4CKQA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
390
structure length
390
Chain Sequence
HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 135
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4ckqA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ckqA02
5CQ1A 4KWUA 3VIJA 1HP5A 3CUFA 1BPLB 3K8LA 1WDRA 3WUGA 3G6MA 4D1IA 3VIMA 3F5KA 3TP4A 3WN6A 4Z2HA 1PPIA 3N1AA 1FOBA 5CGTA 1GQJA 3OGSA 2XM2A 3D3AA 2WCGA 4UTFA 1SMDA 3VIPA 2DH3A 4UZUA 4JFSA 1NARA 3DDGA 4AD3A 2Y5EA 3D4ZA 3VDCA 2YA1A 4M24A 4CVWA 3PZIA 1C7SA 1J0IA 5D4YA 1H41A 3BUIA 4MB5A 1JXJA 4PMQA 4TOQA 3AHXA 4NX0A 4WIWA 4DM1A 3WDQA 2J4GA 2WCAA 3B9DA 2WBKA 3RIKA 2WLYA 1UR2A 2YFOA 4AIOA 2X0HA 3A4WA 3B8SA 1WB0A 1HVXA 2XVGA 1UWTA 2A3EA 4XUYA 4TUFA 2WPGA 4P7QA 1IZKA 5D8WA 3H55A 1ZB5A 4BQ2A 3VD4A 2GDVA 2O9PA 3OLEA 3CHDA 4JFTA 3N15A 2DSWA 4MTVA 2ZX6A 2DEPA 1GNXA 3T0AA 4P8VA 1L8NA 2WHMA 4W5UA 3ARVA 4J3XA 2CEQA 1KQYA 2WMKA 3PBGA 3ARZA 1KCKA 4AISA 4UQEA 4U5KA 5CXPA 1MW2A 2DT3A 3GXPA 4W7VA 2W63A 2F7OA 3DC0A 1ZL1A 3AMDA 1V6UA 2DIJA 2CBIA 2DQXA 1X1NA 1V6VA 1MXGA 3RPMA 4W8LA 1I1WA 2ZXAA 3DX3A 3AZSA 1JAEA 5CPTA 3OBAA 3KZSA 1YHTA 3HG5A 3AYRA 1QI4A 3LRMA 1E0WA 1W3LA 2E9LA 2J74A 2PBOA 2YKKA 1R47A 5A8NA 3WELA 2X2YA 3S5YA 3N13A 4BCEA 2W67A 1VFUA 4CGTA 1GCYA 1ISWA 4B9ZA 4HMCA 1JDCA 3AISA 1E9LA 2OSYA 5JBDA 1W91A 1VF8A 2WC4A 4AWEA 4MAZA 2ALWA 1JZ6A 2QLYA 2VCAA 1BQCA 2VQUA 2TAAA 2UY4A 4HZ8A 1W32A 4PBGA 1VEMA 4WSJA 4UFMA 4E4PA 2PWDA 1E56A 3ZJKA 3AS3A 5E1QA 5CLTA 3VINA 1HVQA 1AQHA 1ISXA 3KLLA 1V6WA 3PN8A 3GH4A 3DECA 2JE8A 1D3CA 5JBFA 2D23A 1ZBKA 3LPPA 4JL1A 2XGIA 1CXKA 1KBKA 2YDRA 3VSUA 4PMVA 4LYRA 4C7GA 3L2LA 1UQZA 1V0KA 2EPNA 1R7AA 2E9MA 2ZXBA 5EBAA 1KXVA 3LPGA 1OCQA 4GI6A 3GM8A 4UCFA 1NP0A 3SCWA 3AXXA 1KXHA 1UH3A 4HOZA 1GJWA 2BVDA 4UFJA 1XC6A 1I75A 1QHPA 3VSVA 1GONA 2C0HA 2F1BA 1E70M 1E6PA 2VCBA 4KGLA 4U31A 3HN3A 3W24A 1AQMA 3BLBA 1DWAM 2BVYA 3W26A 4B16A 5ABFA 3OGVA 1XHGA 3VD5A 3ZMRA 3AIQA 1US2A 2O9RA 1CZ1A 2RGMA 1JL8A 1E6NA 3GNRA 4L4PA 4PTXA 3VIKA 5CPSA 3EYPA 4PTVA 1B3YA 4HA1A 1E4IA 2Y2WA 1U30A 2BY2A 1B30A 1E6SM 2BHUA 4PMZA 3RDKA 3N11A 2E9BA 4MADA 4CD5A 3GH5A 3MMUA 4HZ6A 3VM7A 1HKMA 5M5DA 3UG5A 3T2OA 1V3JA 3WDJA 1O7AA 1EHNA 2ZIDA 4AMXA 3WD3A 1H0GA 2DSZA 2WHLA 2X8RA 5DO8A 4D6FA 1KGXA 6CGTA 4CN4A 1BYCA 3CUIA 1TQSA 3W37A 1W9PA 3MANA 3TONA 3PZNA 3MKKA 1RP8A 5A6BD 3WEZA 3RILA 4BQ3A 1DWGM 3SURA 2WSPA 3VSTA 1EO5A 3WBAA 4TVUA 1LWJA 1QHOA 2WMIA 3WUBA 4ZENA 3UG3A 3T0DA 1SFSA 2A3BA 2ZX5A 1E5NA 5CSYA 2VL4A 3AYSA 4M82A 1VB9A 3CHCA 1DWHM 1M03A 2ZUTA 1UD3A 2WWCA 3NUKA 4EKJA 1AMYA 3CHEA 1BG9A 1E72M 1KWGA 1QI0A 4U3CA 1EOMA 3CUJA 3VIFA 1PBGA 5A1AA 4M29A 1DTUA 1GUVA 3SCNA 3DYOA 3AHYA 2W61A 3ARSA 3WF1A 4XZWA 2A3AA 2CBUA 4P7OA 2DPEA 2E4TA 4FNTA 1V3IA 4JCMA 1UQYA 1UH2A 2PC8A 2Y24A 1WKYA 2DT1A 1G01A 1KQZA 3UCQA 3CC1A 1ITCA 1TQTA 1E0VA 4JFUA 2EABA 2XFRA 3CO4A 5C70A 1VFFA 2G3MA 4GPNA 4B3LA 2XIBA 3CTTA 1WDQA 2UWFA 4FLQA 4AZIA 1QHZA 3T0BA 1E4NA 3I3DA 3E1F1 1OM0A 1VBUA 4HOWA 3RJXA 2VJXA 3BVUA 3O2LA 4UQ9A 1UD2A 3MO4A 1P6WA 4OIFA 1GHRA 1F4HA 3RJYA 4RL3A 2W4XA 1MWOA 3D50A 4C7FA 1EXPA 4QLLA 3NSMA 3CZSA 4IUGA 3L4VA 3BC9A 1PZ3A 1D7FA 3MI6A 3WY3A 4C7DA 3N04A 3VGFA 1QI2A 3K8KA 4URIA 2J7EA 3SUTA 3SUSA 3KL3A 1HJSA 1TA3B 1HL9A 1CGTA 2FGZA 3SCRA 4DWSC 1JNDA 3WY1A 4BA0A 4FNUA 3WIJA 3WUFA 1XH0A 1E43A 3I3BA 4PMYA 3ZR5A 4AMWA 4WKAA 2YA0A 3IJ7A 4P8XA 4UR9A 2DT0A 3NSXA 1QW8A 1B3VA 3WBEA 1HXJA 2UY3A 2F7PA 1UZ1A 3ZOAA 3ZT7A 4PCSA 2VVNA 1GORA 3A6OA 3ZJ8A 1MW3A 1LJYA 4UFLA 1GJUA 4MNMA 4ZFMA 5KEZA 3WUEA 4AZBA 2YLAA 3VILA 1WCGA 1W1VA 1A3HA 2Q8XA 3SCTA 3A3HA 2GJXB 4ATLA 2CIPA 1VAHA 1K9TA 1KB3A 1CNVA 1CXHA 1BSIA 2J47A 1D2KA 3CZ8A 4U2YA 1UUQA 3VO0A 4NZJA 4AY1A 3EJRA 1W3JA 4RE3A 1B31A 1CDGA 1KWKA 3PZ9A 3BUQA 4PMXA 2V3GA 1E6RA 2BY1A 3VIOA 2WVVA 3F5LA 1NWSA 1CBGA 2J62A 1UR4A 4U5IA 3D4YA 2ZOXA 1QNPA 3QHNA 1JD9A 2VTFA 2XPKA 2W92A 3WL1A 4RE2A 1E40A 2E0PA 2O9TA 4KH2A 3LRLA 4DUXA 3U7VA 3BUPA 5E9AA 3WQ8A 3DYMA 2YL5A 1G1YA 2F1AA 2WKGA 5A6JA 1BTCA 1UD5A 2XSAA 4XZBA 4J7RA 1QBBA 1JI2A 2YBUA 1M01A 1CECA 1C8YA 3GBDA 2XVLA 5LA2A 4GXPA 2BHYA 1LQ0A 2XVNA 2WYSA 4CD4A 1GOWA 2BVTA 3AIBA 2GUYA 1B0IA 3D51A 2G3JA 1JF6A 2WM0A 4ZXLA 5ECUA 1XCWA 3FHQA 5FOOA 4NXKA 1CWYA 2Y8VA 4HMEA 3DX0A 4NRSA 3UR7A 4AMCA 4MDOA 1XCXA 1LL4A 4W8BA 3CGTA 3CHFA 1WZKA 2CBJA 4W86A 1UR8A 3AZTA 3POHA 5A3HA 3VGDA 3ZT5A 3WDPP 2XGBA 3SUUA 4CCCA 1UD6A 2EACA 1W9BM 2XHYA 3L4TA 4QAWA 4ACYA 2JFEX 1ECEA 3EDKA 5I24A 5HXMA 2BV9A 2WBGA 1HXKA 5GNXA 1FH8A 4AZ5A 2XN1A 4J3VA 2VT0A 4W87A 4AIEA 3HU7A 1E0XA 1SZNA 1NWRA 4Q22A 3W4RA 4WF7A 1XH2A 1HKKA 4JFVA 3ZO9A 3NYDA 1UHVA 2G3NA 1KR0A 2W62A 5A2CA 4IPLA 1XSIA 1ODUA 2AAAA 4GI9A 4YN5A 2VX6A 1TG7A 3AI0A 3UETA 4S3KA 5BROA 3OLIA 3MMWA 4GZEA 1TZ7A 3A4XA 1E1FA 4UFKA 4CD7A 5A94A 5JIPA 5DF0A 1JYXA 3QOKA 4LQ1A 4FNRA 2DDXA 3WQWA 3K1DA 2A3HA 1LLOA 3DHPA 1B3ZA 4NZCA 1B1YA 1K9FA 3FY1A 4AZCA 2WMJA 2DSVA 5A6MA 3HJEA 1H2JA 1OD0A 4AZGA 1X6LA 1BHGA 4HMDA 1PZ2A 2CNCA 4ATDA 1E4LA 4F9JA 3DYPA 3U7BA 3UG4A 1K6AA 2JEPA 4CU6A 1GZJA 1R8LA 1EOKA 4QDMA 1UKSA 3AMLA 