5CPMA

Xena from pseudomonas putida in complex with nadph4.
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
359
structure length
359
Chain Sequence
SALFEPYTLKDVTLRNRIAIPPMCQYMAEDGLINDWHQVHYASMARGGAGLLVVEATAVAPEGRITPGCAGIWSDAHAQAFVPVVQAIKAAGSVPGIQIAHAGRKASANRPWEGDDHIGADDARGWETIAPSAIAFGAHLPNVPRAMTLDDIARVKQDFVDAARRARDAGFEWIELHFAHGYLGQSFFSEHSNKRTDAYGGSFDNRSRFLLETLAAVREVWPENLPLTARFGVLEYDGRDEQTLEESIELARRFKAGGLDLLSVSVGFTIPETNIPWGPAFMGPIAERVRREAKLPVTSAWGFGTPQLAEAALQANQLDLVSVGRAHLADPHWAYFAAKELGVEKASWTLPAPYAHWLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xenobiotic reductase
publication title Better than Nature: Nicotinamide Biomimetics That Outperform Natural Coenzymes.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 133
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5cpmA00
1OHLA 1N55A 4WD0A 4NJKA 4DO5A 2C13A 3KVKA 4UFHA 1R30A 4I7VA 4K7YA 3BW3A 3MWAA 3LOTA 2A5HA 5TQLA 3TH6A 3PBVA 4LS0A 3W7LA 4XZ9A 3DFPA 1O5XA 2C1HA 2YPIA 1TPWA 2Y63A 1JCLA 1PS9A 3P80A 4DPQA 4UTWA 1W3NA 2GOUA 1TPVA 2CLFA 3K30A 5BW6A 1VJIA 3B04A 3MYPA 3C52A 1N7KA 1L9WA 2X2GA 1QPNA 2AGKA 5FF2A 2NUYA 4FX7A 1ALDA 3W7MA 3BVJA 4RXGA 4NU7A 2WSYA 3QQ1A 2CW6A 2J9YA 3HF3A 1JCMP 2V2HA 4WOZA 5K3VA 4ZL1A 1LLZA 3WJYA 2W0UA 3TUUA 1KM4A 3I68A 1O95A 1KA9F 2BWGA 2X1SA 2WJZA 3IEBA 4JY8A 2YFOA 2VFIA 5C54A 3N19B 3C2VA 3HPZA 4FO4A 1QNVA 4M7SA 5TIMA 1LORA 3LLFA 4XKYA 3FEMA 3P8JA 3W9ZA 1Z41A 1ZHAA 4LTSA 1HO4A 3S1WA 3EWUA 1CX9A 3M5ZA 1V5XA 1H63A 5C55A 3W7KA 5FEPA 1Q6QA 3GX9A 3DFOA 1K02A 5FI8A 5AYZA 1Z44A 4WXYA 3OEXA 3NXFA 2TSYA 5E93A 2YYTA 3LCGA 1QPOA 2BLEA 1GJPA 5HNRA 4JTJA 4OU1A 3W76A 3UPBA 1M7PA 3I7SA 3PC0A 3H53A 2CZEA 3F03K 3N14A 3N34A 4OHQA 1PHQA 5K9XA 6TIMA 1BKSA 4GXMA 3A9IA 1OFAA 3FYPA 3NZRA 4A22A 4CNNA 5K9CA 1KFBA 2D73A 2WOQA 4LT9A 4LVBA 5F2MA 3QH2A 4RXFA 3QW3A 4AVFA 1RVGA 1JQXA 4JN6A 2HS6A 1HL2A 2JKAA 2Y7EA 1FWWA 1B57A 3TIMA 4RZ5A 2UV8G 3CC1A 1GQNA 2C3ZA 2RFGA 2QUTA 4JTSA 2R8WA 4UCGA 3PR2A 3USBA 3W7GA 3L67A 4YMZA 3LHWA 2Y70A 3B05A 3EX6A 2G95A 1JULA 3DH7A 1F5ZA 2XN0A 3MO7A 3DKJA 3G3MA 3IRDA 1YTDA 3W2UA 4QM1A 4XWUA 5AHMA 3P5YA 4H6KA 4FF7A 3W7HA 4E2BA 1T99A 4AB4A 1DKWA 4XBKA 2OZ0A 4PC8A 4O13A 4QJ1A 4NX5A 3GDTA 4WY0B 4ALDA 1LROA 4XUGA 1AW1A 2A4AA 5AC8A 3BV4A 1WYIA 3BPWA 2X16A 3W7QA 3UZ5A 1TV5A 2V30A 4X3ZA 4UMCA 1TV7A 3TMQA 3S6DA 4HSOA 1QMLA 1X8FA 4WUIA 3L66A 1LRQA 5LKYA 5CZ0A 3MMTA 1DVJA 3E9AA 2E1DA 2QJIA 1W3IA 2IQTA 1RQBA 4JGDA 1H7NA 2QCDB 2PE4A 4R34A 1TPDA 1P0KA 5A5WA 2NV1A 4JXCA 4BK9A 1LRNA 3L5AA 1KM3A 4O57A 3STGA 2NV2A 3O6DA 3THQA 2QF7A 1H7XA 3BW2A 2ABAA 3G3DA 1B4KA 2V5LA 4IX0A 4N4PA 4XQ6A 1T96A 5FF7A 3R2GA 3RMJA 1GTHA 2E6FA 2YR1A 3TW7A 1PE1A 1SO3A 3MUXA 3W7OA 2CLHA 1LOLA 4DF1A 1OFRA 3UD6A 3W1TA 2NZLA 1B4EA 2VOMA 3T7VA 3LHVA 4CQ8A 4JX6A 1R46A 2NUWA 3Q94A 2AAMA 3IGXA 2FPYA 2FQIA 1WQ5A 3BGJA 2A6NA 3WJXA 1O60A 5EBUA 5J5RA 4BI7A 3T40A 4N2YA 3ABRA 1LP6A 3M9YA 4UR7A 3WK0A 1HUVA 4CNPA 3B0PA 4NNAA 1VGAA 2X1RA 1DL3A 4Z1AA 3DAQA 1OVDA 2NWRA 4YWIA 2A7NA 1F05A 4W9TA 2WNZA 3O63A 1VS1A 2H8XA 2OJPA 2QCGA 4GFSA 5DY3A 4D2JA 5G4EA 3OHIA 4LVAA 1QPRA 3W1XA 4Z1BA 3DBPA 2ZA3A 3IV3A 5I3GA 1JCYA 3DFSA 1N8FA 3SY5A 3W7JA 3FJ6A 3NQAA 5HJLA 3PSWA 3QPYA 1ZFJA 3IVTA 1TTJA 2X1UA 3DU0A 4UTHA 5EPDA 1AW2A 1NF7A 1WXJA 1RV8A 4NUWA 3HOJA 2J27A 4O0KA 5G2HA 1YXDA 4RZ6A 4NJJA 3S5OA 2VFHA 4NQ1A 2VEIA 2PRHA 3QM3A 4LRTA 4KKXA 1TIMA 2YW3A 3LRMA 4IX2A 4GE8A 4A21A 3M7WA 1PCWA 1EWDA 1JCNA 5DXXA 3S1XA 1MZHA 1GEQA 2YXGA 4O8RA 5DLCA 1OX6A 4U28A 1LOQA 1H60A 3EWBX 3UWUA 3FJLA 3PUDA 3SGUA 2A7RA 3TCEA 1SU5A 3LCIA 2B0MA 3MBFA 1MO0A 3GKFA 4NZFA 4C1LA 4L4MA 5E1QA 2DJLA 1LZOA 4RR4A 3F4WA 4JD4A 4X22A 3KVLA 3HG2A 4B5NA 1VRDA 5F4XA 4MOZA 4K36A 1S3HA 5D09A 1W3TA 3DI1A 6ALDA 1LM1A 3NQGA 3L21A 4UTWC 4WOQA 2J9ZA 3LGEA 1FXPA 3TMLA 5LNSA 1TB3A 3LTPA 3KVMA 3KAOA 3NDOA 4Q33A 3CM4A 3TK7A 2QDHA 2Q8LA 1PIIA 2ZRZA 4JR5A 5KTLA 1OFDA 3B03A 3CWNA 3W6YA 3BLEA 3GAYA 1PHWA 3DHFA 2O7QA 3R13A 2VEKA 1TRDA 3QFEA 3G0XA 4ORMA 4K38A 3N2XA 2VKZG 2VFDA 5LGZA 3LRLA 2H3DA 2I9EA 5DELA 3BG9A 2RDWA 4FX8A 3MBDA 3EB2A 3P62A 2VFEA 4RCXA 2Q8ZA 5CPOA 2EHHA 1L2UA 2WPBA 1W5NA 1LYXA 4UMAA 1SO4A 4K8HA 5FF3A 3NQ2A 2YGYA 3HIJA 5U7SA 2AQWA 3LHYA 4BI6A 3G8EA 5F2LA 2VFFA 4AF0B 2GVLA 1G4TA 3LRKA 3P67A 3DFQA 3MW7A 2WNQA 3QYQA 4JTGA 1KM1A 3RNDA 3W2JA 2Z6IA 2C16A 2BTMA 3DKLA 2Q3RA 4TO8A 1XI3A 1OFQA 3OVQA 2C0AA 4MKNA 4TIMA 5HUPA 3WK3A 1AL7A 5AHLA 2RDUA 1K03A 2R94A 2ZZ3A 3TFXA 1ME7A 3VKJA 1ZNNA 1UUMA 5HR7A 2HMCA 2ZA2A 4JTLA 3VNDA 3W2KA 2FPTA 1UASA 4UR8A 1H5YA 1JRCA 5F4SA 1K3UA 1OYBA 3ABQA 2YCEA 4HT3A 4S1FA 1LBMA 4L4LA 1SZGA 1TPUA 2OCZA 4QITA 1R2TA 4UTLA 4H3DA 3WFAA 2ZRUA 1SW0A 1MEHA 3H54A 4JIQA 3EEGA 4UIOA 4NT0A 5MHBA 1JRBA 5I3IA 5FEZA 3JRKA 1Q6LA 4OGZA 5AN7A 1SFJA 3G1XA 4K6AA 3UPWA 3JS3A 4MFDA 1WOAA 3VCRA 2FIQA 4I7UA 3VE7A 2ALDA 1A5CA 5D2VA 4M5PA 2J9XA 3NQFA 4YL2A 3ATZA 1GG1A 5BNKA 4KWVA 2QAPA 4OBTA 3HG3A 3OBKA 4ZMGA 3LCFA 2F84A 4IMEA 4PCFA 2H3BA 4CNOA 4JNMA 1F6KA 4ORIA 1S5TA 3W88A 3CEUA 3CEPA 4CQAA 3U8GA 3FLUA 4FHAA 4JYFA 3NL3A 3FOKA 1KM6A 5F1VA 3PWAA 3BO9A 4MYAA 2ZRWA 3FKKA 3W22A 2B7QA 4PH6A 4TX9A 1TQXA 