5CPMA

Xena from pseudomonas putida in complex with nadph4.
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
359
structure length
359
Chain Sequence
SALFEPYTLKDVTLRNRIAIPPMCQYMAEDGLINDWHQVHYASMARGGAGLLVVEATAVAPEGRITPGCAGIWSDAHAQAFVPVVQAIKAAGSVPGIQIAHAGRKASANRPWEGDDHIGADDARGWETIAPSAIAFGAHLPNVPRAMTLDDIARVKQDFVDAARRARDAGFEWIELHFAHGYLGQSFFSEHSNKRTDAYGGSFDNRSRFLLETLAAVREVWPENLPLTARFGVLEYDGRDEQTLEESIELARRFKAGGLDLLSVSVGFTIPETNIPWGPAFMGPIAERVRREAKLPVTSAWGFGTPQLAEAALQANQLDLVSVGRAHLADPHWAYFAAKELGVEKASWTLPAPYAHWLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Better than Nature: Nicotinamide Biomimetics That Outperform Natural Coenzymes.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords Xenobiotic reductase
total genus 133
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5cpmA00
2A21A 4UTWC 2NUWA 2ZZ5A 1F2JA 2ZRZA 5C5YA 2VFFA 4PL1A 5C6MA 1UBSA 1WOAA 2V2DA 4AB4A 3UD6A 1KV5A 1ZALA 2HMCA 2DU2A 1YPIA 2YYTA 1Q6RA 5CKSA 3G8RA 1O94A 1C8VA 1UASA 5DCBA 4CNPA 5K9XA 4JTUA 2GQ8A 2X1SA 5DXYA 3GXPA 1CI1A 1YADA 3ZWTA 1SQ7A 4IJBA 5E1QA 1KM1A 4LVGA 3NO5A 3B8DA 1ME7A 1OYAA 3CU2A 3W2JA 2ATSA 1H62A 3I7QA 2P1FA 4OV4A 3THQA 3W74A 3G1VA 3IVTA 3L5AA 5F4XA 4MZ8A 4DQWA 2C15A 5FEPA 1AK5A 1KFJA 2VFIA 3C0JA 5EY5A 4A2RA 2Y61A 3RNDA 3GAKA 1FXQA 2A2IA 5KITA 4GBUA 3TH6A 3L0NA 4UFLA 4HIBA 1G7UA 4N4QA 4NJIA 3DFNA 1PHWA 1Q6LA 1QOQA 2FTPA 3W2KA 4ZL1A 4NNAA 1VQTA 2RDWA 3W7EA 1IXPA 5C2XA 5KSWA 3GX9A 4O19A 1BWLA 2ZBTA 1SZFA 1G7VA 3QZEA 4MFDA 1AW2A 3W2UA 4BK9A 3NPWA 3BG3A 1SFJA 1FCVA 3B03A 5AHLA 3OVQA 4BR1A 4FIRA 4DO5A 3MP4A 3MHFA 3SIZA 1EX5A 1W37A 3G3DA 1LYXA 3WJXA 2RDTA 3IVUA 2TMDA 2NV2A 4N6FA 3MO7A 2VXNA 1WYIA 3VE9A 3CM4A 2WSQA 1Z44A 3G1SA 1F7BA 1YTEA 4IPJA 1HO1A 5AHMA 4UTJA 2QUUA 3TJLA 3WJYA 4AH7A 2C0AA 4NUWA 4UC5A 3QSRA 2A1YA 4O28A 3GYEA 4MOZA 3F03K 5D2YA 3EXRA 1K8ZA 4X2RA 2P0OA 2ZZ7A 3SY5A 4LU0A 3ABQA 1H7WA 3DGRA 1B9BA 4TX9A 4XZ9A 4ZVJA 1W5PA 3TSBA 3A23A 1E51A 3F4WA 4NJHA 4OT7A 1VR6A 5AHNA 4FNPA 4ZQOA 4UIOA 3TC7A 4U4MA 1WAUA 4ONVA 4OQVA 2W6RA 1F74A 1G67A 3NGJA 2Y70A 4IQLA 2FLIA 1JCLA 5F2MA 1H50A 2PRHA 4J9JA 4JR5A 3TW6A 5C54A 1N7KA 1JQXA 4ORMA 2CLHA 1RQBA 3QW4B 3QF0A 3KVJA 2EKCA 3TMQA 3H55A 4X3ZA 1GTEA 5FF2A 4AHOA 1FQ0A 4NZJA 3R89A 1FWNA 1XKYA 3W1LA 1PIIA 3BG5A 4LRTA 3LERA 3PM6A 3BK0A 4R7JA 4CCEA 1SW3A 1J2WA 3HF3A 1B57A 1X1ZA 3W7QA 3TAOA 2QCLA 3B4UA 4AXKA 4NQ1A 5KMYA 2NZLA 5AHIA 1XFBA 3NZRA 1T96A 3ZR4A 1H5YA 1LOLA 3LBCA 1TPDA 3LHYA 3WK1A 3OBKA 3MBDA 4LVDA 5FF3A 3TIMA 3W7KA 1I2NA 3NQAA 2QJHA 2FIQA 1UUOA 1CW2A 2GVJA 3LRKA 4KWWA 3UQNA 2NXGA 3LI0A 4GUIA 2D73A 1WOBA 4GC4A 1KTCA 1MXSA 4LW7A 1F6PA 3STFA 3LRMA 2BSLA 4DO6A 3M1ZA 4O11A 2ZDRA 3BLFA 4ZMGA 1K8XA 2ZZ4A 3GNDA 3TUUA 4KFPA 4KKXA 3OEXA 1W5MA 2HS6A 5DLCA 3EX1A 3W83A 2QCFA 4JX4A 2PCQA 3VCRA 2NWRA 3TC6A 3CEUA 2EF9A 3O6DA 4UFMA 5F4SA 4JIQA 1OFQA 1FBAA 3KVKA 4FNUA 3P7YA 4WZHA 3QQ0A 4YCPA 2E68A 1KV8A 1ME9A 3HB9A 1GT8A 3LTYA 4HNTA 2WNZA 3W70A 1XUUA 2CLLA 2DP3A 4WY0B 3G1YA 3DKJA 3NEVA 2A6LA 5LNWA 3USBA 3B06A 3S8HA 3UXAA 2VEPA 3MHGA 2E1DA 3PAJA 3SR7A 2AQWA 5IBXA 4TU1A 1TV5A 2R94A 1P1XA 2FB3A 1KTNA 4QIUA 3VI2A 4LVBA 3HGOA 4JYEA 3W2MA 3GB6A 3NL6A 3P8JA 1ICSA 1KM5A 1M5WA 3MUXA 4JTJA 4PC8A 3TE9A 1AG1O 4GUFA 3W7LA 3PG8A 4EF8A 3PB2A 2C16A 2E77A 2J24A 3G3MA 2YX0A 5EA9A 1EP2A 2ISWA 4QAIA 2Q3RA 1MO0A 5CSRA 3NA8A 2EHHA 1DJQA 5CPMA 3S9YA 3NQ2A 3KRUA 3HIJA 4BI7A 3MJYA 1AL7A 1S3HA 1DQXA 1LRNA 5HR7A 5BMXA 3G0UA 2E6FA 2NXHA 5L9FA 1L6WA 5CGQA 4PL2A 2ZA2A 1VGAA 3PUDA 1O95A 5AOUA 2JK2A 3NAVA 2E09A 4O1DA 2OT1A 4K39A 4K36A 2X1TA 3C8FA 1A50A 4GXMA 3W73A 1ZAIA 2QCEA 3BW3A 4WOZA 4K7VA 1ZFJA 5CZTA 2CW6A 3KOFA 1U5JA 4EOUA 4N9EA 4GUGA 2YW4A 4MPQA 2DZPA 5D05A 4OU1A 2CZEA 1FWWA 5HMSA 4AMAA 3R5EA 4LS2A 3N19B 3GR7A 1W31A 4CCCA 1HO4A 1EB3A 3QMRA 4AF0A 3G22A 4ORIA 3DHDA 5AFDA 3TXVA 2ZRXA 2DORA 2DZWA 3BG9A 1SUXA 2H3DA 1RQEA 3ATYA 3KHJA 3W71A 1ZJIA 2O7SA 2RKXA 1ZNNA 3NL3A 2BX7A 3INPA 3R8RA 3G24A 2JKPA 3TSDA 2QDGA 2V5BA 3N34A 3I68A 2YCEA 1DJNA 3D0CA 1KFKA 3EX2A 5FF4A 1KFBA 2WSYA 3C56A 1NEYA 4K6AA 1P4CA 1I2QA 3BV4A 1JRBA 4PFMA 2FFCA 1YLVA 3TJXA 1VRDA 2H3BA 4XBSA 2V5LA 1OX4A 1QO2A 1KW1A 4UTHA 3L0KA 3LCFA 3GLCA 3T55A 4S2BA 1PVNA 1FWSA 3A22A 1OABA 3W87A 4MLRA 2QF7A 2NUXA 3CC1A 4TMCA 4MIMA 4GFSA 2GVLA 1EWEA 1GVQA 3LTSA 2TYSA 1EUAA 4HSNA 4UTTA 4QM1A 1YTKA 3KVMA 1CX9A 1ZAJA 3TQKA 4LC8A 2JKEA 2ZA1A 3DU0A 1JCJA 3DHFA 3SW6A 3TX9A 1XBYA 1JUBA 2J9XA 5I3HA 1Q6QA 3W7NA 3WJSA 4TO8A 1VPXA 3TFXA 2CZFA 1YDVA 4WX2A 3NXFA 5AYXA 3FA5A 3LOTA 2C6QA 2Q8ZA 5T26A 3S5OA 1H1ZA 4UNKA 3GDTA 3H53A 3C6CA 3P74A 3O16A 1VHCA 4B5NA 3QEZA 2BXVA 3M16A 1U83A 3UY8A 3GDLA 5AN7A 5G1TA 4ALDA 4NT0A 1R47A 3ATZA 5IBXC 1G4PA 1TPC1 3W1PA 1SZEA 4AWTA 3C3NA 3G0SA 2H8XA 3H54A 3STCA 3PC0A 4KFNA 2H6RA 4Z0JA 1EP1A 3KRSA 5EKYA 3M41A 1A5CA 3QMTA 3GDRA 1DBTA 5F2LA 1ICQA 4RK8A 1PCWA 2YFOA 1GZGA 2E5DA 4FNTA 3B04A 3TFCA 1T0OA 3CTLA 1ONRA 5LNSA 1K02A 5G5IA 5DXXA 1YPFA 2H90A 1THFD 2ABBA 4LV9A 1XM3A 2ZZ6A 4JDYA 5D2VA 1LZOA 5HQEA 4JS3A 5I3GA 1D3GA 3WFAA 3GZ3A 2WO5A 4IX0A 1TV7A 2QJIA 2ZRUA 1D3HA 3B0VC 4O13A 2B0MA 1FDJA 3M43A 3Q94A 4S2CA 3M44A 