3Q58A

Structure of n-acetylmannosamine-6-phosphate epimerase from salmonella enterica
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
229
structure length
229
Chain Sequence
SNAMSLLARLEQSVHENGGLIVSCQPVPGSPMDKPEIVAAMAQAAASAGAVAVRIEGIENLRTVRPHLSVPIIGIIKRDLTGSPVRITPYLQDVDALAQAGADIIAFDASFRSRPVDIDSLLTRIRLHGLLAMADCSTVNEGISCHQKGIEFIGTTLSGYTGPITPVEPDLAMVTQLSHAGCRVIAEGRYNTPALAANAIEHGAWAVTVGSAITRIEHICQWFSHAVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
source organism Salmonella enterica subsp. enterica serovar typhi
molecule tags Isomerase
molecule keywords N-acetylmannosamine-6-phosphate 2-epimerase
total genus 80
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature ec 5.1.3.9: N-acylglucosamine-6-phosphate 2-epimerase.
pdb deposition date 2010-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04131 NanE Putative N-acetylmannosamine-6-phosphate epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3q58A00
2CZEA 2DZXA 3W83A 3NQVA 2E6YA 1GPWA 1I2OA 5G5IA 3NPUA 3BLIA 1S5WA 3TDFA 2DZUA 3G1XA 1SQ7A 3UWUA 1DKWA 1VJIA 4O10A 3IIOA 2X1SA 4K36A 2X2GA 5FF3A 2FB3A 2H6RA 3U8GA 2ISWA 4DBDA 3MBFA 3CEPA 4MOZA 5TBOA 1AW5A 1P1XA 1H1ZA 2GOUA 1H50A 3O1NA 1OJXA 4LVBA 5K9XA 4JYEA 1XBZA 4LOCA 5C6MA 1KTBA 3DFOA 3G0XA 4FX6M 1TCDA 3ZR4A 3FIGA 3N2MA 4IMDA 3UXAA 5SWUA 2Y7FA 3NQGA 3WK0A 3TW6A 3QW3A 2JKAA 4WQ6A 2GQAA 3GR8A 4WXYA 4UMCA 4UTMA 4DXVA 4GRSA 3L2IA 3GDMA 3N9RA 4MYAA 2XN1A 3D0CA 2Z6JA 4JTHA 2A4AA 3SR7A 3MJYA 1TRDA 1G4PA 1A50A 3BW4A 2BLEA 3OVQA 2X30A 2DU2A 3BK0A 4O11A 4AEOA 4HN4A 3IV3A 2D73A 4UFKA 3GDTA 2FQIA 4O50A 2NLIA 2Y70A 4MUZA 3LERA 5D2WA 4JX5A 3EXTA 4NNBA 1O95A 4UTWA 2O7SA 4Y96A 4JIPA 5AFDA 3LHYA 1G69A 3QM3A 4RZ4A 4HT3A 3NR0A 3I7RA 3GIYA 1TO3A 3P61A 3NOEA 5KZDA 1Q6LA 3ABQA 2NXIA 3GAKA 4JN6A 3DH7A 3NQEA 1DL3A 1GVRA 4Z1BA 4UTUA 1DQWA 3FYPA 3NPWA 3P67A 3GAYA 1DOSA 1T0OA 5D02A 4K7YA 3VE7A 2A85A 4IMCA 1NFBA 4G1KA 2QUUA 4ZQRA 4FX7A 1MEHA 2V5BA 4O15A 1ZAIA 2YGYA 1KM4A 4UUIA 2E5CA 2CLFA 2E1DA 3HMJG 4X9SA 4E38A 2TPSA 1H7PA 2ZA3A 3GB6A 1ICQA 1CX9A 2PC4A 3BLFA 1TTQA 3UY7A 3PAJA 4E0CA 1RPXA 4B5NA 1VPXA 1AMKA 2E6FA 1XDMA 3P82A 3EX2A 4RX0A 3C4UA 2BSLA 4CCCA 5LGZA 5BMWA 3L0KA 4DBEA 2YFOA 3DGRA 4IPIA 3W1QA 4UXDA 3LRMA 3GDRA 1N7KA 1D3HA 1W8SA 2E5BA 3NO5A 4RJEA 2EF9A 1SW0A 3DKJA 4UC5A 3TUUA 2R91A 1TPDA 1BEUA 1FWRA 1MO0A 1JQVA 3G1AA 1R30A 1U83A 3SI9A 3UQNA 3TC6A 1TB3A 4FNPA 2AAMA 4HHPA 1A5SA 4PH6A 3SGUA 4Y90A 2VFEA 3GKFA 2QCHA 1EIXA 3CT7A 1QDSA 1TV7A 3S9YA 4EF9A 2HSAA 3LI1A 1CW2A 3QF0A 3DFQA 3P62A 2OT1A 4UR7A 3TKFA 2E77A 4NJIA 2WSQA 4GXMA 5LSMA 3CTLA 3R8RA 4AXKA 4AH7A 3W7JA 5LNVA 3MP3A 2GVLA 2VFHA 4MY8A 1VYRA 2A6LA 3VNDA 3HO8A 1OYBA 1UBSA 4CNOA 3IVSA 4O53A 3EXSA 3H53A 1K8ZA 5HUOA 2GUUA 3PUEA 2P0OA 1JUKA 2YZRA 2B0MA 4O17A 1ML1A 2FIQA 1KFJA 4BI7A 3H54A 5FEXA 1PE1A 1X1OA 3L21A 2J6XA 4K8EA 4CQAA 4NJHA 2G95A 1A5CA 4NXSA 4ZQOA 4H3DA 3N73A 1TJRA 3LHVA 4JTJA 3EWZA 3TK7A 4HNNA 1JRCA 3LHWA 1LCOA 1WA3A 2X1UA 4FB7A 2RKXA 3CPRA 3MI3A 1YDOA 2ZTJA 3LXAA 1JUEA 1VRDA 1SPQA 4FIQA 4FNTA 3FS2A 4CLMA 4MLJA 3C0JA 4O0ZA 4DF2A 3I7QA 4Z0JA 1ME7A 2QCMA 1L6SA 2VFDA 1M7OA 5DXXA 1VHCA 1ALDA 1EX5A 3STCA 4ALDA 1P5BA 2V2HA 1GQNA 3TCEA 5U4NA 1OYCA 3N2XA 3TAKA 1GVFA 1FWSA 2QJGA 2V5LA 3FJLA 4L4MA 4IPJA 4AF0A 4ORIA 4UR8A 2VENA 3W1LA 4QNWA 3PG9A 2VELA 3VCRA 3RNDA 4AWTA 1TPC1 1JCNA 4DO5A 2HMCA 4PA8A 1VHNA 3E12A 5F2LA 4R53A 3HIJA 3LTSA 4GJ1A 4DELA 3A5VA 4MIMA 5IBXC 3QSTA 3SW6A 1SZGA 4GE8A 4TR9A 3LB0A 1VZWA 4KFOA 4NZJA 3RMJA 1EWEA 2FTPA 3GNNA 5F2GA 3SZ8A 1JULA 1OK6A 3W88A 3KRUA 2OCZA 1OHLA 4YWIA 1R46A 4PL1A 3AO0A 2A5HA 5D03A 2I1OA 5KTLA 3M41A 3OIXA 3RF9A 4PODA 1YDVA 3L68A 1MXSA 2RFGA 5HWMA 4UMBA 2C6QA 2VFFA 3TU9A 2ABBA 1RD5A 3STFA 2YW4A 1BKSA 1R2RA 5G1TA 2WNQA 2E6AA 3MBDA 1PIIA 2I9EA 4KWVA 5G2IA 1OX5A 3PWAA 3EWWA 1CI1A 3N14A 1QO2A 3T7VA 2HS8A 5AC6A 4MY1A 1OFEA 3L0NA 5FF4A 2WSYA 3KXQA 4X22A 4Z1AA 3BG3A 3MYPA 5LHEA 3S5YA 4OWGA 3EB2A 4XWUA 5I3HA 6TIMA 3GNDA 1J2WA 1LLZA 2EKCA 3JR2A 3MI6A 3IIVA 1Y0EA 3L66A 3QC3A 4C1KA 1F7BA 1R2SA 4Y6GA 1VR6A 2ALDA 3CQ0A 1UUMA 4JDYA 2W6RA 5K2ZA 3G1SA 1ZHAA 5CPNA 4XKYA 2C13A 3QRHA 4GUFA 1KLZA 4UTTA 3L0GA 3WJXA 1WXJA 1VCVA 3L65A 5AB3A 1OK4A 4LY8A 1GYLA 4MJMA 1A5BA 5TQLA 2GVJA 3PC0A 1H7WA 1Z42A 3W1PA 2NV2A 4N9DA 4JTSA 3MO7A 1K8YA 3P7YA 1KTCA 3WK1A 3F03K 3M5XA 3GXPA 3V75A 2R8WA 1OF6A 5J5RA 4UTJA 1RR2A 1KM0A 2ZFAA 3A5FA 3W2NA 1RQHA 3DHFA 4ML9A 3IVTA 2NWSA 1TQJA 1TPEA 3M5YA 1K03A 3LBCA 4UTTC 3PS7A 2C0AA 3NDOA 3L9CA 3ZWSA 2EPHA 4AHOA 5F2IA 4NQ1A 2ATMA 4HIBA 1KM2A 1VGAA 5A5WA 2E68A 4WZHA 1LP6A 5A8GA 1XUZA 1P4CA 2ZCGA 1GVQA 4IMFA 3DI1A 3THAA 4POCA 1FWNA 1TV8A 2QDHA 5J5DA 2PCQA 1XC4A 5AYXA 4O4WA 1SFLA 2CU0A 1IGSA 2QCNA 1QOPA 1UJPA 4MZ1A 4LWWA 1TPUA 3T78A 1FWTA 2DZWA 3STGA 3FA5A 3B03A 1LRTA 1FCUA 2P10A 3W7NA 1MEWA 3W1RA 4NZFA 3LM7A 4JDBA 1H7RA 3PB2A 2J9YA 1B9BA 1HG3A 3FEMA 4GNJA 1FQ0A 1YADA 4O12A 4WOZA 3QSRA 4Y8FA 1KM5A 3IIXA 4BK9A 1K8XA 2CLOA 4U4MA 3LCWA 4JX6A 2B7QA 3GZ3A 1W0MA 3KOFA 1BTMA 3HGRA 3PG8A 3QMSA 3HPZA 4QM1A 4ZQMA 2NWRA 3HGSA 4O1AA 5DCBA 1C8VA 4LS1A 1YYAA 1BWLA 3BPWA 3KAOA 1ONRA 5CPLA 4ADTA 3P74A 2FPTA 5DBTA 