3Q58A

Structure of n-acetylmannosamine-6-phosphate epimerase from salmonella enterica
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
229
structure length
229
Chain Sequence
SNAMSLLARLEQSVHENGGLIVSCQPVPGSPMDKPEIVAAMAQAAASAGAVAVRIEGIENLRTVRPHLSVPIIGIIKRDLTGSPVRITPYLQDVDALAQAGADIIAFDASFRSRPVDIDSLLTRIRLHGLLAMADCSTVNEGISCHQKGIEFIGTTLSGYTGPITPVEPDLAMVTQLSHAGCRVIAEGRYNTPALAANAIEHGAWAVTVGSAITRIEHICQWFSHAVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetylmannosamine-6-phosphate 2-epimerase
source organism Salmonella enterica subsp. enterica serovar typhi
molecule tags Isomerase
total genus 80
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature ec 5.1.3.9: N-acylglucosamine-6-phosphate 2-epimerase.
pdb deposition date 2010-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04131 NanE Putative N-acetylmannosamine-6-phosphate epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3q58A00
1OFQA 1NVMA 3EWWA 2CLKA 1J4EA 2AAMA 5KTLA 3N34A 3JR2A 2BWGA 5DLCA 1GG0A 5AYYA 2F84A 2Y7DA 4JY9A 1TIMA 2A6NA 1XFBA 3E0IA 3W2UA 3LB0A 3LTPA 1GVRA 4Z1DA 1BKSA 1GVSA 1XCFA 1SO5A 1LOQA 1B4KA 3UXDA 5HR6A 2OJPA 4E0CA 3GB6A 4UR8A 2RH9A 5AHFA 3PBWA 2Q8LA 4WZHA 4N9CA 3B0PA 1A53A 3HPZA 4IWWA 2GOUA 1KFJA 3GDMA 3I68A 2NV2A 3USBA 2Y88A 3H53A 4JN6A 5LHEA 4LUJA 1U83A 1TSIA 3C4UA 3ABOA 3OEXA 3EWYA 4ADSA 1S5VA 5IBXC 2FTPA 4N2YA 3GNDA 3W83A 4BI6A 3WJSA 2O7QA 4BI7A 5CZ0A 4NXSA 2ZRZA 1ME7A 1G7UA 4O13A 3TJXA 5I3FA 2ZA2A 3EX2A 3GXTA 1ICQA 4BWLA 1L9WA 4TX9A 2JKPA 1HFBA 3GK0A 3I7SA 5D38A 2PURA 4IPIA 4JTEA 4MIMA 5HULA 4DO4A 2OMAA 3SGUA 4LS2A 3MMTA 3S1VA 2FDSA 1YPIA 4A3UA 1K7XA 3IIVA 1FUYA 1D9EA 2A5HA 3NO5A 5AC6A 1K8ZA 2RDUA 1IIGA 1TPWA 5EKYA 1H60A 5L6UA 1F73A 3TA6A 3THQA 3IVSA 1JCJA 5G1TA 2C15A 3NOEA 5FEXA 1JCNA 1ADOA 1W5OA 3BLFA 4QNEA 2NUYA 2V2CA 1MSSA 3L68A 4NVTA 5AHIA 1IXNA 2ZA3A 5CZTA 1TJPA 2VFEA 4FB7A 1SR9A 1PS9A 3C8FA 3VNDA 1UBSA 3C56A 4JNMA 4IMDA 3W75A 1LRNA 3DHDA 3A23A 2C14A 2YYUA 3B0VC 4GUGA 1YPFA 3BARA 4A21A 4DPQA 2X1UA 3BO9A 3C3NA 4NNCA 1N7KA 2I9EA 1C8VA 1EP3A 3BPWA 3L5AA 3O6DA 3EKLA 4OHQA 4UMAA 2AQWA 3PB0A 1U5JA 4X3ZA 4FNQA 1TV7A 4BFAA 4FNPA 4OV4A 1FCQA 1TPEA 1XM3A 4O50A 3L5MA 4XUGA 5DY2A 1FXPA 2GVLA 1EUNA 6ALDA 2QCCA 4JTFA 5HINA 3WK0A 1QDSA 3G0XA 3OA3A 1VYSX 1FXQA 3NR0A 3KVMA 5LHFA 4EF9A 4LW7A 3NQGA 2DZXA 1KTCA 4DO5A 3G22A 1OF8A 1Q6QA 4IMGA 3NVTA 4UIOA 1KTNA 5KZMA 4MY8A 4M6QA 3IVTA 2HMCA 2NWSA 1FDYA 2JK2A 1W0MA 4IGHA 1PHQA 2ZDRA 1KM5A 4ML9A 3DFTA 1L2UA 3QMRA 2A85A 2J6XA 3E12A 5DBTA 3G0UA 3OVRA 5D05A 1WAUA 4PL2A 3T7VA 4POCA 3MW7A 1W5NA 3P84A 1B57A 1LDCA 1QO5A 3L66A 4LY8A 4RCXA 3UWQA 2Y6ZA 3ELFA 1TCDA 3DZ1A 5CPNA 4UTMA 3GIYA 3W7PA 3ZFHA 5C2XA 2Y61A 4IJBA 4JIPA 1EUAA 1DQWA 3TQ0A 1WDWA 1SW0A 3I65A 4K8EA 4O1DA 5E93A 4GRSA 3GXNA 4JGDA 4S2CA 1W56A 4ADUA 1XKYA 1KLZA 3A9IA 4O15A 4ZQRA 3UQNA 3LRMA 3CEPA 4IUOA 5CKSA 3TC6A 4PC8A 3S5YA 1QPRA 5LZLA 2DJXA 3PVFA 1RD5A 3EX1A 3QH2A 1OX4B 3BK0A 5I3HA 1G4PA 5C5YA 1EB3A 3QZEA 3NAVA 3L0NA 1OFRA 1LLWA 5EL1A 2ATMA 4E38A 3CEUA 1RQHA 4R7JA 3SI9A 3TMLA 2CLIA 4O19A 2J24A 4N02A 3DXIA 3MHFA 1F6PA 3SFKA 1SQ7A 3GXPA 8TIMA 3PB2A 2ISWA 3W85A 3A22A 2VEKA 3GNNA 1JCLA 3QSTA 4DPPA 1BWLA 3LCXA 4EIVA 5LGZA 2J9YA 1AW5A 4X22A 2QAPA 2OT1A 2W6RA 4NUWA 1H7PA 4AVFA 3EXTA 1HTIA 3TAKA 1GJPA 3TSMA 2FB3A 4Q33A 1L6YA 1JQXA 4BWLC 2QR6A 1JCYA 3SIZA 2E68A 2QUVA 4FEZA 1TJRA 3LLFA 2TRSA 3F4NA 3LRLA 4D2JA 4HNNA 1PIIA 3LHZA 2B0MA 3FKKA 4RKAA 2ZYFA 1E51A 5AHEA 4GUHA 5F4WA 2JGYA 1GQNA 1M7PA 5FF4A 1Q3NA 3W1QA 1S5WA 2H3DA 3MUXA 3AO0A 2NZLA 4XQ6A 4R34A 1JJKA 1OF6A 2ZZ7A 3CC1A 3RF9A 1WA3A 4WX2A 2YPIA 4IMEA 1OFAA 1D3HA 1OG0A 1KM6A 2ZZ3A 4KFPA 1DJNA 4FNSA 5D32A 3STCA 3P62A 4PA8A 2P1FA 1RPXA 3A5VA 4NNAA 5KZDA 3G1VA 3M16A 2C6QA 1OYAA 5D2VA 2WOQA 3EXRA 3RLVA 4MJZA 4QITA 3HBLA 1SU5A 4GE8A 3MP3A 5MHBA 3TIMA 5EY5A 2DZTA 3L0GA 4XBSA 3EXSA 3W23A 1GPWA 3STGA 2GQ9A 1LP6A 3UZJA 3W7JA 3RK8A 1ICSA 4QJ1A 3LRKA 4JIQA 3SY5A 1WOBA 2FFCA 3QYQA 4HKPA 4EOUA 4LRSA 4G1KA 3NL5A 1QFEA 2C18A 2X30A 3B03A 1LBFA 2FIQA 3C6CA 3L0KA 3GDRA 3L65A 4UTJA 4JDBA 1CW2A 2ZRVA 3KRSA 2NWRA 3UXAA 3W2KA 2OCZA 4Y6GA 4JTHA 2Z6JA 3GAKA 3O63A 4AWTA 2J27A 3H55A 3LBMA 3M44A 1H50A 4NJKA 2BZNA 4O52A 2JBMA 3PM6A 3O6CA 5HUOA 4AHQA 5FF3A 2CZ5A 1QR7A 3QFEA 3EX6A 4WOQA 4MZ1A 3B05A 3TU9A 3ANYA 4E2DA 5LGXA 4LS0A 3FYPA 1JR1A 2Q3OA 4CLMA 3A21A 2ZRWA 1QAPA 2X2GA 4L4LA 1KBJA 4O8RA 3R13A 1TQXA 3TAOA 2A6LA 2G97A 5KITA 1FY6A 1W54A 2C0AA 1KFEA 1KFCA 4TU1A 3BLIA 1JCMP 1KM1A 4LU0A 5EYWA 3IRDA 1YLVA 4KFNA 4GXMA 4O28A 3W84A 2PRHA 4ZL1A 3M7WA 1EEPA 5G5IA 5C55A 4DEFA 4PCFA 1XBVA 4ICNA 3U6WA 1GWJA 1L6WA 3W1RA 1ZCOA 4OQVA 1XDLA 2YFNA 2CU0A 2DZSA 2E5BA 3CTLA 3RLUA 1N8FA 4YMZA 1S5TA 3IGXA 4O11A 1FBAA 1O5XA 3E49A 1FDZA 1A5CA 5DCBA 4UNLA 2YZRA 1AW1A 1SZGA 3MHGA 1NF7A 5D2WA 4QSHA 2CLEA 3GZ3A 1T99A 3NA8A 3S9YA 3MI6A 1W5PA 3FA5A 4AF0B 4UMCA 1L6SA 1LROA 4BK9A 1GTHA 4HNUA 2A21A 2J9ZA 4TMCA 1H61A 1JVNA 2DP3A 4TO8A 3G8EA 1B3OA 3GX9A 4LUIA 3F1QA 1DKWA 5LSMA 1ZHAA 4M6PA 3HPSA 2EHHA 4ZVJA 3NL2A 1EX5A 5AYXA 3W7QA 1SFJA 3HO8A 4UTHA 3NQ6A 2LLEA 5TBOA 3DKJA 2HTMA 3KOFA 1NF0A 1QNVA 3QJAA 2Z6IA 3P82A 