5CPMA

Xena from pseudomonas putida in complex with nadph4.
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
359
structure length
359
Chain Sequence
b'SALFEPYTLKDVTLRNRIAIPPMCQYMAEDGLINDWHQVHYASMARGGAGLLVVEATAVAPEGRITPGCAGIWSDAHAQAFVPVVQAIKAAGSVPGIQIAHAGRKASANRPWEGDDHIGADDARGWETIAPSAIAFGAHLPNVPRAMTLDDIARVKQDFVDAARRARDAGFEWIELHFAHGYLGQSFFSEHSNKRTDAYGGSFDNRSRFLLETLAAVREVWPENLPLTARFGVLEYDGRDEQTLEESIELARRFKAGGLDLLSVSVGFTIPETNIPWGPAFMGPIAERVRREAKLPVTSAWGFGTPQLAEAALQANQLDLVSVGRAHLADPHWAYFAAKELGVEKASWTLPAPYAHWLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xenobiotic reductase
publication title Better than Nature: Nicotinamide Biomimetics That Outperform Natural Coenzymes.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 133
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5cpmA00
1J4EA 3O06A 4YL2A 1W5MA 3P84A 3DFNA 4ZQOA 4UTHA 3MBFA 3C2FA 1ZJIA 1K8XA 2ZA3A 1MEHA 1FY6A 4AWUA 2VFHA 1JQXA 2FIQA 3C52A 3DFPA 4H6KA 5F2IA 3W2JA 3DFSA 3TCEA 3SW6A 4FX8A 4GWEA 4J9JA 4TR9A 3G1YA 3B06A 3FYOA 3N9SA 4HHPA 2V30A 3LOTA 2ISWA 2Z0IA 2XN0A 4LS0A 3CU2A 3SGUA 2H3DA 3LV5A 3PS7A 6ALDA 2RDTA 4O13A 5DCEA 3HJZA 3LCFA 3NM1A 5FEWA 1K03A 3FLUA 1EP3A 3PG8A 4FNRA 1TPDA 3C2RA 3QMRA 4Z0JA 3W73A 2AAMA 1VHCA 2VFDA 3UZ5A 2VKZG 1QOPA 2H3BA 2ZRUA 4S2CA 3S5ZA 3LRKA 3F03K 3W07A 4Y6GA 1EP2A 4PA8A 3QZEA 1X8FA 3OHIA 1KTNA 2B7PA 3W86A 4ZMGA 1XUUA 2CLKA 3BLFA 4O50A 2NXHA 3SZ8A 2CFFA 5D2XA 1LLZA 1K7FA 4ZQMA 1HO1A 1FCQA 5I3IA 2TYSA 3H55A 1KBJA 1N8FA 2JK2A 2W0UA 5FF7A 3WJWA 3TXVA 4CNOA 5I3KA 1KM3A 1W1ZA 3S1XA 4RR4A 4FIQA 1P5BA 2ZRVA 1SSGA 3DH7A 5CSRA 5LKYA 1FWRA 3TE9A 4LVBA 5TIMA 1W3NA 2VFIA 2FPVA 1ZAHA 3HF3A 3MI3A 4GBUA 2J27A 5IBXA 5KTLA 1TO3A 1G69A 3UPWA 4N6FA 1K3UA 3BG3A 3LTPA 3GB6A 3HB9A 3L5LA 4NQ1A 3GAKA 4MJZA 3PBYA 2EHHA 3G1FA 3NQMA 4AHOA 1PVNA 3P61A 1GG0A 1XM3A 4GC4A 5U4NA 1OG0A 1MO0A 4WY0A 4XKYA 4AF0A 3KVJA 2EAWA 4PH6A 1Y0EA 3M9YA 2GVJA 3GKAA 3MMTA 4DPPA 4KWWA 3TROA 1JRBA 1O4UA 5F2LA 5LNWA 4WOZA 3U6WA 3TMQA 2NUWA 1ME9A 3W85A 1I8JA 4O1DA 5DBTA 1KTBA 2ISVA 3LHZA 1OF8A 2H8ZA 1KBIA 3INPA 1H1ZA 1UUMA 4LT9A 4RXFA 3WFAA 3GNNA 1I2RA 2YYTA 2DORA 3B0UX 2QCNA 4IPIA 1PHWA 4JDBA 3FKRA 3P8IA 4KFNA 5HUOA 3TAOA 4CCCA 1TPUA 2VXNA 1XC4A 4L4LA 1G4SA 2WQPA 4RV8A 5CSSA 2GJNA 1S5WA 3DBPA 4JGDA 3C0JA 3Q58A 1GYLA 3W1RA 1W3IA 2C14A 5FESA 4CLMA 3W7OA 5F4WA 3CWOX 2QAFA 3P82A 3W7LA 4OBTA 1M7PA 2A21A 5FF0A 3W84A 3O15A 4DF1A 5A5WA 2X1TA 1VS1A 4IMEA 4RX0A 1OFQA 4Y90A 3IRDA 3L66A 3P62A 1KM0A 1OFOA 1T96A 5K4ZA 1TPB1 2ABAA 2DZXA 4LS1A 3W22A 2D73A 3RU6A 4UFLA 1FWTA 2G5WA 2E77A 2W6RA 3G0SA 4NT0A 2BX7A 2OZ0A 1G4TA 1RPXA 2FJKA 3CLMA 4JTSA 1PIIA 1HL2A 1WBJA 3QPYA 1OFAA 3EWUA 4NJHA 4RXGA 2HMCA 2DZTA 3A5VA 1CX9A 1OK6A 2A0NA 2RHGA 5L6UA 3BVJA 3NNTA 4WY0B 4XKYB 3RNDA 4E2DA 3NEVA 2YYUA 4Z1BA 4HN4A 3TDFA 4LTSA 4RZ5A 2QCCA 5HNRA 1ME7A 4UUIA 2QR6A 4AMAA 1F73A 1KM4A 1P4CA 3LXCA 2TPSA 1TIMA 3C4UA 4NJGA 3M5YA 2J6XA 1ZCOA 2NV2A 2QUTA 3CC1A 2GVLA 5LGZA 2YFNA 3HG4A 3L67A 1H51A 3TKFA 3MO7A 3CT7A 4PODA 4N9EA 4N4PA 3AJXA 1L2UA 4TU1A 4JX4A 3UYCA 2C15A 2DZPA 5G1TA 1Q6LA 2QJGA 3MYOA 3PUEA 3R12A 1KM1A 3NQVA 3PB0A 1IF2A 3IVTA 3MI6A 4ZQCA 3DKJA 1X1ZA 1F6PA 1T0OA 3NO5A 7TIMA 2WNZA 3DFOA 1P0KA 3W7DA 4UFKA 1KFKA 5A8GA 3EWBX 3TV8A 1KFCA 5T26A 2C3ZA 1TB3A 4QJ1A 4O1BA 4WJEA 3N9RA 1DOSA 3TH6A 2YW4A 1JULA 1SR9A 1HUVA 1TRDA 1YYAA 3UQNA 1YDOA 1F76A 4QSHA 4ZQRA 1KM6A 3IGXA 1UCWA 4MYAA 2GQAA 2V0TA 3P5ZA 3GDRA 1XXXA 3VE7A 2J88A 3BG9A 4IMGA 5I3GA 1DJNA 5K9DA 4XWUA 5DCDA 3TW6A 2QDHA 4K8HA 1OHLA 4WD0A 1EB3A 3L2IA 5AOUA 3HIJA 3ABRA 4LV4A 1PCKA 4UFIA 1AL7A 3SY5A 3W1MA 1LYXA 3NQFA 3O07A 4N9CA 3N14A 4XTDA 5EBUA 2AGKA 3M5ZA 2LLEA 1R46A 4GUGA 3TSDA 3BLEA 1SZNA 1GVFA 2WSQA 4WOQA 3DGRA 4AAJA 1NFBA 2BZNA 3HGOA 1QAPA 2ZRWA 1O94A 3KVKA 3DAQA 2JKEA 2EF9A 3GXPA 2A1YA 2NLIA 4AEOA 2CWNA 2B0MA 3R13A 4LU0A 4N9DA 1JRCA 3NG3A 1QPNA 3TUUA 5I3HA 3RK8A 3CIWA 2XN2A 3FOKA 3STCA 1ZFJA 4GNJA 2HTMA 4IUOA 1EWEA 2B7QA 5HMSA 5CZ0A 3C56A 1SFLA 3HPZA 2FFCA 2V2CA 1ONRA 2HS6A 3R5EA 3VI2A 1FX6A 1VH7A 3FA5A 3WJXA 2TSYA 5CPLA 4GE8A 5BOOA 1VYSX 2PURA 5DN1A 4DO4A 3QM3A 2C1HA 2H6RA 1V5XA 2YGYA 3DZ1A 5DY2A 3IGUA 1QCWA 1I2QA 3G1HA 3LHWA 1H7WA 2ATMA 3M7WA 1JCYA 1JUBA 1FWNA 3STGA 4HPJA 2O7QA 1OVDA 1CW2A 4MLRA 1RQBA 3A21A 3EEGA 3VKJA 4ZQPA 3NYZA 1AK5A 3S9YA 3PM6A 1THFD 3W7IA 4WY0F 4NZFA 2E5BA 1RD5A 5CG7A 1YADA 3BGGA 3W1XA 4TIMA 1VLWA 1MZHA 4OE7A 2X1RA 3UWZA 3KRUA 4K8EA 2WSRA 3E12A 1L9WA 3GXNA 1R2RA 1FWSA 1VGAA 3P8JA 3NR0A 5CZJA 4Z1AA 3O8AA 1AW2A 5G5IA 4ONVA 3NPXA 1LOLA 1JCMP 3H54A 3NQ6A 4LC6A 1L6YA 3NOEA 2YDAA 3B05A 4O18A 1WX0A 1SPQA 2ZCGA 3L68A 5BMXA 4UTLA 1VCGA 2QF7A 4JIQA 1XBYA 2JKAA 3BLIA 3A5FA 1UB3A 3ABSA 3H53A 2HS8A 2DZSA 4X2RA 2P1FA 3O63A 1H7NA 3LCWA 4UXDA 3LCGA 3ZR4A 4BR1A 3B0PA 3M44A 3QYQA 2V5BA 4GUJA 4CNNA 1DQXA 5HR6A 2DJLA 4RZ4A 3UXDA 1VPXA 4IX0A 1YPIA 3W7NA 4JTHA 1TTQA 1VZWA 3CPRA 2ZZ7A 4UTUA 2ISSA 3DI0A 3M0ZA 4PEKA 1JQVA 2QCMA 3BPWA 5SWUA 3P80A 1W3TA 2Y63A 1R2SA 4O19A 3LHUA 4O0KA 5CPNA 3W7GA 1O60A 2FB3A 1DORA 3W74A 1MSSA 2CLMA 1I45A 2FB2A 5FEPA 1K7XA 1NAL1 3VNDA 1WBHA 1VRDA 1SSDA 4GJ1A 4OHQA 