1HW6A

Crystal structure of apo-2,5-diketo-d-gluconate reductase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
262
structure length
257
Chain Sequence
TVPSIVLNDGNSIPQLGYGVFKVPPADTQRAVEEALEVGYRHIDTAAIYGNEEGVGAAIAASGIARDDLFITTKLWNDEPAAAIAESLAKLALDQVDLYLVHWPTPAADNYVHAWEKMIELRAAGLTRSIGVSNHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGKYDLFGAEPVTAAAAAHGKTPAQAVLRWHLQKGFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE
publication title Structural assembly of the active site in an aldo-keto reductase by NADPH cofactor.
pubmed doi rcsb
source organism Corynebacterium sp.
total genus 90
structure length 257
sequence length 262
ec nomenclature ec 1.1.1.346: 2,5-didehydrogluconate reductase (2-dehydro-L-gulonate-forming).
pdb deposition date 2001-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1hw6A00
3Q67A 4JIRA 1EL3A 2PDCA 4JQ2A 3CV7A 2INEA 3EB3A 3P2VA 2IQ0A 4ASTA 4GACA 4L1WA 4G5DA 3Q65A 3WCZA 4JQAA 1K8CA 2IPFA 3RX4A 4XVDA 1AFSA 1RALA 2IPJA 2PDJA 4EXAA 2I16A 2PDNA 2R9RA 3ERPA 2PDQA 2F38A 2AGTA 2FGBA 4XK2A 2BGSA 4WDWA 3R94A 3UG8A 3R8HA 4LB4A 4GQ0A 3LEPA 4FAMA 1R38A 4QBXA 4YVPA 2DUXA 5M2FX 1EXBA 2PDMA 3LZ5A 4H7CA 3BURA 5LIKX 3T42A 3EAUA 1IHIA 1EF3A 3N2TA 4JTAA 2BP1A 1YNPA 2PF8A 3F7JA 3COTA 3LQLA 2PDYA 2BGQA 2IPWA 2HDJA 2IQDA 3UFYA 2PFHA 2VDGA 2F2KA 3V36A 1RY8A 2IPGA 4JQ4A 4XVEA 2A79A 2NVDA 1EKOA 1T40A 2HVOA 3KRBA 4NKCA 2HEJA 3UZWA 3B3DA 3GHSA 1XF0A 3LN3A 3RX2A 2I17A 3ONCA 4YU1A 3GHUA 3UWEA 1AH4A 3G1RA 3UZYA 1ZQ5A 2NVCA 1Z3NA 2ALRA 3FX4A 2WZMA 4XZIA 2HV5A 3VXGA 2QXWA 4PRTA 2PDBA 3DOPA 3UZXA 1YE4A 2ACSA 3V0TA 2HVNA 4JQ3A 1Q5MA 3O0KA 2J8TA 1AZ2A 2HE8A 1PWMA 2CLPA 2PDWA 3GHTA 4WDTA 4DBWA 4EXBA 4FA3A 4OTKA 1X98A 3CV6A 3LZ3A 2PDGA 3EB4A 4LBRA 2PEVA 4YVVA 3V0UA 2R24A 4XZHA 5LIYX 4L1XA 3ONBA 1XGDA 4WDUA 3M0IA 3G5EA 3UGRA 5LIWX 2ACRA 1Z89A 4XZLX 2IS7A 2PDKA 4F40A 3N6QA 1MZRA 4JTCA 3U2CA 2FZBA 3BV7A 3LUTA 4XO6A 4FZIA 3C3UA 1S2AA 4PUUA 4ICCX 1YNQA 4LB3A 2WZTA 2IKHA 5JH2A 4XZNX 1X97A 3CMFA 1LWIA 1T41A 4GIEA 4QXIA 1VP5A 1AH3A 2ISFA 4HBKA 4JTRA 4GCAA 4PRRA 4GA8A 1Z9AA 4FALA 2IKGA 3LQGA 3R7MA 4AUBA 4YVXA 2IKIA 4QR6A 4PMJA 3M4HA 4QX4A 4DBSA 1QRQA 1ZUAX 1PZ1A 3M64A 4YS1A 3CAQA 4WDXA 3O3RA 2ACUA 3BUVA 4WEVX 1HQTA 3D3FA 5JH1A 4Q7BA 4IGSA 1PYFA 3H7UA 3WG6A 2PD9A 4HMNA 1AH0A 4JQ1A 3WBYA 1ZSXA 3V0SA 3R43A 1MI3A 4XZMX 3MC5A 4WRHA 1LQAA 5HA7A 4MHBA 4RPQA 3UP8A 1YE6A 4I5XA 4JIHA 5LIXX 1OG6A 3RX3A 2DUZA 2PDUA 4XO7A 4Q3MA 4JTQA 2FZ8A 3H7RA 1S1RA 4LAUA 3H4GA 2P5NA 3CAVA 3UYIA 3S3GA 1US0A 1GVEA 4DBUA 2PDXA 1HW6A 1S1PA 1A80A 2FZDA 5LIUX 5C7HA 3R8GA 3V35A 1XJBA 1UR3M 4LBSA 3LENA 1C9WA 2ACQA 3R6IA 4XAPA 4IJRA 5AZ1A 3MB9A 3UZZA 1J96A 1VBJA 4DZ5A 2PDIA 1Z8AA 4WGHA 1IEIA 4IJCA 2PD5A 4JTDA 3LNMA 3WBWA 4PUWA 1RY0A 3WBXA 3CASA 1AZ1A 2PDHA 4JIIX 3LD5A 1ZGDA 1ADSA 3QKZA 1Q13A 1PWLA 1S2CA 2PDPA 1SM9A 2HE5A 3R58A 4GABA 1MRQA 2PZNA 1FRBA 4PR4A 5AZ0A 1M9HA 3NTYA 4R9OA 3GHRA 3FJNA 1PZ0A 2FVLA 3LBOA 5DANA 3BCJA 2DV0A 4GQGA 2FZ9A 2PDLA 5HNTA 1X96A 1JEZA 2C91A 2IKJA 3DN5A 4H8NA 4LAZA 1QWKA 2PDFA 4ZFCA 5KETA 3GUGA 2INZA 5HNUA
chains in the Genus database with same CATH superfamily
1Q6QA 1RK5A 3G1DA 1V03A 1NWUA 4LW7A 2ZX8A 3N2CA 2IQ0A 4ALDA 2X41A 2EG8A 4UTTC 1OGBA 1CXKA 4NILA 4J3UA 1QVBA 3B8SA 1NM9A 1C90A 4RW3A 3P8IA 5E70A 4MWAD 2C8NA 8XIAA 1QO2A 2IPJA 4HZ7A 4AX7A 5CPNA 4EXAA 2DT1A 1VFTA 1KM0A 4I6VA 3C2EA 1JYXA 3EOOA 3SSZA 4OECA 1R2RA 1P43A 1XD1A 2V9DA 1UH4A 3LXCA 3PZIA 3PSVA 1I60A 1IT7A 5EGRA 2DZBA 3W6LA 5CG0A 3NDYA 4S3DA 5M5DA 4GC3A 2F8QA 2J9YA 3IUIA 2REQA 2D2JA 4JKKA 3SQLA 1RBOB 4I7WA 1C8XA 1RVKA 3E0LA 3LQLA 4DWDA 4ATWA 3SY8A 5EB8A 2EKCA 4G2DA 3UFYA 3W87A 1XP3A 2PFHA 4GGHA 7TIMA 2FMNA 4D6CA 1W9VA 1NWTA 3ENLA 2NVDA 2ZZ1A 1X7IA 2WJDA 3ZWTA 2MANA 3ZFHA 4UCGA 5K9CA 4YU1A 4I8YA 3AHZA 3XINA 3UVAA 4E6MA 1BG9A 2PLKA 3S6OA 2EPMX 2P76A 5L9FA 1HVXA 3G6MA 4KGLA 2F9RA 2V3GA 1FWJC 3TLLA 4S3GA 1Q4WA 4KIEA 1FH8A 3V7PA 3IVTA 3EMQA 3W7DA 1G67A 2J47A 4LC6A 3CL7A 3WEZA 2ZVRA 1AL7A 4TIMA 1WBJA 4AEEA 1KFEA 1GOMA 1KM2A 4HQVA 5FJJA 5H8PA 3ITCA 5EMKA 3MO7A 2Y0FA 3KX6A 4DBWA 4EXBA 1QI5A 1JZ7A 1AMYA 1FWEC 1W5PA 2AKMA 3IUHA 4A29A 4ZODA 4ATDA 3SZ8A 4JHOA 3WMLA 1GYMA 3HPAA 3TYDA 1J0JA 4L1XA 3T2OA 3TTSA 1E3XA 4YTTA 1QI3A 2V69A 5HOSA 2ZRVA 2EPNA 1R8LA 3E3HA 1OFAA 1UOZA 4HTBA 1R3YA 3TTQA 1DE6A 1ZBWA 4JYFA 1S2VA 4GKLA 2EG6A 3EX6A 1EEPA 3U2CA 1OT2A 2VFGA 3UWVA 1H5VA 2FZBA 2Z2UA 4L65A 3U2EA 1BG4A 3WH7A 1W3TA 3T0TA 4QROA 2Z2BA 2Y7GA 3QR1A 2XGIA 3LMYA 3FSUA 1T6MA 6ENLA 1MVYA 1HUVA 1Z69A 4LB3A 2ZX6A 3FYPA 1WDPA 2J7FA 4XQ6A 3ARWA 1FWAC 4AIEA 3M1ZA 1ECEA 3VMPA 5REQA 2BVWA 1VPYA 1I75A 1XCFA 3MYPA 1MNSA 3FS2A 3RXZA 4W86A 3RRXA 4B5NA 1ZJAA 2OLHA 1DVJA 3DU0A 4PRRA 4B3LA 2VQUA 3EPOA 3SFWA 1EBHA 3NOYA 2IKGA 4JEQA 2YCEA 1RQBA 4P61A 4FNTA 4QR6A 3W72A 2R1MA 2YXGA 4NQ1A 3M64A 4YS1A 2EHHA 4XIMA 3CAQA 4AZ7A 4PSRA 4AVFA 1KFBA 2OFJA 1YBQB 3GR8A 4AX6A 1M68A 2DT0A 1W1B1 2YW4A 4I9AA 1PCKA 1P0DA 2P88A 1ZU8A 2RFGA 3VZYA 4LANA 4ZA0A 3MMUA 1JAEA 3WBYA 4AWEA 4ML9A 4Q4KA 3ZS4A 4XSLA 4RPQA 3S47A 1DBTA 1YE6A 1EJVC 1YIXA 4BKNA 1M53A 4GO8A 3IIPA 1B0IA 1OX5A 3PBMA 