4CKQA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
390
structure length
390
Chain Sequence
HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords CARBOHYDRATE BINDING FAMILY 6
total genus 135
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4ckqA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ckqA02
1D3CA 1T0OA 2OYMA 3AOFA 3D4YA 2D2OA 2XGBA 1SMDA 3KE0A 1D2KA 1UR2A 1B31A 2XVPA 3MANA 3A6OA 5CGTA 1UWTA 3IJ8A 1JG9A 2Z1KA 1W3HA 2W4XA 1V3IA 3CHDA 1AQHA 1BYCA 1PAMA 3RM4A 1MW0A 2BNJA 4OUEA 3SUUA 3IANA 1E4NA 4KWUA 1QX1A 3UG3A 4LYPA 2W61A 2YDSA 3PTKA 4CN6A 3BUQA 4HPHA 2VCAA 3K8MA 3CUHA 1TQUA 4D72A 1GHRA 2TAAA 4U33A 4J3UA 1MXGA 4JZ5A 3BLKA 1LL4A 3RJXA 1UR4A 1W9PA 1H49A 1CGYA 2OYKA 1NP2A 3WQ6A 3SCSA 2GSJA 2W63A 3K4AA 4RE3A 2VJXA 2D73A 3UG4A 3HG5A 1VEMA 5I79A 2YOCA 3LRMA 4F8XA 1CGUA 2XJ7A 1OT1A 4AD3A 3GXMA 1VFOA 2YFOA 3CIVA 1J0IA 3MS8A 4UCFA 4NX0A 3PZGA 5IXEA 1TVPA 4P7OA 4FNTA 1HVXA 3L4WA 2ZUSA 2DSUA 2CIPA 1NWTA 3EMZA 3U7BA 3WNMA 5BWFA 3HG3A 4JKKA 1W1YA 4HZ7A 1JZ5A 3EDJA 1H5VA 3D4ZA 4BZYA 3POHA 1PBGA 3EJPA 3ZOAA 3B8SA 1JI2A 2X2HA 4GINA 1L8NA 1LQ0A 1QBAA 3N1AA 1LG1A 2VZVA 1XSKA 1G9HA 4D6EA 3WY4A 2O9PA 2A3BA 1FHDA 1VBUA 4UFKA 1GOMA 3LMYA 1JDDA 3CZNA 1P6WA 1B90A 3CO4A 4J3TA 3GBDA 1JD7A 3VD3A 3EMQA 2NT1A 3VSTA 2VVSA 1VEOA 3VGGA 4HPGA 5GNXA 4CUCA 5IHSA 3U5YA 4D71A 4E8CA 1JYVA 2D3LA 2FH6A 4J3WA 5JBFA 2XVNA 4IISA 3VX1A 1HKJA 5DF0A 2FHCA 3HMCA 3BXWA 4QCEA 4J7RA 3GH4A 3N18A 2EXOA 2CCRA 3AZTA 1TG7A 2RGMA 4H04A 4S3KA 1BYDA 2GFTA 2ESCA 5C8BB 4W85A 2OWCA 4UFMA 4D6HA 3EBVA 1ZJAA 4P8WA 1KWGA 1E73M 4GI8A 4X0NA 1PZ2A 5KEZA 2EACA 1NWSA 1MQQA 2Y4SA 2CETA 2J62A 3F5JA 1WP6A 1GJWA 3SUTA 4MTVA 3MV11 1BGGA 4QLLA 3EJQA 3OZOA 5CLTA 5A6MA 7CGTA 1MFVA 4M81A 2WCGA 3WD3A 3WF1A 3ARWA 4ZEPA 3OIHA 1EDTA 3AMCA 3TP4A 4AISA 2XIBA 1H0IA 3OA5A 4AYSA 4PMQA 3W81A 5M17A 2BXZA 1HKMA 2DT3A 3L4ZA 1OINA 4W84A 3GYCA 4ML4A 2XN1A 4PBGA 5DO8A 1E5JA 2WWDA 4A4AA 2WVUA 1OCQA 1H0GA 4QAWA 3VUPA 2WC3A 1M7XA 1CGXA 1SMAA 4HMEA 1LJYA 1CGWA 1LL7A 4DUVA 1PIFA 3AIWA 3DDGA 1PS3A 1NOWA 1EXPA 3MSGA 4XUYA 3OB8A 1TFVA 3AZRA 1QI2A 4W8LA 3N12A 2RGLA 4P7NA 2BHZA 5D9NA 4AD1A 1NQ6A 2XHYA 1I1XA 1PZ3A 1WDQA 1UD4A 3FHQA 2BFGA 1C8QA 3IAPA 2EAEA 3AIBA 1OWQA 4D6CA 1BF2A 1AVAA 2EO7A 1E55A 4CN1A 1A3HA 3JUGA 4NRSA 5CSUA 1UOKA 3BVXA 4H41A 2DT0A 3EDEA 3PZOA 1EA9C 2V38A 2VMFA 1RPKA 4OGZA 1B2YA 2WLYA 3AROA 2YA0A 4M56A 5I0DA 1GHSA 1SZNA 4ATWA 5A8NA 1OGGA 3UEQA 4TTUA 4CU7A 4DUWA 1OSEA 3O9NA 3CZ8A 3SCQA 5M03A 1DWFM 3FY1A 1EQPA 2QHAA 2J7HA 1M04A 3ECQA 5IDIA 2JIEA 2YFNA 8A3HA 1VJZA 1CLVA 1JZ2A 1KXVA 1DTUA 3TV8A 1H3GA 5BYWA 1FP8A 1G0CA 1WZLA 4TXEA 3W27A 4M1RA 1VAHA 3A3HA 4FLOA 1KGXA 2G3NA 3H54A 2JALA 4WF7A 3VNZA 1UQYA 3PHAA 1KTBA 4CVWA 4DM1A 2JF7A 3EJRA 2AAAA 2WCSA 3POCA 4KRTA 3LXBA 4AZ6A 2VX5A 4GZJA 5DMYA 1WDRA 3T0AA 4E8DA 3L4YA 1PX3A 1KBBA 1CIUA 5HXMA 3NDZA 1RP9A 1WKYA 1GQJA 2CKSA 2VZSA 4QLKA 2VX4A 3UR7A 3SCRA 4FLQA 1O7DC 3AS3A 3CHCA 1UH2A 1GUVA 5A94A 5A6JA 5HDRA 4GO8A 1E0XA 1NOUA 3VD4A 1KQYA 4F9JA 2WB5A 1GOKA 1LWJA 1J10A 4C7GA 4C7DA 3W4RA 2OWWA 1PEZA 3BUPA 4U2ZA 2PC8A 3SCNA 3NJ3A 1CEOA 3I3EA 2PBGA 1BYAA 1FA2A 1K6AA 1CPUA 4Y7EA 3NDYA 2VUYA 3GXFA 1IZJA 4LYQA 4AEFA 4QFUA 5C71A 4R27A 4OBRA 1VFUA 2WVVA 3E1F1 3VIIA 2B31A 4AEEA 1FP9A 3VGFA 4H8UA 1TQWA 5EFDA 2X1IA 2CBIA 1J0JA 3A4WA 4V28A 5IFTA 2BHUA 2CPUA 1K9FA 1ISVA 3PZQA 3AQUA 3IGUA 4W87A 4AD0A 1KQZA 3AIUA 4TVUA 4BS0A 4JCLA 4MB3A 3T2QA 5A3HA 2EPOA 2NSXA 2BY3A 4NXSA 1WAWA 3EJTA 4M8UA 1B30A 3D51A 1KB3A 1BPLB 2WVVB 3O2LA 1UQZA 1HJWA 1FOBA 4OOUA 2XPKA 2D20A 3VX0A 4MJ4A 3VIPA 4P8UA 3D50A 1U2YA 4CD6A 2VC9A 2VZTA 2G3MA 1WB0A 2WYSA 1N82A 2WHLA 1CWYA 3KZSA 1R8LA 4FNPA 6A3HA 4AIEA 1UWRA 3QHOA 4JIEA 4YPJA 2WXDM 3W28A 3SIMA 5CSYA 3WQ8A 1GQIA 4CCEA 1K9DA 3ZJ8A 1U30A 1GQLA 1E0WA 3WDQA 1GW1A 5E09A 4IPLA 3ZJ7A 1XRVA 3TONA 1E9LA 4PMUA 2ZXAA 1QW8A 4TX6A 1TA3B 5I24A 2VOTA 4MDOA 1C7TA 2WLZA 1C93A 2XM2A 2G41A 4CCDA 1HTYA 2X09A 1GVYA 1UA3A 1CTNA 5A2AA 1ISWA 3WEZA 3WMCA 1EIBA 2VRKA 3ZR6A 2F1BA 7TAAA 5CLWA 1W1PA 1B1YA 4U3AA 3U7VA 1CECA 3L4UA 4KH2A 3EJUA 4AZ7A 1HKKA 2GK1A 5C70A 5D4YA 2J8FA 2UY4A 3PBGA 4UOJA 5I23A 2XGIA 2ZUMA 3OZPA 5D9PA 1G1YA 2CHOA 3BAYA 1E6PA 1O7AA 1QVBA 1LG2A 1I1WA 4LXFA 2F2HA 3SCUA 3FHAA 2ZXDA 4N0RA 2J77A 5E0FA 3ZT5A 2J74A 2YLLA 4HA3A 1E0VA 2J7GA 5A2CA 2ZWYA 1GZJA 4WLCA 1E70M 4WKHA 1V3KA 2DT2A 1TE1A 4GO9A 4FLRA 2C7FA 3GM8A 2XVLA 4PMYA 3AI0A 2XM1A 3NSMA 1E43A 3VNYA 4D6DA 3LPGA 2E9LA 1V3HA 5FKYA 4DO4A 3GNOA 2CHNA 1J9YA 3WSUA 1FH7A 1QNSA 1W91A 2CERA 2V5DA 4UR9A 1ITCA 4F9DA 4Z2LA 2OW6A 4F79A 3WDJA 4EKJA 1W1TA 3AZSA 4PYSA 2WANA 4LQ1A 3CZKA 3ZIZA 1RP8A 3WEMA 3BVUA 1FH9A 3F5LA 4MNJA 1FFRA 4GIAA 1ISYA 1KFWA 3RDKA 5A8MA 1O6IA 2DEPA 4BQ5A 1UR9A 1MW2A 3CZLA 3WD1A 1E6ZA 4W86A 2J47A 5BXRA 4DWSC 3AS2A 2MANA 2XTKA 3VPLA 3VDAA 3ZO9A 4IM4A 1JIBA 3ZMRA 3WD2A 1OT2A 2YDQA 4AZBA 4ZE4A 4Z2HA 1OGBA 1JDAA 1TZ7A 4NXKA 2VX6A 5DT5A 4FK9A 4JHZA 1JNEA 1BG9A 2D1ZA 2YL8A 4W88A 3IAQA 5IHRA 3DC0A 1DWAM 1OIFA 1PPIA 2E0PA 3OGRA 2WW5A 3T09A 1HIZA 3WY1A 2BY1A 1E71M 4UZSA 1UD6A 1DEDA 