5CPMA

Xena from pseudomonas putida in complex with nadph4.
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
359
structure length
359
Chain Sequence
SALFEPYTLKDVTLRNRIAIPPMCQYMAEDGLINDWHQVHYASMARGGAGLLVVEATAVAPEGRITPGCAGIWSDAHAQAFVPVVQAIKAAGSVPGIQIAHAGRKASANRPWEGDDHIGADDARGWETIAPSAIAFGAHLPNVPRAMTLDDIARVKQDFVDAARRARDAGFEWIELHFAHGYLGQSFFSEHSNKRTDAYGGSFDNRSRFLLETLAAVREVWPENLPLTARFGVLEYDGRDEQTLEESIELARRFKAGGLDLLSVSVGFTIPETNIPWGPAFMGPIAERVRREAKLPVTSAWGFGTPQLAEAALQANQLDLVSVGRAHLADPHWAYFAAKELGVEKASWTLPAPYAHWLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Xenobiotic reductase
publication title Better than Nature: Nicotinamide Biomimetics That Outperform Natural Coenzymes.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 133
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5cpmA00
4JTGA 2QCDB 1QO5A 5C55A 1DV7A 3TA6A 2PE4A 1H60A 1QPOA 1BWKA 3W1QA 5F4WA 1VH7A 3JR2A 3STGA 3MP4A 3BARA 3DI0A 3FJLA 4NZJA 3LX9A 3GX9A 3OG3A 1TIMA 2CLOA 3ELFA 1VHNA 2X16A 4FX8A 3W1MA 1SZFA 3DKLA 3L68A 3WJYA 3B06A 4JY8A 3LHUA 3STEA 1Q6LA 3IVUA 3HB9A 3HG4A 4O18A 4M6VA 3I7QA 1EWDA 4KFOA 2AAMA 1ONRA 4UTWC 1YPIA 1VLIA 2E6AA 3M5XA 1O94A 4UCGA 3A5VA 4XTIA 4A2RA 2ISSA 3P7YA 2RHGA 1DQXA 5K9DA 3W7PA 4Z0SA 3S0CA 5K2ZA 1H7PA 1KV5A 3EXSA 2FPYA 4IX2A 2ZZ6A 3B04A 3NNTA 5G4WA 1GWJA 4K7VA 3BO9A 3QW4B 1ME9A 3P60A 1XM3A 2H90A 3SFKA 4GFSA 4RK8A 4QNEA 3U6WA 4WZHA 1SFLA 5E1QA 1X7FA 3T4CA 5AC6A 3N9RA 3QF0A 4MY8A 2ZZ7A 4LVFA 1J2WA 3KAOA 1FWNA 2A7NA 4PCFA 4Z1BA 4Q4KA 2WPBA 1OABA 2DZPA 1SSGA 4E2DA 3TSMA 2A5HA 3LGEA 1FXQA 3LOTA 3HG3A 1FY6A 1O4UA 1W8SA 4PA8A 3NXFA 3PBWA 3PB2A 1OFBA 4RX0A 4S2CA 1CW2A 1I45A 4O16A 2C14A 4Z1DA 3SZ8A 1GOXA 1YYAA 2I9EA 4O19A 3GDTA 1TV8A 3W6YA 1GVQA 1TREA 4UTLA 3GXPA 2GQAA 4O0ZA 2CLEA 3VCRA 2PURA 1W3TA 3KX6A 2W0UA 3R12A 5I3IA 2H8ZA 5F2LA 4PEKA 4TO8A 4JR5A 3M41A 4UUIA 1XL9A 5CZ0A 3DXIA 3ABSA 3V1PA 2G96A 3SI9A 1KM6A 2C0AA 4O1BA 3LDVA 3STCA 3W72A 1S5TA 4AAJA 3TW6A 4XTDA 1WA3A 4WY0B 4ZQPA 1LRNA 1QPNA 3QW3A 1FDYA 4Y6GA 1KLYA 3KVJA 3EWWA 1QPQA 4IMGA 4ZVJA 3M1ZA 5HJLA 2Q8LA 4JYDA 4XQ6A 2ATSA 4YL2A 1XBZA 2ABAA 1ZENA 2NUXA 2V5LA 1B57A 4NQ1A 2HTMA 2TMDA 3TIMA 3GDKA 1SZGA 3NQEA 1XI3A 3FA5A 1GG1A 5DELA 2B7OA 1G69A 3CWOX 4JTIA 2WQPA 3MI3A 2XN2A 5DY2A 1PHWA 1ZHAA 2V2DA 4XKYB 2JBMA 3QZEA 4BWLA 1NEYA 3L21A 1L9WA 3MMTA 2ZA3A 3W2MA 1TV5A 4AEOA 2Q8ZA 1D3HA 5DXYA 4ONVA 2YYTA 1G6CA 3G1SA 5AHLA 4TR9A 3TQKA 4O11A 1M5WA 4JTEA 3UWQA 2ISVA 1A53A 4N9BA 3NL2A 3NPXA 3W7IA 4DPQA 3TQVA 2O7SA 2CZFA 5IM51 1SO3A 3UY7A 1VCGA 2E68A 4HT3A 1I2QA 3LM7A 2ZZ5A 3W7NA 1G67A 3DFOA 1RPXA 3E12A 1LYXA 4QNWA 3QSTA 4NUWA 2TYSA 4MZ8A 1OX6A 4JIQA 4O13A 3C52A 4NJGA 3ZS4A 2YR1A 3TV8A 2P10A 4NXSA 1HO1A 1TPFA 3MJYA 4Z1AA 2NX3A 2WJZA 2E77A 4IXHA 5D33A 3G0UA 1YLVA 3O6CA 4TU1A 3MUXA 4Y96A 4FEZA 1O5XA 3S9YA 3PULA 3G1YA 3PUEA 4MY1A 4PODA 3GVGA 3MW7A 3BW4A 4BI7A 5LNVA 1JVNA 2A6LA 3UD6A 1L6SA 3LCWA 4NNCA 4M7TA 3GKAA 1YXYA 1JCXA 3NDOA 4ORIA 1QAPA 1OFRA 2GQ9A 4XUGA 1YTDA 4MJMA 3LCIA 3EWZA 2CW6A 1LOSA 1KW1A 1SUXA 3W7GA 2VFGA 3P5ZA 3DAQA 1OFDA 3HBLA 4GJ1A 4E2BA 3LXCA 2WNQA 4JTUA 4DEFA 3W9ZA 4DO5A 3W1NA 2ABBA 4LVDA 4AWSA 4K38A 1I2NA 3LI0A 3M6YA 3O15A 3TSDA 3CIWA 4WY0F 5D03A 1S5WA 2GPTA 5K3VA 4U4MA 3M9YA 4UR7A 2QAFA 2CU0A 1KM4A 4LS1A 3THAA 1NF0A 5CG7A 3HPSA 3C3NA 3QPZA 3CQ0A 4FNUA 1WV2A 3C61A 3TAOA 3ABQA 4AMAA 4ZQOA 2RDWA 4LC6A 5AYXA 3H54A 5BRBA 2I1OA 2ISWA 3HOJA 1LRQA 4RKAA 3UQNA 4R7JA 3H53A 3LB0A 2DJLA 3W07A 3L0GA 1KTNA 2RKXA 4OV9A 1JR1A 1GPWA 1HG3A 2OMAA 3TX9A 2EF9A 3L2IA 4JTHA 1LBFA 4OHQA 2WV8A 4RXGA 2OX1A 1A5BA 2E5DA 3UPBA 3NL3A 5LGXA 2ZYFA 1XBYA 2C6QA 1Q6RA 1W37A 1K8ZA 2NUWA 1FWWA 4GUIA 4K8HA 5U7SA 3TU9A 1GEQA 4CLMA 4K8EA 2W79A 3MHFA 4JICA 6TIMA 3M5ZA 2WNNA 3USBA 3TR2A 3KRZA 2P1FA 2ZZ3A 4HPXA 5ABTA 2BSLA 3E0IA 2ZTKA 4RV8A 3W3OA 2PCQA 4LRTA 4A2SA 4BFAA 3QQ1A 1TYGA 3F1QA 2GUUA 4WXYA 3DHDA 2H3BA 3G1DA 1MEWA 1IXNA 4O1AA 3TUUA 1S5VA 3HQ1A 3DFQA 4NJHA 3VE7A 1I2OA 5G1YA 2B7PA 1R2SA 3L5MA 5C6MA 5KZEA 1XDLA 5FF3A 1Z44A 4UTKA 4JN6A 3DBPA 1KTCA 4M6QA 3P62A 3SECA 1LOQA 3PUDA 4DQWA 3OIXA 1XCFA 3P8IA 4UC5A 5HMSA 5LHFA 5DBUA 3LXAA 4FF7A 1WYIA 1XBVA 3HGRA 4BWLC 4JX5A 1TTJA 1K7XA 5CPNA 3W1UA 4UNKA 1K7FA 3LHWA 3Q37A 2C18A 3LHVA 3INPA 4LW7A 4A29A 4LV9A 3S1WA 3NL5A 5DBTA 4Q33A 4YCOA 2YW4A 3IV3A 5G2IA 3DENA 5J5RA 2ZZ1A 3W1PA 2VFFA 4TX9A 5DN1A 3M0ZA 3PB0A 2CWNA 4A22A 3W86A 3FYPA 4UIOA 3MI6A 3NPWA 3HPZA 4UTJA 1AW1A 5LKYA 1K7EA 1DL3A 1ZALA 3TC6A 3RK8A 3W1RA 3B8DA 4X9SA 3SGUA 4UFLA 2VFDA 4JYEA 4KWWA 4AH7A 2A6NA 3N3MA 4LNYA 1HO4A 3TE9A 1W5OA 4JTFA 3C2FA 1QWGA 1YDOA 3RLUA 2H3DA 1P5BA 3C6CA 3LCHA 1DKWA 2NXGA 3W7LA 3STFA 3KRUA 4M19A 1M7OA 1R46A 1XDMA 3W1TA 1MZHA 3BVJA 1SW3A 2VFEA 1WQ5A 4EF9A 3W7EA 3RU6A 5D02A 4JTKA 3W1LA 5EY5A 2DZVA 2HMCA 2QCGA 3SGZA 1OHLA 1B3OA 3E96A 2JGYA 2QUVA 5AYZA 2FB2A 3M47A 3NA8A 4RZ4A 5H91A 3GDRA 5KMYA 3KFTA 2Z6IA 3DFPA 3GLCA 1U83A 3BGJA 5F4SA 5G2WA 4NJJA 3W7RA 5D2WA 3VKJA 3E9AA 2C19A 2F7FA 4WD0A 4HPJA 2QJGA 2ZFAA 4EVZA 1OG0A 3DFNA 3BLEA 1QR7A 1FUYA 1P4CA 1FX6A 1MO0A 1RVGA 2DP3A 1W3IA 4YWIA 3PSWA 1VCVA 2GOUA 5AC8A 2W6RA 3N9SA 4AHPA 5FF0A 1GVRA 