2WVSA

Crystal structure of an alpha-l-fucosidase gh29 trapped covalent intermediate from bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an e288q mutant
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYQRRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
total genus 158
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvsA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvsA01
2O9TA 2WW5A 1YQ2A 1GNXA 3WF4A 3BVWA 3UEQA 1HJXA 2G3NA 2IXVA 4CU8A 4FLQA 2D22A 3J7HA 5C71A 1WDPA 3KLKA 3IJ9A 2A3EA 5CXPA 3ALFA 5CLWA 1M04A 3DX2A 2VOTA 2DIJA 3FNDA 1CECA 1WDQA 5EB8A 1C7TA 1SMDA 3L2LA 2O9PA 1E3ZA 1B31A 2G41A 4OBSA 3SCUA 1JAEA 2X1IA 1CLXA 4P8WA 1V6WA 3N12A 1C8QA 1OIFA 2X09A 3KEHA 1PX3A 1E6XM 1G94A 4GI8A 2W4XA 4ZE5A 3AXIA 3IGUA 4AZBA 1TE1A 4MAZA 2MANA 4FNTA 1W9DM 2EPKX 2XFFA 1JZ5A 1J9YA 2TAAA 3SCQA 4QDMA 3ARUA 1UYQA 1LG2A 3NJ3A 2YDRA 4HU8A 4M29A 3W24A 5M17A 1BYCA 2F8QA 3N04A 4AZCA 4H8VA 2YBUA 3DYMA 4AD2A 4BQ4A 1E6SM 3MSGA 4TUFA 3AHYA 1LLOA 5M5DA 1C91A 2XFYA 2X05A 1US3A 2W92A 3JUGA 5EFDA 1UUQA 1FP8A 2WHMA 3W27A 3WEZA 1BYBA 2CCRA 2BVYA 5I24A 1PX8A 1XD0A 5HBFA 1FHLA 1BVNP 4AD5A 4E2OA 1JDDA 2EO7A 2XHYA 1TUXA 2OWCA 1KR1A 2WAGA 3MO4A 3A4AA 2AMGA 1VEOA 3SCWA 3GBDA 1DWHM 1XC6A 1HNYA 1GQKA 1UZ1A 4CKQA 3K46A 4UFHA 1XCWA 1J0HA 4BQ2A 3T2PA 3FHAA 1GOKA 1UASA 3F5JA 5LA0A 1TVNA 1HIZA 4W5UA 1TQSA 4Z2KA 1JI1A 6A3HA 3WQ5A 1CTNA 3WQ4A 3VVGA 3SIMA 3WDJA 2J7DA 3WY2A 3I3BA 1C8YA 3CUHA 3ARWA 4Q22A 2QMJA 1ODZA 4UFMA 4U33A 4CU6A 3VO0A 4A3HA 2QPUA 3WD2A 2WMFA 2VZOA 3VTRA 2VZSA 3DX0A 3T09A 3WDQA 3QHNA 4B9YA 5BXPA 1UR9A 4RE4A 3MUY1 1GZJA 4UQDA 4WLCA 3WDIA 3CZJA 1BQCA 5BYWA 5CGMA 3WMBA 1BYAA 1NOUA 2V5CA 1WZMA 1E70M 1W1TA 4W84A 4W7WA 2EAEA 2EPNA 4DUVA 1XV8A 1L8NA 3FAXA 1VRXA 2J7FA 3TTSA 1EXPA 4DUWA 2WPGA 1NWTA 1QI2A 3MUZ1 4HMCA 4HPHA 3VD3A 5EMYA 4CUCA 2J7HA 4WIWA 1JF6A 4U31A 4Z2JA 1E73M 3SUSA 1WDSA 3OZOA 3WENA 2EQDA 4OIFA 4MB4A 1JYNA 2ZUWA 1I1WA 1V3IA 2OYKA 4S3KA 1TA3A 1GQJA 4F8XA 1N82A 1AQHA 1W9PA 4FLSA 3VDHA 1JXKA 2V3EA 1HJWA 3CHEA 2W63A 3G6LA 1W9XA 1V3HA 1GOQA 4V2XA 1R86A 5AY7A 3FXYA 2V3FA 1V6YA 2OSWA 2CBVA 3HG4A 4J3VA 1UHVA 4ZXLA 2VTFA 2Y8KA 3L4YA 1Y7VA 2ALWA 3LPPA 4JCMA 3E1F1 5A8MA 4IPNB 3ZSSA 3QHOA 2CHOA 3WFLA 3L4WA 2ZUVA 3BCDA 5JBFA 3OIHA 4PUEA 1MXDA 4DO4A 1TG7A 3ZT6A 4D6CA 5AYIA 4X0VA 3BH4A 3WY3A 1K9EA 3VGFA 3ALGA 3VIHA 3WDPP 1CENA 4ACYA 1B2YA 2BXZA 3WL1A 2V5DA 4D6HA 1I1XA 1J0KA 1E0XA 2DSUA 2J7GA 3N11A 3ZJ6A 3L2MA 2QV4A 3CZKA 3LXCA 2Q8XA 3WF1A 1KXQA 1EQPA 1QI3A 2VCBA 2ZOXA 3W53A 5GPRA 1PAMA 3S5YA 3NUKA 3WEMA 1HJUA 4LGXA 3ZJKA 2D24A 1KWKA 3HU7A 1E4LA 5IFPA 1Z32X 4OGZA 2WZIA 2XM2A 2ZX5A 4HOXA 2ZX9A 4BQ3A 1W1VA 1GVIA 1MQPA 3HG3A 4D6GA 3O9NA 1W1PA 3K8LA 3WH5A 4NZCA 5E6ZA 3WN6A 1JZ2A 2PI6A 1QI4A 3CH9A 2DT0A 1GCYA 3GZAA 4LXFA 3ZT5A 1OT2A 2IXUA 3DC0A 5I77A 1OIMA 1E5JA 1UQYA 2PBOA 4EAMA 3CC1A 5D9OA 3PZUA 4AYSA 3IJ8A 1ODUA 2ZXQA 3WH9A 3CPUA 3T0AA 3W29A 3H55A 4PSRA 4PMRA 3EJQA 5CSUA 4JL2A 1LQ0A 2XWEA 2DGAA 2WZHA 4PMQA 3O6AA 3EMZA 5DT5A 3WD0A 3PZQA 1CPUA 3SCVA 2WVSA 2PBGA 2DPEA 1H41A 2JEPA 2JIEA 1EOKA 6CGTA 1O7AA 4JCLA 1VEMA 3WNLA 3BAWA 2XIBA 3ZJ8A 2PWEA 5CLTA 5AYBA 3UETA 3BSHA 2E9BA 3ZT7A 1QW9A 1QW8A 5E6YA 4HZ7A 4GQRA 1W9VA 1CXLA 2F2HA 4CD6A 1GQLA 1SYTA 2G4FA 2GK1A 5E0FA 1H49A 5JUVA 1QWUA 2CITA 3PZIA 1UKOA 4RL3A 1OGBA 1J0IA 1GVYA 4KGJA 1LJYA 1MXGA 4LQ1A 2ZUTA 3SURA 3NIYA 3VSUA 1OCQA 1G0CA 4QP0A 2A3CA 4MB3A 1BLIA 1C3FA 1E6NA 3II1A 5GNZA 5D4YA 1GOIA 2J7EA 4RE3A 2D73A 2CPUA 1NM9A 2VVSA 3K4DA 1V02A 4D72A 1E1FA 4PN2A 2E40A 2D3NA 1GHSA 4FNUA 1TVPA 5IDIA 2C7FA 1JG9A 4TTUA 4J28A 3VNYA 4KMQA 1E4NA 3BAKA 3W82A 2VZTA 4HZ6A 2X2IA 3VIIA 3W38A 2VI0A 3WNNA 3BVTA 3VIMA 4WSKA 4KGLA 4NRSA 1RP9A 1EHNA 4V27A 1NOWA 1BF2A 1UR8A 5DF0A 3VILA 3BVXA 3VGDA 1ZU8A 2HVMA 3D5HA 2WKLA 3VUPA 1GONA 4P8XA 1B90A 3CGTA 1WDRA 3T0DA 5HDRA 4QFUA 5CGTA 1V6VA 3AIQA 2XYLA 2ZXDA 2J74A 1DWJM 2WWCA 3TP4A 7TAAA 1C7SA 5HOSA 2W61A 1QI0A 4AD0A 2DT1A 2VQUA 2XG9A 2VJXA 3WF2A 3RO8A 2VCCA 3OB8A 2J62A 3DX1A 1JNEA 2X2YA 1V0LA 1HKIA 2OW7A 5BRPA 4WK9A 3WQVA 4Z2IA 1WAWA 2OLHA 1B30A 2XGBA 2YA1A 1QI5A 4UFJA 2XVGA 4ACZA 1QHOA 1VBUA 3AXHA 5ABFA 3ZJ7A 2WLYA 1JYWA 1FH8A 1TQTA 3AIUA 2CYGA 3PTQA 4ATWA 3WD1A 5I6SA 3AIWA 5D8ZA 4EKJA 2D2OA 4OZOA 4IPLA 1BGAA 2WC3A 1ZL1A 1FP9A 4OOUA 2BHUA 1HL8A 3WDRA 3DDGA 3B8SA 3KLLA 5BXRA 3GXMA 2JALA 3WQWA 1JZ6A 2VX6A 3T08A 1H09A 2QF8A 4HOWA 3VINA 2EBNA 2XSAA 2F61A 2YOCA 1OINA 3N13A 2GSJA 4CD4A 2V38A 5A6BA 5I23A 1TFVA 1I75A 4AZ5A 4DWSA 4TVDA 4H41A 1WB0A 5CG0A 1K6AA 4UOJA 2DT2A 4J3SA 3WUEA 1RP8A 3BVVA 4GPNA 4M8UA 3A3HA 3BLKA 3AS3A 4QLLA 3AOFA 3VM5A 1CXFA 1PZ3A 1E56A 2A3AA 2BY2A 4W8AA 4NZFA 1DWIM 1BFNA 2IUZA 1V6XA 1UA7A 3ZO9A 1HJQA 3M7SA 2PC8A 4AD1A 4U2YA 2BHYA 5JIPA 3BGAA 3WELA 3AS1A 2YL5A 4E8DA 4TTGA 5E70A 3HN3A 3RDKA 4BF7A 3RM8A 2ZUUA 4NXKA 4PEEA 2YFNA 3MV01 4NSBA 2EEXA 3WDHA 2YLLA 1US2A 3W25A 2ZXAA 3BSGA 1TQVA 5A2CA 3SUUA 4CVWA 2IGTA 1CDGA 1JYXA 1BHGA 2GK1B 4M24A 1XSJA 1E1EA 4PMOA 5C8BB 2VZVA 4HZ8A 2ZX8A 2WVUA 1HXKA 2YDQA 1HKMA 1KB3A 1CBGA 3EDDA 4BA0A 4K68A 1GJUA 4P7QA 