3NPWA

In silico designed of an improved kemp eliminase ke70 mutant by computational design and directed evolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
250
structure length
247
Chain Sequence
TDLKASSLRALKLMHLATADTDEKVIALCHQAKTPVGTTDAIFIYPRFIPIARKTLKEQGTPEIRIWTSTNFPHGNDDIDIALAETRAAIAYGADGVAVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLSVIIETGELKDEALIRKASEISIKAGADHIVTSTGKVAVGATPESARIMMEVIRDMGVEKTVGFIPAGGVRTAEEAQKYLAIADELFGADWADARHYAFGASSLLASLLKALGHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of the in-silico-designed kemp eliminase KE70 by computational design and directed evolution
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords deoxyribose phosphate aldolase
total genus 96
structure length 247
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3npwA00
4S1FA 1JQVA 1C8VA 3WJSA 1KW1A 3NL2A 1V5XA 2C16A 2A0NA 3Q94A 1HTIA 4JTUA 1KTBA 1LBMA 4OE7A 4JXCA 3MWAA 1K3UA 3M5YA 4RV8A 1VPXA 1FX6A 1SW0A 3I7RA 2BZNA 1D9EA 4MFDA 2Z1BA 3W7GA 5FEWA 4O14A 3TAKA 1LRQA 3M47A 3THQA 3IRDA 1DORA 1VYPX 3GDMA 1W0MA 5AC8A 2H3BA 2WPBA 3LXCA 5HQEA 4OBTA 3PC0A 4FHAA 5E0KA 4UTMA 4K36A 3VE7A 4N9EA 5AHFA 4GFSA 3OBKA 4NJGA 3BG5A 5CKSA 3NQMA 1XBYA 1LRNA 4L4LA 1NAL1 3W1NA 1GVSA 2QJIA 3D0CA 1WBHA 4H6KA 4ADUA 5HULA 4AMAA 4NZJA 1F76A 5IM51 1WAUA 3DI0A 4HNNA 1XUZA 5TBOA 5HR6A 3NA8A 2V30A 1Z48A 3S1VA 2DJLA 1AW1A 3LHWA 4Q4KA 4AXKA 1FQ0A 2WV8A 3JRKA 4MYAA 3MHFA 4EWND 1TB3A 4MZYA 1YDVA 4I9AA 3PM6A 2QCDA 2FQIA 4E38A 1W5OA 3GDRA 1K7XA 1OFAA 2W79A 3UPWA 5LHFA 1W54A 3PWAA 5AC6A 4JTLA 2BLEA 4O16A 5AFDA 4UMAA 1AMKA 2CLIA 3STFA 4DPQA 5IBXC 2CLHA 5K3VA 4RJEA 3O63A 3SY5A 1OF8A 3C2VA 3C3NA 3GVGA 2ALDA 2C3ZA 1TMHA 2WNQA 3ZR4A 4M6QA 1OK6A 2G5WA 3EWXA 3L68A 3LI1A 2GOUA 4AVFA 4UTIA 4LVBA 5AHIA 1FCBA 3L21A 1ZAHA 2Q3OA 3KAOA 2DZPA 4HPXA 1JCYA 2V81A 4GUJA 5I3JA 1G67A 5ABTA 2VELA 1JR1A 3ELFA 1QO2A 1RQEA 2Y85A 1YYAA 1R46A 3O8AA 1X8FA 1SU5A 4FNSA 4UFJA 1S5VA 5CPLA 1EWEA 1TTJA 3EXRA 5HMSA 1HFBA 3BO9A 5U4NA 2YW3A 4DQWA 3CPRA 2E6AA 2Y7FA 4JS3A 2AAMA 4ZL1A 3O6CA 4K7VA 2E5DA 5C5YA 3LB0A 1A5SA 2J27A 4DEFA 5D33A 4WY0B 3B0PA 4R7JA 1LP6A 1G4TA 2OCZA 3NM1A 3QFEA 2NX1A 1KFCA 3NQEA 2DZWA 1Q6RA 4PL1A 1TREA 5HUOA 4ZQCA 1RV8A 1JULA 4O4VA 4FIQA 5LGZA 1PL9A 4RXGA 3TXVA 1OHLA 4WY0F 3DFNA 1L6WA 5CZ0A 4A3UA 4X3ZA 1B9BA 4ZMGA 4UTWA 3SGUA 2VENA 1A5BA 4Y6GA 3G8EA 4O1BA 2V8ZA 2ZZ4A 4LC8A 2DU2A 3A22A 3CEPA 3USBA 4GUGA 5D03A 4JY9A 4QITA 3W1RA 3GB6A 5K9CA 7TIMA 5DLCA 3N9RA 1GPWA 4A2RA 1ZENA 3H55A 2FB3A 3LI0A 2J6XA 4HSOA 3W1XA 1GEQA 1G7VA 4IOTA 4LC6A 2XN0A 4N9CA 1P1XA 3L0NA 3W7CA 1DKWA 2CW6A 5F1UA 1LZOA 2I1OA 2NV2A 1BEUA 1H7WA 3I7QA 3DFTA 3QM3A 3LCIA 3KRUA 3LCXA 3BW2A 5I3IA 1LRTA 3W7EA 4TMBA 1D3GA 1LLZA 4EF9A 4JR5A 1KV5A 4RZ5A 1GYNA 4E0CA 3MP4A 4JTJA 4BK9A 3A23A 4YLWA 4TIMA 1EEPA 1QFEA 1ZHAA 3TSMA 3NQ7A 3A24A 5DELA 3W86A 2A6LA 1KV8A 2R91A 1GG0A 3AJXA 4O0KA 3V75A 1SW7A 4K6AA 2YFOA 2NWSA 4FXRA 1KBJA 1RZMA 4KFOA 1ZNNA 3HG3A 3QPYA 3LCHA 1S5WA 3NL6A 4UR8A 1Z44A 2UV8G 3M44A 2QCNA 3ZWTA 1FUYA 3UWQA 4JD4A 3P80A 3W7OA 3W1LA 3NQAA 4MOZA 1KM0A 1C29A 3NQ6A 4GC4A 2HMCA 3W70A 3BW3A 4KWWA 4C1LA 1JCNA 4QM1A 3UPBA 3KFTA 3NEVA 2C18A 5DCEA 4M6PA 1X6UA 1VS1A 4GXMA 1FWRA 1TPC1 1A50A 5K2ZA 1JCXA 2QJGA 4ML9A 4O54A 4JX6A 4UTWC 2NV1A 3PVFA 4WZHA 4UTTC 3W7KA 5K7JA 4O15A 3KRZA 4NUWA 1XXXA 5BOOA 4HIBA 4JDBA 5F4WA 4MLJA 1F6PA 1FDJA 3IIXA 2C19A 3E02A 4Y9AA 4NT0A 4N4PA 3HGSA 2Y70A 3I68A 4FX6M 2O7SA 3NQ2A 4BF9A 1QDSA 1OF6A 4XKYA 2NUXA 2O7QA 1M5WA 4JTEA 3LCGA 3BG9A 1RD5A 4IGHA 1BWLA 2CLKA 4IMGA 2QJHA 4TO8A 3EB2A 2QCDB 3G3DA 1AG1O 1SSGA 3HGOA 3W84A 4GUFA 4Z0JA 4Z0SA 3RNDA 1BTMA 2H8XA 2ZA2A 3TFXA 1F74A 4LU0A 1OG0A 1QWGA 2ZFAA 2Y89A 1VLWA 5G4WA 4H3DA 3FEMA 2OMAA 3NOEA 3EX6A 3W7IA 2B4GA 3MI6A 3PBWA 1JUEA 5I3KA 4PFMA 1HG3A 1L2UA 5I3HA 3ABQA 3I65A 3N19B 3E49A 1O95A 1WYIA 1A53A 5G5IA 3PBYA 5FF0A 3SW6A 4AHOA 4O0ZA 4WX2A 4MFEA 1ZALA 3HPSA 3LHUA 5AC7A 2VFDA 1I45A 1H1ZA 3QSRA 1WXJA 4UIOA 4Z1BA 4Z08A 2Q8ZA 3TSDA 3MP5A 3T40A 1ME8A 4FO4A 3FA5A 2VFEA 2J9XA 5EKYA 3LERA 3G1HA 1SW3A 2EHHA 2CFFA 5DN1A 2GVJA 3L67A 4GNJA 4O52A 1TQXA 2RDTA 3DHDA 3BGGA 4I7VA 4QAIA 5IBXA 8TIMA 2W6RA 1OX5A 2QCEA 1O5KA 1ICSA 2QAFA 1MEWA 5K4XA 1TV8A 1FWNA 2DP3A 2ZZ1A 1TIMA 4MLRA 1EWDA 4WUIA 3G1AA 4BWLC 3HJZA 3B06A 3CQ0A 2WSYA 2A7NA 3TDFA 1TJPA 1ALDA 2CLLA 3T55A 3W1AA 3A5VA 1W8SA 4K8EA 4JGDA 3FYOA 4JICA 1GVOA 2D73A 1ZFJA 2NXGA 3ABOA 2QCLA 1JUBA 3DENA 4AH7A 2WSQA 1YTEA 1QR7A 3DFOA 3MP3A 3UZJA 3G0SA 3LV5A 1KFEA 1K7FA 3R12A 5CGQA 4JX4A 3M7WA 1M7PA 3IIVA 1RPXA 3SJ3A 3TC6A 2V9DA 3WJWA 2XFWA 3LRLA 2FPVA 4BFAA 2CLFA 4FNUA 2WJZA 3IGXA 1UUOA 1M6JA 3NZRA 3G1VA 2ABAA 3C8FA 4MUZA 3ATYA 3R89A 4YL2A 4OV9A 1VC4A 4EF8A 1F6KA 5DY2A 1WV2A 1QCWA 1T0OA 5C55A 1AW5A 2HS8A 1FBAA 3PSWA 2RDWA 2V2DA 4AEOA 1JRBA 2YFNA 4UMCA 4K39A 3R8RA 1LM1A 4FNPA 5C54A 3IGSA 3DZ1A 4IMEA 4S2BA 1JCMP 3NO5A 3W1QA 3RLUA 1FWTA 1KFLA 1BKSA 1QPRA 2J9YA 1F73A 3TQKA 5D05A 1LBFA 3HO8A 4S2CA 1ADOA 1K02A 1KFBA 3L2IA 3TW6A 3OHIA 1TV7A 4UMBA 3GZ3A 1UB3A 5G1YA 3GDTA 4LV9A 3N2XA 2CZ5A 1G4PA 2J24A 1R2RA 2Z0IA 1VQTA 1KA9F 3W1MA 1GYLA 5F4SA 3QMSA 1LCOA 