2WVSA

Crystal structure of an alpha-l-fucosidase gh29 trapped covalent intermediate from bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an e288q mutant
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYQRRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
total genus 158
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvsA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvsA01
4CUCA 4BQ4A 3IANA 2D0GA 3CUGA 1AQ0A 4PYSA 1UD2A 5CLWA 1BTCA 3WH6A 4AMCA 4M8UA 3K1DA 4ACYA 4AXNA 3VINA 4C7FA 3UESA 2IGTA 5A6LA 1VAHA 3VIFA 1WO2A 2EADA 4J28A 3MSGA 1MQQA 1VF8A 2OW7A 3EDEA 4Q22A 2GJXB 4J3XA 3GM8A 3PZGA 2ZUUA 1W9DM 3NDYA 3ZR5A 5HXMA 4UCFA 1X1NA 2X1IA 4UZUA 2XSBA 3APGA 1ZBKA 3LPGA 2EPMX 1VENA 1V08A 1KFWA 3BAIA 6TAAA 3QHOA 3SCNA 5D4YA 2EABA 1H0IA 3WD3A 3EJPA 4AY1A 5AC4A 2PWGA 1HKMA 2YDRA 2CPUA 1E5JA 1LF1A 3OGVA 2J7GA 1B3ZA 1XH1A 1WDRA 2GSJA 4HOWA 3LRMA 3K8LA 5A8PA 3HU7A 3CZEA 1B3VA 1EH9A 1PZ2A 2WVSA 1JG9A 2O92A 4RE2A 5I0DA 1WZAA 1MVYA 2WLYA 3LPFA 2AMGA 3A21A 3GNOA 1E3ZA 1AMYA 1B3YA 3VMOA 2Y2WA 1HF6A 3M07A 3AJ7A 1Q4NX 3EBVA 4JFSA 2VURA 3BAKA 3A4WA 4CKQA 1EDTA 3GXTA 3TTYA 3MU7A 3TA9A 4ZEPA 1J10A 4UOQA 2XFYA 3WQ4A 2CBJA 4CU7A 2ZUNA 3THCA 4D1IA 1E0XA 1GW1A 2ZUSA 1QNSA 4E8CA 3VVGA 1JYNA 3NCOA 3ZM8A 2WXDM 1N82A 1HP4A 5E0FA 4CVUA 1SMDA 4H8HA 4GIAA 3BAWA 4CVWA 2JIWA 1ZBCA 3VIJA 2NW0A 1OGSA 4QLLA 3VPLA 3BVWA 4HA1A 3NSMA 2YJQA 1UWTA 3WD0A 2W4XA 3WF1A 1CGWA 5A6MA 4TX8A 3MUZ1 2WVTA 3VILA 3G6MA 1UR4A 4S3JA 4XUYA 1GOQA 3MUY1 3BXWA 1C8QA 1DHKA 2B31A 2CEQA 4DWSA 2FGZA 3VDAA 3VGDA 3HG4A 3BCDA 4OOUA 4PBGA 4U3AA 3OBAA 4AYSA 1EGZA 3WNMA 1GCYA 2WVVB 5CSYA 1ECEA 3WNNA 4ACZB 1US3A 4QFUA 3D52A 1WPCA 4MNLA 1X6NA 1E6RA 1GOIA 5I23A 1W2VA 5C8BB 4HMDA 4AMXA 2WZIA 5JUVA 3ARSA 1W9PA 1UKPA 2ZICA 3ECQA 4D6FA 1KTCA 2BY1A 1KCLA 2UWFA 2J7DA 4UQ9A 1PAMA 2CITA 4M82A 4HZ8A 4EANA 4URIA 2V3GA 1OT2A 1G5AA 2XVPA 3AMCA 4DWSB 4AD5A 1MWOA 2J75A 4LX4A 3JUGA 3D3AA 1JFHA 3N12A 1JZ4A 2FHBA 1HVQA 3VDCA 3SURA 3CZJA 4LYPA 3GXPA 4JCMA 1WZKA 1BG4A 1VBRA 2ESCA 3BLKA 4DUVA 4V28A 2ZXDA 3PZIA 2VI0A 3F5LA 3BVVA 3N1AA 1XD0A 3EJSA 4LQ1A 5TD4A 4PMDA 2TAAA 3A6OA 1MXDA 5C71A 1NWRA 4BQ3A 3BUIA 2YBTA 1HJQA 2XHYA 5D8ZA 4Z2JA 3QGVA 3EDKA 3VX0A 1JD7A 2ZUTA 1QWUA 5A6BD 1E3XA 1C3FA 3MUIA 1MXGA 5LA2A 1W3LA 3W27A 5EFFA 4CD7A 5ECUA 1H4PA 3HMCA 1LG1A 1QNOA 1BVNP 1B0IA 4LPCA 3L4WA 1EO5A 2YA2A 5FCZA 3WUGA 2CCRA 3WNKA 1W32A 1T0OA 1R7AA 1CBGA 2C7FA 3GXMA 5BRQA 5A69A 3MANA 5DF0A 1FP8A 2PBGA 3VD9A 3BLBA 3WL0A 4JKMA 2C0HA 2BXYA 4GINA 3CPUA 1FOBA 3AYSA 2YOCA 3WBEA 2NT1A 5GNZA 1MQRA 4ZFMA 3MI6A 1TE1A 2YA0A 1MW2A 1GHSA 5IFPA 3RO8A 1V3MA 1WKYA 3FXYA 3VIOA 1EXPA 1Q6FA 3W25A 1ODUA 5FIPA 1TQSA 3RMEA 2X2JA 1ZJBA 1W2PA 2J7BA 1E4IA 5E6ZA 1CTNA 5CQ1A 3PBGA 4W8BA 5M03A 3GBEA 4H7VA 2WMHA 4XZBA 3W38A 4BZYA 2VRJA 3BVXA 1UYQA 3PTQA 4L4OA 1J0ZA 3CH9A 4JFTA 2D2OA 2PWEA 1HJUA 5BWFA 3ZSTA 2C8NA 1OWQA 2D73A 1GORA 3B8SA 1UR2A 1IT0A 3S5ZA 1O6IA 3VIHA 4GKLA 2E4TA 5LA1A 1HJVA 3A47A 7CGTA 3T09A 2WHMA 2WSPA 2PB1A 4ZENA 3S5YA 4HU8A 2BXZA 1EOMA 4EE9A 2J78A 4M24A 3UG4A 1G01A 4ZXLA 2PWFA 5E0CA 1ODZA 5ABFB 4FLRA 3PZNA 2F1AA 1HJXA 3H53A 3PZQA 3EDFA 3BAXA 1UQYA 1M7XA 1Y7VA 5AYIA 2XYLA 5M5DA 2ZOXA 2W92A 1NH6A 5E70A 1JYVA 3N11A 4XB3A 4PMOA 5DT7A 4AEFA 1UZ1A 2JF6A 4GO8A 3W28A 1JIBA 2VTFA 3CZ8A 3LPPA 3A23A 3FW6A 1V3HA 3D5HA 3KLKA 3K8KA 1JDAA 4V2XA 1XCWA 1R75A 3POCA 1XCXA 2FYVA 2BVYA 2DH2A 1GVYA 2WWCA 1R33A 1AVAA 2EPKX 2VZSA 1NM9A 1KQZA 3DHUA 4UFIA 1EDGA 3LRKA 3I3EA 3L4TA 1QI2A 4M29A 4OBRA 5DT5A 3AXIA 2ZXQA 5BXSA 2BY0A 1CXHA 1W9XA 4F9DA 3GXIA 5A95A 3J7HA 2WCAA 4C7GA 3SUWA 4AIOA 3CUHA 2F7QA 7A3HA 2E8YA 1VFUA 3BH4A 4D6DA 1V0NA 5JBDA 4U2ZA 3W26A 1MFVA 1E72M 3CUFA 3EJQA 1OM0A 1UWSA 3U57A 4GO9A 1WCGA 1V0KA 3WQ6A 4CD6A 3VSVA 2O9PA 5GNYA 3WENA 4KGLA 1CENA 1CLXA 1LL4A 3BUBA 2WZHA 3POHA 2FE0A 2PWDA 4MB3A 3MS8A 1HNYA 3AI0A 2BHUA 2J4GA 1HX0A 3W6MA 3T0BA 1U30A 2YBUA 4AZ6A 3TP4A 1BGGA 2J7FA 2FH8A 5D8WA 2EPNA 4NRSA 4D6GA 1UD3A 1XC6A 1W9VA 3AROA 3AZTA 2XIIA 4TTUA 2ZUVA 2OYMA 4FMVA 3TTSA 3CTTA 4OJYA 4RL3A 4JL2A 1D7FA 2YLAA 2VRQA 4DO4A 1IV8A 3WN6A 5FOOA 3TONA 3AIVA 3AZSA 5DO8A 4JCLA 1UH4A 1BFNA 1E6XM 3NIYA 4B9ZA 1ISWA 3AIRA 4PSRA 2YA1A 1H11A 2WC7A 2PBOA 4JFVA 1HKIA 5BXPA 4MNJA 2XTKA 3RJXA 2BS9A 3I3BA 3WF2A 1GQLA 5A2AA 4UQBA 1SR0A 1PX8A 2E9MA 5I78A 1D2KA 2WVUA 2OSXA 2GDVA 3AHVA 3WF3A 5EB8A 4PTVA 1HXJA 3U7VA 4MTVA 2XVLA 2QMKA 1CIUA 2VZTA 2DQXA 4NXKA 2WHLA 2NT0A 3FNDA 1HKKA 2J77A 1K9EA 4PCSA 2YFOA 2ZWYA 2CIPA 4CD5A 4LGXA 5CJ5A 1E4NA 1MW1A 5CPTA 3WH5A 1V6UA 2BVTA 3OLDA 2VQTA 3L4XA 2WW5A 2A3AA 2UY3A 3BAYA 2CYGA 3ALGA 2E8ZA 3ZQ9A 4P8UA 2OWXA 2YL9A 3ARVA 1QHZA 1E70M 3AMGA 2D23A 4U3CA 1B31A 1LJYA 3VMNA 1TG7A 1JZ3A 2DSKA 5ABHA 2W63A 1E0VA 1GJUA 4M80A 2UY5A 1Q6EA 3F5JA 4DM1A 3BSGA 3IJ7A 4J3WA 4UFKA 1O7AA 3EJRA 2XGBA 4D6HA 3CMJA 4CGTA 3AYRA 1DWFM 3RM9A 4V27A 3PHAA 3RIKA 3BVUA 4HOZA 2ZIDA 1KXQA 1Q6GA 3ARYA 2Y24A 1UR8A 2GJRA 1YHTA 2DT1A 1US2A 3PZUA 1V3IA 1V6YA 2BHZA 3DDFA 3VGFA 3WQVA 4OZOA 2PWHA 1DWJM 4MNKA 6A3HA 4FNUA 3VGGA 1QVBA 2G3IA 1R87A 3E1F1 4WIWA 