3NPWA

In silico designed of an improved kemp eliminase ke70 mutant by computational design and directed evolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
250
structure length
247
Chain Sequence
TDLKASSLRALKLMHLATADTDEKVIALCHQAKTPVGTTDAIFIYPRFIPIARKTLKEQGTPEIRIWTSTNFPHGNDDIDIALAETRAAIAYGADGVAVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLSVIIETGELKDEALIRKASEISIKAGADHIVTSTGKVAVGATPESARIMMEVIRDMGVEKTVGFIPAGGVRTAEEAQKYLAIADELFGADWADARHYAFGASSLLASLLKALGHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords deoxyribose phosphate aldolase
publication title Optimization of the in-silico-designed kemp eliminase KE70 by computational design and directed evolution
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 96
structure length 247
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3npwA00
2EPHA 3USBA 2C1HA 4ZQNA 4O18A 1AG1O 5BOOA 3G1HA 3GAYA 4H3DA 3IVUA 3TSDA 4GE8A 3BLIA 1FXQA 3NQ7A 1HTIA 4A2SA 5CPOA 4AHOA 1A5BA 3THQA 2V8ZA 4UTJA 3A23A 2I14A 4RXGA 2WKJA 2GQAA 3STGA 1X1OA 3G1YA 4GUGA 4UUIA 1TCDA 2QCNA 3LTPA 4LY8A 1XM3A 5D2TA 1DHPA 1TV5A 3W1AA 1WAUA 3MP5A 3FJLA 3QW3A 2FJKA 3S1VA 1PV8A 5TQLA 4UTWC 3W1PA 5D32A 5KZMA 1XBVA 1N7KA 3RFAA 3CU2A 1X6UA 1QO5A 2B4GA 4WXYA 3W7DA 1LLZA 2QUTA 4IMCA 4RV8A 4FB7A 3TAOA 1YDOA 2ZTJA 2DZSA 4P2VA 4JD4A 2E6YA 1OABA 3OVRA 1K7XA 1LRNA 2DZUA 2GUUA 3NDOA 4PODA 2VFDA 4G1KA 3OIXA 3DKJA 3EB2A 1G7UA 3GX9A 3QPYA 3TJXA 1JULA 3RLUA 2FPTA 3L9CA 3BK0A 2ZZ1A 4X2RA 2Q8LA 3P81A 1C9DA 3KHJA 1RZMA 1QAPA 4BWLC 3TU9A 3K30A 4RZ6A 3TQVA 1OFRA 4S1FA 1DJQA 1N8FA 3BPWA 4CCCA 3NL2A 1VS1A 3PUDA 2HMCA 2CLEA 3CTLA 1LTDA 4JTIA 5DXYA 2J9XA 3RLVA 2I1OA 3W2UA 4XKYB 5D04C 5D30A 2HSAA 3QJAA 3S42A 1A5CA 3C3NA 4NXSA 4MFDA 1TTJA 3E49A 4JR5A 2QCEA 2Z1BA 3GK0A 5LHFA 3BLFA 4XBSA 2GOUA 3GIYA 3R12A 4FHAA 5KTLA 3DFNA 1UCWA 1ZFJA 2VFHA 3HF3A 1RD5A 4GWEA 2QKFA 3QRHA 4AMAA 4ADTA 5IBXA 2CLIA 3SR7A 3TH6A 4UTIA 3UZJA 4FO4A 4JX5A 1YADA 5AYXA 3LCWA 3SY5A 5DBUA 3WJZA 5DELA 3TXZA 4LUJA 3YPIA 4JN6A 3RNDA 4AB4A 3W7LA 2A6NA 3NPVA 4WX2A 3HG3A 4LVDA 3EX3A 3IGUA 4MZ8A 1ZAJA 3PSWA 3LCGA 2Y62A 1UBSA 3PG8A 2C15A 3LERA 3L0GA 3DBPA 1OFBA 3W7QA 4AEOA 4MYXA 2BWGA 2GJNA 5KMYA 3O6DA 5EBUA 4PC8A 3L68A 2NXIA 3RU6A 1L6SA 4FX7A 1TPDA 2B7OA 3QPZA 2ZQ0A 4A21A 5G1TA 3ABOA 4IQLA 4LC8A 2B7PA 3QW4B 1S5VA 4XTIA 3A5VA 4TIMA 5J5RA 1KTNA 3LLDA 3W1NA 1VZWA 5TBOA 1LBLA 3HBLA 1W5OA 1V7YA 2OT0A 5IBXC 5DN1A 1I2RA 3ZR4A 3TXVA 5LNRA 1M5WA 3NEVA 3W3OA 4KFNA 3I68A 4RLIA 3N3MA 1NSJA 4JY8A 4O17A 3EXTA 2ZCGA 3TQ0A 2ZA2A 1IIHA 1O95A 3GXTA 3CHVA 3H53A 1OF6A 1YYAA 7TIMA 4UTHA 2ZZ6A 5D05A 2ZZ4A 5I3IA 3JR2A 3G24A 3CEPA 3LI0A 3LGEA 1HFBA 4JNMA 1FXPA 3M7WA 3CB8A 3W83A 3LTSA 1B9BA 4HT3A 4PFMA 5AHMA 2Z6IA 1L6WA 3UWQA 3PG9A 3GAKA 1F7BA 1H1ZA 1F5ZA 2ZYFA 4QSHA 3NVTA 5CZTA 5C54A 4IX0A 4IOTA 2ZZ7A 3P8JA 3TFCA 3W2MA 1O94A 3O06A 2PE4A 3A21A 3FJ6A 3M5YA 3MHUA 3G0SA 4LWWA 4O11A 1LYXA 2CZFA 5CSRA 2VFEA 3O07A 4RZ5A 4LRSA 3NQEA 2OT1A 2DZXA 4CNNA 3LM7A 1KTBA 1A5AA 3HGJA 1RQHA 1XL9A 3BGJA 4O10A 3T7VA 1W5MA 3L66A 2CU0A 4OT7A 2B0MA 3QMSA 3ZWSA 1LP6A 3C2RA 2V2DA 1O5KA 4R7JA 1GVSA 4KKXA 3O6CA 2A6LA 3EXRA 3PUOA 3M47A 1G6CA 3QZEA 5HQEA 4O14A 4RK8A 5CKSA 5E0KA 1GVRA 3FLUA 5FF0A 4Q32A 2Y88A 2GQ8A 1JCYA 1SW3A 4Z1AA 1OFEA 3W7IA 3SSJA 5EL1A 3HG2A 3W1TA 5I3JA 5BRBA 4Z08A 3BG3A 5F4XA 3WK0A 4IX2A 4XQ6A 3GZ3A 2GJLA 2NWRA 3KAOA 4FIQA 1JCNA 4DBEA 3IIVA 5H91A 1Q6QA 3LV5A 3SECA 2FIQA 3BG5A 4E0CA 2TRSA 5EKYA 1H63A 4UTLA 4MY9A 3P7YA 1MEHA 1AL8A 4LNYA 3UY8A 3T40A 3QFEA 1ADOA 1QPQA 2AGKA 1TQXA 3B04A 1PHWA 2CZEA 3UQNA 3TUUA 5C2XA 2DORA 2ALDA 2GPTA 3HPSA 1SO4A 2CLLA 1W1ZA 1KM0A 6ALDA 2ZRYA 2H8ZA 3N9SA 4LS1A 1WBHA 2E09A 2KZHA 4AVFA 4GUHA 2NX3A 4AH7A 3PB2A 3LXCA 1J2WA 4PTNA 1T96A 5G2WA 5BW6A 1WQ5A 3W7NA 1EX5A 4ZQOA 4OE7A 3W71A 3EKZA 5I3HA 3GVGA 2CZDA 4MZ1A 1LRTA 1TRIA 2V81A 1YDVA 4WY0B 1UUMA 2C3ZA 1VCVA 1AW5A 3NQMA 4LTSA 4UTMA 3VE7A 3BVJA 5LKYA 1FCUA 4AF0A 4O4VA 3MO7A 5U4NA 1V5XA 4O1DA 2V82A 3C2OA 4O53A 4D2JA 4MLJA 2BZNA 4XWUA 3LCHA 4QQ3A 3WJSA 3NL5A 1ZCOA 4PCFA 2E6DA 2B7NA 3PUEA 4XUGA 5T26A 1VHCA 4UFIA 1F6PA 4ORIA 5KITA 4IXXA 4YLWA 2A7NA 3T55A 1XUUA 3PBVA 1R2SA 3DAQA 1KFBA 4K8HA 2ZRUA 2E6AA 3UWZA 1Q6LA 5E1QA 5C5YA 3V75A 1A53A 3UWYA 5KZDA 5FF2A 5KINA 4GBUA 2FDSA 1TPUA 3CT7A 1ONRA 3PBWA 3GYEA 4W9TA 3EKLA 1LBFA 3P60A 3L0KA 1QPNA 1WV2A 4HPJA 3ANYA 3B8DA 4HSOA 1OK6A 2TSYA 4N6EA 5A8GA 2OJPA 2WNNA 4UTTA 3W85A 3GKAA 5EYWA 3JS3A 3EWZA 2A5HA 2EHHA 1BEUA 1XDMA 3HIJA 5KZEA 2E68A 2Y7FA 4TR9A 3W86A 3DKLA 5K2ZA 1TPWA 1TRDA 3UPBA 2D73A 5FEXA 4LT9A 2GQ9A 3UXDA 1X8FA 4HIBA 4HNTA 1OX4A 1K8XA 1JR1A 3C2FA 3GDLA 3NPWA 5K7JA 2RDUA 4MZYA 5FF4A 3W7CA 1R2TA 4JIQA 1KBIA 3C8FA 3FEMA 3W6YA 1WXJA 3NQ2A 3T44A 3HB9A 1OFOA 5HMSA 4BI6A 2YW4A 1Z44A 2VFIA 3G18A 3LTYA 3O1NA 1W3NA 2R8WA 4QISA 4BK9A 2PURA 2ZA1A 3G0UA 4A22A 4DO4A 1Q3NA 4ALDA 2P10A 2FFCA 2X30A 3NQAA 1R47A 3W7RA 3IGXA 1DQXA 1VHNA 3TX9A 3LOTA 1GVQA 3LHTA 4CQAA 1DQWA 4EIVA 3IIOA 1F2JA 5CZSA 2W79A 5K9CA 2A0NA 2QEZA 3NM3A 1FWRA 5K9XA 3R5EA 5KSWA 4KFPA 1H7XA 1T8XA 2JKEA 3DI1A 4UTTC 1KV8A 3LBCA 5H2ZA 3CWNA 3TC6A 3U2OA 4ICNA 4DO6A 1VLWA 