4CKQA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
390
structure length
390
Chain Sequence
HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 135
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4ckqA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ckqA02
3WY2A 3D52A 3W53A 3WF1A 4GO9A 4D72A 5LA2A 5CG0A 1ODZA 2VO5A 4PMDA 1GQJA 2IXUA 2VRJA 1WDPA 1OT2A 2D0FA 3EJTA 4BQ5A 2V3EA 4UCFA 1JNDA 1LQ0A 3ARYA 3WEZA 3GXMA 3TTOA 1TR1A 3VNZA 4BQ3A 2GJPA 5CSUA 3WH5A 1KGWA 1HJXA 3L2LA 5DT5A 4FNUA 2D0HA 5KZ6A 3ZOAA 2OW6A 3PZ9A 4AXNA 1WAWA 3A4WA 3LXBA 2CKRA 2DDXA 1TQTA 2XIIA 3AS1A 2JF7A 3EJQA 1O6IA 4AZBA 1TQUA 1SZNA 4M80A 4YHGA 1FP9A 3DYOA 2CEQA 1V6WA 2VCCA 3OGVA 3OZPA 3KL0A 4JKKA 5A6JA 2XN1A 3A23A 3EDJA 1JNEA 2WYSA 4UFMA 4XUYA 3GXNA 5D8WA 2OSYA 5D9NA 1W2PA 2VURA 4UFLA 5LYRA 3NYDA 2GK1A 3ZM8A 2X0HA 1W2VA 2VVSA 2DQXA 1SYTA 1ZBCA 6A3HA 2VUYA 1V6YA 4Z2HA 3VD3A 2J7FA 1J0KA 3B9AA 2J4GA 3VILA 2VT0A 3HG4A 2GFTA 4W88A 4D71A 3DX2A 1RP9A 2EPNA 4AZCB 3M07A 1A47A 1BYAA 4F8XA 4CD8A 5BXPA 2WM0A 3WELA 1TZ7A 3T08A 1ZBKA 4FNQA 2WKLA 1V6VA 1H4PA 3I3DA 1ISZA 1JL8A 3A21A 3VU2A 2J62A 4UQBA 3RCNA 1EDQA 1QW9A 4Q7NA 1SMDA 3WUGA 2X05A 2BHYA 3EJRA 3ARXA 5LA1A 1BYDA 1D7FA 3SUWA 2C8NA 2WZHA 3CH9A 1EQPA 3SIMA 1KXHA 4MNKA 3S2CA 3U5YA 3LX9A 2BVDA 4A3YA 2TAAA 3BSGA 3CLWA 5JIWA 2DIJA 2XVPA 4V27A 3I3BA 2EBNA 2XWEA 1HJQA 3WD1A 1QNQA 2OWXA 2J78A 5BRQA 3VMNA 3DECA 1LJYA 1WZMA 1R46A 4NXSA 3D4ZA 3S5ZA 5A8MA 1I75A 1GPFA 1E5JA 4P7LA 2XPKA 2YIHA 3PZUA 1DTUA 4CU8A 3BAJA 7TAAA 3AIRA 2WHJA 4AD0A 3ZIZA 1CENA 3QHOA 4UZUA 5A1AA 1UD4A 3LPFA 3PZNA 4AZ6A 5E6YA 5EMYA 4HOWA 5M5DA 3AJ7A 2EEXA 1K9TA 1Q6EA 1OGGA 4FMVA 3DDFA 4J3XA 4WSKA 3CHDA 1DWGM 5IHSA 3UESA 4NZFA 2XTKA 3W27A 1FH8A 1GORA 2E4TA 2D20A 3N17A 4GIAA 4QFUA 1QWUA 5FOOA 4D6DA 4DO6A 4CKQA 3RIKA 4W93A 2BXZA 2UY5A 3W24A 4AZCA 3AHZA 4H41A 1HJVA 1BF2A 5JBDA 1JI2A 1U30A 4PMZA 2D3LA 1U2YA 1R8LA 1VFUA 1E9LA 1UD3A 4C7DA 4QP0A 2XGIA 1H41A 3AHXA 4PTXA 2YL5A 4TVCA 1UR9A 3LXCA 1V02A 2D0GA 2QHAA 5A2CA 3CZLA 4HU0A 1GOMA 3DDGA 4J3VA 6CGTA 1CGVA 2D22A 1GOQA 4PYSA 2X0YA 3WQ5A 1JDDA 1KXTA 4JKMA 1UOKA 2EACA 2YBTA 3AZRA 2Z1KA 3ARUA 1E70M 3GBEA 3WMSA 1UKTA 2VRQA 3M7SA 1QNPA 3UR7A 4UOJA 2DH3A 4BQ4A 1QI3A 1WP6A 2FE0A 2V3DA 4Z2LA 3POHA 2BVYA 2WMHA 5C8BB 3VD5A 2W5FA 1CXIA 3GH5A 3AQUA 1C92A 3AROA 3VO0A 2A3EA 2W92A 1JDAA 1GUVA 4HMDA 5CSYA 3EMZA 1J01A 3BAYA 3ALGA 1PX4A 4GZEA 2WVUA 1GHRA 3L4YA 1PZ2A 2WZIA 4HMCA 1NOWA 4KRTA 1R85A 2WAGA 3OG2A 3WENA 1UR2A 2FDMA 4PMYA 3VD7A 4HU8A 4UOQA 1RH9A 1E1FA 4NSBA 3T09A 4ML4A 2WVTA 2ZUMA 2OSXA 1C8XA 5CPSA 2CYGA 1QNOA 1NM9A 4ZE5A 1EO5A 3WDRA 3HU7A 3RM4A 3ZT5A 1HKMA 4WKHA 3HG2A 2CIPA 3ARRA 4U5IA 5HNNA 2J7EA 4E8CA 4H2CA 1K6AA 3DX1A 3RM9A 1DWIM 1J0YA 2EO7A 4NX0A 4NF7A 1Q6CA 2EABA 2CESA 1W1TA 4GPNA 4GI9A 2W91A 4HZ7A 1HTYA 2WZEA 1XYZA 2D24A 2X09A 2FHCA 1SFSA 4AYSA 2UY4A 4LYQA 5ECUA 2V3FA 2EXOA 2VI0A 1J10A 2ZX5A 3JUGA 3VGBA 4WKFA 1UA7A 1B9ZA 1BFNA 2YL9A 3CHCA 1UKSA 4UQEA 4FLSA 3TONA 1H49A 4P8WA 5A3HA 4GKLA 4ZENA 1NP0A 3RPMA 2XGBA 3BH4A 1QWNA 1CEOA 2DSZA 2F1AA 2VX6A 3CIVA 3KL5A 4UNIA 4PN2A 2XJ7A 2Y4SA 3MKKA 4N0RA 3D51A 4AISA 2FH8A 3AFBA 1VBRA 2WXDM 2WSPA 4M29A 2ZX9A 3FHQA 4J28A 4UQCA 1CNVA 4FNTA 3EJUA 3MU7A 1HXJA 2ZX8A 3ZSSA 2XHYA 4TTUA 2J7CA 4AEEA 3PZOA 2V38A 2EPOA 4MNJA 1PZ3A 3ZR5A 1E6RA 4PMQA 3BAIA 1VFFA 2WMIA 1EGZA 1QBBA 1JYWA 3K8LA 4UFKA 5AC4A 4QAWA 1UWIA 1I1XA 3ARTA 1JD9A 4LPCA 1GNXA 3O9NA 3VD9A 1M7XA 2EADA 4V2XA 4GXPA 3A47A 2OYKA 3A5VA 1HKIA 5I23A 3A4XA 1TQVA 5BWFA 3VIPA 1C93A 2XSBA 4H7VA 3T2PA 2WMJA 5DO8A 1CECA 3GDBA 3NIYA 1W32A 2E8YA 3ZT6A 1UKOA 5AYBA 1TA3B 4QLLA 2OYLA 3BUBA 3EDDA 3DYPA 1BVZA 1BLIA 5LA0A 3AZSA 2CERA 2WANA 5A6AA 2XVGA 4W7UA 3WFLA 2E9MA 1HF6A 3ZJ8A 1QW8A 3POCA 1MW2A 5ABHA 2VC9A 1XGZA 1H1NA 1TVNA 4FK9A 1MFUA 2C7FA 5C71A 1B3YA 4Z2GA 1AQ0A 2J7DA 3VDAA 5A2AA 1V3LA 1E3XA 4RE2A 4AMCA 1WPCA 5A69A 1M01A 2E9LA 2JEQA 3T0AA 4HOZA 5BYWA 1JZ8A 2C0HA 2VX4A 2ZIDA 2GJXA 1ISXA 4LYPA 3KLKA 4IPLA 3N15A 5M03A 1C3FA 5A94A 2DSVA 2ZXDA 1O7AA 3VIMA 2HISA 1ECEA 1YHTA 3L4ZA 2WBKA 4PTMA 4A4AA 1KQZA 3A24A 2CETA 3WH8A 3H53A 2VCAA 4Z2KA 5A8PA 1CBGA 1UD2A 1ZBVA 2WVVB 2PC8A 1B90A 1LWJA 1UG6A 2IGTA 2BHZA 2F2HA 4EAMA 4TVDA 1MFVA 3BLKA 2DT3A 1VBUA 2DGAA 5CQ1A 4X0NA 3AMKA 1WZLA 3VDCA 3G6LA 4N42A 2VX7A 3WQ4A 2VCBA 2X8RA 3W38A 2G3JA 1QHZA 2F61A 4JL1A 5D9PA 5CPTA 4Z2IA 2CBVA 4TUFA 1N82A 1JF6A 4PUEA 3SUTA 2WHMA 2FYVA 3L4UA 2W67A 4NI3A 4Q22A 1ZB5A 3TTYA 4M1RA 3OLGA 3SCOA 5ABFB 3VGFA 1UR0A 5D4YA 1MYRA 2UWFA 1JZ5A 3DX3A 4DO5A 1TA3A 1V0KA 4W8BA 4B3LA 1Z32X 3K8KA 1H0GA 3AXXA 4IM4A 3MMDA 2IUZA 1X6LA 4JFTA 1B3ZA 2J77A 3WNNA 1QHOA 3AYSA 4JFUA 3AMGA 2VNCA 5I79A 5BXSA 1LL6A 1WNOA 4MAZA 5A6KA 3GXIA 1CLXA 2IXVA 1LLOA 4GI8A 3MV11 4PBGA 4AZIA 4B9YA 2GK1B 1NP2A 3KE0A 3BLPX 3D4YA 3PZGA 1H0IA 3TA9A 4TX6A 1C8YA 3ARWA 3WF2A 1XSKA 2CPUA 4CD7A 2A3CA 4OOUA 3AIQA 3BGAA 3A22A 4U3AA 3EMQA 2WWDA 2ZWZA 1EQCA 5DFAA 3ZMRA 2NW0A 3SCRA 2D2OA 3D50A 3N9KA 1K9FA 4R5EA 4W84A 1OWQA 4MB4A 3MSGA 4U2YA 2PWHA 3GTNA 1KXVA 1ISWA 2PBGA 3D5HA 3NCOA 1JYVA 1US3A 