2NUYA 1JJKA 3N14A 4E38A 5I3KA 1KM5A 1B9BA 3HO8A 2Y85A 3Q2DA 1JULA 3QYQA 1OFAA 3NQVA 2QCEA 1X6UA 2NZLA 3NQ2A 4N4QA 3C2EA 1FCQA 2EPHA 2QDGA 4PH6A 3S5OA 4A21A 4WQ6A 2V0TA 4GUGA 2X1TA 2QJIA 3PUOA 4GWEA 2FIQA 2ATMA 3EX2A 2QUUA 1ICQA 4JDBA 4Y8FA 1DJNA 4MVAA 1DOSA 5DCEA 3NQ6A 3W75A 1Q6OA 5AFDA 6ALDA 1OYAA 1B4EA 3HPXA 3NQMA 5G1TA 1HL2A 1OX4A 4FB7A 3ZWTA 4WOZA 4ZQCA 2VFHA 4MY9A 4LVAA 3NG3A 4BK9A 2QF7A 3I6RA 1GTEA 5G2HA 1PV8A 4XBKA 2EHHA 5D2VA 2FDSA 4P61A 1H7RA 1IIHA 1TCDA 1I2PA 3W74A 4MUZA 5LNRA 4O28A 1V7YA 1A50A 1SU5A 1W5PA 3T78A 5MHBA 1R2RA 1FBAA 2BTMA 5TQLA 3LCXA 1N7KA 3EX1A 3MHGA 2VEIA 1TSIA 1EP1A 3C4UA 2H8XA 1HTIA 3G1FA 1NAL1 2I14A 1ZFJA 2J6XA 2D73A 1YADA 4GUJA 3KVLA 3TAKA 3W85A 4MFEA 4D2JA 4LWWA 1EWEA 2RDUA 5LNWA 3B0VC 3G1XA 2CZDA 1KM0A 4HKPA 1TQJA 2J9XA 2DZWA 4IPJA 8TIMA 3DKJA 3L65A 4PC8A 5IBXA 5FEXA 2R8WA 1VCFA 3EWXA 4JTLA 1AL7A 1EUNA 3LCLA 1W54A 4JD4A 1N55A 1JUBA 3EXTA 5D32A 3W71A 5D09A 4N2YA 1EIXA 3MYPA 2LLEA 3L0KA 2HS8A 1ICSA 1F74A 3LLDA 1PHQA 3ZWSA 4DO4A 5L9FA 2Y89A 1ME7A 3WK3A 1H61A 1TTPA 3I7SA 4UTMA 5F4XA 1TRIA 3TDFA 1V5XA 1SSDA 1IXPA 3WJXA 3I68A 3B0PA 3O05A 1ZNNA 3LTSA 4R33A 4J9JA 3F4WA 3LCFA 3L5AA 4KKXA 3BG3A 4MZYA 2C15A 1G7UA 3NQ7A 3QPYA 3MBFA 1RR2A 3PWAA 4X2RA 5FESA 1FWSA 3TXZA 4OV4A 4ZQNA 5FEPA 1VR6A 4O54A 3GZ3A 4N9EA 4N9DA 2E09A 4MIMA 1W0MA 2QCNA 4C1KA 3PM6A 3KOFA 3C8FA 1RQEA 2VXNA 2NLIA 2ZRUA 2A1YA 2VEKA 3VE9A 4LVBA 1KFCA 3P5YA 1F05A 3IIVA 1SFJA 3CU2A 5HINA 1GZGA 3S5YA 3R2GA 4UFIA 5HWMA 5LNSA 1QPRA 1H1YA 3NVTA 1AMKA 3O6DA 4L4MA 2NX1A 4CCDA 3KVMA 3LBMA 1TO3A 3IVSA 3E49A 1A5SA 2ZRYA 5K4ZA 4FNSA 5LZLA 1H63A 5AHIA 1TPH1 1FWTA 1QNVA 3LV6A 2ZTJA 4NNBA 3N19B 4OT7A 3RFAA 4DO6A 4UTTA 3G8RA 5SWUA 1OJXA 1YTEA 2ALDA 4O14A 2KZHA 1SR9A 1GVSA 3OHIA 5CZTA 1ZY9A 3SIZA 5F1VA 1XC4A 5D2XA 4JNMA 3N2XA 5EBUA 1FXPA 1IXOA 2V8ZA 2YX0A 1SO4A 1TPDA 2A4AA 1QO2A 4FO4A 5E0KA 2QR6A 3CHVA 3LV5A 5TIMA 1F73A 2ZCGA 4WUIA 1E51A 1OFEA 3WK2A 1KBIA 4UFKA 1VQTA 3KXQA 3W2JA 3AO0A 3CTLA 1F6PA 5C5YA 3CT7A 4MZ1A 3ATZA 5BW6A 3BV4A 3UZJA 3BW3A 2OZ0A 3IIXA 4O17A 3IGXA 4BI5A 4Z08A 2Y7EA 5KITA 3LRMA 1KBJA 1OYBA 5HULA 1EP2A 4ZZ9A 1N8FA 3CLMA 4QM1A 1Z41A 1YXCA 2X1SA 4A3UA 3TFCA 1H62A 1JRBA 1MSSA 3F03K 2AQWA 2B7QA 1WX0A 2FB3A 4C1LA 4FXSA 3DFTA 3M5YA 1EX5A 4IMFA 3O07A 1HUVA 1UBSA 1FDZA 3P80A 1LTDA 2NV2A 3LI1A 2J9ZA 3NM1A 3R13A 4IUOA 4LT9A 1Y0EA 2OT0A 2C13A 5K9CA 4LVGA 2P0OA 3GK0A 2Z2UA 2Y6ZA 1EB3A 3W7JA 1G4TA 3DGRA 1DJQA 3G18A 3OVPA 3M44A 1ML1A 5FF7A 1CI1A 3TMLA 3SSJA 4LTSA 2YZRA 2YFOA 5IBXC 1F7BA 1QDSA 2NWSA 3G22A 4IWWA 5EL1A 1JRCA 3UWVA 1AL8A 5KTLA 1VYRA 3G0XA 3ATYA 1I4NA 4NXKA 3YPIA 1GYNA 3CPRA 1LDCA 3CWNA 3EX3A 4UMBA 2CZ5A 5CPMA 4WY0A 4IMEA 1VZWA 2FQIA 4JS3A 1OVDA 3L5LA 1H7OA 5K4XA 5TBOA 4H6KA 1JCNA 3QMRA 4UFHA 2JKEA 4YMZA 1YDVA 2EKCA 4HSNA 3OBKA 3EX4A 3W76A 3BG5A 1H50A 3C2RA 3QC3A 4JX6A 3W2NA 4UXDA 3CEPA 5HR6A 4LC8A 4GXMA 3W7MA 2ZZ2A 4L4LA 2A2IA 3CC1A 2XN0A 1TPUA 1TTQA 1KM1A 4ADUA 4XZ9A 4MFDA 5T26A 3L66A 5DXXA 3IIPA 4XKYA 4MYAA 1UUMA 1Z48A 1H51A 3W7HA 2ZA1A 4NX0A 1F6KA 2C1HA 2CLHA 2CZEA 4H4IA 4O8RA 2NV1A 4MLRA 1XBXA 1UJPA 3QEZA 4UMCA 2C16A 2X1RA 4E0CA 1ME8A 1K02A 2V9DA 3HF3A 1JQXA 2R14A 4FNRA 1B4KA 1AK5A 3G0SA 4FIQA 5D37A 2V82A 1Q6QA 4K6AA 3HG2A 2R91A 1YTKA 4MOZA 5BOOA 2YSWA 2QAPA 2BWGA 2ZZ4A 4N02A 2JKPA 1FWRA 4IQLA 4OQVA 2J27A 3UPWA 3BG9A 3D0CA 1WBJA 4IJBA 3EWUA 5HUPA 4UTIA 3N34A 1ZAJA 5DLCA 3W7OA 3QH2A 4O15A 3UWYA 3NZ1A 1W5MA 3G24A 2X1UA 1OK4A 3NL6A 1J5TA 3FKRA 4AF0A 3B03A 2Z0IA 3WK0A 3VNDA 3OEXA 3PAJA 2J24A 1WDWA 1TPWA 4RXFA 1KFBA 1G4SA 2G5WA 3PBYA 3M16A 4NJKA 3S6DA 3Q58A 4TMBA 3WFAA 2CLMA 4UTTC 1X8FA 5A8GA 5F1UA 3HGJA 3IVTA 4K36A 2VEPA 4ORMA 1MEIA 1ADOA 2RDTA 2YYUA 1KFJA 3G1VA 3ANYA 3ZR4A 1ZCOA 3WJWA 1FCVA 1VC4A 4ZL1A 1OFOA 1M7PA 2DORA 2BZNA 4JTJA 4DF2A 4JY9A 3LXBA 4GRSA 2QCHA 5EMUA 5GVJA 3LRLA 5CPLA 2WSRA 1L2UA 4CNOA 3W7DA 2ZBTA 4ADTA 1EPXA 1TTIA 2XN1A 3MYOA 4PFMA 1K8YA 2CLKA 1FDJA 3EKZA 3FFSA 5AHFA 4ZQMA 3N2MA 3UWZA 4HNVA 3H55A 3OVRA 2JKAA 4CNNA 1D3GA 3TCEA 1G7VA 3O6YX 1KV8A 3R89A 3MI2A 1K03A 1AW2A 1SQ7A 4P2VA 4Y9AA 3IRDA 1QOQA 3UWWA 1JQVA 1TPB1 1LCOA 4UTHA 4WX2A 4I9AA 2VEMA 3PG9A 2X30A 1UUOA 3C56A 2ZQ0A 2VC6A 2HSAA 2EGZA 3SJ3A 3DU0A 4O53A 4FX6M 4RCXA 3I7RA 1DORA 5K7JA 3PBUA 3ZFHA 3BW2A 2BX7A 3CM4A 4LU0A 3TC7A 3TSBA 2PRMA 5BNKA 4AWTA 3O8AA 3G1AA 5I3GA 3M5VA 1CX9A 5CKSA 1H5YA 3W2KA 3GR7A 3FKKA 5EYWA 5HUOA 3W2LA 1P0KA 3QM3A 1QOPA 2FTPA 4HHPA 4IX0A 3DZ1A 3UYCA 3W1AA 4CCEA 3WJSA 4CQ8A 4FNPA 2XFWA 4K37A 5HNRA 3T40A 2E5BA 1F2JA 5I3HA 1VS1A 3W7QA 3TFXA 1WXJA 2BXVA 3A22A 3GAKA 5HQEA 5F2IA 3PSVA 1R2TA 2QUTA 5D05A 3B0UX 4HNTA 1TJPA 1H7WA 3R8RA 1OFPA 1VYPX 2GJNA 1X1OA 3EX6A 5D2TA 1SW7A 3UXDA 4YCPA 2A0NA 3DH7A 1VGAA 2GVGA 4UFMA 1A5AA 2DZUA 1XKYA 2H6RA 1KLZA 1R30A 3LHZA 3S8HA 2WSQA 4I7UA 5H2ZA 3S5ZA 4BR1A 3WK1A 3RLVA 1Z42A 4O52A 4QIUA 2TPSA 3TJXA 3MWAA 3HG5A 1O95A 3JS3A 1I2RA 3T7VA 5BMXA 1TV7A 3MBDA 4DF0A 3PC0A 3R5EA 2VFIA 3EWBX 4CNPA 3W84A 2AGKA 3A21A 1XUUA 3A24A 3PS7A 1PVNA 4CQ9A 1SO5A 5K9XA 1EUAA 1VPXA 4LV4A 3G3MA 1VJIA 3IIOA 1ALDA 1KTBA 4O1CA 3EWYA 5DY3A 4BF9A 2CLLA 5FF4A 2R94A 4AHOA 5G4EA 1DVJA 