4CKQA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
390
structure length
390
Chain Sequence
b'HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 135
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4ckqA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ckqA02
2F8QA 2X2YA 4HU8A 2ZXQA 4MB4A 2J7BA 3SCVA 3GH5A 4GZIA 1UR4A 1E4NA 3WFLA 3BVUA 4GQRA 3WNKA 1J12A 5JIPA 3BUBA 2FDMA 4P7QA 5AY7A 2HISA 4P7RA 1BG4A 4UQCA 2XGBA 1KR0A 6A3HA 1KCKA 3CZNA 4M8UA 2OYKA 1K9FA 3UR8A 4F9DA 1HP5A 1E0VA 3CUFA 2ZOXA 4JAWA 4XZWA 3WQVA 2VTFA 4X9YA 5IDIA 5IHRA 2E9BA 3ZJ7A 3KL3A 3QGVA 3MMUA 3CZGA 2GVYA 3WDHA 5GNZA 1VEOA 4JL1A 1BYBA 1HL9A 3CZLA 3HG4A 3K1DA 2F7QA 4C7GA 2EQDA 3L2MA 1R87A 1W1VA 4QLKA 1W9XA 4B9YA 2V3FA 4V27A 1C8QA 4PTXA 2WWCA 3N04A 3RM8A 5LA1A 4HP5A 2UWFA 1V6YA 5A94A 1JZ3A 1R47A 1EQCA 4IISA 1VEMA 2MANA 2Y5EA 4ATLA 3ALGA 1JYVA 2ZX9A 3SUSA 3SUWA 3LPPA 3BLPX 1FP9A 5A2CA 1D2KA 3K8MA 3VIKA 2WMIA 1GQJA 5M3WA 3EMCA 5HNNA 3N11A 4W8AA 3AHZA 3UR7A 1HN1A 1QWNA 1CEOA 4DUVA 5CZKA 3M07A 4FNQA 1WE5A 4IPNB 3VIOA 4MNJA 4Q22A 3TP4A 2O9OA 4ZENA 1MWOA 4YPJA 3L4XA 1M04A 1GOWA 1OD0A 3UG4A 4XX6A 3EYPA 3BCDA 4CVUA 1XSJA 4F79A 1VFOA 1YHTA 1MQQA 4AW7A 1QI2A 3DX3A 1C8XA 1QHOA 2BVYA 1H0IA 3WD3A 2IXUA 3CZJA 3D4YA 2J7CA 3EMQA 3OGSA 3ARPA 1ZBCA 1G9HA 3ZSTA 4GZEA 3ARXA 4U3AA 3OIHA 1TFVA 2OW7A 3ARUA 3S2CA 2AAAA 3GXFA 3LPFA 2G8ZA 2J4GA 2VZOA 3L4VA 1UD8A 2BHUA 3IANA 1GOIA 1QI4A 1KTBA 4UZSA 4HA1A 4DO5A 2GUYA 3WQ5A 2QF8A 3CPUA 4E2OA 4P8UA 3VUPA 2C8NA 3OZPA 3CHDA 1HX0A 4UOQA 1GHRA 2VQUA 5CPQA 5CLWA 2XG9A 5AC4A 5A6BA 3WDIA 2UY2A 3ZR5A 3EJPA 4JCMA 4JL2A 4JFWA 1XC6A 4ZFMA 3WBEA 2W5FA 3GZAA 2W61A 1HVXA 1A3HA 2XVPA 5I23A 3ZJ6A 2DIEA 1PJ9A 1US3A 5FKYA 4PBGA 4HTYA 1CBGA 2XVKA 4W86A 1TQWA 4WKAA 3AMLA 5A8QA 4GQQA 1OSEA 2WKLA 3WH5A 1Q4NX 1VB9A 1ZL1A 4HPHA 3WQ6A 3CGTA 5LA0A 4UFKA 3ARVA 2GDUA 1DEDA 5F7UA 4WKHA 2W67A 3RILA 2A3AA 3CLWA 3AFBA 5I2UA 2G3MA 2WB5A 4WSKA 2ALWA 1GNXA 3EJSA 1NP0A 2ZUUA 5KEZA 3OGVA 3DC0A 4AIUA 4D6DA 5CQ1A 3KEHA 1V08A 3I3DA 1SFSA 1E1FA 3W24A 1LLOA 4B15A 1JD9A 2FE0A 1RP9A 2DT1A 5CGTA 3WH6A 2VOTA 3OLGA 1QNPA 4AZCA 3AIWA 2GJXB 2EPKX 1WNOA 3CHCA 1B30A 4CN6A 1MXGA 3MSDA 3AMDA 1QHPA 5GPRA 3WNLA 1H4PA 3W81A 2D0GA 2BY2A 4GIAA 3SUVA 1PZ3A 5CGMA 3HG2A 3AMGA 1BFNA 1NH6A 2F2HA 2ZUNA 2ZX6A 3W27A 4BF7A 3ZMRA 1W1TA 1CENA 4GO8A 3NUKA 1UQZA 1V3LA 2GJRA 3AHXA 1Z32X 5A8OA 1AQMA 4Z2HA 5IFTA 4ML4A 3A21A 4MTVA 2E3ZA 4GO9A 1OBAA 4CCEA 1QW8A 2XN1A 1UZ4A 4A3YA 1VIWA 4CD4A 4HOXA 1G1YA 3CMJA 1TCMA 3SCWA 3AHYA 4TXEA 2E4TA 1PEZA 1V0NA 3W0KA 1OT2A 4C7FA 1KQZA 1N82A 1JL8A 3ARZA 3W82A 4ACZA 3W28A 3BAWA 1WB0A 4U2ZA 5E0FA 2YL8A 4NZCA 5D9NA 4AEFA 3UEQA 3WY4A 3NCOA 5A8MA 2E0PA 1KTCA 1UA7A 4XV0A 3AISA 1E4MM 3ARQA 3VVGA 3LRMA 1J0JA 4UOZA 3SCTA 2GJPA 1JDCA 1V3IA 3SCQA 3WDJA 2XM1A 5DMYA 3BVVA 3WEOA 1CGUA 3F5KA 3D52A 1I1WA 3PBGA 4S3KA 2D73A 2X2JA 4UQDA 4XZBA 1XSIA 1KQYA 2X0HA 4PMNA 1OIMA 1PBGA 4M81A 1JZ6A 1E0WA 1JGIA 4H7VA 2EPMX 1V6UA 1V3JA 2IGTA 4D6IA 4W8BA 3VGHA 4OJYA 4E4PA 1XH1A 3FNDA 1MFUA 1BSIA 1LL6A 4N0RA 4OKDA 1CLXA 4D1JA 3GNRA 3CV5A 2QV4A 2E9MA 3WNNA 3TV8A 1V6XA 2BXZA 1C90A 4LX4A 3K4AA 1V0MA 3BSGA 4PN2A 1GPFA 5A95A 1UKSA 4JHZA 3VM5A 1IZKA 3KLKA 4KWUA 2XGIA 5A69A 1EHAA 1WPCA 3VGEA 1R85A 2Q8XA 4UFHA 1UWIA 2J75A 3CUIA 4NSBA 4AD2A 3SURA 4B3LA 1GQKA 2CKSA 3L4TA 2J7GA 3GNOA 4MNKA 3M6DA 2PWHA 1C3FA 5HPOA 3DECA 3LXCA 4AMXA 1UG6A 3VMOA 3VD5A 1E9LA 4R5EA 1H09A 1B3VA 4M29A 3NYDA 1MW2A 4AISA 1HJUA 2D3LA 3PZMA 2VQTA 1XRVA 1JXKA 2BV9A 5C8BB 3PHAA 1WP6A 2F7OA 3VDAA 3AICA 3WUFA 3SCOA 3AJ7A 2J25A 4WK9A 3VX0A 3KL0A 1OGBA 3VSTA 3KL5A 2WPGA 4MAZA 3BAKA 2VCBA 1C93A 3DX0A 3L2LA 3CH9A 4LQ1A 4IUGA 6TAAA 1CDGA 1FA2A 2XTKA 3TTSA 1BF2A 3BC9A 3AYSA 1FFQA 1E5JA 4R27A 2WHJA 5C70A 2DGAA 3LPOA 1UD2A 2GSJA 4S3JA 4J3VA 5A2AA 1PX4A 1PAMA 3W25A 1E6XM 3RJYA 4HZ8A 4W85A 2QHAA 4JFVA 1RH9A 5A8PA 2DT3A 2OLHA 4K68A 2QMJA 2BVTA 1DP0A 4P7LA 3DX1A 3CUJA 4TX6A 3AHTA 1OCQA 1W9PA 2UY5A 4AZGA 1HL8A 4YHEA 5LYRA 3WDPP 3LXBA 2EBNA 4PSRA 2EXOA 4CD5A 2XFRA 4AZ6A 7TAAA 4EANA 4QAWA 3AZRA 3KWXA 3NJ3A 1J0IA 2Y4SA 4LXFA 5EBAA 3DHPA 1OD8A 3MO4A 1B2YA 3B9DA 1JDAA 4AZHA 1HT6A 2X8RA 1GCYA 1E72M 3EDJA 2WNWA 1DWAM 1R46A 2XJ7A 4Z2GA 3W29A 4AMWA 3W6MA 1J0ZA 4HOWA 4CU6A 3BUQA 3H55A 1E6QM 3T2PA 5A6MA 4JFSA 3JUGA 3OLDA 5TD4A 3GXIA 1K9EA 1OWQA 1XCWA 2V5CA 5CSUA 1MW0A 4TUFA 2A3CA 3EDFA 2WW5A 3GM8A 3OG2A 2YDRA 2FHFA 1EIBA 1V0KA 3BMWA 1EXPA 3MUIA 2YOCA 2F7PA 1ITCA 3FW6A 4PTWA 3PN8A 3FHQA 2G3NA 2NT0A 1HKIA 1UD3A 1I75A 1BTCA 1C91A 1EDQA 3AROA 1ZBWA 2PBOA 4GINA 1G5AA 4W5ZA 1VEPA 4HA3A 2FGZA 4M24A 4UQ9A 1OGSA 1MQPA 3WY1A 1JAEA 1UH4A 5I77A 3TTYA 5A6JA 3WUEA 4UNIA 4D6EA 1X6NA 4GKLA 2G3JA 2XM2A 2WMFA 1ZJBA 3FY1A 3N9KA 2JF7A 1H5VA 2W66A 3T2OA 4F66A 3AS2A 2XSAA 3A47A 1JYWA 4H2CA 1UWTA 4FF5A 1JZ5A 1E6RA 2FH6A 1HJVA 2X2HA 1CGXA 1XH2A 1DWGM 4H8VA 3WQWA 3APGA 2XVLA 1CGTA 5HXMA 3DHUA 3VILA 2GJXA 3O6AA 3EDDA 4MPKA 3IGUA 4BCEA 3NSXA 2D2OA 1GQLA 2Z1KA 3UESA 5JBEA 2EPNA 4OOZA 3BVTA 2WAGA 1TR1A 3BUIA 4OGZA 4OIFA 1G01A 4E8CA 4BQ2A 4MDPA 2CBIA 2YL9A 4AEEA 