5AN7A 3S6DA 1Q6OA 3G8RA 2NX9A 5LNSA 3G1FA 2VOMA 1H50A 3PSVA 3TQKA 3A24A 4AHPA 2RKXA 1QCWA 2H3DA 3NG3A 1X7FA 5AB3A 1B4KA 1TJRA 1VYPX 3SIZA 5BMXA 2TYSA 1W31A 3C52A 4K6AA 2C6QA 4JTSA 3MWAA 3W2KA 1VH7A 3AO0A 5CZ0A 4M6PA 3TMQA 4AWTA 3LCLA 1UB3A 2NV1A 4UXDA 3MI6A 3MHFA 3R8RA 2VEKA 1G4EA 2A85A 3QQ0A 1KFJA 4JEQA 3KVMA 4AAJA 4EWND 1SW7A 3C56A 2CZ5A 1XXXA 4E2DA 1Z42A 1TO3A 2WV8A 4NVTA 1QPOA 2R91A 4UFHA 4IWWA 1DJNA 1P4CA 3R13A 3ELFA 2NUXA 2YYTA 4NNBA 1QO2A 2ZZ2A 3A5FA 1OF8A 3MW7A 3B05A 3W73A 1H7RA 5AC6A 4LVBA 1I2OA 4OWGA 3UWWA 4MYAA 3TCEA 4PH6A 1NVMA 2O7QA 1G4PA 3B0VC 2ISVA 1KTCA 4RXFA 2HTMA 5CPNA 1VYSX 3C2EA 3ZWTA 3G1AA 1A5SA 4HPXA 4DF2A 4FF7A 1PHQA 1TPEA 3UNDA 3NQ6A 2RFGA 1NAL1 3GR7A 1YXCA 4ORMA 1ME8A 4JTHA 3F4WA 2YW3A 3VCRA 5LSMA 4UFLA 3LX9A 2V30A 3PBYA 5CZJA 2CW6A 3I7SA 4NJGA 5LNVA 2PRLA 3G1XA 3C4UA 3LRLA 2F7FA 1EA0A 4POCA 3QMRA 4DBDA 1F76A 3TKFA 1VQTA 2CLKA 1OVDA 2DZWA 1KW1A 4QNWA 1KFEA 4R34A 3HPZA 2Y7DA 3PF3A 4GUIA 1LZOA 4ADUA 4N02A 3MI3A 4FX6M 4EF8A 3M16A 2J88A 4KWVA 2YCEA 1ALDA 1H7NA 1OFDA 2DJLA 2C16A 3G1VA 2W0UA 1FBAA 5IM51 3CC1A 2V9DA 5HINA 1RQEA 1O60A 3NL6A 2RHGA 3GXNA 3PAJA 2QCDA 5SWUA 2YR1A 1OX6A 4WXZA 1C29A 3LRMA 4QJ1A 4K38A 3THAA 4K7YA 1DOSA 5FF7A 5G4EA 2C13A 2F84A 3HPXA 2W6RA 4NNAA 3QF0A 3DENA 4HNVA 1QMLA 4MFEA 3TFXA 1GOXA 3GDRA 2WSYA 2RDWA 5F2LA 4NQ1A 5MHBA 1SFJA 1RQBA 4N2YA 1VRDA 4X3ZA 2ZBTA 1DBTA 5AHFA 4O0KA 3STEA 1FWNA 3L65A 2NV2A 1KBJA 1TV8A 3FKKA 3M44A 3OA3A 1VJIA 1SW0A 4JTJA 5FESA 1GG0A 3IEBA 5TIMA 3ZS4A 1WOBA 1P1XA 3UWVA 1OFPA 3KVKA 5D2XA 4HHPA 2DU2A 4DEFA 2CLHA 1YTEA 3BLEA 5A5WA 3S1XA 3O15A 3BV4A 1AK5A 5AHEA 1TPH1 1YDNA 2Y70A 2AAMA 4LC6A 3GNNA 1O5XA 1E51A 1ZHAA 3TW7A 2QCHA 4YWIA 4ZQMA 2FPYA 3C2VA 4RZ4A 4ZQRA 1DVJA 4O57A 3BW2A 3MP4A 4NZFA 4UNLA 3FFSA 1DV7A 2Q8ZA 4MUZA 3MBFA 4OGZA 1LM1A 1W8SA 5F1VA 5HR6A 3GXPA 5HUOA 4O1CA 1R30A 3W23A 3N2XA 5FEWA 1JUKA 1TTIA 1EIXA 2HS6A 3EWBX 5HULA 2WOQA 3QQ1A 2P1FA 1Z41A 1GG1A 1IXOA 3LV6A 3IV3A 1F73A 1G4TA 1H62A 4GFSA 2NUWA 1XUZA 2EF9A 1I4NA 1MO0A 2WQPA 1JJKA 4Y90A 3BW3A 3W1MA 3HG5A 4DF1A 5EMUA 5J5DA 4FEZA 3L21A 1JCLA 2V2CA 1ZNNA 4GC4A 4NXKA 4JX6A 1L9WA 1VGAA 3P82A 1VPXA 4IMEA 1RR2A 3BARA 1T0OA 2YFNA 3P8IA 3MYPA 4TMCA 2QAPA 4BR1A 2JGQA 2A2IA 1FCBA 4WOZA 3NNTA 1IXNA 1ME7A 3QH2A 4IJBA 3V1PA 3M1ZA 3OVQA 1J5TA 3CM4A 4GNJA 2J9YA 1G4SA 4EF9A 4MVAA 1YTKA 2X1TA 1QWGA 2OMAA 2DJXA 3W72A 3GR8A 2QCMA 3G22A 3Q37A 1GQNA 3UD6A 3M41A 3M5XA 5K3VA 3PVFA 2Y89A 2Y63A 4O15A 1FQ0A 2ZRVA 5HWMA 5DBTA 3S1UA 1ZAIA 5G1YA 1SZGA 1KFKA 3ABRA 3UZ5A 5D2WA 3G1SA 1EB3A 1IGSA 2E5DA 4HKPA 5DLCA 3H54A 1OFAA 3LDVA 3NPXA 3U8GA 3FS2A 2XN0A 3MUXA 4IPJA 4MIMA 3SFKA 3EX2A 3O6YX 3E96A 3P74A 3UWUA 2EGZA 1BKSA 4YMZA 3H55A 2VENA 2GVLA 1FX6A 5D38A 2J27A 3IVSA 2NXHA 2ZZ5A 3SW6A 3B03A 4MKNA 1AW1A 2C14A 1FCVA 1H51A 1XKYA 3MP3A 2JBMA 5HJLA 1SU5A 4AWUA 1S5TA 2E1DA 1JCMP 4N4QA 2VKZG 4MJMA 5AC7A 4XBKA 3O05A 5DXXA 5G2IA 2WSRA 2X1RA 1M6JA 3MHGA 4DXVA 2X2GA 4Z0SA 3G1DA 1WBJA 3W1XA 4EOUA 2JKAA 4Z1CA 3W07A 1MZHA 2DZTA 2PCQA 3LBMA 4LV4A 4ZVJA 3QM3A 1FY6A 4JXCA 2C19A 2J24A 2PRMA 1VCGA 2AQWA 1CI1A 1IIGA 3G8EA 5LGZA 1SR9A 1GYLA 3TSMA 1J4EA 5LGXA 1GEQA 4M6QA 4Q33A 1LLWA 4NX0A 2QCFA 5D09A 2GVJA 3TMLA 2VEPA 4PEKA 4AXKA 4KWWA 1M7PA 2EKCA 2G96A 3VFLA 2Y85A 3A22A 4CCEA 4UTUA 2QJIA 3KRZA 1IF2A 1KFCA 5FF3A 1LOSA 2CLMA 4L4MA 2X1SA 1A50A 3OG3A 3C0JA 1I2NA 3MYOA 3TSBA 5GVJA 4B5NA 3L0NA 4MOZA 3PC0A 3OVPA 3W22A 4O13A 2V0TA 1TPFA 2YDAA 3ABSA 1EUNA 4M19A 2ZRWA 4OU1A 2YZRA 1F74A 1FCQA 4UFKA 1OK4A 2XN1A 2Q3RA 1BWKA 4JTUA 1W54A 3NZ1A 1I2QA 1H7PA 4JGDA 3WFAA 4YCPA 4UFMA 1W3IA 5AYZA 1TIMA 4FNUA 2ZDRA 2JKPA 2YGYA 2CFFA 1KM3A 3HJZA 4MY1A 1KA9F 4XTDA 4UMBA 2QDGA 1LCOA 3EWUA 5I3GA 1B4EA 4LW7A 4WD0A 4TO8A 4IMFA 4MJZA 1LROA 3W88A 2G5WA 1N55A 3CLMA 3M5ZA 4JICA 2FQIA 1KLYA 3HGSA 1TREA 4IPIA 3FA5A 3W2NA 3W75A 2JGYA 3CQ0A 3STFA 3FIGA 4JIPA 5D02A 3WJXA 4NZJA 4OQVA 3W2JA 4DO5A 1I2PA 3SI9A 2OCZA 3VNDA 2IQTA 1RVGA 3OBKA 1ZY9A 5AHLA 1RPXA 3NOEA 2RDTA 1B57A 4XKYA 1L6YA 1SQ7A 2HS8A 2VEIA 4DPPA 1KM1A 3W7EA 1JRCA 5HWNA 4I7VA 3NL3A 3BO9A 4RKAA 3IVTA 3RK8A 4R33A 2TPSA 4ZQCA 4MLRA 3N34A 2DZVA 2QUUA 3LCIA 1GWJA 3CPRA 4CQ9A 1TTQA 1LORA 3EX4A 2Z6JA 3NA8A 1TPB1 2ABBA 1FWWA 5DCEA 5EA9A 1ICQA 3DFOA 4JDYA 3SZ8A 4MPQA 3TC7A 3DFTA 1GT8A 5AOUA 2E5BA 1LBMA 3NXFA 1YLVA 2ZTKA 4UIOA 2A1YA 4Z0JA 4X9SA 2Y7EA 5D2YA 2QCLA 3GNDA 3B4UA 2NLIA 1PCWA 4CNPA 4OV9A 5DCBA 2J9ZA 3CIXA 2Y61A 4EVZA 4PL2A 2NZLA 5D37A 3KRUA 2WNZA 3MJYA 5CPMA 1LOLA 4ZMGA 2GVGA 1EPXA 2WO5A 3D0CA 1FWTA 4JTKA 4NJHA 4I7UA 4O50A 3PM6A 2V5LA 3NGJA 1QPRA 4LV9A 1VR6A 4I7WA 3SGUA 2VXNA 3MMTA 2WJZA 5K9DA 3TR2A 3I6RA 1K3UA 4DPQA 2QCCA 3L5MA 1YXDA 1JVNA 3E9AA 4GRSA 4ZZ9A 4FIRA 2ISWA 1PVNA 3Q58A 4QAIA 1WX0A 2NUYA 3NQGA 3VI2A 2VC6A 4LVFA 4WQ6A 3PY2A 4E38A 3LCFA 4K37A 4A29A 5FEZA 5HUPA 1HG3A 1SZEA 4J9JA 1W5QA 4E2BA 1HUVA 3LHUA 4X22A 4DELA 3LHWA 3QYQA 1CW2A 4M7TA 3KX6A 1SZFA 4WY0F 3N73A 3R89A 1VCFA 2LLEA 2QR6A 2CLOA 4AF0B 2V2HA 3U6WA 3UY7A 3DHDA 3W76A 4FNSA 4ONVA 4LVGA 4O4WA 3EWXA 5F2MA 4CCDA 2V5BA 3F1QA 5CSSA 4UR7A 5HNRA 1WOAA 1VYRA 5LZLA 3P61A 1IXQA 2E6FA 3ZFHA 1Q6RA 2QF7A 4CLMA 3S0CA 1BTMA 