5CPMA

Xena from pseudomonas putida in complex with nadph4.
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
359
structure length
359
Chain Sequence
SALFEPYTLKDVTLRNRIAIPPMCQYMAEDGLINDWHQVHYASMARGGAGLLVVEATAVAPEGRITPGCAGIWSDAHAQAFVPVVQAIKAAGSVPGIQIAHAGRKASANRPWEGDDHIGADDARGWETIAPSAIAFGAHLPNVPRAMTLDDIARVKQDFVDAARRARDAGFEWIELHFAHGYLGQSFFSEHSNKRTDAYGGSFDNRSRFLLETLAAVREVWPENLPLTARFGVLEYDGRDEQTLEESIELARRFKAGGLDLLSVSVGFTIPETNIPWGPAFMGPIAERVRREAKLPVTSAWGFGTPQLAEAALQANQLDLVSVGRAHLADPHWAYFAAKELGVEKASWTLPAPYAHWLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Better than Nature: Nicotinamide Biomimetics That Outperform Natural Coenzymes.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords Xenobiotic reductase
total genus 133
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5cpmA00
5J5RA 4UNKA 3HOJA 4TIMA 1MEWA 2ZRWA 1EUAA 5FF0A 5HNRA 4MUZA 3WJYA 1KFEA 2TSYA 1YXCA 1QNVA 4Y6GA 5DLCA 3E9AA 4JDYA 2YYUA 1TPWA 4MZYA 2B0MA 1VGAA 2LLEA 4DQWA 1JUBA 2ZZ3A 3S1VA 3EWBX 4ORIA 1QO2A 1W37A 4IMCA 5KTLA 5LSMA 1QFEA 1TB3A 1Z41A 4LY8A 4LS0A 1EP1A 2QCGA 3TSDA 5C5YA 1GPWA 5LGZA 3S1WA 1LRTA 2A5HA 4MFEA 1MXSA 4CLMA 2QCFA 4JICA 2QCNA 1NFBA 3TX9A 4JTJA 1GJPA 5D2WA 5A5WA 4JX5A 1G6CA 2BX7A 4RZ4A 1SO6A 3W22A 1SW3A 3TDFA 3BO9A 3TXVA 3UWWA 3BV4A 1TPDA 3W1LA 4Z1AA 1JCXA 4IXXA 4KFOA 4KWWA 4M7SA 5LNWA 4K8HA 1A53A 2FLIA 4LOCA 4HNNA 3W74A 3LCFA 3QC3A 4A21A 3W1RA 2P0OA 1ZAIA 3TC7A 2CZ5A 4XQ6A 2VFGA 3O6YX 2W79A 5AFDA 2B7QA 3N2MA 4LV4A 4FHAA 1OX5A 3W88A 1OFBA 1T8XA 2GUUA 4OBTA 3NYZA 4X9SA 1GVRA 4ADUA 1O4UA 2OT1A 1A5BA 2DZXA 2GJLA 5GVJA 3LLDA 3VCRA 4O13A 3IVTA 3NPWA 2FB2A 2WNNA 2DZWA 4GUGA 5DXXA 3GIYA 3S6DA 4K7YA 2XFWA 3IIVA 3LI1A 4O0ZA 3RK8A 1WOBA 2Y70A 2YX0A 2J88A 3O63A 4PEKA 5D37A 3W72A 1TV8A 3CQ0A 5T26A 3W85A 2DJXA 5F4SA 3PVFA 3PBVA 1N55A 3W71A 3W86A 4AMAA 3S9YA 4O15A 3FKKA 1TTQA 5FF4A 1YTDA 3CT7A 3NQAA 1LORA 4POCA 5CSSA 1MEHA 1FQ0A 3P67A 5EYWA 1W5NA 1KTBA 1I4NA 4DO5A 5AHLA 2R8WA 2ABAA 3LXCA 3LTYA 1KBJA 2ATSA 4UR7A 4N6EA 3W1NA 2ALDA 5KITA 2EPHA 5L9FA 5I3GA 1VCFA 3TFXA 2PCQA 1DBTA 2X1SA 2WJZA 3P60A 1VPXA 1I2NA 1GT8A 1CX9A 2ZZ6A 4I7WA 2HMCA 3NQFA 3W84A 3LERA 3QMRA 1XM3A 1F73A 3EXRA 2NV2A 3Q94A 1H1YA 4WZHA 1OFDA 3GYEA 2DP3A 1J2WA 1KTCA 3SSJA 3A5VA 1Q45A 1GQNA 4N9BA 3L2IA 5FEPA 4OV9A 4IJBA 3W1MA 1I2QA 3FJ6A 1I8JA 3ELFA 5HUPA 3OG3A 1GOXA 3BLFA 3LHVA 3DHFA 4QNWA 2V2DA 2JKAA 3VE7A 5HQEA 2ZBTA 3U6WA 2GQAA 3N73A 1ZJIA 3RMJA 3NQEA 3GVGA 3C2RA 1W5PA 2FTPA 4DF0A 2E5BA 2Y62A 3PWAA 1JQXA 2Q8LA 4KKXA 2YYTA 3UZ5A 2Y63A 1LLZA 3SJ3A 3NAVA 1DQWA 5DBUA 1IXPA 2V2HA 2CLHA 4YMZA 5F2MA 4JIPA 4K39A 3NQ2A 4Z1CA 2J27A 4WOQA 1RZMA 3GAKA 4UXDA 3GXPA 5CPOA 1HG3A 1VLWA 3QEZA 3M41A 5DCDA 4L4LA 4JYDA 3FS2A 1YDNA 5ABTA 2UV8G 4JTEA 4BI6A 3BK0A 1I2OA 2FPYA 3M0ZA 1OYAA 4RKAA 1XUZA 1H62A 5TIMA 1G4PA 1OFQA 1NAL1 5EPDA 2V81A 4PODA 1Q6OA 3NM1A 3ZR4A 5BMXA 3HPXA 2A6LA 1CW2A 3MP3A 3L0KA 3G1VA 1RQEA 4ZQMA 3NXFA 4HNUA 3QZEA 3S1UA 4ML9A 3O06A 3I65A 3L66A 1GVQA 2ZQ0A 4A3UA 3B0VC 3BW2A 4OT7A 3R5EA 4OV4A 1VYRA 1KA9F 4AWUA 2J6XA 4ONVA 1M7OA 4O0KA 4FNRA 4ZQPA 3TSBA 3W7KA 2QCLA 4RV8A 5U4NA 4OQVA 4IMDA 1KFLA 3DFSA 1EPXA 5CPNA 4DEFA 2H6RA 4UUIA 2Z6JA 3LTSA 2Y6ZA 4M6QA 3VI2A 3IIZA 4U4MA 1TSIA 4O14A 3H55A 5DY2A 2R94A 4ZQRA 4JX6A 4D2JA 3FA5A 4ZMGA 3MP5A 1FXPA 3N19B 3S8HA 5K9CA 4JTSA 4A2RA 1TRDA 4A22A 4AWSA 1SW0A 3GR8A 5D38A 5G2WA 3WJXA 2CZDA 4O12A 3R13A 2E6DA 4M19A 3UPWA 5AHEA 2ZZ1A 2I9EA 4N9CA 1LYXA 5D09A 5BW6A 3NOEA 3RFAA 3IV3A 3ATYA 2H3BA 1YADA 3W87A 3MI2A 2ZA2A 4LV9A 3P7YA 2Y7FA 3CWOX 4UFHA 4UFJA 3GKAA 4IX2A 4A2SA 4UC5A 1H50A 1SQ7A 1YPIA 1VHCA 2H90A 3IEBA 3I7SA 5HINA 1OG0A 3SIZA 5I3JA 1BWKA 4BWLC 4ZQOA 5KZDA 4M7TA 1VLIA 2Y7DA 3K30A 1Z44A 2QAPA 5I3HA 1DHPA 2I1OA 1JRCA 1YPFA 4AF0A 3M5YA 2XN0A 4YWIA 4AHOA 3R8RA 3PBYA 2QCCA 4MLRA 3M47A 1F6KA 3PUOA 1D3HA 2F84A 3QW4B 3KX6A 3DFNA 2QF7A 1W0MA 3NVTA 3QW3A 3T7VA 3PG9A 2ISVA 4MJMA 5DELA 1L6WA 3UY7A 3PM6A 2YCEA 4UTTC 3UZJA 1M5WA 1H5YA 5AN7A 2YDAA 1F5ZA 1W3IA 5G4WA 3MI3A 1TPVA 2P1FA 3DGRA 2R91A 3B03A 3I7QA 4MY1A 2CZEA 3BG5A 3FKRA 4HIBA 4DPQA 2A7NA 2NUWA 2A7PA 4OGZA 1F6PA 3NQGA 2GQ9A 4GXMA 4FB7A 3UXAA 3OVRA 3TW6A 2HS6A 2ZZ5A 3O8AA 4LC6A 4ALDA 3MMTA 4S2BA 2YFNA 4GUFA 7TIMA 4NX0A 4PCFA 4CNNA 3L21A 4XUGA 3GKFA 3M6YA 3N9RA 4BF9A 3R2GA 4UTHA 2X30A 2CLLA 3PBWA 4NJGA 3HIJA 3LRKA 1L6SA 3W7JA 4FNUA 4WJEA 4O54A 4PFMA 4FF7A 3B06A 4JN6A 5K7JA 3G1YA 1VHNA 1P5BA 3C2VA 4HHPA 5CSRA 2NUXA 3MWAA 3TAOA 3QMTA 2XN2A 1IXOA 1O5XA 2QCDA 3TIMA 5D05A 3P81A 5G1YA 4E2DA 5CZ0A 2BLEA 3P8IA 4B5NA 2KZHA 1LOSA 3M5VA 1FUYA 2G5WA 3LHZA 1KLYA 3NL2A 4FXSA 3BW4A 2FB3A 3UPBA 3MBFA 2ZCGA 1ZFJA 3W7DA 3GB6A 4I7VA 3G18A 5KZEA 5D33A 3H53A 3W75A 5E0KA 3GAYA 1TRIA 4O57A 3L5MA 3HBLA 1XBYA 4OHQA 3EXTA 3KAOA 3LBMA 3W76A 1TPB1 3TMQA 4AF0B 5DBTA 1NF7A 4EWND 3TFCA 2CLKA 2ZDRA 3U8GA 2C6QA 4O1CA 4MFDA 2G96A 3C8FA 4MZ8A 5HJLA 1OK4A 1N8FA 3PBUA 5D04C 3SR7A 1LBLA 3TROA 2V82A 3DH7A 5AYXA 3ZWSA 2YW3A 1IXQA 4QNEA 1GVFA 3TC6A 1H7RA 4NNAA 2Z6IA 3DI0A 3DFOA 3M43A 1P0NA 1FCQA 2CLOA 1H61A 3DFPA 3EWZA 3B8DA 4LRSA 3A23A 3UNDA 1VYPX 3TJXA 4XZ9A 1W8SA 1SZFA 3C61A 1TPEA 