4RZ6A 3LI1A 4XTDA 5F1VA 3W1AA 2E6DA 2QCDA 3BLIA 4A3UA 4EWND 2OZ0A 1XUZA 4HNNA 5I3FA 2P10A 3AO0A 1LOSA 3S6DA 4Q4KA 2CLFA 4NJJA 4JX5A 4JYDA 1MEIA 1Z42A 3NQGA 4L4MA 4MZYA 3C4UA 4JEQA 3P67A 4Y9AA 3RU6A 3E9AA 3ANYA 2Z1BA 1QWGA 2WKJA 1H60A 5H2ZA 1L6YA 2GQAA 4QSHA 1FX6A 4XUGA 5TIMA 4IOTA 1VLWA 3FFSA 1KBIA 5H91A 5F2GA 3HMJG 1FCBA 1FWRA 3NG3A 4M6QA 1B4EA 2CFFA 3C2OA 3LX9A 5E0KA 3LHWA 3G0XA 4EVZA 3GKAA 3R12A 4MY9A 1ALDA 2J9ZA 2PRLA 1H7RA 6ALDA 5AHFA 5HWJA 4WQ6A 1O4UA 1FDZA 4QISA 3NQ6A 4PTNA 5AC7A 3TV8A 3WK3A 1WBJA 3LCLA 4JTEA 2B7QA 1QCWA 1TTJA 4JN6A 4S1FA 4LVAA 1EIXA 1TPWA 1LORA 1SSGA 1IF2A 3UWWA 5FESA 2JBMA 5EPDA 1S5TA 3W2LA 3HPXA 4NJKA 3IIZA 1TB3A 1EA0A 4Y6GA 1Z48A 1OF6A 2QKFA 4UNLA 4RCXA 3EWZA 1I2OA 5AYZA 5KZDA 1LBLA 4OGZA 3T44A 1W5QA 5J5DA 4H3DA 1I2PA 1GYLA 5I3IA 1KTBA 1RQHA 2QUTA 5D37A 1OK6A 3SI9A 1T99A 4BWLA 1J4EA 2DZVA 4O16A 4UUIA 3QPZA 1HUVA 3O1NA 5DBTA 4JXCA 4GJ1A 4LOCA 1EPXA 2VKZG 5CZSA 3TAKA 4BI5A 2B4GA 5HULA 3TSMA 3LLFA 4PCFA 3GXNA 2FDSA 5DY3A 3EX6A 1BWKA 3DKLA 1GVOA 5HUOA 4JTSA 2EGZA 2TPSA 3MI6A 1KM6A 1ZHAA 3TROA 3BGJA 3HJZA 4QJ1A 1GG1A 3FJLA 5K4ZA 5FI8A 3KXQA 1KA9F 2DZSA 2W79A 1H7PA 3W7IA 2ZZ2A 4UFHA 4JD4A 1MZHA 3YPIA 3NM1A 2EPHA 4UTKA 1TQXA 3W1QA 3L5LA 4ADTA 2VEMA 2X2GA 4QNWA 1SFLA 2JKAA 1IXOA 2QCCA 4XKYA 1GQNA 3FYOA 4I7WA 3W72A 1SPQA 3V75A 1VH7A 1VCFA 1KFLA 3IIPA 5K4XA 4UTLA 4ZZ9A 4UTUA 1FXPA 3BGGA 1G4SA 1OYBA 2VELA 1H7XA 5KINA 3VFLA 3PBUA 2WNNA 1YXYA 2BLEA 3M47A 1IGSA 3QSTA 2A5HA 3IIOA 4MLJA 4XWUA 2CWNA 3DFTA 1TO3A 2ISSA 4CQ8A 3EKLA 4JIPA 1OX5A 2CZDA 3L5MA 7TIMA 4WOQA 3G1AA 3PULA 5LNUA 3FIGA 2GOUA 2Y6ZA 5D2TA 3TNOA 3LV5A 3OHIA 3CT7A 4BFAA 4LNYA 3PBVA 3W6YA 3IIXA 5LNVA 3BVJA 1M6JA 1LDCA 3W75A 4X22A 4CQ9A 2C14A 2QR6A 4O8RA 2FJKA 5DCDA 3QQ1A 4N02A 4O0ZA 4GUJA 1GVRA 5DELA 1HL2A 2F7FA 1LLWA 1G69A 4ICNA 1F05A 3B0UX 2Q8LA 4MYXA 3W3OA 4E38A 2J6XA 1H1YA 4LVFA 4AVFA 5DN1A 3W23A 4P2VA 4O1CA 2G96A 1X6UA 1VYRA 2R14A 1JCXA 3UZJA 4H6KA 5AHEA 1SU5A 5TBOA 1JULA 4W9TA 3UWVA 4O1AA 5J5RA 3E96A 2JGYA 3C2FA 4UR7A 3JR2A 3DH7A 2Z6IA 3NZ1A 5G2HA 1Q45A 3HOJA 3TW7A 3W1XA 5ABTA 5G4WA 1SW7A 5AC8A 3NVTA 3W86A 4NX0A 1GVSA 1RVGA 3DXIA 3M5ZA 2CLMA 3WK0A 1SO3A 2X30A 3LCHA 4UTWA 1QPNA 2V9DA 2YXGA 1JVNA 3CPRA 1JCYA 3MI2A 1XBXA 4DF0A 3I7RA 2WSRA 3KRZA 1OK4A 3A21A 3DAQA 3LDVA 3N3MA 2QCNA 3UWYA 4O4WA 4RKAA 1VCGA 4O12A 3TQVA 3NQMA 1VS1A 2AGKA 4JDBA 1QPRA 3K30A 4LV4A 4FO4A 1WBHA 3A5FA 4HT3A 4R34A 3W7OA 2B7OA 3NOEA 1WX0A 2HS8A 1EEPA 2ZQ0A 2WPBA 1DOSA 1LM1A 3BW4A 4JTFA 4CLMA 2VFGA 3L68A 5A8GA 4M7TA 1TV8A 2E5CA 1FCUA 4FNRA 1L6SA 3O8AA 3S5NA 1TPVA 4JTKA 4FX7A 4O4VA 4JY9A 1OX6A 4LS1A 4OE7A 4WUIA 1KLYA 1QAPA 3QM3A 3W7MA 3G18A 3CB8A 4FHAA 3WK2A 2RH9A 3EXTA 5CPNA 1OFOA 1LBFA 4RX0A 1VC4A 3MYPA 1LRQA 1RD5A 1TRIA 3EEGA 3GDKA 2DZUA 3OVPA 1DKWA 3W76A 4K38A 2AAMA 5HWNA 3NQDA 4YXGA 5IM51 1SO6A 2Z6JA 2BZNA 4PEKA 1PCKA 4JTLA 3EB2A 3FKRA 3UY7A 2E6YA 3OVRA 3QH2A 2GJNA 4UTTC 3A9IA 1FY6A 1PV8A 2WNQA 4HKPA 2E6AA 3TA6A 3LCIA 3ABSA 1QOPA 2VENA 5F4WA 2PURA 3QFEA 4QNEA 2DJXA 3U8GA 4AHQA 3O07A 4FXRA 5BMWA 3TDFA 1PHQA 2PE4A 3W85A 3EX3A 3ZFHA 4RZ4A 2A4AA 3ELFA 3PSWA 4NZFA 2YDAA 2XN2A 5FEXA 3W7DA 4NXSA 2XN0A 4N2YA 1SW0A 1OFDA 4IPIA 1FWTA 2A7RA 1KM4A 2ZZ3A 1O5KA 3FLUA 1TPFA 2Z2UA 4O53A 1O60A 3P81A 4K8EA 2CU0A 5FEWA 1R2RA 1VZWA 1IIHA 1TMHA 3B05A 4Y90A 1G4EA 4JTGA 1LRTA 3KVLA 3PF3A 3STEA 1PS9A 2VFDA 1Z41A 4MKNA 4A2SA 3C61A 1K3UA 3I65A 1QPQA 1K03A 5EYWA 3UZ5A 1QMLA 2C3ZA 3W84A 1R2TA 2OT0A 3PVFA 1JCMP 2NXIA 1X1OA 1W56A 3N9RA 4XTIA 4NVTA 5F2IA 5EMUA 1OF8A 4M6PA 2ZA3A 2X16A 2V82A 3GDMA 1VYSX 3NNTA 1I8JA 3BPWA 1LP6A 4O1BA 5HWMA 1WDWA 1KBJA 4TR9A 1GYNA 3L21A 1S5WA 1F76A 2OX1A 4IMEA 4UR8A 3S1VA 5FF0A 5BNKA 3VKJA 4A22A 4LWWA 4GRSA 4O14A 2V2HA 3P8IA 2V0TA 4IMFA 1G6CA 1QNVA 3M5VA 3DI0A 1K8YA 1H7OA 2RDUA 3RMJA 1OFRA 1X8FA 1KM3A 4IXHA 3HG4A 4O0KA 5A5WA 1EP3A 4OHQA 5G4EA 1RR2A 1QPOA 3LRLA 4UXDA 1YTDA 1TIMA 3HGRA 3EWWA 3DBPA 3LGEA 2C19A 1XC4A 4FXSA 3CWOX 4R33A 5I3JA 4IMCA 1ZENA 3RLVA 4MYAA 1DVJA 1R2SA 5BW6A 4UFKA 1TPB1 5LGZA 3CQ0A 2V2CA 3NL5A 2RHGA 1A5AA 4JX6A 1NSJA 3N14A 4K8HA 1QR7A 1MEWA 5KZEA 3EWYA 1BTMA 1T8XA 1OHLA 4HPJA 4FB7A 3TKFA 3LLDA 2NLIA 1L2UA 2V30A 1TSIA 2BTMA 3IGUA 4UFJA 3NQEA 2C13A 1RZMA 4L4LA 1M7OA 4JY8A 3L9CA 3GVGA 4H4IA 1F73A 2CLOA 2YPIA 3G1HA 4QQ3A 4DEFA 1ICPA 1B3OA 1WXJA 3QYQA 1UUMA 5DCEA 2FQIA 3G1XA 4O15A 4OBTA 2Y85A 1A5BA 2QCDB 4N9BA 3DFQA 4IMDA 2WV8A 3DI1A 3T40A 4AWSA 1OFPA 3P5ZA 3LXBA 3S42A 3WJZA 3W1TA 3QMSA 3PB0A 2C18A 3CEPA 4ZQPA 3IIVA 3W7GA 3PG9A 1EWDA 5G1YA 3W7HA 1PL9A 2Q3OA 4RR4A 3W7JA 2YZRA 4MFEA 3CLMA 3S1UA 1G4TA 1SSDA 3AJXA 1GOXA 3DFPA 5HNRA 2QAPA 4AEOA 4O10A 2Y7FA 3JS3A 5CZJA 5FF7A 2YYUA 5CZ0A 3HG3A 1TJPA 3IV3A 4BI6A 2NV1A 1XDLA 4Q32A 3W1RA 1JUKA 3RLUA 1YYAA 4I9AA 4FIQA 2BWGA 4LC6A 1YDOA 4FF7A 2VEIA 1RV8A 5G2IA 4DXVA 3F1QA 3PWAA 4JYFA 2ZCGA 4AWUA 4JTTA 3QC3A 4WXYA 3PSVA 3LB0A 4GUHA 3R13A 5D2XA 1WA3A 5TQLA 4EF9A 4O57A 1OFBA 1XCFA 2R8WA 1GEQA 2DJLA 2I9EA 3LBMA 5CSSA 4RJEA 3T4CA 2DZTA 1XBVA 3Q58A 1SO5A 3MMTA 4K37A 4O54A 4N9DA 3NPXA 4QITA 5LSMA 3UWZA 1DORA 5LGXA 4M5PA 4O50A 4MY1A 5D32A 4IWWA 2EAWA 2QDHA 4XQ6A 