2WVSA

Crystal structure of an alpha-l-fucosidase gh29 trapped covalent intermediate from bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an e288q mutant
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYQRRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 158
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvsA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvsA01
4NRRA 1LWHA 3OLDA 2VUYA 3A3HA 4CU7A 2ZXAA 4U3CA 3N04A 3AISA 4AEFA 3WH7A 2XFFA 1HXJA 1QI2A 2G3MA 3ZJKA 3BUDA 2WC4A 3PZNA 4EKJA 1SZNA 1LJYA 2ZE0A 4CKQA 3VVGA 4S3JA 5C70A 4OBRA 4CVUA 2XJ7A 3MSDA 2HISA 2WMJA 4WSJA 3MUAA 4K68A 3BH4A 1MWOA 1YHTA 4PSPA 3CUFA 3VNYA 1C7SA 5E6YA 3QHNA 1ISWA 1ITXA 1GVYA 1LG1A 1V3LA 2X2HA 3W25A 4CUCA 4DUVA 5GQBA 1JNEA 2J78A 4FNSA 3IANA 4GZEA 4A3HA 1GONA 4DO4A 4MNMA 1V3IA 4MJ2A 3TA9A 4TTGA 4AZHA 1N82A 2BY1A 1J0JA 2BHYA 1NQ6A 3SCNA 1AQMA 3WNMA 4NF7A 2GDVA 2WCSA 1J10A 1VJZA 3W38A 2J8FA 5CPTA 1P6WA 1H41A 3A21A 4D6IA 1HJVA 4M81A 3CTTA 4PMXA 1E72M 2ZWYA 3D4YA 4UQ9A 2IUZA 4AD5A 2XVGA 2ZXBA 3WFZA 5LA1A 1R34A 1LQ0A 2F1BA 1UR4A 3T08A 4AMXA 1QW8A 2G3JA 1UR8A 1XD1A 4AZ5A 1C3FA 1XGZA 3T2PA 3VIPA 4A4AA 7TAAA 1J0HA 1XH0A 3ARVA 2CKRA 1MW1A 3EDDA 4P7NA 2DDXA 3VGGA 4Z2JA 1UR9A 1UD3A 1S46A 4JL2A 5D9MA 5A6BD 2CETA 2BHZA 3W81A 2OLHA 3ARRA 3AZRA 1XSKA 1E9LA 1TR1A 3GBDA 1DWHM 3W0KA 4AWEA 2Y4SA 3S5ZA 3RO8A 1BG4A 1UWQA 3DDFA 1GUVA 5D9OA 5CQ1A 2J7CA 3L4TA 2WZHA 2GDUA 1B31A 5FOOA 3WH5A 3SUUA 4CN4A 1FFQA 1PEZA 1E55A 1EIBA 5M17A 2BVDA 3FN9A 1OWQA 3AZSA 3F5KA 2C0HA 3WDQA 5BWFA 1JAEA 1J01A 5CLWA 1UHVA 2CKSA 1PIGA 3MV11 1JD9A 2ZUTA 2DEPA 2FE0A 1WP6A 3GTNA 4P8XA 2JEPA 1TQWA 4PTXA 3VIKA 5A1AA 2DGAA 2FHFA 3BMVA 1FFRA 3MUIA 4PCTA 2FHBA 5FL0A 2QV4A 1E6QM 2XN2A 3WN6A 1W9XA 1WE5A 3VX0A 3AOFA 1CYGA 5E70A 2YL5A 1NH6A 4W84A 3U5YA 4C7DA 2EQDA 4JHZA 2XPKA 2CIPA 2WWCA 3N9KA 4WKAA 3AFBA 1GOWA 2E3ZA 1R86A 1K9DA 4J7RA 3BSGA 2J47A 1SR0A 5A6SA 1GQIA 1MQRA 4KH2A 1OIMA 1JZ2A 2DT0A 3AIRA 1W9PA 1HKMA 3ARQA 3VUPA 1ESWA 1X1NA 3IK2A 1R8LA 2QHAA 4PUEA 2PWFA 2ESCA 1MW2A 2Z1SA 4W8AA 1EOMA 2YA0A 2WHLA 3OA5A 2PWDA 1V6VA 1E6XM 3WY1A 3PBGA 4DWSB 5I78A 3WDPP 8CGTA 1JZ4A 3D52A 1NM9A 1E6SM 2OYKA 4BF7A 1NOFA 4JHOA 1J0YA 1CLVA 1CIUA 4BZYA 3L4XA 2TAAA 5GPRA 2DH3A 3B9AA 3EJRA 2VX7A 3OLIA 4OUEA 3SEPA 3AMLA 1ZB5A 1GOMA 2XIIA 4WIWA 4OOZA 1HKJA 4UQDA 3VMOA 1GJUA 2QLYA 1JZ5A 3H53A 2DH2A 4MB1A 3QOKA 5FD0A 1Y7VA 4J3UA 3L4ZA 1E4LA 3LRLA 1AQHA 1VENA 1E73M 4FK9A 1VB9A 5E9AA 3VIHA 4MB3A 4HZ7A 2WMIB 1EH9A 2VMFA 1J11A 1TCMA 4YHGA 1GQJA 3DYOA 1F4HA 3SIMA 1BYAA 1EGZA 4QP0A 3AIWA 3FHAA 4GO8A 1KQZA 3VOCA 3ZSTA 1TA3B 4MTVA 4MNJA 1B0IA 4AZBA 4CD5A 4F9JA 3VM7A 4PYSA 2VO5A 3WH9A 3KWXA 1E4IA 2CITA 2DPEA 3B8SA 5A94A 4J3VA 4OZOA 3AMGA 2ZUVA 2WPGA 3MO4A 2C7FA 1QHPA 3BAJA 4JFWA 5HXMA 2IXUA 3GXNA 3OGVA 4AMCA 1IT0A 5KZ6A 3ALFA 2ZUWA 2UY2A 3N11A 1BG9A 4J3SA 3BUIA 3CC1A 3A47A 3TP4A 4UZUA 4BS0A 3LPFA 2WW5A 4XX6A 3A6OA 3ZR5A 3ZT7A 4MDOA 1UWTA 2GUYA 5M3WA 2RGMA 1TQUA 2WVSA 2BY2A 2CHNA 4HZ8A 1JZ3A 4NXSA 4B3KA 4Q22A 3CZSA 2W61A 2WCGA 2Z1KA 1RP8A 1HTYA 1VRXA 4C7GA 1MVYA 1KTBA 4RL3A 4BCEA 3SCTA 2XVLA 4E2OA 4AW7A 3GM8A 1CGVA 1Q6GA 3ARUA 3GNOA 3POCA 4WKHA 5CPSA 1UA3A 3WD2A 5D4YA 3D5HA 4LPCA 3WD3A 2ZICA 1LL4A 5ECUA 5BXSA 3CO4A 4MPKA 1CDGA 1Q6CA 1PZ2A 2D23A 2Y2WA 3CIVA 2BNJA 1JF5A 5JBFA 1GNXA 2DIJA 1JXKA 1K6AA 2CESA 4TVCA 3N15A 1X6NA 1KGWA 1CGUA 3MANA 4TOQA 1E6PA 3VIOA 3I3DA 3GXFA 2J74A 2V5DA 3FAWA 3LPPA 4N42A 3L2LA 3WDIA 1HKKA 2IXVA 3FW6A 4AYGA 3E1F1 1VEOA 4GQRA 4J28A 3NSXA 3CUIA 2WKLA 4WSKA 1B3XA 3BMWA 1ISVA 2JF6A 2YA1A 3GZAA 1GZJA 2CEQA 4D1JA 5BRQA 3NYDA 1ZBKA 2F18A 2J79A 5A2AA 4PN2A 4UQCA 2ZUUA 3BVWA 1M7XA 4AIOA 1VIWA 1M04A 1KCKA 3TTQA 3B9EA 4R5EA 4AZ6A 1ZS2A 4M24A 1LG2A 3WSUA 4V2XA 3GH5A 2E9BA 3ZQ9A 3OG2A 3L4UA 3WENA 3WD4A 5A8NA 5E1QA 2EPOA 4H41A 3LX9A 1AMYA 2NT0A 1C92A 2JEQA 2PF0A 3PTKA 3WFLA 1GORA 2WK2A 3CHCA 1E6NA 2HVMA 4MB5A 3ZJ7A 4ZENA 1UH4A 2ZUSA 2VCBA 3PZOA 1JYXA 1UH2A 2YFNA 1V0MA 2EPKX 3VIGA 4PMUA 3WUGA 4E8DA 2OSXA 2NSXA 3AI0A 4ZXLA 5A6LA 1O6IA 5IFPA 3CBWA 4PMVA 3CHEA 4CCEA 4HA3A 2ZX6A 2X2JA 4M80A 1DWAM 3T2QA 4BQ5A 3GXMA 2QF8A 1W3JA 2VOTA 2VZVA 3VD4A 2V3EA 1WAWA 3AROA 1HT6A 3VPLA 3VO0A 2O92A 3L4VA 2BY0A 1PBGA 4PEEA 1HVXA 1EDTA 3WF4A 1DTUA 1GOKA 4QDMA 2XVPA 1QNOA 3WDJA 3WEOA 3BUQA 4HMCA 3BCFA 3M07A 5A8QA 3BGAA 4XUYA 4XV0A 2F61A 1QI4A 2BXYA 4RE2A 3U7VA 3QR3A 2DSVA 1R87A 2CNCA 2WVTA 2QPSA 1XC6A 1CGYA 2ZOXA 4TVDA 5AYBA 1XCXA 4OKDA 1V6UA 1FP8A 3WKZA 1DWJM 4AZ7A 3LXCA 3HMCA 7CGTA 1CENA 2WMHA 2YLAA 5EFDA 1BVZA 5M03A 1JNDA 2J7DA 4PTVA 5AY7A 2D3LA 1BSIA 3VNZA 2J7GA 2CCRA 2E4TA 4JZ5A 3VSVA 1FHDA 2XGIA 1DWIM 3T2OA 4OGZA 4H8UA 1VFFA 4TTUA 1HX0A 3VGEA 2J8GA 2WVVA 3EBVA 3WF1A 2UY4A 1EO7A 3AMDA 2PBOA 4U5IA 1ZBCA 2OWXA 1ITCA 1OGBA 1TVNA 3OLGA 3FAXA 4H7VA 4HPHA 4DO6A 2WLZA 1R75A 1W1VA 2G3IA 2FDMA 3BCDA 1BYDA 4AISA 1HL9A 2CHOA 3JUGA 2EACA 1T0OA 1UA7A 2JFEX 1WCGA 3RPMA 3AZTA 1BF2A 3N13A 3VDCA 1ZJAA 4W7WA 1HJUA 1E1EA 2W63A 4EE9A 2VZOA 1FOBA 2A3AA 1E5NA 1J0IA 1B3WA 3AIQA 3O9NA 3VINA 3G6MA 4LX4A 5A6MA 4JCLA 1R47A 4AYSA 1Q6EA 