3Q58A

Structure of n-acetylmannosamine-6-phosphate epimerase from salmonella enterica
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
229
structure length
229
Chain Sequence
SNAMSLLARLEQSVHENGGLIVSCQPVPGSPMDKPEIVAAMAQAAASAGAVAVRIEGIENLRTVRPHLSVPIIGIIKRDLTGSPVRITPYLQDVDALAQAGADIIAFDASFRSRPVDIDSLLTRIRLHGLLAMADCSTVNEGISCHQKGIEFIGTTLSGYTGPITPVEPDLAMVTQLSHAGCRVIAEGRYNTPALAANAIEHGAWAVTVGSAITRIEHICQWFSHAVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords N-acetylmannosamine-6-phosphate 2-epimerase
source organism Salmonella enterica subsp. enterica serovar typhi
total genus 80
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature ec 5.1.3.9: N-acylglucosamine-6-phosphate 2-epimerase.
pdb deposition date 2010-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04131 NanE Putative N-acetylmannosamine-6-phosphate epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3q58A00
5K9CA 3LHTA 4JX6A 1I2OA 1I8JA 4N2YA 1W5NA 4JR5A 5C54A 3STCA 3QPZA 1LROA 4DEFA 1LTDA 3NQVA 3MYOA 4LS2A 2NZLA 5AHNA 5HULA 1UUOA 1MEWA 2J9ZA 3DFNA 4N02A 1DV7A 3C8FA 4OT7A 4O17A 2QCFA 4NJHA 3GLCA 3NPXA 3DXIA 2C15A 2CFFA 1FY6A 1GTEA 2V9DA 3DZ1A 2FLIA 1FCVA 1H60A 1XM3A 3O05A 4XUGA 4Q4KA 3W7NA 4I7VA 2O7SA 4UNLA 3S1VA 3IIPA 2ABBA 3NYZA 4JYFA 3QH2A 4M6VA 3W7RA 3L21A 4E2DA 1KBJA 1R2SA 5K9DA 1KM6A 5FEWA 3U2OA 4UMCA 5LNRA 4LTSA 3I68A 4O50A 1TPDA 3M7WA 1OF8A 3PULA 4PEKA 2RHGA 1AMKA 1M7OA 3EWUA 2YGYA 4AXKA 1AL8A 2WO5A 3M5YA 4S2BA 3OG3A 1I4NA 1BKSA 2V81A 3Q2DA 5GVJA 1OYCA 3QSTA 2ISVA 4BFAA 3GXPA 3NQMA 1FCUA 1ME7A 2WSRA 3MP3A 1KM4A 1TTPA 4HSNA 5FESA 2H6RA 3B0VC 3JR2A 2QEZA 2ZA3A 4HPJA 2WPBA 3EKLA 1ICSA 4GUFA 4O1CA 3GDTA 2ZZ7A 4MYXA 1SZGA 2QR6A 2ZZ2A 4O19A 1PIIA 4LRSA 3IVTA 5D09A 1QOPA 1J2WA 4FX8A 2PE4A 1A50A 1PS9A 2HS6A 3HOJA 3DGRA 1YLVA 5E0KA 3W87A 1O60A 3EWYA 1RD5A 1KW1A 3NA8A 5D38A 4TU1A 2VFDA 5D04C 4N9EA 3FOKA 2R91A 4LUIA 5F1UA 1TIMA 3NEVA 5FI8A 3W73A 3N3MA 3T55A 5LNUA 3MHFA 1MEIA 3SGZA 1TYGA 2A2IA 4UFHA 4U28A 4HNUA 3A23A 5KZDA 3FKRA 3GAYA 3MYPA 1FWWA 2DU2A 3NM3A 2H3BA 1TQXA 3CPRA 2OJPA 1TPUA 1KV8A 3C3NA 3MW7A 4Z0SA 1SFJA 4YWIA 3W22A 1XBXA 2CU0A 2W79A 4WQ6A 3WJWA 3M47A 1TV8A 1PHQA 1YADA 5AHLA 5FF7A 3TQKA 5LGZA 3T78A 1OFAA 4ZMGA 4FEZA 2RDWA 4HHPA 2RH9A 5EYWA 4H6KA 1KBIA 4JTTA 1MSSA 2GUUA 4C1LA 2EF9A 2QUVA 3VNDA 2Z6JA 3PWAA 3M0ZA 3W7IA 4LV4A 1IF2A 3UY8A 4CNNA 3IEBA 4WOZA 4R33A 3UD6A 3O06A 3ANYA 4UC5A 5DY2A 1D3GA 4MKNA 2NV2A 1XL9A 2E09A 4ML9A 4QISA 3W7DA 1UASA 1L6SA 3P61A 2JKPA 4O4WA 1B4KA 4YMZA 3FJLA 2VFFA 3MI2A 1O5XA 3SR7A 1C8VA 5L6UA 4OHQA 1JUBA 4ZQMA 2YX0A 2VEPA 5CSSA 1QPRA 4JN6A 5C6MA 4UTTA 5CSRA 3I6RA 4UFLA 4LVAA 3W2KA 1WYIA 5FEZA 5DBUA 2QJIA 4NUWA 4AWTA 4PL2A 4JX4A 5LNVA 5IBXA 3RMJA 4JTUA 4DQWA 1WQ5A 4X22A 4WJEA 3W1QA 4QITA 4R7JA 5CG7A 3TUUA 2ZCGA 1QWGA 3HGJA 3KFTA 4UMBA 5LGXA 3G8EA 4JIQA 4JTGA 4NZFA 3NQEA 3BV4A 3UXAA 4XKYA 4EF8A 1OK6A 2I9EA 1M5WA 1YDOA 3EXRA 1AW5A 2X2GA 3MHGA 2H8ZA 2X1SA 3EWXA 1S5WA 2QCMA 4IUOA 1VCGA 1FUYA 3W7GA 4NX5A 3CWNA 4RJEA 4IQLA 1PHWA 2E68A 1RR2A 4KFPA 3PR2A 3USBA 4BWLC 1DQXA 1LRQA 5U7SA 1M7PA 1BWLA 3A5VA 1ZNNA 1K8XA 3K30A 2V8ZA 1B57A 3LDVA 3TDFA 2CZFA 4QNWA 4I7UA 3TK7A 3KXQA 5DCDA 3W76A 2VC6A 4JXCA 5D2WA 3W6YA 3QW3A 1KLYA 1EUNA 3NL5A 3S1WA 3AO0A 2VOMA 2F7FA 5AHIA 4NJIA 3EKZA 5A8GA 3GR7A 4AEOA 4ADTA 3QJAA 5G2WA 3L0KA 4CLMA 5G4WA 3BLFA 4AB4A 1MXSA 3TSDA 3TSBA 3GAKA 3NM1A 4M6QA 2JBMA 1EA0A 1LRTA 1TTQA 1LBLA 4WY0B 2ZZ3A 1H50A 3IVSA 4IX2A 4N9DA 4RLIA 4E0CA 3TQ0A 3QEZA 1T8XA 2YFOA 3PB0A 2ZDRA 4WXYA 1PV8A 3LHZA 3P7YA 2QCHA 3FFSA 4WZHA 3LRMA 3DKJA 4EVZA 4CQAA 3UWUA 3I7QA 3P80A 4NVTA 3W1NA 3A21A 4POCA 5D2YA 3DHDA 3C6CA 1OG0A 5F4XA 1FWSA 1VYSX 1ZHAA 4FNQA 4Z0JA 4QIUA 4GUGA 3CB8A 5C5YA 1XBZA 4XBSA 1LDCA 3PC0A 3TV8A 2I1OA 4P2VA 4O18A 3PBVA 4OU1A 2O7QA 1W8SA 2B7NA 1DQWA 2E77A 1DHPA 3ABQA 3FA5A 3DFTA 3W7HA 2VKZG 4BI6A 1RQBA 3H55A 3BGJA 2NWSA 2GPTA 4PH6A 3WK3A 5AN7A 3R13A 1SW3A 6ALDA 1ME8A 2FJKA 3CLMA 3LBMA 2YYTA 3RLUA 3M1ZA 2FQIA 2ZZ4A 4UTUA 1I2QA 3LRKA 1K3UA 3KVMA 3NL3A 1ZJIA 4MY8A 3VKJA 1P0KA 2CLKA 2CZEA 4UTHA 3LBCA 2A5HA 3BLEA 2WV8A 3W7PA 5L9FA 2FPTA 3C56A 3P8JA 3C2RA 5KTLA 3HPXA 1GWJA 2VEMA 1CW2A 4XQ6A 3LOTA 1G67A 2X30A 2RDTA 2ZA1A 1PVNA 3A5FA 3WJXA 3TC6A 2DZTA 2Z1BA 2HS8A 2OCZA 4XBKA 1H7WA 2YXGA 1XFBA 2CLFA 1S3HA 4JGDA 3SSJA 4AAJA 3WJZA 4NX0A 1LOLA 4KWVA 1EUAA 3M9YA 1F6PA 3LHYA 1OFRA 2AQWA 1VRDA 3C2VA 3CTLA 4A3UA 3N34A 1R2TA 3DFSA 3O63A 3S9YA 2NX3A 2CZ5A 3R8RA 1LORA 1NAL1 3UWYA 3W7JA 4GXMA 4YXGA 4H3DA 2JKAA 3G0UA 3S42A 1A5BA 4IXXA 5AB3A 3O8AA 1L9WA 4LU0A 3PG8A 4ZQNA 4P61A 3P84A 1LOSA 3QRHA 1ALDA 3TFCA 1JRBA 3HIJA 2BZNA 1F6KA 1HO4A 5DELA 1GYNA 2YSWA 2JKEA 2RFGA 2G97A 3RF9A 1K7EA 1GTHA 2X1TA 3OHIA 1VPXA 4ALDA 1HL2A 3V75A 4O4VA 2A6NA 4DBEA 1K8ZA 3YPIA 4XZ9A 3L5AA 4TMCA 3KX6A 3NQ8A 3V1PA 5F4SA 4UNKA 1SQ7A 4HSOA 3B03A 3TAKA 2Y7GA 1WOAA 4HPXA 3L5MA 1H7NA 8TIMA 1ZAJA 3UYCA 3IGSA 3CIXA 3QMTA 3TMLA 1AW1A 2C18A 3OIXA 2QAPA 3NQ7A 4ADSA 5CZTA 1IIHA 5F2IA 1GEQA 1O94A 4LS1A 5D32A 3W7QA 1DBTA 2DP3A 4UFMA 1X7FA 1W1ZA 2V2DA 2Z6IA 1KTNA 1OX6A 1OFOA 4YLWA 4MY1A 4K8EA 3GDRA 5TBOA 3W2LA 3LCHA 4PTNA 6TIMA 