2WVSA

Crystal structure of an alpha-l-fucosidase gh29 trapped covalent intermediate from bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an e288q mutant
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYQRRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-L-FUCOSIDASE
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 158
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvsA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvsA01
4FNRA 4HZ7A 4ML4A 2UY2A 1WDPA 4B16A 4HTYA 1BGAA 4QDMA 3CHDA 3W6LA 1LF1A 3VGEA 3DX4A 4AMCA 5AC5A 1OT2A 4WK9A 3H54A 2G41A 4NI3A 1UD5A 4D1IA 2Z1SA 3LXBA 1B90A 5A8PA 1ZJBA 1JDCA 2WMIB 4Q7NA 1Q4NX 2QMJA 2F8QA 3W53A 3AIBA 1HTYA 3T2OA 4MB4A 1XH0A 2VZUA 3AQUA 3S5YA 1EQCA 1UD8A 5E0CA 1WNOA 2VR4A 3SCOA 1EH9A 3AXXA 4P8XA 4BQ4A 1LL7A 2DDXA 3HG3A 1AVAA 4UOQA 1UWIA 1VBUA 1CBGA 2IUZA 3DYPA 3GZAA 1RP8A 1BF2A 3HMCA 3JUGA 3AHYA 3EJPA 4QAWA 2ZE0A 1UKSA 1CGUA 3B9DA 4D6DA 4KRUA 4CCDA 1HIZA 4QLJA 1V02A 3D50A 4AD1A 4AXNA 3AZRA 4DO4A 4J3XA 3OZOA 3GXPA 4K68A 3VPLA 3DYOA 1XYFA 1X1NA 3MUY1 4B15A 2GUYA 5LYRA 2BVYA 1UD4A 2CBUA 2V3DA 4WSJA 2E9BA 2WW5A 1QI4A 4U2ZA 1C91A 2VX4A 3L4TA 3AJ7A 4BQ3A 1JGIA 3CTTA 3VNYA 1KTCA 2WBGA 1GUVA 3AFBA 3AOFA 1CEOA 2ZXAA 4HOZA 2CBVA 4OJYA 3QHNA 4HZ6A 5CSUA 4GPNA 2DSWA 2EADA 1VRXA 5TD4A 3ARXA 5JBDA 2WC4A 3WD3A 4GI6A 4H8VA 3VDBA 3CV5A 1E56A 4A3HA 2W62A 4JFWA 4LQ1A 1TE1A 4D6JA 1EDGA 5E09A 1UKTA 3WH8A 3LRKA 1WP6A 4ACZB 2WHKA 3VIJA 2QPSA 2OSYA 5D8ZA 4CGTA 2PB1A 1L8NA 2FE0A 1ISYA 3D4ZA 4JFSA 3WUEA 3VD9A 3HG2A 2E8ZA 3BVWA 3WH7A 2F61A 1BLIA 1T0OA 1CTNA 5A6JA 2BVDA 3BXWA 1SR0A 1XSIA 2E0PA 2J25A 3T2QA 2EEXA 3FXYA 1QBBA 4WLCA 5E1QA 4KGLA 2J62A 3VD4A 2WVVB 2VVSA 3VSTA 3A21A 3VIOA 3CBWA 2V5CA 5GQBA 3WMCA 5BXPA 2ZX9A 1MQQA 3NYDA 2GJPA 3KWXA 4UQEA 1GOMA 1V08A 3VIFA 3QOMA 4F79A 2E8YA 4PYSA 4BZYA 4NXSA 1UZ4A 1JNEA 2G3IA 2C7FA 4DWSC 2BFGA 5AYBA 1KBBA 1UASA 3CPUA 3N13A 3ARVA 2IXUA 1PX8A 4GQRA 2YL9A 1OIMA 2WC3A 1PZ3A 1TA3B 1KTBA 1HL8A 4U31A 1ITCA 4MNLA 5CGTA 5LA1A 3BCFA 4CD8A 2EPMX 4FNPA 2UY4A 3VD5A 2XVNA 2ZUTA 4JZ5A 3MSGA 1JNDA 5IFTA 3CLWA 5A6LA 4HA4A 1E4IA 4WF7A 3LX9A 1UR4A 3BLBA 2VNCA 2YFOA 4DUVA 3WELA 5HPOA 1GHRA 1NP0A 1OWQA 4UOJA 1GNXA 1QWUA 5DFAA 2Y24A 1BFNA 4J27A 1QVBA 1C90A 2W63A 3UR7A 2WHLA 2NSXA 2WVTA 2UY5A 1GHSA 3SCPA 3QOKA 2F7PA 3WMBA 1K9TA 3RJXA 3BMWA 1BYDA 4RE4A 3VIMA 1V3LA 7TAAA 3HU7A 2YJQA 1ZBVA 2BV9A 2WBKA 3LPFA 4DWSA 2YLAA 2MANA 2NW0A 2WAGA 1K6AA 4AZ6A 3WEZA 1G5AA 2YIHA 3DX1A 1JIBA 4CVUA 3G6LA 4V28A 1J0JA 4GO9A 1R46A 3OLIA 5DMYA 3NDZA 5EB8A 2GJXB 4CD7A 2YA2A 2PWHA 1J12A 3L4ZA 5IFPA 1HT6A 2J7FA 1UOKA 4D6CA 4TVUA 1JD7A 3TTOA 2D20A 1AQHA 5KZ6A 2D0HA 2E40A 4TTGA 1PZ2A 3OB8A 2VCCA 3FY1A 4U3AA 4P8UA 1J11A 3PZMA 2D2OA 2EPOA 4AYGA 3DDFA 2OYLA 2W91A 2WMKA 2YL6A 3K8MA 2J7DA 1NWRA 3MUZ1 1GQIA 3K4AA 1GVYA 3OGRA 1HKMA 1VEPA 4CN6A 1GW1A 4R27A 3VGHA 2YOCA 2D73A 1NP2A 3L4YA 1JFHA 1UR9A 1NOWA 3WSUA 1EIBA 4X0NA 2EXOA 1NM9A 4NZJA 1HJSA 3AS1A 4PSPA 2OW6A 3EJUA 4BQ5A 2XGIA 4AZGA 3W25A 3BVXA 2J7CA 1VJZA 1NWUA 3U5YA 2RGMA 6TAAA 1H4PA 2FHFA 2WNWA 3WD0A 3LPPA 1XRVA 2YDRA 4H04A 4FNQA 4MDPA 2EPKX 3EYPA 1R86A 2V3FA 4C7GA 4NX0A 4D6EA 4TX8A 3OGVA 1GQJA 4AMWA 4DO5A 1JAKA 4FF5A 4M80A 3VIHA 3GNRA 4UFKA 3K8LA 1OGGA 2HVMA 1J0IA 1FFRA 1K9EA 3ALGA 2ZOXA 2YLLA 4CD4A 5BXRA 1VEOA 4LYPA 2BHZA 2Y4SA 4XV0A 4GZIA 3WQ8A 3HJEA 2VQUA 3M7SA 2ZXBA 4PCTA 2ZX5A 1MW3A 1V0MA 4DO6A 4DUWA 2Y8VA 3WH5A 2VOTA 4AZHA 3VVGA 1JL8A 1SZNA 1VFUA 3WEOA 4WSKA 1I1XA 4MNMA 3WF3A 2XIIA 2FDMA 2F18A 1JXKA 2PWEA 3RM8A 4IISA 2ZUMA 3FNDA 1PAMA 4AZCB 5ECUA 3WD4A 1HKJA 5C70A 1V02E 1EHNA 3BVUA 5GNXA 3DECA 3UG3A 3WH9A 1JZ8A 4V2XA 1V0NA 2CXGA 3WN6A 3SUWA 2X0HA 1H2JA 2BXZA 1CENA 4Z2KA 3N11A 2W5FA 2GDUA 3TTYA 5BXTA 2WZEA 5A2AA 3PZOA 2DSVA 3LPGA 5C71A 2YBUA 2VRJA 4QLKA 1E73M 2O92A 2TAAA 1XD0A 5CPTA 2GFTA 4UQCA 4BCEA 4PN2A 1MQRA 1JD9A 3KL0A 3AI0A 4W5ZA 4YHGA 1JZ7A 3CH9A 3ARTA 4U5IA 3EMCA 3AS0A 2X1IA 5A94A 1PIFA 2XM2A 5LA0A 4CD6A 4PTVA 4HOXA 2FGLA 4WKFA 2X0YA 3NSNA 1OD0A 2CPUA 3WD2A 3VKKA 4FLOA 3GBEA 1BYAA 3OLDA 1E72M 1QI0A 3WY3A 1NH6A 1E6PA 3APGA 4LYRA 3VDAA 4XB3A 1WCGA 1QNPA 4JKMA 1LQ0A 3W29A 1ISXA 1DWFM 2J77A 4AZ7A 4UFMA 2ZUNA 1B2YA 4L4PA 4HMEA 2BHUA 3FHQA 4N0RA 2XVGA 4AD5A 2BY0A 2XFFA 4UTFA 3VILA 1RPKA 4AZBA 3VSVA 2WLYA 3AHTA 3SUVA 2NT1A 3KEHA 2OWWA 1AQ0A 1GJWA 3S2CA 3M07A 5D8WA 5D9NA 3ZM8A 2FHBA 2F7RA 3AMCA 3CZKA 2XVKA 2BY1A 1TQVA 1RP9A 1F4AA 4CU7A 1BHGA 2V38A 1BGGA 2ZUWA 4AIEA 3F4VA 4TTUA 1US3A 5A3HA 3VMOA 3D3AA 2WKGA 2VMFA 1W9VA 2OSXA 4MPKA 4P7QA 3HZ3A 1E4MM 1KGXA 3MO4A 4MB3A 3T0AA 2WYSA 1OGBA 1TQSA 1EO7A 5EBAA 3OIHA 3AIUA 1ZBWA 3QR3A 4JCMA 4PEEA 3ARPA 4W7VA 2ZWZA 1QW8A 4OKDA 4PMNA 1XCWA 2VX5A 4MJ2A 4CU6A 3UR8A 4CKQA 4D6GA 2BVTA 3MUAA 2WSKA 5KEZA 1H49A 5M03A 4MB1A 5DT5A 4H7VA 1FHDA 1GOOA 1HP4A 1SMAA 1HX0A 3A4XA 2XJ7A 2CESA 1Q6EA 3BLPX 2A3CA 5BRQA 3VGBA 3A3HA 3L2LA 2V3GA 1W3HA 1U30A 4W85A 3QHMA 4F9JA 4KMQA 4M82A 3POHA 1XGZA 1UH2A 1UG6A 1L0PA 1J01A 4YPJA 3GXNA 4F66A 1MXDA 1MW1A 1R34A 2EABA 4UNIA 1J0YA 5AY7A 7A3HA 3EMQA 1R47A 1WZAA 3KL3A 2ZXQA 1WO2A 