4JTTA 3L65A 4UTUA 3O1NA 1UJPA 4CCEA 2WSYA 3OA3A 1A5SA 1YTKA 4HSNA 2BWGA 3B05A 3W7GA 1O60A 3KXQA 3UYCA 3MYPA 1QCWA 4CNOA 1ICSA 1TYGA 3T40A 3E49A 5AHMA 5K3VA 3TH6A 1PHWA 1EWEA 4XBKA 3O07A 3G8RA 2C0AA 4DBDA 4R33A 1IIGA 1QPNA 4MYAA 3NPVA 4Q33A 2WSQA 3LCXA 4NUWA 4QIUA 3LHWA 4ZQNA 4NZJA 3W3OA 4UR8A 1LOLA 1B4KA 4FNTA 1JUKA 1SZEA 2FFCA 1GEQA 4AWTA 4NXKA 3CB8A 1OYCA 4WY0F 4FNQA 3L68A 1WXJA 1JJKA 4UMAA 4ORMA 5CKSA 2QKFA 4LVGA 1TO3A 5C2XA 5EA9A 5K4XA 4N4QA 1KFJA 3N3MA 4NJIA 2VEPA 1DKWA 1RV8A 1TJPA 3AO0A 5EL1A 1PL9A 1SR9A 2Y7EA 3DENA 4HPXA 4LU0A 1FWRA 2G97A 4FXRA 1ZNNA 3TR2A 3NM3A 1WX0A 2CFFA 2V8ZA 1WBHA 2FIQA 1ZAHA 3USBA 1A5AA 1OJXA 5EBUA 2JBMA 4BI7A 5LHEA 3IIPA 2VKZG 2TRSA 4FIQA 4KFPA 1JQVA 4MY9A 2WV8A 2XN1A 3N14A 1B9BA 3CEUA 1KM1A 5F2LA 2W6RA 1LRQA 1TQJA 1FCBA 3QFEA 5LNSA 1FXQA 1SFLA 5IBXA 3NZRA 2WNQA 1M7PA 3W6YA 4UTWC 3GLCA 5IBXC 3GR7A 3SGZA 4M6VA 1OFRA 4UIOA 1K7XA 1TPC1 2V0TA 5FESA 1XXXA 3IGSA 5FF2A 3SGUA 1PCKA 2QUUA 3DAQA 3F4NA 2O7QA 3G0SA 4UCGA 1QDSA 2YZRA 3W2MA 2RH9A 4IWWA 3QJAA 4UNLA 5AYYA 3FIGA 4JD4A 3C6CA 1K8ZA 1YXYA 4K38A 4JXCA 4IX0A 1MSSA 2FDSA 2E5DA 3EX4A 1T0OA 3UWQA 2JK2A 4KWVA 3LRLA 5E93A 3LRMA 5FEWA 4JDBA 3T55A 3ZS4A 1S5TA 3SZ8A 4DF2A 1GVOA 5D2TA 3C2EA 4X3ZA 2ZTJA 3C2FA 1PCWA 3EKZA 1LLWA 5H91A 2V5LA 3CIWA 4UFIA 4IUOA 1VJIA 1K7EA 3WFAA 2CLIA 3L5AA 1WV2A 3QQ1A 5EKYA 2F7FA 2VEIA 3E02A 1WA3A 1VRDA 3Q37A 5CZJA 3TAKA 1P0KA 4AEOA 3PUEA 1SPQA 4JYFA 3BARA 4M6PA 3M5XA 4X22A 1TPFA 2WO5A 3CWNA 1ICQA 3M9YA 2QR6A 4XTDA 3C0JA 1WYIA 4HPJA 4OE7A 2V30A 1VCVA 3WK2A 1PHQA 5G5IA 2DJLA 2QAFA 3JS3A 2VFIA 1ME7A 1G69A 5BMWA 1VS1A 1YTEA 3VKJA 1Q6LA 2DZTA 5KMYA 1SU5A 4N02A 1IGSA 5CG7A 1YLVA 2DU2A 5FI8A 2V5BA 3IVSA 3THQA 4FO4A 1NSJA 5I3KA 1JVNA 1F2JA 1QPQA 3LV6A 5L6UA 4ADSA 4NXSA 3U2OA 4Z08A 1GTHA 4Q32A 1FBAA 2OJPA 3P82A 1G67A 3UQNA 1MO0A 4RJEA 3FEMA 3W1QA 1SSDA 4CQAA 2BTMA 2GVJA 3SY5A 2ZRYA 1FWSA 4WOZA 1PV8A 4RZ5A 1HUVA 4O16A 1XCFA 1XBZA 2OCZA 1DVJA 4XTIA 3HJZA 4PC8A 3QYQA 1RQBA 3GDMA 3W73A 2YW4A 3P74A 3FYPA 1LM1A 3E12A 4DO6A 5HMSA 4TR9A 4UMCA 3NQVA 1K8XA 3W7MA 3P5ZA 1Q3NA 4JTUA 2Y88A 1YYAA 3W7EA 3MUXA 4EIVA 4L4MA 1OX6A 5C54A 2YR1A 3B0PA 4NZFA 4Y90A 3HGRA 3LXAA 3TMLA 3BG3A 4NVTA 4X2RA 4JTGA 2A7RA 1DJQA 1TV7A 5HUOA 2X1TA 4LNYA 5EY5A 2GPTA 3S5NA 2VFFA 4IMFA 1YDVA 2Y89A 4EF9A 3M44A 3SECA 3P5YA 4C1LA 2RDWA 1V7YA 3STFA 1RVGA 1OHLA 1D9EA 3DXIA 1XDLA 3MO7A 1M6JA 3MHGA 1SZGA 3G24A 4O53A 3ABOA 4O10A 4WD0A 4CNPA 3G1XA 1QPOA 1ZENA 3S0CA 4JTLA 2NX9A 5CPMA 5G2IA 3A22A 2ZYFA 1ZHAA 5AC8A 1W5MA 3CLMA 1ME9A 2VEMA 5KSWA 2V9DA 3STCA 3NA8A 3D0CA 4MKNA 1VQTA 4LVFA 1H51A 1BKSA 2Q3RA 3DHDA 3SI9A 1WAUA 3W7NA 1XDMA 3TQ0A 2A1YA 4FIRA 3QPZA 3GNDA 4R7JA 4AH7A 2QCEA 5HWJA 3PB2A 3W1TA 1IIHA 3EX1A 5J5DA 4M5PA 1TTJA 3HGJA 2IQTA 2H8XA 1X8FA 2RFGA 4IPJA 3HG5A 2V2CA 3CU2A 1OFPA 1AL7A 2B7PA 1R47A 4O19A 1NVMA 5BOOA 3KRUA 3C2OA 4LS1A 2ISSA 1Z42A 4MJZA 1ME8A 4DELA 1AG1O 4QM1A 4E0CA 3UWYA 4LWWA 2EAWA 4DBEA 2DZPA 3N34A 1TJRA 4O1AA 1AW5A 4CCDA 3NZ1A 4DPPA 2A21A 1IF2A 1KW1A 3V75A 1UBSA 5G4EA 3EXSA 2E09A 1J5TA 1QWGA 3C4UA 3BVJA 4O11A 5D02A 1XUUA 2QJHA 1ZAJA 1GYLA 3NGJA 3QSTA 4E38A 1XI3A 1BWLA 4QISA 3EWXA 4UTIA 2PRLA 4FNPA 4Z1BA 3QMSA 1A5CA 3F4WA 1XC4A 1VC4A 3TUUA 2VFEA 4CCCA 4ZVJA 4ZZ9A 1SO3A 3W7HA 5F2IA 1JR1A 1W56A 4Z1DA 2R14A 2QJIA 1OX4B 1JULA 3TJLA 1QMLA 2E1DA 4JTKA 4EVZA 5FF7A 1H7XA 4LW7A 2NWRA 1DJNA 2WKJA 1KV8A 3HF3A 5K9XA 1G7UA 4WQ6A 4IOTA 1TQXA 4JTFA 1ADOA 1I2RA 3IGXA 4S2CA 3GDRA 3A21A 3C56A 3FOKA 2B7NA 2HTMA 4FX7A 1JCJA 4LRTA 5MHBA 3LDVA 4MOZA 1W3TA 3FYOA 4MIMA 2EKCA 4MZ1A 1W1ZA 4LVBA 3PY2A 3EX6A 5AYZA 2WNZA 1RD5A 2I14A 3A24A 3OEXA 1NEYA 1UB3A 3LCHA 4NU7A 3W1UA 4BWLA 4UMBA 3MW7A 2Q8ZA 4QJ1A 2QCDB 3LTPA 1QPRA 4QITA 2A0NA 5FEZA 3F03K 2B7OA 3GX9A 5DCEA 4G1KA 4LT9A 5TBOA 1J4EA 5LNVA 4YL2A 4YCOA 2PURA 3QRHA 3R12A 5D32A 2H3DA 2NUYA 4RXGA 3WJWA 1GYNA 2NXHA 1HL2A 3TK7A 2VELA 1MEIA 3TNOA 1TMHA 3I7RA 4IMGA 4KFNA 1JCNA 2GVLA 3S1XA 1VH7A 4NT0A 4DF1A 1KM2A 2A2IA 3ZWTA 5K4ZA 3P8JA 2ZRVA 2ZA1A 3S42A 1OFAA 1EUNA 2VOMA 6ALDA 3TV8A 3OIXA 4E2BA 4JY8A 1NF0A 4UFLA 3DI1A 3GDLA 4MY8A 4O17A 2YFOA 5AC7A 3NR0A 2P10A 3S5YA 3RLUA 3T78A 2FQIA 2OMAA 3W2UA 4WX2A 5EMUA 1XBXA 3DKLA 1KM4A 4LS2A 1FCVA 4Y9AA 1JCYA 4K8EA 1UASA 3T4CA 3CPRA 1ML1A 1SSGA 4HNTA 2BZNA 3B04A 4QQ3A 3KVKA 1OX4A 5D2VA 4P2VA 3W1PA 1TIMA 3MYOA 1P1XA 4YXGA 3DZ1A 4CQ9A 4TU1A 4WUIA 3ZFHA 4BR1A 1PS9A 2NLIA 3IRDA 5SWUA 4GUJA 5AHNA 3Q2DA 3PF3A 1THFD 2AGKA 3UY8A 1VYSX 1RQHA 2WQPA 2ZRUA 1B4EA 2BSLA 3G0XA 3HPZA 3UWVA 2OT0A 1WBJA 4JNMA 4TX9A 3W70A 3DBPA 1XBVA 1F76A 1AL8A 1RR2A 2VENA 4IMEA 2NZLA 5C55A 3WJZA 3E96A 1S3HA 2GVGA 1DV7A 1N7KA 1W3NA 3CIXA 2Y7GA 3QQ0A 1TREA 3LOTA 2RKXA 1ALDA 3HQ1A 1K02A 5LZLA 3M1ZA 4NJJA 1KV5A 3CEPA 1LROA 1H7WA 2CLEA 1OVDA 5KINA 3KRSA 4UFKA 5DY3A 1FWNA 3CM4A 3WK0A 1GZGA 1H63A 3MHUA 1BEUA 3DU0A 5HWNA 2ZZ7A 1S5VA 1WDWA 4GE8A 4JYEA 2C19A 5AHFA 2D73A 1X6UA 4NQ1A 5F1UA 4AHPA 3PSWA 1LTDA 3BLEA 3BG9A 5G2HA 3R89A 2QCMA 3PB0A 4UTWA 1SZNA 2EF9A 3STEA 4JGDA 1L6YA 1GVSA 1DOSA 1S5WA 4H3DA 1C9DA 1ZALA 2WPBA 3B4UA 1QR7A 3W7CA 2RDUA 1JCMP 3G1HA 3LHYA 2ZTKA 1UUMA 1TV5A 4BK9A 4Z0SA 