4FX6M

Crystal structure of the mutant v182a.r203a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
218
structure length
218
Chain Sequence
MDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAIIVGASIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 86
structure length 218
sequence length 218
chains with identical sequence N
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2012-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fx6M00
4UR8A 3HB9A 1RVGA 4D2JA 1MO0A 3DFOA 2CU0A 3QW4B 3TKFA 2E6AA 2I14A 4TMBA 4Z1CA 1KW1A 1EIXA 3S1XA 1HO1A 3M43A 1FWSA 3KFTA 3M41A 3G3MA 4WY0B 3BW3A 3B0UX 4LRSA 4NJGA 4I7WA 3NPXA 1TTQA 3W7EA 4O1CA 3HMJG 4PFMA 4O11A 4UTLA 3N2XA 4DEFA 5AHMA 2ALDA 1H7WA 5AYYA 1OVDA 2AAMA 3G18A 5AHIA 4DO6A 4LV4A 1R2TA 1I2QA 1KTCA 3NDOA 3NM3A 4Y90A 3WK1A 4YCOA 3TIMA 3LI1A 3W7NA 1GEQA 1H60A 2ZRWA 1ZCOA 2BX7A 3L2IA 4CQ8A 3ABOA 4ZQRA 2OJPA 1I2RA 2FPVA 4ZQOA 1RD5A 1MEIA 2J9YA 1G69A 1TQJA 2HS8A 5D2YA 1W3TA 4I9AA 1W0MA 5AHFA 4WUIA 1H50A 4IX0A 2A1YA 2E6YA 2X30A 6TIMA 4Q33A 4POCA 3QEZA 1B4KA 4ZL1A 3B04A 4LT9A 3W71A 1TIMA 1LORA 4LC8A 4JTUA 1M7PA 4JTJA 4NUWA 3MUXA 1ZHAA 1LLZA 3TH6A 2QJHA 2TPSA 1VYRA 4Q4KA 1R2RA 2FB2A 1TTIA 2XFWA 1F6PA 4AH7A 2Y85A 1NFBA 2ZCGA 1R47A 1KV8A 5LGZA 5G4WA 1IIHA 2QUTA 3N34A 3LXCA 4RR4A 3EWYA 3W23A 1GVQA 4FO4A 2Z6JA 3NVTA 3N73A 3L5LA 3LCIA 1KM1A 1SUXA 5I3JA 3TMQA 3V75A 1KFKA 3BG5A 3L5AA 4Z1DA 4O28A 3UWVA 3QRHA 5AOUA 3CU2A 2CLMA 4O4VA 1ZY9A 1I2PA 1XBYA 3E9AA 1QPNA 2ZZ3A 1OFRA 5D02A 1SSDA 4JTKA 1JQVA 4XKYB 5CPOA 5KZEA 5C6MA 2R91A 3ZWTA 1TPC1 3WJWA 1D3GA 1LM1A 2BSLA 4N2YA 2VFDA 3LHTA 1SSGA 3MI2A 2R94A 4Y9AA 1F73A 2C1HA 5CPMA 4MPQA 1H61A 2W0UA 5KZDA 5HMSA 3M5YA 3O07A 4K7VA 4RXFA 5DN1A 3ZFHA 2A7NA 3DGRA 3W1UA 3WJYA 1AW2A 3P67A 4O50A 1EUAA 4S1FA 5LNSA 3EXTA 4X22A 1N55A 1GVOA 3B06A 1FWRA 3LLDA 3GNDA 1TB3A 1M5WA 5TQLA 2E77A 4N9EA 2OCZA 4YCPA 4LU0A 3W1XA 3NL2A 4WY0A 4BF9A 1C29A 3JS3A 2Y89A 3SIZA 3KOFA 5HWJA 2ZZ5A 2GPTA 4IPIA 3OVPA 2P10A 5DY3A 4UFKA 1XBZA 5F4SA 1OFAA 4CCDA 3W7GA 1K7FA 4M7SA 2Q3OA 2H8XA 3O63A 3W7KA 2A7RA 3C2RA 3KVLA 5CZSA 3W88A 4CLMA 1VH7A 4PL2A 1DBTA 2ZZ1A 5ABTA 1LRTA 1XCFA 3HGJA 4HNUA 1I8JA 3AO0A 5HULA 4OQVA 3LXAA 1W1ZA 2CLIA 5D05A 2OZ0A 2Q3RA 4WY0F 1B3OA 4WZHA 1K02A 2CLEA 1XFBA 1EUNA 3CWNA 4LVFA 3WK0A 1SW3A 4AHPA 3G3DA 1L9WA 2KZHA 1IXQA 3P80A 1ZALA 1X1ZA 3NQDA 2QJGA 1KM6A 4UIOA 4A2SA 1RR2A 1K03A 3W85A 1VYSX 5KITA 3W75A 4GC4A 2Y7GA 4XKYA 1L6SA 1PHQA 3W86A 4O57A 3W6YA 4QNEA 3HGOA 2NUWA 2QCFA 4WOZA 3L68A 1XKYA 3CM4A 3M47A 4PTNA 3IGXA 1HTIA 4JTIA 2FIQA 3PUDA 3UWZA 4TX9A 3NNTA 2Y63A 1K8XA 4XTDA 2A0NA 4Z1BA 1QPQA 3M7WA 4O4WA 3GXNA 3W1MA 5K4ZA 3TQVA 1H62A 3PS7A 5I3KA 3OVQA 3NQEA 3GZ3A 4X3ZA 5CGQA 2YR1A 2QCHA 3JRKA 4QQ3A 5L9FA 1W54A 1FDZA 3CC1A 2Y6ZA 2WPBA 4LTSA 4NJJA 1GVSA 1Z44A 2ISWA 3RLVA 4E38A 2XN0A 4MZ1A 1K7XA 1KA9F 4UMCA 1KFJA 5LHFA 1W37A 3W76A 1GG0A 5FEWA 1TO3A 4GJ1A 1LP6A 4OGZA 4JDBA 4FX6M 1Z42A 4IJBA 4RJEA 5AHNA 2Z2UA 1G4EA 1UASA 4K38A 1WOBA 2OX1A 5CPNA 1JVNA 3LGEA 1E51A 4UTIA 3TAOA 4X9SA 3T55A 2A2IA 3JR2A 4XWUA 3PUEA 3MI6A 5IBXC 4FNRA 3S42A 4H6KA 1A50A 4RX0A 3M6YA 3H54A 3N9RA 4JD4A 4LVBA 3DFNA 3B05A 3EX4A 5HJLA 3GDLA 4EWND 1TPWA 3VNDA 4N6EA 4HHPA 4LVGA 3W1RA 1T96A 3O16A 3KVJA 2GVJA 1LTDA 1BKSA 3GAKA 1VCVA 3P81A 2CLLA 2NUXA 3P5YA 4LOCA 1VYPX 2DZXA 3L5MA 2J24A 4QM1A 3W72A 5E0KA 1JCXA 1IGSA 1J4EA 3C56A 1JCJA 3UXAA 4K39A 1DQXA 1OK4A 1AL8A 2JK2A 2WV8A 5F2IA 4CQ9A 4MUZA 1TSIA 1H7PA 2V0TA 3EX2A 3C52A 4WOQA 3PY2A 3TXZA 2O7QA 4AB4A 2V2HA 3NGJA 3GB6A 3UWWA 3LM7A 4BWLA 1XDMA 3UWYA 5D09A 5CPLA 2CWNA 3EWWA 3DI1A 3HG4A 1VHCA 1QO5A 1JQXA 2QCGA 5FF2A 2E68A 5I3HA 3PBWA 4ADUA 2H3DA 3ZWSA 2ZYFA 1FCUA 1T99A 4JTSA 4IUOA 4NXSA 1QNVA 3W9ZA 2ZBTA 2Y7EA 1O60A 3LXBA 4XQ6A 4B5NA 1IXNA 3NQFA 3WJSA 1QWGA 5MHBA 3TV8A 3ELFA 2H3BA 3M9YA 3M44A 1WV2A 4A2RA 2VFFA 1R30A 4HPXA 2P1FA 2RFGA 4HPJA 1QAPA 4IX2A 3HO8A 3VI2A 3NA8A 3EWBX 3W70A 3S5OA 2J6XA 3QW3A 3QMTA 1PHWA 4IMFA 5KZMA 4FNSA 3FKRA 2Z6IA 3OEXA 1ZFJA 5D2WA 2CLKA 4MJZA 5LGXA 5D30A 3W1LA 4K36A 3T78A 1FWTA 4FNPA 3P84A 1TCDA 3GK0A 3NL6A 3GXPA 3SJ3A 2HS6A 5FF4A 3UXDA 2PE4A 3MBDA 4JTEA 1LRNA 1X1OA 3S0CA 5I3FA 2J88A 1WQ5A 4JYFA 1IF2A 1T8XA 1XUZA 3L66A 2V5BA 3ABSA 2DU2A 2QDHA 2CLFA 3WJXA 4MFEA 3OIXA 1D3HA 3O05A 8TIMA 5BRBA 4YL2A 2NX3A 4L4LA 2JBMA 4OHQA 4O12A 4WXYA 4NJKA 1FDJA 2VFIA 1YTEA 2JGYA 4DQWA 3QFEA 3WFAA 4NJHA 4UC5A 3GR8A 3THQA 4AXKA 2ZRUA 3EEGA 3ATZA 1H7XA 3K30A 5CZTA 4O17A 3NQCA 5L6UA 1F74A 3TSDA 3N2MA 4LVDA 5FEZA 1HFBA 3I7SA 3R89A 1OYCA 1LBLA 2VFHA 1S5VA 5DY2A 1G4TA 3WK3A 2WJZA 4XZ9A 5AC7A 3LHWA 3R13A 2ZTKA 3STCA 2B7QA 3KRUA 3BG9A 4PH6A 1L2UA 3HPXA 4ML9A 3ZR4A 2FQIA 1YPFA 2QCCA 4DPPA 4UTMA 2OMAA 2B7OA 1NVMA 2RH9A 2I1OA 4UFIA 1XXXA 2O7SA 2ZDRA 1KV5A 4FXRA 4NNBA 4J9JA 4IOTA 3W2MA 2E6FA 4YWIA 4HNNA 4Z08A 4AWUA 4XUGA 2H8ZA 2VELA 3QQ0A 1P5BA 3GKFA 3IEBA 3FYOA 1PCWA 1H1YA 1W31A 2C13A 4RXGA 4LVAA 3M1ZA 3GNNA 2QR6A 3VKJA 3PWAA 4PL1A 1XDLA 1FQ0A 1H1ZA 4K8HA 5DXXA 1TPEA 3QSTA 1W5MA 4E0CA 5EY5A 4NZFA 4UR7A 2EGZA 3PUOA 4EF8A 2EHHA 1QPOA 1O4UA 1H7RA 3G8RA 4UTWA 