5DXYA 4X3ZA 4I7VA 3I7RA 5C5YA 4U28A 1RQHA 4KKXA 2JKPA 2J9XA 3W72A 1Z42A 3Q37A 3UY8A 2W79A 1KTCA 3W7CA 3LLDA 2ATSA 3FEMA 3IV3A 4N6EA 4YCPA 3W7MA 4PL1A 3TC6A 3KAOA 5LHEA 4JS3A 1A5SA 2PRHA 3PULA 2QJHA 1W0MA 4R34A 3NQDA 3M43A 3TQVA 1XUZA 4YLWA 4O1AA 4NXSA 1Q6QA 2VFFA 4JN6A 3OIXA 1DJQA 3KOFA 2BWGA 4XZ9A 1DBTA 3MHGA 3M16A 3GX9A 2NWRA 3LTSA 1OF6A 3O1NA 4E38A 1S5TA 1KLYA 2Q3OA 1W5NA 4JYDA 1ICSA 1FXQA 4BWLC 2VEPA 4O28A 3O16A 5D38A 3L9CA 1RQEA 1LBLA 2J9YA 4XQ6A 4NJKA 2Y89A 2X2GA 1U5JA 1SZGA 4M19A 3CEUA 3W1NA 3CB8A 3LRLA 3KX6A 3P60A 2Q8LA 1JR1A 4M6QA 1X1OA 4PCFA 3BK0A 1EX5A 3W23A 4ALDA 4HKPA 2QCEA 3LCHA 1EUNA 3CEPA 4A22A 4LVDA 3EKLA 4UTJA 3W1PA 2Y7DA 1W31A 5AHFA 4WXYA 1LOQA 5AYXA 2NV1A 1Q6OA 2DZUA 4NUWA 2RFGA 3PAJA 1H7RA 4LW7A 5EMUA 1OX4A 2E1DA 4HT3A 5AYYA 3G24A 3OVQA 4X22A 3EWXA 3I65A 3QH2A 3SR7A 3D0CA 3C6CA 3S0CA 1QDSA 1LRQA 3AO0A 5ABTA 3NL5A 2VC6A 4L4MA 5FF4A 1IGSA 3DHDA 4OV4A 5C54A 1ZALA 5C2XA 3TSMA 1QOQA 4UTTA 3PY2A 3OEXA 1OFDA 1VHNA 3A9IA 3W2LA 1VC4A 3NL3A 2DZWA 4JTGA 1G7UA 3ANYA 2VENA 3JR2A 5HWMA 3W7RA 1J5TA 1YTEA 5K2ZA 1WA3A 2X16A 4DBDA 3LCXA 5AC6A 2C0AA 3PUDA 5FEZA 2ABBA 5I3JA 3C3NA 1GVQA 2J24A 2FPYA 1XDLA 4POCA 2YFOA 1X7FA 4WX2A 1TTPA 1VJIA 4CCEA 3E02A 3TFXA 5F2GA 3HGRA 3TFCA 3QW4B 4IMCA 1T99A 1U83A 3HG5A 4DELA 3ABOA 3S42A 3G0UA 4Y9AA 4FB7A 5C55A 3I6RA 2OCZA 3QMTA 3GLCA 5L9FA 1JCJA 4JXCA 2NX9A 4YWIA 4HSOA 1LRNA 3LHTA 4XTIA 4ADTA 1VCFA 5J5DA 4IWWA 2V81A 4KFOA 1TPH1 1OX4B 3CHVA 3N34A 4MUZA 3NZ1A 3SI9A 2E6AA 2R91A 2B4GA 3GIYA 2WSYA 1H1YA 4M6PA 1XL9A 1JCNA 2QAPA 1KA9F 4MY1A 2OX1A 3HOJA 1B57A 1GYNA 2E6DA 4LS2A 1P1XA 2O7SA 5DY3A 4A3UA 3P67A 3MWAA 1H62A 3V1PA 1ADOA 2R94A 4C1KA 4S1FA 2C6QA 1EWDA 3MYPA 5D05A 1S5VA 2PE4A 3L5AA 4M7SA 3W71A 5K9XA 3SJ3A 2Q8ZA 4NJJA 3GKFA 1GWJA 1QPRA 3P81A 4EVZA 2QKFA 4K37A 5D2VA 3THAA 1FCUA 1IXPA 4JTKA 2NZLA 1NF0A 4I9AA 4FNSA 3CWNA 3M5XA 1YDVA 3S5YA 4UTMA 3NVTA 3LXAA 1EPXA 1OK4A 2JGQA 5EYWA 4UCGA 3ZFHA 4AF0B 2V2DA 3NQ2A 3EXSA 3G1VA 5FF3A 2OJPA 4JY8A 4O15A 1WV2A 4P61A 2J9ZA 5K7JA 4CQ8A 3NQCA 4QNWA 1V7YA 4FXSA 1YXCA 3TQKA 4NNCA 2A7NA 1N55A 3S1UA 4QNEA 1XBVA 4I7WA 3FJLA 3PC0A 4I7UA 3TR2A 4Z0SA 3VCRA 2E6FA 4MFEA 3NM3A 3WK3A 4JX5A 3DU0A 4JTIA 5HINA 3IIOA 1GVSA 4MIMA 5LNRA 2VEMA 1MEWA 5EL1A 3EXRA 3GR7A 3KRZA 2A85A 1TTJA 3ZWTA 5KZMA 2Y7EA 3G3MA 2BTMA 3PB2A 2ZA2A 2YSWA 4G1KA 1JCLA 2WO5A 1AMKA 5HWJA 1I2NA 3ELFA 4MY8A 1I4NA 5CKSA 3MBDA 3TIMA 3TXZA 4LV9A 1HG3A 1NSJA 1R30A 1SZEA 4YMZA 1TV5A 4DF0A 4X9SA 1VYPX 2CW6A 1H50A 1QR7A 1NVMA 3LBCA 5CZSA 2WV8A 1BKSA 2A6NA 1OYBA 5IBXC 1X6UA 3W7QA 3E96A 1QPQA 4O0ZA 5D03A 3W88A 1LORA 2YR1A 4WQ6A 3M6YA 4LVAA 1ZAIA 1SQ7A 3T78A 2FTPA 1EUAA 4UR7A 4ZVJA 3LXBA 1H7PA 4S2BA 3T40A 3QW3A 1QMLA 1KLZA 1F7BA 4LOCA 4GRSA 1FWWA 4EF9A 2X30A 1N7KA 1GT8A 4MOZA 3MP5A 3W7PA 4ML9A 3P5YA 3UWUA 3T44A 4EF8A 4HPXA 2E5CA 4JTJA 1IXOA 1A53A 4EIVA 1O5XA 1OFBA 4IGHA 4NJIA 4JNMA 4GUIA 1TPFA 1GZGA 1TMHA 2EKCA 4UTWA 1FUYA 4ADUA 2ZZ4A 1YTKA 4O8RA 4UR8A 5DELA 1BEUA 3GVGA 1C9DA 2Y7GA 2YCEA 4Y96A 3LCLA 3F4NA 5U7SA 2Y61A 4DO6A 1FCVA 3P74A 4A2SA 1LLWA 1KFLA 1LBFA 2A5HA 1CI1A 2YW3A 3I68A 4NNAA 3L5MA 1EEPA 3EX6A 5FEXA 3N3MA 3NPVA 1DL3A 1LRTA 5G4EA 1H61A 5DBUA 4NNBA 1G4PA 1K7EA 2ZRZA 3QFEA 4QISA 3UWWA 5CZTA 1OFRA 3C2EA 3BW2A 2Y70A 2UV8G 1GJPA 4JD4A 3ZS4A 3O6YX 4EOUA 4TMBA 1JVNA 2CLHA 2F84A 2QCFA 2YXGA 3LX9A 4IXXA 2WPBA 3C2VA 2BXVA 1F74A 3IGSA 4UMBA 3W87A 1G67A 3O6CA 3R2GA 3C61A 3NDOA 4HSNA 1PL9A 3C2OA 3L21A 5HJLA 4GUFA 4FXRA 2QCGA 5G1YA 3JRKA 1OFPA 4NZJA 1DKWA 2BLEA 4Z08A 1W37A 4ZZ9A 5F1VA 2IQTA 3UZJA 3W1AA 5AB3A 3IEBA 1Z44A 5AHEA 1PS9A 1W5QA 2VEIA 3UXAA 4R33A 1E51A 4JEQA 1GQNA 4R53A 2FQIA 3E9AA 5BRBA 3PBUA 3GYEA 2FDSA 4MKNA 4MY9A 1YPFA 4IPJA 3T4CA 3HMJG 1TPWA 1KFBA 4IJBA 4RKAA 1G6CA 4O17A 2QCDA 1EP1A 3LCIA 5AHNA 3I7QA 3LV6A 5LNUA 2ZZ1A 1JCXA 3WJYA 2QDGA 5KZDA 1NF7A 3OBKA 1R2TA 3OVPA 3KFTA 2EPHA 1JUEA 4YCOA 4Z1CA 1XBZA 3B04A 4M7TA 1IIGA 2WKJA 5CPOA 4HNTA 3QF0A 3G1SA 3N19B 3WJSA 4M6VA 4KFPA 1EA0A 4AB4A 1H5YA 5I3FA 4LVGA 4CQ9A 5LSMA 3NPUA 1QO5A 1GG1A 1HFBA 4IXHA 2V82A 4NX5A 4NU7A 3W1UA 2QJIA 1WYIA 3OG3A 4WZHA 4OT7A 4ADSA 1ZAJA 3QC3A 4KWVA 3W9ZA 1W54A 4FIRA 1UUOA 4HIBA 1LZOA 3MP4A 5LHFA 3S8HA 4LRTA 1FXPA 1WQ5A 4O54A 4AVFA 3NA8A 1SO4A 4IMFA 2ZTJA 1AW5A 1Q3NA 2VFEA 4BI5A 3B8DA 1R47A 2QCHA 1ICPA 5G4WA 4AWTA 1QWGA 3W1TA 1RV8A 3KVMA 1O5KA 4BF9A 3IIZA 5AHLA 1TPEA 2VOMA 3CIXA 4QM1A 2AQWA 3NXFA 3NPWA 1IXNA 2A7PA 3EX3A 3LDVA 1TPC1 3FKKA 4TX9A 3SGZA 5AHMA 3FYPA 5DCBA 2Y6ZA 4UNKA 4JTUA 2CU0A 3GDLA 2QCDB 3T55A 3W3OA 3TNOA 2GVGA 3EWWA 4N9BA 3TJXA 3PWAA 1HO4A 5G2HA 2OT0A 3R89A 4JY9A 3RLUA 2CLOA 3TX9A 3HO8A 4RCXA 2Z6JA 3HPXA 3STEA 3FS2A 1GVOA 1SU5A 4PFMA 1ZHAA 2RDUA 1SFJA 5G2IA 2X1SA 3LRMA 1L6SA 5FF2A 1TJPA 4MFDA 3G8EA 2V9DA 1F05A 5KINA 3L0KA 3Q2DA 5AFDA 3MHFA 2F7FA 1A50A 5D2WA 3O05A 1M6JA 5FI8A 1DVJA 3KRSA 2E6YA 5D04C 2QCLA 4DQWA 4O11A 4LVFA 3UNDA 3WJZA 1TV7A 1SW3A 3OA3A 2XN1A 2CLEA 4K7YA 4JTTA 3G0XA 1ZY9A 3NQAA 1FCBA 4Q32A 3E49A 5HR7A 3TK7A 2C16A 5LNSA 3NAVA 4IOTA 1UASA 1F6KA 4O52A 4QQ3A 1GTEA 1ML1A 4YXGA 2PC4A 5F1UA 3F4WA 3C8FA 1LDCA 4R7JA 3G1XA 3WK0A 3UPBA 3Q94A 2QUUA 2QUVA 