4UR7A 3M5VA 4JTJA 2GOUA 3RNDA 1U83A 3TA6A 1K7FA 3TJLA 1OYAA 5H91A 3NOEA 1I2PA 4DBDA 3LLFA 2Y85A 4O13A 5BOOA 3M44A 3S5NA 5FF3A 2R8WA 3DFQA 4GUIA 1I2NA 1Z44A 3NQCA 4JY8A 3NAVA 3W84A 1W0MA 4BK9A 2ISWA 3U8GA 2YR1A 3LI0A 3THAA 1SZNA 2EGZA 1FX6A 3CQ0A 1DJNA 4WX2A 5FF2A 4KFOA 2X16A 2V30A 1B3OA 4MFDA 1LP6A 3T4CA 1QAPA 1ONRA 2CLMA 3L66A 1KFKA 5G2HA 1KTCA 3ABSA 3LCGA 1TREA 3TJXA 1TCDA 3NQGA 2ZRZA 5K2ZA 5HNRA 4EWND 3WFAA 1JUKA 3HG5A 2YFNA 2CLIA 1R46A 3L0GA 3W72A 2QCEA 3GXNA 5LHEA 1FDZA 4L4MA 3PBWA 3NR0A 3LTYA 4M6PA 2NWRA 4KKXA 1Z41A 1KM5A 3HO8A 1VJIA 2E6DA 5F1VA 3G3MA 5CGQA 3UPWA 1F74A 4ORIA 5E93A 1GOXA 2Q3RA 5EKYA 5K7JA 2NLIA 3UNDA 1FXPA 3B8DA 5I3IA 1ADOA 1QOQA 2CLOA 5DCEA 3BW2A 3VFLA 3NQ2A 4RZ6A 3A9IA 1JQVA 4LVGA 2FB2A 1LCOA 2CLEA 4PL1A 1YDVA 4UR8A 5DCBA 4LY8A 2FIQA 1YTDA 3QW4B 4LVDA 1NFBA 5CPLA 2P0OA 4UTMA 5TQLA 2CLLA 3D0CA 1EPXA 4JIPA 3HG4A 4O1BA 3BPWA 2B7PA 1BTMA 1XKYA 4MJMA 2DORA 5DLCA 2A21A 2YCEA 1VGAA 2QDHA 1SSDA 4IX0A 3R5EA 2QUUA 3W2JA 2Y62A 1TMHA 4HNNA 3DU0A 3GX9A 1DJQA 4LUJA 4BI7A 1TPEA 1UBSA 1F2JA 4K38A 1WA3A 2NUWA 3TR2A 4UFJA 4IXHA 4I9AA 2J9XA 1TRIA 3CIWA 4XWUA 2ZA2A 4AH7A 5AC8A 4WOQA 4FNTA 2BXVA 1ICQA 4TMBA 3N14A 2NX9A 3KAOA 3NPWA 1LZOA 2NXIA 2VXNA 1GPWA 4MY9A 1AL7A 3W1PA 3BGGA 1OHLA 2BX7A 4OWGA 3PG9A 2WNNA 3DAQA 4FNUA 1BWKA 2WNZA 5F2MA 2YPIA 4GUJA 4UTKA 1IIGA 1VR6A 3P5YA 4K6AA 4E38A 3M5XA 3IV3A 3C2EA 3SW6A 1FDJA 1O4UA 1OFQA 1FCBA 4DF2A 5LZLA 3HB9A 3UWWA 4CCCA 3W75A 3BG5A 3FKKA 3LCFA 1K7XA 3Q37A 1D9EA 3A24A 5HR7A 1H1YA 4ICNA 1W5QA 1ML1A 4JYEA 1N8FA 3QMRA 1QO2A 1LBMA 3C52A 3MP5A 3NL6A 3PVFA 4O53A 3W23A 1SPQA 3DFPA 4GE8A 4YCOA 3MUXA 3W1MA 2DZPA 2E6FA 2Q3OA 3PY2A 3IVUA 3CWOX 5BW6A 4HN4A 3W9ZA 5FF4A 3PM6A 1LYXA 1T99A 5CZJA 5MHBA 3MJYA 4KFNA 3W1AA 3TC7A 5EL1A 2XN1A 3C2OA 5D37A 1O5KA 3W2NA 3W7CA 4N9BA 1JJKA 3NNTA 2AGKA 4MFEA 4AHPA 4PFMA 1EP2A 3IIZA 2J24A 3FEMA 3M16A 3O15A 3B06A 4MZYA 1RVGA 1KTBA 1ZCOA 1G6CA 1VHCA 2BSLA 1T96A 5HJLA 1V7YA 1K02A 3BVJA 3WJSA 2ZZ6A 3LB0A 4OGZA 4QSHA 1S5VA 3PUOA 2JGQA 1QFEA 1JVNA 3M43A 5KSWA 5SWUA 5F4WA 1FWNA 1Q45A 2C13A 4A22A 3LCXA 1VQTA 2D73A 1XBYA 1VLIA 2TRSA 2Q8LA 2A1YA 3TX9A 2OX1A 3RLVA 2QF7A 4ZZ9A 4RXGA 4L4LA 4Y90A 3FLUA 5LSMA 4ZQOA 3NO5A 3JS3A 3STEA 2FB3A 4CQ9A 4X2RA 1TRDA 4RZ4A 1W56A 2ATMA 2WJZA 1JUEA 3E12A 2E1DA 3SI9A 4LS0A 2GVGA 4JNMA 4QM1A 1KM1A 1JULA 3P60A 3R89A 1F05A 2QUTA 3N2XA 1SU5A 4RV8A 4MJZA 3NZ1A 1JQXA 4N4QA 1D3HA 4NNAA 4WXZA 3W1UA 5LHFA 1G4PA 3SECA 3KVKA 4S2CA 1GZGA 3BLIA 3G1SA 1YTKA 1W3IA 4NQ1A 1RPXA 4FB7A 4GBUA 1OABA 5D30A 2WSQA 2ATSA 2BTMA 5AC7A 2LLEA 2YDAA 4GUHA 1SW0A 2W6RA 3LXAA 2NV1A 5F2GA 1OYBA 3MMTA 4NZJA 1P5BA 4QQ3A 4IMDA 2OZ0A 3E9AA 1TO3A 3QQ0A 3ZR4A 3DH7A 5D2VA 1AG1O 5KITA 4R34A 3LRLA 5KMYA 1XUZA 1TQJA 5H2ZA 3F03K 5LNSA 4FX6M 1I2RA 4S1FA 1OK4A 4H4IA 3UZ5A 2ZBTA 4O1DA 4WY0A 2H8XA 1VYRA 1GVSA 4JICA 3NDOA 1OX5A 4JTHA 3HQ1A 2QAFA 5KZMA 3ZFHA 4TX9A 1UUMA 2VEIA 1CX9A 4FF7A 3F1QA 3CU2A 1Q6RA 2G96A 3O6CA 4YL2A 3B0UX 3UWQA 1IGSA 1LBFA 1TSIA 1YYAA 1TJRA 1SUXA 3TH6A 2B4GA 4Z1DA 4UTLA 1R47A 1GVQA 3GK0A 4PCFA 3LHWA 3MWAA 3WK0A 1W54A 3VCRA 3LCIA 2GJNA 4MLJA 2C14A 3LX9A 3G1DA 3GIYA 3G22A 4RK8A 2R14A 3RK8A 2JGYA 4GFSA 3A22A 3QFEA 1I45A 2ZFAA 4IJBA 3EXSA 3R12A 2BWGA 4K37A 3LI1A 2Y70A 2VFIA 2PRLA 5HUPA 4ZQPA 2PURA 4RR4A 1SW7A 5G5IA 4AMAA 3SIZA 4MLRA 1KM2A 5J5RA 2OT1A 3EX3A 3W70A 5FEPA 4HNTA 4KWWA 4O15A 2GVJA 1OX4B 5G2IA 1DORA 5EY5A 3GDKA 3QPYA 3UY7A 4W9TA 4Y9AA 3L9CA 4WUIA 3HG2A 1G69A 3SGUA 3BW4A 4QJ1A 1TPC1 5C2XA 2J88A 3I7RA 2ZQ0A 3W07A 3L0NA 1NSJA 5TIMA 1JCLA 1X8FA 3STGA 4B5NA 4HT3A 1N7KA 1OF6A 5FEXA 3IGUA 2WNQA 3HPZA 5HQEA 3TW7A 5G1YA 1YXYA 2YW3A 1XCFA 4MYAA 3NG3A 3N9RA 3S6DA 4AF0B 4BI5A 3VE7A 1H61A 3W86A 1OJXA 4LRTA 1H62A 4UMAA 4PA8A 3WK1A 1W3NA 2V2CA 5BRBA 1Y0EA 3BW3A 2QDGA 4IPIA 4TR9A 3NZRA 1IXOA 3TE9A 1IXQA 3GZ3A 4LC6A 2DZWA 1M6JA 1P0NA 2GQ9A 5EMUA 3QMSA 3UXDA 4ZQCA 3HPSA 1F7BA 2X1UA 3TU9A 4LNYA 4MUZA 4GNJA 1OVDA 3ABOA 1HUVA 4WY0F 3G1YA 3S0CA 3W7LA 5AYXA 5K4XA 1RQHA 2VELA 2AAMA 1Q6OA 4GWEA 2A0NA 3LHUA 3PAJA 1BEUA 4X9SA 2OMAA 5EPDA 3W74A 4A2RA 3SFKA 2Z2UA 3WK2A 3GDLA 2PRMA 3THQA 2E5BA 4JTEA 1UB3A 4X3ZA 2B7OA 2ZRWA 1A5AA 4IGHA 1XBVA 1OFDA 5T26A 1KFCA 5D2XA 1Q6QA 3CHVA 1A53A 3TROA 3N73A 4RCXA 3HJZA 1HTIA 3BO9A 2PC4A 3NL2A 2VFGA 3L2IA 1ME9A 3S1XA 3FYPA 3UZJA 3O16A 4AWUA 1IXNA 5K9XA 3ELFA 3DFOA 3H54A 3HGRA 4DO5A 5LNWA 1HFBA 4JX5A 1EB3A 2G95A 3ZWSA 5HWMA 1SZEA 1WOBA 4IMGA 1QMLA 1ZAHA 1LRNA 1WX0A 3T44A 4CNPA 2Y63A 3OEXA 2FPVA 3R2GA 4RXFA 4I7WA 3G0XA 3L5LA 3W71A 1Z42A 2ZZ5A 2TMDA 4MZ8A 4ONVA 1LLZA 2CZDA 3RFAA 4Y8FA 3TNOA 4DXVA 1MEHA 5G4EA 3O07A 3KOFA 3W88A 1Z48A 4O11A 2ABAA 3G8RA 3QQ1A 3LXCA 2RKXA 1EWEA 2DZSA 5AC6A 3LTPA 4JTKA 3JRKA 4FNSA 2WKJA 4Q32A 4JEQA 1GG1A 3LXBA 3FIGA 4Z1BA 1X1OA 5I3JA 2Y7FA 4FXRA 4O1AA 4GC4A 1TTJA 1VC4A 3LGEA 1VCFA 3G1VA 2GQAA 3PBUA 2FFCA 2PCQA 1FWTA 2JK2A 5BNKA 1KLZA 1G4TA 4FHAA 3G1AA 4OV4A 5BMXA 3I7SA 3W3OA 2H90A 1SO5A 4N4PA 5AYZA 1XI3A 2EPHA 1JCXA 4DF0A 3UWZA 3M6YA 5AHMA 2DZXA 1W5MA 4RKAA 1EEPA 3B04A 2A7PA 2DZUA 4JTFA 3INPA 2BLEA 2ZZ1A 3PB2A 1QNVA 3G1FA 4AHQA 1H63A 1SO6A 2QCGA 3MHUA 3FS2A 1WAUA 2V5LA 3W2MA 2ZRXA 