1PE1A 1DQXA 3CTLA 2TPSA 1OF6A 4J9JA 3EWYA 3CC1A 4PA8A 4ZQCA 1TPH1 4JR5A 3G8EA 4O28A 3W2KA 4AAJA 1H1ZA 3L0GA 5LNRA 4FEZA 3W83A 2GOUA 2C16A 3HGSA 3BW3A 1KFBA 1KTNA 3GZ3A 1R2TA 4UTJA 1EWDA 5CZTA 5K9DA 3W7LA 1W5OA 2QCHA 4N9DA 3LV5A 1EX5A 3HPSA 1R46A 3NPXA 2X16A 3EX3A 1B57A 2FPVA 4XBSA 2CW6A 2ZRZA 8TIMA 4EOUA 3ANYA 4K37A 1LP6A 5CGQA 4OU1A 2J9XA 1AW1A 3WJSA 2QDHA 3CHVA 3LX9A 1L9WA 1FDYA 1IXNA 2Z1BA 1UCWA 3VNDA 1L2UA 3BGGA 3W7PA 1ZY9A 4UTMA 4NNBA 5E1QA 1QOQA 3EX2A 3G22A 2G95A 4NNCA 4AB4A 2QEZA 6TIMA 1T96A 1EEPA 1KBIA 3RU6A 3W2JA 2J9YA 1Q6QA 1Y0EA 3KHJA 4I7UA 4W9TA 4UTTA 2PRHA 1EB3A 1R2RA 4Y96A 2FPTA 2HSAA 3P61A 4MPQA 3GXNA 1LBMA 3NNTA 3GNNA 4A29A 4JS3A 1XFBA 1QO5A 2JKPA 4MYXA 2X1RA 4AHQA 3KVJA 2RHGA 4K36A 1OABA 3L0NA 2PRMA 4LVAA 3W7OA 3QH2A 3V1PA 3MHFA 3O6CA 3NO5A 1LDCA 1GG1A 1PIIA 3YPIA 1AMKA 4HNVA 3LCIA 4UTLA 4Z0JA 3NL3A 5U7SA 1R30A 4HSOA 4LUJA 3FFSA 1UUOA 4ZL1A 5TQLA 1XL9A 3N2XA 1G4SA 2JKEA 2ZFAA 5LKYA 1OFEA 3P62A 3LI0A 1SFJA 3LGEA 4PH6A 3JR2A 1LOQA 4RLIA 2ATMA 3GK0A 3O6DA 1VR6A 5C6MA 4Y8FA 5HR7A 1WQ5A 2VFDA 4QAIA 3HMJG 1ONRA 4ICNA 4O52A 2JGQA 4FNSA 1TTIA 3W7QA 4O50A 1WOAA 3TU9A 4GUIA 3TE9A 3MP4A 3VE9A 3I68A 3UD6A 4AVFA 1LBFA 3MBDA 4GUHA 3RLVA 2X1UA 4LUIA 3NQMA 3KFTA 2YGYA 3ATZA 1C8VA 3BPWA 4GWEA 3HG3A 3W1AA 4JTIA 3G1AA 2H8ZA 3EWWA 1FDZA 2C14A 2J24A 4XWUA 4YLWA 5FF3A 2J9ZA 5CZSA 3ABSA 1F74A 1LCOA 4RX0A 3W7IA 5F1VA 1YDOA 1I2PA 2QDGA 5A8GA 2E6AA 3KOFA 3NG3A 1FWTA 4GNJA 2DZSA 3EWUA 3PC0A 2A6NA 3WK3A 3S5OA 3N9SA 3O15A 2EHHA 4N2YA 5AC6A 1FWWA 4WXYA 1U5JA 3IVUA 2C15A 3EKLA 3NQ8A 2NWSA 2B4GA 2QUVA 4NJKA 2WSRA 3DFTA 4Q4KA 2AAMA 3G3DA 2ISWA 3PG8A 4GRSA 2O7SA 4K7VA 4K6AA 2ZZ2A 1H60A 1O95A 4RXFA 1KM3A 4JEQA 2C1HA 3GDKA 1JCLA 1CI1A 1X1OA 2ZA3A 3KVLA 3LXBA 4WY0B 3UWUA 4I9AA 3BGJA 3C52A 4JY9A 1G4EA 1JUEA 1SUXA 3HG2A 4U28A 2DORA 1LZOA 3Q58A 1KM6A 2C18A 3G3MA 5D03A 3TKFA 3O05A 5HR6A 2HS8A 1LRNA 4AXKA 2NXGA 5AB3A 4DO4A 1ZCOA 3RF9A 5KZMA 2Y61A 4ADTA 1OF8A 4N6FA 3NL5A 4CQ8A 3QF0A 3AJXA 4XKYB 4PL1A 1QAPA 3I6RA 4O4VA 3SFKA 5AHIA 1I45A 3B0UX 3LB0A 3PULA 1T99A 1TPUA 3FJLA 4QSHA 3LLFA 1K3UA 4GC4A 1OK6A 3FLUA 5D2XA 1X7FA 5DN1A 2GQ8A 4H4IA 2ZZ4A 4DXVA 1W54A 1R2SA 1KM5A 3L9CA 1EP2A 1EP3A 5K2ZA 2OZ0A 5HULA 5CPLA 3L67A 4PTNA 2TMDA 4LC8A 4HKPA 4TMCA 4R34A 3OVQA 3TW7A 3EEGA 3C3NA 1P4CA 2CWNA 3BLIA 4NJHA 3THAA 2E68A 4S1FA 4IPIA 3E0IA 4EF8A 3NQCA 2CLFA 2QJGA 1FY6A 2OX1A 1U83A 3W2NA 1KLZA 4IQLA 3INPA 3LBCA 5LNUA 2Y85A 1GTEA 3LHTA 4H6KA 4FX6M 3NQ6A 1H7NA 3JRKA 3L5LA 2C3ZA 3M16A 1OFOA 1QOPA 2E6FA 5H2ZA 3NQDA 4BI5A 4O4WA 1EIXA 2Z2UA 3PAJA 4O1BA 1W5QA 4FX8A 4P61A 4JTHA 2EGZA 3HB9A 3MJYA 3OVPA 1HFBA 2YXGA 1RPXA 4C1KA 5IM51 5FEXA 3NDOA 3HO8A 2AQWA 1KM0A 1KFCA 3EB2A 3STGA 3QM3A 2GJNA 1JRBA 3P80A 1DL3A 2TYSA 1K03A 4WY0A 1E51A 1BTMA 5D2YA 2A4AA 3A5FA 1O94A 3G1FA 2FJKA 3TQKA 5I3IA 3H54A 1F05A 1K8YA 5G1TA 4O18A 1GWJA 2YPIA 2PC4A 1KFKA 3QPYA 4O1DA 3LM7A 2E77A 1SO4A 2YSWA 3TXZA 5BRBA 4RR4A 1AW2A 3IIXA 3ABQA 1HO1A 5F4WA 4HT3A 2E5CA 4O8RA 4LVDA 3PUDA 1HO4A 2Z0IA 4UFMA 2CU0A 2DZVA 3G0UA 2WOQA 2NV1A 4JX4A 4N9EA 3LCLA 2NX3A 3NQ7A 3W7RA 1FX6A 4JIQA 1D3GA 4RCXA 3M7WA 2QUTA 1Q6RA 4HN4A 1EA0A 3UWZA 3PR2A 3RNDA 3GXTA 5LGXA 2ZRXA 4NX5A 2BXVA 3SW6A 3NEVA 4IGHA 4MLJA 3PS7A 3TSMA 3P84A 1C29A 3LCWA 3KRZA 3G1DA 2VXNA 2E6YA 4OWGA 1H7OA 2CLMA 1FDJA 4GFSA 3A9IA 1SW7A 1X1ZA 2CZFA 4R53A 2NXIA 3W1XA 2VEKA 2A85A 3IGUA 5DXYA 4IXHA 2VC6A 4WXZA 3QSRA 5AOUA 5HWMA 3DFQA 3PSVA 3LCGA 3T44A 3TQVA 3NPUA 3W07A 1H7PA 1MZHA 2RDTA 3DKJA 3WK1A 3TA6A 3W9ZA 3MI6A 3TCEA 3OBKA 1YXDA 1GG0A 1Z48A 3LHUA 4PL2A 1ICPA 3M5ZA 1W31A 3S5ZA 2X2GA 1OYBA 3W2LA 2Q3OA 1O5KA 1G4TA 2W0UA 4LTSA 4RK8A 2JGYA 3VFLA 4MVAA 3GDTA 2ABBA 2C13A 1TTPA 4BFAA 1A50A 3G1SA 1FCUA 2DZUA 1F7BA 1DORA 4RZ6A 5D30A 5I3FA 1HTIA 2VFHA 5F4XA 1VZWA 1VCGA 4XKYA 4YCPA 3ABRA 3KVMA 1G7VA 3HGOA 2NX1A 3O16A 3F1QA 3HG4A 3UXDA 3OHIA 1V5XA 1XKYA 3NL6A 4GJ1A 5DCBA 3W23A 5LHFA 5BNKA 1AK5A 1K7FA 4TMBA 5F2GA 1B3OA 1SO5A 2PE4A 4TO8A 3IIOA 1TCDA 1PVNA 4GBUA 4N4PA 4UTKA
chains in the Genus database with same CATH superfamily
2W3ZA 3S2NA 3URAA 4TIMA 1EUAA 3VVGA 3WLSA 5FF0A 3A4AA 2TSYA 1ZBKA 3KZSA 3B0XA 2F2HA 4Y6GA 2WCAA 3MPGA 4XSMA 2LLEA 3MMDA 1ENUA 1XP3A 2W61A 4ORIA 3SCNA 5KTLA 1QFEA 1K4GA 1AJ2A 1KKRA 2QCGA 2XSXA 1LRTA 2EG8A 3CQJA 4MFEA 3WQGA 3EDJA 4CLMA 4JICA 3T4WA 4GCAA 3GG7A 3GUWA 1G0CA 3TX9A 5CSUA 5D2WA 4X2PA 4I5UA 4RZ4A 4PBGA 1SO6A 3WQ5A 3UWWA 2D2JA 4AYGA 1JCXA 1TV4A 4KFOA 3QLDA 5LNWA 4K8HA 3UESA 2FLIA 1SFTA 1EGMA 4Q8PA 3I6EA 3VD3A 1RBOB 1GEHA 1CECA 2J6VA 1ZAIA 2VFGA 5FJJA 1PTDA 1T40A 4DXXA 1T8XA 3U9IA 5A6SA 5A8NA 2PBGA 1O4UA 4GD0A 1YQ2A 3VCRA 1RVKA 1UG6A 4GUGA 5DXXA 3WNMA 4K7YA 3IIVA 3CWHA 4UOQA 3ZLGA 4YTRA 2J88A 1TV8A 3CQ0A 4B4FA 3GS6A 1CXLA 2DJXA 3W85A 4D1JA 1VBJA 5F4SA 5CBBA 4AIBA 4AMAA 1GVYA 1R0MA 2WVVB 1ZP3A 4ATLA 1TTQA 3U57A 1W9XA 5IHSA 1PPIA 1JPKA 5CSSA 3NCOA 2XM1A 3P67A 1KTBA 3SCPA 1OC6A 2R8WA 1EDTA 4B16A 3ZR6A 5E9XA 2BVWA 1NARA 2J8FA 3RAOA 3MUZ1 1KBJA 3AWNA 3W1NA 5KITA 1P6WA 1IHIA 2ISFA 5I3GA 4QHRA 5PTDA 4LAUA 5HNTA 1W6TA 2XVGA 4RDZA 5JIPA 5M2FX 3QMRA 3T42A 3K8MA 3EXRA 4G7FA 4WZHA 3OODA 1OZQA 