5IDZA 3MUCA 2FZ8A 1S1RA 3N2OA 3KDOA 4MAZA 1XIGA 1M5WA 3IAQA 3P81A 3ABOA 4RNJA 2P5NA 4GFSA 1LLOA 5HWMA 3AMLA 2AQWA 5BXPA 2VFHA 3LLXA 3VVGA 1DEDA 3OHMB 3SRHA 4DNMA 1J10A 4C6JA 3GG1A 3KBSA 2O9OA 4TX6A 2VZUA 4DBDA 4Q8OA 1KQYA 2B7NA 2CFFA 1TUXA 3BE7A 1XIIA 1HKWA 3O9NA 1QW8A 1EGZA 5CLWA 1AK5A 2I5IA 4DZ5A 3LHZA 4NNCA 3UGVA 2QIIA 4PMUA 3DENA 2F6KA 4FO4A 3FOKA 2OQHA 2Q8ZA 3ZYZA 4WLCA 5E5CA 3RU6A 3PP7A 1FDYA 1S39A 3LLDA 4URIA 4HNVA 1AJ0A 2VMFA 2VRKA 1B31A 4GIYA 3SCSA 2JEQA 6TAAA 4QSFA 3M5XA 4KWSA 3GR4A 1VIZA 3K46A 4ATLA 1YRRA 2WMJA 2E6YA 1PX4A 5J5DA 4AHPA 3N12A 1IIGA 1H1ZA 2FFCA 1HJSA 1LP6A 1R9XA 1Q45A 1M9HA 1TX2A 4M6QA 2ZUWA 3URQA 4R9OA 2XYLA 4L9YA 4OUEA 1V0NA 5D4YA 1UQYA 3ITOA 3P84A 4HPXA 2QDHA 4LVAA 1S5TA 1XLJA 1XBVA 3O05A 2WSKA 3USZA 1BGAA 4MJMA 4K37A 4NNAA 4MKVA 4O17A 4HNUA 1H7OA 3KL0A 4LCSA 1OC7A 3OYZA 3TUUA 1OX4A 3KE0A 4HHMA 4UTHA 1VHCA 2Y62A 2INEA 2C19A 3WLLA 4AAJA 4GY7A 4HYRA 1XQLA 2XHYA 4J1OA 3ANVA 4J28A 2V3DA 4ZO9A 3EEZA 5KSWA 3SCOA 1EQPA 4KS0A 2OJPA 2PDJA 2QNEA 1JDAA 1FWHC 2FDMA 1R86A 1KW1A 3ZOAA 3UEQA 5AOUA 4JIPA 5FF4A 4PFHA 4GJ1A 3KP0A 5AN7A 2AL2A 2DEPA 1XX1A 4ZXOA 5BU6A 3R8HA 4IG2B 2QCDA 1PIGA 3DG6A 4AZCB 4XB3A 1R38A 2PCEA 1GVYA 1F8MA 1GHRA 2E5CA 5AC6A 3MS8A 4V33A 3IRSA 2NQHA 4W4QA 4EPBC 1KKOA 2AQOA 4Q4QA 5D30A 3WN6A 3O8AA 1VKFA 2WZEA 1W9BM 3GK0A 4FHAA 3GVVA 3R25A 3UW6A 2Q71A 4M24A 1O1HA 3BTNA 4JQ4A 2FGLA 1IXQA 2PRHA 4L6DA 1QU4A 5AHEA 1VFMA 1OEPA 4PN2A 4DLFA 2I17A 3HJEA 4S3JA 1EPXA 4R53A 2QJMA 3LM3A 3IV3A 3ZSSA 2ALRA 4O4WA 3W23A 3BJFA 1L0PA 1QCWA 1HJXA 1B4EA 4DPQA 2VXNA 3SCTA 3DOPA 1GPWA 1WUEA 4DRSA 1Y5WA 3DUGA 3UERA 3APYA 3ES7A 2ZDSA 2J24A 1FBAA 4RE2A 8CGTA 3UCCA 1OFQA 4FA3A 4HHPA 1A5LC 3ICJA 2X1RA 1WBHA 3UPWA 2W62A 1VBUA 1VJZA 3GG8A 1UHVA 3V0UA 2D2HA 4G9PA 2PRLA 4H9ZA 2OCZA 4M56A 3WJYA 1M1BA 3ONBA 1OFOA 1KGXA 4Y9NA 2X7WA 4MNMA 3OOQA 3WL1A 3MUXA 1TCDA 3DFHA 4K3ZA 4CQ8A 4JTFA 1XM3A 2O55A 3TEVA 4NP7A 1UASA 5A6BA 4M5PA 4AU0A 2AAMA 2C18A 3SR7A 3C5QA 4J27A 4V27A 3S5YA 2HMCA 3C3UA 4MMWA 6ALDA 4J5NA 3PPFA 1IWPA 4NZFA 1EWEA 2VEMA 3W0KA 4OBRA 5FJTA 4QDMA 4UZUA 4A3RA 4WKAA 1JD7A 3SIZA 4H00A 3LSBA 4EANA 3LCXA 2HPMA 1G01A 3OIXA 4IT1A 3FEQA 3L67A 1FXPA 2WPBA 4X9YA 3G3MA 1A0CA 4O16A 3ARUA 3R0KA 3IARA 3C52A 1EDTA 2AOSA 2V82A 3Q2DA 1GW1A 1P7TB 4LT9A 2E1DA 2V2DA 3ECQA 3E02A 4LYQA 3AXIA 2NX3A 2OSYA 3AYRA 4UQAA 4TUFA 2ZA3A 3VK5A 1VB9A 1MEIA 3DYPA 4F9JA 4HZ6A 1F76A 4F79A 4O19A 5I00A 5DFAA 1PZ1A 3C0SA 1ZRQA 2BY2A 4ZTYA 3CAKA 3WD4A 3M47A 1XRFA 5T26A 2XM2A 3TW9A 5KTLA 1M7OA 2VCBA 1B54A 4PA8A 1B3ZA 1U30A 1QNRA 7CGTA 3WLSA 3T6CA 1FUYA 3CUGA 2DZWA 1TPUA 2J9ZA 4WRHA 5PTDA 4YCOA 4JNZA 4GVGA 2OELA 4LNCA 1V3MA 4JIHA 3QJAA 3T07A 1OG6A 3HG3A 4A8LA 1XIEA 3GDLA 4GO9A 3IVUA 2VQTA 2FZMA 1D3CA 3LHYA 5D2TA 3IANA 4MUZA 3WUGA 1OABA 4K2SA 3GB6A 3NL2A 1ONWA 4DBUA 2WJEA 3BOXA 1UPPA 1QOQA 1PZ2A 1IQ8A 3IK4A 4ZOBA 2FZDA 1TVNA 5FL0A 2H8ZA 3QZ6A 2VC6A 3TN5A 4F2TA 3GXFA 3R8GA 5D09A 3WSUA 5KZEA 4XD4A 1XJBA 4ML4A 3QMTA 4GZIA 5HBFA 3T09A 3UJFA 2A6LA 1G1YA 1XIMA 3I7RA 3P74A 5CC7A 5CZSA 2DZTA 1R85A 2E8YA 3MZ2A 3QR0A 1NDWA 5LKYA 3QZEA 2I57A 4GRSA 1TSIA 5D04C 4BK9A 2VJXA 3I3EA 1Z8AA 1W1PA 3ZJ7A 4L6HA 1ONEA 1K9TA 3WBWA 3LTPA 4KFPA 3ZZ1A 1DWHM 1YHTA 4CGTA 4JFTA 5AYBA 2AQVA 1XFCA 3FJ4A 4HOWA 5IBXC 3U5UA 3A4JA 3BICA 5BOFA 3WBAA 3NPWA 2Q01A 2JALA 2ZBTA 3LXBA 1S2CA 5I78A 3QSTA 2E25A 3NDZA 4PMXA 3PVFA 3VILA 4C6LA 4AD2A 2DSKA 2YXXA 4AWTA 4HKPA 1XQKA 3Q4DA 1K9EA 1MYRA 3WD1A 1FRBA 2POZA 2WCAA 3RM8A 3ARZA 3G1XA 3G1SA 3EYPA 3MZNA 1RV8A 3F2DA 3R79A 4M80A 3QFWA 3C0LA 4UTKA 4DO5A 5IHSA 1KCZA 3CQJA 4XUGA 3VNZA 3BCJA 3SN1A 1FH9A 4KCWA 3AYSA 3SCQA 3WQCA 2PSNA 1JEZA 4PTNA 5CZJA 2V5JA 1A53A 1QWKA 2YL9A 1CI1A 1PDZA 4ZFCA 4UQCA 2VEFA 3WQWA 1X39A 3O7UA 4WJEA 2OOFA 3GO2A 4ZO8A 3E2SA 1J6OA 1IF2A 3ZR5A 4B16A 2HBXA 1O95A 3IK2A 1MW3A 1YTKA 2FHFA 5DEZA 3P82A 1E9ZB 1Q7MA 3AMCA 3NFUA 3B4UA 4FX6M 1XRSA 2Z1KA 4GOAA 1R87A 3NYDA 1WOBA 3M0JA 3DC8A 2EPOA 1BVNP 4XKMA 1ONXA 2NLIA 2WAGA 3THDA 5HK4A 5CPTA 5HPOA 3G0UA 3R94A 5DCDA 3ZJ6A 1FWGC 2CHRA 5BRPA 3M07A 3RJYA 3KWXA 3E74A 5HATA 4QBXA 3PJTA 4LALA 4MJ4A 5TD4A 1XLDA 3BANA 4DZIA 5XIAA 2ZA1A 2OLSA 3MP4A 4EF8A 2B7PA 2W6RA 3FXYA 2E28A 3CYJA 1SSDA 5GNYA 2BP1A 4K68A 3HOJA 3LG3A 2BGQA 1OZMA 2DIJA 4YN5A 2DP3A 2WM1A 1DV7A 1E73M 2PGWA 3IACA 1DE5A 1L8PA 4DX3A 4PTMA 4U5KA 2FH6A 4DEFA 1XYLA 1RUSA 3KRBA 1I1XA 1YDVA 1R3QA 3AMDA 4H2HA 2BVTA 4R34A 2ZA2A 5E0FA 1WDSA 1BYAA 3T0AA 3BAIA 3S4TA 3P7YA 4C6EA 3NEVA 3MMTA 3NXLA 4FOJA 3N25A 2BVYA 4LEFA 5D05A 2E6AA 2J88A 3S5OA 1E71M 2CERA 1TG7A 3K8MA 3CHVA 2EEXA 1QTWA 2BV9A 1JDEA 1XLFA 2POTA 2E40A 4DJDA 3AALA 3KTCA 3UT0A 1CWYA 2PF0A 2ZUMA 2PDWA 5A5WA 3BAKA 3JU2A 3W83A 4CEXC 2OT1A 3M6DA 3WBEA 1EGMA 1IEWA 4KH2A 1LOSA 4H41A 1B9ZA 3MPGA 2CW6A 3TN6A 1TWSA 4W7VA 5CSSA 4F0SA 2ZYFA 3L4YA 3WLIA 2NXIA 3E0WA 5CJMA 3WD0A 1XRTA 1LTDA 2C16A 3MY9A 2YW3A 3ARRA 5ECUA 1OYAA 1H49A 3NZGA 4Y8FA 4XO6A 5HJYA 3EWXA 2G3JA 1EZWA 1WYIA 2WJFA 2PA6A 2RGLA 3CJPA 4Z2HA 3SY1A 3FSTA 5JIPA 3GTNA 1YNQA 3E12A 4EPDC 4A8NA 3LX9A 1V0MA 4H7VA 4QJ5B 4OV4A 3G1HA 4U10A 2YX0A 4D8ZA 2CZFA 2G3FA 1PE1A 1IZJA 2D22A 4W8AA 3R5EA 