5D2TA 1W37A 4DO6A 3PB0A 3LM7A 4G1KA 4Q4KA 3QMSA 3W1LA 1GG0A 1OX4A 1GYNA 2PC4A 4UFMA 1RZMA 4KFNA 1YADA 5FESA 1F74A 2V8ZA 1OFOA 1L6SA 3QSRA 3QF0A 3M47A 4AHPA 1GVRA 3MP5A 2FPVA 4FB7A 2E68A 2QCEA 3HGRA 3W84A 4KFOA 5FEXA 1ZAIA 4RX0A 4UTTA 3M5XA 3P61A 1Q3NA 3GNDA 2QCFA 4IPIA 3W7RA 1UJPA 3MJYA 3TV8A 2XN1A 4UC5A 1DBTA 2CZ5A 1H7PA 1TTQA 3GR8A 1SSDA 3OA3A 4MLJA 2P10A 4FNSA 1HTIA 4UNLA 1W5OA 3SIZA 1VHCA 3EXTA 3LV5A 3PBWA 3BK0A 3LERA 1EWEA 1F7BA 3UY7A 2ZQ0A 1FCBA 4O50A 4TU1A 1M6JA 3C3NA 3L0GA 2ZCGA 5D30A 1OX5A 2ZZ5A 3IIOA 5EA9A 3P8IA 4IWWA 4UTUA 1IXQA 5D32A 3DHDA 1PL9A 1LCOA 3W7DA 3TC6A 2QJHA 4XTDA 3GIYA 2YZRA 4TMBA 3TC7A 2C6QA 1OABA 3QPZA 1JCJA 4ADSA 2NXIA 4X2RA 4OE7A 3W1NA 5LZLA 1H1ZA 4PA8A 4IMCA 4M6VA 1AK5A 3N73A 4N6FA 3O05A 4A2RA 3DI0A 1T8XA 1EP3A 2DORA 5HINA 3E49A 1ZAHA 1OFEA 1BEUA 3E96A 3W3OA 4IOTA 2ZTKA 1KFLA 4I9AA 4CCCA 4N02A 3TROA 4MYXA 3MI6A 3DXIA 1Y0EA 3EXRA 1TYGA 3Q2DA 1A5BA 5KZDA 1I2PA 1I8JA 1VYSX 4DXVA 4DBDA 4PEKA 2Z6JA 1G6CA 3FIGA 4K7VA 3STFA 3IIVA 3O16A 1XBVA 1IIHA 3WK2A 8TIMA 2TRSA 2ISWA 1JQVA 3C8FA 5CGQA 3GZ3A 1J2WA 3M0ZA 3WJZA 2TMDA 1R2RA 1WA3A 1DQXA 3R12A 4UTKA 4MIMA 4RV8A 2CLKA 2EKCA 3W86A 3CU2A 3P84A 1FCQA 5T26A 2OT1A 4HPJA 2EAWA 3ABOA 3WK1A 3I6RA 5EKYA 3BLFA 1JUKA 1Q6RA 3NPVA 4FNRA 3W75A 4POCA 1ZCOA 1VYPX 2V81A 4O53A 4HKPA 3O06A 2QCLA 1D9EA 3TSDA 4EVZA 1FWNA 5U4NA 4MY8A 1SW3A 3LTYA 1TO3A 3QJAA 3S1VA 3LXCA 5HWJA 5EMUA 2ZFAA 1M7OA 5SWUA 1MSSA 4LC6A 1YLVA 4NJGA 1EIXA 4O4WA 5AHNA 1RQEA 2YYUA 1YTKA 2VENA 1CI1A 3G18A 4WX2A 5AOUA 2ZZ6A 3CT7A 2R14A 4CCEA 3PM6A 4GC4A 5J5DA 1KBIA 2Z2UA 3NG3A 2DZPA 1FWSA 1DJNA 2KZHA 2WSRA 3W7PA 3MP4A 1AL8A 1THFD 4IMFA 3C6CA 3NNTA 4JTUA 5CZSA 4PFMA 4DO4A 1KM5A 2V5BA 3LXBA 1BWKA 3RF9A 4M7TA 3W07A 3TAKA 4R33A 4LC8A 3MI3A 4Y90A 5FF4A 1P4CA 2Z0IA 3YPIA 2GJLA 3P5ZA 1KFJA 3L9CA 3UXAA 1F76A 3MI2A 2A6LA 2HSAA 1A5AA 2TPSA 1G4EA 2JGQA 1FWRA 4GRSA 4H4IA 4JIPA 1WAUA 2C18A 4GWEA 3QW4B 3B8DA 3KX6A 5G5IA 2QKFA 1SUXA 4O19A 1PV8A 2VC6A 1YDOA 3QRHA 2YX0A 5HMSA 3C2OA 5CSSA 3NO5A 5AHIA 3TQVA 1EUAA 1RR2A 1TTIA 2ZDRA 3L5LA 5CZTA 3O1NA 2C14A 4E0CA 4UTJA 4XTIA 4JX5A 1IXPA 4LVGA 5G1YA 4UXDA 3KXQA 3AO0A 4K37A 5AHEA 3S42A 4HNVA 1KLZA 1HFBA 2TYSA 4JTFA 1XXXA 3GB6A 3GLCA 1K7FA 3LXAA 4JICA 1C8VA 2EF9A 1VLWA 2G96A 5C2XA 1TPH1 3GXTA 2NXHA 2FB2A 4A3UA 4QNEA 1GT8A 2DZSA 5KZMA 4FNUA 1XUZA 3EWWA 3PG9A 1X7FA 3S8HA 3OIXA 1UBSA 3HO8A 4GUIA 1W54A 2E5BA 3GDKA 4YXGA 2DZXA 1SSGA 5FEWA 3CTLA 1YPIA 3M43A 2QCCA 4J9JA 3DFNA 4UFLA 4IPJA 5AC7A 3I7RA 2QCNA 3TJLA 3W2LA 4MPQA 3NQ7A 5IM51 3GAKA 1QO5A 3P7YA 2ZYFA 5CZJA 1TPFA 5L9FA 3L65A 3TFCA 2QJGA 3G1YA 4YLWA 3RFAA 2BSLA 1FX6A 2X1TA 3HGJA 1K8ZA 3HMJG 4ADTA 2E5DA 2WKJA 3W71A 2JKPA 2B4GA 5F1UA 3UWYA 2O7SA 4ML9A 3WJSA 5I3KA 1YXCA 3GR7A 5I3FA 3EKZA 3HGOA 4GUJA 4OV4A 1FBAA 3STEA 5DN1A 4UTMA 3RK8A 3W23A 1OK4A 3G8RA 3TAOA 2DP3A 5LNUA 4FXRA 4FNPA 4HNUA 4IUOA 5K2ZA 3MP3A 5KITA 4UTTC 3F1QA 2BX7A 5G2WA 2X30A 4MUZA 3LHUA 1AW5A 3W73A 3E12A 4R7JA 1EPXA 3O6CA 1Q6OA 2NX9A 5EY5A 4GNJA 4JTKA 1X1ZA 4LVFA 3TSBA 5CPLA 4UNKA 1SR9A 4NJIA 5DCEA 2ZZ4A 2A7PA 5HWMA 3E02A 3EX4A 3IIXA 5KMYA 1XKYA 3TX9A 3PS7A 4LV9A 3TKFA 3NZ1A 1ADOA 3KRSA 4AHOA 4Z0JA 4UFIA 4KFPA 3NQ8A 3W74A 4NXSA 2ZRVA 4EWND 1VCFA 4TR9A 2OX1A 1QCWA 4O17A 5BOOA 4AHQA 4XKYB 1OFPA 1W5MA 3EX1A 1JUBA 1YDVA 4AEOA 5K7JA 3A22A 2XFWA 5DY2A 2DJXA 1KV8A 5LGXA 1X1OA 2B7OA 2V0TA 1ICQA 1NAL1 3G0UA 3QQ0A 3W1MA 5CPMA 2W6RA 3Q58A 2E6AA 1ML1A 2J88A 3DGRA 4Y96A 4FEZA 1G7VA 2BXVA 3STCA 2JK2A 5IBXA 2ZBTA 1J4EA 2CLIA 1QAPA 3BLIA 1RD5A 5D2XA 1NF0A 3HG4A 4M19A 1UB3A 2YSWA 3T44A 3CQ0A 2E6DA 1TTPA 3ZWTA 4IJBA 5D02A 4O18A 1FDJA 1I2RA 4A2SA 1EP2A 4EIVA 1O4UA 1EA0A 1FXQA 3BARA 4WQ6A 4O11A 1FQ0A 3A23A 4OWGA 4UUIA 4O4VA 1D3GA 3KHJA 5LSMA 5DXYA 3CHVA 5D33A 2V9DA 1KTNA 1LOSA 1BTMA 3PVFA 2A0NA 3TDFA 1WDWA 2BZNA 3S5YA 1QDSA 3TW6A 2YDAA 3OG3A 3KRUA 2PCQA 3BG5A 4N9CA 3TJXA 3I65A 1HG3A 1KBJA 5AFDA 4AXKA 3W2NA 2CLOA 2QCHA 4BR1A 1LRTA 4HN4A 4IXHA 3CB8A 1VR6A 4Y9AA 1YDNA 3PAJA 1TQJA 2H90A 1TCDA 3W1UA 3A5FA 1Q45A 1I2OA 3G1VA 1TV8A 4N9EA 1WBJA 4NXKA 1DV7A 3N3MA 3SJ3A 3R89A 3UNDA 3LBMA 1I45A 3C61A 4Z0SA 3W1QA 2WO5A 1ZENA 5E0KA 4JY9A 3W1AA 4JS3A 2Y7DA 1VCVA 2ISSA 1LBLA 3N9SA 4LU0A 1MEIA 4ONVA 2P1FA 1IIGA 2I14A 1FUYA 1GOXA 3ZS4A 1GYLA 2A21A 3KRZA 1OK6A 1VYRA 1MXSA 1JVNA 1OYAA 3BW4A 1G69A 3EX3A 4QISA 2P0OA 3D0CA 2ZZ2A 3GVGA 4FIQA 1K7XA 4M6QA 5DBTA 3UY8A 1AG1O 4Z08A 4BFAA 4ZQMA 1EEPA 3BGGA 1SW7A 3W7EA 5LNVA 1K7EA 4O1AA 4DPPA 2QUUA 3S5NA 4JTEA 1I2QA 3G1SA 5LHEA 3IVSA 1L6WA 3LDVA 2XN2A 3EXSA 5KSWA 4QNWA 3LLDA 5AC6A 3LTSA 5H91A 2ISVA 5LNWA 4ADUA 4BI5A 1KFKA 2YW4A 5LHFA 1H7OA 4S2CA 3KFTA 5HR6A 5G1TA 2FTPA 3O6YX 2QEZA 3NQ6A 4O1DA 2VFGA 1C29A 3O15A 3W70A 2FFCA 4LS2A 4O52A 1OYCA 4DBEA 5HQEA 4P2VA 4MZ8A 4E2DA 2E09A 1XL9A 2ZRXA 5F2IA 3IIPA 1OF8A 3N2MA 1V7YA 2B7PA 2B7NA 1KM0A 5K4XA 3W1RA 4LW7A 3NAVA 1G7UA 3NR0A 4GUHA 3C2EA 1LBFA 1VZWA 1TPC1 3H55A 2RHGA 2FB3A 1VCGA 1F2JA 1J5TA 4CCDA 4MJZA 2EGZA 1U83A 3MHUA 3T4CA 3SECA 1SO5A 3G22A 3UWWA 1IXOA 3CPRA 4WZHA 3V75A 3TA6A 1DQWA 5CKSA 5BRBA 2VEPA 1AMKA 2RKXA 3P82A 2V2CA 2GQAA 4IXXA 2EPHA 3NL2A 2CZFA 5C5YA 