1KTCA 1Q45A 3EPNA 4N9BA 1Y5VA 4L4PA 3LG3A 2AL2B 4XAFA 1I2QA 3FJ6A 4V33A 5HUPA 4L6HA 3PWIA 2YL6A 3SN4A 5BU6A 5A6LA 4FA3A 3VE7A 4JN8A 2UY2A 3U6WA 4Q8MA 3C8NA 1UA7A 3H4XA 5IOBA 2D2GA 1W1TA 5I24A 4GY0A 4DF0A 4WDUA 3APTA 4N0RA 3PWAA 4QLKA 3QGAC 2YYTA 3VNYA 3SQMA 1IR2A 3SJ3A 5BRQA 1W1IE 2G37A 5DBUA 1IXPA 2JIEA 1GVIA 2QT3A 4S3GA 1H3GA 4LUTA 2J4GA 3NQ2A 1PDZA 1NFGA 4Z1CA 1EF2A 1UR2A 1X8CA 2PWVA 1RZMA 4HJWA 3GAKA 4UXDA 2ZX6A 4Z42C 1QNQA 4WK9A 2PEVA 3H23A 4D6FA 4DNMA 2FPYA 1OYAA 1VEMA 3B97A 1M7XA 2VQTA 5BMXA 1CW2A 3MP3A 3G1VA 3EB3A 1CZ1A 1RQEA 4ZQMA 3NXFA 3QZEA 4ML9A 2IPGA 2OEMA 3L66A 1K6AA 2E1WA 1NP2A 1Q13A 1J8VA 3PJWA 3NTYA 2CBUA 3AWOA 3OB8A 4ZQPA 2YZ5A 2QCLA 4RV8A 3WBAA 4OQVA 4DEFA 1UKPA 2H6RA 3IGHX 2HV5A 3ONCA 2Y6ZA 4IPPA 4ZBCA 3WDIA 3VI2A 3A3WA 3K1GA 5DY2A 4JX6A 3FA5A 1FXPA 3S8HA 1DWFM 5K9CA 4JTSA 4A2RA 1TRDA 4A22A 5G2WA 3WJXA 1SJDA 3LUTA 5AHEA 4N9CA 2V5DA 4L9XA 3TYDA 1GHSA 1FWDC 4D71A 4JKKA 3QVQA 2H3BA 1XG4A 1V02A 4BS0A 3CWOX 2FZ9A 3MMWA 3VIFA 3GKAA 4ZA0A 1RLCL 5A6AA 2ZKMX 1E3ZA 3SIZA 1PEZA 5KZDA 1CLXA 4L9YA 4EAYA 2VZOA 1E55A 4XVDA 2ZUWA 2BY3A 4AHOA 3A13A 3VPLA 3NO3A 3PBYA 3M47A 3OLDA 1NQ6A 1D3HA 3QXBA 3QW4B 2WWDA 3NVTA 3VA8A 4AZGA 1M5WA 1H5YA 1TPVA 2P1FA 2QIIA 3SCRA 3B03A 3I7QA 4C6EA 3BG5A 2A7PA 2GSHA 1KXQA 4CN6A 2GQ9A 4GXMA 2VCCA 1M9HA 3OVRA 1GONA 2X7WA 1GPFA 1KRCC 4LC6A 3UW6A 2HNHA 2I57A 7TIMA 1FWBC 3RU8X 3N9RA 4BF9A 2X30A 2FGLA 1DEDA 2BVDA 4W4QA 3LRKA 2RJGA 2DEPA 4PFMA 2CYGA 5EBAA 1P5BA 3L4WA 3FJNA 3GNXA 3H4WA 2NUXA 2CESA 1O5XA 3PFRA 3MQTA 1EJXC 4N42A 5D05A 2WM1A 4NL1A 3CZKA 1UMYA 4GNVA 4RZBA 3SUVA 3P8IA 3WD3A 2G5WA 4XSLA 3BGAA 3BW4A 2ZCGA 1ZFJA 2PTYA 1Z89A 3G18A 5KZEA 1EHNA 2VZTA 4M29A 3MDUA 1V6WA 2OO6A 3EXTA 3MV01 3B9AA 3LBMA 3TMQA 4QEHA 1NF7A 4D6DA 4AG0A 1WUFA 3JZEA 2OFJA 4S3BA 1JPMA 4MZ8A 5HJLA 3E5PA 1E6PA 1U2YA 3PBUA 1MDRA 1U30A 3SR7A 4ZE4A 3VD7A 1Q63A 3AXIA 2PDNA 1QI4A 1IXQA 1GVFA 1CT5A 1H7RA 1WZMA 2WM0A 1XRFA 4LRSA 1FHVA 3G77A 1W9BM 1VYPX 3TJXA 3C61A 1N82A 3IS4A 2IUZA 5EU9A 4D6EA 1UJPA 4CCEA 1UD3A 3OA3A 7REQA 1FFRA 3BLOA 4QBXA 1ZQ5A 1O60A 2G8ZA 4ZO8A 1ICSA 3A64A 1HKJA 2G3NA 2QF8A 1LUCB 3TH6A 1K9EA 4XBKA 1UQZA 4YPJA 2C0AA 1QPNA 4MYAA 4AZCB 4Q4RA 3JW7A 3NPVA 4Q33A 3MCNA 4QIUA 4ZQNA 5EFFA 4NZJA 2BODX 3RUBL 1SMDA 4UR8A 1B4KA 3DFHA 4IIGA 1VP5A 3CZ8A 4AZ5A 2E40A 1SZEA 2FFCA 2OKOA 4AWTA 4C6NA 5HQLA 2VYOA 4GH3A 1W2VA 4F0LA 4JTCA 4WY0F 1J18A 1FVPA 4FNQA 3VXGA 4ORMA 4GYJA 1TO3A 3GY1A 3N3MA 2J25A 1RV8A 1TJPA 1SR9A 2Y7EA 4DB7A 4HPXA 3OOQA 3TR2A 4NP7A 4LQ1A 1B3ZA 4QQUA 1KRBC 2DH2A 2GGJA 3M46A 3USBA 3QHMA 4XAYA 5EMYA 2D69A 2PDQA 4BI7A 5CXPA 1S3TC 3ZJKA 2I17A 4LYKA 1FCBA 2E4TA 3QFEA 5LNSA 3AHXA 4WIWA 1HIZA 3FV9A 4EXQA 5IBXC 4DJEA 4LXFA 2V0TA 1BXCA 5FESA 1F8IA 1XXXA 3IGSA 1UKSA 2QUUA 2YZRA 2RH9A 4IWWA 4R9XA 2BY1A 4UNLA 5AYYA 2DSUA 2I5IA 4OECA 3DG7A 2VCBA 3FIGA 5HJXA 3EEZA 1J6PA 4MUPA 2FFIA 6A3HA 4TUFA 3EX4A 5D9NA 3VMPA 3AXMA 3N29A 3KBVA 4KWVA 3LRLA 4HGXA 3T55A 2PLKA 4DF2A 2AQOA 4GIEA 5ABGA 1GVOA 1OIMA 2ZTJA 3C2FA 2DUAA 2P8CA 3WFAA 3ITGA 1S39A 5E09A 1SJCA 2YDQA 3Q37A 1HKKA 5CZJA 3WF3A 3O3RA 1XLIA 1DIDA 2VX6A 4LYQA 3WF4A 2OYKA 3ARPA 3KL3A 4TTGA 4BF5A 3WH6A 4XISA 3WQWA 4W89A 3CWNA 3VKDA 1MW1A 2RGMA 4KIEA 4OE7A 3CASA 1TVLA 3RPMA 2AL2A 4DAIA 3NGFA 5ABFB 2DJLA 3T0CA 1ME7A 3UU0A 1G69A 2XGZA 3CTTA 1YMYA 2PZ0A 1Q6LA 2DZTA 5KMYA 1PIGA 1IGSA 3PN8A 2WMHA 1JF6A 2AMGA 1REQA 1X6NA 4Q4MA 4QXIA 1YE4A 3Q45A 1NSJA 4RNJA 1VBUA 1EO5A 1MZRA 3LV6A 5L6UA 4AXNA 4ADSA 5A2AA 1FBAA 1NIUA 4DUXA 3ZSTA 5CC7A 2HEJA 1GORA 2ZRYA 3E2QA 2VCAA 4YHEA 2D1ZA 4WOZA 1HUVA 4O16A 3CUFA 3HJZA 1XLHA 3QYQA 1XIMA 3W73A 2GFTA 4A4AA 3OG2A 2CITA 1K8XA 3UA4A 4FSAA 1Q3NA 4WSKA 4K2SA 1YYAA 4BZYA 4EIVA 1AZ2A 2POTA 1E71M 4NZFA 4Y90A 2HVOA 3B8IA 4NVTA 2MNRA 1DJQA 5HUOA 5EY5A 2GPTA 1PYMA 3H2CA 2XHYA 5A6KA 3SECA 1QNPA 2WVVA 4MG4A 1JNEA 3THUA 2RDWA 2YCLB 3EWDA 4URIA 4ASTA 1M01A 1PB0A 1XV8A 3MHGA 3K4AA 3G24A 4O53A 3H2MA 4WD0A 4O10A 1V7AA 2OX4A 3TYZA 3V4BA 3RX4A 5BXTA 3S0CA 1OCNA 2NX9A 3IACA 3N25A 4M56A 3LPPA 1A5LC 4PEEA 1W5MA 2VEMA 1F3WA 5KSWA 2XTKA 4IIHA 1XLKA 2AGTA 1HL9A 4M8UA 1O7AA 2Q3RA 4Z2KA 1X39A 1WAUA 1XDMA 2A1YA 3CUJA 1HJXA 2PWHA 3QPZA 3LZ3A 5HWJA 3FEQA 3PB2A 3IJQA 3ARUA 1TTJA 2IXUA 2IQTA 2H8XA 3AFBA 4AZBA 3CU2A 3W82A 3CHEA 5BOOA 4DZIA 4W7VA 3GFYA 1MNZA 1AG1O 2PWEA 4QM1A 2G50A 4FALA 4E0CA 2VGGA 4OKDA 3U4FA 4O1AA 3IARA 3NZ1A 2X05A 4DPPA 3VOHA 3ONBA 1QWGA 3SUUA 3C4UA 3BVJA 5D02A 1GYLA 3HMCA 3VIKA 3M64A 4QRNA 3QSTA 1XI3A 4QISA 4UTIA 3MC5A 4GIYA 5ECVA 3VNMA 3T0AA 3QMSA 3F4WA 5AVHA 3IJ9A 5HAOA 4ZVJA 1SO3A 3W7HA 1JR1A 1W56A 2FHBA 2R14A 1N8IA 7ENLA 3IJ8A 4JTKA 5A8MA 4PMXA 1NP0A 1K9FA 4LW7A 5GNXA 3CMJA 1V6YA 4HA1A 3ABXA 4DJEC 1H0GA 4ZR8A 2VTFA 2WSKA 2Z1XA 2O4MA 4CQDA 4B5SA 1I2RA 3TTYA 2OB3A 3A3HA 4Q8QA 4ZFMA 4NF7A 3GDRA 3LU2A 4ZO9A 1PTAA 3A21A 1X1NA 3FOKA 2HTMA 4C6QA 4ILSA 1W3TA 4MJ2A 1OD8A 3ZZ1A 3L23A 2CIPA 4LAMA 2P3EA 3PY2A 2WNZA 1NEYA 2W66A 1HXJA 1XHGA 3W1UA 4BWLA 3BOFA 3MW7A 1E9YB 2QZRA 4C60A 4QGCA 1RK5A 3H2NA 3LTPA 4WKFA 1RA5A 5FEZA 2WMIB 1J4EA 5LNVA 4BKNA 4LBRA 3WX7A 3R12A 3CAQA 4GQGA 2H3DA 3WJWA 4RXGA 2VELA 2BS9A 3AUOA 