2NW0A 2DSVA 4UNIA 2CNCA 4W88A 4B15A 3WY4A 2FH6A 1W3KA 3APGA 3T2QA 4TOQA 5GNXA 1HKJA 1EHAA 3QR3A 1GUVA 3BUDA 1EDGA 2ZUMA 3PZOA 4U3AA 3ARPA 3CMGA 4PTWA 3DYPA 2BNJA 3VGEA 2J25A 1JXJA 3KWXA 3WH6A 2WCSA 3PN8A 4GXPA 1IT0A 3NDYA 3UR8A 4JFVA 4GZEA 4QLKA 3OZPA 4D1IA 1E71M 1VFOA 4J7RA 3CZ8A 2G3IA 3D52A 2UWFA 2D0GA 1CYGA 3CMJA 3KL3A 1H11A 3AICA 2PWGA 3WFZA 2WYSA 2XM1A 2WANA 3GNRA 4GI9A 4M56A 3MMUA 3VX0A 3VMPA 2RGMA 2D23A 1HJVA 2DEPA 1HL9A 3VGBA 3IAPA 1WPCA 3ZIZA 4MDOA 4XX6A 1J18A 1NP2A 1UH2A 2DSWA 3CHFA 4D71A 3T0BA 1J0YA 3EDKA 1GJWA 4W7VA 4L4OA 1Q6GA 1KCKA 3ZQ9A 3AXXA 1E6RA 4ACZB 2CKSA 1ZS2A 3EJUA 2A3HA 2WM0A 1CXIA 1TCMA 3UCQA 2J8GA 1E0WA 4JL1A 1TZ7A 3CUGA 5DFAA 1OWQA 2ZWYA 3RPMA 2ZX7A 1NWSA 3PZNA 1CLVA 1QPKA 3WUGA 1EA9C 9CGTA 3LPOA 4KRUA 1M03A 4PYSA 1XSKA 1W2PA 3OGVA 1E72M 3U5YA 1J10A 1C8XA 2EACA 3PTKA 5IXEA 1B1YA 1MQQA 4PMVA 4H8UA 3CIVA 2CEQA 4AZHA 1W2VA 3VDAA 2FYVA 2WXDM 5CSYA 4AMCA 2XVNA 4AD4A 2EPMX 4A4AA 1ZJAA 1UG6A 3GNPA 3IAQA 5F7UA 5C70A 4ZE4A 3ZR5A 3GXNA 4UFIA 4D6EA 3G6MA 3K8KA 1B3YA 2ZXBA 1C92A 1HJSA 3L4ZA 4PMXA 2F1AA 1J11A 4W8LA 1FFRA 1V0KA 1B3WA 1K9DA 3WL0A 3LXAA 3VNZA 3BUBA 4GI6A 2X0YA 1MVYA 1QBBA 1A47A 1LL7A 3VU2A 4HTYA 3U57A 1JF5A 1CXKA 5I78A 1BTCA 4KWUA 4BS0A 3VIKA 3UR7A 3UG3A 1DWGM 1VENA 5A8QA 2YA0A 2VMFA 5CZKA 1KQZA 5A1AA 1VFMA 1WCGA 1AQ0A 6TAAA 1XH2A 2F7OA 3OA5A 1U33A 2JE8A 4NI3A 5A6LA 2JF7A 3LPGA 2J78A 1UD5A 1VFFA 4H8HA 3GXTA 4ML4A 3ARQA 3MANA 3HZ3A 4CN1A 4AW7A 3MMWA 3RMEA 1Q6DA 4WKAA 2GDUA 1O6IA 4Z2HA 4OJYA 5TD4A 4GINA 1R8LA 3LPFA 3OG2A 3EYPA 4FF5A 4MPKA 2WMIB 4PSPA 2YLAA 4U5KA 4ZXOA 3THCA 1UH3A 1QOXA 3AFBA 4M82A 1HF6A 4MNJA 3SCRA 1HX0A 5BWFA 2WWDA 1M01A 2GFTA 2X8RA 1EQCA 2G8ZA 4J3UA 4W86A 1V3JA 3O2LA 4B3LA 3MV11 3A21A 1JZ4A 4R27A 3WBEA 4CCCA 1FOBA 4D6IA 1KBKA 4C7FA 2GUYA 4GQQA 2ZIDA 2XN1A 3POHA 4DWSD 2GJPA 2BV9A 3EJTA 5A6BD 1V3LA 3GXPA 3F5LA 3VSTA 4MNMA 5FIPA 2CBJA 4OOZA 3HG2A 1BSIA 3DHPA 4JKLA 5A6SA 1H2JA 2FE0A 5E09A 3HMCA 4WKHA 2C0HA 4DM1A 3BMVA 4LX4A 2E0PA 1ISVA 1M53A 1ISZA 1VJZA 2QHAA 4DWSC 1EDTA 3U7VA 2ZWZA 4JAWA 5I3DA 4AIEA 2Z1SA 4W5ZA 2FDMA 3CHDA 3F5KA 1RD6A 1UKPA 1DHKA 3AIVA 4MDPA 1WNOA 4QCEA 1W3LA 4P8VA 3DX3A 1M7XA 1UWIA 3OLEA 1QNRA 1DWAM 5IHRA 1UD2A 4JFTA 3B9AA 3WNKA 1V6UA 3AISA 4D1JA 5BXTA 2QLYA 3A24A 1HP4A 3ZM8A 1QHPA 1FH7A 2OSXA 4Q7NA 2FHCA 2VR5A 3H53A 3KZSA 1H0GA 1QNOA 1UH4A 1H5VA 1R7OA 3KE0A 4HU0A 1HWWA 3U5UA 2J7CA 2XVKA 1W32A 5DT7A 2PF0A 1K9TA 3MUIA 3EBVA 1UA3A 4GIAA 1TR1A 3PZ9A 3B9EA 2QMKA 3ARSA 1CXEA 2G3MA 3S2CA 2BS9A 3EMQA 1RPKA 1LF1A 2GDVA 3HG5A 3WY1A 3AHTA 2YJQA 2BVTA 3GH7A 3GYCA 4D6DA 1ZJBA 3VGHA 4PTMA 1UWTA 1CNVA 4PMYA 1QNQA 2JEQA 1VEPA 4WF7A 2Y8VA 1WZAA 3ECQA 2J79A 3UERA 1V3MA 3MKKA 4TX6A 5AC5A 3TTQA 2EPLX 1VB9A 4FK9A 1TA3B 4GZJA 2RGLA 1J01A 2DSKA 3THDA 1GOWA 4KH2A 3CZGA 3ARRA 3MSDA 4MJ4A 4HOZA 1W91A 4TX8A 2WCGA 2BXYA 1KXTA 4P8UA 3LMYA 4C7DA 4M1RA 3PZVA 4W85A 1R34A 5I79A 5JBDA 4AMWA 3PHAA 4UZUA 2J75A 4WKFA 2XGIA 1R47A 3AIEA 3PZGA 2WMJA 1TMQA 2XN2A 3EJPA 1C93A 3WF3A 1QNPA 3K4AA 4IISA 4UCFA 3RJYA 3WEOA 4URIA 2VR4A 4MB1A 4Z2GA 3NYDA 2W67A 3TOPA 3CZLA 2Y4SA 1ITXA 4NZJA 5ABFB 2YL9A 3BUQA 1VFUA 5DO8A 4PMUA 2CESA 4F9JA 2O9RA 1PX4A 3GDBA 1KFWA 2VCAA 3VM7A 1QNSA 4J3WA 1R75A 4UTFA 1IZKA 1TQUA 4UQEA 3L4UA 1ESWA 3PZTA 2PWHA 3FY1A 2EADA 3BMWA 1QWNA 1MYRA 2UY4A 4UOZA 1R87A 2WKGA 1XYFA 3WD3A 1OT1A 1GHRA 2YDSA 2Y24A 3W26A 1X6NA 1R46A 2PB1A 1LL6A 1XRVA 3VIOA 2VQTA 4S3JA 1H3GA 2XVPA 2DQXA 3AS2A 4UQAA 2F7RA 8CGTA 5A94A 3MI6A 3BVUA 2D20A 5E9AA 4HA4A 1U2YA 4RE2A 4PUDA 2OSYA 2VX4A 3VIFA 3MUAA 1E4IA 4PCTA 5I5RA 3EDEA 2FH8A 2AAAA 2X2JA 1VBRA 1O7DC 1QBAA 3FHQA 1G5AA 1PIFA 4TXEA 1KGXA 3ARZA 4NF7A 2FGZA 5I2UA 1B9ZA 1H0IA 4HPGA 1JZ3A 3N1AA 1OD0A 4W93A 3MS8A 2VNCA 1V08A 3PBGA 4TVUA 2WBKA 1G01A 3WSUA 4ZEPA 4AZGA 5A8NA 1MFVA 4EANA 4PTVA 2DSZA 4EE9A 1H4PA 1PEZA 1UWRA 3RILA 1ISYA 1MW1A 1BPLB 2XVLA 3MU7A 1UZ4A 4L4PA 1SZNA 3IANA 3DYOA 4ZENA 1Q4NX 1CEOA 3ARVA 5BROA 4AY1A 1Q6CA 2OW6A 2GJXA 2WSKA 4UZSA 3S5ZA 1CGUA 3EMCA 2VUYA 1X1NA 3BUIA 2WMIA 2DT3A 3VMNA 4E4PA 4F9DA 4AXNA 3CHCA 4XZBA 3W28A 4M80A 1XGZA 4LYRA 4W87A 3M07A 1AVAA 1NWUA 1ZBVA 3A22A 1SMAA 1FA2A 3RCNA 1F4AA 2YA2A 4U3CA 2BY1A 3VD9A 4CN6A 5I0DA 1GOMA 3CV5A 3DECA 4XV0A 2CETA 5CPTA 3AIRA 2EJ1A 1E6ZA 3VSVA 2XFRA 4NX0A 2WVVA 3WNPA 3SCNA 2WC4A 3GM8A 3VOCA 3ARTA 3BC9A 4IM4A 1E43A 1UR1A 5A2BA 1SR0A 3GBEA 4ATLA 1XD1A 1UWSA 4TVCA 1EH9A 1UD4A 3KL5A 3WIJA 1CGWA 1IV8A 4UFLA 4PMDA 1KXVA 7CGTA 2WHLA 3W37A 1JFXA 1R7AA 1G1YA 1TQWA 3W6MA 4UQ9A 4JFWA 3WUBA 2DH2A 2E4TA 4CU7A 2DDXA 4ZFMA 5KEZA 2VT0A 1J0JA 2J7BA 5ABHA 1U30A 5BRQA 4IUGA 2Y2WA 4AMXA 3AYSA 2G3JA 3D50A 2FHFA 1KR0A 3B9DA 5D9MA 4UQCA 3WKZA 2WCAA 5DMYA 1AQMA 3N18A 2WHKA 5BCAA 4AISA 1MW3A 4MNKA 4GO8A 1HP5A 4BQ5A 3CO4A 1PBGA 3VGGA 2DIEA 2AOSA 1BG9A 1XSIA 2GJRA 4NRRA 1SFSA 1DWFM 1ECEA 8A3HA 3K8MA 4J27A 3NSNA 1P6WA 4E8CA 1EOMA 3SCTA 5LYRA 4B3KA 3AZSA 2Y5EA 3AI0A 3AMDA 1QVBA 3GXIA 1NH6A 3L4XA 4MTVA 3I3DA 5HNNA 4CGTA 5FL0A 5CJ5A 5A6KA 4FNPA 2WHJA 3VKKA 3GH5A 5LA1A 1KBBA 5FL1A 3CLWA 3BXWA 5CPQA 2YL6A 4Z2LA 4HA3A 2D3LA 4FLOA 