3W07A

Atomic resolution structure of orotidine 5'-monophosphate decarboxylase from methanothermobacter thermoautotrophicus bound with ump.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Atomic resolution structure of the orotidine 5'-monophosphate decarboxylase product complex combined with surface plasmon resonance analysis: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 83
structure length 215
sequence length 215
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2012-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w07A00
3BPWA 1X1OA 3B8DA 3MI2A 1T99A 3IGSA 4OU1A 2DORA 4DO6A 3A5VA 4N6EA 4UFMA 5CG7A 4DPQA 1R2RA 1O4UA 4CCDA 4N2YA 3LCHA 1KA9F 4PL1A 1QPQA 1VYRA 1MEIA 4HKPA 4DELA 1VS1A 3G8EA 4AMAA 3HG5A 3S6DA 4GNJA 2QCNA 5DXYA 3NQVA 1KBJA 4TIMA 2WNQA 1LBMA 4KWWA 3BO9A 1KM0A 4M7SA 2FPTA 1ALDA 3OA3A 4R34A 1G69A 2GJNA 1Z48A 3HG4A 2VFGA 1OVDA 1XXXA 2QJIA 2J27A 3G1YA 1ZENA 3LXBA 1K03A 3M16A 2EHHA 2A4AA 5LHFA 3MP4A 4C1LA 3PBYA 4LV9A 4ZL1A 2XN2A 2ZZ1A 4WZHA 1AL7A 1G4PA 1F73A 2YXGA 3HJZA 1DVJA 4BI6A 3EX2A 3P61A 3OBKA 3GDMA 3LTYA 2DZXA 4M19A 1I4NA 4CQAA 3P67A 1YDVA 1JCMP 4WXYA 4K7YA 4JD4A 1F2JA 1FDZA 4ONVA 5F4XA 3TJLA 1OFEA 1XBYA 1YADA 3R13A 3W7PA 1OYAA 3W23A 1FQ0A 3IIZA 3M5YA 1KBIA 1KM6A 4LS1A 4E38A 2FFCA 1R46A 4S2BA 4O8RA 1WX0A 3W1XA 3C2FA 4BWLA 1OX6A 3PM6A 1OYBA 5HUPA 1JCNA 3G24A 4GC4A 4CCEA 3DFOA 1WOAA 4JTJA 3TE9A 1FCVA 1F5ZA 1DQWA 2JBMA 5K9CA 3JRKA 4UTWA 3M9YA 1GTHA 3QSTA 1K7FA 1ADOA 2Y7DA 3DZ1A 3W1LA 5KZDA 5L6UA 2Y70A 3A23A 3W7IA 1C9DA 3SECA 1TTJA 1TPC1 1RZMA 2DJLA 1JCYA 3NOEA 3K30A 3PBUA 4IMDA 3P74A 4LTSA 1VYPX 4O0ZA 4LW7A 1PIIA 3GDLA 5DCEA 3WJXA 2Y88A 3Q37A 3HGOA 4UTLA 3W1AA 1ML1A 1KM1A 4IMFA 1S3HA 4PEKA 5D37A 1H50A 3PR2A 2J9ZA 5HR6A 1KFJA 1A53A 1DBTA 4MYXA 4UTKA 1W5MA 3CIWA 3BVJA 4UTMA 3DU0A 2NUWA 4LRTA 2Q3RA 2QF7A 4O4WA 4K36A 4HT3A 4ZQOA 4AXKA 4N9CA 3TV8A 4NJHA 3UD6A 4O17A 3NAVA 1OK4A 1XDMA 1SFLA 2ABAA 3W2KA 2VEPA 3OVPA 5G1YA 2F7FA 3EX1A 2EAWA 5IBXC 5DY2A 3BG5A 1Q6OA 2YCEA 3O6CA 1ZAJA 3EX6A 1GPWA 5F1VA 2QJGA 3CEPA 3QF0A 3N34A 3PUDA 4DO5A 4UFKA 3LCXA 4FIQA 1YTDA 3P81A 5LSMA 3W7EA 3TROA 1PVNA 2JGYA 3NEVA 4RZ5A 5AN7A 3CQ0A 4ZQMA 1DJNA 3GNDA 1H62A 1W8SA 2CZEA 4RXGA 4CNNA 2TPSA 1MZHA 2FIQA 3R5EA 3TMQA 2QCGA 3ABOA 2W79A 3NL2A 1D3GA 5LNRA 2HS6A 5FEPA 1U5JA 4O14A 1I45A 3NR0A 3L2IA 5T26A 1VC4A 5TBOA 1LLWA 2RKXA 1Z42A 2E77A 2VXNA 1KFCA 2YDAA 4O53A 2NV1A 3E12A 3I65A 3WFAA 4JTLA 1VHCA 3P5YA 4WQ6A 5D2YA 4RJEA 5EPDA 1KFBA 2VC6A 3HPXA 2A6NA 1J4EA 1Q6RA 3BG3A 4JIPA 3R2GA 2RH9A 3TU9A 2ZQ0A 3QMTA 3STFA 4FB7A 2B0MA 5KITA 3I6RA 3HQ1A 1K8YA 1ZNNA 5AC7A 5LKYA 4N9DA 4PC8A 3KVMA 1QAPA 2VEIA 2WQPA 3UPBA 4TMBA 3HPZA 3LGEA 2ABBA 3KFTA 1RQBA 3GAKA 2CZDA 3WJSA 4O19A 2ZTKA 2QDHA 2R91A 5HINA 4I9AA 3TW7A 4Z1CA 3ABRA 1F05A 3NQAA 4M7TA 5G5IA 2Y61A 1YDOA 1Z44A 2OMAA 1OF6A 3IIOA 1OFQA 4JR5A 1JUBA 5HNRA 1IIGA 1M7OA 1TSIA 3TC7A 4EVZA 1RVGA 3PWAA 1PL9A 4A21A 4CNOA 3SGUA 3W7DA 3QW3A 3NG3A 3I7QA 4N9BA 5HULA 3NQEA 1UUMA 3L0NA 3W7NA 3C52A 4QM1A 3BLEA 3KRUA 5CZTA 2QCCA 1ZY9A 2A7RA 3FKRA 1SSDA 3I7SA 2A2IA 2JKAA 1GEQA 1H7XA 1W5NA 1LDCA 4FNQA 4PL2A 3TJXA 3L9CA 1KM4A 1Z41A 3LDVA 4Y8FA 4UIOA 1MEHA 3C8FA 3C3NA 1LRTA 1FX6A 4WY0A 3GX9A 4RKAA 1MO0A 3NL3A 1TPH1 5J5RA 2ZRVA 3L5MA 3GDKA 5E0KA 1S5WA 5AHEA 4W9TA 2Z2UA 3WK1A 4IJBA 4OHQA 2Y7EA 3UXDA 5I3GA 2Y7FA 2GQAA 3KX6A 2YSWA 2ZRWA 2ZZ3A 3W87A 2NXIA 2OJPA 4WOZA 4XKYA 2XFWA 4NNAA 1S5VA 1RD5A 1OYCA 1I2PA 2X1SA 2H90A 3LHTA 3TUUA 5DELA 3LHYA 3W83A 4IWWA 3NQ7A 1LTDA 4XWUA 3G1SA 4JTIA 3TSBA 1W3IA 4JYDA 2I1OA 1FXPA 1TQXA 4IOTA 3TQVA 3NNTA 2QDGA 4JTSA 4UTTA 4NJIA 2C13A 1AW1A 3L65A 4NXSA 3GXNA 4N9EA 1SU5A 3AO0A 3FEMA 3W73A 1TV8A 2V2HA 3C61A 2H8ZA 3QMSA 1JCLA 1GYLA 1ZALA 4UTIA 3Q94A 3F03K 3DFNA 1KM2A 1EB3A 2C15A 2J24A 2VFIA 5D30A 4O52A 2A6LA 3P60A 3S8HA 5KZMA 4HSNA 1F6KA 1A50A 4JX5A 1DORA 5EY5A 1LROA 1F6PA 4M5PA 1T96A 1GG1A 4Z1BA 4OV9A 5K9DA 3P5ZA 1EP2A 5D38A 4MJMA 1KV8A 3W84A 3MI3A 5G2WA 2FB3A 4RZ4A 3I68A 1W3NA 2DZSA 1FWRA 2E09A 3CEUA 3Q2DA 3M5VA 3M5ZA 4IMEA 5I3KA 4QNEA 3TH6A 1TJRA 2WSYA 4G1KA 3W1NA 3PSVA 1JR1A 3S0CA 3LHVA 3SSJA 3M6YA 3BGJA 3KRZA 4MYAA 4Z0JA 3HOJA 5D02A 4QISA 3VKJA 2V5LA 3VNDA 2VFEA 4XUGA 3S1WA 1D3HA 3S5NA 5K4XA 2X1TA 1DKWA 4AWUA 3LI0A 4Z1AA 2AGKA 1MXSA 2NUXA 1RR2A 1X1ZA 4DBDA 4K8HA 1GG0A 4AF0B 2QJHA 2V8ZA 3GLCA 3G22A 2NUYA 5FF0A 4DQWA 3O1NA 3I7RA 5DLCA 1EUAA 5D2XA 2G95A 4O1DA 2C19A 4Z1DA 5LNVA 3BG9A 4J9JA 3W1QA 2BWGA 4XBKA 1O60A 3D0CA 3L67A 3UYCA 3QYQA 2E5DA 1OX4B 3OIXA 4P2VA 1SZGA 4O1CA 1GOXA 3PG9A 4MLJA 2WNZA 2JKPA 4OWGA 2AAMA 1TV5A 3TW6A 2ZDRA 1H7NA 5F1UA 5CKSA 4IPJA 3UQNA 5D2WA 2FPVA 3WK0A 3GNNA 3UWZA 2ZRYA 1SW3A 1HUVA 3QW4B 3TA6A 4UMAA 1T8XA 1QR7A 1NSJA 2TYSA 1AL8A 1EIXA 3HB9A 2QUTA 2DP3A 2DZVA 2ZA1A 5I3JA 3P84A 3F4WA 5KTLA 4HNUA 1K8XA 1AW2A 1O94A 3E02A 1NVMA 2HSAA 3W1TA 1KM3A 1H7OA 1OK6A 3LHZA 3BLIA 2YYUA 4K37A 3TCEA 3LM7A 1PHQA 2YFOA 3MHFA 1WBJA 2LLEA 2RDWA 2A7PA 3IGXA 1ICSA 1H1YA 1L6WA 2Z0IA 3O63A 4PFMA 3W75A 3KRSA 3BV4A 1E51A 1Q6LA 2C16A 1IXQA 1P0KA 2B7NA 1YTEA 5DY3A 1AK5A 1G67A 2HTMA 4DF0A 3M7WA 3LBCA 