXA 3RM8A 3IGHX 2EAWA 4MY9A 3UESA 2E9MA 3W71A 1LRNA 1BD0A 4Q8OA 4PTVA 1UC4A 4IQLA 2O0TA 3W75A 4LW7A 1UB3A 9RUBA 3BO9A 1JZ4A 2JIEA 3EX4A 3EMZA 2GWNA 2J13A 4QS6A 5LGXA 1H7OA 1B3YA 1ZCOA 3MV11 3TU9A 3WQPA 3A9BA 3R10A 2RDUA 1UD5A 4OGZA 2X7WA 2X0YA 1UP3A 1UHVA 2DU2A 3B3DA 1D3HA 1QW9A 3FY1A 3RLHA 4C7FA 3WDHA 1KFKA 2OZ0A 4GRSA 5I0DA 2V5CA 1LLZA 3C52A 1O5KA 3QN3A 4IIBA 1XBZA 3IEBA 2Z6JA 5A8MA 2IPFA 3ORWA 1BVWA 1L6WA 2OCZA 1HKJA 4IL2A 5F4SA 2AMXA 1H7NA 1DP0A 2CHOA 3H54A 5C9XA 3T2OA 5XIMA 1HQTA 3LCXA 1G4SA 5JH2A 5DY3A 1ZP4A 2F7FA 2PF8A 4PUUA 4B15A 5DMLA 3O15A 4DX3A 2QV4A 4LNYA 4CNTA 3P62A 1G4EA 1GOKA 1JVNA 2I56A 2Q8XA 1HJUA 1XIHA 1FWBC 1W8SA 2VD8A 4IICA 2PWUA 1X98A 5A1AA 1TVNA 2W91A 1WYIA 3GVRA 4MWAA 1W17A 2VUNA 1UASA 4MVAA 2VDGA 2YCKX 3KWSA 2ATMA 2GGHA 2BWGA 4L1GA 1KGUA 4IGMA 1XLMA 3KOWA 2OVLA 4Q6JA 3W2UA 4AIEA 2POZA 1WZLA 3GB6A 4RJEA 2IKGA 3MYPA 4QQ3A 3BLEA 4P7NA 3KL0A 2GQAA 1EXPA 3LV5A 3M0XA 4FSAA 5H1WA 3M0VA 5A3HA 2R1MA 5DCBA 1GTEA 4IT1A 2WBGA 4BFAA 2O56A 2D2GA 2XU2A 3KBVA 3TVAA 3OW1A 3KVKA 2BB0A 3QHMA 2OWXA 3ZVIA 4GQBA 1JCXA 2H3DA 3SJNA 5HK4A 4DBUA 1AL7A 4S3EA 5HAOA 3UJSA 1F3TA 5HXMA 3VGGA 4F48A 3S2MA 4FMVA 4QITA 1S5MA 3QOMA 3GVGA 3OLIA 4KCVA 4RL3A 3UJEA 4P5UA 3GU2A 3T1GA 1JCTA 3N34A 4PBFA 2RUSA 1H1NA 2CEQA 1V6UA 2ZA3A 3LS9A 2EPNA 4J3TA 3GYEA 3QZEA 3AIWA 4IGSA 1QFEA 4ERGA 4J3VA 4NJHA 4GI4A 1E15A 4KQNA 2G5WA 4Q6XA 4A21A 1B90A 1TKKA 2G3FA 1VFFA 2YXGA 1A80A 4M7TA 4RDZA 4M56A 1YADA 3B8TA 4NZCA 1P6WA 1AFSA 1IEQA 4XO6A 3WNLA 1JD9A 4XD3A 1PIIA 1FY6A 3WQGA 5BXTA 3G3MA 2OODA 3GFZA 5D32A 2GOUA 2BV9A 1E0UA 3VOFA 2OB3A 4Q22A 2V2HA 3NPXA 5D02A 4H9ZA 1RY0A 1FDYA 3VNKA 3CHFA 1W9VA 1KW1A 3W7NA 3FEQA 3AU6A 3NM3A 2DZPA 2QMKA 4LBRA 3NEHA 5A2CA 3ABXA 3QV9A 3IRDA 1FWJC 2R6OA 4C6BA 2YXXA 3Q67A 3U2CA 4G8TA 3UR7A 7PTDA 2XISA 2W3ZA 1PEZA 2O9RA 4A22A 4TOQA 4QCEA 1J0IA 5C5YA 1TV4A 2IKJA 4WX2A 3GZAA 7TAAA 4F4RA 2A7PA 1W9XA 3MANA 2DVTA 1KA9F 3CAVA 3CT7A 4C1LA 3KRBA 1XLCA 3DFTA 1UKTA 5CJMA 2JQXA 1BGGA 4A8IA 3C0SA 4ZSTA 5JBFA 3PVFA 1A3XA 4WJ8A 4W84A 3EWYA 1OK6A 3EOOA 4BQ2A 3WF4A 1M7PA 4OUIA 4ZOBA 1PZ3A 1PDYA 3OZYA 1QI3A 4FO4A 1QHZA 3LPOA 3I65A 5FF3A 4HPHA 1KNWA 4MKSA 3WNPA 3A4JA 2VDIA 2VP8A 1K8CA 1TX0A 1ONXA 2QDGA 4UUIA 4YWIA 1KTCA 3SUUA 4M51A 3WLQA 5A6JA 5D2TA 3S1VA 2VT0A 3MWAA 4LQ1A 4IQEA 2FQIA 3AS1A 1OF8A 2WLYA 1POJA 1OGSA 1KBJA 3C2RA 1Q7MA 2CHNA 3S9YA 2F9RA 4DJED 3M07A 3W74A 3P2VA 1GOWA 4LVDA 1DQWA 4R27A 5HWMA 2MANA 2IKHA 2XIMA 1TRIA 3P3BA 4CKQA 1TYGA 4LSBA 3OGRA 4WD0A 1IYXA 5T26A 3HBLA 3L9CA 4GXWA 5C9RA 1QBAA 2VZTA 1YNPA 3SBFA 4KS0A 4GXPA 3AS2A 3LPGA 1XLJA 4QJ5B 1BRLB 1ADDA 1NQ6A 2WNWA 3NA8A 1I9CB 2W0UA 1GOOA 1LYXA 3M43A 5LXXA 1GT8A 2BXVA 3UYCA 2GVEA 2WSQA 5HNRA 4ICNA 3BGGA 4UTWA 3K46A 3WF2A 5AFDA 4FLRA 1BAGA 4LYRA 4Q8WA 3ATZA 1XIDA 2QCDB 3GNNA 2VKZG 3A4AA 4PBGA 3GKAA 1LWHA 1JNEA 3CUZA 5I3FA 3GXNA 2Y7FA 3SUTA 4E2BA 4OOUA 4HMEA 5FJTA 1HX0A 2D0GA 2YW4A 2ZWZA 3ZXWA 1NWTA 3W1TA 1V6TA 2VX4A 3EGJA 4UQ9A 3TAKA 5KTLA 3TA9A 1Q6DA 