2OYKA 3AZRA 3VIKA 3LX9A 3U5YA 3CZGA 4AD3A 1QHPA 1OD0A 4GZJA 2OSWA 2W91A 3RDKA 1NWSA 1UKSA 4TVDA 3DYPA 4JZ5A 1VJSA 4HTYA 4AD1A 4PSPA 5HPOA 1J0JA 3MUAA 2EQDA 1KR0A 5BRPA 3PZVA 1JFXA 3PN8A 1OCQA 1E71M 3AICA 3FAXA 2G8ZA 3ARZA 1E6QM 3WDQA 1NWTA 5A8NA 1GOOA 4KRTA 4K68A 4PMYA 2V3DA 1HL9A 4ML4A 2VVSA 4ZE5A 3VD3A 1GNXA 1U33A 3BUDA 5CGTA 1BSIA 3CGTA 2WMKA 3MKKA 1UA3A 1BLIA 4NXSA 2YL5A 1ISZA 3T2PA 1PJ9A 4UZSA 1JL8A 1QI4A 1A3HA 1K6AA 4N0RA 3RJYA 1BGAA 1E15A 4YHEA 4Z2IA 4UFJA 2J8GA 4W5UA 1L0PA 1QBAA 3KZSA 3A5VA 1E43A 1BAGA 1MW3A 4EK7A 4UOZA 5CLTA 1KCKA 1EHAA 4GI9A 5I77A 3NSNA 4AISA 3W29A 1V6VA 2J7HA 5F7UA 4AZ5A 1OD8A 2IXVA 3WY4A 3AOFA 4N42A 1TQVA 2EAEA 4H8UA 4W89A 2QPSA 3RILA 2D3NA 4WKAA 5D9OA 3SCVA 3SUSA 1MQPA 1HXKA 4P8WA 1DWIM 1JF5A 2QMJA 4WF7A 5BCAA 1HWWA 3CUIA 3WL1A 1M53A 2XFRA 3WDJA 4NI3A 1FHDA 2YKKA 6CGTA 5A8QA 5C70A 3CC1A 2ZX8A 2XUCA 4H8VA 1J11A 1H2JA 4JKLA 3SIMA 2X0YA 5I79A 5BROA 5A2BA 2VX7A 4W87A 4FNRA 4CU6A 3QR3A 4PMQA 4RE4A 1B1YA 4UQCA 4GPNA 1QWNA 1WDPA 2Z1KA 4BS0A 1H5VA 2JF7A 3VM7A 2CESA 3MMUA 1O7DC 3N9KA 3AHZA 3UERA 3AIWA 1J12A 3GYCA 3WDRA 2WZEA 2A3CA 3D51A 2J7CA 2EACA 3TOPA 1XSIA 1JDDA 3W53A 2J47A 2DDXA 3FN9A 2VQUA 1KTBA 3O9NA 4PN2A 3MV01 1ZU8A 4W7VA 3WF4A 4LYQA 1BF2A 2O9OA 4A3HA 4J27A 1OGGA 1WAWA 4MDOA 1UD5A 2BFGA 4TVCA 2FHCA 5IDIA 4PMXA 3CHFA 1C91A 1KBKA 4QLJA 1GUVA 2ZX6A 3WMSA 4HA4A 1CGYA 1BYCA 4E8DA 1DEDA 2XFFA 3AMLA 2XWEA 4JL1A 4GQQA 1OT1A 1FH8A 2WCSA 3BMWA 2UY4A 1A47A 4HPHA 2CBIA 3CHEA 4ATLA 2OSYA 1CDGA 3PZMA 3WQ8A 4EKJA 5JIPA 4MB5A 5A6KA 2ZX5A 2EXOA 4HU0A 1VB9A 3ZT6A 4W8AA 1ZS2A 2WKLA 1OINA 1UD4A 2XJ7A 4CN1A 1UWQA 5LYRA 3N13A 1LLOA 1OBAA 3IJ9A 3D4YA 1X6LA 2XIBA 1OB0A 3VD5A 1JYWA 3VDHA 1E40A 1UWRA 1KXTA 1UD8A 4WSKA 2J8FA 3DX3A 1DWGM 2PI6A 3AQUA 4ZE4A 1HKJA 3AHYA 2VX5A 1G9HA 3WUEA 3HG2A 4PMUA 2X0HA 4QLKA 1J18A 5CZKA 3NJ3A 2W61A 3WIJA 2OW6A 3ALFA 2XM1A 2XSAA 3CZKA 4PTMA 3DECA 3GH4A 4P7OA 5KZ6A 1JF6A 1TR1A 3M7SA 3RPMA 1JD9A 4HZ6A 3T0DA 1KGWA 3VIIA 5I2UA 2WMJA 4W88A 1KGXA 1VFFA 4EAMA 2VJXA 1E5NA 1ITXA 3IGUA 4R5EA 1UKTA 1PS3A 1PBGA 2PF0A 4PMNA 4J3UA 1UZ4A 4E4PA 4GI8A 1J01A 3AS0A 2FHFA 1OGBA 4WJXA 2O9TA 5IHSA 3WEOA 4WKHA 2WMIA 2WAGA 3CO4A 5A3HA 1W1TA 2CERA 1KB3A 1ZJAA 1C8XA 2JALA 1G94A 2HVMA 1FA2A 4IPNB 1TA3A 4NF7A 4MAZA 5A94A 4FF5A 1CYGA 4AIEA 3EDDA 2YFNA 2QF8A 4MPKA 1XHGA 4B9YA 4Z2LA 4D1JA 1JI1A 3UR7A 3II1A 3LXCA 1QOXA 2D0FA 4F79A 2JIEA 2VR4A 5AYBA 4TOQA 2CNCA 1E9LA 1ZBVA 3F4VA 1RD6A 3I3DA 1KWGA 2GDUA 4JKKA 4FLOA 3ZOAA 3S6TA 3PZ9A 2WPGA 1G0CA 4UQEA 2J7EA 2NSXA 3AHXA 1BVZA 5I5RA 4CCCA 1C8YA 2WKGA 2CKRA 1B30A 1E6NA 4J3SA 2DGAA 1GONA 2D3LA 3WH7A 1UUQA 4MJ4A 4D71A 4B16A 4HOXA 3DYMA 4B15A 3ZJ6A 4PMVA 3GNRA 3WBAA 3HJEA 1OSEA 1LQ0A 5JBEA 3EMZA 3NUKA 1C93A 4TX6A 3OZPA 3WFLA 4GZEA 4DUXA 1QX1A 3CV5A 3KWXA 3S2CA 4UQDA 4OKDA 3ARUA 2JEPA 1NARA 5M17A 3VKKA 4JFUA 1H1NA 1W1PA 1ESWA 1NOWA 3PZOA 4KMQA 5M3WA 4U33A 1VFOA 4AZ7A 3ZMRA 4R27A 1CEOA 1EOKA 4C7DA 1H49A 4P7QA 2RGMA 2ZE0A 4ATDA 3NDZA 3NSXA 1PEZA 2J25A 1TUXA 5JIWA 1CGXA 4MAVA 3L4UA 4BCEA 1DP0A 1HP5A 2XVKA 2VZOA 4GZIA 1E73M 1K9DA 3BMVA 4WSJA 4AZGA 3CBWA 1RH9A 3W37A 1UR9A 3VTRA 4AW7A 4XZWA 1SYTA 4QCEA 4DO6A 5GQBA 2ZXAA 3TTOA 1UASA 1JZ7A 1CXFA 1P6WA 1VEOA 2WMIB 2UY2A 3MSDA 4MB1A 2G4FA 2QLYA 1XV8A 1PX3A 4UFMA 2X05A 1BG9A 3GH7A 3WELA 1V3JA 2VCBA 4AIUA 1CPUA 3GXFA 3SEPA 3AIQA 3WSUA 3AS2A 3FHQA 3VIMA 1FFQA 1JZ2A 9CGTA 4X9YA 4XX6A 1VBUA 2VL4A 1UH3A 1M04A 2ZUWA 2BHYA 1ZB5A 4L4PA 1TQUA 5AC5A 1QHOA 1F4AA 4AEEA 3T2QA 2E3ZA 2IUZA 3WD2A 3WNLA 1E6PA 1E1FA 1V02E 1WP6A 2EEXA 1V02A 3T08A 1V3KA 1HJSA 1WE5A 3QOMA 2DT0A 3VGBA 1ISYA 1RP8A 2EBNA 2PC8A 3WUBA 1XYFA 4CCEA 1B2YA 2DIEA 4D72A 3CZSA 3KL5A 1MW0A 4BF7A 3DX4A 1TMQA 4YPJA 3MV11 3WEMA 3HN3A 2V3EA 2GUYA 1NP0A 1UOKA 1L8NA 1R85A 4IPLA 1UH2A 4WK9A 4PMZA 3O6AA 5EBAA 4D6EA 1BPLB 1FHLA 1E1EA 2GK1B 1GOMA 1UKOA 1J0KA 1GOWA 1SFSA 2DT3A 3K8MA 3AFBA 3UETA 3D50A 4OIFA 1KGUA 1FP9A 2CETA 3OZOA 2HISA 3VOCA 4UNIA 2WBKA 4UOJA 1VEPA 3WD1A 4FK9A 5CGMA 3EMQA 1HN1A 3H55A 3W6LA 3WMBA 2VCCA 3L4ZA 1EA9C 5BXTA 5E9AA 1NWUA 2CHNA 2YDQA 3KL3A 5DMYA 1C7TA 3L2MA 1TVPA 3UG3A 4OGZA 4FNSA 1IZKA 3BLPX 1ITCA 3PZTA 3KE0A 3ARQA 4DO5A 3ZIZA 4AYGA 2GJXA 3EMCA 4QDMA 1R86A 2DIJA 4KWUA 4GXPA 2DSVA 2XPKA 3SCOA 3NYDA 3W82A 3VSUA 2VVNA 4TXEA 1VIWA 3CLWA 3DX0A 5CSUA 2X2IA 2JEQA 3M6DA 1GJWA 2VMFA 2BNJA 3SUTA 1PZ3A 4H2CA 4AC1X 3IJ8A 1ISXA 2WVVA 4F9JA 3CHDA 4MADA 3GH5A 3VMPA 1J0YA 2GK1A 1XH2A 1VRXA 2OWWA 4FNTA 1KWKA 2YLLA 4J7RA 4OUEA 3WNOA 2WM0A 3FY1A 2E0PA 5JBFA 5HPCA 2WMGA 1GHRA 4E2OA 3A22A 1EQCA 1TA3B 3K4AA 5HNNA 1H0GA 3T0AA 3N17A 2XGIA 5GPRA 3DDGA 3WNPA 2WHKA 2V38A 3EYPA 2EO7A 2BY2A 3LXBA 2Y4SA 4TVUA 1GQIA 1R7OA 2YL8A 3CHCA 1HJWA 4UTFA 2VOTA 1V0MA 3U5UA 3DX1A 4DWSD 1GQKA 2J74A 2YDSA 1DTUA 2ZWZA 1E4LA 1OIMA 3L4YA 2GVYA 4AMWA 1WZLA 3OGRA 4U5IA 5A6AA 1CXKA 3RM4A 1EDQA 1M03A 3AIUA 4FLQA 4A3YA 4HZ7A 5IHRA 2A3EA 2X8RA 2BV9A 1UR0A 4DWSC 4YN5A 2D24A 3L2LA 3VX1A 3N15A 1EIBA 1K9FA 1GQJA 1VJZA 1HT6A 2Z1SA 1C90A 5FD0A 1K9TA 1XYZA 3AIBA 3ZO9A 2FDMA 1CNVA 2CBVA 4FNQA 1RP9A 2AOSA 1WDQA 4HMCA 1Q6DA 