1RQHA 4JTTA 5EPDA 3A23A 3NAVA 3E02A 3S42A 1BWLA 4MPQA 2A7RA 3P67A 2G95A 4QQ3A 2DZXA 3W87A 2J9YA 5EA9A 2DU2A 3TKFA 3NQFA 5CZSA 4R34A 3P61A 3N73A 3EKLA 5BMWA 4R53A 4JYFA 5D04C 2JGQA 1G4EA 4UTUA 1LZOA 1L6WA 1YPFA 1DHPA 2Y63A 1NSJA 2O7QA 3NYZA 3F4NA 3BLIA 2Y88A 4GBUA 1TPVA 2A7PA 1WOBA 2CFFA 2FFCA 1LLZA 3FOKA 4TIMA 2E6DA 3HIJA 1LLWA 4OE7A 5AN7A 3EXRA 1VHCA 1KFEA 2NWRA 2YW3A 3DHFA 2PC4A 4B5NA 5LNUA 3LHTA 1O60A 3QFEA 4RR4A 3NM3A 1LROA 4PL1A 1DBTA 4QJ1A 2QJHA 3ABOA 4OWGA 1SO6A 2ZRWA 4NZFA 3MP5A 4LOCA 1LOLA 3W70A 1AG1O 4CCCA 4O57A 3VI2A 5L6UA 3W23A 2B0MA 4JIPA 3GXTA 4FIRA 1KM3A 3LHYA 3KVKA 2E6YA 2Q3OA 3M43A 1QMLA 4ADSA 2BLEA 1P1XA 3FIGA 2QCLA 2WO5A 2YGYA 3TH6A 2DZTA 1LORA 3NO5A 3MP3A 2UV8G 4POCA 1SW0A 3HGSA 3CB8A 3P8JA 4IOTA 1XXXA 3W83A 3P82A 4RZ5A 1AW5A 2Y61A 1F5ZA 1D9EA 4NU7A 1ZAHA 1TRDA 3P74A 3W7KA 4QITA 5A5WA 2WKJA 1EP3A 3ABRA 1GTHA 3GYEA 1TPC1 2J88A 3B4UA 5FF2A 3NQ8A 4O1DA 3THQA 3T55A 3TXVA 5KINA 1TPEA 2QCCA 2NXIA 2WOQA 1H7NA 3FEMA 2GQ8A 2GJLA 1SZNA 2Q3RA 3JRKA 1WOAA 3HMJG 3G1HA 3PR2A 1MEHA 1IXQA 1OF6A 3O1NA 2QCDA 1WAUA 5EKYA 2G97A 5CZJA 3L67A 1EA0A 4Z1CA 3P84A 3I65A 1EEPA 1P0NA 1QFEA 5AHNA 4DXVA 2IQTA 2ZRXA 4RJEA 4WOQA 3M7WA 3NQCA 3MO7A 5F2GA 3A9IA 5DCDA 2Y70A 4I7VA 3LBCA 3GDLA 4MYXA 3W73A 2YCEA 4LUIA 3QJAA 4UR8A 1LRTA 4DBDA 3LERA 3PG8A 1RD5A 2GVJA 3FJ6A 4LUJA 4O50A 5HR7A 2E1DA 4FNTA 4QISA 4IGHA 5AC7A 2V2HA 3MHUA 2FPTA 4AF0B 2A85A 4Z0JA 1T99A 1ZAIA 3NQDA 5E93A 2Y7FA 4O10A 4U28A 1KFKA 4XWUA 4M6PA 2QCFA 1KM2A 3CIXA 4ICNA 2ZDRA 4IMCA 1H7XA 3U8GA 1RV8A 1QCWA 2FPVA 4QAIA 1PIIA 2B4GA 3W88A 4HSOA 4GUFA 1JCJA 3UXAA 2X2GA 2Z1BA 1I8JA 3O16A 2RH9A 3S1VA 3NGJA 3OA3A 1SPQA 3HGOA 3L0NA 1UASA 1ZJIA 4GE8A 4H3DA 2TRSA 2DZSA 5G5IA 4O4WA 4JXCA 3W22A 2YDAA 1LM1A 2PRHA 5D2YA 4X3ZA 1PL9A 1XFBA 5KZDA 4S2BA 1F76A 1JUEA 4NNAA 3NOEA 3NEVA 3DFSA 1RZMA 2YFNA 2NXHA 3GR8A 3PVFA 4Q32A 1VLWA 3IGUA 3BLFA 2TSYA 4I7WA 2OT1A 5D30A 1G4PA 1H1ZA 2B7NA 4WJEA 3BGGA 4OGZA 3IIZA 2F84A 4LRSA 3GB6A 4NX5A 1R47A 1JUKA 5FEZA 4DPPA 3S5NA 1A5CA 1IF2A 1PE1A 1GVOA 3NQGA 1KA9F 4EOUA 4GUHA 2ZA2A 2C3ZA 3TROA 4AWUA 3S1XA 2V5BA 5C54A 3SR7A 3S1UA 5C2XA 4AB4A 2VOMA 2Y7GA 2Y7DA 1X1ZA 2QKFA 3TNOA 1FCUA 3FLUA 4LS0A 1JCYA 2E6FA 3VFLA 1GT8A 1Q3NA 1JCMP 4PL2A 4JGDA 2E5CA 3QQ0A 3QSRA 4NVTA 3W1XA 4O0KA 1TB3A 1U5JA 2JK2A 4HN4A 3LLFA 1W1ZA 4NT0A 2QDHA 4MKNA 2EAWA 3PY2A 2DJXA 2Z6JA 4QSHA 1UCWA 2VKZG 5AYYA 1XUZA 4EF8A 3UNDA 1TMHA 3CEUA 3QMSA 3G3DA 3OVQA 1BKSA 3QRHA 4JTSA 3NPUA 3V75A 3UZ5A 3GNDA 3UY8A 1J4EA 1IGSA 2V30A 1LBMA 4G1KA 4KWVA 3RMJA 3B05A 3AJXA 4IXXA 4CQAA 4UTWA 1NF7A 4JEQA 1HFBA 4N4PA 1W3NA 3P81A 1W5QA 5CSSA 3KRSA 1OX4B 4ZQRA 5HWJA 3HJZA 3TK7A 1Q45A 1KFLA 5J5DA 3SW6A 2V81A 5AHMA 4BI6A 4MLJA 5CPOA 1L6YA 3Q94A 5HWNA 3NZRA 5AB3A 1T8XA 1GJPA 3LCGA 3O63A 1T96A 4IPIA 1BEUA 4FNQA 7TIMA 1TQXA 4NJIA 3BK0A 3C2OA 4O4VA 2OJPA 4UNLA 1MXSA 5AOUA 4EWND 2OCZA 1S3HA 4HIBA 5DCBA 4DBEA 5AHEA 4FX7A 5LHEA 1JCLA 1W31A 2HS6A 3LTPA 4KFNA 3PBVA 2ZRZA 3TQ0A 4LY8A 1FQ0A 3DI1A 1C29A 2QEZA 4HNNA 3EEGA 3IEBA 1M6JA 4S1FA 1LBLA 3FS2A 1W5NA 4KFPA 5FI8A 2A21A 1OK6A 3W2UA 3TJLA 3K30A 3LRKA 4ML9A 4GC4A 4LS2A 3QMTA 1GVFA 4DF1A 4AHQA 2VENA 1NVMA 4GNJA 3PF3A 4JDYA 2FLIA 4YXGA 3NR0A 1VYSX 5F2MA 1PS9A 1SZEA 3RF9A 3TMQA 1LP6A 4DELA 4OBTA 2YPIA 1TJRA 1ICPA 4OU1A 2YXGA 3GXNA 4N9CA 5LSMA 5D38A 1K3UA 2RFGA 4N6FA 3TW7A 2WSYA 3RNDA 1NFBA 4ALDA 1BTMA 3A5FA 3GIYA 1WBHA 2WNZA 3EB2A 4UMAA 1O5KA 5KSWA 4K7YA 5CGQA 4X22A 4XBSA 1C8VA 1T0OA 3C2VA 1PCWA 1UB3A 5FEWA 1DQWA 4O12A 3IGSA 2Y62A 1GG0A 3SY5A 3GKFA 3O06A 1YXDA 3LTYA 4Y90A 3L9CA 4K39A 4RZ6A 1OFQA 4IMDA 3WJZA 4EIVA 1GYLA 3FYOA 4YLWA 4JX4A 5CSRA 4W9TA 5KZMA 3NPVA 1VRDA 3GAYA 3KHJA 3W7CA 1THFD 4FHAA 1OX5A 1RQBA 4M5PA 3T44A 2VELA 3GNNA 2PRLA 3NQAA 2QCMA 1K8XA 2GVLA 4AVFA 3C0JA 4M7SA 3UWUA 2ZRVA 3GDMA 4HNUA 1YDNA 4AXKA 3BPWA 1C9DA 2CLFA 4PTNA 3U2OA 4FXRA 1FCBA 4RLIA 4ZMGA 3G8EA 5I3JA 4UFJA 4MJZA 1PCKA 5LGZA 1IIGA 2CLIA 4TMCA 5U4NA 4WXZA 1GQNA 2FJKA 4N6EA 1W56A 2NX9A 5I3FA 1OF8A 1OYCA 2V2CA
chains in the Genus database with same CATH superfamily
1QO5A 3SUTA 1FH9A 5ABHA 1QPOA 4DVOA 5F4WA 1VH7A 3STGA 3MP4A 3Q4DA 2WC4A 3GX9A 3OG3A 1TIMA 1EL3A 3EDEA 3ELFA 1GK8A 3VK5A 1RCXB 3ARRA 2XHYA 3CXOA 3EBVA 3JZEA 1W91A 3DKLA 3WJYA 3PTQA 3STEA 4IIDA 4IGNA 3UF9A 4O18A 4D9PA 8XIAA 3AQUA 1EWDA 4KFOA 4NKCA 3I10A 1W1VA 1ONRA 4LYQA 1E43A 2E6AA 2Z27A 1PPIA 2YLLA 2EJAA 3A5VA 3AIWA 3MSDA 2ISSA 2W27A 4DI8A 3E5BA 3P7YA 3JVAA 1DP0A 4Z0SA 1XIEA 5K2ZA 1CB2A 1X8CA 3TTSA 2FPYA 2INFA 2ZZ6A 3B04A 3BO9A 2HK1A 4L6OA 2XH7A 1XS2A 5AC6A 3IJ6A 4MY8A 2ZZ7A 3KAOA 3RX4A 2A7NA 4PCFA 1BG4A 1S1RA 3K13A 1JGIA 3WELA 3LOTA 4A8NA 2X0SA 1B54A 3H4WA 4MSSA 3NXFA 1XYZA 4RX0A 2W3ZA 3CS2A 1TA3A 3SZ8A 1Q65A 2I5IA 2I9EA 3WUBA 3MSYA 4UTLA 1J0HA 4G7EB 4M1RA 2F61A 1CTNA 3QTGA 1W3TA 1XD0A 3KX6A 2W0UA 1L8NA 2EPOA 4XVDA 5DMLA 1UD8A 4FSAA 5JH2A 2H8ZA 3ZVHA 4PEKA 4JR5A 3L7RA 2P3EA 4ZO6A 5I6SA 4ICMA 3W72A 1Q4WA 1S5TA 4XTDA 4ZO9A 4WY0B 1TE1A 5C2CA 1CB7B 2ZUUA 4Y6GA 2XGIA 1GW1A 3MMWA 1RJQA 1WKEA 4C5YA 4GJIA 4GFIA 4YVXA 3GS6A 1DIOA 3M1ZA 3PPFA 4JYDA 2PP1A 2W5FA 2XVNA 1XBZA 2DH2A 2ABAA 2NUXA 3I6EA 