1HW6A

Crystal structure of apo-2,5-diketo-d-gluconate reductase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
262
structure length
257
Chain Sequence
TVPSIVLNDGNSIPQLGYGVFKVPPADTQRAVEEALEVGYRHIDTAAIYGNEEGVGAAIAASGIARDDLFITTKLWNDEPAAAIAESLAKLALDQVDLYLVHWPTPAADNYVHAWEKMIELRAAGLTRSIGVSNHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGKYDLFGAEPVTAAAAAHGKTPAQAVLRWHLQKGFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE
publication title Structural assembly of the active site in an aldo-keto reductase by NADPH cofactor.
pubmed doi rcsb
source organism Corynebacterium sp.
molecule tags Oxidoreductase
total genus 90
structure length 257
sequence length 262
ec nomenclature ec 1.1.1.346: 2,5-didehydrogluconate reductase (2-dehydro-L-gulonate-forming).
pdb deposition date 2001-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1hw6A00
3H4GA 4L1XA 3D3FA 3ONBA 4WDUA 3LD5A 4YVVA 4L1WA 4PR4A 1PZ0A 3R7MA 3CAQA 5HA7A 2VDGA 1OG6A 2J8TA 4XO6A 3R8GA 1LQAA 4WDWA 3CV6A 1YE4A 3UGRA 2ACQA 4ZFCA 5KETA 1AZ1A 2WZTA 2FZ8A 3R8HA 3GHRA 4EXBA 4JQ2A 2WZMA 2FVLA 4JQ3A 4XZMX 3FJNA 3UG8A 1C9WA 2PDIA 2R9RA 3RX3A 2PD5A 2PDHA 1VP5A 3LENA 4XZLX 3M0IA 3NTYA 3FX4A 3V0TA 4F40A 1HW6A 2FGBA 2PDFA 1Q5MA 2INZA 4LAUA 3WCZA 3BUVA 2PDWA 3GHTA 3H7UA 3V36A 4IJCA 5LIUX 3R6IA 4GQGA 3VXGA 3BV7A 4H8NA 3LQGA 1AH3A 5DANA 1Z3NA 1FRBA 4XK2A 1ZQ5A 2DUXA 1HQTA 3LUTA 2PF8A 1MRQA 3R94A 3C3UA 2PDBA 1EXBA 2HE8A 2ACSA 3EAUA 1QWKA 3WBWA 5LIKX 3LNMA 3N2TA 1AFSA 1Z9AA 4FALA 2HE5A 4YS1A 1EL3A 4R9OA 1XF0A 5HNUA 4PRRA 3T42A 2R24A 2PDJA 4GIEA 1GVEA 3WBYA 1X96A 4XVEA 4HBKA 3UZWA 2BGQA 1Z8AA 4WDXA 3UP8A 3V35A 2F2KA 2IS7A 4I5XA 4PRTA 2F38A 4XVDA 1PYFA 3R43A 1RY0A 1AH4A 4JIHA 5HNTA 1ZUAX 3DN5A 2IPFA 2IPJA 1RALA 3M64A 4GACA 1JEZA 4DBSA 4G5DA 2FZ9A 3GHUA 4JQ4A 4IJRA 3MB9A 1Q13A 3GUGA 3UZXA 3O3RA 4XZHA 1Z89A 4JTRA 3BCJA 4WGHA 3BURA 2BGSA 4WRHA 3GHSA 4EXAA 3COTA 5AZ0A 2ISFA 3RX4A 3RX2A 2ALRA 3LZ5A 3V0SA 2NVCA 4IGSA 2PDNA 1PWLA 3B3DA 1S1RA 1YNPA 4YVPA 4FZIA 1EKOA 4HMNA 4LBRA 4ICCX 3LEPA 3UWEA 4ASTA 4YU1A 2P5NA 2HVOA 2PDYA 2PDXA 4JQ1A 1MZRA 2DV0A 3H7RA 1K8CA 3WBXA 2C91A 3U2CA 2PDMA 3DOPA 2IPWA 3UFYA 2IKJA 1EF3A 3F7JA 1QRQA 3S3GA 1AH0A 4DBWA 5LIXX 2HEJA 1PZ1A 3G5EA 4GA8A 1ZSXA 2DUZA 2HDJA 2NVDA 2I17A 3N6QA 3O0KA 4GQ0A 4MHBA 3M4HA 4XO7A 1XGDA 2PDQA 1US0A 4DZ5A 4QX4A 2ACUA 3P2VA 4XAPA 3EB4A 4JIRA 3Q65A 3LQLA 4AUBA 4YVXA 4JQAA 2PDPA 5JH2A 2PD9A 3UZZA 1VBJA 1ZGDA 1YE6A 3WG6A 1ADSA 1J96A 2IQ0A 2PZNA 4LB3A 5LIWX 1T40A 2BP1A 1S2CA 1YNQA 5M2FX 2FZBA 1IEIA 2IQDA 4OTKA 3CAVA 2PDUA 4Q3MA 2ACRA 2PDKA 1LWIA 1M9HA 3V0UA 4RPQA 4PUUA 4WDTA 4FA3A 4DBUA 1S2AA 2CLPA 3ONCA 2HVNA 2PFHA 3LN3A 2IKHA 4JTQA 3ERPA 4GCAA 3KRBA 5LIYX 4Q7BA 2QXWA 1PWMA 3MC5A 4QBXA 2IKGA 1R38A 3LZ3A 3UZYA 4QXIA 2IKIA 1IHIA 2A79A 4GABA 1RY8A 2PEVA 4H7CA 4JTAA 3LBOA 4JIIX 4PMJA 4LAZA 3EB3A 1S1PA 3CV7A 1UR3M 2PDLA 4NKCA 1X98A 2AGTA 4PUWA 3Q67A 3CASA 2FZDA 2I16A 3R58A 1A80A 4QR6A 4LB4A 2PDCA 5JH1A 4XZIA 3CMFA 1X97A 1XJBA 4JTCA 3UYIA 4XZNX 1T41A 2INEA 1SM9A 5AZ1A 2PDGA 2IPGA 3G1RA 2HV5A 5C7HA 4LBSA 1MI3A 4FAMA 4JTDA 1AZ2A 3QKZA 4WEVX
chains in the Genus database with same CATH superfamily
1JQXA 4RZBA 1QVBA 1EB3A 2OCZA 2YL9A 2XVGA 1E72M 4HB7A 3LD5A 1REQB 4CLMA 1K9DA 1R3WA 2QJHA 4Q6XA 3STPA 1CGVA 5A5WA 3KFTA 1ITCA 3VD5A 1W2PA 3CHFA 1V08A 1WBJA 2QLYA 4NJIA 1EDGA 3PUEA 4WDWA 3CV6A 3UGRA 3PTMA 3R89A 4IPPA 1KBJA 2QDHA 2J13A 4ZFCA 3P84A 2ZE3A 1UKQA 2ZQ0A 2WZTA 3GHRA 2H9AB 4HHPA 3FJNA 4P7OA 2QF7A 3H21A 4FLSA 4PTWA 5FD0A 3QF0A 3LENA 3AIEA 5JIPA 5EMLA 5FEZA 2OOFA 2DSKA 3FHQA 1AODA 4FOUA 5EMKA 4ZENA 1P4CA 4FIQA 1QAPA 1QI4A 3ANVA 4W93A 1F6KA 3T2PA 3EA1A 3ME3A 1BYAA 4RPPA 1G4TA 2R6OA 3LMZA 4MNJA 1P7TA 2C8NA 4MF4A 4UIOA 3P61A 1VYSX 3TYZA 3V5FA 6REQB 1VR6A 3T9PA 1FRBA 4XZWA 3F4CA 2ZX8A 3EDFA 3MZ2A 3PBVA 3DEQA 3O15A 1MUCA 5AYYA 1LLOA 1XINA 4Q4MA 1H62A 4HU8A 3QH2A 2HE8A 4B92A 4U5KA 3CTLA 1AFSA 3NOEA 2HE5A 1LROA 3GR8A 3WLIA 2CBUA 2XVKA 3TTEA 4WY0F 3MSRA 3GC4A 1VEOA 3N13A 2ZZ4A 2DZUA 1GVEA 3ABZA 4HCLA 2G3FA 2B7NA 3EEZA 1QW8A 1H7XA 3K46A 4UTJA 3UP8A 3C56A 2Q3OA 3PZTA 3T0DA 1W17A 4FNRA 4I5XA 3AQUA 4J4KA 5FEPA 2FZNA 5E1QA 3CZGA 4O4VA 1V02E 1ZUAX 2A1YA 3W76A 2EBNA 9XIAA 4QGCA 4ZZ9A 3SCTA 2Z2UA 1RH9A 1OSEA 1TV4A 2B31A 3NO3A 4TV6A 3OODA 5BOFA 4HOWA 1DIKA 2BB0A 4ZOAA 1ICSA 3RCNA 4F0KA 2Z6IA 4M81A 4UQDA 4PGLA 3L4XA 1EX5A 1H41A 1P6WA 2Y6ZA 3WUEA 2PP3A 3DFQA 1P48A 4QHRA 3NDYA 3QPYA 4JFWA 3GG7A 3H2FA 4XG1A 4QLLA 1HJVA 1CDGA 1K8ZA 2UZ9A 5TD4A 3G22A 2R91A 4JCMA 3ECQA 3MCNA 4QEHA 1TWWA 3DESA 3S4TA 3KRSA 5BOOA 4B5WA 2NVCA 3P62A 4JTIA 3NQBA 4PB5A 4MLJA 1TIWA 1TV7A 2CLEA 4V15A 1IR2A 4MKVA 2GYIA 3WH9A 5DT7A 2EJAA 4HQVA 4S2CA 4WX2A 4UNKA 2A6LA 3WLTA 3T6CA 2OGJA 3EWXA 2O9PA 2P0IA 4QM1A 3W7QA 1YQ2A 1OY0A 1DWGM 4MTVA 3A3WA 1G94A 3GAKA 1RD6A 1HKJA 1POKA 3VNMA 2Z24A 2H8ZA 3O06A 3QY6A 3THQA 2BOGX 2RDXA 1HF6A 1LJYA 3DYOA 4TX8A 3CMGA 3RUBL 2E6AA 3PZVA 2GUYA 1R85A 3FW6A 1KQZA 3E0FA 3H2OA 4JPGA 2C1HA 4U31A 1XFCA 4Z2HA 1LP6A 1PX4A 1KFWA 2G97A 1K1DA 4R7JA 1O94A 4KPLA 2IXVA 1XRSA 4K37A 5FF4A 3UZ5A 4UQAA 4YVXA 4UMCA 2G4JA 2XTKA 