3UWQA 1RVGA 3MI2A 3B4UA 2B7NA 1YDNA 2TRSA 1YXYA 2YPIA 4Z1DA 2ZRXA 3CQ0A 3NQEA 1FQ0A 3QSTA 4MLJA 1TYGA 5F2MA 1YTDA 1VR6A 3TU9A 3LI1A 2Z6IA 5AHIA 4E2BA 1S3HA 2Y85A 2ZYFA 4IX2A 3HGSA 3KHJA 3P7YA 3TAKA 1DQWA 5HWNA 1SW0A 1KW1A 1PV8A 4NXKA 1KM5A 4CNPA 3EX4A 2DZVA 5D30A 1B3OA 3SFKA 2G97A 3UWYA 1LROA 1H7XA 2ZZ6A 1GVRA 3M41A 4C1LA 3BV4A 3T7VA 3I7SA 2YZRA 4RJEA 5D33A 1TRIA 2H90A 2A4AA 2QEZA 1KFJA 1OFEA 3FJ6A 1TREA 3WK1A 1Z41A 1MXSA 5CPMA 4BK9A 2FPTA 3DXIA 4UIOA 4O10A 3BG5A 4O57A 4FF7A 1M7OA 2I9EA 2JBMA 2NWSA 2Z1BA 3CTLA 3TA6A 5D02A 1QPOA 1NEYA 4E0CA 1JJKA 2G96A 2DU2A 3A24A 3LLFA 3FFSA 3O6DA 2CLFA 3G1AA 1KV8A 1XBXA 1F5ZA 4O1CA 4N4QA 4O4WA 5EY5A 3ATYA 4LRSA 2VEKA 3UD6A 3HQ1A 4Q4KA 3SIZA 3N2MA 1ALDA 2ZQ0A 3GDMA 3RFAA 1H60A 2Q3RA 3TW7A 3VFLA 3UY7A 3W7KA 2A2IA 2RH9A 3L65A 4AXKA 5TQLA 1A5BA 5AYZA 4K36A 3OVRA 3IVSA 1OYAA 3BARA 4LY8A 3S5OA 4ZQNA 1LP6A 1RZMA 2CZEA 4FEZA 1KV5A 1H63A 3E0IA 4O14A 3GR8A 3PUOA 4PC8A 4HNNA 2X1UA 2PRMA 1UJPA 1XCFA 6TIMA 3G8RA 4GUHA 3M47A 2R8WA 5F4XA 2ZTKA 4HNVA 3VE9A 3TJLA 2PCQA 1G7VA 4H3DA 5GVJA 3W7HA 1QNVA 2ZZ2A 4CCDA 3IIXA 3HGJA 3YPIA 2HSAA 3MUXA 3NL2A 1XKYA 2ZDRA 2GOUA 2NXGA 1SO6A 1HTIA 4Q33A 1PCWA 4JYEA 4FNUA 4JTLA 4MVAA 5LNVA 2C18A 3SECA 4ZL1A 4UC5A 1TV8A 1B9BA 3QQ0A 3RLVA 5AN7A 4DEFA 2PRLA 3HG3A 1FDZA 3GAYA 3A23A 4N02A 1SO3A 3W83A 5EPDA 1VLIA 5KITA 2E5DA 3SSJA 3B0VC 1IXQA 1C29A 5J5RA 4NVTA 1PE1A 1Q6RA 5HULA 5MHBA 4GFSA 2Y62A 4K39A 3EXTA 3V75A 3HPSA 2C13A 4TO8A 3N2XA 5KZEA 1GOXA 1D3GA 3GDTA 1DV7A 1OJXA 2GQ9A 2KZHA 4OGZA 5D32A 3PR2A 4FO4A 3LB0A 4LNYA 3STFA 2Y88A 3L0NA 4JTEA 4OU1A 1B4EA 4UMAA 5H2ZA 4DF2A 4BFAA 1LTDA 5BW6A 5LGXA 5K9CA 4K38A 2GJLA 1TSIA 4JR5A 4RK8A 3GXTA 4FNPA 4UTTC 3GK0A 3EB2A 4PL2A 3S1WA 5IM51 1P0NA 3R8RA 2I1OA 1EIXA 4A29A 4RLIA 2ZA1A 4RZ6A 3W2UA 3FIGA 1KM2A 4MZ1A 5TBOA 5D37A 4OQVA 2Y7FA 2A7RA 3HBLA 3K30A 4M5PA 3LI0A 5DXXA 1A5CA 2ZRYA 5D09A 3QMSA 3TQ0A 3L0GA 3PSVA 2WNQA 3IVUA 3NZRA 5KSWA 1TJRA 3MP3A 1Q45A 4EWND 3HG2A 1H7OA 1FDYA 4JICA 1D3HA 2G95A 4XBSA 2OMAA 1JUKA 2ZZ3A 3ZWSA 5AC7A 3F1QA 2ZZ5A 1SO5A 3W2NA 2XFWA 1VCVA 4DBEA 3MHUA 4UTIA 3EX2A 3U8GA 4QIUA 3U2OA 1WXJA 3G1DA 2P0OA 3THQA 1I2OA 4WUIA 1TQJA 4B5NA 1OX5A 3S6DA 4P2VA 3MJYA 3QPZA 3G18A 3W76A 5BNKA 2A6LA 2VFGA 3LBMA 4O16A 3W2MA 3S5NA 4FX7A 4O53A 4JYFA 3IIPA 1OABA 5E1QA 5HUPA 4N2YA 1W5PA 2GUUA 1GPWA 3LHYA 1F2JA 3KVLA 1W5OA 1QFEA 4D2JA 1OYCA 1ICQA 4MJMA 3BW3A 1A5AA 4XBKA 4TMCA 5E93A 3GZ3A 4AHPA 1BWLA 1G4EA 1LBMA 1ZNNA 2GQ8A 8TIMA 5G2WA 4WXZA 5DLCA 1IIHA 1BTMA 3W7JA 1D9EA 5C6MA 4A2RA 1QO2A 1TQXA 5KMYA 1SUXA 3NL6A 1T8XA 4MZ8A 3PBWA 3LGEA 2TMDA 4LC8A 4BWLA 4DO5A 1XI3A 2RKXA 1L6WA 1TPVA 2H8XA 1M5WA 2NXIA 3KXQA 2NUYA 2V5LA 4OV9A 1K02A 2EGZA 2CLLA 1FDJA 4FHAA 3PVFA 3LM7A 3BO9A 4QITA 2WNNA 1LCOA 1UBSA 3TMLA 4CQAA 3S1VA 4UMCA 1WAUA 2B7OA 2ZFAA 1W8SA 3PF3A 3QEZA 4IMDA 3EWZA 3N73A 2NUXA 3DFTA 4W9TA 1XDMA 3B03A 3QQ1A 2WOQA 4ICNA 5BMWA 5CGQA 1ZENA 4UFMA 1VYRA 2OT1A 3QJAA 3RF9A 4JTFA 2YX0A 3EX1A 5EA9A 1AW1A 1J2WA 3LTYA 4PTNA 3W70A 3DKLA 3DI1A 4AH7A 3IIVA 4U4MA 1FBAA 4LUJA 2CLIA 4MZYA 1TCDA 2V8ZA 4LWWA 2R14A 4UNLA 5K4XA 1KFEA 3M5VA 3A22A 2E68A 1YLVA 1O95A 4FX6M 5H91A 4FNTA 1K8ZA 2GPTA 4AHQA 3BW4A 1B4KA 4IQLA 2FLIA 4Y8FA 5EKYA 1AG1O 3MW7A 4JDYA 4MYXA 3EKZA 3G3DA 1I2PA 3UWVA 3PSWA 5E0KA 3W2KA 2ZBTA 3PBVA 3TC7A 5D2TA 2RDWA 5HQEA 3DFQA 5F4SA 2JGYA 3W1QA 4BI7A 3NGJA 1WOAA 5K3VA 1WDWA 4FNQA 2ALDA 3NQGA 4AWSA 1BWKA 3RMJA 4ORIA 2CZDA 2E09A 4XUGA 3WK2A 3NQ7A 3EWYA 1LM1A 2VELA 2DP3A 1TTIA 4JX6A 4A21A 4ORMA 2BSLA 1SZFA 4O4VA 1ME8A 5LZLA 4DXVA 3G22A 3GDKA 4K7VA 3NQ8A 4JIPA 2C19A 4UFHA 1C8VA 3QRHA 4BI6A 4UFJA 3JS3A 2I14A 4HNUA 1LOSA 4QAIA 1VQTA 3USBA 3BGJA 4O12A 3GNDA 1GTHA 3ABQA 3CM4A 3QSRA 2NX1A 2P10A 5AC8A 2DJXA 2V2HA 1MEIA 4LUIA 1DHPA 3DENA 4UTKA 1XFBA 1AL8A 2NX3A 4DPQA 1W56A 1RR2A 2Z2UA 2CZFA 3W75A 3LERA 3LHVA 3W6YA 1WOBA 4GXMA 3M1ZA 3DHFA 4H4IA 1SW7A 4MPQA 4K6AA 3ATZA 3W7EA 4UTWC 1PHQA 1GEQA 4OWGA 3TSBA 1Z48A 1OX6A 3W1LA 4NX0A 5D2YA 1YXDA 2CZ5A 1K8YA 2WJZA 3PG9A
chains in the Genus database with same CATH superfamily
4YL2A 2WM1A 3DFNA 2PDYA 3WLQA 3MBFA 3AZRA 3VD7A 3K4AA 1MEHA 2B81A 1JEZA 5IHRA 5F2IA 2VZOA 4B92A 3DFSA 3T42A 4GWEA 3G1YA 1EQCA 3CZLA 1T7LA 1JDEA 4GK8A 1XHGA 3LOTA 2ISWA 3U3HA 1X6LA 5FJTA 1NY1A 1I60A 4RUBA 5AZ1A 4YVXA 2RDTA 3OYZA 3IUDA 4PZVA 4O0QA 3LCFA 3NM1A 1E1FA 1FFRA 3BGAA 2BHYA 1J6OA 5FOOA 3FLUA 3PG8A 3QVQA 1H41A 1GUVA 1HGYA 4Z2GA 1PZ2A 3FEQA 3ITLA 4NAEA 4TOQA 1I9CB 3HFYA 4YNGA 1QOPA 1J0KA 1S38A 2EPLX 3M0YA 4AD3A 4GINA 1C92A 3H26A 2GOKA 2GYIA 3F03K 1X8FA 4DJDA 4KEZA 3R4IA 3W86A 2CLKA 3BLFA 3M6DA 3SZ8A 3WDJA 4JKMA 5D2XA 3VOJA 5A6JA 2P5NA 4J35A 2HNEA 2TYSA 4PBFA 2JK2A 2W0UA 4GIEA 4B2DD 1X1NA 4MNKA 1KM3A 3BCDA 1DIDA 1R7OA 1WDRA 1P5BA 1ZUAX 5LKYA 3TE9A 3ARQA 4IGSA 3AIUA 2FPVA 5IBXA 1TO3A 1R3RA 1JNEA 3BG3A 3KCLA 3WQDA 4MJZA 3W53A 2I9UA 3G1FA 1GG0A 4G9PA 1OG0A 4Z2LA 2EAWA 1KWKA 3LNPA 1US0A 3MMTA 2WNWA 3PWIA 5M3WA 4DPPA 1UW9A 1WPCA 3B8IA 5CPTA 5FAGA 1DWJM 3U6WA 3TMQA 1ME9A 4FI4A 4O1DA 1KTBA 3N18A 1KBIA 3V5OA 3GNNA 1N82A 4QCFA 1AFSA 4NAEB 3B0UX 4AZ7A 5FJUA 3P8IA 2PZNA 5XIAA 1JNDA 3POCA 