1HW6A

Crystal structure of apo-2,5-diketo-d-gluconate reductase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
262
structure length
257
Chain Sequence
b'TVPSIVLNDGNSIPQLGYGVFKVPPADTQRAVEEALEVGYRHIDTAAIYGNEEGVGAAIAASGIARDDLFITTKLWNDEPAAAIAESLAKLALDQVDLYLVHWPTPAADNYVHAWEKMIELRAAGLTRSIGVSNHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGKYDLFGAEPVTAAAAAHGKTPAQAVLRWHLQKGFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE
publication title Structural assembly of the active site in an aldo-keto reductase by NADPH cofactor.
pubmed doi rcsb
source organism Corynebacterium sp.
molecule tags Oxidoreductase
total genus 90
structure length 257
sequence length 262
ec nomenclature ec 1.1.1.346: 2,5-didehydrogluconate reductase (2-dehydro-L-gulonate-forming).
pdb deposition date 2001-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1hw6A00
2PDMA 4PRRA 2F2KA 3VXGA 1PYFA 2DV0A 4XVEA 4JTQA 2CLPA 2PEVA 5AZ0A 4R9OA 4LAUA 4DBWA 2WZTA 2A79A 1EKOA 3NTYA 4JQ1A 4I5XA 3UG8A 3C3UA 4JQ2A 3V0TA 3ONBA 3WBYA 4PMJA 2PDKA 3H7RA 3H7UA 2IKIA 1XF0A 3BCJA 3LN3A 3BV7A 2ALRA 4DZ5A 2INZA 4HMNA 3LQLA 4FA3A 1K8CA 4WDTA 3M64A 2PD5A 3V0SA 1QWKA 2PDFA 2P5NA 2R9RA 3EAUA 3KRBA 2IKHA 2AGTA 1XJBA 2ISFA 1MZRA 3F7JA 3RX3A 1XGDA 2I16A 3ERPA 1Z9AA 4JQ4A 2IPJA 3N6QA 4YS1A 2NVDA 1X98A 1T41A 4IGSA 4IJRA 2IKGA 3LENA 4NKCA 3B3DA 4WDWA 1ZUAX 2HVOA 3UZYA 1IHIA 4Q7BA 3UZWA 3G1RA 4XZNX 1R38A 2PDGA 4XO6A 4FAMA 2FZ9A 1S1PA 3GUGA 3UP8A 1Q5MA 2IPWA 2PFHA 4QR6A 4XK2A 1IEIA 3LBOA 2FZBA 2PDHA 5LIXX 3GHUA 1AZ2A 1AH3A 2ACSA 3MC5A 4GQGA 1GVEA 5HA7A 4YVPA 2PDWA 2R24A 2ACUA 3DN5A 4MHBA 2PDPA 2WZMA 4FZIA 4JQ3A 3DOPA 4JTRA 3CAVA 1LQAA 1EF3A 1S2CA 4JTAA 3P2VA 3R6IA 5AZ1A 1Z89A 4WRHA 4YU1A 5LIKX 1PWLA 2IQDA 4ZFCA 3LNMA 3D3FA 1X97A 2IQ0A 3QKZA 2BGSA 2DUZA 4F40A 3V36A 3CMFA 3LQGA 3LZ3A 4WDUA 4ICCX 1X96A 4JTCA 5JH1A 3LZ5A 3UGRA 2IS7A 2IKJA 2IPFA 2QXWA 1OG6A 4RPQA 1AH0A 3H4GA 4JQAA 1YE6A 3N2TA 4LBSA 5LIYX 4HBKA 2HE5A 3U2CA 4GABA 1M9HA 3Q67A 1QRQA 3GHRA 5LIUX 3UZXA 1AZ1A 2PDLA 2HV5A 1J96A 1PZ1A 3R43A 3UWEA 1S2AA 4L1XA 3UZZA 4JTDA 2PDYA 4FALA 4H8NA 1MI3A 3UFYA 1UR3M 5HNTA 5M2FX 4IJCA 4WGHA 2NVCA 1ZSXA 2PDIA 3BURA 4EXBA 3WBXA 1YE4A 2IPGA 2F38A 3RX2A 1YNQA 4XO7A 4DBUA 1ZGDA 2PF8A 3EB4A 4OTKA 4JIHA 3M0IA 3GHTA 3R94A 1T40A 4LB4A 2HDJA 2HEJA 1RY0A 3O0KA 3WCZA 4G5DA 1Q13A 4LBRA 4XZIA 3T42A 4H7CA 1VP5A 4LAZA 3S3GA 2PDNA 4EXAA 5C7HA 3EB3A 2PDUA 1SM9A 2PDXA 1S1RA 4DBSA 2DUXA 4QX4A 1US0A 4JIIX 1PZ0A 2HVNA 2BP1A 1HW6A 1C9WA 2VDGA 4Q3MA 3CAQA 1RY8A 3LD5A 4YVVA 3V35A 2PD9A 1EXBA 2INEA 3R8HA 2FZDA 3CV6A 3ONCA 4JIRA 3Q65A 1VBJA 4LB3A 4GACA 3O3RA 2ACRA 3WG6A 4AUBA 4QBXA 4GIEA 4XZLX 1AFSA 2I17A 3V0UA 1Z3NA 4YVXA 1PWMA 4ASTA 2BGQA 2FZ8A 3R7MA 2PZNA 5KETA 3R58A 4WEVX 4XZMX 1Z8AA 3FX4A 2FGBA 2PDJA 1JEZA 3LUTA 2J8TA 3LEPA 1RALA 5DANA 3COTA 1YNPA 4QXIA 1HQTA 4GQ0A 4PR4A 1MRQA 3R8GA 3CASA 3M4HA 5HNUA 2HE8A 2PDBA 4GCAA 4PUUA 1AH4A 5JH2A 4XAPA 1FRBA 1EL3A 3CV7A 5LIWX 2PDQA 3BUVA 1ADSA 1ZQ5A 2ACQA 1LWIA 4XZHA 4GA8A 3WBWA 2PDCA 4PRTA 4XVDA 1A80A 2FVLA 4L1WA 3UYIA 3FJNA 3MB9A 3GHSA 4WDXA 2C91A 3G5EA 4PUWA 3RX4A
chains in the Genus database with same CATH superfamily
3P74A 5C55A 4O1FA 2DVUA 3AIQA 1F7BA 3RIKA 5K3VA 2EGZA 5AC6A 4Y90A 4C1NB 2WHKA 1TVLA 3DBPA 3GG7A 4LAOA 3UZ5A 4GYJA 2GGEA 1PX4A 3S4TA 5F7UA 2XYLA 3NTYA 3C2OA 1H0GA 3INPA 1FP9A 1N2VA 1XYBA 4GWEA 1A3XA 1WXYA 3UWVA 4PTVA 2IKIA 4KKXA 3Q4DA 4KCUA 2QDEA 4U3CA 2RDUA 4IPPA 3JW7A 4PTXA 2YBTA 4IXHA 2PF0A 1XCFA 3U4FA 4ACYA 3QM3A 5K9DA 4DJFD 3FHQA 5C9ZA 5AYIA 3W7CA 4LUSA 3BW2A 1A5SA 3VGGA 1TIMA 3M5XA 3WH9A 4QCEA 1GVIA 4V27A 3WLTA 1UKPA 4EXQA 3WUBA 3SUVA 3T2PA 1ME8A 2ZUMA 2E77A 1UMYA 4YHEA 4GKLA 4IJRA 3MUXA 4B5WA 3A12A 3KE0A 1AL8A 3S9YA 1TJ0A 3WY1A 4HU4A 1VFMA 3VMPA 1VFTA 2G50A 2D69A 4GPNA 5HJLA 2FPYA 2Q3RA 3I68A 3SCSA 4HVXA 4JTKA 3OVPA 3VZYA 3WLLA 4G56A 1CTNA 4XD4A 3C4UA 1AH3A 3A9BA 3QOMA 1Q6DA 1QI0A 3FKRA 7XIMA 5BMXA 1TV4A 3I6TA 1J0HA 1XV8A 4KRUA 1HUVA 3P8JA 4OUEA 3P7YA 4FLOA 3WUGA 1OVDA 4NAFB 2ATMA 3W2LA 3M47A 3QHNA 1Z48A 4J7RA 3NGJA 5B7YA 4BJHA 4NZ4A 4WOZA 2WC7A 2I7GA 1JR1A 1C9DA 2QPXA 3UG5A 4HT3A 3RF9A 3VD7A 2G3JA 1H60A 4FR6A 1K77A 4GYPC 3QN3A 2GJRA 3EOOA 1E51A 1TE1A 1B4KA 3V36A 4LXFA 3UXAA 1TTQA 1A5LC 2VEPA 2QJIA 4NZ3A 1X96A 3GRIA 3QMSA 3DC8A 4NJGA 3B0XA 3ABOA 1KLZA 4UZUA 2DDXA 3WH8A 4W84A 1X38A 4RPQA 3IIXA 3I65A 3NWRA 3A64A 4R3UA 3G1DA 2GLKA 4I5UA 5AVHA 3KWSA 3M41A 4GZ7A 5A6BD 3GK0A 3TFXA 4HBKA 4QHRA 3FCPA 4UWMA 4M6QA 3BANA 1M9HA 2V67A 3KP0A 2Y5EA 3EKLA 1M3UA 1TPEA 1JL8A 5LIUX 4AWTA 3WJXA 2P53A 4JN8A 1PZ1A 3C5QA 1S2AA 4YTRA 3UZZA 1NOWA 1JZ2A 3CB8A 1NVMA 3QTPA 4WX2A 3MP5A 2G4JA 4AZIA 3HGRA 4A4AA 1DJYA 1SUXA 4CN6A 2WYSA 3VIPA 3STGA 1YE4A 4ZMGA 1I2RA 1CEOA 4QSFA 1RBOB 1M01A 3TJLA 4TMBA 1M68A 2PGEA 1GUVA 1W1YA 5G5IA 3BQ6A 1UZ4A 3LHVA 1MVYA 4FX7A 4JNYA 4A21A 3MPGA 3GXNA 3V1PA 2DZTA 1XYMA 3AHZA 4NY2A 2PZ0A 3WCZA 3T42A 1Q13A 3EMCA 3K13A 3WQ8A 2Z7GA 2E9BA 4WOQA 1V6YA 3RR4A 5AHIA 4PRWA 2ZX5A 3QLDA 4AY1A 2DUXA 1VFHA 5FSDC 1MUCA 2GDQA 3TX9A 1YEYA 1MW1A 3OHIA 2NXGA 4CVUA 2YDAA 3SY5A 2E6AA 4X9SA 1BWLA 5DX7A 2HVNA 