5F4XA 4AAJA 4FNRA 2YR1A 4PCFA 3YPIA 5KSWA 4QNEA 3TFXA 1Z41A 1SO4A 1WOAA 3E96A 3LTPA 2OX1A 4NVTA 3FKKA 1NVMA 3DBPA 1ICSA 1IXQA 3M44A 3S1XA 4NXKA 3LXCA 3NM3A 4JGDA 1DVJA 3UD6A 5CPMA 1PHQA 1H7NA 5GVJA 1YLVA 1ADOA 1OFRA 3F1QA 1FCVA 1TTIA 2J27A 4FO4A 4PFMA 5LNUA 2V81A 2YFNA 3G0SA 3PR2A 2ZZ5A 5KITA 3KRSA 1H7XA 4Z1DA 3FFSA 2VEKA 3G1VA 2B7PA 3HG5A 5AHNA 2Z1BA 2TMDA 4I7WA 2FFCA 4EF8A 3R13A 3NQAA 2X16A 3NQ6A 3A24A 1QO5A 4JY9A 4EWND 4M6VA 3DAQA 1QPNA 3GXNA 2IQTA 4MFDA 5DBUA 5BW6A 1PVNA 5EMUA 4JYFA 4RLIA 5D04C 2Z6IA 1EP3A 2OMAA 3KVLA 1UCWA 2GPTA 3DFPA 2WQPA 3P8JA 2E6DA 5FEZA 3DI0A 1H62A 4MJZA 4MYXA 2FPYA 4WY0A 5CGQA 4DPPA 4IMGA 1U5JA 4UFIA 2A1YA 1KBIA 1AL8A 2QJHA 1OG0A 3CLMA 4K8HA 3SSJA 4AB4A 3SJ3A 3NL3A 3NQ7A 1LOSA 2Z2UA 3PVFA 3OVPA 5DCDA 4O1BA 3WK2A 3TJXA 5D38A 3OA3A 1HFBA 5EPDA 1G67A 3HQ1A 3CU2A 5C2XA 4FIRA 3UWYA 2DP3A 4O1CA 5ABTA 5I3GA 6ALDA 3T4CA 5MHBA 5CKSA 4HNVA 3GR7A 3S1WA 1SR9A 1PCKA 4JTTA 4M6PA 2Z0IA 4N9CA 5U7SA 4JTFA 1W37A 2FB2A 4JY8A 4A21A 4FXRA 3S5NA 1TV5A 3LCIA 2YCEA 3TSMA 4MPQA 3I6RA 3PBVA 4D2JA 1XM3A 4CQ8A 1WQ5A 4P2VA 3UPBA 4K37A 4IQLA 2CLEA 3CWNA 2G96A 2QCDB 2UV8G 3USBA 4ZMGA 3O6DA 3IVUA 2CLKA 5H91A 5L6UA 4LVGA 2CLHA 4TMBA 2NUWA 1LBFA 1F74A 3PSWA 1I2RA 2E09A 3LTYA 2LLEA 5IBXA 3JRKA 4HSNA 1SW7A 2JKEA 2EHHA 3HB9A 4A29A 3C2EA 3R12A 2NX9A 3FYOA 1X8FA 1YTKA 5F1UA 1OX4A 2ZA1A 5DELA 3W7QA 3ABRA 3M6YA 4H4IA 4ZZ9A 1UUOA 3INPA 4A3UA 1X7FA 3QFEA 4QQ3A 3TQVA 5C55A 1OVDA 1KTNA 4JEQA 2DZTA 2JBMA 3W2KA 1S5VA 3EWXA 3TC7A 3O06A 1C29A 1ME8A 5K4ZA 1KM6A 1KFEA 4YL2A 4I9AA 4JX4A 4LT9A 5HJLA 2Y7DA 1FX6A 1WOBA 3QPZA 3W1NA 4DEFA 1JCMP 3GYEA 4JTIA 1RV8A 2AGKA 2PRHA 1KV5A 3RFAA 3ELFA 1Q3NA 1KBJA 4UIOA 1IXNA 1XXXA 4R33A 3Q2DA 2A21A 3LX9A 1GYNA 3PULA 4JICA 2Y7GA 2JGYA 1MZHA 3O07A 3NAVA 4N6EA 1TQXA 2KZHA 1A53A 4XBSA 3N34A 2VFIA 3WFAA 3IIZA 3W1AA 2A6NA 3LV5A 3QQ0A 4E2BA 4LC8A 1VQTA 3EXRA 2YPIA 4HKPA 3O63A 2F84A 5T26A 4RCXA 3STEA 1H51A 3W2MA 5AHLA 3CHVA 1GOXA 3MHFA 3W9ZA 1LM1A 3P5YA 1PHWA 3EKZA 3SY5A 2V82A 1LOQA 3M47A 4LU0A 1R2TA 5E1QA 4NX5A 3ABOA 3FKRA 1KFLA 3G1HA 1K3UA 3NYZA 4RKAA 3R5EA 5CSRA 3TSDA 4DF0A 5AHMA 3UWVA 1TJPA 3W72A 5AN7A 4WJEA 5F4WA 2RDWA 1B4KA 2QUTA 5AYYA 3WJWA 2WO5A 3UZ5A 4N4QA 4YXGA 4LTSA 5D2XA 3EX6A 5L9FA 4LNYA 4NJKA 4ADSA 1OF8A 2PURA 2I14A 3TJLA 4UFJA 3H55A 3W2JA 3W2LA 3ZWTA 4JTGA 3W6YA 3TE9A 1WBJA 1ZY9A 2A7RA 3L5LA 3M1ZA 3DXIA 3JS3A 1KFCA 3WJZA 2HS6A 3FJ6A 1EEPA 4IXHA 3PUOA 1Q6QA 3A21A 4K39A 3W7PA 3R2GA 1VH7A 5K3VA 1LLWA 1W54A 3G8EA 4ICNA 1LDCA 1B3OA 3N19B 4IUOA 3B05A 4Z1CA 5FF0A 3V1PA 3O15A 3O6CA 5HUPA 2E5DA 4FXSA 4QJ1A 3SIZA 1T8XA 3TR2A 4Q32A 1OFQA 4M5PA 4CQ9A 1G4TA 1F76A 3IGUA 4GUIA 3W07A 4QAIA 1XBVA 5FI8A 2QCGA 4BR1A 3NXFA 1SFJA 3O6YX 5AC7A 2A0NA 1ZJIA 2A7NA 2QCLA 1PCWA 5D37A 4N02A 3UY8A 2QCFA 3UNDA 5K9CA 1YTDA 1GG1A 2ISVA 4UTIA 4E2DA 4OQVA 3G3MA 2Y7EA 1DQXA 3B04A 1FXQA 3GXTA 3WJSA 5K7JA 2BWGA 1QNVA 4A22A 5HWNA 1Q45A 1QFEA 1EA0A 2B7NA 3DHDA 1SSDA 4A2SA 2VFGA 4FF7A 3LCXA 1W3TA 4IX0A 5HINA 5FF2A 1LROA 4FNQA 1SZEA 1N55A 3NQ2A 3VKJA 3G1YA 1W56A 2RDUA 3RLUA 4K7VA 2VC6A 1FY6A 3SGZA 3TMQA 2VKZG 2XN0A 2NXHA 1TTJA 4FHAA 3L5AA 2ZZ1A 3B0UX 2ZZ3A 3LXBA 5D32A 3W85A 2Q3RA 2J9ZA 2ZA2A 2ZTKA 4O28A 3S6DA 5F1VA 2YSWA 5LNSA 2QDGA 3TNOA 1KFBA 3LI0A 2FDSA 4O18A 3GDKA 3VI2A 3K30A 3EWYA 3O05A 4QISA 3S8HA 3PBUA 4WXZA 4O19A 1W5PA 2CZFA 1W3NA 3NL2A 1K02A 3P5ZA 5EL1A 4S1FA 1JCLA 3IGXA 4IJBA 4ZVJA 4YCPA 4N4PA 3EWUA 1AL7A 3BG5A 2GVGA 3T55A 2O7QA 1YXYA 4LRSA 1D9EA 1H5YA 1V5XA 3W1UA 1JCYA 1OFPA 1DORA 3TQKA 5CZJA 5EBUA 3W3OA 1W31A 3EX3A 3M9YA 4ORMA 3U6WA 1PV8A 2X1RA 2B7OA 3LHZA 4UFLA 3HGJA 1AW1A 2NX1A 4K38A 4OHQA 3S1UA 4Z08A 1VLWA 2ZRWA 5EA9A 4Z0SA 4DF1A 1QWGA 1VCFA 1TYGA 3W1MA 1K7EA 2JKPA 3RK8A 2YW3A 2TRSA 3B0PA 1AK5A 1GTEA 1FDZA 3GLCA 7TIMA 1SO6A 1OFAA 1AW2A 1W5MA 1NAL1 2BZNA 3LGEA 3EKLA 3U2OA 4NUWA 3Q94A 1EUAA 1RVGA 5AHFA 2ZZ4A 4JXCA 3A23A 4O54A 1JCXA 4O13A 1S5TA 5EY5A 1JRBA 4RZ6A 5CZ0A 3THQA 4AHQA 2ZZ2A 3NNTA 3P8IA 3TFCA 3TV8A 3HF3A 3UXDA 2ZRXA 3MMTA 3W2UA 1TPWA 1XBXA 3TROA 3E9AA 1UASA 4TIMA 1G7VA 3G1FA 1KFKA 1FXPA 2WKJA 4OE7A 5G4WA 5LZLA 4WY0B 2H8ZA 3Q37A 3GK0A 3NVTA 2VXNA 3LCGA 4MZYA 4J9JA 4AMAA 3SECA 1TIMA 1TPVA 1VCGA 3UWQA 2JGQA 1YPFA 1THFD 3S42A 1LBMA 3HG2A 4ZQPA 1NSJA 2YYUA 2Q8ZA 3L5MA 3M16A 3CC1A 3M7WA 3E0IA 2W0UA 2R14A 3NQCA 1WBHA 3T44A 8TIMA 5F4SA 4MZ8A 1J5TA 1XFBA 2V9DA 1PS9A 1LBLA 2WNZA 4LV9A 3M5ZA 4X3ZA 1TRIA 5AHEA 3LLFA 3B4UA 1ZCOA 3CIWA 3ATYA 5CZTA 4BFAA 2QUVA 3M0ZA 4HPJA 4JNMA 4PTNA 4HSOA 3DFSA 4PEKA 4O57A 2X1TA 3C2VA 3LOTA 1M5WA 1A5AA 1KV8A 3I65A 3N3MA 3MHGA 4R7JA 3NQDA 1IF2A 3ABSA 1ME9A 1ZENA 1ZALA 4GFSA 4UMAA 4MFEA 1JQXA 5KZMA 5CPOA 4HPXA 3TXVA 2C3ZA 3W7EA 3W7OA 2ZDRA 1VYPX 5D30A 4BWLC 4CCEA 1GTHA 1GJPA 1QCWA 2DZSA 2CW6A 3N9SA 2V2DA 3KHJA 5DY2A 1SW3A 4JYDA 1LRNA 5LNWA 1QPRA 3Q58A 1ZFJA 1QOQA 1EUNA 4L4LA 1W5OA 3C2RA 2EGZA 2G5WA 4QITA 1HO4A 3QW4B 3W7CA 2YX0A 4FNSA 1DJQA 5G2WA 3S0CA 2JK2A 3TIMA 5AC8A 2ZRZA 5HQEA 4A2RA 1ZAJA 1KLYA 4LRTA 4BWLA 4LV4A 3NQFA 4LS2A 1IIHA 3IRDA 4NT0A 3S1VA 4MVAA 4WY0F 2Y89A 2QAFA 1TPH1 1XKYA 5H2ZA 1SU5A 5HMSA 3QH2A 1LOLA 5BMXA 1B4EA 2HTMA 2J88A 2ATSA 1G4SA 3CWOX 4IMEA 