1HW6A

Crystal structure of apo-2,5-diketo-d-gluconate reductase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
262
structure length
257
Chain Sequence
TVPSIVLNDGNSIPQLGYGVFKVPPADTQRAVEEALEVGYRHIDTAAIYGNEEGVGAAIAASGIARDDLFITTKLWNDEPAAAIAESLAKLALDQVDLYLVHWPTPAADNYVHAWEKMIELRAAGLTRSIGVSNHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGKYDLFGAEPVTAAAAAHGKTPAQAVLRWHLQKGFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural assembly of the active site in an aldo-keto reductase by NADPH cofactor.
pubmed doi rcsb
source organism Corynebacterium sp.
molecule tags Oxidoreductase
molecule keywords 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE
total genus 90
structure length 257
sequence length 262
ec nomenclature ec 1.1.1.346: 2,5-didehydrogluconate reductase (2-dehydro-L-gulonate-forming).
pdb deposition date 2001-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1hw6A00
4YS1A 2PFHA 3UZWA 3WBYA 2BGSA 1T40A 1YE6A 2F2KA 2ACRA 2CLPA 3V0SA 4YVPA 2HVNA 1X98A 4JTRA 3H7UA 2HV5A 4GQ0A 2FZBA 1RY0A 4WRHA 3QKZA 2WZTA 4JIIX 1MI3A 4G5DA 1Z89A 1X96A 3DN5A 4PUUA 2PDBA 1M9HA 2PDQA 5JH1A 4AUBA 3M4HA 4GACA 4JIHA 4XZLX 4XZIA 1AZ2A 3RX4A 4QXIA 3FX4A 1QWKA 2P5NA 4FA3A 4FZIA 4JQ3A 1ZSXA 3LQGA 4FAMA 4NKCA 4FALA 4ICCX 3UYIA 1YNQA 4WDWA 2DUXA 4WGHA 1S2CA 4DBUA 3R94A 5C7HA 4YVXA 3R8HA 3GHRA 1J96A 3ONBA 1AH4A 3D3FA 5LIUX 4DZ5A 1OG6A 2BP1A 1PWLA 1K8CA 4JTQA 1Q13A 1Q5MA 4JTDA 4LB3A 5DANA 3KRBA 2IS7A 1IEIA 3NTYA 4F40A 4RPQA 2FZ8A 3V36A 4LB4A 2HE8A 3LBOA 2FZDA 4GQGA 1AFSA 3LENA 3EB4A 3ERPA 3MC5A 5HNUA 1ZUAX 1LQAA 2PDCA 3B3DA 3V35A 1S1PA 2PF8A 3V0UA 2I16A 5LIKX 4LAZA 1JEZA 3Q67A 4YU1A 2C91A 4JQ4A 3V0TA 1ZQ5A 1Z3NA 2PEVA 2IKGA 4XAPA 3LN3A 3CMFA 1EXBA 3UP8A 3F7JA 2IKIA 4IGSA 3WBXA 2IKHA 1FRBA 4EXBA 2DUZA 3LD5A 4IJRA 2ACQA 1AH0A 3LNMA 4XZMX 2HDJA 4LAUA 3ONCA 3BV7A 1EF3A 2FGBA 2HEJA 2R9RA 3M0IA 3UZZA 3RX2A 3H4GA 3R7MA 4QR6A 4WDTA 1S2AA 5KETA 2NVDA 1MRQA 1Z9AA 3FJNA 2PDWA 3Q65A 3BUVA 5LIXX 5LIWX 1PWMA 4JQ2A 2IPWA 2J8TA 4PRRA 4WEVX 1R38A 1ADSA 4L1XA 1VBJA 1YNPA 2QXWA 2PDNA 3N2TA 3WCZA 2INZA 2R24A 3UG8A 2ACUA 1HW6A 1UR3M 2PDYA 3G5EA 3U2CA 4WDUA 2IPFA 3WBWA 2PD5A 2IPJA 1IHIA 1XF0A 1PYFA 1A80A 1VP5A 1Z8AA 2ALRA 2FVLA 1PZ0A 2IKJA 1QRQA 2A79A 4R9OA 2PDFA 4GIEA 4ASTA 3R6IA 3N6QA 3BCJA 3GHUA 2PDUA 5AZ0A 3C3UA 1US0A 3BURA 4PRTA 2AGTA 4HBKA 3DOPA 2NVCA 3CAQA 4LBSA 4ZFCA 3CAVA 3G1RA 2PDIA 2PDPA 4Q3MA 3LEPA 4XVEA 1T41A 3LZ3A 1EKOA 3EB3A 3COTA 4PR4A 3RX3A 2IPGA 2IQDA 4I5XA 3VXGA 1C9WA 3MB9A 1XJBA 5M2FX 3GHSA 4HMNA 3EAUA 3H7RA 2PDXA 4XO6A 4GABA 3UZXA 2VDGA 4XO7A 4JQAA 2FZ9A 4JIRA 2HVOA 2INEA 2BGQA 1XGDA 3P2VA 2F38A 3R8GA 4PMJA 2PD9A 3LUTA 5HNTA 3O0KA 4XZNX 3T42A 1AH3A 3WG6A 2PDHA 4QX4A 5LIYX 4QBXA 2PZNA 4IJCA 4XK2A 4H8NA 4XVDA 1LWIA 3O3RA 1PZ1A 3M64A 1HQTA 3R43A 1EL3A 3CV7A 3CV6A 3CASA 4OTKA 4PUWA 4JQ1A 5JH2A 1GVEA 4JTAA 2WZMA 4L1WA 2PDLA 2ACSA 4LBRA 3S3GA 1ZGDA 4DBSA 3GUGA 1SM9A 4MHBA 2PDGA 1RALA 4GCAA 4WDXA 3LZ5A 3UFYA 4H7CA 4Q7BA 1AZ1A 4EXAA 1YE4A 4GA8A 2PDKA 2ISFA 5HA7A 2PDJA 2DV0A 3UWEA 3R58A 4JTCA 3LQLA 1MZRA 1S1RA 2IQ0A 2PDMA 2HE5A 5AZ1A 4DBWA 4YVVA 3GHTA 1X97A 3UZYA 1RY8A 2I17A 4XZHA 3UGRA
chains in the Genus database with same CATH superfamily
3GG0A 4BEUA 4QTGA 1FKXA 3TSMA 3W27A 1T5AA 3NQDA 5LNWA 3BLDA 3TXVA 4MUZA 1PEZA 4UTWA 5XIMA 1X98A 3WQFA 2GWNA 2VXNA 2D2OA 3FV9A 1E4LA 4ENLA 1JRBA 2FZBA 5KZEA 3OQEA 3A23A 3APGA 1UWAA 5K2ZA 2YKKA 1VFOA 4AZ6A 5TD4A 1RQEA 4ZOEA 1JAKA 4BI6A 4AWUA 5AC5A 3CS2A 2NQHA 3IV8A 3OEXA 3BSHA 2BX7A 4PRWA 3NPUA 4H19A 4HYVA 1GGOA 3NOYA 3RCNA 4QNWA 5A69A 3TC7A 4JX4A 4EVZA 4JCMA 3LTPA 2ZTKA 3VOCA 4NAEA 3WYZA 4JQ3A 5D2WA 1CBGA 3BAWA 1JI2A 2PZ0A 3AMLA 4A2RA 3QBUA 4J40A 3T0AA 3SAZA 2Y4SA 4CKQA 2V6AA 3LHWA 4ZE5A 2DUXA 2VFIA 3M46A 1DE6A 1UP3A 2GQAA 1AJZA 5A2CA 1IZJA 4GK8A 4KWVA 1KV8A 2W61A 3PJUA 5HJYA 1Q5MA 2Z1SA 4DBEA 2QEZA 1QCWA 2YL6A 5HJLA 3CB8A 3TR2A 1HGWA 1TTIA 1OFQA 3NO1A 1B3ZA 3VE7A 1KCKA 4EX4A 4N0RA 2AMGA 3PZTA 3DI0A 4D1IA 3C2EA 4KF1A 1SJCA 3K8KA 4JD4A 2Q3OA 3BLFA 3E0FA 3MTWA 3KOFA 3L23A 1TUXA 4PSPA 3E1F1 3VYLA 3HPXA 3AZSA 5DF0A 3QOMA 3MO7A 4O0KA 4XB3A 2AL1A 4C6DA 2WNNA 3LS9A 3XINA 3MYPA 3LMYA 2DUAA 3PZUA 1E9ZB 2AKMA 3NZ1A 2YL8A 4PMOA 4IPPA 3TUUA 3S1VA 4O11A 3KHJA 5DRCA 1F3TA 2GVJA 2WOQA 4WSHA 1A0DA 1I2NA 4N9EA 4HK7A 2G97A 1QBBA 3IVTA 1OFEA 1ZBWA 3E6EA 5DEZA 2XH2A 4DJED 4AHPA 1Q6DA 3QXBA 4S23A 4C7DA 2YYTA 4DYJA 4LCSA 1KBIA 1ADOA 3KP1A 1VD6A 3CU2A 5HK4A 4D6EA 3BK0A 3PUDA 2DT0A 1C90A 1E0WA 3EMCA 1HL8A 2Y85A 5LA2A 2I1OA 2Y5JA 5EFDA 2WVTA 3UW6A 1XUZA 1BHGA 3LCHA 4NJJA 5LIWX 3IGUA 3VIKA 4UQAA 4DPQA 2I7GA 5I02A 2EGZA 1TYGA 1TMQA 4PH6A 2Z7GA 2XVNA 2TODA 5C8BB 2ACUA 1H2JA 3OTRA 1KLZA 1EIXA 5EMYA 3BZJA 3ZO9A 3AIBA 2WV8A 3S46A 2YPIA 1KQYA 3UXDA 5FF7A 2QUUA 1Z8AA 5KZ6A 2PTYA 3O7UA 2XFYA 3H53A 2FH8A 1OC7A 1SGJA 1E6SM 2YJQA 1J9YA 3MUY1 3BO9A 3CQHA 2HXUA 4GNVA 4HNTA 1UD5A 2PODA 2DQXA 1ALDA 3W53A 6XIAA 3XISA 4HBKA 1OCJA 4HNCA 1RLCL 3RR1A 4AQLA 3IGXA 1Q63A 4L6DA 4MLJA 4K6AA 4MM1A 1F6PA 1SUXA 4JBRA 4BY3A 3NZRA 2Q01A 2A7RA 2EHHA 3MB9A 5D2TA 4F4RA 3T05A 1LQ2A 1X8CA 3RPMA 1BWVA 1XLCA 4PMRA 5EMUA 