4UTIA 2E5BA 4RZ5A 1JQVA 1I2RA 4LY8A 1J5TA 1C9DA 1TYGA 1UCWA 4JGDA 3NQCA 1HG3A 4NNCA 5BOOA 5K9DA 2F84A 3P60A 3LXCA 4LUJA 2YFNA 2Y63A 3LXAA 1GWJA 3W9ZA 3G1FA 1NVMA 3FYPA 1ML1A 4IXXA 3MP5A 4TIMA 3QW3A 4Q33A 5U4NA 4DPPA 2G97A 5LHFA 2Y7EA 4K7YA 3QRHA 3UYCA 5LNRA 1GJPA 3SJ3A 1NFBA 4YL2A 5D02A 2FPVA 3S5YA 4N9CA 4HNVA 5K7JA 5HUPA 1W3IA 1K7XA 5I3KA 2J9YA 3N2MA 1IIGA 2O7QA 3N9SA 3S5ZA 2QCMA 1TTQA 4M6VA 3TCEA 2I1OA 2CZ5A 3A5VA 3W7PA 4GWEA 4I7VA 5K3VA 1KM2A 1W1ZA 3C2EA 1JCNA 1TTIA 1W54A 1H7NA 2Y7GA 4HNUA 3NQ7A 3SECA 4LS0A 1OYCA 5CPLA 5HJLA 5K2ZA 3KFTA 1ZCOA 1AMKA 3T78A 5EBUA 1RPXA 2PC4A 4MZ1A 4WXZA 1F6KA 1HFBA 3P80A 3W1NA 4ZQRA 3LV6A 3JRKA 2WOQA 8TIMA 1HTIA 2IQTA 4XBKA 1A5SA 4X9SA 3MI3A 3HQ1A 4KFOA 2TRSA 1ADOA 3V1PA 3GNNA 3MP3A 3QPYA 1EUNA 1NF7A 3NM3A 5D03A 1H63A 4GE8A 2PRMA 4NXKA 2X1UA 3NPUA 1K7EA 4JICA 1KM0A 4CCDA 1O5XA 2YGYA 5AYYA 4FEZA 1JJKA 4JTHA 3FS2A 1Q3NA 1P0NA 3N73A 3HGSA 4UCGA 3B0PA 1BEUA 1OG0A 2ATMA 5GVJA 4DBDA 3U2OA 4Z1CA 3HO8A 1V7YA 3P5YA 3TR2A 3O06A 4HSOA 1MEHA 3FJ6A 3GAYA 2UV8G 4A21A 3TU9A 4Y8FA 1W0MA 1XBZA 3PR2A 1LTDA 2GQ9A 1TREA 3DENA 2QUVA 1TPUA 1YXCA 1PE1A 3SGUA 3NR0A 4ADSA 4UMCA 3IGSA 1WV2A 3IRDA 3N2XA 3UWQA 2A85A 2OMAA 1GG0A 3KX6A 4IUOA 1OFEA 4OV9A 4PODA 3F4NA 5CPOA 5HINA 3LTPA 4O17A 2YW3A 3ABRA 3UWUA 5C55A 1W5NA 3W07A 3W1MA 4RXGA 1OVDA 3DZ1A 1AW1A 4YLWA 2I14A 4ADUA 3CHVA 5AB3A 1GVFA 3NYZA 5MHBA 3EX4A 5E93A 3W2NA 1BKSA 1QFEA 4O52A 4OWGA 2OJPA 2J27A 3S0CA 2NUYA 3STGA 2ZFAA 5F1UA 3CIWA 3M0ZA 4WD0A 3VE7A 3ABOA 2GVGA 2NWSA 4LTSA 3S1XA 4LT9A 3OA3A 3NQ8A 1TPH1 4MJMA 5L6UA 3HG5A 1W5OA 4E2DA 2LLEA 1Y0EA 1ZY9A 3OIXA 4YWIA 4U28A 4O18A 2Y7DA 3SSJA 1GPWA 3E12A 1R30A 1JRCA 1Q6OA 3G1DA 3W88A 3WJWA 4C1LA 5D33A 5LHEA 4R53A 1OJXA 1JR1A 5EL1A 3G8EA 1VCVA 3M9YA 5DY2A 3A24A 5DBUA 2HTMA 4NNBA 2VFEA 1FUYA 4HN4A 4JNMA 4JTIA 3L65A 1XI3A 4BWLC 4DBEA 4CNNA 3FEMA 1P5BA 3Q37A 5U7SA 1D9EA 3P84A 5D2WA 2FPYA 4E0CA 5KZMA 1F5ZA 4IGHA 4NJGA 3THAA 3GKFA 3P82A 2QCHA 2G95A 3MBFA 2ALDA 1H61A 2XFWA 3SZ8A 1A53A 1TTPA 3MHUA 1IXQA 4XKYB 2ZZ1A 4EIVA 5SWUA 4FX8A 3BLEA 2ZRWA 2KZHA 2ABAA 4N4PA 3BW2A 2YR1A 1AW5A 2ZRYA 5CG7A 3TMLA 3T7VA 2A0NA 1TPEA 3SGZA 4CNOA 1IXNA 1QO5A 3EWUA 1W3NA 5BRBA 4MY8A 1QDSA 2FB2A 4YCOA 1L9WA 3M5XA 3FOKA 1SR9A 4FNQA 3KAOA 3LCWA 1I45A 2VC6A 4M19A 2XN1A 2ZTKA 3LHUA 1YXDA 3IGXA 4C1KA 4AF0B 1VJIA 5D38A 1XL9A 1C29A 3RK8A 5FEZA 2Y88A 5AC6A 2WQPA 3PBWA 4MVAA 2X1RA 3L67A 1KLZA 4YMZA 3MWAA 3VNDA 2GJLA 1NF0A 4LUIA 2G5WA 3O05A 4Z1BA 2QCGA 4A29A 1K7FA 2B7NA 1W8SA 1TRDA 2ISVA 3HBLA 2CLEA 3BO9A 4HHPA 4ZQNA 2OCZA 3C2VA 2TSYA 3P61A 3HGJA 4UMAA 3EXSA 5D04C 3HG2A 3IVSA 1KFCA 3TQ0A 1DV7A 2DZXA 3BARA 3M5YA 2WJZA 3PBYA 1ME8A 3PUEA 4AAJA 1X7FA 2R91A 1UJPA 4HPXA 2A6NA 4NU7A 2NX9A 1M7PA 3O63A 4M7SA 3MYOA 3TK7A 1WQ5A 1FDYA 3EKZA 5D30A 3PUOA 3LHVA 1H51A 1LCOA 1MSSA 3HPSA 5LZLA 4WY0F 4ZQMA 3W7CA 4ZQCA 1DHPA 3C2RA 3UXDA 4Z0SA 1OX4B 3TXZA 3IEBA 1N8FA 3OG3A 3L0GA 2FPTA 1R46A 3EWXA 4CQAA 3W22A 3RFAA 2W0UA 2V81A 2J88A 3P62A 3DFSA 3RF9A 3CWNA 2VOMA 4WY0A 3ZWSA 2CLIA 4MJZA 2NX1A 3PS7A 3I6RA 1LROA 4Z1AA 2ZYFA 3LHZA 4UFIA 3HPZA 3ZS4A 4DELA 3L2IA 3QJAA 3C52A 1TCDA 4FX6M 2A7NA 4Y96A 4UMBA 4DO4A 3E49A 4IX2A 4Z08A 4AHPA 3W7RA 4G1KA 4IMGA 4WJEA 3UNDA 1B4KA 3CIXA 1P0KA 3NDOA 4NX5A 2Y62A 2B7PA 4FNSA 4N6EA 4RV8A 3GK0A 3LCXA 3M7WA 3Q2DA 1W3TA 4PH6A 4ML9A 1TQJA 2YSWA 4DF1A 2GUUA 1LLZA 4BF9A 3SFKA 3U6WA 2NX3A 4D2JA 1DL3A 2JGQA 5G2WA 1DQWA 1FCQA 4KWVA 3DFOA 3UPWA 5LKYA 4RLIA 5KTLA 4PA8A 1NAL1 3E02A 1TJRA 1UB3A 3L66A 1XXXA 3NQVA 3NL2A 1N55A 5K9CA 1VLIA 2GPTA 3R2GA 2QAFA 4POCA 1I4NA 3O15A 3E0IA 2ZTJA 4RXFA 2ZRVA 3W1UA 1SO4A 4P61A 2A7PA 1OFAA 2QEZA 3LCGA 4GNJA 3UPBA 2QJGA 4LRSA 3GR8A 2CLKA 2VEKA 1AL8A 4Z1DA 1VHNA 1LOQA 1YDNA 3NQFA 2H8ZA 3LHTA 1GTHA 4TMBA 3GIYA 6TIMA 4DF2A 3LM7A 3GXTA 2V8ZA 1ZAHA 2C1HA 2HSAA 3PY2A 1KFEA 3EWBX 4E2BA 2VFHA 3S1WA 3O6CA 3M6YA 3MW7A 3I7SA 5HR6A 3O6YX 1SZNA 1LBMA 1JUEA 2Y89A 1SZGA 3FKKA 4MUZA 1VYPX 4UTMA 1XDMA 4I7UA 2Z0IA 4DPQA 2RFGA 1V5XA 5D09A 1S5VA 3NPVA
chains in the Genus database with same CATH superfamily
4X9YA 2NUWA 1L8PA 2ZZ5A 4KGLA 2ZRZA 2PDKA 3XIMA 1ONXA 3UD6A 2DGAA 1Q13A 3IJQA 3UJ2A 1H11A 2WCGA 1JDFA 4ZFMA 1AFSA 2AMXA 2YYTA 4CNPA 1N8WA 5K9XA 3SRFA 3TYCA 1ZPTA 3GXPA 1CI1A 1NP2A 5LYRA 3ZWTA 3ONBA 4LVGA 3NO5A 1OYAA 5D8ZA 3LA4A 3HPFA 3S2NA 3I7QA 2VHLA 4OV4A 1WZLA 3G1VA 1ISZA 1R3QA 3ITYA 4RL3A 3HMCA 1FHLA 5FEPA 4MG4A 1KFJA 2YB1A 4DRSA 4GBUA 4MPKA 2F9RA 4UFLA 4HIBA 4N4QA 3D3FA 2BHUA 5E70A 4NNAA 3EA1A 3B0XA 5C2XA 3RLGA 3E74A 1QHPA 3VUSA 3XISA 1BWLA 4RPPA 1G7VA 3QZEA 3GXMA 4MFDA 1QJWA 1GORA 1EF3A 3B03A 3P2VA 5AHLA 3OVQA 4BR1A 1R3TA 1Q7QA 4A05A 2PDIA 1EX5A 3G3DA 1B31A 2Z4GA 1V3IA 1JPKA 3AIEA 1JYWA 3C0QA 3LBOA 4C91A 3DC8A 4HA1A 3I6EA 3CM4A 2WSQA 4HB7A 1Q66A 1QW9A 3PHAA 4IPJA 3SUSA 3HQNA 3TYUA 3A4XA 3AIUA 3PBGA 3T09A 5AHMA 3TJLA 2VGBA 1R3RA 1S5NA 3QSRA 5D2YA 1K8ZA 4ZO9A 2ZZ7A 3VXGA 5JUVA 4S3GA 3WQ6A 1UHVA 2O4MA 1E56A 3DGRA 2PLCA 2FJUB 4AX7A 4TX9A 4XZ9A 4ZVJA 3TSBA 3A23A 3F4WA 3KOZA 3BSGA 3M64A 1OZMA 4C6QA 1B2YA 1REQB 3H21A 4OQVA 4B92A 5CAKA 1G67A 1MRAA 2Y70A 2FVLA 1BRLB 3O9NA 5F2MA 3BLOA 4JR5A 