4HHPA 4WY0F 4PL1A 4AWUA 1DOSA 3INPA 2NWSA 4MZ1A 1Z42A 3GDRA 4LUJA 3I7QA 4C1KA 2OMAA 1D3HA 3EWXA 4Q32A 2HS8A 1QWGA 2JBMA 3HPSA 1W8SA 3PUEA 3VI2A 4OQVA 1OJXA 1F6PA 3LBCA 4DEFA 3PF3A 1NFBA 2RDTA 1P5BA 4FIRA 5BMWA 3C0JA 2C19A 3PSVA 3S0CA 3P74A 3DENA 3M5YA 2NUXA 3HG5A 2QAFA 3M6YA 4O1BA 4ZVJA 4KWWA 3LCXA 1FCVA 1TPEA 1QPQA 4RZ4A 4JYDA 3ELFA 1GWJA 2DZTA 2QDGA 3T55A 3HJZA 3CIXA 3C56A 1IXNA 4BWLA 4MJMA 3TNOA 3TQ0A 1FDZA 3HPXA 5L6UA 1JJKA 1G67A 3DZ1A 1I4NA 5ABTA 4JTTA 1FCUA 2QUVA 4QQ3A 2NX1A 3SI9A 3ATYA 7TIMA 2J6XA 5KINA 2W79A 2GPTA 2E77A 4TMCA 1TRIA 1DHPA 1VPXA 4N6EA 3W72A 1BWLA 3Q37A 3R8RA 3ANYA 2J24A 3L5MA 3B0VC 3BG3A 2V2DA 3UWVA 2GVGA 4PODA 4JX4A 1QR7A 4OT7A 2ZRYA 3LCWA 1MEWA 2OT0A 3NQMA 2DZVA 1H51A 4MLRA 1CW2A 3G1FA 3TE9A 3TU9A 3RLVA 1SQ7A 1G4PA 4AF0A 1QOQA 1S5VA 3M16A 4M6PA 3PBYA 1NSJA 3GDMA 3ZWSA 3W85A 3QZEA 3FYOA 4S2BA 3GYEA 5D04C 2NX3A 4U4MA 1XFBA 2CU0A 1GVSA 1ZALA 4QAIA 3NL6A 1UUOA 1SZEA 2DZWA 3MYOA 4QIUA 1W56A 3GNNA 3O8AA 3NVTA 3UXDA 2Y85A 1SPQA 1PVNA 4MY1A 3IVUA 5D2WA 3MHFA 5FF0A 2E6YA 3B06A 4RKAA 5IBXC 5EL1A 1EX5A 1WX0A 3IGUA 3EWYA 3NYZA 2A1YA 1TMHA 4ZQPA 5AB3A 2A2IA 1EP1A 3FKRA 1YTEA 4HIBA 3U2OA 2GUUA 4DQWA 4NNBA 3FFSA 4O1CA 5K4ZA 3N9RA 3SR7A 4NJHA 1R2SA 3W83A 1KLYA 1O5KA 4NVTA 4O28A 1H7WA 3UQNA 1LTDA 3A5VA 4X9SA 4LS1A 2RH9A 4WJEA 3PBUA 5F4WA 3S5ZA 2HTMA 4K8EA 1RPXA 1S5WA 5G4WA 2CLEA 3L2IA 4FNQA 3NQVA 3VFLA 1F73A 4A29A 3GK0A 3KOFA 3E0IA 2FJKA 1DORA 1GVOA 5K9DA 1KTBA 2CWNA 1YXYA 1GTEA 1O94A 4E38A 1E51A 4HSNA 3U6WA 1UCWA 1GZGA 4AWTA 3VE9A 4PTNA 5I3JA 3NPXA 4AWSA 1B9BA 3TXZA 4GBUA 5DCBA 2YFNA 3MHGA 4OV9A 1QOPA 2JKEA 4ZQNA 3RLUA 1VQTA 1KFCA 1SO6A 4YCPA 2ATMA 1HO1A 3T78A 3OVPA 4N9DA 4GJ1A 4RJEA 2ZZ1A 5F2GA 4AAJA 1JUEA 4PL2A 2Y61A 2ABBA 5DCDA 2VEMA 4JEQA 5DBUA 3QSTA 2Y89A 1NEYA 5D37A 3HGSA 3OVRA 1XUUA 3DFTA 2GVJA 1XBZA 1W5PA 5CPNA 3A24A 5CG7A 3LHTA 1WOBA 3NM1A 2ZTJA 2FLIA 3NGJA 4NX0A 3W2MA 3LCHA 1H7RA 3C4UA 1VC4A 1KFEA 2Y62A 1A53A 1QO2A 1YPFA 3A21A 4DELA 1OX4B 1XC4A 3L0NA 1IF2A 1W31A 2E5CA 4R53A 1XBXA 1XBYA 2PURA 1R47A 3NQCA 4HNNA 4HNTA 4LRSA 3JR2A 3G1AA 2C15A 2ZZ7A 3IIZA 3B0UX 4FX6M 5BMXA 1GPWA 1T0OA 2VELA 2QCMA 4UMBA 3HQ1A 3HB9A 2NXGA 3M41A 1W5QA 1W0MA 1LLWA 4LUIA 4DF0A 1ZJIA 1G4SA 2LLEA 3EX2A 4IGHA 3GDLA 1ME9A 4IMDA 4LWWA 2Y88A 3B4UA 2Y6ZA 5G2IA 4WXZA 4LY8A 1I2NA 3IGSA 4DF2A 4I7WA 4O15A 3C2RA 2R91A 3NM3A 1EUNA 4RLIA 5AYYA 1GVFA 5LNRA 3QMTA 4JDBA 5AHFA 2ZA1A 3FS2A 3V1PA 3NPUA 3R5EA 1SFLA 2CLMA 5D03A 2CZDA 4EF8A 3RU6A 3P60A 1ZY9A 1VLIA 2V82A 1VH7A 3W7NA 3GXNA 1TPB1 3W1PA 4UFJA 3M1ZA 2CLLA 1TJRA 1C9DA 2Y7FA 3TXVA 4AH7A 3SZ8A 2A85A 4Z1CA 4K39A 3EWZA 4CLMA 5GVJA 3LI1A 3L0KA 4BF9A 5HULA 4IQLA 4IMGA 1K8XA 2ATSA 3NA8A 2DZUA 1ICPA 2NLIA 1P0NA 4Z1DA 3SSJA 4ZQCA 1W1ZA 3ABSA 4GUGA 1GVQA 3WJWA 1M5WA 1VHNA 3KVJA 1H1YA 1KW1A 3W87A 3SW6A 5D05A 1A5SA 3TQKA 5D2YA 3NL5A 3FA5A 1H50A 1KTCA 1L6YA 4MFEA 3O07A 2JGYA 1A50A 4QSHA 3NQDA 4JTIA 3CLMA 1H62A 1ONRA 4BWLC 3QMRA 1SZFA 1SZNA 3G24A 4ZQOA 4N4QA 5HUOA 3LB0A 4O10A 2H8ZA 2F7FA 3S9YA 4GUFA 3NOEA 3NPWA 1Z48A 4WY0A 3PB2A 3G1HA 3C2FA 3LI0A 3TR2A 3HBLA 1JR1A 3UWZA 3UWQA 2GJNA 2WV8A 2CFFA 1QFEA 2GQ9A 3UYCA 1XM3A 3UZJA 3CIWA 4UTIA 5I3HA 3LV6A 1WBHA 3QC3A 3ZR4A 1ME8A 4LNYA 1B3OA 3SFKA 1RQHA 1TREA 1PCKA 2QCDA 1U5JA 3PULA 3M44A 3NEVA 4O14A 2G97A 1KV5A 4XBSA 1DJQA 2DU2A 2G5WA 1KM2A 4Y6GA 1IGSA 1K8YA 2PRMA 4UFKA 2WSQA 1XDMA 3G1DA 2PRLA 4EF9A 4MVAA 2WQPA 1JCXA 3S1UA 1XDLA 1OFBA 2GQ8A 4JDYA 4N9BA 4ZQRA 3LHZA 3EKLA 3M5VA 1OG0A 3ZFHA 3P81A 1OF6A 1NVMA 4EOUA 4Y8FA 1FY6A 2Q3OA 4LOCA 2WNNA 4MZYA 4HPXA 3LX9A 3W7CA 4O0ZA 3F4NA 4NNCA 4LVDA 2Y7GA 1TSIA 3THAA 1YYAA 5CSRA 1X6UA 4FXSA 4JTHA 3TSMA 3GKAA 4YCOA 5A8GA 1EB3A 2FDSA 3GXPA 3PUOA 3CWOX 1FDYA 4P61A 1TJPA 4O16A 1LDCA 4MY9A 3PG8A 3PY2A 3W7IA 4AMAA 5D38A 4CQ9A 2I1OA 4NZJA 3AJXA 4LV4A 5C6MA 3NQEA 1P1XA 5TBOA 1ZAJA 4O12A 1H61A 2VXNA 4O54A 4ICNA 3G0SA 4FNTA 1FWTA 1WV2A 4ZZ9A 5H2ZA 5AYXA 2QR6A 5HWNA 4RK8A 3QEZA 3SGZA 1ICSA 3L68A 4JYEA 5EYWA 1XCFA 3LCLA 2Z1BA 2H6RA 5KZEA
chains in the Genus database with same CATH superfamily
4UOJA 4WD0A 4DO5A 1S39A 2CHNA 3GYCA 4FLQA 3QGVA 1R30A 1PKYA 2P8BA 2OQHA 1B2YA 2A5HA 3NIYA 4QX4A 2BG5A 4PCSA 3W81A 3L4WA 2DGAA 3DFPA 2C1HA 4OOZA 3CHCA 2YPIA 4RE0A 1JCLA 3GVRA 1PS9A 3BDKA 3CQIA 1W3NA 2GOUA 1TPVA 2PF8A 5BW6A 2CERA 4XUYA 4AWEA 1B3ZA 4ROQA 2WVTA 3HV8A 3C52A 2O0TA 2QDEA 5FF2A 2GSJA 3W6LA 2NV9A 4FX7A 2FFIA 2VJXA 4DJDD 2CW6A 1EJVC 1H09A 1W3HA 4WOZA 3A12A 1NWRA 2JEPA 1LLZA 2AOSA 1O95A 2X1SA 2FZMA 3LPOA 1E0XA 2WJZA 4JY8A 4Q8WA 2VFIA 5C54A 3HPZA 3VC5A 4CD5A 4WSJA 1MNSA 3W9ZA 4LTSA 1XGEA 1I1WA 1NOWA 1V5XA 3BCJA 1RBLA 2GDQA 1H63A 5FEPA 4YWSA 4JCMA 3DFOA 1K02A 5AYZA 1BLIA 3P6LA 1NIUA 2TSYA 1GJPA 1C7SA 1ITUA 1UZDA 2VL4A 1GUVA 1DIOA 1PIFA 3K4DA 2BGSA 2ASHA 4AD0A 2CIPA 3NYDA 2CZEA 1BKSA 3ZJ8A 3A9IA 4H1ZA 3NZRA 4A22A 2F6KA 1EZWA 5I07A 3UXKA 2D73A 2WOQA 5DQPA 6TAAA 4LT9A 1TA3A 3ARYA 2NQZA 4UB9A 3QH2A 3QY7A 4RXFA 2DT3A 4AVFA 1RVGA 1VEOA 4AC1X 2WVVA 4JN6A 1XJBA 4KGLA 4W89A 4XVDA 4REQA 1EOMA 3WBWA 2QULA 2VNCA 2R8WA 4UCGA 1BYCA 3ZT7A 2X40A 4ICMA 3DCPA 4KCTA 2G95A 3PZMA 1KCKA 4FS9A 2OZ3A 2QJJA 