1XFBA 5F2GA 1MXSA 3L5LA 1K03A 5D03A 1LRQA 1EP1A 2J6XA 1JRBA 5U7SA 1H60A 2DZPA 3WK1A 4P61A 4BF9A 3IIZA 5BMWA 5AHNA 4U28A 2VFFA 4AHQA 5CPLA 3N2MA 2FB2A 2YYUA 4O0ZA 1S5WA 2PC4A 1YTDA 1H7WA 2H6RA 1S3HA 4TMBA 3IRDA 4K39A 3BG9A 3Q2DA 4LRTA 3NM1A 1P5BA 4YCOA 1GYNA 3KVLA 1LOQA 2QJHA 3LLFA 4LS2A 1YPFA 1F05A 3W7HA 3PS7A 3B06A 3GB6A 3NQCA 1SPQA 5F4SA 5EY5A 4NT0A 1K8YA 2A21A 3GKFA 1AMKA 3L5AA 3F03K 1O4UA 1EP2A 3P67A 3QSTA 4LUIA 4XZ9A 1W37A 3CIWA 4TX9A 1OX4B 1Q45A 4KFOA 4FNRA 2Y6ZA 4UNKA 3UXAA 1PS9A 2P0OA 1ICSA 2QDHA 2R14A 4Y9AA 1JUBA 3S5OA 4BI5A 1U83A 3VKJA 3TROA 8TIMA 1TMHA 1TV7A 4RR4A 1M7OA 4N9BA 4Q4KA 3IIXA 3M0ZA 4WJEA 3W87A 1NEYA 1WA3A 5CGQA 3I7QA 2TMDA 5DCDA 2H8XA 5LNWA 3W1RA 3W1UA 3A9IA 4IGHA 3NPUA 1U5JA 5FEPA 1EWEA 3S5ZA 2ZZ3A 2H3BA 3TIMA 5C55A 3BW4A 1XBXA 3ABQA 3QC3A 3LRKA 3WK3A 2NX1A 3W84A 1T99A 3VE9A 3M43A 5ABTA 1R46A 5AFDA 5C6MA 5K4XA 4JS3A 1H7OA 1YXYA 2VFGA 4C1KA 3S1WA 1GTHA 2ZFAA 2QAFA 1GVFA 4GUJA 2R94A 3DI0A 1OJXA 1TSIA 3NYZA 4O19A 4HN4A 5G2HA 2BTMA 4JYFA 5LNUA 1EWDA 1KM2A 3KRSA 2ISSA 2RH9A 1XC4A 4N9EA 1VC4A 4WY0A 1KM6A 4HNNA 4O54A 3KFTA 3DHFA 4I9AA 1XCFA 4O1AA 4FNQA 1JQXA 1QDSA 1TPVA 5F4WA 1WYIA 1D9EA 2YPIA 3W7MA 5HR7A 1JQVA 2ZA3A 2CWNA 3W74A 1DKWA 4GJ1A 3Q94A 2FLIA 4BI7A 2XN2A 2X1UA 4NJKA 3M6YA 1ZJIA 4H6KA 3RMJA 4L4LA 3W7KA 2Z0IA 1K8ZA 3DXIA 4JY9A 3I7RA 3E12A 2NWSA 3NR0A 3IGSA 4QIUA 2A4AA 3GDMA 3TV8A 1JCXA 1WDWA 4OBTA 3SJ3A 1I45A 1TTPA 2YXGA 1FDYA 2CLFA 4NNCA 1G7VA 4UMCA 2Y7GA 1OX5A 3FYOA 1ME9A 4WUIA 1KM4A 3P80A 1TB3A 1GJPA 3MI2A 3TAKA 1OHLA 4IMGA 1SO5A 1BWLA 4ZQPA 4LS0A 4LU0A 3B0PA 2I9EA 1EUAA 3N19B 2BX7A 4WZHA 1H1YA 1W56A 4MY8A 4JYEA 1MEWA 1NF0A 3NO5A 4JDBA 1YPIA 3L67A 1SO6A 1B3OA 3IIPA 3HMJG 3FOKA 4C1LA 4TU1A 4Y96A 3TW6A 1FWSA 3HQ1A 4PA8A 1TPC1 4WOQA 1W5PA 4Y6GA 4ZL1A 1I8JA 3CEUA 3S8HA 2ATMA 1HL2A 4Z1DA 1HO4A 1TQJA 3TK7A 3LHZA 4YXGA 2ZRXA 1QFEA 2YFOA 3LHYA 3DH7A 3DZ1A 4BFAA 3NZRA 1XBZA 2ATSA 1G69A 3DFSA 3TNOA 3M5VA 4O1BA 4UFJA 3S9YA 4ADSA 1Z48A 3EWYA 5LHEA 1K02A 1OYAA 1THFD 3W7OA 1PL9A 1ZENA 2Z2UA 1XDLA 4LOCA 1SO3A 1SZNA 3FKRA 3OHIA 2QCDB 4A3UA 6TIMA 2BXVA 3LI1A 2DP3A 2O7SA 4NX5A 3B0UX 1QNVA 4S2BA 2FPVA 1ML1A 2ZRZA 2JK2A 3GDKA 3TE9A 1UASA 1PCKA 3JRKA 2XFWA 5AC8A 2FTPA 3HO8A 2OZ0A 2EAWA 5D2VA 1G67A 4A2RA 1FUYA 5L6UA 2G97A 4JX4A 4HSNA 1GTEA 1XI3A 1QR7A 1EEPA 5D33A 4FX8A 4NUWA 1F6KA 3LXAA 3I65A 1W3TA 4FXRA 4AWSA 3G0XA 4JTGA 4CQ8A 1Y0EA 4HNUA 3QEZA 5I3KA 3NQFA 1R2RA 4O52A 3G3DA 3PBUA 1ZAHA 4GXMA 3PB0A 4O28A 5F1UA 1QOPA 3BGGA 4N6FA 2YX0A 3INPA 1LDCA 3S5YA 3EXSA 3W9ZA 3FYPA 3CWOX 1JUEA 1ICPA 4OHQA 5K4ZA 3AJXA 1KLZA 1IXPA 4IUOA 1UJPA 1KV5A 1UUOA 1TJPA 2QUVA 1D3HA 4M5PA 3W7JA 5L9FA 3EX6A 3E0IA 4N9CA 4U4MA 2X16A 1W0MA 3P84A 4QM1A 4UMAA 1H5YA 2A7PA 1PE1A 1XBYA 4GUFA 1H61A 3KXQA 1C8VA 3GLCA 3C61A 4DF0A 4K7VA 4NJJA 1AL7A 5FI8A 1PIIA 3PR2A 4JTLA 4JTFA 4FNPA 4JTTA 2G95A 1K7FA 3LXBA 1OYCA 3F4NA 3GDTA 2WSQA 5CG7A 3EEGA 3N14A 3P5ZA 4O12A 4CNOA 4R53A 4IXHA 2NXGA 1GPWA 1HO1A 4FNTA 4O16A 1K7EA 2VEMA 2BSLA 2WPBA 3O8AA 3S5NA 3NQ8A 5DY3A 1MEIA 3O63A 3L2IA 3ATYA 3WJWA 3DGRA 3OEXA 2ABAA 1P0KA 5E93A 2E77A 4DQWA 3WK2A 1OYBA 2UV8G 4Z1BA 1NFBA 3HGOA 3LHVA 3P62A 3NQVA 3TDFA 4NJIA 4Y8FA 1EP3A 4K8EA 5HWJA 5AYYA 1ZALA 3MBDA 2B7QA 4QNEA 3TA6A 4JYDA 4UTKA 3O16A 4RX0A 5BNKA 4UR8A 2YSWA 3KOFA 2BLEA 4IMDA 5DY2A 2QJGA 2WNQA 3KVJA 2E5CA 2QCGA 3QMTA 1SUXA 1X1ZA 4M7SA 3PWAA 3W7GA 1SFLA 2VELA 3T4CA 2C18A 3TJLA 4NU7A 4JTEA 4UCGA 1AW2A 4M6VA 1DORA 1D3GA 3P5YA 1GVOA 4N4PA 5F2IA 3SGZA 3UPWA 2H90A 1TYGA 3DU0A 1KM5A 1NF7A 1P0NA 5AHIA 4LVAA 2OX1A 3ATZA 3N9RA 4YL2A 1FDZA 5EPDA 1KFLA 3HGRA 2Q3OA 3HG4A 1CX9A 3EX1A 4RCXA 3DFQA 3LCXA 2PRHA 3E02A 3W2LA 3WJYA 3G3MA 4UTWA 4H4IA 4UC5A 3W7PA 3HOJA 1VLIA 3C6CA 2C0AA 1DL3A 1FDJA 5I3FA 3EWWA 1JCJA 1W5NA 1OG0A 1RV8A 4OV4A 5G5IA 3RF9A 1SSGA 4O8RA 3R2GA 4ML9A 4RJEA 3W1QA 4PL1A 3NQDA 5G4WA 4FXSA 3QSRA 3UYCA 3PULA 1MSSA 4N9DA 4QITA 1QOQA 1L2UA 1GZGA 1OFQA 4S2CA 3T78A 3LB0A 3STCA 3DFPA 1SSDA 3M9YA 2A7RA 3W70A 3NAVA 4BWLA 3W1LA 2FB3A 4K36A
chains in the Genus database with same CATH superfamily
1PX4A 4ZQNA 4O18A 1AJ2A 4H00A 1V02A 2V68A 2HPIA 3IVUA 3PANA 3NQ7A 2MNRA 1RCOB 2W92A 3THQA 4S3FA 4RXGA 1X1OA 3ANUA 4LY8A 1FP8A 3W1AA 1Y5WA 3W28A 1RD6A 1E6SM 3AICA 2WYSA 2PGFA 1RA5A 1XBVA 2PDGA 1PEZA 3VIIA 3FEQA 3CU2A 1X6UA 3ONCA 4IMCA 5E70A 1GJUA 2VP8A 3SRFA 3B8UA 2BGNE 2ZTJA 2FH6A 3ORWA 2DZSA 4FALA 3GC2A 4JD4A 4C6FA 4HMEA 3M46A 2VO5A 1ISZA 1LRNA 4E8DA 4ATLA 4XD6A 2E1WA 3DKJA 3M0IA 3PJUA 2BY2A 2G0WA 4AISA 2QIIA 4WDXA 2FPTA 8XIMA 3FVDA 4GHRA 5AECA 3P81A 1C9DA 1EO5A 1RZMA 1QAPA 4H9XA 3BSHA 2DT3A 1OFRA 1DJQA 1DIOA 1YQ2A 3BPWA 1W2VA 3NL2A 1VS1A 3CYJA 3TYBA 2HMCA 2CLEA 3ZR6A 3RLVA 3W2UA 4XKYB 5D04C 3VOHA 5D30A 5EMMA 3K5XA 4Z2GA 4B2DD 2QCEA 2Z1BA 1VEPA 4PTVA 6XIMA 3GK0A 5LHFA 3BLFA 3GIYA 4C7GA 1ZFJA 4HTYA 1Y5VA 1BD0A 3HF3A 4IMAA 3H2EA 4Y9MA 5IBXA 2CLIA 4WR3A 3UZJA 4FO4A 1MXGA 4JX5A 3VIGA 2XZ9A 1NJJA 1YADA 5AYXA 1XP3A 1X96A 4FI4A 4LUTB 3RNDA 4AB4A 3NPVA 1E6NA 4C6NA 4WX2A 1KFWA 2A3BA 2GGHA 3VC6A 4BA0A 3PSWA 2Y62A 1UBSA 3EMCA 3LERA 4M82A 3DBPA 1WE5A 1OFBA 4MYXA 2HJPA 2J13A 3CHFA 4RNIA 2GJNA 3FXYA 