4WLCA 4N42A 3WLPA 3B0PA 4MFEA 3SBFA 3T09A 1R2RA 3L65A 1HKKA 2WNWA 4H19A 4GZIA 4JTEA 5LA0A 4Q4PA 3RM4A 1UC5A 5DLCA 3STPA 1VYSX 4IM4A 3TJ4A 3NYDA 3UYCA 3VZXA 1WDWA 2HMCA 2W62A 1ZBCA 2EPOA 4Q4QA 1XYAA 1E43A 3M9YA 4J40A 1R9ZA 3AMLA 4I8YA 3DHDA 5EY5A 1PWMA 4AHQA 3QR0A 4XAYA 4FSAA 3R7MA 2CERA 3T40A 4Q33A 4W87A 3LK6A 3CWHA 4QROA 3EPNA 3A3HA 2J7EA 3C2YA 4MJ2A 3RO6A 5JU6A 1BRLB 3T0AA 3PM6A 2I9EA 3EOEA 1QXLA 2JEPA 1O1ZA 4CCZA 5DRCA 2PB1A 1KFEA 1KBIA 4LPCA 3M43A 1XLKA 1VEOA 1UQZA 3CL8A 1D7FA 4M7SA 1ENUA 1NP0A 3QY6A 5HWJA 3W72A 4C5YA 3ZFHA 4UTJA 4U10A 2YDRA 4GIAA 2AAMA 1VHCA 2GSHA 2J74A 4KGLA 2EPMX 1XH1A 3CUZA 2O55A 1UOKA 2E5CA 5H6HA 3RLHA 3BLIA 2X2GA 2A21A 4GA8A 1YDNA 3SECA 3MANA 3CK5A 3LGDA 4J3XA 4FIQA 3N1AA 3GB6A 1DQXA 2BY2A 1RJQA 4XTDA 2CBVA 4NQ1A 3G8EA 3WDPP 3SJNA 3GAYA 1E9LA 4XTIA 2FJUB 2WZTA 3WL0A 1W9PA 1CXIA 2E67A 3MVTA 4O28A 1CI1A 4FR1A 3V0TA 4ZTXA 1LROA 3K1DA 1K7EA 3QQWA 1FKXA 3WLRA 2V81A 1ZCCA 2PGWA 2ZICA 1XF0A 2OEJA 3OTRA 1QHZA 4GHRA 2WCGA 4INFA 4DZ5A 4LUYA 3WFLA 4ZQOA 1US2A 5JIPA 2BHUA 1VYRA 3NSMA 2ZZ6A 3U8GA 1EXPA 3UW6A 2P50A 4DUWA 2V2HA 2WCAA 4QS6A 1FQ0A 5ABTA 3MKVA 4Z1AA 1UHVA 3FFSA 5IFPA 1WDPA 2ZRYA 1XBYA 3P81A 3ZSTA 2Z1KA 3NEHA 1EJVC 1Q4NX 2YL5A 4UUIA 3QV9A 1IR1A 1R87A 1VEMA 2WHJA 1Q7MA 1HIZA 3TZFA 1N55A 3P61A 2CLIA 2ZUWA 4B5XA 1CGXA 2GGGA 2XZ9A 2G0WA 2Y8UA 2G96A 3TW7A 4OOZA 4NZCA 1EBGA 3K4AA 3IVSA 8XIMA 4KIEA 3QJAA 3W7IA 2OPJA 4JTHA 1ONXA 4Q7BA 1EUAA 1V6XA 3HGJA 1XIBA 3ANUA 4D9PA 3CTLA 2Y24A 5FF3A 5GJMA 3N2BA 4TUFA 3W88A 4NZ5A 1IXQA 3QSTA 1AZ2A 2CU0A 4QITA 4XZBA 4EF8A 2FLIA 3RMEA 2Z1SA 2INFA 1CT5A 4L65A 4M8UA 1FX6A 1Q2SA 1QUMA 1E0TA 4DLFA 5TNVA 1LJYA 1GQLA 4LF2A 3AYSA 4WR3A 1LQAA 4HCLA 1D8CA 4ATLA 1KBJA 3S2JA 1HVQA 4W9TA 2ZRWA 3HPAA 1TTIA 1R3WA 4GG9A 1ZLPA 4AVNA 1TMHA 5EBUA 2BVYA 3W00A 1VHNA 1CB7B 1XM3A 1XFCA 2PGRA 3B0YA 3W2KA 3B40A 4J3ZA 1W1TA 1XICA 3S9ZA 3LZ5A 2EO7A 2H8ZA 1D8WA 1T0OA 3GXPA 1RV8A 3SUTA 2WKGA 3NGFA 5LSMA 3ZVIA 4D1JA 4PMQA 5HINA 4MPKA 4JTFA 4MAVA 1S38A 1AJ2A 1YE6A 5G4WA 3CUIA 4ALDA 5HNRA 5DO8A 3RITA 4XD6A 4HZ7A 4ZTYA 2YZRA 3HPZA 3SQMA 2RGMA 1XRVA 4Y9OA 2WB5A 2VD9A 2VM8A 3OBAA 2CBUA 5D4YA 3CEPA 3HV8A 3EMQA 1VZWA 3A4JA 5IHSA 4C6NA 1AODA 6TAAA 2V9DA 3ZQ9A 5SWUA 4A2SA 4NYYA 4PMUA 2XSBA 1ZSXA 2PDIA 4EXBA 4RXFA 1Q2RA 2F38A 2O7QA 2XVPA 3L4UA 4S3CA 1FWEC 1KCKA 2FVKA 3WQVA 3V5OA 2YA1A 3CWNA 1C8VA 3DC0A 5D33A 4B9ZA 4M24A 4FXJA 3KTCA 3A9IA 3CGTA 3WH7A 2FB2A 3M0IA 1TWZA 3ALFA 3K8KA 4IIDA 1FWCC 1K4HA 4K68A 2H6RA 2FZMA 4FP1A 1A5BA 4NP7A 4YJ5A 2UV8G 1GOMA 1M7JA 2MNRA 2FPTA 5HR7A 2QNEA 2WQDA 3L4TA 4TVCA 4OECA 4X60A 1EJSC 4AZ5A 4QSHA 1EJXC 3GU1A 2ODOA 1XRFA 3A21A 3NQMA 4ZXLA 3K8MA 3ES7A 1Q6FA 1XSIA 1MQPA 3PZQA 4K7VA 1CGTA 4O1CA 1Y7VA 2B4GA 2QGYA 1HJXA 1VH7A 1VR6A 2CHNA 2BODX 3C8FA 4HK7A 4RE4A 2XGIA 2WV8A 4M6PA 5DFAA 1S5NA 1S3HA 1QPNA 3WG6A 3VDGA 2P88A 1PB0A 1W2PA 5BYWA 1ISYA 2W79A 4AU0A 3W85A 2D0FA 3C6CA 1DJGA 4NRRA 2FZ8A 4GYFA 1QNQA 1EEXA 3AJXA 3T7VA 4Q32A 7CGTA 1JUBA 4H7VA 3TXZA 1F07A 3DKJA 2YFNA 3C56A 3S9IA 3PFMA 3WDJA 4UTWA 1YQ2A 3KS6A 4O19A 2OZ8A 3ARTA 4LW7A 1K9TA 3UA3A 3E2SA 3BZJA 4IWWA 3MO7A 3GZ3A 4HB7A 1W9UA 3UCCA 1X39A 3W1NA 2Z0IA 5F4SA 1MEIA 4NX5A 2Y5SA 1WDDA 1ADDA 1KXVA 2C14A 3PULA 5AHLA 3W81A 1QPRA 4MKNA 4NJHA 3CV7A 4C6FA 3UR8A 1LYXA 4M29A 1EJTC 5T91A 5BOEA 1E6RA 4YTUA 1O5KA 4L4MA 4CU8A 2E5BA 3W9ZA 3DEQA 3O6CA 3DYPA 3LSBA 1V8EA 4A6GA 1E6NA 3W82A 3ITTA 4MWAE 2EPNA 1G7VA 3ZLFA 4TTUA 4DQWA 2RGLA 3PUDA 2CLPA 2FFCA 2J47A 3E5PA 2EXOA 1RPKA 3TE9A 1H5VA 4TV6A 1CDGA 5AFDA 4XD3A 3T0CA 3UG8A 1SSGA 4W4QA 2YCKX 3ARPA 3ONBA 3ZWSA 4RNHA 2CZFA 2NQJA 3H7UA 4EF9A 4YLWA 3LQLA 2PA6A 3MSGA 4HA0A 3M5ZA 1RP8A 2PD5A 3V0SA 4NHVA 1POKA 3TQVA 2BMBA 3U7VA 2XVLA 4LV4A 3CC1A 3AXMA 2AGTA 3ITLA 1ECEA 1PDYA 3OA5A 3Q37A 1JDAA 1MZRA 5J04A 2MANA 4KESA 4C6PA 3FGCA 1QOQA 2ZA2A 3GFYA 4IIGA 4IPIA 1JF5A 2YXOA 1X8FA 3WQDA 1ALDA 1V3KA 1QOXA 3RRAA 5AOUA 4H6KA 5D38A 1SO4A 2VFGA 1KM4A 1LWHA 2ZC8A 4IMGA 4V2XA 1WAWA 3WEOA 2ZX6A 2XSXA 1EF2A 1VB9A 3UJSA 2WMGA 3G1RA 1XIIA 3I7SA 2ZVRA 3NO3A 2VVSA 2BHYA 3WLNA 3W7MA 1W3HA 4JHMA 4WXZA 3ITYA 1KM0A 2XN1A 3T0BA 5B80A 2VRQA 1KNWA 4QG9A 4MF4A 3VPLA 4XK2A 3L67A 5FAJA 1E56A 3USZA 1P0EA 1ONWA 2YL9A 3U7BA 1AW5A 2OZ3A 3GFXA 5I3DA 1WNOA 1ZHAA 4B91A 3LHWA 3AYTA 4HA1A 2C8NA 3GDTA 4HYRA 4WKFA 3MI2A 2GWNA 3QR1A 1QI4A 3AHYA 1AL7A 4ZO6A 4C6BA 5EMLA 2DZBA 1S5MA 2X2YA 1TFVA 3ZT7A 4WIWA 4JTAA 4H8VA 2E0PA 4JFSA 3ZVHB 4MB1A 5EA9A 1Z89A 2WPBA 3SGGA 4AX6A 2PLKA 4IQJA 4YCOA 3RK8A 3CYJA 3PNZA 1CX9A 4FF7A 3W28A 2VFFA 5A3HA 3PHAA 1Y8BA 2PC4A 4UTHA 3VM7A 3PWIA 2PPGA 4LCSA 3H4WA 3KX6A 2G5WA 1M7XA 2JQXA 3VGEA 3GAKA 1B3VA 5FSEC 1F3EA 3JZUA 4JQAA 2VOTA 2HK1A 4KERA 4XSLA 2GOUA 2Y85A 3KW3A 3PZIA 4XAZA 3IARA 1S46A 2BXZA 3G6MA 3TYCA 3HGOA 3UESA 1S2UA 4CGTA 5AHEA 3LMYA 3O1NA 1NWSA 1L8NA 4V1XA 4B3LA 2YCLA 3TH6A 4HQVA 2D2GA 5G2WA 4Z1DA 3LY0A 3W7DA 3LLFA 5MHBA 3CZJA 3B0UX 4D2JA 4ZEPA 2NVCA 3H54A 5EU9A 1NWRA 1UPPA 4NZ1A 1WX0A 2F6KA 3EZ4A 2VCCA 2G3IA 3EDDA 2A3BA 2ZUNA 2XFYA 1DHKA 4IT1A 3U3HA 3W83A 4JN6A 3LLXA 3O6YX 1RD5A 1PHQA 1HO1A 4RE2A 1G01A 4ZOAA 3B4UA 2QCHA 4DZHA 1Q6CA 2J8FA 1YW1A 2HDJA 1W2VA 