3CZKA 3SUWA 1SYTA 3GNPA 1E15A 5ABHA 3ZR6A 3CUHA 3QR3A 3OLGA 4PMDA 5FD0A 3T08A 3CBWA 1CXEA 4W7WA 1GW1A 1XSJA 4AEFA 4V27A 1QPKA 1HJWA 3LPFA 1JZ3A 1ZJAA 1R46A 1WDPA 4P7RA 4JFWA 2D2OA 3RMEA 5FL1A 4GQRA 3AXHA 1V0MA 5I5RA 1RH9A 3BGAA 1CGVA 1UG6A 5A6AA 1V02E 2AMGA 3RO8A 2E40A 3AZRA 2XSBA 3EMCA 8CGTA 4A3HA 3PTMA 2XM1A 3WD0A 2PWFA 4FNSA 2FHCA 1EIBA 1PS3A 3BXWA 3AROA 5E70A 1VEPA 3VIHA 2IGTA 1HF6A 1UKOA 3II1A 4KMQA 2OSWA 3WD4A 5A6SA 2VMFA 3VMOA 3VNZA 1RPKA 2VVSA 2J75A 4FF5A 3A47A 4U33A 4GZJA 3EBVA 1OIMA 3L4UA 4DO5A 4HP5A 1PIFA 1E6XM 1PIGA 4V28A 1CTNA 2DT2A 1HJVA 3WNNA 2DIEA 1XRVA 2EPMX 5A8MA 1DEDA 5CZKA 4P7NA 1OGBA 2OYLA 5IFTA 2VRJA 3ARQA 5A6KA 1MW1A 1R75A 3IAQA 4UFHA 3TA9A 1CLXA 3AJ7A 1UR9A 1CXLA 3VGGA 3AOFA 1BYAA 3FN9A 3SCQA 3HG4A 5I6SA 2GJPA 4OOUA 1OBAA 3IJ9A 3O6AA 4JKLA 3WDHA 4OZOA 1V6YA 4DO6A 2Y8KA 1CGWA 2CXGA 3WQ4A 1V3MA 6TAAA 3BAKA 1E1EA 2VZTA 4JCLA 2JIEA 3WFLA 1UA7A 5A8PA 2JF7A 2C8NA 3LX9A 2X0YA 3EJPA 4FMVA 5M17A 4F8XA 1QOXA 5A69A 3S2CA 3VIIA 2NT1A 1H1NA 3WNKA 4GKLA 3ZSTA 2XN0A 3AHZA 3PTQA 4IM4A 3WQVA 3AIEA 1PX3A 1J01A 5CPQA 2FH6A 1HX0A 7TAAA 1V03A 3WMCA 1MFUA 4P7LA 2J79A 1TR1A 2VX4A 2CCRA 1HTYA 4Z2IA 3WKZA 3FAXA 3NCOA 2QV4A 1PEZA 3HG3A 2X05A 2DGAA 3PZGA 2ZUWA 1ZBCA 4OOZA 5C8BB 4KRTA 4TXEA 5A2AA 1VEOA 3SCSA 1SR0A 3IAPA 5JUVA 4QFUA 2ZUUA 3WH8A 2WXDM 1W1TA 2EPLX 2XVKA 2X09A 3FHAA 1VBRA 2V3EA 4UQCA 5D9OA 1ISZA 3OGRA 5AY7A 4D6HA 3VDAA 4PSPA 3W27A 2YL6A 1GOIA 1F4AA 3GH7A 3BVTA 4RE4A 1J9YA 3OA5A 4AIUA 4M1RA 1E3XA 1BF2A 2YBTA 3H53A 3OLDA 1JZ8A 4W93A 3M6DA 3EMZA 3MMDA 4ML4A 3SEPA 1WAWA 5I78A 4YPJA 4TVDA 2VR4A 1R87A 3DHUA 1JAKA 1TVPA 4NZFA 2VOTA 1HWWA 5ABFB 3UR8A 2VZUA 3PZOA 4MNJA 1W1PA 4DWSA 3GXFA 2PI6A 4CU7A 1KTCA 1FP9A 2F8QA 3AS0A 4AYGA 2J7FA 1XV8A 5FL0A 2FHFA 1M53A 1JXKA 5CJ5A 1UH4A 3VVGA 3J7HA 3VD9A 1QWNA 1FA2A 2ZXDA 5A2BA 1UD4A 1VENA 3A5VA 4YHEA 2WZHA 4MAVA 4TTUA 3WL0A 5TD4A 1HJUA 4D6IA 3AIWA 2QPUA 2ZX7A 4PTWA 2IXUA 4H41A 1SMAA 3HZ3A 3WENA 4D6EA 1O6IA 4JZ5A 1G5AA 4QP0A 1GQKA 3NDZA 2WCSA 3CV5A 2WVSA 1E6QM 1Q6CA 2ESCA 4OBRA 2D24A 2J78A 1HJXA 3SCVA 3TV8A 1B90A 1ODZA 4Z2GA 2ZX8A 1GQIA 2O92A 4BZYA 3IJ8A 2VI0A 4BS0A 3VMPA 3FNDA 2EXOA 5IXEA 3W38A 2X2JA 5HDRA 3ZT6A 3CZEA 1JYVA 4PSRA 4ZXOA 3KL0A 3ARUA 1H0IA 3WH9A 3MUY1 1LL6A 5AC5A 1KXTA 4Q7NA 4AEEA 1EGZA 4S3JA 3WH6A 1PX4A 3WH5A 2WMIB 2FGLA 4GI8A 1Q6EA 5FIPA 2OWCA 2UY2A 4X9YA 2BS9A 3K4DA 1NOFA 2XWDA 3LXAA 2WMFA 3MU7A 1OT2A 5I79A 1IZJA 5JIWA 4TTGA 4N42A 3VGHA 3WNMA 2ZUSA 3WEOA 1BGGA 2F7RA 3VUPA 3LRKA 4TX6A 2ZWYA 4IISA 1JIBA 1BVZA 1JDDA 2VZSA 1ISYA 2WMGA 8A3HA 1BYDA 3FW6A 2WNWA 4PCTA 4HU0A 1VRXA 3SIMA 3WMSA 2YJQA 4OUEA 3WNPA 1BYBA 4LPCA 3GZAA 4QCFA 2EO7A 4WKHA 5ABGA 1OINA 2CERA 5E6YA 1Y7VA 4PYSA 1JF5A 3T2QA 2YIHA 2G41A 2J7BA 4LGXA 1C8QA 2FHBA 2X1IA 4H04A 3ZIZA 2GK1B 1GVYA 3CUGA 4AZ7A 1OIFA 4HA4A 1KTBA 1O7DC 3BAWA 1JG9A 2J8FA 5C71A 1FFQA 5DFAA 3IGUA 3WMBA 1XYZA 2VCCA 1OSEA 4CCDA 2PWEA 3ALFA 4DM2A 1QNSA 3MS8A 2BY3A 3SCOA 4CU8A 1J0HA 3AHTA 2PWHA 2VUYA 4ACZA 1QBAA 2WK2A 1DHKA 1G94A 4ZE4A 1B3XA 1EDTA 4H2CA 4A3YA 4W89A 3VGEA 4H7VA 1R34A 1J12A 3A4AA 4Y7EA 4F9DA 3MSGA 3AMCA 1CXIA 2DSKA 5AC4A 4D6CA 3M7SA 3W53A 1LF1A 4WLCA 4W84A 4EK7A 3MV11 3EMQA 2JIWA 2CETA 4AZHA 1E6ZA 4JL2A 1MFVA 1W3HA 1HT6A 1EA9C 3U57A 3KWXA 3AMGA 1JZ7A 5IFPA 4AC1X 5DMYA 2VRQA 3WF4A 2WANA 2Y4SA 1CPUA 2VRKA 3HMCA 5IDIA 4AXNA 3KL5A 3BCFA 4FLOA 2XFYA 2V3FA 1HJQA 3AFBA 2A3CA 3GYCA 1E71M 1R86A 1Q6GA 4IPNB 1Q6FA 2FYVA 1KBBA 1C7TA 1W2VA 2VC9A 3DDFA 2XJ7A 1QI3A 1ZJBA 1FHDA 2YDSA 2G4FA 4LXFA 4HA3A 1TCMA 3WEMA 2FE0A 1ITXA 3N9KA 1XSKA 1NOUA 3SUVA 3W82A 1QWUA 5A8QA 4GINA 3VPLA 1WZLA 5BXPA 4OGZA 2WZEA 4L4OA 5LA0A 3DX1A 2IUZA 1UASA 1W3KA 1V3LA 2YFNA 3EDJA 4B9YA 4A4AA 2VX7A 4MPKA 1L0PA 1ESWA 3DX2A 4UQBA 5E0FA 4W88A 5D8ZA 2V3DA 1TQVA 2JF6A 1KFWA 3PHAA 1OD8A 1XGZA 4OBSA 2JALA 3AMKA 4NI3A 2WVVB 1H11A 5I2UA 1MQRA 5LA1A 3BAYA 4DO4A 1AVAA 5ABEA 3VIGA 1NH6A 3POCA 4MNLA 2GSJA 1VFMA 2J7DA 1H5VA 1EDQA 2EPOA 5CLWA 1C91A 4R5EA 2WW5A 5CSUA 1UWIA 2CKRA 4PEEA 4GO9A 3BVWA 2V38A 2J25A 1MQQA 3QHMA 1JZ4A 1WPCA 1UOKA 2OW6A 3QHOA 4NF7A 1V3HA 3ARPA 3IANA 1UZ4A 2G8ZA 1HP4A 3GTNA 2OSXA 5GNYA 3N18A 2O9OA 1OT1A 5AYBA 3VX1A 2J7HA 3PZUA 5I77A 2EBNA 3WQ5A 1JGIA 4AYSA 1J0JA 2F7QA 1ZBWA 1S46A 4MDPA 2V5DA 1E5JA 3I3EA 4Z2JA 1C3FA 3CZJA 1PJ9A 1FH7A 1J10A 1J11A 2D3NA 4V2XA 4AD5A 3VOCA 1MYRA 4M81A 2V5CA 2VNCA 3THDA 4D6DA 3BMWA 2WSKA 3U5YA 3EDEA 1DWFM 2QMJA 3BH4A 1OWQA 3MUZ1 1JZ5A 3N12A 1UA3A 4WKFA 2OYMA 4M8UA 1MW0A 3B9AA 2F2HA 3A22A 1CGXA 4BF7A 4MB3A 1TQWA 4JKMA 1W9UA 3ALGA 3CZLA 3UERA 2X2HA 3GXMA 3O9NA 4WK9A 2WAGA 4DUVA 3F5JA 3VKKA 1EHAA 3CPUA 1Z32X 2MANA 2CITA 4GZIA 2BHZA 3PZVA 2ZWZA 1WE5A 4UNIA 2ZXQA 2CYGA 5HOSA 1BVNP 3CLWA 1QNRA 4GO8A 1AQ0A 2QHAA 2VQTA 5BRQA 1LL7A 4Z2LA 2VZOA 4E2OA 4UOZA 1HKJA 3M46A 1LWHA 2J77A 1EQPA 3CH9A 2XFFA 3CMJA 2DSUA 9CGTA 1V08A 4PMRA 4CD6A 3GXTA 1JI1A 3AIRA 1UKQA 4DUWA 2QPSA 3BVXA 1JDAA 2E8YA 1C93A 4FLRA 1JYWA 2QF8A 1GQLA 4FLSA 3WF3A 3WDIA 3W6LA 4AW7A 1BG4A 2ZUMA 2GFTA 1H49A 4AZCB 2WZIA 3WQ6A 2WC3A 3GNOA 1V0LA 1M7XA 2XVPA 5I3DA 