2WVSA

Crystal structure of an alpha-l-fucosidase gh29 trapped covalent intermediate from bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an e288q mutant
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
439
structure length
439
Chain Sequence
b'EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYQRRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-L-FUCOSIDASE
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 158
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvsA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvsA01
2RGLA 1ESWA 2XN2A 1UHVA 2YKKA 1HF6A 5A8PA 4Z2KA 2YA1A 1P6WA 3WD2A 2CHOA 1E15A 5A6BD 3ALGA 3PZTA 4PRWA 1JZ3A 3TTOA 2NSXA 3GXIA 3HG2A 1CEOA 3VX0A 3SUWA 2J7CA 1H11A 3WD0A 4UQDA 4W7WA 4XB3A 3BUBA 1HJWA 2Y8KA 3QOMA 1W3HA 5ECUA 3KL3A 1TR1A 4BA0A 3I3DA 1LG1A 1SR0A 5CGTA 4MB3A 4MB4A 4PTWA 3VGBA 3WY3A 1OIFA 1XCWA 1JNDA 1B31A 3CZLA 4F9DA 3VIFA 1CGTA 2ZXAA 5CJ5A 1UWQA 3ARUA 4MJ4A 4F66A 1W1VA 4GZIA 4X0VA 1E6NA 1C7TA 1N82A 1HXJA 4ML4A 4ACZB 2VVSA 3T2QA 2D0HA 3L4WA 1HTYA 3AZSA 4D72A 1I1WA 3APGA 1K9EA 1JXKA 1B3YA 3PZMA 2Y24A 2VNCA 4NRRA 3NSMA 3FW6A 2XM2A 4DUVA 2VX6A 1JF6A 3G6MA 2DT3A 1RP9A 5BRPA 1W9UA 3VGEA 1OD8A 1HNYA 3VD3A 1ZBKA 4HOXA 2J8GA 1CXEA 2DSVA 7CGTA 2EPNA 3VIHA 3WBAA 3VGDA 2ZWYA 4JKMA 1G0CA 4S3JA 4KH2A 4LPCA 1CLXA 3VM7A 3FN9A 1MW0A 4UQBA 1MQPA 2WVVA 1OSEA 2GK1A 1E55A 2ZXDA 2ZUNA 2F2HA 2GDUA 5A94A 4UFKA 1J9YA 1E73M 3KL5A 3ARTA 3AIEA 4DM2A 4OBRA 3BLKA 3ECQA 4W86A 3ZJ8A 3CZSA 4MAVA 3AISA 4ZXLA 3EJUA 3ZSTA 4MNKA 4HMCA 1NARA 3AS0A 2JFEX 4D6EA 4AD2A 1W9XA 1VIWA 1CGUA 1XCXA 1R7OA 3KLKA 1H0GA 4PSRA 3BUIA 2VX4A 4W8BA 3WDIA 3GXFA 4U2ZA 5AC4A 2D3LA 2WMIB 2VZTA 3CLWA 3CMJA 1GZJA 3WF1A 1IZJA 2WZHA 1CYGA 2FGZA 1OGSA 4FK9A 3OLIA 3DX1A 1V02E 2YOCA 1GONA 1G9HA 1HX0A 1FH7A 1UASA 2WKGA 1ISZA 1UD6A 5A2AA 3ARSA 1JDAA 2WHJA 3MO4A 2VVNA 3WH6A 1H1NA 3H55A 3GXTA 5I0DA 2ZE0A 2ZXQA 3SCTA 2Z1SA 2WMGA 3A4WA 1ODZA 3A23A 1TQSA 1GJWA 4J3TA 4LXFA 3FAXA 1E6QM 3OLEA 5FOOA 3UG5A 2CIPA 1C3FA 3WDRA 1XV8A 2OWWA 1WCGA 2VZUA 1GNXA 3DYOA 3GXPA 2ZX9A 1XH0A 3HMCA 3LPGA 2BHYA 4ATWA 4HPGA 3TP4A 2E9BA 1PEZA 5A6MA 5CPTA 4PCTA 4RE3A 3BC9A 1NWUA 3L2MA 2ZICA 5JIWA 1CIUA 4F9JA 2W5FA 3N9KA 1ZJBA 2JF6A 3VSTA 4GI9A 4BQ4A 5ABGA 2CYGA 3MKKA 2CCRA 1GHSA 3AXIA 2E9LA 4TX8A 1E1FA 2D24A 1E4LA 1HJVA 2YL5A 2GSJA 3PZGA 2BS9A 4WSJA 2CBJA 5D4YA 5HPCA 2BNJA 2VQUA 4B3KA 2CERA 2X2YA 1UZ1A 3BVXA 2CHNA 3KE0A 1H4PA 3AMGA 2WK2A 1BGAA 1WZKA 4OIFA 1EGZA 1U33A 1FP9A 3DHPA 2JF7A 3AHXA 5HOSA 4WKHA 3PZOA 5AY7A 2X2HA 4Z2GA 5A8OA 4J27A 4WJXA 2ALWA 3VNZA 3VTRA 3F5LA 3L4ZA 2CETA 1Z32X 3DX2A 1G94A 5JBEA 2WZIA 2ZUVA 4M8UA 3EJQA 1HKKA 4JL1A 3PZ9A 1QI3A 5I77A 1VBUA 2OWXA 1OIMA 4M56A 4QLJA 3EDDA 4UFMA 1WE5A 3MUAA 3W38A 3EMCA 3WQ8A 3CH9A 2UY3A 1HJUA 3CZ8A 1ODUA 1RPKA 4ZE4A 1W3JA 2UY2A 1SYTA 4JCLA 1HJSA 3WL0A 1MYRA 1TQVA 1CWYA 4PSPA 1V6UA 1H3GA 3SCWA 3L2LA 3AHYA 2VRJA 4JZ5A 2EQDA 1JNEA 5EBAA 2OW6A 2XIIA 1C8XA 4RL3A 1XYZA 1VEPA 1LL7A 5A6KA 4C7FA 2PWEA 5HXMA 1EXPA 1R86A 4PMNA 4FNSA 2XTKA 5D9MA 3NUKA 1S46A 1TUXA 4X0NA 4DWSD 3BAYA 1UQYA 2W66A 3U7VA 3LMYA 1OB0A 3VKKA 3ALFA 2VCCA 5BCAA 3IK2A 1A3HA 4S3KA 4K68A 3OZPA 1KQZA 3BMWA 1E6XM 4HPHA 1FH9A 3WY2A 4PMZA 5FD0A 1Q6DA 4CD6A 1GOKA 1NP0A 4IM4A 1SMDA 3WD4A 3RIKA 1W3KA 2V5CA 1J0JA 2EJ1A 3BUQA 4UCFA 3RILA 3SEPA 2WAGA 1XH1A 3L4XA 4W84A 3WF0A 2GVYA 1B0IA 1SMAA 2EACA 5ABHA 4P7LA 1DTUA 1K6AA 1KXHA 2G4FA 3AOFA 2OSXA 3OIHA 3WEZA 4OJYA 3A4XA 2XVPA 1BVNP 3SCRA 2FYVA 3O2LA 1KXTA 2WPGA 5IDIA 3CPUA 1CXIA 2UY4A 5GNXA 5CLWA 3D4ZA 4KMQA 2XPKA 4BZYA 2G41A 2J75A 1UOKA 4J7RA 1FOBA 3VNYA 2GUYA 1QI2A 3N13A 3ARQA 4BQ5A 2E40A 3A6OA 2X8RA 3PBGA 2WC4A 4P7NA 4U3CA 1E72M 5AC5A 2EXOA 5CG0A 3CUHA 4PTMA 1JZ2A 4ZFMA 2D3NA 1C8YA 1DWHM 2XFFA 4U5IA 3QHNA 4WKAA 4OKDA 3W26A 2YL6A 2W4XA 5DT5A 3TV8A 4YPJA 4EE9A 2DEPA 5IHSA 3NJ3A 4AC1X 3AS3A 2XHYA 5I23A 2E4TA 3PZUA 4JL2A 3T2OA 1WO2A 5A6AA 1W2PA 3CTTA 2X05A 2XFYA 4D6CA 5M03A 3HJEA 3AMLA 1MFVA 4PMXA 4W5UA 1CGWA 1JYWA 2QMJA 2XFRA 4OOUA 3WNKA 1W9BM 3WUBA 4ZXOA 1ISYA 3K1DA 4MNMA 4UTFA 1WAWA 2VL4A 1PIGA 5E0FA 2VZSA 2PBOA 3N11A 2A3CA 1LJYA 3EMQA 2DH2A 1DWGM 1W9VA 5A95A 3W28A 4H8UA 3CIVA 3LRLA 4UOQA 1US3A 4WSKA 1FFRA 1H0IA 3MU7A 5LA0A 1X6NA 1E56A 3WF3A 3BXWA 2B31A 4UOZA 4DWSC 4H7VA 3CUIA 5GQBA 3AHVA 1UKSA 4JFWA 3KZSA 2BHUA 4EKJA 2ZX5A 1R75A 2ZOXA 2F1BA 1UD5A 3SIMA 1EDGA 3WKZA 5A8MA 4HU0A 1BTCA 3PZNA 3AXHA 4H04A 2D22A 3POHA 5JBDA 2PWDA 1ISVA 2O9TA 3U7BA 1BLIA 3AIWA 3RM4A 4B16A 5A8NA 2DPEA 5BXSA 1PIFA 1WDPA 4L4OA 1D7FA 5CPSA 1B3ZA 2J7GA 2WLZA 2WM0A 1EQPA 2XJ7A 5D9PA 2QHAA 1KQYA 2E3ZA 3W37A 3AYSA 3WFLA 2VR4A 1WB0A 4HA3A 2JIWA 5I78A 3AIBA 2YJQA 4FNUA 4V27A 3BCDA 3PTMA 3ZT7A 2A3AA 1I1XA 5ABEA 1AMYA 1VFFA 2DGAA 2JEQA 3ZSSA 1O7AA 4JKKA 4MJ2A 3SUSA 2JEPA 4Q22A 5FKYA 7TAAA 3CBWA 3KLLA 1JZ4A 4HOZA 2WYSA 1ECEA 4BS0A 3VUPA 1U30A 4AIOA 1EOMA 3OG2A 1BYBA 4M24A 1V6XA 4V2XA 1YHTA 5A2CA 4IPLA 5I2UA 1MWOA 1PX3A 4AY1A 4QAWA 3MMDA 2ZX6A 2VURA 1KXVA 1BSIA 2F7OA 2WWCA 1GW1A 4A4AA 1B3WA 2CBIA 1JG9A 1HKMA 1ZBVA 3D52A 3HG4A 3ZO9A 2VX7A 5I24A 2FHFA 2XYLA 4UFIA 