3NPWA

In silico designed of an improved kemp eliminase ke70 mutant by computational design and directed evolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
250
structure length
247
Chain Sequence
TDLKASSLRALKLMHLATADTDEKVIALCHQAKTPVGTTDAIFIYPRFIPIARKTLKEQGTPEIRIWTSTNFPHGNDDIDIALAETRAAIAYGADGVAVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLSVIIETGELKDEALIRKASEISIKAGADHIVTSTGKVAVGATPESARIMMEVIRDMGVEKTVGFIPAGGVRTAEEAQKYLAIADELFGADWADARHYAFGASSLLASLLKALGHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords deoxyribose phosphate aldolase
publication title Optimization of the in-silico-designed kemp eliminase KE70 by computational design and directed evolution
pubmed doi rcsb
source organism Escherichia coli
total genus 96
structure length 247
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3npwA00
3FYOA 3U2OA 3B05A 1V5XA 4OBTA 1KM5A 1TPEA 3G0XA 1GG1A 3GDMA 3LHWA 4PTNA 3HPZA 2RFGA 1RZMA 1GVQA 3C0JA 4EF8A 3TV8A 4QNWA 1RPXA 2EGZA 1OK4A 4K38A 3ABQA 3S8HA 3W86A 4ZQOA 1LRQA 1TTPA 1XC4A 1IIGA 5FEWA 3RMJA 1DV7A 4P2VA 3NDOA 1XBVA 1ZAHA 1G4EA 1CX9A 3GIYA 3CHVA 4O14A 4R34A 5LNRA 1EUNA 4LOCA 3SR7A 5BRBA 1YADA 4E38A 1QO2A 1WBJA 4K39A 3TKFA 3DGRA 3PBYA 1K7FA 3QRHA 3LB0A 3C2VA 3IEBA 5C2XA 3NL6A 1YTEA 5EY5A 1FWSA 3NQAA 2B7PA 2Z6JA 1K03A 2NV2A 3P67A 3EX3A 3STCA 3W73A 5BNKA 2QAFA 4CCDA 1CI1A 2QCMA 3RK8A 3DFTA 4RJEA 3VCRA 1SZGA 3C8FA 3WJXA 2PRLA 2FQIA 2ZBTA 2R8WA 2QCDB 3GDKA 2DZUA 3PY2A 1BTMA 1JCLA 3GNNA 3IV3A 3TK7A 4ZQRA 4O0KA 3O15A 5U7SA 4YMZA 3SECA 3UY8A 2FJKA 1TPB1 1GYLA 4I7WA 1AG1O 3M5ZA 3N34A 4YCPA 3BG9A 3RLVA 1QR7A 3EX2A 3PAJA 3TROA 1DKWA 2QCLA 3LHUA 4N9CA 1XUUA 5H2ZA 5LGXA 3E49A 1LTDA 3RFAA 3WK0A 3UYCA 3MP4A 3O6YX 1WQ5A 3KX6A 5K7JA 1H7WA 5D02A 2HTMA 4PODA 3P62A 1JUKA 4XQ6A 4DO6A 4O16A 2FPYA 5AYXA 1W3IA 2C0AA 2XFWA 5BW6A 3G8EA 3FIGA 4AF0A 1TYGA 2OZ0A 4FXRA 4AH7A 4RKAA 4EWND 5D05A 1GYNA 3BG3A 1K3UA 3IVTA 2CZFA 3LTSA 1B4EA 2VEMA 3KXQA 2ISSA 3TE9A 4TMCA 1I8JA 4N4QA 1EUAA 3KVMA 4M19A 3A9IA 3W1PA 4QQ3A 1L6YA 4TIMA 4UTJA 3ABRA 1VH7A 4IX0A 1KM0A 7TIMA 2NUXA 5I3JA 1O5XA 4U4MA 1U5JA 4W9TA 3TW6A 1LDCA 1ONRA 3LRMA 4WY0A 3ZFHA 4E0CA 3SGZA 3N73A 3KRUA 3I65A 2X30A 4JNMA 2QJGA 3W7RA 4LVDA 5EPDA 4NUWA 4JXCA 3W3OA 4GJ1A 5D38A 3NGJA 3HG2A 3W1LA 4JY8A 5DY3A 3CPRA 4O0ZA 4JTSA 4GWEA 4IMDA 2EPHA 1Q6RA 3DENA 5D2YA 3C3NA 3N19B 2DORA 4NNAA 4NJGA 3BV4A 3BLEA 4MKNA 1VPXA 3TU9A 1L2UA 3MHFA 3L21A 3R12A 3SIZA 1KTCA 3FKKA 4LW7A 2ZZ3A 5D37A 1SW7A 4FHAA 3FS2A 4O50A 3QW4B 2QR6A 3OHIA 3QZEA 2HSAA 3LCHA 3W7QA 3QMTA 5AYYA 1FBAA 5G4EA 1XUZA 1T99A 2C15A 4HNTA 4E2BA 5CPNA 3WJSA 5KZEA 3NQGA 3RLUA 2B7QA 1A5AA 1UB3A 2FLIA 2V2HA 4GNJA 4UIOA 4IGHA 5AC6A 2FFCA 3W1AA 4AEOA 3BK0A 2G5WA 4HNNA 5G5IA 3O07A 2JK2A 1JCXA 4UR8A 4UFMA 4XKYA 2ZTKA 2NLIA 5CZJA 4Q33A 4O53A 5DXYA 3DHFA 4UTLA 4UTIA 3F4WA 3TC7A 1MO0A 4FNUA 3EKZA 4OV4A 4ZVJA 3UZJA 2NX1A 3A21A 3NQ8A 3DXIA 2JBMA 3L9CA 4O17A 5J5DA 1S3HA 5KMYA 3D0CA 3JS3A 3MO7A 3HMJG 2Y62A 2DP3A 5LNWA 3EX4A 3FLUA 1RQEA 3KFTA 4MVAA 4FNQA 4FEZA 2CZEA 1MEWA 3EWXA 3GVGA 1GVRA 2CW6A 2NWSA 3S1WA 3NO5A 2YYTA 2YDAA 5CZTA 1TB3A 1I45A 3HG4A 2ZRUA 3QW3A 3W1UA 4RR4A 2CLEA 4JY9A 3LHVA 5DCEA 2VFGA 5FF0A 1FDZA 4JYEA 2ZRXA 5CSRA 1JULA 2OT0A 2Y85A 3LHTA 2DU2A 3W1XA 5LZLA 3LCXA 1TPH1 1KTNA 4DF0A 5HWNA 1VYSX 4M7SA 4WQ6A 4N9EA 3NPWA 4MZ8A 1UBSA 4MIMA 4JTFA 4GBUA 4IPJA 4IMGA 1ICPA 3C2EA 4UMBA 2YXGA 3E96A 3NQFA 3LXCA 5D2WA 1R30A 3BVJA 3F03K 2NX9A 1QCWA 3O8AA 3W1RA 4L4MA 3GDRA 3DFOA 6ALDA 4HPJA 4Z1BA 3JR2A 5L6UA 3UXDA 1H51A 1J4EA 3STEA 4O15A 2Z1BA 2WQPA 3BLFA 1SUXA 1KLYA 3T44A 2C16A 3NPXA 2YX0A 4U28A 2J9YA 4FXSA 5HMSA 3UWVA 3EWBX 5HULA 4CNNA 2XN2A 1SFLA 3QEZA 4HSNA 3B0PA 4UTTA 4AXKA 1KFJA 2QJHA 4NZFA 4B5NA 3L65A 1F74A 3SI9A 1K7EA 1UJPA 2CZDA 2PRMA 5BMWA 2PRHA 1WBHA 2TRSA 5CPOA 3EXSA 1THFD 4IMEA 1H1ZA 1KV5A 5CPMA 1QAPA 4BF9A 3IIPA 1KFKA 5AHEA 4IX2A 4ZQNA 1KFEA 2GJLA 4G1KA 1SZFA 2H6RA 4UTTC 4CNPA 4KFNA 3W1QA 1PVNA 3NPVA 4O1CA 2BZNA 5AYZA 4WX2A 1S5WA 4I9AA 1LOSA 5I3GA 1KFLA 2QAPA 4WOQA 3BW3A 2GJNA 1G6CA 3L0NA 3W72A 4JTLA 1JCMP 3L5MA 1Q45A 3Q94A 2FPVA 2E5CA 1OX4A 2Y7GA 4UR7A 3CB8A 1OG0A 3GAKA 2B7NA 4H3DA 2V2DA 4AWSA 3QMSA 1OFBA 5K2ZA 1CW2A 1FQ0A 2FPTA 2VEPA 3EWWA 2B7OA 5EBUA 2OCZA 4DQWA 1H7OA 1GPWA 3LI0A 1H7RA 5K9XA 2XN1A 1FCBA 4RZ5A 3E12A 4O18A 1PS9A 3S0CA 1VYRA 1ICQA 3I6RA 1KTBA 5FF3A 4Y90A 2A7RA 4IJBA 2YGYA 3MYPA 1NAL1 1SZEA 1LLWA 4O52A 2PC4A 3W9ZA 4LV9A 1AW2A 4ZQMA 4JTUA 3FYPA 1TJPA 2NV1A 5H91A 2HMCA 3B06A 3VKJA 3S1XA 1DBTA 1V7YA 1DJNA 3TC6A 2YSWA 3Q37A 1EB3A 1XI3A 2DZWA 1N55A 1NEYA 5C54A 3TFCA 1KFBA 1ADOA 1X6UA 4R7JA 3CEPA 3LCFA 3PG8A 3YPIA 4D2JA 3LHYA 1XBZA 3M5YA 3W23A 2C3ZA 3TW7A 3S5OA 1ALDA 2YR1A 5ABTA 3FKRA 2AQWA 3TXZA 2E1DA 1DQWA 3MUXA 4IWWA 2NWRA 4MY1A 4O11A 1TREA 3C2RA 3QYQA 4DO4A 3IIXA 1J5TA 1VQTA 6TIMA 3LDVA 1OFAA 1X1OA 4YXGA 5TIMA 4UCGA 4H6KA 3W7PA 4HT3A 3KVLA 4O4VA 5K9DA 4S1FA 1W5OA 1TV7A 4FX8A 1GTEA 4WY0B 4WZHA 3N9SA 2Q3OA 3BGGA 3NM1A 1JUBA 3N2MA 5LNSA 5AHMA 1JR1A 5I3HA 2WNNA 3W76A 3KVKA 3QF0A 4OQVA 1F2JA 1QPNA 1UUMA 3M41A 1RQHA 3NZRA 4QSHA 2VOMA 4X2RA 1FCVA 3W7JA 4NX0A 2E5DA 1GT8A 