4CKQA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
390
structure length
390
Chain Sequence
HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords CARBOHYDRATE BINDING FAMILY 6
total genus 135
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4ckqA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ckqA02
2A3CA 1WNOA 2DSVA 4JKLA 5E0CA 3APGA 3VGFA 2A3HA 2EACA 3N15A 2AMGA 3SUVA 3VNYA 2J7FA 1UKQA 1QI5A 2FDMA 4QCEA 3WNNA 1KB3A 2VCAA 4UFKA 4NRSA 5I0DA 2X05A 1GW1A 4LGXA 4UOJA 1WO2A 4FLRA 1H11A 1AQMA 3RM9A 2GDVA 2DSWA 3U5YA 5CQ1A 4OUEA 3HG2A 1UQZA 2PC8A 4D6JA 4H8UA 4MDOA 1V6YA 4M80A 2WYSA 3VMOA 1EQCA 3PZNA 5E1QA 4B9ZA 3WUEA 5M3WA 3VX0A 5E9AA 1M04A 4D6IA 1CLXA 2WHJA 1Q6DA 4QAWA 3F5JA 2WVSA 1PBGA 4QCFA 2NT0A 3VGDA 3GXMA 3BAXA 1AMYA 2BHYA 1ZJAA 2PWHA 4AIEA 1W9VA 3VDHA 3BVTA 4DM2A 5C70A 3HMCA 5CJ5A 3IJ9A 4U33A 1DWAM 4JFVA 3OLGA 7CGTA 4BQ5A 3RMEA 2YDSA 4JHOA 3HG3A 4M8UA 2WVTA 2XUCA 4ZFMA 5I2UA 1UD6A 3S5YA 2WHKA 1XSIA 1KCLA 4PMQA 3W24A 4Z2LA 1NWRA 3WH6A 4A4AA 3VMNA 3FW6A 4IPLA 3AQUA 3F5LA 1HVXA 1Z32X 4W8LA 1XSJA 2XWEA 5HDRA 4ATDA 3GXIA 3CLWA 4GO8A 4AMCA 1E6QM 1DWGM 3GXFA 2DT3A 4HA1A 2D0GA 4NX0A 5I23A 4GZIA 3ARXA 5IFTA 1TVNA 2DEPA 2W61A 3AHVA 4UQ9A 1W9BM 1V0LA 1E1FA 2WWDA 3WDHA 2GJRA 4AZHA 2J79A 1IT0A 3EDFA 1E6PA 3AZTA 2CBJA 3CUHA 3OIHA 1V3JA 3T0BA 2BFGA 5E09A 3WDJA 1J18A 5A2CA 2XM1A 3EYPA 2CIPA 3SEPA 3DX0A 1TA3A 3K4AA 2EPKX 1JYNA 4PSRA 4ACZA 2PWFA 3DHPA 1HL9A 1FP9A 4PMRA 5LYRA 3CUIA 1U30A 3TP4A 2Y2WA 3TTYA 3WDPP 1JYXA 3W53A 1G1YA 1FHDA 3L2MA 1E15A 2GSJA 1N82A 3CUFA 5BXTA 1CXFA 2J7EA 1B0IA 1EO7A 2X2IA 2FH6A 2XIIA 1QOXA 3PZ9A 2WMGA 4PMOA 3WQVA 5IHRA 2DH2A 1LF1A 1HTYA 2V38A 3MMUA 4H41A 3SUWA 4HZ6A 2JFEX 1W1VA 4R5EA 4OZOA 4IM4A 3A5VA 4R27A 1UYQA 5E0FA 1MVYA 3GBEA 1UG6A 6A3HA 3EJPA 2WXDM 1MW2A 1NWUA 3WD4A 1ISYA 1UQYA 3NSNA 1LL6A 1TQVA 3IAPA 3QOKA 1PAMA 4MNJA 2WC7A 1TVPA 3LPOA 1KXHA 4OJYA 1V02E 2F1AA 2PF0A 3LMYA 4J3VA 2DGAA 1UD8A 4CD6A 2F7PA 5KZ6A 2J78A 1HJQA 1AVAA 3DYOA 3WY4A 4GIAA 3I3DA 3CHDA 1JGIA 2B31A 1JDCA 5CSYA 2CESA 1J9YA 3A24A 4UFMA 1VF8A 3ARWA 3VVGA 5JIWA 4AXNA 1UWSA 2YDQA 2D1ZA 2DIJA 4PTVA 3ARTA 1Y7VA 2VZVA 3BVXA 1UKPA 2ZX9A 4PMVA 5I5RA 3A23A 3WNKA 4W87A 1WDSA 3NJ3A 2PI6A 2WBKA 1XYZA 2F7QA 1QW8A 4XZBA 3DHUA 1BQCA 2Y5EA 3CHEA 1OB0A 5FL0A 1J0IA 5IXEA 4ZXLA 1CGVA 1EH9A 2X2JA 2CKSA 4FNUA 4L4OA 4FLOA 3IK2A 2EABA 1PX4A 4OGZA 4PSPA 4X9YA 4GKLA 1CXIA 1R75A 5GPRA 5I24A 5A6MA 5HPCA 4W93A 4EKJA 1CXEA 1CECA 4TVCA 1KFWA 3ZR5A 3PZMA 1GQKA 1NWSA 3K4DA 4YN5A 3ZT6A 2ZUMA 1FH9A 2YOCA 2RGMA 4JZ5A 4W7WA 2YFNA 1PIFA 2VX6A 1TUXA 3VDBA 1E43A 3AJ7A 2W4XA 3HN3A 3J7HA 2G3JA 2JALA 3CZJA 1KGUA 2Y24A 1GONA 1KXQA 2J7HA 2VCCA 4E8DA 4AZCA 3HZ3A 4GO9A 3IJ7A 3UETA 1ITXA 3OZOA 4UQBA 4NI3A 1R33A 1OD8A 4BQ3A 2DT1A 1RH9A 4WJXA 3W28A 2Z1SA 3U57A 1XH1A 5ABEA 2O9PA 3GZAA 2UY4A 2C8NA 3AHZA 4H8VA 2XFFA 4XX6A 1JI1A 5EB8A 3VD9A 3KL0A 4W7UA 3W82A 1CGXA 1X6NA 1V0MA 1EXPA 1QPKA 2XPKA 5A6KA 4MB1A 3OLDA 3ZSTA 3B9EA 4HU0A 3WH8A 1B3WA 2FHCA 1LQ0A 1JAKA 3BVUA 4AWEA 5A8PA 2WMIB 3W38A 1OSEA 4CKQA 2GJPA 4V28A 4BCEA 4IUGA 5C71A 1CEOA 2YA2A 1EIBA 1L0PA 1K9TA 1V3LA 2J8GA 3WMCA 2RGLA 2CETA 4H7VA 3MSGA 1GQIA 3SCOA 3AIEA 1KBBA 1UD4A 4EK7A 1BYCA 4D1JA 1JL8A 3EJTA 3W6MA 5JBEA 1P6WA 1XYFA 3SCWA 2XVGA 3AROA 3GTNA 3FAXA 3GNRA 3BAIA 4MB3A 4NZCA 1GVIA 2ESCA 3T2OA 4Y7EA 2G8ZA 3CBWA 3NIYA 1XRVA 1TCMA 2YLAA 1TQSA 3FXYA 3EJQA 1QHZA 1CGTA 1VB9A 1W3HA 1V03A 2YFOA 4AMWA 3AISA 4XUYA 2D0HA 3A22A 2OYKA 1W32A 2VCBA 1JD7A 4UOQA 3L4XA 3AHXA 4UTFA 1B3VA 4DWSC 1KWKA 5CXPA 3NDZA 3BH4A 5A95A 3POCA 1UH4A 3B9DA 3ZO9A 3AMDA 2D3NA 3VGHA 3LXBA 2PWDA 2ZICA 3AHYA 3U7VA 4MAVA 4PMDA 4DUXA 4LYRA 1HXKA 3VIGA 4QLKA 1E40A 2BV9A 4U2ZA 4FF5A 2IXVA 2BHZA 3ARVA 1B3ZA 4ZE4A 2DIEA 1E55A 2CHOA 5A6BD 2ZUUA 1UH3A 3WNLA 3VUPA 3WD1A 2OSXA 3WF4A 5FL1A 2XWDA 1HWWA 1QNOA 3A3HA 1E5JA 1BSIA 3B9AA 1ISXA 3AMKA 2BY2A 4YPJA 3O9NA 1OGSA 3OG2A 4AD1A 1EDQA 1VIWA 3MUY1 1HJSA 3VO0A 2J7BA 1NARA 2FHFA 1NQ6A 4MTVA 1GOKA 2J75A 4HTYA 2ZIDA 2ZXAA 4AZ5A 4WF7A 4EANA 1XD0A 3GNOA 1JNEA 1EOMA 1R34A 1LWHA 3RCNA 1VEMA 4F79A 1JDDA 1MW0A 4PMUA 2J7GA 3S6TA 3QHMA 4AYSA 1BLIA 3BCFA 2ZXQA 1E3ZA 4JFTA 3CZNA 2W63A 3M46A 4JAWA 1UR2A 3K8KA 2ZWYA 3W6LA 3BVWA 4MAZA 2JIWA 1TR1A 4AZGA 3DX2A 3VSUA 5I78A 4J7RA 1ISZA 2V3FA 2PB1A 1WCGA 3U5UA 2XSBA 3CUJA 2WAGA 4WKFA 7TAAA 1LL7A 1BPLB 1GHSA 3EBVA 1E4NA 1KTBA 1C7SA 4AW7A 4CD5A 2BVTA 4WKAA 3WL1A 5LA0A 3VIKA 5A8OA 4KWUA 1TFVA 2OW6A 2WVVA 1HJXA 1I1XA 3VM5A 2CCRA 3AIWA 3WH9A 4NF7A 4N42A 1JZ6A 3WH7A 3D51A 1Q6EA 4LX4A 1KCKA 1UKTA 8CGTA 2VR5A 1QNPA 2X1IA 4UFLA 1KXTA 2X8RA 2VURA 4M24A 3L4YA 1UWRA 3AOFA 4YHEA 5M5DA 1KQYA 1K9FA 4IISA 3CPUA 4UQEA 1XHGA 1BVZA 4ZENA 1KTCA 5FKYA 3RO8A 1MQPA 1BHGA 3AS3A 5JUVA 2EPOA 1UHVA 1FH7A 2YA1A 2WZEA 4DWSB 1XSKA 3BVVA 1IZJA 2WB5A 3CMJA 4HMDA 1V6WA 4P8XA 4JL1A 1UKOA 3ALGA 4WKHA 3SCPA 3NSMA 1CGWA 4B9YA 1UZ1A 1UWUA 1QI0A 3ARQA 1UH2A 1UR9A 5JIPA 1OM0A 3WN6A 4BS0A 1W2PA 3WNOA 1D7FA 2VR4A 3FN9A 4XZWA 1VFMA 1UZ4A 3CUGA 1E1EA 3PZGA 3SUSA 3E1F1 1V08A 1HVQA 1U33A 2XIBA 4MPKA 1ODUA 4W85A 1CTNA 