3MJYA 4QIUA 4BI5A 1QO2A 1FDJA 2W6RA 4D2JA 2FTPA 1J2WA 1UASA 2BZNA 3NZ1A 3G8RA 2A7NA 3A21A 4TX9A 1PCKA 4M6QA 3HG3A 4NT0A 5LGZA 5BRBA 1K02A 1WDWA 3R89A 1WV2A 3C6CA 2RFGA 2CLHA 1KFLA 1QFEA 3PVFA 3O6DA 1WYIA 3W1MA 4M6PA 4O28A 2X16A 3NPUA 5F2LA 4UR8A 1A5SA 1THFD 2XN0A 3JR2A 4LVDA 3DFQA 3NL5A 1Q6QA 3W7RA 2PRHA 3GIYA 4L4LA 3IVTA 4N4PA 3W7GA 3TFCA 4FXRA 3TNOA 2C0AA 4U28A 2X30A 2C1HA 2V0TA 3U6WA 2CLOA 2Y85A 3G0UA 3WK2A 3IIVA 4I7WA 3LI1A 5CPLA 1HTIA 1OFAA 4HIBA 4C1KA 1FWNA 2QR6A 4RLIA 5I3IA 3B0PA 2H6RA 1ZJIA 1H7RA 4HPJA 4PTNA 1IXPA 2ZTJA 3G0XA 3T78A 3TQ0A 4MKNA 1JCJA 1JRCA 1QPNA 4DEFA 4QJ1A 3A24A 4WX2A 5FEXA 1PHWA 1TPFA 1X7FA 1B3OA 4I7VA 3B4UA 1OF8A 3W76A 3C2VA 3PBVA 3LHUA 5KZEA 1FCBA 2QUVA 3HG2A 2GQ9A 4KFNA 3W2MA 3BGGA 1SO5A 2BXVA 2G5WA 4JICA 1VPXA 1TTQA 2ISSA 4KWVA 3DHDA 1UB3A 4UMBA 4S1FA 4ALDA 3SR7A 3HBLA 4DXVA 5FEWA 4ADUA 3NQMA 5BMXA 1VRDA 2CFFA 2FDSA 4PH6A 4YL2A 5U7SA 3T55A 1HFBA 5C54A 2BLEA 2ZA3A 3TMLA 3W1UA 3M41A 4A22A 2ZRUA 2VELA 3GXTA 2PRLA 3LTPA 3TXZA 4TR9A 2CZ5A 1YXYA 2GJLA 3LV5A 1B9BA 2QKFA 4WUIA 3O05A 3FJ6A 3TKFA 3W07A 5K9XA 2CZFA 4YWIA 2FLIA 3O15A 3P8JA 1JVNA 4O57A 2VKZG 1KV5A 5FI8A 1SO3A 3ATZA 3M0ZA 4K7VA 1W5PA 1DOSA 1QPOA 1PE1A 2ATMA 4JX4A 1ME7A 1L6SA 1OFOA 2B7QA 5BNKA 1XL9A 1OFDA 1SR9A 3NA8A 4DF2A 2A0NA 3C2RA 4CCCA 3GR8A 1PS9A 1EWDA 3NYZA 4K6AA 1J5TA 1YPIA 1W5QA 2W0UA 2QCDA 4OT7A 3TC6A 1GT8A 1BTMA 3S1VA 1AMKA 1XM3A 4AHQA 5AB3A 4UMCA 1XUZA 1W37A 4GWEA 1JUEA 1EEPA 1UJPA 3WJYA 3QQ0A 2WKJA 1AW5A 2QEZA 2RHGA 3LB0A 4PODA 1BWKA 4ZQNA 2KZHA 4OQVA 1IF2A 5D05A 3UNDA 1QCWA 2ZCGA 1KLYA 4CLMA 4FNPA 5H2ZA 3SFKA 2NZLA 2HMCA 5HJLA 1LBLA 2ISVA 4ZVJA 2CLMA 3N2MA 3PAJA 4Z0SA 5G2HA 4H6KA 3W1PA 3DGRA 3GDRA 5CPNA 3A9IA 1B4KA 4FNTA 1W3TA 3QC3A 3FKKA 3GVGA 1NF7A 4O12A 3P8IA 4UC5A 3TR2A 4Q32A 5I3HA 3TDFA 4H3DA 2OX1A 2H3DA 3DKLA 1LORA 2EPHA 4LC8A 5K7JA 1VCFA 2Z6JA 1H7WA 4ICNA 3W22A 1O5KA 3GB6A 2DZWA 1TYGA 3E0IA 1QOPA 4UXDA 3IVSA 3LCGA 2J9YA 4I7UA 2FPYA 4UTHA 5CZJA 1OG0A 3SY5A 2ATSA 1HO1A 3RK8A 3UWVA 3HIJA 1DQXA 3IRDA 3W72A 3ZWTA 3H53A 4MY1A 2QCFA 5G2IA 1VJIA 3JS3A 4ZQPA 1TTPA 3CM4A 4WOQA 2FB2A 1G6CA 4FO4A 3S42A 3M43A 1QNVA 1TPWA 2WO5A 3IGUA 3OVRA 3EB2A 5DXXA 3FJLA 2GPTA 4NNBA 1TO3A 3QM3A 3RLUA 4MLRA 2Y7GA 5BOOA 1FXQA 4O10A 3U2OA 4E0CA 2EGZA 2AQWA 1H5YA 1XDLA 1LBFA 2C3ZA 4WD0A 4JDBA 4RX0A 2WSRA 4MOZA 3PSWA 3HGSA 4GBUA 5DCDA 1YXDA 3L68A 5F2IA 4Q33A 5LNWA 2R94A 5EBUA 3F1QA 1ME8A 3S1XA 2PRMA 3LTSA 1DJQA 3W2NA 4KFOA 4UTUA 4XKYB 4LS2A 2EF9A 2E5CA 2E1DA 4UR7A 5DN1A 2NX1A 4GFSA 3THQA 3DENA 2VEMA 5CSRA 5FEZA 3ZS4A 5A5WA 2A5HA 4YCOA 1GQNA 3IIPA 3PB2A 4GE8A 5FF7A 1IXNA 4A2SA 3G1DA 3N73A 3V1PA 2G96A 1DL3A 1YLVA 4K8EA 1YTKA 1GVFA 4Y9AA 4JS3A 1ZHAA 3R8RA 1LLZA 4Y96A 1I2QA 3MHGA 1B57A 2ISWA 1VZWA 2NWSA 2YW4A 4RXFA 4CNPA 1F74A 4JY9A 5G4WA 3NQDA 2NWRA 3NGJA 5AC6A 2TRSA 5CZ0A 1NAL1 1VHNA 4NQ1A 3DHFA 3WJZA 1G7UA 3TX9A 4LNYA 5AHFA 4LVGA 5I3FA 5K4ZA 3UWYA 3B03A 5E93A 3HMJG 3QQ1A 5AHMA 2NX9A 1FBAA 1KW1A 5AYXA 3W1RA 4HSOA 1SZEA 3N3MA 4BWLC 3N19B 3LLDA 3LERA 3LCIA 1TPVA 1TREA 4X9SA 4R53A 4A3UA 3KVJA 3VCRA 4AB4A 4UFLA 4CQ8A 2YYTA 1ZAHA 1O95A 2B7OA 3CIXA 3LCWA 4UTWC 1EWEA 3W7LA 4LT9A 3B0UX 4AHOA 4X3ZA 3S5OA 2V2DA 2Y63A 1A5AA 2A21A 4NJGA 4QQ3A 3W86A 3LRLA 1H61A 1OABA 3M1ZA 4FF7A 2NXGA 3W7MA 3G1VA 5C6MA 4K38A 3C2EA 4K39A 4RV8A 2I9EA 4UFJA 1P4CA 3TXVA 4Y90A 4QITA 2HS8A 4IGHA 3FS2A 1LOLA 3FYOA 1YYAA 4OBTA 3UPWA 4JDYA 1IGSA 4LOCA 1ICQA 2V82A 2VEKA 3LXAA 2ZRXA 2WPBA 3BW2A 1D9EA 5HWMA 3N9SA 4UFIA 2V81A 3QPYA 1K7EA 1W54A 3L0GA 4WXZA 1I2NA 2DZUA 1SO6A 3FLUA 3NL6A 1TPB1 2GVLA 1WOBA 3G18A 2NLIA 5F2GA 1TPUA 1N55A 4A29A 1QPRA 1H1ZA 2JGQA 1TRIA 1XI3A 1LP6A 1LRQA 5TIMA 5L9FA 1LRNA 3EWYA 4MZYA 3S5YA 4LUIA 3LOTA 2P10A 2Q3OA 4LVAA 1H63A 5DBUA 3GZ3A 4JTHA 4AH7A 4UNLA 4O1BA 3LXCA 3PB0A 5EA9A 3EXRA 1W56A 4UCGA 3W88A 1A5BA 2J88A 3NPXA 5D32A 3LRKA 3LRMA 3VI2A 2A85A 4O18A 5D2VA 1BWLA 3OVQA 3SZ8A 5AYZA 4WJEA 5LGXA 3O07A 5LNUA 3GR7A 1ME9A 5LZLA 4E2BA 2Y6ZA 4OV4A 4AEOA 3UWUA 1SSGA 4BR1A 2OZ0A 5F2MA 4EWND 3N9RA 1KFKA 2CLEA 3NZRA 4LVBA 3Q58A 4PCFA 4BK9A 3UWWA 2OT1A 2ZFAA 4PA8A 4LWWA 3BLFA 2ZZ4A 2E5BA 1GVRA 3EX3A 4M6VA 1OX5A 1P0NA 5IBXA 5G1TA 5D33A 1SZFA 5IM51 1RQHA 1EX5A 3G1XA 1TIMA 5AFDA 3ATYA 4ZQCA 1HG3A 4DO4A 2QCMA 4FNSA 3EXTA 2BSLA 3OEXA 3LLFA 2P1FA 2B4GA 5KSWA 1LCOA 6TIMA 3W2LA 3MUXA 1KM5A 1MEWA 1W0MA 3SGZA 3W74A 1G4SA 1OFRA 4EIVA 3UZJA 1V5XA 3CPRA 3R12A 3MHUA 3W7HA 1R30A 5CSSA 3INPA 3NQ8A 1LZOA 2I14A 1CX9A 2P0OA 3PC0A 1MSSA 1S5TA 2X1RA 3KHJA 4O0KA 1RV8A 1HO4A 3M44A 1FDYA 4UNKA 4AF0A 4H4IA 3HO8A 4RK8A 2B7PA 3B06A 2G97A 2QCEA 5G4EA 1WQ5A 5FESA 1K7XA 1XFBA 5CZSA 7TIMA 5D2TA 5DBTA 3DI0A 2VOMA 1OX4A 4JTGA 1SZNA 2GVJA 2ZBTA 4O1AA 2BX7A 2DU2A 1VR6A 3W70A 1KTBA 4MZ1A 1B4EA 1W1ZA 3BK0A 1EPXA 2WSQA 3FOKA 2BTMA 3NO5A 3GDTA 5AHNA 3MI6A 3W6YA 5H91A 3H54A 1JRBA 4MY8A 3TIMA 4IXHA 3W2UA 2GVGA 1TRDA 5C5YA 3ZWSA 3BW3A 4XTIA 2WV8A 2DZTA 4EF9A 3QRHA 3MWAA 4HHPA 1EP1A 4ORMA 4NJJA 4RZ6A 1G7VA 3IIXA 4RR4A 2WNNA 3O6YX 2C14A 4AWSA 3MO7A 1WXJA 4HPXA 4DPPA 1UCWA 2QCLA 3LV6A 4AAJA 1NF0A 3PULA 1GJPA 3QFEA 3P62A 4EOUA 3FFSA 