2Z1KA 1UD6A 1JAKA 1WKYA 3CZNA 3M46A 5A6JA 1KQYA 4EK7A 2XUCA 3VD7A 5A95A 3VDBA 4HA1A 5M03A 1NP0A 3ZOAA 3IK2A 3UG4A 2XIIA 1E3XA 3VMOA 3AMLA 4PMNA 4PTXA 1GOOA 4AIOA 1KGUA 4GZIA 4UOQA 3UESA 2EXOA 3GXFA 4AWEA 2F7PA 3VD5A 3A47A 3AHVA 4DWSB 1JYVA 2WVVB 1GW1A 4YPJA 4F79A 3BAIA 4LPCA 1B3XA 2UY5A 4XUYA 4KRTA 5GNYA 2YIHA 1NARA 1W9UA 1FFQA 3U7BA 1EGZA 1J0ZA 2VX7A 2NT0A 3LRKA 1ZB5A 4FMVA 5GQBA 2BY0A 2E8YA 3NCOA 4P7OA 5EBAA 2F7QA 1UR2A 4D6FA 4PBGA 1JZ8A 3GNOA 1CGYA 2V3DA 2VRQA 1CIUA 1B3VA 2X2HA 3HJEA 3CUIA 4J3XA 3OGSA 2W5FA 3CBWA 2EABA 1HTYA 2XSBA 4QLJA 3AS0A 3ZSTA 3RJXA 3SUVA 2D1ZA 2E9MA 1MFUA 4YN5A 3EJRA 1V03A 3PTMA 3WF0A 3ARYA 4AZ6A 2CBUA 3VIGA 3BLPX 2VURA 1Q6FA 3DX4A 1HVQA 1JI2A 1MWOA 1UD8A 5A6MA 3AMGA 2V3GA 2GJXB 5ECUA 3RIKA 3TA9A 3QOMA 4W89A 2XTKA 2CHNA 1DP0A 1CZ1A 1E6QM 1CGTA 1EDQA 1NOFA 3IJ7A 4OUEA 1W3HA 1AMYA 3TONA 2XN0A 3W6LA 3VD4A 4AEFA 3AIBA 3WH8A 1VF8A 1XYZA 4WSJA 5AC4A 4V28A 2CXGA 2WK2A 2XJ7A 2VZUA 1UKSA 4FLRA 2OYLA 2F1BA 1K9FA 5HPOA 3EDJA 1FH9A 2WBGA 2WMHA 1UQZA 5ABEA 4N0RA 3BUPA 3AHZA 2BFGA 1BAGA 2F18A 1IZJA 2JF6A 1OSEA 2E9LA 4CN4A 5M3WA 2WMGA 1RH9A 1ZBWA 3SCSA 3AQUA 2W62A 1JIBA 1E40A 5DEZA 1EO5A 2B31A 5IFTA 4W7UA 4PMZA 3GXDA 3VX1A 2NSXA 1PZ2A 3D4ZA 5FKYA 4MADA 3CZSA 3WQ8A 3CTTA 1UOKA 1VJSA 4DUXA 4GO9A 2ZICA 2JIWA 4LYPA 2YL8A 2J8FA 2ZUSA 4CD8A 3FAWA 2JFEX 5HXMA 1F4HA 4JIEA 2J77A 1KTCA 1KTBA 4U2ZA 2BVDA 1E5NA 3EDFA 3SCOA 3AJ7A 4DM2A 3BCFA 4A3YA 1JDAA 2D0HA 1NWRA 1HVXA 4AIUA 4NXSA 3SCPA 4D6JA 1CXHA 2PWFA 3WH7A 3PZMA 5D9PA 4JHZA 1WZLA 3D4YA 1JD9A 4W8BA 1BGGA 3GTNA 2J47A 1CGXA 1Q6EA 2FHBA 2QPSA 1JFHA 1R33A 4H2CA 3N17A 2XPKA 5D8WA 3A23A 4JZ5A 4PCSA 2NT1A 5ABGA 5E1QA 1D2KA 3LXBA 2YFOA 4FNQA 3OBAA 4AZ7A 1EO7A 1V3KA 1KGWA 3ZMRA 4YHGA 5FCZA 2WC7A 3A5VA 3GH4A 1BYDA 1J12A 4MJ2A 2W91A 3W0KA 4UFKA 1JDCA 1NQ6A 2OWXA 3FW6A 3LRLA 3D3AA 1UWUA 3WBAA 3WD4A 1CWYA 3LX9A 1LL4A 2BHZA 1WE5A 2J4GA 4LYQA 2VVNA 2YKKA 3A4XA 4WJXA 3BAXA 4MAVA 2ZUNA 3VIPA 3F4VA 3TTYA 4CCDA 3MMDA 1S46A 1B3ZA 2VL4A 1V0NA 1ISWA 2OYMA 1ISXA 5A3HA 4QCFA 4ATDA 1OBAA 3N9KA 4U5IA 5A69A 4BCEA 4AYGA 4B9ZA 1WZKA 5JIWA 2DH3A 2UY2A 4HMDA 4X9YA 3QGVA 3NSXA 3WUFA 1DEDA 1QHZA 3WNOA 3L4VA 1W1YA 5A8OA 1HXJA 2CKRA 3TTOA 2C8NA 2E8ZA 3N15A 1PJ9A 1OGSA 1V02E 1LG1A 1UKTA 1UR0A 2VX5A 3AHXA 3NDZA 3SUTA 3RM4A 4PRWA 3QHMA 2WVTA 4N42A 4GKLA 1WP6A 1V0MA 1JD7A 1XHGA 3OLDA 2WSPA 2WZEA 3AYRA 3KL0A 3OLIA 1GORA 3VDCA 3TV8A 2CERA 5BXSA 1JZ7A 5FOOA 4P7NA 3POCA 4FNSA 4AZCB 1JNDA 1E55A 3CUJA 1D3CA 1GQIA 5IHSA 4XZWA 1GPFA 3SUWA 3SEPA 2CIPA 1HN1A 2HISA 3M6DA 1E9LA 1UR4A 4AZIA 3BLBA 2WLZA 3W81A 1CGVA 1OGGA 1E15A 4H7VA 4JKKA 4H04A 1ITCA 1PPIA 1R85A 4P7RA 3QOKA 1MW0A 4JFSA 3CZEA 2UY3A 4HMEA 1QX1A 5HPCA 1YHTA 1X6LA 1ZBKA 3WQ6A 3AZTA 3AMCA 3AZRA 1BG4A 1B0IA 4AEEA 1PIGA 3DHUA 4CCEA 1ZBCA 2W66A 2GVYA 4YHEA 1OD8A 1G9HA 1H1NA 4CD5A 1E0VA 4UR9A 4Y7EA 3I3EA 3A4WA 3WMCA 5A2AA 1W9BM 1C90A 2WMKA 1LWHA 3K1DA 1JGIA 4CVUA 3WNMA 2VC9A 4JFUA 2O92A 3W4RA 1KCLA 5D9NA 4F66A 5KZ6A 1DTUA 3DDFA 2WB5A 1A3HA 1E4MM 1MQRA 4UQBA 1MW2A 1XCXA 2X0HA 4X0NA 2D0FA 3L4TA 2E3ZA 1KWGA 3H54A 2VO5A 4BZYA 3VPLA 4AD3A 1JL8A 3RM9A 7A3HA 1D7FA 4CD7A 4AC1X 2YBTA 1W3JA 1OM0A 1XH0A 5CPSA 3BAJA 3ZR6A 2VRKA 3CUFA 2ZX6A 4J3TA 1E6PA 3OGRA 4DO6A 4JKMA 3D51A 2CBIA 5CQ1A 2ZE0A 4P7LA 1PS3A 3AROA 1LWJA 5A6AA 1BVZA 4OBRA 5EFFA 3WMSA 4MNLA 3VIJA 2XWDA 2ESCA 2OWWA 3FN9A 1VAHA 1T0OA 2A3BA 3OLGA 1KXHA 4FNRA 3AMKA 2VRJA 2O9OA 5A8PA 4OKDA 3LRMA 4DO5A 4B16A 1EIBA 3ARXA 1UWQA 1UKQA 4QAWA 4C7GA 2FGLA 2EPOA 2WNWA 2BY3A 1OB0A 4XB3A 3A6OA 5LA2A 3NSMA 3S6TA 1HT6A 4M81A 3T2OA 1XH1A 3BAYA 1VIWA 4HP5A 4MB5A 3UG5A 1HKKA 1FHDA 2PWDA 5JBEA 4R5EA 5FD0A 4JHOA 1UD3A 5E0CA 3EJSA 1L0PA 1WO2A
chains in the Genus database with same CATH superfamily
2E3ZA 1DR9A 3YPIA 1QASA 2WW5A 3MU3A 1FDLL 3OKDA 4XNXH 2UZIH 1Q0XH 4FI7A 1GNXA 1DJNA 2KLSA 2BBFA 3L12A 4E0CA 4N3UA 1CQKA 5IVNA 3R2GA 4JTHA 4YHLL 1XC4A 3CLFL 2G3NA 3DVNA 3GQFA 4FLQA 4CU8A 1HJXA 2D22A 2K8QA 2F8XC 4UC5A 5K9DA 5C71A 4R9HA 4M6AA 4OD1H 2OQYA 4JZJB 5JO5A 3DVNB 2CDFA 2CG9X 3ALFA 4HUWB 3O63A 1M04A 3FNDA 2BW4A 1CECA 1ETJA 1HXMA 1B0GB 1SM9A 2J88A 1C7TA 3HG0A 3MLTA 4MCZB 3FFDA 3N44F 3RAOA 3DX8A 1BEXA 3RPDA 1Q1PA 1E3ZA 2AQ3A 2ZOTA 1B31A 1KFGA 5EBWB 1NIBA 1A6UH 5LBSH 5SWQA 4JQ3A 1F3TA 4JNZA 2ALDA 1JAEA 3HUJA 3RK8A 4XCYA 2J9XA 5I0XA 1K72A 3QXAA 3P69A 3HA1A 1C8QA 2Y62A 2QUVA 2CZEA 1OIFA 2AJZB 3KCPB 2NY4C 4EUPH 1WICA 4PV1C 5D2LF 4C56A 1G94A 4YH6A 4FYRA 5SX5H 2HLEB 2VEMA 1UOLA 1H7RA 1NBVH 2EICA 2WXPA 3WFEH 2VLKA 4MAZA 1X38A 4HHGA 2EPKX 2XFFA 4LCIL 1JZ5A 2WLIA 4OLVL 3ARDD 4IIQC 4MLRA 3QNXA 3D1MC 1GOHA 1EZSA 4MA1B 1DXFA 3SKOA 4EXQA 4QDMA 4ELKB 5I1EL 5HI3D 5F0PB 3TCEA 2VWEE 4DRSA 2ADIA 2Y7OA 4TV5A 1LG2A 4YR6A 2Y61A 1MO0A 1M05A 1F4YL 1R24B 4HU8A 3GY1A 3HRZA 1KJVB 3OGCA 4AT6A 4PGCB 3W24A 3PJSB 2IPGA 4M6NL 2F8QA 1BBDH 3NJVA 3RVVD 3SKUD 1I31A 3DYMA 4AD2A 3MSGA 1X5YA 3UGXA 2HT3D 3ZRCC 2CDGB 5HHOB 1ADOA 4JN1H 2J9ZA 4NUWA 1JWUB 5HNRA 4OZFH 1AL7A 3TWBA 3GHSA 3R06A 3AHYA 1T22A 4MAYC 3REWB 3R43A 4ORIA 3SZ8A 1C91A 4WENB 2AV7B 2YAQA 3VD1A 1UUQA 2FLRT 