3W07A

Atomic resolution structure of orotidine 5'-monophosphate decarboxylase from methanothermobacter thermoautotrophicus bound with ump.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Atomic resolution structure of the orotidine 5'-monophosphate decarboxylase product complex combined with surface plasmon resonance analysis: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 83
structure length 215
sequence length 215
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2012-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w07A00
2QCCA 5F2GA 3S1VA 1KM2A 3L5MA 5HINA 4LVAA 4EF8A 1LBFA 1TPVA 3NDOA 2HSAA 1TPC1 5EPDA 1SPQA 2H8XA 4O1AA 3EX6A 5G2WA 3SZ8A 2R14A 1TQXA 2ZRVA 1W8SA 2E1DA 5FEXA 3E49A 3UY7A 3HBLA 3L68A 3PUDA 3T40A 1XBVA 1A50A 5DBTA 2ZRYA 5KITA 3PF3A 1J2WA 2J24A 4O4VA 1KV5A 4WXZA 4K36A 4UNLA 3W83A 1T0OA 1R47A 3W7RA 3EKZA 4CNNA 1JJKA 3MI6A 3CIWA 3DFOA 4M6QA 2V5LA 3HB9A 3LCIA 1FQ0A 2H6RA 1SQ7A 3W3OA 2JKPA 4UCGA 4XQ6A 3UXDA 1RD5A 2E6AA 4KFOA 4RLIA 5CSSA 1WX0A 4HNNA 1MSSA 1TO3A 2RH9A 1TTJA 3DFNA 4B5NA 4IPJA 4NUWA 1LLZA 1OYBA 3W7PA 4YCOA 3NL5A 3TMQA 3DI1A 4K8EA 1JCJA 1Q6OA 4GUGA 4BWLC 1BKSA 1VCGA 5FF3A 3ATZA 5EBUA 1P0KA 1DQWA 1EWEA 3ABRA 3S5OA 1JRBA 2V5BA 2VEKA 4MKNA 3TIMA 2E6FA 1G4EA 2R91A 1PHQA 3ZWTA 1KLYA 1JCYA 3RLVA 2QJIA 3W1NA 4GJ1A 1UUMA 2OCZA 1FY6A 2Y7EA 1GZGA 3W2MA 3LX9A 5AHMA 1QR7A 2YYUA 1JUKA 2VFEA 1OFOA 2H8ZA 2LLEA 2JKEA 3HQ1A 3QW3A 4MLRA 3OIXA 2X1RA 1TMHA 4YCPA 2QR6A 1LRTA 2XN1A 3PBYA 1VYPX 1S5WA 7TIMA 5BMXA 1YXCA 3O6CA 1TPH1 4JX5A 3JR2A 1FXPA 2HS8A 1U83A 5G2HA 3MI3A 3U2OA 4LU0A 3TH6A 4O8RA 3OBKA 3W1UA 2YR1A 3TXVA 3H54A 2OMAA 4DF1A 4JTEA 4WD0A 4AB4A 2ZTJA 3CEPA 1OVDA 3UPBA 3QJAA 3BLEA 5H91A 1WV2A 3USBA 4LV9A 3IIXA 2A2IA 4Y90A 4ML9A 5D33A 1EA0A 5AHIA 3V1PA 3QZEA 5CZJA 1AK5A 3MMTA 1I2NA 4QNEA 2QCMA 2ABAA 3LTPA 1L9WA 4NJGA 3UNDA 1H7NA 4O15A 3QM3A 1PV8A 5L9FA 3HG3A 1ICQA 1N55A 3PBVA 2B7QA 3LV6A 5AC8A 5I3GA 4IJBA 3HIJA 5CZSA 1X8FA 3UWUA 4LV4A 5D38A 3C56A 2ZZ4A 1TJRA 4DEFA 3M5ZA 1F76A 2CLMA 3ZWSA 3O06A 4EWND 3W2LA 1OF6A 4FF7A 3PC0A 3THQA 4OHQA 4A2SA 1KBJA 1N8FA 4LVBA 2JKAA 4O4WA 3NEVA 5FESA 4O50A 4O57A 3W2NA 5AB3A 3WK3A 2YFOA 3NM3A 1I8JA 5J5RA 4Q4KA 1F7BA 4LY8A 1FWRA 1ZCOA 3HPSA 3LHYA 4ADSA 1DVJA 3TU9A 1TV5A 2P1FA 1YLVA 5LNRA 1F05A 4GUJA 3W86A 2V2CA 4LVFA 2DORA 4QISA 1G7VA 4S1FA 5AFDA 3W88A 3OEXA 4DF0A 2ZA1A 3E0IA 1C29A 3N9SA 4I9AA 4OU1A 4K38A 3GNDA 1YPFA 1KFLA 4NNCA 4IQLA 1H63A 4NJJA 1JCLA 1P5BA 1K3UA 5G1TA 4XZ9A 3G8EA 2YYTA 3FJ6A 3W7LA 1SZFA 2VEPA 2A5HA 2C0AA 4S2CA 4O18A 5EL1A 1ML1A 1LORA 2QCNA 3SI9A 3THAA 3C6CA 3T4CA 3IIZA 3M47A 4JEQA 1RQBA 3DKLA 1SO5A 5LGXA 3NOEA 5HUPA 3UWYA 4MYXA 1LDCA 2WSQA 2P10A 5EKYA 2ZRUA 1LBLA 1T99A 3GXTA 1OFBA 2DJXA 4O0KA 4JDYA 4MZ1A 4PEKA 3GK0A 4JYDA 2X16A 4PCFA 5F1UA 3PWAA 1VGAA 5IBXA 3BG3A 1YDVA 1M7OA 3S42A 4FIRA 3IEBA 3W6YA 4JY8A 5FI8A 2QCHA 3M5VA 4ZQMA 4QITA 2H3DA 4ZQPA 1SUXA 4UTLA 4KWVA 3WJZA 1H1ZA 1WAUA 2A7NA 4H3DA 5SWUA 3LTSA 3CT7A 4JDBA 4MUZA 1QO2A 4JTLA 5D2WA 2XN2A 1ALDA 3W74A 1QPRA 3P67A 1A5AA 4M6PA 3G1VA 5F4WA 