4QP0A 4OUEA 1EOMA 2WMHA 4UCFA 5DT7A 4D6IA 2JALA 4HU8A 3ARRA 4AD0A 2D3LA 4GI8A 4F8XA 3B9EA 3GXTA 5EMYA 1FFQA 1UR0A 1CXLA 1XCXA 4JKLA 3S6TA 4C7FA 4WKHA 1C8YA 1HJXA 5HOSA 1HKIA 1KXTA 3B9AA 1GPFA 2O9RA 4D6HA 2GSJA 2D22A 1J9YA 2IGTA 1LL4A 5ABFA 2XSAA 5A6MA 4AIUA 1KBKA 3MV11 3T2PA 1GJUA 1HJVA 8A3HA 2PWFA 4KGJA 3RDKA 3GXDA 2O9TA 1XC6A 1M03A 5D9MA 3WF1A 3ZSSA 3GNPA 1K9FA 2YKKA 1H0GA 3U7BA 5I6SA 4DM1A 1HF6A 1DWHM 1W9DM 3GDBA 4PMYA 2F7OA 3PZ9A 4KH2A 1ISVA 3W28A 4H2CA 1KWKA 5BROA 1KXQA 1KXVA 3A6OA 3G6MA 2ZWYA 3MV01 2XGBA 4UQDA 5CXPA 3SCVA 3W82A 8CGTA 5A6SA 5I78A 2CKRA 3U7VA 1M04A 3VU2A 2WMFA 1BYCA 1NWSA 3AIQA 2DEPA 2PWDA 4MTVA 4MNKA 2VUYA 1VFMA 1QNQA 1VENA 2FGZA 3FN9A 1UH3A 1TQWA 4HPHA 3DC0A 4P7NA 1BVNP 4PUEA 3QHOA 2W92A 4GO8A 1IT0A 3I3BA 4ZXLA 1VIWA 4AZ5A 1V3MA 4D1JA 3ZT7A 3A47A 1V0KA 4J3WA 1IV8A 3VGGA 1CXIA 3BH4A 5F7UA 1AMYA 1FHLA 1HP5A 3AIRA 3N12A 2CERA 2AOSA 1JI1A 1O6IA 3WKZA 2QMKA 4GKLA 3MSDA 4XZWA 3DHPA 3TONA 1V3IA 3CUJA 1V6XA 1ECEA 1H3GA 2J79A 2WZHA 5CLTA 3VM7A 3BAKA 2VZVA 1KCLA 3B8SA 3GXMA 3VINA 1CGTA 3LXCA 4ATLA 1F4HA 5FD0A 1UD3A 3N17A 3RM9A 3WDIA 5A6BD 5EFFA 3AS3A 1Z32X 4CN4A 2Y2WA 4IUGA 4XUYA 2XWDA 3CMGA 3VO0A 2F2HA 3ARUA 4NXKA 4J28A 1UQYA 2WSPA 1D2KA 5A8NA 3AISA 3N04A 4B9ZA 2EBNA 1EO5A 4L4OA 4Z2LA 3ZQ9A 1GCYA 3OBAA 2FYVA 4TVDA 1VB9A 3OZPA 3W37A 3PZQA 4UZSA 4AD3A 2DIJA 1XHGA 4PMZA 2BS9A 4ZXOA 5FCZA 1N82A 3N9KA 3UERA 4FLSA 1WAWA 1MFVA 3HG5A 1C3FA 1QNRA 1E70M 2YDQA 1E9LA 4M8UA 4E8CA 3TOPA 5DEZA 3OLGA 3WFZA 1W2VA 4EKJA 2PC8A 1HNYA 4JCLA 2GVYA 2OLHA 4FMVA 3PZUA 3ZT6A 3BSHA 4UFLA 4AIOA 2E4TA 4PSRA 1P6WA 5A6AA 3VTRA 1NOUA 1OB0A 3VSUA 2BXYA 2CYGA 1HJQA 2NT0A 5I5RA 4OZOA 2DSZA 3PZVA 1B3VA 2EJ1A 2J8GA 1W32A 3NDYA 4GINA 1UA3A 3KLLA 2J7BA 1UZ1A 3AYRA 3M6DA 4B3LA 3ZIZA 1R7AA 1UWUA 3VOCA 1G94A 2XTKA 1E6XM 3WQWA 3DX2A 3MS8A 2W67A 3MMWA 2JEPA 2X8RA 1EXPA 1WB0A 4PTXA 5IHSA 1W1YA 4B3KA 1MW2A 1UD2A 2BY2A 3GNOA 1BVZA 2PF0A 3KE0A 1H11A 4JHZA 4PMRA 1UWTA 2XFRA 3MMDA 2F1BA 1LLOA 4URIA 4RL3A 1I1WA 1E6RA 4W93A 1OT1A 4U33A 3WMSA 2QPUA 2CBJA 2QHAA 3IANA 1CGXA 1DEDA 1XYZA 1HL9A 2BY3A 3K1DA 1BPLB 3AXIA 4AEFA 1MQPA 3E1F1 3CZJA 1KQZA 2WB5A 4ATDA 4JIEA 1WZKA 2ZX8A 2Y8KA 3ZJ8A 2CHOA 4AWEA 2FH6A 9CGTA 1QPKA 1B3WA 3N1AA 1C7SA 2JF6A 4PRWA 1M53A 4U5KA 3A5VA 2XVLA 2CIPA 2CNCA 4EK7A 1KFWA 1Q6GA 3EDKA 1PS3A 3EJRA 1V3JA 4DWSB 1IZKA 4TOQA 4W8LA 3FHAA 3RMEA 3AHXA 2ZX6A 2G8ZA 3CZNA 3CUIA 3VM5A 1BYBA 3SEPA 2JEQA 2X2HA 3W4RA 4HPGA 3SCTA 3WDHA 1DTUA 1CGYA 4TVCA 2PWGA 1A47A 1US2A 1G9HA 3QGVA 1E3ZA 2J7HA 3CZ8A 3RPMA 1JDAA 2BHYA 1VEMA 3CIVA 1XH2A 1Y7VA 4M81A 1JG9A 4RE3A 3GYCA 1BTCA 4GIAA 5ABHA 2XVPA 3ZR6A 1B0IA 1LG1A 1UKOA 1J10A 1UR2A 2VVNA 3GTNA 1OGSA 4HA1A 3IGUA 1ZBKA 2C0HA 5DF0A 1ODZA 1PPIA 2VRQA 3I3DA 4MADA 2AAAA 3L4VA 1UWSA 4UR9A 3L4WA 1V6VA 2DT2A 2HISA 4J7RA 2QF8A 2C8NA 3WFLA 4P7LA 1CYGA 4LX4A 1OIFA 4AY1A 3RM4A 1VAHA 4PMVA 5D4YA 2CEQA 4U2YA 5JIPA 1TCMA 3PBGA 1NOFA 1W1TA 2CITA 4NF7A 2OSWA 3BUIA 4W88A 1QBAA 4GXPA 5CPQA 1PIGA 2V5DA 3ARSA 1U2YA 2D23A 5ABGA 5A2CA 3AS2A 3RILA 1JDDA 3PTKA 3AMDA 4W86A 3UESA 1HJWA 3DHUA 1JF6A 3BAIA 4BF7A 1HVXA 7CGTA 2J74A 3WF4A 3PTQA 3PTMA 4YN5A 4GQQA 2XYLA 3VDCA 2FH8A 4OBSA 2DT3A 2XIBA 3AYSA 1SYTA 1FH7A 2EQDA 3RO8A 4UQ9A 4OBRA 4P8VA 4Z2JA 2XPKA 1FP9A 4M29A 4OOUA 3A4WA 2CETA 2VCAA 3SCRA 4PMQA 5A6KA 1E5NA 3MUIA 2UY3A 1G1YA 2VQTA 4MAZA 4CD5A 3AICA 2ZUSA 2J4GA 4QCFA 1B30A 2VC9A 2D24A 1D7FA 3WUBA 2JIWA 1GOWA 1OM0A 2CHNA 4AZIA 2XHYA 1E4LA 4PUDA 5JBFA 3WNKA 1W9XA 5BYWA 1NWTA 1TR1A 1QW9A 3WQ5A 2WC7A 1R7OA 4Y7EA 1BAGA 1ITXA 1QI2A 3EDDA 3WDPP 1W9UA 4N42A 2GK1A 2D0FA 3SUTA 4UFIA 3H55A 2VURA 4LPCA 2DIEA 3SCQA 4ACYA 1MW0A 3ZMRA 1S46A 1B9ZA 3HG4A 2X2JA 2CKSA 1E3XA 1J18A 4E2OA 3BMVA 4OIFA 1RD6A 2A3HA 2VX7A 3D51A 2PBGA 2WLZA 3WNPA 3MKKA 1KQYA 3AHVA 2VRKA 3AXHA 3AROA 2WHMA 2W4XA 3WQVA 1BQCA 3CGTA 3VMPA 3SCNA 1JYWA 3IK2A 2DSKA 1C92A 1UQZA 3MMUA 3GH4A 4Z2GA 1CDGA 1E6QM 5A1AA 3RCNA 1EGZA 4JKKA 3GBDA 3VX1A 1J0KA 2CCRA 1ESWA 4HP5A 3WBEA 4QCEA 1JYNA 2YL8A 5A2BA 1R8LA 4DUXA 3VIPA 5BWFA 2JE8A 1ISZA 3PZNA 2IXVA 2GJRA 1W3KA 5FKYA 3CUHA 4PBGA 3CHFA 4FK9A 1CECA 4BA0A 2EPLX 3ZSTA 4ZFMA 4TX6A 2ZX7A 2WVUA 4P7RA 5LA2A 4W87A 4S3KA 4W5UA 2WMIA 2D0GA 1JZ4A 5GNZA 4UFJA 4CCCA 3ZT5A 4JHOA 3WDJA 1WDSA 5IXEA 2Q8XA 3GH5A 4IPNB 3ZJKA 4W89A 3LRMA 1QWNA 4PMDA 3VIKA 1CXKA 4HMCA 1EQPA 1R75A 3W6MA 5A95A 5D9PA 2XN1A 3WUFA 3GM8A 5HPCA 3D4YA 5FIPA 4FNSA 1FP8A 1O7AA 3UG4A 2WZIA 2OWXA 3O2LA 3A24A 3EDEA 3CUGA 3SUSA 3EJQA 3VNZA 1UWRA 1E40A 1UKPA 2YDSA 3NSXA 2VL4A 2WWCA 1DP0A 5HBFA 6A3HA 1UD6A 4ZE5A 2Z1KA 1C93A 3VIIA 3EJTA 1E6ZA 1LL6A 4KWUA 1UA7A 1LWHA 1YHTA 3DX3A 5ABEA 2F1AA 5E9AA 2JFEX 2WHJA 1GOIA 2YFNA 1BG4A 1DWIM 2DH2A 5IDIA 4E4PA 1FH9A 1MYRA 3UEQA 3WNLA 3WQ4A 2A3BA 2G4FA 2E9LA 4H8HA 1C8XA 3CMJA 4AC1X 1BG9A 1JF5A 3BUBA 5BCAA 3WDQA 3MU7A 3HN3A 3AZTA 2WWDA 1R85A 2RGLA 2OYMA 3BVVA 2XSBA 1PBGA 3H53A 3SURA 1VF8A 1UWQA 3CZLA 3CHCA 1JI2A 4EE9A 1KWGA 1HXJA 4Q22A 3CZGA 2XG9A 3WQ6A 4ACZA 3ARQA 4AMXA 4Z2HA 3CUFA 2DQXA 3THDA 2B31A 3WD1A 4FLRA 2CBIA 2DSUA 1K9DA 1VBRA 4QFUA 2VT0A 3CHEA 4J3UA 1TZ7A 