3AMDA 4LYRA 2F2HA 3W81A 2OYLA 3SUVA 3QOKA 4M81A 2W62A 3WH8A 1G1YA 5LA0A 5DFAA 4CN6A 1HVXA 3L4VA 1TQWA 2VRKA 1WZMA 3SCRA 5I6SA 2F1BA 2QV4A 3HZ3A 2X2HA 2VNCA 1UHVA 1QW9A 1QI3A 3WFZA 4WLCA 1J9YA 4MDPA 4PMRA 3PTKA 3BUQA 1KR1A 1Z32X 4DUWA 3K46A 3VDBA 1W3JA 1BYBA 2G41A 2WC4A 5FKYA 5A6BA 3GNPA 1JDCA 4Z2HA 2XVNA 1TCMA 1TZ7A 1BYDA 3WDIA 2ZX7A 1WDSA 3RCNA 4HMEA 3BUPA 2E40A 1UKQA 1FFRA 4RE3A 3ZJKA 4IISA 3QHMA 1HL8A 3GBDA 4ZXOA 3K4DA 1YQ2A 3HG3A 1BHGA 3UCQA 3N04A 3OG2A 2F7PA 1I1XA 3SCWA 1XSKA 3GXDA 1R8LA 1GVIA 5DEZA 4J3TA 4JHOA 2WANA 4GI6A 5CPQA 3WY1A 2G3MA 1QW8A 4CD8A 4CN4A 3BGAA 1KBBA 1JNDA 3ZSSA 1R46A 1NQ6A 8A3HA 3W4RA 5A2CA 3SCUA 2DPEA 2VCAA 3WF0A 2CKSA 3WDHA 1HTYA 2JE8A 3DYOA 3FHAA 5GNXA 2E9BA 1C92A 7TAAA 1QI0A 4B3KA 1H09A 2YL6A 1C7SA 5E6YA 4F8XA 1WNOA 4W93A 1XRVA 3ZJ7A 1LWJA 2GJPA 2WYSA 4HPGA 1DWHM 2F7RA 3UEQA 2DT2A 1MFUA 3GTNA 3CZNA 4AZBA 1R47A 3LXAA 1E6SM 1UD6A 1E6ZA 1NOFA 1QBBA 1W1VA 1H3GA 4ATWA 2F7OA 3OLIA 4B3LA 3BVTA 4NZFA 3WQWA 4NZCA 2EPLX 3H54A 1HIZA 4NSBA 3THDA 2WB5A 4WKFA 3BC9A 1QNRA 1XH0A 1LWHA 3SUUA 4MJ2A 4QCFA 2XN1A 2WWDA 3CZLA 4U5KA 2WC3A 3B9AA 3UG5A 2E9LA 3KLLA 3U7BA 3M46A 3T2OA 4P7NA 5I3DA 1JNEA 3ARTA 3AMKA 1ZL1A 2WBGA 3MMWA 4NX0A 1E0WA 4Y7EA 2DSWA 3UR8A 1BYAA 3PTMA 2XWDA 4KH2A 1CGVA 4DM2A 1UWIA 4LXFA 4W84A 4AD2A 3OGSA 1R34A 4J3VA 2WHJA 3ARWA 1PIFA 3KEHA 5CXPA 3VGEA 3VSTA 1JXKA 1PIGA 4JFWA 4JHZA 3OA5A 1EQPA 4AD4A 4AWEA 3TTQA 2JFEX 2WSKA 3AXXA 5FL1A 4BQ5A 5BXRA 1QI5A 1NOUA 1M01A 2DEPA 1CXLA 5A8MA 4Z2GA 3BAJA 3VIPA 1UG6A 4Q7NA 3A24A 3DX2A 1TFVA 2G3JA 4PRWA 4CD4A 3ZT7A 3O2LA 4F66A 2V5DA 4QP0A 4W7WA 4UR9A 2WNWA 1QPKA 5ABGA 2VX6A 3OIHA 4M1RA 5HDRA 3WMCA 1PX4A 2DSUA 3OLGA 1PPIA 3AXHA 5E09A 1KXHA 3D4ZA 3AIEA 3WH9A 3EDJA 4CCDA 3GDBA 3AS3A 3RM8A 1FH9A 2CBUA 2RGLA 4S3KA 3ARRA 4YHGA 3SCPA 5FL0A 1EHNA 1ZBWA 2VZUA 4GQRA 2IXUA 1H41A 1XGZA 3ZT5A 1VEMA 3IAPA 3WKZA 2XVGA 5AY7A 5IXEA 4W86A 4PUEA 2V5CA 3BSHA 2J79A 4W85A 1SZNA 2D1ZA 5D9NA 1CXIA 2MANA 3LRLA 4PTXA 1OIFA 1W1YA 4KRUA 4MNMA 4X0VA 3GZAA 3AS1A 4FLSA 5BYWA 1CXEA 4JAWA 3N18A 1B3WA 1B9ZA 4CU8A 4H41A 1E56A 1MYRA 4PTWA 1QNPA 1W3KA 5EMYA 1W91A 2EPOA 1CLVA 2YIHA 1W9UA 1V03A 1B90A 2F8QA 3KL0A 2ALWA 2Y8KA 5CG0A 2QHAA 3VO0A 1TVNA 3MO4A 4U31A 4ACZA 1LG2A 1IZJA 3WDPP 2O9RA 3G6LA 1I75A 1ISVA 3SCSA 1EO7A 1V6XA 1UQZA 4U2YA 3W24A 1V0LA 5D9PA 3IAQA 3VNYA 1UA7A 1I1WA 1V6WA 3HG5A 3GXNA 3WEZA 5E1QA 4IM4A 1CGTA 2CHOA 3AISA 1QNQA 4P8VA 4XV0A 3W0KA 1JZ5A 1S46A 3ARPA 1D3CA 2BY3A 2Y8VA 4UFHA 1XSJA 2VZVA 1W9BM 2CXGA 4HP5A 1E4MM 1W3HA 4KGJA 2W67A 4P7RA 4AZHA 2FGLA 4Z2KA 1JYXA 2WK2A 3WQ5A 5I24A 4P7LA 2Y5EA 1GZJA 2QPUA 4W8LA 5A8OA 4TTGA 3ARXA 4AZIA 3TV8A 5CPSA 4HA3A 5A6SA 2DSZA 3CMGA 1LL6A 2F18A 4AZCA 5IFTA 3SCTA 1Q6CA 3B9DA 1JZ8A 1V3LA 3A4XA 3SCQA 1F4HA 2XN0A 3VUPA 4QAWA 3AHTA 2V3FA 2BVDA 4UQAA 3EJTA 1E55A 2XG9A 4D6CA 3OB8A 3VM5A 2VR5A 4NZJA 2AAAA 2VX4A 1JI2A 2ZUMA 4OBSA 1NP2A 2WLZA 4AZCB 3VNZA 4X0NA 2VO5A 2XM2A 2VC9A 2Q8XA 2D22A 1LL7A 4PUDA 3ZJ8A 2FH6A 1TQTA 4AD0A 3VD7A 1J0IA 1JAEA 3ZR6A 1VFMA 1GOKA 2X09A 1WB0A 2F61A 1U2YA 4UFLA 4MB4A 3VU2A 3F5KA 3CUJA 3DC0A 4W7UA 5KEZA 2XN2A 4OOZA 3FAWA 1AQMA 1B3XA 1RPKA 1KXVA 1JZ6A 3LMYA 2WMFA 4H04A 3MMDA 3IK2A 3B9EA 4TUFA 2ZXBA 1FH7A 5A1AA 1BQCA 4NRRA 2VUYA 5ABFA 1CWYA 5HBFA 3DHPA 1CGUA 2GFTA 3QHNA 2D0HA 2W5FA 4PEEA 1SMAA 1XD1A 5HOSA 3A3HA 2W66A 8CGTA 3WY3A 3BCFA 2OLHA 2ZX9A 3VGHA 4BQ2A 2VT0A 3WD4A 4W5ZA 4BA0A 5D9MA 5EFDA 4JIEA 2A3HA 4A4AA 3LPOA 4D6IA 1JXJA 4FNPA 1CZ1A 3WY2A 4M56A 2X2YA 1AQHA 3WUFA 5ABEA 4PCTA 1GPFA 2DH3A 5A6JA 2J62A 4D6JA 3EJUA 1CECA 1UWUA 2A3BA 3VIGA 4IUGA 1UR1A 1DWAM 3VD4A 1JGIA 1J0HA 2WCGA 3A4AA 2EJ1A 2G3NA 3CIVA 2D20A 4P8XA 1JAKA 2OWCA 1KQYA 3OLEA
chains in the Genus database with same CATH superfamily
2EYSB 1CI1A 5B22A 1TJPA 2AKRB 3IANA 4JM2A 3BSZA 3L3GB 4R4BA 3GW0A 3Q6GH 3H0TB 2JKXA 1BTCA 3IV8A 4UTWC 5JW4M 1L6SA 3FQUA 1LEKA 4ACYA 4AXNA 2X6CA 3EF4A 4Y8DC 1S7XB 3LHVA 2ENSA 3MUGB 2Z6JA 5AVTB 4EP8C 1OGPA 3I9PA 5FYJD 3BGMA 5J6SA 5A6LA 1XGRA 3L0KA 4OM0H 2NY1C 4K38A 2EADA 4JFXB 3TBSA 3V6BR 2F6UA 3ARGD 4MZ2A 1KTNA 3EDEA 3B37A 3L3DA 1R0AH 2PR9A 4Q22A 2VFIA 2BP5M 4U1GB 1LRNA 1TWSA 4E9YA 4KKBC 1TOXA 2COQA 4DGWC 2M26A 3PZGA 5U4NA 2ZUUA 4QHKJ 2BZ7A 2V2TA 4CQAA 3ZR5A 2IPJA 3KPSA 2X3BA 3S4SA 4G9FD 3QORB 2CG9X 1ETZA 1I31A 4NUGL 2XSBA 1SGKA 2OL3L 4KITB 1PL9A 4GGBA 1PG7H 2R29H 3U6XS 3LPGA 3EGJA 2EPMX 1B88A 1MCFA 3QYCA 4X9BA 3SGEI 2PLJA 2VYRE 2C3ZA 4RDZA 4ALDA 4DHGA 1PY0A 5GZOC 4QCIA 3SD2A 3DURA 3BAIA 5FK9B 3PR2A 4Z3FA 1MFBL 3EHBB 1OVDA 4ZOAA 1T0NA 3CFKB 1H0IA 3WD3A 3NQGA 5DUPH 3P11L 2FPTA 5ICXB 4B9JA 1HKMA 2OQLA 2V5MA 3GSUA 3OXRA 2YDRA 4P2VA 1WUFA 4KIRA 3F2CA 1YEIH 4G8TA 2CPUA 1E5JA 4JFYB 2I7GA 4FXGC 1WAAF 4L18A 4L9DA 2VWSA 3OGVA 3B3IB 1JFQL 1GZPA 4NRZA 4AZUA 4UV7L 4NN7C 1XH1A 1WDRA 2GSJA 1NCGA 3LRMA 5A8PA 4P5KB 3MBEA 3CZEA 1EH9A 4QCIB 2VERN 3EBGA 1KBGL 5JOFB 2GUOA 4P49A 4HIHA 5TH2B 5DJZB 3MCKA 5FYJH 1DFXA 1NBYA 3ZKQD 4WHYG 2WQDA 1MVYA 3ZE1E 4R97C 2AMGA 1JPIA 4C65A 3QXAA 5E6SB 1FYHB 3HA0A 3O2VL 2QT3A 3RTQB 4Q4MA 4RFEA 1HF6A 1HC1A 3M07A 2PXYB 4XTDA 