3W07A

Atomic resolution structure of orotidine 5'-monophosphate decarboxylase from methanothermobacter thermoautotrophicus bound with ump.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Atomic resolution structure of the orotidine 5'-monophosphate decarboxylase product complex combined with surface plasmon resonance analysis: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 83
structure length 215
sequence length 215
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2012-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w07A00
3MYPA 1FWSA 3O63A 5U7SA 2A85A 3CEUA 3IVTA 4HPXA 4E2BA 1OJXA 1H61A 2TRSA 2QCCA 4NJJA 3UZJA 3DI0A 1ZNNA 5ABTA 5KZMA 1XUZA 4P2VA 4IMDA 2X2GA 2BXVA 1XDLA 1B4EA 1PS9A 3TMLA 2WNQA 3T7VA 4A2SA 1DJQA 3GXPA 4NNAA 1N8FA 1U83A 4CCCA 3GK0A 2BZNA 2V81A 4MYAA 4Z08A 3VCRA 3N14A 4U4MA 1RVGA 1H7NA 3W74A 2Y7DA 1XXXA 4DPQA 1MEIA 1SSGA 1XKYA 4UTTC 4MY1A 3TR2A 3Q37A 2OJPA 2V82A 4LV9A 3OG3A 3MWAA 2QKFA 1RZMA 4WXYA 3T4CA 4TO8A 2Y88A 3KXQA 3CC1A 3PG8A 4E0CA 3OVPA 3W75A 4JY8A 1OF6A 3O07A 3WJWA 2ZBTA 2FTPA 4AWSA 3L66A 4PH6A 4NJGA 4N9BA 5CGQA 1K8ZA 5AOUA 1O4UA 5D2YA 2V30A 3Q94A 4IOTA 1H62A 1L2UA 3U2OA 4WUIA 1EWDA 3FIGA 1GJPA 3SR7A 3UNDA 4N2YA 4BF9A 1W1ZA 2QUTA 3W1MA 2B7QA 4GFSA 1V7YA 4OT7A 1I2PA 4RX0A 1TPB1 2OCZA 4Q32A 1TQXA 1JQXA 1FWNA 1EX5A 2NX3A 3Q2DA 3R8RA 5FF0A 3W22A 1X1ZA 5AHLA 2J9YA 4NJKA 3S5NA 2J27A 2ZZ6A 3L67A 1B9BA 4M6VA 5J5RA 3AO0A 4DO6A 5HUOA 2Q3OA 1DJNA 3C0JA 5AC7A 3CB8A 5G1TA 1L6SA 3O16A 5U4NA 2YXGA 4YCOA 1Q6RA 2FB2A 2OMAA 1YXDA 3W7RA 4CNOA 1OX4A 3PAJA 5F1UA 1VR6A 5I3JA 3TUUA 2YZRA 1TRIA 2V0TA 1QOQA 3HBLA 2A6LA 3NQAA 5DY2A 1SQ7A 5EYWA 4CQ8A 4Q33A 1R47A 2Y7EA 4Z1AA 1R30A 2DZSA 7TIMA 1SW3A 1OYAA 3GNNA 3BO9A 3UWYA 2ISSA 4O10A 3FJLA 5CPNA 5LGZA 5F2GA 4U28A 1TV8A 3QJAA 2WSQA 1QCWA 3CM4A 3KOFA 1Z42A 3G1YA 1NF0A 3P81A 3MYOA 4UFJA 1L6WA 4CNNA 2ZDRA 4ZMGA 2WSRA 1OFPA 1EIXA 3FA5A 3TJLA 1LRTA 1BWLA 4MFEA 2NWSA 5D2XA 2X16A 1GTHA 1QR7A 4A22A 3QC3A 3L0GA 1H7OA 5LNRA 3WJYA 5BMWA 2EGZA 3HPXA 5LNWA 4JXCA 3LDVA 5DXYA 1A5CA 3P7YA 1ZAJA 2X1SA 4EOUA 4YXGA 3O6CA 1SFJA 4JY9A 1W3IA 4O1DA 3ZS4A 2QJIA 3UD6A 4HHPA 3W7HA 1H7XA 3W83A 3TSBA 2F7FA 3G0XA 2A4AA 3MI6A 1SO6A 4WZHA 1LOLA 3W84A 1WAUA 4FF7A 3LHZA 4MUZA 3W7IA 4HKPA 4UTMA 2PC4A 1TJRA 1TYGA 3ANYA 1F6KA 1OFOA 2NZLA 1SO3A 2QCFA 4RKAA 2CLMA 2WNNA 1IXNA 4Y6GA 3B06A 3BG5A 3IIXA 5D38A 4LVBA 4ADSA 4IUOA 4JTIA 3TNOA 4UTUA 4FEZA 2B4GA 3M6YA 2CLHA 3L5AA 4O12A 5I3FA 1LDCA 5BOOA 4LRTA 1UJPA 1WOAA 1YXYA 3ZWTA 1M6JA 1B4KA 2GQ8A 4JX4A 5AC6A 3W3OA 1TPH1 2YYUA 2VEPA 4MOZA 3SW6A 3I7QA 4GJ1A 3TIMA 3WK0A 2YCEA 1P0NA 3RK8A 4JEQA 5C5YA 3O6YX 5CZ0A 1ICPA 2VXNA 4FXRA 3W1PA 2CLFA 5BW6A 5D04C 2QF7A 4DELA 2ZRZA 2NLIA 3GR8A 4JYFA 4K6AA 1GOXA 4XTDA 3IIZA 4GUFA 1R46A 2R8WA 4AEOA 4WOQA 3BK0A 4RLIA 3FEMA 1L6YA 3BG9A 1I4NA 3OEXA 1JUBA 2C6QA 3W73A 2DZUA 1Z41A 4O57A 5E0KA 3NAVA 3QF0A 4KKXA 3LHYA 2WV8A 3UY7A 5AYXA 5KZEA 1Y0EA 4X2RA 3HMJG 3K30A 1JVNA 3S1WA 3PBUA 1OABA 3P82A 1F6PA 1SO5A 4O17A 1FDZA 2X1UA 4GUJA 3DKJA 4DF0A 2XN1A 2Y62A 1O94A 3NL2A 4RZ4A 4M6PA 4K39A 1W0MA 1AK5A 3HPZA 4D2JA 3GAYA 1TPVA 3O6DA 1PCKA 2NV2A 3EX2A 4FX7A 3UY8A 2E77A 2ZRWA 2E5BA 3TU9A 4O15A 1UB3A 1WOBA 1NFBA 3G1XA 3C61A 1DORA 3P80A 4LT9A 3LERA 2JKPA 1LRNA 1G7VA 3VE7A 4JGDA 4NU7A 3NYZA 1W31A 3PC0A 3Q58A 3G1HA 4B5NA 1VC4A 3KRZA 1EP2A 4M19A 2E1DA 5EPDA 1FCBA 2A0NA 4MZYA 4LVFA 1Z44A 2ISVA 1O95A 1RQBA 2QAFA 1KBJA 2C13A 4QAIA 5BRBA 5F4XA 2V2CA 4Q4KA 5FF3A 3B0VC 1G4TA 1HFBA 2HSAA 3WK1A 3GDLA 5I3GA 1UUOA 2TMDA 2ZQ0A 3W7OA 3M9YA 2VEMA 2ZRXA 2E09A 3G24A 1HUVA 3EKLA 5K9XA 3R12A 1WA3A 1G7UA 4ZQPA 3VI2A 2A7RA 3P62A 5DBTA 3DFTA 4QSHA 2HS6A 3UYCA 3F1QA 1T0OA 3QSRA 3U8GA 1W3TA 5HQEA 3TMQA 1AW1A 4AF0A 2NX9A 4QNWA 5EBUA 3N73A 2PRLA 2DZPA 3W7PA 3A23A 2YFNA 2WPBA 3W9ZA 2XN2A 2ZZ1A 3ATYA 2J9XA 4E2DA 1XC4A 4O52A 1XBYA 1BEUA 2ZFAA 1QMLA 4QQ3A 4W9TA 3M5YA 2Z0IA 2VENA 4Y9AA 2ZTJA 3W87A 4Y96A 3MJYA 1LOQA 2EKCA 2CWNA 5HNRA 5K7JA 4JN6A 2A5HA 2ZA1A 3R13A 4GXMA 1YDVA 4CQ9A 4IPJA 4O1BA 1OK6A 2ZZ7A 3IGSA 3NQCA 2RFGA 1VGAA 3M5ZA 2R14A 3T55A 3E0IA 4I7UA 2QCLA 1VRDA 1WXJA 3SZ8A 2A7PA 3LRKA 4DPPA 2GQ9A 3H53A 4AH7A 1H1ZA 1OYCA 3M5VA 2RKXA 3C2OA 4Z1CA 2NWRA 4LWWA 2P0OA 1I2QA 2CU0A 2XN0A 5CSSA 2OT1A 3B4UA 3NPVA 5HINA 4JTUA 5H2ZA 1G4EA 1RR2A 1O5KA 3CWNA 3E96A 2B7OA 5CPLA 2ZZ5A 1GG0A 5F4WA 1Q6QA 1PIIA 1YTDA 1ZENA 3OVRA 5K9CA 1ZJIA 3W7MA 1A5SA 4LUJA 2HTMA 2W0UA 4NX0A 2C16A 1O60A 1GPWA 3SGUA 3E12A 1JCYA 3UWVA 3LX9A 1A5BA 2JBMA 1GVRA 3LV5A 3NQ8A 1JCMP 2DZWA 3SSJA 3W7LA 1OHLA 3FFSA 3P74A 5AC8A 3P61A 2J24A 1K3UA 1DQXA 1LLWA 5A8GA 4YCPA 1P4CA 3NL3A 3NDOA 1WYIA 3O8AA 1TB3A 2H8ZA 5CPMA 4L4MA 4UTKA 3B0PA 4LS2A 4Z0JA 1X6UA 3UXDA 3AJXA 3R2GA 1VYSX 5LNSA 3A5FA 3OA3A 1MSSA 5CZTA 2NV1A 1EUNA 5D03A 4HPJA 5DLCA 4JD4A 3L0NA 1V5XA 4MIMA 1H63A 4WX2A 2Z6JA 3DFQA 1KW1A 2G95A 3T44A 4O28A 1F2JA 3IIPA 4XUGA 4MYXA 3G0SA 3PBVA 4IMCA 2YYTA 4FNSA 4MY8A 4AF0B 3VFLA 3B8DA 1IIGA 1KM6A 1RV8A 3DU0A 2G5WA 3W7QA 3L9CA 1EP1A 2YGYA 3W70A 1LBMA 3PSVA 4EIVA 4IMFA 5LNVA 4DO4A 4A29A 2DORA 2OX1A 3PB2A 4UFIA 4NXKA 1TRDA 1XBZA 