4GABA 3MZNA 1W9PA 2XG9A 4TUFA 1UUOA 4WR3A 2ZOXA 2VDIA 3F5JA 5RUBA 1QMLA 2PD9A 3JZUA 2CCRA 1KKRA 3KM8A 3BZGA 3IIPA 2DZWA 2P0OA 3SIZA 4UC5A 3SEPA 3TOYA 1BG9A 3P3BA 1BVWA 3MCOA 2PZNA 4N6EA 2D69A 2VZOA 5SWUA 4Z1YA 3OG2A 2E09A 1PZ1A 4YWIA 1G4PA 2WWDA 1Q6GA 3QRHA 4DAIA 1MQPA 4L4MA 1DQUA 3U5UA 5I3FA 2ISVA 3M5XA 2FLIA 1DE5A 3MJYA 3ITOA 4C1KA 3QLDA 2PTXA 1UBSA 1GJUA 1XYBA 3SN0A 4DXVA 3UXIA 4HP5A 4KH2A 1U83A 3KCJA 3UPWA 1Q66A 2OLAA 2ALDA 3NPVA 3WQEA 2QF7A 4Z0JA 1O5XA 3MHGA 4E8GA 2CWNA 1QPNA 1HVQA 3T81A 2O7SA 1XFCA 2OTDA 1AW2A 4H8VA 4PODA 2YCJA 2VC7A 1ZJIA 5D9NA 4HMCA 2IQ0A 5JBDA 4I7WA 5DMLA 3MQTA 4ZQCA 1KM6A 1RBOB 4NJHA 5CSUA 3T07A 3QV7A 3EBVA 2E6AA 2QMJA 3AYTA 1GPWA 2BSLA 3VOGA 1KBLA 2NT0A 3LI0A 2V30A 1ZB5A 1OABA 2ZE0A 4L4OA 4QEEA 2I56A 5C9ZA 1UB3A 3LRMA 5D30A 2ACRA 1KXQA 1VKFA 3V0SA 1PKNA 4HMEA 3CLWA 4N6FA 3UVIA 1ODUA 1W1VA 3SR7A 1XX1A 1QDSA 2QDDA 1OFRA 5K9XA 3CL6A 3ANYA 1Z41A 3M0LA 4L6HA 2YBVA 2FB3A 1V77A 1LT7A 3K4WA 4M51A 1OM0A 2RDXA 2Q8XA 1LL6A 3LOTA 2PDQA 3EA3A 1MWOA 1VZWA 1CNVA 3NSMA 4O1CA 4I5RA 3ZLFA 3BLKA 4ZQPA 1UYQA 1M7PA 4GOAA 1P48A 3GH5A 3ZR5A 1DHPA 2P5NA 1UMYA 3JUGA 2JIWA 2NT1A 3RPDA 3EWBX 1UPMB 4JTIA 5BXRA 3M0MA 3O8AA 4LC8A 3SUVA 1K3UA 1BRLA 2ZZ5A 2E9MA 1F61A 5K9DA 3NM3A 1PKYA 1V0KA 2Y5EA 4XSLA 3EZ4A 4ROQA 4HKPA 3M9YA 3VD7A 5JXQA 1K7EA 5J8LA 4E2BA 4KIEA 3LRKA 3TIMA 3B8DA 2NLYA 2R91A 4IG2A 4DJFC 4J2MA 2YXOA 1XRTA 5CG7A 1H7XA 3A24A 2QULA 2ZRWA 1POKA 4NAFB 5CBBA 1AFSA 4QIUA 4URIA 2MNRA 1WKDA 1ENUA 2G95A 3RAOA 3ERPA 2OKOA 1WDWA 1IXOA 1LROA 3GDRA 3BOFA 4K8GA 2QCDB 3RLGA 1J0HA 3VNKA 2QF8A 2VMFA 2YBTA 3NDOA 1X39A 1ZP3A 2RJGA 3GU1A 4D72A 3E3HA 4J3UA 2WMIA 1GTHA 1HUVA 2DFAA 1LLOA 3FEQA 2H8ZA 2BASA 1V7YA 4FOJA 3UWWA 1JZ5A 1QHPA 4CD4A 4F0HA 4C7FA 4UOZA 3B03A 4D6HA 1SW0A 2ZZ6A 1FOBA 4HHLA 4QS5A 4RUBA 1ZJBA 4GE8A 1HVXA 4Q8VA 3S47A 4MF4A 1YQ2A 2Y7FA 1CX9A 2FHBA 4TU1A 4I3GA 3L4UA 1VIZA 1AH0A 2RKXA 2WVSA 3HGSA 4H00A 4ZO6A 4LAUA 4CQ8A 3ONCA 3GC4A 3MP3A 1UMLA 1UROA 2J7GA 4GX8A 2CZVA 4KEZA 1XYFA 4PTXA 3EEGA 3ZJ8A 1V6WA 1XW8A 2AOSA 4JTFA 3R7MA 4ZB2A 1EGZA 4XIAA 3N2XA 1J0JA 4S38A 2IXVA 1W3TA 2J9ZA 3FJNA 1PKMA 3WH9A 4W4QA 5EYWA 4PRRA 1ZL1A 3WFLA 1BVNP 4DO6A 2WO5A 1JD9A 2ZADA 4CUCA 1GOOA 1UWIA 4P61A 1EO7A 1YDYA 2CZ5A 1XDJA 4QSHA 3GFXA 1IEQA 4IGNA 2IPFA 2PD5A 3TYUA 4B5NA 2PC4A 3LM3A 3QHMA 5D9MA 1QI4A 2OMAA 3ARTA 1ZHAA 1EHNA 3B06A 3BV4A 3FHQA 4CCEA 3EWYA 4AISA 4U2YA 5TF0A 4GIEA 2ZE3A 3A13A 3PAOA 3R6IA 3NQGA 1KFBA 3P7YA 1GEQA 2QHAA 2CNCA 3L0KA 1REQB 1LJYA 4UTUA 1JG9A 2ANUA 3FY1A 4O8RA 3TFXA 1AJ0A 3V7PA 5GQBA 4W7UA 1ZP4A 5IFPA 1K6WA 1J0IA 4CVWA 4A3HA 2VDHA 3CAQA 4K8HA 3KVJA 3GTNA 4B15A 2VT0A 1F05A 1DWJM 4UFHA 2PDPA 4AEOA 2QJMA 1T41A 2WBKA 3BGAA 1WXJA 3SY1A 4FNUA 4CQCA 3ARWA 3USBA 3GVWA 3AHVA 2PTZA 1VYRA 5M2FX 2OGJA 4RE4A 1FDJA 4DJDD 3VZYA 1OVDA 5H8MA 3VNZA 3RLHA 1TUFA 1R3VA 4D6IA 5FEPA 3OHIA 1CW2A 4V1YA 4O14A 2BXYA 1R3RA 4OBRA 5E5CA 3FK4A 4ZODA 2A4AA 2DY3A 3QHOA 3HGOA 1DWFM 3VX0A 4AZ5A 4UTIA 3TOPA 3P80A 4RW3A 4AIUA 1P0BA 3U4AA 3TFCA 3STGA 1GQJA 4J27A 1BQGA 3W7NA 2ISWA 3EGJA 4ATLA 1OYBA 3R1ZA 1E5NA 4FF5A 3WK3A 1ISYA 5LXXA 1EL3A 2J7BA 1QHZA 4AVOA 3W7OA 3CASA 3W7DA 1IEWA 3TV8A 1TCDA 1AMKA 2OZ0A 3M0VA 4V27A 1RD5A 5EMMA 2C15A 2ACSA 2VVSA 4RPPA 1HKIA 4K7VA 4WX2A 3EKZA 3QF0A 4HA0A 1OCNA 4YTTA 1Q65A 4JTJA 2PTDA 3ARXA 3VKJA 1AZ1A 1R47A 5AYBA 3GVRA 5BRBA 1TJ0A 2CZDA 3M5YA 4QQUA 1QU4A 4UTKA 4G2DA 5XINA 4F2TA 3M0HA 3IVSA 4M7SA 1XIFA 4Q4QA 3B8SA 2CWXA 1X97A 1KCZA 2QYGA 1UG6A 4O1DA 3BQ5A 4R34A 2VZUA 3HJEA 2WVVB 3S6OA 3PZ9A 1VFMA 4HTYA 3W37A 2VR4A 3W01A 1T40A 3UD6A 3UR2A 4QAWA 2J8GA 1GNXA 2CLPA 3TTSA 5AHIA 1VGAA 2ABAA 2GK1A 4DB7A 1B4KA 2V5BA 1XLGA 4K8EA 5EBUA 4OZOA 3PSWA 1A5SA 3VGEA 2HV5A 1GZJA 1H1NA 4HZ6A 5J04A 4DO4A 5GNYA 1UH2A 4H7ZA 3V18A 3DN5A 1RP8A 2OX4A 3P5YA 1FFRA 2HISA 2XIJA 1QBAA 4DWSC 4XZWA 1EJXC 1A5LC 3DFYA 2OELA 4JIHA 1IWBA 3W26A 1SR0A 1QPQA 4MB3A 3GR8A 1TTPA 3IJDA 3EXTA 3LV5A 5I0DA 5CJMA 4G7EA 4FZIA 2JK2A 4KW2A 1SQ7A 4E2VA 3LQGA 3SCNA 1R9YA 4D1JA 5AHEA 3Q4DA 1NELA 3R0KA 2RAGA 3ABQA 9RUBA 3NZPA 2WC4A 2A3LA 3C8FA 3KRUA 4JN7A 1UQZA 2EBNA 3KP0A 4YVXA 1G7VA 4C6BA 3MPGA 3LLFA 4NX5A 4ECLA 4MKNA 2HQAA 5CSYA 5CZTA 3MUZ1 4NHVA 5CAKA 2J66A 3GXTA 2A3HA 2VFFA 5DY3A 2PLCA 1CGYA 2J24A 2RJHA 3VUSA 1XHGA 4GQGA 2O9OA 3GNPA 1A4MA 4O0ZA 4C65A 1WDPA 4JL2A 1B54A 1SFLA 3B9DA 4TR9A 5D03A 7TAAA 5IXEA 3SFWA 4UNIA 3AHXA 1GHRA 3RM9A 1M7JA 4LEQA 2PDCA 3B3DA 2Y8KA 2PLKA 2GDVA 4XQ6A 3WN6A 3LGDA 3VOFA 1ISXA 4ZO7A 2YXXA 4X60A 4YU1A 4DYKA 1YNYA 2CBUA 2WXDM 4W85A 1KFWA 1ZQ5A 1QI5A 4DWSB 4LVAA 4XAPA 4RNIA 2QAFA 1AQHA 1QPRA 3MMDA 5HMSA 3TEVA 5CPMA 1J8VA 3B0UX 1V5XA 1IR2A 1K4GA 2DH2A 3DG3A 3HPAA 4GI6A 2F2HA 2QJHA 3KOZA 1OX4A 1MNSA 3GXIA 2ZVRA 2WZHA 3RF9A 1P0KA 3R4IA 2ZICA 4V1XA 1S5MA 5I79A 5E1QA 3MZ2A 5EKYA 1SO5A 4MPKA 4NZ3A 5E0KA 4WDTA 3KTXA 3WLLA 5CBJA 3ARVA 5JIPA 2V68A 3DBPA 4X63A 4JQ2A 3HURA 1OYCA 3M0XA 2OWXA 3QZ6A 2VC9A 1U22A 3EPNA 4IX2A 3EWUA 2V69A 2A2IA 3VNDA 4XX6A 3SW6A 3UR7A 3WCZA 2IXUA 3HTWA 3VA8A 4MJ4A 2OCZA 1IXPA 3G1DA 1ADDA 3HPFA 4HSHA 4LTSA 1I2QA 3G1HA 1CECA 3IJLA 3NEVA 1W1IE 3PWGA 4AY7A 3WDJA 3BGJA 3NO5A 5AC6A 5I3JA 