2WVSA

Crystal structure of an alpha-l-fucosidase gh29 trapped covalent intermediate from bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an e288q mutant
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYQRRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-L-FUCOSIDASE
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 158
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvsA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvsA01
1UHVA 1R8LA 1J01A 3K4AA 3DX1A 1E56A 3GH4A 4ML4A 2WVTA 5I0DA 2YDQA 3VIHA 1C8XA 2G3JA 2XVPA 1M04A 2ZXAA 4CKQA 4M8UA 2ZXBA 4QP0A 3T0DA 4FLOA 3MV01 3ARSA 4MJ4A 3VGDA 1PIGA 1H4PA 2G3MA 5BRQA 1IT0A 1G5AA 3AJ7A 5BXSA 5LYRA 2ZWZA 3WF4A 1HN1A 3WH7A 3UR8A 2F18A 4PMRA 3PZNA 5BROA 1E3XA 3BUPA 5ABGA 3CHCA 3PZTA 1DWJM 4MNJA 1UR2A 5IFPA 5I6SA 1T0OA 1OD0A 1W1VA 4KRTA 5EMYA 2D3NA 5LA1A 2RGMA 4HPHA 3AHVA 4AZ5A 2XJ7A 4MADA 2HISA 1DWIM 2J7CA 5LA2A 1QHOA 1B0IA 4OIFA 3SUWA 5C70A 3T2OA 2JEQA 2GUYA 2DT0A 3AMDA 3WNNA 3NDYA 3EMZA 4FLSA 1MWOA 1V0LA 4CN4A 2WHMA 3DX3A 4PEEA 1QW8A 4AD3A 3KL0A 3A3HA 1PZ2A 4IISA 3CZSA 3UG4A 3PZ9A 3W53A 1C92A 4A3YA 1CPUA 4OOUA 4H8VA 3L2LA 3WH9A 3AIRA 2YA0A 2J79A 3SEPA 1JD7A 4AIOA 2XGIA 1KCKA 1EXPA 3A47A 1DWHM 2VQTA 1MW2A 2BHUA 3VNYA 3AQUA 4DM1A 3WMBA 4UOZA 3DHPA 3WMSA 2VVNA 4BCEA 3KL3A 1KWKA 1M03A 1CZ1A 3WDQA 1NQ6A 2Y2WA 5GQBA 3I3EA 4PUDA 1J18A 2PBOA 5HPOA 3EDFA 4OJYA 4JFVA 2WBGA 3B8SA 4GZEA 3WFZA 3ARRA 3EJSA 1PS3A 3OBAA 1HWWA 1HKJA 1J0ZA 3WIJA 3E1F1 1JDAA 5DT7A 3VVGA 1WNOA 3ZSTA 4OGZA 4M1RA 1E9LA 3TTQA 1ISYA 1E6XM 1WDQA 1XC6A 3VD5A 2IXUA 5A8PA 3N18A 3VD3A 4P8UA 2FGZA 4NZCA 1XV8A 2UY5A 1MW3A 2Z1KA 2C7FA 1TR1A 1JGIA 4PMNA 3SUUA 5A6BD 2XWDA 4MDPA 2EPNA 1ODUA 5BWFA 5A3HA 4UZUA 3VMPA 3QHMA 3WL1A 5A2CA 5KZ6A 2ZXDA 3UEQA 3MUY1 2NT0A 9CGTA 1VRXA 3AOFA 2WLZA 2BHZA 1UZ4A 3AS1A 5ABFA 2Y8VA 4YPJA 1KR1A 4OOZA 1XCWA 3U5YA 1UKOA 1OIFA 3SCRA 1J0YA 5I78A 2DSVA 5DFAA 1J0KA 4GO9A 4ACZB 3BH4A 3WQVA 4AD5A 4U5IA 1OD8A 1LL7A 3UG5A 4JCLA 4RL3A 1BFNA 3K8KA 3ARXA 4UQEA 1EO5A 5E6YA 1WDPA 1HXJA 2PWHA 2XYLA 4ATLA 4CD8A 3VIGA 4FNRA 3GTNA 1ITXA 1JD9A 3VGEA 1UD5A 1W91A 4BS0A 5E70A 4D6IA 3WL0A 3W37A 5I24A 2GFTA 1XSJA 2J77A 1DHKA 3SUSA 4RE2A 4MAZA 4P8VA 4LYRA 2ZE0A 1MYRA 3AIWA 3UCQA 3AIVA 2BNJA 1CYGA 3BAIA 4ZFMA 4HOWA 3VX1A 1EHNA 2VURA 1UD3A 3ARUA 5E0FA 1UKPA 3MUZ1 2J8GA 1TVPA 1CENA 1UKTA 1MQPA 1UWQA 2BFGA 1WZKA 3KWXA 3AZRA 1CWYA 1GQLA 1V6WA 3BLBA 1V3MA 3HG2A 1ZBVA 2IXVA 2D3LA 4WF7A 3CHFA 2WNWA 1QNPA 1HTYA 1XGZA 2D20A 4EK7A 3OIHA 1EGZA 3WBEA 1UWSA 4EANA 4TX6A 1H49A 3ZO9A 1O6IA 5E09A 5EFFA 3SCSA 4YN5A 1JAEA 3A4AA 2CEQA 4W5UA 2OWXA 1V3JA 1WPCA 4N0RA 2O9OA 2Y8KA 3DDGA 3WNPA 5HXMA 1A3HA 4CD7A 1JZ5A 3CBWA 3VDHA 1HJQA 1NP2A 1JG9A 1Z32X 1SFSA 3ARTA 5A6MA 4XZBA 3ARVA 1ESWA 5DO8A 3OA5A 5CPQA 2ESCA 4W84A 3IANA 4HZ8A 5JBDA 3PZVA 4JKMA 1LWJA 1GOKA 3PHAA 1HJVA 2QPUA 2W62A 4P8WA 2EXOA 4B15A 3K1DA 4RE3A 6TAAA 2J7FA 5E1QA 4XB3A 5A6SA 4HMEA 2FH8A 2YLLA 1CEOA 4NI3A 1TZ7A 1KFWA 3NSNA 4GXPA 1BF2A 4UQDA 4ZEPA 1R34A 2GJRA 1NM9A 3PZGA 2WZIA 4J3VA 3OGSA 4UFMA 3SCQA 4A4AA 2OSWA 5CPSA 3VD7A 3VIIA 4D6EA 1ZBKA 1Q6CA 6A3HA 2X2YA 2YL9A 3WSUA 1X6LA 3D4ZA 1W9UA 4CD4A 4QLJA 1EH9A 1C3FA 3ALFA 4U3AA 2D24A 1CXHA 2QPSA 1KBBA 1VEMA 4LQ1A 3KE0A 1V6XA 1UR9A 4U2YA 1E3ZA 1KQZA 1S46A 3H53A 2E9MA 5AC5A 1GOMA 1UR4A 1WO2A 1H09A 1RPKA 2EADA 1KBKA 1H0GA 4W93A 2EABA 1E4IA 1V02A 3QHOA 3TTSA 2E8ZA 1R46A 5A95A 4P7QA 3GBEA 4AD0A 2O9TA 4ACYA 4J3UA 4M82A 1EQPA 1E4NA 1MQQA 2VNCA 5D9OA 4JKKA 4JFTA 3WF0A 1LQ0A 1SR0A 1GNXA 3CHDA 2DT1A 1UWRA 2MANA 2OYKA 3WNLA 1EOKA 2EPOA 3A22A 4DO5A 2WMIA 4HMDA 4JZ5A 1CGVA 1LJYA 1KXVA 2D1ZA 1JZ6A 1E6RA 2CBVA 1VENA 3EJPA 4IM4A 3QR3A 4YHGA 5HBFA 2J74A 4W86A 3FXYA 3VTRA 1W1YA 4NRSA 2BS9A 5A6LA 1E5NA 1GJWA 4UQ9A 1IZKA 1EOMA 2XVNA 5D4YA 4MPKA 3N15A 1LF1A 2VRKA 4BA0A 4UNIA 2EAEA 4H8HA 1WAWA 2XN2A 1BHGA 4Y7EA 3QOMA 1H3GA 2OW6A 4FNUA 3WUBA 3CMGA 5TD4A 1PAMA 4J28A 1WE5A 5M17A 2AAAA 4U31A 4XX6A 2PBGA 2WAGA 4OBSA 2W92A 4UQCA 2A3HA 4B3KA 3WY3A 4FF5A 1KXHA 1CLVA 1R86A 4J3WA 2CESA 3NDZA 4W8AA 1HJWA 1UH2A 2X8RA 3BLKA 3WFLA 3BCDA 3I3DA 1HP4A 3WBAA 3ZJ6A 5GPRA 4OKDA 1J10A 2CETA 3EDJA 1ISWA 4CU6A 4UFKA 5M5DA 1V0NA 4PCTA 3AMKA 3N9KA 2WCGA 1E4LA 4UTFA 3KL5A 5A6KA 1EQCA 3H54A 2G8ZA 3PTQA 2GVYA 2DPEA 5IXEA 4JFWA 5BCAA 3BC9A 2HVMA 4J7RA 4WIWA 2CBIA 2XWEA 1B3VA 4V2XA 2WHKA 1YHTA 4NZJA 4M24A 1NWUA 1J0JA 4AYGA 2ZUWA 4MAVA 5I77A 2J7GA 5M03A 2FHFA 3DC0A 2Z1SA 5AYIA 1CTNA 3PZUA 5EB8A 2J7BA 3AHXA 2DSUA 4NZFA 2CKRA 1BLIA 1FHLA 2V3EA 3B9AA 4FMVA 1B30A 3N17A 2YLAA 3VDBA 4QAWA 2BY3A 3AI0A 4MTVA 1QW9A 4AMXA 3GH7A 1ISVA 4OUEA 3ARQA 1JYXA 4WSKA 1VBRA 3O6AA 2VX7A 1HL9A 1W3JA 3NUKA 4P8XA 8CGTA 2BHYA 4MNLA 3T0BA 3L4WA 4HOZA 3RILA 1EDTA 2VVSA 3AZTA 1X6NA 2OW7A 4CN1A 3SCNA 1JXJA 2WZHA 2ZUTA 2WSKA 1FH7A 4B9YA 1VB9A 2WC7A 3FNDA 3VINA 3RMEA 2OSYA 3N12A 5GNYA 3H55A 2YFOA 3VIOA 2JFEX 1CECA 3SCUA 3VSTA 4B16A 2WPGA 5A6AA 2YBUA 2VO5A 3CZJA 2XTKA 5E0CA 2VRJA 4P7NA 3HJEA 4WK9A 3IJ8A 4AZCB 3WD4A 4DWSC 5E9AA 3HZ3A 2WVVB 1PBGA 2VZOA 2CITA 4PMVA 3K46A 1TVNA 1H11A 3CC1A 4E8DA 2AOSA 