1LLOA 4AD0A 2ZE0A 3KEHA 3AS2A 3WUGA 2D23A 1ESWA 3KWXA 1C3FA 4AIUA 3T0DA 1SZNA 3QOMA 3EDJA 2EJ1A 1B1YA 4GQQA 4W86A 3TTOA 2EPLX 1B3YA 1HNYA 5IDIA 4F66A 1TMQA 3BLBA 1UASA 2JIEA 4DO6A 1PJ9A 1H09A 1O6IA 4P7NA 1UWTA 2WHLA 5DFAA 1MQRA 1US3A 3EDKA 1HJVA 2G4FA 1G5AA 4Z2JA 4PTMA 5D9OA 1EQPA 4LYQA 5BYWA 2XGIA 2GJXA 1W1TA 4GI9A 1DWFM 3MKKA 3WQ5A 1CLVA 2CBUA 3CZEA 5JBFA 4M81A 2CPUA 2VI0A 4PTWA 1GOOA 4CU7A 4DUWA 1GZJA 1E4MM 2ALWA 3CV5A 5F7UA 2J7DA 1WDQA 1WKYA 3EDEA 4AD3A 3POHA 4M29A 2VVSA 1UWIA 1ECEA 4FMVA 4MADA 1JIBA 1NOUA 4AZ7A 1X6LA 4JKMA 5HBFA 3WNPA 3A4AA 4AZCB 5BRQA 1V0KA 3ARZA 3ZT7A 3VIFA 3K46A 3MS8A 1QI4A 2O9OA 1R86A 1ZBVA 2GJXB 3VD7A 4FLSA 3W25A 4E4PA 1V3KA 2XVKA 1DTUA 2OWWA 4W7VA 1Q6CA 5CGMA 1UD3A 3PTQA 1JD9A 3UESA 2D22A 4AC1X 3NYDA 1HKKA 4CUCA 1DEDA 1QNRA 1W9PA 3BXWA 2J74A 4W8AA 4RL3A 1KR0A 3H54A 1C92A 4KGLA 3BLPX 1BFNA 3OGRA 1HJWA 4PTXA 2G3NA 3SUUA 1HKIA 2EEXA 1CXHA 1MXDA 1G0CA 5CPQA 3WQWA 2QHAA 5IFPA 4AYGA 2EPMX 1PEZA 1IZKA 1VAHA 4AD4A 2BVDA 3SCSA 3BAJA 3GXTA 5D9MA 1WZLA 3BUBA 3WD3A 2IUZA 5A8QA 2XHYA 1JF6A 3VD5A 3THCA 1EHAA 4HA4A 2W91A 1G94A 2E8YA 3F5KA 4ACYA 3HG5A 2XM2A 3EMQA 2WMHA 4S3JA 3G6LA 2QV4A 3N9KA 1CPUA 3MU7A 2W62A 4PUEA 2ZUNA 5DT7A 1I75A 1S46A 4UQCA 3N18A 1J0JA 1Q4NX 2O92A 2F7OA 1QNQA 2CITA 3CGTA 5DEZA 3TA9A 4PN2A 5FD0A 3DX4A 4UZUA 2A3EA 1C91A 2PBOA 3BLKA 4PBGA 3WENA 3MUIA 1B31A 4F8XA 2YIHA 1GHRA 4CCDA 1BGAA 4B3LA 2EPNA 1WAWA 3FNDA 3WEOA 5A6BA 1NP0A 1JXJA 3MI6A 1OBAA 4A3HA 2FE0A 4OBSA 3WMBA 3WKZA 4V2XA 3GBDA 4D6GA 1C8QA 2J7CA 3W29A 4QDMA 3BGAA 2F7RA 2WC3A 3AS1A 3WUFA 1B90A 1EA9C 3LRMA 2CKRA 2AAAA 4JCLA 4AIOA 1FHLA 2CERA 1CGYA 2EBNA 3VILA 4UFIA 4JCMA 3AXXA 3WFZA 3EMZA 3ZSSA 2J8FA 4CD7A 3LXAA 4LPCA 1H5VA 3WF1A 3VKKA 2OWCA 1UD2A 2WZIA 3VMPA 4WK9A 1UR4A 3I3BA 3AIRA 5A8MA 1GUVA 5CLWA 1T0OA 3AS0A 3WDQA 4DM1A 3ECQA 3VNZA 4B3KA 2VRQA 2XN1A 3LPPA 1KWGA 2JF7A 1HKMA 4NXSA 5EFDA 3BMVA 1QBAA 4W5ZA 3BSGA 1C93A 3A6OA 3DDGA 5DMYA 1QHOA 3TOPA 3SCRA 1WDPA 3WY1A 3AZSA 2DDXA 5CPTA 1EDTA 4FNPA 1MQQA 1W9XA 1CWYA 4AZBA 2OYMA 1B3XA 5A94A 2J47A 3IGUA 4JHZA 1MW3A 2ZUTA 3PHAA 1Q6GA 1HXJA 1XH0A 3VIIA 2ZUVA 4UCFA 2QMKA 1ODZA 3WF2A 2YL8A 1QI2A 3PZUA 4GZJA 4GQRA 4LYPA 3WELA 5D4YA 1Q6FA 2OLHA 2FGZA 2V5CA 3LPFA 2WCAA 3PZIA 4NRRA 1G01A 5D8WA 3FAWA 4F9JA 2Y8KA 1E6NA 3VD4A 1UD5A 3VGBA 1E6XM 3MO4A 2D3LA 1WP6A 2F1BA 3VDAA 2QPSA 2YBTA 2JF6A 2XJ7A 2OSWA 1XCXA 2GVYA 3BCDA 2VNCA 1E3XA 4OIFA 3N12A 3UERA 3D3AA 3KLLA 5AYBA 3GYCA 3QR3A 1XD1A 3ZJ7A 3VGEA 2WZHA 2DQXA 1D2KA 1VFFA 1BF2A 6TAAA 5GQBA 5CGTA 3DX1A 2W5FA 2PWGA 4JKKA 1H0IA 3IAQA 1DP0A 4DUVA 1JYWA 3UEQA 3VIPA 1MWOA 1J0ZA 3BAYA 4QFUA 3A47A 4W89A 4N0RA 4WSKA 2WKLA 2BVYA 1U2YA 2XVLA 1XC6A 3UR7A 2W66A 4LXFA 2VQUA 3ARPA 4Q22A 1V3HA 2VX5A 5CZKA 4B16A 3K8MA 1JF5A 3FY1A 1GNXA 1HT6A 3ZMRA 2NSXA 2XGBA 2QPUA 4P7OA 3AIQA 4D6EA 4C7FA 2W67A 2DSZA 3QHNA 4P8UA 4RE4A 2WKGA 1DWJM 3WL0A 1BAGA 4Z2GA 4AMXA 3WDIA 1H41A 1UA3A 1HF6A 2ZUWA 5FCZA 4GPNA 2OYLA 1YQ2A 2Q8XA 3M7SA 1ZBWA 5A6AA 4PMZA 2WBGA 1VJZA 3VOCA 4HOWA 5FIPA 1MFUA 1QWUA 3I3EA 5HXMA 4CCEA 3CZ8A 3AXIA 1HP5A 1UKSA 2V3EA 3BUQA 2D24A 1H4PA 3L4VA 1ZS2A 4TVUA 5A1AA 3W4RA 2XN2A 1RP9A 1HIZA 3LRKA 2QLYA 4FK9A 4A3YA 4S3KA 4OKDA 3PTMA 1OD0A 2DSUA 5IHSA 5CLTA 2DH3A 3A4XA 1VEPA 2XVNA 5DT5A 3T0AA 1KQZA 1XV8A 2ZUSA 2A3AA 4EAMA 4LQ1A 2VT0A 4MJ2A 2VQTA 1VBUA 1UOKA 4M56A 3WY2A 1E71M 1B2YA 4WLCA 1ZJBA 2PWEA 1VBRA 2D20A 4AZ6A 3K1DA 3G6MA 3T09A 4X0NA 4OOZA 5E6ZA 1WE5A 3UG4A 1TQUA 1UR1A 4ATLA 3VIOA 5ABFA 4JIEA 2F18A 4BQ4A 5HPOA 3WSUA 3RJXA 3CC1A 2WK2A 1US2A 1OIMA 1GPFA 1CZ1A 5A3HA 2UWFA 2VJXA 2J62A 4FNRA 4NZFA 2VX7A 3CIVA 1CIUA 2CHNA 4H04A 3EJSA 1BTCA 4D6FA 2OW7A 4RE3A 2CBIA 2BY0A 2FHBA 2WCGA 3RIKA 2TAAA 3H53A 4DWSA 4UFHA 2E9LA 3KZSA 1R87A 2HVMA 2OWXA 3O6AA 1GOQA 1RD6A 3S2CA 3WF3A 4J27A 1DWHM 4J3SA 4P7QA 1JZ3A 2GK1B 4HOXA 3RM8A 2VC9A 2WVUA 1JZ8A 4PCTA 4MJ4A 2VTFA 3M07A 3VPLA 3RJYA 2EADA 2FYVA 2ZX6A 1OGGA 2IGTA 2YL6A 5LA1A 2FH8A 2GDUA 1VENA 1NM9A 3KL3A 3N04A 1QWNA 2ZX8A 3CTTA 1V0NA 4U5IA 3VINA 5BXSA 1VFOA 4HP5A 2CBVA 4GINA 2VL4A 3PZTA 4HZ8A 3MSDA 7A3HA 2JE8A 4D6CA 1B9ZA 5I79A 1EOKA 1GCYA 3B8SA 1QX1A 4X0VA 3DDFA 4UZSA 4AEFA 4ATWA 4TX6A 3CH9A 3ZJ8A 1NP2A 4IPNB 4HU8A 3WF0A 3AIVA 3HG4A 3II1A 4TOQA 4U5KA 2X2HA 3LXCA 2WC4A 4FNQA 2UY2A 4NSBA 1GQLA 4BA0A 5A6JA 4TTGA 3M6DA 1ZB5A 5CG0A 1E4LA 4UFJA 5JBDA 3BUPA 1OGBA 1E0VA 3AMCA 3MUZ1 1OCQA 1KR1A 3L4UA 1R46A 5GNXA 4HOZA 3VIMA 4GXPA 4UOZA 1NH6A 1MFVA 2X09A 4HMCA 2PBGA 3ARYA 3BC9A 1M53A 1E0XA 1GJWA 1QI3A 2G41A 1KGXA 3DYMA 2J4GA 2CYGA 3OGVA 2J77A 1HL8A 1OINA 1SMAA 4JFUA 2X2YA 3WQ8A 3VIHA 1PPIA 5KEZA 3VDCA 1HJUA 3GXPA 1CBGA 4P8WA 4D6DA 4CN1A 3ZJKA 5AY7A 2VUYA 2JEQA 4QLJA 2XG9A 1TA3B 3CHFA 1E73M 1RP8A 1GQJA 3CO4A 3PN8A 2D0FA 1V3MA 5AC4A 4U3CA 3D4ZA 1E5NA 5C8BB 4FLQA 3W81A 3CZLA 2Y8VA 3L4WA 2G3IA 4M1RA 4J3WA 4QLLA 1YHTA 4TXEA 3CZSA 1UUQA 2E4TA 1R47A 4ZE5A 1JNDA 1O7AA 2EQDA 1OT1A 4Z2HA 1LJYA 2YL5A 4UQAA 3GNPA 5I77A 2QF8A 4KGJA 3TV8A 3W26A 5M03A 4M82A 3SCTA 5EMYA 3ALFA 2VRKA 2EXOA 3TTQA 1JZ4A 1GVYA 1E6ZA 5EBAA 3RPMA 3VGGA 2HISA 1OIFA 4B15A 