3QSRA 4IUOA 3QJAA 1TTIA 4NVTA 1TJPA 2VFDA 3TK7A 1G4EA 1W31A 2D73A 4UTTC 4IX2A 4ORIA 5HWJA 1N7KA 4KKXA 1PCWA 5F4SA 4LVFA 1U83A 2PCQA 3STEA 2VFFA 3RMJA 4L4MA 1KTNA 1SQ7A 4MFDA 3ELFA 4O11A 3G1AA 5EL1A 5EKYA 1ZAIA 3ABSA 2QAPA 3S5ZA 1UBSA 3EKLA 5HWNA 1IIHA 5K2ZA 4O16A 3GK0A 5TQLA 5K3VA 2QUUA 3HGRA 2QCDB 2QCHA 4JTTA 3HF3A 3EX4A 3GXPA 1VQTA 1Q45A 5U4NA 1NFBA 1VLIA 3P80A 3B0VC 1SUXA 2X1UA 3LCFA 1CW2A 3MP3A 3PBWA 3NQ6A 4NJKA 4FEZA 1YPFA 1Q3NA 5AHLA 3G1HA 1KFEA 4Q4KA 3EWBX 3T4CA 5SWUA 1IXOA 4N02A 3O06A 4LUJA 1GWJA 3L0KA 1XBVA 4N4QA 1KLZA 2ZYFA 2YFNA 1R2SA 2J6XA 4BFAA 2WOQA 3W3OA 3SI9A 3ABQA 2J9XA 3FIGA 1TV7A 3HGJA 4EF8A 4QSHA 4YXGA 2ALDA 1A5CA 2JKEA 2Z1BA 5CPMA 3A5FA 5LHEA 1BEUA 4YCPA 3DFTA 1H7PA 4DBEA 4E2DA 4Z08A 1SW0A 3DFSA 3EWUA 2PURA 1FY6A 1TQJA 5D04C 1YDNA 3NDOA 3IVUA 4N6FA 4GUFA 4IQLA 4R7JA 3B04A 3BARA 4ZZ9A 3E96A 3CWOX 3TAOA 1I8JA 3ZFHA 3KXQA 3C2OA 2CU0A 1SO4A 4FX6M 3NPVA 4JEQA 4JN6A 1TB3A 3WK3A 3TAKA 1GZGA 3OHIA 1X6UA 1OFBA 4MZ8A 3O16A 2R8WA 3BW4A 3CWNA 4FNUA 2WJZA 2O7SA 2YGYA 2ZZ7A 5AC8A 3DAQA 2H3BA 4HNVA 1JQXA 1FWTA 1TCDA 4R33A 3MMTA 1O5XA 1TPDA 3C4UA 4NU7A 4TMCA 4NXKA 1F76A 3QEZA 2V9DA 1TPEA 3P7YA 3M47A 3UWQA 1VGAA 4GUHA 4GXMA 3PS7A 3W7CA 1Y0EA 1XBZA 4TU1A 5HQEA 3MYOA 2XN1A 1XKYA 4MIMA 3W7OA 3EWXA 1LM1A 4MY9A 4JGDA 2CLFA 3TQKA 3LHWA 5CPOA 1QDSA 3S1UA 5AHIA 1YXCA 3G0SA 1F7BA 4XZ9A 3DH7A 4QAIA 4JY8A 5MHBA 4IMCA 4OE7A 4KFPA 3LX9A 4YMZA 3USBA 5EMUA 3UY7A 2OT0A 1QOQA 2R14A 2ZA2A 4O54A 1W5OA 4POCA 2E6AA 2GOUA 3RNDA 2CLIA 3DBPA 4FIRA 3L66A 4JNMA 3H55A 2CLLA 4LV4A 3QPZA 3QH2A 1N8FA 3W7KA 3T44A 4WY0B 1P1XA 3PY2A 3PUOA 4P61A 2CW6A 2A1YA 2ZZ5A 3RLVA 1GVQA 3LBMA 3SJ3A 4LS0A 4YLWA 5LNSA 4O50A 3CC1A 4X22A 1I2RA 1RQEA 4LC6A 2GQ8A 1M6JA 3UZ5A 4WY0F 3DFPA 1VCVA 4GUIA 3A22A 4NZJA 1GVOA 3C0JA 1OHLA 2PE4A 5KMYA 2DZPA 1FUYA 2Q8LA 4JXCA 2O7QA 3EWWA 1EA0A 3MBDA 4UUIA 4MVAA 2CWNA 5J5DA 3T7VA 1JQVA 1OFPA 1FWSA 2TMDA 3IV3A 3MW7A 2YR1A 1L9WA 3NQGA 4XBSA 1K3UA 4NZFA 3EXSA 2H8XA 3NM1A 3NM3A 2YZRA 3M5XA 4XTDA 3V75A 3CU2A 5ABTA 1QMLA 3GYEA 3THAA 3EEGA 1SW7A 4JYEA 1NEYA 1LYXA 4ADTA 2VENA 1VH7A 4S2CA 1GTEA 1FWWA 1FCQA 4FHAA 3AJXA 4IMGA 2PC4A 3LCLA 4JTFA 1C8VA 4RCXA 3SW6A 3FYPA 1DHPA 5C2XA 1H60A 4FNRA 3CB8A 1QO5A 3CT7A 3G3DA 1T0OA 2YX0A 5HR7A 1G4TA 3QMRA 2GUUA 4GUJA 3DI1A 4AVFA 1QWGA 3W9ZA 1LOQA 3IEBA 3SIZA 5FF4A 1ZFJA 4FX7A 1JJKA 3C56A 3W7QA 5FF2A 2X2GA 3GAYA 5C55A 1L6YA 2YW3A 1P5BA 2RDTA 1OJXA 4B5NA 3STGA 4JIQA 3VE7A 4BI7A 2Y62A 4ZMGA 2JK2A 1CI1A 5EYWA 2VFHA 1L2UA 1M7PA 1C29A 3UXAA 6ALDA 2Q8ZA 4TO8A 3PUEA 3NPWA 2C6QA 3NQFA 2FQIA 3GKFA 3UY8A 3ANYA 3FA5A 3L21A 5AYYA 3HPSA 3OG3A 3W85A 2YPIA 3N14A 4JTKA 3O8AA 3N2XA 3TFXA 1EP3A 2UV8G 4IXXA 1XUUA 3G1FA 5BW6A 4HNNA 4NX0A 4MFEA 3STCA 5KINA 1JULA 3U8GA 3MBFA 1UUOA 2Y89A 4MPQA 1WA3A 2EKCA 4GRSA 2ZZ2A 4Y6GA 1VYSX 3PG8A 3B05A 4NNCA 4MUZA 2TSYA 1FCUA 4JTUA 3CLMA 3TSDA 3EWZA 4HN4A 5HMSA 1GVSA 2C18A 4UFHA 3VFLA 3WJWA 3GKAA 4XQ6A 3QZEA 3T40A 1XBXA 2QAFA 4LY8A 4O4VA 4FXSA 3RU6A 4GUGA 4UTJA 4JYFA 3W2JA 3G3MA 5GVJA 4JTEA 4O15A 4HNTA 1EUNA 3E49A 2NXHA 5HUOA 2Z6IA 1H51A 3VE9A 1R2TA 2NV2A 1SFJA 1BKSA 3CTLA 5D09A 3EKZA 4NX5A 4IX0A 5CGQA 4AHPA 2FJKA 3L5AA 4DF1A 1V7YA 4ZQRA 4OGZA 3L5LA 4O13A 3ZR4A 3YPIA 4JX6A 2CLKA 2E6DA 4X2RA 1JUKA 4AWTA 3RF9A 1TMHA 3KAOA 1PV8A 4FX8A 3KVKA 1VLWA 1HL2A 5DCBA 1VCGA 1M5WA 1LOSA 3NXFA 3DXIA 4BF9A 4GJ1A 3E9AA 3W7JA 3MP5A 3KOFA 3MYPA 2RDUA 1SPQA 5FF3A 1ZCOA 5D03A 1DV7A 4IPIA 1RPXA 4NUWA 3TSMA 1KTCA 5A8GA 1JCXA 3NQCA 2V30A 2E6FA 1GYNA 2DJXA 1WBHA 2NX3A 5AOUA 5BMWA 3NQ2A 4CQ9A 2OCZA 3PF3A 1AG1O 2F84A 1I2OA 4ML9A 1WAUA 2IQTA 1K8ZA 5E1QA 3P82A 4ADSA 3W71A 2V2CA 1ONRA 3CHVA 3KVLA 4LRSA 3NVTA 2E68A 4MJZA 4QNWA 3S9YA 2ZZ6A 1XCFA 3F4NA 2ZRZA 2V5BA 3RFAA 4A2RA 2E6YA 4LU0A 5F4WA 8TIMA 1XC4A 4U4MA 1ICPA 1X8FA 3DKJA 1R47A
chains in the Genus database with same CATH superfamily
3BPWA 2V63A 4REQB 4PGLA 4URIA 3MI2A 1T99A 3A13A 3IGSA 3W38A 4D6EA 3GHRA 3NDYA 1NWRA 5AC4A 4PRWA 1O4UA 4CCDA 4ENLA 1BQCA 1POJA 4G7FA 3V5FA 2VEFA 1VS1A 3S6OA 3F2BA 2QCNA 2J7FA 2NVCA 4KWOA 4AVOA 2WNQA 1H0GA 1LBMA 2W63A 4D1JA 4KGJA 3CHFA 2XIJA 4LUTA 4OOZA 3BO9A 1PKYA 4NSBA 1WZLA 2GJNA 3OBEA 1K03A 4CU7A 1I75A 1WDRA 1P7TA 1AJ2A 1Z7AA 4PBFA 1K9FA 4M0XA 3CQKA 4X9YA 1AL7A 2FVKA 2PTYA 2YXGA 4BI6A 3P61A 7PTDA 3OBKA 2BBFA 2DZXA 4M19A 2YA1A 4CQAA 3P67A 2BVDA 1JCMP 3U2CA 4K7YA 4CNUA 1AD4A 3I4EA 5I03A 2OYMA 3TJLA 1RJQA 2PWHA 1OFEA 1YADA 3RRXA 1OYAA 4LQ1A 5BXPA 4B5SA 1PAMA 4LS1A 3BOXA 3LMZA 4E38A 1R46A 3W1XA 3UG3A 3C2FA 3UR5A 4BWLA 2XIQA 1U5VA 1OYBA 2FDMA 1FA2A 5A8OA 3MWCA 3TE9A 1CLKA 1F5ZA 2JBMA 3JRKA 3M9YA 1GTHA 3H22A 2IPFA 4WKFA 3KM8A 5KZDA 1UKPA 1E73M 4G1NA 2WHMA 5C9XA 1C9DA 3SECA 1SJDA 3AIBA 1RZMA 4PUWA 3K30A 4LTSA 2WW5A 4LW7A 3GDLA 2E28A 3M0XA 2EPLX 4IMFA 1S3HA 2I9UA 5D37A 2W92A 3CV2A 4CD7A 3N17A 5IDZA 3CIWA 3VCCA 4UTMA 1I9CB 2ZUVA 1YPXA 1TX2A 4O4WA 1ZTVA 3AFBA 4FOKA 4AD4A 2C1IA 4N9CA 3SUVA 1OK4A 1SFLA 3W2KA 4GPNA 5G1YA 3S1GA 5F7UA 3B4YA 2EAWA 5DY2A 1GK8A 3BG5A 4HVXA 3EX6A 3RJXA 1E15A 1V6VA 5F1VA 3H4WA 3EOSA 3CEPA 5JBFA 5EB8A 1HW6A 5LSMA 3W7EA 1TX0A 