4IPNB 5DEZA 4YHGA 1TQTA 4GI6A 1E43A 1UWSA 1VEMA 2V38A 1LWJA 1OD0A 4W93A 1FH8A 5BRQA 3AIQA 3N04A 3WNNA 3KWXA 2BXZA 4GI8A 1PBGA 4AMXA 1J0HA 3S5ZA 4URIA 3JUGA 1QW9A 5EMYA 1J0KA 1LWHA 4U2YA 4P8VA 4W5ZA 1SZNA 1RH9A 3WNLA 3GBDA 4BCEA 1TCMA 2QF8A 4JFSA 1D2KA 3DYMA 4CD5A 1NP2A 5M5DA 4P7OA 2WBKA 1KTCA 2EABA 3PTKA 5FL1A 1KGXA 3N12A 3IANA 4PTXA 1R8LA 2WC3A 4JHZA 1XHGA 1BFNA 4FNRA 4PMUA 3SCVA 1E5JA 1ZU8A 5D9OA 3WY1A 2A3HA 1U2YA 4E8DA 5IFTA 5A8QA 4R27A 4M82A 1UA3A 2PF0A 3AYRA 3NCOA 2XN0A 3ZIZA 5HDRA 3RDKA 2BVYA 4AYGA 4QLKA 2GJRA 1OGBA 4AZ6A 3O9NA 1WZLA 1ZS2A 3I3EA 3DC0A 4CCDA 3VX1A 5BWFA 3IJ8A 2QLYA 3T0DA 3MSGA 4FNQA 1ZL1A 2WMHA 3EJTA 2DDXA 4CGTA 1XD1A 1IT0A 2ZX8A 2YDRA 5D8WA 1LL4A 2BXYA 1AVAA 4P8XA 1E0VA 4AZGA 4GO9A 1VBRA 2WVSA 3UG4A 4H2CA 1W32A 3CZGA 4M29A 2ESCA 2OYKA 4BQ3A 3SUTA 1VJZA 3D5HA 1J11A 3NDYA 3A5VA 3W4RA 4PCSA 2CBUA 1R47A 4LX4A 2WHMA 2Z1KA 3DDGA 1R85A 3LXAA 1V3MA 2O92A 3L4UA 4JCMA 1E6ZA 2YBUA 2X0HA 1US2A 2A3EA 2DQXA 1J0IA 2XGBA 3WELA 3B9EA 2VJXA 3T0AA 1JGIA 4AIEA 1XC6A 2F7QA 1WZAA 3VVGA 1H49A 2OSWA 4MNJA 4D6DA 1MQQA 4M80A 3THDA 4H41A 1V6VA 4PMDA 4EK7A 1VJSA 3VDHA 2J25A 4XV0A 1QI0A 2VQTA 1MW1A 1QHOA 1LLOA 3OA5A 2ZWZA 1OCQA 3THCA 4J28A 2DIEA 4XZWA 2J7HA 1CENA 2WMFA 2D0GA 4DUWA 3AMKA 5D8ZA 3MUZ1 4W7UA 2VCAA 5KZ6A 4E4PA 2W67A 3I3BA 3OLDA 1JD7A 2X1IA 3AHTA 1JDCA 2OYLA 5DF0A 5EB8A 3ZR6A 3U5UA 1GHRA 3W6LA 3VMNA 4CN4A 2WCAA 2GJXB 2XWDA 3T0BA 1W1YA 4TXEA 4N0RA 1R34A 1GOIA 3UETA 2IGTA 5CLTA 2PC8A 2YLAA 3MV11 4ACZA 3CZEA 3ZMRA 5GNZA 3CV5A 1OT2A 1OGGA 1E40A 4Y7EA 3KL0A 4QP0A 3W6MA 2ZUMA 2VT0A 1CPUA 4D1JA 1TFVA 1UUQA 3HN3A 5A3HA 3B9AA 1X1NA 3CHEA 4ATLA 1W1TA 3WF4A 1AQ0A 1NH6A 3GNOA 2FH8A 3A22A 5IHRA 2ZX7A 3H53A 4PTVA 1KWKA 2FE0A 5DT7A 3GYCA 1WNOA 2JALA 1KXQA 3BAKA 4AEEA 4F8XA 1HWWA 3F5KA 1CLVA 3WD3A 2D20A 4HMEA 4TTUA 3ZJ7A 3T08A 1JIBA 1HVXA 4MDPA 2WZEA 4MB1A 1ISWA 4JFUA 4AXNA 4UZSA 2F18A 3LX9A 1PX4A 3VINA 4WF7A 1EDTA 3TA9A 4PEEA 2XG9A 3RCNA 1GCYA 3VDBA 2NT0A 3GH7A 2J7EA 1GQKA 1ZB5A 1CBGA 1WP6A 4HA4A 4PMYA 3ARVA 2WC7A 2V3FA 4TX6A 1EH9A 1UKOA 5TD4A 2WMIA 1FHLA 4IISA 4TTGA 4LQ1A 5LYRA 3AZRA 4DUXA 4FLRA 1GPFA 3J7HA 1MXDA 3VSVA 3RJXA 2W61A 4CVWA 1QWUA 4NX0A 4JKLA 3VIPA 2W91A 3VD9A 4CCEA 3ZT6A 3UR8A 4MADA 3GTNA 5C8BB 3NSNA 3N15A 4D71A 2CITA 3WFZA 4KRUA 4UFLA 2XSAA 3W24A 1XGZA 3WH9A 2EEXA 2VZVA 1V02A 4QCFA 2IUZA 1QHZA 4JFTA 3PHAA 1B3XA 4U5KA 3PZVA 3VU2A 1BG9A 3VGGA 4D6GA 1TQWA 3VIOA 3AICA 3LRMA 2VMFA 1A47A 4FLQA 4KWUA 4UZUA 1G5AA 1UWIA 3PTQA 2V3GA 1V3KA 4JFVA 2EADA 2ZUTA 4GQQA 1UR1A 2CNCA 4QFUA 3SURA 5GNYA 1HL9A 1JI2A 3M7SA 1FA2A 3AQUA 5AYIA 2OWCA 1LL6A 2C7FA 4DM1A 1TA3B 2YDSA 1R46A 2VC9A 4HZ6A 1UR4A 2WHKA 2J4GA 2GJXA 2Y5EA 1F4HA 4LYPA 1QPKA 1PZ2A 2ZXBA 4DWSB 3BUDA 2WMKA 1JFHA 4GZJA 3WY4A 1BYDA 5E6ZA 4F79A 1HT6A 1DWAM 4GINA 1V0LA 2V3EA 4AD5A 1ISXA 1BGGA 1E6SM 2VCBA 2HVMA 3UG3A 3AIVA 4PMQA 3SUVA 3VIKA 1Q6CA 2DIJA 4AZBA 6TAAA 1PPIA 4MAZA 1XH2A 3MV01 5A6JA 1JF5A 4B15A 3DYPA 1NOUA 5DFAA 2OSYA 3K4DA 1UH3A 3BMVA 4UQCA 4CUCA 3BVTA 3QOKA 2Y4SA 1V08A 1TG7A 5HBFA 4NRSA 3LXCA 3CHFA 1UYQA 4P8UA 1UD2A 1ITCA 4WLCA 2GJPA 2BFGA 4Z2JA 3NIYA 3W27A 1LQ0A 2J77A 1KTBA 1VENA 4UFHA 3VPLA 4AZHA 4JHOA 1NOWA 4GO8A 1K9TA 1KBBA 3LRKA 1MFUA 4UQEA 3UR7A 2UY5A 4CU8A 3W0KA 3A3HA 1WDRA 1CXHA 3MUIA 3ARPA 2WXDM 3GM8A 2CESA 4CU6A 1QW8A 4HA1A 8CGTA 3BSGA 3W53A 2XGIA 1Q4NX 1B3VA 3A21A 4QCEA 1M7XA 3WDHA 4FNPA 3EYPA 3ARXA 1NWSA 1HP5A 3AROA 3WMCA 1UA7A 2EO7A 3MSDA 1J01A 3QHMA 3ARYA 4V28A 2D73A 3WEMA 3S5YA 4CN6A 1VF8A 1TE1A 2VZOA 1CXFA 2EPMX 4HU8A 5E9AA 4BQ2A 1LF1A 2WMJA 1JAKA 5A2BA 2OLHA 2DSWA 5HNNA 1CGVA 5BXTA 3VMPA 2AMGA 3DHUA 2PI6A 3SCNA 4PN2A 3VIIA 3VDAA 3IJ7A 2RGMA 1F4AA 4CU7A 2AOSA 4D6HA 2OW7A 2W62A 5BXRA 4U31A 2F1AA 3RMEA 2G3JA 4D6IA 2EPOA 4OUEA 1UWRA 3W82A 4AMCA 1EIBA 1D3CA 4GKLA 3AFBA 1C8QA 2D23A 3WL1A 5E09A 4AEFA 4DO5A 1UR2A 1UR0A 4MDOA 4FLSA 2PBGA 4CD7A 2WVTA 3DX4A 1YQ2A 3VIGA 4A3YA 1KCKA 2XVLA 1OBAA 4PMRA 2J7FA 1XSIA 4NF7A 3VIMA 3CZNA 1CXLA 2A3BA 2FDMA 3ZT5A 4NI3A 2V5DA 3WH8A 2QMKA 3ARRA 3TTQA 4QLLA 3QGVA 3N1AA 1V03A 1JZ7A 4Z2IA 1FFQA 4E2OA 1K9FA 1V0NA 3DX0A 1BQCA 1W9PA 3PZQA 2TAAA 1GOOA 3W81A 1KB3A 3WQWA 1E1EA 1V6WA 3BVWA 4AIUA 3BGAA 3SCQA 4MTVA 4B9YA 4AZIA 1TZ7A 3ZOAA 3QR3A 3WQ5A 1E70M 4ACYA 3BSHA 5JUVA 1UH2A 4LGXA 4OZOA 1RD6A 1BF2A 1VRXA 2J62A 2G3IA 1EO5A 2XUCA 3FXYA 1QNOA 3AMDA 3WF2A 3VGHA 2Y8VA 1LG2A 1E4MM 2VRQA 5M17A 3RPMA 5DMYA 2NW0A 1NWRA 2VTFA 4U33A 1QVBA 4ZENA 1UWTA 3AI0A 1JZ8A 3AZTA 3OBAA 3QHOA 1ZBCA 2XVNA 3EBVA 2G3NA 3SCPA 1GVYA 3FY1A 2WSKA 1FP8A 1OINA 3U5YA 4HOWA 3L4VA 3K46A 1JDDA 1C92A 2J78A 3MUY1 1H41A 4WKFA 3ZQ9A 2AAAA 3HG3A 2F61A 4MNLA 4UOJA 3LPFA 4KGLA 3TONA 1QI5A 1B2YA 1UZ4A 3IJ9A 2E8YA 3WH7A 1OT1A 1JZ6A 3K8LA 5KEZA 3FHQA 3VMOA 1GOQA 2MANA 2BY1A 2VR5A 3VSUA 4W88A 3F5JA 4J3SA 2FHBA 1NOFA 1R87A 2FHCA 1W3LA 1QHPA 4DO6A 4AZ5A 5M3WA 2BVTA 3EDFA 1CTNA 1V3IA 3N18A 4XZBA 5FCZA 2O9PA 3GDBA 4D6FA 1L8NA 3WIJA 4TOQA 2WW5A 4JIEA 1IV8A 2JIEA 2WLYA 3WDPP 3MI6A 3HZ3A 2YA0A 3K8MA 2C0HA 3U57A 4KGJA 3CMGA 3BAXA 2DSZA 1XSJA 3DDFA 5CXPA 3WNMA 1GUVA 1WPCA 4P8WA 5A69A 2ZUUA 4CCCA 