1G7UA 1HO1A 2NUXA 1JCMP 5HR6A 3P82A 3GKFA 4JDYA 5I3GA 3O1NA 2Z0IA 1Q3NA 3M5ZA 2J27A 1WXJA 1W5OA 4K7YA 2I14A 1QDSA 3KHJA 4LOCA 3PUEA 1GYLA 1K03A 4IWWA 3VE9A 3QSRA 3F4NA 3ABRA 1ZAIA 3S1UA 5G1TA 3O6DA 1H5YA 1R2RA 3NGJA 3WJYA 1SZFA 1KFBA 5AOUA 4NXSA 2E5DA 1TPH1 5CPNA 4FIRA 3P5ZA 3GR8A 3GNDA 4ORMA 3EXTA 2E5CA 1H7OA 2GVLA 1F76A 3NVTA 4UTJA 1W31A 2CW6A 3TSMA 4NNBA 3G24A 4IOTA 4OE7A 1KFEA 1FWRA 4ADUA 1FDYA 1T0OA 1H1ZA 4WD0A 4BR1A 1YPFA 4NXKA 3LCLA 4DPPA 1DVJA 1OFEA 4GRSA 4RX0A 2G5WA 3HBLA 4HIBA 2ZRYA 3E49A 1JCNA 1RZMA 1VH7A 1B4EA 1L6YA 1MZHA 3W1RA 3KVLA 3L65A 4UTWA 3HGSA 3W7KA 1VYPX 1VCVA 3G18A 2HMCA 3FJ6A 1NF7A 1SR9A 5DXYA 1G4SA 3EX1A 5K4ZA 3CT7A 2Y61A 3SJ3A 2ZTJA 1AK5A 2QCNA 1YPIA 3LCWA 2DZVA 2Y6ZA 4DPQA 4UFKA 2ZRVA 3DHFA 5D03A 1H7PA 1DOSA 3LM7A 3GKAA 4EOUA 2Y89A 4Q33A 2P1FA 2E6AA 2B0MA 3QC3A 1F73A 3KRUA 1XC4A 2ZYFA 1E51A 1ZALA 4J9JA 4CCEA 3PS7A 1QPNA 3AJXA 3W1XA 2QJHA 4OQVA 4TIMA 4EF9A 1XXXA 5D33A 4ZVJA 1NF0A 1W3TA 3B4UA 3KRSA 1QPOA 1RQEA 2OT0A 4O57A 1FXQA 1LOQA 2R94A 4MOZA 2A85A 3ZWTA 3KVJA 3EWZA 1GVFA 1TPB1 3T40A 2FPYA 4LW7A 4IMCA 3E0IA 3STFA 3TXVA 4IMEA 1B9BA 3ZS4A 4NJGA 3S8HA 4K39A 4ZQRA 5I3HA 2YZRA 3G1HA 1FCQA 1C29A 1EIXA 4Y96A 1KA9F 5EBUA 3NPVA 1YTEA 4DO4A 2GQ8A 3NQAA 3NPUA 1XUUA 4E2BA 4EIVA 5F2LA 4O8RA 5AHFA 2F84A 1ZY9A 5CKSA 3Q58A 3MBDA 2C19A 2FTPA 4XKYB 3RU6A 1C9DA 3ATYA 2DJLA 2Y7EA 3O6YX 5CZ0A 5EA9A 1ICPA 2CLHA 3MI3A 4JS3A 1P4CA 3IGXA 1THFD 3W7MA 2EAWA 3KRZA 1AW2A 4NU7A 1TPWA 4UFIA 4O0ZA 3W7OA 3TCEA 4IPJA 2V2HA 3LHVA 2PRHA 1UJPA 1ZENA 3N2MA 1EX5A 1TJPA 1K8YA 4FXSA 3EB2A 4O16A 4M19A 4O14A 4N6EA 2Q8ZA 3UQNA 3LV6A 4LT9A 4QNEA 1L2UA 3IIXA 4K8HA 4JTSA 3BG3A 4A21A 5AFDA 3TXZA 2WSYA 5AYYA 3GB6A 4FX7A 5CPOA 1WBHA 4LVFA 2QCCA 5LKYA 2QKFA 1LLWA 4O10A 3W85A 2TPSA 2NX1A 1KFJA 2XN2A 5HMSA 4A2SA 4M5PA 3LV5A 3NQFA 1YXDA 2B7QA 4N6FA 3S5ZA 2A6LA 5A5WA 3NXFA 4MIMA 3M41A 5DXXA 2NUYA 3U6WA 3W7EA 4DF1A 3QF0A 3HG3A 4TO8A 1WBJA 3NQ6A 4LWWA 5FF0A 1J5TA 3OA3A 1TPFA 4JTLA 4YCPA 3TMQA 2GJLA 3I65A 5U4NA 3C0JA 1PL9A 3CC1A 3FYOA 3OBKA 1GJPA 4OV9A 3G1XA 1HG3A 2NXHA 3G3DA 2W0UA 5KINA 4FIQA 3PF3A 1QPQA 3GYEA 3ATZA 4M7TA 4AWSA 1X1ZA 1SFLA 3MBFA 2C6QA 1J4EA 2DJXA 1H51A 1KM3A 4K7VA 2Y7DA 4NJJA 5I3FA 1OFPA 3N19B 2C1HA 1SSGA 1Q6LA 3EWWA 2NXGA 2QJGA 3DENA 3GXTA 3UWVA 1QR7A 1S5TA 4O28A 1XDLA 4CCDA 3DI0A 3LTSA 2ALDA 2FDSA 2EHHA 3L68A 2VENA 2HSAA 2IQTA 3GVGA 3MP4A 3Q94A 5DY3A 1QO5A 5HINA 4Z1AA 4LV9A 1MO0A 3LLDA 1GVRA 2YYUA 4NNCA 1VLWA 3DI1A 4D2JA 1O95A 1GG0A 4JDBA 1SO4A 5KZEA 3C2FA 1A5CA 4ZL1A 5HWNA 1JRCA 5ABTA 4Z08A 3PUDA 3L67A 1NVMA 2YW4A 4NJKA 3OVQA 4MZ1A 3OVPA 5IM51 1PCWA 3MI6A 4UUIA 3HMJG 1YDNA 1W5PA 4MVAA 1JCJA 4DELA 4QAIA 3CM4A 3G0SA 3PBYA 5E1QA 1KV5A 1NEYA 1EWDA 4MPQA 3HF3A 1H7RA 3F4WA 3MO7A 4HNVA 3E02A 4JYDA 4O52A 1G7VA 3PSVA 2WQPA 4UCGA 4UTIA 3LERA 5D02A 1EP3A 3TAOA 3IRDA 3GNNA 2J6XA 4M7SA 4Y6GA 3GDMA 4N9CA 4C1KA 3SY5A 1GQNA 4JD4A 1G4EA 2Y88A 3CEUA 2A7NA 3QM3A 3TKFA 3P8IA 3BG9A 1P1XA 1TPVA 5DBTA 5K3VA 2QCLA 1SO3A 5HUOA 2VFHA 1OX4A 5C55A 4FNRA 1N55A 3QYQA 4FO4A 2EKCA 1VS1A 5J5DA 3IIOA 1JR1A 2WOQA 3EX2A 5D05A 3HGOA 4AVFA 3P67A 4UIOA 3TQVA 5CPMA 2QCDB 3W2UA 5DN1A 4PC8A 2C0AA 3IIVA 3TFXA 1RV8A 5D2TA 3EX4A 3SZ8A 4XTDA 2ZTKA 2VEKA 3P81A 1EP1A 2P10A 1U5JA 2E6YA 3QZEA 3S5YA 3TW6A 4UXDA 3VI2A 1VZWA 4UTWC 2ISSA 4A29A 2C3ZA 3EX6A 1F5ZA 1FQ0A 1IXPA 2QCDA 1H7XA 1PE1A 1JCYA 3PSWA 4HKPA 4AF0A 1W37A 1WV2A 3DKLA 2RDUA 2A4AA 1XDMA 4NT0A 4JTIA 1LM1A 4AHOA 1X6UA 5HWJA 2X1RA 4XTIA 1KFLA 3NQDA 4CQ8A 4Z1CA 2C16A 3B0PA 1QCWA 4K36A 1TB3A 4PODA 3W1TA 2J9YA 4DO6A 1PCKA 3EEGA 1YXCA 1TTIA 2ZRUA 4U4MA 3T7VA 4BF9A 3P74A 1GT8A 4GJ1A 2V0TA 4O0KA 3W1LA 4LVBA 3C61A 2HTMA 5CZSA 3C4UA 4RZ5A 4JY9A 2XFWA 3P62A 4OBTA 1DL3A 1UCWA 1VHNA 3BARA 4O54A 1KM0A 3BK0A 1R30A 4BWLA 3TIMA 1OFBA 3OVRA 3UPBA 3EWBX 1L6WA 1TV7A 2KZHA 1FBAA 1V5XA 2XN0A 1ZFJA 5AHEA 2TYSA 3E96A 5BMWA 1A5SA 2V82A 3H53A 4UTTC 1DKWA 3B05A 2A7RA 2UV8G 5I3KA 2VFEA 1GVOA 3CEPA 3DBPA 5IBXC 4O12A 4G1KA 2H3DA 4IMFA 4R53A 7TIMA 1TV5A 3N9SA 4FNPA 3S5OA 2V5BA 4LC8A 2CWNA 1CI1A 1WDWA 4CNOA 2TSYA 3W83A
chains in the Genus database with same CATH superfamily
1B31A 4JX6A 3RPMA 2GK1A 4QG8A 3RITA 1I8JA 2GWGA 1AH3A 3TTSA 1UJQA 4V15A 5HNTA 5AHNA 4B5UA 2OYLA 1XLFA 1MEWA 3DG3A 3R8GA 3C8FA 5TF0A 3VIPA 4FLSA 4ZXLA 3PZGA 1DJYA 5C0QA 3DZ1A 1LUCB 1H60A 1W6TA 2Z2BA 2PWDA 4O1FA 3W7NA 1SR0A 3QVQA 3IWPA 3M4HA 2BY2A 1L6GA 3QH2A 1V3KA 4M6VA 4GJIA 3W7RA 1KBJA 3GC2A 1R2SA 4GZJA 4WRHA 4CD6A 1OF8A 3PULA 4MMWA 2RHGA 5CPQA 3UGRA 2JIWA 1X8CA 3GBDA 4WIWA 4IPNB 3OG3A 3SN4A 3ZXWA 1EEXA 4XAYA 1X39A 1A47A 1I0DA 4J3SA 3H22A 4V27A 4M1BA 4W89A 2BB0A 1E9IA 3GXPA 4JTQA 2WSRA 3MP3A 1NQKA 3R0UA 1TTPA 3DC8A 2ACSA 2QEZA 4H2CA 2PODA 1BWVA 2GZXA 4O1CA 4MYXA 4IM4A 2QR6A 2Z2AA 2ZZ2A 1ITQA 3QV8A 4Z2HA 3AC0A 2OFJA 1MW3A 4JQ4A 2PE4A 2SFPA 3K5XA 4XO6A 3DGRA 1UC4A 2BASA 2V3FA 1O60A 2E40A 2OODA 4D6JA 5C8BB 2R91A 1KRCC 4LUIA 5F1UA 2VDGA 3CHEA 1J01A 1ECEA 1MEIA 3VAVA 4NZ5A 2FZNA 3UNTA 4LUYA 4H1ZA 1SFJA 1I9CB 2CU0A 2W79A 3EPNA 4QQUA 3TQKA 3V5CA 3MT1A 1EC9A 1K70A 1OFAA 3QR3A 3WLIA 1GQIA 4GCXA 1E3ZA 2HWGA 5MKGB 5CJMA 3AXIA 1CYGA 2ZC8A 3QFWA 3WMCA 