1W3TA 1B4EA 2J62A 3UXKA 5DT5A 1R2TA 4GIRA 2Q01A 3WDJA 5GJNA 1Q2SA 1DWIM 1MW1A 2D3LA 1BXCA 1W31A 1HGYA 2FVLA 3CZEA 3T08A 2G97A 3SAZA 3B4YA 4CU7A 3NZPA 4PCFA 4O57A 3SB0A 4LX4A 2TMDA 4M81A 3UWWA 4C6IA 5HMFA 1U22A 3II1A 3UT0A 4RNHA 4G6CA 5M17A 4JTGA 1E6QM 3GFYA 1QATA 1PL9A 4S1FA 1HJXA 2A21A 3CH0A 2HRWA 8XIAA 4GI9A 3VDBA 3O6CA 3COTA 3H24A 4M80A 4KWVA 2GSEA 4S38A 1U5VA 1KKRA 3HPFA 4NSBA 1OZQA 1B5TA 3EZ4A 4HU8A 3PFMA 1PXGA 3TKFA 3L4TA 1YDVA 1G94A 2NX1A 3KVMA 4IH3A 2OZTA 5KSWA 1UKOA 2VEIA 3HQNA 3GSMA 5CC3A 1XSJA 5AZ1A 1IXQA 2RGMA 1RVKA 1M53A 3N19B 4ZQMA 5I00A 3ZMRA 4GOAA 4Z2LA 1OFRA 5AY7A 3W1LA 3MSRA 4EXBA 6TAAA 3LGEA 2VRJA 3U6WA 2BHZA 4C6CA 3FN9A 2FDMA 2J8GA 3CUXA 3WUFA 3SCWA 3W7JA 3CHCA 3B40A 2WNQA 3V36A 4DO7A 2BGQA 3TTSA 3HOJA 1Q6LA 3MCOA 3UJFA 2V3DA 4P8UA 4DYKA 3BLOA 4D71A 3VVGA 1QNVA 2YDSA 3PHAA 1P7TB 2VZUA 3MJYA 1ESWA 3ABQA 4W7VA 3O7UA 3MMWA 4R7WA 1DWAM 3G6MA 5E6ZA 1XIIA 1L9WA 6CGTA 3UG8A 3BH4A 2YCLB 4JKMA 1TR9A 1GQJA 2YYTA 1TPH1 3M46A 3DXIA 4UQCA 2EHHA 4PR4A 2R9RA 1PTGA 3ZIZA 1CYGA 1CW2A 3O0KA 4O1BA 4H7VA 5JIWA 2XH0A 3VIOA 1R3TA 2ONEA 1UCWA 1V7AA 1LUCB 1WZMA 3LLDA 4FXRA 4QQUA 2OZ3A 3B9OA 3R94A 3VU2A 1DE6A 1NH6A 1YXCA 4L6HA 1E0VA 4L80A 4S3KA 3VGDA 4GC4A 3D46A 1OX5A 4IQJA 1KWGA 4YTRA 4EIVA 1RD5A 4WVXA 1H5YA 3RG6A 1PWLA 4PL1A 1IWAA 4KT2A 2DDXA 3AIUA 3B8VA 3NO3A 4JIEA 4W7WA 1XDMA 1VB9A 3UGVA 1A5LC 2QZRA 3ARXA 1W9UA 3H2MA 4GABA 3LN3A 4UQBA 2YW3A 2YBTA 1E1CB 1GK8A 4NYUA 1V6XA 4U3AA 4WOZA 3ENLA 3AMCA 4JTRA 5AYXA 2Y61A 3O1NA 3UF9A 3UP8A 3GBDA 3QMRA 1AQ0A 1EEXA 3QTPA 4TVCA 4WQ6A 4KPLA 3ZJ8A 4S23A 1UJQA 2E28A 4ATDA 5HQMA 3NQEA 1XD1A 2GSHA 2GDQA 4HCHA 1RK6A 3DEQA 2IKIA 2QR6A 3LZ3A 3OLDA 1I2OA 2V5KA 1E72M 1A50A 2EPLX 3OHMB 3MDWA 1V0MA 1NU5A 3WD0A 4AFYA 2GVYA 7ENLA 3KWXA 4Q8MA 1ICSA 3VX0A 1X6NA 4UFKA 1PKMA 2JGQA 3FNDA 1JDAA 4GC3A 4KETA 1P43A 1V6WA 3W28A 3BOXA 3AIEA 4GUGA 2HJPA 3VD5A 4HMDA 4E5TA 2PGWA 6XIAA 3WELA 4NZ3A 1A3WA 4UMCA 1UKPA 5F1UA 1QHPA 4HMNA 1ITQA 1V93A 4U10A 4K1WA 2VRKA 3BPWA 3IJDA 1WKDA 3KOXA 5B80A 2GVGA 3R8RA 1OCQA 2EG6A 3WUEA 4JY9A 2AGTA 1EHNA 3PAJA 1XG3A 3F4DA 1ONEA 4K39A 4UTKA 4FALA 3FA4A 3GC5A 4GNVA 3VOHA 4NAEA 3DX5A 1GOMA 2ZTKA 5GNYA 1DJGA 1VD6A 2D2JA 1XUZA 3WLNA 2AL1A 3WK0A 2V3GA 5D38A 3U2ZA 2B31A 4GGHA 3TQ0A 1R3QA 4O54A 4A8RA 1EPVA 7REQB 4DUXA 4DJFD 1BYAA 3GU1A 1FDJA 4LEQA 4WXZA 5REQA 5ENLA 2WKLA 2Z26A 1GVRA 4V27A 4GXMA 1L6SA 2NQHA 3AO0A 3PULA 3TWBA 3VAVA 1UIPA 3IACA 4DF1A 9CGTA 1E4LA 1XYLA 3ARQA 1SQ7A 1UP0A 1V7YA 3ANVA 2FTPA 5DO8A 3KEHA 1SSGA 3VABA 3QKEA 1G6CA 3RYSA 3NEVA 1H49A 2G4FA 1H51A 3PS7A 3UYIA 1S2AA 1NJJA 1SU5A 5EMJA 3UCCA 1K8YA 2XHYA 1E4IA 2CETA 3PTKA 1C7SA 1JUBA 3SCRA 1W3LA 1XSKA 4FF7A 2P53A 4WHBA 1L2UA 4EPKA 3VINA 4CU8A 1EO7A 4CUCA 2F84A 4C1NA 1DJIA 2DQXA 3VD9A 1ZSXA 5I7GA 5C7HA 2QUTA 2HEJA 5KMYA 3SCNA 3M0MA 1XQKA 1NQKA 3OTRA 1K9FA 1N2VA 2FVMA 3CQIA 3ITLA 3SR7A 3MO7A 1XRVA 3VPLA 4MUPA 3KLLA 4LBSA 4LS0A 5ABFA 5JMUA 2CW6A 1FWWA 3GXIA 1SO3A 5TD4A 4MTVA 3W6MA 1HKIA 3QH2A 3BV7A 