3WNKA 1CGWA 4E2OA 4PMOA 3LRKA 5GNYA 2YLLA 4P7NA 2PWEA 2JE8A 5TD4A 3GXTA 1XD1A 3WH7A 4CCEA 1QI0A 1CZ1A 3DHUA 1EHNA 1BAGA 1UASA 1GJWA 4ZE4A 4GQRA 2J75A 4AD2A 2XUCA 5ABFA 1QI2A 1WZKA 3BVUA 4DO4A 1HXKA 2WLZA 3FN9A 1PX3A 1OSEA 1PS3A 5A8OA 1R47A 1CYGA 1WZAA 2VTFA 3VMOA 3L4XA 1NH6A 2JALA 1S46A 4D1JA 4W85A 4UQAA 1KCLA 4WJXA 1GVIA 4AIUA 2YBUA 1PIGA 5I3DA 4JCLA 3LXAA 1FHDA 1NOFA 2YLAA 3NJ3A 3VM5A 3PHAA 4NZJA 1T0OA 3QHMA 1O7DC 4U31A 1NWSA 3OGSA 2YDRA 3WY4A 2E0PA 4PEEA 3RILA 5I6SA 4HA1A 1ZBWA 3PZQA 3MV01 1CLVA 4DWSA 3WBAA 1FA2A 3OB8A 1OGSA 3AZTA 4IUGA 1DWHM 1ITXA 2E9BA 4CD4A 1Q6GA 1E73M 2W61A 3VX1A 1EH9A 1CGUA 3TV8A 3FXYA 4U3CA 3KL3A 5E0CA 4QLJA 3IGUA 1IV8A 1B3VA 3MMWA 2V5CA 1AVAA 1X1NA 4K68A 3BVXA 2F1BA 3NDYA 1GZJA 3WF0A 4JL2A 3VSTA 5I2UA 3BAKA 1BG9A 3PZIA 2WPGA 1LG2A 1QI5A 2ZICA 1RPKA 3WFZA 2CBIA 6TAAA 3EBVA 2WHLA 1W9XA 1KGXA 1GOKA 3VD4A 4QCEA 1V0MA 4D6EA 3K4DA 4MTVA 5BRPA 1C90A 5I0DA 1QI4A 3CZNA 1UWRA 1ZU8A 3VSVA 1UQZA 3VINA 1V02E 2D3NA 1GQKA 1EA9C 2CITA 2G41A 4H04A 2QV4A 1KB3A 4CN6A 2VOTA 3ARVA 1TQWA 2ZUNA 2FHFA 3APGA 2YKKA 2XN0A 4BZYA 1R75A 2J8FA 4JFVA 1A3HA 2RGMA 2CKSA 4PSRA 4W87A 3KWXA 1R7AA 3AMDA 5EB8A 4D6JA 2G3NA 1RP8A 3AHVA 5DF0A 3AIBA 4AD4A 3DX4A 2F7PA 3WKZA 4KRUA 1UYQA 3AIWA 1QOXA 4EE9A 1GOOA 2NT1A 2CCRA 1GVYA 1HN1A 2JIEA 5I5RA 5FKYA 1Q6FA 3KZSA 4ZXOA 5AC5A 4H8HA 3F5KA 3T2OA 1V3IA 2XVKA 1JD7A 3VIIA 1WDRA 3BAXA 1E15A 1XH0A 1W3LA 1GQLA 3RJXA 2V3GA 2VQUA 1CDGA 2DSUA 4WLCA 1ISVA 3CHFA 3VDBA 4XX6A 5FCZA 2FGLA 3B9DA 1LL4A 1M04A 5HDRA 4B9ZA 4HA3A 1W1PA 3N04A 1NWTA 3W0KA 1G01A 3N18A 4QDMA 1GONA 1W3HA 2XM1A 3TTQA 1HNYA 4LXFA 5AY7A 4D6IA 1KBBA 4OJYA 1SR0A 1BYBA 4QLKA 3OZOA 1MW3A 1JZ2A 1KWGA 5EBAA 2PWFA 3CC1A 5FIPA 4ACYA 4PSPA 1JYXA 3HN3A 5KEZA 2WK2A 3DHPA 1VFMA 2YL6A 5BROA 5D9MA 1HKJA 4PTWA 4D6FA 3HJEA 3OGRA 3UETA 2WMIB 2ESCA 3IAQA 2WHKA 5FL0A 2J79A 2WNWA 1QBAA 4UFHA 4QCFA 3NSMA 2ZUWA 1DWAM 3VTRA 3RJYA 1PPIA 5E70A 3WUBA 1EOMA 1HJWA 4GQQA 3B9EA 3W28A 1E3ZA 3ZO9A 1J0IA 1UUQA 5ABEA 1GW1A 4AMXA 2D23A 4AIEA 3AXIA 1XCWA 1LL7A 1DP0A 2PF0A 3W6LA 5E6ZA 4EKJA 2YA1A 4FLOA 2BNJA 4UOZA 2YFNA 4W8AA 5M3WA 1G0CA 1F4HA 1HX0A 2X2JA 4V28A 1KXQA 2BVTA 1DEDA 4LX4A 4AZ5A 3WF3A 3OLDA 3N1AA 1G1YA 4AD1A 1I1WA 4TXEA 3ZJ6A 2Z1SA 2WB5A 2O9PA 2W63A 1MQPA 1JGIA 3ECQA 1KGUA 1E6PA 1LG1A 1V3JA 4FNPA 2GJXB 3E1F1 2XN2A 3N11A 1W9BM 4WF7A 1W9PA 5I24A 3T2QA 3CUGA 3VMPA 1X6NA 4JIEA 2OWWA 4MB5A 4KGLA 1HT6A 5I78A 3CUJA 1EO7A 3WUEA 1R34A 1FH7A 2OW7A 3H54A 1ITCA 1V3HA 3AS2A 5DT7A 3BMVA 3HG5A 3B8SA 3II1A 2ZUVA 2XIBA 2BS9A 2VVNA 2BY1A 3PBGA 3CZEA 2OSWA 1EOKA 2O9TA 1C7SA 2GUYA 3VM7A 3BAWA 3WF4A 1IZJA 1MWOA 4P7OA 5FL1A 2XFFA 3THDA 4EK7A 4F9JA 2VZSA 1BQCA 3WQ8A 2VZOA 2VZUA 4MADA 4M81A 3BVWA 3AIVA 5A6MA 3RM8A 5E9AA 3CGTA 1ISYA 1R7OA 3LPOA 2YA2A 1MW1A 4FNRA 1E43A 3NSNA 3QOKA 3WDQA 2QF8A 3GYCA 3CZSA 1OIMA 3S5YA 3BVVA 3K4AA 5CGMA 3WNPA 3AHTA 2J7HA 2WC4A 4CCDA 1PAMA 4GO8A 4W89A 1JFHA 3OLIA 4OIFA 1E5NA 4R27A 2RGLA 4JHOA 3PTMA 5HBFA 4UTFA 3G6MA 3MSDA 3LPGA 4PMVA 3VIFA 5HOSA 1TUXA 2GVYA 3F5LA 1PEZA 2F18A 5HPOA 1R87A 4D6HA 4XB3A 4UFJA 1V6XA 3VGGA 4HZ6A 1KCKA 3BVTA 4S3JA 1WO2A 1OGBA 1JZ4A 2J7BA 3WMCA 5A6BA 1E6SM 1FFQA 1KTCA 1CPUA 2QMJA 1KR1A 1XRVA 2YL8A 3L4TA 1E4MM 2WVSA 3OLEA 1EHAA 4F9DA 4KMQA 1BPLB 1OD0A 4BCEA 4WKAA 4OBSA 4NRSA 1CIUA 1UH3A 1NARA 3MANA 1ZJBA 3WD4A 3AISA 4FNSA 1BG4A 3AIEA 1HWWA 2ZUTA 3VUPA 2ZXAA 1K9EA 3D3AA 5EFDA 5EFFA 1E4LA 1XSJA 4JFWA 1TQSA 3VKKA 3PN8A 4UQ9A 3WY1A 1UQYA 1BGGA 2F7OA 2AOSA 5IHRA 3W6MA 1DWJM 2Y24A 3CMJA 5IFTA 1NQ6A 4HA4A 4ZEPA 2E8ZA 4AW7A 3QR3A 2E40A 3EDEA 2F7RA 1JXKA 1K9DA 2VZVA 2JIWA 4ATWA 1JAKA 1W9UA 2QLYA 4CUCA 2WWCA 4AY1A 4PCSA 3QGVA 1KWKA 3W4RA 1R33A 2YDQA 1VFOA 3EJPA 1XCXA 3VIJA 3K8MA 4JHZA 2Q8XA 1EXPA 2DSWA 3SCWA 2GDVA 1CGYA 4JFSA 4HP5A 3GNOA 4PMRA 3O2LA 2ZX6A 1PBGA 3HG3A 1WE5A 3IJ8A 3T0DA 1H09A 2EQDA 2BFGA 3QHNA 3WDPP 1UWTA 8CGTA 1UD8A 4RE4A 3ARZA 1W3KA 1Q4NX 2WMKA 1ZS2A 3IJ7A 4C7FA 4H8VA 3W81A 4KWUA 2FH6A 3VPLA 9CGTA 1VEMA 3VSUA 3DYMA 4DWSB 1PIFA 3WD3A 1JZ7A 3AHYA 4XV0A 1GOIA 1VB9A 5A6SA 3VGHA 4NZCA 3ZJKA 1JZ6A 1V3KA 5I77A 4JAWA 4JKLA 3BUIA 3BCDA 1HP4A 1HVXA 2DT2A 3FHAA 4CCCA 4MDPA 3TP4A 3L4WA 4M8UA 3BLBA 2XYLA 3GZAA 3GNPA 3PZMA 2W66A 3UG4A 4AD3A 1E1EA 3SEPA 1P6WA 3MI6A 3GBDA 2W62A 1B31A 3S6TA 3SURA 1JXJA 1E0WA 2QPSA 3A3HA 2XVLA 3F5JA 4W7WA 5A95A 3AMLA 2YOCA 7A3HA 1XYFA 3MUIA 4YPJA 3WDHA 3LRMA 2EPKX 1B2YA 2J25A 4GINA 2BV9A 2XWDA 4HZ8A 5IDIA 3L4VA 1B3WA 4W86A 1F4AA 2WKGA 3KEHA 2NT0A 1TG7A 4RE3A 4AIOA 2MANA 1VRXA 1E40A 4IISA 5HPCA 2UY3A 1ZL1A 2ZUUA 2WC3A 1FHLA 3WNLA 4DM2A 1KTBA 1B3XA 5E09A 3EJSA 2J7GA 2YA0A 2J8GA 2G3MA 2EAEA 3OBAA 4J3TA 4DUXA 3BC9A 4M56A 1SMAA 1TVPA 3EDFA 2D1ZA 3UG5A 4OOZA 1UKQA 3THCA 1JYNA 4PUDA 4P8UA 2F7QA 5DMYA 3CUIA 3WIJA 1VIWA 1GCYA 3VOCA 4OZOA 3J7HA 4TVUA 4CD6A 4LGXA 1W3JA 3BUDA 1V3MA 2CBUA 4URIA 4AZGA 5F7UA 3K46A 1CGXA 1UWUA 2XFRA 1CWYA 1HKKA 1W9DM 5CJ5A 1FFRA 1FH9A 4PCTA 4DM1A 1WDSA 4DUWA 1FOBA 3GXFA 3CUHA 3SCUA 4MB1A 3WN6A 4YN5A 3A6OA 1MXGA 4J3UA 1CXLA 5GQBA 3ZQ9A 4OBRA 1VEPA 5E0FA 1V6UA 4B3KA 5JBFA 