1TJPA

Crystal structure of wild-type tryptophan synthase complexed with 1-[(2-hydroxylphenyl)amino]3-glycerolphosphate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
267
structure length
267
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title On the structural basis of the catalytic mechanism and the regulation of the alpha subunit of tryptophan synthase from Salmonella typhimurium and BX1 from maize, two evolutionarily related enzymes.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 99
structure length 267
sequence length 267
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2004-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1tjpA00
1OFAA 4ZMGA 1AW1A 1IXOA 4XKYA 2A85A 3DFSA 1IXNA 4S2BA 1LDCA 1OX5A 2ATMA 3LHWA 4Z0JA 3NL2A 3QFEA 4WOZA 4Y6GA 3S0CA 3W7DA 4CNPA 3NQGA 2A21A 3TE9A 1TIMA 5F2LA 3LCWA 3B0VC 2ZA1A 4E38A 4JTHA 1D3GA 3LHTA 5DCDA 1MXSA 4E0CA 4HNNA 5A5WA 5CZTA 1R46A 3EWBX 3E96A 5I3HA 3L0GA 2WV8A 3GR7A 3THAA 4U28A 1JULA 1MSSA 1SU5A 2GJLA 5FF7A 2C15A 4CNOA 3IIPA 2Z6IA 3L2IA 2PRHA 3MJYA 1X7FA 1PL9A 2VEMA 2TYSA 3ZS4A 1T99A 5EBUA 2ZZ4A 3L5LA 3PVFA 5MHBA 3BG5A 1R2RA 3WK3A 2R94A 3O05A 1RZMA 4BF9A 1LCOA 4LW7A 3W84A 2QJHA 3W7NA 1SO5A 4N4QA 3L0NA 1Z44A 5AOUA 3LHZA 1EP2A 1LP6A 1XC4A 4O53A 1Z48A 1LLWA 2QUUA 5G4EA 3NM1A 3F1QA 3SR7A 1L6SA 2VFDA 5D2YA 3PWAA 4M6QA 2E68A 4GRSA 5AHMA 2X2GA 3BW2A 4FO4A 3S1UA 4LS1A 4RXGA 3HPZA 3M5ZA 1L2UA 5D32A 2Q8LA 3PS7A 5D33A 1VYRA 4AXKA 4BI6A 4UFIA 3G1YA 2RKXA 5K3VA 3NPVA 5AN7A 4QITA 1NSJA 4IPJA 3GKFA 3M47A 3RNDA 5EL1A 1ALDA 1JCXA 1VS1A 3G18A 3L0KA 4GUGA 4O57A 2J27A 4HNVA 3QPZA 4UFJA 3A9IA 3B06A 2NXHA 4RXFA 3VE7A 1VR6A 4S1FA 1W5PA 1XBZA 4CCEA 5KZDA 3TSDA 1KW1A 4Q32A 1GVOA 2NX3A 5I3IA 1TPB1 1PHWA 3OA3A 1FWSA 1P4CA 5C55A 2J24A 2DZTA 2X1UA 4JY8A 3NQDA 3TSMA 5HNRA 4A21A 4NT0A 4PFMA 3PG8A 5HR7A 1JR1A 1VRDA 4MJZA 3W1NA 4DBDA 2VFGA 2AAMA 3W2MA 1LLZA 1JCJA 1G67A 1XM3A 1GVSA 1JCYA 4KWVA 4RK8A 1A5CA 4A22A 3W7EA 3LERA 3MP4A 4I7UA 4X3ZA 2PCQA 3I65A 3M0ZA 5AC8A 3DAQA 1GG0A 1LM1A 3BO9A 1GWJA 3E49A 3LM7A 1F73A 1O95A 1CW2A 1KLZA 3S5YA 2Y6ZA 4RZ5A 1K02A 2NV2A 1EPXA 4KWWA 3CTLA 3W73A 1KA9F 2OCZA 5F4SA 2CFFA 1LOSA 2E77A 1AG1O 3LB0A 3N2MA 4UTMA 2NX1A 4N02A 1F76A 1VPXA 2ZZ2A 3VNDA 3M5XA 3VFLA 1OFEA 4LS2A 3PM6A 1UB3A 4UTIA 5BNKA 1GTEA 1ZAIA 4Z1BA 5H2ZA 1S5VA 4MY1A 3USBA 1JCMP 5FEWA 4UFLA 5U4NA 2ZZ1A 5G2WA 1GPWA 3RLUA 2W0UA 1MO0A 1G7VA 3EX4A 3STFA 5L9FA 1KBIA 1P0KA 2CLHA 2I1OA 2Z1BA 3W1UA 1R47A 1H1ZA 1RQEA 1QPQA 2QKFA 4ZQCA 1BKSA 4ZZ9A 5CG7A 1EEPA 3NZRA 3ABRA 3EWXA 4LTSA 3HPSA 3GXNA 4CQ8A 4I9AA 1GZGA 3S6DA 5AHFA 2CLEA 3R2GA 4IMGA 3GXPA 3A5VA 4AAJA 4O4WA 1Y0EA 2Z6JA 4LY8A 3RU6A 4O14A 5AHNA 1VQTA 3L21A 4NXSA 1OABA 3W88A 3DKLA 4K36A 1ZAJA 5J5RA 3HJZA 1XL9A 4RZ4A 4AHQA 3SGZA 1EIXA 2V8ZA 2ZQ0A 3GIYA 1F5ZA 1SPQA 2FJKA 1UJPA 2WQPA 2GQ8A 3R13A 1K8XA 1O4UA 3I68A 3FEMA 1HFBA 4DELA 4O18A 3W7OA 2H8ZA 1DQWA 3NNTA 4MJMA 4WD0A 4WY0B 5HQEA 1X8FA 4AVFA 1F74A 2X1SA 3FIGA 1H63A 3TMQA 2YGYA 1IXPA 4JICA 4K7VA 1GVFA 4KFNA 3G0UA 4DPPA 4KKXA 4C1KA 4K39A 4IMFA 4GE8A 3C2EA 5K9XA 1YYAA 3C3NA 3UWQA 2V30A 4M7TA 1I2RA 3IV3A 4ICNA 2A7PA 4N9CA 3IIOA 4WUIA 1THFD 2WPBA 4PL1A 1VH7A 3E9AA 1SZFA 3B8DA 3VKJA 2W6RA 3TC7A 3VE9A 1WX0A 1PV8A 1FDZA 3BW4A 4WX2A 4R53A 4RCXA 1VC4A 4IUOA 1SO3A 3V75A 3MI3A 4BWLA 1TV8A 3TDFA 3L68A 3C61A 4PEKA 4LV4A 2C3ZA 5AYYA 3HPXA 3W7RA 3N73A 5I3FA 4L4MA 1L9WA 3W1TA 4EF9A 2GUUA 2GVLA 3L5MA 2Y88A 1W54A 3CHVA 4O0ZA 2QCCA 4ZQPA 3P5ZA 4QNWA 3W7KA 3P8JA 4OT7A 4BI7A 3WK0A 4FEZA 4FIQA 4QIUA 4LS0A 3RF9A 4QNEA 3SFKA 3AJXA 3OEXA 1KFBA 4FNQA 1AW2A 4IGHA 5EPDA 4O1AA 1ZALA 1KM0A 1YXCA 3GNNA 1JVNA 3G0SA 3QMSA 3R89A 2VOMA 4GBUA 3TX9A 1G4PA 1GEQA 1X1ZA 1F6PA 2BZNA 2JKPA 4UNKA 3DFPA 1LOQA 2WKJA 4JIPA 1TRDA 3W7PA 1S5TA 2Y63A 3IVTA 2QCNA 3CLMA 5DCBA 1QDSA 2JGQA 4O11A 3SECA 4GNJA 2OX1A 5DBTA 3MMTA 1H7OA 1QAPA 3P80A 4BK9A 2WNZA 4JTTA 4JDBA 1FXPA 3LTSA 3DZ1A 3GYEA 4H6KA 5HINA 5D30A 4S2CA 1NF0A 1YPFA 3FJLA 3LCHA 5CPOA 1F05A 4O16A 4UMAA 1ZNNA 2FB2A 2EHHA 1H7XA 4WXYA 1VHCA 3PSVA 4LC6A 3Q58A 4HIBA 2YR1A 2V9DA 4O17A 1WOAA 3PBVA 2QCLA 3OVPA 2NXGA 1EP3A 5HUPA 3W7IA 4JS3A 2PRMA 1KFLA 1SW7A 3GDTA 4A3UA 2B7PA 2F7FA 1ML1A 5CZSA 1XBVA 1J5TA 3TQ0A 4OU1A 2XN1A 3EX6A 5D04C 1BWLA 4AEOA 3PBUA 2RFGA 2IQTA 3BARA 1KFEA 2WNNA 3TFXA 4ZQMA 4IXXA 1H51A 3KVMA 2WO5A 4NNAA 4DF2A 1M7PA 3G8EA 1DOSA 1XBYA 1GVRA 1TTJA 5D2VA 4Y9AA 4HT3A 4YXGA 4OGZA 1T96A 3P5YA 5DELA 2FDSA 2C19A 1FDYA 2D73A 2OZ0A 4MPQA 1W3IA 3HG4A 3W7LA 3UWZA 1LROA 1H61A 2ZRUA 2WNQA 1TQJA 2VXNA 5CZ0A 3LOTA 4X9SA 3HF3A 1TV7A 1XI3A 3KFTA 1OX4A 4UR7A 3ZWTA 2V81A 1FX6A 4LUIA 4LVAA 1TRIA 2V5BA 4E2DA 1SZEA 4HN4A 4UMCA 1ZCOA 4GFSA 4IPIA 5LGXA 4AMAA 2ZTJA 2B7NA 5BRBA 3O63A 3P62A 3EXSA 1EP1A 1SSDA 4K6AA 1ONRA 3L66A 1PE1A 4NJIA 1XUUA 1L6WA 1A5SA 3TNOA 3SW6A 5E93A 4DO6A 3MP3A 4XZ9A 5IBXC 4MOZA 4GUJA 1ADOA 3DBPA 1M6JA 2CLMA 4ADUA 1LRTA 2V0TA 3CU2A 2CLIA 4I7VA 1OVDA 1WYIA 4UTWA 3RMJA 1XFBA 2O7SA 2ZRVA 1R2SA 1B57A 4HPJA 2A7NA 4LRTA 4QAIA 1W5OA 1RQHA 2NUXA 2HMCA 4PCFA 4IMDA 3W1XA 2ZRYA 3TROA 2ZRXA 4O4VA 2PURA 3MP5A 1UUOA 4JTIA 3HMJG 