4OZOA 1FP9A 1GQJA 1NP0A 2D73A 1XH2A 4XUYA 1JYVA 1HKKA 4W7WA 2EPMX 4GINA 4CVUA 3HG4A 2UY3A 4XZWA 1DWGM 2DIEA 2IUZA 4LPCA 3T08A 2PWGA 2XVKA 2ALWA 2WWCA 1PIFA 2F61A 2NT1A 5M3WA 2EBNA 1W9VA 1J0IA 1W2VA 4AISA 2WW5A 1VJZA 2DSWA 3IK2A 3OGRA 5HDRA 1VFUA 2EEXA 1KGUA 4PSPA 2VJXA 3O9NA 1BGGA 3UR7A 3ZJ7A 2PC8A 4PTVA 2D0HA 1GVYA 4NRRA 3WF3A 1B90A 3L4UA 2FH6A 3HU7A 4KMQA 2GK1A 3WUGA 1MXDA 4DUXA 3CPUA 4M80A 2WXDM 3VSUA 1Q4NX 5GNXA 1TG7A 3AFBA 3FHAA 1UQYA 5CSYA 3CTTA 3SCTA 1E40A 1Q6FA 4LYPA 1C93A 1GPFA 3RM9A 3O2LA 3NSMA 4QCEA 3BAJA 4DO4A 2XGBA 2BVTA 4UFJA 2DH3A 1AQHA 3TTOA 2TAAA 4HZ6A 4D1JA 1E1FA 2GJXB 3GXMA 1J11A 2WLYA 3THDA 3GNRA 1R7AA 3VU2A 2D22A 4FNSA 2CBUA 3MMDA 1CXIA 1V0MA 1TQTA 3VO0A 3LXAA 1E6NA 3A21A 1W3KA 4CU7A 1TA3B 2YA2A 3BVTA 3VGBA 3EJUA 1JI2A 3WD1A 3IGUA 3L4ZA 1JAKA 3VGGA 3U5UA 2JE8A 1E70M 1E5JA 1FHDA 4WSJA 1ZL1A 1W9DM 5FCZA 1B3ZA 3ZT6A 3AXXA 4WKAA 1SYTA 5A2BA 1JXKA 2VUYA 1KXTA 4Z2IA 4JL1A 1IV8A 3SCWA 3GXDA 5ABHA 3K8MA 1KCLA 3RM4A 3LMYA 3UG3A 2UY2A 1CXKA 3EDKA 2W66A 3WENA 2VR5A 2YJQA 3TV8A 1O7DC 5DEZA 5DF0A 4FNPA 3TONA 2WCAA 1ZBCA 3HN3A 4DUWA 2NW0A 2X1IA 2DT3A 4N42A 3RJYA 1BTCA 2V3DA 1B2YA 3K8LA 1ZJBA 2WZEA 5JUVA 4HU8A 1U33A 3T0AA 4W8LA 2XFRA 4NF7A 3VD9A 2D2OA 5AYBA 4AZIA 2D23A 2X05A 2OLHA 3LPPA 3POHA 1M01A 4W7VA 4ZE4A 4PMUA 4GKLA 1TE1A 3VDAA 3DX2A 2ZIDA 3GH5A 3FY1A 2FHCA 2YL5A 4D71A 3OLIA 4HA4A 4WJXA 4PSRA 2W61A 2WMJA 3KEHA 1R85A 3VIJA 1RD6A 3W81A 1GOOA 1NWSA 1V3IA 1ZBWA 4P7LA 5CXPA 3AYSA 4MB3A 1UD6A 2VMFA 2FGLA 3IJ9A 3VGFA 5CZKA 4TX8A 2NSXA 4IPLA 3SCVA 5BXTA 1PX4A 1K9TA 1UR1A 4XV0A 1QI5A 4U33A 4JIEA 1C90A 2EO7A 2PF0A 5A6JA 3D4YA 1QI0A 4D1IA 2VRQA 4JCMA 3A5VA 1UH3A 4HPGA 2QLYA 3WDJA 2ZX8A 3AIQA 1UWTA 1VJSA 2OSXA 4KH2A 1TCMA 1XD1A 2YL8A 1C8YA 3BSHA 3DX0A 1OT2A 1V0KA 1VAHA 1XSIA 5A6BA 4D6DA 3UERA 4AD1A 3MMUA 1JF6A 2XPKA 4QDMA 1JF5A 1CGTA 4GIAA 1ZJAA 4TVUA 4PTXA 2J4GA 4UQAA 1WCGA 1MFVA 3WQWA 4HMCA 2W5FA 4KRUA 3WNOA 2PWDA 4BF7A 3MSDA 4UOQA 2J7EA 3PZIA 1R75A 3W6LA 3CH9A 2A3EA 4H7VA 3QHNA 4Z2LA 3F5LA 2VOTA 2XN1A 4V28A 1AMYA 3VOCA 3ZT7A 3CZEA 1BYAA 3RDKA 5IHSA 4TOQA 3LPGA 3A24A 3TA9A 4PMQA 1B9ZA 4WKHA 4PMYA 1HL8A 3WDPP 3LPFA 3WDHA 4M56A 3BUBA 1KQYA 5CLTA 4R27A 2F7PA 3BAWA 2DT2A 2XFYA 3MS8A 1K9EA 4D6GA 2F7RA 2BY1A 3L4VA 1W9BM 4CCDA 4AMWA 3PTKA 2CNCA 1UZ1A 1HJUA 3MU7A 1HF6A 2WYSA 4MJ2A 3T2QA 3SCOA 1ZB5A 5LA0A 2ZUMA 3VMNA 1U30A 2VQUA 1F4HA 1QNSA 2J7HA 1U2YA 1HXKA 4AIUA 4H8UA 1P6WA 2CCRA 2WVUA 1HVQA 2Y5EA 1WZMA 1ZS2A 3WH8A 3DYOA 4FLRA 1V6VA 3WN6A 6CGTA 3M7SA 3GXTA 1TQVA 1OGSA 1SZNA 3FN9A 3VX0A 4LYQA 4UFIA 2CHNA 1NARA 1NWRA 2WMHA 3VKKA 3M6DA 4DWSD 5F7UA 1G94A 4AD4A 1TQWA 5A94A 1VEPA 2WHLA 1GOWA 1E6ZA 1PX8A 3RIKA 4C7FA 3AIBA 2XVGA 3NSXA 1J12A 4AZCA 3MUIA 2QMJA 1PPIA 4GQRA 3VNZA 1W9PA 2WK2A 2VX5A 2WVVA 3WKZA 4NXKA 1I1XA 1GQKA 3PZMA 4HA3A 4EKJA 1UA3A 2J47A 1EDQA 1BYBA 1L0PA 1G9HA 3LRMA 2VCCA 5A8QA 3A4XA 2O9RA 4AZHA 4B9ZA 4KGLA 4B3LA 3WD3A 1MQRA 3CHEA 3M46A 1ODZA 3DYPA 1BVZA 4AC1X 2BXZA 3VD4A 1KXQA 2WC4A 3S5YA 1Y7VA 1X1NA 3AMCA 1DWAM 5FD0A 1US3A 1HX0A 1JFXA 3CUHA 1MW1A 1BG9A 1L8NA 3D52A 3BVVA 3RM8A 3FHQA 3WY1A 3BSGA 3MKKA 2VZVA 1HJSA 1G01A 1JI1A 4ZENA 3BUDA 1NOWA 3RCNA 5I23A 4HP5A 1D2KA 2F8QA 1GZJA 1TMQA 4C7GA 3W24A 1B3YA 5HPCA 2ZUSA 1WDSA 3CLWA 3VILA 1OWQA 2F2HA 1E6QM 1E43A 4H04A 1MXGA 4AMCA 3EJTA 2VX4A 4AY1A 1JNEA 4WKFA 2E0PA 3BVXA 2IGTA 3NCOA 3T2PA 1TFVA 1UWUA 4F9DA 4D6FA 2V5DA 3OGVA 4S3JA 2GJXA 3N04A 3RJXA 1JFHA 1E6SM 4X0VA 3APGA 2FHBA 1UD2A 2YIHA 3MMWA 4QFUA 3BUQA 1UD8A 1XCXA 2W91A 3CZLA 3CUGA 2CPUA 3HG5A 3WEOA 4A3HA 4F66A 4R5EA 5KEZA 3W38A 4AW7A 3BAXA 3AISA 4TVCA 2WCSA 2A3AA 1VF8A 2FDMA 1SMAA 3PBGA 4BQ5A 4PMZA 5D9PA 3GYCA 3L4TA 1SMDA 1H0IA 3ZJKA 4Q7NA 3ZM8A 2WMGA 1LL6A 3AROA 3MANA 2E8YA 3ZOAA 2A3CA 1K9FA 3AHYA 3MI6A 4JL2A 2RGLA 3ZR6A 2GDUA 3W26A 1US2A 2XFFA 4GO8A 1CGWA 2XIBA 3BUIA 3AICA 5HNNA 3WF1A 3VSVA 3D51A 1AQ0A 3UETA 2JIEA 3WH6A 5I2UA 2BY0A 3WH5A 1DTUA 4JFSA 2J78A 4AD2A 1VFMA 4H2CA 1NH6A 2X0HA 1V3KA 4GI8A 3AMGA 2E3ZA 3B9EA 2ZXQA 1OBAA 1E0XA 4JAWA 1FP8A 3AIEA 3VPLA 1QOXA 3VUPA 1E0WA 1M7XA 4CD6A 3BLPX 5CGTA 1QWNA 3N1AA 3M07A 5E6ZA 3BGAA 1BYDA 1CXLA 4P7RA 4BQ3A 1TUXA 2WHJA 3JUGA 1E55A 1KTCA 5C8BB 4RE4A 3BVWA 2VZSA 4ACZA 1HJXA 3U57A 4AEFA 3GNOA 3L4YA 1ITCA 2F7OA 2CIPA 2QHAA 5FKYA 3AS0A 2QV4A 4BQ4A 3LXCA 4AXNA 3BMWA 1XYZA 1W1TA 1BYCA 2ZX9A 3SIMA 2XN0A 5FL1A 5EBAA 2OWWA 3W4RA 1QHZA 1H1NA 1D7FA 5BXPA 1XYFA 1E73M 1V3HA 4FNTA 1CGYA 2YFNA 1J0HA 2QF8A 2VC9A 2JF7A 3TOPA 3BVUA 4PTMA 1V02E 4J27A 1IZJA 3CMJA 4E4PA 1LG2A 1JL8A 1RP8A 1HKMA 3OZOA 2VX6A 1FOBA 1QNRA 3ZIZA 3GXPA 2XUCA 5C71A 5FIPA 1UH4A 3U7BA 2DGAA 2JF6A 3DECA 3D3AA 3GBDA 4D72A 2JIWA 2GJPA 2CHOA 1E1EA 2WMIB 1CNVA 1JYNA 1UA7A 3CIVA 1R7OA 1WB0A 2BVDA 3UESA 3EYPA 4JHOA 4ZXOA 3ARZA 4BZYA 4X0NA 3OZPA 4DWSB 3SCPA 2YBTA 1WZAA 1KGWA 2AMGA 1V08A 1AVAA 3CGTA 4F79A 2EJ1A 1DWFM 2GSJA 4J3XA 1QWUA 1UD4A 4Z2GA 2XM2A 1GOIA 1ISZA 2WVSA 2WMKA 1QBBA 1AQMA 3WNKA 2EACA 3NYDA 1GHSA 3PZOA 1DEDA 2ZWYA 1MVYA 3OLDA 5AY7A 2WSPA 4AIEA 2G41A 1H5VA 3G6LA 3AHTA 5ECUA 1Q6EA 2VCAA 2XSBA 4X9YA 1C91A 2FYVA 5A8MA 