2CLEA 4JTTA 3EXSA 4JNMA 3P8IA 4LVAA 1W5NA 3P67A 4I7UA 4XBKA 2TMDA 1S5TA 4MJMA 3G8RA 5H2ZA 3OIXA 1OFBA 1MEIA 1GVQA 1N8FA 5FEZA 3LTPA 3H53A 3O6YX 3QW4B 4X22A 3W1TA 2E77A 3W2UA 1EUNA 4UNLA 2RHGA 3EWZA 4JYDA 3HGJA 4O11A 5CZTA 3W7RA 1WOAA 1PV8A 3GNNA 4BI7A 3W74A 4CNNA 3TE9A 2CLMA 3L66A 1W1ZA 4NJJA 4XQ6A 1IF2A 3DI1A 4DBEA 2PRMA 1IXOA 4OWGA 4M7TA 4IJBA 5DY3A 4NQ1A 3BARA 1KLYA 5K9DA 1OFRA 4A29A 1QOPA 3W7LA 3S1UA 1ZJIA 2TYSA 4KFPA 2LLEA 3I6RA 1G69A 4TU1A 1GOXA 3PSVA 5HWMA 5MHBA 3UY8A 3WK2A 1W31A 3BLIA 5KITA 3BG3A 3NPUA 4LS2A 3RFAA 4WOZA 3CWOX 1P5BA 3W7DA 2WNNA 3AO0A 3RF9A 1I2OA 1IIGA 3CEUA 3TCEA 4LTSA 3UY7A 4FF7A 3TJXA 3LHZA 1SO3A 1I2NA 3HQ1A 4UTJA 3TNOA 1VYRA 3P7YA 1LTDA 1R2TA 3C61A 4ZQPA 4MKNA 3QH2A 4HN4A 2DZTA 2EF9A 1EP3A 5BMXA 3G1DA 4EVZA 1H63A 5D02A 4LUJA 2WO5A 2QCMA 4WXYA 4LS0A 3NNTA 1EA0A 1N7KA 3KRSA 3LHVA 3GYEA 2ATMA 5K4ZA 3NQFA 2OZ0A 3VCRA 1I2PA 5G2WA 3E9AA 3LV6A 2I9EA 4ALDA 5AHLA 3VI2A 2H3DA 3STGA 1TPH1 3NGJA 4FXSA 3FOKA 3PBUA 4H4IA 2Y62A 3KXQA 2GPTA 1KM6A 3KHJA 4A21A 2BXVA 5BNKA 3W2LA 2ISWA 3F4WA 4QNEA 1AK5A 3B0VC 3TFCA 3KOFA 3TR2A 3N2MA 1OFEA 4NZFA 1NF0A 2Y88A 1GTEA 2BTMA 2QUVA 3M43A 5D2VA 5CPMA 4ADTA 3FKRA 4FX8A 2ZRUA 4GUHA 3NXFA 4CLMA 3EX4A 3C2OA 3M0ZA 4WQ6A 3DHFA 4AAJA 2NXHA 4IQLA 3GXNA 1SZGA 1B4EA 3GLCA 3P84A 2ZA1A 1WOBA 1YTKA 3NQCA 3UWVA 3IEBA 1MSSA 3O05A 3FJLA 1TRDA 1UCWA 3MJYA 3W7HA 3CC1A 3W9ZA 1SPQA 3QEZA 3K30A 2ZCGA 3NAVA 3P8JA 3G3MA 4LW7A 4XKYB 3SIZA 1EUAA 1TSIA 4XUGA 5AHNA 1QPNA 2E09A 4KWVA 5SWUA 3L65A 4DF1A 1CW2A 2Z6JA 3P74A 2X1RA 4L4MA 5LNWA 3O1NA 4PC8A 3SGZA 5HJLA 5EMUA 3F4NA 3L5LA 5EYWA 1KM3A 1DBTA 1G7UA 2X1TA 1GWJA 4HSNA 4R53A 5L6UA 4CCCA 2J88A 1GVFA 1DJQA 3R5EA 3ZWSA 3WK1A 1J5TA 3S1XA 4JN6A 1OFDA 2QKFA 1P0KA 3EX2A 1L6YA 1XI3A 1XBXA 2VFIA 1TTIA 1QOQA 4IX2A 1DL3A 4AWUA 3LX9A 3RLVA 1OK4A 1T96A 3HGRA 1FXPA 3QQ1A 2VEMA 2BWGA 4BWLA 3GDLA 2VFGA 2YX0A 1LLWA 3V1PA 3LRMA 3LCFA 1H60A 3SFKA 1VCGA 3P81A 2DORA 3MO7A 1TPUA 2F84A 2H8ZA 3Q58A 2J9ZA 1RR2A 4O1AA 1UJPA 3GXPA 3TW7A 2G97A 1T8XA 4XZ9A 3H54A 5J5DA 1Q6LA 3UXDA 5KINA 2Y7GA 3W85A 4LOCA 1R47A 4JDYA 1ONRA 1O94A 2WQPA 3MHUA 3E0IA 3LXAA 3MYPA 4JTKA 2V5LA 1RQBA 3SR7A 4K7YA 1P0NA 4UTTA 3O16A 2ZTKA 3NZ1A 5KSWA 3FYPA 3OG3A 4ORMA 3IGUA 1KM2A 4JX5A 4RK8A 4AHQA 2OJPA 3WJYA 4R33A 1YTDA 4O18A 4O10A 2V0TA 3NQ8A 2R8WA 4IMCA 4UFKA 4RZ4A 2GVGA 3IIOA 4N6FA 3W2KA 1IXPA 4CQ9A 4CCDA 3LHYA 6TIMA 1HL2A 3IV3A 4O1DA 3QJAA 3WK0A 3C2FA 3PUEA 2Y7DA 3MI2A 4Z1CA 3O06A 3QZEA 4JIQA 3W7NA 1TPFA 2Z2UA 4WOQA 4IMFA 3S6DA 2Y61A 1YPIA 2ZZ6A 1X1ZA 4KKXA 3FFSA 3F1QA 4QJ1A 4LS1A 1O60A 4Y8FA 4UUIA 3BW4A 3NPVA 3A21A 3BGJA 1ZAIA 2QEZA 5HWNA 5FF7A 4HHPA 1FCQA 4YXGA 1NFBA 5BRBA 4J9JA 3TA6A 3TUUA 3P5ZA 1W3IA 1DJNA 2QF7A 3DAQA 5AYXA 1V7YA 3M41A 5G4EA 2R14A 1VCFA 2DZUA 2V2CA 3G0XA 2A4AA 4HKPA 4FNTA 4IXHA 5DCBA 2XN2A 3THAA 3TH6A 5EPDA 3W72A 4DO5A 3W75A 1YLVA 3L5MA 4MIMA 3LBCA 3TQVA 1UASA 4M5PA 2YSWA 4JTHA 4XTIA 1KTCA 4N2YA 3QQ0A 3CTLA 2OX1A 3M5ZA 1XBVA 3B0UX 1TO3A 5H91A 2B7OA 2QUTA 1KLZA 4FIRA 3EWBX 3ZS4A 1FY6A 1R30A 3LTYA 4UNKA 2B0MA 2V82A 2C6QA 3CLMA 4AWTA 2ZZ2A 2W0UA 4UR7A 2HTMA 2A7RA 4IXXA 5L9FA 4C1KA 2RKXA 4QSHA 3TKFA 4PH6A 4UTHA 1NF7A 5LNSA 1TQJA 3NPWA 4WY0A 3OEXA 4P61A 1ICQA 3LOTA 1ML1A 2GQAA 4LRTA 4JTFA 1ZAJA 3ANYA 2CZFA 5KMYA 2AQWA 4MYXA 2PE4A 1J4EA 1TCDA 4RKAA 2G96A 1Q3NA 2C15A 1YXDA 2WNZA 3HG5A 4DO4A 2RH9A 4PCFA 3GX9A 4M6VA 4IPJA 3C6CA 4CQ8A 1JRCA 4BR1A 5C6MA 3QC3A 5LGXA 2VFHA 1MEHA 1EB3A 1WA3A 1I2RA 3TQ0A 1GVRA 5CPNA 1A5AA 5LSMA 1OYBA 3W07A 4LNYA 1E51A 2Q8LA 4FNQA 4AB4A 4QQ3A 5TIMA 1FDYA 5KZDA 3NDOA 4P2VA 2YR1A 3LLDA 3L0GA 3NQVA 1W3TA 2DZVA 4JY8A 2C14A 3W71A 4UTUA 1GJPA 2Q3RA 1JUKA 2YPIA 3PULA 4W9TA 3S5ZA 3UYCA 3LCWA 3IIPA 4RCXA 3P5YA 2YYUA 3NQGA 3PG9A 3TIMA 3ABSA 4FEZA 2JKPA 4RR4A 3TMLA 2A1YA 5LNUA 1GZGA 1H51A 3OVRA 3LBMA 3N3MA 4TX9A 2OT1A 4JTSA 3HB9A 3R13A 2TRSA 3I7SA 3DH7A 4X9SA 2YCEA 5HWJA 3L9CA 1KFJA 2RDUA 1F7BA 3S1WA 2A6NA 2QR6A 3PF3A 5TQLA 2ZZ5A 1ZCOA 2X30A 2X16A 3EWUA 2Y63A 1PCKA 3DXIA 1ME7A 2PCQA 3BVJA 1YADA 5EA9A 1G4EA 1H1YA 4PODA 3VNDA 3MHGA 1SR9A 3TROA 2X1UA 4QNWA 3EEGA 1LORA 1L6SA 5I3FA 4ICNA 3UXAA 1DVJA 3UWUA 3TXZA 4Y96A 2ZBTA 2X1SA 2VEKA 3LRKA 1D3HA 5BMWA 3DGRA 3MBFA 1NSJA 2GQ8A 1TPVA 1K7EA 3NM3A 1TPB1 3C4UA 3TV8A 3QPZA 3NL3A 4NXSA 1L9WA 3W7JA 4PA8A 1PE1A 1JJKA 2NUWA 4LVGA 1LROA 1HO4A 5CPOA 3PG8A 2Z6IA 1XC4A 4LWWA 3UNDA 5LKYA 3LDVA 3GAKA 3UD6A 3W76A 2ZRXA 2CZEA 5D09A 1GQNA 3B4UA 5HINA 3PB0A 4O8RA 1FCVA 3KX6A 3G24A 4NJIA 2XN1A 2EKCA 3LXBA 2A7PA 5LNRA 4YCPA 1W3NA 1OFQA 1THFD 3OVPA 1U83A 2JGQA 1OX4B 1OABA 1PVNA 3KVMA 4O53A 2DZXA 3W2NA 2ZRWA 1B4KA 1YXCA 3S9YA 3CU2A 3W7QA 1VHCA 1Q45A 5FF3A 2P10A 4DF2A 1CX9A 4LV4A 3T4CA 2JKEA 3W7MA 1LOLA 4K8HA 4EIVA 1VZWA 2P0OA 4Q32A 5F2IA 4NVTA 1AW2A 1M7OA 2NUYA 4QIUA 1G4SA 1A5CA 2GJLA 3P60A 1G6CA 3W1UA 3MUXA 2FJKA 4JTIA 3PS7A 6ALDA 4ONVA 2F7FA 2ZYFA 2B7QA 1F5ZA 3EX1A 3N14A 3TX9A 2GQ9A 1H7XA 1R2SA 1LYXA 3NL5A 1XFBA 3W22A 5LZLA 3KVLA 3HF3A 1KBIA 3SECA 1SZFA 4LT9A 3M1ZA 1W37A 3FLUA 1B57A 1GT8A 2WOQA 4GE8A 4OQVA 3MI3A 4MPQA 4O50A 5FF4A 1MZHA 3S0CA 4CNOA 4LY8A 1W56A 3BLFA 3A9IA 1OJXA 2FLIA 1UUMA 4LRSA 