1JD9A 2BY0A 4AW7A 3VDHA 3WDHA 5FL1A 2FE0A 3WENA 3ARYA 5EFFA 3WF0A 3ZT6A 3VIFA 5A69A 4D6GA 3A4XA 4CVUA 2YLAA 1CXKA 4JL1A 2GK1B 2OSWA 1TQVA 4PCTA 2V3GA 1JNDA 2O9TA 2VI0A 1QHZA 1CXHA 6CGTA 3DHUA 3KL5A 5ECUA 3WF3A 2PI6A 2YA1A 3F5KA 1JAEA 1EDQA 3SCWA 1JYNA 3WY3A 3VGBA 1XH2A 4TOQA 2ALWA 2CYGA 1HP5A 2VRJA 2OYLA 1YQ2A 3CUGA 3VDCA 3TTYA 1BSIA 1EDGA 2IUZA 3AIVA 3N11A 1R7AA 1C8YA 4AMCA 3DDFA 1UWQA 3DYMA 4K68A 4HU8A 2DSWA 3CZEA 4FNSA 3WNOA 1E4MM 3N17A 4Q22A 1US2A 3SEPA 2WZHA 3LRLA 3WELA 3VD5A 3IK2A 4L4PA 3VIOA 3T08A 2WPGA 3BAWA 4H8VA 1GOOA 1ZBKA 4PMVA 4WSKA 1QI5A 5A8QA 3FXYA 4AZCA 3UERA 3PZMA 1YHTA 1R46A 2V3DA 4PRWA 5DT7A 2FYVA 5E70A 1HJXA 1WNOA 4PMRA 3BMWA 1Z32X 1IT0A 1ZJBA 3WUEA 3A22A 3FNDA 1R85A 5DEZA 4MDPA 4S3JA 2YJQA 1Q6DA 1ITXA 2JEQA 2YL9A 2JIWA 2XWEA 4PTXA 1BVZA 4DWSD 4W93A 2ZUNA 3T0DA 4PCSA 5HBFA 1S46A 1WDSA 4P7RA 4Z2IA 1I75A 1UD8A 3B9DA 3WH7A 1FH8A 1TQSA 5CG0A 4FNRA 5A8OA 1MFUA 2ZIDA 3OG2A 1UZ1A 3VKKA 4D1JA 1KXTA 2PBOA 5D9MA 3U5UA 2YDRA 3W82A 3RM9A 1GOWA 2W92A 2VO5A 2OWXA 4QLJA 5AC5A 2PWDA 2E8YA 4UQEA 3PZ9A 3MO4A 1V0MA 1UASA 3AMLA 2X0HA 1EQCA 1GORA 4B9ZA 3QHMA 1UZ4A 3KLLA 4TVCA 1D7FA 3EDDA 2VR5A 2DH2A 1OM0A 3VGEA 3AYSA 4UQCA 3MUZ1 3OGVA 5FD0A 1PX4A 3BH4A 3AIRA 4PMXA 5BXTA 3S5ZA 1LF1A 1E6XM 5GPRA 3A4AA 1PIGA 5AYBA 4MB5A 2V3EA 1TMQA 3FW6A 2VX7A 2GDUA 2XN0A 3W38A 4JKLA 2WHKA 2X05A 3SCOA 1DWJM 1H2JA 4CD4A 4D6JA 3FN9A 5A95A 1VENA 4RE4A 1V6YA 2GDVA 2EBNA 5FCZA 3GTNA 1C7SA 3MV01 1MVYA 1R75A 3WNLA 4X0VA 4AXNA 4TVDA 3N9KA 1XYZA 4EE9A 4UFLA 3RPMA 1WPCA 4JCMA 3VU2A 6TAAA 4P7LA 4YN5A 2WMFA 5BRQA 3TTOA 1E1FA 5I6SA 1OB0A 3OBAA 4H2CA 4B3KA 3SCPA 3H53A 2VQTA 3ZM8A 1B3WA 2J25A 4AZIA 1G01A 2E3ZA 5EB8A 3ZJ6A 1QI4A 3ZJKA 3MSDA 2JE8A 3VO0A 5ABGA 4L4OA 4DUXA 2CESA 3WY2A 3WBEA 2G3IA 1SFSA 2DSZA 1UA7A 2BXYA 4NI3A 1EHNA 1Q4NX 1UD2A 5CPQA 1HL9A 3W37A 2UWFA 1A47A 5A2BA 3CZJA 1B0IA 1ZBVA 5E0CA 2QV4A 1CXIA 2ZE0A 1C92A 3WDPP 1HJQA 4W8BA 3WEOA 2DIJA 1E56A 2W5FA 4HZ8A 1WZAA 2Z1SA 3BVVA 1E72M 1QBBA 4GZIA 1XH1A 2E9MA 1FHLA 3K4DA 5KZ6A 2JFEX 3BAXA 3CMGA 1E4IA 2F7PA 4CU6A 2D3NA 3VGDA 2ZX6A 2FH8A 1W2PA 3VIJA 3WMSA 3I3BA 4AD5A 2Y5EA 1HN1A 1UWSA 4KGLA 2DDXA 3L4VA 3CUIA 4AZHA 4QDMA 4Z2GA 1HJUA 4DO5A 1B3XA 1XGZA 1EGZA 3RCNA 4CN4A 5BCAA 1UD3A 1K9TA 3WH6A 1BG4A 2BVTA 3KWXA 1TR1A 1W2VA 4AD2A 4C7FA 3ZSSA 2NT0A 5EBAA 3I3DA 2GUYA 4AY1A 5AYIA 3VIKA 2EQDA 2D0HA 3N04A 2OSXA 4P8XA 3ARPA 4CU8A 3CV5A 4J3VA 1XD0A 4RL3A 3SCTA 1W9UA 1CGVA 2D0FA 5HPOA 1M53A 2EPNA 2G4FA 2J7CA 2BVYA 2F7OA 2WBKA 2PWHA 2W91A 3W29A 1BTCA 1CXEA 4TX8A 1XCWA 1VBRA 1HP4A 4M80A 3EDKA 1V6XA 1LLOA 3CHEA 1OD0A 2Y2WA 2J7FA 2WMHA 3ARSA 4HOZA 2GJRA 1J0KA 4UQDA 2EPLX 4XX6A 5TD4A 4A3HA 3WFZA 4AZ5A 2DT1A 1GVIA 4AWEA 3QOKA 3ARXA 2XFFA 3GDBA 1QPKA 4M24A 1MYRA 1V6WA 4PMDA 3UG5A 2WVSA 2ZXQA 4MB4A 1BAGA 2CITA 2Y8KA 1OD8A 1MWOA 4AC1X 2XSBA 3EYPA 1B3VA 3DX4A 3VMPA 1BVNP 2WWCA 2EPMX 3BMVA 3K1DA 2ZX7A 4MAZA 1HX0A 1VEPA 5ABHA 1J18A 2WMIA 2X2IA 1HNYA 4UFHA 2F7RA 4ATLA 5CXPA 1TVNA 4WKAA 1H11A 2WSPA 2CEQA 3B9AA 1GOIA 1UD5A 4W7UA 5CPSA 1FFQA 2D0GA 1XHGA 2GJXB 4ATDA 3A21A 2WHJA 1NARA 1V6VA 4IUGA 1VIWA 2ZXBA 1DWHM 4V27A 3PZVA 3K8KA 5BXSA 4U31A 4U2YA 3QGVA 3ZQ9A 1MQPA 1CXLA 1H4PA 2BVDA 2XG9A 5A6AA 1V0NA 1JDCA 2Q8XA 4A3YA 4YHEA 4AMXA 3BUDA 1W3LA 1E6NA 2BV9A 3VIHA 3CTTA 4W8AA 3ZT7A 2YIHA 1ISZA 4JFSA 3CUJA 3UETA 3WF4A 2XFRA 4ACYA 3ARRA 1UYQA 1E4LA 4UQBA 2G3JA 5JUVA 4UQ9A 3WBAA 4H7VA 2WNWA 1R33A 4EANA 4IPNB 3AHYA 3QOMA 1VJSA 3DX1A 5A6KA 1EH9A 3MMDA 4PN2A 3BUBA 3WQ5A 1ODUA 3WIJA 2FDMA 2XN2A 3K46A 1Y7VA 1V6UA 3PZIA 3HJEA 4W5ZA 5A6SA 1NWUA 3CH9A 3MI6A 3WN6A 3BGAA 3GZAA 1V02E 4KMQA 2VR4A 5A6BA 1UKOA 5FL0A 3RM8A 1IV8A 4JKMA 3L2LA 2J7BA 1E15A 2DGAA 3FAXA 4ZE5A 1R7OA 1E6QM 4J27A 2G8ZA 1JL8A 2XVGA 4FF5A 3GNPA 2WZIA 1SYTA 1VF8A 1PX8A 1GNXA 2DH3A 2YL6A 4CGTA 1PJ9A 4DM2A 1JI1A 2J8GA 4XB3A 3W0KA 4HZ6A 3BC9A 2XFYA 4PTWA 1CDGA 4W89A 3CBWA 3KLKA 1B3YA 4N42A 3GXNA 3WH5A 1QNRA 3GXTA 1ZS2A 2JF6A 1QNOA 2CBJA 4U3CA 1HKIA 3VGHA 4J3XA 4PUEA 3QR3A 2XIIA 3AMGA 3SUVA 4MNKA 1W1VA 4PMOA 4MB1A 5CPTA 2EPKX 3OGSA 3WD4A 2X2YA 1HJVA 2ZICA 1BHGA 4ZXOA 2YL5A 2FGZA 1V3JA 4URIA 2PB1A 4PUDA 2CBUA 2E9BA 1XV8A 2QPUA 1XCXA 3KL3A 2F61A 2VURA 4BQ3A 3KL0A 2WZEA 1C90A 3MUIA 4FMVA 4UQAA 4GI6A 1EHAA 2IXVA 1UWUA 3WMBA 2ZUVA 4LYRA 3FAWA 2VT0A 5CGMA 1VFFA 2EJ1A 5FIPA 3CLWA 4WSJA 1E3ZA 1UR0A 2ZX5A 3VD7A 1W9BM 2DSVA 2WHMA 3EDFA 4TTGA 4FLSA 3BAJA 3AHZA 3PZNA 5AY7A 3PZTA 1JZ6A 2BY2A 1R87A 5I78A 1CYGA 3WQWA 1HJSA 4FNUA 3SURA 2CXGA 1V3MA 3G6MA 1JXJA 3BCDA 4W7VA 7A3HA 2F7QA 1B3ZA 1X6LA 4MNLA 4HMDA 3ALGA 5FOOA 3GH7A 4PTVA 1V0LA 1UKPA 3BVWA 1X6NA 2XSAA 3H55A 3S5YA 1UKQA 4HTYA 1KR0A 1WO2A 3VINA 4DWSA 3ARQA 3LXAA 1EOKA 4NF7A 1E40A 3AIEA 3BVTA 4AZCB 5ABFA 4PMZA 4CD8A 3CGTA 3VIMA 4W7WA 1JF6A 2EABA 4QP0A 3HU7A 3GBEA 1W3JA 3NSXA 2X8RA 2J4GA 4UNIA 1J01A 2C0HA 4KGJA 3GXIA 1TQTA 1BGAA 1XC6A 4V2XA 3S6TA 3WH8A 1HWWA 2BHYA 3WQVA 1J11A 3WUFA 2W66A 4GPNA 3NIYA 4MJ2A 4CD7A 1GCYA 5BXPA 3WKZA 5I3DA 2A3CA 2YKKA 4MAVA 3SUWA 3W24A 2ZUTA 4D1IA 1HF6A 1UKSA 3OLDA 1CXFA 3BLPX 3M46A 4NZCA 1CZ1A 3ARUA 