2V30A 1XBYA 5F1UA 1KM3A 3HB9A 4MZ1A 1TPFA 3HIJA 3LLFA 3TXVA 4TU1A 4LUIA 2W79A 1S5VA 4MJZA 1SO6A 3CLMA 4UFLA 4Y96A 1EWDA 1UUOA 4K6AA 1R46A 5DCBA 3GLCA 3M7WA 3DI0A 4Z1DA 2G96A 2CLHA 4FF7A 2BTMA 1XCFA 1W1ZA 1SQ7A 2Z6IA 1TPC1 1YXCA 1TJRA 5HR7A 2G97A 4NX5A 1G7VA 1Q3NA 3DFQA 3O16A 3C52A 2JKPA 2YYUA 2ZA3A 2I1OA 4FB7A 3INPA 1DORA 4O28A 1LYXA 1VLIA 2C6QA 3GDLA 5LHEA 4JYFA 2VFFA 4K37A 4LUJA 3NZ1A 2CLLA 3O6CA 2BSLA 3VI2A 4QAIA 4M7TA 3TA6A 4UFKA 3UPWA 3A24A 4Z08A 3W2MA 4R53A 4MUZA 2BWGA 3V1PA 1EP1A 1VJIA 1B3OA 3HPXA 4GUIA 5K4ZA 1SSGA 1G4TA 4LRTA 5KTLA 1B57A 1TPDA 1KM6A 3IGUA 2Y70A 4TO8A 3VNDA 1A5SA 3PBUA 3G1XA 1VYPX 3DU0A 3NYZA 1PL9A 1XL9A 3DKLA 3W85A 3PULA 3ZR4A 3ZS4A 4O10A 1HL2A 3DKJA 1XFBA 3E0IA 3DBPA 1QDSA 3LV6A 2HS8A 3BW2A 2VXNA 1A50A 1IXOA 3CIWA 4AAJA 1Z44A 4XBKA 3P82A 2A6LA 8TIMA 3G1SA 2V8ZA 3GR8A 3TR2A 1OFDA 1LBMA 4JN6A 1ICSA 2GPTA 3V75A 2VENA 2CU0A 1JUEA 3PUDA 1EA0A 1PHQA 1KV8A 3PB0A 4XTDA 1SO3A 4NXKA 1E51A 5F2MA 2V5LA 3UNDA 1IF2A 1OFPA 2J9ZA 4LU0A 5C5YA 3SW6A 1NFBA 2ZDRA 3I7RA 3EWUA 2ZRZA 2X1RA 3IGSA 4PEKA 3EXRA 1Q6LA 1TV8A 2X16A 3W1MA 3GZ3A 5DELA 2P10A 3S42A 2GQAA 4KFPA 3S1UA 3G0UA 1NF7A 2A85A 1F05A 2FB2A 1TTJA 1GVSA 1OFOA 1W3TA 4M6QA 2J6XA 3QPZA 1IXPA 1Z42A 1ZCOA 1RR2A 3NXFA 1W3NA 4MOZA 1H61A 1Q6QA 4LNYA 1KM4A 2R91A 4GUFA 3LERA 4BK9A 5IBXA 2EAWA 4FX7A 3FA5A 3G1VA 5AOUA 1Q6OA 2NUYA 2TPSA 3W7LA 4HNVA 3R13A 3DFNA 3UPBA 2B4GA 3UXAA 4RZ6A 4OWGA 5HINA 1G7UA 3LRKA 4JIPA 4WXYA 3WJZA 1YPFA 2YCEA 3ABSA 1KLZA 3LTYA 3T40A 3THAA 1DJQA 4OT7A 3OVQA 1QPQA 3P5ZA 5IBXC 1D3GA 1K7XA 4JDBA 3VE7A 3DFSA 3DAQA 3NL3A 1SSDA 5LSMA 1H5YA 3LHZA 4K8HA 1QMLA 2A5HA 2FIQA 3SFKA 3TIMA 4UMAA 1OX6A 3N3MA 2ZRYA 2J27A 1EPXA 3VE9A 3RF9A 2BXVA 3NL5A 4I7UA 1OFQA 3GXPA 3TSDA 4QITA 1K02A 2ALDA 3P5YA 1TSIA 5CZSA 1OYCA 3MP5A 4OU1A 3G1FA 4AHQA 1VGAA 3OG3A 4LS0A 4RXGA 4DO5A 4K36A 2YFNA 2Y7FA 3GR7A 3EX6A 4PCFA 1C29A 2ISWA 3SGUA 3W6YA 2CLIA 2RDWA 1D3HA 3TQKA 2ATSA 3W7IA 1F76A 4ZQCA 1HO1A 1VLWA 4RV8A 1W8SA 4TMBA 5C55A 1WA3A 1R2SA 5HWMA 4N9BA 4LS2A 1LP6A 5TBOA 3UQNA 2OT1A 4O1BA 4AHOA 3STFA 5CKSA 3M43A 3NNTA 1UASA 1FDJA 1B4KA 1L6WA 1X1ZA 1F6PA 1GG0A 4IQLA 3IRDA 2RDUA 4DF1A 2NUWA 3ATYA 2H8ZA 1IIHA 5BMXA 1BWLA 4UTWC 3MW7A 3BPWA 1KBJA 3P8IA 3L2IA 3W7KA 3MBDA 3S5ZA 1AW1A 3P7YA 1W31A 3W2LA 1MZHA 2JGQA 4BFAA 4X22A 2PCQA 1TPUA 2VC6A 4OV9A 1FCQA 1SW3A 3PB2A 2A4AA 1MXSA 1VHNA 1I2PA 1YYAA 2GQ8A 1GTHA 3HF3A 3BO9A 1ZENA 3UWYA 1ZAIA 3M5VA 4IXXA 1XDMA 1ZHAA 3TUUA 2DJXA 1W5MA 2J24A 2E77A 5KSWA 2CLFA 3HO8A 4LC8A 3M5XA 1FDYA 4A3UA 2C19A 2ZYFA 2UV8G 3B8DA 1AMKA 4CCCA 4S2BA 1OF6A 5LNUA 4LWWA 3W74A 3E9AA 2WNZA 5EYWA 5D2XA 2QCFA 2P1FA 3P8JA 4A2RA 4WD0A 4ORMA 4C1LA 4ICNA 4BR1A 4OHQA 4LY8A 4LRSA 2WSYA 4MY8A 2OMAA 3P84A 1TPWA 3T78A 3MHUA 1ZY9A 1XM3A 1EP3A 5TQLA 2H90A 4PH6A 1JVNA 2TMDA 3UY7A 3CM4A 2GVJA 3W75A 3S9YA 1KW1A 5AHLA 1C8VA 3B03A 3W84A 3NM3A 4JX6A 3TJLA 3UWWA 1QOQA 1LLZA 3H53A 3MWAA 2WKJA 4FNPA 2A21A 4IUOA 5F2IA 1PCWA 2IQTA 3QC3A 1FCUA 3G24A 2WJZA 2V5BA 4NJJA 4O19A 1TTQA 4C1KA 5CG7A 2JKEA 1P0NA 4UMCA 1I2QA 4RXFA 2R14A 3P80A 1PE1A 5FEZA 4JYDA 4A21A 3FOKA 1TO3A 1DQXA 1WYIA 4JTEA 1RD5A 4OGZA 3H54A 3ZWTA 4POCA 1OFRA 1PV8A 2OJPA 2I14A 4ADSA 1AL7A 4CCEA 1W5PA 4NJHA 4K8EA 3C56A 3A23A 4NNCA 1I2OA 1HTIA 5L9FA 4NJKA 2NX3A 5I3KA 3G8RA 4FIQA 3M44A 3QPYA 3N14A 1F5ZA 3K30A 4M6PA 1M7OA 3N2XA 4QM1A 1G4PA 1SR9A 2OX1A 4Z0JA 1X7FA 4DF2A 3G1AA 1QWGA 2QCHA 1XBXA 3SJ3A 3GXNA 4WJEA 5AN7A 1DVJA 1HUVA 2Q8ZA 5HR6A 3EWYA 2AAMA 3BW4A 5F2LA 4OE7A 1FXQA 1VZWA 3LCLA 4ML9A 2GUUA 4PL2A 3C2OA 2A2IA 4NQ1A 1ME9A 4RX0A 4KWWA 3EWZA 4LS1A 1HFBA 3STGA 2Z0IA 2E6DA 1ME8A 4Z0SA 1IXNA 4XUGA 4M5PA 1H62A 3NQ7A 3DH7A 2RKXA 3N9RA 1OVDA 2YZRA 4ZL1A 4GE8A 4ADTA 4RCXA 2ZA2A 1H7XA 3B4UA 1NF0A 3A5FA 3TCEA 3W2UA 2DJLA 4O54A 4UUIA 3PBWA 2W6RA 1R2RA 3PG9A 2EKCA 3MMTA 3W07A 5AFDA 2Y88A 4ALDA 1Z48A 2FB3A 1FXPA 3BLIA 4UFJA 4BI7A 4HPXA 3GNDA 1C9DA 4GXMA 1WV2A 2EF9A 4JX5A 3TH6A 1TV5A 5KZDA 4A29A 3NG3A 4JGDA 1JRCA 3WJYA 1WDWA 1YPIA 1IGSA 3RU6A 1KBIA 4HIBA 4HKPA 5T26A 5I3FA 5G1TA 3B0VC 1M5WA 5D04C 5J5RA 4AVFA 3THQA 4AF0B 4LVBA 2QUTA 1VS1A 4X3ZA 3MBFA 4N6EA 4MLRA 1W5QA 2VFEA 3S6DA 3LXBA 2I9EA 4GUHA 3MI2A 3C61A 4IXHA 2Z2UA 1I2RA 3ELFA 1OF8A 1TRIA 1TRDA 3PR2A 5DN1A 1DHPA 3WFAA 2H8XA 2DZPA 4GRSA 3LBMA 4Q4KA 3HGSA 3GKFA 1ZAJA 4AHPA 3QJAA 2TSYA 3KRSA 4DXVA 3CQ0A 5FESA 1N7KA 3PS7A 4HN4A 1ZFJA 1GEQA 1AW5A 4M6VA 4UFIA 2CLOA 4MZYA 3GAYA 3JRKA 2B0MA 2Y63A 1VCVA 2Y61A 3QSTA 2YW3A 1I4NA 4WXZA 3PVFA 1WOBA 2ZCGA 5FEXA 1F6KA 4NZJA 4BI5A 2O7QA 3GDTA 3M47A 3W7MA 4GFSA 2QCNA 2WSQA 1FWNA 1Y0EA 4LTSA 5EKYA 1RVGA 3P61A 4H4IA 3HG5A 3CEUA 3L66A 4N9DA 1X8FA 3AO0A 3U6WA 3IGXA 5G2IA 1H60A 4EOUA 5D2VA 5KZMA 4X9SA 2ABBA 4HSOA 4ADUA 1FY6A 4RZ4A 3L0KA 4JTIA 4HNUA 2A7PA 1T8XA 4QNEA 4MJMA 2WOQA 4O57A 4YWIA 4UTKA 2QJIA 4YCOA 2NXHA 3HOJA 3W7HA 5FF2A 3GB6A 4IMCA 3QFEA 4UXDA 1F73A 4JTKA 1DOSA 3DZ1A 3ZWSA 2AGKA 1ZALA 3KAOA 4LV4A 4TR9A 5BOOA 4XKYB 3S1VA 1H50A 4N02A 4NXSA 1JCNA 4DBDA 3U8GA 3W83A 2E68A 3MYOA 3MI6A 3NQCA 2KZHA 5HQEA 2ZTJA 2DZSA 1QFEA 2QEZA 1YXDA 3O1NA 1ML1A 3QSRA 1GOXA 1FWWA 4NVTA 1PCKA 3W7DA 3UWZA 3GYEA 4QJ1A 3PUEA 1EX5A 