3S6TA 3H54A 3VOCA 4AW7A 1G01A 1C7SA 1UD3A 4PMVA 1EHAA 3OGRA 3WDQA 3ZJKA 5I3DA 3B9DA 4LYQA 1VB9A 1NM9A 2G8ZA 2VO5A 1XYFA 3FNDA 5D9NA 1XSKA 1QBBA 2WANA 2WKLA 1KBKA 1QNQA 3WNOA 3BAIA 1DWIM 1M01A 2VX5A 3CUGA 2PWFA 4L4PA 3WQ6A 4PBGA 1UQZA 2WBGA 1UKTA 3BLPX 2IXVA 3GXMA 2FH6A 3UCQA 1KFWA 5ABFB 5FIPA 2XWEA 2FGLA 1TMQA 1B9ZA 4KRTA 5FL0A 1X6LA 5C71A 1BG4A 3WQ4A 1W1PA 1JYNA 6CGTA 3OGVA 1E5NA 1C90A 3L4YA 3PZIA 4PMOA 1CZ1A 1GQJA 3IAPA 4E8CA 4GIAA 1E4NA 3MMUA 4C7DA 3CO4A 2J74A 1G1YA 3OLGA 3SCOA 2BY2A 1J18A 1PX8A 2YFOA 3B8SA 5IXEA 5E6YA 1QNRA 3VO0A 1AQMA 3AS1A 3EDEA 3VILA 2BY3A 3BLBA 5BROA 4TVCA 3WQVA 1V3HA 1UWUA 1T0OA 3AIUA 1E3ZA 1IZKA 3SCSA 4W8AA 1OWQA 3D4YA 3BVVA 1Y7VA 1J12A 4IUGA 4HZ8A 3VD5A 1EO7A 4AYSA 4U3AA 4FMVA 1KGWA 4AISA 1E0WA 3ARWA 2VRKA 4Z2LA 3G6LA 1HKIA 4J3VA 2BHZA 2IXUA 4DO4A 1H5VA 5CSUA 1EOKA 2GFTA 1BVZA 3D50A 3WEOA 5A1AA 3GXNA 4UR9A 3UEQA 3ZM8A 5LA1A 3TOPA 1ITXA 1HKJA 3VM5A 1CDGA 1CECA 1JL8A 3WDJA 1VAHA 1MXGA 5A6BA 1DWJM 3HU7A 4QDMA 3W29A 4MPKA 4XX6A 1VFUA 1RP8A 4RE4A 4AD3A 3DECA 2E9MA 4AZCB 2WNWA 1OM0A 1C93A 3EMZA 1V6YA 1DHKA 5I6SA 1XD0A 5I5RA 4J3XA 2PB1A 1EQCA 2QPSA 5CQ1A 4AD1A 1PS3A 1UD8A 1JYXA 1JD9A 3SUUA 2VOTA 2CXGA 1GOMA 3BAJA 3CUJA 1UH4A 1WZMA 3O6AA 3RJYA 4W7VA 4M1RA 1UR9A 1HXKA 2O9RA 3A47A 3CGTA 4CVUA 5JBFA 4BF7A 3S2CA 2WHLA 3D51A 2X09A 1EHNA 3ZR5A 1QWNA 2C8NA 1CXKA 1ZBWA 1B30A 1J10A 2EPKX 3GNRA 3N17A 3CC1A 2GDVA 3OGSA 4HTYA 4PUEA 1DEDA 1E4IA 4YN5A 5F7UA 3T2PA 3WD1A 2BV9A 4CKQA 3RM8A 5ABFA 1UR8A 1KGUA 2J8FA 2YL9A 1KWGA 1BYAA 3VD7A 2WCGA 3AHZA 2D1ZA 4EANA 4B9ZA 1W91A 3VIJA 5EFDA 2CKSA 1H09A 2YBTA 1QOXA 4W8LA 2VUYA 4OGZA 3GBEA 1B90A 3NYDA 2CKRA 4JAWA 1TVPA 2OYMA 2EBNA 1SFSA 1MW2A 7A3HA 2ZUSA 3AJ7A 1JAEA 3UERA 3D3AA 1PJ9A 4W85A 2XVGA 1W9DM 1C91A 1DWFM 1E9LA 1TVNA 3ZJ6A 4WK9A 5E70A 5LA2A 3WMBA 3BUPA 2CEQA 4NXKA 2YLLA 2WWDA 3L4TA 1E6PA 1HN1A 4UNIA 3HG5A 1AQHA 3GXDA 3MANA 1Q6FA 1MQRA 4TUFA 5E1QA 1HJXA 2PWGA 1UG6A 3BH4A 2D2OA 2DT1A 1R33A 4NZCA 4FLOA 3EJPA 5HPOA 2XSBA 3F4VA 1VFOA 1MVYA 4AZ7A 3UESA 1HL8A 1W2VA 4H8HA 2DT2A 3OZOA 1JZ5A 2WB5A 2F7RA 1Q6GA 4CD4A 3NSXA 3CHCA 5BXPA 3WNPA 1DP0A 4PUDA 1QX1A 4X9YA 3FAWA 1L0PA 4GXPA 4NXSA 1KR1A 1VEOA 2ZUWA 1J0ZA 1V0MA 1BPLB 1E6RA 1KCLA 3II1A 5C70A 1GQIA 1QNSA 1K9DA 3MMWA 2D0FA 4AZCA 2F8QA 5CZKA 2EAEA 2J79A 2XIBA 3W25A 2J7DA 1E0XA 2V3DA 4GQRA 4ZEPA 5CPQA 1JYVA 3NDZA 3GZAA 2XN1A 2CBVA 3CHDA 2J7BA 4W89A 4CD8A 4AMWA 3ARZA 5CGMA 2F7PA 2QPUA 3WUFA 1J0YA 1GQLA 2UWFA 1HJQA 3E1F1 3M6DA 5A6LA 4UQ9A 6A3HA 2WVUA 1UD4A 2O9OA 3A4AA 4OOZA 5IFPA 2ZIDA 4TVUA 4FNTA 3AS2A 3WH5A 4NZFA 1H2JA 4P7QA 4C7GA 1GOWA 4NZJA 5BYWA 3SCUA 3LPPA 2EPLX 1CNVA 2DH3A 1GORA 1QBAA 3WSUA 4ZE5A 1E3XA 4UQAA 1M04A 3RO8A 4GPNA 1NQ6A 3M46A 4TVDA 2X2JA 3WUGA 3GH4A 1V3LA 1BYCA 4HZ7A 4AD4A 2W92A 5AYBA 3GNPA 4Z2HA 5I79A 5DO8A 2QV4A 4D6JA 4J3WA 1V0KA 4OBSA 3EDJA 1R7AA 2VI0A 2DT0A 1UKPA 4WIWA 3DX3A 4LYRA 3AXXA 1WKYA 1JXJA 3IAQA 3WN6A 4P7RA 5GPRA 4UFJA 3WMSA 1KR0A 4PYSA 5A6SA 4XUYA 3TTYA 1O6IA 2DSUA 2DSKA 4AD0A 1EA9C 2E0PA 3FHAA 1I75A 3BVUA 4D1IA 3AMCA 2YL8A 5E0CA 1WDSA 3CUFA 1M53A 2YFNA 1WDQA 5EFFA 1PZ3A 3KEHA 4YHEA 3AIRA 1XRVA 2E8ZA 3K8KA 3T09A 3LXBA 1QNPA 1JI1A 3MS8A 3A24A 3IGUA 1CGYA 1ZJAA 3RM9A 1JFXA 4W87A 2WCSA 1VFMA 4N42A 4AWEA 4J3UA 3VDCA 3BAWA 1B1YA 1TA3A 3CZJA 3WUEA 1FHDA 1MW3A 4Q7NA 5JIPA 4GZEA 3LPOA 2YIHA 3PN8A 4RE2A 1Q6EA 3GH5A 2WVVB 2GK1B 3BCFA 3EJSA 1TQUA 1QI4A 9CGTA 5CSYA 3EJRA 4DWSA 4M81A 3VD4A 2WSPA 1HIZA 3M07A 1GVIA 1UKQA 1BHGA 2YA2A 1NWTA 2JE8A 4B3LA 2YDQA 4FF5A 1EDQA 3POCA 4NSBA 2J47A 3TTSA 1HVQA 2Q8XA 1HP4A 4H8VA 1V3JA 3WBEA 2W63A 4EAMA 8A3HA 2HISA 4A3HA 3EDKA 1E71M 2G3MA 2NT1A 2CPUA 1CGXA 2Y2WA 3WENA 2BY0A 3CZKA 3OB8A 4CN1A 4HMDA 1BAGA 3VGFA 2BVDA 3K4AA 1M03A 4HP5A 1O7DC 1PAMA 4MB5A 2PWHA 2XM1A 4ATDA 1GJUA 2X0YA 2X2IA 4R5EA 2XVKA
chains in the Genus database with same CATH superfamily
4J3OH 2XN2A 4GYBA 2KERA 5INDA 1A50A 4GO6B 3SUWA 4NCC1 5D05A 1HJWA 1TZOA 3OMZA 4GW4A 4Q56A 3KL3A 2PYEB 4GAAA 3DXIA 1BQKA 4MB3A 5G1MA 1ERNA 1B31A 4F92B 5XINA 4R7NA 4N0CC 2NX9A 1KYFA 5HHOB 3I10A 1W1VA 4DKDC 1MHEA 2Y24A 3B7YA 3PUOA 2JWYA 3FQRA 3H2NA 3NFUA 3KXQA 1L4IA 5EGRA 2EPNA 2X9ZA 2ZOKA 3RNKB 2YXGA 1WAAA 1QSEA 1CLXA 3VM7A 3MJ8B 5IGXH 4ZMTA 5I76A 5KTEL 1FKXA 1LROA 3PDGA 1YUHB 1HINH 1HKLL 5FF4A 3DURB 5ICUA 3MNWB 4ETQA 3O3UN 2VLJD 5ACLA 2OMVB 5DSCB 4JJOA 3LN9A 4F5CE 3SR7A 1DHPA 3CMJA 1GZJA 2P5NA 2AFNA 1IJNA 3L48A 1MLCA 4EI5B 1IZJA 3WF1A 3SBWC 5FI8A 4AJYV 4OECA 2DL2A 4NZDA 4ETYA 4MDJA 2X88A 1UASA 3MRJB 1W6WA 3KVQA 3KLHD 1V7ML 4PLKD 3R0KA 4RFNB 1ODZA 4HQQL 4HIXL 4AY8A 2E46A 2NXGA 4UINH 1E6QM 5FOOA 1NF0A 2AJZB 2NZ9C 4V1DE 2W65B 3H8NA 1J88A 4XMZA 2LLGA 4WI4A 2F08A 2YXFA 1YEJH 3HG0A 4ATWA 3CU7A 2E67A 1U42A 5A6MA 4PJXA 4KDWA 4OGAC 2BGQA 4KROD 4KKPA 5C07E 3GWQA 1HDMB 2FYYB 3N1MC 2W5FA 2UZIL 1P7QD 5EFIB 3O8XB 2QHRH 2Z31D 4R4BA 3K2KA 3K13A 2DQHL 1U5VA 4XNYH 1S8DA 4I3GA 1TMHA 5FYLH 3OO2A 3NCJL 1TIMA 2YCIX 1U8MA 1IO4C 3HRZB 1V77A 5AY7A 4Z7NB 1H1YA 5DJ2A 2NY0B 2PDKA 1S7QA 3IWUA 4DHLA 5DRIA 3DIFB 2OWXA 3UWYA 2NQ9A 1XH3B 3UTQB 3W38A 4HFUH 3NQMA 1I1YA 3BZFB 