4JYEA 1UASA 2WOQA 4UTTA 2DJLA 4WJEA 1FUYA 2TSYA 3U2OA 5DCEA 4WQ6A 1GYLA 1UCWA 1QO5A 1VCFA 1DVJA 4DO5A 2YW4A 3M16A 5CGQA 5FESA 3W22A 3WJZA 4IXHA 3W85A 1OFPA 1OF8A 2CZEA 1TPVA 4Z1AA 5CZJA 2CZDA 3CM4A 4FB7A 5SWUA 3H54A 4JTUA 2G5WA 4NJGA 3SGUA 4MFEA 1XXXA 3W7MA 4OV4A 2TRSA 4HHPA 3E12A 4AF0B 1SFLA 1KTCA 4O1DA 1S5WA 1W5QA 5H91A 1QPRA 4ONVA 4A2RA 1VLWA 5D2WA 1KV5A 1D9EA 3CB8A 3FKKA 4JTSA 5F2MA 4FX7A 5U7SA 3NPWA 3BLEA 3UY7A 4WY0A 3P8IA 1C9DA 3LV5A 4ZQRA 4K8HA 3TJXA 3OBKA 3C0JA 1LORA 4G1KA 2FTPA 2C0AA 1YXYA 1K7EA 2RDWA 3BG9A 2A2IA 3PY2A 5CSSA 4MLRA 3EX1A 2CU0A 1JQVA 3GB6A 4LRSA 2ZRWA 2ZFAA 1O60A 2OJPA 4YMZA 4ORIA 3QZEA 3LTPA 2V2CA 4LV9A 3NZ1A 4WXZA 3DFNA 4KFPA 5HMSA 2FLIA 2YFNA 3A5FA 4LOCA 3UD6A 4TMCA 3N2XA 1FXQA 4LWWA 2GVJA 1VLIA 3H53A 3WJXA 4FNUA 4AWUA 1TTQA 5D09A 1OJXA 1ZJIA 4N9BA 3GDRA 4J9JA 4JN6A 4BFAA 1SQ7A 3NQ6A 4TO8A 1TMHA 1XDLA 1KM1A 1JJKA 3QSRA 4QM1A 4TR9A 2CLFA 3N3MA 2HS8A 1PCKA 2H6RA 2X1RA 2VFEA 4PH6A 1ZY9A 1JUEA 4O15A 4MKNA 3M41A 1TYGA 3EWUA 3QMRA 1FY6A 2XFWA 3QEZA 1H7WA 3I6RA 3LX9A 4M7SA 3G1XA 2ZA2A 4LU0A 4JR5A 3O15A 3ABSA 1A53A 5D03A 3CEUA 1W5MA 3HB9A 5GVJA 4GJ1A 1SFJA 4JEQA 3CIWA 3EWZA 5HR6A 5BOOA 1PCWA 3BG3A 3IIXA 2DZUA 1IIGA 3DFQA 1RQBA 2XN0A 3MI2A 1TQXA 3A22A 4EIVA 3INPA 1KM4A 3H55A 4P2VA 1I2PA 2A6NA 4P61A 1VHNA 1NFBA 1SZNA 1P5BA 3G3MA 3C6CA 3R5EA 3LHYA 3W87A 1TJPA 2QDGA 3RFAA 3WFAA 1TJRA 3W1QA 2Y7DA 3B4UA 3KVJA 4JNMA 3S5ZA 1QPOA 4HSNA 4OHQA 4IX2A 3QJAA 1N55A 3QYQA 5TBOA 3A23A 4HSOA 2CLKA 1HL2A 3KVKA 2P1FA 3W83A 5F4WA 2G97A 5E0KA 1Z42A 1LZOA 3BGJA 1NEYA 4NNCA 1EWEA 4NZFA 1FWWA 3C2VA 4NJJA 1IGSA 3V1PA 3M9YA 5D2XA 3NQ8A 3PUDA 2E1DA 3R12A 4MFDA 1XCFA 2Y7GA 1HO4A 4TMBA 2VKZG 2FPYA 3U6WA 3M5VA 4NU7A 2R91A 4FX8A 1M5WA 4QISA 3TXVA 3PUOA 4YLWA 5DY2A 2ATSA 5HWJA 2ISSA 2PC4A 3W7QA 3EXTA 1AW5A 4IOTA 3OIXA 3P74A 4XWUA 3RK8A 3LLDA 5F1UA 2E6DA 1HUVA 3S5OA 3LI1A 2G96A 2DP3A 2WSQA 3DU0A 3UXDA 3CIXA 3W74A 1FCVA 5D38A 4PODA 3EX3A 4TX9A 3TW7A 4N9DA 1OFQA 2KZHA 2ZA3A 4XUGA 1KTNA 4UUIA 3I7RA 1YTDA 4K37A 4MY8A 1TREA 2JBMA 2QCMA 4AB4A 3GKAA 3TFCA 5TQLA 3TAOA 1TPEA 3HGOA 5AYXA 3F03K 2E6FA 4JTFA 3TSBA 3S9YA 3W7HA 3Q37A 3W2UA 5LZLA 1DORA 3HBLA 3O8AA 4DXVA 3BW3A 4UMBA 4NVTA 1WQ5A 4R33A 4Z0SA 1I8JA 3UQNA 2NUYA 4NZJA 1TPUA 3MHFA 3EX2A 1JRCA 3P60A 1PHQA 1IIHA 2WJZA 3MW7A 3VCRA 2QUTA 1OYAA 3C52A 5K9CA 3IGXA 4RLIA 1JRBA 2YYUA 3NXFA 3QF0A 3MHUA 2DZPA 3EEGA 3KHJA 3IIVA 3DGRA 4MYAA 1WA3A 2FPTA 5HJLA 2ALDA 5F2GA 3UWYA 3B05A 3TQVA 3W76A 5AC7A 2VFIA 1TSIA 1WOBA 1K7FA 3BLFA 1I45A 4ORMA 1TTPA 2ZRZA 3PF3A 4QSHA 2Z2UA 4MYXA 4NJHA 3BPWA 1YPIA 1FCUA 2VENA 5FEPA 1U83A 4DF0A 3NEVA 2Y85A 1LYXA 1XUZA 3G8RA 3C2FA 1PIIA 3CPRA 2QCEA 3TMLA 2B0MA 4O1CA 5EY5A 4BR1A 3S42A 5K4XA 4UTKA 2Y7FA 4CQAA 3L65A 2H3DA 4NQ1A 3C4UA 4ADSA 4CQ9A 4FNPA 5I3KA 4FIRA 1A50A 3NQVA 1H62A 1YDOA 3KAOA 1NF7A 2CLOA 2HTMA 3C2RA 3SJ3A 3PUEA 4FXRA 5IBXA 1BEUA 4JGDA 1YLVA 4JTGA 1KV8A 2RDTA 2ABAA 2J9XA 2XN2A 1Q6LA 1RVGA 4IX0A 2A0NA 5D05A 4JYDA 3G22A 3C2OA 3LHVA 3EB2A 3IRDA 4Y90A 3B04A 3IEBA 1VJIA 1HG3A 4AF0A 2DZWA 3PG9A 2RHGA 3P67A 4OBTA 3PB2A 4R7JA 1VZWA 4IWWA 1TPFA 1XBXA 3UY8A 3HG5A 3NDOA 3L5AA 5AC6A 2C18A 2Q3RA 5BMWA 5LNUA 5K4ZA 1OHLA 2ZZ3A 4MZYA 2A7RA 4H4IA 1OFRA 1VGAA 4K38A 5LSMA 4KFOA 3ELFA 4UC5A 4UFMA 1VYPX 3WJYA 5KZEA 1YADA 2YPIA 5AHIA 1G4SA 1QOQA 3TV8A 3NM3A 4YWIA 1JCNA 1QOPA 3LRLA 1YXDA 3T40A 3W75A 3BVJA 3W2JA 3NQFA 3DENA 4CNNA 3UZJA 4FX6M 1HTIA 3LXCA 4LC8A 3L9CA 3EWWA 3G1HA 3W71A 1KLYA 4ZQNA 3TK7A 1TV5A 1M7OA 2C14A 2GOUA 3W70A 2OT0A 1B9BA 1LOLA 2B7QA 1DHPA 5C54A 3NO5A 3DHFA 3R8RA 2LLEA 3UXAA 4JDYA 3P81A 3W3OA 3W7JA 4ADTA 1KM6A 3NYZA 3PSWA 1K3UA 2JKAA 3CT7A 5FF4A 1W8SA 5KITA 5D37A 1W5NA 4LNYA 3FLUA 1KTBA 1ME7A 2NWRA 2NUWA 1WXJA 1OK6A 2AQWA 4MLJA 1NVMA 2QAPA 2C13A 2YYTA 4JYFA 2ZZ6A 2HSAA 1BWKA 3W1RA 2DZVA 3G1SA 4RJEA 5KZMA 3HG2A 3QMTA 3TUUA 3QM3A 5LKYA 1HO1A 3W2LA 4RX0A 3UYCA 5G1TA 2X30A 2E5CA 3QQ1A 3TC6A 2WSYA 1QWGA 3ATYA 3LDVA 5K2ZA 1RV8A 4YL2A 3OHIA 2YW3A 2JK2A 2NV1A 1DJQA 3ZR4A 4LT9A 5DLCA 2VC6A 3WK1A 3O16A 4XBSA 2B4GA 3UPBA 3GX9A 2NWSA 3OG3A 3N34A 3TCEA 1LRNA 4C1LA 8TIMA 3DH7A 4HNTA 4HPXA 1H60A 3NG3A 3N14A 3KXQA 3HGJA 3QH2A 4HKPA 5G1YA 1GG1A 4XTDA 4Z1CA 1AL7A 5FF2A 1I2QA 2EF9A 3ABQA 4FNSA 3MO7A 1FWRA 3DHDA 3WJSA 3FFSA 1SO4A 4UTHA 4GUIA 1S3HA 4N4PA 3NR0A 3OVRA 2ZTKA 3E02A 5CKSA 1YDNA 2RDUA 3BV4A 3SY5A 5LNVA 3W2NA 4AH7A 3STEA 2FQIA 2Y7EA 3BK0A 3M7WA 4UFHA 1FQ0A 3KRZA 1JUBA 1N7KA 2QCDB 5LHEA 1LBLA 5I3JA 1Z41A 3PR2A 3G24A 5A8GA 3SSJA 3T4CA 3LCIA 1C8VA 3FKRA 5L6UA 1AMKA 1WAUA 1DQXA 5FI8A 3W2KA 3LI0A 3FYOA 3NAVA 5TIMA 2F84A 1H50A 3FOKA 3GR8A 2V5LA 2PE4A 2EAWA 3NVTA 4RZ6A 2H3BA 2G95A 5I3GA 1GVQA 4POCA 4XQ6A 4OE7A 2Z0IA 4M5PA 1DJNA 2ISVA 3MI6A 3PC0A 1I4NA 1F6KA 3LBMA 3QW3A 1F7BA 3ABOA 4UTUA 4NUWA 3LCGA 1I2NA 2W79A 3O6CA 2Q3OA 3P7YA 1LRQA 4JXCA 4PL2A 1F2JA 1YDVA 1AL8A 1EA0A 1W3NA 1SW3A 4Z08A 3S1XA 4DEFA 4UFKA 2GQAA 2CW6A 4NX0A 4JTJA 1J2WA 2I14A 4GUHA 2J88A 4WZHA 4JIQA 1TCDA 1W37A 3LCXA 2VFFA 3DI1A 5EA9A 4O13A 1QFEA 2FPVA 4DQWA 3IGUA 4UCGA 5K7JA 3LXBA 4L4LA 3M44A 3GNDA 4UTLA 1EX5A 3LCLA 2O7QA 4LVDA 3T78A 1EB3A 