1FTXA 3QR3A 3TIMA 1SZGA 1LWIA 5FL0A 3FA5A 3U4AA 2BNJA 5DELA 2B7OA 3VKAA 5DY2A 1R7OA 1PDZA 1PHWA 4IIBA 1I0DA 4YNGA 5FJOA 4WSJA 2WMHA 3W6LA 1V3KA 3L21A 3S83A 3MMTA 2ZA3A 3VKKA 4W7WA 1TV5A 3Q67A 1D3HA 2TODA 1AJ0A 2PP0A 2YYTA 1L2QA 2XGBA 3QTPA 1Z3NA 5HQLA 1M5WA 4JTEA 3RJYA 1P6BA 1UWUA 4QJ4B 1C8QA 1IZKA 4IQDA 3BTNA 3MDUA 3EPNA 3UY7A 3VNMA 1W1TA 2E68A 3CL6A 1QNPA 3ECQA 1PKMA 4QDWA 3VX1A 3GO2A 3W7NA 4HGXA 3SUWA 2FDMA 4O0QA 3E12A 4QNWA 3BXWA 3A4WA 2CKSA 1N82A 2GFTA 2BY0A 3TV8A 2P10A 1TPFA 3MJYA 2NX3A 2WJZA 4IXHA 4AY7A 3G0UA 3M0VA 1QNSA 1ZSXA 4FEZA 3G1YA 3VIFA 3WD1A 5HOSA 4NI8A 1XV8A 3BW4A 5LNVA 1JVNA 4REQA 1L6SA 3GC2A 2VZVA 4NNCA 2ZUSA 2PDXA 4XUGA 1BSLA 5A8OA 3FJ4A 2CW6A 1E70M 4B5XA 3W7GA 1KW1A 3P5ZA 3DAQA 1OFDA 3EWDA 3PJUA 3TR9A 3M0IA 3G1RA 5AVHA 2XG9A 1S3TC 3W1NA 2ABBA 3MA8A 4AWSA 3LI0A 1XQLA 2IPFA 3NTYA 4X63A 1SJBA 4LCSA 2GPTA 3CZJA 2QPSA 4PBGA 3AWNA 3BAYA 1W1YA 3DESA 4J3UA 2X1IA 4GABA 5CC6A 1D3CA 4LS1A 3IARA 2BOGX 3QPZA 2ZX7A 4AMAA 4H04A 2J77A 3H54A 1XR2A 3O2LA 4WDWA 2ISWA 3UQNA 4IH3A 2IKJA 3H53A 3W07A 2GJRA 3L0GA 4QXIA 1JR1A 3GHUA 2PLCA 3TX9A 4MUPA 1ZP4A 4JTHA 1LBFA 2WV8A 3TN4A 2E5DA 3NL3A 4I9MA 4L6HA 2ZYFA 2C6QA 4WSKA 2W67A 3QLLA 1E6ZA 5T9CE 3N15A 3V1HA 4GUIA 4K8HA 3TU9A 2J66A 2BMBA 4K8EA 4LAMA 4QHRA 1HJXA 3MHFA 4HA0A 6TIMA 3USBA 3E2QA 1JYNA 2G41A 4HPXA 3ZR5A 4KESA 5ABTA 1JZ7A 2ZTKA 3W3OA 4MJ4A 3CPUA 4BFAA 3QQ1A 3DERA 4QDMA 2H3BA 2J4GA 1ITXA 3GG1A 1IXNA 2OR2A 5DANA 1Z9AA 1E4IA 4DYEA 4HPGA 1XDLA 1E6QM 1EA9C 4AIEA 5I79A 4HMDA 4B9ZA 4IL2A 1W3LA 5HANA 2X05A 4DQWA 3CUZA 1ZJHA 4M51A 2OEMA 1XG3A 5HMSA 1WPCA 3LXAA 1SVDA 1WYIA 1XBVA 1K9FA 4BWLC 4JX5A 5CPNA 3ZIZA 1ADSA 4UNKA 2P8BA 1LQ0A 5BU9A 3INPA 1US0A 4A29A 3CUHA 4QLJA 2CITA 3HTWA 3BJSA 5DBTA 2OOFA 3APGA 3WL1A 5G2IA 3DENA 3ZSTA 2GWGA 3SADA 5DN1A 3M0ZA 3DYPA 2CWNA 3W86A 4QG8A 3NPWA 4KRTA 2P88A 2FVMA 1QRQA 3TC6A 3W1RA 1EZ2A 3ARXA 2VEFA 3B8DA 4TUFA 4HTBA 3ERPA 4V2XA 2PF0A 3ABZA 3SGUA 1CEOA 4H9UA 4UFLA 4JYEA 5M3WA 5IOBA 2CETA 1UWQA 1IT0A 3SCSA 2EBNA 3CNYA 4RW5A 2A6NA 1W5OA 4JTFA 1QWGA 1YDOA 2C71A 2H3DA 3CAQA 4G5DA 4FLSA 1S5NA 1B5TA 1XDMA 3W1TA 1S5MA 2IKHA 1J6OA 1PX3A 1Q63A 2GDQA 2PDQA 2ZE3A 5JH1A 3PPGA 2F9RA 3W7EA 1MMFA 5HAOA 2ZUNA 4E8GA 3W1LA 2DZVA 1AJZA 2FGLA 2JGYA 1XIHA 4L1GA 3GDRA 2PU1A 2VDIA 2WVUA 5F4SA 1E6NA 3W7RA 5D2WA 2X2YA 3VKJA 1S39A 2F7FA 2QJGA 2ZFAA 1VKFA 4MTVA 1CXIA 3BV7A 2G37A 3OODA 1MO0A 2C79A 4XZMX 4YWIA 2VVNA 1CXHA 1VCVA 5T8GA 4Z2GA 3RCNA 3UG5A 2W6RA 4M6UA 4JAWA 5FF0A 1U5HA 4XSMA 3N14A 4LQ1A 1EO5A 3BAWA 1QI3A 4GZIA 4E38A 3H4GA 1J18A 3OJGA 3HO8A 4YWSA 4HCLA 4BCEA 1OFAA 2QV4A 3W82A 2NZLA 4H01A 3C2EA 2QDGA 3S5OA 4B5SA 2PI6A 3VGHA 4UOQA 1S1PA 5I2UA 1CGWA 1UZDA 4JDBA 4MVAA 3FN9A 3NQ6A 3FV9A 1NQ6A 1LT8A 6ALDA 3UCQA 3HPXA 1AH3A 1XPGA 2HXUA 3NQMA 1HL2A 4FB7A 4PFHA 3UEQA 2YDQA 3K46A 5A95A 2HPIA 4JZ5A 1EX1A 2JIEA 3D6NA 4MADA 4ZQCA 2VFHA 2QF7A 2VL4A 3VAVA 2DW7A 3A12A 3QHMA 3E74A 2FDSA 1H7RA 1H2JA 5KZ6A 3W74A 4MUZA 5LNRA 1V7YA 1SU5A 6TAAA 1FBAA 4NF7A 3MHGA 2VEIA 5GJPA 2ACSA 4WGXA 1GKQA 1WKFA 1WAWA 2OEKA 2EG6A 4WKAA 2BVDA 4FALA 4HN8A 2YCLA 3N4EA 5C9ZA 1VRXA 4D2JA 4Z2LA 1EWEA 3SEPA 2XIMA 2Z24A 1YQ2A 2CZDA 3G1XA 4ZA0A 3WLPA 2J9XA 2DZWA 1OM0A 3L65A 4GCAA 3G5EA 1XCWA 4HTYA 2GLKA 4Q7IA 7ENLA 1EUNA 3AZSA 1ITQA 5D9OA 1NP2A 5I06A 1FKWA 5CXPA 1R86A 5D32A 2GVEA 5D09A 3MYPA 3QZAA 3AIUA 3GTXA 3GC4A 1RA5A 5IFTA 2Y89A 1ME7A 3DN5A 3GG0A 3WK3A 4H6EA 1TTPA 1VFLA 4EWJA 1NFGA 4XV0A 3ZT5A 2O0TA 1J0IA 5GPRA 5C7HA 5F4XA 4TTGA 2HE8A 3T4WA 4W84A 1JZ3A 2J47A 5IDZA 1HKVA 3V35A 2F6KA 3O05A 4RDYA 3WFLA 3N1AA 4F4RA 3F4WA 3A47A 3H21A 4QTGA 2E0PA 1GYMA 3PWAA 3WQGA 1H49A 3SO7A 3AYTA 4N7QA 4WGHA 1KRAC 3B8SA 4O54A 4N9EA 4GQBA 5A2AA 1K9DA 4QE4A 1KXQA 3NO1A 4HK5A 1W0MA 5M2FX 7CGTA 2E67A 4B3ZA 2GUBA 4IFRA 4LVBA 4IL0A 4Q8PA 4PTVA 1DE5A 3P5YA 4CVWA 1F05A 4HK7A 2DIJA 3CU2A 4CEXC 1GZGA 1R3SA 4DNHA 2ZXAA 1W3JA 3ZYZA 3A9BA 1QPRA 1YNPA 3WQCA 1AMKA 2NX1A 3GH5A 3RCMA 1BRLA 1TO3A 3CZKA 4GIAA 3E49A 2VX7A 5BXRA 3N19B 4OT7A 5SWUA 3URQA 2VDHA 4J3TA 3E2RA 4ZENA 4TXEA 4CD6A 1XC4A 4JNMA 3N2XA 1CLXA 1Y8BA 1IXOA 1TPDA 1F3EA 4H8NA 1F3WA 3S4TA 4JTAA 1F73A 1E6SM 3W6MA 2OX4A 3WK2A 4UFKA 1VQTA 3W4RA 3KL3A 3AO0A 2VYOA 4BZYA 1F6PA 2B81A 1K6WA 1W32A 3CQHA 5BW6A 2OZ0A 4O17A 3WH7A 3QBUA 1VFMA 4BI5A 4LSBA 4F79A 3GXIA 3VZZA 1OYBA 4DBUA 3NZPA 3TYBA 3QHNA 1YXCA 3LN3A 1MUMA 4A3UA 3TFCA 1MSSA 3CUGA 2XM1A 1I0BA 2G8ZA 4C1LA 3SQLA 4NP7A 3M5YA 1VJZA 3R43A 3O07A 3UETA 4GY1A 3P80A 2J9ZA 1E0TA 1Y0EA 4ZODA 2OT0A 3TOYA 3FA4A 3CYJA 4LVGA 5K9CA 3GK0A 1UR4A 1IEQA 2WMKA 2BODX 1BXNA 2YZRA 5IBXC 3MCNA 2CERA 5B7YA 3W01A 3G6LA 2CIPA 4GQGA 3UWVA 2HDJA 1FFQA 4BA0A 3ATYA 2INEA 2O9PA 4UMBA 1H41A 1KKRA 3V7PA 4HOWA 4C6LA 4JS3A 4F2UA 1REQB 3N13A 5K4XA 1YPXA 1TCMA 4GQQA 4OVXA 2XM2A 2OGJA 2WLYA 2ZC8A 1PAMA 1RALA 4DJFD 3OBKA 1AFSA 3EOLA 1CGXA 3CMJA 2BGNE 3E0LA 5GJMA 1TJ2A 1E6PA 4GIRA 4D1JA 2AL2A 4HYVA 1MI3A 3PZQA 1W6TA 4XZ9A 5T26A 2HISA 3L66A 1ZJAA 3E2SA 1CXKA 4NX0A 3B9EA 1F6KA 3A64A 3XIMA 3FVMA 5CEWA 1XBXA 3TN5A 3GE7A 2C16A 3QOMA 3ARQA 4AD4A 4E0CA 1ME8A 4IM4A 4MGGA 5I78A 1B4KA 1KGUA 4DJED 4ECLA 4YTUA 2V82A 5FJTA 