4ZZ9A 3PY9A 4ODTL 3C2FA 3NGFA 1P4LB 4RNRA 4D9RE 4UTLA 1ADSA 1R3WA 3W27A 1GGBH 1IX2A 1D9KC 2GAZB 3WEZA 4GSXA 5CWSB 2CCRA 4JICA 4RESB 4PRAA 4OFKA 5CEYB 4BJLA 1PX8A 1V10A 3NYKA 4JEJA 1JGVL 2P8MA 5I2IB 3E96A 3FT4A 3TAKA 2CUAA 1LVEA 1ZVYA 2PPFA 1BVNP 3GM0A 4DZ8A 5LSMA 2AQTA 3TYBA 1Y6KR 3IS1X 2WP3T 3BZFB 1VFBA 2BNQD 3CXDL 4HIJB 1GKQA 1TUXA 3EWUA 4R9OA 1A0QL 5DRNA 3W2KA 1DVJA 3E6EA 1VEOA 2AMGA 2PCFB 1MH5A 4HWZB 4P23A 2OMYA 2VR9A 1GS7A 1HNYA 4MMYA 3DBPA 3EBAA 4CKQA 4R26L 3K46A 4UFHA 3UPBA 1KIPA 2FB3A 3KBVA 4MY9A 1XCWA 5B1BB 2Y3NA 5CBBA 2ED8A 5BPPA 3V5KB 5T3XE 3K2UL 3UJTH 4BQ2A 4X6CE 3T2PA 3MRIB 1UOWA 3EA3A 3F5JA 3VNJA 2H0EA 2Y7MA 3L0GA 5JPNC 1YNTB 1TVNA 1QAPA 1DCEA 5D2NC 3N43B 4Z2KA 3WGUB 5J06A 1B54A 3WQ5A 3CLFH 1KPUA 3VVGA 1OSZB 2C3GA 4DPBX 5HHOD 2GQHA 4U1NB 3WDJA 4WHTB 4PY8I 2OI9C 4N0CD 4UV4H 5FYKL 4D9LL 4OUOA 2NUPA 2J7DA 3IGHX 4GQGA 3U1QA 4WI7A 4NN6B 5D2XA 3KPLA 5EMKA 3RZCA 1PYWA 2FZMA 4A63A 4IGNA 4YBHA 4AYFB 4WW2B 3IDIA 5G1YA 5E8NA 1NLBH 4XN2A 1XLKA 4OCRH 4Y1AE 4S2CA 1G9MC 4GUJA 1NDGB 4L0ZA 4PJCE 3TSBA 1DFBH 3QNYA 2XCMC 2BSED 5IB1B 3MBEA 3QRHA 4A3HA 2QPUA 1JGEB 3HB3C 1FPTH 3WD2A 2Y7LA 1E6OL 1G4RA 4Y5XA 3VTRA 3DX0A 4DAGH 3L9BA 3QFDA 3EKCA 2UY6B 2I26N 4Y19E 2HLAA 3T09A 1LYQA 4DTGL 2IBZY 4PE8A 2IS7A 1Z6KA 4LVGA 4F0LA 3VOFA 4NAEA 1ROCA 4FJYA 4LASH 1LHZA 2XZQH 2Y89A 3OTRA 4H8NA 2WZMA 5BXPA 3IJDA 3ISWA 4RE4A 2K78A 3MSRA 3MUY1 4LLMA 1GZJA 1XPYA 1YXYA 2XRAH 3WDIA 3QH3B 5CZ0A 5BYWA 7REQB 2EEFA 4U6VL 4I13B 4OLYH 3WFEL 5L7XH 5K9QI 3F4DA 2VW7A 3JU2A 4LVOB 3N6HA 4NLHA 2VDNB 4C55A 3B0UX 5HPMB 4LSTH 5JW4R 1W1TA 1FI8C 1EJOH 3RWEA 5J8LA 2FWOB 2X6UA 3TF7C 3WE1A 2CXEA 4IIZA 1FWWA 2PURA 3GRBA 1ZJIA 2AEWA 2XY2A 4G43B 3NPWA 4TLSA 3TCXA 4O16A 1URLA 3P8JA 4BUQA 4BCYA 3FB8A 2DQJL 4KDWA 4LHJB 3GS4A 3V4VH 5T1DL 2A2IA 2HJPA 4BY3A 1T04B 4R96A 4HMCA 3KZPA 4UINH 3LERA 2FX7L 1AJ2A 2CNZA 4PRHB 3N55A 2X1OA 3H42H 1NTDA 5EMYA 4GAFB 1M1XB 1RH8A 2FZDA 5IT2L 5CILH 3WXVL 4X2RA 5FJUA 5LG6A 4Y9CA 3OO2A 3HB3D 4PRID 4QG9A 1O9VA 3P73B 4F7MB 4P46B 2DD8L 3DBXB 4C1KA 1NCBL 4K0OA 1JNNL 1EL3A 1MCPH 3OR7A 2WKOA 3H7BB 1HH6A 4AX6A 2CE6A 5MEQA 3QC6X 4DBSA 4XNQB 5G4HC 4RNIA 1LMIA 2NQDA 3BW9B 5TPWL 3RYMA 2IFGA 2ZSVA 4M8RA 3RVTD 1Z41A 2V2XA 2JJWA 1GQJA 1F11B 1CFVL 2ZSVB 3VWJB 3CE1A 2V5MA 3BQVA 4P5TB 1GQNA 5HI4D 1HL2A 3LHTA 4FLSA 2BNQA 2ZYRA 5D7LD 1SM3H 3F12B 4GOSA 1P4UA 5F7DA 1JXKA 2V3EA 4I9WE 3P2DA 3MTXA 3TNNB 4MVBD 4C57C 5JXEA 1HJWA 3G6LA 4B4HA 2BFVL 4OF6A 4WCYL 4HKPA 1MCOL 4XPHL 3MO7A 5FF4A 4NWUH 4MOZA 2G4EA 3WQOA 4NHCL 2UZ9A 1JHTA 4WUKL 3VNIA 2QKFA 3WFHB 4KRNA 4BUGA 3FXYA 3OBEA 1Q6RA 1XO8A 6TIMA 1LUCB 4Q52A 2F9BT 2QZ5A 1W8EA 1XKYA 3T0EE 1OGAA 1UTDA 4QEHA 3DFHA 4J3VA 1UHVA 5I17B 2PCPA 4ZXLA 2Y8KA 2PXYD 2RD0A 5AC6A 2ZUXA 3MFGB 3E3QC 3HI5L 3RDTC 5A8MA 3DIFA 1TZGH 1CYXA 1EZVX 2Q8BL 4QYAA 3ZLHA 3BEWA 1X9RA 1OP5K 3F4WA 5DMGD 3N42F 4OZIB 3WFLA 3VA6A 2APVA 2ZUVA 3BCDA 5L0QC 3OF6A 2BOGX 2QIWA 3GDRA 4YSOA 4KJWD 3KPSE 1SW0A 4K7PL 3PV7A 4MZ8A 3BH4A 3ILDA 5EU3B 3WY3A 1K9EA 3P6LA 4LB8A 3VIHA 1YEFL 4AAJA 3DVIA 1QRND 3WL1A 5HDWA 1C5DA 1FPTL 1F4YH 1J0KA 4PBVC 5J56B 5EUOB 2LFGA 3QRLA 4YS4A 1XXXA 3BTNA 1U8KB 2J7GA 1SJVA 1UC6A 3BDYH 2WIIB 4WK0B 4HZLA 4YLBA 1W5OA 1EANA 2XZQL 4MDJA 2ZP0T 2QV4A 1SVDA 1HOCB 3CZKA 3WJLA 2CKBB 3M5ZA 2O6PA 5L9FA 2FQDA 2OMTA 2GJZA 3WF1A 1QI3A 2WLHA 3IXTB 2TSYA 1NMCC 2VCBA 5EU7E 1HQRA 3BSZA 3M47A 4TO8A 3W53A 2BNUA 2B4CL 2CH8A 4NNYA 5MP6L 4K23L 2I17A 4J2XA 3IXTA 2B15A 1KCRL 3GMPA 4JTQA 4LL4A 3FN3A 3ASOB 1ZVHA 3NUKA 3WEMA 3ARGA 4PD4J 5BV7L 3PAYA 2X9ZA 3K0YA 5E6UB 3F85A 3RWJB 1W1B1 1BOYA 5AOJA 2VUNA 3DAQA 4XBPB 3RPBA 1IAIH 3LDBC 1GK8A 2PDPA 3QO0B 1KT2A 3W7GA 5C6MA 4JN6A 3U0PB 1FFTB 1TETH 1E4LA 1Z32X 2Y7SA 2Q3XA 4OGZA 3W2LA 4L5FE 2WZIA 3SGZA 2ZX5A 2XM2A 4NYLB 3SRDA 5FDWB 2R91A 4WU5B 1W1VA 1JDFA 2DORA 2FR4B 1J8HA 2AXWA 3LSCA 1CG9B 2HRLA 3JVFC 5LNEA 3ISIX 4A3UA 4LK4A 4Z17A 5CILL 3U0TB 3WXVH 4NZCA 1CF1A 1PDKB 2O5XH 4I3SL 3EPMA 4HK3N 5EO0A 1BVLB 3MUGA 3PFQA 1N3NB 3WN6A 4DOHB 4HLJA 4XBGB 3G6DL 4NOBA 1C9SA 2QCMA 3Q2DA 4BK8A 2J5WA 5AVRB 2IG2L 3V75A 2EG6A 3OTTA 3LS5L 3HA0A 4JFPB 5MEPA 3H7BA 5F1NA 1G4MA 1OT2A 4HIJA 4U4BA 5IB5B 2HRGA 2XBTA 3RL1B 1TLMA 4OJFL 5J1AB 3T6XA 1YEYA 1QLEL 4MXWH 4LESA 2O1AA 2PBOA 4EAMA 2L4OA 5HUPA 1IARB 1ZHKA 3Q2VA 2FT7A 2ZDRA 5GS1B 2HCVA 1L9SA 3RCYA 3NTYA 2W0FB 4PCFA 4I7ZC 4XODA 1CIDA 4PRHE 5M7QA 1DBBL 3T8XB 2N3JA 4AGOA 1DKWA 3RVUD 5GXBB 1TYEB 3QUZA 1HP5A 3MLXH 5I1IL 2C91A 5FACA 3W84A 3HC2A 3UYRH 2PAJA 1N0LB 2BDNL 4WUKH 4FP8L 2E75C 3QUML 1EJTC 3G1SA 4N90E 3V10A 5FEPA 3T0AA 1SVZA 3NSFA 1QZNA 4AVIA 4N90D 4XSLA 4LRNH 3N6YA 3LD8C 2A7PA 2SEBB 2EKSB 3EJQA 3II3A 3PQYD 3QJHA 3OKNB 3W7LA 5IW1B 3NJIA 5I8OL 1H3WM 2A6IB 1QSEA 4RFNB 4NDMA 4H13C 4AYFA 2ZNWA 3BT2H 2QCDA 3H9SA 3VFUB 3CYJA 4LNYA 3BN9D 3NJMA 3ZMEA 2DS4A 2FO8A 5L8KB 3EMZA 3ORJA 4PVBA 3QKEA 2Q7YA 2PBGA 3HMXL 4IOSA 3E5BA 2DQDH 1WWBX 1EOKA 4IBQA 4S3BA 3F7LA 3I10A 4K7PH 3BAWA 3NH7L 4FF7A 3ZJ8A 4LEEA 1WAAA 4KV5F 1RXOB 4IS6B 4K71C 1UYWL 3UETA 3VOIA 1UUMA 1D6EA 2DDQL 2XQBL 1RZFL 3BSHA 4Y16C 3W01A 4HNUA 4FE9A 