4PTMA 4HPHA 4ATWA 2E3ZA 3BMVA 4ZE5A 1X6NA 4NSBA 3W6MA 1EQCA 1UD8A 1UWRA 1GPFA 1OGGA 5FCZA 5AYIA 5BRPA 3BAIA 3L4YA 4JHOA 4AZ6A 1WZMA 3SCPA 3AHVA 3OIHA 2XUCA 4HOXA 2WB5A 3K4AA 2ZICA 3QGVA 1XD1A 3GXDA 1XYFA 4W5ZA 4LX4A 4CCEA 3OZOA 1HN1A 5GPRA 4X0NA 5HBFA 1TFVA 2EPKX 2ZUVA 2EQDA 3LXBA 5DT5A 2G3IA 4UOQA 5BXSA 4KGJA 2OYKA 4JAWA 5E0CA 1B3WA 3OB8A 2D22A 1UR1A 4GIAA 5KZ6A 3WY4A 1YQ2A 4XX6A 4QLKA 3MUIA 3AS1A 3D5HA 4PMOA 4AD0A 4FNQA 1Q4NX 2C7FA 3MSDA 1PX8A 1W2PA 2VX5A 3EJTA 1QNQA 3BLKA 3AIVA 3W25A 1WZAA 4EANA 1FHLA 5E09A 2PBGA 4D72A 3WNOA 1GOQA 1E3ZA 4MJ2A 1EDGA 3WY2A 5IHSA 7A3HA 4B15A 5HNNA 3VM5A 4QLJA 3VDHA 1QX1A 2X2IA 1TE1A 4QCEA 1VFOA 1R33A 3KEHA 4JKKA 5GQBA 3UESA 3K46A 1KR1A 3VMNA 1KXQA 1JFHA 3BSHA 2YL8A 1V6XA 4W85A 1UWQA 3BUDA 1I1XA 3BSGA 2J7GA 1W9XA 1KGUA 1NM9A 5BCAA 2D73A 2VURA 3U5UA 1B2YA 4PN2A 5F7UA 2E8ZA 3KE0A 1Q6DA 3VNYA 2OW7A 1TMQA 4Z2KA 4CKQA 1IT0A 3VX0A 1LG2A 2YLLA 5BYWA 1U2YA 3M07A 2CHOA 4E8DA 1NWTA 2XIIA 2FH8A 3TTSA 2BXZA 2YOCA 3QOMA 1UKPA 1V3KA 3CZGA 1G0CA 3ZJ6A 1WO2A 4TX8A 1C92A 2ZUNA 4HU8A 2YA2A 4PMNA 1E4MM 3RM4A 1HL8A 1GOOA 3OG2A 1XD0A 4NXSA 1JD7A 1R7OA 2WWDA 4DWSD 5I0DA 4B3KA 4P8WA 3A23A 2EJ1A 1CIUA 2WVTA 2JEQA 4MB1A 1JNEA 4XV0A 2J8GA 1NOWA 1US3A 3GXIA 4H8VA 4D71A 5EMYA 1CYGA 1UR0A 4U3AA 3CZNA 4PRWA 2QMKA 1E73M 3BAXA 5LYRA 2ZX9A 2GVYA 1CENA 4KRUA 1BLIA 1U33A 1H4PA 4OKDA 2CBVA 3ECQA 3W29A 4CVUA 2OWXA 2CKSA 1WP6A 1WDSA 5BXRA 1M04A 1KGWA 2BY0A 4ZEPA 5A95A 6A3HA 4P8UA 4EAMA 1VIWA 2XWEA 1JFXA 1ZS2A 5A6BA 1GOKA 2EEXA 2FDMA 4NRRA 1IV8A 4GQQA 5D9PA 3T09A 3NDYA 5I23A 3VDBA 1CGYA 1WNOA 3OZPA 3NIYA 4R27A 1CEOA 1TA3A 3BUBA 1DWJM 3UEQA 5BWFA 4MNKA 5CG0A 4JIEA 1TVNA 4K68A 5D9NA 3TTYA 4UZSA 3ARRA 2WLZA 4AD1A 3PTKA 2PF0A 2PWGA 1HIZA 1RP9A 3CIVA 4F66A 1XH1A 3WF2A 3N17A 1NWUA 3TOPA 4LYPA 2EAEA 3BCDA 1ISVA 4TVCA 2GK1A 4DWSB 4X0VA 2ZE0A 2F61A 2WHJA 1DP0A 4PUEA 2Z1KA 2HVMA 3B9EA 1H3GA 3S5ZA 5CGMA 2D0GA 4UQAA 4D6GA 3WD1A 1MXDA 2GJXA 1T0OA 1J0KA 2Z1SA 3VU2A 2PB1A 5A8OA 2IXVA 1VJZA 1W1YA 3BAJA 1J18A 1K9DA 1EO7A 5A6LA 1QI5A 1BFNA 3ARXA 3EJUA 3A21A 2NSXA 2NW0A 2W91A 3APGA 2BFGA 3D52A 2XTKA 2GDUA 4FK9A 3EJSA 3GDBA 1DWIM 1GVIA 1RD6A 2D1ZA 3BVVA 1C90A 2GJRA 3FAWA 5JBEA 4YHGA 3GBEA 1OB0A 3SCUA 4HZ7A 4BQ4A 2DH2A 3L2MA 4UOJA 4U2ZA 3TTOA 4F79A 3AICA 3VGBA 1ZBVA 4UFIA 1BGAA 1BAGA 4J28A 2J7CA 1MVYA 4H8UA 3MUAA 4H8HA 4LYQA 2YL9A 1R85A 1CLVA 5EB8A 1MQPA 1V02A 2VO5A 4AD4A 3NJ3A 1UKTA 3W81A 4UQDA 3F4VA 3VD7A 2W5FA 1UYQA 1E55A 3WDRA 3L4ZA 2WMHA 3PZMA 4J27A 3THCA 4CD8A 3WSUA 2F18A 3LPOA 2D3LA 5EFDA 4M56A 2OLHA 5DT7A 3NSNA 5DEZA 3K8MA 2WHKA 3AXIA 1G9HA 2VR5A 1EH9A 1NQ6A 2W66A 3JUGA 5HPOA 1GOMA 4N0RA 1VJSA 5M3WA 3ARWA 2VZVA 3EDDA 4CN1A 1C8XA 4EE9A 1W9DM 3S6TA 2EADA 5D9MA 3RCNA 5GNZA 2BXYA 4M80A 4J3UA 1UWSA 3BLPX 3LMYA 2B31A 1LG1A 3EDFA 1OGSA 3RM8A 1HNYA 1QNOA 3WH7A 4CN6A 2D0HA 3HG2A 2XG9A 2NT0A 4HTYA 3WF0A 1TUXA 5FKYA 1KCLA 3IK2A 2YDQA 1J0ZA 3EJQA 3ZJ7A 1B9ZA 3AIUA 1K9EA 2D0FA 2CPUA 4PUDA 3TTQA 1FP8A 3GXNA 2BNJA 3RM9A 1QVBA 1GHSA 1V0NA 3W0KA 1NP2A 3AS2A 2OWWA 1TQUA 1N82A 4D6JA 4BQ5A 4MJ4A 2WKLA 5IHRA 2HISA 4ACZB 5HPCA 3A24A 1FFRA 4CUCA 4WJXA 2XN2A 4FNPA 1J0YA 3PZQA 3H54A 3CMGA 1H09A 3WD2A 1CXFA 1JZ2A 1FH9A 3L4WA 4W8AA 3MV01 3ZM8A 1QW9A 4J3WA 2RGLA 4OJYA 3DX4A 2WC7A 2XYLA 3LXCA 3WFZA 5M03A 3FXYA 1HKIA 2D20A 4PMUA 3AQUA 4MB4A 3VD3A 5EFFA 3VTRA 4AD2A 4W7UA 2CESA 4JHZA 5E6ZA 3KLKA 4HPGA 1ZU8A 3T2PA 4J3SA 4J3TA 2AOSA 1JYNA 1PAMA 4D1JA 1UWUA 5BXTA 3G6LA 3W28A 1CGUA 3L4XA 2WVUA 3PZTA 1W9VA 4XB3A 3ZQ9A 7CGTA 3ARTA 3ARYA 4WSKA 3WNLA 3ZSSA 2CHNA 2UY5A 4E8CA 1A47A
chains in the Genus database with same CATH superfamily
1CURA 4FL4B 1FNGA 3GUFA 5D38A 5LNWA 4GAAA 3VIJA 1L6FA 4Q6JA 5CIPH 1UA6L 2AKZA 1OCCB 4I90A 1OFAA 1RAKA 2BLEA 4YVVA 5AUMA 1T04B 3AQYA 3FULA 1U8JB 2QSVA 1Q9OB 1DQQA 4AD3A 4A7GF 3QDJB 3D4ZA 1ULVA 2VCOA 4ACTA 4MMYA 1YDPB 1W1B1 4G7SB 3L65A 1H41A 1JXJA 3U46A 3G6AB 4NX0A 2B16A 3PAOA 4ODWB 1MKFA 1FHVA 3ECUA 2WLYA 3ARDA 4AIOA 1RMFL 2FGWH 4NZ5A 4DXXA 2H0FA 4TUFA 2WPGA 4P7QA 3VD4A 1IGSA 3W3BA 4BEUA 2WHMA 4YIQB 5IOBA 1FN4B 3QAZB 4LKCA 3CJPA 3F58H 2CBQA 1VPQA 4PJ5A 4F7MA 2WPBA 4NENA 5A2KH 4XP5L 3HRZC 1V6UA 4FZ8L 4K8RC 3VWKB 1K4HA 1BBDH 4O4VA 1MRDL 5HYQB 3AACA 2ZZ1A 2YRLA 1PWLA 4CQBA 2PFHA 1EDHA 5CUSL 3HG5A 3UJTH 5HVGB 5SWSD 3WJXA 1W3LA 4LEOB 2QCNA 2INFA 3HE6D 5K9OB 2EDBA 3WELA 3DKLA 4NC1E 1GCYA 4HIXH 1SBSH 4ZTOH 4FQCL 1R38A 3UTZB 1SJCA 3K13A 2O7QA 1KTDB 5GGVH 2CFFA 2UY4A 4HZ8A 5E9DB 5EEZA 1B6DA 5KTEL 3W9ZA 1T66D 1TELA 2BJML 3BXNA 1JZEA 4Y9GA 2RALA 3AJXA 1PHWA 5JR1H 1MHHA 3DECA 4HLZH 3NA4A 3O15A 2WZAA 3S36X 1KBKA 2B81A 3URQA 4JTIA 4WDUA 1K8ZA 1R7AA 2XINA 2YD9A 1OCQA 4GI6A 2G60L 1UH3A 1GJWA 3S2NA 5IHUL 1T0MB 4JIRA 4H26A 2KZKA 2OR2A 3W85A 5FW6A 1S9VA 3HJZA 3D7PA 5BZDB 2O9RA 3W7IA 4PTVA 2NZIA 4HUKB 5TE6H 2BY2A 4O15A 1BMGA 4MADA 4CD5A 3CFBA 4PIRF 2NUPA 1A6VH 3AAZA 1JNHA 1EHNA 4PUNA 1SUHA 1AKPA 3IRSA 5GRUL 2E1DA 4KDVA 4M7LT 5HMEA 3SQRA 3RILA 3AU0A 3ULUL 3AADB 4IGMA 1EEPA 1UR3M 3B5GA 1QHOA 4OVXA 5EOTB 2J5LB 5F9JA 4V1XA 1CD8A 1JK9A 2A3BA 4PBDA 5ICYB 