4FX6M

Crystal structure of the mutant v182a.r203a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
218
structure length
218
Chain Sequence
b'MDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAIIVGASIYLADNPAAAAAGIIESIKDLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase/lyase inhibitor
total genus 86
structure length 218
sequence length 218
chains with identical sequence N
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2012-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fx6M00
3MWAA 3JR2A 3BV4A 2ZZ7A 4XUGA 4JTGA 5EYWA 2H8ZA 1KV8A 1TPB1 4OBTA 3MHGA 1Y0EA 2CLHA 4OWGA 1GWJA 4KFPA 6ALDA 2DP3A 1NEYA 3GX9A 1TYGA 3MUXA 5F4XA 3BPWA 4LVGA 1TRDA 3N2MA 2FIQA 4CQ8A 1DQXA 4JIQA 3F4WA 2C1HA 1KM5A 3CT7A 2A7RA 4UNLA 2DZSA 3LLDA 4BF9A 3IGSA 3LRLA 3DGRA 1CX9A 4XWUA 1OVDA 1GG0A 1R2RA 1U5JA 1G67A 2VKZG 5AFDA 1OFEA 1VZWA 4M7TA 4M6QA 1LRNA 2CLOA 4OHQA 4POCA 4IMEA 1SW3A 4M6VA 3Q2DA 1W54A 4D2JA 4HT3A 3N9SA 3QZEA 4YL2A 1OFQA 5HNRA 1T8XA 4DEFA 1W1ZA 3FJ6A 1TV5A 2ABBA 3DFOA 1UASA 2E1DA 3GB6A 1KW1A 3C56A 3O15A 3C6CA 2XN0A 3QRHA 5IBXA 3TH6A 5L9FA 4DO4A 4MJMA 1M7OA 3NXFA 4O1BA 4KKXA 3UWWA 2R8WA 5I3HA 7TIMA 4FIRA 2Q8ZA 4KWWA 4TU1A 5DXXA 5AC7A 3N3MA 1OFPA 3SIZA 2A21A 5G5IA 3YPIA 4QIUA 1FUYA 2BXVA 5KMYA 1Q6OA 1VYSX 1K7FA 1ICPA 8TIMA 4AWSA 4BI5A 3LB0A 3TJLA 4BR1A 3HIJA 5DLCA 3WJYA 3S8HA 1GVQA 2JK2A 4FHAA 1JCMP 1I8JA 3STFA 1KA9F 1ZAIA 1L2UA 2PC4A 3PUDA 3G1AA 3LHUA 4O15A 1OYBA 2Y89A 4JTKA 1QPRA 4MZ8A 3TSMA 2ZBTA 4AWTA 3QF0A 2B0MA 1TB3A 3HPSA 3L5AA 1LBLA 4O52A 5IM51 4ZMGA 4MYXA 1NVMA 1GTHA 4JY8A 2BX7A 4LTSA 5K9XA 4NZJA 1GOXA 2DU2A 4WXZA 4O0ZA 2VFIA 1JCNA 4ALDA 1YTEA 1QPQA 4UMBA 1VYPX 2PRLA 4IX0A 4K8HA 3N14A 1QO5A 1ZCOA 4JIPA 1OFRA 3NDOA 2TYSA 1VCGA 3GDKA 4GFSA 1ZHAA 3HGRA 5FF4A 4ZVJA 3RLUA 3WJXA 3WFAA 4H6KA 3USBA 5BRBA 4OE7A 1ADOA 5D38A 5A5WA 4JS3A 1D3GA 3I7SA 3GKFA 5AHLA 3W84A 4J9JA 1KM1A 4E0CA 4IOTA 3NEVA 4NU7A 3EXTA 3PB2A 2YFOA 2E6FA 1MXSA 3NQVA 1JCYA 4JYFA 5DY2A 4AHPA 4ADSA 1LM1A 1YTKA 2P1FA 2R91A 4RKAA 3LTPA 1W5QA 4NJKA 2C19A 3FEMA 1G6CA 1E51A 3DENA 4KFNA 3QMTA 4O14A 3BW2A 2FFCA 4GE8A 1A5CA 1ALDA 1LROA 3N9RA 4E2DA 1VRDA 3OVQA 2FLIA 3SGUA 1JUKA 3O16A 4IPIA 3CIXA 2J27A 5DCBA 4O16A 3DFQA 1FWTA 3NAVA 1B4KA 3BG9A 4LT9A 2DORA 1FWRA 3KAOA 4RXGA 3PVFA 2CLIA 5FF7A 4CCEA 4LC6A 1P0NA 5CG7A 4O17A 5KZDA 4UTUA 3W87A 2GPTA 1F5ZA 4HPJA 2JGQA 1VJIA 3CWNA 2JGYA 3NL3A 2GOUA 4GNJA 3RNDA 4JD4A 5GVJA 5KSWA 3TROA 1LLZA 3GVGA 1TPVA 4K8EA 1OHLA 2TSYA 1RD5A 1VCFA 3DFPA 3HGOA 1LOSA 3G0UA 1K8YA 3PBVA 2EGZA 2WKJA 1O95A 4LW7A 1LLWA 3STEA 5DELA 5LGZA 4UC5A 1RR2A 6TIMA 3M1ZA 3R2GA 4K37A 1I2QA 3L65A 2ZFAA 1Z42A 4MFEA 5I3KA 1EIXA 1AK5A 1G4PA 3LHYA 3NQCA 3IV3A 2C13A 3BLFA 4EF9A 2VELA 3M41A 4O50A 2ZQ0A 1O4UA 1W3IA 3D0CA 5EL1A 3EX6A 3QQ0A 4Y9AA 1H60A 1ICQA 4LS2A 3TR2A 1TQXA 3O63A 2Z0IA 4IJBA 4MVAA 2DZPA 3E0IA 4JTLA 3P84A 5DCEA 4A3UA 5IBXC 1AL7A 5BOOA 1SW7A 3L0GA 4RCXA 3SR7A 1QFEA 3PF3A 3OVPA 1W3TA 3KVMA 4XTDA 1ZALA 1R2SA 3S5YA 3ZS4A 2V2CA 4DQWA 2VEPA 3PAJA 3STCA 2WNZA 4MLJA 3DI1A 4E38A 4RK8A 1TTJA 3W22A 3W73A 4IMDA 1DORA 3NQ8A 4O1CA 3TJXA 1KM2A 4BI7A 3THQA 1KFEA 3HG4A 4MY1A 4K36A 4JN6A 1F7BA 2V30A 1PCKA 5G4EA 2XN1A 1HG3A 3TMLA 1VQTA 2HMCA 3MW7A 1XDLA 3FIGA 3MI6A 1KM3A 5CPNA 1X8FA 5EKYA 1QOPA 2QCEA 3EXSA 2VXNA 3EWXA 4PEKA 5BMWA 4QAIA 3MO7A 4MY9A 4DXVA 4I7VA 4LRTA 1TPC1 4C1LA 2NUXA 4X22A 1EP2A 1DBTA 2P10A 4GWEA 2FB3A 4JY9A 4S2CA 2V5BA 4M6PA 5D05A 1OK4A 2QJGA 4ZQRA 3BO9A 4TMBA 3TK7A 3DZ1A 2CFFA 1JQVA 1WDWA 1KBIA 3B8DA 3HG3A 1CI1A 3O1NA 3QW4B 5D03A 1GT8A 1S3HA 3N19B 3V75A 5D37A 1O94A 3DKJA 4IGHA 5FEZA 3EXRA 1DHPA 4LV9A 4EWND 3FA5A 5H91A 5DXYA 4PCFA 4UNKA 1JR1A 3BLEA 3UZJA 3G18A 4O4WA 3FYPA 4IPJA 2V9DA 3LXCA 3M43A 3SGZA 3C52A 2ZRZA 2W0UA 5J5DA 3UD6A 1Q6LA 2XFWA 4NUWA 5EY5A 1JVNA 1U83A 5LNRA 3LV6A 2B7OA 2J24A 1PS9A 3W2UA 1LOLA 4JDBA 2Z6JA 4GRSA 4OT7A 4XTIA 2CZEA 1L6YA 3P80A 3M47A 1LBMA 3SY5A 1Q45A 3ATYA 1H7XA 3QSRA 3TXVA 3NQGA 3TIMA 4HSOA 3ZR4A 4XBKA 4L4LA 5AC8A 1PCWA 3R12A 4PA8A 1PE1A 2RHGA 4DF2A 3LHVA 2WNNA 1LYXA 4IMCA 4QM1A 2CLMA 3W2KA 3EX2A 3W1TA 4N4PA 3M5XA 1HL2A 2GVGA 2A1YA 4XZ9A 1V5XA 2JKEA 5CKSA 4HN4A 2QJHA 3QMRA 4QNWA 1WOBA 3AJXA 1XC4A 1LORA 3BVJA 1LOQA 4YCOA 3LERA 3W1XA 4EOUA 2HS8A 3DFNA 3W7RA 4PL1A 2X16A 2ZDRA 1EX5A 5BNKA 1VS1A 2BTMA 4AHOA 3KVLA 2P0OA 1IXOA 4UTIA 1JCXA 1B3OA 4FIQA 3DU0A 3L0NA 3LXBA 5CZTA 5I3JA 1ZAHA 3BK0A 1LBFA 2AAMA 3G3MA 1FDZA 3S0CA 4KWVA 5EPDA 5F2IA 2NX3A 3MP4A 4LV4A 1IXQA 1D3HA 3EX3A 4O18A 4A22A 2KZHA 3NO5A 4Q33A 3NG3A 4O1AA 3R8RA 1G4SA 5G1TA 4EIVA 2Y63A 4WY0F 1KFKA 4MY8A 1QNVA 2YW3A 3C2EA 3E96A 4HIBA 1W8SA 5FEPA 1FWNA 3T44A 4IMGA 3EWWA 4N9CA 4JTIA 2Z2UA 2WPBA 3QC3A 4UTJA 4DPPA 3DXIA 1B4EA 5HWMA 3WJZA 4PFMA 5LNUA 3P82A 4Y6GA 3UXDA 1DJQA 1YPFA 1FCVA 4R33A 5BW6A 4WY0A 4PC8A 2TPSA 4N6EA 1F73A 3QQ1A 3IRDA 3P8IA 3T4CA 3M0ZA 4GUHA 3WK3A 3QSTA 5BMXA 2NV1A 1ZJIA 1SZGA 4IQLA 1GVFA 1OX5A 4NX5A 3S5OA 5A8GA 3W1LA 1TTPA 3GNNA 2NLIA 1AMKA 4CNPA 4NXKA 3W3OA 1MEHA 3ABOA 3F1QA 3STGA 1VPXA 1GJPA 1SZFA 4MIMA 3QPYA 2V2HA 3CQ0A 1DQWA 2VC6A 3OVRA 1AW2A 3HJZA 