3WLIA 1NWRA 3VVGA 3UG4A 5CBIA 1E1CB 4U5IA 5ECVA 1QK2A 4HNVA 4PL2A 3H22A 3VINA 2PBGA 7PTDA 2OVLA 4UCFA 1KRMA 4H8UA 3N6JA 1J6OA 1OZMA 2VL4A 3SCTA 3BLPX 2VRKA 1EJVC 2UY2A 4XAGA 1PCKA 3ITTA 2ZX6A 4QDMA 3IARA 4D6CA 2ZUUA 1W2PA 4M82A 2BWGA 1K4HA 3WJZA 3SCSA 3WQPA 1FVPA 2PGFA 1LOLA 3W1LA 4H01A 3FN9A 3DFPA 5I2UA 1VBGA 2CBJA 2Z4GA 3CIVA 2PDIA 3CMJA 1XD0A 2O56A 1ME9A 1ZAJA 3L67A 5BU9A 2ZXQA 1VF8A 4Z08A 2HPMA 1E3XA 2HXTA 1E5JA 3D46A 2ZKMX 2D73A 3UY8A 2WBGA 3SSZA 4K68A 3W7LA 1BFNA 5E93A 1WKYA 1F4HA 1NDYA 4G7FA 4MB4A 4A3YA 3G24A 2INEA 4PCNA 1Q3NA 2QCEA 1VEMA 2F38A 2WQPA 3HO8A 4PMJA 3N9KA 1G5AA 2WJZA 3WF1A 5HQLA 4B92A 1TPDA 1E73M 4UIOA 3DHDA 1QW7A 2D2HA 1F8IA 3UPBA 3BMVA 4BF5A 2PCQA 4DJDC 2Z0IA 6REQA 1GVRA 4DHGA 4KFNA 4B2DD 3TNOA 1KR1A 4HNLA 1WYIA 1V3MA 4FF7A 3S1GA 1FH9A 2D23A 4F48A 2J7CA 3LHUA 4IF2A 1TJRA 4R7JA 5LA0A 1OIMA 4JTAA 3HQNA 2GOKA 3MU7A 3S2NA 1W56A 2CYGA 3WQ5A 1GYNA 3POCA 4QJ1A 2R1PA 2WHKA 4I6KA 3WBEA 3LX9A 5BXPA 5D4YA 1RQHA 5A6BA 3EEZA 1UZ1A 2G5WA 1UUMA 3JU2A 2GGJA 4MTVA 3G0XA 3LBCA 4UZSA 4JTCA 4YPJA 4OKDA 2WCSA 2BOEX 5AZ1A 4DBWA 3ZR4A 1L2QA 3AO0A 3U4FA 5D02A 2I17A 2VNCA 1U1HA 2OOFA 3FXYA 5A8NA 2BZNA 4YS1A 2E40A 1LQ0A 1IIGA 2EKCA 1N8WA 3IANA 3I10A 2JF7A 2XPKA 5G2HA 4AVNA 3H70A 2YCEA 3A64A 3OBEA 2VELA 1D7KA 4TX9A 2WLZA 1WV2A 2DP3A 1JF6A 5L9FA 3EX1A 3AAMA 3AIEA 3HA1A 4LRTA 3PF3A 1XS2A 2XN0A 4PUUA 3SCPA 2O0TA 1QWGA 4JFUA 3B8TA 2ZUTA 1KM1A 3M4HA 3OA3A 4RZBA 1V3LA 1XISA 4DVOA 4Q8TA 1WKEA 3FX4A 3G22A 3H7VA 3CV2A 2J75A 3II1A 1ITUA 3PBWA 3QLLA 3IWPA 3ISIX 3A4WA 4FO4A 3O15A 1QNQA 1JUKA 3V4BA 4WDWA 2E28A 2IMRA 1UIPA 1AD1A 3E5BA 3PWAA 3CO4A 1GQIA 2MANA 1NIUA 4M24A 3TC3A 4B9ZA 1DXEA 4DNHA 3P60A 3D3FA 3CHFA 3W70A 2FHFA 3L65A 1WUEA 4W5ZA 4ORMA 2D2GA 1JAEA 3B40A 3MY9A 4JYDA 4LH8A 2DIEA 4YHGA 2BHYA 4JTDA 4GVHA 4Q4MA 2EG7A 3KHDA 2QDHA 3DBNA 1I0DA 1IEIA 2E5CA 5FJTA 5GJMA 1F4AA 2VX6A 1I60A 4EPEC 1SSGA 3WD0A 1H63A 4KWOA 3EXSA 1XQLA 1W5OA 2FZDA 1ZBKA 4ZOCA 3BGGA 1FWCC 1XSJA 2OYMA 2C0HA 4B16A 1W17A 3GDMA 1EWEA 5L6UA 3GLCA 1UR4A 5DT7A 4LAOA 4K36A 2AL2B 1ZAHA 4WD0A 5FESA 1KM5A 1I2PA 4W86A 2VCAA 3R79A 4PTVA 4ILSA 1G0CA 1CXIA 4WKHA 1S1PA 4LGXA 3MV01 1JCYA 3N25A 1FWSA 1DWAM 2W0UA 3WJSA 2R82A 4F79A 2GWGA 4AMCA 4JS3A 4CNUA 1UWRA 1HJQA 4E4FA 1SZNA 1E72M 4DUOA 1L6GA 3LGGA 4IUOA 3L2MA 4F66A 2WYSA 4PBGA 2FDMA 1U1JA 4BQ5A 2IKIA 1QPOA 3G1SA 2WPBA 2FVMA 4IXHA 2WZEA 4UMBA 3SGGA 4UOJA 4DIAA 4AX7A 4IJRA 1WP6A 4FLQA 2QKFA 4O19A 2ZUMA 2E6YA 3ECQA 1P1MA 4NX0A 2H8XA 1A47A 3WQCA 3GKFA 3AQUA 5EPDA 1G9HA 4FOKA 4FNRA 3P81A 1OF8A 5FL0A 2YZ5A 1WZAA 2XZ7A 5KETA 4IMFA 3ZVIA 3DXIA 5FCZA 2I5QA 3CIWA 4X9SA 1P5BA 1V3HA 4P5UA 4MADA 4MY1A 1E6RA 3M16A 3LERA 4GIRA 1CTNA 1PDZA 3LK6A 3BL3A 3BJFA 4QRNA 4PUKA 1AL8A 4XIMA 2CEQA 5AY7A 1UR3M 2XHYA 4ML4A 1XV8A 1H0IA 4UTHA 1Q85A 4O1FA 3W7EA 3WSUA 4LEFA 3NO3A 1QRQA 3CTLA 3EDFA 4R9OA 3W2UA 2FHCA 5DBUA 3AISA 1S46A 3WUEA 2OX1A 2FGZA 5I23A 5ABEA 4DLMA 4WY0F 5GNZA 4V28A 1V6TA 3PS7A 3NWRA 4AD2A 3VNLA 2X05A 2P53A 5C2XA 1Q6CA 4AZGA 1JCMP 3N4AA 2R14A 2WNWA 3TYZA 4LAKA 4MYAA 1CLXA 4KWWA 3TTQA 4LUYA 2MUCA 2Q3RA 4YYCA 1EKOA 4AD4A 5DBTA 1U33A 3VXGA 1W1YA 1IXNA 4S3AA 3PUEA 1E4IA 4R33A 3A5VA 3GTXA 3FKRA 2QCMA 1A5CA 4GBDA 4S3JA 2HS6A 2OG9A 4JIRA 4JZ5A 3ES7A 2VWSA 2HZGA 4LF2A 4JAWA 2PUZA 3T42A 2J7DA 1TE1A 3THAA 4UQDA 4W8LA 3FXGA 1YKWA 5GPRA 3RJYA 4H04A 4WY0A 4AW7A 1HXJA 4W8BA 3T8QA 1J10A 2H9AB 1E55A 3MWAA 5A95A 1FUYA 3ALFA 3M64A 1HQTA 1BWKA 4O8AA 3ZQ9A 2OO0A 3DI1A 2X1IA 3L21A 4XAFA 2DZBA 3KDNA 4C6LA 3WNNA 4JQ1A 3REQA 4GIYA 1F07A 1U5JA 3G2GA 8CGTA 4PTNA 1WNOA 4KETA 3N11A 1UD8A 1OGBA 4YMZA 3W7QA 1W6TA 3OZMA 3VTRA 4IL2A 3IV3A 4YIWA 2YSWA 1ISVA 3FCPA 1TZZA 2V3FA 2XU2A 3LA4A 1O1ZA 1EJ7L 2CETA 2X42A 1XLBA 4LRSA 4ZZ9A 2PFHA 2BGSA 2EQDA 3GZ3A 3QY8A 2Z1BA 3GDLA 1W9BM 1O7AA 1B30A 4NZ4A 4YVPA 1C29A 4GI9A 2E0PA 3NQAA 1MEWA 4P7OA 3VDGA 5LSMA 1XLHA 3UA4A 3TW9A 2C3ZA 3THQA 3UCQA 3RG6A 1AW1A 4WRHA 3DFOA 1CXKA 3NIYA 2WJEA 2PDBA 2XVLA 1UOKA 1B3XA 4XZLX 3WLPA 4M7TA 2D2JA 4IQLA 4GJJA 2X1SA 4IIEA 4DJEC 5C2GA 3U3HA 4PMNA 2XGBA 3TXZA 1BRLB 4TV6A 2FMNA 2D3LA 4NKCA 3E0IA 3HQ1A 4XD3A 3UYIA 3MDWA 1RLDA 2WZIA 1SW7A 3WNKA 3S2MA 3OZPA 3TN4A 4WGHA 4CNPA 4CCZA 6A3HA 5HPCA 4UMAA 1Q45A 4NAEB 3USZA 4ZEPA 3FA3A 3BCFA 1EGVA 3TTYA 1WUFA 4YNGA 1EF2A 2X7VA 3M44A 6ALDA 2OU4A 3APYA 3GFZA 3QV9A 5E6ZA 1H4PA 5C0QA 3DHUA 2D24A 4J9JA 3KRBA 4V15A 2GGEA 4DO7A 2Z28A 2CU0A 3VIPA 1XWYA 3LBOA 5MHBA 2J47A 3HJZA 3EDDA 4J28A 1RJQA 3ALGA 1NP0A 2GVGA 1XYAA 2OYKA 1EYEA 2GUYA 3FA5A 3KVKA 3AROA 4UNLA 2PF0A 5C5YA 4HNNA 3U8GA 2FB2A 2PWFA 3FA4A 2SFPA 4KCWA 4KESA 3V0UA 1XDLA 3SRDA 3VD3A 4AIBA 3AYSA 4XKYB 5LIKX 1OFAA 2C8NA 1YHTA 1SVDA 2PP1A 3I3DA 1MEIA 2WMJA 3U7BA 4JPGA 1JDEA 1H1ZA 4GFIA 4DF0A 3QFWA 1T96A 3MBDA 4P7NA 1Q6FA 1BYCA 1RP9A 2DT1A 2WSRA 5A6MA 1I75A 5AB3A 5HAOA 3NJ3A 4Q6JA 2J7HA 1D8CA 3NDZA 1XIJA 2DEPA 3RDKA 1E6PA 3LYEA 2PB1A 1FWFC 1KFJA 3TSDA 3VOJA 1ML1A 1TCMA 2Y6ZA 3EB2A 3I6RA 3TWAA 3FW6A 4JTGA 3SIMA 5I06A 3T9PA 2XJ7A 2VJXA 4DZAA 2Q02A 3EYPA 2BVYA 2WNZA 1HKWA 4MLRA 1L6SA 4NNBA 1TTQA 3GIPA 3LPOA 1SFSA 5HR6A 1A5UA 4NJGA 1H60A 1V02A 2OZ8A 1EJSC 1P43A 2OWWA 5I24A 1Q6LA 