1Q6GA 1J11A 4JTQA 1DJNA 1XJBA 5IHRA 1H62A 2CZEA 4UZUA 1MZHA 3VIIA 3ABOA 3MMUA 3TR9A 1F61A 5LNRA 1X39A 4QFUA 3T08A 4IL0A 2HS6A 1AJ0A 4AZ5A 2YJQA 3WH6A 5TBOA 1BWVA 2RKXA 3T42A 2VTFA 2Z1KA 3AMGA 3I65A 3WDHA 1VHCA 3P5YA 3XINA 1KFBA 1TMLA 1M3UA 5M3WA 3T4WA 1J4EA 2OZ8A 3BG3A 4DNMA 5FJOA 3GH4A 3ES7A 1ZNNA 1BSIA 5LKYA 4QJ3B 3RR4A 3USZA 2PLKA 1QAPA 3QC0A 3HPZA 2Y8KA 3KFTA 5GNXA 3EOEA 3MMDA 1CXEA 1H41A 2R91A 2F61A 3TW7A 2PZNA 5C0QA 4C6OA 5FJPA 4EPDC 5G5IA 1Q7ZA 2Y61A 3F5KA 3BAYA 4H9UA 3IIOA 4EVZA 2PTDA 3PWAA 4IIGA 2VGGA 3THCA 5JQ9A 3W7DA 2YA2A 1S38A 4WDWA 3ARSA 2JE8A 3U5UA 3I7QA 5HJXA 1P48A 3NQEA 3QY7A 3V16A 1AZ1A 4IFKB 1EJ7L 3RG6A 3WF2A 2QCCA 3W81A 2JFEX 2CKRA 2A3LA 3NGFA 1CGWA 3I6EA 3S9ZA 4Y9MA 3VOFA 4QE5A 1YNYA 4H6RA 4PL2A 3LDVA 1AD1A 4Y8FA 4Z17A 3GR4A 1V3KA 1JF5A 4RKAA 5A8NA 3A3XA 3GH7A 4NI3A 4C6KA 1O5RA 1S5WA 5AHEA 2Z2UA 4HNCA 3UXDA 2GQAA 3KX6A 2YSWA 3QTPA 3W87A 4WGHA 2OJPA 4WOZA 1DTUA 2QULA 3WD1A 3WQVA 4IHCA 2H90A 4E3VA 4YYCA 2IW0A 5CBBA 4DZAA 3H2MA 2IMRA 5AY7A 3TQVA 4W7WA 4XISA 2J4GA 3OW1A 2QDGA 3UU0A 1N8WA 2ZWYA 3NO1A 1CXIA 1H49A 3FGCA 2C13A 1WZAA 3AO0A 1TV8A 1A49A 1US2A 1UZ1A 4BZYA 2C15A 1SJCA 4INFA 4PTXA 3KOWA 4HNOA 5KZMA 3E2SA 4HSNA 5AC5A 1B30A 4JX5A 1LROA 1F6PA 1LT8A 3P5ZA 1VEMA 3WG6A 5H8MA 4J3ZA 3MI3A 2J25A 3T0CA 1E43A 5A6MA 2NQ5A 2OKOA 1B3WA 4JQAA 1FWRA 3Q2DA 5I3KA 5JMUA 4QNEA 1UH3A 3T07A 1KCXA 1T8QA 2PDHA 1Z89A 4PBGA 3CPGA 3LHVA 1X7IA 2ALRA 1XIEA 1P43A 2D24A 1E4NA 3VA8A 1GW1A 3KRZA 2XM1A 3T2OA 1L6FA 3VGBA 3VKJA 2WMKA 3TYEA 3S5NA 3HZ3A 4AFYA 2X1TA 1UKTA 3SCQA 1UPPA 4AWUA 1Q8JA 1EL3A 4DBSA 4YU1A 1A4LA 1MXSA 2NUXA 1GG0A 1MNSA 4GVGA 1B0IA 1SM9A 2QJHA 4UWMA 3G22A 1FHLA 3KHDA 5D2XA 2C19A 1UJQA 1YHTA 3TYZA 1PXGA 1XPGA 4C5ZA 1XD0A 3OHMB 4FOJA 2BWGA 2PCEA 4IPNB 1ONEA 3EPMA 3A6OA 3QYQA 2E5DA 4PRTA 3OIXA 4P2VA 1SZGA 2WB5A 2WNZA 4D8ZA 4OWGA 5DFAA 1R3WA 2ZDRA 3AIUA 4IPJA 3DOPA 2FPVA 1HQTA 3A64A 4A05A 1SW3A 3OOQA 3TA6A 1W17A 3K4WA 3CXOA 2R1PA 1QW7A 3QYSA 4F0HA 3HB9A 1RP8A 1F3XA 4XG1A 3P84A 5KTLA 4MB1A 1TWDA 4F8XA 1NVMA 1KM3A 3W4RA 2PLCA 4K37A 3W0KA 1EO5A 4M8UA 4L5ZA 3R4IA 4OBRA 3VZYA 2LLEA 3WLLA 3IGXA 1ICSA 1M7XA 3W75A 1F6YA 1DIDA 3KRSA 3EAUA 4CGTA 2C16A 1G67A 5KEZA 2HTMA 2AQVA 3WELA 3JW7A 4HK7A 5BU9A 1FKWA 1GPFA 1XF0A 1ZBCA 3WQDA 3VK5A 2IQ0A 1L2QA 5LIWX 2PDCA 4NT0A 1JDFA 1ZQ5A 1U1JA 4EX4A 2BY2A 5JVLA 4DAIA 1WDWA 4LY4A 3PVFA 3O6DA 1WYIA 1RAKA 4B2DD 1DYSA 2FZMA 2VC7A 2X16A 4N0RA 4U5IA 4AIBA 2BP1A 2XGIA 1AQ0A 2XN0A 3E2VA 3ITLA 3DFQA 3NL5A 3W7RA 4GY0A 3GIYA 1GYMA 3MMWA 4XAPA 3W7GA 4FXRA 3CL8A 3TNOA 1XD1A 2X30A 2V0TA 5LYRA 1G1YA 4K68A 1KBLA 7CGTA 4F2BA 2Y85A 3WK2A 3IIVA 4I7WA 5T9BG 1OFAA 4HIBA 3UNTA 1ONXA 2Q09A 2QR6A 3ARVA 1KD0A 4BQ2A 4IFRA 3AZSA 1ZJIA 2VR5A 4HPJA 3H2FA 5C9RA 1IXPA 2ZTJA 3G0XA 3LPPA 3AROA 4MKNA 2R1MA 3OBAA 4IP4A 1JRCA 1QPNA 4S3EA 4DEFA 4HA3A 3B0XA 2Z27A 4QJ1A 3WMBA 5ABFA 3GM8A 4WX2A 3H2NA 1S2CA 3N1AA 2VZUA 1B3OA 4I8YA 4KCVA 3C2VA 3ECQA 4D72A 2JEPA 3PBVA 2QUVA 3HG2A 2GQ9A 4KFNA 3W2MA 2BHYA 2G5WA 4JICA 3M0KA 1TTQA 4ALDA 3HMCA 4HBKA 3SR7A 3VIKA 3P0XA 6TAAA 4TV5A 2UY2A 3OTRA 2ISDA 1FH9A 4A3QA 1BF6A 2OR2A 2BLEA 2ZA3A 3EA1A 4MMWA 3TMLA 2OOFA 3M41A 4YYFA 3H8AA 4A22A 2ZRUA 1IGWA 4KEZA 1XW8A 4QS5A 3FAXA 2CZ5A 3PJTA 3KTXA 3LV5A 3KTCA 1B9BA 3WBXA 4ZE5A 3FJ6A 3AICA 5CQ1A 5FJTA 2FLIA 4RNIA 3P8JA 1JVNA 2PP0A 3ZZ1A 4K7VA 3BLKA 3TN5A 2MUCA 1XWYA 1ME7A 4DXKA 1XL9A 3WLMA 1OFDA 1MRAA 2I5IA 3C2RA 1OG6A 3SADA 3GR8A 1EWDA 1QI3A 1V3LA 4K6AA 2W67A 1YPIA 2PFHA 1W5QA 2QYGA 1NDVA 2BY0A 1LWIA 2G50A 1OCBA 2WQDA 1GT8A 1BTMA 1ISVA 3T81A 1UJPA 4GQRA 3TYCA 3CBWA 3U7VA 1SVDA 4YPJA 1N82A 1LL6A 1W9BM 3HA1A 2O4MA 4W7UA 1IF2A 1KLYA 4CLMA 2FJUB 1FH8A 4KEUA 3UG4A 5C7VA 2NZLA 1LBLA 4ZVJA 4GY1A 3WF1A 4Z0SA 4B5VA 3A9IA 2VOTA 2D3LA 3ZVHA 3GVGA 2WSKA 3ZLFA 4E6MA 1KBBA 2E67A 3OB8A 5I3HA 4H3DA 1LORA 1BSLA 3ZSSA 5XINA 1IT8A 1MUCA 2OZ3A 1O5KA 3GB6A 2OZTA 1TYGA 1ZCCA 1KQZA 3IVSA 3LCGA 5CZJA 3PUGA 3SY5A 4NRSA 3UWVA 5BXRA 3CUGA 3PJXA 2ZX5A 3IRDA 4Q8VA 1VD6A 3CMGA 6XIMA 4ZQPA 3CM4A 4WOQA 2WM0A 1G6CA 3S42A 3TTYA 2HXTA 2XIBA 1QNVA 3IGUA 1M01A 2W62A 3RMEA 1NELA 3FJLA 2WCGA 3CZLA 1R9YA 2QMKA 4MLRA 1UYQA 3VIHA 1DJGA 4NILA 4O10A 4RE2A 2C3ZA 4CNSA 2DFAA 3R79A 4MOZA 1C91A 3VUPA 4UBPC 4XD5A 3RCMA 1CECA 2E4TA 4Q33A 5EBUA 1ME8A 3S1XA 2PRMA 3W2NA 1W6TA 2ONEA 4UTUA 1J10A 2E5CA 4XBJA 3UG5A 5CSRA 3ZS4A 4QLKA 1EJRC 4GE8A 1P6WA 3ARYA 4LAZA 3FXGA 1Q65A 4A2SA 2WVSA 1VFTA 1DL3A 2G96A 1DP0A 1AH4A 3CL7A 3JZUA 4K8EA 3N3TA 4R27A 2V3DA 1ZHAA 1XDJA 3VGDA 1IE7C 2NQHA 4B4FA 4O8AA 3ALFA 4JPGA 1AUSL 1UG6A 2ISWA 2NWSA 4RXFA 3WNMA 4GH1A 4F0SA 3W28A 3N4EA 5AC6A 4KETA 4NQ1A 4IJCA 4M56A 1S2TA 3WJZA 1G7UA 3BLLA 3T6CA 4LNYA 3MY9A 4OZOA 5I3FA 1A0CA 1L0PA 3GTXA 5EFDA 3DG6A 5AHMA 2IKJA 3E0WA 1W1A1 5AYXA 4FLQA 2E7FA 3C0QA 4BWLC 2CESA 3LCIA 1ZAHA 2GJXA 1AJZA 3ME3A 2FZ8A 1REQA 1VAHA 3R94A 5DMNA 5LIXX 4LT9A 2CC0A 4XVEA 3FW6A 4AHOA 2V2DA 3O2LA 2QDEA 4QCFA 1OABA 3EDJA 5I06A 1JPDX 3AIVA 3RHGA 1B90A 3SN4A 4RV8A 4F2TA 3LZ3A 1JDDA 4JDYA 2VGBA 3SCWA 4GI6A 2PWGA 2AL2A 2V81A 3QOKA 4UFIA 3ID7A 2DW7A 5JH2A 1KRAC 4GISA 2AAAA 4WF7A 