1QW9A 3IYLW 3KLHC 4QE4A 4J1OA 2ZA3A 3GMMB 5IB4B 5B7EA 1YLVA 1ZZMA 3BDYL 2A6LA 3FXIC 3IKCA 4HYTB 4KPHH 4E0RB 1LO3L 3HRPA 5H2BA 5C0AE 3B2VH 3CJJA 2FDBP 5FLUA 4G8TA 1MCQA 3V0WH 2G4FA 2F0CA 4JDYA 2GK1A 3ABRA 3F6LA 4XT1C 3UL4A 3LNEA 3NOEA 3QR3A 1QWUA 3NEHA 2AK1L 4AHOA 3S96B 5EOCH 4A3RA 1GVYA 4JUSA 3U48A 2P44B 4GQ9L 4S3FA 3SURA 2I32A 4KV5E 4WY7L 5TJWK 2QPFA 4PGCA 5IB3B 2ABAA 2YB1A 4HN8A 4JM2C 3ZFHA 1L5GB 1JGUH 1FH5H 4LIQL 4LFHG 2PF8A 4KZEL 3QXWA 1MNZA 5JHLA 3W86A 3HE6B 4L9YA 5HJXA 4MZ1A 5IM51 3C09B 3IJHB 1BF8A 1UXSB 4LBRA 1OOAA 5I1GL 3II1A 1FXPA 1L6FA 3QISA 5DMJB 1TTFA 3EOAB 2PTVA 4MDRA 5BVJA 1LP9B 5I28A 1XLFA 2QVHA 4YTSA 5EDXA 3L21A 3U9UB 1YEDA 3K3QA 4APQB 2R24A 2OV0A 3CV2A 3K4DA 2ADFL 2GQ9A 2HKHH 2YSTA 4P46A 4O2EA 4AJVA 1KM4A 2OGYA 5H35A 2Q02A 3WX7A 1MUWA 3KBMA 4C6KA 3VRJB 1MCWM 5H8MA 2BFVH 3W1QA 4G70B 4FNUA 4XQ6A 4FG0A 3JTBA 1WKDA 4TTUA 3VNYA 3IWPA 4I4WB 4WDWA 1ME7A 3GLEA 1U41A 3C9NB 1IGYA 3EFDL 5ITBH 3ANUA 1VYPX 4P4KD 3MVTA 2AQRA 2B08A 2FEJA 4PH8A 4RVBA 4F7PB 3VIIA 2N4IA 3W38A 4OJFH 4S2SA 1YMYA 4EF8A 2VI0A 2CM6A 5GJNA 3RBGA 3WNNA 3KVMA 2EE9A 3BVTA 5KVDL 4B7IA 3FRUA 4WSKA 4A8RA 4E42A 4NRSA 4PS3A 4M5SA 4GRLD 4ZTPH 2B9BA 5EOCJ 1MCFA 2XV3A 2CLKA 2RCSL 1NOWA 4PUUA 3NIFF 1LZOA 1TJ0A 1RZPA 4B9IA 3VGDA 5A8GA 5AOKA 5LGXA 2NLYA 1QKZH 2HVMA 3PJUA 3VUPA 3F05A 1PTDA 3KM1A 2J1YA 3CGTA 3EJJX 3T0DA 4LQFH 3LKRB 3TBSB 1POJA 4MNQD 3GIZH 4JM2D 3SJVA 4UTBA 4AQ1B 1V6VA 1FFOB 2XN9E 2DEXX 1OP5H 3TWCL 3B1TA 3NABL 1W0YT 1L6XA 4C4KT 4FQ2H 5I8OH 5SV4A 3WIFB 2DWEB 2WQDA 7TAAA 3O11B 4QIRA 1OAJA 4MJZA 3MV8E 5L2KA 4X8JA 5IVXF 1CICC 1HEJC 3ALXA 2XG9A 2HJLA 1IKNC 3H7LA 5DURD 2ICEC 1IBFA 4RAVB 3IGAB 1IC7L 5B1JA 1JNEA 2X2YA 4L37B 1DQTA 1HKFA 1SJHA 2JXMA 3ZX1A 3NA9L 1HKIA 3GU9A 3PULA 4DH2A 2OW7A 4ZR8A 5AL0A 4ROQA 4PJGE 3SZ6A 2AGTA 3RF9A 3DA0A 1XF3B 1WAWA 2DDQH 4N68A 3HTLX 2DM3A 1BVKB 5ID1A 3Q58A 3HMWL 2NY6D 3TVMA 4ZG1A 1G7JA 1NGZB 3BP6B 1N5YL 2GTZB 2UWEA 4LL9A 3HE7C 4WWKC 5DC4B 4DGYL 2GITA 1QR1A 2XGBA 4UFJA 3CVBA 5TTRA 4UV7H 1Y0EA 4EZJA 3FT1A 5JHDB 3BKYL 2YPVH 5ISZE 1XGEA 3EYQD 1T0PB 1MY5A 3S34H 1FH8A 2FJUB 1TPEA 4XP6L 3FQNB 4QPEA 3WD1A 4Z7WA 1ADQA 2VYOA 4HW6A 2AK4B 5I6SA 3AIWA 4I48B 1BCIA 4EKJA 1P7BA 1ESOA 3C5XA 1IC4L 4P2OC 4RBPK 3HNVH 5F8QC 1LK2A 4OOUA 1FP9A 4WKZA 1KLGA 2VL5B 3VJ6A 4DGIL 2VDOB 1O7VA 4KESA 3WDRA 2PDXA 3CHQA 1I1AC 3JTSB 3QDME 3B8SA 3VH8A 3LS5H 3DXAB 5CBAA 2R29A 5BXRA 1L5GA 3GXMA 5J7CC 5AW0B 2D69A 3GAKA 3EOOA 3NVTA 5LHFA 3VYPA 1JZ6A 3T08A 2VX6A 1QYGH 3FRPA 3HE6A 2PEVA 3DX6A 4HOWA 3US0A 1QR4A 3RJQB 2F61A 3FRPB 1OINA 4BFEA 2ZCZA 3GF8A 4JO5A 4L8SA 2PTUA 3P9MA 5D7KE 2P28B 1H6EA 5KINA 3Q7JA 5D93B 1EF2A 5KVGE 3LQZB 4EBQH 3COOA 3N4FA 4XN8A 3OZYA 4F24A 2ZCKL 4LLWB 1MUCA 1BFOA 3BOFA 4TVDA 5KZMA 1WB0A 5F9WB 3QT2A 2OMXA 4FAMA 4P46C 5F1VA 3CFEA 2GCYA 2HFFA 4NBZB 2QQLL 4UTBH 3X1EA 1SQ2N 1H7PA 2V5TA 4FXFA 1T6VN 3WUEA 4P48A 4AL8C 2B5IC 5TK4A 2ADGA 4NO0B 2XIOA 3SY1A 4M8UA 3AS3A 1YG9A 1I3GL 4AUJA 2J4WL 3U4EA 2XG4A 1FGNL 4K94H 1LE9B 1E4WH 2ONEA 2BHFA 4DNLA 1PZ3A 1KB9K 4G11A 1E56A 1EYEA 2A3AA 4MMWA 1E7VA 5EDSA 2R0LH 3FB5A 4NZFA 2H2SC 4IM8A 1FL6B 1MJ8H 1KTJA 5FJOA 3ESOA 3CAFA 2OZ4A 3M5VA 4OQTA 3V4UL 1TYGA 4MS8D 5AW9B 4ETQB 5TDPA 1VGKA 1JRHH 2ROYA 2PC8A 4AD1A 2FFCA 4FQ1L 4JK0D 1OPOA 3W7RA 5I66B 3VKAA 4ETQA 4DIAA 2GI0A 1TEYA 2BP8B 1ZLWK 1G4SA 4PY8J 2EE2A 1S2UA 3IMVA 3BGAA 4HUWA 3RZWA 3WELA 4Z3IA 1OC7A 2ASHA 1I8IA 2NXIA 4MA7H 3M4HA 4AE1A 4HIEB 3T8MA 4JPIB 4X83A 3M0KA 5DRIA 2YL5A 5I74C 1HHJB 4TTGA 4EVZA 3W7HA 2O61A 1WYJA 1CZ8L 1BM3L 1JV5B 4M43L 4ORGA 5E70A 3DFOA 4JX4A 5SWQB 3RDKA 4BF7A 3U7YL 3HC4L 4RGMC 2LLLA 2ZOLA 4PP2A 4KDTA 2O61B 3VIMA 3HOJA 3FONB 1SGJA 4FFZA 3UBXA 4RAVA 4YX2H 1I9CB 1DE4B 3P4NB 1US2A 4DP9X 3AYVA 4JRXB 3T3MF 2DWYA 3INUL 1VFSA 2JJSC 4QOKE 4P5MB 5F4XA 3LYEA 3SUUA 1S7VA 1R9XA 4H40A 1TQBC 3HF3A 1JYXA 3LHYA 1L0QA 4I3RL 4Z9KB 3BURA 1QO3A 1EIXA 8A3HA 1KM2A 3EF4A 5E4IA 4E9XA 1YY8A 5FOBA 1RZGB 1FZOB 4V1YA 3AT8A 4PJ8C 1LOLA 3DKLA 3P1VA 1RAMA 3AQDA 3NEOA 5IBXA 5C8BB 4HZ8A 1O9WA 4MXVE 4X5QA 2Z31B 4NU7A 3UCRA 4NSKA 1D5XB 1ZHNA 3JZUA 3P8IA 5C9UA 3QV6A 1Q90A 2DWTA 3K80A 4BH7B 4LUJA 4UNUA 2CO4A 1BMGA 3EOBB 1TMCB 4MXQC 3SGEH 2A9NL 1OABA 4HISA 4K68A 4MNLA 3FYEB 1SZEA 3E0GA 3T4AC 3BZEB 3TFXA 2D31B 2PC4A 4UNIA 2PZ0A 3ZUNC 2CNCA 1FHUA 1XGDA 4Y9AA 3L3DB 4PJXF 4DVBA 1OFEA 1A3ZA 3UWYA 1O6VA 2FH6A 5DD5H 4I6KA 5C0GB 4TOQA 1HKJA 1XH3B 3HPAA 2FATH 1FBAA 2X4RB 3UTQB 3BPOB 5M95B 1LORA 2Q3AA 3F6JA 2IPJA 2NWRA 1Z44A 4R7OA 2GY5A 3MOAL 4V1XA 1KC7A 1IYXA 3BUDA 1XGTA 4UB0H 1AD9B 5DYOA 4MFDA 5EU6A 1A0EA 4XMLH 2CLPA 4LW7A 2ZRXA 3NO1A 3C09C 4KUCF 2W1NA 3MVSA 3OJDB 4B3EA 5J13C 3N19B 1XQ4A 2WQWA 3Q5OA 4R97B 1VBGA 3MHUA 3HHRB 4L1LA 4WTQA 5DRXA 5JXAH 3E5PA 1SVCP 2NY0B 2W79A 3K5RA 4FADA 3WEXB 4XB8A 3GHPA 3ZTCC 2YGNA 2Y1ZA 4XPFL 2PGEA 4C1NB 1WAPA 4ZMYA 4TUUA 5IGXL 1IT0A 4RUBA 4XI5C 4CNIA 5JW5B 4GZEA 3BUTA 1KM0A 2GCYB 1JGLL 2HFFB 5HYJB 1E71M 3OZPA 1RHFA 1JVNA 2AXFB 5IBUB 3NVDA 4J7RA 5IHZA 1REQA 3L3IB 4LEFA 1U92A 3EX6A 3ZTDC 1J5TA 1UJ3A 1KTDA 4FNLL 4HFUL 4PJAF 4XAFA 4ZAKA 3QYCA 3RWIA 