1LROA 3W85A 3S8HA 2QUUA 4GNJA 3M16A 5D2VA 1G69A 3LCHA 3G0SA 4JTHA 2QUTA 3PR2A 4I7WA 3W70A 3NPWA 4BFAA 2QEZA 3B04A 2Y88A 4RZ6A 3H53A 3QMTA 4O1DA 1FX6A 1MXSA 2YXGA 1H7OA 3FA5A 1NSJA 4IOTA 4A22A 4NU7A 1DJQA 3P82A 2I9EA 1JULA 3UZJA 1ZALA 4EF9A 5BW6A 4N4PA 3EWUA 2Z0IA 4OQVA 2V82A 2ZZ1A 3S0CA 5F2IA 2QCEA 4PFMA 5AN7A 1G4PA 5KSWA 4XKYB 1RR2A 1XKYA 4WOZA 3C2RA 4MY1A 1EUAA 5G4EA 1S3HA 3W1TA 4O0ZA 4UR8A 3CHVA 3M5XA 1KA9F 5G4WA 3T7VA 3LOTA 4YXGA 4E2DA 1L6YA 3IVSA 3MJYA 3ANYA 3PBWA 3G3MA 3JS3A 2YZRA 4O12A 1VCVA 5TQLA 3NQVA 1FWWA 3LDVA 1FWSA 4O14A 3G18A 4KWWA 4GRSA 3LHTA 1EEPA 4DXVA 2WSYA 3EX2A 2GUUA 2DZSA 2PRHA 2QJHA 1CX9A 2FB2A 1V7YA 4KKXA 1W5MA 3TV8A 4UUIA 4JGDA 4TO8A 5CGQA 4Z1AA 4DF2A 3QEZA 2ZRWA 4MJMA 3ELFA 3GKFA 4X9SA 3E9AA 4K7VA 4X3ZA 3A24A 4P61A 1GWJA 1R2RA 5DCDA 3GR7A 3NNTA 5CSRA 5ABTA 2YX0A 1JCXA 4JR5A 2RDUA 2DP3A 3W7CA 1QOQA 4AWUA 3NO5A 5G2IA 2WOQA 3TR2A 1KM5A 3S1XA 1K02A 2ZA3A 4JIPA 2E09A 1PCWA 2Y63A 4R33A 2Z6JA 5LZLA 4RZ5A 2ZFAA 4NXSA 3HG4A 2VKZG 3EXRA 2Y7GA 1JUEA 4Z1CA 1HG3A 2GJNA 3BK0A 1YPIA 3PS7A 1GYNA 1DJNA 2A0NA 1EP3A 3EB2A 3E96A 4ONVA 2ZZ3A 2OZ0A 4I7UA 4UTIA 1A5CA 2YFNA 3O63A 3W7HA 2NXIA 1XM3A 1Z42A 1AL8A 2E68A 3W7OA 2WNZA 4CLMA 1PIIA 3TQ0A 2ZQ0A 3MWAA 1X7FA 4JTUA 3MYPA 1GG0A 3NXFA 1OFEA 3DHFA 2J9YA 3QW4B 5LHFA 4XBKA 4XBSA 1VQTA 1OX5A 2TYSA 2QF7A 2GQ8A 5HMSA 3VE9A 1VYSX 5FEWA 2G5WA 1QDSA 2CLHA 1NAL1 4Z0SA 4IXXA 4PH6A 1W3IA 2OX1A 3B05A 1LYXA 4UC5A 3G1XA 3S1UA 2I1OA 3OG3A 3EX1A 1HL2A 5E93A 3LRKA 1LM1A 2DZVA 5DXYA 5FEPA 3GAYA 2DU2A 3W72A 3KVLA 4OT7A 3LCLA 1KFCA 3GDLA 5D09A 1M6JA 3STGA 1RZMA 1KV8A 3QH2A 3BLFA 1VC4A 3PSVA 1W5OA 3LXCA 4FNQA 1PE1A 3E02A 2J27A 1QCWA 1C9DA 5F2MA 4TMBA 3Q94A 1N7KA 4HSNA 3N14A 1WOAA 3FKKA 4PL1A 3PB2A 1SZNA 4AHQA 2ZTKA 1X1OA 4JTIA 4O13A 1IIGA 5AYZA 1K8ZA 4UTKA 2QAFA 4A29A 4A21A 2WNNA 1LCOA 1KM4A 3NZ1A 1LRNA 4YMZA 5K2ZA 3RK8A 2NWSA 3BW4A 4HN4A 4N9EA 4NNAA 1G67A 1K7FA 2Y89A 1OFAA 1DKWA 1QO5A 2Q3OA 3E12A 4JXCA 2X2GA 3EXTA 3GZ3A 5I3KA 2J9ZA 3QSTA 2YCEA 4DELA 3NPVA 1P0NA 2CU0A 1KFJA 4IXHA 3INPA 3KRUA 3FOKA 3W87A 4IMFA 2FTPA 1MO0A 1I2RA 2W0UA 4BF9A 4LUJA 1AW2A 1LRQA 4UXDA 1OX6A 5EYWA 5HULA 1FCBA 3STFA 1K7XA 1NF7A 5EY5A 4IMEA 4CNOA 3M7WA 1OX4A 2GQ9A 4N9BA 1MEHA 3R2GA 4JICA 3BGJA 1J4EA 2JBMA 4IX2A 2HS6A 1I4NA 2VFIA 1XXXA 3NQ8A 3P8IA 4YLWA 3W76A 1P4CA 3KRZA 1VCFA 3A5FA 2A1YA 4HNUA 4WZHA 1PL9A 3R12A 3I7QA 1FDYA 2WJZA 2V9DA 3MW7A 4N2YA 3L2IA 3NA8A 2TPSA 1DQXA 3HGJA 3FFSA 1KTNA 2V2HA 4KFNA 2NX9A 3RLUA 3NQAA 4E2BA 3W73A 4WY0A 3G1FA 3NYZA 4O19A 2E5CA 4UFIA 5DCEA 3W1AA 1LOQA 4K8HA 3P60A 1Y0EA 2WSRA 5AC7A 1TJPA 1YADA 3MHUA 3C61A 6ALDA 4OGZA 1O5XA 3Q2DA 1T96A 3W7NA 3DXIA 1XUZA 2CLEA 3F03K 3F1QA 1GG1A 3N19B 4MJZA 1EPXA 1W5PA 4UTJA 4O17A 4OV4A 3T44A 2JK2A 3VI2A 3A9IA 4CCCA 3LHWA 1G4SA 3MP4A 2J88A 4FXSA 2ABBA 4LS2A 3V75A 4X2RA 1TTPA 2RKXA 3SGUA 1F6KA 2ZDRA 1JR1A 3PULA 4BK9A 1ONRA 4RZ4A 4H6KA 1L2UA 3F4WA 3GDKA 2YW3A 2PCQA 2V0TA 3TJXA 1O60A 1PS9A 3N9RA 2Y62A 1TIMA 4K37A 5C5YA 3TSBA 5G5IA 1UUOA 5HUOA 4FXRA 4NX5A 5AOUA 3PVFA 3STCA 1OFRA 1ZAIA 3C2OA 3O1NA 5CPMA 3N2MA 