4YMZA 3W23A 1T96A 2J24A 3NZRA 4NNAA 1FCQA 3G3DA 5CSSA 3DZ1A 1NF0A 5TIMA 3R89A 4IGHA 5E93A 1HTIA 1W5QA 3W7DA 2R94A 2H8XA 4GUGA 4YLWA 4RR4A 3C3NA 3GVGA 4XUGA 4NJGA 4XQ6A 3QMRA 3TAOA 1AG1O 4ZQNA 2CZDA 2F7FA 2QKFA 4TU1A 3TXZA 4DPQA 4Q33A 1GVOA 1GEQA 2PRLA 2ABAA 2OJPA 5FEPA 1SO5A 4TO8A 1FBAA 1TPB1 2NX3A 4ONVA 3T40A 1M7PA 1I8JA 1NEYA 5FF7A 4N2YA 5I3JA 3ZS4A 1W3IA 1WV2A 2WNNA 3BGGA 2XFWA 1C9DA 3PM6A 5G4EA 1LORA 2NZLA 1QPQA 2TSYA 3LHUA 4KKXA 3I68A 1E51A 1O94A 1ZNNA 2YXGA 3W7IA 5C54A 3P81A 3UZJA 1I45A 4PL2A 5IM51 4ZL1A 5G2HA 5I3FA 4IWWA 4QIUA 3W7HA 3LV6A 1DV7A 2V0TA 4OU1A 3C8FA 4AWUA 2H90A 2VEMA 3BO9A 4CNNA 4GC4A 4MLRA 3QYQA 1J4EA 4UFHA 4WUIA 5K4XA 1H63A 2ZZ7A 2DZPA 3W1XA 1H60A 3DFTA 5LNRA 1OX4B 3DU0A 4OBTA 3TSBA 3PUDA 4FNUA 3NQ8A 1T99A 4Y9AA 4XKYB 5HR7A 2Q8LA 4WX2A 5D2YA 1I2PA 3QZEA 5FEWA 1JUBA 2CLMA 2P1FA 1H1YA 1P0NA 1W5NA 3F4WA 4NNCA 3W74A 1ZAHA 4OT7A 5D2TA 1HUVA 1IIGA 3A22A 2YYTA 3MUXA 1OYAA 3LLDA 3VFLA 3PF3A 5DY3A 1FUYA 3GDLA 1OX6A 1VYSX 1WAUA 3BARA 3W7RA 3W71A 3QEZA 2DORA 3AJXA 3OEXA 1EB3A 1O5KA 1RQEA 1W1ZA 2C18A 2CZ5A 1DHPA 2FLIA 4WD0A 2V2CA 3W7MA 2PRMA 4AVFA 3IEBA 1X6UA 2A2IA 1DBTA 3PBWA 2Y85A 4XBKA 3LBMA 2DJLA 3C52A 4LUJA 3DKLA 1L6WA 2C19A 3CIXA 3TA6A 3TQ0A 1F6PA 4X2RA 3BG9A 4GWEA 3MP5A 3M5VA 2C15A 3KFTA 1GT8A 4OV9A 3RU6A 2ZYFA 4IOTA 3W7KA 2BXVA 2ZRVA 5AHIA 5BNKA 1O60A 1FDYA 4M19A 3MWAA 1SSGA 5C5YA 1OABA 1Z44A 1LZOA 3C6CA 4EOUA 4Q4KA 4JD4A 3QQ1A 5EKYA 2QJIA 1F5ZA 2Y6ZA 3BVJA 1EWDA 1GVSA 5I3IA 3L67A 1XDLA 5DXYA 4RXGA 2ISSA 2J9XA 1F73A 3LCHA 5HULA 1L2UA 5HNRA 4UCGA 5LHFA 1EP2A 4UTHA 2AQWA 3TX9A 3NM1A 3DFNA 4MKNA 1KA9F 1DJNA 1L6YA 3PBYA 4HNUA 3IGSA 3CB8A 3QMTA 1S3HA 4BI5A 1F2JA 5CZSA 1XBYA 3IIPA 3C2OA 5KZEA 3OHIA 3ATZA 4AHPA 3OVRA 4JTUA 3W86A 1D3GA 4EVZA 4M7SA 1M6JA 1SZNA 3I7SA 3OBKA 2C14A 3B06A 3QPYA 3W22A 2NUXA 1XCFA 3TMLA 5F2MA 4UFMA 3G18A 4DO6A 2C1HA 3W73A 2WSRA 2RHGA 4CCDA 3W70A 4M7TA 3PY2A 3E49A 4K6AA 4LW7A 1BWKA 3HPSA 3PSVA 5D33A 3VE9A 3UPWA 1ICPA 3BV4A 4S2BA 2WV8A 4S2CA 4LVAA 2GQ9A 3TW7A 1FWWA 1MEIA 2DJXA 2NV1A 2WOQA 4NJJA 1WX0A 4JTKA 3W1TA 4UTWC 3P84A 3QJAA 1TMHA 3G1DA 3BLEA 3EEGA 4KFNA 4H6KA 3FLUA 2TYSA 2BX7A 3G0UA 3NPXA 1YXCA 3HJZA 1RQBA 3WJYA 2ZRUA 5EYWA 2QAPA 4I7UA 2V8ZA 3HBLA 3GX9A 4JIQA 1P0KA 3S5ZA 1EPXA 1K7FA 2PE4A 2NXGA 3KRZA 3B0VC 3HG3A 1Q6RA 3HPXA 4WOQA 1QR7A 1RZMA 5KINA 3KVKA 3NA8A 2Y62A 1B57A 2WPBA 2A7PA 3UWWA 1XUUA 3NQMA 4UTKA 4RZ5A 4KFPA 3KVJA 3NPVA 5K9DA 4O8RA 1O4UA 4LVFA 4BF9A 2GQ8A 1G7UA 4N9BA 1JCJA 3LDVA 4OGZA 1GZGA 1VLIA 3CM4A 1VS1A 3NG3A 5DLCA 4C1LA 1YTEA 1XI3A 1NF7A 3BGJA 5G1YA 2Y61A 2Y63A 2BTMA 4RV8A 4ADUA 3HGOA 4O52A 4HNTA 5DCEA 4N9EA 4I7VA 3W75A 5BOOA 1FDJA 2RH9A 3LHTA 2H3DA 1OFDA 2QR6A 4UTLA 5DN1A 3W7LA 3EWBX 3NZ1A 4RXFA 3EX4A 2VEIA 4LVDA 3ZFHA 3SFKA 2G97A 2WJZA 1SZFA 1TTPA 2DZVA 4IX2A 1H7OA 3MI2A 1QAPA 2QCDA 2ZBTA 2QF7A 4GUJA 2ZQ0A 4AF0B 3NL5A 1Q6OA 1HL2A 2W79A 3WK3A 1JR1A 4XTDA 4O14A 1TPFA 1GG0A 3PB0A 2ZRYA 1JJKA 4EIVA 5D2VA 3M43A 2ZZ6A 3FOKA 2CFFA 4UNKA 1X1ZA 4MY9A 5LGXA 4QSHA 4UNLA 4TMCA 1G6CA 4FEZA 4W9TA 1I4NA 4FX8A 1EP1A 4NX0A 1LRQA 1MSSA 1JVNA 3O16A 1IXOA 4KWWA 2QEZA 3P80A 1YXDA 4YCOA 1TREA 5AYZA 4NU7A 2GJNA 3UWZA 3OG3A 3NGJA 3LRKA 2H3BA 3C2FA 4GBUA 3LCFA 1R47A 2OT0A 3MHUA 4LS0A 2OZ0A 1GWJA 2EAWA 3A9IA 5AOUA 1IXPA 1OFOA 2XN2A 3G24A 1OFBA 4JTLA 3TH6A 1F05A 1L9WA 3C56A 3GKAA 5D05A 1VC4A 1QPOA 5FESA 4R34A 4IXXA 1YPIA 3MP4A 1HO1A 1KM3A 4OV4A 5HR6A 1KM1A 1QMLA 1FCBA 3LRLA 4GUHA 2FJKA 4BI6A 3ANYA 1LTDA 3G8RA 2NUYA 4LC6A 2FPVA 1LYXA 4M6QA 2QCEA 3W76A 5HWJA 2VEPA 5KMYA 3KVMA 5CG7A 2GJLA 1Z48A 2CWNA 3O8AA 3W84A 3NEVA 4JTEA 2B4GA 4DQWA 3MW7A 4PC8A 3LCLA 3MYOA 3F4NA 3DENA 5I3KA 3G22A 3UYCA 4CNPA 1SUXA 1I2NA 1KW1A 4ZQCA 1UB3A 4XZ9A 5LKYA 4AWSA 3RLVA 4O1DA 3S5OA 1WDWA 4JR5A 5E0KA 1F6KA 5D09A 1TSIA 1K7XA 4XTIA 2Y88A 3B8DA 4LUIA 3EX1A 1YDNA 2QCCA 3BW3A 4N6FA 1I2QA 1V7YA 1XL9A 3HG4A 1G4EA 4P61A 3KX6A 2RDTA 4TX9A 3W87A 2CLIA 3P60A 4JS3A 3E02A 3CEUA 1O5XA 4O0KA 3NL6A 2V30A 3BW2A 1H61A 2VOMA 3HOJA 3C61A 1PL9A 3W7GA 1N8FA 4RK8A 2CLLA 2YDAA 4O4VA 4DO4A 1WYIA 2C16A 1SO3A 4O16A 4U28A 5BRBA 2Q3OA
chains in the Genus database with same CATH superfamily
1FWBC 3NQVA 2ZKMX 3U48A 2E6YA 4H41A 1I2OA 3K8KA 3RPTA 5G5IA 3ARQA 3RO8A 4JCMA 1R3WA 3G1XA 4AFYA 3UWUA 1DKWA 2YOCA 3QLDA 1W1PA 5I6SA 3BAKA 2FB3A 1UP2A 4AC1X 3URNA 3BE7A 3T1GA 1OT1A 3BZGA 3HPAA 1H50A 3O1NA 2VEGA 4LVBA 4JYEA 1VRXA 4IMDA 3R43A 3UXAA 1UD6A 2Y7FA 2Q02A 3G77A 2JKAA 2GQAA 2V5KA 3D6NA 4DXVA 3O3RA 3QC0A 3PANA 3GDMA 3ES7A 3Q67A 1XINA 2WNWA 2Z6JA 1NDZA 4JTHA 2A4AA 4WDWA 3PWIA 3MJYA 1TRDA 3ARPA 3RYSA 2BBFA 3BW4A 1UIPA 1YEYA 3IJ8A 1HGWA 1XLIA 4XKMA 2FVKA 1T5AA 4AEOA 4HN4A 2IQDA 3MT1A 2CEQA 3IV3A 2PDGA 1BGAA 4UFKA 4QXIA 2FQIA 4O50A 4L9YA 1BG4A 4NNBA 1B30A 1O95A 2PDBA 1Z8AA 1I75A 2X0YA 3TTYA 1UZDA 3WLLA 1V03A 1GOOA 1PKMA 2OTDA 3V4BA 3PUGA 3NR0A 2VDIA 2XWEA 1QW7A 1FWIC 3NOEA 1GGOA 3ABQA 3WUBA 4MWAB 3TA9A 4CVUA 5BROA 3V16A 2ACQA 2JIEA 3CV2A 4YWSA 1DQWA 3FYPA 3P67A 1ESWA 4G56A 1T0OA 2A85A 4IMCA 2NSOA 1NFBA 5A6KA 1S2UA 4ZQRA 4U3AA 3SCVA 5CLWA 5HNTA 5HNNA 3VZXA 3ANVA 3OO2A 4UUIA 4C60A 3AMGA 2HBVA 3W02A 4JHMA 4C6FA 3UP8A 