5BOOA 2YSWA 2QAPA 5KEZA 1QNQA 2ZZ4A 4ERIA 2JKPA 4IQLA 5REQB 3APTA 3LYEA 1O1HA 4PMRA 4G7FA 5LA2A 3ONCA 1PBGA 5I5RA 4X2PA 4PMJA 4O15A 3NZ1A 3G24A 1OK4A 1J5TA 3FKRA 4AF0A 5ABEA 3WK0A 5TF0A 1C7SA 1CXFA 2J24A 1RK6A 1TPWA 1KFBA 4S3FA 1US3A 3B9DA 1UR9A 4LJ3A 4ICCX 3HGJA 4K36A 1FWBC 4QJ5B 2NVAA 5LA1A 1ADOA 5LIWX 2R1MA 2YYUA 1V3IA 2ZX9A 3ANYA 3QR0A 1WUEA 3DUGA 1M7PA 4PCNA 2IPJA 2REQB 4JY9A 3DECA 4KCUA 4CD7A 2QCHA 2CKRA 2OZ8A 3LRLA 5CPLA 3WENA 4E3VA 3VKDA 1U2YA 1L2UA 3W7DA 2ZBTA 3MYOA 1FDJA 3EKZA 4XUYA 4IFOA 3WX7A 1SR0A 4ZQMA 1TZ9A 3N2MA 5DRIA 3UWZA 4HNVA 4YS1A 1F61A 2JKAA 4CNNA 3FGCA 3WLOA 3KUMA 4MWAA 1E3ZA 4IMAA 1K03A 1SQ7A 4P2VA 3UWWA 4F8XA 1JQVA 3IJ9A 1KCZA 1TPB1 3KTCA 3WMSA 1LCOA 1GHRA 4WX2A 3S2NA 3I3DA 1OSEA 3C56A 3W38A 2HSAA 3WDRA 3SJ3A 4ZFMA 4GY7A 4C7DA 2O9TA 3I7RA 3F5JA 4Q6JA 3PBUA 5HK4A 3CM4A 4ZB2A 1UJQA 3TSBA 1NM9A 1OCJA 2EPNA 3W24A 3RO8A 2PTXA 5CKSA 4C6DA 3FKKA 3W2LA 1HL8A 4JHOA 1TMLA 3BSMA 4IX0A 3DZ1A 4GOAA 2JF7A 3L2LA 1OGGA 1R9XA 4K37A 5HNRA 2ZE0A 3E2VA 3CIVA 1VS1A 3W7QA 2ZIDA 1WXJA 3N6QA 4W8LA 5HQEA 5F2IA 5D05A 3VDCA 4HNTA 3MV01 3AZRA 3EOOA 1DTUA 3R8HA 1UA7A 2GJNA 1X1OA 5D2TA 1SW7A 3UXDA 4YCPA 1Y65A 3OZYA 1VGAA 1R3VA 2H6RA 1Z6KA 2I17A 4FLOA 3D3AA 2XIOA 3RM4A 1XDJA 1Z42A 4AG0A 4HZ6A 4N0RA 3BSHA 4B91A 3VGDA 3W26A 3T7VA 1TV7A 1U5VA 1WKYA 3PC0A 4Q8NA 1BTCA 3OVGA 4M82A 4H7CA 2PDHA 3P2VA 5AECA 3DHPA 1Q2RA 1SO5A 4MNJA 3ZJ8A 4J35A 2V5CA 1NWSA 3IIOA 3GH4A 3TYUA 1ONWA 2BOEX 5TAOA 2E9MA 1RQHA 4FS9A 3SM0A 3A23A 3NAVA 3S42A 4FMVA 4PMVA 4LB4A 3F5KA 3KCLA 3L12A 3NQFA 2DDXA 2OKOA 3N73A 3VIPA 1IT7A 1WP6A 2HNEA 1MWOA 5D04C 4UTUA 1G4EA 5CGTA 5CLTA 3GG7A 4X60A 2QJJA 3UXKA 1V6TA 2VO5A 4PMXA 2A7PA 2J7FA 2FFCA 4IF2A 1K1DA 4X0NA 3NUKA 3HIJA 1MXGA 3RM8A 3DHFA 2PC4A 3OZMA 2DFAA 1KGXA 4AW7A 3QFEA 4AD1A 3TJIA 4V33A 3NM3A 1YRRA 3QY7A 1E1FA 1SO6A 5D4YA 2AKMA 2WHMA 3PHAA 1AG1O 4CCCA 1CBGA 4F3HA 2B0MA 4JIPA 4B4HA 4FIRA 2WBGA 2Q3OA 1QMLA 1MZRA 2AAAA 2BLEA 1P1XA 2WO5A 1IWBA 4DXKA 2DZTA 4RPPA 2VC5A 4LBUA 1NOWA 3NO5A 3SUSA 3HGSA 4IOTA 1VFSA 3P82A 3OZPA 2Y61A 3V18A 4OKDA 3W7KA 3MMUA 3VDGA 1E5JA 4V27A 1GTHA 3AHYA 3B4UA 5FF2A 1YW1A 3NQ8A 4O1DA 5KINA 2PF8A 2WOQA 1H7NA 3UU0A 2G4JA 3VOJA 3HM7A 3AIQA 1OF6A 3A4XA 3BC9A 1A0CA 1WAUA 5CZJA 3MKVA 4Z1CA 4IHCA 3P84A 1PUDA 1FWEC 1TKKA 4L1XA 1L0PA 4BQ5A 3C2YA 3MO7A 4QG6A 2OODA 1GJUA 2BP1A 2Y70A 4I8YA 1GQKA 2CYGA 1XRSA 3LBCA 4MG4A 1P0BA 3SDOA 2Z4GA 2E25A 4B90A 4DBDA 1ODZA 1KCLA 3LERA 2C91A 3SCUA 1RD5A 4HU4A 4FNTA 4A3QA 5AC7A 2V2HA 4NL1A 1UPMB 3M0XA 3V36A 2Y5EA 4Z0JA 2Y24A 1A5UA 4QE1A 1ZAIA 3NQDA 1K9TA 4O10A 3TONA 4DJFC 4QEEA 2QCFA 4ICNA 2ZDRA 4IMCA 3U8GA 5CBJA 4UR9A 1RV8A 1XIIA 2FPVA 5J8LA 1ZLPA 1PIIA 4IISA 1PIGA 2WVSA 3UXAA 1PYMA 4FPSA 2Z1BA 2FTWA 3NGJA 1ZJIA 1ONXA 2GGHA 4L61A 2VC7A 4H3DA 4C6NA 4O4WA 1PIFA 3SIMA 9RUBA 1JPIA 4NNAA 4M80A 3NEVA 4DJEC 2F38A 4G7EA 3GR8A 5IDIA 1ECEA 2TSYA 4I7WA 3T42A 4NRRA 2J75A 5ABGA 2WANA 5I02A 3BGGA 4JNZA 4FOJA 3V5CA 3GB6A 1R47A 5FEZA 2Q01A 4DPPA 1M7XA 3ANVA 1ECQA 4AEEA 3KBMA 1GVOA 1PWLA 2VUYA 1E3XA 1HJUA 2EEXA 3Q45A 2VX6A 2W9MA 5C54A 3APYA 1KRCC 2HPMA 2X09A 3LPFA 2VOMA 4AB4A 2Y7GA 1GOQA 4HYWA 2QKFA 1XRTA 4LS0A 1NDYA 4YTQA 4W8AA 3MC5A 4OUIA 1Q3NA 4PL2A 1WZKA 5IHRA 3BAIA 3TA9A 3W1XA 4O0KA 1U5JA 1JF6A 1R3RA 3QGVA 4E6MA 2RGLA 3QV7A 1H4PA 2EAWA 2EPMX 5EFDA 2Z25A 4QSHA 1AA1B 2WC7A 5RUBA 3UNDA 3QMSA 4NSBA 1T7LA 1UR0A 1B3YA 3QRHA 4XZLX 4PUDA 1X7IA 4UOZA 1VEPA 3B05A 5EBAA 1NF7A 4S3JA 3P81A 1TUXA 5CSSA 3AS0A 4GGBA 3LUTA 1K4HA 3TK7A 1BQGA 3G2GA 4XK2A 4ZE5A 5JMUA 5AHMA 4BI6A 4IPNB 5HNUA 3GBDA 2RJGA 3CT2A 1GZJA 4JTDA 1T8XA 1EPVA 4AZBA 3T9PA 4ZB5A 7TIMA 1TQXA 1SZRA 1Z8AA 3DC8A 3UR2A 5DT7A 3ES7A 2OJPA 4UNLA 4GYPC 1PTDA 1BGGA 4R7WA 1S3HA 2J8GA 2PA6A 4IPPA 4DZHA 5DMYA 4FX7A 1JCLA 4LBRA 1O5QA 2ZRZA 3PAOA 3EEGA 1M6JA 4S1FA 5BYWA 1XICA 4H8UA 1R8LA 3LPOA 3O0KA 3VNLA 3W2UA 1KCXA 3K30A 3LRKA 4GC4A 4LS2A 3UJEA 3U57A 3OLEA 1UH2A 5A69A 1QNRA 2SFPA 4GNJA 1QW9A 3KOWA 1LQAA 4MAZA 1V0LA 5F2MA 2YL8A 2NT1A 3TMQA 1Q85A 3BMWA 4OBTA 1ICPA 2WPGA 4OOUA 4GI8A 1AZ2A 2D22A 2WLZA 5D38A 4IFKB 1TWSA 3LEPA 2VGIA 1GKPA 2PDNA 1WE5A 1NFBA 1DJYA 3GIYA 3NIYA 2WNZA 2F2KA 4Q4RA 1O5KA 1U33A 4GD0A 5CGQA 4RW3A 4Y7EA 3TWAA 4XBSA 4QS5A 1ISZA 1RAKA 5A6KA 1G94A 1LL4A 3GXDA 4PTWA 1MW2A 3PTDA 3D3FA 2DZAA 5FEWA 1XF0A 1EBHA 3GKFA 4MMWA 4LAZA 4Y90A 2PPGA 2WZTA 1JEZA 1G1YA 4DJDA 3WJZA 1Q5MA 2WJDA 2PDKA 4LXFA 3FYOA 2XWDA 4W9TA 4CCZA 3PTMA 1JZ6A 3VX0A 3OTRA 3H2CA 4M5PA 3T44A 1Q4NX 2WWDA 2GVLA 1YBQB 3MO4A 1A5MC 3GDMA 2BVWA 4Q8OA 2OB3A 3BPWA 1C9DA 3GVQA 4BHYA 4FXRA 4DB7A 1FCBA 3G8EA 2GUYA 3AXXA 1AJ2A 3UJFA 1XINA 3ZQ9A 1V4YA 2AKZA 5CAKA 4WXZA 4N6EA 1LG2A 1W56A 2PDYA 1AZ1A 1MQRA 2NX9A 1OF8A 4TVUA 4P8UA 3SCRA 3ZOAA 4RNHA 2PE4A 3LNPA 1H11A 3QOKA 4C6QA 2I56A 4HU8A 3GIQA 1XCXA 3BARA 3FJLA 3LX9A 3KDOA 2PB1A 4MJ2A 2GSHA 3QZ6A 5HA7A 2PODA 2X16A 3L68A 3IANA 3VABA 3LHUA 1J10A 3ZJ7A 1Q6LA 1ZBKA 3HB9A 1DTNA 4M6VA 3I7QA 8CGTA 1FHUA 2HQAA 2Y1HA 1O94A 4UCGA 3BCFA 4GINA 3VM5A 1DHKA 1US2A 3S0CA 3EXSA 1V6WA 4IX2A 2E40A 4OBSA 3BAJA 1WCGA 2Y5JA 5G4WA 4K7VA 2J7HA 3QW4B 3MKKA 4KH2A 2BBFA 4QLLA 4WZHA 2VOTA 2QVNA 