1S5NA 2XN0A 3MO7A 1KQYA 3IRDA 3W2UA 4QRNA 4GCAA 5AHMA 4H6KA 1PPIA 2GSHA 1E4NA 1T99A 5T9BG 1R3WA 1RHCA 1KXTA 4WY0B 1LROA 2PDKA 1WYIA 3BPWA 4H2CA 2DZAA 4X3ZA 4UMCA 2AAAA 3APTA 1TV7A 3MUAA 3FA3A 1QMLA 1K9DA 2G3NA 1LRQA 4QEEA 4NP7A 2GYIA 4DM2A 5IHSA 1DVJA 2PD9A 2J47A 4MAVA 2E1DA 2QJIA 1W3IA 7XIMA 1FTXA 1NTHA 1QT1A 4R34A 1TPDA 3MTWA 3AS0A 5A5WA 4JFSA 1LRNA 5M3WA 1KM3A 4EAYA 4O57A 4QEHA 3EB4A 4F0SA 2PDMA 2HROA 3G3DA 4N4PA 5B7ZA 1T96A 5FF7A 4L9ZA 3N13A 1PE1A 2ZUTA 1KBKA 1SO3A 1JXJA 1HP4A 4OJYA 2CLHA 1LOLA 3BOXA 3ONBA 4DF1A 3QZ6A 2XZ9A 4V27A 4JX6A 4W7VA 3VIHA 2NUWA 1A47A 3Q94A 2AAMA 3QFWA 2TAAA 3BAXA 1W9BM 3JZUA 1N8IA 3CTTA 3N18A 1ITCA 3T40A 2PBOA 3QHNA 1GPFA 1LL4A 1LP6A 3SRFA 1F3EA 4NL1A 3SB0A 2CBJA 2PTZA 2YXOA 2X1RA 4HU8A 1BQCA 1OVDA 4YWIA 3QTPA 1ZP4A 4W9TA 4UQAA 3O63A 4EACA 3IJLA 2QCGA 5DY3A 5G4EA 1QPRA 4D6CA 1Q63A 2F2HA 3DBPA 2ZA3A 5H8PA 3BLLA 3DFSA 1WDDA 4TUFA 3WBXA 1AQHA 4ZR8A 1XD0A 3M0VA 1XSJA 4XIAA 1TTJA 3EDEA 4NYYA 2WM0A 3DU0A 4H9VA 4JKMA 3R10A 4G7FA 3HOJA 2J27A 2X05A 4ZXLA 3SCOA 3WEZA 4HNOA 4LAOA 4GJIA 3S5OA 3BQ5A 1J6PA 3CPGA 3QM3A 4JNYA 1GCYA 4L5ZA 2YW3A 3M6DA 1DJYA 4Q8VA 3D3FA 1CIUA 3IAQA 5BXPA 1BGGA 1GEQA 2YXGA 4C1NB 2P53A 1A0EA 1LOQA 3EWBX 4ECLA 3ZO9A 5TD4A 3TCEA 4Q4PA 2CLPA 4MDOA 2R1MA 2DJLA 4EE9A 3F4WA 3ARXA 4JD4A 1LG1A 3KVLA 4J2MA 4DIAA 2XFYA 3N6QA 4DZHA 4AZ6A 4H8HA 1XYLA 1S2AA 3LGEA 1RP8A 3T2PA 1TWDA 2KX9A 1S2WA 1KRAC 4M56A 1PIIA 5AVHA 1HJQA 3P3BA 2YLLA 3B03A 1NP0A 3GAYA 4L6HA 3WH8A 2VR4A 1BXNA 4B3KA 3T09A 3G0XA 3N2XA 4GYKA 2VFDA 5MKGA 1XFCA 4GH1A 1KKOA 2C79A 4HBKA 2ACUA 2H3DA 5DELA 1UIOA 3MBDA 3N29A 3EB2A 1S1PA 3QC0A 5DEZA 3BMVA 4W7WA 2WPBA 1W5NA 4UMAA 1IHIA 3P0XA 4C91A 2FH6A 1P0BA 2YGYA 4BQ2A 4OIFA 1K6AA 4BI6A 4WDTA 1TA3B 1MUCA 1XLAA 3HQPA 1KM1A 2BTMA 2Q3RA 2C0AA 1FWIC 3A3XA 1AJ0A 5AHLA 1MQRA 1K03A 3VKJA 1P0EA 1ZNNA 2FPTA 1UASA 2GWGA 1H5YA 2EPMX 1K3UA 4JTAA 3WD2A 2HV5A 3CV6A 4IICA 1C7TA 3E0LA 4H3DA 3WFAA 4GABA 2ZRUA 1SW0A 2DUAA 2EKGA 2INZA 4MUPA 4JIQA 4UIOA 1JRBA 2DSVA 4GLEA 3IPWA 4IIDA 5C0QA 1WOAA 4HZ6A 3THDA 4CEXC 4PUNA 2Y4SA 3AXHA 4KWVA 1Q7MA 2F84A 1PX4A 1GW1A 3MU7A 4EXAA 1V51A 3FLUA 1EGZA 3CAQA 1XQLA 3WBEA 1KM6A 1MFVA 2C91A 4AMCA 1TKKA 4LQ1A 3CHFA 1E1CA 2JQXA 3W22A 5D2TA 4G1KA 5G4HC 3URAA 1IEWA 3THUA 1E55A 2PC4A 1RZMA 4PBEA 3VGGA 1FRBA 4G8TA 1D7FA 1F74A 4C6QA 3QSRA 3QF0A 3S6OA 5FOOA 4WGXA 1GVRA 2FPVA 5FJTA 3UT0A 3W84A 3GNPA 5FEXA 4UTTA 4UQCA 3HMCA 3M5XA 1Q3NA 2QCFA 1TWSA 2WM1A 1ZJHA 3HTWA 3TV8A 4RNHA 4UC5A 2CZ5A 1H7PA 3GR8A 2P5NA 3EA2A 2PDUA 2AL2A 4HYRA 4IIHA 1BSIA 3OGRA 4DAIA 3PBWA 1ZS2A 3RCNA 3LERA 1EH9A 3L0GA 5E0FA 3IJ6A 1OX5A 1O66A 1E6XM 4R3UA 4UTUA 1ZCCA 2CC0A 4J2PA 4Q8UA 5CXPA 1XH0A 1OZMA 1LCOA 3TC6A 2YZRA 3TC7A 4GGBA 2C6QA 1OABA 4LEQA 1JCJA 2VCCA 4OE7A 3WN6A 5LZLA 1H1ZA 2PDXA 1V3LA 3N73A 4N6FA 1UWAA 2GGJA 1B0IA 2DORA 3H8AA 2NVAA 4XKMA 2ZTKA 2V3FA 2XWDA 4DBUA 1KFLA 3OW1A 4I9JA 4GYJA 4MKVA 3OYXA 5I77A 1Y0EA 3Q2DA 1BVZA 5KZDA 1R7OA 1FWFC 4DXVA 4DBDA 1OWQA 1UA7A 4PEKA 3GW3A 1ISXA 3ARVA 4K7VA 3MA8A 1PZ0A 4AZ5A 1FH9A 1IIHA 2ISWA 1D8CA 2Z2BA 3C8FA 2IPGA 4AZHA 3GZ3A 3BANA 4UTKA 3SUTA 4Z2LA 1M9HA 4PTMA 5T26A 3UG4A 4AZ7A 2EAWA 3WK1A 4FNRA 1J18A 3KP0A 3AYRA 2R1PA 2VC7A 2XH2A 2HXUA 4PMRA 5IHRA 4Z2IA 3O06A 1JYWA 4EPBC 4DUWA 1FWNA 1Z3NA 5U4NA 4MY8A 3RR1A 1SW3A 3QJAA 3TC3A 1QNOA 5SWUA 5T8GA 4PUKA 4NJGA 1PSCA 1K4HA 2BBFA 3ZYZA 1C9WA 2YYUA 1RCXB 1W8GA 1FWEC 4Q7NA 2D23A 3PM6A 3DYOA 2Z2UA 2DZPA 2GFTA 1DJNA 1AL8A 3C6CA 3NNTA 3Q65A 4PFMA 5B80A 4DO4A 1VBHA 5BWFA 4WDXA 1TFVA 2GUYA 1BWKA 3LXBA 3RF9A 3KCJA 2HE8A 1CDGA 4NF7A 1EEXA 4N0RA 1TJ0A 2GJLA 3P5ZA 1Q65A 1KFJA 2PP3A 1W1A1 2IPWA 3MI2A 2HSAA 3K4AA 4ZTXA 2X42A 2XSBA 3NZPA 1G4EA 1H4PA 1XG3A 3ZMRA 1ZPTA 3OHMB 4D8AA 4V28A 4GY1A 4I90A 1POKA 4GWEA 2VC5A 3QW4B 3KX6A 3QLLA 4JHOA 4A4AA 4O19A 1MI3A 4DWDA 4B4FA 1VFLA 2I56A 3S83A 2JEQA 1VFHA 4LAKA 5T9CE 1EJTC 4AD1A 4ZO8A 3TR9A 4E0CA 1PYMA 1GVIA 2VDIA 1HJVA 2QMKA 3AXIA 3ZVHB 3LXAA 4JICA 1C8VA 5C2XA 4ZO7A 3AHZA 3MKCA 1DE5A 4CN6A 2YXXA 3HO8A 2E5BA 4YXGA 4TQTA 3CUHA 3IK2A 3M43A 3N12A 5AC7A 1H1NA 3TN3A 4AU0A 3MMWA 5IM51 3DFHA 3P7YA 3VUSA 1ZU8A 3ANUA 3L65A 3ES8A 3RPMA 1HKMA 1FX6A 4K3ZA 1K8ZA 4ADTA 2J25A 2WKJA 3GHTA 5A6LA 1KWGA 2PA6A 3MJMA 3OB8A 5HAOA 1XP3A 3ITTA 3HGOA 1DQUA 3VU2A 5DN1A 3W23A 1IEVA 2AL2B 3FSUA 3G8RA 1KRMA 3RX3A 3ZT6A 1UR3M 1WP6A 4UTTC 3ITGA 5DANA 2BX7A 3D5HA 4DX3A 3I10A 3TYCA 1J0JA 2X30A 4MWAE 2V5KA 5KETA 3ZJ7A 4PMQA 1ZL1A 3O6CA 4Q8NA 4LVFA 3QLDA 3L2MA 2E4TA 5CPLA 5DCEA 3DHUA 4NJIA 2ZZ4A 2A7PA 4LAZA 3EX4A 5HWMA 1XR2A 3TX9A 3W00A 2QQ6A 4KPLA 3TKFA 1Q7QA 4N42A 1VENA 4AHOA 4AVNA 2DSUA 2UY4A 4KFPA 3NQ8A 1RJQA 4F0RA 2ZRVA 4EWND 5I23A 4K1GA 5DMNA 1QCWA 1OFPA 2BY2A 5HNUA 4WDUA 3A22A 5K7JA 2XFWA 5DY2A 2DJXA 1EJUC 3KWSA 1R86A 3KTCA 1ICQA 1QHPA 3QQ0A 2PDHA 3MSRA 4ZFMA 1GOWA 3CH9A 1ML1A 2AKZA 1OIFA 1G7VA 1JDEA 2ZOXA 4HCLA 2E9MA 2YA2A 2ZBTA 1U1HA 1J4EA 2CLIA 3UG5A 2VVNA 1B3WA 1GHSA 2FKPA 4M19A 1C8YA 2VRJA 1E0WA 2E6DA 2J7DA 3VIFA 5HNTA 1YE4A 1L8PA 3TYAA 1XPGA 3GFZA 1EP2A 2IS7A 3W0KA 4PUEA 4LB4A 2J74A 2FZDA 1FQ0A 4OWGA 4AIBA 4O4VA 3KHJA 1V3MA 1HJSA 1EBHA 2ESCA 2D69A 2V9DA 