1HW6A

Crystal structure of apo-2,5-diketo-d-gluconate reductase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
262
structure length
257
Chain Sequence
TVPSIVLNDGNSIPQLGYGVFKVPPADTQRAVEEALEVGYRHIDTAAIYGNEEGVGAAIAASGIARDDLFITTKLWNDEPAAAIAESLAKLALDQVDLYLVHWPTPAADNYVHAWEKMIELRAAGLTRSIGVSNHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGKYDLFGAEPVTAAAAAHGKTPAQAVLRWHLQKGFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural assembly of the active site in an aldo-keto reductase by NADPH cofactor.
pubmed doi rcsb
source organism Corynebacterium sp.
molecule tags Oxidoreductase
molecule keywords 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE
total genus 90
structure length 257
sequence length 262
ec nomenclature ec 1.1.1.346: 2,5-didehydrogluconate reductase (2-dehydro-L-gulonate-forming).
pdb deposition date 2001-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1hw6A00
2PDYA 4NKCA 1M9HA 1US0A 4WRHA 4WGHA 2PDUA 3R6IA 2PEVA 4JQ1A 2BP1A 2PDHA 3V35A 5M2FX 1YE6A 3BCJA 3LQGA 4PMJA 4QR6A 2PD9A 3V36A 4LB3A 2IKIA 4XVEA 1AH3A 1S1RA 2FZ9A 4LAZA 1K8CA 5JH2A 4ZFCA 2IKHA 4XK2A 2IQ0A 1YNPA 3COTA 4H8NA 3UFYA 4YS1A 2PDWA 2PDQA 4L1XA 5KETA 1GVEA 3GHSA 2BGQA 2HE8A 1EXBA 3F7JA 3UYIA 4WDXA 1EKOA 1Q13A 1PZ0A 2NVCA 2PDCA 3V0TA 3CV7A 2R24A 1HW6A 1QWKA 3LUTA 2IKJA 2FVLA 3LENA 4LAUA 2DUZA 1EF3A 2ACQA 4OTKA 4WEVX 5LIWX 3V0SA 2PDLA 2A79A 4YVVA 4MHBA 4YVPA 4XAPA 1PWLA 4GQ0A 3MB9A 3EAUA 2ACSA 4JTRA 3R8GA 2PDJA 1IEIA 2FZ8A 3WBYA 3GHRA 3R94A 2ISFA 4PRTA 3NTYA 3U2CA 3WBWA 2IQDA 1Q5MA 1ZGDA 4GA8A 3B3DA 4LBSA 3N2TA 3LD5A 4JTCA 4WDWA 3R43A 5JH1A 4DZ5A 2ACUA 4QXIA 3LN3A 3BURA 1AZ1A 1Z3NA 4FZIA 1RY8A 4ASTA 1ZQ5A 1LWIA 3LBOA 4IGSA 4JTDA 2PZNA 3WG6A 2FGBA 1QRQA 3R58A 3H4GA 1ZUAX 5DANA 4JIIX 5LIKX 3H7RA 1A80A 4R9OA 1Z8AA 3RX4A 3KRBA 3O0KA 3Q67A 3UZXA 4RPQA 4QX4A 4FAMA 4XZHA 3GUGA 2WZMA 1PYFA 1MZRA 2PF8A 4Q7BA 3UP8A 2ALRA 4JQ2A 3WBXA 2PDBA 3G5EA 1ZSXA 1C9WA 5HNTA 2IPGA 2PDKA 1FRBA 2PDMA 1AZ2A 1AH4A 1X96A 3R7MA 3GHTA 2PDFA 4LB4A 2PD5A 2I17A 4JTAA 2IPFA 3QKZA 4F40A 4JIHA 4I5XA 4XZMX 4YVXA 1T41A 4LBRA 3Q65A 4AUBA 4JQ4A 2I16A 1PWMA 1JEZA 2IPWA 1T40A 2P5NA 1ADSA 1Z89A 4Q3MA 3D3FA 2FZDA 2DV0A 4WDUA 5HA7A 1LQAA 2HDJA 3FX4A 2C91A 2IPJA 3CMFA 3CASA 4XO6A 1VBJA 1R38A 3LZ3A 2F38A 1RALA 4XO7A 1YE4A 1UR3M 1IHIA 1OG6A 3O3RA 1S1PA 4DBUA 2BGSA 1MI3A 2QXWA 4JIRA 4JQAA 1XF0A 2J8TA 2HEJA 4PUUA 4YU1A 2FZBA 5LIXX 1AFSA 3ONBA 3M4HA 3UZWA 4PR4A 4JQ3A 2CLPA 4GIEA 5C7HA 4WDTA 1HQTA 1XGDA 4GCAA 3C3UA 3H7UA 3WCZA 4IJCA 2PDIA 4ICCX 5AZ1A 4HMNA 3LEPA 4JTQA 3EB4A 2ACRA 3RX3A 4GACA 3MC5A 3R8HA 1AH0A 2VDGA 2R9RA 4FA3A 5AZ0A 2DUXA 1RY0A 4DBWA 1SM9A 3UZZA 1PZ1A 2HVOA 2INZA 2HVNA 4L1WA 3LQLA 4XZNX 3EB3A 4H7CA 2PFHA 1Z9AA 3M64A 1VP5A 1MRQA 4G5DA 3FJNA 5HNUA 4PUWA 3S3GA 3BUVA 3T42A 3N6QA 1S2AA 4XZLX 2IKGA 3ERPA 4HBKA 4QBXA 5LIUX 2IS7A 3VXGA 4XVDA 3CAQA 3UGRA 4EXBA 4DBSA 3V0UA 3UG8A 1EL3A 3LZ5A 3UWEA 3CV6A 4GQGA 1YNQA 4XZIA 2PDNA 3CAVA 3GHUA 3M0IA 2HV5A 5LIYX 4PRRA 3DN5A 3ONCA 2WZTA 2HE5A 4GABA 3RX2A 3UZYA 1X98A 1X97A 4FALA 2NVDA 2PDPA 3LNMA 3G1RA 2AGTA 3P2VA 2PDXA 3BV7A 2PDGA 4EXAA 4IJRA 1J96A 1S2CA 2INEA 3DOPA 1XJBA 2F2KA
chains in the Genus database with same CATH superfamily
3H8AA 3EXTA 3H22A 4CVUA 2DSKA 2BY3A 2GPTA 3NPUA 5D2WA 3S47A 3SJ3A 4NNCA 3EMCA 3EWBX 1KM3A 2Z27A 1W1PA 4M5PA 4OV4A 4F2BA 5LHEA 2EJ1A 4M81A 3V7PA 4Z0JA 1FCQA 1W1B1 3LQGA 3V36A 3KTCA 3UZ5A 3I7QA 2VELA 4IIFA 1EJUC 1WX0A 2I9EA 4AYGA 1X6UA 3BZGA 4REQB 3DG6A 3BOFA 2G96A 2Y7EA 4AZHA 1JCJA 3I68A 2W79A 5HULA 4WOZA 3VFCA 4KKXA 4UFJA 1CLKA 3V1HA 1QASA 3FJ6A 3U7VA 5C6MA 5HR6A 2QUTA 3C86A 2C18A 3I4EA 3SN1A 3G3MA 4M24A 1O60A 4AYSA 4O19A 1U1UA 1VLWA 2IUZA 4P7RA 1XGEA 3WDIA 1E6PA 3ITLA 4H2HA 3RCYA 4O4WA 3LPPA 4GUGA 2CZVA 4IL2A 3S2LA 1KRBC 5FF4A 3LG3A 3BGJA 4GG9A 3UPWA 4FOKA 4FMVA 3TXVA 4C1NB 5ECUA 1K9DA 2J6VA 3F4WA 2FH8A 1FH7A 2D0GA 6A3HA 4DBDA 2PDJA 5FF3A 1ME9A 3IIVA 2ISFA 3H23A 4JKLA 5BRPA 1M7OA 4QNEA 1Y5WA 4R5EA 5TIMA 1DQXA 5D8WA 2ZE3A 4FI4A 1GONA 2E6AA 1LM1A 2QGYA 2VYOA 3MKKA 1DQWA 1MWOA 5E9AA 3DHFA 1T96A 4UFKA 3LN3A 3OYXA 1WKYA 3N6HA 3A5FA 3WQVA 3WH9A 2Y8VA 1VJIA 3BG9A 5E0CA 3R58A 3MJMA 1JVNA 1OT1A 1UD3A 4MNKA 4WK9A 3URQA 3MHGA 1NWRA 2B7PA 2F84A 4H9YA 3EOEA 3NG3A 3O6CA 1Z8AA 3UZXA 3O9NA 4RPQA 3DFQA 5DMMA 1TR1A 1JDAA 1LJYA 1WDRA 3FCPA 1E1CB 1MZRA 2XFFA 3EXRA 5TF0A 4Q7BA 4AZ7A 3IGUA 1JCTA 1K7XA 4D6EA 1C3FA 4HU0A 3GDMA 3SCNA 4PUEA 2D20A 4WHBA 1U33A 1PX8A 5D30A 5D38A 1KFLA 1Z69A 3G1HA 1ZJHA 1BRLA 2CZDA 4MWAB 2B31A 4PTMA 3U5YA 1A49A 5CZKA 3LERA 3F5KA 5CAKA 5AVHA 1KRMA 2A4AA 2Z2AA 4JQ4A 2A3HA 2V9DA 1OVDA 4UQBA 1W3LA 4RE0A 3QRHA 3LA4A 3F4VA 5REQB 2BWGA 4H1ZA 3W38A 3T40A 2QJIA 1VPYA 3H4XA 2HDJA 5I24A 1Q2SA 1WNOA 1XSIA 1UZ1A 3OZOA 3BH4A 1JPMA 1WV2A 1I2OA 3KL0A 1VBJA 3C8FA 2QMJA 1J12A 1YE4A 1UR3M 3Q94A 4O4VA 2EKGA 4UB9A 2E6YA 3V5FA 4S3GA 2E4TA 3U57A 1ZALA 2VURA 3MUCA 2VL4A 4BF5A 5T9BG 4Z42C 4PR4A 2FQIA 1J2BA 1WXZA 4LVGA 5AC5A 6CGTA 4L4OA 5BW6A 5FJUA 3CC1A 1KKOA 2XGZA 3PUGA 4HCDA 4OWGA 4W8BA 3WUGA 3TOPA 2A3CA 5DXYA 4Z08A 1AW2A 1C8XA 1NM9A 2E7FA 3ZO9A 2V82A 1SFTA 1OK6A 4PZVA 1F6KA 