1JXKA 5DF0A 3O2LA 3WFLA 3QGVA 1M03A 3WY3A 2YA0A 3WBEA 2V5DA 3WD0A 1PX8A 1TE1A 4AISA 1QW9A 2BHUA 2F2HA 3A21A 5ABHA 4MNMA 1H0GA 1XH2A 4UNIA 3CMGA 4KRUA 4XB3A 4W88A 4OOUA 3KE0A 5A6SA 3BMWA 1LG1A 1NOWA 2WWCA 1SR0A 3UG5A 2G3MA 1TQWA 3MMDA 3VU2A 3DX3A 2WANA 3IJ8A 2E0PA 1E4IA 4WIWA 3DECA 2VO5A 1HN1A 1UA7A 3WMSA 2DT0A 3OZPA 2ZXDA 3W0KA 1SFSA 2ZX7A 4WSJA 1R7OA 1E6RA 1GJUA 1CGUA 3ZIZA 5HNNA 1BGGA 1A3HA 5BRPA 2AOSA 1B30A 1J11A 3AIBA 3WNMA 1VEOA 1PZ2A 1UR0A 1QHPA 1PX3A 4HMEA 5AYIA 2CXGA 3PZOA 4PUDA 3MANA 4MDPA 3RDKA 1FA2A 1JZ5A 4HZ7A 4GZEA 1WDRA 3EMCA 3N17A 1AQ0A 1H1NA 2VZUA 4W84A 1JAEA 5FOOA 4BZYA 1W3LA 3LX9A 4GI8A 3VX1A 2ZOXA 3PBGA 1JFXA 1SMDA 1EO5A 2VZOA 3N1AA 3EDDA 3JUGA 4W8BA 3GH5A 3SCUA 5A2AA 2BS9A 1V6VA 1BYAA 4CGTA 3AIUA 2O9TA 5ABFB 4CN4A 4NXKA 1BYBA 2WM0A 1VRXA 1OT2A 4AZIA 1V6XA 1UWQA 3OA5A 3D50A 2O9RA 3LPGA 3W37A 2DSKA 1CENA 4CD4A 3WEZA 2WLZA 5LA2A 2WCSA 1WZMA 2Z1KA 2BY1A 2D73A 3AZRA 3AMLA 3HU7A 4U2YA 4FNTA 1CYGA 1EDGA 3UR8A 2YJQA 1JYVA 3EJRA 4D6HA 2EAEA 3AFBA 3DYPA 5HOSA 1WZKA 5A69A 4PMXA 1XGZA 2DT2A 3ZR6A 3NDYA 3OLIA 4W5UA 1M7XA 4CN6A 3TONA 8A3HA 5I6SA 1QNSA 1MXGA 3PZVA 4AY1A 1GOMA 3T08A 2GK1A 1H49A 5A6LA 2E9BA 1GORA 3SURA 4NZJA 1R7AA 2VZTA 1HKJA 1TG7A 4CCCA 4J3XA 1R8LA 2BXZA 4H2CA 4ZEPA 2NT1A 4AD5A 3WDRA 1KBKA 1LL4A 3NUKA 3ZOAA 4GI6A 4E8CA 3KLKA 3K8LA 2BY3A 3W27A 1FFRA 3A4WA 3NSXA 1X1NA 2C7FA 2E9MA 1E70M 1CXKA 4J3TA 5BXRA 1E9LA 2YDRA 4L4PA 1PS3A 1EGZA 3ZQ9A 2ZWZA 3SUTA 5A2BA 2WMFA 3AICA 4YHGA 3WIJA 4V27A 2F61A 4TVDA 2VMFA 4QP0A 4PEEA 5GNYA 3SCVA 3PZQA 4DO4A 3D52A 2MANA 4KH2A 1JZ2A 4UQDA 2J25A 2C0HA 1ZU8A 4MB5A 2VRJA 1J10A 3THDA 1C90A 1GOWA 3CHCA 3QHOA 2YLLA 3VD3A 4FNSA 2QMJA 2XN0A 4AD2A 1TQTA 3PTKA 3L4ZA 1LG2A 1K9EA 2VZSA 2WPGA 3MMWA 1FFQA 4RE2A 2W92A 4TTUA 1WPCA 3FHAA 4HPHA 5BCAA 4CVUA 3ZT5A 4JFSA 1LWJA 2X0HA 2CEQA 1D3CA 2BXYA 4D71A 4K68A 3WEMA 2OSYA 1CXLA 1W2VA 3WQ4A 4U3AA 5AC5A 1CNVA 1C8YA 1ISWA 4J28A 2DPEA 1A47A 3OB8A 3T2PA 4PYSA 5GNZA 3UG3A 3AMGA 2D2OA 2WMKA 3ZM8A 4CVWA 2WNWA 1E6SM 3D4YA 4H8HA 2YL9A 1NWTA 4OBRA 2IXUA 4KMQA 1ZBKA 5A8NA 5E70A 4UR9A 5BWFA 6CGTA 1JG9A 5BXPA 3TTSA 1E0WA 2XSAA 5TD4A 1JFHA 4PMNA 3GDBA 3BSHA 3OGSA 5EFFA 3WUBA 4PMYA 1C8XA 2WVVB 3VSTA 4DO5A 1F4HA 1VFUA 1SYTA 3SCNA 1QVBA 2E8ZA 4U31A 5ABGA 4EE9A 3AYRA 1J0YA 3MV01 1W9UA 4CD8A 3RM4A 2XFYA 4AEEA 2WW5A 1DHKA 2GUYA 3AI0A 1ITCA 4C7DA 5CSUA 2WSPA 3GXDA 3ARUA 4F9DA 4ACZB 4BF7A 4PCSA 4CU8A 2V3GA 3EJUA 4TX8A 3GXNA 2ZXBA 5E6YA 5M17A 3LRLA 1BG9A 1E72M 4MB4A 1F4AA 2WSKA 9CGTA 3DC0A 4MNLA 1BVNP 1W91A 3MV11 3WQ6A 4J3UA 1WB0A 3CZGA 1VJSA 2BNJA 1JI2A 4BQ2A 3D5HA 4KRTA 2VVNA 4Q7NA 4D1IA 1K6AA 3VTRA 1DWIM 5D9NA 2JEPA 3N13A 3F4VA 2CNCA 3ARRA 4Z2KA 1ZL1A 1C7TA 1TZ7A 3BAWA 3SCQA 3VM7A 4DWSD 1PZ3A 3MUAA 1FH8A 2V3DA 2XTKA 1J0KA 3S5ZA 3ZJ6A 4TUFA 4CU6A 2E40A 2Y4SA 3HJEA 1JZ7A 1FP8A 1H3GA 1UR8A 5D9PA 1I1WA 3NCOA 4ML4A 1EHNA 1XCWA 3GH4A 2YKKA 3WD2A 3L4TA 3RILA 4P7RA 1MW1A 1E56A 1FOBA 2GFTA 1PIGA 3AHTA 3VSVA 2XYLA 1IV8A 4MNKA 5DO8A 5BROA 1V02A 3GM8A 2WMJA 1K9DA 2VX4A 2XFRA 1BG4A 1GOIA 3BAKA 3OLEA 3SIMA 1V6UA 2F8QA 1J01A 5D8ZA 4XV0A 3BUIA 2WHMA 3N11A 4JFWA 1W1YA 3VIJA 3CZKA 5CPSA 1KGWA 1G9HA 1CDGA 3GH7A 1W3KA 1NOFA 1J12A 2UY5A 2XVPA 3UCQA 1L8NA 4PRWA 3BUDA 4P7LA 3H55A 4P8VA 1HP4A 4C7GA 1MYRA 3WH5A 2E3ZA 2VOTA 4HPGA 1KXVA 2WLYA 2NW0A 3T2QA 4JL2A 1H2JA 5ECUA 1ZBCA 3AYSA 4E2OA 2YBUA 4D72A 5I3DA 1R85A 3L2LA 3OBAA 1JDAA 1AQHA 2FGLA 2X0YA 3AXHA 4Z2IA 1WZAA 3WBAA 3FHQA 1BYDA 1ISVA 2UY3A 2A3BA 1HX0A 1QBBA 4URIA 3ARSA 1W3JA 2WMIA 4ZXOA 3U7BA 1M01A 2EO7A 1RPKA 1W1PA 1V3IA 4HA3A 2ZX5A 3IANA 1O7DC 1W9DM 1OWQA 1J0HA 3KL5A
chains in the Genus database with same CATH superfamily
4R34A 2A3CA 2HXUA 3MP3A 1NCIA 1WNOA 5GJSL 5BU6A 2B7DT 3W9DB 4HXBL 1ADOA 1OX4A 2H9AB 2JV6A 5I17B 3IIOA 4L9ZA 1W8OA 2A3HA 2WNKA 1LROA 1FLRH 2AMGA 3VWJC 4LUSA 3MODH 1R5VB 1FV1B 1AP2A 2EDRA 3HC0A 5L9DL 2FDMA 1SF3A 4GKNA 3GLAA 3WHXA 2HFTA 3INPA 2VCAA 2EDNA 4DN3L 3VWKC 2VDKL 4AQ1C 3R06B 1P6AB 3PR2A 2DN7A 2PW2B 4Z7QE 5IB3A 1GW1A 5DMGD 3KHQA 1F7BA 1H11A 1IC4H 4MJIA 1AQMA 3OAUH 4HIHA 4GZ7A 3QO0B 5JHDA 3OOQA 1LO0H 3U5YA 2PUQT 3KG5A 3KWVA 2CSPA 2W81C 3FQNA 3FT9A 3V5HA 4DGYL 5L7XL 4O19A 2NUWA 3BD3A 4YTRA 3OR7A 2WHVA 3HG2A 3SJVA 1RUQH 2JQZA 4GQ9L 2IBZY 3ULVD 3QF0A 2F68X 1FRBA 3GO2A 1PFCA 2IGFL 4Y4FA 2R0WL 4D8PA 3WJJC 4KK9C 4NRXB 4HJGB 2OR8A 4MDOA 1YMMB 3H56A 3HURA 1AY1H 3QE5A 5AG8A 4LCCC 1O7VA 4OIAA 1EQCA 4Q56A 5E1QA 2DKMA 3VI3B 3PAJA 3KCPB 4WK0B 1XG3A 4H7ZA 3MOAH 4D6IA 1F5ZA 1QUMA 3SY8A 3WS3B 2NUPB 3QR1A 4MWAA 1DQKA 3F5JA 2ENSA 2QR0A 1PBGA 1QVOA 4H8NA 5H8UA 1RK1B 1K3ZA 3BAXA 3VTTA 5I1HH 4GUOA 5HNRA 3LHTA 2Q76A 3OXSA 1ZJAA 1A7RL 2P80D 4NS0A 3BRGC 4LDEB 3BPOB 1GVFA 4AIEA 4DKEH 4XB8A 3P6LA 3VDHA 4L48A 4NO2B 1W0WA 4AH7A 1UBSA 5TH2B 4DM2A 2GIXA 2NVDA 1TX2A 1NBCA 1AG6A 4I2XB 5HI4C 2PDPA 3HZYB 4FC3E 4U1NA 3ZTEA 3O9WD 1CFTA 4O18A 3IJ9A 3NCYS 3QIWB 4DPQA 2NY1C 3ZMNA 5I6LA 3TA3D 4BQ5A 5GIRA 3MQIA 5D1ZA 4H1LB 4MKMA 1KULA 3EA1A 3ICJA 4JHOA 4LF1A 3FF8A 3HG3A 2AABL 1SM3H 4M8UA 1WDAA 4ZFMA 5AYZA 1OC5A 1BIIB 4OW6A 4YDIL 4X60A 