3W88A 2H90A 2YZRA 3IIZA 5T26A 5KTLA 3HBLA 3B8DA 5FF2A 1JVNA 5A5WA 1OYAA 4K38A 2WKJA 1DQWA 3DU0A 1TTPA 2ISSA 1GG1A 2VC6A 2ZTJA 4R34A 3GAYA 4POCA 4ZQOA 1YXYA 5D2YA 3SSJA 2YYTA 2VFFA 3BK0A 2C0AA 3QF0A 4JEQA 3U2OA 4RXFA 4DELA 4UFIA 1H5YA 1FXQA 2BX7A 3S5OA 1ICPA 1SO6A 4O19A 3M6YA 1LOQA 2EAWA 2E5BA 3QMRA 3TU9A 1TV5A 5D30A 4AF0A 3YPIA 5CZSA 3T78A 4D2JA 2I14A 4Z1DA 1JCJA 3UWYA 3ZFHA 1OX4A 4E2DA 4PTNA 4UTLA 4JYFA 4DPPA 1LDCA 5F2MA 3EXTA 1SO4A 4LUIA 2IQTA 4WJEA 1K8ZA 3MMTA 3G0UA 1H7RA 3CB8A 2GUUA 3N73A 4YWIA 1W5MA 1DQXA 2FFCA 1I8JA 4PL2A 4O4WA 3VE9A 2FPTA 4TR9A 5F4XA 4AWSA 1XBZA 4XTDA 1JCLA 1XM3A 1VR6A 2P1FA 1ZY9A 2CLOA 3S5YA 3RK8A 4UXDA 1SUXA 3M5XA 2DJXA 4N6EA 3TMQA 4HNTA 5G1TA 3G1SA 1PHQA 3U6WA 1J2WA 4MY9A 2A21A 4DO6A 2C13A 1F2JA 3QYQA 4XWUA 5HUPA 5E93A 3CWNA 1VLIA 3W2MA 2R94A 2QDGA 5D38A 1DOSA 3LHTA 4O17A 5AYYA 4GRSA 5DXXA 3T44A 3F03K 5I3GA 3GR8A 3O15A 2G95A 2ABBA 3LM7A 4HT3A 1FWWA 1TPDA 1WX0A 3E12A 3TSBA 1KFKA 2X2GA 4N9BA 3QSTA 4U4MA 3VFLA 1YPFA 2ZRZA 3M9YA 4MY8A 3INPA 4OV4A 3C0JA 1VYSX 2GJNA 3DKJA 1IXQA 1CI1A 3TJLA 2B7PA 5HNRA 1WDWA 2ZZ7A 4IMDA 2PRLA 3LLFA 3T7VA 2CWNA 4LVDA 2HS6A 3EKZA 2VKZG 4UC5A 5G2HA 3W73A 4N4QA 3DFPA 2H6RA 3MYOA 3P62A 2JBMA 4NXKA 3DBPA 1I2QA 2Y7EA 4JIPA 2NZLA 3BLEA 2CZDA 3GDKA 3BV4A 5CSSA 4AF0B 5F2GA 4B5NA 3PUDA 5D2WA 1EP2A 3S8HA 2QCHA 1RQHA 4M7SA 1K8XA 2V2HA 2E6DA 4ADSA 2PRHA 4NX5A 3A5FA 3IVSA 2EPHA 1OVDA 3KVKA 3HG4A 5DBTA 4BI6A 3U8GA 1Y0EA 5E1QA 3GKAA 3PAJA 5FI8A 2KZHA 1SO5A 3W1PA 1TYGA 2ZA3A 3CM4A 1NVMA 1TRIA 3UWZA 1I4NA 1FDZA 4RX0A 5D2TA 2YXGA 5FESA 4O12A 3STEA 3WJZA 2VOMA 1OFOA 2JKAA 1DV7A 3BPWA 4UTKA 2A5HA 5LNVA 3O07A 2FB2A 3RU6A 1X1OA 1EX5A 1U5JA 1YDOA 1PS9A 3L5AA 3HIJA 3VKJA 4JYEA 5K9XA 5J5RA 3SI9A 2E68A 3B05A 1VGAA 2E6FA 4HNUA 5LHEA 3EWYA 3FKKA 1SZEA 1TPWA 1OFPA 4O1CA 3EX3A 5G2IA 2VEPA 2NX9A 3ABRA 2E1DA 1TJRA 3MBDA 5CSRA 4OT7A 1B3OA 1MO0A 4NNAA 1AL8A 1S3HA 5D04C 1DHPA 5FEXA 4GWEA 3ATZA 4OGZA 4QISA 4UFMA 3WFAA 2GVLA 1NEYA 1H7PA 3QMTA 3G1XA 3G22A 4ZQMA 1EP1A 1VJIA 3UWWA 3HOJA 1LBLA 3N34A 4IWWA 1T99A 3JS3A 3S5NA 3NVTA 3GKFA 1BWKA 3CIXA 2A85A 5U7SA 3IVTA 5D2XA 5DBUA 2JGYA 1H61A 1VHNA 1SQ7A 2NXIA 3FJ6A 2TSYA 3GNDA 1EIXA 3P82A 3Q37A 4IX0A 3PB2A 2B7NA 1KM5A 1OX6A 5C2XA 3PBVA 1Z42A 2VXNA 3NG3A 2E5CA 3G1YA 1KM4A 4EOUA 2PC4A 5A8GA 1QPOA 2YDAA 4O57A 3QRHA 3FS2A 3C2RA 1GTHA 2NLIA 3W2JA 2QCCA 1YDNA 3C56A 3G1FA 2CU0A 3N9SA 4TMCA 1TPEA 5BW6A 2QUUA 3STCA 4JTGA 1P4CA 3KVJA 2DZSA 2Y6ZA 1Q6OA 3DFQA 4YCOA 4NJHA 1X7FA 4CQAA 4CCEA 2FDSA 1HO1A 2EGZA 3HMJG 4U28A 5DCDA 3LGEA 1IIHA 1W5PA 1QO5A 2ISVA 1H7NA 2QCGA 2ZDRA 3M16A 5CG7A 2PURA 5AOUA 3LCLA 1Q6QA 4ZQRA 1UBSA 3L0KA 3JR2A 3IVUA 3DKLA 1SSDA 4GUIA 5EY5A 4MJZA 4G1KA 1Z41A 1QAPA 5D32A 2FPYA 1C9DA 1QNVA 2ZZ3A 4NX0A 1PHWA 1XKYA 1SFJA 1VH7A 3C52A 1SFLA 4OU1A 1ME9A 4Z1AA 5AN7A 1FCUA 5GVJA 3S42A 1XDMA 3HPXA 3LTSA 4M19A 4KFNA 4E2BA 1KM1A 4UFHA 1IGSA 4DBDA 4XBSA 2V5BA 1XDLA 3M5VA 3NPXA 5DXYA 5D37A 3CHVA 3QW3A 2WSRA 4MZ1A 1IXNA 1PCWA 3CT7A 3Q2DA 3FIGA 3G18A 3MW7A 1H50A 4Q33A 3WK3A 4A22A 5KZMA 1RVGA 1H62A 4O28A 2FIQA 1O4UA 2RFGA 4IPIA 4FNRA 4OHQA 1WQ5A 4HNVA 2A2IA 1VRDA 3GIYA 4N9DA 4DXVA 1K8YA 4GBUA 3O6DA 4LVFA 3PR2A 4RZ6A 4FB7A 5FEPA 4WD0A 1KTNA 3DFSA 4NU7A 5EBUA 5HR7A 4NNCA 2QCFA 1AL7A 3W3OA 4PEKA 2NX3A 5AB3A 2C1HA 3OA3A 3TK7A 1EPXA 5AHMA 2YW4A 4ZZ9A 4HPJA 3GK0A 3E96A 3HPZA 2QDHA 4YMZA 2QAPA 3W87A 1MXSA 5F1VA 5AHEA 2E6YA 4WXZA 2TPSA 3EWWA 4BI5A 4I7WA 2FTPA 4NJKA 4GJ1A 4FX7A 3PY2A 3W23A 2NWRA 3WJXA 3UQNA 2ATSA 4UCGA 2ZRVA 3EKLA 1XCFA 4N02A 1O5XA 4MZ8A 1QPQA 5EL1A 1LOSA 1PIIA 4X2RA 2VEIA 3HG2A 5F2LA 3R2GA 4A2SA 5AYZA 1W5QA 4IUOA 4DF0A 1SZNA 1XL9A 3TAOA 4ORIA 4NNBA 4O13A 2HSAA 3UZ5A 1N55A 3W7PA 1WBJA 3PUOA 5KZEA 3TC7A 4UFLA 3B04A 3CIWA 1HUVA 1QMLA 4K37A 3GR7A 4MVAA 3NYZA 2ZRYA 1FWSA 1OYCA 3C2EA 1JQXA 1H7OA 4ZVJA 4RLIA 2OT0A 2YGYA 4MY1A 3W6YA 3RMJA 1K03A 3W83A 3NQDA 2JK2A 1F05A 4AHPA 4Y90A 3OVQA 3B03A 1VCVA 2ZQ0A 3SZ8A 3GXTA 3NR0A 5CZJA 1XUUA 3P61A 2BSLA 4CNPA 2AGKA 1TTQA 4ZQNA
chains in the Genus database with same CATH superfamily
3CAWA 4S1FA 1XRVA 4B16A 4FOUA 5E0CA 2A0NA 3GFYA 3TYUA 1MQRA 5BXRA 2YJQA 4RE3A 1LBMA 4JXCA 1TE1A 1LG1A 2JIEA 5LIKX 2O9PA 1OT2A 1SW0A 1C8XA 2XH4A 4F4RA 4JTRA 3VM7A 4O14A 1FRBA 4DWSD 3M47A 2VNCA 2WKGA 1DORA 4P7NA 4QXIA 3OYXA 4XZWA 1PJ9A 3GDMA 1E43A 3CB3A 3WMLA 2D20A 4FOJA 3LXCA 3KZPA 4OBTA 4FHAA 2DVUA 4UTMA 3KLLA 4N9EA 5AHFA 1A5UA 2OO6A 2GWGA 3BLDA 3OBKA 4NJGA 5JIWA 1CLXA 3JU2A 1HZYA 1NAL1 3M64A 5HPOA 4H6KA 1FWDC 3CV6A 3HMCA 4JQ4A 1F76A 3DI0A 5TBOA 5HR6A 1SZRA 1MZRA 3NA8A 4ATWA 3UG3A 3CQIA 1Z48A 1S2CA 1AUSL 2DJLA 1W9DM 5I78A 2AL1A 4ZSTA 4MYAA 2HRWA 2GJRA 5MKGA 1J0ZA 3PM6A 3IWPA 2C0HA 2JQXA 2W92A 4E38A 2VDGA 4ZB0A 3OLIA 4GZEA 5LHFA 1PX8A 3GVQA 1W54A 1MQPA 3WLRA 3A64A 5AFDA 3N2BA 1AMKA 1WDDA 4GYKA 1R8LA 2DW6A 3MS8A 3O63A 2W4XA 3C3NA 3EDEA 1AMYA 1JZ2A 5C2GA 4JIIX 3ZR4A 4L9ZA 3CHFA 1AODA 3LI1A 4LCRA 2GOUA 4AVFA 4LVBA 1FCBA 1TWWA 2Q3OA 2RJHA 3KL0A 4R27A 2FVMA 1JCYA 5CJMA 1Y8BA 1G67A 3MTWA 1JR1A 4IGSA 1YYAA 4JFVA 5EMJA 3O8AA 3TVAA 1N8WA 4FNSA 3BOLA 5HMSA 5U4NA 4C6BA 1C7TA 2E6AA 4GVGA 4C90A 1EJRC 3K4DA 1JI1A 