1T8XA 2WO5A 3NL3A 4N4PA 1G4SA 3LXAA 3P67A 3L67A 3W7HA 5LNSA 3QEZA 1YDVA 2H6RA 3FYOA 5A8GA 1VH7A 4IQLA 3O1NA 3TW7A 2NX9A 3F4WA 5F4SA 3CT7A 1FCBA 3W7OA 1GYNA 2CZDA 1P0KA 5AYZA 4JTKA 3WJZA 3CWNA 3UWWA 3D0CA 4WQ6A 4UCGA 1WXJA 2QCFA 3HG2A 5HR7A 4O1CA 1AG1O 1M7OA 4LWWA 3W7LA 2Y85A 1YADA 4OWGA 2G5WA 4Q4KA 3W73A 3HG4A 3OIXA 2V2DA 3G1HA 1W31A 1G4TA 3PAJA 2NX1A 3TW6A 3UNDA 2QDHA 1VC4A 2C1HA 2R8WA 1V7YA 4JDYA 4O4WA 4WOZA 1H7NA 1NEYA 2GJNA 1XXXA 2TPSA 2VFHA 4XZ9A 4PEKA 3K30A 4GBUA 3BGJA 3W87A 3T55A 1PE1A 2EKCA 3O05A 3EX4A 5K2ZA 2BX7A 1J5TA 3MI2A 1TRDA 6TIMA 4NX0A 5C54A 3GKFA 1EP1A 2QCGA 1QPOA 3OVPA 5F1VA 4I7WA 1PCKA 2Z2UA 2V81A 1B4EA 4LRTA 1JCXA 3UWUA 3MO7A 3V1PA 4K39A 5EPDA 3B0UX 1YTDA 1ZENA 1T0OA 3GAYA 4QNWA 4LS1A 4MYXA 1WV2A 4YLWA 5F2IA 1VS1A 3M47A 1GVQA 3YPIA 3L2IA 4UR7A 1KM4A 3LCHA 3VFLA 3NPWA 3UYCA 3STFA 3MBDA 3TH6A 1I2OA 2V8ZA 1UUMA 3W07A 2QUTA 4PL1A 4Z1AA 3N3MA 2ZTJA 1HL2A 3M5XA 3DI0A 3TCEA 1OK4A 3N73A 2VENA 1G69A 3KHJA 1F76A 4UFMA 3M1ZA 4WUIA 4QIUA 3HG5A 1QCWA 1LORA 4P2VA 4FX7A 3B06A 3N14A 1MXSA 2PCQA 5E1QA 2Y62A 4EVZA 3NQVA 1X6UA 3I6RA 3VKJA 2ZBTA 1DHPA 4IXXA 4Z08A 1OFDA 1FWRA 1H63A 2CW6A 1KM2A 4JTSA 4YCOA 4UMBA 3PC0A 3NNTA 4CQ8A 4LV9A 4I7VA 4Z1BA 1A5AA 2RHGA 4EWND 4ZQNA 2YR1A 3DKLA 5K4ZA 1DORA 3C61A 1H7XA 3JS3A 3O15A 1RVGA 1KFBA 3TROA 2YX0A 1VQTA 3IGUA 4AF0A 4LTSA 3LV5A 3PUEA 4ZZ9A 1KBIA 5SWUA 2ZRXA 4ALDA 3LXCA 1MO0A 1F7BA 1VRDA 1O60A 3W6YA 1F6KA 3W7RA 3LTYA 4N9BA 1PL9A 2GUUA 2YYTA 1CX9A 3I7RA 1SFLA 4HNVA 3W1PA 4JXCA 4LVDA 4P61A 1G67A 4IMCA 2BXVA 5FEPA 2FQIA 4K7VA 2EAWA 4KWVA 5D02A 1K02A 3G1DA 4AH7A 1R2RA 1IGSA 4WXYA 2X16A 2NUXA 1KM0A 4ORIA 5BOOA 1SUXA 4XKYB 1SPQA 3S6DA 5D2TA 5CPLA 3FJLA 3U2OA 3MI3A 3LHYA 1I2RA 4K37A 3HGJA 2BSLA 4YWIA 4QAIA 1WYIA 5HNRA 3NQDA 2F7FA 4UC5A 2RFGA 3W7KA 4DXVA 3HJZA 1M5WA 3HB9A 1XBYA 3SGZA 4J9JA 2QCEA 1ME8A 4MLJA 3ATYA 1SO6A 3GR8A 4TR9A 3H54A 3TXZA 4L4MA 5AC7A 1VYRA 2DU2A 3QW4B 3S5ZA 3T78A 1R2TA 3IEBA 3KAOA 3MYPA 3CIXA 4Z0JA 4DF2A 5CSRA 1HG3A 4M5PA 1QPQA 5F2GA 4GUJA 3C52A 2C19A 1OJXA 1UJPA 3OBKA 4U4MA 2QCNA 5CSSA 5K9CA 1VCGA 4OT7A 3EWUA 4MFEA 1W3TA 3NQMA 1X1OA 1ALDA 2YW3A 1SSDA 3QMTA 2PC4A 3C0JA 5L9FA 2Y70A 4LVFA 5FF0A 2FPVA 4JTTA 3BG5A 1WOAA 4N9EA 3GKAA 5G2HA 5CG7A 3TK7A 2GVJA 3TUUA 3CHVA 1ZAHA 2V9DA 3LHWA 1BTMA 1GZGA 3CQ0A 4O14A 3P60A 1I45A 2FJKA 4ORMA 4JTLA 5FF7A 4Y96A 1EPXA 3PUDA 5AOUA 3QPZA 2R14A 1ZY9A 3EWXA 2R94A 3W7CA 3W1MA 3MHUA 2KZHA 1RZMA 3NXFA 3W1TA 1IXOA 3N2MA 2Z0IA 1TPC1 3UWZA 4UTIA 4O12A 3GLCA 4R53A 5CPMA 5HQEA 1ZJIA 2A4AA 4JY8A 1F2JA 1ZNNA 2TYSA 5DELA 3NZ1A 4JTGA 3IIOA 3LOTA 1GVOA 3R89A 3STEA 1AW2A 1TPVA 2H3BA 3M6YA 1XL9A 3IVUA 2UV8G 5CGQA 3GDLA 3W7GA 2EGZA 2QEZA 3FKRA 3N9RA 1JUKA 1Q6OA 1TPUA 3P74A 4LVBA 3NM3A 4BR1A 3L9CA 3PBUA 4MY9A 1SO3A 1WQ5A 3P5ZA 1OYCA 3HQ1A 2GPTA 1HO4A 3N2XA 4GNJA 4HSNA 4MUZA 1KTBA 4DF1A 2QJGA 1R46A 3R8RA 1ONRA 1EA0A 2ZZ2A 3WK3A 2X1TA 1TTPA 3TSBA 2CLFA 4ZQPA 1H5YA 3WJYA 5U7SA 3TFCA 3HIJA 3BG3A 3JRKA 4MOZA 5H2ZA 2YSWA 1A5BA 2C13A 3PBVA 4JX5A 3W1AA 5AB3A 1R47A 3ABRA 3FLUA 4UFKA 1W1ZA 5D2XA 3G1XA 1RR2A 4ZQCA 3SW6A 2TMDA 4NX5A 5D30A 3DU0A 2XN1A 4CCEA 3PR2A 4O1AA 2DZVA 2G95A 1C29A 3TSDA 3DENA 2E5DA 1Z42A 4RLIA 2B7NA 1W37A 4AXKA 4XKYA 4JICA 3RU6A 2J88A 4AEOA 3B8DA 4UTLA 3M0ZA 4AB4A 2HS6A 1K7EA 5FI8A 2Q3RA 3C2FA 1TPDA 4O18A 2NUWA 2Y7GA 3LHVA 3W7NA 3BW4A 5F1UA 5CZJA 4HPJA 5G1YA 3W7IA 2A7RA 1FCVA 3KFTA 4RV8A 3HPXA 5FF2A 4ONVA 7TIMA 3UWVA 2BLEA 1P1XA 1PHWA 1DJQA 1XUUA 4JS3A 3DFNA 3UZ5A 2RDTA 3PSWA 3O6YX 2XN0A 2ZCGA 3WFAA 3C2EA 3LI1A 1P5BA 3FIGA 1X1ZA 3O8AA 4MPQA 1N55A 3MP5A 3UD6A 3LBCA 5AC8A 3FEMA 3BW3A 2J9XA 3TX9A 2OT0A 5HUPA 3UY7A 2GJLA 3FJ6A 2WQPA 1R30A 4MZ8A 4QQ3A 1OX4A 1PCWA 4U28A 3DBPA 1XBZA 3T44A 3TNOA 1VR6A 1BEUA 5TIMA 1DOSA 2ZRYA 4N9DA 2C3ZA 1TRIA 1FDJA 4NJJA 4C1LA 5H91A 4PTNA 1M6JA 4CQ9A 1K3UA 1X8FA 4UTTA 2VFDA 3HF3A 3VE7A 4MJMA 5HMSA 4DBDA 3EWZA 1FCUA 4AMAA 3UWYA 2XFWA 4O10A 1QO2A 5FEWA 2H90A 1BWKA 3W9ZA 4K6AA 2NXIA 2Y63A 1FX6A 2ISVA 4RJEA 5EMUA 3ZWSA 1XDMA 4UUIA 3MWAA 5K9DA 3GDKA 4YXGA 3NQEA 2VFFA 4LT9A 3TE9A 3UPBA 3NEVA 1SO4A 1TPB1 3Q94A 1O94A 2V5BA 3W2JA 3W1LA 1VHCA 3MP4A 5I3IA 2WNNA 3G18A 3W74A 1ME9A 3C2VA 4K8HA 1XC4A 2VC6A 3DFOA 5AN7A 4LC6A 2FLIA 3IIZA 4O4VA 1I2NA 3UPWA 4LOCA 2ZFAA 3GYEA 4CNNA 3NQ2A 2GQ8A 1DQXA 3SSJA 2ZZ4A 3KRUA 1Y0EA 2VEPA 1YDNA 3CWOX 2YXGA 4HNTA 3ZS4A 4HSOA 3PS7A 3KRZA 2JKEA 1MEWA 2ABAA 2HS8A 4DELA 4RX0A 3CB8A 1H1YA 4TMBA 1B9BA 4WY0B 2V30A 1GG1A 1DV7A 1Z41A 4Z1CA 1TPH1 3G1YA 3LDVA 3CIWA 1G6CA 5AFDA 4NJHA 2NX3A 2E5CA 4B5NA 3PG9A 1TTIA 2I14A 3DFQA 2C16A 4H4IA 4RK8A 3TDFA 2EPHA 2A0NA 1ZAJA 5DCEA 3SJ3A 1IXQA 2VFGA 5HWMA 1VGAA 5ABTA 4UTUA 3SR7A 3LI0A 5LNRA 1P4CA 3S42A 3TXVA 4CCDA 3N9SA 3VCRA 2P10A 1OX5A 2NLIA 3RNDA 2ZZ6A 4GFSA 2QDGA 4Y90A 3S0CA 4ZQMA 1OVDA 4OGZA 3NQ7A 3BVJA 4DF0A 3QSRA 4BI5A 1H7WA 1NAL1 2CLMA 3W3OA 4AAJA 1QOQA 5G2IA 3G3MA 2RDWA 4M6VA 3DH7A 4NU7A 2ISSA 4RZ6A 4WXZA 2PE4A 3M5ZA 4QISA 5DBUA 3S1XA 4UFIA 5DXYA 3M5YA 1R2SA 4C1KA 2WSYA 3HG3A 5KZEA 2R91A 2VOMA 1HUVA 3C2RA 4X9SA 3TC7A 5LNVA 4YCPA 3A24A 3NM1A 3CM4A 1JRCA 3N19B 3EX3A 3QPYA 3CPRA 4JTJA 5U4NA 2WNQA 5D33A 4UFJA 5KINA 4MVAA 