1SJVA 3QQDB 4NKOA 4X6FA 2NMSA 4I2XA 1JZJA 1S2EA 2VWEE 1FKXA 4NC1E 3GLCA 1XSIA 1D6VH 4DP5X 1T1WB 1F61A 3SRDA 5B8CB 3L66A 4WUUA 3MREB 3TJHD 4ZUTB 1GC1H 2N01B 5A6IA 4JIPA 4K7PH 4S0TD 2AMUA 3IJEB 1U8JB 3MCLH 5D2LB 4RPPA 3MRGA 4A4AA 3W2MA 1FE8H 1DJQA 5MERB 1X5ZA 3D08A 1DVQA 3VMNA 1XLBA 4LRSA 2Q2LA 3B37A 4L5ZA 1BIIA 2G2PA 5GGSA 5L2KE 3VKCA 4F40A 1F2QA 4L9YA 5JXQA 2EP6A 4OLEA 1G7QB 3CB3A 3S5NA 1JK9B 2XWEA 2WGNB 3ALPA 3GXIA 1TTQA 3KH3A 3KOFA 4RJEA 3MHFA 3GJFH 4ZAKA 1W72L 4AMCA 1G1CA 5ERWB 1J8HB 2VDMB 3T07A 4MDJB 5FSEC 5C07A 1RZKC 2ZKYA 5DJ8B 1DPMA 4F3HA 3ETSA 4ACTA 1J4EA 3W76A 4IZGA 3PWNB 3F7YB 4K23H 1J5CA 1R24B 2FR4A 3LUTA 1PLCA 3DROB 3ATBA 3FUHA 4ODTL 5KYUA 4F5CA 1WDWA 2ZRWA 4UQ9A 5CD3A 1K85A 3CXHK 1Z5LB 1ORQA 3IDXH 2D7TL 1H1ZA 3NT0A 3NFNB 2X1WL 3PDOA 4OZGA 1ZZMA 2Q01A 4XODA 5LIUX 4UUJA 4XVDA 2DUXA 3ZS4A 1EX0A 2WWDA 1IL1B 2Q7YA 3QWQB 4A2MA 1JGLH 2CLHA 4DTGH 2MQGA 4IIQC 4RRPM 2J79A 1V27A 3ZZ1A 1U83A 4M3JA 1IYXA 1QBML 1EHKB 3CUHA 4YO0A 1V3JA 1W0VB 4D0CA 1EEZB 4Y19D 3X2QB 4QNEA 1SYVA 4C6FA 3RAJL 1C12B 4JX0A 3WDJA 4QJ5B 2Y7GA 1ZGDA 2BWGA 1E4XH 3D8MA 3GI8H 2CIPA 3QDMD 3UAJD 3FOLA 3QUXD 2OJPA 3GUTB 4KKPA 1TA3A 2FGBA 3BOFA 3NVDA 3SDCB 1X8CA 4H13C 4KVCH 1PUDA 2VGGA 1F8TH 1IFRA 2HN7B 4PSRA 3TN0B 2CC0A 2VW6A 2B3IA 3DHPA 1V7AA 1FP9A 4LSVH 2WKOA 5DCCA 4NQCB 5DTFA 1TPWA 2AL2B 2ENJA 1X44A 3TTYA 4N9GB 1WBXB 1JYXA 4DHGA 1MZZA 3WHXB 1U8IB 5BO1H 1IBGH 1OP3K 4GGBA 1OD7A 2DV6A 4MJJA 3L2MA 4IOFD 2FO1A 4M6NH 3QDMA 1I2QA 1CXFA 1B0IA 3CUFA 3NQDA 3CMOH 4OU3A 3OBEA 3NN8B 2FH6A 4ZZKA 4MJ5B 2XIIA 1OABA 3CK0H 4HDIB 1QRQA 2IW0A 5IHRA 4DZ8B 2ADIA 4YHLH 3CFUA 3EXSA 4QRRB 3MA7B 5EOCH 1WBXA 2WBWB 5I19H 5BVPL 2CBTA 4EBQL 4CMMB 1E1CB 1LF1A 4AHOA 4RE0A 4QTFA 2LFEA 4E4FA 4AKOA 3R8QA 2PDLA 4JXCA 1ZAHA 3FQTB 1W1VA 1F3DJ 3OQ3B 4PWFA 4NWTL 5HTSA 4KOCA 5BVJA 4OZOA 4R27A 3TJ4A 5E0FA 3GBEA 4LIQH 5KVGE 1NKGA 3TT3H 1T0PB 4HSAC 3ZKXB 1VFSA 2GEEA 1NOAA 1DE4A 3ILPB 5AALA 1ISYA 2EG6A 3NSNA 3O05A 1LUCB 3T0TA 2D7MA 4HK3J 4ZMVA 2PXYB 4TUOA 1V77A 2Z8VC 2ZZ4A 3QOKA 3DSNB 1DJXA 3VOFA 2GVEA 1ZHNB 5LXEA 1M71A 3HLKA 1AAJA 2ED9A 5DMJB 1PG7W 2J13A 3LA4A 4XPBH 1AY1L 2ATKA 3VXTB 1DXFA 4N2EA 3M1CA 4WRLA 4OLXH 3TFKC 3UAEA 1GKRA 3DKLA 3FSUA 3LMYA 4U6TA 3GW3A 1UJ3B 3C08L 3OPZL 1UD8A 4HZLB 3BQ6A 3QI9C 4PRHA 2P49B 5AZ0A 2J1YA 3BJSA 3V9CA 2EZ0C 2IWEA 1RZ8A 2WOYA 4H8WL 3U0PB 1Z48A 3PXHA 2P52A 2J78A 5KZ6A 4WUUB 1F6AA 2BOLA 2GG1A 2BSTB 1I7TA 1NDTA 5IVXF 6PAZA 1K2DB 4UTKA 1PKQA 1LQSR 5DJDA 5CD5D 4U1JB 5D1ZI 1KNOB 3CHDA 4HF5L 3HC3H 1PZCA 1A6AA 2JMRA 3O4LB 3U2SA 2QUUA 2GVJA 4F0MA 2HG5B 2R1PA 2CESA 3JWNG 4MGXA 3SGGA 3SY5A 4TMCA 3A24A 1MZHA 4IFKB 3WK3A 1BDYA 1Z8AA 4XCEA 2NY5H 1B9KA 1SXCA 2VM3A 3PDGA 4FQCL 1U8CA 4ZUSB 2PDCA 3NEXA 1E90A 2J1KA 3ARTA 5EOTB 3FCTB 2VZVA 3D2UB 4LP4A 5F9DC 1MCDA 2FAUA 2ZX9A 3RPBA 1WCQA 1VLIA 2YKLL 2NSQA 2DF3A 3FRUB 2EDBA 2P53A 5HGGS 1JUBA 2TSYA 3NJ3A 4YHIA 1O5PA 5DUJA 2H8PB 4N4YB 3F7VB 4KX9A 3CFKB 4B5EA 4DVBA 2B7QA 4Z8FL 3P7YA 3DHUA 3B2XA 4PRAB 2Y5EA 4S1RH 5J6GA 1XIEA 2PA6A 2O5YL 3FFOA 8XIAA 1SVZA 3APMA 4YHZL 4LBEA 1RHHB 5T5FH 1JEZA 5GJMA 3L4CA 1L2QA 3MLRL 5IXEA 3PQYB 1P5VA 4AUYA 1MCWM 3DETD 1C29A 3FJTA 3FT0A 1Q5MA 2CKSA 1FPTH 1OGTB 2BP5M 2X44D 1HH9A 4PS8A 2MTAA 1UATA 1H61A 3OHXB 3FL7A 1A7BA 2C0AA 1JGDB 1XC4A 1LQAA 1PX4A 4OGZA 4PGCB 1KFEA 2Y07L 2DS4A 1R3IL 1Z5LA 5E7FA 5E8EA 4X9YA 1QNVA 1FFTB 1SJEB 4G7SB 1UR3M 2GQAA 4XD4A 1JPGB 5ICUA 1QFEA 5TNVA 5EBUA 3MFFA 2AJUL 3C12A 2GZXA 1XH3B 4RMUA 3QHFL 3FU7B 2ZXCA 4XH2A 3L68A 4PUJA 2VLJB 4NQSB 1OW0A 4JQVA 1RJZB 3NMEA 1TVLA 4L4VD 4HUWB 4KXDA 3LY6A 3REWB 2QZQA 5DTFB 4Z1PA 5AAWA 5C2BL 5DSCB 2AL2A 1CECA 4TVCA 2YGNA 3UYPA 2GABA 4PGCA 4FMFA 5IM7B 3JV0A 2V9DA 1O68A 3NPZB 2VLKA 2J2ZB 2LAGB 3LZPA 1OP5H 3K4DA 5LGHH 1F41A 3ZT6A 5C6TH 5BS0B 2Y23A 1E4WH 1OM9A 1W0YT 2EDWA 3TZVA 2NXYC 4AITA 4GUQA 3H7RA 5I3KA 5DEGA 2E76C 2K45A 4FQLH 5JIHA 4AYBA 2YFNA 4JZ5A 3PJWA 1L9NA 4DY1A 5JUEL 2G96A 3FYPA 3TEWA 4KETA 3TFBA 3UH8A 5EC2A 3OA3A 1SRDA 1XX9C 5HYJB 2WUBH 5AKSA 1V6TA 2GGGA 2CCVA 2XWCA 3B3IA 4O51A 3LQAL 4FERA 4JR9H 2Z31C 2ZOWA 4PGZA 1SBSH 3VNJA 4RFOL 1H7OA 2XN9D 2BS8A 1KCRL 1PL9A 2B0MA 2CRIA 3VWJA 3C86A 4YWSA 3UETA 3G18A 1NFDB 3KPPB 4NI3A 4UQBA 1A3XA 4BA8A 1TZ9A 3OZOA 1R33A 2W9DH 1BD2B 3SKJL 1DOSA 1AA1B 1F3XA 3W28A 2Z1SA 3R58A 2NUYA 1XH1A 3U57A 5ABEA 3GZAA 1HHKB 1VCFA 3AHZA 5K9OB 5EBLB 4XX6A 1Z9LA 3VXMD 5C0FA 3ZFHA 2BVOA 3PB0A 3M88A 3CQQA 2UZYA 2B4CC 5FF2A 5K4ZA 3W82A 1X6NA 4LCRA 3CK0L 3FQ2A 2JIXA 4C57C 1LEIA 2YPVL 3ABLB 1V0MA 2WSYA 4MMZC 4PUWA 2DKUA 2X4RA 3TEVA 4NCDA 4TSBH 1DBAH 2DWYA 1HNGA 1NAKL 5ECVA 1AW1A 3SDDD 1U3HB 4NC0B 3T0VA 4DZ5A 4XGZA 3AB0C 1AL8A 3D39B 3A12A 4XO4A 5L7XH 1I4NA 3S42A 4MJMA 2CMRH 4XAZA 2Z3FA 4NNPL 2X0SA 1LQ0A 1JAKA 5LGXA 1OT4A 4JPKL 2ARWA 5I1GL 3VXTA 4AWEA 5G5DB 3REVA 1C9SA 4IIFA 1Z2KA 4PWHA 1WAEA 5DDHA 3SGDH 4Q6YA 3W38A 4M6VA 3ANUA 4CKQA 1PHWA 4GUGA 4FFVD 1W8EA 5ALBH 4Z0XA 4N6FA 4JTHA 3V1HA 1EIBA 1CEOA 1ZGLM 1OAXH 1TU2A 1V3LA 3QQNA 3CSPA 3DKHA 5ESVB 5JDSB 3HGRA 4AIZA 4EIVA 3MSGA 1ZXQA 3C87A 3OAWA 5LDSA 1BYCA 3G1HA 4HXAL 4EDWL 