1G94A 1WCGA 5EBUA 1RH9A 4PC8A 5HK4A 3WH6A 3L68A 3RDKA 4JIHA 3WQVA 3S9ZA 3KOZA 1PJ9A 2ZXQA 1O12A 3AZSA 5T91A 2EG6A 4L9XA 4H2CA 3KDNA 3QPZA 4A21A 2Q02A 3ABOA 5E9XA 1CXIA 4GJIA 3OJGA 4Y2WA 3RR1A 5J5RA 4KQNA 3LEPA 4HA1A 3LLDA 1HKWA 4AY8A 3DBNA 4V15A 2OT0A 3TEVA 1IT8A 1NQKA 4IFRA 1TE6A 1TR1A 3ARVA 5JU6A 1N82A 3CAVA 1OIFA 1E1CB 3UCQA 2A3AA 1IIHA 3EA1A 3CHVA 4DM1A 5HANA 1EC8A 4UTHA 2ZZ6A 2GSHA 2ZVRA 3O0FA 4A8LA 4DI9A 1U5HA 2BXYA 3R1ZA 3CH9A 2ZZ4A 3VNYA 4NSBA 1U5VA 5I3IA 1EX1A 3LGEA 2VX4A 1TV4A 1GHRA 3LTSA 1B9BA 4GYFA 4HT3A 4I9JA 4U5IA 2Z6IA 1L6WA 3PG9A 3V3WA 1F5ZA 1WDQA 1A5KC 1J0ZA 4GZJA 1XIFA 3W6MA 4R3UA 4K1WA 3T2OA 3TFCA 3TJ4A 4IP5A 3EYPA 1I1WA 2DIKA 1M65A 4LWWA 1P43A 1LYXA 2C91A 5CSRA 4JPGA 4LRSA 2RGLA 1XGDA 2DZXA 1KTBA 3TLQA 4Q7IA 2OZ8A 1EZ2A 4RNFA 1XIDA 3VKDA 4DJDC 4E4PA 3RUBL 3MUAA 1JI2A 1LP6A 4G5DA 4HK5A 5GNXA 3RCNA 3C2RA 2V2DA 5M3WA 1W2PA 3LG3A 3O6CA 1G6CA 1LG2A 5HQEA 4O14A 3AMGA 2BBFA 1XLEA 2CNCA 1XLIA 1ECQA 2PDIA 4KBXA 2G3NA 3LQGA 4ZOEA 1UPPA 8XIAA 5I3JA 1HJQA 4IX2A 4C6PA 1DHKA 2GJLA 3KAOA 1QWKA 3DCPA 1DJIA 5H91A 1V3KA 3B9NA 3BMVA 2OFJA 4E0CA 3BG5A 1H63A 4JCMA 4DN1A 1MEHA 2Y8KA 3A3HA 1ADOA 5BCAA 2AGKA 1HGYA 1TQXA 1PHWA 2CZEA 5A95A 2ADAA 2BASA 2CLLA 1V51A 2H8ZA 1RPKA 1C90A 3N9SA 4LS1A 4AVFA 4GUHA 4AH7A 3LXCA 4PTNA 1T96A 2NVDA 4H6RA 3VZZA 3B8SA 5I23A 3CXOA 3W71A 2R1PA 5I3HA 3UG3A 2VM8A 4MZ1A 3ZMRA 3D3FA 2V81A 3RX3A 1OEPA 1VCVA 2Y5EA 4J3ZA 3VIHA 4UTMA 3VE7A 2PF0A 3GH5A 4L80A 4LGXA 5U4NA 3PZNA 4O53A 4B9ZA 2I5IA 4H8UA 4MWAA 4DNHA 1UH4A 2DUZA 2UY3A 4W8BA 2JFEX 4HQVA 3BV7A 1H41A 2HZGA 2Q71A 4IXXA 1IEXA 2E6AA 2PODA 3F2BA 5E1QA 2VC7A 4UNIA 3IJIA 5XIMA 4ENLA 2FDSA 3N04A 1GQJA 4S3BA 1GGOA 1XX1A 1PKYA 3S2JA 5EFDA 1CLXA 3QC0A 4W9TA 1K8CA 1QPNA 2IPWA 3B8DA 1HVXA 1XH2A 1M68A 2BNJA 2OJPA 1Y5XA 1O66A 2WNNA 3W85A 5EYWA 3VDCA 3ME3A 3ITGA 2EHHA 1BEUA 1HJVA 4TR9A 3W86A 1WZMA 4HMNA 4G1NA 5FEXA 2GQ9A 1UR1A 4E2OA 1E70M 2CETA 1X8FA 1JZ6A 1L8NA 3FA3A 2YA1A 1GCYA 2AGTA 2EBNA 3ICJA 1TWDA 3C8FA 3PWIA 3OBAA 3EB3A 3LGDA 1HXJA 2CCRA 2VFIA 4GINA 4PMQA 4B92A 5M5DA 4LYKA 4JOMA 3URNA 3H23A 3NQAA 3IGXA 1GQKA 3THUA 4GG9A 3WMLA 1F2JA 5A8QA 1XJBA 1HNYA 2A0NA 2QEZA 1FWRA 3R5EA 1T8XA 3UVAA 3CZEA 1HVQA 3OZMA 4EXBA 3ENLA 3CWNA 1J0JA 3U2OA 4ICNA 4DO6A 4I8DA 1KGWA 1Q6OA 2GSEA 3V1HA 3G1FA 1PYMA 1H50A 1A0CA 3A24A 5E6YA 2FTWA 3PZVA 3WMSA 2IPFA 1B4KA 1W31A 1HT6A 2C6QA 1Q4NX 3W2KA 1W1YA 4M6PA 1BG9A 3S6OA 4W88A 1KO0A 3MHFA 2WKLA 3RRAA 2A85A 3N9KA 4KH2A 2PTYA 4JEQA 1H5VA 1PAMA 4WGHA 3QOMA 2PWDA 1GNXA 4EWND 3C56A 4ATDA 4E2DA 1Z42A 2G8ZA 3J7HA 3W01A 1A5LC 3ZT7A 5C9XA 1XLBA 3EA3A 2R91A 2YCJA 4IWWA 2QS8A 1DJNA 2Z25A 3BZGA 3B05A 3R58A 3EEZA 4IH3A 5AC6A 4D1IA 1QJWA 4NI8A 3S47A 3W0KA 3WKZA 4IISA 1HJUA 3RAOA 5CPNA 5FSEC 1VYSX 4QAWA 4RDVA 1OD0A 3GR7A 4ORMA 1X7IA 4ZOBA 3GBDA 3LX9A 2V30A 3DGBA 4HHHA 2QUNA 5LNVA 2PRLA 3EAUA 1MRQA 3C4UA 3LRLA 2E28A 2EO7A 3NZGA 3QMRA 4DBDA 1B9ZA 1VQTA 1UKPA 2CLKA 1KW1A 1S5MA 2VEGA 1R38A 2Y7DA 1XYMA 2YL6A 5LA1A 3WSUA 3M16A 4EF8A 2DJLA 4XZNX 3FHAA 1KGXA 3LNMA 1GW1A 2Z26A 1O60A 3LZ3A 3GXNA 3QBUA 1NWRA 2VR4A 3M0LA 3TOPA 1EYEA 1C29A 4Z2IA 4TTUA 4JHZA 2QMKA 4YU1A 3BCFA 5G4EA 1V6UA 2GUBA 4HNVA 3T2PA 3EPNA 2DZAA 3S3GA 2RDWA 3SCVA 1WAWA 3NCOA 1OCQA 4W5ZA 1SFJA 1RQBA 1TZ9A 3JU2A 4N2YA 5GJMA 4XZHA 3TJIA 1DBTA 5AHFA 1SR0A 1IWAA 1KCLA 4PZVA 5H8UA 1F3WA 1TV8A 2W62A 3FKKA 1LWIA 4WHBA 4PUUA 4JTJA 1BFNA 3IEBA 5TIMA 1P1XA 1W1TA 4UOQA 2DU2A 2X2YA 3CHDA 2TAAA 3O15A 3BV4A 1TPH1 3FJ4A 3UT0A 1O5XA 3CUZA 3TW7A 1ZHAA 4QJ5B 4YWIA 4ZQMA 4DUWA 4PUEA 3E1F1 4ZSTA 4ZQRA 3BW2A 4UNLA 1W3JA 1X98A 1GQLA 4GABA 2A3CA 3MBFA 4OGZA 5FIPA 2DQWA 5HUOA 3QHMA 1N2VA 3N2XA 4GVGA 4U10A 1IXOA 3LV6A 3AS1A 4J3UA 4A3YA 4C6OA 3LMYA 1UWQA 3UCCA 1XUZA 5JH2A 2EF9A 1SGJA 3N2CA 3VOCA 3GIPA 3GU2A 3H24A 1CENA 3G5EA 5J5DA 3L21A 1JZ5A 3S5SA 3AIRA 4GC4A 3P82A 3GG8A 4IMEA 2V5KA 2AAAA 5FJUA 3CHCA 2POZA 2HCVA 1QNSA 2JGQA 1J79A 4DJEC 4WOZA 2CBUA 1ME7A 3QH2A 1MYRA 1LL6A 3V1PA 1DWGM 3FA4A 4GNJA 4PSPA 2UBPC 4J7RA 2V69A 4YJ5A 3CZGA 2F2KA 4EF9A 4FLQA 4MVAA 3CASA 4GQBA 1HP4A 4LQ1A 4Q8OA 2IKIA 1XD1A 3LS9A 2QCMA 2ZUTA 1A0DA 4FOKA 4D8AA 3TTSA 3M5XA 3HQPA 3PVFA 1LQAA 2PSNA 2J7CA 2WC4A 1WDRA 2Y89A 4CNTA 2AMXA 4O15A 3OLGA 3VMNA 4IQEA 1B3WA 5DBTA 1ZAIA 1SZGA 3HV8A 3N18A 5A6TC 3BXWA 3KWXA 2E5DA 1TG7A 1VJSA 2VYOA 3NPXA 3FS2A 1W3HA 1DJZA 1DXEA 3EDJA 1J0KA 4HMDA 1R3VA 3T0CA 3KCOA 3PPFA 1CTNA 4YMZA 1A5NC 3MUIA 5MKGA 2P3ZA 2J27A 4EXQA 2NXHA 1XPYA 4GYPC 3B03A 2WNWA 3MP3A 2JBMA 1FCVA 1H51A 1XKYA 1XLFA 2FHFA 4B5WA 2VKZG 4XBKA 3TYAA 1E5JA 5G2IA 5IRPA 1MNZA 2X1RA 3BSGA 3MHGA 3W1XA 4Z1CA 2PCQA 2REQA 4JXCA 1QW7A 4J35A 1YHTA 5E0FA 1Q2RA 1CI1A 1IIGA 1XLAA 4R9OA 5REQA 4DXKA 5GPRA 5FJRA 5LGZA 3N6HA 1GYLA 4P8VA 1RHCA 5A8NA 2OEKA 4KWSA 1J4EA 2VRKA 4GZIA 4IGMA 4M6QA 4Q33A 3WBWA 2QCFA 2JEQA 4CU8A 3VGDA 1REQA 4PEKA 3USZA 4KWWA 2FZNA 3A22A 4B9YA 2QJIA 2Z27A 1LOSA 1EKOA 3FSTA 3GFZA 4C6LA 3OG3A 1I2NA 2BGQA 3MKCA 4QE4A 1CXFA 3L0NA 4MOZA 4P8UA 2PDHA 1TPFA 2GQ3A 2QGHA 2O4QA 4UFKA 3S2NA 3L4ZA 2Q3RA 4Q6JA 1W54A 4PTDA 4AZHA 5C0QA 4W89A 3WFAA 3OQ8A 4A3RA 2PWUA 2J8FA 4PMVA 3EDEA 3BZJA 2JKPA 4JTAA 3OLEA 