4GGHA 3REQA 3TQPA 5C54A 2CLHA 1RQBA 4PUKA 2EKCA 2AQVA 4K2SA 5FF2A 5CJ5A 1TWZA 4W8LA 4NZJA 1FWNA 1XKYA 4GVHA 3TTQA 4W7VA 1PIIA 3GHSA 3BG5A 3LERA 3QZ6A 4R7JA 3TEVA 4UOQA 4CCEA 1XLHA 1JF6A 4C6OA 1A3HA 2GL5A 4DUWA 3WD0A 4S39A 4DVOA 3NZRA 3AYSA 1UWUA 2X1IA 4XAZA 3BAIA 2INZA 2OVLA 3MBDA 3W7KA 3IK2A 2QJHA 2FIQA 5DF0A 1VF8A 4RNIA 2GVEA 1VBRA 1WOBA 1IEWA 3WLLA 5I78A 1A5KC 2GGJA 4C6MA 4KKXA 1X96A 4MM1A 1S2VA 1K77A 3CJPA 1MMFA 3O6DA 3KDOA 1UD2A 4JIQA 3N18A 3MSDA 1F8MA 3BJFA 7ENLA 4YCPA 2VT0A 2PCEA 1ME9A 3LTYA 2PZ0A 1S5MA 2GGEA 4HNTA 1S1RA 2VZOA 4HK5A 4DM1A 5BOFA 1YIXA 4ASTA 1B0IA 3USBA 5DQPA 4TVDA 4GY1A 3MHGA 4PE8A 3AIQA 4OTKA 5FACA 1VIWA 2FB3A 1KTNA 1VIZA 3W2MA 3SY8A 4EF8A 2J24A 4HMDA 3G3MA 4Q8UA 4AC1X 1EP2A 5IXEA 4AZIA 4QAIA 1GVYA 5CPMA 2WM1A 4Q8WA 3S9YA 1J01A 5I02A 5E6YA 4BI7A 3MJYA 1UD6A 5BMXA 1BXCA 1YW1A 4MMWA 3WNOA 4PL2A 3KBJA 3PUDA 2J13A 2E09A 1FWCC 3CK5A 3THDA 3R94A 3W73A 2QPUA 1E6NA 4FSAA 2WKGA 1ZFJA 4FXFA 3KOFA 4N9EA 4PCPA 1MFUA 2OQYA 1PX8A 5H8PA 3DYOA 4AX6A 2CZEA 3R5EA 1TX0A 4LS2A 4FLRA 1MXGA 2X2YA 4A3RA 1KWGA 4GXPA 4QP0A 3G22A 4H6EA 1HKVA 1PKLA 3UXLA 4ORIA 3C3UA 5AFDA 2X7VA 2DORA 3BG9A 3WNMA 2H3DA 4PTMA 3KHJA 2RKXA 3A47A 3NL3A 2BX7A 4PTXA 2I16A 2POTA 1ZGDA 4Z2GA 2V5BA 1ITUA 3GFYA 4J3UA 3UEQA 4GYJA 1E6SM 3C56A 1R3YA 3UESA 1HKKA 4X0NA 4GLEA 4H19A 1E0TA 5DT7A 3RG6A 4PFMA 3GU9A 1OX4A 1BVNP 3CHFA 4UTHA 1EJTC 1QXLA 3R43A 3W87A 4MLRA 2QF7A 2NUXA 1TZ9A 1UZ1A 2YA0A 3CC1A 1B54A 2J47A 4KIEA 3GTIA 1DWAM 1EUAA 4QM1A 1J2BA 1ISWA 4G7EB 4J27A 3H4XA 3WFZA 5AZ1A 3M7SA 4KRUA 3DU0A 1JCJA 4XAFA 4M0XA 4ACZA 3SW6A 4B5UA 1JUBA 2INFA 2PSNA 1QK0A 1VPXA 3PWGA 3RGTA 2CZFA 5LIWX 2CZVA 1LUCA 2EKGA 3JVAA 3N13A 3WLIA 3LOTA 2Q8ZA 4MNKA 1H1ZA 3GDTA 3P74A 1RSCA 1VHCA 1B3WA 2BS9A 3T08A 1OB0A 1XF0A 4US5A 3W38A 3R0UA 1R47A 1G4PA 3MKKA 3WEZA 3FEQA 2NQZA 1JIBA 1R3VA 3ENLA 4QTGA 3ARZA 5EKYA 3QMTA 3GDRA 4RK8A 3DGBA 1PCWA 4GIYA 3OZYA 4P7RA 5C2GA 4V2XA 5G5IA 4A8RA 5CSUA 2PBOA 1THFD 1XM3A 3GQYA 2R1MA 1U5HA 1CWYA 4JS3A 1JF5A 2QJIA 1D3HA 2EPKX 3BAKA 1G9HA 3Q94A 4RZ6A 3LI1A 2Y4SA 3VZXA 4A3UA 1M04A 3DIPA 1E3XA 1WDPA 4JZ5A 1V02A 3RU6A 3E9AA 4OECA 3ANYA 1B30A 2WKJA 3LQGA 2VVSA 4Q4MA 4QSHA 4W4QA 1V8EA 4XUGA 5TIMA 1J0KA 3FFSA 3HMJG 2PDBA 2CFFA 3C2OA 2V68A 4D8ZA 3G0XA 4EVZA 3EPOA 3CT2A 1DJXA 4E3TA 2J9ZA 3FAXA 1H7RA 2V6AA 1ZP3A 3IS4A 4PSRA 3NQ6A 4PTNA 5AC7A 4W86A 2J74A 3TV8A 3CNYA 3SUVA 3WK3A 1WBJA 3LCLA 1QCWA 4HOZA 3EDFA 3QR0A 3IGHX 1A5MC 1UMLA 1XIHA 1C92A 1RP9A 2OQHA 4EX4A 3MU7A 2WVTA 3W2LA 2OR2A 3HPXA 1K8CA 3AU6A 1Z48A 2QKFA 2R24A 5C9XA 3LMYA 2XH2A 4HK7A 4OGZA 3UGVA 3GIQA 1WXZA 1I2PA 2DV0A 3SY1A 2OEKA 2VRJA 4X2PA 1KQYA 4UUIA 5DBTA 3ZVIA 5C0QA 2XTKA 1W3JA 3TAKA 2B4GA 5HULA 3TSMA 3LLFA 4F2BA 3TTEA 2YDSA 4DAIA 3H12A 2FDSA 4FMVA 1HKMA 4RE4A 1BWKA 3DKLA 4EPBC 2TPSA 5C2CA 3MI6A 2ZXQA 1O1ZA 7REQB 4F0LA 3O0KA 2DZSA 4KH2A 3PJTA 3S9IA 3VU2A 1MZHA 1HVXA 3WENA 3L5LA 4ADTA 3MSYA 2X2GA 3EB3A 2ZXBA 1XIIA 2JKAA 2QPSA 2REQA 1S38A 4IPPA 1SPQA 2XM1A 4EXBA 2PUZA 1KFLA 3BL3A 5K4XA 2AMGA 1US0A 2CHNA 4ZCWA 1G4SA 1UD5A 2VELA 4U33A 4OFCA 3G77A 5H6HA 3VFLA 3PBUA 4JFTA 1I0DA 4GI8A 3M47A 2CBUA 2R1NA 4H6QA 4J1OA 4MLJA 4XWUA 1TO3A 3E0WA 4ECLA 3VCCA 4MB4A 3QR1A 3UXIA 2VR4A 3MV01 5A2BA 3G1AA 3PULA 4ROPA 1UA3A 3FIGA 2GOUA 2Y8UA 5AKQA 1XIGA 1S2WA 3PBMA 3PBVA 4B2DD 3IIXA 3R8HA 2ZVRA 5LNVA 5HANA 1CGYA 3EOSA 3H23A 1HT6A 4O8RA 2FJKA 1J0JA 2PWUA 5DELA 1HL2A 2OFJA 1LLWA 3NZQA 1RUSA 4ICNA 4EPEC 1E43A 3B0UX 3VNZA 5BU9A 3Q65A 1V6UA 1IHIA 5CC5A 4C90A 4E38A 1H1YA 1MQRA 4AVFA 3AHVA 1XCXA 2WZHA 3WMLA 3ZT6A 1X6UA 4D6JA 1JNDA 3UZJA 3D5HA 1UZ4A 3GD6A 5E09A 4W9TA 4XISA 1TV3A 4URIA 3C2FA 2Z6IA 3NZ1A 3T0BA 1PKNA 3W1XA 1MW3A 3TLQA 1CXFA 1SW7A 3NVTA 5AC8A 3H2EA 1IV8A 2QYGA 4CN4A 2BHZA 3MO4A 4L1GA 3CUXA 3M5ZA 1DWIM 3R0KA 4D6DA 1QPNA 9XIAA 2V9DA 1EJSC 3RN6A 4U5KA 3ARUA 4W88A 3WO8A 4B5XA 1XIBA 4Z42C 2QVHA 4ZOCA 1VCGA 1JZ4A 2NSOA 3NQMA 2WKLA 3QHOA 4FO4A 4I9TA 3A5FA 2BV9A 3WQWA 1WX0A 2WPBA 2O92A 4JTFA 4CLMA 3GU1A 3POHA 3L68A 5A8GA 1Q6DA 1TV8A 2E5CA 1FCUA 2EO7A 2EPOA 5FL1A 4GZIA 4E4UA 3B8IA 2GOKA 4O4VA 3SFWA 1OX6A 4OE7A 3WLMA 3G18A 3CB8A 5GNZA 4PN2A 1AVAA 3M0KA 3EXTA 3FHAA 1XLLA 1VC4A 3MYPA 3VNYA 4Z17A 1RD5A 1DIKA 5LXEA 3NQDA 1SO6A 4PEKA 4R3UA 3EB2A 3FKRA 2E6YA 2OQLA 3VDHA 1FY6A 3ZXWA 1PV8A 1DTUA 4HKPA 3AMGA 4QLLA 3BSHA 3TA6A 1S2AA 2XIMA 4G9PA 4KS0A 4AZCB 3O07A 3RILA 3ZT5A 1PHQA 1YNQA 4QCEA 3ZFHA 4IP4A 4LSBA 1CXHA 2WMIA 1W9BM 3PSWA 3PTMA 3WL1A 2YDAA 4E2VA 2GK1B 4NASA 4UB9A 5FEXA 4QE5A 3W7DA 3UYIA 4M29A 2VEGA 4ZO8A 1L2QA 5CPQA 1QWKA 4F9JA 5A6BA 2PMQA 2ZZ3A 4K3ZA 1YQ2A 1RJQA 1FKXA 3FLUA 1XX1A 3V4BA 2CXEA 4MWAB 4GD0A 1K1DA 3GW0A 3N6HA 8RUCA 4F2UA 3B05A 4JTGA 3BMXA 2PTYA 1GNXA 5EMYA 4MKNA 1QMLA 1V3JA 1DEDA 4LBSA 2OT0A 5C70A 2CETA 3N9RA 4QG8A 1BFNA 3BTNA 4DYJA 5FSDC 1OF8A 4JAWA 2P50A 2X16A 3GDMA 4B9YA 1VYSX 3BJSA 3P3BA 1WDWA 4FAMA 4TR9A 5I07A 4OOZA 3OODA 3TOPA 1F76A 2ZWYA 1W9XA 2XSBA 3PP7A 3GTXA 3DHUA 2V69A 2Z7GA 3PZTA 2V0TA 4IMFA 1QNVA 2FVMA 2QUMA 4DZHA 1UC4A 3S9ZA 2XINA 2XVKA 3APTA 3FHQA 1H49A 3IJ8A 1OFRA 1X8FA 3VKKA 4IXHA 2XVGA 2HJPA 1MXDA 1EP3A 1EHAA 1RR2A 5G4EA 1QPOA 