2WJFA 5DT7A 2J47A 5B80A 3LB0A 1A5SA 2J27A 5AYBA 4GOAA 4QROA 3UJ2A 2PWDA 4IIGA 1KFCA 4JZ5A 3NQEA 2DZWA 1C90A 1Q6RA 1QATA 5HUOA 4H19A 2WLYA 4ZQCA 1FHUA 5CJ5A 4QS6A 3SAZA 2EPOA 4WY0F 3K1DA 1L6WA 5CZ0A 4QR6A 1B9BA 4ZMGA 4UTWA 3B8VA 2WMFA 4HNLA 3G8EA 5IXEA 1BVZA 2ZZ4A 4UWMA 3A22A 3SDOA 4PTWA 1TV3A 4JKKA 3W1RA 1US0A 1WDPA 1XH2A 4I6VA 3GB6A 2WVSA 3S2MA 2X09A 1E0XA 2YLLA 3N9RA 4GK8A 3L0NA 5A8NA 1DKWA 1KGWA 3ITOA 1RLDA 1BEUA 2QJMA 3I7QA 3BW2A 5I3IA 4TMBA 3FNDA 4E4UA 3WQDA 1XC6A 4JR5A 4GIEA 4XD5A 3MP4A 4DRSA 4AZCB 1QI0A 4U33A 3TSMA 2GGHA 3A24A 4P5UA 1KV8A 3UGRA 4X61A 1GG0A 3V75A 2R1MA 4K6AA 2YFOA 2NWSA 4KFOA 3A13A 1W1A1 1ZNNA 4F2BA 5JIPA 5DANA 7REQB 3LCHA 1S5WA 1UMLA 3QKEA 1TWIA 2VRKA 4PTXA 4ZOBA 1FUYA 3MA8A 3WBYA 3W7OA 1HX0A 3GTXA 3W1LA 4MOZA 1C29A 3NQ6A 4F2TA 4KWWA 4C1LA 1UP2A 3IJ6A 1I6NA 1UG6A 1X6UA 1VS1A 1FWRA 5K2ZA 8XIAA 1KCLA 2QJGA 5BXPA 5JH2A 3PVFA 4UR9A 4WZHA 3GNOA 2XIOA 2F6UA 2PGEA 3WF1A 4O15A 1PZ2A 2W66A 4HIBA 2OYMA 1Q8JA 4C7FA 3T0AA 1M01A 4MLJA 4PEEA 4HPGA 2C19A 2Z1VA 1IWAA 2Y70A 2O7SA 3NQ2A 2NUXA 2HK0A 3APYA 3M0MA 5A6AA 3A6OA 4LF2A 3EAUA 4IMGA 2QJHA 2G3NA 3AJ7A 3HGOA 3W84A 1QNSA 4QDWA 4GUFA 4QEEA 1BTMA 2DUZA 1UD5A 1R3VA 2PLJA 2QLYA 4Y9OA 4HYWA 2YLAA 5G4WA 1CXKA 3A3HA 1JUEA 5I3KA 4PFMA 1HG3A 2Q71A 5I3HA 4XSLA 1FH8A 3ABQA 2HROA 3EOOA 3E49A 5AZ1A 3CZEA 4B5TA 3PWIA 4BY3A 4J5NA 4NZ4A 3T05A 1SJBA 3AIBA 5A94A 2YCJA 1NOFA 1I45A 1WXJA 3WQEA 1VBHA 3KRBA 4Z1BA 2ESCA 3CIVA 5EKYA 1EJUC 2VZTA 3G1HA 2FZ9A 4JCLA 4W7VA 2CFFA 5DN1A 2GVJA 1TQXA 3RITA 3VNMA 1LL4A 4QAIA 3ZSTA 3NXLA 1OB0A 3T0BA 2QAFA 4CN1A 3QY8A 2ZZ1A 1N8IA 1BVWA 1TIMA 4HMEA 4WUIA 4IG2B 4BWLC 3HJZA 4MG4A 3B06A 4Z17A 3F2CA 5E9XA 1EHNA 1S3TC 5HJYA 4HU8A 1KBKA 1ISYA 4Y9MA 1XH1A 4AG0A 2P8BA 3FAWA 3WQCA 3A5VA 1MNSA 4I5XA 1W1YA 3FYOA 2D73A 1ZFJA 1AQFA 2J7BA 3VM5A 3ABOA 3CXOA 5FD0A 1W17A 1JUBA 3DENA 4AH7A 1YTEA 1AQMA 1QR7A 3DFOA 4OUEA 1B90A 4XB3A 4ECLA 3M46A 1CEOA 2ZE0A 3FDKA 3MP3A 1UWQA 5H1WA 3VOGA 2WZTA 3AS1A 4TX6A 5IDIA 1JIBA 3ITVA 1VBRA 3TC6A 1B3ZA 5DT5A 4C1NA 1GORA 4KWOA 4HQVA 3CPUA 1GPFA 3IGXA 1FWBC 1UUOA 1E6QM 3M4HA 2ABAA 5EMLA 5HBFA 4UQEA 4REQB 1KR0A 1NWUA 1VC4A 4TV5A 1WV2A 3WYZA 3UP8A 1AW5A 3TN6A 4ZXLA 4O1EA 2IPWA 4AEOA 2IPFA 4MJ2A 1J2BA 4K39A 1BGAA 3R8RA 5C54A 4KGLA 3IGSA 3KBVA 3NSXA 1PWMA 2PU1A 3GFXA 3NO5A 3W1QA 5BXTA 1FWTA 4IJCA 1E4NA 4XKMA 3S9IA 1IEXA 4BKNA 1XSJA 2D1ZA 3H7VA 4MB1A 3TQKA 3ZIZA 3KS5A 5CC6A 3HO8A 3DFYA 1G94A 3HPAA 3OHIA 4Q4OA 1R9XA 2VC9A 4LV9A 2Y8UA 1CCWB 3SRHA 1UKOA 2X0HA 5HA7A 2OOGA 3QMSA 2Z1KA 2PGRA 2ZX8A 3U57A 1ZJAA 4AZHA 4YTTA 4DJDC 4AZIA 3EXSA 3GC2A 3RG6A 1V08A 3UXIA 1EXPA 3S2LA 1EYWA 2FVKA 1N8FA 2HCVA 3LTPA 3BAYA 1KGUA 4X22A 3OLGA 4J7RA 4G6CA 3HGJA 5CZTA 3GNNA 3GNRA 1NARA 2PC8A 5FA5A 5A6MA 2YL6A 4NJJA 1IF2A 2CESA 3DX5A 2VI0A 1IXOA 4M7TA 2PZ0A 2Z00A 3EPOA 4DYJA 1O7AA 2D0HA 1KLYA 4MTVA 5K9DA 2O56A 1W1VA 2FZBA 4GO8A 4YN5A 1G69A 4M6UA 4KPLA 4RE2A 1GNXA 2MNRA 5HWMA 5MHBA 3MY9A 3UY8A 1Q4NX 3I3BA 3BG3A 1UH3A 4LH8A 3NPUA 4QSFA 4LS2A 3KM8A 2ZUMA 4LY4A 4PMXA 1P5BA 4J40A 1I2OA 4LTSA 2HK1A 3UY7A 4Q6XA 4XV0A 4FF7A 3TJXA 1SO3A 2ZOXA 4MNJA 3TNOA 4X0NA 4H00A 4ZQPA 5E6ZA 2V68A 1MXDA 2PDXA 3G1DA 5D02A 2DIJA 4WXYA 1XLDA 1EA0A 1N7KA 1LJYA 1C3FA 4C6MA 3VKDA 4K68A 5A95A 3CMFA 1MRAA 4JBRA 4JL2A 2OZ0A 4C60A 2PDIA 1V6YA 1W6TA 2PLKA 1GOMA 2D2JA 4DUXA 3FOKA 2PWFA 3IS4A 1EJWC 2Y62A 4H4IA 3KXQA 3T1GA 3JZEA 4LYKA 4W8BA 2WHMA 1C92A 3TFCA 3TR2A 1REQA 4NZFA 2Y88A 5KEZA 2A3BA 4NG3A 4ACZA 5BYWA 2ZRUA 3SURA 3WO8A 3AMKA 4L64A 4ZFCA 3PPHA 4RV3A 3VIIA 4KQNA 1IEWA 4IQLA 2XVPA 1B4EA 3P84A 3PWGA 3N4AA 1KKRA 2PDNA 1M7XA 3O05A 2DZBA 1UCWA 3PFMA 1WXYA 3W9ZA 2B31A 2XFYA 3WNPA 2DVXA 3TJ4A 4GMEA 1EUAA 4AD0A 3CUFA 5C70A 4IFOA 1DWIM 3AU6A 4KWVA 1E6RA 3NJ3A 3VC6A 2X0YA 4IFRA 1CW2A 3A9BA 4S39A 2X1RA 4L4MA 4PC8A 3SGZA 5HJLA 1UKPA 5EMUA 3F4NA 2X1TA 3UA4A 1JF5A 1XYBA 2VT0A 4CCCA 2J88A 3VAVA 1BYDA 2F8QA 3TA9A 1DJQA 4HSHA 3WK1A 1OFDA 1P0KA 2BGNE 1FP8A 3DHPA 4PBEA 3NDYA 2Y24A 4DYKA 2VUYA 2V69A 2VFIA 1DJXA 4IX2A 3H26A 4AWUA 5AZ0A 5BCAA 4M51A 3VMOA 1OG6A 3N04A 1T96A 3AUJA 5E6YA 3Q65A 2OWXA 4DI9A 4L9XA 3FSTA 2F84A 1Z8AA 2J9ZA 3AHTA 3GXPA 4TVCA 2G97A 1T8XA 4UQBA 4CD8A 4F9JA 1T40A 2ZUWA 3UXDA 3OGSA 3BUVA 3GXDA 1HIZA 4UNIA 1R47A 4LAKA 3PJXA 2WQPA 5HQLA 1LG2A 3MYPA 4CNUA 1ZBKA 4DJEA 3MSDA 3GG7A 3VKCA 2E67A 4UTTA 4C6PA 3UZZA 5KSWA 3O6AA 1J5SA 1QJWA 1Y7VA 5CQ1A 3ES8A 3GHTA 4O18A 2G3IA 1PKYA 2V0TA 1CLKA 5AYIA 1GYMA 1EYEA 2GVGA 1ZBCA 1KRBC 3E6EA 3LZ5A 2AL2A 3QYSA 1IXPA 1KFWA 4CCDA 4PUJA 2XGBA 1J10A 2HPMA 2WZEA 3AMGA 2XFRA 4R88A 4JIQA 2AMXA 1TPFA 4WOQA 3W7NA 3WUFA 4XAGA 4IMFA 5D9OA 3TTYA 3S6DA 2Y61A 3FFSA 4D9PA 4NRSA 4C1NB 1MNZA 5DF0A 1ITXA 4LS1A 4Y8FA 3BW4A 4MB4A 1DEDA 1MI3A 3VUPA 3CGTA 1F3TA 5HWNA 5FF7A 4A6GA 4U10A 1NFBA 2Z2BA 3TUUA 4AISA 4A3QA 4DVOA 4E5TA 2DZUA 2A4AA 2V5CA 4FNTA 4D8LA 3BICA 2DZAA 3B8TA 3SUWA 4NIRA 2VHLA 3W72A 1E3ZA 3L5MA 1F3EA 4D71A 1D7KA 1E0TA 5E09A 3TQVA 3TYAA 3GHRA 2YSWA 4JTHA 1KTCA 2QYGA 4HHLA 3CTLA 3QVQA 3ME3A 1M65A 4RPPA 1FY6A 3VYLA 3PK7A 1NWTA 6XIAA 2ZZ2A 1MMFA 3HV9A 4F8XA 5HPCA 3GXMA 3TKFA 3L23A 2QUMA 2VRJA 4GQGA 2HZGA 1ICQA 2V38A 