4IMFA 2W0UA 3PSVA 2DZUA 1YDOA 4ZQOA 1RQEA 4UFLA 2E6FA 1LBLA 3P61A 4O16A 1OFPA 2QF7A 1OX6A 2IQTA 1XI3A 4MZYA 2QCDB 4E2BA 4CNOA 3S1UA 3NG3A 1ICPA 2VEMA 4K38A 2B7QA 4LVGA 1TB3A 4R33A 3QC3A 4AHOA 3LCLA 3KVLA 5BNKA 3TJLA 2V0TA 5FESA 1VYPX 2PRLA 4IOTA 3MBFA 4UTWA 4NJIA 1CI1A 3LV6A 2VKZG 3SZ8A 5HWNA 1S3HA 3M43A 3EB2A 3W2NA 2H8XA 4A2RA 3AJXA 4UTTC 2ALDA 2NXHA 3LM7A 1K8XA 4IPJA 1DBTA 3FFSA 5DXXA 4LC8A 3G1SA 5I3JA 4CCCA 3W71A 3P8JA 1KFKA 3TQVA 1EWDA 3QF0A 1PV8A 1OFBA 4K36A 5D09A 2VELA 5LNUA 2B7OA 2E6YA 1ML1A 4O1BA 3F03K 3R2GA 4FHAA 3HMJG 2TSYA 4HHPA 3W86A 3MYOA 4FX8A 3LHTA 3Q2DA 5CPOA 2ZZ5A 3LX9A 1MZHA 3QMSA 1XBXA 1I2PA 3NL6A 3NQAA 2ZA1A 2PRMA 3E96A 1AMKA 3NGJA 4KKXA 1SZNA 1ZFJA 1FWNA 3B04A 3U8GA 2CLLA 1UUOA 4FX6M 2DORA 3W1XA 4DBEA 3NZRA 5DN1A 5GVJA 4JTUA 3PUOA 3NQFA 3R12A 2OX1A 1PVNA 4WY0A 4MYAA 1H7OA 4I7UA 2DJLA 2V2HA 1TMHA 4BF9A 4DQWA 3G0SA 4O57A 3P80A 1JQVA 4OU1A 4RXGA 4H6KA 3T40A 3VE9A 1YXDA 3LLDA 5D03A 3WK1A 1JUEA 1VPXA 1SZFA 3VI2A 3M5VA 3PG8A 1EWEA 4UFHA 4NT0A 5F2MA 1SZEA 4AWUA 2YFOA 4Z0SA 2XN2A 3P5YA 4FNTA 3EWBX 3Q37A 3Q58A 1F5ZA 3O16A 3P81A 5DCDA 2HSAA 1Q6LA 1IXPA 3LGEA 4FXSA 1ZAIA 2WPBA 2X1SA 4QM1A 3DAQA 3KVKA 2E6DA 3S1WA 2A2IA 3NPVA 4MY1A 2QJIA 1O4UA 1GEQA 5K4XA 4JYDA 2YGYA 5AHMA 1I2QA 4K7YA 3LCFA 1OFOA 3NPXA 1TREA 3QW3A 1FWSA 3GR7A 5TQLA 2FB2A 1AL7A 4RXFA 1QPNA 3HGOA 1KLYA 3EEGA 3WJXA 1EIXA 4WY0F 1H1ZA 1VZWA 1RV8A 1JULA 4O0KA 4H3DA 4M7SA 1O5KA 5IM51 4M19A 3M9YA 1TPFA 4XTDA 2NV1A 2OZ0A 3QQ1A 4KWWA 4O0ZA 4CNPA 3LERA 1LZOA 1QOPA 5D2YA 4ZMGA 2QUUA 3IIXA 1DVJA 1W5MA 1A5SA 3BW2A 2ZTKA 4OBTA 1MEHA 4NZFA 4LV4A 3NQ8A 2I1OA 1K7FA 2QCDA 5K9XA 2B7PA 2GQAA 1SSGA 2WSRA 1SW3A 1I8JA 1C9DA 2JGQA 1LCOA 3FOKA 4FXRA 3PBYA 3NPUA 5K3VA 4RZ4A 4UTKA 5I3KA 1RQBA 5G4WA 3G1AA 5G2WA 1LM1A 2FPTA 4HIBA 3S5OA 4ADTA 4PODA 1TV8A 2V5LA 1VLWA 4JD4A 2FPYA 3G24A 4IX0A 2BTMA 3W2MA 3O06A 2Q8ZA 4JEQA 4UTWC 2P0OA 1OABA 3PULA 1GOXA 1AL8A 4FIRA 2WKJA 3LCGA 1OHLA 4JYFA 1H51A 3W7EA 1KM3A 4LNYA 2QCMA 3TKFA 5D04C 4LVAA 2A7PA 3NYZA 1KV5A 3W7MA 4W9TA 2WSQA 4RR4A 3CU2A 4KFOA 2A7NA 2ABBA 4GJ1A 3BGGA 2ATSA 4MLRA 1VCFA 2JKAA 1FWWA 3HGSA 3KXQA 4O54A 3W88A 3P7YA 5EA9A 5T26A 4S1FA 4S2BA 4XBKA 5FEZA 4X2RA 3PF3A 1V5XA 1W3NA 4UXDA 4NZJA 2E77A 1KV8A 2VXNA 5AHNA 5EBUA 2CWNA 1F05A 1X7FA 1YXYA 5J5DA 3TV8A 1HO1A 1A50A 1YXCA 3INPA 3ABQA 3KX6A 1LOSA 3TQKA 3L5LA 3RFAA 2YDAA 3G3DA 1TO3A 4JX4A 5J5RA 3OG3A 3WJWA 3G8RA 3BG9A 1SW7A 4NXKA 3TMQA 3IV3A 2Y89A 3FS2A 3LCIA 2G96A 4I9AA 2ZRUA 3GDTA 3NQCA 1W8SA 1KW1A 2E6AA 4YL2A 3HOJA 3S5NA 1H62A 1LOLA 4HN4A 2EF9A 4FNRA 3E9AA 1LTDA 2D73A 1Z44A 3DFSA 1VCVA 5CZSA 1LRTA 1GTEA 2WJZA 2AGKA 3DI1A 2CZFA 3BLEA 1JUBA 5BMXA 4JX6A 4AHPA 3E02A 2YCEA 5DY3A 3ABSA 4JR5A 3PY2A 2WV8A 2ZQ0A 2CZEA 4GC4A 1T96A 4PH6A 4WJEA 5KMYA 3I7QA 1UASA 2O7SA 2ZZ1A 5D37A 2Y7EA 2Y7FA 3BV4A 2YW4A 1O95A 4GUIA 1KA9F 3W70A 2CFFA 2QCLA 3W72A 2QKFA 3LCWA 3HGRA 1YTEA 5IBXA 3W7DA 2A1YA 1THFD 5I3GA 3ZR4A 2E09A 1Q6RA 4JYEA 3EKZA 3NDOA 3QRHA 3OVQA 1GVFA 1EP2A 1P0NA 1LYXA 2DZPA 2QCHA 3UY8A 4CQAA 3C2OA 1F74A 2B4GA 2RKXA 3LTSA 4HPXA 5BW6A 4GUFA 2X1RA 4OV9A 3LHUA 4NJGA 4N6EA 1JRBA 1W3IA 2WNZA 4FO4A 4XTIA 1IF2A 1D3GA 3B4UA 5KSWA 5HJLA 3KVJA 1OK6A 1FWTA 2GVGA 2NXGA 1Q45A 3W76A 5HWJA 5F4XA 3ZWTA 1TV5A 3A5FA 3IGSA 1GT8A 3SECA 3TR2A 4FF7A 1LLZA 4RZ5A 4TIMA 1K03A 4HT3A 3PWAA 5G4EA 1I4NA 2E1DA 1LRQA 4AWSA 3W1UA 5LKYA 1OFEA 1VHNA 2DZWA 2H8ZA 3O07A 1W5QA 1TYGA 4FIQA 4N4QA 1H7RA 1TQJA 3DGRA 4Y9AA 4O17A 3IIPA 4Y8FA 1UB3A 1QWGA 1QMLA 1GYLA 4OE7A 1IIHA 1G4EA 1Z48A 1FQ0A 2VEIA 3TFXA 3T4CA 3QQ0A 4FNUA 5C6MA 3R5EA 1NSJA 3QM3A 3WK2A 1LBMA 3LXBA 4GWEA 5A5WA 1NFBA 3DHFA 4A29A 3ATZA 1WBHA 4M7TA 2VFIA 3RMJA 3W2LA 4A2SA 2QAFA 3CLMA 4UNKA 1XUZA 2CLHA 4PFMA 1TTJA 1YTKA 4A22A 2CLOA 5F2LA 2QJHA 3OHIA 1G7VA 1YYAA 1ZALA 3GVGA 5K7JA 3V75A 1VJIA 5LNWA 4MFDA 1OYBA 4IXHA 3THAA 4XWUA 3W1NA 1WX0A 3DFPA 1DL3A 4NQ1A 4MKNA 4JTIA 4DO6A 1UCWA 3P8IA 3M41A 5BMWA 1MEIA 4EF8A 4IX2A 3W22A 1VLIA 3S8HA 2Z1BA 5AHLA 3G1FA 4Q32A 3L21A 4N6FA 2V82A 4NNBA 1KFLA 5BRBA 4O53A 2W79A 5E0KA 1K8YA 1TTQA 1AK5A 4WD0A 1WBJA 1J2WA 3MJYA
chains in the Genus database with same CATH superfamily
3SRFA 1NVMA 1SMAA 2GGJA 1KWGA 1J4EA 1IEXA 1NDWA 3CTTA 3N34A 2F6KA 1IT7A 1GG0A 1V08A 1XFBA 4C6QA 4BZYA 3W2UA 3CZJA 3SY8A 1GVRA 2WVTA 3H6OA 1LL4A 1SO5A 4R7WA 1KGUA 3UXDA 3LN3A 1OT2A 4S3KA 3RIKA 1VFTA 4IGSA 1E6NA 4EXBA 3N9KA 1BG9A 2IUZA 4N9CA 2BHUA 1A53A 3WKZA 1T7LA 3P14A 3EB4A 3USBA 2O4QA 3C4UA 4WLCA 1H3GA 4ADSA 3PJWA 3W83A 1ZU8A 3WQGA 4BI7A 2ZRZA 3MT1A 2E8ZA 4O13A 3TJXA 1UKPA 5T91A 1ICQA 2XGIA 2VT0A 3AYTA 3TEVA 4H9YA 3GK0A 4MIMA 4JTEA 4M8UA 4M24A 1FH8A 4HHMA 2EO7A 1W9VA 2XVKA 2O0TA 1L6GA 3NO5A 4IP7A 5AC6A 2RDUA 1IIGA 5EKYA 1F73A 4G6CA 3TA6A 1I0DA 1J96A 3KTSA 3CNYA 3NYDA 2C15A 5FEXA 5I2UA 1QNOA 4R9OA 1ZLPA 4QNEA 3AS3A 3CPGA 2V2CA 1EX1A 1XWYA 4YVPA 5AHIA 1E70M 1IXNA 5CZTA 2FVLA 3FXYA 3G1RA 3TP4A 1TJPA 3BLKA 1Q13A 1XD1A 3VNDA 3SRKA 3W75A 4IMDA 4QLKA 2GJXA 3R0KA 2UY3A 4R85A 4PMVA 1XPGA 1M04A 3L4XA 3UFYA 3L5AA 2BP1A 3T0CA 3EKLA 2AQWA 3PB0A 2WKGA 4E8DA 3LPOA 4BFAA 1TPEA 1XM3A 2NVAA 5CGTA 1MYRA 3L5MA 5A94A 1F8MA 1FXPA 2GVLA 2WMIA 3WK0A 