4Z2KA 1JDDA 2F1BA 3VIMA 2WB5A 1UKQA 1LLOA 4GPNA 3AHZA 3W27A 2DEPA 4UOJA 1JDCA 5A2AA 3EJRA 1Q6GA 1QNQA 1UYQA 1JZ2A 1W9XA 2WM0A 1OM0A 2XHYA 2PWEA 4UFHA 4DUVA 4W87A 3J7HA 2J25A 2EQDA 1CDGA 3VMOA 4AZ7A 2VR4A 5DMYA 2ZOXA 4K68A 2WKGA 3OB8A 1UUQA 1JNDA 2WWDA 3LPOA 5DT5A 1W3LA 3F4VA 2DIJA 1YQ2A 3ARPA 2J7DA 4CVWA 4LGXA 5AC4A 3K4DA 1C7TA 1QVBA 1CGXA 1QPKA 1W3HA 1PEZA 1E71M 1R33A 3D5HA 2C0HA 2DSZA 2X2JA 2J8FA 3CZGA 4EAMA 2BY2A 5EFDA 3L4XA 1WP6A 1QBAA 1JZ8A 4D6JA 3MV11 4KWUA 5CSUA 4WLCA 1QX1A 2A3BA 1OIMA 4QCFA 1VBUA 4ATWA 3F5KA 4CCEA 3WDRA 3KLLA 3F5JA 1V3LA 1UWIA 3GNPA 1E72M 3RPMA 2F7QA 4ATDA 1EDGA 5D8WA 4UCFA 1BGAA 1EO7A 3OLEA 4HOXA 3WD0A 3FW6A 1MFUA 2JALA 3EDDA 5FL0A 1JZ7A 2CYGA 2JEPA 3AXIA 2PWFA 1CXFA 3W29A 4PMXA 3W28A 4PRWA 4M81A 4AZBA 1FH8A 4CGTA 2BXYA 1RP9A 1VFFA 3WQ4A 3WUFA 7CGTA 4TVDA 1XHGA 2OYMA 1W2PA 5A8NA 3NJ3A 1OINA 2V38A 3IAPA 1GOQA 1UQZA 1XSKA 4PMOA 3SUVA 3MUAA 3W82A 1GHRA 1UASA 4F9JA 1W32A 4U5KA 3BCFA 5CJ5A 2DSKA 2WANA 1B3XA 3N13A 2G3NA 3EJQA 1G0CA 1I1WA 3S5ZA 1V6YA 5CGMA 2DQXA 2VI0A 4GZJA 3FAXA 5JIWA 3ZMRA 1EHAA 4CU8A 1GORA 1OGGA 3WY2A 3W0KA 4C7DA 3TP4A 1TQUA 1HIZA 2WKLA 2CXGA 2QMKA 2YOCA 4MB1A 1ECEA 3W6MA 1HNYA 4EE9A 5JBFA 2V5CA 2VT0A 1EIBA 5JBEA 3ALGA 3ZR5A 3ZSSA 2YKKA 1GUVA 4JKLA 4UQBA 2BV9A 2OWCA 3VGHA 1OSEA 1JZ3A 2E9LA 1OCQA 1HP5A 3WQ8A 3N11A 3WELA 1O7AA 3T09A 2ZX7A 5IDIA 5IHRA 2E9BA 1CGUA 2ZX5A 1KTBA 2VL4A 4AEEA 2O9PA 2GK1B 3WD2A 1OT1A 2V3FA 4D6HA 2E4TA 1XH1A 1CXEA 3D50A 3WUEA 1MW0A 2WBKA 3IAQA 4URIA 3VIPA 1I75A 3VIFA 3AIUA 1FFRA 2WC3A 1R47A 2WMFA 1KGXA 4GI6A 1B1YA 4NXSA 4AWEA 3B9DA 3CUJA 3S2CA 2W63A 4W85A 1VIWA 3WMCA 2Q8XA 4JFUA 2F1AA 1UKSA 2D0GA 1E15A 1N82A 1K6AA 1KWGA 3CUFA 4UFLA 1GVIA 4JHZA 1UR8A 2ZX6A 1HT6A 1XH0A 3KLKA 3WQ6A 1FA2A 3AZSA 1EA9C 1V6UA 4AZGA 4YHEA 2GDVA 2G4FA 5I79A 1Q6DA 4F8XA 4NX0A 4HTYA 4P7OA 1DP0A 3QOKA 1PZ3A 5HOSA 1BSIA 1RH9A 4MB5A 3CZ8A 4MNKA 3BXWA 4IPNB 2YDRA 3BAYA 1BG4A 7A3HA 4TUFA 3BMVA 2VTFA 2VZUA 3CV5A 3VM5A 3NIYA 1PX3A 2J62A 3HG3A 4FLQA 1QNOA 1HVXA 3AXHA 1BQCA 2O92A 3W25A 4LXFA 2X09A 4W5ZA 4PYSA 3ZJ8A 2YDSA 2UY4A 5ABEA 1UG6A 3OLGA 3LXBA 3OG2A 2ZUUA 4CD5A 3HMCA 3WF2A 3FAWA 4D6CA 2C8NA 3U7VA 5A1AA 2CERA 1C7SA 3GDBA 1GCYA 2ZUVA 1OB0A 1LL4A 1OGBA 4J3SA 3DDFA 3MSGA 4BQ2A 3BAKA 4LX4A 1PJ9A 1W1PA 2E40A 5ABFB 3GZAA 3THCA 4W88A 4Z2HA 4PTWA 5CG0A 2OYLA 1NOFA 1B3WA 1ZU8A 1G1YA 1ISXA 1NOUA 5BYWA 3AS3A 1CIUA 4UZSA 1UR0A 2UWFA 3SURA 5JIPA 4GZIA 4DWSA 1BAGA 5BRPA 4CN6A 3I3BA 4TTGA 1QI2A 1B31A 1FFQA 3KZSA 4PBGA 1UOKA 1TQSA 4CUCA 1BVNP 3WNMA 5D9MA 4DO6A 4PMDA 2YL6A 2X2IA 3DX4A 2VZTA 3WQ5A 2DH2A 4W7UA 4KGJA 3LX9A 3DYMA 5CQ1A 3WEMA 2Y24A 5CLWA 5FOOA 1NWTA 3CUIA 2XIIA 1CLXA 3DHUA 4MNMA 2PI6A 4Z2JA 1E4MM 1BPLB 3EMCA 4OBRA 3CZNA 4PCSA 4AYSA 4Q22A 3S6TA 1GJUA 1J9YA 2Y4SA 4TXEA 1K9DA 5D8ZA 5A69A 5I5RA 3A23A 5IFTA 3GXFA 4FK9A 4UR9A 1CBGA 1XRVA 7TAAA 3EMQA 3PN8A 1H2JA 2W4XA 4GQQA 1TA3A 4MB4A 4ZXLA 2DDXA 3VIKA 8A3HA 4M29A 3RO8A 2CKSA 3SUTA 3LRKA 3GXNA 4IUGA 3VDCA 3WDIA 1HKIA 2ZICA 4AZ6A 4L4OA 3ARYA 2V3GA 3L2MA 4TTUA 1A47A 3LRLA 2X0YA 5A8OA 2J75A 2XVLA 4QLKA 4S3KA 4GI9A 3IJ7A 1E6PA 4NSBA 1JYWA 3GXIA 1F4AA 4FNQA 1QI4A 1M53A 1WZLA 5BXRA 2XSAA 2EPLX 3ZT5A 2YA1A 4W8BA 4CCCA 4V27A 1JZ4A 3CO4A 3G6MA 5I3DA 1QHPA 3II1A 1GONA 1KR0A 2VCBA 2PB1A 3TTYA 4PUEA 3AYRA 1WKYA 1LWHA 2CBJA 3ZQ9A 2B31A 4DM2A 3PTMA 3A6OA 3QGVA 5D9NA 4PN2A 4J3TA 2X2HA 3WY4A 3VM7A 2XM1A 1C8QA 1GW1A 4MDOA 1VFOA 2FE0A 1R87A 4U2ZA 1FH9A 4ZE5A 4E2OA 3ECQA 4E8CA 3POCA 5CPTA 4U3CA 1H41A 1QI3A 1LG1A 1JIBA 1GQIA 1WDRA 2EPKX 4HA1A 1VEOA 2XG9A 4HU0A 2D0FA 2W67A 3A4WA 2G3IA 1D3CA 3MO4A 1V03A 3EDEA 3EBVA 3ARWA 4H41A 4HZ7A 3PZQA 1KB3A 3GM8A 2ZUNA 4QLLA 4W89A 5GNZA 1E0VA 3AS2A 3CZKA 3AMLA 4L4PA 2BVYA 3WEZA 1XD0A
chains in the Genus database with same CATH superfamily
4PRPD 1X8FA 4X7FC 4Q7BA 2NZIA 3KH3A 4L4TA 4LUSB 2FB3A 5HMEA 4BBWA 2VW6A 1SJVA 3QEHA 3PFUA 1M04A 4CKQA 5C0BA 3WLLA 1F6LL 2OZ4A 3VNDA 1TSHA 3O3AA 1H4PA 2IPUG 1P4LA 1XJBA 1K4HA 3BL3A 4KJPC 2AK1H 5T1LB 4ODSH 5CLXA 2IBZX 3ISWA 2ZRYA 1ZTVA 1B0IA 4QHRA 1KFCA 4Y2DB 4AIZA 3NDYA 1IXPA 1DUZB 3TROA 3ELAT 1Q9KA 1FPTL 1GZHA 2BNRD 3PAUA 4YTQA 1KFAH 1MJJB 1NAKH 3FEMA 4HIXH 2XGIA 1BJ8A 3A47A 1G7IB 1MOEA 4MJ5A 2Y2WA 1JCMP 2HJLB 3N6JA 4M9PA 1XLLA 4GG6B 3VOJA 4JTQA 2Y7MA 5JO5A 3NPZB 1FNSH 4DGYH 4D8PB 2WNNA 2QTEA 3QBUA 1P43A 1GHFL 2NUWA 2OQYA 3KAOA 3TYGL 2XWDA 3X14B 1TCRA 2ZXDA 3CBRA 3PNRB 5F6IC 1UKOA 3RVVD 5G4OA 1EAPB 4RESB 2OOGA 4ACZB 1WIOA 2X70A 4ECLA 4TNFA 2CH8A 3IJSA 1MCHA 2VITB 3MCG1 4IDJL 4FHBD 3B7TA 5IR1A 2OKTA 2CO6A 3PFRA 3SGKA 5KSVA 4Y9OA 3UCQA 2ESVB 2VL5A 2HFGH 1UKPA 2J8GA 4JEJA 3JV6A 1IIGA 4HYVA 3X11B 5F1NB 3O81A 3HPFA 5RUBA 3O05A 1SEBB 4YN5A 3LEPA 4NLAA 4HIJA 4W5UA 3CDYA 3QPZA 4CQ8A 3BVNA 4DSYA 2ZA2A 4PVMA 4GNJA 2GGJA 4JHVA 3QIBB 4F2MA 3SB0A 1KB9J 5DFTA 2O30A 3PUDA 3L7RA 3DVNA 1P1VA 2WJDA 4O14A 3HHSB 4PJXE 1G6RB 4KIRA 4JVUA 3FT1A 4OCRL 4K94C 3LKQB 2J7FA 1S5TA 4JCWA 4DETA 3NSNA 4GXPA 3MWAA 3SCQA 5CPSA 3H22A 4K8GA 3QI9D 1N6UA 2YL9A 2EJAA 1QO3B 5BPPA 4R97C 2NUPB 3LKOA 1SUJA 2YBGA 2QPSA 4MY8A 1G7HA 4BFEA 1MHEB 