3HG4A 4TU1A 2BWGA 3IV3A 3IGUA 3C52A 2A6NA 2PRMA 3LBMA 2A7NA 3KX6A 4UXDA 3LI1A 1LP6A 5D33A 2QCMA 4UUIA 4NUWA 1TCDA 5EL1A 3TROA 3EXTA 4XBSA 4JS3A 4M6QA 3TXZA 1TTIA 3CEPA 5AHFA 2Y6ZA 2FDSA 1WBJA 4ZQMA 3TFXA 4IXHA 3W1XA 3W7JA 3MP5A 3EX3A 4ZZ9A 1QFEA 1A53A 8TIMA 4MPQA 1F74A 2C14A 4IMEA 3W2LA 1JCLA 5AHNA 2TSYA 3M1ZA 1NF7A 4AHPA 3M0ZA 4WD0A 2VFEA 3G3MA 3LHWA 3QSTA 4NX5A 3T78A 3IEBA 1AW2A 3HG3A 5AYYA 1HG3A 2YPIA 3MUXA 4R7JA 4QJ1A 4KWWA 3ABOA 4AAJA 4DF2A 2Y63A 4LVGA 5G1YA 3DBPA 4A2RA 2ZRUA 3DKLA 1H1YA 4HNUA 3LI0A 3B04A 3G1DA 2PURA 3PUEA 3MP3A 4OBTA 5EA9A 3M7WA 3GDRA 2FJKA 1SU5A 5LSMA 5G2WA 2CFFA 1QPOA 3S0CA 3LCWA 1GYNA 3DHDA 2GOUA 2W79A 1DBTA 4UTTA 5BNKA 1FDYA 3M5XA 4RCXA 4GUHA 4DBEA 4UFMA 3TSMA 5AHMA 2DJXA 2V2DA 1OF8A 3U6WA 4OGZA 2O7QA 2J6XA 4FXSA 3FS2A 5F2IA 2VEIA 4LC6A 5KTLA 3LCGA 3LLDA 1OFBA 5DXXA 3NQMA 5CSRA 3NZRA 5KSWA 2E6FA 2FIQA 3W85A 1FWWA 3QW3A 5K3VA 1I2NA 2Z1BA 1Q6OA 3EXRA 2C1HA 2P1FA 2XFWA 4P61A 3BLIA 4UIOA 5I3HA 1W8SA 1W3NA 4JDYA 4JX5A 5C55A 3B03A 3G1VA 1XFBA 3O05A 1BTMA 1TO3A 2E5DA 3NQDA 4Z1BA 3W76A 1QO2A 4UMAA 5FF2A 2Y61A 1IF2A 1GTEA 4UFHA 4O14A 1HO4A 1EP3A 1S5TA 1VZWA 1R2RA 3PS7A 1BWKA 1QDSA 2ABAA 1K03A 1KFCA 3UQNA 1ZAHA 3W1NA 1EA0A 3LB0A 1CI1A 2V5LA 1J5TA 5KZDA 1WV2A 1S5WA 3LCLA 3H55A 2WQPA 1YPIA 3S8HA 1I8JA 3W2UA 1RQHA 1PVNA 4DQWA 3EWZA 4OHQA 4K7YA 3IIVA 1FBAA 4IPIA 1SZFA 3W1QA 1H51A 3NQ2A 3P8IA 4I7VA 3TW6A 2QUVA 1H5YA 3YPIA 3W7NA 1QWGA 4JYEA 4GUGA 3QPZA 4WXZA 2Y85A 3TAOA 3RU6A 3EWWA 3NZ1A 2AQWA 2JKEA 1C8VA 3IIOA 2QUUA 1BKSA 3TCEA 4AB4A 2IQTA 1H7PA 3LHTA 3F4NA 3RF9A 1C9DA 4CNPA 1SZEA 3RFAA 1QO5A 3LTYA 5G4WA 5HR7A 4UTJA 4UR7A 1JJKA 4NNBA 4JTFA 1GVQA 1YTEA 3OIXA 1YYAA 1SZGA 5D05A 1PV8A 3DFPA 3NQ7A 1IIHA 4O19A 3WFAA 3PG9A 5D2VA 3HGOA 3RMJA 3C2RA 3OHIA 1TPEA 1QPRA 3S1VA 4FIRA 1KFEA 2G97A 5G2IA 4ZQRA 3W2NA 3LCHA 3TFCA 5G2HA 2ALDA 3C2EA 4TX9A 4O1AA 2A2IA 2GJNA 1LZOA 3STFA 4K7VA 3DFSA 4ADTA 1AL8A 3W2MA 4BR1A 3LCFA 3CU2A 2X1RA 1ALDA 2ATSA 4OV9A 1DL3A 1B57A 1J4EA 1OX5A 2DU2A 3EWXA 3MHGA 4NZJA 3LGEA 4M7SA 3E49A 3VKJA 5HULA 3JRKA 3FJ6A 3GR7A 5D2WA 2H8XA 5FEXA 2C3ZA 5DY3A 4X22A 4M7TA 1IXPA 1TTQA 1MEWA 3GLCA 3W23A 4S2CA 4Z1DA 1SW0A 5CPOA 1W5MA 3EWBX 3DENA 3HGSA 6TIMA 3LXBA 1KV8A 1FDJA 4UTLA 1KA9F 5DN1A 1H50A 3W07A 3PR2A 2DP3A 3TQKA 3W71A 1JQVA 3NA8A 3B0UX 2FPVA 4LY8A 3PY2A 4UR8A 4MZ1A 3W1LA 3GVGA 3HPSA 2CLKA 1IXQA 2VEKA 4LRSA 3UPBA 3G18A 4ORIA 1VH7A 4FNTA 1FXPA 1F76A 2Y89A 4UNLA 4A3UA 3NM3A 2FLIA 1LBFA 2PCQA 2ZA3A 3W7KA 1FCUA 2HS8A 4N4PA 3MW7A 4EVZA 1JCJA 2I9EA 3M47A 1L9WA 2R94A 1ZY9A 4WQ6A 4Y90A 1WQ5A 4LVDA 5EY5A 3ZFHA 4RXFA 3MBDA 1P5BA 3C6CA 3N9SA 2QEZA 1YXCA 2BTMA 3TKFA 3TAKA 3NO5A 4UTWC 3F4WA 3FKKA 4NQ1A 1KLZA 1JUKA 4LVAA 1VJIA 4FX8A 3NPXA 2RDTA 3M16A 3TSDA 2V8ZA 3M43A 1RPXA 3B05A 4BWLC 3USBA 2X1TA 1NSJA 3KFTA 4TMCA 4RR4A 5TQLA 4WY0A 4ZQCA 4KFNA 3TA6A 5HWNA 4NXSA 4GC4A 2H90A 1VHNA 4O54A 1OG0A 4FO4A 3GKAA 4JTSA 3G1SA 3L0KA 3HQ1A 2GJLA 3O06A 2RH9A 4E38A 1LROA 1TPUA 2GQAA 4UMCA 2WOQA 2DJLA 5G4EA 1OFQA 3NQVA 1WDWA 1JRCA 1T96A 5D2TA 3TQ0A 1W5QA 4GWEA 5DCBA 3NL5A 1OYBA 5AYZA 1K7XA 4OWGA 4N9EA 1RQEA 5HUPA 3I7SA 3L21A 2Q3RA 3CHVA 5DELA 5EMUA 3GDKA 3W86A 5LZLA 2H3DA 3W7GA 4PA8A 4UMBA 4R33A 2ZRYA 4EWND 2VKZG 5FF4A 1W56A 2NUYA 4H4IA 5CZJA 1M7PA 3W1TA 3EX6A 3W1AA 4YMZA 3TC7A 4HN4A 3S5YA 4DF1A 3QM3A 3C2VA 5KMYA 4R53A 5L9FA 3ABQA 4JNMA 3MI2A 3IVUA 2D73A 4POCA 3NXFA 4L4LA 3TK7A 3MMTA 4CQAA 4NT0A 4R34A 3SJ3A 4KFOA 3W2KA 1VHCA 2H6RA 3W88A 2QCGA 2YFOA 3N2XA 4HSNA 5I3KA 3F03K 3GDMA 4JTTA 3IRDA 3EB2A 1F73A 3DAQA 3LTPA 5DCDA 1XBVA 5MHBA 3QZEA 1KM5A 4GRSA 1DVJA 2GUUA 3EKZA 1G69A 3TW7A 5I3IA 2I14A 3FLUA 1GYLA 1YDOA 4ALDA 4JIPA 2NXHA 3LXAA 3W1RA 3QMRA 4HIBA 2Y7FA 3DHFA 4RZ5A 2C0AA 1TIMA 3KVLA 3M41A 2ZZ4A 4O0ZA 3BW3A 5HJLA 3E02A 3GIYA 1ME8A 4IGHA 5A5WA 4GNJA 4XKYB 3S5OA 5HR6A 1TJPA 5IM51 1F7BA 4LUIA 1SZNA 3N19B 3WK3A 3QYQA 5FF7A 1JCNA 1E51A 1M5WA 2GVJA 4NJHA 4N4QA 1I2OA 5AHEA 3TJXA 2E68A 4NJIA 4TR9A 1FUYA 2CZDA 3LRMA 2C19A 4YLWA 4QISA 1YADA 4O18A 2E6AA 5D37A 1EWEA 1N7KA 3LV6A 3LRLA 1GVFA 3GX9A 4Y8FA 3R5EA 1X7FA 1S3HA 3SFKA 4FX6M 2V5BA 4HNNA 5E1QA 4BFAA 1GZGA 1ZCOA 4NNCA 2C18A 3LXCA 5F1VA 2DZVA 3S9YA 3STEA 5FEPA 3KRUA 1XUUA 1QPQA 2BLEA 1H60A 3LCXA 1G67A 1P1XA 4ML9A 3ABRA 1RD5A 1ME7A 2QCEA 1PHWA 1WX0A 3UWZA 4DXVA 3NGJA 3C3NA 4O4WA 3EX1A 1EUAA 4WY0B 2P10A 2KZHA 3NNTA 3QQ0A 4YWIA 4XTIA 6ALDA 3SGZA 5AFDA 1IXOA 1X8FA 4LC8A 4BK9A 3PB0A 3NOEA 2TYSA 3WJXA 2WJZA 1EB3A 3PBWA 4AVFA 1TV5A 4XZ9A 1TMHA 1OFAA 3L5LA 4UFKA 1YLVA 2NXGA 3EXSA 1HO1A 2V2HA 2RDUA 1FXQA 4DO5A 2ZRVA 1OFEA 1YDNA 3LHVA 4BI5A 5L6UA 3JS3A 5KINA 1K8XA 1T99A 2FFCA 1GQNA 2FQIA 4PEKA 4JTKA 4J9JA 5FEZA 2YW3A 3NQ6A 2J9ZA 5LHFA 3P84A 4PCFA 1VLWA 5K9DA 2VFIA 2QJGA 4O4VA 4LS0A 4FNPA 2DZTA 3L65A 1GWJA 3CIXA 3UZ5A 3TE9A 1LM1A 3QMSA 3DI1A 2DZXA 1K02A 3SECA 1OVDA 3HG2A 2ZZ3A 3GB6A 4CCEA 2WSYA 3LCIA 4HT3A 4IX2A 3BPWA 5LKYA 1MO0A 1D3GA 4N9CA 2CZFA 3MP4A 3IVSA 2CLLA 3BGJA 4ZVJA 5C2XA 4LS1A 4JTLA 5KITA 3C4UA 1VCFA 4ORMA 4AWTA 3LHUA 1VCVA 3CT7A 3L68A 2YSWA 4KWVA 3G1AA 2WO5A 3HGJA 3STGA 3ABSA 1MEHA 3NEVA 1TPC1 1KV5A 