3ZT6A 3AS2A 5E0CA 1J9YA 1UKTA 2J75A 3U57A 2CXGA 1VBUA 3VSTA 1UZ4A 2BVTA 4HMEA 4GI8A 4AC1X 3WMCA 2EJ1A 4B15A 2XSBA 4F66A 5BXRA 1MW3A 5I6SA 5DO8A 2WZEA 4FNTA 1JAKA 1JYWA 3CUHA 4ATDA 2X05A 2W67A 3AHTA 1JG9A 4HTYA 3K1DA 2DSZA 1HJWA 4TX6A 3MI6A 1PZ3A 2QMKA 1PS3A 1R33A 1WDRA 3PZVA 4R27A 3ZM8A 5CZKA 1VEMA 1QI0A 4W85A 4MNKA 2CBVA 1BLIA 1FH8A 6TAAA 4JKMA 4D6CA 5JIPA 3DX1A 4MNLA 4LYRA 1A47A 4UOZA 4XZWA 3VIMA 2WHMA 4CD8A 1R7AA 5I24A 2F1AA 3PZTA 2JIWA 3WF0A 1MXDA 3PN8A 1JZ8A 3HN3A 2J62A 3ARXA 3AJ7A 1WZKA 3KEHA 3MV01 3QGVA 2D0HA 4FLRA 3VD3A 1CTNA 2YFOA 2D2OA 4CU8A 3W26A 3VILA 1EDQA 2YBTA 2A3CA 3A4WA 3GXIA 3NJ3A 2YA2A 1JDCA 2WC7A 4WLCA 1TFVA 5A2CA 4MADA 3AMKA 2WB5A 4MAVA 4JFUA 2EPLX 2VL4A 1TVPA 2DSKA 5BRPA 2J25A 4AIEA 1O7AA 1NWSA 1MQQA 1H2JA 4YN5A 4P8UA 2F7PA 4KWUA 2YOCA 5JBEA 5IHRA 3DX4A 3BC9A 2CERA 4NX0A 1MXGA 2ZWZA 4X0NA 2VI0A 5JUVA 1JDDA 3KLLA 2YIHA 1ECEA 4URIA 2GSJA 3VMNA 7A3HA 4H04A 1FH9A 4PCSA 1HNYA 1E40A 4D1IA 1J0KA 4AZIA 4PTWA 3RILA 3POHA 4H8VA 3W28A 3LXBA 1O7DC 5HDRA 1SMDA 2VVSA 2XUCA 4ATLA 2ZX8A 3EJQA 4GQQA 3BLKA 1HP5A 1QNRA 3WQWA 3THDA 1LL6A 4PMRA 1I1XA 4RE3A 2ZXQA 4YHEA 3WY3A 4QLKA 4ZE5A 4CGTA 3MUZ1 1W1TA 4LGXA 3F4VA 3GBEA 2F8QA 2CBJA 5I23A 4FLQA 2FHCA 3PZ9A 3VIFA 5LA0A 1OT2A 1E5JA 2XIBA 3FNDA 3EMZA 2WM0A 4ZFMA 1UD4A 2D0GA 2VRKA 2WMFA 1PJ9A 2OYMA 1SYTA 2GK1A 3MS8A 4L4PA 2E9LA 2WANA 4PMQA 4JAWA 2V5CA 1NWUA 1TE1A 1VEPA 1WZLA 2C8NA 2J7BA 3AHVA 4ZE4A 4D6DA 2X2YA 5ABFA 3MMUA 1G1YA 1V02A 4AD0A 3A24A 3U5UA 4ACZA 5BROA 1QI5A 4W88A 1G0CA 3WQ6A 2YJQA 1ODUA 2G41A 3VX1A 4AY1A 3SCVA 2WLYA 4DO5A 1E0XA 4M1RA 2WSKA 4TX8A 1BGGA 2V3GA 1CGTA 3ZSSA 2YDSA 2FH6A 5HNNA 5KEZA 1HJQA 4QCFA 4HA4A 1M03A 4AEEA 1V3MA 3MKKA 4F9DA 5ABGA 3UCQA 2WVVB 3W53A 2ALWA 4Z2LA 5DF0A 1QX1A 1G01A 4TXEA 4AMWA 5GNZA 4GO9A 4UOJA 3KL3A 3WUFA 1FA2A 5HPOA 2D3NA 3OB8A 3UG4A 1H09A 2UY5A 3HJEA 2DT1A 4D6EA 4DM2A 3OZPA 1QNQA 3WMSA 1DWFM 1K9FA 3PTMA 1MFVA 3PZGA 3A5VA 5D8ZA 2VZTA 3RJYA 4H8HA 4JL1A 5CSYA 5BXPA 2F2HA 1WPCA 2X1IA 4IISA 4P8VA 3MSGA 3GNPA 1CXLA 2ZUNA 3F5JA 5I3DA 2W4XA 1XRVA 1HXKA 3GDBA 2PC8A 4U3AA 4UFLA 1VFOA 2AMGA 1JXJA 5DT5A 3K8MA 3EJTA 1C8YA 2X09A 3THCA 3W24A 1GHRA 1C7TA 4LYPA 2VX6A 1DEDA 4U5KA 2X0HA 5A69A 3AXHA 1CEOA 1HN1A 5IDIA 1OD0A 5A8MA 4KRUA 3GH7A 2GJXA 4UNIA 2D22A 5JBDA 3ALGA 6CGTA 3CZLA 3NSMA 4HU8A 4QFUA 3ZT5A 4P8WA 3CUGA 2DIEA 3OGSA 5TD4A 4UFKA 3RDKA 2J77A 2XM1A 1M53A 4PMOA 3LPOA 2OW7A 2BXZA 3BUBA 1KXTA 3AHXA 3PZUA 4D6GA 3W29A 4FLOA 4WK9A 3HG4A 4NI3A 3TTSA 4UQBA 1E6ZA 1UZ1A 3EMCA 1EA9C 5EMYA 5A6JA 3WH8A 3CH9A 4MJ4A 5IHSA 1UWIA 4IUGA 2OYLA 5C8BB 3N18A 3PTQA 1B3VA 1VAHA 1E6RA 1Z32X 1BQCA 3AS0A 1CWYA 1K9TA 1YQ2A 1EO5A 1UKSA 3SUVA 1W1PA 1V03A 4W8BA 4GINA 4UFIA 2Y8KA 9CGTA 3EYPA 3WNOA 1QW9A 1H49A 3RCNA 1GCYA 4DM1A 3TV8A 1ZBWA 2WBGA 1CXIA 4LQ1A 2AAAA 1OGGA 3BAKA 4AZGA 3BAIA 1UH3A 5A8OA 3WDHA 5BYWA 3BLBA 1W9UA 1BHGA 4J27A 1V6YA 1ZU8A 1EOKA 2GVYA 3CV5A 3LXAA 2O9PA 3VDHA 2O9OA 4FLSA 1LWJA 1R46A 4J3XA 3WL0A 4P7RA 4FF5A 1JZ7A 2WAGA 3DDGA 1CPUA 1G94A 1J12A 5A8PA 1X6LA 3DYMA 3GXPA 3CUJA 1LL7A 3NSNA 4HA1A 5AC5A 3WUBA 4X0VA 3HG2A 3DYPA 1UD2A 4CCCA 1QPKA 1XSIA 2W62A 1E71M 1V02E 1Q4NX 1E0VA 5LYRA 1E4MM 4U31A 1ISXA 2VX5A 4W7VA 4WJXA 1UD5A 1FHLA 3ARPA 3IJ7A 2YDQA 1W3HA 4DWSD 5A2BA 4B9ZA 4D6JA 5ABHA 2Y24A 1L0PA 3GH4A 4OIFA 4HOZA 2FYVA 1H3GA 1UG6A 3WD1A 5I79A 4V28A 3O6AA 3WEZA 3VDBA 1IV8A 3VU2A 1MQPA 4HZ6A 4Z2IA 2VVNA 1EHAA 2X0YA 1AQ0A 1E70M 4PMDA 3PHAA 4ACYA 2BHUA 5E09A 1KWGA 4Z2GA 1H11A 3WL1A 4OBSA 2F7RA 2FGZA 1HJXA 1UR1A 2WKGA 3ZOAA 1CXHA 4B16A 1OCQA 2WZIA 3AIEA 4QCEA 3WBAA 4PSRA 3WNKA 3W4RA 3W27A 4UR9A 1K9EA 1UKOA 5I5RA 4FNRA 4DWSC 3ZR6A 4U2YA 3SCPA 2PBGA 2XVNA 3GXDA 2XN1A 1ZBVA 6A3HA 3AS1A 2YL6A 2GK1B 3QHOA 4X9YA 2J7EA 4P7OA 2XYLA 2GFTA 1NP2A 5AYIA 1XD0A 2YL9A 1WO2A 4MB4A 4WF7A 2NW0A 3PZQA 4GXPA 1QWNA 3HG5A 2CBUA 3AHZA 3VIJA 5ABFB 1NWRA 3VGDA 1KR1A 1E15A 1H0IA 1KGUA 3L4WA 3AMCA 1UUQA 3BXWA 4ACZB 3WQ8A 1WKYA 5ABEA 4ZXOA 2XWEA 1CLXA 2VURA 1ZL1A 3MMWA 2YDRA 2RGLA 4JKKA 1XHGA 3BAXA 3WNLA 1FP9A 1HVQA 2GJPA 3KZSA 3O2LA 3CZGA 4AZCA 4D71A 2J7FA 2VCAA 1XH2A 2VTFA 5M5DA 3FXYA 4JCMA 4IM4A 1CNVA 2EADA 1CBGA 3L4YA 4FNPA 3N17A 1GJWA 1GOIA 1W1YA 1OT1A 1BFNA 4OOUA 1GHSA 3S6TA 5A6KA 2WYSA 1B1YA 3OIHA 1TQSA 2YKKA 1Q6FA 3QOMA 4HPGA 3OLEA 4KGLA 1MFUA 4GIAA 4ATWA 4W5UA 4F8XA 1C91A 4CD7A 4W8LA 1KWKA 1QOXA 3ZMRA 2CBIA 2XM2A 3EMQA 3WQ5A 4JKLA 3UG5A 1UQZA 1OIFA 1FH7A 3DHPA 1US2A 4AD4A 1B3YA 2CPUA 1PPIA 2VJXA 2XVKA 5I2UA 1UR2A 3SCQA 2J7HA 3KL0A 1M01A 2D20A 4W87A 3CZEA 3CPUA 1BAGA 1GOQA 4JFVA 3EDKA 1E3ZA 1UASA 1ODZA 1HL8A 1XYFA 2O9TA 2XFRA 3IAQA 3DX0A 4D72A 4E8CA 1D2KA 3BUPA 2V3FA 3K46A 3WBEA 3S5YA 3VD9A 2D24A 3AICA 3WF3A 1Q6DA 3EDFA 3SCUA 2O9RA 4AD1A 4A3YA 3VGBA 4V27A 4Z2KA 3A4XA 3KL5A 2VRJA 1UOKA 1RH9A 4YPJA 2GJXB 2ZUMA 3TOPA 3K4DA 1QHZA 3NUKA 4PMNA 3HG3A 3LPGA 4U33A 4JFTA 1B30A 1H1NA 1QHOA 4QAWA 1E56A 3WDRA 2FH8A 4JFSA 2OWWA 4D6HA 3M7SA 1HIZA 4J3WA 3AYRA 3FY1A 3UG3A 1XH1A 5E6ZA 1J0ZA 1BYBA 1V3JA 5C71A 1I75A 4BA0A 1KXVA 3ARSA 3H55A 2VT0A 1NOUA 1F4AA 2WSPA 4PRWA 1E3XA 1KBKA 5CGMA 