1QOPA 4FNRA 3LDVA 2R1LA 5T91A 4JTRA 4A35A 3SQSA 1H11A 3WFAA 3UXLA 4EKJA 3B9EA 3B03A 3NEHA 3NL3A 4GHRA 1KB3A 1LL7A 3SADA 1A3WA 3CUZA 5CH9A 3GX9A 1JQVA 2VO5A 3BXWA 4J4KA 1QRQA 3PAJA 3NAVA 1TWZA 3LPOA 2ISVA 4NRRA 2VZTA 1PIFA 1ZAJA 1CECA 1IEXA 1Z7AA 4UCFA 5LZLA 4IUOA 4O14A 5HJLA 3U3HA 1BEUA 1BQCA 1WPCA 2W66A 2EPKX 1RPKA 1MNZA 3NQ7A 3R43A 3TLQA 4L9ZA 2HK1A 3GH7A 1XICA 3GYCA 3CQ0A 4ERGA 3VNJA 2B7QA 1O12A 4NAEA 1POJA 5H1WA 1QNSA 3TOPA 3N4EA 1KV5A 1GJUA 1MQRA 4LAUA 1FFQA 3AIQA 2ZX5A 3VUSA 2GQ9A 3S3GA 2YLLA 4UTMA 2D3LA 2C15A 2WBKA 1AMKA 2DZVA 2PWGA 4D72A 1IXNA 4NXKA 3VOIA 5M3WA 2DZSA 5DXYA 4MB3A 1UBSA 2I56A 3FGCB 2G3MA 2WQDA 3RUBL 3I6RA 4RPPA 4A8IA 5C54A 4Z1AA 3SRFA 5E0KA 4C91A 4LVBA 1RQEA 4DYJA 4K8HA 3LMZA 4CD8A 1JYNA 2Y5SA 4BF7A 3CQHA 3BQ6A 3N14A 4NJHA 3BAWA 3O07A 5I3DA 5A69A 2OLAA 2Y24A 1NF0A 3ALFA 2J77A 1OCQA 3IAPA 1BRLA 3CQKA 2VYOA 3NVDA 2A5HA 4MTVA 1OVDA 2WM0A 3AIRA 4LOCA 4ROQA 5IRPA 1VBRA 1LDCA 4C6MA 3U8GA 4C1LA 1JVNA 3FA3A 3VMOA 1DIDA 3R58A 4UOZA 4GABA 1CGXA 1QI4A 3W7LA 2NQ5A 1J01A 1P6WA 1QI0A 4CKQA 2BOEX 4W5UA 3KTSA 3MU7A 2BODX 2Z24A 2BXVA 3GHRA 3AS2A 3BK0A 2O9PA 1D8CA 2X40A 1W9XA 4PBEA 4B5XA 4IGHA 5H8UA 4C6DA 3QF0A 2Z7KA 3HG5A 3MBFA 1JF5A 4QNEA 3SO7A 2WHKA 3NL6A 3Q67A 2ZC1A 2WVVA 4H9UA 4LVDA 1SJBA 3P2VA 5ABTA 4ASTA 2J7DA 4L1WA 2Z6JA 2D2GA 3HFYA 4BQ4A 3B8WA 1V93A 3SECA 2NQJA 3OP2A 1DXIA 5F1UA 7ODCA 2PBGA 4AMCA 1WXZA 1WAWA 1OADA 2Q3RA 2RDUA 3V1PA 4BS0A 2VVNA 3N4AA 4EACA 3GVWA 2JKAA 2Y5EA 1IV8A 3KCLA 2AGTA 1G4TA 2Z6IA 3T44A 3OODA 1GQJA 3QRHA 4W88A 4MKNA 3BLKA 5F7UA 3V75A 1U1HA 2NT0A 4LUJA 3QPEA 2QZRA 3P0XA 3TAOA 2ATMA 4NF7A 5EMJA 2PDMA 3AZTA 4KKXA 2Q02A 5CLTA 3V5OA 2GQ3A 3W70A 4ZQPA 3W76A 1TQJA 4B15A 4HK5A 5I3HA 1T8XA 4JTAA 4WXZA 1TPDA 1OGSA 3NO5A 3BCFA 3CH0A 5GNZA 4ERIA 4XAZA 4HSHA 4PL1A 4C6OA 2VDGA 3PPHA 1S3HA 4UTJA 2V5BA 5MKGA 3ABXA 4RDWA 3PWGA 2YL5A 3E0IA 1RJPA 3MUY1 1TJ2A 3S2MA 4IIGA 1E4LA 3EEGA 2F6UA 4DWSB 4Y96A 3M46A 3VU2A 2AAAA 5FEPA 4WY0B 3OBKA 4F2UA 4ZXLA 3FA4A 4NI3A 2YKKA 5C2XA 3G1RA 2NVCA 1ELSA 3PTKA 2ZOXA 1KFCA 5EL1A 5C2GA 2FDSA 1LBLA 3CLMA 4AEOA 1GKQA 1YE4A 1NIUA 1MW0A 4BI5A 2QJHA 5E93A 2C6QA 4XTIA 2HVNA 5DY2A 3L21A 3W82A 3DI1A 2IQTA 1Y8BA 2YIHA 4DJEA 2VFIA 4OTKA 1K9FA 2Y61A 1HP5A 1J12A 1GYNA 4ZSTA 2WCSA 1NQ6A 4AZGA 2A3EA 3HU7A 3B9OA 1ITCA 3EX4A 1Y5VA 4GBUA 7PTDA 4ZSUA 2QAPA 1SO5A 4C6IA 3NYZA 4FEZA 4LUTB 1LORA 4AZHA 1WCGA 4RLIA 3DHDA 4U2YA 1Q6CA 1Q4NX 2OOGA 1DHPA 1YDOA 4UWMA 3PNUA 1EJSC 4BEUA 2BY1A 2QGYA 4O11A 4FZIA 1REQB 3RPMA 2RDWA 2BG5A 3DXIA 3N13A 1L8NA 3WJSA 4AD1A 2PZ0A 3KP1A 1OWQA 1BSIA 3PUDA 1ICPA 1W3HA 4QIUA 4O8RA 3PPCA 3BJTA 3IIZA 4GIEA 3PBUA 1M65A 1KTBA 1UKPA 2DH3A 3O16A 1M7PA 4LCRA 2JF7A 3PPGA 5FJIA 1N8IA 3EA2A 2VELA 2ZRYA 1F3WA 1ZCOA 1G94A 2R6OA 3NZQA 4UQ9A 3N73A 4WSJA 2GJXB 1KBJA 3ARPA 4DM1A 1EGVA 2YDAA 3DFQA 4YVXA 2PTYA 3ZVHA 5KEZA 2QDGA 2XFWA 3UWQA 1ENUA 3D46A 1SJCA 1WKFA 1MDLA 2V38A 1F61A 4JGDA 5ENLA 3N9RA 3LLFA 2CBJA 1RK6A 5G2IA 1HQTA 1CB2A 3H7UA 4GX9A 3VIGA 1KBBA 1X6NA 4FOKA 1AH0A 1ZJBA 3U48A 4A3HA 1CIUA 2PP3A 4FXSA 2J7GA 5A2CA 2J8FA 1DQWA 2FQIA 5AHNA 4CCDA 3CPRA 3D5HA 1N82A 1GJWA 3MHUA 3JRKA 4AW7A 1XIHA 1Q6EA 4S3CA 3UP8A 4LCQA 1XLGA 1VYRA 4NJIA 1DJZA 1UPMB 3CGTA 1FVPA 3F2CA 3SN4A 2W9MA 4ZE5A 3G77A 3H4GA 1LUCA 2DJLA 5ABGA 3NR0A 4F0LA 1I2PA 1Q2RA 2CC0A 3PZVA 1IZKA 5HQLA 2WVSA 3WDRA 4O12A 4UIOA 3OVRA 3A3HA 3DDMA 1R47A 1XI3A 2DQWA 1HTIA 1TQXA 5D9MA 4WX2A 3NGJA 3WK3A 3AXKA 4ZCWA 4FS9A 5DBUA 3B8VA 4KEMA 4NU7A 3BMVA 5HQEA 5H91A 3NM3A 2XUCA 3CC1A 2G50A 3S8HA 5AZ1A 3C2OA 3RG6A 3KEHA 3VD3A 3WD2A 1EFZA 3H24A 4GPNA 3A47A 3WNPA 4C7FA 2XINA 3L4XA 4UQEA 2ZWZA 1FHUA 5DQPA 3VABA 5F4XA 5A1AA 3KUMA 1NU5A 3B8UA 4NXSA 1W5MA 1BYDA 3QYQA 3QY8A 1ADSA 1GOKA 3QKZA 1YTEA 1UROA 2PU1A 3W2JA 4DF0A 5FAJA 3UWWA 1BTCA 5I03A 4AZ5A 3QLDA 4LQ1A 4PMYA 3T55A 3N6HA 2XIBA 2DSZA 2GSEA 5EA9A 5JUVA 1TVPA 3EMCA 5FCZA 5CAKA 2ZADA 5A8GA 3BH4A 4FNUA 1EIBA 3STGA 4U5IA 2FVLA 5CJNA 2DV0A 1TZ7A 4UOQA 3WELA 4JX5A 1BVWA 5A6MA 4H9VA 1GCYA 3MI2A 1M7XA 1KRMA 1SW3A 1QXLA 2Q8LA 1YXYA 3VYLA 2XGBA 2DIKA 2VX4A 3W7KA 5HNUA 4GVHA 3K1GA 2OTDA 1P1MA 4UFKA 1PX8A 4JQ2A 1KV8A 3HMJG 4NX0A 4GY1A 2XIJA 1UR8A 3KL5A 3FHAA 2QMJA 1QOXA 4G1NA 4E8GA 3S5ZA 1H2JA 1UA3A 3VPLA 3R2GA 3VMNA 3BOFA 1TREA 5AYYA 3USBA 4HA0A 3ABZA 2CKRA 4QDPA 1QASA 2WNZA 2Y7EA 4XK2A 3W02A 1H7RA 1XFBA 3VGEA 3QPYA 4KCTA 3AQUA 3IIVA 3GVRA 4LB4A 3N18A 5G4WA 3P5ZA 4K6AA 4MNJA 3TH6A 4M7SA 1X7FA 4IIHA 4GLEA 5AC7A 4PSPA 3RMEA 5FJUA 3OBAA 3GBDA 2GGHA 1KXQA 2A3BA 3I6EA 2ONEA 2C7FA 4IX2A 1JFXA 4PH6A 2Q3OA 1RY8A 1GHSA 5AB3A 3MV11 4PCNA 4C7GA 4UR7A 5EY5A 3WLPA 3QY6A 4JKLA 3TYCA 1E6NA 4O0ZA 3GFZA 4DF2A 4C6KA 3EA3A 2PMQA 4QLLA 2OSWA 1G9HA 1WQ5A 2R91A 2XZ7A 1M7JA 1QW7A 2NXGA 4MPKA 3DKLA 1L6WA 4LY4A 3GKFA 1E70M 2HXUA 3ITTA 4LC8A 4MWAA 1XS2A 4GIAA 4X3ZA 1KTNA 4LS2A 2R1PA 1R0MA 1TKKA 1DOSA 1M41A 5C6MA 1KLZA 4FX8A 3VC6A 3ZLFA 1FCBA 2Z1XA 1ZALA 3BLPX 1G5AA 4LS1A 4IFRA 2XVLA 2ZRUA 5CEWA 2DVTA 4GUIA 3AHVA 3PHAA 5FF3A 2BMBA 2E6FA 1Q6DA 3FVMA 2GK1A 3VDHA 4HPJA 1E4NA 1ZP4A 4IISA 1JFHA 3A12A 2TODA 2QDEA 5J5RA 1W91A 5KZMA 3GZAA 2R1NA 3PANA 4AF0A 1QWGA 3PB2A 