3CAQA 3FV9A 5LA2A 4P7QA 3DERA 4WVXA 4C1LA 2EF9A 2QUVA 1FH9A 3VNDA 3USZA 4LV4A 4CNNA 4WOZA 3UD6A 3O06A 3OIHA 4UC5A 2J7EA 5HDRA 3CBWA 4MKNA 3ZOAA 1JPDX 1ONEA 2GDVA 2E09A 4ML9A 1M9HA 1BXBA 4PMYA 1RP8A 1UASA 1O5XA 4ZFMA 3SR7A 2HJPA 5L6UA 1V3IA 1S46A 1PZ0A 1NDWA 2YX0A 1GEHA 1QPRA 4UTTA 1Z8AA 3I6RA 4MJ2A 2QDDA 2BS9A 4GXPA 2PWGA 1VBRA 4NUWA 5IBXA 1XYBA 4LBUA 4DQWA 1UWUA 3GNRA 4X22A 3FHQA 3ITXA 2FGLA 4WJEA 4K1GA 4QITA 5CG7A 3TUUA 3H2EA 1EGZA 4IFRA 1US3A 4JIQA 4PCPA 4E8GA 4DJDA 4HB7A 1WUEA 1XIBA 4NAFB 3DX5A 1A0DA 3CZJA 1UWAA 3RCYA 2I9EA 3OPSA 1YDOA 3SUUA 3MHGA 3ARQA 2QCMA 4IUOA 2D1ZA 1EOMA 3CL7A 4H6EA 1EYEA 1GUVA 2E68A 4J2PA 3PAOA 4BWLC 5CLTA 5HA7A 4NAFA 1R9YA 1BWLA 4XVEA 4CN6A 1NM9A 1ONWA 1VIZA 1WKFA 1OCJA 2DSVA 5F7UA 3KXQA 3ECQA 2BGNE 5D2WA 3W6YA 3QW3A 4DJFD 1KLYA 3HPAA 1EZ2A 1RCOB 4HZ6A 5AHIA 5HNNA 2XZ9A 1BF6A 5CGTA 3GFYA 2FFIA 4YS1A 3DFHA 5G2WA 3BLFA 1QW9A 1FWBC 1DWFM 1MW2A 4B5TA 4WKAA 4BZYA 5CLWA 3TSDA 1EA0A 4WGXA 1VFLA 1UQZA 3H4WA 3VDBA 1T8XA 2OSWA 1DQUA 1PV8A 1V03A 3P7YA 2D0HA 2Y5SA 2QCHA 1QI2A 3WL1A 3FFSA 3DHUA 1CIUA 1JZ4A 2XIJA 5BU9A 2OELA 4ML4A 3IUIA 3LRMA 3DKJA 3MY9A 1FP8A 4NVTA 1XR2A 4GX9A 2A3AA 4POCA 5A8MA 1S39A 1FWSA 1ZHAA 4FNQA 1OC5A 3NO3A 3CB8A 1P48A 2E0PA 2QUNA 5G1MA 1DHPA 2XM1A 3VABA 3DFTA 3W7HA 2VKZG 1T5AA 4BI6A 1RQBA 3BGJA 4HHLA 4LAOA 3CH9A 1EDTA 4G7EA 4PH6A 3LMYA 5C9XA 2WC4A 4US5D 4A3QA 1ME8A 2IQ0A 2YYTA 1N82A 2XH2A 4UTUA 4LBRA 1I2QA 1B5TA 3KVMA 3NL3A 4DUXA 1GQKA 3CPUA 3S2MA 3C86A 3W7PA 5KTLA 4KEZA 4XQ6A 2I17A 4MF4A 1NFPA 2X30A 2ZA1A 4K1WA 3VC5A 1V02E 5M5DA 2OCZA 1UKTA 1E0VA 1H7WA 3VIGA 2VGGA 3WELA 4JGDA 4AAJA 3E74A 3WJZA 4DNHA 1US2A 3M0XA 1EUAA 4MWAB 1SJDA 4F48A 4Q7BA 3VDHA 3C2VA 4S3BA 1TUFA 3SIMA 1J12A 2XU2A 1QNPA 3QLLA 3HURA 1NAL1 1EJXC 3RUBL 1V6XA 4GXMA 4J27A 4GQRA 4PMRA 5HJXA 1TWDA 4TUFA 5CGMA 4MTVA 3O8AA 2G37A 1KBBA 3OO2A 4ZB5A 4FSAA 2XIIA 2D3LA 3OZOA 1E6QM 1EH9A 1LOSA 3AS3A 3F7JA 4KIRA 3E0VA 3QYSA 2BZNA 1F6KA 1GYNA 2J78A 2RFGA 2C71A 1UYQA 1GTHA 2X1TA 3V35A 3OHIA 1HL2A 2A6NA 4DBEA 1Q63A 3L5AA 3WQFA 1VKFA 5F4SA 1SQ7A 3TAKA 4OECA 4KCWA 1BYBA 4HPXA 1KWKA 2CHNA 1V6UA 3CIXA 4PFHA 5CZTA 3ZYZA 1UD3A 3CNYA 1W1ZA 3V5FA 5BCAA 3K1DA 1OX6A 2XIBA 4YLWA 2JE8A 3GH4A 1DIEA 2HNEA 3RYSA 3W2LA 4QBXA 2GVYA 3WF3A 4ZO7A 6TIMA 4UR7A 4P8WA 3RNDA 3ZVIA 2CLPA 4L6OA 1Q4WA 3V0TA 1Q7QA 3I3EA 3TJLA 2PUZA 3JU2A 1UR9A 4O13A 3ARPA 3NSXA 4R9XA 3AALA 4JY8A 1JDDA 4S3EA 3W84A 2REQA 1W0MA 3PP7A 3BGAA 4KEMA 3U8GA 3GQYA 1UMYA 4GCAA 2X16A 1V08A 4NAEB 2V30A 3MO4A 2C91A 4PR4A 3LZ5A 1JAKA 1LP6A 3BICA 3T4CA 3IS4A 4HJFA 3MPGA 4FZIA 3ABSA 3LCGA 4MSSA 4KBXA 3IJ6A 3K8LA 5K2ZA 5HNRA 4NAEA 4ZOEA 2PDQA 1JUKA 4IL2A 3L0GA 4HA3A 4FPSA 3N13A 2NT1A 2OLSA 2OO6A 3R6IA 1Q7ZA 1KM5A 3HO8A 1VJIA 3LMZA 5F1VA 4ZFCA 5EMMA 1F74A 5E93A 2VC5A 5EKYA 3U5UA 1VPQA 3WFLA 3BW2A 3NQ2A 3TR9A 2FB2A 2JALA 4PL1A 1XIIA 3URNA 3QW4B 4F2BA 1CLVA 1JD9A 3D0CA 1EPXA 3AS0A 1W2PA 4O1BA 3BPWA 3I6TA 3AMGA 1XKYA 2PGEA 5DLCA 4E8DA 3S46A 4RV3A 3R5EA 3KLKA 3KCOA 4HTBA 3RCMA 2Y62A 3EOEA 2DH2A 4AU0A 4JPGA 4GMEA 4OKDA 3GX9A 2Y8VA 5XINA 1M1BA 1Q6DA 2IXVA 2FZMA 4WJXA 1IR2A 1WA3A 2MUCA 3TR2A 5CC7A 3Q65A 4M0XA 4TVUA 4D6FA 1QOXA 2ZUSA 4D6IA 1Q7MA 3BMXA 1E0XA 2NQ5A 2AMGA 3GUWA 2ZA2A 1A49A 1JEZA 2PS2A 3J7HA 3M0IA 3NZGA 5AC8A 5CCZA 2OVLA 3NPWA 2NXIA 3S3GA 4MY9A 3W1PA 3S2JA 3MDUA 1OHLA 1OT1A 2WNZA 5F2MA 4UTKA 4K6AA 4E38A 4H83A 3CQJA 4FALA 5C7VA 3AMCA 3SW6A 2YLAA 3WH6A 1OFQA 2J62A 3BC9A 3HB9A 1DIDA 2Q71A 3UWWA 4S3CA 2W3ZA 4LFYA 3F2BA 2D22A 3T0AA 4P8VA 1IZJA 3VMNA 3TYDA 4PMVA 2PTXA 4HYVA 2CEQA 2XFYA 4BF7A 2OX4A 1CENA 2DT2A 4HCHA 3W1MA 1MXDA 2Q3OA 4D72A 3NWRA 1A3HA 1X6LA 3CWOX 4HN4A 4UQ9A 3W9ZA 3VUSA 3W1AA 3TC7A 3C2OA 1V02A 4YPJA 1RJRA 3S1GA 3R7MA 2ZVRA 1JJKA 3ITYA 4AHPA 4YVVA 4GVHA 3RMEA 1K9DA 1EP2A 2J24A 4JKLA 4CU7A 4DJFC 1G6CA 2BSLA 1K02A 3WJSA 4K8GA 2YA2A 2F2HA 2UY3A 3CIVA 4FP1A 1JYXA 2JGQA 1QFEA 3ABZA 2PDLA 2EPOA 4JFWA 3S83A 2WCGA 5FJRA 3L2LA 1Q45A 2C13A 3KWSA 2HV5A 4G1NA 2PGRA 3FJ4A 3AUJA 1VLIA 4OBRA 2ADAA 2Q8LA 5AC4A 2OX1A 3KTCA 4HVXA 2QF7A 1DYSA 2J13A 3CZEA 4H19A 4KIEA 4TV6A 1CXFA 4KQNA 4X2RA 5I79A 3T42A 4GYFA 4GA8A 1U1JA 4QLKA 3ARSA 4IH3A 3R89A 1IEXA 1ZB5A 3N2XA 1PDZA 1SU5A 4MJZA 1JQXA 4NNAA 5LHFA 1Z69A 4R7OA 1VEPA 1FVPA 1W3IA 3S47A 4FB7A 3MSGA 4IIFA 1AJZA 1IEVA 2LLEA 4GUHA 3GR4A 3LXAA 1S3TC 1TVNA 3W00A 1WNOA 2YCJA 1GVYA 3MMTA 1PKMA 4IMDA 1XIEA 2W91A 3IPWA 2CITA 4L7ZA 3DH7A 4F0LA 5D2VA 5KITA 3LRLA 1XUZA 2IXUA 3LYEA 3WQ4A 3MV01 1EJWC 2YDRA 3F03K 2Z26A 5I02A 2ZBTA 4WY0A 2H8XA 5I03A 5A6LA 3C0SA 3MSDA 1IQ8A 3NCOA 3UESA 1A4LA 2ODOA 3ZFHA 4QE1A 5HBFA 2ISFA 1JDEA 3KOYA 1PB0A 4EAMA 2ZUWA 1CB7B 5D9MA 2G96A 2ZUVA 2NV9A 1UBPC 1WB0A 4GYJA 1PUDA 2XPKA 4X2PA 3VD9A 4Z1DA 1JYWA 5CC5A 1UZDA 3KCJA 1KO0A 5AYBA 3TN5A 4IPLA 3LCIA 2GJNA 4U31A 2J4GA 1XLCA 3RM4A 3AQUA 5FA5A 2D2JA 3G1DA 4MNMA 3G22A 1GOOA 1XCXA 3H7UA 4GI8A 4IPPA 4IJBA 3EXSA 3IJIA 4C91A 4M82A 5CJNA 2BY3A 3GG1A 3PJUA 2PDHA 1JXJA 4G8TA 2OT1A 1E1CA 1EGMA 3T08A 2Z29A 4PMZA 2OZ8A 1XD0A 2WCAA 2V5JA 4Y9AA 4GGBA 3MMWA 1JNDA 1G69A 4NYYA 3SGUA 3WLQA 4Q22A 1HGYA 2ZQ0A 3B9DA 3W07A 4EP8C 3R43A 1XICA 1W9UA 2F38A 1X8FA 4H9UA 1A3XA 