2J62A 1KTNA 1LOSA 3PVFA 3NQBA 2BZNA 4H41A 5ABHA 1S5MA 1DTNA 3TW6A 4LJ3A 4N9CA 4PCNA 3WH5A 4H01A 1HG3A 3KEHA 1KBJA 4AC7C 6XIAA 2X7WA 5KZ6A 3B8IA 3WFLA 4IXHA 3MZ2A 3RYSA 3EOLA 1YDNA 4YTRA 3PZNA 2P3ZA 2E8ZA 1I2OA 3VMPA 4EPKA 1WBJA 1QXLA 3HN3A 3SJ3A 3UNDA 3LBMA 1KXVA 1L2QA 1A5OC 3VFCA 4JQ1A 1KNWA 1AVAA 5E0KA 1JAEA 2O56A 2HE5A 1EF3A 3EDKA 1I0BA 1BYAA 3E2VA 1FUYA 1GOXA 1GYLA 2O4MA 1IT7A 1GKRA 3GM8A 1MXSA 1OYAA 3N17A 2P0OA 2EG8A 3D0CA 3H4GA 4C6FA 2WJDA 2QPSA 1AG1O 4LEFA 1H5VA 1XG4A 3BGGA 1J0IA 2EPOA 2EG6A 5LNVA 2QUUA 3PJXA 1BYBA 4LYKA 3IVSA 1L6WA 2XN2A 2QLYA 3EXSA 3PPGA 4QNWA 5AC6A 4PUMA 3UJSA 4DJEA 4WJ8A 1A3XA 4HNLA 2ZX5A 3RU8X 1H7OA 2BOGX 5G1TA 1EXBA 2XSAA 3OBEA 3O6YX 3AXMA 4NILA 2QEZA 1C29A 3QYSA 3RLHA 3S2LA 4B4HA 4IPLA 3FA4A 1UW9A 4CNTA 1U30A 4JL1A 1XL9A 2ZRXA 5F2IA 1P7TA 2B7PA 3MO4A 3T9PA 1V0LA 4M6UA 3GTFA 3N9KA 3W1RA 1UKSA 5H8MA 4B2DD 4GUHA 1HJUA 4B92A 4DNMA 4A05A 1VZWA 1TPC1 1Q6CA 1SJBA 1J01A 4MJZA 2PB1A 1MQPA 1SO5A 1XIMA 2MUCA 3G6LA 1IXOA 3RO6A 2RKXA 1E6SM 3BLOA 5CZKA 1PDYA 2EPHA 3NL2A 2YCIX 2WLYA 4GNKB 5HPOA 1OIMA 1K8CA 3WNNA 1T41A 1W1PA 2QZRA 3GDRA 4GINA 1GZJA 2WKGA 3I7QA 1FH7A 1QVBA 4Q32A 4OQVA 1OJXA 3LYEA 1BYDA 3AMKA 1CGTA 1NFBA 5FL0A 1U1JA 4L1WA 2WBKA 2A3EA 3P74A 1A3WA 3DUGA 1Q5MA 4DY1A 1FCVA 3WF1A 4RZ4A 2WKLA 2PLJA 4D6FA 3T55A 1YNQA 4GZEA 2G8ZA 1V77A 3TQ0A 3HPXA 2HDJA 4YHGA 3DZ1A 3SURA 3EA3A 8XIAA 4D6EA 4QQ3A 4XG1A 3T05A 1N8WA 2J4GA 1A0CA 4J3ZA 3SAZA 3WUEA 3WQPA 5HMDA 1HT6A 4N6EA 1YNPA 1BWLA 1KGUA 1N82A 1R9XA 4DZAA 1FVPA 3Q37A 3ANYA 4C6CA 3OVGA 3B0VC 2YBVA 5E6ZA 3ZR5A 3H23A 2PP1A 2PC8A 2Z25A 2ZRYA 3BLDA 1MEWA 2OT0A 1ITQA 1I6NA 2QUMA 2ZXBA 3N25A 3RLVA 3F4CA 2NVCA 1PAMA 1YMYA 1QOQA 4DUXA 4LH8A 1NM9A 3M16A 5A2CA 3LA4A 3FYOA 3GYEA 1AA1B 2NX3A 1XRTA 2CU0A 2V69A 1US0A 3A13A 1V3HA 5A2AA 3RCYA 1GZ1A 3H2FA 3EZ4A 3N6HA 2FH8A 1KBBA 4QIUA 3QR1A 4NRSA 1SPQA 3DIPA 4H9YA 4JFTA 1YRRA 2JE8A 2IKHA 5D2WA 2E6YA 3NO1A 3NYZA 4JN8A 7ENLA 1TMHA 2PDGA 4UQBA 1B1YA 1CTNA 3DHPA 4JIHA 1YTEA 3LZ3A 4HIBA 9XIAA 2GUUA 2WBGA 5XINA 4DQWA 3WQ6A 1D2KA 2OU4A 4ZOBA 5HMEA 1F8IA 2QVNA 4M82A 2F6XA 4O28A 2OO6A 3VA8A 3UQNA 4DZIA 4X9SA 1X6LA 4LS1A 2PZNA 3S5ZA 2WK2A 3LENA 3S5SA 3A6OA 3NQVA 3VFLA 3H2AA 3MMDA 1DORA 1GVOA 4GVIA 4L6DA 1KTBA 2I16A 1O94A 3IANA 4E38A 1E51A 4HSNA 1JZ2A 1UYQA 3LN3A 4ROPA 4MWAB 3VE9A 1H49A 4RV3A 4B91A 5I3JA 1W1B1 1GK8A 2WZIA 5I00A 4HNCA 1PKMA 3AALA 4JFVA 1HVXA 2ATMA 4L64A 3T78A 3OVPA 4N9DA 1E6RA 3R8HA 5CGTA 1ZJAA 2GDVA 2YCJA 1JUEA 4D6HA 5D8WA 3CMJA 3TJIA 4Z1YA 3MCMA 5CBBA 1EX1A 2Y89A 1IT0A 1NEYA 5D37A 3DFTA 5M03A 1CGWA 4GACA 2CCRA 1WOBA 2ZTJA 4WEVX 4NX0A 3VABA 3C4UA 1QBBA 1XIBA 1YPFA 3UA3A 1RD6A 4Z2JA 7REQA 3PTKA 3OZOA 4US5A 2XVPA 1QWKA 1XBXA 3CYJA 5EMLA 2PURA 1R47A 1UPPA 4L56A 2NQHA 1TX0A 2YCLB 4W8BA 4DJEC 4LRSA 2C15A 2OYKA 1E0TA 3VIJA 3VVGA 4GIRA 3L12A 1GPWA 4UMBA 3ZM8A 4LUSA 4BS0A 2CHRA 3ZSSA 3EA1A 3UP8A 1XISA 4ACZA 1G4SA 1TX2A 4IGHA 3IACA 4AISA 4WXZA 4LY8A 4DF2A 2V67A 5ENLA 3NM3A 1EUNA 3GFYA 1XLFA 3I3EA 4RLIA 4B9YA 5AYYA 1GVFA 4J5NA 3L4YA 5LNRA 3E6EA 4DZ5A 4DNHA 1ZSXA 2PS2A 5AHFA 2DVXA 2ZUUA 3GIPA 1JDDA 2BP1A 2QW5A 3QV7A 4DRSA 3V1PA 4TXEA 1DE6A 4EF8A 3PTQA 1JPIA 4QG6A 5IDIA 5MF5A 1HKIA 2V82A 1VH7A 3W7NA 5M5DA 3PANA 1TPB1 2UZ9A 5ABFA 3W1PA 4B5UA 3SY1A 3M1ZA 1IEXA 1FKWA 4AH7A 2A85A 3O2LA 3LI1A 3L0KA 4BF9A 4IQLA 4IMGA 3F7JA 3CIVA 2DZUA 5I79A 1I75A 4Q3MA 4IJCA 1W3JA 3W87A 1A5SA 3TQKA 4TV6A 2Z1VA 1H50A 1WKEA 2VWTA 4X63A 4DLFA 1YBQB 1E3XA 1ONRA 1HZYA 1XKJA 3QMRA 3G24A 4ZB0A 2OOFA 5BXTA 5HUOA 3L4XA 3F5KA 3S9YA 4XAZA 4GUFA 1Z48A 5CBJA 3UFYA 1FFQA 3HBLA 4KGJA 2MANA 2WV8A 4ACYA 3G5EA 3IUDA 4GYPA 4UTIA 2VEFA 2R24A 2NQ9A 4NASA 1P6BA 4U5KA 3ZR4A 3SIMA 1F3TA 3WNMA 1VFUA 4LNYA 1B3OA 3SFKA 1TREA 1PCKA 3PULA 1DJXA 5ABEA 3NEVA 2W67A 4O14A 2G97A 5CG0A 2VZVA 1IGSA 2PWUA 2PRLA 2V5DA 2XGBA 3S1UA 4A3RA 1XDLA 2OOGA 2OEJA 4DYEA 4TV5A 3KP1A 3LHZA 1EYEA 5BXRA 3EKLA 3M5VA 3DC8A 4EOUA 1K77A 4OUEA 3CJPA 1XS2A 4L6OA 3LX9A 3OPSA 4GI4A 4HOZA 5HANA 5LA2A 4LVDA 2AMGA 3THAA 4I9MA 1O5RA 5CSRA 4FXSA 4JTHA 2WZTA 3E5PA 3MCOA 5A8GA 1EGMA 2FDSA 1UWRA 1W9XA 2ZUWA 4MY9A 1DXFA 4NRRA 4PTXA 3WYZA 4AD3A 1BHGA 3G0SA 5I09A 2PMQA 1FWTA 3KTSA 5H2ZA 2PU0A 1J5SA 4MF4A 2PI6A 1T8QA 4I6VA 1ONWA 3LNMA 2OSWA 2PGFA 2WMJA 5C8BB 1J0KA 2H6RA 5KZEA 1NDYA 1OHLA 2C13A 4UFHA 4DJDA 3EPNA 1ZB5A 3C0LA 4FI4A 2ZC8A 4KERA 1U22A 2GOKA 3AHXA 4LB3A 3U4AA 4LBUA 1PYFA 2JFEX 3LOTA 1V0NA 3QPEA 2ANUA 2ZUSA 3BAJA 4F3HA 2L5HA 3V35A 4XZ9A 2IMRA 1TPWA 3P80A 2O9OA 6PTDA 2CLFA 1VJIA 3EAUA 3XINA 3CQHA 3KCLA 2X2GA 3WQVA 1ALDA 3IS4A 3CUIA 4RXGA 1KRCC 3FK4A 3MZNA 2F8QA 3VNLA 1L6FA 3WJYA 4LUSB 2W0UA 2DIKA 3TUUA 4Q6XA 2BWGA 4CNSA 3IEBA 3RRAA 2WHKA 3VILA 3N19B 4A35A 5TIMA 3TTQA 3P8JA 2Q09A 1AODA 3VKCA 4QBXA 4EXQA 1MUMA 3QOKA 5CLTA 3M5ZA 2ZX6A 3GXDA 1W3LA 3BH4A 6REQA 5C55A 1IZCA 3TN4A 4S3EA 3CZLA 2W61A 1Z44A 3LCGA 2BLEA 4OU1A 3LY0A 3HJEA 2W3ZA 2OYLA 3SQLA 1G5AA 3XISA 1SFTA 3I7SA 4JTDA 1SJDA 3H53A 3N14A 1PHQA 3WDQA 4CU7A 4ZE4A 3BSHA 4GXMA 3BJTA 3WSUA 5K9CA 4JOMA 3XIMA 1KFBA 4LVBA 5F2MA 3CHDA 1L0PA 5AKQA 4JQAA 8CGTA 3S46A 1UMYA 2HS6A 1B57A 4GG9A 3TIMA 1FWBC 9RUBA 