3D3AA 3WUEA 1TQTA 3VGFA 2JF7A 1A3HA 4AXNA 1QI3A 1QNSA 4W5ZA 4P7QA 3RM4A 5CGTA 2BV9A 1B3ZA 3N12A 3OBAA 5A6BA 3VTRA 3HU7A 2F7QA 4GPNA 3SCRA 5D9NA 3VM5A 3WIJA 2DT3A 4TVUA 1V0LA 2J4GA 1DWGM 3BLPX 4B9YA 3OZOA 3T0DA 3A22A 1QBBA 4KGJA 5HOSA 2BFGA 4CCDA 4CD6A 2WCAA 4CD4A 2D1ZA 4HU0A 1R85A 1J18A 4NZFA 3ZJ8A 4C7FA 3BVUA 1W2PA 3K8LA 3BAWA 3I3BA 4S3KA 1CZ1A 1E4NA 4EAMA 4GI9A 3NIYA 1JF6A 3VSUA 5DEZA 4M82A 4TUFA 1G5AA 2VQUA 2ZXDA 2VZUA 3M6DA 5CXPA 1JI1A 1V6XA 1I1WA 3WF2A 2G4FA 2XHYA 1OM0A 4ZEPA 4KMQA 1G9HA 2WC3A 2YBUA 1VBRA 2B31A 1OGSA 1QWUA 4GZJA 5D8WA 1JZ6A 1SMAA 2ZIDA 3IJ8A 1KBBA 1ZJBA 3ARYA 3DC0A 2VNCA 1JD7A 1TZ7A 1WB0A 4D6FA 3NDYA 1EQPA 2WNWA 1OINA 4W93A 2FGLA 2V3DA 2EPNA 3QHMA 1W91A 1WDSA 1L8NA 1BVNP 1OSEA 1KXQA 3CZ8A 4XZBA 2WMKA 1UD8A 1R7OA 4AD3A 2EAEA 2PI6A 1XV8A 4NSBA 5CG0A 1WNOA 2EABA 2PWGA 3LRKA 1UYQA 1CXEA 2WWDA 3VGHA 3NCOA 2UWFA 1H5VA 2XTKA 1TUXA 2IGTA 4E4PA 3H54A 4HOWA 3T0BA 2A3BA 2PWHA 1KCLA 3RM8A 3NDZA 4HP5A 3APGA 3VD5A 4DUWA 2EXOA 5CJ5A 4CVWA 2F7OA 1KR0A 4Z2HA 1EDGA 1PAMA 3WELA 2DSUA 3WNNA 1W9DM 2OWCA 2XG9A 3IGUA 1C90A 1GQKA 4BQ4A 1V3KA 5HBFA 3W6MA 2AOSA 1UD6A 5EB8A 2E9MA 4IPLA 3AHYA 2WMGA 1V0KA 2WBKA 3G6LA 2BY3A 2DQXA 3KLKA 1JIBA 3D51A 3TTOA 4EK7A 2VC9A 4LXFA 2VR4A 2W91A 5EFFA 1D7FA 1UR0A 1LLOA 3MUY1 1ISYA 1EQCA 3IJ9A 4EANA 3AXXA 4FNUA 4AZCB 4GZIA 2W66A 2GJRA 5DT7A 4NRSA 1XCWA 2G3NA 4FNQA 1UWUA 2Q8XA 3BAYA 3W37A 2XFYA 1JI2A 2W92A 2DSWA 2ZX5A 2A3EA 1QVBA 4Y7EA 4M8UA 5I77A 4UZSA 3AQUA 1PX8A 1VF8A 1KFWA 5CPQA 2XSAA 4GKLA 3BVXA 3CLWA 1UKPA 1JFHA 4M56A 2CYGA 5AC4A 1GVIA 4N0RA 5D9PA 2QMJA 1V0NA 3A4AA 3DX3A 3WQVA 3RM9A 8A3HA 1UWSA 1W32A 4CN1A 1RD6A 1HKIA 4IPNB 4HMDA 4PTMA 1JYNA 3CHDA 3DX2A 3BVTA 1MYRA 4UFHA 2G8ZA 2XGBA 5GNYA 1B90A 4ML4A 2D73A 3AIUA 5DFAA 2JIEA 4U2ZA 4RE4A 3SUTA 2X8RA 4UCFA 4QLLA 3IAPA 1W9BM 1JL8A 3VKKA 3FHQA 1VFMA 2W5FA 2OSYA 1OD8A 1WZMA 4UQEA 2BVYA 3UR7A 5BXTA 3CZNA 3WMBA 1LF1A 1BYCA 3I3EA 3ECQA 3B9DA 3OGRA 3WQ4A 3BVVA 4BQ2A 3UEQA 4W86A 3U7BA 2XN0A 2JALA 4WKFA 2VRQA 3VMPA 2UY3A 1WDPA 1CXFA 2BS9A 2YLLA 1UQYA 2PB1A 1XYZA 2V38A 2E40A 2MANA 1KQYA 3RJXA 1VJSA 2EBNA 1IZJA 4XB3A 1GPFA 4HOXA 1NOWA 1TG7A 4Q7NA 1EXPA 3VD7A 5CSUA 2D0FA 1HWWA 2PWEA 3L2MA 3GYCA 2EPMX 4J3TA 2WHJA 4AD2A 1QNPA 3A23A 4NZJA 4CU6A 1WDQA 1UKQA 1H4PA 3UR8A 3T09A 5FL1A 1C8XA 1PX3A 3CHFA 3BSHA 3CZKA 2EEXA 4UOQA 5DMYA 3ARWA 3WEMA 1U33A 3DHUA 5A3HA 2WVUA 3WY4A 2E8ZA 3EJPA 3GNRA 4DUXA 4LYQA 4L4OA 3LRMA 1V6WA 1TQVA 3KE0A 4FMVA 2E8YA 1C93A 1NP0A 1CGXA 1B2YA 2VR5A 5A6AA 1JDAA 1KGXA 1KXHA 4PMZA 3ARZA 1KTCA 1E43A 3ZIZA 3II1A 1E0WA 4UFMA 2ZX9A 3MMDA 2YL8A 1CXKA 1ISZA 1SFSA 2X2IA 2QPUA 1PIFA 3S2CA 5E0FA 3RMEA 3VDAA 1PX4A 3AXIA 3CGTA 1W2VA 3CZJA 4NXKA 5FKYA 1EHNA 3MU7A 4B3LA 2VQTA 3SUWA 2WHKA 4CN6A 3UETA 1JYVA 4UQAA 3T0AA 1DHKA 5GNXA 5A95A 4DWSA 3CMJA 5LA2A 3EDJA 1H0GA 2VZSA 5I0DA 1GQLA 3J7HA 3K4AA 1HJSA 3SCWA 4OJYA 4PMYA 3WY2A 1D3CA 2NT1A 1RPKA 3WD0A 4JIEA 3M46A 1DP0A 3SURA 1W3LA 3UESA 5FCZA 1KB3A 1VFUA 2ZX7A 3W6LA 5JIWA 4PBGA 4UTFA 3TTYA 5EBAA 2WXDM 2JE8A 3SUSA 5IXEA 1UWRA 4W7UA 5HPCA 1C8QA 1TMQA 3D4ZA 4MDPA 3RIKA 4P7LA 3EJSA 3W82A 3EDEA 3WNPA 1GOOA 5BCAA 3D50A 1E1FA 4M29A 1U2YA 1BPLB 2EO7A 3GXTA 1NWTA 1OBAA 4W89A 2WMIA 4PUDA 1CGWA 3PZMA 3EJUA 3ZO9A 3PZIA 2Y5EA 3AIBA 1V08A 1W3KA 1JFXA 4MAZA 1V3HA 3WH6A 4NZCA 4H2CA 1BGAA 2XWDA 2VX4A 2OSWA 4KRTA 1MW0A 3VIIA 2VCCA 1TA3A 3SCOA 3AS3A 3AIVA 3K8KA 3DECA 5F7UA 3ZJ6A 4QLJA 1BTCA 1QBAA 1CECA 1RP9A 1HP4A 1B9ZA 2OW6A 3F5LA 2A3HA 1NARA 5FIPA 3SCSA 4BQ3A 1WZAA 5CLTA 4UFJA 1XSJA 1IZKA 3ARTA 3N1AA 2DT2A 4F79A 2E0PA 1OB0A 3CMGA 1GW1A 1W9VA 3TONA 5IFTA 1AVAA 1US3A 4AIUA 3UERA 1U30A 3AYSA 2Y8VA 1JGIA 4GI6A 3HZ3A 3LMYA 1HF6A
chains in the Genus database with same CATH superfamily
2OCZA 2E1DA 4JO4L 4AEFA 4KESA 3UYIA 1IGJA 2FEDC 4W4OA 2ZSWB 4PRNA 2ZE0A 3RDJA 3MNWA 4S3JA 2NX9A 5DURD 5IEKB 2HISA 4YNGA 4ZX4A 3BH4A 3V1PA 1CU4L 5D04C 2X4OB 1EUAA 5FYKD 1RA0A 3ZIMA 1YO4A 1FI8C 3ONBA 4CUCA 2J78A 2IG2H 3NJHA 1Q6QA 5EGRA 4OFVA 2QVNA 3G0UA 2GDVA 4UT9H 1S9WA 3VVWA 4HCGA 3UGVA 5BUPA 4XNBA 4FJ6A 4GRSA 3FQ4A 3SN6N 2ZWYA 4UQ9A 1HCFX 3RWGA 1G6RL 4WEEA 4AZ5A 1C3FA 3QUMH 2H47C 3T2PA 3VIPA 1S7XB 4JTIA 2AQRA 4EVNB 4P3DA 5KVFE 1ZZMA 3C0QA 4GGHA 3MOBL 1OC6A 1KPRB 3NCEB 5T1DH 4A8NA 4P4KB 1UXSB 3KTCA 3VNLA 4GGBA 3SI9A 4FABH 1UM6L 4ZTPL 2JQAA 2IALA 2WYIA 1SFHA 5JVLA 1YRKA 3CLMA 1DVFC 5DUPL 5FB8A 2J57A 1JD9A 4QRTB 3DDMA 5D7LB 4D0DB 5E4OA 4WU5A 1KTLB 3TF7C 1CYWA 4PCTA 4DYJA 2CR0A 2DWEB 3VH8B 3ZVIA 2FWSA 1ED3A 4UAHA 4F7MB 2R0ZL 5J04A 2XIOA 4F1SA 1JZ2A 3S8HA 3ETBJ 3T3ME 4M8RA 1FRBA 4X50A 1ESWA 4XCYA 1S3HA 5LG1A 3K6DA 1DIKA 5HGBA 1JZ4A 5D2XA 4Q8BA 4JRXE 2Z1VA 4XBPB 1MWAH 3OZ9H 1CIUA 4FTVA 4PW9A 4AX6A 2E86A 3DVGB 4YC2C 4WIWA 3QQ4B 3DFOA 2C3GA 3FYYA 3NRPA 4YVXA 5EFIB 3S83A 2QYGA 3B8UA 2XKSA 1AZNA 3CPGA 3AFLA 4HZ7A 3JTSA 1TSRA 2DLHA 1CDUA 3QLLA 1BYAA 3TJXA 4TVPE 3DV6A 3WFDL 4ES8A 4XXDB 3VOCA 3PUOA 4LNCA 4MNJA 3FJTA 1Y0LB 2BIIA 3GHSA 4O0QA 4Y9OA 2DPEA 2KX9A 2OXGA 2Y07L 3CK0L 4UMCA 3GNNA 4WRLA 4DGWC 1XLKA 3IFNH 5IMMB 4WO4B 3NO5A 3P0YL 1CDHA 3ALPA 1FNFA 