1TPFA 3CWOX 4K36A 1JUEA 2BX7A 5F4SA 5F2LA 1UASA 4UCGA 4JTEA 4GUIA 1EPXA 1PHQA 4S1FA 1R2TA 2EF9A 1G6CA 2O7SA 2Q8ZA 2E5CA 3UPWA 4M5PA 2BSLA 4JICA 3KHJA 3NPUA 5K4ZA 3DFOA 4N6FA 4CCDA 1H7WA 1Q6LA 3LOTA 1VYRA 1WBHA 3N9RA 2EPHA 4H6KA 4ONVA 1KFLA 3INPA 1MZHA 1XCFA 2NUWA 2ZTKA 2YR1A 3QMTA 4UC5A 1DHPA 3NM1A 3UWQA 3A24A 4KFPA 1SPQA 3TC6A 2ATMA 1ONRA 2B7PA 1ICQA 4N6EA 3P5YA 4RJEA 3HB9A 4FB7A 2V9DA 3PBYA 4WOZA 3PF3A 4JDBA 1SR9A 3HGRA 3UWWA 4ICNA 3WJZA 3NPWA 4JTJA 1UBSA 3C8FA 1SFLA 2QDGA 4AWUA 2ISWA 5CKSA 3DXIA 4FNRA 1KTNA 5C6MA 4ZQNA 2ZYFA 2QCHA 1O5XA 3S5ZA 1GG1A 1A5AA 1FCVA 1YTKA 3V75A 1DKWA 4OU1A 4AMAA 1KM4A 4MY9A 4C1KA 1OX6A 4H3DA 1KM2A 4RK8A 2GVLA 3GAKA 2EHHA 2H3BA 1G4SA 5D02A 1KM0A 3A5VA 3HIJA 4RV8A 4O11A 3MHUA 4MLRA 1NEYA 1PE1A 1T8XA 3O1NA 2UV8G 2TPSA 3TDFA 2VFFA 4NVTA 4BI7A 3GKFA 1QOPA 3QEZA 4JX6A 4QITA 3BW2A 4RXGA 2VOMA 3KRSA 4QM1A 2VELA 4LTSA 4X3ZA 3G8EA 2QCNA 2ZCGA 3OBKA 1TREA 3R89A 1H7RA 4WJEA 2FB3A 3I68A 3PUDA 5D32A 2PE4A 4BI6A 4O16A 3QFEA 2VFGA 1ZFJA 4QNEA 3N34A 1FCQA 1W5PA 3TV8A 2Y7GA 4MLJA 3G3DA 3W1UA 4UFLA 3PM6A 4ZQOA 4K38A 2B0MA 2HMCA 1IGSA 1TQJA 3ATZA 1KLYA 2QR6A 5HMSA 1I2RA 4OE7A 1TTJA 1LBLA 1R2SA 1JULA 3MI3A 3QW4B 3CPRA 2FPYA 4X9SA 2AGKA 3L2IA 3KAOA 2B7NA 1XBXA 4HNTA 2QCDA 3BLEA 1ZALA 3N2MA 1K7FA 1Z48A 2A21A 2NXIA 4IJBA 4I9AA 2YW4A 3S1UA 1AW5A 1PCWA 3THAA 3KVJA 1OFRA 4GE8A 3I65A 2CZ5A 1PL9A 4I7WA 5D30A 3VE9A 4S2BA 1EEPA 3PWAA 1DOSA 2Y70A 1KBIA 4XWUA 4CLMA 1W37A 4FNUA 3G0UA 1J2WA 1FX6A 3O15A 4ZL1A 1KTBA 1AL7A 1AMKA 3RLUA 1MXSA 2GPTA 3BARA 2VFDA 4IMGA 5FEWA 2I1OA 3GZ3A 1VCGA 1VQTA 3CLMA 3HJZA 3DGRA 1ADOA 2NUXA 3UWUA 4GBUA 1OX4B 3ZR4A 3SY5A 1W5NA 3QPYA 4PODA 4IX0A 4O8RA 3P5ZA 2ZA2A 5DBUA 1TV7A 4MJZA 3DFNA 2QJHA 4YL2A 3LTSA 3ELFA 4LNYA 2Z6IA 1K7EA 2CLOA 3G22A 5LHEA 1FQ0A 4ADUA 1U5JA 4K8HA 3W7CA 2OZ0A 1HTIA 1KTCA 3WK2A 2YX0A 1VS1A 3W7DA 4O13A 4UTHA 1LOSA 4K37A 3V1PA 1GVSA 2JGYA 3BV4A 5J5DA 3UXAA 1JR1A 5K2ZA 5EKYA 4JTGA 1QNVA 4FNQA 5GVJA 1KFKA 2ZZ2A 4XKYA 3HOJA 2C15A 3MBFA 1TTPA 4O53A 3VNDA 1SO4A 5SWUA 4EF9A 2RHGA 3TQVA 1XM3A 5FI8A 4QIUA 3DZ1A 2NX1A 5FESA 3GNDA 3G1FA 4HSOA 1D9EA 1LRQA 1NVMA 2GVGA 3PSWA 3PUOA 1TSIA 3HF3A 2OT0A 2E6DA 3A9IA 3MHFA 4N9DA 1GEQA 1FWRA 1OK4A 5LGXA 2CLIA 3DH7A 1QAPA 3A21A 4K8EA 4O50A 2E6YA 1N55A 4PTNA 3NG3A 3NQEA 4FIQA 3LM7A 2J88A 1XL9A 4AHQA 4PC8A 2QDHA 5G5IA 4RZ6A 3BW4A 3TX9A 3P67A 1NAL1 3MO7A 3NQFA 2WNZA 3E9AA 1B3OA 1QPNA 1W5OA 3BG3A 4PL2A 3W72A 4LOCA 4WY0F 3CQ0A 1LYXA 5AHIA 2VC6A 1X1OA 2CZEA 4TMBA 5IBXC 2EAWA 2F84A 3S1XA 3T40A 1VLIA 3FOKA 3GXTA 4TIMA 2A1YA 4AHOA 1KM3A 4DBDA 3W7EA 3LBCA 3IGXA 3I6RA 1D3HA 1CW2A 5CZSA 1DQWA 5HWMA 1KFBA 4G1KA 1FY6A 3C2FA 1W54A 1UCWA 1ML1A 3G8RA 1ZHAA 3HG5A 1DV7A 4DEFA 1AG1O 1S5VA 1M7OA 4Z0SA 1GT8A 3SI9A 2QCDB 3THQA 2Q8LA 1HL2A 4LV4A 2JK2A 4IWWA 4JYDA 3QRHA 1SSDA 5H91A 3EWUA 3RLVA 4MKNA 1THFD 5T26A 3WJSA 4OQVA 2PRHA 4O1CA 1A50A 1XI3A 1C29A 3A22A 4UNKA 4UTWA 2ABBA 4IXXA 5F2MA 3EX4A 3S6DA 4C1LA 1P0KA 3GDTA 3D0CA 4A21A 4XBKA 3C56A 4BWLA 2JGQA 3RNDA 1F5ZA 2JKAA 2WKJA 3STCA 5IBXA 4LU0A 3HO8A 5LNUA 2R91A 3BLFA 5CG7A 4MFDA 1YPFA 4LW7A 3CIWA 1CX9A 1FWTA 4MVAA 2CW6A 3NR0A 5TBOA 3W2JA 3N3MA 1Q45A 1VPXA 1K8YA 1XDMA 4JTHA 2G96A 1OFDA 3NQGA 4IQLA 4O0KA 5HWJA 3NVTA 3P60A 2CLEA 1SW7A 5AB3A 1JRBA 5K4XA 3ZWSA 3TH6A 3FYOA 2FPTA 1UUMA 4OV4A 3QQ1A 3M44A 5C54A 1LORA 2RDWA 5E93A 1SUXA 2YDAA 4PFMA 2W6RA 4UTIA 3FYPA 1KM1A 3I7RA 3GYEA 4JR5A 3LLFA 1I45A 4MJMA 1Q3NA 2X30A 3EWYA 1ICSA 4FHAA 1LLZA 5AN7A 5DCEA 4NZFA 3PULA 2QAPA 1LCOA 4MZ8A 3PVFA 1VYPX 4XQ6A 2LLEA 2VFHA 5D09A 1G4PA 3KVKA 3S42A 5BMXA 1ME9A 2AAMA 3OVQA 1JCXA 3EEGA 4AXKA 3FKRA 3TXVA 3H54A 4PL1A 1F05A 3GXNA 1GVOA 2Z2UA 3JR2A 3NL6A 1KFJA 4N02A 3P8JA 3BVJA 3QH2A 3L5MA 1TPDA 1ZAIA 1TPWA 4HNVA 3BGGA 3W6YA 4EF8A 3SIZA 3CTLA 1LTDA 3KVMA 4JIQA 5TIMA
chains in the Genus database with same CATH superfamily
4RDZA 1FWSA 5U7SA 2XSBA 2VR2A 3TTQA 2WSPA 4A05A 2QCCA 2G3NA 4NJJA 3UZJA 4Q8QA 3E5PA 4JTQA 4L6OA 1B4EA 2EJAA 1PS9A 3ZSSA 4EPKA 1V0NA 3GXPA 4NNAA 1PDYA 3GK0A 2JF6A 3M0XA 4KWOA 2BZNA 2V81A 3N14A 4U4MA 3T2PA 1H7NA 2Y7DA 1Y5VA 3CHEA 1VFLA 1SSGA 1XKYA 3E74A 1W9BM 3CK5A 1JPHA 3PJTA 4JAWA 3MWAA 2BXZA 1RZMA 4UCFA 2VCBA 3A4XA 5LA1A 4E0CA 1FP9A 4MDPA 3MANA 4BF7A 1DIEA 2J7FA 2C0HA 1K8ZA 3E0LA 3K1DA 3FVMA 4UNIA 5EMLA 1EWDA 3AAMA 4F3HA 2E9MA 1I2PA 4RX0A 2I7GA 2OCZA 4Q32A 1TQXA 4NG3A 1UH4A 3H24A 3R8RA 3Q2DA 1V3IA 4BJHA 5E0FA 4NJKA 2QJNA 4NIRA 5CSUA 4IPNB 4TVUA 1DXEA 1VB9A 4DO6A 1PX3A 1XIDA 4J3UA 1IT7A 3C0JA 4PMNA 3CB8A 5G1TA 1L6SA 1K6WA 5U4NA 9RUBA 1UH3A 2YXGA 3GFYA 1Q6RA 2FB2A 2YL5A 4DZAA 1W9VA 4CNOA 3QTPA 4LSBA 1W2PA 2PGWA 2WSKA 5E0CA 5HNUA 3TONA 3DHUA 3WQGA 5CQ1A 3U4FA 1E0UA 3MMUA 1DWFM 4L9YA 3OQ8A 2E8ZA 3BO9A 3R6IA 3UWYA 2YBTA 1K4GA 1B3WA 2ISSA 4XIAA 2HDJA 5F2GA 4CKQA 2NQ9A 1TV8A 2VQUA 2WSQA 3CV2A 3G1YA 5E6YA 3K46A 3TWBA 2ZDRA 2O9PA 4H7VA 3BGAA 5D2XA 1QR7A 3QC3A 1FWBC 5BMWA 3ZYZA 2EGZA 3HPXA 3FHAA 5XIAA 1A5CA 1EEXA 3P7YA 1ZAJA 5HK4A 4EOUA 4JPGA 4YJ5A 4O1DA 1E43A 4GA8A 2A3LA 7PTDA 3UD6A 1E15A 1H7XA 1PJ9A 3TSBA 5FJPA 1SO6A 4PB3A 1UR8A 4FK9A 3W84A 1WAUA 