2BVPA 2Q8LA 1Q4NX 5DGQA 5HHOB 4JFSA 5T1KB 2DL2A 5FEBA 3PNWB 1X7QB 4FIRA 1GGIL 3BAKA 4PJDF 5JIKA 4U49A 5SWZD 2EVJA 2QCMA 3FQ2A 1R3VA 3I6GA 3D34A 1IB5A 5B8CA 2PCPB 5K9JH 2H32A 3MU7A 1FWGC 1D9KB 1ET7A 1H3UA 2FO4A 4OLWH 5IK3B 3T71A 4UOQA 1O5QA 2X1UA 1WT5A 4RAHA 4EUPH 1TV8A 3GSMA 4M1BA 4YXGA 4QXGL 2XN9A 1R3WA 4UTTA 3IB4A 3U4BL 4PHXA 1W5QA 3OHXC 1J6OA 3LA4A 5AAWA 1QYGH 1FG2A 5F88A 3P67A 3QY7A 2F9BT 1E0XA 3THCA 3M8OH 2VSCA 5F3HB 4HUVA 1J79A 3EG9A 4QG6A 2BIPA 5KSBE 1QK0A 1CK0L 5DJCA 3ETBF 4PG9B 4U1KA 1ZOXA 3GMNB 4KO6A 4N90D 2DQHH 1OFDA 4BM7A 1S9VA 3PHQA 3ZM8A 2R0LL 1A1NB 2CKBH 4LAQL 1GKQA 4RISL 3PANA 2WXDM 4UNLA 2XTJB 1HP4A 3SGJA 5CP7B 5E0FA 3PP4L 4XP9L 4XXCC 5EN2A 5HGAA 4HHPA 1WUEA 3GI9H 4GP4B 1SMDA 2QYGA 4O19A 3HMJG 2DFAA 4PR4A 2NTFA 5IM51 4GIAA 2J6EA 3C9NA 4HK6A 4LSTL 4QTGA 2GCYA 1WK0A 3GFXA 5D5MA 4EX4A 1ZBCA 1SXAA 3CMFA 3VPLA 5B3SB 4X2UA 1ZTXH 1E5BA 1ZMYA 1D5MB 2XWZA 3BVWA 4QYAA 1F58H 2OGYA 3N25A 1OZMA 4X22A 1T1WB 5CD5D 4XMKL 1AZUA 3BIKB 1WLHA 3QZLA 3V5DA 4Z7VA 2NX5B 4FXSA 3WD0A 2N3JA 4EBQL 4JFFE 4KY2A 4PUUA 5I66B 3NP3A 4QYOB 2FECL 1BW8A 5HJBA 2PE4A 5A6MA 2HRPL 3KXQA 1WTLA 2VXQA 4JTFA 4S3JA 2X6AA 1OF2A 5EU6A 1NEZG 4APQD 2AJ3B 2YR3A 3IDXH 4PYHA 4F58L 3GY1A 4IX0A 4MLJA 1GOQA 3MUY1 5C3IA 1QKZL 1TZOA 3G22A 3UJ2A 1Y18A 2NLJA 2XKSA 4KH9A 4OLZL 5T1MB 1T5WA 3SCMD 1HI6B 5BJTA 5CD5C 4Y2OB 3ESPA 5I8OH 3X11B 2FGZA 2VLRD 2I9UA 3ELQA 3BZJA 1OAJA 4AYMC 3VGDA 1DVFA 1GIGH 4DYJA 1M1XB 4PBGA 4B3EA 1DE4B 1WFNA 3HJ0A 4Z0BL 1BZOA 4J5VA 3ZXWA 1T6VN 2JKJA 5CSYA 1ECEA 1T1YB 3WNNA 1SSDA 1KCWA 3D69B 1XW8A 3R5EA 2VFDA 3ZHDA 2I60H 4YBLB 3D52A 3IYLW 2B8OT 1YXDA 1WPCA 4HSOA 4NL1A 3TKFA 1X6NA 1LK3L 5I23A 1FAIH 5C09B 2C14A 4AMXA 2B5IC 1POJA 4OVUA 2ZC1A 5TPWL 1V8EA 4GG6A 4GBXC 3BUYB 3PUDA 1MNSA 2NQDA 1WYIA 1CTOA 3O6ML 2DU2A 2CBTA 4BXVA 1VP5A 2H8PB 3CLMA 4US6A 3SKJH 1FVDB 2CIIA 4I3RH 3T4AA 4FA8A 5JMOC 1H9DA 3W00A 4DXXA 4NUJA 4OCWL 5I8CB 3R43A 1X7SA 5B7FA 4XE5B 4W9TA 4HD9A 2H8ZA 4IFOA 5JQHC 4HZ8A 4MKMA 5ISZB 3G08B 3MSPA 1KIQB 1GYAA 1QOKA 4LVBA 4URIA 2XVPA 2QJMA 4OZFG 1XBRA 1FVCB 2CLKA 2H26B 1CFNA 2J43A 2JKWA 5J12C 4TMBA 4ETQA 3N2BA 4HIPA 5IFJA 5DJDB 1HXMB 4JQIA 5F88B 3DROB 1P9MA 3SOBH 2P0IA 4Q9QH 1JFHA 3N12A 1B57A 5AHLA 1KXTB 2OTWB 2WY3B 4XPAH 2PTTA 3WHE0 4ZMXA 1JZ4A 5JIHA 1XF4B 2GFBB 2PP8A 3HC3H 2FHBA 3VXOA 5B3JE 2MQGA 4X6EB 1SOKA 1FFPB 1QBLL 5CZXC 3VDCA 1QCWA 3SW6A 3RO6A 1TVLA 4E2BA 2DQFA 2X1QA 4ZQNA 3OB0H 4O52A 4FKEA 5TQ0L 2ESCA 3ESNA 1X7QA 4N0FB 4DUVA 1UZHA 3KGSA 3UJEA 5L4MA 3WLNA 4TNWF 3EADA 3F5LA 2DDQL 2BP0B 3BVVA 3N1AA 4KTYA 5DR5L 1YJDC 3QXAB 1EIXA 3EJSA 5TD4A 3SPVB 2C6QA 4QEHA 5BOPA 4PMDA 4YFLF 4WCYH 4KZEH 2V9UA 2TAAA 5D4HA 3H26A 2VAAB 2I07A 1EAPB 4TQEL 3RZCA 1NWRA 3LTYA 3BUIA 2YBTA 3ZWTA 4BQ3A 3WLTA 2XHYA 5IMOA 1QA9A 3ES7A 3A6BH 5I6MA 2X1RA 3EDKA 1N3NB 3JBG7 2ZUTA 1QWUA 2W94A 2YZ1A 5JLZB 2XWBA 1CI3M 5A6BD 3O63A 5CZSA 1XLCA 1BQLH 4LH8A 5JW3L 4TV5A 2VDQB 4JREB 4OGAD 4JJ5A 5T91A 3DSFH 1X5GA 2CJ3A 5LA2A 2A7NA 1J8RA 2EZ0D 5GS0D 3VCRA 3W27A 5EA0H 5EFFA 4CD7A 5ECUA 3HNSL 5DRIA 2QHRL 5T1MA 2ITFA 4HIIA 4A7SA 1I8AA 5D2NA 1UQSA 1WISA 4EN3C 4A22A 2Y2YA 4LPCA 3VD0A 4R2GB 2TMDA 5ICYB 3C09C 2O5YL 2ICSA 2FYYB 1SU5A 3RG6A 4FHJA 2WB1A 5BMXA 1CF1A 3D0VA 3GO2A 2HJFB 4GQ0A 4FOMA 3TZVA 3WNKA 2CCRA 4MUZA 3TO4C 5EOTB 3RWEA 2ZOKA 1W0YT 3H7LA 4FB7A 1E2WA 3ZIMA 2H90A 1XR9B 3BWUF 4GRWF 1RR2A 2NX5A 3QC6X 3LZ3A 3L1FA 2OX5A 4LLQA 4JIIX 5A69A 1T5AA 4LRIC 1FP8A 1TPVA 1YEJL 1V7NL 1TZIB 4FFWC 5KVDL 2Q8AH 5BV7B 1X97A 3WL0A 3XISA 3CAKA 2V9RA 2FECI 4OAWA 1D2PA 4EVNB 5C0EB 1N0XL 3OAYK 4XNUL 2BXYA 5J4MA 3SKOA 1QYGL 1NAKL 2XWBB 5BS0E 5CF3A 2XIMA 2YB1A 3RGVA 4APXA 5GS0C 4EDXA 1JPTL 2NTFB 3P4OA 3U4EB 5I71C 5GNZA 3LHPH 5CAYB 4TR9A 4ZFMA 2R0ZL 2IG2L 3EH4B 3ZKXB 1Z5LB 2WXFA 4ZVJA 3G1AA 5DJ0B 5EU3B 5EZOL 3ARDD 1S2AA 1MJ7H 4PMFA 5E8EB 3S8HA 5IFPA 3RO8A 1FKWA 4YHOH 4PY8J 1WYJA 5FWRA 1RJQA 3THAA 3T9WA 2QVNA 4PJEA 1DL7H 4K7PH 1V3MA 4QXUL 1WKYA 3FTVA 4U1MB 5AAMC 4TVPD 2E67A 2EPHA 3P6LA 1Q0YH 1HO1A 4H9MA 2B0SL 4AEOA 4EJ1C 1EXPA 1LP6A 4UTAL 1X39A 4JIPA 3ZUNC 1JCVA 1G69A 3W7EA 4CQDA 2G5UA 3RMEA 3TOYA 4RFOH 3OBEA 4H83A 3BH9A 5IHBA 3GSOB 1E4IA 2J7BA 1KBVA 1CTNA 2JQXA 1TQCC 1W6LA 3PBGA 4S2SA 4QWWC 3DOIA 2FQDA 3IVTA 3GBEA 4QRPB 4W8BA 3WIHL 3IEBA 3MV8A 4Z76A 2GSIA 4BZYA 2D03H 4NYLA 3DX7A 3PNWA 2WKJA 4LUTA 3X11A 1EGMA 4UC5A 1BFOA 5E00A 3LEYL 4Y7MA 1DBJL 1IGCL 4IOSA 4NRYA 1TZAA 5DU7A 1C8VA 3CH9A 4JFTA 4PRTA 3D3VB 4QI3A 4ZI8A 1HJUA 3ZSTA 3EX3A 5C2GA 3LKNB 3GRBA 3ZTCC 1IT0A 4MZ1A 2CR0A 4Y4KB 3RQ3A 5LGHH 3LRGA 1OW0A 4TXVB 1O6IA 3UP6A 3KAOA 4GYPC 4WOZA 5I00A 5LA1A 1HJVA 2GLKA 3S1WA 1Q72L 3GGWB 5DUML 2DY2A 2OXNA 3KNBA 4MJJA 1FNEA 3QXTA 4N6QA 4A04A 4P5KA 3IMWA 1JCKA 3G5YA 5CGYC 1F0LA 2D2HA 4X6CF 4DO7A 4RZCA 2APBA 4NN5C 2PW2A 3A6CH 1NANH 3BUYA 5HHPB 5LBSA 3QRFM 2B81A 5CSRA 2AMUA 4HS8H 2FZNA 3UG4A 2YBRB 3EYSL 4FQIH 4FTDA 4ZXLA 3R7MA 3GI8L 4LCRA 3L5XL 4HS6B 3T5WA 3FA5A 2OL3H 5E0CA 1L9MA 5FYJU 1ODZA 4HPJA 2X2UA 5FOJA 4FLRA 3KEDA 4MQXC 1HJXA 3PZQA 3MRCA 1QTSA 3CFIC 4C54A 5HHMB 3T0WA 2V6AA 3BAXA 2PMZA 1UQYA 4C6FA 