3TJXA 3MJMA 4G8TA 2TPSA 5D9PA 2EXOA 2BNJA 2O7QA 1KXVA 1XBYA 3OG2A 3VUPA 1GVSA 4XAFA 1XH2A 5BNKA 4MYXA 1H60A 2DJXA 1QHPA 1W1VA 2OEJA 1U5VA 1LBMA 2V5DA 1Q65A 1CXIA 4O50A 3DBPA 3KVJA 3MVTA 4ZQRA 1EOKA 3D0CA 2MNRA 2QJJA 5HMSA 1FQ0A 2R8WA 3KVMA 5GJPA 4J3TA 1FHLA 3VZZA 3OO2A 4FK9A 3QHNA 1JDFA 3BGJA 3BWWA 3WJXA 3WQ6A 4M8UA 3MMDA 4NZJA 1T5AA 1MXDA 2J66A 3RAOA 3RIKA 1UWIA 3B04A 3AC0A 1E6ZA 4AY7A 4WXYA 4RUBA 2QT3A 4S2BA 2WXDM 3AROA 2UY5A 4KCUA 4JY8A 3ANYA 4HNTA 4KF1A 4KRZA 4LYKA 3D3FA 4WSHA 5JH1A 3S0CA 1NSJA 1OCNA 3W2KA 1PYFA 1VFUA 3OG3A 4UMCA 4XZMX 1LQAA 4Q8UA 3O6YX 1WDDA 2JFEX 3FAWA 2XFYA 3OHIA 1AW2A 3VIFA 3TQKA 4I5XA 3EDDA 1P0EA 5T8GA 1UWQA 2EBNA 2ZXBA 1TE6A 3MWCA 2J7EA 1Q85A 2DUZA 4Q8TA 4K39A 3QKEA 4N2YA 3HV9A 1YDNA 4HZ8A 1PHQA 4XBSA 3GU1A 5CJ5A 4IOTA 4TTGA 1TTJA 4ZB5A 1U2YA 3TFCA 2HWGA 3GXIA 2GL5A 3G0SA 4BFAA 3M0YA 2EPHA 5TAOA 3KW3A 2XWEA 1UUQA 3L5MA 1UWUA 4I6KA 3QGKC 1E9YB 2QEZA 3A4XA 4KFNA 3SDOA 3SAZA 5A2AA 1RCXB 2Z2AA 4C6CA 2OX1A 1YTDA 2OODA 4QE4A 3GG0A 3MDUA 1V0KA 3GIYA 2G3IA 4IJCA 5A6JA 1TZ9A 1IGWA 3AUJA 3DCPA 1H09A 4PUWA 1QBBA 2XH0A 1MEWA 3EPNA 4YNGA 3KCJA 5XINA 2F2HA 1F8IA 3KBWA 2XVNA 1SM9A 1B3WA 3WJWA 2GGEA 2OYLA 1XYZA 4HSOA 3HURA 2Z00A 4HU4A 2EF9A 4IQEA 2AL1A 2YL6A 4KGJA 2J13A 2WYSA 3FJNA 4BCEA 5E9XA 2VC7A 2G96A 3VAVA 3UWZA 5G1MA 1EJTC 1R3TA 4PMNA 5LNUA 2PDLA 3DZ1A 4UTUA 3W1QA 4DLMA 3W01A 2HBVA 2WMGA 3EPMA 1GZGA 5ABFB 2I9UA 1A5UA 1BWVA 3WD3A 1E5NA 1NP0A 3HZ3A 3EB3A 1E0WA 5G5IA 4H19A 1EA9C 1I0DA 1NOFA 1KQZA 4GACA 3BLLA 3DGRA 4FR1A 2VDHA 3NIYA 2EAWA 3QTGA 4B5TA 4XVDA 4B4HA 2HQAA 4L61A 4Z2GA 1YQ2A 4RZ4A 5TQLA 1LT8A 1Z48A 4DUOA 3LGGA 2XH2A 4EP8C 3BO9A 5DMLA 2CWXA 2NX9A 4IX0A 5CC3A 4IFOA 4TMBA 4AHOA 4CD4A 4GNJA 2ZXDA 5CZTA 3S42A 3WDPP 1CLVA 1YBQA 2QPUA 4B2DA 4FAMA 3BOLA 4YVPA 2DUXA 1H4PA 5T9CE 3RJXA 3N3TA 4J3ZA 4GXWA 4H7CA 3O0FA 3ELFA 5LIKX 3FNDA 2Y4SA 3SEPA 3E0VA 4PZVA 5EBAA 1R3SA 3M0MA 4PUNA 3QC0A 3OIHA 3OTRA 3W7JA 1CGUA 4HU8A 1LRTA 2C0AA 5DXXA 3P0WA 4Y90A 1A5CA 2W27A 1JCTA 1EJXC 5JVLA 2E9MA 4HU3A 4W8BA 3GIPA 3WKZA 3NSXA 4NJGA 2QAFA 3CZGA 2IPGA 1UMYA 3VD9A 3LPGA 5EYWA 3L2MA 2HEJA 1V77A 3PWAA 1V3HA 3JUGA 2XM1A 2YGYA 3ONCA 1DYSA 4JN6A 5FEXA 2VTFA 4DO7A 3UWEA 3WQDA 4CU7A 1U22A 2QS8A 1JCMP 3F5KA 2HV5A 1SO4A 1HKJA 3QM3A 2Y8KA 2J9XA 5C70A 4GI4A 1YW1A 1P1XA 3GU9A 1U1UA 2CLPA 3L12A 3ARXA 3ISIX 1XPGA 3PZNA 4Q4MA 4S1FA 2YFNA 3CV6A 3H2AA 2PDGA 3RO6A 2OO6A 2OR2A 3EB4A 4C90A 3B0XA 2PEVA 4LYRA 1CYGA 3DG3A 1Q3NA 5H2ZA 4UQDA 3QOKA 1YXDA 4RW5A 1DJQA 1OJXA 4C1KA 3LCLA 1SW0A 1ISVA 3G5EA 1HL2A 4DUWA 4IQDA 5HMDA 4WJXA 1NY1A 2GQ8A 5AYZA 1Y7VA 2YR1A 2Z27A 3LTYA 1KCXA 4N4QA 1FA2A 4MG4A 1JAKA 2ZVIA 3DFOA 3LUTA 3EMZA 3M0XA 4CN4A 3TONA 1VCVA 4AH7A 4ICCX 1HVQA 1W2PA 2HNEA 3SSJA 1JCYA 1BF6A 3VINA 4DJDC 1X97A 2XN0A 1NWRA 1OD0A 4LFYA 1MFVA 3NDOA 3AO0A 3T1GA 4CQ9A 1J0YA 3T4CA 3VGGA 3DG7A 1QFEA 1G4SA 3GLCA 3VNMA 2DZAA 3CWOX 1JCNA 4R9XA 1LCOA 5CG7A 4KEUA 3PUOA 4L80A 3AU2A 4GA8A 1ODUA 2OYMA 2J7BA 4H01A 3AXHA 3C61A 2IKIA 2HPIA 2OKOA 1RJQA 2E9LA 3AFBA 3HGOA 2KX9A 3QR3A 4P7QA 1O6IA 2DZUA 4KETA 4RE0A 5D9OA 3U57A 5TBOA 3BUVA 2DSWA 3H55A 3A5VA 2YB1A 3VIHA 1GWJA 4IG2A 2WHJA 5AC5A 3GXDA 4AZCA 2QGHA 3QQWA 2BXYA 2E0PA 3WG6A 4G7EB 3SCRA 5AYXA 3WX7A 1EO7A 4H6RA 4N42A 4QITA 3VNIA 4QE5A 4M29A 1F73A 3MC5A 3TW7A 3NO3A 3MDWA 4KPLA 4MHBA 3CQIA 5CGQA 5A2BA 5G2HA 4WUIA 1UP2A 3VNKA 4AXKA 3PFMA 2IXVA 2OGJA 2PWVA 3H7RA 1AQMA 3H2EA 3IJ9A 1HJQA 4YHGA 1N8FA 1J6PA 4CNSA 3CHFA 3DC0A 5CKSA 3FJLA 5FI8A 1VCFA 4YYCA 3RCMA 4OT7A 2UY2A 5C7HA 3OZYA 3CPGA 4L1GA 4W9TA 2AMGA 1IE7C 3VKJA 1TPVA 3UZZA 1J96A 1W8GA 4RNFA 1VBJA 4GYPA 2X1TA 3HG4A 3WIJA 1W3LA 6CGTA 3MQTA 1IEIA 4U33A 3FXGA 2XVPA 4HTYA 4FNSA 1DIEA 3CASA 2IUZA 3AS1A 3WQOA 4JTLA 5FJPA 1CXLA 3L9CA 4B5SA 4Z1CA 2X8RA 5K2ZA 3LK6A 1DJGA 3TC3A 2QDDA 4MOZA 1H5YA 4ZB0A 4PR4A 3SUTA 1ME9A 3EOSA 4XWUA 3IWPA 2ZZ3A 3KOYA 3H2FA 4PBFA 2QCDB 4JIQA 2EJAA 4BF9A 4IIDA 1TJ0A 3L4UA 3T4WA 2VGGA 4JHMA 4LTSA 4ZE4A 4QE1A 4OBSA 1UC5A 4LYPA 4TU1A 3LCHA 5FIPA 3T0CA 2DT2A 3BGGA 5AVNA 1CZ1A 1UR1A 1JI2A 1WZAA 4LVGA 4TVCA 1P7TA 5EMLA 4ACZB 4S39A 3RLGA 2JGQA 3Q65A 2W5FA 2OSXA 3MT1A 3L4TA 4EPEC 3TTEA 4GIRA 4Z2JA 3QLLA 2IPFA 3TJIA 2HVMA 4H7ZA 5G4HC 3MANA 1I6NA 2F38A 2RKXA 1KNWA 1OYCA 1KR0A 4NZ5A 1ZHAA 1I0BA 3GQYA 4GX8A 3UPMA 1M6JA 4WJ8A 2QJNA 1UZDA 4JFSA 3BSGA 1PB0A 4JTJA 3LEPA 3QV6A 4RK8A 5G2WA 2BZNA 5DT5A 1UH3A 2QW5A 4N9CA 4IPIA 3T42A 4PB4A 1W2VA 1EF3A 1VEMA 3N2TA 1B3YA 3MKCA 3F7JA 2P10A 3FYOA 3H54A 4AB4A 1Q8JA 1U33A 5CCZA 3ZXWA 3CEPA 4GY0A 1XSKA 1XKYA 4IQJA 3CLWA 2Q6ZA 3WDJA 2F2KA 2Z29A 4P7NA 4QS5A 4F9DA 3FK4A 3JVAA 3DHUA 1NP2A 4ZQNA 4HMEA 3TMQA 3GHSA 3GUWA 3LYEA 1LWJA 4FLRA 1XF0A 3EKLA 3HQ1A 5FD0A 4PTWA 3L5AA 1KRCC 4ZGYA 3ES8A 3UZYA 1H63A 1UWSA 2NLYA 2WKLA 4ZMGA 4P7OA 3GC2A 3FX4A 2VCCA 2G95A 3I65A 4WCJA 1U83A 1BPLB 2VI0A 1FFRA 1OSEA 1RSCA 2PC8A 1TPH1 3CXOA 2Y89A 4NAFB 2XN1A 1EF2A 5JMUA 1Q5MA 1AZ2A 1A4MA 1PZ3A 3NQMA 3C8FA 4RZ6A 1A3XA 4O13A 3LZ3A 4D1IA 4GNVA 4CD5A 1GG0A 1ITXA 3EWYA 3SIMA 3VGDA 3VFCA 1R3RA 2GPTA 5C9ZA 2J25A 2VFEA 2NUYA 2OWWA 2JGYA 5D2WA 4LRTA 1ZAIA 4JTGA 4JAWA 4UNLA 1P6BA 3L2IA 3LRMA 4BZYA 4C5ZA 