3W07A 3TJLA 1MEWA 1UBSA 3IIZA 4IMEA 3W7CA 4H3DA 1BTMA 3NL6A 3UZ5A 2OT1A 2TPSA 2E5DA 5HULA 3MBDA 3KRSA 1OFBA 3HOJA 3EKZA 3UWUA 3S1VA 1O94A 3O1NA 1JUKA 4B5NA 1WDWA 2E5BA 1FWTA 1ME8A 3BGGA 4UNLA 5T26A 1WV2A 2QEZA 3QC3A 2X1TA 2ZBTA 4Z1DA 3TR2A 4DBEA 1ZHAA 1GJPA 1RR2A 1TTIA 4OQVA 4X2RA 3ANYA 4A2SA 3S5NA 2VEPA 2ZCGA 4N9EA 4GUFA 3RLVA 1H7PA 2YFOA 4X22A 5AB3A 2V2DA 4N6FA 4FXSA 3T55A 4NJKA 3UWVA 2E6AA 4M6PA 4RR4A 2A5HA 3FA5A 4CLMA 3IGSA 3GDKA 5DBUA 4OWGA 3GK0A 4N2YA 3W1MA 5LGZA 3KVLA 2GVGA 4MIMA 5FF3A 3E0IA 1ZAHA 1K8ZA 3GAKA 1ICSA 1OYBA 3SI9A 2BSLA 2PRLA 1DV7A 2I9EA 3KX6A 4O54A 1AK5A 1WBHA 3EXRA 4GC4A 1D3HA 1U5JA 4JX6A 4LUJA 4GWEA 1R30A 3SIZA 1W56A 4O50A 3O07A 1KM5A 1H5YA 1KFKA 1OX6A 3G0XA 5G4WA 3NL3A 5D02A 3M43A 4O8RA 2H8XA 4GXMA 1OX4B 1GYNA 3CC1A 5G2IA 1PS9A 4EVZA 3LV6A 5DN1A 1RPXA 3TIMA 1TB3A 2BX7A 1CI1A 5C6MA 3A21A 1GQNA 3YPIA 2VEKA 2E09A 4UTWC 1Q6OA 4D2JA 3U8GA 3WK2A 3NQMA 1FDJA 3GDMA 2GPTA 3C8FA 3CWNA 3L67A 4ZVJA 1SUXA 4O0KA 5IM51 1KFJA 3DFOA 3JRKA 5K9DA 3N9RA 4MVAA 2R8WA 2Y70A 1TPWA 1B4EA 2VEIA 3W6YA 4JTKA 4UTTC 1IF2A 4FHAA 2C1HA 4IJBA 4JTEA 3O6YX 1FWNA 3TKFA 2J9ZA 3QPYA 2VFHA 3NQ2A 5AYZA 3F4NA 5CPMA 2RH9A 3D0CA 3LCFA 3CWOX 4K8EA 7TIMA 3P82A 4JY9A 1OFOA 4UTJA 1T8XA 1ZENA 3DFTA 3NPUA 3STGA 3W7GA 5AHLA 4AWTA 2X16A 1EWDA 2QCFA 2Y61A 3G1VA 1DBTA 2YDAA 1N8FA 5KMYA 1YTEA 5HUOA 2ISWA 3LBCA 2DJXA 4Q33A 4IQLA 2QJIA 4BI5A 2A6LA 2YXGA 3BLIA 3THQA 1PVNA 1SW0A 4U4MA 1Q45A 3ZWSA 2FFCA 3LTYA 1EUAA 3LXAA 4XKYB 4PC8A 3FJ6A 5CSRA 1UUMA 4K7YA 3HIJA 3Q2DA 1E51A 1H7NA 1QO2A 3GLCA 3LRKA 1G4TA 1OYCA 2JGYA 3W72A 2DU2A 3O06A 2AGKA 1JCLA 4JD4A 1FCQA 2CWNA 5LNSA 2UV8G 5CPLA 5E1QA 3KRUA 3HG3A 3G1DA 4UIOA 1QNVA 3EWYA 1SR9A 4QJ1A 4JX4A 5EMUA 1CX9A 4PA8A 2C6QA 4I7WA 3ZFHA 3F4WA 4AHPA 3DI0A 4N6EA 4FNRA 5ABTA 5HWMA 3QSTA 3M5YA 4YCOA 3C56A 1ME9A 4A29A 3NPXA 4TIMA 2ZZ5A 3I7QA 3QRHA 2QCDA 3B0PA 3FS2A 2P10A 1X6UA 3ATZA 3NQEA 1QCWA 1G4EA 3GAYA 4HNUA 6TIMA 2QR6A 1TPDA 3B0UX 4O52A 2NXIA 3PB0A 4RKAA 3NL5A 3W1LA 1X1OA 3LRMA 5AFDA 3O6DA 4EOUA 2Y89A 3VI2A 3W9ZA 5KINA 1V7YA 3TXZA 1DKWA 1LBMA 1OK4A 2J9YA 2DZXA 1A5AA 5LHFA 5EYWA 4XTIA 6ALDA 1SSGA 5DXYA 1QMLA 1O5KA 1RD5A 3NA8A 1XDMA 3GZ3A 3NGJA 1W31A 2HS6A 2EGZA 3FYPA 2H90A 3W1AA 3IVUA 4Y8FA 4W9TA 3PBWA 4QQ3A 3W23A 1FCBA 3LGEA 4LVGA 4PTNA 4JX5A 4WY0F 5C2XA 3UPWA 4NXKA 4FF7A 4ALDA 3S8HA 3CEPA 4AHOA 1MEIA 1H7RA 2A1YA 2JKEA 4OV9A 5BW6A 3M1ZA 4TU1A 4Y96A 1G7UA 4LVFA 1O5XA 1LTDA 4WOQA 4XBKA 4ZL1A 1T0OA 3TQKA 2R14A 3HGSA 4IMCA 2Y62A 3MBFA 2NLIA 2GQ9A 5G5IA 4DF1A 1W3TA 3MWAA 3N19B 3NOEA 4EWND 5J5DA 1G69A 3TH6A 3TA6A 3T44A 2J6XA 4Q4KA 5KTLA 3PAJA 1V5XA 2V82A 3MHGA 2BXVA 3STCA 3TAKA 1NAL1 5G2HA 1ZFJA 1MEHA 3JS3A 3NQCA 3OVQA 5C5YA 2BWGA 4CCCA 3GVGA 3S1WA 1EUNA 4MY9A 2YZRA 3SZ8A 2CZ5A 2YCEA 1B4KA 2VELA 1KFCA 1VCVA 2P0OA 2C16A 1TPH1 3PBYA 1XKYA 2QF7A 3B03A 1YTKA 2QCHA 2EKCA 3QQ0A 1OG0A 2ZDRA 3WJWA 3JR2A 4M6VA 2BTMA 1K8YA 3MYOA 1K7XA 5FEXA 3CQ0A 4JTLA 4EF8A 3TW6A 4NNBA 2DZSA 2NX9A 3MYPA 3G1AA 1I2OA 4NX5A 4O19A 1WBJA 1G6CA 1KM2A 3DXIA 1GTHA 1Q6QA 5HWNA 2BLEA 2QDHA 3LLFA 4O12A 3W86A 4MZ8A 3M6YA 4RV8A 2V2HA 5F2IA 3K30A 1Q6RA 1ICQA 3UWWA 3DKJA 1LBFA 2CLLA 2QAFA 5LNWA 4M19A 1J4EA 1OFDA 1R2TA 1A5BA 4MZ1A 1H1YA 4DPQA 1W0MA 3TU9A 1GOXA 3LHUA 4UR8A 2FIQA 2FB3A 2CZFA 3HQ1A 1OF6A 1KM3A 3HGRA 5BMXA 2ZZ7A 1C29A 2EPHA 2YX0A 3P61A 5AHEA 1JQXA 2GJNA 2E6YA 4BWLC 4LVBA 2OMAA 3I7SA 1W1ZA 1GT8A 2YSWA 3P84A 1ICPA 1K03A 5FEZA 1QR7A 4AWSA 4FNTA 4DO4A 1FBAA 3GXTA 1SO6A 2WSRA 2QCGA 5EKYA 1L6YA 1Q3NA 2ZYFA 3UNDA 4MUZA 5FF0A 4O28A 1DL3A 4R34A 2Q8ZA 3G3DA 1P1XA 1B3OA 4UXDA 3HO8A 4ML9A 3QW4B 2QUVA 4YCPA 3NQAA 3KOFA 2A4AA 1QPNA 5DY3A 4O1BA 1TO3A 2B7OA 1TPC1 3T7VA 5KSWA 3NQ7A 4CCDA 4ZQOA 3A24A 5F1VA 2QJGA 5CPNA 3MUXA 1KBJA 5D2TA 1SZGA 3PULA 4O10A 3GDLA 5F4XA 2NZLA 3EKLA 2TMDA 2ABBA 5DXXA 3W1PA 1VYSX 3N9SA 1MZHA 5LNRA 3IVSA 1VCGA 2DORA 3Q94A 3G1FA 4E2BA 1P0NA 3AO0A 1IXQA
chains in the Genus database with same CATH superfamily
2IPWA 4XKYA 3DFSA 4QCFA 4GQRA 2ATMA 3LHWA 3NL2A 3NQGA 4I9TA 5F2LA 3LCWA 4JTHA 3LHTA 3LK6A 1FWAC 2MNRA 4IIHA 4W84A 1UH4A 3DERA 4HNNA 3APTA 5CZTA 1JPKA 1Q7MA 3LYEA 3L0GA 1POKA 5RUBA 4XO6A 1E6PA 1XIFA 2VCAA 3AIEA 2HBVA 1JULA 1MSSA 1SU5A 1VB9A 3UR5A 3IIPA 3T42A 5ECUA 4FR1A 2TYSA 4B2DD 2ZZ4A 3CUZA 4QE4A 4P8UA 1BPLB 3BG5A 1R2RA 3EDKA 1X39A 3W84A 3VCNA 1SO5A 2ZC1A 1TR1A 3L0NA 3VVGA 3WD4A 4DNHA 1EP2A 3GQYA 1LP6A 3TR9A 3CLWA 3TVAA 2NVCA 1PKYA 3COTA 5G4EA 5FJRA 2GGIA 1Y5VA 4DAFA 3PWAA 4I9JA 3KBMA 4FO4A 4NAFB 4PMNA 1A3XA 3S1UA 4D71A 3MCMA 3R58A 4GIYA 1T40A 1L2UA 1KKOA 3SGGA 3U5YA 8CGTA 3OZMA 4BQ2A 4WDXA 4UFIA 2XHYA 4QITA 1NSJA 2YDRA 2EKGA 4ZA0A 3MA8A 4PUKA 4IPJA 3RNDA 1JCXA 3OBEA 3L0KA 4GUGA 1MQQA 1W1PA 3V5FA 2J27A 4UFJA 3DEQA 2NXHA 1VR6A 3WEOA 1DWGM 3LSBA 3SCRA 3TSDA 2VEFA 1KBLA 4DJFC 4GYPA 3AIRA 3IJ6A 3WL0A 2GDVA 2IS7A 1W1YA 4JY8A 1ISYA 3TSMA 5HNRA 3EWDA 4KESA 1CECA 3WMCA 2BBFA 4W4QA 1VRDA 5JVLA 1A3WA 2AAMA 2OGJA 3W2MA 5IFPA 1XM3A 4RK8A 1A5CA 2XVPA 4DY1A 1RCQA 4I7UA 2WHKA 2PCQA 3I65A 3T2PA 1LM1A 1NFGA 2Z27A 3LM3A 2G4JA 3E49A 1F73A 4IFRA 1AVAA 2WC4A 4LBRA 3SRHA 2GGEA 4RZ5A 1K02A 