5FF6A 1YMHA 1GOMA 3QRBA 4Q52A 2NY6D 4MCNA 5B4MD 1OFPA 4MS8C 1N12A 1EQPA 3HC0B 3KDPB 4PTNA 4JKKA 3VCLA 4LLQA 1SR0A 1GOHA 3R1ZA 1XGDA 4XPGL 3Q8EA 2BCMA 1CGVA 4N2NA 3GW0A 3MYJA 4G5ZH 2J74A 1W0VB 1NC4B 3U1QA 5XINA 1GJWA 4KU1A 2QVKA 4B9CA 4NP4L 4IW4C 4HG4K 1H3GA 2AXFB 4PGDA 2HFTA 4KBPA 3O45A 4X6DE 3SIZA 4MAYC 4ZQPA 3M9YA 5B8CC 4H5SB 5EUOE 3NDOA 1KUMA 1S5WA 3RGVA 4YGAB 3S1VA 1IE5A 2XSXA 2AJZA 4TO8A 4US5A 3GHBH 1XIWC 2AJSH 3V1HA 1INEH 2PTZA 1E8YA 1RCXB 4LNCA 2WCGA 2P8MA 4G8GA 4K39A 5KTEH 4X5WB 3R5EA 2R9RA 3DV6B 1ZP4A 5C7ZA 3EXJA 4BWLC 4YH6A 4A67A 3CFIC 4J8RA 2PRHA 3QJQB 2BXVA 4K5LA 3Q1SH 1PZDA 2PXYA 3U0HA 2QQKH 2FECI 4IJ3B 5EZJA 1P9MC 2IH9A 1WAUA 3AFLA 3GC5A 1X7QA 3EHBB 3HVNA 3W73A 1D9KA 3QQ0A 2KLTA 1WV7T 3DSNB 2PGEA 4MNLA 4N28A 1K6WA 1B57A 1ZDQA 2Y6SC 1UB5B 2P46B 4JXCA 3SN6N 1VB9A 5DEGA 5CR1A 5FGSA 4HJGB 2IJ0C 1EDYA 4KITB 1IGYB 1YPXA 3C60A 1TWZA 4A3UA 4PRDA 3C5XA 4FOUA 1A5MC 4O8RA 4Y9EA 2C4XA 3KLAA 3GMNB 4KUZL 3HG4A 4HCHA 1XBDA 2QGDA 4EACA 2PWGA 2GUOA 3WL9B 2F74A 1MFEH 3GEFA 3W56A 4JZJB 1WAPA 2B1OA 2WIIB 3KHOA 1Q0EA 3LVTA 1KV5A 4ANWA 4ODUA 3TQ0A 4HIXL 5DK0A 2VEFA 4O28A 4UWMA 3IVUA 4G7YL 1N67A 2HKAA 1WYIA 1ZVHA 4K9EL 3DETD 2PDKA 3UFIA 4ERGA 4TSCL 1SY6H 1HO4A 1NLDL 3U2IA 5IJKC 3C6CA 1J11A 3THDA 3FN0H 1FNSL 1I7RA 2Q2LA 1F6PA 1J87A 5CCGE 2AGTA 2ZCLL 4PV8B 1P7KA 2J43A 1TEFA 3VGGA 4RMSA 4HEMA 4C59B 3N44B 2F5AH 3RWDB 2JE8A 1YEIH 4OF0A 1CB2A 4GAGH 4KCWA 4ZMTA 2NY2C 3STFA 3RL1A 2UXGA 4ONOA 4HWZB 2MQCA 5E8NA 3D4CA 1ZRQA 2IXQA 3QHFH 5I71C 1E28B 4ONFL 2NTFB 1LXMA 2B7DT 1CDCA 3Q0HA 4BH8B 4PJAA 2XI9A 1B2YA 1M7IB 4H3DA 1CYXA 3RRQA 2Z1XA 1IC7H 2PPGA 3WN5A 5FGCE 1S9XB 2OR8A 4LDLB 3COOA 1ZK9A 1BAWA 4BY3A 1FFOB 3N9GL 4L05A 5D1QD 5JW3H 1ZAGA 2E28A 4XPHH 3VXQB 3S8GB 4FFYA 4N5ED 1YEDA 3MC0A 2HMCA 2VMFA 2FZDA 43CAA 4ZNEA 1AFSA 2R4SL 3FO0L 5IHHA 2WMPB 4EUPH 4IP5A 3KPMB 2O1AA 1J5TA 4B5UA 2FZ9A 1RCYA 1VJSA 1KYUA 4L4TB 1Q7ZA 1B6DA 4JG1H 3I9GL 1DBKL 1XD1A 1G4SA 4GVIA 4QE1A 5GGTL 3MMUA 2XPKA 5AC6A 4OBTA 1VH7A 1CGTA 2Z35A 3LNGA 3DBPA 1RBAA 1IQ8A 1WTLA 4KS0A 3WQWA 4JK0D 2D4DA 2GQ3A 3VTTA 3HC4H 3UJ2A 1YUKB 2XWBA 1MCCA 1TTIA 3QJZA 1KYOJ 3CASA 3LPGA 4BM7A 1K72A 3Q7JA 3K80A 4GKSB 3SDCD 3V7PA 4CW1A 1KQYA 1QSVA 2GJNA 4IU3B 4YEEA 5D7JC 2BY1A 5CLZA 1DQMH 4K3DL 2R59A 4YBLB 1ROCA 4MJ2A 1EUAA 5ABTA 1REQA 3M88A 3WQGA 4MNQA 4APQA 3MX0B 4JRYE 2J88H 5CMAB 4IHOA 1F4XL 4V1YA 4JQ1A 2VLJD 2EYRB 3TN0A 1IWPA 4EMZA 1JGEB 4MJ5B 3ZE2B 1MFDH 3V16A 6CGTA 3I74A 2JJSC 2IQAB 4AD4A 4Q8QA 5K4ZA 4XN8A 5C0FA 2UY6B 5JO5B 2HUHA 3VI3E 4N9EA 3BKMH 3D09A 3T4AC 1T2QL 3LQLA 5GGRA 5AB9A 1X38A 2PP7A 2MHAB 2VX5A 3L5JA 5E00B 6REQA 3T8LA 2AERT 1BYBA 2HKFH 3CU7A 2QKIA 3O0RH 1EVTC 3SGEI 2DY3A 4CNOA 1RJCA 4G7VH 1YPZE 4PUNA 3P4NB 1IXOA 1IU1A 2VLLB 4FL4B 2F68X 1PZ5A 2R1NA 4BI6A 3ZVIA 1HX0A 3OVQA 4DYKA 1G9NC 1UYWH 4Y4KB 2X70B 3GHBL 1HQTA 1ZT4A 2WZPD 3FHQA 4PJFA 5HTSA 1WOAA 2K4AA 4LBAA 4IX0A 4REQB 1DBJL 3ZX1A 1GZJA 1PYMA 5HPCA 5C6WH 4O2FA 5JPMB 3V6OC 4DPRA 3L1GA 4H04A 3ZE0F 5IR1B 4ZA0A 1MXGA 1O6SA 5KSVB 1FHNA 2VABA 3MROA 4B5XA 4I87A 4S3JA 1MAML 3ULUH 3ARFC 3B04A 1JFHA 5I3KA 4UOW0 3JV6B 1WWWX 2Q3RA 3GSWA 1Z3GL 4A3HA 1NFKA 3QSRA 3BAXA 2A3AA 1DE6A 4YIQA 3GRGA 1Z89A 2FVLA 2AK4A 5IBLD 1NCUA 3BGFC 1OB1B 3KWTA 4ELMF 2P5EB 3G1AA 1MCWW 3S36X 5HNNA 1T7XA 2K4WA 3LSOA 4JFSA 3K2UH 2INZA 4ODXB 5I0YA 4N8UA 3Q6FA 5HPMB 2IDCA 1VGKA 2OX5A 1QOXA 1ID2A 4JDVA 5DJZA 4IPIA 4DKFL 1HEHC 1OK4A 1TQXA 1C5CH 1ZHBB 1RUKL 1X4ZA 3I2CL 2UWEF 2O5ZL 2FWOA 3FX4A 1DQVA 4XAKD 3O6LL 1DN0B 2IQ9H 1E73M 1V3HA 4HK6A 3NPUA 1J0HA 2QF8A 3PJLA 4YTRA 4GEIA 2JVUA 4HZAA 5BMFL 2AZUA 2P1YA 5TJWK 3VFRA 1RUAL 2CJUL 3ZIZA 4J4PD 4DWHA 3VWKC 3S3DB 1GW6A 3IGKA 4WD0A 2J71A 4FQHB 3PQYB 5GGVL 3W02A 4LMQI 3GJEA 3EXRA 3TA3A 4FULA 3KTCA 4TUOA 1T83C 2CALA 2OMUB 6PAZA 4IQEA 2VXQA 1DVFC 5EB9A 2YD2A 1XLIA 5BRZA 2GSJA 1QWUA 1GYCA 3R8RA 2F5AL 2WVSA 1YEIL 1E4WH 3NYDA 1I1YA 1LK3L 1NC2B 4GAGL 5AY7A 4AIEA 2XFXA 3O45B 4YSSA 2NXZD 3QHFL 2VAAA 5K2ZA 1ZV5A 2FYVA 1AXTH 5D7IF 1AH4A 2XTLA 4WV1B 1IILE 2PMZA 4GSDL 4Y89A 4NO2B 3QR1A 5EF2A 4NZTL 4B95C 3KPLA 1TT6A 4WNSA 1CDGA 4UT7H 4JFQA 1QASA 2ZOXA 1MCLA 4TMBA 3NOIA 4NUPA 2ZJSH 1HCVA 2YD6A 1W3LA 3QT2A 3ARPA 3KD4A 5SV3A 4KVCH 2ADGB 3L81A 4XPHL 4HCRL 4BWWA 1W3HA 3KAAA 4EAMA 2NY3B 5IB5A 3VYNA 1QBAA 4AYDC 2DICA 1RHFA 1VIZA 1CB4A 4RQQA 3SGDH 5EZJB 5DZLA 5KWYC 5FA4A 2XH4A 3TBTA 2NYKA 5LGYA 3N2JA 2YAFA 1EDGA 1XLMA 2A9BA 4FQIH 1CD0A 4HOXA 1MFUA 4LFHG 1JZ7A 1O7DE 4LAUA 4CGTA 2AMXA 1U58A 1I3GH 1A0CA 5DFWH 2FWUA 5KG9A 1M7DA 5BU9A 2WHVA 2X5PA 4PB0H 4AQEB 2HVJB 4BUGA 1UASA 4M7JH 3HC4L 1SPDA 3BOXA 2G3NA 3EJQA 4BQBA 3PAJA 4CQDA 3CPLB 2DQXA 3P82A 2WLLA 4N8PA 5DVMA 4KPLA 3KLAB 1Q0YH 4K4KA 4PRHD 1LT7A 4FFWD 1HIZA 4G6AC 1N26A 1D5BB 4KHXL 4PFHA 2BLEA 1OAUH 2MMXA 5JBFA 2D31A 2F74B 5HJDA 1V55B 5A8GA 7FABL 1N0XL 1FBIH 1H3WM 5LXVA 5EPMB 5T3ZH 3UTOA 4P2RA 3HR5B 3UXKA 2E9BA 2KS0A 1E51A 5ICUA 4OD3H 1T22B 3W7OA 4FXGB 5KYYA 5KSAC 4HA0A 1IGFH 4M5SA 3UTTB 1WXJA 4IGBD 1I45A 1XH1A 4MGXA 5L2KB 3IAQA 1I75A 2G2RB 4NNCA 2P47B 4WUKL 1XLCA 2WC3A 5IQOA 5JW4R 4W70A 4AHPA 2R1WA 