5EBUA 4EF9A 4CNPA 1ZAHA 1WOAA 3EKLA 1FCQA 3GDRA 1ADOA 4JTFA 2YPIA 1EP3A 5CSSA 3THAA 2A7PA 3VE7A 4JICA 1U5JA 1ICQA 2DZSA 2NV1A 3Q37A 1OFOA 3MI3A 1VC4A 4UFJA 4OT7A 3BO9A 4NT0A 4M6QA 3P7YA 3HIJA 1KBJA 4Y8FA 4A3UA 3GR7A 4FNUA 4MJMA 1RQEA 4AHOA 1Q6OA 3N3MA 1TPFA 1L6YA 3CTLA 3TFCA 1TYGA 3LRMA 2B0MA 5CG7A 4I7VA 1VZWA 2B4GA 3SY5A 2C6QA 3V1PA 1QO2A 1Q45A 1K7EA 2CLOA 3NXFA 5FEXA 2TMDA 4OU1A 3MMTA 4FIRA 5D2XA 1OG0A 3H55A 4MYAA 4BR1A 4HSOA 3NQ7A 4ZZ9A 4MKNA 3G24A 3LV6A 2VXNA 1UCWA 3BPWA 3NPWA 1YDNA 4O19A 3Q58A 2YW4A 3C2OA 1KTNA 2Y7FA 3FEMA 4UTHA 1XM3A 2JKPA 3B03A 3TA6A 2ZFAA 3GX9A 3O06A 2WQPA 4M7TA 3KAOA 3FOKA 4UTKA 2I9EA 3R12A 2YYUA 4FX8A 5G1TA 1JUKA 1NSJA 1RPXA 1A53A 3TMLA 1GYLA 3CEPA 4MIMA 2WNZA 4NJIA 2A6NA 1TRDA 3HPSA 3EWUA 3LTSA 3UD6A 3NR0A 3R2GA 1SO3A 3G1YA 3BK0A 3TK7A 1YYAA 2W6RA 2DORA 2E09A 3W73A 2GOUA 1WBJA 4BI7A 4CCCA 3W2KA 1XBVA 3IVTA 2YDAA 2ZRXA 4TR9A 4ZQMA 2P0OA 3LRLA 3WJZA 1HL2A 1KM3A 1O95A 4IWWA 1OFPA 1BTMA 2RDUA 1G7VA 3E96A 1EP2A 2EPHA 3W07A 1DV7A 3RK8A 3LCGA 1OYAA 4HNTA 1WYIA 1P1XA 1X7FA 3N14A 5A8GA 3G1HA 3HJZA 3R5EA 3LV5A 4BI5A 2FFCA 1AK5A 4BFAA 4P61A 1AL7A 4M5PA 1XL9A 2VEKA 3STEA 2Y88A 2X1RA 1P4CA 3E12A 4Y96A 4YLWA 3OA3A 3TU9A 3O1NA 4ZMGA 5EKYA 4KKXA 3PG8A 1FCVA 4NX0A 1S5WA 2J9XA 3NZRA 3M5ZA 1W8SA 1KLYA 1IXPA 3MHFA 2PC4A 1OF6A 5HWNA 1ICSA 1N7KA 1DL3A 4UCGA 4GUHA 4GWEA 4G1KA 1DQWA 3NQ8A 2VEPA 1W5NA 4QISA 1PVNA 4O1DA 1CX9A 4DO4A 1A5BA 1TV5A 3DFQA 4JTHA 2D73A 1UJPA 2C3ZA 1TPB1 3W7MA 1TTPA 3KX6A 3IIZA 3UY8A 2RDTA 2ZZ2A 5H91A 3FJLA 4PCFA 2NZLA 2EF9A 4HNVA 3IGUA 4LNYA 3S1UA 4S2BA 4AWSA 3LBCA 1JJKA 1FUYA 4UFHA 1TRIA 1PS9A 3G1VA 3EWXA 2E5CA 3SECA 2TYSA 1YDVA 4C1KA 1EA0A 2G5WA 1KLZA 4LUJA 2ABBA 3BGJA 3O6CA 4MFDA 1WAUA 3DHFA 5EA9A 5G2WA 2DJLA 5LHEA 2G96A 2TSYA 1P0KA 3FLUA 4ZQPA 2A6LA 3S5YA 2DZWA 3L0NA 4MYXA 4O1AA 2QCDA 3BV4A 2DZPA 3TDFA 3M0ZA 3TJXA 3IRDA 3PAJA 3ZS4A 4WD0A 5H2ZA 1PE1A 3WK2A 3STFA 2X1UA 4O0ZA 1SO5A 5CZJA 3QQ1A 3SZ8A 1PCKA 3MW7A 2QJIA 3LERA 3IIXA 4GUGA 3SSJA 2QUUA 3F4WA 1I2OA 3MWAA 2IQTA 2NWSA 4RZ5A 3R8RA 2Q8LA 4FEZA 4CNOA 3U8GA 4UMAA 1EX5A 2QCNA 3TW7A 3MO7A 4FIQA 3GYEA 1SW7A 4GUIA 4OV4A 1H63A 3CEUA 1IXOA 1Y0EA 1KM4A 4MOZA 3AJXA 3GIYA 1XI3A 1IIGA 5EPDA 1VR6A 2EKCA 5IBXA 3A23A 1OJXA 3C3NA 1LRQA 5K2ZA 1FWWA 1N8FA 3U6WA 2JKEA 4WXZA 5F4XA 1YPIA 3S6DA 1WA3A 4U28A 3GAYA 3O6YX 2ATMA 4IXXA 4XBSA 3LCFA 2VFGA 1FCBA 3BARA 3QC3A 3I68A 3BVJA 2YFOA 3LCXA 1OFQA 3PM6A 3GLCA 3E0IA 3SGUA 5FEPA 3I7QA 3S1WA 2A4AA 4RCXA 4UUIA 3FA5A 3NAVA 4LC6A 4DBDA 4PC8A 1QDSA 4JIPA 5BW6A 3TE9A 4AF0B 2AQWA 5LNRA 5D37A 3UWUA 3I6RA 3C2VA 2VFEA 2H6RA 1KFBA 1MEWA 2QUVA 2PRLA 3RMJA 3W7QA 3F4NA 1JUEA 3CQ0A 3OG3A 3DENA 3W3OA 4UTJA 2ISSA 1TV8A 1U83A 4AAJA 2NX1A 1QCWA 4UTWC 3SW6A 3ANYA 2FLIA 2NX9A 4KFNA 2NXHA 3PB0A 1FBAA 1JUBA 3UQNA 3W7OA 1O5XA 3GDMA 3FKKA 1EEPA 4A21A 3PBUA 3OVRA 2QCMA 1M6JA 4NVTA 4ORMA 3LX9A 1VLIA 3W1AA 3IV3A 1GTEA 3C2EA 3Q94A 1QR7A 3IVSA 4RLIA 2A21A 4LV9A 4K37A 4IMCA 3UWQA 3W7CA 3KRSA 3HBLA 2YXGA 5HR7A 4R33A 2Z1BA 5A5WA 3NL5A 4FX7A 2G95A 1RQHA 4OV9A 4N02A 1C9DA 2OT1A 4TO8A 4LRTA 1KTBA 1DJNA 1M7OA 4OWGA 4JY9A 1RV8A 3IVUA 3MHGA 4FHAA 1LDCA 3W2NA 5EYWA 2CW6A 1KM0A 2C16A 5D33A 2E1DA 1YXYA 2C15A 3NPUA 4KWVA 1OX5A 2R14A 3N19B 5FI8A 3QMSA 1TJPA 1L6WA 2YW3A 4FXSA 4L4MA 3QSRA 1VJIA 4IMEA 3MHUA 2ZTJA 1WBHA 1AW1A 2G97A 3B0VC 1TV7A 5C54A 2FJKA 3FYPA 2CLHA 5DCEA 1YXCA 3MBFA 1J5TA 3VCRA 1W56A 3RF9A 3UPBA 4JX4A 3G1DA 1SQ7A 4WQ6A 2FB3A 1UUMA 3KHJA 3W7LA 4MLRA 4NQ1A 4FB7A 2V2CA 3W84A 4MZ8A 2WNQA 4HKPA 1G4SA 1ZNNA 4AWTA 3HG3A 1A5AA 1GVRA 3HGRA 3P8JA 3TR2A 1J2WA 1OFDA 5G2IA 1D9EA 3LCWA 5HUPA 5HUOA 3NM1A 2V5LA 2B7NA 1HO4A 1BEUA 3CLMA 1LBMA 2DZTA 4RZ4A 5G1YA 3CB8A 6ALDA 2WNNA 4N9BA 1I2NA 2BTMA 3MJYA 1Q6QA 4M19A 3W7JA 3I65A 4ZQNA 1G67A 1LOSA 2YCEA 1VLWA 5F1VA 1MEHA 1S5TA 3KXQA 2DP3A 4O18A 1X8FA 2QDGA 3T4CA 1V7YA 1LOQA 1PV8A 3P5ZA 4O53A 3GKAA 4HSNA 4QSHA 1LBFA 1TJRA 3CWOX 5C2XA 3NYZA 4QJ1A 4JTGA 5LNUA 3QMRA 4FNQA 2HSAA 4GNJA 4O15A 4O1BA 4IMGA 2J27A 4ADTA 2FPTA 5K9XA 3UY7A 4DPQA 3P61A 1W3NA 1JCNA 1X6UA 3DI0A 3A5VA 1Z41A 1TPUA 1Q3NA 1EP1A 2ZRYA 3MYOA 1TPH1 2QCDB 1K3UA 1SU5A 1RZMA 1P0NA 2PURA 1SFJA 3FJ6A 5FESA 1XBXA 3QPZA 3KVKA 4OE7A 1B4EA 3FS2A 1MSSA 3EB2A 4UTTA 2RKXA 2A85A 3L67A 2J9ZA 2ZZ4A 3A22A 5HNRA 2Z0IA 7TIMA 5I3IA 2QKFA 1GVFA 2WSYA 1OFBA 5AC8A 1ZAIA 3FFSA 3HGSA 3QYQA 3EX3A 5F2LA 5K3VA 3USBA 2ZA3A 3A21A 4UTUA 2C19A 3HPZA 5E93A 3M5VA 1NEYA 2V30A 5LNVA 3TX9A 3C61A 2R8WA 1GZGA 1VGAA 4H4IA 3MP5A 4K8EA 3GVGA 5HINA 3W22A 2BXVA 4NX5A 4MY1A 2JKAA 4UFLA 3IIOA 1HG3A 1KFCA 5FF3A 4N9CA 1HUVA 3TC7A 4AEOA 4UXDA 3RLUA 5KSWA 5LKYA 2EAWA 3EX1A 3E49A 4I7UA 4NZJA 2PCQA 2YGYA 2YYTA 1OYBA 1YTDA 3QZEA 3PVFA 2JGQA 1JR1A 4JXCA 4NU7A 2WOQA 2GVLA 4ALDA 3PSVA 2BLEA 2QCLA 1DJQA 1B9BA 1DORA 3INPA 5U7SA 4EVZA 3DFPA 3G22A 2GQAA 2C18A 3VFLA 3YPIA 4K7YA 1JCYA 2Y62A 5T26A 1F6KA 4A22A 4DO5A 4DF0A 3W1PA 4QNWA 1OX4A 2OT0A 2GQ9A 5SWUA 5F2MA 5AYXA 1KM2A 1G7UA 3EX6A 3T44A 3W7DA 4YMZA 3OHIA 3HOJA 3G8EA 4IGHA 2GJLA 1NF0A 1OX4B 4MVAA 5DCBA 1JCMP 4EOUA 2CZ5A 4JNMA 3CT7A 1F05A 1K8ZA 3BG3A 5BMWA 