2G3IA 4RL3A 1R46A 4ERIA 2A3LA 2VFDA 4O1EA 3AXIA 4XD6A 3W23A 1O4UA 2P76A 2ON3A 1C93A 4C90A 3HJZA 5HJYA 1J01A 1R6WA 2YPIA 4LH8A 1OYBA 2GDVA 2GWGA 4Z2GA 1CYGA 3ZO9A 1TPDA 1YNQA 5HMDA 3MDWA 3R13A 1XISA 1XWYA 5DMNA 4WXZA 2L5HA 4M82A 3UD6A 1UD5A 2VFHA 1E70M 1W8SA 5DMMA 3WLSA 3E74A 3SCUA 5KTLA 2WB5A 1SZGA 5F7UA 3HV9A 3CWOX 3TV8A 4ES4A 1LDCA 3IIXA 2W79A 3RF9A 1QW9A 3DC0A 2EJ1A 4WJXA 3N17A 4CD7A 3SSZA 2QULA 5IDIA 4JTQA 4WIWA 1I9CB 5A6TC 3HB9A 1Q3NA 3R25A 3ARQA 3HPAA 2DP3A 1GJWA 4H04A 3PTDA 3WLPA 2PEVA 4V2XA 3TLLA 1YNYA 4JIIX 3ZOAA 2YBVA 1S1PA 3W01A 1UR3M 4H8VA 2B7PA 1XD1A 1LQ0A 3PZQA 4PUWA 1JPIA 5K4ZA 4F4RA 2FZDA 4ZE4A 2Z1XA 3R58A 2NZLA 3CO8A 4UB9A 3N4FA 3C5QA 1S2VA 3URBA 3CIVA 5JH1A 1JFXA 1A0CA 2YL8A 5BU9A 3NOYA 2Z1SA 4U3CA 4H7VA 1M01A 2E6DA 1WCGA 3WLRA 1TZ9A 3KAOA 2RJHA 3NM1A 4KW2A 3WH6A 3HBLA 5H91A 3T0CA 2FH6A 3ATZA 4DYJA 3F1QA 3ONBA 1UZHA 2Y61A 2NLIA 1EJXC 2XN1A 3WH5A 4JFVA 1IXQA 3FA4A 3QGVA 4YTQA 5LNRA 5CPTA 3GBDA 1YX1A 1TWDA 3KBMA 3WQ4A 4NNCA 2OOGA 4LPCA 2VYOA 4LC6A 3U4FA 3W1XA 4HGXA 4AZCA 1C90A 3GK0A 1V02A 4HU0A 3GXFA 5F2GA 2YR1A 3CTTA 1ME9A 2JFEX 4JQ3A 1FWRA 4AYSA 3IVSA 4YHGA 1OYAA 4J3VA 4DRSA 4W9TA 2VGFA 3RMJA 3IAPA 3MKCA 2Z6JA 4XZLX 4NAEB 4PRWA 4BWLC 3OLDA 4ACZB 1H0GA 1PXGA 2XIBA 1FCUA 1Q66A 2WBKA 4Z1YA 3BV4A 4HOXA 3H7VA 4J3UA 3CQHA 1PDZA 2AL2B 3B0VC 3W2JA 2AQVA 1THFD 1OFAA 2QJNA 3HA1A 1NTHA 2H9AA 2ZVRA 2A2IA 1XLAA 2QCMA 2ZC8A 1FH9A 1DWHM 2QCEA 4MWAE 1QOPA 4QRNA 3LRKA 5E6ZA 2NQ5A 3DENA 2JQXA 4MY9A 3N2CA 2R8WA 3UGVA 4MB5A 4LTSA 4AIEA 2ACSA 1JGIA 1A5NC 3EA3A 1NFPA 4WF7A 3VMOA 3ZLGA 4PMZA 1XRTA 3W81A 3WK3A 1Z9AA 4DI9A 5CSRA 1JDEA 1W54A 1EL3A 4R9OA 4NI8A 3IVUA 4JR5A 7ODCA 5I00A 1UWTA 1BPLB 3ZT6A 3GVRA 4Q33A 1TKKA 3IK4A 4HSOA 3WBYA 1IYXA 4OV4A 1DORA 4S3AA 3FKKA 5CJMA 6REQA 3FGCA 3ZFHA 4YYCA 2BGQA 4HT3A 1DWAM 2J74A 4QJ4B 3VKJA 4XVDA 3LG3A 4CN6A 4C5ZA 1AH4A 4L9XA 1ZAJA 1GT8A 1LYXA 4JYDA 3TA9A 5GNZA 3LU2A 1KM6A 3AHZA 1ZU8A 1MXSA 1R3YA 1VHNA 3EKGA 2PUZA 1A5UA 1VAHA 4DPPA 1GKRA 1K6WA 3ID7A 3RPDA 3HG3A 3R2GA 4G5DA 3NYZA 2PCEA 1OC6A 2DZAA 4YHEA 2TRSA 2RUSA 4DNHA 4IJBA 3P5YA 2FHFA 1CGYA 3H8AA 4NZ3A 1W37A 4FHAA 1H0IA 4FXFA 5A8NA 2PC8A 4E3VA 3S47A 3GU1A 1XCXA 2BGSA 5GJPA 1ECQA 1YIXA 4DN1A 2WMHA 4BEUA 1PWLA 1E1EA 2WWDA 1CXKA 3AIWA 4A29A 2VURA 4O14A 1Z42A 4NSBA 4US5A 3E5PA 2HVOA 3AUJA 3CH9A 2PDYA 3M5XA 2RHGA 1GVQA 2F6KA 3LM7A 3QV6A 2QMKA 5CG7A 2WQPA 4MG4A 4NAFB 4CN1A 2G3NA 3P0XA 1UR4A 3L4WA 1KFEA 3UG4A 1XBYA 3EDEA 1LL4A 1RJRA 1AD1A 3JR2A 4A8IA 4R5EA 3ARWA 4ORIA 1JQVA 5HUOA 1MW3A 1UPPA 3E0WA 4J9JA 2NXGA 3W7KA 3A13A 2ZWYA 1TJ2A 4W5ZA 1TZZA 3RR1A 1H1NA 3T78A 4EF8A 1UD8A 2FTYA 3NYDA 3TC6A 2YCJA 5BU6A 5GVJA 4GLEA 3GVWA 2XWDA 1VRXA 1YE6A 3TLQA 1RCXB 3U0HA 3UJFA 2OT0A 1E6SM 1VJSA 3LTPA 3UVIA 1XIDA 3KOFA 1X6UA 4ZQOA 4CD8A 1ZJBA 5LSMA 1GW9A 1AK5A 5AC7A 3RPTA 3L2IA 3GLCA 1H63A 3CUJA 3GE7A 4JICA 4PZVA 3L4UA 4ZXOA 5CBJA 1F3TA 1GHSA 4JIQA 4IIHA 3POHA 2G41A 3EKZA 5G1TA 2QR6A 3DI1A 4GK8A 1QHZA 2CLPA 4B3KA 2CLIA 1JIBA 3ONCA 4MZ8A 1SZRA 3QZ6A 4IF2A 2J27A 1LLWA 3OPSA 5HDRA 1DQXA 3CWHA 4HTYA 3AXHA 3OIHA 3HOJA 1GG0A 4GGHA 4QXIA 5CBIA 2KZHA 5D2TA 1W1ZA 1Z48A 1GYNA 1RY8A 2ZX9A 4NT0A 4H7CA 3MU7A 1QHPA 3G1AA 1JZ7A 1GUVA 3WF4A 5BMWA 5DCEA 3TJIA 4A2RA 2VNCA 1N7KA 3Q67A 3OEXA 3NA8A 1F2JA 4IPNB 1OX6A 3RHGA 3M0ZA 3GSMA 1E9LA 4MWAA 3STGA 3HFYA 4GC4A 4XZIA 1A5KC 3OA3A 3MVTA 5SWUA 3Q58A 1FCQA 2Z1WA 4JTCA 2J6VA 2TYSA 4C1NB 4H9MA 1G6CA 2VC6A 1XLGA 2INEA 5CQ1A 2J4GA 2ZZ7A 1OVDA 1CT5A 1W9BM 6XIMA 1OF6A 3M07A 1UR0A 1BRLB 2DSWA 1QATA 3VKAA 1VFLA 4OVXA 2ESCA 1OCBA 4AAJA 3EX3A 3ITXA 1C8VA 3C2RA 2XIIA 2ZX5A 1V6YA 3CYVA 3I4EA 5F4SA 3HO8A 3B8TA 1X1ZA 3R8GA 3E1F1 3TJLA 4MJMA 4UQ9A 2OO6A 3CQJA 4MPQA 4DHGA 4LXFA 4XISA 2VEGA 4B3LA 5C6MA 1OK6A 4QS5A 2WW5A 2HVMA 3A4XA 2A0NA 4LY4A 1DBTA 1HGWA 4PMQA 4JX4A 4GYJA 1TO3A 2E1DA 4BCEA 4KEZA 1C9WA 1WDDA 5AECA 1Q7MA 3C0JA 4BK9A 1VP5A 4E2BA 4DUWA 4D1JA 3AISA 2LLEA 3V0TA 2ZRYA 1LORA 3PULA 4CQDA 3KTSA 1DV7A 1UJQA 2AAMA 1VBUA 1JDDA 3GX9A 4MJ2A 3B8DA 4FXSA 3RO8A 3KBVA 3N04A 2IUZA 3MUAA 2JGQA 3VKDA 1JRBA 3ITYA 4HIBA 1O68A 1FCBA 1XLIA 3B9EA 1P1MA 2UY4A 3O6CA 1HQTA 5GJNA 4D72A 3LTYA 4DJED 4NAEA 4JFUA 2J62A 4ACZA 4Q6JA 2CEQA 3CNYA 3ANYA 2NUYA 3WBWA 5T9CE 4LFYA 5TAOA 1NDVA 4NVTA 5ABGA 3W1RA 2AL2A 2VEIA 1I0BA 3QMSA 4YNGA 4GIEA 4JTHA 4JKLA 3MHFA 4XVEA 3GTNA 2ODOA 1YKWA 2C19A 3H70A 1MXDA 3BO9A 3GH7A 1VRDA 3IWPA 5M1TA 3L4YA 3W7JA 2FKPA 1TPEA 4GIAA 3FNDA 3DH7A 1OZQA 1B0IA 1U22A 1UH4A 1W3KA 2OWWA 3URQA 3T8LA 5I23A 1RALA 2DZWA 4EVZA 3MYOA 4NF7A 2Q09A 4IUGA 9XIMA 2OVLA 1U30A 1UC5A 5CGQA 4NRRA 4Q8TA 2GGIA 1EGMA 2OPJA 3MUY1 2ZXQA 1OIMA 4AB4A 4HN8A 1UMLA 3TONA 1RR2A 3OJGA 3TDFA 1EXPA 1VPXA 5K9XA 4HNTA 1W5MA 4PH6A 3BDKA 3LGEA 5XIMA 2DSUA 2VCAA 3EKLA 2WCGA 1LLZA 5HQMA 4GG9A 4REQB 1W2VA 5LHFA 1JAEA 6TIMA 2DZSA 4IHCA 3FFSA 2YB1A 4LBRA 3VMPA 5XIAA 4S3DA 4W5UA 3TIMA 3L0NA 3QPZA 4Q22A 4OBSA 1CECA 2VFIA 5E9XA 4GYPC 2C91A 5D04C 2PDMA 5FJPA 2DDXA 2J6XA 4HZ8A 4W84A 3W7CA 5CAKA 2E5BA 2X05A 1E0XA 5CLTA 3TX9A 4TUFA 3RLHA 2DU2A 2GVGA 4B9YA 2OG9A 3APTA 1G69A 2Z28A 1TUXA 3H22A 2E8ZA 3BZGA 3CBWA 1OFBA 3VE7A 4AD2A 4Q8WA 4HOZA 3HF3A 