4ZO6A 1QAPA 5INDA 2DZUA 1OARH 4HETA 4AENB 1QOPA 4UZGA 2Q8XA 3N1MC 2JIXD 4U1GB 2R2BA 4O0ZA 1XICA 4G5AA 4YHEA 3TWBA 3BLDA 5D1XC 5MEOA 2EE6A 2AI0H 4AW4A 4G1NA 3WSQH 3QOKA 2HKFL 1BSIA 2V2WB 4AZ8A 4IPNB 1MCWM 1BG4A 4KKXA 2VZUA 1KFBA 4LQFH 1AQFA 2KYIA 1E9OA 4QRSA 1PWLA 4H1LG 3F05A 5REQA 1QP1A 4ZFZB 2MCMA 5GGSY 3AXHA 4JTDA 1E4XI 3QJXA 3AREA 3QYCA 4S1DC 5ABEA 2QQLH 3QGKC 4ZXBD 3BLOA 1A49A 1FNLA 1YMMA 4EI5C 1A65A 3CL6A 5EOTA 3MRMA 2HWZH 1M05A 1ZVYA 1YEDB 3DPBB 1UR0A 3ULUL 2UWFA 4PODA 1UOKA 2XC8A 3S46A 4YWIA 2JF1A 3T07A 1VFTA 1NM4A 4Z2JA 5LWYH 2PF8A 4Q22A 1GJUA 2P3ZA 3EX6A 4YL4A 1CBGA 7TAAA 4KCVA 1C8VA 4DP2X 2DVUA 4KCTA 1ZLWH 1DIEA 1UADC 3EO9L 4OGXL 5G1TA 5DMMA 3K2UL 3DRQA 2GJ6D 1VS1A 2XWBB 9RUBA 1GJIA 3F3HA 2MOVA 1WTGT 4JFEE 1TO5A 2GITB 1AOZA 1NDZA 4DKEL 4JN6A 4QJ5B 1UM5H 4H7ZA 4CEUC 2RQ8A 5IMLB 3HB3B 1C5CL 4L9LB 4L61A 5JUEH 3WNIA 5HHQA 4CVXB 1YYML 3VFNA 2NNAA 4MDOA 4WX2A 2IAMB 5BOJA 1WQVT 2H6OA 4QF1B 5HHNA 1YYCA 3PHSA 1O9VA 3VXNA 2P5WE 1ZSXA 3DVIA 4HH9A 5JHDA 2AJYL 2Z92B 2W67A 4ES4A 4H41A 3ZVHB 1KBVA 2NXYC 2GGEA 2GYSA 3TXZA 1LE5B 3KCOA 1MPAH 3H70A 1UHVA 4PB4A 1KPUB 5L88L 1J01A 1E56A 3WE6A 5IEHA 2Z4GA 3NIDF 3C5ZB 4WFHD 1GGBH 3NFNA 6REQB 3CDFA 5DJDB 1OTUC 1E4WL 2ZXBA 1E8XA 5DS1A 4ZSOA 1I1CA 3W72A 3G5YA 2YCEA 3V0VB 4G8EB 2Y2TA 5DRZA 3ASWA 3O3EA 4I0PD 4L1TA 1SZFA 2JGYA 3UR8A 4ODWA 3CFBA 4Y5YC 2VDNL 4MNJA 1OP5K 2FGWL 2X44D 3BZ4B 1ZT4B 2LHAA 4KRTA 2D3NA 1WEJH 5FF3A 2HISA 3UWWA 4G56A 1ECQA 4C91A 5ALBL 5ILTH 3CX5K 5AVQB 3BJLA 5KBPA 2VSDA 3B4UA 2IAND 1TETL 5H4ZA 1HAWA 2VABB 1LZOA 4HU3A 1KN4H 2ITDA 3SEPA 1AIFA 6PCYA 4MZ3A 3DXAD 2X6BA 5FJJA 2QGEA 4JTGA 3EOAB 1FCBA 3GSWB 4UQIM 4FQIL 1M03A 1NQ6A 4NJAL 5T3XE 1TZGL 4HWBA 2X12A 2X1PA 4PWFA 2DQMA 5IREA 5C3IA 3MUCA 5D96B 2OZ8A 4OVVA 4WOZA 4M1RA 1I3GL 2V2TA 4Z3FA 3W7NA 3VD5A 3H7VA 1CFTB 5D8JH 3KX6A 1XV8A 2D7TL 4FAAB 2CIIA 3V4BA 3BPCA 3AB0B 4NI8A 5C07A 5KS9A 1AAJA 3E0FA 3F2LA 2R29A 3U5YA 2O5XL 2R23A 1RJZB 3CN2A 3DKHA 3O2VH 4K9EC 2K1MA 1J0YA 2F8OA 1IBDA 5HMSA 4QX4A 1LL7A 1CE1H 3PIQB 4QRUA 2FYYA 3NQ7A 3OGOE 1N6VA 2PWHA 3ABOA 4WHTA 5T3ZL 5HJXA 2N0KA 3HHRB 5IK3B 3PP4H 3GFUA 1IGFL 4GY0A 5D9SB 4IMKA 4DLFA 4I18C 3D9AH 4XPAL 1BWLA 1UWFA 5AHLA 1OAQH 4ML9A 5BMWA 1H7XA 1X97A 1OARL 4TUOB 2PZ0A 1P1XA 1FQ0A 4XAGA 5AUMB 5IHBA 4FOJA 3DG3A 1QQDA 3L5MA 4DW2H 4DOHE 1ZP3A 2QUVA 4NQCE 3BGMB 3UFYA 3O6FC 5KANG 1VBGA 3BG9A 3O0KA 3S9IA 3QJFB 1ZTXL 1DL3A 4LQFL 1ETA1 4JM2D 3OA5A 3TBSA 2AGKA 2BMKB 3L3GA 1J2BA 3QZPA 4HZ8A 4NYUA 3SW6A 4JPQA 4GXMA 4WGWB 4FQPA 2W62A 6TAAA 4LYKA 5A6SA 3D0LA 3EWBX 4N24A 4Z7WB 4F37F 3REQA 4DNHA 4XVJH 4U3AA 1CXHA 3BV4A 4YXGA 3ARDC 1TRDA 3ZKXB 3H53A 1EJTC 2DQFB 1SVBA 2BG5A 5E9DB 3WFDH 2J5WA 4LUSA 5GVJA 3S3GA 4AD0A 5E6IC 2IC2A 1JWSB 1QRQA 1MQQA 5L6UA 4I3SL 5F9JB 2V17H 1EOKA 3FS9A 2DBLH 1LP9B 4XMXA 1F90L 4QGTA 1SBBA 5DD5L 2G97A 3AJXA 5T1LA 3QC5X 3FXYA 2GQAA 4N90E 3V95A 4LVNB 2MOQA 1G1OA 2QADB 1CD8A 1QWKA 3SKMB 4FNUA 1H9DA 4Y2DA 3OV6A 1OK6A 2A3HA 1DUZA 1KYDA 1KXHA 4J3WA 2W0UA 1U8MA 5DRWB 2VFGA 5B3SB 3LB0A 4RV8A 4MSWA 3WFLA 3NIGE 3URAA 1MJJA 3QY8A 4GP4B 5MENA 1FRGL 3BSZA 4PWGA 2WTPA 3U4BH 1G7IA 1AC6A 3TS8A 5JIKA 4FZEH 5C6MA 2EPHA 3HN5A 3LHUA 1Q65A 3OBKA 3KVKA 5KYYB 3LV5A 4MAVA 2HJLA 4Y88A 1UR3M 2HJPA 3TSDA 2PLCA 3AQYA 3V0IA 4GG6A 4ZUUA 3UZVB 4LCWE 3SE9H 2E1DA 4P46B 4AK2A 5MEQB 2VFDA 4PRIE 1B30A 4D8PA 2R0ZH 2B4GA 4MWAA 4C6LA 5C0CE 2VZ1A 1KKOA 5IQNA 4GXVL 1MPAL 1L7IH 2GPZA 3GVVA 3SSZA 3C6LA 3KXFE 3NUKA 3T3PB 1DDTA 3T0BA 4DVOA 3NZRA 1ET7A 1BEYH 5CSGA 2I5GA 5DANA 1FH2A 4U7KA 4DWDA 5DZVA 4QNPE 4E41D 4HG4J 3VRJB 2JK5A 1MDLA 2WXIA 3CIWA 3QUZD 3AXKA 4GABA 3N12A 3QFJD 1EJRC 4WUIA 4S3FA 2NY5H 5E0CA 4JTJA 2WXHA 4PJHF 2VITA 5I76B 5SWZD 3ARBB 2Y1YA 2VMEA 2P10A 2CITA 4PMVA 1UCBL 3TT1H 4E8DA 5FV1L 2VC6A 3MTWA 1NP0A 1KCBA 4X9IA 2DIEA 4FA3A 4CL7A 4NQXA 1X4YA 4J3ZA 4PB5A 5CEZE 3QIWD 4YXHH 1BGXH 3MRMB 3UIYA 2X0SA 3UWYA 3X11A 2VDRH 3W1XA 4P5TC 2DJSA 4OIBA 3BZJA 1P48A 3U0PB 1LEKB 3NZQA 2HA1A 4M80A 4LALA 2WXDM 2A77H 2IWEA 4HFUH 1PG7L 3CTTA 4IKLA 2CUAA 5HHXL 3NABL 4PYGA 4RUBA 4P5KB 2WSDA 2PDPA 3BKYH 2GI7A 1AL8A 1A6ZB 4AC2A 3PSVA 4RNIA 2YPLE 1CXIA 4NOBA 2XY1A 4B2DD 1G6RA 3VGBA 5D8JL 3IGUA 3U5UA 3TH6A 3LK6A 4D0CB 3LKQA 4TUJB 1MZZA 3OZ9H 1IV8A 4XKYB 1RUMH 3LMYA 4FXFA 1O7DC 5HNUA 3IE4A 2VDML 2Z26A 1QO3A 3CH0A 4QOKE 4ETYA 2NUPA 2C34A 2QHRH 1UACH 3RJYA 1EF3A 3LS4L 1IO4C 2H0PA 5G2HA 1MHEA 3X1EA 1CE1L 4I13B 4NC2B 2A4EA 4GXWA 4PRAA 2NNAB 2Q87A 2NTSP 4XVUC 3HC0A 4PSRA 4JFYB 2IBGA 4I1PA 3Q6GL 4LK4A 2NQ3A 4YDKL 4HH9B 4WY0F 1HEJC 3D9AL 5E2TH 3W7KA 3NCYP 3Q8FA 5BXTA 1W0VA 1NC4A 1C9DA 4BGDA 3U0WL 3F7KA 1WYJA 2UZ9A 5CZ0A 3BZEB 1BX2B 4EAEA 5F6IB 1IKOP 3MRPB 3ESMA 5CILL 5IEHB 2E9IA 5HJLA 3WK2A 2AXFA 1N55A 4FZIA 4LEQA 1KTNA 1L6GA 3NFNB 1PTDA 3T6WA 2NSQA 3DURB 2R1LA 8TIMA 3GJFH 3E2HC 4LB4A 5C55A 5HJGA 5AL8A 4X6BB 1YEWA 2A6DA 5D4IA 1K70A 3R8BB 1I85A 1PLBA 3LCXA 4FF7A 1T4WA 1GGCH 4MQ7B 3V75A 3CFBB 4FB7A 4DOHB 3CQHA 4X5WA 3S83A 3FO9B 3F5LA 2VOTA 5F1OB 4NQCB 3GE7A 4MLRA 2VW4A 3IDYC 5B7YA 3UG8A 4TOQA 3WTWA 2VR6A 3MSPA 3N91A 5AKVA 4G71B 3V5DB 5LGHH 