4HOXA 4L4LA 2OU4A 4WGHA 4TV5A 4JGDA 1FHUA 2C14A 4JOMA 4Q8PA 3VYLA 4LYKA 5FESA 4CLMA 3W7OA 4PMZA 2QAFA 3ZMRA 4LBUA 3PNUA 3ES8A 4I9MA 4XZMX 1NU5A 2A21A 5JUVA 3SY1A 3WUFA 4ROQA 1JI2A 2ADAA 1GZJA 4HN8A 5A5WA 1VFTA 1QATA 4IMEA 1UQZA 3L66A 1EZ2A 1OFOA 1UWUA 5CG0A 5IHSA 4LS1A 4NHVA 3W22A 2ZUSA 2V3EA 1CYGA 5I24A 1FWTA 2X0HA 3DN5A 4KCWA 3TYAA 2O55A 2XVNA 3OLGA 2CWXA 2FJKA 2NQLA 4JTDA 3WG6A 3UJFA 3PNZA 4DJFA 5CC6A 3NNTA 1TKKA 3NEVA 2ODOA 3TDFA 1Q85A 2ZUVA 1Z32X 2QCCA 3LPGA 3VGFA 3QLLA 1ME7A 4DN1A 1CDGA 4AMAA 1F73A 1P4CA 1E6PA 2PDGA 4P8UA 3SM0A 3C4UA 3PZMA 3WQCA 2J6XA 2WC7A 3PZUA 5LGZA 3HG4A 1H51A 4AX6A 4ZGYA 4PMOA 1CTNA 3AJXA 3F4CA 3UYCA 1B3YA 3QHOA 3RR4A 1V51A 3IJQA 1P0DA 1BG4A 4HA1A 1XSJA 4H01A 1KCLA 3BAIA 2AMXA 3R12A 3NQVA 2PWVA 3KHDA 3OLEA 1A5MC 3DKJA 4M24A 1JPKA 2WNZA 1GVYA 1EPVA 4UFKA 5DMLA 1P6BA 2J7EA 2XFYA 4CNSA 2WKLA 2C3ZA 3F5LA 4QJ1A 2XIIA 3WNOA 4O1BA 1JYXA 5B7YA 2OEJA 2PF8A 4AU0A 1ZCCA 1MW1A 2WLZA 1SR9A 4LJ3A 4I9TA 2J6VA 1YDOA 4A6GA 4M81A 3VKBA 4JTRA 2P3ZA 3IGXA 4Q7BA 4WCJA 2V0TA 4L7ZA 2HRWA 2E9LA 1L6FA 2J88A 3BG9A 5LIXX 2D24A 1CGYA 2X41A 5I3GA 5BXTA 1DJNA 3TW6A 1YKWA 2QW5A 3L2IA 5AOUA 4C60A 5CAKA 3W24A 4UFIA 4GYPA 4KWOA 1RP9A 4NF7A 1U22A 2A3AA 1K8CA 1XYLA 5DQPA 3NQFA 4LX4A 3T0DA 3RN6A 4XX6A 5EBUA 4GC3A 4QEHA 3HV9A 2LLEA 1E15A 3TSDA 1KD0A 1SZNA 2D22A 4WOQA 1O7AA 1XLLA 4PCTA 3HGOA 1U1UA 1HIZA 2WZHA 1OZMA 3AMCA 4HQVA 2R1PA 5E0FA 2ZWZA 3R13A 4OBRA 4N9DA 1YX1A 3QV9A 2VL4A 1JRCA 4DYKA 1LWHA 3CIWA 2DT2A 2GDVA 3ZR6A 3FOKA 1ZFJA 4IUOA 2B7QA 2XVPA 2DSVA 2V2CA 2BBFA 2HS6A 3R5EA 4ZO6A 4GPNA 1FX6A 3RAOA 1TUXA 3QY7A 3WZ0E 3T6CA 3AC0A 4YVPA 1QTWA 1YIXA 1UBPC 3WY1A 4GI6A 2D23A 3LK6A 1I2QA 1UKOA 2ATMA 1JCYA 2ZOXA 9RUBA 3VGHA 4R88A 1V3LA 1FWNA 4HPJA 2O7QA 3BSMA 1RQBA 4QSFA 1RXOB 3VKJA 4ZQPA 1RCOB 4NZ1A 3WDQA 1THFD 3O0FA 3W7IA 2E5BA 1YEYA 2ZX6A 1RD5A 3ZT6A 3QY8A 1YADA 1NFGA 3BGGA 2W61A 4TIMA 1VLWA 3KS5A 2X1RA 3LQGA 3UWZA 3C0LA 3B8WA 4J3XA 5JIWA 2GGIA 1BKHA 1GOKA 3GXNA 1R2RA 4IFKA 4YIWA 3NR0A 4Z1AA 3O8AA 2OPJA 1GHSA 2VEFA 4LNCA 4AZGA 1BQGA 3B05A 2ZCGA 1NQ6A 1VCGA 3OBAA 1TVPA 3K2GA 3LQLA 2YA2A 3UW6A 4E2OA 3VNZA 2VWTA 3EZ4A 3LCGA 3ZR4A 5AECA 4MJ2A 3QYQA 2V5BA 1DQXA 4WSKA 3UXDA 1VPXA 5M1TA 1YPIA 5AYIA 2VZVA 3APYA 1BPLB 3M0XA 4MAZA 3BPWA 1KQZA 4ATDA 1D7KA 3FA4A 1ITQA 1AJ0A 3VABA 2NW0A 4GGHA 4QS6A 1EHAA 2CLMA 3EPNA 5T91A 3VNDA 4GQQA 4YYFA 2YLAA 4X3ZA 5C5YA 4KCUA 1VAHA 3HMCA 2BXZA 2J9XA 1W9VA 3UY8A 1E6SM 4B9YA 2HROA 4PL1A 1A5SA 2PTZA 3M43A 1TWDA 4O1AA 4PYSA 1Q6QA 4IFKB 1BYDA 4WJ8A 1DJQA 2BWGA 1DBTA 3ABXA 2DUAA 1W9PA 3M16A 2PWEA 3N6QA 3GNXA 4WDTA 2VWSA 5BCAA 3OZMA 1MFVA 3MWCA 4YS1A 3O1NA 4YTUA 4E38A 1S5TA 4F40A 2WMKA 4PMDA 1KRCC 3M4HA 2BNJA 1EBGA 1W5NA 1IHIA 2VEPA 4O28A 3KE0A 4E3TA 2FGBA 4XQ6A 2Y89A 3V0SA 1U5JA 4M19A 4IP7A 3CB8A 4MNLA 1RK6A 2JEPA 3AXMA 1O5RA 1JR1A 4M6QA 4HCHA 4Y7EA 4HK6A 1IR1A 3LCHA 4DLFA 3CEPA 1A0CA 3EKLA 1GPFA 1RUSA 2CZVA 3CMGA 2Y7DA 3DGBA 4PCPA 4R9OA 2E4TA 3QN3A 4Q8WA 2NV1A 1MRAA 1Q6OA 4KESA 1XRFA 1VFSA 1JYNA 5D8WA 3PAJA 4ERAA 3O7UA 1OX4A 3VM7A 1TE6A 4OUEA 3C3UA 4HT3A 3MVTA 2Q71A 3OVQA 4X22A 2PDLA 2HCVA 4X9YA 3T9PA 1LRQA 3AO0A 1BTCA 2OEMA 5ABTA 1IEVA 1XLDA 1M7JA 3BQ5A 3NL5A 2VC6A 3Q45A 4IICA 4L4MA 3DEQA 1PPIA 3CHEA 1EKOA 2VR2A 3C5QA 4DAFA 4KETA 3PY2A 3OEXA 3IJ8A 3MUZ1 3A9IA 3W2LA 5M5DA 2Z1XA 3SADA 2ZKMX 4DRSA 3PZTA 3PTKA 3JR2A 1J5TA 2PWUA 1MXDA 1HGWA 2ZADA 1GORA 1WA3A 3VA8A 1P6CA 3EPMA 1J11A 1CT5A 3LCXA 5AC6A 3E0WA 4US5A 2QJMA 2C8NA 3HTWA 2I17A 4ZOBA 4EPDC 2ABBA 1RK5A 5CSYA 1G5AA 1GVQA 1FKXA 2J24A 1DWAM 5A3HA 3T81A 5JQ9A 4D6IA 1VJIA 2DIEA 1R3YA 3TFCA 1OC7A 1U83A 2I5IA 3KDOA 4DELA 3S42A 4C6KA 4IQEA 5C55A 3I6RA 2OCZA 4N42A 1UH2A 2OLSA 4AD0A 5DX7A 1CGUA 1JGMA 1LRNA 3HJEA 4IWWA 2E28A 5HQLA 2V81A 3IGHX 1UP0A 1OX4B 3CHVA 1ZSXA 2E6AA 2R91A 4WHBA 1H1YA 4LAZA 3LPFA 3DG6A 1PDZA 1B57A 2Q01A 5DY3A 4PBGA 4A3UA 7ODCA 1F8MA 1EH9A 3MWAA 2C6QA 3MYPA 4GH1A 3VMOA 4XZHA 5CBJA 5K9XA 2Q8ZA 4GBDA 4NJJA 4CUCA 1KGXA 1GWJA 2OO6A 1PWLA 3N12A 4HYRA 4M8UA 3SAZA 3VCCA 1NF0A 4YN5A 2IW0A 2EO7A 1GW9A 1BVWA 1OK4A 2WLYA 3R7MA 5HNUA 2DDXA 4U5IA 3EXSA 3G1VA 1FWAC 3SUTA 3OHMB 2QGHA 2WVTA 3OO2A 1DE6A 4MB4A 5K7JA 2R1NA 1ITCA 3NQCA 1H0IA 3TYUA 1RBLA 4DHGA 3EWDA 1V7YA 4FXSA 2UY3A 3GO2A 1YXCA 4DZIA 3TQKA 1M7XA 4A35A 1NDVA 1XBVA 2D69A 1Q7MA 2I57A 4Z0SA 2E6FA 3NM3A 3DFYA 4JX5A 1OT1A 3E5BA 5HINA 1GVSA 5CPSA 2FTWA 1UPPA 3KM8A 5LNRA 2NQHA 2VEMA 1MEWA 2CETA 3V4BA 1KC7A 3GR7A 1XP3A 5FJPA 4F0MA 4G5DA 3H6OA 3BXWA 1X8CA 2ZA2A 2YSWA 2WO5A 1I2NA 1XYCA 3R94A 1WUEA 4LEQA 4B5VA 3A4AA 3ARXA 3TXZA 3N4AA 1SZEA 4DF0A 1G01A 2CW6A 2BODX 3LBCA 1BSLA 3QGVA 1B3VA 1MUMA 2A6NA 2BY2A 1OYBA 1CXFA 2GVYA 3GG7A 3E96A 1QPQA 1ZGDA 3TVAA 1LORA 5LIUX 3UG3A 1V02E 1ZAIA 2WCGA 1W3HA 3VMNA 3QW3A 3ITXA 4JPGA 5JH1A 4GRSA 3ZJ7A 2QLYA 3JW7A 4EF9A 2DEPA 3GUGA 3I6TA 4C1NA 5I3DA 3URNA 4LCRA 4D6GA 4HPXA 2E5CA 4JTJA 4V33A 1EDQA 2YA1A 1RJQA 1TA3A 2OOGA 4GUIA 2PC8A 4HPHA 2YA0A 1BEUA 1PAMA 1UR8A 1C9DA 1XWYA 2Y7GA 2YCEA 4Y96A 1W6TA 4DO6A 4KPLA 3ZLGA 1LLWA 1RALA 1KFLA 1LBFA 1W9XA 2YW3A 4C7GA 3MUY1 3PUGA 3I3DA 1EEPA 3EX6A 3N3MA 1NTHA 1UWTA 1DL3A 5G4EA 1KXQA 2QJNA 