2VX4A 1YBQB 1JD9A 4LRTA 3IJQA 1ZAJA 2CZFA 4DWDA 1V8EA 1SJAA 1Q7MA 4DO4A 1LLOA 3GX9A 1UH4A 4CVUA 4BR1A 3WLQA 1MEHA 1WA3A 1T6MA 1I2RA 3TQ0A 1GVRA 3WLHA 3R0UA 3QN3A 5I09A 4IM4A 4QQ3A 1FDYA 1U1HA 3LUTA 3NQVA 1W3TA 4W8AA 2DZVA 2IKHA 3WD1A 4UTUA 3PZ9A 3VGGA 2Q3RA 3S5ZA 1OEPA 2I56A 4OBSA 4MHBA 2C1IA 3PG9A 4MPKA 3ABSA 3TIMA 2P76A 2JKPA 3F2BA 2OLAA 1GZGA 3A3WA 4DJFD 3OVRA 1YMYA 4TX9A 3PN8A 2TRSA 4X9SA 2YCEA 3VINA 5GQBA 2WAGA 2VZSA 3LM3A 3S1WA 2WK2A 3APTA 3EOUA 3KE0A 3RR1A 4B91A 3PF3A 5TQLA 5A6KA 4CN6A 3I3EA 1Q13A 2Y63A 4H7ZA 2QPXA 3F5JA 1JPDX 3ITTA 3IAQA 1YDYA 1ONXA 1PCKA 1ME7A 2Y5EA 4MWAB 1B5TA 3NO1A 2PCQA 1W1TA 3OBAA 5EFDA 3CUJA 1YADA 3TZFA 2PF0A 1TFVA 4M80A 1V79A 1H1YA 3DCPA 1W8GA 4H6RA 2J75A 4ICNA 2O0TA 5XIAA 4I9MA 3SQMA 2ZBTA 3T6CA 1D3HA 3ALGA 3ONBA 2TODA 3MBFA 1XIFA 2GQ8A 1K7EA 1DPMA 5FJTA 4BQ3A 3NL3A 4NXSA 3H2MA 1REQB 1PE1A 2NUWA 1PKNA 2Z6IA 4I9TA 3SSZA 4LWWA 3VGBA 1VEPA 1CXEA 3UD6A 3TYEA 3W76A 4RL3A 3QY7A 1GQNA 2E1WA 3KX6A 2EKCA 3LXBA 2XVNA 3KTSA 5BRQA 4IQJA 5CH9A 2VWSA 4YCPA 4CQBA 3WD3A 1C7SA 2GK1B 1MUMA 1THFD 1LUCA 1OX4B 5LXEA 1PVNA 3KVMA 3RUBL 3W2NA 1O5RA 2ZRWA 1BFNA 1YEYA 4ZO8A 1UWSA 2XINA 3URAA 5ECVA 1WDRA 2WMGA 1XX1A 2EO7A 1KBLA 4LV4A 1JDFA 3T4CA 3MB9A 4EIVA 1FA2A 1M7OA 2NUYA 1WZMA 2ZDSA 1YE6A 1A5CA 4Q4MA 4UQAA 3L7RA 1G6CA 3W1UA 4PGLA 2FJKA 3ERPA 3WLOA 3EB4A 4ONVA 2ZYFA 2B7QA 1V6WA 2OR2A 1ZB5A 3EX1A 3N14A 1FWFC 2F61A 3ZM8A 5LZLA 3HQNA 2WQDA 3RX4A 3SECA 1SZFA 4LT9A 3GRIA 1W37A 3FLUA 4GE8A 3T2OA 2W61A 5C9WA 2BHYA 4EPDC 5FF4A 3GSMA 1AH0A 1OJXA 1LWHA 5T26A 3UPMA 2VC7A 5KTLA 3THUA 5FF2A 1Q6CA 1JVNA 5A2AA 3DU0A 2ISSA 2ZTJA 4POCA 4I8DA 2ICSA 2C0AA 2BB0A 5EMYA 4HU4A 3LN3A 3GIQA 4AZ7A 3P0WA 3E2VA 3EDJA 3S5OA 3CQKA 3IARA 2VQTA 1PEZA 1DWAM 2EAWA 4L80A 3QMRA 4FLRA 3O7UA 4KERA 3TU9A 1TV5A 3YPIA 5CZSA 4XBJA 3OGRA 1UUQA 1XSKA 1E9YB 5LIUX 2GSHA 1JCJA 3VOFA 3UWYA 3ZFHA 1R87A 4PTNA 4JYFA 1LDCA 3EXTA 1UR1A 2GUUA 1KQZA 3OZPA 3VD7A 3VNIA 5IRPA 2RJGA 3K2GA 1RBOB 3KL5A 4DJFC 5D8WA 5F4XA 4EX4A 3M0XA 1J18A 1ZY9A 1SUXA 3WNLA 3TMQA 5G1TA 3U6WA 4DO6A 4FMVA 5E93A 5H6HA 3AIWA 1VLIA 4ERGA 1IZKA 1LL6A 4O17A 3A3XA 3F03K 2PI6A 3AS0A 1FWJC 2BP1A 2B81A 4H7VA 3LM7A 1CGXA 1TPDA 3RO6A 3E12A 3GNXA 3TSBA 1KFKA 5I07A 3QSTA 3VFLA 2A3EA 1ITCA 2ZRZA 2QMKA 3M9YA 2RUSA 4MY8A 3ZJKA 3C0JA 1B30A 2XIBA 1L8PA 3FJ4A 2GJNA 4I9JA 3RMEA 4AY8A 1J0IA 2B7PA 3VDCA 1JYXA 3CMJA 2RGMA 2J78A 3N15A 5JVLA 2PRLA 4LVDA 3EKZA 3W73A 4AX6A 5F7UA 1VENA 4N4QA 1YHTA 1D8CA 1EJ7L 4NXKA 3WL0A 1KCXA 2Y5SA 1UW9A 3DBPA 2Y7EA 3CYVA 3RO8A 4GGBA 4AF0B 3TN3A 4ZODA 1YNQA 3OTRA 3PUDA 3S8HA 1ZZMA 2QCHA 3W0KA 1RQHA 4QX4A 1UP0A 5FCZA 2E6DA 3GO2A 1WKEA 2J79A 2PRHA 3NTYA 3RXZA 1HJWA 4W7UA 1ELSA 3VIFA 3KVKA 1WO2A 2PEVA 2XZ7A 3U8GA 1Y0EA 5E1QA 1OGBA 2KZHA 3UA3A 2ZA3A 4AIOA 3CM4A 1NVMA 2XIQA 3EBVA 4RX0A 3RIKA 3I4EA 2HJPA 2GUBA 5XINA 5BOFA 2JKAA 4UTKA 3BPWA 3N2OA 2A5HA 1AD4A 3REQB 2FB2A 1X1OA 4WSJA 1YDOA 3HIJA 3KWXA 3UFYA 2QW5A 3I6TA 4AZGA 3V1HA 4W8LA 3T4WA 3EWYA 4LNCA 3MV11 1E6SM 1HGWA 2WB5A 1TVLA 1GCYA 1ZSXA 4OOZA 1NELA 2VEPA 2NX9A 3EWCA 7CGTA 4LUTB 1TJRA 3MBDA 2CXEA 4J28A 1S3HA 4IFKA 3ATZA 1BRLB 1TWSA 3SN1A 3SUVA 3EMCA 3WFAA 2GVLA 2REQB 1QI4A 3POHA 1NEYA 1CGWA 3QMTA 5CC3A 3A47A 3G1XA 4ZQMA 3WSUA 4PE8A 1F6YA 3BLOA 3UWWA 2FZ8A 1E72M 3N34A 4IWWA 4GXWA 3UJRA 3S5NA 4XAYA 1HP4A 1J12A 2FHBA 2JGYA 1VHNA 1SQ7A 2NXIA 4DM2A 3GNDA 3PB2A 3TZNA 2B7NA 2G3JA 2VXNA 3BE7A 2WNWA 1KM4A 3PJUA 4H04A 2XTKA 4YPJA 4H6QA 3QXBA 1TE6A 3WFZA 2NLIA 4MAZA 1YDNA 5I7GA 3L2LA 2BHUA 1AQ0A 2Z1XA 3ZMRA 4MM1A 1BLIA 4ZO6A 1J0HA 3G6MA 3W6MA 2Y6ZA 1XV8A 3GS6A 5HNTA 5AC5A 2ZICA 1W9VA 1OADA 9XIMA 3HMJG 3DOPA 3VDBA 4U28A 3LGEA 2ISVA 3BMXA 2PDLA 3OU8A 4WKAA 2F38A 5CG7A 4ZQRA 4FAMA 2BGQA 1UBSA 3L0KA 3JR2A 4B92A 1EGVA 3KL3A 4J3UA 1UZHA 4M8UA 3CWHA 3ZOAA 4NX0A 3QGVA 1XKYA 3SEPA 4IIDA 1SFLA 2OQYA 1ME9A 4PUUA 5AN7A 2ZVRA 1MWOA 4IUGA 2W3ZA 3K8MA 4UFHA 2OXNA 4B15A 2ZX5A 3QW3A 1JDCA 3KBSA 4JQ1A 3G18A 2J66A 1H50A 3KP0A 2QZRA 1RAKA 4D6CA 2QDDA 3GH7A 4FNRA 4XZLX 4C91A 4QJ5B 3ISIX 1M9HA 3K4AA 1V93A 4GINA 3ITYA 3O6DA 3PR2A 2BHZA 3HU7A 1F9CA 5EBUA 4NNCA 4CEUC 5AB3A 1QI2A 4HPHA 1EPXA 5AHMA 4L1XA 3HPZA 1XISA 4YMZA 4ZTYA 5M03A 5F1VA 5AHEA 1VEOA 2QNEA 2TPSA 3EWWA 4BI5A 1RJRA 4NJKA 1HVXA 3RU8X 2CHNA 5HDRA 2BODX 4UCGA 1TIWA 4G7EB 3AS2A 4QQUA 4MZ8A 1QPQA 3KBWA 5F2LA 3R2GA 5AYZA 1WZAA 1V51A 3UCQA 1KXQA 3TAOA 4NNBA 1MQQA 2G8ZA 4TVDA 3UCDA 1EPVA 2WBGA 3EA1A 2YBTA 3PUOA 3OZOA 1LWIA 5KZEA 4UFLA 3B04A 3CIWA 1E0WA 2ONEA 2ZRYA 3C2EA 1QRQA 2JF7A 3B9DA 3L4ZA 4ZVJA 3W6YA 5ABEA 3RMJA 4P7RA 2UZ9A 4HD5A 1F05A 4XAFA 4AHPA 4Y90A 1FFRA 4J3WA 2ZQ0A 3E0VA 4GBDA 3GQYA 2GQ3A 3LGDA 3P61A 4L1WA 3DDMA 1XCWA 1C8VA 3TYDA 1JAKA 3KOXA 3CL6A 2EPNA 1WKYA 2GL5A 4CU8A 1HTIA 3FJNA 3QHMA 4JN8A 1YX1A 3AWOA 1NJJA 4OE7A 2BVYA 3L4UA 3AZRA 3M5YA 4RV8A 1VPXA 4UBPC 2JFEX 4H9ZA 5FIPA 3BLLA 3C0LA 3THQA 4ZEPA 1D3CA 1GZ1A 1UPMB 2Z28A 2NQJA 3PNZA 5HQEA 3PC0A 4S3CA 3PTMA 1OM0A 3VE7A 3GW0A 5D9PA 4DBUA 3RJYA 3BG5A 5CKSA 3NFUA 4PFHA 4L4LA 1CZ1A 2QJIA 1WBHA 5HULA 3RCYA 4AMAA 4NZJA 4KRTA 1WAUA 2C8NA 1B31A 3B9NA 1XUZA 1BD0A 4Q8QA 4Q4KA 2AQOA 2I17A 1Q6FA 4IPNB 3TOYA 