4CNUA 3W7IA 3VC5A 2HZGA 2PC4A 4V27A 1F6KA 2AL2A 3URQA 1IXNA 1JI1A 1F4HA 3B06A 3BG5A 4I9JA 3S2JA 4DO7A 4LVBA 3IJQA 4IHCA 3TNOA 4U33A 4D6IA 4UTUA 2B4GA 3H8AA 2CLHA 3L5AA 1PKYA 5I3FA 1LDCA 2PODA 3RM4A 1Q6FA 4LRTA 4KETA 1JZ6A 3TOYA 5HJXA 3UG4A 1S2AA 3CAKA 4MOZA 1T8QA 2W27A 1KGWA 3WY1A 2YCEA 4OKDA 4XZNX 4B90A 3N11A 5CZ0A 2PZNA 3W1PA 5BW6A 1WE5A 4QX4A 2XIOA 5AYIA 3B4YA 3EOLA 4XTDA 4GUFA 1R46A 1KR1A 3QV7A 4AEOA 4DAFA 1M01A 3BK0A 1JAKA 1YHTA 1KGXA 4ZEPA 2JFEX 1Q66A 5D8WA 4XB3A 2FDMA 4ZFCA 1MW1A 1Y0EA 3K30A 1E6RA 4PMYA 3NVDA 4UTFA 2O92A 3EB3A 1F6PA 4O17A 2JQXA 1ONEA 2X1UA 3N6JA 5H6HA 4LUTB 1SYTA 1K6AA 1KWGA 2ZVIA 3LQLA 1B54A 4EPBC 4HZ8A 4D2JA 3DEQA 3M7SA 3BL3A 1NDWA 3WBAA 1AZ1A 3GAYA 2WMFA 3D6NA 3EOSA 2NV2A 2W67A 1GPFA 4PMDA 2YDRA 4O15A 3TR9A 1UB3A 4FMVA 4IFKA 2OEJA 3TZFA 1LRNA 4Q8UA 5FSDC 3DG3A 5E9AA 3WLMA 2YXXA 4NU7A 3NYZA 1W31A 2QJMA 1VC4A 1Y7VA 5EPDA 2CHNA 5CC7A 4S3GA 1KRMA 3GTNA 3S4TA 4C91A 3E0VA 3ZXWA 2OGJA 4HBKA 1G4TA 1HFBA 4OUIA 4DNHA 2HSAA 3GDLA 5I3GA 1Q6DA 2ZRXA 3WBXA 2ANUA 3FY1A 2J7BA 1UA3A 5DBTA 3OG2A 4TQTA 4QSHA 2HS6A 5FOOA 1T0OA 3QSRA 1W3TA 3TMQA 3T0TA 4Q8OA 3AALA 3N73A 5EBUA 1JF5A 4GYKA 4ICCX 4JQ1A 4FLSA 3A23A 5A6AA 2ZZ1A 3ATYA 1XFCA 1OCJA 3H2EA 1DJGA 1KWKA 4JZ5A 3G6MA 2YB1A 2DY3A 3G5EA 1YDYA 2ZTJA 3S1GA 1I6NA 4Y96A 3W87A 4QTGA 4S38A 3MJYA 2EKCA 3IV8A 2I17A 4IG2A 1LLOA 3M0HA 4JN6A 2ZA1A 4FI4A 4GXMA 4M1RA 3H21A 4NILA 4A8IA 2POTA 2ZZ7A 1GGOA 3NQCA 4IP7A 2FKPA 1VGAA 2R14A 2VC7A 2VMFA 4L7ZA 4W7WA 2HXTA 5D9OA 3O6AA 3ZLGA 1DXFA 3UJEA 4AX7A 4DVOA 1AVAA 3MUAA 2RKXA 4KESA 3R79A 3AXIA 1S3TC 2P0OA 2Y5EA 3S47A 4ASTA 1K4HA 3NPVA 3URBA 4JTUA 1H09A 1BVZA 1EOKA 3RDKA 1ZP4A 1RR2A 5LA2A 3D3FA 2ZZ5A 5CPLA 3LUTA 3CZEA 1OCBA 5F4WA 1NARA 4LJ3A 1Z8AA 4LYQA 3I3DA 1YTDA 2MUCA 3OVRA 1EO5A 1A5SA 3F2CA 4LYKA 1O60A 4E4PA 1GPWA 2XH7A 3SGUA 3B8SA 3URNA 1KKOA 3VIIA 3IPWA 3CV7A 2NQHA 1GOMA 2DW6A 4GC3A 4IT1A 3NQ8A 2DZWA 3H22A 1ODZA 1IYXA 2VT0A 3W7LA 4QLJA 5AC8A 3KS5A 5C2CA 3MVIA 5A8GA 2OPJA 2J6VA 3EOEA 1P4CA 2PWVA 1EJWC 4XAFA 1DYSA 1S2WA 1RCXB 3ITVA 3UA4A 1VEOA 3ARQA 3B0PA 4LS2A 4U10A 4Z0JA 6A3HA 2BVDA 1X6UA 1VYSX 3DGBA 3WLLA 1MSSA 3B0XA 1W17A 1ZGDA 5CZTA 1EUNA 3RX2A 3ARUA 3QC0A 4JD4A 5CGTA 3TLLA 3AICA 4IIGA 2XU2A 4KEUA 3AI0A 4QDPA 2C1IA 5HDRA 2YYTA 4FNSA 4AF0B 4Q7IA 1IIGA 3V0UA 1ZRQA 4OIFA 3R7MA 2PBOA 3WD1A 3GXDA 2Q8XA 3W70A 3PSVA 4LUSA 2DORA 3PB2A 4UBPC 2XINA 2WVVA 4NXKA 1TRDA 4U2ZA 3IGUA 5HBFA 2A6NA 2PRMA 3LBMA 3KX6A 1EJRC 1VFMA 3SCWA 4GX9A 1VEPA 2QCMA 4NUWA 1TCDA 4XBSA 1PAMA 1W1TA 4V1XA 3CO4A 3OJGA 1X8CA 1IEVA 2J62A 3PZUA 1IZKA 5HPCA 6XIAA 1G5AA 3VA8A 4ZZ9A 1A53A 2ZUSA 3VXGA 4M51A 5AHNA 2UBPC 1FFQA 2ASHA 1HKVA 2NVDA 1W1B1 3GS6A 3SCRA 1AW2A 2CKSA 1R3WA 5AYYA 2E40A 5JQ9A 3TC3A 4KWWA 1UD4A 1W32A 4AAJA 4DY1A 2AMXA 4E8CA 4GZIA 1I9CB 4HNUA 2PURA 3IUIA 1EJVC 5AVNA 5EA9A 3V7PA 4AZBA 3GW0A 3KBJA 5G2WA 1QPOA 4PMXA 3LCWA 3DHDA 2GOUA 1H1NA 1DBTA 1BRLB 1FDYA 4DWSA 5JBFA 2C8NA 1OD8A 1TCMA 1VFUA 1VBHA 1UWIA 3MSYA 2V2DA 4V15A 2XVKA 3WEOA 5F2IA 3TW9A 1ZU8A 4H8VA 1P1MA 4L1XA 4K68A 3LNMA 2V3DA 3NQMA 5CSRA 3EGJA 3C8NA 5A8QA 1I2NA 2Z1BA 4UIOA 1HW6A 3BLIA 4RE4A 1XGEA 2Z2AA 5I5RA 4D1JA 1MUCA 5C55A 2GGHA 5AC4A 1SJDA 1XFBA 3H2AA 4HA0A 4UMAA 1IEQA 5FF2A 4S3AA 4UFHA 3SUSA 1HO4A 4EWJA 3PS7A 4IIHA 3UCCA 1KFCA 4JCLA 2PDMA 3LB0A 1RAKA 1SJBA 2P76A 5KZDA 3UT0A 1E72M 3VCCA 6PTDA 3H55A 2WQPA 1RQHA 3PPCA 2CC0A 1GVIA 3NJ3A 4OHQA 2PF0A 3RILA 2IQ0A 1J01A 3NTYA 3KZPA 1SZFA 3T6CA 1H51A 2PGEA 4I7VA 4PGLA 3UCDA 1HT6A 3UJFA 3BE7A 1QWGA 3RUBL 4WXZA 2O9RA 3WO8A 3RU6A 4AZ7A 4OVXA 3EWWA 3WH9A 3FNDA 3NZ1A 5GNXA 1EJSC 3PAOA 4GQBA 1JPIA 2DVXA 1QNOA 1UR4A 4UOJA 3RF9A 3IUHA 2IPWA 1OCQA 3PN8A 1DE6A 2VZOA 1GQIA 4X61A 4P8XA 3V16A 2OODA 2ACRA 2YCLB 2ZC1A 5A3HA 1YRRA 2DT2A 1AH3A 4QR6A 3DFPA 1MRAA 4H00A 1XLBA 1S2VA 3NQ7A 4V28A 3VUSA 3SB0A 3HGOA 4E8GA 2D69A 5GNYA 3WDHA 4ZQRA 3CL8A 1O7AA 1EJXC 4GY1A 3OGVA 4TX9A 2Z1XA 5JXQA 5ABGA 3SSZA 2GJNA 4K7VA 1F3WA 4R88A 1AL8A 1MQRA 4KRUA 3LCFA 2C71A 4OV9A 4JNYA 1DL3A 3M4HA 2GGGA 3ZJ6A 8XIMA 3C86A 4US5A 3NSXA 5D8ZA 4CU6A 5CBIA 4MKSA 4RUBA 5HULA 3THCA 2H8XA 4QXIA 4WKFA 1P7TB 1JG9A 5DY3A 3E5BA 6CGTA 4M7TA 1BAGA 1F3XA 1MEWA 3MQTA 1XLGA 3UR5A 1SW0A 5CPOA 3EWBX 3DENA 3LXBA 2Y2WA 5IFPA 4J3ZA 4JN7A 1TE6A 1KA9F 1H50A 2D2HA 3PR2A 3CL7A 4M80A 2OWCA 2FPVA 4LY8A 3PY2A 4UR8A 3C0LA 3W1LA 4DYJA 3GVGA 3HPSA 2WHLA 3VK5A 1IXQA 1YBQB 4HCHA 1MVYA 4LRSA 5LIXX 3G18A 4ORIA 1VH7A 3MDWA 2FGBA 1B3VA 3ZM8A 1NOWA 4RDWA 3NM3A 4LEQA 2FLIA 1J0HA 2PCQA 4L6HA 1FCUA 3B9AA 3MW7A 2D2JA 2I9EA 1MFVA 1X96A 2R94A 3H70A 1WQ5A 2J77A 4RXFA 2G37A 2WCSA 3MBDA 4HMNA 1P5BA 3C6CA 2CIPA 1XGZA 3N9SA 4MF4A 4PTXA 1NWSA 2QUMA 4S39A 2PLJA 3VGEA 4HZ7A 1KLZA 4AY7A 1VJIA 4FX8A 1XRSA 3M16A 1CLXA 1KXTA 4NI3A 3KOWA 3UG5A 4BWLC 3USBA 1E6NA 5HQLA 4RR4A 3N15A 3TA6A 4GC4A 3L2LA 4FO4A 5DMLA 3ARVA 4JTSA 1EL3A 4TUFA 1NH6A 1EHAA 4GH3A 3VM7A 5FSEC 1B31A 3KBVA 1SFSA 3LQGA 3VINA 5I03A 1OFQA 1T96A 3TQ0A 3BCJA 5CG0A 2CERA 1OYBA 4OWGA 3AMLA 1RQEA 1XISA 3L21A 5AECA 4DBWA 5LZLA 1EF2A 4XZWA 2H3DA 3ONBA 2W3ZA 1F3EA 1NM9A 3EDFA 4EWND 2VKZG 2XFYA 5E5CA 