1YNPA 1M7XA 3FLUA 3QR3A 1QASA 4Q8UA 4LNYA 3TQVA 3CZJA 2I9EA 1AD4A 4NRSA 3WK1A 2DVUA 4ZVJA 4S3CA 4OECA 4UQEA 4KEUA 1SO3A 5CGQA 1KFCA 1V51A 1IZKA 4GVFA 1PZ0A 1UKTA 2Q6ZA 1XC4A 2VEIA 5CPOA 4F9DA 3SGZA 4D2JA 1VFFA 1F8MA 1PZ2A 2X16A 3B04A 3NFUA 1WA3A 3M6DA 1V6YA 4YJ5A 3MKCA 5F2GA 1UQYA 3QYQA 3UYCA 1OB0A 4MNKA 5LGXA 1P6CA 2XSBA 1TR9A 1KNWA 4H6RA 4C60A 1E0VA 3URQA 2GUUA 3E2RA 3MSGA 3VKBA 4LBSA 5JU6A 3VCCA 4LAMA 1GK8A 4WOQA 4XVEA 2E25A 5I3HA 2VP8A 3IAQA 4XD6A 4PFHA 5ABTA 5AC8A 2ZC1A 4HQVA 3VGDA 5JQ9A 2QCGA 5K9CA 2JKPA 1GG0A 2QLYA 4MDPA 5CZJA 2WK2A 4AWTA 3A9IA 2TMDA 4N7QA 3UZXA 5CC5A 2VDGA 3CC1A 3LCIA 5CSSA 4IM4A 5A8MA 1Q6QA 3UXKA 3WJXA 3R8GA 5F7UA 3P6LA 4A21A 5HNTA 4KFPA 2HMCA 2ZTJA 3PANA 1AH3A 4XTIA 1A4LA 2WM0A 3VD4A 3UA3A 3BOXA 5LIYX 3WKZA 3RM4A 3EA1A 5LNUA 1GOMA 1TELA 1NF7A 5C9UA 4OBSA 3GC5A 1ZCCA 3T55A 1R87A 4GZ7A 2DZAA 4R3UA 1XLIA 4OE7A 3CV6A 6CGTA 2GGIA 5M5DA 3FVDA 1P1XA 3GVVA 2VCCA 4ZE4A 3IK4A 3WD4A 1IWPA 3AMCA 3I4KA 3MUIA 5HDRA 3VNIA 4XAZA 3NNTA 4XBSA 1DJZA 2FVKA 1REQA 4RCXA 4JN8A 5HR7A 2QJIA 1SSDA 3W1PA 3RR4A 4W84A 5FA5A 3LU2A 5HQEA 5G1TA 3O6DA 4WDXA 3LZ5A 1VC4A 4B91A 4UB9A 4H7CA 4ZENA 2E68A 4O15A 4C1LA 2FGLA 2PDJA 3B4YA 1B3VA 1C91A 3THCA 4AEFA 5AVNA 5CPTA 2W4XA 5D9PA 4B3KA 2ZYFA 1MZRA 1LLZA 3CUHA 3T4CA 4FXSA 4K3ZA 3C0QA 4NT0A 4E4UA 2OR2A 1KXVA 2QUTA 4WLCA 4KWUA 3W2JA 1EP3A 4E5TA 4O0QA 5A8GA 4IPLA 4PBEA 2DT3A 4HPNA 3U7VA 1DIEA 1NOUA 3O6AA 2DGAA 1IT7A 2A85A 5FF3A 2XVGA 3S5NA 4PCTA 1UWTA 3LB0A 3C2FA 2W27A 4RK8A 1TB3A 2A7PA 1M68A 2F7FA 4IGMA 5HANA 1KXHA 2ZX5A 4TOQA 1E4MM 3TJXA 5A5WA 1BYBA 2WZTA 3QTGA 3C61A 1W1B1 4LNCA 1JZ7A 3AOFA 4O16A 3VPLA 5I77A 1KRCC 3WLHA 3TYBA 4RDZA 2CLOA 3D6NA 2WKGA 1VR6A 2X1TA 3CZLA 3OA5A 1BWLA 3AYRA 4GYKA 3T0TA 1EX5A 3OGVA 3VGGA 3HBLA 3IJIA 3TK7A 3BVJA 2X41A 1WZMA 2C14A 3LRLA 4DEFA 1ONXA 3BW2A 3H6OA 3K4AA 5C7HA 4AZCB 1NTHA 4XKYA 1C9DA 3EWXA 1EZ2A 5B7ZA 4HMDA 5LIUX 4DZ5A 2XISA 4NJKA 4CLMA 4C6FA 1O4UA 1OD0A 1GQKA 5C55A 2OWCA 3AHZA 1ICPA 5A6LA 1O1HA 5HOSA 3NTYA 4IH3A 2O7QA 3G18A 4I9TA 3UEQA 3QY6A 1H7NA 3GY1A 2ADAA 4GYJA 2WSQA 2DZSA 3EB4A 4Z17A 1PIGA 1OGGA 4LUTA 1W9XA 4H6QA 3PUGA 1LQAA 4KBXA 2VD9A 3D3AA 2W67A 4GWEA 1U2YA 3PZVA 4C7GA 3PY2A 1X1OA 3NQBA 4QE4A 4NF7A 3EOUA 2B0MA 3S42A 4PN2A 1RBLA 4MG4A 4ZSUA 1V6VA 1NY1A 2Y8VA 3C52A 1TV5A 2XYLA 4H7VA 4D6FA 3GW0A 3TW6A 3QV8A 1JCLA 1Z3NA 3LNPA 4FI4A 4ZQMA 2OQHA 3AICA 3SCOA 2QUMA 2F84A 1P7TA 4MJZA 3QSTA 3F7JA 2VZSA 3MI2A 1J93A 3E0LA 1ELSA 3Q45A 3ANVA 1GOIA 1PB0A 5HQMA 1B5TA 2V2CA 3LD5A 2QIWA 2ZZ3A 3MW7A 3P67A 4W7VA 5D2XA 4FNPA 5LNSA 5BROA 1VBHA 3WY1A 1QI2A 3QR0A 4EACA 3R11A 3W85A 3HQPA 3PBMA 4HU8A 2G41A 3KZSA 5FIPA 4QE5A 5EBAA 5JBFA 3W1UA 4WJ8A 1XBZA 4IG2B 2WWCA 2O9TA 2PC8A 1HJVA 2VGGA 4INFA 1ADSA 1MUWA 2BMBA 1FCBA 4BEQA 1V79A 2VZTA 1NWSA 3F1QA 2DJXA 5FL1A 3NQVA 5I3KA 3WUFA 1MW1A 1Z42A 1YW1A 3DYMA 3GXMA 1A80A 4EKJA 4DI9A 5A8OA 1MQQA 3TX9A 2PDFA 4HHHA 1QATA 2BY0A 3AIVA 4Q6XA 1JDDA 4XISA 4FXFA 5BNKA 5C54A 2PDUA 1TKKA 1UD6A 3E9AA 5FSEC 3TJ4A 5AKQA 3RIKA 2VZVA 1GKQA 3Q58A 1WPCA 5CLWA 4E2OA 3SSJA 2GJPA 1Y65A 2AKZA 3QKEA 4PB5A 4QDWA 1I45A 2OSWA 1AQFA 1W8GA 2D22A 4Q3MA 5EMKA 2H9AA 4K7YA 5FJUA 4Q8PA 1I2RA 3DZ1A 4IFOA 3CAKA 3W84A 3H7RA 3IIOA 3FOKA 1QI0A 2ZBTA 1W8SA 1IXQA 3M07A 4GC3A 3U2EA 3B0VC 4IFKA 4JX6A 3A4JA 2BOGX 1LUCB 1MXGA 4P7QA 3LLXA 2CC0A 5FACA 1KA9F 1UKOA 4A35A 4U28A 4IQEA 1V7AA 3SUSA 5I6SA 1TRDA 4PE8A 3VKCA 2YB1A 2DSVA 4JHZA 2DH3A 4GD0A 1LWIA 2V67A 1VIWA 3K5XA 3HZ3A 2ZC8A 3APTA 2F61A 4JFVA 1JNEA 3QVQA 3V75A 1R9XA 3SJ3A 1TV8A 3BAXA 4QSFA 3CZKA 3KL5A 2P1FA 3P93A 1LRQA 4UOQA 4OIFA 3GAKA 3L5AA 5HBFA 2Y2WA 3P74A 3W1AA 1DQWA 2WSKA 3UWVA 1B9ZA 1ZGDA 3UJEA 5FSDC 4BR1A 1OD8A 3VM7A 3W1TA 1UC4A 2YFNA 3P84A 3GFYA 2CERA 1JQVA 1RJRA 3U48A 3UWEA 1WKFA 3WUGA 2Z25A 5AVHA 1S1RA 3RCMA 1C8XA 3LCXA 2QVNA 2NXIA 4MKSA 3QPEA 1F73A 4NU7A 4YVVA 3YPIA 1Y5VA 4YTSA 4JFTA 1XBYA 1UKPA 5EL1A 3IIZA 4PGLA 1CT5A 1Q2SA 2FMOA 2RDUA 2D20A 1HO4A 1PV8A 2FTYA 2Y24A 3W2MA 5T91A 3ES8A 4NJIA 2IQTA 4NZ1A 1CPUA 1RH9A 2V3GA 3E0VA 3N29A 1LZOA 5EY5A 1YIXA 2RGLA 1ITQA 4YCOA 1RY0A 3MMUA 4JIIX 2YLAA 4JFSA 4Z2IA 3KX6A 4RV3A 4Q33A 4XD4A 3ITCA 2ZZ7A 3AUJA 1QO2A 1PIIA 1E40A 1FWGC 3TQKA 3B0XA 8XIAA 4AUBA 2BGNE 2R1KA 4LFYA 1D3CA 4M5PA 5IDIA 5JBEA 3RN6A 4TVUA 3W6MA 3WQDA 4UFLA 1XRSA 3UF9A 4RE0A 1HKMA 4FOUA 4NY2A 2XSXA 1QUMA 3AS2A 5JMUA 1M41A 1H51A 3QHNA 1YPIA 3TN3A 4J3VA 1NFPA 3CZ8A 1FWIC 3AS0A 3T0CA 1JCXA 4N02A 1PHQA 2HPIA 3N3TA 4G7EB 1NFBA 3O63A 1Q6EA 4TX8A 2XIOA 2VD8A 2ZUNA 2BV9A 4AC7C 3FEMA 3O07A 3AXIA 5A6TC 3TQ0A 3W07A 1MW0A 4HA4A 2C0AA 5DANA 3R13A 1B0IA 3MVTA 4MNLA 4J1OA 3FFSA 3HG2A 3NPWA 3B0YA 4BFAA 8RUCA 3CHDA 4MB1A 2ZDRA 1XYCA 3C0LA 4LQ1A 3KL3A 4KFOA 3ZS4A 4PZVA 2XIMA 4N4PA 4EPDC 2ONEA 4QEHA 2Y0FA 3PUOA 1K9FA 3GWQA 3R0DA 5E9XA 2A3EA 3CQ0A 5I09A 5HNUA 1UASA 1JRCA 2H90A 4DBDA 1XIHA 3LCLA 1R3WA 4LVFA 2YDSA 4HJWA 2PF8A 1SJDA 1C3FA 1EP2A 1JEZA 3AZTA 1GYMA 1KRAC 3G1AA 1RVKA 4HT3A 4CNSA 2PEVA 4RZ4A 1RHCA 1G7UA 4ZXOA 2XN1A 4DAFA 5CJ5A 1PAMA 4ZL1A 3W7PA 2X1RA 4GIAA 1LWJA 3U2ZA 2ESCA 2R6OA 3AXMA 4S3BA 4EXBA 1UC5A 1V3JA 3MUCA 4H9MA 2E8YA 1XH1A 4FB7A 1VBRA 1ESWA 3LNMA 