1FQ0A 4X0VA 3JRKA 1VF8A 3MHFA 4AMCA 1TWZA 2DSUA 4DNMA 1TB3A 1YDVA 1DIEA 4M3PA 1OBAA 3KCJA 4GX8A 1K7XA 3PJTA 2W79A 3UPWA 2QUNA 1H3GA 2AAAA 4MSSA 1WUFA 4JTLA 4E3TA 3C5QA 2BLEA 4O16A 1GW9A 3STFA 4DPQA 4JQ2A 4LFYA 2I9UA 5IBXC 2CLHA 2YBUA 1NDVA 3V5CA 3GVGA 4HCLA 2QVHA 1U1JA 2J7HA 3KDOA 4M6QA 1OK6A 1XINA 3H7RA 2G0WA 2DZPA 1C93A 2V81A 3ANVA 3RM4A 4DWSA 5ABTA 5AECA 1RQEA 2WMIB 1X8FA 1SU5A 5B7ZA 3RPDA 2WWCA 4F0KA 1H2JA 2JALA 1XLFA 1EWEA 1E5NA 1TTJA 2WSPA 3BO9A 4DQWA 3GBEA 3EEZA 3MZ2A 1RP8A 2XH0A 2Y7FA 1XD1A 4K7VA 2XVKA 2Y8VA 3GHUA 5JBEA 2OQLA 1POJA 4DEFA 1R3WA 4WY0B 3AHYA 4R7JA 1LP6A 2OCZA 5MF5A 3MMDA 1PZ0A 1ZBWA 1J96A 1JFHA 2NX1A 4IPPA 1TREA 3MDUA 1VFUA 1XW8A 3H6OA 3TYBA 1UD6A 4QCEA 4DM1A 4DZHA 1FVPA 4A4AA 2WPGA 4RXGA 2AKZA 4FZIA 3GM8A 4A3UA 1A5BA 4LC8A 1SGJA 4XK2A 4NAFB 3USBA 1UMYA 5A6TC 4JY9A 3D46A 4DZ5A 5K9CA 1B3XA 5DLCA 4A2RA 1GPWA 1ZENA 1TMLA 2FB3A 3LI0A 4GC3A 1GEQA 3PZTA 2CW6A 5F1UA 1XGEA 1PAMA 3TTEA 4Q8OA 2NV2A 3KOWA 1H7WA 1S2WA 3LCIA 4O1FA 3E38A 3XIMA 1N82A 1VFFA 4GNKB 1GYNA 1XRTA 2VDIA 3W81A 3A23A 1V6XA 3VKAA 1ZHAA 5LA0A 1JNEA 2G37A 1J0JA 4LAUA 5M5DA 1NQ6A 1L6FA 2DIKA 2O9OA 3FEQA 5EFFA 3CYJA 1GHRA 3VTRA 1RZMA 1R6WA 3SUTA 3VNLA 4FALA 1Z44A 2CIPA 3M44A 3ZWTA 5M1TA 4YTRA 4JD4A 1XYAA 3QKZA 3ID7A 1V0LA 2PWVA 1KM0A 1EBGA 1FFQA 4YVVA 3W70A 4A35A 1V6TA 4QM1A 4K1GA 3L4WA 5T9BG 4M6PA 4GXMA 3BGAA 2FH6A 1J6OA 1W1IE 1JCXA 3EMZA 4ML9A 2OSYA 4LYRA 4B90A 2FZDA 1DE6A 1GHSA 2C7FA 1RK6A 4IP7A 4W88A 4UTTC 1T41A 6A3HA 5K7JA 4NUWA 1XXXA 5BOOA 3QC0A 2PS2A 3AALA 4LCSA 1EH9A 5AVNA 1F6PA 1EXBA 2HQAA 4NZ5A 3IIXA 1K9TA 4Y9AA 4NT0A 2DT0A 4N4PA 2VX6A 3VPLA 3LSCA 2O7QA 3W00A 4K1WA 3S4TA 3L4TA 1BAGA 3T8QA 1BWLA 2CLKA 1R3SA 1M3UA 4YVPA 3RNDA 3UZWA 2P53A 2H8XA 3AI0A 2E4TA 2ZA2A 1SMDA 2ZFAA 2CBVA 1VLWA 4H3DA 3NOEA 2OMAA 2Q6ZA 2GUYA 3G5EA 1P0EA 4Y9NA 2WC7A 2B4GA 1A3HA 2Z4GA 4MGGA 3WBEA 2XZ9A 1QHZA 1WYIA 1E73M 1A53A 1NDWA 1JGIA 3PBYA 5FF0A 3GE7A 4AHOA 5FKYA 4WX2A 4H9XA 3HPSA 3LHUA 2YB1A 4NAEB 4KCUA 3QSRA 1H1ZA 4UIOA 3TSDA 2Q8ZA 1CPUA 2WKLA 4Q7NA 3MP5A 4FO4A 3EGJA 3RCMA 1SFSA 2EHHA 1Z3NA 4L1GA 3B9OA 1EGMA 3L67A 2QPSA 2WC3A 3H2NA 3SCSA 4CNTA 3DHDA 4F2UA 3W38A 5IBXA 1W9UA 1OX5A 1S39A 1O5KA 5K4XA 1TV8A 1C8QA 2EPLX 4XVEA 1FWNA 4FLSA 2DP3A 4PYSA 1FWIC 4MLRA 4GABA 3V35A 3BAIA 3G1AA 2A3CA 4L6DA 1TKKA 2OELA 5LA2A 5BU6A 2A7NA 1XF0A 1FWAC 3LMZA 3FYYA 1GGOA 3OJGA 1E6XM 4G56A 2DW7A 4I5RA 4JICA 1X6LA 4PULA 2NXGA 2QCLA 1IEVA 2WSQA 2YDRA 3ZR6A 1J0YA 3QBUA 3UZJA 4YU1A 3T07A 2E8YA 3G0SA 1U2YA 3LV5A 1KFEA 1H0GA 4PMJA 2GDUA 3MVIA 1XHGA 5FL1A 3E2SA 3WJWA 1ZUAX 4IL2A 3VKKA 3LRLA 4BFAA 3RM9A 4F0RA 3WDPP 5JH1A 3PPCA 3R6IA 3II1A 1VIZA 1UD2A 4B5XA 3H4GA 3C8FA 5G1MA 1J8VA 3CJPA 4YL2A 1F6KA 1UR9A 5DY2A 1QCWA 3TWBA 2HS8A 1R3QA 2RGLA 2V2DA 1XLLA 3U4FA 3UW6A 2IKGA 4H01A 1XDJA 4S2BA 4AZ6A 3RLUA 4KCWA 3VIMA 1GVYA 1BGGA 1Z69A 3GU9A 2J9YA 4XZBA 1ADOA 1K02A 2VDHA 4WDWA 3CUHA 1PIFA 1TV7A 2VQUA 5GJMA 2XUCA 1UB3A 7XIMA 2VX5A 1R2RA 4ACYA 2HDJA 4AD3A 4DAIA 1KA9F 3W1MA 5F4SA 3PNUA 1IYXA 4TUFA 1ITQA 3P67A 4Q3MA 1DJHA 4J2PA 1DXIA 5H2ZA 1PPIA 4W84A 3SRFA 1MEIA 1GVQA 5FEZA 3GTIA 3WN6A 1QUMA 4ATDA 4GO9A 4HZ7A 3W1TA 2PDYA 1FH9A 3WNNA 4UNLA 4O11A 3TTSA 1XLEA 1PV8A 1DIKA 4FA3A 3W74A 1R38A 3L66A 5I06A 1AH3A 1DIDA 3DI1A 5FAJA 4DBEA 2PRMA 3LS9A 4TV6A 1OINA 4IJBA 2V5DA 4PCNA 1CECA 3S1UA 4KFPA 3VIOA 4ZSUA 2LLEA 1RK5A 3WK2A 3A4AA 4CD4A 3RFAA 1KKOA 4WOZA 1UD8A 4Q7IA 1XIMA 3LSBA 2WNNA 5A2BA 1IIGA 2OQHA 2OX4A 2E40A 5CC5A 1Q6DA 1RXOB 2D0GA 1R2TA 1ZJBA 3L12A 2XWDA 4HN4A 3HURA 4EVZA 1VJSA 4LS0A 4HJFA 4LANA 1KB3A 3KRSA 4LB4A 3ARVA 3M0HA 4ZO7A 3AMDA 2X2YA 2ATMA 2I9EA 4ALDA 1R86A 1M04A 3CL7A 3STGA 1K9DA 1W2PA 4A21A 1V3LA 1WNOA 2POZA 2ISWA 3F4WA 3WEMA 3B0VC 3UZXA 3E5BA 1OFEA 1GTEA 1Q8AA 5CPMA 4ADTA 3FKRA 3HFTA 3MC5A 4GUHA 1K4HA 4JIHA 3C2OA 3M0ZA 1SYTA 3WLPA 3ZVHB 1H4PA 1F07A 3GXNA 1J0KA 2NSXA 1KR1A 3QHOA 3NQCA 3UWVA 1KC7A 2YL8A 4FXJA 1DWHM 1TRDA 4PTDA 1VB9A 3CC1A 4LX4A 1K6WA 4AD5A 1FH7A 1UWUA 3BCJA 2X05A 4QE1A 2XFFA 3P8JA 3G3MA 4LW7A 3SIZA 2OGJA 3DC8A 2QIWA 4AEFA 3MV01 1IHIA 3L65A 4DF1A 3MUAA 1W1B1 2Z6JA 4BA0A 3AIRA 2XIIA 3O1NA 4QRNA 2QV4A 3L5LA 5EYWA 3E2RA 1DBTA 5L6UA 1GWJA 2F6KA 2UY3A 4HSNA 3W37A 2Y8KA 7ENLA 3ZWSA 1J5TA 2O9TA 2QKFA 2P0IA 1RJQA 1RP9A 1XYZA 1L6YA 2DQWA 1XI3A 1DL3A 1RVKA 2CZVA 1XD0A 3LX9A 5CSYA 4PR4A 5C9XA 5T9CE 2OKOA 3HGRA 2BWGA 4BWLA 3GDLA 2VFGA 3V1PA 3EZ4A 4R85A 2VURA 1QW7A 1VFOA 4MUPA 1VP5A 3Q58A 3UG8A 1R0MA 3FHAA 1EEXA 1E4MM 4HK7A 1LQAA 3LD5A 4X9YA 3H54A 8XIMA 3B0XA 4EACA 4LJ3A 3R8GA 5KINA 5HQMA 4C6KA 4LCQA 3SM0A 4LOCA 4JDYA 4JFUA 1O94A 4F40A 3E0IA 1JCTA 5I79A 4TQTA 1B1YA 3BC9A 3O16A 3NZ1A 1VJZA 2XGIA 1MW2A 3ES7A 2EJ1A 2ACUA 3U7BA 4ORMA 1EOKA 4JX5A 5REQB 4FR1A 4RK8A 3W4RA 4A3RA 4AHQA 4R33A 4H8UA 5IDZA 2R8WA 3M0VA 4RZ4A 3IIOA 2V3FA 1VAHA 4AQLA 4PRTA 1TJ1A 1X7IA 3LHYA 5LYRA 6TIMA 3KZSA 1HL2A 4O1DA 1VD6A 2W63A 3C2FA 1UR2A 2Y7DA 4L5ZA 3MWCA 1Q65A 2VWTA 2CERA 2ZZ6A 6CGTA 3F1QA 1O60A 1POKA 4IP5A 4UUIA 3S3GA 1U5HA 3NPVA 3A21A 4DJEC 4HHPA 1GZJA 4DXKA 3P5ZA 1V7YA 5G4EA 2V2CA 3G0XA 4HKPA 4IXHA 1ZS2A 2WVUA 3TH6A 4L61A 3VDHA 3AOFA 9CGTA 4DO5A 1PIGA 2OG9A 