1SJCA 3MC5A 1D9EA 2BZNA 3L4VA 4QLLA 1XIFA 3KXQA 3CEPA 3SUWA 2YB1A 1NQKA 3S5NA 2YSWA 2D0HA 2B0MA 4I6KA 1GKPA 1W91A 4X9YA 4ZQCA 3GC5A 5BXTA 2OOFA 2AL2A 4GMEA 5H8UA 2GVYA 5HNNA 4HGXA 1JQXA 3E96A 3A22A 2V69A 3DESA 1JUKA 4Q8WA 4B2DD 1DJXA 1JPKA 1G4TA 3CT7A 1B3WA 1POJA 1E1EA 2DIJA 4JTUA 3HMJG 3FKRA 3VM7A 1EQPA 3QQWA 2GQ3A 3SCVA 1IYXA 4EP8C 3VMPA 5E9XA 1A4MA 3QEZA 4C6DA 4C5YA 2ZZ3A 3LOTA 2PLKA 4A8LA 4K37A 5D9PA 3THQA 2AKZA 3UGRA 3EA2A 1B54A 2X09A 1WQ5A 3PPCA 4JL1A 4NZ5A 1XYFA 2WSQA 4O1CA 2ZQ0A 1ZAJA 4KFOA 3W86A 3CV6A 4DNMA 2POZA 4N2YA 3EX4A 3GKFA 2FVMA 5EMJA 5A2AA 4O8RA 5DELA 4HKPA 1CWYA 4JGDA 1DYSA 3P93A 3W7NA 4O8AA 4E3VA 1XPGA 1SVDA 4AX6A 1KTCA 5B80A 2PTYA 4MLRA 1LTDA 4Q8MA 2V5BA 4H8UA 1W2VA 4YWSA 5DFAA 5CZ0A 2CLLA 1EWDA 4HNTA 4W89A 1KGXA 2CKRA 5CSYA 5I02A 1JDDA 1KM0A 1OX6A 4IJRA 1R7AA 3S2CA 3NZRA 4HHMA 2A85A 3VNDA 3H55A 3QGAC 2PDYA 4C7GA 1D7KA 1V5XA 2JKEA 4QE1A 5HAOA 3VDHA 4HHPA 4Y7EA 2X7VA 1S2UA 3B0YA 1NARA 2R6OA 1LLWA 4HJFA 1GQKA 1YE6A 4LBUA 5FESA 3A4XA 1EO5A 5MHBA 2Y63A 3WD1A 2YW3A 3QFEA 4UNKA 4A29A 1O1ZA 1O5QA 5I7GA 1ISYA 4R34A 4EK7A 4KCWA 2GQAA 1HO1A 3RF9A 4QE5A 1M5WA 1DWFM 4B91A 1SJBA 4E4PA 4QAIA 4IP7A 3E0WA 4XK2A 1UD4A 3K2GA 1F6PA 4DB7A 2VKZG 4J2PA 4XBJA 3K4DA 1XLDA 1LBLA 2PDWA 1EUAA 5DN1A 2FGLA 3OLEA 1VBUA 4CNTA 3ZZ1A 3G77A 1ZLPA 4E8GA 2WZEA 1RK6A 1HL8A 3BVJA 1TPUA 3ENLA 4BZYA 2VRQA 1W1TA 2Q02A 1HNYA 1UB3A 4DYEA 1CENA 4JOMA 5JIPA 4ROPA 4XKYB 4DF0A 4PTWA 2Z1BA 2ADAA 2Z28A 3ABSA 2CERA 1G7UA 4UXDA 3ZXWA 3ZVHB 4V28A 1XLEA 3LSCA 2OZ3A 2V63A 3BW2A 1TMHA 4B5UA 4DI8A 5FJJA 3KOWA 1H7PA 4K3ZA 3HG2A 4PULA 3CUGA 1QNPA 4Q8UA 1K9EA 1GK8A 4O14A 4MZ1A 3CT2A 2CYGA 1Z7AA 4JBRA 2FDSA 2VEFA 2YCLA 1IEIA 7REQB 1S38A 2WM1A 4X22A 5GNXA 2XU2A 1ODUA 3NUKA 4JTHA 3NTYA 1E9LA 4JHZA 1UKTA 1Z32X 1JD9A 5H91A 3OIHA 5G4WA 2BV9A 3WLJA 4DIAA 2G3FA 3OP2A 3B9EA 1NFBA 4LW7A 4W7UA 3F4DA 4O17A 3NEHA 1Q85A 3L5MA 4LUYA 3L4YA 2EJAA 5JH1A 1IWPA 3VU2A 1V02E 2FKPA 3H2OA 3UQNA 2KX9A 4ASTA 3VKAA 1LWIA 1OZMA 2VEKA 1QRQA 3GX9A 4Z2GA 3PUOA 3LDVA 2WNQA 1RZMA 3GE7A 4LCSA 4YTTA 1MEWA 2PZ0A 3HQPA 2CCRA 1GW1A 1EP2A 5HK4A 1GZ1A 2G97A 3S9ZA 1VFUA 5JU6A 1Q6DA 3T55A 5DO8A 2EPLX 3KOXA 4YHEA 1I2QA 2DP3A 4QHRA 1GTHA 2PDBA 1R2TA 4CQBA 4JNYA 3PZTA 3INPA 3CHEA 3TSBA 3L21A 1OD8A 1IV8A 1Q8JA 4GYPA 1I1XA 2ZC8A 1E6XM 2PDMA 1HTIA 3WNLA 1HGWA 4NL1A 1REQA 3W2JA 4L4LA 2L5HA 4ZB0A 3KBJA 3R0DA 1KR0A 3VGGA 2GGIA 1G1YA 4P7OA 1QBBA 4ML4A 4MJMA 1TCMA 4K1WA 3C0QA 1VPXA 3DI0A 1MYRA 4ZQOA 3S42A 3N12A 2ZUTA 1FDZA 3GM8A 4RX0A 2Z2UA 4BJHA 3M0XA 4EKJA 1Z89A 4GOAA 4U5IA 2G3JA 3A3HA 1H41A 2Y4SA 5FJPA 4KEMA 4I8YA 1OFPA 4KS0A 4HJWA 1OG6A 1DJYA 5CG7A 3ES7A 1V8EA 4UR8A 4JQAA 5T9CE 3D47A 3NWRA 3SGGA 2A3AA 3STEA 4M7TA 5D32A 5LIXX 5D02A 1WUEA 1AFSA 2QAPA 3LV6A 3QR1A 4LAKA 1FXPA 3JRKA 3USZA 4WY0F 4REQA 5JBDA 4LF2A 3GLCA 1WDSA 3LTPA 3VDCA 3NZ1A 1BSIA 5HDRA 4ICCX 4M19A 4MSSA 4CQCA 3W7DA 1XYLA 4GNVA 3NNTA 3CTTA 1W6TA 3WEOA 4S3EA 1OIMA 3TJLA 3RK8A 3M43A 8TIMA 3QYSA 4UQ9A 2HXUA 4GACA 2Y8KA 4HPXA 1W2PA 2QUUA 1GORA 2J8FA 5HJLA 1UJQA 1BXNA 3FOKA 3M5ZA 1MO0A 3A3WA 3SR7A 3SCQA 3LU2A 1QOQA 2IW0A 3MI3A 3MJYA 4MNMA 3GVQA 1AJ2A 4WZHA 3TX9A 3W1UA 1A0CA 1FFQA 4ZXOA 1BGGA 2ZA1A 2ZVIA 2WNWA 1TX0A 1KBIA 5EB8A 2VFEA 4W85A 3VX1A 1HIZA 1WXJA 4K8GA 2PSNA 3WO8A 2QV5A 3VCNA 1NF7A 2VGFA 4URIA 5CPOA 4UIOA 1WE5A 2VZTA 2P88A 1F3TA 4KT2A 9XIMA 2VVNA 1RUSA 4MMWA 4WY0B 3TZNA 3VXGA 3W81A 1PCWA 3D5HA 1IXNA 3VCRA 5T8GA 4FS9A 3LI0A 1OFQA 5LHFA 1JYNA 3IJQA 1W31A 5EFFA 2YA2A 4QDPA 4DUVA 4DJDA 4CQDA 1XYMA 1NEYA 1YEYA 4OZOA 1H7OA 1B0IA 1BSLA 2MANA 3JR2A 1WDPA 1QMLA 5BMXA 3CQIA 1FUYA 2ZKMX 2WZTA 3WBAA 2XN1A 1CGTA 2E25A 1QO2A 3TFXA 4Y9AA 4JTKA 5BROA 1G67A 2D3LA 5I3HA 4JFWA 4UTUA 1MXSA 3T1GA 5AHMA 1EOKA 1J0HA 1JZ7A 3PFRA 3VDGA 1XBXA 3P2VA 1UR2A 3RLGA 1QBAA 4TOQA 5J8LA 3GXMA 4FNSA 2RDXA 3P67A 1UWRA 1RVGA 2W4XA 3KP0A 1I4NA 1SUXA 4X61A 1B57A 1V77A 6ALDA 2PTXA 3FGCA 2WM0A 1PTDA 5CZJA 1OQFA 3V18A 5CPLA 1KC7A 3W7GA 1JCMP 1CI1A 5IFPA 4FP1A 1WBHA 1E0TA 4KGJA 3BCJA 1BWKA 3C2OA 1SQ7A 4IZGA 1OYAA 3K1GA 3PPFA 1BQCA 1GCYA 2OLHA 4JIPA 4LAZA 2XN2A 3E2QA 5LSMA 1K8CA 3MSYA 4ERAA 1UH2A 1KTNA 5TQLA 3ITCA 4N6EA 3G0UA 1H11A 1VFLA 2XTKA 2A3LA 1V6VA 1W8SA 3TVAA 4R7OA 4GPNA 3COTA 2VR4A 3UF9A 1C93A 4BEUA 4DWDA 4M7SA 1N55A 3HJEA 4LNCA 4H7ZA 1F3XA 1XR2A 5AYIA 4L56A 4Q4PA 3RJXA 4FLQA 1ZBVA 3FNDA 4LFYA 4IG2B 4L64A 1DHKA 1E3XA 3VUSA 1L6YA 3L5LA 2WLYA 2WMIB 4PBFA 2ZIDA 1QWKA 1PTGA 1S5TA 2RUSA 2OZTA 3TC7A 1UD8A 4WEVX 3DFTA 4U4MA 3VD5A 3HOJA 4NX0A 4MHBA 4XZ9A 2X1RA 5A5WA 4W8AA 4J28A 4F79A 3FDGA 4JEQA 3KCLA 4J7RA 3NGJA 2D2JA 1MW3A 3TW6A 1RP9A 4S1FA 2R8WA 3RRXA 3PSWA 4D6FA 3H24A 2BFGA 1UKOA 2XVPA 4PCPA 3TTOA 4LAMA 1Y65A 2O9RA 2OYMA 1Q5MA 4QE4A 1FWEC 3BANA 3UEQA 3S4TA 1UG6A 2CITA 1S5WA 2HWGA 2DVXA 3C61A 3W26A 4QCEA 3LB0A 1LRNA 1R2SA 3E5BA 3S2NA 3VNLA 4H00A 1FH8A 4ZOBA 1XS2A 2EF9A 4JHMA 3LLDA 3AS1A 3VZZA 2FPTA 3DENA 3GW3A 3T2OA 1ZJBA 2ZX6A 3GFXA 4TQTA 2NUWA 2REQB 2A21A 1OHLA 5LIKX 4MWAC 4GYJA 4QSFA 3EA3A 3PFMA 4ZFMA 1F9CA 3S1WA 3VGDA 3WZ0E 4H6KA 1P5BA 1KRAC 1CEOA 1TKKA 1C8VA 1IGSA 2VO5A 3TYBA 1C29A 4HZ8A 2ALRA 3WYZA 3R11A 1H7RA 3R0UA 1FFRA 