2X05A 4W88A 1K9FA 4IP4A 3RJYA 3BJFA 1K7EA 2DIKA 3WFLA 3QFEA 5ECUA 2W3ZA 2Y70A 1EYWA 1OZQA 3VIJA 2Y5SA 4OKDA 2VO5A 2ZE0A 1E6NA 1F74A 4KRUA 3W87A 1OG6A 2OLHA 5D4YA 4D72A 3L21A 2HNHA 4CD5A 3NURA 3JRKA 3K5XA 2EPOA 1NDWA 1TMLA 1HVXA 4KCTA 1GVEA 1W37A 2IQTA 2VNCA 5AHEA 4C1NB 3UXAA 1E51A 3H2OA 6PTDA 2NQJA 4GJIA 2FQIA 4PUDA 3WBAA 5BRBA 3B8UA 1JF5A 1XIIA 4MADA 1E4IA 2VDGA 6XIAA 3F7JA 1U33A 1KFBA 1TA3B 4RKAA 1NFPA 1EP1A 3LCIA 3OZYA 1KBKA 1ZU8A 3CH0A 4IG2A 1MDLA 4PUUA 3AZTA 4HD5A 3TZNA 3CZEA 4ZO7A 1E70M 3SCUA 1TJ2A 4Z1CA 2QXWA 4OECA 1IT8A 1BYAA 1VFOA 3E6EA 4M7TA 5CPOA 2JFEX 4HNTA 3MMWA 1XPGA 3WJSA 4KFPA 2NT1A 3BCFA 3U4FA 1QO5A 1GG1A 1S1RA 1HFBA 2ZVRA 3W1UA 3H8AA 1WYIA 4NYUA 4WZHA 1ZAJA 1W54A 2OX4A 1UUOA 1SVDA 4IMAA 1ISZA 3AMGA 4GLEA 1SJBA 4ML4A 3NA8A 1I6NA 4IMFA 1Q3NA 2DZAA 4HTBA 1QVBA 4AWTA 4TTUA 3UCCA 4B3ZA 1KQYA 2HPIA 4BF9A 2VOMA 3WH6A 3UA3A 1AVAA 1M41A 1R85A 3OYXA 3LDVA 1EDGA 2UY5A 4UTFA 2ZUMA 3CZGA 4JQ2A 3FYPA 2VX5A 4UNKA 1MMFA 3UU0A 3FHQA 3TC3A 4L56A 1KGUA 1K1DA 4RPQA 3WIJA 3I6EA 4J27A 1ZS2A 4AD2A 4IG2B 3R0KA 3PWAA 1UR1A 2PDFA 4I6KA 1MNSA 3UF9A 3N2OA 1V6WA 2KX9A 3B9NA 1KKRA 1I75A 3OZPA 1US2A 3UEQA 1DXEA 4P7NA 2YCJA 3W25A 3UA4A 1NELA 3PPHA 4HYVA 2PU0A 3H24A 5A6SA 2YIHA 4P7RA 3T09A 1DWFM 3COTA 1F3XA 3ITVA 4DI8A 3Q2DA 1DJGA 4M29A 3K8KA 1VPYA 4D1IA 2IXUA 4XO7A 2E6YA 4B5XA 4LVFA 1SW3A 8XIAA 4L65A 3ARWA 1CECA 3VOCA 3WH7A 3AS2A 3LBOA 3NQAA 3LM3A 3E49A 1S1PA 4PR4A 3NAVA 1Y65A 1W3LA 4D6HA 1E5JA 2OSYA 1QNQA 3CHDA 3THUA 3S5SA 3H4WA 1UR2A 4HMDA 2D3NA 1BFNA 2PC4A 4H7ZA 2VZSA 4IIBA 5JBFA 1EJWC 3UPBA 3Q94A 3AIWA 1S2UA 2QUUA 2QUVA 4DUWA 1YDNA 1YXYA 2YPIA 1A4LA 3BUVA 1BF6A 3CQ0A 2PZ0A 3EWCA 3WLMA 1TYGA 1YTDA 2AMGA 4A3YA 3LI1A 3SUWA 2PDXA 3HQPA 5KZ6A 2VX7A 3GHRA 4GH3A 2PWFA 3IS4A 3N29A 3KHJA 2PS2A 3MY9A 3QTPA 2PDQA 1PV8A 1KM5A 4CNPA 1ZLPA 4CCZA 4DM1A 4MDPA 1LROA 3GW3A 1JXJA 4KBXA 1H7XA 1GVRA 3BV4A 1S2VA 4RJEA 1TRIA 1HL8A 2H90A 2XINA 1M04A 3VU2A 1OFEA 3MA8A 2GVEA 1MXSA 2OVLA 4LF1A 2FPTA 3DXIA 5H8UA 1HKWA 2BFGA 2EG6A 3BG5A 2F6KA 3VDBA 2P3EA 5AY7A 1ITUA 3OLIA 2V38A 3UNTA 5ABFA 3TA9A 3WBYA 1NEYA 2W4XA 3LSBA 2G96A 2DU2A 3VCNA 3HFTA 3E2SA 1XBXA 1QI0A 4E4PA 1RBOB 3UD6A 4Q4KA 2D0FA 4E4FA 4LAOA 3RFAA 1WZKA 3TW7A 4EX4A 3W7KA 3F2CA 2A2IA 4AXKA 2GGHA 2GZXA 3GTNA 3RX4A 2RAGA 3E74A 2J7GA 3AOFA 4GI4A 2AAAA 4FEZA 1KV5A 1H63A 3U0HA 1JF6A 3GR8A 3PUOA 1OY0A 1XC6A 3OG2A 2PRMA 1XCFA 6TIMA 3B40A 2DT3A 5A6BD 3GTFA 3MDUA 1WO2A 4L9ZA 1HKKA 3A3XA 4L6OA 4NZCA 1G7VA 3W7HA 3WQWA 3AU6A 1QNVA 3CHFA 4CCDA 1GEHA 2J13A 3VIIA 5I0DA 2NVCA 4S3CA 2PWHA 4CD4A 1QI2A 4JKKA 4H9ZA 3V16A 4FNUA 4MVAA 4ZXOA 3VD9A 1K6WA 2JIWA 2PWGA 3SECA 5HJYA 4ATLA 8CGTA 1T8QA 2PRLA 3KTXA 4ZTYA 4NIRA 4ZO8A 4EE9A 3GAYA 4H8HA 1CEOA 2I7GA 3SSJA 1FWCC 1Q65A 3B0VC 5ABFB 2G3FA 4AFYA 2O4MA 3BAXA 4YTRA 1KXVA 2AKZA 3GVQA 2FTYA 1XLAA 4JTQA 4GQ0A 3SRDA 4C6LA 4DY1A 1FA2A 3VZZA 5CH9A 5GNZA 1RCQA 4TO8A 3N2XA 1D3GA 3GDTA 1OJXA 5DO8A 2KZHA 5D32A 2E9BA 4UR9A 4FO4A 3LB0A 1XLBA 2Y88A 3L0NA 3T2QA 1B4EA 1FHLA 1LTDA 5BW6A 5LGXA 2VX4A 4JFSA 4EPBC 3KOZA 3VAVA 3EB2A 2X1IA 4HA0A 1CXLA 3CZJA 4PMNA 4RLIA 2ZA1A 3PZIA 4GCXA 4RZ6A 4MZ1A 2NSOA 4MNMA 5D37A 3WX7A 4HU4A 2ICSA 3LI0A 1G1YA 5DXXA 1A5CA 5D09A 3F4VA 2VCCA 3QMSA 4Q8TA 5CAHA 1NWUA 1XLCA 3WF3A 1M01A 3CYJA 1RD6A 3NEHA 4H7CA 2OMAA 1JUKA 3QOKA 4FMVA 4MB3A 3LPOA 2ZZ5A 4IL2A 4M0XA 3MHUA 1DJXA 3EX2A 3U8GA 1XGZA 4RDYA 5D9PA 1HP5A 3S6DA 2CC0A 4IGNA 3G18A 5LA0A 2A6LA 3LBMA 4O16A 3S5NA 2PBOA 4O53A 1QOXA 3KVLA 3SCNA 4TMCA 5AYBA 8TIMA 2WHMA 1PEZA 3K4DA 3QBUA 3N2BA 5DLCA 1IIHA 1CGTA 1KB3A 1QO2A 4MZ8A 3LGEA 4LC8A 1F4HA 3M0IA 1L6WA 3IJ6A 3TN3A 3QY6A 4LCQA 2EGZA 2CLLA 3G6LA 3U5UA 4CQAA 3S1VA 3AHYA 1W8SA 1NOUA 3EWZA 1Q6FA 5DT7A 1EO5A 1OM0A 1JDCA 1XDMA 2PDPA 5BMWA 5CGQA 1ZENA 4J3VA 1VYRA 2FGLA 3FW6A 2YX0A 1J2WA 2X7WA 1C9WA 5ABEA 3VGEA 3A4JA 1VP5A 3DKLA 4AH7A 1LG1A 3ITGA 3HU7A 4PSPA 1FBAA 4JL2A 4JFUA 2R14A 3ITCA 3BC9A 4Q22A 2E68A 1O95A 5H91A 1B4KA 4JDYA 3OGVA 1J79A 2WMJA 1TUFA 3FV9A 3KL0A 5D9OA 5HQEA 1DHKA 3QKEA 1YW1A 5BWAA 3NSMA 5F4SA 2R24A 3W1QA 1HJSA 3KLKA 3RX2A 4PMJA 5BZAA 2FZDA 2XSXA 4AWSA 1OCBA 3VINA 2BMBA 4XUGA 4ZFMA 2DP3A 3LZ5A 5I78A 2E8ZA 4A21A 4Q6XA 4ORMA 2QHAA 1SZFA 1XSKA 5LZLA 4FLOA 3SEPA 1JXKA 4K7VA 3NQ8A 3SRKA 3QRHA 3S47A 2ZXAA 4RV3A 5I23A 4ZO9A 4DUXA 2WMGA 1E6ZA 4QAIA 4C6QA 3ISIX 3S9ZA 4U33A 1TX2A 4O12A 4XAFA 1UMLA 2CCRA 2NX1A 4W93A 2OKTA 1MEIA 2X0SA 3IARA 2NX3A 1KXHA 4DPQA 1FKWA 3BJTA 4OZOA 1GJWA 3AISA 3U5YA 2CZFA 3ZYZA 4KT2A 2B31A 2XH2A 1EO7A 4H4IA 4MPQA 1Z69A 2XM2A 4UTWC 4OOZA 3UVAA 1GEQA 4LH8A 4OWGA 1Y8BA 3KBVA 4NX0A 2QV4A 1QASA 1K70A 1YXDA 4IJCA 1GW1A 3OJGA 4Q8UA 1W5MA 3P84A 4U2ZA 4UTHA 4W4QA 4Q8MA 1ZJIA 1K8XA 2Y5JA 1E1EA 2ZA3A 4QCEA 1U5HA 1FY6A 3W2JA 1SJDA 3TCEA 3SW6A 2V3GA 3B06A 3KBWA 4HU0A 2FMNA 2BGQA 1W17A 5FJJA 5A69A 1VPQA 2Z0IA 4HGXA 2XN0A 3CU2A 1B2YA 3PS7A 2FZ8A 6ALDA 3HJZA 3P0WA 3KS6A 3MTWA 5FEWA 2PB1A 1EP3A 4LXFA 3MKKA 4FNRA 1TPDA 2VC5A 3C2RA 3QMRA 4Z0JA 4RNIA 3BMWA 4I5XA 4IPPA 2WQDA 2VFDA 3UZ5A 2V67A 1TJ1A 3LPPA 4XZNX 4GX9A 2F9RA 2OOFA 2DGAA 3S5ZA 4GO9A 2YDSA 1S2AA 2C0HA 3W07A 1OCNA 3QZEA 1TWSA 1RY0A 3S9IA 