1CX9A 2CXEA 3UY7A 3PAJA 3W6LA 3MKVA 1AMKA 3K2GA 5DRIA 3QKZA 4DVOA 3C4UA 2E8ZA 3VGFA 4CCCA 3ECQA 4CU7A 2HJPA 4US5A 4IPIA 4LXFA 3I4KA 1Q7QA 4F8XA 2PBGA 4RJEA 2EF9A 2RJHA 1OCQA 1SW0A 4DM1A 2G4JA 2R91A 1TPDA 3G1AA 1R30A 2P53A 1U83A 3R11A 3MDWA 1C7SA 3BOFA 4Y90A 3E6EA 3GKFA 1QDSA 1L6FA 1OBAA 4D6FA 3DFQA 2PDPA 2OT1A 4UR7A 2E77A 3KL3A 4GXMA 3UW6A 1V0MA 4KRTA 3VDGA 3TW9A 4JIHA 1IV8A 1LG2A 4MY8A 4KEVA 3VNDA 2ZVRA 3S47A 3EXSA 5HUOA 1MNZA 3PUEA 4R7WA 2P0OA 1IWAA 5BOEA 2XIMA 4OKDA 1ML1A 1TWIA 3S1GA 1WXYA 5CZKA 1HL9A 3EB3A 1KXTA 3DYMA 4Z2JA 2X7WA 3L21A 3UWEA 2G95A 2GSJA 4NYYA 3WD1A 3N73A 1A0EA 1JYWA 4HNNA 4QE4A 1PPIA 1Y8BA 5D9NA 4ZE5A 1WA3A 2X1UA 4TQTA 4GI8A 3WH6A 4FB7A 2RKXA 1WKYA 3CYVA 5C9RA 1MW0A 1YDOA 4ZBCA 3ALFA 1VRDA 1E0TA 1JZ5A 1YPXA 1HT6A 3RRAA 3FS2A 3CNYA 2XH0A 4DF2A 1ME7A 2QCMA 4GXWA 1PIGA 4DX3A 3AS0A 2VFDA 2D2HA 4TV5A 5DXXA 1ALDA 4XIAA 3STCA 1P5BA 2V2HA 3FHQA 5U4NA 1CWYA 2UY3A 1ZP4A 3N2OA 4AMCA 1MW2A 2V5LA 4PFHA 3FXYA 3FJLA 4H19A 4L4MA 2O0TA 1XYBA 2VENA 2NQZA 2Z1SA 2OG9A 1HX0A 3WLPA 4QNWA 1X39A 1BHGA 3RNDA 3W4RA 4DO5A 2HMCA 1Z9AA 3EKGA 5FL1A 4TR9A 4S3EA 1W9PA 4KFOA 1UD3A 2A3BA 3SZ8A 1JULA 1W9UA 1R3QA 2VR5A 4W5ZA 3IUIA 4H8NA 2A5HA 3VA8A 5D03A 2I1OA 3CZKA 3O7UA 4NSBA 3OIXA 1I1WA 2BNJA 3EPNA 2PDXA 1YDVA 3UVIA 2OPJA 3L68A 5HWMA 4IFKA 1M7JA 1RD5A 3STFA 1EO7A 1F9CA 5I78A 2KX9A 2E8YA 3S5SA 3AWOA 3PWAA 3AHVA 2O92A 4HP5A 3N14A 3T7VA 5AC6A 4JNYA 1DXFA 1RPKA 3E74A 4J2MA 3N2BA 4XZNX 3S5YA 4OWGA 4XWUA 4AEFA 4B4HA 4PMXA 4ZO7A 5C71A 3H8AA 1J2WA 8XIMA 2WW5A 1Y0EA 5D8ZA 4DLFA 1FWEC 3OLIA 4GG9A 5C9XA 2ALDA 3CQ0A 3T08A 5I79A 4C6NA 2VWSA 4KEMA 2W6RA 3G1SA 1OC7A 3RU8X 2F2HA 5BRPA 1G0CA 1WXJA 1IEWA 1VCVA 2D2OA 4MJMA 1TWZA 3M6DA 1Z42A 3W1PA 4V33A 4PMZA 1K8YA 1FHUA 3WK1A 3F03K 3WQCA 3I6EA 1RR2A 2WANA 2WVUA 3A5FA 3SFWA 3DHFA 2YA2A 5FJOA 4L5ZA 3ZJ6A 1K03A 3NIYA 3WKZA 3UCDA 2J79A 1UZHA 4DYKA 4WJ8A 3L9CA 4GPNA 2Z28A 4DYJA 4NQ1A 4G6CA 3BLPX 1VGAA 4PCSA 1YBQB 3VYLA 3WQ8A 1FWDC 1FOBA 1GVQA 1QWKA 3AIRA 6XIAA 3DI1A 1XC4A 4H1ZA 3RR4A 5AYXA 3S3GA 4HCHA 4GO9A 4F0MA 2DZBA 3TN3A 4MZ1A 4LWWA 3T78A 1FWTA 3FA5A 4KRUA 4MADA 5HPCA 3LM7A 4PUUA 4R3UA 4QDMA 2J9YA 4G7EA 4HU0A 4GNJA 2XIOA 2WMGA 2G3FA 5C7HA 2J7EA 2PWUA 3AIBA 1K9FA 3OA5A 1V6TA 3LCWA 3PZIA 1CBGA 1VJZA 4NZCA 1MI3A 5LIWX 3GZ3A 1UP0A 1W0MA 1SVDA 4DJED 2J8FA 2ZUNA 1BTMA 4HMDA 3TCSA 1CT5A 2VC5A 4ZQMA 2NWRA 5FOOA 1UJQA 1M65A 2W92A 3H12A 4F2UA 3PTKA 4ADTA 2J62A 2YR1A 4RNHA 4QP0A 3RX4A 4GX8A 5CAHA 4Z2HA 4HN8A 2GOKA 2OX1A 1SYTA 3THUA 1IXQA 3KWXA 3SCSA 3HQOA 2OEMA 3K8MA 4US6A 5XIMA 2GUYA 5CPMA 5HQMA 1XRFA 3NURA 2VX7A 1YLVA 4PMQA 1OFRA 2W61A 5HBFA 4DHGA 2BXZA 2YFNA 3PR2A 1O12A 2ZZ5A 4ACZA 4AZCA 2XHYA 3UVAA 3PNZA 3PTMA 2O55A 2YA0A 4Z1DA 4H9MA 4EP8C 2A3LA 1XPGA 2OVLA 4HMCA 1Y5XA 4EF8A 1LT7A 5DMYA 3NQAA 3NQ6A 3VZZA 5BW6A 1QPNA 3GXNA 5C8BB 1VEMA 2OMAA 3U4AA 5FEZA 4JQ1A 2FH6A 2HPIA 1H62A 1TMQA 4MJZA 3SQSA 1DJWA 3VOIA 5HQLA 4DPPA 4KF1A 3FA4A 1ZBVA 1DP0A 4UFIA 5EU9A 1FHVA 4MWAA 3CLMA 1MVYA 3SJ3A 3NQ7A 3CO4A 4XZIA 3TJXA 2GK1A 5EPDA 3WD0A 1J0IA 3ITVA 3HQ1A 4ZTYA 3CU2A 1IEQA 4FIRA 2DP3A 1AQHA 4IIBA 2JEPA 1ELSA 2YBVA 7ENLA 1XC6A 4N9CA 3RJYA 3OG2A 1VFHA 3VIFA 3MU7A 5U7SA 1PWLA 4JY8A 2YZ5A 5A2AA 1EL3A 2YCEA 4D2JA 2EG7A 4CQ8A 1WQ5A 3UPBA 1VFUA 3Q65A 4IQLA 3CWNA 2XZ9A 3VMPA 3USBA 5H91A 3IVUA 1P6WA 8XIAA 2CLHA 2NUWA 2QZRA 3WDHA 1I2RA 4I6KA 2E09A 3LTYA 5CGTA 5IBXA 2JALA 3BJSA 4HSNA 1Z69A 3HB9A 4GGHA 4W7VA 3ZR5A 3R12A 3FYOA 3BAYA 4QQUA 5F1UA 2ZA1A 4PTMA 4KGLA 3EA1A 3ABRA 1XGEA 4W7UA 1ECQA 4A3UA 1X7FA 3CUHA 4QQ3A 1OVDA 3DFYA 3REQB 2WB5A 2NLYA 2DZTA 4HSHA 1S5VA 3EWXA 3TC7A 3N12A 4L9ZA 4LUTA 4RNJA 3TP4A 4YL2A 4JX4A 4LT9A 3CUIA 4DM2A 2Y7DA 3QPZA 3IANA 1S5NA 4H9ZA 3DN5A 1JCMP 2AGKA 1MMFA 4RDZA 4JOMA 1Q3NA 4RE2A 1UWSA 3SGGA 1VJSA 4B2DD 1ZLPA 2BS9A 1TV2A 2A21A 2PWDA 1GYNA 1WO2A 4HJWA 3T2PA 2WC3A 4K68A 4N6EA 2CBIA 4Y8EA 3M0MA 4GVGA 4EANA 2FGBA 4IIDA 4W4QA 1NWSA 2VO5A 4RNFA 1J18A 2VFIA 3SIMA 3WFAA 2WCAA 2BVTA 3K4DA 4WGXA 3VGBA 3CHVA 4GOAA 1BXBA 3MHFA 3W9ZA 1E0UA 1TA3B 1RHCA 2O4MA 3DUGA 3M0VA 3M47A 3BJFA 1E6NA 2VD9A 2R82A 3CK5A 2WMJA 2P3ZA 3WH5A 5ABHA 4F79A 3N17A 5CSRA 4C6LA 4EE9A 4JFVA 3UWVA 1WZMA 4IGMA 2O9TA 2D1ZA 3OQEA 4WJEA 5F4WA 2ZUMA 1UYQA 1NM9A 2POZA 2Y8UA 3TTSA 4YYCA 3CAQA 4KETA 5D2XA 2EG6A 2BP1A 3EX6A 3H4WA 3UXLA 4NJKA 4ADSA 1XH2A 1OF8A 3WEZA 3N6QA 3TJLA 3D47A 2GLKA 3W2JA 3W2LA 1EJVC 1BRLB 3T2QA 2EXOA 1ZY9A 2WSPA 2XZ7A 4XD5A 3VNJA 3L5LA 3M1ZA 3U7BA 4KT2A 3WJZA 2HS6A 4HOXA 2PS2A 3GBEA 2BY1A 3OP2A 4A4AA 4FR6A 5K3VA 1LLWA 1J0ZA 3BXWA 3PJWA 2QJJA 5FJUA 2PF0A 3N19B 2DW6A 4Z1CA 3PPGA 4IG2B 3UG4A 1RLCL 4J7RA 5GJPA 3SUUA 1IT0A 2OKTA 4Q32A 3GG0A 4GUIA 3WENA 3K4WA 4BR1A 1AZ1A 3NXFA 1SFJA 5CPQA 2A0NA 2A7NA 5GNYA 3UY8A 3VGEA 2QCFA 2RUSA 1O1HA 3ISIX 4WF7A 3RX3A 3WLJA 1GG1A 3BCJA 3EEZA 4OQVA 3SEPA 3E0LA 4RUBA 7ODCA 1UD2A 3VU2A 1YBQA 3AFBA 1OZQA 1QNVA 5HWNA 2Q09A 4IH3A 3DHDA 3VKCA 1W3TA 4LH8A 2PDJA 1M9HA 7CGTA 3QR1A 3LNPA 1E3ZA 4MNLA 2Y5EA 3UJRA 4EPKA 4FNQA 2YDQA 3NQ2A 3VKJA 2RDUA 4K7VA 4AISA 4INFA 1DQUA 1JAKA 1JYVA 1X38A 4JKKA 3TMQA 1TTJA 4IHCA 3BOLA 2ZZ3A 2OZ3A 3SO7A 2J9ZA 1LL4A 3PZMA 3LNMA 4H6RA 5F1VA 5LNSA 