1EX5A 1MW1A 4L7ZA 2GLKA 4GIAA 3M46A 4O1AA 1XIBA 1M01A 1X8CA 5IDZA 2WNZA 4OBRA 1Q65A 3WD4A 1SW0A 4NY2A 1EDTA 3DDMA 1JYVA 5EMYA 2CW6A 3PAOA 4Q8VA 3CQJA 4WUIA 4F40A 1V0KA 4GZEA 1ICPA 4XTIA 2ZTJA 2D2HA 4DJFC 3WY1A 5HMEA 3S5OA 2V5JA 1PVNA 4O0ZA 3TW7A 3U4AA 1XYZA 2EHHA 5E93A 2CESA 3L2MA 4PMXA 4NRRA 4FB7A 1IR1A 3WF0A 3VABA 1HP5A 2ZRZA 3DYMA 1WUFA 3BDKA 4G9PA 4HZ7A 1GHSA 4H8HA 3C3NA 1E0WA 1LL6A 3ARRA 4LAOA 4PEKA 2XGIA 2XWDA 4PYSA 4P8XA 4DJFA 4J4KA 4NZ1A 3DIPA 5I3JA 3ZQ9A 2AAMA 4QS6A 3CLMA 2VEGA 1LRQA 2WJDA 4L9YA 1VKFA 3MMTA 2VX5A 3SRFA 4XQ6A 1LLZA 3DX5A 4FNPA 5DY2A 1PPIA 1E9ZB 3GXPA 4C6PA 4GISA 3E0FA 2C3ZA 5C0QA 1B3YA 4IFRA 4I7UA 4ZSUA 3BICA 3SY8A 4HMNA 2FJKA 4NAEA 2ZX7A 4UTWC 5FIPA 4I9JA 2J66A 5C70A 1KM4A 1Y7VA 4F0RA 3W53A 1BTMA 1P0KA 4LXFA 5C9XA 3FN9A 2DUXA 4TO8A 3N2CA 2GDUA 1BGAA 2W92A 1ZNNA 1BQGA 1E5JA 1QPQA 2O9TA 3DG3A 2BLEA 3ZLFA 1LF1A 4KRZA 2PFHA 3DC0A 3WELA 4PFHA 4KH2A 3KTSA 1FCVA 1O12A 1VP5A 1MRQA 3USBA 3N34A 8XIAA 1OGSA 3RG6A 3M16A 3W01A 3UWVA 3N3MA 2P76A 4JTEA 5KINA 3CHFA 1VS1A 4N9DA 3PNUA 4IGMA 3DC8A 1F61A 1PL9A 5M03A 2FHCA 1UWTA 1BFNA 2OLAA 3UT0A 2Z1XA 4US5D 4XVDA 4O10A 2ZZ4A 2J25A 3W25A 5EA9A 3H4WA 3I65A 3EMQA 4RK8A 3HO8A 1YNQA 2GFTA 2NQ5A 3W7JA 1PKYA 3WH8A 2QCDA 3BWWA 4PRRA 3T2PA 2C0AA 2Y7FA 4GABA 3W23A 4RR4A 1BVWA 1W5QA 2ZZ7A 4O53A 4GH1A 4ZVJA 3N1AA 4JCLA 5GNYA 4A6GA 3PAJA 2PDPA 1JCXA 1GHRA 4HMDA 3GVVA 4WD0A 1KFKA 1GOXA 4KGLA 4PSPA 3BV7A 1CIUA 3KL5A 3P81A 4QAWA 4KCTA 4LUSA 4P7NA 4HVXA 2OPJA 3OYZA 1M9HA 3MSRA 4I6VA 1Q6OA 4QG9A 1ISWA 3L66A 5CPQA 3HPAA 3RLHA 1NVMA 4AZIA 4RKAA 4F9JA 1K9TA 1BVNP 4ZTXA 1WAUA 3KEHA 3WQ8A 3UG4A 4D6HA 3B8TA 1GJUA 3IIXA 1E15A 3FAWA 2D73A 2PGFA 2PD9A 1RCXB 1RPKA 1JNDA 4Q8OA 3LCLA 3M0HA 2ZXDA 2ICSA 5F7UA 2B7OA 3KBVA 3GNOA 3KHJA 1FWCC 3AYTA 3JVAA 2WMHA 4US5A 3S2JA 2NXIA 3CU2A 8XIMA 3PB0A 4CEXC 1W9XA 2ASHA 4GQBA 2ZZ1A 3GSMA 4HSHA 3DI1A 1MSSA 2BGQA 1E4IA 1V7AA 4LQ1A 1EA0A 3TMLA 1F07A 1AD4A 3MUIA 1OSEA 3W88A 2NWRA 3UJRA 3PTDA 2OZ8A 4GVHA 1YXDA 3TKFA 1XRTA 1U1HA 3WLKX 3OGVA 4GJIA 1IEXA 4B4HA 3GVRA 4GI8A 4IJBA 1FWJC 5KEZA 4DWSD 4R33A 4CCDA 4YVPA 1RXOB 4B5VA 4XAPA 4C6QA 4RV3A 4A8RA 4B5XA 3TYAA 3SQMA 3NQFA 5EBUA 1P7TA 3A12A 1EH9A 1W1IE 3POCA 3VFLA 1DKWA 3A47A 3BW4A 2NX9A 3KOYA 3GG0A 4S2CA 1XL9A 2W9MA 4HOXA 3W9ZA 3PSVA 4PRTA 3GDRA 5HJYA 1TVNA 3TOYA 5I2UA 1SMAA 3N2OA 1MQRA 4WJXA 2G0WA 2YGYA 3VAVA 4C65A 1RPXA 3W73A 5JIWA 1BXBA 3BQ6A 4BR1A 5XIAA 4YTRA 2CETA 3M5XA 3UJFA 1EX1A 2R1PA 1AZ1A 1NOWA 3AUJA 1JULA 3WD0A 4W7WA 5XIMA 3LYEA 3SURA 3CUFA 1UD5A 1EF2A 2ZUVA 3E38A 1NP0A 3CAWA 2PE4A 2OLSA 3M0VA 2OELA 1AW1A 4PRWA 4HPNA 3A9BA 3RLUA 3OG3A 3VNKA 1OK4A 2E28A 1QI3A 4QX4A 3MO4A 3AC0A 1XIJA 5JBFA 3RO6A 5BRQA 4DAIA 2WZMA 5EMMA 1G7VA 1R30A 4Q4SA 1WAWA 1FY6A 3MMWA 1EC9A 5CH9A 1EA9C 4KFPA 2ON3A 3G5EA 2DZXA 2ZRYA 1A53A 2HBVA 4KESA 3RLVA 2ZXQA 2ZUWA 4AIEA 4F2TA 1KNWA 2VJXA 3QC3A 4DWSA 4HSNA 3R7MA 4UBPC 3OPSA 3QSRA 4DWSB 2ZRUA 4MB3A 4GINA 4HPGA 2IPFA 2D24A 4P2VA 5KZ6A 3CK5A 4XZMX 1S2TA 3N15A 3B8SA 1XIMA 2UZ9A 2VR2A 4A8IA 2JEQA 2GGHA 1H62A 1MW2A 1LQAA 2XH0A 4KWWA 2PI6A 1G5AA 3FX4A 2VGGA 5I79A 1JI2A 4AD2A 4Q6JA 4NSBA 4Z1DA 3FHAA 1XLCA 3GXIA 3W1MA 1EZ2A 4LRSA 3Q4DA 4E5TA 1J4EA 1IEVA 1OABA 1BYDA 1J6PA 1MI3A 4JIRA 1R3TA 4ZOAA 2TPSA 2R1LA 4JQ3A 3HGOA 1R6WA 2C71A 1B1YA 4C90A 3ARVA 3I7SA 1KM1A 3GVGA 3TN3A 1ZS2A 3M0LA 2P50A 5A2BA 1QXLA 4R3UA 1MZHA 4GGBA 1A5AA 3LEPA 3G2GA 3LMZA 1SZRA 1P1MA 4D1JA 1WZMA 1ADDA 3R8HA 1AD1A 2VC9A 2ZC1A 1P7TB 4AY7A 1AQ0A 1J2WA 1PZ1A 2FFIA 4CD5A 4G7FA 4GKLA 4UFLA 3VGHA 3PZVA 3KVLA 3AMKA 1MNZA 4DZAA 3H7VA 4YYFA 1AMKA 3LBMA 4G5DA 1XH1A 3FJNA 1O7AA 5A6LA 5MKGA 4DHGA 4O16A 4KWUA 3ZLHA 2V2CA 3FEMA 1FBAA 3T0AA 1NOFA 4J5NA 3PTQA 1W9BM 1JG9A 5DRCA 3P0WA 1QNRA 4PTNA 3N19B 3UWWA 1HKMA 3TN4A 4UQDA 2DJLA 3CO8A 4G7EB 3W72A 1F05A 2BVDA 3K8LA 3CUXA 2ZXAA 4DBSA 3HU7A 2GJLA 2QAFA 5C9ZA 3UERA 4GY1A 2OCZA 3CIVA 1SZFA 4HCHA 5XINA 1ELSA 1OFDA 1Q7MA 1QFEA 1XDMA 3WQ5A 3R0KA 3NDYA 1XIEA 3P6LA 5A8MA 1SFSA 3KDNA 4B3LA 2WC3A 1KFEA 1E56A 4AEEA 4CU8A 3LS9A 2Z0IA 2QKFA 2WCAA 3PZMA 5D37A 3M7WA 3FKKA 1JDCA 4V27A 2OYKA 4QG6A 2YYUA 4LRTA 2AGTA 1S5VA 4QS5A 1AJZA 4Y8EA 4XD3A 3MO7A 2PTZA 2PODA 2CU0A 2QMKA 1H5YA 5LZLA 2JQXA 3QC0A 3S8HA 2YYTA 4AISA 4MDOA 4DUXA 4AC7C 3P82A 1UC4A 4A2RA 2FYMA 1YYAA 2CWNA 1XQKA 1KCZA 4QR6A 3FXYA 3W1LA 1XLJA 1WB0A 4XVEA 1YPFA 3I6EA 1EPVA 4IMFA 4NAFA 3HTWA 3K8KA 1OYBA 1XLLA 1TPDA 3IV3A 3KX6A 4LU0A 1JRBA 3HURA 2C1IA 3WJWA 1GPWA 2AMGA 1ZP3A 3S6OA 5JXQA 4F3HA 1JAEA 3SCWA 3WDJA 3LX9A 3WL1A 3GYEA 4LV4A 2WC4A 4OBTA 4YS1A 5HMSA 3TFCA 2PDQA 3OVQA 3GHSA 1GQIA 2X1IA 2NQHA 3F7JA 3IJLA 3TTQA 3H2NA 4AD3A 2YXXA 3HF3A 4LSBA 3IVUA 4AF0A 1PZ0A 3ZOAA 4A35A 3EKGA 3AHZA 3VGFA 5A8NA 2OX1A 1E72M 3L68A 2Q01A 3F2DA 1ONRA 4TUFA 5A8QA 4LYKA 4O1EA 1KFJA 2NQLA 4GVFA 2ESCA 1G6CA 5CC3A 1ITQA 2D2GA 1XP3A 1PWLA 3LTSA 3EPMA 1EZWA 1E0VA 3KL3A 3TQPA 1O1HA 3R12A 4PGLA 3QR0A 5C2GA 1PO9A 1K7FA 2VGBA 1MFUA 1R8LA 5HBFA 3XINA 4ZEPA 1HJXA 2ZUUA 5FJTA 5A95A 3UY8A 2V2HA 1FWDC 3ARXA 2VC7A 4WDWA 4MIMA 1U5HA 1AG1O 4Y6GA 1FWAC 1VCFA 5CZSA 3CZLA 3REQA 4UTWA 7ENLA 3WJSA 1Z3NA 3MP3A 4GJJA 2Z1KA 2XPKA 1M7XA 4A3HA 3UXLA 