4JD4A 4CQAA 4Q32A 3G1HA 1KM2A 4EF9A 4J9JA 1VRDA 2VELA 4CNOA 1FUYA 2JGYA 5E1QA 3NQ6A 3M6YA 2TYSA 3LGEA 1LOLA 2QF7A 4CLMA 3G3DA 3QQ1A 1QPOA 2NXGA 3CWOX 1LBLA 4JIQA 3EEGA 3B0UX 3I7SA 1M6JA 3R5EA 3LV5A 2CLMA 3LRLA 3NOEA 4K7VA 3O05A 2X1UA 2VKZG 1QO5A 1YDNA 4AWTA 3CIXA 1OX5A 2C1HA 2FDSA 4R33A 2E6AA 4FNSA 3HGJA 5E0KA 3RNDA 4PA8A 4NNBA 1AK5A 1O4UA 4UNLA 3M1ZA 1MSSA 3NQDA 2D73A 2ZA1A 3W7EA 1EWEA 4RLIA 2DZXA 3B04A 3R89A 3ATZA 1P1XA 3TX9A 2ZZ1A 4IOTA 2G95A 1SFJA 3W22A 1HG3A 3PC0A 2J9XA 5F4SA 5G2WA 2F7FA 1ZJIA 1VCGA 1OJXA 2ZQ0A 4MFEA 3G18A 2ZZ5A 3DFPA 3CC1A 3TSBA 3C2FA 1OYAA 1SW0A 3OVPA 2CFFA 4QIUA 3O63A 4JX4A 5LGZA 2V0TA 1JCYA 1IXQA 5C6MA 4FIRA 5K4XA 2QUVA 4PC8A 3PSWA 3SSJA 5AHFA 4JTTA 5G4WA 3W2KA 1H63A 3T4CA 5K9CA 3EX1A 4LC6A 3OEXA 3W88A 3BG5A 2E6FA 5EMUA 3QH2A 4EIVA 5DLCA 1OYBA 3FEMA 5F1VA 2ATMA 4GUJA 3W1NA 4Z1CA 4UTUA 3I7QA 2NXIA 2GVGA 4BWLA 3IIZA 4HHPA 1GWJA 1YTDA 3CU2A 5CSSA 3ANYA 2RH9A 3E02A 3GXTA 2CWNA 1TPVA 5DBUA 1JRBA 3CTLA 2VEIA 2RDTA 3FFSA 1OHLA 4CQ8A 4ONVA 3LM7A 2WNQA 2Q3RA 4UTWA 5LNVA 1GZGA 3TMLA 3HGOA 1GQNA 5FF7A 3OVRA 4BWLC 3QM3A 3Q2DA 2QUUA 4UNKA 4GUGA 1OX4B 1FWRA 3F4NA 1HO4A 1YXYA 1A5BA 5F2GA 1GVFA 4FNTA 3L5LA 1EEPA 2H3BA 1LZOA 3UD6A 3TJXA 2H3DA 1KM1A 1QPRA 2CLKA 1J2WA 3M0ZA 3UZ5A 4KFOA 3LCIA 4UTMA 5AHNA 4PFMA 3M16A 1A5CA 3KVJA 1TQXA 3PUOA 2WO5A 1OABA 1R47A 2V82A 3A5VA 4GC4A 3CT7A 2YFOA 4NT0A 3BGJA 5HUOA 3HPSA 3IVUA 4WUIA 1FWTA 2GOUA 3L0GA 3AJXA 1SZNA 1U83A 5D33A 1LCOA 3FJLA 4O13A 3OA3A 5EA9A 3G0SA 4KWVA 1SU5A 3SY5A 4JTHA 2DZTA 2QKFA 1YDVA 3IIVA 3PWAA 1W0MA 4NU7A 2CZ5A 1L6SA 3WK3A 1VC4A 3NQ2A 4JDYA 4AWUA 4DPPA 1KFCA 1GVOA 1YLVA 5D32A 1YTKA 4DBEA 5DXXA 3WJWA 4TX9A 1G4SA 1TIMA 2Y7DA 4FO4A 4MPQA 1SO4A 4PL1A 3KOFA 3TDFA 1LOQA 3PSVA 3G22A 1G67A 1QNVA 1M7PA 4L4LA 1WXJA 5DY2A 3TSMA 2C14A 4CQ9A 2QCCA 3KHJA 5AC8A 1OFEA 3NVTA 1K8ZA 1H7PA 3W70A 2BX7A 2QCDA 3TAKA 4Y8FA 1TQJA 1P5BA 4MYXA 4Y9AA 1W37A 4XZ9A 5K3VA 2VFIA 1JQVA 3NQEA 1DL3A 3L68A 1LRTA 3F1QA 1S5TA 4LVAA 3G1DA 1BEUA 3UWUA 4DPQA 3EB2A 4O8RA 4JR5A 3PBVA 1KA9F 3S5YA 3W71A 4WOZA 2ABAA 5D03A 1R2TA 4FX6M 4XTIA 1RQBA 1K8XA 3NQMA 5LHFA 1I2NA 1VHCA 5A5WA 2YW4A 4DELA 3A22A 3NA8A 3ABOA 1EP2A 1T96A 2Y7EA 2BLEA 4LVGA 1P0KA 1N8FA 2A0NA 4A2SA 3M9YA 3C6CA 4MLJA 1JJKA 1PHWA 1Z41A 2JKAA 5KINA 3NQVA 3I68A 3LX9A 3FJ6A 2A1YA 3WK2A 1H1YA 3IIOA 1L9WA 3CWNA 2ZRVA 1BKSA 2WPBA 2Y6ZA 1RV8A 5SWUA 4RK8A 3UWQA 4FNRA 5F4WA 3EXTA 3SZ8A 2QDHA 2E5BA 3LOTA 5IM51 1PIIA 1GJPA 3MHGA 5KITA 3R2GA 4JTGA 3O6DA 1MEHA 4O12A 2YPIA 4MYAA 1K8YA 4O4WA 3S5NA 5MHBA 3W2NA 3R8RA 2VFDA 2VFHA 3EKLA 2X1TA 5G1YA 2V81A 2ZZ4A 3W7OA 3LCGA 3DHDA 3T7VA 1LRNA 4Z1AA 2O7SA 2A6NA 5CZ0A 5GVJA 1NVMA 2ZZ6A 3NL2A 3GKAA 4AMAA 4N6FA 3TMQA 1VR6A 2ZRWA 1LBFA 2E09A 3NR0A 3OIXA 4P61A 3LI1A 2QDGA 1B9BA 4QISA 3P60A 1TMHA 2QCEA 1T0OA 5D09A 4UTHA 5CPLA 4O1AA 3P74A 4DEFA 3DI1A 2W0UA 4LVFA 5AC7A 3LTPA 4UFHA 3USBA 2PE4A 3W7GA 1H7NA 2Q8LA 3LBCA 5FF4A 3W1TA 1W54A 1O94A 2XN0A 2ZFAA 3PM6A 2X2GA 5CGQA 1TCDA 5U4NA 1W56A 1WOAA 3NPUA 2ISVA 2V2CA 5F4XA 1O5KA 4YL2A 3LCWA 3MJYA 3QQ0A 4XWUA 1A53A 3L5AA 4BI6A 4IPIA 1WX0A 3Q58A 2X1SA 2Y89A 3P81A 2GQ9A 1VCFA 4ZQPA 5EL1A 3C4UA 5HJLA 3WK1A 1AL8A 2LLEA 1XDLA 4JEQA 4ORIA 3TNOA 1G69A 3W7CA 2QCGA 5DBTA 1SO5A 1WAUA 5E93A 3PF3A 5FEPA 3MI3A 1P4CA 3O06A 2PURA 2HS6A 1LM1A 5DCDA 1LORA 3T55A 5D30A 1ZNNA 4O1DA 1D9EA 4N4PA 3GK0A 1FX6A 2DZVA 1YDOA 4EVZA 4ZMGA 4MFDA 4S2CA 4KKXA 5LKYA 1LROA 4ZZ9A 5AHIA 2RHGA 4MY9A 4AB4A 1O95A 1W5NA 3L67A 2NZLA 2ZZ2A 1NSJA 2V9DA 1SPQA 3KRZA 5AB3A 1F7BA 3TAOA 5G2HA 1JCJA 2C13A 2WSRA 5HNRA 3HQ1A 4I7VA 4XBSA 2C18A 1QOPA 1EIXA 4WY0F 1BWKA 4LT9A 4A22A 2GVLA 4N2YA 2F84A 1UCWA 4Y6GA 5D2TA 3TQ0A 3TFXA 4IMFA 3HJZA 3LXAA 1JQXA 2J88A 3W7NA 2A7NA 2P0OA 2ZZ7A 3HBLA 4K7YA 5HUPA 4JS3A 5I3IA 2E6YA 4E2DA 2R94A 3G3MA 3TQVA 2EHHA 1O60A 3GX9A 1XKYA 5FI8A 1XXXA 1ME7A 3W2JA 4UC5A 3MP3A 4NJIA 4YLWA 3QMRA 3BARA 3NEVA 3W87A 3HGRA 1TTIA 3OBKA 1OK6A 4JICA 3NAVA 3HG3A 2VEKA 3H55A 5A8GA 3VFLA 1MEIA 3IVSA 4JTJA 5HWJA 2FTPA 3G1YA 3LLDA 2WV8A
chains in the Genus database with same CATH superfamily
4AZ6A 2F6UA 4OUIA 2BOEX 3AMCA 1XIHA 3AOFA 3LG3A 1UH2A 3HPZA 4JTCA 1DHKA 4EF8A 3VINA 3KCLA 1TFVA 1UKOA 4P7OA 3S8HA 1JZ6A 1MUWA 4HCDA 4ZQOA 1LRQA 2O4QA 5JQ9A 3VGDA 1HNYA 4H41A 4H1ZA 1ZAHA 1G4EA 2GDQA 2BOFX 2ZOXA 1EUNA 4LOCA 4A4AA 3A3HA 4E38A 1WBJA 4K39A 3PBYA 1K7FA 1Q85A 5FJPA 3QYSA 3LB0A 3IEBA 1KGWA 3NL6A 5EY5A 3TTQA 2Z6JA 2WC4A 5BNKA 3FY1A 4RJEA 3VCRA 3KTCA 3C8FA 3KCOA 2PAJA 3WJXA 3SQMA 3BL3A 1M1BA 1E4IA 3ITYA 1UG6A 3F5KA 3M64A 1XF0A 3PY2A 1ZPTA 4Q8TA 1BTMA 3GNNA 3TK7A 4ZQRA 1W1TA 2BVDA 1ESWA 3NYDA 3SRDA 1ITXA 3O15A 3CV7A 3IK2A 2I16A 5B7YA 1TPB1 1AG1O 1XYCA 3PFMA 1XRVA 4GVHA 1OCNA 4YCPA 3WUEA 2VRJA 5E70A 1P6WA 2OELA 4IGMA 4D1IA 3TROA 1UKQA 1QVBA 3LHUA 1XP3A 1LTDA 2FHFA 3UYCA 3RAOA 4IG2A 2E1WA 3T0DA 5D02A 4XQ6A 3GNOA 5AYXA 1IEXA 3G8EA 1HN1A 3KBJA 2P3ZA 4AH7A 2EJAA 4EWND 4B9ZA 3KXQA 5REQA 2GL5A 3SQSA 5ABEA 1OIFA 4M19A 1PIFA 3U7BA 2X2YA 4UTJA 1E1EA 4Y9NA 3ABRA 1TWIA 4LYQA 3I65A 3L4VA 2PWFA 2X30A 4JNMA 3W7RA 4LVDA 4HU4A 2YA2A 5I00A 3HG2A 4JHMA 3W1LA 4ZTYA 5HATA 5DY3A 2INFA 4UQBA 4L9ZA 