1AZ1A 3LRLA 3EBVA 4F9DA 2WHKA 3HGRA 3DBPA 2C19A 3FSTA 1XC4A 2CC0A 1WKDA 4GQQA 3CWOX 1AMYA 3PPHA 3GBEA 1ZENA 3LK6A 4S3FA 4UFKA 4Q4SA 3OPSA 4P7LA 3NL5A 2RHGA 1BKHA 1E55A 4I9MA 4LF1A 2ZE3A 1MEWA 5KZEA 4MADA 4ZSTA 2NT1A 3TKFA 5CLTA 3WF0A 1L2UA 2V30A 1DJHA 2UY3A 1SFTA 3IGUA 4KGJA 1H1NA 4JY8A 4PUNA 1E40A 3UR7A 3AFBA 3R8GA 1F73A 4IPNB 3G1HA 2PDMA 4XVEA 3MUY1 1ICPA 4WF7A 3BC9A 3G1XA 3NCOA 1LF1A 2OEMA 2XSXA 3DFQA 1C3FA 3HM7A 3T40A 1SR0A 3U3HA 3M4HA 2PTXA 2GSEA 1P1MA 3S42A 3WJZA 4DY1A 3PB0A 4LAZA 3W7HA 2Q3OA 3QKZA 3EEZA 1M9HA 2PI6A 1EC8A 1SSDA 3AJXA 3N29A 2E1WA 2VGIA 5HNRA 2QAPA 3SQLA 4AEOA 2Q09A 1EC9A 2OYMA 5CZJA 3KLKA 2YYUA 3L2LA 1A0EA 2C7FA 4K1WA 4J3WA 1V4YA 5D8WA 4Q32A 1JUKA 1PKYA 4PUWA 1DXEA 4M80A 1RV8A 2O9RA 1NH6A 4YYFA 1E1EA 3MMWA 1PYFA 2F61A 3EWDA 3LB0A 1GOMA 1SMDA 1IWAA 5ABFB 1QPKA 4OOUA 4HD5A 1A5NC 2OTDA 3Q58A 1SO5A 1HIZA 4IL2A 4B3LA 3MMTA 4EXQA 4O54A 4GVGA 4DWSD 4XSLA 1KGUA 3VNMA 3QV7A 2EAWA 2QDHA 1BVWA 3GG0A 3MTWA 4AEFA 3VGBA 4IISA 4HU4A 4X63A 3F4DA 4JGDA 1F61A 1HG3A 2J7GA 4KMQA 5K9DA 1N8IA 5HNNA 3SJNA 3LXAA 1LQ0A 3RMEA 1GOIA 3W9ZA 2JIEA 2WZEA 1IYXA 5M17A 1TJ0A 1ML1A 4IXXA 4EAMA 3UGRA 3IWPA 3QW3A 3QXBA 4JFUA 1F4AA 4FA3A 2Y7EA 4K7YA 4LYKA 3AJ7A 3KWSA 1GJPA 2WHJA 4TVUA 1C8YA 3CZLA 5IRPA 2FPVA 4N9CA 4LYPA 3VGHA 1UD3A 1KXVA 4M6UA 5K7JA 1E0UA 1OBAA 1K7XA 2FGBA 2J9YA 4GZJA 4Q7IA 3T1GA 1IIGA 3N9SA 1DJGA 3AS3A 1TTQA 3SN4A 3TCEA 2CZ5A 1CDGA 3W7PA 4I7VA 1UR2A 2D3LA 4QJ5B 4PEEA 4HNUA 3NQ7A 5HJLA 5K2ZA 1BF6A 1B3XA 5CGTA 5EBUA 1WZAA 4HPNA 2BXYA 4IF2A 4UQAA 3MVTA 2WOQA 1HTIA 3MANA 1V03A 3P6LA 5HPCA 2DT1A 4J35A 1EUNA 1FH9A 2PC8A 3KBSA 4HU3A 1EOMA 3NZGA 1K7EA 1KCZA 2E25A 1H0IA 4CNUA 5FA5A 1W9PA 4FP1A 4JTHA 1KGXA 2IKGA 2PDWA 4RNJA 3RCYA 1JZ2A 3N73A 3VMOA 4DHGA 2V3GA 1V7YA 3P5YA 1O5QA 3UETA 2FZDA 4HSOA 3AUJA 3FJ6A 3GAYA 4MSSA 5BOEA 3TU9A 4JFWA 2IW0A 4Y8FA 2CLPA 3C0LA 1A47A 1LTDA 3SURA 1TREA 3GM8A 3PPCA 4Y7EA 1BSLA 1FWFC 1PE1A 2PU0A 3SGUA 4YHEA 2V5DA 2HK0A 1WV2A 4P7NA 5GNXA 1UOKA 1W3LA 3N2XA 3K4WA 3UWQA 2OMAA 1PUDA 3W25A 3KX6A 1W1IE 1OFEA 3ID7A 4PODA 3LTPA 4O17A 2YW3A 3ARPA 4E4FA 3B9OA 3UWUA 2F2KA 2WC3A 5C55A 1W5NA 3W07A 1AW1A 3CHVA 5AB3A 1A3WA 5TAOA 3W2NA 4HCLA 4OWGA 2OX4A 2OJPA 4LNCA 5F1UA 1FFRA 3URBA 3RU8X 3HA1A 4WD0A 3VE7A 3ABOA 4JTQA 3QGKC 2QUNA 2HBVA 3QFWA 1R38A 2QGHA 4YWIA 1FWAC 1B90A 4C65A 3RITA 1GPWA 1KXQA 1JRCA 1Q6OA 3G1DA 3W88A 3WJWA 1SMAA 3E5BA 5LHEA 1JR1A 5EL1A 3CPUA 3G8EA 4MWAC 3M9YA 4JTDA 5DY2A 2XVPA 4GIRA 3FDGA 4JNMA 3RM4A 3C0SA 3GYCA 4H9UA 1WCGA 3ITVA 3MSGA 4NZ4A 5A8QA 1IGWA 1D9EA 5D2WA 2FPYA 4XV0A 4IGHA 3NYDA 3QLLA 5XINA 1HXJA 3P82A 2E7FA 3COTA 4WDUA 4LFYA 2ALDA 1DE5A 3ABXA 3RJYA 4XKYB 3VC5A 2HXTA 4J28A 1XSIA 3WDJA 3VINA 1HL8A 3AYVA 5DMYA 1QK2A 3BW2A 2F38A 2VCBA 4XG1A 1XQKA 3AAMA 4WRHA 2X0HA 1QO5A 3N6QA 3UBPC 2PDHA 1W3NA 5BRBA 1QDSA 1S46A 2FB2A 1UKPA 3M5XA 4M51A 4JKMA 1OZQA 4PB3A 3WELA 5E5CA 2ONEA 1SR9A 3KAOA 4HYRA 2VQTA 2VD9A 3LCWA 3GIPA 1I45A 2PDJA 3UZYA 1RBAA 1YXDA 4C1KA 5D38A 3KP0A 1QATA 4IJRA 5AC6A 3PBWA 4RDZA 3KS5A 4OBSA 2X1RA 2WHMA 3KHDA 3MWAA 4HA3A 3VNDA 2Q71A 5CH9A 4Q4PA 1Z69A 1VFOA 4GXWA 3SN0A 4PB4A 1DWHM 2VD8A 1BG4A 1UIPA 1W8SA 1OIFA 3CB3A 3V1HA 3HBLA 2JEQA 4QE1A 3N11A 3P61A 1HX0A 3EXSA 5D04C 1QHOA 2VX6A 4CN1A 2C71A 3PUEA 3M0IA 2R91A 1XP3A 3ZYZA 5A1AA 2NX9A 1LT8A 5CCZA 1P0EA 1E6ZA 2WW5A 5A2CA 3CH9A 5D30A 3PUOA 2OO0A 3LHVA 1LCOA 2MANA 4LUSB 3UVIA 4WY0F 1DXFA 2RGLA 1Z7AA 2NVCA 1R86A 3UXDA 5A6SA 4X61A 3GFZA 4RE3A 3TN3A 2FPTA 1R46A 1JZ8A 4JHMA 2V81A 2HDJA 4A3HA 2VJXA 1DWFM 3ZQ9A 4AISA 2CLIA 1JPHA 3ORWA 3QBUA 4Z1AA 9RUBA 3AYTA 4L7ZA 4DO4A 1GOQA 3GUWA 4G1KA 3UNDA 1B4KA 1XYFA 1P0KA 1V7AA 3Q4DA 1MW2A 4IPLA 4RV8A 3GK0A 4PH6A 3AOFA 1GHRA 2PWVA 4JTCA 4EP8C 3MT1A 4DF1A 3MCMA 1LLZA 2ACUA 3AIRA 3SFKA 3GUGA 3CWHA 2NX3A 4L80A 2C91A 3VOGA 3LN3A 4QQUA 1WUEA 2DFAA 2E9LA 4LEFA 4HZMA 1LQ2A 5I06A 4C5ZA 5CG0A 3NL2A 1VLIA 3O15A 1UP0A 4RPQA 3VD5A 2BNJA 1MDRA 4L6DA 4P61A 1J9YA 2A7PA 3BQ6A 3LCGA 3TC3A 2XPKA 2J79A 3KL5A 4P8UA 3WBXA 3R10A 1JXKA 2VEKA 1VHNA 4WSKA 1YDNA 3NQFA 3LHTA 1TV2A 1J0HA 3EKGA 4G56A 2ISFA 3WQFA 4C6FA 3TR9A 3KBVA 2PLMA 2R1KA 4GH1A 1KFEA 1W1A1 1SGJA 3S1WA 4EPDC 1Q6CA 3MW7A 5HR6A 1Z8AA 4I8DA 1XINA 1SZNA 3V16A 2Y89A 5D4YA 1PB0A 4HJWA 3WF3A 3AIVA 3VTRA 4DPQA 2RFGA 3W02A 1EJXC 3ITCA 1PTDA 3NPVA 3MS8A 2A21A 3KL0A 3L4ZA 1K9DA 2HROA 4JQ4A 3IK4A 1KV5A 5E6ZA 1YPIA 1Q6RA 1XIJA 1O94A 4RNFA 4GPNA 4KCUA 2GQ8A 2PFHA 1NFPA 4E5TA 1JI2A 1UQZA 4S23A 4GYPA 3O6AA 4DUXA 3VIGA 1Q6GA 2GGHA 1XJBA 3W74A 3WNPA 2VMFA 4UZUA 2PDNA 1VFLA 4MZ8A 4WIWA 5REQB 2C15A 4FZIA 2VFIA 5EY5A 4XAPA 3TNBA 5LIXX 2BGSA 2C1IA 1MUCA 2A2IA 1AQFA 1R3SA 4DBSA 1UZDA 4NJIA 2FTPA 1U1HA 1CXKA 4ZL1A 3EPMA 2BVWA 3I3DA 1VQTA 2RDWA 3RDKA 3W7EA 5KSWA 2ZBTA 1E71M 1H09A 4BK9A 3AHTA 1EBGA 1MVYA 3GRIA 4AUBA 2FFIA 2PWDA 4FIRA 1EIBA 2VYOA 3SIZA 5A6AA 2GDQA 1IZCA 1LYXA 1BXBA 3P14A 3KOWA 2TMDA 2NV2A 3VE9A 2JQXA 2VGFA 1L0PA 2VVNA 1Z44A 3G1SA 5REQA 2O9TA 2W9MA 2QUUA 3B97A 4UQCA 1NDZA 4AH7A 2DW7A 1YRRA 4NUWA 2A1YA 4O28A 2V67A 3APGA 3BXWA 3AHXA 5IHRA 4TQTA 1LQAA 4HNLA 1XD1A 4S3CA 4NJHA 4OT7A 1VR6A 1ZS2A 3VOJA 5EMLA 1UMYA 3TC7A 4U4MA 