5DQ9A 2UBPC 5DRZB 1LEKB 4OB5L 3S98A 1R2SA 2LV4A 1TETL 4AM0B 4E5XB 3FXGA 3M43A 4MNGE 1V3IA 1PKOA 2YPLA 4XI5C 4EDWL 3C12A 3V6FB 2NYKA 3IGAA 2XPGA 5C9UA 1TZIA 3L08A 1F6PA 1S7WA 2VAAB 3CTTA 5G2HA 3QFWA 3GNXA 2B1AH 3PPFA 5EF1A 2EDLA 3MT1A 1KIRB 2OSLB 1D9KD 1EXPA 4GH7B 5AVTB 2PR4L 4JM2C 3KCWA 3BLLA 1ZENA 4OFKA 3K8KA 1S7TA 4JRLA 2QVNA 3NTYA 3N44B 2Y9RT 3E3QE 5IEHB 4Q8UA 5KYWA 2ITDB 2DV6A 3ORJA 4M6VA 4JM4H 1K8YA 4LP8A 5GGUB 1NGXA 2W0KA 4CBPA 4AUJA 1VAHA 3BZJA 5HYEA 3CZ8A 4U3XA 1M2VB 3H7BA 5I1EL 1FDLL 4RE3A 1R3QA 3QDGE 3G1XA 3F1QA 1OK6A 2ZP9A 3PJNA 3OVGA 4QSFA 1QK0A 4N5EC 1N19A 5I1CH 3IJHA 3GLAA 1P6BA 3ML8A 3LV5A 2ZOXA 2PXYA 3TZVB 2EF9A 1GW9A 3IJQA 3SHSA 2XA3A 3KOZA 3ZTJH 1GPWA 1H7RA 5HJLA 1BLNA 5E9AA 3LOTA 4H44C 3PBUA 1XIWC 3RG1C 1TQXA 1WG3A 1W0WB 5IKCB 4A2MA 4OZ4A 4J7RA 2YBUA 2ZXGA 2G0KA 1K2DA 4UDUA 4D8ZA 2VLLA 4J4PC 1QUPA 1PFCA 5KYYB 4P4KB 2H47C 5A2IH 2G30A 2K9UA 3EGSA 4FP8H 4IXHA 1XCWA 3ARFA 1QO2A 4FKEA 4QXVA 1OC7A 1XCXA 3CGTA 3O6CA 4JR9L 5EPDA 5BJTB 1RI8A 2XGBA 2B77A 2KQNA 3RPIB 1Q2SA 4XVDA 1OP4A 2DIKA 1YNTB 1ZANL 4ZRGA 1JNNH 1HNFA 4IIQA 4HV8A 3D12B 2KMWA 2OJPA 3W1AA 1GR7A 3REQB 4H25A 1UHVA 4Z3JA 4GI9A 4J6IA 3CSBA 3LQAC 5DMKB 2C1OA 4LEEA 3DHPA 4PG9B 2NUTA 1X5HA 4HS8H 1PZ1A 4CNOA 4DGUA 5EG6C 4HPJA 5BW7A 3G7TA 1H2JA 1U8LA 4V1DE 3AU1A 4ATDA 1GC1L 3VNMA 2X3AA 3T0EE 3V75A 3CZKA 4NIRA 3LIZA 3U7YL 3ULUE 1HS6A 3QR3A 4FB7A 1H62A 1TYJA 3UIZA 2F19L 3T08A 3QO1B 1KEGL 4LLYB 3VXTB 4Y90A 4KDWA 5J57B 1XUUA 3DURB 1OF6A 6REQB 2OJZH 2HPMA 4N20A 5CGYC 3E6FA 4TQEL 1Z48A 1X5IA 1R3LB 2R2BA 5I1JH 3LUTA 3E2HC 1ADOA 4JEQA 2HKFH 1PS3A 3BXWA 3AROA 4MAYB 2BW5A 1AD9B 4ZUTB 1YXDA 5DD6B 3GMNA 4JS3A 3W7EA 2GZXA 3VMOA 3PQYE 4N0FA 1JWMB 3TH6A 4DO5A 2RD0A 4YGAB 2Z4QB 5E5CA 4C6NA 1F05A 4HLEA 4P7NA 4YMZA 4S2CA 4QTIL 1TJRA 1IT9L 4GKOA 4C58B 2GIXA 4BK5A 3HBPA 1KB9K 5C0GA 2GYIA 1LRNA 4AVOA 4JYEA 4PJFE 3V6OE 4U05A 5F9OL 3CSYA 4KROC 2ROYA 3KLSA 4JCLA 1OF2A 4NM8H 3MLZH 3NAAL 1XF5B 1IGYA 4OCRH 1H5BC 3CK5A 4F8XA 1QOXA 5D1QC 3VIIA 1A7PH 5CFAA 3GB7A 1UWEH 2WWNA 2ENQA 1NFIA 5F7FA 3QFJB 3PTQA 4JFFB 4NFDA 1AP2A 1HX0A 1XGRB 2UZXA 3QDGA 5DXWA 3VQ2C 4N85A 4KC3B 3C0SA 5C8BB 4HSHA 3IRPX 4BXSV 4BM7A 3B43A 4IRSB 3WH8A 4PJ7B 1LQ2A 1DBKH 1GSKA 4GNKB 4X6EB 5BRZD 1YEFL 4BWWA 5IOKA 4NQ1A 1ZHLB 5CP7A 4DX3A 4HSOA 4O1DA 3NPSC 3S96B 2A7RA 4RUBA 2MCAA 1PF3A 1H3WM 1D7CA 2VOTA 3H9HB 1MH5B 3K7UA 4PUMA 2F8QA 5MEQB 5L2JA 3FN0H 2R0LH 4QQ3A 2BERA 1BWWA 1DUZB 4UAHA 1MFDH 1WIPA 4TTUA 5JQ6H 3TBYB 5GJSH 3HAEG 4ZMYA 2HRPH 3SJVD 3R12A 3BZFB 4BY3A 4QJ5B 4JZ5A 1U36A 3W1PA 1TQCC 1SJEA 1DEEA 2TMDA 4JG1H 1QNZL 3HKFA 1ZLWK 3VMPA 1DANU 3FSAA 4L4LA 4UT7L 3B9KC 2P0OA 4ZXOA 4IEFB 4S3JA 1PX4A 3GMOA 4MD4B 4DZBB 2GSGB 2OA9A 5KN5B 1NANI 4AH2A 4NRXA 5AAMC 3GU1A 2J1YA 2X1UA 3EGXA 1WFIA 4NHCH 3OKKA 2XA8H 1NBYB 2QCDA 3A4DA 4LSQH 3CXDL 4UQ2B 2A6DA 4NWTH 2GKIA 4HU0A 4V1DA 2I7OA 2I57A 1LMIA 1ZVHA 3T0EA 4CC4A 2YXOA 4NKOA 1ZRUA 2VDQH 1MRQA 2FHBA 3T1GA 4RCAA 5BU6A 1GKQA 2VEFA 4MBRA 4AQZA 1D8WA 1RHHA 4ONFL 1NWPA 1QQDB 3IGUA 3WMBA 1SGKA 1AO7B 1DPMA 4RSYA 4J2MA 3BMXA 3QEQB 2IH3A 3MYPA 2GC7C 1NUNB 3Q9PA 1XH3A 1J0HA 4XMWA 5F2IA 1I6NA 3TESA 3APCA 4RMRA 3ZKQD 2UXFA 3GSVB 3SGDH 3KW7A 3H3PH 4A6YH 2ZSVB 2QSCL 4QLWA 4B50A 1TCDA 1IGJB 3C5ZA 1OAXL 1TTGA 3MA7A 4QI3A 4AZHA 3P4OB 4FFZL 5CKAA 5JPMC 1ED3A 3PQYA 3WTYA 2Y4SA 3OJDA 4HAKA 2V2WB 2A3CA 4P5TC 3M47A 3ZYIA 5E4EB 1ONXA 1KBBA 1ZPUA 3HBLA 5ANMA 3SUVA 3L3DB 4MAUH 1NGPL 2X40A 2YFNA 1AAJA 4A4AA 4BZ2A 2R23B 2WAHA 2E6AA 3V6OA 1M6JA 1OD8A 3WXWH 3CBJB 3KJ4B 4GXVH 4GRMB 3GU9A 1T04A 1U8JA 4N2HA 4EZMA 4DO4A 4K7FB 1NH6A 4XPHL 2Q8BH 3QDJA 4Z3EA 5G55A 3U30C 4GG6B 4Y19B 3OTRA 2CKRA 3QC0A 3ILEA 1YA5A 3N0PB 5H4YA 1MIEL 4ANUA 2NQZA 3G6AA 4ODWA 4XXWA 2IKJA 3WYZA 4M5SA 4KZEH 1W0YT 1WTLA 1ZBWA 1Y0LB 2XXFA 5D05A 4A2LA 4AY0A 1J11A 3WGVB 2D3NA 3U8GA 2X10A 4QRRB 2X4UB 2R1YB 2V5CA 1FN4A 1RHCA 2PRHA 3KDPB 3MV9B 5KMYA 2ZKWA 5DR5L 1OWQA 6PCYA 1EHXA 2C9AA 2GBTA 2KLRA 3RZWA 1DKWA 1XW8A 3OAYH 2WBJB 3VWKA 3MJYA 1F4WH 5IESL 1UFUA 5HYQA 3CPUA 4HG4K 2SFPA 3P8IA 5JPNC 3GHEL 2Y69B 4LEOA 3IFNH 5FF3A 4DGYL 3ABSA 1ZDQA 5K9OA 5B1KA 3CWGA 1EZVY 4JHUA 4Y96A 4CD6A 4CNUA 3OAZK 4Y9PA 5EO1B 1U42A 3UTZA 1KTDA 2N01B 3M0LA 1FY6A 5E9DA 3CK0L 4OJAA 1NDYA 1EERB 4GYPC 2LVEA 2AJSH 5JHLH 4NSBA 4KBPA 2RAMA 5XIMA 4TNEA 4HVBA 1E6JH 4L2YA 4D9LL 4H83A 3MBWB 1WBYB 3U4KA 3R79A 2HUEA 2DIAA 4R90H 3P82A 1OM3L 2EIDA 1T5WB 3CQKA 4LMQI 2IH9A 3ETSA 2QUUA 2QV5A 3A12A 1JRHL 5GPRA 2EG7A 3QE5A 4LCUB 1T0MA 3EH2A 2BSSB 2OYKA 4MJ6A 1KYOK 3MMTA 3II2A 1JZJA 5BZDA 3WY4A 4GC3A 2I16A 1HEJC 4AK2A 3KBEA 4G7VH 1P4LB 1PX8A 3NZUA 5E93A 4F58L 3SGJA 3M0IA 4M51A 3NVQA 2XICA 1DQDH 5DTFB 5FYKE 3X12B 1QFOA 1BG1A 4LVBA 4OGXL 1GGUA 1KFLA 1BX2B 5MENE 2O0TA 5H37H 2Y63A 2D7TL 2ZVIA 3JUYA 3GLEA 4FCHA 5EOTA 4Q9BA 1Q6DA 3VXPB 3NJKA 5ICYA 3HNSL 1UC5A 1S3HA 2FH8A 2X6UA 1G7IB 5DRZA 1LEKA 3FU6A 2YOCA 1QMLA 5D1ZD 1C92A 1LILA 4AM0A 4E5XA 4WCJA 3D5OF 2YA2A 1XD0A 2OFJA 1A4JB 1A7NH 1HO1A 2WWDA 4HHHA 3V6FA 3PS7A 3WLQA 3WN5C 1KM4A 1EPVA 3DFOA 1PKMA 4XNYL 2VAAA 4UCGA 4GAJH 3G8EA 2G3ZA 