3T0DA 4XZMX 1I4NA 3RJXA 3BV7A 1Q4NX 2OT1A 1BTCA 3C5QA 2ZX9A 4Y7EA 3RO6A 4CNTA 1LOQA 5CLTA 1C8YA 3DFTA 1XCWA 1XLKA 4QR6A 1HP4A 4XUGA 4B5WA 5LIXX 2VR5A 1E1EA 3SN1A 4FR6A 4GX9A 5M03A 2NWRA 5BRQA 4EWJA 3OGRA 1G4TA 1HT6A 4WUIA 1R3TA 4DI8A 4KEVA 1VBJA 2QXWA 1W31A 2VC5A 1IR1A 4S3EA 3QZEA 3KTSA 3VMOA 3BWWA 1UR9A 3DC8A 1N2VA 4MIMA 2GVLA 2X09A 5LXEA 2QPSA 2FDSA 1ZAIA 3WBWA 5JIWA 3VAVA 2QJNA 1S3TC 3BICA 4HPGA 2KAUC 2BXVA 2PCEA 4GISA 2X40A 2IUZA 2G3IA 4GUIA 3GHUA 2FIQA 3N2BA 2BG5A 3HOJA 5AZ0A 5DMYA 3EX4A 5A6JA 1OQFA 3AHYA 2ZZ2A 3XIMA 2FQIA 2WHLA 5AN7A 1JR1A 3W7MA 3DFNA 2J77A 3WQ8A 3DOPA 4QDPA 5G1YA 3R0UA 5F2IA 2I9UA 3NOEA 5D2YA 3NUKA 1ZBVA 3AUOA 4M1RA 1O5RA 3CAVA 3RPTA 3HPZA 4PCFA 1PO9A 1EHAA 3VZZA 3PG8A 2FPVA 1Y8BA 1OK4A 3KCOA 4WY0B 4GZJA 4DN1A 1XQKA 2BODX 2EPLX 2FFIA 5C9WA 5I07A 1LF1A 4LOCA 4ZOBA 3WLRA 3IJ8A 4NNAA 2A1YA 3V5CA 4BK9A 1FHUA 3P2VA 5C7VA 1KM3A 2Y62A 4JCLA 1YADA 3L0NA 3UXLA 5FJPA 4RNHA 4PMXA 3M7SA 3H2MA 3QPYA 4UQ9A 4M6UA 3G8RA 4E3VA 4UQCA 4A4AA 4XD5A 4B5VA 4GVGA 1ICSA 1UKQA 2OEMA 1ONWA 1UUQA 3H21A 1IT0A 3VGBA 4Z1CA 1QOPA 4AWEA 4NQ1A 1W5MA 1Q7MA 4J3XA 4PEKA 4BI5A 3C4UA 1KWGA 1RXOB 3V1PA 3DX5A 3QW4B 3TR9A 1OX4B 1W2VA 3CWNA 5JH2A 3MP4A 4J7RA 4LBRA 1FQ0A 3ABSA 3SCUA 4MGGA 3VIMA 2W63A 1U5HA 3OIHA 3ZWTA 4MHBA 2PDGA 1F6KA 2Z1XA 4DZHA 3E38A 1FDYA 4Q4PA 2QW5A 3TJLA 3OOQA 4EXAA 5HATA 4P2VA 2XTKA 3GUWA 4OQVA 3ZMRA 3TE9A 1EEPA 2OOGA 1G6CA 3HGRA 2ON3A 4J3TA 4ATDA 2I14A 3PNUA 3NVDA 3UGRA 4B4HA 2XWDA 1XGZA 3UZWA 1XBXA 3L12A 4P8UA 1V08A 1UR1A 4CQAA 5JVLA 3VC6A 4FSAA 4R9XA 4UCGA 1L2UA 3CB3A 1IV8A 4MFEA 1TJ2A 3P5ZA 2TAAA 4Y8FA 1NF0A 4M8UA 1ISWA 4BA0A 4REQB 1FWTA 1VRDA 3ITVA 4GZEA 2AQVA 1Q2RA 3MSYA 4Y9NA 1CYGA 1M01A 1G1YA 4L1GA 1VRXA 1JPKA 3LDVA 1YTEA 3NSNA 3S2JA 2ZUWA 2Q71A 4RDVA 4NI3A 4UTWC 5JH1A 1P0EA 1YXCA 4IWWA 2BY2A 1OBAA 2Z2BA 4DXKA 3DFSA 5FEZA 1AZ2A 3WD1A 4B5UA 2ICSA 2YCIX 4IICA 1FH8A 1C7TA 1FWNA 1WAUA 2NV1A 1Q8JA 2GGGA 4HCLA 4JX5A 3AMKA 4FIQA 1KTNA 7ODCA 3KRZA 4H9XA 2F8QA 1E51A 4U31A 5I5RA 3PBVA 3OJGA 4PEEA 1J5SA 4GINA 4NSBA 1J96A 4PMDA 2E5BA 2JE8A 4FK9A 1AVAA 1K8CA 2PSNA 4AYGA 8A3HA 4CEUC 4YCPA 1FCQA 3CPRA 2IS7A 3FJ4A 4HSNA 3W2LA 5KSWA 1OT1A 4LB4A 4EOUA 5D32A 3LM7A 1F74A 3EX3A 4GRSA 2X2YA 5FEXA 1KGXA 2ATSA 3KLKA 2WKJA 4RJEA 4Q4RA 2R1NA 2DW6A 3NQ2A 1E43A 3CJPA 3T6CA 3D5HA 1TRIA 1LRTA 3H2AA 4IT1A 1GJPA 4LY4A 1CI1A 1FBAA 2Z24A 3BJSA 3PR2A 4QISA 4GCXA 1NDWA 3H23A 4HHPA 1O94A 4S3DA 3WO8A 4PBFA 3OLEA 4KCTA 4B5XA 4JQ4A 4HPHA 1BYDA 3C3NA 4H2CA 4IL0A 3Q2DA 3LN3A 1VCVA 3CUGA 3KVMA 1EXBA 1GOQA 4ALDA 4D8AA 2J13A 5ECUA 2VEPA 4FXJA 4IGSA 4HCDA 3IJ7A 2AQWA 2VFHA 2BY3A 1T8XA 3W7GA 3MCMA 4JYFA 1LCOA 2XM1A 4KCVA 3N1AA 3UZZA 1A5AA 2ASHA 3B8UA 4K37A 3Q37A 4DJFD 1M53A 1PHWA 4AG0A 4ONVA 5G5IA 4U3CA 4WEVX 4GYPC 4L80A 5C6MA 1N82A 3E02A 4UTLA 4Z1DA 3KLLA 3RMJA 1O60A 3GE7A 5FD0A 3WMBA 3TVAA 1WCGA 4TTGA 2WVVA 5DN1A 2Z6JA 4AC1X 3TH6A 4MZ1A 3W7KA 1YTDA 1E6QM 4TTUA 2NUXA 4PCPA 3QY7A 3VIJA 3G1VA 4QP0A 2IPJA 2GJXB 3PTKA 1VP5A 2DSUA 3CQJA 3BH4A 3K13A 3EX6A 3F4CA 3GIQA 3WLJA 3U0HA 1C93A 1DJNA 3WEZA 3TZFA 3OLDA 5M3WA 1W9VA 4GQRA 3LLDA 2X0SA 1SPQA 1XFBA 1TQJA 4X22A 1AJ2A 4H4IA 1SFTA 1LG2A 3FSTA 1AA1B 3EPOA 3G1FA 4AHOA 4IXXA 5G4EA 2E1WA 1XLAA 4I7VA 1DV7A 2VM8A 4P8VA 4Q22A 1ZCOA 4E8CA 4F0KA 1OFPA 2W91A 3CEUA 4C6QA 1S2UA 5CQ1A 1DJIA 4JYEA 3ID7A 2E5DA 1XIGA 3MKKA 3T08A 3LI1A 4DRSA 3GG8A 3GHSA 4HMNA 3GTFA 3TP4A 1VYSX 3HG3A 3A4XA 3U9IA 1KCXA 4MSSA 4JQAA 1SZGA 3KVLA 2HVOA 4LUSA 3VDBA 2REQB 4TMCA 1OINA 3WG6A 3ZSSA 3DKJA 1JXJA 4S2BA 3WF3A 4O57A 1TMLA 3N14A 3FAWA 2UWFA 4QBXA 3OLIA 4XVDA 4A2SA 3NQFA 1MFUA 4O4WA 3UGVA 1EXPA 1NOFA 5IBXA 2R94A 3D47A 3WENA 1QNSA 3M0KA 2CHRA 3FJLA 4OGZA 4ZMGA 2NX3A 5FF0A 1VENA 5FOOA 1VS1A 3C2YA 1XXXA 4L1WA 2UY5A 1RR2A 5CXPA 1HL9A 3S83A 5CSRA 5MKGB 3QW3A 2QMKA 3H4XA 2OKTA 3RRAA 1E1CA 2VUYA 4GJ1A 2RDTA 1DWHM 4M6PA 4UTJA 4D6JA 3FNDA 3AMDA 2J78A 2CLMA 1V6XA 1DJWA 4ZQNA 1SJAA 4NASA 1JFXA 3FHAA 4PTWA 1GOKA 1EDGA 1P4CA 4PCSA 2V5LA 4CU8A 4S1FA 3F4WA 3WDQA 3TN5A 2P88A 4KWSA 1C8QA 2C1HA 2A3CA 3EDJA 3LTYA 4LT9A 2F6UA 3RITA 3OW1A 4WKFA 4IMCA 1IT8A 2G50A 3BDKA 4BWLC 3PWIA 2WCAA 4NXKA 1VQTA 3W75A 2G3NA 2DIKA 4ES4A 3SCVA 4IP4A 3WMCA 2CITA 1DPMA 2A0NA 4NXSA 1S5NA 4XZIA 2NWSA 1W3JA 4OV9A 3RX4A 1FHLA 3AWOA 1V03A 1SZEA 3PPFA 1JPHA 1SW3A 5KMYA 4WKAA 5DRIA 4J2PA 4BCEA 2ZA3A 5BXSA 2V2DA 4M56A 3CQKA 3NG3A 2E4TA 3MKVA 1UWQA 1S2CA 3UETA 3CUIA 4HA3A 4IPJA 1HX0A 2HBXA 3TLQA 4Q32A 3RYSA 2R1LA 4Z2HA 3WLKX 3GHRA 1HKVA 3LV6A 4IMAA 4U5KA 4IZGA 3RU6A 2Y7EA 1WDDA 1CGXA 4MZYA 3CYVA 5AHFA 1EPVA 4PB4A 2PGWA 2WC7A 4OU1A 2CPUA 3GO2A 4FNSA 2V63A 3ZJ7A 4AZBA 4H9TA 1V6UA 4FNQA 4X3ZA 3K46A 3S9IA 3QEZA 1ZS2A 3RRXA 3GK0A 4Z2JA 4JOMA 3K1DA 3I4EA 1TZ9A 1FFQA 1RCOB 3U2OA 4TVCA 1CWYA 1QK0A 3W22A 3JS3A 5GVJA 5B80A 3RUBL 4F9JA 5FJOA 1H7PA 3OVGA 1ZUAX 1K03A 5AYIA 5K4ZA 4ZFMA 4I5UA 4W87A 1ZFJA 3QZAA 4LV9A 3UWYA 3P14A 3B8IA 5G2IA 2ZA1A 3GAYA 4AHQA 1V3IA 3ARPA 3UNTA 1VHCA 2JKAA 4RE3A 2ZIDA 4AY8A 4XV0A 4H83A 3DESA 3DYOA 4GY7A 1FY6A 2C18A 1JPIA 2IKGA 4JDYA 2GZXA 4CQDA 4GZIA 2WMKA 3RLUA 2FTWA 1DIKA 2QNEA 4HVXA 2HK0A 1JZ2A 3WBXA 1JDCA 1XCFA 3QQ1A 1W3NA 2BVWA 