1LDCA 1XRFA 1ZTVA 1KBIA 1DEDA 1DQXA 3GQYA 4GNKB 4F8XA 3UCDA 3BGAA 3K13A 1KGXA 1EDGA 4URIA 3PK7A 1T99A 1K7EA 1OCNA 3NOEA 4LRTA 5G2HA 4BHYA 3KDOA 5AYBA 1WOAA 4LC6A 2DIKA 4NZFA 3W86A 3DAQA 2V82A 4M6PA 3UVIA 2FHBA 1J0YA 3FFSA 3T40A 3MSGA 4TX9A 1ZPTA 3QYQA 1F8MA 2V3EA 3EDJA 1NDYA 5B7ZA 1DJYA 4EX4A 1B0IA 1HL9A 3TFXA 4UB9A 3SCTA 5LGZA 3RR4A 3GDTA 1YBQB 1VJZA 3CS2A 3RJYA 3PUGA 4AEOA 2VGBA 4K7VA 1FWAC 5AKQA 4WY0F 3DFNA 3UG4A 1XR2A 4FK9A 3N73A 4ONVA 3RF9A 1W1VA 4IPIA 3PR2A 4MLRA 3MKVA 1GZ1A 3E2VA 4PMVA 4C60A 1GUVA 2EF9A 5A6MA 2CIPA 1O5XA 4XUYA 2GJXB 1JCJA 5LSMA 2C6QA 1ZU8A 4WEVX 3EMQA 4B5TA 4NJIA 3NDYA 1VCFA 1ZBVA 1WCGA 3M16A 4A29A 3APYA 2V3FA 1WDDA 2DORA 1OINA 2OGJA 3SCVA 5EPDA 2X2GA 3UR8A 2CCRA 1MFUA 1EYEA 1O1ZA 1OX4B 1EWEA 4UWMA 4N4QA 3KL3A 3NQVA 1MFVA 2WPGA 4ZO6A 5HR7A 1XC4A 3E9AA 4ZENA 3SGUA 2QJHA 1D3GA 5C9WA 4V15A 3FSUA 1W3KA 3U57A 1AJ0A 4LFYA 1EFZA 1ECEA 3AU2A 4LJ3A 3EWBX 3FK4A 1XLHA 4LUTA 4F0KA 1ZENA 7A3HA 3SY1A 3DFSA 2A3BA 2W27A 5F4WA 3BV4A 1JZ2A 1D8WA 4EF8A 2PD9A 4HT3A 6ENLA 1V6YA 5A69A 3WZ0E 3RFAA 3W1QA 1J8VA 4XSLA 3WBXA 3JR2A 3WQDA 3TW9A 2X8RA 4J40A 1KM5A 2A79A 2FHCA 2PDXA 2IPJA 3WQVA 2J7FA 4DI8A 1IHIA 5CZJA 5FF0A 3GX9A 3CMJA 4J3WA 4B3KA 2HCVA 1NY1A 4XTIA 2XTKA 3KVJA 4OUEA 2GGEA 1I2PA 1UR2A 3SUWA 1TRDA 1JAKA 4WJEA 2V68A 2DH3A 1B4KA 4IM4A 2Y70A 2W67A 4IFKB 2Z2BA 4US5D 5FIPA 1U1UA 1WDRA 3LCFA 4PZVA 1B9ZA 3UXLA 4DWDA 1GOIA 3CIVA 3L21A 3CEPA 3W25A 1JQVA 2DZTA 3R8GA 2FJKA 1HL8A 2V5LA 4O1EA 2D23A 1VS1A 3R6IA 3K4WA 3EKGA 3QLDA 1B57A 3GG8A 3OEXA 4LVFA 3QR1A 1J18A 3V5CA 2WXDM 1F3EA 1J12A 5E0CA 2ZWYA 3JU2A 1XYCA 3MMTA 3UFYA 3B0VC 2NZLA 1GCYA 3PY2A 1PTDA 3W00A 5LZLA 3QC3A 1Q2RA 4WR3A 3REQB 4E0CA 3G8EA 1KCKA 4X63A 2AMGA 1XH0A 5B7YA 1B1YA 2PDUA 3GR8A 1XFCA 2AKMA 4B2DA 3NSMA 5HJXA 4LCRA 1TQJA 3N18A 4IP4A 3A47A 2GOKA 4G2DA 3WH6A 3E74A 3FW6A 4H1ZA 4V1XA 1JXJA 3WLSA 2ZADA 2Z1SA 3FXGA 1TO3A 3I6EA 2YL9A 3OBKA 4LB4A 4HZ7A 2A5HA 5GVJA 4BQ4A 2IQ0A 4R33A 3WH7A 5A2AA 2C19A 4E8GA 4C5ZA 1D7FA 3WF1A 1DORA 4KEVA 4ZTXA 3A23A 1FP8A 2CLIA 4FP1A 3C2OA 3T0TA 5T91A 2QDEA 5H8UA 3E5BA 5D04C 2X1SA 5F2IA 3VD7A 3WO8A 5GPRA 3WQWA 3XISA 3ZO9A 3TTQA 1XV8A 1RJPA 3HG2A 4PRTA 2PWHA 2GDUA 4DXKA 4LAKA 2VX7A 1UD2A 1O4UA 3MHUA 1CGYA 4J2MA 5BXSA 1RVGA 1US0A 4JCLA 1VBUA 1DIOA 3J7HA 1B3WA 4UZSA 3WJYA 1UR4A 2CBVA 4QLLA 4AZCA 5KITA 4F9DA 4R3UA 4XTDA 2VX6A 2V6AA 4IUGA 1PCKA 2VM8A 4IGNA 1R0MA 4MM1A 4N2YA 3G1DA 3V1HA 3VKJA 2BOGX 3I3DA 1FP9A 2NQ9A 5KEZA 4IQDA 5FAGA 2PDQA 3DC0A 2RKXA 3B8SA 4GISA 1TJRA 2VJXA 1UPPA 3IIZA 2J8FA 2AL2A 3PSWA 1JI1A 3CH9A 4KIRA 3WLKX 2VVNA 1UWIA 5DRCA 1XKYA 4MDOA 3UZJA 4LC8A 4WZHA 3QMSA 4Q3MA 4O14A 4AD1A 4BF5A 3U2EA 2E09A 3ARUA 3LCHA 4HCDA 1FTXA 4BS0A 4MJ2A 4DVOA 3ITGA 2X7VA 2F6XA 3BAKA 2DPEA 2Q8LA 3DI0A 3P80A 2XDFA 3P61A 3I3BA 2CXEA 3T8LA 4FNPA 3N3TA 2GGGA 1VRDA 1O94A 1JCMP 1GORA 4KWUA 3RCYA 4D6JA 3O3RA 3BCFA 5FI8A 1KR1A 2YLAA 3VCCA 3I6TA 4WF7A 4ZO8A 1PX8A 2G0WA 3UG3A 3GNPA 1VBRA 3T4CA 1R5YA 3W6YA 1EL3A 2XIQA 4INFA 