5I09A 1U0QA 4GE8A 4MHHG 5C97A 4XX6A 1AG6A 1IEAA 1US0A 1UWTA 1TTQA 1L6GA 5SWSA 3ZLFA 3CAWA 1CN4A 2DQEH 2WVSA 1R3IH 1JN6A 4Q4QA 3SDYL 1VCAA 3LGEA 2D7OA 4XBSA 5IWLA 3N4AA 1PEWA 2WCGA 1XS2A 3SJVE 3FOKA 5J5DA 3VSQA 1GY2A 3KBHE 1W72L 4N20A 1AO7A 1FJ1A 4H8QA 5F1NA 2JKJA 5ALBL 3ZW3A 4UT7L 3U9UB 2PDNA 4P5TA 1XF4A 1A4JA 3DOPA 3QEQD 1H8NA 3VOHA 1UXMA 4ECLA 1KENH 4Z95L 3X3FH 3E2VA 2IGLA 2BNQD 3P73B 1UTDA 4UNKA 3LZRA 4OM0H 2KZKA 4QRPA 2VDPH 3JV6B 3HPZA 1GYVA 2BBFA 2PTVA 4CDGC 4PVMA 5A2AA 4PN2A 4UQCA 2PDYA 2P76A 2WNQA 2BWIA 1SXSA 2R69H 2GAZB 2XA8H 3ABRA 4R5EA 3EWUA 4Q4OA 1T1XA 1KCXA 4XPBH 4XAWL 5DVMA 4MVAA 1OVZA 1NMBH 1E6NA 4N3TA 4ZAKC 4ZENA 1EZVY 1RK7A 5DZNA 4XO6A 3W2MA 4FXTA 2ZVIA 2ZZ7A 4PRHD 5REQA 4E8DA 4KUCD 4DJDD 5E2VL 4CCEA 4HA3A 3GR4A 4GW1A 5EZPA 3AY4C 5IJBC 2VB5A 4C6QA 4XNDA 2QF8A 5DI8A 3B2VH 3R0NA 3L4VA 2RFXB 4NO2B 3WIIH 4QDMA 5D96B 5I1KH 3ARDA 1T7YA 3M07A 1FPTH 4EXQA 4WGKA 3KYAA 2C1IA 1D6VH 1S7WA 1J79A 5ESQA 2WVTA 4JPVL 2AQWA 4XPGL 4IJ3B 4OKDA 2UWEF 2ZUXA 3GJFH 3DGDA 2IAAC 3LMZA 1HHGA 3L6FB 4FFVC 5I6PA 3WLBB 5AY7A 1JP5A 2D3LA 2F15A 1CD1B 3UROR 3GTHA 4RFEB 3T2OA 1HX0A 3HRPA 4P8QA 4YSOA 4P5SA 2JJVA 1G84A 3B06A 1EFZA 5FJJA 2OWXA 3NACL 4KTEH 2W27A 3HI5H 1W1VA 4IP5A 1GPOL 4MMZA 3INUL 3QDAA 3O6KL 3X1BA 4J9JA 4WI0B 1WFUA 5DRXB 5GS0D 3L7EA 4AITA 1NLBL 4Z7UB 3LERA 4KXBA 5C09D 4DKDC 3DIFA 1CFTB 1GXEA 4UTCA 1TVHB 4AM0Q 5F1VA 4Y1AD 3S7GA 3VNDA 2OJ1A 5HJ3A 3Q3GA 4PJBF 3SQMA 3FRUB 2DORA 3WMCA 4ETQB 1XIMA 5H94A 3HEIB 4YWGL 3E3QE 1QRNE 5D4JA 4IPJA 4U3HA 1OOAA 5JORA 2DQ6A 2R2HA 4WEVX 2QUUA 5DJYA 1USQA 3HTLX 1EC7A 3II3A 4G8FB 4HN4A 1DUYA 4KEUA 1B0GA 3BDXA 4AGOA 4KUZH 4TNWF 1RERA 5EKYA 1N0LB 4GH1A 1BLIA 1E0UA 4J3OH 1OPOA 1QFEA 1QACA 2GDQA 2R0WH 3T8QA 4LYRA 5FAGA 4WV1C 3G2GA 3QUZC 3WF0A 2NY3D 3UWQA 5FJTA 4HT1L 1DBKL 2A3TA 3SCMC 3D0LB 1RBLA 2EYSB 3AALA 3MUCA 2P53A 2P50A 2DSKA 5C08D 3N50A 5GIRB 2DKSA 1HXMA 3UTSA 1F3EA 1CZ8L 1MXGA 3GSNL 1TV5A 4AUJA 3FBKA 2YIHA 3LG3A 4U1KA 3EOBA 5EIVA 3K5SA 4HEPA 5IB2A 1QPPA 3UY8A 3L3DB 4JW3A 4HSCX 5FEZA 3EW3B 1ECZA 4Z1DA 3O0FA 1I7ZA 3SDAA 3POHA 4H8VA 2VLME 1X1OA 1U93A 5IBTL 5K3VA 1N3NB 4JPGA 1F42A 4GG6B 5IF0B 2DW6A 4AKPA 3BZ5A 3VB8A 1I4FA 1EXHA 2DJUA 1A4MA 3AZUA 1A22B 2AK1H 3FO9B 5I3KA 3MRDA 2GK1A 2J24A 1JGDA 1TIUA 3NQDA 2UWEA 1DQXA 3CDGB 2WN2A 1HGWA 3HJZA 4DP7X 1RL1A 2OZ0A 5ABFA 2PCPB 2X2YA 2OT0A 3NEHA 3UMTA 3MMEB 2H1LM 3N06B 2EH7H 3TV3L 1RIVL 4W88A 3PREA 1IT9H 5FUZL 5DCDA 3MKGA 1TU2A 1U3ZA 2BP0B 3B7YA 4BFFA 4E3VA 4KWSA 1HJQA 5DZ9A 1JHTB 1G01A 1HH9A 2IPTL 3RWCA 1RK6A 4LHUA 3QIUB 9XIAA 4KKLC 2CLOA 4H26B 3C0SA 3OMZA 4JIHA 3PZGA 4G1MA 3BI9X 2QIWA 5B22A 5MF5A 2AXJA 4XHJD 4V15A 4D7PA 4J3ZA 4C56A 1XVSA 3LY6A 4LCSA 4KIRA 1ZJHA 4YDLC 1YY9D 3DO7B 4XNMB 5BRZE 4PJBA 4Y5XC 1FL6A 4C5ZA 1G7LB 4JDZB 4ZXBD 3LV3A 3C5JB 4M62H 4UV7L 4JREB 3HG1E 5IOPA 3RG6A 3W24A 2MPAH 1GHRA 4OD3L 3SKOB 2GJ6B 4DGYH 5JW4N 3CHXA 1NAML 1P7QA 3RUBL 1OD0A 1MCHA 3K1KC 3U3HA 2CFFA 3HQ1A 4HUXA 3E6HB 2HG0A 1PWLA 2XM1A 3EGXB 3SE3C 4M93C 3EAUA 2VLRB 3EO1B 1JCYA 1NVMA 4WSGA 5CP3A 4HYVA 3OU8A 3F1QA 3VXSB 3AU0A 3QXBA 2V69A 5JMUA 2HXUA 4NZ8A 4B3VA 4IUGA 4FI8A 1N59A 1LEGB 1RBOB 3D46A 3PHOA 4OT1H 3W1AA 4E36A 3IV3A 4L1XA 5IHUL 1AL7A 1O6SB 4LQ1A 4M3JA 5A8OA 3WDHA 1W9UA 3ITLA 2VM8A 4ZW7A 1D5ZB 5IBXA 4K3JH 1BXXA 5D71L 1XSIA 2W62A 1E71M 5I03A 1VH7A 2ZRUA 1E4MM 1HKLH 3THML 2B3RA 3W9EB 2NY0C 5ID0A 3WEZA 1GZ1A 5I6XC 4Z2IA 1EC8A 1UZGA 4YO0B 4EPDC 4ICCX 2PCYA 5HJBA 3V5KA 4R9OA 4UC5A 3U6RA 1OCQA 4FP8H 2AC0A 3TLLA 5FECB 4HSHA 2X0UA 3AIEA 1XIFA 3W4RA 4PJHB 4UDUB 1X9UA 5K9JL 5IK3A 5DJ6B 4LALA 1WQ5A 4B5VA 2MRYA 2NY4D 2FEEL 4ROQA 1WCBA 2ZAIA 5IBUG 1OX5A 3PZQA 2GTWB 3W9DB 1KR1A 5AYXA 1WITA 4IHBA 2EG8A 4XBEH 4TU1A 5J9PB 1BQHG 1GGTA 2J7FA 1OM3H 2PW1A 4K3EL 5D1ZA 4HUCA 3S35X 1M3UA 4IEFB 2EADA 4BEIA 1XDMA 4XI5D 3H9ZA 4FAMA 1GT8A 3CB3A 5DFWH 5HMDA 1B1YA 3DARA 4QG9A 2GW5A 2F08A 2HAZA 4I0PD 5I76A 1KWKA 1GGBH 2GCYA 1N9PA 2QGEA 4CBZA 3L45A 4PPTA 3B5GA 2IGFH 5HHMB 2J6EH 1VPQA 2EF9A 3EDKA 1D2KA 4XVTL 2PNDA 3JW7A 3U9WA 5KSUB 4AIZA 3VGBA 3DEQA 3EHBC 1ET7A 4TSAL 1I53A 2ZA1A 4WD0A 4RK8A 1IBFA 5ES4B 3AGVA 4NAJA 1GOHA 4QHLB 2HEJA 3FS9A 1POKA 1AKJB 1VLIA 3N2OA 1KFGA 4XXCA 4DP8X 5D38A 4PLJD 4DI8A 2H6PB 2BW5A 2NW2B 2DZBA 1E3XA 5D7HA 1TQTA 3VGFA 4X6BA 1QNSA 4QD2E 3GIQA 2GVJA 2BDQA 4JTFA 4H25A 3P60A 5D9NA 2GUBA 2OMYB 5KBPA 4QJ3B 4KGJA 2OZ3A 1NFDA 3QZWA 2NQHA 4HU0A 1C12B 4WJEA 1LJMA 1IKFL 3PSWA 4DPRA 1U3JA 3IJHA 3GZQA 4NQXB 4HKZB 3FF7A 3MV9D 1KD0A 2XHYA 4QJ1A 2C9UA 2WC3A 2X16A 1OGSA 4RDWA 4O9HL 2DQUL 3ABMB 1Q4WA 4YFDB 1S8DB 4DJFA 1WB0A 4QDWA 3NDYA 1KGCD 3SB3A 3B97A 4IL2A 3IKKA 3OWEA 1ZPLA 1W91A 2QR0B 1XMWA 4QE1A 1DFBH 1VACB 3HO8A 1AJ7L 1L5GB 5F0JB 2NX3A 1XV8A 4ORGA 3ARFB 3R06A 1ACYH 1TUXA 2QGDA 4PJEA 1ZT7A 2FMOA 2YGOA 4IDJL 5CC7A 1HC1A 3FTUA 4WFEE 1T1ZB 4Z2HA 4OGYL 1NGZB 1EUUA 3W2UA 1J2BA 4LKXB 4JFFA 1Y8BA 1U21A 5HI5D 4HQVA 4HKPA 2WBKA 2BY3A 2FZBA 2AHIA 4J3OD 1G9MC 3T3MF 4Z1PA 3Q58A 2IH9A 2CJUH 2FB2A 3TA3C 2PETA 5IQ7L 2W66A 5ESVB 1Z48A 2Q8XA 2W92A 2GBAA 4PRIA 3IGKA 1A3RH 2V5LA 1I1RA 1EFXA 