2CEQA 1K9TA 1CXFA 1AMYA 4RE3A 3SCUA 3A4WA 4DO4A 3WFZA 3WUGA 1FH8A 3GXDA 3F5JA 2XPKA 5LA2A 2VCCA 4IM4A 3LRKA 1L8NA 3DDGA 3OA5A 4W88A 4F9JA 3UERA 3WD2A 3WMSA 1QBBA 3AIQA 3VD4A 3VKKA 4CGTA 2WMHA 3LX9A 2J62A 2VVNA 2JEPA 2W92A 5ABEA 1V03A 2VUYA 4GPNA 1UYQA 3PZOA 1BVZA 1QVBA 1GORA 5AYBA 2PWDA 3VX1A 2PC8A 4W84A 3EJQA 2OWWA 5E9AA 1FHDA 2VT0A 1LG2A 1U30A 2ZX8A 3HZ3A 1EQPA 3MSGA 2XWDA 1OM0A 4U5KA 1B3WA 1WZLA 2WMKA 1H0GA 4HOZA 4DWSC 2WCSA 2YFNA 1Y7VA 3MV11 2D0HA 1TQUA 3PZNA 1ITXA 1GHSA 4FLRA 1W2PA 3QHMA 4P8VA 1F4HA 2JEQA 3MS8A 5BXPA 4MB3A 3PTKA 3EDKA 1KXHA 1PPIA 1NOWA 1R7OA 3ZT7A 1D3CA 2VZUA 3I3BA 2J8GA 1TE1A 4OUEA 1NQ6A 1GW1A 1H41A 2A3EA 5I0DA 1CGWA 4UQEA 3VIGA 4UFJA 3VM7A 1UASA 2DDXA 5AYIA 5I6SA 2GDVA 3D50A 3MMDA 3SCSA 3WBAA 4MDOA 3KLLA 2J77A 4P8XA 1NWRA 2VL4A 1EHNA 2D22A 3QR3A 5JUVA 5IHSA 4URIA 5CLTA 4NRSA 3VIMA 2F1BA 1EDGA 2OSYA 1UWQA 4F8XA 2YIHA 3LRLA 3VDCA 1L0PA 3A22A 1JZ8A 3TTOA 4AD0A 4Z2JA 2VRJA 3ZOAA 4NF7A 2DIJA 5A6AA 3VGFA 2DH3A 1CLVA 2EJ1A 1B3YA 1BGGA 1LG1A 4CU8A 2J74A 1WDQA 2Y8VA 1H3GA 1B0IA 2CIPA 2HVMA 3MUZ1 1GJUA 2XUCA 1JG9A 4LYRA 5D8ZA 5I79A 3AZTA 1AQ0A 2OSXA 3T2QA 5BYWA 2WZEA 4QCEA 1WZAA 5A8NA 3LPGA 5GNYA 3W6LA 2VMFA 2F1AA 2FH8A 1E15A 1CXIA 2J7HA 3WH8A 2QMKA 3ZT6A 2D24A 1PZ2A 5A6LA 3WIJA 5EFDA 1DWHM 2VVSA 3ZSSA 1M53A 3VIPA 2X1IA 3WENA 3AI0A 4ZE4A 1XV8A 2V3EA 3SUUA 3FHAA 1BYCA 2F61A 3A4AA 3EJTA 3DDFA 3N18A 5IXEA 2VRKA 3TA9A 1NOUA 1HF6A 1E6NA 1BHGA 1ESWA 3EMZA 2WCGA 2VURA 2V3GA 4H8HA 3AS0A 4FLQA 3VSVA 3I3EA 4JKKA 1EGZA 2CHOA 2CHNA 1OB0A 2BVDA 1V3MA 3RO8A 2ESCA 2VX5A 2G41A 4BQ5A 4UQBA 5D8WA 3BAJA 3OLEA 4CD8A 2YL5A 4QFUA 1R34A 1EDTA 2XVNA 3THCA 3QHNA 3LXAA 4MAVA 3BLKA 2WSKA 1BPLB 2CPUA 3D4ZA 1HTYA 1HWWA 4PRWA 2OYLA 2JF6A 4HA4A 2XN0A 2ZUTA 4TTUA 1P6WA 2QPUA 1BVNP 4AIOA 3ARWA 3W26A 2C7FA 3AIBA 5CSYA 1UUQA 1FH9A 4GZJA 1KWKA 1UD4A 2BHZA 1UKPA 1UA3A 3SEPA 3NDZA 2PWEA 2ZIDA 2OYMA 1QW9A 4J3SA 1ZU8A 4MNLA 3II1A 3MU7A 5EB8A 3OLIA 1B1YA 4UTFA 5ABFA 3VD3A 3B9AA 4PUDA 1WDRA 5D9MA 3EJUA 4YN5A 3T08A 1JF6A 4J27A 1MW1A 3AZSA 1JZ2A 2NW0A 4JKMA 4TX8A 3MANA 3T0AA 1VFFA 1C7TA 4BA0A 3VIFA 2WMGA 5AC5A 1FH7A 2ZWYA 3NDYA 3WMCA 4Y7EA 3W4RA 2WSPA 3W37A 3S5YA 3WY2A 2ZX5A 1ODZA 2WBGA 3WNOA 1CTNA 4QLLA 4J3XA 2ZUWA 3WQ8A 4V28A 1ZBVA 1Q6FA 4J3TA 4D71A 3GBEA 3NIYA 1Q6GA 3E1F1 1HVQA 1MVYA 4RL3A 4U31A 1NM9A 5BXSA 1VBUA 2YLLA 1U2YA 1VF8A 1KGXA 3AQUA 4D6JA 1SYTA 3A3HA 1SMAA 3HJEA 3CZEA 3PZGA 2GK1B 1QNQA 3ZJKA 1NP2A 2EACA 4PTMA 3F5LA 3POHA 1DWFM 3GYCA 4PMUA 2J79A 3MMWA 1LL7A 4AXNA 4KGJA 3U5YA 3ARRA 1W9VA 1A47A 1B3XA 1OGGA 4AC1X 1QHZA 1HP4A 1KR1A 3BH4A 3VPLA 4BZYA 3CO4A 1VAHA 4W5UA 2CETA 2PWGA 3ECQA 2XHYA 4DWSB 2WC7A 1ISVA 2BY3A 3RM4A 2XVGA 2EPLX 2F18A 1LJYA 2XFFA 1FOBA 3T0DA 2DSZA 2G4FA 1AQHA 1E4LA 2BFGA 1O7AA 3VGDA 2WZHA 2VR5A 1VJZA 1Q6DA 3IAPA 3WH7A 1C8YA 1CWYA 2A3BA 3IJ8A 5E1QA 3UETA 1LF1A 1XH0A 2XYLA 1KGWA 4P7NA 4RE4A 5DEZA 4W7UA 4AD5A 3UCQA 3AXXA 3BVXA 2RGMA 1KB3A 2YDQA 1QI3A 1KBKA 2WK2A 1JYXA 4N42A 4BS0A 1WZKA 4B16A 4J3UA 1GONA 1W2VA 3VU2A 1E3XA 4JKLA 1EOMA 2DSUA 1W9UA 2YJQA 3DX2A 2JIWA 2XIIA 3GBDA 1RPKA 2C0HA 3PZTA 4YHGA 2J7FA 4OOUA 1J11A 1WCGA 3AXHA 3WL0A 3HMCA 3EJRA 4GI9A 4NXKA 2J8FA 4ZXLA 5A6BD 1X1NA 2V5DA 3AYRA 3W38A 1BYAA 3L4UA 1TZ7A 4JCLA 4CUCA 4PEEA 3OB8A 3K8KA 2VX6A 1UKQA 1B9ZA 3D5HA 3BMVA 1MW3A 1W9DM 4J28A 4W93A 2YDSA 1E0XA 8CGTA 2J78A 2WMJA 3POCA 5FL0A 1WAWA 4D72A 2ZE0A 3D3AA 4QCFA 4W7VA 1E55A 4AMCA 2CBVA 3ARSA 3TTQA 3OZOA 1HKKA 5FL1A 4A3HA 4PCTA 3QHOA 3OGRA 1FFRA 3WF4A 3DYMA 4D6FA 7CGTA 3M7SA 4AZ7A 3ALFA 1CGVA 1Q6EA 5BRQA 4HU0A 2PB1A 5A1AA 3SCPA 3UG3A 4C7DA 1VFMA 3VIIA 1HXKA 2YA1A 1V6WA 3W53A 2O9PA 2XSBA 3VMPA 3CZ8A 3HU7A 4BQ3A 4FK9A 2OW6A 1J10A 1CECA 2VCAA 1UR1A 4FNSA 3BLBA 2ZX7A 4FMVA 3B9EA 9CGTA 4WKFA 2PBGA 2D3NA 2YA0A 2DT0A 4ACZB 1WDSA 3IJ9A 1WKYA 4X0NA 3WD4A 3WMBA 3MUAA 3DX4A 4PTVA 4JFUA 1ZBKA 3A24A 4KRUA 4B3KA 3CZKA 4PMOA 1ZS2A 4W7WA 4GI6A 3GH4A 1JFXA 2V3DA 3U57A 4BQ4A 3N1AA 2VJXA 4AZ5A 5E6YA 3VSUA 2WVSA 2WANA 2CNCA 1F4AA 1CXHA 2D1ZA 1E1EA 4EE9A 4M1RA 3AIVA 3RDKA 4EAMA 4CCCA 3TONA 3ZR6A 1DWIM 2VRQA 2DPEA 1XYZA 2WC4A 2W62A 2G3IA 3U7VA 2YLAA 1GUVA 5A6KA 3PZUA 1LWJA 2OWXA 7A3HA 2QLYA 4MB5A 1LWHA 3PTQA 1JI1A 4WSJA 8A3HA 3WEMA 3CHEA 3VMNA 1B31A 1E56A 3WDRA 4MNMA 4MJ2A 4ACYA 1SR0A 4AWEA 1UD6A 5ABHA 1JDDA 4TVUA 4L4PA 1RD6A 1QOXA 2VX7A 1R33A 1E70M 5BWFA 1QWUA 3GNPA 1W91A 4PMRA 2CYGA 2D0FA 3VIJA 1W3LA 3BVWA 3BXWA 1MFVA 2X05A 2A3HA 4UOJA 2CCRA 3AMCA 1Q6CA 1CXKA 1C7SA 3ARTA 2CKRA 2E8YA 4AYSA 4PCSA 2E9LA 1TQSA 4DO6A 3HG5A 1E71M 4AD1A 5CXPA 4QDMA 2BHYA 3BUPA 1E5NA 4KRTA 3BGAA 2W63A 1W32A 1DHKA 3THDA 4CN4A 1KXQA 5E09A 2X2IA 4FNPA 1M01A 3CUGA 4QLJA 2YKKA 3MI6A 2UY3A 2XWEA 4IPLA 2JIEA 3ZJ8A 2CXGA 5DO8A 5BROA 3AIEA 1B3ZA 2BY0A 1OIFA 1BYDA 1HKJA 1NWUA 3GXMA 3IK2A 2EO7A 1TVPA 4UCFA 3GXTA 3OBAA 4U33A 5FD0A 3ZIZA 3VIHA 3VO0A 1R8LA 1E6PA 2XFYA 1IZJA 1BAGA 3L4WA 2EABA 3SIMA 2FYVA 2YFOA 4W8LA 3AMKA 4MB1A 1O6IA 1EO5A 3PZ9A 3QOKA 5M17A 1W1YA 3MUY1 2W4XA 1ZJAA 4P7OA 1CYGA 2ZXAA 1PX3A 3BAYA 1QNRA 1CXEA 2ZXBA 1E6SM 5A2BA 1T0OA 4ATWA 1GZJA 5D4YA 