1ES0A 3QK0A 3LK6A 3QQ1A 1QTPA 4YK4B 5C0DB 4NILA 1Y7VA 1JV5B 2HFGH 3QQ0A 3VQ2C 2W0FA 1V8HA 4A7UA 3O4OC 1OPGH 5E51A 1FO0B 5KS9E 2KZ1B 1AQ8A 5I2IB 1M1BA 2HWGA 3OP2A 1JYVA 5C7XH 1KENL 5CINL 4S38A 2YMXH 1I2RA 5M1TA 2NSMA 4L1BA 2JF1A 4NERA 4FAAB 5DEGB 4FXGB 4U6YA 4G7EA 1UZ1A 5DT7A 4LEEA 1EHXA 2C1OA 4QOKA 1JIBA 1JVNA 3B0PA 5E1HB 3IRPX 1BFVL 1Z48A 2E6YA 2ROYA 3VG9C 4BF5A 3BQUC 3IFLH 2NQ9A 1NFDF 3S0PA 6PTDA 1KBWA 3G6DH 3FU6A 4IXHA 4Z0BH 5SX4I 4NT6B 5IB3A 4HAKA 2DQDL 2YPLA 3MRQB 3QFDA 4N9GA 3DX6A 2CR3A 3L3OA 2CRIA 4PJ8D 3EHBD 3LHZA 4V2XA 5IB5A 3LDVA 1KUMA 1B4LA 5I6XB 1XCXA 3AU0A 2BVYA 3MHZA 2HG0A 3MXVL 5IB2B 4JHMA 3MJWA 4YUEH 4J2XA 3KPRA 1R33A 4OD1L 4N9CA 2Q01A 3PWLB 5EORL 3SFWA 3NCYP 1NWPA 2G3ZA 4YBQD 2YRBA 4PJCA 2P5WE 2HFFA 2OZ4L 3HNVH 3L4TA 3LRKA 4XBMA 4YDJB 2XPYA 5LCVH 4DP9X 1VS1A 1EBPA 4RXFA 4R7LA 5FIEA 2ZXQA 5L6YH 3OJDB 3UO8B 2DQGL 4B97A 1LL1A 3PWJB 1RIUH 1VZIA 4NUWA 5ECVA 3MLTA 1UOLA 2CUHA 1E6OL 3GXIA 1XIHA 1ECYA 4H4NA 1SFTA 3EX2A 3RPKA 3GFYA 1XMEB 4OSUL 4LCWA 4CBPA 2VN4A 3BW4A 4Z7OF 4LLQB 4B53A 4KHTH 5IHLB 3GLCA 4C7GA 1PAZA 1XL4A 4F3HA 3KW3A 5KSUB 5DT1H 2ZQKA 3WV0A 2NVCA 1DZ0A 7A3HA 3QC0A 1FCCA 1JV5A 1L7IH 5IROC 3V4UH 1NAMH 1A7BA 3WD5H 1DN0A 3IMSA 4RISH 2YMTA 3PQYE 1X5KA 3T6WA 2ZZUT 3DURB 1H6FA 1NLBL 4U2ZA 3WFEL 2VXNA 5G2IA 1IAOB 5FUOL 5TE4L 3CUFA 3UCRA 3L2IA 4B92A 1ZDQA 1KM1A 4JG1L 2PXYA 4Q8BA 3GUWA 3WQ6A 4BXSV 4XZ4A 5JOPE 1JSYA 3S4TA 2CBPA 3H2CA 4HF5L 3DUSA 3VSVA 1BWKA 2O9PA 3ZKMC 5GNYA 3WENA 2HS8A 1TQBB 5C09A 1YZZA 3V7PA 1CLXA 3V35A 2VRAA 4XKMA 3APMA 1QRNA 4WUUE 1E8WA 2VGLM 3BUBA 2WZHA 2PW1B 2NXYC 3TN6A 5HMEA 5E2JA 2ZP0T 3MBEB 5EH1A 3QG7H 3C0LA 1ORQB 4P3CL 1VYRA 1HNYA 3MS8A 5EEVA 5IQNA 1VKFA 3GRWL 5SWZB 3O6YX 4LCCC 1UT1A 1L5GB 3SPVA 4AZ6A 3TP4A 4PTUB 5F3BB 1SPDA 2PCQA 2VC2L 5FX3A 3MRHB 1IGYA 2FH8A 5D8WA 3AM8A 1PUDA 4NRSA 4WRHA 3NIGF 2Y1HA 1T2QH 2SODB 4GQPH 3QF0A 4X6CB 1XC6A 2AQ1A 4S3FA 3AROA 3H9HB 4UDTB 3F4WA 1EVUA 3CSGA 3U7YL 4A8LA 4PLJD 3FEMA 3BKYH 3U46B 3REVB 2DQIL 4F2TA 5J1SC 2Z28A 2WXGA 2OYMA 4JQ1A 2ZWSA 5CD3A 5HYSB 4XC3H 2WBXA 3MNZB 4P2RA 1L8PA 3RU8H 1YE4A 1XF4A 2GFBA 3MBXH 2BSCA 4JFQA 1Z42A 2D3JA 1USZA 2YLAA 4K3DH 2Z1XA 1DIDA 2JKTM 4IRSA 5I3IA 2L3BA 2P5WB 5DJXB 1UZ6F 2C26A 3MYPA 4YHYB 3BQ5A 2DQTH 1VFSA 1TTFA 1U8NB 2E74C 2KPWA 4NQVA 4WWKD 1UH4A 2AL1A 3R6IA 3ZKND 3W0WB 3L3KA 3VKAA 3E02A 3RIFK 4GW4B 4NQEE 3AIRA 1KJ3H 4DAIA 5HQLA 1YYMH 2RCSH 4XBEL 1WHOA 3U2CA 1H11A 2A73B 5E7FA 1CCWB 2VDKH 5I6NA 1AE6L 4N8CH 3D0CA 3LBOA 1HKIA 3D3VD 3FXIC 5E5LA 2ITDB 2ZZ3A 3L21A 3G6JB 4M5ZL 3WBXA 3RJXA 2CO7B 3E6EA 1CE6B 1W80A 2YD5A 2GQ8A 3I6EA 2D7TH 3WF2A 4UBPC 5E1AB 3W01A 2NUWA 4YVPA 3DVGA 4I3SL 5A2AA 1EGJL 3HZVA 3PQYB 1TXKA 1U3JA 3VI4E 2L4OA 2YAEA 3R10A 5I78A 2L8AA 1JGUL 4UT9H 2OX5B 4JN2A 4YHNB 5C0JB 3WQCA 2VDOB 3WLJA 2WVUA 3AHVA 2PNDA 2ZOOA 3DPBB 4DPBX 2QAFA 3MGTA 1K77A 2WHVA 2V8LA 3D2TA 3KH4A 4MS8C 3H21A 4DKTA 5HWJA 4RDBA 3THML 1RUML 1BWMA 5CFAA 3VCNA 1R17A 4NQXB 1HKKA 2OL3A 4CC1A 3HI5L 3EGDA 1VLXA 4PCSA 3FUDA 1UGNA 3L7EA 4JRXD 3JWNH 4RAVA 4K71C 5C9JB 1VPXA 3IXTA 4I6KA 4CD5A 3BTNA 3QIUB 3IEAA 1MW1A 3CX5J 3NCWA 2L7QA 3WH5A 4G6MH 1U8QA 1OPGL 4AE0A 1W31A 4QNPE 3G9VA 2Q7AA 3LKOB 4OUUA 2WW5A 2UY3A 3QPYA 3TCTA 4ZFOL 2GJZB 4MX7A 5BVJB 1C16A 2CYGA 4NKIH 1INQA 4WD0A 4X4XB 1HYSC 2GGEA 4NASA 5JOFA 4XBPA 2N7AA 2W07B 3HFTA 4YSDA 4I0PA 4DGYH 2C1IA 5F1KC 1GJPA 4MNQD 2IH1A 2OZ4A 3EXSA 3WZ0E 4U3CA 1B31A 3IJEB 2HUHA 5E2UL 1GZPB 2Z91B 3EJZC 5E94B 5LJYH 1JZ3A 2DSKA 5ABHA 4U4MA 3MA9L 3LSOB 3SIKA 3OJGA 2W63A 4M19A 2NY3C 2V7HB 1NM4A 2RCSL 2XQYA 1JNHA 1IJNA 1GJUA 4OGAC 4XBEH 4M80A 2XICA 5DO2C 3DX9B 3REWA 3W11C 3S36X 5ETUA 1Q6EA 2VGGA 3F5JA 4L4LA 2CLVA 4CVXB 2G97A 3P0VH 2YGYA 1IKOP 3VH8A 2C3VA 3OC8A 1MFDL 4J3WA 1CLOH 5AZUA 1T83A 1YC8A 8PAZA 1NSNH 1SJBA 2BODX 3G5XA 2FTPA 3FXGA 4LBSA 4OBTA 4WY7L 3FB8A 3C8FA 1AHWC 3IGLA 2EUWA 4RMVA 4L4TA 3S36L 3UWQA 3OKKB 1AJ7H 1VHCA 2Y7GA 4ZE4A 1WBYB 3CMJA 5AUMA 4CGTA 2HBVA 4XD4A 4OZIE 2ILLA 3ILQD 3VXSA 3RM9A 1DBJH 1IGCH 1ZLUH 1KJ2H 2DAVA 3BVUA 4ACPA 3IMTA 2DIKA 3RPDA 5LCVA 2O1AA 3WHXB 5I0XA 2V67A 1DQJB 5IMKA 5KVGH 1FHVA 4ES4A 2EXWD 2QQKL 5DA4A 4Q8MA 1KXQA 4M7TA 2ICWI 3ARYA 2Q3OA 1LO5A 2FB4H 4NY2A 4AYBA 3MT1A 1DQQB 3JT2A 4LCUA 3PZUA 3D85D 3O4LE 5MEOA 4JGDA 4JM4H 2HKFH 2QGCA 4M1GL 2XQBL 3DDFA 4M62L 5F1UA 4OZFA 3T2NH 1YY9D 3GDCA 1DWJM 4MRCA 2WLLA 2ED8A 3UX9B 3U79A 2XWJB 4RPQA 3WTXA 1U36A 2PTVA 2WO3B 1QW7A 2G0WA 2H8PA 3KXFD 2OMYA 4UUJA 1WKFA 2J9XA 3F05A 2VGFA 3AZRA 3CZGA 1YCSA 1DHPA 5CUSH 3H9SE 4HC1L 3NL3A 2VLKD 3TYCA 4GZJA 5JXEA 1K3IA 4QSHA 2BNRB 2R2BA 2OSWA 4A2RA 5AVUB 2PWUA 1HAWA 4WNQA 3EA1A 3NA9L 3GTIA 5FO7B 1E0TA 3QV8A 3BOFA 4JTIA 1XG3A 3OKOA 1LILA 5FOBB 4HTYA 1DBBH 3DX5A 1MUJA 1J0JA 3ARGA 3X14B 4OIIL 3MUAA 2KHAA 4RLIA 5F3FA 3MNWB 1KR0A 3PZVA 2YQ2A 3OGOE 5F1NB 2FKPA 4GJTB 3W22A 4G7VL 1NCIA 4LOUD 3LB0A 4R3SB 3VFUB 4UT9L 1OCQA 4OZGE 3H2PA 2LU5A 2LE9A 2PPAA 1E9ZB 2DMBA 1KBIA 1WUZA 1G7JA 1IGTB 2X5PA 2CU0A 2VP8A 2O30A 2NTSP 5A8NA 2OR8A 4KRTA 4O51A 4DEUA 1JUKA 4G1NA 2V3DA 3HE6C 4UTHA 2VVSA 3WUWB 1U8IB 4ZE5A 3ATFA 1W15A 