1KA9F 3AJ7A 2QDGA 2OGYA 4ZE5A 4ZCWA 2GUYA 4LW7A 2G5WA 3CLMA 4YVPA 4JICA 1KLYA 3WEZA 1PX3A 4GQGA 4L64A 5CH9A 2JGYA 3STFA 3FIGA 2G41A 4OQVA 1SFTA 4ERGA 4EX4A 3AMCA 1AA1B 1I2PA 1UWRA 3K8KA 4PRTA 4C6IA 2OCZA 3I3BA 2CHNA 1BXNA 1F9CA 4OOZA 4RNJA 3CTTA 3AHZA 1AH4A 1LG1A 2HS8A 2QV5A 3AHXA 1A47A 4DPPA 4XV0A 4I7VA 2ZUMA 3NL3A 3WH8A 2HVMA 2TPSA 2VUNA 1TVNA 2YB4A 1W1A1 1BYBA 4CQ9A 2ZIDA 1YNYA 5AY7A 3NA8A 5BU6A 1FWWA 5GNZA 4N0RA 5DCEA 4G7FA 3OYXA 3DFTA 3OGRA 1QHZA 2E5BA 4V1XA 3CLWA 3TYCA 2HK0A 4Z0JA 1IT0A 2CHRA 3O6AA 3R79A 3MU7A 4F2UA 3GHTA 2GVYA 3B3DA 4CGTA 4CNPA 4OV9A 4MPKA 1V0NA 2X09A 2Y61A 3SCOA 4GY7A 2NZLA 5D37A 4LCQA 3MJYA 2O9OA 2DUAA 1CXKA 1EPXA 3N11A 3WO8A 3PM6A 3ZT6A 2EJAA 3WDRA 1VR6A 1KRBC 4H6EA 2VXNA 2WJZA 3NXLA 3CJPA 3I6RA 3DHPA 3R43A 3L5MA 1YXDA 3E9AA 1C93A 1L0PA 2QMJA 1PVNA 3CV1A 3CQJA 3NQGA 4LVFA 1XFCA 4E38A 3NO3A 4JEJA 4K37A 5BXSA 1DWHM 4U31A 1HG3A 1WUEA 1SZEA 5FL0A 2AL2B 4E2BA 4QRNA 3XINA 5HA7A 1MMFA 4JKLA 5DMNA 3QYQA 4NZ3A 2YCLA 2NQ9A 4KIRA 1EXBA 3R89A 3A64A 2UWFA 3VVGA 4KETA 2DPEA 3C5QA 1PBGA 2QPUA 5JXQA 3FAXA 4LVGA 4CCDA 5CSSA 4MNKA 1Q6RA 3IK2A 4G7EA 3WD4A 5F2GA 4NI3A 1CWYA 3KM8A 3ARQA 3IPWA 5D03A 1EP1A 1GK8A 3WK1A 2DZPA 4P61A 5AHNA 2WMGA 4AHQA 5A3HA 3N2MA 3IACA 2YYUA 3T1GA 4O0ZA 1S5WA 2GDVA 2PC4A 1F4AA 2ZDSA 1K9FA 1YTDA 3ANVA 2H6RA 3WQPA 4K39A 3BG9A 3WLRA 4LRTA 4AD4A 4JQ1A 1GYNA 3SRKA 2J8TA 3GNOA 1AQFA 4MM1A 1XSIA 1EDQA 2P88A 1L8PA 2VI0A 5F4SA 5EY5A 2WMIA 3H4GA 3F03K 1PYFA 4LPCA 3W27A 4H04A 3H2NA 4XZ9A 4HYVA 1XSKA 1ISXA 4RE3A 1FH7A 3TZFA 5TF0A 1UA3A 4AVOA 4KS0A 7REQB 3T09A 3R10A 1R3YA 1PS9A 2R14A 2D1ZA 4Y9AA 3S5OA 8TIMA 1TV7A 1TELA 3W87A 2VEFA 1EJVC 1WA3A 5IFPA 1UPMB 1XYAA 2OODA 4FLOA 1PUDA 3PNZA 4NAFB 4AZ7A 1OINA 1JGMA 5LNWA 4AIEA 1W17A 3A9IA 4HSHA 2QUMA 4BZYA 1FHVA 3OZPA 5LA2A 1I0BA 1EWEA 4HBKA 4H19A 4WJ8A 3KZSA 1WXYA 2H3BA 3TIMA 1NDVA 3ZM8A 3LRKA 2NX1A 2PLCA 1P6CA 1RBAA 4QDPA 3KLKA 3VD3A 1ZGDA 1H7OA 4DX3A 1GTHA 5LIUX 4MSSA 1PTDA 5CXPA 1PZ3A 4PB3A 4HN4A 4MDPA 5G2HA 3IUIA 3KRSA 4N9EA 3JUGA 1C8XA 4WY0A 2VZOA 5M2FX 3RILA 5CC3A 4HNNA 4O54A 1JYNA 2PWVA 5BXTA 3OYZA 1QOXA 5A6MA 2PCEA 3CUIA 2CWNA 4OIFA 1QVBA 3Q94A 4EKJA 3M7SA 3WF3A 1OT2A 3R0KA 3CMFA 4H6KA 4TVUA 2EQDA 2R1MA 4QG6A 2FZ9A 4JFVA 2NWSA 3JVAA 3IGSA 3TWAA 5FJTA 3RN6A 4A05A 2A4AA 3GDMA 3TV8A 4OBTA 1FVPA 1JNEA 1TTPA 2CLFA 2J77A 4GKTA 3UESA 1OX5A 3E0FA 4WJXA 1V79A 2OSYA 3GIQA 3UA4A 3CYVA 1OC6A 3N17A 1BWLA 4LALA 1BSLA 1OQFA 3IAQA 3I4KA 1EUAA 1OWQA 4JYEA 2BG5A 3HQNA 1YPIA 3IIPA 1B3OA 4TU1A 1OG6A 1JF6A 3H12A 3QHNA 2BVWA 2D24A 4Y6GA 3E3HA 4Z1DA 4GY1A 1DXFA 3LHZA 4JN8A 4V2XA 4HMCA 3DDMA 1SMDA 4QHRA 1F3TA 3VXGA 1PKLA 3M5VA 1DP0A 2AQVA 4CUCA 2Y2WA 4ADSA 4HPGA 2YL5A 1FHUA 4BS0A 3HMCA 1SO3A 3FKRA 2QCDB 3LI1A 4ZB5A 4WSJA 3B0UX 1QNVA 1XV8A 2WVVB 5BOEA 1Q7ZA 1I0DA 1J11A 1UASA 5AC8A 1XRTA 1FHLA 4GIRA 2EAWA 5FSDC 5BXRA 3WF0A 4HSNA 1BGGA 1XI3A 1QR7A 2NSOA 5D33A 4NUWA 3U2EA 3LXAA 1JXJA 3N4AA 4M29A 3Q45A 3UZYA 3G0XA 4JTGA 1Y0EA 3QEZA 3VYLA 3NQFA 3G3DA 4PE8A 1ZAHA 2J6VA 4W87A 2HQAA 2YBVA 2GOKA 3RCMA 5KETA 1QOPA 3BGGA 4N6FA 3KRBA 4FOUA 2OWCA 3S5YA 5CC7A 2I7GA 5JBFA 1QI4A 3VAVA 2XIMA 1RUSA 4XISA 1IXPA 2Y8VA 3WLIA 1F8IA 3IJLA 1UUOA 4L1XA 3VNZA 4U4MA 5ABEA 1W0MA 4UMAA 1H5YA 2A7PA 1XBYA 4GUFA 4DF0A 1AL7A 1MUWA 2V5JA 1MW1A 1Q8JA 5FI8A 2W67A 2GJXA 1MFUA 2G95A 1K7FA 3LXBA 2HRWA 2WSQA 1O5QA 3EEGA 2WANA 3XISA 4MJ4A 1VFMA 3KL5A 4J3SA 2AQOA 4FNTA 4PCTA 4GMEA 1GW9A 2BSLA 2WPBA 3H4WA 3NQ8A 2INZA 3MS8A 1T8QA 3ZVIA 4LY4A 3FGCA 4GCXA 3VU2A 3SCSA 4OUEA 2UV8G 1NFBA 1RK6A 3HA1A 1JAKA 4JQ3A 3LHVA 3P62A 4HGXA 3NQVA 5JQ9A 2D3NA 2W5FA 2BY1A 5TNVA 4Q8UA 2GDUA 4Y8FA 2G3JA 3GG7A 4J5NA 5HWJA 6TAAA 3AIQA 2B7QA 4UTKA 2XJ7A 3UJFA 1DWFM 2WXDM 5BNKA 2NQJA 1P48A 2YSWA 4F0RA 2XZ7A 3CL7A 3QZAA 1SUXA 3EDFA 2J75A 2YDRA 3PWAA 4BQ5A 4LAUA 3PZOA 4NU7A 4LUTA 1CGTA 4M6VA 1DORA 2W9MA 1W3KA 4N4PA 1JDFA 3SGZA 3UPWA 1FWCC 1FWDC 3WF2A 3AXMA 2OX1A 3N9RA 4YL2A 3HGRA 3MCNA 1VFHA 1GZJA 2Q3OA 4TUFA 4V28A 1CX9A 4A4AA 5CC5A 3H2FA 1M1BA 1GKQA 3LCXA 1WKFA 3E02A 3W2LA 2D23A 4UTWA 4H4IA 4UC5A 3HOJA 3UERA 1EOMA 1DL3A 1FDJA 5I3FA 1JCJA 1OG0A 4KW2A 5CJ5A 1RV8A 4JQAA 1SSGA 4O8RA 2W91A 3UG5A 1ZP3A 4B3KA 4FOJA 2E9BA 1L2UA 3UU0A 4QTGA 1GVIA 2O4MA 1RA0A 4QEEA 1R3SA 1Z3NA 2H9AA 4H9VA 2IUZA 5M17A 4IF2A 3SCQA 3URAA 2PB1A 1PZ2A 3WDPP 4BWLA 1VD6A 1BWVA 2EPHA 3NZQA 1AG1O 1QI5A 5BOOA 4C6EA 1UWUA 3TSDA 4GE8A 3ZYZA 4L65A 2QW5A 1FXQA 5BYWA 4ZB2A 3NQBA 2FKPA 3B9AA 1JCTA 3ZOAA 2V8ZA 3MSYA 2WKJA 4N7QA 3EMZA 3STGA 1TV2A 4GUGA 4KCUA 4UUIA 1TCDA 3LTPA 5AZ1A 1XM3A 1WAUA 3FJLA 2FJKA 3S1VA 3K4DA 5TQLA 5KZMA 4F79A 4NAEA 3OBEA 4GI6A 2GDQA 4ZOAA 1QO5A 2B4GA 3RFAA 2XH0A 1XYZA 3OLDA 3QV6A 2WSKA 2VX6A 3TAOA 1YDOA 3T9PA 3OVRA 1K7XA 3NDOA 2VFDA 3U48A 3OIXA 3UR2A 1CGWA 3ZSTA 3APGA 3TJXA 2BVDA 3L9CA 4X2RA 3WF1A 3TU9A 4RZ6A 2SFPA 5A8PA 1UH2A 4S1FA 2NQ5A 1PTAA 1N8FA 4CCCA 4AD5A 4B5TA 4W85A 3PUDA 4H9YA 2GGIA 2J9XA 1NDYA 3K1DA 1KR1A 3W25A 3C3NA 4CN4A 2CKSA 4NXSA 4JR5A 1VIZA 3KW3A 3WBYA 2ZX7A 2PU0A 4XBSA 2GZXA 2GOUA 4ECLA 3R12A 4HZ8A 2PBOA 3OO2A 2VFHA 4OJYA 3AZRA 1RD5A 4GWEA 3ZLGA 4E4UA 4ADTA 4D71A 3PP7A 3SR7A 1QNQA 3U5YA 2PDPA 