4WUIA 1XBZA 3W72A 1QPNA 3GDRA 1A50A 2DZTA 5F2MA 2HS6A 3SZ8A 2J9YA 3OA3A 4Q4KA 4N9DA 4BK9A 2WSQA 2DJLA 3W7LA 1S5WA 4QQ3A 3SW6A 4CLMA 3GR8A 1TMHA 3VI2A 1DV7A 2DZUA 4HNTA 1BKSA 4O11A 2R14A 4K6AA 3UWZA 3Q58A 3EX1A 3DAQA 3TNOA 2Y62A 5AN7A 3NA8A 5D2YA 1TREA 4PTNA 1VH7A 2ZRUA 4LS1A 3W1QA 5LGXA 2QCDB 3FS2A 4GC4A 3L0KA 3IVSA 3NQFA 3W07A 1EP3A 1RZMA 3L66A 5E0KA 2A5HA 3B0PA 1SO4A 5EBUA 3TX9A 3HF3A 3E12A 5CSRA 3UXAA 1YXDA 1SQ7A 3GAKA 5HQEA 3W71A 3FJLA 3GNDA 1EUAA 3SI9A 3GZ3A 5HR6A 1PHQA 1MO0A 4K39A 4N02A 5EMUA 3W1MA 4UFKA 2C18A 1QMLA 3CB8A 3HG2A 3CHVA 3A5FA 4UFLA 4MZYA 1UJPA 5CZSA 5G2IA 1MZHA 2PRMA 2ISSA 5D33A 1LTDA 2E5DA 3OHIA 5LKYA 2CW6A 2WNQA 1GQNA 2B7PA 2V2DA 2YXGA 3W7NA 1VHNA 5HINA 2H3DA 3LX9A 1RPXA 3E9AA 4WOQA 1GZGA 2A6LA 3HG5A 2FPVA 4S2BA 1IIGA 4FEZA 2VFFA 3ZWSA 3PULA 2GVJA 4LVBA 1SFLA 5CPMA 3C3NA 3LTYA 1QOQA 2YCEA 2ZCGA 3W7OA 4FNSA 1ME9A 1T96A 4TX9A 5CPOA 4JEQA 1BWLA 2W79A 4M7SA 3NQDA 1RV8A 4IUOA 4JTEA 1L6SA 4OU1A 1FCUA 1JUEA 1S5TA 4JGDA 1XFBA 3NQ2A 3FLUA 2QAFA 2XN2A 1K7XA 5DY3A 1KV5A 3L9CA 2OCZA 3TMQA 1XUUA 4NT0A 5CSSA 5D04C 1OX4B 3PBUA 4FX6M 2X1RA 4O12A 2GQ9A 3W7DA 3O8AA 2YW4A 4O8RA 1I4NA 5TIMA 3R13A 4Z1AA 3B06A 3TKFA 1W5PA 1SPQA 3LHWA 1P1XA 1MSSA 4UMAA 1WBJA 3O05A 2I14A 1H62A 3BW3A 3CEUA 4LVDA 2EPHA 3P5ZA 4OV9A 3DHDA 1SW0A 5FEXA 3EWBX 1QAPA 1YPIA 1NF0A 1JJKA 1EP1A 5F4SA 1PHWA 2VEKA 5CPLA 3W1AA 3HGSA 2Y6ZA 5G1YA 1GVOA 3SFKA 3NVTA 5U4NA 1KLYA 3M5VA 4C1KA 2ZRYA 1XXXA 4R34A 5CZJA 1TSIA 4DO5A 3B04A 2A2IA 3JRKA 4AF0B 3NGJA 4ZQMA 1H63A 4R53A 5F1UA 4IWWA 4DBEA 3B0VC 3HQ1A 2CZDA 3F03K 3W7KA 3L21A 3O6YX 3NZRA 5HJLA 2FB2A 3TQ0A 5C5YA 1I2OA 4HNUA 3UNDA 2FPYA 4YWIA 1C8VA 1LRTA 1RQEA 3W7QA 5FF0A 4P2VA 1WBHA 1I45A 4JNMA 4O10A 1EPXA 3CPRA 3C61A 3HMJG 4NJHA 2JBMA 4RXFA 4JTJA 1A5AA 2H90A 3PUOA 3IIVA 3TUUA 2ZA2A 3G0SA 2QUVA 5EA9A 3W88A 4AWUA 3W23A 3ZFHA 3PBYA 1PL9A 1UUMA 4WZHA 4Z1DA 3TV8A 3L5LA 3GAYA 3TW7A 5K9DA 1RVGA 2QF7A 5L6UA 1TIMA 1G4EA 1EWEA 2ZRXA 3W7HA 4QISA 1XI3A 3FKKA 2C3ZA 2RH9A 1WXJA 3U8GA 5C2XA 2YSWA 1WA3A 3TFXA 1ML1A 1FWWA 2BLEA 4DELA 1W5OA 5DBTA 3W2MA 4M19A 3ABRA 5D2WA 1D9EA 1VYRA 4IMFA 2PCQA 1OF6A 3KRZA 3B4UA 3CU2A 5D2TA 3EKZA 1TPWA 1KFLA 2BWGA 2OJPA 5HULA 3W75A 3NL2A 4M5PA 1IIHA 4CQ9A 2NXGA 1RQBA 3NQ7A 4DPQA 5MHBA 1QPOA 4YXGA 3KOFA 4CNOA 3OEXA 1CW2A 1XBVA 4NJIA 4DBDA 4FB7A 2WO5A 2ZYFA 4RR4A 5K4XA 2E6DA 2E68A 4Y96A 3TDFA 1WQ5A 1KLZA 1K8XA 4DF0A 2YDAA 3C2OA 2X1SA 2ZZ2A 1HO4A 4EF8A 1LRQA 4HPXA 4GUFA 3W7GA 4I9AA 5FEWA 1GYNA 5FF3A 3LRKA 2QCGA 4X3ZA 4CCCA 1Z48A 5G2HA 1RQHA 1OK6A 3I6RA 3NPUA 3NQ6A 2C16A 1TPDA 3T55A 2E5CA 3TW6A 4NZFA 1I2RA 5AB3A 4TR9A 3CIWA 3W9ZA 2YYUA 3CC1A 5HMSA 4RZ6A 4UTTA 2QCDA 1A5BA 3O6CA 4MOZA 2Q3RA 3PB0A 3G1YA 3A22A 4NJJA 4Y8FA 4DO6A 1NAL1 4AAJA 1F6PA 4JYDA 2B7QA 3L2IA 4HNVA 4PL2A 3GK0A 3NQMA 3QMSA 4DF1A 1I2PA 4QNEA 3P7YA 2R94A 4JXCA 3C2RA 1XCFA 4ZQNA 3BW4A 2Z6IA 3IIXA 1BEUA 1LCOA 4WOZA 2QCNA 3INPA 1DVJA 2CZFA 4BI6A 4CQAA 1TQJA 3Q94A 4LWWA 1G7UA 5D32A 3PSVA 3NNTA 4LUIA 2Y61A 4ZQOA 1P4CA 3KVJA 3O07A 2A4AA 5KITA 2DZXA 2QCCA 2NX9A 1W31A 1XBYA 2BZNA 4FF7A 4R7JA 3N34A 2G95A 1VGAA 3GDTA 1G69A 4WXYA 3ANYA 3P81A 1H50A 4IXXA 5CGQA 3CM4A 4FXRA 4XBSA 1YDVA 1ZY9A 5F4WA 4MUZA 3MYOA 2LLEA 3G3DA 2E77A 3QFEA 2ZZ6A 4UTWA 3TC7A 1K03A 1ZENA 2RDUA 4GUGA 2VFGA 2QKFA 2X1UA 3FKRA 3LXAA 4UMCA 1JUBA 4GUIA 4JTHA 4HKPA 5T26A 1HUVA 4YLWA 3KRUA 1JRBA 2WJZA 2YYTA 4I7UA 1TO3A 1VLWA 5LHEA 3P62A 4NQ1A 1SFJA 3LOTA 3QPZA 5DBUA 4RZ5A 2NZLA 2BSLA 3U2OA 4ZL1A 1JCLA 1KM6A 3GDLA 3HPZA 5D02A 1UB3A 3UWVA 2ZZ3A 3OG3A 2QEZA 4H3DA 4UFMA 4UTMA 4UR7A 5K7JA 2A7PA 1JRCA 3KHJA 2Q3OA 1TRIA 2ZZ4A 3DHFA 5F1VA 4L4MA 2PE4A 3KVKA 2QDHA 4HHPA 4NVTA 2A85A 1L6WA 3BGGA 3RF9A 3N73A 3B0UX 4AH7A 1TTIA 3G1XA 1H7PA 3WK0A 3LCXA 3C2FA 1S5VA 1K8ZA 3I68A 3LCWA 1FQ0A 4UFHA 2WQPA 4JTSA 3PSWA 4AF0A 5ABTA 3ABSA 1T0OA 3E02A 4A2RA 3M16A 1TPEA 2RKXA 2VEMA 2I1OA 1VCVA 1YDNA 1H7RA 2CZ5A 4Y90A 1OX6A 1F76A 2DZVA 2ZTKA 3NPXA 2JKAA 5LNVA 5C55A 1FDJA 2GQ8A 4NX0A 4JX4A 5K2ZA 4JTFA 3VKJA 2NUWA 1ZFJA 4WQ6A 2RFGA 1XDMA 1V7YA 3LM7A 1AL8A 3UPWA 2WV8A 3MMTA 1H51A 2Q8LA 1Q3NA 2DJXA 2GVLA 3CTLA 3Q37A 4Z08A 3DFSA 2X30A 3K30A 4UFIA 3TQKA 3IEBA 4MLRA 5D30A 3W2LA 1SZEA 3WJSA 3NYZA 5HWJA 3W6YA 1TV7A 1SO5A 3AO0A 3P74A 5E93A 3N2XA 3NQAA 4BWLA 1TPFA 1EB3A 4LC8A 3DBPA 5G4WA 5J5RA 1TPH1 3MP3A 1MEIA 4UTTC 4AVFA 1IGSA 1P5BA 3C8FA 3R5EA 2CLLA 2VFEA 1W5MA 3UZ5A 1H1ZA 2AQWA 2IQTA 1WYIA 4ADUA 2QJIA 2OX1A 2OT0A 4JYEA 1YYAA 4YMZA 3BG5A 4XQ6A 3IVUA 1JQXA 3EWZA 1TTQA 2G96A 5AHNA 2ZA1A 3G1SA 1N55A 2ALDA 2QR6A 3KXQA 3I7RA 4JTTA 4ADTA 1OYCA 3RLVA 3EEGA 4FNPA 2PURA 3A5VA 3OIXA 4FX8A 4Z0SA 1J2WA 3I7QA 4K7YA 4XKYB 4ZQPA 4G1KA 3RMJA 4O1DA 4K38A 3MJYA 3EX4A 5AHMA 4HSNA 4JTUA 3G22A 5HUPA 5KINA 2YX0A 2QUUA 3W76A 1FWSA 3R89A 3PS7A 3GIYA 3LLFA 2F7FA 2A7NA 5AYXA 3B05A 3PG9A 4U28A 5AC6A 3HPXA 4ORMA 4N4QA 2ZTJA 1YLVA 3W1NA 1IXPA 3VCRA 1PV8A 1X1ZA 3PC0A 1YTDA 1MEWA 4O0KA 1G7VA 3BGJA 4GUJA 4UIOA 5U7SA 4WX2A 3G1VA 3TXZA 2NWSA 2Y88A 2YZRA 3W2NA 1L9WA 1WX0A 1FBAA 2VFDA 3E49A 1GPWA 2FQIA 2GJNA 2PRHA 2ZRWA 3PWAA 3UWQA 1FX6A 2B4GA 2QCFA 4ICNA 