4DXVA 3W7IA 2CZEA 3TFXA 1KFEA 4IPJA 1PL9A 4UTTC 1SZNA 4HT3A 3NQAA 4HIBA 4Z1AA 1Z48A 1YXDA 2C14A 4N4QA 1JRBA 3EXSA 3M16A 3BW4A 2YFNA 1YLVA 4LS1A 4MZYA 3L0GA 4K6AA 1LCOA 1H51A 1FX6A 3C6CA 5TBOA 4O0KA 5U4NA 3LCLA 4JX5A 4H3DA 4RKAA 2GQ8A 2WO5A 1CI1A 4AVFA 2ATSA 1AMKA 3LHZA 5D04C 3PG9A 3O6DA 3TSBA 5J5RA 1ME9A 4W9TA 2V82A 4U4MA 4ICNA 2BZNA 1A5SA 2YZRA 2GUUA 3NPVA 4X2RA 5KTLA 4JR5A 3QH2A 3UNDA 3DHDA 1FDYA 3D0CA 4GUFA 1GTHA 3DKJA 5CKSA 2W79A 4RV8A 5DBUA 3RU6A 1V5XA 1G4PA 4LS2A 1K8YA 4Z0JA 3S9YA 1YDOA 1BWLA 4EIVA 4AMAA 1SR9A 3B0PA 1TMHA 5DXYA 2ISVA 5CZ0A 5J5DA 1F5ZA 1SW0A 4S2CA 1KBIA 4C1LA 4JYEA 3G1SA 5G5IA 5TIMA 3NO5A 4RZ6A 3NQ2A 4N4PA 1LROA 4DELA 4R34A 4LUIA 3HF3A 5F1UA 4O14A 2FPYA 3TQKA 5AC6A 2NV2A 3NZ1A 5DELA 2ZA1A 2LLEA 3B8DA 3G0UA 1OF8A 1GQNA 1EWDA 3W1NA 3L9CA 2DZVA 5D32A 5CSRA 4JX6A 3TNOA 1NAL1 3OBKA 1VPXA 3NG3A 1EPXA 4LWWA 4O54A 4TU1A 4JN6A 1QOQA 4JTTA 1ME7A 1FY6A 3SR7A 4JEQA 3M5XA 1JULA 3DXIA 3W7HA 1SZEA 1OABA 2HMCA 2E5BA 3KVMA 1W5QA 4BI6A 2GVGA 2Y7DA 3LHUA 5FF0A 2YSWA 3PBYA 1VCFA 3DU0A 4LS0A 2NWRA 1THFD 3ABRA 1QMLA 3U2OA 2RDWA 4FF7A 4HN4A 3P82A 2X1SA 2E5DA 3UYCA 1SFLA 1XUUA 3BGGA 3W7PA 5K9DA 2X16A 3LHYA 4WJEA 4PEKA 2ZA2A 3IIPA 5LNWA 4UNLA 4JS3A 1R46A 1H5YA 4MY8A 2FDSA 3TW6A 4GXMA 3CIWA 4N6FA 2BWGA 1GPWA 3MYPA 1GOXA 1JRCA 3QM3A 1TTJA 4CCEA 4O52A 5D2TA 3G0SA 1WDWA 3G1AA 3E02A 4MLJA 4Z0SA 1G6CA 5K4XA 4FNTA 2VOMA 4GRSA 4M6VA 1NF7A 5K7JA 2CZFA 5KINA 1SZFA 4KFPA 4A29A 1KM5A 4ONVA 2GJNA 3HQ1A 5F4WA 3BLIA 4O8RA 2TRSA 2WSQA 5BOOA 1OHLA 4N9DA 1SZGA 5HWMA 5BNKA 3Q2DA 5C55A 4E2DA 4AHQA 3P8IA 1W3IA 3TSMA 4ADSA 4JYDA 1DOSA 1CW2A 4NNAA 4Y6GA 2DJXA 5E1QA 3TC6A 2PRHA 1GT8A 4QIUA 1GWJA 4JIQA 4GBUA 1EWEA 3P60A 3W2LA 2V2DA 5KMYA 5HR6A 3F1QA 3NQVA 3HG2A 1DKWA 5K9CA 1TPDA 5IM51 1AW5A 4IXHA 3C0JA 2RHGA 3W2UA 1O94A 1DVJA 5EL1A 5D2VA 4NXKA 2ZRZA 3LHVA 4UNKA 1F2JA 3W87A 2VKZG 1B57A 4UFMA 1ICPA 3GDTA 4IMDA 4KFOA 3CHVA 4O16A 1ONRA 3STGA 3PSWA 1GJPA 5DBTA 2VENA 3C4UA 3DKLA 1R2SA 3ABQA 3TQ0A 5F2GA 5AB3A 1W5OA 3TCEA 4R53A 3G0XA 3TUUA 4JGDA 2X1TA 3HG5A 1F76A 3O15A 3UZ5A 3NQ6A 4AF0A 1VRDA 3S1VA 2X2GA 5DLCA 2E6DA 1KFLA 3BLFA 3LTPA 2ZQ0A 3UPWA 1JCLA 1OK6A 1LYXA 3VE9A 1OX6A 2UV8G 1H7NA 1PIIA 3FIGA 3SI9A 5GVJA 3PF3A 1FXQA 4RK8A 1C8VA 1YADA 2V8ZA 3C2FA 4DF1A 3F03K 3LDVA 2QAFA 3C8FA 2PRMA 1TREA 1MXSA 2QEZA 3T7VA 1SO6A 3CPRA 2ABAA 3SGZA 2WKJA 5DCDA 3EXRA 2Y70A 3EWZA 2A5HA 3A5FA 3G1FA 3B4UA 2ZZ6A 2XN1A 2V81A 1XC4A 1W5PA 1WX0A 3H53A 1Q6RA 4Q32A 1VHNA 3S8HA 3RNDA 1ZENA 3L0KA 3DH7A 1S3HA 3QJAA 2H90A 4P2VA 3A9IA 4DBEA 3O8AA 4BWLC 3PBVA 4M6PA 3S5NA 5FF7A 2NLIA 2NXIA 3I7RA 1ME8A 2WSRA 1SPQA 1TQXA 3L65A 5EMUA 2ZZ7A 1GG1A 2NXGA 4PODA 2QAPA 5BMXA 2VEMA 2YX0A 1WXJA 1I45A 1I4NA 5AHEA 3P74A 3EKZA 2F84A 4DF2A 2V9DA 3NL3A 1OFEA 1H7OA 4O13A 5LZLA 4QITA 3W1TA 1Q6LA 1UUOA 4GE8A 4YXGA 4LW7A 2QCEA 2HTMA 2CZDA 1T0OA 2C0AA 5AHLA 4GUJA 3LBMA 3QPYA 5AN7A 2Q8ZA 3NEVA 1FXPA 3LB0A 2VC6A 4NNCA 4IQLA 2XN2A 1AG1O 4JDYA 1ALDA 3ATYA 3NQGA 3MP3A 3GXTA 4QAIA 2F7FA 3TROA 4WX2A 2VEIA 5AYZA 3DFSA 1VS1A 4ZQCA 3PB2A 1LLWA 4TMCA 3BW2A 1QOPA 4GFSA 3W1QA 3P62A 1FWNA 3SFKA 4MY9A 1GYNA 3CIXA 3NOEA 5I3GA 3TXVA 4JTLA 2ZRVA 3LI0A 3L21A 1F7BA 2AGKA 3W74A 4UMBA 1LOLA 1MZHA 3W2JA 5C5YA 3NQMA 5HQEA 5D38A 3QF0A 4OBTA 3G1XA 1ML1A 1UBSA 2Y61A 4XBKA 2CFFA 4KWWA 4CNNA 3LLFA 3KRZA 3TJLA 1O5KA 3TAKA 4ZVJA 4CQAA 2B7PA 1ZAJA 4LY8A 3LOTA 1YTKA 5G4EA 2QF7A 5AFDA 4PA8A 3LCHA 1QFEA 1LZOA 5D03A 5G2HA 3BLEA 3DZ1A 3S5ZA 4JY8A 4O10A 3T40A 1EB3A 3PC0A 2FTPA 4TIMA 3PULA 3MP4A 3GDKA 1QPRA 3N9SA 4E2BA 1DHPA 3DFTA 3RFAA 3A24A 4XTIA 3W7RA 3IIVA 3LTYA 4BK9A 1UB3A 1VQTA 3IGSA 2DZUA 3W83A 4R7JA 5LSMA 1TPVA 1ZJIA 3PR2A 2NUYA 3LRKA 1SO4A 1RQBA 3DBPA 3DAQA 1VCGA 3UZJA 4ORIA 1BWKA 1A5CA
chains in the Genus database with same CATH superfamily
4UR8A 4UQEA 3VGHA 1V3MA 2FHCA 2BVWA 2E6AA 1R7AA 4YYCA 2DUZA 4Z1CA 2HQAA 1E6XM 1FA2A 1FWSA 3CAKA 3KFTA 3M41A 2QXWA 4JTQA 3DUGA 3BW3A 4LRSA 2OOGA 4NJGA 5BRPA 4I7WA 1TTQA 4CN1A 4J3TA 4O11A 4B5SA 4Q8MA 1WDDA 3MDWA 3MKCA 3G18A 1GJWA 4DO6A 3AQUA 1BYDA 2ODOA 4N7QA 3TW9A 4NILA 1WKEA 1B3WA 1KTCA 1QHPA 1SYTA 2PDMA 3TIMA 3TA9A 1GEQA 1REQB 2ZRWA 1ZCOA 1J9YA 3OU8A 1R8LA 1A3WA 4ZQRA 4DUWA 2AQOA 1G69A 1RD6A 4IICA 5JH2A 1TQJA 3WLNA 4E4PA 2HS8A 4RDVA 4Q4PA 3NGFA 4I9AA 1H4PA 1W0MA 4NHVA 1Z32X 2PLJA 5BXRA 4WUIA 1RLDA 2FVLA 2XSBA 4JNZA 4IX0A 3VNLA 2E6YA 4XAZA 1H0GA 5IRPA 4L4PA 4POCA 3W71A 4LC8A 2FMNA 1M7PA 1FOBA 1EJXC 1CXIA 4X0VA 3WEMA 1B1YA 1O68A 4GZ7A 1TTIA 2HEJA 4HQVA 5G4WA 1YNYA 3R8GA 5DO8A 1UWQA 1P0DA 3LXCA 4OUIA 4LGXA 3EWYA 3C3UA 3W23A 4FO4A 3NVTA 2VQUA 3L5LA 4ACZA 2Z1XA 3NJ3A 3TMQA 1KFKA 3BG5A 9XIAA 1E15A 3B9AA 4O28A 2WQDA 3UWVA 5AOUA 1KBLA 1IV8A 4O4VA 3E9AA 2ISFA 1QPNA 4A4AA 1OFRA 2C8NA 5CPOA 5C6MA 2R91A 3LGDA 3N18A 1LM1A 3CXOA 2QUMA 3MI2A 4Y9AA 3M5YA 4K7VA 2A3BA 3ZFHA 5CAHA 3PJXA 5I23A 3DGRA 3URBA 1E6RA 5CC7A 3P67A 1PPIA 2XIIA 3ICJA 1EUAA 4JL1A 1W9VA 3EXTA 4X22A 3U2ZA 3ZVIA 5BXSA 1R9ZA 4BCEA 3VO0A 3SY1A 1M5WA 3NL2A 4G2DA 4ZR8A 3SIZA 4KCWA 2XH2A 1B3VA 5HWJA 2GPTA 4R3UA 4ZTYA 3OVPA 2PDGA 2P10A 4CCDA 3NSMA 