2PWHA 7CGTA 1OT2A 1W9PA 4QQUA 5J5RA 2NZLA 3C8NA 3IIOA 1OFRA 1BPLB 1UHVA 1ICSA 3GXTA 3GU9A 3LTYA 4NT0A 4KIEA 2PWVA 3S1GA 3B8WA 4S3CA 3LXAA 2PA6A 1IZJA 3CS2A 5I0DA 4RLIA 1VEOA 2BHZA 4NF7A 2J8GA 2BVWA 2BY2A 4AHQA 4K38A 5A6KA 2X40A 4QEEA 1HZYA 3HV9A 1E9IA 4WY0A 3U2ZA 4ZB2A 2CLOA 2BG5A 4BF9A 2OQLA 4X60A 3FW6A 1YDNA 2IPWA 2CZEA 3MW7A 3VK5A 2FZDA 4RE3A 1BF6A 3TU9A 4QNWA 1XYAA 3N9SA 4NJJA 4PSRA 2C91A 1KV8A 3WMSA 3ZMRA 2NV1A 4PUDA 4LPCA 5A69A 1H1YA 1R38A 4BCEA 2DH3A 2YX0A 1EOMA 3BE7A 3GD6A 4NZFA 9XIAA 4O57A 1SFJA 4L9XA 4G6CA 1VJZA 3ABRA 4E4UA 5K2ZA 4JNZA 2A1YA 2YZ5A 1JZ8A 3E3HA 3F2CA 2ZXBA 1PIIA 5I78A 3ITOA 3FA5A 4ALDA 2CLPA 4H83A 1DBTA 5HUPA 3T0BA 5HQMA 1IT7A 2XH7A 1RCOB 1XLAA 3CLWA 4JN7A 1K03A 2PDIA 1OFAA 4Y2WA 1KFBA 1DV7A 2IQTA 3K5XA 2D1ZA 1IIGA 2FLIA 3A3XA 1QW8A 1NFPA 3ZT7A 4TX6A 3P62A 1G9HA 3KOZA 1AH0A 1QR7A 4AQLA 2G5WA 2GJXA 4AD0A 4MPQA 1UROA 3PWAA 4JKMA 3V3WA 5ABEA 3E6EA 2HMCA 3SM0A 2PC8A 2VOMA 4RV8A 2BB0A 3N6JA 5G2WA 4AIBA 1YBQA 1UKPA 1XBVA 3TR2A 4A4AA 1GOQA 1J8VA 4Z1CA 3F2BA 5AYXA 1XYBA 4HB7A 1X38A 5DY3A 2YCIX 4LWWA 5AOUA 1D8WA 2GWGA 3DYOA 3GH7A 2XZ9A 1TE1A 2CBIA 3NSXA 1KBJA 2VOTA 2D0FA 3VGBA 5BOFA 2ZVRA 5ABHA 1QCWA 2QCFA 2VDHA 3W3OA 1QU4A 4GFIA 4RZBA 3FS2A 4HN8A 5FAJA 4CU7A 3UPBA 1FCUA 2XIIA 4C6NA 1VGAA 4MB4A 2GOUA 3W76A 3G6MA 1OZQA 1DTUA 1NH6A 4MG4A 2P10A 4ZENA 3LXBA 3UYCA 1XIIA 4D72A 4CEUC 3M0IA 4G1NA 3WKZA 2J9YA 4WGXA 3UGVA 1XFCA 1A50A 3KS6A 4GYKA 1TMLA 7TIMA 1BXCA 1AA1B 3O6AA 3MYOA 3PWGA 4ZE5A 2H9AB 3LNMA 2Q8LA 1EJSC 2QQ6A 3E74A 4H6QA 3NIYA 3GIPA 3KBWA 4NILA 1ISZA 3DHDA 1N8FA 3W1QA 4AAJA 4O54A 3QTGA 3CUHA 3THUA 5EGRA 2XIJA 3CZGA 4GC3A 3EKLA 4M6QA 1G01A 2BY1A 1L2UA 3SUVA 1B90A 1J0ZA 3LHYA 4FR6A 3I6RA 5K7JA 1CLXA 2BP1A 4JQ1A 1SYTA 3WLHA 3V35A 1KV5A 2P8BA 2GUYA 1GG1A 4PCFA 1RD6A 2EPMX 3O07A 2GVEA 4LB3A 1VIZA 4O0KA 1QNVA 2H3BA 3HPSA 4TU1A 5D04C 3VNJA 2CZ5A 4NP7A 2PRHA 5D4YA 1VBHA 2GDQA 4QIUA 4WOQA 4OJYA 1J01A 2VRKA 4IMCA 3RR1A 1YDYA 2NSXA 3BG5A 3RPMA 4HMEA 3SEPA 3WQFA 3HMCA 1UD6A 4H8NA 5C2CA 3O6YX 1ONWA 4XV0A 4R7JA 1ZRQA 2XDFA 1I8JA 5G4EA 2VEIA 1M68A 2RH9A 3O1NA 3NQCA 4UCFA 4YTSA 1LDCA 1F74A 5HPCA 4US6A 4WDXA 4WIWA 2EPKX 4IT1A 1UWQA 1TV3A 2GVGA 2YLAA 2RGMA 1IWBA 3VGEA 4JX4A 1K8XA 2PAJA 3C56A 3WEMA 2Z2BA 2YL8A 3L5AA 3M0MA 2CKSA 2ACQA 2XVKA 3B8VA 2WB5A 2A3EA 4FIRA 3H2FA 4DNHA 4C6LA 1FDYA 2YDSA 3BAWA 4IIBA 4Z1AA 1JF5A 3HQ1A 1CB7B 1C9DA 2QVNA 2VCCA 5CGQA 2WCGA 4K68A 4F0SA 3W1RA 3QR3A 1H63A 1BTCA 3B8UA 3B3DA 2YCKX 3PHAA 1K02A 2NUYA 4TVCA 3WUBA 3AMLA 4YJ5A 2UV8G 1SZNA 4CQ9A 1HUVA 4AHOA 1GTEA 1Q6CA 4GK8A 2BX7A 3LBOA 4ZOEA 3B03A 4RUBA 2HBXA 2CBJA 1AMYA 3WNKA 4EOUA 1W3KA 2EPOA 2ZADA 4JIIX 1YPXA 4PODA 5HQLA 3NYZA 4M29A 1B30A 3WLSA 2WXDM 3PR2A 2A5HA 3BK0A 2NUXA 1DTNA 1PIFA 2WHJA 5F2IA 2GZXA 4M80A 4IMEA 3WLOA 3TCSA 1X6NA 1XV8A 3M44A 3VIKA 3BO9A 1DIDA 3DFOA 4AVFA 5HWNA 4PMNA 4W5UA 4ZB5A 1E0UA 5EMKA 2QUMA 2FHFA 3GTXA 2WOQA 4QITA 5H8PA 3DFHA 3GIQA 1I60A 3DFYA 1ZHAA 3E0LA 3UJSA 2VFFA 2YCJA 3CQKA 5IDIA 2P3ZA 3UETA 2GK1A 1T41A 4LBRA 3Q65A 1PWMA 3QY6A 4R27A 4AVOA 3SCOA 1PE1A 1UPMB 3WD2A 5A8PA 4S39A 1OX4B 5FEZA 1WZKA 3MSGA 3ZR6A 1E4LA 3CASA 3GR7A 1H0IA 1DWJM 3B05A 2RJGA 4LANA 1VCVA 1V0NA 3BARA 2P0IA 4GJ1A 1R85A 1XF0A 1KGWA 1PZ2A 5BU9A 3PK7A 1VC4A 2BMBA 4FNQA 1D3GA 2QCCA 3WMLA 1SO6A 1XLBA 3OGSA 1V6YA 3HFYA 3ONBA 3UZWA 3H6OA 1Q66A 2HZGA 2ZX5A 4M0XA 3VM5A 5DT5A 1F2JA 2WBGA 4KRTA 5IXEA 4H04A 2WVVB 4IQDA 3GU2A 5HQEA 4BKNA 3CHDA 3MVTA 4AMCA 5CG0A 2W27A 2WMJA 1GOOA 4OUIA 4B5NA 2QJNA 4X63A 2IMRA 4JNMA 4DPPA 3DAQA 5IFTA 1BKHA 4IISA 3EZ4A 8RUCA 1GKRA 5LA1A 2O0TA 3FA3A 1GZGA 3GTNA 3E2RA 4YPJA 3EPOA 2B7QA 1W3TA 5AECA 1JDFA 3PBGA 3R5EA 4AXNA 5KSWA 1DWGM 3LQLA 4O50A 3OHIA 3C2FA 1PIGA 4ZTYA 2NQZA 3S0CA 1R87A 3AS2A 1Y8BA 3E49A 3GH5A 3ABXA 2DZPA 3GTHA 3N6QA 1K3UA 1S2AA 4B9ZA 3C0JA 1CZ1A 1UOZA 2IKGA 1WKDA 3A4JA 2QIIA 3BAIA 4AB4A 2E9LA 4GLEA 3TZFA 3WUEA 3IJIA 1CGUA 3CEUA 3PG8A 2H3DA 3HM7A 4IMGA 4AEFA 3C0LA 1XSKA 4EXBA 1GQLA 5C7VA 1JRCA 4MWAA 1SJAA 4NJKA 3LZ5A 1UYQA 3MWCA 3VC5A 4B16A 1L9WA 3C6CA 4Q6XA 4LYRA 6REQB 4ICMA 3VNIA 2XYLA 1LOQA 4H6RA 1T6MA 3NQ2A 4NJGA 3QPEA 1XGZA 3AIQA 1PKLA 4MJ2A 4OOZA 3DYPA 3G3DA 4L9ZA 4LT9A 3LNPA 2P1FA 4ZMGA 5I6SA 5AHIA 4FOUA 1EEXA 2RKXA 2PDXA 4D8AA 3VOCA 3TNOA 3IV8A 4E3TA 2ZUSA 1XLMA 1H49A 5I00A 3VKCA 4EPDC 4N6FA 2VZSA 3ABOA 1HJSA 4RJEA 1UBPC 3M5VA 3WMCA 2DZTA 2DSVA 4CUCA 1OF6A 2C6QA 4ZBCA 2C8NA 3FY1A 1TWIA 2PDUA 4KFNA 3PJXA 3EWXA 2X8RA 4PMZA 3R2GA 5C9UA 5KTLA 4AMAA 2NT0A 1R86A 2EG7A 2J47A 4DXKA 5ECVA 4UUIA 3HQOA 4K6AA 1YQ2A 1VLIA 2F6UA 2ZICA 4ICNA 2QCEA 2HVMA 3WF1A 2V5LA 1XXXA 3WQPA 3STCA 2Q3OA 4ATLA 3TAKA 4MWAD 1RSCA 4ML9A 1WXYA 4NJIA 4PTXA 4L1XA 3SECA 1GVEA 1HFBA 3ITGA 3FLUA 3VIMA 4H9MA 3M6YA 2BASA 4OU1A 3WLQA 3LCIA 2QCGA 3MV01 4E8CA 4QCFA 4EF9A 3PVFA 3IJ8A 1QNQA 3CV7A 1OX4A 1C8QA 1XLFA 2IKJA 4J3WA 4L6HA 4UFIA 1TPC1 1KRCC 3AXKA 2R94A 4ZODA 3GVWA 4JEJA 1W0MA 3BMWA 2EXOA 3A4WA 4RZ5A 1FWSA 3WLLA 3W6YA 3UXAA 3M0ZA 3K8MA 1HN1A 1FHUA 3MDUA 4G8TA 3GB6A 3KLKA 1UASA 1VQTA 2UY2A 4ACZB 2YLLA 4O28A 2XFWA 3U2CA 4C6IA 5HWJA 1XG3A 3AHVA 3V4BA 4LUSB 3WH6A 4LBSA 2IXVA 4JYDA 1XCWA 3SSJA 5D33A 