1FA4A 2P46B 1BBDH 5DMGD 3CPRA 1E2VA 2W60A 2HROA 3CGTA 1IFHH 1DSYA 5DHXB 3MKKA 4Z77A 3L3OC 1S2CA 2FD6L 4XBPB 1UA3A 1JQVA 4NXSA 3JV6A 3UA4A 4DBDA 3UZ5A 1RHHB 3T2PA 1PJ9A 2CRZA 4L5FL 5EU7E 2FWOB 4C56E 2FZDA 5GS1C 4Y8EA 3U6RA 4W70A 4YPGB 1WD8A 3O6LH 4NHUB 2EKJA 1CLCA 5LBSH 3U2SA 2LLLA 3BZEB 5JW3H 1QBAA 5KVEH 2A1YA 5HATA 5MP6L 3QQ9C 3A5VA 1RZGB 1ADOA 4HFUH 3LCHA 3RCMA 5GGRY 3OZLA 4UOZA 1AS7A 2ZKHH 4F20A 5CLTA 4GJ1A 1B4TA 4FQ2H 3TYGH 4F57L 5C0GB 2GYIA 3ABRA 2YKLH 4P46C 2VDKB 4W81A 5AVSB 5JR1L 3SDOA 4NO0B 3WLWD 7PTDA 1RZPA 1E4WH 2XRAL 4FXLA 1YYLH 4XAGA 5DX7A 3W29A 4ZJ9A 4YQXH 3AGVA 1V6VA 3VA8A 4E6MA 3R0NA 4HIEB 3L5IA 1YC7A 2UWEB 5DJ2B 1XS2A 3PPFA 4BWWA 3BWWA 3YPIA 5IDZA 3FQYA 5C7HA 2QPSA 5BVPH 2DJ4A 3HBPA 3T4YB 4N20A 1RK5A 5D1XE 3CO8A 3LN3A 5J57B 3GMLB 1SGJA 2V81A 2LV4A 4HJ0D 1MQPA 1S9XB 1D3GA 4P8WA 3FOLB 3RU6A 4J8RB 3OJ2C 1RH8A 1S7TB 5FGCE 3GK8L 2A74C 4AJ0A 1DWIM 2ZJSL 1IGIL 2XQYG 3UJIL 1HQRA 3P62A 4XPAL 2QCDB 2WUCL 3H2MA 4HJ1A 3EXRA 3AT0A 5DQDH 3CUIA 1ITBB 3LHUA 5I3JA 2HX7A 1SZRA 3HMXL 2WOYA 1QRND 4MG4A 3MJ8B 1L6ZA 2DEYX 1UOZA 2Z0IA 3CC1A 2ZX8A 4BV1A 2EE2A 2F5BL 1INDL 1FNSL 3KPPA 3OKNB 4MZ3A 3DFSA 4I90A 5C6PB 1UYWL 4RPPA 5J5RA 1J11A 5ID1B 4JKLA 5CIPA 1EO8L 4JM2F 5BROA 1TZHA 1SF3A 2J1XA 1NBZB 5CU9A 4DBUA 3JYCA 2DUZA 1DFBL 3ABMB 1MCLA 3MRBB 3ZJAA 2HKAA 1NGXB 3FT3B 5FDWA 3BV4A 1UM5L 3H7BB 2QQ6A 2B16A 3D1MC 2C34A 1Y5VA 4Q6IB 3QR3A 4OHQA 2WJ5A 5EN3A 2DP3A 5EPMB 3UIYA 5ITBL 3MP5A 1B1YA 4UQCA 3T1FA 4DFIA 3S3JA 1TJRA 4UQ2B 1S3HA 4LOEA 1IEHA 2H6OA 5JMRA 1Z89A 3VM7A 3IJ6A 4X2PA 4AFYA 4JO8A 4CDHA 3STGA 1IXNA 1ASQA 5F3BA 3PUOA 4GABA 1WHPA 5DANA 1FKXA 1DOSA 2IMMA 4IGBC 1MEHA 4MM1A 4P04A 4FL4B 2I56A 3IXAB 3UERA 1Y6KR 3BPLC 2J3SA 2GI7A 3S3BB 2VD9A 4C6EA 4GUCA 3DGGB 1BP3B 2BMKB 4P5MA 3AW5A 2J7CA 3EPNA 3STFA 3HS0A 3VQLA 5DS1A 4WNQB 3CS2A 3BZ4B 3AB0C 1BDYA 3FRPA 3W53A 4UTUA 3VYNA 3FO2B 4XVUD 1L9QA 4APQA 3U9UA 2DDXA 5DZ9A 4LASL 2E77A 3V0AC 4PCPA 1YNTF 4PN2A 3N43B 1T3FB 1FBIL 1OCWL 1AGFB 4Z17A 1P5VA 4TSBL 2EDBA 2HA1A 3P82A 2VLRA 4BFNA 2XVBA 1W6WA 1OSZB 4FXFA 1BF2A 2O9OA 4E42B 1OGGA 4MDOA 4LIQH 2WLLB 4XNAA 2APFA 2GUUA 3U30C 1B0GA 1JZEA 2RALA 3UDWA 1H6TA 3CHFA 3TYFB 4K3EH 4QLJA 5DYOB 4E8DA 4HA4A 1BYCA 1YG9A 1R3JA 4NOFA 2JB5L 3T3ME 3EEZA 2NQJA 4FG4A 5ICUA 2I25N 2PN5A 2PR4L 1G6RH 4OLUH 3TURA 2AABH 4GQQA 1G9MH 4GSXA 4P61A 5FUZL 1F7BA 4C6IA 1I7TA 2WTOA 3BMWA 1GGCH 4DKDC 2OXGA 1A9BA 5JDJA 1BXNA 1HO4A 4J1UB 5HGBA 4P2YA 3RVTC 3JV6B 1P7KB 4F2MB 3C60D 4JBSA 1A47A 3NGBB 4EPBC 2HFGL 2QADB 1I9IL 5HVHB 5FM4A 2OSYA 4X98A 1EGVA 2ZXWB 1QFEA 4LAOA 1V93A 1DQWA 4IGMA 4ELDA 3P69A 3LKRA 1MUCA 1ZGLP 1MEIA 1NDVA 4HU0A 4F91B 1IC1A 4AYFB 3DSNA 3VZXA 2DKUA 4Z08A 5ETUB 4LSRH 5LXVA 1ZS2A 3QORD 1KTRL 1PG7W 1KC5H 1UD4A 2CLVB 3II2A 5FR3A 5IOKA 1XBVA 3W1TA 1E8YA 3DHDA 3DO7B 5LYRA 2GGGA 4JRXB 4R90H 5EUKB 5C2UB 2Z91A 3N13A 3UY7A 4B90A 1YXCA 2WP3O 4U0RB 4Y2DC 5I15H 1N55A 4CNIB 1ZWIB 3IWPA 1KRBC 3WSQH 4GMEA 5IBXC 2VR7A 1OVZA 3IDIA 3FH8A 4V1DE 3H9SD 1V7MH 2WXPA 5A3IC 1H7PA 3N19B 4IPIA 2XIBA 3LB6D 1OB0A 3VD5A 4O2FA 2UY6A 4LP8A 1G7PA 2Y70A 2WWMD 1F8TL 1KCRH 1T0PB 1XYLA 1BJMA 2E47A 4F27A 4PJIB 1LE5A 3TSMA 1XKJA 3KVPA 2QTVA 1M65A 3KCLA 5HI3D 3CAFA 3COTA 4OJEH 5I26A 1H15B 4MZ8A 4XO7A 4L9YA 1X5MA 3DXAA 2F53B 2OMZA 1H51A 2VX5A 1MF2H 4MWFA 1A3LL 4QRRB 1F5WA 3H7RA 4L4TD 1A5AA 1WBJA 2WQSA 3C5SB 5A2JH 3P2TA 4GUOA 2OR7A 1EP1A 1P0EA 1VPYA 2YCIX 3BYYA 5CZVH 5HHNB 4EI0A 3D08A 4ZOBA 1D7DA 1W1B1 1QNZH 3MLYL 4N2BA 2OW6A 3ALFA 2XM1A 2MRYA 4MWAA 5B7ZA 2B3RA 4PTMA 1RULL 3O41B 2QZQA 2ACSA 3MFFB 4P7OA 1N6UA 4HB7A 4QXUH 4XSMA 3LEVL 8XIAA 1BVLA 1XINA 3HZVB 4PWFA 2PETA 1TR1A 3R8RA 5GRJH 3SIZA 3RPMA 1JD9A 3T0DA 4HZ6A 2G2NA 5I2UA 4BFBD 3FS2A 1P9MC 2NDFA 2NY6B 4C5ZA 1KGXA 4M3KB 1Z69A 3H70A 1JPTH 1OE1A 2VLKA 5CBJA 4F7CA 1UKTA 4ODWA 1PBGA 3S6DA 2A9ML 4Y7OC 3TXAA 3B4UA 3FTGB 4JTTA 4PMNA 2QNEA 3TN0D 3SDDC 1U41A 1NFBA 1WQVT 3RK8A 3ZDYB 4RVBA 3ZTJH 1KPUA 4PJGE 5AOZA 4K4KA 5GS2D 2O9TA 3NA8A 5GGTH 5JQ6H 4GIYA 3KRSA 1Y6MR 4E5XA 5A3HA 5HGDB 5C6WH 4C90A 2VDOH 1XLBA 2CERA 4DN1A 1AXTH 1KB3A 4C6KA 5DC4B 2JALA 4F8QA 4QKTA 1G94A 1HILA 1PKQB 3FQWB 3UJTH 1AZNA 2F8VA 2HVMA 4IPNB 4PUWA 2GITB 1TA3A 2Y7QB 4XPHL 2DB8A 1SXBA 5D4QA 1INQB 3SSGA 1OQXA 4AX6A 4X5XA 4XZNX 2ABBA 5IHUL 3IETB 1KDIA 5EUOE 4JRXE 4JTHA 3GSXA 3RBSA 1U9KA 2ADYA 4L4JA 2MQCA 4GFSA 1HXYA 2V9QA 2OMTA 4B3VA 3OXSB 3KBSA 1YMMA 3V0GA 4ZQKA 2E7DA 3GO1L 2X7VA 4D1JA 2GJ6A 4P23C 1DXEA 4CMHB 1ERNA 3Q1SH 3LDBB 1YTKA 4YTUA 1PMYA 5HDBE 5JW5A 1DR9A 3P81A 1IEVA 4ETYA 2Q10A 1C5CH 3APDA 1CFVH 4KKLD 1WX0A 3K6NA 3QARA 2E7MA 3FU5A 4XI5D 4PJ5A 1A25A 2NY1D 3WCYA 1NBQA 1NDGB 1LZOA 3HE6D 5HJ3A 2F53E 2WYIA 2BCMA 1W6TA 4TQEH 2G0KA 1JPGA 3D3VE 4P9MH 5GSRA 3GDTA 1E9LA 1LDCA 4W9FC 4KEZA 4X0KA 5KSVA 3E80A 3LMZA 4YTTA 1ZBVA 5EZLB 2G75A 4GW5A 3F12A 3IVKA 1VERA 2DD8L 2GK2A 1CL7L 3AACA 3I3DA 4WFGE 4A7GA 1EXGA 1KWGA 1LE5B 3AT9A 1BD2B 4JKKA 4JY9A 2LU4A 1ZJHA 1X5YA 2ENQA 4FLOA 3KBWA 2GG1A 3CSFA 3IFOB 5D1QB 2ZDRA 4JFDA 4TKWA 5C8JB 4F2UA 3DBPA 2FD6H 2O93L 3T0XA 5JIMA 5KBMA 3GKAA 4FTVB 3QEQA 4G71B 