3G24A 3QM3A 4RV8A 4UTWC 2NUYA 1DKWA 1OFAA 4ML9A 4OGZA 3IGUA 4TIMA 5K4ZA 3H54A 4UCGA 4A29A 3P8JA 2E6YA 3TAOA 3VE7A 2EKCA 3W7MA 1AG1O 1G4TA 4IXHA 1HO1A 1EWDA 3ZWTA 4NNAA 3RFAA 5I3FA 3MYPA 1IF2A 2OMAA 2J88A 3MHUA 1NF7A 3L5MA 1SO3A 1W37A 4O57A 1KM4A 4AB4A 1THFD 1KM0A 1W3NA 2W6RA 1TCDA 5KZEA 5LSMA 5C6MA 1KFBA 2FPTA 4LNYA 4JICA 1LDCA 2FJKA 3LCIA 1QWGA 3NM1A 4UTHA 2VOMA 2NWRA 3QW3A 4A2SA 3KX6A 1OABA 3ATZA 1XUZA 2H6RA 4GXMA 5FF2A 4I7WA 4UR8A 1UUOA 1KBJA 1TPUA 2TMDA 3QEZA 1R47A 1Q6RA 2H8XA 3LCLA 5TBOA 1OG0A 3O6DA 4RJEA 3GR7A 2E09A 2Y85A 3CEPA 2HTMA 3W7JA 4OQVA 5LHFA 1R2TA 1YDOA 3G8EA 3W1RA 3DH7A 2FTPA 1A53A 4UXDA 3S1WA 1H5YA 3S9YA 4MFDA 1T99A 1SSGA 2FDSA 1JULA 2I9EA 2VFHA 3S42A 3H53A 1YADA 1N7KA 4O54A 1LZOA 2ZRVA 5KZMA 4LS0A 2NV2A 3LHTA 4CCDA 4ZZ9A 2O7SA 3BLIA 3BG3A 3EB2A 5K3VA 4N2YA 2EHHA 2F84A 3GDMA 1H7OA 4RLIA 2C6QA 2H3BA 2QDGA 3GXPA 4O13A 3O06A 3QH2A 4W9TA 1SUXA 1NSJA 2NX1A 4FXSA 2J9ZA 2ZZ1A 3NL6A 3EKLA 3UPBA 1EEPA 1GTEA 3I65A 4Q32A 1NFBA 3LGEA 3PUEA 2VENA 3A21A 3W7IA 3C0JA 3NPWA 4BWLC 3MBFA 3M7WA 3TCEA 4TO8A 3SSJA 4MPQA 4ONVA 4H4IA 2RDTA 2AGKA 4UUIA 3NL5A 5F2LA 4WY0B 1WOAA 3MBDA 2EAWA 4OV4A 4B5NA 1BWKA 4TMCA 4O53A 3V1PA 1B9BA 1GVRA 2ABAA 2GUUA 2GJLA 2HSAA 2QUTA 2V5LA 3H55A 3UYCA 3WJWA 1PVNA 3W1UA 3VE9A 2O7QA 4AEOA 4MKNA 1Q6QA 1KFJA 4FX7A 4EVZA 4K7VA 1KTBA 3W86A 4RX0A 3VFLA 1EUNA 3L68A 2YPIA 3TU9A 3PY2A 5D09A 3IIPA 2Z1BA 3VNDA 5H2ZA 1I2NA 3GXNA 3SJ3A 4P61A 1OF8A 1TJPA 2QCHA 1DOSA 5CZ0A 4YCPA 4X2RA 1LP6A 3TSBA 2YR1A 4JDYA 3TC6A 2V82A 2C14A 2ATMA 1VHCA 3PM6A 3TSDA 3C2VA 3W7CA 1H7NA 2ISVA 5I3GA 2CU0A 1VLIA 1YXCA 3DKLA 3RU6A 4MYAA 4A21A 3P5YA 2QCMA 4LVAA 3WK2A 3LI0A 3M9YA 4KFOA 1M6JA 3FFSA 5D2XA 3CWOX 3KRSA 4N9EA 3WK1A 3M5ZA 1K3UA 3A23A 3UY7A 1DL3A 3B03A 3P61A 2Y70A 2A0NA 4HNNA 1IXNA 5FI8A 3MP5A 1W0MA 1YXYA 3UWUA 5HUOA 3U6WA 3MHFA 4ORIA 1Z41A 3M6YA 1AW1A 3A24A 5AHEA 3W2JA 3IIOA 2RDWA 5SWUA 1OFOA 5LNSA 2G97A 4O28A 5G2WA 5AHFA 1JCJA 4PH6A 3G1DA 4FNQA 4NXSA 3FOKA 3G1HA 3RK8A 5LNWA 1Z44A 2OT1A 1SR9A 1C9DA 2NXIA 2E5BA 4ZQCA 2B7NA 2ISWA 2QAPA 2V81A 3W85A 3T78A 3F4NA 1R46A 1GG1A 2CLKA 3JS3A 3S6DA 4LOCA 3W1PA 4QJ1A 1XKYA 3G8RA 4XKYA 1FCQA 1EA0A 1SU5A 3LCFA 3NQEA 4FNTA 1BTMA 3NR0A 1QCWA 3ABQA 3GKAA 2WSYA 3LHZA 3CLMA 1J5TA 1HTIA 2V8ZA 4GBUA 3MI2A 2X2GA 4U4MA 1ICSA 4CNNA 1OYAA 3LCGA 4NNBA 3NZ1A 4Z0JA 1H61A 1XBXA 3SECA 1X1OA 1KFCA 1H1YA 3IVTA 2GQAA 2Y7FA 3ELFA 2Y7GA 2CWNA 3NOEA 3TA6A 3LV5A 1QR7A 1O5KA 3S5NA 3P67A 3S5ZA 1W56A 1H7WA 2C15A 1K02A 1SO6A 3A9IA 1K7EA 1SZNA 2QCLA 1SSDA 3EWUA 1N8FA 3PBWA 3T40A 4X9SA 4JX6A 4JX5A 5KTLA 2C0AA 4PODA 1VR6A 1DJNA 1F2JA 4AXKA 5AOUA 1WAUA 1HFBA 2ZZ5A 3G0XA 1A5SA 4Z1BA 4FNRA 3M5YA 3T7VA 1WV2A 5AYZA 2UV8G 1GEQA 1QO2A 3HOJA 3HO8A 5HR7A 1FXPA 3BARA 4NJGA 3GYEA 2E6AA 3LDVA 4O19A 1ZNNA 4RZ4A 4O4VA 3M44A 4NNCA 2YFNA 2VEIA 4LY8A 2V0TA 4N9BA 5K9CA 1W5NA 1FCBA 3LBMA 1FY6A 3QYQA 1OX4A 4LRSA 4QSHA 1GYLA 1TJRA 4LU0A 3LTSA 3EWYA 3PG8A 5TQLA 3G1FA 1ONRA 3TFCA 1J4EA 3LI1A 3W7PA 4FO4A 5LZLA 2JKPA 3MI3A 5AYYA 3W83A 2OZ0A 3S1VA 1FDYA 2A6NA 1M7PA 4BFAA 4UTLA 5D2VA 1ME8A 3GLCA 4UFJA 1XL9A 3LCHA 1P0KA 2X1TA 3W74A 1X6UA 2WOQA 2ATSA 1X7FA 1PIIA 4LVFA 3PR2A 1ZAJA 1KTCA 5FESA 4GJ1A 5F2GA 2J9XA 2G5WA 2NXHA 4S1FA 4MZ1A 5DN1A 5AHIA 3TAKA 2J6XA 2DZWA 3UQNA 1OJXA 3L67A 4WD0A 3HB9A 4FNUA 1F6KA 1UCWA 3W7EA 3IIZA 3NPVA 4MJZA 1R30A 3S1UA 3NM3A 3UY8A 3DI0A 3LBCA 1UBSA 3P60A 1M5WA 4QITA 1QDSA 3S1XA 1OFDA 1AW5A 5I3IA 4AHQA 2CLFA 5E1QA 2CLEA 1O5XA 2YGYA 4LUJA 1F74A 5HWNA 4WJEA 3GXTA 4Z1CA 4JR5A 1C29A 3OBKA 3C4UA 4UTKA 3W70A 1KTNA 3IGXA 3QJAA 1TV8A 2TRSA 1VC4A 3HGJA 4E2BA 1ME7A 3TE9A 1GVSA 3FYOA 3HBLA 2ZA3A 2EF9A 2Y7DA 2D73A 3DFTA 1XM3A 5C54A 5DCDA 3THAA 4AMAA 2WSRA 1OFBA 2Y7EA 4IX2A 3UWYA 1F05A 1FXQA 3LRMA 4N6FA 3KFTA 1B57A 1O60A 3TQVA
chains in the Genus database with same CATH superfamily
2J79A 3FDGA 3PTMA 4L1WA 5EYWA 1KV8A 1UD5A 4IL0A 1Y0EA 3A64A 4C6OA 1FWFC 2CLHA 3GY1A 1V4YA 1GWJA 1Q13A 3WSUA 4LF1A 1TYGA 3MUXA 2VX7A 1HW6A 4D8AA 3TZFA 4LVGA 3VNMA 3UXIA 4LEQA 4U5KA 2FIQA 4CQ8A 3NJ3A 3F4WA 4RDYA 4O1EA 2A7RA 4BF9A 2DZSA 3LLDA 1PJ9A 2X40A 3DG3A 1B0IA 3NSXA 2DZAA 1OVDA 3C0LA 1F8MA 2X0SA 3DG7A 1HKIA 3WCZA 1JF5A 5AFDA 3M0LA 3E2SA 4WCJA 2HK1A 4OHQA 4NYYA 5FAJA 3GZAA 2BODX 3SAZA 3VM7A 4HT3A 3CHCA 3QZEA 3KLKA 1CBGA 1T8XA 4DEFA 3FJ6A 1TV5A 2ABBA 1UASA 1BKHA 4F66A 3C56A 2XN0A 3QRHA 1EEXA 1EL3A 3UG5A 2GLKA 4IIFA 4O1BA 5DEZA 2R8WA 3WBXA 1L8PA 2HDJA 4QE4A 4UZSA 1TKKA 4GKTA 4TU1A 3BOLA 2WBKA 1EZWA 1UZ1A 2PD5A 3A4AA 3V7PA 3LMYA 5KMYA 1K7FA 4J3SA 3FXYA 3LB0A 4L9XA 2VVSA 3WJYA 3S8HA 4S38A 2VX5A 3CYJA 4M0XA 1GORA 2PC4A 4I90A 2RJGA 3LHUA 3R79A 4O15A 4B4HA 4S3GA 3TSMA 4XZWA 4AWTA 1TB3A 2I5IA 2C1IA 4LQ1A 5BOFA 1A5UA 4ZMGA 1GTHA 3TR9A 3ZR6A 4JY8A 2X0YA 5AVHA 4NZJA 2V5JA 2YBTA 3KOYA 4WXZA 4O0ZA 5FL1A 4D8ZA 1LJYA 1QPQA 4UMBA 1CTNA 1VYPX 6REQA 2PRLA 1ZCOA 3ZSSA 4D6IA 4ZVJA 3NDOA 2EJAA 1VCGA 3GDKA 5FF4A 1AVAA 4H6KA 4EXAA 2YIHA 2QLYA 4NZCA 4WIWA 2ZX7A 2GSEA 1XYLA 1GZ1A 5CC3A 4J9JA 2BV9A 1UQYA 4AX6A 4NU7A 1IGWA 2AKMA 4GVHA 3SY8A 3EXTA 2YFOA 4GQQA 1JCYA 1I75A 4HMEA 5D9NA 