3TJLA 5AHNA 4CQAA 1K8XA 3L21A 3LLDA 3UPWA 1THFD 4O53A 2ZZ6A 1S5VA 4DO6A 4GUFA 6TIMA 4EIVA 3B0PA 2ZRXA 2Z2UA 5FF2A 3SFKA 4N02A 1OFDA 3NPUA 3I6RA 4W9TA 2FPVA 2QDHA 3HPZA 4GWEA 1ZAHA 4MIMA 4Y96A 5LNWA 3VKJA 2HMCA 3HGSA 1W5NA 3P62A 3LGEA 2B0MA 2FQIA 1O4UA 4UTTA 3MO7A 1QPOA 3HG5A 3QMRA 1FXQA 2V2DA 4L4LA 3D0CA 5K3VA 4R34A 3A21A 1WOBA 1GTEA 3UWVA 1XL9A 5DY3A 3QYQA 2CW6A 3BPWA 2W6RA 3WJSA 3W75A 3KVJA 1KW1A 1M7PA 3CLMA 1KFEA 2F84A 2H90A 3BVJA 3CPRA 4OWGA 5CG7A 2E6DA 3HGRA 4RX0A 3T55A 2DZXA 5HWMA 3GIYA 4RXGA 4ALDA 2CZDA 3PY2A 3MYOA 2FFCA 1Q6QA 3NAVA 3EWBX 4IUOA 5FF4A 4UTUA 1R46A 5I3IA 5CPLA 4UTMA 1WBHA 1TPWA 3NQ7A 4FNTA 1FCUA 3UWWA 2FLIA 2CLKA 4RR4A 3GYEA 2ATSA 3W7EA 1UCWA 4M7SA 2RHGA 4GBUA 1F5ZA 4MYAA 5DY2A 3I7RA 1LBMA 4NXKA 5E0KA 3W7KA 3G3DA 1ZENA 3W7JA 4O1CA 3NM1A 4YL2A 5DN1A 4P2VA 5HNRA 4RJEA 3LRLA 4NVTA 2Z1BA 1EIXA 1OJXA 3W07A 4CQ9A 4A2RA 4LTSA 3UQNA 4LNYA 3TMLA 3EWZA 3NQDA 4MVAA 4LC6A 3CWNA 4LC8A 5F4XA 1TV7A 3CC1A 1OFPA 3O6DA 1RQEA 4QM1A 4BI5A 4POCA 4N9DA 4JS3A 1EX5A 2VELA 4LWWA 1H50A 1EB3A 5C6MA 3RU6A 3TW7A 1SZGA 3QMSA 3PB0A 5D05A 1XBZA 4UMBA 1KFBA 3LCGA 3IGXA 1LOSA 5HWNA 3LERA 1TPUA 1ADOA 3MHGA 1GVRA 1SU5A 1FCVA 1YDOA 4HKPA 3TROA 2O7SA 4UFLA 3W1RA 2WQPA 2B7NA 3BARA 5F2LA 1FUYA 5A8GA 3S5YA 4ADUA 3HG2A 2ZBTA 2Z6IA 1W37A 3U6WA 1EP1A 5C2XA 1SFJA 2YPIA 3NL2A 4NQ1A 3M41A 4JNMA 1YDNA 3I68A 3TQVA 3W7IA 1TQJA 3L0GA 2W79A 4UIOA 4AVFA 1PVNA 4J9JA 2EHHA 4MY8A 4E38A 2E6YA 1ICPA 1I2PA 5DBUA 1ME8A 3M5YA 1HO1A 3DGRA 3P7YA 4JIQA 2CWNA 4JY9A 1Q3NA 1QFEA 3FYOA 1FBAA 3G1AA 3W2UA 3O15A 2C1HA 1SZEA 3HGOA 2E77A 1ME9A 4FO4A 4JYFA 3EX3A 3SR7A 4X22A 4Y6GA 1QPQA 2GOUA 5LNVA 2NV2A 4I7VA 1YTDA 3HO8A 3FIGA 2PRMA 3EWXA 4JX4A 3C4UA 2C3ZA 2FDSA 2QUVA 2GVLA 3ABOA 3GXPA 1IXQA 1YYAA 3OVRA 4NNBA 3W71A 2GPTA 3GVGA 1ZAJA 4KFPA 4UTTC 2QCDA 4UNKA 1X1ZA 3ZS4A 4QNWA 3FLUA 3GDTA 2AGKA 1GEQA 1XI3A 3NQ2A 3TFXA 3I7SA 3STEA 2QCLA 4PODA 3UWQA 3HMJG 1QWGA 3DFSA 1U5JA 4H4IA 4LVDA 4R7JA 3WK1A 2OJPA 3WK2A 4HPJA 4FX6M 3EX4A 4HNTA 4DBDA 1JUBA 2PC4A 3NVTA 2CLIA 3LI1A 2NV1A 3TX9A 3L9CA 2G95A 1FDJA 1GJPA 4XTIA 4AHPA 1R30A 5KZDA 2B4GA 1SSGA 1BTMA 1XDMA 1S5TA 1K03A 5D37A 4M7TA 4Z08A 3W7DA 1UB3A 2GJLA 5CZTA 5TBOA 4TX9A 3BG9A 1GT8A 3G0UA 3W2JA 3IIPA 3WFAA 2TSYA 2CLOA 4IMCA 1LLWA 4E0CA 3LBCA 4O10A 3W9ZA 4GC4A 3O07A 4D2JA 4FNUA 3DH7A 3N3MA 1JQXA 4DO5A 3PM6A 4DO4A 5E1QA 2Y85A 1K7EA 1AW5A 3G1YA 1DL3A 5J5DA 2A85A 2VFGA 1KTCA 4C1LA 4LS0A 2ISWA 2C15A 5K9CA 4UTWC 2FJKA 2NZLA 2A7RA 5C54A 1D3HA 1LOLA 1F73A 3TC6A 3W2KA 4BI7A 1TPFA 5LHEA 2YGYA 1H62A 4O1BA 2NX1A 4WXYA 1KTBA 3P5YA 2QAPA 3QSRA 1UJPA 3IV3A 4LS1A 3TSDA 3M44A 1TRDA 1LP6A 3GAKA 4UMAA 1VLIA 3LRMA 4TU1A 3NQCA 4WJEA 2GVJA 2Y61A 3B4UA 3LCXA 1I2QA 2FIQA 3GB6A 2WKJA 2EF9A 3W1PA 4R53A 4UFKA 5TIMA 4ZQNA 4JTGA 4FX8A 1XCFA 3BW3A 1DV7A 1H7PA 3GXNA 1R2TA 1DOSA 1ZFJA 1FWTA 4FIQA 2A4AA 3B8DA 2BLEA 3H55A 3NR0A 3Q58A 4U4MA 3FKRA 3DU0A 4AAJA 3B03A 3KFTA 2VEMA 1SSDA 1W56A 4YWIA 4UFHA 4LRSA 4N6EA 1QPNA 4Q32A 3MP5A 5AYYA 1IIHA 1TRIA 4O54A 4OV9A 1WDWA 3L65A 3PG9A 3GNNA 1A5BA 5GVJA 3KVKA 3TXZA 4ZVJA 4AXKA 