3MUY1 4QHRA 3W73A 1KA9F 4UTMA 3LB0A 4L6HA 3VXGA 3PUGA 4A8IA 4LS2A 3PM6A 1JIBA 3VPLA 4C7GA 5BNKA 4Z1BA 3GTIA 2XZ7A 4JOMA 1JCMP 1ZBWA 5FEWA 3IARA 2ZICA 3EA2A 2W9MA 2WKLA 2Z7KA 3GNXA 4TTGA 4D8AA 2ISDA 4W8LA 2I1OA 2I7GA 1O5QA 1RQEA 2QKFA 4ZQCA 1EEPA 3N04A 2PLCA 3TYBA 4WKAA 4HA3A 3B9AA 2OLAA 2BVTA 5CLTA 4TTUA 4DLFA 3BAWA 3O2LA 3E0VA 2QPUA 4PMZA 2IXUA 4PMDA 1JCTA 2VRQA 3A5VA 3WZ0E 2Z6JA 3UWEA 3K46A 4AD3A 1HZYA 3L21A 4NXSA 3CUIA 3DKLA 1ZAJA 3HJZA 4RZ4A 4AHQA 3VILA 1F5ZA 2WQPA 1RXOB 3V5OA 1EQCA 3R13A 5AYBA 3QLDA 1KBKA 3I68A 1GVEA 3W7OA 4CEUC 2Z1SA 5HQEA 4WY0B 5I6SA 2GZXA 3ZOAA 2X1SA 2HBXA 3IJLA 1E0VA 4IIFA 3K4AA 4JICA 4K7VA 2PDBA 2GL5A 2PAJA 4GE8A 3C2EA 5CBJA 1M3UA 1YYAA 4C60A 5FAJA 1I2RA 3IV3A 1UD8A 5GPRA 3MMDA 4U5KA 2WPBA 1K8CA 2I5GA 3WH5A 3E9AA 1SZFA 2EG6A 3B8DA 2W6RA 3WKZA 3BQ5A 4C6QA 1VC4A 2D2HA 1SO3A 3IAQA 1TV8A 4PRTA 2OYKA 4MWAB 1K1DA 4A3YA 3N73A 4L4MA 1L9WA 3W7KA 1TX2A 4OT7A 4CD5A 4BI7A 1W9PA 4FIQA 4QIUA 3RF9A 1IEQA 1H5VA 1YXCA 3UG5A 3TX9A 3QR1A 3MQTA 3ID7A 1X6LA 3EBVA 4BCEA 4C65A 3ARQA 3VX1A 3W7PA 1E6NA 2UY5A 2Y63A 3IVTA 5DCBA 4HMDA 1V6XA 4MB1A 1GKQA 4O11A 3SECA 4C1NA 3ANVA 3WUEA 5HPOA 3MMTA 4WKHA 4HOZA 5DEZA 4JTTA 1FXPA 3H4XA 3PZGA 2C8NA 4H6KA 3WDIA 3ZJKA 1YPFA 3FJLA 2QPXA 3IK4A 4ERAA 4O16A 4CN6A 1TWZA 1ZNNA 1OT1A 2FB2A 2ZADA 4WXYA 1LWJA 1P48A 4PULA 4HIBA 4DZIA 1ITUA 4S3DA 5HUPA 3K1DA 4JS3A 2PRMA 2PLJA 1SW7A 3FHAA 3LGDA 4RE3A 1ML1A 1XBVA 1J5TA 3AHXA 4OU1A 1IEWA 1DJXA 2VQTA 3E2SA 1CB7B 1GZJA 3W0KA 4PTMA 3PBUA 2IQTA 3BARA 5BXRA 2WNNA 1S39A 2C1GA 3K8KA 4ZQMA 3MC5A 1Q8AA 3KVMA 5FOOA 2ZWYA 1C9WA 2WSPA 4KPLA 4Y9AA 1B0IA 3G1RA 1WDDA 4YXGA 4OGZA 4ZXOA 3S6TA 4JNZA 1WAWA 4XVEA 4AD4A 2XGIA 4RNJA 3BURA 4YHEA 2C19A 3W7LA 1W3IA 3HG4A 3N17A 2PDKA 5CC7A 3UJEA 4QLJA 2GVEA 2WNQA 1TQJA 4C6OA 3O0KA 2G3IA 5CZ0A 1TV7A 1XI3A 5CBIA 5I09A 3ZT6A 4LVAA 1TRIA 4J3VA 2FTYA 2V5BA 2GSEA 5EU9A 1ZCOA 1PYFA 4JTDA 3VO0A 3F4DA 3U7BA 3NCOA 5LGXA 3CT2A 4B9ZA 3O63A 4A8RA 4K6AA 4XG1A 3SCTA 3GM8A 1JNEA 1TWIA 4R85A 3TNOA 3SW6A 2E0PA 5E93A 4XAPA 4MB4A 2G3NA 1YIXA 3DHPA 4DO6A 3AFBA 2WVVB 4S23A 1M6JA 2CLMA 5AZ0A 1V3HA 4BQ4A 1U33A 4UTWA 3RMJA 1GJUA 1TE6A 2A7NA 4HZ7A 4GY7A 2J62A 4XK2A 3FGCA 3BAXA 3UZZA 2D3LA 2X1IA 3ALGA 3F4CA 3W1XA 1Q2SA 5E70A 3IUIA 2D0HA 4KCVA 1BXNA 2Y8KA 4JYEA 3WLRA 2WOQA 4UTTA 2DJLA 4JL2A 1A80A 2YOCA 1GYLA 1QO5A 2FDMA 4E3VA 1QTWA 5JU6A 1XIIA 3IWPA 1QBAA 1X6NA 3HPFA 3UA4A 1OF8A 3H70A 3ZR6A 5DMNA 1SR0A 4Z1AA 2CZDA 3CM4A 3WQGA 4FB7A 2WNWA 1R9ZA 4NJGA 4MFEA 2H9AA 4R88A 3AXHA 3T9PA 2CIPA 2TRSA 1FWDC 2PDWA 3VIKA 5I3DA 1S5WA 5H91A 3RM9A 4EXQA 1QATA 1MDLA 1P7TA 5KZ6A 1E55A 2YB4A 4ONVA 1VLWA 5D2WA 2HV5A 1WZLA 5F2MA 2QMJA 4DUVA 1RSCA 2OWCA 3P6LA 2R1KA 3GIQA 1EC8A 4K8HA 1MUCA 3OBKA 2FTPA 1XINA 4BQ3A 1K7EA 3BG9A 2A2IA 4XIAA 2CU0A 4LRSA 5C71A 4B9YA 3II1A 4CNSA 5DRCA 3R8GA 1DWIM 3LTPA 4LV9A 1DPMA 5HMSA 3MKVA 3A5FA 3GC5A 4HPGA 3UD6A 3N2XA 1HN1A 1VBRA 3WJXA 3KE0A 4AWUA 5AKQA 3L4XA 4MAVA 1TG7A 4HTYA 2REQB 1CGWA 3HU7A 3GDRA 2PTWA 1SFSA 4BFAA 4TO8A 1XDLA 2D1ZA 1KM1A 4TR9A 4Q22A 3SO7A 7REQB 2XIJA 2QUNA 4I6KA 4O15A 5DRIA 3EWUA 1FY6A 3E1F1 3G1XA 3O15A 1A5NC 1GOKA 3BZGA 3CEUA 3H2EA 5AVHA 5HR6A 4DWSB 3CMGA 3RMEA 1B5TA 1IIGA 3VC6A 1EJUC 4EIVA 3INPA 3N9KA 4MF4A 2J7HA 3URQA 4P2VA 4RZBA 2KX9A 2A6NA 1FWBC 2D20A 3PK7A 1VHNA 1SZNA 1P5BA 3G3MA 3LHYA 5A2CA 5BYWA 2QDGA 3W1QA 3KVJA 2OSWA 5JBDA 1QPOA 3E2VA 1Q65A 1DXEA 2YBTA 4OHQA 4LB3A 1BG9A 5D4YA 2G3MA 4WRHA 3V0TA 3QYQA 4HSOA 2CLKA 4LYPA 3CUFA 3R43A 3KVKA 2G97A 5E0KA 1Z42A 4NNCA 1OADA 1EWEA 4NZFA 3H2NA 3M9YA 5D2XA 4EAMA 3NQ8A 1YKWA 3VKKA 3PUDA 1HJQA 1XCFA 2Y7GA 3A3XA 3TOYA 1QT1A 4HYVA 3TN6A 4YLWA 1MUWA 1TE1A 4NZ1A 4D8ZA 3OIXA 3P74A 4GD0A 4HSHA 1I1XA 3LLDA 3ZJ7A 4EE9A 2E6DA 1UZDA 2P53A 4WR3A 2G96A 2DP3A 3L4VA 2PZ0A 2PDUA 3CIXA 3HV9A 4PODA 1MRQA 3EX3A 5A8QA 4TX9A 1ZRQA 5HMFA 3ENLA 3B8TA 4K37A 1E1CA 1TREA 4MY8A 4Z2IA 2JALA 1UZHA 1NDVA 1JZ2A 3HGOA 1XDJA 2QMKA 2E6FA 3W7HA 3PHAA 1MMFA 3W2UA 1DORA 3DBNA 4UMBA 2NUYA 4NZJA 3MHFA 2CPUA 3EX2A 2WJZA 4P8WA 1NOWA 2HVMA 2PP3A 2QUTA 3EGJA 5K9CA 2R1NA 4RLIA 6ENLA 5D8WA 3BH4A 1VFLA 3KOWA 3IIVA 1WA3A 2FPTA 2QLYA 5HJLA 2J78A 2V3GA 5F2GA 1XYZA 2VFIA 1V08A 1TSIA 1K7FA 3O6AA 3BLFA 1I45A 4CU8A 1XIHA 1XSKA 4JTQA 4M3PA 4EPEC 4NJHA 4DF0A 3NEVA 2CXGA 3OP2A 1FRBA 2I5QA 5FIPA 3LG3A 1YEYA 3CL7A 2Y7FA 3KTSA 2F38A 1NP2A 1JFXA 1GGOA 1A50A 3THUA 1ZSXA 4H6QA 4X61A 1NF7A 3APGA 3SJ3A 3OOQA 1F07A 3UZYA 3KWXA 4V1XA 4FR6A 1UPMB 4RDVA 1XQKA 2XN2A 3SCWA 4EACA 1MW1A 4NZ3A 1V93A 2FJUB 1BQCA 4JFUA 3L4ZA 5CBBA 3WBWA 1BYCA 2DZWA 3WLHA 2RHGA 3P67A 3UG8A 3WQEA 3WQFA 4YU1A 1VZWA 1AD1A 3AMLA 1CGUA 3HG5A 2XVNA 1FP8A 4J3TA 3WD0A 1E72M 1GW9A 1OHLA 1EXBA 1FH7A 1E5JA 3ABZA 1V51A 2A7RA 1OFRA 3C2YA 1DJZA 4UC5A 2AKZA 5KZEA 2YPIA 4Z2LA 1G4SA 3M0KA 1MRAA 5C0QA 5I24A 3EDEA 1KR1A 3NM3A 1AH0A 3LRLA 3VIMA 1YXDA 3W75A 3DENA 4FX6M 5GNZA 2XWDA 1BKHA 2NVAA 3EWWA 1KLYA 1Z7AA 1TWSA 1ONWA 1NOFA 3W70A 1YBQB 4L1GA 1B9BA 4ILSA 1E1FA 3F5LA 3N2TA 4KIEA 2G8ZA 1KM6A 3NYZA 3PPGA 1V02E 4XIMA 4AYSA 3ZVHB 1OK6A 1NVMA 3GBEA 1IEVA 2ZZ6A 2VZVA 1TWDA 3QMTA 4DUXA 2XH0A 3QQ1A 2VVNA 3AIVA 