2NUYA 4AD4A 3VO0A 3TC7A 5LIWX 3QM3A 4BKNA 2DSZA 2OQHA 3I10A 2HISA 4L5ZA 5EMJA 3UZXA 1VFHA 3THDA 4FOUA 1NWRA 2JIWA 1UHVA 4L4LA 3ORWA 4LBRA 3GH4A 3MMTA 4TVCA 5A69A 3RPTA 3W2KA 1VHCA 3QY6A 1TV4A 5CAHA 3SCOA 3U2ZA 1OIFA 2WZEA 2H6RA 3W88A 2YFOA 1E4NA 5I3KA 1O68A 3IK2A 1V6VA 3GDMA 4JTTA 3IRDA 3CQHA 3DAQA 1FHVA 2YA0A 5MHBA 3V5CA 1KM5A 7TAAA 1DVJA 2GUUA 3T8QA 1U33A 4I5UA 3GY1A 1G69A 2DSWA 3WLRA 3OB8A 4DJFC 3VMNA 3BURA 1GYLA 1YDOA 2EJ1A 4KEZA 1ZP3A 4RE2A 4JIPA 2VWTA 3N1AA 2FZ8A 5CEWA 1CDGA 3FSTA 4HA4A 4GKLA 3M41A 3BW3A 3GIYA 3QV8A 3S5OA 1XQKA 1XYLA 1TJPA 2E25A 5IM51 4K8GA 2E9BA 4U5KA 3IACA 4P8UA 1M5WA 3V1HA 1O66A 4LX4A 3Q45A 4ZOAA 5AZ1A 2E68A 1UPPA 2OKOA 4Z17A 2GDUA 2J78A 4PBFA 2J25A 2C19A 4GISA 4YLWA 4QBXA 4QISA 1YADA 4O18A 2E6AA 1GW1A 5D37A 1CGVA 3EMCA 3OW1A 3R5EA 1OZMA 4HNNA 1S39A 1ZCOA 1HZYA 3OOQA 3FVDA 3DC0A 4L9ZA 4QGCA 4FAMA 3WF1A 1P1XA 1HJVA 3TWAA 1ME7A 2QCEA 1PHWA 4DXVA 3BANA 3FCPA 3W29A 1C8YA 4LBUA 4WY0B 3ZOAA 2P10A 1EOMA 1T40A 5M17A 2Z7KA 4XTIA 1X8FA 4LF1A 3RCYA 3UR8A 3WQFA 3EXSA 1BTCA 3LPOA 4CU8A 1K8XA 1T99A 3UJSA 1UKTA 5PTDA 4TXEA 1JI2A 3NQ6A 3WNKA 2J9ZA 5CPSA 4ZE5A 4PCFA 5K9DA 2VFIA 5I77A 2DIKA 1EX1A 3BMVA 1CXKA 3WMLA 3TN4A 1IZJA 1GNXA 1UIOA 1GWJA 3UZ5A 3TE9A 1O6IA 2ZE0A 5A8PA 4A8RA 4PUJA 2BMBA 4PB5A 3USZA 4I8DA 2ZX9A 2R24A 3GZAA 3LCIA 4R3UA 4L80A 4HVXA 1XIGA 3P3BA 1MO0A 1MQQA 2ONEA 3EYPA 3E6EA 5C2XA 1GKQA 1JPDX 5KITA 3K2GA 4AWTA 3LHUA 4AZIA 4YHGA 1M04A 4C90A 4IIBA 3KBNA 1B1YA 2F6UA 1MEHA 1TPFA 5ABFB 3LMYA 1D3CA 4PTMA 3RCMA 4UCGA 4JTEA 4GUIA 2BGSA 4LY4A 3WLJA 5AKQA 1R2TA 2O7SA 1G6CA 2AOSA 4D6DA 2E5CA 3M6DA 3UPWA 2ZIDA 1LJYA 5DMMA 2BSLA 5G1MA 4DLFA 1PPIA 3Q67A 3OBEA 1D7KA 4ONVA 2L5HA 3KE0A 1MZHA 3E2QA 2NUWA 2YR1A 3QMTA 2VGIA 3VZYA 3NM1A 4YWSA 3UWQA 1PSCA 3APTA 3L4ZA 3WQDA 2VL4A 1SPQA 3SFWA 5T8GA 4ZODA 1ONRA 4N6EA 4RJEA 4JNZA 4WOZA 1PTGA 5A6BD 3UWWA 2OYMA 4B15A 2WHJA 4JTJA 2P88A 3GFXA 3WX7A 3C8FA 5BU6A 1JFXA 3U5YA 2OO6A 4RPQA 1A3WA 4ZQNA 3CL6A 3SRFA 3TTSA 1PUDA 1GG1A 1K8CA 1A5AA 1A5LC 2XG9A 1FCVA 2QPUA 1BXBA 1YTKA 1DKWA 5C8BB 1X97A 4RV3A 1KM2A 4YTRA 3PZQA 1A3XA 1LUCB 5D02A 3DYPA 1Q4WA 4E8DA 1UYQA 4RV8A 3BICA 1JDCA 2XDFA 4HK6A 5C7VA 3MHUA 3WEZA 3CIVA 3JZUA 4C5ZA 3GKFA 3TTOA 3QEZA 4JX6A 1D8WA 1V0MA 2QCNA 2ZCGA 4J3VA 3P93A 1J11A 3H2NA 2FB3A 5D32A 2GYIA 5JVLA 4O16A 5CLTA 4IUGA 1ZFJA 3S5SA 4QNEA 3HV8A 4C6NA 2Y7GA 3G3DA 4UFLA 4K38A 4F48A 4R7WA 4PMVA 2B0MA 1JZ5A 4D1IA 3ATZA 2QR6A 3CYJA 3AXKA 5HMSA 3KL5A 1LBLA 3OZPA 4ZB0A 4KWUA 3KL3A 3MI3A 2OWXA 5FKYA 2FPYA 3WUBA 4ZO7A 3KAOA 3MJMA 4KT2A 1XBXA 4FS9A 2MNRA 7ODCA 4G2DA 2NXIA 1PCWA 3GHRA 4CNSA 4NAFA 5EGRA 4IIEA 2PWFA 2VI0A 3VE9A 3TTEA 5BXSA 1PKMA 3BQ6A 4ERIA 5IXEA 4XWUA 3CQIA 1B2YA 5DRCA 5AZ0A 2GPTA 2VFDA 2FVKA 4IMGA 3GZ3A 4DJED 1XIIA 3HJZA 1ADOA 1PTDA 1UJQA 4RL3A 2HBXA 3TNBA 4KF1A 3VKAA 4S3BA 4IX0A 2BHYA 1QK2A 1W3JA 1TV7A 3DFNA 2QJHA 4YL2A 4MB5A 2CLOA 1C7SA 1E9IA 3W7CA 1KTCA 1RLCL 3Q4DA 3W7DA 3UXIA 4PZVA 4C7GA 1GVSA 1RK5A 1Q7QA 5K2ZA 4XD5A 2QMKA 3RX3A 3T05A 1A0DA 3HOJA 1TTPA 4O53A 2R1NA 4MMWA 3CJPA 2AKMA 4S3JA 3TQVA 3ZIZA 5EFDA 1MYRA 4H9XA 3NOYA 3WD3A 1D9EA 2D3LA 3PSWA 3PUOA 1UZ4A 2HVMA 3KP1A 1UA7A 2POZA 1OC5A 1OK4A 5LGXA 3QN3A 3BOXA 1JD9A 5IDIA 1ZBCA 4X0NA 2OGYA 4PTNA 2WLZA 4NYUA 2J88A 2QDHA 3TX9A 2ESCA 3NQFA 4JHZA 3TZNA 3E9AA 5LIUX 4PL2A 4X63A 1QHZA 4YIWA 3W72A 5AHIA 1O5QA 3SRKA 3ECQA 1MW0A 4J7RA 1ISVA 1QNQA 3FOKA 3GXTA 3O0KA 3ARRA 4LCSA 4F8XA 3NFUA 3W7EA 3EAUA 4P7RA 4PSPA 3E0FA 5HWMA 1E1CB 1G0CA 4CD6A 1ML1A 1ZHAA 4ACYA 1JNDA 3WF2A 5I3DA 1AG1O 1S5VA 3C2YA 3OZYA 4PUEA 3IJIA 3WQ8A 2PWEA 1H2JA 2HVOA 1ELSA 2Q8LA 1HL2A 4IWWA 1Q6EA 2PD9A 1Q7ZA 5H91A 1FHLA 4Q8WA 1QI5A 5T26A 1P43A 1TKKA 4O1CA 4M24A 4QE4A 3EPMA 1C29A 2XIMA 4C65A 1Y5WA 5BWAA 1P0KA 2CZVA 4A21A 3D0CA 3P0WA 3CMFA 4J2MA 3TYEA 3LYEA 3S46A 2QF8A 2JGQA 3RNDA 1BXCA 3CV1A 1AJ2A 2R91A 3BLFA 5CG7A 4MFDA 4JCMA 4R9XA 3BZJA 2PF8A 4MVAA 5TBOA 3N3MA 1Q45A 1VPXA 5BCAA 3AIEA 4H6EA 3NVTA 1AJ0A 2CLEA 3AJ7A 2VD9A 1A0EA 5K4XA 5C54A 2UY4A 1LORA 3SUTA 1ZZMA 2OSWA 4BF5A 1HJUA 4UTIA 3UETA 2KAUC 2WM1A 2QJJA 3DCPA 3VDHA 2ZUTA 3PULA 4A35A 1ONWA 4MZ8A 1I1XA 3PVFA 4ICMA 1KGUA 2D0FA 5I00A 2PTXA 3K4WA 3T1GA 1JZ3A 4PRTA 4HU3A 4NF7A 2ODOA 2UZ9A 4K1GA 2R1KA 1MW3A 2D22A 2Z2UA 3JR2A 1YPXA 4WJXA 1TA3B 3S9ZA 4OBRA 3PZOA 3MUIA 1D8CA 3QH2A 3MT1A 4ILSA 1BWVA 4OTKA 3ZJKA 1XICA 4IJCA 4BHYA 1F8MA 3WF4A 1XIMA 2GSEA 4DZIA 1CXHA 1Z32X 3BAXA 4E2BA 1H61A 2TRSA 4C7DA 1QRQA 5ABTA 1WDPA 2OO0A 3CGTA 3CWHA 1E4LA 2NT1A 3TMLA 1CB2A 2WNQA 2ZX6A 4GI4A 4A2SA 4XZLX 2GVEA 1DJQA 1PIFA 2JE8A 3W81A 2WMJA 1N8FA 4CCCA 4Q6XA 4WDTA 3KOYA 4S3CA 2PLKA 1RVGA 3W74A 2YLLA 3AYRA 4LXFA 4UTTC 5CGMA 3Q37A 2CXEA 2OJPA 1XG4A 1XIEA 2E1WA 3V18A 3VKCA 4WXYA 2GWNA 4TO8A 1GQLA 3CC1A 3OVPA 3W75A 2OX4A 2X42A 3O07A 4HU4A 3U7BA 4JKMA 3AU6A 5CGQA 1NJJA 3U2OA 3FIGA 2YCKX 3UNDA 4N2YA 1W1ZA 1TVNA 3W1MA 1V7YA 3V0TA 4AZCB 4RNJA 2H9AA 3P0XA 4U2YA 2VR5A 4MB1A 3DECA 5B7ZA 4DIAA 1FWNA 2NX3A 5FF0A 1KBLA 1BQCA 4TOQA 2J9YA 5T91A 3TEVA 4LAUA 3KRBA 5CJNA 1VKFA 4Z2HA 2Q3OA 1A47A 3O16A 3N9KA 4YCOA 4IM4A 2C91A 2PWGA 3J7HA 2OMAA 3REQA 3WLIA 