3KZPA 4JTFA 1QDSA 3G0XA 5ECUA 1FXQA 4F0LA 3KVMA 5LHFA 2EG6A 4KCWA 3IK2A 4H8NA 4DO5A 2VYOA 1Q6QA 1KTNA 5KZMA 4M6QA 5KZ6A 1DP0A 1UYQA 3PUGA 4PUKA 4JKLA 5HMFA 1AH3A 3E74A 3VFCA 3PJTA 1PHQA 1Z69A 4MWAA 4XO6A 1FTXA 4ML9A 3DFTA 4IGMA 4KW2A 4P7QA 4AXNA 3QMRA 3E12A 3G0UA 2J62A 2UWFA 4AD2A 4POCA 3VX1A 4LY8A 3UWQA 3ELFA 3A4JA 1RAKA 2VX7A 1TCDA 4UTMA 1JYXA 3ZFHA 2RGLA 3AHYA 4JIPA 4NZCA 4REQB 4MB1A 1WDWA 2AQVA 1JZ7A 4K8EA 4EPDC 5E93A 1J0JA 4GRSA 3QVQA 3UR2A 3SUTA 3L4WA 1XKYA 4U5KA 2DVUA 2WKLA 1PAMA 4CD7A 3MMUA 5LZLA 1A5UA 4L65A 1HJUA 2POTA 3VVGA 2BFGA 3EA1A 3QH2A 5I3HA 4HTBA 1S2CA 1VBGA 4GCAA 2WC4A 2J8GA 1OFRA 3B8SA 3BZGA 1LLWA 5JBFA 1SR0A 4GJJA 3GSMA 1OBAA 3S2LA 4R7JA 3SI9A 2G3MA 3AHTA 4O19A 1UR1A 1JNEA 1SQ7A 1XLJA 4ACYA 4NAEA 4D6EA 1JCLA 2OR2A 5LGZA 2J9YA 2QAPA 1GVIA 2WC3A 3SCVA 3MB9A 4BQ5A 5T9CE 1H7PA 4PTWA 5HATA 1HTIA 4HN8A 2VCCA 3WF2A 3HU7A 1A3HA 2FB3A 5TF0A 4DB7A 4XK2A 1XSJA 3SIZA 2E68A 1NM9A 1G1YA 3RO8A 1P0BA 3PHAA 3QV7A 4HOWA 1K9DA 1UPMB 3SQLA 1TJRA 2TRSA 3LRLA 4D2JA 4L9ZA 2HCVA 1Y5VA 1PIIA 3SO7A 1I9CB 1E51A 5AHEA 3WLSA 2D24A 4HCHA 3VNJA 1KD0A 1UKOA 1GQNA 2VTFA 2EBNA 4WKAA 2NZLA 3IK4A 1DJHA 3BLPX 3RLGA 2ZZ7A 3GFYA 1WA3A 5JUVA 4IMEA 1OG0A 1KM6A 1CLXA 1ITUA 2VM8A 4FNSA 4J5NA 3STCA 3FNDA 1XLLA 1W1TA 4PA8A 2P1FA 3C0SA 3GO2A 4GZJA 3ZSTA 3S6TA 3ZVHA 4WK9A 2YIHA 4H7CA 4QITA 3GWQA 3MP3A 3T09A 4XBSA 3W23A 2ZKMX 1IYXA 3T08A 1Q6FA 1XIHA 1LP6A 3B8VA 1PIGA 3VMPA 3PWGA 2WBKA 4JIQA 2JQXA 3AU2A 3AS2A 2FFCA 2IXUA 1F4HA 4WSKA 3S83A 2VQTA 3NL5A 1FHVA 2X30A 2PUZA 4PRTA 1LBFA 3GDRA 4UTJA 4JDBA 3SN4A 3GU1A 1DJXA 3UXAA 2XIMA 2AAAA 3O63A 1XIBA 2RGMA 3SFWA 3A3HA 6REQB 1EJUC 4O52A 4GQRA 4NL1A 4W7WA 3PM6A 3O6CA 1J01A 2I5QA 4H6RA 1HKVA 2CZ5A 1JI2A 1QR7A 1BWVA 4C6FA 3VNYA 4WOQA 3WL0A 3HM7A 4UBPC 1OINA 4Q8UA 4QROA 3PZOA 4FK9A 1QI0A 4F9JA 1J12A 4W85A 2G3JA 4L4LA 4DLMA 3WQ5A 3TAOA 4E4FA 2G97A 1FY6A 1W54A 1EJSC 2C0AA 1GKPA 4I6VA 3BLIA 3EZ4A 5EFFA 3BMVA 3AOFA 1YLVA 4KFNA 4J2MA 3UJRA 3W84A 4DWSC 3GTIA 3KOYA 5C55A 4F40A 2YKKA 3ZJ6A 4ICNA 3U6WA 4HMEA 1GWJA 4DZHA 1L6WA 1ZCOA 3NO3A 3E5PA 3VGGA 4GIYA 4ERIA 1V0LA 5CH9A 1N8FA 4YMZA 1RLCL 4O11A 3SCQA 1O5XA 4IFRA 4GOAA 4P5UA 4GNVA 5KEZA 4LUSA 4M6UA 5DCBA 4ZO8A 3V3WA 5AZ0A 4WDTA 2OTDA 3A47A 3CXOA 4QSHA 2J7DA 2PAJA 1YW1A 1IE7C 3ARVA 3BQ5A 1T99A 1KCLA 2PDBA 1DWAM 1UD3A 4PUEA 1ONXA 1LROA 3MWCA 4XBJA 2J9ZA 1B3OA 3GX9A 4RZBA 4LUIA 7CGTA 2PDIA 2VC5A 3WZ0E 1CCWB 2EHHA 3AXKA 1HP5A 5AYXA 1SFJA 3PANA 4GH3A 4CCZA 1MRAA 3DKJA 1NF0A 2I16A 4XZLX 5DMNA 1G4SA 3D5HA 4LGXA 4YTTA 3H2OA 5LNSA 4I9JA 2PGRA 3LMZA 4ACZB 4IQLA 4W8LA 1OD8A 5AYZA 3CWNA 3NWRA 4UCGA 1JD9A 1RBOB 3U4AA 2QCFA 1DJIA 1DQUA 4PRRA 4H7VA 3W7LA 2E67A 4GI6A 4OWGA 3OIXA 1LQ0A 2VWTA 1W31A 3G1HA 3PAJA 1F3XA 4FF5A 1E3ZA 5D8ZA 4G8TA 2WMKA 3GU2A 3AZSA 3QR0A 1BGAA 3B0YA 1XXXA 4Q4MA 4XZ9A 1BYDA 2Y2WA 3GVWA 3BAJA 3EEZA 1PE1A 1QHOA 1MQPA 3SCPA 5A3HA 1QRQA 3AIQA 3H2MA 1TRDA 2GYIA 1GZJA 4NX0A 7PTDA 1YX1A 1EP1A 2X0YA 2QCGA 3H4GA 5F1VA 3WSUA 1JDDA 2BY0A 4NZ5A 2G50A 1OEPA 3MUY1 3B0UX 4OOZA 3GHUA 4V1YA 4LS1A 1VS1A 3M47A 1GVQA 4Q8QA 4BEQA 1W1VA 3WFZA 4UR7A 1KM4A 2QPUA 4U2ZA 3UYCA 4OBSA 1PKYA 3BAKA 1WDDA 4M82A 1I2OA 2V8ZA 1UUMA 4LQ1A 4F66A 3M5XA 3DI0A 1ADSA 3N73A 2YBVA 3L4UA 2VENA 5LIKX 1B5TA 2Z26A 3M1ZA 5ABHA 2VRKA 4AD3A 2AOSA 3FHQA 4CUCA 4B5WA 3W38A 1TELA 2XIOA 2WSPA 4FX7A 1Q6DA 4R5EA 2QGYA 4EVZA 4AZIA 1X6UA 2WZIA 3AMCA 3CMJA 1ZBCA 2FVKA 1M3UA 1XW8A 3RAOA 1T5AA 3VGEA 2J75A 4J27A 4GHRA 3SUSA 2IW0A 4GXPA 5K4ZA 1DORA 3HPAA 3D6NA 3LNPA 4G56A 4AF0A 1SMDA 3MCMA 4LTSA 3PUEA 5FJOA 3CWHA 3MDUA 3RHGA 5SWUA 1DYSA 1F7BA 1M53A 4WF7A 1GW9A 1RH9A 3WBEA 1PL9A 2GUUA 3VOIA 4J3XA 3SCSA 3I7RA 1IQ8A 3W1PA 2FQIA 1FOBA 1KRAC 3DG6A 3DCPA 2OPJA 3SEPA 2HE8A 1Q4WA 4XISA 1RALA 2ZOXA 3LG3A 2NUXA 4D9PA 3WMSA 5BOOA 3ZT7A 5D2TA 2KX9A 3FJLA 2OELA 2BSLA 2JIEA 2X7WA 5HNRA 1G5AA 4HB7A 1UWSA 2RFGA 3W7KA 4MWAD 3EMZA 5HJXA 3SGZA 1JAKA 4IH3A 4MLJA 1NARA 3OLGA 3GR8A 4TR9A 3IANA 2YB4A 4ZBCA 3VGBA 3QW4B 1UH4A 1VEPA 3GXIA 2PDYA 4Z42C 4KRTA 5CSRA 1HG3A 4MKVA 4JFWA 5F2GA 4GUJA 4GX8A 4NG3A 3OBKA 2QCNA 4YYFA 1VCGA 5AC4A 1X1OA 4IIFA 3RPMA 3FVMA 1Y5WA 2OLHA 3HFTA 4DY1A 5HJYA 2PU1A 2PBGA 1PJ9A 3W26A 4N9EA 4L56A 4XD6A 4W87A 5G2HA 2H9AB 1OCBA 5CG7A 4ZEPA 4DUVA 3TUUA 5AYBA 1ZAHA 1GZGA 2WHKA 2FJKA 5HPOA 4US6A 1I0BA 3VKCA 2V5DA 5DF0A 2R14A 3OLEA 2VZUA 3GTNA 4CD8A 3NXFA 1IZKA 3F2BA 1Y7VA 2GFTA 4R53A 5CPMA 5HQEA 4JY8A 4RNIA 2TYSA 5DELA 3NZ1A 4JTGA 4DJFA 3R89A 2FVMA 2ON3A 3MCNA 4MTVA 1XL9A 3IVUA 4C5ZA 3GDLA 1M9HA 1JUKA 1Q6OA 3L9CA 1X7IA 1HJXA 3OTRA 2GK1B 3N2XA 4HSNA 3UU0A 1A0EA 3CUHA 3IS4A 1EO7A 3WDHA 1EA0A 3N15A 2ZZ2A 4LBUA 2X1TA 3TSBA 3QY7A 1CTNA 2X1IA 3FW6A 2DQXA 1JDAA 1XYFA 4FPSA 1BYCA 3HIJA 2IPWA 3JRKA 4MOZA 1PX8A 1A5BA 2F61A 2QV5A 4P8UA 4GVIA 4ROPA 3ABRA 2ACSA 2PWEA 3PBGA 1RR2A 3SW6A 4AEEA 2TMDA 2DSUA 4FA3A 4HNLA 2B7NA 3QTPA 4D6DA 2FHBA 1LJYA 2VQUA 3WNNA 2O56A 3KCLA 3VOHA 4D1JA 4C7DA 4AB4A 4H9UA 4KEUA 3AIEA 3AFBA 4O18A 2PTXA 1VFHA 1Z9AA 4J3WA 4ZO7A 3RDKA 3LHVA 1QTWA 5CAHA 1V4YA 3VIIA 4E3TA 2A7RA 1FCVA 4CQBA 1O1ZA 2YL8A 3N12A 3SQMA 2D2JA 7TIMA 1P1XA 1PHWA 4OFCA 2BVWA 2RDTA 3H2NA 2XN0A 4L6HA 3C2EA 1P5BA 