3M5VA 2PMQA 3GVGA 5A1AA 1XIIA 3WNMA 3HFYA 2OFJA 1ITCA 2J25A 4G9PA 3N4EA 1J79A 3U57A 1CB2A 1PX4A 4PULA 5A3HA 4GUGA 2WQDA 4QS6A 3PJTA 1S2AA 4IMEA 3GH7A 1E56A 3KUMA 1TPH1 3E96A 4DWSD 1PVNA 5C70A 2V8ZA 2JQXA 4GPNA 4AF0A 2J6VA 4R7WA 2J9XA 3MA8A 1L9WA 1WBJA 3P0WA 2J8FA 5TAOA 2XGZA 3R2GA 5GJNA 2FJUB 3MV11 5CPSA 3N2TA 4FNTA 5H91A 1VEPA 3BLIA 3CT7A 3UG8A 4O10A 2DZPA 4NILA 3H2NA 1E3ZA 4DELA 1KKOA 4IIGA 9XIAA 4AIEA 2IKJA 4QCFA 3WH5A 3JRKA 4DM2A 3WZ0E 4EK7A 1CENA 5IHSA 1JI1A 2DSWA 4FIRA 4IP7A 1O68A 1DBTA 3LCGA 1R0MA 3OBKA 4GH1A 4N9BA 1EQPA 3PJXA 4A05A 1KFEA 5K3VA 4AFYA 3FJ6A 2WJDA 1OGSA 2YA1A 3L7RA 4EPKA 1N8IA 3V5FA 1A49A 4CN6A 1R6WA 3EB3A 4RZ6A 5AC7A 2WHJA 3G1XA 1US3A 4GYFA 5FEWA 5AHMA 4DUWA 2B81A 4A3QA 1JDFA 2C13A 4WK9A 4LS2A 4O17A 3QJAA 3D0CA 3CT2A 4IQDA 1VPXA 2YOCA 4LY8A 4Z1BA 5A6AA 1OWQA 1EJTC 1M6JA 4HB7A 3MI3A 3TMLA 3E49A 4Z2LA 3LUTA 3QSRA 1LOSA 4XZNX 1TG7A 4WJEA 1KM2A 4TQTA 2YXGA 3NQ8A 4KRUA 1X7IA 1HP5A 4G56A 1TPEA 3AFBA 5H8PA 3O3RA 3OGSA 1UR8A 1OSEA 1S3HA 3VIIA 4AMAA 3VMNA 4X2PA 3H26A 4Q7NA 2W79A 4LANA 1AODA 3VABA 4KMQA 5KEZA 2DVXA 5J5RA 4GI4A 4WOZA 1XDMA 1E0UA 4E6MA 3BSGA 5J5DA 2VQUA 4BZYA 1W1ZA 3VIGA 2HCVA 3HM7A 2EPOA 5C71A 4X61A 4XWUA 2D0FA 4RXFA 4JNMA 4M29A 1UJPA 1ZNNA 2J7FA 3ZXWA 4PMZA 1QNOA 1EO5A 4M6QA 2NUWA 1M3UA 1ODZA 2POTA 5E9AA 3LXAA 3VZXA 1US2A 4HGXA 1KV5A 2JEPA 4HJFA 4LVBA 3T78A 3UG5A 3SCWA 2ZFAA 3NL6A 4O52A 4F8XA 2NW0A 4PUJA 1W1A1 2HWGA 3M0ZA 5DCEA 1GYLA 3STCA 3M6YA 3FYOA 1LUCA 1VPQA 3A22A 1R7AA 2G4FA 3P62A 3L5MA 3EWDA 3BLEA 1C7SA 2Z1VA 1PYMA 3H55A 4Z0SA 3ZSTA 2G4JA 3LPGA 5AHLA 4GKTA 1XYMA 1FCUA 4GQ0A 3IACA 1W32A 4UWMA 1TJ1A 1OADA 2TRSA 5IDZA 3LY0A 5DQPA 2DDXA 1QW9A 2EO7A 1UPPA 1UA3A 1XSIA 1EC7A 4HNOA 4M6VA 2VC6A 3L4VA 3EOEA 3EXRA 1GZ1A 3UR5A 3F2CA 4ZOAA 1K7FA 3GTHA 4Y8EA 3S9YA 3QM3A 4CVUA 2LLEA 3N9SA 4GGBA 1PCWA 5ABFB 3TJIA 1P6BA 1UH4A 7CGTA 3DAQA 4IMGA 3B05A 3ARSA 3W86A 2V9DA 4ICCX 2OODA 4C5ZA 3L68A 2P0IA 4AH7A 3GS6A 2V82A 5A2BA 3QMSA 3W7HA 1GVOA 4R5EA 1S2WA 3CQIA 1QO5A 3HN3A 3TLLA 3CWOX 3SY8A 4LCQA 4RE2A 1QXLA 3DDMA 1AH4A 4G1KA 1GWJA 2CZEA 1EA0A 4HPXA 4ZTYA 3MUXA 1XLFA 6TAAA 2YCKX 2YGYA 3RU8X 1V02E 3W29A 2ZVIA 4JN6A 4LUTB 4RPQA 4L64A 4KRZA 3OLGA 3IJ9A 4OOUA 2HE8A 4UFIA 4O1AA 4FX7A 3SGUA 4NAFA 2DSKA 4EP8C 3HG5A 4K1WA 2YW4A 3MP5A 1MUMA 3AMGA 2VGFA 5BRPA 4C91A 4AD3A 4QJ4B 5AFDA 4BWLA 2GQ9A 1R3QA 1WQ5A 2O9RA 3SUUA 4ZO9A 4OVXA 3WF4A 3S1XA 2I16A 3HPSA 4FX8A 3TYCA 1UH3A 4LAZA 1XG4A 3ME3A 2GDUA 1GTEA 4CN1A 1R2RA 2XH4A 2YL5A 1VBUA 1QNRA 2XZ9A 4BS0A 1J2BA 1RPXA 3CMFA 4ZB5A 3U5YA 2HNEA 4E38A 3UP8A 2WM1A 3K30A 4MWAB 5D9OA 5BOFA 3BMXA 3F4NA 4WF7A 3HV8A 3GQYA 4US5D 1D3GA 3GZAA 4WZHA 2OEJA 1NQ6A 2W66A 4EAMA 2JALA 1ECQA 3CEPA 4JY9A 5KZMA 1GJWA 2J74A 3SBFA 1YYAA 3B8VA 2YCLA 4PUDA 1TV2A 3M0IA 3WNPA 1FX6A 3RX2A 1B2YA 3SRFA 3ABZA 2C19A 1UJQA 1H50A 9XIMA 1NSJA 2PDWA 2JGQA 3EDEA 3BUVA 3KZPA 1BEUA 1Z48A 1FWJC 1RAKA 2VOTA 1A5OC 2EG6A 2WCGA 3AXXA 4KKXA 2VX5A 1XBVA 3BLLA 1E1FA 1NDZA 3G77A 2OSYA 5B7YA 5TNVA 3T7VA 2PDYA 4WDUA 4OJYA 3WUBA 4PUNA 2Z7KA 5F4WA 2D0GA 3CH9A 3M0JA 5CJNA 4PTMA 2ODOA 1CXFA 3S5SA 1ZY9A 2CIPA 5CZSA 4J3ZA 4ASTA 3WQ4A 5ABFA 3BCJA 5MKGA 2D0HA 2G0WA 4K39A 5CPNA 5TQLA 1SMDA 1VFSA 2ZA2A 1EJUC 2PS2A 3BURA 4M81A 4A22A 1PX3A 2A7NA 3VIHA 5F4XA 5DCBA 2NVCA 3VM5A 3CPGA 5D04C 1MVYA 4JKLA 3ITYA 4UTFA 1EGMA 3U6WA 4JHMA 5BOEA 3G1RA 4US5A 3TDFA 5HNNA 2WPGA 3ATZA 5GJPA 5HWMA 2NV9A 3WLNA 4HHMA 1E6ZA 1SMAA 4AZIA 3W28A 3EAUA 3ZIZA 3HGJA 2ATMA 3AIUA 3KBWA 3KBSA 5CZ0A 4DYEA 1KB3A 3WBAA 1QT1A 4XO7A 3RMEA 3CK5A 3H54A 4UXDA 4HZMA 3KCLA 4UFMA 4E2DA 3DG6A 3T09A 4ICMA 4UMCA 3CHVA 4DNMA 4NG3A 2NZLA 4GQQA 4XZBA 4CN4A 2L5HA 1F7BA 2GJLA 2QZRA 2V5DA 1A5NC 4KIRA 4KGLA 3M0YA 1OJXA 3ZVHA 2WJFA 2QCFA 2Z26A 3KDOA 2EJ1A 4NNCA 3O0FA 3QFEA 2JGYA 3HMCA 2WZMA 1W1PA 1UW9A 3DHPA 3IIVA 4L56A 4HNUA 1RCQA 2RFGA 2X1UA 4F2UA 4LU0A 1JL8A 1Y5WA 1PIFA 2VHLA 3NQMA 2PP0A 5KITA 1J01A 1Q7QA 4AIOA 5FJRA 1E9IA 2ZWZA 3KWSA 4YTUA 1OCBA 1TPVA 4NRRA 3GBDA 4Q8MA 1W1TA 3S0CA 3UVAA 1YEYA 4J3SA 1KFLA 3AZRA 1K9DA 4ADSA 3I7SA 4UR9A 1TTJA 3DECA 2TYSA 3LBMA 3A5FA 1XR2A 2XN2A 4U2ZA 5FAJA 2F2KA 3KS6A 2WANA 5E0CA 4I9MA 4CNNA 3F4DA 1K6AA 1GVYA 1QPKA 3VKDA 3LCFA 3B9EA 1NFGA 1AMYA 3CMGA 2WMFA 4AXNA 5BW6A 2QGHA 4MWAD 5H2ZA 1LL7A 3DEQA 3WF0A 3CBWA 1X96A 1X6LA 3SB0A 4PUEA 3TC6A 1EOKA 3VDHA 1X8FA 3WLSA 4H9YA 2PGEA 4EXQA 5T8GA 2NQJA 2OB3A 1F9CA 2QCNA 1TR1A 4L7ZA 3I6TA 1P6WA 1TA3B 2O4MA 3BARA 2A6NA 3VDCA 4JDBA 3A4AA 4X0VA 2P50A 1YLVA 3OVPA 4WQ6A 5IRPA 3CGTA 3BSMA 5BWAA 1SZRA 1R3SA 4CQ9A 1YNQA 4R88A 4PA8A 4AEEA 2GJRA 4H41A 4JEJA 4GY1A 1N8FA 2INFA 3LPPA 3QH2A 3S1WA 2WNQA 2PWDA 3TSBA 3R8HA 4L6OA 1SYTA 4JTHA 1A5BA 3SQSA 5G2WA 3NXFA 1TFVA 3PC0A 4AD5A 1L6WA 1VFLA 1R30A 3NXLA 3PN8A 1GHSA 4H6EA 1NWTA 3PTMA 1R46A 3EWWA 3IEBA 1HKJA 3MHUA 4BHYA 1WZLA 3GYCA 5E70A 2XH7A 4D8LA 1OFDA 4I6VA 4LSBA 1LL4A 3NSXA 4IPNB 5LGZA 2XINA 4QGCA 1TE6A 4YN5A 3PK7A 3FSUA 1JYXA 7XIMA 2DSZA 2B7PA 1W3IA 1A5MC 1GOWA 3N9RA 3V16A 1W5PA 2V3EA 4W93A 3V1HA 2F6XA 1ZJHA 3HFTA 2YDQA 1HN1A 1WOAA 1WDQA 2CFFA 2B4GA 2BY1A 3NQ6A 3KOWA 3WFAA 4N9CA 2PLJA 2VX7A 2FZMA 1GEHA 1VJIA 3OYXA 1QJWA 3OVQA 1JUEA 