2IS7A 2VCAA 4QLLA 3GH4A 4M56A 4YPJA 3S8HA 4MWAC 4WXZA 2CZFA 4ECLA 3ME3A 3NL2A 1K02A 2G3JA 3P5ZA 5EL1A 4CN1A 5E9XA 4IJBA 1P7TB 4MAVA 3WBAA 5LXXA 2GL5A 4YCPA 4N4PA 2X0SA 3HN3A 4DZAA 1EJXC 4C6BA 3BZJA 1XLDA 5XIAA 2GVGA 2ZE0A 3VXGA 4LRSA 2W91A 3W1UA 5FL0A 3E2SA 1OFPA 1HKWA 4G9PA 2WMHA 1X6NA 1XLLA 4IZGA 3MCMA 5EBUA 1DIKA 5C7VA 3C2YA 2ZX8A 2FHFA 1FA2A 3M9YA 3A4XA 4ORMA 2AKZA 4CD4A 4J4KA 3B8SA 3OZYA 4UFLA 1RJQA 8CGTA 1J0YA 4OHQA 2NV9A 2DEPA 1RCOB 2INEA 3ENLA 1L0PA 1DTUA 1B31A 1QWGA 1C8XA 1HJSA 3AYTA 3B0PA 3AIWA 1KXVA 7TIMA 3GLCA 3JUGA 5HA7A 3VD7A 1AW2A 1W5MA 4JTDA 2BGSA 1YQ2A 4NUWA 1R9YA 3CUZA 4GJIA 1OINA 1HN1A 4LYKA 3THQA 1QOXA 1TMLA 1K9DA 3TV8A 3HF3A 4CEXC 1KKRA 3WDPP 3MMTA 2VX5A 3W6MA 2Y5JA 5C9ZA 5G4WA 3LU2A 3CUJA 1EIBA 3HFYA 4IJCA 2G37A 7REQB 4ZEPA 2QF8A 3UWQA 1QPKA 2JGQA 4QE5A 1THFD 2ODOA 1LBMA 1MRQA 2NW0A 4KIEA 1YE6A 4NIRA 4ZQPA 3QY6A 3M16A 2X41A 4J3WA 4XAZA 1UKPA 1WBHA 3T44A 4FXJA 1XFBA 1LBLA 4LV9A 1WZLA 3M5ZA 2VZVA 4X3ZA 1TRIA 2PFHA 2PA6A 2Z2BA 4DWSC 1ZCOA 3CIWA 5CZTA 5H6HA 3URBA 3TTEA 2X09A 3CUGA 1GW1A 2O56A 3ZT5A 1M5WA 3I65A 3N3MA 2Y8KA 1JDEA 5JIWA 3NQDA 4P8UA 1TE6A 5IXEA 1V3MA 4GY7A 3QFWA 3WUGA 3W26A 3CXOA 2MNRA 4BWLC 2ZICA 1Q4NX 1QCWA 3KHJA 2V2DA 5DY2A 3VD5A 4F2BA 3IRSA 5BOFA 1EUNA 1V79A 3C2RA 5FCZA 2ZX5A 3W7CA 3KBNA 4FNSA 1DJQA 2BB0A 3S0CA 3NZGA 2ZRZA 5T91A 4LRTA 5B80A 1DJHA 4LS2A 3ARYA 3ZQ9A 3L4UA 2YJQA 5HMSA 1GQJA 4Q6XA 3QH2A 1B4EA 1P0EA 3OODA 2OWWA 4I90A 1G4SA 3RDKA 3TTOA 4YMZA 3W23A 1T96A 1SM9A 2VR4A 3NZRA 3P2VA 4NNAA 3DZ1A 5TIMA 3R89A 3MC5A 4IGHA 2R9RA 1HTIA 1BXNA 1D2KA 4RR4A 3MZNA 3GVQA 3QPEA 3GZAA 4NJGA 1AG1O 3TYEA 4FXFA 2QKFA 4F9JA 5B7ZA 5LA0A 3V0SA 3LPGA 3GHTA 1K1DA 2PC8A 2PDLA 3GTNA 2POTA 5FEPA 2NX3A 3MMDA 2OFJA 2OXNA 4M81A 4EKJA 1BWVA 1NEYA 3TNBA 2EPNA 4AVOA 3KOZA 4AC7C 1W3IA 1WV2A 4XG1A 1C9DA 3NOYA 3WLOA 2GJPA 4YU1A 3C0LA 1LORA 2WLYA 3LHUA 2XUCA 4Y9NA 4XVEA 1JPKA 1E51A 1ZNNA 2YXGA 3P81A 5HMDA 3UZJA 1I45A 2PZNA 4IWWA 3CMGA 1DV7A 4ML4A 1ISZA 4AWUA 3V3WA 2EKGA 4CNNA 3AMLA 3H2NA 1H63A 3ZO9A 3VO0A 4NI3A 4XX6A 3DFTA 2Z26A 3U9IA 3DYOA 2QJMA 1DJZA 5HR7A 1E73M 1I2PA 3QZEA 1GQKA 3AIVA 4QRNA 3OB8A 1JUBA 1PO9A 2MUCA 2H9AA 4Y2WA 1UKOA 4YTSA 1EDTA 4AZ5A 3M7SA 3A22A 4I3GA 1V6WA 1UOKA 2W27A 3WL0A 5DY3A 3LENA 3IJQA 3E2QA 2FZBA 4HHMA 3OW1A 2BXYA 2VDGA 1O5KA 2C18A 5FSDC 1DHPA 4WD0A 2P8BA 3LPOA 3IEBA 1X6UA 2GDQA 2A2IA 2HXUA 2DJLA 4K2SA 5JBFA 4LUJA 3N04A 1ZBCA 1QNOA 2J7HA 1VFSA 4C7DA 1AQFA 1OGGA 3BG9A 1RJRA 1EZWA 4IOTA 3W7KA 2OLHA 4NHVA 5AHIA 3WF3A 1O60A 1FDYA 2DIKA 2OGJA 1Z44A 1LZOA 3C6CA 4EOUA 2YKKA 4TOQA 4KCVA 1NQ6A 1Z7AA 3H22A 1ZB5A 1IYXA 4W7WA 2Z1VA 3LCHA 4ZXLA 1L2UA 2Y24A 1VIZA 5LHFA 4XK2A 4AQLA 4MKNA 1CECA 1L6YA 2DH2A 3O2LA 4P7QA 3MUAA 1TJ0A 1F2JA 2CLPA 1XBYA 2YIHA 4V1XA 3MY9A 1R87A 4R85A 3ATZA 1K77A 4RW3A 4JTUA 4MG4A 3RXZA 2IKJA 4P5UA 2NQLA 3APTA 1M6JA 2J78A 4PSPA 3B06A 4ICMA 2QLYA 4LBSA 2RHGA 1TZ9A 3W70A 3L4WA 7XIMA 2PF8A 4K6AA 4QJ5B 3PSVA 4BA0A 4BKNA 4PMOA 5MKGB 4S2CA 3RAOA 3P14A 1Q6EA 2AOSA 2GQ9A 1MEIA 2NV1A 4I9TA 4JTKA 4UTWC 4PB4A 3EEGA 3FLUA 4DJDA 2TYSA 3ZLFA 2BX7A 1XF0A 3G0UA 3KP1A 3NPXA 1J0KA 2FZDA 1WXZA 2QAPA 4X60A 3GX9A 4JIQA 4BCEA 1WCGA 3UESA 1D7KA 1FVPA 4J27A 1K7FA 1DIDA 3HPXA 4O1EA 3T0CA 3F5KA 5I02A 1LWIA 2IKGA 1B9ZA 1KGXA 5HJXA 4Z42C 2V5CA 1OD0A 4B9ZA 1AFSA 1EYWA 1ONXA 5HAOA 4U33A 2BY2A 4DBWA 1GZGA 4DUWA 3CM4A 4DYEA 2FJUB 2PTZA 1XI3A 2UY2A 1XHGA 4OBRA 4GCXA 4L1GA 3BGJA 1V3KA 2Y63A 4HNTA 4MHBA 3ICJA 3H2OA 4C6QA 4NZ4A 4FS9A 4KQNA 1EJUC 4PB5A 4FAMA 4I5XA 3OZMA 4XBJA 1QI4A 1QHOA 4LALA 3HURA 3GHSA 2DZVA 4WKHA 1H7OA 4C6IA 1QAPA 1XD1A 2QCDA 2QF7A 1EPVA 3RR1A 2CKSA 4AX6A 2HROA 3R6IA 4KERA 2W79A 1JR1A 4XTDA 3W28A 4O14A 4C91A 1ADDA 2ZRYA 1A5KC 1JJKA 4EIVA 5D2VA 3JZEA 2ACUA 3P3BA 1I6NA 2E1WA 2CFFA 2D20A 3TJ4A 1X1ZA 5LGXA 1E0VA 4FEZA 4NX0A 3O16A 1PYMA 1K4HA 4ATDA 3ZMRA 5RUBA 3UCQA 3PAOA 2XSAA 4HU3A 3VTRA 2PDYA 3OG3A 5CJ5A 3C2FA 4GBUA 1YMYA 1WKEA 1GWJA 3QR0A 4PSRA 3F4CA 2HE5A 3G24A 3TH6A 1BVWA 4Z17A 3CUXA 1ZZMA 3C56A 1MUMA 5D05A 1VC4A 4IXXA 2J6VA 1ITQA 1HO1A 1EOKA 3IWPA 3MDUA 1W3JA 1LTDA 1ECEA 5C0QA 1M53A 2OEKA 3KUMA 5DT7A 2VZUA 3M4HA 4IQDA 3AMKA 3W76A 2DSVA 3KVMA 5CG7A 3WEMA 3W84A 3CV6A 1GOWA 4JTEA 2B4GA 4LYQA 3DENA 5A2BA 2PDHA 1SUXA 1ENUA 2QMKA 3B9EA 1EHAA 5LKYA 3L4VA 1XD0A 4O1DA 3S5OA 1WDWA 2ON3A 4GH3A 5D09A 1TSIA 1EHNA 4XTIA 1LWJA 3BW3A 1I2QA 1V7YA 3VOHA 2XM1A 2RDTA 3QHOA 2WVSA 3W81A 3E02A 3CEUA 2GGEA 4O0KA 4H2CA 1M41A 1H61A 2VOMA 3HOJA 2OO0A 3VUPA 3MUZ1 3C61A 3CL8A 3GTXA 5IOBA 2REQA 4CNTA 1N8FA 3GH7A 3G6LA 2YDAA 4FA3A 4O16A 3SUTA 4TVDA 2CZEA 3W83A 2PDMA 4KCTA 4X2PA 1AMYA 3BQ5A 3B8WA 5IHSA 3MKCA 4LB3A 4GO8A 4XAGA 1SQ7A 1RXOB 3CQIA 5FF3A 2H6RA 3U8GA 1P6BA 2AKMA 4DBDA 3N29A 1B90A 1A5NC 5JUVA 3BICA 1E9ZB 4C6MA 1H1ZA 3DG7A 1UWAA 4ATWA 1XBZA 1RBAA 4LOCA 1KTBA 1Q85A 2Z29A 2ZWYA 3G0XA 4FX6M 3FIGA 2TAAA 1Z6KA 3WK0A 3CBWA 2G0WA 4XB3A 1JPDX 1VIWA 4Q8QA 3N9RA 4MYAA 1V02A 2G3MA 2UWFA 4NAFA 1V8EA 2AL2B 1UR1A 3SR7A 1G4PA 1A50A 3ZM8A 2BLEA 1U30A 3AMDA 2X30A 4WRHA 1BTCA 4H83A 4DUXA 1UR4A 1MRAA 3GDTA 1HQTA 6A3HA 1FTXA 3E0FA 2Y70A 4MUZA 4JX5A 3EXTA 2PCEA 3R4IA 1GKRA 4LPCA 2Z7KA 2VTFA 5LIYX 