2VX6A 1SZFA 1I8JA 5DRIA 5FJUA 3VM5A 1X6UA 3BSGA 5G2HA 5I3HA 3B06A 4PTMA 1JCNA 1TMLA 4KCTA 1B3YA 3ES8A 2PDUA 2ZZ5A 2J7HA 5KINA 2O9PA 3UD6A 3MQTA 3U48A 4WSKA 2B0MA 5BXTA 4WKHA 4FOUA 2D2HA 4GI6A 3WH5A 3P6LA 5C2XA 4XKMA 1OD0A 5H2ZA 2XH4A 2CLKA 4L4PA 1J5TA 4DPPA 3OB8A 4DB7A 3ID7A 2WVVA 4DWSA 4JKMA 3WDRA 1VFSA 2WHMA 3UCQA 4KBXA 4XZ9A 2NXHA 3WNOA 1K7FA 2DFAA 1ZPTA 1DV7A 3I4EA 3B03A 4GXMA 3TAKA 1KW1A 2XH7A 4JIQA 2X8RA 1OEPA 2VQTA 2ZBTA 3O05A 4UB9A 3FIGA 2YIHA 4TQTA 5ECUA 1OFEA 3GFZA 4Y9PA 1OX6A 3IIOA 4PFHA 2V63A 3WLOA 1ICQA 2VRKA 5KETA 3PJUA 4QFUA 3EWXA 1XISA 2PTXA 1A5UA 1PO9A 3FX4A 4ORMA 1WDSA 7TIMA 3BCDA 4M5PA 4MDPA 1F3WA 2VI0A 3VA8A 5TIMA 2RAGA 3MHUA 4ADTA 3FVMA 4TX9A 2GQ8A 1OB0A 3M6DA 4A3YA 2X41A 1YBQB 1XPGA 3WQOA 2SFPA 4QNWA 4E0CA 2O0TA 1CLXA 2E4TA 4MNJA 1TMQA 5D30A 3VVGA 1GHRA 3A3WA 2YCEA 1LLWA 2IMRA 3AIUA 1TQJA 4I9MA 2PDQA 1QDSA 2C79A 4N2YA 4K8GA 3PBWA 3II1A 1J6PA 2FVLA 2YB1A 3GHSA 2CLOA 1RH9A 4UTKA 3L68A 3OLEA 1TSIA 4GY0A 2GOKA 3D46A 2VGIA 1R2SA 3G18A 3H23A 1PYFA 3DFQA 3BJSA 2GUUA 5CXPA 2NWRA 2O4MA 3UBPC 1FH9A 1XRTA 3F2CA 4IQDA 2DORA 3H2AA 3L5MA 3NQ8A 3MZNA 3A47A 4JQ2A 1JYVA 3BSHA 1OINA 4PMJA 4IPNB 1PTGA 1UJPA 3W0KA 3FSUA 4BY3A 5LA1A 4C1NA 4H9YA 2WCSA 2INZA 1BYCA 4RDWA 2XWDA 1W3KA 1K8CA 1E6XM 1BXBA 4AHOA 4AF0B 3UXKA 4PMOA 4L61A 4OBTA 4B5SA 4DRSA 4GUFA 3WMBA 3TOPA 3KBVA 5I3KA 2I16A 1QNVA 4C60A 5CGTA 3PZMA 2PGFA 4AY8A 3S5NA 1I0BA 3TSMA 3R1ZA 4IGNA 3VOJA 3MMTA 3KBMA 3WF3A 3DG7A 4CQCA 8A3HA 2QJHA 2A3LA 2Y5JA 1A5AA 3W86A 1OC6A 3KRUA 3UJRA 2HRWA 3H70A 4O53A 3LM7A 5TQLA 4MKVA 5DN1A 1XLIA 3IK4A 3VNYA 3G1HA 4DO5A 3QVQA 4GNJA 1LP6A 3GXIA 4AC1X 2AL2B 1WV2A 5IDZA 3TJXA 2B7QA 2DZVA 1EYWA 1B5TA 1GVEA 4M7TA 2WNNA 4PH6A 1O1HA 2E9MA 4MHBA 2BZNA 2W4XA 3N3TA 5LA2A 4JQ3A 5K4XA 1TA3B 1DJNA 1CGVA 2PTDA 3CAVA 1TREA 3FAWA 5BW6A 2D0GA 5CC5A 3SB0A 4HA3A 3A4AA 1UPMB 3NAVA 4FS9A 1F6PA 1HF6A 2E8YA 3W6LA 4BCEA 3SCTA 3STEA 4NAFA 4UQEA 4CEXC 2CESA 3VABA 4X0VA 2HPMA 4UOZA 1GCYA 1TUFA 4KEUA 1R5YA 2DQXA 2VFDA 2AOSA 3GNXA 3RLGA 2NZLA 3TAOA 2QXWA 5FAGA 3T55A 2X0HA 4JY9A 1AK5A 4Q4SA 5FF0A 3RILA 3SY8A 3CUGA 1VIZA 3AHVA 1F6KA 4YTSA 4PEEA 2VKZG 4FNUA 3FSTA 1UD5A 3DFPA 5G1MA 2JKAA 1MRAA 4GABA 4WSHA 1KV8A 3R25A 1JDEA 3FW6A 3L4VA 4C6DA 2VUYA 1Q6OA 3IRSA 3MMUA 1QRQA 2FHBA 2WJEA 1FWFC 3EDEA 4H4IA 1KTBA 1XYFA 3HZ3A 1UMLA 3LPPA 4A8NA 4FLQA 1RLDA 3DFOA 5A2AA 3OGVA 1B3OA 4HPXA 2XH2A 1Q6QA 2NVAA 2BSLA 1TG7A 4NNCA 4I7WA 3GDRA 1QFEA 1ONRA 4U33A 4AQLA 1Z32X 5D9PA 3ZT5A 5CAHA 5FCZA 1PHWA 2PS2A 4PUNA 1LBLA 1UKTA 4IFKB 2QUVA 4Y9MA 3GDMA 4EP8C 1JXJA 2YL6A 1S5WA 2EF9A 1DJIA 2C1HA 1XKJA 3IK2A 2WQPA 5EYWA 4W5ZA 4OWGA 1KO0A 3L0NA 2CIPA 3CJPA 4H2HA 4H7CA 3PK7A 4CUCA 1VBUA 3N4AA 4S3BA 2VVNA 1DXFA 3GC4A 1T99A 1AUSL 4OJYA 1Y5XA 1EH9A 3MZ2A 5FEXA 1VLIA 4ZOEA 5CPNA 3PANA 4MAZA 1TB3A 3SQLA 4I9JA 1UWRA 1MUWA 5BOOA 1US0A 4OT7A 3QQ1A 1PZ0A 4BKNA 2QYGA 1KFJA 3ATZA 3NOYA 4PA8A 2V3EA 4JX4A 3R10A 3CAQA 1EO7A 3WQPA 2X40A 2A7NA 4AZCB 4YVVA 1I4NA 3VGHA 3WQFA 1DWHM 3MHGA 2WXDM 1HN1A 3DGBA 1L6SA 4JIRA 2FYMA 1UD2A 2ACRA 1HZYA 4HSNA 3G1YA 4DEFA 1TRIA 1XIDA 1V7AA 4H8HA 1HNYA 4XZLX 1AFSA 2I17A 1UWAA 3QV8A 3T2OA 3MJYA 3W70A 4UTUA 3GE7A 1A0DA 3W7HA 5ECVA 3FYPA 1XLHA 2GJLA 3OHMB 3W76A 3WJYA 3H8AA 3HU7A 3MUY1 1Z8AA 4WY0B 4MY1A 3AQUA 3A23A 4QNEA 4W93A 3RLUA 5J5DA 3WQ5A 3RHGA 3J7HA 1NQKA 5LGXA 1K9EA 2Q6ZA 1KKOA 3LBMA 5KZEA 1W3JA 2DJXA 1J11A 4IQEA 4CU7A 1BRLA 1FWNA 2C13A 3UR2A 1Y65A 1GONA 1QW9A 2DT2A 4AY7A 4ZVJA 3TYBA 4JGDA 3CHEA 4JTGA 3KOYA 2HQAA 2RFGA 4GJIA 5BNKA 3CHFA 2X1RA 2YSWA 5LIWX 2ZYFA 1RCOB 4K36A 1UJQA 1PZ2A 3UR7A 4H8UA 3WBWA 1A53A 4PRTA 3T0DA 4X0NA 1PDZA 4MLRA 2EKGA 2WBGA 4HHPA 3AXHA 4FOJA 4UTTA 5BOFA 3CV2A 3OJGA 3LRLA 1FWWA 5D9OA 4CNNA 2BVTA 1OX4B 2DV0A 3ARQA 1SO6A 2PODA 3QW3A 1DIEA 3GDLA 4DBWA 3VOFA 4FNQA 1V02E 3RAOA 3W23A 8TIMA 3T1GA 1Q66A 3WBYA 3MWAA 1WE5A 2RDXA 4CCDA 1I60A 1XIJA 2WVSA 1NDVA 1OG0A 4PZVA 1DIKA 1IXOA 4UFIA 1OWQA 1GTHA 2OZ0A 2CYGA 1E55A 3R12A 4HP5A 5LXEA 2P0OA 1GVQA 1PUDA 3PSVA 3OIXA 1HKIA 1K6AA 4HN4A 2WOQA 1HKWA 4I5RA 2HBXA 3NIYA 4IP5A 5C8BB 1ZB5A 3E3HA 5CGQA 3C0JA 1R8LA 1PCKA 1EP2A 3EAUA 4JTSA 5HWNA 3WLJA 4GMEA 1U2YA 5IXEA 4S3EA 3RNDA 5K9CA 2CNCA 1H7WA 3EX2A 5EMMA 4IF2A 1GG0A 3WIJA 1KLYA 1M41A 3ANVA 1OGSA 4H9UA 5ABFB 2P0IA 3CQIA 1FKWA 3UZJA 1W5PA 5CPOA 4G7EB 3LENA 4IMAA 1IXNA 2HNHA 1HL8A 1EJWC 3QMRA 3B3DA 4JTUA 4CCEA 4KPLA 4CQDA 1DE5A 3RCYA 3N25A 4S3DA 3WNKA 4WSJA 1ADOA 4UBPC 4O50A 2CBJA 3L2LA 3W7OA 1K8ZA 1JRBA 4FI4A 3KBSA 3AZSA 5FJPA 3UGVA 2EKCA 1ISWA 5F1VA 2Y63A 3L5AA 4J28A 1VFLA 1WZLA 3LTPA 3MJMA 1ZBKA 2RJGA 3IUHA 3UJFA 3TMLA 4AIOA 4KWOA 1X7IA 4D6GA 3TYZA 1DTNA 1XIFA 4GQGA 1V51A 4GC4A 1BTCA 3KL3A 3PFRA 3CLWA 4UOQA 5CZJA 1XG3A 1SZEA 3NO1A 3APGA 3C3NA 3DN5A 4NSBA 1ZRQA 2PDPA 3GC2A 4FOKA 2NLIA 3SURA 2A7RA 1IF2A 3SDOA 4YNGA 1H7XA 1THFD 2R82A 3BAXA 4NIRA 3P2VA 1IEVA 3DHUA 4E4UA 4WRHA 3MUCA 3VUSA 4ZSUA 1GYNA 3SO7A 4QTGA 4PMNA 1NY1A 4UFJA 3CQ0A 4IUGA 3SSJA 1N7KA 1LT7A 1W8GA 4ICCX 5D2VA 4ICMA 2DT0A 2ZRXA 1JAKA 1TR1A 1W9DM 3MA8A 3RO8A 1SZGA 2DPEA 1OG6A 4DWSC 4ZOBA 1PTDA 3NO5A 2BOFX 1GVYA 4AVFA 1MO0A 3RU6A 4UFKA 4J27A 1DP0A 4Z17A 