3M1ZA 5A94A 3F03K 3KL0A 4TO8A 4FS9A 2D3NA 3A21A 3PB2A 1E9LA 1TMHA 2Z27A 5DMMA 3UZJA 3DHFA 3W02A 2CLIA 3OP2A 4JKMA 1FWRA 5CH9A 3PPHA 2FGBA 2HEJA 2VFGA 1VLIA 1UIOA 1VFHA 1JD7A 1BGGA 5CKSA 1JJKA 2QCDA 1E0XA 5HNRA 2PWVA 5DMNA 1OC6A 1XUUA 2OT0A 3OHMB 4JIPA 4D6DA 1KBKA 2NLIA 1UZ4A 4LF1A 3EMQA 4W88A 3A3WA 3W7RA 4ZTXA 5A6KA 3VOHA 4ACZA 3Q65A 3PFMA 5D38A 4LVGA 3VIFA 1F5ZA 4FLRA 5IFTA 3FKKA 3EOSA 5JUVA 4LYKA 1H41A 3DU0A 4X9YA 2QV5A 2R24A 2F6KA 1F76A 1UOZA 1X6NA 1LM1A 4DJFA 4A8IA 3VC5A 3KOYA 2YW3A 2XFWA 3KBJA 3ICJA 1TVPA 2GQ3A 5HUPA 1XF0A 4E3TA 1XKYA 1JYNA 3W74A 5BZAA 3CHCA 2A79A 3VGFA 4HSOA 1WX0A 2BDQA 1W3HA 2EF9A 2OSXA 3DYPA 4BF7A 1EC8A 1ME8A 4H2HA 1NP2A 2YL9A 3N4FA 1Z6KA 2YR1A 4B3ZA 1TVLA 3C3UA 4RNJA 1US0A 2OJPA 2Q09A 1J2WA 2AGTA 3ENLA 1J0YA 2BOFX 3DENA 5HMEA 3NZQA 4AYSA 1Z69A 1UR0A 4RZ5A 4LVDA 1WDRA 3M5ZA 3T1GA 4ZFCA 2R1MA 1KW1A 3PZGA 4JR5A 4IUGA 1E6XM 1BF2A 1HKKA 3B4UA 1XYZA 3CH0A 2XGIA 2QV4A 3NM1A 3S5OA 1G01A 2J9YA 3R10A 4ZQRA 2CBVA 4DY1A 5A8QA 1Q8AA 4OUIA 1GCYA 4EWND 3CZEA 3BPWA 3MHFA 1XGDA 2EAWA 3KW3A 4ADTA 1ZALA 4QG9A 2JKEA 2V5CA 1OC5A 4MFDA 4QX4A 5CGTA 2WHMA 4EANA 3STPA 4LX4A 2HJPA 3WQOA 3VD9A 4XK2A 1NDVA 3JZEA 2DZUA 4A8LA 1GPFA 2QCLA 2DORA 1B31A 3MMTA 4J35A 2C16A 1HJWA 2PGRA 5DELA 4JNYA 7A3HA 4CD8A 4LUIA 1QNPA 3KFTA 1W37A 4PUWA 3AIQA 4GNJA 1JQXA 3F2BA 1QTWA 2E67A 8XIMA 4N42A 5DLCA 3E12A 2OLHA 2HROA 2ZRVA 4U33A 1TQXA 3R5EA 4OV4A 1RALA 1TJPA 1MXDA 4GXMA 4UQBA 1YDNA 4ICNA 3FAXA 3PBGA 4LUJA 2X30A 3ZWSA 3GBEA 2HTMA 1PPIA 2PRLA 2VCBA 1NJJA 3H2CA 3BLOA 3QTPA 3UWZA 1OK6A 3WLMA 2VOMA 3HG4A 1CXEA 1RJPA 3EDKA 3SUTA 1O6IA 3BAIA 3G8EA 3L4ZA 3URNA 2B7QA 2OZ3A 4C1NA 2GVEA 4MNMA 3A3HA 2Y5SA 5M1TA 1G4EA 4J4KA 5CPQA 4JTRA 3LHTA 3LHZA 2FTPA 1XICA 3UJ2A 3DH7A 3SECA 3TA6A 1JGIA 2C1IA 5K7JA 1HJXA 3UWQA 4BKNA 1WXYA 3G0UA 4A8NA 1HL2A 1R85A 3TTEA 2H3DA 4C90A 1OX5A 4AZ7A 3MT1A 3A9BA 3HU7A 1NM9A 1D9EA 1W9DM 3ZOAA 4GO8A 4OBTA 2PWGA 3WK0A 3RO8A 5E6YA 1QWKA 3PBYA 2J27A 4HOWA 1JYWA 3ZZ1A 2XUCA 1JNDA 1ZSXA 3W7IA 1B9BA 2FKPA 2PTWA 1KM0A 1IGWA 1MRAA 3L4WA 4QE1A 1XC6A 4DWSA 3TAOA 2E3ZA 1WE5A 3QPZA 3GU2A 4R53A 3WMLA 1K7XA 1EJWC 1HJSA 3V3WA 4QAIA 3GXNA 1CLKA 5HUOA 3PZMA 3S9ZA 4AVFA 1V3KA 2FH6A 3BJTA 5KTLA 2DU2A 1K1DA 3IGHX 5FJIA 1P0DA 3SRHA 5BCAA 1B3WA 1H61A 4WIWA 3H2OA 4IFKB 3I3BA 1ITXA 3N13A 1CCWB 5U7SA 2HBVA 4U3AA 4CCDA 1T6MA 4HIBA 1RUSA 2QGYA 3UERA 2FYMA 1T8QA 3AALA 1O95A 2VGIA 4M3PA 1THFD 2PE4A 3BAYA 4HK6A 1S2TA 3B0PA 4AX6A 3ZM8A 3RCYA 2J4GA 4V2XA 4EE9A 4QG8A 1ZZMA 2QPXA 5T26A 5D37A 1IZCA 5EFFA 3KS5A 1L8PA 3QR1A 3TROA 4S39A 1PKLA 3LXCA 3STFA 1MW2A 5H6HA 4ZXLA 2C79A 1TPFA 1FHVA 1C92A 2W3ZA 4NIRA 3BAJA 1FXQA 5DX7A 1S2VA 3EWZA 5C2CA 2A5HA 3C6CA 3P8JA 1IEXA 1CDGA 1I8JA 2QS8A 3IS4A 3N73A 3UESA 3W38A 1BSIA 1TA3A 1XINA 2XVKA 1H1YA 1RA0A 4O1EA 1WOBA 4AD0A 2EXOA 3BXWA 2DUZA 4C6EA 4GFSA 2XFRA 1TSIA 2QJJA 3S5YA 3QV6A 1NVMA 3JW7A 4JNZA 3W23A 1IEVA 3THDA 3BANA 2VEGA 3POHA 1SU5A 3W81A 1GVQA 3UY7A 1XP3A 2OXNA 4GXPA 4JICA 4W7WA 3FDGA 1OHLA 3MSRA 4XBJA 3GNXA 4LS1A 3GC2A 1NOWA 1TPWA 4ZQOA 3BW3A 4AXKA 2GSHA 1DIDA 5EU9A 1J5TA 2J8TA 1GUVA 4JEQA 1H3GA 3PTQA 2QCHA 3KRSA 2EPKX 1B4EA 2PDNA 3T2OA 2WMHA 2YIHA 4ZGYA 5EMJA 6XIMA 4DPPA 1E9YB 1K77A 2GOUA 4F3HA 5FF4A 2ZRXA 2WKLA 4IQJA 4GI8A 2DJLA 2PRMA 3TWBA 5CC7A 4G1NA 1MYRA 4MWAA 5LKYA 3W1XA 2ALRA 1VAHA 1J0ZA 3CL8A 5IBXC 1K02A 2G37A 3GH4A 1EBHA 1TV3A 3QQ0A 1JCJA 3R89A 2VYOA 4N2YA 3VFCA 3VU2A 4JHOA 2W5FA 2QUVA 3N6QA 2B31A 5PTDA 1I0BA 3K8LA 1TIMA 3L0GA 9CGTA 4QITA 2AMXA 2PBOA 3SI9A 1EOMA 4TMBA 4RL3A 3WF2A 1UR2A 1RCXB 1K9TA 2OO6A 3CUZA 2GUBA 1XCXA 4Y9PA 3UCCA 2A21A 1BLIA 1H0GA 4JL1A 3COTA 1R8LA 4QG6A 4HU4A 4W9TA 1BAGA 1C9WA 1KRBC 1H11A 3S6DA 3ITLA 5MF5A 1HO1A 2GSEA 2BVTA 3L5LA 1PDYA 1RK6A 2Z2UA 3MYOA 3W7JA 1EX1A 2XM2A 1S38A 3CAWA 2BGQA 1CGWA 2I5IA 3RNDA 4IGHA 1TWWA 3O0KA 4POCA 4HU0A 3R8RA 4Y9AA 3VKKA 4TXEA 3KOXA 2IW0A 2J88A 4AF0B 3UJSA 2Z00A 3GDTA 2WAGA 1S39A 2OQLA 3P0XA 4IJCA 3PHAA 2GVYA 1IE7C 2A3BA 3QC3A 2YDAA 2R8WA 3MJMA 1Q6RA 4EPBC 2GGHA 3QN3A 4PMVA 4B5TA 3P82A 5REQB 4I90A 4RX0A 3MMWA 2VURA 2XWEA 4O28A 4ADUA 4KRTA 3E2VA 1XGEA 2QDEA 4F2BA 4D9PA 3R12A 4S2CA 1GVEA 3REQB 7REQB 3WEMA 4I9AA 1F2JA 2XIQA 4O18A 3VNMA 1KFKA 5T9BG 3TYAA 4MUPA 1GW1A 1E15A 4U10A 3AXKA 2W62A 1UP2A 1YE4A 4GA8A 3HV9A 2HNHA 2DV0A 4RXGA 3GNDA 3KBMA 3QGAC 1IGSA 4H9UA 1XIBA 3PNZA 2ZUVA 4RLIA 1UD4A 2WC3A 1B90A 1K9EA 3AXHA 3WMSA 4DUVA 3PP7A 3UZYA 5I3IA 5K4XA 3MANA 2Y70A 1IQ8A 2WMIB 1KWKA 1Z7AA 2ZXDA 1RVGA 1OFBA 1WZKA 2YZRA 3GYEA 3L4YA 5DXYA 1YE6A 2CLLA 2OZTA 3W88A 1DQXA 4QCEA 2Y1HA 3NQCA 1L0PA 3NR0A 1BXBA 2DVTA 4ZSTA 2DPEA 3N18A 5A8PA 4ACZB 4ZBCA 2HVNA 3GB6A 2CLEA 1XI3A 1XIDA 1UHVA 4S3KA 3WQ6A 3MWCA 3RHGA 2RGMA 3N6HA 4LYRA 1FWDC 3W6YA 4WHBA 1MDLA 5I78A 3DFQA 3LHYA 3PPCA 1Z89A 3FYPA 4GXWA 1AQMA 1M9HA 4WSKA 3ARZA 3GU9A 3T2PA 5LHEA 4EF9A 2FFCA 5D33A 4HA1A 5HMDA 1QFEA 8TIMA 1J12A 1GQLA 4F0LA 4DWDA 3KWXA 3T44A 3KBNA 2XH0A 1ISZA 1EYWA 3AC0A 4FAMA 1FWBC 3ZLHA 3WDIA 1A3XA 3H2FA 3I68A 3L9CA 5EMLA 2NSOA 2P10A 4LC6A 1XH2A 1XL9A 4L9ZA 3BC9A 4AAJA 3RXZA 1O66A 3WJYA 1I6NA 3VD5A 3E5PA 3R94A 2NUYA 4IFRA 4HYRA 1JCNA 4XAYA 4ZB0A 5HINA 