5BRPA 1LQ0A 3VDHA 4H41A 4LGXA 1W9BM 3RPMA 1H1NA 3HG3A 3N12A 3AS3A 4WF7A 1LL4A 2BXYA 1E43A 2GK1A 5FIPA 1E3ZA 2WVVB 4WJXA 1ISZA 1UWUA 1TVNA 2WKGA 4Z2IA 3HN3A 3J7HA 1J0KA 1E4IA 2E40A 5A6SA 1V02E 4U2YA 1KXVA 2BS9A 4KMQA 4NZJA 2EADA 4W87A 3GH7A 2CERA 2D20A 3ZM8A 4PMDA 3RIKA 4HMDA 1UR8A 2CBUA 3RJXA 5CJ5A 4DM1A 1OT1A 3N17A 2YBUA 2WZIA 3LMYA 1YQ2A 3WKZA 4DWSA 1TA3B 1UR2A 3WELA 3VGGA 1TQVA 3VD9A 3GXPA 2O9RA 3H53A 4EK7A 3N13A 4D1IA 1JAKA 5HPCA 1VFUA 1W3JA 1JIBA 3MKKA 4ZXOA 5I5RA 4PYSA 3DYOA 4AZBA 1PS3A 1GOMA 1MQRA 1TUXA 2ZXDA 2VX4A 3CMGA 1PIFA 3CTTA 2ZICA 3A4XA 3PZVA 1UH2A 1VENA 5I3DA 1VRXA 4U5IA 2D23A 1G0CA 1JZ4A 3GTNA 1CPUA 2J47A 3O9NA 5E6ZA 2EPOA 1UH3A 2WBKA 1E40A 1QPKA 4P8WA 1H49A 2F7RA 1SMDA 5IFPA 4AY1A 2DSWA 5D9PA 1TMQA 1XHGA 3G6LA 3IJ7A 4PMZA 3ZT5A 4D6GA 3G6MA 4TTGA 1EO7A 4V2XA 1QBAA 4OZOA 5FOOA 3WNMA 1JNDA 1IV8A 4JZ5A 3K8LA 5C71A 4LYPA 5HBFA 4MJ4A 1UWSA 3S6TA 1KXTA 1XYFA 1J0HA 4NX0A 1JFHA 2YA2A 1H2JA 1QX1A 3BAIA 5JBFA 5JBDA 1JNEA 4ZE5A 1V3KA 4XUYA 2O92A 1HNYA 2ZUSA 4NXSA 1W3HA 1V6VA 1D7FA 3RM9A 4AYGA 1I1XA 1J18A 1X6LA 2Y24A 2OWCA 1JF5A 4TVCA 2J7EA 5DT5A 4HMCA 3WQ4A 2WLYA 4JHOA 3A23A 3VD7A 4L4OA 2DH2A 3GXNA 2ZUMA 1JD7A 3BSHA 4FLSA 3VGBA 4TOQA 1DTUA 4HPGA 5EMYA 2IXVA 3CHFA 1DWJM 1GOQA 4JFTA 5DF0A 3SUTA 3WD0A 3U5UA 4A4AA 1V0LA 1FP8A 4H04A 1JZ7A 2WVTA 4M56A 2VO5A 5D9OA 3WD1A 4Z2LA 1NWTA 4U3CA 3PTMA 4WIWA 3M46A 2VZTA 4PMQA 5GNXA 3VINA 3F4VA 1QNOA 1UKTA 3BAXA 4NRRA 2PWFA 2WLZA 4W89A 3AIUA 1MXDA 3S5ZA 3QOMA 4FLOA 3WL1A 3ZO9A 3AIRA 4CCDA 2WYSA 2O9TA 4LPCA 3WN6A 3B8SA 3KZSA 3A6OA 5DT7A 1RP8A 4CU7A 1EA9C 2XN2A 1UHVA 2WMIB 3CBWA 1V02A 2XIBA 2WM0A 2WVUA 1QI0A 1TG7A 3WSUA 3CUHA 3MV01 4PMXA 1ISWA 1K6AA 2GFTA 2FGLA 2VNCA 1UQYA 2VZSA 4DM2A 4B9ZA 4MADA 1JYNA 3CC1A 1XSKA 3T0BA 2WWDA 1K9DA 2PF0A 1W1PA 1UOKA 4X0VA 4AZIA 4ZEPA 1BGAA 5ABGA 1GQIA 3WH9A 1R7AA 1CIUA 2DSKA 1BG9A 2X0YA 2WHMA 1NARA 1KGUA 3L4ZA 1PX8A 1NWSA 3VTRA 2X09A 4J3WA 1G94A 5BXTA 3O2LA 1EOKA 1WO2A 1HJSA 1UZ1A 1J0YA 4FNUA 1EH9A 4WLCA 2TAAA 3K46A 1R86A 1W3KA 1ZB5A 1GJWA 1GVIA 1SZNA 4GI8A 3AXIA 4LYQA 3RCNA 1HJQA 5GQBA 1HJWA 3WUBA 3H54A 2VC9A 1KWGA 1ECEA 1C92A 2WHLA 2RGLA 4GXPA 5E0CA 1JXJA 5I24A 1NOFA 3WEZA 1HJXA 2CITA 4KGLA 2BY1A 2B31A 1XD1A 1UD5A 6CGTA 3KE0A 5EFFA 1KFWA 1PIGA 4Q7NA 2FHCA 1E73M 1U33A 4HMEA 1S46A 1J9YA 4PMYA 2DT2A 4FNTA 5M5DA 3NSNA 2DQXA 4M80A 1XGZA 2NT1A 2WHKA 4CD7A 2NSXA 3VOCA 4EKJA 2EEXA 3ZQ9A 4DWSD 1UR9A 2YL6A 1ODUA 2W91A 2WC3A 4DUWA 2WXDM 4E8DA 2FHBA 3FAXA 1BLIA 4AD4A 5ECUA 1CGYA 3WDQA 1VJSA 1UR0A 4OBSA 4UFLA 2YBTA 1BQCA 1M7XA 4UFIA 1CZ1A 5KZ6A 3UG5A 5A3HA 4AZCB 4OBRA 3BUDA 5CG0A 4PMVA 2Z1SA 4NI3A 1WDPA 4AIEA 5BXRA 4Z2KA 4H8UA 3FAWA 3VNZA 1B90A 4HZ6A 4NZFA 3K4DA 4CKQA 1HXJA 1US2A 1UWRA 1KCLA 3SCNA 2WVVA 3WF1A 3N15A 4CVWA 3AHVA 1HKMA 2CBJA 3ARYA 4TVDA 1WZMA 3AS1A 1AVAA 1GOKA 4QP0A 5I78A 1TQTA 4UQAA 1QI5A 3CZSA 3SCRA 3FN9A 5E70A 4AD3A 2AOSA 4XB3A 2V38A 3VDBA 2JE8A 2PI6A 3AOFA 4CN1A 1TA3A 2UY4A 5HOSA 1CXLA 4HZ7A 1QNSA 4RE2A 3NSMA 1GVYA 1CNVA 2ZUVA 4M82A 3FXYA 4ATDA 5M03A 3EDEA 3PZQA 2WCAA 1R75A 5DFAA 4PUEA 5HDRA 1JI2A 3PZIA 2Y2WA 1M03A 1V3HA 1GOOA 3RMEA 4CD6A 1XCXA 4UFMA 1HIZA 1MYRA 2E8ZA 1UKOA 2VI0A 4UR9A 1ISYA 1E6ZA 5BCAA 3T09A 5ABFB 4J7RA 5CPTA 2J7DA 1O7DC 3WF0A 3TOPA 2DEPA 1ISXA 4DUXA 3DYPA 1KBBA 5CPSA 2QPSA 2DSVA 3U7BA 3BCFA 3VNYA 2IUZA 2Y8KA 4D6HA 2JALA 1H11A 4KH2A 1IT0A 3CIVA 3IAQA 4UZUA 2OSWA 2VR4A 3GDBA 2EAEA 2AMGA 2ZWZA 3WF2A 3WNPA 3WF3A 1FHLA 2BNJA 1OINA 2JFEX 3D51A 1J01A 2VZVA 3L4YA 5JIWA 3A5VA 1VBRA 2CESA 4FNRA 5FCZA 4D6CA 1XD0A 4JIEA 4PSPA 3WY3A 3EBVA
chains in the Genus database with same CATH superfamily
3IWVA 4X6EB 1L2QA 5LVEA 4WTXA 2QCNA 5BQDA 4LVEA 1TMHA 1J5SA 3LKRA 3QUKA 1I8KB 2C9RA 4JFZL 4LPYA 3CSPA 5J1TC 5LJYH 1IGSA 2LTQC 1KCKA 4WY7L 2YC1B 3WYRA 1KSRA 5EU6A 2BVWA 4OM1L 1X8CA 1YYCA 3STGA 3WDHA 3Q8EA 1I1FB 2RTTA 1Z5HA 3FB6B 2R0ZH 4RESB 2V3FA 4AH2A 1TRIA 3QUML 4NNPH 5DVOA 4C83B 1XL9A 4OLEA 1ASOA 5E2UH 5D7KE 5L9DL 3CPRA 2X16A 1QWNA 3LSOA 4FXSA 5HGDB 2H2PD 4POZC 4QEGA 3PQYE 3FYYA 1DANT 25C8H 5HHMD 1DQJB 1QK0A 2Z8SA 2LFGA 4GG6E 5KBKA 4EI0A 1UT2A 1IE4A 2H6PA 1H15B 1E2WA 3UTTB 1XQ4A 3EMQA 2EDFA 4FALA 4XG1A 3E9UA 2VDOL 4AE1A 2NQ9A 1MLBB 1WXZA 3L4VA 4X0KB 3MJGX 4YFDB 5B8CC 4A2DA 3OR7B 3QRHA 4E2OA 4QHRA 4HPYL 2OOFA 3S36L 3KCWA 4GUOA 1I1AA 2XG9A 4OKVB 1ZLSL 4GO6B 3MO1B 3KLQA 4PV8A 3QHZH 5FUZL 5C8JA 3KM8A 3EJPA 2K9UA 2PDGA 3C8FA 4D0DA 4A2RA 3GZAA 3P73A 1YPXA 5J12C 4F7MA 1H5BC 5KANG 4PBGA 2QGCA 4K94H 4X4ME 3AAMA 1BXVA 3EA2A 4NJGA 3IGHX 1KTDA 1TRDA 2EDHA 1FNFA 1TZGL 4K0OA 1IBZA 2OGJA 2VITA 3AC0A 5FJTA 3UJTH 1ZENA 5BUGA 4M5YH 2PDMA 2UZYA 3CVDA 1I9RH 2AL2A 3WNJA 2CZDA 5HWJA 2ZZ1A 3GG0A 5HJDA 2VR6A 1JGLH 2ZUNA 1UXSB 3F7JA 4U1IB 1YUHA 2VO8A 2X1SA 3BD4A 5IFTA 3A21A 3FQ2A 1JPSL 4Q8MA 4KWSA 2XX1A 2QYGA 3T4AB 1V0NA 3F2CA 4WCYL 4KXZI 4BHUA 3AUOA 3TL5A 1ALDA 3NCOA 4TX9A 4Y2DC 4N2EA 3AISA 3VU1A 1PCWA 1ES0A 5HQEA 4DOHB 3SCTA 1MFAL 4NWUL 3ETBJ 1V3IA 4XBEH 3WMQA 3O05A 2JJWA 4P05A 4DKAA 1Q9OA 1PL3A 4ZDHB 1RHFA 3PIQA 4UDUB 3NIFB 4BKLB 4NUQA 1AANA 3NJGA 