2J20A 3MNDA 5ITFB 1Q0XH 4IPIA 3C61A 2ZX9A 4EXBA 2KAUC 4DGIH 3QIBB 4R7JA 2BP8B 3H9YA 3UWWA 4MCMA 4WDWA 1KIRA 2OSLA 3RO6A 2DJ4A 3GSWB 1ADDA 4LU5H 5I23A 3UABA 4US5A 3NM1A 2WSDA 2Y61A 3E8UL 1I2OA 3U1PA 1TVNA 4PJGE 5IEHA 4RNRB 4YTQA 5FUZH 2ITDA 2WLZA 2NVDA 4YSQA 1HIZA 4BZ1H 1KCXA 4FD0A 2VFDA 1MFAH 3S2LA 5ALBL 2EAEA 5DJDB 5GZNA 3DIFA 2MTAA 1J1OL 4NBZB 1NCNA 3Q2VA 1H3GA 5GGUA 2OMUB 5CJXA 1X7SA 5DFVD 4ONGL 3WD1A 1EUUA 1ONEA 4EPEC 3K80A 1TV5A 3DG7A 5FPIA 4MFEA 4AX6A 1M2VA 4YDLC 4JFFE 3RGVB 3PSVA 4GWEA 1IBFA 5FHBL 2C3ZA 4JPVL 1T6VN 4KKQA 1GVIA 4PWIA 1OCRB 3WHE1 1EEYA 3KXQA 4XBEH 5LIKX 4I18B 4KQ3H 3MRNB 2JXMB 1GT8A 4XSLA 1KLZA 1KFGA 1GYNA 3G3DA 1W0WA 5IKCA 2VO5A 3MOBL 1KBVA 3O6KH 4M00A 1RIVL 1UYQA 5K9KB 5EMJA 4JDEB 2CGZA 3M86A 3THCA 5KYYA 4P4KA 4GX9A 1A7RL 5I74C 4N4QA 5FV2A 1CLCA 3HB3D 1HKFA 3FTVA 2MRYA 2OMYB 1P1MA 4PCPA 3RCNA 1SQMA 2YQBA 4PJAB 3PPGA 5E8EB 4M93B 3IDIB 4X7DC 4GUCA 3GVGA 2NY3D 1YNTA 2XV2A 4JKPL 3ZJ7A 2DQDH 2FLIA 3FOLB 3MZGB 4FGMA 4J4KA 5LXEA 2FPYA 3BHBB 1PNCA 3PANA 4LCVA 3RRAA 3REQA 4JQIA 4JQXC 1KG0A 3SPIA 4EI5B 3HVNA 5A3IC 4B9CA 5J8OA 2Z0IA 1KV3A 4P9HH 5DMKA 3LXCA 4KKBC 4PG9A 3T2NH 4C56E 2ADIB 1A4KB 4OLWL 2GJ6B 5LHFA 3GD6A 3FQYA 2WAQA 1CL7I 2VUNA 5JUEL 4F15C 3UBPC 2HEJA 4NRZB 3CU7A 1N8OE 2VE6B 3SGEI 3QO1A 2UXVA 2EDJA 3GKFA 2PNDA 3QEGL 4LLYA 3VFWB 3DURA 2HCVA 4D1IA 3C60B 3EOTH 1FOBA 4GUQA 3ISYA 4YSAA 5FAAA 1I7RB 3HMXL 1MZHA 2NLIA 3OGOE 1R3LA 3KYOB 4G8GE 5HHMB 3QH2A 3BUIA 4C57C 5FO2A 4I9TA 2IOIA 4HJJH 1BGXL 4MAYA 4ZUTA 2VC5A 5DD6A 5B39G 3NABL 1CLYL 2R94A 1HVXA 3NT0A 1BQ5A 3GINA 1JWMA 5D8WA 2IFFL 5AOZA 4HUVB 4O11A 2IMRA 3QCTH 1U5JA 2Z4QA 4MGGA 4YE4L 1U3HC 2Z8WC 1WJ3A 3C8KB 4WO0A 5ITBH 3SY8A 1KCRH 4LSRH 4J3OG 3GMQB 4UUJB 1VCFA 1WBZB 4PA8A 2NNCA 4JKNA 3DGCR 1UA6H 4APQC 3AYRA 3T65B 4MUZA 3PXJA 3L9RB 1IKFL 2J9XA 1XF5A 4TV6A 3IU3B 1R9FA 3QEUB 4RETB 3S3PA 2FLRT 4Y19E 1RL1A 2VW6A 3QFJA 2A85A 1SEBB 4JFFA 5L6YL 5HHOB 1XGRA 3CN4A 3APMA 1NCBL 3G6JE 3AQDA 1RMFH 5SX5K 3DPBB 1GTEA 5I19H 5DD0L 3DXIA 3SY6A 5FEZA 1WKFA 2DUAA 1D3CA 3NYKA 4QRRE 4IRSA 1OW0C 1CXKA 3GIYA 2GJZB 4PJ7A 3QJRB 3VSUA 4C7GA 1RBOB 4X6EA 4K7VA 3GF8A 3IMBA 2A38A 3W1UA 1SEQL 1KXVA 2LU4A 4B5NA 1XKJA 3EPMA 1ZHLA 4ADSA 5LSMA 4HD9A 5FUOL 4XP5H 3PWIA 3S96A 1CD0A 4TMPA 3ENEA 1DVQA 3CQ0A 3W24A 3DBNA 3H9HA 1MH5A 4NNCA 2W9DL 1MRDH 3E38A 2DVTA 5FV1L 4N9EA 3ZMRA 5MEQA 3MXVL 4YR6B 3F85A 4Y2DD 1X1OA 4Y1SA 1DUZA 3P9MB 3VQ1C 4FOJA 2AL1A 1WV2A 4S3BA 1OTTC 5I6PA 2PYEB 1JCNA 5TJWK 2C6QA 4FQCH 2OMAA 4A3QA 3MREB 2LAGB 5AWNL 4C6BA 1NIAA 2FWLB 2XWJB 2Z24A 3CUIA 5KTEH 1B57A 1WRFA 1W9PA 3MANA 3NQDA 1RCXB 2YD6A 3B1TA 4CMHB 1A9EB 4HIBA 3EYOA 1J7VR 4IEFA 4WO4B 3GIVB 4MD4A 4DZBA 4AY8A 4JHAL 1W17A 2GSGA 4RMWA 1G4PA 5KN5A 4AVKA 2VUKA 4OCWL 3BD5A 5K3VA 4TVSa 1T1WB 4NX5A 2WWMC 1T21B 3L6FB 4O57A 1LDCA 2G60H 1NBYA 3KM1A 4L6HA 4LLMB 2KS0A 2PR9A 4UQ2A 3KNBB 1TQTA 3IRCA 3VE9A 4UTTA 5BZZA 1E4WL 1P4BH 4B4HA 3RFZB 4UQ3B 4HN4A 4FFWC 1UZHA 3R0UA 4FHAA 2GYSA 2Z27A 2VJXA 1XGUB 1X96A 1EK3A 2V9QA 3CVHB 1QQDA 3ULVL 1AO7A 1Q45A 4K3JH 3QEQA 4MVBD 2W4XA 1BZQK 4GYKA 5HMSA 4F27A 3X17A 4IUGA 3QQ3B 5GRUH 1ZUAX 3GSVA 4KOCA 4PHZA 5C07E 2WYHA 1TPH1 2ZSVA 3EXTA 2PPCA 4UT9H 5GRVK 2QIWA 1IGJA 4OM0L 1GGCH 4AMWA 3VXMD 3P4OA 1XG4A 2EXYD 4OB5H 2E6JA 3TM6A 3BT2L 4ZJ9A 1H9DA 2V2WA 1PG7W 1XFBA 3P3RA 3ZIMA 3L5WB 4EDWH 2QJNA 4YSEA 2HK0A 3L3DA 5ABTA 1CNVA 1CDBA 1HCVA 4BH8B 1KCVH 2R23A 3S34L 5I5JA 1FLTX 2YRBA 3MP5A 3VTAA 2KC0A 4Z3FA 1E4HA 2BY1A 4GRMA 4IXXA 4ZAKB 2TSBA 3PHOB 2PO6D 4NAQA 1F4YL 4K7FA 1KIQB 1ELSA 4LRIC 3W7OA 4GG6A 5XIAA 4Y19A 3V6BR 2CJUL 2ZTBA 3LRLA 3SBPA 2X1WL 2WKGA 1BTCA 2YYUA 5IFAH 2QUTA 3W7HA 5KS9B 3LCHA 4QAMB 4XVUD 1C8YA 4YHZH 2RA1A 3IM1A 3QJXA 3APTA 1Y0LA 4DEPC 2QADD 2JKTM 4DPRA 3TMQA 4F57L 3ECBA 4QRRA 2X4UA 2R1YA 1P0EA 4L5FE 4DZIA 1GZHA 3MV9A 5FOOA 1FGNL 3AG3B 5LGHL 4YHYB 1A3QA 3FA4A 1UR8A 1KNOB 3RLHA 5KINA 5JOFA 3ZVHA 4KEMA 2PTZA 2WBJA 3DJ9A 1HE7A 3B4YA 1H6UA 5GNXA 1FDLH 4NQEB 2MKWA 4EOUA 2FCBA 5LIYX 5HJGA 5AW6B 4XVSL 3NIDE 3CWOX 3ZO9A 4ZW6A 2J8UB 5A2CA 1DBML 5E1GA 3MBXL 4ONVA 2DM7A 3SZKC 3RLUA 3EF4A 2LGNA 1G9NC 2DDXA 4YL9A 4B95C 3VXRB 3EBHA 4ZTPH 5J12C 2YXMA 4JTGA 4L3EE 1J8VA 3H23A 1HWGB 3QH3B 3FA5A 4B53A 4YGVB 5FWRA 2E86A 2JEPA 4QUOA 1EOKA 4QDMA 3MBWA 1WBYA 3SUWA 3HA0A 3ATFA 4MXQC 3OAWA 5D2XA 4K07A 3AWNA 1T5WA 1BEYH 2R56L 5IJBC 4W7WA 4LCUA 2PCFB 2WLIB 1FAKT 2BSSA 1OABA 4MSSA 1ZANH 4F8QA 2X28A 4PJEB 1O5DT 1NFGA 2JMRA 3DO4A 3CB8A 1JPTH 2OEKA 4BFJA 1P4LA 4E2VA 4TNWK 5DTFA 3X12A 3ASOB 3INPA 5BOJA 2IBBA 3W56A 5FOJA 2GIMA 4PS3A 2VVSA 3KBVA 2GJ6E 1BX2A 1CT8B 4LCCC 4R7DB 5JW4R 4YLQT 3KPTA 2REQA 3ZE0B 1MEHA 5A8MA 2NV2A 3O3UN 1Q0YL 5EU3B 4N3UA 3IIZA 3RY4A 3IAQA 2CD0A 3SB0A 4KK5D 5D1XE 3VGGA 3U7YH 1G7IA 3MOAL 2FWOB 1OAQH 5F7KC 2F19H 3LNDA 4KTDL 1KEGH 2FLMA 2HZHA 4UWQB 3DV4B 2VDHA 2JIEA 1A4JA 3RPBA 2C8NA 3NK3A 5HHME 2NT1A 1TWZA 2I27N 1U8IA 5B38G 5ITFA 1H8OA 2PS2A 3TW7A 3QIBA 1KLFB 1XGPB 1HTYA 1W72A 2BP8A 4B41A 3VKAA 4JJHA 4JN8A 1RLCL 3KM8A 2HPTA 1Z5YD 4KRTA 4HETA 1H3TA 5DJAB 4OZGF 3GSWA 3HS0A 1A9BB 4DERA 