3FAXA 4XO7A 3WF0A 2F6UA 4AC7C 1GQLA 2ZCGA 4OV9A 4LRSA 3EOSA 4MPKA 2RAGA 4MY1A 1SFTA 3PTQA 2W92A 2QJMA 3LRMA 1W1TA 2PDPA 3BAWA 1VBJA 1JCTA 4B5XA 4HSNA 2E0PA 4ECLA 1E6ZA 2VQTA 3WG6A 3VZYA 5A6BD 1KFCA 1EFZA 5EMYA 3PZUA 3ABQA 4CQ8A 1AL7A 4UTHA 1T40A 1PJ9A 2P1FA 4U28A 1IXOA 1I2RA 4TOQA 3G1VA 3A12A 3BG9A 1P0DA 3QV7A 5AYZA 3KCLA 3DECA 2GFTA 4FNSA 1IEIA 2EPHA 3L2MA 1V3LA 3KZPA 4H9VA 4HCDA 4MOZA 4Q3MA 4DBEA 1BGGA 1UUOA 1S2UA 1POJA 3E0IA 4LX4A 1GPFA 2R14A 3BGAA 1ITXA 3REQA 3S6DA 4J2MA 3R0UA 1V0KA 1LL6A 3PUOA 3GH4A 1B57A 3HPXA 5L6UA 3G1YA 2VUNA 5FL0A 2ZDRA 2PWEA 2Q71A 3W00A 3UG5A 3VKKA 3W75A 3VM5A 4AIUA 3GR7A 4Z08A 3IGXA 1I2NA 3BCFA 1UR8A 1K77A 3D0CA 3QHNA 1Q63A 2YOCA 5KZ6A 4UFKA 4CNSA 4O11A 2Y5JA 3CV1A 1MFVA 5A6JA 1B2YA 1WKEA 1PAMA 3VD7A 3S1VA 3CIXA 1ONWA 2YXOA 2DZPA 1R0MA 3B8IA 1B3XA 1R7OA 1MQRA 4LBSA 2H3BA 2O9OA 2NWSA 7REQB 3LERA 1VZWA 3UXIA 1JF6A 1W8GA 3SCWA 1J5TA 4XUGA 1ALDA 2A4AA 5J04A 1PZ0A 4K68A 4JEQA 4UCGA 3EWWA 4Q8VA 1HJQA 1D8CA 1TMHA 1XH1A 4IMGA 3GXIA 1DYSA 3AICA 4ZQPA 4W7WA 3KBJA 1BKSA 3H53A 4L4MA 4WXYA 1PTGA 2QUNA 4O28A 2PWGA 4D71A 1RLCL 3NGFA 1BRLA 1WDWA 2WAGA 4A8RA 4EXBA 4JQ2A 4M5PA 1TE6A 3FDGA 3UG8A 3RCMA 2XWEA 1HIZA 4O4WA 4DNMA 3F4WA 4A3RA 5KZEA 3RAOA 3U7VA 2E6YA 3IJ9A 2E77A 1LBFA 2GUBA 3TQKA 1GQJA 2C7FA 5BYWA 5A8GA 1ONRA 2I56A 1GTEA 3VA8A 3KZSA 4BF9A 3LX9A 4AYGA 1JYXA 2RH9A 1VLIA 1VC4A 1ZLPA 5DEZA 1EP3A 3T05A 1PVNA 3GHTA 3QYSA 4AF0B 1X8FA 4CD5A 1SJAA 1ZCCA 4UTIA 3SSJA 3QVQA 4L6HA 4H8NA 4BI6A 1AH3A 5F2IA 2QUUA 3CV2A 1JYNA 3ZQ9A 2VC5A 4KQNA 4DAIA 2O7SA 2YFOA 3HN3A 5I3KA 3UY7A 1TCDA 4GC3A 5LNWA 1AUSL 3CPUA 3CPGA 1XYMA 2A3CA 3KXQA 2AGKA 1MEIA 3KDOA 4W7VA 1TJ1A 5C9RA 1FWDC 5K9DA 3KOYA 2ZDSA 1EDTA 1TWZA 2FZMA 4XAZA 1SFLA 2HTMA 2WC3A 3ITLA 3QSTA 2VR5A 5HNUA 3T42A 1UWRA 1J0IA 1K7XA 3GTHA 3C2YA 1X96A 2ZXDA 4LGXA 4GJJA 1ITQA 3NG3A 3HGJA 5C71A 3L2LA 3UF9A 1QU4A 2G4FA 3QZAA 1QHOA 2NW0A 2BTMA 5IHRA 3PPGA 4JHMA 4A21A 3LGDA 1I2QA 2XU2A 1UC4A 2ZKMX 4FK9A 1FDZA 3VNJA 1TQJA 2YIHA 4I9JA 4IP7A 3LXAA 3MKKA 2V5DA 4PTNA 2HQAA 4XWUA 3KVLA 3T8QA 5BMXA 1XLLA 1F8MA 3TNOA 2WSPA 4JYEA 1VIWA 5C54A 1B3VA 3EMQA 1S5WA 1WV2A 3NQ8A 5LNUA 1F4AA 5E0KA 3GUGA 4UMAA 2ISWA 2C0AA 3TSDA 4QDWA 3P0WA 2E68A 2QPUA 4LOCA 1EA9C 3MO7A 3RX4A 2VZTA 4DJEA 3TZFA 4W7UA 2PDNA 5A6LA 1ESWA 4DF1A 1A5BA 4AMCA 3JW7A 3KL5A 3NQFA 2EPOA 2B4GA 2YA1A 1M1BA 1HL2A 1FWJC 3UWEA 3CUGA 3MW7A 1EJSC 5CPMA 3IIVA 4JTUA 2HS8A 3A21A 5AHMA 1AW2A 2GJXA 3D5HA 1ISZA 3UJEA 2H3DA 2X30A 2VX7A 2DORA 2GPTA 4AZ6A 1I60A 3LK6A 4MJ4A 4WSKA 3W85A 3EB2A 1BVWA 3AIRA 3WQ8A 1WA3A 2V63A 3OZOA 5EB8A 4Z2JA 4AHPA 9RUBA 2W63A 3VZXA 1FY6A 4HMCA 2ISVA 4JNZA 3O0KA 4BEQA 1PUDA 3BSMA 4JFTA 4A8LA 1LUCB 1BVZA 1GVFA 2O4MA 2Y8UA 4DWSD 2FMOA 1M7OA 1TV3A 3TAKA 6ALDA 3EB4A 4PSPA 3WLQA 3E3HA 3Q65A 3LQLA 1DWIM 1UA3A 1E0UA 3KVMA 4GVGA 3LPOA 2XZ7A 3M0VA 2BY0A 3ICJA 4CUCA 2WYSA 2J7DA 4Y9NA 4C5YA 3W7IA 3GVQA 1NIUA 1UYQA 4ICNA 4DI8A 4P7RA 4KWSA 2EKGA 4RW5A 3PS7A 4FNTA 2IQ0A 4AX7A 2V8ZA 3HGOA 2C1GA 3U4AA 4Q4RA 3GXMA 4NZJA 4W85A 4HZMA 4NZCA 3S5OA 5K9CA 2O9RA 4CGTA 2VEFA 2VDIA 6A3HA 2GOKA 4UUIA 4LUTB 5JU6A 2J9XA 3TWAA 3CHCA 3L21A 4N4QA 4FI4A 4DWSB 3TMQA 1U5VA 2X42A 2YA2A 3W82A 1KBIA 4HMDA 1QK0A 4WDTA 4C6FA 4ROPA 2BG5A 1HJSA 4MLRA 2HBXA 1ENUA 3CZJA 4UOZA 4I7UA 1VD6A 5CGTA 1EJ7L 4QITA 2CLHA 3ABXA 2NUXA 5GNXA 3S2CA 2Y7FA 3MC5A 1K4HA 1OFOA 1RXOB 3DHDA 1LT7A 3G8RA 1E6NA 4V33A 5AB3A 5EU9A 4WKAA 2X41A 4DWSC 3NXLA 2B81A 1RD5A 1PL9A 1RK6A 4TV5A 3VINA 3WQWA 3WNKA 4TIMA 4AH7A 1BF2A 4W8LA 5EKYA 5I3DA 3ZMRA 1XHGA 2CBVA 1S2TA 2J24A 1FP8A 1R3RA 4I8YA 1M5WA 5A6BA 2BXVA 1E73M 1RVKA 3BMVA 4N02A 1GZJA 1UH3A 4XZNX 4BQ5A 3RJXA 3VFLA 3KBSA 4LNCA 4IFOA 3KCOA 1N8IA 3OGSA 3TN5A 1PKLA 1OM0A 1X6LA 4Z0JA 1QNOA 3ZZ1A 3L23A 2PP0A 5BZAA 1OD0A 1SO3A 3AU2A 2HISA 1GW1A 5DF0A 1GOIA 1PZ3A 3CK5A 3HQNA 3ZM8A 2XIOA 1NAL1 3KTXA 1IZCA 3EWZA 2J8TA 1JVNA 4PB3A 4JS3A 1LRTA 3HQOA 3N9SA 2HBVA 2BY3A 4H9ZA 2G3JA 3BAJA 4UQEA 1QO5A 1XG4A 1PB0A 3VNIA 1HKKA 4EK7A 4B2DD 1VH7A 5HJLA 3TW7A 2WMIA 2YBUA 4OUIA 4ZQMA 3KRZA 4C6BA 3KWSA 7REQA 4AX6A 1B9ZA 2P50A 4NHVA 4CVWA 1FP9A 4L4PA 3GTFA 4A6GA 1V6UA 4U33A 1FHUA 1MUWA 4H6QA 4A35A 3NVTA 3QSRA 3QHMA 2V5KA 1HX0A 4YJ5A 1NVMA 4IX0A 3N3TA 1Q4WA 4QDPA 4G7FA 3XINA 2HPMA 2C14A 1EQPA 3W28A 3UWVA 4M6VA 3VNKA 5FJIA 3NPXA 3WL1A 5FF2A 2WHKA 2HNEA 4QLKA 1TRDA 3T81A 1FWCC 2VGIA 1E6XM 2OJPA 1H51A 3T40A 1XIMA 2ATSA 4HN4A 5LIKX 2VR2A 5DBUA 1F6PA 1XIGA 3O6AA 2PGWA 3QFEA 5C5YA 1A0DA 4PRRA 2YX0A 3W2KA 4QNEA 2D3NA 3AUOA 1FWNA 3T07A 3NDZA 3LI0A 2PLKA 1VBHA 1PIFA 2E3ZA 3LHYA 2V0TA 1XG3A 3RK8A 2F2KA 3W1LA 4ERGA 1R3TA 1AQFA 1KD0A 1YHTA 2V3EA 1XXXA 4FX8A 3LCFA 1KCLA 4ZBCA 4OOZA 5BROA 3BAIA 1TA3A 2V38A 4I9AA 3M64A 3RJYA 2BOFX 2YCEA 2V82A 3SRFA 1FFQA 5E93A 4URIA 2ZA3A 4MFEA 5JBDA 4IJRA 5FA5A 2B0MA 1JYWA 2VEKA 4LYKA 4BF7A 4ADTA 2J88A 5IFTA 1K8YA 3OHIA 2Z4GA 2E5DA 4D6FA 5A6AA 1IXNA 1QNSA 4ZVJA 1P0BA 3GHSA 3COTA 3OTRA 3EWDA 3PUDA 3VIFA 1A4LA 3NQ6A 1JXJA 1OYCA 3B3DA 4KCWA 4QJ5B 1LT8A 3B40A 3T7VA 2BY1A 1XLEA 3G6LA 4F2UA 5I09A 1FDJA 5I7GA 3E02A 2EPLX 4HU3A 3TCSA 5JUVA 2QT3A 4K36A 4E38A 3MUIA 3H7RA 4YYFA 3CZ8A 1VCFA 1JCNA 