5BROA 3W7GA 1JFXA 3W7KA 1ONEA 2A7RA 3C2RA 3KVLA 2EKGA 4CLMA 1TWDA 4PL2A 1LWIA 2R1PA 1V3LA 5B7YA 1K9DA 4JN7A 4PGLA 5HULA 3WF3A 3FX4A 2XHYA 1WP6A 3DIPA 1W1ZA 2OZ0A 4WY0F 4WZHA 1R3RA 3CWNA 3VZXA 1AD4A 1E6NA 2AL2B 4HYVA 4U2YA 3P80A 1ZALA 3OHMB 1X1ZA 6TAAA 1ONXA 1AQMA 3F5JA 3K8KA 3QTPA 3SJNA 4GC4A 4XKYA 3APGA 1L6SA 1RBAA 3W86A 1TFVA 4IFRA 4NP7A 4V28A 2PBGA 1MMFA 4G9PA 2G37A 3M0HA 3CM4A 4CQBA 4Q8NA 2ZE0A 3IGXA 2FIQA 4KPLA 1YE4A 1NU5A 1RBLA 1J6OA 2Y63A 4DJDD 4DWSB 2A0NA 1XLEA 4Z1BA 1QPQA 4J3WA 3WUEA 1QHOA 4O4WA 1XR2A 2OKTA 3GZ3A 4X3ZA 5CGQA 5L9FA 2QCHA 2OTDA 1XLJA 4LTSA 3VIIA 1GVSA 1GJUA 1W37A 2P76A 1GG0A 1CGVA 1F3WA 4O1FA 3E2RA 5FEWA 1LP6A 1UQZA 3V36A 4JDBA 3UZYA 4ZSTA 4FX6M 1Z42A 1LWJA 5AHNA 4K38A 2QHAA 2WWDA 1E51A 1NIUA 3TAOA 3K2GA 3JR2A 4J5NA 1ZU8A 4PTDA 4WK9A 2GGEA 1UMYA 2F2KA 2DIKA 2C7FA 3UG3A 3N9RA 2WHLA 3DFNA 5HJLA 1QWKA 4GO8A 2E8ZA 3O16A 3KVJA 2GVJA 4P7OA 5MF5A 1SFTA 2XIJA 2CLLA 2NUXA 5FJUA 4B2DA 4ZOBA 4GG9A 2VVNA 2J24A 4QM1A 4JFWA 4XAYA 5BZAA 1J0ZA 1Q66A 1V0MA 1V08A 3Q45A 4FMVA 2OO6A 5F7UA 2PDKA 1IGSA 4NRRA 1O5RA 3C56A 3UXAA 4DM2A 3GBDA 1MVYA 1QNPA 1SMDA 2VD9A 5A8MA 4K39A 3SCRA 3V5OA 1KRBC 4PZVA 1DIKA 1AL8A 4GVHA 5RUBA 3OZPA 4CQ9A 1EO7A 4IQDA 4MUZA 3L2MA 1HJUA 1MNZA 4WOQA 2WBKA 3GW0A 3FHAA 2V2HA 3NGJA 3GB6A 3OQ8A 3CUIA 1ZB5A 3HG4A 3GM8A 1JQXA 3TOPA 2ZC1A 5FF2A 2E68A 1XF0A 2DZAA 4YNGA 3PBWA 2GUYA 2CESA 1JNDA 3L23A 4JTSA 4IUOA 3QV9A 4NXSA 1KO0A 3CZEA 4XQ6A 3WJSA 1XLBA 3PAOA 4GI8A 2PUZA 3FVMA 1DYSA 1YE6A 1F8MA 2VFFA 1R30A 2JFEX 2P1FA 1QAPA 4IX2A 5ABGA 3GY1A 4ZXLA 3EWBX 3T81A 4B3KA 1H3GA 4F66A 4KGJA 2FTYA 3ARTA 1OCNA 1VBGA 1GQLA 2J6XA 3QW3A 1VIWA 1SMAA 4YTQA 3W29A 4DI8A 3FKRA 3AJ7A 4H6RA 3KZPA 5D2WA 5CC3A 5H1WA 5LIWX 4H1ZA 2FDMA 1V0LA 2A3EA 3CWHA 4CEUC 3BV7A 3B9DA 3W1LA 4S3CA 4K36A 4XZMX 2IPFA 1Z3NA 1QBBA 3TCSA 3NL6A 5A6LA 1WPCA 3SJ3A 4JTEA 1LRNA 3U5UA 3UA4A 1R6WA 5I3FA 1WQ5A 1IF2A 4AUBA 2YL6A 2NQZA 1YEYA 3L66A 2V5BA 2DU2A 3WJXA 2PTYA 3GXDA 3PZGA 4KESA 2NX3A 1TX2A 4L4LA 3V0SA 1FDJA 1LG2A 2OSYA 4I3GA 4RUBA 1GEHA 3W38A 2OZ8A 1OIMA 4H2HA 5CJ5A 2RGLA 4UC5A 1BRLA 1RCOB 1VFHA 1D8CA 1FRBA 1FWCC 2Y5SA 1T7LA 3N2MA 4R7OA 3OTRA 4AYSA 3S2MA 2C71A 3ZQ9A 2GQ3A 5I78A 3FAWA 3WK3A 1CZ1A 4XZ9A 2A3LA 3S9ZA 3SQMA 1OC5A 4PRWA 3ZSSA 3WNPA 2B7QA 4NAFA 3BG9A 3VKBA 4W84A 3GXIA 1H11A 4IISA 3GFYA 3VUPA 3T2PA 3IGHX 3BJFA 4UTMA 1KNWA 4PMNA 1NVMA 2I1OA 5REQB 3E1F1 4NNBA 1TJ1A 2EG6A 4GJIA 3W2MA 2E6FA 4BJHA 1LG1A 4ZE5A 4AWUA 4XUGA 3QQ0A 3IEBA 3FYOA 1A4MA 1W31A 1VBHA 3GNNA 1IEQA 4EPEC 4WLCA 4AY7A 1NTHA 1HKVA 1TPEA 3URNA 4URIA 3PUOA 4EF8A 4F48A 2Q02A 4W85A 1O4UA 3AXHA 4C6FA 4CNPA 1ZAHA 3GE7A 2INFA 1MDRA 4R9XA 4ROPA 2P5NA 2ANUA 1UH2A 3CLWA 3THAA 3VNIA 4Q8VA 1U5JA 2WMHA 2WYSA 5I07A 3BO9A 3LMYA 1EJUC 2FZBA 4FNUA 3EDFA 4MJMA 5CSUA 3S3GA 3WNNA 2VCCA 4AHOA 3W27A 1MFVA 2NQHA 3CTLA 2NQJA 5LA0A 3EB4A 1U5HA 1UOKA 5A2AA 3AALA 2B0MA 2B4GA 2GJPA 1CIUA 2R82A 3V1PA 3WCZA 3NXFA 1GKQA 4FIRA 5D2XA 3H55A 1Q6GA 4FLSA 2VXNA 1JF5A 4QLLA 3NPWA 1YDNA 4O19A 3Q58A 3VC6A 1KTNA 2JKPA 1A47A 3TA6A 3PZ9A 3GX9A 4A6GA 1EQPA 3ZLGA 5BCAA 3FOKA 2NVDA 5EFFA 2OXNA 3C8NA 5HA7A 1NSJA 3QY7A 4M80A 2L5HA 4ICCX 4MIMA 2WNZA 4ZO8A 4F9DA 1EGZA 1DJXA 3G1YA 1LF1A 3VNMA 4E8DA 1QNOA 5HATA 1WBJA 1FVPA 1EJRC 4BQ4A 4CCCA 3W2KA 2G3MA 3WDRA 3GVRA 3VDCA 3IVTA 1M9HA 3TNBA 5IFTA 2OG9A 1DWAM 1BTMA 2RDUA 2XG9A 2ZXAA 3RK8A 4GOAA 4DJDC 4HNTA 3VD5A 4PMYA 3G1HA 3U4FA 3EB3A 4BI5A 2FFCA 3DBNA 4LBUA 4P61A 1AL7A 1OSEA 3STEA 3ME3A 2HE5A 3B8SA 3PBGA 2B81A 1S2UA 3TWAA 3RU8X 5JUVA 1FCVA 2HROA 3M5ZA 3IJ6A 3MHFA 4S38A 3FAXA 4YTUA 2V3FA 4B92A 4J27A 3VYLA 4GWEA 1FWGC 1DQWA 3NQ8A 3RX3A 1WB0A 2WPGA 2D22A 3C0SA 3WEZA 4UTFA 3ZLHA 4W4QA 4DO4A 4O8AA 1A5BA 4XG1A 1UJPA 3W7MA 3ID7A 1GYMA 1F8IA 1W3HA 5AY7A 2ZZ2A 3WLKX 2CIPA 3FJLA 1C8YA 3MSRA 2X0HA 2I17A 1E1CB 1FP9A 5AZ0A 1JJKA 1PS9A 4QDMA 4NAFB 1YDVA 3I4KA 2ABBA 3BGJA 1JZ6A 3P3BA 1GZJA 4K1WA 4M0XA 2VZSA 2DJLA 3VCCA 2G96A 2TSYA 1P0KA 1WZAA 2XU2A 2IPWA 3AS2A 2DZWA 4MYXA 3RRXA 3BV4A 8XIAA 1TUXA 2DZPA 2NQ5A 1CXKA 1IT7A 3LPOA 1YX1A 2FTWA 1LWHA 2IKJA 7TAAA 3PAJA 5H2ZA 1US2A 3STFA 5CZJA 1PCKA 3MW7A 3NIYA 2NT1A 4GUGA 2PB1A 3I3DA 2QUUA 1UWUA 3EDEA 1I2OA 2IQTA 2NWSA 4RZ5A 5BWFA 3UCCA 3DERA 3U8GA 4UMAA 4XAPA 3R8HA 3TW7A 2A3CA 1QXLA 1ZJHA 1SW7A 4GUIA 1GW9A 1IXOA 1EJ7L 3BICA 1J79A 4QDWA 3AJXA 1IIGA 3DX5A 1KKRA 3EWCA 3FSUA 3C3NA 1A5NC 1GHSA 3DESA 3AIWA 2DVTA 3H70A 4XBSA 4BEQA 3MB9A 3FXGA 2VFGA 2Z25A 5HMDA 3A47A 1UYQA 1FHUA 3ES7A 1OFQA 2OOFA 3I7QA 4JQ3A 4RCXA 4JQ1A 3AUJA 5GNXA 5CPSA 1C7TA 3TJIA 4JIPA 2ZOXA 1K9EA 1KFBA 1MEWA 2V38A 3P93A 1VFOA 5EMMA 3OG3A 3GG0A 4GGHA 2ISSA 1TV8A 1U83A 1QCWA 1UJQA 2NXHA 1DTUA 3TYAA 1JUBA 3FYYA 1NDYA 2OO0A 5DMLA 3SQSA 2BOGX 3N9KA 4C6DA 1XCWA 4ERAA 4CNTA 1VLIA 1GOIA 2VD8A 1UP3A 3Q94A 4RE2A 3TLQA 3UZWA 4RLIA 3WQFA 2A21A 3TVAA 1KQYA 4IMCA 4AZCB 3VMNA 3HBLA 3W25A 2YXGA 1A5UA 4XK2A 3IACA 5A5WA 5C9ZA 5I24A 3BC9A 1CDGA 1M7OA 1S3TC 2REQB 2OGYA 3KL0A 5BYWA 4EACA 4FA3A 1Q4WA 3W2NA 3AXXA 2C15A 4BS0A 3NPUA 4IL2A 5FI8A 1L6WA 1FWEC 4UQ9A 4I9TA 4DNHA 2D23A 1TV7A 3LA4A 3WH5A 5CGTA 3WLQA 