2DQXA 2CNCA 1RD6A 2IGTA 4CCCA 3LX9A 3O6AA 1JZ3A 3RILA 4JFVA 1K9EA 4OOZA 1V0KA 4HA1A 4AIOA 1CBGA 3SUSA 1LWHA 4JHOA 1AQMA 3VDBA 4GQRA 1LL6A 4WJXA 3THDA 3VSUA 2NW0A 2D24A 3PN8A 5LA0A 1ZBCA 1EO7A 1RH9A 1GPFA 2VTFA 3AIQA 1QI0A 1GQKA 3VTRA 1ESWA 3CHFA 1KR1A 1BLIA 3L4XA 1Q6EA 1R34A 1F4AA 2W67A 1GJUA 1Q6FA 3VIGA 3AS0A 1QHPA 3KEHA 4X9YA 2ZX9A 4QCFA 5GNZA 4GI9A 2E4TA 3BSHA 4PSRA 2VCBA 2PWGA 3CZSA 3LPPA 3T2OA 3M6DA 2PF0A 2QPSA 1E6SM 3ARTA 1GONA 1HL8A 1KCKA 4AZGA 1JYXA 3M07A 3WFLA 3CMJA 2ZX8A 4M29A 3RMEA 3VMOA 4GZEA 2WC4A 1KBKA 4XZWA 2WMGA 2WC7A 2X0YA 4DO6A 2J79A 3AHVA 3AHXA 2V5CA 4CD5A 1J0HA 5I2UA 1C3FA 5LYRA 2A3HA 3TA9A 1QW9A 2BS9A 2F1AA 4H8HA 1NOFA 2WMIB 3T0BA 1TUXA 4NZJA 1E5NA 4J3SA 2XUCA 2VZUA 3AICA 2OW7A 2ZOXA 3VSVA 1JGIA 2J78A 2F8QA 1QWUA 4WIWA 1CNVA 1UHVA 4EK7A 5E1QA 2WCAA 2E8ZA 1VB9A 2YA2A 4CKQA 3A47A 3N13A 4PTMA 2PWFA 2XWDA 1QNQA 1G5AA 4HMCA 5CJ5A 2QLYA 4ZXLA 1W9VA 2OLHA 3II1A 4JFTA 3BAIA 4FNQA 2DSKA 4HU0A 4LGXA 5A1AA 2C8NA 1VRXA 4GQQA 3U57A 3L2MA 2E40A 1HXKA 4GXPA 5I77A 1XSJA 1W9DM 4BF7A 3TTQA 4NSBA 4U5KA 3D5HA 1KGWA 1WCGA 4XV0A 2WAGA 4LX4A 4UFJA 2DIEA 3W53A 2VCCA 3MMUA 2VNCA 1HT6A 1BQCA 4WK9A 1DWIM 3GNRA 3WQ4A 3WL0A 5JBDA 4OIFA 4YHGA 1U33A 4MNMA 1TA3A 1ISXA 3DECA 1DWGM 2HVMA 4OKDA 3W6LA 1V02A 4J28A 4KRUA 1JFXA 3A23A 4D6FA 4ZENA 1NWRA 3VM5A 3UR8A 1JZ7A 2VRQA 3HG2A 1NP0A 4TUFA 4Q7NA 1ZL1A 3EMCA 3WD0A 1KXHA 1UH3A 2O9OA 5CZKA 3AFBA 3BSGA 1KTCA 1L0PA 3LRKA 5BROA 2WBGA 3TOPA 4E4PA 3W6MA 1ODZA 4OZOA 3AMDA 3OLEA 3AXXA 1UH4A 3DYPA 1QHOA 4P8VA 3WUBA 1M03A 3A24A 3UESA 1VFMA 2ZWZA 4NRRA 3VILA 2AOSA 2PWEA 3MU7A 1F4HA 3LXCA 1Q6CA 3ARZA 3AYRA 4W5UA 1BFNA 1OIMA 3AMKA 2A3AA 3M7SA 1MQRA 1NM9A 3LPOA 1GOQA 1Q6GA 5HOSA 2CBVA 2CKRA 1V03A 1WDPA 2WKLA 1DHKA 1XD1A 2JEPA 1MXDA 5E6ZA 1W32A 2YBUA 4P7QA 4B15A 2XVKA 4UZUA 2D23A 4B16A 1NH6A 2YBTA 3AISA 2WM0A 3RO8A 1KXQA 2UY5A 1JXKA 4BA0A 2UY2A 5D8WA 1IZKA 1UR8A 3ZR5A 3RIKA 1ZU8A 1US3A 1J12A 3MUY1 1KGUA 1JAKA 2Y24A 2W62A 4OBSA 2VQUA 1OGSA 3N15A 5BRPA 1CENA 1QI3A 2WKGA 3VD9A 2J75A 4RE2A 5AC4A 4HOWA 4JFUA 4LPCA 2WMKA 4R5EA 4U5IA 3HZ3A 2F18A 1ZBWA 3HG4A 1DP0A 4JL2A 2FGLA 5EMYA 4AMWA 3D3AA 1QOXA 2EEXA 3MKKA 3DYOA 3WNKA 3QHNA 5D9OA 3THCA 4ACZA 1XYFA 2WSKA 1H1NA 4B9YA 5GNYA 1UWIA 4M82A 1V08A 5LA2A 3L4TA 3NUKA 2A3EA 1HVQA 3PZUA 2AMGA 3IJ9A 5E9AA 1OBAA 3DHPA 3APGA 5D8ZA 4MADA 2ZUUA 3AXIA 1E3XA 1WZMA 5M5DA 5F7UA 4Z2JA 5A8PA 3WDIA 2EADA 1UUQA 3AJ7A 3WNPA 4ACZB 1JZ8A 1UR1A 2Y8VA 3TTSA 1EO5A 5I5RA 2HISA 3WNNA 5JIWA 2GVYA 4UOQA 4GKLA 1KCLA 2X2JA 3NCOA 3RJYA 3GXPA 1J0YA 3MMWA 3DX2A 5LA1A 3AS1A 3WUGA 1H09A 3HN3A 5A6BD 2GJXA 2FHFA 3WL1A 3A5VA 1E1EA 2QMJA 4PEEA 2O9RA 1XSIA 4HA4A 5E6YA 1TCMA 8CGTA 5ABEA 1J0ZA 3BCFA 3ALFA 4PMNA 5CQ1A 1MW3A 1WE5A 2XYLA 3GXDA 1G94A 4AIUA 2WK2A 3G6LA 3W26A 2DPEA 3AHTA 1UG6A 5HNNA 5IFPA 1QWNA 3F4VA 3LPFA 1R47A 3W25A 1AMYA 2VVNA 3CC1A 3GH5A 3IJ7A 4BCEA 3VOCA 2J7EA 1CLXA 1CGTA 2WVTA 1HXJA 1V3LA 4JAWA 4WKFA 4F66A 3BLBA 2FHBA 9CGTA 3OLIA 1E6RA 1R86A 2ZUWA 1XH0A 4ZFMA 1AQ0A 1QNPA 1SR0A 3T2PA 5JBEA 1WZKA 5A6LA 3CUFA 1JZ4A 3NSNA 3BAKA 2VL4A 3S2CA 1JF5A 4UFIA 4E2OA 3VM7A 4Z2KA 4OJYA 2IXUA 1KWKA 3MUAA 3WH9A 3UCQA 4AD4A 1C8XA 2V3FA 2OSYA 3ZSTA 2VZOA 3OLGA 4D6IA 3WDRA 1EOMA 5GQBA 4UOZA 1ECEA 4EAMA 1MW1A 3SCVA 1ZB5A 3D52A 5HPCA 2UY3A 3DX0A 3NYDA 4BQ4A 3B9EA 1X1NA 3WF2A 3DX3A 1H41A 2QMKA 2WMJA 3ARVA 3PTMA 1C91A 5M3WA 4B3LA 2GJPA 1BYBA 2D22A 4BQ2A 3AXHA 5JIPA 3PTQA 4AYGA 1JYWA 1W9XA 2O92A 5DFAA 3VVGA 1W3KA 1JFHA 4UTFA 4MPKA 1UKTA 1B9ZA 3CPUA 2J7DA 4JFWA 3J7HA 3CZGA 2QF8A 4XZBA 4NZFA 4DWSB 4PSPA 3K8LA 4HOXA 5ABFB 3EJSA 4HP5A 1M01A 3BUIA 3VMNA
chains in the Genus database with same CATH superfamily
3TBWA 1T7ZA 1MH5B 4DJDC 2ZOOA 1FYTE 2OYMA 2VR9A 3P2TA 1WBJA 3AOFA 3IVUA 5M5DA 2XGBA 5GGRA 3TWYA 3KE0A 3MLZL 5FM5O 4L2LA 3BYYA 3BXNA 3TBYB 4U3XA 2GDQA 3B9VA 1EGVA 2ADFL 5CGTA 5EU5A 3V6FB 1IILE 4L1TA 4UANA 3V0DA 4C83A 3DO7B 1FWDC 4ONFL 5DZVA 5TF1L 1MWAB 1RUPH 1PG7W 3UZVB 3S4SA 2GSIB 5I79A 5GS0D 1XIGA 2Z1KA 1H3TA 3JWOC 4JZJB 4WFFE 1WVZA 4R90L 5F3HA 1V3IA 1KJ2B 5EC2A 5DDHA 3L0GA 3LHWA 4Y4FC 4AFYA 1NIDA 2JELL 1MEWA 2FZNA 1O9ZA 4JBRA 2Y6SD 1SBSH 1KPRA 3LQAL 4KTDL 1RK7A 4WSGA 2BNJA 2E7BA 3FJTA 4Q4KA 3EHBD 1DQDL 1H6EA 5AKRA 3UG3A 4UNVA 5SWSE 1XF1A 3NDYE 1NCAH 2YDSA 1D5RA 4CMMB 4X3ZA 4YBLC 2AKRA 1FN4A 5LUMA 1W5OA 3NPUA 3PTKA 4K8HA 5E6IC 1Q9OA 5D6CA 4OM1L 3QJUB 3HHSB 3MOAL 2JBMA 1P0DA 1QRNE 1MXGA 4RLDA 3LCHA 2OWWA 1ACCA 1G87A 3COTA 3BQUD 4C6MA 2YYTA 1B0WA 2FLBT 3FQTA 3BLKA 4K15A 4OZGA 3UTPD 4PGJA 1SVCP 1NFGA 2ZOLA 1W9PA 5FFLA 4OV4A 3ABSA 1XCTA 4MLJA 1GGCL 2JKLA 1A5LC 3PRZA 5FF2A 1KM6A 1U93B 1NCDH 1LP6A 1T1YB 5F6IB 4RE3A 2VDOB 2PPEA 3KJ6L 4TNVF 3UYPA 2BOGX 3HPZA 2BIPA 2H6OA 4HTBA 3V7MA 5MEND 3E96A 4DW2H 3N9SA 2NY5L 3S7GA 1TTAA 2MPVA 2V69A 4F8XA 2OJZL 3CWGA 5B3JF 4K3EH 2AV1B 1XDLA 4Y4HC 2OPJA 3JV6A 4N1HB 4EAEA 5L4JA 1LE9B 2VW4A 4JFEA 3NZ8A 4JN7A 2GT9B 2YFOA 5EDSA 1J0IA 2IWFA 4UCFA 5D5ME 4QLJA 3RP1A 4FNLL 3GSNA 1E9IA 1TZ8A 3FO9A 4HCHA 5IXEA 2V5KA 1TVPA 2R0ZL 3PWPD 3PL6D 3I4EA 1A6VH 4ACPA 1E9PB 1MHEA 2BOBA 4KDWA 