3QF0A 2RGMA 3R4IA 2UBPC 1DXIA 4Z1BA 4NY2A 2V5JA 2WPBA 4Q4KA 2DZPA 4E2DA 3TSMA 3KZSA 3R8GA 1FXQA 1TX0A 3WN6A 1O4UA 3BJFA 3PBWA 3PB2A 4S2CA 3DX5A 4O16A 1W2VA 4O19A 3CO8A 2VWSA 3GG8A 2NW0A 5LIXX 2Z28A 4ATDA 5AZ1A 1VIZA 3ZLFA 5CJ5A 3AI0A 2J7CA 3GQYA 3R12A 2VR5A 4C6JA 1DIDA 4IQJA 1ELSA 2OPJA 1XL9A 1HF6A 2YOCA 5CZ0A 5FSDC 3SI9A 3M0MA 1R3YA 3R0DA 3LDVA 1BFNA 1Y5WA 3TW6A 3RU8X 1E6RA 3KVJA 1I75A 4FOKA 2ZXQA 3CL7A 5BWAA 4IMGA 2Q8LA 1KXTA 4XQ6A 2ATSA 4I5RA 3WBYA 3WF3A 1OWQA 3LA4A 3ARVA 2XH4A 2V5LA 3C3UA 1ADDA 1VFHA 5D9NA 4NQ1A 2HTMA 2TMDA 3WQFA 4NI3A 3CWOX 4J3VA 2WQPA 5A2CA 4Y2WA 2V2DA 4XKYB 1IYXA 4IP5A 4F2BA 4C7GA 3VINA 4IIHA 1JFHA 1VEMA 3W2MA 4BF5A 3RDKA 2V3FA 5DXYA 4GKTA 4PE8A 2P8CA 2G4FA 3N3TA 1G6CA 2PGEA 4PTXA 1NWTA 3H7VA 4LGXA 4TR9A 4O11A 1PB0A 3ANUA 2ISVA 2PEVA 3SCNA 4ZTYA 3W7IA 1F4AA 3A6OA 1UH3A 4KW2A 3VNJA 5EMMA 5IM51 2QDDA 1OC7A 4FLQA 1I2QA 3LM7A 1Y5VA 4NIRA 2O9RA 2XZ9A 4RL3A 2CHRA 5BXPA 3DFOA 1YKWA 1NJJA 3RAOA 1VBHA 5AYBA 2W62A 2V63A 3TYAA 1ZP3A 4V1XA 3ZS4A 2YR1A 3SSZA 4NXSA 4HHLA 4S3BA 3WUFA 4Z1AA 4MDPA 1BXBA 2FFIA 2W63A 2A79A 3O6CA 1O7AA 4W5ZA 3S9YA 3GNPA 3VNKA 2VEGA 3GFXA 3N6HA 4MY1A 3MW7A 4UZUA 1XLLA 2E7FA 2A6LA 3UD6A 4B92A 2ACRA 3IJIA 3GKAA 3MSRA 1QAPA 1OFRA 2BY3A 1FOBA 3VFCA 1YTDA 2YDSA 4MJMA 4AY8A 3EWZA 2VFGA 3HBLA 4M56A 2OZTA 3U2ZA 3W9ZA 1A4MA 3SUUA 4DO5A 1B1YA 2GYIA 4ZCWA 4EXAA 1I2NA 3O15A 4GKLA 3LQGA 4DUVA 1T40A 4DWSA 2D0HA 1CXLA 4MM1A 4TQTA 3WO8A 3PFMA 1X98A 5HQMA 5K3VA 4U4MA 3GWQA 1H3GA 2J79A 4PUUA 2XIJA 4PYSA 1M3UA 3LMZA 2QAFA 4JIHA 5C0QA 3AYSA 2PWUA 1UH4A 2W4XA 3OO2A 4HMCA 3THAA 3VTRA 3HPSA 1MXDA 3C61A 3ABQA 1C7TA 4MPKA 5BZAA 4XO6A 2RDWA 3HQNA 4LC6A 5AYXA 3I6TA 5BRBA 2I1OA 1LRQA 4R7JA 1PZ2A 3LB0A 3ITOA 6REQB 4FOUA 2OX1A 3BMXA 1Q6RA 1LG1A 2CPUA 4Z2JA 4DI9A 4ZOEA 3UG4A 3S1GA 2PAJA 4QG9A 1VB9A 4JKLA 5BXTA 2VQTA 4UNIA 1GEQA 2YCJA 3VILA 3H4XA 3GXMA 1E9YB 3M5ZA 3KRZA 1Q7ZA 2XSAA 1WXZA 3WQEA 3D46A 3E0IA 3PNZA 3UBPC 4A2SA 1RXOB 3PZMA 2I7GA 3RLHA 3DHDA 2V3DA 4ZXOA 3ZJKA 1JG9A 4Y8EA 3HQ1A 4NJHA 3DFQA 3KDNA 3VE7A 1UD6A 5DEZA 3WDJA 1J0YA 1QI0A 2B7PA 1EJVC 3L5MA 2VR2A 5KZEA 2VURA 3DBPA 1JNEA 3DG3A 3PZIA 4JN6A 4Q3MA 1KTCA 3SECA 1LOQA 1ODUA 3PUDA 1Q66A 3POHA 3OPSA 3P8IA 4UC5A 4RNIA 5DBUA 3ARZA 5A6BD 3N2BA 2PMQA 3W1UA 4F48A 1L6GA 4AZCA 4AIBA 4LV9A 3OBAA 3NL5A 3MUZ1 2HK0A 4G56A 2VFFA 4TX9A 4ACZB 3LS9A 3PB0A 3BLPX 1QOXA 2FKPA 3FYPA 4UIOA 3MI6A 5I07A 4MWAE 4Y9MA 1M01A 4BEQA 4J3ZA 5E5CA 5LKYA 2XJ7A 1K7EA 1DL3A 1JYVA 5A2BA 1ZALA 1OCQA 3RK8A 3P3BA 5EGRA 1KGWA 2HCVA 1T6MA 4LNYA 3WF4A 1HO4A 5PTDA 1HKKA 1OQFA 3C2FA 4FR1A 3BZJA 3LCHA 4GC3A 3KRUA 3ZXWA 3BVJA 4U33A 3QN3A 2ZC1A 5JBFA 1WQ5A 2PFHA 1M03A 2BVYA 4EF9A 2UY4A 5D02A 1DWAM 1U30A 4AZGA 1TVLA 1XLHA 5D9MA 4JFUA 4F9JA 5FOOA 5A3HA 2DGAA 2XUCA 5KETA 3GLCA 1DWGM 3NQBA 4GX9A 3E9AA 1YX1A 3RHGA 4WD0A 4HPJA 3DFNA 3BLEA 1QR7A 1REQA 1WDDA 2XZ7A 4AVNA 2DP3A 3EA1A 4HMNA 1W3IA 3WZ0E 3KL5A 2V68A 5DQPA 2VGFA 3AYRA 4XB3A 4L9YA 3V5FA 2IXUA 4AMCA 4AHPA 2IUZA 3GTIA 1XGEA 2XGZA 3IUHA 4UQ9A 1JJKA 1I1WA 3CO4A 4LNCA 4GMEA 2QV5A 7REQA 3NQVA 4P8XA 1M41A 4DX3A 2HRWA 2OTDA 3BZGA 4PH6A 2HVMA 3SUVA 1HN1A 4WQ6A 4GUGA 2OOGA 2X1TA 4QSFA 5FJIA 1J0KA 2HV5A 4AD0A 2VCCA 1ZU8A 2FIQA 2ATMA 4CU8A 4H19A 4PB5A 1OG6A 3SN0A 5AFDA 2WMIB 4O1EA 4L9XA 1XG4A 1OYAA 1B4EA 3WBEA 3VXGA 3ZWTA 4UOJA 5DMMA 1JIBA 3T08A 4WOZA 1J5SA 3NG3A 1IR2A 4BK9A 2H9AA 3I6RA 5G2HA 2EHHA 3CYVA 1TVPA 1XX1A 3BLOA 2P50A 1UD5A 3BGAA 2V5DA 8A3HA 3LCXA 2QXWA 2YB4A 8XIMA 1Y5XA 3EMCA 1ITCA 4K8GA 4DWSD 3C4UA 3S2CA 4L4PA 1HTIA 4LX4A 3A4JA 1B3VA 4WJ8A 2GJPA 1FFRA 2I14A 2DIEA 1YADA 5LIYX 3LPPA 3TAKA 3ZSSA 4L1WA 5LNWA 3TW9A 3HV8A 1KKOA 1J96A 2IPWA 4IPJA 2HWGA 4LBSA 2GGIA 1RBAA 3OZOA 3N2TA 3HPAA 5FEXA 2R8WA 1AL7A 1ZBCA 1N55A 3EXTA 3W71A 1FWCC 4PBEA 1EIXA 2RDXA 4Y9OA 5LXXA 5M5DA 4JOMA 3TJ4A 2HS8A 4FP1A 5LXEA 3ZWSA 3OYZA 1H61A 3I7SA 4NAEB 4E8DA 3EOUA 2FMNA 3WMLA 1TRIA 2WJEA 1QTWA 3AYVA 1V5XA 1SSDA 3KW3A 4F0LA 4QLKA 4GYKA 3SAZA 2E9BA 3WY1A 4QBXA 3UXIA 4FI4A 3ARTA 3BOFA 3LTSA 1ONEA 4P7LA 4J9JA 4R33A 1TWWA 1J93A 2WCSA 3CL8A 4ZTXA 3OLIA 1RR2A 4C6CA 2PLMA 4U3AA 4F0HA 4PUKA 3MANA 4OV4A 2D2OA 3WCZA 3VUPA 1KD0A 3UNTA 4MIMA 1UKSA 3LY0A 3LM3A 2CBVA 3WD2A 1FWHC 3C8FA 4HP5A 2VXNA 1TUFA 2CEQA 2ZRUA 2WVTA 2A1YA 2VEKA 4K68A 3VE9A 4Q8UA 4Y9PA 2GDVA 2QVHA 3IIVA 3R7MA 5GNXA 5HINA 2W66A 1OINA 3WD3A 3BLLA 1H1YA 1NP0A 4L4MA 3BCDA 3B9NA 2OKTA 4YTRA 1JL8A 3L4XA 1A5SA 3OB8A 2XPKA 5LZLA 1TPH1 1FWTA 3LV6A 1MFVA 1S2UA 3KBJA 1JGMA 3G8RA 1YTEA 2DPEA 1ESWA 2F2HA 2ON3A 2KZHA 1ZCCA 1UKPA 1JYWA 1RJRA 2HNHA 5MF5A 2RUSA 3AC0A 4NZ5A 3PNUA 3KM8A 1QO2A 4IPLA 5E0KA 3LV5A 1J0JA 4A3HA 1AH0A 5A6MA 3KOYA 2ZCGA 1OFEA 1KBIA 2P53A 1E1CB 3W2JA 4URIA 1RUSA 3ZR6A 1OADA 3CT7A 3WLKX 3FA3A 3ATZA 3M7SA 3UZJA 1GJWA 3QR1A 2Z1VA 4WDTA 5I24A 2V6AA 4GLEA 2Y7EA 5DFAA 1QATA 4ZZ9A 2QPUA 2P76A 3LNMA 4PCTA 1N8FA 3CLMA 3AIVA 3AICA 4QM1A 1Z41A 3R11A 4GQRA 4MAVA 4ES4A 1H62A 1JRBA 2D0FA 2VZOA 3FAWA 2WHJA 3MWCA 4I5XA 5EMYA 3F03K 2AQWA 4X61A 4LCRA 1S46A 1IEIA 3WNNA 2OFJA 1XLGA 3UZYA 1FDZA 3VD7A 1V08A 3PN8A 3LI1A 1ISWA 3NM1A 3R13A 4BS0A 4IUOA 1EJTC 3KLLA 1GVIA 1FWGC 1UZ1A 