3CL7A 2CNCA 1QTWA 2PLKA 1GOQA 4REQB 2X7VA 4Z2GA 3OA5A 4PMOA 3ES8A 4TX8A 5KEZA 1KD0A 3W7LA 4A35A 4NQ1A 3MJMA 4Y9PA 4JKMA 4HKPA 4YYFA 2Z1VA 1DQUA 5GQBA 1NP2A 1ZNNA 4WF7A 1JEZA 2BY0A 1XIGA 4XBJA 3FVDA 2E9MA 3WQ4A 3NFUA 2Y5EA 1LT7A 1XYAA 5G2IA 3F4VA 1PWLA 1BHGA 2CITA 3LCWA 5HUPA 3RLGA 9RUBA 5DMYA 3OYZA 2E9LA 4GI6A 1B3ZA 4HN8A 4GY1A 1LBMA 2DZTA 2FJUB 5G1YA 3HJEA 4BHYA 1UMLA 2WNNA 3IK2A 2NLYA 4HK5A 3NEHA 4M19A 3W7JA 3I65A 2YCEA 4CQDA 3P14A 3S6TA 3M4HA 2DP3A 3MY9A 3VNKA 4ASTA 4O18A 3T4CA 3IAQA 1LOQA 3GKAA 3ARPA 4HSNA 1J5SA 4GCAA 3CL8A 3T1GA 3NYZA 1HJVA 4JZ5A 1H41A 1KQZA 2HSAA 4GNJA 1QATA 2WANA 1WO2A 4LSBA 4IMGA 3T0BA 1XIJA 3P61A 5GNYA 1JFHA 1JCNA 3WMBA 1X6UA 4LAZA 2DQXA 1IE7C 1TPUA 1FP8A 1IR1A 3N13A 4DYJA 1SU5A 1UROA 1RZMA 3OIHA 1NFGA 4EXQA 3AICA 5FESA 3LQLA 1PTDA 2WVSA 1MSSA 3EB2A 4UTTA 2PF0A 4OKDA 2E0PA 2RKXA 2A85A 2FVMA 3D46A 4JQ4A 4ACYA 1F07A 2BVTA 3P6LA 1J0IA 1JDCA 7TIMA 5I3IA 2VZOA 3LNPA 4F2TA 5AC8A 3RX2A 4U3AA 3FFSA 2PGRA 1TWWA 3SUWA 4HZMA 1E0UA 2QIWA 3H24A 2PLMA 3HPZA 5E93A 1B3XA 1JF6A 2V30A 5LNVA 4A3QA 4OZOA 3C61A 3WQVA 4C6JA 1GZGA 5ABFB 5EMYA 2E28A 1HG3A 4IQEA 3CUXA 4N9CA 3TC7A 4IM4A 5KSWA 1V6YA 3ZMRA 5CLWA 2EAWA 1AUSL 4L9ZA 5BU9A 1YTDA 5IDIA 4PUJA 4EK7A 1RSCA 2JGQA 2VT0A 4KQNA 3FY1A 4JXCA 2WMFA 2VZVA 2VVSA 5U7SA 3T08A 1ELSA 1E6QM 4A8IA 3REQA 3SQLA 3AMKA 1AD1A 3VFLA 4BF7A 4K7YA 4A22A 4XZNX 1L8PA 2WWCA 3UJSA 3W1PA 1UD5A 1K6WA 1AJ0A 2GQ9A 4YS1A 4AIUA 1KM2A 1T5AA 5LXEA 2HPMA 1V7AA 2FZDA 1IEIA 2PDFA 2QMJA 1UKSA 1K8ZA 1Q2RA 3VMPA 4DXVA 3W7IA 2DT0A 1XICA 2OELA 1IYXA 3A4JA 5A8PA 3VM5A 1YKWA 1PL9A 4UTTC 2XFYA 4B5TA 5I7GA 1SZNA 1JNEA 3M0LA 4YTTA 1JRBA 1VP5A 2X09A 3BW4A 4TQTA 5ABHA 3L0GA 1LCOA 4Z2LA 4QJ4B 3FDGA 1QT1A 5EMLA 1OADA 3TYEA 2FHBA 2I56A 2G3JA 4JHZA 3WBXA 3BLPX 4RKAA 5M1TA 2GQ8A 1F61A 1CI1A 3ARZA 3V5CA 3O6DA 3AYRA 2V82A 2GGJA 2HPIA 1NP0A 3NPVA 1Q6FA 4X2RA 3CAQA 3D0CA 1MRQA 2W79A 4U3CA 4C6OA 5DBUA 2OX4A 3AHZA 4N42A 4Z0JA 4XKMA 3H7VA 4EIVA 1SR9A 2PU0A 4FLQA 3SCTA 5J5DA 3B3DA 3DFYA 3RMEA 3IJIA 1I9CB 4I90A 1QVBA 4JYEA 4C1LA 1TZ7A 3I3BA 2X0YA 3AI0A 3M0XA 1EHNA 4DELA 2VMFA 4PSPA 4TV5A 3HF3A 4O14A 3WMCA 2FPYA 2QDEA 4CN6A 1HJQA 1VFSA 2Q6ZA 1RA5A 5AC6A 3NZ1A 2PGEA 3S6OA 3G0UA 1LJYA 3AWOA 3UVIA 5I00A 1ITCA 3SIMA 4JX6A 3TNOA 3OBKA 1VPXA 3PTMA 4JFUA 1EPXA 4LWWA 4O54A 1QOQA 1FY6A 4FS9A 3M6DA 1VFFA 3W7HA 1QI4A 1OABA 1XLKA 2HMCA 1XH0A 1W5QA 4IIHA 1QASA 2Y7DA 3LHUA 2OEMA 2J74A 4LS0A 3OO2A 1QMLA 4ERGA 3U2OA 2RDWA 4FF7A 3P82A 1OCJA 1EDQA 3BGGA 2RGMA 5K9DA 4DM1A 3BQ6A 2CC0A 4GABA 4UNLA 2QYGA 4JS3A 3EMCA 4MY8A 2FDSA 4JCLA 3TW6A 3TONA 4GXMA 3CIWA 4CKQA 1ISZA 1GQIA 2BWGA 2Z29A 3N2TA 1CYGA 4L61A 3QM3A 1XYLA 1TTJA 4O52A 3QKZA 1WDWA 3R94A 1AFSA 2HZGA 1WKYA 3E02A 3GU9A 5K4XA 1KB3A 5LIKX 2DH3A 5K7JA 4GRSA 1NF7A 3J7HA 5KINA 4GNVA 2TRSA 1OHLA 4XO6A 2QPSA 1H49A 1SZGA 4BQ5A 5HWMA 3AMCA 3Q2DA 5C55A 3VNYA 4JYDA 4V15A 4Y6GA 1UWSA 4Q8OA 3WD4A 1GT8A 1VKFA 4GVIA 3UW6A 3P60A 3OZYA 5HR6A 3F7JA 3UCQA 4GFIA 1E0XA 3SCQA 2RHGA 1O94A 1DVJA 3B8TA 1SR0A 5D2VA 1S39A 4NXKA 2ZRZA 3ARRA 4L9XA 3W87A 1B57A 3QY6A 2WLZA 1W6TA 4PBGA 3STGA 1UZHA 3SBFA 1GHRA 2W4XA 4NZ5A 1W5OA 4AMCA 5ECVA 2X1TA 4CUCA 3S1VA 2EJ1A 3JVAA 1KFLA 3W00A 3BLFA 4JHMA 1MQPA 1ZTVA 4P7LA 1UKOA 1FXQA 1YADA 3E5BA 4IG2A 4V27A 3F03K 3LDVA 3C8FA 2G41A 2FMOA 1MXSA 4PTXA 1SO6A 5DCDA 2A5HA 1GPFA 3MT1A 3A5FA 1EBGA 5C7HA 1PAMA 1K9TA 2XN1A 3DC0A 2V81A 3VNJA 1WX0A 3SN1A 1UBPC 1E6SM 4CD4A 4P2VA 2WJDA 3A9IA 3SUUA 3ZT5A 4LB4A 1BXNA 2NLIA 2NXIA 3I7RA 4GI4A 5BRQA 4JIEA 3C2YA 1SPQA 5EMUA 4AZCA 1UR4A 2YX0A 2OYLA 2YJQA 3P74A 3APTA 2RJHA 1H7OA 3NYDA 4HZ7A 4O13A 5REQA 2FYMA 2GSJA 6ENLA 2C0HA 4LW7A 2DY3A 4QS5A 1V02E 2ZVIA 3UU0A 2HTMA 2X7WA 5AHLA 3TYBA 1HZYA 3GQYA 4XD5A 2VWSA 3LB0A 2VC6A 5D8ZA 3IV8A 3VTRA 3BLDA 4IQLA 1PZ3A 3KTSA 4WJXA 1Y7VA 4IZGA 1ALDA 1N8IA 4JIHA 2EQDA 3GXTA 4WX2A 4DYEA 4Q3MA 3DFSA 4B9ZA 1I6NA 1EPVA 3W6LA 4TVCA 4TMCA 3BW2A 2VDHA 1W9XA 4C6LA 4GFSA 3W1QA 3P62A 4MY9A 3SUSA 1Q4NX 3GIPA 4IFOA 5JBFA 2C79A 2ZX7A 3BAWA 2AGTA 2AGKA 4YN5A 3W74A 1LOLA 4C60A 1MZHA 2R6OA 1HX0A 5C9UA 3NQMA 1YMYA 5HQEA 3MUIA 4AW7A 2UY5A 1BWVA 3OGRA 1UBSA 1TE1A 5CG0A 2CFFA 4C7GA 3KS6A 1O5KA 3TAKA 8XIMA 3KOZA 4ATLA 2F8QA 3LPPA 3LOTA 1YTKA 3DECA 2QF7A 4X63A 4H00A 3NO3A 5IXEA 3BSHA 3QYSA 1F3EA 1QFEA 1A0DA 1YPXA 2PD9A 4X61A 4YTSA 3ZR5A 3PZQA 3S5ZA 5A8QA 2WC3A 3PULA 1QPRA 3TZFA 1JPKA 2ZICA 2IMRA 3V4BA 4WCJA 4DUXA 1UB3A 4D8LA 3R43A 3A3WA 3AXIA 2DZUA 2Y24A 4C6QA 3W83A 2HVNA 4XUYA 7REQB 5LSMA 2PWVA 3VZZA 3LRKA 4J40A 3DBPA 3DAQA 4KIEA 3WQDA 3UZJA 3IJDA 3N11A 3MUZ1 2VGFA 1SM9A 3HB9A 1RVGA 3AU2A 1MO0A 1TVLA 4GJJA 5DF0A 2PGFA 1EGVA 3IRSA 4RPPA 2I14A 1FKXA 1KW1A 4E4FA 1EIXA 3W02A 5C7VA 3PNZA 1HO1A 3QQWA 1EH9A 4WY0B 3B0UX 3NPXA 3O7UA 3W7EA 4O1CA 1NOUA 3CO8A 4PFMA 5AYYA 1OVDA 2HXUA 4GPNA 4Z2HA 5AHIA 3AS0A 4MKSA 3NDOA 3NM3A 1MXGA 1FWAC 1H60A 2PDPA 4HHMA 2XH4A 3GUGA 3A4WA 4PEEA 3V18A 1JZ8A 4NAEA 3SFWA 1Z9AA 2VRKA 3EOOA 1R5YA 1S2AA 2X30A 3DC8A 1BVWA 4G7EA 4Q33A 5HMEA 3B8WA 1KCZA 1B4KA 4QDPA 3B04A 4LT9A 4ZTXA 5JIWA 4R9OA 4JTJA 2CBJA 3RM9A 4YIWA 2IW0A 1OM0A 