3K2GA 2WSYA 5HNTA 2XM1A 5K2ZA 1RV8A 4EP8C 1NH6A 4MTVA 3UCQA 5E6YA 3GC4A 3PTQA 4JTCA 3WK1A 4XBSA 2VDIA 3GX9A 3BAJA 2NWSA 3OG3A 1OSEA 3CZ8A 3I3DA 4JNYA 5ENLA 4HCLA 4YTTA 1KWGA 4NIRA 3QH2A 4HKPA 5G1YA 2HE5A 5DO8A 2PWGA 3ABQA 3ZSSA 3MO7A 1XIGA 5H8UA 1GHRA 4B5SA 3ISIX 1S3HA 3NR0A 3OVRA 5CKSA 4A35A 1G0CA 5LNVA 1ODZA 5IHSA 1SVDA 3ONCA 1UKSA 5BRPA 2FQIA 4WGXA 4DJDD 4DZ5A 3BK0A 3M7WA 1QW7A 1FQ0A 4YNGA 4QBXA 1LBLA 1O68A 2VZTA 2VGFA 1OCQA 3QY6A 3SSJA 3TYCA 1F3TA 2BVWA 3UGRA 1AMKA 4RPPA 4XUYA 3GTNA 3PZTA 3ARWA 1H50A 4PUNA 4PRWA 3NVTA 2H3BA 5I3GA 4POCA 3MANA 1EIBA 2Z25A 4NZ5A 4OE7A 3GVVA 1RJQA 5LXEA 1DJNA 2BP1A 1UWAA 3AMKA 3MI6A 3GXDA 3ABOA 4UTUA 4CKQA 1PO9A 1I2NA 1K4HA 4HNCA 4NZCA 5CH9A 4HCHA 4OBSA 4PL2A 4AD1A 2J8TA 1NWSA 1AL8A 3S1XA 1VP5A 4UFKA 4G7FA 1T41A 6A3HA 4FXFA 3CV2A 5EMLA 1SJBA 3WEZA 4JIQA 1TCDA 5FJJA 1U1UA 3MSDA 4R9XA 2YLAA 1LG1A 2DT3A 3FJ4A 5EA9A 1QFEA 1R5YA 2FPVA 3BLLA 1HXJA 3IGUA 1RBLA 4UCGA 3LXBA 3M0YA 2PP0A 2W63A 3M44A 1IZJA 1YQ2A 2W3ZA 5REQB 3B8VA 5A6KA 1TX0A 2NT0A 2HNEA 4M0XA 3VD9A 4HOWA 3TJLA 3N12A 3OZPA 1UBSA 1CXHA 4C1NB 3DDMA 4G6CA 3W7CA 4H3DA 3FYYA 1BTMA 1NDYA 3NL6A 4C6MA 3VDHA 2R1MA 2TPSA 3GYCA 3KRSA 1OFBA 4BKNA 3HOJA 3EKZA 3UWUA 3O3RA 3S1VA 1Q6EA 1P6CA 4ERIA 5D9MA 5HJYA 2OB3A 2E5BA 1ME8A 4TVCA 3BGGA 4UNLA 4IPLA 3QC3A 3EAUA 4Z1DA 1L6FA 1ZHAA 1S5MA 5MKGA 2E9LA 4X2RA 3CQIA 2VEPA 4GUFA 4GISA 1H7PA 4H6RA 3ZJ6A 3RLHA 1X38A 3EMQA 4PB5A 3ZJ8A 1B3VA 3PFRA 4FP1A 5A6JA 3KCJA 5BU6A 3A4WA 1S1PA 4OWGA 2HZGA 3PZMA 4XSLA 1TFVA 2BSLA 2PRLA 1WXZA 4F3HA 3KX6A 1AK5A 4GC4A 3BMWA 2D23A 4TX6A 1C90A 4LUJA 4B5TA 4JCLA 1R30A 3E38A 2FZDA 1W56A 2W61A 3O07A 1KXTA 2QHAA 3RLGA 1E9ZB 4HA4A 3NL3A 1GKPA 3CV6A 4O8RA 4C5YA 4RUBA 4GXMA 4ZCWA 3TIMA 3B8WA 4D72A 3C5QA 5KETA 1PDZA 3G6LA 4D2JA 1TV2A 4B4FA 3WK2A 1RY8A 1FDJA 1IZCA 4I5XA 1K6AA 3T08A 3BSGA 1KFJA 3JRKA 2RDXA 3N9RA 4MVAA 3W28A 2Y70A 4JTKA 3WLPA 1EJSC 4BEUA 1BYAA 1I6NA 4G7EB 2VFHA 1JL8A 1XIDA 3AXMA 1AA1B 1MZRA 1CENA 4U2ZA 1GQKA 3H22A 3P82A 2VUNA 2F8QA 2F2HA 3A4XA 3NPUA 3VDCA 3STGA 3W7GA 1Q5MA 3RJXA 5AHLA 3VNLA 2QCFA 2Y61A 1QJWA 5HBFA 1MNZA 3WY1A 2YDAA 3RR4A 5HUOA 3R25A 2ISWA 3EA1A 4Q33A 1S2UA 4BI5A 4WEVX 3BLIA 2UBPC 1SW0A 1Q45A 3ZWSA 4JQAA 4MPKA 3FJ6A 1YE4A 4K7YA 3HIJA 5G4HC 2ESCA 3H4GA 5FJOA 3TJ4A 3W72A 2VC5A 1A5LC 4OOZA 3T0BA 2J74A 3G1DA 3TOPA 1JD7A 3V4BA 2X7VA 3EWYA 4JX4A 4MSSA 1U30A 5EMUA 2VOTA 1CTNA 3NTYA 4I7WA 3NQBA 4N6EA 1XSJA 1O6IA 4URIA 4B4HA 5HWMA 3RPDA 3GFXA 4OVXA 4CD8A 4HBKA 4YCOA 2CHNA 3ARPA 2HK1A 4M82A 1V0NA 3GIPA 3QR3A 2QCDA 3FS2A 2P10A 4RL3A 1NU5A 3WBYA 2QR6A 4MUPA 5EMKA 4AFYA 4O52A 2FHCA 2NXIA 1E0TA 3SQMA 3NL5A 3WLJA 4ERGA 3GH5A 1DIKA 3VI2A 2FGZA 3TXZA 1OK4A 1A5AA 1J0JA 3VMOA 1L8NA 3DG3A 4XTIA 1XYLA 5DXYA 1W3KA 4UQCA 1CXFA 2QGYA 3LD5A 5AECA 1XDMA 4FLQA 2F9RA 1J9YA 1XYCA 1EC7A 2EGZA 3UP8A 3GFZA 4GLEA 4GXWA 1FCBA 4PTNA 4JX5A 3W25A 1FWFC 1R9YA 2ZXBA 1Q66A 3IJ9A 4FZIA 4AHOA 4EANA 2VC7A 3LA4A 2G3FA 3WMLA 4UQDA 1FFRA 3GW3A 3O7UA 5CJMA 1J96A 2CERA 2OU4A 4LVFA 3AICA 9XIMA 3WQWA 4XBKA 4F8XA 4ZL1A 1R7AA 1E70M 1L8PA 2R14A 2D2OA 3MBFA 5G5IA 2ZX8A 2Z28A 3B9NA 4C7DA 4HGXA 1EJWC 3BGAA 3TH6A 4QDWA 3TA6A 5FA5A 2ZDSA 4Q4KA 2VDGA 5BXTA 3HFYA 3NQCA 7A3HA 1JYXA 1TCMA 3ITGA 3MCOA 4J5NA 3EB4A 1XHGA 3VNYA 1XIEA 3MV01 4B5WA 2C1IA 2YZRA 3SZ8A 3WBEA 1KGUA 4YJ5A 4E4FA 2YCEA 1FFQA 4NP7A 1VCVA 4YS1A 1POJA 4JPGA 1UD3A 4GI9A 3PBYA 1XKYA 3ONBA 2O9OA 3H24A 1PAMA 2QCHA 4P7NA 2J77A 1DJIA 3ARRA 4M6VA 2BTMA 4ACZA 2VR5A 5FEXA 3CQ0A 2HDJA 4EF8A 4NNBA 2DZSA 3IV8A 4Q6JA 2YZ5A 1I2OA 3M46A 1GTHA 1XLCA 2QDHA 4R27A 5M2FX 1TIWA 3ECQA 4UR9A 1V0KA 2V5KA 1JEZA 2VYOA 3BSHA 4Q8MA 1UZ1A 3K30A 4GQGA 2CXEA 1E1CB 2YL5A 2CLLA 5DMLA 3CMJA 4IG2B 1OFDA 3R11A 1A5BA 1QI5A 1KCLA 1E6QM 1TWWA 2X40A 3LHUA 4PMJA 2CZFA 2CKRA 3OQEA 3N3TA 5GNXA 5BMXA 2ZZ7A 3CGTA 2EPHA 2GJXA 4HA0A 3ALFA 5AHEA 1JQXA 2GJNA 2E6YA 1Y7VA 4BWLC 3QTPA 1GT8A 1ICPA 1QR7A 4XD6A 1MDRA 2FVMA 3GTHA 5EKYA 2YXOA 4LALA 4MUZA 1M53A 2GK1A 5FF0A 3APYA 1DL3A 4A3QA 4AC7C 4LEFA 4CVWA 4ML9A 3QW4B 2VO5A 3AHZA 3KOFA 2A4AA 3KTXA 2B7OA 3TA9A 5C8BB 2VX6A 3NQ7A 4I9MA 4GH3A 2P88A 2BY0A 4ZE5A 3MZ2A 1EHNA 1T7LA 2MUCA 2B31A 2VX5A 5CPNA 2BHYA 4GI8A 3MUXA 4DBSA 1XG3A 4O10A 5BWAA 2QVNA 5F4XA 1ONXA 3EKLA 3VZZA 5DXXA 3N9SA 1FWGC 4RDWA 1UH2A 4PCTA 1HKIA 1VCGA 3N6HA 3UXLA 4EAYA 2PLMA 2V5CA 3Q94A 2WHJA 1OQFA 2DGAA 4ZMGA 4S2BA 3SN1A 4Z0JA 3QFEA 3W7DA 4CNPA 4Z2HA 3TE9A 4DUOA 3B0VC 1T5AA 4E38A 3VGEA 1D3GA 2WMIB 1MXSA 5ECVA 4H2CA 5A5WA 1R46A 1XG4A 5I3HA 2WV8A 2V3EA 3TZNA 3ES7A 3FXYA 4EX4A 2VGIA 4MNJA 4CNOA 3L2IA 1LUCA 3GTFA 1X7FA 4LUYA 2YXXA 3ZS4A 3GVQA 1DE6A 4WK9A 3PVFA 5MHBA 3M0VA 2R94A 4BF9A 1G5AA 2PWVA 3SIMA 1EX1A 1OCJA 4AZCA 2GDUA 3WNPA 4M1BA 4N4QA 5BU9A 1ZL1A 2ZX5A 1NIUA 1XC4A 2PF8A 4PTDA 4JIIX 1ECQA 1YNQA 4LAUA 3AHTA 3A12A 2VDHA 1TR9A 2QUUA 3SR7A 3NM1A 3F1QA 3N29A 4W8BA 3KL0A 1L6SA 3P93A 1E9IA 5D2YA 4GRSA 5AHMA 2C91A 5CPTA 1UHVA 4LYKA 3PZOA 4KCTA 4ZTYA 5D32A 2XTKA 3PS7A 2VTFA 3ITVA 1HVQA 4XZIA 4PCSA 3VDBA 2G50A 3W6LA 4KEMA 1WXYA 1BF6A 4QJ3B 4PMOA 5IXEA 1ALDA 4ZB0A 1UMLA 1VS1A 4O57A 4PSRA 4H6EA 3QPZA 3A9IA 3B06A 4RXFA 3DYMA 