2VDLL 1REQB 5EZOH 1S7XB 5I16B 4KCTA 1A7QH 1GC1L 3SCWA 1MRDL 1CVSC 1VEPA 3BG3A 1BJMA 3GKZA 4JFQB 4KMTL 1NEYA 3O4LD 5E4IA 3PGCA 2W66A 1OB0A 2EIDA 3IRSA 5BCAA 5T3XH 3UBXA 1DVZA 1EFXD 3ZTEA 5K39A 1NMBL 2ZSWA 3OAYH 4N2FA 5F9WB 3FOMB 1TTGA 3D39B 2WXPA 1GPOH 1XH1A 2P53A 4O1AA 2HX8A 3MRRB 4JQAA 2HTLC 4LDEB 5K5YA 4X6FB 4OCXL 4AV0A 5IQMA 3AOFA 4AGOA 4HS3B 4NKDA 4K7FB 1UOKA 4Z23A 4LRNL 1QI2A 3H7BB 2ZCLL 3N1QC 4NKOA 4FXGC 1DE6A 5FM8A 4ASTA 5K9JH 3RAOA 3AU2A 2P24A 2E7CA 4FFTA 4DJFA 3GIVA 2XOTA 2AI0H 1QJWA 3UTSB 1MJ7H 3PM6A 2CJUH 5ITFA 4PJGA 3MLUL 4BGDA 1RA5A 1T83C 5B1AB 3VFWB 1UWGH 2XFYA 5AZ2L 4D6CA 3N85L 2CDEA 1RERA 2BCKA 1PZ5B 4R90H 4U1NA 4NNBA 1RK1A 2HS6A 1PWMA 2Z1XA 4L4VE 3ESUF 1T0MA 4K36A 4A2MA 3BW2A 3CLEL 4Z08A 5LA0A 1IEVA 2XU9A 43C9B 3BXWA 1J5CA 2B31A 3MRFA 3MJ9A 3MA7B 1R3TA 1VHCA 5GGUA 1MG2C 1UADC 5A8MA 2E6AA 4TMCA 3BDYH 1CYWA 4GIEA 5KW9H 1TZIB 4HJGA 1M6OA 3RM4A 1WDPA 2G5WA 4FA3A 1MRCL 4Q52A 5HANA 3RWGB 2N0KA 3TVMC 4XK2A 2H2SC 3WFLA 3ZE0F 4KI5E 1ONRA 4AGPA 3OXSA 3WO4C 2HT4C 2JXMA 3LQGA 5EPDA 1OT4A 4AL8C 1VFFA 2MH4A 3FFOA 3SUSA 1RD5A 4GIOA 3B8TA 2IKJA 2FECI 3STBA 1FG9C 2WYSA 1ECEA 2PS2A 3KS6A 4OGQC 1UACL 1K72A 4M7ZC 4J1UB 3PB2A 2MSPA 5DJ0A 4FXJA 4UMAA 2GC4C 1MH5A 3PJTA 1CBVL 4IQLA 1Y5XA 4E41B 1HKMA 3SECA 5D7KD 3GU9A 4EO5A 1DN0B 1OD0A 1MCLA 3CHOA 2QJNA 1IM3A 1HHIA 2B16A 3CZUB 4UUJB 4YDJA 3TM6A 4U4BA 5K3VA 1SZNA 2FEEL 3REWA 1OWRM 2GBVA 4QRSB 2V9DA 4K7PL 1QFWH 1FFNB 4MLIA 3BT2H 4Y7OC 2HXAA 4ENZA 1MFCL 1IKFH 1Y0LA 4X4XB 1F56A 3N12A 4A3QA 3EFDH 4RLIA 3ME0A 2AV1A 2A6KA 4APQB 4FB7A 5IFTA 4O58H 2PF0A 4QYAA 4IRJC 4QHUB 3U6XS 3RDKA 5D2VA 2GJRA 5LNSA 4F2BA 4A8IA 4TQEL 2HXUA 3OJGA 4LOUC 3OR6A 4Z1PA 2CDGA 5I6XC 1PU0A 1XD1A 1KIPB 1TO4A 2BXYA 1BF6A 1A4JB 4JRWA 3HHSA 3TEUA 4Y16D 3K6DA 1A0EA 3SUTA 2K7QA 4JTDA 4Q6JA 5EU4A 1ZSDB 4HXBH 4EUPB 2WHMA 4LGPB 2O92A 1Q6QA 3RWDB 4EKXA 5GZOA 3J8F7 4BFFA 4A3UA 3VVGA 1LK3H 3TNNB 4JS7A 1H49A 1L5GB 5H37G 4XN8A 1E6OH 1OTSC 4BCXA 1T40A 3W07A 1E7UA 3PBYA 2AERT 3OGOE 5BV7B 5L4MA 4R34A 4FJZA 4DEPB 2AXFA 2INZA 3UTPE 2YGVA 4MD4A 4YTQA 5H2BA 5CLYA 5LLIC 2R1MA 5CBIA 4YS4A 4N0FA 4S2SA 4NPYA 3GZOA 3UBGA 1F11B 4QG8A 4F15B 1EX1A 2VD9A 5IT2H 1KV7A 2VT0A 3JTTA 3F5WB 1JCNA 3LOTA 3GTIA 2JJUA 1AQ0A 2E47A 2VW6A 4OE7A 1T04A 3A22A 3KH3A 1CE1L 1VLIA 3CFKA 4FFWC 3PAYA 3G5XB 2BC4B 2D20A 4FCAA 1BQLL 1YNTF 1ISWA 1XIMA 2IS7A 4M7SA 5C5YA 1MQ8A 1GCYA 4LSDA 4W4NA 4X4ME 1I9RL 3ULUF 3TJHD 5AHMA 4NEHB 1O95A 1IU1A 3VWJC 3IGHX 4HA4A 5KS9A 3A12A 3W0WE 4IISA 4ZUTB 3NO5A 5LYRA 5KJRH 1MXDA 2W61A 5C09E 2DQEL 3ZZ1A 4XP1L 4YTTA 5FJJA 2X44D 3W24A 3CK0L 5DTFA 2EXTA 4L3EE 1V7NH 4K0OA 1ZGLP 3PHAA 2JLPA 5C0EA 3PZVA 5F1IB 5KYXB 1PDZA 3N6YA 4P4KB 1LRQA 2AAVA 4E9YA 3V5FA 4YHYC 4CJ0A 2EADA 4H44C 1HL9A 1OPGH 2NUXA 3QDGE 5AEAA 1EUUA 4MMYA 4C6KA 3NIGB 2OP4H 4HH9B 4K5LA 3STLB 3HNVH 4PULA 4NZRH 4DWSB 4GZJA 1TKWB 3UT0A 2NQJA 1CI1A 5HD8C 2OYPA 1BYDA 2R1YA 4F79A 1P4UA 1R3IH 1CU4H 2NX3A 4AZBA 1VYRA 1XH2A 4JPKL 2GHWB 4B15A 2JKWA 3WUWA 2OSYA 3BVJA 2Y4SA 2VFGA 3HQ1A 3M1CA 1J2WA 2C1PA 1GW0A 1U4FA 3RU8L 4PL2A 3V5DA 2VMDA 5EEWA 4N5ED 4F0HA 1P84K 5I15L 3SADA 4OLXH 5JHBA 3SKJH 1SN5A 3UPRB 2Y62A 2QSQA 1KFJA 1M7XA 1D6VH 4W9HC 4LKXB 3H7RA 1NFKA 5BOOA 4MRBA 3EYPA 5IOPB 4ZUVA 1BEYL 1UA7A 3W7KA 1Q0XH 2QPXA 1IGIH 3U6RB 4GXUN 4GAJH 1LO3L 4JTSA 1OGTA 2JJVA 2BNRA 4LS0A 3ISWA 2R69H 2DVUA 2P80D 3HBGA 1U8IA 4LUJA 4YNYA 2OZNA 4IF2A 3KPQA 2RAMA 3V4VA 2PP7A 2RGMA 1MFEL 1J8VA 4G5DA 4CU7A 2OW7A 4EXBA 1CFNB 3SRKA 2CLKA 3T4WA 3S4SB 3RWCA 4BH8A 1FXQA 3WEBA 5FDWA 3ZKXC 1B3IA 4XHJC 1FYTD 5I2IA 3DUUA 3UNTA 3PWGA 3ABGA 3WL9B 1X9RA 3RX9A 2QT6A 4XO9A 2NNXA 1O7SA 1UR0A 1RU9L 3COTA 5A7BA 3RVTD 2J7FA 1ADWA 4GGHA 1ROCA 2NNAA 3I85A 1AZVA 2OCCB 5FF3A 2VL5B 5I73B 2YMTA 4PRHA 1YEHH 4QHKJ 4X5LA 3B0VC 1SJHA 4R5XA 3DV6A 3T1WA 1U5HA 2O6PA 3GSVA 4R7DB 1VFLA 4QROA 5JOFA 3ZOAA 1XBRA 4O4WA 2FWOB 4E38A 1AKJA 4KRZA 4OJFH 2Y8VA 2V5MA 3ILEA 3EUUA 4OZ4A 2FJUB 4G7SB 3QIUC 4PJIA 4LCVA 3AI0A 2QDEA 4ODBD 1PZSA 1LO0H 4EAYA 4K71C 4WGHA 4HOWA 3L4VA 3HPSA 4BRJA 3DVGA 2V8MA 4GI4A 2J88H 2R23B 5HVHB 1GY1A 4JDVB 1DCLA 4IIZA 3UYRL 1NAMB 4Z7OB 2A73B 2DTSA 2FBOJ 5JQ9A 3KYNB 3KLQA 4EXAA 4DZHA 1W3LA 2GAZB 2BVTA 3EHBD 1Z3RA 1HYSD 2OR8A 4GJJA 1LEGA 1SJVA 2WXGA 2C7UB 3DSFL 4LL4A 1CWVA 2GGEA 2JIEA 1G7IB 3HZ3A 5DA0B 1XCFA 3C2FA 2VLRA 3K8MA 3U57A 1TLMA 2Y2TA 4PIRF 4JK0D 3VE0B 1CI5A 5GHWH 3BWUC 5EF0A 1T8XA 5IMMA 5IBLD 5EEYA 3M4HA 1TWDA 4KUCD 4LVHB 1NM9A 2ACRA 2OMWB 4AC2A 4EDWL 3JV4B 4PRAA 3UTOA 2J9ZA 2ATMA 3L3KA 1DWIM 5CJNA 1MJUL 2PLMA 2CALA 1WZ1H 3W39A 3BDKA 4ACTA 2EDBA 5FL0A 4R4FH 1UC4A 4UTMA 3KCLA 4JKWA 1S5IL 1J4EA 3PZIA 2F19L 4CKVX 1CZ8L 1ADQH 1XGRA 5K9DA 3T4AA 4PGDB 3CZFB 2BY2A 1ZFJA 4E6MA 4PJAB 1D7BA 2H41A 5H35B 2J1ZA 4ELDA 3TC9A 4FQXA 2ADGA 1IZKA 1R3RA 1J12A 4AQOA 4TL4A 4WXYA 4GUPB 4H2AA 2ZBTA 4AISA 3EWZA 1OCBA 4RAUB 1NCIA 4XMUA 3QXAB 3VQMA 4Z3IA 3PWVA 4KK6D 4ONOA 2V7NA 4O4VA 1YECL 5KVFL 4E68A 3ZYJA 1TKKA 5D2LB 2B0SL 1K7XA 1MXGA 3MV8A 1KXTB 5AVVB 4QDMA 3FCBA 1O66A 4WCYH 5ADOH 3L9CA 3EGSB 4JFEB 1A6PA 5DHVA 2XACC 3ES6B 5I6SA 2ZC8A 1EIXA 5AOZA 4G6KH 