2TPSA 1VYRA 2D0HA 3UR8A 4Q4KA 2D24A 4F0MA 5CC5A 3ZR6A 4MB4A 5HAOA 4NZ4A 2BY1A 2Q01A 1M41A 1R47A 1KV8A 5JBDA 3AOFA 1IIHA 2QUTA 3N34A 1DWFM 1SJCA 1VPYA 3ZJ7A 2VRJA 1KM1A 1A4LA 1P0EA 1YW1A 4R27A 3L5AA 1F9CA 3N6JA 4Z1DA 2J47A 1GNXA 1K70A 2WZHA 5A8OA 3QRHA 1UKQA 1I2PA 1XV8A 3O9NA 3VGGA 2WK2A 3ITCA 1EZWA 1N82A 1UR1A 1JQVA 5KZEA 3WEOA 4HOZA 1OT1A 4GMEA 4N2YA 5CGMA 3WFZA 1TJ0A 2BHUA 5CPMA 2FH6A 3RITA 5HPCA 2AL2A 4DIAA 1UWTA 3PZIA 4X9YA 1V77A 3W1UA 1B90A 2CXGA 1AW2A 4S1FA 1VFMA 4LCRA 1NDVA 1GQKA 4M24A 3VFCA 1UKPA 4MUPA 3GNDA 4XISA 1QRQA 1TB3A 1E0VA 1DXEA 4N9EA 3W1XA 5XINA 3NZPA 1C29A 3JS3A 3KEHA 1G94A 2PA6A 1VEPA 1JDFA 2EG8A 4J3ZA 1CXFA 1XBZA 5BOFA 1OFAA 1CT5A 3BAKA 1K7FA 4M7SA 3O63A 1UD8A 2OSXA 1X6LA 1XGZA 4MNLA 1U1UA 4CVUA 2ZZ1A 1XCFA 2VP8A 4AEEA 5HOSA 1NWTA 5D05A 4AU0A 1XFBA 1EUNA 4LVFA 3G3DA 2YA0A 1L9WA 3AU6A 3VGEA 4HB7A 4IJRA 3T8LA 2QJGA 4UIOA 4MWAE 2VC7A 3GZAA 5KITA 1R3YA 2OYKA 4QNEA 4IL0A 2NUWA 1BF6A 3C86A 3BH4A 3LU2A 4WOZA 1U2YA 4Y8EA 3L68A 1JXKA 3OLDA 3T9PA 3M47A 1SJDA 1PKNA 2QULA 3HURA 4I8DA 3ZVHB 4TX9A 1J6PA 4BQ2A 3A4XA 2FGBA 2GJXA 5JXQA 1EEXA 1YQ2A 1CLXA 1XKJA 3WLMA 3UNTA 4BZYA 2G3FA 3GXNA 3TQVA 4ML4A 4DJFA 2ONEA 3NQEA 2YR1A 1W54A 1FDZA 4NYUA 1EXBA 4J35A 4HU8A 4E38A 3UR5A 1EJWC 1K7XA 4RDYA 1EGMA 1KFJA 4HPGA 4W7VA 4UMCA 1W1TA 1TO3A 2P3ZA 2XGZA 1EQCA 4OOZA 4IJBA 4V2XA 4RJEA 3UXIA 5CPNA 3NXLA 1DIOA 1KXTA 4X9SA 3T55A 1V02A 4B90A 4B3ZA 1TV4A 3PUEA 3T0CA 4HCHA 3RJXA 1QI5A 3DGBA 4RX0A 1IEWA 2E3ZA 2EG7A 4YWSA 3WKZA 4NIRA 4EWND 3GDLA 3H2CA 4C90A 1VBJA 1BKSA 3SO7A 2QJJA 3P81A 4LOCA 2FFIA 5CJMA 4DAFA 2DZXA 2ZUNA 3W72A 1AQHA 1PDYA 2NT0A 4WSHA 1Q2SA 3BAJA 4YJ5A 4S3GA 1J4EA 1HP4A 1X39A 4DJFD 1CECA 4QJ5B 3WD3A 2JK2A 1SZRA 1RUSA 4FLOA 1VPQA 2WVVB 4ZO6A 3GXFA 2HDJA 3KW3A 3VDHA 3H4XA 4CCZA 3BSMA 1DJYA 4GVFA 1CCWB 4MWAB 4QE5A 3O0FA 5D09A 2CWNA 1RPKA 1BPLB 4LAOA 3KBNA 1DIDA 5I3HA 2IXUA 3RX4A 2XFFA 3ZWSA 1A5OC 1PB0A 1T99A 2PWUA 1Q6CA 2VR4A 3S4TA 2PSNA 1AH0A 3CUGA 1QNVA 3THCA 2ZBTA 3MVIA 1XH1A 3LXBA 1X8CA 4KEVA 4IP4A 3TV8A 3ELFA 1E4NA 2H3BA 3BXWA 3M9YA 2REQA 4K1GA 1C90A 4A2RA 4LANA 2HISA 4AD2A 3HO8A 4LF2A 3IK4A 1CGUA 1V3KA 1D7KA 1ISYA 3S5OA 3HV8A 3ISIX 3ITVA 4LFYA 3F5KA 4KWOA 3ONCA 4KMQA 1PHWA 4IMFA 5DANA 4FNSA 2Z6IA 3TOYA 1ZFJA 2JEPA 5LGXA 3AMGA 5D30A 6CGTA 2PWGA 1AMYA 1G0CA 1XCXA 1IWAA 3P84A 2J13A 3QVQA 1S2VA 3GK0A 3OYXA 3PNUA 3Q67A 4NZCA 2HS6A 5FF4A 1E9LA 2Y2WA 3UXDA 3I4EA 3VK5A 2X8RA 3ZLFA 1CEOA 1XLGA 1HKIA 1T8XA 1NY1A 4DZAA 4Z17A 3VIGA 3SCOA 4MFEA 8TIMA 2PI6A 4OHQA 3S2CA 4WXYA 3L4WA 4JOMA 2HWGA 1R86A 2H9AB 3HM7A 2JGYA 1VAHA 3WFAA 3K4DA 3GR8A 3GC4A 2QDDA 2YXXA 3A3HA 4PFHA 3EEGA 3AHYA 1RJQA 4JTCA 4QCFA 1YRRA 4K68A 3WO8A 5L6UA 3W6MA 2CERA 2PD5A 5FEZA 4CU6A 1HFBA 3R89A 1OYCA 3V0UA 4UOQA 4PCSA 5DY2A 3MMWA 2WJZA 3GNOA 2PTWA 5AC7A 4A8RA 4EPBC 3PZMA 2GVYA 2XIMA 2FQIA 1YPFA 3TN3A 2ACSA 4B4FA 2HNHA 2OMAA 2B7OA 1EHAA 2PZNA 4PUWA 4UFIA 2MUCA 1DIEA 1W3JA 3RCNA 1XXXA 2ZDRA 4FXRA 4PMDA 1E0WA 3DHUA 3P2VA 4J9JA 4IOTA 4YWIA 2OEJA 4HNNA 4Z08A 2PWHA 5A2BA 3VX1A 2H8ZA 1H1YA 2VX5A 2X2YA 2QR6A 1E5JA 1DWHM 2HCVA 1QW8A 2OODA 4G7FA 3VKJA 4C6PA 4PL1A 1H1ZA 1B9ZA 3R79A 1W5MA 4E0CA 3E0FA 4MDOA 3G8RA 2W91A 2EPNA 1WOAA 3EKLA 1US0A 1FCQA 1K4GA 5I06A 1W3LA 3VVGA 2YPIA 3GNXA 2ZE3A 2J7FA 2O56A 3BE7A 3N15A 1ZCCA 2XGBA 1ECQA 1XYMA 3P7YA 3G6LA 4TX6A 1KBJA 4D6HA 1RHCA 3GR7A 1FTXA 3K1DA 1SFSA 1TPFA 4LEQA 1TYGA 1YNQA 1BD0A 3WQ8A 2PWEA 4E2OA 2C6QA 3PWIA 1K7EA 2HK0A 5FEXA 2TMDA 2O9RA 3MMTA 2PDLA 2R24A 4BR1A 4ZZ9A 3LV6A 2G0WA 1WZMA 5J04A 4LUSA 4DN1A 2GGIA 3C2OA 3VGBA 2Y7FA 4UTHA 1XG3A 2ZFAA 1DP0A 3O06A 1BQGA 1Q6EA 5M5DA 2WQPA 3KAOA 3MVTA 4P5UA 3UA3A 3ZXWA 2WKGA 2EJAA 1HKKA 4FX8A 5G1TA 3D5HA 1ZJAA 4ZCWA 3TMLA 1GYLA 4Q4MA 2XVNA 5XIAA 2QV5A 2I16A 1GOKA 2A6NA 1TRDA 5EMJA 3HPSA 3NR0A 3R2GA 4X0NA 4F2BA 1W32A 1SO3A 5FL0A 1HGYA 2W6RA 4MF4A 1EA9C 2DORA 5FJPA 2E09A 1S1RA 4BI7A 1PZ1A 1WNOA 1WE5A 4PBEA 1XBVA 3N4AA 2YDAA 2ZRXA 2BP1A 4ZQMA 1AH4A 3LRLA 5E9AA 2BVYA 5BU6A 1ZBKA 3E96A 2EPHA 1DV7A 4JN8A 3GO2A 3LN3A 4OUEA 1E3XA 3EMQA 4MG4A 1OYAA 3IUHA 4AC1X 4GYJA 3R5EA 4HCLA 1KFWA 3CPUA 1TX0A 3LV5A 4GQQA 1AK5A 3VDAA 1M1BA 1XL9A 4AD1A 1VFUA 4MKVA 4PMVA 1XQLA 3QV8A 1P4CA 3QBUA 4Y96A 4V1YA 4YLWA 3TU9A 4AZ5A 4ZMGA 1JYVA 4KKXA 4GQ0A 1S5WA 1UWIA 4B4HA 2J9XA 5FL1A 1W8SA 1KLYA 1YIXA 1PX3A 7XIMA 2PC4A 1OF6A 2XIOA 1C8QA 1DL3A 4UCGA 2QZRA 4L65A 2UY3A 1UH3A 2XTKA 5HXMA 3KBSA 1V6UA 4QISA 1PVNA 3KBVA 2J62A 1L6GA 2PDCA 3G6MA 3VIMA 4C6IA 2DH2A 4H9YA 4PTVA 5H91A 3GYCA 4KEMA 1WDQA 4HNVA 3IGUA 3II1A 1V0KA 4FF5A 5XIMA 1O7AA 3EA3A 2OSWA 1M3UA 4Q8QA 1FUYA 4UFHA 3VOGA 3IUDA 3EWXA 3SECA 3TTOA 1EA0A 1KLZA 3COTA 3EYPA 3VIOA 4MFDA 1WAUA 4D71A 4ZQPA 2A6LA 1UZ4A 1XQKA 1IWBA 2WSKA 3L0NA 1EOMA 4ZA0A 2QCDA 2POTA 1E73M 1W9DM 3O3RA 4HK7A 4WKAA 3M0ZA 3TJXA 3IPWA 3VUSA 4OVXA 1QI0A 4WD0A 1HXJA 4LCQA 2PMQA 3KBWA 3QQ1A 2BOFX 3CYVA 2VDIA 3LERA 3IIXA 3SSJA 4J3XA 1EZ2A 1I0DA 3KTXA 4H8NA 3R8RA 4M3PA 2Q8LA 4CNOA 1P48A 5ABEA 2QCNA 5HNNA 3MO7A 2VM8A 5ECUA 4OV4A 4L1WA 1KM4A 4MOZA 4KEUA 5JQ9A 2F9RA 4KETA 3A23A 1OJXA 1W1PA 4JTDA 3CNYA 