3F64A 1FZOB 1E9OB 2X09A 2CIIB 1VBRA 3HFML 1ZTMA 3SZ6A 1YYLH 1S7XB 2BSRB 3MJ9A 4AIUA 4RNRA 5DVPA 2HLFD 4NIKB 3IJYB 2OVLA 3G3LA 4YPJA 1R87A 4NZFA 4JTAA 1HWWA 5DJDA 5FFOA 1W1PA 3GO1H 5F9OH 2IDFA 1BFSA 3QWNA 1UH4A 2OMUA 3VVGA 2LTQC 5E4OA 4Y4KD 1U8HB 5CCHE 5E1HB 5FYLD 5A40E 3GJFH 4XPGL 4MAVA 4FI6A 5J04A 4FG0A 3CDCA 3QUYA 3CHSA 3WENA 4U1IB 3RGVA 4FABH 4D6EA 4IGSA 5D2LF 5CMAB 1CICB 3L1GA 3PP4L 2X1XR 1DE5A 2F54B 3QIUD 4AEIL 4XCYB 1DN0B 2WGXA 2OQYA 8RUCA 3QUHA 5PAZA 4LOCA 2X2UA 3MRNA 2JXMA 1G7UA 3QXUA 3N2MA 4KETA 3QG7L 4CBZA 4TIMA 1RUSA 2VW7A 3UOAB 1RQ5A 3FKUS 5K9KA 2OT1A 5J9PB 5D8JH 3IWPA 2P5WB 4C6OA 5E4IA 1S6NA 3TH3T 3AWGA 3NL5A 1E9PB 1TF4A 5E6YA 2OMYA 1MHCB 4PJAA 2X1IA 3SRDA 2GK1B 4BKLB 3U2SB 1ZMYA 5E8EA 2PYEE 3FN3A 4YBLC 4Z08A 3IDIA 4KCVA 2WXRA 3TIDA 1RZJH 3D3FA 2BSED 1N6QL 3FS2A 2P44B 2ZCZA 3FOLA 2X4TB 1TXKA 3F62A 4KEZA 3BHBA 4F0SA 1DTNA 1LP6A 2HXTA 1DIOA 1DHKA 5HDLA 1QNZH 4PW4A 4EI5A 3N29A 2FO4B 4JEJA 4UT7H 3TFKD 1OHLA 3ZWTA 1X5JA 4RFNC 2KZWA 2BP0B 1TJ2A 4GS7C 3UNDA 4TOYL 4ZGYA 5IFPA 2ADIA 1A4KA 2R39A 2GJ6A 4MJ5B 3LENA 2VRKA 2C3VB 2YD1A 3C3UA 2NDFA 1M7IB 4Z1BA 3WD5L 5FSDC 1IM3D 3OR7B 4J40A 1W2VA 4JLRB 2B15A 4FEMA 1W8GA 5A8QA 4GINA 4MNQB 1W3KA 4LRSA 2H6UA 3W9EB 4EUPG 4IBZA 3LIZL 2TODA 3FX4A 3VFWA 2HTMA 3N1MC 3C60A 3PHAA 1UQSB 4ONFH 3D2TA 3JWNH 4QG9A 5I2UA 1I7RA 1UUMA 1AQKH 4MNLA 5DVLA 1TEFA 3KYOA 5E7FA 1JGUL 1EDQA 1LO0H 3EEZA 1ZCOA 2KBGA 5GS3A 1MQQA 2VB5A 5IRPA 4NF7A 4H7CA 3SQOL 2QSCH 5FJJA 2YPLE 7ODCA 4TRPL 5AYBA 3FO2B 4M5YL 4EP8C 4JTTA 1RUKH 3LN3A 2W27A 1VPYA 1OAXH 4FFZH 1J1XL 4MDPA 5LQBL 2WQUA 4HUVA 1EF3A 2P47B 4G8IB 2WSKA 3D9AL 5D4IA 1GIGL 4LPYA 1X5LA 1JZ5A 3C8KA 1QLEB 2DZBA 1UWYA 4LTSA 2NY0B 3GMQA 4UUJA 3DGRA 1XICA 9XIAA 2EIJB 1W5NA 1WBZA 2OTUB 3WNIA 2PABA 2WAGA 3TJEL 4ACPA 2BIIA 4OIAA 3H7LA 2E9IA 4BKSC 3T65A 1X9UA 2WSYA 3JZEA 5AKVA 4U3HA 5IMOB 3IU3A 3JV6B 1XIDA 2XWXA 5FUCC 2BP3A 3QEUA 4FTVB 3TEYA 1P7TB 5AVVB 3Q2NA 3CZFB 1SEBA 1GG0A 1WZ1H 2F58L 5T1MB 1GZPA 1MIEH 1Q6RA 5HHOA 1BXUA 2QELA 3NQIA 4BFEA 1BG4A 2ZUMA 4GCAA 3WQ6A 1ND0B 3DPBA 2WC3A 3GNOA 1U92B 4NAEB 2XVPA 1KTRL 3P0YL 5HHVH 3JVFC 2SODB 4WWKC 1EQCA 1BKSA 4ZX6A 1R3SA 2GJZA 2G95A 3UTOA 3KMDA 3ZDZE 1FNSL 2FATL 4D9QE 2AJYH 4Z8FL 2PPDA 4X0NA 5GS2H 2BRRH 1GHFL 3CSFA 5DMIL 5BXSA 3SY1A 4LDEB 4JAWA 5E0CA 5IESH 4WGXA 4H0HB 4K23L 1PFOA 4CQ8A 5KZ6A 4YR6A 4GQGA 5C8JB 4DGYH 2VX5A 4GQ9H 4Z95L 4S1DD 5KZMA 5IJKA 1DHPA 3P9MA 1EDGA 2PYEA 4GXWA 1RV6X 2BB0A 2FBRA 2ALDA 3TO4B 1KJ2H 4WUKH 4FC3E 1A5KC 4HIQA 3C2VA 1RUML 3MREA 3EH3B 2XWJA 3KEHA 3ABGA 2XIMA 3VMNA 4JD4A 1DVFC 2WXMA 2IXQB 1AC6A 4FA7B 4NUPA 1A9EA 3XIMA 1KGUA 1NM9A 3IBOA 4R2GD 5BCAA 1POJA 5E1AB 4WO4A 3GIVA 4LHUD 4D9LH 4E9LA 2CHOA 4PY8J 1DLHB 2K7PA 3B03A 3LMJL 1T1WA 1MJJB 1OM3H 1T21A 3ZBMA 3C5SB 3L6FA 3EO9L 4DP1X 2EILB 4NHUB 3R7MA 4H1LH 4XO9A 4TX8A 1JRHH 3B1UA 2O4EA 4XNDA 5ID0B 4LLMA 5B4MD 1PZ0A 3ETTA 1Z9PA 4Q9RH 4PJEE 3KNBA 1EC7A 2QJDA 4XV0A 3TBCA 2XISA 1OP5H 4U3AA 3FTZA 1FWBC 4EWJA 4GQ0A 3RFZA 4UQ3A 1S3RA 2E4FA 1SO3A 5EOCJ 1XGUA 1F3DH 3CVHA 4CVUA 2OWXA 5IFHH 3TQVA 1KGWA 3O2WH 2YWZA 3S36L 1L9PA 4Q97A 4B5XA 1HCZA 1F76A 1DCLA 3NSJA 3QQ3A 3PAVA 4YHML 4MA3B 5I0WA 3S2JA 1UOZA 1OLLA 4CILA 4MJJA 5DZPA 5BWFA 3TV3L 1TR9A 1DQKA 3FJNA 1G7MB 1XBYA 3HNSH 5LDSA 4AT6B 4IKNA 4L1XA 4KMLB 2OJ1A 3CIVA 4FIRA 4JHVA 4EX4A 3P1VA 2CDEB 2HVMA 4HCLA 1IKNC 3L5WA 4EAYA 4G6KH 2VJ0A 1XIHA 1V7MH 4OFDA 4QQUA 3GTVA 2XWCA 2UZYB 1PUDA 2IXVA 1THAA 4BH8A 4B96A 1F07A 1BOGA 3S5SA 4PJXF 2OJEA 5GGSB 4GXUN 4NM4L 4BZ2L 4ZAKA 4ZMTA 3PHOA 3NCBB 3GDMA 3MJ8B 1I4FB 2Q7AA 4L37B 4YHGA 1KIQA 4WTQA 5J06A 3CT7A 3AICA 4ZR8A 1ZIBA 4IQDA 2W9EH 3SM0A 3BWAB 1XB6A 3QHFH 3O9WB 3IGKA 5EB8A 2IH8A 1S5MA 3E8UH 3ITLA 4DOHB 5KS9A 4IOFC 1E55A 4CQDA 4IH3A 4F8NA 4FXSA 4X9GA 4JHMA 1XYMA 4XN4A 1TYGA 3EOBB 4IJRA 5IJDC 4UMAA 4IGBB 4HNOA 3ARWA 4GUGA 5JIHA 4WGVB 3SPVB 3RKPA 3M5ZA 1Q63A 3PF2A 1NVMA 1KNOA 4RRPM 5KOVC 3ASWA 4LVNB 1YEDB 4D0CB 4HTYA 4A6GA 4NQEA 3EOLA 2NY4C 1IE5A 4GNJA 4ZMGA 4PBEA 4JPVH 2F54E 1ZHAA 3WS6A 5DQJB 5FYJU 2J8UA 1EXUA 3L1FA 4PRPD 3M45A 3MV01 5K9QI 1XAUA 2VGGA 4XNQB 3BQUC 1IX2A 2COQA 1MSPA 3VXRA 2UWEB 1CD1B 1RIVH 4JO3L 2P5WE 1VZIA 1R5VB 1BJMA 1FDJA 4KZ0A 4H8WL 3QH3A 4JREB 2R51A 4YGVA 5DCCA 1A7RH 4L8SC 4MLJA 3L4XA 2C13A 3L0NA 3ZQ9A 3ARYA 3HI5L 4O00A 2CHNA 2CXKA 3U9IA 4BSJA 3O8XC 1HIML 4DN3H 5BV7C 3K8LA 2PCFA 3K2UL 2WLIA 5K9CA 3LCFA 1BM7A 4PJEA 4UZUA 4BQ6A 4ZB2A 1PCKA 3O4LD 5D7KE 5GSRB 5KZCB 3WDQA 2VSKB 1FKWA 4KRPB 1BQHG 2CRZA 5L9DL 2Q02A 4X5QA 2DKSA 1WB0A 4OJDH 4XUYA 2BP1A 4JTRA 1ZB5A 1CT8A 3M0XA 4RZBA 1FFOA 4OLWH 4R7DA 4Y16D 1UP2A 4YSUA 3DCPA 3F8UB 3TF4A 1W1A1 1HOCB 4DLFA 4MNQE 4I3RL 4JB9L 3TU6A 1MVUB 3HC4L 5SWUA 2FWOA 1X1NA 3RPMA 5ELIA 3DXAB 4CNNA 3HC2A 3MWCA 2L0DA 4AKOA 4J8QA 2P9RA 3O2VH 5BQ7B 2NQ3A 4A38A 3DV4A 4XO8A 1TZHB 2MOGA 5DS8B 2AVFA 1YAIA 2CO2A 2FQEA 3HMXH 4BCEA 1RULL 3OKYA 1DQUA 1LVEA 5AD0A 1VF8A 2YGPA 3CDZB 3NQKA 4OTKA 4YXHL 4IOTA 5CBIA 4DNLA 4GQZA 1ZCRA 4PBGA 1KLFA 3QZ6A 2A74B 4ZD3H 1XGPA 5ANME 3NABH 1CLYH 3G1AA 1ISXA 2OGYA 3BPOB 2EDYA 4LS1A 5DJAA 5HDOA 