1JFXA 4F79A 1HVQA 1UKPA 1KBKA 1WCGA 3CUFA 1D3CA 1XH1A 1E0XA 5GNXA 2A3HA 1QHPA 1AQMA 2VL4A 4GI6A 5A2BA 2VR4A 4MDOA 3M46A 4W5UA 1Q6DA 1BVNP 2JEPA 1CGTA 4H8UA 1R86A 3VNYA 1H11A 4HTYA 4CU7A 1H3GA 4DWSC 4WIWA 4TTGA 3TOPA 1PJ9A 1UH2A 1GHSA 2XM2A 3WH9A 3GXPA 1XSIA 1RD6A 5CLTA 1B30A 3AICA 4OGZA 4M82A 4RL3A 4J3SA 2DT0A 1CXFA 1JDCA 1E6ZA 1NWRA 2AAAA 3MUAA 4B15A 2UY2A 4HMEA 4ACZB 5JUVA 1VF8A 3MS8A 4E4PA 3U5UA 1UHVA 3U7BA 5FD0A 3BUQA 4W7VA 4MNLA 1JAEA 2CNCA 2DT1A 2ZE0A 3VDHA 1OBAA 1JI1A 1UD5A 4CU6A 3BCFA 1FP8A 3AXHA 1W1VA 3RDKA 2XSAA 1J0HA 1YQ2A 1V0LA 3FW6A 3SUSA 3WDJA 5CGTA 3LPPA 2X1IA 3AIUA 2OLHA 2JF6A 4P7QA 3BUPA 1WB0A 2O9OA 3WH6A 1IT0A 2BY2A 2DEPA 2EJ1A 2PB1A 4HPGA 3EMCA 3VIGA 5E1QA 3UERA 3SUVA 4AZHA 1DHKA 1JZ3A 1C91A 2DH2A 3UR8A 4MJ2A 1ODUA 3CPUA 4ATLA 3OA5A 2W4XA 4JCMA 1PX8A 3AI0A 2OYMA 1TFVA 1MVYA 1D2KA 2Y2WA 4MJ4A 4DWSD 1J0JA 5D8ZA 1M53A 3QOMA 3IK2A 3A4AA 2QMKA 3CZGA 2BY3A 2VRKA 5BCAA 4D1IA 5A8NA 4L4OA 3EYPA 2WBGA 4J7RA 4M24A 1MQQA 1LF1A 4BA0A 1M03A 2BHUA 2ZXQA 4HOXA 3WQWA 1V0NA 1US2A 4MB3A 2ZWYA 2FHBA 3SCQA 1KQYA 3WSUA 1JIBA 3CTTA 3SCNA 1JF5A 5A6LA 3ZSTA 1EIBA 2DPEA 3VX0A 2BY0A 3ZR6A 3NUKA 4WK9A 4ACZA 1HJUA 1C8QA 1J12A 4PMNA 5JIPA 1HP5A 3SCPA 4C7GA 2WC7A 1UH4A 3FAWA 4U2ZA 4P8XA 2ALWA 1NOUA 5ABGA 1GQIA 4PTVA 4ZFMA 2OWCA 3LMYA 3GNRA 3I3EA 1OCQA 7CGTA 4KH2A 3ZT7A 3N13A 4Z2JA 4CVWA 4CN1A 3HZ3A 3CV5A 1UD6A 2AMGA 4GZJA 1G5AA 5HXMA 1MXDA 2WCAA 1XD0A 2Y5EA 1QNRA 4U5KA 4OKDA 2YFOA 1E6NA 3CHEA 4AD5A 4MNMA 1QNSA 5D9OA 3WMBA 5DEZA 1TCMA 3FNDA 1EDTA 2D73A 4IPNB 1BHGA 1CXKA 3MMUA 3UCQA 1V03A 4AC1X 1E72M 2DIEA 3N12A 2CHNA 3O6AA 4KGJA 4UFIA 1AMYA 3K1DA 3WBEA 2XG9A 3IAPA 4CGTA 1BGAA 4U33A 3MO4A 1BYCA 3ARSA 2X2YA 3AS0A 2DSKA 4E8DA 2VMFA 1VJZA 1W9VA 2CXGA 4GZIA 1E71M 1QVBA 1CTNA 5CZKA 3EDKA 2B31A 1CXEA 3WNOA 1J9YA 2ZOXA 1UWSA 4ATDA 4UQDA 4WSJA 4AEFA 3ALFA 4PMUA 4X9YA 1IZKA 1TE1A 4YHEA 3VVGA 2VX5A 3T0BA 1UR4A 4FLQA 1Y7VA 2X2IA 3BMWA 5CXPA 4TOQA 1HIZA 3GH4A 3FAXA 3AMCA 1G9HA 1E0VA 2EPLX 1LWHA 4W5ZA 5CLWA 1W91A 4XZWA 3SCTA 1OD8A 3BXWA 2YDSA 4EANA 1J0ZA 3U57A 1OINA 5M17A 1E4NA 2J74A 1OM0A 4LQ1A 4J27A 3F4VA 3GH7A 1UWQA 1XC6A 4MAVA 4TX8A 8A3HA 1KFWA 1VENA 4JZ5A 4MPKA 3WUFA 5GPRA 3WEMA 3W82A 3WEOA 4OUEA 3UG3A 2ZUSA 3IANA 1J11A 3AS3A 4D6CA 2BXYA 2YJQA 3GXDA 4W8LA 3W37A 2PWGA 3CBWA 4A3HA 3LRLA 3BSHA 1E6QM 3KLLA 5GNZA 2WW5A 4S3KA 1W1YA 3RO8A 4HPHA 1GJUA 1L8NA 3CMGA 4P7RA 1OB0A 1EDGA 3GM8A 4AZ7A 3WY3A 3W29A 1G94A 4AYGA 4FF5A 2CBJA 2PI6A 2VR5A 1UZ1A 2G3IA 3UEQA 4L4PA 2G8ZA 1J18A 1OT1A 3CZJA 3SCVA 2X2HA 2PBOA 4LYRA 3AOFA 3WD2A 5JBEA 3CZKA 4XZBA 4ZXLA 2NSXA 3U7VA 3W26A 2WMFA 1UZ4A 2HVMA 4X0VA 1UR1A 4BF7A 1UA3A 2ZX7A 3L2MA 4CD5A 1HL9A 1AQHA 1L0PA 3IJ9A 1ESWA 3CO4A 4UZSA 1DWFM 1VJSA 2VZTA 1BSIA 4BQ2A 3TTSA 4D6GA 4F66A 3MUY1 4DUVA 4AWEA 2GJRA 4CVUA 3FY1A 3RMEA 1B0IA 5CPQA 4BS0A 1VEOA 2Y8KA 3SCSA 2EPMX 3WQ6A 2O92A 1ZJAA 2V5DA 1MW0A 2VJXA 4UR9A 1TMQA 1XV8A 2O9RA 3VIOA 1V08A 1GOWA 2WCSA 2A3BA 1E6XM 2QPUA 3CZ8A 2Y8VA 3VGEA 5C70A 1E4IA 3PTKA 2WCGA 2ZXBA 1XH2A 1BTCA 5BXRA 3NDZA 5IFPA 2WSKA 4NXKA 3WDIA 1H2JA 5BXTA 3M6DA 2WLYA 3PTQA 1XHGA 3ARPA 1JG9A 1VAHA 5IXEA 2CHOA 1E55A 2XFYA 2J47A 4CN4A 2WMGA 1WKYA 3WL0A 4B16A 2JFEX 5AYIA 1HJSA 1H5VA 3ARQA 1CXHA 1MQRA 3WL1A 3VIKA 3DX0A 2XVNA 4NRRA 2F8QA 2A3AA 3VGDA 2G4FA 1C7TA 3PZVA 1U33A 3DC0A 5A8QA 1E56A 3W25A 4FLRA 3PZTA 4J3WA 3MUZ1 3HMCA 2PWDA 2E3ZA 4P8VA 4PMXA 1B1YA 1QX1A 3WD0A 1HL8A 1QPKA 3WQVA 3OIHA 1NWUA 1UR8A 2WVVA 2GSJA 3NSXA 4AMWA 3AYRA 2FGZA 3H55A 4PRWA 3SUUA 1OIFA 4Y7EA 3ZJ7A 3VIHA 2GDUA 5A6BD 1WDQA 1KR0A 2VQTA 3WNMA
chains in the Genus database with same CATH superfamily
1QFPA 3D52A 4D72A 1S7UA 2ZBTA 2IXUA 4QTHB 4OI9A 2WN2A 5E23A 1H15B 4N1HB 1XB3A 2DZVA 2Z8VC 1IR2A 4OB5L 1E3FA 4E9SA 3R7MA 4WHYG 1WZ1L 4ZQKA 4L4VA 4JD4A 3VCLA 3AG2B 3PZ9A 3APNA 3BKJH 1RZQA 1PYWB 3UXFA 3WFBH 3EGDA 2YAHA 1QXLA 1KIRB 2Z65C 4KWSA 4GJ1A 2IAMA 2VCCA 4FD0A 3BOVA 4XOAA 4ORGA 1W72B 1XIHA 1XL4A 3A23A 43CAB 1O1ZA 1OZMA 4FKHA 3ISYA 2VVSA 4C1NA 2QPFA 2CNZA 2ZAHA 4YXKH 1MREL 2BVQB 3BXNA 1HNGA 2NY2B 2EPNA 3JTSA 2M2DA 5C7HA 4JTHA 3F6IA 3I9IA 4I4WA 1JL8A 4J40A 5I1GL 1FPTH 3INUH 4N9DA 4ZMNA 1YYAA 3GO1H 2P8MA 3ARXA 4LRNH 2PYED 2F6KA 3U5YA 2ESVE 3BSGA 5TDNA 2D7TH 2VDQB 1XINA 3SO3B 3SPVB 4M7LL 1UOVA 4YXHH 4K71C 3T07A 1QNQA 3BMXA 4GIYA 1TNNA 4O4YL 2HT2C 4DP2X 4XZMX 4IK7A 5DQJA 4DEPC 1LP6A 4INFA 3GU9A 2XPKA 2G75A 4KUZH 1L6XA 5SWSD 2BC4A 3R6IA 4XAKE 2P49B 5J04A 5H1WA 5J0BA 5CEXA 3IGAB 5F9JB 2E4TA 4JDVB 2PETA 5FOOA 1JERA 4X7SH 3H2OA 4XZHA 5FW8A 3M0YA 2VLME 5DYFA 2J13A 2XTJC 1WAEA 3QQNA 2J9YA 1DVJA 4MOZA 3U9WA 1WBZA 2OJZH 3G5WA 4NUGL 3S97C 1JV2A 4U05A 4MRCA 2Z91B 3G22A 3NBNA 3TROA 4ZS7H 1MUMA 4GOAA 1KENL 5FDWA 5SWQA 3O2VH 1JZGA 4XOEA 1SFLA 1GOMA 2AVFA 2FFIA 4OD3H 2D22A 1QUNA 2OVLA 3X1BA 3N4FA 3RYMA 3BN9D 5F96H 4JO2L 2CBTA 3RK8A 2WXIA 4Q8VA 1TUPA 2V3DA 4IM8A 3POHA 3D09A 4POYA 1YECH 3DKLA 1AR1C 1ZA6A 5IBXC 2LQRA 4BXSV 2DQCL 4MLSA 3IDIA 2F1EA 4JHWH 1H19A 3MNWB 4H9ZA 4YPGB 1SXBA 4GG6E 3R1ZA 5D2LE 5J12B 3WQFA 3WENA 1EEXA 3HC2A 4WK4B 3M41A 4YHKL 