2VX6A 4KRTA 2E3ZA 3AIEA 2FHCA 1O7DC 4ZE4A 1WPCA 3VD7A 3IAPA 5CJ5A 4J3SA 5ABFB 3BAJA 1WZLA 4GZJA 1QI5A 1SMDA 4UZUA 2ZUUA 1NQ6A 4J3VA 3BAWA 5C8BB 2WK2A 5CPSA 2E9MA 1JAEA 2WVVA 2ZIDA 2DPEA 2WANA 5I3DA 3TV8A 4B9YA 3VGFA 1J0ZA 2J47A 1ZL1A 3MANA 4WKAA 4EAMA 4UOZA 4JL2A 3EDFA 1H41A 1CZ1A 5I0DA 4NZCA 2JF7A 1HN1A 1CIUA 3BC9A 3S5ZA 4AISA 4S3JA 3T09A 4ZENA 4CU8A 3ALFA 3O6AA 2J7GA 3W26A 5A8OA 3WUGA 3NSMA 1XH1A 3IJ7A 3BLKA 1XSJA 4QLLA 2PI6A 2DT0A 1DHKA 3TTQA 1BSIA 4MJ4A 1TA3A 4ZEPA 2XN0A 2O9OA 4P7OA 1E15A 1C7TA 1TG7A 1UH4A 1HJUA 4DM2A 2VTFA 3T0BA 3PN8A 1X6LA 3AMGA 1E43A 4CN1A 5E0FA 1W2PA 1GVIA 1QHPA 4H8UA 2G3MA 4F9DA 1E6NA 1R33A 1QHOA 3VD3A 1V3HA 3A23A 1G0CA 3SCWA 1HVQA 1WZMA 1GOQA 5A69A 3OGSA 4CVWA 1CLVA 1GQLA 2V3EA 1B1YA 3AIVA 1Q6CA 1WE5A 2DH3A 4OGZA 1B3ZA 3ZO9A 3CZSA 3I3EA 1E0VA 5HNNA 4GI9A 4P8WA 5CGMA 2EPNA 1VJSA 1JYVA 4AD2A 3LMYA 3ZOAA 1ISWA 3T0DA 1CGWA 3GXIA 2VJXA 1W3LA 3WY2A 2BNJA 5HDRA 5I77A 1KXHA 1MVYA 1J0HA 2YA1A 3WY1A 4NRRA 2WKLA 2WXDM 1EHAA 1M7XA 4EANA 1H09A 5IHRA 5EFDA 2GJXA 1TMQA 1V6UA 1MFUA 1E5JA 2VZTA 3IAQA 1W1PA 3BVTA 2WMGA 2EO7A 2AMGA 2EAEA 3WF0A 5CG0A 1ZS2A 3VUPA 3BAXA 4OOZA 1B3YA 3WF2A 5BXSA 5AC4A 5M3WA 2ZUVA 3FW6A 5GNYA 1R87A 3A22A 3KL5A 4A3YA 3EJSA 1TQTA 1NARA 3OLEA 3ARYA 1RH9A 2DT1A 3WEMA 1PX3A 3L4UA 4MB5A 1UHVA 4A4AA 4LYQA 4HOWA 1GOKA 5FOOA 1DWAM 1W1VA 3KLKA 4V27A 4D71A 1XSKA 1GORA 2WM0A 3OA5A 3WL1A 3O9NA 4AYSA 1FA2A 1CLXA 3WENA 2ALWA 3SUUA 3BUPA 1VFOA 3CC1A 3PZGA 3ZJ7A 3UG5A 3NCOA 3TA9A 1E4NA 1QNOA 1KCKA 3UETA 1H1NA 3WL0A 3KZSA 3LXAA 5AYIA 3D52A 1FH8A 3ARWA 3FAXA 3WH6A 3WIJA 3AMLA 2OW7A 2G3NA 3U5UA 3VIGA 3THCA 3IJ8A 1CXEA 1JZ2A 1OBAA 1JYXA 4HU0A 2ESCA 1E55A 1PJ9A 1U33A 4CUCA 3PHAA 4M24A 2QLYA 2XWEA 2W61A 4WIWA 3BGAA 3T08A 3IJ9A 2DGAA 1YQ2A 2JIEA 4R5EA 3W0KA 1UR8A 1MXGA 5JIWA 3WY4A 2EACA 4JAWA 1CWYA 3LRLA 5CSYA 1DWJM 4PTMA 1G01A 4NRSA 3W27A 1OSEA 2XFYA 3PZTA 1B31A 1ZB5A 4HA3A 3WBAA 2WCSA 2WCGA 2VR5A 2PBOA 3AIWA 3N18A 4M1RA 4BQ2A 5E6ZA 2D1ZA 1QOXA 2W66A 1M01A 1KGUA 2GDVA 3F5LA 4MNJA 4D6FA 1CNVA 1LJYA 5BRPA 4UFHA 2J78A 4AZCA 2F7QA 4CCEA 5CLWA 4W84A 4E8DA 5I23A 3N15A 1QI3A 3CZEA 5JUVA 4LGXA 2WPGA 1OCQA 1TVPA 1ZU8A 1ODUA 2VI0A 3NIYA 1SFSA 4YHEA 4PMUA 4HZ8A 3GXFA 1HKKA 1HWWA 1A3HA 6CGTA 2D3NA 1W9BM 4FLQA 2WMJA 4FNUA 3SCSA 4MAVA 1WDRA 2WVSA 1X6NA 4AEEA 4PMXA 2J75A 4H41A 3BUDA 2X2YA 2X2IA 1XV8A 2YL5A 5CZKA 3J7HA 1CGVA 5E6YA 1OD8A 3AZSA 1UYQA 3OG2A 5E70A 1EDTA 1EOKA 5I2UA 1DWGM 1JXJA 1JZ3A 4ATWA 2XUCA 3WNOA 3AMKA 1PX4A 4PMOA 3K46A 4PTWA 1UKQA 3BSGA 1E6SM 3A4AA 4XZBA 1E0WA 3WNMA 1MWOA 2VO5A 3RJYA 1GQKA 4BS0A 1E1FA 4X0VA 4JFTA 1E0XA 1W91A 1ZJAA 3TP4A 2OWCA 1CXFA 2VCBA 1JFXA 1Q6FA 5HXMA 3CO4A 1EA9C 2YBTA 3POCA 1E1EA 2J8FA 2XM1A 5A6BA 1LWJA 5M5DA 1WKYA 1CXHA 1EDQA 4GZEA 3BAYA 4JFUA 1KB3A 5FL1A 1PEZA 2OYKA 3EBVA 1JZ5A 3FAWA 2QV4A 5A8QA 4JL1A 1V3KA 2VZSA 2J7EA 2Y5EA 1XD1A 4LXFA 1TFVA 1V6WA 1VFFA 4IPLA 4W7WA 1V0LA 3II1A 1LG2A 2VZOA 1AQMA 4M56A 2WCAA 3NJ3A 4IM4A 3W24A 5GPRA 1D3CA 5A8MA 3DX0A 5I24A 2X05A 3F5KA 3L2MA 3SCUA 1W9PA 3VGDA 4FNTA 1GONA 3PZIA 5M17A 2UWFA 4NZFA 4PCSA 4RE2A 3WDRA 1H5VA 1ZBCA 3RIKA 4W7UA 3L4XA 3ARZA 3LPOA 2YA0A 4C7DA 1IZJA 3VMNA 1V03A 4U3CA 1UR1A 3W38A 3EDJA 4TUFA 1QHZA 1KR0A 1FOBA 1OINA 1C8QA 3DDGA 1V6YA 3ECQA 3U57A 3W81A 3DYMA 4XX6A 1H0IA 1UUQA 4TXEA 3SIMA 3M46A 3TTSA 3K4DA 5DO8A 3EMZA 1CPUA 4NSBA 2XN2A 1KR1A 1W3JA 4UQBA 4W8BA 4UQAA 3K8KA 3D5HA 1E71M 4JFVA 1QX1A 1B3XA 2GK1B 1I75A 4AW7A 4J3TA 3ZR5A 4Z2IA 2X09A 5FL0A 3BUQA 1HXKA 3BCDA 1TVNA 5I79A 3VX0A 4DWSD 1JZ6A 3WNNA 1TUXA 5JBEA 2A3EA 1QNSA 4X9YA 3ZJ6A 5D9OA 2G3JA 2ZXDA 3VDHA 4HMDA 4D72A 3GH7A 2O9PA 1GZJA 3AHZA 4MDOA 1KGWA 1TQUA 1WDQA 3NUKA 3MI6A 1Q6DA 3F5JA 4AD4A 4W8AA 2A3AA 3UCQA 2ZICA 4WJXA 5CQ1A
chains in the Genus database with same CATH superfamily
4GPVA 5ISZD 4FTVD 1ID5I 3MREB 4ANWA 3KYNB 3HI5L 5LBVA 2HRGA 2YZ1A 3FN0L 4LW7A 2BNQB 3VXQB 2ZCHL 4G82A 1HTYA 3QORD 4PIBA 3BZEA 3O6YX 4BXSV 4LAMA 3KVLA 1O95A 4M5PA 2I07A 1CT5A 1DANT 1FH2A 4JFXA 1FDYA 2C13A 1C1EH 3ALXA 4KFOA 1T7VA 4XNBA 1L6XA 2ZE0A 2WSRA 4UAOC 4Q2ZB 4D0BB 5SX5K 3D2UD 5J5RA 1V02A 4ACTA 3UJIH 4H9ZA 4XXDA 4YVPA 4JM4H 3RL2B 3SKOA 4Y4KD 4XRCB 4QEGA 2A7BA 1C91A 4OTXH 2ZCKH 5FO8A 2QCNA 3AOFA 1JF1B 3IJDA 2NVAA 2DSWA 1FIGH 2DZWA 1K4CA 1A0QL 3UGXA 1DVZA 5D02A 3IACA 1REQB 5KSWA 4G9PA 1HCYA 4EUPA 4GLEA 3BVWA 4Z7WA 2XWTA 3BFOA 3GC2A 5C0GA 2VGBA 3R6IA 2P8MA 2VDQH 3AU1A 3LCIA 4O53A 4TV3A 4PVMA 4JX6A 3Q48A 3O0RL 4M19A 4XNUH 2WAQA 3LTSA 1HYSC 4ERAA 3NCJL 4DAIA 12E8L 3VIFA 4KQ4H 5F97E 3BURA 2F5AH 2OMTB 1JNEA 5EFIB 4PJ7F 2P5WD 3VOFA 2LR4A 4M0XA 4AMKL 3OHIA 2QCFA 1CUOA 3UU0A 5C0RL 1NF7A 1FAIL 2F54D 3TNNB 4KIEA 4HIJB 1ZCRA 1FPTL 1OABA 3BGGA 3WJMA 3T4WA 2A0LD 3V75A 1FL5A 2AF2A 5TQ2L 1CFTB 5F1IB 5SX4I 3H24A 4D9LH 3OXSB 3B03A 2F7PA 3HU7A 4YIQA 1JV2A 2Y0SA 4I5BA 2IH1B 1MVUA 2QADC 3I6GA 4AGQA 3I68A 3PDGA 4CJ1A 1XAKA 3RE0A 3P60A 3GSNA 3SQSA 1ZHKB 2CDFA 4N8UA 1PKYA 2YN5A 4XMLH 2BP0B 4MJ5B 2Q6WA 4QD2E 4YHOH 4IGBC 5E2TL 1BZ7A 4JFEB 3VKDA 4UYPA 4NVTA 1K70A 4MS8C 3JV6B 1Z44A 4NS0A 3KPLA 1GQIA 3A12A 4PJ5B 5C2XA 1E0UA 