1WAUA 1RY8A 2CXGA 1C90A 3CHEA 4I5RA 1UUQA 1AQMA 2PRHA 2VX5A 3WQ4A 4GHRA 3TW6A 3URQA 3S2CA 1N7KA 5IHSA 3SBFA 4X3ZA 3WQGA 1FQ0A 2XH4A 1JGIA 4W8AA 3GG8A 1A0DA 4NY2A 1E9LA 1J2WA 4TX6A 3HF3A 4KPLA 1VFFA 3W7QA 3B4UA 1FKWA 5KMYA 1AJZA 3DYMA 1XFBA 3DFHA 4QLKA 3ZR4A 3OLEA 3UZWA 5FJJA 1LOLA 3LBCA 1TPDA 1NFGA 1UWRA 3OBKA 3BZJA 3TIMA 3VMNA 1JYVA 4KWWA 2Z1WA 3QOKA 2HRWA 2D73A 1KTCA 4LW7A 1F6PA 4UQDA 3LRMA 3CS2A 4DO6A 3DYPA 1CPUA 4PMXA 3M1ZA 1QBBA 1KBBA 3WH7A 4ZMGA 1K8XA 3TUUA 1FP9A 3BURA 2UZ9A 3JW7A 1XWYA 4TV5A 2YCLA 1W5MA 2CKSA 2HS6A 2Y5JA 4L4PA 5DLCA 5E0FA 3PTDA 2VNCA 3W83A 2QCFA 4JX4A 1OGSA 3TC6A 2EF9A 2YJQA 5F4SA 2VX4A 1TA3B 4KRTA 3USZA 8XIAA 4ZB2A 3SCTA 4XSMA 4GCXA 3HB9A 2YA2A 4KWSA 1AUSL 1L6GA 2PTZA 2DP3A 2HWGA 4H7ZA 3DKJA 3NEVA 1XIMA 3GY1A 3B06A 2BBFA 3TCSA 3UXAA 2VEPA 4JQ1A 4GI6A 4ML4A 1ITQA 1GJUA 2P3EA 1TA3A 4PGLA 3SR7A 5IBXA 1T5AA 1TV5A 2R94A 1P1XA 3R0DA 1XQLA 3PZQA 1SYTA 1EJUC 3HGOA 4JYEA 3P8JA 3NL6A 3WQEA 2DIKA 1KM5A 4JTJA 4PC8A 3TE9A 1AG1O 4GUFA 1KWKA 3W7LA 2E77A 2YX0A 2XZ7A 2ISWA 4QCFA 4D6FA 2Z00A 2HPMA 2Q3RA 3N25A 5CSRA 5FAGA 3KRUA 1ECEA 3U2CA 5HAOA 3STPA 3UG3A 3V7PA 2VC7A 3TWBA 1F4HA 4CUCA 1AL7A 1DQXA 4IM4A 4N7QA 3G0UA 2E6FA 3UJSA 1EFZA 1O5RA 3SCQA 5AOUA 1MDLA 3NAVA 2OT1A 4K39A 4K36A 2E28A 4JKLA 1A50A 1L8NA 3QTPA 1PYMA 3ITTA 1EJ7L 4K7VA 4HMEA 4ACZB 2CW6A 2D69A 2OWWA 1U5JA 4EOUA 1MQQA 3PZIA 5I23A 1KRCC 2YW4A 2DZPA 1UPMB 2BY2A 5HMSA 4AMAA 2XVLA 4V15A 4KF1A 4AF0A 4AWEA 1NIUA 3VDGA 2WSPA 3T8LA 1PWLA 4XO6A 1MUWA 4W93A 2ZX8A 3ATYA 5JVLA 2QMJA 5DANA 3EOOA 2JKPA 3G24A 2QIWA 4RV3A 3N34A 1KO0A 2BP1A 3I68A 3D0CA 1LWIA 4U3AA 5FF4A 1KFBA 4K6AA 1P4CA 3NTYA 3BV4A 2FFCA 4FR1A 3TJXA 5CEWA 3HV8A 2H3BA 2V5LA 6A3HA 3WG6A 1KW1A 1VEMA 3AHYA 1BXNA 4KWUA 1PZ0A 3LCFA 1W9VA 4NZ5A 4HN8A 3A22A 3E38A 3NUKA 5TF0A 4Q6XA 3HPAA 2YIHA 4MIMA 4XIMA 1EWEA 4R7OA 3KVMA 1CX9A 3UZZA 2Q8XA 3GVVA 2JKEA 3VKDA 1BAGA 2AQOA 2EXOA 3VKBA 3TX9A 4EXAA 4PTWA 4S3JA 8A3HA 5I3HA 3WJSA 3TFXA 2AKMA 4Z1YA 4WX2A 3OBAA 5IDZA 3NXFA 4FS9A 4XUYA 5T26A 4UNKA 3C6CA 4B5NA 3QEZA 4UOZA 3CUHA 1E9ZB 3M16A 4KT2A 2W5FA 5G1TA 1XHGA 3ATZA 2V3EA 1TPC1 3KE0A 3HFTA 1MZRA 1QASA 1SZEA 3C3NA 2H8XA 4DNMA 4WGHA 5T8GA 2H6RA 2X41A 1NELA 4HHHA 2XJ7A 3KRSA 3M41A 1DBTA 1RCXB 1HJSA 2YFOA 1UH3A 3CL8A 2E5DA 4M1RA 3B8SA 3E1F1 3TFCA 1T0OA 1ONRA 1XYCA 3PTKA 4DX3A 3ICJA 2DSVA 4AD1A 1U1JA 1ZBVA 4GKTA 2CBJA 1D3GA 3WFAA 2WO5A 1UG6A 4ZE5A 1GOWA 7ODCA 3VIKA 1TV7A 2ZRUA 1JZ6A 3B0VC 3I3BA 2O0TA 2B0MA 1FDJA 4QDWA 5F1VA 2E6DA 4EWND 1HGWA 2OZ0A 5I3FA 2P10A 1DWJM 5AY7A 2D1ZA 3AO0A 5CLWA 5IFTA 2HVOA 3S6DA 2WM0A 1MEIA 3NQGA 4EAYA 4L4MA 1D3CA 4MZYA 3WQOA 2WAGA 3C4UA 4JEQA 2Z1BA 1H60A 2V3FA 2GQAA 4PUMA 4HTYA 3EOEA 1M41A 3ZLGA 5MKGA 1VLWA 2GZXA 3HTWA 5JBFA 3T0TA 2YXOA 5H91A 3I4EA 2GGGA 1FWBC 4M6QA 1B4EA 5E0KA 2PWFA 4WR3A 1UPPA 1XW8A 5A6TC 1IR1A 3GKAA 4MY9A 1DHKA 3S5SA 4C7DA 4WQ6A 1O4UA 4QISA 3GR4A 1XFCA 2H9AA 4GMEA 4QS6A 5LA1A 1NTHA 4JTEA 5JBDA 2B7QA 4IHCA 4C60A 5DMNA 4AZ7A 3AHZA 3A4WA 1EIXA 1TPWA 3RPMA 1R7AA 1SSGA 1IF2A 3OZMA 2JBMA 4P8XA 3KZPA 4BCEA 3B40A 1TB3A 5EU9A 1OF6A 3HURA 3H7VA 1DJYA 1XGZA 3OW1A 3QVQA 4UNLA 1XRVA 4PBGA 1X6LA 3T44A 3W00A 4H3DA 4J40A 4BEUA 4PMYA 2ZIDA 3VIOA 3SI9A 1SVDA 1T99A 4BWLA 2XSAA 2DZVA 1X38A 3HQOA 3QPZA 3O1NA 4QRNA 3QYSA 4ZTYA 3SN1A 4LOCA 1GKQA 2ODOA 4BI5A 4L65A 5M3WA 1PJ9A 3GXNA 2HVNA 1GVOA 2EGZA 2D24A 3BGJA 3HJZA 1GG1A 5FI8A 3TONA 4W7UA 1XIFA 1KA9F 4B91A 2W79A 4GY0A 1XG4A 3PZNA 2VDHA 2ZZ2A 2AGTA 1O12A 2WMJA 2FKPA 3YPIA 2F6KA 4LUSA 1K9FA 1Z6KA 1TJ2A 3AC0A 3RHGA 1P7TB 1SFLA 2RJHA 2ALRA 3FYOA 3SEPA 2RJGA 3W72A 3BLLA 4CGTA 3MZ2A 4HPGA 1EO5A 1FXPA 2WLZA 1JL8A 5A8PA 4WKHA 4PZVA 5A6LA 1H7XA 4NAEA 1DE6A 1Q65A 1PX4A 2J77A 4HHMA 1KRBC 2WNNA 3F5JA 1YXYA 1IGSA 1ZL1A 2AKZA 3QSTA 1C8QA 5CC3A 4HK6A 2A5HA 3IIOA 4YPJA 4PBFA 4XD3A 3RR4A 3D47A 2CWNA 4GQ0A 4CQ8A 2PF8A 5C7VA 4U5IA 4JIPA 1OX5A 1XYLA 4EKJA 4IJCA 4WOQA 3IUDA 4AD2A 2Y6ZA 3WH6A 1BYDA 3H4WA 1TWSA 3TNOA 3OHIA 1FWJC 5ENLA 3CT7A 4BFAA 4LNYA 5FJIA 2XM2A 1G1YA 4HZ6A 3QQ1A 4HMNA 4N02A 1OIMA 4GUJA 4Q4OA 1GVRA 1EH9A 3A9BA 2F7FA 1VJSA 1F05A 4MYXA 1DYSA 3W3OA 4AD0A 1JFHA 3FVMA 4UNIA 4YIWA 1I1WA 1M7XA 4CD8A 4GQBA 3NIYA 3VK5A 4EACA 3QV8A 1E3ZA 4H6KA 1Y5VA 4CQCA 5TBOA 1JULA 2OSWA 5DEZA 4TX8A 3ZSSA 4O1AA 3JR2A 3DH7A 4W5UA 2BGQA 4CD4A 2YBVA 1Q45A 3TW7A 5ABTA 4NX0A 2BY3A 3DXIA 1XYMA 1KKRA 3LCHA 3WSUA 2YXGA 3CPRA 1U1UA 1KQZA 3VDAA 3TJIA 3CAVA 2ZXDA 3A21A 2CESA 3DAQA 4IMAA 5EFDA 4DWSA 3URAA 2QCNA 3TQVA 3E0VA 2AGKA 3TVAA 3K30A 2G4JA 1UWQA 1WBHA 4R34A 3W7OA 2B7OA 2HS8A 1QI2A 2DQXA 4WDXA 4E8GA 3WLNA 5DMMA 3PFRA 4Y9NA 2IPJA 4FNRA 4PTVA 3S5NA 1TPVA 4JTKA 3H6OA 3WDQA 2IQ0A 1KLYA 3QM3A 3RO6A 5ABEA 3TYBA 5CPNA 4K68A 3U4AA 4AD5A 1AA1B 1TRIA 3EEGA 3GDKA 1EJWC 1OC5A 5HWNA 2Z6JA 2BZNA 5CGMA 3GWQA 3OVRA 1JDAA 2XGIA 3LD5A 3WF4A 3W24A 4XX6A 4PMZA 4DNHA 2FMOA 2VDGA 5CXPA 3LPOA 3LU2A 4D6GA 5I03A 4KETA 2VDIA 3QFEA 1JYNA 3U8GA 3W4RA 4DI9A 2UY2A 5BMWA 3TDFA 4UOJA 2PE4A 3W01A 2VZSA 1ECQA 2A4AA 2DQWA 1HW6A 1WDQA 1XICA 2FMNA 3E3HA 3WLTA 5I7GA 2HE8A 2DSUA 3U0HA 3IARA 2FH6A 5FCZA 1R9ZA 1A5OC 3VO0A 3T9PA 2XN0A 4LCQA 2DEPA 1FWTA 1KM4A 