1YLVA 1CB2A 1H49A 4M5PA 5CG0A 2Y0FA 4HMDA 3QQ0A 2OX1A 2WJEA 2OSWA 5H91A 2B7OA 1T8QA 4FIRA 1A0DA 3ZS4A 2PDMA 4ZB5A 3LTYA 2PFHA 3OQEA 3CLMA 1R9ZA 2HXTA 2OODA 2W0UA 2HTMA 2RKXA 2BBFA 4AC7C 4PH6A 1EZWA 3W24A 4UTHA 2VYOA 1NF7A 3LGGA 4IIEA 1AQHA 3OEXA 1UKTA 3NDZA 3O9NA 3WLTA 4QTGA 4JTFA 1BF6A 3ANYA 2PDFA 4RW5A 4Z2LA 4HYRA 4HHMA 3S2JA 1VBGA 3PZIA 1TCDA 4RKAA 2G96A 3E1F1 1W3JA 2WNZA 3QLDA 2RH9A 3BLPX 3C6CA 4CQ8A 1SJDA 3QC3A 4GJIA 3O3RA 3QTPA 1QK2A 5LGXA 4IIFA 1YE4A 2DGAA 2ZUNA 3W02A 1A5OC 4DUOA 1RUSA 1XLJA 5CPNA 5LSMA 3T9PA 3W07A 3EA2A 5DQPA 1YKWA 4LNYA 2BY1A 2W5FA 5KZDA 3F7JA 3TP4A 2YR1A 4ZOEA 1U33A 1HKKA 1GJPA 2JEPA 2YPIA 3PULA 3UYCA 2VZUA 4Q8UA 1XGDA 2YXXA 3FXGA 4FEZA 2X0SA 3EPNA 5HANA 1H51A 4AEEA 4IF2A 1OGGA 3LBMA 3N3MA 3CHCA 3T09A 3VIJA 4JTSA 2DFAA 3UR5A 2IXVA 3DH7A 2VCAA 1E6ZA 5HWJA 3BAKA 3PZNA 5XIMA 1F7BA 2W67A 3C0SA 1J01A 2ZZ5A 3M0KA 4OOUA 2CHOA 1JZ7A 1F61A 4D1IA 2OB3A 2VEFA 4WLCA 3DXIA 3CS2A 4MDOA 1QOXA 4LSBA 1CNVA 3BANA 3OG2A 2BFGA 2X7VA 3EOLA 4XAZA 3AXKA 4CGTA 3MHGA 3TROA 2X1UA 1LORA 1BSLA 3B8IA 4FLOA 5HMFA 3LNPA 3DGRA 4C6QA 1O5QA 3ONCA 3I6EA 1TPVA 3NM3A 3TV8A 4G2DA 1DHKA 3VMNA 3QPZA 1A5MC 1V77A 4MB5A 3W7JA 1ODZA 1Q63A 3G77A 3VABA 1JJKA 5CPOA 2Q09A 3WQWA 4CVWA 5LKYA 1Q6GA 2X1IA 1QW8A 5D09A 3B4UA 2BY0A 3PB0A 4O8RA 4NYUA 2XU2A 3WQOA 4WF7A 3E0WA 3WIJA 1V4YA 1R9YA 5LNRA 3H2OA 1DJYA 1NOUA 2PCEA 3GNPA 4F66A 5TAOA 5C9ZA 2JGQA 4YNGA 1OABA 4BQ4A 4O53A 2DZXA 3MUY1 4V28A 4B3LA 1MW3A 3GG0A 3GU1A 1VHCA 3AXMA 3JW7A 3ORWA 2ZIDA 2E9LA 3ARTA 2P10A 1Q6EA 1CX9A 3UXKA 4QS5A 3HQOA 3W7MA 1LOLA 1VZWA 3D3AA 4Q32A 1W9XA 2OLHA 4LYPA 3IJDA 2AKMA 2GJLA 1XLCA 4HOXA 1B3VA 3P60A 1YRRA 3HV8A 3MUXA 2ASHA 2ODOA 4CD7A 1F5ZA 1UR3M 4HNOA 2GQ9A 3WD0A 5FSEC 5A6JA 2BXYA 1XG4A 3HF3A 2WMKA 4GZJA 3M1ZA 5A6LA 4ZE5A 1HQTA 2F2HA 1B57A 1GT8A 4OQVA 4AW7A 3VNZA 2VZOA 3WBXA 4LRSA 3W88A 2H90A 3HBLA 4AD1A 5A5WA 1OYAA 4K38A 3H70A 3BOFA 1VBUA 1ISVA 4JOMA 2ZVIA 3EYPA 3DUGA 3GAYA 1HXJA 1JL8A 1YXYA 4X63A 5D2YA 3SSJA 1UZDA 3P93A 2VFFA 4IG2A 4US5A 4Q6JA 4JEQA 5FSDC 4UFIA 2O92A 1FXQA 7ODCA 4E4PA 1SO6A 4B5SA 2J62A 2D3NA 4GCAA 4TTGA 2GDVA 4Z2JA 5AVHA 3VD3A 1CXLA 4RDVA 3T42A 4UTLA 5F2MA 2OYKA 1SO4A 3MMTA 3JZUA 3WDHA 3N73A 4JEJA 1DQXA 3WQ4A 2PD9A 3NEHA 4O4WA 1QNQA 4J3SA 4MWAE 1I9CB 5CXPA 2FPTA 1TA3B 3RR4A 4Z42C 1TX0A 2XM2A 4GHRA 4GLEA 1BXCA 5M17A 3VGDA 3WY1A 4XTDA 1XM3A 2P1FA 5CPQA 3V4BA 3RK8A 3WQ5A 4REQA 4OBRA 3VILA 2EPMX 3G1SA 1PHQA 5TNVA 1G5AA 3LPGA 3ZO9A 4Y9PA 3CWNA 2R1NA 5CCZA 3W2MA 2R94A 2QDGA 2Q02A 3BZGA 4GYPA 4WR3A 5AYYA 4GRSA 3VD4A 4LAZA 1HF6A 5PTDA 1SM9A 2J8TA 2G95A 4Z2KA 4NKCA 4INFA 1P6WA 4URIA 2Y4SA 5GNXA 2QF8A 3QR1A 3NVDA 5FACA 3WD2A 2GVYA 3IJ8A 4M1RA 1VYSX 1XFCA 1IWPA 1CI1A 1EL3A 1EIBA 1PYFA 2DIEA 5HNRA 1WDWA 4XG1A 1CYGA 1TJ2A 1VFSA 1JPKA 1QBBA 3T7VA 1TUFA 4PUDA 2VKZG 4UC5A 1GVEA 1JYVA 2IPGA 4D72A 2OKTA 3DFPA 4A8RA 2C79A 3KW3A 2H9AA 2H6RA 2J8FA 3MYOA 3SCNA 4XUYA 3ZT6A 1FWHC 2VR5A 4IGMA 1CENA 2NZLA 3TN4A 3BLEA 1AZ1A 5T91A 3T08A 1OCJA 5FJUA 3GWQA 4YVXA 1EP2A 3BMVA 4JN7A 1E1EA 4H2CA 2XJ7A 1K8XA 1MW0A 4NX5A 1TUXA 2YIHA 4ILSA 4J2MA 1BYCA 3IVSA 4KWUA 1DJIA 3HG4A 5DBTA 3M0IA 4Y8EA 2Z7KA 2ZXQA 1QK0A 3GKAA 4ZCWA 2FKPA 3WH8A 5FI8A 2I16A 1OCNA 1XRSA 3UWZA 1TRIA 1WP6A 2BXZA 2VOMA 3GU2A 3VOHA 1D8WA 1NDZA 2R1PA 1EX5A 1U5JA 1PS9A 3L5AA 3VKJA 1LL7A 5K9XA 4ENLA 3LPFA 2D23A 2E68A 4ZBCA 4HK6A 2GOKA 3FKKA 1OFPA 1RCQA 4DLFA 3TN5A 2ZWYA 4GQBA 4B3ZA 3EX3A 1NIUA 4HTBA 4K2SA 1HKJA 1EDGA 2W27A 1R5YA 1B3OA 1MO0A 3PBMA 1DHPA 5FEXA 4BEUA 4Q4RA 1NTHA 1E4IA 1H7PA 1H5VA 4R3UA 2RDXA 1SMAA 1EP1A 2Y1HA 3VUSA 3S46A 2CKSA 1ZL1A 4L6HA 1T99A 3JS3A 4TVUA 3S6TA 5KETA 1UZ1A 3GKFA 2PA6A 2OTDA 3W82A 1X96A 5D2XA 4YS1A 1H61A 5CGMA 4CKQA 1ENUA 1CGUA 3IPWA 1PTDA 1EIXA 2BASA 3W26A 4IX0A 3WEOA 1MRQA 1WDSA 5C2XA 1ECQA 1Z42A 1M68A 4BF7A 3WX7A 5A8GA 2WZHA 4D6FA 2J13A 1EFZA 3QRHA 1GKPA 5E9AA 3FS2A 1GTHA 3W2JA 1M41A 3C56A 1AA1B 3G1FA 3LBOA 1OD0A 1L8NA 3KWSA 3N6JA 4TMCA 2ZUSA 4C6CA 3STCA 1QHPA 4DAFA 5A6BA 3KDNA 1QU4A 1K70A 3F4CA 3LMYA 3B4YA 1S2UA 2FDSA 4PZVA 2BOEX 1HO1A 1E55A 3QY6A 4ICCX 3V16A 4OTKA 3SCWA 3E3HA 1W5PA 1R7AA 1VFHA 1KCKA 3VIGA 3LCLA 1RCXB 3FAXA 3BWWA 1IEQA 2RAGA 4G1KA 1QAPA 2FPYA 1C9DA 2DDXA 3KTXA 4W89A 1PHWA 4XO6A 1VH7A 3C52A 4I8YA 5G4HC 3N18A 1FCUA 5GVJA 4M19A 4DWSB 4E2BA 1IGSA 4XBSA 2ISDA 2WZIA 3N3TA 1E1CB 4E8GA 5DXYA 2WSKA 5D37A 2O4MA 2ZE3A 2WSRA 4E2OA 1IXNA 4HZ8A 3Q2DA 3FIGA 3MW7A 4PUMA 4C6OA 5KZMA 3WNOA 1H62A 4O28A 4MNMA 1ISWA 2OO0A 2J7GA 3VD5A 1MFVA 2PAJA 3GIYA 5DX7A 3SUUA 3H12A 4GBUA 3SFWA 2FMNA 4WD0A 1GOQA 2VMFA 3FVMA 1TG7A 2QQ6A 1AL7A 4PEKA 4DYEA 4E6MA 2C1HA 3OA3A 1DYSA 4ZZ9A 4KH2A 3GK0A 3E96A 4PMYA 3WG6A 4WKFA 4WXZA 1JEZA 1YIXA 2WJDA 4FX7A 4Q4PA 4LAOA 3EKLA 4EXBA 4N02A 3MVTA 1PIIA 4EWJA 1E71M 1F8IA 1CBGA 3AFBA 2TAAA 1XL9A 1NY1A 4A8LA 3KBMA 4JFTA 1UQZA 3OB8A 1WBJA 3PZOA 1WPCA 1B2YA 3TC7A 5H8UA 4EANA 2JIWA 1Q85A 4K37A 2R82A 4HPNA 5TD4A 1TR9A 4N42A 4A3HA 2A3LA 2PPGA 4FPSA 3CK5A 3AS3A 4GX9A 3V0UA 4MAVA 3RRAA 4NI8A 3OVQA 3B03A 2SFPA 4DBWA 3OZMA 3SZ8A 1Z89A 1I1WA 4ZQNA 5BROA 2OOFA 4GGHA 3WJSA 3BAWA 5J8LA 4IPLA 3MUCA 2I5IA 4QJ4B 4HTYA 2VL4A 3MWAA 