4ACYA 2XGZA 4AHPA 5MF5A 2P1FA 3THDA 2FFIA 1UR1A 1L6GA 3FEMA 3II1A 1Q66A 4C5YA 1QI3A 2DSVA 2FHFA 2QMJA 3ABXA 1LROA 4E2DA 1OC5A 2FLIA 3GNXA 3QOMA 2YCJA 2J27A 5D4YA 1SVDA 2G3FA 4O16A 2OOGA 5DT7A 2Z29A 1FWTA 3G1RA 2G41A 1HVXA 2OX4A 4DO7A 5KZDA 2GPTA 5CAKA 4GNJA 5KETA 3ES7A 4XD4A 3PZGA 3SRHA 3GM8A 3USZA 1WAWA 2TSYA 1M41A 3LGGA 1G01A 3HGOA 1LOSA 2H9AA 2EGZA 2WKJA 1J79A 3WF3A 4DUXA 1LLWA 3GVRA 5FIPA 2XVKA 2VRJA 4QFUA 2ZFAA 1Z42A 1E40A 1AK5A 3LHYA 3BQ5A 4W8LA 3NQCA 3IV3A 4HK7A 2VELA 4QJ3B 3M41A 4O50A 5LXEA 4N0RA 1LUCA 1IEVA 3QQ0A 3FY1A 2BNJA 4LS2A 1UKSA 3AC0A 3B3DA 2XH4A 1CNVA 4H00A 4IJBA 2DVTA 5DCEA 5IBXC 1PKYA 2XFYA 3M0JA 3K13A 2YL8A 1O7AA 3CUZA 3BSMA 1R2SA 4AIUA 4CN1A 1V02E 4AZ5A 4DQWA 3STCA 2WNZA 4MLJA 1JAKA 1QRQA 1YNPA 4IMDA 4HBKA 1VIWA 4S3DA 4O1CA 3TJXA 2FZNA 3ITCA 2V30A 3KDOA 1VFSA 1HG3A 3TMLA 1L0PA 3FX4A 3MTWA 3MI6A 4HJFA 4HZ7A 5CPNA 3MUAA 2X7WA 4L1XA 4LBUA 3PPGA 1X8FA 3UZZA 1YNYA 3MO7A 4MY9A 2NUXA 5A6LA 1EP2A 5DMLA 4Z2KA 4GWEA 2RJHA 5D05A 5FAGA 5DMNA 4ZQRA 2FZ8A 4GJJA 3BO9A 4TMBA 5EU9A 1ECQA 4OOUA 4GA8A 3HG3A 3QW4B 5ABHA 3A3XA 1S3HA 4W4QA 2DSZA 3CUFA 1ZZMA 3FA5A 3QR1A 1JYNA 1JR1A 3BLEA 1I1XA 1Q7QA 3FYPA 4IPJA 3HPFA 1ZLPA 2VD9A 3M43A 3SGZA 1Z8AA 2YDQA 2ZRZA 4A6GA 2W0UA 6XIAA 1U22A 2B7OA 2WHMA 4JDBA 4WKAA 1R0MA 1EOMA 2ZWZA 5DO8A 1E0TA 3ATYA 1NQKA 3QKEA 4M56A 2IPWA 1PZ3A 5M5DA 3NO1A 5E0FA 4PA8A 4Q4OA 3S2MA 1BG9A 4DF2A 3VIIA 2BHYA 2FMNA 3OBAA 1WKEA 5C71A 4C6JA 3AIBA 3W2KA 2VGFA 1HL2A 5AKQA 3QYSA 2Z1VA 4KIRA 4X60A 1XC4A 3BVJA 2XGIA 4JQ3A 3W1XA 4WJ8A 1VFHA 1DYSA 2HS8A 3DFNA 3W7RA 2X16A 1OC6A 3EDJA 1VS1A 3W6MA 3HMCA 1U33A 2BGNE 4FIQA 3AIUA 3OYXA 3L0NA 1UWRA 5I3JA 2QJJA 1T7LA 3WNOA 1NOUA 3MP4A 2DQXA 4LV4A 1RA0A 1D3HA 4QE5A 4O1AA 1XCXA 3WQEA 2ON3A 1ZTVA 1J18A 3BLKA 4EIVA 4WY0F 2EPKX 2G50A 2CHRA 1YDYA 2HBVA 2C1GA 3C2EA 2PF8A 1W8SA 3WLQA 1XLAA 1VB9A 4JTIA 3BOFA 1X98A 5HWMA 3R25A 4Y6GA 1DJQA 4PC8A 2TPSA 4W8AA 4GNVA 1NWTA 1U30A 1CGVA 3VO0A 3T4CA 3WK3A 1XSJA 1SZGA 4IQLA 4C6FA 3RPTA 4WGHA 1OX5A 4NX5A 1D8WA 3W1LA 3LPOA 3GNNA 2NLIA 4CNPA 5IHSA 1MEHA 3STGA 2PDJA 1GJPA 4MIMA 3VDBA 1UC5A 2VJXA 2VC6A 1AW2A 4DXKA 3GDBA 1QPNA 3XIMA 2J9YA 1UD4A 4N9DA 4QQ3A 4Q8UA 4CLMA 1MYRA 4DWSB 3ZSTA 3S2LA 3VI2A 4P8WA 1BKSA 3LY0A 1TFVA 1XDJA 4K6AA 3PTQA 4IPPA 5D2YA 4IHCA 2ZRUA 4LS1A 3FN9A 1UOZA 3W1QA 1RK6A 2DH3A 2A79A 1Y5VA 3IVSA 3W07A 1P43A 4JIRA 5MKGB 1TG7A 2OZTA 5EBUA 3HF3A 4OOZA 1KKRA 5CSRA 3UXAA 3KLLA 4ILSA 3K1DA 3OLIA 3FJLA 3GNDA 1S5MA 3RYSA 1MW1A 2DH2A 3KOWA 2YXXA 4L65A 5HR6A 3URNA 4MMWA 1PHQA 3H4WA 1MO0A 4K39A 4LCQA 2E3ZA 2PBGA 4FOUA 4ERGA 3CHVA 4XO7A 4F9DA 5AVNA 3A5FA 4UFLA 4MZYA 3K8LA 3WD4A 4DZIA 4NRRA 1WKDA 5D33A 1YMYA 1K1DA 4XV0A 1UA7A 1PDYA 5LKYA 4XIMA 2V2DA 1VHNA 5HINA 4C6EA 1EF3A 2H3DA 1E4MM 3BH4A 1DPMA 2A6LA 3SRFA 2FPVA 1JNEA 1IIGA 4FEZA 4GIEA 1SFLA 2TAAA 1QOQA 2W91A 1Y8BA 4RW5A 3W53A 4EXQA 2Q01A 2PZNA 1R9XA 1H49A 1EOKA 5C9RA 4E4PA 4X9YA 3S47A 4IUOA 1FCUA 3UR2A 4L7ZA 4GO8A 2A3CA 1W9DM 4XZMX 2P76A 3FLUA 3CQHA 1K7XA 1XUUA 3CUXA 4KRZA 1I1WA 1W3JA 1WDQA 4IIGA 2YW4A 1HL9A 4O8RA 5TIMA 4LY4A 3H7UA 2BVWA 4N7QA 1WZAA 4EPDC 4C6BA 1H62A 3CEUA 1K77A 1IT7A 4PULA 1TUFA 3LNPA 1UHVA 4HNOA 1QW8A 4ZOBA 1JJKA 2YB1A 4XD6A 4DJFA 4GACA 1EP1A 1P7TB 3QGAC 3OP2A 4CEXC 1CXKA 1UR2A 4LB4A 3VDGA 3NVTA 5U4NA 3PZNA 3L2MA 4MAZA 4L1GA 2PDCA 3WQDA 3B04A 1ISXA 2VUYA 5TAOA 3SCPA 3JRKA 1EX1A 4RNHA 3KCJA 4J1OA 3A3WA 5CLWA 1POJA 2CZDA 4U2YA 1UD2A 2PB1A 3PTDA 4Q8PA 2FB2A 1REQB 5C5YA 2FPYA 4YWIA 2DY3A 5T9CE 5FF0A 4P2VA 4QBXA 4O10A 2FKPA 2JBMA 4JTJA 2D24A 1MDRA 3N3TA 3DFYA 4QSFA 3G0SA 1Y5WA 4AWUA 3FSUA 2BY3A 3DUGA 3W23A 1YE6A 3QC0A 1RPKA 4WZHA 2HZGA 1GOWA 2E9MA 2J62A 3TW7A 1RVGA 4ZR8A 1OGBA 3W24A 1TIMA 2GGIA 4C5ZA 1ECEA 2RH9A 1WXJA 4OBSA 3U8GA 1WA3A 3SCQA 1ML1A 4JQ4A 5DBTA 3L4XA 4V28A 3ABRA 5D2WA 1VYRA 1PDZA 1F3XA 1OF6A 2VEFA 2GWGA 3IJ8A 1KFLA 2OJPA 5BWFA 5HULA 2E7FA 1EYEA 1IIHA 2NXGA 4DPQA 5MHBA 1RD6A 4YXGA 4TVCA 3IAPA 3KOFA 4N42A 4ZE4A 5IFTA 4FB7A 2WO5A 2ZYFA 1AA1B 3CZJA 2E6DA 1A5LC 4Y96A 3TDFA 1J0HA 5JU6A 4IUGA 1PB0A 4JIHA 3RLGA 4WDTA 2X1SA 3UJSA 3VOJA 4W89A 5M03A 5CH9A 2WKGA 2GGEA 5FF3A 2WC3A 1OBAA 3LRKA 2QCGA 2XFFA 4X3ZA 1AZ2A 3WLRA 1Z48A 1ZPTA 4IP7A 4HP5A 1OK6A 5C8BB 4NI3A 3VGBA 4F48A 1XH2A 5I00A 3QLDA 4NZFA 4BZYA 5AB3A 1JPHA 1EJRC 3VNJA 1MWOA 3LU2A 4TOQA 4XAZA 2OLHA 2DIKA 2YYUA 1EDGA 3ITGA 3MQTA 1MFUA 8RUCA 3U5YA 3KL3A 4BQ2A 3O6CA 2Q3RA 3PB0A 5MKGA 3SUUA 4WHBA 1NAL1 4DO6A 3EDKA 4ZA0A 3QMSA 4LH8A 1L2QA 4Z2LA 3P7YA 3NTYA 4P7QA 2PPGA 4ZQNA 2F2HA 4FF5A 3EDEA 1BEUA 2P8CA 4WOZA 3MC5A 1JFXA 2CZFA 3WMCA 2E0PA 1OZQA 1VFFA 3ALFA 3AXIA 2HPIA 4AY7A 1V3JA 1VENA 4CQAA 1ELSA 1TQJA 1G7UA 5D32A 4NZ4A 2ZIDA 2Y61A 1CB7B 1DWAM 5KITA 2Z7KA 1W31A 4ZFCA 2BZNA 1OINA 4FF7A 2ZUSA 3GNRA 2AQOA 1RXOB 2EG7A 1QW9A 4MWAD 1G69A 2D2HA 3SEPA 3ANYA 4DJED 1H50A 4F0MA 2IKJA 3JUGA 3CAKA 4FXRA 4KMQA 1JGIA 3P93A 4H6RA 1DTUA 2J7DA 2WZTA 4R7WA 1QJWA 5AC4A 3MO4A 2ZZ6A 3T42A 2QKFA 2X1UA 4AIEA 4IJRA 1KRBC 1KBLA 4ZO8A 1JRBA 4I7UA 4ZBCA 3CAVA 1SFJA 3VMPA 2G3NA 1QNOA 2ZXDA 3CMJA 4C6CA 4QXIA 4MSSA 4ZL1A 4KCUA 1UB3A 5BXPA 2QEZA 