4NNBA 3NZPA 5EBUA 2PP0A 2QVHA 1EH9A 1PCWA 1UIPA 4PC8A 2FJKA 4Y6GA 2A1YA 3KOZA 3TTYA 3VE7A 3QBUA 1S2AA 1XWYA 3L66A 2KZHA 3LCFA 1J9YA 3HGRA 3W84A 6PTDA 3QYSA 4XBKA 1MXGA 1X1NA 4U31A 2VR5A 4PMVA 5K9XA 2P3ZA 4PCSA 2R1KA 1ONRA 3VKAA 4GWEA 3IGSA 5A6BD 3H2MA 3VIIA 4DJEC 4YWIA 2VVSA 2H9AA 4PMOA 2E77A 4X0NA 3MCOA 1W56A 3FN9A 1Z9AA 4S38A 3RLVA 2WMFA 3FJ6A 4IP7A 3WDQA 1XISA 3QW3A 4QX4A 2JBMA 1C8VA 4GZJA 1GNXA 2V0TA 1QNQA 1RVGA 4BQ2A 1KBIA 5K9DA 5TF0A 2VHLA 5AHIA 4H9TA 1ADOA 2J27A 2TYSA 4Z2LA 4L4PA 3WK0A 5DCEA 5D2XA 2UBPC 4OFCA 5CPSA 5FAGA 5FOOA 5EU9A 3I4KA 2VRJA 1HIZA 1WAUA 2HCVA 2ON3A 2HJPA 5HNRA 4GUJA 3B97A 3DFTA 1FWFC 1M03A 3L65A 5G1TA 1JPMA 4JTQA 3DFNA 1W1IE 1X6UA 4CQCA 4LRSA 2V5CA 3NUKA 1TE1A 1F2JA 3QGAC 4GUFA 3UR5A 3OA5A 1S1PA 4I9JA 3GXTA 2F7FA 4YXGA 4KIRA 1QT1A 2WQPA 3ZJ8A 2C14A 4PEKA 3UXKA 1Z42A 4I3GA 3M9YA 1C9WA 5AHLA 1MWOA 5I7GA 1JI1A 1VFOA 4N7QA 3T40A 1OFEA 3P60A 1GORA 1GVOA 2Q09A 3GSMA 3K8KA 2F84A 1ECQA 2DW6A 3R4IA 3PY2A 2CNCA 5I3IA 4JTDA 2PD5A 1N2VA 3DBNA 1P0BA 2WKGA 3AYVA 3HPFA 2TMDA 1TRIA 4TX8A 4NHVA 3CHEA 4J7RA 1V6WA 1WZKA 3KOXA 4QLJA 1IEVA 2ZE3A 1KCKA 1XLMA 4MDPA 4J2MA 3UA3A 3ZLGA 2YXOA 3GNRA 3HN3A 3CL8A 4Y9PA 2X1UA 2R14A 4I90A 3G3DA 4WIWA 1VJSA 1SZRA 3G18A 1HKVA 2VGIA 4NRSA 5I3KA 4AG0A 4F0KA 3CYVA 1NEYA 1HP4A 1JZ5A 2P1FA 1AUSL 4WR3A 2HRWA 4JCMA 4GQGA 3DFSA 5G1YA 5CGMA 4ZTXA 3TK7A 4QG9A 2WSRA 4JYDA 5HNTA 4L4OA 3M7SA 2B81A 3HF3A 3U4AA 4HD5A 2YA2A 2X0YA 3JZEA 1J5SA 3CH9A 3H4XA 3UF9A 1DP0A 3NQAA 3P5YA 1RP9A 2BASA 2QJGA 4KESA 3BJSA 1JGMA 3B0YA 3SCNA 1RBAA 5EFFA 5GJMA 2VWTA 4JNYA 1RZMA 5F4SA 3EXTA 4A3QA 3LNPA 4H6EA 4QQ3A 1EP2A 4P2VA 4RE3A 1A3HA 1TO3A 3I3DA 2GDVA 3II1A 2PDQA 2FGBA 2YDRA 4M6VA 3VDBA 1B3XA 3C0QA 4PFMA 2XTKA 5IDIA 1XGEA 4MWAE 3PBVA 4JEJA 1VR6A 5SWUA 4EF9A 3W7NA 2TSYA 3SJ3A 1XGZA 1IHIA 4ENLA 3HQNA 3O6AA 2BXZA 3AUOA 1BWLA 2OZ3A 5HUOA 1TR9A 2PF8A 4ZENA 3B0VC 3COTA 3QTPA 2P8BA 1F6YA 4K1GA 1VFHA 4Z2IA 2XIIA 1F9CA 1EJRC 1W1ZA 1E15A 3V36A 2GGGA 3D47A 3TA9A 5CAHA 4O4VA 4HN8A 3TN3A 1T40A 2YBTA 4H8HA 2WVTA 4Z2KA 4QSHA 3LOTA 2FLIA 2TRSA 2DY3A 2VEPA 3FGCA 4GH1A 2PWEA 4Z1BA 3FA5A 4OVXA 4KMQA 2HS8A 1IR2A 3UZ5A 1Q7QA 4D6JA 1LBFA 5E0CA 1EC8A 1ISZA 4X60A 1AG1O 5BWFA 4JX4A 3H2CA 2NVAA 2PU0A 2D2OA 2VZVA 4YPJA 2PTDA 1S2UA 1QR7A 4LUYA 3EX2A 3EDKA 4FXJA 1AVAA 3BAJA 4ACYA 3AMGA 7XIMA 1ZL1A 4F48A 2J79A 1PKNA 1K8XA 3CT2A 3CZEA 4JTIA 2VT0A 1X38A 4I9MA 1XGDA 3PG9A 3OVGA 3O06A 3W25A 1Y5XA 4O57A 1B3VA 5LIWX 1Z89A 1FHDA 1XBXA 4E2BA 1GEHA 4FF5A 2GUYA 4XBJA 3WLHA 4HCHA 1R7OA 1MZRA 4PUDA 1WE5A 3OBEA 3NO1A 3BV7A 3AHYA 1DJWA 1FX6A 4MY8A 2YDQA 5AKQA 4TX9A 1DIKA 3CNYA 4YMZA 2DT3A 1RD5A 3VOFA 5CSRA 2G8ZA 4OV9A 3LBCA 2JE8A 1LL6A 4MWAC 1UG6A 4FLSA 2XPKA 3BG3A 1FY6A 2ZZ2A 1VLWA 1QPNA 1XC4A 4LV4A 3GYEA 3M0VA 2GSJA 4J3SA 1PTDA 4E3TA 3EWZA 2ISFA 2FYMA 2QUTA 2XH7A 5D37A 4LU0A 4PODA 3LY0A 1XLLA 1P48A 3S2NA 5CQ1A 2A7NA 3RPDA 1RA5A 4JR5A 5XIMA 4DUVA 3UWUA 1KM6A 2GOKA 1JZ2A 1JPKA 1DTNA 1UC4A 4AFYA 1XLCA 2WO5A 1EJUC 3BLEA 2V5KA 3S6TA 4Q7BA 4CCCA 3UJSA 5HR7A 3L7RA 4ZOAA 3B0PA 1Z41A 3CMJA 1BHGA 3U5YA 1Q6LA 1KC7A 3MSYA 4Q8MA 3ZO9A 2JKEA 3V0SA 2FVMA 1W9DM 1IEQA 4UNIA 3CS2A 3VM7A 3U7BA 1A47A 4UXDA 4D8AA 4E8CA 4XO7A 1GOXA 1OHLA 5IHRA 1S3TC 1QPKA 1GQLA 3KVLA 3N1AA 3DX5A 3AXMA 4QM1A 3GZ3A 4RDZA 1TELA 2V3EA 3QQ0A 2DVUA 3K4DA 1E51A 1XPYA 2VUYA 4KFOA 2PDXA 4G56A 1CPUA 8XIMA 3S83A 2QV4A 2B31A 4DWSA 4WY0A 4GXPA 6REQB 4D1JA 1VYPX 3GY1A 1ISXA 4W87A 5FEWA 1C3FA 4IJRA 4F0RA 3UXDA 3Q37A 3CEUA 3OA3A 1D9EA 2QLYA 4V2XA 3IJIA 1W5OA 4WSKA 3BARA 3FYYA 1GVQA 4WGHA 7REQA 1WO2A 5DO8A 4QTGA 4HCLA 4UZSA 4GG9A 3E96A 2VGFA 3AIBA 5CSUA 1QW9A 1Q13A 2AKZA 5C0QA 4HNLA 4OHQA 3WY1A 3UXIA 1KA9F 4NUWA 3GBEA 2HE5A 1XIJA 1TPWA 1V5XA 3GD6A 2PWUA 4TVUA 4XKYB 5GQBA 3PN8A 4GI6A 3KWSA 3LV5A 1XD0A 4EPKA 1ZFJA 4CD7A 4BI7A 4LUTA 3I6TA 2A3LA 1UZ4A 1MUMA 5DX7A 1CGTA 5KZDA 3ARYA 5IFPA 4QCEA 2D3NA 5HULA 2YCIX 1ADDA 3N9KA 2QCLA 4DI9A 3MVIA 1O5XA 3EXSA 1REQA 4LBUA 4US5A 1YMYA 2W3ZA 4HJWA 4A21A 1SJAA 3TJ4A 5BOEA 3IVSA 2DSVA 3GUGA 3SW6A 2INZA 2VOTA 1TV5A 4AYSA 3CWNA 1UW9A 5AYIA 3N6JA 1YYAA 3CV7A 4HYWA 1RLCL 1OFRA 4BEQA 1F3TA 2C3ZA 3EWBX 3ZR4A 2X0SA 1S5VA 5DY3A 1OM0A 2D24A 2BB0A 4BQ5A 1VFLA 1KM3A 4L5ZA 2GJXA 1PJ9A 4QJ1A 1L6FA 3ITLA 3TQVA 5FKYA 4WDWA 4E4FA 1EHAA 2QKFA 1PHWA 1TPFA 1G4EA 5BRQA 5HAOA 4YTRA 4AQLA 4XX6A 4HPNA 1EDGA 4B9ZA 5DBTA 4O1FA 3STEA 3RM4A 2YA0A 2E5DA 4HJFA 5HINA 3I7SA 1R2SA 1SMDA 1V7YA 3DHPA 3CMGA 2Z4GA 2Z26A 1H61A 5FACA 4JICA 4D6IA 2W92A 2HDJA 2IQDA 4WKFA 1CLXA 3G0XA 1RLDA 4WOZA 3WF2A 1XDMA 2EO7A 3B9AA 5C2CA 1EC7A 4AXNA 3PZMA 1YDYA 3STFA 2A79A 4IFKB 1KWGA 2VR2A 1BSLA 1JULA 1WKYA 4HVXA 4QJ3B 5AECA 4DN1A 3EWUA 1V8EA 3APGA 2Y2WA 3REQA 2OXNA 4BY3A 3R1ZA 4XUYA 3U4FA 3W73A 3GXNA 1RXOB 4O1BA 3JR2A 7ENLA 3MI3A 1TX0A 3H6OA 2VL4A 2FMOA 1BTMA 1F4HA 4F4RA 1PTAA 1BQGA 2A6NA 5LXXA 3CAWA 3QSRA 4O1DA 4PRTA 2CWNA 4XTDA 1A5BA 2PLCA 2Z0IA 2ACSA 3VGBA 5ABHA 1LG1A 3WO8A 4M0XA 2HE8A 1PWMA 3SUWA 3DYOA 1O66A 2PI6A 4MYAA 4F66A 2C71A 2YL8A 4XISA 2R24A 4MB5A 1B3OA 1RH9A 4ZEPA 1UH2A 2BHUA 3S1WA 1NQKA 5CPOA 2QULA 2CPUA 2FPVA 4K38A 3U0HA 1VYSX 1WZLA 3W7HA 2PDKA 5M17A 