2X42A 3N34A 2NLYA 3GVVA 2VGGA 3FVDA 3AISA 3B9OA 4JX5A 3DCPA 4R7WA 2PWFA 3LPOA 1A0EA 2PDLA 5K2ZA 1JG9A 3EPOA 2WLYA 4JTDA 2V5LA 1HJWA 1JCXA 4UFHA 3WLKX 3S46A 4BFAA 3E96A 1ML1A 1UBSA 1VKFA 4J3WA 3VDHA 3E9AA 3BURA 4PODA 4AIBA 2ZE3A 4LS1A 5E0CA 3B8IA 5LNVA 1I9CB 4GX8A 5HMEA 4L64A 1GNXA 3RX2A 1DJZA 3RFAA 1FVPA 2WM0A 3P8IA 1JQVA 4ZO7A 3M0YA 3SCWA 3LHYA 1UIOA 1UIPA 3EDKA 4P8VA 3PZOA 4IISA 1J0YA 1I2PA 1QMLA 1W5OA 3DI1A 3AUOA 1NTHA 3U2OA 3E0VA 3OG2A 4LB4A 1YPIA 4JCLA 4P7NA 2GJXB 3MW7A 3O0KA 1ICSA 3S3GA 4OIFA 2J7BA 4K3ZA 4NJJA 3KCOA 3UF9A 1W9BM 4NJIA 2ZZ7A 2V82A 1P0KA 1NM9A 2JGYA 3F4VA 1TV7A 1BG4A 5HMDA 3I10A 4NU7A 1V77A 3SRHA 4FNRA 1MWOA 3PUEA 4W8LA 1HW6A 1NDYA 1DE6A 4FEZA 2HS8A 4H3DA 1XINA 4H1ZA 4W85A 3DIPA 2OQLA 4LX4A 2QVHA 1MEWA 1MW2A 4OVXA 4LT9A 3AIBA 3SFKA 2OT1A 1JAEA 4RZ5A 1I1XA 2XG9A 4ACZB 1K8YA 2HNEA 1ZFJA 2BGQA 3Q58A 1W17A 3S1VA 2XFWA 3EWZA 3UVIA 3KRZA 4WEVX 1H41A 3CPRA 4AZ7A 2VEFA 4WXYA 3APYA 3UPMA 2PTZA 3GO2A 1K1DA 1UW9A 4HPJA 4LJ3A 1AQFA 5C9UA 4YYCA 4GQ0A 5LXXA 1EP3A 3OEXA 4H9MA 4KWUA 1BWVA 1JZ5A 4AXKA 1YXDA 3BC9A 4MUPA 4J35A 1R2TA 3LCLA 5M03A 2PDBA 1ICPA 1M65A 3E6EA 4P7OA 4JEJA 4N9BA 5E5CA 3BAWA 1DQUA 3IUIA 4LRSA 2V38A 1F76A 1LWIA 4PUDA 3WF4A 1W37A 3TTYA 1T7LA 2E68A 5CPSA 1A80A 5AKQA 5C5YA 1CXEA 3N6HA 3EEGA 2QAPA 3KRSA 1PKMA 2G3FA 2OEKA 5FI8A 1KM1A 6CGTA 4UMCA 1E4MM 2GGHA 1BPLB 4G1NA 2CKSA 3THAA 3W7QA 4NNBA 4L6HA 5AC8A 4LAUA 2V5KA 2WNQA 1BVNP 2V3FA 5ABEA 4A8LA 4L7ZA 3HBLA 1Q6LA 1DJWA 1KFKA 1IZKA 2HSAA 3WDIA 2ABAA 1E9YB 1GYLA 2JE8A 3BV7A 2C19A 4HYWA 3VOGA 3NL6A 5U7SA 4PCNA 3BLEA 2YA2A 2GVLA 2V2CA 1B1YA 2UWFA 2XHYA 1IWAA 3MUIA 2PWGA 4JYEA 3F1QA 4I9AA 4C7FA 4P5UA 3REQA 1FXQA 2BASA 2E6FA 5CG0A 1V0KA 2Y7EA 1UA3A 2BS9A 3H55A 1OADA 1MFUA 1AD4A 2OO0A 4WCJA 4UR7A 4FPSA 3WJZA 1GTEA 1OFDA 2WLZA 2QDGA 1ODZA 1OGGA 1J0JA 3WZ0E 1RK5A 4MADA 3GIPA 4GGBA 5DBUA 5EBAA 3S1UA 1S2WA 1MDLA 5I07A 3V18A 4CNPA 1OZQA 1V3MA 3DFNA 4K38A 3WUFA 1SJAA 4Y7EA 4EVZA 5DY3A 3BV4A 3WFZA 3UXLA 2FGZA 1XBVA 5C9RA 4IIFA 3GH5A 4A35A 3MI6A 1V08A 1F8MA 2FJKA 2H9AB 3UU0A 1JCTA 1EWEA 4GE8A 1TPB1 5EL1A 4AX7A 3XIMA 3TVAA 1Q85A 4MPQA 4WF7A 3HPXA 1E71M 2DT3A 3F5KA 3N18A 3NM3A 2RDTA 3H53A 3IIVA 2EQDA 4BQ3A 3CWOX 1QR7A 4GYPA 2OZTA 4LUJA 2NWSA 3IJ6A 4WK9A 1PAMA 2XVKA 2EHHA 2R94A 1D9EA 2PU1A 2Y8KA 3G1SA 4HOZA 3L5LA 3EWDA 4NXSA 4R5EA 3BGGA 4RDYA 4F0MA 1JRCA 1SW7A 3FYYA 2IS7A 5G1YA 3VNJA 2PLCA 4YHGA 3ZVHA 4JFUA 5JUVA 2WPGA 2YXGA 3GYCA 1RCXB 4QG8A 3EKZA 2BXYA 2GVJA 1UWQA 3VDCA 1EDQA 3N2TA 4U28A 4I7UA 3KZPA 2LLEA 3TP4A 4GC3A 1A3WA 4GCXA 3K2GA 2Y7FA 4JNMA 2FQIA 1EFZA 3ZT6A 4EIVA 4UR9A 1V3IA 4S3AA 3WMCA 1W1PA 1TWSA 4ECLA 3MUAA 1EIBA 2FZNA 3VOIA 3ZXWA 3DESA 1W5QA 4P2VA 1F8IA 1XHGA 1GPWA 4FALA 3TC6A 3MP4A 2V5CA 4I7VA 1GOKA 3UCDA 1BGGA 4D6DA 3TJIA 3R0UA 3VE9A 2DUAA 2QCFA 1SYTA 2GGJA 3B4YA 2EJ1A 2J66A 2CWXA 1E4NA 1N8FA 4D8ZA 1PKLA 1C3FA 1YNQA 4XO7A 1EHAA 5LGZA 3PPCA 2WSYA 5BWFA 5KZMA 3I3BA 5FACA 3NDYA 4EWJA 2ZZ2A 3MSYA 2WJDA 3GHTA 1E73M 1HKJA 1WAUA 1ITQA 2PRLA 5DMLA 1BXNA 4AIUA 4HNLA 1DJQA 3BVJA 3GNPA 3ZR6A 1Z42A 2J77A 5HMSA 1V3LA 4ADUA 1ZAIA 3LGEA 4REQA 1SM9A 3CH9A 4XQ6A 2XIBA 2ZXBA 1QPQA 1TPDA 1U83A 3VNKA 1XX1A 1AJZA 3O7UA 2XFFA 4E8DA 3W87A 1J9YA 1K6WA 2WHLA 4H7ZA 3U9IA 1LCOA 3W29A 2CLLA 4JHOA 4KGJA 2FIQA 3NA8A 4N7QA 3LERA 2GDVA 1TV2A 4AMCA 4QJ5B 2JF6A 3R4IA 4GACA 4TV5A 1R9YA 1UR9A 1EGMA 1CLKA 5FESA 2B31A 2FHCA 3ZJ7A 3T8QA 3W73A 1K3UA 3BH4A 3W1XA 1MSSA 3TV8A 2X1TA 1IGSA 3UT0A 5F4XA 3T0TA 4KT2A 2Y88A 2POZA 4IL2A 1RQEA 1RD6A 1WKFA 3EWWA 5A5WA 4PCFA 1P6CA 1OX5A 4AZHA 3FA4A 1UR1A 4GNKB 1P6BA 3G1AA 4LVGA 5HQMA 1SMDA 1ZJAA 3TU9A 1P7TB 3KCJA 1VC4A 3B9EA 1FWBC 3PUGA 1HQTA 3PNUA 1DBTA 3CPUA 4B2DA 4M0XA 3VI2A 3HF3A 3QY8A 4RXGA 4B90A 2V69A 1KD0A 3SUUA 4TMCA 2WMIB 1VENA 3Q45A 4K8HA 2ZIDA 4RNIA 4PUUA 5GJPA 1TPH1 4RL3A 1AW1A 4ORIA 4CNTA 3BUVA 4OV4A 4OBSA 1YBQA 3OGSA 1GQKA 1DIOA 1JPMA 1KCXA 1SR0A 3QHMA 4MTVA 3FJNA 2GYIA 4LVDA 3H26A 5M1TA 2VJXA 4GIRA 4ZOCA 1TX0A 5CZTA 1I2NA 2ZZ4A 1HXJA 4JL1A 4ROPA 2WMHA 1BF6A 3ARVA 3FLUA 3TK7A 2OYMA 4C7GA 4M56A 1WZKA 1SU5A 1UKSA 1VRDA 3FOKA 3O6AA 1H2JA 4UFLA 4I5XA 1TJRA 4UXDA 3MYOA 4Y9AA 4XG1A 2ALRA 4AC7C 1NFGA 3ALGA 3AICA 2Q3OA 5PTDA 3GY1A 2NQ9A 3W4RA 3W1TA 3TTSA 2W9MA 2PWDA 3IV3A 5MKGB 3AMGA 3DAQA 1K9DA 4WDTA 5A94A 3IACA 5CKSA 4MUZA 1WKDA 3IJIA 1F05A 3QHOA 2W63A 2OXNA 4CCCA 2IKHA 1WXZA 2ZZ1A 2Q8XA 3ICJA 4QJ4B 5CEWA 2JKEA 2QW5A 3PN8A 2DSWA 2QDDA 3SIZA 3LCXA 1QW7A 3QV6A 1B9BA 4W7UA 1HJQA 1QHPA 4QP0A 1GVRA 3NQAA 1B0IA 1PX3A 4AF0A 3AC0A 3AS3A 1GZ1A 2QJMA 3NPWA 3HG5A 1ME7A 1CWYA 2Y70A 3DECA 4DY1A 2BOGX 2VWTA 3TFCA 3BLFA 1IHIA 4C65A 5EMJA 3ENLA 3RM8A 1FWHC 3GU9A 4UMBA 4FB7A 3IGXA 1S1PA 1W3TA 3OYZA 3M0LA 1YTKA 4LUIA 1YX1A 3H7VA 5CPLA 1PVNA 2Y7DA 2VR5A 3AZRA 4QAWA 5BU9A 3LTSA 2ACSA 3GBDA 6REQB 3CLMA 3JVAA 3PZNA 4O54A 5HA7A 4R33A 1L6WA 2PDWA 1TZZA 2E25A 3ARYA 2QS8A 3HQPA 3M7WA 3L0GA 4YTTA 1JJKA 3TOYA 1RQHA 5FF2A 4CD7A 3TYEA 5M17A 4B9YA 1V7YA 3BOLA 5HK4A 2JF7A 4LAKA 5HANA 2AL2A 1S2CA 4J9JA 2VNCA 4LYQA 4NVTA 2J4GA 5AZ1A 5G4HC 1YHTA 4ZSTA 1Z41A 3VO0A 2IQ0A 1T6MA 2BGSA 2FTYA 3I3DA 4CQ8A 4B4HA 4JICA 2OKOA 4FHAA 1G7UA 3OZOA 