3C0QA 1K3UA 4ERAA 1D9EA 3P14A 2X8RA 4MFDA 3W7GA 2CLPA 1C9WA 2YCIX 3TAKA 1ADSA 1I60A 3IRDA 1W0MA 4PMOA 3U7VA 2PMQA 2H3BA 2WPBA 1BPLB 5D4YA 3CO8A 5E0KA 1VIWA 4K36A 4B2DD 1JPHA 2X40A 3GTNA 4GISA 3NQMA 1XBYA 1LRNA 1GEHA 3T81A 2P3ZA 3VC5A 2XHYA 3W1NA 1GVSA 4QG9A 5IM51 2PWEA 3V3WA 3AYTA 3WUGA 3RGTA 1KWGA 3CZKA 2V30A 3S1VA 4GVIA 2BVWA 1AW1A 4AXKA 3URNA 3H2EA 3H24A 3ZT5A 2WV8A 3VOJA 2PGFA 4AC1X 4EWND 3NSNA 4MZYA 4NF7A 2DT3A 2DSZA 1EX1A 1CXIA 1W5OA 5E0FA 3GDRA 1OFAA 5E70A 3PWAA 4O0QA 2QGHA 1K9EA 5CLWA 1K9FA 2D3LA 4IQEA 1A47A 4RJEA 3SY5A 4MDPA 1OF8A 1ZBVA 3C2VA 1UD3A 2ALDA 2QT3A 3EDFA 2C3ZA 1TMHA 2WNQA 4B5WA 1JDEA 4RNJA 3L68A 1NQKA 5DFAA 3GDBA 3L21A 5I02A 1TJ0A 2I57A 4XZIA 3KAOA 2HE8A 3WLMA 3LYEA 4HPXA 4GUJA 5I3JA 1XGZA 2PWGA 3ELFA 1QO2A 2Y85A 1JNDA 4PTVA 1HGYA 4YHGA 4BS0A 4JIEA 4UFJA 1S5VA 5CPLA 3EXRA 1HFBA 4IL0A 3MSRA 4CNSA 2AAMA 4ZL1A 4PB5A 3O6CA 4DWSC 1M03A 3PAOA 3S2CA 2J7FA 3B0PA 2GYIA 2CYGA 2HVOA 1VFMA 1GJUA 4PL1A 2R1KA 1A0CA 5BXSA 2GGEA 2NQLA 4JQAA 2CPUA 5C7VA 1M7JA 8CGTA 5I23A 1RPKA 4LEQA 5ABGA 4XSMA 1PL9A 1PX3A 3WMSA 1OHLA 3WQVA 1X1NA 2NQHA 1BXBA 1Q2RA 1UZ4A 4X3ZA 3H2AA 3SGUA 2WMHA 1LUCB 2DU2A 3CEPA 4GUGA 5D03A 2HPIA 1TMQA 7TIMA 4HSOA 1G7VA 3FHQA 4AVNA 3CO4A 1P1XA 4WIWA 2BGSA 4NZ3A 1LZOA 3N11A 2IXUA 3DFTA 3KRUA 1W9BM 4W5ZA 3W7EA 2NT0A 4WSKA 1EJTC 4RZ5A 4GXPA 4JTJA 1J79A 4BK9A 1R3TA 5BRPA 1Z6KA 1BG9A 1OC7A 3NQ7A 3N13A 5DELA 3CUXA 3KTCA 2GJXB 3W86A 1ODUA 3RHGA 4WGHA 4FXRA 1KBJA 3FGCA 1ZQ5A 2INFA 4CUCA 3HG3A 3N12A 3S1GA 3TNBA 1JXJA 1CDGA 5FAGA 2XIJA 2UV8G 2QCNA 4OUIA 4NZ1A 1DQUA 3UWQA 3P80A 1E1CA 2VD9A 3VIKA 1NP0A 3NYDA 2PU0A 3SIMA 1PXGA 2HMCA 1BXNA 3H2CA 4J35A 3COTA 1JCNA 3DG6A 4XX6A 3CZGA 3KFTA 4UOZA 4QE4A 2C18A 2WW5A 4IH3A 1UC5A 3PZMA 5LIXX 2DQXA 4UTWC 1LQ0A 1P1MA 2VM8A 3UJSA 3VKBA 3W7KA 1MXGA 1E56A 4FS9A 4IQDA 4KCVA 5F4WA 1E6NA 1W3HA 1UOZA 5A6SA 4FK9A 1VBJA 4GJJA 3I68A 4L4PA 1E40A 3R58A 4BF9A 1OF6A 4XKYA 4LUSB 1M5WA 4JTEA 3LCGA 1UPPA 4LF1A 3BG9A 1V02A 1UR8A 3E0FA 4TXEA 5BWFA 1KBBA 2QCDB 3N6QA 4DJDA 4JCMA 5I00A 3LPPA 2Z24A 4Z0JA 5CEWA 4ZA0A 1J11A 3CTTA 3M07A 5JQ9A 4Y7EA 3FEMA 1KCZA 3RYSA 1L2UA 2WANA 1X39A 4F0HA 3I65A 4WK9A 3MMWA 1G1YA 1O95A 1A4LA 5G5IA 5CZKA 4B9ZA 3LENA 4GIRA 1OZMA 2E3ZA 1V0KA 3AIQA 1RLCL 2VFDA 1KD0A 4HMNA 5CBJA 1J6PA 3VO0A 3T40A 3ZXWA 3SADA 3Q67A 3VDGA 3LERA 1SW3A 4O52A 3B0YA 1HT6A 3BGGA 2L5HA 1KRAC 8TIMA 2W6RA 2QCEA 3DYOA 4KF1A 2DY3A 1ICSA 1KRCC 2FMOA 3GVRA 1AJ0A 3EDKA 2NQ9A 1IQ8A 4S38A 1JF6A 1JAEA 4L56A 5C2CA 3CQ0A 1GOIA 2WSYA 2XH2A 3ZLFA 3TDFA 1TJPA 3S47A 4R9XA 1GOOA 1F8MA 4JGDA 1RA5A 1UC4A 4E2VA 2ZX6A 2CITA 1YNYA 4X60A 1EC8A 3IUHA 5GJNA 2E28A 4YWSA 4L9YA 1K7FA 4HP5A 2EG7A 4HNCA 3B9AA 3IIVA 1P7TB 3SJ3A 2V9DA 4Y2WA 5DMMA 4FNUA 3G2GA 3PFRA 1M6JA 3VOIA 2HBXA 1L6GA 3NZRA 3G1VA 4MUZA 3ATYA 5I3DA 3R89A 3CUGA 4OZOA 1T0OA 4P7LA 4XZMX 3PSWA 2WVVB 1JRBA 2YFNA 1XPYA 1ZRQA 1LM1A 4KBXA 2OZ8A 1JCMP 1OIFA 2ALRA 1YPXA 1KFLA 1BKSA 1QPRA 4PMNA 2HWGA 1PBGA 2WZMA 4S2CA 3ZLGA 3L2IA 4TTUA 3TW6A 1WB0A 3MKKA 4UMBA 3N2XA 4PCPA 3SY1A 2CZ5A 1G4PA 2J24A 3VU2A 4A8IA 4NSBA 1GYLA 4AD4A 1LCOA 4B4HA 3OLDA 4JTTA 4JNMA 3P8IA 1W5NA 4NHVA 1ZTVA 4XBKA 5IHRA 3ZR5A 1S5TA 2NQZA 3ZZ1A 3G8RA 4RW3A 3OIXA 1OFBA 3EOEA 3GC5A 1Y5VA 4ZFMA 1WKDA 1UKSA 3O6YX 3R11A 4BZYA 3QW4B 2E77A 5JXQA 1EUNA 2RHGA 3EWZA 5HMEA 1WOAA 2BMBA 3AXXA 3GIPA 2ZXDA 3E74A 4IJRA 4S3BA 4CNNA 3VXGA 5GJPA 2CLMA 1W1ZA 4XQ6A 4Q22A 1FTXA 1R3RA 3GR4A 5DY3A 2FGBA 4NQ1A 3FVDA 2FDMA 4MKSA 1S2AA 1HKMA 3A4JA 3W7LA 1ZJIA 2TYSA 4TU1A 1GOXA 1B0IA 3ARPA 1HJSA 1K1DA 4B2DA 1B9ZA 2Y5JA 2Y2WA 5HNNA 4LQ1A 2CCRA 4JKMA 3TCEA 4IMAA 2UBPC 3MCNA 3W28A 1SVDA 3UCCA 5CLTA 3HQ1A 3DC0A 3UU0A 1UR4A 2BNJA 3CQJA 3C61A 4MKNA 3QH2A 1VFLA 4S23A 2EF9A 3VCCA 1H63A 2VRQA 4LUJA 3GTFA 3WNMA 4GKLA 2GJXA 2QCMA 1UH2A 2W62A 2NT1A 3BSHA 3NNTA 4EE9A 6ENLA 4MKVA 4KS0A 3GYEA 1VPYA 3EDDA 5K4ZA 3DFHA 3VCRA 1I2PA 5I0DA 1UKQA 3GG1A 3E9AA 1ISXA 4D6DA 3LK6A 3VI2A 4I5UA 3NGJA 3F2DA 2ACQA 1TX2A 1H0IA 3KHJA 5BNKA 3DEQA 3EPMA 1KXVA 5IFTA 4QNEA 4NL1A 3FDGA 3MSGA 4QLJA 3KOFA 4ZB2A 3N2MA 4ZTXA 3UESA 1S1RA 2QUVA 3M43A 5D2VA 4PB3A 3H4WA 4FX8A 4EP8C 2PDPA 3WELA 5HK4A 3ZSSA 4CLMA 4HU3A 3MPGA 3OW1A 2NXHA 3ITGA 1WOBA 1YTKA 1N2VA 2YCLB 4QP0A 4C5ZA 4PUNA 2HVNA 3FJLA 2E8ZA 3MJYA 3W7HA 3WBAA 3QEZA 2HVMA 3K30A 5C9UA 2ZCGA 1P48A 5BZAA 2VD8A 1KRMA 4XKYB 4LUSA 2YXOA 4DJFA 4G7EA 1TSIA 4XUGA 2GGGA 1QPNA 5ABHA 5AY7A 4BQ2A 4OJYA 4ZGYA 3P74A 1UJQA 3ALFA 3ARXA 4J1OA 3WF4A 4C65A 3LQLA 4R53A 2VJXA 1G7UA 2V6AA 3R5EA 4IP4A 2YA1A 3SCQA 3EX2A 2CHRA 3CLWA 4HK5A 2KX9A 2PLCA 4UZUA 1A5LC 1E4LA 3CT2A 3RLVA 4R7WA 2XGZA 3TEVA 2Q8XA 2PDKA 3UVIA 2VEMA 3QV7A 1LLWA 3ZYZA 6TAAA 4F3HA 3SFKA 1VCGA 3KBNA 2DORA 1TPUA 3WD4A 5DMYA 1RR2A 7A3HA 1UJPA 2AQVA 3TW7A 3UBPC 5JBDA 4XZ9A 1T7LA 2P8CA 3CAQA 5JUVA 3O0KA 2Y7GA 2OEMA 5JU6A 3W85A 2E9BA 2CBUA 3MHUA 2WYSA 1ITUA 4JTKA 2V5LA 1RQBA 2OEKA 4KMQA 1P0NA 2XYLA 3OGVA 3B8WA 3FYPA 3GH5A 2E7FA 2GSEA 4NI3A 2Z1WA 4PMUA 4YIWA 1H1NA 1KM2A 2D69A 4ASTA 4CN4A 3VGEA 2OJPA 3WJYA 1YTDA 3R0DA 3NQ8A 4UFKA 4JKLA 2ON3A 4N6FA 3PPGA 3AICA 3K5XA 5A2CA 4Q8PA 1GJWA 3QJAA 3WK0A 1IR1A 3SCUA 1ONEA 2OPJA 4A8NA