3QJSB 3W6MA 2YD1A 3FTGA 3NK4A 4FJYA 1LD9B 5E2VL 4QTHB 4QRQB 4E42A 3SCWA 5IVZA 1XGTA 5FO2A 1EEYA 3DC8A 2XVGA 3GTNA 2DQHL 1AGCA 2P46B 3CX5K 4ODUB 3GNRA 4MB3A 4NZCA 1FUNA 4Q6JA 3RVTC 3CLFL 6XIMA 4XO6A 4DGYH 3WLHA 1D5BA 1YEIL 3U8GA 4C1NA 2JKWA 3Q65A 4K3EL 1H62A 2C1GA 4GJ1A 4GKNB 3CBWA 4MHBA 3NIYA 2QELA 3SKNA 5D2NB 1XRVA 2A6JA 3FO9A 3QJHB 1OGAA 3HIZA 3L81A 2VQ1A 1FLTX 3MJ8B 2F58H 4Y2NA 2APWA 5ESAA 5DI8A 2VSMB 1TIUA 5I1CL 1QHZA 1P69B 3DG7A 1GGIL 2XWBA 4HGWB 3ZHLA 2D69A 4GY7A 4M43L 3EB3A 5FCSH 5LKYA 2OK0L 4J2PA 3BKYL 1M05A 1T89C 4QOKB 2FD6H 3H9YA 2RAGA 1KIPB 3QJHA 3A22A 1K4GA 1D6EA 5BV7B 3IMSA 5AW0B 1ETZA 3G7TA 4MCYA 1ZWIB 3W0WA 3L4XA 3UZEA 4F2EA 5BO0D 3FUDA 1Q94A 2A9BA 1NAMH 4UTFA 4CJ1A 5D7JC 3LMJL 1JUFA 3QCUH 2WXNA 3DROA 4XNXL 5JNYB 1FTXA 3O6LH 5CXPA 5KANI 4WQ6A 2VEIA 3POCA 1M05B 3NSCA 3W57A 2YW4A 3C0QA 3URBA 2X70A 3B9DA 4LS2A 4F2TA 1S7QB 1ZQ5A 5HHOA 3DLQR 4E5XB 4JZNB 1NDGB 3EX4A 2QR0B 3VACA 1MVUB 4X7EC 5D4JA 2ZICA 4HIXH 4JMXA 1TJHH 4Z7UB 5BZZA 1UROA 2CGRL 4O02A 3N29A 4PMDA 5IROC 3S47A 1MFBH 4LYRA 3FVMA 1KPRB 5CAHA 4GKSB 3CQJA 4Y5YB 1NFBA 4X9HA 4NWUH 3UGVA 1ZK9A 1E40A 2MJWA 4CDGC 5I00A 4JO2L 3RDJA 4U2ZA 4CSSA 3RX9A 1I60A 4QXWA 5DSCA 5TH2A 1B3ZA 5A7EA 5AW1B 2DI7A 1E4JA 4OCSL 2FJHA 3GHPA 4GD0A 2B2XH 2QQNH 4PRRA 2CHOA 3S2NA 2H9GB 3LBMA 2ZUUA 1DORA 1XLHA 4ELKB 1JFQL 1NIBA 4PGEB 4JQXA 4RA0C 3P3YA 5ETUA 5DA0B 1QNOA 1WZ1H 4LOUC 4P59H 5K39B 3VJ6B 3OKDA 4X80L 1P6CA 2N1TE 3GSVB 1YZZA 4MYXA 1IE5A 2PXYC 4EN2A 3ABGA 3NCJH 2XN9E 4YDVA 5CEXB 3GRGA 3RL2B 1MEXL 2IXQB 2PF6A 4XNQA 5B39A 4G2DA 2J7BA 2APTA 3PBMA 1XRTA 4ZW8A 4EXBA 5LNWA 4GPVA 3ULUL 2FHFA 1F05A 1HSBB 3LENA 3GSRA 5F6HI 5DRIA 2CIIB 3QULB 4J8RA 1GOKA 3C2AL 3SQOL 2ZIDA 2ISFA 3U7WL 4QSFA 4LP5A 2Q8BH 4YE4H 1R30A 2E1DA 1RUAL 2IALA 4Y19B 1Q6OA 2Z2BA 4BUHA 4AZ5A 4OFVA 1HHKA 2AP2A 4EWJA 4HQQH 1MWAH 2W0FB 1UWXK 3FZUD 3TO4D 3BUYB 3SM0A 3DVIA 5LG1A 4YR6B 1JDDA 1MW0A 1BQ5A 5BS0D 3RXZA 3S6TA 2IBZX 3DJZA 4PCPA 3QDGE 1Y8BA 1UBPC 3GZPA 2BOFX 4UQ3A 4ZTOH 3HTWA 3TASA 3I6LD 4AGPA 1FUYA 7PTDA 2JIXB 1D5RA 2N0KA 1PVHA 3WBDA 1OHZA 4I18C 2FCBA 2QDDA 5DHYA 1BZEA 1KACB 2OMNA 3N0PB 5HWNA 1P0NA 1UR2A 5E8OB 1LE5B 1Y0LA 2ZWYA 3ZE0F 1BW8A 2CUIA 3DSNA 4MAZA 2YLKA 3UGUA 3ZX1A 1U91B 2JIWA 1LT8A 1BAFL 1K8IA 1TR1A 3DX2A 4R90L 3W1QA 3KBMA 3GRWL 1OG0A 3B4NA 2XACC 3IYLW 1A7NL 3SPHA 4QRQA 3UMNA 3ZHDA 4E42B 4PGJA 3L0KA 5JTWA 3WD1A 3CUJA 3CU2A 1M7DB 4KEZA 4WKFA 1MFAH 1UYWL 3R8BB 4DUOA 4R97C 3EBVA 4WCJA 4QY8A 3WCYA 4XNMB 1BYPA 4ENLA 2ESVD 2H45A 3ARDC 4QRPE 3FB6B 4OAWA 4ZRGA 3SGEI 2WMPA 1O5QA 4AW7A 4A2EA 2WINB 2B1AH 5GHWH 4CD5A 3QHZH 2A2QT 4XP1H 3MLWL 5CAYB 3GUTA 4DJEA 2J73A 1M6UA 2DWTA 1TTBA 4D3CL 3UMTA 4IKNA 1XF0A 1Z9OA 2WVVA 2I9LB 3ZL4L 2C91A 3Q45A 3ZDYE 5EUOE 1KLFB 1U8LB 1I1XA 1IGWA 4Y4KD 3T4WA 5CEYB 1Q45A 1BBDH 2X4OA 1QBLH 1XM3A 4L0PB 1KLGB 2D03H 3WH9A 4M1CC 5BVPH 4JREB 3EZJB 1BXCA 4PVMA 1NCBH 1LP9E 3SI9A 2J7LA 1WG3A 2IPJA 3DMMC 2XY2A 3NP4A 3TN6A 4EUPA 2D03L 4OCWH 2WYZA 2ACRA 1MJJB 2VJ0A 1MCIA 2VR5A 4HW6A 1K6WA 2ICWA 5CZTA 2WB1A 1XAKA 1XLJA 1R19A 2O30A 4JQ4A 3QT2A 4C47A 2VURA 4ZQOA 5DT5A 1UQSB 4MMWA 4IU2B 3D4CA 3QYCA 4KCTA 4TUUA 5TK4A 5K1NA 5LCVL 1TV5A 1AP2B 1NFIA 2OL3A 4PJGA 3A64A 3AGVA 1DJWA 1LO4H 3GSNB 3FT3B 4KTGA 3CAQA 5DS8A 1IT7A 1K9FA 2PSNA 3O6DA 4IISA 4R2GB 4ZTPH 4XOCA 5H2BA 1DVJA 1O5KA 4LF3A 5M95B 1RUQL 1KZYA 1I1AC 4JEJA 2ZCHH 3OQ8A 3RO8A 1BVZA 1KPRA 5AZEL 4Y1AD 43CAB 2ZSWA 4YFEA 1BHGA 3D09A 1MQPA 1NINA 4W81A 1A3LH 4JZJC 4XMKH 1OARL 1FDZA 2BMBA 2WZEA 4HLZG 3WJLC 5CPLA 5E1IA 2ZDRA 1JK8B 3BDKA 4HMDA 1YEGH 1MRDL 3P60A 3D2TA 4LLMA 4K9JA 1YNTF 1WA1X 2DQUH 3NDYE 4WWKD 4C83B 3KM8A 4WKHA 1E0UA 4JTFA 3SCPA 4GJTB 5E2JA 3CSGA 3ECBB 5HK4A 3DPBA 1EDYA 5DVOA 4B9YA 4XXWC 1UWUA 4I9TA 4AEHL 1UH2A 1UR9A 3NG5A 3RR4A 3PSVA 3BI9X 3WJWA 1M7IB 3DTXB 2WWOA 3LEYL 5ACZA 5GZOD 1QSFE 3BIKB 3RJDA 3M7WA 1HSAB 1P2CB 1QEXA 4KZCA 3VUAA 2PDBA 2DWSA 2VLKB 1CB2A 4ZNEA 4NN6B 3L9BA 1CQYA 2YD9A 4FTVA 3L7RA 4Q8WA 4RFEB 4DBUA 3QRFM 3X3FL 3FN9A 1UIOA 3G5ZB 4G43B 4KY2A 3SY0B 3DPBB 4NFCA 1YTDA 3TYAA 2JH2A 3FS9A 1B4RA 4WO4B 1GVRA 1A6AB 2Q3ZA 1LL1A 2Q3RA 1SQMA 2QKIA 3K81A 4BEIA 1EFZA 5KJ4A 5DJZA 5LNGA 1JGMA 1U92B 3E1F1 3B3IB 4JRXD 4O51B 3GUWA 1WX0A 1HXYB 5D96C 1OO2A 1V08A 4I5XA 1HI6A 1AJ0A 3KRUA 1MIMH 4PJIA 3N43B 2XIBA 4JFOA 4MD5B 5AKTA 2BNRB 1ODUA 4WHYG 2ETWA 4O1EA 3UZ5A 3D3FA 3GM0A 3GFZA 2GI0A 2ZE0A 1HSBA 3KEHA 4HA0A 2A9NH 2D23A 1U8PB 4LSPH 1ESWA 2CM6A 3KWXA 3DFOA 3UPRB 3CPLB 1TV7A 5CZ0A 3N1PC 3Q0HA 3GS6A 3QYSA 1SW0A 3H7LA 8FABB 3MWAA 4C6PA 1RIVL 3IRCA 4PS7A 4AC4A 1A22B 3T0DA 2Q6ZA 3EDJA 2PTZA 2EJ1A 1T2XA 2X7LB 2Y25A 4OVUA 1J5IA 3ENLA 1B1YA 2TPSA 1EHLL 2ISVA 1RZIB 2B0SL 3CS2A 4JR9L 4Z3HA 2BOBB 5FC9A 3GAKA 5CZSA 1FHVA 3TBYB 2EPLX 2DQJL 2RCSL 5EF0A 3LTVA 5ECUA 1HNYA 3FSWA 5IDIA 4F66A 3G08A 4ZFFA 4PCFA 1P7QA 5C2UB 3TYEA 1C16A 4JFXB 2ZONA 5EBMA 2VLJE 3X12A 5BJTB 5MEQA 2GJZA 2JSFA 4UOW1 1XLIA 5A6TC 4GH3A 5C0BA 2LLEA 3OHXA 1UWTA 1XCFA 4G7EA 3D39A 4N6QA 5SWQA 1XF4A 1B9BA 5J4MA 2GBAA 4JUTA 1U91A 1A4AA 4PTMA 1G4MA 2O0TA 2FMNA 2XGIA 4GKOA 2I17A 3GG0A 