2OO0A 2GLKA 3LCWA 4GXWA 4PMXA 3TXZA 2HDJA 4KGLA 1E55A 3OIHA 5CGMA 3QY7A 2IQDA 4LVDA 3IGUA 3SUTA 3WFZA 1NQ6A 2IMRA 3GW3A 2C15A 2P3EA 3L0GA 3TVAA 3W7QA 1UMLA 2FH8A 5KMYA 1U1JA 2G4FA 4B3LA 3KBVA 4WGXA 2DV0A 2NXIA 3MQTA 1CDGA 3RU6A 4HYRA 5IFTA 3AIVA 3CZ8A 5KZ6A 4FX7A 1VPYA 1MUMA 1TPDA 2B7OA 1KQZA 2FTYA 1AD1A 2PDJA 1DIEA 1TA3B 5G1TA 3T0TA 1P7TA 4LC8A 2B7PA 4DJEA 4XTIA 3A5VA 1XKJA 3H2OA 4Q22A 3TWBA 1VZWA 1POJA 1LL4A 5TBOA 5CPTA 1W5OA 2XSXA 4YNGA 1V7YA 4PMJA 1XRVA 5IBXC 1G5AA 5DN1A 1I2RA 4QCEA 3MT1A 3ZR4A 3TXVA 1MZRA 1PKNA 3KOWA 1M5WA 3I68A 2ISFA 3URQA 3BTNA 3O9NA 3WH5A 2ON3A 4GYKA 2ZCGA 3AISA 2ZA2A 5D9OA 3LA4A 1OF6A 3SB0A 7TIMA 2G4JA 3DX5A 1XIIA 4HZ6A 4LUSB 3UG4A 1KBBA 3JZUA 2XM2A 3EBVA 3JR2A 3G24A 4PUWA 2HBXA 1Z89A 2OO6A 1FXPA 2VZTA 1FKXA 3W83A 1LUCB 4PFMA 1DJWA 3QLLA 4ZB0A 3UWQA 2X0YA 3PTQA 4FA3A 4IFKB 5CZTA 4WKFA 3UR7A 4IOTA 4IIHA 4L4PA 3AZTA 1HIZA 2WLZA 3O06A 2ZVIA 3A21A 4Q4QA 3SADA 3M5YA 4CQBA 3MHUA 1EBGA 1E9ZB 3CQKA 4O11A 4H9MA 3O0KA 2EJ1A 1GEHA 3EZ4A 3O07A 4Q8WA 3GW0A 4YTUA 1KD0A 4WVXA 1A5AA 5CLTA 3EOSA 4I6VA 2VGFA 1BVWA 1WKYA 1W5MA 3GVVA 5HNNA 2CU0A 4DJFA 1O7AA 2XH7A 3QMSA 3ZWSA 1OADA 1O5KA 1GVSA 2O9PA 3U57A 3EXRA 3I3EA 3PUOA 4ROPA 5CKSA 2ZC8A 5HBFA 4XD4A 2ONEA 4YTQA 3RHGA 2GQ8A 1JCYA 5C2GA 4Z1AA 4DYJA 1OFEA 3V5FA 1XIMA 3W1TA 3HG2A 3M4HA 3BG3A 3WK0A 4ZO9A 3ITOA 1JCNA 3RO6A 4XX6A 1DIDA 2WLYA 5DRCA 3LSCA 4MB5A 1ODZA 2FIQA 1ZRQA 3OLIA 3SECA 5XIAA 1KWGA 4AIUA 2TRSA 3Q4DA 3P7YA 3SQMA 4WK9A 3UY8A 1CLVA 3WEMA 5A6KA 3PHAA 4WIWA 3WH7A 5ECVA 4EAYA 1SO4A 2X0HA 1SMAA 4JKKA 6ALDA 2E09A 4F40A 2NX3A 1HL9A 3GNPA 3SN0A 2E67A 3PPHA 7CGTA 3EKZA 5LYRA 3EWDA 4BQ3A 1KXTA 1TRIA 1YDVA 2OG9A 1UUMA 2C3ZA 1HQTA 7ODCA 1MQPA 3LPGA 2BMBA 3C2YA 4F0SA 3AHTA 4AF0A 2IXUA 2HVOA 2PWFA 4O1DA 1VFLA 1J6PA 4MLJA 2BZNA 4QQ3A 2VVSA 1JPMA 3CIVA 3NL5A 5CAKA 4IGNA 2BHYA 3P14A 2B7NA 3PUEA 3RYSA 4XUGA 5T26A 1H2JA 5AYBA 1ZSXA 3WF4A 1F6PA 3V0SA 4E8CA 2A7NA 3PBVA 2YA2A 4GJJA 4W7UA 3REQB 3V5OA 4G9PA 1HF6A 5C5YA 3V75A 2Y5JA 4FLRA 5KZDA 5BRPA 2FHCA 4PUKA 1AQMA 3CT7A 3QY6A 1ONRA 1S2VA 1LBFA 1VEMA 1IYXA 3R25A 3ANYA 2CBJA 4HSOA 1OK6A 2TSYA 2PBGA 4I5XA 4UTTA 1HKMA 3GKAA 3SAZA 3JS3A 3EWZA 3FYYA 3L4UA 3HIJA 2HNHA 2Y7FA 3VOIA 4DBWA 3DKLA 2VD8A 4TOQA 2NVCA 1TPWA 1TRDA 2D73A 3H6OA 4LT9A 4GCAA 3GHUA 2X41A 5I06A 1K1DA 4MWAC 1ZP4A 3F5LA 2OLSA 1K8XA 3C2FA 2FZMA 4NASA 3GDLA 3NPWA 4QEHA 3CB3A 4NZCA 5FF4A 1TVLA 3W6YA 1MQQA 1OFOA 1UD8A 4AX7A 3W29A 1Z44A 2R8WA 3G0UA 4DO4A 3AXKA 3POCA 2P10A 3T6CA 2X30A 3IS4A 1R47A 2PAJA 4LF2A 1XH1A 1DQXA 1PPIA 3TX9A 3LOTA 3MVIA 1ZPTA 3ARSA 2JEPA 2OZTA 2D0HA 2DSZA 4AZCA 5CCZA 5H2ZA 4C6KA 1VLWA 3VIMA 2Z1SA 1RY8A 5LNSA 2VOMA 2BS9A 3PSVA 1U2YA 4AHPA 1E3ZA 2QT3A 4PUMA 5AB3A 5BMXA 3SIZA 3MWAA 2Z1WA 2PDMA 1UB3A 2OQYA 4UXDA 3MI6A 4IIEA 2VEKA 4PYSA 4Y9NA 1UD4A 3FSUA 3BAWA 1KFJA 1GKPA 2VHLA 3I4EA 3MUY1 1SW7A 1C9WA 4X9YA 1TWSA 4M80A 4GYJA 2BY0A 3V7PA 3DC8A 2JE8A 2WV8A 4NVTA 1QPOA 1F4HA 4XAYA 2Y8UA 2NUXA 1QO2A 1IZKA 4Z2JA 3A5FA 3MW7A 4HU4A 3RGTA 1QPKA 3OVGA 4KCWA 1P0DA 1ZJAA 4OWGA 3UWWA 4UQCA 4PH6A 1QTWA 4RXFA 3N3TA 3G1AA 4FF7A 3WLHA 1J0YA 3NQ6A 1BQGA 1NAL1 1SFSA 4HNOA 1XLGA 4JTHA 4M1RA 3F4WA 2YW3A 5LSMA 4UFLA 3MKKA 4IP4A 3BUVA 3PBYA 5CZJA 2DVXA 2CW6A 1V03A 3G1XA 3FHQA 1R7AA 3RLHA 3KOXA 4MF4A 4L6HA 3SJNA 1DE5A 4XAPA 1AD4A 3MVTA 2DZWA 4QNWA 1HKIA 4NL1A 3H7VA 3V18A 6REQA 3MSRA 1LZOA 1D3CA 1RXOB 4N02A 1Q65A 2EPLX 8CGTA 2C16A 3G1VA 3ARPA 5E6ZA 1IHIA 1FBAA 1E56A 1I1XA 5IM51 1RQEA 3NL6A 2RHGA 1P0EA 2AL1A 3M64A 5SWUA 2F6UA 2YR1A 3BLOA 1PWLA 1V3IA 4HB7A 4IJCA 4RV3A 3THAA 2ZXBA 2CESA 4QCFA 1DOSA 1BXBA 4EPEC 3KTSA 3L4YA 3N25A 5I0DA 4NNAA 3QF0A 1Z9AA 3DENA 1QMLA 2IS7A 1J2BA 1UQYA 1NH6A 4P7QA 1BYCA 3ARUA 3GDRA 2WSYA 4EPKA 3ZJ6A 4XZBA 3L4TA 1VFFA 3SEPA 1TCMA 2ZBTA 3STEA 1FWNA 3QV8A 4Q4OA 4HTBA 1S39A 1MWOA 1UROA 4NIRA 3M44A 2UY5A 3OA3A 3CT2A 3MV11 1TZ7A 3GXIA 4B16A 3LU2A 2YA0A 4AEFA 2OTDA 1EQCA 3F7JA 1T40A 3AIUA 3WUEA 4HHPA 3K4WA 2QQ6A 3NTYA 5A5WA 1UKOA 3KL0A 4XUYA 4ILSA 3T08A 3VILA 1TUFA 4IIDA 2AAMA 2XU2A 2WHJA 2QCHA 3IUHA 1UKQA 2FPYA 3VC5A 4KWOA 4F3HA 4BQ2A 1DV7A 2Y0FA 1JDAA 5F1VA 2E4TA 3MMDA 3TYUA 1PZ1A 4GX8A 1QU4A 1R30A 3W23A 4GIEA 1XG3A 5FEWA 1JUKA 1JG9A 4MTVA 2R82A 4AYSA 4H01A 3EWBX 4H8VA 2V38A 2WOQA 3QQ1A 4IG2B 1GPFA 4KCVA 1ONWA 2PDNA 1G4TA 1H62A 3WLSA 2D2HA 1I4NA 1MO0A 4Y90A 3WIJA 2Z24A 3W1MA 3HG5A 3SQLA 4DF1A 5EMUA 4F4RA 1ISVA 1ITQA 2V2CA 1ZNNA 4JX6A 3WBEA 1VGAA 1B5TA 1VPXA 4EWJA 1RR2A 2YFNA 3BQ6A 5AZ0A 4BR1A 3NWRA 3H8AA 2ZXDA 1FRBA 4WLCA 3SO7A 2P50A 5FAJA 3A12A 1L2QA 4XAZA 4S39A 4PUNA 3M1ZA 1J5TA 3UP8A 2Z1XA 4DBSA 3BMWA 4AU0A 4HYWA 3WQWA 1O68A 1YTKA 2WC3A 1EBHA 2DJXA 3GR8A 4PBFA 1V8EA 3Q37A 3UD6A 1M9HA 3KOYA 4X2PA 2CEQA 4M3PA 3GS6A 1FQ0A 4RNHA 3BAKA 1R7OA 3UZ5A 2A3HA 2YL9A 4LSBA 5A6JA 1JYXA 5DLCA 1QRQA 2DH3A 3GXMA 1OFAA 1X38A 1YE6A 4CCZA 4HOWA 2ZXAA 3GTFA 4AFYA 2B81A 4ZR8A 4PTWA 3THCA 3SFKA 3AXXA 3NUKA 3EX2A 3O6YX 3P74A 2Z00A 3G1RA 2WK2A 1NP0A 3COTA 1VRXA 2GVLA 3PZIA 4RE0A 3U4AA 3IVSA 3U3HA 1X97A 1AW1A 1ZCCA 4LX4A 4Q8QA 5HJLA 1SU5A 4AWUA 4MDOA 2E1DA 1JCMP 5AC7A 3B97A 3O05A 3TN4A 3IJ6A 4GO9A 1NFGA 3Q67A 3VABA 1WBJA 