1N8FA 3U6WA 4EWJA 1PZ0A 3I3EA 5F4XA 3KUMA 4IXXA 5KETA 2VTFA 1FCBA 3QC3A 4HP5A 3BVJA 2EPKX 3LCXA 3PM6A 3GLCA 4F40A 3AS3A 4L6OA 1I1XA 2A4AA 1LUCB 4LC6A 4DBDA 3UJ2A 1QDSA 2OVLA 3MUCA 4TTGA 1A80A 4AF0B 1D2KA 2AQWA 1P1MA 5LNRA 5D37A 1BFNA 3WUGA 3N1AA 3I6RA 2VRQA 2QUVA 2PRLA 3W7QA 4J7RA 3EBVA 4CNUA 5CEWA 1OGGA 3W3OA 1J0KA 4UTJA 1TR9A 5HQMA 4UTWC 4ATDA 2OLSA 3SW6A 3RR4A 3ANYA 2FLIA 4LUYA 1FBAA 1E43A 4DJEC 3UQNA 1O5XA 2XH7A 1Q65A 1WDSA 3BQ5A 3PBUA 4PMUA 1FHLA 3IJ8A 3AIVA 2TODA 3IV3A 1FKWA 5A6SA 3IVSA 1XISA 2Z1KA 1K1DA 2V5DA 3WDPP 4R33A 2Z1BA 2Q09A 5AYIA 4FX7A 3ARVA 1GUVA 4W8AA 3ZO9A 1QI3A 2OT1A 4TO8A 4H9TA 1DWJM 1HJWA 4OOUA 1JDEA 4JKKA 4H9XA 4OWGA 4S3EA 4JY9A 4GGBA 4J4KA 1IT0A 1LDCA 3VD3A 5DMNA 2CW6A 1XPGA 2ZUVA 2VX7A 2TAAA 2E1DA 3OB8A 1ODZA 1OX5A 3N19B 5E5CA 4NKCA 3AMDA 3QR0A 3QSRA 2BS9A 4IMEA 4KF1A 1AW1A 5C54A 2CLHA 4MSSA 4MWAD 3WBEA 3MBFA 3VCRA 4Z2JA 3RF9A 3UPBA 1A0EA 3G1DA 2QT3A 4EP8C 3R7MA 1HJXA 1ZSXA 4J1OA 3D47A 4GX8A 2W67A 4FB7A 3W84A 4MZ8A 3ARSA 4AWTA 1A5AA 1GVRA 4GY0A 4DRSA 5GJMA 5A2CA 4DI9A 3MUY1 1PX8A 5TD4A 4C65A 3AYSA 3I6TA 4IJCA 1OFDA 3L12A 1WUFA 3QHMA 1BYAA 3RUBL 2WKLA 4IGMA 2NSXA 1E56A 1MUCA 3KLKA 1QUMA 2V5LA 1I60A 4RW3A 1HO4A 1N8WA 3KDOA 1V3JA 1A5KC 4IIGA 1Q6QA 2WCGA 2Z7KA 3UERA 3WLIA 2DDXA 1UH4A 4R85A 4ZQNA 1VLWA 1QU4A 5F1VA 1Q8AA 1ODUA 1JPHA 3LENA 1PTAA 2D3NA 2BGSA 5EU9A 3T2OA 1LBFA 3WUBA 3CWOX 4MB3A 3QMRA 2WXDM 4FNQA 5AKQA 3ABXA 2EO7A 3ENLA 4IFKA 4O1BA 4GKTA 3OP2A 2G4FA 2FZ8A 2J27A 3LM3A 3UJFA 2FPTA 4LQ1A 3UY7A 4DPQA 2KAUC 1W3NA 3E0LA 1VEOA 3H23A 3DI0A 3A5VA 1Z41A 3AWNA 1Q3NA 2ZRYA 3FEQA 3LPGA 2R9RA 4I5UA 3TC3A 2CXEA 1P0NA 2PURA 1FWDC 3GHTA 2W92A 3KVKA 3MCNA 4H8UA 3FCPA 3FS2A 2NSOA 1GK8A 4B2DD 5EBAA 4PUKA 2J9ZA 3A22A 3N6QA 2QKFA 1V8EA 1FH9A 2WSYA 4PYSA 1ZAIA 7ENLA 1QK2A 3HGSA 3EX3A 3QGVA 3KLLA 1W1B1 2NW0A 3CUHA 3VD4A 5A6BD 4JAWA 3DCPA 3TX9A 1Z7AA 4K8EA 2BXVA 4MY1A 2DT3A 2XIBA 1ADSA 5FF3A 1M7JA 1HUVA 8RUCA 3WNMA 2DSZA 3EX1A 3E49A 1KCLA 1EC9A 3T0DA 2BGNE 4B5UA 1O66A 2NVCA 3PVFA 1B3YA 2GSHA 1JR1A 3C0LA 4NU7A 2PC8A 2WOQA 1FWFC 2BLEA 5IDZA 1DJQA 1B9BA 1LT8A 1X6NA 1DPMA 2VCAA 2GQAA 2C18A 4P8XA 3YPIA 1JCYA 1JZ2A 4P8WA 5T26A 3GH5A 4WIWA 1F6KA 1XLFA 3B8UA 2D3LA 4YVXA 4QNWA 2OT0A 2X40A 2UBPC 4GXPA 4MNKA 4C6NA 3T44A 4ZB0A 1ZRQA 1NF0A 1OX4B 4MVAA 4QFUA 1JCMP 1CGYA 4EOUA 3DFHA 2QQ6A 3BG3A 5BMWA 3BOLA 3BL3A 3M64A 1GVIA 4F8XA 4W88A 3O0KA 4HT3A 3NQAA 4HIBA 2OQHA 4Z1AA 3CV1A 2C14A 3AMLA 4KEZA 2VX4A 4H9UA 3C6CA 4GLEA 1ZUAX 3RRAA 5TBOA 4CGTA 3HN3A 3WDJA 4PMJA 4O0KA 5U4NA 4JX5A 1RALA 2I5IA 2WO5A 4QG9A 5FIPA 1AMKA 2BHZA 2Z7GA 2WM0A 2JF7A 3ZVHA 2BZNA 1A5SA 5KTLA 4JR5A 3QH2A 1FDYA 4IIEA 4GUFA 4MDPA 4OECA 2CCRA 3S9YA 3VOHA 3GRIA 5FJJA 4AZHA 1B0IA 4U33A 2ISVA 1U22A 1F5ZA 4DXXA 2MANA 1UD4A 3G1SA 4D6FA 1B5TA 2JEQA 1DJHA 3NQ2A 4PB5A 1V4YA 1UC4A 4LUIA 5E0CA 3PP7A 4AIBA 2WJEA 1IHIA 4D6EA 1UD3A 4W5UA 3TN5A 5HMFA 3TQKA 1RCXB 4X2PA 2ZA1A 2LLEA 1G1YA 5JIPA 4XVDA 4H6QA 1EWDA 3W81A 3L9CA 4DZIA 4Z2IA 5CSRA 1WAWA 5CSYA 2VCBA 1CPUA 4HU0A 4JN6A 3CYJA 4JEQA 1JULA 1XLMA 1PYFA 3T42A 3KRBA 4H9ZA 3BLOA 9CGTA 3KVMA 3CMFA 1BTCA 5C71A 2ZX8A 3R11A 3MC5A 5FAJA 1O6IA 1TCMA 1KGXA 1DXIA 3DU0A 2NWRA 1THFD 3UR2A 2JALA 4LBSA 1ONWA 2DEPA 1S5MA 4FXJA 2GGHA 3UYCA 4XSLA 4ERIA 1B54A 1SFLA 5FJIA 3WLTA 1O12A 3AIEA 3LHYA 4WJEA 4HYWA 4DUOA 2IUZA 3IIPA 5LNWA 5G4HC 1UG6A 1H5YA 1KXHA 5CZKA 1MNSA 4HNOA 3GIQA 1W2VA 4D6JA 4N6FA 1GPWA 4IUGA 1GOXA 1ZP3A 2BMBA 4C1NA 2DT1A 1UD6A 3CT2A 3G1AA 4Z0SA 4FI4A 3CZGA 4FNTA 4MWAA 1SZFA 4A29A 4ONVA 2GJNA 3HQ1A 4O8RA 2G50A 1XLAA 2WSQA 3MU7A 5BOOA 4WR3A 4DWSD 4LF1A 1ITQA 4C91A 3MSYA 3BSGA 1J12A 4J28A 1CLKA 3TSMA 1L0PA 2VGGA 5E1QA 4NNAA 5CQ1A 1XRVA 1XDJA 2FVKA 2UZ9A 2PRHA 4R88A 4QIUA 1GWJA 4GBUA 2V2DA 3FK4A 4F4RA 1DKWA 2XSXA 2HRWA 2WHJA 1R7OA 3CV2A 3C0JA 5A6KA 1R85A 4GQRA 2OKOA 3UETA 4DUVA 5I09A 1MI3A 4C7FA 1JG9A 5AYBA 2VKZG 4IMDA 3CHVA 3DOPA 2VENA 3B40A 3C4UA 4WEVX 1R2SA 3LZ5A 3H7RA 2ZX9A 1D7FA 2QUNA 5A6AA 2AOSA 3A6OA 3G0XA 3TUUA 4JGDA 1L8NA 4AF0A 1VRDA 2X2GA 4EXBA 2E6DA 4S3AA 3LTPA 3UPWA 3DYPA 1LYXA 4DWSA 1H2JA 1OX6A 3JUGA 2UV8G 4XZHA 3JW7A 3GH7A 1PIIA 1TJ2A 5GVJA 4JL2A 1ESWA 3BGAA 4RK8A 3C2FA 3WBWA 3THDA 3APYA 3TYZA 2QAFA 1XSJA 1TREA 3ARYA 1XHGA 2QEZA 4RNIA 3GNRA 3GG8A 4PRRA 2Y70A 3AZRA 3DYMA 4E8CA 3G1FA 2ZZ6A 1ECEA 3VKDA 1XC4A 2J8GA 4ZFMA 1M7XA 2DPEA 5JVLA 1W5PA 3H53A 1XP3A 3U7BA 3ZT6A 2ACUA 3MSGA 2XZ9A 2YDRA 2BG5A 3DH7A 3QJAA 2CHRA 3VKAA 4BWLC 4EAMA 5JU6A 2ZIDA 2PU1A 4MAVA 4Z2KA 1HKWA 3GG1A 2NXGA 2BHYA 2OWWA 3AIUA 5A6BA 5AHEA 2F84A 4DF2A 1RK5A 3NL3A 2VURA 4QITA 3KCOA 1UUOA 4GE8A 4YXGA 1O5QA 1NOWA 2QCEA 3WBAA 2GJXB 2CZDA 1TWIA 4AFYA 1C3FA 2YLAA 3LBMA 4XZWA 2WVUA 1CXEA 2XVGA 5FKYA 1FXPA 1JPDX 4FSAA 5D9PA 2PTDA 1UZ1A 5CH9A 2G8ZA 3GUWA 4JDYA 3ATYA 2R1LA 4QAIA 2ZKMX 3TROA 2DUXA 1WDRA 4KW2A 1CNVA 4GZIA 4XZIA 1VS1A 1E3ZA 4ZQCA 3PB2A 5FOOA 1V51A 4WDUA 3F4DA 3RHGA 2X41A 4GH1A 1S46A 3SCSA 1L2QA 1FWNA 4RE0A 3CIXA 4L7ZA 3TXVA 4IIFA 2ZRVA 3QR1A 4G5DA 1F7BA 1KRMA 4PUEA 1O1ZA 3W2JA 2PAJA 2VR5A 3OLGA 5LIYX 4BEUA 2IPGA 3TTYA 2WZIA 5I77A 1EF2A 2HXTA 4CNNA 