2UV8G 4PTWA 1GQNA 2QUTA 1E4MM 4JKLA 1XGZA 3H12A 3USBA 3R58A 2Y70A 3B05A 4A8IA 4GI8A 1JGMA 3VUPA 1JULA 4ZB5A 5J04A 4AEEA 2DUXA 2C1GA 1YTDA 1G0CA 4XWUA 1REQA 3NSNA 4E2BA 4QTGA 3PJWA 1DKWA 3ZT5A 2OPJA 4QROA 5LIUX 4O13A 5D9NA 4NX5A 3ARQA 5C9UA 3POCA 1R3TA 5BZAA 1T6MA 5E70A 3PTMA 1LUCB 2YOCA 1Q8JA 4HSOA 1X8FA 3L66A 2PGRA 5LKYA 5CZ0A 4X0NA 3E9AA 1V93A 4PMOA 4XAFA 1RQBA 1H7NA 1BTCA 4H6QA 4X60A 1P0KA 4GYPC 2NV1A 3UGRA 1SJAA 3ORWA 4BK9A 5CPTA 2GWNA 1XYFA 4S3FA 2FGZA 4KT2A 3THQA 4IZGA 1H7XA 3BW2A 5LIYX 4XQ6A 3RMJA 4B5VA 1GTHA 2E6FA 2YR1A 3T81A 1VP5A 1N2VA 5DRIA 1OFRA 1YKWA 2BVWA 3T4WA 1Z32X 5A6KA 3VKKA 1KD0A 3LHVA 1QUMA 4Z2KA 1A49A 3DDMA 1WQ5A 1NP2A 3WJXA 4ZEPA 3BZJA 4CQCA 1E73M 1XLDA 4QJ5B 1QW8A 5EBUA 3C86A 5CAHA 3DESA 3WK0A 3E0FA 3GNRA 3B0PA 4RW5A 4NNAA 1J0HA 1DL3A 2INFA 2ZC1A 3DAQA 1XIHA 4Z1AA 3L4VA 5EMMA 2XZ7A 2H8XA 4DJFA 2HRWA 4KRUA 2Z7GA 5I03A 1CXIA 2Y5EA 3M4HA 5I3GA 4H9UA 3KOWA 1YE6A 1N8FA 3SY5A 3EBVA 1EKOA 1O12A 4Q8TA 2VGBA 3IVTA 3LD5A 1UJQA 5EPDA 4NUWA 5G2HA 3V5FA 4E4UA 2VFHA 4NQ1A 3CQJA 4AD4A 2VEIA 3I4EA 4LRTA 1IZJA 4KKXA 1TIMA 5A6SA 1CXHA 3LRMA 2BDQA 4GE8A 3BMXA 2QVHA 3PBGA 1WAWA 1JCNA 2PSNA 4MKSA 1MZHA 4O8RA 4ICCX 7TAAA 1SM9A 2IW0A 4H7CA 4DJDC 1TZ7A 1H60A 3QV9A 1DYSA 4YYCA 1VBJA 2IKGA 5I78A 2A7RA 3Q45A 2EO7A 4FOKA 3AUOA 3MBFA 3CH0A 3WH6A 3RJYA 4PSRA 3DECA 4C1LA 5E1QA 1BXCA 3MUIA 3WD0A 1EFZA 1KQZA 4MOZA 5D09A 1L8NA 1S3HA 1W3TA 4N7QA 3B9DA 1V02A 6ALDA 1LM1A 3NQGA 3L21A 3K2GA 3CT2A 1XYAA 2J9ZA 3S1GA 1OQFA 4M80A 5LNSA 3LTPA 2V3GA 3KVMA 2OQYA 4UZSA 3TK7A 1BXBA 3DFYA 3QV8A 2Q8LA 4HZ7A 4ZA0A 4D72A 5GNZA 2GGHA 2XWEA 3CWNA 3CS2A 4HYWA 3VOHA 3BLEA 1PHWA 1X98A 4Q8OA 1BAGA 3Q67A 4RL3A 2AGTA 4HZMA 1TRDA 2VT0A 1UZ1A 3O0KA 3TEVA 4K38A 3OG2A 2VKZG 4GIAA 2BS9A 3GO2A 2ADAA 4YVVA 3SUSA 2FHFA 1QBAA 2I9EA 1W9PA 1LT8A 2VFEA 2Q8ZA 5CPOA 3WF2A 4MTVA 1LYXA 4KWOA 1PWMA 2XVNA 2WHJA 1OC7A 1GQKA 3AWNA 3NQ2A 1PEZA 3ZXWA 5LIKX 3HIJA 4IHCA 5F2LA 4GQQA 1G4TA 1VFTA 1EGVA 3P67A 4PCPA 1O1HA 3DFQA 3KS6A 4IFKA 2WNQA 3W2JA 2G3JA 4WHBA 4IUGA 4TO8A 4U3CA 4JL2A 1XI3A 4TTGA 3KOYA 5D8ZA 2RDUA 3TFXA 1UUMA 5HR7A 3K8LA 1HGWA 1CXLA 3AZTA 3VYLA 5F4SA 4GPNA 1OYBA 1OZQA 1UG6A 1SZGA 3UVIA 3B9EA 2OCZA 4HK7A 3AMGA 4DUVA 4YHEA 1D3CA 4UTLA 3MSGA 1FA2A 3GQYA 3TTEA 1MEHA 3FAXA 3A9BA 3EEGA 1ZQ5A 3WUGA 1BVWA 1OY0A 5I3IA 5FEZA 2OSYA 3JRKA 3GG1A 3UWEA 3JS3A 4G9PA 3EOUA 5D2VA 4UCFA 3NQFA 4M51A 4YL2A 2ZX7A 4S39A 3ABXA 4LBRA 3O9NA 1ECEA 2QAPA 1CB7B 4HPNA 3N4EA 5E9AA 3OBKA 4ZMGA 3LCFA 4PCFA 1TG7A 1XIJA 4CNOA 3PK7A 1P6CA 2VZTA 1S5TA 3VMNA 3NOYA 3U8GA 4QHRA 2WMIB 1CZ1A 3NL3A 4BKNA 1W9DM 5CBIA 2ZICA 4MWAD 4HVXA 4JIEA 4M8UA 3BO9A 4MYAA 2OKOA 1LQ2A 4MNJA 1J96A 4PH6A 1TQXA 3KLKA 3LM7A 1Z9AA 3MB9A 5DMLA 4LAMA 1PBGA 1C91A 2QPXA 1GG0A 4LXFA 2J8GA 3VOGA 4KFNA 1C93A 1YADA 2FGLA 4Y7EA 3LGDA 4AHPA 2E40A 3MP5A 3TNBA 3KOZA 2VX4A 2X8RA 4FB7A 1IWPA 4L9XA 4KFOA 1K9TA 1ZAIA 4RX0A 1SR0A 4AIEA 2D2GA 4DJED 1TTQA 1IWAA 3OA3A 5LYRA 3QTGA 3SDOA 2WWDA 4ZENA 1W5OA 4E3TA 5I24A 3EXTA 4Q4RA 2J8TA 3A4JA 4KEZA 3AIWA 2PP0A 3BSMA 1EZ2A 4O50A 3TYEA 1UKPA 3TOPA 2BY3A 4AW7A 3WX7A 4DJFC 2VTFA 1NDZA 2GVYA 3CWHA 1IXQA 2VX6A 3GTIA 2IQDA 3THCA 3DHDA 4F48A 4AZCA 3W7DA 5EMKA 1RY8A 4GO8A 5JBDA 4AY8A 3QPZA 4LCRA 1EJXC 5XIAA 4NZ1A 5AECA 4M6VA 1AK5A 5EFDA 4IG2B 4LYPA 2FMNA 3DI0A 3WF3A 1ZAHA 3AS2A 5H1WA 4IOTA 4GZIA 4HU3A 4EAMA 3GVQA 1TVNA 3AICA 4I9AA 3BLPX 3OU8A 3TROA 3F2BA 5I3DA 3DXIA 3EXRA 1V6UA 1A5BA 1I8JA 1VYSX 2EPLX 4MNLA 5BXSA 2ON3A 1G6CA 3STFA 1W2PA 2QMJA 3IIVA 3O16A 1ONEA 5HATA 4IGSA 3TTYA 2TRSA 1KGXA 3WJZA 1XINA 3BQ6A 1WA3A 1DQXA 3WF0A 5C7HA 1XCWA 2CLKA 2EKCA 3AUJA 3CU2A 4YVXA 3P84A 3BV7A 1FCQA 3W86A 5LA0A 2OT1A 3MQTA 3BL3A 3ABOA 3I6RA 1FP9A 2E28A 2DQWA 3W75A 1UZ4A 4POCA 1EC8A 2VUNA 5E0CA 1VYPX 3AXKA 5BOFA 3W4RA 3TSDA 4EVZA 4C65A 1Q66A 2B31A 5EMUA 5HWJA 2ZFAA 4MJ2A 1AQFA 3LK6A 1XX1A 4LC6A 4H83A 3Q4DA 1EIXA 1DTUA 3AROA 2VENA 3G18A 2PLCA 3PZUA 4W8LA 3NG3A 1FWSA 1X96A 3S4TA 4UZUA 4LUTA 2KZHA 2WSRA 3MDUA 1NOFA 2OGJA 4IMFA 3BJSA 5TNVA 1LT7A 3TW9A 4FLSA 4W5ZA 3T8QA 5CZSA 5EU9A 1KM5A 3PZOA 2V5BA 1V3KA 1ITXA 3VK5A 3GZAA 3HPAA 3W28A 2EJ1A 3TAKA 1MYRA 3MI3A 4IPPA 2Z26A 4E8GA 1ZUAX 4RNJA 4C7FA 5CJNA 3UXAA 1QI0A 4P7QA 3WF4A 1UC5A 4PSPA 2RDXA 2JGQA 5T91A 1FWRA 2I57A 4H4IA 3OLGA 4JIPA 1JDCA 1WAUA 2C18A 4FF5A 3GHRA 3BCFA 3FXYA 2QKFA 1SUXA 3EMCA 1JCTA 2PBGA 3VGEA 1PV8A 2VR2A 3LMZA 1YDOA 3QRHA 4W87A 4C6LA 2YX0A 2XH7A 3H2NA 3NO5A 5AHIA 1EUAA 4PZVA 1BSLA 1JFHA 4YS1A 3B40A 4AX7A 5IRPA 2ZDRA 2DW6A 4RNFA 1UA3A 3AIBA 1IXPA 5CJ5A 4AYSA 4LVGA 5G1YA 3QHMA 5BCAA 3N04A 1R6WA 5AHEA 1KLZA 1HFBA 2TYSA 2EQDA 3LBOA 1O6IA 3GB6A 4IIFA 3FGCA 3T0CA 2EF9A 1RVKA 4GY0A 3QBUA 2FB2A 1Q85A 3KBWA 4H8UA 3S2CA 1SZRA 1VPQA 5KZMA 3CZGA 4CGTA 3FV9A 3PG9A 3QKEA 4ZODA 3MDWA 4HPHA 1UBSA 4NAEA 1W54A 4KQNA 3QN3A 4HMNA 2EPKX 5FEWA 3CTLA 1YPIA 4M24A 2QCCA 1XRSA 4J9JA 4FA3A 4UFLA 4IPJA 4I8YA 2QCNA 1ODZA 1X7IA 3VX0A 3NQ7A 4W88A 1TWWA 4IP5A 3GHUA 1QO5A 2ZYFA 3R11A 1TPFA 5L9FA 1UWIA 3T07A 4YLWA 4XB3A 3RFAA 4KS0A 3WH7A 1O7AA 3HMJG 3FW6A 4P8UA 5AC5A 1ISZA 3W71A 2B4GA 4ZOAA 1IV8A 1POJA 2REQB 1YXCA 1NQKA 3EKZA 3LSBA 4YJ5A 