2CITA 1AD1A 5E6YA 1QW8A 4M82A 4JIPA 4IQJA 1EC9A 1OC6A 4HT3A 4JQAA 3P61A 3FDGA 3RO6A 2NXIA 3UGRA 3GAKA 4PGLA 4JN6A 3DH7A 2EBNA 1GVRA 3TN6A 4Z1BA 1XDJA 3C3UA 3NPWA 5A8NA 4QE1A 2IPFA 4HYVA 2C7FA 4M3PA 4FX7A 2OLAA 1F6YA 4NZ1A 2E5CA 2E1DA 4GMEA 5A8MA 3HMJG 4DNHA 1H7PA 5BWFA 3VM5A 2PC4A 4O0QA 2G8ZA 3BLFA 3BTNA 2DQWA 2E6FA 5E0CA 4DJFC 1XDMA 1CXIA 5BXRA 1CIUA 3DG6A 4RX0A 3AZSA 1JIBA 5EMMA 5BMWA 1S2CA 3L0KA 4DBEA 2YFOA 4HCLA 3UYIA 4J3SA 3GDRA 1D3HA 3QY8A 1J0HA 3S4TA 3NO5A 3TYDA 4P8VA 3DKJA 4UC5A 1FWRA 4LF1A 3VFCA 4FPSA 4JN8A 3UQNA 3QN3A 4U2YA 3WZ0E 4A8LA 3VDHA 2XVKA 1EIXA 5D4YA 1TV7A 4HA1A 4EF9A 3LI1A 1CW2A 2DDXA 3QF0A 2I9UA 4GVFA 3THCA 1A47A 3GTIA 2WVTA 4QG9A 4P8XA 2NVAA 4S3GA 5LNVA 4DBSA 2GVLA 3CZGA 2VFHA 3FAWA 2PTYA 4CNOA 4O53A 1K8ZA 3WNPA 2BDQA 2YZRA 2GDVA 3B8VA 2FIQA 1JD9A 1KFJA 4BI7A 3H54A 4ZTXA 4O8AA 4NJHA 4Q6JA 3SQMA 2WZIA 4H3DA 4H9XA 3EWZA 1Q6FA 1JAEA 1EDGA 4GYPA 1JRCA 4Q4PA 2WJEA 5FJRA 3K13A 1G94A 1BAGA 2AQVA 1NDWA 3RRXA 2WHJA 4FIQA 2GDUA 3H70A 3K4AA 4CVWA 1GZ1A 3C0JA 4A3QA 2OU4A 2W3ZA 4GGBA 3E1F1 3I7QA 4Z0JA 3MZ2A 1L6SA 1EF3A 1VHCA 4PMYA 1EX5A 5A2CA 3TAKA 3FV9A 2WKGA 1FWSA 4ZB0A 3CV7A 3H4XA 4C6OA 4AF0A 4ORIA 2DT0A 4H8HA 1LF1A 2VELA 1MW1A 4JFSA 4AWTA 1RP8A 4XISA 1TV3A 4PA8A 3HIJA 5I03A 2AGTA 3NJ3A 4GJ1A 5DEZA 4W8AA 5IBXC 4H04A 1S2AA 1A80A 4Z2LA 4YNGA 3GNNA 3PZVA 3QTGA 4GVHA 4A8RA 5F2GA 1OK6A 4PL1A 2OB3A 3WQWA 3L7RA 4PCPA 4DN1A 5J8LA 3VX0A 3RF9A 3K8LA 3LSCA 2WZEA 3GH5A 2RFGA 4UMBA 4QSFA 2EPOA 1UR9A 1KWGA 5AYIA 3HTWA 1R2RA 2VWTA 1C7TA 3QHMA 4KWVA 4G1NA 1WKDA 1QVBA 1XIHA 1CI1A 4J35A 3R94A 2HS8A 3S83A 1OFEA 1C8QA 4Y9OA 5FF4A 4Z1AA 3MYPA 4WDTA 5LHEA 3HU7A 1PDZA 3VD4A 1GHRA 4B3LA 5I09A 1W8GA 3GNDA 4GCAA 3AJ7A 3L66A 3QC3A 1F7BA 2RAGA 1VR6A 4PCNA 3K5XA 4D8LA 1UUMA 4NY2A 3BMXA 1TFVA 1IZKA 3WQVA 4S3JA 1IWBA 2YA1A 4GUFA 1KLZA 4RPPA 2CCRA 1MNSA 3WJXA 1JI2A 3UBPC 4PBGA 1GYLA 4XAYA 1H7WA 4N9DA 4JTSA 1J5SA 2R6OA 2ZXAA 3M5XA 3ES8A 1HJXA 3GQYA 1PB0A 4MJ2A 4A6GA 3NXLA 4FALA 1EBHA 4OOUA 1AH4A 3PZ9A 3MV11 4R7OA 3IVTA 1KD0A 1J6OA 5CC3A 5CEWA 2QJNA 3AZRA 1PZ0A 4GC3A 4NL1A 3LBCA 1EGVA 3WQ4A 2DSUA 2VZSA 4AHOA 1JZ6A 4HIBA 1DWAM 2PB1A 2GGJA 5I23A 2ZCGA 2EPKX 2QPXA 4IMFA 3K46A 1TV8A 2PCQA 1S3TC 4AD2A 3BH4A 2WC7A 1BPLB 1UW9A 2F6KA 5LIUX 3WNOA 5TNVA 1QOPA 4TX6A 3W27A 2GJXB 5AZ1A 1WE5A 3B03A 1LRTA 4PUWA 3WYZA 5AVHA 4JNZA 4XD4A 1H7RA 1H11A 3FEMA 1HZYA 1FQ0A 1YADA 4WOZA 3KBVA 1V6XA 2P76A 4BK9A 1Z32X 2C91A 2CLOA 2QPUA 3B40A 3ITYA 1ZCCA 4ZE4A 3PG8A 4QM1A 4ZSTA 3RM9A 2AMGA 4LS1A 1YYAA 1BWLA 3BPWA 3KAOA 4X61A 2L5HA 1KFWA 2BOFX 5F4XA 4FNRA 5KSWA 1QXLA 1B3VA 4QNEA 5TF0A 2DIEA 2PGRA 4NVTA 2PTWA 3OGRA 3FKKA 3T9PA 3DBPA 3LXCA 2P50A 2HXTA 3P6LA 2F38A 4HGXA 1PHQA 3ARVA 3SAZA 1ADOA 1NOUA 4F0LA 3OHMB 1R38A 1BYBA 1H7XA 9XIMA 1MQQA 2VEKA 1W9XA 3HG5A 2B7PA 1WZKA 1ZSXA 1U1HA 2TMDA 1UC4A 3KRBA 2PDUA 3A24A 1PZ3A 2V68A 1A0DA 4EPDC 4MFDA 2XPKA 5EMUA 3QGAC 5BCAA 1E70M 1C93A 5FJTA 2GPTA 2PDQA 3P8JA 5H8UA 1W1TA 4H9VA 4LGXA 3QLLA 2FPYA 2XH4A 4Q8WA 1N2VA 4CD6A 4IMGA 4HZ7A 1ZBKA 3D3FA 1KBIA 1AL8A 4MSSA 4AB4A 4UQEA 3ITLA 3PVFA 3OVPA 4O1BA 8A3HA 3WK2A 5D38A 3FYYA 1AZ2A 3OA3A 1HFBA 4XD6A 1G67A 2ADAA 1US3A 3T2OA 3GTHA 2VVSA 4O1CA 1QK0A 5ABTA 5I3GA 1W1A1 3JW7A 6ALDA 5MHBA 5CKSA 2PDNA 3AICA 4B90A 1Q2RA 4JTFA 1W37A 2OSYA 1JCTA 1H0GA 1OGSA 3CH0A 3I6RA 3PBVA 3OYZA 1XM3A 4P2VA 4EK7A 2CLEA 1CLKA 2J8GA 2XVPA 1FKWA 2QCDB 1DTNA 4TTUA 1ITCA 4C6PA 2NT1A 4LVGA 1MFUA 4TMBA 1LBFA 3PZQA 1F74A 4HA0A 3WQGA 4DZIA 5CLTA 3WLSA 4RZBA 3JRKA 5IDIA 1SW7A 3N15A 3VIPA 1FH7A 1TKKA 4DY1A 2NQ5A 2V63A 3APYA 2XH2A 1H41A 1OX4A 1RCQA 1GEHA 4M29A 4UNIA 3M6YA 4ZZ9A 2BMBA 4D6GA 5C55A 3TQVA 4PZVA 4JEQA 1PX3A 2JBMA 4KESA 2DVXA 3H7RA 1HW6A 3O06A 4IGSA 1C29A 1ME8A 3UJEA 1FX6A 1SFSA 4HB7A 4IQEA 3POHA 4F0HA 3K1DA 2WHLA 1KV5A 1MXGA 3ELFA 1GCYA 4US5D 1OZMA 2E40A 1IXNA 1ZRQA 2Y7GA 1GOKA 3WY1A 4WCJA 2CC0A 3NAVA 3SCRA 4H7CA 2ZUTA 3A3HA 3B97A 1XCWA 2KZHA 3H7VA 3VABA 5I3DA 4AIEA 3VKBA 1H5VA 2BVYA 2YPIA 3O63A 3W2MA 1S38A 1CZ1A 1NWTA 1J93A 1GOXA 4AWEA 3P5YA 1PHWA 3EKZA 2WHMA 3B9OA 1LOQA 3U2CA 3KOWA 1UUQA 3T09A 5E1QA 2OQLA 2VL4A 1TVLA 4U10A 5HJYA 3FKRA 3TWBA 1KFLA 1X98A 4LSBA 1BVZA 1K3UA 1H09A 4RKAA 4I6VA 5E0FA 2ASHA 3TSDA 5AHMA 3W72A 4C7FA 3DC0A 4L6HA 3UZ5A 4YXGA 4IFKB 3CGTA 2G3NA 1L8NA 2INZA 5L9FA 2FTWA 2PURA 1NOFA 2WMIA 2FKPA 1WDSA 4LBUA 4B5TA 3T0DA 5CH9A 5PTDA 1OCNA 3WN6A 3ZR6A 3XINA 1FKXA 5LXEA 1WBJA 2J7CA 3CS2A 1T6MA 2J25A 4QDPA 4PYSA 1EEPA 2WKLA 1Q6QA 3NZQA 4PCTA 1XS2A 2ISDA 3W7PA 3HMCA 1VH7A 3CMFA 1AQMA 4IMAA 4Z2KA 1WUEA 1W3HA 3DERA 1BSIA 1RUSA 1LQ2A 3O15A 1OY0A 2E5DA 1ISVA 2OZTA 4NASA 1P7TA 3AIEA 3TR2A 1OQFA 1PWMA 4CQ9A 3N25A 3LD5A 3MMWA 5CGMA 3WQ6A 4QAIA 1XBVA 5FI8A 3CL6A 3N3TA 4GJJA 3TN4A 3O6YX 4PBEA 1B2YA 2CHNA 1ZJIA 2QCLA 3DEQA 1PCWA 4BQ4A 5D37A 1NDYA 3ZIZA 4LCQA 2ZX9A 2ICSA 5K9CA 3CZJA 3ARXA 2VCBA 4OOZA 3QVQA 3KWSA 2Y7EA 4Q7NA 5M5DA 1DQXA 4FP1A 2VRKA 3HV9A 3MTWA 3WJSA 2BWGA 4A22A 4WSJA 2V69A 5I7GA 1SSDA 3OLGA 4A2SA 2WCGA 2FH8A 4I9JA 4GINA 4H2HA 4QAWA 1N55A 1PJ9A 3RLUA 3QV9A 2PAJA 4L1WA 1WAWA 2VC6A 3N4AA 1HKMA 1E56A 1FY6A 3SGZA 2NXHA 2YXXA 3B0UX 1VFMA 1T8QA 3LXBA 5E6ZA 2ZA2A 