3PJWA 1Q6RA 1WDPA 2WZHA 3TV8A 3EOLA 4I9AA 4G9PA 4RV8A 4HHHA 3QPEA 1E55A 1HKWA 1E1EA 2Z6IA 2MUCA 3K8LA 4TVUA 2UBPC 3WQ5A 1VFMA 4CNSA 3VO0A 3N6QA 2IUZA 2CKSA 2DSUA 3UVAA 1S2WA 2GUYA 4KWOA 4CQ8A 3VK5A 4TU1A 1YW1A 4LPCA 1OCBA 4FHAA 1UQYA 2HPMA 2XFYA 4K68A 1FH9A 1JYVA 4AY7A 2ZVIA 3MTWA 1ELSA 1LOQA 1JG9A 1LROA 3S6TA 2ABAA 4DZAA 1UWSA 4LXFA 2G8ZA 4UQDA 3V5FA 5K7JA 1VKFA 5BWAA 4PFMA 5AC6A 4K38A 1YYAA 2PCQA 3PBMA 4RLIA 3TN4A 2OEKA 1V03A 4O18A 4XAYA 2VO5A 4YN5A 2EBNA 2QJMA 3N13A 2E4TA 4HK5A 3RHGA 4MZYA 3QMTA 2D1ZA 1W1IE 3HV9A 3BJSA 4ADSA 2VWTA 3HGJA 4AXKA 1CGVA 1FQ0A 4XD4A 3W24A 2Y24A 5F7UA 1VPYA 5I78A 5D9OA 2XINA 5EA9A 3WMBA 3NQCA 1GTHA 4H01A 3DYMA 1W3IA 1GKRA 3M7SA 4NX0A 1HP5A 1UA3A 4L6OA 2E6DA 4MNMA 1UR8A 4MY8A 2NLIA 1H7RA 2CITA 1OG0A 4YTQA 2PWGA 2ANUA 4MIMA 4YMZA 4HGXA 3LHVA 3THQA 4N02A 1YTEA 1Q7QA 3NTYA 3TE9A 1NDVA 3O6DA 4O12A 2OSXA 4KF1A 3PB2A 3T0DA 3FXYA 3CMFA 3STGA 3GDMA 2P3ZA 1AW2A 1VGAA 2PFHA 3THUA 1D2KA 4W5UA 1RP9A 4AEEA 3C4UA 3BGJA 5HMDA 2GQ3A 3B8WA 2PURA 2UY5A 2W9MA 1EKOA 4K8EA 1UR3M 3YPIA 3IAPA 4DUVA 3ZLHA 1RPKA 2GJPA 1RUSA 3TJLA 1DYSA 1XLKA 2PTDA 3SCQA 1LP6A 1O95A 4W88A 2A7RA 4P61A 3LMYA 1XIMA 5CKSA 2VL4A 1RQBA 4GVFA 2V81A 3KE0A 5CPQA 1FWDC 3MZNA 5U7SA 4FNQA 1W91A 3M47A 2VD9A 3WH5A 5FL0A 3OVRA 1LG2A 4BI6A 1E3XA 4RNIA 3EA3A 4PTDA 1E4NA 1QPKA 5D9NA 1C92A 3WQ6A 3B8UA 2H8XA 4O0QA 1K02A 2XSXA 2PDWA 4AF0A 3VIIA 3S9IA 1DIEA 3F4CA 3KS5A 4UR7A 2EPKX 2O4QA 1YXDA 3ITYA 5D2YA 1EUAA 2VGGA 1UZDA 1XLEA 1M68A 5K4ZA 1FWHC 1W1B1 4QX4A 5CBIA 4S2CA 3WBEA 4S3AA 3RDKA 3TNOA 2Z27A 3RM4A 4IXXA 1NP0A 1E71M 2Z24A 1FWTA 4AD2A 4FPSA 2BNJA 4ATLA 4IPPA 1O12A 2E40A 5D8WA 2DW6A 3CU2A 4WDXA 5EY5A 1K6WA 1U1HA 3T0CA 4NP7A 4Q4KA 1F73A 3OJGA 4M82A 1W1TA 3D47A 1AQMA 4WY0B 4Z1BA 1R3WA 3BVJA 3M9YA 3R4IA 1R87A 1OGGA 4R7JA 5JH1A 1N7KA 4UMAA 4I9JA 3CNYA 2FGZA 1IT8A 1OFOA 2OGYA 5ABEA 4CEUC 1RSCA 1MSSA 4AH7A 3PUOA 2YKKA 4YS1A 5FKYA 1ODUA 3BG3A 3L4XA 2OTDA 3N1AA 5D8ZA 4OV9A 4XISA 3G0XA 3FHQA 1RY8A 1EJ7L 4E2VA 1Z41A 3A6OA 3I7QA 1OM0A 1M3UA 3BQ6A 4PCTA 4PMRA 4BY3A 4ZBCA 1LBFA 3MI2A 1OJXA 1Z69A 3SJ3A 2QCNA 4LS1A 4EK7A 2J8TA 1RZMA 1KRCC 2WHJA 1I1XA 3MSYA 2HNEA 1H1ZA 1D7KA 2BXZA 5HUPA 4ZFCA 4M19A 3HO8A 4KEUA 3NZQA 4WKHA 2NVDA 4XZHA 5K2ZA 4S3FA 2DGAA 1KM2A 4Z1YA 1W9PA 4WKAA 1QHOA 1H50A 3HQPA 3HJZA 3RO8A 3UPMA 3VGEA 1YTKA 1MVYA 5CSSA 1DTUA 3BTNA 2YLLA 2F8QA 1BG4A 1RA5A 3QVQA 4REQB 1VEPA 3LTPA 4PUMA 5HMSA 1DJZA 3B05A 1PZ2A 3USBA 2B81A 1XF0A 3W7GA 3N25A 4FNRA 4Y9OA 4UIOA 4Z2JA 3RCMA 3VILA 2DP3A 4S3BA 2R1PA 5J8LA 3UZYA 2ZUMA 3M7WA 2BASA 1TQXA 4AVNA 3PPHA 1E6SM 2BVTA 1FWGC 2CZDA 1IQ8A 3BW4A 3P84A 3UZWA 3QBUA 1OFDA 3BSGA 4X61A 1TPFA 2O9TA 1A3HA 5CGQA 2VR2A 4C6QA 4D6HA 4RZBA 2A6LA 1WO2A 2VEMA 3UJ2A 2Y5EA 3AXMA 3ZFHA 4B3LA 4MAZA 4DM1A 4NZJA 4CN1A 4S3GA 5C71A 4K3ZA 4JYEA 4LCQA 2QJNA 3RCNA 2WVVB 3P7YA 4ZXLA 4W86A 1ITUA 2EQDA 1V08A 4N9BA 4DB7A 3NXFA 4CGTA 4DNHA 2WSKA 1YKWA 4NNBA 4HK6A 4HHPA 4Y8EA 1TV8A 3NL2A 4QXIA 1J6PA 4PMUA 1SZGA 2HV5A 3EB2A 4GIYA 