2G5WA 5HD8C 3LQLA 2JE8A 3L54A 2APVA 3OJVC 1NCWH 1A9BA 5J13C 4P2OC 1FZOA 3F5WB 1E9OA 5A2FA 2CIIA 3EYVB 1S7XA 2BSRA 3FUMA 1H7WA 4AG4L 3QRBA 4HOZA 3QDJE 3IJYA 5F3FA 5EUOF 1FJ1B 3HS9A 3V9EA 3QW4B 1CZ1A 2ISDA 2OELA 1IKFH 1RUQH 3NQVA 1U8HA 2OV0A 3V1PA 1IGMH 3PWNA 2ZQKA 2W79A 3MZ2A 1A7OL 3UMNA 5SWZD 3ESNA 4U1IA 5CMAA 2CRIA 5C2UB 5D2VA 2OS7A 3QI9C 4EDXB 1S2UA 4G6CA 3IDNB 4MQXC 3US9A 2F54A 1GVRA 3LQMA 1DN0A 4UF7C 4AC7C 3D8MA 2NNAB 4B9GA 3N9GL 3KTSA 3SURA 5DD0H 1R0AL 2XFGB 4E38A 4N9CA 3CBRA 1S9WB 1FCQA 4C4KT 3FU8A 4XD6A 3CHEA 5E8DL 4RGND 1RSFA 2X1PA 4HC1A 4M29A 4E68A 1DTUA 5J9PA 1BWLA 2P5WA 4YDJB 1QDSA 1ZVSB 2PPFA 5CZTA 3QUMB 3HC3H 4M03A 1FHUA 1UH2A 4U1GB 1IGFL 5E9DE 5JXEC 3ZL2A 5D4HA 4NDMB 3MXVH 1MHCA 3X1EA 3ARGB 4FQXC 1Z8AA 4PGBB 3U2SA 2FBJL 1NMBL 1KGJA 1P6WA 1GHRA 3RJYA 1E27B 4J1OA 5C3TA 5EGRA 2X4TA 1AUSL 1MWOA 2RCSL 4XMTA 1KMGA 3SDOA 5GS1B 4BSWB 2IWGA 1TPXC 2FEEI 3E12A 3UZWA 5JHMA 2C1HA 1Z9LA 3WY3A 5D4JA 1QI2A 2FO4A 2J7EA 2ZCGA 2HT3D 4JQIL 4JHAH 3WIJA 4NPKA 1E43A 4JN1L 2BP0A 3B3DA 1Y6KR 4P2QB 1RZGB 1CT5A 4Z0BL 3NSXA 5FYKL 1ZSHA 3SPGA 5FECA 3WBEA 4MJ5A 4HK7A 5FJOA 3QRLA 3W2LA 4XC1L 4YDZA 3V3WA 2C3VA 2AJ3B 1M7IA 4LEXL 3OR7A 2BBFA 3MY9A 5IBXC 3Q3GB 4UFLA 5EU9A 1OAYH 2B20A 5TBOA 4D0DB 2G2PA 4AZBA 2BSLA 4JLRA 4FXRA 2Z93B 2ZCHL 3SCTA 4NIYE 4HCRH 3RI5F 1A4BA 4MNQA 1ZA6B 2KPWA 1E4WH 5AOIA 3W9EA 2JSFA 1W3JA 1YN7B 3WFEL 4JM0A 1UQSA 3AC0A 3ULVH 5DD5H 3KJ6L 4B5VA 1MFBL 1S1RA 2ODIA 1PHQA 2FAUA 3I9AA 3PP3K 5H8MA 3QPZA 4FX5A 4GAGL 4RE2A 4A7QA 2V5KA 4R9HA 5IREA 3CHPA 1TWDA 2QGCA 3FO2A 1D8CA 3NQAA 2YPKB 3ES6B 4ONHB 3GU2A 3RKDC 4G2AA 1R3VA 2DEWX 3QUXD 4Y9EA 1D5BB 5I26A 3EWWA 4GFSA 5EY5A 4G8IA 3FHQA 4EE2A 4L4VD 3QSRA 3FCUB 1XWVA 3POHA 3VGDA 1LEIB 5EB9A 1Q9OA 2XTJD 1XX1A 1TSRA 2C7UB 2JKXA 4OFYA 3VOHA 1WICA 2OTUA 1PCSA 4HMNA 1YDPA 3WLTA 2Y5QA 1I3RB 5IMOA 4ZOBA 3JV6A 4IPLA 1F4YH 1VA9A 4FTVA 1P7TA 3MMWA 2CJUH 3CZFA 4QXUH 1UYWL 4PJCB 4P46C 4M7ZB 5T1MA 4UFKA 4CD7A 2Z0UA 3QOKA 4YIQA 4EVNB 1JDFA 3IPFA 1NFAA 3HB9A 3U2EA 5FSEC 5B7YA 1ND0A 4ODTL 4S10A 1U92A 4NAEA 1BHGA 4HMDA 3FYPA 2Q7NA 3IRZA 4R4FH 3ZHNA 4BR1A 2CDFB 4LKXB 4JPQA 4GE8A 4H7ZA 4C6CA 2D4DA 1FGNH 5LGHH 3BUTA 3CZUB 43CAB 3VC6A 1LO2L 4LGSB 3MJWA 3QJAA 4LT7A 1HJWA 2O5XL 1HW6A 3WSQL 2XHNA 4KNTA 2D2OA 2OTWB 1SHSA 4GQRA 4AGLA 1EZUA 3KUMA 5C8JA 2AK1L 4XVSH 4W4NA 2J6XA 1XO8A 2CZFA 2XM1A 1EIBA 3MBXH 3RVWD 4P3CL 3GMMB 4UYPA 3TO4A 1UKOA 3UBGA 5CGBA 4FF5A 3ONCA 3OHXB 5G4EA 4GSXA 4AQ1C 5KAQG 2IXQA 1E2WA 2F5BL 4FERA 3VZYA 2UV8G 4B9PA 3NPUA 2A7BA 3B05A 3UR2A 1CG9B 4AAJA 4PGDB 5C0FB 1DLHA 4IPPA 1FVDB 4GRWH 3T3PB 2EDNA 1MJJA 3LRHA 4OOUA 3C5SA 1GGTA 1RVKA 2XKSA 4NHUA 2R56H 1RZKL 2Q86B 1R3IH 1AIFB 4G6FB 2H32H 3ESOA 3CM4A 3WFLA 4XMLH 2JF7A 3HOGA 4BUQA 2W0FB 2AQRA 3SDDC 1K7XA 5A69A 3S2CA 4FALA 3BAEH 4LAQH 2XETA 1TZGH 3R94A 2AGKA 2FDSA 5BVPL 4QWWC 4F9LC 3I68A 3WKZA 3ZZLA 1MCWM 4XNBA 1B88A 2ANUA 3G1HA 4MA3A 1KGCD 1SLVA 4LMQE 2CXEA 4KRMB 3M1ZA 5D9OA 1ISZA 3UXLA 1Q0YH 4LCYB 4JO4L 4XG1A 1G7MA 1Z41A 4W93A 3SEPA 4AT6A 3QR0A 3DXAE 3OZ9H 3MOAH 4FX8A 5AECA 4R34A 1YADA 3UCRA 2YQ2A 2CDEA 1F56A 4S2BA 2X4NB 3B9KB 2Y1YA 5DHMC 4PW9A 4YXGA 4X42A 4ZPVB 3KHOA 1PLGL 2UZYA 3V4PB 3AIWA 1MPAH 4P0DA 5A8GA 4JXCA 5DC4B 2QF7A 4C60A 1YPZF 1E6QM 1JPKA 4HUXB 5GGSA 1GQIA 3MJ8A 1I4FA 1UATA 1JYVA 4L37A 3V1HA 4ADUA 5C0RH 4H01A 2G96A 3O05A 3JTTB 2IO5A 4X5LA 2FGLA 2PDPA 3TXVA 2OWCA 3BWAA 2RBLA 3O9WA 3UJRA 2EXWC 2XWDA 3HFMH 3BL3A 5AHEA 2J71A 1F0LA 4QT5B 4N42A 2WLKA 1IYXA 2ZUSA 3IDJB 4GGHA 2ZWYA 2E7DA 1BXNA 3FLUA 1EJFA 3EOBA 3WMPA 3QFJE 8A3HA 3JYBA 1W5OA 4XBGB 5B7ZA 2FKPA 1OC5A 3UAJC 1GPOH 2K4AA 3OPUA 2LW3A 4GYFA 1XDLA 3SPVA 4DF9A 5KVGL 3BD4A 2QVHA 4DZAA 1E5CA 3TR9A 2GI0A 1E8WA 2XIOA 2MQCA 5I1AB 5TK2A 1YEDA 4D0CA 3TZVA 4ANWA 4RDZA 5E9XA 4PJ7E 1GVQA 4UR7A 1SSGA 1QNSA 2YR1A 2VGBA 4RZKA 4KKPA 4P5TB 5DQJA 3X13B 4ZXBC 4ALAC 4Y8DC 4AEIH 4DP5X 3G24A 3PBWA 2AEQH 4JRYD 2J3SA 2VLJD 4KFNA 2EDDA 5AC4A 4KJQD 4XNQA 5C54A 5HA7A 4XAWL 4MFHA 3QG7H 3ZDXF 5I8EB 1J5SA 2UWEA 4ZZFA 1CD1A 5EMUA 5FEXA 5BJTA 2J6WA 4AXNA 1R5VA 2IAAC 2AEPL 3RPIA 1MHPL 5DD1L 3AVEA 5J5DA 3RITA 2AJVH 4DJFA 4LPXA 4GMTL 1TPEA 3TT3L 2Z34A 3EDJA 4ZMVA 1XF0A 3N6YA 4I7WA 3A3YB 5ACLA 4W88A 2O5YL 3T6WA 2YCJA 1H11A 1N6QH 1W80A 3EOOA 4FLHA 2NR6C 4P8QA 3RAJH 5DUML 1N6UA 5KSBB 2NXZD 1MY5A 5CLWA 2V7HB 5GSRA 1KNWA 2VR8A 1QEXA 1BVKB 3J2PA 2V38A 1WPCA 3GW3A 2FNBA 2AERT 2MWCA 4RMSA 2OSXA 4Y89A 1MCIA 5HYSB 1A3WA 1J0JA 5FI8A 3L3HB 2FLBT 3I3EA 4IGNA 1I1CA 2ABAA 4OLEA 1UC6A 3GD1C 4M81A 3RFRA 3VXTA 3WD5H 1OZQA 3QGAC 3EFDL 1AO7E 3EZJB 6REQA 3QEQE 1HOCA 4UIKL 3ABQA 3QRGL 4BFOA 3SE9H 2CUMA 1UWGL 1MVUA 3ZHDA 2H0PA 4KHXH 3DXAA 3QQ1A 2YD5A 4E0CA 3DFSA 3DENA 1TQBC 1EWDA 3E9TA 1INQB 1JGLH 2Y5JA 1AD9A 1TZHA 3LQZB 1BZ9B 4O19A 5DS8A 1TTQA 1T83C 1X9LA 4NZ8A 3M46A 4EPBC 1EQPA 4PU2A 2ZAHA 2J44A 3KPPB 1JGUH 3X3FL 3QYCA 1F6AB 3CDZA 4DUWA 4NZ1A 1Q1JH 3GG1A 2E8YA 2IAMB 2A74A 3W6LA 4TRPH 5EO9B 1RY7B 4JTUA 2YZRA 2QDHA 1OP3K 3VI4F 3LCWA 5E6IC 3O3BB 1W72L 1KUMA 5AYIA 3GK8L 3EYVA 3D9AH 2G4EA 3OKMB 2BINA 4W5ZA 3CE1A 2LOEA 