1RHCA 1YXDA 5F1UA 3VNJA 1VR6A 3W28A 5I3JA 3SQMA 2YL8A 2O0TA 4X9YA 4UQDA 5A6KA 1PDZA 1QOQA 2A6LA 5EYWA 4LCQA 1KBBA 4NY2A 2Y7EA 1B0IA 4Z1AA 2CITA 4UQAA 2J47A 5CPNA 5LGZA 4U28A 3QJAA 4WGHA 3UJRA 3GNXA 4CNNA 1NOUA 2WSRA 3KWXA 3QLLA 2VQTA 1EIXA 4B4HA 3AHYA 4MFEA 2NWSA 2BV9A 3WJYA 4ZOEA 2YDQA 2DIJA 1XH1A 3MPGA 2PAJA 2WKLA 1BKHA 5DXYA 5BU9A 2UWFA 2X1SA 2ICSA 4YXGA 1B90A 3O6CA 2XHYA 3GU2A 2VUNA 3AXMA 3UXKA 2VEGA 3G0XA 2A4AA 5TNVA 2XM1A 3ZT7A 4WZHA 3RR4A 2UY3A 4HKPA 1HVQA 1Y65A 5F7UA 4Y7EA 1YNQA 3ANYA 4IGSA 3M0VA 2QCFA 5KETA 4Y6GA 2XGIA 1MDLA 4AX6A 3M64A 3PPGA 4ADSA 1E1FA 3I6TA 4H8HA 3JUGA 3RPDA 4DUOA 3V36A 4O12A 2ZICA 4GIEA 3VABA 3U5UA 4IP4A 1M6JA 1QWKA 3RAOA 2GQ8A 1TPH1 2PLMA 2YYUA 1T6MA 2VUYA 4HPGA 3I7QA 3MCMA 4GJ1A 3TIMA 4PCPA 3WK0A 2XSXA 4GINA 3RK8A 4JEQA 5M5DA 3PANA 1I75A 3RJXA 5D04C 2QF7A 1M9HA 1JEZA 5JBEA 3VNZA 4F0SA 4M29A 1GOXA 1DEDA 3IIZA 4GYPA 2R8WA 2DV0A 2RGLA 3BC9A 4WOQA 3FEQA 3FEMA 1L6YA 3BG9A 2VHLA 1I4NA 1HIZA 4HOZA 5I23A 4FZIA 1Z41A 4HSHA 1TWSA 3QF0A 4GI8A 5KZEA 2D2OA 4ATDA 3S1WA 1CPUA 3PBUA 1OABA 1VFTA 4I6KA 1W91A 3P82A 2PDNA 4B9YA 1XYZA 1FDZA 5JUVA 3DKJA 3FAWA 3WEMA 2ISDA 4I5RA 2OOFA 3NL2A 4E3TA 1J6OA 2EG8A 2INZA 1BYCA 3CUZA 1TPVA 4BQ5A 1KCKA 4GLEA 2WANA 2XVNA 4HHLA 1TV3A 4FX7A 3VKDA 3F4DA 2ZRWA 4OUEA 4WEVX 1TZ7A 1BVNP 1NFBA 5KZ6A 4BCEA 2IKJA 4H8UA 1HGYA 4LT9A 5CPTA 4PB4A 4AFYA 1F4AA 3DBNA 3VE7A 5C70A 3H2OA 5EMKA 4KCWA 5M1TA 1EC7A 1JYVA 4ZO6A 3WQ6A 3KRZA 4RE0A 1EP2A 5CBBA 4M19A 1FCBA 5FJOA 5E09A 3VGGA 2A0NA 2AAAA 3TA9A 4MZYA 5I24A 4LVFA 5ECUA 2I57A 1RQBA 1VENA 2C13A 3U2EA 1QBAA 4QAIA 1US0A 5F4XA 3EBVA 1UP0A 1GJUA 3UF9A 3KBSA 2XH0A 1R3TA 3WK1A 4CU7A 2ZC8A 1UUOA 3ZVHB 3W7OA 3M9YA 1MWOA 5E70A 2E09A 1JCTA 1HUVA 3R12A 1WA3A 1G7UA 4ACZB 1J0YA 4ZQPA 2A7RA 3P62A 1WAWA 3DFTA 4J3WA 3S2CA 3UYCA 4PR4A 3F1QA 4JEJA 1OT1A 3B8TA 4ZTYA 2PC8A 5HQEA 1KRBC 1CGWA 3MZ2A 3W7PA 2WPBA 3W9ZA 1ZBWA 3VGDA 4KCTA 5BXTA 4GNVA 4AYSA 2CLPA 4E2DA 1XBYA 4J5NA 1BEUA 2ZFAA 4Z2JA 1K77A 4PUUA 5DANA 2GZXA 3U9IA 3IANA 3CQKA 1W8GA 2CWNA 4OECA 5HNRA 4QS5A 2A5HA 3R13A 1YDVA 4IPJA 4NHVA 1KFWA 4QCFA 4HPHA 3LNPA 4RDVA 3M0JA 1HF6A 2PDYA 2O55A 4I7UA 2QCLA 1VRDA 2A7PA 3H23A 3LRKA 4DPPA 5HPOA 4IGMA 1H1ZA 3JVAA 5MKGB 3EA1A 1GW9A 4LWWA 3VIPA 3WD4A 2XN0A 4WLCA 4A3YA 5A94A 1FH7A 5T9CE 3XINA 2C79A 5BYWA 4B92A 2Y5SA 5A6BA 2XM2A 3CB3A 1HVXA 3KW3A 3CV6A 1GKPA 3CWNA 3E96A 2BNJA 1MUWA 4M6UA 1GG0A 1Q6CA 4HZMA 1E0VA 3GVVA 3OLEA 3W7MA 1EKOA 4F40A 3I4EA 2HTMA 5CCZA 1JCYA 2PPGA 3UWVA 3HU7A 2BY1A 1ONXA 1A5BA 3WLHA 3ARYA 1JCMP 3N2BA 1N2VA 1W3HA 2AGTA 2VJXA 1XKJA 2XIQA 1LLWA 3TYUA 3UERA 4LANA 3TN5A 1XRTA 1P6BA 3NDOA 4MNLA 1JF6A 3O8AA 3QHNA 1NTHA 1A3HA 2OLSA 2H8ZA 5C71A 4KQNA 5CPMA 4L4MA 1EZ2A 5M2FX 1UIPA 3AJXA 4K2SA 3CXOA 3AIUA 3OA3A 4GI6A 2OLHA 2OG9A 1UR2A 5D03A 4HPJA 3L2MA 1CIUA 4GVFA 2NSXA 4INFA 4HK7A 3L0NA 1V5XA 4MIMA 1FWEC 4IP5A 2WMHA 3NURA 4WR3A 1R3RA 2WJDA 2Z6JA 4DJEC 5JBDA 4AZ6A 2P8BA 3T44A 4DZ5A 1RCQA 4ERAA 4XUGA 4MYXA 1OC7A 1QNRA 3G0SA 4XAYA 1TIWA 3B8DA 4PULA 4CCZA 1ADSA 4AC7C 2AL1A 2G5WA 3W7QA 1J10A 4M0XA 1EP1A 5HOSA 1ECEA 2FYMA 1LBMA 2QDEA 1K70A 5LNVA 1S1RA 3AMCA 4DO4A 4A29A 2OX1A 4XO7A 3OGRA 4HTBA 2BOGX 1ADDA 2A7NA 4UXDA 1HKMA 4UUIA 5EL1A 3TROA 3MV01 1J93A 4JS3A 4M6QA 3TXZA 3CEPA 2I5QA 3CPUA 5M03A 1FOBA 3TFXA 3GC2A 4IXHA 1NU5A 3W1XA 2BY3A 3W7JA 4AZHA 1CLVA 1DWGM 1F74A 4GVIA 4IMEA 3W2LA 1JCLA 2TSYA 3UESA 3M1ZA 5A2BA 3W38A 4AHPA 2I5GA 5HMDA 4JBRA 3KTCA 4IH3A 2WB5A 1UH2A 1XDJA 3IEBA 1LG1A 2J79A 4XKMA 5G4HC 4QG6A 3GG8A 3MUXA 3VZXA 3CUHA 1EQPA 2Y63A 5BWFA 2XZ7A 3DBPA 3DERA 1C8XA 1H0GA 3SY1A 3LI0A 1BVWA 3G1DA 4YTSA 3MP3A 4EXQA 3QOMA 2VNCA 3M7WA 2FJKA 1QW8A 1DE5A 1SU5A 1T7LA 3HV9A 1TZZA 4REQB 4AD3A 1GYNA 2YJQA 1POKA 2VO5A 3WFZA 4HA3A 4LUTA 1H5VA 3M5XA 2IS7A 4GUHA 4DBEA 2PBGA 1UWSA 5AHMA 4NZCA 5CPQA 1OF8A 4GK8A 3U6WA 3PPHA 2O7QA 4FXSA 1JFHA 3CS2A 4C6LA 1J6PA 4LC6A 2V68A 4YYCA 4H6QA 3BMXA 1OFBA 1V7AA 1Z6KA 5DXXA 1E6SM 5KSWA 2BP1A 2E6FA 1ZBVA 3GU9A 3QW3A 1V51A 2BB0A 3DX5A 1XPGA 2QNEA 4D8ZA 2PP1A 3WSUA 3G1VA 1OD0A 3VNYA 3GU1A 2ZUVA 2BG5A 1QO2A 3WF0A 1X1NA 4IQEA 4EPDC 4RZBA 3T08A 1XLDA 4O14A 1XLMA 1S5TA 5D4YA 1R2RA 3TP4A 2OSXA 3RO6A 2YKKA 2ABAA 3UQNA 1QHPA 2IKHA 4WDXA 3W1NA 1CI1A 2FTYA 4TX6A 1WV2A 1S5WA 2GUBA 4N7QA 4M56A 1QTWA 1X7IA 1DPMA 3UWEA 3KL0A 1YMYA 4KS0A 4C6EA 4KWSA 3AUJA 1V03A 4W89A 4IPIA 2OWWA 2XFRA 3HFTA 3OYXA 2PDFA 1UWQA 1H5YA 1F8IA 3W7NA 4JYEA 3QPZA 1V02E 4AISA 4AU0A 4PCNA 4YHEA 2VTFA 2BVYA 3B97A 2HJPA 1N8IA 2QUUA 2DEPA 3LHTA 4G5DA 1SZEA 5IFTA 5HR7A 4UTJA 4UR7A 3SCUA 3K1GA 3A4WA 1EC9A 3VAVA 4Z2GA 1QJWA 2WW5A 3LPGA 3QY7A 1EPVA 1TV2A 5D05A 3R0KA 1PV8A 4RDYA 4FP1A 3PG9A 5D2VA 3AXHA 1REQA 5BRQA 3RMJA 5M3WA 1MZRA 5HANA 3OHIA 4GX8A 2PLCA 1KFEA 2G97A 1Z89A 1BD0A 3W25A 4PMZA 1HN1A 1FKXA 3C2EA 2WPGA 4DWSB 1LZOA 3EZ4A 3H4XA 3STFA 4F0LA 3ME3A 2PTYA 3AMDA 3DESA 2J7DA 4NYYA 3W2MA 2DUAA 1S2TA 4NRSA 3B3DA 1LQAA 2AMGA 3SN4A 3VD3A 1TFVA 1GK8A 1J4EA 1OX5A 3WBEA 4NZJA 5C9ZA 3OPSA 4HGXA 3LGEA 4GIYA 4ZFMA 3KTSA 3JRKA 3WZ0E 4DI8A 3TYCA 2OEKA 1SFTA 4XVEA 1J0ZA 3ANUA 1IXPA 3D3AA 1WDQA 2G3FA 3DFYA 