4GUJA 3STEA 3RK8A 1TV4A 1GQJA 1UD5A 2BGNE 3TAOA 4FXRA 1R0MA 2BVDA 3VNMA 3O3RA 3VNZA 5K2ZA 4JN7A 4GOAA 4MMWA 5AY7A 4CN1A 3CLWA 1KBLA 4MUZA 3LHUA 2E67A 1Q6OA 5GNXA 5EY5A 2XTKA 3KM8A 3NEHA 1OEPA 1P0DA 3CUXA 3IIXA 4B16A 1XRFA 2WQDA 4XSLA 3NZ1A 2XH0A 2WC3A 4C6IA 4Z0JA 3PPFA 1QRQA 5CEWA 2BY1A 2OX1A 5BOOA 4XKYB 4PCTA 4JHMA 1E1FA 2P88A 2O9RA 4AEOA 4IP4A 2GJXA 2WNWA 1OC6A 3CK5A 2Z1SA 1NAL1 4G1NA 4GZ7A 3G0UA 1RCOB 5I6SA 4NG3A 4EPEC 3W1MA 2W6RA 4W8AA 2BHUA 2E6AA 2PTXA 1V0MA 2E0PA 3IJQA 1F3XA 2BXVA 3STCA 2JK2A 4KW2A 4MB5A 1JEZA 3BLIA 4MGGA 5D2XA 3EMZA 1TR9A 5JBEA 3CQ0A 3RM4A 4O18A 4ERIA 2GLKA 2UY2A 1FDJA 1I2RA 1NARA 1OINA 1EA0A 1FXQA 4DM1A 4WQ6A 3A23A 4UUIA 3POHA 5LSMA 1ADSA 3CHVA 2PD5A 3WLNA 3D46A 2A0NA 3GG0A 1WDWA 4C6KA 4YTUA 1QDSA 3KRUA 5J8LA 3TJXA 5AFDA 2R1KA 4ZB2A 4J7RA 3HQOA 3W2NA 4HCHA 1JPDX 1MRQA 2WVSA 2GGIA 2IPFA 2GGEA 3PZGA 4GI6A 4HN4A 3S47A 1U1UA 1TMQA 4Y9AA 4PMZA 4H2HA 1B5TA 3A5FA 4ATWA 3CYVA 3U9IA 2X09A 1NOUA 2YA0A 3WKZA 3A3HA 4J3WA 3I3BA 2WO5A 3WZ0E 1ZENA 4OOUA 3VIOA 4GKLA 2Y7DA 1C8QA 3N9SA 5IFPA 1U2YA 4S3DA 1MEIA 4ONVA 2P1FA 1F4AA 3WLOA 3AZSA 4AEFA 3ZS4A 2PCEA 3KRZA 3ARRA 4E4PA 1JVNA 3BW4A 3EX3A 4PMDA 4HD5A 3GVGA 4XZNX 1EA9C 2QJNA 4FP1A 4FIQA 4AZBA 3VOFA 3UPMA 4WLCA 4Z08A 4BFAA 4X9YA 4CVUA 4JTRA 4HHHA 1Q2RA 1SJCA 5C9RA 1IEQA 1GVYA 4B2DA 1I2QA 5LHEA 1CWYA 3W38A 4XISA 2ISVA 1W17A 4ADUA 4BI5A 5LHFA 1J6OA 3BLKA 4S2CA 1XIEA 3A4AA 1UIPA 1GJWA 4DI9A 3NQ6A 4O1DA 3FN9A 2VFGA 3HM7A 4FK9A 2FFCA 4O52A 1UPMB 5ABGA 1OYCA 4W85A 4DBEA 5HQEA 4H9TA 4M1BA 3W53A 2XISA 4OBRA 3BJFA 4BQ5A 1KM0A 2XDFA 3NAVA 3C2EA 1XHGA 2FTWA 2IPJA 2EGZA 3AC0A 3MHUA 3T4CA 4H00A 1FHLA 3UWWA 4ENLA 1RBAA 2OB3A 2IKIA 4F0HA 4NAEB 3RLGA 4PUUA 5BRBA 2VEPA 1AMKA 1W6TA 1GOMA 1M3UA 2EEXA 2V2CA 5JXQA 1RA5A 4HHPA 4PL1A 4C1NA 1DOSA 3UXIA 3MSDA 2NWSA 4MZ1A 4IH3A 1Z42A 4LUJA 5FA5A 4C1KA 3EWXA 4HJFA 1J11A 3DEQA 3NVDA 2JBMA 3HPSA 3PUEA 4ERAA 5FKYA 3HA1A 2WMFA 1F6PA 1J9YA 1BF2A 2H9AB 5BMWA 2FHCA 3S0CA 1R8LA 1MW2A 4O1BA 7CGTA 4ZVJA 4KWWA 4YPJA 3LCXA 1QPQA 2C0HA 3IGHX 3ELFA 1F07A 1M7XA 1IXNA 4BWLA 2QIIA 3TNOA 3U2EA 3EPMA 1G67A 1UR2A 1M53A 5ABTA 2QUVA 4IP7A 4F66A 3BAIA 4EKJA 1DIEA 2W79A 2GPTA 1UOKA 1UUQA 1TMLA 1ISYA 3E38A 1WKFA 3GVVA 4BY3A 3R8RA 2WHMA 2J24A 1AJ2A 3UWVA 3P14A 3M0YA 1JPMA 4OT7A 2YB1A 4QSFA 3VCCA 3T1GA 4KCVA 3KBJA 1WXZA 3NQMA 2DZVA 3TU9A 2GJXB 4W5UA 4GVGA 4F9DA 2VP8A 5C9ZA 5EMJA 4S2BA 3M46A 5D04C 1XFBA 2BXYA 1GGOA 1GOIA 1GVSA 2VRQA 1ZALA 3NL6A 4WIWA 1V8EA 4B15A 3UZZA 3AI0A 4GQGA 1SZEA 3RX4A 1XCXA 3GNNA 3SN1A 1Q6FA 1E0VA 3BURA 1XQKA 1JZ5A 3B06A 1JZ6A 4PTDA 1EX5A 3IGUA 2ZE3A 3EWYA 2A1YA 3S9IA 4ZQPA 4JQ2A 1EP1A 3FKRA 3IARA 2W9MA 4B3ZA 3QHOA 1ODUA 1BD0A 3TA9A 8XIMA 4HU0A 5EBAA 5K4ZA 3N9RA 4NJHA 3UR7A 1B3VA 1KLYA 1O5KA 1LTDA 1QI5A 2PDCA 3PBUA 4FR6A 1UR4A 4NYUA 1V79A 3GH4A 4MM1A 4RDWA 7PTDA 4LSBA 2FJKA 1VF8A 4F0MA 1GTEA 3LU2A 4C60A 2V3DA 2YL8A 5JH1A 1EJWC 3BOFA 4W93A 3OA5A 5JMUA 3NPXA 1FP8A 5I5RA 4AWSA 1B9BA 3TXZA 1KWKA 3OZMA 1H3GA 2FHBA 3GR4A 4OV9A 3V3WA 1GORA 1B31A 2E3ZA 1SO6A 3T0DA 4W4QA 3VGBA 5BROA 1WDQA 2PLMA 5D4YA 1QASA 2Y61A 2VEMA 3MC5A 3CO8A 5DBUA 3OLIA 2JALA 4YVPA 2OZTA 2GVJA 4MG4A 4DB7A 1W5PA 5CPNA 1XSIA 3A24A 3NM1A 1E4LA 1E9YB 3CQKA 3PN8A 4IGNA 1H7RA 1VC4A 4AIOA 1KFEA 2OLHA 4US6A 1A53A 3MKKA 2VM8A 5JVLA 3H4XA 1UP0A 1I60A 1OX4B 1XC4A 3L0NA 2D2OA 2E5CA 4R53A 4H9MA 4C7GA 3NQCA 3UVAA 2HVMA 3G1AA 3IIZA 4XD6A 4JAWA 5BMXA 3O0FA 4F0LA 3K46A 1E71M 2VELA 1WDPA 3HB9A 1ZBWA 3ARTA 2G50A 4QJ3B 3M41A 2PWHA 1G1YA 1OG6A 2XVGA 3WBYA 2CXEA 1QNQA 3EX2A 4DJFD 3GDLA 3M0KA 4ES4A 2Y88A 3D6NA 1YX1A 3DYPA 1BF6A 1EHNA 3R94A 4O15A 1OCJA 3C2RA 2J75A 3H2CA 3QY6A 2DIEA 2D24A 3QMTA 3EWCA 1EXPA 1GONA 3VDHA 3FS2A 3EPOA 3NPUA 3R5EA 1SFLA 2CLMA 3RU6A 1K1DA 4D8ZA 1BRLB 1XDJA 3IV8A 1AH4A 1WDSA 3P60A 1VLIA 4QG9A 1CLKA 1PO9A 3AYVA 4GJJA 2J7BA 5LIWX 3GH5A 1EO7A 1JNEA 2G0WA 2Y7FA 3TXVA 5A95A 1ZLPA 4CLMA 3EWZA 5GVJA 1QW7A 3GC5A 1SGJA 4KIRA 1K8XA 3PUGA 4G5DA 2NLIA 1P0NA 2DVUA 2QHAA 3DG7A 4GUGA 3QZAA 3UJFA 1M5WA 3CBWA 1Q6GA 1V6YA 3SCRA 5HJYA 5JQ9A 1MDLA 3APGA 5A6AA 2CKSA 3WLKX 3FA5A 1KTCA 1L6YA 3KWXA 2VR5A 3CLMA 3RR4A 4JPGA 1H62A 4BWLC 4AD2A 1SZNA 4K1WA 4G7EB 1KR1A 4N4QA 3LSCA 1WUFA 4O10A 2VUYA 1UWSA 2H8ZA 2F7FA 2VD9A 4QS5A 1VFSA 4WCJA 1PTDA 5A69A 3N2BA 3C2FA 3LI0A 3TR2A 1JR1A 5AYBA 3UWQA 4B5XA 1UD2A 2G4FA 3ITOA 2RGLA 2CFFA 1QFEA 3IWPA 1HKKA 3EDJA 1XM3A 2Z28A 3UZJA 2Q71A 4IIBA 4Z2GA 1ME8A 4C6DA 1UZHA 3NXLA 1UH4A 1GHRA 4LF2A 1H0GA 4FAMA 4DWSB 1XC6A 2WSKA 3NDZA 3ID7A 1K8YA 2PRMA 3UNTA 1DEDA 1XDMA 2GL5A 4MVAA 4XZBA 3V0UA 2QYGA 2WQPA 1S38A 4NKCA 4C5ZA 3ALFA 3GRIA 4M0XA 1NFPA 1OFBA 4N9BA 4L7ZA 3EOOA 1MW3A 4XZMX 1HF6A 3A47A 2GJRA 1TELA 2QF8A 1FY6A 2Q3OA 3L4UA 1QI4A 4X2PA 2Z24A 3UCDA 4MJ4A 4ZO6A 2Y7GA 1TSIA 1ZZMA 4KMQA 2F2KA 2V38A 3TSMA 1DWJM 3VZXA 1RBOB 1EB3A 3GTNA 3CWOX 2Y0FA 4QLLA 4RDZA 5CC6A 3ZVHA 2PDQA 4GFIA 4AMAA 5D38A 1WZAA 3PZTA 3AJXA 4DBSA 3AHTA 5HPCA 2YKKA 1HN1A 1ZAJA 4O12A 4O54A 3UZYA 2OQLA 4YN5A 3LPPA 1O1ZA 4ZZ9A 2QR6A 3PAOA 1R9ZA 2BV9A 5HWNA 3URNA 3GC2A 2OELA 3L68A 5JBFA 3FHAA 3E2QA 4M29A 5CQ1A 4JTCA 4F2BA 4QP0A 3E1F1 3M0MA 4GA8A 4WGHA 1NFGA 