1UWIA 4UR7A 4V2XA 4B9ZA 2IQDA 3KHJA 4RNIA 3E74A 4M51A 1P7TA 3VNYA 3KVKA 2QDHA 4NL1A 4ZO9A 3K4WA 3OIHA 1H7PA 3IK2A 2YLAA 3I68A 2X1IA 1KFWA 1JI2A 4WK9A 1R3VA 4B9YA 2E67A 3E02A 4A2RA 3M16A 1VCVA 1H7RA 1F76A 1REQA 4LYKA 1A5OC 2ZTKA 3V5OA 1GKRA 1UBPC 1FDJA 2GQ8A 4NX0A 4D6EA 1GGOA 4JTFA 4PUWA 1HJVA 1WKYA 4Q4PA 4DLMA 2YCKX 4OIFA 4WQ6A 1K70A 3BAJA 1AL8A 3UPWA 2ZVRA 4HU3A 2FGLA 3MMTA 2GVLA 2QUNA 3ICJA 4M8UA 3OU8A 1V7AA 2RGLA 4P8XA 3MKKA 1HKMA 1GQLA 3H2OA 1TELA 3TQKA 3GFZA 3W6YA 3C86A 3RM9A 3UA4A 1J0YA 3P74A 2X2YA 3FDKA 1EB3A 4Q4QA 3T05A 3VOHA 4AVFA 3ID7A 1XKJA 1ITXA 1EGMA 5EMMA 3QOKA 4HMDA 1NWUA 1YYAA 4YMZA 4Z1YA 3BG5A 3EWZA 2G96A 1OWQA 3G1SA 2ZUWA 2XH7A 2QUMA 4JTTA 3VIGA 5E5CA 4GQRA 3AI0A 2BOFX 1V6WA 1JAEA 6A3HA 2J7FA 4Z0SA 4XKYB 1HXJA 4G1KA 3RMJA 4K38A 1W91A 3PJXA 4HSNA 5KZ6A 4CNUA 3G22A 3KL5A 5HUPA 2YX0A 2QUUA 3MB9A 3VOIA 2A7NA 4AZ6A 4ICCX 3PG9A 5AC6A 5CC7A 3E6EA 2CCRA 3W00A 3VCRA 3KTXA 2PWUA 1JG9A 1MEWA 1G7VA 4UIOA 1FKWA 3G1VA 3TXZA 4G6CA 2Y88A 4HU8A 4HJWA 4HU4A 2VFDA 4W84A 4XK2A 1LG1A 2QGHA 4GOAA 3D47A 2PRHA 2ZRWA 3UWQA 1P0BA 3RM4A 3QM3A 4LBSA 1OFAA 3H54A 4QS5A 4A29A 4J27A 2V69A 4ERIA 2EKCA 4HYWA 1XYBA 4Y9MA 1HO1A 3ZWTA 3MYPA 4PEEA 1IF2A 5BYWA 7XIMA 2PDIA 3VNKA 3B0XA 3MHUA 1NF7A 4URIA 3L5MA 4LFYA 1S2AA 3APYA 1KM0A 4U31A 1V0KA 1W3NA 4AWEA 2W61A 3CUIA 5A2AA 5LSMA 1WNOA 4LNYA 5A6AA 1LDCA 3ZM8A 4F0KA 4S3JA 4UTHA 4A2SA 1OABA 5FF2A 4I7WA 4UR8A 1N8IA 1P48A 1Q6RA 1OG0A 3O6DA 2HTMA 1EIBA 3S4TA 1R2TA 4UXDA 1AJ2A 3S1WA 3WFLA 3VKCA 4B3KA 3VD9A 2OKTA 2YZ5A 5A8MA 3S42A 3RUBL 1GNXA 1IWAA 1BRLB 2ZRVA 5JIWA 3WQOA 3BG3A 4W86A 2NV9A 1XD0A 4N2YA 2EHHA 3TWBA 3GDMA 5G4HC 4C6NA 5CBBA 1FWEC 2H3BA 2QDGA 3CZGA 5A6TC 3GXPA 4JL2A 4QLLA 3SCWA 1QHPA 4PMDA 5A6JA 4RPPA 1H0IA 3SIMA 3C0JA 3NPWA 2CETA 3ITOA 3H2AA 3GG0A 3PZ9A 4UUIA 5GQBA 1XGEA 5F2LA 2W63A 4WY0B 2VURA 1I60A 7ODCA 4B5NA 4D6HA 3LUTA 4TMCA 3V1PA 2HSAA 2Y5EA 4KQNA 1AMYA 3VE9A 3L23A 4FX7A 1KTBA 3CZLA 3VFLA 2W9MA 4ZXLA 4AISA 5D09A 2PEVA 5FL0A 3IIPA 2Z1BA 3ARQA 2V67A 4IF2A 1XIFA 4X0VA 4J3VA 1QNRA 3DFHA 4C1NB 2PTZA 4PTDA 2GUYA 2QCHA 2D0GA 3NQBA 1KR0A 2CKRA 5TF0A 4AG0A 3TSBA 3T2PA 3WLHA 1IEXA 4JDYA 2F8QA 4DVOA 1R5YA 3HTWA 2C14A 5M17A 2C91A 4EACA 3C2VA 4L4OA 1H7NA 3BOXA 3BAIA 4IP5A 1IE7C 1GKPA 3H26A 2CXEA 1VJZA 1E6QM 3RU6A 2Z25A 4M82A 4UR9A 4A21A 3AMLA 3P5YA 4LVAA 3IV8A 4QG8A 4PMOA 4B5UA 4S3FA 4GK8A 4KFOA 3FEQA 4RNFA 3MUZ1 2HXUA 4IQEA 2J7BA 3CWOX 3KRSA 2CBIA 3QGVA 2HROA 3A4XA 3M5ZA 2WJDA 4I9JA 3UY7A 4AZBA 2Y70A 2R1NA 2FTWA 4HNNA 1HQTA 3UT0A 1XIJA 3MP5A 2G3IA 4GXWA 2F9RA 1U1UA 1BXBA 3B8SA 3BAKA 3LLXA 2XPKA 1EBHA 2IPFA 2JF6A 3DOPA 3IJ9A 4LJ3A 3IIOA 3LPFA 1QOXA 3ZR5A 4PH6A 3FOKA 4H8VA 3UXKA 5LNWA 4BQ4A 3V5CA 2CXGA 4GKLA 4GVIA 4F79A 5AECA 2V81A 2OOFA 1WDDA 3A3HA 3WNPA 3F4NA 2CLKA 3S6DA 1OGGA 3W1PA 3AOFA 1E6PA 2PP3A 4XKYA 1VD6A 3EPNA 1EA0A 1SU5A 3LCFA 4FNTA 1BTMA 3XISA 3B9AA 1B54A 1HTIA 4ZB5A 4GBUA 3BV7A 3MI2A 4XVDA 3H2CA 1ICSA 1OYAA 4L9ZA 3NZ1A 3FV9A 2HNHA 3SECA 3WDRA 3O0KA 1QI0A 1W1VA 3CL6A 1C9WA 2VGBA 3QN3A 3S5NA 4ENLA 3S5ZA 1H7WA 1B1YA 2C15A 1K02A 1K7EA 2QCLA 5A6KA 2PSNA 4FLQA 1DJIA 4X9SA 1U5HA 1DJNA 1F2JA 4RL3A 3AHYA 4AXKA 4ZTXA 1BXNA 5HNTA 2ZZ5A 1A5SA 3M5YA 1WV2A 4A8LA 1FHVA 1KBKA 1S2CA 2Z27A 3L2LA 1GONA 7TAAA 3TCSA 4H2HA 8XIAA 3F4VA 3GYEA 2E6AA 2QF8A 3LDVA 4KEUA 1XYAA 4HHMA 3V3WA 4RZ4A 3M44A 2YFNA 1V3KA 2E9LA 2V0TA 1RJRA 1W6TA 3FA4A 4PBEA 4W7UA 3KZSA 4QSHA 2OELA 1TJRA 4DAFA 2DSUA 3U9IA 1J2BA 1VF8A 1V6UA 1OIFA 1J4EA 4GIAA 2VDHA 4X61A 3MI3A 5AYYA 2OZ0A 1FDYA 1C92A 1M7PA 2VM8A 4DJDC 4BFAA 4MWAB 4PTVA 4UTLA 1ME8A 3CV1A 3UG3A 3W74A 1X6UA 2WOQA 2PWDA 2EPOA 2OSXA 3PR2A 4AD4A 2JALA 4GJ1A 4AXNA 3CT2A 4BQ3A 5HBFA 1W9VA 2XIMA 4YN5A 2FJUB 1M68A 2G5WA 1RCQA 3VD4A 4S1FA 3T81A 2Y4SA 1EJUC 5CQ1A 4J4KA 3L67A 3EA2A 4W5UA 1UCWA 3IIZA 1R3QA 3WN6A 3NM3A 1SMAA 3BJFA 3CO4A 3P60A 4Z2JA 4TV5A 1OFDA 1JL8A 3WMLA 1JZ5A 3SGGA 1DWJM 2I5GA 4AHQA 2CLFA 5E1QA 4W93A 3MMUA 4LUJA 2FZ9A 3GXTA 4NI8A 4Z1CA 3LM3A 3A47A 4JIIX 4E2BA 1ZL1A 3TE9A 1GVSA 4JN7A 4D6FA 1MW2A 1XWYA 1NWSA 2Y7DA 3DFTA 2OB3A 3AU2A 4NIRA 5DCDA 4LF2A 1RBAA 2Y7EA 3GG7A 2DUXA 3UEQA 1F05A 1FXQA 3LRMA 5DMYA 1UC4A 2YCIX 3UNTA 4DRSA 3SUWA 2IXUA 3LD5A 3R94A 2GYIA 3JR2A 3BV4A 3RXZA 1D2KA 2ZZ7A 4C1NA 2VOTA 3GIQA 4JTGA 4XUGA 2H8ZA 2HE8A 3SM0A 4CD5A 1BQCA 4OBTA 4OUIA 3NSNA 2Y1HA 1UP3A 3NOYA 2MNRA 3GX9A 1SMDA 1UJQA 3VGHA 2BFGA 4CVUA 2PTDA 4F3HA 1XSIA 4GFIA 3WIJA 3LENA 2ACSA 1VPYA 4UNLA 4JNYA 1VEPA 2VYOA 3LRLA 3WLOA 4H9YA 4X0NA 1R2RA 5ECUA 1G67A 5LA1A 2GDUA 4F4RA 3LNMA 5IDIA 3JW7A 3TN5A 1OFEA 4M7TA 1LRNA 4LYQA 2CLOA 4POCA 5FJOA 4IMEA 1AD4A 4M6VA 5J04A 2QVNA 1CGUA 5JUVA 3ARVA 3EGJA 2E1DA 3C6CA 5IBXA 3TH6A 2AL2B 4HPGA 5L9FA 4DO4A 3E0VA 1QNQA 3NXFA 3H2MA 3UWWA 2Z24A 5I3HA 2XM2A 7TIMA 1POKA 1RHCA 3Q4DA 4B5SA 4KWWA 4CGTA 3N3MA 4QIUA 3DCPA 1FUYA 1ONEA 4CCZA 1Q6OA 3QY7A 4R9XA 6XIMA 3GNPA 2O56A 4BR1A 1EJ7L 5DLCA 4CVWA 4QDPA 4AIOA 1XV8A 1FWHC 2CERA 2IW0A 4IP4A 2JK2A 3STFA 1KA9F 2YL6A 3G5EA 1TZZA 4MZ8A 5DRIA 2ZBTA 2B0MA 3GTXA 1OGSA 3L5AA 1LBLA 4O52A 5IM51 1Q6FA 1NVMA 1QPKA 3VNIA 4ZGYA 5K9XA 4IIEA 