3STGA 4QDPA 4B5NA 4HT3A 3MS8A 4M6UA 5G1YA 5JQ9A 3KBJA 2R82A 2QMJA 4LX4A 2YW3A 2VTFA 3V5OA 1FHLA 3N9RA 3S6DA 4BI5A 3VE7A 2PDCA 4LRTA 4UMAA 3Q4DA 4PA8A 3CXOA 2V2CA 4G6CA 4DJFA 4IPIA 2A3LA 1E0TA 3N18A 3DCPA 3PFMA 2YCIX 3TJ4A 4P7RA 3DFYA 2GQ9A 2WJFA 4ZQCA 3MQTA 3HPSA 3NZPA 3GTXA 1W17A 2X1UA 3TU9A 4MUZA 4GNJA 4BJHA 2IUZA 5AYXA 4DYJA 1RQHA 3GW3A 2VGIA 1TWWA 2NQHA 3NSMA 4A4AA 3AU6A 3WNKA 4GD0A 3UP8A 2OB3A 1Q8JA 4KERA 2ZRWA 1A5AA 2CERA 4Q8WA 4UQAA 1Q6QA 2I5QA 3H70A 2W27A 3IJQA 3HJZA 5LIXX 4AZHA 1MQRA 2CCRA 2IPWA 2PC4A 1PBGA 1XQLA 2D23A 3AAMA 2PWUA 3L2IA 4PB3A 5A2CA 3QZ6A 3V0UA 1IXNA 3ELFA 1M53A 1RA5A 3H54A 4F2UA 4JX5A 4DNMA 4CEXC 1K9FA 1BGGA 1EB3A 1E9YB 3MUY1 5HWMA 5DFAA 3SEPA 3W0KA 3IANA 4US5A 2WMIA 3OEXA 2FPVA 3PBGA 4C6PA 2GGGA 4I7WA 2PZNA 2XINA 3L5LA 2VZTA 4ONVA 2DIEA 2XFFA 3RFAA 1A5UA 4Q8PA 3QTPA 2WM1A 1MEHA 3H23A 2DFAA 1OZQA 2FVMA 3W88A 2GJXA 5FAJA 2ABAA 3QQ1A 2ESCA 1AQHA 4PTWA 4JCMA 2DZSA 1XG3A 5CPSA 3SN1A 4C6MA 5J04A 4L4PA 2Q02A 1X1OA 2VP8A 2XSAA 4XD6A 4L80A 5ABHA 4O1AA 3MSRA 4IQJA 4UOQA 3N3TA 1PXGA 1VCFA 3ZQ9A 4KMQA 4LALA 2FHCA 1PZ3A 3G1AA 3DG6A 1ZSXA 4N4PA 3MWCA 4KEUA 4ZO6A 3GUGA 3M6YA 1G01A 5AHMA 1B3WA 2Y4SA 4RKAA 4XD3A 3CAKA 1VBGA 3TN4A 3ANUA 4A05A 2DZUA 1XLBA 2ZZ1A 7XIMA 2YDSA 3CAVA 2QCGA 2R6OA 3W6MA 2ZRXA 3PJXA 1G7UA 1HO1A 3RO6A 3RM8A 1ZUAX 3GKFA 4JDYA 5I3GA 1IWBA 2J27A 4K7YA 1E0WA 3TCSA 1OBAA 1BLIA 3PUEA 1GYLA 4PGLA 3GWQA 3CZ8A 1UA7A 4A35A 2VRKA 1VBUA 1XFCA 2ZICA 3O6DA 4MWAE 1R2RA 3WJYA 1SZFA 1KFBA 3CQHA 5AOUA 4R9OA 5CPNA 4FIRA 3GU1A 4ORMA 2E5CA 2GVLA 4YNGA 4C6JA 2F61A 1W31A 2IQDA 4NNBA 4IOTA 3W53A 4OE7A 3WQ6A 4ADUA 3MUIA 4OFCA 4DIAA 3LCLA 4YTUA 4GRSA 3K8KA 2G5WA 4RDYA 3T81A 3ARXA 1S2CA 3W1RA 4GNVA 2PLKA 4UTWA 1WUFA 3R0KA 3RRAA 1R3WA 3PZTA 1J0KA 2W5FA 1VYPX 2WHLA 3G18A 4PTMA 4C1NB 3N04A 5DXYA 1G4SA 3VFCA 3VIMA 3ZSTA 3CT7A 3WQCA 1AK5A 4O8AA 3S6OA 3LCWA 2YDQA 2EBNA 4QR6A 1OGGA 2ZADA 1E56A 4GH1A 4C1NA 3D46A 3OGVA 2O9OA 4RDZA 3ARWA 3KE0A 3AJXA 3KM8A 4OQVA 3KWXA 4I9JA 3REQB 4TIMA 3NGFA 3I4EA 4LANA 5DF0A 1VFUA 1NF0A 1CXKA 4LF2A 2VT0A 4O57A 1JZ5A 1XLJA 4AY7A 3VOJA 3KVJA 3EWZA 1GVFA 4LW7A 3REQA 1WAWA 3E0IA 3IUDA 1B9BA 2BY1A 2ZUMA 3L7RA 4BQ2A 4MWAC 1U1HA 3RO8A 5IFPA 1O6IA 2XGBA 3V4BA 3L12A 5EMJA 3G1HA 4HD5A 5EBUA 1EIXA 4Y96A 1KA9F 1YTEA 2G3JA 2GQ8A 1F6YA 4EIVA 3QC0A 5F2LA 2HXUA 4O8RA 5M1TA 1TR1A 3SGGA 2D20A 5TAOA 2J6VA 4H8UA 4NRSA 4XKYB 4AY8A 1HJQA 1MUMA 1MRQA 2RJHA 1E6XM 1VPYA 2CLHA 3MI3A 1P4CA 3QQWA 3AI0A 1XIHA 1L0PA 3THDA 2WSPA 1J11A 3VVGA 3CUZA 4QFUA 3MMDA 3EA3A 2V2HA 3C8NA 3E0WA 3RGTA 3WZ0E 3LQGA 3EB2A 4M19A 4N6EA 1ZGDA 4K8HA 3UXLA 1NP0A 5HPCA 2WLYA 2Z24A 2FGBA 3GYCA 3GB6A 4ATWA 3F5JA 4LVFA 4ZO8A 3W85A 4JBRA 3B0XA 3NIYA 4IFKB 1EHNA 1UOKA 1SJAA 1CTNA 2WJEA 1PZ2A 1WBJA 1DJIA 4IFKA 3EKGA 5FF0A 4WDWA 3OA3A 4JTLA 1B2YA 4YCPA 2GJLA 4CQDA 1QVBA 1NJJA 2BFGA 5EMKA 1RAKA 2OKOA 3ZLGA 4OV9A 1RY0A 1UHVA 4FIQA 1ELSA 3GYEA 4M7TA 4AWSA 1J4EA 2DJXA 1H51A 3WO8A 4CQBA 1XYAA 3KP1A 4LEQA 3II1A 4NJJA 4MJ4A 5I3FA 1SSGA 3WH8A 3EWWA 1QUMA 3GXTA 3CL6A 1ZLPA 4ZCWA 1S5TA 2INZA 2VJXA 2J8TA 1LQ0A 5GJNA 4L1GA 3JW7A 4P8UA 2HSAA 2IQTA 3Q94A 3ZO9A 1UD6A 1S1PA 4LV9A 4AYSA 5LYRA 3ITVA 1GZJA 5I7GA 2RUSA 3F5LA 1M41A 4WLCA 2YJQA 5T9CE 2EPLX 1ZQ5A 2PDIA 3BAJA 3BUVA 3WG6A 1FHUA 2ZUTA 1NVMA 3C3UA 4J1OA 2Y5JA 1FWFC 3MI6A 3HMJG 1YDNA 1W5PA 4PMOA 2YB4A 1UP0A 3T6CA 3CM4A 4DWSD 4YJ5A 1G7VA 1SJCA 3FGCB 3LERA 3WLSA 3IRDA 1WCGA 3SCQA 3FY1A 2FYMA 1GQNA 4JD4A 1E6NA 5FL1A 1G1YA 4NZ1A 3QM3A 2JFEX 4URIA 2QCLA 1XCWA 5HUOA 3UYIA 4L9XA 2XGZA 1YNYA 1OX4A 2PSNA 3A3XA 5C55A 6CGTA 1N55A 3QYQA 4L5ZA 2VZVA 5J5DA 1R8LA 1QK0A 4AVFA 4QP0A 5CPMA 4IICA 1GHRA 2C0AA 4JIIX 1TWSA 2WMHA 5ABGA 2VD8A 3SZ8A 1PDYA 3OB8A 3P93A 1J18A 3AYVA 4EXBA 2E6YA 4XAZA 2YXXA 3TW6A 3T8LA 4BA0A 1LLOA 1F5ZA 2YCLB 1IXPA 2NVDA 4Y9MA 1HW6A 1WV2A 1B3YA 1DWJM 3DKLA 2A4AA 1O12A 4DVOA 1TX0A 1GOWA 1FWJC 3OGSA 3NQDA 4Z1CA 3B0PA 1QCWA 4KRZA 4K36A 4PODA 3OZYA 1C8YA 2J9YA 2EG7A 4C7DA 4DBSA 2IKIA 4OUIA 5CZSA 3BSMA 3OW1A 1AD4A 3C4UA 4QGCA 5ECUA 3UF9A 3THUA 3P62A 1H4PA 3WLPA 4UTFA 3EWBX 3WEMA 3BLPX 2XVGA 3LENA 4JTCA 3DBNA 3GVWA 5AHEA 2I57A 4Y2WA 3AYTA 4W4QA 3R0DA 3SBFA 1J6OA 5BMWA 5EGRA 2V82A 3AHZA 1DKWA 3B05A 3N12A 2UV8G 4LUSB 4H7ZA 4R53A 1FP9A 1TV5A 1W9XA 3N9SA 4FNPA 2GVEA 3UG8A 1CI1A 1WDWA 2TSYA 1OCQA 3ZLHA 5PTDA 2OSYA 1W5NA 1V3JA 4JNYA 3STCA 1TR9A 1UWQA 3L4WA 1RHCA 4PBFA 3MYOA 2NZLA 2PFHA 2WBGA 2QHAA 1UUOA 1V7AA 1MMFA 3DFNA 4CD5A 1DV7A 4OT7A 4O17A 1C92A 4QROA 5FCZA 2R24A 4LF1A 4W8BA 1FY6A 2J47A 1SFTA 2PGFA 1XM3A 4XUGA 4Q4KA 8XIAA 5DX7A 1BXCA 2V3EA 3IIPA 4ZOBA 3NYZA 2OKTA 4JYFA 4ZENA 2BVYA 3FVMA 1I6NA 4UMCA 5LNRA 1A5KC 3LEPA 4LTSA 4B3LA 2PU1A 4LB3A 1TPDA 2VZUA 3MKVA 1XLGA 4LUTB 1M7OA 3UJSA 3PBMA 3VNKA 3G5EA 2WO5A 4RNHA 3OYXA 4K68A 1I4NA 4H8NA 1XD1A 2WMFA 3QSTA 1FCUA 3NQMA 1CLKA 4GYKA 1Z6KA 4AUBA 4CNUA 5FESA 3LPGA 3B0VC 1ICSA 3HQPA 3GDTA 4MADA 1W3JA 1PIIA 2VR5A 4LRSA 2XH4A 1M7JA 4FX8A 2BG5A 1ECQA 4GKTA 4B2DD 3HOJA 3W28A 1PTGA 1W9VA 4IJCA 1KW1A 4W93A 3SCTA 5D38A 5EB8A 4N9EA 2BVWA 3GXIA 4HHMA 3BL3A 1C7SA 4DY1A 1JZ7A 5LNUA 3VU2A 3MHFA 4LB4A 2A2IA 5KZDA 3O3RA 3GAYA 4ATLA 1FWWA 1E73M 