4QOKA 5BV7L 3CBJB 1MI5E 1JPSH 4OZIE 2IXQB 2Y2YA 3FJ6A 3QYSA 1OTTD 4H83A 3WQVA 4S1FA 4K7PL 4X80L 3WBDA 3BVTA 5EA0L 1MYRA 2C79A 1TZHA 3HTWA 1JUKA 3ZVHA 5DHYA 3PXJA 3SUTA 1E6JL 2X8RA 4QLLA 4PRDB 2WZ0A 1GEQA 1PMYA 2JKEA 3HAEA 3UTQB 4XZ9A 2A9NH 3T6QC 1L9OA 3OGOE 4MVBC 3GFUA 2X10A 3HC0A 1KQYA 4X6DB 2CWXA 4XMVA 2JGQA 4JXCA 1I1AB 4AM0A 3NOYA 2O4EA 4KJYA 1FFPA 4MX7B 3P4NB 4AD2A 2PXYD 3B2XA 3QZ6A 3MRFA 4DJED 5FL1A 4ZB0A 4N1EA 3DHDA 4P4RB 1N70A 4FQ1L 2WINA 3HMWL 1TQVA 2E8YA 2B3IA 4PJ7F 2ZOOA 1KXHA 3NDZE 4YYFA 1A5UA 2DAVA 2VAAA 3MNMA 4UFMA 1QTYT 1CXKA 1FDJA 3E9TA 3GFYA 3VA2C 4AYBA 3EPNA 5FKYA 1ET5A 2VGBA 4LPVA 1IQWL 2EC8A 1FFOA 4L5FH 3AXKA 4UM9D 5DLCA 1YNTF 3HNVL 5BW7A 1YRRA 4ZR8A 3QWOB 4P46A 4NN5C 1I8LC 4BFEA 3E8UL 4DW2L 4HUWA 3HFTA 2QGBA 2JCCB 3VWKA 2Z35A 3TFBA 5GRUL 5HHQB 4X7TB 1QPXA 4S1RL 5DLML 2NQLA 1RJCA 5HPCA 4Q8WA 1QOQA 3V4PL 1G1OA 1LNUB 1U91B 4P7LA 4DK6A 5E00B 1Q90A 1FTXA 1KDIA 3U2OA 1Q9OA 4LFYA 1BYNA 3BZ4B 2Y5EA 1W3KA 2E76C 1JFXA 4PP1C 4KWOA 4GISA 2C9VA 4LVHC 1IBZA 1REQB 5IHHA 3AREA 3K8KA 2HS8A 6PTDA 4HHGA 4EDWH 1FBAA 2MPVA 5EOQL 2CDEB 4N2CA 1BVLB 3UVIA 3SCSA 3CH1B 4L3CA 1XSJA 35C8L 2N0MA 4BUQA 1MCIA 1HQTA 4JRXA 4AIUA 4WFFD 5A5WA 1G7UA 4ZO8A 1LWHA 3N44B 4IBUA 3MLXL 2Y7QB 2ZOUA 1O94A 1IAOB 1SZNA 4YL2A 4O02L 1YMMD 4GY0A 5HQEA 3O41A 4MDRA 4R0LA 1Q63A 2BC4A 1V3LA 2ISVA 3B3BA 1EXUB 4OZHF 4BEQA 4LLMB 5GVJA 3RVXC 4NRYB 2DD8L 2NY7L 2QCCA 3SCNA 3VE0B 1BX2A 2ENYA 2MCG1 5HULA 4JQ1A 5K9QG 3FUFA 4C1LA 4FQQA 1BF6A 3PGDA 3VUAA 1UWFA 5DQ9B 3VXRB 3TBSA 1DORA 1DQDL 5H91A 3UA3A 3A3YB 1XD1A 4QROA 2CH8A 7TAAA 5DTFB 3FCBA 1S46A 4WW2C 5CEXB 5A6BD 3AXLB 1I8AA 3QEQB 3MRKB 4GIRA 3FKKA 2PCFA 3FUJA 4XCCH 2J2ZA 1TWDA 4Z7VE 3SUUA 4MKMA 2O5NA 4W9JC 3SJVA 3TYCA 2UZIL 3WQDA 2ZUTA 4P59L 5F96H 1JPEA 1QMUA 3W1PA 3EH5B 4OGAD 2M1KA 2UZ9A 4RZ6A 5E70A 4C7DA 3QLDA 5DK0A 4M3PA 3TOYA 1OAUL 1RUKL 2HE5A 5G2HA 4KRNA 5DC0A 2E3ZA 1YNTA 4U1NB 3THAA 1JPTL 1QATA 3NG5A 3KHOA 5EO9B 1X1NA 4OQTH 4MMXB 4PRHB 1XICA 3HV9A 3ULVL 4XVSL 2H9AA 4LUJA 3DOHA 2PWDA 4GS7C 4FCHA 1GKQA 2HX7A 5FYLE 1FL5A 4J8RA 3TN5A 1S9YA 3W0WE 1HH6A 4KKPA 3DX7A 1BVKA 3B9AA 5DS2A 3PB2A 3O6DA 4PJ9B 3WK0A 1TKWA 1MIEH 1D5MA 3CIWA 2BK8A 1JZ5A 3H53A 4DJFC 3MRGB 2V82A 4S11A 4H9YA 4IIGA 5MEND 1A64A 3TX4A 5D05A 4LVEA 5DZLA 4GUIA 4EI5D 4OI8A 3O2DL 4OLWL 3I6RA 3K0YA 2QQLL 2HVNA 1TKKA 3ROOA 3QXAB 4FXKA 4BSWB 4PYSA 2J8UB 5BZXA 1KMGA 4QS5A 4O2FB 2E9WA 2AJYH 4WTWA 3RHWF 5F2IA 2Z1BA 2YMTA 3G5EA 4HJGB 3OODA 3FQWB 1XGTB 2LABA 1W0MA 1XR8B 2WQWA 3CC1A 8TIMA 3C6SB 1MVFA 5F93C 4BS0A 4MUPA 3EO9L 2GUYA 3E02A 2RGMA 3HR5B 4B96A 5DD6B 2BY2A 4WWKA 5C09B 5GZOA 2FNWA 4IGBD 1KTBA 3V4LA 4Q4KA 4ZFQA 5IVXE 2ED9A 3OR7B 2OI9C 1BZEA 2TPSA 1S5TA 2R1XA 4FQXA 1UFUA 3UWZA 1IC4H 1CCZA 3F12A 3ITOA 3MREA 3N9SA 4XNZB 1G4MA 2ZICA 4HFWA 2Y63A 5C6TH 3OVPA 3CIVA 2PGRA 4Q8TA 1YY8B 1K6AA 1Q85A 2OS7A 2YPKB 4WTZG 4KZDH 1AD1A 3DMMA 4H9TA 2DWXA 1E6PA 1HNGA 1MQKH 4E9VA 2J74A 1F1AA 2LHAA 4GX9A 4HK3J 2F2KA 4WSKA 1GGUA 3MLRL 4E0RA 5GGSA 4BCXA 3VA6A 4EXBA 2NY3B 1Q7MA 2B08A 1ACXA 5EU4B 2W07A 1QRNA 3OG2A 2AF2A 4YDJA 3B5TA 4LCIH 2J13A 4YL4A 2PDBA 3KPSE 2X1RA 4MYAA 2YGVA 1A5BA 5C08B 4OFCA 4MB5A 5FUCC 1WFIA 5E8OA 1CLZL 4N4QA 4PMUA 5HNRA 5CILH 2OSXA 3S5SA 4HHAB 4RGMC 2DUZA 4B6ZA 1A7QH 3HI6H 3K6SA 2A6DA 3CHEA 2ZX6A 2X2JA 2LR4A 1RHHA 5AFAA 5CCHE 5EU6D 1J5IA 1SY6A 3BKCL 3VPLA 3RAJH 2EVHA 4WDIB 5C9JA 3WEOA 3TSBA 2C9QA 4J6RH 5EZJA 3ISWA 1OZUA 3RWJB 3K4WA 4E3TA 5F2FA 1SRDA 5EEYA 4M43L 4JGJA 5I1IH 4E38A 4N8CL 1CENA 3QQ3B 5FIEA 2NY5H 5DRWB 1RIUH 1W31A 4AVFA 5F3BB 1U5JA 3QH3A 2AXWA 4PA8A 3UZQA 2XGIA 4UT6A 1VFFA 3QUYC 3PWPD 3NRQA 3SY5A 3AMDA 1TVNA 3LRGA 4IMDA 2YQ2A 2AQSA 1OC7A 3JUGA 5FPIA 3OGCA 4XAFA 4YXHL 4NNXA 5FJIA 6ENLA 1Q45A 3B9KB 3P3BA 3Q5TA 2YGQA 2VMJA 4P57A 4FS0A 4AQEA 3TZVA 7PTDA 1X7IA 5FEPA 5JMOC 1H51A 3OAWA 3QZOA 3CX5K 4LAJH 3L9YA 4PJ5D 3U1SH 1FNLA 1VZHA 3HRZB 3FN3A 3ULUL 5DZVA 4ZXBB 3O4LE 4C4KO 1RK1A 1VCFA 3KR3L 4R4BA 4Y0GA 1RV6X 2RAGA 5F0LB 4Q14A 4R27A 5CZKA 4ZQTA 4ODWA 1ZSHA 1CFNA 4TULH 3DHMA 4BXSV 3L1OH 3K13A 3AUOA 1DTNA 1FH8A 1TO4A 2FLBT 5JIPA 1R7AA 4V1XA 4P9HC 2VISA 2J62A 5CLZA 3UPAA 4NC0B 4RNHA 1JE6A 3Q6GH 4QTGA 2D2OA 2XN9D 2BNUB 3ZKXB 4RH4A 5BRZA 5E7BA 4O1EA 1R5IA 3PYCA 3CHQA 3HG1A 2F53D 4I8DA 4OGXH 5I19L 2KT6A 2VEIA 1H2JA 4JIQA 1BM7A 3Q9PA 5B8CB 2J12B 1EXGA 1ECEA 5F70A 4UWQB 1Z69A 3DTDA 2NY6D 4PFEA 3TSMA 1GZHA 5TGBB 2VXTH 2OK0L 2VDOH 1BQGA 2EUZA 4GQ9H 2ZX8A 4M5YL 2EO9A 3SO3B 1HP5A 1I1XA 3MUZ1 1VD6A 1W1TA 3Q43A 4P0DA 3F4VA 1WKFA 1FN4B 3T04D 2ZG2A 1NANI 2ZKWA 1NIBA 2NY1D 2VRKA 1FZJB 3BSZA 4UCGA 4MHHI 1WDAA 3KW8A 2E9LA 4JAWA 3JRKA 3P0VL 5HTSA 3PU7A 1NWUA 2WY3B 2BSBA 5L9DL 1RZKL 2IO5A 3GTTA 1MNZA 3OL2A 1MN4A 3BPNC 3U5UA 5L88H 1CB7B 5DRZB 4HPJA 1AFVL 1QLRA 3IDIB 3VX1A 4NNCA 1KEGH 2NY4B 2Z8SA 5A2JH 4HUMB 5KEZA 1YN7B 2P80A 3ALXA 5IM51 1IAII 1RLDA 5AVYB 3TFXA 3GE7A 1ADQL 3CV1A 2W38A 3P2BA 5EF3A 3KBSA 1GEHA 1ZP4A 1MF2L 1VYPX 4DM2A 1UP3A 3CX5J 4L3ED 3PTMA 3FKRA 3A5VA 3QO0A 4L23A 2BMKB 2C7UA 3MA9H 4P8VA 3MSGA 3SB0A 2EE6A 3V0VA 3UH8A 1XRVA 1ZVSA 2VDPB 4ONVA 4FXKC 