5ECVA 1FJ1A 3ZMEA 3OKEB 3CSYB 2VH5H 5IT2L 1UR9A 3LV3A 4BK9A 1PY9A 1ZCCA 4Z7VF 5DRIA 3MVSA 4JFFB 4TVSa 4OZ4A 1LO2H 1R5WB 4R85A 4XSLA 5EMJA 3GHSA 3QCVL 4JTIA 5D7HA 4YL2A 2EPKX 1TJIL 1NGPL 4N9GA 1KM0A 3ZKMD 3S36H 2ZZ3A 4GXUM 4A8IA 3VIHA 4FF5A 4IT1A 4GABA 2KHAA 4XP6H 3ATEA 2HVMA 2WN2A 5KW9L 2YLLA 1JV5A 3PCYA 2HS8A 4WTXA 2VQUA 3SQOH 4MGGA 3D48R 4O02H 3TN0B 3TYBA 3G6JA 1JL8A 4G9FE 1I1XA 2FZ9A 2HJFA 3DUGA 1EHKB 1KT2B 2PWEA 4O4YL 1YEKL 4IISA 1NGZB 2R7EA 1X7QA 4H5SA 1II4E 3S83A 4FHBD 1KXQE 3SJVA 2K6YA 2YGPA 1AQKH 5I1JL 2DW5A 2HBVA 1MXSA 2VL5A 4ZSOE 1A4MA 4DNLA 4IOIA 4EQ3A 3GMRB 2BNUB 4LSPH 4PRIB 4H26A 3DBXB 3W1MA 4UQCA 5EG6C 1U3NA 3TFKC 2HK0A 4PJ8D 2ZOLB 1AHWB 1A5FH 5TPWH 4JKPL 3CL6A 2J9ZA 1WUEA 4GY1A 3WD2A 2X4OB 2FYYA 2P8LA 2Z2AA 5AB3A 1XYAA 4PS7A 1HINH 4Z0SA 4LU5L 1ISXA 1DWFM 2QQKL 5IB3A 1DSYA 4D3CL 2GC4C 1A4KB 4ODUB 2E6JA 3EJJX 3VSVA 2G2NA 2PP8A 4P0DA 1HAWA 1GJWA 1H60A 5F7YC 1TTUA 3PWAA 3FJTA 2XVKA 4FQPA 2DLHA 4FOMA 5TGBB 3EFOA 3CTLA 4HLZH 5K9XA 1F6AA 1BQRA 3RJDA 1QLRA 2P8CA 5FI8A 4JDYA 1OGBA 1MFCL 3QNXB 4JFED 3RHWK 3QR3A 4KRZA 1Z3NA 4KT2A 4ZMPA 5H4ZA 1FWSA 4DZBA 1WTGT 3Q7JA 1ZV5A 2RCSL 4MB1A 3UZJA 3FS9A 1FHDA 1OM3H 1CS6A 4HHAA 1Q6EA 3BLPX 2C9VA 3A3HA 3NFNB 3QHMA 4E41B 4JFFD 4AYFA 1PU0A 3PU7A 1UOVA 4L5FH 4PRDB 1IQ8A 3UP8A 5AY7A 4PGBA 3T8XA 2WO2B 4FI7A 5E7BA 4GG6A 1Z9MA 3TX4A 2BMKA 5G5DA 1C8YA 3I6TA 3MGOA 2EC8A 3MI2A 4FQQB 3OZ9H 2XSAA 5A6MA 4AIUA 2C3GA 2X6CA 3S48A 3TN0D 2MPAL 3E9AA 1ID2A 4PWHA 4O16A 4JVUA 1BQUA 5CBEB 1JTTA 2W5PA 1MFNA 3SQRA 5JHAA 1MUCA 1AI1H 3PZ9A 4XN9A 3BZ4A 2QPEB 4Y8AA 4EXAA 3I6LE 5IBXA 1M3UA 4LLQA 4PW3A 3N40F 3GMNB 1DQXA 1SM3H 1D5XA 4A2DA 4EF8A 2CO4A 4PRID 1NWSA 1KRBC 5CAKA 3QZAA 2J1KA 2HJPA 5LBGA 5K9JL 4QE5A 3W7MA 1JCNA 2FWUA 5EU7C 1M5WA 1N9PA 1FO0L 3REVA 3VGGA 1FHLA 4M5ZH 3ZXAC 1MCCA 1LP9E 5LCVA 2E7CA 2OKMA 2NY3D 1HHHB 3T3MB 3VYPA 1HE7A 2V33A 3G7TA 2PP9A 4QNEA 1V3IA 3W7OA 4NI8A 4QITA 1FUYA 1XP3A 3EWCA 3IK4A 3NCFB 5JPMA 3B8SA 2AEQH 2FUQA 2H2SC 1K7XA 4JO2H 3RM9A 4MG4A 2FNWA 4Y4HB 1BA9A 3G5ZA 1YN6B 1KJVA 1BJ8A 1XTLA 4EPSA 4YHML 3TCSA 1NFDF 1NQBA 4U28A 3SZ8A 4GVHA 4O50A 3P2BA 5D7IB 4MUPA 3S5OA 1W5OA 4PJGE 4HCHA 4PUUA 3W37A 5AVZB 4AD3A 5FCZA 4EIUA 2G96A 1CGSH 5CMAB 4NT0A 2O0TA 2WZ6A 4DQOL 2R83A 3WFZA 2JVUA 1XL6A 4E41D 3WIHL 2VEMA 5H2BB 3LN3A 5B80A 5T3XH 5D4IA 4NIYE 4R7JA 5HGHA 2CA3A 3S1UA 3HPFA 3TR2A 2GKIA 2A7PA 3OEXA 1E9YB 4QRQA 1TV3A 4OZOA 3RDTB 3O81A 4KI5E 4GINA 3EWUA 5IKCB 2E56A 3OG4B 2VEPA 4L8BB 2I5IA 9RUBA 5E1AB 5MEPB 1I9RL 2VDRH 4LIQL 3R1ZA 5EBLB 3SADA 4PTXA 3M8OH 5I8EB 4KEUA 4G5AA 3N44F 5AALA 1ZHLB 4PRBA 3F8UB 4Y4FB 3KLQA 2RGSA 3IVUA 1BQHB 3MHZA 4PGDB 4I1RA 3FS2A 1H61A 4M6QA 1QLFB 3B7TA 4JIEA 2CHOA 1D5BB 3B1TA 1MCJA 3KTCA 1QRNB 3NK3A 4EK7A 5HHQA 1TPC1 4ELKB 1N64H 5F8RC 5CCGE 3V0WL 2OAAA 1EEZA 5J3HC 1BYBA 3EH5B 1NCOA 2BWDA 2QPFA 5HHPB 3VG0H 1I7TB 4DIXA 3HVNA 2DYPB 5D1ZB 4TVCA 1A47A 3L2IA 3RU6A 1E3ZA 3BN9D 1VGEL 2I60H 4P2AA 3S37H 1QJWA 4EOWL 1XYCA 4FEMA 3MCYA 4HJ0C 3OBKA 2UY6B 3ILDA 4ELDA 4YLBA 5ABHA 3SYQA 2Z0BA 4BK5C 3UF9A 3U7YH 2VLJE 4WQ6A 5FW6A 4M7KH 1MEIA 3L4VA 5BUPA 3VFUA 1WC7B 2C3VB 5LNRA 3WFLA 4NJ9H 3NQCA 1DVUA 4LX4A 3RM4A 3T6WA 5DD1H 2IFFH 4U2YA 3VXSA 1W1TA 3UTTA 4JMNA 2EIEA 3AY2A 5L9DL 3IIOA 4M1GL 4LKCA 5A2CA 2IKIA 1HJWA 4IIQC 1JF6A 3QH3A 2QPXA 5CIPH 4NZRL 4FFVD 4KZEH 4JYEA 2C3XA 3MVIA 1J9CT 4WZHA 1GYMA 4FQXA 1HAUA 3WLRA 4OOUA 3FTUA 3DURB 1FNGA 5E9DE 3IDYC 2UY3A 3IMTA 5EF3A 2HPMA 3GNML 3F7YB 3QXTA 4WVRA 3BFWA 4AY0A 4DJFD 1P1VA 5ENWB 4K5PA 1Q63A 4Q8UA 3RDTD 5I74C 4F7MA 1HCZA 3SUTA 2VURA 1CR9H 2HXUA 5E8EB 3ETBJ 4WUUE 4L9DA 1MZRA 4E9SA 2W65B 1U8KB 5E6IA 3TJEL 3BMVA 1IGMH 1EC9A 4PJIE 2W9MA 3QIWB 3NNTA 5EU7E 1PHQA 4DWHA 3OO2A 4Y4FD 4RNHA 1A8ZA 1KBLA 3VIPA 4YAQB 1CU4H 5GNZA 1SJDA 2E68A 1QRND 2JI1A 2VZ3A 3REWA 3Q5YA 1TIMA 4ZTEA 5TQ0H 5GXBB 2H2PD 3WHE0 5F93C 4O14A 3ZHNA 4G43A 2DZVA 4FX8A 1QTSA 3DETD 4ZBCA 1T2JA 1W0YT 4KOBA 1Z9SA 3ZXWA 3QR1A 2OZ8A 2ZQKA 3D3FA 3KLHD 2VL4A 1KIRB 2AS5M 1BZQK 2EE2A 1H7OA 3H2OA 5L4FA 3NZGA 2FATL 3TTEA 2IDUA 4KWUA 5ABEA 3AWGA 1YPZB 1V7NL 1MYRA 2W9LA 3GDKA 4C6MA 2G4FA 5D2LE 2D31A 5I0YA 1ZWIB 2OG9A 2WUCH 3WDQA 4R96B 5AZ1A 1ZAGA 1WOBA 2F6AA 5GRUH 2OYMA 5B1JA 4BZ1L 5KSAB 3L3GA 5IVXE 2EYRB 5AVQB 1XPGA 4ZTOH 4BFGA 1OF0A 3HG1B 4X4KA 2ICWJ 3JWNE 2VDPH 3NN8A 3DKLA 5DI8A 2CBIA 4QFUA 1VBRA 3HPLA 4UT7H 2YD7A 1SQ2N 1UWEH 1E9PB 5JVLA 2DLTA 3GPSA 1FZKB 3SKUD 4XD6A 3ZZSA 4JQIL 3HZVB 3PWUB 2DIKA 1R3SA 4WV1C 3BAWA 1TV4A 3PNUA 3KVPA 4NAQA 1F4XL 1IHIA 3MRIA 1T21A 3V55A 1W5MA 4YDIL 3ZE1B 4PTUA 4U7KA 4M8QA 4S3JA 1EJRC 2GSHA 4NGHH 5I66B 2ADIB 3IPEA 1XGEA 3C8FA 2L3BA 1JGEB 3B9KB 4HZLB 1GYLA 5IHZB 3G9AB 4IFKB 2VTFA 3QIWD 3OZLA 4GISA 3QDJA 4L8DB 1A5AA 4RMUA 2B15A 3HAEG 4GYJA 1IC7L 1ADSA 1G1KA 3CFTA 1R1CA 3MOAH 2LU7A 4JRYA 1KLUB 5KZCB 5IREA 2RFXB 5F7BA 2V2HA 1B0WA 2JIXA 2AJYL 3CFBA 5JR1H 5T5NF 5LHEA 2VJXA 4L4VB 4OFIA 3LS4L 4H6EA 3EUDA 1NCBH 4P57A 4DLMA 4FKEA 3FCSB 3QTPA 1P48A 3IGLA 1E5JA 3MNZA 2IFGA 5M2FX 4YHNA 4X4XA 3I2CH 4NQDB 1ZKAA 3JYCA 2AABL 3TC9A 5LG6A 1R87A 3DXAE 3IGSA 5F0JB 1TQTA 2CRZA 1NFAA 