1QI4A 3C0QA 3CIVA 5D2YA 4YPJA 3C3NA 3BLEA 2PDLA 3RPTA 4P8WA 3CUIA 2RGMA 5E5CA 5D37A 2YL9A 4C6CA 1SW7A 2ADAA 1QI3A 3OHIA 3U5YA 2HSAA 3QXBA 4BY3A 1XX1A 1FBAA 4G7EB 3M0LA 1T99A 3EBVA 3WLHA 2PP3A 4DI8A 4GQBA 3W28A 5D8WA 2PU0A 2V2HA 4GNJA 3VMNA 3N6JA 1HGYA 2GLKA 3VCCA 5EGRA 3K1GA 2ZTKA 4MWAB 2NLIA 5FAJA 4O53A 3TC7A 4ROPA 1PX4A 3GXIA 2BODX 3U2ZA 5JBEA 3DXIA 5J5DA 1S3HA 5KMYA 2YA1A 2IUZA 1WXYA 1BHGA 2DP3A 3EX4A 3FAXA 2DH3A 4JBRA 2D0FA 1VFMA 1B3YA 3H21A 3W27A 3ABZA 3DEQA 3AIBA 2NWSA 3S1WA 4ZOAA 3BDKA 2YYTA 1W32A 4ECLA 4AD0A 3HG4A 2ZRUA 4U31A 3W1UA 1Q65A 1QRQA 2J8TA 3LHVA 3A3XA 5DCEA 4JYEA 3WNNA 1J12A 3ERPA 1JULA 2OT0A 2Y85A 3U2CA 4JNZA 2QS8A 1EXBA 3VNIA 2E25A 3ZLFA 5LZLA 3LCXA 1TPH1 2Y8VA 4WQ6A 3NPWA 4MZ8A 4WIWA 1P0DA 1QT1A 1BYCA 4B9YA 4ICMA 3NQFA 2VR2A 5D2WA 3F03K 2NX9A 1R3WA 4N0RA 4L4MA 3GDRA 4XB3A 3KP0A 3DFOA 4HTBA 3OYZA 3RCYA 3BAYA 1OGSA 4GZJA 1FHLA 3UXDA 1J4EA 4O15A 3BLFA 2WQPA 1ISZA 1KLYA 4FOJA 2F9RA 4LPCA 1T41A 2FHCA 1XLCA 4LEFA 3UG4A 4AZCB 2I5QA 3WQ6A 2CBJA 1U2YA 2OVLA 2XVGA 1MDRA 5HMSA 1UP3A 2WQDA 4QRNA 1A0DA 3VCNA 4CNNA 3QEZA 3B0PA 4AXKA 3TN6A 4B5NA 1HJQA 4HA4A 3K5XA 2CZDA 1JG9A 3IWPA 4RL3A 5CPOA 4ACYA 1PYFA 4IMEA 3VNMA 1QAPA 3EZ4A 4BF9A 2UY3A 4E5TA 1B3VA 4B92A 2Z27A 3M0IA 4IL2A 4REQB 3WDPP 2GJLA 4G1KA 4DRSA 3ITXA 3FVDA 2BZNA 1T40A 2V5CA 2Z1KA 2QAPA 4WOQA 3BW3A 2G37A 1RBOB 1XKJA 3CHEA 4JTLA 3L5MA 1Q45A 4UBPC 4BF5A 1GKPA 4R88A 3CB8A 1ELSA 2WPGA 1OCBA 4AWSA 3E3HA 4UB9A 4CKQA 2J7GA 1DIOA 4PEEA 3WBWA 1RCQA 5K2ZA 1FQ0A 5D4YA 4E8DA 2NSXA 3AU2A 3RRXA 4DQWA 4HVXA 2VEFA 4A8NA 4LBUA 1FCBA 3S0CA 1RBLA 2PODA 1D8WA 3FYYA 4PRRA 2X05A 5FF3A 3MYPA 2XH7A 1JPMA 3M0MA 2CZVA 2DSVA 1CGWA 4ERIA 1AW2A 2J79A 2NV1A 2E28A 4CUCA 2I7GA 1BRLB 1DBTA 3NZQA 5D9NA 3HV8A 2DUZA 3AI0A 1K4GA 1IEWA 2XVLA 1DE5A 3T8QA 4D2JA 1XBZA 4HNLA 1AUSL 1Q6GA 3N17A 3AYVA 3TXZA 4A8LA 1A5LC 4BZYA 2Q6ZA 2WYSA 3FK4A 4MY1A 4O11A 1RPKA 3C2RA 3UR8A 1E1CA 1KD0A 4U5IA 1VQTA 6TIMA 2X0HA 3LDVA 1OFAA 3VUSA 4YXGA 4H6KA 1NFPA 3KVLA 1JNEA 4S1FA 1W5OA 5C9ZA 1GTEA 3QZAA 1JUBA 3N2MA 5LNSA 3K4DA 4GCXA 1JR1A 3KOXA 3CQIA 1UUMA 3M41A 1VBGA 2ZVRA 3APTA 3SCRA 4M6UA 4A05A 1XBYA 4GK8A 3I3DA 3R0DA 5F1UA 1AD1A 4MZ1A 2PDBA 1EF3A 1FWAC 1TPFA 4ERAA 3LLFA 1E9IA 4TU1A 3WG6A 3RIKA 2W79A 4GQRA 4MJZA 1SO6A 2PP1A 1XIDA 4PMUA 2DIJA 3L4YA 1EWDA 7XIMA 1R46A 3DI0A 4Z1DA 3VOJA 3TOPA 1XCFA 3AALA 4B15A 1JAEA 1SQ7A 2Z6IA 4NX5A 1EO5A 1GNXA 4F3HA 2V3EA 2JKPA 5XIAA 4W8AA 4C65A 3INPA 4WGXA 3V0UA 4UQ9A 2C6QA 3M07A 3LPFA 3MA8A 2VFFA 1KC7A 1V6UA 3VI2A 2NQ9A 2FVKA 1WDPA 4GOAA 4UFKA 1ZJAA 3A24A 1KBBA 1A5KC 4MUZA 3JVAA 3LK6A 1B3OA 4NASA 4GUIA 5K4ZA 1SSGA 2WC3A 3K1DA 5AC4A 4NRSA 1B57A 3S6TA 2Y70A 4TO8A 3VNDA 4AX7A 1VYPX 2XGIA 1PL9A 3GW0A 1AA1B 3DKLA 3PULA 3ZS4A 4H04A 4DUOA 4ATDA 3UWEA 2HK1A 3LV6A 1LUCA 3BW2A 1E6SM 4XBKA 2BFGA 3GR8A 2GPTA 4GI9A 2C71A 3V75A 3ZLGA 2VENA 4D8AA 3DG7A 1OZQA 1SO3A 5LA0A 1E6RA 2V5LA 2HE5A 2WZIA 6A3HA 1A5MC 1US3A 1MUMA 3I7RA 3W1MA 4QAWA 1X38A 1E72M 2Q02A 5BYWA 1NF7A 2A85A 1F05A 4M6QA 3QPZA 1W3NA 1FKWA 1H61A 3F5JA 3VU2A 4D6HA 4GUFA 4C6JA 4CN1A 1XJBA 1PTAA 3VDHA 2ZICA 1TZ7A 3FA5A 4CD6A 2NUYA 4AQLA 3PNZA 2F8QA 3UPBA 4Q8QA 3RYSA 4RZ6A 4WXYA 4C5YA 1DXEA 4AC1X 4XSLA 4LF1A 1JYXA 5JIWA 1QUMA 3DAQA 1F4AA 2PTDA 2HRWA 1OT2A 2A5HA 3GRIA 1LL7A 2ICSA 3CZ8A 5MKGA 2FIQA 3ZQ9A 4UMAA 2ZRYA 4NZ3A 3EWCA 4I7UA 4J7RA 1JYWA 3CZLA 4C6NA 1PB0A 3TSDA 3OGSA 3GTIA 5CZSA 3MP5A 4IFKA 2IPFA 5HMEA 3OG3A 4K36A 1REQB 3GR7A 3GVVA 4PCFA 4ZTXA 5AVHA 4H9ZA 1CCWB 2CLIA 4IP5A 3LGDA 3TQKA 1IT7A 4QBXA 1W1VA 1VLWA 2ASHA 1W8SA 4TMBA 2OYMA 3EYPA 5C55A 1GORA 5HWMA 4I6VA 4GIRA 1UASA 1C8XA 4GMEA 1B4KA 4PZVA 1L6WA 2QMJA 3PZGA 4S3DA 1W1PA 1WO2A 2H8ZA 3IJDA 1IIHA 4R9OA 1ENUA 3MW7A 3BPWA 1KBJA 3P8IA 3UZZA 3S5ZA 2BGNE 3GY1A 3U4FA 1SFTA 3IK4A 1W31A 4PRWA 5FAGA 1KQZA 1BF6A 2YCLB 1AQFA 1C7SA 1TPUA 4GJJA 4OV9A 3KP1A 3VNLA 1PKMA 4HQVA 4D9PA 1I2PA 1HT6A 3IJLA 2NT0A 1ZENA 1ZAIA 1TWDA 2OLAA 2EXOA 2DJXA 2E77A 2CLFA 4B90A 3M5XA 4A3UA 3OLGA 4ENLA 2C19A 3E2SA 2UV8G 3TYAA 4S2BA 2PC8A 2R1MA 4L4OA 1X1NA 5LNUA 4LWWA 3AS0A 1Q6FA 1W2PA 1X8CA 4DZAA 4WD0A 4AW7A 4UZSA 4ORMA 2CIPA 2OSYA 4C1LA 4XG1A 3AYTA 2E8YA 4AU0A 4MY8A 4OOZA 4XD5A 1TZZA 1CXIA 1ZY9A 1DWHM 1XM3A 2XYLA 4GCAA 2TMDA 3SN1A 4PSRA 2Y4SA 3GC2A 2WANA 2OEJA 1DIEA 3S9YA 5AHLA 3NM3A 1JF6A 3H2MA 3W38A 4BKNA 1V08A 3UWWA 1YEYA 3LQLA 1R3YA 1O6IA 1QOQA 1LLZA 2WKJA 3MB9A 4DWSD 3N2TA 2IQTA 2VC7A 2XG9A 2AL1A 4C1KA 1V02E 2PP0A 5HMFA 3GO2A 4RXFA 1XCXA 1FH7A 2V6AA 4WSJA 4A21A 1PKYA 4M82A 3WLNA 1DQXA 1RD5A 4OGZA 2BBFA 5T9BG 3ZWTA 1W17A 2V5KA 1OFRA 3AMKA 4QCEA 2I14A 2V38A 4CCEA 1WZAA 2D24A 3AZRA 3O3RA 4PTDA 4AIBA 3IUHA 2XDFA 3FEQA 1I2OA 4NJKA 1JDAA 2QV5A 4BEUA 3QVQA 3MMUA 3WQGA 4JQ2A 1BVNP 3N2XA 1UMLA 2E9LA 4MWAE 3WNOA 3WF4A 1QWGA 1XBXA 3SJ3A 4ZFCA 1HQTA 2ZX8A 3IARA 2YDSA 1VZWA 1XYBA 2ZKMX 4K2SA 4NQ1A 4C6IA 3OU8A 2JE8A 2VX6A 3EWZA 2I5GA 4IIEA 4B5UA 3UESA 1M7XA 3AJ7A 4JFSA 3SSZA 2IW0A 3RM9A 1I1WA 2Z24A 1ZP4A 4YVVA 3DH7A 2PWEA 3N9RA 2UY5A 4X61A 2YZRA 3E38A 5M17A 4ADTA 2ZA2A 4PCNA 1FKXA 4HYWA 3N11A 1FWDC 4BHYA 2W6RA 4RE3A 5I77A 4WDTA 4H7VA 2FB3A 1FXPA 3QR1A 2PF0A 4HPXA 3HM7A 