4JD4A 1KBIA 3DHDA 1L6WA 4WQ6A 1VPXA 3NQGA 3A23A 5BMWA 3TNOA 2GVGA 5H2ZA 2WNQA 3BO9A 4WUIA 1BWLA 3A22A 3L0NA 4XTDA 3DI0A 3O8AA 3MI2A 3G0XA 3S9YA 3CM4A 4QSHA 5K9XA 1D3GA 3RFAA 2XFWA 2AQWA 3DAQA 2DZTA 3C0JA 3NPXA 3R13A 4HNVA 5D2XA 4OE7A 3CQ0A 1GOXA 3N73A 1W54A 5KTLA 4XWUA 4LT9A 4U28A 1KM3A 4K39A 5K4XA 2C14A 1TPEA 3L67A 4CCDA 4ORMA 3UZ5A 3L5LA 1A5SA 2I14A 2AAMA 5HQEA 1NFBA 5LKYA 2Q3RA 4FEZA 2QJGA 5AC6A 1GVOA 1DORA 2F7FA 3MHFA 3CU2A 3L5AA 3TCEA 4GUHA 2Y70A 3L66A 4JTJA 3M0ZA 1ZNNA 2ZYFA 1ICSA 2ATMA 3W7GA 4A3UA 1IXOA 1HFBA 2QCFA 4JTTA 1O95A 5F1VA 2ISVA 1W0MA 3TA6A 3HOJA 3M43A 1YTKA 3OA3A 3C2VA 3OVQA 1OX4B 3BV4A 1QNVA 3KX6A 4LOCA 3R89A 1IGSA 3QQ1A 3IVTA 2JGYA 3KXQA 1VYRA 3GKAA 3P84A 3VCRA 3KOFA 1H1YA 3VNDA 2WPBA 1PHWA 4QIUA 3S1WA 5I3JA 3BGGA 5D2YA 1I45A 3I65A 2OT0A 1VS1A 2IQTA 4K7YA 5DELA 1XBYA 3HPXA 3AO0A 1TYGA 4RK8A 1GVQA 1G6CA 3QRHA 2R8WA 1RPXA 4O28A 1AMKA 2A6LA 2B7OA 3G1SA 5FF7A 4NJIA 1JVNA 4WY0B 1WYIA 4QAIA 1BWKA 1YXYA 4AMAA 1V5XA 4Y8FA 1VHCA 2DZPA 3VE7A 1VH7A 5HR7A 3S5ZA 3FJLA 3NG3A 1GVSA 2XN0A 4ZL1A 4FB7A 3TSMA 2VXNA 1QOPA 3A5VA 1T8XA 4NJKA 1XFBA 4JTSA 4O11A 3P5ZA 2ZCGA 2VC6A 3SY5A 1YTEA 2X1UA 3EWWA 4PC8A 3NL6A 2PURA 4JTFA 4DPQA 3QPZA 4Z1BA 4M19A 4MZYA 2VOMA 3OVPA 2NX3A 1JCNA 4FNRA 1A53A 3O6YX 3TC7A 2ZRZA 3F4NA 1YXDA 2B7PA 2ISSA 4UFJA 1H61A 4UR7A 5K9DA 3MBDA 1HUVA 3C2EA 4AHOA 3R8RA 3EXSA 4ZQRA 4AWSA 3FEMA 2YW4A 1SO4A 4JYEA 3LBMA 5CPOA 4WOQA 2R94A 1HO4A 4C1KA 5DCBA 3W23A 3EKLA 2NXGA 4NZJA 5CKSA 2RFGA 3KVMA 1B3OA 5DXXA 1WXJA 1H7WA 1SR9A 2ZA2A 3PG8A 3P8JA 2ALDA 3KAOA 1QAPA 1IXPA 3GDRA 2UV8G 1LTDA 3O05A 2Y6ZA 2QDGA 3S5NA 3LLFA 3NZRA 3DFQA 3GR8A 1B4EA 5K7JA 4O52A 1G4TA 5T26A 5LNUA 1JCMP 1VRDA 3VFLA 4NZFA 3DENA 4NX0A 4BI6A 1CI1A 1KFKA 4BR1A 3HJZA 3SJ3A 4Z1DA 4AH7A 1VR6A 3W1XA 1O5KA 1RQHA 3JRKA 2EKCA 3RF9A 2Y7DA 4MFDA 1AW1A 4ZMGA 1RV8A 1NF0A 2V81A 3N34A 5EMUA 2FPTA 1H60A 1SFLA 4K6AA 1GYLA 2NUWA 3C52A 3DZ1A 5EA9A 3Q37A 3WK0A 2CZEA 3B0UX 2Q8LA 3IGUA 2DZUA 1PCKA 4PTNA 1OF8A 4S2BA 4AWTA 3LCWA 4MFEA 5KZMA 3NQ6A 1G7UA 1P1XA 3DKJA 3QQ0A 3UXAA 1OABA 3PSWA 3WJXA 1J5TA 1TTQA 1W1ZA 4EVZA 5A5WA 3TW6A 1LZOA 1MEWA 4Y9AA 3K30A 2RDTA 4WX2A 3TKFA 1IXNA 3MBFA 3U8GA 3GX9A 4FNPA 4N6FA 3M1ZA 4CCEA 1AG1O 3GDMA 4GE8A 2KZHA 2TMDA 3RNDA 4ZQOA 1NEYA 3L0KA 4HHPA 2YDAA 3P81A 4MPQA 2BZNA 3OHIA 2FB3A 3W1MA 2TRSA 4ICNA 2NUXA 4ZZ9A 5MHBA 2C13A 4RV8A 1SO6A 5BOOA 3B06A 4MZ8A 3W1QA 3P80A 4UTWA 5BNKA 3EWYA 1F2JA 5D03A 3LTYA 1R2SA 2WV8A 2D73A 2V30A 3IVUA 2A7PA 1FWNA 1NVMA 5FF0A 2Y7FA 5U4NA 1IF2A 1WBJA 2X30A 2EGZA 3TAOA 4IPIA 1WA3A 3S6DA 1KLZA 2WO5A 3TQKA 1UBSA 3SW6A 2CZFA 4UMCA 4PL2A 5AHFA 1FCQA 3CB8A 4ORIA 1F74A 3O16A 3BLIA 3TUUA 3ZFHA 5G1YA 4LW7A 5I3HA 1EWDA 5KINA 1ZHAA 1TV8A 3SECA 5KZEA 3CTLA 3GLCA 1GQNA 5AHLA 1OFQA 5CZ0A 1M5WA 4FNSA 1GPWA 1ZJIA 5C55A 1B4KA 1Z41A 1TSIA 4JN6A 3UYCA 3W22A 1RVGA 4EOUA 1KM1A 3AJXA 1TPDA 4LRTA 5AHEA 3CEUA 1W3TA 1VJIA 3CIXA 1B9BA 3TDFA 1SW7A 3LHZA 1SW3A 1D9EA 2O7QA 4XUGA 5CPNA 5I3FA 1OG0A 3NQEA 5U7SA 2BSLA 1E51A 5KMYA 1TREA 3LB0A 4JTKA 3TAKA 3LXBA 3ZR4A 3PBUA 3BG5A 2ZZ5A 1BEUA 3LI0A 