1Q9LB 2GT9A 4AGMA 3D18A 4TLTA 43CAB 1AJ0A 1GORA 1JPTH 4I7VA 3IJYA 3O9NA 1AGCB 3OKNA 5HYSA 1A4BA 4XVSH 2BOBA 1RSFA 3OR6A 4PJHF 4E9YA 1QNOA 3B0PA 2TSBA 5L7XH 5KSAD 1CD8A 3IFPB 4JRXB 4F5CA 4LDLB 4PBXA 3IJ8A 3N3TA 3TZNA 1KCUL 4IU2B 4W70A 1E55A 2F8IA 4ONVA 1JNLL 3MNWB 3K80A 2QDHA 4X6BA 4W9LC 2RJHA 1VPYA 3CN2A 2EACA 4PTMA 3MJ7A 2R15A 1B31A 2OJZH 4MUZA 2NV1A 1NEZB 5LNUA 3F5LA 1LJYA 1YXYA 2J78A 1DIDA 2FWLB 3SOBH 1A6UL 2H9GA 4GXFA 3TZFA 5GJTH 1W3TA 1NF0A 3BJTA 3GO1L 3CHRA 4XVTH 3HRZC 4D2NA 1SJCA 4WI3A 2J75A 4H41A 1FY6A 5PTDA 3GK0A 4B2DD 1XV8A 4WW1B 2QKFA 3GD1C 2CCWA 4FZ8H 4JTEA 2MPVA 1S9XB 3CDGA 4WI8A 4ZS7L 3IVKA 2QSCL 4W4OA 3FQRA 2VAJA 2EE3A 1ETZB 2GEEA 3MRQA 2E47A 3MRCA 4HOMA 4YO0B 4O2CB 4C1KA 4YC2C 1P4LB 4HAGA 1E0XA 4J8QA 4JFOB 2XKNA 3UZEA 2OMYA 3LDBC 4L23A 3W11D 4JDZB 1E50A 5D2NB 2FGBA 3ZIYA 2J8FA 3IJLA 2BSSB 4HUMB 3STFA 5ACLA 3MV7E 1S9WB 5FL1A 4NT6B 5A8QA 4FFZL 3QNYA 5FUZH 1LRQA 2Y5EA 4RMQA 4Y5XC 3SGEH 1CLKA 3QPXL 3VI2A 2VZOA 4REQB 3RVXD 4R53A 2BDNH 3QI9C 5GPRA 4NQDD 3E0WA 3TESA 4N0UE 3C5ZA 3G08A 5EUKB 4ERSH 1RUMH 4YE4L 3I75A 2VQ1B 3AGWA 1FKWA 3HMXH 1V03A 4PV8B 5BV7C 2LAAA 3FXIC 2VHLA 4GYPC 4ZXBB 1FCBA 4MKNA 4OSUH 3ZK0A 4QXUL 2QDDA 1IM3D 4AE1A 1YEGL 2YRZA 3DYMA 3T4CA 3UGUA 3RX9A 1P7HL 3EZ4A 1XG4A 4JRXD 3NFPA 5EU5A 1UPPA 3BW2A 2MQGA 3I4KA 1PO9A 4JANB 1CG9B 5HDQH 3KCOA 2Z91B 2P26A 2L8AA 4LO9A 3Q8CA 1QBLH 3QDGB 2O9PA 5D7IF 1MFEH 1MRDL 4W6XB 4KY1L 3SPIA 3NOIA 1XQ4A 5FACA 3PS7A 3KJ6H 2PYEA 3OAZH 4A1RA 3QFJB 3EOSA 3KM8A 4FNRA 2WLLB 4LEXL 2Z7UA 2HXTA 3FSOA 4I3SL 3CHDA 5E1HB 5E2UH 3WX7A 2R29L 1R9ZA 2HJLB 1ZJBA 3CV1A 2F8QA 4M9OA 3NGBC 4OJFH 1IC4L 5KYWB 4ZMOA 1T5AA 4DJDC 3MJGX 4HGWA 4GH1A 1U8IB 2ROXA 5C2BL 2FB2A 4GSQA 4EXBA 1EH9A 2O61A 3LMZA 1O60A 1VRDA 1T8QA 4JFDA 4YX2H 3S98A 2BSCA 3H70A 1MNUH 5IWLA 2XQBH 3DYPA 5DJ6B 1T89A 3BH8B 4M6MH 3Q8AA 3OPUA 4PP1D 3ZW3A 2F9RA 4G1EA 1CIDA 4GJTB 4DERA 5CCZA 1OO2A 4K68A 4APXA 3HNTH 4K1WA 1Q13A 4Q6IA 3GDCA 1BD2D 5FPIA 5IW3A 1A3XA 1UD4A 4EPDC 5H94B 2XG5A 2TYSA 2X3AA 4DKEL 1KCXA 4BEUA 3AJ7A 4OGAD 2H9AB 1JCYA 5E8NA 1IXQA 3W23A 1P0BA 4XPAL 5JBDA 2WC4A 4LSSL 2BSBA 3CV5A 5ANMA 4OV5A 3I7SA 4PJBB 1WP6A 3CZUB 4C4UA 4W4NA 3OQEA 1LTDA 5HHNB 4FTDA 1L3NA 1T0OA 2BVDA 4ZXBD 2CIIB 5BS0A 3N1PC 2YR1A 5AZEH 3EWXA 1RZ7L 4P5SA 1KYFA 3DENA 1BWWA 1H0DA 2QIIA 5DR5H 3EYFB 3BPOC 2KDGA 3MRHA 3F01A 2DMKA 3NAAH 2J12B 4DP9X 1XGUB 3TO2B 4UQEA 2RAMA 3QOMA 3BDYH 3UCCA 3NJVA 1WRFA 1ZIAA 3CPUA 3P11L 3QDGD 2I14A 1TJRA 3UT0A 3INUL 1QQDA 1FCQA 5F9OH 4L4JA 1JCKA 5JPNB 2HN7B 3MCG1 1OZMA 2OZ4A 1GZPB 1S7SA 3FQWA 5INCA 1F90L 4ZOAA 2YSSA 4AQLA 4P5KA 3VXRE 4M1BA 3NAVA 3OC5A 4EUPG 4XD5A 1GHSA 3SCPA 4NC1C 2AVFA 3IIZA 3QOKA 3WMBA 1D9KB 2DTSA 2E6DA 3SSZA 5F4WA 4DWSA 1CDIA 4FF7A 3A0OA 4Q4OA 5HSFA 2PWHA 1J12A 2NNAA 2W1NA 3GRWA 4C55A 4PP2A 4TVUA 4QRPB 3PTDA 5JOFB 2J5WA 5IQMA 4YCOA 4Z7AA 1J8HE 4EN2A 1W5NA 5IQNA 3RB7A 3CFKA 3OGRA 3U6WA 4CN6A 5HNUA 5JTWA 3KYMA 4PLKD 3U1SH 1UJ3C 4X0NA 2L7QA 4HK0A 2HLFC 4KVNH 3TIEB 3OP2A 4QMEA 4P59H 3MBEC 4XVDA 6TAAA 4CNUA 1XRVA 4FNQA 3H7VA 3L67A 2CKBH 2V3FA 2BVQA 4UTIA 5DZOA 3P62A 3FK3A 4AMWA 1K8DB 1SM9A 4IHOA 1XH3A 3OG6B 1OY3B 4HYVA 4AVHA 1K9EA 3G04B 3FBQA 3TYAA 4LYPA 2K0RA 5JW3H 1YMMB 4GZIA 3L7RA 3ESOA 2AKZA 2AJ3B 3T8VA 2I25N 1HHJB 3MTWA 4CQAA 4TVPD 4LLYB 4HCRL 2F15A 2C3ZA 3PF2A 3IWPA 3GTXA 2WQDA 3TYZA 4X5LA 1VHNA 4JPKL 2XA8L 5TDNA 1FFNB 1PLAA 1K5WA 2HROA 3RLUA 4GKZB 3CWOX 5A2AA 1P2CA 3L7EA 4FL4B 1HNFA 1WWCA 4GKOA 3LBMA 2NQCA 1M7PA 4OZHB 3SBWC 1P7TA 4ORGA 1IWPA 2WWKT 4NKMB 1R38A 5K59F 4KIRA 3P77B 1KLFA 3TEXA 4LYRA 2VABA 3X1GA 1V7AA 4UFMA 1JPSL 1FWXA 2F74A 4K8RL 2P28B 1RPKA 3WUWB 3T71A 4JN2B 4P4KA 2DORA 5AW2B 3TBBA 4Z5RB 1KJMB 2FHBA 5KVMC 4M43L 1I1AA 2OXNA 1A6PA 1XC4A 1P4IH 4NZ3A 4CU7A 1BHGA 5MENB 2MH4A 3HF3A 2ZUWA 3ZE1F 4MWFB 3KPTA 2DM3A 1YDNA 1E9ZB 3HOGA 1EZ2A 5BZAA 1A9VA 1F45A 2AV1A 3NCCB 3RIAK 1OK0A 1GS6X 3MO4A 1OGAB 1NKGA 2ZOUA 4P2OA 3RVWC 2ZP0T 4HU3A 1EJWC 1EFQA 1XX1A 3PL6C 5KEZA 4LT9A 1SMAA 2EDWA 3HGSA 3ZVIA 4IJTA 4U1IA 5D72L 5FA4A 3VCCA 4F7PB 5IUCA 1J8KA 1XIDA 1W3HA 4L1HA 4MDJA 5CS7A 3GFYA 4NP7A 1G6VK 2CFFA 4A2GA 2NY7H 4PS4H 1G7LA 4OUEA 1E9OB 2IG2L 3G77A 4FXGB 4Q0XL 3FO1B 4MSWA 4UCFA 3FLUA 3A5FA 2ADJA 3GXTA 3ARGB 4XPBL 3MQIA 2JB6A 3OOQA 2OEMA 3SRFA 1KNOB 4NY2A 4K3EL 1YPIA 4RA3A 3FGCB 5ABFA 4XK2A 4AVFA 1Q0YL 1ACXA 4A8LA 2H3NB 3LHAA 4YDVB 1H0GA 4XTIA 3GBMH 1UB5B 4O00A 4BJLA 4PMYA 3LBCA 5GIRA 1KGIA 1IBYA 1GCFA 2WWKO 5TF1L 5E8OA 1L2QA 1T2XA 5I71B 1YNPA 2V82A 3GMOB 5CXPA 4I1NB 3W82A 5L8LB 1I3RA 5A6SA 4L37B 2WMFA 4GG8B 5JXAH 4WW2F 2FGZA 3MC0A 4WI6A 3CC5A 1ZA3A 2H26B 4HPHA 3DC0A 3LU2A 5F89A 4JQ4A 2X88A 3JTSB 5BJTA 2PTZA 3QK0A 4OM0L 3A47A 4NENB 3BH4A 4Y8EA 4LSTL 1HQRA 2AOSA 1QLEL 2KPNA 3CVDA 1CICA 3DHPA 1WKFA 1TPUA 3NTCH 3L5HA 1TJHL 4LUIA 3K2IA 5A2FA 3D5OF 3QWNA 4N9BA 2QQLH 3A4DA 3JVFC 1TJGH 1HEJC 1NCTA 1WUFA 2Z35A 1N5AB 4E9RA 2BSRA 1JPDX 1T0MB 3ARUA 1VH7A 4ZW8A 4F9PA 1VYRA 2CWXA 4DN1A 3TFBA 3G9VA 3M7WA 4KROB 1OGAD 3CLFL 4OI7A 5IW1B 1CZ8H 3F64A 2ARJB 2AQ1A 1WICA 2B5IB 4QHNA 4QRRD 4XCCL 1XDLA 2BS9A 4UXDA 1MHHB 5EOQL 