3NPUA 4HKPA 3QPYA 1OW0A 1AZZC 4N9BA 1OYAA 1LRQA 4LCWD 4BM7A 2EDBA 3WBXA 5AEAA 2FQGA 1KTRL 4B91A 5F6HJ 1C90A 5F9WB 4HSCX 1UKSA 1KCSH 3TBVB 4I5RA 2GIMA 1AZ2A 1OP9A 2G4EA 4EXKA 4PLKC 1KCWA 5C2GA 4AYBA 4FLHA 5DR5L 4B3LA 2FZ3B 3LXCA 1BBDL 4K2SA 5GGSA 4Y96A 4NP9A 1OGTA 4OLZH 4UU9B 1JXKA 4XVSH 4RGNB 3CAQA 2UVEA 3ABXA 1XBDA 3DH7A 3WYZA 2V2TB 1QUMA 1JNJA 2WPGA 4FJYA 4ZXBB 2YXXA 3BAKA 4AAJA 5KJRL 1NLDL 3DX0A 3ASNB 3GLCA 5D93B 1UZHA 1CDGA 4HZ1A 1M2VA 3GEWB 5L4JA 2BHFA 2VC2L 4JFVA 3NNTA 4Z7NE 1XRSA 3O2VL 2VN3A 4N6RB 2GEEA 3N55A 1I1AD 1DXFA 4F0HA 5CJ8A 3SE6A 5DFVC 4G9PA 4ZBJA 3WFAA 1RCYA 2QGHA 2QHRH 3VYOA 4F91B 2Y4SA 5HHVL 1BXCA 1HT6A 2VLJE 1OM3L 5J0BA 1DWAM 5C0NC 5PCYA 4ALAH 1G4MA 4CU6A 3K5SA 4Z7WE 3P5YA 2V5CA 4Y4FA 1CT8B 1EAQA 3KPMB 2MPAL 3GM8A 2Y61A 3ONCA 2YAOA 2PDBA 4HXAL 5HY9A 5DEFA 2FSEA 1ZCOA 2X30A 3RE0A 3GUFA 1N0LB 2UZIH 4O4VA 4GCAA 2IGFH 1K4DB 3HFMH 1WH0A 1SUJA 4M1DH 1H6EA 3WUEA 2X4TB 3VI4E 1ZJBA 2R2HB 3GRGA 3A47A 3C2SA 3GK8L 2GI0A 3RN6A 3B34A 2FH6A 2DZAA 5BU9A 1U4FA 1A64A 1T89C 3Q48A 2HK1A 1S78D 3QK0A 3MZGB 3SDXB 3QBTB 1CQKA 3WL9B 1A6TB 4OIFA 4Q32A 4GRSA 4O50A 1TKKA 4MDPA 3SZKC 5EN2A 3LEXB 5SV3A 1I3UA 4F1SA 5TQLA 1EAPA 4ZS6D 3FU0A 4KZDL 1QMLA 5LA2A 3PV6B 3MXWL 1NC4D 3OA5A 3TV3L 3LTSA 4Z6AT 3SYOA 3QJTB 3LJ3A 2ZOUA 2W92A 4QHUA 3HLAB 3CLMA 3PG2A 4GXVH 2INEA 3QV7A 4DAGL 4AQAB 5D2LA 4AEHL 1OEPA 4C4BA 5HYJA 3WFEL 3ZTDC 5FGRA 2WTOA 2WXGA 4QHMA 1B3WA 5CZVH 2Z0BA 1KB9K 4JPVL 3I6RA 3H9SA 4FE9A 1PHWA 4PW9A 4FLRA 4Z7VA 1JZGA 4HH9B 2FX8H 1V7YA 1MJJA 4PI0A 1PPIA 3QLLA 1R7OA 1XCFA 2VZUA 3WLQA 4JHWL 3ZTEA 4N0CD 3P1VA 1C9SA 1NMCC 4WKXA 2O30A 4M6NH 5J89A 2OL3H 3VM7A 1A5AA 3LTVA 4FSAA 3UXFA 3NAVA 4YDJA 3MJ8B 1J96A 4RAHA 4FG6C 5FYKD 2P3EA 4AL8C 3VIMA 3CLEH 2OSYA 4F8XA 3B05A 3D1MC 2RCSL 1DIKA 3UTSA 3QNFA 2KI6A 3L17A 4IP4A 5LBSL 3CH8A 3K0YA 4RGOL 1W2KT 5FSDC 3BG5A 4WU5A 2DQJL 3DK2A 1G4SA 1ONXA 1TIWA 5BYWA 3CK0L 4GKTA 1VPYA 3UZYA 4N2HA 1EDHA 4QEEA 2OMYB 2XU9A 3WH8A 1FCCA 1ITUA 4DKTA 4YLBA 1LE9A 2A1YA 1MCWW 5FA4B 1KEMH 3AI0A 2CGZA 2DD8H 2F38A 1RI8A 1TJHH 4I0CC 3SY0A 1NOUA 3ATEA 2OQYA 2PXYC 4F57H 2WCGA 1XR9A 2ZG3A 3WJZA 5KYUB 4NNBA 1CLYH 3Q2LA 1VCGA 1HDMA 4LEOA 4JIHA 2G95A 4CD8A 4QFUA 4RWYH 4X6CA 4HGKC 4N6QA 3QA3B 4E5XA 2ADIA 2CDEA 3ZTJG 2XN0A 2ZUTA 4GH7B 4ANKA 2H3NA 1BGXL 1BBJB 3DX9A 2DZUA 1KC5H 1MNUH 4N8PA 5CLXA 1Z0MA 3B9AA 2FZDA 1SJHB 1OX5A 3CN4A 3JVAA 3PWNB 4LNVA 5AC5A 4ETQA 1NUDA 1CTNA 3WQ8A 1BQ5A 2CLKA 3W85A 2AVFA 3EXSA 4G7SB 3GBEA 4O02A 4PGEB 4IJBA 3ULAB 3QEQE 1R38A 4UDTB 1CD8A 2W60B 1SMAA 1BKSA 1NEUA 4M93C 1QAWA 3KWSA 4IHOA 3PYCA 3GYCA 3KBFA 3U6XS 2AK4E 1FYTB 4KTEH 3DG7A 4XP4H 1E4KC 3H9SD 3LS5L 4PRHB 2WZHA 4MF4A 1Q6DA 5T91A 3FO0L 1XR2A 5GISL 3LI0A 5EA0L 2RIKA 5SX4H 2GUBA 4XPHL 5C09A 5B3JE 3UCQA 2IPGA 3M86A 4M5SA 1A6PA 5F3BA 1KMGA 2CZ5A 2APXA 4H26A 5GIRB 4QG8A 3C56A 1X6UA 2J7FA 4F7EB 1GEHA 1QR1B 2DQEL 1KJ2H 1QZNA 3O8XB 2V7NA 4XNXH 1JHTA 4G59C 2WQWA 4MS8D 3TVMC 2P88A 4NDMA 1L6GA 1JPHA 3AYRA 5GRYA 3UTSD 3NABL 5JOEA 1KIPB 3TZVC 2FT7A 1IX2A 5EHFA 4Y7MA 2OCFD 2X44D 4OFVA 2A7NA 3L4CA 2R7EA 3V4VB 4W7VA 3NIGF 3D69B 2H5UA 4FJZA 4NC2B 2R69A 3ULUE 1M57B 1N4XH 4JY6B 4MNQB 4QRTB 3X1FA 1MUCA 2EXYD 4WDIB 4TR9A 3EB2A 1EERB 4KPHL 2Z2BA 1G6RH 2N1KA 3QQDA 2J5WA 2X89A 4TIMA 3ZN6A 1VF5C 1B9BA 4W7WA 4GI6A 4C56A 2HLFD 1F1DA 5L4FA 3FQNB 4U1SB 5EC1B 5DVLA 2FSDA 1REQA 2BNUA 2NY0C 3ECBB 1UBPC 1BVLA 4EIBA 2Q7YB 1WDAA 2G3FA 3GAKA 1LWJA 2HB0A 4M8QB 3PZUA 2VERN 2Z1XA 3JYCA 4L1LA 5A7EA 2N4IA 4OZFG 1GRWA 5AAMA 3H9ZA 3IJDA 2J88L 3K1KC 5D04C 3FO9A 1MI3A 3HBQA 3QQ4A 3B8IA 4H2HA 3EGXA 2AFNA 5DGQA 1AZCA 3S88H 3W23A 5LQBL 3SDOA 3D46A 1CXKA 3QZWG 1XGRB 3ULUH 2DBJA 4FZ8L 3V0GA 2PRLA 2CMRH 2ADJA 4QDMA 5IVXA 1QSZA 2PRHA 3BGAA 4H6QA 3PBUA 3UWEA 1KXQA 2CKBL 4GKZB 3N9GH 3K13A 3KBWA 4W9TA 1NIFA 3V7PA 4PODA 5I1IH 4D8PA 3W11D 5MERA 3D12B 3EPNA 4BSVA 2ROXA 1LO4H 1RQHA 3CVHL 4PJFA 4WI9A 3FSUA 4LCIH 4GSDL 3JTTB 1NAMB 2K8QA 1W0YT 2YFOA 1TTUA 2B20A 3UYPB 2EE0A 3FFSA 1PWMA 4P7OA 2A4ZA 4L5FH 1UGNA 4AYMC 1PNCA 3BE7A 5MF5A 1RUQH 3IS1X 5D4YA 3GHEH 2JQXA 5C09D 4DPBX 3BPNC 4XAZA 3QWRA 3AS3A 4U1NA 1T1WA 3Q3GA 3N91A 2WTRB 2BXYA 4Q4KA 4G5ZH 3DOSB 1E3ZA 2NCEA 1TVNA 3OXSA 2PTDA 2FFIA 5JHMA 2EADA 4Z78B 4WFFD 2NY3D 4J5NA 5CC5A 4PMDA 4JO3H 3GB7A 1IF2A 5JO5B 1HH6B 4AJWA 3TYDA 2P8MA 3UJJL 1V7MH 1XHHA 1RUMH 5K93A 3NTCH 4CC4A 5I3DA 3O6FA 2ZE3A 3VVWA 5KVMC 3H3BC 3IJHA 1XYAA 4IMLB 4NZUL 2DVXA 1AIFB 5IFPA 3HE7B 3R4DA 4NUWA 2IO5A 4TQPA 1W72L 1XHGA 1KKOA 4F2BA 2RFGA 4IIEA 5IHBA 2AP2A 1TNMA 4XOCA 2Y7QB 5I66B 3K8LA 1L9RA 2WBJB 3L13A 4NOBA 5C0AE 1OFAA 2OZ4A 2E1WA 4Q9QH 1ZSDB 2OI9B 2JCCF 5GZOD 2ED8A 4XAYA 4JFHD 3IDIA 5AUMA 2O92A 2BIMA 1OCCB 1W3HA 3MRRA 2IQDA 3L68A 2ITEA 1I1XA 1MFMA 3G3LA 1NFBA 3RWEB 2DWEB 3CFKB 4CVXA 4ISVA 2PDLA 1JD7A 3RIAF 2PU0A 3DJRA 4JFTA 3GIVB 4U7KA 2CD0A 4LE8A 5KSVA 1RZGB 4PGLA 1FP8A 1SDAB 2IBBA 2P7TA 5D9OA 4LAKA 1MSSA 1PYWA 3KPLA 2WPBA 1E4XI 4LU0A 4ZPTA 3UWUA 3TSDA 4AY0A 2DUAA 4YJ5A 4HBCH 3D9AH 4JB9L 4P2OA 2Y07L 4CCDA 4YAQA 4JN7A 4LPCA 1KFKA 3EWBX 1TX0A 9PCYA 4PJAE 1TG7A 1QXLA 2Q86A 