1GOXA 1LLOA 2DU2A 1TUXA 3ANVA 4LAMA 2NVDA 2IXVA 1T40A 5D9OA 3N14A 5LA0A 1QO5A 4JIPA 1OFRA 2TYSA 4GFSA 1MUCA 1ZHAA 3WFAA 3USBA 2IPJA 4H8UA 5BRBA 3Q65A 5D38A 4YJ5A 2R9RA 1GJWA 3OPSA 3WZ0E 4JS3A 2Y5JA 1D7KA 1XYCA 1KM1A 4L4PA 4IOTA 3KW3A 3BAWA 3SCTA 3PB2A 4JYFA 2G3MA 5HPCA 5DY2A 1YTKA 4RKAA 3VIFA 4G56A 3LTPA 4NJKA 1YQ2A 1TV4A 2C19A 3NURA 1G6CA 3D46A 1UIOA 1E51A 4EPKA 1A4LA 1BGAA 3OO2A 3OGVA 1VBUA 2WHKA 2PC8A 3WD0A 4XSMA 1JUKA 3OGSA 2XUCA 1HKWA 5E70A 2BGSA 3NAVA 1B4KA 3BG9A 4LT9A 3GVQA 3OZYA 5HMFA 4B5XA 2R6OA 1XIMA 1JF6A 4MWAA 3PVFA 1AUSL 3N04A 2YCLA 4CCEA 1BAGA 4LC6A 5C7HA 1P0NA 4U5IA 3PZMA 2D22A 3VC6A 2F61A 1CIUA 4JD4A 3APTA 2Y8UA 1L8NA 1ISYA 3FCPA 1XIEA 1LLZA 1TPVA 4K8EA 1OHLA 3S46A 3N13A 2ANUA 2JQXA 3DFPA 5DRCA 1EBGA 4J35A 4LW7A 5DELA 1DWGM 4EXBA 3M0YA 2ISDA 2W5FA 1JZ3A 1RR2A 5I77A 2GSHA 4IGMA 4IPLA 6TIMA 3R2GA 4K37A 1I2QA 3L65A 3V4BA 1F8IA 4UOZA 1R87A 2YJQA 1EIXA 3CH9A 1G4PA 2BXYA 2NT0A 4CD4A 3WLTA 2C13A 2WSKA 3BLFA 3ITLA 4XB3A 2X0HA 1O4UA 1R3RA 5EL1A 5A3HA 2IKHA 1Q6EA 1TCMA 3SRDA 2XTKA 1TMLA 4MPKA 1ICQA 3D3FA 4NKCA 3SCVA 1T5AA 1TQXA 3TR2A 3BCJA 4MVAA 2DZPA 4DYJA 2ICSA 3E0IA 4JTLA 4QJ4B 3WQCA 3AYTA 4A3UA 4FLSA 3VVGA 3L0GA 4RCXA 4S3EA 2WC4A 2PCEA 3WKZA 3RIKA 2OLSA 2UY4A 5CAHA 3RX3A 2Q09A 2VEPA 3PAJA 1KGUA 1YW1A 4E38A 4RDVA 4RK8A 1K9DA 3PJWA 3URQA 2PDMA 2OYKA 1EJWC 4PSPA 4AX7A 1GUVA 1KM2A 4BI7A 4DAIA 4K36A 4JN6A 3QR0A 1PCKA 5G4EA 3IACA 1CENA 2GJXB 2HMCA 2VL4A 4ZFMA 1VBHA 3ARPA 3C8NA 2GOKA 1TV3A 5EKYA 2INZA 3TLLA 2QCEA 1XPYA 1NP0A 3EWXA 4AFYA 3QLLA 1UQZA 4QAIA 4I7VA 2BY1A 2QYGA 4C1LA 4X22A 1Z3NA 2HVMA 2FB3A 4JY9A 4S2CA 2V5BA 1G0CA 4Y9PA 4D71A 2GSJA 2QJGA 2DT3A 1HJSA 4CQDA 3G6MA 1DIEA 3AQUA 5HA7A 2DPEA 3DZ1A 2CFFA 4GZIA 1JQVA 1WDWA 4MKVA 1KBIA 5D03A 3EOOA 1GT8A 4BHYA 3DKJA 4IGHA 5FEZA 3TOYA 2WKLA 3FXGA 3I6EA 3BANA 3PWGA 1MQPA 3TYAA 4EWND 3OZOA 1O1ZA 4UNKA 3UZJA 1DIDA 3EMZA 2XJ7A 3AYVA 1JDDA 3EOSA 3LXCA 5M2FX 5FJPA 4HCLA 5M1TA 5J5DA 3UD6A 4NUWA 3TN3A 1JVNA 5LNRA 2ZX8A 3LV6A 3N12A 5HQLA 1PS9A 1WZKA 1LOLA 1EXBA 7A3HA 2Z6JA 4GCXA 4GRSA 3J7HA 2CZEA 1L6YA 3P80A 3UP8A 1XH0A 3SY5A 2KAUC 3TXVA 1H7XA 3NQGA 1FKXA 2ONEA 3IUDA 4XSLA 5AC8A 2WHLA 1J0ZA 1PCWA 3WH5A 3PNUA 3MCNA 5C70A 4DZAA 2NQLA 4UTFA 1H2JA 4IMCA 4KGLA 4QROA 3W1TA 5CEWA 2VI0A 2XSAA 4I9MA 1HKJA 5HATA 2QJHA 3EYPA 3QMRA 4W8BA 1WOBA 3B8TA 3AJXA 3U57A 1B9ZA 1LORA 4ASTA 3AXXA 2GUBA 3UJEA 1LOQA 3SN1A 4EOUA 3WNMA 5I0DA 2OTDA 3V0UA 5BNKA 1QI5A 4C7GA 1W9XA 4AHOA 1JCXA 4DUVA 3LSBA 3DU0A 3BQ6A 5I2UA 2BVTA 4H9ZA 1LBFA 3ARYA 3M0IA 4C90A 3G3MA 2Y8KA 1AJZA 3GH4A 2HWGA 1FDZA 1E6ZA 4KWVA 3OQ8A 1DE5A 4Q8OA 1R3SA 4A22A 2KZHA 3M0VA 3NO5A 2VQUA 3WH9A 1J0KA 4Q33A 1Q7ZA 4L6OA 1CXLA 1KNWA 4AYGA 4K68A 2HVOA 2INEA 1ZCCA 1KFKA 4MY8A 1QNVA 4HTYA 2WYSA 2V38A 4OFCA 2Q02A 2IUZA 3E96A 5FEPA 4YTSA 4C6QA 4N9CA 5CSYA 2WPBA 3B8WA 4FPSA 4UTJA 4DPPA 4B90A 4HA0A 4PFMA 5LNUA 1S5NA 4R33A 1P1MA 2ACUA 3MSYA 3BWWA 1B30A 3HFTA 3CPGA 3QSTA 1H41A 1GVFA 5I02A 1NWRA 5JBFA 1M01A 3GTFA 1XLJA 1XLMA 2XZ7A 5A8GA 4U3CA 4HZMA 1E73M 3XINA 3ABOA 2PA6A 3H7RA 1VPXA 3WNNA 3NZGA 2V2HA 4JPGA 1RJQA 3CHEA 4H19A 1XBZA 3GHUA 2DZTA 5F2MA 5I06A 3SZ8A 2DJLA 1S5WA 4LAKA 3W28A 3EDFA 1ZJHA 1DV7A 1FH9A 1US2A 1X38A 2X09A 3EX1A 3DAQA 3TNOA 2Y62A 4WR3A 2XZ9A 4C6PA 5LGXA 3M0XA 2HVNA 3NQFA 4FLOA 1RZMA 3BAYA 5E0KA 3B0PA 3LQLA 5DMMA 1TZ9A 1YXDA 1SQ7A 3GAKA 5HQEA 3GZ3A 4AD2A 1V02A 4N02A 1JPKA 3OBEA 3ZT6A 2C18A 2VC7A 3HG2A 1W1IE 1V0MA 4B4FA 5CZSA 1VEOA 4MDOA 2PDKA 4NAFA 1F3WA 3WQ8A 3OHIA 2CW6A 1ONWA 2WNQA 1GQNA 2VQTA 3MKVA 3W7NA 2GJXA 2OQLA 4Q8WA 2DT1A 1E5NA 1RPXA 2O9TA 2NQHA 4YS1A 1GZGA 4PB3A 3S9ZA 4YHEA 2WZIA 3ZWSA 2WHJA 3PULA 2GVJA 3C3NA 2ZCGA 3W82A 3H7VA 1D8CA 4MDPA 3F5JA 4M7SA 3IPWA 2JEQA 1Y5XA 1XICA 1C91A 1TV2A 4Q8VA 1GOMA 3NQ2A 4JKLA 1F4AA 3PFMA 2QAFA 3L9CA 3NVDA 3TMQA 1M53A 4NT0A 5D04C 3LK6A 3IUHA 3NDYA 3PBUA 5DT5A 2X1RA 4MG4A 2GQ9A 4F0LA 3O8AA 3BJTA 5E6YA 1DXIA 1I4NA 3R13A 4Z1AA 1W5PA 2WZEA 4M6UA 1MSSA 3N4FA 2I14A 3VYLA 3BW3A 2O9PA 4ZSTA 2WVUA 2EPHA 1SR0A 3CAWA 1CXIA 3MUY1 1DE6A 2W66A 3UZYA 1UZ4A 2FGBA 3RCYA 1YPIA 4RDWA 4L56A 5F4SA 3WQ5A 2E28A 4IJCA 1PHWA 3E2VA 5E09A 4OTKA 3ZJKA 4I9TA 1KLYA 4E2VA 3VIPA 2ZRYA 4QG6A 4C6LA 4C6DA 4MNKA 3DEQA 4PMVA 2Z2AA 3IS4A 2Q71A 5F1UA 2XWEA 4IWWA 5FKYA 2WCSA 3HQ1A 5PTDA 2OG9A 3RN6A 3VDCA 1I2OA 4HNUA 1ENUA 1H1NA 1LRTA 2J47A 3W7QA 1W9PA 1JZ7A 1EPXA 3CPRA 4UQBA 2F2KA 6PTDA 2DT2A 4NJHA 4RXFA 2H90A 1O5RA 2EPLX 1FH8A 1MFVA 2QUVA 4NG3A 2VZVA 3O7UA 1XLGA 1HJXA 3EMQA 2OSYA 3DYMA 3CV2A 3ZFHA 1PL9A 1KXQA 1AJ0A 1JGMA 3TV8A 1VBGA 4CKQA 4F0HA 3EZ4A 1GPFA 5BROA 2ZRXA 3HM7A 4QISA 3SB0A 1E6SM 4WF7A 2YSWA 1RY8A 2ESCA 1SFTA 2E4TA 1FWWA 3DGBA 4DELA 1CGTA 4HB7A 4AY8A 3CO8A 4M19A 1RBLA 4FR6A 2PCQA 4R5EA 3CU2A 5D2TA 3EKZA 4UOJA 5BCAA 3EBVA 5C9WA 4LEFA 3GXIA 3NL2A 3WUEA 4PUJA 1M9HA 3KZPA 4XG1A 3VU2A 4ZOEA 3KBMA 4CNOA 3ARUA 2BOEX 4NJIA 2P3EA 4DBDA 5BXTA 4IGNA 1JXKA 4RR4A 5A94A 4F2TA 2E68A 3RPDA 1SM9A 1BYDA 1KLZA 1GOQA 1K8XA 2EBNA 4PMQA 3OLEA 4C6IA 3KP0A 3AHZA 2VTFA 4GUFA 1TA3A 3V35A 1GYNA 3N2OA 5REQB 4CCCA 2XWDA 3T0TA 2DUZA 3I6RA 3NPUA 