4LB8A 3RWEA 4AMKH 3BAJA 4KV5E 5D1XD 1UR9A 3CGTA 1RSYA 4ZSOE 5LHEA 3RWFA 3WKPA 3IJEA 4IMFA 3F7YB 4MJ5B 4EI6B 2X0VA 4MF4A 4WEUD 3N17A 1PNCA 3N44F 4KK5C 1DEDA 4HSQA 1VBJA 1YMHA 1XF3A 4CL7A 1KTNA 1F18A 3QEHB 3D3VA 4AC7C 1INQA 4AGNA 3P80A 1F3RB 2D1ZA 1W91A 4MNQA 1E5UI 3FONB 2VUYA 4BQCA 4FZEH 4Z7UB 1MAKA 4PV9A 4J3OG 1KCSL 3QKZA 3AJ7A 4LPVA 5AW0B 1IEWA 5I74C 5ESQA 2A6DA 2J6EL 3JQOB 3S5OA 3FYOA 2WJ7A 2G96A 3BXNB 4NO3B 2FJGB 1AE6L 4DETA 4Z0XA 1J5IA 4Y9MA 1H15A 5F9JB 5IB5A 5DC4B 4G7YL 3OR7B 1Q6FA 5E1QA 3O3RA 1P5BA 4NENA 4HCRA 4NQCD 1KGCD 1S7TA 1A1MA 4H8HA 2A0LC 1HKVA 3QQWA 5F8RC 3S2LA 1OW0C 1VEOA 5L8LB 1BPLB 5J0BA 1EB3A 4N3TA 4PUNA 4XH2B 3TPUB 2RQEA 1HQRB 1I2NA 1F8TL 1JYVA 1B0GB 2V5SA 4LHJB 5E5LA 3TVMB 3RPIB 5E8DH 4RIRA 2DLHA 3WO4B 1RZJL 3C8KA 1AQFA 3OVRA 3OQRA 6A3HA 1UD4A 4B97A 5DD6A 1RZFL 3VOFA 2R2HA 1FL3A 4M7ZB 3UAJC 5G1TA 5BOEA 1M04A 1TJIL 2X2JA 1QSFD 5IF0A 1UP3A 1U0QA 4QCIA 3BVDB 3B2UD 4MVAA 4UXDA 2VGBA 4ZQKB 2CRYA 5A6SA 3TTYA 1DZBA 3WLJA 1ZT7B 4XVJL 3W2DL 4ZMZA 4AD0A 2R8SH 4KZEH 1VCGA 3ZTJH 4GBUA 3K5SA 1ZWIA 3FYIB 3LXBA 5GS1C 3QHTC 1JI1A 3T81A 1QW7A 3B1TA 1VLXA 1MHCB 1TRDA 2EIJB 5EB9A 4YXKL 2XU2A 1R2TA 5HDWA 4AV5A 5DD5L 5FAGA 3NN8B 1NIEA 2E5BA 2JCWA 3GO1L 3PUEA 2DBLH 2XN9A 4JEGB 5ACMA 2UWEB 4B0MM 3SJVA 4GLEA 4IRJB 1EDQA 5LXGH 7ENLA 4Y1TA 4WI8A 3TJPA 3TAOA 3S35H 2CKNA 1PZUB 5KSBF 4JFXB 1K5NB 3EDKA 3E6FA 5I6LA 3QNYA 3WENA 3LKQA 3GSNB 2L7JA 4OCYL 4Z5RA 1INEL 2XVKA 3FSWA 4GLRH 2QIIA 1VQTA 2V17L 4QY8B 2N7BA 4REQA 1BQRA 5CHNA 2FGWH 3MCLH 1QSVA 5FKPA 3BUTA 4DF0A 2TPSA 4F8PA 3B8WA 1OIFA 2IAND 3RDTD 4OD2B 1UWXK 2GQ9A 3HB3D 1I4FA 2VEMA 4FC3E 1UJ3A 1GS7A 2HP4A 3FU5A 1AIFB 4MJ4A 1EC9A 4Y4KC 1A7RH 1YYCA 3C9NB 4HUCA 5L8KB 4OD1H 5AVYB 4JE0A 3APGA 5D7LB 2ZNWA 2YAOA 4V2BA 1D7DA 3LVEA 4TLSA 5B39G 3KVPA 2BVQB 4XP6L 2PR4L 4NOBA 3B05A 4ZO8A 1CXEA 3H6AA 3ZL4H 1KLYA 4KFOA 2EUZA 1G0CA 4KH2A 2ZG2A 4NYUA 4ADIA 4XMPH 3X3GH 1ZJHA 2ZUNA 2BM3A 4JX6A 4AM0Q 2KQMA 3W88A 2NQHA 3EJUA 4D6EA 1W72H 1W9XA 4KJPD 1FAKT 1IC1A 4DUOA 1YJDC 4XOCA 5CP3H 1AHKA 2W88A 2XC8A 4KXDA 1H6UA 4QTIH 2OJPA 3OHMB 3M17B 4ZCWA 3RA7H 4LAMA 4QGCA 4RQQA 3MRBB 3FT2A 4Q4EA 2GEEA 2AJVH 4Q0XH 4O0KA 1AD9B 2TSBA 2EDHA 3PS6A 1WFOA 3WJYA 3VWJB 2WMGA 3AAZA 4PM1A 3KYAA 2H32H 3SPCA 4LE8A 1PTDA 1HS6A 3TN0D 2RACA 1S1RA 4K3EH 1SDYA 1NSJA 3SE4C 3CV7A 5J6SA 4G6AD 2QCGA 2PW1B 4WJ5B 4A68A 3QJFA 4U3SA 3L17A 1THAA 3LGEA 1Q0YH 1B3OA 4HYTB 1QWGA 2DWEB 3LQAH 4LUSB 3WLBA 3Q01A 2QDVA 3MR9B 3GW3A 4AWSA 3ZBMA 2PW2B 3BHBA 4ZOEA 2UZXA 3O3DB 1AGFB 2VQUA 4B3KA 2X2YA 4ZMXA 4PRBA 3GNNA 4QM1A 4DJEC 1IEIA 3S6CA 3T1FA 2BRRH 4Z2GA 1EXBA 4PJHA 5CAHA 5C0DA 4WY7H 5JBEA 5EV7A 5E1AB 4RW5A 5JORA 4HK7A 2P76A 1WBJA 1UCBH 3ZL2A 4KQ4L 2DYSB 4ZNEA 3CFEB 2FLBT 3MUAA 1N6QL 3VI2A 4M7KL 2WZPA 4H6QA 1YYMH 1W3JA 3NTCL 3P30H 4KPLA 1HJSA 4HSAC 5T8IA 3B4UA 1NGPH 2C9QA 2IIJA 4LK4A 3UD6A 1A53A 2XG5B 4BE5A 1I8IB 4HHHA 4EUPH 4ELKA 3HUJB 2AJUH 4R7OA 2NTSP 4NCC2 4YTRA 1UB5B 4OCMC 4PRHD 2ENSA 2HRLA 1QLFB 4B3VA 1QBLH 3OV6A 1YC7A 2NY2D 4L4LA 4AKQA 1W8NA 1GOKA 3NAAH 4APXB 2G5UA 2G2RB 2WD0A 5C9JB 4GP5B 3BUQA 4F1ZA 3WK0A 4NDMA 3FC8A 3PAZA 3VD0A 2RBLA 4OJYA 5BV7H 1AKJD 1WBYB 4FI8A 5ID1A 2CKBB 2J75A 1B4LA 2CO7B 2Z6IA 3Q1EA 3ZKXB 1PLGL 3QI9D 4BQ5A 4QS6A 3A6OA 3TCEA 1PUDA 1NIAA 1E72M 1DIEA 3EOBA 3GJFK 2G95A 1G6RA 1V6TA 5J6HA 4WU7A 5JUEH 1LK2B 4P2OC 4TULL 1EEPA 4YPJA 1U1JA 3MRHB 1QD0A 2XHYA 4NZUH 2AKRA 1J9SA 4JL2A 3M0JA 3QBUA 3CTTA 5LN8A 3HAEH 5INCA 3NCEB 1ZP4A 2RFGA 2XH2A 4KXAA 1ME7A 1BXUA 4NUMA 2Z29A 3QMRA 1P7TB 4E4UA 3REVB 3ZDXE 4MWAC 4MNMA 5CD5D 1Z5HA 1CFMA 4Q4MA 3IJLA 4DAGH 3GMNB 3JV6B 5CIPA 1D5RA 2Q76A 3L5WA 4P3CH 2IQ9L 3MUXA 1NCBH 3CXHK 4ODUB 4K71B 2NY4D 2GK0B 2F1BA 3ALXA 3ABKB 3REQB 5D72H 4L1DA 1DQDL 4KI1A 2DPEA 2QJIA 5CPSA 3LS5H 1IC4H 2ICWI 2OR7A 1JWMB 1BEXA 2VW4A 5F1NB 2HNHA 1QEWB 5ICXA 1A66A 2QAFA 4G6MH 2ODIA 2FX9L 3VOGA 2EKJA 2MQGA 1JGUH 3NK3A 4RAVA 4FQXD 1EUTA 3I74A 3P0YH 1M7UA 3ETBJ 1KUMA 1TVHA 2CE6A 4ZB0A 4B2DA 5J8OA 4H4NA 1Q9WA 2CM5A 4YGAB 3W1PA 3W7QA 1SY6A 3N4EA 5T1DL 1QG3A 3KLAA 3B8YA 4HOMA 3SQBB 4MLSA 1NFDF 4YHGA 1ZAIA 5CCKL 3EOEA 1FH8A 2F53B 3N04A 4XAKD 1HOCB 4WRLA 5CSZB 3W7RA 3VXRB 4URIA 5EMYA 3WNLA 1NLDL 1A6AB 4CAGA 1OL0A 1JZGA 4LLQA 1NP2A 2DI9A 4G11A 4HJ0C 3UWWA 4S0HA 5FL1A 3GG8A 1A4BA 1X5FA 2WZ6A 1TPH1 5D7JC 3GMPB 3LOWA 2DUAA 4WQ6A 1BZ9A 5A8QA 1MSPA 2XN0A 5HDRA 3KVJA 3QW9A 3RHGA 3CFJB 2X7VA 3ZDYB 3B9VA 4LIQH 3ESNA 2Y8UA 3DWTA 1EV2E 1NDMB 4WKZA 5CFHA 3QB7C 1AVAA 4J2QA 3SZ6A 4NNAA 4M1CC 1XIDA 1KPUB 1KA9F 3CZGA 4M29A 4N2YA 1G0YR 3JTBA 4XVSL 5AOIA 1UWAA 3G0UA 2Z1KA 1PNDA 4OHQA 4FOKA 1GS8A 3ML8A 4X98A 1UOWA 5LXEA 4POYA 4BHUA 5CCZA 4O10A 2ZKXA 1HAWA 4O18A 3BLEA 4QHLB 5H94B 2OSWA 1XGQA 1MQQA 4LUYA 4IL2A 4H41A 2YAHA 35C8L 2FMOA 5FFLA 3V7AG 2V67A 4KY1H 2DQCL 4IH3A 2VDOB 2VQTA 1MW1A 3GKWH 1JERA 3IDIA 5DUMH 3THCA 3FUFA 3JR2A 4MA8L 4E5XG 5GISL 4FE9A 3QJSB 4G3YL 3TEXA 4UV7L 4S38A 4W6YB 1P7KB 1F7BA 3ATEA 3VMNA 2GJXB 3SDDC 3L5JA 2XQBH 1OTUC 3JSSA 3ZKND 3OM3B 4QYOB 2WJFA 2Y7OA 1KB9K 4EVNB 1PZAA 5IM7B 1E40A 2NYYD 1OAYL 2EVFA 3HN3A 4NQXA 1XW8A 4AQ1C 3MRKA 2FH8A 