4OGAC 2WVTA 2XN9E 5I74B 1MF2L 5B4MD 1UWEH 5H2BB 3D85A 5LCVA 1K3ZA 3W7NA 4E8CA 3DX1A 1TYGA 3PB2A 2EXOA 3LB0A 3IGKA 2WMPB 3C2OA 2WM1A 3NRFA 1SUJA 3EJZD 3QEQA 3UAJA 1OYAA 4Y2OA 2ITEA 1ZVSA 3MRJA 4EN3B 3LNGA 1Z5YD 3JWOH 4FJYA 4KBXA 3GRWA 5AVQB 2LU5A 4EF8A 2VLKA 4M29A 1M3UA 4UQCA 3ETSA 3RZCC 4TPRH 3EBAA 3CIAA 1LE5B 5FJJA 1DBKL 4L5ZA 4AEEA 2ITFA 1PZ3A 3ZR4A 1A2YA 2WMIA 4O0KA 4H40A 1JYWA 5CUSL 3N2JA 1UWIA 3L95A 2EVHA 3ARGB 4E5XB 3BPLB 1YQVL 5D7SH 1HKIA 8FABA 1XIEA 4D9LL 4KO9A 1CECA 2ZC8A 3NIYA 1P9MA 3OJDA 3NGBB 2O26U 5F3FA 5AVVB 2OMWA 4HIPA 4C59B 3AZSA 3FQNB 3ONCA 1CVSC 1SSGA 2XZ7A 4TV3A 2X1UA 3WLRA 4NNBA 2H26A 4FK9A 3CC5B 2FGWH 3GMOB 4DW2L 5HYEA 1ZCCA 3ME0A 3IRDA 5FHAH 3P11L 5KS9B 4US5A 3NQDA 3D0CA 5HPMB 2Z35B 1CFTA 1OCWH 2GJXA 3LB6D 1TZ9A 5BUAA 1GYWA 5A94A 4TUUA 4NNPH 4Y4KC 4PJ7A 1EC8A 2HISA 4DIXA 4A4AA 2ICWJ 1KTDB 4OV6F 2NY3D 5IJVA 4LO9A 3TYDA 4CNSA 2PC8A 3WO4B 2HKHH 1LWJA 3EH1A 4NQVA 2IGTA 1PG7H 4JDZB 1MUWA 2AEQH 3U2ZA 3ZUNC 3IDYB 2V5LA 1YYLH 2NWRA 5CBJA 5D6DC 4NFBA 2BIPA 3RUGF 5TBOA 4TKWA 4WV1C 3TXVA 1GKQA 1YPZA 5IFAL 1PGRB 3AXXA 2IG2H 2GBUA 3IU4L 5BXSA 1LL6A 1CN4A 3U4KA 1I45A 3CV2A 1F9CA 3D9AH 3BLPX 4RAVA 3NABH 3QXTA 3FCSA 3CHXA 5EOCJ 3MGOA 2V37A 4KU1A 1UBSA 1CLYL 4BCZA 1EQCA 1DIEA 5AL0A 1BXUA 1FH2A 3BPNB 3D50A 5B7ZA 4S3FA 4A8LA 5MHSE 3N1PC 4XZUB 2ZXWB 4MZYA 1OYCA 3FJ6A 4XMPH 3PR2A 1SF5A 2YPLB 1ZTXL 2VFEA 3JZUA 3QNXB 2TRYA 3KPLA 4CCEA 5BQDA 1WC7A 1CF8H 4NQUA 2FWSA 2C6QA 1U8QA 3D3VB 4NI6A 3CUPA 3EEGA 3MMEB 3CFKB 3TA3B 4I3SH 4I0PB 2O72A 5FYJE 4B5VA 2BNRE 4PL1A 1QAPA 1AACA 3FTVA 3FH7A 2CMRL 1XP3A 1FXQA 3MKGA 1NIEA 1O7DC 4MZ8A 3L7EB 4PB3A 3L16A 4OD1H 3PZQA 4RISL 3UYIA 1O0VA 4Y4FD 1RJPA 3QK0A 3QPZA 3HKFA 1H3PH 1U91B 2ZQ0A 5ADOH 3G1XA 4N0CC 5E0CA 4QLJA 1ZVNA 2L0DA 2VDML 4HTBA 4YDKL 1IGYB 3FQUA 3MOAL 4KWVA 2R1WA 3S46A 3GHSA 4JXCA 1B6UA 2FLBT 2QUUA 1MI5B 4Y7MA 1MELA 1OM3L 5AENA 3BJSA 2ZSWB 1BAWA 7ENLA 4WXYA 1UWYA 2WOYA 4BI7A 5GS0C 2HFFB 3NAVA 1RVKA 3VXSB 3G18A 1AZRA 2GC4C 1ZRQA 1ZU8A 2GL5A 1RHHA 1EZLA 4DN4H 1PWLA 4QRRD 4H04A 4C54A 4CN6A 3V9CA 3O4LA 4PWGA 3EHBB 2ICES 2J8FA 4FAMA 5IKCB 2VC2L 1BM3L 5EB8A 4UR8A 3WMQA 3UXAA 4M9PA 1FV1B 1DSYA 4AD4A 3E2SA 1EX0A 5A16B 1Z9MA 1ZMYA 4C5YA 4Q9QL 2AL2B 5AAPA 1Q6FA 2F68X 5AC5A 1G0YR 1TTQA 4WFFD 5IBTL 5AKSA 3O41B 2YBGA 2J9ZA 1TQXA 1FORH 2I57A 1LK3L 3SGJA 3ZVHB 1X7IA 3PGFH 3KWWB 1HFBA 4C1KA 4NHVA 4OLUL 3FCGA 5EV7A 3RPIB 3CFIC 3OR6B 1TTUA 1WAUA 1TTBA 1EPXA 5DT1L 4PRDB 3CYJA 1I82A 5TE4L 1MH5B 4O1AA 5I1DB 5D7KD 1T40A 4X9BA 5KEZA 1QPXA 3OM3B 1PCWA 3QCUL 1JHLL 5I8CB 1I7TB 4NRXB 5EZJB 2Y62A 1MIMH 2I07A 3BISA 2WHKA 4XD5A 1QBAA 2C4FU 4G6KH 3Q4DA 3QDME 2KH2B 5TFSH 5KUMA 1NIFA 3IXAA 5C07A 1E3ZA 3BDYH 2OQLA 1S7TA 4EKJA 3GO2A 2ADIB 1NPNA 3OWRA 1L6YA 2KAUC 1NAML 3T4CA 4LX4A 4QRPE 3WF3A 1FF5A 2QSQA 3DFOA 2N59A 2J88A 4PJIB 3W1PA 5FA3B 5LGYA 1V3JA 1IJ9A 2YLKA 1UIPA 4HUCA 3N11A 5I24A 4MKSA 3BPCA 4V2CB 4HZ1A 2VQ4A 3LN5A 4K3GA 1Q66A 4FI6A 4N8CL 3IVUA 3UWZA 1R34A 4BWTA 3H54A 4LSQL 4LLWB 4HKPA 1PY9A 4RGNC 1UXMA 5K69A 1P4LA 4X6BB 1C08B 1PF3A 4HT1H 2I9TA 5D4QA 3ABMB 5EIVA 5HMSA 4DKDC 2VDNL 2EKCA 2XFFA 1CLZH 2V5TA 3IETB 2HVJB 4EIZC 1TXKA 1F3WA 4TSBL 4B50A 2JKXA 3S8HA 2D9QB 5K1JA 3LKNB 1YTKA 5AW4B 1N5AA 4MQXC 3WNPA 2PU0A 4HJ1A 1VGAA 4Z0BH 3G5XB 3UBXI 4JEGB 3ULVF 2YRLA 3NQBA 1QMUA 2OOGA 4EXPX 5J6SA 5I1IL 5C0FB 1O5KA 5HPOA 4WTWA 1OTTD 5H94A 1CFMA 3N2TA 4N5ED 3MOQA 2J73A 2AJXL 2AXGA 1GKEA 4ZNEE 4KOCA 5LNGA 3ARDB 3GG0A 2VISB 3LS9A 4PR5A 4C1LA 2FGBA 1J5TA 5AOLA 2O6FA 1Q2RA 2VWEC 2WO4A 1FHNA 4WO4B 5IHHA 5DQPA 3MGAA 3E0GA 4QDPA 4JFOB 2GC7C 5DRNB 3EDEA 2WWOA 4N28A 1JXKA 5TQ0L 2ZJSL 3I6KA 4PB5A 2V2HA 4PP1D 3NIDF 1ULVA 3YPIA 2FNBA 4YFEA 2C3GA 1FGNL 1CGYA 5D1XC 2OR9L 5FOJA 5CBAB 2OMXB 4YC2C 3KYMB 1WE5A 3CQKA 4FG4A 2EDWA 3RY4A 4X3ZA 3FXIC 1TTGA 3UZEC 3M1ZA 2IALA 3PWJA 2PW1A 2PNDA 1V7MH 3MRKB 1R6VA 1TTAA 2GCYB 3LV3A 5IMLA 2WKOF 4NZ3A 3TP4A 1JGUL 2PZNA 5FF4A 4HK7A 1IEWA 4X7DC 5CMAA 3HE6B 4ODHL 1SLXA 4DGYH 4F91B 1K4HA 3AMLA 3RHWK 4KQ3L 4PLNC 4EZJA 1OHLA 1IGML 1TZIA 3M0IA 3GKWH 4C56D 1FLRL 1EYWA 1XDMA 5KN5B 5J13C 1A5KC 5ACZB 3IT8D 5HHOE 5F0JB 1NCDH 1A1MA 4RFNC 3N0AA 4DETA 5IZ7A 1VIWA 5D2YA 3G3DA 2CBUA 4AY8A 2Z1VA 2IO5A 4ZBCA 2Z4GA 1I2PA 1DQMH 3MKVA 1H51A 4IX2A 1BWMA 5IF0A 3PBYA 2G5BB 3N9SA 1I4NA 1BIHA 1H7OA 2QQKL 4FJZA 1Q1JL 3G0XA 1VEPA 2DPKA 2ENJA 2BSTA 4JFFE 4K3DH 5IEKA 1WEJL 2YK1H 1MCPL 3KAAA 3E2RA 1WFOA 4LUTA 25C8H 4XMWA 3T4AB 3RVWD 3VXPA 2R91A 4EPSA 1A5LC 2HVOA 2XM2A 4XUGA 5BRZE 4ZBJA 3SCMC 4P9HH 3D18B 1NC2B 3NZRA 5FLUA 2F2KA 1PHWA 4HNTA 1OFOA 4FQPA 3TN3A 4ZUWB 2H6OA 2QF7A 1T80A 4LLMA 5H35A 5D2TA 4DLFA 4OZGB 5EN2A 3U2SB 8RUCA 3TA4D 3E3HA 3LRSB 1URZA 2O9OA 3UTPD 3O6FA 3P9LA 3W2NA 2BY2A 1RBAA 3T6ZA 3MZGB 2D2GA 4JVWA 5DU7A 1EGVA 4RGMB 2IH1B 5C09B 4MJ2A 3K30A 3VH8A 4JCMA 3QFEA 3TBTA 1NBZA 4AH2A 4HF5H 1AJ2A 3WGVB 4D1IA 1A7RL 4AKOA 4L4OA 5E1IA 1LF1A 3JWNG 3CVHL 2K7QA 4BA0A 3NFNA 4I77H 4A7VA 3S5OA 2W0FB 5DS8B 2BRRL 1XUZA 3GTHA 1J05A 4PMNA 1BVLA 5FO9B 1MLBA 4PJ5B 1BLNA 3S1UA 3I02A 4W9TA 1PHQA 5KSUA 3KHDA 3AITA 4LVGA 5IHZA 