1TPB1 2WCSA 3AS0A 4W4QA 1N55A 1QPRA 3BAJA 5L9FA 1LP6A 4EAYA 4MZYA 3AXXA 5LA0A 1M53A 2Q3OA 4LVAA 2CPUA 3GZ3A 3CUJA 5REQB 3CO4A 4GMEA 4QEHA 2UBPC 1GVYA 4CVWA 5EA9A 3OQEA 1W56A 3WNPA 2VWTA 5D32A 3LRMA 4A8NA 2A85A 4O18A 5D2VA 3OVQA 5LNUA 3L4TA 4JFVA 1ME9A 1WKDA 5LZLA 5A6BA 2I56A 4OV4A 2QPXA 1A0DA 3AS3A 3GW0A 4JL1A 3UWUA 5BCAA 4DNHA 2P50A 3WMLA 3NZRA 2OODA 8XIMA 2VL4A 1ZBKA 3GHTA 1XLCA 4LWWA 2FHBA 1GVRA 4M6VA 1W2PA 4EXBA 3SRDA 1PPIA 1HKMA 3LQGA 5D33A 1QI5A 5IM51 4XIMA 3VD9A 1EX5A 1GGOA 4L9YA 3G1XA 1TIMA 5AFDA 3EOLA 5A6AA 4ZQCA 1HG3A 2BSLA 1EC9A 3LLFA 4PUJA 1LCOA 4Q8OA 3SGZA 3PP7A 3NFUA 1G4SA 3UZJA 4FK9A 3R12A 3MHUA 4B4HA 4YTTA 4PTMA 4DBUA 1VFOA 3MPGA 1TV3A 2Z1WA 2FMOA 1CX9A 1ZRQA 4GHRA 3ISIX 3KHJA 4O0KA 4AIEA 4GXPA 3HO8A 1LWHA 2OSXA 4JTDA 3DG3A 1WQ5A 1U1HA 3AIEA 3H6OA 1X97A 2PPGA 1A3HA 1GONA 3NO3A 1J96A 4J40A 3BSHA 1E71M 3ZLHA 3WLNA 5LIUX 2ZBTA 4O1AA 3BSGA 3Q4DA 4HA4A 4XK2A 1B4EA 1Q7MA 3C2YA 3CGTA 4M29A 4F48A 4JTCA 1JGMA 3M46A 2WYSA 3MI6A 9XIAA 4UQDA 2O9OA 3T0TA 4GIEA 2EG7A 1I6NA 4LCRA 5FJJA 5ABFB 4UQ9A 1QI2A 1TRDA 1V02E 1EJSC 3BW3A 1GORA 4ZB2A 2WV8A 3N11A 4GZIA 4DXXA 1EP1A 1A47A 3HQNA 4ORMA 2VD9A 3RGTA 1G7VA 1WXZA 2WNNA 3CZJA 3WH7A 4ZE4A 3QZ6A 3NZQA 4HPXA 3U9IA 2QCLA 4Q4QA 3KBSA 1E70M 1NF0A 1E9LA 3QFEA 4PMDA 5EMMA 1AA1B 3EA3A 1UKQA 2DIJA 2DPEA 1W31A 2HV5A 4GI9A 4LEQA 3B8IA 4ORIA 2ZUSA 3S6TA 4KKXA 2QNEA 1LL4A 2HNEA 3CASA 2PCQA 1KGXA 1V0LA 5CGTA 3BOFA 1PZ0A 5EKYA 1ZAIA 4UQAA 2QAPA 4DM2A 1R7AA 2DT2A 1ISWA 2XFRA 4LALA 5H8PA 1H1NA 2QUUA 3HGRA 4QG8A 3CH9A 1W9PA 2QCHA 4L1GA 4JTTA 4DUOA 1HT6A 1VLIA 2CKSA 3SQLA 3H24A 4B15A 3NQ6A 4NJKA 2PDWA 4FEZA 1CLXA 1YPFA 5HJYA 5FJUA 4DI9A 5AHLA 1RVKA 2QJJA 4XAZA 3RYSA 1RJRA 3B9EA 4P8XA 1GWJA 3L0KA 1D7KA 4N4QA 1KLZA 2ZYFA 1R2SA 1YE6A 1S46A 3W3OA 4Z2IA 3GU2A 1WZMA 3SGGA 4YXGA 4TVCA 3OQ8A 1A5CA 1F3WA 2FH6A 3LGGA 2V67A 2Z1BA 4I9MA 3A5FA 5LHEA 1BEUA 4YCPA 1PEZA 1H7PA 4PBEA 2PWEA 3GC2A 1SW0A 3NQBA 5FOOA 2XDFA 3NDOA 4H8UA 4UR9A 3R11A 3BARA 4ZZ9A 2F2KA 3CWOX 4EPBC 2EKGA 3CNYA 3C2OA 3FV9A 3NPVA 3V5OA 3WEOA 3ARRA 3KOXA 1CB7B 1IHIA 1E6QM 3O16A 3BW4A 2XVLA 4P5UA 1NP0A 3MVTA 2XIIA 1AZ2A 2H3BA 1TCDA 4R33A 1TPDA 3CZ8A 2BNJA 2WBGA 1WAWA 3TEVA 1V6UA 1FWAC 2WM1A 2V9DA 3P7YA 3H70A 5DEZA 4GX8A 5FJRA 3M47A 4MM1A 1J0HA 4JCMA 3PS7A 4JNZA 1WNOA 5HQEA 2VGFA 1LM1A 4G2DA 1QDSA 2H9AA 3BCJA 5AHIA 3VO0A 1YXCA 3BLPX 1PX3A 3VC5A 4JY8A 4QAIA 4IMCA 4OE7A 4KFPA 1Q6EA 4LUYA 3UY7A 2XZ7A 1XLAA 3VNJA 4XO7A 5A6SA 2I5QA 3GD6A 3LSBA 3DBPA 3WBWA 5BXSA 1GJWA 1FWGC 4AZCA 3PY2A 3S83A 3WH9A 2CW6A 2WMIA 3VOGA 2A1YA 1Q2SA 3DHPA 5AZ0A 3RIKA 2OKTA 4V33A 1RQEA 4GACA 3QGVA 3MV01 2RDXA 1M6JA 1XLFA 1OHLA 3W6MA 2Q8LA 5C2CA 1EA0A 3MBDA 4UUIA 3GG7A 2BOGX 3A12A 1GHSA 4ZCWA 1W9XA 2P5NA 3IV3A 4BQ4A 4LANA 1L9WA 4XBSA 4AU0A 1K3UA 2Y8UA 3CIVA 1KXQA 3APTA 5BYWA 4J7RA 1PWMA 3UJRA 1XQKA 4IGMA 4DJEA 3V75A 5ABTA 3KW3A 3R25A 3THAA 1SW7A 4JYEA 4BJHA 4GY7A 3GFXA 2OFJA 4K1GA 4V1XA 4HMEA 1FCQA 3OYZA 1BD0A 1M03A 1VFMA 2ZX6A 3SW6A 1KGWA 4FLOA 5MF5A 5CJNA 4FNRA 1S2VA 1QO5A 3G3DA 5JXQA 4JHZA 1NWUA 4KQNA 1QPKA 5A6KA 1KQYA 5FD0A 2DT1A 3QMRA 2ISFA 1GQLA 3SSZA 2QV4A 5M03A 4Q7BA 2NQZA 4L1WA 3IEBA 3UVAA 5I02A 4AXNA 5FF4A 1ZFJA 4CQBA 2C79A 2D2JA 4FX7A 3C56A 2QF8A 3W7QA 3A4AA 3ARQA 2HEJA 2RDTA 3DX5A 1OJXA 4B5NA 4JIQA 2XG9A 4BI7A 2JK2A 2F6KA 2VFHA 1L2UA 1M7PA 3MUAA 5I2UA 3B8TA 3DYPA 2FQIA 4ZENA 1EDQA 3HPSA 1QTWA 2G3FA 3D47A 1ZJAA 5IFTA 3N14A 4RW5A 3O8AA 2UWFA 3ITOA 1EJTC 1A5OC 1XUUA 1QU4A 5BW6A 4HNNA 2YL9A 3FJNA 2OQYA 2YCJA 1JULA 1J2BA 1EZ2A 4XSLA 3WF0A 2EKCA 2EJAA 3EWDA 4YTRA 1DPMA 2ZZ2A 1VYSX 3B05A 4P7OA 4IPLA 2JIEA 5KETA 4MUZA 2X2YA 4QLLA 4ZEPA 2FZ9A 4KS0A 3CLMA 3EWZA 1GVSA 4UFHA 2WHLA 3QZEA 4LY8A 3FAWA 5HMFA 3AUOA 4HJWA 3R0UA 3RU6A 3G3MA 3ZR6A 4AZIA 3NCOA 4QHRA 4HNTA 3LPFA 3E49A 2DSWA 2NXHA 3B8SA 1BYDA 2PC8A 2NV2A 3AAMA 4CNTA 3D5HA 3CTLA 3EKZA 4DWSC 4JBRA 3L5AA 1R9ZA 3L5LA 3YPIA 4JX6A 1IV8A 2FH8A 2PDPA 4MWAA 1JUKA 4X2RA 4AWTA 2J7HA 3KAOA 2J79A 4FA3A 1TELA 1LOSA 3NXFA 1XSKA 3VIJA 3MP5A 3KOFA 2IPJA 1JZ4A 4ZOBA 2VZTA 1AH0A 1ZCOA 1XG4A 4C6FA 4CN1A 1PB0A 2BGNE 2VDHA 3T0BA 4NUWA 1LG2A 3CQJA 3CYJA 4DYEA 2NX3A 3VOHA 5BMWA 3NQ2A 4CQ9A 2OCZA 4QDMA 1AG1O 3RJYA 1OIMA 3UZWA 5GJNA 2IQTA 1K8ZA 2RGMA 4FR6A 3M0HA 4A8IA 4DJFA 2WBKA 4CN4A 4MJZA 1E9YB 1TIWA 3E0VA 2ZRZA 3RFAA 4YTSA 3QN3A 3CL6A 5DMMA 4FXFA 4RNHA 5CH9A 4U4MA 1X8FA 4NF7A 1IZCA 3DKJA 4PUKA 4B9YA 3B8DA 3O9NA 5I6SA 1NDYA 3A5VA 4HCHA 2OWXA 4TX6A 1VIWA 4DPQA 1R2RA 1XH2A 2R82A 3UCQA 3LNMA 4N2YA 3LCHA 1KA9F 1JIBA 1QPQA 3ZJ7A 1MEIA 4C6CA 4HKPA 3GYCA 3TLQA 4DELA 1VFFA 3G8EA 3U5YA 4AMAA 4GNJA 5DXYA 3QV7A 3QR0A 2WMHA 1ZPTA 5T91A 1V6TA 4DN1A 3PZVA 4KCTA 1KBJA 3MCOA 4GI8A 1JYWA 3PZOA 4NAEA 1KM0A 3OA3A 1DWIM 3HG4A 1XRFA 2QJIA 2J27A 3G1YA 3WLOA 2WZMA 2E25A 4N42A 4RV3A 4DUVA 5LHFA 3JUGA 3I10A 4C1LA 2NV9A 5C8BB 1X98A 2XFYA 3PBYA 4KGLA 2ZE0A 4F0KA 2FVMA 2ZZ1A 4WZHA 1VIZA 1VBGA 1YDYA 3IAPA 4OUIA 3AXHA 3EX2A 3WN6A 3LTYA 3W25A 1QHPA 2WHKA 3KDNA 4WXYA 3GC5A 3PZQA 1C93A 4JD4A 2Y5JA 4ONVA 3CAVA 3W7PA 4HZ7A 2OVLA 3IIZA 1KM6A 4L6DA 3FVMA 3ITYA 4HU8A 3P93A 4PEEA 3QGKC 1WX0A 