3FIGA 3LBCA 3CO4A 2ZVIA 3BW3A 3NSNA 2J9XA 3TX9A 2NT1A 2WLZA 5HUPA 3UY7A 5DRIA 3I6EA 1NQKA 2PTZA 1OX4A 1PCWA 3W01A 1EDTA 3TNOA 1BEUA 1ENUA 1S39A 5TIMA 4MPKA 1E43A 4CU7A 2PD9A 2C3ZA 1TRIA 1LWHA 3OP2A 4BS0A 4LPCA 1O12A 4P7OA 4LFYA 5H91A 4PYSA 5JIWA 1K3UA 2GLKA 4UTTA 3IUHA 3RILA 1W1YA 5CJNA 4DUOA 2QULA 5C71A 4CNSA 3B40A 3U3HA 1BWKA 3W9ZA 5XIMA 1Z6KA 1AVAA 4JNYA 4RJEA 1RBAA 2D0GA 1R0MA 4UUIA 1RJPA 3GDKA 4YXGA 1EYEA 1NELA 3IJQA 1O1HA 4RE3A 3TE9A 1TPB1 1OGSA 3Q94A 3W2JA 3MP4A 5I3IA 4JOMA 1TJ0A 1KKRA 1B3WA 3W74A 1QK2A 3URBA 3ZM8A 2W91A 1XC4A 3LPGA 4LC6A 4O4VA 1I2NA 1Q2RA 3REQA 3VM7A 1XPYA 1DQXA 3POCA 3T1GA 1U1HA 4TVDA 3CWOX 2YXGA 4I5RA 3ZS4A 4HSOA 3PS7A 4WKHA 3W28A 1R8LA 2JKEA 2ABAA 3AJ7A 3H21A 3V5OA 4DELA 1XS2A 2G3NA 2CXEA 3ARXA 3V7PA 3RMEA 1MQQA 4ATDA 2DDXA 3AS0A 1B3ZA 4LYRA 3T6CA 2J4GA 2BXZA 2ZUMA 3P0WA 1OQFA 4QHRA 5HWMA 3NIYA 3SR7A 3S9ZA 2R24A 2XVNA 3DHPA 2CC0A 3N9SA 1XIMA 4L9XA 1OX5A 6TAAA 2NLIA 2PDKA 4Y90A 1C9WA 4OGZA 2DSWA 3PNZA 2JE8A 4BI5A 1US2A 4ZTYA 1ONWA 4CKQA 1QOQA 4RW5A 4KH2A 2YCIX 1K9TA 2PLMA 4ML4A 1NOUA 4B4HA 3NFUA 4NU7A 4WXZA 4RDVA 4Y8EA 2JALA 1KQZA 3S1XA 4DI9A 3QKEA 4C5YA 3EOSA 1C7TA 1C3FA 1R2SA 2J77A 3BOLA 3WLIA 2WSYA 3NQBA 2DIEA 3AQUA 4BY3A 3OYXA 1XLBA 5C9ZA 1O5QA 4X9SA 4YCPA 3WLLA 4WJ8A 5CEWA 4GYPC 3N19B 3CPRA 4MB3A 3VMNA 5U4NA 1QW9A 3IUDA 5KINA 1W9PA 4IMFA 4AZ6A 3GDBA 3PSVA 3GIPA 4UFLA 3WQDA 3P61A 4O16A 3KWXA 2QF7A 1OX6A 3K8KA 3PN8A 4WGHA 1CB2A 1QU4A 1J9YA 4CNOA 3S3GA 1U2YA 2NQLA 3EDEA 1VF8A 4R33A 1FH9A 1HJVA 1MDLA 4EWJA 2R1NA 5G4HC 3TJLA 3RO6A 3HN3A 4IOTA 5FA5A 3LV6A 4OOUA 2B31A 3SZ8A 4PMUA 3EB2A 2ALDA 1X38A 3T4WA 3LM7A 1K8XA 3LZ5A 1T40A 4DNHA 3TQVA 2QNEA 1PV8A 4AG0A 1JDFA 2IKIA 3EMQA 3GW0A 3S2NA 1FWEC 4JQ2A 2E9MA 4O1BA 2RAGA 4JCLA 4KWOA 4HHPA 3W86A 4FX8A 4L64A 3UPMA 3ZXWA 4PMRA 1E9LA 1TCMA 1MZHA 4PN2A 3QMSA 1IEVA 1EJRC 3WY1A 3NQAA 4HK7A 4I5UA 3U8GA 1ZFJA 4W5ZA 1UUOA 1EOMA 1D3CA 2DORA 3W1XA 3VOFA 3UJEA 2W61A 4JFUA 3PUOA 1RK5A 3W37A 1PVNA 3VA8A 3K13A 2P0IA 2R1MA 2DJLA 1TMHA 3ID7A 4O57A 3P80A 4ZO9A 5LA2A 3EPNA 1JQVA 2XGZA 3RX3A 4DYKA 2J7HA 3VM5A 3TNBA 3U4FA 1CB7B 2PDFA 3WMBA 3ZQ9A 1EL3A 3M5VA 3B9AA 3H22A 3KLLA 4PUUA 4UFHA 1TWWA 4AX6A 1XH2A 4ICCX 3GS6A 2UY2A 7XIMA 3P5YA 2WAGA 1RPKA 4EE9A 1EHNA 1IZCA 3Q37A 1F5ZA 3GFZA 2V3DA 3FDKA 3CUZA 1ELSA 1Q6LA 1VFUA 5BOEA 4FXSA 1X96A 2WPBA 3PZGA 1D7KA 4X63A 4PTMA 2GGHA 3PZMA 4MY1A 7ODCA 4K2SA 2F9RA 3PP7A 1F3EA 3UR5A 1FWSA 2VUNA 5TQLA 2XWEA 1PZ0A 3BOFA 3CZKA 3EEGA 4WY0F 1H1ZA 1GKRA 1RV8A 3BCJA 1JULA 1PIFA 1XYZA 1E0XA 1R9XA 3K2GA 4O0QA 1TPFA 4W7VA 4XTDA 2EPLX 4ZOEA 3UGVA 4NAFB 4O0ZA 3LERA 2EQDA 1LZOA 4AW7A 1QOPA 1V8EA 1HKWA 1JYWA 2DT0A 3BW2A 4DWSA 4JIEA 2ASHA 3VGFA 2QCDA 2GQAA 1HIZA 1SSGA 1SW3A 4AIOA 1I8JA 1H0IA 1XRFA 3FOKA 4C6PA 1ISYA 2VX4A 5D9MA 4GY7A 1B3YA 3G1AA 4GH1A 1LM1A 2FPTA 4JQ4A 4ATLA 1R3SA 1W1A1 3WDPP 4UWMA 4ZO6A 4I9MA 4IX0A 1EDQA 2BTMA 1TUXA 3O06A 4DJFD 1E73M 4AZ7A 1OCNA 1UROA 4FIRA 3KHDA 1OHLA 3COTA 1ZJHA 2IPFA 4DVOA 3VDCA 4W9TA 2WSQA 3XINA 4KFOA 3AHVA 3BGGA 1A5NC 4MLRA 1JPKA 3EPOA 3VX0A 3IUIA 3UA3A 5EA9A 5T26A 1KGWA 2Z25A 3V5CA 4XBKA 1S3TC 1VFFA 3N13A 5DRCA 4UXDA 1V79A 2E77A 3TTQA 3AZRA 5AHNA 2CWNA 1XH0A 2O4MA 4LCQA 3WD2A 1F05A 3F7JA 1CWYA 4GQBA 4MNJA 1NDZA 1A50A 3TQKA 4I8YA 3MMDA 1CENA 2UBPC 5J5RA 3H2EA 3WJWA 4YTUA 4XX6A 3TMQA 1PPIA 2Y89A 4DUWA 3FS2A 4I9AA 1ODUA 5JBEA 3NQCA 1W8SA 1U5HA 2AL2A 1AUSL 4Y9PA 5CC5A 1CGVA 4HN4A 1XQKA 4XZIA 1YPXA 1Z44A 1A5MC 3QBUA 2OWWA 3H24A 3MA8A 1K4HA 4GY0A 4NZ4A 5E6ZA 2YCEA 1R86A 1VPQA 5DY3A 5KETA 2WV8A 2ZQ0A 4C60A 4GC4A 1T96A 2E28A 3I7QA 1FRBA 2O7SA 2PWHA 2Y7FA 5JQ9A 1W2PA 3WQ6A 4YWSA 2VZTA 1XYMA 2WMFA 3BLDA 5C9XA 5IBXA 5MKGB 4ZR8A 3N6HA 3EKZA 4FXFA 4XUYA 4DYEA 1EF2A 1QVBA 3QRHA 2PODA 3UR7A 1V6YA 2OB3A 3P3BA 3N4FA 4KRZA 2O55A 2WVUA 4HPXA 2INEA 1BYAA 4GK8A 4C65A 1BXNA 3NUKA 4NJGA 2WNZA 1AD4A 1H0GA 4FALA 4XTIA 3B4UA 4YHGA 1XIDA 2DQWA 1FWTA 5FSEC 5ABEA 4KWSA 2NXGA 1Q45A 3A5FA 1GT8A 4FF7A 3TW9A 4RZ5A 2PD5A 4L61A 4HT3A 4TVCA 1I4NA 4WDUA 1R6WA 4AUBA 3GYCA 4FLOA 2H8ZA 3QGVA 3RRXA 1UD6A 3TQPA 3AXXA 1XSIA 4A3QA 3IIPA 3ARTA 4US5D 1UB3A 3KLKA 5GQBA 5BCAA 5CJMA 1IIHA 4U3AA 1G4EA 4IQDA 1H49A 1FQ0A 1BTCA 3WMCA 1UW9A 2GJXB 2DZBA 3ICJA 4L9YA 3LXBA 5CJ5A 5A5WA 2ISFA 4A29A 4X61A 2VFIA 5A6LA 1V02E 1MRQA 4KESA 1UOKA 2CLHA 4J4KA 3N4EA 1UR3M 3C3UA 3APTA 3OHIA 1E6SM 1G7VA 3RCYA 4HVXA 3ITTA 1F4AA 5K7JA 3V75A 2VRJA 1R3WA 3W81A 2IPJA 1QNSA 2PDCA 2QLYA 3IJ8A 2WC7A 4JTIA 3M41A 4HSHA 3N2OA 4IX2A 1E1CA 1J5SA 1OG6A 1GONA 4F48A 1QOXA 4MWAB 4LAMA 5HAOA 3DUGA 3RYSA 2W79A 5E0KA 5JXQA 2DPEA 3MJYA 1VEMA 5A6JA 3QHMA 2VDHA 1JZ3A 4QRNA 1V3MA 2CLKA 2BWGA 5DLCA 2XPKA 2V3GA 1GJUA 2Y7DA 2VDGA 1TIMA 2A6NA 3DG3A 4R3UA 3QOKA 3QV6A 1X39A 2WMHA 4PBFA 1XCFA 3I3EA 2CHNA 1LOQA 5HR6A 2DSVA 4FLQA 2YA2A 3AIUA 3II1A 3GVRA 1LQAA 2W62A 4E0CA 3GB6A 1RP8A 2PU0A 3UESA 3BUVA 1MUMA 5FJJA 3CLWA 2FFIA 4IWWA 5A6MA 2DV0A 4E6MA 5GJPA 1GEHA 4IISA 1XYLA 2NV2A 2Y88A 3H53A 4XAFA 1CYGA 3IAPA 1RXOB 1S1PA 1X6NA 4HYVA 1U83A 4W88A 1TSIA 3ABOA 1KR1A 4ICMA 3O0KA 2BS9A 3EWYA 5HDRA 3PPGA 3KBMA 2ZX5A 4J3TA 1L6FA 3M64A 4PBGA 3GXMA 2O7QA 3RGTA 3UXKA 1ME7A 4NAEB 1G7UA 