3F58H 1W1TA 2HWZH 2VMEA 4JREC 2OQHA 1SZEA 3WQ5A 3ID7A 1X1ZA 3CZEA 2CM5A 1IC1A 1MRFL 4YH6A 4C56B 2LE9A 5HMSA 3SE4C 2VI0A 1DFBH 1ZDSA 3CHSA 4ZO8A 1F3JA 4CU7A 1G7IB 2E6QA 1IBBA 3C3UA 4MD0A 3FB6A 4OAWB 3WIIL 4D9QE 2O61B 4MJID 2J7DA 1I85A 2Y70A 4AD3A 3C5JA 5AVVB 3W7IA 2VRAA 4ZXBA 4AYID 5AL8A 4M29A 2ICWB 1B3JA 3DRQA 5EULV 3HHMA 1XGTB 1A2YA 3P0GB 3PHOA 4MADA 5B38G 2PYFB 4P5RA 1R17A 3D69B 2X1SA 1JIBA 5B1BB 5CEWA 5KSAD 3U2ZA 3VRJB 5HBFA 5IMLB 4X3ZA 5GRVK 4E4UA 2BRQA 1B4LA 2YMTA 3U6RB 5BRQA 5TK2A 4Z7WF 1BQGA 3ARZA 5ADOL 3O7UA 4X2PA 4XE0A 12E8L 3K46A 2W94A 2AEWA 4XP4H 4B50A 1OGAB 4C59B 4UNVA 2Z91A 1PVNA 3IV8A 3LQAC 5HD8C 1IBGL 2X9XA 3USBA 4RDYA 1WAPA 3WFCL 1WH0A 2GJXB 6REQA 4EIUA 1IR2A 3IEAA 3DGCR 4KY1H 3R79A 3EIFA 5E00A 3F00A 4I18B 2XA3A 4XMTA 1S5HA 2YUVA 4JTRA 4MVBD 4LLUB 2VEMA 4O8AA 2I85A 3QQXA 1PZ5B 1VLXA 2NX5E 4YWGH 3FDKA 1UD3A 2J24A 2VR7A 3UR2A 4PG2C 1MH5B 3QDME 1LP6A 5KTEH 3UESA 1NDZA 5EIQA 1FVPA 2P8PA 5BOFA 4DKFL 4N2IA 1V8HA 2KLTA 1JUEA 1QMLA 5CSBA 1DQJB 1SFDA 5GS3A 4YAQA 5CH9A 2XTJC 1EGJL 1DEDA 3QDGB 4FF9A 4WV1A 1RCXB 3L9EA 3NPUA 3W1RA 4KQ3H 4LSDA 4WU5B 3BXWA 2NY4D 4W8AA 4BDVB 1H5BB 1S3HA 3GLEA 4YN3A 5FYJL 1DEEB 2HDJA 2ZOTA 3NFPB 4V1DB 2OMWA 3CSFA 3KYNA 4LEFA 3BD4A 3IJDA 1NC2D 4MXWL 3W75A 3FQTA 1PLBA 3ES7A 3CDCA 4PHZA 5DYFA 5KSAA 3EWCA 5EEZA 2I9TB 3UF9A 4F4RA 1OIOA 4QDGA 3SUUA 1IFHH 2EEXA 3ZDYF 2EUZA 1D7BA 5DU7A 4R83A 2WIIB 3CLFH 1MJ8H 5IFPA 5LNVA 5AOZA 4AYGA 1INDH 3MMTA 4I7ZC 3LEPA 2P44B 2ZD0A 5JXED 4HJEA 1WOAA 2A6DA 4XX1E 2BVDA 1AGDA 4KPHH 3UROR 4YFDB 3AQYA 3LKSA 1XF5B 3GO1L 4ODHH 3C60D 1ZENA 4UWQB 4UBDC 4P2QD 4BKLB 3NJKA 3CSYB 2XHYA 5CC7A 5C6MA 1I7ZB 3HRZC 4LAQH 1BG1A 1A6WH 1UJ3A 2BDNL 1F07A 1SFLA 2PS2A 1EHAA 2AQPA 2F9BT 2HKFH 2QKIC 3DNKA 4KTDH 4X7FC 3BQUA 4XWOC 5JW3H 1G94A 5L2KD 2DZBA 4W4OA 3QEZA 3HG5A 4TUKL 1RUPH 2XV6B 3L3OC 3TCXA 2JELL 1BYNA 1TNNA 2WMHA 2XWZA 3MRJB 1XR8A 4D94A 2NY7H 2GQ3A 3G6LA 4RGMC 1UUNA 3SO3B 4I6VA 4XNZC 1ZJIA 2CU9A 1H8SA 3MV8A 1DSFH 1FY6A 2W62A 3OTRA 3O3EA 1ASQA 1D6VL 1I75A 1JVLA 3A6CH 4KMTL 4QR7A 5CPMA 3RUGF 3BH9A 5J06A 4FF7A 1XDTT 1LILA 1S46A 3CHPA 3QEUA 1I8LA 4XCNB 3T2LA 4DGVH 2DEWX 2G9HA 4ELDA 4XKYA 2ADGA 3GDMA 4GUJA 4I7VA 4HS8H 4Z0SA 2O92A 4KQ0A 2CITA 4F27A 4DGIL 3FN0H 2TRHA 1SVBA 5A3IC 3IKCA 4HKXA 4R7OA 3TA9A 3S88H 1BZ9A 5F7DB 4PN2A 2YRPA 5FD0A 3TLLA 1IL1A 3E0LA 4YFLF 1KZQA 3MLYH 4Q9BA 4XZUA 2PBOA 3BTNA 1WV7T 1QSZA 3DGGB 3KPMA 2BP0B 4OCYL 5I82A 4JFXA 3WENA 1IGFL 1E6OL 5AUMA 4C54A 4F7CA 5BJTA 4PRBB 1AFSA 3MOBL 4PJ9C 4RQQA 3QDJD 5CF3A 3EXLA 3GTTA 3AALA 4AH2B 2Y7SA 5IJCC 1BGAA 4RMRA 1HIMH 3RLSA 5AWNL 2JJTA 3NIFE 6XIAA 1DVYA 1I8UA 2BMKA 4L0ZA 1OJXA 2QJGA 4BUQA 4MJHA 1M2VB 3LZOA 4FS9A 4OFIA 1E67A 2ADJA 4O9HL 1INQA 3QY7A 4AZ8B 1FVEA 4PV1C 1OBAA 5BNKA 1HUVA 2ZAGA 4RDVA 3DK0A 3NABH 2KHAA 5I74C 1HH9B 1HL2A 1XIDA 4FP1A 3WKZA 3GBDA 5HGAB 1IKOP 1KG0A 3E9AA 4QDMA 5KVDH 2POZA 5ICYB 4ZMXA 5A2IH 1I4FA 1I9IH 1LQBC 1IEBB 2HT4C 1BEYL 2C4FU 1I82A 4ZFGH 5G4OA 1B90A 3FB5B 1E4WL 5D33A 1RU9H 5A2FA 3JQOB 5C0BE 3NZHL 1MFNA 2HH0L 3NN8A 3AT8A 2VXUH 4ORZC 4Q9RH 4LU0A 3VI2A 5I17A 4G1NA 2VH5H 3M17B 1QDSA 1BM3H 4AGNA 5JUEH 1A14H 5J8OA 4JCMA 1FGVH 3AXXA 1TQJA 3TYZA 4BH8B 3EMZA 3NZHH 3ABMB 1FL5B 3FFCB 2CO1A 3ZSSA 2DMCA 4G6AC 1BTMA 2G0WA 3MA9H 3OEXA 2IBBA 1KBVA 2PCPA 3TIEB 5LWYH 3RNQA 3W1ZA 3MA8A 4UU9A 5IB2B 4P5MA 4U6VL 3WF1A 2WBJB 1T5WA 3MAWA 4K8RC 3W7NA 1UD2A 1YMMA 4K8GA 2AXGB 3JTSB 1RD5A 3KRBA 2Z24A 1UR4A 1OGAE 4LAJH 1AGBB 5H4YA 3AIRA 2Z2UA 4L6OA 4KMLB 3NQIA 1USZA 1PTGA 1XW8A 5IFAH 4ZQPA 1IO4C 3IN0A 4FIRA 4GRSA 2QCHA 4NP9A 4DN3H 4HYRA 2E25A 4KCUA 4PI2A 2M1KA 1OHQA 1U8KB 5MI0C 3LIZA 4Q14A 2K7QA 2VLKD 4OFDA 4PJAE 2GSHA 4IMLA 1BIHA 5T1KD 4XVOA 1BJ1H 3EF7A 3CT7A 3VNZA 1N2RB 3PV6A 2Q20A 1WFIA 3QDAA 2MKWA 1CLOH 3GSQA 2VRQA 1UMLA 1U36A 3W7RA 4N0UB 4XPAL 3HUJE 3PJLA 4DK5A 2VR2A 4JY4B 5C9XA 4JIIX 4GW4A 2QDWA 4XP5H 3LPPA 2C3VA 3QNFA 1FVCB 2HJLB 4GQ9H 5AW9B 3S5LB 2JF7A 3LERA 4MIMA 4ZSUA 4AENB 4XP1L 2IIJA 2P8MA 5IB5A 5EFDA 2PP8A 4XPAH 1SSDA 3EYSH 4JFFD 2UZYB 2PLJA 1KV3A 2X53A 1TTUA 1U95A 2JKTM 4K15A 4PJ6A 4GYPC 3W7QA 1S7SA 1QSFA 3OXRB 1HEZA 2VYRE 4P5KA 3V0DA 4GXUM 1CFVH 3IETA 1PU0A 3KW7A 4ASTA 1J5OH 3IMVA 3OZKA 4MA3A 3CPRA 3QFWA 1OXYA 4MKTA 3H4GA 4BFNA 2I5IA 2PW1B 4XWOD 2AQQA 2FZ3B 1KTDA 4UT6H 2EVIA 2FX9L 3W2LA 3QIWA 2KPNA 2OV0A 1I0DA 1S5VA 2X4QA 2NR6C 2ZA2A 4ADTA 2FB3A 2SEBB 5E2TL 3EOAA 5E6IB 1GIGL 1EDTA 3VCNA 1P1MA 5D72L 2GWNA 1TO4A 1AG0A 2EDLA 4QHPA 1MQQA 4OWGA 1YQVH 2OYMA 4KJYA 1TV4A 1JCKA 2H1PL 2Q7NA 4DEPB 1NQKA 3CDZB 3PHAA 4OQTH 4PJCB 4HWEL 5T5FA 3CL7A 3APDA 4IL0A 4Q4MA 1IM9A 3NIGE 1XH0A 2V0TA 1Z9MA 4MDJA 4XMZA 4UCFA 4YXHL 1N3NB 3H2CA 2AABH 3KNBA 4OGYH 4P2QB 1ODZA 1WQVT 3QQ9D 3V5DB 2KAUC 2O7SA 1E27B 2YL8A 4DBWA 1PV8A 1EUAA 4ZK8A 1HFUA 1II4E 3N44B 1Y6NR 5D1XE 4RE4A 4U1KB 2MWCA 1P5VB 4BFKA 4PV8A 2FB2A 3AUOA 4OV6F 5C0CA 3SR7A 2H2SD 4O5LH 1E2WA 5EN2A 1BWLA 1RZGB 2PGWA 4AX3A 1CLYH 2GHWB 2MOGA 2Z6FA 3LPFA 1MCCA 4OQ1A 5DK2B 3SCMA 5I1IH 1BWVA 2BIIA 2EKGA 2PRHA 3KBJA 1M6JA 4ZNEE 4W9FC 2WCAA 3OG4B 4TIMA 4H5SB 2BSED 3UTSD 5A7BA 