2YLAA 3GFZA 5GNYA 3L12A 3UWEA 4NRRA 3P2VA 2GL5A 4M1RA 4MJ2A 3IV8A 3G24A 4GC4A 4CCEA 1W32A 1W1TA 1E0VA 1WOAA 4CVUA 4JIRA 3QSTA 1K7FA 1PYMA 1ADOA 4NIRA 1HKWA 5FSDC 2REQB 1KRMA 2VP8A 2C7FA 2DJLA 1JCYA 3NOEA 3PBUA 4TTUA 1C8YA 1XRTA 4O0ZA 1PIIA 3WJXA 3Q37A 4UTLA 1OD0A 2P3EA 1W3JA 5CJ5A 3IJDA 4PUEA 1R5YA 1O68A 4HPNA 1H50A 3CV1A 1ZJBA 3BL3A 3PR2A 3QV8A 5HR6A 1O7AA 3HU7A 1RCOB 4JIIX 4MYXA 3GXIA 1Q13A 1MYRA 4LRTA 2O4QA 4HMDA 4RZBA 4GA8A 4K36A 3COTA 2YIHA 4YVVA 3BQ6A 4NJHA 3QFWA 3S46A 3V0UA 5A8PA 5BRPA 2VEPA 1ISXA 1QBBA 3OVPA 3MU7A 4GYFA 4S3DA 3PNUA 3CV6A 2YCEA 1ZAJA 1CGVA 4XX6A 2QJGA 4JQ2A 3HFYA 4LJ3A 3GXDA 1NDWA 1DWJM 1NFGA 4DJDD 4EE9A 2QQ6A 1EX1A 3CQ0A 3IJ8A 2CETA 4ZQMA 1JFHA 2WMIB 1W8SA 4RXGA 2TPSA 2FIQA 3R5EA 3TMQA 4GZJA 3NL2A 5I5RA 4WGXA 1I45A 3L2IA 5T26A 1VC4A 1VP5A 3VOCA 1F8MA 5C7HA 3RITA 2DEPA 1JDCA 1SFTA 3F5LA 2A3EA 2YDAA 3WDJA 3WQWA 1C90A 5D2YA 5EPDA 4GYPA 2VC6A 2A6NA 1Q6RA 3THUA 4JIPA 3R2GA 4H9ZA 1E4LA 3AMKA 5A8MA 3P3BA 3PZGA 2ZQ0A 1JI2A 3QMTA 1ZB5A 4FB7A 3WQ4A 5KITA 3HQ1A 1K8YA 1Y65A 2WZTA 3L7RA 4J2MA 4QTGA 1ITUA 4IMAA 2G8ZA 3UPBA 4TMBA 3LGEA 4HB7A 1FFRA 4RUBA 3WJSA 5AZ1A 1I0BA 3CAKA 2WVVB 3KBMA 3BAXA 3HJEA 5HINA 1G0CA 3J7HA 1W1YA 4YS1A 1A5LC 1WPCA 1OF6A 1FP8A 4WVXA 4EXAA 1JUBA 1IIGA 1M7OA 1RVGA 3SGUA 3KUMA 3VNLA 3NSXA 5HULA 1K6WA 4PMUA 3DERA 3C52A 3KRUA 5CZTA 3LNPA 2ZXQA 5H1WA 3FKRA 2JKAA 1GEQA 4CU6A 3EEZA 1DIOA 3UJ2A 1LDCA 4FNQA 4NASA 3L9CA 1KM4A 1Z41A 2CBVA 4UQEA 4UIOA 4J2PA 2V3EA 1MEHA 1FX6A 2P76A 4U2YA 4WY0A 1MO0A 1HF6A 3GDKA 5E0KA 4FMVA 3VILA 3WK1A 4OHQA 3FYYA 3F2CA 1TUFA 1TJ2A 3WUBA 5FCZA 3RCNA 1SJBA 1H11A 1RD5A 1OYCA 1I2PA 2X1SA 1BRLB 3QKEA 3W83A 3NQ7A 3ZT7A 4PTWA 2A3BA 4WEVX 1FXPA 3K1GA 4IP5A 3SCNA 3GNPA 1H3GA 4MUPA 2DUAA 4C7DA 4UTTA 4NJIA 2OYKA 1OEPA 1AW1A 3L65A 4I5RA 3GXNA 4NXSA 4N9EA 3UGVA 3W73A 2H8ZA 2ON3A 4XZLX 3AYRA 1GYLA 3MKCA 1ZALA 4UTIA 4QEEA 3F03K 3SEPA 1EB3A 3QR1A 4A6GA 1WP6A 4WJ8A 4O52A 3P60A 3S8HA 3ZVIA 3ABXA 3SO7A 1EBHA 2E3ZA 1J18A 5ABHA 1CGTA 2WCAA 2PDMA 4M5PA 3WYZA 1GG1A 3VMPA 4OV9A 1EP2A 4S3JA 3AXMA 3W84A 4E3TA 4MB3A 3ZLGA 4E2VA 2E09A 3CEUA 4DZ5A 3MUIA 2WSYA 3LBOA 1FKXA 1XH1A 3W1NA 3NZPA 2Z7GA 4XO6A 3LG3A 3GIQA 4Z0JA 2G3IA 5D02A 4M82A 1W2VA 3GY1A 1H0IA 5HNNA 2VFEA 3S1WA 5K4XA 4HU3A 1K9DA 1YNQA 3B3DA 4Z1AA 2AGKA 4DUXA 1X1ZA 4DBDA 2FKPA 3REQA 1KCLA 4AF0B 4ACZB 2NUYA 3FVDA 3GG0A 3I7RA 2G95A 3S2MA 1WZKA 4Z1DA 3BG9A 4PCPA 3W1QA 4DIAA 4R88A 3D0CA 3UYCA 3WCZA 4O1CA 1GOXA 4S3BA 3MUZ1 1XRVA 2POZA 2AAMA 2FTWA 3TW6A 5F1UA 3UQNA 3AUJA 3B9NA 2XINA 4L4PA 3WK0A 3VNKA 3GNNA 4D6FA 1W3LA 1FOBA 3SN1A 3UWZA 2JIWA 3QW4B 1JD7A 3AHTA 1QR7A 1ADSA 4F0RA 2TYSA 1MWOA 2QUTA 3BCFA 3KCLA 3TN4A 2DP3A 2DZVA 5I3JA 1E0TA 1R3VA 4AX6A 3F4WA 2DIEA 2HSAA 3W1TA 1J0IA 3BGAA 1H7OA 3UJFA 2DV0A 4ZR8A 3BLIA 3B40A 2YYUA 6CGTA 3LM7A 3MSGA 5AKQA 3VKDA 2VM8A 3NXLA 3MHFA 4C90A 4Q8TA 3QY8A 3XISA 3VINA 1Q7QA 2GSEA 1XLMA 1O6IA 2YL5A 1E51A 4DHGA 4MSSA 1KFWA 2OEMA 1IEXA 1Q6LA 1IXQA 1JG9A 3U2ZA 3DIPA 1UR3M 4D6IA 3KWSA 4M1BA 2W6RA 4D2JA 2FTPA 1J2WA 1UASA 2BZNA 3BSMA 3NZ1A 4ZODA 3A21A 1PCKA 2HPIA 3HG3A 4DJEC 1XLEA 4HP5A 5LGZA 3TTOA 4B2DA 5A1AA 2F8QA 1K02A 3V5CA 1JF6A 3TOYA 3W1MA 4M6PA 2CEQA 4O28A 5D4YA 3VPLA 3ZQ9A 1KWKA 1A5SA 1U1UA 4P7RA 3UYIA 1XLHA 3PPHA 1YRRA 4H2HA 1PTAA 4L4LA 4MJ4A 3GUWA 2O92A 1JZ6A 3TFCA 2D23A 4HHLA 3U6WA 2HVOA 2CLOA 4ZSTA 3G0UA 2NVAA 1FWNA 3D3AA 4RLIA 3B0PA 2H6RA 4GD0A 5CEWA 1H7RA 3N4FA 1VEOA 5CZKA 3ICJA 5ECUA 3WEMA 3URAA 4JHMA 3QZAA 4MNJA 1PHWA 2O9RA 5JIWA 1OF8A 4FAMA 3WH8A 1A80A 2NSOA 4C5YA 4WDUA 2QIIA 2D3NA 1IZJA 4QXIA 4WKAA 1SO5A 3C0SA 1HJQA 2ISSA 4WK9A 4UMBA 4S1FA 4LFYA 3HBLA 4DXVA 4ICCX 4H9XA 2IPWA 4ADUA 5BMXA 1Z8AA 4YL2A 3EB4A 4I5XA 5I3DA 1HFBA 2VZOA 1RBLA 4ZO8A 2YL6A 3W1UA 5DRCA 4Z2KA 3WNLA 2VELA 2PRLA 1RA0A 3ES8A 3ONBA 1NARA 3MC5A 1CB2A 2QKFA 3V1HA 3O05A 2GFTA 1HJWA 1GQKA 5K9XA 2CZFA 4YWIA 2WWCA 4HMCA 2VKZG 3ATZA 3B0YA 1L6SA 3WLPA 3WY1A 5DRIA 4DF2A 3M0YA 2Z29A 3NWRA 3OLDA 1PS9A 1TR1A 1XGZA 3NYZA 4KEVA 2DT0A 3KRBA 2WC3A 2VDIA 7REQB 4J3UA 1RD6A 3STPA 5AB3A 4GWEA 4H7CA 1EEPA 2Z24A 1QVBA 3WEZA 3WLHA 1F4AA 3QQ0A 3G1RA 1US3A 2EG6A 3VDBA 1EXBA 3LB0A 2J8FA 4QP0A 4U3CA 4MWAC 1Y5WA 4J4KA 2OPJA 3DYMA 3OP2A 5D05A 3NZGA 4HZ6A 3BJFA 1KXHA 1J0ZA 2IKHA 1DE5A 2HMCA 3SIMA 4FP1A 3RPTA 3N2MA 3PAJA 1CLVA 4GQGA 4H6KA 3KZSA 3DGRA 3W1PA 5CPNA 4X0NA 4WJXA 1W3TA 3WUEA 3GVQA 1J0KA 2YCKX 4O12A 4E4FA 1OQFA 4UC5A 2XSXA 4Q32A 4WHBA 3TP4A 6REQA 2JF7A 3TDFA 3U3HA 1JDEA 5LXEA 2ZX8A 3LGDA 2FHFA 2Z6JA 2XHYA 1H7WA 3W22A 4MAZA 4YTUA 2VZVA 4C91A 3E0IA 1QOPA 1EA9C 2FPYA 5BRQA 3SUTA 1K9EA 1PTGA 5C2GA 2VR2A 3VABA 3AZRA 1DQXA 3W72A 1DTNA 3ZWTA 1VJIA 3ANUA 3JS3A 1TTPA 2WO5A 2VVNA 2EXOA 4LSBA 3EB2A 1MDRA 4ZO6A 4NNBA 3QM3A 3RLUA 1UZDA 3GUGA 1VPYA 2Y7GA 1FXQA 2WMGA 3U2OA 4E0CA 2EPNA 4LH8A 3VNYA 1I1WA 4RX0A 1PJ9A 1W1IE 3GQYA 4GBUA 1YXDA 4L9XA 3UT0A 4YVXA 1JXKA 2R94A 1E5NA 4H01A 3LTSA 1DJQA 1HJUA 1HKKA 3DYOA 4LS2A 2EF9A 4PCNA 2CITA 1EC8A 2R9RA 1BTCA 5LA2A 4PUDA 4AYGA 4F0MA 3POHA 1GQNA 4QQUA 5FF7A 2F38A 4ATLA 3IWPA 2X09A 3AHXA 1YTKA 1GVFA 1OD8A 4GQQA 3R8RA 3H7RA 4Y8EA 3MHGA 