3KCOA 1LWRA 3MJ9L 4GG6E 2L7EA 4JGDA 1FJ1A 3EYQD 1OTUC 4CMMB 3KX6A 5DZOA 2BP5M 3AS1A 4DI9A 5C6PB 4AMKL 1W2PA 3M0MA 4L5FL 2EIEA 4RRPA 5TK4A 5KVGE 5T9BG 3PUOA 3V0IA 5CZJA 3VM5A 4O1AA 3MV9E 4J3OC 1NIFA 4A8NA 4JKKA 5GQBA 4EDXA 3IDNA 4IMFA 3GJEB 1NMAL 3HHSB 5B1AB 1UWQA 1TOXA 1G69A 1AJ2A 4GXUM 2NNAA 2EE6A 4FZ8H 3UZXA 2XZZA 2H9GB 4RNFA 3P0YH 1EVUA 3WN5B 5LXVA 5GXBB 1S9WA 4HCDA 1U2YA 3G0XA 2EUWA 3WJJC 5CUSH 4ES9A 2F8OA 1FNSH 2KZHA 2V2DA 2ZPKL 1MCDA 5F70A 4FFYA 5I1LB 4DP7X 1G0CA 1OCOB 1EBPA 4QXWA 4HU8A 1GHFH 4A8RA 3TBYA 4YDJA 4WK2B 1ZVSA 3QUMA 3BZFA 4DWSD 4B3KA 4MKTA 1C1EL 4MB1A 2FT7A 4NDMA 2DLEA 2V5SA 3EZ4A 3FSTA 1EYEA 3ARGA 1KFCA 4Z95H 4PGBA 4DBUA 1LDSA 2BJMH 3C2AL 4M7KL 1U33A 4XVTL 2GOKA 1E27A 3V0VB 4MWAB 6A3HA 4XAGA 5GS1A 3US0A 1RUMH 5F7AA 1NC2D 1ECZA 1P6AB 4BSWA 4XX1G 2AITA 3GZKA 3DMMD 3OQEA 2IANB 2VJ8A 3NIYA 5IHUH 1S8DB 2D9CA 4AOFA 3M5XA 3OBEA 3UGRA 4P2QA 1RZGA 1K3ZA 3BLFA 1EDYA 1WFJA 3LBCA 3LMJH 4I0PC 3CFDB 3EO9H 2AJ3A 4TVCA 3P3TA 4H4NA 4PUEA 3Q3GA 4D0DA 3RUGB 2Z93A 1MXDA 1YNQA 4X9HA 4AYMC 2P43B 1ZA6A 1IC0A 4YSTA 4F2MB 1OYCA 1YN7A 5HGBB 2UZIL 3O4OC 1CYWA 4J4PA 4M6ML 1FV1B 3ULUH 3UT0A 4ZL1A 4O54A 3MBED 5D2NC 2LT9A 3S36H 4XTRD 2A9CA 3IMRA 3LHZA 4U7MA 3GWQA 1PCXA 3LH9A 1S39A 3DIVA 4YHMH 2XQYG 1TETH 1R85A 1CLVA 3NJ3A 5F7WC 1YTDA 3QWRD 3TV3H 4Y7OC 2W5FA 2TRYA 2DL2A 4XH2B 4L7ZA 4S0HA 3WDRA 1QPPA 1O7VA 3PZMA 5J56B 2YPKA 3ES6A 4ONHA 3VZXA 2DQJL 2OZ8A 2ZE3A 1D5BA 3P4LA 4CN1A 4H88L 2EADA 3AXMA 3QQ4B 4UB0L 4JGJA 3N2OA 4L29B 1OGSA 2C7UA 3PAYA 4XTDA 2PR4H 1VKFA 1EV2E 5AHMA 3FCTB 4PEKA 1K9EA 5J3HC 4G9DB 1S3KL 1SN5A 3DHMA 1P84J 1TQUA 1I3RA 4BZ2H 4WDIB 1YEHL 2AL2B 4W9CC 4WJXA 5FGRA 4G59C 4LPUA 1ZK5A 1JZ2A 2DI8A 1S78D 4PJCA 4E41D 5MEOB 3E6EA 5BNKA 4EVNA 3V52L 2G9HB 4MB4A 5A7BA 4D7PA 3LNMA 5E6ZA 3U7WL 4KHTL 3QJFB 4XO5A 5CC6A 2P1FA 4ZPTB 3L3OC 3QJZA 3G6LA 1CGUA 1P7QD 1BMZA 2CDFA 4LKXA 4W9HC 4HSNA 3VWJB 2BIOA 2O55A 5I1EH 1EFXD 5JDSB 2CHDA 2GGJA 1O9VA 4LSDA 4JIHA 3RLGA 3I10A 3GMRB 3IB4A 4ETQB 5CBJA 5EO1A 3OGSA 2OTWA 3US1A 4HD5A 1AXIB 2AV1B 2ZRWA 3ILQD 5CZXC 5EU7E 2QVTA 1UWAA 4JTKA 3GMMA 3QSKB 3JWOC 3WUZA 4KJWC 4OJCA 3PGDB 4AHQA 1L4IA 3OHXA 4R85A 4H19A 1A8ZA 4PJAE 5FM8A 4APQB 1Q2RA 2P5PA 2DSWA 3EXSA 4JR9H 4KI5D 1HH6B 1O75A 4UQEA 4W7VA 3W01A 4PGDA 1ZL1A 5C0FA 3DLQR 4A3RA 1FVDA 2XX0A 1WEJL 3VFCA 1GKEA 3RIAK 2Q86A 3ZIYA 4KY1L 3UC0L 5T9CE 4Q4QA 1BVOA 3W70A 1QI4A 3K2UH 3C0QA 1OC6A 3P0GB 3FJ6A 4E6MA 1CFTB 3V8OA 2W0FA 2A2QT 5KSBE 4JNXA 5HGAB 4WCYL 1A0CA 4GRSA 1ISWA 3ITGA 3VK5A 4X98B 2NZ9D 2W59A 4LCQA 3IPBA 4PVLA 4KF1A 1W91A 2R6OA 1B4LA 1NPJA 1XFPA 4OQTA 2QLYA 2VCAA 1BQCA 3QBUA 1G6RB 3MKCA 3IGLA 5IQNA 5L9DH 4O1BA 5CLTA 4M62L 2PRLA 3F4NA 3F7VB 1GC1H 4UOW0 4HWUA 3VXPA 4XBKA 4X8GA 3CQPA 5JMOC 3CVHL 4BQCA 3TC6A 1XG3A 2KX9A 3W84A 1GA2A 1WFNA 2YDRA 3PDDA 4QEEA 3D39B 5I3HA 1UQZA 1PD6A 1HZYA 4LCYA 4WXYA 3JTSB 5EV7A 2AQWA 1ZAGA 4TQEH 4I3RH 3O6FD 1E70M 3WK0A 5FW8A 2CKBB 3HN3A 1AXTL 2X4NA 3B9KA 2NX9A 3UGVA 4HBQA 2WB7A 3HG1D 1OE3A 2VEMA 4ZPVA 1DBJL 5D5MB 2V67A 3C09C 1G7JB 1RULH 3V4PA 4CEUC 2N7BA 2FPVA 3FHEA 5BS0B 3L16A 2HG5B 1X7IA 4PB3A 3WDJA 2WHLA 4IHCA 5KG9B 5IB3B 5KVEE 1KGXA 4HUXA 2IG2L 4XD3A 4QTIH 3VC5A 1LT7A 3LZPA 1IT9H 4LP4A 1J8HD 4XN8A 1U95B 3JTTA 2VWEE 2EEFA 1NCAL 2WY3B 2CK2A 3N43B 3QF0A 4QT5A 3NEOA 1ANUA 3IDJA 5FF6B 4AG4H 3NAAH 1GGYA 1O5XA 4XBGA 3E74A 1NEUA 4PGCB 5HHOE 4Q4PA 2OLSA 5GRYA 5AG8A 2C79A 1UROA 1NM4A 4AENB 3H2CA 4B3LA 2QZQA 4XNMB 3EOYG 2UWFA 3VXUD 3KRBA 2NX5B 1BZEA 3CDFA 5I1AA 1A7OH 3RGHA 1QPQA 3C8HA 1VF5C 3O2LA 1XSOA 4EIGB 3TBVB 4I18A 3OMZA 3E2VA 3ZKMD 1YPFA 3EFFB 4UTCA 4P5TA 1YEFH 1TPUA 3X13A 1O5PA 1JWUB 4JDEA 3RRXA 3W76A 3T8MA 1R0AH 3BJTA 4IOIB 3WUFA 4BA0A 3MLUL 4PMYA 4EBQL 1FNLA 5I8EA 3VA8A 3ALWA 3M0ZA 4U3SB 1FA4A 2ZZUT 4NOFA 1S9YB 1GJUA 2SEBB 4MNMA 3GHTA 4CQCA 4NCC2 5KEZA 1A0DA 1V7YA 5H8DA 4KXCA 1BSIA 1VJIA 4C4BA 3R7RA 2EXSA 1UUQA 4FKKA 1I0DA 3NZHL 3DUGA 4KKAC 1AODA 4HJTA 1DBAL 3UXFA 5K7JA 4DEPB 1IJ9A 2YZ5A 1ILSA 2RCSH 4U5IA 2IANE 5KSBA 3GLCA 1AZBA 3O07A 2V7HA 1T4WA 3T9WA 1RZIB 2JKWA 4XIMA 1BVKA 4MTMA 4WTWA 2VP8A 2DM3A 5EL1A 4PBXA 5AZ0A 4XZBA 3CXDH 1QBBA 1JI2A 2H9AB 3BRFA 5LG6A 3UCDA 5HYSA 2JKSA 5AOMA 3TC9A 4NRZA 3QC3A 3Q5TA 3L3HA 2VE6A 4GMSL 5FYKH 1PKQB 1NAMB 4PG2A 5FJTA 2UX6A 3E6HB 1OCJA 1T40A 3GWJA 2YAPA 4QG8A 2VN5A 1WAAF 4W86A 2UXTA 1CI5A 2CLEA 4ZFGL 5BPPA 5FR3A 4PJHF 4ENZA 4LHQB 4Y1TA 4ACYA 3B2DC 4PWEA 1A5BA 1YZZA 5CD5D 3SE6A 1INQA 4J39A 4GYPA 1MZZA 1AR1B 3W2UA 3D48R 5E5MB 1HKVA 3JVGA 4KRNA 3LQZA 1HQ4B 1BZ9A 3KJ6H 1ZLPA 3NYDA 2ESVB 3CYJA 3K30A 1MFBH 1PS9A 5E51A 2AAAA 1I53A 3KPPA 5EU4B 1URIA 1F6AA 3U6XS 4RSVA 3MV7D 3CPRA 2MCG1 1TJ1A 3LKSB 2FT8A 4RDVA 4HWEL 4FNRA 4IMKC 2A3HA 4ILSA 1FWRA 2IAMA 3VXGA 2R1NA 4KV5E 3OKOB 1LLZA 5EO9A 3UZVB 4BWLA 5A6MA 4OWGA 3K0YA 4QMEA 3O3BA 1NGPH 1R8LA 1UKSA 1T5XB 4LDLB 4GKSB 4OZHF 2IQDA 1ICSA 1G9EA 3L9RA 3LEYL 3OKMA 1V55B 3MYJB 1CXEA 4I1PA 2DB8A 3I84A 3A5FA 4H9UA 3PGFL 3ABZA 1R46A 2E7CA 4XPHH 3T05A 3SR7A 4U6TA 4CMMA 4YZFF 1QZNA 1MI5B 2BNRD 5KS9E 2QVIA 3H8AA 2V5TA 2WNGA 4HIPA 3TJXA 3KGTA 3N91A