1XGDA 1GIGL 3F04A 2UXTA 4MNQB 1KBGH 3H8NA 3DV6A 1R24B 3AAZB 2CIPA 2I9UA 3EMZA 2YPKB 3T78A 3U4FA 1R3RA 4AUBA 3AY2A 2ZYFA 4I90A 1CG9B 5BWFA 4Z3HA 4JKKA 5LHFA 4GFXA 4XCCL 4YBLB 3O63A 5CGQA 1O6SA 4PHZA 1JZ5A 5ICZB 1KO0A 4NFDA 2WQRA 1RVGA 2OZ3A 3C2FA 4BK4A 2BIHA 4YDJA 3EJPA 2IPKA 3B8SA 3FB7A 5C0FA 5DJYB 3TF7C 3MVIA 1G7HB 3LKSA 3HNVL 1KF9B 4NKIL 1EJTC 3CWHA 3OYZA 5G55A 4FQXC 1LQ0A 5BOJA 1SM3L 4YZWA 1U8CA 3CQ0A 3O8AA 3V0JA 1QD0A 3TPKA 3GSRB 4LHUB 1N59B 1XSKA 1YEIL 4LRNH 3WY4A 3UAAA 2A3BA 4V15A 1E4KC 3E8UL 3LEVL 2UYLB 4K36A 3CHOA 4BUGA 3B3DA 4O52A 3FN0H 5AKTA 5KVGH 2DWYA 5AB0A 3U82B 4HLZH 5BW6A 4EQ3A 5CGYC 4JBSA 3DTXA 5E08L 2I1OA 2BVEA 3CZNA 2I9LB 1DUYA 5DZPA 3L5JA 2V5MA 3VD3A 1KIUA 1V79A 4HPNA 4N9GA 3W7EA 2FD6L 4NZTH 5FYKU 3A3XA 2LT9A 2NT1A 3DX8A 4P4KA 5K1JA 1GEHA 2DUZA 4Y4KA 1U3ZA 2PGWA 2VVSA 5FAGA 4MNQA 2BWDA 4MKMA 4Y4HB 3H9ZA 4OKVB 5DHMC 3O3BA 3T3PE 3L2IA 1QTYT 2IPTH 2VXTH 3GSMA 4XSMA 4CUCA 4JM2C 2F8IA 4IS6B 4KZ0A 3I6KB 2D3LA 1YDYA 2UXGA 5LAPA 2XVNA 1W6LA 4JE0A 1EEZA 2DVXA 1DVQA 1F9CA 2FHCA 4D94A 1A8ZA 3GHTA 2X9ZA 1KTRL 4P23C 2ZRUA 1I31A 5C9ZA 4J7RA 3R2GA 1HHHA 1T21A 3DUUB 4KXCA 1AD1A 1H1YA 4FS9A 2UZYA 3GMMA 5A6SA 1GZQA 4JREB 3VKDA 3VFMB 4OH2A 5AYQA 4XBMA 3UC2A 5EH1A 3UA4A 1TB3A 2PDFA 1UWAA 5D7JA 3R25A 1C5BH 1FL5B 2CJUL 2QTEA 1U8HB 2RFXB 4QWWD 4XPHL 4MRBA 3RURA 1BYDA 4JFFB 4EI5D 5GJTH 3QNYA 2P3YA 2ZOKB 2YXFA 4WHYG 5CZ0A 4NS0A 5ADOL 4HW6A 3EBVA 1ZJAA 3S36H 2H3NA 3DX7B 4UV7L 1NANI 4TRPH 3RY6A 3MC0A 3LY0A 1OPGH 1I0BA 1XF4A 3TT3H 1DQLH 2BGQA 1ZHLB 5C2GA 3R58A 1PZ2A 3ZGHA 1E51A 1AI1H 5ALCL 1ZDQA 2EACA 3H85A 4X7SL 5C0IB 3G1VA 3N3TA 4ZL1A 2ZOTA 5I8OL 3GS0A 1IQ8A 4ONGH 5CEXA 3BWAA 4PJXA 2BSTB 4DZ8A 1MQQA 3VJ6A 3LNEA 1L3WA 4M9PA 3GDRA 3GNNA 3ABKB 2YPLB 1GJWA 3ARBA 1N68A 2Z7ZA 4R2GD 4X80H 4KU1A 4MTVA 2QQQA 1S7TB 4JO1L 3QHZL 1RU9L 5CLTA 5B7MA 4XISA 4MD4A 1ACZA 4KKCC 2EVIA 3CUXA 1S8DB 1MFAH 3GG0A 4Z78A 3SODB 3B0YA 3BO8B 4YXKL 4CNSA 4XBPB 3ZE2F 5E2VL 5EGRA 4ZEPA 4F58L 3KPMB 2D2CC 3DVIA 4GS7C 3VFTA 2GIYA 2HJLA 4GEIA 3E3HA 2BSEA 4HZLA 4GAFB 4WI3A 3RY4A 3RZCD 4K0OA 2K7QA 3WJJC 5BQ7B 1C9SA 4PMQA 4ZCWA 4QS5A 1BM3L 3W81A 4BK8A 4PS8A 1A02N 1AMXA 2BXZA 3LAFA 5I1HL 4G56A 5I3GA 3NCYP 3HE7A 3QR2A 4KMLB 5HDBF 1LDPH 3LMJH 4XOCA 5IHZB 5KJ7E 4URTB 1QKZH 3TQ0A 3DRTB 1P4IH 5JHDD 3UPAA 3UVIA 5A43C 1TCRB 5BO1H 4GG6F 2VERN 3BESR 4G7QB 2XN1A 4L9LA 4XHJC 2TSBA 5KTEH 1Z5YD 3KPPA 5MP6L 4H6RA 2BMBA 3WYZA 2DD8H 4QKTA 1FX6A 1H0GA 5F3BA 3P73B 5D1ZA 4R7NB 5JXEC 1B0GA 5F2LA 3VUPA 4O1AA 4GIOA 2OZ8A 4M1CD 3IDMB 4MHHG 5JW4R 2A0LD 4DUVA 1ZENA 4YFEA 2R15A 3ATFA 3EOBA 4NJGA 2UUDK 5DD5H 3DBSA 3RWEB 3MSGA 4DKFL 3OB8A 1TFVA 3AZRA 3QRHA 2VAJA 3CNKA 2DLIA 3BDXA 2HG0A 4P7NA 1E4JA 4NNYB 2C4FU 3X12B 3EGXB 1O5KA 4JHVA 2GJ6D 1OAUL 1PZ3A 2XNAB 1UD4A 4MVBD 3U30C 1H63A 4IHBA 4PJ7A 4E9XA 1MCHA 1A66A 1NFDF 3VXRE 1B9BA 1ZAHA 1X5AA 1E28B 2EDNA 1MHCA 2EAEA 1M6OA 4PREB 4WFHE 5I8EA 1AVAA 1BF2A 3AACA 3MJ9A 5BZWB 4ABUA 3WTYA 3PUOA 3KWTA 4X99A 3DGRA 4D0CB 2R29A 4HDIA 3CLEH 3EGSA 3QYMA 1QT1A 5DD6A 1UOKA 3SJVA 4H41A 3B2VH 5BV7H 4D6HA 2PCYA 1XIBA 3M4HA 4WJ5A 2O5XL 2XQ0A 3EDEA 5D7KE 2ZKHL 2IKJA 1PY9A 1IC5L 3MHGA 1EA9C 3H9HA 1AXIB 4Z77B 1PHWA 4FLHA 3UXFA 4L8DB 3CLEL 5IW3A 1GOHA 4OTXH 2UZIH 2ZF9A 2H32B 3IRDA 3IFLL 4HIIA 3PANA 5XINA 4XVTL 3HG1B 4URIA 1ZLEA 3ZQWA 4YFLI 2PRLA 3ELAT 1ZT7A 3NIFB 1UA6L 4H5SA 4HIEA 4K5PA 1FNGB 4J2XA 1OGGA 3UEQA 1N12A 4XZUA 2YPVL 1ADOA 2Z34A 3O8XD 4B9GA 2WJ7A 1A3WA 4GP5B 1WD9A 3BZEB 2EPHA 3NABL 3ZYZA 4KKAD 1X1OA 3SCMD 4IRSC 4AUJA 1M2VA 5TQ0L 1MRCH 2G5UA 1OSEA 5CD3A 2WY3B 5DJXB 4C6CA 1NGWB 4LSUL 4RMBA 5L4FA 4KBXA 4W9HC 4AYDC 4UILL 2ZP9A 4S10A 3NZRA 4D3CL 5IDIA 3ECQA 4OI8A 4QNWA 3TCEA 4NC1E 4UUJA 1BFOA 1IL1A 3GLAA 4JN1H 1Q45A 2J1ZA 4L3FA 2DY3A 3DKJA 1BGXL 2XZQH 4RR4A 4F0RA 2ZXGA 1NMCC 4IJBA 1WDWA 3ULVH 1WC7A 2VSDA 1LK2B 3P5YA 4XPFH 4GJIA 1K4DB 4XBEL 4X2UA 5TK4A 1G0CA 1H5BC 3OZMA 3JQOB 4D9PA 4TXEA 3W27A 4WRHA 4H9TA 5AWNL 4LYKA 4JPKL 4QHMB 4NILA 3TW9A 3OOQA 5JW4M 5C0AA 2GLKA 2G3NA 3H54A 1ZQ5A 5AC7A 2YAQA 3O7UA 2HG5A 2ITDA 4JLRB 4N26A 3AB0B 1NCBH 5AYUH 2NW2A 3L3HB 2Z4QB 3QZBA 1KTBA 2GQ3A 3W7IA 3QNZA 4EOUA 3LKQB 3PAVA 2HNHA 4C54A 3W1MA 4K8RH 2DKUA 1RZFH 2IXQA 1I45A 1IJ9A 5LWYH 1OCCB 4PJ7B 2G3ZA 4GW1B 4Y5YC 3VFCA 1WC7B 2WCSA 1UM6H 3IT8D 3M1BA 5CBIA 3NRPA 3GSOB 4HK0B 2PDLA 3S8HA 1FGNL 3T2NH 2FQGA 2VX5A 4GZJA 1GKRA 2WXOA 4RVBA 4UUJB 15C8H 3C09B 2HXAA 1WAPA 1S7QA 2A9CA 3ULUE 1RR2A 2AK4A 4LCWA 2EO9A 2P46B 1L9WA 1TV4A 1MCEA 1E9OA 1KLUB 3QPKA 3MYPA 4BWLC 2WXMA 4NQSB 4DP1X 4S1DD 1RP9A 2VGBA 1AD9B 1YEJL 1WKYA 2AEPL 5MHSE 4HK6A 3QZOA 1KGCD 5F1NA 2YLHA 5T3XE 2Q6ZA 4QHKI 1ZGDA 4JPVH 1V7AA 2ARJA 2J43A 4HUCA 2AQ3A 1X5GA 5HDBE 1REIA 3TSMA 5KW9H 4ERAA 3BE1H 4FFWC 3UR7A 2AK4B 3SCRA 1CI3M 4JIHA 4CVZB 4ZFFB 2PTYA 4P46A 5T33L 4GGHA 5U7SA 3W7KA 3C0LA 2GJNA 1D9KB 4KV5E 2FL5B 4OJFH 5A6JA 1OK6A 1I1AD 5K9KB 1SLVA 3VG9B 1FBAA 2YPLD 4XZMX 3BEVA 5H2BA 4YH6A 2PS2A 4L1LA 3SN4A 4TNWF 4O02A 1NUGA 4F80A 4MKVA 1LWJA 1J10A 1TIUA 4JFDA 5C0RH 2A4CA 1VQTA 1ZNNA 2Z2AA 4GBDA 3DTDA 4EDWL 1PEZA 3BUPA 2FBOJ 3FT0A 