2E68A 1QPOA 3O6DA 4DJED 3IIOA 4G1KA 3WQ8A 2ICSA 4WVXA 3BW2A 3R10A 3EA1A 1KGWA 5C8BB 3PZOA 1E0XA 4LGXA 3URBA 4HMDA 1TPB1 4NJKA 1S2TA 1PKMA 1CB7B 3PBGA 1XDLA 4RKAA 1S5WA 4HHLA 2GJRA 3K2GA 1IWAA 2JQXA 4WKHA 2ZICA 1GQKA 1O94A 1H0IA 1VP5A 5IXEA 5AVHA 3WUBA 2E6DA 4DHGA 3T2PA 3KAOA 4GCAA 4ZFMA 1DPMA 5D03A 4HU0A 1IXPA 4O15A 4Q7NA 3R7MA 1DJYA 4L4LA 3GH4A 3LBMA 4P5UA 4PMJA 2W79A 1AJ2A 2ASHA 5AC4A 4DBSA 5HWNA 4FF7A 3GC5A 3W1TA 3UJRA 4O54A 3WQVA 1KFLA 4DO6A 1OC5A 2YDSA 1SZGA 2FHCA 1E1CB 3Q45A 1IGSA 7TAAA 1LOQA 4IH3A 4IP4A 5DMYA 3QZAA 1X6LA 1X8CA 4C6PA 1ZJHA 3H7VA 3W2UA 4UFLA 2JEPA 1ISWA 2GVGA 2VEIA 1HG3A 1UD4A 1CLKA 3M5YA 4EAYA 4JXCA 3W38A 1OYBA 1A5AA 4HN4A 1PTGA 4GCXA 3OGSA 5H6HA 3S1UA 3M0LA 4FLQA 2ZRWA 1W17A 2B7OA 1XINA 2X09A 1RCQA 1CTNA 4OU1A 3TYBA 4FP1A 2ZFAA 3G24A 4LUSB 2C1GA 3CAVA 4I7UA 3L23A 3R0UA 3N15A 4GH3A 3W2LA 2Y88A 1AW5A 3WUFA 2YPIA 1FCVA 3EDJA 5LNWA 3E2RA 2WLZA 2GVEA 4UR9A 1T0OA 4KWUA 4TOQA 4U4MA 3T08A 4LBSA 4DJFA 5DN1A 4C65A 2YZ5A 3O1NA 4HT3A 4XAPA 4H8UA 1V0LA 5A6TC 1F05A 3C8NA 4A3YA 1KBKA 3HQOA 1BGGA 3N34A 2XSAA 2J6VA 2E8ZA 4Q6JA 3HA1A 3BVJA 1OG0A 3HB9A 1NWSA 2QCCA 3PR2A 2OEMA 3NL5A 2A3CA 5BYWA 2CZ5A 4PUEA 4Z1DA 3ITXA 5BU9A 1IIHA 2H3DA 5FF7A 1PWLA 4GQQA 1XIBA 5A8PA 4HZMA 1YX1A 3KOWA 1WA3A 5KZ6A 5JXQA 1J93A 3C56A 4PCFA 4FLOA 4LJ3A 1VRDA 1GTHA 3GU2A 2ATSA 4XD6A 1NDYA 1LLWA 5E1QA 1K7EA 4R7JA 1FWWA 1G0CA 3GNNA 4IGMA 4JCLA 3S1VA 4PTVA 3S2CA 1KFWA 3F5JA 4PUMA 3WLOA 4M51A 3DGBA 2CHNA 3MI6A 3SRKA 4GKTA 4BR1A 1UD6A 1AL8A 4IPNB 2VKZG 1Y0EA 2OYKA 2G5WA 2OO0A 4Q4PA 4H8NA 4EX4A 4GZ7A 2QUNA 1H7PA 2WMIA 4EWJA 3TYAA 1SPQA 4GYPC 5GNXA 1OCJA 2RDTA 1YKWA 5I02A 1LM1A 4CQDA 3WLKX 3QV7A 4X2PA 1KBLA 4G5DA 5A6LA 3WCZA 3MMWA 3ZSTA 2GLKA 3TJLA 1OX6A 1AFSA 1IZCA 4U28A 3SCPA 4O28A 5AHMA 1RALA 5J04A 1TB3A 2PDNA 3IRDA 3VD5A 3ME3A 4H4IA 1O4UA 2GVJA 4GBDA 1J18A 3SCWA 3W1RA 5IM51 3A6OA 5GJNA 1Z32X 2VX5A 5E6ZA 3ZQ9A 1AODA 2FB2A 3GTFA 4J3XA 1LOLA 1VZWA 2OEKA 3PF3A 2ABBA 1BKSA 4M3PA 3UQNA 2CCRA 2G4FA 1TA3B 3CZLA 2CLHA 3ATYA 1JXJA 2R94A 3EAUA 1FWTA 3I7QA 4HNCA 1VF8A 3BV4A 4HYVA 2NSOA 3SGUA 4K8GA 1H50A 3M7WA 3FAXA 4YYFA 3BLFA 3M5VA 2C1HA 2WSYA 3KL3A 3Q94A 4D6FA 1J4EA 1PVNA 4GK8A 3QFEA 1UQZA 1GG1A 3AICA 4I9TA 1KXTA 4M6PA 3D3AA 2CZDA 1V6VA 3GDBA 4UNKA 3HPSA 1EX1A 3UZWA 1POKA 2OZ0A 4A2RA 1TMQA 2BHYA 1HNYA 3UXAA 1J2BA 1A5OC 4IIBA 5BRBA 1ZQ5A 3WH9A 4N6FA 4ES4A 2ZIDA 4AD0A 4HSNA 4JOMA 1UZHA 3LCIA 2CYGA 4HA1A 3UY7A 1YXCA 6XIAA 1A5SA 3W88A 2RUSA 4NYUA 4G7FA 4GYKA 4MIMA 3WL0A 2Y63A 4LXFA 3URAA 3UYCA 2P8CA 1KM1A 3OLEA 4GQBA 8RUCA 5GVJA 4KQNA 5DRIA 1BXBA 3CUJA 1K6AA 3GKAA 4AISA 3KVKA 1EUAA 5DMMA 1DXEA 5CPMA 1FWNA 4E2DA 3IGXA 3CBWA 3NQVA 3DH7A 4DUXA 3POCA 2ZWYA 2V67A 4MZ1A 3T9PA 3S9YA 3VGHA 1UUOA 2Z28A 4US6A 1GZ1A 2WPGA 3AI0A 3KFTA 4X22A 1EWDA 1MQPA 4RDYA 2V2CA 2WNWA 1I2QA 3TAKA 4BHYA 1W3KA 4B91A 2YLAA 2PODA 1K7FA 1XYMA 2NXHA 2WWCA 3L5LA 3GNDA 1LYXA 1PKYA 2RJGA 8TIMA 4O0QA 1SVDA 2PWDA 2QPXA 1V6UA 2WZTA 2GYIA 1TVLA 4XZNX 2YJQA 5ABFA 4JX6A 5E6YA 2Y8VA 2O92A 3FIGA 3QXBA 3BDKA 3KZPA 1K4GA 1ODZA 4H9MA 5CPLA 3F4CA 3TCEA 1OT1A 1J0KA 3TN4A 3TNBA 3KCOA 1GQNA 1JZ6A 3TCSA 1HZYA 3GXPA 1DORA 9RUBA 1EHNA 4REQA 3GM8A 3M41A 1LQ0A 4IQLA 2Y85A 1TTQA 1KM5A 3VZXA 1U5JA 2ZTKA 4D6HA 4O53A 3BW3A 3PG8A 4OKDA 3WLRA 1EP1A 4JDBA 4Z0SA 3MSDA 5L6UA 4NT0A 5FJRA 1OC6A 3SQMA 3UWYA 2GZXA 4B3ZA 2QUUA 3UESA 4Q4RA 1TYGA 1UB3A 3HGSA 2WVUA 3L2LA 3TU9A 4MM1A 2V68A 4Q8NA 5AY7A 5LIXX 3RDKA 4P8UA 1JYVA 1FWSA 1UWTA 1TR1A 4H6KA 2O4QA 3GW0A 1J2WA 1XLKA 2ZX7A 3NQCA 4IWWA 2NWRA 1OFDA 4CQAA 5M03A 1W0MA 3QV8A 1GOIA 2DZXA 1US0A 2GJPA 4H9YA 1HW6A 2ZUTA 1A80A 4FNQA 4NZ3A 2ZZ5A 1MW1A 4GJJA 5B80A 5IFTA 3T81A 1BWKA 2ZRXA 1ZCCA 3P62A 3PC0A 3N9SA 4JL2A 3MB9A 3CWHA 4N9DA 1HJWA 2MUCA 4RNIA 2V6AA 3BMXA 4Z08A 3VA8A 4J2PA 3IV8A 1HFBA 5F1VA 4PTXA 3K30A 4ZOEA 4A22A 4ILSA 1L6SA 1AZ1A 1VBGA 1CXFA 4JIIX 2VD9A 1D2KA 4XZ9A 4UQBA 2VX6A 1DJNA 1G6CA 3PTDA 2FTYA 2QQ6A 1BFNA 1MRAA 4RV3A 2CBIA 3J7HA 2PE4A 4AYGA 1A50A 2GFTA 4UUIA 4IP5A 2EKGA 2I7GA 2XU2A 4CN1A 5I6SA 3R12A 5AZ0A 2NUXA 3G22A 4GVFA 1XCXA 1JG9A 5CBIA 2PGEA 3NTYA 1VPXA 5FESA 4U3CA 2ZDRA 2VRQA 1PS9A 3WK2A 3PBYA 1A0DA 4S3FA 3RF9A 2I5GA 1Q63A 1L2QA 2XN2A 4Y9AA 3DN5A 4QEEA 2WC4A 3BPWA 4PMQA 2PDFA 3W1AA 4E4UA 4OUIA 1F6PA 1SQ7A 1ZBCA 2QV5A 4GI8A 3KBMA 2DQXA 4MZ8A 1FWBC 2SFPA 1ZNNA 2A7PA 1EYEA 1LZOA 1GONA 4ERAA 5I77A 3ZVIA 4DAFA 5K4XA 1P5BA 3LI1A 4M1RA 1UJPA 3TXZA 2R9RA 3ERPA 3QGVA 4DZHA 3NSNA 4UOJA 3OYXA 4IMAA 4O1AA 3AMKA 3MKKA 3H53A 3CZ8A 3UG8A 4AY8A 4GVIA 1ICQA 4C6FA 2BDQA 4QRNA 4W85A 5M2FX 4P8WA 3ALGA 2HROA 2WMKA 1XYCA 4G7EA 1F3XA 1TJRA 3W6YA 1NH6A 4JDYA 2X05A 5D9NA 3TSMA 4W84A 2IW0A 3VC5A 1V3KA 1ZBVA 1XH0A 4PCTA 3ANUA 3OU8A 4XSMA 1EX5A 1Q7ZA 4MNLA 2W91A 4B2DD 5HXMA 5MF5A 4FXRA 5DRCA 1FCUA 1GEQA 4I5RA 2ZZ7A 4A8RA 3HPXA 3JS3A 1DJIA 1K1DA 1VAHA 4IPPA 5KINA 2PLJA 1TCMA 1Q8AA 9XIAA 1J0ZA 3RX2A 1ICSA 4V15A 4NJJA 1SYTA 3G8RA 3BLIA 1QUMA 3B40A 1BF2A 3VCRA 4XZWA 3DI0A 4WHBA 2CHOA 4GNKB 1SZFA 3URNA 4YHEA 1H7NA 1UMLA 3GIQA 3P6LA 3PULA 3EX3A 3UZXA 4EK7A 3K5XA 3W1NA 3K13A 1YLVA 4JQ3A 4P8VA 5I3JA 2J8TA 4GI9A 3RLUA 3B4YA 3LI0A 1FOBA 1DL3A 