4OT1H 3OKDB 3RX3A 3PWPA 3CMJA 5FCUH 4RW3A 3KL3A 1MJ8L 3AICA 1PQZA 1WXJA 1DUZA 2CWXA 2WJFA 4LOVA 2BOLA 3HHSA 3SO5A 3V7AE 1DQKA 5C1MB 3LS9A 5TAOA 5IQ9B 2HFEB 1GR7A 3MLPA 3FYPA 4M56A 3X11B 3GNRA 4O13A 1SLWA 2QAFA 1H8OA 5GS2H 3QIUC 4AM0B 2NYKA 3FFOA 1J96A 2VKZG 4DGYH 1LRTA 2AW2A 2Z34A 2B1HL 4NRYA 2RGMA 3E0IA 3FT2A 1E5ZA 4JMNA 3V0VA 2DZEA 5T1JA 2DEPA 1U91B 5T1LA 4XOEA 1WSST 1JCVA 3ZIZA 2C9RA 5DJAB 1KN4H 1MUJA 4FYSA 2MQ0A 1UURA 2QBWA 4PJXA 3MRHB 3ZN6A 1UADC 4EO5A 5MERA 2H47C 1NP2A 2PU1A 4KCVA 4UNLA 3T0BA 1J0YA 1R5IB 3Q4DA 3EDKA 5FYLD 5B80A 1TCRB 3O3AA 3TBTB 5T3ZD 3ULUC 2XV0A 1JNLH 4OGAC 1I2PA 1GJWA 3NAAH 3QXDB 4QD2E 4QR7A 1UJQA 3QWNA 3AWOA 3C6SA 1Q6GA 1KCKA 4XN1A 3AXXA 2CK0H 1HCFX 2J1XA 2JI1A 2IALB 3WOVA 1JPMA 5A2LH 1XLDA 1S5IH 2WOBA 2CLLA 1WBHA 1Q45A 5CEZD 3E0FA 3FQRA 1FL5B 2OT1A 2HDJA 2TPSA 2AITA 2XZCL 3L45A 1IQWH 1U8KA 3LNPA 1QYGL 1Z9LA 2WY3B 4M7ZB 1SSGA 1XCTA 3U2SA 4JL1A 1TZ7A 2AMUA 2F53D 4JGMA 1OWQA 3GMQB 3WLRA 4J4PC 1A9VA 4DCQB 1BZ7B 3W0WD 5MENB 1CFTB 3AREC 3O6FB 3WMPA 1P7TB 3DGGB 1QVOB 2AAMA 3PZNA 1IM9B 2Z91B 4J4KA 2IWFA 1EA9C 4Y5YA 4KRUA 3B97A 4DN1A 2I5QA 3Q2LA 3CT7A 1VPYA 3G6AB 1W2PA 3N41F 2MJWA 2BIQA 1ORQA 4W9CC 5FYJU 3R0KA 1T80A 4XNBA 1KT2B 4UIOA 2WD0A 1DLHA 3V0SA 3BL3A 1YX1A 2NX5E 4P3DA 2BCMA 3FOLB 4ZQKB 2MCPL 1WA1X 4LSUH 4QHNB 4RSVA 1K03A 1B1YA 5KS9F 4H8UA 1YYML 3AITA 5FDWA 2CEQA 5KVDE 3ABZA 1SFDA 3SRFA 5D5MB 3VDAA 3FSVA 4AMCA 1QK2A 2ADAA 4DT2A 4G83A 5K1NA 5DMLA 4AD4A 3ITOA 3P9LB 3B8TA 1VPXA 2VC6A 3MUCA 2OZ4L 1DJYA 4JFQA 1J87A 2X88A 5AAPA 4EOWL 3UYIA 5ICYA 2AQOA 1BVLA 1EBPA 2AQQA 3BW9A 3QQDB 4JPWH 4KMLB 4XP9H 2REQA 4WGVB 3IDXL 3GXNA 2EVHA 4IIEA 3PGFH 4S10A 3VFSB 2QVFB 2PD5A 1KFLA 5C0AA 2HVNA 2LABA 1LMKA 2W9LA 2ZXBA 4X6BB 3FYIB 2F1AA 5D7JD 4DEUA 1RJPA 4NJJA 2KERA 1V0KA 3KYAA 4BHUA 1QFPA 1E5YA 2PTWA 3UJSA 3ZDZE 5HYJA 3T0CA 3FXGA 2A74C 2VQ4A 3ZQWA 4KZDL 1KIUB 1RUQH 3GMNA 4GI6A 4M6OL 4CMMA 4XBKA 3UZEC 4WI2A 1TPVA 3NCEB 4BM7A 1FCUA 1IBZA 2MHAA 2ZCHH 3VCCA 1NUFA 3RKDD 1T89C 1LL7A 1JCKA 3H7RA 2ROXA 3OKOB 1XZ0A 2J8UA 4JG1L 2Z35A 4KAQL 3LN3A 3WFCH 2R2CA 4JTFA 2Q10A 4O02H 3MNMA 2IVFC 5IVZA 3C8NA 5I78A 3SDDD 1U2HA 2JH2A 2W5PA 3LV5A 2DBLL 3NJFA 4KWUA 3MRJA 3UO1L 1HFBA 2BVWA 1NC4B 3BLLA 1H6UA 3KOFA 4QTHA 5BQ7B 5ISZA 4W9KC 3QI9A 4N8PA 1DWGM 2R14A 3RGVB 1OF0A 4G7EB 4E68A 3AXLB 3SQOL 4F92B 4UTAH 4FS0A 1ZTMA 1YA5A 3MFFA 5CZKA 4ZFFA 1PIIA 3HNTH 3QA3A 1RI8A 3V0VB 2UBPC 1KQZA 1JK9B 1VFMA 4Z8FL 1AQ0A 3WHE0 4CJ1A 2AQWA 3R4IA 3QXBA 4DQOH 1XH2A 2WUBL 1AR1D 4FA8A 3BLFA 3SOBL 4KBPA 1KLZA 1XCFA 2QSVA 2GJNA 4A3QA 3MA7B 4REQB 1FYTB 1XBZA 3OAZK 5IJDC 4Y96A 3ANYA 1A0CA 3CK0L 4WJ5B 4IICA 5CSSA 1ELSA 3QEQB 1L6PA 3LPGA 3L3GB 1T6WA 4Y2DD 4WZHA 1A3RH 3MANA 4IMCA 3WLIA 5CJ8A 2W9DL 4FQCH 1SXSA 2W81C 4K8RD 3NXFA 4DP0X 2GJZB 2OMTB 1TZHA 5REQA 3SRKA 2GTWB 5DQ9A 4H25B 1XF4A 4UMGA 4N8CL 4NNYB 1Z9SB 2D7PA 3MSYA 2BIIA 1MFAH 4P2CG 1F41A 3RVWC 3EXTA 5JPNA 1RFDH 5AHIA 4RGOL 3LS4H 3W7MA 5KYNA 1E3FA 2IEPA 2WMPB 4OZ4B 4PR5A 1Z3GH 4MAYB 2APTA 4EUPB 3LCFA 3OODA 3UYCA 1R8LA 3ZWSA 4ODXB 1CFTA 1XISA 5BJTB 4PJ5E 3GJEB 4L3FA 2Q01A 4XO9A 3EYPA 4RNJA 2EC9U 1G7HB 2ORBH 4IFRA 4C5YA 3FH5A 3SJVE 1QVOA 4A05A 4CNUA 4B5XA 3MRQA 1R24A 3THCA 5D7EA 4M82A 1HZHH 4MNJA 4NC1C 4EPEC 4LF3B 1BQRA 3NIFE 2VDMH 2AHIA 1KM6A 2VDGA 3PJSA 1M01A 3V18A 1IQDA 1YEEL 5E4OA 3WO4C 4ZMGA 2G8ZA 2Z3FA 3FU9A 3CX5J 4J3UA 2MPVA 2D2CC 3PDGA 4KDTC 5FWQA 4JW3A 8FABB 1EWDA 4R0LC 2CCWA 4JIQA 4L4TA 5FW8A 1IWAA 3H9SE 3FUEA 4F9PC 2CLMA 3DDMA 1JZ4A 4OFIA 1YYMH 3KP0A 4TNGA 4PLKC 5KSVB 1PLAA 3WBEA 5IOKA 4NT6A 5KZCB 3X14A 4TULH 1JCMP 1KBKA 1QACA 2BSBA 1BZDA 2J8HA 3BGMB 3E8VA 3H6AA 1MHPH 4PW4A 4E9QA 1P6CA 1WAAE 4GQQA 4EI6A 4E41D 2HE5A 3POHA 4XMWA 4JO4L 4OZFB 4ZBJA 5C0BB 3ARBC 3GX9A 5AYYA 4DWSD 3UCCA 3PGFL 4IZGA 1T3FB 2VDPB 4PCNA 3QZWG 2WLMA 4ZO8A 3W5NA 35C8L 2REQB 3G24A 3ASNB 1FIEA 1WFOA 4KO7A 3F12A 1IGCH 2KUTA 1U3JA 1P48A 3VFSA 2WWNA 4GFXA 1AQKL 4WDTA 1LM8V 3VSTA 2E67A 4WUIA 3HG2A 1LBMA 4LLQB 3SBPA 2ITEA 3F01A 3HS8A 2B5IB 4GG8B 5DRNB 3AAZB 1BIIB 2ZSWA 1S78C 2XU9A 3GSWB 3O2WL 4K9EC 4BKLA 5DCDA 5DRCA 4PI2A 4OZHF 5EF1A 1KEGL 2E5CA 3GBMH 4XAYA 1ZPTA 3GHBH 3GLDA 1FVCA 1T20A 5SWSA 4F80A 3W75A 2A4AA 1D9KD 2LV4A 1S5IL 3QEUB 5E4AA 3PJNA 3Q2NA 1VJZA 2VWSA 3I6GB 3M5XA 2CDEB 3H8NA 1EEXA 5EU9A 4ORGB 5I26A 2YCLA 3A64A 1GYAA 1TPH1 5I8EA 1JV2A 3DOSB 1M1SA 3QCUH 5K9KA 2XZ7A 4IIFA 4WJEA 4LC6A 3VCLA 4ECNA 4C1LA 2PCYA 3L3JB 2P47B 3O81A 4S1SH 4KKQA 4XMPL 5FECB 1FVEB 4PP1C 4AC7C 3DPBA 2FLIA 3C6LA 4X7CC 2P9RA 5HDBB 2WUCL 5FA4B 4MDIA 4HS3B 2EUVA 2VR7A 1I1AA 1MCLA 4FD0A 3BVNA 3DX3A 4GRMB 1LQBC 3QORD 3GIYA 3KDOA 3HZMB 1FO0H 1FNHA 1A3RL 5IHRA 1ID5I 1UD2A 2QSTA 3K13A 1JVOA 1V6UA 1DV7A 4H2HA 4LVHB 3DI0A 4QE5A 1ZLPA 5BXTA 1U3ZA 3TO4D 4GKNA 4WRLA 4QJ1A 4IFOA 2VDRH 3LCXA 3TT3L 2ARWA 3KVKA 3R58A 4MJJA 3TBBA 1TELA 2Q8AL 4KK6C 4ZQTA 1KIRA 3MHZA 1X7QA 1BGXH 4H1ZA 1FLTX 3QW9A 1IKFH 4HQQL 4ZMVA 1KV5A 4GY1A 3L3DA 2H32B 3SDDA 1I1RA 5JQHC 2OZ4H 2HBXA 3LD5A 3GTHA 1EA0A 5BS0D 5JHMA 1JRBA 3SPJA 2IQDA 2ORBL 3AU1A 1XSOA 4XO8A 2VMEA 1BVOA 1W32A 2NZIA 1LO5B 