3LLFA 3KRZA 3TJLA 4ZVJA 1V6TA 2B7PA 1ZAJA 2ON3A 4H8HA 4HJWA 5G4EA 4HYRA 5AFDA 3WQWA 6A3HA 4GY7A 5ENLA 1FWBC 3N4FA 3A12A 5T9CE 5G2HA 4NY2A 3BLEA 3UG4A 4MPKA 3W26A 3XIMA 3H4WA 1J8VA 4O10A 2FTPA 3PC0A 4TIMA 4XAFA 4AIOA 3MP4A 3GDKA 4E2BA 1E0TA 1ITUA 5CJNA 3IGSA 4PMRA 1UA7A 1Q85A 4R7JA 4UB9A 1UKTA 1KC7A 1XRFA 1P7TA 1XLIA 2XINA 1SO4A 1DJZA 4DNMA 1RQBA 5DT5A 4ORIA 3QPEA 1QI2A 1BWKA 3MWCA 2IPJA 2YOCA 1OINA 1UA3A 3S46A 3EZ4A 4D2JA 1WXYA 4AISA 1M65A 3DFOA 4HGXA 1QK0A 4GX9A 3TKFA 1P43A 4IGNA 1EYEA 2YCLB 2OQLA 2IQDA 2F2HA 3WELA 3S1XA 4HNCA 3AUOA 1XC6A 3G3MA 3EPOA 1OB0A 2B31A 3K1GA 2ACRA 3N2XA 4DEFA 5AHMA 2ALDA 3GTHA 1H7WA 4V33A 2CHNA 3T0TA 2AAMA 1G5AA 3RYSA 4IF2A 4G56A 1HIZA 4J3SA 4LV4A 3BAYA 1R2TA 4FK9A 4L1GA 4HD5A 4YCOA 3LI1A 1E55A 2OYMA 4GQBA 3A3XA 3L2IA 1XRTA 3ABOA 2OJPA 1I2RA 2FPVA 4K2SA 2BY2A 3VPLA 2Z1SA 1MEIA 3T8QA 1C91A 1W3TA 2J8FA 3GTXA 3KZSA 4DXKA 1XYZA 4WJ8A 3SM0A 3H2EA 4F0SA 1D3CA 2AAAA 4M29A 3E2VA 3G1RA 2A1YA 5E0FA 4O0QA 3LLXA 5C9RA 4ZGYA 4UWMA 4H7VA 4ZL1A 1LORA 3RR1A 4JTUA 4LEFA 1J0JA 4NUWA 1ZHAA 3QHOA 3TH6A 1RAKA 2VZTA 4CN4A 4AH7A 3CUFA 2Y85A 4M81A 3EOSA 3RPTA 5LGZA 1B2YA 3PZUA 2IKGA 4RR4A 2GDVA 3OG2A 5HK4A 2AL1A 3WDIA 3N73A 2VC5A 3LCIA 1SUXA 1DWIM 1WCGA 1X97A 5I3JA 3GBEA 3B9OA 3QN3A 4UR9A 3V75A 1GOOA 3UT0A 2BGQA 4AZIA 3VD9A 1ZY9A 1XBYA 3WD0A 4GCXA 1NDZA 4PCPA 1JAKA 4KRTA 5D02A 3QKEA 5GPRA 3VOIA 1DJWA 2VO5A 3ANVA 3QLDA 2R94A 5BOEA 4L1XA 4MPQA 1H61A 2W0UA 2DGAA 5HMSA 3VILA 3MTWA 5DN1A 5PTDA 5B80A 1W1YA 3WH8A 4LY4A 3WJYA 4O50A 3MKKA 1XIHA 2V6AA 1J01A 1N55A 2WCSA 3B06A 1A3HA 1VENA 4K3ZA 1FWRA 4KRUA 5TQLA 2EPOA 1OCQA 3G5EA 1J0HA 4WY0A 4BF9A 2PDQA 2ZZ5A 2BXZA 3NSNA 4UZSA 2OZ3A 4IPIA 2J25A 3H2AA 4UFKA 1T6MA 2Q3OA 2H8XA 3W88A 4Q7IA 2QF8A 3HGJA 4KBXA 4HNUA 2GDUA 3W53A 1I8JA 3CL6A 3AO0A 4MJ2A 3LXAA 4A3UA 1K02A 2CLEA 4NZ3A 2ZX6A 1SW3A 1VJZA 1TWSA 2KZHA 1IXQA 2WMKA 3R1ZA 1NQ6A 4YHGA 4WGXA 1ZQ5A 1K03A 1KCKA 3W85A 1Q5MA 2Y7GA 3SCPA 2ZWZA 4O57A 3W6YA 4P7RA 3NUKA 4BKNA 2QCFA 3QY8A 4RNHA 1GKPA 3QHNA 4PTNA 1QNSA 3D6NA 3PUDA 4JEJA 1XINA 3UWZA 2VHLA 2GFTA 4US6A 3IANA 3NNTA 1K8XA 2JQXA 4XTDA 4AY1A 3D3FA 3M7WA 1UZDA 1ZGDA 1H62A 1MQQA 5I3KA 4HZ6A 1A3XA 3OVQA 4QQ3A 2Y6ZA 2ISWA 1W1A1 4Q4QA 2XN0A 2PWDA 5LHFA 3MPGA 3W76A 1M04A 2OGJA 4W87A 1K4HA 2Z2UA 1UASA 3BMWA 2E9BA 2OX1A 1ZJBA 1RY0A 1WZKA 4XWUA 2EPLX 3MI6A 2YKKA 4FNRA 4TUFA 3HQOA 3S42A 2I5GA 1A50A 3R0KA 4QCEA 1US3A 3M6YA 1LQ0A 3EMZA 1H5VA 3WQ6A 4Z42C 2EXOA 1YHTA 4LVBA 3B05A 3NVDA 3EX4A 1TPWA 3VNDA 4N6EA 4LVGA 1AA1B 1X96A 4Q7NA 1DJGA 4OJYA 3AISA 4LAUA 4GHRA 3V1HA 2YXOA 3P5YA 4F0KA 1JYWA 4D9PA 1VYPX 3L5MA 5E0KA 5FSDC 3AYVA 1V03A 1KBKA 3WL0A 4DHGA 1DQXA 3KDNA 2J7EA 3W82A 4HK6A 2PDNA 2WV8A 3ZSTA 2IQ0A 4F0HA 1H7PA 3UZZA 3C52A 1HW6A 2GZXA 1MW3A 2O9OA 2VUNA 2IS7A 3LM7A 4BWLA 1XDMA 2VC9A 2DSVA 4MNMA 5CPLA 3EWWA 3DI1A 2QCGA 2FZNA 4PRTA 4ADUA 1PKYA 4QGCA 4F3HA 1FCUA 1E6ZA 1VBUA 1TV3A 2QLYA 3WQEA 2XPKA 2QPXA 1NM9A 1WXZA 3VD7A 4RV3A 7REQA 3NQFA 3S5SA 2OR2A 3CZJA 4CD8A 3CBWA 3ITTA 4U10A 1WV2A 5D8WA 3RIKA 4HPXA 5B7ZA 1EDTA 4HPJA 3UF9A 4EX4A 2YB4A 3NA8A 3OGVA 5M3WA 2PDJA 1P6BA 1VB9A 4Q8WA 1PWMA 1QW9A 3R25A 1ZBCA 2E40A 5TAOA 1UUQA 3AAMA 2DQWA 3QMTA 2Z27A 1FH7A 5KZMA 4KT2A 3OEXA 1RLCL 4PB4A 2CLKA 4MJZA 5AVHA 4DYKA 3ERPA 4UZUA 1FWTA 1A49A 1LLOA 1CLVA 3UGVA 1XSIA 3CQIA 5HBFA 1BGGA 3E74A 1CGTA 3CB3A 4JCMA 4C5YA 1FFQA 1HL9A 1AVAA 3MBDA 1X1OA 3S0CA 2GK1B 2MNRA 3ABSA 3P0WA 4HOXA 2CLFA 5I6SA 3O05A 4GKLA 4NZ1A 4U31A 5BRBA 2NVAA 4NJKA 1I1WA 2VFIA 4ZO9A 3ANUA 4DQWA 2E8YA 2WMJA 2Y4SA 2ZRUA 4RE4A 3VIPA 3BCDA 1H7XA 3K30A 4PUNA 4O17A 7ODCA 3NQCA 3UR7A 4W8BA 4INFA 1F74A 5FSEC 4PTWA 4D6GA 1DE6A 3I7SA 2GK1A 4GC3A 3USZA 5C8BB 5E9XA 3WQOA 3LHWA 1J11A 1MYRA 3R13A 2ZTKA 2F6XA 3WF4A 3H8AA 4PH6A 4LYKA 1V3IA 4I6VA 3HPXA 4ML9A 3PZNA 3WG6A 3ZR4A 4A05A 2QCCA 4DPPA 4ES4A 4ZXOA 2O55A 3QV6A 1RBOB 2O7SA 1KV5A 2YDQA 6PTDA 1YDYA 2DFAA 3SCWA 2V5JA 2YL9A 3GKFA 1PCWA 4RXGA 4KCUA 3M1ZA 4Q6XA 4LVAA 3ITOA 3PWAA 4I5XA 1XDLA 4K8HA 4E3TA 3BDKA 3LQGA 3QSTA 5CCZA 3F2CA 2EGZA 5JBEA 5HJXA 3TLLA 1H7RA 4UTWA 4YVPA 3LK6A 1VIZA 1OEPA 1WUEA 1CBGA 8CGTA 1QJWA 4CD7A 2HVMA 2J7DA 1NJJA 1ZBVA 4H01A 1EP3A 1QNQA 2Z00A 2A7PA 1R38A 2VEGA 1F6YA 1ICQA 2DZSA 2NV1A 3MI3A 1VC4A 4UFJA 4B91A 4NT0A 3SSZA 4B3LA 4S3FA 6REQA 4AZ7A 4Y8FA 1IEXA 2D2JA 3GG7A 4I5RA 3R58A 3GWQA 1Q6OA 3N3MA 2J7HA 4RDWA 1BSIA 3TFCA 2XUCA 2ZUWA 3GHRA 3VDGA 3WY1A 1X7IA 3U2EA 2YIHA 2R1KA 3SY5A 1J0YA 2V3DA 3RPDA 2CLOA 2GDQA 2I57A 3BWWA 3WENA 4EANA 3KP0A 4OBSA 2D0FA 1FHDA 3T07A 4Y9MA 4HSOA 4MKNA 5TF0A 3KBMA 3QTGA 1XM3A 2NQ9A 3B03A 2KX9A 2P50A 4GH3A 3EKGA 1UD2A 4M7TA 4HA1A 1RCQA 1S2TA 5H8UA 4W5ZA 4D1JA 4UTKA 1M68A 2I9EA 2NQLA 5AC5A 5AECA 3R12A 3SCNA 2FZ9A 1JUKA 3EEZA 5TNVA 4QE1A 3ZIZA 3CEPA 3WLLA 1EF3A 4LCSA 1PTGA 1UHVA 3EWUA 3LTSA 3BOFA 4MADA 4W8LA 1UR8A 3BK0A 1YYAA 3ZYZA 2VNCA 4MJ4A 1R3QA 2Y8VA 3WUFA 4L4OA 2WLYA 4XIMA 4TR9A 1DTNA 4DZ5A 2P0OA 1W91A 1HL2A 4NRSA 1KM3A 4GYFA 1O95A 4IWWA 1VEMA 1EO5A 1EXPA 1OFPA 2PP1A 3VABA 3DG7A 3MV01 3W07A 1G7VA 2Z28A 2P88A 4JTAA 4DX3A 3ALFA 3UXLA 4LJ3A 3L4VA 1M03A 1P1XA