3VK5A 3HJEA 1XD0A 4S1FA 1EJXC 1XPYA 1W5PA 5HPCA 4IPPA 1TPB1 2EXOA 1FWSA 1RCXB 5EMJA 1Q4NX 2OFJA 3NQDA 3TTSA 4ML4A 3QLLA 3T8LA 4NT0A 4DZHA 1JR1A 2FGLA 2BOEX 2DFAA 3W1NA 4DBDA 2VFGA 3T09A 1JCJA 1G67A 1GVSA 3W7EA 3LERA 1FKXA 4CNUA 3MP4A 2ON3A 2Z29A 2WYSA 3M0ZA 5AC8A 4DXXA 3U9IA 3BO9A 4IUGA 1GWJA 3C0SA 4J2MA 5DFAA 1CW2A 5IDZA 4IQDA 1OC5A 2OWWA 5FCZA 4MNMA 1EPXA 4MDOA 3CTLA 3RCYA 4QLLA 4O8AA 5F4SA 1LOSA 1AG1O 3O9NA 3WCZA 1IR1A 2NX1A 4N02A 3DHUA 1MYRA 1HP5A 2BB0A 3UGVA 3UT0A 3PPCA 3T4WA 1XWYA 3OQ8A 5A6AA 3K4DA 2VI0A 4WSKA 3TLQA 4GY0A 4UFLA 5U4NA 2ZZ1A 3B8UA 3MSRA 2OQYA 2DUAA 2W66A 3RLUA 2WAGA 1MO0A 2J7GA 4GZEA 4NL1A 3STFA 3WD1A 4AUBA 2CLHA 3AXKA 2Z1BA 1R47A 2RAGA 3WELA 1UR2A 1C92A 3HV8A 1U5VA 2ZWZA 1AFSA 3ABRA 3DCPA 3K5XA 2PDGA 1D8CA 4GCXA 3HPSA 4M80A 3S6DA 3MS8A 4YPJA 1KCKA 4IMGA 4AAJA 3GXPA 4O4WA 3GH7A 4LY8A 3S2CA 2V63A 3RU6A 2DSVA 4O14A 4UZUA 4QR6A 4L65A 4K36A 4Q8WA 1J0KA 1EIXA 1UP0A 4PMQA 3BCDA 1JXKA 2FJKA 3EDFA 3RILA 3U7VA 1M65A 4JN8A 3GC2A 5A2BA 1HFBA 3S6OA 2H8ZA 3TWBA 4LUTB 1F74A 1DWJM 2CYGA 1UUQA 3PZVA 3EDDA 4C1KA 4Q8NA 3CB3A 3U4AA 4K39A 4IMFA 1E9LA 4NYUA 3UWQA 2V30A 4M7TA 1W91A 4NF7A 4N9CA 4GJJA 5A95A 5FJUA 4GBDA 4B5XA 2OZ3A 1W9UA 3VE9A 1WX0A 2JFEX 4UBPC 1PV8A 3THDA 1FDZA 4C6KA 3BW4A 1CGYA 4WX2A 2J13A 3KOXA 3TDFA 3L68A 3C61A 2QVHA 2C3ZA 4XAYA 4HZMA 3RCNA 4DX3A 1PIGA 3OODA 4PUMA 1DJHA 1XYBA 3CAQA 3OLGA 3LMZA 2C79A 1W54A 3CHVA 4XAZA 4O0ZA 2QCCA 5MKGB 3QY7A 4QNWA 3P8JA 4MKVA 1X7IA 5CPQA 3WK0A 4FEZA 2VQUA 3SFKA 1KFBA 4IISA 3UYIA 4CCZA 2E1WA 2O9RA 4FNQA 1IEXA 4IGHA 4ZO6A 4H8UA 4IFOA 5EPDA 3TN4A 3W4RA 1JNDA 2XFRA 5I79A 3VGBA 1HVXA 3G0SA 4B3ZA 3W37A 4ATLA 1PKNA 3VOHA 4GBUA 3AIUA 1X1ZA 4EPDC 1LG2A 2QJJA 1ZBKA 4EXAA 2R24A 3QN3A 1DE5A 1ZCCA 3SBFA 3B9EA 1CDGA 2OX1A 1XP3A 3MU7A 1P0DA 1RAKA 2WNZA 2FH8A 3EPNA 3WD2A 3WX7A 3AMGA 3LTSA 5D30A 1M01A 1NF0A 2EPOA 1F05A 2EHHA 4LYRA 1MI3A 1VHCA 3ITCA 3Q58A 4ZGYA 2Y5EA 2QCLA 4L7ZA 1EP3A 1HKWA 4H9TA 1KFLA 3U4FA 2B7PA 2F7FA 1J01A 2Q6ZA 4RE2A 3TQ0A 5I7GA 3PNZA 3EX6A 3MUZ1 1UQYA 1BWLA 3BLDA 2JIEA 4W7WA 1DTNA 1K4GA 4D1JA 3HFTA 1G94A 4IXXA 1H51A 5M3WA 4ICCX 3G8EA 5D2VA 1J0ZA 2A3HA 3BL3A 3VDGA 5DELA 5J8LA 4QE1A 2WVSA 1W1A1 2P8BA 3HQOA 1LROA 3W6MA 4PE8A 1H49A 4GVIA 1HNYA 3WMSA 1CBGA 1FHVA 2V81A 5FACA 3RM4A 4ZTXA 4E2DA 1SZEA 1I0BA 1W1IE 4HN4A 4UMCA 2ACQA 3FAWA 3T05A 4AMAA 3B9DA 5DANA 3KCLA 3V18A 2W91A 4IFKA 5FAGA 4PBGA 2ZUTA 4MB3A 1V03A 1VAHA 4Y9MA 4W7VA 1A5SA 1B3YA 4FLOA 1GQLA 1BGGA 3WQDA 3DECA 3IJ8A 1F8MA 2HISA 4KCWA 4AZBA 3SY1A 4PR4A 4XZ9A 4EPBC 4NASA 4GUJA 1ADOA 3RUBL 4ADUA 2XIBA 1WYIA 1UD5A 5BCAA 4HPJA 1GYMA 2BY2A 1W9BM 2P50A 1KXQA 4QAIA 3WDJA 1W5OA 1RQHA 3PANA 1J2BA 1K77A 3D47A 3TROA 4L1WA 2PURA 5XIAA 4JTIA 3HMJG 1IHIA 1AQHA 1UASA 3KP0A 4Y2WA 2I57A 4WJEA 4XZNX 1ZP3A 4WQ6A 5DCEA 3KL5A 1DVJA 1R85A 3WLLA 2PGWA 4QROA 3WJZA 2E9BA 5BOFA 3BSMA 7CGTA 3CAVA 3W85A 4TOQA 1B9ZA 5CZJA 5AZ1A 3RITA 4WDTA 1TVLA 2G5WA 4E8DA 4OV4A 1SFLA 3BOXA 3GHSA 2P5NA 4X0VA 4O1DA 5LIWX 3AMCA 2EG7A 4WHBA 1QPRA 4A2RA 3CB8A 2E28A 4PMUA 2DT1A 3WEMA 5U7SA 4Y9NA 3BLEA 4WY0A 3T6CA 3P8IA 3MKCA 3LV5A 3TCSA 3EEZA 4H01A 1SJCA 2ZE3A 4R5EA 4GYFA 1G1YA 4OOUA 3S83A 3R0KA 1LORA 1NELA 3QY8A 4RNFA 2PDNA 1YXYA 4K3ZA 4FLRA 2PWFA 1GONA 4MLRA 4F66A 1VFUA 3GB6A 2ZRWA 3U3HA 1UIOA 2OJPA 3VZXA 3BTNA 3QZEA 4JQ1A 4ZO8A 3NZ1A 3EA3A 2FLIA 2YFNA 4LOCA 3C8NA 4LAZA 3GHRA 1OC6A 3ZT7A 3KOZA 5B7YA 4LYQA 5T9BG 4G1NA 1ZS2A 3OGSA 1ZJIA 4JN6A 3NQ6A 1TMHA 1EJVC 4X60A 1JJKA 1KB3A 1W2VA 1MW0A 4PUUA 2HS8A 1HJSA 1PCKA 4BEQA 1QASA 3M41A 3NDYA 3FVDA 2DQWA 3KLLA 4P7RA 2XFWA 4TVDA 2F6KA 4ZFMA 5HMDA 4LU0A 1RK6A 4IQEA 4JR5A 1A53A 5BWFA 4F0LA 3MUCA 1ZB5A 3HB9A 1BSIA 1SFJA 4JEQA 1QI4A 3ITTA 1XH0A 3WENA 3IIXA 1IT8A 3KHDA 1DQUA 1RQBA 2XN0A 4RDZA 1TQXA 3H55A 1I2PA 3CZEA 3U2CA 4F2BA 1NFBA 1H4PA 3R5EA 4BY3A 3W87A 1TJPA 3LBOA 3WDRA 1J8VA 3S5ZA 1OG6A 2DVXA 2F2KA 1NWUA 2IKHA 3S1GA 4IX2A 3QJAA 4CD6A 1B90A 2Z26A 1HL2A 1S2CA 4L4OA 2GJXB 3W83A 4KBXA 5LIYX 5C7HA 1K70A 3BGJA 4UNIA 1NEYA 2NVDA 1FWWA 4NJJA 1IGSA 1V3JA 1R0MA 3R12A 3FA4A 3RPMA 2G41A 1M41A 4S3CA 3M5VA 1ZTVA 2R91A 1EDTA 4FX8A 4QG8A 5I06A 4L9ZA 1M5WA 3ITOA 1ITQA 2ISSA 2PC4A 3W7QA 5A6MA 1M7JA 2XVLA 3NEHA 3RG6A 4XWUA 1M7XA 1UPPA 4RNIA 2PDJA 4Q4OA 3R8HA 4HYWA 1FH8A 3S5OA 4KEZA 1V6UA 3KOYA 2DPEA 5D38A 3LUTA 4N9DA 4AZ7A 1OFQA 2KZHA 2ZXAA 4XUGA 1KTNA 4OTKA 4E4UA 3OLDA 2AL2A 1AUSL 1UJQA 4UUIA 1MVYA 2JBMA 3TFCA 3TAOA 4HMCA 3F03K 1XYAA 4JTFA 4W93A 3Q37A 1W9VA 5LZLA 4TX8A 1VFMA 1L2QA 4DXVA 2XH2A 3BW3A 2BHZA 4I8YA 4R33A 4FF5A 4Z0SA 2GOKA 3UQNA 1SZRA 4D9PA 1PHQA 2XJ7A 1IIHA 3MW7A 3VCRA 1OYAA 1XLJA 3WDQA 1MFVA 1A3HA 1JRBA 3SADA 4PMXA 4FI4A 3P0WA 3QF0A 1RHCA 1RJRA 3PWIA 2Y0FA 2J7EA 1QW8A 1G01A 4JKLA 3UWYA 3CS2A 4LAOA 3WQ5A 3K8LA 2DZAA 1V3IA 1ENUA 4ORMA 1TTPA 2RJGA 4QSHA 3H23A 1LJYA 1PZ0A 2WVVA 1KRAC 4MYXA 4C7FA 3BPWA 1YPIA 3WLNA 3I4KA 1U83A 3LZ5A 1J79A 3G8RA 1PIIA 3CPRA 4L64A 2YJQA 2JQXA 4O1CA 1XGDA 1V7AA 3UVAA 4UTKA 4WGHA 3MZNA 2OYMA 2H3DA 4NQ1A 3C4UA 1JDDA 4FIRA 3QGAC 4L80A 2G4FA 3CASA 1YDOA 3SN4A 4KGLA 3T8QA 2HTMA 3C2RA 5IBXA 3GG7A 2D2GA 1PXGA 1AMYA 2WC3A 1BEUA 2HXUA 