1Y5VA 1UZ4A 2H3BA 1TQXA 4AD4A 2OJPA 2ZIDA 1TPUA 4OBSA 4HZMA 4Z0SA 4YWIA 3W22A 1XBXA 1YADA 1RVKA 3E1F1 3T78A 3VD7A 3UR8A 1HKJA 1OT2A 3STPA 2RDWA 2O9PA 2QGHA 3OP2A 3TC3A 1OCBA 2JIEA 1PX4A 1U22A 4H6KA 1MSSA 3QXBA 3W7IA 3WLRA 1AVAA 3MA8A 3IEBA 4R33A 5DY2A 5CAHA 1D3GA 3C0LA 4QISA 1TE6A 1V51A 4DM2A 1XISA 2BV9A 1P7TB 3R10A 4YMZA 1XYLA 3U2ZA 3N2BA 2GUYA 1C8VA 4MG4A 1EXBA 4XK2A 3K46A 3T05A 4U3AA 2WC7A 1EJUC 2VEPA 5CSSA 3JZUA 1CXIA 5C6MA 4YU1A 2WVSA 3WENA 4UFLA 4GVFA 3W2KA 1WYIA 1EOKA 1QNQA 4KGJA 4PL2A 3S2LA 4JX4A 2X0HA 4EKJA 3RMJA 3CUJA 1LG1A 3T0DA 3TA9A 5C2GA 3AIWA 2J79A 4R7JA 1B3VA 5HNUA 1QWGA 3HGJA 4QLJA 5LGXA 3G8EA 2WZMA 4JTGA 4WR3A 3NQEA 4ZGYA 2YXOA 5LIWX 4EF8A 1M5WA 1J79A 3EXRA 1AW5A 2X2GA 3EWXA 3QR1A 1FUYA 4PMDA 4HCLA 1EX1A 3CWNA 4IQLA 1RR2A 3ARVA 1FA2A 3PR2A 5I07A 3BAYA 2WCSA 1LRQA 1M7PA 3EEZA 2CBVA 3LLXA 2V8ZA 3BLLA 1B57A 1BG9A 3VOFA 4GO8A 3H6OA 4Z2KA 1DP0A 4I7UA 3TK7A 2D24A 2V3DA 4JXCA 3WY1A 5E0FA 3NL5A 5EMYA 2NSOA 1E0UA 4IIEA 2ZOXA 1Q6EA 5A8GA 3B8IA 1JI1A 3QHNA 4F9JA 1EF3A 3MANA 4ADTA 3QJAA 1KXQA 5G4WA 3L4TA 3U5YA 3SCRA 4AB4A 3U4AA 4IG2A 3RDKA 1HJSA 1R7OA 3LUTA 1JG9A 4M6QA 1OY0A 1UR8A 1BYCA 1LRTA 1TTQA 2ZZ3A 4IX2A 4N9DA 1IHIA 1YMYA 4E0CA 1DJGA 1C3FA 4WKHA 2XTKA 2ZDRA 4WXYA 4DWSC 2WHJA 4LQ1A 1XGEA 1ISXA 3W24A 3BWWA 1X96A 3K2GA 4EVZA 4CQAA 3UWUA 1Z32X 3P80A 1UR3M 1YEYA 3M0HA 4HNOA 3W26A 3SDOA 1YE4A 3DHDA 1MXGA 4E6MA 3C6CA 5F4XA 4Q8UA 1UIOA 3JZEA 3GW0A 3VGDA 4I9TA 4U2ZA 1WKDA 2I1OA 3CHDA 4OU1A 3H7VA 4BEUA 2E67A 2FVLA 1W8SA 3ABQA 3ZM8A 2PTDA 1F3XA 3UWEA 2NWSA 2E9BA 2E1WA 3D3FA 1QBBA 3WK3A 2PU0A 4XB3A 4HGXA 4S3FA 3MKCA 2FH6A 2FJKA 3M1ZA 3LRKA 1K3UA 1XKJA 1I60A 1Q65A 2O4MA 1MWOA 3VKJA 4JIRA 1P0KA 4XIAA 5DMNA 4UTHA 3LBCA 2EG8A 4QEHA 4PUEA 5L9FA 2FPTA 3BH4A 2G3IA 3QBUA 4QXIA 3LOTA 3T0TA 2FGZA 1G67A 2RDTA 5A94A 3EA1A 4Q4OA 1FWEC 2DZTA 5HMFA 2PDFA 4XBKA 4S39A 3F2CA 2YXGA 4B5XA 1XFBA 3AS2A 1VEOA 4QS6A 4CNTA 3M9YA 1FWIC 3SRDA 1OFRA 2X2YA 3D6NA 1XIMA 4HOWA 5FJTA 3O63A 1LORA 3ARTA 3MB9A 4H3DA 2QLYA 4IZGA 4E3TA 2DUXA 1UZHA 4XSLA 3VNLA 3S42A 4JHOA 4X60A 4R85A 5ABFB 4IXXA 1GJUA 2J7HA 4KEVA 4J3VA 1L9WA 2CBIA 3PG8A 3SM0A 4P61A 1J0YA 3P84A 3QRHA 4EWJA 1PJ9A 3TFCA 1JRBA 1X7IA 1HO4A 4GYPC 3EWCA 4WDXA 2YSWA 4DWDA 3CASA 2L5HA 4XUYA 6TAAA 5IXEA 1ISWA 4O4VA 4XZ9A 3NQ8A 1YIXA 3V1PA 5A3HA 1L8NA 3HQOA 4MNJA 1HIZA 2JEPA 3M7SA 1ZAJA 3IGSA 1VBJA 3QMTA 5GPRA 4Q8NA 2QAPA 3SFWA 4J35A 1EJ7L 3MC5A 5F2IA 1UD8A 1O94A 4LS1A 4IFOA 3AS1A 3N2TA 3W7QA 1E72M 2GSEA 2V2DA 2Z6IA 1OFOA 4H9YA 4MY1A 3GDRA 2HISA 2AL2B 4JIEA 5A69A 1XIGA 3M5VA 3A47A 2J75A 3UR7A 3HN3A 1K7FA 1E4IA 1I2PA 5HPOA 1EF2A 4DBDA 2Z00A 3LLFA 1QHPA 5BOOA 3VGHA 5EFDA 3BAXA 4CN4A 2R8WA 3DFQA 1I2NA 2GSJA 3NAVA 3PFRA 2ZUUA 2VUNA 1MQQA 1IZCA 1BD0A 3DYPA 1R3RA 3PZMA 4GBDA 4DWSA 4J7RA 1SZNA 3PTQA 4KFOA 4BKNA 1TZ9A 4QE4A 1TJ0A 3E3HA 1QAPA 2CLMA 4HA1A 1KFKA 3TJXA 1TCDA 1GVEA 1G94A 1XF0A 4DAFA 4EWND 3S9IA 3GHTA 3WFAA 1J9YA 4BF5A 3WNOA 1IGWA 2IMRA 3W72A 1RALA 2QCEA 1FDZA 3UU0A 3NR0A 2O92A 3A4WA 4JFVA 3LTYA 1G9HA 4XKMA 5HMDA 4M56A 4JFSA 1DXEA 1S2WA 3ZMRA 4F79A 3WQVA 4NASA 3EZ4A 4ORIA 1NDVA 4HU4A 1PKLA 1GOXA 2Q3RA 1QASA 3UNDA 1T6MA 1FXPA 5I3IA 4RE4A 4GNKB 3GU9A 1JQVA 1LCOA 4UOJA 1IT8A 1B1YA 2CLLA 2R1PA 5JIPA 1MI3A 5C71A 7ENLA 3WMSA 3HG4A 1PSCA 1BTMA 2TAAA 4GQ0A 2DORA 3FXYA 1A5LC 4IX0A 3TONA 3GM8A 2QUUA 1BHGA 2VCBA 2DQWA 1GPFA 1SGJA 3T1GA 4HNNA 2HEJA 1EQPA 3DU0A 1DJQA 4LUJA 4BI7A 1TPEA 2DUAA 4Q7IA 1K6WA 4YYCA 2FZ9A 1UBSA 3WDPP 2NUWA 4S3GA 1IT7A 1NOWA 3MUZ1 1HVQA 3O0KA 4LEFA 3P14A 1FH8A 4GKLA 2J9XA 1TRIA 3CIWA 4JQ1A 1XSKA 4XWUA 2R9RA 3SUVA 5M3WA 3K4DA 1AJ0A 1YHTA 4WOQA 4FNTA 3T07A 4TMBA 4OIFA 3KAOA 1LZOA 3ZJKA 2ONEA 1E9ZB 4LY4A 3OLIA 3U2EA 1GPWA 4F3HA 4Q8OA 3DAQA 2UWFA 4H6QA 2YPIA 1P0DA 1EDQA 3IV3A 4QG6A 3S6TA 3T0BA 4NKCA 1FCBA 2ACQA 4J3TA 4D8ZA 3KP0A 4CCCA 3W75A 3I10A 4DZ5A 4GYPA 3LCFA 1D9EA 3HU7A 3A24A 5A6TC 1H1YA 4ICNA 1N8FA 1QO2A 1LBMA 3C52A 3DDMA 3MP5A 2QV4A 4M51A 4DYEA 5DRIA 1JL8A 4O53A 3TTEA 3W23A 1GKQA 4YCOA 2OZTA 4I6VA 3KOZA 2DZPA 1CLXA 4B16A 2OOGA 1BF2A 3NO1A 1XYCA 3VNZA 4L4OA 5FF4A 3PM6A 2DDXA 5MHBA 4KH2A 2XN1A 1O5KA 4I5XA 4D8LA 5I6SA 3IV8A 3C2YA 4NF7A 3UVAA 1MW1A 4GQGA 2TODA 3I3DA 1V3LA 2C1GA 4LAKA 3TZNA 3K1GA 3B06A 4QLLA 3TW9A 4D8AA 1VHCA 1R3SA 3QY6A 1T96A 5HJLA 3BVJA 4AVOA 1Y7VA 3P0WA 3RCNA 4QSHA 1EO7A 1HKMA 4X0NA 4A8LA 3PUOA 2W63A 2PWHA 2I7GA 1JDCA 4A22A 1TFVA 1R3QA 3IK2A 2AOSA 3QV6A 4DJED 5ENLA 3RLVA 5BOFA 1XYFA 3WIJA 4ZZ9A 3U9IA 4RXGA 3VIOA 4L4LA 4U5KA 1P1MA 3FLUA 5LSMA 2UY2A 6A3HA 4XD5A 4ZQOA 3NO5A 4HJWA 2VR2A 2FB3A 2QVHA 1JUEA 5BXPA 4IGMA 3KW3A 4NYUA 4DZAA 1KM1A 1JULA 4B2DA 3P60A 5E0CA 2QUTA 3GC5A 1D3HA 1WKEA 4UR9A 4WXZA 4XAPA 1CT5A 3KVKA 4S2CA 1OZMA 2ZWZA 3G1SA 3OA5A 1FWGC 1RPXA 3BE7A 3UZXA 2ATSA 2D2OA 2X7WA 2YDAA 1IEQA 4JTDA 1TCMA 4Z17A 2IKHA 2ZX7A 3CV6A 1HT6A 3BOFA 1P5BA 2EPKX 4QQ3A 2OZ0A 1VFSA 3QQ0A 1UWIA 2E4TA 3CZGA 1R0MA 4PUWA 5H2ZA 1J0ZA 5IRPA 4C6FA 2YL5A 3VZYA 4ZE5A 1LQAA 2C7FA 3UZ5A 1W32A 3OOQA 4HQVA 1VYRA 1DEDA 3NYDA 4JICA 6REQA 3VTRA 2FDMA 3HQ1A 4MUPA 2QAFA 1PX8A 5KZMA 4Z1YA 3M0KA 1UUMA 2VEIA 1R7AA 4FF7A 2OSXA 1KRBC 1Q6RA 1DE5A 2P50A 1P6CA 