4JHOA 3GIPA 3WBWA 3T55A 1VBJA 2E5CA 4PRRA 2C79A 1QNPA 4TR9A 3WQGA 1E6RA 1FHUA 4AD0A 3H8AA 4RZ6A 3PZQA 1A5BA 4YYFA 4LUTB 1AFSA 4MOZA 5GJPA 2XH2A 1F3TA 3G1YA 2ZOXA 3K2GA 3R11A 1F6PA 1HZYA 4JYDA 5ABGA 5E9XA 2B7QA 3L2IA 3VX1A 3FAXA 3H21A 1CGWA 1XCFA 1DP0A 4DJFD 3BW4A 3TTSA 5CSUA 2ODOA 4LYPA 2F6KA 4E5TA 3AICA 3RPMA 2I57A 2A3LA 1HT6A 2RUSA 5AYBA 4LUIA 3MUIA 1ZQ5A 1O6IA 4L80A 1OQFA 6REQB 1TX0A 4IIHA 3UG8A 4FAMA 2OZ3A 4J3UA 1VGAA 2QV4A 3L12A 4WXYA 2QQ6A 3A6OA 3AHXA 3A4WA 4QGCA 5CGQA 3CM4A 4J5NA 2AL1A 4XBSA 1YDVA 3VZYA 1XLEA 3VKDA 2W92A 4MUZA 2GJPA 3TONA 3I6TA 3G3DA 4W87A 4GY1A 4W5ZA 3KTCA 3QFEA 1K03A 2RDUA 4GUGA 4YVXA 5H6HA 1U1HA 2PDNA 4X63A 1CLXA 3BSGA 4LX4A 1DJGA 1XCWA 2XG9A 1V77A 3GU1A 1HUVA 2Q6ZA 5LHEA 3P62A 3QPZA 4QLJA 3K8MA 2OFJA 2NZLA 2AMXA 5A95A 2ADAA 3GDLA 5HAOA 2R1LA 3GUGA 5D02A 3TYDA 2CLPA 3OG3A 1FFRA 1JI1A 3T6CA 3THUA 1JRCA 3NFUA 2DGAA 2ZZ4A 4QR6A 2WCAA 1AQFA 3SN0A 4HHPA 1PTAA 3QFWA 4NVTA 3BGGA 3RF9A 1TWDA 4AH7A 3LCXA 3FAWA 3LCWA 4PB4A 1FQ0A 1A80A 1T0OA 1HNYA 2CBUA 3ARRA 1E56A 1TPEA 2VEMA 4Y90A 4FXJA 2CZ5A 2NQ5A 2VC5A 4NZ5A 2DZVA 1J10A 2JKAA 5LNVA 3VUSA 5K2ZA 5AYIA 4JX4A 1J9YA 1E0VA 3VKJA 1QWKA 1NY1A 4A8IA 3U3HA 2PGEA 3V0SA 3WEMA 1V7YA 2Z4GA 4GGBA 2FH8A 4H6EA 4DNMA 3CTLA 4DZ5A 3Q37A 4Z08A 4Q7IA 2JIWA 2XH0A 4QS6A 3GHSA 4MLRA 3QV8A 1UWSA 1SZEA 3WJSA 5HWJA 2OPJA 1SO5A 5ENLA 3N2XA 1XLBA 5AZ1A 3DBPA 3VC5A 1C8QA 1YNQA 4G1NA 2W27A 1MEIA 3AYSA 4BQ5A 2PMQA 1ZP3A 1IGSA 1P5BA 3R5EA 2CLLA 1W5MA 2O4MA 3G2GA 1WYIA 3K5XA 4ADUA 2OX1A 4JYEA 3V0TA 1JQXA 1XLLA 3CQJA 4GPNA 5I09A 5AHNA 5LIUX 3QZ6A 4WDXA 2R1PA 3H2NA 4B3ZA 1H4PA 1G5AA 3RLVA 1ZS2A 4I3GA 3EEGA 2PURA 4P7NA 3TYBA 3F2CA 2HE5A 1IR2A 3CB3A 4J3ZA 1PKLA 4KWSA 4US5A 3HFYA 2IKIA 3BGAA 3MJYA 5AHMA 4JQ2A 4JTUA 3DX5A 1E0XA 2CZVA 4GIRA 3FK4A 1V3HA 1FWSA 3PS7A 4Y8EA 5FOOA 3GTHA 4UQDA 2F7FA 3WG6A 4FLRA 1JZ6A 3HPXA 3S9IA 2ZTJA 3W1NA 2PDBA 1X1ZA 2V3GA 3IJ6A 5REQA 2UBPC 1EC7A 1YTDA 1HN1A 4HPHA 3BGJA 4WX2A 2YZRA 2PFHA 3UG4A 4EE9A 3R1ZA 1GPWA 4ZB0A 1C7TA 3PWAA 9RUBA 2B4GA 2QCFA 4ICNA 1RUSA 3ZJ7A 4RV8A 2NUYA 1DKWA 4ML9A 4DNHA 2GK1B 4UCGA 3P8JA 3VNLA 2E6YA 3W7MA 3L4TA 1MRQA 3M0MA 5H8UA 2ZE0A 7PTDA 2OEJA 4LUTA 3RFAA 4GD0A 1S2TA 3ES8A 3EMCA 4GJIA 3LEPA 3BICA 1SO3A 4CD8A 3NGFA 2YLLA 1JDAA 3HQNA 2EO7A 4PBFA 1FA2A 1M3UA 5C6MA 1XHGA 2XYLA 4GYJA 3W37A 2VX6A 3AWOA 3LCIA 3U7VA 1ZBKA 1EDQA 3NM1A 1MQQA 1BD0A 2EEXA 2NWRA 3IUIA 3MS8A 2W67A 3ATZA 4GXMA 1OD0A 4GQ0A 2VZTA 3QEZA 2PZ0A 1GVIA 1R47A 4YVVA 5TBOA 2PU1A 4RJEA 3HA1A 3CEPA 3W7JA 1XISA 3UR7A 1FHDA 3WQFA 4E4FA 1A53A 1Q4WA 1QNSA 3RR1A 1FOBA 3S9YA 2FVKA 1GYMA 3CQIA 1ZJAA 2I9EA 2VFHA 3H53A 1YADA 1LZOA 4Q8MA 3RITA 5KZMA 2NV2A 4C6MA 4GQGA 4CCDA 1J12A 4S39A 2O7SA 4MB3A 3GBEA 2F84A 3BZJA 4O13A 3O06A 4KCVA 2J8TA 3TJIA 3VKAA 2FDMA 5CPSA 1IWPA 2ZZ1A 3FYYA 4Q32A 1IEQA 3LGEA 2QULA 2V68A 4H04A 1UP0A 3URBA 4BWLC 4GCAA 3MBFA 3NUKA 4TO8A 5FJRA 4ONVA 4H4IA 2RDTA 1UKPA 3EPMA 1JCTA 4Q6JA 3MBDA 4OV4A 4NILA 2YB4A 1K9FA 2DUAA 2GUUA 3UYCA 2V5LA 1AZ1A 3MVIA 3W1UA 4AEOA 4MKNA 1V6TA 3T2QA 2XISA 3WD1A 1W32A 2YPIA 4B5VA 4DJDA 1RP9A 1MNSA 2V5DA 3UPMA 1LL4A 3VNDA 3N2CA 5H2ZA 2QIWA 3GXNA 3PPCA 4EAYA 1DOSA 4YCPA 3GFXA 1LP6A 3TC6A 4B3LA 2V82A 4FR1A 2ATMA 3PM6A 1QI2A 3W7CA 1OT1A 5I3GA 4A3QA 1YXCA 2D0FA 1M03A 2D2OA 3LI0A 1V6VA 4S3KA 1YKWA 3FFSA 5D2XA 2QW5A 4YTUA 4N9EA 1EJSC 2UY2A 5DF0A 1DL3A 5CGTA 2C71A 1ZRQA 4IIDA 1UG6A 1Y65A 3ORWA 4MTVA 1IXNA 5FI8A 1M1BA 2ZXQA 1W0MA 1YXYA 3UWUA 1XLFA 1GCYA 3MHFA 3B8VA 3M6YA 1AW1A 3VM5A 3GYCA 5AHEA 2PTWA 3W2JA 3NDZA 1QTWA 2YBUA 5LNSA 3R43A 3SUTA 4PRTA 4O28A 3NO3A 1XC6A 3BMWA 3MV01 1W1B1 3AS1A 3T0DA 3G1DA 3MZ2A 3WDPP 3G1HA 3MWCA 5CPTA 2OT1A 2ZWYA 4RW3A 1PYFA 2B31A 4PE8A 1A0DA 3QY6A 5BU9A 5D9MA 1XIIA 2QAPA 2C7FA 4BKNA 1EO5A 3JS3A 1R46A 1GG1A 2VEGA 5C7VA 4QJ1A 3G8RA 3LZ3A 3WLMA 4DHGA 3W26A 2I7GA 1BWVA 3NZPA 1TJ1A 1QCWA 2OSWA 1EO7A 2WSYA 3GKAA 3CLMA 1J5TA 1B2YA 3WLKX 3ZO9A 5A6SA 2E8ZA 3GXFA 4U4MA 4CNNA 3LCGA 4NNBA 4FALA 3ECQA 2E40A 2Y7FA 3IVTA 1S2WA 2CWNA 4GMEA 3TA6A 4HA3A 3DDMA 4H7CA 3P67A 1IR1A 2ZUMA 3TVAA 2R1KA 3MANA 3P14A 1PZ2A 2NVAA 3EWUA 3WY1A 4JX5A 5KTLA 2NQ9A 4PODA 1VR6A 5AOUA 1WAUA 1LQ2A 1HFBA 2GK1A 3WF2A 1J5SA 1WUFA 2BY2A 4IGSA 2VP8A 1GEQA 3RU8X 1QO2A 3HOJA 3HO8A 1W1A1 1DJXA 2XHYA 1WZMA 2OEKA 2BDQA 3BARA 2CBVA 1Q63A 2WC7A 3R0DA 2P0IA 4R27A 4NNCA 1O5QA 1OC7A 4LY8A 1R3WA 1W5NA 5AZ0A 5LIWX 2YDRA 5A8NA 1FY6A 1OX4A 1KRMA 4LRSA 3VD7A 2Z2BA 3EWYA 2BP1A 5J8LA 3TFCA 4A3RA 3W7PA 4FO4A 5LZLA 2JKPA 2ZUUA 3M64A 4HZ8A 4R3UA 5JH2A 4WSKA 5D2VA 4JN8A 1IT8A 4UFJA 3VIMA 3PANA 1XL9A 2ATSA 1PIIA 4LVFA 1E4IA 3I4EA 5FESA 1KTCA 1XYZA 1DWHM 2NXHA 3ISIX 4OKDA 4Q4SA 4DI9A 8A3HA 1BF6A 4MZ1A 4D6GA 5AHIA 3TAKA 1OJXA 4WD0A 1Z32X 3UGVA 3W7EA 4AYSA 3OB8A 1X1NA 3NPVA 3S1UA 4K3ZA 3WD2A 4M1BA 2AMGA 5I3DA 3GVWA 1UBSA 3BL3A 1K8CA 2CYGA 4JTQA 3S1XA 3TEVA 2ZKMX 4JQ1A 2HQAA 2DQWA 4V15A 3OLGA 1BF2A 3ZJ6A 5XIAA 2YGYA 5A8QA 1FHLA 3UCCA 2J66A 4HZ6A 1F74A 2WMFA 5HWNA 3GG1A 1C29A 2Z1WA 1QK2A 1WDPA 4B2DA 3QJAA 3BAXA 3HGJA 4J2PA 1XR2A 3MU7A 4LANA 2ZA3A 1HP4A 1V08A 1Q65A 1U2YA 4DWSC 4DY1A 4AMAA 2WSRA 