1EGVA 2BDQA 2E1WA 2WHJA 1ZCOA 1TCMA 4YLWA 1K9TA 1YW1A 4G8TA 5I3HA 3FA5A 1H2JA 1J12A 1X38A 4KFPA 5C0QA 1SJBA 3TJXA 4OBRA 1A4MA 3HM7A 4ADUA 2YKKA 2OZ0A 5LIXX 3W2UA 1P0NA 1A5AA 4P61A 1QNRA 5E0FA 1ZSXA 3CEPA 5D9OA 1EJTC 3M4HA 1J4EA 3VU2A 2DGAA 1C8YA 4RKAA 1OCNA 5I02A 3N29A 2QPSA 3A4AA 3FEQA 1ICPA 3WQ6A 1E55A 5JH2A 1XSJA 4GXWA 1EX1A 1E4IA 2PD9A 5CBBA 4AD0A 1R3VA 2D2HA 3LTSA 4OZOA 1ZGDA 2TSYA 3PG8A 4KEVA 3DHPA 4Q7NA 1CXFA 1ADSA 4GIRA 1U2YA 1S5MA 3PPHA 3U8GA 1S5TA 4ZO7A 4AHQA 5TBOA 3GYCA 4FLOA 1JCYA 2P8BA 1DWJM 3E2SA 1JULA 4LVGA 1FH7A 3R79A 2TAAA 3IRSA 1CEOA 5FJUA 4H41A 3MMDA 4HHLA 4MB4A 3A5FA 1US2A 5HMEA 2ZUUA 1TPC1 1WKYA 1A50A 3G1HA 3W7MA 4LC8A 2CBJA 4N9CA 2V5LA 4UZSA 2IW0A 4A3YA 1BSIA 4LUIA 2HXTA 3LI1A 3HIJA 1VBRA 3TJ4A 3F2DA 2IKHA 4Q32A 1A5CA 2F61A 3STCA 3PAJA 4HYVA 1CBGA 4N7QA 2OLHA 3LGGA 4LU0A 4LS1A 1F4HA 3I6RA 1UQZA 1J2WA 1X6NA 3VGGA 3M46A 4KCVA 4BQ3A 4AQLA 2ASHA 5BXSA 2JEQA 2ZVIA 4N0RA 2Y4SA 4LUTA 3Q2DA 2KX9A 1L6WA 2GK1A 5CJ5A 4DWSA 1ZJIA 4JCLA 3PAOA 3TTOA 5BCAA 2ICSA 3UESA 3TWBA 5E5CA 3KEHA 1Q6QA 4M6QA 4K7VA 1ZBKA 2ZZ1A 3VO0A 4JGDA 4JN8A 1SZEA 4XBKA 3MV11 4Z1BA 2Y89A 4QJ3B 2VL4A 1TTIA 3FDKA 5H8UA 3TYCA 3NPVA 3L4ZA 1SU5A 3BW4A 1MI3A 1CGXA 4OBTA 3RIKA 3SM0A 5J5DA 4I6KA 2CBIA 3W53A 3GG8A 2RGMA 2X0HA 4Z2KA 2QV4A 2EPNA 1TYGA 5BRPA 1R7AA 3A47A 4QLJA 4UTWC 2FHCA 4UFMA 3SW6A 1Q8JA 1PCKA 1OFEA 2ZRUA 3BJSA 3KLKA 1Y8BA 3WNMA 3VIHA 1CWYA 5D9PA 1QK2A 3P93A 3TC7A 4LJ3A 3PK7A 4FLRA 3QHOA 4F0RA 3KUMA 1OCJA 3G1FA 1YE4A 3UEQA 2PBOA 4HU4A 5IOBA 2PBGA 3LV5A 3THAA 1GYMA 1XLJA 5HPCA 2NXHA 4EXQA 3CL8A 2J7CA 1XBVA 4BI7A 3I68A 1W32A 2X2YA 1J0JA 3AJ7A 1KQYA 5I3JA 3MSYA 4H6RA 1P0KA 4ZB5A 3ENLA 3M0IA 1CLVA 3NTYA 3IANA 4BHYA 1GCYA 1QBBA 1H7NA 2EXOA 1BQGA 2QDGA 2ZX6A 3UA4A 3AMCA 3H7UA 1Q6EA 4IJCA 2G0WA 3M5YA 3T1GA 1I45A 2YGYA 4ZFMA 2X16A 1UUMA 3APGA 4WHBA 4ZQRA 2A3BA 1NOWA 2AQWA 2YLLA 1AJ0A 4HK7A 2ZUTA 3WQFA 3K4DA 3B05A 3LUTA 3MSDA 5CPQA 1JZ5A 1MRQA 3MP3A 1ZENA 4TVUA 3MPGA 1G5AA 1K3UA 4H3DA 1QWKA 2UY2A 1GGOA 4GGBA 3NWRA 4A05A 4IQEA 1R2TA 4NILA 2XSBA 1OF8A 2Z2AA 2Z26A 3HZ3A 1GG1A 4B3ZA 4X3ZA 4H8UA 3S2JA 4TR9A 5FJJA 4BQ4A 4B5UA 3PWGA 1RJQA 2CFFA 3OQ8A 1C92A 5DRCA 3GYEA 3UZWA 4FEZA 3L12A 4KF1A 3SQSA 4HPJA 3ANUA 1QNQA 3RMEA 1V3KA 3TH6A 4DO7A 3S6OA 1W9DM 2CHNA 5EA9A 1KBBA 2GVLA 1VLWA 1I1WA 1Q6RA 3EEGA 1SQ7A 3E96A 5U7SA 3LCLA 4CN4A 3SCPA 1KXHA 1FFRA 4XKYB 4TMCA 4OKDA 5LNSA 1R9ZA 3NZGA 3WK0A 3GDKA 2RDUA 4GX9A 3U9IA 4Y9OA 3SUUA 2PGEA 3FY1A 3RM8A 3UZXA 1X1OA 3O3RA 3IARA 3PUGA 1K9EA 4JTRA 1HJWA 1XIBA 3AXKA 5E0CA 4JNMA 2G96A 3ISIX 4WRHA 4EXAA 3SY8A 4CU7A 4L9ZA 3BG3A 4GVIA 3RDKA 4MUPA 4N9DA 4ZQNA 3WF1A 1J2BA 4UCFA 1S1RA 1F8IA 2GJPA 4U3AA 3TA6A 4HMNA 3AJXA 2BFGA 2P10A 4YU1A 1KTBA 4KCTA 3R10A 2CC0A 3E0LA 1NDZA 4DXXA 1W3TA 4B5VA 4LCRA 4CNTA 4ATWA 3C0SA 3UFYA 4RZ4A 3PANA 2VD9A 4IP4A 3UJSA 2A21A 1SVDA 5E9AA 1QNPA 5T26A 3S1UA 3PSWA 2HDJA 3N6QA 3WIJA 4F66A 2V3FA 5F1UA 4PYSA 4GY7A 1XI3A 3V5CA 4KERA 4IQDA 1LBLA 2Q01A 2VFFA 2D23A 4LALA 1BXCA 3QRHA 2ZUMA 4PUEA 4YIWA 3OBEA 3FCPA 4AUBA 4E5TA 2JF6A 1RQBA 3HJEA 3B8UA 1JZ2A 3TQVA 1PX3A 1FVPA 3B03A 1EJWC 2QCDB 3AC0A 1PTAA 1EGZA 2YB4A 4FF7A 4NG3A 3RYSA 1HKMA 1GVYA 3FXGA 3K1GA 5M2FX 3VGFA 4EP8C 1MW1A 2C3ZA 4J27A 1KFBA 3ARXA 3CAVA 4JD4A 3PR2A 2HMCA 4JDBA 1TWSA 2J66A 4OHQA 5J8LA 1M03A 3T4CA 1AMKA 4Z42C 2YCKX 3TTYA 4PTMA 2F9RA 1T0OA 4I9MA 3QOKA 3O63A 4RZ6A 3CEUA 3TR9A 4GMEA 1RVGA 2HCVA 1JDFA 3W1MA 1N55A 4GE8A 4O0KA 1Q2RA 4GXPA 1JXKA 3W27A 1FXQA 3LM3A 3KOZA 4EPBC 1XS2A 3S1WA 1DOSA 4Y6GA 1OGBA 4CU8A 3CASA 1GJPA 4Z1CA 3HV8A 1JRCA 1RQEA 3G77A 2RKXA 3HTWA 1A80A 1HFBA 4RUBA 3WJWA 4Y2WA 3DFHA 3TQPA 3WMBA 4DJDD 4DZAA 1V7YA 4LCSA 3DFYA 2Y1HA 3TYUA 5C9XA 2OGYA 3BARA 5E70A 4ZEPA 2GGEA 4LS0A 1I2OA 4CEXC 1EEPA 3DGRA 5AYIA 1WOBA 4C7DA 2PDGA 3BLLA 2YJQA 3NUKA 3NO5A 5A3HA 3PWAA 4RNFA 5KZMA 1P1XA 4FAMA 3W71A 3K1DA 3VZZA 1FHLA 3S2MA 2QKFA 1KV5A 4PMRA 5DX7A 3S2LA 3BL3A 3GNPA 3I7QA 3FS2A 4OWGA 3ZT7A 4PR4A 3KX6A 3I3EA 3GDBA 3Q94A 3E2QA 4UFLA 4I90A 3SY5A 3PZOA 3DFNA 6PTDA 1S5VA 5HQEA 4ML9A 1E3XA 1XFBA 5HWNA 5FOOA 2Y5EA 3OHMB 2YFNA 3R8HA 1P0EA 3QQ1A 3WBEA 2WZMA 4XZMX 4Z2LA 4XAFA 5LA0A 1RA0A 2XYLA 4FSAA 3TKFA 1SZFA 2YZ5A 4LF2A 4C6IA 4YN5A 4LANA 2WC4A 1RBOB 2PLMA 1US3A 1VFMA 3PTKA 3TTSA 3AWNA 4U10A 3GNDA 1TTQA 1UQYA 1L2UA 1BXNA 4HZ7A 5C2XA 1EIBA 1XM3A 3EYPA 4Q8NA 4DJDC 1ZP4A 1QO2A 3UCQA 1DJHA 2QAFA 1UD6A 2Z1KA 4GISA 1QJWA 1KGXA 4NP7A 2JKEA 3URNA 2FIQA 1BD0A 2DFAA 2V5CA 4E4FA 3DIPA 3WDJA 1FKWA 4PCPA 4RDZA 1HG3A 3G0SA 3FEMA 2WKJA 3W1QA 3TNBA 1W1VA 4PMNA 3LS9A 2PRLA 5DQPA 4RDVA 3EAUA 2CESA 2A3EA 4GD0A 3BLIA 1FTXA 4B4FA 1EOMA 1ZBVA 4LEQA 3M41A 2PDJA 3PBGA 1B30A 3S46A 3PNUA 3BOFA 3LHZA 1ZZMA 5D30A 2C6QA 3LOTA 3AZSA 1MFUA 3W3OA 2J7GA 5KZDA 3WQGA 5CEWA 5AOUA 1UB3A 3L66A 3VIMA 3JS3A 4FNUA 3GVVA 1EH9A 4JIHA 1ME7A 2YLAA 3C61A 2GUUA 3CT7A 1NWTA 4LAOA 4KS0A 5H2ZA 4M51A 2PU0A 2ZUVA 3F2BA 3PZGA 3VD3A 4Y9PA 2XH4A 4S3GA 2I14A 1F7BA 4WVXA 1KC7A 2GDUA 3CPRA 1Z41A 3R4IA 1P43A 1OBAA 2GL5A 2W5FA 2G3MA 2WJFA 3LY0A 2WOQA 1UR9A 4KETA 3U6WA 1JZ6A 4NJKA 5FJTA 2XHYA 1B4EA 1U1UA 4GFIA 3KP0A 2ALRA 2F8QA 3LZ5A 1BTMA 3W6YA 4HHHA 3W1PA 