1TA3A 2E1WA 2NSOA 1KGXA 3QKEA 3KDNA 3KVMA 5IDIA 3RG6A 4NAEB 5E6ZA 3C2RA 3IJQA 1JGMA 4A3QA 3GNRA 4XSMA 4LUTA 2XISA 3UWUA 1GQIA 5KITA 3GUWA 3MP3A 1JCJA 3OLIA 4EANA 3IV8A 3UQNA 4D71A 3N13A 3TWBA 2PCQA 1E9ZB 3HV9A 1P5BA 5HMFA 1HVXA 5FEZA 4PTDA 3NYZA 4WVXA 1J79A 3KEHA 3KOZA 3OA3A 1ZENA 2V5DA 2PDYA 1XKYA 5L6UA 1SW0A 4HZMA 1KM3A 1BQCA 3TC7A 4IJCA 3KLKA 2YW3A 4IMFA 1JYXA 3F03K 1POJA 4NILA 2DZPA 3NEVA 1EHNA 4HKPA 3LU2A 3PB2A 4FIRA 4HSOA 3LRKA 4PMDA 1FWAC 1FWRA 4IIHA 3NG3A 3CAWA 4O11A 4QG6A 5T9CE 4M82A 4QLJA 1AQMA 3P0WA 3ZS4A 4XUGA 3V75A 1FHVA 5K7JA 2D22A 4UQBA 3K4DA 2NUXA 5DMNA 1W1IE 1W1VA 4IFKA 3B9DA 4NL1A 3PBUA 4P7QA 4IL0A 1I45A 1NOUA 2VYOA 1XIEA 2QCEA 4MZ8A 1E6PA 3ZR4A 1KM5A 2BY0A 1WKEA 3BJFA 2O9RA 4JIIX 2PWUA 3GTFA 4WD0A 3LNPA 3VYLA 1ISZA 1LRNA 3PPFA 2OELA 2J9ZA 3CQHA 3V35A 5FEWA 1P0DA 3SCRA 3W1AA 4BZYA 3WQGA 1W3LA 2WWDA 2CKRA 3G6LA 2VX7A 4LB3A 4X2PA 4AIEA 4UQCA 4AUBA 3LX9A 1OC5A 5HBFA 2PRMA 3P14A 4IFOA 4AZCA 2A6LA 4ERGA 5HR6A 4TOQA 4ENLA 1QNOA 1F3TA 4PSPA 4PUKA 4GUJA 2B7OA 3NL3A 3AROA 2VR2A 3S2CA 3SN0A 2F6UA 2A3CA 3IGHX 4G9PA 5AECA 2CZ5A 2NT1A 3T08A 1R6WA 2WKLA 3UG3A 4Q4RA 1WKYA 2GQ3A 5DMYA 3TSDA 5CJ5A 3H2CA 1JNDA 3R89A 4B3ZA 1UUQA 3WFAA 3BMVA 1SJCA 4G6CA 4HNNA 3HO8A 4B4FA 4O8RA 3CUJA 4WY0A 3W7JA 1QVBA 3FK4A 1GQJA 3W7KA 4WQ6A 2HE8A 2JGQA 5A6JA 1I1WA 1KGWA 1YIXA 3QPYA 1SJBA 2P3EA 1E0UA 3NQ7A 3CU2A 2R91A 1LL7A 2YBUA 3BAJA 2QGHA 3NSXA 5CZKA 1F61A 1W32A 4JBRA 4ZQNA 1Q6RA 4ATWA 3WEZA 7TAAA 4F79A 5BXPA 3S0CA 2BNJA 4XV0A 4XVDA 3V4BA 4NI8A 1E6QM 3VNLA 3WLHA 1XIHA 4JIEA 1L2QA 2REQB 3MCNA 1IZJA 8RUCA 4LH8A 4RZ6A 4Q4MA 3QBUA 4UCFA 2CLHA 3K5XA 3BE7A 2BHZA 3ARZA 1Q6GA 6A3HA 3O8AA 4H41A 4R9OA 4GRSA 1LBFA 3SRKA 5BU6A 3LOTA 4JFWA 1NU5A 3WF2A 3CIVA 2HK0A 1TPFA 4WY0F 4JS3A 1FWSA 4F0HA 3ZLHA 1GZJA 3LHZA 4HPNA 4CKQA 3T05A 3AZTA 5IBXC 3S2LA 1OX4A 4C6KA 3BCJA 2P76A 2WSPA 1DL3A 3RLVA 4HMNA 4AAJA 1VJSA 4MFDA 1VGAA 1VFUA 1NH6A 3OODA 3VD5A 4FA3A 1Q6EA 4L56A 2E8ZA 1A5CA 2XSAA 1ITXA 2C16A 1IEQA 4OE7A 1GHSA 4JEQA 3W6YA 2OMAA 3PZGA 4HTYA 3B05A 3AYVA 3EOSA 4IG2B 2W61A 3KRBA 3BGAA 1XLLA 1XYLA 1B3ZA 3ARXA 4R85A 1Q8AA 3NQEA 1ZP4A 1M7PA 4Z1BA 3W7NA 2C71A 3I3EA 1Q45A 2J88A 3OZMA 2ZXDA 1XLMA 1XS2A 1EC7A 4MYAA 4IGSA 3WJWA 5AYBA 1XW8A 4PB5A 2VEKA 4NKCA 4A22A 1EJUC 1CXKA 3NPUA 2XGBA 1UA7A 1KBLA 1HT6A 3MMWA 3LV6A 1FDZA 3VIIA 1M03A 4WJEA 4JDBA 1UD8A 3GW0A 2F8QA 5FEPA 1GEQA 1G4TA 4N4PA 4Z0JA 1O94A 3TNOA 3KM8A 4EOUA 1WB0A 2PDGA 5ABFA 1J6OA 3LPGA 4G7FA 5CGMA 2F84A 4V33A 3E49A 4G7EA 1VRXA 1TR9A 3JU2A 1IEIA 2ANUA 2FZBA 5A8MA 4JAWA 1W9VA 4AB4A 2J9YA 4HK6A 5HDRA 1W91A 1TX2A 1JZ4A 1NP2A 4QRNA 2ACUA 1DTUA 2ZDRA 1OT2A 4BS0A 3CEUA 5A8GA 4G8TA 3NQBA 1YMYA 2Q8ZA 3QYSA 5LNWA 1B57A 1EF3A 3GS6A 2XVNA 1UWIA 2TRSA 1VD6A 4NT0A 1WA3A 2GJPA 3U6WA 4MWAC 1X97A 1O66A 3QKZA 3OQ8A 3GD6A 3BMXA 3GVWA 2QCDB 4UIOA 5JH1A 1REQB 3UETA 4DYEA 1W1ZA 1LOSA 1W5NA 5HATA 2YX0A 3MSRA 4CU6A 1HP5A 1JFXA 4Z08A 1P4CA 2YB4A 1V6VA 1TCDA 3P93A 4HPGA 4LBSA 2QUMA 3JS3A 3BO9A 4YPJA 3NQ2A 2WMFA 4GY1A 1W31A 1EQCA 4Z2GA 5CBJA 1PXGA 3QH2A 3BICA 4HJFA 4AG0A 4ZBCA 2HJPA 1SO3A 9CGTA 1Q7ZA 3BLOA 1A5MC 3ABXA 1CXLA 3PBGA 1LG2A 4B5VA 1UYQA 3OYXA 3AIWA 2Q8LA 1RZMA 4QLLA 1XQKA 3S6DA 2DVXA 3KZSA 2J27A 3N9SA 2ABBA 2BGNE 1H7OA 1US3A 4WGHA 4CQAA 3C0SA 4I3GA 2JKPA 1J4EA 5D9NA 2YFOA 4DBUA 2DIEA 1WUFA 4C6LA 2V3DA 5BXRA 1B3WA 5XIMA 1KC7A 2Y2WA 1GOWA 1MW0A 5KSWA 1SSDA 3N3MA 3ZO9A 3PR2A 3QLLA 4IFRA 4LQ1A 1EYEA 3TDFA 5CSSA 1F3XA 4ZO9A 3GWQA 2QUNA 3LGGA 3AI0A 1QAPA 3WNNA 4J4KA 1EA9C 3EB3A 1IGWA 2ZOXA 5FD0A 2WANA 1E0WA 4Y2WA 1UWUA 1OC7A 4ZFMA 1UUOA 2GJXA 4HHHA 3S2MA 2NX1A 5FF7A 2GSJA 3BOFA 3UVAA 3HIJA 5ABGA 4LYRA 4TTGA 1V3JA 3MCOA 3VCRA 3RPMA 3PAJA 3N73A 4HYVA 5I2UA 3E1F1 3ITCA 4X22A 2FZDA 3ZOAA 3Q65A 2V6AA 1AMKA 4QM1A 3P82A 2O9TA 2MUCA 2R1MA 3VD3A 4Z42C 2IXUA 1W56A 3KL0A 3O0FA 4F66A 2BY1A 2FDMA 3M0ZA 1EDTA 1PV8A 4KEMA 1XD0A 1EX1A 3VGBA 3L66A 3BG9A 1XPYA 2I1OA 1Y5VA 4Q8OA 2C18A 4OKDA 2FFIA 4TVDA 5JBFA 3FAXA 3VMOA 1F73A 3PZTA 3EMZA 2HPIA 4L5ZA 1R7AA 3RGTA 3CIXA 2NQLA 1DVJA 4N4QA 4PTWA 1JPIA 5D03A 1FCQA 2J8TA 3CZGA 3BXWA 3COTA 3TLLA 3PBYA 3FA3A 5AC4A 3L2MA 3OLDA 3HURA 3GVRA 1E3XA 1E6SM 3B04A 4H83A 4RE3A 1H63A 1GEHA 2CZVA 5ENLA 5E09A 1EWDA 1P6WA 3AWNA 3P84A 3GIQA 3H24A 4R27A 3O15A 2DSUA 4YWSA 3U4AA 1TPUA 2BVWA 4MG4A 4GVIA 2Y6ZA 1M5WA 1P0NA 1G1YA 1V5XA 3KVKA 1KTNA 1VBRA 2WO5A 4S3KA 3D5HA 2WK2A 4Q8WA 4XZHA 4HOXA 1TJPA 2VDHA 1X6NA 4LNCA 4QQ3A 1J2WA 2OLHA 5DELA 3CQJA 4W8AA 3MB9A 1MXGA 1PIFA 3M7SA 3V3WA 2DW6A 3PVFA 3T4CA 4CN1A 3M0HA 1WZAA 2DJLA 5E9XA 2TPSA 2J75A 2BDQA 3RJYA 3W24A 2ZRUA 1A0CA 5F2GA 5CLTA 1XP3A 4N6FA 2NX3A 1UZ1A 5REQB 3ZM8A 3GW3A 1D3CA 1H61A 3SCOA 2D1ZA 1VPYA 3BAYA 2PP3A 2F9RA 2XM1A 5AZ0A 4X3ZA 1SQ7A 3GNOA 5C0QA 1OT1A 4Z2JA 5MF5A 3HTWA 1IE7C 3QMTA 2ZUVA 2OX1A 2V5BA 1O12A 3QW4B 1BYAA 1J93A 3RRXA 5CJNA 1LLOA 3CUHA 1EZWA 1IIHA 4W5UA 1UR2A 4F2TA 2NUYA 4GXWA 1GG1A 4E2DA 5I02A 4F8XA 1R0MA 1TV3A 9XIMA 2DT1A 4GXPA 1YLVA 3M64A 1QWKA 2VZSA 5LHFA 1GORA 4AEOA 4PUMA 3WELA 3EWCA 3ABSA 2VWSA 1V03A 5DT5A 4JX6A 3G2GA 3H2EA 3ERPA 4ZB0A 3N6QA 4MB5A 1O7AA 1FCVA 3ARUA 1W1B1 5HAOA 4YN5A 3M0VA 1K70A 