1JXJA 3TPUA 4I0PB 2WJFA 3PDOA 1XINA 3T4WA 4M1CD 3D18B 2BX5A 1LQBC 4DVBA 1DSYA 3KWWB 4JJ5A 3P3TA 3N5AA 2DLGA 1HCYA 3CUGA 3L0KA 1EJOH 4XPHL 2BXZA 1KF9B 2YD8A 4NI3A 1OCOB 5C7XH 2OCFD 1GJIA 5L6UA 2ZZ5A 3FLUA 1MH5A 2IMNA 5C8BB 1KBLA 3N18A 2DQIH 1CWYA 2GTQA 1NDGA 1SXBA 1MJ7L 2CM5A 4KPHL 2ZPKH 2VC2H 2IPFA 4XMZA 1BXVA 3G1FA 3IDYC 3WHE0 3V18A 5AL0A 1JRHL 5A43C 1KELL 2FX9H 4FF5A 2FD6H 1TMCB 3H6JA 3SE8L 5F7FA 2H1PH 4Y4KB 3AY4A 4PULA 3THQA 3NSNA 3ZE2F 1W5OA 2Y36H 3DYPA 1R3QA 5LGKA 3N3MA 2Z93B 4WHTA 5IR1B 1E0VA 5LYRA 4U31A 5IHZA 5L6YH 4WJXA 2DQMA 2VFDA 1XGPB 3TX9A 4DXKA 4ISVA 2B1AL 4HEME 3ZWTA 4PS8A 2W9LA 4PM1A 4XH2A 3MV9B 4OCWH 1XGQA 2I07A 3GAYA 2PDWA 4FFTA 1A7BA 1WC7A 3VG0L 1HU8A 5EN3A 1KN2L 1H0DA 3WS3B 4ZW5A 3ZOAA 2R8SL 4IMCA 1HK6A 2BNRD 3QY7A 3P0GB 3BT2L 3NEXA 4FNRA 4Z77A 4DWSC 5BZWB 4U2YA 3AT0A 3SCPA 4YHMH 1TCDA 6A3HA 2VENA 4R7JA 3BPWA 3RWDB 4P7OA 1C9SA 2RR3A 2ZYHA 4GXPA 3AU2A 1H0IA 1LQ2A 4YDVB 1L9QA 2RGLA 1XHGA 2HLFC 4H9VA 1V27A 3TWCL 4MDIA 4NI8A 3A13A 2PN5A 4X5LA 1OAKL 1G1KA 2FCBA 3MO1B 4XP5H 5CNHA 3W7OA 4OU3A 3WTVA 4Z42C 1FDYA 2FTAA 2YR1A 1UQZA 4QR7A 2N01B 3LTYA 4C6JA 1WXZA 1A6UH 1AOHA 4G7EB 5I2UA 5IFAH 1VFLA 5FUCE 4NYYA 5GGVL 4G6KH 1DBMH 3IWPA 3LNPA 2KLRA 2XFRA 4ZSUA 2VXVL 3BUPA 4N6RA 2D24A 4WV1A 3NSCA 4HAKA 4A21A 5AOZA 3QUZA 4ZDHA 3WD5H 3TZVC 2V17H 3HG3A 3ICJA 3E6FA 3SN1A 4GKSA 3WO4B 4PCYA 2HMCA 2UZYB 5DO2D 3X2QB 1O5XA 3TC3A 3SCMA 3GIZL 1R3WA 2ZCHH 2E6JA 4NIRA 4HUUA 4HS3B 3MTWA 4L1GA 2E56A 3NM1A 5EU5A 4LARH 1BGXL 3BIBX 5TFSH 4DZBB 1MI5A 4OZIA 5GHWH 2ZSVA 4U7MA 4AXNA 3O3BB 3QDMD 4MZRA 4W5ZA 1YDPB 4E4FA 5ESAA 5TDPA 3VTRA 3TBYA 3HU7A 5F4WA 4F2UA 3VGAC 4F15C 5H37G 4NQQA 4TVUA 4RIRA 2HTLC 4ZTYA 1AP2A 4LEOB 1ZANH 4CCDA 2WZ6A 4HZLA 3BKJL 2EKJA 4I2XE 4N0UB 3ARGD 1KJ3H 4S3KA 1E4NA 15C8L 3I6GA 2OR9L 1VZWA 1EBPA 3V0WL 3LBOA 5CKGA 1MZHA 2P9RA 4O10A 2YB1A 5CCKL 1SFJA 1LE5A 4RQQB 1TPXC 4H6QA 1RUAL 1D6EA 1KBBA 1YEEH 3CE1A 2R2EA 3T1WA 4YSSA 5HI3D 1BZDA 1IZCA 1PY9A 4RX0A 1BPVA 4W93A 1XLCA 4L8DB 3OHXA 4UM9B 2CWNA 4PGEB 4GX8A 1IEBB 3VTAA 3UYCA 3AO0A 1GZHC 5ETUB 4QG6A 3NFSL 3QJHB 2Z2UA 3U36B 4Z7VF 5G4WA 4EI6B 3MACL 2PWHA 2ERJC 3NDZA 1NCNA 1FA4A 3DBNA 2Q02A 3QG6A 1K6QL 3O2VL 4NQDE 3EEGA 2YD2A 3RVTD 1WXJA 2FFCA 1C90A 1E4XH 4Z3TA 1XBYA 3OQRA 4AAJA 1Z41A 3N2MA 3S3GA 2OMTA 1CDYA 1EGMA 3RU8L 3RYMA 3H1ZA 5SWZE 3W85A 4Y5XA 1FNEA 4UM8B 3GFXA 4FNQA 3MKCA 2XFYA 2OTPA 1JI2A 3QDJE 1QVBA 3M1ZA 3O2WL 4R3UA 4RRPM 1H60A 3G6DH 1TWSA 3H23A 3GVWA 3TN6A 3O16A 2GVGA 4G42A 2AJ3A 3P4MB 1UC6A 5AOKA 5D9PA 2YZ5A 5EC1B 1IR2A 3GK0A 1ZK9A 3UWYA 4CN1A 1W32A 3SE3A 3W87A 4WZ9A 3M0KA 1LDPH 4DP4X 3LV5A 5I82A 3FYIB 1ZUAX 3GNDA 3MXVL 4WJ5A 1A4AA 4KY1H 1YMMB 3H2EA 4KKAD 4LOVA 1Q13A 1DJYA 3WG7B 3S3PA 3HZMA 4PJ7E 1ZWIA 3GUFA 4PL1A 1TJPA 1KYDA 2BVPB 1I1FB 4N5ED 2QSCL 5E6IC 3O3DB 3I02B 2DPKA 3QARA 3G8EA 3VMPA 2GSGA 5KJ4A 2IPUK 3OM3B 4XB3A 3BGMA 1L7IL 5CZSA 1XBRA 2OXNA 2Y5QA 4WQOA 1XYLA 3PP3H 4PEKA 1NU5A 2Z6JA 3IU3A 4MXQC 4TUOB 3TJHD 3IGHX 2IC2A 2IQAB 1GGIH 3K80A 3UXIA 4A2EA 2HFEA 2EDYA 4PG9B 4QHNA 5IVXF 5F1UA 2GL5A 5FCUH 5SX5K 4XSMA 1ORQB 1E43A 4NHVA 3ZL1A 3CXDH 2ZYSA 2QPUA 4UILH 1KIRA 2RQ8A 4X60A 1JTOA 2PDXA 5T1LD 4F7PB 1XLDA 3UETA 1JYVA 4LZKA 3ZMNA 3S6CA 4Y19D 1TZ8A 5K33A 1QSEE 4GAJH 4NJJA 1DP0A 3H2FA 1PZAA 1B0RB 3MLZH 1W16A 4PBGA 4N22A 5EBAA 4H3DA 3BDYH 4MY8A 5IXEA 1PZDA 4Z7VA 4MQSB 1OEZW 5TDOB 4W7UA 5F8RC 2BSLA 2B7DT 4ADTA 3JXAA 1AGEA 4TTDC 4Y2DD 4U6TA 1UOVA 2R8WA 5B39G 2ZOTA 5H8UA 3FPXA 5H8DA 4X2PA 4Y8EA 1UC5A 4OZHE 4WY7L 5MENB 4NPYB 2ZA2A 3V5HB 3O0RL 2EXWD 4JFEE 1UG9A 4EI5B 4NM4L 1HP4A 4LT7A 1B9ZA 2QT3A 5ITFB 1UACL 3D87B 4QTIL 4XOCA 1JSYA 2W60A 2C3XA 2Z1XA 1MVUA 3W0WA 2Y8VA 1ESOA 2FYMA 4QY8A 1MAKA 1F6FB 4BH8A 1P1ZA 2I7GA 2V5KA 3VQMA 4HWBL 2XINA 3I65A 1N8ZA 1Q72L 3AISA 2CLVA 2G3MA 4GQPH 4AQLA 3B9OA 4J39A 1PNDA 4BHYA 2XJ7A 4JO3H 1UWXH 4LUSB 3ZYZA 4DO7A 3S3CB 2AEPH 4PSPA 3N6JA 3BFQG 5E6YA 1LG1A 3W7EA 3QCVL 5GQBA 2XHNA 2PE4A 5D6CA 2ZRWA 4MJ2A 3EFOA 4MHBA 3CO8A 4TTGA 1R2RA 4NDMA 3VFNA 4GVIA 3WEAA 3G0XA 5CAKA 2PSNA 2O72A 1TFPA 4HN8A 3FK4A 1P4LA 2OODA 3V36A 4A6YA 3EYVA 4F24A 3MOAH 4HNNA 3MYJB 3KGRA 4U4BA 3V2AR 1Y1DA 4FOUA 2DUAA 3UTTE 2C91A 3WTTA 1GR7A 4S1QH 3F7JA 4QRRD 2V2XA 4CILA 2F5BL 3ENLA 4GSUA 4HIEA 3MV8E 3RI5F 1IEIA 2MQ3A 4G8IA 3RO8A 3QPXL 3CEUA 3LA4A 4EIBA 1DUZB 4PWIA 3WH5A 1HQRA 2Z28A 1PY4A 4LWWA 5IVXA 2FWOB 2BSSA 1J01A 1BQHA 2BOLA 4CSTA 2CKSA 2WXKA 1UR3M 2RBLA 3D2UB 3PNWB 3EWXA 2Z2AA 1YEDA 3ILQD 1P4IL 2QV4A 3UR5A 1Q0EA 4PYGA 1IKNC 3LCWA 4DYEA 1CG9B 4GVGA 3WQCA 5CGYC 4IPIA 4YHNB 2UYLA 1K9DA 3OV6A 2FGWL 4QHUA 1OIMA 2DBLH 3ARQA 4Q8UA 3NIFB 5KYUB 1EVTC 3WAJA 1EOMA 2X9XA 3WY1A 8CGTA 4BJHA 1C5BL 2JV6A 2BCKB 4OCNC 4BQBA 3ZIYA 2EVIA 5EU6B 4PJAB 3B8VA 2VX7A 2DJXA 5GJNA 3TVMB 2CIIA 1E5ZA 1R2SA 2A9AA 3VFOB 3GSUB 1OTUD 4BDVB 5HSFA 4P2QD 3KPSA 3FOLB 3GBNL 3W1UA 2Q7AA 2Z7WA 3OHXC 4UXDA 3TA3A 1XYCA 3ESOA 1BXAA 3CJPA 1PYMA 5JPMC 2WMIB 4NBZB 4GFIA 5F4SA 5LGZA 1MCFA 4ZFFA 4YIQA 4XTRD 3SIMA 1JGVH 4X5WA 1BFVL 2B9AA 3WIFB 2Q3XA 1QRKA 4AHQA 1OQXA 4LW7A 1RQHA 3ULAB 1G67A 5DS8A 3VM7A 5C0RL 