1V3JA 4YCOA 2X7VA 4F2BA 2IQTA 3TC3A 1VKFA 1EWEA 1YNPA 3WLHA 2DZTA 1BYCA 1TE1A 2E4TA 3WYZA 1BWLA 3W29A 4I5RA 2GWNA 2QDEA 1A0EA 4CU6A 5BRQA 2XN0A 5G2HA 5GJMA 1LWJA 3KDNA 4AZGA 3N18A 1KLYA 4GYKA 4K8HA 2QEZA 1QI2A 5I03A 4RDYA 5I78A 4HNCA 3R12A 4H9TA 4AZ5A 3OIXA 1J11A 1QI5A 1L8NA 4DM1A 1PZ1A 4OECA 1X7IA 2ZRXA 2NXIA 2BASA 3ARRA 4ORMA 3NSXA 2WKLA 4FX6M 4P5UA 4NZ1A 3STEA 2F7FA 3GIYA 2EKCA 3DI0A 1CIUA 1YADA 2VOMA 3NPUA 4XAGA 5DRIA 4YPJA 2XGIA 3QQ0A 1ZBWA 1TX2A 4EAYA 3M16A 1XIJA 4O8AA 5LYRA 2GSJA 3K8MA 4XSLA 4Q4SA 2VMFA 1Q2SA 1NDYA 3ITTA 2OT1A 5HATA 3IGSA 1J96A 3ELFA 4PUMA 5BXPA 3NO1A 4GBUA 1P6CA 4DELA 2D1ZA 1NF0A 2G5WA 2J77A 3MO4A 3LHWA 3LYEA 1WUEA 2IQDA 3VVGA 1YPFA 3KCJA 3ZJKA 3IJLA 1F05A 2XIJA 5AVNA 1QPKA 3KLLA 4FO4A 3GW0A 3W6LA 4DX3A 3H54A 2GJNA 4XB3A 2QCDA 2J9YA 1S2AA 1MRAA 1HO4A 2ZUNA 1GVSA 1OABA 4IMCA 1XIIA 4YTUA 3GM8A 4S39A 1X8CA 2QXWA 3TOPA 4QBXA 4IP5A 3MI2A 2PTWA 1K7EA 2PC4A 2WSQA 4LYRA 1OWQA 1IHIA 4R53A 4IMDA 5FJRA 2G37A 1Q6OA 3I6EA 3W70A 1G4PA 3FGCB 1IGWA 4FXRA 1I1XA 5HR6A 3AS0A 2CITA 2ISSA 2DVUA 1E51A 3SUWA 1TPVA 1KWKA 2QQ6A 1XIHA 1KCKA 1R9XA 2HSAA 2PRHA 3WH7A 4OUEA 2INFA 4GY0A 4HA4A 1G7UA 4HK5A 4US5D 3NQ2A 4NIRA 2PGFA 1ADOA 4GWEA 1DE6A 2W4XA 4AEOA 3F2CA 2PTZA 1VHCA 2HV5A 3GD6A 3H4GA 3BLKA 1PV8A 1UD4A 5IM51 4L65A 2J7BA 1SW7A 1M53A 4KRTA 3GO2A 2XH2A 2A6NA 4M7SA 1FWBC 3B04A 3SECA 4C6OA 4PEKA 2JF7A 3NL5A 1OG6A 2DPEA 1NP0A 3OOQA 3MCOA 3KS6A 4XAYA 3O7UA 3WX7A 1W6TA 4GZJA 1UD2A 1HKWA 3CL7A 4U2YA 1Z69A 3W74A 2SFPA 1OGGA 3IUDA 3SBFA 1RJPA 3WQPA 4S2BA 4D6HA 4WQ6A 1O5KA 3I6TA 1XLMA 3P14A 3NVDA 3JRKA 1HKVA 1HT6A 1ZALA 5D09A 2X1IA 4R88A 1S2WA 3DG3A 3C6CA 3TN4A 2D2OA 3GFXA 1IF2A 2DEPA 2EPMX 3SRKA 5IFPA 3ZS4A 1R47A 3FX4A 1B90A 2OODA 2O55A 5CZKA 5K2ZA 4IMEA 4WOQA 2E40A 2PDFA 1O66A 1SO6A 1UD3A 3A9IA 3VAVA 4MM1A 1BSLA 1EQCA 2D0FA 3VGHA 3ARZA 4DJDA 4WY0B 2VGBA 4UFHA 1UWIA 3GNXA 1RAKA 3LQGA 5JBEA 2YDAA 3UXDA 1GJUA 3WNOA 3CWNA 1SO4A 5FACA 2O7QA 3ZR5A 4DAFA 1ZQ5A 2BHUA 1SZNA 2V3GA 2JKPA 3QW4B 3WLOA 4EIVA 1K02A 3M0HA 4KIEA 5F4XA 3PJTA 2PWHA 2Y8VA 5DXYA 7TAAA 1M65A 2W9MA 3OBKA 3H55A 4RNJA 1QNVA 4IIGA 1EEXA 4QDMA 3HURA 4J3XA 2PWDA 1OFPA 1IWPA 3WDQA 1XYAA 1BXBA 1NEYA 4XD5A 2XFRA 3H2EA 3CUZA 3A24A 3L5MA 4UTUA 3E12A 2G8ZA 1R86A 3QZEA 3VOHA 4KWOA 5EMUA 1BYBA 1V8EA 1DJQA 1QPOA 2X8RA 2Q8ZA 2BHYA 4ZOBA 1JUEA 1PIGA 4MWAD 4GI6A 1KRBC 2VVNA 4V28A 4TU1A 1DJNA 3WZ0E 1R2SA 3GHUA 1PTDA 2WVUA 3JU2A 4A8NA 3NGJA 4O0QA 2OQLA 1UBPC 4J3WA 4M6UA 1FBAA 5AHIA 1C3FA 3VTRA 1FWIC 3T0TA 1KNWA 4CVUA 4MIMA 4MAVA 3TU9A 4XSMA 4IT1A 1TVLA 2X0YA 1Z7AA 2IMRA 4IOTA 3VDBA 4WKHA 4ZTYA 3GDRA 4GNVA 2QVHA 3W7DA 3TE9A 2CLKA 3OO2A 3WD1A 1WZKA 5DMYA 3UY8A 2ZWZA 4MWAB 3BGJA 3THDA 2W0UA 2UV8G 1VFOA 3LMYA 1RP8A 3AAMA 1HP4A 1EBGA 3VDGA 4YXGA 5FSDC 3AMKA 1UIPA 5AY7A 2IPWA 2QCGA 3GH5A 5G4HC 2AOSA 1W5NA 1E15A 1ODUA 3S1GA 1RBLA 3D3AA 1XH0A 2I5GA 2OMAA 4MWAC 1TG7A 4D6CA 4H9YA 4D9PA 5D2YA 2R1KA 1W5QA 1B4KA 3FYYA 5KEZA 1KKRA 4IX2A 2QGHA 2OZ3A 3P2VA 2HXUA 3TCEA 2QCNA 4UNLA 4W4QA 2D2JA 2PP1A 4XAPA 1RPKA 4JYFA 4LAMA 3F5KA 5HINA 3WDHA 3EWCA 2AKZA 2WXDM 3W2NA 3IIPA 5I24A 2ZFAA 1PHWA 1XH2A 3M6DA 5DY3A 1JCMP 1V0NA 2O9TA 3VE9A 3NSNA 1FWSA 3CS2A 2WNWA 2Q6ZA 4GH3A 1ZS2A 2CW6A 3EOUA 1XUZA 3W24A 4NY2A 1S2CA 4OT7A 1C91A 2CU0A 2EGZA 5AN7A 2WSRA 2BX7A 1XL9A 2VP8A 1M3UA 2UY3A 3WELA 4RCXA 3UERA 5D33A 4IFKB 3PVFA 4OTKA 3IACA 3C2FA 5IRPA 1LWIA 3ES8A 1I2PA 1UZDA 2I57A 3QLDA 4X9SA 4FA3A 1EOKA 1UZ4A 3N2MA 1KRCC 3VNYA 4D1IA 1HL8A 1YDVA 2HVNA 3KHJA 3MA8A 1N2VA 3LN3A 2CNCA 1EWDA 3UETA 2O56A 2WANA 2XH0A 5HWJA 1YDNA 1MMFA 4Q7BA 1UP0A 3LPGA 4UOQA 2XG9A 4LAKA 4LVDA 2Z00A 1UKTA 2OWXA 4GXMA 1PO9A 3CHVA 3D6NA 4MFDA 2DSVA 3DAQA 4JTJA 3H6OA 3BAYA 3UWZA 3N12A 1J6PA 4E8CA 3ZVHB 3S5ZA 4ACYA 4LAZA 1XLBA 4D8LA 1EIXA 1OGSA 4LUYA 1UOZA 2AGTA 3MYPA 1V6TA 3GFZA 2Y7DA 1XW8A 1E43A 1XGEA 3W02A 1H50A 4GUJA 4LB4A 1GZ1A 4H7ZA 4F48A 3IGUA 2JBMA 4MNLA 1BWVA 1M7XA 1YXCA 4AY1A 5BNKA 2IPGA 2VCBA 3EPOA 2PF0A 4J3ZA 1JL8A 3L67A 3T0AA 3DFOA 3THUA 3W37A 4W89A 3N2BA 1ME8A 1J0ZA 3AYVA 1H3GA 4U2ZA 4FNQA 1H60A 1J79A 1DIEA 4L1WA 3NJ3A 4YVVA 4BS0A 1EPXA 2CHOA 2OQYA 2XVLA 3MMTA 3MS8A 4ZCWA 3WQOA 4IPIA 4L61A 3F4VA 1H7RA 2OZ8A 4GNKB 1KWGA 1U1HA 1I6NA 2ATMA 5G1YA 3S5NA 3O6DA 5CH9A 3ARPA 5EFDA 4WK9A 1UWSA 2VZUA 4UMBA 3NPWA 2B7QA 5FI8A 3P8IA 2HZGA 1WX0A 4ONVA 3F5JA 1I4NA 2PTYA 3PY2A 4WKFA 2WVTA 1HVQA 1WXYA 3GG0A 3P67A 2FPVA 2ZIDA 1UKOA 3SN4A 1WO2A 4M8UA 4RW3A 2OYKA 3DFSA 1S3TC 4QNWA 3MT1A 2FQIA 2PGRA 4OQVA 1ICQA 5A6SA 4JNYA 5FAGA 4K2SA 1NOUA 1WDSA 2C16A 3MANA 2EAWA 8A3HA 3F03K 1CXEA 3MHGA 3GS6A 1ODZA 4GZEA 2QHAA 3C86A 2JALA 1JFHA 2BS9A 4PFHA 2ONEA 4IQJA 4K6AA 4HA3A 3K30A 1EHNA 5G2IA 2CWNA 2AAAA 2DT1A 3UW6A 2NSOA 3VDCA 3TYDA 2X7WA 2X09A 5A94A 3PNZA 3CUFA 3ABRA 1ELSA 4E2VA 4ZTXA 1HXJA 1SSDA 2XVNA 1QPQA 1LWHA 4ZODA 4DYEA 3WKZA 1EJVC 3IUHA 4ZE5A 2BY2A 3W7LA 4GH1A 4FB7A 2WO5A 4C6EA 4RE3A 4YS1A 1XF0A 2WV8A 3AWOA 2X2GA 1XC4A 3ZVIA 2OLAA 4WY0A 1TX0A 5AHNA 3EXRA 3MJYA 1WQ5A 3VGDA 2QS8A 2MNRA 2CZFA 2W91A 4D6GA 4RLIA 1TSIA 3OU8A 3QYQA 4LT9A 1PIIA 2CZ5A 3ABSA 4A3HA 4KBXA 2BODX 4Q4OA 3SAZA 3GC5A 3WMSA 2XSAA 5A95A 1V6WA 