4FI7A 2DMKA 1AD4A 2VLRE 4TMBA 4LLVB 5FDWA 3PB0A 5KVEL 3UTSA 3Q2NA 3VXQB 3W70A 4J4PA 5LNDA 1FA2A 4AM0B 1JRBA 1TQJA 4TQTA 1WAEA 2BZCA 4MLRA 1QXLA 2LABA 4AMKL 3WMLA 4JFZL 4NX5A 3V4PL 5DBTA 1KN4H 5AD0B 1VA9A 2IGLA 2YXWA 2VUYA 2XNAA 3MRMA 3PY2A 2VKWA 1IZJA 3CAFA 1WD8A 5K5YA 4I9JA 1MREH 4J1UA 4OBRA 1OF2A 1U1UA 1CVSC 3VIIA 1TJGL 3BP5B 3QIUD 1J1PH 1XIWB 4BFIA 4U1IA 4YWSA 4RLIA 2D7PA 5A16A 5DZOA 3B56A 4OT7A 3FT3B 2DN7A 1MCFA 1UR3M 2HRGA 4C4KO 4JPGA 1IBGL 3U0HA 3CHSA 4PI0A 4XC1L 2CBIA 4DBWA 1J0JA 3NZSA 3IFPB 3PBYA 3VFNB 2NY1D 1L9OA 5IFTA 4D9RE 1RZ8B 5DQDH 3BD3A 3CVCA 4GMTL 4A7QA 4XCCH 2X30A 4I5BB 3AQUA 4JTFA 3ILQD 3C8DA 3SBRA 4M7TA 4W87A 1KQZA 3VG9C 5E95B 4Y8DC 3OMAB 4JCLA 2O6EA 5I82A 5A3HA 1RJZB 3HEIB 5SWZB 2EPOA 2NPLX 2W27A 1NDZA 2NSXA 4Q9RL 1OK4A 1JGLL 4NXSA 4XN2A 3QHTC 3T77A 1DJIA 5FJRA 1XF2A 4PJ9C 3A3YB 1TT6A 3D51A 3EJYD 1BVKB 2WVVB 4F1ZA 1J2BA 1Z9AA 1GOXA 4L6HA 1O5XA 2MH4A 4OOUA 2E09A 4PRNB 4U3SB 4UTAL 2BLFA 4X0KB 3QF0A 1TU2B 1S78D 3L3IA 3VX0A 5E6RB 2ED7A 2WINA 4UYQA 2VC9A 1NL0H 3RXZA 4Z1BA 2XG5A 3TEZA 1W1ZA 3FN3A 2WYSA 4ZS6C 2WHLA 2VE6B 1ICQA 3KZSA 1J8HE 1R8LA 1HZKA 3TSBA 4MS8D 1JGDB 1TCDA 2LVEA 1P7QD 5E8EA 3U0TB 1XIWC 5E93A 4POZC 4RXFA 1UWRA 3QHOA 1XF4B 4E6MA 1JPGB 3D39A 3V9EA 4IG2A 5CKSA 1SDYA 3NRFA 2MNUA 5KVDL 5CSYA 3QJFA 4Q4EA 4U3HA 4RV8A 1U6AH 3TXAA 3VW3H 1KCZA 3OKOB 4IGBA 4OSUL 4F7MA 3OG4B 4Q3MA 1A7NL 1GW1A 4ANUA 3WNIA 1JPDX 3WDQA 1KEGL 3ZJ7A 4BZ2A 2OA9A 1ZTXE 3TWAA 3TONA 4QYOB 4QHNA 1E9LA 5I8KL 3C5SB 4YHOH 2XFGB 3CZFB 3YPIA 5J12C 1GZ1A 5IEHB 3BG9A 4XKMA 1MFBL 2GJ6E 1HHIB 4F8QA 4X4YA 4ZFQA 2WLZA 4XPAH 3BSZH 4FTDA 1C93A 5IOKA 4FEZA 3B6SB 4FYSA 1K8XA 5TNVA 3IWUA 2JLPA 4IK7A 4QO1B 5EEVA 3MV8D 4HPOL 5I16B 3LOTA 3UNDA 2VM9A 5H8PA 4CQBA 3QXWA 3I2CL 4J4KA 1GVYA 1ZT1B 3V6BR 3N40P 4I18A 4GEJA 2VDIA 5EBWB 1EIBA 1I4FB 4NYLA 1VFTA 4GW4A 1YPZE 3SE6A 4MY9A 2DWEB 7TAAA 4PJ7F 1W1PA 3CV2A 3E3QE 4AMAA 3DX6A 2ACUA 2P76A 5K9CA 4YK4C 4P99A 4I5BA 4RZCA 4XIMA 1UA6H 3KPSA 1M7IB 4E3TA 3QUYA 4L18A 3KWVA 5ACMA 5HHQA 1ZDSA 5KTLA 3GKZA 1HHGA 3W7JA 1AODA 3C6LA 2OT0A 1BV8A 3EJUA 3F7JA 2K8QA 3Q9QA 4AZ7A 4NO3B 3FTXA 5D1XD 5D30A 1TO4A 1I8KA 4UOJA 2C79A 3PBGA 4IBUA 2F6UA 3IKCA 1ZCRA 3S9ZA 3ZTNL 1TKWA 4J4PC 4Z7AA 1PO9A 3Q2DA 1OX4A 3V95A 1S2EA 4PW3A 2HJPA 5F7MC 3FUEA 3VI4A 4KK9C 4LOFA 4ZPTA 4KESA 4CMMA 2J2ZA 4N0RA 5FAAA 5I0WA 5GZOA 4LNYA 3TJXA 4ZFCA 5D93C 5E0FA 3KNBB 4GG6A 3ZDXE 4YHLL 3ZDXF 1HHKA 1IAKB 3KBFA 3QC5X 3EPNA 2WXQA 2AEQH 3MR9A 1F0LA 1MLBB 3EX4A 3S37X 4RBPK 5EIIA 1JP5A 1PKQB 2PRMA 4HHLA 2BJML 4MYWB 5LIXX 4BA8A 3EZ4A 3V7AG 1EO8L 2C1IA 1EL3A 1I8KB 3NJLA 4DSYA 3B5HA 1GW9A 3QO0B 4WKHA 4GRLD 4XCYB 1ODAA 4DCQB 4G5ZL 3TA3B 1TV7A 4BRJA 5AVSB 1LHZA 1TE1A 2WWKO 4GO9A 4GPVA 4AGNA 3Q6GH 3GFUA 3NJKA 1TWIA 2F8OA 2X42A 3NZ8B 1Q7MA 1KPVA 4LMQE 4CBZA 3DAQA 4A21A 1F3JA 4PMYA 4EXAA 4P9HC 1LOQA 2E77A 1EWEA 1WEJH 4UQ3A 3B83A 3NACL 4TNFA 1ERNA 3US0A 3AM8A 2XM1A 3OWRA 4YYCA 1LORA 2ZC1A 3L1OL 5T1JA 1JMXA 3ETSA 3LA4A 3TN6A 3L3GA 2J57A 1NGZA 2XA8H 4NHCH 1F4WL 1H3WM 2LOEA 4X9SA 3VACA 1HCYA 2JIXB 1Z41A 5I5JA 3RWHB 5K59E 3IJDA 3OIXA 4ELKA 4KK6C 4LY8A 4F7EB 3TLRA 3V4VH 1O1HA 3GNOA 3GVWA 2CHNA 1J9YA 3S1WA 2F6AA 5E94A 5EPDA 4LCCC 3FCSB 1QYGL 4F9DA 1H7WA 2YGPA 4ES9A 3E3QC 4LLUB 3U0WL 4AE1A 5KN5A 1IC5H 4A7TA 1KM3A 3KHJA 2HRLA 2ZWNA 4F79A 4OFDA 4EKJA 1W1TA 2XWJB 5DR5H 1QA9B 4DVRL 3D46A 1JPFA 3FA3A 4AK2A 1AJZA 4NYUA 3O6KH 1X5YA 4RISH 3UBGA 1G7HA 3LKSB 4FA6A 1LDSA 2IKIA 3HF3A 4JY5L 1PIIA 4JN8A 4MNJA 3DETD 3GHRA 1W15A 3BKJL 3HPLB 3KPRE 4FX7A 3TO2A 1H5BA 2VO8A 5DC0A 4CVXA 3RCYA 2V2WA 3WTTA 3QQ4B 4L4VB 3BOLA 3LCFA 2DEPA 3I65A 1AGBB 2HQAA 5DZNA 5JXAL 4X7CC 5G4OA 2DJUA 3DOPA 3N2BA 1O12A 5DVPA 1M1XA 1AI1L 5ALCH 4YN5A 4M62H 4Y2DA 5AEAA 4H8WC 2V2DA 1Y5VA 3HQOA 4ZOEA 3ZE1F 2J47A 3FQ1A 4LVOB 3QW4B 1KEMH 3AS2A 1SBBA 2XPGB 3HUJF 4PV1C 1TE6A 3KVPA 2MANA 3AWOA 4TUOA 1KIRA 4HSQA 1HAWA 2FR4B 2BP8A 5ICXA 5AKSA 1OLLA 4GLRH 1U36A 5E8DL 4PGDB 4EIUA 1K72A 5I66B 1GAFH 3WD2A 2DIBA 1OT2A 3CCHA 1KDJA 3AFLA 1I7ZB 1D5MB 3G5YB 2YDQA 1HXYA 4ZE4A 3P77B 3CFDB 4NQXA 3QIBA 2VQ1B 1CCWB 2V82A 1AGCB 3LIUA 5DEFB 1PFCA 2CKBB 2FX7L 4D9LH 4GUPA 1NFKA 4PY7A 1WFOA 1TZ7A 1XYMA 2BDQA 2OMAA 2CBMA 3EO0B 2E3VA 3IDIB 4JHZA 3SN6N 3F2DA 1PWLA 2WLIB 3IAQA 1YNTB 5HHMD 3HN5A 4AX3A 1OGPA 3QI9C 5I66A 4OZIF 3X11A 3P61A 3T6QC 1EJ6A 3LNHA 1DWAM 2Y8UA 3QFEA 2P5PA 4BWLA 4XXCC 1PPIA 2E0PA 1T66C 4H0HB 3UMTA 2ALDA 4IPIA 3I9GH 3REWA 4OAWA 3H4FA 4ORGB 1MZZA 4B9IA 3WY1A 1I82A 3EOYG 2BY1A 4JFHD 3C8NA 4KVCL 3UPCA 5BNXD 2E9IA 3D39D 4PBEA 3BIKA 2R94A 1JD9A 3QG6B 4AW7A 1KG0B 2FECL 4ZZFA 2CO3A 3NSYA 1O5RA 3EYSH 4TMPA 2L0DA 2FWSA 4P2RA 5EFFA 3MRKA 4F3FA 5ILTL 4O4YL 5IB3A 1BQSA 1E9QA 4JFFE 1P1VA 3UJJL 1CI1A 4YDVA 3DIVA 1FPTL 2Y6ZA 4NJ9H 2HFTA 4HB7A 2GI0A 3RDTB 4N87A 2VL5B 3DX9B 5FOBB 2NTFB 3LEVH 2E6JA 5HYQA 5ID0B 2GEQA 5AAWC 2QGYA 2YLAA 3WE6A 4GGBA 3PULA 2EZ0D 2YEZA 5C0CD 4PCTA 3MCNA 1NAML 1A6UH 1N0XH 1JNDA 3VRJB 4KXZI 4ZODA 5JO5A 2EF9A 3LSBA 4NQEB 1RJYB 3L9YA 1XG3A 1UYWH 4HBQA 4QR7A 3U7AA 4B9JA 2G2PA 4QRRA 1JCLA 2F74A 4R2GB 2ZE3A 3UBXI 