1LO0H 3L0GA 3QP3A 4CCCA 5KBKA 5B7MA 4MDRA 2WKGA 1IC7L 4N5UA 2CKRA 4H2HA 4YL2A 1N68A 1P1VA 2RH9A 4D8LA 2K6ZA 3HA1A 2DGAA 1GONA 3BICA 4KDWA 5IJKC 3EXTA 4XNMB 5E9DB 1HINL 2MJWA 4FMFA 5HD8C 4DZBA 2Y89A 5BOFA 3WJXA 4UOW0 2P49B 3RWCB 5I18L 1WVZA 1UG9A 2NR6D 4LLUB 1WKDA 2IIJA 3H6AA 2R94A 4D71A 3CXDL 4S1DC 4H7ZA 3OKOB 1SZGA 3DMMD 1LP9E 1O5PA 3VXQB 4HOXA 3DYMA 4OT7A 2B7OA 1WBZB 2ZZ5A 2C9XA 3PAVA 4X6CA 4PMVA 4ZXBB 3GNRA 3BISA 3U0WL 4I87A 2ZUQC 1EWDA 1O5XA 4TULH 3ULVD 3PIQA 4OF7A 3U8GA 3MLUL 3N3EA 3BN3B 2ZCKH 4RNFA 4IRJC 2Q0ZX 1C93A 4HEPA 1XDTT 2N7BA 3L23A 2BWIA 5BUPA 1INEH 1TZ8A 2OEJA 3OZPA 1ZV5A 5HJXA 3WFLA 2R7EA 2MMXA 5JOPD 3QDJD 3HR5A 5DC0A 1U5HA 1HHHA 2Z35A 5C2BH 2YSTA 4ZBCA 2EICA 3QJAA 1HL2A 4C6BA 4HZMA 3SRKA 5D96C 1ZLWK 3AYVA 2ZKWA 3V18A 4DP2X 1NMBL 3NZQA 2WZ6A 1D7BA 1Z9AA 4I6VA 4LVGA 3CUPB 2IQTA 3UYOD 3EGXA 1IKFL 7REQB 1EUNA 1G0YR 3NRQA 2GSGA 2KS0A 1ESWA 1FGNL 4UIKL 2DVXA 2FFCA 1VFOA 5DFVC 3KJ6L 3QZ6A 1S7VB 2DZBA 3ZMRA 5J11B 1UM6L 3PUUA 1KTDB 1CEOA 3QEUA 1SFLA 4L3EA 4XOAA 2I9EA 3UA3A 1MHPL 4LSUL 3ASOB 3G77A 4AVNA 4QITA 1FUYA 1I3VA 3WFCH 1JGMA 2PEVA 2RGMA 4X5WA 4P7QA 2ZE0A 4XVDA 5EYWA 3LJ3A 2A4CA 3NDZA 3QPXL 5FW6A 4YEFA 1FQ9C 1KYUA 2C91A 1KZQA 3B2XA 4ACTA 1DE6A 3TGXA 2XBDA 4UQ2A 4ZB2A 1O95A 4XD3A 3WTVA 4JTSA 2ZE3A 1YEFL 2XBTA 4GX8A 1W5NA 4L8BA 4LCWD 1TLMA 1RMFL 3IFNL 1ECZA 2OV0A 5ALCL 5IOPB 4DEWA 3LCLA 4F37F 2GW5A 2CALA 1XLHA 4JTDA 1R9YA 1TDQA 4XCEA 3BVJA 1AYOA 3LQLA 5GJNA 3ABGA 5BO1L 2MCMA 4L3EB 3N91A 1BAFH 3FN3A 4GH7B 1IL1B 2Y72A 4AW7A 3N29A 2ZXAA 3MJ6A 1UASA 4CAGA 1CE1H 5JW5B 5TGBA 1DJIA 4MB1A 4NRYB 1XPYA 2G4FA 3N2OA 4PJCF 4UFMA 2X05A 4X7TB 4PJBB 3TO4A 1V3JA 2AC0A 3KS5A 1ACCA 4AIUA 4XMLL 2VENA 5D03A 2B08A 5FYKE 1QUPA 4QXGH 1R1CA 4AQAB 2DI8A 3VE7A 3MJMA 2P28B 1SR9A 3LIZH 4X6DB 3SEPA 4XZUB 1VFLA 1E5ZA 4FFVD 1N9PA 1I53A 3GNNA 1YEKL 5AN7A 3BVNA 3T1GA 3MTRA 3QQNA 4K3EL 4TO8A 4N26A 3VIMA 1ZVSA 3G7TA 2DMCA 2X9ZA 4WO4C 4X9YA 4XX6A 3VXUA 3OBKA 4I8DA 1YNPA 2VL4A 4IM8A 4R7NA 4YXKL 1EF3A 2FBOJ 4X6CE 1A02N 3QJRB 4EIBA 2J9ZA 4Y4KD 1ME8A 4ASTA 4Q8VA 1R9FA 5C0IB 4AGLA 2J1YA 3QDMA 1FBIH 1OCWH 4AUJA 2BHYA 1T03L 1M04A 3TROA 3V9EA 3H23A 5T5NF 2HNHA 2CO7A 4LARL 4L4PA 1TQUA 1ICTA 4PB4A 3K71B 5GGSA 1QJWA 1HFUA 1QHOA 3BH8A 3QIWA 5DQ9B 1F45A 4PE8A 1G6VK 2DKSA 2PP7A 4MMZA 1M5WA 2Z7YA 1EJ6A 5GRYA 4H00A 3SB0A 4CQCA 2QGBA 2IUZA 3QUHA 1H5YA 1JCNA 1T7XA 2WAHA 4UM8A 1Y0EA 1E1FA 2YBGA 4ZTOL 3MUUA 7PCYA 1TF4A 1HJSA 1KFEA 1A80A 1KRMA 4ORIA 5FEZA 2IQ9H 7XIMA 2DT0A 3FO9B 4XCNB 2K6WA 3ZDYF 3EO9H 3MHFA 1DQLL 2PC8A 1LWRA 3EO9L 5DVPA 4E9RA 5BUAA 1OPOA 5LKYA 4JX0A 4Y5VB 4FQLH 2DIEA 2JWYA 2Z8RA 3G6JE 4X5RA 1HCFX 1LLAA 2J57A 4BRJA 2XZ7A 3P0VL 4US5D 4A29A 3RU8L 1AD9A 1MW0A 1P1ZB 3MRDA 3VXGA 4BF7A 2JVUA 1LO2H 3FX4A 4L6OA 1XIWC 3CAVA 2GUYA 3QDGB 1CT8A 1UOKA 4GG8A 1G7QB 1QACA 4L4VB 1L8NA 1Q63A 2R1LA 5D2NB 2QUNA 1KPVA 4AG0A 1BPLB 1RIVH 1IGTA 3T0ED 4DXVA 5JHAA 3RXZA 4PP1D 1IC5L 1R19A 1G9MC 4A63A 1ZGDA 3H12A 3W1NA 2EIDA 2VISB 2DZPA 3F7VA 4NQDE 4WO4D 4X4KA 4KIEA 3CB8A 2NY0B 3RWGB 3GRWH 1XLAA 2F5AL 2F2KA 4G2DA 4Q4PA 3WKYA 2GJ6E 4PV8B 3FUKA 2VWEC 2KDYA 5I82A 1BIIB 4ZSOA 1ENUA 1RAKA 4DJEC 1J5OL 3OZOA 4MKSA 3AY2A 2VDMH 5IV2B 4QSFA 4G8GA 2WLJA 3MRJA 4ZMLA 1GSMA 4PR5A 1A4CA 4PB0L 2E7LC 3UTTB 3HAEA 5GGSB 3U4KA 3BZFB 3MUJA 1TMCB 4O1DA 3VZYA 1MRCL 4MXVE 3TBYB 1Y8BA 2C1HA 5C7VA 3FMGL 5ADPH 1XR2A 5GGSY 3RE0A 1MFAL 3K6OA 3V2AR 5EBGA 2JFCA 2P0OA 3BPWA 3WD1A 3P1VA 2GAZA 2QBWA 4FK9A 3IGAA 3CVIH 4GO6B 4RGOH 3EMQA 1MCKA 4Q8WA 1HN1A 3UYIA 4FI8A 5A16A 5FESA 5TE4H 3J2PA 5KSWA 3CDGB 3ZKSD 4XP1H 5INDA 3EW3B 4ZX6A 4MVBD 2J44A 5E9AA 1NWUA 2CHNA 4ADJA 3PB0A 1DQQA 5AKRA 1LLZA 4EVNA 2A77L 2DVUA 4LPUA 1Q9KB 5C92A 3NRFA 4TQPA 5GRUH 1TVPA 1JJUA 1WAUA 1I8KB 2DZTA 3AXKA 3EO1B 4JJOA 3ZDXF 1CICC 2QKIB 4LU5L 1U1HA 4X8CA 5JZ7D 1OAUL 1AR1B 1KIRB 1WV2A 3BLPX 1ITCA 1G7IA 3U7WL 2O6FA 4JDZA 2UVEA 2PCFB 3OZ9L 4PRNB 3IDNA 1P84J 4AYGA 4IRZH 4DO5A 3V4PH 3FTYA 3EMCA 4DOHE 2HFFB 3QHZH 4IRZL 1TREA 2ATKA 4QDMA 1R86A 1J9CT 2DIJA 2G60H 3M1BB 2HJLA 5HVGB 2DSVA 1SFDA 4TVSa 1UFUA 1FFOA 2ZNXA 4JAMA 4J2QA 3GHEL 2C7UA 2VN7A 3P4MA 5B1JC 3PP7A 4NT0A 8XIMA 4XN9A 5K4XA 3R0KA 4TXEA 2N01B 2I5YH 1URZA 2IPTH 2VM3A 2YQBA 4QT5A 4YUEL 1N5YH 1B54A 4JFDD 4JPVL 3RHWF 4NAQA 3SN1A 4N2OA 4EN3A 3RL1B 4XC3L 4K7PY 3RNKA 4YX2H 1NC4B 3DX6B 4PN6A 3ZE1F 5DBTA 1GJWA 4R0LB 3O0KA 2BNJA 3SUTA 1PZ3A 4GGHA 4B7IA 3DXAE 3QQDA 1FO0L 4HJSA 1K7FA 1UBPC 4MGGA 1FL5B 2NNCA 1A21A 2Z29A 3TEXA 4X80L 4IKJA 4A2FA 1ISXA 2V30A 4XKYA 4XAKE 1DSWA 4PTTA 5KN5B 3CHDA 4MADA 2PODA 3Q9QA 4GFTB 1S7SA 4QHMB 4DESA 2QLVB 3LLXA 4CNUA 1E2ZA 4NHCH 4PJ6A 1CICB 3F5WB 3ZY7A 4OE7A 2GK1A 1XH2A 5IQLA 4CC4C 3TQ0A 1M3UA 4KUCD 1VRXA 2OWWA 5C0BE 3VNMA 1Z3NA 1N8ZB 2AJ3A 3NEXA 4MVBC 3QZWA 3ERPA 1L0QA 4CVZB 1SBSL 4OQVA 3VXTA 4OUEA 2WM0A 1ES0B 3K5RA 2Y7MA 2DQUL 3TESA 3IVUA 4GBUA 4X2RA 5AQ0A 1AIFA 4WSHA 3ECBB 1HEHC 4W9GC 3K4AA 2NQLA 4B3ZA 5IFAL 3CXHJ 3F00A 4AQ8C 1IC5H 3RPBA 3QMTA 3H3BC 1A0CA 1A4KA 2XFGB 5H35B 1UXSB 3RHGA 1UB5B 4I1RA 2JCCA 2WHKA 2EDJA 2I9LB 3DVGB 3S8WA 5JO5B 4O10A 5D7JC 1D5MA 