3GG7A 1EFZA 2QDGA 3OVGA 1KKOA 3VI2A 3K30A 1W5PA 3SBFA 3IGXA 1OADA 4ZVJA 1AL7A 3BG5A 1RVKA 1H2JA 4ZODA 2PMQA 1V5XA 3C8NA 3UJFA 1JCYA 3TQKA 1UWRA 1B5TA 1KB3A 1R9XA 1PV8A 5IRPA 2B7OA 3LHZA 4IT1A 2HNHA 2NX1A 3R8HA 2ACSA 3G6MA 3CQKA 1A3XA 2XDFA 1J6PA 3S1UA 4Z08A 3EMQA 2D3NA 2ZRWA 1LUCA 3SRDA 3VMOA 1NOWA 1BF6A 3W1MA 1K7EA 1POKA 1F3EA 2YW3A 2OZ8A 2HVOA 1GTEA 2G4FA 2Z1KA 3SCNA 3UGVA 1SO6A 4H9YA 5EMLA 5E5CA 3EKLA 4PE8A 4AYSA 1EUAA 5AHFA 4JCLA 1EZ2A 4DLMA 3A23A 4O54A 1JCXA 5C70A 1K9TA 4MB1A 2CBJA 1U33A 1XYZA 4F4RA 2ZZ2A 4V28A 4FLQA 3NNTA 1KBKA 3TFCA 3U4FA 3OYXA 1ZJAA 2ZRXA 4HBKA 3RHGA 1E5JA 3MQTA 4AW7A 1ZBWA 1G7VA 3VINA 1IQ8A 1FXPA 2WKJA 4OE7A 5LZLA 2H8ZA 3GK0A 3NVTA 2VXNA 3LCGA 4W8LA 4MZYA 4J9JA 4AMAA 3SECA 1VCGA 3HV8A 5A8QA 3SADA 3GIQA 4BEQA 1NSJA 3OU8A 1IT7A 2J13A 3LPPA 4CQBA 3CC1A 3M7WA 4XO6A 2OWCA 4NILA 3E0IA 4ERGA 5B7YA 3BLKA 5JIPA 4WSHA 3H2FA 4WVXA 1PS9A 2WNZA 2C8NA 3PBMA 5GNZA 4K1GA 5AHEA 2VURA 1FWCC 1E1CA 4DRSA 2QUVA 1TVPA 2DUXA 4PTNA 3GVVA 4JKLA 3DFSA 1H1NA 4O57A 4IM4A 3W37A 1ONWA 2E7FA 1KV8A 1K6AA 1VEPA 2O9OA 1IF2A 5MF5A 1ME9A 2VYOA 4Q4OA 1VB9A 3N1AA 3UG3A 4MFEA 3W25A 3NSXA 4DWSA 3W7EA 5BZAA 2ZDRA 3N9SA 1HNYA 1SW3A 1LRNA 3HJEA 3PPCA 1AH0A 2DH3A 5A6TC 2Y1HA 1FHLA 1BKHA 1QOQA 2V3GA 2WCSA 1W5OA 2NT0A 4OUIA 1ITXA 5D9PA 1J10A 5HDRA 4R27A 2EGZA 3CQHA 4QITA 3QZ6A 4G2DA 1HO4A 3QW4B 4JIEA 1E71M 3AHZA 2JK2A 5AC8A 4XSMA 2CHOA 2X2YA 4A2RA 2CPUA 1LLOA 2Z1WA 3NQFA 1IIHA 3IRDA 4NT0A 4X63A 1BFNA 4G7EB 4MVAA 1XYLA 3WQEA 2QAFA 1JPHA 4B5SA 4D1IA 1EGZA 1TPH1 1XKYA 3OGVA 4RE3A 4W88A 5BMXA 3WDJA 4TV6A 1I60A 1NIUA 2J24A 5CSSA 4F9DA 4XSLA 1OT2A 1W5QA 4YLWA 3C3NA 4NF7A 2E9LA 4HTBA 1XR2A 2XH7A 4PBFA 5TD4A 1REQA 1B3XA 4ZQNA 2CZDA 1V0NA 3NSMA 4WK9A 4FZIA 4DPQA 1TR1A 4Q33A 5E9AA 1AQ0A 4PMVA 1EYEA 1I0DA 2DIJA 1SO5A 2YL5A 3IJIA 4TO8A 1ISWA 1TPB1 1Z89A 7REQA 3VDBA 4ZCWA 3SSZA 5FF7A 5EMYA 1V7AA 4B2DA 3BGGA 4S39A 3PM6A 4JFWA 5G4EA 2CBUA 2DFAA 2TSYA 3CZ8A 4S3KA 3I68A 1KXHA 4IIFA 2PLCA 5C54A 3W7IA 4UCFA 1E6ZA 4ROQA 3KS5A 3PJTA 1GHSA 2QULA 1A5OC 2ZXQA 3LV6A 3W7HA 1AUSL 1E4NA 2H90A 4A3HA 5JQ9A 1BYCA 4MLRA 4UFHA 1J4EA 4WUIA 4KRZA 4UB9A 1XGDA 3S2JA 3W1XA 3S6OA 5LNRA 3TSBA 3PUDA 1JI1A 3N2CA 3TTQA 5AYBA 4BQ2A 3NQ8A 4Q4SA 1T99A 1KRMA 4XKYB 1PAMA 2CLMA 1P0NA 3F4WA 4NNCA 1JZ8A 3W74A 1ZAHA 5ENLA 1O5QA 4OT7A 3ZYZA 2QHAA 3LGGA 1TZZA 1UBPC 3GFXA 1POJA 1ZGDA 3E0WA 2YYTA 2PGEA 3WIJA 3MUXA 2WWCA 3LLDA 3MMUA 3VFLA 3PF3A 1OX6A 3ITCA 3KZSA 1UR2A 3CHFA 3LBOA 5C2GA 3W71A 3T4WA 4YYFA 5H8MA 3OEXA 2J7DA 4HMEA 3EOUA 4MTVA 3GVWA 3W7MA 4AVFA 2PRMA 3ARUA 1R9ZA 4TUFA 4N42A 3V18A 3DKLA 4DXXA 4E8GA 2PGFA 3BAXA 4XZMX 3CIXA 2XSBA 1F6PA 2RGLA 4GWEA 5KETA 1TWWA 3KFTA 3U2EA 2P0IA 4OV9A 3RU6A 4BJHA 5FJIA 2ZRVA 4HZ6A 4HYRA 1H0IA 4A3YA 3W0KA 3ITTA 4AD3A 4RPQA 1F5ZA 4M1RA 2XGIA 1GK8A 3L67A 4REQB 5DXYA 3GXIA 2J9XA 2HE8A 1F73A 5HULA 2FHBA 4CD7A 1D8WA 2YCIX 1YIXA 1S2WA 4UCGA 4Q8TA 1EP2A 4Y9PA 3KOXA 3TX9A 3A9BA 4Z2GA 1JDDA 3NM1A 4B5WA 1DJNA 1M03A 1KWKA 1H4PA 3RLHA 4BI5A 4HZMA 5CZSA 1RLDA 3OIHA 3OHIA 4UQDA 1D3GA 3NCOA 4M7SA 3I3BA 1SZNA 1W9BM 2C14A 4E6MA 4AZ6A 3QPYA 5JU6A 1OC5A 2V6AA 4B5UA 1XCFA 5F2MA 4UFMA 4YN5A 3G18A 4DO6A 1CLXA 1Q6GA 2XFFA 1TG7A 1EOMA 2WLZA 4YVPA 4M7TA 3PY2A 3WEOA 4DI8A 2VZOA 1M7XA 3HPSA 5D33A 2QGHA 3VE9A 3UPWA 3PPHA 4LVAA 1VBHA 4GA8A 4PUEA 1FP8A 1JZ4A 4H7VA 4NRRA 1UIOA 1WX0A 1DE6A 3KE0A 3W1TA 4AIBA 4KCUA 4QJ4B 5LIKX 4H6KA 1MXDA 2E25A 4JTQA 5JVLA 1UMLA 3ITGA 1W91A 3VOJA 2BVDA 4QLJA 1VF8A 2VUYA 1BQGA 3UR2A 3M64A 4I7UA 2V8ZA 5DRCA 3ZJ7A 3S5ZA 4KGJA 4D8AA 3KRZA 4JKMA 3B0VC 1Q6RA 5A6AA 1RZMA 5KINA 1XLHA 3NA8A 1Y7VA 1ZL1A 1XUUA 4KFPA 3KVJA 3REQA 4GXPA 1XIBA 5K9DA 4UQAA 1O4UA 2GQ8A 4N9BA 3CLWA 3FNDA 4PULA 3WLRA 1E55A 2WVVA 4J3TA 3VIKA 3CB3A 3KTXA 3NG3A 3S2LA 4C1LA 1YTEA 2V3EA 1NF7A 2I5IA 2E4TA 5A6MA 5G1YA 4ADUA 3HGOA 4O52A 5FSEC 3UJSA 4I7VA 2XIJA 2RH9A 3LHTA 3V0TA 4UTLA 3VDCA 3W7LA 1U2YA 3KS6A 3NZ1A 3PNUA 1PUDA 2VEIA 4LVDA 1A4MA 1SZFA 4KPLA 2ZBTA 1Q65A 3WG6A 1GZJA 4B4FA 4E3TA 4GUJA 1TX2A 3NL5A 2XG9A 1Q6OA 5ABGA 3SN4A 3UR5A 1TPFA 3VKKA 4ZR8A 1XH1A 4XAFA 1VENA 5CSYA 3M43A 1V6YA 3SRFA 3FOKA 5A8PA 3FAXA 4UNKA 4MY9A 2UZ9A 3T0BA 3GU2A 3WD4A 3MKKA 3V7PA 1EP1A 1UH3A 5CQ1A 2BFGA 4OVXA 3N4EA 4GKLA 1XRTA 4KWWA 1YXDA 5AVNA 4L80A 2WMFA 2GJNA 3KBJA 3KOYA 3LRKA 3EOEA 3LCFA 2EAWA 3A9IA 1EJRC 3BCFA 1GVEA 2BOGX 2XN2A 4JTLA 4BQ3A 1L9WA 2FZ8A 1V6UA 4R34A 4GZJA 1KM3A 1FCBA 2Z00A 4BI6A 3G8RA 1A5MC 2NUYA 1WUFA 2VR2A 4LC6A 1B3WA 4CQDA 1J9YA 3NEVA 5HXMA 3MW7A 4PC8A 2BHUA 3MYOA 5I3KA 2QDEA 4OECA 3AALA 4CNPA 4UOZA 1UB3A 4XZ9A 3AIUA 5D8WA 3SCOA 1V3JA 4WEVX 4DWDA 4M1BA 4I8DA 2AQOA 2Y88A 3EZ4A 1KQZA 1YDNA 4Q8NA 2ZVIA 4N6FA 2UBPC 3FSUA 1VFLA 4L9XA 4BF7A 2OOFA 2XM2A 4TX9A 2CLIA 3P60A 3BL3A 3LG3A 3SUVA 3NL6A 1XG3A 1XLMA 1ZJHA 1M01A 1FHDA 2PBOA 1O6IA 1JZ7A 5EMJA 3F4DA 2OYMA 1JDCA 3TYBA 2C16A 5A95A 3OZOA 1XQLA 4QBXA 4HHLA 4EXAA 3DHUA 5I2UA 2DZXA 4B5VA 4XZBA 1GPWA 1FRBA 4DUOA 1XLAA 3NPUA 4L6OA 4HK7A 4P7RA 1VJIA 1R3SA 3M0XA 3IIOA 2X1SA 4K36A 2P3EA 2X2GA 3U0HA 2ISWA 2PLKA 4KWSA 3MBFA 3T05A 3GDBA 4L64A 1S1PA 4MOZA 4RDYA 1AW5A 2GOUA 1M04A 1TWSA 1B54A 3A47A 1DWFM 1F3WA 4DUVA 5K9XA 4LYRA 