4BH8B 4N90E 5EO9B 3BRFA 3GJFB 4U5KA 3TT3H 4YXLH 4YVUA 3RZCA 4BHYA 2FX8H 2XPGB 2A4EA 3W7CA 2EDFA 1CXKA 1XGRA 5D8JL 4CC4A 1E1CB 3W02A 4JN2B 2DSKA 3Q8BA 5FO7A 3RDTB 4FZEL 4S0TD 1F56A 1EWDA 4Y4HD 1MCSA 1UWSA 3GSXA 2X3AA 1Q72L 4XCCL 3UU0A 3VI3B 4JRWA 4WUUD 4XZ4A 5I5MA 1XQLA 1QTSA 2AQNA 2V30A 4LHQB 3SY5A 4IQDA 2DDQL 1G9HA 5KWYC 4C6OA 4K5MA 5DWUH 2CIIA 1O5PA 1SJMA 4W5ZA 1Z9NA 1OD8A 3SAZA 4K7FB 4J27A 1XEUA 2A1WL 3WKMH 2OBGA 3TNNB 3VXSD 1AGDB 3RA7H 1TPXB 3THQA 2BXYA 1I4FB 4ZFOL 1LT8A 3WJMA 4MLRA 4AL8C 4RZCB 3PUGA 2BOCB 5C0AB 1VFBA 3SE8L 3GHTA 3KLLA 5GNZA 1LJMA 1M42A 5GIRA 5C6TH 4L1XA 3ZWSA 1EWHA 3AQZA 2AKMA 4OIIH 1ETZB 1M6JA 1XQKA 1HZKA 2XBTA 2CBJA 3WKQA 4LF3A 2QCGA 4GRWF 3UEQA 4FS0A 4NPYB 3SCVA 5I19L 1E4XI 5DMKA 3UADA 3EFOB 1QSED 4BI6A 3AQYA 3KDMB 4E41A 1JOIA 4ZQPA 4WFGE 1FHGA 2JLLA 3KW7A 4AMAA 3HBGA 4RETB 3MUY1 1YEGH 5EU4B 1NBVH 2FR4A 2WB7A 2GJRA 5KVFL 4RIRA 1UWXK 3OAZH 3WBDA 4Y16D 4HN4A 2O1AA 3M0JA 3QJAA 2H2PC 4M8QA 3FVDA 4X6EB 2ICWA 3C2AH 1BQ5A 3QUYA 4XNYH 4QSFA 4O0QA 1FO0A 2FD6L 3EYSL 1OCZB 4GQGA 4M1GL 2V2DA 1PIIA 3ESUF 2OZ4L 3S8GB 2P8LB 3SBPA 2DQFA 5IB5A 3HC3L 3HC0A 1HJSA 3C2SA 2ZP0T 4QRQA 4GIOA 3H2EA 2B14A 3ZW3A 4AGLA 4ML9A 1A21A 1E27A 3PJUA 4UZGA 4JIRA 1B1YA 2YZ8A 1CU4L 4DYJA 3MCMA 4BKLA 5FYJU 1JV5B 3RGVC 4MY8A 2NY7L 1LUCB 1GZPB 4U49A 3R5EA 3L54A 5EMMA 3KOWA 2VRJA 2HT4C 4N2IA 2BO0A 4NIKB 2G2PA 4KPHL 2GJPA 3IRCA 1F11B 1M71A 1CZ8L 1MZHA 3K2IA 5KZ6A 2OW6A 1WOBA 3G3MA 3IWPA 3NIFE 3ALPA 2PYFA 4ZSTA 4KS0A 3QJVB 4O1EA 4BSWB 2NY0B 3OGVA 5K9KB 3PM6A 3REVA 2EUXA 5C0BA 4R96B 5LCVH 1I9CB 3T4YA 3RGTA 5FM5M 1MMFA 1J0KA 1RP9A 4XOBA 3CDZB 3RPKA 4BFKA 3EGSB 2PDJA 3L9BA 2BWIA 3CU2A 4FNQA 2WKLA 3PF3A 4LAKA 4LP5A 3SE9L 4NJAL 3UY8A 5I1JH 4FERA 1MWAL 1UWAA 4NYLB 3VFNB 3RCNA 1EDQA 3DTUB 3L9RB 1AS7A 1TWWA 1E9IA 1XXFC 3EJRA 3M64A 1YMMD 4PFMA 4BE6A 4OLXH 5C2CA 1JNNL 3FO1A 3S2NA 1QRND 3CH8A 1MCDA 2JIXA 4TSCH 4EAYA 3ECWA 4WGWB 4V27A 3VH8G 4KQ0A 4MZ1A 3VMNA 1G9EA 1LJYA 3OHXC 2IAAC 2X3BA 4BELD 3F6LA 4J4PA 4X8JB 3L65A 3PS7A 3NJLA 5DJXA 3OIXA 4L1SA 3QHOA 4PB0L 3FA5A 4H0IA 5HHME 1NFBA 4TRPL 4FFVD 2AQQA 3CHDA 3G6AA 5I3GA 4Z76A 4KKCC 3AREB 3ABRA 3ABKB 5BNXD 4JK0D 3ABGA 4JTKA 3MI2A 3H23A 3IUDA 4DTGH 1YE6A 3TQKA 1XXDC 5EO1B 4HU2A 4ENEC 1QFWI 1E50A 3SR7A 4PWHA 2WNKA 1XLAA 5LBVA 1L9TA 4NJJA 5F2IA 5ICYA 3LHWA 4FTVA 4QAMB 2E47A 1XX9C 4MPQA 3BQUD 1PDYA 1H60A 4HU0A 5BWAA 4NOFA 4OIAA 2EACA 2F15A 1GEQA 4A21A 3VFMA 3NVQA 5TH2A 3LZ3A 2OLDA 5GRVL 1YEEH 1LOLA 4UM9D 4HZLB 2NZ9C 1IFGA 2P5WE 4OF8A 1KEML 5CSZA 1YSOA 5EFIA 4M7JH 4GSDH 4X9HA 3O2DL 1A80A 3MLWH 2K6ZA 4QIUA 4OUUA 5DJ8A 3W3BA 1TF4A 4QTIL 2WVUA 2YAPA 4OLVH 3ZHDA 1VHNA 1SQMA 4HMCA 1WD8A 1KCRL 1CQKA 1RH9A 4AT6A 2WHVA 3DJTA 1XJBA 3TFKD 2GJ6B 4F3HA 4N86A 4KJPC 1HKMA 3NVTA 2B7NA 3IKCA 3H4XA 1JPKA 3LKPB 2NQ3A 3ILEA 2EABA 4HZ7A 1OP3K 3KCOA 1J10A 4QKTA 1BVNT 3ATDA 3U0WL 4JY8A 4XTIA 2A4AA 3O8XB 3TCTA 3D5OF 3QQ3B 3FOLA 3ESOA 2D7PA 3MLXL 3PFUA 1ITBB 1MCWW 4P46B 5KS9F 3MCKA 4AZUA 3ZDYB 2GIMA 1X4ZA 2X44D 4WNQB 1PLAA 3ZZQA 3PZOA 1H9VA 4I6VA 4UILL 4W4OA 3ZR5A 1O1HA 3M1OA 4YO0A 4QAWA 1ORQB 1NEZA 2PKDA 3JZ7A 3LNDA 4IT1A 5GS2H 4AYMC 2W27A 4U6VL 2OI9B 3A4XA 4RZ6A 1C93A 4OBTA 4NRZA 3LN3A 3MHFA 3EFFB 2YRZA 4NWUH 6FABL 1GYMA 2XRAL 4GQPH 3BUBA 4EPKA 1NC2D 1RY0A 5GGVH 4W7UA 4YAQB 4QTGA 2FQDA 4Z2GA 1I8AA 3LNIA 4MBOA 3DDMA 1E3XA 3B2VL 5F4SA 4KDTC 1WPCA 3EO1B 1FA4A 3T0AA 3G1SA 1BZEA 3IXTA 1HNFA 2ZIDA 3D7PA 3IV8A 3QJHB 1IGJB 3NN8B 4Y2DB 5K3VA 5GGSB 4PTMA 4MY9A 5H4ZA 4A2GA 1P9MC 5L4IA 3RIFK 3VXUA 1QR7A 4KOBA 3SYCA 1D5RA 2FBRA 1WZLA 3T7VA 3S6CA 3ILQC 2JKJA 4Z2IA 4HEMA 2FYVA 3ZU8A 4ZSOE 4M1RA 2GQ8A 5D1ZB 1XSOA 2J71A 5D70L 3GSQA 3DX3A 5EIIB 4W8BA 1KZQA 3UYRH 5E2WH 5FUOH 3MTWA 5IOPA 3N3MA 3AMGA 3NEXA 5J3HC 3L13A 4AMKL 1OAKL 2X9WA 4MD5B 1JK8A 4ANUA 2Y7GA 4PBGA 4ELMB 2W80C 3MUJA 4JPQA 2L5HA 1NP2A 4F0MA 3KE0A 2N56A 1KTLB 2XXMB 3H7LA 2HCVA 3SKJH 3SM0A 3EFDL 3LNEA 2WWDA 4KPLA 1JGEA 5CU9A 1NDYA 4IRSB 1VZHA 3GPEA 4P2RD 3TF7C 3N85L 5DO2C 4GK8A 1R3KA 1TX0A 4Y8EA 3O05A 4WJ8A 3VG9B 3OPUA 5C9JA 1H63A 3UZZA 1Q9WA 3AJXA 4E2OA 3EGXB 5BV7C 4LAMA 4OZFB 1MNSA 2PR4H 2PR9A 2PWEA 3N6YA 1RJLB 1AO7B 1ZDSA 4JNMA 3PBUA 1G7MA 1TVDA 4R3UA 3ITXA 2EKSA 2JGQA 1SJEB 1R9YA 4IRJB 3C5QA 3ZZSA 3LCGA 4UTIA 1ZLPA 4JQ1A 3L4XA 3OSVA 1NH6A 4ANVA 1EFXA 4F15B 2J1ZA 4LIQH 4DNMA 3JV6B 2FX7L 2AV7B 3STCA 2ATPA 1PY0A 2DI9A 1NJ9B 5F7WC 2FJGA 4YCOA 4UTLA 3MRNB 2DQIL 5DJZB 3MCYA 1IKFH 2QDDA 3VNMA 4GXUM 4LY4A 4PM1A 1NFDA 5MEQA 3H7BB 5JQ6H 4QI3A 4NQ1A 4KKPA 4K5PA 2CLPA 1Q38A 3KR3H 1ICSA 3JZYA 3RL2A 3JWNH 4YBQD 4IDJL 1GT8A 4JRYB 3MMWA 3FSAA 2GFBB 3INPA 5ISZD 1IT9L 1EZWA 1V7NH 1BECA 2LTQC 4CDGC 4WI9A 3C5ZB 3AAZA 2CM6A 2WPGA 1QI5A 1UQSB 4LSBA 1I7RA 1EEZA 1D5BB 6TAAA 1KGXA 1JRHH 1A3XA 3BH8A 3U1PA 4JB9H 3TIEB 4A2DA 1UBPC 2WLLB 3AB0B 1NDVA 3QORB 4ZFFB 4ZPTB 3APGA 3AY4C 4Q4KA 4JFVA 2YGYA 3BD5A 2ZCKL 3QNZB 2DTSA 3BZEA 5AZ2L 4KK5C 3LSCA 2X0VA 2YEQA 4X6DA 4EACA 2BOLA 5ENLA 1TENA 2CCWA 2DJSA 2OXNA 4A6YB 3I6LD 3NTCH 4JN7A 3T2OA 4TX9A 2XVKA 1JCJA 3BAXA 1TPDA 1A6TA 1CDGA 2DSUA 2Y1VA 3TWCH 