2ZAIA 1OFBA 4J35A 3B7UX 3HOJA 1CFQA 4F8QA 3RWEB 4W4OC 4ZFOB 5IBUG 5EIIA 2RTTA 3RB7A 5I1IL 1FFPB 1Z9PA 1NCNA 4N8UA 3VGBA 3TQKA 4PV9A 1JS4A 3EO9L 1EEZA 1BD2E 1RJQA 3MUCA 1E51A 2JQXA 4IXHA 2F1BA 3ZDYB 4FX5A 5ANHA 1TNMA 2YBTA 1YDPB 3VOJA 3C8KB 2EIDA 4L4TE 2QCLA 5HUPA 4UBDD 4WK4B 1WKEA 4IQEA 3EX3A 3I7SA 4WJEA 2GVYA 4JTAA 1O66A 3GIZH 4HHGA 3FSZA 2HAZA 2OCFD 1KV7A 2AV7B 2D2GA 4PJHF 1R3QA 5DT1H 3WTWA 1TTAA 3L5WA 3QR3A 3ZJ7A 3UJJL 3UBPC 3DI2B 2DQXA 1UUOA 3TW6A 3IFLL 5IV2B 1P0KA 4RWYH 2P47B 4ZQKB 4X63A 3AXLA 4L37A 3ARBB 2PWGA 2P24B 5ENWB 4NO5B 4ZTXA 3IAQA 3QC5X 4PWIA 2IH1A 3PP4L 1EYWA 3ZUNC 2CGZA 3BZDA 2ZVIA 3TA3C 3KM2A 4X4KA 2D2CC 4HHLA 4UXDA 2EDYA 4GUCA 4F58H 1W56A 3B3DA 5E2UL 4QFUA 2ZCZA 4H1ZA 5DC9B 4W89A 4RA3A 3C6EA 4N0RA 2V7HA 2A4CA 4FHKA 4PHXA 1HCYA 2ITEA 2CJTA 4WNQB 2MCG1 2BVYA 5L4FA 4WZHA 2OPJA 4L1XA 1C08A 1EFXA 3HI6H 2VQUA 2V68A 3ARPA 1V3HA 1SLUA 1OSZB 1YEEL 3WFEH 3PS6A 4HN4A 1YE6A 5TQLA 3II3A 4C60A 3K8MA 3ASOB 2WLHA 2WBJA 1BF5A 1KM3A 1QEWB 3ITTA 1JF5A 4B9IA 5IVNA 1DQDH 2HEJA 2AEPL 3P9MA 3SZ8A 1A0QL 2DQFA 1QNZH 4P2OB 4R5TA 3ABSA 2Y5JA 3CFJA 2YR3A 5F2IA 2DM7A 3ZMRA 2IPUK 1EPVA 4N9BA 5IBTH 5K9QG 2DQDH 1JHLH 1NEZB 2DDQH 3OX8B 1Z44A 2QPUA 4O15A 4U1SB 4TXVB 4D6EA 4H1LH 1KFCA 4LWWA 4ACPA 1MJUH 5MI0B 3V5KB 2QT3A 3UZJA 1ZIBA 4EXQA 1YNLH 1BAGA 3D3VB 4JRFA 2XG4B 1K77A 4KVNH 2VDNB 4AT6A 1CD1A 1UA3A 2YGOA 4ZMLA 6FABH 5E0KA 2Q3XA 4BQ8A 2INEA 2K78A 2W27A 2KZ1B 1SGJA 4O52A 2YQGA 2INZA 1C5CL 2YB4A 1ODAA 3S5LA 1MEHA 5FCZA 4GPNA 1F6FB 2Y0SA 4LLWA 6FABL 1JPTL 1TQBB 4H8WC 1MRQA 4GW5A 5JHAA 1ZBWA 2WBGA 3HVNA 1EXBA 5GZNC 1LEKB 3I3EA 4P49A 1HC1A 5FDWA 1YTKA 3KPLA 1Q0YH 4EI5A 2ZG1A 1ADWA 3UTSE 5A5WA 4UNKA 1KCZA 5DD5L 1WT5A 3MTWA 4OCXH 4P5KB 3CYJA 2EEAA 3MN8A 4TVUA 5DHMC 5A1AA 4E0RA 3C6LA 1IJNA 4TM9A 4YLQT 2AHIA 2V30A 3PANA 1HZKA 1Y0LB 4F33A 1HIZA 1BRLA 1TTJA 5D2VA 5ABTA 1JNNH 1Z9SB 2QLYA 4OCXL 5FA5A 4OVVA 4WNJA 4OLXL 4OKDA 4WWOA 5I75B 5M94B 1K7EA 3BDYL 2IH3A 3LTSA 1OPGL 3VD2A 1A5MC 5DZ9A 2C3ZA 3RPIA 3P8IA 5CLTA 5DVPA 3P2DA 1OOWA 5T1LB 3VXOB 1IMHC 3RL1A 4XB7A 3RVUD 4JLRA 3KBFA 3SKMB 4XNMA 3N9SA 4JHWL 5D9SB 4EAMA 4AQEA 4N9EA 4MJ2A 2OGYA 4FADA 1MNUL 4ZUTA 4HSHA 2VLRE 3MQTA 2DIAA 3IVKA 1UOKA 2VDOH 1CFQB 2GTZB 5KVGL 4F7TB 3ZW3A 2OMVA 2ZJSL 2Z4QA 1TZHB 2UVEA 4JRWA 1A5NC 1ZJBA 4F37K 2QDVA 3SQSA 3L2IA 3M1ZA 2O26U 3GLZA 3K1DA 3NFSH 1IAIM 1RULH 2GBUA 4PRPB 3X14A 4JFPB 4NKQB 1NMAH 2BWQA 3AFLA 3MRPA 4PYGA 4X99B 5EN2B 1PKMA 2P88A 4GQGA 1CB7B 4YBHA 3N85H 4O57A 1TQUA 4W9LC 1U4FA 4WHTB 4YGVA 3V7AE 4WHYH 4OF6A 5IGXH 5LQBH 2PZNA 4ZQNA 2B59B 3TR2A 4DJFC 3H0TA 3JV6A 3OPUA 1FG2B 3QZOA 5F7DA 1RHHA 4HWNA 3QDJE 3SODB 4LJ3A 4F48A 1HHHA 3LDBC 2R27A 3CC1A 5D7LE 4HUWA 1S9XA 3HN8A 4FG6D 1AH1A 3FKKA 1IVLA 1A9EB 2LAAA 1OIMA 5ICXA 3ZDZF 4DB7A 1CZ1A 2AEQH 1EF3A 2UWFA 3UXDA 5HHOE 4DJDA 3OKOA 5A3HA 3CFMA 4XWGL 3Q3GA 4FNRA 1RERA 4NZFA 1CIUA 3QCUL 2VX7A 2Y8UA 3T78A 5IK3B 5DEGB 4OV5B 1BTCA 5CJNA 3I4KA 4RE3A 4FQJH 4UNTA 4OGAC 3WKYA 2BY0A 2FHBA 3B97A 1RV6X 1MN4A 43CAA 3MRCA 4PYHA 4UTAA 3IU3B 4MYAA 3H53A 4E9XA 5D7JA 5KSUB 2CDGA 5GS0H 3KS0J 2CHZA 3M1BA 3VFTB 4B95C 2E9LA 4UFHA 4M5ZH 2NYYC 2FNBA 3EXRA 2PGFA 2H90A 5IQ9A 1JP5A 3NIGF 3M0LA 4PJCF 2OWXA 4G56A 4H2HA 4MQXD 5IK3A 3S2CA 2VFFA 3HAEA 2OXNA 4FA6A 3QNZA 2E9JA 4AMKH 3FRPG 4M5ZL 1UOVA 3NG3A 5BQ7B 3Q2CA 4J27A 4JFHD 5EHFA 4F9LC 1BMWA 2PDXA 3BEVA 2NNAB 4GB9A 4JANB 4O0ZA 2JKLA 2EXYD 3MNMA 4OLUH 5BZDA 4HOXA 3D0VA 1JZ3A 2WZ0A 5D09A 3GDCA 1U1UA 4GCXA 5CKSA 2OXGB 2VW4A 1JZ8A 4KNTA 3Q8FA 4MJ4A 4PW4A 2VTFA 1ROWA 5CM1A 1HQRA 3ESMA 3U9IA 2CLZB 3JZEA 4DAFA 4JX6A 3SDCD 1NCAH 1OGGA 2Y1AA 3CNKA 4DLFA 1QTSA 2FH8A 2GDUA 2PEVA 1U93A 2R0LL 2APXA 2RCSH 2O56A 3ME0B 3KL3A 3ULUH 4MAYD 4P3CH 4Q7IA 1PCSA 5D1QC 1K7FA 1V0NA 3HCVA 4JZOA 4GWEA 2XNAB 1T4KA 2YD7A 5B39G 2ENQA 4YUEH 3S3BB 4HP5A 1H6FA 3MHUA 4LZKA 3WMQA 1KTNA 4WXZA 1AH0A 4R9OA 1BXXA 2VL4A 2HLEB 2PDHA 3PZTA 4HZ8A 3MSDA 4D6CA 3DI1A 1B9ZA 3NJLA 4L9DA 4YDMA 4GXFA 5I79A 1EOKA 3CE1A 2DZUA 2PPDA 4X2UA 1BQLL 3VNDA 1GCYA 3QRLA 1BJ8A 2J8TA 1TETL 1QX1A 1O4UA 1I7RA 4UZSA 1PY0A 4EJ1C 3ZJ8A 2W9MA 2VABA 3QCVL 2CDEA 1THFD 3PUDA 3QEGL 1P4IH 2Y5QA 2B8OT 3QV9A 3WJYA 2YYTA 3T1GA 2XH4A 3QAZC 3HFFA 4H44C 4UUIA 4K94C 5B1AB 2VXUL 4Q9RL 1RXLA 4TOQA 5G5DA 3REVB 2AKZA 1TTRA 1NGQL 4LFHG 3QUMB 1TEFA 3LXCA 4GSRA 4FNQA 4KKQA 4Z7AA 2UY2A 3CK5A 2IWKA 4F9PA 4NSBA 2A4AA 4JQ3A 2FJFA 5CD5C 5D9SA 4P4KA 1ZB5A 4AWSA 5I6PA 2B14A 4F80A 3PDDA 2RHGA 4GH1A 4GMTH 3BUPA 5I1GH 3ORJA 3WIIH 5JORB 3IV3A 3CVIH 4BHUA 4GRLB 3TF4A 2QIWA 5GS1B 4NNCA 4YMZA 4XD5A 3W85A 2FSDA 3CL6A 1YEYA 2VDML 3QUMA 2FNWA 4WSHA 2O6DA 4UOZA 3BGFB 1PSKL 2XJKA 2QAFA 3ARYA 3D18A 5CEZH 1GGCL 2PBGA 4ZCWA 1M53A 2NX5A 2OMYB 4DQWA 3MRNB 4V2CB 1WT5C 1GA2A 1CCZA 3FT4A 2J4GA 1FZKB 2J77A 3OGVA 5DZNA 5GS1A 4RGOL 4UU9B 4GEJA 1KBPA 2LV4A 4HIIA 4JFUA 2X2YA 4OD2A 3ANVA 1P1VA 3PWLB 4WTZG 1SO5A 4C6QA 3DRQB 4K5NA 4D6DA 1HJUA 5JH1A 4P8WA 4L56A 5FYJU 4YZFF 3O4LD 2XX1A 3QQ3A 4YXKH 3U9UB 4AQZA 1BKSA 2B3RA 4Z3JA 1ROCA 3D0AA 2XQ0A 3DXAD 4N22A 3WNIA 4M4RB 3H9SD 1NJJA 3ASWA 3LMZA 2RFXB 2Z35A 