1KC7A 2O9PA 2BP1A 1PWLA 2PP3A 2EKGA 5IHRA 4H9ZA 3WL0A 3GIYA 1DL3A 4RNFA 1OY0A 1VLWA 3L4XA 1VJSA 3URBA 1XYLA 4G8TA 5AC4A 4PB3A 2NXGA 1SFJA 5FKYA 1VH7A 2OYLA 3V36A 3P8IA 3N12A 3SO7A 3N34A 1IF2A 4FR1A 3LENA 1R3YA 4GO9A 3SRKA 1AW5A 2JIEA 1YDVA 2PWHA 3MC5A 1DWGM 1T0OA 3ARYA 1T7LA 4MOZA 2ZRUA 3RK8A 3WD3A 1UZDA 3WH7A 1KTCA 3S8HA 1D8WA 3L4TA 1J4EA 2E1DA 1KD0A 1BQCA 3DKLA 1XH0A 3Q67A 4Q7IA 2PI6A 4UNKA 4KEMA 3V0TA 2C91A 2V81A 4NZFA 5AECA 3SDOA 2VO5A 2D1ZA 2NX1A 3LTSA 4J3WA 4ZR8A 2EJAA 2G8ZA 2QUNA 1JVNA 3NGFA 2NQ9A 3PTDA 3BW4A 3IRDA 1U30A 5HULA 3I6EA 1XRFA 4ERGA 3I7QA 1GT8A 4C6NA 1FRBA 1TV7A 2C7FA 5I03A 4WGXA 2AAMA 4QROA 5EB8A 3W71A 5TBOA 3GVQA 4HN4A 2J6XA 4YYFA 2ZRZA 1PTDA 5CG0A 1ME7A 2Z2AA 3C56A 1S5TA 4I8YA 2WSPA 2X0HA 4BI7A 3TTOA 2YBUA 1W5QA 4PTDA 1L8NA 3UWUA 3NL3A 1PWMA 4FXRA 2XVPA 3F2DA 2W92A 2PRHA 4JIEA 3T2QA 3A47A 4A6GA 4U4MA 1H7OA 4JTTA 4O1BA 1J6PA 2EPMX 3GNNA 3W87A 3CZGA 2I57A 2VX4A 3TN6A 3LPFA 4B5SA 4BQ2A 2DW7A 3BQ6A 1GQNA 1FWHC 4EAYA 4IISA 4FX6M 4QLJA 4EIVA 2YLLA 3AI0A 4L9XA 1PXGA 1DVJA 5BMXA 2BHZA 2X7WA 2FJKA 2QIIA 4FHAA 1SO4A 4XBKA 3QGVA 4QJ5B 1NARA 4YHEA 2B7NA 4L4PA 1VCGA 1PBGA 4RDYA 1UZHA 4H9VA 4MAZA 4ML9A 4MJMA 5AYYA 3WLTA 1JPMA 3ZVHB 3TNBA 1K70A 1TPC1 3LEPA 5G1MA 3J7HA 1LDCA 4PR4A 3CO8A 2IPGA 3CM4A 4I5XA 1JXKA 2E77A 4L9YA 4NZ5A 3VX1A 1XJBA 3C86A 2EPHA 3ZT5A 1JPDX 1TX2A 2V3DA 2YX0A 2ZX7A 4P8WA 3N17A 1DKWA 3K4DA 3PVFA 1UKSA 3EA2A 3W6LA 5E0FA 4IX0A 6TIMA 3DFHA 1OX6A 4DQWA 3E2SA 1YBQA 3WH8A 3W3OA 2CLFA 1EZWA 3B9NA 1D3HA 4E8DA 4YWSA 1MZHA 2PDHA 1H7WA 4L61A 4B4FA 2NSXA 2VEMA 1T99A 1BXCA 2VRJA 5LZLA 4ROPA 4YL2A 2VKZG 1MUCA 4Q4KA 1M65A 3OVRA 4Q4OA 4QHRA 3W0KA 4C5YA 2QR6A 1MXSA 1YX1A 1L6FA 1GW9A 5ENLA 5LNVA 1BF6A 4ERIA 2WW5A 4IP5A 2UZ9A 3UQNA 3SQMA 2E9BA 3UU0A 3MSDA 4NUWA 3RFAA 3W76A 4MWAE 4RDWA 2G3FA 3GG7A 4JTLA 1EJRC 4Q8NA 3F5KA 1XD1A 4LV4A 1DP0A 2WLYA 3GKAA 5FJJA 3C2VA 3IUIA 1LYXA 3NDYA 3C2OA 1EBGA 1HFBA 2CXGA 3LMZA 6ENLA 3G1YA 4Y9MA 4XKMA 1W5NA 1O12A 1X1ZA 4M0XA 4QQ3A 3SZ8A 1JZ6A 3GX9A 3GG1A 3GW3A 3GTIA 4GG9A 2RH9A 3E2QA 4M80A 1E0TA 4NI8A 1RBAA 3H7UA 1OT2A 2DT2A 2HK1A 1DORA 1XLDA 2BS9A 3EPMA 2TPSA 5HWJA 3UCDA 1TWSA 1XG3A 1AK5A 3BTNA 4HYWA 4C6CA 1TO3A 1JCTA 1Z44A 4KT2A 5TIMA 1JULA 2Y63A 2GJNA 5AHNA 2DIJA 3MVIA 1A53A 4QXIA 4P7RA 1X7FA 3QQWA 4K38A 4GNKB 5FF2A 3S2LA 1YPXA 1OIFA 3KTCA 3NQEA 5D09A 2TSYA 2P76A 4FALA 4FLOA 3WLOA 4R7OA 2QAPA 2J79A 1BXNA 4CU7A 3EMZA 3HB9A 4DBUA 3S1UA 4H8HA 5DY2A 1QOQA 1CXLA 3BG9A 1XM3A 5F1UA 1EIBA 3O06A 3ONBA 3FYYA 4JTUA 2E6FA 3AU6A 1ZLPA 3AYVA 1H5YA 1PTAA 4LUSB 3C2RA 2V2HA 2PURA 1ZJAA 4S3FA 4LB3A 4Q8WA 1UD3A 3TCSA 1ICQA 1UD2A 1QOXA 1HF6A 2QT3A 1CGTA 4X0NA 4QJ3B 3QC0A 4S3GA 3BAKA 2JEQA 1DEDA 2ZXBA 1CGVA 3NURA 1J11A 5DFAA 5U4NA 3SURA 3TAKA 1KM4A 1W9UA 3H2EA 2VEFA 3IJ6A 3NAVA 3WELA 2CHOA 4C6JA 4DXXA 1SR9A 4Q4SA 3GDKA 3QMTA 2VTFA 2HRWA 1R7OA 4CQBA 3ZT6A 4AB4A 3OG3A 1ONEA 4OUEA 2DZXA 1UBPC 1XLMA 1MEHA 3S6TA 4V33A 3S5ZA 3WFZA 4FLSA 1A3WA 2Q8LA 4YLWA 2XFFA 1BKSA 3K8MA 3PZOA 4GUFA 3ZR6A 4O50A 3GR7A 4N9DA 4DJEA 1A3HA 2BB0A 1OEPA 1LWHA 1IYXA 1CLVA 2P3EA 1JZ3A 2HSAA 3DGRA 4UTMA 2KZHA 2GJXA 1OYAA 1SJBA 1JZ8A 4HOXA 4BQ4A 1PJ9A 2CHNA 4TX6A 1HZYA 3PJWA 4CNOA 1I1XA 3ABRA 1FDZA 1DJYA 3LGEA 1B3YA 3MCNA 4KPLA 4GC4A 5REQA 4G6CA 3UJFA 5BMWA 1LBLA 4M1BA 1EH9A 5FI8A 1FWWA 3CPUA 6REQB 3OYZA 2CLKA 4CD5A 1MRQA 2BHUA 2OQYA 1Z9AA 1PZ3A 4ZO8A 4XG1A 1YXYA 3QYSA 1A0EA 3DIPA 3N04A 4IIBA 1TPB1 1JF5A 4UFJA 3W7CA 1KLYA 4PFMA 5XIAA 2REQA 3B97A 1A0CA 4GVIA 1LBMA 1WO2A 4L1XA 3ITXA 5CEWA 3WNOA 2INZA 1DXFA 4HD5A 1K8YA 5GNXA 4CGTA 4A8RA 1HW6A 1WXZA 2A3AA 2ZZ4A 4DLFA 3BG5A 3GRIA 4MMWA 3CHEA 1PYFA 2FVLA 4IHCA 5F4SA 1M7OA 4Z2GA 1JZ4A 2JF6A 1W91A 4W89A 4C6KA 1LP6A 4IIHA 1PS9A 2BFGA 3ORWA 3BG3A 1GVFA 4LWWA 4O54A 1OFOA 4LYPA 4QLLA 1Q6OA 3IVUA 4CCCA 1R2SA 1Q4WA 4XSMA 2V38A 2XSAA 5D05A 4QFUA 3FGCA 3SQLA 4L65A 2BVDA 3PBUA 3ZJ6A 1XSKA 3N2CA 4QNEA 2WVUA 3AJ7A 1KBJA 1H5VA 1UCWA 4DZIA 1V93A 3F5LA 3NPXA 4OWGA 3LZ3A 3PZNA 5LA1A 1AL7A 2YFOA 1PX8A 5G4HC 3VUPA 3QGKC 3AS3A 3V5OA 2NQ5A 2GK1B 3WX7A 1TX0A 2NXHA 3N2MA 1EDQA 4YTRA 2FZ9A 1HIZA 3PZIA 4MPQA 4GY0A 4I9JA 4AY1A 3SCRA 2UV8G 4ERAA 2ZRYA 1AQ0A 4ZCWA 1Q7ZA 5DXXA 5HJXA 2A6LA 2X0YA 4MKVA 1VCFA 4L4LA 4C6OA 4NZCA 3LG3A 2Y7GA 3UZ5A 2VGBA 1E70M 1TPUA 2BXZA 3BE7A 1JUBA 3R43A 3TYEA 2XDFA 3ZJKA 4Q8QA 1EUAA 2WMGA 2ZZ1A 3CV7A 2NQZA 3IK2A 2J7EA 3KAOA 1VJZA 2PAJA 3UT0A 3JR2A 2VFEA 2PWUA 1EUNA 3EOOA 1GVSA 1L6YA 2X2GA 4R85A 2ZX8A 4YXGA 5KINA 2G3MA 2QDGA 3WK2A 2Y88A 1A5KC 4MVAA 4HTBA 3S3GA 2Y8UA 1EA9C 4LS0A 3WLQA 4DBSA 4L5ZA 5LYRA 3DC0A 4CD6A 4AU0A 1GKPA 1FTXA 3TA9A 3TZNA 4A3UA 3H12A 2OEKA 1N55A 4PMUA 5HA7A 1ONRA 3R58A 3VCNA 5DT5A 4XTDA 4Z1AA 1M03A 4DX3A 4PMYA 4LPCA 4UFKA 2JFEX 3W4RA 1YRRA 3F4VA 3GHTA 4C1NB 3QMRA 3G6LA 4H6KA 1M1BA 1RY8A 1RQBA 1V4YA 5DO8A 5FAGA 1MO0A 2AL2A 4B9YA 2ZUSA 2VENA 2GPTA 2P3ZA 3AIWA 2GSJA 4DM1A 1XKJA 2DZVA 2PA6A 1S5VA 2H6RA 3W2NA 2UBPC 1QI3A 4MYXA 3GXPA 3M43A 3VE9A 2EG8A 5I00A 2ISSA 1WDSA 4R27A 3WD2A 4PMQA 2QJGA 3W83A 1HG3A 4KCUA 3UJRA 1GVIA 1F3WA 2DQWA 1E4NA 2W6RA 3QKZA 4MY8A 1G4SA 1MI3A 3PULA 4G5DA 1TVNA 1Y5XA 1B1YA 1VYPX 4QLKA 3MI6A 4UR8A 5BOOA