2VXQA 1DL3A 3IFOA 2NLJB 4TUKL 2GUOB 1TETH 4MD0B 3M9YA 1KFAH 2C7FA 1QHPA 3OGVA 1GYAA 3REQA 4UMGA 4JDEB 2Q7YB 2GYIA 2CW6A 3FT4A 5KINA 1HSAB 1DQKA 1V5XA 8FABB 1YNQA 1W0WB 4HWZB 5CM1A 2FZDA 3V9CA 5M3WA 3G1AA 4C54A 1W8NA 2PU0A 4L1WA 5CMAB 4WK2B 2COVD 2X1TA 5H35B 3OBKA 2DYPD 1JGLL 4PJ8D 3ZTJG 4G7YL 3T42A 2VJ8A 2PO6A 2AJXL 1OADA 3ARUA 3IVKA 2CJSA 3V55A 3GNOA 4KNSA 5DCBA 2Z0UA 1SEQL 3RMJA 2E77A 1DIDA 3E74A 4WW2F 1BFTA 4MPKA 3HQOA 2I9LA 2Z92A 2R9HD 3CFEB 1JCTA 3ROLA 2X4SA 4K94C 1IM9D 3QZAA 3UZ5A 3CVCA 2ZADA 1JCKA 3DCPA 1G7QB 5CINL 1NFIA 1LUCB 2FIRT 5D72L 2OPJA 2N7BA 3KPPA 4GQRA 1PTZA 4GJIA 1R5VA 2WZPA 4MD4B 5HPMB 4NQUA 2CEQA 2CD0A 1JWMA 1D7BA 3ML8A 3JWOL 3TTQA 1CGSH 4V1YA 2XN9B 3P3SA 1ZS2A 5EBWB 4XMUA 3WXWH 4KJQC 5E8EB 4K7PY 3O4LA 2F53B 3NBNA 1SHMA 2CBMA 2NT0A 3CXFA 4NLHA 1ICPA 2IOMA 2AVFA 1YJDC 1I8LA 2QT6A 4GBDA 3SDXB 3FONB 2YGPA 4L8BA 3NK4A 5LXXA 4OFPA 1NC2A 2EPKX 3KOYA 4ZXLA 4H1LG 1UPPA 3PAUA 1B4RA 2VLJE 2CPCA 2NY6B 3UJ2A 2J6XA 2BWGA 1TZGH 1J96A 1D8WA 4BUGA 3VD4A 1W3JA 2YXGA 4XOAA 1YEFL 2O92A 1X5AA 1ZLSL 5AHLA 3SR7A 5F89A 1MLCB 3UC0H 5INCA 3BGFB 5A8QA 4I7WA 2N7AA 4XV0A 4LKCB 3FCTA 1G1CA 2DIAA 1SO5A 2GJNA 3U7VA 2KH2B 4M8QB 3GTVA 3BUYA 5LNUA 2ZOXA 2IVFC 2X88A 3CV7A 4Q97A 1JNNH 2Q8ZA 1XGYH 3S5OA 5EL1A 2NY1B 3KDOA 4JDTL 3PJLA 2EKSA 5T5FL 1EJTC 4P5KA 2C6QA 3JTTA 3EBVA 1WKDA 5FA3B 3FUIA 5J1SC 3FAXA 2QPDB 5D70L 2G2PA 3GI9H 3QJXA 5D1XD 4C90A 2HJFB 4YHIB 4NEHB 2QF7A 2G3IA 2FDMA 3IXAB 1UA7A 4Z6AT 1I3RB 2AJUH 2YAEA 3AZTA 3BJTA 3N13A 4N90D 1ZHNB 2CCLA 3VDCA 1E1EA 3OWRA 3TJIA 4TKWA 5T1KB 4G7QB 2VZOA 3HB3C 1T99A 1YNKH 1XDJA 2GI7A 4ZTXA 1KLUB 4L3EB 1F61A 4MA8L 1DANT 4DUOA 1N10A 3BXNA 1V51A 2QKIB 2AXFA 3CZFA 3P14A 3RCYA 3IE4A 4BUHA 4I8YA 2WZEA 3ME3A 4ZZ9A 5EZOL 1TG8A 3MBWB 2YPVA 5I5MA 2OMUA 5ANMB 1QTSA 2YMXL 1FO0H 4WW2A 3VW3H 4PCKA 3ZM8A 2E7LC 4H8WH 3NN8A 4GAYB 4MQ7A 2OPCA 4V11A 1JNHB 3LB6C 1KEML 4JQIH 4F80A 3DX1A 4AXWB 4MNLA 2XGZA 4BZ1A 3O9WD 3AAZB 2WHMA 3H3PL 1BBJA 1XI3A 2ITCB 5TPWH 3RPDA 1VGKA 2WXLA 4LLDB 2QQKL 2XV2A 25C8L 1I8IA 3DG6A 4I0KA 4GABA 4IBZA 2QEJA 4K15A 3GMOA 3VILA 1TO5A 2QZRA 4H20H 2V33A 1SF5A 5LNVA 4MADA 1BEYH 2A7BA 4PWKA 4RNFA 2F9BT 4HBKA 4AIEA 1OWRM 4Q32A 4ZOBA 3AQDA 4P8UA 3PGFL 3GSQA 3SIKA 5DD0L 3OVQA 3RX2A 3JZYA 1MHEA 3L9RB 3H42L 2X4RB 1CBVL 1OXYA 2J71A 1O12A 2AW2A 2HXAA 5INDA 3W28A 3LXBA 1HYSC 3HPJA 2ZF8A 3EJQA 2JKSA 3MLYL 3PFUA 3D6GA 4OGQC 2WXRA 1JERA 4Y4FC 4IRZL 1C16A 2FHCA 3CU7A 1W6TA 1JPHA 1AGDA 1JPGB 1UD4A 1UVQA 4LB4A 3FTWA 2NUYA 1NTHA 1SYTA 4ZPVB 1KCSH 3SQLA 3EB2A 4WXYA 1OK8A 1TJHL 3A6BH 3L5MA 4PR4A 2BVOB 3VRIA 4JDBA 3C86A 2W9DL 2BNRB 1XIIA 2FNBA 2GI0A 1JVOA 3QR1A 2PCXA 1E0OB 4Z78A 4RRPG 3G1DA 3F58H 1J5SA 1KM2A 4UQ3A 4HUVB 5EU3B 4HEMA 3Q45A 1A7OL 4F9DA 3QFWA 3MRQB 2VN6A 4CMHB 4LVNB 2Y1YA 5E8DL 4JFHE 1KCRH 3WUFA 4WUKH 4PTUA 3HJEA 3N2BA 3V35A 4D6EA 3VFMA 5D8ZA 4UTIA 4O2CB 5BXPA 5IJVB 3P9LA 3X14A 1EJ7L 4UDTB 1ZLVH 4UFLA 5I8KL 3K8MA 2J8OA 1T20B 4JQXC 4GT7A 1MZYA 4NRXA 4N2DA 4LOFA 3SD2A 1BECA 1Z9LA 4U5KA 3VJ6A 4ES9A 3U1QA 3AXHA 3RVVD 3ANVA 1DEEA 2WB7A 3M0ZA 5DURB 4QRQA 3Q1EA 2FUTA 2DIEA 4HBQA 4CEXC 2MOGA 3ZE2E 2QQNL 1ETJA 3FTGA 4DQOH 2PFHA 3O0LA 5KVGE 1EA9C 3PWUA 5F7NC 3JSSA 4Y16C 1DDHA 3K6IA 2PO6C 1PG7L 5JYMA 4HDIB 3D69B 5I3FA 4S2CA 1H49A 2WIIA 1ZRUA 3VAEA 2AAAA 4JPWL 3BLBA 5CS7A 3FGCB 5CC3A 4W6YB 4H2HA 2PTUA 5KETA 3GSWB 4UUJB 4ENZA 5EORL 4P9ML 1RPUA 4B5EA 3MA7A 2AGJH 4DAFA 2B0SH 3W76A 1EJ8A 3RAOA 3O3AA 2PEVA 4OJDH 1I4NA 1KUMA 4DELA 1BZ9A 5J57B 2E27H 5I1JL 4R97C 3T4YA 1ES0A 4ZD3H 5EG6C 3G6JB 3GU9A 4LF3B 3G1VA 5KVEL 3KGTA 1CLYL 3ZKNC 1CT5A 7XIMA 1FRGH 1SYVA 4ODBD 2X0YA 4IOSA 1SJHA 4A2FA 4K8RL 3QB7C 1KM6A 3C0LA 1J5OH 2EG7A 1L9RA 4MSWA 1HSBA 3WSQL 4P23C 4FEIA 5KSAD 1K7EA 3MBDA 4Z5RA 1MO0A 2EEAA 2C3VA 4UR9A 4X5PA 3QUYA 2CDFB 1UKOA 4I2XA 3LEXB 2VFGA 3TMLA 4KKCC 3NIGB 5L8LB 2WMPB 5AYIA 3BE1L 3DX9B 1BIIA 4MB4A 5LDUA 2ARJB 1QWNA 1DSFH 4TV6A 4WTZA 4G59C 5EUOF 5AW4B 4PBFA 2ZONA 2VURA 1RZJL 2YDRA 3B7TA 3FH7A 4CNOA 4GW5B 2A9DA 3MVIA 2YAFA 4ORMA 1TENA 2JQMA 1L6FA 1OT1A 4URKA 2X1PA 1TQSA 3CN4A 3WFDH 1MFUA 4U3SA 3K91A 3MQIA 4U1GB 2OU4A 4JHMA 1E9YB 1XHHA 1Q0XL 4GIPD 1DN0A 3KS5A 2XVKA 3H9HB 1L9WA 4OBTA 4W87A 4OFDA 2WUBL 3N0AA 4TM9A 4NQDA 2LAGB 2ADIB 3TESA 3Q0HA 4HPOH 4OFQA 1G69A 2YD7A 3E0GA 3EZ4A 5EH1A 3MLTB 3CUZA 2ICEC 3MY9A 3C08L 4JY5L 3ZUCA 2I32A 5SWZA 4CVXA 1M3IA 4OLXL 1KTDA 4M7SA 3PGCB 4QWWC 2E28A 3P0WA 3HN5A 3DA0A 1BYBA 3QDJA 4N2BA 1EJFA 5EOCJ 5IB4B 1FWEC 1FZOA 3LSOB 3NEVA 2Q76A 1E8WA 4UT7H 3RL1A 3C12A 1R3HB 2WSPA 4PRWA 3WUEA 2E09A 5JPNB 4MNQE 4NQEE 1C5DA 1AJ2A 5KOVC 2JF7A 3NP3A 3MRNA 1OGAE 1SLUA 1A80A 3UXLA 4P7QA 1JVKA 4GPNA 3FYPA 2G3XA 3BFWA 4Z95H 3UGEA 2CBTA 2BNQB 4KKBD 2YXOA 4EUPB 5EF0A 4O8AA 4JIPA 2HVJA 5F3HB 1L0XA 4U1IB 1A5OC 2BSRA 4N5UA 4N9GA 3PULA 4PJ7A 3QFEA 3V16A 3AQYA 1LO2L 1ML0A 5IOBA 1AR1D 3W1MA 4O4WA 4IMLA 3PWLA 2NUXA 3DPBB 2Q7NA 3CPLB 4W6WB 4EZJA 2OCCB 1LBFA 4I3SH 3IDJB 4FR6A 1YA5A 4G6CA 3U4EA 3S1GA 4GYFA 1P0NA 1JD7A 1QOKA 3FCUB 4TV5A 1EQPA 5T1LB 3LVTA 2EPNA 4Y19B 2EZ0D 1Q8MA 5ICZB 3NFUA 4GQBA 2QCMA 