4MHBA 1X38A 2Y6ZA 1EB3A 3W7JA 1EH9A 1DJQA 1FHLA 3AIRA 4HJWA 1QK0A 3OGRA 4MKSA 3M44A 1ML1A 3TMLA 3SSJA 1FHDA 3T0TA 1QDSA 4IWWA 1XYAA 5EL1A 1JRCA 5XINA 4O1FA 1VYRA 4XD3A 3CHFA 3ITYA 4I9TA 2VD9A 3EX3A 1UQZA 3GHSA 4RDZA 1VZWA 5JXQA 3TEVA 3AUOA 1OVDA 3L5LA 1H7OA 1EQPA 4I90A 4QE5A 4H6KA 4UFHA 2JKEA 4YMZA 2EKCA 1WO2A 4HSNA 1XLFA 1PTAA 3OP2A 3C2RA 1D7FA 3SB0A 5HR6A 4LC8A 4GXMA 2A2IA 3T1GA 4F0SA 2WW5A 2BB0A 4AYSA 3RRXA 2CXGA 1E4MM 3IIPA 1C8XA 4MYAA 2J74A 1LWHA 4WF7A 4AYGA 2PCEA 1RP9A 4H00A 2C1HA 2CZEA 4ZOCA 1MDRA 4O8RA 4MLRA 4MNMA 5HNNA 5M1TA 3HF3A 3GTNA 2GJXB 2R14A 5CJNA 3CV6A 3R1ZA 1NQKA 4FIQA 5D37A 3DHUA 1S2WA 1E5NA 5CG0A 4K6AA 4YN5A 1YTKA 3GFZA 2BWGA 8RUCA 4A35A 4N02A 1FWRA 1HKWA 4DYJA 2J27A 2DSUA 2X8RA 3D0CA 3EWUA 3UT0A 5LA0A 4UTIA 1FWIC 4BQ2A 3NL6A 1FWJC 3R79A 2DSVA 1XP3A 3CLWA 2WWCA 1WZAA 1CIUA 2G5WA 1J0ZA 3WF1A 1P48A 5G4HC 3MKCA 3Q58A 4AWEA 3WFAA 1WUFA 4HYRA 1EC8A 4UTTC 1ZGDA 4H41A 1UC4A 5F1UA 3WLNA 3IVTA 2VEPA 1R85A 3U0HA 2PDLA 2ONEA 3MQTA 1FH7A 1KFJA 1M9HA 5H8UA 1FCVA 1HXJA 5CPTA 2C8NA 3AMLA 4GO9A 5I03A 2DORA 2BZNA 3CZGA 4AZ6A 3FHAA 2G3IA 1V6VA 3VOHA 3MVIA 5EMUA 5GVJA 3N11A 2WSRA 4CNOA 2PDFA 1PZ0A 3FDKA 4ADTA 3NXLA 1EPXA 1TTIA 2XN1A 1NWUA 4PRRA 4D1IA 3TYCA 1J6PA 3NSMA 4X9YA 5LYRA 3N18A 1E72M 1T41A 1FWAC 3N04A 4QGCA 4XAPA 4XAFA 1D3GA 3PZOA 4XG1A 3H2AA 3VGFA 1R9YA 5E0CA 2DIKA 2PU0A 4PGLA 3IRDA 3BLDA 1JPMA 4JTQA 3LZ3A 1M68A 3WF0A 2NV9A 3BCJA 2VEMA 3PG9A 4ACYA 3ZVHB 2VC6A 3WIJA 1SJDA 2IKIA 1J12A 3DU0A 2CHOA 3PJXA 4PUJA 3H7UA 3ZFHA 2Z2AA 2BX7A 3PPHA 4W5UA 2DUXA 3TC7A 2YBVA 3WYZA 4P5UA 5BNKA 4XBJA 1D8CA 3O8AA 4Q4MA 5I3GA 1PWMA 3M5VA 3W37A 1H5YA 2AMXA 4YU1A 2VQUA 2ESCA 4A3RA 4OBRA 1AD1A 4B4FA 3NURA 3UYCA 4CCEA 3EB3A 3PBMA 2XFWA 3T40A 2E5BA 3TWBA 1DWHM 1F2JA 3TFXA 2G3FA 3A22A 2HE5A 2PWGA 3GAKA 4JN7A 4DZ5A 3PSVA 2QUTA 4XZBA 3B0UX 5ABFA 2VTFA 4DXXA 4Z2KA 3LSBA 3QFWA 1H7WA 3EAUA 2A0NA 4UFMA 2GVGA 3M64A 3LHZA 3JU2A 4WSHA 1UKTA 5H2ZA 4D6CA 3WK1A 4C6MA 3CZLA 3S2JA 2TPSA 3LENA 1RLDA 3VMNA 1I2RA 3FHQA 2VP8A 1SM9A 4DYKA 2VFIA 3WH8A 4CNPA 3W84A 3U4FA 3UVAA 2XDFA 1XUUA 3A24A 1PVNA 5K9XA 1VPXA 2CCRA 3K8LA 3GC5A 3H70A 3TLLA 1ALDA 2PDPA 4O1CA 5JIWA 4BF9A 2CLLA 2O4MA 2OLHA 5D9PA 5FF4A 2R94A 4AHOA 5EPDA 1MNSA 3AIBA 1RVKA 1U1JA 2A7RA 4US5D 4QQ3A 4B2DD 2DU2A 4J2PA 3TKFA 3EKLA 4REQB 3WBXA 4I6KA 5FJRA 4H6QA 1DHPA 1NSJA 2O7QA 3NYZA 2Y88A 4A05A 4GBUA 4D6JA 1LLZA 1F9CA 3ITLA 4OE7A 4U3CA 3CUIA 4GK8A 5A94A 2YW3A 4B5NA 5A6LA 3LHTA 1O60A 1K77A 5CZKA 1UP3A 4RR4A 1LROA 3B97A 4UQAA 4YIWA 4OECA 2QDEA 1XYBA 2ZRWA 4GA8A 4NZFA 3MP5A 4LOCA 1XRVA 4M0XA 1FA2A 3N9KA 2F8QA 1AMYA 3DFYA 1OT2A 3LHYA 3KVKA 4O8AA 1S38A 1DXEA 4PRWA 2OQLA 3FIGA 1O12A 3MB9A 2GVYA 1LORA 2UV8G 3KOXA 4HB7A 1SW0A 3H2OA 1XXXA 2Q8XA 3M46A 1ZAHA 2WYSA 3WH6A 4E4PA 5A5WA 2WKJA 2VUNA 4XD6A 1EP3A 1UR2A 3ABRA 4AFYA 1F3XA 1A5LC 5ECUA 1ZPTA 4IJCA 4M24A 3TN6A 3THQA 3GRIA 4PUEA 3WDHA 4QP0A 3UR8A 2YCKX 1MYRA 3FEMA 3IAPA 2Q3RA 2JALA 3JRKA 1KQYA 3DGBA 3PR2A 1MEHA 3GVWA 2J7BA 1FVPA 4JEJA 2G97A 2A3CA 3KHDA 3TQPA 3L67A 1EA0A 2EG8A 4GYJA 3MPGA 4CN1A 2IQTA 4DZIA 1CNVA 3A9IA 3ARPA 3RUBL 3GDLA 5IXEA 5A8MA 3BQ6A 3QHOA 2YCEA 3GVRA 3ZMRA 1BHGA 4LUIA 4INFA 4UR8A 1UPPA 3ITXA 4A8RA 4LUJA 3AUJA 2E1DA 4EE9A 1RJPA 3AS3A 2WNWA 3GU9A 3NJ3A 3FSUA 2IKGA 5E93A 4U28A 1R6WA 3QV9A 4A8LA 1M7JA 3IAQA 1O68A 4ZSUA 1QCWA 4LEQA 1IEVA 3HQPA 2B4GA 3EMQA 4FXJA 4HSOA 4XSLA 2VNCA 2QYGA 3RR4A 4U2ZA 1XH0A 3O16A 2RH9A 3OA3A 3HGOA 4GNVA 3L0NA 4RE2A 3EDFA 2TRSA 2VRJA 4QAWA 3W22A 1Q13A 4X3ZA 1PL9A 1JPDX 1XFBA 4H9VA 2FZ8A 1QHPA 1JUEA 2AGTA 3OW1A 3LMYA 4JFWA 1TFVA 3II1A 3WDPP 4PMOA 4S3KA 2EKGA 2OT1A 5D30A 2QIIA 4FZIA 1BVZA 3QV8A 4OGZA 5CBIA 3IIZA 2F84A 2WVVA 2XSXA 4MB5A 1PE1A 3CUFA 3NQGA 4NYYA 3MY9A 2YZ5A 4AWUA 1EJWC 2FZDA 3S1UA 2VI0A 3VC6A 5C2XA 1IZCA 1ZS2A 2WC3A 3FLUA 1JCYA 1LL7A 2E6FA 1IR1A 2XFFA 1JCMP 2QGYA 4F0KA 4JGDA 2PLKA 3QQ0A 3QSRA 4NVTA 4D6GA 1B90A 4HN4A 3RN6A 3MCOA 1W1ZA 3H6OA 4NT0A 3WFZA 4DIAA 4MKNA 4I8DA 4C6EA 2DJXA 3PFRA 1UCWA 3DCPA 5AYYA 1JPHA 4EF8A 4S3AA 1E56A 3G3DA 1BKSA 3R58A 4JTSA 3ALGA 3GNDA 5BCAA 5B7ZA 3I3EA 3EWCA 2V30A 1NY1A 4JL2A 4G1KA 1CPUA 4KWVA 3RMJA 2NQZA 1IHIA 3BSGA 4IXXA 4CQAA 4IIGA 3CK5A 2DSZA 4EPKA 1OGBA 5CBBA 1W1PA 3KTSA 1QI5A 3NGFA 4N4PA 1HFBA 4DWDA 1W3NA 4ATWA 5E9XA 4ZQRA 1TV2A 1F6YA 5HWJA 4D6HA 5EMJA 2HZGA 4C91A 5J5DA 1XYCA 2WMJA 2HVOA 5CPOA 3WLQA 1L6YA 4R3UA 4L64A 5CAHA 3M0LA 5HWNA 4PSPA 3LCGA 3KWXA 2CESA 3UGRA 4IPIA 2QJNA 1F07A 1BEUA 4NJIA 4P7NA 3VKCA 2QUMA 3E0WA 2EPKX 4J5NA 2XIIA 2IQ0A 1MXSA 3WUEA 4EWND 4HIBA 4DBEA 4RDWA 5AHEA 1OZMA 4DUWA 1W31A 3LTPA 3TQ0A 1W3KA 1XC6A 3AU2A 3DI1A 1DIKA 3VNYA 2YCLB 4HNNA 4B16A 1LBLA 2A21A 2YBUA 3IACA 3T0AA 3P0WA 1OK6A 1K4GA 1A0EA 1UBPC 4L7ZA 3W27A 1TJ0A 4JDYA 3WLHA 5I23A 5MKGA 4QS6A 3NR0A 4KQNA 5AC4A 1VYSX 4EPBC 3IUDA 1SZEA 2YPIA 2CHNA 3GXNA 3F5LA 2G50A 1H1NA 1XW8A 1K3UA 2EXOA 3L4UA 2PDMA 2DUZA 1WDPA 4ROQA 4AXNA 1I9CB 3A5FA 3TTEA 1P7TB 1JDFA 1EZWA 2NQJA 1NDWA 5EB8A 1T0OA 3C2VA 2YCIX 1UB3A 1UG6A 1SJCA 5FAGA 1GG0A 1RH9A 3SY5A 1YXDA 3O06A 4JQ4A 3LTYA 4ZOAA 6REQA 4I9JA 3L9CA 1OFQA 3IPWA 3H23A 2QLYA 4EIVA 3UESA 5FJUA 1A3XA 5KZMA 