1BD0A 1P6BA 4HK6A 2Q01A 5E0FA 1VEMA 4IQDA 3KLKA 2J66A 1JRCA 1W6TA 3M0KA 3WJYA 2W9MA 1BQCA 1YPIA 4HKPA 3CQJA 3WD3A 4JKLA 4EPBC 3SUTA 1WP6A 4LVBA 2QUTA 1VS1A 4PUWA 3S6DA 2WKLA 3LXBA 4GUHA 3C61A 4IXHA 1WZMA 2Z2UA 1I2RA 3HV9A 3OBEA 4OJYA 3PR2A 2VZVA 5DN1A 4RPPA 3WFAA 2DUAA 3QGAC 3FGCB 4I9TA 3CV1A 4G6CA 3BCDA 3LBMA 2PGWA 4Q4KA 3R11A 1JGIA 3KRSA 3OPSA 1E9YB 2PU1A 2FGBA 4JQ1A 3WNPA 1C3FA 1H49A 2YXOA 4PUEA 1H1NA 3LMYA 1I4NA 4H8VA 4WXZA 1E43A 3PVFA 2WVTA 5HQLA 1WOBA 5A8NA 1FWNA 1RVGA 3BLKA 3LPGA 4OBSA 2XFYA 3U6WA 3TTOA 2O9PA 1AQHA 3IGXA 5G2IA 4EOUA 2P8BA 4ADUA 2JALA 2WSPA 3I6TA 3L0KA 4QS5A 3OLIA 5M5DA 2A7PA 1T8XA 4GY0A 2QXWA 2QJIA 1OGBA 4YCOA 2VR5A 1BVZA 3HOJA 5FF2A 3GB6A 1YE4A 1YBQB 4JTKA 1CLVA 2AGKA 3DGBA 1Q7ZA 1XIIA 4ZE5A 4GYPA 5BOOA 4XKYB 1EQCA 2P88A 2XSAA 1JCNA 1FWGC 2BG5A 4D6CA 2C1IA 4W93A 5HQEA 3S9IA 2P53A 3O1NA 3QSRA 1OINA 2DSUA 1XCWA 2IXUA 1PCKA 1F9CA 4QJ1A 1EX5A 1R9YA 4CQAA 5CXPA 1HF6A 1J2BA 1R0MA 2AKMA 4HCHA 4ACZB 4JN8A 3WFLA 2PD9A 4L1GA 4QDPA 1NDYA 3FHQA 5C70A 3V5FA 3PZNA 4KRZA 1GVIA 4K68A 3LGEA 1Q7MA 1RP8A 5LIYX 4LUTA 3VUPA 3ANUA 1QPOA 2NXGA 3CWOX 3P0WA 3I7SA 3F2BA 3PZOA 1SMAA 3O05A 4B5XA 2VKZG 4C6BA 1B3WA 3QOMA 4PMOA 3W4RA 4FK9A 2FDSA 4PRTA 3TZFA 2PDQA 4FNSA 3HGJA 3RNDA 5ABGA 4PA8A 3VX1A 5C9XA 1JL8A 1MSSA 3THCA 3NQDA 2D73A 2ZA1A 3AS2A 4RLIA 1M65A 1VBHA 3GDBA 3QV8A 3R89A 4ZB5A 1Q6DA 4IOTA 2G95A 5B80A 3W22A 3AWOA 3UG3A 5I79A 2ZZ5A 4IIHA 1TVLA 3ZO9A 4MHBA 4ROQA 4QIUA 3O63A 2V0TA 3HJEA 3VGFA 1UHVA 4FIRA 2WMKA 5AHFA 4JTTA 3A4JA 1E6XM 2ZUVA 4RV3A 4GINA 2WM0A 3UFYA 3W88A 3LBOA 4YHEA 5EMUA 3FEMA 4PMXA 4S3JA 4GUJA 2CBVA 4Z1CA 3R0KA 1ZQ5A 3BMWA 1QTWA 4QCFA 4B4HA 1P7TA 3GU2A 2J7HA 3GXTA 1GVYA 1IHIA 1MRAA 4UTWA 5LNVA 1KCLA 4GBDA 2YCJA 8A3HA 5FF7A 4ICCX 1EJWC 5D9PA 2DUXA 4I9JA 1RUSA 3QZ6A 4DUWA 5A2AA 5G1MA 3F4NA 2C0HA 3H24A 4GZ7A 4BQ2A 1XIMA 4FNTA 3BH4A 1LZOA 2H9AB 1IZKA 1CGVA 1E40A 4KFOA 3TTEA 2PS2A 4G1NA 1GONA 1OABA 4GC4A 3PANA 4HGXA 2YFOA 5DMLA 5KZ6A 3HPSA 3IVUA 3AWNA 3VIGA 5D33A 5AVNA 4O13A 3B3DA 2WMFA 3OA3A 4NI3A 4F0RA 3WQCA 1SU5A 4JTHA 4B4FA 1NQ6A 1ZBKA 5EMMA 1Q2RA 3S2CA 4GO9A 3WH8A 2CZ5A 1L6SA 1MW1A 1VC4A 3U2EA 4CEUC 1FTXA 2WHMA 3DN5A 4KRUA 4C7DA 5DXXA 4TX9A 1TIMA 1Q8JA 4FSAA 1O1ZA 1Z8AA 4PL1A 3NCOA 4M80A 2AQOA 2VGGA 4PUMA 3EPOA 1ONXA 3T2QA 3PSVA 1QNVA 1M7PA 3O2LA 3PJXA 2TAAA 3TSMA 1DEDA 2C14A 4CQ9A 1OFEA 4LUYA 4DYKA 1NFGA 2L5HA 2WLZA 3W70A 4MYXA 5K3VA 3PZQA 2HNHA 3WFZA 1TR9A 3UCDA 5FJRA 3G1DA 2QZRA 1O5QA 4X63A 4QG9A 5IDIA 4UOZA 4MAVA 3W71A 4W86A 1K77A 1UQZA 3TLLA 4XTIA 1L2QA 1MVYA 2VEGA 1GQJA 1EP2A 1V4YA 4ILSA 2BLEA 3NWRA 4JEJA 4MDPA 2FGLA 3LPPA 1X7IA 2X40A 2JKAA 3UGVA 3WQFA 3LX9A 2A1YA 3CAQA 3IIOA 1L9WA 4YTRA 2WPBA 2Y6ZA 1RV8A 2BY0A 4FNRA 3GHTA 4KGLA 2XIIA 3GG0A 1MQPA 3QBUA 2MNRA 1U30A 4KCTA 3M0VA 3PZTA 2A3LA 1MEHA 1S5NA 3MUCA 1F3TA 4MYAA 3APYA 2XJ7A 3W2NA 4QJ4B 4KEVA 3R4IA 1ZB5A 5LXXA 4YIWA 2V81A 3CLWA 3DHDA 4XIMA 3UG8A 3QC0A 3VNKA 1F07A 1LRNA 3HU7A 1WB0A 1NVMA 4ZO9A 2VD9A 5C9WA 4N6FA 3TMQA 1E1FA 1WNOA 3OIXA 2ZUSA 1ITQA 2YBTA 4KCVA 1E4MM 1TX2A 2UZ9A 1T0OA 2ZXAA 3W0KA 4AISA 1WKYA 3DI1A 3DC8A 4LVFA 3HZ3A 3LTPA 4L6HA 3N4EA 3K4WA 1VIWA 3PJWA 3T09A 3W7GA 2O4MA 1O94A 2ZFAA 3PM6A 2WWCA 2OZTA 1BSLA 1BXNA 2WMHA 3QLDA 3O7UA 2XWEA 2V2CA 2G8ZA 1O5KA 3DYMA 1A3HA 1FVPA 1RA0A 2NQLA 4IPIA 4GACA 3N13A 1R85A 4QDWA 3V1HA 2GQ9A 5EL1A 4AY8A 2LLEA 4DO7A 1M03A 1FWEC 1EFZA 4HU3A 4PGLA 1FFQA 1G69A 2D1ZA 3FXGA 4ES4A 3GG8A 5E93A 2GSEA 3O06A 4W87A 3WD2A 2OTDA 1GEHA 3DYOA 3F5LA 1M7JA 4O1DA 1S46A 5AZ0A 1VKFA 2ALRA 3GNRA 4IT1A 4X60A 4ZMGA 2O9TA 4PCPA 1BG4A 2WC7A 3EPNA 4S3GA 4ZZ9A 2RHGA 4MY9A 4AB4A 4D6JA 1O95A 1W5NA 2CYGA 1KO0A 2NZLA 2ZZ2A 4RDVA 2J13A 3UT0A 4HK5A 4C7GA 1CBGA 4CNSA 2Z1SA 4FP1A 2EJ1A 4IIBA 4Z1YA 5HNRA 3RM8A 4RZBA 3ZOAA 3TCSA 3E2VA 3V18A 4CVUA 4PMDA 4OOUA 1BWKA 5DEZA 3VD9A 1M68A 1XRFA 1TE1A 1OY0A 4N2YA 5A8OA 4XVEA 5J8LA 3FXYA 4GX9A 4WVXA 3WF2A 4ZXOA 3LUTA 3W7NA 1NELA 4M56A 2A7NA 1S5MA 5I6SA 1IEIA 4BF7A 1W9PA 2HEJA 2E6YA 2DVUA 2Z4GA 3KOYA 3G3MA 3TQVA 3KBVA 4P7RA 3GX9A 1O66A 1W9VA 1XKYA 3CHCA 3VMPA 1ME7A 1XWYA 4LAKA 4LAMA 4NJIA 4AZCA 1DWAM 1L6GA 3PBGA 4YLWA 4M0XA 1N82A 1DJHA 3W87A 3QKZA 3HGRA 1TTIA 4YU1A 7PTDA 1SYTA 5CC7A 3MANA 4FAMA 2F61A 5A8GA 4MUPA 3MT1A 4IL0A 2W92A 4CU6A 5A6BA 3FX4A 4W7VA 5HWJA 3G1YA 3GUGA 1I75A 4AFYA 3FYOA 2CESA 5C9UA 3G0XA 1GG1A 3LHWA 5T8GA 3VGHA 1GVQA 4TX6A 1VP5A 1QNRA 2EGZA 2WMIA 2OU4A 4YS1A 2RJGA 3JW7A 3CL8A 3NVDA 4GISA 2BNJA 3BSGA 1E73M 1GHRA 1CX9A 3GIYA 1KBLA 4O14A 5LNRA 5BRBA 1W1IE 2PWUA 3L4UA 4KMQA 3SCQA 1Z32X 3TKFA 2PDPA 2AMGA 2PDUA 3F4DA 1GQLA 2WK2A 1YTEA 4U2ZA 3LD5A 5C7HA 3NQAA 3CMFA 3GTNA 2OWCA 2PTYA 4DBUA 1SVDA 5E9XA 2NV2A 3P67A 4CCZA 4TXEA 2QAFA 2HDJA 1EYEA 3GR4A 3DFTA 2QDEA 2GK1B 2PRLA 1Z9AA 4FLOA 2QV4A 2R8WA 2QCDB 2ON3A 4NAEB 2DZUA 1JCLA 1GOQA 4O0KA 3DIPA 3R1ZA 5U7SA 3SECA 2QVHA 4Z2HA 1XLGA 4ZOCA 3M5ZA 1Z7AA 3N34A 3BG9A 3RLVA 4XZHA 3KDOA 1M3UA 5DX7A 3E5PA 1OWQA 3UYIA 4D6FA 5JXQA 3E49A 4AEFA 3WK0A 2DH2A 5K7JA 3MV11 4BA0A 1E6PA 3P62A 4KF1A 5ABFA 4DO6A 4PMYA 3ARYA 3CYVA 1EJRC 3GC4A 2XFWA 3H2CA 4IIDA 3EMQA 3FIGA 1XW8A 1P1MA 1XR2A 2CBIA 2CXGA 1CXKA 1D7KA 