1C3FA 4ZMGA 1JL8A 4O50A 2NXHA 2PP3A 1LLZA 3FAWA 3OP2A 3R25A 1KGWA 5I3IA 4V15A 4QE5A 3H55A 4FOJA 5CGTA 3TXVA 1QU4A 4ZR8A 3S1XA 3DH7A 5CSRA 4LSBA 3WENA 3HF3A 3MI3A 1KBBA 5KTLA 5A95A 1AZ1A 4N6FA 1K3UA 4J3UA 2XH4A 1E4LA 1R6WA 4NQ1A 4C6BA 3U9IA 3T0TA 3FK4A 1LT8A 2EHHA 1JPDX 4FR6A 4AHOA 2DFAA 4GC4A 3UJRA 5U4NA 1PB0A 1MO0A 1C8XA 4AF0A 4PH6A 1Y0EA 2DUZA 2GVJA 2VC9A 3GKAA 1FP9A 1JRBA 4D6DA 4C6MA 3QQWA 5LNWA 4MJ4A 2NUWA 4JTAA 1I8JA 3WNLA 2I5QA 4MTVA 2H8ZA 2P8BA 3INPA 2EEXA 3G77A 1UUMA 3WFAA 4KIRA 4PUKA 4Z2KA 2QCNA 1S2WA 2V5DA 3JZUA 3PTQA 5HUOA 3TAOA 3WQVA 1TPUA 3W38A 1G4SA 2WQPA 4D71A 3CL7A 3R0UA 5CSSA 3DBPA 3Q58A 1GYLA 4ES4A 1W3IA 3GU9A 2WC3A 8XIMA 2Z7GA 5F4WA 3H2MA 4ENLA 5A6MA 1NDZA 1W2VA 3OA5A 1TWWA 3W7LA 1GOWA 3UZYA 5FF0A 1R5YA 3T08A 5I00A 5DFAA 2VMFA 4DYEA 1AQFA 4S23A 4JCLA 3PJUA 3KWSA 4DF1A 3M0LA 1OFQA 4Y90A 1XGDA 1XYMA 5K4ZA 1TPB1 3RU6A 3I3EA 2D2OA 2OODA 4I5RA 1YRRA 2BX7A 2OZ0A 1G4TA 2Y1HA 3UR8A 1PIIA 1HL2A 2XYLA 2E0PA 1HT6A 2ZUWA 2XTKA 1V0KA 1OK6A 2RHGA 2OO0A 2YYUA 4Z1BA 4LTSA 4LB3A 2VOTA 4XVDA 4KEVA 2O4QA 1CXKA 5HNRA 1SR0A 1XSIA 3B0YA 4IQDA 1KM4A 3LXCA 5HXMA 2EPNA 2FYMA 4NJGA 3M5YA 4OVXA 4C6JA 4NL1A 1CCWB 1ZCOA 2NV2A 2QUTA 4ZODA 2YFNA 1FWDC 3G1RA 3TKFA 3MO7A 4N9EA 3MMDA 2YBVA 3T2PA 2YB1A 4HK5A 2OZTA 4Z17A 2DVTA 3W6MA 4KS0A 4E4UA 2YL6A 2GK1A 4QDWA 4CEUC 5G1TA 1Q6LA 3WF0A 3MI6A 4W5UA 1IEQA 3NO5A 7TIMA 3R79A 3H2AA 2J7CA 1J96A 1KFCA 3GSMA 2NVAA 3AS1A 4RNHA 3UJ2A 4PB4A 3AIEA 3TH6A 1TRDA 1JZ8A 4EACA 3UQNA 3JU2A 2Z25A 1F76A 3M0VA 3TEVA 3L4VA 3WLRA 3GDRA 1XXXA 4H9XA 3VE7A 3IJDA 4YTSA 1TE1A 1O6IA 3DYMA 4IMGA 3CQJA 3WDIA 3ZO9A 4JQ4A 1EB3A 5JVLA 1FWBC 1XFCA 4NRSA 2BP1A 2J7FA 1LYXA 3UG4A 4XTDA 1XRSA 2AGKA 3M5ZA 4H1ZA 4GUGA 4LEFA 1TCMA 2WSQA 1WB0A 2J79A 1XIEA 2PDBA 2BZNA 2CLPA 3VDGA 1QAPA 2ZRWA 1O94A 1PX3A 4F3HA 2NLIA 1S39A 4PMRA 2B0MA 1JDAA 2P50A 4PB5A 1QPNA 2GK1B 3RK8A 4WJXA 2XN2A 3CQKA 1AH4A 3STCA 1BG9A 1V6UA 5REQA 1EWEA 3AUOA 3GVWA 3C56A 3V35A 1SFLA 1GZ1A 3TWBA 1UZHA 3A4XA 1BD0A 4RW3A 3VI2A 3T2OA 4AZIA 3FA5A 2WPGA 4PUMA 3V5CA 3EDEA 5C0QA 4B5TA 3O0KA 4UCFA 4GE8A 4B3KA 5DN1A 3QM3A 2H6RA 1V5XA 5D8ZA 2YGYA 3TTYA 1KXTA 2AKMA 3DZ1A 3G1HA 4Z2HA 2F8QA 1Q8AA 1DTNA 1CW2A 2PDJA 4LYPA 4MLRA 3A21A 3EEGA 5RUBA 2PDMA 5HDRA 4JEJA 7XIMA 3PM6A 5HMDA 4WY0F 4AD4A 1UA3A 3ZSSA 4FSAA 4OTKA 2OQHA 1W32A 4XG1A 4H9TA 3KRUA 3H2CA 4K8EA 2CNCA 4NI3A 3E12A 1L9WA 4ECLA 2PEVA 3LUTA 2HBXA 3H4GA 2ONEA 3OQ8A 1UIOA 2V5KA 1LOLA 1JCMP 4W8AA 3WF4A 3GC5A 3NQ6A 3WLKX 1L6YA 3NOEA 4O18A 1WX0A 4F4RA 5CZKA 4UTLA 2DQWA 3LD5A 3ABSA 1EFZA 4X2RA 2PP1A 3LCWA 3B0PA 3M44A 4GVGA 4GUJA 5REQB 4CNNA 4GI9A 2DJLA 3W7NA 5AZ0A 4JTHA 1TTQA 4PEKA 4ZTXA 4MWAE 1GNXA 3CUHA 5A8OA 4A8RA 2W92A 4ZE4A 4O19A 5CPNA 4HZMA 1O60A 2VZUA 2FB3A 1DORA 2DT0A 2VURA 1LQ0A 2FB2A 5FEPA 1NAL1 3RO6A 4GJ1A 4OHQA 4KRZA 1DPMA 4DYJA 4Q8VA 3S2MA 4U28A 1RQHA 4EKJA 4HOWA 4J3SA 3W72A 1Z42A 3Q37A 4GYPC 2W79A 4JFVA 1WZAA 3LLDA 3FEMA 4N6EA 2IUZA 5XINA 3S2CA 1LL7A 1V79A 4Y9NA 1K4GA 5LHEA 2HVNA 4GY7A 3M0MA 4JS3A 3VXGA 6CGTA 3PULA 2WHLA 2QJHA 3FXGA 3APTA 3BURA 4PUWA 3APGA 1XLJA 1Y7VA 2VYOA 3OIXA 3EOSA 4PMYA 5JMUA 3FVMA 1OSEA 4HHHA 4XZ9A 3GG8A 2BOEX 2G3MA 3GX9A 1QNRA 2NWRA 4I9JA 2IPJA 1JCTA 3ARUA 1OF6A 4I8DA 2FZMA 1H0GA 3NDZA 1KLYA 3VX1A 3BANA 1ICSA 3THDA 1X96A 3L9CA 1RQEA 1LBLA 2J9YA 2X2GA 4CD6A 4QTGA 3CEUA 3W1NA 3HM7A 2Q8LA 1JGIA 1Q8JA 4PCFA 3ZSTA 1AUSL 4I3GA 4ALDA 4HKPA 4TVUA 1EUNA 1GCYA 4LVDA 4UTJA 1W31A 5AHFA 4WXYA 4GYKA 3L7RA 2C1GA 3V7PA 1Y5XA 1RA5A 1AD1A 5AYXA 2Y4SA 4HVXA 4AVOA 3BICA 4Q8NA 4L1GA 5LA2A 3RJXA 3DIPA 1IWPA 4IF2A 5E5CA 3G24A 3BSHA 1CPUA 3QH2A 3SR7A 4XZWA 3CPUA 3C6CA 1DJHA 1QDSA 4UZSA 3VM5A 1UKSA 4MB5A 3GFZA 2Z00A 5IFPA 5FF4A 4GY1A 4HZ7A 1IGSA 4BEQA 3UWEA 3TSMA 1XLEA 1V0MA 1E71M 5JIPA 2WHKA 1B9ZA 2DSKA 3VKDA 2OR2A 2INEA 3WL0A 1OFDA 1UKTA 1VHNA 3L2LA 3GXDA 3DHPA 1VC4A 2AOSA 3P2VA 4JTGA 1G7UA 3ANYA 2VENA 5A1AA 4LAKA 1YTEA 5K2ZA 5CBBA 2J74A 1FHVA 2C0AA 5FEZA 3AUJA 1YBQA 1UA7A 1QI3A 2W9MA 1ONWA 2FPYA 2X42A 4R27A 4POCA 4WX2A 1K9EA 5GNYA 1PKMA 4CCEA 3TFXA 4KWUA 2XGZA 3HGRA 4IMCA 4IIDA 1T99A 3T0CA 3LGDA 3OGRA 4PTXA 3ABZA 5EB8A 1ISYA 3R8HA 4Y9AA 4FB7A 4CD7A 3QMTA 2W63A 1UG6A 3GLCA 2YJQA 6TAAA 4GIAA 3WLIA 4QHRA 5I7GA 4P8XA 4ADTA 1IQ8A 4KFOA 1TPH1 3QV8A 3ITOA 1UROA 3NZ1A 3SI9A 3NQBA 3QR3A 4V27A 1JCNA 1VFUA 3HOJA 3GXMA 4QGCA 4M6UA 3URQA 3EPOA 1V08A 3L12A 4JIIX 2O7SA 4C6OA 1ADOA 4CN4A 3SN1A 3RRAA 3VGBA 4HBKA 3A3HA 5D05A 3QTGA 3RPMA 3L5AA 3V36A 3SJ3A 3K46A 3VIGA 1DXIA 4MKSA 1QPRA 4S3GA 3ZM8A 2QKFA 2WZTA 4JTKA 4BKNA 1KO0A 4EXQA 3QV7A 4UTMA 2XGBA 3NVTA 3LXAA 3ES7A 2V3FA 3NQ2A 5FF3A 1CXIA 4JY8A 8A3HA 4CQ8A 1RLDA 3VOGA 1YBQB 2HISA 2A7NA 3VC5A 2YBTA 3WLHA 3S1UA 1UKPA 2EPKX 1TX0A 4I7WA 3VCRA 3WK3A 1XPYA 4QFUA 2PFHA 1XLKA 5E9AA 3B9OA 1G94A 5EL1A 3LGGA 1V77A 4F9JA 4F48A 2A85A 5C8BB 3KL3A 2CBUA 4IPNB 1CLXA 2XIMA 1YQ2A 1JCLA 2GJXA 1WDSA 3IAQA 5DMMA 4Z2IA 1HG3A 1E4NA 1R30A 2G4FA 4AYSA 1A5OC 1PTAA 2FVKA 1H50A 1QR7A 3CT2A 4BQ4A 1FH7A 3VO0A 3NDYA 3W7QA 2OG9A 4O0ZA 3W88A 4C6PA 4WDUA 1MUWA 4CQCA 4WQ6A 3KLLA 3M6YA 4LVAA 5T8GA 4B3LA 3T78A 3CGTA 2R9RA 1SJCA 1E40A 1H7PA 3RPDA 1MRQA 