2FJSA 3QPKA 3IJHA 1M9HA 4G9DA 2Q8BL 3TA3A 3JZ7A 2YD6A 1HNYA 4OZIA 1EL3A 4NWUH 4Z7VE 3MRGA 3O3BB 4AX7A 5KSBE 2D69A 3SGZA 2E4TA 3CT2A 1S38A 1ZAHA 2V2WA 1TRIA 1LGVA 4C5YA 4H88L 3H3PL 2EJ1A 2GY7B 2W0FB 3ARGD 4AT6A 4W9KC 1YVLA 2JK5A 3QORC 4O13A 1P0DA 2CLLA 1PG7L 3K2GA 1VS1A 2OQHA 1DEEB 4HJGA 2NZIA 3M0ZA 4XCFL 4XXWC 1Y6MR 3ZE2B 3MRFA 3F4CA 3PNWB 3W01A 2JEPA 1TV8A 2DLIA 4QRTA 2LFEA 5AOZA 1OC7A 5EPMB 2PF0A 3G6DH 4A04A 4JN1L 3DV4B 4KDTC 4FXLA 5C6PB 4H40A 4Q4MA 5EF2A 3EXRA 3E1F1 3QWRD 3F00A 1P6CA 3C09B 4G56A 4Y4KC 5IJVA 2CIPA 5EZJA 5KYNA 4JN8A 4GT7A 4DNHA 2B1OA 3RMEA 1XLFA 1T04A 3FUFA 4RISL 4FG4A 4H8WC 3CZ8A 1NGQH 1TO3A 2XZCL 1YA5A 2VYRE 4FTVB 1WYIA 1JHTB 2NUYA 2VKWA 4XMKH 3SDDA 2G60L 4LVBA 4N22A 1ODZA 4L80A 2VRQA 3JW7A 1EEXA 3BH9A 1UWSA 5H6HA 1GT8A 2CUAA 4IMGA 5GZOD 2QF8A 1NKOA 1TTAA 4XCYA 2H6PA 3SCMA 4C8XA 1HDMB 4E9WA 3KP1A 3FSUA 3M5ZA 4IBSA 3P0YH 5DJDA 3L9RB 4BBWA 5I03A 4BF7A 1Y5VA 5K9CA 4RZBA 4ZMZA 2F6UA 5C1MB 1R6WA 4ZAKD 2NDFA 1IRAY 2HV5A 4PMQA 2BIPA 1S78D 3USZA 4F3FB 4NAFA 3U2OA 4XO7A 2J4GA 1DJWA 3SODB 4PJAE 1BWLA 4NZUL 4Y4KB 2G75B 3PWPA 3NGFA 4Q4IA 1H5BA 2FQGA 3L16A 4NM4L 3T0XA 4PUDA 1AD0A 4UUJA 2C91A 2UZ9A 1QHQA 3U0WH 1FSKB 4DJMA 3MRBB 3X1NA 2W88A 5LN4A 3H55A 2YAOA 4WI2A 4S0HA 3WL9A 1Q0XH 3JWDC 1S46A 4KQ3L 4OCNC 5EO0A 2NY5H 1G7IB 3FH7A 3GSUA 2VX7A 4G7VH 3AROA 1QFUH 4ZQPA 4PJBF 5DC0A 3JZUA 1U8NA 5A1AA 3ZRCC 5B39A 3VX1A 4HETA 2CCRA 2D8KA 3DIPA 5A2BA 4DVRH 3WJXA 3MCLL 1FG9C 1SSGA 2WXHA 3O4LB 1JPGB 3MLYL 3UP6A 4FFTA 1JZ4A 1A1NA 4D0CB 4P48A 4K23L 1BQKA 3MO1B 4AENA 1QWNA 2VFGA 3O8XB 4C56E 3QLLA 1XRSA 3NRFA 5MKGA 4LY8A 2OEKA 1A65A 1JRCA 4PB5A 5K7JA 2W07A 2DYSB 5IGXL 2W8CA 3EDEA 4WCJA 6FABH 3VNZA 2XYBA 3BAEL 3DMMD 2ZTKA 1N8ZB 2UXVA 5I5MA 1WGVA 4A68A 2SODB 1LL6A 1HEZA 3H8NA 4A2MA 3WNLA 4RMRA 5K4ZA 3S96B 2ADGA 5K9OB 3BUBA 3L66A 3MU7A 4UYQA 1YNKH 4FD0A 1SW0A 3V4PH 5CSRA 3TZVB 1NU5A 5TK4A 3HNSH 4CVZA 3DO7B 3CHCA 3EX3A 3DO4A 4H13C 3V6ZA 4DP7X 3S1XA 3NVQA 3QO1A 3DX8B 3WD1A 1WH0A 1OHLA 4G3YH 1HG3A 3NCMA 3EX6A 3IETA 1KXTB 5FO7A 4ZE4A 2QZ5A 4H0LC 3IAPA 3G1HA 4EAYA 1A1OA 5EZLB 4H3DA 5I1EL 3WO8A 1DVFB 1PCSA 4Q89A 3MW7A 1RK7A 5D7JA 4QHUB 1AO7E 3GZKA 5F1SA 4IP4A 4Z76B 2QUMA 3LHTA 1PVHA 2F2KA 3NIDB 3SE6A 3N40P 1Y0LB 2A77H 1EQWA 1OGTA 1O9ZA 4C6JA 3BLKA 4QLLA 2DT0A 1DHKA 5E00B 1OEZW 2OGYA 3DUUA 3GRBA 3E02A 1T96A 3NYZA 1T3FB 1XR2A 3RRAA 1RZKH 3JZYA 3T0WA 2V2CA 4YN3A 4E9TA 4WIQA 2PTWA 1WXYA 4F8NA 4CNOA 3RTQD 1Q6CA 3MLTA 1WE5A 3O4LD 3VXPA 1D5ZA 4FRWA 4HJJH 3Q2VA 3V52L 1YEEL 2WAHA 3FTVA 1ISWA 5IBLD 3RY4A 3O8XD 2F84A 4AIBA 3P3TA 4XNXH 1T8XA 4HCLA 3B0UX 1T22A 3BUYB 4PJ8B 3UABA 1NGWA 3IF1B 3SGEI 1DQDH 3WXWH 2KLSA 2FL5B 5EOTB 1F86A 3A22A 5HJBA 4JO3L 3RWIB 3S1GA 1OARH 3JV4B 1IGTA 4M6VA 3ARYA 2WZPA 2XXMB 4AG0A 1PX3A 4OZHF 3O05A 5BRZE 4UMAA 2R51A 3TN0C 2CHZA 3OA5A 4S1QL 2NQ5A 3RAJL 1S7VA 4X9IA 4HKJA 4DGYL 3TZVD 1J96A 5GSVA 1JVLA 3UETA 1H1NA 4X6DA 5DX7A 1R3JB 3WSQL 3ASNB 3FFDA 3R94A 1ZTXH 1IMHC 3UGVA 2YGQA 2XHNA 1MOEA 2BNQE 3RUBL 1KV8A 1UUMA 4JDVB 3E6FA 4B53A 4ODHH 2X70B 1TSIA 5I1KH 3LLFA 5KVGH 3PHAA 3IMRA 3TT1H 1UBPC 1AHWC 3T7VA 2F8XC 1TCRA 3WQCA 3VKAA 1JHLL 1L0QA 3MRRB 1DWJM 3TN4A 1EZVY 3IS0X 1DVFD 3PZTA 3APFA 3WBAA 2WCSA 3VCNA 2PBOA 1LNUB 4M1RA 4QG8A 5T3ZL 3HTLX 4X22A 4Q6YA 1XZ0B 5BW7C 2QZQA 5IHWA 1DBMH 4TIMA 3BKCL 1U42A 3GR4A 4GP8B 3W1XA 3ULUC 1T1XB 4W1TA 3GXFA 1DVSA 4QROA 3KX6A 5KS9A 4FNUA 1OC6A 3I6RA 3WIFB 4YS1A 5HYSG 5KVDE 1TJMA 3PJSB 4LPYA 4AEEA 2FTAA 1S7XA 3L17A 1A6AA 4LH8A 2X2YA 4WTWA 3RPIB 5L2JB 1OP5H 2IPTH 1B3OA 4A7VA 3NP3A 1L6PA 4GKNB 3AZSA 1XF5B 3FQXA 3O3EB 5K39B 4KK8D 4AAJA 5J6HB 1DVTA 2APSA 3QLDA 3DV6B 1T66D 2PLKA 3BEWB 1YLBB 2AJZA 3K46A 3A4AA 3FSWA 1ND0B 3UJJL 1POKA 3HNVL 2EDLA 2EC9T 4GIPD 4GRWE 3HLAA 4PB3A 2OWCA 2O6EA 1VFTA 4P9ML 3D0AA 3WLQA 1JZ5A 3L5JA 3VFVA 3T4YA 4MMZA 4Z3TA 1CD9B 2NOYA 4NZ4A 2GHZA 3Q6FA 3QQ0A 1X5JA 4PUMA 1S3HA 3EOBA 3W2NA 3TK7A 2Z31B 3U2EA 2NY3B 4PJHB 1ZAJA 4K9EC 3RFRA 4U4BA 2KDYA 4GAYA 3SY0A 1F7BA 3LZOA 4HBQA 4BZ2L 1I2OA 3OAYH 3WKMH 1T4WA 4AOFA 2BB0A 4TNWK 4UB0L 3IRPX 2FR4A 4RFEB 4CCZA 5KZDA 1X5IA 4LGSB 4IIBA 3AT9A 5IEKB 3EMZA 4NSBA 1IKNC 4LKXA 2V5MA 1CL7H 1B3XA 4K7PY 4PRPE 2EYTB 4RGOH 4WRHA 4NQED 3KLDA 2OX5A 1W3IA 1QNZH 1GZJA 3CDFA 3AREA 3KHJA 1KGWA 2QS8A 4S1FA 3HGOA 2PPEA 4HD5A 4AGPA 1VFHA 3BN9C 2WP3T 1D7KA 3W2LA 1A9BB 2X4QA 5DWPA 3MOBL 3GXUB 3DX4A 4PJ5E 1AZ2A 4EXKA 2H1LM 5I28A 1LK2A 4NI3A 3WS3A 1O6SA 3EYSL 5JQ6L 4RGNB 4Y4HC 3E2VA 1RA0A 5ITBH 2C79A 4LPUA 1QACA 2QVNA 3MJWA 3HC3H 3T2OA 2VZUA 4R4FH 5E0CA 2ED7A 5FO9A 3C56A 1TPXB 1TYRA 5CNHA 1TZAA 3LHPH 5J6SA 3PUEA 2B59A 3L5WA 2GSGB 1TETL 2G95A 5E5CA 4JNXA 4AYBA 4IRSA 5I1IH 3I6KB 1W0VA 3STZB 4HK7A 1BF2A 3K30A 4LAJH 3BLEA 3ZE2F 3UTQA 1XXXA 3B9DA 2XFXB 2IWFA 4LS0A 3AZRA 4E9VA 2YMXH 1D2OA 3O41A 1RHCA 4B15A 1K77A 5CEXA 4XD3A 3URBA 2IPKB 2EUWA 3HFMH 1A5OC 1DBTA 3TWCH 4FE9A 4L4TA 2PLMA 3F4NA 1XGTA 4KTEL 3RDTC 3JT2A 2DMGA 3KXFA 4L6HA 3VK5A 3BIBX 2A4CA 3VI3A 2J27A 3KYOB 4D6JA 1NIDA 2Z31D 2O7QA 1UZ6F 4ACZB 2ZA1A 2HDJA 3BJSA 2FE0A 5CZSA 4IIHA 2E8ZA 1BLIA 1UB6A 1MCIA 3ZO0A 3G5YB 