4CD7A 4YYFA 1DWFM 3G2GA 4K7YA 1XLCA 3MWAA 2J7CA 4WSKA 4MHBA 5TQLA 3TH6A 1RA0A 2Y8KA 3PBVA 1MWOA 1CPUA 1EC9A 4R7WA 2HBXA 3W7LA 1JDAA 4WK9A 2HNEA 2Y63A 1Y5XA 4DPQA 4UTWA 1KXHA 4MAZA 3MYPA 3KCOA 3QKZA 2Q6ZA 1QJWA 2NUYA 4HOXA 3B8TA 3W7MA 2J13A 3OP2A 3BVJA 2WSYA 3HF3A 4TTUA 1RLDA 2A3LA 5K3VA 3URQA 1UROA 3SUVA 4HOWA 4GVFA 3VCNA 2YFOA 2YCKX 1V6XA 4Y2WA 4M7SA 1LORA 3LLFA 2PDWA 3OTRA 1Z41A 5AYIA 1ZHAA 2NSXA 3S1WA 3CV1A 3EWUA 1CX9A 3UCCA 2UY3A 4XBJA 1Q6QA 3SBFA 4G56A 5FI8A 3NFUA 3NXFA 5CC5A 3B8VA 4GMEA 4JIRA 3WQEA 5HNRA 1FWHC 4IQEA 4IIGA 4PB4A 2GK1A 3CL7A 1IGWA 1XLIA 3G77A 1EBGA 1GEHA 3FYPA 3SRDA 3TYUA 3M0JA 2C8NA 3AMCA 1CXFA 1TE6A 3QW3A 1X6NA 1UOZA 3UBPC 5LXEA 3TLLA 3T08A 5A6BD 2EXOA 2JKAA 2Y7EA 2ACSA 1FWWA 7ODCA 4RZ5A 3OJGA 3DN5A 1OGGA 1WXYA 3FCPA 2V68A 1TJ2A 2W63A 4JTSA 1EHAA 3PR2A 3W7GA 4YMZA 3LHWA 3ENLA 4GX9A 3AIUA 4HTYA 3ICJA 3DH7A 1F5ZA 1TCMA 3G3MA 1RSCA 4R88A 3V4BA 3P5YA 1Q4WA 4IMAA 4AB4A 1IQ8A 2OZ0A 1TZ9A 2V5JA 2IQ0A 2Y8UA 4XSMA 3GDTA 4ALDA 1EOKA 3CV7A 3KBMA 2A4AA 5AC8A 4YNGA 3PJTA 3O6AA 3NCOA 3W7QA 1W9VA 4U5IA 5ECUA 3U5UA 2V30A 2OVLA 3LMYA 4LCSA 1UWQA 3U2CA 3UZWA 2CBVA 1XSKA 4WUIA 3GXMA 1JFXA 3N4FA 2ZUNA 5BOEA 2EJAA 3H4WA 3FX4A 3VIIA 4JGDA 3GNXA 1OCBA 1XIFA 2Y8VA 2PDNA 1W2VA 2PWDA 4LYRA 4JXCA 2D0HA 3STGA 2WVUA 2NV2A 2QF7A 2G3FA 3AZRA 2ABAA 4IX0A 2V5LA 1HKVA 5C71A 1GOKA 5JH2A 3W7OA 3IAPA 4E2VA 3CZJA 2P8CA 2FZ9A 1E5NA 4AZGA 2NZLA 3LNPA 4Z17A 3E0VA 2FTYA 2VOMA 4XD4A 4BEQA 4CQ8A 1F4HA 5C9XA 1US3A 2Y5JA 2FQIA 3TWBA 3BGJA 5F7UA 5E9XA 2A6NA 1TWIA 1O60A 5J5RA 4ZGYA 4BI7A 2POZA 2A3CA 4N2YA 3ABRA 4MB1A 2PDYA 4LY4A 4AYGA 4QS6A 5A6MA 1SMAA 2OEMA 5E6YA 3M9YA 4UR7A 4CNPA 1WUEA 1VGAA 1WDRA 3N3TA 3VIKA 1GYMA 4L80A 3TTSA 4GFSA 4JBRA 5FJIA 1OT2A 3RGTA 4D2JA 2PWFA 3H22A 4G6CA 3VPLA 3BMWA 2WZEA 3W1XA 4Z1BA 3IV3A 1JIBA 1QI2A 3GY1A 3W7JA 3FJ6A 3NQAA 5HJLA 3PSWA 2XPKA 3C0QA 1V6TA 4O8AA 4UR9A 2YZ5A 3N2OA 5IOBA 2X1UA 4DN1A 3UZXA 1AW2A 1YXDA 1QOXA 3JVAA 1R87A 3MSYA 5GJPA 4NJJA 1VBGA 4IX2A 5CH9A 3M7WA 1EWDA 1TWZA 5CGMA 3DERA 5DXXA 3S1XA 5E5CA 5DLCA 1OX6A 2UY5A 4U28A 1MW0A 3VD7A 4A8RA 4C6JA 4C7DA 5BU9A 3H2OA 1MO0A 3UETA 1FHDA 4NZFA 4A3QA 3AFBA 1MNZA 1LZOA 4H6RA 4RR4A 4X22A 3LG3A 1WB0A 3L4TA 3HG2A 4B5NA 4V1XA 5F4XA 2NT1A 3OGVA 1DJZA 3RDKA 3PFMA 4UTWC 3TMLA 4EPDC 2FVKA 3A4WA 3KAOA 3AIVA 3NDOA 4HP5A 3CAWA 2QDHA 1A5NC 3T0TA 3ZIZA 4JR5A 1BGAA 3W6YA 5CAKA 4O1FA 4Q4SA 4CQDA 3WD1A 2O7QA 2VEKA 4ZFCA 1EC7A 2IXVA 3TLQA 3RAOA 2B81A 3SCUA 4P5UA 3WELA 1FOBA 2POTA 5LGZA 4KEVA 3P0WA 2G3IA 3R0KA 3LRLA 3CO4A 3BG9A 4GQRA 3J7HA 4GY7A 4AY1A 1FWJC 2WCGA 3HQNA 2DEPA 2GK1B 1EPVA 2EHHA 5EFFA 3OODA 5FJJA 1SO4A 5FF3A 2AQWA 1F6YA 4XX6A 4AG0A 3G8EA 3CAKA 2VFFA 4S3AA 4AF0B 2GVLA 4C6PA 1M03A 3MW7A 3QYQA 4JCLA 3ZSTA 2CNCA 2VI0A 2Z6IA 3GW0A 1EJRC 3R1ZA 3WK3A 5HUPA 1AL7A 2R94A 2ZZ3A 3CUFA 4HCDA 1TZZA 3AQUA 3U0HA 4JTLA 3VNDA 1R38A 1JRCA 3VKDA 2FYMA 3OGSA 3ABQA 2ZUMA 3W82A 4BF7A 4S1FA 1JNDA 1LBMA 3M07A 1R2TA 3WQ5A 2E9LA 3UERA 2W66A 3W24A 3EMQA 4MWAA 1SFJA 3G1XA 4K6AA 4A8NA 2ZDSA 1ZGDA 4H6EA 4MFDA 4I7UA 2PWGA 3II1A 1FHVA 3AXXA 3WMSA 2F61A 4M5PA 4E6MA 3CMFA 2Z00A 5FJOA 3TYBA 3ATZA 3GU9A 1DXEA 5B7YA 2XJ7A 5BNKA 3R7MA 2VHLA 1RJPA 4IMEA 4U33A 2WJFA 1MFUA 4S38A 3GWQA 5I2UA 4ORIA 3W88A 3CEUA 3CEPA 3EDDA 4CQAA 3T0AA 2I17A 1Q4NX 2E9BA 3WLPA 3FOKA 3VD5A 1KGWA 2QGHA 1WKDA 3ITCA 1UKQA 3FAWA 5F1VA 4DAFA 1JL8A 3PWAA 3FKKA 5CPQA 1JI2A 2B7QA 1O68A 4TX9A 4R27A 4QFUA 1W37A 2VX7A 1A4LA 3PB0A 4I6KA 3VNYA 3WLRA 4PFHA 4Q4KA 5IXEA 3ARWA 1VFFA 4RE2A 2D1ZA 2PUZA 4UFMA 4Q8QA 4BQ3A 5PTDA 5FESA 3ZOAA 2V8ZA 3BGAA 3M47A 4EWJA 3TZFA 1LLOA 3AHYA 4CQBA 1CGUA 2YCLA 4B9ZA 3E0WA 2QCEA 2XIMA 3GC4A 3P61A 1HVQA 3W7RA 3MUZ1 3MJYA 1DWAM 3REQB 4E4FA 2XN1A 2YJQA 2GJPA 3BCDA 1DBTA 4MLJA 2P10A 1XIIA 4FALA 2RJHA 1WPCA 4UNLA 1YHTA 3AU2A 2J8FA 4J35A 3ABZA 4PRTA 4R85A 1E6QM 3BK0A 1F7BA 3UY7A 5LXXA 2D2JA 2ZQ0A 4TU1A 4H7VA 2ZCGA 3W29A 3HURA 2ZZ5A 4Y9OA 3GXFA 1OD8A 4NI3A 4I9TA 4IWWA 1GNXA 2Q01A 4K8GA 5D32A 3ANVA 2VMFA 1PL9A 1W32A 1UD3A 2O4QA 2QJHA 1S2CA 3GIYA 4TMBA 3QVQA 3CZ8A 3EGJA 4ADSA 4DLMA 3W1NA 2JF7A 3OYZA 4PA8A 1DJHA 3ZVIA 3ZR6A 4J40A 4A2RA 1T8XA 1EP3A 1BEUA 4JNZA 3A4XA 5DT5A 4E8CA 2OZ8A 4FZIA 5REQB 4RW3A 2AKMA 1I1XA 4HMDA 4J3VA 1TYGA 4XO7A 1XIDA 1UKTA 1PTAA 2AL1A 3WK2A 8TIMA 3U3HA 1YBQA 3UR2A 1HJWA 3E3HA 5CGQA 5CC7A 4LALA 1J2WA 3W01A 2TMDA 5FL1A 4RNIA 4RV8A 3SM0A 4MNKA 4IFOA 2EBNA 5EKYA 3A64A 1JUKA 1Q6RA 1R7AA 1ZCOA 4O53A 4HKPA 2O92A 1Z7AA 2OKTA 4Q7IA 1D9EA 1IEIA 4AZIA 1MZRA 2PU1A 3UR8A 2Q02A 1VBRA 2VCBA 4GBDA 3IUHA 3LTYA 4HTBA 3ZLHA 1TO3A 3S1VA 3C3UA 3T6CA 3R8GA 1MSSA 4NZ3A 2VDGA 2WC7A 1YLVA 4GCXA 4O4WA 4X0VA 4NAFB 3UJ2A 1YEYA 5AHNA 3WLSA 2ICSA 1RQEA 1YTKA 1CI1A 1V08A 3M0HA 3ZQ9A 1UD6A 3ITYA 5AOUA 4ILSA 2ZZ6A 3CT7A 4CCEA 4GC4A 5J5DA 3SQSA 1KBIA 1R5YA 3TYZA 4LGXA 3MP4A 5HA7A 3MKVA 1NJJA 4OUIA 2OYMA 3PFRA 3U48A 4AQLA 3PNZA 4LC8A 5FF4A 4D6DA 4HYVA 2A79A 1P4CA 3YPIA 4IPNB 4HZ8A 3FXGA 3T0BA 4DWSD 4XAYA 2RJGA 2A6LA 3TP4A 2HZGA 1MUWA 1A5AA 3KDOA 2HCVA 2TPSA 3GFXA 2O55A 4GRSA 2BVTA 4C5YA 2OTDA 3GUWA 1OADA 1M04A 2PFHA 3B8DA 5G5IA 5A8MA 1R9YA 3B4YA 4ZOEA 3WLIA 5HMSA 3TQVA