1T8XA 4HK5A 2A6NA 4IQEA 4KF1A 4CKQA 4DELA 1VR6A 1ZBCA 3O6DA 3CL7A 3DHPA 5CLTA 3DZ1A 4FZIA 4IICA 4CD6A 4FO4A 2RDTA 1PDZA 4C7DA 2JEPA 1CXEA 1K4GA 4BEQA 4X0NA 2LLEA 4GGHA 4HOWA 2P8CA 4TTGA 3EA1A 1CXKA 2QZRA 4MKSA 5KITA 4PB5A 4IIGA 4ZCWA 5AC7A 2QPXA 1KKRA 1KM6A 3IJDA 2QHAA 5M3WA 3GU1A 3ANYA 2X2YA 1Q6EA 4PB4A 3KZPA 3WBXA 1AL8A 3DKLA 2EG6A 4A2SA 1M53A 5GQBA 1AZ2A 3G6LA 1BYBA 1QPOA 2BSLA 4ZQMA 5CGMA 2BVTA 5K9DA 2CPUA 2DEPA 1HL2A 4BF7A 4DO5A 1O95A 1ZL1A 4PCSA 5E0KA 4YCOA 5I3FA 3VKDA 5BCAA 2AOSA 4EXQA 2CNCA 1U2YA 1JEZA 4MTVA 4BHYA 5FJIA 3RGTA 2OWXA 3KS5A 1KFWA 2TYSA 4Q3MA 3SRHA 1G4SA 3A21A 1O66A 4FEZA 1P1XA 2YBTA 2HS8A 3PZQA 3L4UA 6ENLA 4NAEB 1LOSA 3O3RA 5TD4A 4MADA 1FOBA 1TPFA 2JE8A 4Q4QA 4XBSA 1ISVA 2HEJA 4RCXA 3R4IA 3W6LA 3Q2DA 1VPQA 4D6GA 3IK2A 4A8NA 3S9IA 3G1YA 4UTLA 1NTHA 1R5YA 4YWIA 2QNEA 5LKYA 3NQ6A 5C54A 4Y9NA 4J2MA 3ZLGA 4I9TA 4I7VA 2V81A 4JTLA 4K36A 4IM4A 3DERA 4F0HA 4HNVA 4P7QA 3S1UA 2VP8A 3OGRA 2C15A 5D2VA 1P6CA 5J04A 2Z00A 2WVTA 5F4XA 1GVRA 4M51A 4NYYA 3PZOA 5EKYA 1L6FA 5H1WA 3WFAA 1K1DA 3VNYA 2H9AA 1YIXA 3SIMA 3CQHA 3TCEA 3NDOA 4WXZA 1DJHA 1O94A 3T42A 3R10A 1N8IA 5G2HA 3W1PA 3AHTA 2J78A 3IEBA 3QJAA 1OGBA 2CLEA 1A3WA 2XIMA 3BGAA 1H4PA 5LIUX 2H8XA 1KM2A 2VT0A 1SU5A 1Z41A 5F1VA 3CAKA 1CX9A 2GJXB 1VIWA 3V0UA 3ABZA 1BYCA 3AIWA 3PBUA 3WQWA 1DQUA 1F3WA 1GOIA 1LLOA 3OLDA 4I5RA 2PDNA 1NDWA 4FXSA 4TV5A 3E9AA 3GDTA 3ZIZA 1SZGA 4K8EA 5HXMA 4B3ZA 3DN5A 3CUZA 3ONCA 1T7LA 2ZDSA 3NO5A 1JPDX 2W61A 3LM7A 2Q8XA 4Z2JA 5CCZA 4NZ4A 3HV8A 1B3ZA 1R3VA 2E09A 1VHCA 3OZYA 4BFAA 4O18A 3BAXA 1CCWB 1YPIA 1E6ZA 2AQOA 3T4CA 4LALA 9RUBA 3OG2A 3NVTA 3W7EA 3T4WA 2Q71A 1US0A 3IARA 5I5RA 3M0KA 3DBNA 3VD7A 4ENLA 2QCMA 1GEHA 3SGZA 3RMEA 7ODCA 4E0CA 3S6DA 3NVDA 3UCQA 2ISWA 1QI4A 5M2FX 1BF2A 2BOGX 4R88A 1XUZA 4XD5A 4PMJA 4IWWA 3B0VC 3IK4A 3E5PA 1S1RA 1KR1A 5CAHA 3BMVA 3P0XA 1WCGA 2CXGA 3U5UA 5EMLA 3QF0A 2RFGA 1DJQA 1G69A 1JCLA 2VZVA 3JS3A 5FEXA 2QIWA 1WBJA 2ODOA 1M41A 1DP0A 3UWZA 1DWAM 5EBAA 4M82A 3R1ZA 1GNXA 3EWWA 3S9YA 1XIGA 2ONEA 5F2MA 3AISA 4WVXA 3UJEA 4HZ6A 3LI1A 2WPBA 1YW1A 1J5SA 4PE8A 3O7UA 4WR3A 3V0TA 5H8MA 2VM8A 2R24A 3AWOA 4L61A 4UR7A 5LXEA 3P5ZA 4NQ1A 3W2LA 2OQHA 2XFRA 4H3DA 2Z7GA 3HBLA 2FMNA 3U48A 2NWSA 2PDLA 2ZYFA 2QF8A 1E6RA 2OSWA 3OODA 1EJ7L 4PMDA 4GQ0A 3BV4A 4LNYA 3EAUA 3R8GA 4IG2A 4ZO6A 2FZ8A 1D7FA 4EX4A 1KXHA 1UWSA 2X7WA 3T0TA 3BSMA 3HPZA 2RJHA 1OC5A 4GY0A 1HKWA 3ATYA 3P7YA 3PG9A 2BY0A 2HK1A 4U2ZA 1K7EA 3GG7A 3P3BA 4J3TA 4JAWA 2Q09A 2W3ZA 3BAJA 5FD0A 5D2YA 2OMAA 1UZ4A 4JL2A 3GUWA 2J27A 1W5NA 4IGSA 3FDKA 3O15A 1SR9A 4NNBA 4TX9A 3I3DA 1P0NA 2Y70A 4LC8A 3P8JA 4WSKA 3GQYA 4OE7A 3ZJ7A 3IJ7A 3AALA 4GO8A 4ES4A 3G1SA 1EJVC 1ADOA 3FFSA 4XAGA 4EACA 3NL5A 1Q6LA 3W7CA 3PPHA 2GGEA 3LHUA 3BLFA 4GQRA 4AZ6A 3UP8A 1ECEA 1DE6A 1NFGA 4KBXA 2V0TA 3DFSA 1JPIA 3QMTA 1JFXA 4ZGYA 1NDVA 3JZEA 3W2MA 3W74A 5A8GA 4X2RA 3NO1A 3SSZA 2GK1B 3T08A 3MMUA 3URBA 1PJ9A 4S23A 4H4IA 4INFA 3CYJA 2OEKA 1E43A 2QR6A 3PM6A 3NSNA 3B0XA 3HJZA 3P84A 2EBNA 4XZBA 4A3YA 3TE9A 1GYMA 1VCGA 2J62A 1IEWA 2PRMA 4G1KA 4V1XA 3SCSA 3W7QA 3QKZA 3R8RA 3TQ0A 2JBMA 3NURA 4AUBA 2I16A 4DI9A 3UESA 3PZIA 3ITTA 2JKPA 2P5NA 3DCPA 2E1WA 3FVDA 2WJFA 3EWCA 5HA7A 2QEZA 2AGKA 5CJ5A 2AAAA 3NR0A 5H6HA 1A5BA 5GJNA 3T7VA 2QYGA 3OB8A 2YFNA 3B97A 2ZRXA 2Y61A 1GWJA 2BGSA 3EKZA 5E5CA 3UR8A 3P8IA 4LUTB 4GZIA 4D2JA 3TYEA 3O8AA 4UOZA 3IANA 3GTFA 4LVFA 3GRIA 3AIVA 3WNNA 1XLHA 5C7HA 1S3TC 1XGDA 1L0PA 3W7PA 5M17A 4FR1A 4OGZA 1XPYA 3CNYA 3H7UA 3HGRA 3N2MA 4LUTA 1L8NA 1YX1A 1WZAA 4Z1BA 2C7FA 3BLLA 4ACYA 3MTWA 4J40A 1YDOA 1PX3A 3GZ3A 2I1OA 3PBWA 2ZUNA 4CNUA 4EPKA 3A9IA 2HCVA 3FVMA 5A94A 3HQNA 3EX2A 3S5SA 3WUFA 2EKCA 4HA0A 3U3HA 3FV9A 1VENA 1W3JA 2QDHA 3FHQA 2O92A 2PP3A 1ZZMA 3WF2A 4MGGA 1OY0A 4CQ8A 3GFYA 2INZA 3CIXA 1XINA 3NQ7A 1S2VA 1CT5A 3OLGA 3WNMA 1E4MM 3TN5A 4LJ3A 2Y7GA 2FB3A 5DXXA 3CB3A 3VMOA 1XH0A 1A5OC 3AZRA 3BUVA 3RR4A 3EOSA 1OWQA 1CECA 3AIEA 1TTIA 3TLQA 4HHHA 4BWLA 2ISSA 1CW2A 4ZQPA 2C16A 2CHNA 4ZO9A 2YL6A 4D8LA 3T8QA 1OFBA 1S5MA 3TEVA 3HB9A 3AOFA 4E2DA 3U0HA 4HOZA 5HANA 3OBEA 4JY8A 1OBAA 3P14A 4BI6A 1OGGA 4MZ8A 3EWUA 3LV5A 2VI0A 3B40A 4YL2A 4F0KA 1W37A 1N2VA 3VMNA 3TC6A 2PTDA 1TIWA 3DXIA 4PMYA 5K9XA 4QISA 2W5FA 1V51A 1PKMA 4GVGA 5A1AA 3ITVA 3GNNA 1T8QA 2NVDA 1THFD 3G1RA 2PP1A 4FNUA 1M65A 3VD9A 1A3HA 1UWIA 3R25A 1S2CA 4C5ZA 4CNNA 4DRSA 3GC2A 4C6FA 4RDWA 1L6SA 1A0DA 1V6TA 2G3NA 2NLIA 5CC5A 2ZZ2A 3KRUA 4WCJA 4HNOA 3OTRA 3RDKA 5BU6A 3LGGA 3R6IA 2E0PA 3RITA 2QUNA 5IM51 5I06A 1AQMA 4WJ8A 1OINA 5FSEC 1ITXA 2IKIA 3L4ZA 4N7QA 5FJRA 1T5AA 3U8GA 4V2XA 2WSKA 2ZTKA 1MDLA 3A24A 2WYSA 3WLMA 2Z1VA 2O9OA 4IFKA 4JYFA 3NQDA 5FI8A 2DZBA 2VMFA 1TV5A 4TR9A 3VO0A 4MPKA 1E6SM 3HG4A 3LBCA 1RK5A 1P6BA 3G8RA 3LCFA 4I3GA 3S1VA 3NJ3A 1QHPA 4DJDD 3TN6A 1ODZA 4LGXA 4GXMA 3VINA 2E6DA 2XIOA 4K7VA 5I3IA 3DFPA 5DQPA 2E40A 4OFCA 3W02A 2XH4A 1XM3A 2Z24A 4IPJA 4DM2A 3UR7A 4FF7A 1I9CB 2FVLA 1QTWA 3CWOX 4LAUA 3RILA 5RUBA 5E6ZA 3L7RA 3EXSA 4JN6A 3IS4A 1SO4A 3W70A 3NL3A 2CLFA 4BA0A 1RAKA 1OADA 3W87A 2ALDA 3TYUA 3MB9A 4O52A 5TBOA 2VTFA 1VYRA 2QCLA 4PC8A 4P8VA 2ZZ6A 4F66A 1XRVA 3B9DA 4JY9A 2DIKA 1PS9A 3SADA 3SJNA 