3PGDB 2FO4A 4HS3A 2E0PA 3T2QA 1XLDA 2EEXA 3D39B 3DI3B 5E1QA 4GQGA 1Q9OB 4Y4FC 1R3LB 1HQ4B 3HCVB 4QJ5B 4AY8A 4XMPL 2PFHA 1INDL 3HBZA 1IKOP 3KPRD 4DF2A 1HK6A 2D3JA 3EX1A 2C16A 3ULUE 5BV7L 4OU3A 1V08A 3AGVA 2DQTH 1TLKA 5LBSA 2G9HB 1MI3A 1AZNA 2QFPA 1ZT7B 1XIIA 7REQB 3WTVA 1E2WA 3TLLA 3MXVH 5KETA 2NYYD 2O4EA 1UZGA 3DETC 4DRSA 1YAIA 5D1ZC 3BCFA 5C2CA 4FNPA 3R0MA 1CLYL 5DJCB 2NLJA 3KLHC 3BVNA 3C8KA 2AQRA 4WF7A 4DUVA 4DZHA 2J6EH 3T8QA 5HHXH 1U9KA 1NP0A 2R23A 1X5GA 2PPCA 4P4RB 1L0YA 2Y5SA 5FAGA 3LZPA 2H90A 4RGND 4QXIA 2NUWA 5LXGH 4PWJA 2I24N 1DDHB 2R56L 3BOFA 3K5SA 5CLYA 3BGMA 1RK6A 4BH8A 1KIQB 5AB0A 4RFOL 3UTPE 4E2BA 1KACB 3AQYA 4MYAA 3MY9A 1XIFA 9XIMA 3TR9A 2NZLA 5J11C 3P30H 3WLLA 2Q3ZA 3U2SB 3QZOA 1HSBB 1PZ2A 4ZTPH 3M5VA 1SNRA 4CEXC 1J5TA 5CC6A 2HZGA 3MA9H 4N2DA 4AYGA 5DEGA 2J7DA 3BYYA 1I3GH 1GVYA 3EOAB 1W8EA 4KTYA 3B0YA 4OLYH 4TSCH 1R9XA 1KRCC 3RUGB 1W6LA 2ZNWA 4Q74A 1RQHA 1E4XI 3BVXA 2YPIA 2PKDA 1I2QA 1VHCA 2FHFA 4LOCA 4H0HB 3EYPA 1CFNB 5FOBA 3B2UC 2YXFA 4TX8A 1ADOA 2A4ZA 1ZVHA 3KHDA 4CMMB 1GYNA 1IGFL 1OPGH 5EUOA 4M6OL 4TNFA 3QIUA 3VI4E 3OX8B 2ZOXA 4CD4A 3QIWC 3LQGA 2AW2A 3D39D 1KFBA 2DLFL 1RULH 4DO6A 4EN3A 3FO2A 3T3ME 5DQDL 3UZVA 3K72B 3OXRB 3KEDA 4GC3A 1CT8B 4WZ9A 2XLLA 3UIZA 2LLGA 3N91A 1PSCA 3DECA 4ZOCA 1XPYA 3ZTEA 1BD0A 4PLJD 4I7ZC 1T4KA 5J11B 3Q2DA 3F2LA 3K91A 3QKEA 1VJIA 1JHKH 5I18L 3DGGB 5C71A 4QLKA 4KO7A 3QIBA 4IUOA 4Z6AT 2IPUK 1JD9A 4GRMA 3LIZL 2X40A 4HF5L 4ZFGL 5HHOD 1LO5A 2OMUA 1FTXA 1SR9A 4Z7NB 1KM1A 2Y7QA 2EE0A 3G0XA 4GXWA 3GVRA 2M8XA 3IUIA 2R1MA 4AZ7A 3KZPA 4YUEL 4XBEL 3M0LA 2E86A 2Q9OA 5LWYL 4AD5A 1AGDB 3DSFL 2V2TB 4BSWB 4IS6A 3AQXA 1LE5A 2NT1A 4FG6D 5D8WA 5F7DA 4ZMYA 2GJNA 4H7ZA 2R9HD 1S39A 4ZG1A 1BQGA 1F4AA 5KSAC 2CC0A 4HWEL 4AIEA 4U1SA 3R18A 3C5JB 3R1GL 2KH2B 3NIDF 3V4VB 1NUGA 1U8CA 5FF3A 3MBXL 1RK1A 4YNYB 4BHUI 1I85A 1A6WL 5BUGA 4EE2A 4LAQL 4NP9A 4HXBL 4CU6A 3IMWA 1AMXA 1DVQA 4ODWA 1P9MC 2JQXA 1GGUA 2CO6A 2EVIA 2G3ZA 4H7CA 3A4XA 2CUHA 4O2EA 2UZYB 4IEFA 4AVKA 2TRSA 2Y06L 5JH2A 1J0YA 5LVEA 3EMQA 4LOVA 1WZAA 3KL3A 3RLVA 2VERN 2ZXWB 4KPHL 1YDOA 5F70A 1LQBC 1JVNA 2H41A 3B9KC 3IBOA 1QATA 1HJXA 5I06A 4ELMA 1GPFA 4D6HA 3HUJB 3KVMA 3NDZE 3T5WA 2EDDA 5CSBA 2A9DA 2DF3A 4ZFOL 2P46B 3T2PA 5ALCH 3KOWA 2YQBA 1S9YB 4HEMA 3MNDA 3L3KA 2F7OA 2GQ3A 1SZFA 1EFXB 2ZPKL 5BNKA 3M0MA 5BROA 1KXVA 2ZWYA 1M2VA 1U8LB 5EO9A 2I26N 7XIMA 5ERWA 1ZANL 5GRZA 4DJEA 2VXSH 5I8CA 1UH3A 3RVXC 1QK2A 1T80A 4ZXLA 4GFTB 4PCYA 4ENED 1SOQA 4NNPH 2XU9A 4XP4L 1G6RA 3SBQA 4H00A 2QV5A 1O6IA 1R5IA 4WKZA 3QUYB 4G8EB 3C60D 5CLTA 3ARFA 2GL5A 4LSRL 3VINA 4YPGA 3EA1A 3WDIA 4J9JA 1A5MC 1I7RA 3LNPA 3FT4A 3LQAH 5ADOH 4WW2C 2KS0A 4B9FA 1SGKA 4Z7UE 2FSEB 4JO1H 4B7IA 3B8VA 4ATTA 3D0LA 3N04A 3AISA 2GITB 3Q2NA 4O1EA 2FEEL 4FA7B 4L3CB 4M6NH 5BXFA 1U4FA 4K3DH 4YTQA 3FU7B 2B1HL 1CYWA 3ZKQD 3UERA 4LC8A 3G6AA 1EX0A 2BJML 1BOYA 2HRPL 1AH0A 1IO4C 4Y9NA 6PTDA 1H1ZA 3QKZA 4K8EA 3VABA 5IMKA 1FFPB 4LYKA 4ZT1A 3RL1B 1OAUL 3L45A 3GMMA 1R3KB 1E30A 5DJYA 4FXKB 5KBKA 1RKRA 2QR0A 4ADUA 1CVRA 1J05B 4LVHB 4QE1A 4XSMA 2ZP8A 3RGVA 4KJQC 2B4CL 4XVEA 1G94A 3UZYA 2XPGA 1QR4A 4GEIA 2XSXA 3M16A 2PCFB 3KE0A 1IM3B 3DX7B 1NMAL 1XLIA 4TNVK 3VA8A 2XFRA 1LLOA 1EFXD 3N55A 4WW2B 4F8TA 1IAKB 4U33A 4GQBA 2QHAA 3STGA 1YPZE 1OAXH 3AXIA 3N2TA 1QEWA 2FH6A 4UWMA 5J5DA 2FX7H 4UT9H 5D2NC 1FNSH 4S1RL 5JORB 3P74A 3BP5B 1SHWA 2EXSA 5F3BA 4OGAC 4U05A 1RBOB 3HG0A 3T0EA 3BOVA 4OM1L 2ZKXA 4QTGA 3W39A 3HG1E 4K4KA 3C5SA 1X44A 3RWCB 3PY9A 4F7CB 5K59E 2ZTJA 2AXWA 3CX2A 2PU0A 5DUBA 4M81A 3QUYD 4JPSA 4JZOB 1O5RA 4X4ZA 1EJVC 4ZXBC 3ULAB 5GGVH 1W1A1 5DZPA 2VVNA 3W2UA 1KJ2L 4QEHA 1OTTD 3IJSA 4DXXA 1FCCA 1ORQB 4I3RH 3TLRA 5EHFA 1OT4A 4QIRA 3GKZA 2Y6TE 5REQB 3KCJA 1CYGA 6ENLA 1MN4A 4KVPA 4HN4A 2CITA 1QBAA 3BLIA 2V5DA 3ARSA 1IXPA 1C5BH 3CQQA 1VSCA 4JG0L 4L3ED 2WW8A 1FNEA 4X8JA 5F3HB 3T0VA 2WYHA 3V4BA 2BZ7A 1IKFH 1SYTA 2EQDA 2JJUA 4OBRA 2XPKA 5ICZA 4XNDA 3MRDB 4M29A 2HK1A 5I19L 2CETA 3TWYA 4EO5A 3HMWH 3OB0H 1MCSA 1NANH 3QYMA 1BD2B 2Q02A 3LHZA 3ES8A 4PJFA 3VFTA 5BO0D 2AQ2A 3WE1A 4KV5F 3W7KA 4F7TB 3RWGB 3OF6D 4QOKE 2WC7A 4YWIA 3CX5K 1MLCB 2BO0A 3ZL1A 1TMHA 4L4VE 1AHKA 2D0FA 4N6RA 3WKPA 5T3ZE 1YEFH 4ABWA 3DBSA 2I7OA 2XISA 1UT9A 4ODSL 4KK6C 4K15A 4ZFFB 4TTDD 3WFDH 1YRRA 5HPMB 2ITCB 4X7EC 3WNPA 3MKKA 4PS8A 2WHMA 3BKJL 4UNKA 4UNTA 3QXAB 4Z2GA 2EECA 1USZA 1GS8A 4JKKA 4FNLL 3SRHA 1OVZA 4MJIA 1A5KC 1JYNA 4OT1L 2HWZH 2VKXA 2PO6D 3LKRB 4BA0A 2FJGA 1VKXB 3C52A 1D6VL 2EE9A 4FP8H 2R0LL 3ME3A 4PLKC 1RCXB 5CEZD 2UZPA 4O0QA 1E5BA 5C7ZA 4XNMB 4UQ2A 2G5BB 2Q8XA 4FR6A 3ZJKA 2PS2A 4M93B 4UTTC 4HMCA 1OVDA 5FKAB 5H8UA 2YC1A 4YHZH 2VGFA 1SW3A 4JRXE 1T7LA 2OZ0A 4CW1A 3RFZB 1XBXA 3NL5A 4A6YA 2A21A 5GGSA 1NBYA 1F8TL 4EZMA 2RH9A 1S5HA 1T03L 2WWCA 2OTWA 4OLWH 3RNQB 4GKSA 2O55A 1SHMA 1LWHA 5CCHE 2JFEX 5IVZA 2YFNA 5DYOB 1IYXA 1S2UA 2A3BA 3IDMB 3VB9A 3L81A 4Q4RA 1UA6H 5B39G 3BV4A 3N2OA 2HKFH 3OAUL 3MJYA 4K7PL 4HNNA 4H8WL 5HYJA 2WJ7A 4BFIB 5MHBA 4HUKB 3OKOA 4DVOA 5F9AC 1YG9A 2H3KA 5I1GL 2ORBH 1EBHA 2ZSWB 3TO4A 1KFEA 4AMXA 3P8IA 4DIAA 2DJUA 1Z5HA 2XSKA 5C8JA 4UF7C 