1UKQA 3W28A 5I5RA 1EJWC 3N2XA 1X98A 3PAOA 2WJZA 1WZMA 2E3ZA 1QK0A 3UZJA 1ZP3A 4B3KA 1UBPC 4KERA 4AVOA 1A4LA 1LLZA 3HQPA 1E56A 2BBFA 1KFKA 1XYAA 4O10A 5C9XA 2XGZA 1DWIM 2VOMA 1JJKA 1W54A 4QGCA 1S38A 1XSJA 3MCMA 3V16A 4F40A 1E9LA 4JTEA 1X1ZA 3L0NA 1HKIA 1LRQA 2YCJA 2V63A 4JTCA 3TX9A 2L5HA 3SGZA 4C1NB 1JZ4A 1V51A 1TZZA 4JFWA 1L9WA 1JZ8A 1E4MM 4RXFA 3TR2A 1KTCA 1E6SM 1VBHA 4S3EA 4NL1A 3DFYA 4LVFA 3IPWA 1J11A 3G8EA 4E5TA 3F4DA 3H21A 1LWIA 1Z44A 2KAUC 4WQ6A 3VX0A 2EG7A 1T41A 3MTWA 2C1IA 1YPIA 4QXIA 1AQHA 3CO4A 4EWND 1UD3A 4ACZA 4KWWA 3HTWA 3OLDA 3W27A 1E0TA 2Z25A 1KGUA 1VLIA 2WB5A 3MHGA 5I3FA 4PUJA 4HK7A 1ITQA 1UR0A 1E6RA 1I45A 3WNMA 3GWQA 2OX4A 2ZZ4A 2X1IA 4W7WA 5FSDC 4KBXA 2WSQA 1TTPA 1HL9A 2WK2A 2X16A 1I2OA 5A6KA 1JF6A 4IGSA 1QNOA 5AHFA 4Y2WA 2PD9A 3OB8A 1FH7A 5D2VA 5BMXA 2ESCA 2YCLB 2XG9A 1GJPA 1TV8A 3A64A 2H3BA 2QCEA 1FTXA 4B5WA 1E0VA 1ZAHA 2O9TA 3OLIA 2ZKMX 3UBPC 3WMCA 3CUHA 3N2BA 1TV2A 1NJJA 1MO0A 2VWSA 3EKGA 4UR8A 1IR1A 1LROA 3FEMA 3H22A 4HNOA 4JFVA 3WENA 2WC7A 4RV8A 1SO6A 2CLKA 1H7WA 5MHBA 4KWOA 4JIEA 3MUIA 1CDGA 3PB0A 1PV8A 4S23A 2V2HA 1DWAM 1LF1A 1OF6A 3HM7A 1V3JA 1UR3M 1F5ZA 3C2YA 1UZ1A 1E43A 1H1YA 1DWJM 4A3UA 1DIOA 3PWIA 2RGMA 3WF3A 3KRSA 4PB3A 5I07A 3QV9A 4AIUA 3VFLA 3QW4B 4IMDA 4CD6A 3HBLA 1WDQA 1E3ZA 4ZL1A 2ADAA 4N4PA 1R6WA 2PDIA 4NAFA 1K77A 3N17A 4GQRA 3NURA 3LM7A 2ZCGA 4L4MA 3WUEA 3CM4A 3CV1A 4C6QA 3V5CA 1E9IA 4KEZA 4XD3A 1K70A 3IJQA 3K1DA 4E2VA 1G4PA 3PTMA 4NZCA 2GJNA 4QISA 3W86A 2HISA 1VS1A 1HXJA 3GW3A 2EGZA 2ZUVA 2FB3A 2OQYA 4OIFA 2PWHA 3MSGA 4FIRA 4IXHA 3LHUA 2BX7A 1MSSA 3F5LA 3LERA 3WNOA 3UR2A 2J78A 2WZHA 3W4RA 1QPQA 4WY0F 2Z1SA 5U7SA 4UBPC 4DWSC 1FWCC 4JTUA 2VFFA 1WX0A 3EZ4A 4FB7A 3RFAA 4GYFA 1RCOB 3S6DA 3PBWA 3LRLA 3THCA 3DEQA 1G69A 1XUUA 3DERA 2A3HA 5LA2A 3LPFA 1PDYA 3UA4A 3KBVA 1VH7A 3MUZ1 1AJZA 1IYXA 1TWDA 1F07A 1EB3A 3N11A 4GXMA 1IT0A 4DYEA 4A4AA 5DCBA 4D6DA 1JUBA 1K8CA 3TMLA 4E3VA 4JTTA 4FPSA 4HMCA 2BSLA 3NWRA 1WV2A 3UU0A 2I16A 1C91A 3IIXA 4UTWA 4U2ZA 2Z1WA 1TPC1 1WKDA 3T0DA 2W4XA 5A8NA 1X8FA 3KS5A 3M0HA 1RAKA 4QNWA 1V4YA 3M43A 3ORWA 3VCCA 1OFBA 2A2IA 3AJXA 1OCBA 3FVDA 1H62A 4KCVA 3HMCA 4LH8A 1QK2A 1GUVA 2X0HA 2C0HA 5U4NA 1WKEA 2CXEA 1YNPA 2VCAA 2Y1HA 4YL2A 4M81A 4F2BA 5C5YA 2R82A 2PDYA 4H2CA 3W1LA 1DQXA 1GW9A 2W0UA 3CZKA 4Z42C 1Q6FA 1JNDA 4HCDA 5HPCA 3TV8A 6XIMA 3BC9A 1FKXA 4ONVA 2CLMA 2Z7GA 2HVOA 4NKCA 2RHGA 2GOUA 3B8IA 4MF4A 3H26A 2QVNA 4QG8A 1RD6A 3CIVA 3EWDA 3TOYA 3BLDA 1D3GA 4QJ4B 2F61A 3MV01 5HMEA 4EOUA 1Z3NA 1R3WA 5LGZA 2XFRA 4D9PA 4XAGA 3BAXA 2YFOA 1QJWA 1GVRA 3F4VA 3GAYA 2FZNA 3AWNA 2DPEA 3V0TA 1OY0A 2BOGX 4HNNA 1F6KA 4M82A 3P3BA 2CIPA 3GHTA 5TIMA 4UFMA 3AHTA 2HNHA 1D7FA 1VD6A 4EIVA 3WK1A 3XISA 3SB0A 1SSGA 2H9AB 3GNOA 3TQ0A 4CNPA 4YVVA 4NSBA 4Z1YA 2FVKA 2GDQA 3CB3A 4XZHA 1C93A 2E1WA 1YEYA 3KOFA 1AQFA 1US2A 1P0KA 3F4WA 4LF2A 4QDWA 4X9SA 4MZYA 4LUIA 3W07A 1FWIC 1K7XA 4I7VA 3VDGA 1JPHA 4QHRA 1EEXA 2QJIA 2YYTA 4UFIA 3M5ZA 3H4WA 2WLYA 1BLIA 1XW8A 2BS9A 4Q7IA 1LG2A 2F6XA 1XYFA 2XFFA 3CL6A 4O0KA 3N3MA 4IM4A 3QHOA 4DXVA 4ZBCA 1QNVA 1HGWA 4DIAA 1CEOA 4FX7A 1G7VA 2CBUA 5LGXA 3PJUA 3W7PA 1FP9A 2XIQA 4DM2A 2D23A 2VM8A 3GXMA 3TE9A 3H70A 1HO4A 2OMAA 1SFTA 1WDRA 3ZJKA 1HJVA 4HBKA 4JN8A 5D38A 3NQ8A 3LGEA 4H1ZA 4HGXA 1TV4A 4DXXA 1K9DA 3V4BA 4D8LA 1N7KA 4H3DA 1OBAA 2D69A 3A5FA 1B4KA 1BAGA 1V02A 4CU6A 1XCWA 3M4HA 3TZNA 1ZUAX 1UOKA 8A3HA 3QPZA 4MAVA 1DTUA 1JNEA 3CTLA 4OJYA 2ACUA 1HKKA 3UY8A 2A0NA 3DKJA 4INFA 2HXTA 1XLAA 2X1SA 3TWAA 2CEQA 2QIWA 2REQB 1PKLA 4JQ1A 3T78A 3L4VA 3RM9A 4HOXA 1FDJA 5C55A 3KM8A 1KCLA 3BSMA 1KKRA 2I9EA 4MLRA 3W37A 3GNPA 1LT7A 2HK0A 3E2VA 3QQ1A 1JRCA 1UR9A 1NVMA 4CU8A 3EKZA 2QF8A 3NVTA 4RR4A 3UYIA 3UR7A 3NNTA 2XSXA 1WXJA 1F74A 4HP5A 2RDXA 1XV8A 4WK9A 4KT2A 3NGFA 1XUZA 1XBZA 3EDEA 1OB0A 2VC5A 5JQ9A 4W93A 2ACQA 4MADA 2CESA 3SGGA 1TRDA 4AD3A 4QAWA 1XHGA 1UKOA 1JQXA 4IMFA 4S2CA 3A22A 5JBDA 1OK4A 1SMAA 2HS6A 4DELA 3U9IA 1HN1A 3G1VA 1W3NA 2V30A 2VDIA 3WZ0E 3MBDA 4ZR8A 3CB8A 1NFGA 3LD5A 1ZGDA 2WCGA 2HTMA 1I1WA 4HPHA 3C0JA 4PMZA 1H7XA 1ME8A 4NASA 1JD9A 3GR7A 1EYWA 1E6QM 4J9JA 5LHEA 5BMWA 4ZQOA 4BJHA 4DAIA 2PZNA 4S3KA 4RXGA 3WMBA 4U3AA 4MB4A 1CXEA 3AAMA 4IPJA 2I14A 4ZO6A 4CNNA 4Q8WA 2BVDA 1UWRA 1LL4A 2E09A 4M7TA 4E4PA 1AD4A 2PWFA 2DORA 1UJQA 4E2OA 3LBOA 2A3AA 4B5VA 3OEXA 4L56A 1RQHA 4DJFC 3FW6A 3CV2A 3LGDA 4MLJA 3V3WA 4GFIA 2C91A 3CUXA 4GYJA 3A3XA 1ZS2A 4LAZA 1ZBKA 4H8VA 5FL1A 1VEOA 3SM0A 1BXNA 1ZZMA 1HKMA 3QMSA 5EFDA 1E4IA 5REQB 1EL3A 4GGBA 1F4AA 3W7OA 1M01A 3BG5A 3AIEA 4JTSA 5CGTA 4IL0A 3VDCA 2PC4A 1J8VA 2WC3A 2EJ1A 4N6EA 3N4FA 4OWGA 4K36A 1AA1B 1UP3A 1S5MA 1F3EA 5A3HA 3MA8A 2H90A 2GDUA 4TO8A 5F2GA 3NM1A 1PX3A 3LA4A 4KRUA 1UIOA 3VCNA 4CNUA 3RK8A 3M6YA 4CVUA 2O4MA 4DVOA 2NQZA 1V3LA 2PB1A 3C2VA 3TXVA 4TV5A 3RN6A 2V81A 3HGJA 3C4UA 4RDVA 3GS6A 1WP6A 2YYUA 3N04A 1DQUA 3IS4A 1H3GA 3ARQA 3HPZA 4AIOA 1RR2A 5K3VA 4YTUA 4PBGA 3SI9A 2IPWA 1EXPA 5I79A 3IJ7A 1RJRA 4PMDA 5JU6A 1V6TA 1B9BA 2IMRA 3LRKA 1EC9A 3IJ8A 3CT7A 2VC9A 4TVDA 2ALDA 3OLGA 4D6GA 4NG3A 5I24A 3KLKA 4ADUA 3WEMA 1YPXA 4GUGA 2G97A 2GUBA 4FSAA 4R85A 5EPDA 3HG2A 4GC4A 2VD8A 4DI8A 1I2RA 