4MDOA 2WSRA 1ZY9A 3GSMA 4MJZA 1DOSA 4GH3A 2Z6JA 5E9AA 5A6MA 5CSUA 5JMUA 5IOBA 2PI6A 2PBGA 4MOZA 1WQ5A 2O4QA 2XN2A 1XWYA 3LSCA 3A24A 4DJEC 2F2HA 1G9HA 4XB3A 1R38A 2R1NA 5TBOA 2QMJA 1GZGA 4US5A 3S42A 3KP1A 3W71A 5I5RA 1SFSA 2PFHA 3MO4A 3GG0A 2ZTJA 1E15A 1AQHA 3GHUA 5KZDA 3DGRA 2RUSA 3MC5A 3MS8A 4BR1A 3URBA 2R24A 1OK4A 3IJ9A 1C7TA 4S23A 1L6GA 1KFLA 1I75A 2J25A 4PN2A 3N12A 4L4LA 5L9FA 2WZMA 4J5NA 3OU8A 3T44A 3CMGA 5A8OA 3MV11 1W3NA 4BF5A 2GFTA 2FKPA 4H9VA 2H9AA 3IPWA 4PUEA 2W91A 2DUZA 5K4ZA 4FX8A 4GLEA 4ATDA 1B31A 4JY8A 4LEFA 2TYSA 4JTCA 1QCWA 5GVJA 3GKFA 1YTEA 3W7RA 1OYBA 4J3VA 4Z1YA 1CXHA 1TV8A 4O17A 4ZZ9A 1C90A 1TJ1A 1G6CA 2QCGA 1F74A 1W6TA 3CPGA 5AHFA 4LTSA 5DQPA 4HOWA 1RQBA 4C1LA 1V6WA 3EPMA 4DM2A 3GTNA 3I6EA 4GUGA 4US6A 2VZTA 4S2CA 3ZIZA 4FXSA 1Z44A 4CNSA 4DXKA 4Y8FA 3D47A 4YL2A 3PSWA 2WKJA 4OV9A 2GJNA 4FLRA 2A1YA 1E3ZA 4DO7A 1EDGA 3A13A 5DBTA 1ZNNA 1OD8A 1JDDA 2HS6A 1YADA 3PWGA 3HQ1A 5M3WA 5BROA 4TX8A 5G2IA 1KFWA 4JD4A 4KEZA 4ZXOA 1IT8A 3TKFA 1QNPA 1AJ0A 4P8UA 2X1UA 4C6JA 4EPBC 1ZGDA 1SZRA 4UFMA 3SR7A 4KFNA 3NPVA 3WD1A 1L9WA 2DZUA 3EX3A 4QJ1A 4RPPA 4G5DA 4XZIA 5G4EA 2DW7A 3B8SA 1PSCA 3FJ4A 2WM1A 5DCEA 3MCMA 1NDWA 3H6OA 4M81A 5AHMA 1DXIA 2ZADA 2VRJA 1VF8A 1C93A 4EX4A 3SGUA 4RCXA 4DHGA 1O5RA 3NXLA 2BP1A 1KRCC 2QCNA 1E72M 3HPFA 3TC3A 1RY8A 1JNEA 4FXRA 4P7LA 4O14A 3WNPA 3T9PA 1YDVA 1TZ9A 2INEA 2E3ZA 1K8XA 1S3TC 3G8RA 1OY0A 1H11A 5C9XA 4FXFA 4V1YA 4LS0A 2XINA 3SCNA 2XZ7A 3B9NA 4ZB5A 2HROA 4MIMA 2CHRA 1C8YA 1D2KA 3GC5A 2PZNA 1VBHA 4AW7A 3R58A 3WF0A 2QJNA 1DYSA 1BVZA 2QJGA 3RCNA 4M1BA 2VC9A 3W22A 1UD3A 3AIVA 4HNOA 3SN1A 3DKLA 3QF0A 3QYQA 2PP0A 5HWMA 4Q8QA 4US5D 2ISVA 4AZ6A 3WF1A 1MRQA 5I00A 1CXFA 2VGFA 1VPXA 2XUCA 4IH3A 1P7TA 3TQPA 3GVQA 3NUKA 4ERIA 4XAPA 5A69A 4IX2A 4RV3A 1UBPC 1ADSA 3W38A 3P5YA 4WZHA 3WDHA 3NQVA 3CYVA 2WMIA 2BTMA 2L5HA 4L1WA 3NQ6A 3P67A 3W84A 3N9RA 2CHOA 1VFFA 1FA2A 1GW1A 3VTRA 1JDFA 3SGZA 3WD4A 2PWEA 8CGTA 4JTJA 1ZBVA 2PEVA 2OYLA 1JYWA 3AS0A 1RJRA 4L6OA 1E9IA 3MBFA 4AEEA 4LEQA 3OIHA 2Z7KA 4B5TA 3C3UA 2OEMA 3WSUA 3R79A 3QZAA 1Y5WA 4NASA 1AD1A 1FHLA 5AY7A 2CLEA 3FKKA 2VO5A 3VFLA 5C6MA 1YDYA 2FPVA 4R88A 3AXIA 5HJYA 1V0MA 1XUZA 1H51A 4LALA 2XN0A 1H0IA 2OLSA 3DHFA 3HMJG 3DBNA 2WNZA 5EMUA 1BYBA 4RW5A 2HWGA 2P3ZA 1Q4WA 2CETA 3CT2A 5A8NA 5A6BA 2YGYA 4JIPA 3VKAA 1XJBA 3DI0A 3W25A 3DFHA 2OKTA 5MKGA 1GVFA 3CB3A 2IPJA 2VFEA 1EPXA 4H6QA 4DJDC 1GKQA 4MGGA 1IR2A 1BAGA 4IQLA 1FHUA 1R86A 4RK8A 1XDLA 4GX9A 4WDWA 1D3GA 3E2QA 6TIMA 1K4GA 2HVOA 3MMDA 3SZ8A 3OGRA 3SJ3A 5CBIA 1GOOA 4XZNX 3SUWA 4A2RA 2D73A 5A6KA 5KMYA 2Z00A 3WYZA 1XCWA 3LBCA 1JD7A 2OGYA 1UD4A 4QR6A 4PUJA 1RAKA 4GJJA 4HCDA 3TR9A 4XKYB 4W7VA 1DWJM 4KCVA 1MNZA 1XDJA 4MWAB 3S5SA 3VD4A 4ZR8A 1ZAHA 3WLMA 2X09A 2QHAA 4HZ6A 5C7VA 3A5FA 4FZIA 1FCUA 1H7NA 4O13A 4LC8A 4KH2A 1OHLA 3TTOA 2KAUC 1W0MA 1L6FA 5HUOA 6REQA 2X30A 4NZFA 3B8VA 4YU1A 4XAFA 1QTWA 6ENLA 2OFJA 3BZGA 4H2CA 4AH7A 3MSDA 3AMDA 3HQOA 2VQUA 3CQKA 1XLJA 3PP7A 3UGRA 3R2GA 3KS5A 5LNUA 1HJUA 3KBJA 4LVFA 5AB3A 4LGXA 1MQQA 1FTXA 2JFEX 2XJ7A 2E7FA 3LM3A 3VC6A 3ZWTA 3A6OA 2E1DA 4JCMA 3L4YA 2EG7A 1MXDA 1JUKA 4PB4A 2J8GA 4PBEA 2OSXA 3DYMA 1G5AA 5FJRA 1HL9A 1YPXA 4NAEA 3H4XA 4ZO8A 4Q8PA 3ZJ6A 3E12A 4I90A 2HV5A 1J96A 1I2QA 3LTYA 3SRFA 3FJLA 3R43A 4L9XA 1BG9A 3VU2A 3QXBA 1B3XA 4H8NA 4LCQA 2ZCGA 3APTA 2A2IA 2GK1B 1HKVA 2IUZA 1KFBA 1TO3A 3WBXA 4I9TA 4DZIA 4E2BA 1H5YA 3BCFA 3THUA 1IXPA 5HUPA 5EPDA 3RXZA 2ZWYA 3KLLA 2G8ZA 4JNZA 3CO4A 4HMCA 3HG2A 2OT0A 2J78A 3P80A 2NV1A 4OTKA 2BBFA 2I14A 1MXSA 3N14A 2W5FA 3HG3A 3CHVA 2DSZA 2HVMA 2OWWA 2XTKA 2DZWA 4F3HA 3B0VC 4K2SA 4HNTA 1AMYA 4UZSA 1RY0A 2ONEA 4AD3A 1FFQA 2QPSA 1IWPA 5D05A 1WBHA 2QF8A 3QOKA 2WVUA 2OWCA 4J3SA 3PTMA 1XLGA 2CLMA 4C6OA 1QI5A 4F2UA 3FS2A 4GO8A 2WC4A 4GJ1A 2GDUA 3ATYA 3PC0A 4EWND 1S1RA 1TV5A 1G4SA 1ESWA 2X1IA 2FH8A 1PIIA 3NJ3A 1R3TA 1XH0A 4B16A 2PMQA 4JYFA 3TZNA 4O1AA 4PMVA 4E2OA 3CBWA 5H8PA 2ISSA 4KWVA 1F4HA 1R3QA 2DIKA 3UWQA 4R53A 3NXFA 4AYSA 1GJUA 3N2CA 4AWEA 3TLQA 4OQVA 4EAMA 1YKWA 4XZWA 5I3FA 1VFOA 4QIUA 4WHBA 4JPGA 1QASA 1FDYA 1BEUA 1M6JA 4XBJA 5DCDA 7ENLA 4BWLC 3OVRA 2HXTA 2D0HA 4YWIA 4RZ4A 3ISIX 3VX1A 5LKYA 1OFBA 1J12A 1JPDX 3ANYA 4CD5A 1F9CA 3V7PA 3IAQA 2VX5A 2VZUA 3NL2A 2Z27A 5CC3A 3W7LA 5EGRA 3GXDA 3FDKA 4E4FA 2R8WA 3GBEA 3UY7A 3O16A 2Q09A 3H22A 3IS4A 2PAJA 3CHDA 4Q4OA 1LZOA 4E8GA 1O95A 1XD1A 4Q7IA 3CHCA 3K4WA 5JIWA 3O6DA 4DAIA 1LM1A 2Y0FA 5A6LA 3PPGA 1H7PA 4RLIA 1EBHA 3M0XA 4XBSA 4BI5A 3A3XA 5JH2A 1FRBA 1U30A 3BLLA 3STCA 2VEIA 4KW2A 4LYPA 3XINA 3EDJA 4PB3A 2Y62A 1ODUA 5CC7A 3UYIA 3C2FA 1QNRA 3B8TA 1RR2A 4KWSA 4UOJA 4PUWA 3PJTA 3AOFA 1GGOA 1SW3A 2VC5A 3EKGA 9XIAA 2W6RA 3VXGA 3NZQA 4DYJA 4PMRA 7REQB 1QBBA 4PEKA 5AHNA 1H49A 3U5YA 4PCSA 4JFVA 1RVGA 4IP4A 4M3PA 4DWSD 2EJAA 2A79A 1V79A 1VYPX 3ABQA 4DWDA 2REQA 1PEZA 1KFCA 4I6VA 2ZKMX 4LFYA 2Z26A 1JYNA 1CB2A 3LN3A 3OO2A 3LCFA 1A4LA 3G0XA 3ORWA 3S5OA 2VDIA 2BXVA 3BQ5A 3RJXA 3RPTA 2BY3A 1RVKA 2Z4GA 1FH8A 4NNAA 1WOBA 2E6YA 1JGIA 3LI0A 2D24A 3N17A 3O9NA 2PDFA 2FH6A 3MUZ1 1HFBA 1OYAA 1TELA 3SRDA 3QTGA 2IXVA 3E0LA 4DYKA 1K03A 1XGDA 3EBVA 4LY8A 2VT0A 3GNNA 2VZVA 1Z69A 