2V81A 4UBPC 4YCPA 3B8WA 3REQB 1HJXA 1GOMA 2QAPA 4MDOA 2RJGA 3W6MA 5EBAA 3GIQA 1T99A 3FSTA 5FJOA 3ZWSA 3GWQA 1V93A 2VM8A 4XZHA 1V3HA 3EPNA 2XPKA 3G8EA 2VJXA 4LS2A 1VQTA 2E7FA 4WGHA 1D7FA 4NASA 3O2LA 4UR8A 3TP4A 3QW3A 4L4LA 5DO8A 3S42A 1F73A 4YVPA 3H2AA 1EKOA 3GTIA 3ATYA 1U33A 2WVVA 2D20A 2PWUA 4ASTA 3EOOA 1YXYA 3F5LA 2P88A 1KV8A 1XLKA 2VZSA 2YDRA 1DXIA 1TPB1 2FYMA 1EHAA 4C6MA 2F6XA 4MB3A 3SN1A 1W9UA 3DXIA 3MVIA 4YTTA 4J1OA 4D6JA 3WD0A 4QJ1A 2ZZ5A 5D05A 4JXCA 1XGZA 2JIEA 5CZJA 3S9YA 5TIMA 3KW3A 5I79A 1OCQA 4Q7IA 2ZX7A 1OJXA 4MNMA 2ZXBA 2GVYA 1PZ2A 2ZRZA 1WXJA 3SUTA 4LV9A 4UXDA 4ZA0A 5C2CA 3S9ZA 3WDPP 4R33A 1KR0A 2PLCA 2OELA 1DTUA 3P6LA 4EAMA 3ZLHA 1LBMA 4WZHA 3PBWA 1MDRA 3UXLA 4JN6A 3SJ3A 2PLJA 2HNHA 1ZY9A 3VDHA 3QBUA 5ENLA 4O1AA 3M43A 3P60A 1H61A 4P8VA 3TN3A 4CCEA 1ZJHA 5AHLA 1H1YA 4GI8A 1HP5A 3M44A 3P5ZA 3SRDA 4AMAA 5LIWX 1OHLA 1F6YA 2PB1A 4AEEA 1W1IE 1E9IA 4GKTA 2XGBA 3K5XA 3BWWA 2R1LA 4PMDA 1RP9A 4PCFA 1KM5A 1L6FA 5CGMA 1GONA 2CETA 4JN7A 4X2PA 1GOQA 3WD3A 2CZDA 4I3GA 4PMVA 1M9HA 3FVDA 2PURA 2OKOA 3ALFA 3PWIA 3W0KA 3Q37A 2QVNA 3PZ9A 4X2RA 1Z44A 4YTRA 3UBPC 1CXLA 2ALDA 2PFHA 5LXEA 3M0LA 3SCRA 1P6BA 5HOSA 1D8WA 4JTKA 1NM9A 3UWWA 2WK2A 1BFNA 1R38A 4Z1AA 4GNJA 8CGTA 4O1CA 4IFKA 5FIPA 2Y85A 1TV2A 2VX4A 4WSJA 3WLMA 1IIHA 2BGNE 1YTEA 4KKXA 4O1DA 4XD3A 5MKGA 3T08A 2J7FA 1ZHAA 4P2VA 4N2YA 3EB3A 1X98A 3P81A 1GK8A 2PI6A 5EGRA 3IJ8A 3EX6A 1Y5VA 5H8PA 2BWGA 2GVEA 1KM1A 2V67A 3B0XA 2WSKA 4ML4A 3WQDA 1FH8A 4UFJA 4UTTA 2HK0A 3AS1A 3BQ5A 3WN6A 1FWEC 1HTIA 3QLLA 3OB8A 4PEEA 3CGTA 3BW2A 4DLMA 4OFCA 4DVOA 3AI0A 1T41A 1YBQB 7PTDA 1PKNA 1VJIA 3ORWA 4PBGA 5C7HA 5BWAA 3MMWA 2WNNA 1OADA 3ZVHA 4JZ5A 1E71M 2V3DA 2PODA 2IXUA 4K7YA 4NYUA 4GVFA 3UPWA 1KW1A 1GQIA 3CHDA 1ISVA 3STFA 5BWFA 2VDGA 4TX6A 2ZE0A 3IRDA 4XO6A 3MP5A 2W67A 1SUXA 3E2VA 3PM6A 1F76A 2BBFA 1HJUA 2DJLA 5JIWA 1X1NA 1CPUA 3NZRA 4YWIA 4D8ZA 2FZ8A 2WBGA 3VM7A 1C8XA 3T55A 2PS2A 2FVLA 1CLKA 1WYIA 3RM4A 4PBFA 1ONXA 5I06A 1NARA 1V5XA 2GJXB 2OXNA 3RX3A 2UWFA 1R30A 1DKWA 5CAHA 5B7ZA 5I2UA 3QMTA 3W83A 3C3NA 4DJEC 3S9IA 4F9DA 3C8NA 4QCFA 1JYVA 2WJDA 4GOAA 1YYAA 2V68A 1W3JA 2E6FA 3W38A 3W26A 5LIUX 4GQGA 4QG6A 3BV7A 3UJRA 4IL0A 1Z3NA 2VRJA 4WOZA 2ZADA 5DELA 5IDZA 4RNHA 2DUXA 2VRKA 5HBFA 1TPFA 2PF8A 2DVTA 2ZC1A 4ZQCA 3IJ7A 1OB0A 2W62A 2FFCA 3A22A 2ZA2A 1UHVA 1JI1A 2XSXA 3EDDA 2OYMA 3MWCA 4IUOA 1TB3A 3GVGA 4IL2A 3AO0A 3MMUA 2VC7A 3DCPA 3ITVA 2H6RA 4CNOA 3WF3A 2PA6A 7XIMA 1VFSA 2BXYA 2I5QA 3VCRA 3SR7A 2XFWA 3R43A 4KEUA 3ARUA 2PCQA 3T44A 4PODA 1C8QA 1J8VA 1CGUA 3URAA 2IPFA 1GVRA 1KR1A 4C7FA 3GC2A 3N11A 4GI4A 3BZJA 1MQPA 1NP2A 1QBAA 3BCDA 4GACA 1D9EA 1TELA 1JGMA 3H2MA 3WL0A 1CB2A 1IT0A 2GQ8A 1BEUA 3N6JA 1Y65A 3QKEA 3V7PA 1EJRC 3QPEA 4EWJA 5F2MA 3EWBX 1VCVA 3H26A 2VFEA 2YXGA 3OZPA 4HPGA 3MBDA 3FJ4A 5LKYA 3GUWA 3NDOA 3LHTA 4J40A 4OE7A 1R5YA 4UTMA 3RX2A 5D4YA 3M5VA 3VCCA 4Z0SA 2W27A 4JTEA 4AD5A 3G24A 1JR1A 2V2DA 1CI1A 1G0CA 2I9EA 1FCVA 4ICCX 1GOWA 7TIMA 2FHBA 3AIVA 1GOXA 3I7SA 5A8PA 5HAOA 2GOUA 2DV0A 3N1AA 4D6EA 3SQLA 4JHZA 3WBXA 2ZICA 4PUDA 3ZJ6A 1GKPA 3U2CA 3ITOA 3RCYA 1ZL1A 1W9XA 3GIPA 4D6DA 1D3HA 4Y8EA 1UASA 3PG9A 4JDYA 3RO6A 1J93A 1IT8A 1NU5A 4DF2A 1BTCA 3F7JA 3NEVA 2QPXA 3TZNA 5D9NA 2QJGA 2WNQA 3B9AA 3I3BA 4GA8A 3VMNA 2EO7A 2BVWA 2NVDA 1VBGA 4WUIA 1TWIA 4H2HA 2GSEA 2P0OA 2RDWA 4AY8A 3N6HA 4C6QA 4K1GA 4DZ5A 2VRQA 1A5SA 3K4WA 3GNNA 1NQKA 5CC3A 3DG6A 4QE5A 1DL3A 1M04A 1JCXA 2WMIB 5BXRA 2YDQA 2OU4A 3RNDA 3N15A 1EYEA 3SCSA 1ZB5A 4C7GA 3UXAA 3WLKX 3GNRA 3AS2A 5CC6A 4L64A 3W4RA 3O07A 7ENLA 5A8MA 3BMXA 3GRIA 4IGHA 3SGZA 1L8PA 2FZBA 4FOJA 2FJKA 1XUUA 3DHUA 4ZGYA 3BSHA 2DQXA 4JEJA 1OQFA 3V5OA 5LXXA 2WZEA 4OOUA 4Q4PA 4GJ1A 3VGBA 3W86A 4L9YA 1GEQA 1Q6CA 4FOKA 4GCXA 3PPCA 5BW6A 1KTCA 4DBDA 4QEEA 4WR3A 1UJPA 5EBUA 4CQ9A 2XZ9A 1Y5WA 4OU1A 4PBEA 1Q45A 3VNZA 3CZLA 1A5MC 5DN1A 2VZOA 3VIPA 3QGKC 1YMYA 3WD4A 4BZYA 4ZB2A 5FF7A 1NOFA 3VOIA 4J5NA 4DQWA 1IWBA 4AW7A 2WLZA 4IIEA 5CLWA 4QS6A 1EBHA 2ZRVA 1ZJAA 4O1BA 2JKAA 4EE9A 2DQWA 4M6PA 3CM4A 5EMJA 3W84A 2ADAA 4Q8OA 3W7HA 5IBXC 1TA3B 1XJBA 4QTGA 5HULA 1SW0A 2I1OA 3GAYA 1SM9A 3MWAA 1JNEA 2J78A 2BVYA 3LCXA 3T4WA 3NFUA 4AZ7A 4H2CA 2EHHA 4WEVX 2ZA1A 2CKRA 3WQEA 4B4HA 3H4XA 3SADA 3D3FA 1XYCA 3HG2A 2CZVA 4TQTA 4FXJA 3BE7A 3SFWA 4A3QA 1SJCA 4EPEC 4C6JA 3U48A 3DBNA 3CAQA 2X1TA 5I6SA 4GRSA 4S3FA 4AVFA 5JVLA 3DHFA 5CXPA 4PE8A 1AVAA 7CGTA 4XUYA 2VO5A 4RZ5A 3K13A 4E0CA 3W88A 1LZOA 5T9BG 1YBQA 4O0ZA 2HWGA 2CPUA 4IPJA 3UA3A 1GORA 4NNBA 4D2JA 3H23A 4MY8A 1ML1A 1E5NA 4CCCA 1AJZA 4ADSA 1JUBA 2PDHA 4DYKA 1JUKA 4MMWA 4M1RA 2DH3A 5D8WA 2G50A 3SFKA 3GB6A 4HNNA 4IG2A 4WJ8A 1FDYA 4F40A 1HW6A 3E9AA 1MYRA 5AC8A 1NY1A 4HTBA 4AXKA 2TMDA 3WCZA 1OX4B 3BUVA 3SCQA 1TR1A 2PDWA 2DZBA 2ANUA 3TFCA 2CLOA 2PAJA 3K4AA 2UBPC 1ISWA 2YL5A 4U4MA 2QCHA 1UW9A 3GQYA 5DANA 4AD4A 3KWXA 1E3ZA 2CWXA 3MJMA 4G2DA 1V0LA 2XIQA 4XK2A 1O1HA 3NL6A 4H6EA 5DFAA 1VEPA 2XINA 4F2TA 3R94A 1W56A 3BXWA 3GDMA 3UNDA 3SN0A 1MWOA 1QMLA 2WMGA 4ATDA 4Y9AA 4XIAA 1BKHA 1ONEA 1TTJA 2VEMA 1O5RA 2YSWA 1X7FA 2O92A 2OR2A 4S23A 1SYTA 2QYGA 4ZOCA 3WFAA 3L65A 4FNPA 2OEMA 1H7PA 3CL6A 1WAWA 4PMUA 4BKNA 