1XISA 3NO3A 4TMCA 3LTSA 2VEMA 3NJ3A 2ISSA 3OG2A 4N4QA 1XS2A 3ZVIA 1EUAA 1S2WA 3KVMA 1NWTA 1WCGA 2VC9A 1L6YA 4TIMA 3CBWA 1VH7A 4IX0A 7TIMA 2NUXA 3F4VA 3N73A 3KRUA 5GPRA 1WXZA 3FNDA 3EKGA 3WN6A 5HNNA 4ZODA 4GQQA 1DWGM 4JXCA 3W3OA 1U1UA 1AQMA 5D38A 1EEXA 3CPRA 4LUSB 1PZ3A 1ZZMA 4O0ZA 4JTSA 3F4CA 4IMDA 3DENA 1BYAA 1W3HA 3N19B 4NNAA 3QHMA 1UMYA 1TZ9A 1VPXA 4LANA 1EYWA 4NZ5A 2CETA 3H4XA 1UWIA 3GFXA 3BOLA 3FKKA 2ZZ3A 1IT8A 4O50A 1VB9A 3QZEA 4PULA 1V6YA 5HJXA 3LCHA 4F40A 4PTWA 5AYYA 3GIQA 5G4EA 1XUZA 3U3HA 1K6WA 1B3ZA 4PR4A 5CPNA 4E2BA 3WJSA 2GVYA 5KZEA 2A3EA 2FDMA 1EC9A 2B7QA 4JIEA 1TELA 2O9RA 3KUMA 2R1PA 1LG2A 2JQXA 3OZYA 2DPEA 2FFCA 3EEZA 3G1RA 1QNOA 1TMQA 4AEOA 2YDQA 3O07A 3VIPA 2GYIA 2JK2A 1JCXA 5EFFA 1J6OA 1MNSA 2CERA 5DXYA 3DHFA 1XIGA 4UTLA 4UTIA 3QPEA 1ZTVA 3F4WA 3W29A 4ASTA 2OKOA 1MRQA 4ZVJA 2NX1A 5M1TA 3L9CA 1WDRA 3R8GA 1DE6A 3TN4A 4B3ZA 2XIOA 1O5RA 3JS3A 4PTXA 3T07A 3B9OA 3G6MA 1IEQA 1UKPA 2Y62A 3UXIA 1RQEA 1ZL1A 1AFSA 2D2GA 2D3LA 4FNQA 4FEZA 4HNCA 2CZEA 2VX7A 3NO5A 4CNTA 4Q22A 3T0TA 5CZTA 4AZGA 2CLEA 4JY9A 1L6FA 5FF0A 1E0WA 3KW3A 2ZRXA 3ECQA 2DU2A 3T2OA 4R27A 4H2HA 2WCSA 1Z6KA 5TF0A 2OOGA 5HWNA 3AQUA 4HTYA 1UBSA 4JTFA 4IPJA 2DZBA 4HMCA 4OVXA 2YXGA 3REQB 2IKHA 2HISA 3BVJA 5FOOA 2OWXA 3FA4A 1R3SA 4HPJA 1TJ0A 4Z1BA 1EJUC 1K4HA 1KKOA 5L6UA 3VX0A 1E56A 3STEA 2Z1BA 1SUXA 1UZHA 3AIRA 3S2JA 1G01A 1H11A 3U5UA 4LBSA 2PUZA 2YX0A 3LZ3A 2J74A 2J9YA 5FJJA 6REQA 1PX8A 4HPHA 3UWVA 5DT5A 3SY8A 5HULA 4E2OA 4LXFA 3ZT6A 4HSNA 4UTTA 4DYEA 2ESCA 4H9TA 3SI9A 1UJPA 2YA0A 5BMWA 1XH2A 2AQVA 4HZ7A 1O1HA 2HV5A 3Q67A 1H1ZA 1KV5A 5CPMA 2E40A 4JOMA 4C6EA 1KCZA 5CC3A 1KFEA 2H6RA 4UTTC 4CNPA 2VTFA 3W1QA 1PVNA 4O1CA 4MB4A 1E4NA 5AYZA 4FMVA 2V69A 1S5WA 4I9AA 1F3EA 3U48A 2PFHA 4WF7A 2GJNA 1QHPA 1MNZA 3L0NA 5CC5A 4RDYA 1OGGA 2DT0A 3OZOA 1JCMP 3DOPA 1S2UA 3O9NA 1HVXA 2E5CA 1OX4A 1AJZA 2NVDA 3U7VA 2FTWA 1FRBA 2DSKA 3BZGA 4H3DA 4B16A 2WXDM 3QMSA 4W7WA 4ERGA 1CW2A 2VEPA 4H01A 2HROA 1V3MA 5AYBA 2OCZA 2J4GA 4RW5A 3SN4A 2XWDA 4V15A 4O18A 4S38A 2YCLA 3VDGA 1XQKA 4I5RA 4WRHA 1NAL1 4DLFA 2PBOA 4C90A 1QNQA 2QNEA 3G77A 3DECA 5E6ZA 3OJGA 3ABXA 3B4YA 1CTNA 5H91A 1MW3A 1RJRA 3OQ8A 3S1XA 9XIAA 1DJNA 3TC6A 2YSWA 4DZHA 2IPJA 1DWJM 2DZWA 1VD6A 1ZS2A 3IPWA 1ADOA 3EDEA 1JXJA 3ITOA 4P8VA 2FZ8A 4R7JA 3TR9A 2GDUA 3M5YA 1YDYA 3TW7A 3L7RA 1ALDA 3CH9A 2PSNA 2YR1A 5ABTA 2AQWA 4OUEA 4F66A 4IWWA 2NWRA 1TREA 4PTVA 3A47A 4LCQA 2WBGA 4C91A 3C5QA 3W7PA 1KXHA 4O4VA 4FX8A 4WZHA 3N9SA 4J3UA 1QW8A 3BGGA 1T7LA 2HJPA 5JH1A 4WKHA 2WNNA 3W76A 3GTXA 2A3HA 1K8CA 4G9PA 4US5D 4TTGA 3SCWA 3NZRA 2CKSA 2E5DA 1GT8A 2VGFA 2DSZA 5A6MA 3HB9A 2IPWA 2D22A 4B91A 3EMZA 2Y5EA 3TXVA 3URBA 7ODCA 3PTKA 4LUIA 5BWFA 4B5TA 2FZNA 4JTRA 1CGXA 4Y96A 1UUOA 4K6AA 2CITA 3KL3A 2GZXA 4QJ3B 2BTMA 4M81A 4L7ZA 2G97A 3II1A 1Q3NA 3DFQA 4DUXA 3O16A 2PPGA 3BJFA 2VQTA 2YYUA 2I1OA 1DORA 2D0HA 4O28A 1VLIA 5LHEA 2PMQA 4MNKA 5I24A 3CYJA 4D8ZA 3DC0A 4K37A 4LUJA 4C1NA 4D8LA 2DSWA 2BSLA 5HA7A 3G6LA 5E09A 4UR9A 2AAAA 5FJIA 4J3ZA 3UPWA 3W2MA 2REQA 3W26A 1EP1A 1VJIA 5A2BA 4V1YA 4I90A 1V0LA 3ES7A 4LF2A 2VZOA 1UWQA 3AC0A 3SAZA 3CAKA 3DU0A 2HBVA 1EH9A 1XL9A 1MZRA 4GJIA 3W85A 3VC5A 1HL2A 2HS8A 1UIPA 2VXNA 4WLCA 1R3QA 2OQYA 2QDDA 1IXOA 3CIWA 2A6LA 1CGUA 1L8NA 4AIOA 1QXLA 4JN6A 4AD3A 1JFHA 1OB0A 1EA0A 3SFWA 1KRAC 1PHQA 1KV8A 1UC4A 3WMLA 2VM8A 3E2RA 1H09A 1NFBA 3CS2A 2GWGA 3OA5A 3RCMA 3ZVHB 1N2VA 1YX1A 2ZRZA 3IGSA 4PEKA 3URQA 1BSIA 4PFHA 4JAWA 2B31A 3GZ3A 2P10A 3RUBL 3S42A 3PJUA 4F9JA 4KFPA 3S1UA 4HBKA 3G0UA 1JXKA 1DXIA 1C8QA 1GVSA 1OFOA 1EF2A 1W3TA 2GDVA 1ZCOA 1RR2A 3V5CA 2W4XA 1BXBA 1Q6QA 3GSMA 3VFCA 1ONWA 2Z1WA 3ARRA 3OOQA 1QHZA 4NILA 3W7LA 4EPEC 3P14A 4PMRA 4GQGA 1S1RA 2AOSA 3LRKA 2YCEA 3ABSA 4WDUA 4WJXA 1EDGA 1W9BM 1DJQA 3OVQA 1QPQA 3P5ZA 4MJ2A 1B31A 3BOXA 1LWJA 1TA3B 4Q4QA 1QK0A 2XU2A 1IEVA 1Q13A 1JZ2A 3N3MA 3PPFA 1LT7A 3NL5A 3ZM8A 1QHOA 3IUIA 3EOEA 1OFQA 3GXFA 1MMFA 4M8UA 7REQA 1K02A 2ALDA 3UJSA 1HJWA 1OBAA 3P5YA 3N25A 4JFUA 5CPSA 1OYCA 1VGAA 4LS0A 1C8YA 3LLXA 3VKAA 2XIBA 3EX6A 4J4KA 2ISWA 3SGUA 4A3HA 1JFXA 1HVQA 3LN3A 5RUBA 4QDMA 3W7IA 4EXAA 1PXGA 3W02A 1HO1A 4RV8A 2ZC1A 2PDYA 3ME3A 4LS2A 2OT1A 4AHOA 4DM2A 5CKSA 2HE8A 4WDWA 1X1ZA 1ZU8A 1F6PA 5JBFA 5F7UA 3IRDA 4GZIA 2E7FA 3AXIA 1VFSA 3UF9A 3ATYA 3B8WA 3EA3A 4NP7A 5BMXA 4IM4A 3SQLA 1I0BA 4YYCA 4MG4A 2NQJA 3UXLA 3LS9A 3KHDA 3MBDA 3N6QA 4CD5A 3CK5A 3PPCA 1P6CA 1E0VA 3NZPA 2PCQA 1FFRA 5DO8A 1FCQA 3NDYA 2GQ8A 1GTHA 3HF3A 4INFA 2F6KA 1JDDA 1XDMA 1ZHAA 4IPPA 5HNUA 2PDKA 3O0FA 3HO8A 4LC8A 1SGJA 3B8SA 1TWZA 5FA5A 1IWPA 4PBEA 3E5BA 1Y65A 4I5XA 5B7ZA 3O6AA 3WMBA 2GGEA 4GH1A 1V93A 3TYCA 4A2RA 1F3XA 2Z2BA 3NSMA 2GJPA 5D9OA 4OHQA 4LY8A 4LAUA 2WSYA 1WUFA 1TPWA 1YNYA 3GG7A 4TQTA 1EJSC 4Q8WA 2NQ5A 1N8IA 3UVAA 1B2YA 1JVNA 4F0LA 3MDUA 3CM4A 3A4XA 3W75A 2BB0A 1EGMA 1KW1A 1EQPA 4R7OA 2E67A 4Z2KA 1GW1A 1V3JA 2CCRA 1TVPA 4KIRA 3MS8A 5AECA 2VZSA 2IXVA 1FCUA 1J8VA 4O19A 5FL1A 1DPMA 1TTQA 5CG7A 2RJHA 4UMCA 2R14A 3P80A 1H0IA 5C2GA 4N7QA 4DXKA 2QLYA 1ODUA 2HCVA 1TO3A 4PB4A 2PDWA 4AIUA 2OJPA 2VOTA 4FLRA 2BGQA 3DERA 1AL7A 4FZIA 3LM3A 5GNXA 3CTTA 4QQUA 5I3KA 1P48A 