1JZ5A 4B2DA 1KLZA 5CC5A 1F7BA 2POTA 4LOCA 2WVSA 3CHCA 3TR9A 3IAPA 3MDWA 1Z7AA 2OEKA 2CBJA 1N7KA 1GT8A 4WIWA 3ZVHA 3CV7A 4NI8A 4KF1A 5HQMA 3WQGA 1EEXA 3UWUA 5I07A 1V3HA 4EF8A 1Q6GA 1IXOA 3N17A 1VBJA 1YE4A 1A53A 2W67A 1OFBA 1JDDA 4NJIA 3ITTA 4X61A 4JNMA 3WLNA 5AC5A 4PRRA 4K1GA 1TMHA 2EKCA 1DWGM 4UTWA 1FUYA 3CAWA 1FHDA 3W6LA 2ZXQA 4MB1A 3BOXA 4P7OA 5BXRA 3LCLA 3F4NA 4LYRA 1FCVA 3P74A 1VFLA 5I09A 2A5HA 3LS9A 2D20A 4S3FA 3GU2A 5FEXA 1R7AA 1LRTA 1GQKA 1Q7QA 4CN6A 2YOCA 2GJXB 8RUCA 1WUFA 3S83A 1H5VA 3C2EA 2EBNA 3CZ8A 3V1HA 3CLWA 4JD4A 2J7DA 1RBAA 2OSXA 4EOUA 1JVNA 2F84A 2QCFA 3LX9A 2XIJA 2G8ZA 1G67A 1XLGA 3NDOA 3KTSA 1PL9A 2BOFX 3UR7A 1W1PA 2IPFA 2QCGA 5G1YA 3N9KA 4D8ZA 3SY8A 3VOIA 3PTDA 2AL2A 1DKWA 2BLEA 4O1FA 4Z08A 1Q4WA 3CASA 3WQ8A 1W91A 3UZJA 3W1AA 1M3UA 5AB3A 3PPGA 3IEBA 3R10A 3ZVHB 1PS9A 2VEIA 1GQNA 4R53A 5KEZA 1GKPA 3E9AA 2G41A 1TV4A 5GJPA 3OTRA 3BZGA 5E6ZA 4GKTA 3GC2A 3HMJG 2YCLA 5BRPA 4S3AA 4BF5A 5BXSA 1JAKA 1AODA 4E8CA 1ZTVA 3WEOA 4OBSA 4M80A 1J0IA 4W7UA 2QDGA 5HANA 5KZDA 1UP2A 4XUYA 1ONEA 1WE5A 3ZQ9A 1OD8A 4DUOA 4NY2A 1XBZA 4AVNA 2QPSA 4GNKB 3E2QA 1FP8A 4E8DA 2AL1A 3FDGA 4W85A 4JCMA 3GH5A 4HNOA 3VVGA 1XLMA 2YDRA 3NPUA 1GOQA 3CMFA 1GKRA 3TP4A 2V82A 3RHGA 3C8NA 2HXTA 1PWMA 3QC3A 1WXZA 3RDKA 4FIRA 3H12A 4HIBA 1V8EA 3IWPA 3EB4A 5LHFA 4LRTA 1WQ5A 1JZ2A 1AW5A 2QMJA 4ZOEA 2VFEA 3PBGA 3H7VA 3WEZA 3IJLA 1R47A 2QCHA 1ICPA 5G4WA 3UZXA 4GXPA 2AL2B 3W1TA 1Q6EA 4ROPA 3KVMA 1O5KA 1KRMA 5C9RA 1TPEA 3CIXA 1OC5A 1OGGA 4ACYA 4DXKA 4HCLA 1IXNA 5FJRA 3FKKA 3SGZA 3KEHA 3VX0A 3BLKA 1CLVA 3CXOA 2E67A 2Y6ZA 4G8TA 4FLSA 2YCLB 1YNPA 2CU0A 4I8YA 1XD0A 1CWYA 1KCKA 3GDLA 1ADSA 3TYCA 3WNKA 3T55A 1W1VA 5CC7A 3EWWA 3WD4A 3MZNA 3TJXA 5DT5A 1PYFA 4JQ1A 2OT0A 3R89A 5M2FX 4JY9A 2JQXA 3NTYA 5JBEA 3UVIA 2YBUA 4GISA 3D3AA 3GIQA 3K4WA 1ISXA 3FS2A 1SU5A 5C9XA 2WCSA 4FLRA 3VNLA 1L6SA 5FF2A 4MFDA 3G8EA 3RM8A 5TNVA 2GGJA 2WZIA 3L0KA 3MHFA 2D2GA 4DO7A 2OQYA 5FSDC 3E0LA 3FGCA 1A50A 5D2WA 1EC7A 2QS8A 2ESCA 4QP0A 2ZUNA 4O11A 3UNDA 3TOPA 3S2LA 3AZSA 3I4EA 2XN1A 3W28A 3UCDA 2WC4A 5CEWA 2Z28A 1B5TA 1ZY9A 1FCBA 1K6AA 3DBNA 3TK7A 5LNSA 1BF2A 4X60A 3CO4A 2VGBA 4O52A 1WNOA 4QQ3A 2HDJA 1LQ2A 3ARTA 4NZ5A 1I1WA 2QIIA 4YXGA 1E9YB 2J4GA 1QHOA 2I56A 2GL5A 3M07A 3EDJA 3U2CA 3MV11 1LDCA 3MB9A 3UWQA 1V93A 3MI2A 5FKYA 2B7NA 2TRSA 1I0DA 2GWNA 3OZOA 1E0TA 2ZRXA 4MUPA 2YB4A 2PODA 4E2BA 3VOHA 3K8LA 4BQ3A 1S3HA 2Y85A 4PRTA 5FA5A 2A3EA 2DW6A 1FVPA 3P7YA 3TAKA 1Z9AA 5C7HA 5HWNA 4H41A 2BGSA 3ANVA 3EX4A 6XIMA 2DZVA 1JFXA 2FZNA 3V0UA 1E55A 3T7VA 5HA7A 5D33A 2QIWA 5CJMA 2MUCA 1Z41A 5CPMA 4WEVX 4LALA 2REQA 3IUIA 3CV2A 3PZGA 2JBMA 1PKNA 2NQZA 2Z1BA 3CTLA 3TA6A 3FGCB 4E0CA 1JJKA 3LY0A 1XYBA 4GJJA 3A24A 1XQLA 3LLFA 3O6DA 2CLFA 4O1CA 2Z4GA 3CH9A 2VEKA 4KRTA 2Y5EA 3TJ4A 3T0AA 1IT0A 3N2MA 4XB3A 1ALDA 1NP2A 1QW7A 3GDMA 2ZIDA 1XINA 4GQRA 2W66A 4C7DA 3WF1A 3UY7A 4RDVA 3B8TA 1UR9A 1E9LA 3W02A 5JU6A 3RR1A 4I5UA 2WW5A 4XVEA 2VCBA 4WF7A 4HNNA 4S38A 3BV7A 3G8RA 2OFJA 3UG8A 3M47A 1GVIA 2XVKA 4HNVA 1OGSA 3VE9A 3TJLA 1D7FA 3H2EA 3IIXA 1QI4A 2YXXA 3MUXA 3NL2A 1QW9A 2PD9A 2XJ7A 4DB7A 2GOUA 2IQDA 1SO6A 2DH3A 4Q33A 1XIJA 4JTLA 3AQUA 1Q4NX 2HJPA 1R9XA 3WLOA 4ZFCA 3D5HA 4MGGA 1E6XM 1FWHC 3BJSA 3W83A 7PTDA 2FFIA 1VLIA 4UBPC 2E5DA 2REQB 3A64A 1B30A 1QK0A 2E8YA 2RDXA 4V2XA 3FCPA 1UZ1A 1R3QA 5J5RA 3KP1A 3U7BA 3FAXA 3CTTA 1UZDA 3GTXA 3EXTA 9CGTA 3N15A 3V75A 3HPSA 1GOXA 4LGXA 2OWXA 2GQ9A 2JE8A 4XBJA 3II1A 1WZLA 1VBHA 4HSHA 4DF2A 4PTVA 4PRWA 1HF6A 1XG3A 4K38A 2WMFA 1TSIA 1H1NA 4JR5A 2DW7A 4RK8A 2VR5A 3GXTA 4WDWA 4J3TA 3NCOA 5H8PA 4A4AA 2PLMA 1P0NA 3R8RA 2I1OA 3AXIA 1EIXA 2CIPA 4AX7A 1EJRC 3MJMA 4IL0A 4IPLA 3W2UA 1KM2A 2JF7A 3WBEA 2A7RA 3U2ZA 3HBLA 2ZXBA 4M5PA 1YPXA 4HJWA 3SUUA 4ICMA 3PJTA 3VKCA 3L0GA 1UC4A 3IVUA 1EOMA 4A3HA 1H7OA 2G95A 4XBSA 4JHOA 4AY7A 4U3AA 1XH0A 4MM1A 1VCVA 4PMUA 4DBEA 5IFTA 1E4MM 4Y8EA 2VDHA 4UTIA 4QIUA 3U2OA 3ARSA 2P0OA 3THQA 1I2OA 1TQJA 3MQTA 1OX5A 3CQIA 4HU8A 4CNTA 1J0ZA 2MNRA 3MJYA 3LA4A 4JIRA 4FX7A 4JYFA 1IWBA 1OABA 1QW8A 3MV01 1W5PA 3LHYA 1G0CA 1F2JA 2Q8XA 4CEXC 4D2JA 3SCTA 1W1A1 1HJQA 3DC8A 4QLLA 1MXGA 3L4TA 3ORWA 2PF0A 3GZ3A 3IRSA 1XR2A 2E25A 1BWLA 2GQ8A 4ZENA 5FD0A 1YNYA 2WWDA 1SUXA 3NL6A 3CUIA 2YL9A 4GKLA 2TMDA 2PTDA 4GZJA 1XI3A 1TPVA 1M5WA 2NXIA 3C86A 4H9VA 4QEEA 2NUYA 2V5LA 3W01A 3EA1A 1K02A 1R38A 1S5MA 3EB3A 1UBSA 3TMLA 1EC8A 4UMCA 1WAUA 2VD9A 3PF3A 3QEZA 4FZIA 3GTHA 4MG4A 1W1B1 3N73A 4JAWA 2RJGA 4ZSUA 1UD5A 1JDFA 3QQ1A 2WOQA 4EXAA 1I0BA 2ZX5A 3RF9A 4PMQA 4JTFA 3AS3A 3GHSA 4GD0A 3WQEA 1J12A 3W70A 4ILSA 1Z3NA 1OBAA 5JXQA 4K3ZA 2PTWA 2W5FA 4UNLA 3GM8A 3A22A 5IDZA 1YLVA 1AH3A 2WWCA 1NIUA 4FX6M 4FNTA 5E6YA 1UYQA 1CZ1A 4LF2A 4X63A 3EKZA 3G3DA 4JBRA 3UWVA 3W4RA 5E0KA 3W2KA 4FALA 2RDWA 2OWWA 1UH3A 3DESA 1AJZA 1C90A 4P8WA 5FAJA 1EYEA 4BI7A 1MFUA 3NO1A 4BZYA 4FNQA 4ICCX 3UPMA 3MT1A 5FL1A 1HZYA 2CZDA 4DNHA 3BZJA 1V03A 3N3TA 1QWKA 2BSLA 5DMYA 4DXVA 4PMXA 4GIYA 3GDKA 2FDMA 4JIPA 1ISVA 1W3JA 4UFHA 1C8VA 1O68A 3QLDA 1TZ7A 4XAGA 4BI6A 2I14A 1LOSA 4F79A 5FIPA 1VQTA 3USBA 3GNDA 1CB7B 3MUAA 4KCVA 2P10A 3I4KA 1RHCA 2DJXA 2V2HA 3B8SA 1PKLA 2VUNA 1SZRA 