1EVUA 1EGJH 4QDGA 4DP7X 5CNHA 5DT7A 4GMSH 2XKNA 1VZHA 5I1GH 5KZCD 1QYGL 2BPBA 2BASA 2I27N 3O6FC 1HVXA 1XGTB 4OZFA 3BLDA 4JPVL 2ALDA 3VW3H 5M2FX 4KTYA 4S39A 2VXNA 1IXPA 3G04B 3FHEA 1J93A 3RVWC 4GYPA 2WC7A 4WEBH 4TV6A 4GNJA 2DMCA 4ZW3A 1G9NC 4KKLD 3UR8A 2XN9D 1VRDA 3O4OC 5FR3A 2FK9A 2WMPA 1KEGH 3WN5A 1OCWH 1XKYA 4RZ5A 1ONEA 3WLIA 1S9YB 4N22A 1K1DA 3WMPA 5KSVB 4H1LH 3CXOA 1JI2A 2YUVA 5AW4B 3AQUA 4H88H 4XWUA 3O4LE 1KCXA 3VFOA 3INPA 3BP6A 2YCKX 4FJYA 4L0ZA 3B83A 2C34A 1F76A 2DL9A 2CJ3A 3GSOA 4E9WA 2YCLA 1JK9B 4XTDA 2GBUA 1UH3A 1Z9SA 5EA0L 2X1UA 1ES0B 3P4OB 3CHFA 4WLCA 3TA4D 1AGDA 2I9UA 3ECUA 3LD8C 5LVEA 2J8UA 4RMQA 3SDCD 1ICTA 3E2HB 4GO8A 1K9TA 5MEOB 1Q38A 2UY7B 2V7HA 3R89A 1OCJA 1E2WA 5L4FA 2BVOA 4WO4A 3W53A 2PURA 4QCEA 4JRXA 3WDHA 4FNPA 2X3CA 4LUTB 1QTWA 1NICA 4JVWA 1J01A 3OQ8A 3ARYA 3MZTA 5IQ7H 1UP2A 3V6OC 5KYYB 2DI7A 5E6ID 4ZTOH 4LMQE 2D03H 4OTKA 3N73A 3CWHA 2YBRB 5JIKA 2MEJB 4RMRA 4AIXA 3PU7A 3SCNA 5BXFB 2A85A 4FDWA 1YEFH 1I8JA 3TFKC 5JXEA 1ZSXA 3UOAB 3AFBA 4IOSD 3WL1A 2OAAA 3NZ8A 4AEFA 4NN6C 4J12A 4Y4KB 2O7QA 4JTUA 1OBAA 5DD3H 5DRWA 2PTWA 2EDOA 4A8LA 4HAFA 1K9FA 4YCOA 3W2LA 1X98A 1XIIA 2AQRA 4PJDA 2QW5A 3H9SB 3TT1L 3CUXA 1Y07A 1WFUA 3WK3A 5CD3B 2JJSC 3PDDA 4KAQH 1JV5B 5CZVL 1A80A 1J5SA 3UC0H 4DVRH 1Z7AA 3UPMA 2OT0A 4TMPA 1QPQA 4LGXA 4PJEA 4XPFH 5D2NA 5HHQB 1S78C 1ZLSL 3BURA 1A3LH 1XTMA 1JUBA 3BDBA 3O2WL 1JVKA 2CK2A 4IRSA 1PMYA 4RR4A 1YYLH 2PF6A 4AL8H 4E0RB 4TPRL 1EAQA 5EPMA 2F61A 3LPFA 1OP3H 4L5ZA 3IJ9A 5D7KE 2WLIB 4NQEA 2XDFA 4XD5A 1JF1B 2WLHA 5LNEA 3R1GL 3CX5K 4JTQA 1CF1A 4N2OA 3EO9H 3PP3H 3IFNH 4HPYH 1V3IA 3AAMA 3N18A 1TTRA 4OF7A 1NCHA 1X5MA 4JIEA 3RI5K 1AGBB 1V51A 4OFKA 3TBWA 2P5EA 3DRQA 4X7SH 3CV1A 4XP9L 1FG2B 4NJ9H 1VP5A 1MCPL 3G1YA 2WOBA 3N5AA 3BUVA 4CDGC 3PABB 3VNMA 4WY0B 4IKLA 4Y2DC 2F8OA 1U3JA 1X5AA 1ZGLA 1IR2A 1XYFA 4FLHA 4BJLA 4HZLA 2EUVA 1A5KC 5IVNA 1P4IL 5F7DA 4AVJA 3OPSA 3CUGA 1S5NA 3BLPX 2N01B 2XQYG 5EUOB 4TNWF 4IIFA 3WQ4A 1F4WH 2J6XA 2XZ9A 1S4IA 3U83A 4F58H 3LZOA 5I1DA 4K5MA 4MA3B 3MUUA 5B1KA 1J9QA 3KPOB 3QT2A 5DJCA 2YWZA 4HNUA 1TCRA 1MIEL 3MJ6A 2X9YA 1M7DB 3GSNH 4YUEH 2LFEA 3BVVA 1QZ1A 4JREC 3EX6A 1RK6A 3NZHH 1NGZA 3MNDA 2AEQL 1QKZH 4JO1L 4OM0H 5LBVA 4DTGH 3U4KA 4F8QA 4BSJA 3B0XA 2GSEA 3IMWA 2A7BA 3CN1A 1I1RA 1ZDQA 1WWWX 1EHXA 4NB7A 3VTAA 3I6SA 4TSCH 3DPBA 2C4FT 1QBMH 4QXTA 2GI0A 5JPNB 3CCHB 4IK7A 1Z89A 4IBWA 4KQNA 1HWGB 1YHPA 4AD1A 5FF0A 4X5RA 1E5AA 2OQLA 4E9TA 2D7PA 5U7SA 1KENH 4MJ6A 3QBTB 2DMKA 1OZTG 2R4SH 3E80A 3S2CA 4ERAA 4H2HA 3G1VA 2A38A 3OKMA 1UZGA 1S2CA 2X09A 1CXKA 1AZ1A 4PRPE 5I8KH 4X7CC 5AVNA 1CICA 5DVNA 4AQEB 4PU2A 3RM8A 4Y1AA 4P2OB 5LGHL 3NYZA 1PFOA 3CN0A 3VD7A 3V9FA 3ZDZE 4KZDL 5EFDA 1QLEB 1AS7A 5J06A 1MW2A 4CCZA 4Q3MA 1MJ8H 1K3ZA 2VJ8A 4N2HA 3NZGA 3NL3A 4PJ8B 2HS8A 3EYUL 4MWAB 1WKFA 4N1EA 3BJTA 3LRSB 1MQRA 3SZKC 3O9WB 4UQ2A 5EEUA 3KBVA 5D5MF 3DJSA 2OPCA 4H6EA 4QRPE 1BWKA 2LT9A 4FQ2H 1ROWA 1UCWA 4QF1A 3M5XA 4NQQA 3OZKA 2AJSH 1E6RA 3MMWA 3OZLA 2NUWA 4QBXA 4C65A 1K8XA 4YDKL 1OYBA 3L5XL 1EBAA 3L0NA 1G7MA 3ARZA 4PWJA 1EUNA 3RBGA 1ZD6A 4XVTL 3TFCA 2BX5A 3ARGC 4JY8A 3MREA 1YPZF 3MO1B 5MENB 1F00I 1HJQA 3ONCA 4OOZA 4DEUA 1R3WA 2HVNA 1W3NA 5REQA 4GQBA 2I24N 3AS2A 1SFTA 3FCUB 2AZUA 3SFKA 3ET9F 4J5VA 3RO8A 1MDTA 5FM4A 3TZVD 3INUH 4FQPA 1LE5B 4WZHA 2NYKA 3F7PC 4OLWL 2VZ3A 1BD2B 3WS3A 5KSAA 5A3IC 4D0DA 3ZRSA 1US0A 4OBSA 4LBUA 3HMWL 3NABH 4J4KA 1XLEA 2Z6JA 4LYRA 2DVXA 4KJWC 3WMSA 1HH6A 3QJQB 5DEFA 4IGBA 1XF4A 4OI8A 1RK7A 2VMEA 2QFPA 3QYQA 3MBDA 3Q3GA 3BP5B 3C86A 4NNYA 3ZLFA 4GXVL 5A2KH 1DYSA 5SWZA 3P40A 3IIVA 4UIOA 3NBNA 1NJ9A 4QX4A 2I25N 1RMFL 5M1TA 1W72B 3GKFA 2F58H 1SU5A 1MNNA 1AZCA 4JG1L 2WM1A 1KBPA 3V9EA 1G7HB 2GUOA 1FYTE 2EDNA 3QZBA 4U7MA 5KBDA 4GUOA 3SO7A 1HP4A 4JXCA 2MQCA 1JPSL 4FXLA 1GH7A 2DQFA 3N50A 4Z3TA 3T4YB 4LAQH 2CKBH 3WAKA 1Q9LA 3CZKA 4CN1A 2H32B 5E03A 1JNLH 2ZDRA 4GG6A 1CR9H 2OMBA 4QR6A 3ALGA 4MCZB 4UWQB 5I9QB 3WTXA 4PRWA 1YDPA 3TTOA 4ECLA 2J7CA 3GS0A 3EZJB 4W7WA 1MY5A 4YQXL 4PP2A 1ZAGA 2C1OA 4X6DA 1CURA 3W9DB 5K9OB 4PUUA 4MB4A 2J24A 2QJHA 1HQ4A 2BIIA 4W9TA 2ZXAA 4EUPG 1BLNA 4P5KB 4MLRA 3QO0A 3KPLB 1ZK9A 1RUQH 4IMGA 4ABVA 1GGIL 1B3YA 3AADB 5J6GB 5FHBH 2QCCA 1EJ7L 1EXUB 2MNWA 1M6JA 2DT3A 4ZMPA 1RP9A 3QFWA 5HMDA 1HNYA 5K33A 3WLHA 7CGTA 2UXGA 1EYEA 3SDDB 1GYUA 1PLAA 2OBGA 3FYEB 4OZIF 2RJMA 3K7UA 1QATA 5DQ9A 4UQBA 3NIDB 1D6EB 3CXDH 1BFOA 2FZ3B 3NO1A 4OLVH 4Y2OB 5JHLL 2Q7YB 1BQUA 2VM9A 1KIQA 2PCEA 1T6BX 3G5ZB 4ERGA 2XWXA 3MCKB 4NN7B 4GRMB 4RJEA 5C55A 1TJPA 2NY7H 1RJYB 2JCCF 3P62A 3UJIL 2E7LC 4PJFA 1IIIA 1XDTT 3TJEL 1XF5A 5DZOA 3P4MA 3O6FB 2PGFA 5G4NA 1LEIB 4P99A 4I2XE 5JW5B 2WWKT 1R5YA 4XOAA 2DJSA 4G72B 3OTTA 4MVBD 1KBVA 1XIFA 3PLYA 1M2OA 4F93B 3HAEG 1F3TA 1Z0MA 4C5YA 3BLOA 3OQ3B 4QWWD 3OLEA 4AHOA 5L7XL 3V5HA 1WCGA 3ABSA 5D1ZD 1T7WA 2E75C 2YW3A 3HZYB 5HY9A 3ZYOA 3O4OB 2H3DA 1GRWA 4MG4A 5L0QC 4O53A 2AXWA 3KPSD 3TJIA 1KELH 1MNUH 1SOSA 4H26A 3OSVA 2MKWA 5LNVA 5EMMA 2G9HA 2VH5L 3OZ9L 1ZMYA 3WU1A 1EJUC 3E0FA 2VLKA 5L9DL 3VXNA 2JF7A 3B7RL 3JV0A 4S1SL 3OKOB 4HG4K 3HAEB 1QOQA 5HVWA 3ITGA 3RGVC 3D2UD 5L4JA 