1VRDA 1E9ZB 3VZYA 7PTDA 5A6AA 1OX5A 3GNNA 4XAYA 5GQBA 3NQAA 1JDAA 4AVFA 4JBRA 4GGHA 4M7SA 4F2TA 4B5TA 4AXKA 3U2OA 3TZFA 3AAMA 1L8PA 4ZMGA 4UFJA 4MJZA 5LGZA 1V3JA 2J25A 1AQ0A 4LH8A 6ENLA 5HMFA 2QUNA 4TTUA 1OIFA 2OO0A 2POTA 3STPA 1BRLB 1B3ZA 2Z1WA 4QAIA 3IWPA 5T91A 1DV7A 1BWKA 3COTA 5C9WA 4KWOA 3UJSA 3E1F1 2ZDSA 1A80A 3DI0A 4NZJA 1EF2A 2B31A 4GBDA 4AEFA 1OD0A 4FX8A 3W1MA 2PWVA 5C8BB 3CMFA 2G3NA 5A8QA 2GSJA 3B06A 4JY8A 3HG4A 3QPEA 4MB4A 3GNRA 2AAMA 1R0MA 3VC5A 4UTWC 1YPIA 1VLIA 1DJGA 2CBIA 3EOSA 3QKEA 4NZ4A 2RHGA 5K9DA 1TWIA 4K1WA 3W7PA 3PWGA 2PDIA 1FH8A 4GVFA 4W4QA 3NNTA 7TAAA 1GWJA 1JXKA 1ME9A 5I0DA 2Z00A 4QNEA 3U6WA 3XINA 1SFLA 5E1QA 3N9RA 3OU8A 3LZ5A 2DY3A 2X0HA 1FWNA 1OABA 1SSGA 3IS4A 4KEUA 1WZMA 4RPQA 5C9RA 1C9WA 1E40A 1YMYA 3HG3A 1FY6A 4PA8A 3AZTA 1OFBA 1R87A 1RCOB 1CW2A 2PGRA 4Z1DA 2PSNA 3KBSA 2VRQA 1YYAA 2QNEA 3GDTA 3KRBA 1TV8A 1MW1A 4NAFB 4MNKA 5HMEA 3RPTA 3GXPA 3GTHA 4O0ZA 2CLEA 3VCRA 2PURA 1V8EA 4YHEA 3VNZA 1AUSL 2VZSA 3H24A 3N6JA 2PBGA 4AD3A 4DZAA 4QRNA 1UOZA 5JU6A 3SRDA 2PTDA 4TO8A 4UUIA 3DXIA 3ABSA 3V1PA 2C0AA 2PDBA 3KBVA 4O1BA 3F4CA 3K4WA 4QJ3B 3NYDA 1ZL1A 1WA3A 1QPNA 3ITGA 1XSJA 3W25A 5HDRA 1UROA 2JQXA 1E0UA 4DM2A 4ZVJA 1M04A 3GDKA 3NQEA 1XI3A 1G69A 4KRUA 2AL2B 1CDGA 4HD5A 5A1AA 4HZMA 2VT0A 3FEQA 2BOFX 3OOQA 2NQ5A 4BWLA 1PTGA 4CEUC 1L9WA 2V3GA 1UR1A 2WMIA 1BWVA 5BRQA 1ISVA 4YPJA 4AEOA 4C1NB 3AXKA 2DVTA 1JCTA 3G1SA 5AHLA 1CLVA 3TQKA 1A53A 4N9BA 3NL2A 1F4HA 3NPXA 5DX7A 4Q7BA 1JI1A 3BDKA 4HCHA 4OJYA 4HT3A 1G67A 1KQZA 1V03A 3QSTA 5F7UA 2TYSA 4LUTB 1OX6A 4PMZA 1I6NA 3C52A 3U5UA 4NJGA 4B5UA 1VF8A 1U1UA 1GNXA 1HO1A 2Y8UA 1GOMA 1IZJA 5FJJA 2X42A 2XYLA 2VDGA 1YLVA 3RXZA 2BGQA 4QCFA 4Y96A 1TVNA 1J11A 3PULA 5I7GA 3T0DA 3CWHA 2D2GA 4Z42C 1MQQA 3GVGA 1VPQA 1QUMA 3LCWA 2OU4A 1UUQA 1X1NA 1YXYA 3NDOA 4ORIA 3UA3A 1BAGA 1KBLA 3EPMA 1XHGA 3LCIA 1Q8AA 4FLRA 1TZZA 4ZB0A 1LOSA 1SUXA 4JHMA 1X97A 4US6A 4JIEA 3LXCA 2WNQA 4DEFA 3T8QA 4K1GA 3URAA 3GZAA 4K38A 3M6YA 1O66A 4NAEA 3FGCB 4WY0F 2DT1A 2WQDA 4MWAB 4PR4A 1X6NA 1V3LA 3A3HA 1KBBA 4M3PA 3M9YA 1GONA 1Z7AA 4W8BA 1KM4A 3C3NA 4FNUA 3TAOA 4ZQOA 2DQWA 1IT8A 4WLCA 4PCSA 2DJLA 4P7OA 3ZVIA 2VWTA 1KTNA 3MTWA 2OMAA 4K3ZA 4TX6A 1HKIA 2PTZA 4ERAA 1UZ4A 3UPBA 5LGXA 1XBYA 1W37A 5CH9A 3FSTA 1FWWA 3D47A 3KBNA 4L9ZA 5U7SA 1SYTA 1E55A 1KWGA 4CLMA 2W79A 4EX4A 4PUWA 3AIEA 2WNNA 4H9ZA 3TR2A 1QI2A 1L6FA 3E38A 5AY7A 5EMKA 4WKFA 3VKBA 2BSLA 4RV8A 2PCQA 2BXZA 4H7VA 4LRTA 3MMDA 4H7ZA 2DEPA 1VP5A 2P5NA 3U7BA 2HJPA 3F1QA 3MZ2A 2X41A 1MEWA 4O1AA 1P0DA 1HIZA 3T81A 3TUUA 3OLGA 1S5VA 4HNCA 1I2OA 3QY8A 4UQDA 3VM7A 5C6MA 5FF3A 1Z44A 4UTKA 3PP7A 4M6QA 3P62A 4PMYA 1XFCA 3OIXA 3T6CA 5LHFA 1JZ5A 1MW3A 3AU6A 1UWAA 3HGRA 4HA3A 1K7FA 3LHWA 1GOIA 2C18A 1RP8A 3LHVA 3CH0A 3SRHA 4RNJA 4H6RA 4YCOA 3IV3A 5J5RA 2ZZ1A 3URBA 4P7RA 2D20A 4A22A 3WLTA 4HPNA 2QT3A 4GNKB 4X9SA 1GKRA 3KS5A 2VFDA 4KWWA 7ODCA 4AH7A 4ZO8A 1BPLB 1RCQA 2ZX5A 5E9AA 2ZUWA 3TE9A 1GHSA 4KBXA 4ZEPA 1P5BA 3CHDA 4HOXA 3F4VA 1DKWA 2IW0A 5DMNA 3STFA 4M19A 3RLGA 1DE6A 2A3AA 4I6VA 4Q8TA 4IGMA 4JCMA 1SW3A 2VFEA 4PB4A 4TV5A 4CQCA 1JFXA 2WKGA 4HA1A 2WMFA 4JTKA 5BRPA 2HMCA 3LK6A 3B8WA 3SGZA 1B3OA 3VOCA 3E96A 3ZLGA 2QUVA 4L6DA 5AYZA 1FHVA 2FB2A 3NA8A 4RZ4A 5KMYA 4CU6A 1WKDA 3WLJA 3BL3A 4F0RA 3BGJA 2BHYA 4BEUA 1XIMA 3VZXA 2GSEA 4EXBA 1OG0A 1HJQA 1DWJM 3KL0A 1FUYA 1P4CA 4PTDA 2V67A 1FX6A 1RVGA 3AISA 1XWYA 4LPCA 1TZ7A 2RAGA 3RGTA 4U2YA 3PSWA 4DUXA 1BGAA 4KERA 3WQ5A 3VD9A 3N9SA 3QGAC 4ENLA 3B4YA 3RPDA 3WDQA 3UERA 3NDYA 5I3KA 1KM5A 5M03A 2XWEA 2Y85A 2VJXA 1IQ8A 4KEMA 3N29A 1JULA 4OOZA 4ROPA 4V1YA 3ALFA 3QKZA 4N4QA 3LU2A 1GOOA 4ASTA 2YXOA 5HPCA 4GWEA 3PUOA 2GGJA 4W7UA 2WAGA 3EX2A 3QGKC 1ICQA 4Y8FA 3BURA 1XJBA 4F9DA 1QWKA 3NSXA 1Q6OA 5CSYA 5G1TA 4D72A 1OX4A 2ZADA 1U22A 2PP3A 4KF1A 4CNSA 4MY9A 4LVAA 1NIUA 1GTEA 3UCCA 1GZ1A 4KCWA 2JE8A 1XQKA 5D2VA 4P61A 1TCDA 3LGGA 2ZVIA 3T78A 4GIYA 2BTMA 3ITTA 4AZIA 5CLWA 5TQLA 3CJPA 2PTWA 3WQDA 1N7KA 3EX1A 3B8UA 2H8XA 4DUOA 1QJWA 1TJ1A 2FH8A 3AMDA 1NAL1 2J6XA 2D73A 1EGMA 1DWFM 3KVLA 2UY5A 3AHTA 1MVYA 4IIEA 3CQIA 3EB4A 1VBRA 5EMLA 4MFEA 1TV4A 3UFYA 2RDUA 1QBBA 4CKQA 1MUCA 1KM0A 3A3WA 4HKPA 1H5VA 4GVGA 5CC3A 1TQJA 3DKJA 3F2BA 2VM8A 3SURA 3UJRA 5IBXA 2NQHA 1VCFA 3EWXA 4HSHA 3LCLA 4RZBA 2FZNA 3ARYA 3VMOA 1TWDA 4R85A 4N2YA 2FYMA 3PTKA 2LLEA 2QW5A 1ICSA 2CZVA 3CMGA 5CGMA 1F74A 3LBOA 3N25A 4DO4A 3W02A 1DWIM 4Q8MA 4UTMA 1C93A 3VA8A 4FXFA 2AQOA 2NQLA 2WSKA 2GK1A 1J8VA 1YNQA 1IXPA 3WJXA 1BVNP 4UQBA 4DLMA 3I68A 3B0PA 3S6TA 3W81A 3LCFA 3SY1A 4X0VA 3L5AA 4KKXA 3BG3A 2C15A 3QPYA 1LF1A 3NQ7A 3MBFA 1DYSA 2FZMA 3UP8A 4X2RA 5FESA 1E71M 3U3HA 3ABXA 3L4TA 5FEPA 3NCOA 1VR6A 1YEYA 1JZ2A 1UWTA 1H09A 4C65A 2E09A 1HGWA 2QCNA 4C1KA 3KOFA 1RQEA 1E0VA 2D3LA 2PDJA 3SN1A 4NZ1A 1KFCA 2ZX8A 4FF5A 3PBGA 2O4QA 3PZTA 4KIRA 1Z69A 3M4HA 1NU5A 5HWMA 2X0YA 3ZZ1A 3K5XA 3IJDA 3UG3A 3CAWA 3EMZA 1BYDA 1J79A 2VD8A 3LBMA 3IVSA 1Z32X 1CGTA 5K4ZA 4FNSA 3IJ7A 3VDAA 1QNVA 2ZTJA 3BQ5A 3RFAA 5C70A 4O14A 3WF2A 2QF8A 4D6FA 1CGVA 1SR9A 1GVSA 3OHIA 2FHCA 3SIZA 3RX3A 2WZHA 3T0CA 2XIQA 4KGLA 1FXPA 1LT7A 2V8ZA 2YX0A 1UKOA 1SO4A 2A4AA 2BHUA