4YDKH 2ZZUT 4UV4L 4F91B 2R83A 3P80A 1ETJA 5CCKH 2PLKA 4X8XA 1WRFA 2VXQA 2W88A 1TTPA 4KWVA 2YA1A 4A38A 3F5KA 1JAEA 4ICCX 5I18H 3QDME 4CBPA 1Q7QA 4GLRI 1EDQA 3O3UN 4GIPD 5DK3A 4GUOA 3WY3A 1RURL 1TYRA 4HAKA 3VGBA 2JV6A 3RFZB 4L9LC 2ON3A 4FA8A 3KWSA 2FB4H 1W8SA 3MJYA 3WTSA 3O4LB 1SF3A 1JGMA 5D1QE 1JGVH 1T03H 2CYGA 3AQZA 2VRJA 4NN6B 5A2JH 1YQ2A 3PQYE 5H1WA 1HAUA 1RLCL 3TTYA 4APQC 4KKXA 5ELIA 1X96A 3ONCA 4K94H 2VABA 3EFDH 5ITBL 4PGDA 2WUBL 1GC1H 2DZXA 1K8IB 2ZRXA 4M6OL 5BS0D 1C8YA 4AMCA 3DDFA 3EO9L 5AC8A 4CNIA 3K6IA 2RAGA 2Q5BA 2P49B 4BFRA 3FQYA 3S5LG 2FDBP 1FVEA 3V4UL 1C12B 4JM4L 2I60L 3OQRA 4PM1A 5CWSA 1EJVC 4MDIB 3WNOA 1F13A 2J88A 3MRRA 3ENEA 2EYSA 3FFOA 1US2A 1EAPA 5DVKA 5HWJA 3VCNA 4YDNA 1G67A 3D2UA 2WZHA 3R8HA 4OCWH 5G4MA 5IR1A 4GFIA 1XFCA 4XD4A 4XVEA 3VIOA 2OXNA 4OVXA 1CICD 4NNYA 3X12A 1GOOA 1WKFA 3A67H 3MP3A 1KJMB 3P14A 1AC0A 1OF8A 1S39A 1C08A 3PZMA 4LL1A 1VZWA 2WJEA 1R46A 3UROR 1YHTA 1QABA 3N41F 5I9QB 3ABQA 3HAEG 3OA3A 1FCUA 2ICES 3DPBB 3APTA 4ZYKB 4BBWA 3ZR4A 4CW1A 2R1XA 2J1KA 1T0MA 3DPDA 3LKQA 4HS3B 4U1SB 3TPUA 1REQB 3M7FB 4GC3A 3AABA 1JV5B 2QQKL 2QSVA 3EBAA 4GH3A 3KOFA 3GIVA 5KBDA 1UXWA 2O6DA 2Y5SA 3RFZC 4MDPA 3FT4A 3CJJA 2ED9A 5D7LA 2L7JA 2YJQA 1HI6B 3QNFA 4YSOA 1Q6DA 3JUYA 4KQ0A 2RFGA 4ZUSB 1BF6A 2AKZA 4NB7A 3U2OA 3UY7A 3BJFA 4ZSOB 3ABXA 2YRPA 4XCNB 3H7UA 1RUPL 3QUKA 3NCFB 3C09C 2VMDA 5CEYB 3X1EA 4XNQB 3Q8FA 3GMNA 5IMOB 2V2HA 2DWTA 4W93A 5F71A 3O8XB 4LSDA 3ZX1A 3R4IA 1IGMH 3SDXB 1NMBH 2GGEA 3D2TA 2WLLA 4FNLH 3V75A 1S46A 4FFZL 5C86A 2OEJA 4JM2A 1WDSA 1NUDA 1OY3B 2OMTA 2VC2L 4HJEA 3B9DA 3F7QA 3FTYA 4OM0H 4DERA 1FH8A 5SWQA 3HI1A 1TX0A 4NAEA 4FNRA 2FTYA 5A8OA 2IMRA 4XAYA 1MFUA 2HVJA 3VFVA 5MHBA 3CZFA 3V0HA 3W2KA 1KXTA 2PBOA 1IEAA 4NAJA 1HOEA 1E67A 5ILTH 2D31B 4NZUL 4J5VA 1GOWA 2DEYX 4AITA 5C3LD 2VO5A 2BVWA 3MMDA 4LLQB 1DIEA 2O9RA 2P8MA 2PWDA 4GRMA 4R0LC 4UQEA 5LWYL 3FU7A 2OGJA 2FO4B 4PLJC 1UASA 4K7PY 4IIGA 2IMNA 3LB6D 4Z95H 3FVDA 4BY3A 5TQ2H 1MEIA 1NOAA 2EDJA 2DORA 4Y5YA 1S9WA 3IU4L 5KS9F 2IC2A 1S7VB 5FGBC 3T1FA 1R3SA 1G9NH 4DVBA 3EDDA 4HJUA 4P07A 5FOJA 4B3EA 4X50A 2F19L 4X5RA 4J4PD 4A1RA 3FKRA 3WLNA 2BNRD 4LSRH 1XUZA 4RFEB 4W9IC 4J39A 4KK9D 1TJMA 3BRGC 4M7LH 3OGVA 3N0PB 3HNSH 4XMLL 2YQBA 4XAWL 4LYPA 3MRPA 4XN8A 2IGFL 5AUMA 5B80A 4OZHA 5BXTA 1NGQH 4UM8B 1LF1A 3N2CA 5GPRA 2J73A 4NNXB 3PJUA 1DQDH 3A4AA 3QDJB 2QCDA 5JHAA 2HBXA 2Y07H 4HU3A 3MRFA 5E2WH 4HKZB 1ZT4B 2E6DA 4H2HA 2EIEA 1IE4A 12E8L 4MB5A 2NLYA 2E6PA 3MLYH 4OI7A 4FXSA 2HJFB 3FW6A 1HFBA 1E2VA 2VX7A 4RZ6A 3W38A 4BH7A 2UV8G 5ACZA 5LBGA 1LGVA 4LOUC 1DWJM 2WXPA 4AKQA 5FUOH 2E7LC 2A6DB 4G1EB 4N2IA 2AJSH 5EOQL 2I9EA 2BOCA 1DIKA 3ZHKA 4RE4A 2VZ1A 5DZAA 4A7UA 4ZMYA 2V5LA 1KGYE 1KBWA 1ETB1 1G1OA 1NGYA 3WFAA 4IOIB 2FECI 4JDTH 1ZY9A 4FTVE 1R75A 4WUKL 3C6EA 5JIIA 1UWEH 3QJHB 4EE9A 1D5BA 3DURB 4PJXF 4JCWA 1BQHB 2WP3T 5FO9A 5GRUH 2XFXB 4S1QL 1G9ML 3ISYA 3WQDA 4PRPD 4PJHA 4NAMA 4R0LB 1B5TA 4MFDA 1I9IH 3GMNB 5DRCA 4WO4B 4XNQA 3C5SA 3GZPA 5HPMB 3KOZA 1WFNA 1U8KB 3MDWA 1I9RL 5EHFA 3DFSA 3CIAA 4LVDA 4AQLA 2Q2EB 3HZMB 4JRWA 5BRQA 1JWMA 2CHDA 3T8XB 5I71B 1VS1A 4YL2A 3TTOA 5TDPA 1DCEA 2PC4A 1JGEB 2XZCL 4OCMC 2XWZA 1OB0A 2IPUK 2CDFB 5FJIA 1L6GA 4FQ1H 3U46B 3MRFB 1IEXA 3N9RA 2R4SL 2HKHL 3LQZA 4NKMA 3U30B 3SGKA 2VQTA 3OD3A 3HZYA 1S7SA 4RK8A 25C8L 3NIDE 2Q7YB 1B3WA 2AQNA 2XTLA 3N14A 4LAKA 1X3DA 4Q4OA 1HKLL 4WI9A 1HG3A 3UP8A 4CQDA 4OLXL 1AZRA 1W72B 5GRZA 3RA7H 1X5ZA 4QG9A 3TN0A 2XWTA 1QI4A 3NRQA 3MLUL 2VJ8A 2JE8A 5D2WA 3ZJKA 1LWRA 2SEBB 1XCTB 4JQ1A 3P54A 4KX8A 4Y4FA 4AM0A 5JQ6H 2HB0A 2LU3A 4QOKE 1KTNA 4CEXC 5JOEA 2FIKB 1UZDA 2VLKD 5F7LB 2ADYA 1SFSA 4P2QA 1ZSXA 3A9IA 4L1WA 4ZBCA 4PB5A 4PG2C 4MWFA 5F7EL 5A3ID 4DJFA 5C6MA 1MH5A 5CPQA 4IMLA 1FG9C 1E7UA 3W37A 3UP6A 2UWFA 3VI3F 4O51A 2QKIA 2VFGA 3URNA 2GC4C 4JFPB 5F72S 1IT9H 3LIZL 2VDML 4K8RD 3TEVA 1NGPL 1WBYB 3MRBB 4PRHA 1QLEB 5CJXA 2QVNA 2R14A 3QVAA 4BSWB 4F2FA 3BGFC 3D48R 3Q0HA 3ZDYE 1MUCA 1I4NA 3LDBC 5INCA 4ZMVA 2HKFH 4A3RA 1F56A 4GVFA 2Z1SA 5D2LE 3U2IA 5DDHB 3C52A 3W88A 4Q6IB 3L0NA 5JXEA 3BAXA 3O3AB 3T04D 2F7PA 3PWLA 3SN1A 4LBEB 4EUPG 3SGDI 3DRQA 2JQZA 2XQYA 3ILQC 2OL3H 3CN0A 1OFPA 3MHFA 4UAOC 3OL2A 4JO5A 1EXHA 5IKCA 1YYMH 3UTZB 2ANUA 4PB3A 3UD6A 1S3RA 3A6BL 4Y2OB 1P1ZB 3NFNB 3T0TA 2XTJD 4UMGA 3QLDA 5GRVK 1AHWA 2H26A 4S3GA 3O9WD 3P3BA 4U6TA 3C6SB 3MA8A 1S7RB 3CLFL 4V1DB 5DD1L 2Y5EA 4A22A 1FCQA 3H2EA 2AKRB 4KGLA 4XX1G 5IMMB 4UU9B 2QVTA 3VXUB 1Q1PA 5H8UA 2VGGA 4Z2GA 1NUNB 4UQ2A 4DGVH 3R6IA 1QHQA 1EGZA 5BCAA 1CLCA 2Y0SA 2HRPH 5TE7L 1H62A 1RQHA 4EE2A 2Y5JA 9XIAA 4H8PA 4J3OF 3V0GA 4WEVX 2PDXA 1QACA 1K9TA 1LO4H 3T3PF 4JUTA 4LGPB 3D08A 4QHUA 3LH2H 1DUYB 4WX2A 2VD9A 4WW2C 3ABGA 5SX5H 4BSJA 1KEML 3ZO0A 3L3KB 3GJFA 1TPWA 2IQ0A 1CURA 1BAFL 4A7SA 3W4RA 1B4RA 2ROXA 2Z24A 3R8RA 4PG9B 3K30A 5ALBL 1H3XA 3GHUA 3QJTB 3QULA 4JFDB 5G5DA 2J13A 4P8XA 1UCTA 4EI6B 3AUOA 2ATMA 5D70L 4J3VA 3X1BA 2YD7A 4PCYA 1S3TC 4RL3A 4RW5A 4Y9MA 4H26A 2MSPA 5EU4B 3CK5A 1QLFA 3QUZC 3G8EA 2OMUA 2WXJA 5MENB 5HJLA 2ADJA 5HPOA 5L9FA 1M53A 4PIRF 3TL5A 2L7UA 2VN7A 3MBXL 4ETQA 