1Z7AA 1LL7A 5M1TA 5C9RA 3LBMA 4LV4A 5BWAA 3QM3A 3EOEA 3M07A 4AW7A 4FXFA 6XIAA 2A79A 1VCGA 2AL2A 2AQWA 5I09A 3G8EA 4M8UA 4ZO8A 1W1B1 3TSMA 1XDJA 5D09A 4Q7BA 2VEPA 4AXKA 2WCAA 1M7PA 2G96A 2X7VA 4CCEA 4UTUA 3KRZA 1IF2A 1KFCA 3V36A 5FF3A 2AMGA 2X1SA 1A50A 3C0JA 2GK1A 1UKSA 5CZKA 3W22A 3PNUA 4O13A 2YDAA 2G3FA 2ZRWA 1UWIA 2HV5A 2VWSA 1OK4A 2JALA 2FFIA 1WPCA 1I2QA 3TZNA 3AHYA 1H7PA 4JGDA 4RZBA 2Z4GA 5G1MA 4LEQA 4R88A 2CFFA 1KM3A 3HJZA 5HPOA 3FXGA 4UMBA 1LCOA 5I3GA 1B4EA 4WD0A 2VGGA 2DDXA 1LROA 1V7AA 3W88A 5I24A 1DTUA 4NY2A 1FWAC 4GQQA 3FA5A 4FSAA 3QR0A 3BAIA 2NVAA 3WJXA 4W8AA 2ODOA 2DZBA 4QS6A 3SI9A 3KHDA 3OBKA 4UBPC 5H8MA 3GH4A 4IPLA 1B57A 1BF2A 4XZLX 1AUSL 1E15A 2CYGA 1EHAA 4I9TA 3AMKA 1R85A 4US5A 3N6QA 4D6IA 1JRCA 1JNDA 4RKAA 3IVTA 4R7OA 3RK8A 3HURA 1V3JA 1GWJA 3CPRA 2P76A 3EX4A 4XIAA 3FJNA 3RM4A 4AUBA 3NZPA 3W6LA 4ZFCA 2P53A 1E6RA 2Q6ZA 4QE1A 3SZ8A 3MB9A 4GI8A 2VCAA 3NXFA 2VX5A 4BF5A 4F2TA 2ZTKA 3LZ5A 3VDHA 3UPMA 2QCLA 3GO2A 5FCZA 3B4UA 3AQUA 1QBBA 2NLIA 4QR6A 5DCBA 2J7DA 3KRUA 3PK7A 4B5SA 2C79A 2XFFA 2GVGA 1VP5A 3BLDA 4NJHA 4H8HA 4O50A 2Q01A 2V5LA 4QDMA 5AVHA 1QPRA 3DYMA 4K68A 2J8GA 1W8GA 4GACA 1J6OA 3SGUA 1B54A 3CMGA 3OODA 4DPQA 2QCCA 5HJXA 1JVNA 4FIRA 1ZBCA 3Q58A 4J3WA 1WX0A 2NUYA 3A4JA 3VI2A 1J96A 3PY2A 2UZ9A 5I78A 4WEVX 4DELA 1SM9A 3EB4A 4AVNA 1SZFA 3N73A 3PTKA 3AHVA 2IPGA 1MDLA 4UOZA 3HQOA 2QJMA 2PLJA 1WNOA 4OVXA 4FAMA 2IKJA 3UY7A 3DHDA 4ONVA 4O4WA 1PX8A 3EWXA 5F2MA 1BVZA 3F1QA 5HNRA 1WO2A 2HISA 3P61A 2E6FA 3ZFHA 3TTQA 3ABXA 3VDBA 1V3HA 3S0CA 1BTMA 2AOSA 1MXSA 4J3VA 4AD2A 1E6XM 5JBEA 1K03A 1R87A 1BAGA 3DIPA 2J6XA 1JRBA 5U7SA 1H60A 3EPOA 4BF9A 3IIZA 4XVDA 1XIJA 1ITUA 1OT1A 5BMWA 3WNLA 1S2TA 1OGSA 4U28A 2VFFA 4YPJA 1W3LA 1V6VA 3WDQA 3U4FA 2VCBA 4KRZA 2HE8A 3I6TA 4Q8MA 3IRDA 4TMBA 3U5UA 5D9PA 3KVLA 2QJHA 1EHNA 4LFYA 4KPLA 5EGRA 3W7HA 1Y8BA 4F66A 3GB6A 4B2DA 3NQCA 1SPQA 4ICCX 4NT0A 2C8NA 4PUDA 1TIWA 2R24A 2PI6A 4LUIA 1GONA 4C6QA 3M0MA 1UA7A 3A9BA 2V3GA 5IHSA 3O2LA 5CBJA 1VFSA 3L4WA 5CJMA 4ACZB 1XSJA 2ACUA 2C1GA 3F5JA 4IGSA 4PSRA 1U83A 3VIJA 1JL8A 4RR4A 5HNTA 3IIXA 4WJEA 1NEYA 1BSIA 2DT0A 5CGQA 1A49A 3I7QA 4AQLA 5B7ZA 1TMQA 4LYQA 2YBUA 3W1UA 4TV5A 1IV8A 3F2CA 1GUVA 1UC5A 3BW4A 2C71A 3ABQA 1C7TA 2V5CA 4LEFA 3W84A 1Q66A 1R46A 4Z2LA 5C6MA 5K4XA 4YYFA 5A94A 3P93A 1C92A 1YXYA 4C1KA 2QAFA 5I5RA 1GVFA 4UQDA 1TSIA 3TCSA 4O19A 5H8PA 2BTMA 4D6DA 3BSMA 2BY3A 2ISSA 2RH9A 1VC4A 3WQOA 3ABZA 3QR1A 3KFTA 3DHFA 4DJED 4X60A 4FNQA 1QDSA 3AIEA 4S3GA 1WYIA 3PBGA 3W7MA 2CBVA 3S2CA 7XIMA 1VB9A 2ZA3A 4JFTA 1UC4A 3U2CA 3S2LA 4IIGA 3KZPA 3RPMA 3CH0A 1Q5MA 1BLIA 4W5UA 4OECA 4BI7A 2XN2A 4NJKA 1ZJIA 3W7KA 1WP6A 2GJRA 3AWOA 2OU4A 4FS9A 4AMCA 1NOUA 2PDYA 4HU0A 2D2JA 1FDYA 2Z7GA 3AMDA 1G7VA 3DEQA 2FHBA 2VVNA 2WJDA 1DWJM 1I6NA 2PD9A 3PZMA 4RW5A 3WMBA 1KM4A 1GVEA 3TAKA 3TN6A 4IMGA 4GH3A 4D8LA 3PWGA 3ZVHA 3AWNA 4UTFA 3B0PA 3N19B 4JHMA 1H1YA 4PRRA 4HK6A 1AQ0A 1MEWA 3R94A 1P6BA 4P8WA 3WLJA 4C1LA 2EG8A 2E9MA 2EPMX 3CQIA 3MDWA 1TPC1 4WOQA 4ZL1A 3S8HA 3RU8X 4M0XA 3TK7A 5C2CA 3ITYA 3LD5A 1CGVA 2ZRXA 3LM3A 3DZ1A 4BFAA 3NZRA 2C1IA 2VCCA 1JZ3A 1XBZA 1D2KA 4LYRA 3TNOA 3CAWA 3VNKA 2FGZA 1Z48A 3ZT5A 3W7OA 4JCLA 1MXDA 4JAWA 1FHDA 6TIMA 1M04A 2DP3A 2J4GA 4NX5A 3FVMA 3APYA 4S2BA 4MUPA 9CGTA 2J7GA 2ZRZA 1G1YA 1XQKA 3TN5A 3BAXA 4PB5A 2POTA 3JRKA 2FTPA 2V3DA 4P8XA 2XVKA 5D2VA 1FUYA 2G97A 4JX4A 4LBUA 3W4RA 4DVOA 4FX8A 1E72M 1YRRA 3I65A 1Q8AA 3MSDA 4PB4A 4MJ2A 5ABGA 4AWSA 3S6TA 5I3KA 4AZBA 4C6MA 1R2RA 4O52A 1SJBA 2PC8A 4O28A 3ZIZA 1MFVA 1M03A 3AFBA 1WKEA 4A3QA 1RVKA 2QJJA 3EDKA 3CWOX 4OHQA 1HJSA 1WZKA 4XO7A 1KLZA 4GZ7A 4IUOA 1GYMA 1UJPA 4C6BA 4AD3A 2ICSA 4GLEA 1FP9A 3KTXA 3L4VA 3E0IA 4N9CA 4DWSA 2X16A 2I16A 3KP1A 1BYAA 1QHOA 4XZMX 5CQ1A 4K7VA 1RJQA 4HPHA 3RX4A 2PDLA 4Q8PA 3SCTA 4JTLA 3H2AA 1PSCA 1A5UA 3H2MA 1OYCA 3LPOA 3F4NA 3GDTA 4J3TA 3W00A 4M56A 4LAMA 3CAKA 4DNMA 4XIMA 4DZAA 3TYZA 1EJRC 2VDHA 4HOXA 3U9IA 1JPIA 4W7VA 1CIUA 5JUVA 1V6WA 2J7FA 2NXGA 2JIWA 1Q6GA 3E74A 1T6MA 4E4FA 4PEEA 1K7EA 2XVNA 4OOUA 3QKZA 1US2A 2DVTA 4NYUA 1EF2A 4JIEA 2WQDA 1KRAC 3ATYA 4Q4MA 3DGRA 4CQCA 3QN3A 4NYYA 1Q7MA 2W4XA 1P0KA 5CG0A 2E77A 3WK2A 3HTWA 1OYBA 3ARWA 1R9ZA 3PJTA 3SCPA 1EP3A 4K8EA 5AYYA 3WEOA 2QF8A 3II1A 3M0XA 4JZ5A 3O16A 1J0HA 2ASHA 2OLAA 4HPNA 4ML4A 4RUBA 4GFIA 4GBDA 4E6MA 4IMDA 4GH1A 1E0XA 3QV9A 2QJGA 2ZWZA 2QCGA 3GFYA 3N29A 1EJUC 1DQUA 1X1ZA 2GSJA 1QASA 2C18A 3TJLA 3BL3A 3WUGA 1BRLA 4MKVA 3JZEA 4U2YA 1S2CA 2XIOA 1D3GA 3P5YA 3GU9A 3VUSA 5F2IA 1XYFA 3D3AA 3DU0A 4HJWA 2QDDA 1QI2A 4D6GA 5ABFA 1ZB5A 4DY1A 1JDCA 3TQPA 3P3BA 5MKGB 3FK4A 3WJYA 4R85A 1BGAA 4IJRA 2E7FA 4CD7A 1IT7A 1VLIA 2JQXA 1FH9A 3QFWA 3C6CA 5CBBA 2C0AA 4O0QA 2VX7A 1YIXA 4F0KA 4OV4A 5G5IA 5AC4A 3R2GA 1QHPA 4PL1A 3NQDA 4REQA 4HK7A 3S83A 3OOQA 1FWGC 2O56A 4N9DA 4QITA 2REQB 2BXZA 4S2CA 3AYVA 3LB0A 3KCLA 1X39A 3DFPA 2BOEX 3M9YA 2A7RA 3W70A 3UF9A 2FB3A 4K36A 2F2HA 3USBA 2J7BA 3KBSA 1GKRA 3G1HA 1BTCA 4GPNA 3GG1A 1REQB 1H4PA 1B0IA 3IGHX 3BLIA 1HTIA 4A2SA 4LUSA 4AHOA 1A5BA 3S1GA 3A23A 2I14A 1VJZA 2GQAA 3G1YA 3H26A 2I5GA 3WDHA 5D2TA 4DRSA 1TV5A 4PCPA 1Y65A 3GVRA 4UTWC 3W1PA 5D32A 