2BOFX 4NASA 3VCCA 1OX5A 4KMQA 1KGUA 1TVLA 4D1IA 2VD9A 1UJPA 4IQJA 4JKKA 3KW3A 3SUUA 1RV8A 3OQEA 4PMQA 2DZWA 4P8UA 1E6QM 3FSTA 2OG9A 4J3ZA 3PUDA 4IP4A 1NWSA 3EEGA 2WQPA 2YXGA 1X39A 3II1A 5AHNA 4KRUA 2PU0A 3WFLA 3BCDA 3PZ9A 4UTFA 1R3SA 2DIEA 4GBDA 2NV9A 3GTIA 1ZENA 4Q8NA 4B4FA 1W1VA 4XZHA 3GZAA 3D3AA 3FYOA 4FXRA 5EU9A 1E1FA 4NI3A 4HA3A 3H2AA 1A0EA 2PWGA 5AKQA 4KPLA 5AYZA 5I07A 5LNWA 3MA8A 3BJTA 1EIBA 1UWUA 3UBPC 2WKGA 3QM3A 1BVZA 3PJWA 1E6NA 3VIIA 3O05A 1R9YA 2DSWA 1W5PA 4OVXA 3UU0A 1FWTA 2F9RA 5CPMA 3VYLA 3QV8A 1AK5A 4U28A 4M6PA 3QPYA 4LV9A 1IE7C 5A6JA 3ARZA 1Y5XA 1PDYA 4XSLA 1UIOA 1KXTA 3BLPX 5DX7A 5LNSA 3NOYA 4LVDA 3TDFA 1JGIA 4UMCA 3I3BA 3WJXA 3I10A 3AIBA 4I9AA 3QV9A 5HPOA 1UH3A 1RALA 4I8DA 4NVTA 4BK9A 4GVIA 3NQEA 1NOUA 3DGBA 4HNCA 3WD3A 3JUGA 3LRMA 2CHRA 1DORA 3GNPA 1IXPA 2QF7A 1OJXA 3VNZA 1MXDA 1H0GA 5HNRA 4WKAA 4AY8A 3LLFA 3KVMA 2I5GA 4PL1A 1SZEA 3IAQA 3EDKA 1AQHA 4L6OA 2PWFA 1A5UA 2WLZA 3W27A 5M5DA 4UTHA 3G1XA 2Z1WA 3CYVA 1V03A 3TSMA 3S6TA 1NWTA 1AUSL 4JTQA 3BJFA 2ACRA 3O06A 4XD6A 2FZNA 3ANUA 5D8ZA 3DBPA 1RY0A 3KHDA 3W4RA 3N18A 1RQHA 3UZZA 1I45A 1VB9A 4PFMA 3BMXA 5REQA 1JIBA 3PULA 4GZJA 3GH4A 4LH8A 2JGYA 2YIHA 4H7CA 3W00A 2VHLA 1VFOA 4E2BA 1Z9AA 1AQFA 3M64A 3TTEA 1QW9A 4DM1A 2Y24A 3CHVA 3FAXA 5DMNA 2GL5A 3S3GA 1CB2A 4AF0B 5I23A 4XZLX 1TELA 2X2GA 4GC4A 1CDGA 4HBKA 1JUEA 1OC7A 2MUCA 4B15A 1EP3A 4MYAA 1TTQA 5LNUA 3CAQA 3STFA 3MZNA 1FWHC 4CLMA 3CL6A 3XISA 4AZBA 4D71A 1G4EA 1QATA 4JCMA 4DUWA 2OU4A 4W9TA 3L2LA 3H26A 3BAYA 1XI3A 2VXNA 4FOJA 1A4LA 4E8DA 1MUMA 1VZWA 4CGTA 3C2VA 3P5YA 1RCQA 4J3SA 1S5NA 4F8XA 1TUXA 1A47A 4WSJA 3TR9A 4ATWA 1SFLA 3GXNA 1XFBA 2C14A 3STPA 1VYPX 4JFVA 4HSOA 4YLWA 1BRLB 1SGJA 5AC8A 1MNSA 3MS8A 4FSAA 1SMDA 3WQDA 3B9AA 2CLKA 2WMGA 3VOHA 2ZE0A 1H50A 5HUOA 4W8LA 4RNHA 4AZCA 5J5DA 1M04A 3BG3A 4ACZA 3N4EA 5TNVA 3SBFA 3N25A 1GJPA 1YRRA 4HT3A 4WGHA 5FEPA 1JGMA 3BC9A 3AJ7A 1N7KA 2E5CA 3LCXA 4B2DA 1KXVA 2GDVA 6TAAA 3TAOA 3LRKA 4GI6A 2OSYA 2KAUC 4HNLA 5AHFA 5AHLA 3AHXA 3WLNA 4O12A 2X1TA 5BRBA 3QY7A 4ERGA 2GGJA 1W1A1 4Q4KA 2WW5A 5T91A 1H7WA 3I6TA 2X1SA 2DQXA 2O7SA 3SAZA 3VZYA 1UMLA 1YNPA 3QXBA 4QLJA 4Z2KA 3H2EA 2I9UA 4Y96A 1UP3A 3GR4A 4FX8A 4P5UA 3UFYA 1X7FA 2P53A 2X0HA 3EBVA 4Q4MA 1LBMA 1TPWA 3DG7A 4NU7A 4XWUA 1NU5A 3LCWA 4NYUA 4RNFA 1QHZA 1V3LA 1XC4A 2QULA 1LORA 4RW3A 4W7VA 1PUDA 1QPNA 2DUZA 2Y1HA 3BOXA 3MBFA 3RMJA 3QQ0A 1GGOA 3PUEA 1L2QA 1KLZA 4ONVA 2A79A 3TV8A 3ZR5A 1UA3A 1BHGA 3OVPA 3MY9A 3N4AA 4JTRA 2RDUA 1LG1A 4PA8A 3KWSA 4PMVA 4O11A 4W86A 4B92A 3R94A 2FPYA 1IZCA 5DT7A 2IXUA 3WMBA 2V38A 5AC6A 1QO5A 4KEZA 4TVDA 5G1MA 4WSHA 4WLCA 1U5JA 1GT8A 2AKMA 3ORWA 2AMXA 3L4XA 2W62A 2XM2A 2Y8UA 5U7SA 3QLDA 2XVGA 5BYWA 1UWAA 1RY8A 4RZ6A 3SN4A 5JUVA 2OWCA 2NVAA 1VFMA 2A2IA 3PZNA 3GXDA 1GOWA 2YPIA 5LNRA 3NZQA 3CPGA 2J7BA 3CV2A 3ARUA 4IUOA 4R9OA 5E70A 5BXSA 3MP5A 1Q45A 1YXCA 2I5IA 1XC6A 3LPOA 1W3HA 5JMUA 2V67A 1PYFA 3GNXA 1FDJA 4IGHA 3ALFA 5KMYA 3QZEA 2Y62A 4FXJA 3W84A 4GI4A 3TMQA 3OW1A 4NRSA 8CGTA 1EB3A 2PDKA 3CZEA 1VFFA 3CZKA 4Q4OA 3UWUA 3BSHA 3O63A 3ARYA 3SDOA 5CPSA 3KCOA 3TQVA 2QJJA 1NDYA 2POTA 3D46A 1AVAA 4Z2IA 3WQ6A 3GHTA 4MZYA 4F9DA 2PD5A 4DN1A 4FK9A 4I5XA 2G8ZA 2YBVA 3UWYA 1T0OA 2WSRA 2V5DA 1PAMA 8A3HA 1NWUA 2OVLA 3C2EA 1TREA 3MKVA 3EDFA 5K4ZA 1Q63A 2EPNA 2WMIA 1BAGA 2DV0A 2YDQA 1F8MA 2HROA 4MYXA 3WK1A 3KBNA 4EAMA 3IJ6A 4BY3A 5GVJA 1JZ5A 2YB4A 2FFCA 1TTPA 4XO6A 4QM1A 3KM8A 3L0NA 3V75A 1CNVA 1Q3NA 4AIUA 1MDRA 5BOOA 3CB8A 3OO2A 3AZTA 4MJZA 4DBUA 5I3KA 3PN8A 3ANVA 2J75A 4FXFA 2CIPA 3ZFHA 1J9YA 4DO6A 2E9MA 4S3FA 2XH2A 3FSUA 1MFVA 1V6XA 2INFA 3M4HA 3GO2A 2CBVA 2ZA3A 5DRIA 3MUXA 4N9BA 3J7HA 1IIHA 4RXFA 5BMWA 3NM3A 3C3UA 2BS9A 1W54A 1UR0A 3VOGA 3ELFA 2EGZA 1DWHM 3B9OA 1E0XA 3L23A 3CGTA 4GZ7A 3GBDA 4MWAE 2GQ8A 2QS8A 2ZRVA 1KCXA 2VUNA 4HMCA 4WX2A 3W6MA 1QK0A 5U4NA 2G41A 4XG1A 1B4KA 5E1QA 5AZ0A 2J79A 3SQLA 3UPMA 4GIRA 5TAOA 3T2QA 4HIBA 3WSUA 3U4FA 4B5SA 4C6BA 3N4FA 3RM4A 2WC7A 2WSPA 5A2CA 1O5KA 2YKKA 3NQMA 1HJQA 3CL8A 3WENA 5CSUA 2XSXA 4UOJA 3HZ3A 4S3AA 1Y5VA 3IGHX 3ZJ6A 1EJXC 3AIUA 1TG7A 1HXJA 4S2BA 1DXFA 4LTSA 4NAFB 3ERPA 5L6UA 4CVWA 4I9MA 1FHLA 1O68A 3NZGA 2WHMA 4GD0A 4POCA 2VFIA 3G1FA 3AIRA 1TMQA 2Y88A 3CZJA 2A3BA 2MNRA 4GY7A 3ZM8A 4KWSA 3W85A 4DUOA 1ZFJA 2QUVA 3LK6A 1EIXA 4W88A 2OO6A 4TTUA 3BPWA 1U83A 1V4YA 1V08A 2YOCA 2P3EA 3PWIA 6XIMA 2ANUA 3A4AA 3B06A 4Y9MA 1Z44A 2O7QA 4JZ5A 1X98A 9CGTA 3GYCA 5AYBA 4FALA 1G94A 4UQEA 4EAYA 3TXZA 1H2JA 3CO4A 2XSBA 3OBAA 3L0GA 4HNNA 4JICA 1C90A 1NDZA 2JALA 1QOXA 2HTMA 3MDWA 2Y6ZA 4X2PA 1BLIA 3RM9A 1GVOA 4IX0A 4IX2A 2OKTA 4C6CA 1UQYA 4I7WA 1H1ZA 2E5DA 1CXLA 2W91A 1FX6A 3B4YA 1QUMA 2JK2A 1DJWA 3K4AA 4TX8A 4JTSA 2HRWA 1YLVA 2VFGA 2ZDRA 2BXVA 2OR2A 4W5ZA 3EOOA 2QCDB 2WWCA 2DZUA 4DEFA 3VOJA 5C71A 2QW5A 1SW3A 3W7HA 3NEVA 5MF5A 5AFDA 1XQLA 4LYPA 1POKA 2AL1A 4YN5A 1KCLA 1W32A 3QY8A 1HGYA 2IKHA 3G1DA 3WK2A 1D3HA 1REQB 5A6SA 4PUNA 3TYCA 3TJ4A 3FA4A 4H19A 4H9VA 1XICA 1ENUA 3OZMA 3A64A 1QT1A 1HO4A 1TV2A 2AQWA 3QPZA 2E8ZA 4CD7A 4F0MA 3PZGA 1Q13A 2FTWA 2FTPA 4H9TA 4L4PA 1PZ3A 1SO3A 3PBYA 1UIPA 3GBEA 2J77A 4HP5A 4GYPC 1GOKA 5IHSA 3ZJ8A 5FJOA 3LENA 4E2VA 