5JHLH 1L9SA 4BQCA 5I74B 4FI8A 2PWUA 4DTGH 1BDYA 5CSZA 4Y1AE 4MJHA 2LE9A 1UOLA 4P23A 1M05B 5JA9A 1U42A 3KVMA 5HR7A 4MNGB 3NZPA 2OR9H 2BVYA 5DHYA 2F7OA 2DEXX 5F1IB 1B4JH 2IH1A 5DWPA 2W91A 5FYKE 2ZXCA 3BZEA 1UWEL 5C0GA 1JCMP 3BISA 1L6WA 3ZFHA 4FQ2H 4HUUA 4CKVX 4FP8H 2DFAA 1XCWA 2BP8B 2M26A 2VB5A 4MNQD 5ICXB 1K77A 1PCXA 4JQVA 2P88A 2B4CC 2QKIC 2PDQA 4FZ8H 2ACQA 2WQXA 4Y4KC 2Q3OA 4N5EC 5IQ9B 1XIDA 3HPAA 3O2DA 2W9DL 4LSTL 4EDXA 4MA1B 4P57B 2Y2WA 1A5AA 5EOQH 1ZLPA 1MVUA 1P5UA 4ZI8A 1FL6B 2DQCL 5JMOC 4HS3A 1ZCCA 1I0DA 2BHFA 5HK4A 4WW2B 2GJRA 4FG2A 4MMYA 4JAMA 4UQDA 4XX6A 4DNMA 1YAZA 1X9QA 3CVHL 4PMEA 4A2HA 1AAJA 1P4LB 2NY6C 2P4AB 4KJWC 3L5XL 2YD4A 4AZ5A 3EWXA 4BZ2L 2OMUB 3LM3A 3K81A 1OPOA 2NW3B 1ZD6A 3L9RA 4HETA 3ARXA 2WBXA 4OCXH 5IB1A 5D2LF 1LQ2A 4OFVA 3KVJA 5F0LB 4UWQB 2DYPB 3PGDA 1QPKA 5LXGH 4UYPA 3ES8A 3QMSA 2HXUA 2XY1A 1WQ5A 4HK3N 3RU6A 3UG5A 2BVOB 1NBCA 2F5BL 4POZD 5DRZA 2F68X 1SO6A 3RUBL 3BIKB 5KSBF 2ZNXA 1D3HA 1OGAD 2K6ZA 2G75A 4OGQC 4ZQOA 2Y0FA 4AC1X 4HZMA 2AGKA 3EYPA 4PJBA 4X8CA 1BVNP 4ACTA 1R1CA 3LOWA 4C4BA 1R9FA 1A4AA 1TJ0A 2EPMX 2WWCA 4J2PA 2PCFB 2ZX7A 3K1DA 2DLFH 1CI5A 1JULA 3SQMA 4MAZA 3ZDYF 3CEUA 5ETUB 5ABHA 1J18A 2LLEA 2WO5A 3NXLA 1Q72H 4GSQA 1HNYA 1JXDA 4ERSL 3N44B 4UFHA 1RZMA 5E5CA 4I3SL 3MLXH 1U3HD 1ACXA 4CCZA 4K8RC 2VDLB 4GXUM 3ASWA 5DEFA 3ZDWA 4QSHA 4QLWA 4ATLA 2XISA 1Z9LA 4LLWA 3B7YA 2MJWA 1H11A 3GTXA 1OZQA 3B9AA 4QXTB 2CEQA 3TYZA 1COBA 1OABA 5DFVC 2YR1A 3G7TA 5GSRB 3JWDC 4MA7H 1GYCA 5DHXB 1QNVA 1FFQA 1FO0B 3V4PH 1XHGA 4JFZH 1KIRB 3G6AB 4ZUTB 2NY3D 4FKEA 4LAJH 1MFEH 2IAMA 5D2NC 5AALA 3C5JB 4ZUUA 3RGBA 1QPRA 1V6VA 3ANVA 2OTWB 1AG1O 2QUNA 1VIWA 2ADGA 3ZYJA 4EVNB 4B0MM 1M05A 1KJ3L 2NY6B 3CFUA 3B9KC 1DWHM 2AL1A 4J3OH 1V7NL 5HI5D 1UACL 2OMBA 4LHUG 4Q7IA 1G7MB 3WJZA 4DN1A 4LKCA 2KDGA 4NZ1A 4FQLL 1S5TA 4OZHF 4C1KA 5DO2C 3WAKA 4Z08A 5TE6L 5L8JB 4GA8A 2OI9B 1H4PA 4XP4H 2XG9A 3H70A 3X2QB 4L4VA 2B3RA 1AR1D 3MROB 5HYJB 3WUWB 1HHKB 1M68A 5DD6B 2WXIA 4DP9X 1L0XA 4YHEA 4Q58C 2Z6FA 3QJAA 1SXAA 1AG6A 3OMNB 4YHOL 1E6NA 8XIMA 1EERB 3SBFA 1DEEA 1FYHB 4PJEF 4WGKA 2LLNA 4NWUL 1ZTMA 1OB1A 4KOBA 1BKSA 3BW9B 4JFSA 4WWKD 1I7RB 4ZRGA 4O15A 5KYWB 3E0WA 5FYJU 5C0IA 2XZAH 3TBTB 4ONFH 5TF1H 5KVDH 2WWOA 4ACYA 5I1DA 3S48A 5IJBC 1UYQA 2IDFA 1T5XB 2IWEA 3FZUC 2G3JA 2YYUA 5FO9B 5C8JB 2C1OB 2PO6D 2NUXA 3LV6A 1C9DA 5JUVA 4M6ML 1HINL 1VFBB 1J86A 1XEUA 3CPRA 3E0IA 4IRZL 4LB8A 4MD5A 1SO4A 3AHYA 1IWAA 2EDHA 2AQQA 2H2SD 1NGZB 5A6KA 3L3GB 4PV9B 3AY4C 2VLME 4TUKH 4MSWB 4YE4H 5F9AC 3HUJB 5H35B 2R1LA 4ZT1A 4IU3B 4PY8I 4NPYA 4IKKA 4FABH 3T81A 2PYEE 2NX1A 1KGJA 1AW1A 3K46A 4FCAA 4NKMB 1ZK5A 2GBTA 4LPXA 3NP3A 4ODTL 4PGZA 5D2NB 5D4HA 3CH9A 4LWWA 4IRJB 3IUDA 3CVHB 1Q72L 1R6VA 1MCOH 3C6SA 3BGAA 1NAMA 3FQ2A 1WGVA 1G9NC 1UKOA 5D5MB 3FH8A 4JB9H 4DK5A 3OB0H 3QI9D 2WIMA 1E15A 5I3HA 2B1AH 5IFHL 4F7PA 2X6CA 2C3HA 3OKDA 4HZLB 3NGBB 3UAJC 2Y62A 4ZE5A 1GS8A 1OTSC 1LLWA 2DQTH 2ITCB 5I09A 4HNUA 2GYIA 3MCYA 1GTEA 1JL8A 3LS5H 5J7CC 2P50A 4X6DA 3QK0A 2MPAL 1WDDA 2V30A 3GNPA 4FF5A 2V2WB 2DL9A 2OPCA 3HAEB 4ISVA 4E2BA 1KCVH 4DJMA 4GG6B 5CJ5A 1HL2A 5AENA 1SYTA 5DMMA 1VF8A 4YDKL 4M6AA 4NKCA 2DQWA 2GJ6B 4Y5VC 5B4MD 4IUOA 4GG8B 1YMMA 3PWAA 2A7BA 4L1GA 5C0DB 4CGTA 4D2NA 1PG7H 1PJ9A 4PWJA 4KTEH 3E2SA 3OJ2C 4XNXH 5D93B 1WCQA 1T1ZB 5IFJA 3W0KA 4EJ1C 1TTRA 3VH8A 2P8CA 1FV1B 1PSKL 4N0YL 3UFIA 1CDGA 3SE3A 1W54A 3MA7A 5DJ6A 5H94B 2EKCA 5I9QC 3PNZA 1GWJA 1URLA 4EPSA 1AZCA 1TWDA 2J88L 1CC3A 3GXNA 4R9HA 1UP0A 3DURA 1KC5H 2G4JA 3PIQB 1OARL 1K2DA 5I6MA 1DQQB 2RQEA 4UT6A 4Z76B 5IY5B 1JDEA 4XWGL 1CLYH 5IV2A 3W73A 3VGHA 1NMAL 5KYYA 1MCPH 4NN5B 2YW3A 4PUEA 1RZGB 5EPMB 2B39A 1IAII 5CU9A 3CBJB 3SDCD 1K4CB 1G7LB 3BH8A 1J87A 3MNWA 5HNRA 5CIPA 3O07A 3PP3H 3OTRA 3KBSA 4Z0SA 1XGYL 3R89A 3SUVA 1W1VA 1M3UA 1H0DA 5CPTA 3E2HB 2O5YL 5KAQG 5F2FA 4HKXB 3M0XA 1Q8JA 3OGSA 4K3GA 4ZO9A 3DMMA 4JO2L 43C9B 3L3JA 3P4OA 2BOFX 1U8OA 1IM3B 3VNJA 1Q2RA 1X4ZA 2P47B 3LZFL 1JGUH 1TJHH 5AG8A 1KENL 4NPYB 3H0TB 5L0QC 3VG0H 4RMTA 4YX2H 1AH1A 5SX4I 1PDKB 2E9BA 3UO8B 3HI1B 3MNMA 4E5XA 3KDMB 4U1HA 1CR9L 4Y5VB 1XGEA 5E9DE 4FQXB 1I2RA 3GO1L 3EBGA 4LVHC 3LCIA 1AXTL 4FJZA 4U0QB 3ULAB 1C90A 4FQHB 3MUIA 4WY7L 2HTMA 1HILA 4UQAA 1SJAA 3MCKB 3ML8A 4NGHH 3SM0A 5IJDC 3VFSB 4RDBA 1CB2A 2UYLA 4LASH 3H42L 3BX7C 2A4EA 1VBGA 3GB7B 3F2CA 3N44F 2XI9A 1IXPA 4OV9A 3CAWA 4GMEA 2ZUVA 4ZOCA 1HI6A 3QS2A 4I9MA 2K4WA 5CGMA 5DJ0B 1VFFA 2EJ1A 1EUTA 5IIEA 3LEPA 3CLWA 4WSJA 3VD7A 2C5DC 2ZX5A 3MRDA 4DGYH 1UIPA 1W9BM 2D8KA 2BBFA 2DSVA 3QKEA 4RZBA 2R1WB 3QXAA 4WIQA 4JPSA 3UJRA 3GG8A 4N0CC 4FYQA 4GUFA 3L2NA 3BAJA 3SDXF 3MWCA 3MA9L 3PZNA 3SO7A 4UBPC 4K8RL 3QQDA 5TTRA 1R87A 4M19A 2X12A 3WQWA 4ALAC 1NCTA 3GK8H 3ZY7A 3I7RA 5EBLB 5DMIL 2R1NA 4NI8A 1YYML 5GJPA 1FIGH 4FNUA 3KFTA 3AWGA 5IBTL 4W7VA 1LOLA 1ITBB 4MAYB 3TBYA 2VC6A 2F7QA 5GRJH 2YSWA 2V7HB 2IQDA 5JH1A 3WN5B 3P81A 1X6LA 3KXFE 3RBSA 3OAUL 4HT1H 2WJFA 4HMDA 4GT0A 4YSCA 1SVBA 4M5TA 3VXPB 3ALGA 1P7HL 1P2CA 5FOOA 4RNRA 4V2BA 2WUCH 2X1UA 4ZTPH 2WB1A 3BWZA 4KK5C 3FXGA 1L2QA 4LV9A 1X6NA 2XSAA 2I07A 3QEQA 