1I2OA 4HKZB 5D96C 3TTQA 5BJTB 4GBXB 4IOFC 1KPRB 1JZ2A 1XBDA 5IP4A 1DQJB 3QEHB 4PJIF 4DVOA 5AYZA 2WK2A 4PI0A 3HVDA 3PWPB 1NCJA 4LSSL 2J2ZB 5D9MA 3EKGA 1HKJA 1NANI 5DRIA 4Q0XH 4HJWA 3HJEA 1RA5A 2AXFB 4N8PA 2NX5B 3QJTB 4W4NA 2FDBP 4KROD 3Q1EA 3MBDA 4D0DA 4QCFA 1ZPLA 4JX5A 3DFPA 2EC9T 3CL8A 3U4EA 3SGJC 2ZONA 1UXLA 1HJWA 1BOGB 2CK0H 3UPWA 2EDOA 4NNYA 3W7EA 1BJ1H 4AIXA 2UYLB 3MTRA 2EVGA 3KLHC 3ZZLA 5E6ZA 5BPPA 1U8HB 2E9GA 1IAOB 3RITA 1OYBA 1J86A 2WQPA 3T4WA 2GY7B 3E8VA 4JE0A 4AVKA 2Z9TA 2Q71A 1BD2D 3P3YA 4I5XA 3ZLFA 1D5XB 5HHQB 1L9NA 1TLKA 4EVNB 4KGLA 4MJIA 3MJ6A 2R2BB 4JFDB 3R0NA 3BEWB 1M7OA 1WICA 2DWSA 3MRDA 1HHIA 3VFLA 4OCWL 5EOQL 1IZJA 3G6DH 3EJCA 3Q2LA 4XMKH 1RUQH 3TZNA 2CDFB 4X99A 3TJLA 4M81A 6REQA 3G1RA 4HHGA 2PP7A 5DQ9B 5E9AA 2TSBA 2FZ9A 2KLSA 3AU1A 1XVSA 3L66A 1A50A 3E2QA 4WI3A 2HNEA 3CZSA 2A6LA 3VQMA 2B0SH 1Q1PA 2Y5SA 1D6EB 1E5NA 1O60A 5EBLB 1UACL 5BOZG 4IGBD 5IR1B 3G6MA 4AVFA 3QFJE 4US6A 1QSVA 2FQFA 2NSOA 1DJWA 3VGGA 3CFBB 2NY1B 1XB6A 3BVJA 3N14A 5KOMC 3AXMA 3NQEA 1V7YA 4U1HA 3I68A 3FDKA 1LD9B 1XBYA 2V5JA 4K1GA 3K2MC 3EO0B 3O2WL 4C65A 4GACA 4JG0H 3HBLA 1SYVA 3M0VA 4PW9A 4X6CB 3G5YB 3U6RA 5BZWA 2F7OA 3K2GA 1S7SB 3BKMH 3TPKA 1KM3A 3SRHA 1KV5A 1CL7L 2CLRB 4M3JA 3ES6B 3QGVA 3GTVA 4PW4A 2BNQE 2ZKHL 4PJGE 1KGIA 3GNOA 3CDCA 1IAIM 1IE4A 4Y9EA 3IJ8A 2BFGA 4I8DA 4ZX3A 3NFSL 3RGVA 2VKXA 4MF4A 2G5RA 4DESA 2VN5A 1I1CA 4YEFA 2Q8BL 5JYLA 3DYMA 4LP4A 4XO9A 1J8HB 4PYGA 4Y1AB 3BCDA 4K7PH 3ZL2A 5GHWL 4ZJ9A 5IT2H 1RERA 5FF0A 4O14A 3B8TA 4D9QD 1PDZA 3HMXH 4HQQL 4LLQB 3GNPA 4JNXA 3VW3H 1UC5A 3FSUA 2I5GA 4CCZA 5J9PA 2Q9OA 1B31A 1KBPA 5DJDB 4HH9B 5KSWA 1F86A 2P1FA 3MR9A 1DXIA 4PC8A 2H6RA 4HZ8A 4TNEA 2QS8A 2XQBL 4OCLC 5T3ZD 2DMBA 1IC5L 2EKGA 1AW5A 2P5EB 2E5CA 2ACQA 3MV8A 2OL3L 4DM2A 5E09A 1PKMA 1OY0A 1Z0NA 5C0CE 1QFHA 2UZIH 1RCQA 3EWZA 4H8QA 1Q13A 1TEFA 3T1FB 4MQSB 4CQDA 3HHSA 4FNLH 2YUZA 2C3VB 1EXUB 1I0DA 5JH1A 1A1OA 1VCVA 4AZGA 1WBXB 1UWUA 1G7HB 3UTSB 5L6YL 4GS7C 3TVMC 1FFRA 4LPUA 2BLFA 1A25A 3OHXA 4ALAL 4GW4A 3IGHX 1A0QL 1V93A 4XC1L 1AL8A 4O1BA 4Y19D 1MHCB 2VXNA 3S2AA 2HG5B 4OZGF 2PLCA 5K39B 2Z7YA 3QUZB 3MBEB 5HNRA 1UKPA 2VMJA 3GMNB 3VJ6B 5IBLC 3FQXA 4HZMA 2X4NA 4AYDC 3UXDA 4GI6A 5E5MA 1R0AH 2PF6A 2ISSA 3BIKA 1Q6DA 3QCTL 2P8CA 3NJNA 5LNEA 2J21A 2Q3RA 2FB4H 5I1AA 4U3SB 1M1XB 2OCCB 1CXFA 4WK0B 2FEEL 2CO1A 2WWMC 1KEGL 2EUWA 2H5UA 2CKNA 3ULVD 3ZE2B 3VOIA 1E4WH 4B9FA 1PO9A 4BKTC 3OVPA 4TXVB 2FK9A 2E28A 4JO3H 5FFGA 5GGTA 4N7QA 4KFMA 1PAZA 1XR8A 5IHUL 2VXSH 1BYOA 2C7UB 1CD9B 1KB5L 3WMPA 5H91A 1WBYB 1ZHLB 1WB0A 1FFPB 4RW5A 4ADSA 1TPVA 2ZWSA 3NSCA 4TOYH 1B0GA 3UXLA 3SDCD 2GITA 4R6UA 3RAOA 3CPUA 4ATLA 1J5CA 5C0RL 3HPLB 1W5MA 2JB5L 3H9SD 4FZ8L 2WUBL 5IV2A 3CHQA 5T33L 2HN7A 4PP2A 3MJ9L 3MHZA 3CZGA 4PJ9B 3P0GB 4JZJB 3EZ8A 3C2VA 3SDXE 7ODCA 4JE4B 1ASQA 5LGJA 2YSWA 5AG9A 3NAAL 3O6FC 1THAA 3HGOA 3VI3F 3FAWA 3DN5A 3LKOA 1U8IB 1HSAA 5KW9H 4DJDA 2OWCA 1U8CB 2VDIA 3C0LA 4GKSB 5ESAB 4X8XA 2OR7A 5F3BA 4ZFZA 2NQ5A 2YCIX 4KNTA 2OKOA 4N87A 3STLA 5C6WH 3SB0A 1AZ1A 1FYTD 3M0HA 5KVGH 5A3ID 4FQXB 4YSEA 1R0MA 1XGUA 3RY5A 4KJYA 2WXLA 3VSQA 1XL9A 1C9SA 5GGSY 4NUJA 1H7RA 4Z1YA 2MPVA 4M5PA 1DANU 4X6FB 1MAKA 2AJ3A 3S5NA 2AK4E 1QUMA 4YHEA 3VVGA 4QDWA 3BWWA 3PY9A 4ABUA 3E1ZA 3T0BA 4KZEL 1C8PA 1HIZA 4HFWA 3FYOA 1LWHA 1OTUC 2EDHA 1TJ0A 5D7LB 4KDTA 3G1FA 1ZAIA 5EOCH 1HUVA 4CC4C 4BFFA 4IEFB 2JXMB 4HDIA 3EGJA 2W5PA 5AN7A 1EMTH 1UROA 2CJUH 3F4VA 1XMEB 3VWJA 1SR9A 4XN5A 3ARFB 4PTTB 3DPBA 4MNGB 2UZ9A 1IAIL 4OCXH 4I9XA 3PAJA 2BMBA 2Z7UA 1T1ZB 1F4XL 3SGZA 1CD1A 3B37A 1E6QM 3IEBA 4XNXL 2AV1A 1TQCC 2C9AA 4QGTA 3U9UB 1G7VA 4C6MA 5GS0H 4WRLA 2Q86A 2PXYC 1ET7A 4AQAA 4EXKA 2YQ2A 3GINA 2B20A 5JBEA 3I50L 4Q4IA 4X9IA 4KK8C 3QPEA 1U8PA 3Q45A 2VXUH 4HUVA 2DU2A 2QR0A 3HZYB 3EBGA 4YSQA 3U7VA 3L4CA 1JXDA 1A4JA 4YNYA 4C60A 3EJYD 3LKRA 3HRZB 4G8GA 2R59A 3QI9A 1L0PA 2BCKB 4UZSA 3S1GA 5ERWB 5HK4A 4D6GA 5DC2A 1KCSL 3S9YA 4JHBA 2DIKA 4G9FB 1X44A 2Y8KA 1XLBA 1HOEA 2APTA 1ZJAA 1KM0A 3S3PA 4QRAA 5JPNB 4HU4A 3ET9F 2WCSA 1FZJA 3MCG1 3PWPD 2Y7QB 5FKPA 3H3BC 3CZ8A 2YBVA 3RWEB 5D09A 1KFAL 3BP4A 5LQBL 5DI8A 4QHKI 3QG7H 5DJ0B 3MRPB 1FWSA 4P49A 4AZ8A 1E55A 1HI6A 2NXYD 5FS5A 1HHGB 1DIDA 3NZ8B 3V9FA 1H5VA 5JU6A 4ONFL 3WL1A 1P4BL 4GUQA 2F8QA 3PDDA 4AWTA 1C7TA 1XF0A 2OA9A 4ERIA 3HMCA 4NQDE 1E0UA 1JNHA 1T8QA 4XKYA 3F5WA 1WJ3A 4QRUA 2WVVA 3QUYC 3SUUA 5A6BD 4QT5A 2VQTA 3LCHA 3FK4A 3W53A 3QVQA 3CFQA 3V4UL 1OX6A 1T7XA 2YB1A 2VO5A 4B3VA 3P69A 1TJGH 2CLOA 1OT2A 3HI1B 3RX9A 1KCBA 4NT0A 1F6KA 4UT6A 3ARYA 2W9LA 4GFSA 3B56A 5G2NA 4Y5YB 2HG0A 2LR4A 3UJTL 2C1PA 2FJFA 4YVPA 1SOXA 3BG9A 4DZ5A 5C0EB 4N2NA 4JZNB 2V5YA 1WWCA 3WBWA 1VFTA 3RNKB 4H26B 1Q9KA 3GXNA 1P0SE 3E9UA 3IGLA 4EXBA 4LCSA 5IGXH 3OAUL 4XXDA 3F7VB 3EBIA 3NEOA 2DQJH 3HQOA 1RJZA 1SJXA 4TVPD 3PFMA 3U2OA 1IXPA 1ZLSL 3BG5A 1F6AA 1VPOL 3AY4A 1A7OL 5FCSH 1I3GL 2MRYA 1G4EA 5J1SC 2JTYA 3QAZC 5LG1A 3HUJA 3LIZH 5AL8A 2MIZA 4MZ2A 3KBNA 4YDIH 1R46A 3B6SA 3D4ZA 4J5NA 4DPCX 4G7RB 4IPPA 4MXWL 4EI5D 1VKXA 4CU8A 5K4ZA 3GSOA 7TAAA 5HYSB 4AOFA 2AI0H 5FB8A 1DLHA 2VAJA 4G9DA 