3VD4A 1JI1A 3TQKA 2WMKA 3ZSSA 1PCKA 4QGCA 5LIWX 3V0SA 1EUNA 1HP4A 5CC6A 2VEPA 1EGZA 1P48A 2O9PA 4E6MA 1ZAIA 3RFAA 4U3AA 2C1HA 2GWNA 3H2CA 2OJPA 3G0SA 1KA9F 2E67A 3UXIA 2Y89A 3CWHA 2V68A 1A5KC 2CLHA 5GJPA 1TWZA 4O13A 1LCOA 1WP6A 2B7NA 4PUMA 2G3MA 5F4SA 4DO7A 3VE7A 4YMZA 3R43A 3QW4B 2PRLA 1XKYA 2ACUA 4QXIA 4BWLC 1LT8A 3THAA 1R46A 2C19A 4M6VA 4XAYA 4Z2HA 2TODA 3B0UX 1ZQ5A 1JYXA 5GNZA 1TTJA 4KW2A 1TUFA 2FGBA 2R1MA 1KD0A 1IT0A 5BXPA 4DJFD 1CBGA 2F61A 3SN0A 4UTKA 3W7IA 2HJPA 3TA9A 3RX4A 3KRBA 5EFDA 1QW7A 2TRSA 2FHBA 3QYQA 4D6IA 2XGBA 3PS7A 5B7YA 2YFOA 1ZTVA 3IRSA 1V6UA 2PF8A 3CQ0A 5EPDA 1V3MA 4R85A 1CLVA 4XIAA 2NSOA 3VIGA 4E38A 1B3XA 4GKTA 1ZSXA 1UD2A 1WPCA 3TROA 2E9BA 3SUTA 4MLJA 4EANA 1NELA 2WZHA 4YCPA 2YCLB 1MEIA 1QNOA 1TCDA 2NXHA 4ZO7A 3TJIA 1SR0A 3V5CA 1OD0A 1XD1A 4JTAA 1W1YA 2PB1A 2UBPC 2O55A 3WQGA 2V30A 3ZVHA 4K39A 1JQVA 5C55A 1QWGA 2I7GA 4UTIA 1ADSA 2PS2A 5G5IA 3RCMA 3VIJA 1KLYA 5G4HC 3TUUA 2F6XA 2BNJA 4RZ4A 1GOMA 3ITYA 4S3KA 5D9OA 3VI2A 3QMRA 1UR9A 5A6MA 4ADSA 4XO7A 1IXOA 3OA5A 1MQPA 4ZOCA 4HZMA 3QGVA 3EDJA 1S1PA 3ISIX 2SFPA 4JTJA 2QXWA 3CUJA 2J8TA 1I75A 5A3HA 1O5XA 3ARWA 4KCUA 2PMQA 1V93A 1TWDA 4WXYA 5AHEA 3UR2A 4XIMA 3E2VA 2ISDA 1Z48A 3RHGA 1TSIA 4H8VA 2F7FA 5SWUA 3WCZA 3LMYA 4PL2A 4O0QA 5FEWA 1IXQA 2D69A 1VRXA 4J3UA 2VVSA 1TQJA 4IOTA 1UQZA 4JTTA 4U5KA 4HU4A 4Q8TA 2G4FA 2VX4A 3G24A 3RX3A 4AH7A 4DX3A 5I3GA 3APTA 1E70M 4LEQA 5FL0A 3GK0A 1XRFA 4UTMA 4FA3A 4NI8A 2C13A 4J3VA 3MT1A 1VF8A 2ZBTA 4UQAA 3WNOA 1LQ2A 1FCBA 3MCNA 2J24A 2I5QA 2HVNA 3KP1A 4MNJA 4Q32A 1ZJAA 2XFYA 5JBEA 3KBSA 1QOPA 3GY1A 1UR8A 1Q7QA 3QGKC 4NZ3A 4GNJA 2X16A 2VR5A 2VZUA 1IGWA 1EJWC 1DVJA 2V3EA 3VPLA 2J6XA 2F2HA 2UWFA 1EFZA 3Q37A 3A13A 3SFWA 1A5MC 1B5TA 3W1NA 4DF1A 3PBMA 1LBFA 1U22A 2IS7A 3UA4A 4L65A 5IOBA 3TIMA 1JDEA 1F73A 4PTDA 1FQ0A 4FLOA 4F48A 1CGWA 1P4CA 4D6JA 1F7BA 4XZIA 2Y5JA 5ABFA 3UCCA 3U2EA 4QJ1A 4JX6A 4PBEA 2DU2A 2WJZA 4PMUA 4NZCA 5M1TA 3FYPA 4OBSA 5CKSA 3HG3A 3APYA 3RX2A 1UUQA 4RDVA 5K3VA 1S39A 3GC4A 3EGJA 4AHPA 1A5CA 4QLKA 4DAFA 3PY2A 1KBLA 3L12A 2BTMA 4BS0A 3NXFA 1RP8A 4L4MA 2X30A 3IUDA 1FP9A 1LUCB 1GYNA 2QLYA 3AS0A 3CJPA 3NQGA 3TSDA 1GG0A 2PLCA 4HCLA 2WPGA 1UA7A 3WNPA 3HIJA 2VNCA 4AVNA 3URNA 3W0KA 4MJ4A 4HQVA 3ABQA 5FSDC 1E71M 5L9FA 1TFVA 2Y85A 1ML1A 3CTLA 1RHCA 4A21A 2UY5A 4AZCB 4A3RA 2PURA 3IWPA 4C91A 4DZHA 1TWSA 1I2RA 3MSDA 5HMDA 4FNTA 4KQNA 1UUOA 4O1FA 2FH6A 3GWQA 3GG1A 5I03A 2ABAA 4CNOA 3I3EA 4Y9PA 4ZFCA 1OC6A 5FA5A 4LVBA 4S3BA 3KTXA 2EAWA 1ITUA 2JFEX 3W83A 4ADUA 1HVXA 1V0LA 2B81A 1E4NA 2V3GA 4GCXA 4W4QA 7A3HA 1DOSA 3T9PA 1XIDA 1EKOA 4XAFA 2J74A 1I1WA 3SCTA 3URAA 2NVCA 3BLEA 3TONA 4HTYA 3U7BA 3POHA 1E5NA 4JS3A 3OEXA 4DLMA 4JDBA 3MVIA 1DPMA 3WK0A 1R3RA 2OODA 4YVVA 1FWNA 4XAZA 2VC6A 3B8DA 1FHVA 1OCNA 1QNSA 4FX6M 2YW4A 4ZQNA 1KWKA 1IF2A 2VZOA 3ARQA 3G1VA 3GFZA 4B9YA 3SIZA 5IHRA 2WHKA 4QG8A 3EB2A 5D9MA 3IVSA 3V16A 3QVQA 4Q7NA 3WBYA 2HISA 3MPGA 3IUHA 3BLIA 3WDHA 4O1BA 3H54A 1EGVA 4KWVA 1L6GA 3KVKA 3CBWA 4LCRA 1XSJA 3QHOA 3W37A 4DYKA 1N8WA 3N73A 4JTCA 1ZCCA 4GYFA 4PMOA 1P0EA 5C9RA 3QHNA 2G37A 2J88A 3NQ8A 1YTDA 2CLIA 1DJNA 3LPGA 4EF8A 3K30A 4M6UA 2J9XA 2FGZA 4C1LA 1IWAA 4PUJA 1KW1A 4O15A 3ZT6A 1J6OA 3C0SA 3V5OA 3NGFA 1UH4A 1PV8A 3MUZ1 1U30A 2E6FA 3AU2A 2XISA 4MDPA 3UA3A 3ARSA 3E2SA 5BXRA 3CPUA 3VX0A 2WVSA 5DMYA 2XJ7A 3EX3A 4M1RA 1VAHA 2WJEA 3W1TA 5ABFB 7PTDA 2JIWA 2GVJA 1FRBA 4Z2LA 1RQBA 3ME3A 1J0YA 1E55A 3AFBA 1WDWA 4FHAA 3N3TA 2Z1SA 1X96A 1NF0A 2HK0A 4GI9A 3ZS4A 3AYSA 1YDVA 1VFTA 4LVAA 1GPFA 3SFKA 4YVXA 3T07A 2RAGA 1XHGA 1UC5A 3VOIA 3BAKA 4PEEA 4UMAA 3KRZA 1KBKA 5BWFA 1JF6A 3W71A 1GVFA 3AXIA 3N2XA 1XKJA 5G1TA 3KZSA 1YBQB 4RDZA 3SI9A 4N9EA 2EQDA 2VCAA 3TYDA 4W93A 2CBUA 4DVOA 4V15A 4MUZA 5FKYA 1XCXA 3JZUA 4C6EA 2DH2A 4KEUA 1TPB1 2OOGA 3PF3A 3T8LA 4LS1A 4FX7A 3MCMA 4X0VA 2QDDA 3L0KA 2W66A 5DEZA 4B5TA 4QEHA 1MXGA 1FH9A 4WDTA 2DW6A 4ORIA 3W7LA 2REQA 1A5LC 4IJCA 3MV11 2OWWA 4AWUA 4NIRA 2Q8ZA 4DF2A 4QDMA 4LC6A 2QDEA 4N4QA 1EP1A 1ONEA 3WF3A 4MB1A 1CXHA 3M47A 2E3ZA 2GUUA 2DPEA 2Y0FA 3EWDA 4GRSA 3TTYA 2R9RA 3QTPA 3C5QA 4MFDA 3FYYA 3UVAA 1CYGA 3RNDA 2WCSA 3W24A 5CC7A 4KIRA 5DMLA 1S3HA 3QH2A 3AXMA 3IRDA 3AS3A 1J5TA 1W9DM 3IACA 3ID7A 3TWBA 3CM4A 3QMSA 4FPSA 4OIFA 1RVKA 4QRNA 5HNUA 4NG3A 3MWAA 4GXWA 3QZ6A 2VD8A 1SSDA 3G22A 1US2A 1KQYA 3APGA 1PHQA 2TAAA 1C7SA 6REQA 1VD6A 4YNGA 5LA0A 3O2LA 1EWEA 3NM1A 1FVPA 1J0KA 4A22A 3DEQA 4HK7A 3OVGA 5K4XA 1EXPA 4GO9A 4X9SA 3UG8A 3C2RA 4OQVA 1EL3A 1MW0A 1KTBA 3UWEA 4UFHA 2QGHA 3FJLA 2D2OA 3KDOA 3UXKA 3XIMA 2YA1A 5AY7A 2HV5A 1OM0A 4HA1A 3G0XA 1J11A 3U2OA 1LP6A 1KFCA 4C6MA 3BXWA 2XSAA 3KBMA 3UZYA 1X97A 3BL3A 3TJXA 4NUWA 5D09A 3CH0A 4D9PA 5HR7A 4L6DA 1TJ1A 1SSGA 3NO3A 2JF7A 3C2YA 2VCBA 3MI6A 3WH5A 1A5SA 5LYRA 1GQNA 3CV1A 4R7WA 4NKCA 4JFUA 5IBXC 5A8OA 3UXDA 4WRHA 2QCHA 1LOLA 3TH6A 2ZZ5A 1U5VA 4UQCA 3VDAA 1JXJA 3MBDA 4PCTA 4V1YA 3OU8A 2DSUA 3E02A 2UY4A 3GNRA 4H9XA 1R9XA 1AH3A 1J93A 1MEHA 1XUUA 2QJGA 1GVQA 3AQUA 3WLIA 4JN8A 3S5YA 5BWAA 5FF7A 1EGMA 2R91A 3F1QA 3AI0A 4YHGA 2ZX8A 1HX0A 2R1KA 3QZAA 1EXBA 1Q4WA 2Q6ZA 2GOKA 3U6WA 3NQAA 3WLTA 3WL0A 3W29A 3K4WA 5EL1A 4A3QA 4MY9A 