1FL5A 3WQGA 1RK1A 4JS3A 2TSAA 1GHFH 3KPQA 4B9ZA 3U7WL 4HJFA 2HG5B 3U7YH 4JIIX 2GJZB 1MPAH 3NCCB 4ZTOH 1G7IA 1A3LH 1R7AA 3AB0C 5EIIB 4QOKA 4JQAA 2BDNL 4WWKB 2EIKB 1BVNT 1JPMA 1JUKA 1KA9F 2W9MA 1QRND 3WG6A 4GIEA 4MHHG 1OB1A 5DRNB 4GBXA 3UT0A 1Q90A 1TETL 1FNEA 1PZ0A 3NJIA 1OOWA 2GGGA 4EIGB 3BYTA 2QT3A 1SM9A 2D9QB 3QWRD 4AY8A 3JWDH 4NB7A 3L5JA 4PVNA 1FVEA 2J6EL 2B31A 1Y0LB 4C6MA 3GSNH 2EVIA 3R12A 4R96B 32C2B 3PUOA 2W0KA 4DKEH 4C5ZA 4DUWA 4O8AA 1QVOB 3BCJA 4IU2A 4FFZL 1KPUA 3MLXH 4WJ5B 1ZTXL 2G9KA 3HRZA 4IGBB 2OCJA 2VDKB 2CIKA 3O6FD 4FX8A 1YEKL 1O7VA 2Z1SA 1ZLPA 5HGHB 3W0WB 3NVQA 1NSNH 3TBYB 5GGUA 1JPST 4HAFA 4TTDD 3AHVA 3ENEA 4BCXA 4JD4A 1AVAA 2W9DL 1Q8JA 4CA4A 1ESOA 3UXKA 1F8MA 5CF3A 4UF7C 2CXKA 3PWJA 4L7ZA 1TA3A 3OZYA 1BFVL 3MRNB 2AGJL 4P07A 2WOBA 3KOYA 4IW4C 2HUEA 2GC7C 1F3XA 4FZIA 3EDEA 5FJPA 5MP6H 1AOZA 2Y2WA 4XAWL 3LEYL 5A8GA 4LLAA 3RGVA 1TVBA 2NTFB 2Q20A 2NUXA 3ATFA 2KBGA 2QKIA 2BERA 1DUYA 2B8OT 5IK3B 2I7SA 4FPSA 3U7BA 3VXMD 1OV8A 5DY2A 1DSWA 1FA4A 2ZTBA 3OAZK 3ABQA 3X12A 3INPA 4PBFA 1JVLA 5JU6A 1X1OA 3WNPA 3NJFA 5BO1H 5G1TA 4KXZH 5EV7A 3B06A 5L88H 1S7UA 4OQTH 1XD0A 3V4LA 3SQOH 3UYCA 3KDNA 1IGTB 1N8OE 3NCYP 2FUTA 5KTEL 1KV8A 2OZTA 4GQRA 2FDMA 1W0WA 4BEQA 4PJEE 4DW2L 1YPFA 4C1NA 3IMTA 3WQVA 2WLLA 4GUIA 3V0EA 4L18A 5IDIA 3M45A 2MHAB 5C0FB 3QM3A 1WBJA 5D7HA 1N55A 5K59F 3W73A 4F2TA 2CHXA 2EDLA 5E5CA 3HG4A 1FWTA 1GOXA 4C7GA 4QOKD 3MUGB 3L2MA 1VADA 4QLKA 3IDXL 4V27A 4G2DA 3QQWA 5F6IB 2UWFA 1PJWA 3VFNB 3H8NA 4YSOA 2PAJA 1WA1X 1PIIA 4IX0A 3EMCA 1J1OL 3USZA 2OQJA 1GPOH 4WXZA 1C08A 5CZKA 3RLHA 4IPNB 2P50A 3DRTB 2WWNA 4YS1A 4R5TA 3MJ9L 3WK0A 3H12A 3G1XA 4KK5D 3DGGB 3D18B 4KZCA 1IWPA 4XZLX 3CAFA 1RJCA 1LTXA 4P3DB 3IN0A 3QUXA 4WU7A 1E8WA 1US0A 3BGJA 1ZAHA 4JPWH 4F9LC 1U8NA 3GXFA 4HCRL 2Y36H 5B22A 5AHFA 1QDSA 2A6DA 2YGPA 4HA1A 5CILL 4PB0H 2A79A 3VUPA 2IFGA 2XIQA 1C8PA 2OX4A 5EBUA 2VQUA 5CLWA 4RNIA 5FGSA 1X9UA 2EVFA 1NPJA 12E8L 1OGAA 2BOEX 3W70A 1DZBA 3MX0A 4NO3B 4P4KD 4XCNB 3ZY7A 1GSMA 2G9HA 4GQQA 4G1NA 1Q4NX 1OLLA 4YU1A 5E1AB 4O1BA 1V8HA 4JUTA 3OD3A 3DETC 3B8YA 3F58H 5TQ0H 2OMVA 5I1DA 5CUSL 4YYFA 3OKNA 3W87A 4G3YH 1W31A 2J71A 4XX5A 4AHOA 3MA7B 2WQDA 3RGVD 3I6GA 3AIWA 4PRIB 2FR4A 5DEGB 2DJ4A 5LKYA 3QEZA 3I50L 2L04A 1P4BL 1PLBA 2NQ3A 4PBXA 3LGGA 2ZX6A 4ASTA 5E2VH 4IOIA 2KPWA 5G5IA 1VLIA 3T3MB 4P2RE 2Q3XA 1UXMA 4OZHA 3N25A 1GGIL 1QW8A 4WFGE 4N2GA 1VIWA 2EILB 2E4TA 5DWPA 2WIIA 1M7IB 3I85A 3PG9A 3F6IA 3R8GA 3BAWA 2YL8A 4NZCA 3DDMA 4YSEA 1ZQ5A 3UEQA 2LU3A 3RWIA 2ISSA 4MKSA 5E6UB 3TPUB 3S2LA 1XBVA 4LVOB 3U9WA 1V5JA 5E9DB 4DELA 5LBVA 2DYPA 1JDCA 2OZ8A 2MCPH 2IAMA 4JKWA 3SCQA 3T9PA 2XJLA 4Y8DC 3H1ZA 3D52A 3L3HA 3ZYZA 3M16A 2FO8A 3GTIA 3U82B 4Y5YA 3TIDA 4HSNA 1O5RA 3WMPA 1D5BA 4H7VA 2EPMX 1V6UA 3VGHA 4OJYA 4ZUSB 1MCJA 3QAZC 1ZV2A 2J55A 2AANA 2Z8RA 3WFCH 1ACYH 3VKAA 5L0QC 3DGRA 3STFA 2AEQH 1JBJA 3Q5OA 4F9PC 1LNUA 4I5XA 4S0HA 1MRDL 1RZIA 4L4MA 3U30B 1PKQE 3SGKA 3NJJA 5C08A 5FOJA 2NQ5A 5C54A 4WI5A 3M6DA 1DYSA 1JK9A 4Y7OC 1HGWA 4LUSB 4FXFA 1UG6A 5IJKA 1BA9A 2B5IB 1CFVL 5DMLA 3WLWD 4HXBH 3ENLA 3BZEA 1WP6A 4QSHA 3W1MA 3LN4A 3QUXD 4KJPC 3VSTA 4CEUC 3KYNA 3LHPH 1G4RA 3QZNA 3HI6L 4QGYA 4BR1A 5E1HB 5DHEA 4WV1A 3WG7B 5AOMA 3RVVC 5C70A 2DGAA 1UD2A 4S3JA 2AJXH 3HC2A 3ILDA 1IQDA 1P5VA 3HAEG 2PYEE 4DH2A 4ZW8A 1TPUA 1DP0A 4MVBD 4IPJA 3UDWA 5C0DA 2YEZB 4AZGA 2ZOKA 1ZVYA 1XCQB 2YZ8A 4RX4A 4M6PA 4EWND 1OGAD 2VFFA 5E00B 5AKRA 4ANXA 3QW4B 1RIHH 1SQMA 1ZHLA 1WFMA 2F15A 1ZVNA 1LTDA 3L5XH 5EBAA 3SYCA 4BFIB 3F7VB 5CNHA 1B2YA 1Q66A 3FU7A 1NFKA 3HW7A 1RXOB 5DJYB 5I3GA 1R46A 2C1OB 5DJZB 1B0GB 4IFRA 4G9DA 1E9ZB 1FVCB 3BUQA 4UOW0 4GWEA 5H37A 4LOUC 1MW0A 1EUNA 4DETA 3PVFA 1HHGA 1N26A 1PDZA 2E47A 1FVDA 5D7IB 3ZVIA 3PN8A 4HKXB 4YHKH 3VWJD 1HKIA 1BTCA 3N2CA 5E6IC 1ED3A 2D4DA 5FS5A 1E7UA 4UQ9A 1OGSA 4NIKB 3VXRB 1VKXB 2W3ZA 1IU1A 3G6JA 1CZ8L 3UC0L 2ZZ2A 5BOOA 3AS2A 3Q0HA 3M0ZA 4H2CA 4S3GA 4IOFC 4J4PC 4Q6IA 1MNNA 5FA3A 1VP5A 3QQNA 1JZ5A 4ZQNA 3F85A 5LNRA 4PJCA 3JV0A 5IMLA 4P9ML 4UM9D 2DBLL 4JO2L 2ED6A 5INCB 3W1ZA 3M0XA 4YDLC 3BWAB 4I0PC 2GJXA 4WFED 3ISIX 3CNKA 3EDDA 4OUOA 1DFBL 5D2NA 5TDPA 2IAMD 4EX4A 4ZAKB 2Z1KA 3RU8X 3GNMH 2WAGA 3QFDA 2HVNA 3S6DA 5D96B 5E8NA 2VABB 1G4EA 3OKMA 5GJSH 4MWFA 5FEWA 4PGCA 3I9GL 4GUPA 1LBFA 2FJHA 1A3XA 2BVUA 3GXDA 4JFXB 2NZIA 1L8NA 1LK3L 4G8GD 4H83A 4XPBL 1MCOL 1ACCA 4J4KA 5EO1A 3Q9QA 3E2HB 6REQB 1MWAH 3M7FB 5AYXA 2QVMA 3NCWA 1T5WB 1IYXA 1CG9A 4YBHA 3CUXA 1H0DA 6PAZA 5ECJE 1QPRA 4KY2A 2X7WA 5DJ2A 5C08D 2VT0A 1C12B 4FD0A 3FYOA 2AF2A 1K5WA 2IBZY 2PD5A 1EJ7L 2AV7B 2P47B 3LVTA 1BP3B 3JV6B 1Y7VA 5F6HI 3EWZA 3PZNA 3HMWL 2V33A 3QHMA 3FUEA 4HNTA 4MDRA 3QNZB 3RZCA 4NHCL 1R3SA 1WAUA 4HWBA 3C87A 3QDJE 3CDYA 5LXEA 3IJLA 1JPKA 4D8OA 1GZ1A 3HE6D 4HEME 2W8CA 1T96A 2XTJD 4IM8A 5FF6B 4AGOA 2V82A 3D6NA 1IWBA 4Q4OA 3QJAA 2BZ7A 2HVKB 3PNWB 2AJSH 5EBWA 1MHCA 4X99B 1EDGA 4HDIA 2AEOA 3LRLA 2AITA 2A77H 3R19A 4RX4D 3NZQA 4NF7A 5TE4H 3N2TA 5E0KA 3WXVL 4QYOA 4DN4H 4BFNA 3TA3A 1ZVSB 1UP0A 1B0IA 1UJQA 3MUZ1 3DI0A 2HN7A 2X4OA 3Q43A 1FIEA 1AQ8A 3T2QA 5F1OB 