2A6NA 2QCDB 2DJLA 1VHNA 1X6UA 3NQFA 2PRLA 2VEIA 1JQVA 2BXVA 1DHPA 4UTHA 2C16A 3WJWA 3TFCA 4XKYA 2YSWA 4Z0JA 3SIZA 1W3NA 4FX7A 1OYAA 3W7QA 3TK7A 1C8VA 2PE4A 3KRSA 3LHVA 2G97A 1OK4A 1O94A 1TPB1 5HR6A 4L4MA 3UY8A 2QCGA 3G24A 3G8RA 4RCXA 3MUXA 2FPYA 3FYPA 2EPHA 1TCDA 1HTIA 2VENA 4HPXA 1KM0A 3IIOA 5D2TA 4RKAA 1B57A 3PUEA 2E5BA 4CQ8A 1VLWA 1XDLA 2CLLA 1SO3A 2DZWA 3NGJA 1F6PA 1TB3A 1GTHA 2A21A 2VFFA 3QC3A 1XC4A 3LM7A 5LNSA 2CLFA 4IX0A 3N2XA 3QFEA 3P74A 1EP2A 2BX7A 4M6VA 3RMJA 3KHJA 2C19A 3QF0A 5LGZA 5HJLA 3ABQA 5L6UA 4CNPA 4N4QA 1L6SA 5D04C 4IMGA 4Q33A 4GUIA 4IWWA 3IGSA 3T78A 3IRDA 2EAWA 8TIMA 4AF0A 3HF3A 3PAJA 1EUNA 4AF0B 3DFPA 2CFFA 2VFDA 5AYXA 1Q6LA 3C3NA 2X1SA 3EEGA 4OBTA 4GXMA 2HTMA 1Z48A 4TR9A 3UWZA 3YPIA 4DBEA 1OYCA 1ME7A 1CW2A 1MEIA 3MP3A 1GVFA 3ABSA 1WQ5A 3IIVA 2NXHA 2NLIA 4HIBA 2JGQA 2ZZ2A 4BWLA 1KM6A 4LUIA 5IM51 1TTIA 4UFMA 1DBTA 3W84A 1Q6RA 4NJHA 5D30A 2X1TA 4HT3A 5D32A 3G22A 3WJYA 3PUOA 5HWJA 2BWGA 2ZZ7A 2G96A 4O16A 4TMCA 5IBXC 3R5EA 4N9CA 1XUUA 2GQAA 1H7RA 5F4SA 1I2OA 3M9YA 4MY9A 1SW0A 4QJ1A 5FEZA 3LV5A 4AEOA 2V8ZA 3SGZA 1FDZA 1W31A 1JRCA 2RDWA 4TIMA 3NQMA 3BW2A 2BTMA 2E5DA 1K8YA 2OT1A 3W7MA 2C18A 1ZY9A 4G1KA 1H7XA 1W5QA 1OK6A 3G1DA 3M6YA 1Q45A 5BRBA 5LSMA 4M5PA 3C2FA 1AL7A 3NL3A 4PA8A 4NT0A 4JX6A 1Z44A 3G1HA 3LXAA 2H3BA 3CWOX 4ZQCA 4DPPA 3P61A 1H51A 4DQWA 5D02A 1MZHA 3ATYA 3FS2A 3DBPA 3W1LA 2P0OA 2CZ5A 2J6XA 2QKFA 2VFHA 4LVGA 5K4ZA 3C8FA 3QPYA 3B0VC 3TE9A 4WY0F 3UD6A 4MOZA 4ADTA 3DFTA 1OHLA 5DLCA 4FHAA 2NUYA 1UASA 1H5YA 2J9XA 4MLJA 1QMLA 4IGHA 4QQ3A 2C6QA 4IMDA 4RXFA 2Q8ZA 1XBXA 4GFSA 4HSOA 3LCFA 3LHUA 3SSJA 1VZWA 2NWRA
chains in the Genus database with same CATH superfamily
5CAKA 1PPIA 3P14A 1F4AA 1WUEA 3PTKA 4CD7A 1TPVA 3AMGA 3LK6A 3SZ8A 4BEUA 3OLEA 1CEOA 2D0GA 3V5OA 5FEXA 1BGGA 1QI5A 2YJQA 3TJ4A 8RUCA 2PDIA 3PF3A 1J2WA 3VIMA 4UNLA 3CHFA 3SSZA 3PTQA 4PR4A 3VNIA 4M6QA 2V5LA 3TWAA 4H8HA 4IJCA 3HB9A 1BSLA 4YYCA 3AIVA 2KX9A 1RD5A 3OPSA 4KFOA 2Z1SA 5CSSA 1TO3A 1OINA 3P6LA 4DWSD 4OVXA 4YCOA 3HM7A 4O0QA 3EDFA 1JCJA 1Q6OA 2CBUA 1O5RA 3W27A 4BWLC 4NZCA 4V28A 3G6LA 3ZLGA 4AZBA 3ABRA 3RUBL 1SMAA 2VEKA 2E6FA 3W6LA 3LZ3A 1CGTA 4HYVA 4ROQA 5A6AA 3UJSA 2Z7KA 3A9BA 2YYUA 5FD0A 3CS2A 1ISYA 1OCBA 4DO7A 4JIRA 3ARUA 1EDGA 1BXNA 1M53A 4IFKA 1AMYA 5LXXA 3WMCA 3T08A 1NOWA 2HE5A 1TWDA 1CTNA 3CL7A 3PBYA 4DM2A 2OZ8A 4XBJA 5HAOA 1YXCA 4MHBA 4B3KA 5JMUA 3CL8A 1UC5A 1DYSA 2HS8A 3WLTA 1U83A 1TG7A 4MWAB 4WF7A 2AOSA 5BCAA 3U2OA 3TH6A 2VQTA 3S4TA 1YNYA 1Q4WA 2YR1A 3TXVA 3GH7A 1UH4A 2OMAA 3CEPA 1XLLA 3QJAA 1TVPA 5H91A 1EH9A 1XX1A 2J74A 3USBA 4LV9A 3NDYA 3T81A 2A2IA 4LALA 2DGAA 3S2CA 3D3FA 3M0LA 3IJIA 1AK5A 2EG6A 3S2MA 4L1GA 4NJGA 3R7MA 2J47A 3UNDA 5JIWA 2X7VA 3C0LA 2G8ZA 5D9NA 3QM3A 1XIGA 1PV8A 3I3BA 3FV9A 3VIJA 2BY3A 3AMDA 3CV6A 3ITGA 1E6SM 6A3HA 2I56A 1FH8A 5CZSA 1X8FA 3QV6A 1H11A 3C56A 5D38A 4QLKA 1HN1A 3MPGA 1RK5A 3IK4A 4KERA 5HJYA 3ZWSA 3WUFA 2WJEA 3VX0A 2J75A 4A2SA 4NHVA 3WLMA 2BG5A 4DXXA 4O57A 1FWHC 2QT3A 1J8VA 4KT2A 3EOSA 2FMNA 3NM3A 3H2EA 2VL4A 1QXLA 4Q4KA 2OZ3A 3HPSA 2X8RA 1DVJA 3UEQA 