2YBVA 3OU8A 3K8KA 3ANYA 3JS3A 3APGA 3BW2A 2XIIA 4D8ZA 4M7SA 4EVZA 3FV9A 4P7RA 1TIWA 3GHUA 4U31A 3NUKA 4HN8A 4JQ4A 3CYVA 3ABOA 1TMQA 1LCOA 3OOQA 1X8FA 1VPXA 3FDKA 1E51A 3VD4A 2W62A 1TA3B 4ZB2A 4KGLA 1BTMA 3RPTA 1XLLA 3VIKA 1WE5A 2VNCA 3P5ZA 4O1AA 5D09A 3UWUA 3VIHA 3G1RA 1K70A 1S2VA 1KD0A 2OMAA 1TTIA 3BJTA 2Q71A 4BF9A 1RBAA 4G7EA 2FMOA 5FD0A 4JN6A 4M24A 2Y63A 1XI3A 4JN7A 1F3XA 2J75A 4NL1A 4AD0A 5LNWA 2D69A 3HFYA 2PDYA 3WUBA 2I17A 2XPKA 4KWSA 3E12A 3QV7A 3B04A 1GW9A 2PD5A 4C6JA 1XYZA 1H41A 5D2XA 1SJBA 2G50A 2TRSA 5E5CA 1PBGA 1T5AA 4X0NA 4GY1A 1R8LA 4GCAA 4L61A 4CD7A 2Q02A 2C0AA 3EWDA 4GIAA 4QNEA 1H0IA 4J3UA 2YOCA 4JICA 1MQRA 1UD4A 1VBJA 1VCGA 4HU4A 5RUBA 3ZT6A 5DMNA 3WDQA 1JYWA 1XGZA 5FSEC 3PANA 2Z00A 1AQFA 1GVYA 2BODX 2AQWA 3FGCA 3U0HA 3W2KA 3UEQA 5M03A 1ZBCA 5HQLA 4XB3A 3G77A 4TVDA 1AW1A 1JDEA 1WB0A 1XLBA 2GFTA 2WMIB 1DJXA 1PO9A 1TZ7A 3BLLA 1M03A 3SSZA 4FX7A 4MAVA 1I6NA 2POTA 2P0IA 3E0IA 3I68A 2QEZA 4GFSA 4KESA 1RLDA 1XIGA 3CQJA 5H8MA 2ZFAA 3H4GA 1XIJA 3UNDA 2PRMA 3BSMA 2YB1A 5HUOA 3LG3A 1CENA 4NZ1A 4XD5A 4H9MA 3MCNA 4QSFA 2AQOA 5T9CE 3QRHA 3RUBL 1UR9A 1IE7C 2CLLA 4GYPC 1X6UA 1KBKA 3W53A 1U2YA 1XINA 3AIVA 1GGOA 2ZTJA 1DQUA 4DNMA 1XYBA 1MNZA 3W07A 1W2VA 1VFTA 1Q3NA 4HPNA 3CJPA 3WJWA 4XAPA 2D3NA 3UG5A 3VC5A 1AW5A 4RE0A 1NEYA 3WLLA 4DJEC 4HK7A 3F1QA 2WYSA 4NAFA 3LM7A 2DVUA 4Z42C 5A2BA 2Q09A 5HBFA 4X2RA 2QJGA 5CJNA 3A24A 4H7CA 4MNKA 4OT7A 2NSOA 1AH4A 4CU6A 1UZHA 5BYWA 2ZOXA 4DUWA 2DUXA 5C2XA 4L64A 2QPUA 3R0UA 1HUVA 1N8FA 1EA9C 1Z32X 5HPOA 4HZ6A 4G56A 3GXMA 4I5XA 1H1YA 1EHAA 2YDRA 4U5KA 5EMMA 4A3YA 2CBJA 5BRBA 3C2FA 3ICJA 1JPIA 3RN6A 4O10A 3VMNA 3N11A 4ZQPA 2CLOA 4M6VA 4PUJA 4TV5A 1EF2A 3P5YA 1XYFA 1Q7ZA 1BFNA 3EX3A 1RPXA 3UA3A 3D5HA 1LQ2A 3CB3A 1QNQA 3E2RA 1A5BA 3P81A 3LRLA 2DIJA 3CO4A 5C55A 4FLQA 3EWXA 2GVLA 1J5TA 3PUEA 1TE6A 1LBLA 3M1ZA 1EXBA 2B0MA 3F5KA 1ADSA 4D1JA 3W7LA 3W7CA 3RILA 3GBEA 1BXBA 3AJ7A 1Q8JA 1FHUA 3R25A 2WSRA 5BCAA 3LM3A 3S8HA 3GO2A 3S6OA 2VDHA 5MKGA 5EBAA 1JPHA 1VYPX 4Q8TA 2C16A 3Q2DA 1FCBA 2F2HA 3H2CA 4J2PA 4DO4A 1QNOA 3OBEA 1NWSA 3UZZA 5EB8A 3A4WA 5A6TC 3AXHA 1FVPA 1YE4A 3TTOA 1E9ZB 1VPQA 1JPMA 3K8MA 4RK8A 4F0LA 2OQYA 4PUEA 1DVJA 2F6UA 4BZYA 1DXFA 1DHPA 1IIGA 3PUDA 3PPFA 4TTUA 3N2CA 3ZR4A 2WJFA 3GW3A 3VZZA 1X7IA 1K3UA 4JY8A 1BPLB 1S39A 4MMWA 2VI0A 3LU2A 4H9UA 3GC2A 1WBJA 1XBXA 4C6MA 2FH6A 1QPOA 5HDRA 1NVMA 1NOWA 1P0NA 5D9PA 3GTXA 1FCVA 3L12A 4YYCA 1QW8A 1TV2A 2WOQA 3EB4A 3VE9A 4YLWA 3S9ZA 3ZS4A 3DENA 1K9EA 1Q13A 2R91A 3HGSA 3WNNA 1ZAJA 1EUNA 4PRWA 4JTDA 2XUCA 1REQB 2D0FA 3T55A 3TQKA 4DQWA 1BTCA 4Q33A 5EU9A 3G1YA 3M44A 3NXLA 1Q6FA 4GUFA 3OGVA 3K5XA 3W7KA 2E5DA 2CC0A 4TIMA 4AMCA 4C6PA 4I5UA 1WBHA 1DE5A 3AIBA 4U4MA 2KX9A 4J3SA 5BOOA 1A47A 1EZWA 4LAUA 1QW7A 1JPDX 2WM0A 3TH6A 4AHOA 3QY7A 4JFUA 4GQQA 4ROPA 2FTYA 3KTCA 5D2WA 1SO5A 4DXXA 1MEHA 2WSYA 4NQ1A 3G1SA 3VOGA 3O2LA 5XIAA 2Y7EA 2O92A 5G4EA 2QLYA 1UZ4A 4NHVA 3MBDA 1F76A 1LT8A 3S3GA 2OLAA 4RE2A 4GUJA 1W5PA 4GACA 2BHYA 3T78A 