1UOVA 1N2RB 4ZZ9A 3HPLA 3W1QA 1HJBC 2I32A 4WW2A 4AEIL 3O2WL 4JQIL 5MENB 3LPGA 3E0LA 4HJUA 1KYUA 1M3JA 1CO1A 3WIJA 2PNDA 4QYAA 1OX6A 4XN8A 3UBXA 4LFHG 4RQQB 5CHNB 2HFEB 5J5DA 1FKXA 5HDBB 1TPFA 2G50A 1UUMA 2A6KA 4UOW1 1JRHI 1PMYA 4AITA 3KCOA 4E42A 2YL5A 3TESA 1GYLA 3KXFB 4MAVA 1BPLB 3B3BA 4JG9A 4HUMB 3CN1A 3D4ZA 1HTYA 3C0JA 5M2FX 5DJXA 3S48A 5E4OA 4NP4L 2H6UA 1TVHB 2QPUA 3B3DA 4PV1C 5K7JA 3SBFA 1FL6B 5AD0B 3FVMA 1ZU8A 4BZ2L 3FT0A 2FLIA 4PUDA 3ITOA 3RMJA 4G6MH 4DQOH 3MYOA 4YQXL 3NDYA 3WY2A 1INEH 5CIPA 1HHKA 4PCKA 2O5NA 3MP4A 5E56A 3NIYA 1K2DB 2ATPB 5B1KA 1F6YA 3I9AA 4NO0B 4XOAA 4F2UA 3BUYB 3R0NA 4UTHA 2X3CA 2HRWA 2LLEA 3RWHA 1B0WA 2GK1B 4KO9A 2C3XA 3BIKB 4UQ3B 3K3QA 1YNKH 2WZPA 3GO1H 3CYVA 4ODSL 3ARRA 3WGUB 2NY6C 4NWTL 3JWOH 5HANA 4WXYA 1FWWA 4FOUA 3AQYA 4PS4H 2XXGA 1ZAJA 3P8IA 3RZCD 3WH7A 4DP2X 4EN3A 1A5BA 4MWAA 1D5IL 3QCUL 2XYLA 3SFWA 3WE6A 1XX1A 4IGHA 5CBAA 3BWZA 5C7ZA 1RLWA 2PCFA 3BJ91 1NIUA 2H9AA 2WYZA 3VE0B 3DKHA 4PRTA 2HV5A 4QRRB 1EXBA 3QY6A 1QBMH 1BFOA 3N85L 3BJLA 2OLSA 1QCWA 4LAUA 1MIMH 4RAUB 5DD0L 3NMEA 5HSFA 1B9ZA 3L12A 3TAKA 3BMVA 3TA3D 3TXAA 4NQXB 2C3VB 3DFPA 1TTIA 3SSGA 4D72A 3UZJA 5HYJE 2PDXA 3NM1A 1EEZA 1OAQL 4FS9A 3BH9A 1WWWX 4PR5A 4X5XB 2JJTA 4LCRA 4V1XA 2Z31B 2OZNA 1GZHA 4H1LA 3VXPA 4LCYA 1SXZA 4GOAA 2EAWA 2QVFB 1WWBX 5I6PA 2OW6A 4GP8B 4W4OC 3GI8H 5IEKB 4H9ZA 2VIRA 1WAAA 1G43A 1BQGA 3L67A 5AKQA 3BLOA 1R3QA 4YVPA 3SSZA 3G9AB 4D0CA 4KRUA 4U6YB 4EN2A 3S5OA 4F8NA 5D1QB 1T4WA 3VSUA 3TFCA 2N3JA 4FDWA 2NNXA 2BPBA 4N9GA 3D87B 1UMYA 2Q8AH 3LHUA 1EANA 3PTQA 3GJFB 4R2GC 1OG0A 2XA3A 3K74B 1L5GB 1IJNA 1E4XH 3D25A 1P5UC 9XIMA 1YNTF 4NRXB 4PBWD 2WQ8A 4ZS7H 3VD1A 1TQXA 3IFOB 2ESVA 4F2ME 4YGVA 4M7JH 3B2VL 4AD1A 2E77A 3AY2A 4C4KT 3NCJH 4Z7OB 1CE1L 1ERNA 2XSKA 3CUGA 2YKKA 3KDPB 1A53A 2WZPD 5EFIB 1URIA 2R0LL 4LCWA 4PJ9D 1O6TA 3UROR 3H6OA 3ZIZA 4X6CE 3AG3B 4LBUA 3AM8A 3ZTNH 3W86A 4OLUL 3FT4B 2R1LA 1XDJA 5M17A 5LXVA 2KZHA 3DIFA 4XP1H 5FF7A 1P6CA 1DBBH 3E0VA 1A3RH 3M0VA 2FWOB 3OJDB 4EN3D 1E28B 3TLRA 4KO5A 4MWAD 4A63A 2QJJA 2QVKA 5JW5B 4E9WA 3KW3A 4WJXA 3ZDZE 2RALA 4OGXH 1CK0L 3L0GA 4L8BB 1O68A 2H0EA 4HMDA 5LWYH 3W9ZA 1U8MA 1U9KA 3ARBC 2YBUA 1YQ2A 3D33A 3FQXA 3NQMA 4YHYB 1KBGL 5AW2B 1ZLUH 5D1ZI 3WTUA 3G5YB 2WQUA 4POUB 1T0MB 4G42A 3L5WB 1U95A 2CBPA 1CPUA 5AB0A 3ANUA 4N25A 4RAVB 3VQ2C 4K37A 3O0RL 4CVZA 3MLTB 2EPOA 2NMSA 3QUGA 3U3HA 4JG1H 4P8WA 4ONHA 1SMDA 4F5CA 3IJ7A 3IF1B 4R97C 5ELIA 1G1OA 1T40A 4YUEL 1E50A 4V2XA 1QBAA 4HZLB 2KMWA 3RITA 3G8RA 1CTMA 3QQ9D 1HNGA 4ORZC 1YYMH 3LH2H 1J0HA 1NBZA 2WWOA 4J23A 5JBDA 1H3VA 3V6FA 4MHBA 2EIDA 1DVFA 2Q2EB 4NXSA 1PG7X 2ZKXA 1AJZA 3M1BB 1BAWA 1LLZA 2RDXA 3WHXA 3C2RA 3QDGE 3C5ZC 3EA3A 1IKNA 1I3GL 2R1XB 2GJLA 3IPWA 4JQVC 1LDPL 1WA2X 1IILE 2VE6B 5LXXA 1GOQA 1RERA 2R0KH 4A4AA 3GS0A 1N6VA 1V0LA 3E6FA 3FJNA 1QBLH 2Y7LA 2Y6TE 4MJ5B 1DTNA 2E5EA 4G6FB 2OSLA 3VINA 3AREC 4UTIA 4WO4B 3UO1H 5LIXX 1KLZA 3QOMA 1EVUA 1YY9D 2ESVD 3WUWB 1SM3H 4GKOA 2Y2YA 1IC1A 5FB8B 2IQ9L 1ILUA 3FONA 5LNUA 5CZXD 5TF0A 3P77B 2B81A 2NX5B 1IQWH 3RY6C 1NC4A 4QTHA 3FU5A 3TA4D 4BUHA 5EUOA 4DVRL 2BSCA 3EGDB 4KJYB 4NEHB 5E2JA 2MQCA 3ME0B 5IHZA 2P46B 3QNXA 3TLQA 5LNDA 4WLCA 4CNIA 1SPDA 1WSST 1KBJA 3EO9L 1DQQA 5CJMA 2HT4C 4GI8A 3AXIA 1EZVY 4R8WH 4Z7UE 1P4IL 2VC9A 1P1ZA 5E0CA 4AB4A 5I24A 3LTPA 5A6IA 1ZPTA 2H1XA 2BSLA 3PU7A 1T2JA 2RMNA 4FXKA 1XGTB 2ZCKH 4O5LH 3OAZH 4HMEA 4PB9H 3AABA 5KYWB 2DT2A 5M5DA 2NT1A 4GY0A 4X5WB 4IKNA 1RIVL 4HLJA 3W3BA 3QXWA 2OELA 1CGYA 1TQCC 4HETA 1KXQE 1K8ZA 4BQ8A 5EBLB 1JCYA 2YBTA 5J9PB 1BQCA 1M7XA 4UFIA 3IJIA 2P45B 2BFVL 3LAFA 1U1UA 1LQAA 4QTIL 5L8JB 4ODWA 4G6CA 3QFJA 3CUPB 4CW1B 5EY5A 3VCLA 5CG0A 1FE8H 4BH8B 4PJFE 1ECZA 4AIEA 5DX7A 3W9DB 3FAWA 3H21A 3CQJA 1BD2A 3GM0A 4JAMB 4HN4A 3WF1A 3CHPA 3VOGA 3KYAA 1Q72L 2IBGA 2VKXA 2BZNA 1T4KB 1ZANH 4AL8L 5D7SL 1O95A 4HZ7A 1A6UL 4QIRA 1JWMA 4XNQA 3IDGB 4DLFA 3MV8E 1TUFA 3PQYB 1R75A 1DVFD 2X9XA 3AACA 3CQIA 2FJGB 4GG6B 4EAEA 1W54A 1IGFL 3M8OH 3T09A 3S8WA 1SSDA 4GFSA 3WF0A 4DUXA 4TSAH 3GG1A 2XFGB 1MFBH 4L4VE 4F37F 2EXWC 3MYJA 5HYSB 3V1HA 1MHEB 4KH2A 4PAZA 5DHDA 4A6YH 2ZD0A 3X3FL 1WQVT 4YVXA 3Q05A 1K02A 15C8L 1FWDC 5F72S 3NQVA 4TNEA 3MCG1 2QEJA 3IGAA 4FNRA 1KFCA 3EBVA 5DTFB 4UWMA 3TCLB 3GH5A 2DWXA 4MJ6B 2MPVA 1I45A 3OMNB 4P7RA 2J4WH 2QQNH 3HC0B 5LLIC 2K78A 1TJ1A 1U8LB 4JREB 4UQ2B 5PTDA 2YAMA 5KS9F 4MMXB 3ZJ7A 3DI2B 3MMUA 4O1FA 4N2KA 2AXWA 1IBYA 3MUXA 4PJDE 4MFHA 3HI1B 4D7PA 4NENB 5L2KA 4F3FA 3V16A 5LNEA 4M6OH 4DPAX 4FI7A 2R4RH 2Z7KA 2JB6A 5A2CA 1LGVA 2FX9L 3AHZA 3P9LA 1MN4A 1CBJA 4G82A 3H0TA 3WBDA 2C9UA 2O9OA 1SW7A 1W0VB 1SVDA 3EO1B 4NS0A 1HYRC 3IKCA 1MQQA 1U3JA 2BVYA 4AYFA 1Q1PA 4Y8EA 4ADJA 2J7CA 3ARPA 4OZ4A 1G9HA 4GZEA 4L9LC 4PLNC 2FGWH 2J4GA 1TB3A 4AKOA 5G4NA 3B03A 1YLBB 1GOIA 1JGMA 5EZOL 3R8BB 5JIMA 5JOPD 2QF8A 2DMHA 2VLMD 3QFJD 1MFDH 2ZKMX 2E46A 2VDLH 4NT6B 4BWLC 3KX6A 3L7EA 2HP4A 3LCXA 1MCLA 1BD2D 1R3TA 1TPC1 5DEJA 2W61A 1HVXA 3M0IA 2EIZA 2YHGA 1PJ9A 1EJSC 2IPWA 1TQWA 5HGGS 3QPZA 2DMGA 1YMHB 4L80A 3ARVA 1QNVA 3LS4L 4IYKA 3H3PH 4J1UA 2ARWA 3F65A 2CLEA 3WD5L 