3G8RA 3UEQA 1F5ZA 5AKQA 3RO8A 1JPIA 4QM1A 5EMLA 3MSDA 2OX1A 1X7FA 2PLMA 4G8TA 2YBVA 4Y9OA 1FH8A 2IPGA 3G1AA 2QJJA 3PWGA 2QCHA 4NHVA 4QLJA 1DVJA 3GVWA 4XZMX 1GW9A 4GGBA 5F2LA 2XH0A 4OE7A 1FXQA 4W88A 2GUUA 4PL2A 4DVOA 1GOOA 3C2OA 4O0QA 3MTWA 1ME9A 1JEZA 1VRXA 3SRHA 4RX0A 4KWWA 3RR4A 3VNYA 3STGA 1TCMA 3FHAA 1QW9A 4MDOA 4Z0SA 4M5PA 1XSJA 2ACUA 3VKBA 3ZR5A 1WDQA 4KQNA 5CAHA 4ZL1A 3N12A 4RCXA 2BMBA 3B4UA 2EEXA 3A5FA 2O0TA 1VBUA 1YNQA 3QTPA 2DJLA 3PUGA 3RJXA 1R2RA 5H8PA 4OKDA 3W07A 3CWHA 2DT1A 2XFRA 1H2JA 3SCNA 3Q45A 4ZR8A 4GXMA 2BASA 1WV2A 3T0CA 4JX5A 4K1GA 3OBAA 1TV5A 2PCEA 3H7VA 5KETA 3WQDA 4HYRA 3M0XA 1WDWA 3LSBA 3RU6A 1KBIA 5T26A 2FVMA 4S3FA 8XIMA 5G1TA 1M5WA 2XM1A 3S5SA 5J5RA 2AGTA 3B0YA 3MBFA 3MJMA 4N6EA 3QY6A 3WKZA 4ATLA 3WBEA 1NP0A 1GZJA 1XC6A 2GGJA 3MI2A 3ELFA 1AH4A 5REQB 1TRIA 4K8GA 4R85A 1JCTA 2H8XA 2NVAA 4H9XA 4JTDA 1CT5A 3GBEA 4PCTA 4HA3A 3HGSA 3GKFA 5AC5A 2PEVA 3NURA 2CHRA 3RXZA 3QJAA 5D8ZA 2DFAA 1C90A 3CQ0A 5FSDC 5A8PA 2DVXA 5FESA 3CZKA 1SJAA 4CNUA 4R7WA 4M6VA 2NLYA 4H8UA 3EGJA 2D20A 3PBMA 2YW3A 1HJUA 3GD6A 3H2OA 1TX0A 4NZJA 1PUDA 2VVSA 3M47A 3W7MA 1V6VA 5EKYA 1EJVC 2WAGA 4YWSA 2VL4A 3PZIA 5BRPA 1OCQA 1R86A 1H60A 2D2JA 2YL5A 4J3VA 4HSOA 1I0DA 1FY6A 4RZ4A 1JI1A 4HB7A 4JTIA 2EPNA 4QNEA 3MU7A 4MJMA 4YWIA 4UTKA 4EKJA 4NL1A 3K8KA 4KGJA 2NXHA 3W7HA 4F9DA 4IMCA 4MF4A 3AHYA 2VGBA 4UXDA 1JGMA 1ZALA 4LV4A 1UROA 4TR9A 4QR6A 5EB8A 6TAAA 3S1VA 1HXJA 4C6QA 4DBDA 3U8GA 2E68A 4EWJA 3VIOA 1YNPA 2Z1VA 3TVAA 1YXDA 1KFWA 1NOUA 1UWTA 5DMNA 1HP4A 4NVTA 3URNA 3W7DA 3UWZA 3GYEA 3CGTA 3PUEA 4RW3A 4QFUA 3VPLA 4CEXC 2FKPA 2PDIA 2W3ZA 2ODOA 1Q2SA 1XIBA 5A95A 3AMLA 2BHUA 3OIHA 4JFWA 3N2OA 5E1QA 4F8XA 1J0IA 1LOLA 2QF7A 4GKTA 4CLMA 1PZ0A 1FHDA 5BWAA 1LBLA 6CGTA 3EEGA 1M6JA 3R5EA 4LBRA 4AYGA 1W91A 5ECVA 4ZO6A 1PBGA 4NG3A 2X1UA 3SRKA 1QO5A 1JDEA 1A5NC 1VEOA 1OX5A 1ZLPA 2C1HA 4R33A 4TTUA 4Z2JA 1UD3A 3H12A 5GJPA 4NKCA 4G5DA 1W1YA 2DZXA 4V27A 4URIA 3H4GA 1F6YA 3ATZA 5CBIA 2VJXA 1AMYA 1VCGA 2WW5A 1L8PA 4Q8NA 2GGGA 3C2FA 5ECUA 2VDGA 3PPHA 4IJCA 3H2AA 3OVPA 2CFFA 4BS0A 4Y8EA 1IXQA 2EO7A 5K4XA 2BGSA 3SSJA 1DXFA 3OLEA 1H63A 3T4CA 4LC6A 1F8IA 1ZBVA 3OEXA 4JKKA 3BG5A 3ONBA 1T6MA 5ENLA 3IJIA 1OYBA 1NP2A 3KE0A 3UJ2A 4NZ4A 1US2A 3VO0A 5C0QA 2MUCA 2CKRA 2POTA 4L6DA 3W1NA 3CAVA 3I7QA 1BXCA 2NXIA 3IV8A 4HHPA 1YTDA 1S38A 4CQCA 3ANYA 3E02A 4RNJA 4GVGA 1XLDA 3CTLA 3WQWA 3FFSA 4CQ8A 5DANA 1A5UA 1OHLA 2HVNA 3LM7A 3IAPA 2WNQA 2Q3RA 2PWGA 3HGOA 3W37A 3QM3A 1DP0A 5I07A 3ARUA 4UNKA 3EWDA 4GI6A 4GUGA 2NVCA 1YQ2A 2GQ3A 4AY1A 2WHLA 5F2GA 4FS9A 3L5LA 2H3BA 2H3DA 4UQEA 4EE9A 1RY0A 3MZ2A 3NOYA 3W25A 4UTMA 3NIYA 4QG8A 2FZMA 4PUNA 3M16A 4J35A 1TQXA 3PUOA 2WB5A 1R47A 2V82A 3A5VA 4DJDD 1ADSA 3CUHA 5HUOA 2BDQA 4O8AA 4L4PA 2RDXA 1GOIA 3FJLA 3L4TA 1T5AA 3LQGA 1IZCA 4KWVA 2DZTA 3IIVA 3M46A 1W0MA 5T91A 4Z17A 2C8NA 4P8XA 1DIKA 3NQ2A 1QWKA 3AHVA 4DPPA 1KFCA 3TYDA 4AZ7A 1KNWA 1LQ2A 2Z25A 1UUQA 5A1AA 3WDJA 1ZJBA 1E70M 2Y7DA 1SO4A 2WKGA 2A3AA 1ZUAX 3JZEA 4G56A 2D0GA 4ATWA 3N18A 2GSHA 3AMGA 2ZXBA 1E1CB 1XQLA 5AC8A 3ES8A 1EA9C 2DW6A 4PTMA 2QCDA 4C6MA 1P5BA 4TVUA 1XSKA 3USZA 3L68A 1LRTA 3N9KA 3F1QA 1NH6A 4TOQA 3MSYA 1BEUA 4DPQA 2PDMA 4O8RA 4X0NA 3ARWA 1GJUA 2DZAA 1Z89A 1EJTC 2WHKA 5LIKX 1QW7A 1TVNA 3VDCA 2ZVIA 5A5WA 4GIEA 4V2XA 3TW9A 1T96A 1PJ9A 2ZUWA 4LVGA 1P0KA 4OIFA 3J7HA 3WQ5A 4MLJA 1JJKA 3IJQA 3CH0A 5KINA 3SUSA 3RPMA 3FJ6A 1H1YA 3UR2A 3CWNA 2OWWA 3UWQA 2XIJA 5BXTA 4H7ZA 3OQEA 3KM8A 4HZ8A 4DM1A 2E5BA 1PWMA 4HN8A 4QEHA 1PIIA 5IRPA 3VOGA 4E4UA 4JTGA 3O6DA 4O12A 4O4WA 4HU0A 3S5NA 5MHBA 3VYLA 4DWSA 3CMGA 3EKLA 3MQTA 1X6NA 2A79A 4IQEA 2ZZ4A 3W7OA 1DWIM 4XD4A 3LCGA 1R38A 2VDIA 3MCNA 3ALFA 3ARZA 1BAGA 4H83A 5GVJA 2ZZ6A 4DB7A 3R43A 1LBFA 2E09A 4P61A 1CIUA 2QDGA 4DWSC 1LUCB 2QW5A 5XIMA 2GOKA 2WJFA 4O1AA 1M01A 4DEFA 4UQCA 1XLFA 4UFHA 1BGAA 2FYMA 2PE4A 1HGWA 4V28A 3BCFA 1H7NA 5FF4A 3W1TA 1W54A 2XN0A 1BPLB 5U4NA 3HMCA 1W56A 4H8NA 2ISVA 2V3GA 4L1XA 4Q4RA 3MUIA 3GH4A 3RO6A 4RNFA 5CH9A 3QQ0A 5IOBA 4XWUA 4RE0A 1Q8AA 4BI6A 3MVIA 1WX0A 1V51A 4LFYA 3SCPA 3SUWA 2OPJA 3Q58A 2X1SA 3ZT5A 4AG0A 3HPFA 3C4UA 3WD0A 1AL8A 5I09A 2W27A 1XDLA 2VO5A 3BLPX 2IKIA 3TNOA 4S3CA 3DBNA 3MI3A 2PLJA 1LM1A 2O92A 5DCDA 5CQ1A 3DX5A 4LB3A 1IE7C 1YE6A 2WVUA 4MNLA 3GK0A 3XISA 4S2CA 4KKXA 3CUGA 1LROA 3BICA 1E0TA 2UBPC 3KRBA 3E6EA 3T2PA 3BJTA 3ENLA 3KRZA 3S9ZA 3K46A 3TAOA 4QEEA 2WSRA 2GSJA 1WPCA 3GU1A 3HQ1A 2HNEA 3N4AA 3D5HA 2C18A 1HKJA 2QQ6A 1EIXA 1TWWA 4JFVA 4GIAA 3MMWA 2J7FA 2GVLA 2WWDA 3SDOA 2F84A 1PEZA 1UCWA 3REQA 5EMKA 1GQIA 1E9ZB 1OD0A 5JUVA 2Z26A 3HJZA 3L4XA 1W9UA 3WLOA 5FCZA 3GZAA 5I2UA 5HUPA 1E71M 4QROA 3CO8A 3IGHX 4TV6A 1VBRA 1ITUA 2R1NA 4BJHA 5CJMA 2R94A 1CPUA 2EHHA 1O60A 1K1DA 5E9AA 1I60A 1BYBA 4PMNA 5PTDA 3MP3A 5AZ1A 1J0KA 3RX3A 1XYMA 3BARA 3HFTA 2QF8A 1F4HA 1OK6A 3NAVA 3BLLA 1EIBA 3VFLA 1EL3A 3IVSA 3GM8A 4JTJA 3TWBA 1OQFA 4ZBCA 1GKRA 3MMDA 4E8GA 3U2OA 4OBTA 4HPGA 1BLIA 1J79A 1TPEA 4PTNA 5IDZA 1RZMA 4QNWA 4XZIA 3LU2A 2G3NA 5CEWA 3CV2A 4K38A 3ABQA 3VMOA 3UBPC 5FEWA 3RMJA 2VRQA 1E6ZA 3SRFA 1DV7A 2XUCA 3NDOA 4FXJA 3T0BA 3L23A 4AC7C 3CHVA 1F3WA 3CL6A 1RY8A 3SR7A 1QO2A 4QE1A 