1UWSA 4LV9A 5I3GA 2NVDA 1O4UA 4BA0A 2QV4A 4H00A 3AU6A 9RUBA 1JQXA 4QDMA 5BMWA 4IG2A 2ZA3A 4IOTA 2GQAA 2GQ9A 1BXCA 5JBEA 4N0RA 3CZEA 3WDQA 1UP2A 4QDPA 1V0LA 2Q02A 1XIMA 1IEWA 3KUMA 4AISA 2YLAA 3CIWA 2VELA 5A8QA 4KFOA 1HX0A 3JZEA 3GUGA 3UP8A 4NX0A 3NFUA 4IJBA 4IIBA 1EO5A 3LBOA 2BFGA 2PDHA 2Q01A 3EWYA 2QKFA 3BLKA 2GPTA 1FWIC 2OQYA 1UWTA 1SGJA 3GR7A 5I7GA 4GYKA 4JXCA 4N9EA 4D8LA 3VKDA 1LL4A 4E5TA 1CGUA 5BXSA 2CWNA 4ZE4A 2QCCA 1X6LA 4O4VA 2V8ZA 4RDVA 3CV1A 3R6IA 3D6NA 1XI3A 1GW9A 2XIMA 1FHDA 2I57A 2PCEA 3W74A 4PBGA 3W7EA 1G69A 4ZFCA 3DH7A 2OSWA 3KVJA 1U1JA 4AEFA 1KM6A 4BEQA 5LNSA 1YDOA 3VX0A 2XVGA 1P1XA 1EPVA 4NRSA 5FJIA 1KQZA 1RUSA 3VCCA 1OYCA 3GG1A 1IT0A 1B90A 2IKJA 3E0IA 1W5MA 3GVGA 5A2BA 3C52A 3HGSA 1FWGC 4O1DA 1JPHA 2H90A 1NDZA 4GBUA 4EACA 4LU0A 4LS2A 2QCDA 3WLIA 1CYGA 1SVDA 4Q8NA 2WZIA 3WO8A 1UR0A 5D9MA 3RM9A 1DXEA 1REQA 4UMAA 2A4AA 4ML9A 2UZ9A 3C2VA 3CM4A 3M5VA 2GWGA 1FH7A 3PG9A 5I0DA 2VHLA 4DJFC 1TWWA 5DCBA 3S6TA 5I77A 2G4FA 1DWIM 3TR2A 1G0CA 4LY4A 2P8CA 4GFIA 1OFPA 1LRQA 3CXOA 3PZUA 3TUUA 1UR3M 3RU8X 2B7PA 3EGJA 1ISVA 4IHCA 1NIUA 5E1QA 4DX3A 4DELA 3CAKA 3G3DA 2VXNA 3FV9A 4TXEA 1IWBA 3G77A 4U2ZA 2VZOA 3G24A 4H04A 3IRDA 4HMDA 1E6ZA 1RPXA 1P1MA 1HO4A 5CZ0A 3TCSA 4WUIA 2A0NA 2OTDA 3RR1A 4YYFA 1NF0A 3SIMA 2HXUA 4YMZA 1GPFA 1T40A 1PBGA 2H8XA 2YYUA 2J7GA 4HA4A 3PF3A 3UERA 3BLDA 5JVLA 1HG3A 2QLYA 3EXRA 4CLMA 3OOQA 2VEGA 4KF1A 4Y8EA 2HCVA 3I7RA 4AFYA 2J6VA 4DPQA 1E5JA 5GNYA 5GNXA 2BWGA 4F2BA 4GK8A 4DAFA 5D2YA 3URQA 4NI3A 4HJWA 3P5ZA 4BEUA 5AYYA 1WBJA 1QO2A 5TD4A 4D6HA 3H12A 4LAMA 3UXDA 1LOQA 3W3OA 1IZCA 3N4FA 2IQTA 2YZ5A 1KRBC 3GTHA 4PE8A 1UP0A 2QVNA 1H1YA 2Y1HA 4U4MA 1Q7QA 2VR4A 1SFTA 2DZSA 5BWAA 3ZJ8A 5F2LA 4GIEA 1VLWA 4P8XA 1FY6A 3W75A 3WNLA 2VTFA 1V3HA 1GK8A 1EZ2A 5D2TA 1WCGA 1A5KC 4L9YA 2WSQA 3QZ6A 3E2VA 5LZLA 1LOLA 2TMDA 4IPJA 2NV9A 3PAOA 7A3HA 3VIOA 1EC9A 4S3JA 1PKNA 3POHA 4JL2A 1ZBWA 4ERAA 2FGBA 3UPBA 4TO8A 3QGAC 1YNYA 1BSIA 3TQ0A 3VK5A 4L9ZA 1KR0A 4AD5A 4Z2KA 2DQWA 3DDMA 5F2MA 4I6KA 5DANA 1NWTA 2UY4A 4FF5A 3VUPA 5DMMA 1P0BA 2DU2A 4AYGA 3L4WA 3OVQA 4B15A 2WW5A 3W1RA 3FXYA 3CASA 5CZSA 3I7QA 3N29A 1QO5A 4GISA 4GQBA 3B8UA 4HNVA 2BX7A 5HQEA 4DBEA 4X2RA 3D3AA 1OJXA 1NWUA 3P0XA 1GKPA 3H2MA 1P48A 3PTDA 1GOXA 1U1HA 4GCAA 4HNUA 1GJPA 3QFEA 1PTAA 6XIMA 1WZMA 2AQVA 2DSKA 4JTTA 3THCA 2Z29A 2ACQA 3M5YA 4JYDA 4Q6XA 2CCRA 5DEZA 3E74A 4CVWA 3RX4A 4HU3A 4HZ8A 3BJTA 1ISXA 3ITXA 1M7OA 1PJ9A 4MY9A 3RPDA 4M1RA 4HCHA 4Q8UA 3VINA 2WVTA 3C61A 4OFCA 2R1PA 2R14A 4YCPA 1EKOA 1UR8A 4W89A 5E0FA 3S83A 1UC4A 3WEMA 1V0NA 2PDKA 2Q71A 4ZB2A 4CD6A 1OZMA 2DY3A 5REQA 4O8AA 5HXMA 4GFSA 4WGXA 5FKYA 2HTMA 1BD0A 2ICSA 5JQ9A 1GVSA 2VCAA 2V2DA 3IVUA 3MBDA 2XIJA 4JFTA 1IIGA 2XFRA 3W2JA 3AWOA 1QW8A 2PUZA 5C9WA 1JCLA 3MI3A 2P8BA 1TUXA 2D3LA 3O2LA 4W88A 3AS1A 2ISFA 4KMQA 5D8WA 3RX3A 3FY1A 1FWTA 1J0IA 1EX5A 2XH0A 4JQ4A 3UXIA 2QCLA 4O0QA 3GDBA 1DQWA 3QR3A 4XIAA 5A2CA 1GKRA 1OFQA 3HA1A 2QZRA 1IYXA 3UZYA 2OO6A 3KBWA 3PPHA 3G0UA 3W1LA 1B2YA 1O5XA 1X8CA 1KXTA 1ITUA 1VS1A 1UH2A 3OVGA 3KOXA 1XCXA 1QU4A 4KRZA 5D04C 3PZ9A 2IPWA 3KOFA 3LMZA 1XYCA 4K8EA 1I0DA 1TYGA 4A3RA 3NZPA 4BF9A 5LIXX 4FNPA 3XISA 1E1FA 4F9DA 3AIEA 1TKKA 3EEZA 4D6CA 1OFOA 4WKAA 2I5IA 1QK0A 3E38A 1KBKA 4H9TA 1G4EA 4JTRA 1XBZA 2YBVA 1RBLA 4GZJA 3WD0A 4MLJA 1FBAA 1LUCB 4IP7A 5T8GA 4O0ZA 3WLQA 4F0LA 1B30A 5BCAA 2EPKX 2RH9A 1QT1A 2QAFA 4MB3A 1WUEA 2ISDA 3LNMA 1R7OA 1H50A 2PP1A 3WX7A 3CZ8A 3CMFA 3LZ3A 2FB3A 4RW3A 3AJ7A 2ZQ0A 3REQB 1VBGA 4RUBA 5EFFA 3USBA 4U31A 5DXXA 1X7FA 4ES4A 3QC3A 3FNDA 3CUXA 3WD3A 2V0TA 3HJZA 3ARSA 1LBMA 3HJEA 3IGUA 1A49A 1QBAA 1C92A 3UPWA 3H4GA 5I03A 1EP1A 4K39A 3M07A 3AO0A 1B54A 2QPUA 2W92A 5LIYX 3NPXA 2EPLX 3FJ6A 2ZUUA 2QJJA 3UNTA 2HE5A 1KA9F 3IWPA 3W01A 2ZFAA 5A6TC 3W07A 1M1BA 3VIGA 1SJDA 2ZX7A 3V5CA 4UQAA 3MWCA 1N8IA 1OCQA 1OFRA 3U0HA 1WXJA 5A6AA 3MDWA 1AZ1A 3L21A 5C71A 1KB3A 4O12A 1FUYA 4OUIA 1D3HA 3W27A 3KOWA 1H1NA 3UWEA 4OZOA 4L1XA 2NXIA 1UR4A 4QE4A 2G37A 2JK2A 1HGWA 4DI8A 4GY7A 4P61A 1TE6A 4LVBA 2FTWA 4UTMA 2AMXA 4HN8A 3HFYA 1S5VA 3A4XA 5HNTA 5KTLA 1HJSA 2A3AA 3LRMA 1MZHA 3N04A 4F0SA 1MW3A 4CD8A 1Q3NA 3EA1A 3KCLA 1MQRA 1QATA 3G22A 2CXEA 4QE1A 3MKCA 4O52A 1XQLA 2NUWA 4MY8A 4MKSA 4H6EA 5D09A 1RA0A 1UCWA 7PTDA 1X1NA 1R85A 2FVMA 2CBIA 3VOHA 1YXCA 2J62A 1BTMA 1FOBA 4OGZA 4GI9A 5DY2A 3S8HA 4LBRA 1VP5A 1CLVA 4EXAA 3THQA 2G97A 2FMNA 5CC6A 2EEXA 1NEYA 4CEUC 5M5DA 2Z24A 3O63A 4LANA 4DBSA 1JIBA 4D72A 3QEZA 3GH7A 1KRMA 5I6SA 3TTEA 3GR8A 4S3GA 3E5BA 3EYPA 1N8WA 4N9CA 2G3NA 1C9WA 3CMJA 3RDKA 2CW6A 1PE1A 3VZZA 4DF1A 2CEQA 3L2IA 1UZHA 1ZTVA 2EG8A 1G67A 4GQQA 3FYOA 4Q8TA 3W1UA 1JFHA 2BLEA 4U5KA 8XIAA 4M6VA 1U5JA 3V0UA 3BPWA 1ZJHA 2X16A 4YVXA 3N4EA 3RCMA 3B9AA 3AYRA 2QMKA 2A3EA 3M6YA 1N82A 3AMKA 4LWWA 3W1MA 3QGVA 2GVGA 5C2CA 3N2OA 3SW6A 5A8PA 5K9XA 2ZUSA 3M1ZA 2HBVA 2Z1VA 4PC8A 4F9JA 2NQHA 1UASA 2OU4A 2RDWA 4XUYA 3MYPA 4QXIA 3K30A 4TVUA 3TEVA 3URNA 2C0HA 4LYKA 3ABRA 1ZAJA 2WZEA 3ZMRA 3M4HA 1KRAC 4DI9A 1O68A 1XRSA 1KM2A 5HNUA 3EXSA 4REQB 4NF7A 1BWKA 4R7OA 3OZPA 1JI1A 3UWZA 2V68A 3GKAA 2G95A 5E70A 5H8UA 3GX9A 4X63A 1JF6A 3WQCA 1XLEA 2ZRVA 4A8RA 