5KEZA 3OWEA 3U0PA 2UY7A 4MD5B 3PB2A 4BUGA 3W74A 3HQOA 1YN6B 3OR6A 1J1PL 5CH9A 3FYIB 1VZWA 3CAWA 4GY7A 1NC2B 5U4NA 3C52A 2D0GA 4NFBA 4L56A 1N5AA 3GKWL 1ECYA 1W1TA 3FOMA 1AMXA 2P5WB 1HEZB 2HWZL 3T55A 4RNFA 3H6AA 4ML4A 1JZIA 2VR9A 4NSKA 1C5DB 2GYSA 4ODTL 4C4KO 4LHUA 1BQHA 1WKEA 1L9SA 2CH8A 4U49A 3MKVA 1N10A 1MREL 3ULSB 4XI5D 1I2NA 3NZHL 3E0IA 5FYJL 3WK1A 1VGKB 5J3HC 4UOZA 1XF4A 1YNTB 4I13B 2OR2A 4JJOA 3LUTA 3B2UC 2VN4A 2D7MA 4FABL 4XMPL 5I15H 2VLJB 1LDSA 5T3ZL 5ACZB 2IGTA 4D6IA 1S9XB 4Z7WB 4LAZA 4MAUH 3IJQA 4JFFE 4F8TA 3BE1L 3O41A 2MKWA 3T9WA 1MFUA 1SY6L 2FDSA 2HS6A 1WWAX 4J3OF 3RU8H 1O1HA 3PDOB 5L2KD 4HLZH 4YMZA 1T7VA 1I9EA 1AP2A 1E51A 3SZ8A 3UTPD 1SJBA 3DPDA 4E3TA 4YE4L 2D69A 3MBWB 3KOXA 4OQVA 4B41A 5I8EA 2WXJA 4LLUB 4XMTA 1MCQA 3T0CA 5A69A 1WPCA 4FEMA 1DQLH 1S9YB 3BH8A 3VI4B 3ZQXA 1AD9A 2NXZB 3QIBC 2CKSA 4YBLB 5FKPB 2Z1WA 3KYMA 1A22B 1IKOP 1L9QA 3U46B 1HJUA 3Q44A 1A2YB 3QJXA 1ZUAX 1GVFA 3CU1A 3PHAA 2EG7A 3VFWA 5E4AA 3KLAA 2OL3B 1CICC 4OUUB 3T65A 5JHLA 5EOQL 3DJ9A 1Q65A 3UYIA 2NVCA 1JGDA 1OE2A 2FBRA 5CFHA 1U83A 1Q6LA 1P69B 2FWLB 3ARFA 3CWGA 4NUJA 1KM5A 2UYLB 3HNSL 4N2NA 5F7DA 3MSYA 4MX7B 1DQWA 4YHOH 4NZTH 5F88B 4MMZB 3QNYA 4J35A 3TBTB 3RLUA 3GVGA 4LXFA 4L8CB 1XEUA 4X7EC 2PLMA 1J1XL 2VHLA 4C1LA 3QR2A 2EYSA 5GSVB 1ADQH 4WTWA 1TQBB 3NA9L 4D8LA 3AWOA 1GG1A 4R7DA 2OX1A 4KDTA 3L3GB 3UZEC 1V0KA 1VQTA 3CSYA 3IAGC 1IKFL 3GQFA 4GAAA 1R17A 4YSCA 3RFZC 4OI8A 4FZEH 4DKDC 5KN5A 5TH2A 5GZOA 4ZFCA 1VEPA 4HA3A 4M3HA 4S3AA 1JRHH 3VOIA 4I90A 2P8BA 3VRJA 4Z3FA 3JZ7A 3NZPA 1UIOA 5JLZB 3T3MF 4LHUD 5TE7H 1AHWA 3R10A 4GAJL 3VYLA 1FL3A 5TAOA 5J04A 3HFFA 3GTFA 3SJVA 4FQPA 2A4EA 3NEOA 3O6AA 4AVNA 2CKNA 5ANMA 3RGTA 3MNWA 4DTGH 5JBEA 2ZQ0A 2C3GA 2HX9A 4E4FA 1TJXA 1F11A 4YZFF 2WINA 3GFUA 1MI5E 1RZJL 5FR3A 3TF7C 3W7LA 3TJIA 1BIHA 1QLRB 4NRYA 4L23A 1EO8L 2Y63A 1P7TB 4S1SL 2ZUQB 3W71A 2EUZA 3KW7A 4ILSA 5DZVA 2IOOA 7PCYA 1QFUH 2R29A 5IUCA 2HRPL 3BKMH 4KXAA 2IV8A 5KUKA 3RVUD 2Y6SD 2VYOA 4DFHA 4KX9A 2B16A 1BZEA 3F03K 1KELH 2OWWA 2VW7A 2OMAA 2JGQA 4U5KA 1QRNA 3FHEA 4ZFZB 1A7OH 4PLJC 1U91B 5DO2C 3FCTA 1Y5WA 4KQ4L 3ZZLA 5DI8A 3D0AA 5IOPA 1VFAB 4UT9H 2PGEA 2LE9A 3D3VE 4NYLA 1TVDA 3QJVB 3S6OA 4ERSH 5JOFB 3MNZB 3LB6C 1XKJA 1KJ2B 3X11B 1NUFA 3TN0B 1NWRA 3T0ED 5D9SA 4KI5F 4GRLD 3V0TA 3EHBC 1UM6H 3ARFD 1AKJB 1Z9MA 2FPTA 3VFTA 5HJ3B 1H63A 3ZOAA 3QEQB 2UVFA 3B9VA 4B5VA 1LG1A 5IBTL 4CU8A 2MEJB 1K4CA 2V2WB 4H0LC 2YJLA 3JTSB 4KVNH 1UCBH 4W9KC 1NEZB 3C09C 1JPGA 5F97E 4GQ0A 3BXNB 2GTZB 3M41A 1YSOA 4DK5A 1Q7MA 4KKAD 5D7JC 4ZQKA 3QQ3B 1EHKB 5GNYA 4NU7A 3W6LA 5HHNB 5C7XH 1CXIA 2AK4B 5FYLL 3ALWA 1G6RB 5K9DA 5T3XD 2ZRXA 1PZ2A 4BSWB 4XCCL 1NFDA 3ZSSA 4NKIH 2X6BA 3LPWA 4HJEA 2Z92B 4LVDA 3KYKL 3GSOB 4QCIA 5D7IF 1AGEB 3L3OA 2Y0FA 4JYFA 3TIEA 2K4WA 3EMZA 2VURA 3FQUB 4GJTB 2XWTA 2YSSA 2AGKA 5C97A 4X6DE 3ABMB 1RZJC 2XVNA 3UPAA 5DK3A 2JF6A 4HA4A 3IU3B 1OK6A 2GABA 2GEQA 4IEFA 4WHCA 2NW2A 4DFIA 3ES6B 3SJVD 5AC8A 2XIDA 3QWOB 4PJ8B 1LK2B 3KBHE 2X4RA 3VXMA 1IAMA 3OHXB 4DYEA 3DV6B 4WGVB 4YSDA 3KVJA 1FWEC 4EZKA 4GC4A 4TX8A 2QQQA 1PEWA 1AE6L 2OCZA 4AGPA 1Q0EA 3V6OC 2QQKH 1MUMA 5GGVH 2WLIB 3JRKA 2L3BA 3ZKMD 3N1QC 4PJIE 5BXSA 1D6VL 3RNKA 2Y7SA 4XXWC 5KS9B 5D1XC 4DF2A 5GGQH 4E4UA 3G6JE 3SGZA 5CBBA 2AJVH 3CFDA 3QXAA 2EVGA 1LE5A 3VXUE 5ICXB 2UX6A 4MAYB 3MJ7B 4CL7A 4FHJA 1WJ3A 1QHZA 2O56A 3PP4L 3DXIA 1VAHA 3V0UA 3OKKB 4ZMGA 4DWSB 2ZRZA 3C2FA 3O63A 3LIZH 4ORGB 2X2GA 3NFNB 4JFDA 4PJ6A 3DMMC 5AHMA 4EEEA 3KWTA 3QORB 3APDA 4Z7QE 2VENA 4Z76A 4WNQB 1O7DE 3GS4A 1LF1A 1W16A 4P7NA 3MACH 3AXXA 2WQSA 5JHAA 3ZLHA 2VR7A 4B16A 3LZNA 1GONA 2OR9L 3GIZH 4QWWC 4NLAA 3D06A 4IMEA 1SFDA 3L5IA 4OI7A 2XBZA 2YGQA 4MQXD 1A6AB 3QS2A 2OJPA 4XZMX 3BDXA 4GQ9L 3M0LA 3WL0A 1IAKB 5EIIG 5FESA 4JCLA 2OXGB 5LIWX 1UKQA 4GRMB 4NKDB 3MNVB 2OKMA 4NQDE 4J28A 4OJAA 5T1MA 4DN3L 2J78A 3STEA 2Z6IA 3MFFA 3TTQA 3OGRA 1L7IH 4APQD 4P4KA 3SPJA 4F0MA 3ZRFC 4NNYB 2XZ9A 2XBDA 5CD3B 4MCZA 3ZWSA 1TFHA 1YNLH 3VKCA 3N0PB 1J10A 2LAGB 3HNVH 4G7YH 3D5OF 4S1FA 3IVTA 3QTGA 4E9YA 1P6BA 3L48A 4R7NB 1RY7B 3U6RB 3U7AA 1ZBKA 2BLFA 3A24A 5HDBF 5ACMA 4JGMA 4YXKH 2JKTM 4G43A 2H0FA 4HOMA 1F07A 3N1AA 4MA7L 4MXQC 1L0QA 4S2SA 3ZKSD 2CDGB 3WFDL 3PB0A 1N59A 5JPNA 2I14A 1PW3A 2BK8A 3FB7B 1I9CB 2DPEA 1LP6A 4MUZA 4E2BA 1IM9D 1N5YL 2OWXA 3E3QC 5LXGH 2WSRA 1VDGA 1IXNA 1S7XA 3H2EA 3TJ4A 2CO7A 2FATL 4AWEA 1EX5A 1JDDA 4H9MA 7REQB 4QTFA 7ENLA 2WXRA 1FO0L 3ANVA 2DQCL 2A3HA 2OX5A 1T83C 1BDYA 5FEPA 2R1WA 2KAUC 5A7BA 4LARL 1MCCA 2K3HA 3BUPA 3KCJA 3O9WB 2W63A 5C0AB 1C5BH 1UR3M 1HIML 3TX9A 1RJLB 3MLRL 5IQ9A 5CEXB 3F1QA 5ILTH 4HWZA 1BYDA 4F0SA 3GXMA 4R0LA 4U33A 1CN4A 5HJXA 4XC3H 1U8OA 4YYCA 2XFYA 1M68A 4Y4HC 2PDCA 4RMUA 2BJML 1MCWM 3QOKA 4IPIA 1ZJAA 3DTXA 4JTTA 3W5NA 4JFDD 4K3HA 3BAYA 4IGSA 4FFVC 4EDXA 2O0TA 4WKZA 3THUA 4HKBA 4ATWA 1MDRA 1EGJL 4U6HB 1MAJA 1JTPA 3W2DH 3GSNB 2I25N 3C6SB 5KW9H 4QHKJ 1BAFL 3SCMC 2A6IA 2WVVB 4HZAA 4FOMA 1GTEA 4Z2IA 3CN2A 1Q1JL 1J0KA 3GRWH 4YDIL 4J3OG 4W87A 3U4FA 1WHOA 4QX4A 2DZPA 2YQGA 2L7QA 3EZ4A 3JV4A 4M9PA 4ZQMA 4XWOD 3RJOA 5C2BL 4EZLA 