1TJ2A 3TONA 2ABAA 1YHTA 1RVGA 4S3EA 2W67A 3L7RA 3A6OA 1XRTA 3IRDA 4K1WA 3IEBA 3QQWA 1WDRA 3VA8A 3WLOA 4IP7A 2VC9A 1UBPC 2ZX7A 2OSXA 1KD0A 3PG9A 4OBTA 2X0YA 4R7OA 1XBXA 3UY8A 3DX5A 3H21A 5BMWA 5LNUA 3GVWA 4MZYA 1R86A 1VGAA 4K38A 4C6DA 1VD6A 2DIEA 2XGZA 4UFMA 4QTGA 1QOQA 2ACSA 3TZFA 3CK5A 2GVYA 3GW0A 2INZA 5AYIA 3WLMA 4GNVA 3PP7A 3UZJA 1TV4A 1RPKA 1S2WA 3L9CA 3W71A 3G1HA 1A4MA 2VHLA 4QS5A 2HEJA 2JF7A 1QI2A 1M7OA 1BG4A 2C14A 6XIAA 1LOLA 1AH3A 3ZVIA 3K13A 5C54A 3DHFA 2LLEA 4JDYA 3P81A 3QXBA 1XH1A 3W7JA 4ADTA 5XINA 2PLKA 1VBUA 1K3UA 2JKAA 2POZA 3CUXA 4ZODA 1U1JA 3XISA 1W5NA 7REQA 5CC3A 1XYMA 2WPGA 2QAPA 2YYTA 4JYFA 3URBA 1BWKA 1CXKA 2DZVA 3G1SA 3VNJA 1ZPTA 5CJ5A 2DZBA 1HO1A 3W2LA 4RX0A 3KRBA 4J3XA 3A47A 3TN5A 3N4EA 2X30A 2E5CA 3TC6A 3ATYA 3FAXA 4XX6A 2YW3A 2NV1A 2JK2A 4DJDC 3UPBA 4AU0A 4HYRA 3N34A 4GFIA 3DH7A 3SB0A 5LA0A 4HPXA 1E4LA 1PZ2A 1NWRA 3KXQA 3HGJA 4XTDA 4Z1CA 2TODA 1GQIA 3H7RA 1XCWA 1XSIA 3RAOA 4FNSA 4PTVA 3SCUA 5LIKX 1FWRA 3DHDA 4B16A 1SO4A 4UTHA 1TELA 2PDCA 4PB3A 2RDUA 3BV4A 4Q4MA 3W2NA 4KW2A 2Q09A 2GGJA 3I10A 3PBGA 2Y7EA 3KRZA 1JUBA 4XAGA 4D6JA 2PA6A 3H4WA 2G3JA 4HK6A 5A8GA 3W27A 2PTZA 3LQGA 3FKRA 3HPAA 1HL9A 3AXXA 3H7VA 1DQXA 4GPNA 4H9VA 2WWCA 4UOQA 2X2YA 2PDYA 3MJMA 2ZKMX 5TIMA 4E5TA 3FOKA 3GR8A 3TEVA 5HNUA 3V0UA 3W26A 6CGTA 3WQ4A 1VFOA 2EPLX 2WJDA 1GVQA 1PZ1A 3EOSA 2Z0IA 4M5PA 1PZ3A 1JF6A 3LBMA 4PN2A 3QW3A 1XGZA 3VIFA 1TJ1A 4NUWA 5EFFA 4KEVA 2Q3OA 3V0SA 3MUIA 3E6EA 4JXCA 1VKFA 3HQNA 1EA0A 2QULA 1SW3A 2BOFX 1QK2A 2CW6A 4JTJA 1Q7ZA 2XVGA 4GUHA 2WHLA 4A3HA 5JMUA 1IGWA 4O13A 2QPSA 3T07A 3FVMA 3KCOA 4L4LA 4EPKA 5FSDC 1EGMA 1A5MC 3WLTA 2W62A 3T78A 3UW6A 2WBGA 8RUCA 3AU6A 1MEWA 4LFYA 3VNKA 3NFUA 4R9OA 5BXSA 4CVUA 4FALA 4IMEA 2XFYA 3EKGA 2J75A 4QX4A 1RD6A 1Z8AA 3KDOA 2OT1A 3S2NA 3BE7A 3DN5A 1J18A 1X98A 3OB8A 1W9DM 1O94A 1PUDA 1RP8A 3ANUA 1WDWA 2IPJA 3WBAA 3BMVA 1BSLA 4Q8OA 3BLOA 3GY1A 1SM9A 1FWEC 5T26A 5C2CA 3L4WA 1TA3B 2X1TA 1UW9A 4DBEA 4DB7A 1RR2A 1TTIA 4OQVA 2ISFA 1FH9A 3ANYA 3S5NA 4UQEA 2ZCGA 3CH9A 3LENA 3VMPA 3B3DA 2YFOA 4YTRA 3AYRA 3W82A 4N6FA 4FXSA 3C0LA 3T55A 1CWYA 3UWVA 3LNPA 2XVKA 1O12A 4RR4A 4AMCA 2AGTA 2A5HA 3FA5A 4L6DA 3LPOA 1MWOA 2R82A 4BS0A 2NQ9A 3GK0A 4HB7A 5BRQA 1J0HA 3MO4A 2VD8A 3GAKA 3WDPP 1ICSA 1DV7A 3PBMA 1ITCA 3KBVA 4O54A 5A6SA 3EXRA 2QT3A 2G37A 2HVNA 4D6FA 1U5JA 4GH1A 5E09A 1KNWA 1BTCA 4O50A 2BVDA 3QKEA 3UJ2A 2W5FA 1KFKA 3G0XA 5G4WA 1EQPA 2H8XA 4FSAA 1GYNA 5G2IA 1PS9A 1VEOA 4G2DA 4IPNB 2DDXA 1TB3A 1W8GA 1VEPA 2DIKA 1Y5WA 1Q6OA 1XRFA 2Q8XA 3HZ3A 3IJDA 4QJ4B 4Q7NA 3WNKA 4B5VA 4YTSA 3GDMA 3C8FA 3FK4A 4O1FA 2PDMA 4ZVJA 1SUXA 4W5UA 2OG9A 1NOUA 2YCIX 3DFOA 5K9DA 1XFCA 4IFKB 4Z2JA 1CLKA 2YB1A 1N2VA 3VKDA 1TPWA 1U22A 2VEIA 3W6YA 4DNMA 1FA2A 4AZHA 1YBQA 4MGGA 2C1HA 4IJBA 3LMYA 3EOUA 1FWNA 2J9ZA 3D3AA 4IGSA 3QPYA 3WD3A 4WKFA 3NQ2A 4GHRA 5AYZA 3F4NA 1DWHM 3E5PA 3VD3A 5D9OA 3EDJA 3LCFA 4K8EA 1AQFA 1UYQA 3S3GA 1Q2RA 4OUEA 4UTJA 3R7MA 3ZVHA 2X16A 4Z1YA 3LGGA 1UKQA 1PX4A 3G1VA 1LQAA 2ONEA 4ZO9A 1N8FA 3LBCA 2DJXA 2FVLA 4IQLA 2PBOA 2PWUA 4XD5A 4AY1A 1XLBA 4ATWA 2FFCA 1EL3A 3LXAA 4M81A 5CSRA 4KRTA 1E43A 3N4FA 1H7NA 1EZ2A 1QO2A 5MF5A 4DI8A 4EWJA 7TAAA 3KDNA 3VDAA 2DU2A 4JIRA 4MJ2A 3IANA 4Q8QA 2DSUA 4P7QA 5CPLA 5E1QA 1KRMA 4E4PA 3HG3A 1UC4A 1QNVA 1SR9A 3A9BA 1CX9A 4PA8A 3PNUA 2CHRA 2Z2AA 3ZFHA 4AHPA 2PD9A 4HJFA 3CQHA 5ABTA 1AODA 4M29A 1KXHA 4JFWA 3BXWA 3QSTA 1JYVA 3M5YA 1R38A 1ME9A 1XLIA 2QIWA 3NPXA 1E9YB 3H26A 4TIMA 2ZZ5A 3I7QA 4ZO7A 1X6UA 3VNZA 2JF6A 1CGXA 2OTDA 4MKSA 3ATZA 5A1AA 3CL8A 3GAYA 1W3HA 3UR7A 4B91A 2Z4GA 1P0BA 4Q7BA 1BAGA 3NVDA 3L4UA 1TZZA 4XV0A 2Z1KA 1H0IA 5CC5A 2FHBA 4GYPC 1C7TA 1GOQA 1DKWA 1YDYA 1AZ2A 1W3LA 2ZUSA 3VUSA 1LBMA 2WWDA 1UA3A 4IP4A 4ZOBA 4E2VA 1SSGA 3GS6A 4WIWA 2P76A 4XB3A 2A3EA 4C6CA 2I56A 4GIAA 3VAVA 2HS6A 3FYPA 4Y8FA 4W9TA 3U2EA 4IICA 1EFZA 3V7PA 3PTDA 4HHMA 1OIFA 1QNPA 1F9CA 4WY0F 2Z7GA 4KH2A 1CXEA 5KEZA 3KP1A 3S8HA 1NP0A 3CEPA 1MEIA 1H7RA 3O0FA 2JKEA 5BW6A 1G7UA 3NWRA 1LTDA 2BMBA 3CH0A 1KRCC 4C6NA 3TNBA 5REQA 3THCA 5A6LA 1PKMA 5BOEA 3N19B 3NOEA 1G69A 2HE8A 3W38A 1GCYA 1WCGA 3IJQA 5G2HA 4BJHA 3R10A 4AX6A 1FOBA 1UD2A 2BWGA 4CCCA 4LXFA 1B1YA 1GPFA 3QV9A 1OIMA 1EUNA 4MY9A 4ZSUA 1A0EA 4XBJA 5E0FA 2OQLA 3AU2A 1KQZA 1OCNA 3CAWA 3ZXWA 4FA3A 1QHZA 9RUBA 1UIPA 2ANUA 2WSKA 5CQ1A 2C16A 4FPSA 1SFTA 2QF7A 4CD4A 4ZB2A 2KAUC 4YYFA 2EKCA 1OG0A 2ZDRA 3MVTA 3JR2A 1QRQA 3MYOA 4OJYA 3TW6A 2HCVA 5LIUX 1PJ9A 1G6CA 1KM2A 3J7HA 2A79A 1XS2A 4DJED 4O12A 2PP1A 2PFHA 4MZ8A 4XD3A 4I6VA 2AL2B 4RV8A 2V2HA 5EB8A 1Q6RA 2WKGA 2E8YA 4M19A 1W3JA 1S2VA 1R2TA 4N42A 5HAOA 1MQRA 5DX7A 3WLIA 4Q6XA 3LPFA 1REQA 3RYSA 3UA3A 4Z17A 5I00A 1CLVA 1ESWA 3QV7A 2AQOA 4F40A 4LH8A 3TYZA 3AMDA 3P61A 3KLKA 2BS9A 3WQ6A 2I17A 3JZUA 2XGBA 1UOKA 3I7SA 4V28A 4E2OA 1W1ZA 3P84A 2YSWA 4S3BA 4AZ5A 3AWOA 1LQ2A 3ICJA 2IXVA 2ZYFA 3RRXA 1K6WA 1WKYA 3OW1A 3L2LA 4YN5A 3UNDA 3NSMA 3G3DA 1P1XA 2NQLA 4AC1X 4G7EA 4YCPA 4GYKA 4US6A 5DY3A 1S1RA 2YIHA 4FS9A 3E3HA 2XWEA 7ENLA 3T7VA 2WLZA 4GZIA 1UR4A 3MWCA 2QNEA 4OFCA 4S3FA 5IOBA 1PDYA 2QJGA 5E6ZA 4XVDA 3I3EA 1KBJA 5D2TA 1SZGA 1BXCA 