3ITCA 3D46A 3WUEA 5LNRA 4GUJA 3A12A 2DORA 6ENLA 1CECA 4C6OA 3W88A 4KCTA 1FH9A 3OEXA 4QG9A 4NAEB 4I9AA 3N9SA 1EC8A 3C86A 3GC4A 3H12A 5A6TC 1K3UA 5G1TA 4J2PA 1SZFA 1X98A 2VEPA 4JQ1A 3TVAA 3WD4A 4CQCA 3ITOA 2I17A 1BWVA 4RE4A 4XG1A 3CO8A 3NOEA 2DW6A 2BY2A 2P10A 4XSMA 5EKYA 4EWJA 4TX8A 4O0KA 1OFBA 4FI4A 3SRDA 4MZ1A 4JYDA 2VJXA 4PCFA 3GWQA 3GUGA 2PLKA 3KLLA 1XD0A 3IEBA 2QCHA 3M5VA 4ZQMA 4NI8A 4ZQPA 1UWSA 1H1ZA 1WAUA 5REQB 4CEUC 4M24A 1D3CA 1T8QA 1QO2A 4CVWA 2XN2A 1SJDA 4U3CA 4PCNA 2VRKA 1VEOA 5D2VA 1G69A 2QUTA 2R1MA 3H53A 3QMTA 3IS4A 3F7JA 1FX6A 4TTUA 2YXGA 4GGHA 9CGTA 3QKZA 3KBWA 3P82A 1X39A 4QAWA 3VIGA 2WWDA 4N4PA 4E3VA 2WJFA 3WQGA 3MS8A 4JFWA 3V4BA 1XGEA 2DQXA 3S0CA 2A3LA 2ZX8A 4LF2A 3H7RA 2ZUVA 3CZ8A 1JPHA 4O0ZA 3CHVA 1JPMA 1KA9F 3LOTA 4AIOA 3WLRA 4H19A 1KCXA 3RX2A 1A0EA 3GM8A 3ARTA 3G3MA 2H9AB 2YZRA 3GW3A 2EKGA 3FN9A 3MUIA 4M82A 3G18A 2V38A 4KWWA 1QASA 4HZ6A 1PDZA 2GUUA 4GJIA 1CX9A 2QW5A 4H04A 4KKXA 3FK4A 1W5MA 3V3WA 3KM8A 4DBWA 4UUIA 4JGDA 4TO8A 2E7FA 2ZRWA 3F5KA 5AYIA 4K7VA 3BCDA 5DCDA 1YBQB 2XWEA 3BAJA 3R6IA 3N29A 1PJ9A 1XR2A 5ABTA 2PTZA 3AZRA 3W7CA 4GLEA 3FSTA 3GO2A 3NO5A 3GG7A 1N8IA 1D2KA 3TR2A 1K02A 3N11A 2ZA3A 2E09A 2Z6JA 1V3KA 3UCCA 4L9XA 4PYSA 3A6OA 3DIPA 2Y7GA 4V27A 1JUEA 3RN6A 3BK0A 3PS7A 1UPMB 1MWOA 3QBUA 1K9EA 3EB2A 3VTRA 1E0TA 2BVDA 2OZ0A 1AH3A 3N4EA 4MUPA 4CN6A 1A5CA 3O63A 3W7HA 3TLQA 4GO9A 4JIEA 2PLJA 1RCXB 2ZQ0A 2O56A 1X7FA 4JTUA 3NXLA 2A3EA 3MYPA 5XIMA 4QFUA 3NXFA 1VBRA 1OFEA 2J9YA 1PBGA 3B8VA 1OX5A 5HDRA 1ECQA 5ABFA 3VDGA 3VE9A 3R0UA 1VYSX 5A6BA 4FXJA 2CLHA 3R4IA 4PH6A 3UFYA 2HV5A 5E93A 3N6JA 3LRKA 1CXKA 4C6QA 2YB1A 2WMJA 5FEPA 4DJFC 4D6FA 9RUBA 1WDQA 2XTKA 3LCLA 3UU0A 4AX7A 5JBEA 5D09A 1RZMA 1KV8A 3QH2A 1GHSA 2J79A 2ZUMA 1A80A 4URIA 4G7FA 2HZGA 2J27A 1C9DA 4KCVA 1XWYA 3AXMA 1C91A 1Q13A 3A4JA 3PZUA 4E3TA 1KXHA 1SZNA 1DJZA 1X1OA 1HJQA 1W1A1 4E8DA 1K8ZA 3IPWA 3AC0A 1LRNA 4QDWA 5K2ZA 2NWSA 4CD4A 1E6RA 4F0HA 2Q3OA 3F2CA 5I3KA 1Q65A 5I07A 1NJJA 3F5LA 4P8VA 3V5CA 1P0NA 2J8FA 4IXHA 3KRUA 1UR3M 3FOKA 4IMFA 3U2EA 1WNOA 1MQPA 3PWIA 3BQ5A 3M0VA 5HULA 1FCBA 3MWCA 4DZHA 3I3DA 2XPKA 2HROA 3R8GA 4IX2A 3DG3A 3VINA 1I4NA 5AVHA 3NIYA 2A1YA 4WZHA 4OZOA 3I7QA 2ACSA 2V9DA 3N6HA 4A8RA 1QHPA 5HA7A 3ITTA 2HCVA 1JCTA 4KFNA 2NX9A 4NZ1A 1QW9A 2XM1A 1GOOA 3NYZA 1YHTA 1B0IA 3P60A 1EZWA 1Y0EA 4ML4A 1XRVA 3MHUA 1XG3A 3LPGA 4DUVA 1T96A 3W7NA 2CLEA 1OGBA 3AHYA 3N19B 4MJZA 1W5PA 4O17A 4LCRA 2JQXA 4CCCA 2J88A 4I5RA 1RJQA 4JAWA 3R1ZA 1ZU8A 3B0XA 4X2RA 2RKXA 2GFTA 1MUWA 3PULA 1N2VA 1ONRA 5A8NA 4DJFD 1L2UA 3F4WA 2YBVA 3GFXA 2YW3A 2PCQA 2PTWA 3BJSA 2E3ZA 1XRSA 3N9RA 2BVTA 4K37A 1DEDA 2OGJA 3TSBA 3TTSA 5HUOA 5A95A 4FXRA 4GACA 4NX5A 4DJDD 5AOUA 3PVFA 2OYKA 2UWFA 1ZAIA 3C2OA 3O1NA 3WDJA 3JZUA 1MDLA 1V02A 2GDQA 3WNOA 2OODA 3LLDA 3UPWA 1XLMA 1THFD 1F3TA 4CNUA 2BXYA 1A49A 5DMNA 4EIVA 2Z2UA 1V79A 3I6RA 5EB8A 2QDHA 1ZAHA 2HMCA 2QF8A 4G7EA 1YIXA 3KTCA 4HK5A 1QNRA 2B0MA 1O4UA 2XIJA 3EB4A 4Q8QA 3E5PA 1E4IA 1UH2A 1VIZA 3QMRA 4WSHA 2XH7A 1ONWA 1W1TA 3CUIA 2EG8A 2IQ0A 1GTEA 3VIHA 3AALA 3UWVA 1XL9A 3TYCA 