3P3BA 1QI2A 4RX0A 5JXQA 2UBPC 2C6QA 2V5JA 4ZQPA 1BSLA 4PRRA 2F2KA 4C91A 3PJWA 4XAGA 2JALA 2ZE0A 2GZXA 5D02A 1KCLA 2GUBA 4JTLA 4F48A 2EAWA 3T4WA 5T26A 1E4LA 4J3TA 1CENA 3IJLA 2I5QA 3T07A 3LHTA 2H3DA 2PLJA 1E70M 5IBXA 3UJ2A 3TN5A 4C5ZA 1EJ7L 3HPSA 3EDFA 2UY2A 3QRHA 5RUBA 2YCIX 3AHXA 1OM0A 3TN4A 4H9ZA 3BGJA 3EWUA 1NFBA 4QE5A 1GQNA 3LHUA 1XLAA 4KEVA 4LSBA 3UY8A 5TF0A 4XIMA 7ODCA 4MSSA 1OF8A 5CSRA 4ZENA 3WMSA 1JPKA 1CGWA 2R9RA 2C0AA 2QEZA 4OBRA 3WN6A 1XYZA 4Z0SA 4IMEA 3F7JA 5HJXA 4E2VA 2ZVIA 1WOAA 5DT7A 2UY5A 2J7CA 1H1ZA 4TU1A 3G1FA 1U22A 3TNBA 1RHCA 2IKGA 5FL0A 3VIJA 5IHRA 1R9XA 4C6EA 3S2NA 1S2TA 3TW9A 1KR1A 3HOJA 1L8PA 2R6OA 4U3AA 1PKYA 2YYTA 4IPLA 4E3VA 4JTIA 4FX6M 4FAMA 3W1QA 1DJHA 2FZ9A 4GIYA 1ONEA 3HN3A 4I8DA 1Q5MA 2KX9A 3A22A 3CL6A 3SCQA 5FL1A 3S1GA 2WSKA 5C54A 1QK2A 4UTLA 3OBEA 4QLKA 4MJMA 5I3IA 3N2XA 4LOCA 1LDCA 4IZGA 4Q22A 4IIEA 3VNZA 4JZ5A 2BV9A 3DOPA 3N19B 1OSEA 3PWAA 1LORA 2VURA 1EOMA 4NZJA 4DLMA 3POCA 4JHZA 4XKYA 3WLSA 1V4YA 4BQ2A 5EMYA 3LCWA 3VDBA 4X61A 4C1KA 1U1UA 4MJ4A 2BVDA 1MDRA 3VNIA 4MWAA 3FEMA 1RBAA 3KTSA 2E5DA 2F7FA 3GXMA 1BGAA 1G4PA 3E0FA 2I9UA 3THDA 3GXFA 5HPCA 3M0MA 4XX6A 1RA5A 3W2NA 4M51A 3UR5A 3OG3A 1YTDA 3TQKA 4ZCWA 2VEMA 1YPFA 2AKMA 4EPDC 1JUEA 2YDSA 5CPMA 3SY1A 5D37A 4PL1A 2YL8A 3K1GA 4UTFA 2Z1XA 1CBGA 3U2CA 2OWXA 3E2RA 4IGMA 3KDOA 3Q67A 4N02A 3WKZA 1T8QA 3IEBA 1C8QA 2Z1WA 2QUUA 1PL9A 1XDMA 3GHRA 4W7WA 3F4CA 1FP8A 2CXGA 1K02A 1UOZA 3SUSA 4GGHA 2ZTKA 2A5HA 4H9XA 3N15A 1VCFA 3F2BA 1C29A 2B7NA 3WJSA 1MI3A 1TPVA 3IJ7A 2DVTA 3VFCA 3NZ1A 3QPEA 3TWAA 4C7DA 3TA6A 2YA0A 3HG4A 4FMVA 2QQ6A 4O1BA 2G3MA 3BG3A 2PU0A 3VE7A 1XC4A 1OCBA 3F4DA 2A7PA 4O15A 5I09A 3PS7A 5I3JA 2EPHA 2GK1A 5EKYA 3C86A 1GJWA 1MNSA 3KHJA 5D32A 5DF0A 3IUDA 5TAOA 4PYSA 4A05A 3QQ0A 4S3FA 1RSCA 4NG3A 3EX6A 4MZYA 3NCOA 4LBUA 3I4KA 3AIRA 5C7HA 3MVIA 5J5RA 1GT8A 2J9XA 3FEQA 5A95A 1BLIA 1VJZA 2PDXA 5ABHA 1FWJC 3VIKA 3LYEA 1LG1A 3W1PA 2CLFA 3TYDA 3GZAA 2CITA 3EOLA 4KETA 4AD2A 5CSYA 4E8CA 1ZALA 4LUTB 1DHPA 3AAMA 2RKXA 4FNSA 3KXQA 3BAIA 4EKJA 3LD5A 1E1CB 1EC8A 1EXBA 1Z7AA 1A4MA 5T9BG 3R8HA 2Y7GA 3C0QA 4QJ3B 4YXGA 3NQFA 1F5ZA 3SFWA 4Q7NA 4NXKA 3SSZA 3OQEA 4YTQA 2Z6IA 1H4PA 2VOMA 1BHGA 2FGLA 4QBXA 3TCEA 3KFTA 3GTIA 1EQPA 4L1GA 2DZAA 1SR9A 3B8DA 1Z3NA 2TSYA 5CPTA 4NJKA 1X1ZA 4UR8A 1NJJA 2OOFA 4AD1A 5F4WA 5CPQA 1W3IA 1JD9A 4ZL1A 2DIJA 4HTBA 1XXXA 3W7PA 5HQLA 2YPIA 1I6NA 3GYEA 2ZRZA 4UTWC 1VCGA 3V16A 1ECQA 1NELA 1NSJA 3NOEA 2Z2UA 1NOFA 6ALDA 4Y96A 3BOXA 3MV01 3NNTA 1UD6A 4O4WA 4GNVA 2NW0A 3VGDA 1JCMP 3LI1A 3OPSA 2J13A 2NSXA 4GH1A 3V1HA 1AH4A 2OB3A 3B97A 4POCA 1EL3A 4S1FA 1U5VA 4D1IA 4AMAA 1ZQ5A 4C6QA 1R3SA 2OSYA 4AVOA 5JBDA 3R11A 3U2ZA 2PWVA 1E0XA 2OJPA 2GL5A 3H2NA 3S47A 2QR6A 4ICNA 4MWAD 1JDCA 2Y4SA 4WDXA 2C91A 3L4XA 1QJWA 4RE0A 4BF7A 4BK9A 3NVTA 1AW2A 4E38A 4GUIA 3GQYA 4OOUA 3LXAA 4S38A 5GNZA 3K46A 4H6RA 1E1EA 3TSBA 2VENA 2ASHA 3G1VA 2E6DA 1TTPA 2OVLA 4M80A 1DIDA 4KWWA 3WL1A 3CT7A 2AGKA 3GIYA 1EGZA 4LUSB 2DEPA 4HPHA 2OGJA 1BVWA 3H7RA 5AC7A 1JZ6A 4JOMA 4C90A 7REQA 3G3MA 1TQXA 2EBNA 3ZJKA 4AXNA 4GD0A 3GTXA 2AQWA 4ML4A 4A29A 1AVAA 1PYMA 3S1WA 2XU2A 1EB3A 4ZE5A 1KV5A 4FLSA 1PZ3A 1ZS2A 3TROA 2A3HA 2TAAA 4KS0A 4PBFA 1BKHA 3H2OA 3STFA 4B3KA 5KEZA 2ATSA 1QPOA 1EA0A 1WO2A 2PWHA 4RJEA 1NF7A 3SI9A 4O1EA 1BQGA 3VAVA 1Z9AA 2AL1A 3SQSA 4YS1A 4ROQA 1FDJA 4LRTA 2VUNA 1DWAM 3T81A 2O9OA 1VIWA 4B2DD 3P62A 1OGBA 4DUVA 1P43A 3LB0A 4GINA 2Z2AA 1ZUAX 3DG3A 1TZ7A 2WBKA 5BRBA 3NDOA 2X1SA 2ZC1A 4DJEA 2VD8A 1Q63A 3UZWA 1LWJA 4GKTA 4DUOA 2BG5A 2BB0A 1KWGA 1C91A 3R0KA 3VKCA 1JZ3A 2OR2A 3NZRA 1FXPA 2AMGA 4A8IA 2GVYA 3KWXA 4DF0A 3PB0A 4MNLA 3M46A 3M0KA 5H8MA 3MY9A 4QEEA 3V5FA 1XLCA 2AAAA 3LCIA 3W7GA 3HB9A 4Z2HA 1VQTA 4HIBA 2FMOA 1OFAA 4PL2A 4ONVA 2W3ZA 5LIKX 2IQDA 4PCPA 2YW4A 3D3FA 4R9XA 2F6XA 2VP8A 4XBKA 1UKOA 1ELSA 4DXXA 3WK3A 2E28A 3TYUA 1KWKA 3LA4A 4LCRA 5GPRA 1PS9A 3RYSA 1SFJA 5AYZA 4MYXA 3MKKA 1F6YA 3WQEA 1J0ZA 3VIFA 3BLPX 3M44A 3WD2A 1UB3A 3LDVA 2OCZA 2J7FA 1OQFA 1YYAA 5AC5A 3L4ZA 2D2OA 3AHTA 4J1OA 3H2FA 4LNYA 4Z2LA 3WMLA 3VILA 4S2BA 5G1TA 1OK6A 4GZEA 2D20A 1V6TA 3DU0A 3T78A 4DIAA 3TONA 1XUUA 1XC6A 3PY2A 5CH9A 4ZQMA 3DG6A 1W54A 4MNMA 3NQCA 1U5HA 3N2MA 3QV7A 4CD4A 4UC5A 3GU2A 2RHGA 5KZ6A 4AZGA 2QUTA 1U33A 2YXXA 2HZGA 3TIMA 1UUMA 3OBKA 3RN6A 3L0KA 1XBXA 2OOGA 3SEPA 1JZ7A 4GO9A 1PCWA 2C3ZA 1OIFA 4PMXA 3KTXA 4O18A 5HOSA 3R13A 4UQDA 4CN4A 1EIXA 1HL2A 1E40A 3QZEA 4IXXA 3O07A 3FXGA 4DNHA 4QAIA 4HU8A 4IICA 4QQUA 1CNVA 1CIUA 4HGXA 6PTDA 1CW2A 3MDUA 4QX4A 3JUGA 5J8LA 1OABA 4K37A 1GYMA 3ITGA 4N6EA 3R5EA 2ZWZA 1A5OC 3U57A 1AQ0A 3FN9A 3G1XA 2VDGA 4DF2A 3WUEA 3DYOA 3CL7A 2PRHA 4TIMA 2PD9A 1UQYA 1TJ2A 2G41A 4PGLA 3W53A 2VFIA 3LS9A 3I6RA 3CNYA 1CGYA 3ITOA 2W67A 3W2UA 4F0RA 1ZJIA 1LRTA 2ZZ3A 1WDRA 2ZDSA 1W1A1 2PURA 2W27A 1WPCA 1PIGA 1DEDA 3N6JA 5I23A 1LTDA 4LVAA 2Z25A 1RCQA 1QWGA 3VIMA 3C2EA 5I78A 4DJED 1FCBA 4BQ4A 3DFTA 4GVHA 1ZJBA 4ADSA 2XPKA 1C8XA 1XSKA 4H01A 1VEPA 5A1AA 1S5TA 3W2MA 4F0KA 2NQ5A 2GVEA 2WMJA 3HM7A 3R8GA 1LQ0A 4ILSA 2TODA 5BRQA 4Q4KA 3D0CA 2QULA 3FHAA 3VC5A 2CZEA 4EK7A 4HU0A 4URIA 2QT3A 3SCPA 4J2PA 1QI3A 1MEHA 1A47A 1TPWA