3QRHA 4ZB0A 1QI5A 1F8MA 3GNPA 1K03A 3STCA 2OB3A 3UPMA 2FMNA 4CCDA 3N2CA 1CI1A 2RAGA 2QCMA 1EJXC 1EJ7L 2W91A 2YB1A 2F38A 2ZBTA 3VA8A 3WIJA 3WBYA 3NO1A 3ZJ7A 3U0HA 4KESA 4OZOA 2FJKA 3KL0A 5I03A 4A35A 3UCCA 1XYZA 4MADA 1GYLA 2OQHA 2ZUUA 2V3FA 3KOZA 1RJPA 1R8LA 3EX2A 3TTSA 3PAJA 4AX6A 4C6DA 3OLDA 4DWDA 2QCLA 2BHZA 4PMJA 4N9CA 4KEUA 1XUUA 5H2ZA 1ONEA 3HA1A 3RFAA 3O6YX 3KX6A 2XSXA 2HTMA 1TJ1A 5CLWA 1R5YA 4UCFA 1OIMA 2GFTA 3TOYA 5BXRA 1W3IA 3R58A 4AF0A 1TYGA 1XFCA 2OZ0A 4RKAA 3B8UA 8RUCA 3M0YA 5D05A 1GYNA 2GJXA 3VDAA 1UA3A 1Y5XA 4IQJA 3GIPA 2XPKA 1X98A 1PPIA 1B9ZA 4FI4A 5I3JA 2PDHA 3ARTA 3SCSA 1U5JA 1YIXA 3LRMA 1Q63A 2A3BA 4E0CA 3SGZA 4HJFA 1C93A 1Q66A 4U2YA 4J3TA 4US6A 5EPDA 4S3AA 1EDQA 4PUUA 4JY8A 2VVNA 4F2UA 1Q6RA 3BLDA 3KLLA 4L9XA 4XZLX 5CBJA 1E6NA 2DORA 4YHGA 1L2UA 2WZHA 3VOIA 3DFYA 3L21A 3R12A 4E4PA 1B5TA 4FF5A 1V6TA 2PF8A 4C6PA 2QR6A 3E0FA 4Q4MA 3B9EA 4D6DA 3W7QA 1Y5VA 3QMTA 3R10A 3WQOA 1UH4A 4HNTA 4AVOA 3AIVA 4IPLA 1E4LA 1GK8A 4C60A 1G94A 1A5AA 2UY2A 4UIOA 1OZMA 1ECQA 4IZGA 5AC6A 2G3IA 3QKEA 4E3TA 1RLDA 3BK0A 5G5IA 2BXYA 4UFMA 1HL8A 5CZJA 4Q33A 3VDBA 4GXPA 3U57A 3ARVA 1KB3A 3OP2A 3M6DA 2VWTA 3BQ6A 4FNUA 3T1GA 2C91A 4QTGA 5A6TC 4OV4A 2OYKA 3NQ8A 3QHNA 2JBMA 1R7OA 4O17A 4QE4A 3LSCA 3PTMA 4DBWA 3UNTA 3HMJG 3UVIA 4AVNA 4XBJA 3WLIA 3UA4A 5LNWA 1KRCC 3KFTA 1XPGA 2J78A 1MEWA 3P93A 3VOCA 3TP4A 1TMLA 2CW6A 1H5VA 3VABA 5JU6A 1TB3A 1WE5A 4DX3A 5CGMA 1S2AA 2G4FA 2NQZA 3EDDA 2G3FA 2OO6A 1FDZA 4BCEA 3MWCA 4Q4OA 4UQDA 1KTNA 3UW6A 1RVKA 4M7SA 1JPHA 4UMBA 1U33A 3GBDA 3K2GA 4HD5A 1UR1A 2E0PA 1QCWA 3RX4A 3BWWA 6ALDA 3UZWA 2XVKA 3BOFA 2EBNA 5HDRA 4B2DD 1IGWA 1KRBC 2OO0A 3STPA 2ZUNA 3T44A 5IXEA 3COTA 4U28A 4A6GA 3T81A 4FXSA 3MKKA 1G9HA 3EWBX 4KW2A 4QE5A 1SFLA 1K9EA 3MUAA 4GKLA 1KFJA 2QJHA 4NZFA 3L65A 1VAHA 3ITCA 1K7EA 2PRMA 1GKQA 2PRHA 4KS0A 3EXSA 4Q7IA 1THFD 4AZIA 2WJDA 5ABHA 1F61A 3IIPA 5AHEA 5TNVA 1SZFA 3TYBA 2C79A 3RG6A 1QU4A 4NI8A 3S83A 1C91A 3KBMA 1B1YA 4R5EA 4Q8OA 3L12A 1KFLA 7CGTA 1RBAA 2IKJA 5DFAA 3W72A 3IACA 3Q94A 2FPVA 4F0MA 4LUTB 2Y7GA 4UR7A 1NOWA 1OG0A 4D6IA 1BKHA 1AH3A 3WD1A 4TX8A 2V2DA 3V7PA 4FPSA 4Q6XA 3WH9A 2FPTA 3EWWA 4HMDA 2B7OA 5EBUA 4EAMA 2Q71A 1H7OA 1GPWA 3DHPA 3LI0A 3WENA 2XN1A 4RZ5A 4TUFA 2D23A 3VM5A 4M1RA 1ICQA 1RH9A 1ZP3A 3I6RA 1KTBA 2O56A 4CVWA 4DUVA 2A7RA 4IJBA 1RCXB 2YGYA 4L6OA 4XZNX 4O52A 2PC4A 4LV9A 3FYPA 2AL2A 1JZ7A 2HMCA 3WLPA 3TYUA 5EMJA 3VKJA 1WUEA 3H6OA 3Q37A 1EB3A 2Y0FA 1N55A 1NEYA 4JFTA 3NGFA 3TFCA 1KFBA 3FSUA 3THUA 1X6UA 2JEQA 3CEPA 3PG8A 4CGTA 2BY3A 2WM1A 5HJYA 1UR8A 4CD7A 3EPMA 3BMVA 5A6AA 3MCOA 1O12A 1DQWA 3MUXA 2VWSA 3AYRA 3QYQA 4DO4A 1U1HA 4S39A 1UWAA 1J5TA 1K9DA 1X1OA 5A69A 3HQNA 5BOEA 5K9DA 1TE6A 1TV7A 4MPKA 3WD4A 4WY0B 1XD0A 4XO7A 1EGZA 5AHMA 1UR9A 4H6RA 1UKTA 3KVKA 1ECEA 3P3BA 3WLQA 1J93A 2P76A 1F2JA 4QSHA 4AZBA 4QSFA 1FCVA 4X2RA 3W7JA 1KM3A 2CXEA 3FAWA 5HQMA 3HIJA 3I4EA 4E6MA 2F2KA 3R79A 1UP2A 4KEMA 1KCXA 3GFYA 4FF7A 3S6OA 1W1ZA 1TPC1 1TJRA 5HR7A 3N15A 3C52A 2ZA3A 4BQ4A 4FB7A 3XINA 3GDLA 4JYFA 1NOFA 4J40A 4QAIA 4M7TA 3LY0A 4Z08A 2UWFA 1Y5WA 5C71A 2ZX5A 4UQAA 3WEMA 3V1PA 4U33A 3WSUA 5A6KA 3HPXA 6XIMA 3VD4A 4TV5A 1H41A 4LCRA 4BQ5A 3C0SA 4LRTA 3ZYZA 1TPDA 3IGUA 1KM6A 1A5SA 4XISA 2X7WA 2X42A 3A9BA 1LT8A 4KCUA 3NYZA 3ZZ1A 4I8DA 3WLJA 3V36A 3ZR4A 1NQKA 4O10A 3DKJA 1ZBCA 3LMZA 1XFBA 3E0IA 1VFOA 4GYPC 1A50A 2OZ3A 4AAJA 3P82A 5IHRA 3G1SA 2V8ZA 3TC3A 3TR2A 1OFDA 1LBMA 2FTYA 1SR0A 3BJSA 3W6LA 3PUDA 2PBGA 2QYGA 2VDHA 3WQ8A 4M1BA 3CZEA 4NXKA 1E51A 3EA2A 4FOUA 5F2MA 5A8MA 1IF2A 1A5OC 2J9ZA 5C5YA 3SW6A 5H8UA 3BAJA 4CU8A 3EWUA 2X1RA 5CJNA 5CPTA 1HKIA 1Q6LA 3CZGA 4PUJA 4IP7A 5DELA 1CXLA 2EPLX 1I6NA 4D6GA 5GJNA 3SUUA 4JQ4A 4J2MA 4P8UA 1J96A 1TTJA 2WVVB 3GS6A 2J6XA 1IXPA 5EBAA 3NXFA 1V6XA 4L65A 3VKKA 1CXEA 1U1JA 4BK9A 5IBXA 1BGGA 2EAWA 1MXDA 1V3LA 1TKKA 2TPSA 9CGTA 3FV9A 4HNVA 3R13A 3DFNA 2C1GA 4KIEA 4WHBA 3A4AA 5HINA 1G7UA 3WJZA 1ODZA 1XLHA 4MKVA 3GXMA 1KLZA 3SM0A 3NXLA 1UA7A 3T40A 4OT7A 1EX1A 5IBXC 1D7FA 5GQBA 1PIGA 1K7XA 4JDBA 1YW1A 3LGGA 4ZO8A 3LHZA 1Q5MA 1QMLA 2OSXA 2D2OA 5I02A 4AY7A 3SFKA 3TIMA 3R7MA 1OX6A 4J3WA 1DJZA 3P6LA 1VFFA 2J27A 3S2LA 1EPXA 1V77A 5KEZA 1RA5A 3B0XA 1XLLA 3ISIX 4W5ZA 3PN8A 4OU1A 3G1FA 4AHQA 2GGHA 2Y7FA 1C29A 4F79A 2XGZA 4W85A 1J0JA 2ATSA 3URAA 1F76A 4EANA 2WCAA 4GFIA 5FACA 4XVDA 4O1BA 4A3RA 3M43A 3NNTA 3W82A 3VIKA 1XICA 3BANA 1CXFA 4DF1A 3IJ6A 2Z28A 4GGHA 3VTRA 4XUYA 4UTWC 3HTWA 3VD5A 5E6YA 3L2IA 3IAQA 2Q09A 3P7YA 3AXMA 2J8FA 2JGQA 5FJUA 1Q4WA 1G1YA 1P0EA 1OM0A 2VC6A 2YLAA 4DIAA 1VHNA 1FOBA 3SUVA 3BO9A 5CSYA 3M5VA 5JBDA 2J24A 2DEPA 5KSWA 1FDYA 1RAKA 1S2VA 4H00A 2VCBA 4Y7EA 5H8MA 3B8DA 2PGRA 1AMKA 4WKFA 1VPQA 3WMSA 2Y2WA 2WNZA 1DJWA 5EYWA 2QCFA 3KWSA 4JL2A 1AVAA 1BYDA 1XH0A 1E3XA 4DBSA 4ICNA 4BR1A 4JL1A 1RXOB 3N29A 1HJSA 2C7FA 3BAXA 2OMAA 3VGBA 3EOOA 3MHUA 1CB2A 1EP3A 5TQLA 3QV7A 4ZCWA 3UY7A 2GVJA 4P5UA 3B03A 3TJLA 2QVNA 1BQGA 4H9MA 3H53A 2XVPA 3MWAA 1IV8A 2D2HA 7ENLA 5IFPA 2A21A 1TV4A 5CPQA 1MXGA 3QC3A 4JQ3A 3G24A 2XVNA 2V5BA 2P5NA 3EOUA 4NJJA 2JKEA 1I2QA 4AZHA 2QMKA 3FOKA 1QJWA 1WYIA 2Y1HA 4JTEA 2V63A 3AIUA 2W61A 1O7AA 4POCA 2