2WVVA 2PDQA 2DV0A 4GOAA 3W75A 4DXKA 5LYRA 1M7PA 3CLMA 1KFEA 2F84A 2H90A 3BVJA 1CCWB 5CG7A 3HN3A 1ZTVA 3EZ4A 5HWMA 4ALDA 3CMJA 4E5TA 1EF3A 1UA3A 3WO8A 3NAVA 3AI0A 1R46A 5I3IA 5CPLA 4UTMA 4B2DD 4FNTA 2CXEA 3R43A 3UWWA 3CHCA 4DI8A 2D1ZA 4I5XA 2J4GA 3KS5A 4YN5A 3GYEA 3PBMA 1UCWA 1V8EA 4GBUA 2L5HA 1R8LA 4MYAA 2FGZA 2TAAA 1BD0A 2Z1KA 3W7JA 1O12A 4JEJA 4RE0A 3ARZA 1EIXA 3HJEA 4CQ9A 4A2RA 2ADAA 3UGRA 4LNYA 4PEEA 3TMLA 1KXVA 4N42A 2Z1WA 4MVAA 5T91A 4LC6A 4LC8A 3DG6A 4X60A 1KGUA 4FLSA 4BI5A 3KTXA 4N9DA 3DHUA 4WJ8A 1H50A 1EB3A 4ATDA 5C6MA 2WVSA 4QROA 4S3CA 4DWSA 3PB0A 5D05A 3LCGA 5D4YA 4L6DA 3LERA 3KBJA 3MHGA 2PLMA 1SU5A 1FCVA 3UR8A 1YDOA 4GYPA 3FXYA 5CC6A 1FHDA 4UFLA 5F2LA 2PPGA 5I24A 2EO7A 5XINA 4M51A 1A5LC 1VENA 3KHDA 4GVFA 4U5IA 3BAYA 3NL2A 1JDFA 1X7IA 4JNMA 1TQJA 1J0IA 1MXDA 4MNJA 4E38A 5CGMA 1A5UA 1ME8A 2GVYA 1DWJM 4PRWA 4AZCA 3P2VA 4CQBA 1Q3NA 1QFEA 3FYOA 3DECA 4Q8NA 2D3LA 5EMYA 3W2UA 4H01A 5IFPA 5IDIA 3EX3A 4X22A 1QPQA 5B80A 3BLLA 3C4UA 4PRRA 2VX4A 5JVLA 1OBAA 3ABXA 1PX8A 3JUGA 3VNLA 3IWPA 4OBSA 3GVGA 1W9BM 3OGRA 2OSXA 3ZSSA 1WKFA 3ZS4A 1JF6A 1JDDA 3FA3A 3UZYA 4PTWA 3VXGA 5CPSA 3WDRA 1LUCA 3NQ2A 2VO5A 5HATA 3STEA 1QOXA 1JXJA 3WDQA 4DB7A 4ZR8A 4PCPA 4R7JA 4DUWA 1K9TA 4HPJA 4TOQA 4DBDA 3OQEA 4ZOBA 3ZM8A 3NVTA 2VC5A 3SEPA 3CMFA 1QI4A 2WSKA 1ELSA 3L9CA 1MW1A 1EXPA 3XIMA 1GJPA 4XTIA 4GHRA 4AXNA 2G4FA 4D6JA 1B3ZA 2J7HA 2ACUA 3W7DA 2GJLA 5CZTA 1VFLA 5TBOA 4TX9A 1G0CA 3OYXA 1GT8A 3W2JA 2HK0A 3WFAA 2PS2A 2TSYA 3GDBA 4E0CA 4JZ5A 3W9ZA 2VWSA 1Z3NA 4HP5A 4QS5A 4DO5A 4DO4A 5E1QA 2Y85A 1AW5A 4PTDA 3UGVA 6REQA 3T6CA 2VFGA 4US5D 4C1LA 5K9CA 2FJKA 4FA3A 3TC6A 1TPFA 1HJXA 5CLTA 1KTBA 4ATWA 2QAPA 1IEIA 4FP1A 3KOYA 4RNIA 1ONEA 1AJ0A 3FDGA 2FJUB 4ZXOA 1VLIA 1V3IA 4Q7NA 3SUWA 2FIQA 3EWDA 2OGYA 1ZS2A 4F0MA 3AROA 4F40A 5CCZA 5FIPA 3G6MA 1AQHA 1RK6A 3GXNA 1J93A 3FCPA 1DE5A 2G4JA 5ABFB 3ZT6A 3H55A 1DWHM 3MCNA 3SM0A 4CGTA 3ALGA 3KFTA 1OC6A 2WANA 3VGBA 2XGIA 1NFGA 2XH4A 1QPNA 2WCSA 2J8TA 2RGLA 4OV9A 3AXIA 4PGLA 3O9NA 3PG9A 1RY8A 4HCHA 5GVJA 4ZVJA 2G0WA 4JD4A 1LWHA 2P88A 2EPOA 1L6WA 3M7SA 3HQOA 3TNOA 4ASTA 1Z8AA 5H2ZA 4L61A 2F6XA 1BWLA 1HL9A 3L0NA 1J12A 1B1YA 4GNKB 1W1IE 2V67A 1ZP4A 3W4RA 1EGVA 3C0JA 1PDYA 5DQPA 4OE7A 3CQ0A 1W54A 4XWUA 4QJ4B 4LT9A 4HTYA 4U28A 4K39A 1TPEA 2PWUA 1K70A 1V6WA 1A5SA 2I14A 5LKYA 1NFBA 4X61A 4YVVA 3E2SA 5AC6A 4HBKA 1DORA 4S3AA 2Y70A 4FOKA 4JTJA 1ZNNA 3RCYA 1UWUA 2VCBA 1RUSA 5BU9A 4IUGA 4DYEA 4JTTA 3ZSTA 3SCSA 1DJXA 3KOZA 3RCNA 3OVQA 2WVUA 4XD5A 1IGSA 4TX6A 2JGYA 1XH0A 3AISA 3GKAA 4MJ2A 3WNKA 3P84A 4DRSA 3VCRA 2WPBA 3KW3A 1LL4A 1PHWA 2PDBA 5HJXA 1JGMA 3I65A 2XVKA 2OT0A 4JTRA 4W85A 1VS1A 3WQ8A 5ECUA 4RK8A 3MCMA 1Q6GA 1G6CA 4O28A 2UY3A 4HCDA 4QTGA 4A35A 1UWQA 1C90A 1VHCA 1JIBA 1VH7A 2VT0A 4JCLA 9XIMA 3VC6A 1R6WA 3WLJA 3TTQA 3BSGA 4FB7A 3TSMA 2VXNA 2PF0A 1T8XA 1XFBA 2PEVA 4O11A 4XZNX 2Y5JA 4LYKA 2NLYA 2HXTA 4GPNA 1RXOB 4MB1A 4C7GA 5H1WA 4M6UA 5FJJA 4HOXA 5I79A 4KWOA 1V6VA 3QPZA 4Z1BA 2YCLB 1J0HA 1QT1A 4MZYA 1E15A 2NX3A 3BZGA 2ZRZA 3F4NA 2B7PA 2ISSA 4UFJA 2HQAA 3FVDA 4AHOA 2ZX5A 