1JCNA 4M3PA 2GVLA 1TA3A 3GU9A 3GUGA 2XIMA 1E6NA 1EJWC 4HTBA 3URNA 3P8JA 1GW1A 2Z24A 2ZRVA 3F4CA 2Y8KA 1EUNA 3IWPA 2VOMA 2DT1A 6ALDA 4LUSA 3B4YA 3OIXA 4HNOA 5C0QA 3N4EA 3GDLA 1RBAA 2QJNA 4O17A 2YFOA 5AC7A 1PYFA 3D6NA 4JQAA 4TXEA 1W9UA 3R94A 4Q6JA 1M04A 1XGEA 1FWHC 1R9YA 3BXWA 4UQEA 1XR2A 1IT0A 1JPDX 1KCKA 4HNTA 4QQ3A 3KVKA 3W1PA 1TIMA 4AQLA 2CHNA 2WMJA 1S2UA 3VNLA 4WUIA 4BR1A 4IFKB 5SWUA 4GUJA 5HK4A 1MRAA 4D8LA 5CGTA 3PF3A 1THFD 3WMCA 3AC0A 1VBHA 2WQPA 4QX4A 4AX6A 1NY1A 2ZRUA 1XQKA 1B4EA 3AU6A 4TX9A 3DBPA 1AL8A 2VENA 3PNZA 5A6MA 5M3WA 2OWXA 4ZENA 3CIXA 4IP7A 2PGWA 2Y7GA 4OUIA 3RPTA 4CD6A 1ALDA 4JKMA 4UZSA 4UQAA 1KXTA 3SBFA 1LROA 4LAZA 2CLEA 3TEVA 1FWNA 4KQNA 3CM4A 3WK0A 2ZUVA 5AC4A 1MQQA 1XWYA 3DU0A 2VUYA 1OC7A 2YL9A 2YIHA 4JYEA 2YLLA 5AHFA 3SEPA 1YRRA 4AY1A 2XGIA 4HZ6A 3BLEA 3BG9A 1SZNA 2EF9A 3O2LA 2Y1HA 1GJUA 2WPBA 4WDTA 1E6ZA 3NVDA 1TV5A 4BK9A 1R5YA 3DG3A 3CTLA 5H8PA 2YDRA 1F61A 3N9KA 3S83A 1XC6A 4S38A 1TPH1 5LNRA 4AIEA 4E4UA 5GJNA 1Q8AA 9XIMA 3BW3A 2FHCA 5TAOA 1KTNA 3GZ3A 1VB9A 5CZTA 2YA0A 2JE8A 3W7LA 1HP4A 3VOGA 4Q8OA 3VC5A 4CD5A 1FRBA 3NPXA 4WKAA 1K1DA 4XBSA 1WB0A 2ZRZA 2INFA 4PB3A 8TIMA 3QFWA 4K37A 5CGQA 4OU1A 3B0YA 3W28A 2WCSA 3TW9A 1A4MA 3C5QA 1UCWA 2D0FA 4H7VA 1L2UA 3VNDA 2GDVA 2E8YA 4UTMA 4NNBA 1QOQA 3EX2A 1UWSA 4IIFA 3CQKA 1EEPA 5CSYA 3RU6A 3W2JA 3GTFA 1Y5WA 1E9IA 3H70A 4AD4A 1Q6QA 5MF5A 1NWTA 2PRHA 3OIHA 1EB3A 4Y96A 2FPTA 4ENLA 1LBMA 3GNNA 4J3VA 2JKPA 4AHQA 3TVAA 2GQ3A 2W91A 1CLKA 3L2LA 3V1PA 3O6CA 3MUIA 4FLQA 4A3HA 1XLBA 1LQAA 1PIIA 4GO9A 1RP8A 4KCUA 3LY0A 2FVMA 3MSGA 3GVWA 3NL3A 5U7SA 1JCTA 3WEMA 3ES8A 1UUOA 5ABFA 3TTSA 5TQLA 1XL9A 2ON3A 2JKEA 5LKYA 4B5XA 1OT1A 1A0CA 4LYPA 4RLIA 3OYZA 5E5CA 3GK0A 3O6DA 4J3TA 5J04A 1W91A 2OG9A 3DC0A 5C6MA 4Y8FA 1REQB 2VFDA 1BXNA 4PMJA 1ONRA 2NQLA 3GE7A 5T9CE 3VKKA 3PTQA 4FNSA 1WOAA 1AFSA 2QUNA 4GUIA 3SIMA 1BQGA 2DVXA 1Q2RA 2VVSA 3MKCA 4GUHA 1S1PA 3BLKA 3RM9A 1E15A 4GWEA 3W1AA 1RAKA 3G1AA 1HJVA 2H8ZA 2R1LA 1FDZA 2J24A 3ARVA 3SQSA 1QW9A 5FF3A 4IP5A 1F74A 2PA6A 4U2YA 2QDGA 4MDPA 2YB4A 2VX4A 1YNQA 3NYDA 4B2DA 2WVUA 4QE4A 4W8AA 4N2YA 4DJED 2NSXA 2E28A 3NQ8A 2NWSA 3EYPA 3BWWA 4JHMA 4AZHA 4G6CA 3NURA 3CYVA 3G3DA 3HA1A 1Q4WA 5D8ZA 4GRSA 2O7SA 4L1WA 1JI2A 1J9YA 5JH2A 1H60A 4YYCA 4YS1A 2PP3A 1KM3A 3WY1A 5IFPA 1JCLA 1CI1A 3P0XA 2ZA3A 4NRRA 3LXBA 4WY0B 5BU9A 4MGGA 1J0KA 3UWUA 3QKEA 4I9AA 5EFDA 4K1GA 3GM8A 4CVUA 4W5ZA 5CBJA 2J62A 1TVPA 3EOEA 2Z1WA 2B31A 1LZOA 4JHOA 2F6UA 1GJWA 4DY1A 3G3MA 3A9BA 2PDMA 5FAJA 2YBVA 4WJXA 4AXKA 1ZCOA 4JFUA 2J7EA 3LSBA 2J8TA 3S2MA 4GGHA 3SY8A 2QPSA 3QF0A 5FCZA 3WH7A 1V3HA 3HQOA 3KM8A 3LB0A 3H22A 3PULA 3LLFA 1GGOA 3PTMA 3FHAA 3OZPA 5D2XA 2GQ8A 4AUBA 3VD5A 3HTWA 2DVTA 4IJRA 2A79A 3OTRA 5CPLA 4PTNA 1KC7A 3IANA 1EJSC 3T8LA 4LC8A 1GUVA 1RBLA 4R34A 3ARWA 3DN5A 3WQVA 3EEGA 4P7OA 1P4CA 4S1FA 4EF8A 3T05A 2OTDA 5LIUX 6ENLA 2XH0A 3OQEA 3INPA 3LBCA 4IQLA 2W5FA 2NQHA 2Y85A 4NZ1A 2C3ZA 3M16A 1OFOA 4PCPA 2QQ6A 2I56A 4GYPA 3N4AA 3BV7A 4JTHA 3MJYA 3OVPA 1IEIA 3KE0A 4C1KA 1GCYA 3DC8A 1HF6A 3HO8A 3VDAA 3CUZA 2XIBA 1KFCA 1QHOA 2GGHA 4R9OA 1ADSA 1DL3A 1ZCCA 2Q02A 1K03A 4J3WA 1Q85A 4YIWA 3MU7A 4AY7A 4UWMA 4DBUA 4WRHA 3WENA 1A3XA 3UG8A 2OQHA 1QXLA 1K8YA 2INEA 2WPGA 1GWJA 3FX4A 2E77A 1QK2A 5BRBA 4LGXA 3H12A 4CQBA 2YCLA 2ANUA 3VGBA 3IIXA 5F4WA 4R88A 4HT3A 3L4XA 2HVNA 2XWEA 3AIBA 3SSZA 4JX4A 3WD4A 2PP0A 4N9EA 2VR2A 5FAGA 1FX6A 3U5YA 3E5BA 4MNKA 3OGSA 4GKTA 4OVXA 3GXTA 3HV8A 2AKMA 4UOZA 3F5KA 4XZBA 3TSMA 3G1DA 1VFOA 2OODA 3ZVHA 4TQTA 4JL2A 4GFSA 2BVTA 3W1XA 2GYIA 2A85A 1X38A 3CAWA 1L8PA 3IGUA 3QOMA 5E0FA 1EJUC 3SUSA 4IXHA 1TA3B 2VC6A 2QXWA 3T44A 2PZNA 3I6TA 3W07A 4KCWA 2I5QA 1H7PA 1BG4A 3TJIA 1KGUA 1DJYA 5LXXA 3TCEA 1Z48A 4RE4A 4PTVA 2VX5A 3W2LA 3OGRA 3VFLA 1F3EA 3GDTA 5E0CA 3TN6A 2C13A 1GOQA 1TTPA 4V1XA 3G1SA 1FCUA 2V63A 3GVVA 3UCCA 1XRTA 3B8UA 4PMVA 1IEWA 4ZE5A 3O16A 4IIBA 3F1QA 2EG6A 4HPHA 5GPRA 3H7UA 1XKYA 5C7VA 3GWQA 2NT0A 5DCBA 3W23A 1K7FA 1PZ1A 3CMFA 3QY8A 2HK1A 3NDZA 1XLFA 8XIAA 4UNKA 3KDOA 1A5OC 4S23A 3WJYA 1KFEA 1YXCA 1Z7AA 3VAVA 3PJTA 1QNVA 2XG9A 4AD3A 5LXEA 5DLCA 2YOCA 3E9AA 1R85A 4MB1A 1YNYA 4EANA 4JDYA 2YYUA 3BJFA 4E6MA 2B0MA 1OGSA 3SCWA 2PLCA 2YDSA 4PMNA 4IMCA 3OGVA 3GD6A 4LS0A 3NZGA 1EP1A 2BP1A 5C5YA 4A35A 5LGZA 2PD5A 3S1WA 1AQMA 5FJUA 3QOKA 2ICSA 3ITVA 2ZUSA 5A5WA 2GLKA 1H5VA 1BTCA 3BO9A 3TXVA 3BV4A 5CG0A 4MB3A 3K2GA 4O8AA 2IQ0A 1SJAA 3WYZA 5I2UA 4A21A 4W85A 4LAKA 3TC7A 1XSJA 1E9ZB 1UR1A 2PODA 4S3JA 3GHRA 3LLXA 1K6WA 3N2MA 4LV4A 1OX5A 3W88A 1OFBA 4QROA 1YE6A 2WBKA 1Q8JA 1AZ1A 1OCJA 4F4RA 1TKKA 2VM8A 1IWAA 1A5BA 5B80A 4K3ZA 2J74A 3M0MA 2DZWA 3GIYA 2XFWA 3RM8A 3RK8A 2Y70A 1R87A 4PEKA 2J7DA 5A69A 2ESCA 4IFRA 3RCNA 2B81A 2DSKA 3PBVA 5I00A 4JNZA 1N55A 4ZSUA 1C9WA 4OJYA 3W71A 2BB0A 4GH1A 3GH5A 1UWUA 2FTWA 1YTDA 1NDYA 3CT7A 2WJDA 4M0XA 1XG3A 1J11A 1HKVA 3MS8A 1V3LA 1JGMA 3GC5A 4WSHA 4LAOA 1C8YA 4GHRA 5EYWA 1UKQA 3RIKA 4BEQA 5AHLA 3IJDA 3LXCA 4PUUA 3BCDA 3Q4DA 3VCNA 4TV5A 3LTYA 3BE7A 4KEMA 5GQBA 1AD1A 2ATSA 4UR7A 4HOXA 2OWWA 4RDWA 3TFXA 2PCQA 2IKGA 1XRVA 1EOMA 2R1KA 1VPXA 1I2NA 2WJZA 2BFGA 4HB7A 1I0DA 4EP8C 3WF0A 2X42A 