4HA1A 4CCZA 1VZWA 4OFCA 2YW4A 4QCEA 2GGGA 5G4WA 3NQDA 5DQPA 3VX1A 4OTKA 2TRSA 3PZIA 1NAL1 2X05A 4QBXA 1J9YA 5AHFA 4LVGA 4XUYA 4AD0A 1UA7A 3UWYA 3B03A 1YIXA 4O1FA 3HPFA 3RO8A 5IFPA 4HSOA 1SZEA 4C1NA 2OTDA 3N19B 4OBSA 1TPVA 3WQPA 4U5KA 1R3YA 4X61A 3VCRA 2B7OA 3R7MA 4C6BA 4QX4A 3W7LA 2W27A 3SRFA 1UBPC 1YW1A 4IFKA 4XD6A 2Y63A 3N13A 1EPVA 4NJGA 3W86A 3RO6A 1XQLA 1DJYA 3G1VA 5C6MA 3AWNA 4K38A 1UD6A 4K39A 3O0KA 6ENLA 2I9EA 3KOZA 1P4CA 4JFWA 3TXVA 4QITA 2HS8A 4OBTA 1IGSA 1GOWA 1CZ1A 1O1HA 4L4OA 1D9EA 5HWMA 1W54A 3L0GA 3U57A 4YVPA 4QS6A 3FY1A 5TAOA 1SO6A 2IS7A 3FLUA 4US5D 3H2EA 2CHRA 2X1IA 5F2GA 1R6WA 4WRHA 2JGQA 4LEFA 3AMCA 3CHDA 1TRIA 1XI3A 1LRQA 1NP2A 3II1A 3QR3A 2DH2A 1LRNA 1HJVA 1VRXA 3GHUA 3CUIA 3ANVA 3MT1A 2GWGA 1FFQA 1V79A 4IF2A 3NPXA 1UD8A 3LRKA 4MF4A 5LIKX 1BWLA 2XH0A 5AYZA 3WUGA 2DW6A 3GR7A 2Y6ZA 4D1IA 2ACQA 4AEOA 1SSGA 2OYLA 2OZ0A 4EWND 3N9RA 1K4GA 1KFKA 4PCSA 3WLTA 3NOYA 3E6EA 2PLMA 4PCFA 2VYOA 2VNCA 3UWWA 2OGJA 2XVGA 3PWGA 2XZ9A 1WCGA 2YCLB 5A69A 4ZFCA 2ZZ4A 5E0FA 3SBFA 3AIWA 1GOMA 5G1TA 1TJ0A 2RJGA 2PDJA 4GYPC 1U2YA 4F9DA 1XLDA 4H9YA 2J7BA 2I17A 3ATYA 1NWSA 1F3TA 1CEOA 3EXTA 4FNSA 1TVLA 5CBJA 1R7OA 5KSWA 1NQ6A 5CG0A 4WDXA 3PBMA 1EOKA 5GQBA 3ZJKA 4EIVA 4H1ZA 3QBUA 3CPRA 3RPMA 4L1XA 1R30A 3VX0A 2I14A 3PJUA 3NEHA 3PC0A 2J7DA 3HURA 3QY6A 1S5TA 3ARTA 2PB1A 3S9IA 1RV8A 4UNKA 5A6JA 3RM8A 2E9MA 1XGEA 3VIGA 2QCEA 5I79A 4HPGA 7TIMA 3NURA 3VM5A 5IOBA 1WUEA 2GK1B 1EFZA 3DI0A 1QK2A 4JTGA 3A4JA 3RM4A 5D9OA 2HVNA 2YBUA 3OGRA 4IIHA 3FDGA 4PZVA 3WENA 3EMCA 3BK0A 1MNZA 3FOKA 2BTMA 3NO5A 1YE4A 3PZMA 3F4VA 4GIRA 3ALGA 5H91A 3H54A 5CC3A 4AISA 5HQMA 1C3FA 3W2UA 1C8QA 1FVPA 3A3HA 1GHRA 4EF9A 3NVDA 3UR2A 4J3VA 1P6CA 3B8WA 1J93A 1CTNA 4NJJA 3TN3A 3IIXA 3OZPA 1YKWA 2C14A 1BYBA 8RUCA 3DUGA 1S39A 1MUWA 1S5NA 3KP1A 4AAJA 2QT3A 1RPKA 3V35A 2ESCA 2C1GA 3QJAA 4XZIA 3AQUA 1K4HA 4WSKA 3UCCA 1TJPA 1GOIA 1O5QA 2D73A 2VWSA 4UTTC 3M0IA 3EMZA 2BVWA 5HWJA 1PDZA 4ATDA 1HZYA 1DJWA 1N7KA 4LAKA 1LL7A 1UP2A 1EH9A 4LVFA 2INZA 3STEA 2VFFA 3ITCA 4L4MA 4L9ZA 5RUBA 1C9WA 4MFDA 1V02A 3ELFA 4O11A 7ODCA 1IIHA 4CUCA 5K2ZA 4O16A 3SUSA 3W82A 3BTNA 4WSHA 3E1F1 5E70A 3EX4A 3LM3A 5HBFA 1Q45A 2QVHA 5U4NA 1E6PA 1J0JA 1E40A 2XH7A 3LCFA 2X1UA 3BDKA 1SYTA 3PBWA 4DM1A 4L64A 1BVNP 3UETA 3FEQA 2DUXA 1Q3NA 3KDOA 3G1HA 4OVXA 2Q6ZA 1KCKA 4XIAA 1XYLA 1YMYA 4S38A 3SAZA 4EXQA 1L6GA 1UW9A 2J6XA 2DUZA 2WOQA 1RCQA 1R3SA 1GW9A 4U33A 4Q22A 2B81A 4QSHA 4KF1A 4MDOA 1SFSA 2V5DA 6REQB 1Z3NA 4B5TA 3M07A 3DFTA 3DHUA 4Z08A 2PURA 4V1YA 3UR8A 5D04C 1TQJA 1YDNA 1ZU8A 3VDGA 4N6FA 2BOFX 3B04A 1JAEA 4LUSA 4RE0A 3ZFHA 4QJ4B 2HJPA 3KXQA 1SO4A 3W27A 4JN6A 3WK3A 1OFBA 2R8WA 8CGTA 4FNUA 2O7SA 1IT0A 3W6LA 2ZZ7A 2AKMA 1NDZA 1HGYA 2ZDSA 4GINA 1JQXA 1O5XA 3C4UA 3PZUA 4NU7A 4TMCA 4AVNA 1GQIA 4QRNA 4Y9PA 2GDQA 4GBDA 1KWGA 1ODUA 1UR9A 3SJNA 5CC7A 1VGAA 4GUHA 1BG9A 2EPOA 2IQDA 1Y0EA 2NSXA 1BXBA 4DWSD 3MYOA 2XN1A 4MIMA 3EBVA 4AEFA 4AZ6A 1JYNA 1I1XA 2WZHA 2QV5A 3KBVA 1F7BA 4XZ9A 3DH7A 1UC5A 3LX9A 4J35A 3VMNA 1HKVA 2OT0A 4O54A 1W5OA 4POCA 4TXEA 5I0DA 1P0EA 2E6AA 2CLIA 2NQ9A 3L66A 4JNMA 2ZC1A 4NZ1A 3QH2A 2F6UA 2ZXDA 4ZBCA 3PUOA 1JXJA 3RLVA 1GVQA 1DJZA 4YLWA 4O50A 2O0TA 3CC1A 1D7FA 1I2RA 3DFPA 1XIJA 3C0JA 4C1NB 4HN8A 1YEYA 1FUYA 3EWWA 3AYVA 4MVAA 2CWNA 5J5DA 2D2GA 4GXWA 2YR1A 3QHNA 1PBGA 2TAAA 3VU2A 3PAOA 1BQGA 4DX3A 4NYYA 2H8XA 3VGGA 4Q7NA 1DE6A 5CC5A 3NM3A 5EFFA 3ERPA 3CU2A 1CENA 4NP7A 3TNBA 1EDTA 5PTDA 3MCMA 2PGFA 4Q8PA 3GXFA 1NEYA 1UH2A 2Z1VA 1FHUA 4LB4A 1FHDA 4S2CA 1GTEA 1FWWA 5CLTA 4FHAA 4U3AA 3LCLA 4RCXA 4IICA 1T5AA 4GGBA 3MS8A 1OZMA 3CB8A 5EMJA 3IS4A 1MDLA 2OEKA 2PTZA 2PUZA 3KBJA 2YX0A 4F0LA 6XIAA 5HR7A 1G4TA 3AS2A 1XV8A 1LQ0A 1HL8A 1E0UA 2WVTA 1XCXA 1FWDC 3W01A 4AVFA 1QWGA 3W9ZA 5FAJA 1DQUA 4AD3A 3LD5A 1JJKA 5FF2A 5C55A 1L6YA 1GZJA 1CXKA 1V3IA 1JZ2A 2ACRA 2GLKA 4RPQA 3VE7A 1CI1A 5EYWA 1Q6CA 2Z7KA 3VD4A 3HQPA 2Q8ZA 4TO8A 2L5HA 1UIPA 4PUUA 2R6OA 3NQFA 1QOXA 3S2LA 1XC6A 2X8RA 2V3GA 3L21A 1BXCA 3OG3A 3AHVA 3W85A 4E4PA 2YPIA 1TG7A 4JTKA 4M6UA 2DVXA 1W91A 4NKCA 3E2QA 3LK6A 2Y4SA 2BGQA 2Y89A 1UMYA 3JU2A 4GRSA 4Y6GA 4NNCA 2XTKA 2W61A 3WL1A 2J47A 3VFLA 1ISYA 3LEPA 1TVPA 3WJWA 4XQ6A 1UD3A 3T40A 4C6IA 3TVAA 4JYFA 3W2JA 3N2BA 1LF1A 2Z2AA 3N9KA 5GVJA 4JTEA 4PMYA 3H21A 4AD2A 5M5DA 3RX2A 4GVIA 1YQ2A 3ITGA 1VJZA 2Z6IA 3H26A 1XLBA 4NX5A 4GKLA 2VCAA 4IX0A 5CGQA 1JZ5A 2QIWA 2E1WA 4DF1A 3P6LA 1V7YA 3SQMA 1AQHA 4EPEC 3GNXA 1O66A 2YDQA 3OPSA 3C3UA 1PV8A 3TOPA 2FGZA 4QDWA 4FX8A 4QJ5B 3I3DA 1YX1A 1HL2A 4IZGA 1KGUA 2VD8A 1M5WA 2ZKMX 3DXIA 4BF9A 3FJ4A 5REQA 4XAFA 4Q8WA 1AH3A 3CHEA 3LZ5A 3MYPA 1PDYA 1SPQA 2X0HA 4IIDA 5FF3A 1DXEA 5D03A 3CYVA 5CPTA 2WLZA 3KLKA 1KR0A 1KTCA 5A8GA 2HZGA 1EZWA 1D3CA 3NQCA 2V30A 1E3ZA 2DJXA 2O55A 5AOUA 5C71A 3DG7A 2OSWA 2YZ5A 4DUWA 1I2OA 2Z26A 4ML9A 3VFCA 1RP9A 4Z1YA 3UF9A 2VC5A 4ADSA 3N6JA 2V2CA 2KAUC 4LRSA 3V0SA 4QNWA 1G94A 1F8IA 4DRSA 4GCAA 1MZRA 3BAWA 3CWHA 2V5BA 3H23A 4A2RA 4RDZA 2E6YA 3L4UA 1TMQA 5F4WA 4V27A 4F40A 1UD2A 1ICPA 4DLMA 1ITCA 1R47A 1E55A 4FSAA 3VC6A 4C7GA 1E6XM 4UOZA 1TWIA 1VENA 4K3ZA 4N6EA 5CG7A 3GU9A 