3ZJ6A 5A6BD 3HA1A 4CQCA 4FNUA 3MT1A 3MPGA 1EDTA 7CGTA 2X05A 1S5TA 1PSCA 3PWAA 3NZGA 4EAMA 3RU8X 1CZ1A 3DYPA 1FWFC 4KIEA 4BI7A 1DV7A 1O5QA 4PMDA 3S47A 3GDBA 1PTAA 2F6KA 6REQA 1BYDA 5JQ9A 3ES7A 2VEKA 5IBXC 5BMWA 3OVQA 4KWWA 3IJLA 5TNVA 5I3DA 3TJIA 3QC0A 4A2SA 4AZ7A 4RNFA 2VFIA 3TSBA 5JU6A 3M5YA 2ISFA 4W4QA 3CAQA 3L2LA 3H21A 3KS6A 3GAYA 4HOWA 3WQFA 3E1F1 2FLIA 2GWGA 4UOQA 1Q65A 3C0QA 4DJEA 2C18A 4WDTA 4PH6A 4CEXC 3BLKA 2Z0IA 3VX1A 2YPIA 3DOPA 4LEFA 1XRSA 2EKGA 4UOJA 1SO4A 1C29A 1DBTA 2XVNA 3SN4A 3CYJA 1O1HA 5F2GA 1ISXA 3V75A 1KXHA 4K36A 1O6IA 5EMLA 2WWCA 3EDFA 3H2OA 4HBKA 3W01A 1VHNA 3CZ8A 5CPTA 4GY7A 1KBBA 2BP1A 1TSIA 3G0SA 4L9XA 3VKBA 2J47A 2ISWA 1UWTA 1Y8BA 1T40A 5MF5A 2D22A 2AQVA 3P0XA 3H2NA 5DCEA 3LRMA 3QV6A 4JHZA 2PU1A 1VQTA 3AMGA 3KM8A 2IXUA 2BVYA 3DUGA 3VNLA 4AC1X 4WXYA 5JBEA 2PP3A 4Q4RA 3UPBA 1A0EA 2J7EA 4ZE5A 1WDWA 3O8AA 1CI1A 3W2NA 4KFOA 1J0ZA 4DEFA 3A13A 2OXNA 2V67A 1KM3A 5J5RA 3HU7A 3RLUA 2YDQA 3T8QA 3NDZA 3TZNA 1TJ0A 4DF2A 2QIIA 1R3VA 5I23A 3AMLA 4XSMA 2XH7A 1S5NA 2J7GA 4QFUA 2HROA 3IRSA 3C2VA 3CEUA 4PFHA 2UV8G 2PI6A 1UROA 3PZGA 4JTLA 2QAFA 2PRHA 4DJFC 1PIFA 3IUIA 3MYOA 4TV6A 2PDLA 2Y5JA 4R88A 4GZIA 1F6PA 4J3ZA 1F4AA 3B4UA 4JYFA 3TR9A 3NVTA 2PGRA 1IWBA 1PVNA 4JIRA 1VP5A 4LVBA 3W26A 3FIGA 3TYDA 3S2JA 3OVGA 4Q4MA 5I09A 1OYCA 2WKGA 4I8DA 1LJYA 4AHQA 1TWDA 1MO0A 3BG5A 1S5WA 2PSNA 2QUNA 3CZGA 1VFUA 5FJOA 2YJQA 3HURA 1SZEA 2XJ7A 3PB0A 2NSXA 3HMCA 2BY2A 2VTFA 3GYCA 3TQVA 2OO0A 5KZMA 3RITA 3TN5A 4AYSA 5EGRA 1B2YA 2CZEA 1YRRA 3WQ8A 1YXYA 3DC8A 4DLMA 2WB5A 2WC3A 4FEZA 1TPWA 1R46A 2GGJA 3BC9A 3ZSSA 5FF2A 5FACA 3T2QA 4GYFA 5AC5A 4C6EA 5AVHA 4XBKA 1ZJIA 3LPFA 3SUSA 2QIWA 4XZIA 4Y9NA 3IJ7A 2QNEA 4FR6A 5LA1A 4MNLA 1G9HA 4A8LA 3R79A 2Z1WA 4Z2GA 5H91A 3ECQA 1M65A 1GYNA 3CTLA 2HVMA 1LWIA 1VCVA 5HNUA 1W3HA 4J3XA 4O13A 4YPJA 4IGHA 4L1WA 3KCLA 4NG3A 1LQ0A 3W1RA 2IW0A 1RD6A 3AWOA 2PAJA 1XISA 2OYKA 1H3GA 4KFNA 2PP1A 3ONBA 2H9AB 2VFFA 3GNOA 2OSYA 1H61A 4F2BA 1UIOA 3SIZA 3CC1A 3WY1A 3WNKA 1QI0A 3A9IA 2YR1A 3AJXA 1EGMA 1LOSA 5DX7A 2IPGA 1G01A 3CZJA 2GL5A 2VVSA 1OT2A 1HW6A 4PUKA 4I3GA 1EJTC 4NXSA 5DCDA 5CJ5A 4UBPC 1BF6A 2PLJA 3QR0A 3LHZA 2ACSA 3WSUA 2EPHA 3T6CA 1TWIA 3NZ1A 2ZUNA 2C15A 4UC5A 1UKSA 4JQAA 4D8LA 3BAJA 1XX1A 4C7DA 3EAUA 5IBXA 4JTEA 1EOKA 2PODA 4ADUA 4CD8A 5A6SA 2WHLA 1KRBC 4NF7A 5CH9A 1CGXA 1W1PA 3GH4A 4EAYA 4EACA 4YJ5A 3R58A 4ZCWA 4DWSB 1JYXA 1O66A 3FEMA 3CUGA 1E73M 2E9LA 3AALA 4UNKA 3RR1A 2RDWA 2E6AA 1RQEA 3WLIA 2ZRXA 4V28A 8XIMA 1RCOB 1XUUA 4QG8A 4Y7EA 2CLHA 3VD3A 1HKKA 3NQBA 1X96A 1UJPA 2PZNA 2YFOA 3GNXA 1X39A 1WDQA 4AEFA 2HISA 2HE5A 4IJBA 5XINA 3MKCA 4IMAA 5HOSA 3TOYA 5DFAA 3FJ4A 2A3LA 2ZDRA 4W89A 2WMJA 4DBSA 4L7ZA 3VFCA 3W7HA 5AC4A 3T4WA 2BZNA 5A8GA 4MB1A 1K4GA 1PS9A 1E6RA 4PUDA 4EWND 1SUXA 2WMKA 5D30A 2QT3A 2JFEX 4QDWA 1A5UA 1NDZA 1Z6KA 2V9DA 4PMNA 1A0CA 1TFVA 4PTMA 1WA3A 4AQLA 1T41A 3RIKA 3ZYZA 2TAAA 3PWGA 4ASTA 3G6LA 1VENA 4ZSUA 3S5ZA 3ARTA 2CERA 4HIBA 1KFEA 3Q94A 2J7CA 1ECQA 4IMCA 4EKJA 