3W84A 3GG8A 4CU7A 2OEKA 4LX4A 1XM3A 3WQEA 5I06A 1H1YA 1AODA 4IQEA 5CEWA 2CXGA 2WZTA 1X96A 3A5VA 4OV9A 1GZ1A 1T8QA 1RD6A 4IJBA 3W1MA 3VU2A 1GOXA 1E1EA 3E0LA 3LHVA 3K8LA 4QNWA 2JKAA 4IPLA 1K8CA 5A2CA 3H2FA 3WLHA 1Q65A 1J01A 1KCZA 3UCDA 3S6TA 3R0UA 3MDWA 4KKXA 3UZ5A 3DX5A 1AQFA 4JEJA 3NAVA 2V2HA 4YMZA 3MJMA 2W63A 1XICA 3CUXA 1EJ7L 4K39A 3PAOA 3VKBA 4J3UA 3L12A 5AYIA 1IE7C 4UQCA 3CT2A 3PANA 2IMRA 3CIVA 1ZTVA 4DZ5A 2BGNE 2ZOXA 4XKMA 3O0FA 4CNSA 3ARXA 2Z4GA 3GXPA 3RPDA 6CGTA 3T08A 3WDRA 2JIWA 4JYDA 3KL0A 4PB4A 1FTXA 4RV3A 5ABTA 2UV8G 1EO7A 3BK0A 5I07A 1I2OA 1MNSA 3QZAA 3UNTA 4QTGA 5BWFA 3RO6A 4D1IA 4I8YA 3ZIZA 1G4PA 2H9AB 3UGRA 2WHJA 4ACZA 5BOEA 4PODA 3UG3A 1Q6OA 4XD6A 1FH9A 3L0KA 3KZPA 4HNUA 2ZUTA 3S1UA 3WLKX 3O06A 3I65A 2IKJA 3LENA 3ZJ7A 1FWGC 3P93A 2CKSA 4GFIA 2VRKA 2XIOA 4OV4A 2D0GA 4H6QA 4AWUA 1B3YA 4ONVA 4O0KA 1Y7VA 4E2VA 5HA7A 3QV6A 5XIMA 2WZIA 3E74A 3OBEA 2SFPA 1L6FA 2BVYA 2QYGA 4CN4A 4UUIA 2VD8A 2Z6JA 3HFTA 1S5MA 3AI0A 1P7TB 3G5EA 4O14A 1TSIA 2Q09A 1XLCA 2IXVA 1XLDA 4D2JA 1ECEA 4BQ4A 1VJZA 4HU8A 1S2VA 3WEOA 4QG9A 3WMBA 4R7WA 4AWSA 4DBSA 4J35A 2NV9A 3GR8A 2CZDA 3R13A 2E6DA 3UPWA 1KRMA 2HZGA 2ZZ1A 2I9EA 3BANA 5D09A 3NOEA 3RFAA 3U2EA 1D7FA 2P0IA 4IT1A 3DG6A 3W87A 1YADA 3ID7A 4XB3A 2Y7FA 3REQB 3SCVA 5LA0A 2VZUA 3CUIA 3UGVA 4A2SA 2WLYA 2DY3A 5LA1A 4KESA 1VHCA 2H90A 3IEBA 3W24A 3SN1A 1JZ8A 1OG0A 4ZQOA 1JD7A 3GH7A 4LNCA 3K30A 2QAPA 4DWSA 1JRCA 3R7MA 1RCOB 2Z28A 3V1HA 1ZJHA 2XH2A 4YWIA 2BGQA 1EF3A 4DN1A 2QCCA 2C91A 3PPCA 4HD5A 2BHZA 4QCFA 3LGDA 2DDXA 2FH8A 3P6LA 1IZJA 2PGFA 2QF7A 1W0MA 2ISVA 1GQJA 2YCJA 3N04A 3UY7A 5FACA 1WZAA 2DZBA 4UCFA 1V77A 1K9DA 5AN7A 2YDAA 3AYSA 4JKLA 3MI3A 4HYVA 2R91A 2WW5A 3W81A 1K4HA 5T9BG 2A7NA 4MNJA 1F4HA 2QV4A 1J2BA 3RRXA 2QVHA 5KEZA 3TW6A 1WKFA 4Q8WA 2VDHA 3EOUA 2HS6A 3O8AA 1GKRA 3MMTA 2YFNA 4GUFA 2YL5A 4JNYA 4S3CA 3R2GA 1NFPA 4QFUA 2CLLA 1GZJA 2XIJA 2C71A 2GVEA 1XFCA 4KEVA 1L6SA 3B06A 3ZVHB 1VHNA 2XH7A 4HHPA 5CSRA 3TAOA 2I9UA 1RLDA 5H6HA 3WCZA 2XN2A 5REQA 1G9HA 1IXOA 3B8WA 1S2AA 1PUDA 1LJYA 2EG7A 2FGZA 5G1YA 5CZ0A 3F5JA 1JZ5A 1CEOA 4HVXA 3RJYA 4HA0A 2KZHA 3M5VA 2J7GA 4CEUC 1FUYA 1QBAA 1QBBA 4NASA 2XVLA 4CD7A 1M65A 3IUHA 3UPBA 3MBFA 4NAEB 7ODCA 1US3A 3UA3A 4PYSA 1M41A 3WH8A 2EPMX 5HNNA 4O57A 4GC3A 3ME3A 3KAOA 3K1DA 1TPB1 7CGTA 2Q01A 2OZ8A 2ZDRA 2HBXA 3WUBA 5CC5A 4DJDC 2PCEA 3POHA 2DT3A 3VIPA 3OLEA 2BG5A 1BQCA 2G3IA 4C5YA 5DT5A 4OZOA 4G1NA 2ALRA 3B8SA 3DYOA 3CQHA 3KLKA 1TWSA 2VL4A 2Z6IA 3DI0A 3DFOA 5FKYA 1P0NA 3O0KA 3IJ6A 5AYBA 4DLFA 2HE5A 4JFWA 3B8DA 3UNDA 4XZ9A 3WF1A 1SZFA 1DTUA 1B0IA 1VBGA 4IIEA 3B9NA 2WSYA 1YTKA 3BAJA 1ZRQA 3ZT6A 1KBBA 3UYCA 3MYPA 1UWQA 1EJRC 1QCWA 1TYGA 3T40A 3E49A 5K3VA 1S1RA 1WKYA 1EWEA 1CBGA 5DX7A 3G2GA 1OADA 3G8RA 2BGSA 2HRWA 2F6XA 2WSQA 3LCXA 4NUWA 1BYAA 3LHWA 2NVDA 3OJGA 3AIQA 4PBEA 2PB1A 4FNTA 3BMWA 1GEQA 5CC3A 4RUBA 3MZ2A 4V15A 1NJJA 3V7PA 4LB4A 4XD3A 1JJKA 5HMDA 4UMAA 3SN0A 2QKFA 5IXEA 4I6KA 4NJIA 4PULA 3MUY1 2C8NA 3AO0A 3W01A 2WHMA 1KCLA 3UCQA 3XISA 2VC9A 4JQ2A 4GQQA 2V8ZA 3RITA 4QLJA 2FIQA 1A5AA 1H11A 5EBUA 2JBMA 4XBJA 4Q7IA 1WE5A 4P5UA 5A8QA 5LHEA 3IIPA 2VKZG 4KFPA 2O92A 1J96A 1XRSA 3CEUA 3N14A 2XH4A 1TQJA 1XGDA 3KBWA 1FXQA 3NZRA 1M7PA 5CH9A 1TWDA 3W6YA 3UR2A 3P0WA 1I9CB 4EWJA 1DXIA 4M6VA 4UIOA 3WLRA 1TPC1 2NLYA 4LUYA 5CGMA 3FDKA 5CC6A 1UIPA 4KGJA 3KWXA 3QJAA 3FGCA 2OPJA 3GSMA 4JFSA 3TJ4A 4MTVA 4J3ZA 4GVIA 1J93A 1K9TA 3C6CA 4K38A 1RH9A 1NH6A 2V5KA 2J66A 3GHTA 2FDSA 1T0OA 1IR1A 3UWQA 4U3CA 5FEWA 1KWKA 4JDBA 1FWJC 3ZS4A 3NQBA 3WBYA 1EEXA 4FXJA 1K70A 5H91A 1M03A 2V5LA 3CIWA 5C2CA 4H01A 4XAPA 2WHLA 5DMYA 1K7EA 2X7VA 1FOBA 5BWAA 1WV2A 1CIUA 1QU4A 3FAWA 1XYLA 3GVQA 3E02A 3MTWA 1QNSA 1VRDA 1CXKA 3WD0A 4AEOA 2XZ7A 2CEQA 2PFHA 1SPQA 1W8GA 4JYFA 2ONEA 4AY8A 3M5XA 1XINA 2WO5A 3WMLA 2VGFA 3BZGA 1N2VA 2WK2A 1WYIA 3AMCA 1TZ7A 1VCVA 3WK2A 1PHQA 1P48A 1UD4A 3FXGA 4EKJA 2QAFA 2YL8A 3OLGA 2REQA 5BRPA 1HX0A 3WL0A 5I5RA 1RALA 5FL0A 1XYZA 1EJVC 4KW2A 4N02A 4BY3A 1C7SA 5CG7A 5TF0A 5FI8A 3ITTA 4PRTA 3TLLA 4NZ5A 4PE8A 2W92A 3WLTA 1JVNA 1RHCA 5HANA 1QPQA 4JTAA 3U2OA 3APGA 1GTHA 1PZ0A 3LPGA 3IJLA 1PX3A 2VDGA 4CEXC 1G67A 3LN3A 3K5XA 3FEMA 4CQAA 4RZ5A 1JYVA 1XCFA 4FOJA 2VGBA 4XTIA 1DVJA 5EB8A 1F9CA 4DXKA 4XZLX 3CPUA 1VFLA 4TR9A 3NQVA 3AUJA 4KPLA 3W7MA 3LBOA 3P5ZA 3PZMA 5AVNA 1A5NC 3AIEA 3MUXA 5IDIA 1U1HA 2WMFA 8A3HA 6PTDA 3TMLA 4X2RA 3FXYA 4JTGA 3GTXA 4LNYA 1CXHA 1KXHA 2E67A 2QNEA 2Y5SA 1MUMA 3PNUA 3P5YA 2YBTA 1EYEA 1BVZA 3ZXWA 4C1LA 1BYDA 1V7YA 1RVGA 3W00A 3DXIA 1M6JA 3WEZA 1ZB5A 3PZTA 3OO2A 4E3TA 4CNPA 3G1XA 1J0HA 4B9ZA 3BLDA 4GYPC 2TODA 4JTLA 1CTNA 1VFFA 4QE5A 4NHVA 1QI3A 4ZXOA 3TCSA 2V9DA 3STCA 3NA8A 4IF2A 3ZYZA 1VQTA 4L7ZA 5MKGA 1V3KA 2WZMA 4F3HA 3TQ0A 1DQUA 1HJSA 1QTWA 1O5QA 3BSMA 4R7JA 4NAFB 4AH7A 4DNHA 3DECA 4M5PA 1L2QA 3U4AA 2GVYA 2WXDM 1TZZA 2J13A 3CHFA 2V2CA 1OFPA 4ZOAA 2B7PA 1R47A 3ZOAA 2ISSA 1Z42A 4DJDD 4GVGA 3CZJA 4I9TA 4H83A 2EAWA 1WDDA 4DBEA 2A21A 2G3MA 3IPWA 1LT8A 1UBSA 2E09A 4RE0A 3WLJA 3FSTA 1Q7QA 4GIRA 3UR8A 2X8RA 1XUUA 4MJ4A 4WLCA 2P76A 2WB5A 5HPOA 1BWLA 3W6MA 2PRLA 1ZJAA 3VC6A 1EX1A 4RPQA 1W1B1 3H7RA 2PDCA 