1OFBA 1WKFA 5EGRA 4BA0A 1K9TA 4N6FA 3KFTA 3AJ7A 1B57A 1S39A 1BHGA 4FOJA 3MWAA 1PSCA 1Z69A 5FSEC 2G8ZA 4OWGA 2DDXA 4KFPA 1PXGA 4AZCB 2DP3A 4Q3MA 4XAYA 2G0WA 1R38A 1UR9A 1F4HA 3VX0A 2ZADA 3N2MA 4WKHA 1V8EA 4JIQA 1RK5A 1GHSA 3DGRA 1CX9A 1R86A 1CXFA 4E3VA 1AD1A 1O68A 1U5JA 4LUSB 1J8VA 4NAEA 1KR1A 1V3LA 3UVAA 4ECLA 2V5KA 2D3LA 3PWIA 4P7LA 1HX0A 1MRAA 4HA4A 3WX7A 4QHRA 3Q2DA 1W54A 3IK4A 5EMYA 5XIMA 4D2JA 1N8WA 3N9SA 1YRRA 3PFRA 1OFQA 3LN3A 4PMZA 1W1ZA 4IM4A 2PDFA 3PNZA 1GVYA 3GB6A 1KW1A 1JEZA 1E15A 4D72A 4PUEA 3U2EA 4MJMA 3CAQA 3SCRA 5JXQA 3E2RA 4YYCA 4FIRA 2Q8ZA 5DXXA 5AC7A 3REQB 1OFPA 1EA9C 4XBJA 3SIZA 1A5KC 2A21A 4FS9A 2EPNA 1TWSA 5G5IA 3W6LA 2BXVA 4HCDA 1WXZA 2Y0FA 4UWMA 1OD8A 1VYSX 5HPOA 1ICPA 3AAMA 8TIMA 1ADSA 4AWSA 4BI5A 2HRWA 3FGCB 4QEEA 4H9VA 1SGJA 1K4GA 1ZAIA 3PUDA 1L2UA 1PZ1A 3G1AA 3F2BA 1OYBA 2Y89A 4JTKA 3N25A 1NOWA 3W0KA 2WPGA 4RDZA 1GK8A 1R85A 1IQ8A 1VAHA 3WH7A 1EFZA 4AUBA 3UFYA 1J01A 1E9YB 3EOLA 4H8HA 2DV0A 1ADOA 5A5WA 3MSDA 3BCFA 3I7SA 3GKFA 2IKGA 3P6LA 4MM1A 4E0CA 1F3EA 4EX4A 2PUZA 3RDKA 1TE6A 1QBBA 1XRFA 1MXSA 3NQVA 1A5NC 3E5BA 2ISFA 5JIPA 1Q7MA 4D6CA 4H9TA 2R91A 1CXHA 4QJ5B 3KUMA 4FSAA 1JPDX 3MZNA 4AEEA 4E2OA 4P8VA 2XVGA 3UF9A 4FMVA 4O14A 2FFCA 1ALDA 3N9RA 1LT8A 4YVPA 4LB3A 3SGUA 3TYZA 3O16A 5TNVA 3CIXA 4K8GA 5DCBA 2PGWA 4GI8A 3DFQA 2EKGA 4KGJA 3LYEA 2WMKA 1FWRA 3KAOA 2ZC1A 3SQLA 2CLIA 3CK5A 1JZ8A 5CG7A 4O17A 3W87A 3CWNA 3NL3A 3RNDA 4LAUA 1Q4NX 3KEHA 3S6OA 4BCEA 2PDQA 3K8KA 2CHOA 3LG3A 4DB7A 3VK5A 1L6FA 2G3JA 3G0UA 2IQ0A 3N2TA 1K8YA 2BHZA 4G7FA 3STEA 5LGZA 4UC5A 3M1ZA 3VMNA 1OY0A 5I3KA 4OUEA 3MVTA 3UYIA 3VIKA 2ZX6A 3N2BA 3G77A 2CC0A 4EF9A 4PFHA 2QDEA 3BSHA 4RPQA 2O4QA 4PUUA 4HOXA 4LCRA 2ZQ0A 5DFAA 3R7MA 3D0CA 2J78A 1Q6GA 1F6YA 3M07A 4Y9AA 3WQVA 3O63A 2PU0A 4JHZA 1Q8JA 5JMUA 4MF4A 4WLCA 1CECA 2NVCA 1AL7A 1EF2A 1Q2RA 4EP8C 4P8UA 1M7JA 1SW7A 3U4FA 3SR7A 2PLMA 3THCA 3OVPA 3S5SA 3KVMA 1CWYA 1PWLA 1TVNA 4GABA 3U7BA 5GJNA 3ZS4A 3RCNA 3IANA 2BS9A 1NJJA 3W73A 1DORA 4BEQA 2FVMA 2QHAA 3NQ8A 3T4WA 1KFEA 3HG4A 3BC9A 4I5UA 4AZCA 1F7BA 4QDWA 3QPEA 2PWEA 2XN1A 3JU2A 4G7EA 5CJ5A 4K1WA 4LAOA 3ITYA 1KM3A 3PZUA 4S3BA 4XZNX 1EHNA 1Z89A 1QOPA 4H01A 2VXNA 4PEKA 4PMYA 5BMWA 2UWFA 2PDLA 3KOZA 4LUSA 4DXVA 4LRTA 1A4MA 4QG9A 4Z2HA 1OCQA 2P10A 5HMDA 3QHMA 2VCBA 3CUHA 1OK4A 3WLNA 1JDCA 5HQMA 3TK7A 4R9OA 4ZO7A 2PDXA 2ZX5A 3B8DA 4NYUA 1CI1A 3O1NA 1N2VA 4H2CA 3N19B 3V75A 1KC7A 4KWUA 3EXRA 1DHPA 1NFPA 4HHLA 5DX7A 1SJCA 3LGDA 5A8OA 2A3HA 5DXYA 4DBUA 4IFOA 4FP1A 4O4WA 4JTAA 2V9DA 3REQA 4MHBA 3WNLA 3D6NA 1TWZA 3C52A 3HURA 2O92A 3E3HA 1E0UA 2XFWA 2FGZA 5EY5A 1U83A 3I3EA 3N6QA 3DECA 3LQGA 4OT7A 3GR4A 3FGCA 2YA2A 3M47A 4WEVX 1Q45A 3QSRA 2QMKA 3TIMA 4HSOA 3ZR4A 4KIEA 2WZMA 2BXZA 3R8GA 3R12A 4ZCWA 1PE1A 3SCSA 1MUMA 2RHGA 4EWJA 3LHVA 2WNNA 3AIVA 1LYXA 4QM1A 3EX2A 4NHVA 3M5XA 2GVGA 3APGA 1V5XA 3WQ6A 3CL8A 2JKEA 5CKSA 2C8NA 4HN4A 4QNWA 1HL8A 1J0IA 1CCWB 3AIRA 1JD9A 4MWAE 8XIMA 4PL1A 3VKBA 2AOSA 2BTMA 3KVLA 1QK0A 2P0OA 1IXOA 3HU7A 4UTIA 4S3AA 1OSEA 4JNZA 1IHIA 4A35A 3TTEA 1IZKA 3LXBA 4G2DA 1LWIA 1ZAHA 3BK0A 4QX4A 4HK5A 3S0CA 5EPDA 3BURA 2J77A 2NX3A 2OWCA 1W2VA 1RP8A 2P53A 3TW9A 1IXQA 4CN4A 3EX3A 1I0DA 4O18A 1UA3A 4Q8NA 1BVWA 2BHUA 4OBRA 3NG3A 3R8RA 1G4SA 3CJPA 1LQ0A 2ASHA 2Q8XA 2XIJA 5G1TA 2NT1A 1LL6A 4V33A 2YW3A 1UW9A 4LYRA 2VCCA 1GW1A 1FWNA 3AZRA 4DXXA 1BFNA 2Z2UA 5HMEA 4AZ7A 4ATDA 3DXIA 1B4EA 3WJZA 3B8UA 3P82A 3ARTA 3UXDA 2CHNA 1YPFA 1UP2A 5BW6A 5B7YA 4HCHA 4KCTA 2XVLA 3TTQA 3A13A 4N6EA 1F73A 2YBVA 3QQ1A 5ABEA 3GTNA 3M0ZA 4JQAA 2J75A 5GNYA 2QT3A 5D8ZA 5IDZA 3S5OA 3NEHA 9XIAA 4CQBA 1TTPA 1AMKA 5C9ZA 1WUEA 4HA1A 5GNZA 1SZFA 3EB3A 2Z1KA 5A2CA 3QPYA 4GY0A 2BY0A 1DIKA 4WUIA 3WENA 3HV8A 1JYVA 3MDWA 4Q4KA 2WSQA 3W7LA 3B97A 1BLIA 5BWAA 4XO6A 1TMHA 2DZUA 2WMHA 4O11A 3UWZA 4HHHA 1CPUA 3Q58A 1E3XA 5AN7A 1DJYA 1TREA 4PTNA 1FFQA 2QCDB 1S3TC 3FS2A 4GC4A 3H2EA 3EKGA 1ODZA 4Y2WA 3L66A 5XINA 3C2YA 3VGDA 1ONXA 3MJMA 5C9XA 4IL2A 4H83A 1FP8A 4GI9A 1KRCC 3DN5A 1Q5MA 2UY5A 3W71A 3SI9A 3CV6A 1ISWA 4NP7A 6ENLA 1W9UA 2D1ZA 4JFUA 3W1MA 4UFKA 5G1MA 1EKOA 3L4YA 1QMLA 3WFZA 1KRAC 1G9HA 5D9PA 3TA9A 4GYPC 3MSGA 3CASA 2F6UA 5FACA 1MZHA 3QBUA 2PRMA 2ISSA 1UKOA 1IT0A 3Q45A 2E5DA 2B7PA 2YXGA 1YE4A 3KCOA 4GINA 5LIKX 3LX9A 3F7JA 4IICA 4WOQA 3IJQA 4S2BA 3RAOA 3OJGA 3KCLA 4EKJA 3LTYA 2YCEA 1MI3A 3MT1A 3GFYA 2PAJA 4TX9A 1WCGA 4JEQA 4J40A 1BYCA 2HCVA 3CV7A 4JTEA 2GWNA 3WF0A 3BLOA 2HBXA 2OGJA 1JUEA 2WBGA 4JGDA 1S46A 4RE3A 1MXGA 4KRTA 1XYFA 2XN2A 3SQSA 1KV5A 2KX9A 4FX6M 5D8WA 4O12A 3W7DA 5LYRA 4X2PA 3URAA 3VGGA 1ISZA 3TKFA 1B31A 5A2BA 1SPQA 3LHWA 4UMAA 3O05A 4LVDA 1TJ0A 3P5ZA 3DHDA 5CG0A 5FEXA 1O66A 2DT0A 4MGGA 3AMDA 2OWWA 1ZBCA 2JEPA 3SQMA 2IS7A 3W1AA 2Y6ZA 2PS2A 5G1YA 1GVOA 2PTXA 3M5VA 4C1KA 2OWXA 4R34A 5CZJA 4DO5A 1KQZA 3NGJA 4ZQMA 4GBDA 4Q8TA 4R53A 4ZXOA 3B0VC 3E38A 3O6YX 3NZRA 3UNDA 3F5KA 4NF7A 1KD0A 5E9AA 1BSIA 1I45A 3C61A 3HMJG 1W1YA 1H0GA 1I6NA 3FJNA 3WMBA 1A5AA 4GH3A 2Y8VA 5EA9A 2GL5A 4QP0A 4F9JA 4KERA 3WBYA 1HJWA 2RDXA 4GISA 4R7OA 4Q4RA 1V79A 2IMRA 2JFEX 1W2PA 5K9DA 5A6BD 2QF7A 3VIOA