3ABLB 2OQJB 4LSRL 3LBMA 5IMLA 1NFPA 4NSBA 3IXTA 2EABA 1RSCA 3I50H 4E4PA 4IBQA 4RBPH 1NPUA 3H2WA 3D85D 3C6EA 1AW1A 5EBLA 1LL1A 4R2GC 4RNIA 3QAQA 3R13A 3F2CA 3TBWB 1AIZA 2G4JA 2FX7H 4Y2DB 5C7VA 4BK9A 3E3HA 4L37A 2IWGA 3QR0A 4XWUA 2WWMC 4G6JL 1QSEA 4RFNB 2IKHA 1A5AA 4IU2B 3VH8G 4LU0A 3RUGE 2YC1B 1QLEL 5DRNA 5IMOA 3IS0X 2Y1VA 4ZQPA 3WFAA 1V7NL 3UL4A 3FSTA 4JX6A 2J3SA 1IM3A 1R3YA 1MAML 3LD8C 5HHVL 4HETA 2AL2A 4Z7NE 4FC3E 4XO5A 3L3OC 1W1B1 2PDFA 1OFOA 4GY1A 3T0WA 3MCKB 5I73B 3EJJX 2VC2B 1T04A 3LDBC 3O6KH 3BUVA 4MJ6B 3LEYL 4L4VD 3CU1A 4RFOH 2GEEA 1X3DA 1E1CA 4JY4A 3V1HA 4G6ML 4REQA 4FQ2H 1Y18B 2P1FA 3J8F7 4OZHA 5LG6A 4Y1AB 3ABXA 4JFEA 1LTDA 3WX7A 3WQ4A 1BYCA 2DWYA 3KPNA 2CC0A 4JTHA 4PW4A 1WDPA 3HI1A 4L1DA 2HZHA 5AW2B 3BKMH 2GSEA 3O6FD 1IZJA 5I0XA 3VB9A 1A6TA 5DZAA 2VW4A 1J93A 4CADB 2DKUA 1QNPA 4AE0A 5CR8A 3THUA 4NFDA 1VPOH 3PLYA 5I1CL 1TPVA 4HKXB 4QRRB 4NJ9L 3TC7A 2INFA 3DHUA 5F8QC 3RX4A 2VD8A 4Y5VC 1NP0A 1OP4A 4FNLL 1HDMB 1JDAA 2AQTA 1LOQA 1DBKH 1S2AA 4AGQA 3EYQC 1W8GA 3GY1A 3CBKB 4FALA 4D9QE 4PGDB 4GLRH 5AW0B 1U4FA 1S5WA 1EHNA 2KLSA 5LXEA 2X1UA 1CZ8H 1G7JB 5LBVA 1DHKA 5A95A 3UTTA 3GSXB 1KYAA 1RZIA 3NCJH 4DWSA 2VZSA 1H0GA 3J7HA 3B3IA 4B60A 1QLFB 1Z9OA 4XNYH 4NSKA 4H0GA 3MV8A 3M46A 3UPCA 3PVFA 1J6PA 3R8QA 5FCZA 4NO5B 3WIHH 5JIWA 4TOYH 1OWWA 1N8WA 4YJ5A 1OP5H 4QIRA 5JXAL 3NAAL 1NTDA 2OP4H 5IROC 2ESVD 4HNTA 4RZCA 3EJSA 3MDUA 5A16B 5JHLA 1J2WA 3L3GA 3HMXL 1OFPA 3OEXA 1QO5A 3PZMA 4FFYA 3C2AL 4JTSA 9XIMA 1FV1A 2OSWA 3STZA 2NYZA 2MKLC 1KCUH 4P2QB 3P9WB 2IANE 2PABA 2UVEA 3FCSA 4HU4A 1DN2A 4GRMB 1X4ZA 5EN2A 1RCOB 3LNFA 3QEHA 3WCYA 4MWAC 1RIVH 4UFJA 2ZG1A 3LNMA 2E0PA 3BWZA 4LVBA 5F1IA 3TONA 1CD9B 4ADJA 1EJSC 2UV8G 1EHLH 2EGZA 2P5WE 4MJJA 3OLDA 4HHWA 3A3HA 2GTZA 3HPLB 5C0IB 3EJCA 4FA7B 5MP6L 2K8MA 4C1NA 2B16A 3QUMB 4DVOA 4QKXB 4C1KA 3CVIH 4KFZC 4FZ8L 3SZ8A 5SWQB 2B5IB 2APBA 5TE7H 2ZVRA 3ZL4L 3BPLC 3MCG1 3N73A 4P2AA 3VCCA 3CAVA 5T1MA 1KFKA 3QHNA 5DT1L 4A3HA 2NX1A 4LAKA 1CVRA 4HLJA 2QKFA 4D9LL 1C5CL 2J4WL 4YSRA 2FVNA 1KFCA 1RFDH 4NHUA 4N9BA 1UB6A 5T91A 2F1BA 4IGSA 2JGYA 3NZPA 1FZKB 3REWB 3P7YA 4MASA 5HUOA 3VXUE 5GGRY 3OYXA 1IM9B 1KV3A 3QI9C 1M2VA 3OKOB 5D9OA 2YAMA 2GDUA 4FIQA 4FKHA 3WLIA 1M57B 1MWAB 4OUOA 5ISZE 3QJQB 4UTAH 3KH4A 4W9ZA 4ZB5A 2BVDA 4JTCA 5AHEA 3FU7A 4OF7A 3MV11 1P5UB 3UVAA 2Z0BA 3KTXA 5GGVY 2PZNA 3HC4H 3P9MB 1RY7B 2WO4A 1TTPA 1NH6A 1A3WA 5FA4B 4X99A 1M7JA 1PNCA 3QS2A 4IRSC 5ENWB 5LKNA 5AVNA 4KZEL 3JBG7 4MKNA 3S1XA 3OG4B 3MUJA 1TR7A 4DYKA 1OAYL 3FO0L 1O5KA 3THMH 3MSPA 1BM3L 5B3NA 4K7FB 2OYKA 4BF7A 4Y9CA 4R7NB 4JDYA 3ZDWA 3QIBD 4DKAA 1X5IA 3OLIA 4OUEA 5G4EA 1N64L 2QLYA 5IB5A 4LAOA 3M0LA 4C4UA 5XIAA 4WDXA 1MCSA 2H3KA 4FIRA 1XIWD 1T5WB 3U30B 2ZAHA 4LBAA 1G7HA 4AEHH 2P46B 2JXMA 4JFZL 4GXFA 4CC0A 1KCVH 2VLJA 4ONHB 1T4KA 4ZFOB 3ZSTA 2BTMA 4MTVA 4L18A 2EICA 3MC5A 4LP8A 3KD4A 2MTAA 2B15A 4WWOA 4WVXA 3FQUA 1U8NB 4JS3A 2XACC 5H37A 4YHKH 2B8OT 3L5XH 4NQ1A 4UMBA 4JM2D 3V6OC 2F84A 1R9ZA 1ASOA 1YVLA 4ZMTA 4YFLF 4K3EH 2RQEA 3LPFA 3FF8A 4KJWD 1R3JB 4N0YL 3QJVB 1XGDA 1YEYA 3TA4D 1ZV9A 5E6IA 4Q22A 1AHKA 1OZTG 2J72A 2A9CA 3IGAB 4N68A 1R24A 3NZ8A 4OZ4A 3R18A 4YBQD 2MCAA 3GI8L 3O6MH 4ODHH 4YFLI 1WDWA 1A1MB 4GYJA 1FVDA 2DZXA 4ESKA 1AH4A 1XF2A 3UPRA 3LEVL 1JF5A 3UTZB 1GNXA 3STPA 1U3HC 3BHBA 3H2PA 4R3SA 3UOAB 4ATTA 3NH7L 3BP6B 3BG9A 5EZLA 3M17B 5K59E 1M42A 4US5D 4O14A 4IW4C 4L8SC 3LPPA 3O9WB 4YDKH 2L4OA 3ES6B 1IBGH 1KN4L 4IIZA 2G60H 3E80A 2GIXA 2J79A 3LHPL 4XVUC 1HTIA 3EEZA 4QRBA 2PDHA 4IP4A 3PHSA 4NPJA 3FH8A 1KLGA 2HTKD 4B4HA 3B8TA 4GW4B 4XBGB 2FTYA 5HQMA 4ZQOA 4F20A 1GORA 3GJFB 1NCIA 5GSVA 1YQVL 4HZMA 1R3KB 3RK8A 1BMZA 4M8VA 4A8LA 4GC4A 2OQLA 3WLPA 1TJGL 3MSYA 2AJVL 5DJ8A 2P44B 3ZDYB 2P24A 4G9FD 2XPYA 4A63A 2DQGH 3C87A 3A6CL 4HH8A 1H7NA 4PLKC 4GMTL 2FJGB 1PZ5B 2C71A 5HDQL 1ZGLP 1HVXA 5DVPA 3U2ZA 3HZYB 2OXHA 2HSIA 3FB5A 5D7JD 1OE2A 5E7FA 3A64A 4PJGB 4MLIA 2CO7B 4PD4K 1QD0A 4YK4B 3CHVA 2XQBH 4BQCA 3VVVA 4R5VA 4LMQE 1UUNA 1N8OE 4PV9A 5CBJA 2CJ3A 4M5PA 5CSSA 5KVDE 2LLEA 1AKPA 1H3TA 1FWAC 3PE9A 2J7GA 3FV9A 1RAMA 3U0WH 3WJJC 4OGZA 5HWJA 2PLJA 3WF1A 3U7YH 1IJNA 1DQLH 3GSRA 2CLKA 1ZBCA 5JDJA 3DERA 2I60L 4WR3A 2WLZA 5IVOA 3ZU8A 5F7WC 1EO8H 4O0ZA 5DMGC 1K7FA 1HCZA 3N4FA 4TUJA 4NNPL 1FVCB 1EIXA 3RWHA 4NZRH 4ODUA 4PRPD 4TLKA 4G5AA 3G04A 3QC0A 4PS4H 1G7IB 4BSVA 4FA3A 4KK8C 5E0CA 5IQ7H 3A5FA 1AXTH 4PRAA 4F7TB 5ACZA 4ENED 1UZ4A 3OC8A 3X1FA 1YEIL 3WI9A 4DGVL 4BK8A 5DC2A 1NMCC 5A7BA 4JTAA 4FS9A 1J1PL 3URAA 2DMBA 1JAKA 2A6KA 1XH3B 2G5WA 2CUIA 3U2SA 3F7VB 2QDGA 3IKCA 1VFTA 3TEXA 4A38A 5GRJH 3R0MA 1K3IA 2PRLA 5E4EB 2YSSA 3HE7D 4NQVA 1A9EB 3Q5YA 3ZUNC 2BOCA 3VFWB 4LIQH 3W83A 3P5YA 2A83A 3NL5A 1JMZA 3M8OH 1I7UA 2VLKD 4K9JA 1C08A 2L0DA 3GJEA 4N6FA 1JZ8A 2Q5BA 3S48A 1WZKA 4K37A 3CLFL 4YEEA 5B39A 5DHEA 3HNSL 3RB7A 3CFKA 5DY2A 2K9FB 2Q0ZX 4JRYE 2YA2A 1TTCA 1YEGL 1IKNA 3W75A 1MHCB 3V0TA 1DJSA 3GLDA 4IX0A 1PKQB 2J25A 2HSAA 2PXYB 2CERA 4NX0A 1A6AA 3QQ1A 2F8OA 3RG1C 3W23A 2IKJA 4MWAE 5U4NA 3FZUD 3HLAA 1JNLL 1OGTB 1GGOA 4FA8A 3VOJA 4JANB 1UBPC 3UX9B 5TE6L 4PTWA 4DKEH