1SUXA 2B4GA 4LJ3A 4FOJA 3VIHA 1ISVA 4REQB 4PCFA 3LPFA 3LHWA 3CHCA 4ATDA 3WK0A 1W54A 2O0TA 4PRTA 4A8RA 2PB1A 3VCRA 1TJ2A 4NRRA 1PTDA 5REQA 4IUGA 3VIIA 2C14A 4F9DA 3LX9A 3GIYA 4WJ8A 4I8DA 1HGWA 2JGYA 3A22A 3QFEA 3EOSA 1I45A 1OG6A 3RRXA 2BWGA 2OQHA 3SCPA 1X6NA 4XAFA 3LI1A 4J2MA 1RSCA 4DB7A 3POCA 3GH5A 2Q8XA 5HUPA 2PDXA 4ZQPA 3EB3A 2P53A 3B0YA 5G5IA 4AMAA 5I5RA 5J5RA 3EX3A 6ENLA 3W70A 4ICCX 5FEPA 4HNTA 5C9WA 4D1JA 4O15A 4S23A 4FA3A 1Q6CA 3N6HA 3GDKA 1R85A 3QPYA 4W9TA 4ZE4A 3MVIA 5BXRA 4WUIA 3SUSA 4TX6A 1NWSA 2Z1VA 3H2OA 2Y2WA 5FEXA 5GNYA 5DANA 1YXYA 3TLLA 1KNWA 3KZSA 3E5PA 2QPUA 3CL8A 4I9MA 2V5KA 4MYAA 1SFSA 3NG3A 1H62A 2I56A 1W3NA 1DJXA 3RX2A 3OGRA 5BRBA 1LL6A 2QDGA 4I90A 3AICA 2PTZA 1XLKA 2MNRA 1WXZA 1A80A 1IXOA 4BEQA 3GZ3A 3OBEA 1M6JA 1P0NA 2CZVA 2G3NA 3QMSA 4E4UA 1QW8A 2VC9A 3H8AA 3UCCA 4Z2LA 1F7BA 4PSRA 5LIKX 1HUVA 1XGDA 3W7LA 4OOUA 4XZHA 1JYNA 3H24A 5A6MA 3W27A 1ISZA 1Z89A 4UQBA 5FIPA 4GWEA 1YW1A 4JKMA 1D3CA 5A8OA 1FKXA 3CUXA 2A0NA 3LHUA 3PAJA 1RK6A 1BEUA 2YOCA 3GVRA 2XHYA 3BDKA 3K8MA 3SFKA 2PRMA 2E5BA 1UB3A 1A5NC 1ZBWA 2B7OA 5BWFA 2EPMX 1ZPTA 3QHMA 5CSYA 4JL2A 1R38A 3WDQA 5BRPA 1XC6A 3S1XA 2X40A 3LBOA 1CEOA 3O16A 4AWUA 1EA9C 5K9XA 4HPNA 3SO7A 3FAWA 2DUZA 4KW2A 1R9XA 4GIEA 5GJPA 1W1A1 4GABA 3AUOA 4C5ZA 4B3ZA 1WOBA 1O5RA 4FXJA 4JIHA 1AODA 2FTYA 2Q01A 5I24A 4JZ5A 1R87A 3W71A 4AWEA 2CWXA 1IEWA 2WHKA 1U30A 2CZDA 7ODCA 2RAGA 4Y8FA 4GZIA 3UA4A 4CEUC 3WDJA 1V6WA 3EPMA 1Z48A 3AMDA 2XWEA 1GOKA 3U7BA 1H2JA 1U5HA 1XHGA 4CU8A 3LTPA 1FOBA 3JRKA 2QV5A 4YYFA 4DBWA 4PTXA 1OEPA 3KZPA 6XIAA 1VC4A 3LGEA 4H9TA 2FFCA 4L9ZA 3THCA 1MZRA 1NFGA 2PAJA 1PWMA 3I7SA 4X0VA 3E6EA 1UC5A 1JCXA 3W38A 4S3KA 1RP9A 4PBEA 4CVWA 3FA4A 1VRXA 1EEPA 1NARA 2A7PA 4M8UA 1VJZA 1SO6A 3ITGA 1ZCCA 3NTYA 3MHUA 4JQ3A 1HNYA 3RX3A 1OADA 3VGGA 1QDSA 1WZKA 1KKRA 4LOCA 3B9EA 1K03A 3KEHA 4IWWA 3VE9A 3F4NA 1PX3A 3LK6A 3S1UA 3T9PA 1H5YA 4XISA 4NZ3A 2QIIA 4NXSA 3RXZA 3P5ZA 5JUVA 1C8XA 3B9OA 1NQ6A 4UTJA 3TSMA 4S3DA 1FDYA 1T0OA 3CK5A 5AC5A 4BR1A 4NXKA 3R94A 4DPPA 1DVJA 3WLKX 2QNEA 1Q2SA 1JCNA 1VH7A 4P7LA 1L6YA 4Z2JA 2PF8A 4J28A 4DAIA 2GJRA 1BQCA 2VEFA 1KB3A 2HMCA 3FJ6A 3WQEA 3IGHX 5JU6A 2NQ9A 1GONA 1EHAA 3SJ3A 1YPIA 2V68A 1TKKA 2DIKA 2DZVA 1ZS2A 4UFKA 2FMNA 3DHFA 2BXZA 3IUHA 1H7PA 3LM7A 4KRTA 3VC6A 2E6AA 4ILSA 5AKQA 3H2CA 3KRUA 2ZYFA 1E51A 1ZALA 2Z1SA 4J9JA 4CCEA 1QPNA 2WAGA 1Q8AA 3TYEA 2QJHA 5DRCA 3ZIZA 4DJEC 4QE5A 2WHMA 2XSBA 2WSKA 4GZ7A 2D2HA 3UCQA 4ZVJA 4PRRA 1HP5A 3KHDA 5EFFA 3B4UA 3HFTA 3SCSA 2R94A 3R79A 1B0IA 3G6LA 4LYKA 5EU9A 3GNXA 3ZWTA 3GHUA 4TV5A 2Y24A 3T40A 3PZQA 1QRQA 2J7GA 2JEQA 4K39A 5LA1A 1JF5A 2Y0FA 4D6EA 4YHEA 4HNLA 1C29A 4DO4A 3SCUA 3WH9A 3NPUA 2QW5A 4E2BA 1A4MA 3SJNA 4PBGA 1AH4A 1XJBA 5AHFA 3UR2A 1VIWA 2OYMA 2FZ8A 4LPCA 3QGAC 2FTPA 4ZBCA 3RU6A 4C6DA 3ATYA 1POJA 1KR1A 1GK8A 3MTWA 3O6YX 5CZ0A 4JS3A 3VKAA 2IKGA 3AIQA 3B8SA 2EAWA 4HMCA 1OGBA 3BXWA 3TCEA 4GVGA 3SCVA 4IPJA 3LHVA 1ZENA 3N2MA 4A3RA 1TJPA 4FXSA 1XYMA 2INFA 3PPGA 4ES4A 2NT0A 4KCUA 3LV6A 3PZ9A 1JYVA 3GRIA 3QHOA 1FTXA 2YL8A 4FF5A 3TXZA 2WSYA 5AYYA 3WF4A 2QYGA 4FX7A 4JNZA 4DRSA 5LKYA 1LLWA 3CV7A 3BQ5A 2TPSA 2NX1A 3POHA 3L4UA 3FDGA 5HMSA 3UG3A 5LIYX 2B7QA 4B9ZA 4I5UA 3S5ZA 2A6LA 1RJPA 2AQVA 1EO5A 3BLKA 2A3CA 5A8NA 1KC7A 1A0CA 2WMKA 4DF1A 3QF0A 4M81A 4TO8A 2BVTA 1UKOA 4DXXA 1XLAA 5H8PA 1UOZA 2DW7A 2BY0A 3GXFA 3I65A 3ITLA 1U1UA 3T0CA 3WLJA 1UPMB 3OBKA 2WZHA 3G1XA 2BBFA 2NXHA 1CGXA 3G3DA 3IK4A 1KXHA 3VMPA 1SFLA 3MBFA 2C6QA 1KFWA 2Y7DA 4JEJA 2WC3A 1ZJAA 4FLQA 4A3HA 3UWVA 1XDLA 4CCDA 2FDSA 3WNNA 2WW5A 3L68A 4F66A 3MP4A 3EGJA 1H0IA 1HKVA 1MO0A 3R25A 1GVRA 3D3AA 4G7EB 4NNCA 1E5NA 2HK1A 1RCXB 1SO4A 5KZEA 5IDIA 4ZL1A 1EBHA 3FYYA 4PMQA 1JRCA 4AFYA 5ABTA 4EE9A 4RNJA 3CS2A 4UZUA 2H9AB 4ZOAA 2WPGA 3L67A 2YW4A 1C7TA 3ICJA 4X61A 4PUMA 4HSHA 4B4FA 3BJSA 4JN7A 1TA3A 4L56A 1BRLA 3PBYA 3G0SA 1NEYA 1EWDA 4MPQA 5FL0A 3HF3A 1H7RA 4W84A 3F4WA 4HNVA 3ZJ7A 5FSEC 2H9AA 2WQPA 4IQDA 1EP3A 2J6XA 1Q6GA 4LNCA 4Y6GA 4C1KA 4ZB2A 3SY5A 5KEZA 1G4EA 3CEUA 3TKFA 3UXKA 3P8IA 3BG9A 1P1XA 4L61A 5T9BG 2VFHA 3URBA 3F2DA 4AW7A 4E5TA 3OQEA 3W6LA 5CSUA 1LJYA 1JR1A 5D05A 3EX2A 3HGOA 3IJ7A 3TQVA 3EA2A 1YNQA 5DN1A 2CC0A 2WZTA 3U2CA 3IIVA 1UQYA 4GLEA 2ZTKA 2VEKA 3W4RA 9CGTA 4V33A 5H8UA 3BZJA 3HV9A 2I16A 3S2NA 5JH2A 4UXDA 1I1WA 1XLEA 4D6GA 4IP7A 4A29A 2C3ZA 1K1DA 2PDPA 2Z27A 1AZ1A 1FQ0A 4AF0A 1H7XA 1PE1A 4HKPA 5DMYA 3N29A 2RDUA 4JTIA 5LXEA 4B5WA 4UQCA 3W82A 4B91A 4M80A 6PTDA 2R1NA 1JNEA 1RLDA 1KD0A 4F2TA 1V0KA 2YBUA 1YXCA 5DQPA 2EPNA 2ZRUA 4U4MA 4BF9A 3AHYA 2HXTA 2V0TA 3C61A 1VEMA 4L65A 2I9UA 4RZ5A 4JY9A 3O2LA 3TTQA 2ALRA 1CGYA 2G50A 3WD3A 3RLHA 1UCWA 4C6KA 4DXKA 4O54A 1KM0A 4Q4MA 2GWNA 3TQPA 4BWLA 4F0SA 2VEGA 3L4YA 1PAMA 3OVRA 1L8PA 3BZGA 4PN2A 1TX2A 1L6WA 1I1XA 1VJSA 4ZXOA 1EKOA 1M01A 1YPXA 1R5YA 2KZHA 1FBAA 1V5XA 3RPTA 1MYRA 2PDKA 3ZJ6A 1O68A 3H53A 1H09A 2A7RA 5HMEA 1B9ZA 1QHOA 2VFEA 1GVOA 1JI2A 3KLLA 2WVVA 1Y5XA 3S5OA 2REQB 1ESWA 3VD3A 3GTIA 2VHLA 4MDPA 4WSJA 3ONBA 1H5VA 3NUKA 1OM0A 3UXIA 3OJGA 4N2YA 4GC3A 4F0HA 3WDHA 4JR5A 3FSUA 1LROA 4JFTA 3DC0A 4AY1A 2PF0A 1LTDA 4EPBC 3NQVA 4LS2A 1A5MC 1PZ1A 3CTTA 2ZVIA 