1Q66A 3CZJA 3WEOA 3IJDA 4QP0A 3W1UA 4HHHA 1QMLA 1TWIA 1AH4A 6REQA 1VGAA 3VO0A 3GDKA 1I9CB 2FTPA 3AIWA 2QF7A 3MSRA 4W8LA 4Q4SA 4XZBA 2Q8XA 3L4WA 3W7GA 2G3NA 4MUPA 1RHCA 2QXWA 5HUPA 3A9BA 3E5PA 2PDBA 1O5QA 4WOQA 3WQEA 2OPJA 1TIMA 3FKKA 3S5SA 3YPIA 3P93A 3CPUA 4LWWA 3TWBA 4IIFA 3H2OA 2XIMA 3ITGA 4UTLA 4B92A 3PZQA 4TMCA 5LNRA 2PURA 5A95A 1C29A 1ZPTA 4RJEA 1BXCA 3K4AA 3HO8A 3F2BA 5LIYX 3UNDA 5FJOA 3WF4A 4WZHA 3NJ3A 1B2YA 3APTA 3ZT5A 3WF1A 4ROPA 3W00A 4XKYA 1HL8A 3IUDA 2B4GA 4XD5A 3O15A 4UB9A 5BROA 1ML1A 3ID7A 3VTRA 2GJLA 2GSHA 1TPEA 2WHMA 2WSPA 3THUA 3TYZA 2BHZA 4JYEA 2QHAA 3MO4A 1ZJIA 1XLIA 2IKHA 3HFTA 5JH2A 1O5KA 2EPLX 1OX4B 3NZ1A 3G1YA 2Y7FA 3W6MA 1HO1A 5HANA 3G1AA 3KLLA 3SJNA 1MXSA 2QUVA 1T7LA 3LPPA 1OD8A 2ANUA 1AH3A 3WNNA 1L6YA 2J74A 1BKHA 3M0ZA 1PEZA 5ECVA 4Q8VA 4DPPA 4BWLA 2XZ9A 1HGYA 2AMXA 5DMNA 3TSDA 1UD8A 4YJ5A 3V18A 3KZSA 3WJZA 4PUKA 3S2LA 5BXTA 4AD5A 1FWRA 2XISA 3H8AA 2DVXA 4M1BA 1OGGA 2AL2B 5F4WA 4YWSA 3O3RA 3AS3A 3QY7A 2J4GA 5J8LA 7REQB 1XH1A 2G41A 1R7AA 3VOJA 1EBGA 5BCAA 1BVZA 2I1OA 3VD4A 2ZRZA 1MI3A 4WD0A 3OW1A 9XIMA 5LXEA 2VZSA 4QG6A 3OPSA 5FEZA 3PJWA 1R30A 4LF1A 4L7ZA 3RX3A 5A8OA 4OOZA 3VX1A 4N9EA 4AY1A 1XRVA 4JHZA 2OVLA 3MCNA 4ORIA 4D6EA 2WOQA 4X0VA 3GFXA 3SCVA 4IFKA 4Y9OA 1KWKA 2X2YA 1O60A 1KRAC 2GVLA 5EMUA 3O63A 3ITVA 1DWGM 3W29A 2BLEA 3NPUA 3FDGA 2J75A 1QO5A 4ZO7A 1W6TA 3RO8A 1T96A 3RGTA 2NX1A 1DJXA 1UUMA 3R6IA 4EXQA 5TNVA 3WNKA 3WH8A 3TDFA 2QUMA 4Q8QA 2JKPA 2GWGA 1W9PA 1XG4A 5K7JA 3B0UX 5A6SA 3VOGA 3ABRA 2UY4A 4CUCA 4Z17A 4Q6XA 3GG7A 2YBVA 4UTTA 4DWSD 4R7WA 3QC3A 3M44A 3E0FA 3V5FA 3WYZA 4P8XA 3EX1A 4CQBA 1W8SA 3MYOA 1FKWA 2QCMA 1J0HA 3CU2A 4KWVA 4O18A 2WV8A 3UNTA 1ME7A 4B9YA 4HA4A 3A23A 1R2TA 3C2RA 2ZUUA 2WWDA 2ZUNA 1A5NC 1XR2A 1PO9A 3W1XA 3AXXA 1UKTA 1UA7A 2FIQA 1EZ2A 1OQFA 4XIAA 1PSCA 2FHBA 5DANA 3ZIZA 1XIFA 2FZ9A 3GE7A 2DSUA 3IJLA 4H6QA 3P80A 1X96A 3KTXA 4QS6A 3OZMA 5KETA 4OQVA 2UY3A 3QOMA 2E5BA 1LQ2A 2GVYA 1VJIA 4ZOCA 2PDCA 2E67A 4YLWA 1Y65A 3OVQA 3S1XA 2OWCA 1WB0A 4F3HA 5LSMA 3MUAA 1J5TA 2J62A 3KHDA 3LU2A 2B0MA 4R33A 4NVTA 1VEPA 3PFRA 1K4HA 4FI4A 1MUCA 1E1EA 3RX4A 4AMAA 4US5D 3REQB 3OJGA 5C7VA 3ABSA 3QEZA 3VKCA 1W32A 1UKSA 1AW1A 2A21A 4JNMA 4X2RA 3W7QA 4PTDA 1XKJA 2VZOA 1J0IA 5HNNA 1NARA 3FDKA 2OT0A 3WQPA 2DZPA 1TJ1A 4XG1A 4DXKA 5BWAA 2GWNA 1VIWA 1E1CA 3R89A 2LLEA 5HJXA 4JZ5A 3S9IA 3OVPA 3W7IA 3LZ5A 1KRBC 3BAYA 2VENA 3I68A 4ADTA 3WF0A 3H12A 3BW4A 3WLJA 3EBVA 3PS7A 3S46A 4EVZA 4IHCA 2OU4A 3ZWSA 2X2GA 1W1A1 2X42A 3OZPA 4X63A 5B7YA 1P4CA 1I8JA 4XVEA 1TUFA 3TKFA 1EKOA 4R3UA 4LUSA 5E09A 1RA0A 3B3DA 1V6XA 3SFKA 1SJDA 1LRNA 3RMJA 3LN3A 3GVQA 3GHUA 3WFZA 4AHQA 1S2WA 1O7AA 2ZC8A 3VDAA 4AWSA 5RUBA 1KFJA 3QHMA 3W74A 4JKMA 3THQA 1A5KC 5I2UA 1WNOA 4UFJA 4RL3A 3TIMA 1US3A 4B4FA 2FTWA 3THAA 4Y8EA 3UD6A 2WW5A 3JZUA 3EXRA 5JIWA 3S5NA 3BCDA 1R9YA 3SUSA 5CXPA 4WDTA 4TTUA 1DHKA 4HK6A 3L68A 1E1FA 2EQDA 3W22A 4CN6A 1ZB5A 3RLHA 4F0HA 4MVAA 4P7LA 3KBJA 3HIJA 3DECA 3V1HA 4JD4A 3MWAA 4LAMA 2OZTA 1K03A 1BYCA 2DUAA 2O0TA 1SUXA 1CNVA 5G4EA 2IS7A 3E9AA 2QCFA 3BMWA 2YB4A 2O56A 3W81A 1PYMA 3ABQA 1T99A 4RZ5A 1MFUA 1VC4A 3M16A 2O9RA 1ZTVA 3R13A 1THFD 2PCQA 5LYRA 2PP1A 3VD7A 2V8ZA 1O5RA 2OKTA 1NF7A 4PUUA 4RCXA 4K1WA 1W1YA 1QBAA 2CBVA 2HZGA 3S2JA 5AFDA 2P3EA 1TTIA 1OZQA 4L9XA 1NOWA 1W3IA 2A85A 3SN0A 1JPIA 3CMFA 2XH4A 4HA3A 4ORMA 3GAKA 3CTTA 1IT8A 1XL9A 4AVNA 3LCGA 2RJHA 2P50A 1NTHA 4MFDA 4OE7A 1OK6A 2G0WA 3E6EA 3VNLA 1JDDA 2VR4A 3BQ5A 1HT6A 4J3VA 3TVAA 1V08A 1R5YA 3ARTA 4C6BA 5BW6A 4AUBA 3ATZA 3PK7A 3VNDA 4NI8A 2D0HA 3T0BA 1FDZA 1PPIA 3C3NA 2W67A 1W3JA 4D71A 4WF7A 2DH2A 5I09A 3XIMA 3PUGA 3GRIA 1WDWA 2CLOA 3IGHX 3B05A 3SUUA 1K02A 3UJEA 3WLMA 2FH8A 4O1EA 1FCQA 4HMNA 2YOCA 3UCQA 1TA3A 5EMMA 5LNVA 2BY3A 1K3UA 4A2SA 4IZGA 2XVKA 3ZLHA 2X30A 3ARVA 3TC7A 1YNYA 3NQ6A 4PMRA 1H0GA 3MW7A 4R5EA 4Q22A 1FP8A 4GISA 2UZ9A 1GZJA 2CLIA 2XJ7A 1GOWA 2PDUA 1BYBA 3UVIA 2P53A 4Q4OA 1CW2A 3FY1A 3NQGA 4DO4A 4YTQA 2DGAA 3SRDA 2J8GA 2YCKX 3E1F1 1HJUA 2PUZA 3BLOA 5T9BG 5LHFA 3C2FA 1XDJA 3SUVA 2VEKA 3PNZA 2Z1VA 3K8LA 4FIQA 3LB0A 5D02A 1F7BA 4NYYA 3RRAA 5AC8A 1UR4A 3RHGA 4ZQCA 4CCZA 3MJYA 3WDIA 3A4AA 2ISSA 4QCFA 2VNCA 3WQ5A 2PTZA 1JCJA 1Q6RA 1N55A 4AIBA 2NWSA 2WMIB 3RPTA 3H23A 1FHVA 4YIWA 2NV1A 1XG3A 1EO5A 3DESA 5C9WA 4BA0A 4H83A 2WZIA 3NSMA 1SR0A 5LNSA 4MPQA 2PDHA 2RH9A 4LPCA 4DJFD 4UMBA 4WGXA 1EIXA 1I4NA 1XSIA 2DFAA 3EB2A 2PDPA 2XWDA 3ZMRA 3KRUA 2C79A 4BQ3A 1E5JA 1X1OA 2IXUA 1PXGA 3VIPA 2HSAA 3RU8X 3WDHA 1UCWA 4AZBA 1E6XM 4DY1A 1GVIA 4XV0A 1JCXA 1SGJA 4Q33A 1JUKA 2G4JA 3C86A 4JPGA 4LSBA 1E72M 2O7SA 3LHWA 3I3BA 3R0DA 5HMFA 1A5MC 1GK8A 4LAOA 4HIBA 2E9BA 5D33A 1G7UA 4CEUC 3U6WA 5CSYA 3OGRA 5CBJA 4OGZA 2JK2A 5B7ZA 2IKJA 4JY9A 4LNYA 1SO3A 1E6PA 5FSEC 3VKBA 1I2NA 3S9ZA 4IICA 4JIRA 3L0GA 5D8ZA 4DZAA 1EQCA 4AC1X 3PM6A 1C9DA 1W9UA 2YBUA 2YSWA 4JQAA 1YADA 1EA0A 1U1JA 4GINA 1FXQA 1E40A 3GDRA 4R7OA 1JL8A 3U2ZA 3W7MA 2PAJA 3HJZA 1J79A 1SFSA 1D3HA 2VGBA 2J7CA 5HDRA 4DJDD 3STCA 2BGSA 4K7VA 3QVQA 4D2JA 6A3HA 2QR6A 4JS3A 4UFHA 4DBEA 1GVFA 1ISYA 4RE4A 3TW6A 2OQLA 2Y6ZA 4O52A 4GQ0A 4LS0A 4C5YA 2CZVA 4OOUA 1B30A 4C60A 1OFPA