1DIDA 1QW8A 3GXTA 4BWLA 1L9WA 1P6BA 1HFBA 3UCQA 1ZPTA 2PURA 4IPIA 1HX0A 4PEEA 3SGUA 4FS9A 3MMTA 4LS2A 1J6OA 4A3UA 3IIVA 2NQ5A 2P3EA 4H04A 1K8ZA 2HPIA 1H60A 4KWUA 2PEVA 3AAMA 5L6UA 2I7GA 3WF1A 2A3BA 1HZYA 3THQA 5G1TA 1U1JA 1KXTA 5I03A 1JCNA 2GJRA 1KRBC 1ADOA 3APYA 2KAUC 1W5OA 3BLFA 4MHBA 2WCAA 3CZ8A 4TOQA 2ZA3A 1DJZA 2BY1A 4RDWA 4FB7A 3ZYZA 4D71A 2EJ1A 4JNMA 5DFAA 3A23A 3B0VC 4GUGA 4A21A 3BARA 4ENLA 4DPQA 4WKFA 1N7KA 3WLPA 3BPWA 4JBRA 4KIEA 1MUWA 4IM4A 3B97A 3OB8A 1DIKA 4FNQA 4X3ZA 4HYWA 4C1NB 3GG7A 4F0HA 5F7UA 5GJMA 1VYSX 1WKDA 3NQGA 2DZXA 1TVNA 3KCOA 3NSMA 1XD0A 3G22A 1OF8A 4IMGA 4UIOA 3WNOA 3C2YA 1PB0A 4MY8A 4K1GA 3OOQA 3IVTA 2HMCA 4Q8PA 1C7SA 2VD9A 4LUYA 3OVRA 2A3EA 1XG4A 2WB5A 3T7VA 1M03A 4AY7A 4E2OA 4IL0A 1B57A 2NV9A 2WYSA 1QO5A 2OLSA 2P76A 3H12A 5CPNA 2J7GA 4A8RA 3GIYA 2WWDA 1Q63A 1LG2A 4IJBA 1EUAA 3BJSA 1LG1A 1SW0A 5A2CA 4W8BA 3WLOA 1PX4A 4JGDA 3WNKA 2BB0A 1KLZA 4QBXA 4O15A 3UQNA 4IUOA 3CQIA 4AY1A 3S5YA 3H2AA 2D3NA 3PVFA 2EKGA 1RD5A 2OWCA 1CLKA 4GIEA 4ECLA 3NAVA 1OY0A 2ATMA 4DWSD 4E38A 2P8BA 2XVLA 3CEUA 3A9BA 4KQNA 1RQHA 2GSEA 5AYIA 3AU6A 3TMLA 1M65A 1TA3A 1TZZA 3RUBL 4L5ZA 3AHXA 3ZLHA 3E0LA 1V0NA 3A22A 3ES8A 4EIVA 3MUAA 3CYVA 5DMYA 3GBDA 3WQWA 4JQ3A 2OT1A 1EGMA 1C90A 3LNMA 3EXTA 1GNXA 1K1DA 1S1RA 2OSYA 1GJPA 3TYEA 3TSMA 1OCJA 4Q33A 1L6YA 3CZLA 3BWWA 1JQXA 2QR6A 3BMXA 3MSDA 3WN6A 4S39A 4CQCA 1CBGA 3B9EA 2PGFA 6ENLA 3LHZA 5F4WA 3ZJKA 4S3BA 1M7PA 5I07A 5FF4A 4JL2A 1WUEA 3QGAC 1UKQA 5HOSA 1H4PA 3AO0A 2VGFA 2VGGA 2FGLA 4R34A 4XQ6A 4DN1A 4FZIA 2ZX9A 4P7LA 1JZ8A 4JQ1A 1E9IA 8A3HA 3PJXA 1X8CA 5EMYA 3UVIA 1KCKA 2V68A 1D3HA 1MWOA 2DFAA 2ZZ3A 1ZUAX 1DJNA 5D32A 3TJ4A 4GIRA 5E0FA 4JQAA 1RPXA 4LAOA 3K1DA 4NNAA 5KZDA 3G1VA 3M16A 1OYAA 3UXLA 3HBLA 1SU5A 4GE8A 2XSBA 3LZ3A 1UKTA 3TIMA 3B9DA 2JEQA 3JU2A 1EA9C 3LSBA 1SVDA 3E3HA 1GPWA 3STGA 4BF5A 3VDAA 3RK8A 1A0DA 1VFOA 4HU3A 4QJ1A 2ICSA 1J0ZA 1QI5A 3THUA 3NCOA 3RJXA 4DX3A 2C18A 3DDMA 2GGGA 2FIQA 1QHZA 4HQVA 2QVNA 2WMGA 2OYKA 2NSXA 2OCZA 4Y6GA 3GAKA 3H55A 1AFSA 1A3WA 3UA4A 3M44A 4QJ3B 2EPMX 4NJKA 1PZ3A 2J7EA 2NQJA 3UZZA 4CD6A 4DO7A 2ACUA 3A4XA 4WGXA 4A3HA 3T42A 1E55A 3EX6A 4AIEA 3FN9A 1LQ2A 1YEYA 4UOQA 3CUXA 1S46A 3UG5A 3C0QA 3GTHA 1JR1A 1CPUA 2ZRWA 4O8RA 4NILA 5FJUA 3E2QA 4PE8A 3R13A 1J93A 4FLSA 3H4XA 1KGXA 2A6LA 1E4NA 3RITA 1SJBA 3N11A 1KFCA 2OSWA 3GNPA 4LU0A 2V3EA 1EYWA 3IRDA 3AXHA 1MQRA 4O28A 2PRHA 2F2KA 2ACQA 4LCRA 2HVNA 1O6IA 1GQIA 2Z2BA 2QYGA 2HK1A 3W1RA 1XDLA 4XAGA 5IOBA 2E5BA 3RLUA 3FDGA 4G7FA 1S5TA 2DUXA 3VKKA 3FGCA 4UNLA 1J0YA 1AW1A 4IL2A 1SZGA 2PDUA 1NF7A 2W66A 5D2WA 2CLEA 4FOUA 1EJXC 2Z1SA 2ZXQA 3NA8A 5I6SA 3MI6A 4NYYA 5T9BG 4AF0B 3VD9A 3S6OA 4L6OA 1EJVC 1GQKA 2ZX7A 4HNUA 2PFHA 5H8MA 1XLCA 4AD5A 4TMCA 2FZBA 1JVNA 3AS1A 1IEQA 2HPMA 1WKFA 2CHOA 1OGBA 1DKWA 2DIKA 1V51A 2HNEA 3LM3A 3W7QA 1DJGA 3W6LA 4OZOA 2I5GA 4UTHA 4Q4QA 4MDOA 3AYSA 2UY4A 2C79A 1QNVA 1T8XA 1KWKA 4N4PA 3KZSA 3P67A 3L67A 4IT1A 4XD5A 1GCYA 3W7HA 2GUYA 3CUIA 4RE0A 3W53A 1REQB 3FYOA 1WP6A 1VH7A 3F4WA 3ZJ8A 5F4SA 3CT7A 3SY1A 3KM8A 1YDYA 3W7OA 4KPLA 3WJZA 4JTKA 3WQ8A 4WQ6A 3UWEA 3TN5A 1FWCC 1RUSA 1M7OA 2WJEA 3W73A 3HG4A 2NX1A 3UNDA 2OLAA 3WUEA 3I6TA 3P0XA 2C1HA 3OU8A 1MW0A 2R8WA 4HMNA 2PC8A 1BYBA 3OYZA 3WDRA 1V7YA 2G4FA 3KOXA 4WOZA 1H7NA 2Y8UA 1A5KC 2GJNA 3VD4A 2VFHA 4QJ5B 4C6CA 1KXHA 3W87A 3ARRA 3SIMA 3T55A 3O05A 2VX6A 1E40A 1B3XA 2UZ9A 3HTWA 7ENLA 2PDQA 5C54A 2YXXA 4B90A 4P8VA 1QPOA 3E0FA 2D0HA 1PCKA 1B4EA 1JCXA 1I75A 1VENA 3UWUA 3V1PA 4WVXA 1H11A 1YTDA 2OWXA 1T0OA 3GAYA 4QNWA 4LBRA 4MYXA 5F2IA 1EO5A 3VTRA 3QLLA 4BKNA 4UQDA 3ZOAA 3L2IA 3M0KA 2F6UA 4A8IA 3EOLA 3BLOA 1UH3A 4H01A 3STFA 3TH6A 1K6WA 3W07A 4V2XA 3AWOA 2HZGA 3T8QA 5IRPA 2R1KA 1G69A 4PULA 4MDPA 3HG5A 3SAZA 1P43A 3EBVA 2EPNA 3N14A 1MXSA 2Y62A 3CUFA 1NFGA 2HRWA 1DHPA 5LIUX 5FOOA 1FWRA 4UMBA 5H8PA 5JH2A 3SCWA 4CQ8A 4LV9A 3CL8A 2PDNA 4Z1BA 3TN6A 2RHGA 2HWGA 4EWND 4ZQNA 3V35A 2YR1A 3DKLA 3MJMA 2AKMA 1RVGA 3BJFA 1CDGA 2YX0A 4PZVA 2BVTA 3IGUA 3VU2A 4UNIA 2ZRXA 2YCLA 1O60A 3NSXA 3PNUA 3W7RA 4HZMA 1H41A 1UWTA 3PZVA 3SN1A 1HN1A 1CX9A 1FWBC 4CD5A 1SFLA 3GG0A 3BSGA 1G67A 1PTGA 1E0UA 2BXVA 4KWVA 1YNYA 3U2EA 1GQJA 5JH1A 4Q4RA 2VC9A 3VCCA 1IGSA 4HP5A 1FWGC 2X16A 4ZFMA 4B4FA 4MUPA 5XIAA 4PSPA 3U2OA 2DUZA 5A1AA 1TWSA 2C7FA 1EC8A 4K37A 4HYRA 3VIHA 3NQDA 2F7FA 4UC5A 3R79A 4UQBA 3HJZA 1M5WA 3SCTA 1FHDA 2DIJA 2QCEA 4C6EA 3ATYA 5GNYA 3OZPA 3H54A 5AC7A 1VYRA 5A8QA 3PFRA 4BF7A 3TA9A 4TTGA 4Z0JA 3WLNA 4M5PA 1QPQA 1JYVA 4B3ZA 3T05A 2C19A 1OZMA 1E6RA 1OJXA 1UJPA 4MSSA 4YVXA 4U4MA 2W27A 4OT7A 3N17A 2V5JA 4H83A 1W3TA 1QI3A 1XSKA 4IFOA 5FJIA 3DX5A 1Q4NX 4YTSA 2HE5A 1SSDA 3C0JA 3ARWA 5B80A 2Y70A 4UCFA 5FF0A 2FPVA 4MADA 1KFWA 4JTTA 1N8IA 4JTAA 2DSZA 2J13A 2PDMA 3TLLA 4HOZA 1JZ4A 3OG2A 2XG9A 5JMUA 3MO4A 4MB5A 3Q65A 2Y8KA 4MNMA 4O14A 3T2PA 1F3WA 2A3CA 3AXMA 3NJ3A 3N6JA 3T0TA 4JTLA 1GOKA 4EXQA 4IIDA 5FF7A 1JZ6A 3NZPA 3TZNA 3EWXA 1SFSA 3W7CA 3ZO9A 2O9TA 3E5BA 4OUEA 1RZMA 1IXOA 3N2MA 2Z0IA 3VOCA 3GLCA 1UR4A 2Z00A 1ZJIA 5GNXA 5FSDC 4C6JA 3WELA 1AW2A 1TPVA 2FMOA 3CHCA 3AZTA 5FL1A 3DIPA 5CGQA 5EMKA 2EGZA 2QEZA 3FKRA 4DWDA 1Y5XA 5BOFA 3P74A 3OQ8A 