1W56A 3RYSA 5PTDA 1JYVA 1RR2A 2Z2UA 1EJVC 4TTGA 2GDQA 5TF0A 3W75A 2CKSA 4IT1A 1UOKA 3M1ZA 3DHFA 4KMQA 4CNUA 1XYFA 1SW7A 1FTXA 1PZ1A 3W7EA 3WUEA 4U5KA 3EOLA 4QLKA 1PHQA 1OX6A 2A3LA 3GQYA 1K8YA 2WJZA 3PG9A 3O06A 3T8QA 1E3ZA 1A5NC 5CBIA 4AWUA 1X38A 1UQYA 1OEPA 2BY0A 3TYZA 4FX8A 4J9JA 2HK0A 3FYOA 1C7SA 2WAGA 3NOYA 1UWRA 2Y0FA 3WD2A 4HHPA 2V30A 3T1GA 1P48A 4LS0A 1B90A 3SGUA 2H3DA 3Q67A 5BOEA 4MNJA 2HVMA 2Y8KA 5DCEA 1UKQA 3MO4A 4ATWA 4HP5A 3CZKA 1XV8A 2G3JA 3REQA 1VHCA 4HMEA 4WKFA 3BSGA 4M82A 2H3BA 4AY8A 2ZRUA 3UT0A 3SUSA 5A8PA 3AXXA 3LRKA 2QPXA 3OHIA 1KTNA 2E7FA 5A6TC 3NJ3A 1XUUA 1B3WA 2CFFA 1K7FA 4ZQMA 4UWMA 4AC7C 3D47A 1FCQA 4Z2JA 2HBVA 3N4EA 4XSLA 1M1BA 1FWIC 5FF7A 2O56A 2HQAA 4CNOA 5I3KA 4QRNA 1WCGA 1AQ0A 3BLOA 1FWRA 3LNMA 3ZJ8A 4B4HA 4GBUA 3BL3A 4DVOA 3W82A 5HNNA 3UPWA 2AQOA 1CENA 3VK5A 3GB6A 3F4DA 3R8GA 3L5LA 5A8QA 3GAKA 4PUEA 3PBYA 2C71A 3QGKC 4NSBA 2DZBA 1DJWA 5BOFA 3NQMA 2PP0A 1J0YA 3P61A 4Q6JA 3TN4A 3D46A 4HCDA 5FJIA 4JNYA 4XKYA 1J5SA 1AA1B 3KVJA 2VVSA 4G2DA 3FSTA 1XCWA 3PHAA 1UD8A 4KWWA 1O4UA 4BCEA 3ANUA 4W84A 1J8VA 2ISVA 3EA3A 1H1ZA 3B9DA 3WFZA 4RXFA 3REQB 2YYTA 1UD3A 4KH2A 2F38A 4L80A 1X6NA 3GH7A 2VXNA 2WJEA 7TAAA 1XC4A 1A0DA 4EWJA 4A8LA 2GJNA 1S5WA 1MQPA 2F6XA 3C0JA 3H23A 4DXXA 1W9BM 3CWOX 4EK7A 2SFPA 5J04A 5HAOA 4E2VA 4OBTA 3CL8A 1R3SA 2BVTA 1M7PA 3W84A 4RE0A 1JD9A 3WMLA 5BU9A 3MSYA 5BU6A 3O15A 4ZE5A 4RE4A 3WH5A 4GQGA 3V0TA 4RX0A 1YE6A 1KM0A 2ABAA 2DZXA 1HXJA 4UQDA 4UFLA 2ALRA 1LLOA 4R3UA 1BYCA 2PSNA 1RPXA 4AEEA 1A5KC 1CGVA 4HMCA 3QPYA 4OJYA 1E9ZB 4NJHA 4KIEA 4B16A 1JYWA 4AYGA 3RU8X 5L6UA 4XKYB 1O12A 5EMYA 4E2DA 4HN4A 3A47A 5I03A 3ARVA 4AEFA 2DV0A 5J8LA 2QR6A 4D8LA 1EXBA 2TPSA 2ZUTA 3PJWA 3WL1A 4S3DA 3CC1A 2GVLA 4IISA 2BB0A 3CT7A 4PODA 3RCYA 1L2UA 5ECVA 5H8MA 4MAVA 1PTDA 2Q6ZA 2ZX8A 2DZPA 2EPMX 4WK9A 2J8GA 2FHCA 2QJGA 3MYOA 3PUEA 3UR5A 2FKPA 3PB0A 4MWAD 1IF2A 1UZ4A 3CWHA 1F6PA 3WQPA 1XISA 3DFOA 2E1WA 1V3MA 2DUXA 4GCAA 4QG6A 1XIBA 3NZGA 2Z1SA 1QXLA 3VIMA 1VJSA 4WJEA 3WELA 3CJPA 2YL5A 2G0WA 1JULA 2YW4A 1HUVA 2OXNA 4TX8A 4ZQRA 4QXIA 5ABHA 3VTRA 4XIMA 1GQIA 4FOUA 5BXPA 3C0QA 3SJNA 2QNEA 5K9DA 3UP8A 4XWUA 2QDHA 4K8HA 1OHLA 4GFIA 2FJUB 3AHTA 4F9DA 1UR4A 4WLCA 1XGEA 2P53A 1PZ3A 2VUYA 1VIZA 3E2VA 3SY5A 3O6AA 1VBUA 3TLLA 3O07A 1NOFA 4L6DA 3NVDA 4E8GA 2FZBA 2J78A 2OGJA 4QROA 1IWAA 3WLSA 4D8AA 4AAJA 4NZ3A 1Z8AA 1AD4A 1QHZA 3KVKA 2EF9A 2CEQA 2V5JA 3GXPA 1NJJA 4AEOA 2CWNA 5D9MA 3N2TA 3S6OA 3WD3A 5I02A 2G4JA 3MUIA 4GHRA 4RDZA 1C8YA 5HMSA 4L4PA 5CZ0A 4B5SA 4A05A 3HPZA 2FFCA 1ONRA 2OZ8A 1PX8A 1T6MA 1OADA 3ID7A 2FH6A 1KBLA 4J3WA 3WJXA 2J75A 2G37A 4D1JA 3UESA 2PGEA 1EJTC 2OLAA 3AWNA 5BOOA 4ERIA 2C1HA 4TX6A 1TELA 1A49A 5DY2A 3IGUA 1QCWA 3QFWA 3M7WA 1JUBA 5A6BA 5AVHA 4GABA 3NYZA 1ECQA 4Q4QA 1ADDA 2YKKA 3POHA 5CG7A 4B5WA 2QDEA 3W1XA 4OE7A 2Z29A 1AZ2A 3N13A 4JKLA 3AJ7A 5DANA 2WSRA 2IQ0A 4H6QA 1TV2A 1VGAA 3P8JA 4U2YA 1AW2A 3VNYA 4DWSD 4ONVA 1UD6A 3VIHA 3NPXA 4UOZA 2OB3A 3GYCA 4W7WA 4GYJA 3FX4A 1WDQA 1W1IE 2YDAA 2Z2AA 3VFCA 1SPQA 6REQA 4DZ5A 2NVDA 4JIQA 1I1XA 4XV0A 5CGMA 4GIRA 3BLIA 3A5FA 1UB3A 4A8NA 2P1FA 1TR1A 1H7NA 7A3HA 3AHXA 4BR1A 7REQA 3WUBA 1ZBKA 4XZLX 4HZ6A 2RGLA 3FA3A 3VD5A 5LIYX 5HR6A 1E5NA 3QR0A 1SM9A 3CPRA 1ZJAA 3FJNA 2R1KA 3M0ZA 4IIFA 3LMZA 4AWEA 1QI5A 3P80A 1W3TA 2DIJA 2VGIA 1R2SA 3LHUA 3W7GA 1V6TA 3GNOA 1FOBA 3W74A 2WJDA 1I45A 4B4FA 1K7XA 1WBHA 1VRDA 1SSDA 5DXYA 3LLXA 3CO8A 4I7VA 3I7RA 3FVDA 3UXIA 4GZIA 4V28A 4R85A 4F0KA 1KTCA 3CAKA 1MI3A 2XZ9A 3RM4A 4F2UA 4YCPA 1SMDA 3KAOA 2PRHA 1XLFA 3NQDA 1VIWA 3TQVA 1XUZA 4YLWA 4CQBA 4NXSA 2VFFA 3GFYA 3AHZA 4JN6A 3R6IA 3KOFA 4H9MA 1GYMA 2HXUA 3GRIA 3M0KA 1VD6A 3RXZA 4W8LA 6REQB 1ZB5A 3OODA 1OC6A 3UETA 2Q3OA 2W27A 1FXQA 4BWLC 4M3PA 3N1AA 3O16A 5DMNA 7REQB 4NJKA 2QUMA 2WCAA 4ZB5A 2V5CA 3LRLA 4Q4OA 5LYRA 3QHNA 3P60A 1QK2A 2V3DA 3BK0A 1US3A 1EX5A 4RZBA 4GQBA 4DJED 1QHPA 3W1PA 4UQCA 1XCXA 1BXCA 5CPQA 2DZUA 2XSAA 4NUWA 1PYMA 3E0VA 3QGAC 3SCPA 1H7RA 4X0VA 4LW7A 3NSXA 5EMUA 1MNZA 3T8LA 1DIOA 2DQXA 3EWXA 2VJXA 4EANA 5I5RA 3WMBA 5TAOA 1Q5MA 3ARPA 1H09A 2F2KA 1V3KA 5FACA 1J01A 4EPEC 3T07A 4CQDA 1TZ9A 3DHDA 5C54A 1ZALA 5C2XA 3TYBA 4GVFA 1S2CA 1R3VA 1XICA 3VUPA 1EDTA 1F3WA 4ERGA 1EGVA 3NL3A 1EZWA 2DZWA 3IK4A 3OQEA 3VIOA 4L1WA 1E0UA 2OSWA 3W7RA 3BH4A 2CYGA 1KR1A 4F0HA 2GUBA 1FH8A 3CB3A 5I3JA 4PFHA 1OT2A 2DH2A 3RCMA 3IPWA 3BLPX 2QQ6A 2EG8A 4LAMA 3GG1A 1TTPA 2BXYA 2G3IA 3FDKA 4CD8A 3E02A 1F07A 5F2GA 1LF1A 2ISDA 1B3XA 2EQDA 5A6KA 2RUSA 2Y2WA 3ABOA 2XIBA 3MSGA 2DSZA 3UYIA 3N4FA 3U4AA 1E1CA 2BY1A 4NRRA 1JCJA 2NX9A 2PBGA 4YWIA 5JH2A 4HSOA 1XIMA 4XTIA 1U30A 2EJAA 5J5DA 4V1XA 2EG7A 3HQOA 4M6PA 1PO9A 1XL9A 2QAPA 4MY1A 2OX1A 2E6DA 1GYNA 4LS2A 1P1XA 4J3ZA 1X97A 2ON3A 3Q4DA 3AMKA 4IGMA 2R94A 2YDQA 4INFA 1EWDA 1R3TA 2GWGA 4EAYA 4M7SA 4PTMA 3W71A 3L23A 1V3JA 1WZMA 4XISA 2J77A 2XDFA 3H2FA 4BS0A 2CBVA 3URBA 4HPNA 2XIOA 5D2VA 1FCUA 2CITA 3TQPA 1VENA 4DX3A 4WDXA 2VD8A 3K1DA 4HK7A 3CWNA 3M5XA 2TODA 4NASA 2JALA 2C91A 1A3WA 1YDVA 3AIVA 3S5YA 5EYWA 2JGQA 1ZQ5A 4UCGA 6ENLA 1KCZA 1UP3A 4L4OA 5MKGA 2O9OA 2OJPA 1DIKA 1WV2A 4P61A 2J9ZA 2WSKA 4F0LA 4Z42C 1K9DA