2J6EH 1EP3A 3PG8A 3AY4A 5FO7B 4RPQA 1UZ1A 3G3MA 4L9ZA 2ICES 4E9XA 1ROWA 1IE7C 3GZQA 1GKQA 3P84A 2ZZ4A 3TU6A 2VXSH 2HV5A 3KHJA 4AIUA 4H8UA 4M6VA 3DSNA 1D6VL 3WFDL 2Y5EA 1A3QA 3WTVA 5IWLC 1UB5A 2OX4A 1NARA 1NWRA 5C0GA 1GS6X 3B8WA 1MFCH 2J2ZB 3QUHA 1E6ZA 2P8CA 5HHOD 4ZMWA 1IGYA 4ERSL 4QHLB 1J12A 5C9KA 1U8NB 3UXLA 1GR7A 3B06A 3GMNA 5TF0A 4YZWA 5AHNA 1XR9B 1WAAF 2R0LH 4QWWD 4R97B 3W7HA 3WL9A 4MXQD 1MZYA 2EE3A 2DQTH 4BSVB 4JZJA 3P8JA 1Y7VA 2N7BA 4Y8FA 4P4KC 4HLJA 2WIIA 3PM6A 3CUHA 3GS6A 1BG9A 4F2FA 3QRFM 3BVVA 1UZ8B 1FHGA 2WXLA 3ID7A 2DFAA 2ZOWA 3BUDA 3RCNA 4WHTB 4C7GA 2BSLA 5JR1H 3U4BL 4H6RA 2ZUSA 3MODH 5D32A 3O8AA 2CLMA 4KQNA 3OMNB 1A6WL 2PO6D 1PBYA 3ZY7A 3NIGB 3KMDA 3UF9A 1LO2H 1W1A1 4PJBF 4RRPA 3P5YA 3WLPA 3DJRA 1Z9SB 3UAJA 4PV8A 2IV9A 4ZNCD 1XCXA 4XWGH 1CQKA 1TJ1A 3WEOA 5CF3A 1L7IL 4F66A 4AW7A 1N6QH 4HMNA 4MAYB 4LRIC 5B8CB 2OKOA 1SMAA 4AE1A 1QQDB 3V6OE 4HKBA 4XZHA 1F05A 4PUMA 4PRIB 4GO8A 4JVWA 4G6CA 4DEFA 4L9XA 1QT1A 2A3TA 2NQDA 1AQ0A 3BISA 4FQXD 1M7IA 4LNYA 3H2WA 2Z0UA 4RMBA 3TEYA 3MJWA 5BS0E 3SQMA 1S9XA 1U8CB 1YNLH 3A0OA 4B90A 3MACH 1FFOA 5IY5B 4YSPA 2YAHA 1FHUA 1V51A 3TT1L 3KDMB 3GWJA 3VXQA 4H2AA 1U3HC 1TTJA 3LLFA 2XX1A 5CD5C 2BODX 3SOBL 2ZZ3A 4YXHL 3W71A 1ETZB 3L4YA 3REQB 1XH3B 1XYZA 1M1BA 2A6LA 4Z7VE 5D7SL 1H1NA 1RVFL 4DZ5A 2WMPA 1CGYA 2VC9A 3KPMA 4WWKC 1AGBA 1RZKC 3IJDA 1QTYT 4PTMA 1V02E 3E0LA 3T6ZA 4JVPA 4Z95L 4HFUL 2EXYC 1WIUA 1A5FL 3OJDB 3S3PA 5BOZG 3IFNH 3GXPA 3TASA 1MDAA 2DGAA 3D3AA 1XEUA 2JB6B 2TSYA 4Y90A 4KRPC 4BZYA 3C09C 5D5MB 3U6XS 3ME3A 5LGXA 1DVXA 3CGTA 2YKLH 4ZB0A 4TVPE 4F79A 2EJ1A 1DWFM 4EWJA 3MLZH 3LQGA 4E3TA 1XB6A 4AJVA 2OODA 1NIBA 2ZWYA 4N6RB 1E2VA 4GKSA 2WSPA 2OTPA 6XIAA 3E74A 4JREC 1VQTA 3W7RA 4IU3A 4PJXA 1U8MB 1XYBA 1OX5A 1JDCA 3QDHA 1Q6GA 3TC6A 4YHNA 4MSWB 4LT9A 3SKJL 3MX0A 5MENB 4GX8A 4DUVA 5CMAA 3V5CA 1S3TC 3UQNA 4GAYB 4AVOA 5G4WA 4GG8B 2EYRA 2DP3A 1JGEA 3H9SB 3F4VA 1E5BA 4QOKB 3DSFL 3VQ1C 3EYSL 1QVBA 3BQUC 2P49B 2IQAA 3O2WL 4ZUUB 5EFDA 2UY6A 3ONBA 1AHKA 4ROPA 5CBJA 4V33A 3MV11 2J27A 1E9ZB 1JNLL 4N2MA 1FF5A 3KLLA 4MWAB 3FUEA 2B20A 3HUJF 3TZNA 2NY2B 1E72M 2MHAA 4I1RA 5DFVC 5E00A 2NQ5A 4LAQL 5DY2A 1MIMH 4ADTA 3C6LB 4OQVA 2CLOA 5F9AC 3A6CL 2AVGA 2PWFA 2BM3A 3P4NA 1FH8A 1OZQA 3GF8A 4ZW8A 3MUJA 4GYPA 1DBAL 2A21A 2VLLA 2OLAA 4ZW3A 2JK5B 3MRQB 1H3PH 1Q94A 1OT4A 4ENED 4Y4KA 3QFGA 3MNMA 5CCKH 3ZTDC 1N3NB 5T33L 2ACRA 4REQA 4X6DA 2VI0A 3I9AA 1I1RA 4CU8A 5JPMA 3BD3A 2H8XA 1A66A 4JKWA 1DQUA 2Q7AA 2ZRWA 2B9AA 2CXGA 2YOCA 1ZV9A 3JVGC 4NQXB 1F6KA 3GFXA 4NT6A 3NQ6A 3F83A 2I32A 1GUVA 3GSMA 1NL0L 2OWCA 3BDYL 4WXZA 3HKFA 1KYFA 4Y7MA 4EN3C 2VXSL 1SN2A 1GYVA 5F2FA 4J2QA 2Y22A 1OB1A 2P5EA 4JO2H 1JTTA 2ZFAA 3NZHL 1FFRA 3OAUL 3AU1B 4BFIB 2V5TA 1IC4L 5FM5M 4W85A 3CFQA 4TF4A 3DIFB 4ODXA 3CUFA 1UBPC 4DJDA 1P53A 4WENB 5HPMA 1GSKA 2K9FB 4A3RA 4JHUA 4LL1A 3AW5A 3GDLA 2W27A 1RH9A 4R4FH 3CZ8A 3NYZA 4OFPA 2Y72A 1AQ8A 5D7JB 3S42A 2R0LL 3BMVA 3RFZC 1ZHBA 3UDWC 3CQPA 2J62A 2QGBA 3M0XA 4JOMA 4RMQA 1O5DT 5AHMA 2FJFA 4IPJA 4C60A 2Y61A 1DN0A 5ENLA 3M0YA 3OG2A 1FIEA 4A38A 4JQAA 5D1XE 4PRAB 4L5FL 2ZZ7A 2F54D 1EVUA 3IJEA 4DYJA 1OW0A 1QNVA 2QCEA 4FQHA 5DD3H 3PQYA 3KCLA 4F1ZA 1ZU8A 4NKOA 2WD0A 1LO2L 4YHPB 3P5ZA 2H2PD 2R83A 5E4IA 2OMUA 3AUWB 35C8L 1JRHH 2VZTA 3T55A 3WEMA 4WDUA 3CUIA 3ILQC 4HNTA 1FZMB 3PC0A 1NC2A 2E7LA 2VM9A 1OPGH 3IJYB 3N4EA 3L5XH 2PU0A 5HDBF 4XSMA 3GXFA 5D6CB 2H6UA 4WI5A 2H3NA 3UZ5A 4WV1A 4GH7B 4MB4A 2R1MA 4A7SA 3S6DA 2A6DB 1S9WB 4NO2A 4BFFA 1SHXA 3L2MA 3S36H 3BFOA 4TL4A 2Z1VA 1N8ZA 5B1JA 4N4YB 3WQPA 2OTUA 1UZGA 4XP5H 2C13A 4O2EB 3F4DA 4B97A 3ZT5A 3H7RA 3ARFB 3F84A 3G6MA 2ADGA 1OJXA 4X80L 1R3HB 4KY2A 1XBXA 3F65A 1BEUA 2ATAA 4NUJB 2EDEA 2P45B 1GY1A 1VFOA 4S3BA 4XO6A 3BGFB 3PXJA 5GS0H 2KHAA 1H41A 4IGNA 2NSOA 1KF9B 4PJ7B 2XV2A 3TFCA 1EYEA 4HU0A 1AH0A 2I7SA 3OJVC 3GG0A 1EX1A 3B3IB 5C0GB 4MCYB 4O18A 4EIBA 4L4MA 4Q89A 4R9HA 1XRTA 4OJDH 2AEIT 2E9GA 1OE1A 4AQEA 1FWCC 1A64A 4Q6KA 2HVJA 3QUYC 2AK1L 4JGDA 4ODSL 4M6OH 2YDQA 2X3AA 3CPLA 3MLZL 2VWTA 3F7PC 4C6CA 4K36A 3L0NA 3H6JA 1QPQA 4YDMA 4QP0A 1FUYA 1D5BA 1JCJA 1BIIA 4TUUA 4H1LB 3DG7A 3II2A 3FF8A 2G0KA 5EPMA 2JKEA 1KFAL 1GOXA 3HR5A 4QYOB 5IFPA 3MA7B 3IMUA 2WM1A 1NAKL 2YPVH 5F2GA 1XCTA 1GVEA 1OD0A 4HJFA 1T22A 4FXGA 1XBZA 3UTTA 1UGKA 1P4IH 3VWKB 4HYWA 5L2KA 1HCZA 3MJYA 5LNGA 2G2RA 1HOCB 2TODA 3DJ9A 1P4BH 4IISA 3ZIYA 4KKLC 2G3ZA 4QGCA 4H8VA 1PE1A 4NO0B 4ZODA 4AENA 2G2PA 4DGYL 1BF6A 4UR8A 4WWOA 1GMEA 4PY7A 1ZV2A 4C4UA 5A3ID 3ORJA 4F9LA 3A67H 3QXAB 2V2WA 2ZKWA 4K9JA 4IP7A 3EDFA 5BW7C 3D3FA 5TBOA 4HKBB 1PS3A 5DQDH 4UYQA 3VVVA 2G5RA 4ZFZA 1DXIA 1ISYA 1Y1DA 4JHMA 3PFQA 3IDGB 5E2VH 3IV3A 3N18A 3FS2A 4HIBA 3L21A 3MWCA 5EU4B 4HUWB 1MW3A 5B7MA 3KVJA 1YPZA 2DAVA 4K1GA 1IBZA 4MZIA 4J3OF 4NAQA 4JEQA 4IQDA 3H4FA 1F7BA 3ZKMC 4CILA 2Y8VA 4FN0A 2XLLA 4GVFA 1CTOA 1OIFA 2ZNXA 3UR2A 5I78A 1DIKA 3DPBA 2HFGL 4IRJC 3CX5J 3FUFA 5E6YA 3SOTA 3W1TA 3AT8A 1W17A 1FNEA 4XMZA 3FXGA 2P8BA 1NUNB 3WL0A 3ATDA 4MMZC 3RZCD 4OQTA 1AGBB 1ZDSA 5T5FA 4J40A 2ICWI 1ECZA 2R1YB 3AIWA 1VGEH 2K3TA 2RHEA 3X13B 3OVUB 1TTPA 3VDGA 