2GWGA 1BF8A 4JS3A 2BOGX 5C6WH 1I8KA 4K8HA 4XD3A 2Z1VA 1D8WA 4M56A 2ZYFA 4HUWA 4YAQB 1EEUA 4IXXA 3EDDA 2HAZA 4JR9L 3KOXA 3HZMA 3GC4A 4F0LA 2IFGA 4KVPA 1FJ1B 3DBXA 3T3PF 5D1XE 3L2LA 3JXAA 4JO2H 1GIGL 3LD8B 4I7UA 3RO6A 4O51A 4DOHE 2OLAA 3JU2A 2HKHH 2QGDA 4H83A 2WQAA 2X4SA 3QPQC 4RDWA 3ALFA 3QEQE 2R2EA 1IQWH 3VC5A 1R5WA 1OCOB 2NSMA 4UNLA 2QCLA 4I90A 3LDBC 4KVNH 1GOXA 1A7NL 3N44B 5FD0A 5IB2A 1F5ZA 2OMZB 4QJ3B 4LNYA 4WWOA 2VDOH 5ABZA 2XG4A 4P7LA 4Q74A 2BWIA 2CBPA 2Y7EA 2HVJB 4W9KC 4IP7A 2YBVA 3HNTL 2F8VA 4ZDHB 1RCYA 3QQ4A 4NC1E 3UJSA 4J35A 1L9PA 12E8L 4EZMA 5FW6A 3MV7B 1I8LC 3H1ZA 3GNML 1GW9A 2O61B 4NQCE 4YR6A 4JDZA 3SQSA 1KGCE 4M6NH 2D3NA 4NN6B 2XIQA 4WAFA 3G8EA 4TNWK 3FVDA 4EE9A 1YX1A 3S4SG 4X8GA 4WWKA 1LEKB 3CSYA 2ZOUA 3RWIB 4GVGA 3T2OA 1WO2A 3S34L 5KANG 4LCIL 1V8EA 4N7QA 4L48A 1G4SA 1VH7A 2VDIA 2NCEA 5CJ8A 4DKFH 2CIKA 3Q05A 2P5ED 1WS8A 2P47B 1CGWA 2ZZUT 3G1FA 1AAJA 1YXDA 4V2CB 3CC5A 2PRHA 1ZVNA 1XG4A 2VZSA 1BDYA 4OAWB 3MA9H 1QSED 4BK4A 1US3A 5ABAA 4FS9A 4XVEA 4Y9PA 1GOGA 2JB6B 1INDH 1G87A 1GOHA 4I48B 5D2YA 3TLRA 3AHVA 5DWUH 4WJ8A 4F91B 4JY4A 4EKJA 3OAWA 4UIKH 1QSFE 1FI8C 3RFZC 4Q4OA 3NCFB 1M65A 3FO1B 3SPHA 2OXNA 1OG6A 3U48A 2YK1H 5IBUB 5D9PA 4RAHA 5J11C 4N8CL 1N0XH 3LZQA 5FPIA 4ORGB 2C5DC 5FESA 4X0KB 3TNMB 1I1XA 2ICCA 3ZSSA 3LNGA 2Z7YA 3WHE0 3M5YA 4BA8A 2BZ7A 3KLLA 2VR7A 1T6VN 3JZ7A 1EOMA 1BYBA 4HKZB 1V6XA 4Y2DB 2H9GB 4X6CF 1PX3A 2HG0A 3O3AB 1JUFA 3ZVHA 2X41A 1OAQH 4NWTH 4WOQA 4MS6A 4N2MA 1A7PH 1JPHA 3NFSH 2WUCH 1TQTA 3ZZQA 1DUZA 5E24E 1TO5A 4W93A 3GSRB 3W86A 4F0MA 1SM3H 4MCMA 5DRNA 1IFGA 1YNKL 1DKWA 1Z9OA 3KDPB 3R0MA 4W5ZA 4WU5B 1AJ7L 3LCWA 4JFSA 5DRCA 3B2PA 2OEMA 3N41B 4PY8I 3A9IA 2PZNA 2V2WB 4B7LA 1GKPA 1R8LA 4XPHL 1XHGA 1XR9A 2DPKA 5TH2B 1P9MA 3VQLA 2CW6A 1FNLA 1CICD 2DZVA 25C8L 2HMIC 4HJUA 4NY2A 2Z6FA 4AYGA 4OLUH 1A21A 2IANE 4S1QH 5FK9B 2BMKA 4UTBH 3S88L 4BY3A 3JUZA 5FGSA 2V9RA 2DDXA 3RP1A 1NF7A 1UXLA 1RUML 1RULL 1IFHH 4OV4A 3FFDB 3ZS4A 4AH2B 5EC2B 1ONXA 1J11A 4B5TA 1OGAB 3NCWA 4MAYC 3UDWA 2C13A 5IMKA 3VYOA 4AENA 2N3JA 3FO0H 5DK0B 2FJHA 3BPOC 2V9QA 4KIRA 2A3EA 5I0VA 2BXVA 5FF2A 5MKGB 3MZNA 2R2BA 2YD6A 1SYSA 3QEGL 4KJQC 4A6YH 4PWHA 4WW2A 1HNFA 4LESA 2E27H 3MLYL 2AHIA 3MLZL 2JQZA 1ZP3A 2XINA 5DS8A 4MS8C 1QHOA 4M93C 4H1LB 1BYNA 4PP1C 1TWWA 1EANA 3DO4A 3MSYA 5HHMB 5I3FA 1DJGA 3FJLA 4M7LT 3CFDA 5CS7A 1F2XK 2VO8A 4G6CA 2P8MA 4DJFD 5EB8A 1ZPTA 1GHRA 3N19B 1PKMA 1YJDH 2WCAA 1HQTA 3EO0B 4G42A 2IGTA 4ZMLA 3QJTB 4KTDL 3TH6A 3WJSA 3FPYA 1GTEA 3R4IA 1UUQA 2UX6A 2VC6A 4DGYH 4FULA 1W1TA 3Q45A 3BJ91 3BP7B 3GSUB 1MUJA 3UAFA 1N68A 2IOIA 1NY1A 4LBEA 1JWUB 1KWKA 4X9BA 3T44A 4ZZ9A 4DP9X 4M4PA 4TTUA 4P4RA 1E5CA 4DQOL 2HWZH 1PX4A 2G5BA 1IHIA 4UM8A 1G9EA 2NT0A 2HT2D 5AW5B 1VLWA 4HS6A 4FXGB 4J2XA 2DLFL 4JM2F 3NJNA 1GQKA 3FS2A 2EG6A 4YX2H 3QISA 4P23A 4LRTA 2QUNA 3ZKQD 4F2MA 5SWZD 1EH9A 3FQTB 1S7WB 3ARGB 2F6UA 1F4YL 5C8JA 2Z91A 2HVOA 3THMH 5KVDL 5HDLA 3NFNA 5H2ZA 4BF9A 4PCPA 5I30H 4PCFA 2IPUG 3T6WA 4HV8B 1MAJA 5DHYA 5CZXD 3EYVB 3WK2A 3FUIA 1KTDB 4N9GB 2AJYH 4MFDA 3D18B 1J1XL 1LO4H 4JAMB 1JZIA 3GFUA 1WUNT 2PDYA 1A0QL 1IQDA 2VLMD 2J6EA 1LL6A 2CZDA 3FSUA 4IDJL 3WHE1 1DLHA 4WGXA 5D2XA 3VFLA 3WG6A 3P9LA 1PZ2A 1AH3A 3CL6A 2RB8A 2IAMC 1M2VA 5E6ZA 4WI6A 1NGYA 3FDGA 5JDJA 3L1FA 1IM3D 3MXVH 4I89A 1XS2A 3SUVA 4XC3L 6XIMA 1OTTD 3FH8A 2XX1A 2HROA 1JGVL 4GHRA 1JF5A 5E08H 3F7JA 4M48L 2QCDA 2IALA 4K6AA 3TMLA 3H4HA 3NQBA 4KX9A 4PJIE 4C57C 3RK8A 2EEFA 1KTBA 1QLRA 4Q14A 5BRZB 5CJOL 3QGKC 1WDRA 3CVIH 4Z8FH 3T2NH 1UBSA 1CFTB 4CU6A 2ARJB 8CGTA 4IMLB 1SJAA 4MXQD 3CEUA 2F68X 8TIMA 1OE3A 5DCEA 2NLJA 1Y18B 5CUSL 4JUSA 4HFWB 4RZBA 1VF5C 1LLWA 5F1SA 5E9AA 2V81A 2X6BA 4PJ7B 4RWYH 5IMLB 5HNNA 3GMLA 2PI6A 4PN2A 4D6HA 3V0TA 1MEWA 1QLEH 4JNYA 5FUZH 4N6RA 4NNPL 3OMAB 1DJWA 3W82A 3WNJA 5GZOD 3DN5A 2J1YA 1HSAB 5D96C 4ICXA 4ZMQA 4K94L 4LL9A 4DF2A 1YQ2A 4A3YA 4X99A 5C0FA 5DEGA 4EOUA 1DQVA 2FDMA 4AF0A 3Q5TA 2WLNA 2GJZB 5AN7A 4HC1L 5SWSA 5F7WC 2AKZA 2IPWA 4M6OH 5DZPA 3PZQA 2F54B 3DK0A 1SDDB 3RPTA 1V6WA 2XH7A 3D25A 3RXZA 4AVOA 4AIUA 1IGFH 1OCRB 4B9YA 1YMMB 1HGYA 4ZFGL 5I6XB 3WQ5A 1E70M 4GW1B 2DKUA 2XVBA 3B9OA 3RLHA 2BJML 3IGFA 4L8CA 2V5RA 1N3NA 5ESVB 4FNLH 5L6YL 4PGJA 2LFGA 2QCEA 2MPAH 4UR7A 4NKCA 2DYPB 3H2EA 3LNHA 1ZBCA 4AY7A 1EWHA 4LAKA 1CLOH 2I5YL 5E8NB 1SQ7A 4MYWB 2IGFH 4EPEC 1N0LB 4XC1H 1REIA 2BSLA 1S9XA 1W8EA 1JZ6A 5CJXC 1HEZB 4P59H 2BY1A 2H8PA 1WYJA 3VSUA 3S3BB 3F5JA 2BHFA 4XAKE 2AK4B 5FJIA 3EFOA 1LQBC 1EUAA 3UBHA 2DP3A 3WIJA 1IBGH 1FZMA 1B2WL 3IJHA 1IBFA 2H8XA 4F8OA 3ZWTA 2AEIT 1KYOK 3IPWA 2TYSA 4MA7L 3NJXA 1JFQH 1JGDB 3CMGA 4WK2B 3BAXA 3BG5A 5L0QB 3H2QA 2XKUA 4B9KC 1AZRA 4PMVA 2YRPA 2NQ5A 4M7LH 4WRHA 2ENQA 1OFPA 5J12C 1XSKA 1UQSA 3MRDB 4J2MA 1W15A 1MCKA 1KEMH 3BAIA 1UB6B 1XIEA 1QQDB 1X9UA 1XZ0B 5DQJA 2WBJA 2FH6A 5HGHB 1Q6RA 4RFOH 3FQNB 1OAKL 1HOEA 4OSUH 3DX5A 5CWSA 3A4JA 4KNQA 3H0TB 3JYBA 3RGVB 3UWZA 3ARFA 4PMOA 1J1PL 2CUIA 3E3QC 5J5RA 3CO4A 4OU3A 5DT1H 3S36X 2UY6B 3VKJA 4EP8C 4AB4A 4YSDA 1VGKA 5JW4R 2G2NA 4X61A 1AHMA 3WIHH 3UPWA 4C1NA 1OK4A 1F3JA 1NGQL 1FGVL 2DUXA 4R4NC 2PUZA 3QH2A 