4PA8A 3SZ8A 1SPQA 1VENA 3OP2A 3SEPA 5ECUA 3GU2A 4AIBA 4XBJA 2AMXA 1E9YB 4LWWA 5I3IA 3ARYA 4F0HA 5HNTA 1SGJA 1SW3A 2V5JA 3M5ZA 3MZNA 5I5RA 1N8FA 5C7VA 3O16A 3OYZA 2VELA 5C55A 4BF5A 4LW7A 4M0XA 1XX1A 3KL3A 5DMLA 4FP1A 1IGSA 3WLLA 1TJRA 4NJGA 3WJZA 1MQQA 2Z25A 4X9YA 3WJSA 3BANA 4G7EB 3VUSA 4DLFA 4JKMA 1HL9A 1WZMA 1REQA 1WOAA 1V79A 1B1YA 4P7QA 1K7FA 4Q8MA 3VIIA 1UWUA 2D2GA 4V1XA 5J5RA 1A5LC 1J6OA 4ZXLA 2FJUB 1J5SA 2GK1B 4G1KA 2CXGA 1MEWA 5I77A 3V75A 4EPKA 4L1GA 1GPWA 4IM4A 4N4PA 4NNAA 4QG9A 2NT0A 4R7WA 3LEPA 1HZYA 1QPRA 1KFLA 3L4TA 1TMQA 4R85A 4TX9A 1M6JA 3CLMA 2HK1A 3VOJA 2P5NA 3NL3A 2Y70A 3POCA 1MW2A 4DF0A 1MZRA 1OZMA 4ILSA 2OX4A 2CLMA 5IXEA 4JX6A 3TYEA 1JI2A 1TPUA 5K7JA 4AVNA 4P8UA 1V03A 3I65A 4O15A 5TF0A 4MZYA 1QPNA 4OGZA 1PHQA 1AH0A 2WM0A 2X1SA 2Q8LA 2VQUA 5HWMA 5AC4A 4HD5A 1W3HA 4QAWA 4JOMA 2X0SA 4NYYA 4ZO6A 4FR1A 4GQ0A 3CC1A 5A2BA 4HA1A 3SGGA 4C60A 1EUAA 4KT2A 5B80A 2NQ9A 1ISYA 1F5ZA 1I75A 3CT2A 4JIRA 4ZMGA 2C71A 2YW4A 5FF0A 5HXMA 5MHBA 1IZJA 3A5VA 2B7OA 3MUCA 6CGTA 1EA0A 2PTDA 2XM2A 3CXOA 4C65A 5XINA 1W5OA 1TIMA 1JZ3A 4DIAA 1D7KA 4QIUA 2C15A 1F61A 1Y5XA 4AC1X 1SFSA 3I7RA 4HNUA 5CSYA 4X0NA 2D24A 1IIGA 1IEWA 4F3HA 2AL1A 2DW6A 1AQHA 3CJPA 1E9ZB 4NX0A 4LVFA 1OX5A 5H6HA 3G3DA 2FDSA 1XP3A 4X60A 4PUNA 3D46A 4MYAA 4QQUA 3MI6A 5D37A 3TYAA 4IMFA 4KRZA 2I9UA 2BNJA 3V18A 1QI0A 3WQVA 2R1NA 4K39A 3CIWA 3BJTA 1XICA 2E67A 4O53A 1G67A 3THCA 2O0TA 1RUSA 4L6DA 1RQHA 5LGXA 3AYSA 3KRBA 4IQLA 5HMFA 4RJEA 3LZ3A 1XBZA 4H01A 3AS3A 3VDAA 3N19B 3KBWA 4JBRA 4JTAA 4IXXA 1QWGA 2Q8XA 1L0PA 1A5OC 1OK4A 1BVNP 3QV9A 1KM0A 3WFLA 1MEHA 4M80A 3BG5A 1EC8A 3EMZA 1KCZA 3K8KA 4GHRA 1W3IA 3UWUA 3U5UA 1EP1A 1XQLA 1TZ7A 4LNYA 3R1ZA 3U2EA 1X97A 1VFHA 3NM3A 3L5LA 1G4EA 4B5TA 2YZRA 1OFDA 5IBXA 5GQBA 2WJEA 1AZ2A 1D2KA 4EKJA 2ZTKA 3BTNA 5H1WA 3V16A 2POTA 3OBAA 3S1XA 3FLUA 5AHFA 4CCZA 3R7MA 1V51A 5TQLA 3USBA 1XPYA 3NL2A 5CZSA 2DUAA 1WDPA 1ZFJA 3BK0A 3W7OA 1IT7A 2FMNA 3LLDA 3N3MA 3GDTA 1XSKA 1Z32X 3DGBA 3MDUA 3G6MA 4UNIA 3I10A 1W31A 3RM9A 1E0TA 4HP5A 3SCVA 3M0KA 1DHPA 2DY3A 3RRAA 3RITA 3MBFA 3ARSA 4Q8QA 3UR8A 2Z1VA 3SJNA 3VABA 7A3HA 5K4XA 4PC8A 1S39A 1Q5MA 5LNVA 1FWWA 1EZ2A 3E5BA 3M6YA 4L6OA 3QY7A 2GZXA 4A22A 4LAUA 4Y8FA 5AYBA 4A4AA 4GFSA 1MO0A 4RE2A 3Q4DA 1M7JA 3V36A 1K03A 3WUBA 3U2OA 1O1ZA 3R6IA 1N8WA 4ZSTA 4J35A 1AW5A 3UQNA 4C6DA 1KXQA 3WJYA 1ZPTA 1GKQA 3C8FA 3UYCA 3KVJA 2CZEA 1RCOB 5JQ9A 2QJJA 1EUNA 5AVHA 2VHLA 3QR0A 4LCQA 4UTKA 4FALA 3QOMA 2C18A 3BOLA 1RHCA 4KGJA 1K8XA 3S5SA 1XC6A 1NF7A 3OLGA 1OX4A 5KITA 3IIOA 5I0DA 2WCSA 1HN1A 3A4WA 4S3JA 1CGTA 4BI5A 1TUFA 5HR7A 3G0UA 2DIKA 1LM1A 3ITGA 2GDQA 5C9ZA 1UA7A 4LEFA 3HPSA 3LSCA 3ITCA 2FB3A 1Z8AA 4WDXA 1Q6GA 4L7ZA 3EGJA 1H4PA 3UWYA 3KRUA 4AFYA 1L2QA 4E3TA 1Y7VA 2D69A 4GI9A 4F79A 1DQWA 2OFJA 2FH8A 3WO8A 2J7EA 1XCFA 1HUVA 4GUHA 3AALA 3ZJ7A 1NELA 1E1FA 3PF3A 5E6YA 1E6RA 4CQCA 4W86A 4JQ4A 5RUBA 3PC0A 4PL2A 1NFGA 1TQXA 3NSMA 5K3VA 4GO8A 1SJDA 4GQQA 4H4IA 5MF5A 1L9WA 4QROA 1Q13A 2F2HA 3DUGA 1XKYA 5A2AA 8XIMA 2YYUA 3GKFA 4IZGA 3FV9A 2P3EA 2A5HA 1LG1A 3AIQA 3B0YA 4X0VA 3BURA 1G7VA 1T8XA 1XIEA 1E0WA 1KXVA 2X1UA 1XCWA 3TTQA 3IUIA 2O4QA 4BWLA 3OVPA 4XTIA 3PBMA 1MNZA 4EX4A 2J8FA 2Z29A 4ENLA 1EP2A 1YTDA 1TMLA 1OD8A 4UWMA 1MW0A 1W3LA 2QGYA 4ZR8A 3I4KA 2XUCA 1TREA 3WLNA 4G7EA 3RLGA 5F1VA 3C2EA 3DBPA 1GVIA 1Q7ZA 3BLPX 2PWVA 4XTDA 3ABOA 4R7OA 1SMAA 4RDWA 3KOWA 4NZ4A 2HEJA 3GG1A 4E8GA 5D02A 1GVOA 2Q3RA 3R5EA 2QCCA 4W88A 5G5IA 2I17A 3K8LA 2GGHA 4DM2A 5M3WA 1XGDA 2PDQA 1US0A 4QX4A 4B90A 4GINA 3ZSSA 4IFRA 2Z2BA 3AIUA 4XIMA 3R0KA 3LXBA 1TJ0A 4YWSA 5CPOA 2WMJA 3P82A 4Y96A 4EACA 4M3PA 3FYPA 3F4NA 3KE0A 2V69A 4CQBA 4XBSA 3VD9A 1V3IA 4LB3A 3PZIA 4AY7A 2JIWA 2NSXA 1Q7QA 1PDYA 3H12A 3WBAA 2QZRA 1K4GA 4JTTA 2QUMA 4WCJA 4F0SA 1XLDA 1QW7A 2VOTA 1JD9A 4QCEA 5AC5A 1VFTA 8XIAA 3JUGA 3QJAA 2V30A 3LSBA 4L80A 1TVNA 3CU2A 3RG6A 4M1BA 3PFRA 3ZR6A 3V1HA 1KGUA 1LOSA 4ZO9A 3BGGA 4WD0A 4YTSA 3PB2A 1EO5A 3VOCA 4R3UA 4IIFA 2WQDA 4PTXA 1ZBCA 3WENA 4GUFA 3ERPA 1E0VA 1MSSA 1PWMA 2CKSA 1N82A 3UZYA 4PCNA 3VI2A 8RUCA 1MZHA 3TW9A 4KESA 1EC7A 3BC9A 3HU7A 4GBDA 4TMBA 2Y0FA 4GABA 3GXPA 4FPSA 1W1YA 4JL1A 1XDJA 2NWRA 4C6KA 2PMQA 3CV7A 2GGJA 2NX9A 4C91A 4HJFA 4JY9A 4FLQA 4UZUA 3NEHA 1R3QA 3NZ1A 1MVYA 2WKGA 4K8EA 3WK1A 3PJXA 2BMBA 2Y8KA 1FA2A 5ABHA 2NV1A 1YPIA 2J79A 3LA4A 5C2GA 5G2WA 1ISXA 1W1PA 2VFGA 4ROQA 4NAFA 2OO0A 3LCGA 4NL1A 1WDRA 3UYIA 3SURA 2EEXA 4IMAA 3SQMA 4Z17A 5AZ1A 3W07A 3F4DA 4B15A 2VI0A 1W5PA 2WPGA 3P80A 4DZIA 4KFNA 3LV6A 1WKDA 4L1XA 5CPLA 1WP6A 2Y7GA 4ERAA 3NCOA 4K3ZA 4D6IA 3FA3A 4P7LA 4HYRA 1QOXA 3EDJA 1YEYA 3L68A 1J0KA 3WK2A 2RFGA 3H4WA 4NX5A 4WLCA 2OYLA 3B4UA 4HNVA 1IR1A 1F3XA 5FL1A 3WQ5A 3ARTA 3E2RA 3VCNA 1VGAA 6TAAA 3HPFA 1AZ1A 1GZGA 4OJYA 1CTNA 1FHVA 1OT2A 1IWAA 4RE0A 4DUVA 4JTSA 1KFKA 3CO4A 2R9RA 3BMWA 1JF5A 1R8LA 2XH7A 2PD5A 5HK4A 1W9PA 5I3FA 1BYDA 3RU8X 2WPBA 1XLFA 5ABFB 3CH0A 4QSFA 3MQTA 3QMRA 2PWFA 1BAGA 4KEMA 3TEVA 2XFFA 4HPHA 1OC7A 3M7SA 5FKYA 1NDWA 3TW6A 1OEPA 2OWCA 2Z7GA 3EMCA 4RV3A 1DWFM 1AG1O 2VXNA 4W8AA 5DBTA 3HQPA 3M1ZA 4TVDA 1UOKA 1NQ6A 3RRXA 1RPXA 2VENA 2E9LA 3A3XA 4I8DA 3DKJA 2C13A 