3VIJA 3GDLA 5I03A 1YW1A 2NZLA 1BXBA 4WCJA 1JFHA 1GEHA 3Q67A 1VYSX 3W1PA 4KMQA 1EF3A 1MZHA 1JPDX 3S47A 2OOFA 3AO0A 1OFAA 4EK7A 2A85A 4CGTA 1IXNA 2OO6A 1OX5A 1VFFA 4WOZA 4Y6GA 1TIMA 3CWHA 1JF5A 5DCDA 5FJIA 5EMYA 4PUDA 4E0CA 4HN8A 5C2GA 1HJXA 3E96A 4I8DA 3ME3A 4NAEB 4DAIA 4U28A 4B3KA 3TLLA 5HXMA 4JBRA 2WBKA 2GJLA 5FF7A 2C15A 2PRHA 3MJYA 1XPGA 1PL9A 3CQJA 2IKIA 2JEPA 1T99A 1DWAM 2X42A 3WK3A 1RH9A 1XLDA 2J7CA 3DFYA 2PBGA 4OKDA 1CNVA 2P3ZA 4J40A 1ODUA 1Z44A 5AOUA 3BUVA 5JBFA 3GG0A 3KZPA 4O53A 1Z48A 2V3FA 1ZJBA 1RLCL 1UWQA 4FOUA 4M6QA 2E68A 3LN3A 2GJPA 1DEDA 2QDEA 3HPZA 3M5ZA 2Q8LA 4BQ5A 4BI6A 1MW3A 4GX9A 3G1YA 3NPVA 5IHRA 2D22A 1C8XA 3S46A 4Z2KA 5EL1A 3U57A 3G18A 3MT1A 4IQJA 2GQ3A 1E1EA 2Z1XA 3VE7A 2CBIA 3WG6A 1VRXA 5KZDA 3REQB 4HTBA 3RGTA 1KW1A 2NX3A 2PGEA 1P4CA 4JHZA 2J24A 4ECLA 4GACA 2X1UA 3VOFA 4A21A 2HROA 3VFCA 3VMNA 2TAAA 1R87A 1XRVA 1IE7C 2DVUA 1LLZA 3WBXA 1JCYA 1UR9A 4KWVA 5I23A 2BGNE 4GOAA 4A22A 2CC0A 4HD5A 4GZJA 2GWGA 2W4XA 3MMUA 1OEPA 3LM7A 1BYDA 2OLHA 2HXTA 3OGRA 2QJMA 2NV2A 3T81A 2CFFA 4AY7A 3D3FA 1F76A 1VJZA 1VPXA 2ZZ2A 4UTFA 2Q02A 3M5XA 3VFLA 1OFEA 4AQLA 4UTIA 1GTEA 1ZAIA 4AWEA 2AL1A 2BFGA 1S5VA 3FEQA 4MY1A 3USBA 3CZJA 1UZ4A 1R3WA 4JFSA 4ZXLA 2C71A 4Q8TA 3HM7A 4P5UA 3QKZA 5L9FA 1KBIA 5GQBA 1P0KA 3W1UA 1U5HA 4AW7A 1H1ZA 3POCA 3CUJA 1QPQA 1BKSA 1Q7QA 3T0CA 4N7QA 3BOLA 1CT5A 2NSXA 3EWXA 2OEKA 2V38A 4LTSA 3GXNA 4CQ8A 5DMMA 3W00A 1GZGA 2EPKX 5AHFA 2CLEA 4IG2A 1Y0EA 2ZOXA 5AHNA 4D6GA 2XISA 3BV7A 2IKJA 1XL9A 2GGGA 4GX8A 2GSHA 3H8AA 2V8ZA 2ZQ0A 1SPQA 2EO7A 4NKCA 3SUTA 3KBWA 2GQ8A 4MDPA 5AC5A 1K8XA 3LY0A 1O4UA 3SDOA 4DELA 4O18A 1DQWA 4MJMA 4WD0A 1R3VA 3S2LA 1X8FA 4JHOA 4Q8VA 4PUJA 1AD4A 3FIGA 5EGRA 4QSFA 3TMQA 1IXPA 3ZZ1A 1GVFA 4LCQA 1VJSA 3CL6A 4KFNA 2WC7A 3G0UA 4DPPA 4MNLA 1GZ1A 3AUJA 5K9XA 3C3NA 3OU8A 1QUMA 1I9CB 4ICNA 4J7RA 2PUZA 1WDPA 1XYFA 4WUIA 1GNXA 3N2CA 4PL1A 1RBOB 3TC7A 3JW7A 3PZQA 4R53A 4RCXA 3AS2A 3V75A 3MI3A 4ZR8A 3G2GA 4PEKA 4LV4A 1D7FA 3SUWA 2GUYA 3HPXA 1US0A 4QCEA 4EF9A 4MWAD 2BY3A 2GVLA 3L5MA 3ZLHA 4ZQPA 3HQPA 4KS0A 4G56A 1E15A 3WNOA 3TQPA 4MNKA 2QS8A 1RA0A 2FZ9A 4IJRA 4LQ1A 2PWEA 2CEQA 3OEXA 2WMIA 1HW6A 3KZSA 4O1AA 1ZALA 1XGEA 2ZUVA 1KM0A 3R0DA 4V33A 3QMSA 3R89A 1G4PA 1GEQA 2BZNA 4NI3A 4I3GA 4W88A 4UNKA 1K9FA 3FNDA 3DFPA 3N11A 5A8NA 2WKJA 4JIPA 1TRDA 3CLMA 3B9OA 4PTXA 4BF7A 5JBEA 3USZA 2X8RA 4REQB 3URAA 1UKOA 4ZBCA 3P80A 4BK9A 5M5DA 3GYEA 5HINA 2VNCA 1OY0A 4TXEA 1V3LA 3LCHA 2D3NA 4HK7A 3UJSA 4UMAA 1EF2A 1I75A 3PSVA 3T0DA 2YR1A 1WOAA 4BA0A 3OVPA 4CQCA 2NXGA 1PB0A 3E0WA 3M4HA 2BOGX 2YDQA 5CZSA 5HQMA 2J7BA 2CITA 2Y1HA 3DESA 4GI6A 2VM8A 1JAEA 3XINA 2XN1A 4JTAA 4P8VA 1QK0A 4UZSA 1QNRA 1CYGA 4AEOA 5E0CA 2RFGA 3N18A 4S3KA 1CCWB 1TUXA 4NNAA 4DF2A 1XBYA 3IJIA 1GVRA 1TTJA 3NSNA 4HT3A 3WNLA 1K9TA 1T96A 1PBGA 4P8XA 1HX0A 2NSOA 2YCLB 1J11A 1H61A 2INEA 3WNMA 2PDLA 2WVTA 2PB1A 3LOTA 3CJPA 3HF3A 4X9SA 1OX4A 4RW3A 3ZWTA 4R7WA 4L6OA 2EQDA 3KBJA 1C8YA 3AYTA 4GFSA 4IPIA 5D9PA 3NZQA 3A13A 2O0TA 3ABXA 3SUVA 4DJFA 2ZTJA 4PYSA 4D1IA 3MCNA 3F7JA 3IAPA 1XLEA 3EXSA 4YWSA 1SSDA 1Q6DA 1ONRA 1PE1A 1XUUA 1IQ8A 1L6WA 1LLOA 2AAAA 3CO8A 2I9UA 5I02A 3FSTA 4MOZA 4B5UA 4ZENA 2E67A 2OLSA 2V0TA 1QW9A 2CLIA 3CU2A 4I7VA 5F7UA 1OVDA 1XFBA 2O7SA 1R2SA 3AOFA 5CC6A 4MG4A 4LRTA 3DFHA 1NARA 3H12A 1OGBA 3FDKA 2HMCA 4PCFA 1EGVA 1TZ9A 2ZRYA 4IMDA 4O4VA 2ZRXA 3MP5A 1UUOA 1IZKA 1JPMA 4RW5A 1FUYA 5BROA 3DGBA 1UCWA 1XLAA 1VCFA 2GWNA 3M16A 5FESA 1DP0A 4CNTA 3MPGA 1H1NA 2O4QA 5A94A 3ORWA 1TPVA 1E71M 1YRRA 1QOXA 2HRWA 2QXWA 5SWUA 3H54A 4JTUA 3W7MA 3ZYZA 5M1TA 1BHGA 4L56A 3E12A 4AF0B 4H7ZA 1KTCA 5I0DA 1W5QA 4C6LA 1BLIA 2VZUA 1T6MA 5LA2A 1RVKA 4WJ8A 1D9EA 3WH7A 4GYJA 4FX7A 3UY7A 3PJUA 4LUTA 4YVVA 3PPHA 3KBSA 1MUMA 1OM0A 1FWIC 3TJXA 3C0JA 3GO2A 4M8UA 3VIHA 2WMJA 2RDWA 4J1OA 1Y8BA 1L6GA 1HL8A 1MXDA 3EX1A 1JQVA 4DZAA 1O60A 2CBVA 3BAYA 4ORIA 4OZOA 2BGQA 2V2CA 3LU2A 2CLPA 1CGVA 4LWWA 1FXQA 2GVJA 1VLIA 1OT2A 1KQYA 1DIOA 2I16A 3DYPA 3UG4A 4PTWA 1OJXA 2FFIA 3TTYA 4N9BA 4J9JA 5M03A 3KBNA 1SQ7A 5T9CE 3QSRA 2CLFA 2Z00A 1V6WA 2H6RA 2X1RA 1KC7A 2VFEA 4PH6A 1ZY9A 2J79A 2P8CA 4MKNA 4ZOCA 4XZMX 1CGTA 3QMRA 3LX9A 4W85A 4M7SA 1YNPA 1XX1A 4OUIA 2ZA2A 6XIMA 1JDCA 4GINA 5D03A 3UVIA 4PSPA 2ZX9A 4GJ1A 3CIWA 1Q8JA 1JDEA 4IH3A 5BOOA 3UPMA 1PCWA 3BG3A 2DZUA 3DFQA 2PDXA 2WZTA 3A22A 4DWSD 1KM4A 2AOSA 1C7SA 2OQHA 1PTAA 3CYJA 3GFYA 3I6EA 3C6CA 1VBGA 2IPFA 3WFAA 2Y7DA 4X9YA 2JEQA 1REQB 4GKLA 1N55A 5TBOA 3VD7A 3VD4A 5C9RA 1LL6A 4H1ZA 3D6NA 5F4WA 5CZKA 1LZOA 4PCNA 3STPA 4WJXA 2OKTA 3V1PA 5JXQA 2ZUUA 4JEJA 4TMBA 2OODA 3A3HA 3U6WA 3MSYA 2Y4SA 4NU7A 4QISA 4GGHA 5DY2A 5HWJA 3C3UA 1B31A 2YKKA 2NQ5A 1UP2A 5F1UA 4INFA 1XLLA 2XPKA 1J0IA 3EWCA 2BXYA 4ZB5A 3DU0A 4GXPA 3VU2A 2RGLA 3W74A 1FCVA 3MSGA 4QQUA 4KWSA 3NO3A 1XV8A 3TW7A 2ZA3A 1A5OC 4KRZA 2F6XA 3QV8A 1B54A 1TV3A 2QCMA 3EOOA 5TQLA 3QOMA 1X1NA 3TSBA 3S9YA 4MWAE 3RR1A 3M0JA 1IWBA 3O8AA 8XIMA 2Z2BA 1UROA 3WYZA 4WDUA 3ZLFA 3P60A 4GGBA 3OTRA 4IM4A 4YTQA 3M07A 1TUFA 1GUVA 2Y24A 1C91A 2FZBA 2BODX 3NXFA 3MHUA 3EEGA 3VCCA 3DGRA 4MYAA 3LQLA 1O66A 4GVFA 3GSMA 3TQVA 4UWMA 5AC7A 4AZIA