1TPFA 2Z2UA 2BOFX 4H9VA 4K8EA 1R2RA 1VZWA 5A6JA 4NHVA 2QPXA 3CO4A 1V3HA 1G4EA 2CKRA 3KVLA 4PRTA 3QY8A 1E73M 3VABA 4F66A 2VFDA 2MNRA 3AI0A 3C61A 1K3UA 2IKJA 3I65A 1K03A 2G0WA 3KLLA 2C3ZA 1IT8A 4PCSA 3W84A 4BF7A 3PVFA 3N2OA 1M68A 2NXIA 1X1OA 1W56A 3LPFA 2QDEA 1PDYA 5EMUA 1ZSXA 3PFMA 1IE7C 4C7FA 3NNTA 3SCPA 5CJNA 1LP6A 1KBJA 1NP0A 7PTDA 1RVKA 4J3VA 3OYZA 4BKNA 2PP1A 4UR8A 3RPDA 3S1VA 3SCVA 4RE0A 3V35A 1TG7A 1V0LA 3L4YA 5JBEA 4O14A 4XZNX 2V2HA 3P8IA 1V6WA 2DUAA 3H2FA 1HKIA 2WZIA 2WJEA 1G6CA 3M5VA 4LB3A 2F6XA 4MKSA 4QBXA 3QC0A 1GKPA 1ODZA 1RALA 1JPMA 3AZSA 4DM2A 4QEHA 1UKQA 1W6TA 1BF2A 4LXFA 3EWWA 3QY6A 3OOQA 4ICMA 4R33A 1IEVA 6ENLA 1HN1A 1NWUA 2GDVA 4ZBCA 4CD5A 1E9YB 3CL6A 1Q7ZA 3ARXA 1A5AA 3UA3A 3V0UA 4JX6A 3N14A 4K8HA 1WNOA 3T2PA 3EWYA 4HPJA 4FB7A 3LLDA 2QVNA 1ZU8A 1TSIA 1RZMA 4P7OA 1M7OA 1A0CA 2Z29A 3GTNA 2NLYA 3AMCA 4H4IA 2GK1A 4E8DA 2XGBA 2V3DA 4QQ3A 3CGTA 3B8UA 4CU7A 1B3OA 5DCEA 3A4AA 4O15A 1CIUA 4OBTA 4ENLA 2Y85A 2HPIA 2QCDB 3FJ4A 4BEQA 6XIMA 4PMQA 3DI1A 4AWSA 3LXBA 3EWCA 1KRMA 4ZXLA 3CEPA 5CSYA 2Y8KA 1PL9A 3W7JA 2YZRA 3CLMA 2P53A 3DFPA 4FXJA 2VRQA 4WJXA 2PEVA 4O10A 4NYYA 3DUGA 3JS3A 3ARYA 5A6BD 4HPHA 3EDJA 3VC6A 4ATDA 1NOUA 2POZA 3HG3A 1TJPA 1XDLA 1TWWA 1YYAA 4I9AA 2ZUSA 2BWGA 3ZVHA 2GWNA 1V6YA 1EJVC 3U5UA 5G2IA 3JZEA 3F1QA 3AZTA 3PWAA 1XGDA 4AWUA 4H04A 3MA8A 1UQYA 3CQJA 4JTTA 2PS2A 3FJNA 4B4HA 3PSVA 5D2XA 1WA3A 4CEUC 4QJ3B 5TQLA 2I9EA 5CSSA 3T4CA 1XBVA 2I5QA 2VO5A 4AIBA 1AZ2A 4N9DA 3NPXA 4QITA 4IWWA 3BCFA 1QNQA 2E3ZA 4XQ6A 4UTIA 4AIUA 1VFMA 1FHVA 1JQVA 1I2RA 4XK2A 1J5TA 2GSHA 1C9DA 1TYGA 3NFUA 5BOOA 1DXIA 3LXCA 4TOQA 4LUJA 3WD2A 3PTQA 2IMRA 1PSCA 5M5DA 2ZOXA 3G1FA 3OU8A 1BYBA 3M6DA 2AL2B 3MP5A 5U4NA 3VX1A 3EA2A 4HHLA 1UD4A 2PGRA 1EPVA 2ZX5A 2E0PA 3KEHA 2G97A 3ARWA 3UYCA 4C7GA 3FN9A 4PRRA 1WZMA 3SCOA 5C71A 3DFYA 5HUPA 5HNUA 2VM8A 1ZCCA 1CB7B 3P0XA 4J5NA 3GH7A 3GXDA 3FDKA 1V6TA 1TJ1A 3IAQA 1LL4A 1WDRA 1JCNA 2VWTA 1TTIA 1DTNA 1W54A 2QJNA 3E2SA 1H7NA 3SECA 4LS0A 2PP0A 2XU2A 1F6YA 1AMKA 4JQAA 3ZVHB 1F6KA 4S3BA 1DJWA 3NO3A 3P80A 3W1NA 4BA0A 3LV6A 3JRKA 4XBKA 1T7LA 5AECA 4QEEA 2NW0A 4X9SA 4ZR8A 2TRSA 1ADOA 4L6OA 3V1PA 4LB4A 1PZ1A 1TWIA 1NF7A 3NM3A 4D8LA 5D03A 1Y65A 3F5KA 5B7YA 4JICA 1KM0A 2YGYA 5JIPA 4FEZA 3HGSA 4UCGA 1BEUA 1OG0A 3B8WA 2ATMA 2EPMX 4DBDA 3U2OA 4Z1CA 3M0JA 3GG7A 3TR2A 4S3KA 3O06A 3SO7A 3SUWA 4CEXC 3REQB 2DT2A 2UV8G 1EL3A 3RLHA 4A21A 2D2OA 4NZ1A 3ZOAA 4DJDC 4O1FA 1XBZA 2YB4A 1LG2A 1RJPA 3PR2A 1BSIA 3VNIA 3IRSA 2QUVA 3O3RA 5DMLA 4DJFC 3CUGA 4GY7A 4ADSA 3WDRA 8CGTA 1RD6A 1V0MA 3PK7A 3TN4A 4GNVA 2J7CA 2ON3A 4IUOA 3LNMA 4RDWA 1I60A 4OV9A 3D46A 5CPOA 5HINA 3H2CA 3V0TA 3AUOA 1X8CA 1DIOA 1NQKA 4LCRA 4QAWA 4RXGA 5BRQA 3DZ1A 3B8TA 4YVPA 3QV6A 4Y8EA 4OUIA 3BOXA 3UW6A 1C93A 3N2TA 3CUZA 3DOPA 3S0CA 2NUYA 3STGA 2G4FA 1TUXA 3M0ZA 2GVGA 2NWSA 3S1XA 3H7UA 4LT9A 3UG5A 3BUVA 3ARRA 3NQ8A 3E6EA 1FWIC 1W5OA 5CBJA 4PMVA 1G5AA 1Y0EA 1ZY9A 4W89A 4XZLX 3SSJA 1XH2A 3DCPA 4V28A 3E12A 4B90A 5HQLA 1K6AA 3VYLA 2QJJA 4C1LA 3WEMA 3CASA 1OJXA 1MI3A 1VD6A 3K46A 1VCVA 3CMFA 3A24A 2QQ6A 3N17A 1VAHA 2YLAA 4TTGA 2W3ZA 4W85A 3Q37A 3MUCA 2JE8A 4U10A 1F5ZA 3EA3A 4ZSUA 1PO9A 1J18A 3ZO9A 2DIEA 3AXXA 2BY0A 3CUIA 4KQNA 2XFWA 4FALA 1R8LA 1IXQA 5IFPA 2IS7A 3ES8A 2ZRWA 2ABAA 5I3DA 2ZRYA 2PU1A 1RP8A 3SGZA 4CNOA 4NKCA 3VM7A 3WNNA 3RYSA 1S39A 1BGAA 4HVXA 4YCOA 1L9WA 1Q5MA 2MUCA 3LS9A 2AL2A 1R6WA 1BD0A 1EO7A 2WNWA 5I2UA 2VC6A 2XN1A 1PTGA 4ICCX 1XL9A 3W27A 4Z2KA 2WLYA 3LPPA 1GVIA 1V93A 3L67A 1FWHC 1FOBA 3OZOA 1CTNA 4Z1BA 3MSRA 1K7FA 5D9PA 4A8LA 4DJDA 1TRDA 1AJ2A 3M0MA 2ISVA 1QI0A 4BJHA 3U7BA 4WCJA 4C6DA 2CLEA 2YA1A 3A3XA 4YYCA 2EJ1A 1GK8A 3HGJA 2XISA 2G41A 3IVSA 3TLLA 3TQ0A 2WVSA 3WNKA 3PBYA 1W1YA 5E9XA 4IFKB 3H26A 1P0BA 3S2MA 1EKOA 2SFPA 4M7SA 3VCNA 3MYOA 4TUFA 2PAJA 4B9ZA 3IJ7A 4L6HA 3ES7A 1MSSA 3CYVA 3OA5A 2VUYA 4JTRA 3GXFA 1XLCA 4Z0SA 1OCJA 1OX4B 1N8FA 3K8KA 3PPGA 3AQUA 2RUSA 4C1NB 3FK4A 3GNXA 1CXIA 4YNGA 2W0UA 2XIBA 2J88A 3E2QA 3DFSA 3RF9A 3CWNA 2NSXA 3ZWSA 1HNYA 4KBXA 4PCTA 2Y5SA 3W37A 4CVUA 3LSCA 3T8QA 3ZS4A 4DELA 3L2IA 3QJAA 2A7NA 4Y96A 4FOJA 4UMBA 3E49A 1YNYA 4IX2A 4Z08A 3CIXA 3WD4A 2B7PA 3LEPA 4FNSA 4ROQA 1WDSA 5G4HC 1VPYA 3LCXA 1W3TA 2GJRA 4JIEA 1TQJA 2IPWA 4EK7A 2YSWA 2GUUA 2FHFA 3U6WA 1DL3A 2JGQA 5G2WA 2WJDA 1DQWA 2YL8A 3APYA 3DFOA 3UPWA 3WL0A 3K4AA 3SIMA 1PX3A 3L66A 1KGWA 1XXXA 3NQVA 3WDIA 2GPTA 3R2GA 4MJ4A 4DZ5A 4DZIA 2W61A 1I4NA 5GQBA 4ZENA 1XR2A 4EE9A 1E5JA 2B81A 4J3ZA 1RK6A 3BGAA 3OGSA 3OLIA 5I6SA 1XYAA 3I3EA 2PODA 9XIMA 4GNJA 1MNZA 4LRSA 4DWSB 4QLJA 2CLKA 2YLLA 4QFUA 3TA9A 1ISYA 1QNOA 2H8ZA 4TMBA 3GIYA 6CGTA 1C91A 3MV11 5CPTA 2Y24A 4NIRA 4DO7A 2C1HA 2HSAA 2VR5A 1MFVA 3FXYA 2P5NA 2VFHA 2DZAA 3O6CA 2I17A 3M6YA 3I7SA 5D9MA 3VILA 1LBMA 3GXIA 2ZWZA 2IPGA 3UCQA 2GJXA 3TYEA 2OZ8A 5HATA 3F4CA 4YTQA 2HK1A 3TW9A 4HA4A 4V1XA 1K6WA 5BXSA 4UTWC 3N4AA 3ONCA 4R88A 4GABA 1UBSA 1WOAA 1FTXA 1UROA 4CNTA 2DU2A 2XZ9A 3L4VA 3TZNA 1UASA 3O7UA 4XZHA 4JTUA 4CU6A 5XIMA 2X1SA 3RX4A 3H4GA 1SQ7A 2X0SA 4IJBA 1SZRA 3B8DA 5FKYA 1ME7A 6XIAA 3VA8A 3CU2A 3W2JA 3ARVA 2P1FA 3EDDA 1EYEA 3U4FA 3NO1A 3ME3A 3WUEA 3L5AA 