5EZLB 1OGGA 4UTAA 3DDFA 1GGUA 3DUUB 1DWGM 3VFCA 5SX4H 3MX0B 5KAQG 2I16A 3URQA 4AGPA 2HVBA 2XA8L 5E2TL 3RIKA 3HJ0A 2C91A 3T1WA 2L7EA 1UM6H 2XZQH 2OQHA 1GTEA 4M6NH 3UP6A 5JIQA 1N64H 4J4PC 5HYJE 4PRHE 1EJUC 1FNSH 1ZK5A 2HLAB 5I0YA 1ZHBB 2QADD 2FZ8A 6CGTA 2RD0A 5LNWA 4NENA 4YTTA 3A6CH 4JFPA 4P2QB 4X0KB 3RX8A 3SQMA 3GBEA 4LSUH 4JFZH 2CLIA 3T0EA 4KTDH 5SWZB 1B2WH 5JMUA 4Y9AA 5KSBE 4O58H 5IB2A 3EF7A 3QHZL 2A3EA 4QXTB 3U83A 4EIVA 1SJHA 2NYZA 2AJUH 2IGLA 3CL6A 3O6CA 4WGVB 3LSBA 5GJTL 2QHLA 1R5IA 1R85A 4JY4B 4MVBC 3LQLA 2FDMA 3ZDYF 4PMYA 1MHPL 1VESA 4Z7VB 3KPMA 2ZG3A 1TTJA 2L4OA 4XPGL 3RM4A 3ZT5A 4FGMA 2GJZB 3OGOE 3GZQA 2V8MA 4FS9A 4GAYB 3S88H 3RM9A 3HQPA 4GPNA 5D1QC 1SFSA 35C8H 5L2KA 3PUOA 2ZX5A 1I7ZB 2I5YH 4WKFA 1JWSB 5CZJA 3CHCA 4JEQA 1KG0A 2GQ3A 4LANA 2GQHA 3IPFA 3LYEA 4H00A 3UJEA 3RPMA 2XG4A 1M68A 2XGBA 2BBFA 1QWNA 2XDHA 3GSWA 3OB0K 3U25A 5JUEH 3ABLB 3L1FA 2NY2D 4F8LA 1RQEA 3D51A 2WYZA 3FHQA 3WG7B 2J7CA 1FHVA 2V38A 2NUPB 2QFRA 1GVOA 4FO4A 3L0KA 1PFCA 4HHMA 1QBBA 4V1YA 3P62A 5IJDC 4LCUB 3ARTA 1QK2A 5KVDH 2Y6ZA 3SY1A 5DO8A 1W32A 4XNUH 3UFYA 1MSSA 3CNYA 3FUEA 1RZJH 2Q3OA 1J5DA 5CCZA 2HFTA 4U7MA 3MUGB 1A9EA 2VC9A 2BSSB 4Z3HA 1X1OA 3K7UA 1EEYB 3U9PL 2JK5A 3EUUA 1XPGA 1QLEH 1A6AA 4RE2A 4V11A 4MD0B 4X5XB 3VVWA 5HUPA 4W4OC 2A74B 5J6HA 4MJ6B 4AF0B 3NCFB 2QCCA 2YGVA 4ZOEA 3PS6A 1K2DB 1B0RA 3MRQB 5C2BH 1IGSA 2IKIA 3DA0A 2R0LH 3VIMA 4ELMF 2CETA 2Q3AA 1FWXA 2V5BA 5E2VL 2EAWA 1NGYA 1IQWH 5T1MB 1UA6L 1SZEA 2F2HA 5MEOA 5IW3A 5F3HA 1NCHA 4WHYH 3FT3B 1VBUA 2ZOLB 4U1NA 3AMKA 4N42A 4EIUA 3N0PB 1W1B1 3FRPB 3GGWB 3FH8A 3KGTA 3AAMA 1ECQA 3O3RA 4GUHA 4NZ5A 2VFIA 1JTTA 1XZ0B 5C9XA 1N59B 3LCIA 4M93B 4YHYC 1NLBH 3SGEH 2YS4A 3HB9A 1CLXA 5GRVK 1KYUA 1OF8A 1QR1B 5F7KC 2EZ0C 2QGBA 4AZIA 2FYYA 5G4MA 4WDWA 1KTRL 3ARWA 1C8YA 1RHFA 2ACRA 1FGVH 3W73A 3NFPA 5HYFA 4F1SA 3SGUA 5CR8A 3A22A 4WI8A 4LBUA 1J6OA 3ESPA 3LS5L 5CSSA 3CFJB 4I85A 3N9KA 4NN6C 4R5EA 4XWUA 3PL6B 1SW7A 2LV4A 2VDLB 5TPWL 5KYYB 2JCCE 1T1WB 4CBPA 1G1KA 2W88A 3OKDB 5LN4A 3TVMA 2W8CA 4S1QH 3CIWA 3QIBA 4EN3D 4DKAA 5EPMA 2MCMA 4G1EB 1F74A 1S7VA 4R4FL 3AVEA 1DSFL 1OSEA 4GXWA 1A1NA 3IJYB 1POJA 1NINA 1R47A 1X4YA 3J27A 4HCRA 4GKZA 3MRIA 2Y7NA 2JKSA 5I3FA 1OC5A 4WY7L 4XISA 2PDPA 4OAWA 2CUIA 3V4VA 4YHMH 3FU7A 3BT2H 1LVEA 3GJEA 5D5ME 3ARGD 1TKKA 2IBZY 4PLJD 3RDJA 3VRIB 5TQ2L 1MJ8H 4IL0A 3B2PA 4XPTL 2A21A 2HJKB 4XT1C 1UZGA 4ODUB 3WKNA 3QNFA 4NLAA 1PKOA 3VX1A 3IGUA 5A6IA 1P7TB 1MJUL 2J8UB 3KPOB 4LYKA 2DLIA 3FFSA 3TH4T 3JW7A 1E6JL 1I9IH 4WJG3 1R2TA 1KM4A 1RZJC 4AL8H 3JV0A 1DQXA 4PBVC 3BI9X 2G96A 5LAXA 4ADUA 4WVRA 1F5WA 4AYFA 4LKXA 1PLCA 4MHBA 1UWRA 3D0VA 2YGQA 3ZMEA 2XI9A 3UTTE 2VQ1B 3FMGL 2GTWA 4KO5A 1YEKH 4UV7H 1H8OA 3ARVA 3IFLL 2Y88A 2RGMA 2PRHA 3E7JA 2XX0A 3PJXA 3QSKB 2G3NA 2GI7A 1UZHA 4P9ML 1KRCC 3AQDA 3X2QB 1VA9A 4LVHB 4UWMA 4Q7DA 2FB2A 1ILUA 2IPUK 3VXQA 2FTYA 9XIAA 1PWMA 8XIAA 3LDBC 1TT6A 4GMSL 2CGRH 2VL5B 3LENA 1GPOL 2EE3A 2VDRB 4K2SA 4HPYL 2OTUB 2QGYA 4JM4H 1W3HA 4PY8I 7TIMA 1FE8L 3ABQA 3M1BA 3OZOA 4E4UA 1G9MC 3F4WA 1IM9B 3ASWA 4RSYA 3CC1A 5ESQA 2EDKA 3UC2A 4ACYA 1WFNA 4UAOB 1KACB 4PIBA 4Q7IA 1ITUA 3WBXA 5TK4A 3X13A 1VZGA 3C3UA 3O4OC 1BMWA 1T0MB 2IPTH 2YPLD 3MRFA 3H21A 3DROB 3NSMA 2VDOL 1XTMA 5FO8A 4H1LB 4JQVC 4GQQA 3W28A 3D3VD 1SF3A 3NK4A 5ILTL 2POTA 3IBOA 5AW5B 1GW1A 4AMXA 4MWAE 2H0FA 4F1ZA 1DP0A 2IMMA 4HC1H 3TA3D 5ES4B 4I0PD 4K4KA 1TB3A 1LP9E 3AWFA 1KFCA 3QQ4B 2X2JA 4AYBA 4X5WA 2EILB 4KEMA 2TRHA 4QYOA 3EH3B 4M5ZL 3U6WA 1DUZB 3QY6A 5IQ9A 3EXTA 3MRMA 2NLJA 2X6VA 1CDYA 1W9PA 3VMPA 5MI0B 3B0XA 3CN1A 4PGBA 2Y23A 3SD5A 2HWZL 3FYIB 1GW9A 3GI9H 2O9TA 1A4KB 3TVAA 2E68A 3DX9A 4EKXA 5LGHL 3THDA 5HJYA 4L4TB 3AIVA 3W39A 4LHUB 2PXYA 1R5VB 1A0DA 1MI5D 2N1KA 1NIDA 4YWGL 1UOLA 4X6CF 3QZPA 1S38A 1JFHA 1FDJA 3BPWA 3RWIB 5F88B 2WN3A 3P0VL 3U6XA 3VIFA 3U46A 5T3ZL 3U7YH 1NGXB 2KERA 5LGXA 1SO3A 3EHBD 1IVLA 4Q8PA 2Z4QA 1PJWA 1QA9B 1SJCA 3EPNA 3CNKA 4PRIA 1XRVA 4F58H 1JZDC 2OMZB 1A22B 2OMTB 4F9DA 1QKZL 1W0VB 2A9DA 1NL0H 1HDMB 1TVBA 1AIFA 2WXQA 3GM0A 2PLJA 3AIEA 2E5EA 1AQ8A 1HWWA 3HQNA 4I9WE 3BZJA 2G3XA 1BIIA 4G82A 3PN8A 3MA9H 2V2XA 9XIMA 3VOJA 3QR3A 3N5AA 3ZTNH 2X6CA 1JAKA 4CQ8A 3CB8A 4PUBL 5L0QB 1SXAA 5E9DA 1MHEB 2R1XA 1G4MA 4AENA 2Z0IA 4Z7WE 2RBLA 2M8XA 5I6MA 4ODWA 2GDVA 3MFFB 4ZUTB 5HJDA 1NKGA 2CIKA 1WUEA 4E0CA 2GAZA 5C08E 1ILSA 1QTYT 4Z08A 4XN2A 2NNAA 4XP9H 3NT0A 3RAJL 4CADB 1O6VA 2X1OA 3MLYH 5B38B 3T0WA 1XM3A 4W6YB 4M1BA 3IFNH 4XP1L 5CPMA 1S5WA 4FJ6A 3WEXA 4GZ7A 5I77A 3UR2A 3ULVL 5BMFL 1SPQA 1F5ZA 3VRJA 2ORBH 3E0VA 2XYCA 3GBDA 2GT9B 5TDOA 4YN3A 2NTFA 3Q05A 4NDMB 4QY8B 3UBXA 1P84J 1U5JA 3NPSB 4C6CA 3HAEB 4GRLC 2CZ5A 1LBLA 2IVFC 2PTTB 3B40A 4RE3A 5ETUA 4GX8A 2DKMA 4ZA0A 4UMCA 4ICXA 2J7GA 4KRZA 3B83A 5JW3H 1WA3A 4J3TA 4XNZC 4F7TA 3CX2A 3JBG7 3CIXA 4HBCH 1ID2A 1WV7T 3J7HA 3DOIA 1IM3B 3NJXA 4FFYL 4M8VA 3LV6A 3DH7A 4YU1A 1KC7A 3VD2A 4ORIA 5I1HH 3TYEA 3CDYA 1S9WB 2YAMA 1OSZB 2EYTB 2DICA 1D9KC 1V77A 3GTIA 3DSFH 3CFEA 3WIIH 3AG4B 2KBGA 3GS7A 1FNEB 2A83A 4LCWE 5E0FA 1PZAA 3IVTA 4OJDH 3CV6A 2C9UA 5DJCB 1QHPA 