4RDVA 4CCCA 1Q7ZA 4Y9OA 1OX4B 1CENA 2PDFA 3T1GA 4KWUA 2I7GA 3NIYA 1AJ0A 4IHCA 1BD0A 1G7UA 3CZGA 4WQ6A 3EA1A 4IOTA 2GSEA 2ZXDA 3B8VA 4S2CA 2PDIA 5A6JA 1RUSA 1OQFA 4OTKA 3TZNA 3C56A 1A49A 1RJRA 1JCJA 5MHBA 2W27A 4DI8A 4NG3A 4MIMA 4MNLA 2EO7A 2EJAA 1I6NA 3CZLA 1W32A 4LVBA 2QVNA 3TTOA 3OEXA 3WZ0E 3RXZA 1UB3A 4NU7A 1OGBA 4UMBA 3E2RA 1ZZMA 1ODUA 1BPLB 4QJ1A 5BYWA 4H8NA 2WCGA 1QPRA 4KCTA 2A0NA 4E5TA 5DCEA 5TBOA 3T0DA 4L6OA 4YL2A 4YCOA 1D8WA 4FI4A 2G3FA 1HL2A 2VX7A 3TNOA 3I7RA 5A95A 2D22A 2Z00A 4ZB0A 3S1XA 1UWAA 1VH7A 3OLIA 4NT0A 4DF1A 1KM2A 3E2VA 3ZWTA 4H00A 2ZA1A 1OFAA 4QJ4B 4PTWA 3S6OA 4DJFA 4L80A 4V2XA 2V6AA 3S5YA 3U2CA 4GVFA 3NZQA 4P8XA 3RLUA 3WNNA 4Z1YA 2OMAA 4H2HA 4AD5A 2PGRA 1JZ7A 3KDNA 1EBGA 3DKLA 1H41A 4LS2A 1BLIA 3HU7A 3CO8A 3T4CA 3B04A 4YTSA 4ICMA 3DZ1A 3HURA 1R8LA 3ZFHA 3QN3A 1PS9A 2NLIA 1FHUA 4NI3A 3IRDA 5AHNA 4UB9A 1JZ3A 3Q2DA 3L4YA 5TNVA 1VYSX 1NWUA 2PDBA 1POJA 2EPKX 4JIHA 3G0XA 3UWVA 2OT0A 4JNMA 1CLVA 3ZR5A 1E70M 4GY1A 1F76A 1RR2A 2NZLA 4HOWA 5C55A 4NSBA 3WJZA 3VD9A 1RJPA 1W3KA 1TREA 1A80A 5D9PA 3HQ1A 1K02A 1Q6CA 4NJJA 3PTDA 4HQVA 4Q8VA 1KV5A 4H2CA 1OVDA 5KINA 4UFKA 5DY3A 2L5HA 1RY8A 2R1PA 1DP0A 1U22A 5CJ5A 5D4YA 1QI2A 1GZGA 1H63A 2PDUA 5HWNA 4RNHA 1E72M 2AAAA 2ZZ7A 1V0MA 5C9RA 1S5VA 5H1WA 2XGBA 4IQJA 1S38A 2C19A 1E1CA 2WMGA 3PPFA 4H9MA 2D73A 2NQJA 1EKOA 2JEPA 1LTDA 3PSWA 4UTWA 3WNPA 4JGDA 4U2ZA 4YWSA 4F40A 4H3DA 1C9DA 1R7AA 3G1HA 3UT0A 2ZTKA 3RR4A 2FZ8A 3GNPA 1E73M 1BYBA 1UUMA 4Z0SA 2AL1A 2GSJA 5JH1A 2YCIX 3PZVA 3EWYA 3CC1A 3WDQA 4ZQCA 4PUEA 4WR3A 4JR5A 4F2BA 2PLJA 3H26A 4O28A 3VK5A 4AAJA 3L0GA 4FEZA 2GOUA 3CH9A 3TC3A 3HQNA 1VD6A 1S2WA 4DJFD 4PMRA 4UTJA 1GK8A 2BXZA 3LPFA 2CZVA 1W5OA 2QCHA 1V8EA 3AMGA 1VFTA 1QATA 2XM2A 4H6EA 2J7BA 2FTYA 3EX3A 3FA3A 5FJIA 5EGRA 2VC5A 2R1MA 4GVHA 4Q4QA 1DJIA 2J9XA 4IFKA 1UOZA 1YKWA 4XX6A 1A4LA 1WUEA 4JFVA 1OCBA 2Z1BA 1TE6A 3VM5A 1CGXA 3G22A 4X61A 4KERA 2RUSA 2QEZA 2XFFA 1KBIA 4C6PA 3H6OA 4W9TA 4UTTA 3DYPA 2G41A 2A3CA 2HSAA 4MPQA 4B90A 3GXNA 3NNTA 3OPSA 4A29A 2C0HA 1XFBA 1DYSA 3WQDA 3R0KA 2X1RA 3KVJA 4EPEC 4UQBA 4HYWA 3QH2A 2Q6ZA 2QMJA 4WDWA 1IEVA 4HNVA 3LCIA 2P53A 4UTLA 2VWTA 4Z0JA 4L6DA 2F8QA 4UQDA 4ZL1A 4K8GA 5M5DA 1UZ4A 1XH0A 1XISA 3WELA 2R1NA 3WL1A 3AIVA 3KLLA 4PH6A 2VDIA 4MPKA 3F7JA 1BSIA 1HKIA 2ATMA 3CL8A 4GZ7A 3EMCA 3U3HA 1O68A 2E3ZA 2Y0FA 4O52A 2JGQA 1TTIA 3W7QA 4O50A 1EA9C 3I68A 1LBFA 1WDQA 1B5TA 1HQTA 3MBDA 3RLVA 3DESA 2X1UA 2OWCA 4LUIA 1UR4A 2FVKA 3KFTA 4HHLA 2YGYA 2NVAA 3BPWA 1C8VA 4D8AA 4A6GA 4P7RA 3PJUA 3EWWA 2AMXA 2C14A 4PUMA 3AAMA 4XWUA 3VM7A 4RX0A 4AD2A 3EDDA 5A8GA 3KOFA 4GNJA 2OLAA 3EWUA 3PC0A 2A6NA 3WK3A 4HPNA 4TX6A 2EHHA 1FWWA 4WXYA 4C7GA 3H8AA 4GINA 4PTMA 2B4GA 3I4EA 1GOMA 3DFTA 4Q4KA 2ZC8A 2HISA 3WD1A 4JL1A 2ISWA 1E5NA 2XVKA 3EDKA 1UD6A 3FGCB 3CBWA 2ZZ2A 4P8VA 2C1HA 1JIBA 3UYIA 2VI0A 3BC9A 4EX4A 2WYSA 1JXKA 3F4VA 3BGJA 2GOKA 3C52A 3TYCA 1E9LA 4D6IA 4U28A 3FA4A 1D7KA 4I90A 5D03A 3TKFA 3O05A 3IK4A 5HR6A 4WEVX 3E3HA 4S39A 3UETA 1LRNA 3RCMA 2NXGA 5AB3A 1R3VA 1YX1A 1UW9A 1OF8A 3NL5A 1C93A 1PDYA 4QDWA 3TP4A 3AZRA 4PL1A 3SM0A 1QAPA 3U0HA 1XYBA 1C3FA 5HJYA 3PTKA 3WNKA 4M82A 5HBFA 5HQMA 5AHIA 5H8UA 6TAAA 2YLAA 3VGEA 8XIMA 1TPUA 3FJLA 5FOOA 1K3UA 4GC4A 1OK6A 3FLUA 2ACQA 3ZVIA 4DHGA 1X7FA 3LZ5A 3N2BA 4FPSA 4H4IA 4FR6A 2ZZ4A 4DXVA 1W54A 1EP3A 1TUXA 4M24A 5K2ZA 3NFUA 3L67A 2AKZA 4TMCA 4HN8A 4J40A 3CAVA 3KOZA 1ZP4A 3RMEA 1BSLA 1XH1A 1O12A 2E68A 4IPIA 4AIUA 2CLFA 2OX1A 1TUFA 5LNUA 3R4IA 5M17A 2FH6A 3L5LA 2QPUA 3BMVA 2DW6A 3R79A 3RLGA 3QTPA 2Z1SA 1TVNA 4O4WA 3B3DA 4O1BA 2JF7A 3KHDA 4P61A 4LBUA 3ITYA 1JDAA 1ONWA 4C91A 4CUCA 1HFBA 2ACSA 2YXGA 5IM51 4AZ7A 3GBEA 3NDOA 4YVPA 1KM0A 4GI6A 2VRJA 3EB2A 3P80A 2PTWA 3EGJA 3UZXA 4WY0A 3APYA 4AEEA 3AIWA 3A5FA 3KL5A 3G1FA 1ZL1A 4BJHA 3TQKA 3BQ6A 2J8GA 3JVAA 4AMCA 1F05A 2C1IA 4O18A 1CNVA 2YPIA 1KFKA 3QPYA 3LM7A 4RR4A 3V36A 1BF6A 2C1GA 4J28A 1HO1A 3SCSA 4Q7BA 2E5CA 4UFMA 2XISA 2DZVA 2NX3A 3M7WA 2QUTA 1EA0A 1C91A 3CPGA 3PR2A 3IRSA 2BXVA 3SW6A 4ML4A 4MLJA 1O5RA 3FK4A 3PS7A 4W7WA 4F2UA 2VWSA 3KRZA 4OWGA 1US0A 4JTRA 2PLMA 1FDJA 2R6OA 3VIOA 2CZFA 2NXIA 2VEKA 5EMKA 1JYXA 4REQA 5DXYA 1EDGA 5HWMA 4GXPA 3LCGA 3TQVA 4LCRA 3NPUA 4H19A 3Q65A 4A8IA 2XVPA 2RDTA 3XINA 3C86A 3VGHA 2J77A 3WK1A 3TA6A 3THDA 3LQGA 1I1WA 5RUBA 2EPNA 1YXDA 3MZNA 5AY7A 1GG0A 1XD0A 3LHUA 1POKA 3M5ZA 1E0WA 4LUTB 3S5ZA 1OYBA 2Q3OA 3I10A 2W0UA 4RK8A 3S5SA 4MMWA 5HMEA 4BFAA 3M0VA 2UY5A 4F66A 2PBOA 1WXZA 1DORA 2X0YA 2VFHA 5F4XA 4YCPA 4GJJA 3ABRA 3GNOA 3VFCA 3U2ZA 3HGOA 2J7CA 1PKYA 2RJHA 4P7NA 1NWSA 2A3AA 1KQYA 4M80A 3UXDA 1V5XA 1EQPA 1TJ2A 5BNKA 1AK5A 4TMBA 1B3OA 2Z7GA 4LANA 2YKKA 4KS0A 1TMLA 1TCDA 4J3SA 4US6A 1ZUAX 2X1IA 5J5RA 4KETA 3II1A 2ZRWA 4LCQA 1LLOA 3M6DA 4MUZA 3V0SA 4CCZA 1PTGA 1KFWA 1CWYA 5LA2A 1TPWA 3WUFA 3ARYA 4H9UA 4H9XA 4DQWA 1JUBA 4K1WA 1IGWA 3S1VA 2D0HA 5A3HA 4HYRA 1QO2A 5LSMA 2ZE3A 1TB3A 4PCSA 1Z41A 2HE8A 2BASA 3RX3A 3H2EA 3TSDA 4HP5A 1GPWA 2OOGA 3V35A 3WQFA 4C6BA 1MXSA 1V02E 1QI5A 2PTXA 2NQ5A 4KF1A 2V38A 1MVYA 1NFBA 1GJPA 3BSHA 2WJFA 1G6CA 2BX7A 2VZVA 3P2VA 3W22A 2W67A 3R58A 4R3UA 1SW3A 3LS9A 3PK7A 4Z1AA 