1G0CA 2PDFA 5F4XA 4IIGA 4DQWA 3M0YA 1WPCA 1O7AA 3C0JA 1Y5XA 2PDXA 1M53A 4IGSA 3ZZ1A 3CUJA 5KITA 1V0NA 3L0NA 1Q6EA 3DFNA 1PHWA 1Q6LA 1QOQA 3AMKA 3KOXA 1IXPA 1TUFA 1OT1A 2IKIA 3WUBA 3S6OA 3BQ5A 1AW2A 3W2UA 4A8NA 2J7EA 4MB1A 1FCVA 1UP3A 3S4TA 2VR2A 4DO5A 3BOFA 3RAOA 3MP4A 1XYZA 1CGXA 3MHFA 4M82A 1W1PA 1JI1A 1W37A 3VOCA 3U48A 5HBFA 3IVUA 3UPMA 4N6FA 1J0IA 3GC4A 1E72M 5BWFA 2VXNA 1WYIA 1JD9A 1TIWA 3CZGA 3ISIX 1F7BA 2CBVA 2EG8A 1HO1A 5BRPA 4UTJA 2VC5A 1VJZA 3NXLA 2C0AA 2WC4A 4ZA0A 2O56A 4X2RA 2P0OA 3SAZA 2BFGA 4LU0A 1H7WA 1W3KA 1B9BA 3KTSA 3KBWA 1JD7A 1W5PA 4C6KA 1E51A 3WD1A 1BTCA 5AHNA 4ZQOA 4UIOA 2ACSA 4WEVX 3MPGA 4LBUA 1ZB5A 4IQLA 1O68A 2FLIA 4YTSA 1H50A 1XLDA 4J9JA 5C9WA 1CLVA 2X8RA 4KW2A 3RX2A 1JQXA 1XLEA 3AALA 4ORMA 3B9DA 2VOTA 3W6LA 1XCWA 4AY8A 1NM9A 3W1LA 2OGYA 3ALFA 3PM6A 2WK2A 3UERA 1SW3A 4JFSA 1PKMA 3N04A 3BICA 1J0YA 2BHYA 1S2CA 2QCLA 4AZCA 4NQ1A 3VDCA 1EDGA 3SUTA 5H8UA 3VNKA 2NZLA 3U2EA 3RPTA 5AHIA 4HNCA 5LIKX 1T96A 3LYEA 4EWJA 4IH3A 3QTGA 1H5YA 3WK1A 1RA5A 3LHYA 3CZKA 4Z2IA 4YTUA 5FF3A 1FVPA 3FCPA 4REQA 1KD0A 2GVJA 2IKHA 4ZO6A 2ZC1A 3UQNA 2NXGA 1US2A 1W9DM 4GUIA 4GC4A 3STFA 1XSJA 1GJWA 3M07A 2ZDRA 3BLFA 1P7TA 2ZZ4A 4YHGA 1V3MA 4KFPA 3OEXA 3WLJA 5LA0A 3A13A 4K1GA 4C6JA 4IT1A 4M24A 1GCYA 3CEUA 2OEJA 2Y1HA 4XKMA 1I6NA 1OFQA 1FBAA 3KVKA 3THUA 3QQ0A 1QVBA 4J3XA 1KV8A 4OUEA 1ZUAX 1E4IA 2ZICA 4MF4A 1CCWB 4PMJA 1XUUA 3HFYA 2CLLA 2J78A 1CXLA 2NVAA 4HOXA 4RW3A 4Q7BA 3VFCA 5HOSA 2A79A 1D7FA 2E1DA 4DI8A 1HL9A 3PAJA 4JQ2A 4GISA 3NJ3A 4QIUA 3LSBA 3VM5A 1K4GA 3IJLA 2PWGA 3GB6A 3MUXA 1QNPA 3PG8A 5EA9A 5I5RA 2J8TA 1EGMA 1NJJA 2EHHA 1ZJBA 4GACA 4LBRA 3HJEA 3NQ2A 3DHPA 1T8QA 2JF6A 3RRXA 1S3HA 3PAOA 2IUZA 2NXHA 5L9FA 2OELA 3WLSA 3FNDA 1L6WA 3F7JA 5CGQA 1O95A 2JK2A 2Z2BA 2WMHA 4O1DA 2YOCA 1GVEA 1U5VA 2X1TA 3C8FA 1ZAIA 2DDXA 4NF7A 3KWXA 1GQKA 3BW3A 2DSWA 4DUOA 1MQPA 2P88A 1FH8A 4YVXA 4W5ZA 2NVDA 4MPQA 1QHZA 2QS8A 4BZYA 5D05A 4OU1A 4NAFA 4PMDA 2XYLA 3URNA 1ELSA 3N19B 4UWMA 1W31A 4C6NA 1HO4A 1ZP4A 3QMRA 3GNOA 5A8OA 5M1TA 2YL9A 1K9EA 3TXVA 4OBRA 1SUXA 1RQEA 3W71A 1ZJIA 2O7SA 1KBLA 3G1RA 4ERGA 3R8RA 2BXZA 4AVOA 3TSDA 3MZNA 3EX2A 1W3HA 1TE6A 1A5LC 3BLPX 1WKYA 2J6VA 1NEYA 4LCSA 4US6A 1QRQA 4I3GA 1I2QA 1RBOB 1JRBA 2Z1XA 1VRDA 2Z1VA 2L5HA 4GJIA 4IUGA 2ZX6A 4FLQA 3L0KA 3WEOA 3GLCA 3KM8A 1PVNA 1F3WA 1OABA 4KRZA 1XPGA 1ONEA 2QV4A 2EEXA 5FJRA 1XPYA 1XIDA 4GFSA 1GVQA 3LTSA 2TYSA 4HSNA 2D23A 1YTKA 3RX3A 3ZJ8A 5A94A 3VOFA 2ZA1A 4MDOA 4XAYA 3SUUA 4Z2JA 4AC7C 1XBYA 2Z1KA 2YZ5A 2J9XA 2R1PA 2HCVA 3CV7A 3LM3A 3BCDA 1EDQA 1YDVA 3EGJA 2UBPC 5AYXA 3FA5A 4FPSA 3S5OA 3H53A 5FOOA 2UY5A 2BXVA 1U83A 3UY8A 3GDLA 1CLKA 3TWAA 3IUIA 4REQB 3UZXA 4F8XA 4GBDA 3T0DA 4H9ZA 3GTFA 4J3SA 4F0HA 1QTWA 1UA7A 3W1PA 4AWTA 3H54A 3PZOA 3VD3A 5CBBA 4HMCA 1U2YA 2F6UA 2O55A 3E0FA 1WKEA 4Z0JA 3R4IA 1TCMA 1EP1A 5I09A 1A5CA 3RCNA 1CECA 2X42A 1ICQA 5F2LA 3WDPP 1GZGA 3PJUA 4FNTA 3B04A 4NL1A 2G3FA 1Q4NX 2E8ZA 2WPGA 5LNSA 3UXKA 5GNYA 5FIPA 2CPUA 2H90A 2ABBA 2FZMA 3T81A 4LV9A 1LWHA 4JDYA 5D2VA 7A3HA 1LZOA 5HQEA 1CENA 3RR1A 3ARQA 5I3GA 3GZ3A 4IX0A 4JIHA 4JTAA 3M43A 4S2CA 3W1AA 1EQCA 1C7TA 3LPGA 4DBUA 3GU2A 1LLOA 4N0RA 4Q8QA 2VURA 4UCFA 3WLPA 2YCKX 4JYDA 1Z42A 2PGWA 1CGTA 2XFRA 4AZBA 1R9YA 1LT7A 4ES4A 3P67A 4Y9AA 4OVXA 4H7CA 4PMUA 1RA0A 3WUFA 5H2ZA 1Q2RA 1L6YA 4H8HA 1OC7A 1KBIA 3OP2A 5F2GA 4IFOA 4JHOA 4S3DA 1FWRA 3A64A 3NG3A 1S2UA 3GC2A 3LHWA 3GNRA 1VBJA 3J7HA 3ARSA 3EB4A 4I6KA 1IR2A 4KIRA 1OGBA 4S3AA 6ALDA 4ERAA 5HWJA 5T9CE 5HPOA 3DN5A 4NP7A 3HU7A 4FOUA 3KCOA 1TTJA 4D6EA 3DG3A 4JN6A 4Y9PA 4S1FA 4LVAA 1LORA 1ODUA 5CJMA 1DPMA 4PB5A 1PIFA 1OG6A 3UWWA 5FESA 3VX0A 5EPDA 4NJKA 3C8NA 3IIZA 1J5SA 4GX8A 1YNPA 3U57A 4ZO7A 1I2OA 5AYZA 4B3ZA 5KZDA 3T4WA 1YMYA 5J5DA 5I3IA 5D37A 2BASA 1OK6A 4DLFA 1S2TA 4FI4A 1ZLPA 5EMJA 4O16A 3H2OA 3LMZA 4AMCA 4H8UA 1EPXA 4H2HA 2VKZG 1JPDX 5DRCA 2DSZA 4ZOEA 4PCFA 2OSXA 1A3XA 5JIWA 5DY3A 3EX6A 5HUOA 3CZJA 5DFAA 1JNEA 2IXUA 1KM6A 1ZHAA 3TROA 5K4ZA 3FJLA 3KXQA 4LF2A 2WMIB 3OB8A 1JDEA 4JFVA 3W7IA 4UFHA 3WUGA 2FZBA 1BG9A 1Z89A 2VP8A 3MCNA 2EPHA 4UTKA 1TQXA 2FHCA 1VEOA 3K8LA 1P6CA 4GNKB 4QNWA 2ZUTA 3HV9A 2X09A 5J8LA 3Q67A 4XKYA 1GQNA 4GG9A 1Q85A 3V75A 1VH7A 4XO7A 4DAFA 3L4WA 4KESA 1ZJAA 4UTLA 4UTUA 3VNLA 3W6MA 9CGTA 5IDIA 4DWDA 2I5IA 3GW3A 5KINA 4F79A 4Q3MA 2BLEA 1Q6FA 1B3YA 1LUCB 3N4FA 3WQPA 4B3KA 3DFTA 2ISSA 4G2DA 4AZGA 4R85A 4Q8VA 4QS5A 2F2HA 2FVKA 2I9UA 3D3AA 1QW8A 3L2MA 4A3QA 2OOFA 2OOGA 5LNUA 1X97A 1J12A 1W91A 4JIIX 5AC5A 2J75A 3LV5A 2E8YA 1RCQA 1EEXA 1XLJA 3UFYA 3KDNA 3W6YA 3QN3A 1LDCA 2G50A 3W75A 1V02E 3H24A 5CQ1A 2QR6A 3N1AA 2CBIA 5DCDA 3NSNA 5LIYX 1A5UA 3OO2A 1G69A 3QZAA 4L61A 4U2YA 4LVFA 3EMCA 4P2VA 1VEPA 1OM0A 2G96A 2OWXA 1VYRA 3VZYA 1NWSA 2BVYA 4JHZA 1JCXA 3VGFA 3WLRA 2QT3A 1M1BA 4L56A 3UWVA 2WZTA 2BB0A 5J5RA 4UR7A 1B1YA 3EMQA 4TVCA 3NVDA 5G2HA 5G4WA 1UH2A 3W86A 4X0VA 3IJ9A 1TV4A 3WK0A 2CLMA 1E1FA 1SO3A 3VGGA 4F2TA 1UC5A 1JCYA 1CGVA 4R27A 3ZJ6A 3I7RA 4UTFA 2WSRA 1F3XA 3KRZA 2FYMA 5JXQA 3N3MA 3UWYA 1XSKA 4RKAA 4O12A 5CC6A 3THCA 5ABGA 2Z1SA 4JDBA 1WZKA 4IG2B 3E2VA 4LV4A 2BODX 4HBKA 3SCSA 4HT3A 1PDZA 5C8BB 1HZY