1TZ7A 1MUCA 1W17A 1GZJA 3T81A 1JAKA 2PDCA 3K13A 2DT1A 1RH9A 1EDQA 2TMDA 1W56A 3LUTA 1DIOA 1B3OA 3MUY1 2G95A 5A6BA 3PJTA 1SPQA 1J0IA 2V2DA 2YDAA 4Q4RA 1KXQA 4K8HA 3CH9A 2XIBA 4S3DA 3JU2A 3VUPA 2DZSA 2YA0A 4IXHA 4DJEC 2OX4A 1B9ZA 4AG0A 3VE9A 4JDYA 4P61A 4ZZ9A 1DIKA 1FWIC 2WVUA 1UPPA 4ZL1A 4L80A 2J7EA 2DY3A 3RIKA 4MAZA 3PZUA 3IGSA 4YTQA 3L2IA 5D2TA 3LCGA 2Z6IA 5GPRA 1WO2A 1LROA 2Z7KA 4MB5A 2J7GA 1JZ6A 1QI0A 4P7LA 5ENLA 1B9BA 1GUVA 1TJ0A 3SRDA 5C9WA 1TV7A 4JTDA 3VC6A 1JFHA 1F5ZA 2VRJA 3A23A 2DUAA 2RGLA 1JUBA 2I14A 4M56A 3BQ5A 1A80A 4GUIA 3YPIA 1R0MA 1J10A 4QFUA 1PXGA 5LGZA 1N82A 3WQOA 4XZWA 1HKKA 5JVLA 1ONXA 4F2UA 3PTMA 3B8IA 4JQ2A 5HATA 2RHGA 4D6DA 5LXXA 1Q6RA 1ZB5A 2PPGA 4H2CA 2O4QA 1ME7A 3OZPA 1BKSA 3E1F1 1LWJA 3WFZA 4WKFA 1PHWA 3LRLA 4AIOA 3HG5A 4DLFA 4IPIA 3UNDA 4U33A 4IPNB 1WKFA 4TXEA 4I90A 1RQEA 1V3JA 4UTTC 2CXEA 4HD5A 3PJUA 3LSBA 5HMFA 3FEQA 1QI5A 1RJPA 2FZMA 4M8UA 1CPUA 4HTBA 2DT0A 4AZ5A 3TLLA 3SY5A 1PX4A 2V3DA 3B9NA 1TB3A 2X0YA 5K9CA 3ATZA 1OYCA 3TP4A 3K46A 2A7NA 4TV6A 1JCNA 4AZGA 1TJPA 4GQQA 3SO7A 1X1ZA 2F38A 4OOUA 3AO0A 2VC5A 2JIEA 2OB3A 2W63A 1ZJIA 1F3EA 1UW9A 3NPVA 1JPHA 1RA5A 4DYJA 3MCOA 3DH7A 3MYPA 1JD7A 1H51A 1RBLA 4JD4A 3TYZA 1CGVA 4GX9A 3MKCA 4OT7A 1EC8A 3LGDA 3S1XA 3RM8A 2ABBA 3MQTA 4C6KA 1WZLA 1K8ZA 5BZAA 4H9ZA 5CJNA 2Y2WA 4UC5A 4JPGA 3BCFA 1GVYA 3AWNA 1UP0A 2Z26A 5BNKA 2OXNA 1IZKA 2XWEA 2J7FA 4IH3A 5AZ1A 2AQVA 2YBUA 2C1GA 1LZOA 3CPRA 5CLWA 4JIQA 4UFMA 2Y5EA 3T05A 3EB4A 4C6JA 5HOSA 2A6LA 1I0BA 2VDGA 4JTIA 2ISVA 2EO7A 3KVJA 1EQCA 1TZZA 2YXOA 4JTFA 2V5CA 4C60A 1XLKA 2DW7A 1GQJA 1OCQA 4L1WA 2HNHA 2EG8A 5G2IA 3OBKA 2F6KA 5FF2A 1ZY9A 1XCFA 3ZWSA 5F2LA 2NQ9A 2PCEA 3M0JA 3MHFA 3BLKA 3F5JA 1JCYA 3M0YA 2C0HA 3QV6A 1RBOB 3QOMA 1Q4NX 2GJPA 3PC0A 4KCVA 3T09A 3IVTA 4Y9OA 4RW5A 5B7ZA 2GVLA 2XVNA 3VKBA 3GDKA 3NAVA 3MZ2A 3QSTA 1I2NA 3QW3A 2BVYA 1YNYA 4XKYA 3RUBL 1I6NA 1HKIA 4LUIA 1QI2A 4C1KA 1H5VA 4GE8A 2DZVA 1ESWA 2WNNA 2XUCA 4AEOA 1UBSA 3L9CA 4PH6A 3RPDA 3T78A 2WK2A 1F4HA 2V8ZA 3CAVA 1R3YA 3KE0A 3N14A 5LIYX 2NLYA 3AAMA 1VHNA 5FACA 2Z6JA 4AXKA 1WKEA 4NZJA 4HU3A 3W22A 1EJTC 3N9RA 1HJVA 3KFTA 2Y7DA 3LGEA 3G8EA 3TTSA 4GNKB 2FIQA 4EXAA 4EWJA 1W1ZA 4JHOA 4ROQA 2INEA 2Q3RA 1NSJA 1VBGA 3W7MA 2WQDA 1XH2A 3N11A 3W2NA 3A5VA 1H1NA 5A6AA 3RAOA 4YTUA 5LGXA 1AODA 4PTVA 4Q8PA 3AJXA 1P6WA 2OQYA 3VD3A 2PDHA 5C5YA 3WQCA 1AJ0A 4L1GA 2QPSA 2YDRA 3IGXA 2KZHA 2DORA 2W0UA 3ZJKA 1CXFA 4H7VA 1X8FA 2FZ9A 3GAYA 2E77A 1XG4A 2OZ0A 4WKHA 3NQBA 3HPXA 3AICA 4N4PA 1NIUA 4UCGA 2IQ0A 1VJSA 1TRIA 3ICJA 3Q45A 3SCUA 2J9ZA 3EX1A 3CXOA 3RCNA 3KWXA 4Z0SA 2WZIA 3HFTA 1I2PA 1C92A 1UMYA 2DQWA 2YL9A 4TIMA 2PWUA 4HNUA 1JXKA 3ZVIA 1YTKA 4B5WA 3TA6A 3WQ4A 1VFSA 3N17A 3UG3A 3M1ZA 1ZBWA 1BWLA 2VQTA 3Q58A 4K7YA 1EDGA 2OYLA 3IPWA 3HN3A 1MQQA 1R47A 2PTWA 1P0DA 3ES8A 4XKMA 1EF3A 1WYIA 4OECA 4A3UA 4JIEA 3AYRA 3IAPA 3FIGA 4MNLA 1GYLA 5AYYA 3WX7A 2ACSA 1VEPA 3EWZA 4GIYA 4K2SA 2Z25A 4J1OA 2V6AA 2CLMA 2WHLA 3KCJA 2YL5A 3GAKA 2QVHA 3WBWA 3UJ2A 1RLCL 4H41A 1VRDA 1XWYA 3H21A 1LL7A 3DUGA 4UNLA 4GA8A 1XDLA 1QHOA 2DVTA 3NSMA 3SUSA 1JL8A 3ARPA 3LD5A 3DU0A 1AW5A 3NL2A 3AHYA 2HQAA 4JTGA 4AD4A 2DDXA 2WWDA 5DF0A 1TIMA 4LYQA 1TA3A 2PGWA 3RU8X 5D2XA 4HHLA 1L6WA 4B3KA 2GJNA 2QDGA 1X1OA 4CNPA 2V3FA 3GDBA 5CPTA 2XVLA 3MHUA 3EOLA 2R14A 1PEZA 4ECLA 3R13A 4HK6A 3Q67A 4IMAA 5FOOA 5I09A 3LHVA 1IR2A 3AZSA 4N0RA 1FWGC 3REQB 1NY1A 2I57A 3GUGA 3THCA 3DECA 4MVAA 3PBVA 2CHOA 5H2ZA 1CGXA 3CIWA 3JW7A 4L5ZA 2BXZA 3PB2A 5HNTA 2IPGA 2ZWZA 4AY1A 1D8CA 3ZT5A 4FLSA 5D05A 3STGA 1L8PA 2H90A 5C2XA 4TMCA 1EC7A 3N9KA 4OHQA 3R79A 1E40A 1UR4A 3GIYA 4DXVA 1TO3A 1VYSX 3B4UA 3AMCA 3N04A 1QJWA 1C91A 2I17A 1OF8A 4GUFA 3N13A 3AU6A 1SO5A 1TYGA 2EPHA 3O0FA 4FF5A 3BOLA 4P8WA 4LX4A 3UW6A 3EPNA 2QJHA 3D3FA 4RDYA 1DWIM 1Y0EA 5GJMA 4WDUA 1UOKA 1QPKA 2IPJA 3MUAA 6XIAA 3I4KA 4UMBA 4OKDA 3WBEA 3LZ3A 3BW3A 3V1PA 1DEDA 2WKLA 1XLGA 2I56A 3M6DA 4XSMA 3UD6A 1QVBA 4XUYA 2ZCGA 4PUUA 3M5YA 4HPJA 3D6NA 3FK4A 1OFOA 5AB3A 4MY8A 4OV9A 4FNRA 1W3NA 4DJED 3S2MA 1H09A 3EX6A 3RJYA 1D2KA 5JQ9A 2BXYA 4GCAA 4JFTA 5EYWA 1W5OA 3VIFA 2BBFA 2PGRA 2R1NA 1JZ3A 3UR5A 5A6TC 1DHPA 3P74A 2YZRA 1FXQA 2OEMA 3G1AA 4ZE4A 2E8YA 4C7FA 1W9VA 3HGJA 1SM9A 1WOAA 4H01A 1DE5A 4RXGA 4EPBC 3MMDA 4XZNX 2ZFAA 4PCNA 1VH7A 4AW7A 3C4UA 3ITXA 1BG4A 5C8BB 5CGTA 2OO0A 2J7CA 4PUWA 1V79A 1XDJA 4C1NA 5I3DA 2B4GA 4PBGA 1RD5A 2OKOA 4UR9A 2G50A 3NL6A 3EWYA 3D0CA 3HPFA 4QBXA 2CC0A 3LY0A 2C79A 4MOZA 2DT3A 1YMYA 5AN7A 3SCPA 2OFJA 3KLLA 4E4FA 2Z29A 5FF0A 3QN3A 4UOQA 1GW9A 5KZMA 1RLDA 1PTAA 3W2KA 5HWMA 3RRAA 4DJEA 4G7EA 4H9UA 4XTDA 3GHUA 3SB0A 3GG8A 3L67A 5E6YA 2HS6A 3NCOA 2HNEA 2DZAA 1FHDA 4BI5A 3S46A 1UZDA 1CXIA 4PUKA 1EPXA 5MKGB 1YKWA 5ABGA 4ZR8A 1H7NA 3NZPA 4M3PA 1JR1A 1ITCA 5A6BD 1ZP4A 3VILA 1AL7A 1LWHA 1HF6A 1PSCA 1JZ2A 1LYXA 1YADA 1OG0A 4R53A 1FKWA 1XD0A 2JGQA 1XJBA 3SRKA 2O56A 2WO5A 1JZ4A 1SW7A 2YCEA 1LRTA 1QAPA 5HJXA 1E51A 1TX2A 1Q6FA 7REQA 4PB3A 1X6LA 1HJWA 1W9UA 2PEVA 2PLJA 3THDA 3UG5A 4CN4A 4WJEA 5EY5A 4BQ2A 1S2WA 1TJRA 1SJDA 3N2BA 1FWRA 1R2RA 4JR5A 4W84A 2WMFA 2H6RA 1TR9A 3WF4A 1WDQA 2GYIA 1HT6A 2O4MA 3PNZA 1HVQA 2OSXA 2VWSA 3AROA 5CXPA