4GQ0A 3MRFB 1X5IA 1JUEA 3OG3A 3QUYC 1UA3A 5JHLL 1Q2RA 4QAMB 3CFCL 4M6UA 2OODA 1KCSH 2CZNA 2GIMA 2WO3B 4BK5A 2DYRB 2VDML 5IF0A 1MDTA 2QMKA 1BD2B 3K5XA 3SN0A 4Q33A 4C6LA 4DJDD 3TJ4A 4F0RA 1AW1A 1T21A 4TVPD 1FWGC 5HNTA 1CXEA 3EMQA 1GS8A 3IACA 1LF1A 5CP7B 2GDVA 4IXHA 3WY1A 2XWJB 3HPLB 2FMNA 1CICA 5CO1A 3JVGA 4F8LA 2PDUA 4PRRA 3ZZQA 1X5KA 4G82A 5DRXB 2XTLA 4YLWA 2CJ3A 3BN3B 4F2TA 2HG5B 3IWVA 3H6OA 5IMLB 4PWKA 1I9IL 2IBBA 4Y19D 1JQVA 1UZ6F 1ZJBA 3GH7A 2XXCB 1XIWC 4JG1H 1MHPL 5E1GA 2JEQA 3WFCL 1ODZA 4CNIB 2E6FA 4DXXA 5KYXA 2WNXA 4GAYA 4JZOA 4UQ2B 3CAWA 4TF4A 1TPUA 3V16A 5DLML 2Y8VA 5XIAA 2DBLH 3MLYL 5MEQB 2BLFA 3WLJA 1V7YA 1SUJA 4KEVA 4OSUH 5E9DB 1NSJA 5IHUL 4B95C 5FSEC 4CBZA 3L48A 4R7NB 1WQ5A 4S38A 2B0SL 3Q3GA 5FM5O 3DX5A 5B39B 1PSCA 5C08E 3BSMA 3GNDA 2GBAA 1GTHA 1K3UA 2GGJA 2RGLA 3EWXA 3QFWA 4RFEB 4U7SA 5F1UA 3FJTA 3LEVL 4PRDB 4KH2A 5IBTH 2H41A 2YWYA 4JFDB 1EK3A 3X12B 5BOPA 4KEUA 4MJ4A 1BQHG 2XTJB 1W91A 4TX8A 2WUBH 2ZXWB 3WFDL 3WO3B 4C7DA 1J1OH 2HFEA 4M1RA 1YDVA 4PRTA 2GJ6A 1LNUA 1L0YA 2DQGH 4HS6B 1OADA 1OX6A 2XDFA 2ZZ7A 5I79A 1SQMA 4HHAB 3CK0H 5JBDA 4I0PB 2Z8SA 1PTGA 4P3CH 4OFVA 2WLLB 4NP9A 1XTLA 2J75A 3I6RA 3GJFB 4L56A 3S4TA 2DV6A 3VXMB 3PZGA 3MJ8A 3D25B 4O57A 3ARFD 3MLSH 5DJAA 4BFAA 4FB7A 4HGWB 2XN2A 4WJG3 1OFBA 3FFDB 1U8MB 1KFBA 2W65A 3K4AA 1YYLH 4PUWA 1TU2A 2KLRA 1HQTA 4YVPA 1MFAL 3HG1D 1AGFB 5JW3L 2C1HA 3RJYA 4OUUB 3QXAB 3WEOA 4XNZB 3GIVA 3W1PA 2VR4A 4MB1A 2VUOA 4Z2GA 3M0YA 2QUNA 3I85A 4ADSA 3TOPA 4FR6A 4AQAB 4ZB2A 2ZZ5A 3PP3K 1CFBA 2F8VA 2XH0A 2X9YA 3IMRA 1XBXA 4HTBA 4RNHA 5F9JA 3O6ML 5FW7A 4BBWA 4YTQA 1S3TC 4OLUH 4ECLA 5I15L 3BUQA 4QROA 4DPRA 2FECI 5C09D 3NQIA 3H4FA 3R0MA 5MHBA 1GJIA 3QNXB 1M65A 4LY4A 4IQLA 4JTEA 4ENED 2X9XA 4U1HA 3BWZA 2J8TA 4S0SD 5D4QA 5ITFB 1E27A 4NUGL 3TYEA 4UTKA 3ROOB 1AH4A 1GGIL 1RHHA 2IQ9L 3D05A 3E0LA 5H6HA 4NBXB 2OKOA 4Q4SA 1PLBA 3CU7A 1VJIA 2R9HC 1QOPA 3CC5A 3P3RA 1YECH 2QPEB 1HE8A 2O93L 5JH2A 3TFCA 3IJ6A 1WBZB 3DVGB 1OFOA 3AM8C 2G3FA 2HZHA 3LEYH 1A8ZA 1ZSHA 2ZKYA 4JFOB 5ABAA 2J1KA 1A4LA 1ORSA 3VG0H 3TDFA 1J5DA 1BYPA 3LMJL 4I85A 4JFFD 4LSDA 4PWIA 3LBCA 1IGCL 5BNKA 1UVQB 4JFFE 4FIRA 1LBFA 4F0SA 4UOZA 4O19A 5EOTA 4WQ6A 3VRJA 3NJLA 1PKNA 1AG0A 4HU4A 3BFQG 5SWZA 3WD3A 4FR1A 1ECZA 3DESA 1AR2A 1XZWA 3LTSA 1BXAA 3MRMB 2J73A 2XWJA 3HPLA 5KANI 1RCQA 4P3WA 1C12B 3EGXA 2R6OA 3W26A 1C8VA 1IC1A 4YN3A 1R46A 3W2DH 2IANB 2RAMA 2EDWA 3H7UA 4DJFD 4NPKA 3BZGA 4M3PA 4NC1E 1QNVA 4J6RL 2BSLA 5F7FA 1BQHA 4CMHC 1KBWA 1EO8L 1MF2H 3JUZA 1TPXB 2HE8A 2P1YA 2EDOA 3UPAA 1SFTA 3AS2A 4S1QH 4OFPA 1F0LA 1MHHB 1WOAA 4M7LH 4E42B 1E30A 1G7MB 2F7RA 1O7DE 2D7QA 5HBBA 2QV2A 4C58B 2XZ9A 4I9JA 1KYFA 5KVMC 4UT9L 2Z92A 4OVXA 2AGJL 2GYIA 3BJSA 4UB9A 4FIQA 2ZG2A 2CLOA 3FO2A 2OSYA 1FUNA 1C5CL 2AQPA 1XLLA 5JIQA 4PCTA 5CZRA 4AD0A 1P7HL 1E65A 2BP0B 3SDAC 1LDCA 3WFDH 3QDJB 1CB4A 2C34A 5IHBA 1I0BA 1UB3A 3G22A 3GK8L 4PJIF 3TIDA 4Y2OA 4X99B 3ZLFA 1LNUB 1G5AA 2N7BA 3EFFA 4TXEA 2PDBA 3NO3A 1E6JH 1XGPA 4NS0A 4LCCA 4HVBA 3CTLA 1QBLL 3PL6D 4EIBA 3D06A 1JZ3A 5EUKB 1YEKH 5KANG 4BK4A 1XINA 4HA0A 5GGRY 4R0LB 3A3WA 4G42A 3NCYP 3RY6A 4G3YH 3MS8A 3PBGA 1ZJHA 2JLPA 1H9VA 4PJ9B 5ALBL 2MIZA 4S1DD 3G7TA 3FU6A 1SXBA 2H9GB 3IVKA 2C1IA 4AZGA 3IDJB 1NIAA 3APYA 2VGFA 3EOTH 3NA4A 4ZMZA 1FDLH 4XNXL 2PYEB 4BFFA 3IVKB 5ABZA 2DSZA 4EE9A 1N4XH 3LYRA 4PY7B 2CKBH 1JRHI 1RSFA 5JHDA 1ISYA 2F54E 4BFIA 4KI5E 4S2BA 3R18A 3UDWC 3NESA 3ARGC 2VSMB 5I6XC 4ZSOB 5I0VA 2XVLA 3UTSE 1EXUA 1FC1A 1SF3A 3QY8A 5B22A 4R9XA 4XZ9A 2RACA 3JTTA 3W02A 1MHCA 3VXTB 1XWYA 3S4SG 4PBXA 1CEOA 1ZT1A 1SXCA 1CUOA 4PR5B 4AZUA 4EUPA 5BROA 5I6KA 2HMCA 4F91B 5EC2A 5ICXA 4UZSA 2GJXA 3NQ7A 4WKZB 1QAWA 3BQ5A 1A6WL 2C3VB 2OCFD 3QJTB 4QGYA 1X9UA 3ZYJA 2K4AA 5CZXC 3M1OA 1HG3A 4HIHA 1OX4A 2MNJB 4LEBA 3ZDZF 2GSEA 4XZBA 1XGZA 3AG1B 4W87A 4OFQA 2BSTB 3U79A 3BUYB 2JQZA 1H3UA 2XXGA 1PG7H 1QFWI 2WLKA 1SMAA 1S2CA 3UZXA 1G69A 3MLRH 3N29A 1J9QA 2CJSA 4WHYG 5C7XH 5F44A 2HS6A 4TNWF 2OQLA 3VD9A 2BY1A 3WSQH 4JFDD 4P2QD 1F58L 4OZIE 1LTXA 3OPUA 3G6JE 4IK6A 4LCIH 5KJ4A 1CGSH 3OEXA 3S97C 3IEBA 1ET7A 4N02A 2NY1B 4GLEA 3IDYC 5BRZB 4C60A 1S7UA 2CETA 4WHBA 3AIRA 5I1EH 4I9MA 1W3NA 1PSKL 4PW9A 3TXVA 4Y4FD 4M5TA 3R12A 1A6ZB 1F3DH 5IIEB 4CSTA 1JJUA 5JPMC 1M1BA 1TPB1 3N4EA 4FKKA 4OZFA 3W7CA 2XFRA 4V33A 5LHEA 2WVVA 4BSWB 3RLGA 1AE6L 1DVFB 2K1MA 3GSQB 1M41A 4KTDH 4LCWE 4N6RB 1F61A 4RV8A 1HQ4A 3A3YB 1EZ2A 4EPKA 4I18B 3HS0A 3G9AB 2C1GA 3ARTA 4MD0A 3BC9A 3L3OC 4IM4A 3QXTA 4AH2A 1F8IA 1WA0X 4OH2A 1SR0A 5G4NA 1L3NA 4YL4A 1RUSA 4GP4B 4X5RA 4P9HL 5B4MD 1SOKA 2OK0H 4GPVA 1Y1UA 4LHUA 3N2MA 2DMBA 1UD4A 2I57A 1J8RA 3WIJA 1DANU 3BQUD 3EJZD 3FA4A 15C8L 2V9RA 3BWAA 4FEMA 2B7OA 2F68X 2R8SL 1KXVA 1A7RH 3L9RB 4X7TB 1JTOA 5T3XH 3ZTNH 3QUGA 3W37A 4GG9A 4ODTH 1IGJB 2IWKA 5I18H 5I6LA 1EX5A 2ICEB 4KXZH 1EJWC 4HF5H 4E9SA 5I5IA 1XLEA 4S11A 1SPDA 3TN6A 5SX5K 1SJXA 2DH2A 4TQ8A 4WUUD 4ZFMA 4ODSL 5ERWB 4Z7QE 1J0JA 1GG0A 4OZHB 4WO0A 5FO9B 3NQBA 3MJ8B 1U30A 5JOFB 3WIIH 3KXFA 2RFXA 5HHXL 3TYGL 1AUSL 4QHKI 5EA9A 1E6JL 2Y2WA 1Z7JA 4FQHA 4L4TD 3TW7A 4O02B 1R38A 4JFXA 