5ESVA 3CASA 1R1CA 4N0UA 2HUHA 1TU2A 2YXFA 1PIFA 5KSUA 4FYQA 3FB8A 3L3DA 3PS7A 2IDFA 4TUJB 2W0PA 3RTQB 1Z2KA 4HN8A 3QZMA 3LKNA 2PLKA 5FAAA 3MCOA 3KWUA 2FYYA 5B8CA 4ZX4A 4C6IA 5FM5O 1OK4A 4D6GA 4IRZA 1FHNA 4ZFGH 4FQJH 1OXYA 1JNDA 4JZ5A 1QKZL 3MOBH 2QUUA 1TOXA 4L8SB 1Q9KB 4YDKL 1JFHA 5CP7B 3FTYA 5IP4A 2DN7A 1U42A 1FC2D 3LZQA 2UZXA 4RXFA 2YPKB 4JDTH 1F0LA 3VWJA 5CP3A 3U1SH 4TQHA 2NW3B 3VD7A 2EDOA 2DH2A 1MEIA 5DUML 4Y16B 4FLSA 1MIEH 4HPGA 5HA7A 3OKDB 3CHFA 1NFIA 3Q13A 5EDSA 3SRFA 1KLGB 4GT7A 4S1DC 1MCNA 3DHDA 3T8XB 4H04A 4IL0A 4Z2LA 2QTVA 4U3CA 3V5KB 4ACTA 2Y3NA 2W59A 3MRPB 5HTSA 3TWCL 2AQRA 3GSWA 3EOAB 1WFJA 1CI3M 4AQLA 4UM9A 1MXDA 1HL5A 4HX1B 4YWGH 2EH7L 2W94A 5IT2H 3B8SA 3FTGB 1B4EA 3NCBB 3RUGA 1OF6A 5GRVK 4XMXA 2DLFH 1K8DB 4OY9A 5E1IA 3MLSH 4JR5A 1F8TL 4DJED 5JH1A 3U9IA 4KIEA 1WFNA 2WWDA 4L05A 5D5ME 1T1YA 3U9UB 1QRQA 4Z7OF 3WEAA 4AZIA 1MRAA 4TNWF 2HEJA 1GQIA 3J07A 3DEQA 2HSAA 4G8GA 3L21A 4XPFH 1T2QL 2EICA 1KGUA 1A14L 3QCTH 3AT0A 3L3JA 1FFNA 2PDQA 1HINL 1GGBH 3FN0L 4WUKH 3SBWC 1VFLA 5ETUB 4JN1H 1S7SB 1SZNA 5E94B 2F5BH 2H26A 1IEAB 2QUTA 3OA3A 3ECUA 2C4FU 5IB1A 4R88A 3FO2A 2CO2A 3WEZA 3TYGH 1AY1L 3ESOA 1HZHL 4KGLA 4NN6B 3T4YA 5I30L 2NXYB 2IPUG 1TF4A 3SKJL 4XVJL 1UENA 4MDIB 5CC6A 2XH4A 2VGFA 3JUYA 3I6EA 5C7HA 5EZIL 4POZD 3BEVB 3HE6A 1A4KA 5EU6E 1I8MB 1CC3A 3CS2A 4PJEB 3W72A 1HKFA 1H6FA 1R3LA 4LS2A 1S1RA 4QITA 4C54A 2WYIA 4IDJH 2GSHA 4IOSA 3BUDA 1E4WL 2XPGB 1CLCA 4JPIB 4NI3A 1OF8A 4NZFA 2PCQA 2PYFB 4Y4KB 3ARYA 1TQTA 1GIGL 2QQLH 1ZA6A 3V0VA 1CIDA 1R5WA 5LUMA 4JOMA 3WTTA 1EXHA 5EF2A 1OZMA 1JJKA 4BH7B 4M82A 4UYPA 2ATKA 4JR9H 3VXNB 4HK7A 4PUEA 2FT8A 1XG3A 3KOZA 2HRLA 2VWEC 3EYSH 3KCPB 3BOLA 4HA0A 4JTFA 3FQRA 1WCBB 5CPTA 4ZX3A 2ACUA 3PUGA 3V0AC 5CU9A 1HTIA 5GGRY 1KBBA 4C90A 4WK2B 5K1NA 4UM8B 3QXBA 4P3CH 4G1MB 4BQBA 3UA4A 4C65A 3MV9A 3EJZC 2EAEA 2AMGA 2FZ9A 3VFCA 3ERPA 5F89A 2Z28A 4B5SA 1J05A 4PBEA 2A9NH 4KMTH 3R1GH 1VBRA 1YMYA 4F5CE 2G5UA 5JQ9A 4IKJA 4IJCA 4FTDA 3VFVB 3T81A 2KKQA 3SQRA 3H2QA 5DJ6B 1T7WA 5AKTA 2HISA 5B7ZA 3THQA 2AK1L 4JGJA 1G87A 4BQ9A 1CLZL 1E0UA 4QROA 4A35A 3ULVL 3QPXL 5J8LA 2GVYA 3QMSA 3BKYL 3CZLA 3BP4B 2AEWA 1AR2A 1V7AA 1PL9A 4NZ8A 3P0YH 1T6BX 3PWPA 4XBMA 3RBGA 1J5OL 4ORIA 4OF8A 3LPPA 5JIQA 2C1PA 4GKSB 2IFFL 4PTUB 5GHWH 4JO1H 1HN1A 4DUVA 4P2RB 8TIMA 3VIOA 1OEZW 1HS6A 4YPJA 1RZFH 3AALA 3L4XA 4F7CB 5I75C 2Y5TA 2D03H 1RZ7H 1EBHA 1E9QA 4LRNH 2X4PA 3G24A 1SJVA 5KSAB 2HAZA 1PD0A 1N67A 4AW7A 3HR5B 3WD3A 1XLBA 3GBNL 1KN2L 3BZ4B 3G2GA 4LUIA 1J7VR 3SKNA 2GBAA 3R5EA 3IJ6A 4LSRH 1KM1A 4CQCA 2VZOA 4IU3B 4K5LA 3KS0J 4LNRB 1W5QA 2V5LA 1NBVH 2JQAA 3OVQA 2GVJA 5C0RH 1S8DA 1PTAA 2O5YL 3OHMB 3LN5B 4AVHA 4IOSD 3ZMNA 1AG1O 4ANWA 2GHWB 4RZCA 3BJTA 5JDSA 3SDAB 5C0GA 1ZP3A 1A3HA 1IEWA 3R94A 4XNZB 4DX3A 4PRBA 3GJEA 3AMLA 2GLKA 4AK1A 3KVMA 3GMLA 4Z5RB 3WQ6A 1L9TA 4R4FH 2GVLA 2YXWA 5DFVD 3QKEA 2UV3A 4NM8L 3RX2A 3DV4A 2X6MA 1O5QA 2CO3A 4AIUA 3MGAA 1RK6A 1SFSA 4B15A 1FH5L 1BMGA 4KK6C 4QRSA 4U1LA 2X0SA 2Z3FA 1X39A 3SGJC 1I7UA 3GT6A 3F2LA 5C0ND 2JFCA 5D71H 4OUIA 5JW3H 3WNLA 4XN4A 1RK7A 4GG6F 5I2IB 2PW2A 2G5RA 3E74A 2XG4B 1ZVHA 1Q94A 3HG2A 5CWSA 5I18H 3UMTA 3O3AB 3NUKA 1CENA 2R27A 2VDML 5FOBA 1RJQA 5G4OA 3O3BA 2MH4A 2PYEB 4GW4B 1N68A 3MV9D 5JVLA 4KUZL 5KBPA 2M2DA 3ULVC 3WO8A 2Q6WB 3FTXA 5EMLA 4GB9A 3HCVA 1UA7A 2QF7A 3US1A 3LNHA 1OG6A 2E74C 2AJUH 3BVVA 4QI3A 2E9GA 3P2VA 3DRQA 3V5HA 1ZHNA 1PBGA 5MKGA 4JVUA 4LCUB 5C0EB 5EIQA 4OF0A 4IBUA 4W8BA 5DUJA 2Q7NA 1WAEA 1BSIA 3COTA 1EWHA 3INUL 1MWAB 3CV5A 4F4RA 3EYOA 1FWRA 1V6XA 2FECI 4I5BB 2XQBL 3PWPD 2ZPKL 3LIUA 4F58H 5K39B 2O5ZH 1YDYA 2L7EA 3NP3A 4PJ9A 2R56L 4PRPB 5LB1A 3OJ2C 3GSXA 1N7KA 4MNKA 3BPCB 3VMOA 2ICWA 1UXWA 4PB3A 4U0RB 1XRVA 3AICA 3SCOA 1MVFA 3BRGC 3D39A 1OGBA 1MJ8L 3MFGB 4QR7A 4RDBA 2YXVA 5F2IA 1FA2A 1BF2A 1KGIA 1FFQA 4M43H 2NQJA 2PEVA 5KVGE 1A7PL 4RFOL 4JDVB 2GT9A 3VXOA 1CL7L 1SXCA 5DMIL 4PE8A 1WOBA 3QQ1A 1B0RB 3CUJA 3EOYG 5LBSA 5IMMA 2DQUL 3WDPP 5IJVB 4PSRA 2ZOLA 4QAWA 4IQLA 2QPDB 1YMMA 5IW6B 4PG2C 1U5HA 5D2LE 1J5IA 4FG6D 4H8QA 2ED9A 1WLHA 5D05A 2QUNA 4KHXH 1T1ZA 2EYRB 3MLYH 3HHSB 1V93A 3WAKA 3SE9L 1YG9A 4GD0A 4J2PA 3IRPX 5EWIH 1PG7W 3UBHA 4HOWA 3H9SE 4C58B 3TEYA 3LH8A 2YK1L 4Z7VE 3WS3A 4G5AA 3LXUX 5GJTL 3EDFA 2C7UA 2NNAA 4I18A 3QZOA 4XP6H 3GSQB 5IBXA 2B4GA 1UD3A 1EUAA 4LSUH 2J9ZA 3OKEB 2OFQA 5ESQB 3QDJB 3OVPA 1FSKB 2QADB 4G7QB 2X70B 2H6OA 2XM2A 1LO3H 2JF7A 2HMCA 2W66A 1NGWA 3GSRB 3UTSE 2EVHA 1S5IH 4QY8A 3N0AA 2J6VA 4Z7NF 2Z7GA 1XIWB 2HBVA 3WN5B 4AWSA 5I1HH 2C4XA 4MQSB 4KROD 4ERAA 5E23A 4PV9A 5J13C 1QO5A 1HHIA 1JXDA 1U8PB 1TLMA 1UWGH 4ZMVA 3BAEH 1ICQA 5CCJA 2JGYA 2F74B 1G4TA 2QV2A 5AOZA 2YMTA 2EPNA 2P5PA 4XH2A 3LHYA 1AC6A 5CC7A 3P4OA 3RU6A 2YBGA 2JJVA 2CU0A 4QE4A 1SOXA 3LD8B 2DQTL 4GJ1A 3TKFA 3GBML 3YPIA 4Z7WF 1XR8A 5FUOL 4NN7B 1F86A 1M7PA 4PP1C 3AIQA 5I17B 5DHYB 1CF8H 3HPSA 1AHKA 4HK5A 1IL1A 3HUJA 3U0WL 2CCWA 1QNIA 4HNNA 3NAAH 1JGEB 2PC8A 4MJID 3C60B 1P1XA 2R2CA 3WLHA 3W00A 4E41B 4DUOA 5BS0B 4G8FB 3NSCA 2Y06L 3VI4F 4KNSA 2VP8A 4UTAL 2CHWA 4ZQRA 1QWHA 4NY2A 3GI9L 4RK8A 2JEQA