4N02A 2PGWA 3N4EA 4IISA 5D8WA 2QCFA 5C70A 4P7OA 3GLCA 4AX7A 3DXIA 4PCSA 2C15A 2YL9A 2WKGA 3FJNA 1EBGA 2G3MA 3EOUA 2FLIA 3SADA 5XIMA 2GGJA 3CUGA 3WDIA 1FWCC 2O7SA 1JZ8A 1ITCA 4UNLA 3CMGA 3S1VA 4PMNA 8A3HA 1IWAA 5D4YA 3L21A 5D9PA 4GX8A 3U2OA 2AL1A 4ROPA 3E0FA 3CH0A 1W1IE 2B31A 3IAPA 3M7WA 1HP4A 4PEKA 1IZKA 2Z1KA 1AMKA 4XZIA 2YGYA 4AXKA 4H2HA 3FN9A 1ITXA 3M5YA 5FJPA 3TEVA 4YVPA 4DJDD 2WWDA 1DTUA 4E2VA 3Q2DA 5GVJA 1OYCA 2ISVA 5B7YA 1ME7A 1KM4A 2F9RA 2V6AA 4HSNA 2H6RA 1WKYA 3JR2A 1IYXA 1VF8A 4H01A 2ZA3A 2WPBA 3EKLA 3ES8A 1M03A 4GUFA 2ZZ7A 1SZGA 3A4JA 4O19A 3ARUA 4W8AA 2OYKA 4DO7A 3IVTA 3P3BA 5D09A 2VQTA 3QZAA 1J2WA 2DSWA 4L9YA 2YL6A 1KQYA 2HS6A 5E0KA 3EWYA 1GZ1A 1RD5A 1LT8A 2PWVA 4TU1A 4FLRA 5D04C 1TIMA 3N3MA 3T55A 1BYAA 1I0BA 1C8QA 1TYGA 4HNUA 4YVXA 4UB9A 1JDFA 3MYPA 1A3WA 1UD5A 2Z1XA 7A3HA 3NM3A 4BY3A 3CPRA 3AISA 3MW7A 4JTRA 1CCWB 3T4WA 4WQ6A 3WJWA 3M47A 1TV8A 1PHQA 2Q09A 3CUHA 5FF7A 5AHLA 3TWBA 3Q45A 4XZWA 2CHOA 4KCVA 1VBHA 2G0WA 4ZMGA 2BVDA 4FEZA 4GIRA 3OU8A 4HHPA 1RUSA 3M07A 2P3ZA 2RH9A 1IT0A 5EYWA 2VGFA 1V6TA 1A0EA 1KBIA 4JTTA 2PTYA 3WBXA 2WJDA 2IS7A 2Z6JA 1VFOA 3M0ZA 5MF5A 2O55A 3OQ8A 3ANYA 3UZWA 1S1RA 3UZZA 1L6SA 3P61A 4F40A 2DVTA 2VFFA 3PTDA 3V7PA 3MI2A 4ZTXA 3AIEA 3R1ZA 3W01A 2UY5A 3ARRA 1JUBA 4ZQMA 4JN6A 4AZCA 5CSRA 4LVAA 3VNJA 1L6FA 5JBDA 1PTAA 2QJIA 3AIBA 2W62A 2XIOA 5LNVA 1TIWA 3L4VA 2GGIA 4JTUA 3IARA 4UQEA 1HJWA 4BCEA 4W5ZA 1HX0A 1NELA 1OINA 1W2VA 4H9MA 2QF8A 3PTKA 2ZCGA 2BOEX 2HVMA 3KFTA 4UMBA 4QTGA 1XDJA 4WKFA 1Q85A 5AZ0A 1YNPA 3ITCA 4NZFA 1XW8A 4MAVA 3UXAA 4AD5A 2PD9A 2OWXA 2H8ZA 1DIKA 1VCGA 2QMKA 3BTNA 1XLIA 3WKZA 1D2KA 4L6HA 1PEZA 3RU8X 4C6LA 1DQXA 4PSPA 5BWAA 5CPTA 3A5VA 3VGBA 2VZSA 1MNSA 1HVXA 1ZNNA 2X0SA 3WFZA 3PPCA 1K8XA 3H2NA 3CT2A 7PTDA 1GJWA 5A2BA 3LDVA 2PLCA 2WANA 1PWLA 4QNWA 4MWAD 4F8XA 1NIUA 3AZSA 1EUNA 3AO0A 2F7FA 3PWIA 4NJIA 3L4ZA 2VO5A 3GR7A 3NSNA 1S38A 3L0KA 2E9LA 1BPLB 3SSZA 4CNSA 2JF6A 3WH5A 4OVXA 1MXSA 1K4HA 4YHGA 2WZEA 4WY0B 1H50A 3IVSA 1N8IA 3QEZA 4DUOA 2NQJA 1ZBKA 2FKPA 2OPJA 3PB0A 2QULA 3CV1A 2DGAA 1AUSL 5FJOA 1US0A 4W88A 3FCPA 3MUAA 3ITOA 3UPMA 1TJ1A 2PLMA 1NOUA 3SAZA 3I7QA 2PLJA 2QT3A 4IL0A 3W1NA 4DLFA 1WXYA 3A21A 1V0MA 5D2YA 1V3HA 1KWGA 1OG0A 7TAAA 3NDZA 4GUGA 4JFUA 4XBSA 1TUXA 5A6BD 1LDCA 3OVGA 1REQA 1UWRA 4P2VA 4O18A 3PBVA 3ITTA 1IR1A 4S38A 1E3XA 2O7QA 3VPLA 2QZRA 2B7NA 1DQWA 1WDSA 2EO7A 1W1VA 2GFTA 1BVZA 2BHZA 3UJ2A 5BROA 3GTNA 3DEQA 3H55A 3VD4A 1H49A 3R13A 1DWHM 6ALDA 3PPHA 2WVUA 3CLMA 1DJWA 3LBMA 2P76A 3RLUA 4MKSA 1E1CB 4AQLA 2F6XA 3FW6A 2ZKMX 1ZJIA 4MY8A 3E2QA 3VK5A 2CZEA 1QK2A 2YBVA 3CYJA 2A5HA 4DUWA 3BLEA 1ZJBA 4Q6XA 5M03A 3QOKA 3P8JA 3UJRA 3HPXA 1GWJA 2OEJA 2VEMA 3BLDA 4HU0A 1CW2A 4AD1A 3OZMA 3AWNA 3WJXA 3TC6A 4MDOA 2Z1BA 1UWSA 4OTKA 4WSKA 3NQBA 2CLFA 1S3HA 3SSJA 1E71M 4HMDA 4NX0A 3QN3A 1LOLA 1TV2A 3RX4A 1F6PA 2HRWA 3CQIA 1CB2A 4A3UA 3PNUA 4Q4PA 3S9YA 2CZ5A 1UROA 2JKAA 3OODA 3G0UA 1W9DM 2ACRA 1X38A 4WEVX 1DWAM 3KUMA 1GHSA 4C5YA 1EJVC 4Q8MA 5AB3A 4AZ5A 3H2MA 4ZQNA 1ZBCA 1XLHA 1ZJHA 1ALDA 2BXYA 4IIBA 6XIMA 2V69A 3MU7A 4QCFA 4A6GA 3P6LA 3RF9A 1K7EA 4A3YA 1VPXA 1XH0A 4ALDA 3V75A 3MZNA 1K8ZA 3YPIA 2Z7GA 1KCKA 4UNKA 4HSOA 2C8NA 1ZRQA 3B03A 4GPNA 1SJBA 2Y7GA 1H7NA 1KXVA 2CBJA 8TIMA 1KCXA 1NY1A 3TMLA 1DWIM 4ADSA 1IIHA 2FVKA 1GEQA 5GQBA 3C5QA 5D32A 4UFMA 1X7FA 2X05A 1N2VA 4QJ4B 1KTNA 3ALFA 4NZCA 1S2UA 4K8EA 5TBOA 3KDNA 3VMOA 3LCHA 3G77A 4JTJA 3VNIA 1HF6A 2WMIB 5E70A 3NOEA 5H91A 2X09A 2WMJA 2Y85A 4AEFA 3M44A 2D0GA 4H9VA 4GUIA 3SQLA 1Z44A 1FHVA 4DJDC 4IGNA 4BK9A 2GYIA 2GJXB 5FOOA 2YR1A 3AYRA 3LI0A 2EGZA 4DZHA 1FX6A 3CQ0A 2HE8A 4WHBA 1DJNA 3EDDA 4WX2A 3IAQA 4FS9A 1B3OA 2ZX9A 2RGMA 4H9XA 3CQKA 3S5SA 1KTCA 4HOXA 3NQGA 1TELA 2ZRZA 1E6RA 3OLEA 2CLIA 1R46A 3LG3A 5LHEA 1LUCA 2PWEA 4L4MA 4Y9NA 1J93A 1PIGA 3TTOA 4AISA 3KOWA 4M6PA 5GJMA 2NWRA 4KKXA 1Z41A 3KL0A 3WD2A 2E6DA 2A3EA 2YIHA 2P0IA 3G3MA 5CGQA 3UPWA 1PKNA 4QJ3B 3HPFA 3B4YA 3MZ2A 3B8DA 4EANA 4FI4A 3E0LA 1ADOA 1QOQA 2GL5A 2CLOA 3LS9A 4FK9A 3A9IA 4LVGA 2CLEA 2WZIA 5DCBA 2O9TA 4H8VA 5CPLA 1W3HA 1ZBVA 4UTMA 5TQLA 2GSHA 3WNPA 3ID7A 2P3EA 2B7PA 3FDKA 2WKLA 3M0JA 4NG3A 2A21A 2YCEA 1VGAA 1RY8A 1B3ZA 1EDGA 3WQPA 2HBVA 3AHTA 1TMHA 1X98A 1P0BA 3AXMA 1WDQA 4JQAA 3VOGA 4K38A 4D71A 1AQFA 4UFJA 1EC8A 4FR1A 3CUIA 2WLZA 2HE5A 3FNDA 4DI9A 3AMKA 2VC7A 4AH7A 2QJMA 1JAEA 4LSBA 2NX9A 1WZMA 2OLHA 1XIJA 1EPVA 4RPPA 2VXNA 3V1HA 4H04A 3BGGA 1V4YA 1KCZA 2PP3A 4HBKA 1EYWA 5BU6A 2BX7A 4L64A 4OWGA 5A6KA 4GUJA 1QJWA 1D7KA 5I78A 1VR6A 3SCWA 1O4UA 1HL9A 1LWIA 3SUTA 4DF2A 4UOZA 5LZLA 4C6OA 3BG5A 4L1WA 2XIMA 1W5QA 1ML1A 5MKGA 1BGAA 1GVIA 3PVFA 1SPQA 3DFPA 4GE8A 2X41A 1J8VA 3AOFA 1AQMA 1NTHA 4C90A 2E6FA 1E4MM 3A64A 4RL3A 4PUJA 3UJEA 4XSMA 4WK9A 5FJUA 1OB0A 1CZ1A 1LYXA 2AKZA 5CZJA 5DEZA 5EL1A 4EAYA 2VOTA 1W1B1 1M3UA 4O1EA 1W1YA 3W7CA 2EEXA 3WD4A 4UNIA 3NNTA 1U5VA 2AGKA 8CGTA 1QNRA 3IIZA 4B3KA 3M16A 4MZYA 1KTBA 1D8WA 1ZCOA 3AIRA 3AXKA 3TTYA 1HKKA 3G6MA 4Z42C 1P0EA 1LF1A 3RN6A 4GI4A 1SVDA 3DGBA 3N1AA 3H4GA 1MW0A 5F4WA 1ODUA 3KBVA 3LCXA 1VQTA 1XBYA 5BZAA 1HJXA 2RJGA 4E4FA 4Y90A 4PTDA 1N8WA 2HVOA 3JS3A 3WQWA 3OZPA 4CQ9A 1TRDA 2ATM