3VPLA 2CEQA 2PWUA 3PBUA 3REQB 4F8XA 1WQ5A 1HJQA 3MY9A 4G5DA 4GNJA 2V5CA 3L4TA 4GKTA 4Z2KA 4Z2JA 1LUCA 2CLFA 1CECA 3MS8A 1R3TA 1H5YA 3QTGA 1PYMA 5I5RA 2NSOA 3BG3A 4QEEA 1F61A 1TR1A 3AALA 5H2ZA 4ERGA 2YSWA 2C13A 5IHRA 1E6ZA 2A3AA 2VZVA 3LD5A 2YCKX 3W1AA 5AB3A 1R47A 4UFKA 2DW6A 5AC5A 1XIJA 4KCVA 4ZCWA 2VVSA 2XN1A 2V63A 4CCEA 5A2BA 1Q85A 3TN4A 1C29A 3G2GA 1U33A 4AXKA 1HL8A 3CYJA 4JTCA 4JICA 1WO2A 3RU6A 4H8HA 3EDKA 3S2MA 2HS6A 1K7EA 2Q3RA 1PSCA 4JZ5A 3BW4A 3UG4A 4LUTB 3KFTA 1AA1B 3LPFA 1AH4A 3GHSA 3HPXA 4HZ7A 4JS3A 3PSWA 1RVKA 2R82A 2ZCGA 4I6KA 4WJXA 1BVWA 3LI1A 3TOYA 3O8AA 4JCMA 4KERA 1PTDA 3MP5A 4Q8WA 4H41A 2Q6ZA 3MC5A 3SCOA 2XWDA 3IJ7A 3WG6A 1C8XA 2GJLA 4QQUA 3D47A 1R30A 3E38A 4QQ3A 1EBGA 3DBPA 3E0WA 1XBZA 4MAVA 1VR6A 3LENA 1DOSA 2ZRYA 4KRUA 4N9DA 3AYVA 1IWPA 4HU0A 3PJUA 1KC7A 2YDRA 4PTNA 3MPGA 1X8FA 4DBDA 3HF3A 3ISIX 3FX4A 3CAWA 1FCUA 4AMAA 4O10A 1XINA 3ENLA 3NOYA 4K6AA 2Y63A 2Z1WA 3S47A 1UKSA 1MVYA 1XDMA 1POKA 5CGMA 5H8UA 2E25A 3WF0A 3ITOA 1A0CA 7REQB 1EC7A 4HPGA 2W63A 3GNOA 2VFFA 3R43A 4AZHA 8RUCA 1P7TB 1SO4A 2J8FA 5CXPA 2ZDSA 3QN3A 1UMYA 3W1LA 1VHCA 2ZXDA 2ONEA 5A6BD 3G18A 2OQLA 1ME9A 4EKJA 4K8HA 2X05A 4O1EA 5EMJA 3FJNA 3UPWA 2NT0A 5FJTA 4CNNA 1GGOA 2WCGA 1JAEA 5E70A 1PUDA 5I7GA 1Y0EA 1M68A 2YDSA 1XP3A 5EGRA 1CXKA 1MEWA 5HPCA 1NDYA 1H1YA 3KW3A 4TMBA 5ABFB 4HU8A 4DZIA 1GG1A 1Z41A 1GUVA 1F8IA 3G1YA 1GK8A 1G6CA 1NOFA 4BQ3A 4NJHA 2NX3A 1HVXA 1OIFA 1OWQA 3ORWA 2PTYA 4H4IA 2IKJA 3TDFA 2A0NA 1ZAJA 1E6QM 4F2TA 1W9BM 4FP1A 5DCEA 1GOWA 2GDVA 1VGAA 1WZLA 3LI0A 4JHZA 5LNRA 2A3HA 1P4CA 3S42A 3TXVA 2GGIA 2FHFA 9XIAA 3JVAA 2ZZ6A 1C93A 3JZEA 4GFSA 3S0CA 4ZQMA 1QASA 2CLMA 3G3MA 3PZTA 3DH7A 1EJWC 4QISA 1VBJA 6REQA 4DHGA 2OGYA 4UFIA 5FJRA 5DXYA 3M5YA 2VC7A 1GPFA 1XLEA 3HG3A 1XH1A 3C2RA 3TC7A 3NM1A 2YCJA 1JRCA 2ZICA 4WSJA 2VMFA 3H26A 4MVAA 1E5NA 2E6FA 1LBLA 3W02A 1IHIA 1OFPA 5M5DA 4DWSB 4CQDA 1XI3A 3CHFA 2QCDB 2MNRA 4J2PA 3NG3A 2B7QA 1TV4A 1V03A 4PB4A 4X2PA 3V0UA 5A8NA 3LCLA 1R3YA 5FESA 2BVYA 4UTWA 1CI1A 5HWNA 1S3HA 5BROA 2FZ9A 3W2NA 5AZ1A 4A2RA 4UTTC 1BSLA 4JTRA 1DBTA 5DXXA 3G1SA 2Y1HA 3P8JA 3W71A 1UUQA 4H9XA 1OFBA 4GO9A 4PCPA 3R2GA 1GORA 1QNQA 5EMMA 3A13A 1KXVA 3BE7A 1KRCC 4WRHA 2JFEX 5FD0A 4ZFCA 1UP2A 1UG6A 4DJDA 3SUUA 3WBWA 1I2PA 3L7RA 1Q8JA 5HMEA 2ZA1A 3F5KA 2PRMA 3JUGA 2CLLA 1DXIA 4DBEA 4ZTXA 4JTUA 1EPVA 4ZB5A 3R12A 1XQLA 3TTSA 3PTQA 4MYAA 1H7OA 4S3JA 1FFRA 1TE6A 4OU1A 4IG2A 4AVNA 2ACRA 1SZFA 4QEHA 3VI2A 2V38A 1EWEA 1VRXA 5F2MA 3RPTA 2YFOA 2WPGA 2AL2B 5TNVA 4GZ7A 5FAGA 3CV1A 3TYUA 1YE4A 2ZX8A 2J25A 2X1SA 4ZSTA 5BXPA 2E6DA 3M6DA 6A3HA 1DXFA 4XKMA 2QJIA 2WXDM 1I6NA 1BF6A 2YGYA 3IPWA 3LCFA 1J11A 4KIRA 3VINA 3WMLA 4B3KA 1XYCA 2JF7A 3HGOA 1KBLA 1B90A 3VZZA 3KEHA 3UGRA 1ZBWA 2Q02A 2P8CA 3FSUA 3PAOA 2VCBA 3BANA 4M19A 3M9YA 1ZP4A 4HA1A 1WNOA 3QQ1A 2V3FA 4DM2A 2HEJA 3CMGA 4IPNB 5LYRA 1AJ2A 2YA0A 5PTDA 1HQTA 1CT5A 2ZTKA 1MEHA 4NZFA 1OB0A 2I1OA 4XD3A 1BRLB 4B9YA 4HD5A 2WSRA 3PBYA 3NPUA 2ZIDA 2QZRA 4Y2WA 5G4WA 2PGEA 1DIEA 1FVPA 5G2WA 1RHCA 1NOWA 2FDMA 3S5OA 1WB0A 1KO0A 4LEFA 2OQHA 3VD5A 4HMCA 3WNPA 1TV8A 3Q4DA 2V5LA 4JD4A 2FPYA 2ZUSA 3G24A 2BOGX 4RL3A 4TQTA 1US0A 5REQB 5C8BB 5CBBA 3CBWA 4PCNA 4AY8A 2PTDA 1AODA 2VR5A 1OABA 3PULA 2VO5A 2WKJA 3W7EA 2PWDA 1F07A 4S3EA 2FMNA 3R94A 2J79A 1PWMA 3NYZA 1KV5A 4HOXA 4RR4A 4K8GA 5HMDA 3VMOA 2ATSA 1XIFA 3MUIA 1VCFA 3F4CA 3K46A 3EOUA 1HL9A 3CJPA 4S1FA 4S2BA 1QWKA 1W3NA 2D23A 3UG3A 1EGVA 2BDQA 1KV8A 3DYOA 3EA3A 1FKWA 2FTYA 4C6KA 1B1YA 3H8AA 1M01A 5ENLA 1X7FA 4B3LA 5J5DA 2GGEA 4IUGA 1HO1A 5HQMA 3KX6A 2F6XA 3RFAA 2X0SA 1BKHA 4L6DA 3OG3A 4H2HA 1SW7A 3IV3A 4G2DA 3LCIA 2G96A 4IP4A 2XM1A 3W00A 4L7ZA 1QHPA 1BVZA 4Q4SA 2QMKA 2CBIA 4YL2A 1J0KA 3HOJA 3S5NA 3O2LA 2D2HA 2G41A 3GQYA 3TJIA 1JGMA 1K9EA 2YL5A 4DUXA 2PPGA 5HXMA 3DFSA 1PZ2A 5CZSA 1C8YA 1Q8AA 4GXWA 3DI1A 4GI4A 2CZFA 3BLEA 3KUMA 3GH5A 3WDQA 3E2SA 4AZCB 2CZEA 1HXJA 3ONCA 2CESA 4IHCA 4IIEA 3U2ZA 3MTWA 1UASA 2ZZ1A 5D37A 5H6HA 2PS2A 3WENA 4F0RA 2YW4A 1O95A 4A35A 1TZ7A 3D3FA 1DE6A 5JBDA 3W70A 2QCLA 5HNTA 2GWNA 2OSXA 3ITXA 3Q67A 1A80A 3CV2A 3VZXA 1THFD 5I3GA 1R9ZA 4OVXA 1Q6RA 4RV3A 4ZGYA 3NDOA 4F4RA 1BG4A 2CITA 1EP2A 4TXEA 4K3ZA 4X0VA 4M29A 3TYDA 1HVQA 4KBXA 4YU1A 1F74A 2B4GA 3LTSA 1R85A 5BW6A 3XIMA 4IGNA 1JRBA 1W3IA 3ANVA 4PMYA 1IF2A 3LA4A 1BF2A 1KB3A 1FHUA 4YNGA 1S2VA 2GVGA 5DX7A 1JD7A 2ZC1A 5F4XA 1TV5A 3TR2A 3UETA 1LLZA 5AVHA 4KETA 4Z1YA 1LT8A 5G4EA 1LRQA 3G6LA 4JFTA 2ADAA 2DZWA 2GUBA 5I00A 1WDSA 2O92A 1W5QA 1TYGA 4FIQA 3BMWA 1TQJA 1S2AA 4HPHA 3FY1A 4AIBA 4WIWA 4KEMA 4UQAA 3UZWA 2F38A 5DQPA 3UXIA 4NHVA 4WDXA 4JEJA 1GYLA 4E4PA 1QPKA 2E1WA 3T4CA 3W82A 3UZXA 2POZA 5C6MA 4K68A 3QM3A 1EFZA 3WK2A 1LBMA 1VJSA 3ITLA 4GWEA 3ATZA 3GHTA 5B7YA 3THCA 3RMJA 3SCNA 3W2LA 4A2SA 2NQHA 1VFLA 1YTKA 4A22A 5F2LA 3VNMA 1YYAA 3WLMA 1NJJA 3PZIA 5LNWA 1OYBA 3THAA 4XWUA 1WX0A 3DFPA 2G8ZA 2PF8A 1JZ5A 3MSYA 4NQ1A 4DO6A 3GE7A 5BMWA 1MEIA 2VVNA 3QC0A 3G1FA 2MUCA 4Q32A 1ZZMA 4W84A 2ZE3A 4CU6A 3NURA 5E0CA 1UHVA 1KFLA 1S2WA 2QJNA 1K8YA 4V27A 1WBJA 3VC6A 1YIXA 3TYCA 2G37A 1IR1A 1DIOA 5KTLA 2VZSA 1S2TA 2Y8VA 4JY9A 3KL0A 1UD5A 1K4GA 3LB0A 1G94A 1GHSA 1XFCA 4MG4A 