3MHUA 1VYPX 2XM1A 2ZRWA 4O16A 3MP4A 3CQ0A 4X22A 3APYA 5HANA 1T7LA 4RXFA 5AKQA 2W3ZA 2AKMA 1LCOA 3NR0A 5AFDA 3HG5A 5IHSA 3DU0A 1KRMA 2R24A 2QIIA 1XBXA 1XQKA 2ZZ6A 4QP0A 1J0HA 3BICA 4TXEA 1LF1A 4HBKA 4PUJA 3V1PA 4AD3A 3NQMA 4LQ1A 3KL0A 3OZYA 1RV8A 4C1KA 4CKQA 2X1RA 3XISA 4H8HA 2IS7A 1EPVA 4PRTA 1W1B1 4CNPA 3CLWA 2F38A 1O5QA 1RY0A 2E28A 3RFAA 3FYOA 1QASA 3H2CA 3CAKA 1JCJA 1H5YA 3DN5A 2DT2A 4W8BA 3GFYA 1PS9A 3VOFA 5T91A 1AL8A 2YCLB 2BV9A 1QDSA 1KKOA 4EWND 2CIPA 3G2GA 4C1NA 1L6YA 5CCZA 1TJPA 3AXMA 1DJIA 3TVAA 1G01A 9CGTA 1XIFA 2Y24A 2FTWA 2Q02A 3AMGA 1S5NA 1CXHA 5DLCA 5EPDA 1Z89A 3NQVA 5REQB 3FOKA 3DERA 4PMOA 1R87A 3SB0A 3UJ2A 5AZ0A 1ZAIA 3W25A 4RX0A 4M56A 3HFTA 1PYMA 1B54A 1CCWB 4NXSA 4O52A 5HNRA 4XX6A 3WD2A 4GY1A 3PZNA 1JPHA 1Y0EA 4FZIA 2W66A 3B9NA 5D8ZA 1J0YA 1WKFA 3TYBA 4Y7EA 3V4BA 3PZMA 2YW3A 4DXVA 2E25A 1UH2A 1XDMA 3WF2A 3VFCA 3L7RA 3GDLA 2JK2A 1U83A 2POZA 2KAUC 1GWJA 3BQ6A 3M47A 1C7TA 1Q65A 1A3WA 1UMYA 1F3WA 2OKTA 2NV9A 1QRQA 3UZJA 1LRQA 4BFAA 2DIJA 2NT1A 4DBWA 1BHGA 4UTLA 1QT1A 3M0JA 1YLVA 3A4JA 4O12A 3MI3A 3UPMA 5HPOA 3B06A 1E56A 4DEFA 2V6AA 3IJIA 3VGEA 1DHKA 3Q45A 3CQKA 2QUTA 2WCAA 4P8WA 3HG4A 3RU6A 2FDMA 3UVAA 3LHVA 4H9XA 1X39A 4N42A 4AISA 3HQ1A 5DY2A 4XZ9A 3BJFA 3O05A 1O12A 3T0BA 3S2NA 5HMSA 2DH2A 3RN6A 1XRFA 5A1AA 5JXQA 3NQ7A 4QG8A 4E6MA 3AXXA 1MUMA 3FAWA 2GJLA 3AHXA 4G1NA 1QUMA 3B9DA 4RR4A 4R9XA 3DX5A 2Z1BA 4B91A 1TV8A 3O0FA 3QQWA 2ABBA 3PHAA 5KINA 2WC7A 4HK6A 4BQ2A 2A3AA 5A8QA 4PUUA 3AZRA 3LCWA 1T5AA 3GTXA 4DBUA 4B5SA 4E2OA 4J3TA 3SDOA 2H8XA 3TN6A 3A23A 1IEXA 4JTFA 1U5HA 2FVMA 2CYGA 2CLLA 2E5CA 4KFOA 5GPRA 2J9ZA 4LRTA 1PSCA 4PN2A 1GQNA 2GJRA 4ZB0A 1CLXA 3E6EA 2NUWA 4F8XA 1JPKA 1U5JA 5EFFA 3VX0A 4GYPA 3TOYA 2VDHA 3LBOA 4RNIA 3NIYA 1IEVA 4PSRA 3VILA 4REQA 4DUOA 4NKCA 2HS6A 3OG2A 2QCLA 4UOJA 1B3YA 4CQAA 4XV0A 1VF8A 4ZOEA 5I07A 1F74A 3EOLA 3ZR4A 2A7RA 5HNNA 1ZNNA 3UR5A 2WM1A 5FF3A 3IV3A 4O1FA 1T8QA 3AHTA 2JEPA 1LOLA 3QTPA 4G56A 5FAJA 2CERA 4Y90A 3GNOA 2EQDA 1JZ8A 1HVXA 3B97A 3MCMA 2P8CA 5E09A 4LSBA 5BXTA 1WE5A 3IJQA 3LNPA 1D3GA 3DYPA 1XR2A 5DT5A 4W87A 3VKBA 3W1TA 2FVKA 4MDPA 4US6A 4BJHA 1EZWA 4KWUA 4NZFA 3QN3A 3CB3A 2WSYA 1R3SA 3IS4A 2GQ3A 1UBSA 3A6OA 4XQ6A 1QTWA 3PJWA 4S3KA 1F9CA 1LQAA 4I7VA 3AMDA 2NX3A 4K1WA 1SO5A 4NJJA 3IGHX 1B3OA 3FSUA 4D8AA 3TSMA 4GYFA 3OVGA 1OINA 1TR9A 3C0QA 2ZOXA 4LV4A 1CNVA 1UR2A 3QV8A 2BVTA 4O54A 3LCIA 4V27A 3RGTA 2YXXA 3O1NA 1JPMA 2FPYA 3R8RA 5CC7A 1YXDA 3W2LA 2GVJA 3PFMA 4KGLA 3WEMA 5LA2A 4XKMA 2VWTA 5C9WA 3I3DA 1TRIA 4K8GA 2C79A 3VPLA 4FMVA 2Z7KA 1HO1A 4IH3A 2CCRA 3OQEA 4O10A 5HQLA 1WBHA 2VX5A 1Q85A 3VIOA 2PTXA 1V7AA 5EYWA 4HZ6A 3SCOA 4EANA 2BLEA 1WXZA 1OIFA 3EX4A 3PBYA 4F0LA 4Z2IA 1FX6A 1GEHA 2OQHA 4QE1A 1B9BA 3QR3A 4HSHA 4DY1A 3DFPA 4L4OA 2P53A 2RGLA 3C3UA 1E4LA 1LL7A 3TUUA 5ABFA 2DT0A 1S38A 2OLSA 3LNMA 3S5YA 4ZSUA 3PP7A 3LPPA 4Q4QA 4KIRA 3GY1A 4ALDA 4CD6A 4DB7A 2NQHA 3UPBA 1Q6LA 4AIOA 3GKAA 4I5UA 5A6KA 1KO0A 3B8SA 1R9YA 4F0MA 4HYWA 3GW3A 1FWTA 3M0MA 1Q6DA 2REQB 2DVXA 3J7HA 1UWAA 3WEZA 2D0GA 1WB0A 5U4NA 3TFXA 4ZL1A 3OW1A 2E9BA 1GNXA 2WZIA 3ZWTA 3UNTA 5FESA 2IPJA 4JL2A 1DJGA 3UG3A 3USZA 3U57A 3OGVA 1EC9A 2R1MA 5D32A 2W6RA 1HNYA 1RBAA 4AZIA 2FZ9A 1LG2A 3BLFA 4LY8A 2QW5A 5A8OA 3LCHA 4JY8A 3TXVA 1A3HA 2A7NA 2QJIA 2ISFA 4TO8A 2YCLA 2YL6A 1PX8A 5CZ0A 4LUSB 4E8DA 2A85A 2BZNA 5KSWA 4PUKA 3VX1A 2FFIA 4U5IA 1UUQA 3OLEA 1CX9A 1TPWA 1BQCA 1JDAA 2I7GA 3B4YA 2NQJA 2OSWA 3BLDA 2PSNA 5C9UA 1L6SA 1K8CA 1EF2A 5REQA 3VC5A 3LDVA 1EYWA 2EG6A 3W22A 3DOPA 4UR9A 4O8RA 1SR9A 4Q8UA 2WHLA 3KOXA 4WJEA 2D22A 4CNNA 3L5AA 1A53A 3AHYA 5HUPA 3NQGA 1ZP3A 4C6NA 2VTFA 3U5YA 3ZXWA 3RR4A 4AF0A 2OEKA 4IGMA 2DUZA 2VZVA 1KB3A 2BSLA 4IICA 5LGZA 2Z0IA 3GXNA 3SCNA 3LHUA 1XD0A 1UP3A 4MZ1A 3TR2A 1UKPA 2NV2A 3WMCA 3LB0A 3WEOA 4MJZA 3IPWA 3M0XA 3EDKA 1IXPA 2OEJA 3HGSA 4S1FA 3IAQA 2VVSA 3CB8A 1NWUA 4PULA 3N73A 4O17A 3A9BA 2A7PA 1FUYA 3AZTA 3CYJA 1FWFC 3VIJA 2OX1A 3P74A 3B9OA 1KRAC 1TPH1 4I9TA 3ZJ8A 3NQCA 2E8YA 1DVJA 4E4PA 4LVAA 3QEZA 4R27A 1JZ4A 3G1DA 3MV01 1AQMA 4PMYA 4TTUA 1VFUA 2BP1A 1QFEA 3OA5A 2VWSA 3WJXA 2QMJA 1XRVA 2BHZA 3QTGA 3VK5A 2MUCA 1KBLA 1M7PA 2Y5SA 3OLIA 3K2GA 5DXXA 2ACRA 2PDKA 2QNEA 4N6EA 3EA2A 1IZKA 2VX6A 4NI3A 5G4EA 1XSIA 4HCHA 5LA1A 3A3HA 3WY1A 4CD4A 3HPZA 2QF8A 3ZIZA 4PB4A 3BH4A 1O60A 4J2PA 4XD4A 3LBCA 4AG0A 3BPWA 1FWGC 3DZ1A 1OFQA 1QXLA 1FKXA 3DYMA 3NURA 4GCAA 3T2QA 5LIYX 4QISA 1VEMA 5D03A 1B3WA 1A3XA 1AJ2A 3H2NA 3N2XA 2IKIA 3O9NA 4RV8A 3CQIA 2VEPA 2XGZA 1E4NA 1J18A 3SGUA 3W1UA 3FXYA 4KCUA 2AMGA 2XN2A 2I5IA 3W7NA 2EG8A 3FJLA 4KWVA 2Y2WA 3C2VA 4H83A 1U1JA 3TK7A 1XV8A 1PKYA 3KS5A 4O13A 4I7WA 3VKCA 3LLFA 4HPNA 3L4VA 4Y9MA 2QUVA 1PPIA 1UPMB 4QR6A 2PDCA 3GU9A 1CGWA 1FOBA 2PU1A 3VIKA 1GTHA 3QGAC 4RK8A 1H11A 3W72A 2WLYA 2X40A 1YDOA 3AU6A 4JTDA 2GGGA 3AYRA 4AWTA 1OC5A 3U2ZA 4Q8PA 2V2HA 2J8GA 1E5JA 2V2CA 3MY9A 1JDCA 2R94A 5EY5A 1XYLA 1NWSA 2J25A 1S3HA 2H90A 1PCWA 2GQAA 3VC6A 4DZHA 2JE8A 2J75A 4GUGA 5HA7A 4M19A 3QR1A 2ISDA 4UQBA 2QCFA 5CSSA 2XVPA 1LUCA 1RZMA 2Z27A 4AXNA 1B3ZA 1KLZA 4NRSA 4JAWA 1RLDA 2ACQA 2NX1A 4AHOA 3AIBA 1V6VA 5T8GA 2WVVB 4HNLA 1M41A 1NWRA 4A2SA 4M7TA