4PH8A 1TLKA 1TELA 2QUVA 3FT1A 4H1LG 1LNUB 2VOMA 4S1DC 1XLLA 5CEWA 4U6VL 1GXEA 1Z69A 1WO2A 2HWZL 2OXGB 3HUJA 5L2JB 4JTJA 4R26H 4XNBA 5JHDA 1AJ0A 3NQ6A 3BPNB 4N6RB 4Y2NA 1YPXA 1YA5A 3ARQA 2AGJL 1TSRA 4NF7A 4K39A 3P67A 3AIEA 4S0TD 1C08B 5CCHE 3JUZA 1LE5A 3UR2A 4A8RA 3RDTA 1KFBA 5AVVB 3GLDA 1EEYB 3EIFA 4YTRA 1AMKA 4JKPL 2E59A 1Z9MA 3RB5A 5J9PA 1B54A 3GRIA 3GIYA 3GSOA 1Y0LB 3VIMA 4ECNA 3S1UA 4TULL 3U36A 4HXAH 4EBQH 2R8SL 3IU3B 2BJMH 5HJGA 1EJXC 1NIEA 4IMEA 4QP0A 3GBEA 3ULUC 1TPXC 1BKHA 5AN7A 4L3EA 5EOCJ 2DWXA 3QDHA 1N2VA 3F7YB 1UP2A 3RB7A 3N2TA 3WLPA 3PPFA 2B4GA 3EYFB 4UNIA 3GHEL 3RNQB 3OO2A 3OAYH 4CLMA 4UB9A 3CXDH 4QD2E 3K2IA 3K6NA 4BFKA 5FFOA 5I06A 3LZ5A 3GXIA 3G6DL 4EIGB 4GIRA 2UZIL 2ESVE 4MBOA 1WSST 1BGAA 3S6TA 1W3NA 1CFBA 3BLLA 1BVNT 2ITEA 2X4TA 4HWNA 4GPNA 3QHFH 1W5MA 4LAUA 3MACH 1I60A 5MEQB 2R23B 4X4KA 1SQ2N 3FOMB 1F2XK 3WKZA 3LKPB 4A66A 3LNIA 5I3DA 3TX4A 2VZ3A 4XMPL 3I6GA 5CN1A 1N64H 5CJOH 4S1FA 4GKZA 3W24A 4HCIA 2NY1C 1HF6A 1MKFA 2H8PA 1SJXA 4PGEB 4PWFA 1YCSA 5H6HA 2BW4A 1TPEA 5BW7A 4R4ND 1CK0H 3F01A 2YD2A 4DJEC 3ARUA 3ZTCC 4W6WB 2DQXA 2CNCA 4M7LT 2GVLA 3LX9A 4N22A 1GGTA 2XPGA 4X6DE 1CFTB 5EZIH 4LVAA 1RUML 3UBXB 4ODSH 1K9EA 2J12B 3H3KA 1DXEA 4HK7A 2XG4A 2MIZA 1NEUA 2QSQA 5HHOB 4L48A 3QWOA 1LWHA 4MD0A 5DMKB 4B50A 1AQMA 1BD0A 4HNCA 3O4OC 4X5WB 5HYFA 5KYXA 2AXFA 1RCQA 3GG7A 4WJXA 4FQIL 4PU2A 2AZUA 5A16B 3THDA 4PRAB 3VSUA 2ZPKH 1IAOB 1SM3H 1OXYA 5K1NA 4IRJD 5D2LB 4IU2B 1FSKB 4KUCD 1GPFA 3KRZA 4LVFA 2WMPA 4KPHL 4PFHA 2X89D 3ERPA 2HT3C 3PGFH 5HY9A 4C6DA 3VTRA 1LEGA 4OCYL 4NC2B 2QULA 3CHFA 5H2ZA 1ADDA 1YNKL 1I3RA 1U8QB 4K5MA 5FXCH 1QR4A 3U4AA 1Q8AA 1SO5A 3SY0A 4XZLX 2V9UA 4B2DD 3NYZA 1MAJA 4KZEH 5JPMA 1GG0A 3EYVB 3Q3GB 3HNTL 5B1KA 1F4AA 3OAUH 4HT1L 5I2IA 3WK0A 2B1HH 5C3IA 1RSFA 3HE6C 2B7PA 3VIGA 3NQBA 5I1EL 2DQ6A 1I7TA 1QHPA 3HCVB 4LLDA 2ZX9A 4X9YA 1OM3H 4HJGA 3PWUB 2GI7A 2IFFL 3IIXA 4XSLA 5D38A 4PSRA 5DA0B 1M3JA 3BSHA 3C75A 5AW6B 1PLAA 3D07A 5EC1B 4KROB 1ES0A 1TEGA 3INOA 3KDOA 4F2TA 5H37G 5D55A 2J71A 3M6DA 1MEXL 2QPSA 4L3EB 3I75B 2QT6A 1KYAA 4JAMB 1C5CL 4URKA 4GSDH 3FMGL 5FV2A 2FGBA 1KCKA 1AP2B 1JYXA 2OJZH 3M07A 5FJOA 3TESA 3WJSA 2RJMA 4KT2A 1KNOB 1N5YL 1UG9A 3KG5A 3ZN6A 3STPA 4UQ3B 4U4MA 5FO8B 4GIEA 3CU7A 1KV3A 3CSTA 3QQ3A 1TZIB 2GBVA 4IRSB 4QY8A 1NDTA 1F3RB 2IH9A 3ZZQA 3VYPA 2H26B 4LTSA 4S0SD 1QRKA 3Q8CA 2CU9A 4LASL 4XZWA 1UB6B 1NGWA 1PYFA 3WXWL 4UNUA 2ZRWA 3OM3B 5F1IA 3MFFB 3AHVA 3IVTA 3AHXA 2A4ZA 1LK3L 1T2QH 1EC8A 2E6AA 3GC5A 3T0CA 4CD5A 4OZFA 2EH8H 1C3FA 4DZIA 1YEWA 5KG9A 1T7VA 1HNGA 2ERJB 3FK3A 2AK4D 2YAHA 2H5UA 1DBBL 4Z7VA 2ODIA 1H7OA 5AHLA 3QY8A 1DBJL 3MFGB 1NOFA 2WCPA 4PLOB 2ADJB 1XICA 3T0BA 4JANB 2WMIB 3EX3A 3FCPA 2OTUB 4RMUA 5LXGL 1AGCA 1TJHL 3LB6C 2QTVA 2ZOXA 5IREA 3R1ZA 3FA4A 2J78A 5T1KD 2NX3A 3DFNA 2F8QA 1B6DA 1QWUA 5AVRB 3TC3A 2F54D 1UHVA 1V8HA 5B1AB 4IT1A 2F53D 3AB0C 3PWJB 2COQA 1VB9A 3BWWA 3E38A 4CKQA 4PTMA 2HK0A 2PWFA 1BOGA 3ZVHB 1BF8A 4JFEE 2X1TA 1QNQA 2GSMB 5EMMA 4H0GA 3LIZA 1DVXA 3IMSA 2OLHA 1T20A 1BM7A 4XPBL 3RAJL 5C7HA 1MFEL 4MMXC 4WU5A 1EXUA 1IM9D 1ZS8B 3MLZH 4JFTA 5EUKA 3VWJA 2DSKA 1UJTA 3B7UX 4LGXA 2DTML 3W57A 4WCYL 3BEWB 2IBGA 4MAUH 4KHXL 1JZHA 2X10A 1V05A 1QMUA 2DWEA 5F7AA 3C2AH 5ISZB 4W70A 3MUJA 3AIBA 2DVTA 1HXKA 1PVHA 2ICEB 2BO0A 4FULA 2HN7A 3W86A 1KFAL 1ZHLA 5I77A 3EYQD 3FS2A 3QJRB 1RPXA 5FUCE 4LOUD 4NUQA 3QEQE 3OPZH 2C3WA 5E24E 6REQA 3VRLE 2XHNA 3S5NA 1EP3A 1NWOA 2G5BB 5C0RL 2B59A 4OZ4B 2GOKA 1PDKA 5C6TH 4UFJA 1I85C 1YECL 5KUMA 2DIEA 1ONRA 4L1SA 3W53A 3IDJB 3HFTA 3QUGA 3QI9A 3GMPA 4JVWA 4WKZB 3MMUA 2F2KA 4OJFL 5DS2A 2UZYB 4GRLC 1AW5A 3RKPA 4ODBD 2DKSA 1BQCA 5AZUA 1DWIM 2ASHA 2GIMA 4LRIC 1IR1A 4MY8A 1SEBB 3WQGA 1XTLA 5A40E 3B2UC 3QG7L 4WO4C 5I18L 4M7ZB 1W56A 4OIFA 2W0UA 3W76A 3C5ZD 4HNVA 1UPPA 1UFUA 3DECA 4FTVB 1IGCL 5FLUA 1L5GB 1DWGM 3WUWG 2HVMA 4OKDA 4KEVA 5A7BA 5IFHH 1AJ7L 1V02A 2XIOA 2DBLL 4F15C 3ZLQC 1OIOA 3OV6A 3BDYH 3MMEB 4FFYL 4LSPL 4ENED 4QO1A 5KZDA 5SWSD 2PU1A 4D7BA 3HQPA 3WMQA 3WXVL 1KJVB 4MZRA 5CJQH 4WVXA 3HG1E 2Z7UA 2VLJE 4XN1A 5RUBA 3RWFB 4Q7NA 3DENA 1ZL1A 5D7IA 3WD0A 3ULUD 5FEWA 5FO7A 3W71A 4OLVL 3OZLA 1K7XA 3LRKA 3HC3H 3FO2A 1J2WA 2VFHA 1P84K 1KJVA 4E4PA 1BVKA 2R0WL 4AJ0A 2QR0A 4M7KH 4XNUH 5J4MA 4OZOA 2ESVB 3MZTA 5EEZA 2R0KL 4R9XA 1NELA 1R5IB 3TO4C 4CADA 2WXGA 3DDMA 2OMNA 2DQHH 4ONHB 5AYYA 3DYPA 3EFFA 3EO1B 5HMSA 4GKNA 4FL4C 2XZAL 3TA4D 4B5WA 3UESA 1Y1DA 3L81A 2NDFA 3RZWA 1KFEA 3CIXA 5CPNA 5EORL 3PQYD 2XZ7A 1DJXA 3AXLB 5IK3A 2QR0B 4Y19D 3MU7A 3DG7A 4XNDA 4TN9A 1DANT 2IQTA 3V52H 1TNMA 4XI5C 2J1WA 1JK9B 3IPWA 3QYQA 5T8GA 2EGZA 1F3WA 4Q89A 3RRQA 3U2JA 3AYRA 4PJGE 3W75A 1BFNA 3AMKA 2IMMA 2VXUL 2VWEC 2HVJB 1A3LH 1S5VA 1ZANL 1VC4A 1MQRA 1N4XL 3K71A 4WI8A 3LPOA 1HHHB 1T21B 3AUJA 5LNSA 4BI5A 2NCMA 5HHOE 4XP4L 1BXBA 4F7MB 1WFTA 1DVFD 1X9RA 2G5BA 4RFNB 1UZ6F 4XHJD 2GVEA 1DHKA 2VXSL 1XD1A 4JK0D 1JN6B 2QADB 3C56A 1DHPA 1F3TA 4KDTC 1W32A 1H61A 4QMEA 4P7QA 4WEUD 4XZ9A 2HLAA 2ZG3A 1GW6A 1TF4A 5SX4H 2UV3A 5H35A 4MJIB 1E1CB 1RK1B 1FHVA 4P4KD 3SB3A 4AJVA 4X7TA 3EEZA 3VYLA 1USZA 4G1NA