2JIXD 4GSQA 2FHFA 3B9DA 4L4TE 4YC2B 1YPZE 3ULUE 4HHPA 3QJSB 3W11D 1JUFA 1AQMA 3ULUD 2WHKA 1HHHA 3N18A 4IFKB 3ZVHA 3VYLA 4MY1A 4AISA 1YMMD 2QUMA 3W1XA 4WHDA 4GO8A 5LBSL 2DYPD 2IDUA 2IQ9H 5AB9A 4JQXC 5C3LD 2G9HB 2H8PA 2XISA 2DIEA 3MGOB 3H2FA 3HGOA 1VRDA 2QUUA 4FFVC 1QNZL 1Y8BA 1SFSA 1ECEA 4X5WB 2DLFL 2NUTA 2Y63A 4J27A 4JREB 4HDIB 3M0HA 1HE7A 2P5EA 1TQCB 4RKAA 4WDXA 1AO7E 3AZSA 1XLGA 3VZZA 2Y5EA 5FYKH 2YRLA 1KNWA 1JF1B 3AI0A 1QPXA 4G7VL 3DU0A 1PNCA 1LEKB 1LD9B 3L1GA 4I3GA 3FUDA 4YCOA 2TODA 5HQEA 4OLVH 1JZFA 3I3DA 3P54A 4CGTA 5HNNA 3BKML 5FL0A 4HJEA 2AJVL 2Z91A 4FNPA 2AV1A 2WHJA 3FYYA 3GH5A 4XMZA 3RVXD 2OR9H 3SJVD 1FFNB 1KYUA 2NDGA 3KBEA 4KO5A 3CFBA 2J13A 5EU5B 4OHQA 5I1LB 4FI4A 1V5JA 2ISWA 2D3LA 1U8HB 2CGYA 2JCCB 3IMUA 4FC3E 5HHME 1FKWA 2OO6A 1UD6A 1RPQA 4HYRA 1QPNA 1BF6A 1JAKA 4LB4A 3QRGH 3CSGA 4AHQA 5REQB 3MBEC 4OZFG 2I7GA 4EK7A 1WF5A 4XVOA 2DWDA 1H1ZA 2XRAL 1HKWA 3HKZA 2Z93A 3WEAA 3VMOA 3AMLA 1PG7X 1OHQA 1I9JL 2WB1A 2PGFA 2YXFA 5D7SH 4PTXA 3VXGA 3UTSB 3MROA 1V8HA 3IDNB 3GB6A 4X6EA 4FTDA 4M48H 2Y07L 4KVNH 2PR9A 4XMXA 4OI8A 3UESA 5I19L 3QIWD 3FIGA 1A64A 3DN5A 3S1WA 1UT1A 1R3IH 3OKEB 4RLDA 4G1MB 2DQJH 3V4VL 4C56E 1JGVH 4GH7B 2V33A 4N6FA 5DJZA 2WVVB 4BSWA 1VLWA 4HJFA 3M1BB 4GIOA 4KEZA 3B7YA 4Z6AT 3BAIA 2GVGA 3WK0A 2B1AL 5C0BA 3CXDH 1RZJL 2DB8A 1QSFE 2I5IA 3KVQA 1W80A 3C5ZB 2EIDA 4HTYA 2YC1A 2WLJA 1A4MA 2YIHA 2CLRB 1H8NA 4K36A 3CDCA 2IQAB 4Z77A 3U7BA 4BELD 1F8MA 1EGZA 4IJTA 3C3NA 2JI3A 4F7CA 1SJBA 3PTDA 2G30A 5ALBH 2E7BA 1S7QB 1BQGA 5CFHA 3U0WH 5GZNA 4HNCA 2WYHA 2RQEA 3IDUA 4FMVA 4IBSA 1OAUL 1AS6A 3ZDYE 3MI2A 4E6MA 4OQ1A 4P7OA 4DJEC 1G7QA 1JHKH 4LRIA 2F7QA 4IK7A 1PV8A 1TRIA 3DBNA 5MHSE 4KFPA 4H44C 3V6ZB 3SDXB 4XNUH 1CGYA 1LUCA 3EH5B 1Q94A 4PJ8D 4BZ2L 4DAFA 3BLDA 4JPGA 4OAWA 3BPLB 3HJEA 2HTLD 2M1KA 4MAYD 1FWJC 1YE4A 1X4YA 3OJGA 1PAZA 2KLTA 1JK9A 3UWZA 3FS9A 4F3FB 5D7KD 2W5FA 1T1YB 5JDSA 1T0NA 3JRKA 2A5UA 2HT3C 4P07A 1BP3B 3G08A 3LA4A 3SPHA 1TUFA 1KB5A 3AS0A 5FEZA 4HNTA 4NUJB 4M5PA 1BQKA 3DC8A 1KBJA 2E9MA 3UGVA 3DMMD 1NQKA 3N6QA 1KGYE 2E7LA 4RDVA 5DXXA 3NURA 5HJLA 1A6WH 1CWVA 4YN5A 1NWPA 4BWTA 1K3ZA 2XPZA 4JVUA 3ZL4H 1FVEA 1XFBA 3WF0A 3ARYA 4PRPE 5BMWA 1T7WA 2J8UE 1GY2A 3GZPA 4LARH 3VIGA 1I4FB 2ZWKA 1YUHA 4GIPD 3DUHA 3DX4A 1HVQA 1W1IE 4EF9A 3MLRL 5E5MA 3RWFA 2RHGA 4HXAH 4YHPB 3GKAA 1JNJA 2MCMA 3VFOB 5AG8A 2Q3ZA 5JPNB 3I50H 1I2NA 3WIHL 1F86A 2HROA 4YHPA 4LVFA 1OPGH 3RIKA 4D0DB 4R7DB 3EA1A 4W4QA 5EPDA 4LSTL 3MJMA 3ITLA 1UFGA 2CR0A 4W4OA 1QBMH 4RA0C 4X7DC 5CNHA 3RGVD 2YCJA 1KMGA 2OR9L 2Y0FA 3U4BL 2WNKA 3G6AA 1NC4D 4L4JA 1O94A 5KSAB 1KC5H 1LOQA 1QW7A 3E38A 4M7KH 4R97C 5IVXE 5KITA 1FH2A 4X2UA 4NQDD 4MNGA 5KJRL 3D0LA 2PP0A 4L5FH 3C6EA 2Y72A 3FOLA 5F4SA 4M62H 3FTWA 1AFSA 2DVXA 1T22B 3N41B 3C5ZD 5FYKU 1R9FA 1XYZA 1S5VA 2GT9B 2CLIA 1FL3A 1IEBB 1ZSDA 1KELH 3QXVA 4FXGC 5E2UH 5BRZA 4I5UA 5CSRA 4GRWE 2VFHA 3KCJA 2GG1A 4JHAL 4TIMA 5D1XD 4RISH 4YJZL 2O6CA 3CPGA 4NFDA 4ZTXA 2WK2A 1DE5A 3HGRA 1KCRH 5T3XL 4M48L 1LP6A 4M3KB 3FDWA 2F1BA 3H7VA 4D8PB 2APXA 2X42A 4UTJA 2X89D 2ZQKA 4R5TA 4FS9A 4NIKB 3UAFA 1CFSB 3BZ4A 5F9DC 4X6BA 5TPWH 2YQ3A 3WIIL 4XBMA 1BAGA 3KLDA 2BGNE 3M43A 1WFJA 1J5IA 2HVJB 1XGRA 1IZJA 3BEVA 3L08A 4HAFA 5SWZD 3WL9B 5I1JH 2P10A 5ACZA 4HPJA 4AEHL 1BPVA 1KIUA 2F5AL 3HI1B 1FN4A 2VXQA 4DN3L 4YFEA 1A66A 2O56A 2PDJA 4XOCA 2Z28A 5AN7A 1KIPB 2D4DA 3DRQA 4PB0L 1DJIA 4XGZB 2W62A 5KZEA 5DEZA 2V5KA 2IAMD 3O45B 2CLRA 1E9OA 4I3SH 3QUKA 4NWUL 3KVPA 3KHOA 5GGVL 1F13A 4KK6D 4PEKA 3GXDA 4Y9FA 5AUMB 4HULB 3Q1SL 3UYPB 2JLLA 1XHHA 4RX4A 3PWPB 1FVDB 1PZ2A 1NMBH 3D4ZA 5J57B 4DEPC 1NAMH 4ZQPA 3PC0A 5D72L 3CUXA 2UVFA 5FKYA 2Q6ZA 1KB5H 2YZ1A 4U05A 3LCYA 3C6CA 3KWUA 1JVKA 3LN9A 2KYIA 1G7QB 1MDAA 2L8AA 1YE6A 3Q37A 2W60B 2LGNA 1JZIA 2QJIA 1VJSA 3WE6B 3M86A 3STLA 5D9SB 1JUFB 1QLEH 3D09A 4PRIE 3TBYB 3SDXF 4R4FL 3TEXA 2DZTA 2V5LA 5C08B 2EJAA 1IL1A 1KCZA 3H12A 3D9AL 4BHYA 4PJ9A 5CCZA 2CXKA 3CVHL 3MV7B 2DJUA 5JO5B 2XYBA 1JWMA 1HCVA 5IMKB 1U91A 2OJPA 2YL8A 5CMAB 1AHWB 2ED7A 3DK0A 1NCDL 2VISB 2ZUSA 4AY7A 4D2JA 1FYTA 1GZQB 2QKIB 4RMWA 1YEFH 4NJKA 2ATSA 2C19A 2QYGA 2CLVA 4ODUB 3FT0A 2PDMA 1DN0A 2WGNB 1ZAJA 4TTDC 3QKZA 2JFEX 1RUMH 4TUKL 1A49A 4LRNL 1P4IH 4DVOA 1Z0MA 2MOVA 2J77A 2JKNA 1OE3A 1VDGA 2ZF9A 1XIWD 5HI5D 1OAYL 4IXXA 3ZL2A 2IH1B 4R6UA 5E00B 5C0EB 5HVHB 5I3GA 2OL3B 1QP1A 5D2NB 3BT2L 2NVDA 4WO4A 1T6BX 2D0HA 4PTTA 3ZYZA 2BZ7A 2COQA 1MCKA 5BUGA 1N8WA 1I8JA 3FQWB 5BUPA 1JXFA 1XCTB 2CK2A 2PXYA 1NEUA 5FYLL 5D7SL 1KY6A 3EKLA 3ZE2E 2VJ0A 4Y9OA 3GMQA 2XWTB 1WZLA 2BRQA 3D4YA 4PGEB 1JD9A 1H6FA 3KRUA 4V1DE 4NHVA 3L1OH 1UYWH 4W8BA 3QUYD 1I3UA 3HIZA 4ZX3A 1R3IL 1IAIL 2V5YA 5F89A 2ZYHA 3W1UA 1O6SA 2HB0A 2KZWA 3BKCL 5I5JA 5H8PA 2VLRE 3N17A 3APFA 3EYFB 3AWFA 4U1SA 4EVNA 4J2PA 3HRZB 3VCRA 5F9OH 3SGGA 2X10A 1I3RB 3TW9A 4B5UA 1ZLWH 5AZ2H 3SHSA 5GS0C 2NT1A 5ABGA 2XV6B 2J12B 5E1QA 5T8IA 3LXBA 4NJIA 3AREA 3TX9A 3KVDD 3OAWA 4UZGA 4JLRB 4L4VA 3RY4A 1MI3A 3RDJA 5GS0D 1L2UA 4LCUA 2VLKE 4TQEH 2JGYA 2LLEA 3KM2A 3KXFD 5EOCL 2GI7A 3ATYA 1W72H 1ME8A 1ZLDA 5FCZA 1DVFD 1NIEA 1KFJA 3U0WL