4JN1L 3ULUC 2NYKA 3EYPA 4NZ4A 4Z78B 2BIHA 2BY2A 2Y4SA 3CFCL 4ILSA 1QR1A 2X4TA 2J1KA 4B5VA 2HKHL 1GYCA 1YJDH 3V0VB 1R7OA 1P4LB 4K73A 1QDSA 1FFOB 3CHCA 1JRCA 1G1CA 3I7SA 4X61A 2H1PH 3TXVA 4PJGF 4P5TD 2Z1WA 2AK4E 5DMMA 2BH0A 2X88A 3NZHH 3TFKD 4KROC 4APXB 3AQXA 3W85A 3EH2A 3DX1A 2ABAA 3BRDA 4IHBA 3GIVA 1M4KA 2X4OA 2H9GA 4HISA 4L8DB 4NHVA 4DK5A 2YDSA 4PRHE 3CFMA 4TNGA 4CADB 5L2KA 2HRWA 4S1FA 2FSDA 1UMYA 3H8AA 3A3XA 5AG9A 1FAKT 4ZSTA 1IWBA 4Y16B 2VLRE 5D2LF 2JJUA 5AYZA 2DY3A 1K7EA 4NN7B 3RM4A 5HNRA 1D9KA 1R3JB 1M7DA 1M03A 4MZRA 3AIUA 2Y22A 2X4NB 4FLQA 5EORH 5CD3B 1OFPA 3PHOB 3S97C 2Y2TA 2Y7QA 2Z35B 3QZAA 3NK3A 1UR0A 3P9MB 4WJ5A 3GQYA 2YWYA 4LVAA 5H8UA 4Y1SA 1HL4A 3RY6A 3QXWA 1CDHA 3L2LA 4JFZL 3TW6A 2F58H 4EF9A 3WJYA 3P0YH 4YCOA 1EIBA 4DIAA 3RFZC 1D5RA 1A0QH 1EZLA 5I1LB 4KKBD 4IIEA 4TYUA 4C47A 4RFEB 1U3HB 4OCYL 2FDMA 3GDLA 1XB8A 5IVNA 2GVJA 1CNVA 2OTDA 2B2XH 1IE5A 1QABA 5DJ0A 4ODWB 5EU3A 4IMFA 1XF5A 3G6DL 1AP2A 3ZDXB 1Z44A 4LYRA 3S9IA 1B2WH 3I6TA 1Z9OA 3W81A 4JHBA 3ZE2F 2FSEA 3SUVA 3CFJA 2ICWJ 2AVGA 3LCYA 3P4LA 3A12A 3UXFA 3QOKA 5I8KH 3RZCB 4NM4H 1NAKH 1EC8A 3LY6A 3RVWC 3T4AC 5J6HA 3NCEB 1G1YA 4NRZB 5AKTA 3MMTA 1A6VL 2CRYA 4AGOA 2ZZ4A 2CLLA 4XNMA 5E9DA 3W2NA 3L4VA 3SZ8A 1TQWA 3ETTA 4R7WA 3NQBA 3SN6N 2H2SC 4I3SH 1HSAB 4C1NA 3QM3A 4Y4HC 4MCZA 4U3SB 5TDOA 2ADFL 3MRPB 3A67L 3OGCB 5H37H 4PGLA 2A6NA 3IMUA 2WXOA 3CG8A 5CP7A 5AW9B 1CFMA 4ABVA 4Q7DA 3UCCA 3CFJB 1UHVA 1WAEA 4C83B 5T33H 5ICYA 2HT4C 2WKOF 3MV9E 3VGAB 2PFHA 3SBWA 3WFZA 1U8JB 5DHYA 1T4KA 1OT4A 2H3BA 4F0SA 4WI0A 1HNGA 3IS1X 1ZGLA 2ALDA 3EOUA 5IBXA 3U1SL 1U2HA 2QHRH 4AIBA 3BLDA 3FTZA 4ADSA 2IKIA 4DUWA 3EXJA 4JTRA 4FMKA 1YVLA 1F2XK 1T5XB 4B9GA 1W3JA 3HPJA 3S88L 1BYBA 3F83A 4K8RD 1JK9A 2NCMA 2G41A 3BKCL 5IK3A 2X3AA 5A6BA 3O3UN 1JPGB 4JFZH 5GSRB 3URAA 1JDCA 4PV9B 2XVNA 1BF6A 1G6RB 4WY0B 4MBOA 3MBXL 3QNYA 4KJQD 4KEVA 5BZZA 4CILA 2ZZ6A 2W8CA 5TQ2L 1V7YA 3GSNL 3HI1A 4TQTA 2BZDA 3GYRA 3GMPB 2KZHA 3RCNA 4YR6A 2PGWA 3GHTA 4PUJA 1IAIH 4ROPA 1DO6A 4Z5RA 1PKOA 3WIHH 3BUPA 2AJUL 2J8UA 3SGDI 4ODHL 3N1PC 5GGQL 4GVIA 2IEPA 1ZCCA 2ITCA 3ZJKA 4OU3A 2GL5A 1P0KA 1VSCA 1NGQL 1WGOA 1I2NA 3AVEA 4G9DB 5I8EA 5FB8A 2MEJB 2QDVA 3DIVA 1J7VR 3ULUF 3QHMA 4HIEA 3MUHL 2V82A 2GVGA 3VOIA 5JVLA 1VGKA 1BHGA 4LCCB 1NWOA 1CGSL 5LXEA 1Q0YL 5PTDA 3OYZA 4HGWA 1NGYB 3N04A 4TIMA 2F7PA 2QFPA 3O3BB 4IOFD 2NXZC 1KCRL 1I1AB 1XSKA 3C75A 4LDCA 3JZEA 3VRIB 3L7FA 5FV1L 1WXJA 1TENA 3GG0A 1GVIA 3B3IA 2LU3A 25C8L 1QO2A 5ACLA 4NQCA 3I9GL 4RIRA 4E0RA 4NLHA 3ICJA 5CPQA 3KPOB 3WY1A 2J6VA 2XX1A 5KSAC 1AZ2A 2NZ1A 3ML8A 4CSPA 1GVFA 2C1PB 4HNOA 3NZRA 4Q9RH 3ZN6A 3H4HA 3X12A 3O0RL 1YEYA 3P5YA 3MYJB 3W4RA 3EWCA 5A2CA 2Y85A 2QL1A 4GXUN 3KPNA 2DPEA 4XAZA 5BU6A 1HTYA 2EXSA 5I66A 3QA3B 3G2GA 2OI9C 4WU5B 3G5WA 2A85A 3WK2A 2W60B 2JE8A 3IDIB 1DSFH 1IEIA 1YDVA 1HKFA 2I7SA 2N4IA 4I9WE 2R2EA 2V5JA 5HJDA 2WBJC 5JHLA 4AEHH 3SBWC 4YC2B 1QI0A 1I9IH 1C7SA 5IG7B 3HEIB 1WNOA 2OXHB 4V1DB 2AKZA 2ZA3A 3UXIA 4FDWA 4D0BA 4GUJA 5HUPA 2GJPA 3UBHA 3E6HB 1OG6A 5FYJE 3NFNA 3C9NB 3S5LA 1PZBA 4YTRA 1UVQA 1D9EA 1MFUA 4XN4A 4DKFL 4HWBA 3MO1A 3QZPA 1OGTA 4P2QB 3LXAA 5J13C 1UD6A 1HG3A 4AJYV 1E6ZA 2R4RL 1JDEA 5D7EA 1H3GA 1H1ZA 3O05A 2YXOA 4NZTL 4ATWA 1N6QH 3G6AB 3MX0A 3OLIA 1NVMA 4NZFA 4Y5XB 2HFTA 4HUCA 3RWHB 2J56A 1HIZA 4ZAKA 1P4BL 4WKFA 3S0CA 4U6XB 3W74A 5CLYA 1D8WA 3FRUA 5F6IC 1TYEB 2I5YL 2IPTL 4MJ2A 3M1OA 5IG7A 1L0XA 2MWCA 2VITB 3A6BL 3CC5B 3LN5A 5DJ2A 3CZLA 5GGUB 3F58L 4H1LB 1MEXL 4LCIH 4W9HC 4UAOC 2WXJA 1ZLSL 4LVOB 2WC3A 2VXUH 3O06A 4ZTXA 1XEUA 4NDMA 3MRBA 3ZTJG 4N4PA 1J93A 1CFVL 1EZSA 3W56A 3MACL 3MCLH 4JO4L 1UTDA 5CHNB 1HILB 1PKQA 2Q7NA 3VXSE 1OF0A 5JORB 4A8IA 2BNQD 1KULA 1ZL1A 1T20B 2R2HB 3HQNA 5DK0A 3QQXA 5KOMC 1D8CA 4HKPA 4AG4L 2QUMA 4BFFA 2E25A 1NOLA 4RMTA 1XPGA 2Z7WA 5T1LA 4BFIB 4JTQA 1UM4L 5D5MB 2Q09A 4DVOA 2E76C 4IRSB 1BRLB 3QTPA 4IICA 1CGVA 4DM2A 3ZQWA 5DRZA 3N85H 5FYKL 1UCWA 4BZ2L 4AD2A 3OGSA 43CAA 3W9ZA 1ROWA 3FVMA 4HUUB 3IWVA 4MMZC 1A4LA 4NYUA 2JELL 3VOGA 1PIFA 5CXPA 5ESVA 3UXAA 1FL3A 2CLZA 3EKCA 4AUUA 2C15A 1X6UA 3PP4H 3PXJA 4PJGB 5C07E 2F9RA 4DVBB 5C0EA 2VO8A 1DUYA 4XVTH 4YDVA 4JHZA 4M8QB 1EQPA 3W2DL 4AWEA 1QQDA 2P8BA 5D2XA 5TE6L 2JFEX 2G5BA 4FZEH 1JHLH 2A74A 3ET9F 1A3XA 2DLEA 1PVHA 3TN0A 1UZDA 4I48B 5H8DA 5BXRA 5T3ZE 2HX8A 1T41A 4FR6A 3MV7D 3IGKA 5D7LE 1M01A 4QNEA 1EHKB 3VG0L 1N67A 1CXLA 5HPMB 4IFKB 5FF6B 5A8MA 2CSPA 2MHAB 4Z2GA 1F13A 3VIPA 2DJSA 4X5LA 4LLVA 1O6SB 4BA8A 3PLYA 4HHGA 4Y1AB 2B15A 4YN3A 2DQUH 4MNGB 1W8EA 5FDWB 5E2VL 2VFEA 2FWLB 3N6QA 3KS0H 2VDIA 3P77A 3ESOA 3UPRA 1VKXB 1KELH 5G5DA 1UIPA 2XH7A 4IT1A 3E7JA 1YECL 4OIAA 2AW2A 5BZWA 3ULSB 2IWFA 4HUNB 2Q7YB 1YMYA 2VDRB 4I0CC 1MH5B 1JULA 1GVSA 3NTCH 5EZJB 5ENWA 4QP0A 1T4KB 4G3YL 3LBCA 1CFTA 4NGHH 4IJ3B 5ABGA 2VR2A 1AI1H 3QSRA 1N10A 3WMCA 2OT0A 4YSUA 4WWKC 4MNGA 4LEXL 1A3LH 1YYLL 4C4KT 2DSUA 3OLGA 1F3DJ 4N0YH 5E09A 1U8IA 1W0VA 1D2OA 4NNXA 3AIEA 3T4WA 3EDJA 3GDMA 4P07A 4DT2A 1JFQH 2Z4TA 4NC0B 5ILTH 5HPMA 3GVGA 3NPUA 4YVXA 3SSZA 2MCAA 1XX1A 3NNTA 4Q8QA 4JG5A 5HHQB 5I5MA 1UWEH 5MP6H 1MUMA