1KC7A 5C6MA 1TCDA 2PWHA 3N2MA 3RM4A 3NQGA 1W2PA 2PDWA 3TW6A 4AZBA 3QW3A 2XGZA 4WXYA 1R3YA 4UTMA 1JXJA 4GRSA 3SCWA 3B8UA 4N0RA 3GHUA 2XN1A 3UF9A 2NQHA 3VILA 3IUHA 1GOIA 3D0CA 2HVNA 1CYGA 3R0DA 2ZOXA 5DANA 2DU2A 5FA5A 3FVMA 4O11A 3W29A 4W87A 1V6VA 5REQB 5BU9A 2D73A 5D2WA 4PTXA 1K9EA 3BGAA 4UTWA 2O7SA 4EWJA 1AODA 1HKJA 4Y96A 5AFDA 2JQXA 3WH7A 4RZ4A 4KWUA 3B9NA 3I7RA 3GIYA 4LYPA 3NO3A 4Q8MA 5KZDA 1Q6LA 1XICA 3WX7A 1KBBA 5DX7A 3NQEA 2OYLA 3PPFA 4UTUA 1V3IA 3GAYA 1DOSA 5D02A 4K7YA 3VE7A 3CHDA 4G1KA 1E72M 3PFMA 2XWDA 4GQGA 4E5TA 5M1TA 4O15A 1ZAIA 1KM4A 5IFTA 2CLFA 2EO7A 3AU2A 2X8RA 5XINA 4GZEA 3GB6A 1ICQA 3N6JA 2PP1A 1TTQA 1Y5WA 1HIZA 1QNRA 4BQ5A 4E0CA 1QJWA 1VPXA 2V5JA 1VAHA 3NUKA 1CDGA 3HM7A 4W89A 1OD8A 4HOWA 4XIMA 2VHLA 2A3EA 3EMZA 1N7KA 5E70A 1E4IA 3H2EA 3TUUA 3MUY1 1MO0A 1X6LA 4GFIA 1SMAA 1JDFA 1G01A 2PD9A 1TB3A 2AAMA 4HHPA 4DJFA 4P7NA 1NDVA 3QGKC 1U5VA 2OEJA 2NQ9A 3P62A 1BF2A 1TJ1A 3TKFA 1W9VA 4L1XA 1F4AA 2HZGA 2VC9A 3BC9A 4IICA 2Z1XA 1BRLA 4AXKA 1TELA 1T40A 3CTTA 3ONBA 2A6LA 1OYBA 1UBSA 4GYPC 5GPRA 4F0RA 4YTRA 4HA3A 1CCWB 2B0MA 1XLJA 4O17A 5BU6A 3LS9A 3RX2A 1QW9A 3KEHA 2J6XA 4PUNA 3NDZA 1A5CA 4ZQOA 1TJRA 3EDKA 2HWGA 2QS8A 3FDKA 4XZLX 4DZHA 3N18A 4LF2A 4IIEA 3EAUA 1K8CA 1LCOA 4ZOCA 3CPRA 3A4JA 1E9YB 3DC8A 5FAGA 3LXAA 1F61A 1F3TA 3WNKA 1D3CA 4FNTA 3WF4A 4MLJA 1JFHA 3UA4A 4HNCA 4O0ZA 3DYPA 3AC0A 3LQLA 2DT3A 1M7OA 4PN2A 3MUIA 4GHRA 1GQNA 1OYCA 3N2XA 2FMOA 2WBKA 2QJGA 3VM7A 3WD2A 1FH9A 3L4TA 4CN6A 2A3AA 2RJGA 2IQ0A 4UR8A 4C5ZA 4W5UA 3W1LA 3PG9A 1NFPA 1JCNA 2YDRA 1MUCA 1VHNA 3E12A 1REQB 3RMEA 2ACRA 4M8UA 4DELA 3BV7A 3KL5A 1SZGA 4WLCA 3GVRA 4NZJA 3RMJA 3PJXA 2D0FA 1ONEA 4ZFMA 3KRUA 1XYAA 2OCZA 1R46A 4P7LA 3AO0A 1TCMA 1AH3A 3M41A 1Q4WA 4LNCA 2A3CA 1VBJA 2W63A 1DXEA 3ZLHA 4HU4A 4AZ7A 4ZOAA 1MXSA 3VIGA 4W84A 3SCUA 2C6QA 4X0NA 3TU9A 1X1NA 1U5HA 1KNWA 2YW4A 1BKSA 5G1TA 3QXBA 5DMNA 2BGQA 2WNQA 3MSGA 1PIIA 2I9EA 1OX5A 4LAZA 3EWWA 1KQYA 1QO2A 4MY1A 1BXCA 3L0NA 1IGWA 2WSYA 3E3HA 3KXQA 1OWQA 4UQCA 3BG3A 1XIEA 4AUBA 3EB2A 5I3HA 1UD5A 2AAAA 2EKCA 1LLZA 1ITUA 3MI6A 3DFHA 3IIVA 3WD3A 1V0LA 4MM1A 3SCPA 4C1KA 3GW0A 1IZCA 8RUCA 3D5HA 1X8CA 3M46A 4ATLA 4MB4A 1KGWA 1UWTA 5K2ZA 1GONA 4GACA 4Z2IA 4QX4A 1SMDA 4GX9A 5CPNA 2FZNA 1SFTA 4C65A 3QRHA 2W62A 4FR1A 4UTTA 4TTGA 3L65A 3V1HA 3VMNA 2EJ1A 4LY8A 1A5BA 3QYSA 4HVXA 1NP2A 3LK6A 4F40A 2NV2A 3P7YA 1XLEA 4GLEA 1UG6A 3GXPA 2J7GA 5CBJA 1VBRA 4LAOA 3W2NA 1RQHA 4ML9A 1TQJA 1TPEA 3M5YA 4HU8A 1BGGA 2QYGA 1GJWA 4UTTC 3U5YA 3GXFA 3ZWSA 2EPHA 2QVHA 1DPMA 3B9AA 5F2IA 3MVIA 4Q7IA 1KM2A 2Q6ZA 5A5WA 4WZHA 1LP6A 1XUZA 5E09A 3SDOA 4ES4A 4H00A 3THAA 4DXKA 1WKFA 1FWNA 2JEQA 4NZ3A 1SFLA 4PTVA 4EACA 4QCEA 2QCNA 1UJPA 2NSXA 1TPUA 4WKFA 3STGA 2P10A 1P6CA 1R3TA 2DGAA 2QNEA 3W1RA 3W7NA 3ZXWA 4NZFA 3PB2A 4H9TA 1B9BA 1HG3A 4RE4A 1R5YA 4D8ZA 3B4YA 4ACZB 3UR8A 4Y8FA 4LBRA 3FXGA 4U4MA 1DIEA 2WMKA 4JX6A 3IACA 2B7QA 1PKLA 3A13A 2W9MA 3MB9A 3KOFA 3GG8A 3HGRA 3QMSA 3HPZA 2G50A 5DCBA 4HJFA 4O1AA 4PRTA 3H6OA 3IV8A 3NWRA 4GZ7A 3WF1A 4PTWA 1ONRA 2FPTA 4ERIA 2GK1B 5DBTA 4AAJA 3TFXA 4JIIX 2E3ZA 3THDA 3E96A 3QHNA 2WJFA 3LTPA 1UWQA 1QUMA 3MUCA 2CZVA 1ICSA 3M44A 2WYSA 3Q4DA 4NXKA 3OJGA 2PWVA 4JHZA 3NDYA 3DHPA 3NM3A 4H8VA 2Y2WA 4JGDA 5J04A 1JFXA 3R0UA 3GE7A 3UPMA 1H7NA 3TEVA 1F4HA 3F1QA 1FCVA 1TTIA 2J27A 2YXOA 4PFMA 5I00A 1J01A 2OSXA 2PLMA 3KRSA 5I07A 1B0IA 2R1PA 1E6RA 1XQKA 1Q7ZA 3EOOA 2DW7A 5GNXA 3FFSA 4D6DA 1EGMA 3G1VA 2Z1BA 4WGHA 3R13A 2X16A 4JY9A 2I57A 3J7HA 4GY0A 4DI9A 4RLIA 5D04C 4ZOBA 4HK5A 1EP3A 1YNQA 4UR9A 4E3VA 3KVLA 1UCWA 3U3HA 3DFPA 1TZ7A 4K1WA 5ABFB 3ARSA 4F0KA 1KO0A 3DI0A 2CNCA 4MYXA 1KGUA 3C86A 2IXVA 4WY0A 5CGQA 3AHXA 3B9DA 4IG2A 2A1YA 1GKPA 3FY1A 4K8HA 3WQDA 3VIJA 3WH9A 2Z2UA 1J12A 1XIGA 1V93A 2GGIA 5C2XA 1Q2SA 3CV1A 3QZAA 4L7ZA 4MB5A 3UWYA 4JBRA 4C6JA 4HNVA 3L23A 4GNVA 4UQ9A 4M6PA 1SR9A 3AUJA 5FACA 1YRRA 3SQLA 2PDIA 4JFUA 1N8WA 3ERPA 4PMNA 1RD6A 3BOXA 2FB2A 4RE0A 3NVDA 4FXRA 4JQ2A 1X97A 3U7VA 3LCIA 3TSMA 4MPQA 3A3XA 3E0VA 2ALRA 1DE5A 2I5GA 5EMKA 3O6DA 3S2CA 1ZPTA 5L6UA 4Q4MA 2AL1A 2PSNA 3GUGA 1MYRA 1BVNP 3PSWA 5LYRA 3TC3A 1GVYA 2VDHA 2JKEA 4IFRA 3PZOA 1P1MA 4LAMA 4A29A 1PZ2A 3C2EA 4D71A 2NX9A 2VRJA 1X8FA 1E15A 5DELA 5EBAA 2FTYA 3BMWA 2C0HA 3UG8A 1UUOA 3LZ3A 3INPA 1EXBA 5IHRA 1W2VA 1XCXA 3QFEA 3EBVA 3MWCA 4Q8UA 1KTNA 3W2KA 3H24A 2J77A 1VKFA 5K4ZA 2PTXA 2XJ7A 1KFEA 4I9AA 5HJLA 1WOBA 4LB4A 3W1NA 4DEFA 1O1ZA 1TUFA 2FVLA 2PRHA 4PUKA 1FWFC 4M6UA 6PTDA 4MPKA 1R86A 1KBJA 4UIOA 3SUWA 4PMRA 3VNYA 2BVWA 4R33A 3LX9A 4YHEA 1I1XA 1MZHA 1A3HA 2C1GA 3VCCA 3CJPA 1A53A 3IIZA 3W1AA 4ICCX 2A6NA 4AY8A 4NG3A 3ZJKA 2C79A 2DY3A 3ARRA 2D0HA 4H8UA 4HKPA 3STEA 1V3LA 4RCXA 1H51A 2XSXA 1S39A 2Y8VA 4ZXOA 3AYRA 4QTGA 3SY5A 2V82A 5EFFA 3OTRA 1R2TA 5HK4A 1WP6A 1F07A 2FGLA 3ABOA 2X05A 3WQPA 4Q3MA 2EG8A 1UH2A 2WXDM 3BUVA 3LEPA 5HPOA 4HZ8A 4DF0A 3RPDA 3M0JA 4AG0A 1TJPA 5AN7A 4U2ZA 1W1IE 3M0KA 2RDWA 2QUTA 4AZIA 5CC7A 5AYYA 4C5YA 3SN0A 3AXIA 4LTSA 3FCPA 3SURA 1JD7A 1JGIA 5HMFA 2QW5A 1DIOA 4GIYA 2I14A 4LAUA 2G41A 3AS1A 4UFJA 3H55A 3I3DA 4JTGA 3VNLA 3BSGA 4IISA 3JS3A 2NQJA 1UQZA 1P43A 3FJ6A 1OEPA 3A21A 5F7UA 5JXQA 3KLKA 3F2DA