4N20A 2APVA 1TVPA 1OM9A 4DZ8B 1GVFA 3CUPB 3CSGA 4W6XB 4XO3A 2TRHA 1V6WA 2CKBH 4AC4A 3KTXA 1R3LB 2E46A 2BHFA 4JDTH 4L29B 2ATPB 1GY2A 4E9RA 1EHLH 3TVMC 1DXEA 5IM51 5HXMA 2GITA 1WH0A 4OLXH 4A2HA 1D5ZB 4R4FL 1NP2A 3RWGA 4FF9A 5IMLA 1D7CA 2XTJD 2Y3AA 2KI6A 3HNSH 4C6BA 4L9LA 5DO8A 4PJXB 4W84A 4AXKA 4Y9NA 1FORH 4Y4HD 4MFHA 4CVXA 4DGUA 5KSAB 3IUDA 4YHNB 1I0BA 2QPUA 4C55A 2IAMA 2XG4B 4QF1A 1LO5B 4D8LA 3RDJA 5CIPH 3LCYA 3MXVH 3RHWF 3SDXE 2Z92A 1FL6B 4PN6A 3ZVHA 1EWEA 3T4WA 2ZXEB 4JFHE 3TT3H 1LE5A 1DIDA 1KPUA 1VERA 3JWDC 3CWGA 5D1XB 1INQB 4G5ZL 3EKGA 5L9FA 5EO1B 4POCA 4Z17A 3C5ZA 3E6FB 4ACYA 3N85H 4M82A 3H2OA 5DJDA 4JFDE 2WAHA 4RSVA 2VR8A 4K37A 3WF0A 1XISA 1Z3RA 2OQHA 3V0VA 4G8EA 2CMRH 1IM9D 4X3ZA 1NQBA 1XM3A 4HC1H 3IDIB 4U6YB 5E2UH 3LB6C 2NUTB 4WVRA 4FSAA 5A6LA 1Q94B 4UQ9A 3ITVA 3DERA 4JG9A 4BHUI 3BZ4A 1WAWA 2B7OA 2AJSL 1TV5A 4Y7EA 3S36L 1INEL 3BW9B 4X6DB 2QXWA 5KTEL 3G7TA 1KCZA 5J06A 1QFHA 4PJEE 5EUOB 4XP5L 4Q4PA 4UQCA 3RWHB 3QJAA 2B5IC 1WDAA 3FFOA 1G7QB 1MJUH 4H0HB 1R86A 1IEQA 4O1BA 2L7JA 4G9FE 1BF8A 5BU6A 3VZZA 4HHWA 3OKDB 3LEXA 3Q1SL 4NT6B 1AR1D 1T7VA 1GGUA 2XKNB 2DB8A 4JFZH 4NLHA 1V7NH 2QQKL 4UTFA 4Y5XC 3FC8A 2GVYA 4LPVA 3EOAA 3V0SA 4J7RA 3SZ6A 2VDIA 2CHDA 2EUVA 4V2XA 4CNTA 1RKRA 1YHTA 4M24A 2XICA 1QSFE 1WBZB 2EVIA 3EWCA 2HMID 3RAJH 1JJUA 1CT5A 5EB8A 3AHXA 3PPSA 1W5PA 2V3EA 1H9VA 5D1ZI 3CVBA 1V93A 1CFTA 1WZ1H 5KVEE 1GK8A 1S1RA 1MNNA 1CL7I 3G2GA 2JH2A 1VBRA 1NCGA 1HL9A 3NCEB 3N5AA 4RGND 3QJOA 1GVOA 1B4KA 4A8IA 1MEWA 1QRND 2YGPA 2VN6A 2JI3A 3S9DB 1SDDB 4MSSA 1RJZA 4P5RA 2JQMA 3H55A 5E1IA 1EQWA 4Z6AT 2BDQA 2VR3A 2XYBA 1MFEL 2CDEB 3GKZA 3PIQA 4WGXA 1U5JA 4KTYA 5HQLA 3W11D 4LAOA 1F02I 1J1OH 4UMGA 1OADA 4F8NA 3OKKB 4W6WB 2FJFB 1AZUA 3I7QA 2DM4A 5IK3A 2YPVL 3DFNA 3N2MA 3GB6A 3KPRD 2ALAA 4X6EB 5HHPB 2DLIA 2I56A 2D73A 3MRJB 4G8TA 4M5ZH 5D9SA 2E25A 3HS0C 3SECA 2ALWA 4BR1A 3IJEB 3PK7A 5CM1A 3GSVB 1SY6L 4XTRC 2VJXA 3O9NA 5HK4A 3NSCA 1JXDA 4NKOB 3AT0A 4PTVA 2D0HA 3FN0L 3KBHE 1NGYB 2VQ4A 1R3QA 2NLIA 1BKHA 5AUMA 1TF4A 3QBTB 3LTYA 3SGJC 4X9FA 1YZZA 4JZOB 3BGMA 1C93A 4V1XA 1TSIA 3AG1B 4AVHA 3BAJA 1MEXH 5T91A 4BZ2A 1XUZA 3QJFA 1E1FA 4Y5YB 1XYCA 1X7IA 1W5NA 2D22A 3KEDA 2BMKA 3C2AH 4JFFE 2H3NB 1T03H 5E2VL 1JAKA 4GVHA 1IC7L 3CAKA 1ZL1A 1G7LB 4L4LA 3AXXA 3DI0A 1N8ZB 4Z7WA 3MT1A 2OTUB 4U4MA 4P2VA 1KCLA 2W66A 2AQ1A 4GIRA 4BKNA 4DESA 2YJQA 3TCLB 4NILA 1JPMA 5JW3L 1SLWA 3B97A 2IKIA 3CDZB 5FGCB 4A2LA 5JUVA 4NQED 3WLWD 5IVXE 2DQFA 4YCPA 3RXZA 2SODB 3IS1X 4NPKA 2ARJB 3GRWH 4PMUA 3OJGA 5E9DA 3FY1A 1JWSA 3ES7A 1CD1B 5EMUA 5F9JA 3LH2H 1R85A 1OLLA 2AXHA 4Y4FD 1V3IA 4JG1L 1L6SA 5GJSH 3AYSA 3VGFA 1LP9A 2E47A 3IRSA 2WZ5A 4A8RA 3E5BA 1QI5A 2YRZA 1VFBA 1OTSD 3RI5K 4LHUG 3D4YA 1QI0A 2CKBL 4AX6A 2PR9A 3I6KB 1EHXA 4JDTL 1UWTA 3SKMA 1DHPA 5I3IA 3D30A 1HSAB 3CE1A 1JNJA 3K4ZA 1F5ZA 1EHLL 1C5BH 3LZ5A 2C7UB 4TS6A 2DYRB 4OLXL 5DRWA 3K72A 5FJTA 4NJGA 3SJVD 1MFVA 1M9HA 1BIIB 3CB8A 3HNSL 3ABXA 3QQXA 3NQGA 3UW6A 3DMMB 1XIEA 1FORL 4OF7A 3IMWA 1DQML 2Z65C 3QQ1A 4ZCWA 3OG4B 1XCTB 2J88L 5C7HA 4HNOA 4KKPA 4B9KC 1O9WA 4LCRA 3LPFA 1ZIBA 4M56A 3UZVA 1MFDL 1MQ8A 4P46A 1ZRUA 5MEQA 3PTKA 2CNCA 1HF6A 2I07B 4JRYB 4YHKH 4XBJA 5FF4A 3OSKA 3H4WA 3B83A 1I9RH 3TPUB 3WLOA 3BKML 4TV6A 4PY7B 3O6FB 1TV2A 5FB8B 2D2HA 2VEGA 1XG4A 1XHHA 3FRUB 3VX0A 3VKKA 3VRJA 4DWSD 3O0RL 3EADA 4G7VL 2CMRL 3VI3B 1HUVA 3LD8B 4E4UA 5I76A 4F5CA 3ARBA 1UYWL 1A1MB 1IB5A 3WTUA 3RZWA 1EDQA 5F97E 2O9RA 1YPZB 4XZLX 4B3LA 5GS0D 4PMEA 3RRXA 4RXFA 2F9BT 2ZCZA 3ARDB 3C61A 1W1ZA 5K7JA 1TV7A 1H7NA 1AUSL 2UXTA 3V0HA 5C08E 3L67A 1L8NA 3GC3A 2QJIA 5CP3A 2Z31C 3CN0A 2XH0A 3U0PA 1LEKA 1OC7A 2P28B 3W24A 3TMQA 1YTDA 4PLKD 1FNEB 1JNHB 4FXTA 4PP1D 4OI8A 5DBTA 4P5KA 1CWVA 4EE2A 1PCWA 3RAJL 2V5DA 1A6ZA 4UCGA 1LUCB 4GMTH 2RALA 3LNFA 3S35H 1KM6A 3MVTA 3BUQA 4PG2C 4PWEA 3U9UB 1PY0A 5E0QA 4D0CA 2TSAA 4TUJA 3S6OA 3VXSD 4LCVA 4BQ5A 1T99A 4XKYA 1HE7A 3L7FB 3K6DA 2HX8A 5CGYD 2VLRE 3RWGB 4M8QB 1NDTA 2BY0A 4IJBA 3HMWH 1NH6A 3RX2A 1UP0A 2X89D 1HW6A 1GXEA 4JYDA 4N2OA 2ZKXA 5JIHA 1E0XA 4NM8H 1E0WA 1IKNC 4XT1C 2IQ9L 4JFYA 3D85A 4O1CA 5FOBB 2FAUA 1TUXA 1UEYA 2VZSA 3MU3A 4QGYA 4R7OA 5FKAB 1KXVC 4HJTA 2GTWB 2V9RA 4PI0A 1TR9A 3L66A 4ADIA 1QHZA 3RNDA 3BT0A 3BZEA 2VR2A 1BX2A 2JF7A 1NCCH 3IGHX 3LERA 3MRPA 4FO4A 3FTZA 1XLEA 3CV6A 3BVUA 3RTLA 4WO4D 4TULH 2XRAH 2PWVA 4K7PY 4W9IC 1N59B 3DURA 2PCYA 2F53D 1MEXL 1UATA 4X6BA 1A6AB 2BVDA 3PXLA 4G6KH 4HNLA 4Z3EA 4AGOA 2X1SA 1AXTL 4MQ7A 1SRDA 5ABAA 1T03L 4KVPA 2BIOA 3QCTH 3GMRB 3FO9A 4NQCA 1UD4A 2FVMA 5LVEA 3ZDXF 1E67A 3MSRA 1AD0A 4KCUA 4UT7L 4W9LC 3VA6A 3HG1E 2G41A 2X1XR 1EFQA 5K9JH 2BNQE 3V5DA 1Q1PA 4KDTC 2RFGA 2ZJSL 2R2EB 1OAZH 5A8MA 4TNEA 5FO7A 4KVCL 3H9ZA 3CBKB 3FH7A 4MLIA 2GGIA 3O1NA 3C0LA 3LEXB 1S7XB 4D7BA 3PR2A 4Y19E 3VXTB 1QFUH 1RY8A 3T0WA 1A8JH 5HI4C 3SYPA 1IFRA 4ZD3H 3JV4B 3LLXA 1O9ZA 4RBPK 4I2XE 5CGQA 3S5NA 2POZA 3LH2L 3V4VH 1PCXA 3PPFA 2J2ZA 4HPJA 4JGMA 3OVRA 4GX9A 4PULA 1TIMA 4O17A 2YGQA 3ZUNC 1QX1A 4Q7IA 2VXVH 4QHLA 3F7VA 1U8NA 2YGYA 4PB0L 2Z7KA 1PZBA 4ATDA 2Y7OA 4M7JL 4UCFA 1BGAA 1SM9A 3OLEA 3RX4A 3RLSA 4YO0A 