1QUMA 1AQ0A 1E3XA 4KWWA 4M7SA 1EGVA 1A53A 3GG0A 4LOCA 2VEFA 1EXBA 1XGZA 2BHUA 3LCFA 3KOYA 2C7FA 3W1RA 4KWOA 2P0OA 1IWPA 2CZ5A 4QDMA 4FP1A 3T09A 4WVXA 2W79A 1MYRA 4Q8TA 5AFDA 2B7QA 1ELSA 2GUUA 4OBTA 3NYZA 4X9SA 1WNOA 4AZIA 2OT1A 2DZXA 5GVJA 3LLDA 2ZVRA 4Y8EA 2FB2A 3AHTA 3WKZA 2HXUA 1A5MC 1BF2A 3DGBA 4M51A 4ROQA 1TJ1A 3LI1A 4JIIX 1WOBA 2HNEA 2YX0A 3RG6A 4DUVA 1V08A 1YEYA 2PDXA 1QWKA 1FWCC 1OM0A 3W72A 1OIFA 5T26A 1QHZA 4Q3MA 1XSKA 3ENLA 1UWIA 2E0PA 3W86A 3H2AA 3TR9A 4O15A 3FKKA 1LORA 1RY0A 2HCVA 1W5NA 1EC7A 3ALGA 4DO5A 5M1TA 2ABAA 3EOOA 4WHBA 5DO8A 5BCAA 4FOKA 1F07A 3UEQA 1FKXA 4DIAA 3BAKA 2EPHA 5L9FA 1DBTA 1F4AA 3P60A 3POCA 4H6RA 3AQUA 1GT8A 1CX9A 4LB3A 4J7RA 4WSJA 1VJSA 4UNIA 1F73A 4X63A 5C2GA 1OFDA 1J2WA 1GQNA 3L2IA 4AU0A 3N6HA 5CBIA 3ELFA 3HV9A 3BLFA 2WANA 3DHFA 1UBPC 3ITLA 1XPGA 4NILA 3OYXA 4LBSA 2OEJA 1UC5A 3R10A 2GQAA 1VIZA 2O9OA 4HZ8A 1J5SA 3NQEA 3AS0A 2DZAA 3GVGA 4GI9A 3TLQA 1W5PA 4AW7A 1XIFA 2JEQA 2Y62A 2ZX7A 1VEPA 2Q8LA 4L65A 1LLZA 2DSVA 3B8TA 3QYSA 5EMLA 1DQWA 2C79A 2FYMA 2CNCA 3BAYA 1L8NA 2J27A 3DOPA 5A8PA 5JBFA 1RPKA 3C0QA 4ERIA 1VAHA 2FZDA 5CPOA 1HG3A 3QEZA 2QMKA 5DCDA 4E4PA 4L1XA 3A12A 2HROA 2EEXA 1YDNA 1HP5A 4BI6A 1BRLA 3OZYA 3AISA 3URBA 1UR3M 5TIMA 4ECLA 3OZOA 1NAL1 3PFMA 3GRIA 4OFCA 3EKGA 2DQWA 3TN4A 1E40A 1G5AA 2V81A 4P7QA 4EXBA 9RUBA 3HPXA 5FJRA 3S2JA 3OU8A 3USZA 4GX8A 4HU4A 4HK7A 1GVQA 2Q8XA 2ZQ0A 4A3UA 1EYWA 3BW2A 3N6JA 8RUCA 3IK2A 4OT7A 3R5EA 2VURA 1EXPA 1ISZA 2QHAA 4MSSA 2PUZA 3ES7A 1IV8A 3D5HA 5DANA 3TSBA 3W7KA 4F48A 5U4NA 3MA8A 4YVVA 1IT7A 3VO0A 4MWAD 3VOJA 3VIGA 1ZSXA 3DHUA 2WWCA 3LTSA 3PZOA 3GXMA 4M6QA 1QW7A 3IIZA 4L9ZA 1QHPA 3H55A 2R94A 2PDYA 3CS2A 2I16A 4ZMGA 3ANVA 3N19B 3MANA 2QIWA 2YA1A 1SW0A 3UG4A 1EIBA 4XD5A 4O12A 4M19A 1V3MA 4HNCA 1LYXA 3PPHA 4TX8A 1XCXA 2CWXA 2Y8UA 3P7YA 2CBVA 4EPKA 4C6LA 4IX2A 1NOWA 1VBRA 1PO9A 1JPHA 4UC5A 4EK7A 1H50A 1SQ7A 4F9JA 1YPIA 4UQ9A 4G8TA 3QV8A 4Q4PA 2QV5A 3I7SA 3IAQA 1MW0A 1BYCA 1YPXA 4M7TA 1VLIA 2Y7DA 4ATWA 5I3HA 2GJPA 1DHPA 2I1OA 4C6DA 1YPFA 2VNCA 4AF0A 1LUCA 3M5YA 2XN0A 3QHNA 3UXKA 4CNUA 3R8RA 1HKWA 4MLRA 1F6KA 1I60A 2F84A 4MHBA 4EXAA 2QPXA 2CERA 1GNXA 3PG9A 2ASHA 4MJMA 5DELA 4HPGA 3GTIA 1L6WA 3PM6A 1DHKA 4UTTC 3UZJA 1WCGA 1LL4A 1F5ZA 4L1GA 1SMAA 3K4WA 3PZ9A 5G4WA 2DUZA 2OGYA 4GI8A 2IKHA 1QJWA 3W38A 2PTDA 1QNRA 2NUWA 4OGZA 2D2OA 3NQGA 3W25A 2Z27A 4TOQA 4FB7A 4FXFA 4PMDA 2QLYA 1AH0A 4NX0A 4CNNA 3L21A 4XUGA 3GKFA 2XU2A 3M6YA 2W4XA 2PWFA 3UR7A 2OR2A 4WGXA 4PMQA 3W7JA 5B7YA 1SZRA 3T9PA 4FF7A 3PHAA 1NM9A 4JN6A 3BMXA 1QOXA 3AHYA 4DUOA 1BKHA 3VOFA 5GJPA 1O1ZA 2EKGA 3FVMA 2VOTA 4KRZA 2Y24A 1GYMA 1Z32X 3D3FA 1CB7B 3EAUA 2F2KA 4E2DA 3GTHA 2BLEA 2WMKA 4GKLA 1LF1A 3OQ8A 1MRQA 1IYXA 3FYYA 5I09A 4B5NA 2V3GA 1BRLB 5B7ZA 4K68A 1KLYA 3NL2A 2NQ9A 4FXSA 3W7DA 4I7VA 1ODZA 1UYQA 3L4UA 5D33A 2UZ9A 1TR1A 3GAYA 1TRIA 1GOKA 3DEQA 3L5MA 4OHQA 1D2KA 2CHOA 3W76A 3TOPA 3BH4A 5DBTA 4GK8A 1RXOB 4EWND 4E8DA 2XVNA 1V6UA 2D2HA 3WUGA 2HDJA 1E6RA 3C8FA 1SVDA 3WNLA 1OK4A 1I1XA 3RILA 5D04C 2MUCA 1LBLA 4XD4A 3TROA 4A8LA 1H2JA 5AYXA 3ZWSA 1JAEA 1W9VA 2VVNA 4X0NA 3E0VA 1Q6GA 3G6LA 3M43A 4KEUA 3T2QA 3OZMA 1CGTA 5AECA 3DFPA 4PMZA 4C7DA 4DJFC 3A23A 4KMQA 1W8SA 4AFYA 3VNZA 4UTUA 4PRWA 2ZXQA 3URQA 3VZYA 2Z1KA 5JIWA 2VJXA 1SR0A 4PBFA 3W7GA 2BOFX 5XINA 3DFYA 5AHMA 3CZEA 2DIJA 1PHWA 2JF6A 3W27A 1F3XA 3DBNA 4DBDA 1CCWB 3WIJA 3RR1A 3WQPA 3VKAA 3T2OA 2CLPA 3TN3A 3W3OA 2V5CA 1PX4A 4H9TA 1M53A 1JUKA 2G4JA 3QV7A 4NXKA 3CB8A 3U5UA 1HKMA 4XZMX 3UJFA 1V03A 3W6LA 1Y65A 5CKSA 2GGGA 3CYJA 5K4XA 4N4QA 1KFJA 1UWRA 2XINA 1ISYA 2A3BA 1J79A 1DKWA 5EL1A 1FWFC 4LU0A 1IWBA 2G97A 4NAEA 4FXRA 1ZNNA 2V68A 2O9TA 3P14A 4S3FA 3NM3A 1WX0A 2CFFA 4D72A 1O6IA 1WBHA 3GQYA 3GFXA 1E6QM 1U5HA 2V3FA 4FIQA 3BJTA 5F2LA 3UWEA 1KM1A 1XKJA 3AU2A 1LRQA 1SFLA 1UOKA 4A3YA 1SYTA 2WNQA 5GNZA 3DUGA 3VX0A 4UTWC 2VMFA 3GLCA 5F7UA 3PPGA 5HATA 4JN7A 1OFRA 2IPJA 1NOFA 1GKQA 5FF2A 3PZGA 4HBKA 4BQ2A 3F4NA 1AJZA 3G0SA 1MFUA 4HZ7A 4F0RA 2DVUA 1DJZA 3ICJA 4JD4A 4XUYA 4C90A 3WLIA 4IX0A 1MSSA 4HK6A 1JD9A 3HN3A 4QP0A 4ATDA 2JK2A 4H7CA 3BOXA 3LRMA 4EAMA 2P8BA 2VHLA 1S5TA 4JQ1A 3SZ8A 5D2TA 4X3ZA 1TWWA 5HNUA 1HW6A 4S3EA 1VJIA 3QQ1A 3EOSA 1W1A1 2VEIA 1V79A 3KOWA 2PP1A 1MMFA 3TAKA 1P0KA 1MQRA 4PUDA 4CD4A 3PUEA 3VGFA 3BARA 2WC4A 5HOSA 1TPFA 3SRFA 2ZIDA 4GMEA 4DYKA 3C0JA 4HPJA 3MY9A 1UZHA 4FK9A 1JL8A 2VFIA 2O55A 3ZQ9A 1NU5A 5BMWA 1VS1A 2Y5EA 4AD0A 1YTEA 1DJGA 3FHQA 1SU5A 7REQB 1KBLA 2FJUB 1YLVA 2DU2A 4GACA 3W4RA 6XIMA 2V5BA 3LK6A 3RN6A 1OSEA 4FO4A 1E0UA 5CQ1A 3BL3A 3N13A 4NXSA 4JCMA 3VINA 4ZO6A 3CO4A 4Q32A 3P82A 3H24A 4DWDA 3UQNA 1MO0A 4RJEA 1SSDA 1HJQA 3T0TA 5C9UA 3PBGA 1PV8A 1UH3A 5CZKA 3AYRA 1XIBA 2HPIA 1UIOA 1B9ZA 1GOOA 1XBZA 2OCZA 4M81A 4JOMA 1RQBA 2V5JA 3CUHA 4Q6XA 3E12A 3RO8A 4B9YA 4DO6A 4UMCA 1DPMA 4PSPA 5CJNA 3LMYA 2E9LA 4WF7A 1LQ2A 4PN2A 4NZ3A 4GZEA 5DFAA 4IH3A 1OX6A 3ZMRA 2PS2A 1GOWA 2HBVA 1ONEA 3SRDA 1Y8BA 3UFYA 3BTNA 2VP8A 2X1TA 5I03A 4LY4A 3H7VA 3S5NA 4IMFA 4L56A 4IFOA 2Y89A 2ODOA 3ITXA 3VIMA 1Z9AA 4EF9A 1UZDA 4QJ3B 1C92A 2A3LA 4W7UA 1XLLA 2JALA 5CAKA 3STFA 5BOFA 2QGYA 3ORWA 4WJ8A 1OHLA 1RSCA 3IJI