3KTXA 4ERAA 3UXIA 2YL8A 4LU0A 4CVUA 1TMLA 1NF7A 1ZFJA 3F4WA 1XHGA 1J01A 1OD0A 4GH1A 5K4XA 4M6UA 1P48A 1TPC1 4OZOA 1TMHA 2X1RA 4NX5A 2XWEA 3RX3A 1P0BA 2Z29A 4XKMA 5I07A 1J0KA 3PZMA 5G1TA 5HQEA 2W61A 5E9XA 2GGIA 5CQ1A 5C2GA 5HATA 8RUCA 4TXEA 2F38A 4DJFA 3KUMA 3VIMA 2QULA 1L0PA 4OVXA 3LXAA 1JRCA 1LG1A 4J35A 4F3HA 3SRDA 3OIHA 4HNNA 3LNPA 2ODOA 4WOQA 2DZVA 3G3DA 3H70A 3P8IA 1Q6GA 4HSHA 1JL8A 1Q6OA 4DXVA 3V4BA 1PZ0A 2PGEA 4DPPA 1V79A 1FH7A 3A4XA 2Y1HA 2G3IA 2CWNA 2EPOA 3WK2A 4MB4A 4W8AA 4C5YA 1JRBA 1ZAIA 5CBBA 2PPGA 3AHXA 4A3QA 4S2BA 4JKKA 4PA8A 1WPCA 4LV9A 4TUFA 4LALA 3VKCA 3EEGA 3U5UA 1EBGA 2ZUSA 5IFTA 3WUGA 2GUUA 4RXFA 3UWVA 3B9EA 2PZ0A 3TFCA 2Z25A 3CPUA 1GQLA 2ASHA 1H7XA 4GX8A 2EXOA 2ZXBA 1Z7AA 1ZQ5A 2XFWA 1XG4A 3C0JA 1J10A 1XYMA 4OOZA 3WF3A 3B0YA 1HF6A 2NXGA 3ITCA 3UZ5A 3WN6A 2Y62A 5HJYA 1UP2A 4P7QA 4B9ZA 4ZR8A 4UTMA 3TQPA 5A5WA 4IIGA 4FXJA 2YCEA 4AZ6A 3EDKA 2V8ZA 4JDYA 4JDBA 3KBMA 3PTMA 4F0MA 2NVAA 3VMPA 1A5NC 4JGDA 1MUWA 1E0WA 4ZVJA 3BJFA 1XSIA 3USZA 2JKPA 3LSBA 2PUZA 3QR3A 2OPJA 4GVGA 1CXKA 2NUXA 4L65A 3ZOAA 3VGHA 4OBSA 1M7OA 4BEUA 4ZQOA 3M41A 1I60A 4Z0SA 3DERA 1XLGA 1KM4A 1TVPA 2RH9A 1RXOB 3TTEA 4E2DA 4LAOA 2YA0A 4PEEA 1TCDA 3A5VA 3OPSA 1CLVA 4JHOA 3KBWA 5BMXA 1JGMA 4NJKA 3VOJA 2J24A 2PBGA 1MW0A 2Z2UA 2DT3A 4KRUA 5JIPA 2OT1A 3IS4A 5CPOA 2DZBA 3VZXA 1MEWA 2QXWA 1ALDA 3TLLA 3L2MA 4GI6A 4GGBA 3ZT7A 1E9IA 4H6QA 2XGZA 1K4HA 4KMQA 1IXNA 5A6AA 4MF4A 3NOYA 3W02A 5CSUA 3MP5A 2YGYA 1BRLA 1VF8A 2VCBA 3H22A 3N2XA 3CIWA 3R13A 1U33A 3RXZA 3KZPA 4HU0A 5F1VA 2ZZ2A 4AX6A 1PX3A 3LD5A 5DMMA 1KLZA 3ITVA 2HQAA 3TMLA 4P8VA 2E7FA 2QCDA 1SJCA 3EB3A 4HYRA 2D2HA 4X60A 3TN3A 3UR2A 2V0TA 5G4WA 4AIOA 2E1DA 4U5IA 3MO4A 7ODCA 3STFA 1C90A 4QE1A 3ZJ7A 4CQAA 2RHGA 1KFLA 4Y96A 5A6KA 2ZX8A 3VM7A 3TJXA 1QK2A 2G95A 4GJ1A 1BEUA 3G5EA 1OEPA 4Y6GA 3BSHA 4C91A 2JKEA 3AS0A 2PE4A 1C93A 2FMNA 3WYZA 4JN8A 4IIEA 3SRKA 2P10A 3IIVA 1KFBA 5J5DA 4HVXA 1GPWA 1T7LA 1SMAA 1BWVA 3QSTA 3SRHA 3GUWA 3NL6A 4D6EA 3LX9A 2AGKA 3C3NA 1FWNA 1UC5A 1BLIA 4M5PA 3A5FA 1XGEA 3U7BA 1KFWA 1FWSA 4BI5A 2Y85A 1ICQA 4AXNA 1GEQA 3O05A 3FYYA 5LNSA 3POCA 4J1OA 2Q6ZA 5FEXA 5DQPA 4DO5A 3F4VA 5FEZA 1E5NA 1K77A 1V0LA 3CHEA 1NOFA 3DHDA 4RW3A 4RR4A 3RPDA 4MLJA 2YDAA 3SI9A 3GNDA 3ZLGA 4JIQA 4NXKA 3WMLA 3PZOA 4US5A 4MUZA 1J4EA 4ZB5A 1G4PA 3NQ7A 1IV8A 3HV8A 4WSHA 4UCGA 3PZUA 3WL0A 1OBAA 3ABSA 1P4CA 2AAAA 3FAXA 2OLHA 3W0KA 4JOMA 1KXVA 5HNNA 4I7UA 5FA5A 3VNZA 3LHWA 5GJMA 1BVZA 1P7TA 1KKOA 3MCMA 2NX9A 1YHTA 4WIWA 4JTTA 1UUMA 1PPIA 3GR7A 3NL3A 3D3AA 1VLWA 2OEJA 2YCLA 3FJLA 5JUVA 4ZOAA 2ZUUA 3OYZA 1AL8A 4O28A 4I9MA 1E3ZA 3TYEA 3VNJA 4N4PA 3SGZA 5BU6A 4Q32A 4LUYA 3C8FA 5H2ZA 1W1YA 1Q66A 1TG7A 2VHLA 1RR2A 2WO5A 1NIUA 1PE1A 4JIHA 3P93A 1E43A 1KLYA 1LUCA 1C8QA 2DT1A 1JFHA 4YHGA 2EEXA 3GZ3A 3CPRA 4MFDA 5I3GA 5DELA 3IVSA 2A0NA 2J9ZA 3VI2A 2A3CA 4FXSA 4QP0A 4EPEC 2BDQA 1O60A 1W37A 2WMGA 4ZQCA 4UFMA 4O4VA 2PA6A 4N9CA 1US3A 3EA2A 2FKPA 3L4ZA 3F2DA 4TMCA 4NZ4A 1EQPA 3W1NA 1ZZMA 3LDVA 