1XR9A 1F18A 1B4EA 4XISA 4F24A 1XGRA 5A8NA 1Q0YL 4BSVA 2XGZA 4N0UE 4DXVA 2B3RA 4AL8H 2J72A 3B5HA 1OAUL 4WQOA 4UV4H 3KRBA 1UZ8A 1ET8A 4U1NB 4ZPTB 1FBIL 2WANA 1B3XA 1I1WA 2ZCGA 1HILB 4ZMAT 1LO4H 4OD3L 5CCHE 1HXMB 1TKKA 3GPEA 2WTOA 4APXB 1EIBA 5IBUG 4DF2A 4JPGA 1URLA 3DNKA 4G1MB 1H1YA 2O5YH 3ETTA 1Z9SA 3JTSB 2R91A 3A3XA 2P42B 5J5RA 5IHRA 2QSTA 4YLBA 1I9RL 4MAYA 4AM0Q 5B8CA 3GTFA 3BYYA 1CLKA 4P49A 5HHMD 4H8PA 2B1HH 2AI0L 3TYBA 3AIUA 4PRIA 3WSQL 4AEHH 2BWQA 3KPSE 2VLME 1UOWA 3MFFA 2Y7QB 4IFOA 3N06B 4ZL1A 4KKAD 4UFLA 3IDYB 1U8CA 4BWLA 2NXGA 3HRZC 5DUBA 2XXGA 4IRZH 3MI3A 3KDMA 2C9XA 2QQLL 5HOSA 1RAKA 4YEFA 3H9HB 4MB5A 3AUOA 2ZAIA 3CV5A 1P9MA 1OE2A 1XX9C 1PX3A 4B9GA 1ETZA 2NDGA 5CN3A 1XH3A 2HWZL 4BI7A 4J4KA 5A6TC 4OLYH 4DIXA 5C9RA 3LBMA 2AABH 4Q3MA 5AFDA 3GDBA 4QIUA 4LX4A 2E40A 1W1PA 5DHVH 3OJDA 1C9WA 3SFKA 4RW5A 4XOEA 5LWYL 3WMLA 2AKRB 4N2EA 2JB6A 5D5MA 3R10A 3NRFA 2ZAGA 3IRCA 1VFBB 1WOBA 2M8XA 4LPYA 5BW6A 2C9PA 2MNUA 1NOAA 3VKAA 4N6RA 1JHLH 3BW3A 4R33A 1FVCB 4LSQH 2IQDA 4P4KB 2YPLA 3K72B 1UM5L 4LL9A 5FJIA 3WFHA 3TE9A 3RO8A 4WNJA 3UJRA 1X9QA 3NJXA 4DBWA 3HMWL 3QDGD 5JUEL 1ZTXE 4HSNA 4B53A 3WLSA 2VDKH 2X0YA 2J75A 2BK8A 3TW7A 4GKOA 1IAIH 2K6YA 3T9WA 4GAYA 1H19A 4JFEB 1MVUB 4GG8A 2Q1EA 2HTKC 1NFDE 4MMWA 3H9SA 3S35X 4QOKA 5IJKA 1XRSA 3W2NA 1KR0A 1FZJB 4HKJB 4XO5A 1O4UA 4XN5A 2CBJA 5JOPE 3BD4A 4DFHA 1AXSB 1IT9H 4OFQA 2NR6D 2A0LD 2O26U 2ZPKH 3GTHA 3VM7A 5DBUA 1M5WA 2D3JA 3ECQA 4RZ4A 2P5WB 3IETB 5B80A 2PLMA 4ZW5A 1GGBL 1QUPA 4TULL 5TF1H 4K3HA 2XRAL 3EBVA 1Y07A 4A2RA 3MRQA 4HEPA 1FCGA 1SXBA 3UJIH 2R0KH 3AMLA 1W72H 4L4PA 2W38A 3SE8H 5CJBA 3SO7A 2GUBA 1N3NA 1D6EA 1U1JA 3DU0A 3RVXD 3VIHA 2ADFH 1U3HB 3GRIA 4IBWA 4H8NA 3PUCA 1WEJL 3KBWA 2F58H 5E7BA 1YQVH 3H0TA 3MV01 5LUMA 4N2FA 5K9JL 1G5AA 1HS6A 1XYMA 5ILTL 2JJUA 1DSYA 2ZONA 4WWKB 5I6XC 4NUWA 3G24A 3DIPA 4LSDA 5I6SA 2CCLA 1LOQA 3F8UB 1KN4L 4RFNC 4LP4A 3U83A 2QNEA 1K7EA 3WQDA 1CF1A 2EIKB 3EMZA 3BPOC 4JIHA 4ZD3L 3DX3A 3TH4T 3QIUD 4PEEA 3C09B 3AU1A 3V4VL 4BFIA 1EZSA 3EB4A 4KC3B 4LRTA 3AIRA 2YA0A 4V1DE 3DIFA 2X2GA 1OF8A 2VXVL 2XWTB 1NOLA 3M0HA 3FCUB 4I2XB 3AQUA 3JWNC 2BSCA 3SY1A 4JREB 1USQA 2JI1A 5HPOA 1KM4A 5D7JA 3IBOA 2LOEA 1Z9AA 2GVJA 3KRSA 3O2VL 4GD0A 3V8OA 4XZ9A 4UV4L 2ZCKH 3AABA 5G1MA 2UY5A 4FKHA 1CJYA 1JGIA 3QUMB 3MLPA 3BWAB 2V2XA 5FAGA 4C6FA 2JJSA 3AS1A 1UZ4A 3PP4L 1KR1A 3SPJA 3W70A 3D85B 3KOXA 5I30H 2YR3A 1UC6A 2X6MA 3OTTA 2P53A 1A5KC 4GQ9H 1OZTG 3RITA 3T4AA 3MRKB 4BD4A 5KSBF 4JGNA 2RJGA 4F40A 3E9AA 4YHPA 1OAQL 3QV7A 4XOCA 5BOPA 2O7QA 3U2OA 3VGEA 5BV7H 5D6DC 1WUZA 1KJ2H 4H20H 3TIMA 1DHKA 1FZMA 2VUKA 2KX9A 3IJYA 2CCWA 3EJYC 3ILDA 4DW2L 1UUNA 5D6CA 4Q4SA 3QHZH 3RPIB 5DHXB 3GFYA 4XZUB 1RLDA 4KIEA 1FFNA 3GWQA 3E0GA 4AV4A 1BXUA 5L8LB 1S9WA 4PLJD 3I6LD 1FZOB 1A4JA 4I3GA 5CZVH 3V6OA 3WBEA 4HYTB 5IKCA 3UO1H 1MCJA 1J05B 3SN0A 4DPBX 4O2EA 3N1FC 3PL6D 3KPSB 2HTLD 5L8KB 1FV1B 1AD0B 3ARFA 3QJVB 3R0MA 1R3HA 1SXCA 1LMIA 5AOKA 3BOVA 3W2MA 3HO8A 5LLIC 5BS0A 2MJWA 4NUJA 3FTVA 3IT8D 4XVJL 1GOKA 4O11A 1G69A 2X1RA 2FZ3B 5A43C 4XPTH 5IW6B 4PJ7A 4WW2C 3VIIA 2P43B 4H2HA 2E7DA 1NANI 3NCYS 1TV4A 3WXVH 4DHLA 4OTXH 3B3IA 4K38A 2YMOA 4MCYA 2V17L 1BRLB 5JA9A 1VEMA 1ENUA 1H3XA 4CMHC 2DBLL 3GMQB 2E9MA 1CLCA 1UR4A 2LLGA 3PWVB 1RPKA 4C6PA 3C6EA 4W93A 2EABA 1V02A 2YX0A 4M7LH 3JRKA 3F7VB 2EKCA 4I7ZC 1THAA 2OMWB 4EXAA 3ZTNH 4A2MA 5H4YA 3RFZB 5CBBA 4BHYA 3OMZA 3K81A 4MUPA 2XHNA 3LJ3A 2OYKA 1JHLL 4YO0B 2EE2A 1P5UC 4F7EB 1YIXA 4H1LA 1XGRB 1FH5H 5HD8C 3QZBA 1FHVA 3W87A 3ZHDA 2VZ3A 4QYOA 2DLGA 3MA7A 5DEFB 4UNIA 1FDLH 1BHGA 2OJZH 3SYQA 1GEHA 1RZ7H 2CKNA 2APWA 1WA2X 1I9IH 1A0QH 2AAAA 5GZND 3VWKA 4FZEL 4B3KA 4DF9A 1TUPA 1HOCA 3EOYG 3TYFB 4MLSA 1JZIA 4UMBA 1T83A 3ARGC 3SKOB 4GLRH 3LS9A 3F2CA 3H2CA 3U7AA 2W07B 2FLMA 3BLKA 3N43F 5GPRA 3SE9L 1J10A 1IBBA 2VLKE 4NO0A 2GCYA 4NHUB 4IMEA 4MFEA 3JWNG 2R0ZL 2ZPKL 3P9LB 2WBJC 1DQTA 1NFDB 3ZL1A 2WQ8A 2C5DC 3W1NA 2VGBA 5EIIG 3QNYB 2WHKA 1GT8A 3QXAA 4HU4A 4LCWB 4EF9A 2EG6A 2J7BA 1BEYL 2X1OA 5F0LB 3EB2A 1XIWB 5C0CB 3IDGA 2YYUA 1KRMA 3MFFB 2R0KL 1CO1A 5EU4A 1JYXA 3RPKA 5AVNA 4HUWA 3KXFB 3SE8L 2XIQA 2NY5L 4MS6A 1YBQB 3ULUC 5DUBB 1T5XB 4NY2A 4Z3IA 4XUGA 1U8PB 3C2EA 2YK1H 3GMPB 5D2XA 2VYOA 1Z9NA 4C1KA 4MA3A 3SYAA 1P0SE 2W81C 5A6AA 3UGUA 2YBUA 4X6CE 1BGXL 3DV4B 3D07A 3ATEA 4AZCB 1ETJA 1OPOA 2R8SH 4LVEA 3K6FA 3ZKSD 3K46A 2VDRL 1S7VB 4GBXD 3TAKA 4J6IA 1P7QD 2R1YA 2A77L 2IDSA 3DTXB 3X13A 3B2PA 3SGZA 4AWUA 1P69B 1SO5A 1W9VA 3KLHC 4JQVA 3QUYB 4I89A 4DZ8A 3CUPA 3HFTA 4Q4QA 3FDKA 3BKYL 5I5IA 4JRXD 1Q72H 1R3LA 1GVYA 4HN4A 2DMGA 4XVSH 3L4UA 2E5EA 3E96A 4L29A 3W00A 3LZOA 2ATPA 4G6JH 5FYKD 1DUYB 2HROA 1VCBC 5DMGD 4Z23A 5EU6D 2H47C 1S2EA 2DQWA 2H1LM 1D5ZA 3OZ9L 3WTTA 1TEGA 2BVTA 3HS9A 3ANVA 4H26B 4KAQH 1VDGA 4G6FB 2YPLB 1RUML 3MCOA 3EA2A 3W5MA 4JN7A 5HYJD 1I82A 1XDTT 3LXAA 1TZZA 5B21A 3BOFA 3GG8A 3WFHB 2QHRL 1UACL 5KSAA 4A05A 3CX2A 1TWWA 3EGDB 3L9EA 2XG4A 5JIDA 3AGVA 1LO5A 5D7KE 1TYGA 4HUUB 3SCWA 1OYAA 3VFPB 2UY2A 4R84A 4ANXA 4BQCA 1FL6A 3N40F 4YSEA 3RUGF 4GQ9L 3KUMA 2X1IA 1TNMA 3P30H 1IL1B 5FA5A 2P3YA 1NWP