4OU1A 4YXKH 2GTZA 3RFAA 2M1KA 1S5TA 3FFCB 2HLEB 3IN2A 2R2HA 3WEXB 3VD7A 5JPNC 1PYWA 3QXDB 1SFJA 1VPOH 1XF2B 2HKAA 5CPSA 2YLHA 1BDYA 3GQYA 1FX6A 3UIYA 1J0ZA 1RHHA 5DMIL 1HXMB 2A99A 1D9KC 4LEOA 1HN1A 3KOXA 3U1PA 1F6KA 5D2NE 3VXUA 3RUGF 3QJFA 4C1LA 1YEJL 3OAWA 3WUGA 4GACA 5JQ9A 1NPNA 2G2RA 5F88B 2C15A 4OW6A 1YW1A 4M1DH 4P7OA 3KRZA 1BZ9A 3G3DA 1A6ZB 5AD0A 3K6SA 2N7SA 5KSUB 2VDKH 2CDEB 2Q71A 1GG1A 1KG0B 2WYIA 1EUTA 2PABA 2B7OA 2CLVA 5IEHA 3JWDL 4I0PA 1UWFA 3SDOA 4M6AA 2PDJA 2Y7GA 2DZTA 4Z7WB 4AD2A 3ZOAA 2APXA 3DIDA 5CBAA 5HDRA 3AWOA 2BSTA 5G1TA 4M7JH 2MTPA 1CVSC 2CWRA 4ZYKA 2NVCA 3F03K 2L7JA 5CC3A 5LG1A 4XP9H 2HUEA 2DQCL 4YU1A 1PXGA 2D7TL 3V0EA 1VRSA 4FN0A 5KTEL 1DFBL 3BAXA 5KVDL 3TH3T 3LQLA 4LCCA 3S9ZA 4FA3A 1Z66A 4FEIA 3OLEA 3LHUA 2DT1A 3TQKA 1G0XA 4WFHD 3VKCA 3UPRB 1W1VA 4F4RA 2YPKA 4UTBH 1XCQA 3EZ8A 1BQLL 1FG2B 3OAZK 4NJAH 2ALAA 3QXUA 1NAKL 1N59B 3QFJE 4Z7NF 2XETA 3BUPA 3UJFA 1EX5A 1SQMA 2ZD0A 1MFAH 2RJGA 4PREB 4AQEA 2DZSA 1JWSA 2XWXA 1QFEA 1JGVL 4IJBA 3UA4A 4WJKB 2VMCA 3E6EA 1Z5LB 3E38A 1CK0L 1R4XA 3OMAB 1CL7I 2GK2A 4FL4C 3WTYA 1KPVA 3ZGHA 3FFCD 3P3YA 5FGRA 3T08A 2HG5A 3WHXB 5EBWA 3CS2A 1OHZA 4JX4A 1RU9H 5CN3A 3AIWA 2PW1A 7TIMA 4E5XG 5GS2D 2Q6WB 4GMTH 4AZCA 4GQ9H 2F7QA 1T83C 5D4QA 3RWJB 1QI3A 3CG8A 5A2JH 2FPTA 1F02I 2CALA 4YHEA 1HKKA 1HWWA 3HRPA 1J1PL 2DQ6A 3CB3A 1L7IL 3KGUA 4KJWD 4DGVL 1SYVA 5HNRA 5CD3A 4S3CA 4JRWA 2Y8UA 5DJZA 3MUXA 4PH6A 1A3RH 4Y5YB 5DD5H 4S3DA 1SBBA 1R3IH 4QNPE 4RZKA 3GPEA 1S7UB 1S7WA 1UFUA 2NUPB 3ZDXE 1PX4A 2CBPA 3HUJF 3H9ZA 4PZVA 1A4JB 2F8VA 4RW3A 1DJSA 3FJ4A 4X0VA 4WGVB 3F7PC 1M7DA 1XQKA 4YWGL 5IV2A 1JFXA 4UQIM 3RURA 4HT1H 3JT0A 4GO6B 2X2UA 3PFQA 4GZEA 3MRNB 4X9HA 2DWXA 1PEZA 5M94B 3FAWA 3SO7A 3FFOA 2VZSA 4W7WA 3REQB 4FXGC 3UC0L 5FM8A 5IROA 4EEEA 2FVKA 4HV8A 4YFDB 3ARGC 2G3FA 3K2MC 3FQTA 3II2A 2WJEA 1F56A 1PUDA 5FGSA 4QRBA 1IGIH 3QGAC 5I8KH 1N3NA 1WWAX 3HQOA 5IBTH 2EDYA 1NC4B 3WD5H 5DRZB 2ZKYA 2CWNA 3FBKA 3M17A 4O58H 2HT4D 4ZPTA 3VQ2C 1OINA 4LFHG 4OB5H 5C6MA 4G6CA 3B8YA 3EADA 3FO0H 4TXEA 1N0LA 2BNRA 4N2YA 1JPFA 5TE4H 4DXKA 4N8VB 4FJ6A 4XX1E 4HIXH 3MGTB 5I71C 2BRRL 2IKGA 4B3ZA 1VPQA 3CX5J 1AGFB 3VUSA 3R43A 2PCPA 4J3TA 2VDOB 4NKCA 1Z7JA 4GC4A 3WS6A 5DEJA 5I79A 4QRRB 4RDBA 3EB4A 5FYLD 3WJZA 2ZOKA 1SFTA 3BLLA 1RH8A 4K2UH 4NCDA 2DQIH 3OA3A 5E2VL 5J6GA 2YPVH 3QNFA 4QRPE 3LZNA 1RUQL 4KKLD 3PBUA 2J88L 4K5NA 3EW3B 4BIKA 4NPJA 2ZRYA 4HVXA 2AV7A 4HHWA 5C86A 4YR6B 2HCZX 5FK9B 4EBQH 3SW6A 4A66A 4F27A 4EXPX 1KMGA 4AIXA 4YDJA 1KN4H 5I1HH 1IWAA 4FC3E 5L4JA 4OLXH 3LXBA 3CU7A 2WO4A 3QUZB 3AG1B 4RR4A 5GZOC 4IKNA 4Q52A 1BVKB 4PG9B 4GBDA 2VR4A 1OFRA 2MNWA 4KROC 3X2QB 4BQ4A 5EIIB 1U8OB 3ULUL 5KYXB 1AVAA 2B5IC 4UOQA 2MSPA 4DAGL 1JDFA 4GG6B 2FVLA 5B8CA 1KIPB 2VLME 2CZ5A 3JUGA 2B0SH 1YMME 2DN7A 4D6DA 2DICA 4GUJA 5G5DB 4LCIL 4NC1E 4GRLB 4ZAKC 2OMBA 4MNGB 2NY4B 1S78C 4AWUA 4PJ7E 3LI0A 2W0LA 5E8DH 1RCYA 3B7UX 4QY8A 4LUTA 1HHIB 3L4TA 4G2AA 3IDGB 1CEOA 1IAOA 4MVBD 3ZZ1A 3SJVD 1KD0A 2EADA 3N2XA 3ARXA 3KBPA 3DNKA 3FT1A 4JFWA 2VUOA 4TSBL 2C71A 3VIJA 5MI0B 4ODXB 2EIZB 5LGHH 1KEML 4JFSA 4FZEH 3GHPA 1NC4D 3W7QA 4OZHE 5C07E 5F1NB 4PRHB 1NUFA 2VXUL 1W1B1 1AUSL 4JLRB 3BL3A 3V1PA 1N4XL 1YY9C 2L04A 2P80D 3SDXB 3SKNA 5HAOA 3NVTA 1IEBA 4GG9A 5IY5B 1XICA 3C09C 4HBCH 5C0FA 1YNQA 5M1TA 1GIGL 3HEIB 4PYSA 1RVFH 5MENE 3AWEA 4YFLI 2DP3A 1N2RB 1RQ5A 3ZDWA 5IESH 3K81A 1GVSA 4ZAKB 4I77H 3VXGA 5B7EA 4LGRB 1E4IA 3PG9A 4N0YL 9PCYA 4JCWA 2VELA 2Y24A 2H7WA 2W63A 2WHLA 3CSBA 3PSVA 2QSTA 3QUZD 5DQJA 4UTMA 4RE4A 3FT3A 4G7YL 4JFPB 4WY7H 4LEQA 1DE4B 2MANA 3FUIA 4AZ6A 4FP1A 3CLEH 3L65A 3VNIA 1Z1WA 2JQMA 1BIIA 4CVUA 4G5ZL 4FABL 1J0JA 3ISYA 2GTWA 2HFFB 3VXTA 1A9EA 1Z3GL 1BLNB 3C6LA 3NO5A 4JFZH 5JHLH 2D20A 5E08H 2E7BA 1SJEB 4DNMA 1FLRL 3HS0A 4P46A 3PZMA 2D2OA 1AK5A 4X9FA 4GRLD 3S35H 2OYLA 2IH8A 2C9PA 3HPJA 2OMXB 2NY4D 3HPZA 4KAQH 4LBRA 4YGVA 2Y2TA 4RAVA 5DY3A 3W7LA 2WB7A 1IGWA 1TNNA 2CLZB 2DZUA 1X9RA 3PV6A 3Q2LA 1UYWH 1GJPA 4Q8PA 4Y5VA 2OW6A 1OAYL 4GB9A 2C18A 1FSKC 2AQOA 5GHWH 3T42A 2OXHA 4I4WB 2YUXA 2P8PA 3DMMB 3U9IA 1SZRA 4PHZA 3MHFA 4O4WA 5L88H 5DA0B 4K8HA 3PXHA 2G5UA 3TQ0A 1PDKB 2QF7A 2E5BA 4M3HA 4PRHD 4R7NA 5EU4B 2ETWA 2Y4SA 3H9SA 3WGUB 4X7TA 3EKZA 1HSAB 4ZL1A 2QUTA 1JK9B 4M6UA 3QEUB 3U6RB 1SZNA 2XXCB 2N7AA 1AP2B 2HJKA 3S8WA 2YGOA 1HKJA 5HDBB 5C70A 2AAVA 4H9MA 4V1DA 3W1UA 4BJHA 3D06A 3SUWA 1ZK9A 1BFOA 5IBLC 1CENA 1OAQL 3O8XC 2EDNA 1T20B 1T5XB 3FTWA 5FDWB 2Q3OA 1ONQA 4A67A 4WOZA 5ANHA 1MF2H 3DO3A 5I15L 2NR6A 3AI0A 2A0LC 4U5IA 3TBVB 2QVHA 4LSQL 1M1SA 4X7DC 4N0FB 3MROB 4XPGH 4G8AC 5IHHA 4Q9RH 3L48A 3FMGL 4NZTL 1NFBA 3SE8L 4G8GA 1PZSA 1CD0A 1KTLA 2NY2D 3DKJA 3FHQA 2QV2A 5HMSA 4AZBA 5JHMA 4N8CL 1FVEB 2PP0A 4OLZH 1J8RA 3C6SA 3O3DA 4XPHL 1MRCL 3PHQA 3TZVC 2X7VA 2BY1A 4HNUA 1UWGH 2FBJH 3HA1A 3ONBA 1MCKA 3J8F7 5A3HA 3VMOA 2WKGA 1A5UA 4P2RE 2JKSA 3MYJB 4DP8X 2OSXA 4MB3A 5FV2A 4IRJB 5DANA 1E6OH 2BXVA 1NBZA 1GYVA 4R4BA 4FI6A 4IM8A 1NDMB 3TJIA 1J87A 4J3OH 2C7UA 3ABXA 1KENL 5GS3A 4C83B 4Q8OA 4N9EA 3RTQB 4KY2A 4MJ2A 1IBBA 2NW2A 3V6BR 5G2HA 4X4MA 1V8HA 3DTUB 3M86A 1DVF