4Z1DA 2W92A 1GVSA 1ISWA 1QUMA 1CEOA 1B4KA 2R1LA 4Q3MA 3DYMA 4UR8A 2RH9A 5AHFA 2EG7A 2Q8LA 2PLKA 3B0PA 1RY8A 3H70A 3HPZA 1WKYA 1KFJA 3K8MA 2Z7GA 3CB3A 4FAMA 1S5VA 5IBXC 5E9AA 4N2YA 1TA3B 4BI6A 4E8GA 3CGTA 3CV7A 5CZ0A 4NXSA 4MJ4A 2NQ9A 1XICA 5I3FA 3EX2A 4NZ1A 1JFHA 2XISA 1SYTA 1XGZA 1KQYA 5D38A 3QV8A 3R6IA 1IZJA 3HMCA 2OMAA 3S1VA 3UW6A 3T07A 3R4IA 3CAVA 2FDSA 1H2JA 2J8TA 1FUYA 3MKKA 2ESCA 1BQCA 3GNXA 4DZ5A 3TYBA 3IVSA 1JCJA 3NOEA 2YDQA 3IARA 4IJRA 1E0TA 4EPKA 5IFPA 1E6XM 1MSSA 3M7SA 4NVTA 3GH7A 5A2AA 1V0MA 4DJDD 1XDJA 1P1MA 2VFEA 5GPRA 2IMRA 1SR9A 5DT5A 3R11A 1PS9A 3C8FA 1R3VA 1UBSA 3T81A 3CT2A 3DHDA 1Q65A 3GC2A 2C14A 3BO9A 3C3NA 1EP3A 3U48A 1FFQA 2FH8A 3UBPC 3O6DA 4UMAA 3D3AA 2PMQA 4PCTA 3B8UA 2PZNA 2BXYA 4FNPA 4OV4A 4XZMX 2YL6A 2CBVA 4Q7IA 3CIVA 2QCCA 5HINA 1QK0A 1IWAA 5GJNA 3OA3A 3NR0A 5C7VA 3BSHA 4B16A 4EF9A 4LW7A 4NRSA 4QG6A 1KTCA 1UPPA 1WUFA 3UP8A 5EFDA 5CCZA 1J0HA 3NVTA 1G01A 4C90A 4X9YA 4FOKA 4FSAA 3B8WA 2NWSA 1W0MA 1CXLA 3HZ3A 1PKMA 1E71M 2BG5A 3UEQA 4XG1A 2A85A 5DBTA 3QZAA 4PL2A 3HPFA 1TV2A 2AGTA 3MW7A 4V33A 1V6TA 4Q8OA 1AJ0A 3L66A 1J2BA 2F8QA 3E2VA 4LAUA 3DZ1A 4NI8A 3W7PA 4NRRA 3TQ0A 2W4XA 4LBSA 4FR1A 3GXNA 2VWSA 3A9IA 4C7FA 5A6KA 4ZQRA 3CEPA 3TC6A 2ZVRA 1UD8A 4PC8A 3RG6A 5EB8A 5CQ1A 4A8LA 3EX1A 1G4PA 5C5YA 1FWAC 3CUJA 3QZEA 1OZQA 3STPA 3ABXA 3MKCA 3M0IA 3L2LA 1V6XA 2PDPA 1S5MA 5FIPA 4INFA 4N02A 3MHFA 2XINA 3SFKA 3GXPA 8TIMA 3PB2A 4RNJA 3W85A 4QR6A 2D22A 3PTDA 1QNPA 2VEKA 3U7VA 4DPPA 1BWLA 3S46A 3LU2A 3MSGA 4NUWA 3LSCA 1XIEA 5I23A 1KCXA 3IJ6A 2AL1A 3A4AA 2QIIA 3AISA 3CZEA 4J35A 4AISA 4J3ZA 1WZKA 4BWLC 1JCYA 1V3KA 3WLRA 3GUWA 4FEZA 3HFYA 1IT0A 3LLFA 1D2KA 4GIAA 4WSHA 3FKKA 4RKAA 2ZYFA 1E9ZB 2JGYA 1Q3NA 3W1QA 2AMGA 1S5WA 1ZSXA 4H19A 4LF2A 4LANA 2XH0A 3VKDA 1JJKA 1OF6A 4PFHA 1TX0A 1PKNA 2G4JA 3CC1A 1H1NA 4TTUA 1XKJA 2HROA 2YPIA 5M1TA 1OFAA 4KFPA 3QZ6A 3GU9A 1XIIA 2YLAA 3A5VA 1T41A 3WFLA 2C6QA 2J78A 5D2VA 1PYFA 4IFKB 3RLVA 1PXGA 4MJZA 3U57A 4GINA 3MV01 1EIBA 1TJ1A 3DOPA 5MHBA 5EY5A 3L0GA 3LGDA 3EXSA 3PPCA 4X60A 3UZJA 3M0VA 3KCJA 2QV4A 3ITGA 1BHGA 1ICSA 2W67A 3SY5A 3BOXA 6CGTA 2JEPA 3QOMA 1VIWA 1XC6A 3LK6A 3AIRA 3WLJA 3GG8A 1FA2A 3C6CA 1PEZA 2QDEA 1N8WA 4Q8TA 1V6UA 2GSHA 2NWRA 3V0TA 3W2KA 4JTHA 5BXRA 3SUVA 2J27A 3LBMA 3T0BA 1W9XA 5BWAA 3AUOA 4L1WA 4J3VA 1H50A 4EP8C 3KOWA 2JBMA 3VIJA 5HUOA 5A69A 1SZRA 4QFUA 5FF3A 3QFEA 1UD2A 4MZ1A 1N82A 3B05A 3TU9A 3ANYA 4E2DA 3FYPA 1JDEA 4B5UA 2XGBA 2Q3OA 3ITVA 4CLMA 2X2GA 1PZ1A 1Y65A 1TQXA 2DT2A 5KITA 2F2HA 4TU1A 1JYNA 1TE1A 1JCMP 1KM1A 5A6SA 1JIBA 5EYWA 3BLLA 4ZL1A 4HGXA 3M7WA 1EEPA 2OEMA 2XDFA 4PCFA 1XBVA 3MZ2A 3DG7A 4OQVA 2CU0A 2DZSA 3CTLA 1B2YA 5LXXA 1VP5A 3MCOA 3IGXA 2PCEA 4G1NA 3EYPA 1JI1A 3LQLA 5A8OA 1J10A 1Z8AA 1FDZA 1A5CA 4RUBA 2YZRA 3MKVA 3EOOA 3MHGA 4IMAA 4XB3A 3U0HA 2VDIA 3GZ3A 2XVGA 3DEQA 1HGWA 3R0DA 3FA5A 1L6SA 3WYZA 4H1ZA 3NZGA 4GPNA 4HA4A 4R7OA 1GTHA 3RX4A 5BRPA 1U1UA 2OKTA 4Z2LA 4TO8A 4GD0A 3G8EA 4D6HA 1A5OC 1TG7A 3CHEA 1WXYA 3F1QA 3OJGA 5LSMA 2X0HA 2VNCA 5AVNA 1J6PA 4I3GA 2J6VA 1O5RA 4ZVJA 1EX5A 3H4WA 4BQ4A 3HO8A 3KTCA 3DFYA 1QI4A 1Z3NA 3KP0A 2CIPA 5TBOA 1OC7A 5BU9A 3QJAA 3P82A 3NL3A 2XH2A 1EXBA 1N2VA 3B3DA 3IJDA 1JDCA 1EC9A 2PGWA 1ISZA 3XISA 3H2FA 3O7UA 3RM4A 1YDVA 2H6RA 5BRQA 2CLPA 2NX9A 1FCBA 4XZNX 2CZDA 3UWWA 1K9FA 3D0CA 2DH3A 3VGHA 2VCAA 1WXJA 5HR7A 4O1CA 1AG1O 4PMOA 3ME3A 4AC1X 1RA0A 2Y85A 4Q4KA 2G5WA 2OYMA 3TC3A 3H23A 4RNHA 4JPGA 2D0FA 2QDHA 3VIGA 1EDGA 1JXJA 1VC4A 4GISA 5ECVA 1WPCA 1VB9A 4JDYA 5C70A 4TV6A 2ZUVA 4O4WA 1ZRQA 4Y9OA 3SGGA 1RY0A 3K30A 4DIAA 4GBUA 4M56A 1MXGA 1BFNA 4F3HA 1LL7A 3I3BA 3ITCA 1VBHA 2E0PA 3V1HA 3H7VA 2BX7A 5MKGA 2WSKA 4U33A 4R88A 1E3XA 3U9IA 4AD0A 1MW1A 4GQQA 3GKFA 1JFXA 3GC4A 2PP1A 3KOZA 4D72A 2Z2UA 4LRTA 3MO7A 4K39A 3ZJ7A 5I0DA 4D1IA 4YLWA 1HW6A 2C8NA 3LCHA 4UR9A 3VFLA 3NPWA 4L4OA 3W6MA 3BCFA 3GFXA 2QUTA 1XX1A 4A3YA 1E4IA 4Z1AA 1W1PA 1HL2A 2ZTJA 4P8WA 1X97A 2BY3A 5J8LA 3SBFA 1G0CA 3TCEA 1OK4A 1W1B1 3KHJA 4EX4A 1F76A 1Q7MA 4EK7A 4GI9A 5C2CA 1KKOA 1QCWA 2Z1XA 1LORA 4Q4OA 1TR9A 2PCQA 1PDYA 5HNNA 3JZUA 3NQVA 4QE5A 4O1FA 3VKJA 3BSMA 2QW5A 4Z08A 1OFDA 3M4HA 2CW6A 1KM2A 4YCOA 3KRBA 3NNTA 2PI6A 4ZODA 2QT3A 2FZMA 1IWBA 1TVPA 1WDQA 3JS3A 3TROA 4JN7A 1VQTA 2HVOA 3LV5A 1KBIA 1LUCB 4A05A 3LXCA 4B91A 1MO0A 1VRDA 1JF5A 3W6YA 1K6AA 3LTYA 4N9BA 2Y4SA 4AZ5A 2YYTA 4W86A 4P61A 4LVDA 2IQ0A 1JPIA 4K7VA 2EAWA 3O9NA 4ZE4A 5A6TC 4BHYA 7TAAA 3RM8A 1K02A 3VUPA 3UVAA 1DWIM 3URAA 3WBYA 4AH7A 5BZAA 4H8UA 1W9DM 1C8QA 2BHZA 1Q6GA 1SUXA 1SPQA 7A3HA 1JNDA 2CERA 5CPLA 1HP4A 3LHYA 1UWIA 4OUIA 3LY0A 4YWIA 3UJ2A 4QAIA 1WYIA 5TD4A 3OGRA 4DXVA 1MW2A 2VP8A 3HB9A 1XBYA 4J3UA 4J9JA 1ME8A 2Z2AA 3L4YA 1TFVA 4L4MA 3T78A 3QXBA 3S5ZA 3IEBA 5BWFA 3MVIA 2QXWA 1GOIA 2ZE0A 2HISA 2QJJA 1E9YB 2J7BA 2BGSA 5J04A 2V67A 3AC0A 4GO8A 4MWAE 1MZRA 3JW7A 3P6LA 3BAWA 3GVQA 3ZMRA 4CU8A 3EOEA 3T0AA 2CYGA 2I5IA 4JAWA 2PC4A 1ZJBA 4PGLA 2C0HA 3T0DA 5T8GA 1MNZA 2FGBA 3KBJA 1WOAA 4PUMA 1XLIA 4NF7A 3SCRA 4CN1A 5EMLA 4JFVA 5BU6A 2V9DA 3WH7A 3LHWA 4HCLA 3CQ0A 1I45A 3MANA 3LPPA 3A3WA 4UB9A 2XTKA 1E0WA 2E9LA 1X98A 2WVVB 1UA3A 3R8HA 5AOUA 1ZY9A 2R94A 1YBQB 3MZNA