1Q2RA 3AHYA 4KIEA 2CLPA 3GE7A 4BHYA 2YLLA 2DSZA 3S2JA 2CXGA 1VYRA 2C8NA 5A2BA 4A8RA 4GZEA 1MXGA 1OZQA 4ERIA 3S6DA 1ADDA 1S1PA 2CZVA 4TIMA 3MJMA 4IG2B 3AXIA 1GUVA 4KWWA 3RPDA 4M7SA 4P8VA 5FIPA 1ALDA 1G69A 3AOFA 3M0MA 4L65A 1Z48A 2UY4A 1OVDA 3LXBA 3M16A 4B5UA 4HOWA 2I7GA 4LV9A 4ZL1A 2XN2A 3SCUA 4O0QA 1U22A 2Y8VA 1Q66A 1G4PA 1DVJA 4G8TA 1YDVA 1BF2A 4C6DA 3BC9A 5CPSA 1FDZA 4MGGA 1XBYA 3N2OA 1JNEA 3W23A 3FCPA 3M5YA 1KBIA 4Z2GA 1V3HA 4S2BA 1MXDA 4AZGA 2DZAA 4BY3A 2QHAA 3SY8A 4J28A 2ZADA 4JTJA 1FCVA 1RXOB 3QLLA 4LUSB 1P0BA 3DZ1A 3W1LA 1GVIA 2HBVA 3GDBA 3EB3A 4TV6A 5L6UA 2HVMA 2Y70A 1QBAA 2J13A 3BWWA 1TTJA 1TPC1 3XIMA 3BUVA 4JQ4A 1VEPA 3P74A 1V0MA 4JTAA 2FHCA 5DCEA 3HGOA 3WFLA 3AZTA 5FSEC 4C6QA 1E9IA 3WMSA 1V93A 3BMWA 3FK4A 1Z32X 1DXFA 5MKGB 1KFJA 1A53A 3AU6A 1DBTA 1EJXC 4UTKA 1BG4A 1W5MA 4I8DA 1Q63A 4ZOCA 3WBYA 3R8GA 1XIHA 5I7GA 1U30A 1TZZA 3TV8A 2CWXA 2I57A 1XDMA 5GJPA 4GOAA 4ZTYA 5ABEA 1JCTA 2DQWA 3EX1A 3F4CA 5JH1A 1H4PA 1WB0A 4GX9A 3O6CA 1GPWA 4B16A 2VI0A 4DJDA 3PUDA 4DO5A 4UFKA 1NY1A 3GBEA 1YTDA 3P81A 4FS9A 2PODA 1U33A 3U4AA 4RZ5A 4NYUA 4AC7C 4S3FA 1W1B1 5AN7A 3FX4A 4D8LA 2W5FA 3GNDA 4CNNA 3WNNA 1BAGA 2W79A 3MANA 1D3GA 1KC7A 5FEPA 3IJ7A 3R43A 2VCBA 3OLGA 1LLWA 1CT5A 2VXNA 4CEUC 2VX4A 4XZWA 1KFCA 3HM7A 4O53A 3E12A 3WFAA 2PTXA 1XPYA 4WQ6A 1FWIC 4RJEA 4P7QA 2GWNA 2PDYA 4GCXA 4KBXA 2J78A 2RH9A 4AMCA 3TU9A 2ZX9A 4FLRA 3STFA 1Z9AA 4ZXLA 4KW2A 4PULA 2B0MA 3I6RA 4E5TA 1OINA 4QLJA 2V69A 2Z25A 3K13A 4BCEA 4PC8A 4H6QA 3KVMA 5EBAA 1OGBA 2J7EA 4AD5A 6PTDA 1RQBA 4ZB5A 2ZTKA 2QDHA 1GQJA 2G3NA 3L4ZA 2PDIA 4I9AA 3NYDA 4Z1CA 5BWAA 4M7TA 1S3TC 2G4JA 1YDOA 1H09A 3GU1A 4G56A 1UOKA 4RE3A 1TV2A 1OFQA 1MMFA 1XYAA 2GGEA 5ABGA 3TC7A 3EOUA 4J3SA 4A21A 1J6OA 4A8LA 2R1LA 3QW3A 3NG3A 1RH9A 2XH2A 3W02A 4N9BA 4HZ8A 1UUMA 4Q8MA 4QM1A 2DVTA 3FXYA 1JL8A 1SSDA 2YKKA 3T8QA 4ASTA 1H7XA 1EHNA 1W5NA 3AI0A 3THDA 3VDAA 1Q4NX 3TJXA 3TZFA 3C8FA 3CQIA 3C3NA 1LRTA 1SMAA 1EIBA 3NL3A 3L5MA 3MSRA 3H2AA 1P6BA 4W9TA 1QI4A 3TYAA 5I3GA 1QJWA 2FFIA 2ZRWA 3ZIZA 2ZZ3A 2NXIA 3UG8A 2OX4A 2MANA 4XKYA 2R1KA 4ATWA 3TUUA 2PS2A 4IWWA 1LTDA 3G1SA 4JTIA 4PMVA 5CJMA 3TSBA 2I1OA 4IOTA 1TQXA 1L8NA 2GOKA 3WO8A 3NNTA 4KT2A 1M1BA 4C6NA 1EGZA 4UQBA 3RM9A 1SU5A 1ESWA 1YNPA 1XLLA 2V2HA 3QMSA 3TJ4A 1JCLA 1SMDA 1UPMB 2CBUA 3EPNA 3Q94A 3EYPA 1KM2A 1RALA 1XSJA 3UEQA 4GQBA 3U0HA 2A6LA 4F79A 2Z1XA 4AZBA 2XGBA 1J8VA 1QNPA 4X0VA 4Z1BA 2Y5EA 5K9DA 4FI4A 2WZIA 1E1CB 1UKSA 5G2WA 2FB3A 4RZ4A 1JGIA 4IL2A 3L4WA 3M5VA 4IMEA 3TH6A 1HX0A 1TJRA 2QUNA 1UP0A 4A35A 1N2VA 2WAGA 4H2CA 2VR4A 3PSVA 1JR1A 4XVDA 3QQWA 3MDUA 2QPUA 3BGJA 3CPUA 3TWBA 1UP3A 3WF4A 3VKCA 4QISA 2UY3A 5HAOA 1XSIA 2V5LA 4Z42C 3SCVA 1D3HA 5CC6A 3LI0A 1OC6A 3VOIA 3M0JA 2PU1A 4K8HA 4KWSA 2V8ZA 3GLCA 4GLEA 2PP3A 4DQWA 3O1NA 4D71A 5DLCA 4F9JA 5LNVA 4J9JA 5GJMA 3GTNA 4XBKA 2PDFA 3L67A 1OX4B 3CUXA 3CUFA 1UWSA 3PG9A 4MLJA 2JKPA 1HVQA 1TV5A 1E1EA 1E5JA 3DECA 2Q01A 5CKSA 1TA3B 1CXHA 1PZ3A 3GWQA 2ZRYA 3CB3A 3UP8A 3LU2A 2BODX 4UMAA 3FA3A 1T8XA 1NSJA 3PTQA 4GIAA 2ZXAA 2D2OA 4J1OA 1AL8A 3IGHX 4H8NA 2ZA1A 4Q4RA 4HNUA 1K8XA 1AW2A 5HMEA 1DHKA 3LHZA 2YFOA 1OM0A 3MA8A 1ENUA 4KRUA 2RDWA 3GTHA 4AZHA 2A7PA 2P53A 1NOWA 2HE5A 1YBQB 1H1YA 3O63A 8XIAA 5E09A 3ARPA 2A3CA 1M41A 1W3KA 1P0KA 1RUSA 5H8UA 2B7NA 4DO7A 1YTEA 2V5CA 3PHAA 3LBCA 4QIUA 1QO2A 2BMBA 1LG1A 4U2ZA 2BOEX 3G8RA 4TX9A 4DYJA 1DWGM 1FWBC 1X6NA 5CAKA 5BRBA 4HOXA 4IGNA 3R89A 4JQ1A 3QV9A 3Q65A 1W1VA 1KFLA 3TONA 3WKZA 1E56A 3BMVA 3VIPA 3LA4A 2JF6A 3SCTA 3NPUA 5F2LA 4NY2A 4UR8A 1THFD 3JR2A 1XS2A 4LVDA 1TUXA 2PRHA 1E9ZB 1BKHA 2GGJA 2C0AA 1Z6KA 3TTQA 4U28A 1RK5A 2C1HA 1NTHA 2PEVA 1JI1A 3ARUA 3LI1A 1H5VA 5CPLA 1V77A 3KS6A 1HTIA 5IHSA 1JNDA 5I3IA 5D8WA 4PTNA 1PKNA 3T78A 1G5AA 1UR8A 1KO0A 5C9UA 2WVUA 2OWCA 1PTDA 1KNWA 3A24A 3VTRA 2XWEA 3H12A 5FEXA 1TPFA 1X7FA 4I7VA 1DJIA 3WUFA 1KRCC 2ZC8A 1J0YA 4D6JA 3W76A 1CGYA 4BEQA 3HFTA 1NIUA 1CXLA 3LHUA 4LPCA 3WQ6A 4E8DA 3ZJ6A 4AW7A 2DT3A 4A3YA 2DSVA 3RLHA 1VPXA 4KWVA 3DHDA 1UB3A 2GDUA 2CBIA 3MCNA 4ZGYA 4I6VA 4B9ZA 5FEWA 1PX8A 3QVQA 1VRDA 3T55A 3KL0A 5C54A 4PRRA 2XGZA 1AODA 1L8PA 4M51A 1W8GA 3LTPA 4XZMX 3TXZA 4TR9A 4LYRA 3FHAA 4D9PA 1EQCA 3WQOA 3W07A 5DT5A 2ICSA 3O15A 4O57A 1KV5A 5FI8A 1SO3A 3M0ZA 3WDPP 3A9BA 1W5PA 1DOSA 1QPOA 1PE1A 2ATMA 4JX4A 3UBPC 1OFOA 2GSHA 5BNKA 3NA8A 1SR9A 4CCCA 1J5TA 2FZNA 4M81A 1XGDA 2QCDA 4OT7A 3C8NA 4MHBA 3VMOA 5DO8A 2IKIA 1XM3A 4Q4MA 4UMCA 1XUZA 1W37A 5DMLA 4G7EB 3IAQA 3NIYA 1M9HA 3IJLA 3WJYA 1TWZA 2WKJA 3SCSA 2PWUA 2RHGA 4PODA 1B2YA 2VGIA 3U2EA 4FXJA 1PYFA 3UXIA 2KZHA 2QXWA 3CZGA 4OQVA 1WDSA 1QCWA 2QMJA 1BLIA 1GOKA 2REQA 4RE4A 1OBAA 4B91A 1T7LA 3SFKA 5H2ZA 1GKPA 3UGRA 5HJLA 3PZ9A 1Y7VA 2ISVA 1E6RA 2CLMA 4EK7A 7TAAA 5G2HA 3GDRA 5I00A 2NW0A 2IXUA 3WQ5A 4FNTA 1NF7A 2BV9A 1O12A 4GC3A 3P8IA 3W29A 4KH2A 4PTDA 2OX1A 4H6EA 2CBJA 2H3DA 4W89A 5TF0A 4W93A 4X2PA 1UQYA 1VCFA 4MKSA 4XV0A 2DZWA 4V28A 1XYBA 4UXDA 4L7ZA 2J9YA 4I7UA 4C60A 1OG0A 1HO1A 1EGMA 1E6ZA 3RK8A 5FA5A 2BGSA 4MY1A 1XIDA 2QCFA 5G2IA 4ZFMA 1IYXA 4Q3MA 4I5UA 1CCWB 1ZP3A 2PTWA 4FO4A 1W1PA 1BGAA 3KCJA 1Q6DA 5DXXA