5I02A 4JFUA 1N7KA 1V02E 2Y4SA 3T2QA 1LLZA 3WD2A 3QR3A 1ZS2A 1RJRA 2PPGA 2GWNA 3NIYA 4P2VA 1XW8A 4NHVA 1OABA 2F61A 3E2VA 3L4XA 2DZUA 2GUUA 3H70A 1V3MA 4PODA 4DAFA 4G1KA 1VBUA 1GOIA 2MUCA 1EF3A 4U33A 3EB2A 4E3VA 3GX9A 2X42A 3QPYA 1JULA 3TTEA 3BK0A 2ZZ1A 2OQHA 3TNBA 2Q8LA 3SDOA 3KHJA 2PMQA 4BWLC 1TV3A 2WBGA 3TQVA 4A3HA 4G8TA 1X6LA 3MKVA 4HOZA 3VKKA 4JTIA 3GYCA 4HHMA 5DXYA 2I1OA 4NKCA 4EPDC 4CU6A 3S42A 3QJAA 1A5CA 3QOKA 3C86A 1JPDX 2BHUA 4DWDA 2Z1KA 1UR3M 5AYIA 3VD9A 1OY0A 1GOMA 4FHAA 4AY1A 5KTLA 1ZU8A 4Q4SA 4AC1X 3GVWA 4S3EA 1V6YA 2QKFA 3QRHA 4AMAA 2WMJA 1EEXA 3BOFA 3T0AA 1B90A 4UTIA 1MRAA 3BLLA 3SY5A 5DBUA 2VOTA 3N4EA 2D22A 1OC5A 4LUJA 4NG3A 1CGYA 4KCTA 2XISA 2A6NA 3EOUA 3HG3A 1TJ0A 3EX3A 4W86A 4MZ8A 1ZAJA 4X0VA 4G2DA 3GZAA 4WKAA 1BG4A 1UZHA 3LCGA 4YIWA 3PG8A 2P8BA 3QLDA 4ERAA 4LBSA 4AEOA 5DFAA 2WCGA 2BWGA 4QXIA 1PDYA 5AC5A 1UD3A 2DQXA 4DB7A 3UG8A 1V6XA 2EPOA 4NRSA 2QVNA 4GQ0A 3GR4A 2PTZA 3N2BA 3QW4B 4BEUA 1S5VA 4J40A 4TIMA 1TWWA 2W27A 1V08A 3CZKA 3W1NA 3KCJA 3N12A 3HBLA 1XYBA 1E9YB 2GVEA 1C8YA 3OP2A 2HE5A 4B5XA 2YCLB 3NEHA 4ZFMA 3NEVA 3W3OA 1PZ0A 2JF6A 3N3MA 2OB3A 4NP7A 4F48A 1DEDA 3LMZA 3TQ0A 3PTDA 4IFOA 3H53A 1YYAA 1A5OC 1ZBWA 1TVPA 1S1RA 2ZX6A 4S3DA 3WYZA 3NSXA 3TYEA 4AIBA 3LI0A 3M7WA 3CB8A 5GQBA 1EJXC 3D5HA 3EGJA 1A5MC 1K9TA 1H1ZA 2ZYFA 3GHRA 4UWMA 4IX0A 1U33A 4C7DA 3WDJA 3B0XA 2O9TA 1AODA 1HKVA 2PE4A 1G0CA 1VBRA 3FJ6A 1OBAA 3G0SA 3CZJA 1US3A 1CB2A 2F6XA 1OZQA 2OT1A 5EFFA 2NV9A 2E3ZA 3ERPA 3UJEA 3HGJA 3SN4A 2WMIB 1RQHA 2D2GA 4I3GA 3AYTA 4O10A 1ZUAX 1FFRA 1LT8A 3L66A 3GTHA 4OT7A 3BJFA 2B0MA 2PDKA 4DZHA 1UR0A 4C1NB 4LXFA 1QW8A 1OM0A 4R7JA 4JN7A 4AY7A 1FKWA 4RK8A 3DG6A 4EAMA 1S5NA 5FF0A 4Q32A 3B8IA 2Y88A 3QVQA 3CZLA 1ZBKA 3QY8A 1WB0A 1UWSA 3LLXA 3W7IA 4QSFA 5EL1A 3SSJA 4D6HA 4P7LA 4Z08A 5F4XA 2A3EA 1TE1A 2WVUA 4DBEA 4FIQA 4XK2A 1F07A 3IIVA 1Q6QA 5LXXA 4H7VA 1DE6A 3ARRA 3N13A 4UTLA 4A8RA 2F6KA 3BWWA 2NLYA 1AL8A 5EB8A 5LIKX 1J18A 1XD0A 3TUUA 2GPTA 3BURA 1OD8A 3SFWA 2WVSA 3POHA 2ZRYA 4JL2A 2I57A 2P8CA 1E4LA 3PB2A 1J2WA 2QPSA 3E0VA 5G2WA 5BW6A 1WQ5A 1EX5A 4ZQOA 1PWMA 4OE7A 4DJFC 1FH8A 2CC0A 3TP4A 2P5NA 2WB5A 3CUGA 2CZDA 1LRTA 3QGAC 3VPLA 4CD4A 4WY0B 2VTFA 3NQMA 4LTSA 2PS2A 5FKYA 3BVJA 3AYSA 3HPFA 4O4VA 3LPFA 3C2OA 4D2JA 5MF5A 4XWUA 2VD9A 3LCHA 3E2RA 4IICA 4CVUA 3A47A 2E6DA 2OWWA 1V0KA 1UR8A 2Z7KA 4IIFA 4UFIA 4LAOA 4ORIA 5IDZA 4JL1A 1E71M 5A1AA 3DAQA 1KFBA 4K8HA 3UWZA 1A53A 4GVHA 2WZEA 2O0TA 5KINA 4GX9A 4MWAE 1R3TA 2E0PA 2ESCA 2WHLA 2BGSA 3P60A 1WV2A 3OB8A 3BAJA 5A8GA 1RK5A 4DHGA 4IHCA 6A3HA 2Q8XA 3ARTA 2WSPA 4DM2A 1CB7B 2A5HA 2R1NA 3E38A 5A6BD 5K2ZA 2WW5A 5LIXX 1HJWA 2YXXA 2EPNA 3UXDA 1FWJC 3ZSSA 4IPNB 4XZWA 3ARXA 3SCNA 4ZE4A 1VFUA 5JIPA 3SN1A 4HNTA 1OX4A 1JR1A 2RDUA 4MZYA 1AZ2A 1R2TA 4JIQA 2O55A 4IQJA 4XB3A 3NQ2A 3HB9A 5HMSA 3AU2A 4V33A 3IAPA 3G18A 5HPCA 1W3NA 4O1EA 4QISA 2OGJA 2PURA 3RJXA 4KF1A 1Q3NA 4ALDA 3SBFA 1AJ0A 2FFCA 2GGJA 1GVQA 3ZLHA 1R8LA 4CQAA 1DQWA 3B9OA 3IIOA 2GWGA 3HZ3A 3ZJ7A 3NM3A 1JD9A 1ESWA 1BQCA 1H7XA 1R3RA 4HU8A 1R9XA 3DI1A 4UTTC 3LBCA 1KWKA 1NWSA 2X1IA 5AN7A 3WL0A 1A4LA 2XVPA 3BCDA 3PFMA 3MJMA 2WAGA 2PP3A 3TQKA 2RKXA 2H3DA 3NG3A 4FR1A 1X7FA 5FJPA 4A6GA 4JTQA 2TYSA 4K6AA 5BXPA 3VZYA 2XIJA 1VH7A 2VJXA 3TMQA 4AWTA 3S46A 1NTHA 3LCLA 3A3WA 2NV1A 5I07A 2WMKA 3R8RA 1G4EA 4AZIA 3QQ0A 4WKHA 3ZQ9A 1NFPA 4GNKB 1JFHA 2V63A 4AAJA 2CZ5A 4J28A 1YBQA 1TWZA 5CPQA 5FOOA 3STPA 4IG2A 3IARA 5T9BG 1TO3A 1IZJA 1J12A 1G01A 4UFHA 4Z2KA 4IUGA 3WLQA 1P4CA 3R13A 3ELFA 2YYTA 4NNBA 2D0FA 2ZZ2A 2R1KA 1OF8A 2YIHA 2GJXB 3TYDA 3W73A 4H9TA 1M41A 4M6UA 4LVBA 3WL1A 1I2OA 3SY8A 3TCEA 1NVMA 2O7QA 1G4PA 4RDYA 4QQUA 2ISVA 2XSBA 3N4FA 2BFGA 2HTMA 3ZWTA 1A5SA 2QHAA 1PHQA 3WLLA 4ZO6A 3OHMB 1X8CA 3L2MA 3T07A 4NILA 3QHOA 5GNYA 1ZQ5A 2V6AA 3TTOA 4JBRA 4TVCA 1CYGA 3I7SA 1UOKA 4NJGA 5LIYX 4IP7A 2F7FA 3FGCB 3WLOA 3B8TA 3VIFA 2XFYA 1GVYA 1KFEA 4PULA 1CGXA 4R34A 4GUIA 3AS0A 3KP0A 4ADUA 3B8WA 2VZSA 2Q09A 1W1PA 3MI3A 4FX6M 3GUGA 1DJXA 4KWVA 2YCEA 3WD3A 1ALDA 1H7NA 2PDWA 1EZWA 3CC1A 2V9DA 2RDXA 3TN3A 3RPTA 3UCDA 3PAJA 2R6OA 3QGKC 2VRJA 4WXZA 3GD6A 4PUJA 4O1FA 3DOPA 4ICMA 5FF7A 3MY9A 1K9EA 2C13A 2F84A 3HPXA 2W6RA 2ZC1A 4AEEA 1V4YA 1QNOA 2DT2A 4Z1YA 1GOXA 5E0CA 3LY0A 2XGBA 3D6NA 4URIA 1R9YA 5MHBA 1MQRA 4NZ1A 1XLCA 3BLPX 1XG4A 3W82A 3WNMA 3ITVA 4F0MA 3L65A 2WZHA 3NJ3A 1KBKA 1XPGA 3AIBA 5EU9A 4MG4A 1DWAM 5DEZA 3DESA 3WD0A 3ZZ1A 1SW0A 1GG0A 4C6JA 5GJPA 3QGVA 9XIMA 2EG7A 4AXNA 3SUUA 3W02A 5RUBA 3KVKA 4DEFA 2DUXA 1YTEA 3BLEA 3P0XA 1XGEA 5FD0A 5AHEA 3LYEA 2CXEA 2Y70A 2O9RA 3GNNA 4LJ3A 2ZX8A 3BOLA 3VNMA 3TTYA 4RZ4A 5M03A 4O57A 3H21A 3DC0A 3LENA 1C7SA 2H9AB 1EJ7L 3C3UA 1ONEA 4Q4RA 5HR6A 1B3VA 3E5BA 3RM9A 4O1CA 4M51A 4B3ZA 2BB0A 3GTXA 5G4HC 1C8QA 2PZ0A 1TTIA 2HS6A 1D8CA 1CZ1A 1Q85A 5HULA 1YPXA 4UB9A 5A6LA 1GG1A 4R27A 2GJPA 4MAZA 1F73A 1NY1A 3U7VA 5PTDA 1HL8A 4GOAA 2RGMA 1ITCA 3VINA 1ISYA 2OPJA 1OGGA 3KTCA 3MO4A 3E2SA 4NAEB 4JTDA 4RW3A 3WG6A 2FMNA 3NSNA 3BARA 1XH0A 3MYPA 2ZADA 4TMCA 1N8WA 2YOCA 2QAPA 2OX4A 3NNTA 1IXNA 5BRQA 2RJGA 4IJBA 3AROA 3EOOA 3OVQA 3CM4A 1UP0A 4WRHA 4LAKA 1G4SA 2YZ5A 4F8XA 5J04A 5DANA 3L23A 1D7FA