5MEPB 5AY7A 1YC8A 1A7QL 1TA3B 5EUKA 4BCYA 2WCPA 1E73M 2A21A 4PFHA 5FYJH 3RA7L 3SD2A 3DOIA 3MVIA 3DOHA 3IRZA 1HDMB 2CH8A 4XMPL 3QRHA 2E7FA 4JE4B 1TUFA 2J4WH 4LVHB 2V5SA 2Y5TB 3EX1A 4XWUA 3OVGA 4TTDC 3S36H 3VXSD 1E5NA 3M1BB 2AQVA 3GT6A 3VXSE 2BLEA 4N2YA 3LH9A 1JGDA 1CYWA 1PIIA 3CZLA 4K6AA 4PL2A 1D2PA 2IKIA 2YPLB 3SDDC 1I1RA 5L2JA 2OO6A 2X70B 1PB0A 4LLUA 3L5LA 4M1RA 3WCZA 2MCPH 4N2NA 2NLJA 1J8VA 2D7NA 4NLAA 4NU7A 3ZE2B 3N5AA 4MAUH 4UMGA 3CZSA 1UUQA 4C1KA 4M4PA 2XSXA 3CLEH 4QG6A 2UXGA 4Z95L 3PP3H 3NZQA 1LORA 1O7AA 4XN1A 2BPBA 4P57B 1LJYA 4NKDB 1EVTC 3U82B 3BWAA 5BOJA 1CW2A 2YL5A 3HNVL 3KPRA 2QF8A 3HPJA 4KGJA 3W26A 2IMRA 4IIHA 4M82A 4HT1L 1EJTC 1YUKB 2A2IA 3M0KA 2PO6D 1UT9A 3ALFA 5GS0C 3SB0A 3KYNB 3W7EA 2COVD 4ZO6A 3NQ2A 1KV8A 1Y1DA 3VDGA 1SY6A 2BX5A 3PWUB 4U1LB 2FB4L 4OGQC 1E6ZA 3OW1A 5K39A 1ENUA 2XIOA 5IFHH 4GRWF 5EBAA 5TF1H 3HGJA 4Y9MA 4YL2A 3QW9A 1LQ2A 4LAOA 1OIFA 4QF1A 5AAPA 4S3FA 4XZMX 1X39A 2G2NA 5MHSD 5CGQA 3OMIB 1J1PH 5DF0A 3TX4A 2P3EA 5SWZA 4UAOC 1QUNA 4EVNA 2W60A 4H9XA 2RQEA 3QGVA 1XBRA 2PDJA 4AJVA 1N64L 1AGDB 3OKKA 2DV0A 5CHNB 1C92A 5K1VA 2V5DA 4A8IA 1A5FL 3DX8B 3PNZA 1AHMA 3SB3A 4B9FA 1TFPA 4M7JH 5M1TA 5E2UH 2IWGA 1P5BA 2WXFA 3EWUA 4LFYA 2VFGA 1VPOL 1U0QA 5JW4Q 4Y9PA 3TBWA 3EH3B 3ZDZE 3IDNA 3BQUB 2F2HA 4RH4A 4P3DB 3TEZA 4A2SA 1CG9B 3A21A 5JPNC 3IM1A 2CIKA 5SWQB 4MNMA 2A6IB 4PE8A 2VDOB 5FKAA 4K5MA 4KRUA 4XB3A 5AVHA 5F72S 1JDFA 2Y63A 1M7OA 3DX8A 3RFZA 4FQIL 4WW2A 3N2OA 3K5SA 2VN4A 2VEGA 4EI5B 3B2DC 4E3TA 3RR1A 1OD9A 4NO2A 3MRQA 2X4SA 4TQEL 4E8GA 5T3ZD 3BJFA 2KERA 4FXJA 1NWPA 5D1XB 3MMDA 1S9WB 3MV8E 3O0LA 3OWEA 4AL8L 1YNPA 2XIMA 2R83A 3C2VA 2H7WA 3PU7A 4IF2A 5FHAL 1E4IA 3ONBA 2VO5A 2WQWA 1DBKH 5DGQA 4Z78B 1UA7A 4LESA 4PJCE 2FATL 5DRNB 1I8MA 2DT0A 1YPZA 3NIGB 3W0KA 2C14A 3C5JB 4N02A 3MBWB 4LUTB 2I7GA 4CW1B 1MG2C 4D7BA 5FHAH 2R2HA 2QCDA 1R7OA 4NJHA 2Q6WA 3ZIZA 1S78D 2ZNXA 3S35H 4ZD3H 1MHCB 3P80A 2KZWA 3QQ1A 4H20H 3LZFL 3HLAB 2ICSA 3THQA 3Q01A 1AZBA 5BRPA 4KEMA 3PWVA 2I26N 3WNMA 3HC0B 4B53A 2XWJA 4FFZH 3WQDA 1PZ2A 2HUHA 2P48B 3C5ZD 2WMPB 5G5IA 1Q2SA 2CK2A 2VDIA 4MA7H 1TZGH 2CXGA 3QXAB 3PZOA 4PUDA 1Q38A 2ITDB 4ZO9A 4M9OA 4B2DA 3UBXB 5FF0A 3EOBA 4Q33A 3RVTD 4BE6A 4CADA 1O5DT 1VBGA 2AJYL 3M5YA 3CX2A 2R39A 4QXTA 3SDAC 1FA2A 2DMHA 5C0CE 4XCFH 1WDRA 3EMCA 4GZEA 5IBTL 5E0QA 5LVEA 4QISA 1AZVA 1T83C 1H1NA 2YX0A 5DEJA 4WCYH 4AYMC 4UT9L 4LUYA 1CYXA 3MXWH 4GI8A 4XPHH 3V8CA 5C0IA 3LOWA 5H2BB 3VX1A 2E3VA 3U30B 5HVHC 3C61A 1L9QA 2BCKB 1SMDA 2ODHA 5AKRA 3N1AA 4Y4FB 3BSZA 2GGJA 4REQA 3F7YA 1EUNA 1ZEAH 3QV8A 2AI0H 5IEHA 1XEUA 3SCUA 3MVTA 5A2AA 3FS2A 4AEOA 1QQDB 3ARBD 5HPMA 5J11B 2Y62A 2R0ZL 3P4MA 4OD3H 2J5WA 4XNUL 1BA9A 1KEGL 1YPIA 3WJXA 2Y3NA 3WF3A 1T7XA 2BWIA 3I84A 5FDYA 2O9TA 5IT2L 2Z35B 3KJ4B 5MEPA 1NC2A 5K4XA 1JPSH 5ABFB 1Z9AA 2ADFL 4NXKA 1OE1A 2PCPB 3N44F 4RAVA 1AUSL 1BYBA 1VRXA 1T0NA 5KVGH 3K6NA 3BLEA 2BVUA 4NPKA 4HKBB 3IFPA 2HBVA 4DT2A 1PZAA 1XB6A 2GJ6B 1AOHA 2HVJB 4MJ6B 5ICXB 5F70A 3WJMB 3OA5A 4LTSA 4CAGA 1M9SA 3LPGA 2CRZA 4UT7L 2O9RA 4RMQA 1OC6A 2ARJQ 3L0NA 1UM5L 1A6TB 1JNNL 1RJYB 4CSPA 4CD4A 2R69L 1RIHL 4XP5L 5CKAA 3WD2A 3MJGX 1IGJB 2NTFA 4TQPA 2YD8A 5HGDA 5LAXB 3TQ0A 2Z1KA 2D73A 3EYFA 3AWNA 1DIDA 3PGCA 4IGBC 2QVHA 2WZAA 4U2YA 1GIGH 2D2JA 1XBYA 2UXTA 1X7IA 1YMMD 1SYSA 4X5QA 1DUZB 3GG7A 1QAWA 4FNTA 1V8EA 1CYGA 1BPVA 3LLDA 4X61A 2H1PH 1MUWA 4PJ7A 5DUBB 2BGNE 4D6HA 2EAEA 1I8KA 3DYPA 3L5HA 1WZKA 4WUKH 3IJEA 1UA6L 5TQ2L 2CG9X 2IH3B 4KQ4H 3ZR6A 5JQIB 5F4XA 1QUPA 1B4JL 7PCYA 1Z89A 3O3UN 4X6CE 3B0UX 2VW7A 3AZUA 3IE9A 4U1HA 5TDPB 1R3KA 4FSAA 1G4RA 3F7QA 3H42L 4DW2L 1DV7A 1NLDL 3B9KC 2QKSA 2ZWKA 4HHWA 1Z7AA 4J5NA 1L6WA 5F3FA 4PVLA 3GE7A 1FBIH 1JN6B 4PJ8A 3W1AA 4CBPA 4XCCH 3KWSA 3R1GH 1Z6JT 4ADSA 4HFUL 1N6QH 3QSTA 4PJEB 4N2AA 1I3GL 4UB0H 5LXVA 2HZGA 5I6SA 3BT2L 2ESVB 2UY7A 4GMSH 1MXGA 3WXVL 2JJTC 3UTQB 2FPYA 2GJZB 3IVSA 5IMKA 3BX7C 4FXKC 5CCGE 1H49A 1W37A 2QVIA 4NCC1 1AGFA 1SM9A 3C5XA 1V7ML 1G4SA 5IF0B 3HB3D 5B4MD 1TG7A 1S2WA 5GRWA 1QACA 1AC0A 4Q6IA 4P2RE 2W80C 4JQVC 4J3XA 1YEKL 1U8MB 3LHPL 1CZ8L 3KMDA 1KV5A 1P4LB 5I3HA 1T21B 4ODXB 4HHHA 2XPGA 3OR6B 4C56D 3LPWA 4ETQB 4ZEPA 1V10A 5IVXE 2VC2L 2P26A 3MLTA 4OT1H 2OZ4A 4IBZA 4HSOA 3LSCA 4LY8A 2HUEA 5I1DA 4GI6A 3KRZA 2PTTA 4ANXA 1LE5A 1SR9A 3O0KA 3BHBB 3GS7A 3W2DL 1QWHA 3NAAH 1KFKA 1QPNA 3W27A 3KXFB 3OMZA 3A4WA 4KHXH 3VKBA 3NSXA 3LCYA 1ETJA 1AHWB 1X1NA 1QKZL 3VK5A 1L9OA 1QU4A 3BZ4A 5KZMA 4H0HB 5KW9L 3ZKXC 3FQRB 5JZ7D 1E70M 4R96A 1JHKH 4OM0L 2YDAA 3FMGH 4GRWE 1VBHA 4IQDA 2FTPA 2HMCA 3WE1A 4ZSOA 1W5OA 4MD4B 5IUCA 3MCMA 2EILB 3D2UA 4ZUUA 2YDRA 1JHKL 2VLRA 1IB5A 3CCHB 2PDQA 4WSGA 4G7QB 1CJYA 3ROLA 1NVMA 4UCGA 3SUTA 1KBGL 3BQUD 2WMFA 4YHGA 4M1GH 4JFEE 1I8JA 2YXGA 1NTHA 3ITXA 3KOXA 5FJJA 4CNOA 2XKNB 5JW5A 2X4OB 1DQDL 5FYKH 4DP2X 5DMLA 2A85A 4WI6A 5TDNB 4AGQA 3GSWA 4I4WB 5IW1B 3SCVA 3WTYA 1FAKT 3MI3A 2MANA 1I8LC 3HS0B 1FYTB 4R7XA 1UWYA 3PL6C 2NQ3A 1AXTL 2NY0D 3IGAB 4JG0L 1IGIH 1OTUC 2AGTA 1N8WA 3CVIL 5BVJB 1ZU8A 3GDLA 3DRTB 3S46A 4UTHA 3CHRA 1Q0EA 2VQ4A 3QJAA 3MNZB 4QXVA 3SDYL 2QCCA 1LO2H