3V4PL 4NAJA 3RTQC 4O52A 3FCTB 4PH8A 1RJQA 2PU0A 2BVUA 2V2XA 4MSSA 4OT7A 1XYLA 4JEQA 3H23A 1UIPA 4HEPG 3VZXA 1MCOL 2ZKWA 3WDJA 4NVTA 1MZHA 3G5EA 4X4ZA 3QXWA 3BQUA 3DX9A 1AW5A 4OQ1A 1Q72L 2DMHA 1Z48A 5F8QC 3ITVA 3DBPA 4YHYB 4C83B 3NRPA 1EQCA 3O6LL 1QT1A 5EOTB 3AQDA 2VOTA 2P8PB 3U6XA 3S1VA 3QQXA 3SSGA 1B0RB 4YHPB 1HXKA 3OKNB 3M1ZA 3NP3A 5HI5D 4WK0B 4KHXL 2BNRD 3VWKA 3VUSA 4L0PB 1U21A 1BIIA 3RQ3A 2WY3B 5HDQL 1CT8B 5C0AE 3CJJA 1U8CA 1GEHA 3WD1A 4BQ9A 2BV9A 4X6EB 4JZOA 4CKQA 2XX0A 3GSXA 1WLHA 2X6CA 2DZEA 5CEZL 4N2GA 3PJXA 1BYAA 4J2PA 1FV1B 5K9CA 4X80H 1RZKH 2APTA 3GE7A 1SFSA 4WHTA 1HI6B 1NINA 4CBPA 4QS5A 3LSOB 3L95A 1WV2A 5HYQB 3RYMA 3OMNB 3BH4A 2FFCA 1G4EA 4IBZA 2D7OA 3E6HB 4AG4L 5F3FA 3IFPA 1CMOA 1MCEA 3GJFH 4FQIL 2EE6A 1G9NH 1UGKA 3MRLA 4K7PY 4ZAKA 1HILB 4OUUB 3RFZB 3OVGA 4ZTXA 4PGCB 1KR1A 1DFBH 5HGGS 3RI5F 4C6DA 1J05A 2Y7GA 1U3YA 1QNSA 4IIEA 3U4FA 4GKSB 3KDMB 2QGHA 4XXWA 1RXLA 1P1ZB 2WTPA 2XN1A 5J11B 4OIIH 3TYCA 2QFRA 1E67A 5DUPL 1G7LA 1R3KB 4GQGA 2VQ1A 4PBEA 3VUAA 1MIMH 2O9OA 3WLMA 3A4AA 3BZ5A 4M3KB 3FTXA 1GOWA 4MKVA 2IQAA 1GORA 2ZAGA 1GWJA 4B5NA 1MELA 2RDXA 4YO0A 1QO2A 5FKAB 5EIIB 1JCTA 5AOKA 4QHMA 1MHPL 5DYFA 2VLRD 5C0GA 1L9MA 3U1SL 4NO2A 5EYWA 1XIWC 3OEXA 3CHQA 4WEVX 1UKPA 4JYEA 1OX4B 3ULUC 1Q6LA 4XZHA 3C5JA 2DSKA 1E9QA 2DQIH 3BVUA 1SVZA 4IOIA 3O6CA 2YFNA 3QIUB 1HZHH 3RG6A 4ALAC 3UZEC 4KK9D 3IETB 1TTJA 4M6PA 3VDCA 3WUEA 7ODCA 2ZSVA 2P44B 5FF6B 3UACA 1OKEA 5CPMA 3D9AL 5JLZA 3PQYB 2XWJB 1HIZA 1UKQA 6REQB 1MPAH 3ASNB 4P49A 1YEGH 3I7RA 5DZNA 2APFA 1P2CA 3CDGB 1CF8L 3CYVA 1LQ2A 2DYRB 1QFPA 3S8HA 1AXIB 1YYAA 4A3HA 1DSWA 3U4BL 3KWUA 2NT1A 1HE7A 5IBXC 3HI6H 1JCXA 4WEEA 2VXVL 1D9KC 2EIZA 2Q8BH 3CLFH 3P2TA 1PAMA 4ATDA 1C08B 2MJWA 3QYNA 2X0YA 5GJTH 1FVDB 2R0KH 3MV8D 3CN2A 5EC1A 4YHKL 3BPOB 3GXIA 2LOEA 1S3HA 1ZTVA 2AMXA 4G5ZH 2YRLA 4XB3A 2W0FA 3VIFA 4JO5A 2CLVB 3RKDD 5CJ5A 2R1XB 3TO2B 2R83A 4M93B 3TT3H 3QQNA 3V5CA 1N82A 3T2QA 4YOKA 2WN3A 4NJHA 3R8QA 1QFOA 3QFDA 1W0WA 1X97A 4O8AA 1TZHB 2BNQA 2ZPKL 2FX7H 4P23D 3QZWA 3LKSA 1G1CA 1BECA 5LSMA 4W70A 2ZTBA 1QSZA 3VGEA 2J8GA 3MY9A 3ZHFA 1OD7A 3MGTB 4R9OA 3D3VD 3LUTA 2PCQA 4S3CA 1JNHB 4FZ8L 4I3RH 2DZXA 4FI7A 3EKLA 4MNQD 4PRNA 2Z4QA 4QIUA 3ARTA 1T3FA 2M2DA 3GS4A 4W86A 3IU4H 5EU3A 3ZSTA 1LMKA 2BOCB 5C0JA 2EUWA 1TV7A 4DZBA 4TYUA 1GG1A 1F3XA 4JHMA 4Q8TA 3CO8A 1ZHNA 4MQXD 3IMRA 3F05A 4PJ5B 5IHWA 2H1LM 1AO7A 4Q8UA 1H3XA 4FK9A 4YL2A 2OLSA 1OQFA 1XRTA 3R8RA 3V6ZA 3SE9H 4INFA 4J3TA 1ZCCA 2B1OA 2VLJE 5B8CC 3WDRA 2VDRL 4XNAA 1KFKA 1DDHA 1EHLL 1Q7MA 2ZP8A 2ED9A 2P4AB 1FL6A 4JHWL 1PEZA 4A2SA 4N9OB 2C79A 5CPTA 1ED3A 4MQ7B 3MBWA 4XNMA 3L2MA 1CIUA 3FB8B 3CFBB 3OL2A 5I74B 1VFHA 5ABGA 4XI5D 2J73A 3IDGA 5D38A 5LHFA 3CNYA 3ZE2E 1B9BA 1HWHB 5D4YA 3MQIA 5L4IA 1N6VA 2K1MA 2V68A 4K1WA 3L1OH 1H4PA 4ODTL 1RZKC 1WZKA 4OIFA 3GMMB 2EDFA 1MRAA 1EPFA 3AY2A 2GLKA 3BN9C 5EOCL 1FWDC 2E1DA 3RB5A 2CETA 2IAMB 1DSFH 4R3SB 2GFBB 3GJEA 4UC5A 1VBUA 4QOKA 2R0WL 2O4QA 2VDHA 3M0YA 1ZOXA 2XKSA 2JIXB 2P0OA 4FR1A 1OSZA 4HKXA 3QP3A 3FOLA 4M02A 5L88L 2PTUA 1IQ8A 2ISVA 4HS8L 2I56A 1T1YB 5T3ZH 3FX4A 2E6YA 1ZLWK 3NUKA 3MRMA 2AITA 3C6SA 2PDMA 3BAYA 2Q8LA 4KETA 3SJVD 3B6SA 1U8KA 4ZXBA 2Y7MA 1A3HA 1FUYA 4ZUWA 1XIGA 2PDCA 4ZW8A 3T8VA 2A9BA 3MMEB 3WLTA 5DRZB 3MBEA 3ZJAA 5BVPH 5I0XA 5F0MB 1QXLA 2XZQL 2QR6A 4UCFA 3SEPA 4Q8WA 3L4XA 1KIUA 2Y6SC 4NAMA 4ERSL 2G4FA 1UPPA 4WCJA 2V2TB 2VM4A 4WI2A 1U8HA 3OTRA 5GS1B 5J5EA 4AKOA 4JFDB 4KKZA 5D96B 3FFCA 4LTSA 3VFMA 3LKPB 3HPLA 4NIKB 5IFHL 1IGMH 4WKAA 3B8UA 3AGVA 2W4XA 2NRDA 5DT5A 3IDYC 4ES4A 4XPTH 5D5MB 1NSNH 2VGGA 3PSWA 1LCOA 1G84A 2X4QA 5LXVA 4O16A 3F84A 3VE9A 1QPOA 1MFVA 4PMXA 2J21A 4JQVA 5ANME 3M8OL 3WUBA 3QDJB 3K1DA 5IJVA 2DZWA 4K2SA 1PIGA 4JM2C 1X4ZA 1HE8A 3HE6C 3ISRA 2AQOA 3W28A 4KI5F 4UOQA 2FBJL 4L3CB 2MOGA 3HLKA 4QUOA 2NNRA 4E2BA 1U41A 4L1XA 1KIRA 5I3IA 2ZX5A 2PXYA 1R75A 5D1QA 2WBJD 5J56B 3TN4A 2V9UA 5CZJA 4G8FB 4H04A 3OJVC 1ZKAA 3MFFB 1TMCB 4UMGA 3UZYA 1CDJA 5TPWH 2HRPL 2WLJA 3LDVA 3TC6A 1I2OA 1S39A 4LCWA 4KCWA 4I87A 3SDXA 3PUGA 1GL4B 3W7MA 3WTTA 4TUKH 2B14A 2B1AH 4A6YB 4CNTA 1JCKA 2ZXCA 3GFZA 3SCMA 3VUPA 2PDNA 2YKLH 4OIAA 2QCMA 1YKWA 3IGSA 4DK5A 4FXFA 5IMOA 4YXGA 4TU1A 5DBUA 4JG9A 1W0YT 1FRBA 2PZ0A 1BW8A 5J12B 1EBGA 1B3WA 4Y9FA 3A4DA 3CN3A 4F7TA 1KYUA 3BQUD 5DEZA 3VXTA 5IEHB 5ESAA 1UP0A 4GG8A 4JZNA 3ZE0B 2BXZA 4YSCA 3PE9A 4XP4L 1DJXA 2Y61A 1DVXA 4ZS6D 2WYTA 1O1HA 2Y06L 3EJYD 4IGNA 4BCEA 1Q7ZA 1XL6A 3QEZA 4E9RA 3U79A 3SY0B 5JA9A 1MFDH 3D5OF 1MEIA 4XOEA 5FYKD 1JN6B 3RGHA 4DBUA 1TTBA 3FQXA 4KX7A 1HXYA 3SDOA 4HUXA 1FQ9C 3VK5A 3QYMA 2ITDA 1QTSA 1WVZA 3MRQA 3NR0A 5HJGA 5D7EA 4YIQA 4MASA 1OYCA 2H9AA 3LQZB 1IBDA 4JTFA 1UA3A 1CLKA 1TIUA 4TUOB 2VB5A 1LM8V 2WZPD 1IEAA 3DO3A 3I3EA 4HIIA 4RV3A 3DC0A 3U36A 5FSEC 4ORZC 3K6FA 4Y4HA 3KHQA 5DD1H 2DWSA 4AX6A 3WEXA 2ZX8A 4XB7A 4ZYKB 3QQDB 3RY5A 2VGIA 4OV5A 4TVPL 4EBQH 1UZ8A 4E42A 3RVXC 3NZUA 3ABXA 3T9WA 1IYXA 4N8VB 3X11A 2JKLA 2P50A 1T1XB 4RNFA 5ALCH 1W17A 4YZFE 1VZGA 2PYFA 3IE9A 4HIBA 4MY8A 1AGCB 4N0UE 3RVUD 2BSEA 4NJGA 4MHHG 2MKLC 2YXWA 4UMCA 3EGDA 1E3FA 1K85A 3VXSA 1VJSA