3QYSA 3GLCA 1CCWB 2PDPA 1W5MA 3NYDA 6TIMA 4LYPA 1FDJA 6REQA 2Z2BA 1XLCA 3WNNA 3WLSA 3W71A 1JQVA 1PKNA 5AC5A 4H9TA 3VFCA 1EDTA 2CLKA 3LGGA 3E2SA 2IXVA 2RJGA 5BOEA 3B0YA 1E71M 4FNTA 1F76A 1LBFA 2ZA3A 2HS8A 4N4PA 3K4DA 3E2RA 3M47A 1L9WA 3WQWA 4Q8MA 4WQ6A 4LVDA 3ZFHA 4HOWA 2D24A 4DM2A 1XWYA 1JDFA 3BSHA 3TKFA 3PZMA 2QIWA 3F4WA 1AMYA 2DVUA 2GGJA 2OZ3A 3NPXA 3ZT6A 3N4FA 1QK0A 1GUVA 1OY0A 4EAYA 3NEHA 4KFNA 5HWNA 2H90A 1OG0A 2GJXB 2UY5A 3LY0A 2GDQA 2F61A 1XW8A 3G1SA 1YEYA 3HQ1A 2GJLA 1N8WA 3IJ6A 3MA8A 3NIYA 1IR2A 5BXPA 4E38A 3UFYA 1W3KA 2GQAA 4FALA 4UMCA 2WOQA 3VNKA 3ITYA 3CTTA 4XBJA 5D2TA 3ZVIA 4JIIX 3GHUA 4GWEA 4LB4A 1K7XA 1A49A 2CESA 2Q3RA 3CHVA 1C92A 1M68A 3FX4A 4H9UA 5DMNA 1GOIA 2PU0A 3W7GA 4PA8A 5FF4A 2YCJA 1W56A 5CZJA 3EX6A 3MS8A 4YMZA 4DF1A 3A47A 4R53A 2TAAA 4KRTA 4KGJA 3II1A 2D73A 4EP8C 1U5VA 4J27A 3UNTA 4NAEA 3WUFA 1DJYA 4MWAD 3WCZA 3GNRA 3WDPP 3VNIA 1JYNA 3SJ3A 4KFOA 3IJDA 3JU2A 2QCGA 1V3KA 4HSNA 1DWAM 1AH0A 1VJZA 1GOKA 2V38A 4CQBA 5EMYA 1R6WA 3QGKC 3N4EA 3F03K 2J4GA 1F73A 2W62A 3LTPA 5DCDA 4YU1A 2WMIA 3EKZA 1CECA 3OIHA 3ARTA 4CQCA 2X05A 3NZPA 1P6WA 3LU2A 3TLQA 2VRJA 3B9OA 2V3GA 4ALDA 1E5JA 2NXHA 3B8IA 1CGYA 1NIUA 3KOXA 3QMRA 3W1RA 2QDDA 2ZUMA 3EDKA 5B80A 1VBGA 2YBVA 3M46A 3E02A 4IGHA 3R8HA 3L7RA 4K3ZA 2BHUA 2WC4A 3FN9A 4HD5A 3IARA 4UOQA 4LBSA 1E51A 4Q8TA 2GFTA 5EFFA 4N4QA 1PWLA 5MF5A 4NJIA 4TR9A 1V6WA 4ZENA 3CAVA 2CWXA 2F9RA 3AROA 3LRMA 1Y5XA 4ZTXA 1TVPA 2E4TA 4PMJA 1EWEA 2HNEA 4L64A 3GHSA 1GVFA 3GX9A 1X7FA 3TYBA 3SFKA 2V5BA 1EA9C 3I6EA 1CXEA 5F1VA 2ZUNA 4PUWA 3S9YA 5DQPA 3STEA 5FEPA 3KRUA 1EJTC 3IJ9A 3TQPA 5DF0A 2ZWYA 4ML9A 3ABRA 2B81A 1WX0A 3UWZA 3C3NA 3WD2A 3EX1A 2KZHA 1AD1A 4B5XA 5AFDA 4DJDD 4LC8A 1HJWA 2WJZA 1EB3A 4AVFA 2WCAA 1XLEA 1OFAA 3L5LA 1LWHA 1YLVA 1YQ2A 1FXQA 2HE8A 2E8YA 1YDNA 3A6OA 2FFCA 3OBAA 3KBMA 2EKGA 4PEKA 2YW3A 4TX8A 5LHFA 3P84A 3ZO9A 3SIMA 1XSJA 2QJGA 4FNPA 4Q8NA 1J79A 3SECA 1OVDA 3HG2A 2ZZ3A 4ZB2A 2FFIA 4HT3A 3BPWA 1EZWA 2CHOA 2YCLA 4NZ5A 4PRWA 4YVPA 3WDQA 1JDDA 3MP4A 2Y24A 3IVSA 2CLLA 3C4UA 1VCFA 4JIEA 3QR0A 4CD8A 4KWVA 3EB4A 3G1AA 4TV5A 2WO5A 1PYMA 3LMZA 3HGJA 4H19A 3STGA 3ABSA 3T81A 5GJPA 3RMEA 3PJXA 4V1YA 1FFRA 3CWOX 1ENUA 3QLDA 1JUEA 3RHGA 1ISZA 1XIHA 5I78A 2WMKA 4XV0A 5DRIA 2ZKMX 4QRNA 4M5PA 2ZXBA 4JHOA 2WC3A 3AIQA 3KHJA 3NPUA 3DFOA 4WK9A 1Q6LA 4AUBA 2GDVA 5HA7A 3INPA 4W7UA 3NCOA 2FJUB 2PDGA 3A24A 2CXGA 5I7GA 5JH2A 3TC6A 4PMOA 1P7TA 2VD8A 1XYFA 3PF3A 1SR9A 3N3TA 4ICNA 4P8VA 4H04A 1UBSA 3A9BA 1E5NA 4W7VA 4FNRA 3CYVA 5A8NA 4J1OA 2C7FA 1QI4A 3S5ZA 1BQGA 3T9PA 2Q09A 2AQVA 1R3QA 3V75A 3E1F1 4OU1A 4UQEA 3CBWA 3MCOA 4IZGA 4H3DA 4AIUA 4RK8A 2O4QA 2EHHA 2REQB 2QIIA 2D2GA 3A5VA 3ZZ1A 4URIA 1CT5A 1JZ2A 3IAPA 2WVTA 4MLRA 1T8XA 3AHTA 3O1NA 1TZ9A 4NVTA 2BS9A 4H7ZA 3KRSA 4QM1A 2Q71A 4LTSA 4X3ZA 1P0BA 3F7JA 1H7RA 4WJEA 3V3WA 3I68A 1PEZA 3LPPA 3PUDA 1PXGA 5ENLA 4ZOCA 4JTCA 3N34A 1JZ7A 2BFGA 3TV8A 4GMEA 3BAJA 5D9MA 3W6LA 4ZQOA 1UWAA 4GPNA 3SCTA 4QS6A 4PMQA 2J66A 3VTRA 3LM3A 1Q4NX 4BQ3A 1R3YA 5J04A 1TJ2A 1R2SA 1FHUA 4ZBCA 1JULA 3TN6A 4X9SA 2AGKA 3VU2A 3UU0A 3L2IA 4HNTA 1C90A 2ADAA 3MSDA 3N4AA 1Z48A 3D5HA 4I9AA 3S1UA 2CZ5A 2EPNA 3Q65A 4FLOA 3KTXA 4S2BA 3PWAA 4G7EB 3LBOA 3FDGA 2Y70A 2V69A 3CUIA 1KBIA 4CLMA 3G0UA 1FX6A 1AL7A 1AMKA 4F0KA 1MXSA 1KC7A 3GVQA 3T0CA 1ISYA 1VQTA 2ACSA 3CLMA 3DGRA 2NUXA 1OX4B 3ZR4A 3QKEA 1ZCCA 2VRKA 1W5NA 2J7HA 1R5YA 1JXKA 3P5ZA 4Q7BA 5XIMA 3CUGA 2V5CA 2R82A 1VFFA 3IJ8A 1GHRA 1K7EA 1ZBKA 3G22A 3ITLA 1FQ0A 4N0RA 1RLDA 4Y9OA 5LHEA 1U5JA 2DSVA 4K8HA 3GH7A 1QHOA 2WVSA 4AIOA 3WK2A 3I3BA 4ATWA 4TVDA 3AFBA 3VIJA 3VMOA 4G6CA 2ZWZA 4K37A 2JGYA 3BV4A 3POCA 5J5DA 1E0WA 5GVJA 4PYSA 2PGRA 2ALRA 2ZZ2A 3AQUA 4AW7A 2C15A 1F9CA 3VNDA 1SO4A 4EF9A 2VEFA 2RHGA 5FI8A 4CVUA 3GNDA 3W24A 3WUEA 3G77A 2GVGA 1TSIA 2OT0A 1FRBA 2CLIA 3EMZA 1YE4A 2OKTA 2E6YA 4XD3A 1N55A 3NG3A 3NQEA 2XH4A 2HQAA 4AHQA 3LM7A 1XL9A 1VD6A 3P67A 5A6SA 1NAL1 4AEFA 3MO7A 2WNZA 4S3KA 1B3OA 2GSHA 4J35A 4LOCA 3LG3A 2XJ7A 5CXPA 2VC6A 1U1JA 3AISA 2CZEA 5IBXC 2F84A 3OLGA 1US2A 1VLIA 4TIMA 4E3VA 3M0KA 4QCEA 4PRRA 5ECVA 4W87A 3F2BA 1CW2A 3BLKA 1RBLA 5C9UA 5DT5A 2G41A 2QQ6A 1OGSA 1FY6A 1W54A 3G8RA 1XINA 3HG5A 4FLRA 1X39A 4DEFA 4Z0SA 2IUZA 7A3HA 2W61A 3GO2A 4QEEA 2JK2A 4JYDA 3EWUA 3RLVA 1J2BA 4OQVA 5A6TC 3B9DA 1JGIA 3RM9A 3GG1A 4BQ2A 3A22A 5HNTA 2IQDA 4UNKA 3MB9A 4UTWA 4IXXA 3EX4A 3WDJA 3QHMA 4W8LA 4XBKA 4HNCA 3UVAA 1E0XA 1XX1A 4UQBA 4JKKA 1W9DM 3N6QA 3ZMRA 7XIMA 3AYSA 1OSEA 2JKAA 2WKJA 4AZGA 3TYDA 5IBXA 4LU0A 3ARPA 3GNOA 1S2CA 3DG7A 3CIWA 1UROA 1CX9A 5ABFA 1WDSA 4C6BA 3K4AA 3AIRA 3VD7A 1XG3A 2KX9A 3AYTA 3GTHA 2YZ5A 2G96A 4EK7A 1UKOA 4UOZA 4LUYA 4IQLA 5HWJA 3P60A 3CHDA 3IJLA 1SW7A 1JRBA 1KXQA 2BVTA 4LALA 4EXAA 2XH2A 3SDOA 2VC5A 1Q5MA 5IOBA 3QQ1A 3M44A 2WJEA 3BLDA 1V6YA 1JPKA 5E93A 4PFHA 2EO7A 1V3MA 4PFMA 3LN3A 2PSNA 2YLAA 4JR5A 1GEHA 1FWFC 3KUMA 4MJMA 4PTWA 1UR0A 3SY8A 2RAGA 4XUYA 3EWYA 4FF5A 5AYBA 4FHAA 7CGTA 2HV5A 1LCOA 4LFYA 1CENA 2LLEA 3ICJA 3L12A 1G4PA 3KVKA 1WCGA 1ME9A 2AAMA 3OVQA 1J8VA 3FKRA 1UOZA 1EIBA 3TXVA 3QKZA 5FJTA 3OGSA 1KFJA 4N02A 1OWQA 4HPNA 