1AQMA 1SXCA 4W5UA 3RQ3A 1TNMA 3ARDD 3GRWH 2E59A 3BKYH 4DWSC 1KBGL 2DQGH 3VAVA 3ERPA 4RL3A 2DT0A 1JDCA 1EJWC 4J6IA 5AEAA 4WO4D 5T5FL 2UY2A 2P24B 3DPDA 2FIKA 3RNDA 1RZ7H 2MJWA 1MEXH 3C60A 1JAEA 2NQZA 1ZVHA 1QQDA 5LNDA 3FO0H 4M7KH 3UOAB 4ZT1A 2NZ1A 1NUGA 2UWEE 3HZMB 4WWKB 5JVLA 4QOKA 4O57A 2ESVA 4DO7A 4LVNB 3SOBL 2R2EA 1R3JA 1OZUA 3EX1A 2ARJQ 2GSGA 3E0IA 5L4FA 2WJZA 5FM5O 1ODUA 1TVLA 4OQTA 3P0YH 4NQCB 4WU5B 2QCFA 3P7YA 2YXMA 3BGGA 4L5FE 1DVYA 3RR4A 1HKFA 5EBUA 1ZHNA 1AI1H 2WOBA 4N4PA 2Y7LA 4AQ1B 1HL5A 4GIPD 1RZFL 5C9ZA 4UUJA 4J7RA 1C9DA 1M03A 3SHSA 2A9ML 1US2A 3TC6A 3DK0A 3FB8B 2DYPB 3HE6D 4PUWA 2J4WH 4RR4A 4QR6A 5D1QA 1PD1A 3R1GL 3STBA 3QMRA 1EA0A 1BZ9B 4LZKA 1XTLA 1URIA 1MDRA 3H9ZA 3ZT7A 3IPWA 3ULSB 3ME3A 4XO8A 3TBWB 3A3WA 3US9A 1BXAA 2XWJB 4LFHD 2E76C 4GW5B 1AC6A 3JSSA 1VFSA 5BV7H 5D9OA 2MCG1 2QCNA 2G97A 2HNHA 4RCXA 4CJ0A 1RZGB 3N1FC 3FUKA 1XKYA 3GBNH 3CAKA 3PPCA 3TBSA 1UB5B 4GG6A 4U1JA 1TKWA 4DJDC 3HN8A 4L61A 1R9ZA 4MWFB 1JGLL 4JLRB 1E9QA 3KPRB 1RZMA 4UYQA 2VEIA 2XV2A 1UR4A 1BXVA 2XN9A 1ZHAA 3TSDA 4H9XA 5D72L 3DKJA 3T8QA 1DVQA 4IGHA 4UT6H 4W1TA 4M51A 1OINA 4XMZA 1E4NA 3GS0A 2BIIA 1FL5B 1YVLA 4N9CA 5KBDA 2ED7A 1REQA 4GQBA 2PURA 2O5ZL 3MRGA 5CD3A 2C3WA 4P2YA 1OTSD 2JQAA 3WEMA 4AV0A 2WY3B 3GBLA 1UJTA 1R3TA 3L7FB 4Z7AA 4Q8BA 2OK0H 3CBWA 3UZVA 4JHMA 3NQ7A 1PZ5A 5AAMC 4S3KA 3NSFA 1DO6A 3W7DA 3KYAA 1MAMH 3K91A 4KWWA 5IK3A 3OGCB 1MFCL 4JJHA 4O8RA 1OT1A 3ALXA 3NDOA 3WD2A 4NB7A 2IPKA 3VWJC 4OFKA 2DL2A 4WSHA 3DZ1A 1PBYA 1YNYA 3D69A 5KSVA 3F12A 1FFNB 1HKLH 4N0FB 1ESWA 5C09D 1VJSA 5J1AB 4LNRB 5I75B 3EOOA 4CVUA 4TVPL 2R4SH 4BS0A 4ZAKA 5CAYB 3ROOA 4F8TA 3CQJA 5ITFA 2VJXA 2YMXH 4CDHA 3DVNA 3ZTDC 3UBXG 5L2JB 4B0MM 4M03A 3PQYB 3VGEA 4G43B 5FW6A 2M83A 4D3CH 2EKJA 3QRFM 4OKVA 3O45B 3JTBA 5IFPA 1UWGH 1JNJA 4NQEE 3W7RA 3QI9C 3H22A 4PJ5D 3Q9QA 4IHBA 4KK9D 1DLFL 3FUHA 4TUOB 3J8F7 3TH6A 3STZB 5L88L 3PWIA 3RBSA 2VZ3A 2PAJA 4HJ0C 5A8QA 4R90H 5EYWA 3I6GA 3NQMA 3WQVA 1IGTA 1T2QH 2Z25A 1U8LB 2C3XA 4ZD3H 4GO9A 3B9KB 3RDTD 1KTNA 4ODXA 2D0FA 1N8IA 3EJTA 3TZVA 3LSOB 4UCFA 4Q9RL 3WEZA 2QFPA 1T0PB 1H3WM 2WNQA 4FEIA 4RV8A 1A7PL 4KCTA 2QPEB 1M05B 1AQDA 3A4WA 3K74B 1V51A 3CX5K 2DDXA 4WI4A 5FGCE 3O11B 3HNSH 2HYMA 4JGUA 5I18H 5EH1A 3VXRE 4NOBA 3EDJA 2WYSA 2OSYA 4MNQE 5CEWA 1C5DA 1SUXA 2VURA 1O5QA 3HG4A 4EI6B 2C9VA 4A7UA 3FULA 5GGRB 1R3LA 3HA0A 5BXPA 3BW9A 1JNLL 3U8GA 5E8NB 5C0AD 3H3PH 4Z7NB 2MQCA 2H9GA 2J88H 3D2UB 4MQ7B 1UPPA 4H6EA 2BODX 2EDYA 1D7FA 3W9EA 7FABH 2BNRA 4IPIA 4HCLA 2K8MA 3T8XB 3HEIB 2OWXA 3ULUC 3HC4L 5AW1B 5DMGC 1TPB1 2W94A 3VGAB 3KZ8A 3SADA 1W72L 2QVIA 1LE9B 4Z3GA 2QVTA 3CLEH 2VXQA 3OKMB 5DDHA 3EWCA 4XAPA 2C9QA 2A6KB 4P5TB 5DEFB 3A9BA 4I7WA 4P3DA 2FJSA 3S1WA 1MZYA 5ADPH 3QA3B 4QDGA 3OKYA 4D6DA 3BESR 4Y6GA 4A6GA 2H2SD 2DBLL 4W93A 2P88A 5C8JA 2WNZA 2B1HH 5KYNA 1QW7A 1LYQA 2OT0A 2YJLA 2VDQL 4NP4H 3L3OC 4Z7VF 4LV9A 4F7CA 2ZXEB 3TKFA 4WEBL 3OV6A 4YE4H 1RJYB 2IPWA 3NCBB 3WQ5A 2OQYA 4R4BA 4JQVA 3R06A 2AXWA 1E70M 1EJVC 1ET8A 5B39A 1D7CA 3ITGA 4KEUA 2DH3A 2K8QA 3UA3A 5IB4B 2BVYA 2EH8H 4X98A 5FACA 3BCJA 1MNNA 4Y90A 4E3TA 1LDCA 4HS8L 1VHPA 1Q5MA 5JA9A 4GZEA 4RK8A 3HGRA 2UZXB 4M43L 1URLA 4Y5XB 1NOWA 1Q8MA 5CGYD 3WYRA 4JGDA 4GPVA 1WIOA 2VSDA 2VE6B 4XH2A 3HU7A 3H3KA 3T0EC 2OMVB 3NFUA 3FEQA 4L9LA 1X9UA 1YMHB 5JHDB 2DZEA 5ECVA 4FXGB 3EYVB 4DGIL 5I3JA 4NF7A 2CESA 5IQMA 4X4KA 4GP4B 1IM3D 5B3SB 4IMEA 5ECUA 4YBHA 1F76A 5L8LB 1FWBC 3VGBA 2NY0D 5TDPA 2PPCA 2BMKA 3PUCA 4N0UB 3LRGA 3CXHJ 2DSZA 1G87A 3TQVA 3QHFL 3PWAA 1F3JB 3QDMA 4KTEH 3PWVA 5FYLE 3DETC 3AFBA 4OZIE 1ICPA 4IJ3C 3DK2A 1JN6A 1HXJA 1OAQL 3LZ5A 1RVFH 4OSUL 2VLJB 4DBDA 4UU9A 4QHNA 1I1XA 3DGGA 2GVEA 4Y9NA 2H8PB 5I1LB 2NR6D 1I9JL 4Z6AT 4P3CH 1AUSL 2HRPL 1HINL 1F07A 4DAGL 3V4VH 5C2UB 4LCCB 3DYPA 4YHIB 2CERA 3FPXA 4A05A 1AKPA 3NCJL 3GPSA 5AW8B 1T5XA 4GUPB 3Q7JA 5FJOA 5KVMC 1IGIH 5C71A 3RO6A 3BJTA 1COBA 4D0CB 4KZDL 2FJKA 3RF9A 1PB0A 3ARED 2JV6A 5L7XL 3DVGA 3GVVA 5CJXA 3GSUB 4IPLA 4PWJA 4XN1A 3NJMA 3M0LA 3NDZE 1SJAA 1ANUA 3U0PB 1SY6A 1YZZA 3OZ9L 4KAQL 3D4CA 3PGCB 4N25A 2FO4B 4U1SB 1ZBVA 1B90A 1E90A 1TJIL 1HZYA 1UG6A 3I74A 4BD4A 4I5BA 2DP3A 4FMFA 1ZLWH 4EAMA 4GABA 3G1DA 2Q10A 3HCVA 1A3LL 5CN2A 3WQ4A 3KLDA 3W38A 5CEZH 3KHQA 4ZS6C 4Z7OE 4Z7UB 4PWFA 3TCEA 2XNAB 4XX1E 1F13A 4OF3A 3TTYA 2IMNA 2UWFA 4P5MB 2Y7FA 4JM2A 2PDCA 4ZNEA 4F7EA 2LU3A 3K8KA 2Y61A 3WD5L 5SWUA 1EUUA 3WNNA 3MKCA 2W81C 4P4KA 4LCYB 1TZGL 3ULAB 4J3OD 1PKQE 3SJVB 2ZYRA 4GRLA 3LZPA 1SRDA 3F2BA 2P8PB 3TA9A 4TX6A 2GJ6D 1AD4A 3EOTH 4HD5A 1LO3H 2A3CA 1QG3A 1QYGL 4EAEA 4U0RB 5HUOA 1U8OB 4HA0A 1WKFA 4MB4A 4I7VA 2ZUXA 1IFRA 2PWHA 5GJSH 1NBYB 4HWBL 4X9SA 4B5ZA 3KPNB 3QDJB 4JCWA 3O8XD 2YLLA 1S7RA 5F44A 2Q76A 4W9HC 2H6UA 1T2XA 4LLVB 1D9KA 2XKSA 4P46D 2J8UF 3EOAA 2PD5A 4ZMXA 1T2JA 1WZKA 1I7UA 2OJEA 4A7GA 3LEVH 3FUNA 1EHKB 3VMOA 2GGEA 3T1GA 3TWAA 3O9WB 3VXME 1GGTA 3MBWB 3U0TA 4HGMA 4K37A 5DBTA 3O3AB 2C3ZA 1DV7A 3WY4A 1ZXKA 4DWSA 3AU2A 4G7YL 3C12A 1K6WA 5K33A 3EOBA 5AB3A 5EF2A 3QIBC 4D7PA 4QHKJ 4CD4A 1C5CH 3IWUA 1KBJA 4AC7C 1RXLA 2X42A 1K6QL 1X1NA 4K68A