4R5EA 4BQ3A 2BVWA 3EXRA 4RPQA 3TN6A 3RNDA 4KEMA 2ZC8A 1SGJA 3SQSA 2E6FA 1HN1A 3KFTA 4DWSD 1E1CA 2NLYA 4HPGA 3QY6A 1IZKA 5KZ6A 4QHRA 2B7NA 1VFLA 3MHGA 5HA7A 3C6CA 1CXLA 2DEPA 1JZ3A 1OF6A 4CNOA 3IUHA 4HA3A 1GNXA 2PB1A 1TWSA 2PRLA 1KXQA 4D8AA 4I7WA 1XJBA 1DWJM 3ITTA 3OZPA 1UMYA 1GQIA 4PUNA 3W7PA 3KOYA 3MC5A 5CAKA 1KV5A 2C1IA 1QO5A 3WK1A 4J5NA 3BLIA 3QZAA 2JE8A 2WCGA 4FLOA 4KERA 3BMVA 1UPMB 5LHFA 4DY1A 3EWCA 1R9ZA 3GR4A 1OY0A 3FJ6A 4M6QA 2YCIX 4RDYA 5BWFA 1UWRA 5TAOA 1R3YA 1L6GA 2V5BA 4IMGA 1DL3A 3GXPA 2Y7DA 5AZ0A 3L5AA 3MSDA 4AVOA 2RJHA 2VELA 1ZGDA 4PMQA 3LBCA 3H7UA 1LF1A 3UA4A 1TWZA 4IPLA 2WNNA 4Z1DA 4UFLA 1SVDA 4QTGA 1MYRA 1JIBA 4E6MA 4HN4A 3SURA 3NQ8A 4QLKA 4IMFA 1EX5A 4TX8A 4KH2A 2XVGA 1RQHA 4QJ1A 5AYYA 5GJPA 4LUSB 1YLVA 5CG7A 3UBPC 4F0SA 3H2AA 1JF5A 2C7FA 1I45A 3HPZA 1B3XA 1HNYA 4F2UA 1VFHA 3SCOA 1EO5A 3MI3A 2WMHA 4F66A 1VFOA 1AQHA 2I9UA 4QLJA 1KM0A 4XVDA 2J7DA 5BRQA 3W1MA 1M01A 7REQA 1S2UA 5ABGA 3VFLA 2BVDA 1F7BA 2DSVA 5FSDC 3BAXA 4DJDD 1KC7A 2ZZ3A 3S2LA 2FFCA 1RBLA 4J7RA 4ILSA 2VEFA 3ITOA 4AAJA 2QDHA 2XGBA 1BKHA 4JTHA 2ZA2A 4FIQA 1HG3A 3NCOA 1F8IA 3IV3A 3AC0A 3PZTA 4H2CA 4IPNB 2PDCA 1P1MA 2BX7A 4LF2A 2Z2AA 4P7OA 2VOMA 1P6CA 1Z44A 2EO7A 4L4MA 1QU4A 2DZXA 2QAPA 4PGLA 5KZDA 3EDDA 3LERA 4IIHA 4CQDA 4HZ8A 4L4OA 3WFZA 5SWUA 4MB3A 1JPKA 3LYEA 3NL5A 3WD2A 3JRKA 3IK4A 1J6OA 1HVXA 3EPNA 3O6YX 3N6HA 1WUEA 4DLFA 4YVXA 4D9PA 3ABRA 4YTTA 2V2CA 4FNTA 2TPSA 3O16A 9XIAA 4BKNA 4MZ8A 1SM9A 2DW7A 4RDWA 3QZ6A 1HIZA 1UWAA 5HULA 2CBUA 3NDOA 3WL1A 4LB3A 2UZ9A 4D6FA 1XPYA 2PC8A 4GFIA 3WH9A 2GJRA 3MUXA 1OX6A 1A5OC 1C8XA 2GJLA 4IP5A 1ISWA 2CYGA 3WD1A 1XW8A 3QYSA 4NT0A 1QOQA 3GXTA 2W4XA 5ECVA 1EC8A 3UCQA 1E4MM 4U2YA 4ZODA 1UMLA 4N9DA 4PMYA 1BWKA 3WFLA 1AMYA 4A8NA 2FZNA 3W37A 2WK2A 2WW5A 3QF0A 4HB7A 5AB3A 2X16A 2DT2A 5LIWX 4MADA 2QGYA 4AUBA 3DFPA 1UWUA 2WLZA 1E6XM 2BY1A 4XBSA 3H23A 2X0SA 2WNZA 4K2SA 4C65A 3LCIA 3PZNA 4UTJA 1F74A 2YL5A 3W85A 4G1KA 5K3VA 2HK0A 3NURA 1YBQA 4UR8A 3JW7A 3AUOA 1CB2A 4HPJA 4KFPA 4XD6A 1K7XA 5AHEA 2WAGA 4H8VA 3BAWA 2GDVA 1D9EA 1HKVA 3CB8A 4PODA 3W7IA 3R89A 3L4UA 2CESA 2Z28A 3N12A 4NU7A 2ATSA 1H7PA 1IIHA 4XAZA 1ZAHA 1QNSA 3GTFA 2WWDA 2GJNA 5ABHA 3NQFA 4V2XA 1VAHA 4O50A 3GVWA 3UW6A 4N0RA 3W7EA 3MV01 2L5HA 2GJXA 3LI1A 5AHLA 4C6DA 1V3HA 3NR0A 4NASA 4YVPA 1Y65A 3KVLA 1ZJBA 3LENA 3WLOA 3DIPA 2QV5A 1SSDA 3UGRA 4EXQA 1TZ9A 1EP1A 5CGMA 4OJYA 3WLTA 1ME7A 4UFIA 3U2OA 4ECLA 3UWEA 4NKCA 1E56A 1R3SA 1KM6A 1G0CA 2J7HA 3ARSA 2D2OA 2R82A 3L4WA 4JX6A 1OX4A 4Q4SA 1E6ZA 1BYBA 5DEZA 4XBJA 3SADA 1RP8A 1QRQA 2WZEA 3D0CA 1V3JA 3SQMA 5I24A 1CNVA 4YCOA 4O53A 2CKRA 1GHSA 4B3ZA 1XH2A 2ZX6A 4AD4A 1Z3NA 1K9DA 1M1BA 3BLDA 3MUCA 2I14A 1VYRA 4GG9A 1ZLPA 1XLAA 3GTIA 1LLWA 4LUIA 1UZ1A 4OECA 5JXQA 3ZWSA 4GWEA 4Q4OA 4XX6A 3W73A 2IQTA 2ACRA 2V5DA 1VEOA 4LH8A 1EGZA 4LAZA 1W54A 3SN1A 5KINA 1VR6A 2MNRA 3URAA 3W1PA 2XGIA 4JFWA 3UETA 3WKZA 1KQYA 2DVXA 4DO6A 4ZB0A 2W63A 1C8VA 3MVIA 1M04A 4O15A 2REQB 3CL7A 3I4KA 4O8RA 4A6GA 4ICCX 3WNMA