1TPDA 1E6QM 1TPWA 3GE7A 4HNVA 3BGGA 3MKCA 2A3AA 2VX4A 4WHBA 4JIQA 3TJIA 2ZVRA 3FYYA 1QW7A 5JIWA 1UUQA 3I4KA 4LF2A 1M1BA 3R94A 2A85A 3ALFA 1HP5A 5ABHA 3IVTA 1TE1A 4PSRA 3N2TA 3H4WA 5CLWA 3A3WA 1XUZA 1F6YA 2BXVA 1XDLA 1S2UA 3TCSA 2PDKA 1G1YA 1P6CA 3FGCA 3UGRA 2PTDA 1OT2A 1J5SA 1KBKA 3ZLFA 1IHIA 2PTZA 3SADA 1XLLA 4GQQA 1MNZA 1DP0A 4F2UA 2J8TA 3T2OA 1XXXA 2EG7A 3TR2A 4MY1A 1OCNA 1ZPTA 3EWDA 4DWSC 4LV9A 3WLOA 2G3IA 1X6NA 3CH0A 3FJ4A 1UD2A 3OG3A 1UD8A 4NASA 2QKFA 1VRXA 3T4CA 3H7UA 3RU8X 4AY1A 1OF6A 3WJWA 3QZAA 1J0KA 2FTPA 4AWSA 2A3EA 1XYBA 4GACA 4IOTA 2FZNA 1H62A 4WUIA 1GJPA 3GC4A 3OTRA 2EPOA 4J2PA 5C7HA 1T41A 1E4MM 2B7QA 4GFSA 4GH1A 1JQXA 4YTTA 5AHLA 4XAZA 2J27A 2ZZ6A 3L67A 1DQUA 1B9BA 1S5NA 4M6VA 5HUOA 5CSYA 4XIMA 1H4PA 3G1RA 2XWEA 3EKGA 3W7RA 3PAJA 3RLHA 1Z7AA 3RIKA 5I6SA 4OOUA 4LCRA 3NQAA 5DY2A 4CQ8A 2QLYA 1MQPA 1R47A 3MZNA 1GQJA 1WKFA 2D1ZA 4QLKA 1R30A 2DZSA 3GRIA 7TIMA 4H41A 2R1LA 1SW3A 4O10A 2EPKX 3FJLA 2W5FA 3U3HA 3MSRA 1NF0A 3P81A 1L6WA 2X0SA 1HNYA 4ZMGA 1TWDA 3FA5A 1BWLA 3GW3A 3WH6A 2X16A 3WQ4A 4IQJA 1AJZA 1TR1A 4CN6A 1K9DA 4XO6A 3UR7A 3PZTA 5IHRA 5LNWA 3M07A 1IV8A 2YBUA 1NOFA 4R27A 1S1PA 3LDVA 2X41A 3T0DA 4GABA 3HM7A 2ZXAA 4FXJA 2GK1A 4JY9A 3LZ5A 2QJIA 3R0DA 3VCNA 4HHPA 1DJWA 1ISWA 2G50A 3MI6A 7REQB 4FF7A 2VM8A 3LHZA 3MUZ1 1TYGA 1OFOA 1XLIA 2NZLA 4RKAA 3P14A 2CLMA 1MMFA 2WNNA 2PDHA 3HPFA 1XCWA 4WRHA 3MSGA 4JTIA 3N6HA 3U4AA 3BLLA 3M6YA 1NDYA 1UJPA 3ZWTA 2Z1SA 4JFVA 1B4KA 4MWAA 4JX4A 5AC6A 1E1CA 1NP2A 2VEPA 2IXUA 3SW6A 4KW2A 1L0PA 2O56A 3KCOA 1GHSA 2J8GA 1P0NA 3JW7A 3LSBA 4P5UA 1V4YA 5C5YA 1ICPA 2VXNA 2E3ZA 2CLFA 4HCDA 4AVNA 2ZRZA 2NLIA 5A8MA 3GR8A 4JYFA 1W9XA 1OC6A 3BCFA 1WPCA 2W4XA 5H1WA 1P0DA 2DQXA 1V0LA 3PBGA 1DJHA 2C6QA 3W73A 3A3XA 3IRSA 5E0KA 1XR2A 3VOCA 3LHYA 2WV8A 3UY7A 3WIJA 2WXDM 1JVNA 1W1VA 5REQA 2QPXA 4Q7NA 4NZ1A 1JDEA 2JIEA 2PUZA 1O94A 3SCNA 1UZDA 4RZ4A 3BQ5A 4JN8A 3VUPA 4M6PA 3VZZA 1W6TA 4JL2A 2Z26A 4PUNA 3HPZA 1X98A 3UBPC 4Q8PA 1XHGA 3O6DA 3N04A 2CKRA 4WCJA 1OZQA 2E5BA 3VMPA 3TU9A 4IQDA 1WOBA 3MCNA 3C61A 2PWUA 3P80A 1V77A 3E2VA 5DEZA 1PX4A 3O9NA 2BDQA 3GR4A 1JDAA 2EEXA 1CGTA 4LB3A 1RCOB 1K9EA 1VJSA 2PGFA 3Q58A 4WSJA 5D9NA 4PUMA 3ZR6A 3GTXA 3AHXA 4KEVA 3T07A 2V67A 2WHKA 1OADA 4A3QA 1Z44A 2ISVA 3AHZA 1O95A 2QAFA 3G2GA 1S38A 3RG6A 4FR1A 4R7OA 5BRBA 3CHCA 1X38A 4DJDA 2VOTA 3SN1A 2V2CA 1O1HA 5FF3A 4L9XA 3FDKA 3VIFA 1BSLA 4W86A 2XVGA 3N18A 5JMUA 1UKQA 3WL0A 4ATLA 1TA3A 5BOFA 2TMDA 2YCIX 4IFRA 2OOGA 1BYDA 2PFHA 2QULA 2X40A 1H3GA 5FJRA 3VD4A 3JZEA 3CUFA 3AWNA 4CN1A 2CHRA 1HL8A 2Z1VA 3W4RA 1AW1A 1PZ1A 2NX9A 4QNWA 3ANVA 2PRLA 2DZPA 1AQHA 2XGZA 2YFNA 2XN2A 4W88A 4CGTA 1HJSA 1LF1A 2DT0A 1OINA 1XC4A 1VP5A 1IEIA 2OLAA 1J18A 4QQ3A 3W01A 1R87A 4W9TA 4HYWA 3M5YA 2VENA 1TELA 4LAMA 2QPSA 3V5OA 1LOQA 3AS1A 4DX3A 2P5NA 5K7JA 3AOFA 3W0KA 3IGSA 2BY2A 1LQ0A 3H12A 4HNLA 3T55A 4NL1A 3E0IA 3QBUA 2GQ9A 3H53A 4LPCA 4AH7A 1O12A 1OYCA 1IWAA 3COTA 4Z1CA 2F2KA 1IZCA 4F0RA 4FOJA 3R0UA 2BOFX 1I2QA 2YA2A 3L4TA 5CSSA 6ENLA 4B5TA 2OT1A 2A79A 4AZCA 3ES7A 2C1GA 3ITGA 5H2ZA 2V3FA 3BWWA 1G4EA 1YIXA 4HMCA 4CVWA 4IIFA 3ID7A 3GTFA 1DIKA 1LT8A 3MU7A 1ZENA 3KLLA 4MKVA 5K9CA 1ZJIA 1XCXA 4LUJA 4NX0A 3VIKA 2I9UA 1IQ8A 3E12A 1NWTA 5HNNA 3VKBA 2VGGA 2JBMA 1GVRA 1OHLA 3P74A 1H49A 2J24A 5LA0A 4C6DA 3T4WA 3VOJA 2D0HA 4PMUA 3W37A 2J8FA 3NL3A 4WSHA 9XIAA 1TB3A 2Y0FA 3N17A 4BA0A 3BOFA 1B3YA 1MW2A 3ERPA 3C3UA 2VZSA 5LNSA 1OQFA 3A5FA 3ZQ9A 3DC8A 1BPLB 1LL4A 2QV4A 2GVYA 3S2MA 3EWCA 1H63A 4WX2A 2G95A 3EA2A 4EE9A 4R9OA 3IIPA 1DJXA 1TR9A 1DJIA 4S3EA 4ZCWA 3PBVA 1FKWA 5JU6A 4MY8A 4WIWA 1JIBA 1KM6A 4ZE4A 1KKRA 1RV8A 3DU0A 4KIEA 4QJ4B 4Q8VA 4Y8EA 3L9CA 2YGYA 3IK4A 3WLNA 1C93A 3A3HA 4IMFA 1V6UA 4XAPA 2DSKA 4UFIA 4E2OA 1XBZA 3C52A 2R1MA 3MDUA 1TUFA 5D33A 3PZVA 4JQ3A 3VGBA 4ZOBA 3EXTA 3GG0A 5AHFA 2Y6ZA 3PZGA 1WBJA 2AQOA 3XISA 1HJXA 2ZADA 5AY7A 4RW3A 4IPPA 3EX3A 4D6JA 1OM0A 2C14A 3BMWA 3ENLA 1JZ4A 2VFEA 3G3MA 3QSTA 5CJ5A 3T78A 1W1A1 3A64A 3HG3A 2YPIA 2X8RA 4KPLA 4R7JA 4DBSA 2QS8A 3ABOA 4DF2A 8A3HA 4LVGA 2VVSA 2WVUA 3V4BA 2ZRUA 2E9LA 4GGHA 1TWZA 4OBTA 1MRQA 3NDYA 3O0FA 1EBGA 3SGGA 3PFMA 1WZLA 4ZO8A 4CD5A 5LSMA 2CFFA 1GVEA 2W79A 1FTXA 5BNKA 4MUPA 4C1NA 2CYGA 2BY0A 3WD0A 4UFMA 2XYLA 4B3LA 3CHFA 2E7FA 4OGZA 2WAGA 2PD5A 4J3TA 3ITTA 3APGA 2VEIA 4W85A 4A8LA 4XZHA 4OFCA 3LCGA 4KGLA 4AYGA 3RPMA 3F5LA 1UC4A 3WQEA 3ALGA 4OZOA 1RD6A 1FWWA 4LH8A 1Q2RA 1Q6OA 2P1FA 2XFWA 3B40A 4P61A 1B9ZA 1ZL1A 1W3NA 4JDYA 4D71A 5I09A 1C9WA 3B03A 2P53A 1TO3A 2E5DA 4PCTA 4Z1BA 3P6LA 4P7QA 1KRAC 2Y61A 1GTEA 4GG9A 1VZWA 3KBWA 1W9PA 4B9ZA 4FXFA 2IPJA 1QDSA 2J7GA 4PMRA 1EA0A 4TTUA 8CGTA 3P2VA 3ZVHA 2W63A 3S8HA 4W4QA 3DDMA 4V33A 3W2UA 4ACZA 5EU9A 2HPIA 3KP0A 1G94A 4DQWA 3EWZA 4B3KA 1XPYA 1NFPA 4F9JA 1EDQA 1NDZA 1ZJBA 1NFGA 3W1QA 4DXKA 4W5ZA 4DI9A 3TW6A 2QUVA 3D46A 4F9DA 4QFUA 4GUGA 1HL9A 4I9TA 1MXGA 3TAOA 4HMDA 2JKEA 1C8VA 4DJFD 1BKSA 4AB4A 2DZAA 4XAGA 2DGAA 3LTYA 2YXOA 1SMAA 1K9FA 1XLKA 5A1AA 4GIAA 1JJKA 1ODUA 4NNBA 1GVQA 4ZA0A 3OIXA 4GY7A 4KCVA 1SZGA 1FWDC 4D6EA 4P7LA 3S3GA 5EBAA 4AD5A 1HXJA 1V0KA 3C2RA 1QPRA 3S1VA