3CAVA 3GS6A 4JNZA 1ZGDA 3FEMA 3AMCA 4JYEA 1UZ1A 4S3GA 4S3KA 1GZ1A 4PFHA 1HO4A 1KNWA 4GXWA 4QDMA 3FY1A 4NZJA 1X6LA 5CKSA 2RFGA 2RAGA 3KVMA 5BXSA 5DRIA 1LQ2A 1IGWA 3CQJA 1FHLA 1POJA 1OWQA 2P76A 2YLAA 3BZJA 1E43A 1QAPA 3GDRA 3VD5A 1LTDA 4AD0A 2HISA 2QDGA 5DMMA 3AZTA 1S2TA 3GR8A 4O52A 1GUVA 3S47A 4HZ7A 1G1YA 3IRSA 4YIWA 1UH3A 3JZEA 2WHLA 4G7EB 4GQGA 4NYUA 1GQIA 2PDLA 4KEUA 2FPTA 3LEPA 3RM9A 5J04A 1ZBWA 2XISA 2WVVB 4ZBCA 3B0UX 4R9OA 1PCKA 2DY3A 1DIDA 4PTNA 3LCWA 5KZMA 4WRHA 2A3HA 1OC7A 3OZOA 1V6TA 3LN3A 1TFVA 5A5WA 3TW6A 1X96A 3ISIX 2XGZA 5C71A 3AXXA 1SM9A 5TD4A 3HQPA 2NQZA 3WEMA 3GG0A 3ARRA 1ZSXA 4CCEA 3GDMA 3F2BA 4C65A 3QGKC 4U3AA 4DAIA 3KWSA 1NEYA 3TTEA 1G9HA 2VZSA 4DUXA 2YDAA 5E09A 2BZNA 4H1ZA 3MMDA 3D6NA 3NJ3A 1KXQA 3W1MA 3GHSA 1XYBA 4N7QA 3FJNA 3V18A 4H9YA 2VC7A 5BOOA 3V7PA 4MZ8A 3P80A 5CEWA 4YHGA 2VMFA 3EWYA 5D03A 3LTYA 3UG8A 1R2SA 2YL8A 3BANA 4PUEA 2ZC1A 3VZYA 3QVQA 1QBAA 1AA1B 3FJ4A 3QOMA 1JG9A 4FZIA 5FF0A 1EBGA 1JEZA 2EGZA 3O0KA 5E5CA 4D6HA 3KCJA 2FZMA 2Y8VA 3TQKA 4S3DA 2CZFA 4UMCA 3VDAA 5A3HA 4W5ZA 1F74A 3BLIA 3ZFHA 1HGYA 1A0DA 3C5QA 4Q7IA 2AQOA 2WMIA 2EBNA 5CPQA 2VGIA 3F4DA 1BQCA 4GCXA 1GPWA 4H83A 3WIJA 4GINA 1B4KA 1Z41A 3ZZ1A 1TSIA 2Y0FA 3GG1A 4BQ5A 3WUBA 2W66A 1HF6A 5BXPA 3CEUA 4AZCB 1W3TA 3TDFA 3WX7A 3LHZA 3K4DA 3VMOA 2X05A 2JF7A 2O7QA 5GQBA 5CPNA 3DGBA 2XG9A 3WLSA 4XO6A 4E2OA 3R25A 4IQDA 1XLKA 1H5VA 3IACA 2HVMA 3IJQA 2E9BA 2X0HA 1QNQA 1CXFA 4JKMA 3ZR4A 1QATA 1TJ2A 4GKTA 1E72M 2ZUUA 4F9DA 1R85A 3HTWA 5CC7A 1X6UA 3V0UA 4ZEPA 3NQFA 4ZCWA 4TV5A 5J8LA 3BUVA 2PRLA 4B90A 2BXVA 1LUCB 1W3LA 2DH3A 4UTHA 2C16A 4P7OA 1O7AA 5JXQA 4FX7A 1OYAA 2NQLA 1C8VA 1OK4A 1BG9A 4W88A 2XVLA 4L4MA 4WCJA 3G8RA 1VEMA 4P8XA 2Z1XA 2ZUNA 3O2LA 3FYPA 3SFWA 1TCDA 1HTIA 4AD3A 4YU1A 2D2OA 3PUEA 2IUZA 4BHYA 4G1NA 2CLLA 3V35A 3WBXA 3NGJA 1F6PA 4LEQA 4IPLA 1GTHA 3L4YA 2QUNA 1W17A 8CGTA 1UMYA 1RJRA 3QC3A 4K3ZA 1ZJHA 1KKOA 1JPDX 2ZUTA 3N2XA 3P74A 3RMJA 5A8MA 1A5MC 1XDJA 3QF0A 3LZ5A 1UJQA 4CNPA 2P53A 1K4GA 4LAKA 4GUIA 4IWWA 4YYFA 4TTGA 3PAJA 1R3SA 3DFPA 1Q6LA 4NASA 4OBTA 2HTMA 4TR9A 1EGMA 2XVNA 1MEIA 1UKSA 1GVFA 2HPIA 3IIVA 2NXHA 1E9YB 1WDDA 3VOCA 5JBFA 2JGQA 1KM6A 1JI2A 3H2AA 4UFMA 5BU6A 2PGFA 2GGIA 4NF7A 3CL6A 3L4UA 4AZHA 4ZO6A 3W84A 1Q6RA 5D30A 5D32A 3L4VA 1TZ9A 4IIEA 5DMLA 5HWJA 2BWGA 2G96A 4TMCA 3ITLA 5IBXC 4AC1X 1PZ3A 1EQPA 1VBUA 1EYWA 4QJ1A 2IKGA 1QPKA 3CZLA 1CIUA 3GBEA 3T4WA 3WBEA 2V8ZA 1LQAA 4C6PA 4J3TA 2WM0A 1FDZA 3SCPA 3NQMA 2BTMA 4Y9PA 4CUCA 6XIMA 1B90A 2DW7A 3S2LA 3E5BA 1HVXA 4JPGA 3M6YA 2UY5A 5C0QA 4HHMA 4PA8A 4M0XA 1VPYA 2FHFA 1GK8A 1JFHA 2XSAA 3CWOX 4DY1A 2GJXA 3DBPA 3W1LA 4LVGA 5E70A 4KCUA 4MOZA 1BTCA 4AZGA 4DI9A 5DLCA 4L6HA 3LNMA 3W28A 2PDFA 4F66A 2QZRA 4D1JA 1QI2A 1EO7A 2C91A 1E5JA 4I9MA 1H5YA 3GNPA 3Q65A 3C8NA 5LIYX 4R88A 3AUOA 4GH3A 4INFA 3K8MA 1AVAA 2XZ7A 2POZA 4DLFA 1XBXA 1FHUA 1VZWA 4NSBA 2V68A 1WP6A 2QCCA 1XH1A 5IXEA 5F2GA 3IJ7A 4IGSA 1XPGA 2HRWA 3LS9A 1UW9A 3S9IA 5HINA 3NDOA 4BS0A 1ITQA 1M65A 4AG0A 1TPC1 5EPDA 1TWSA 1CBGA 1SPQA 2H8XA 2EJ1A 3EX6A 1OY0A 1TQXA 4S23A 2ZRVA 3PK7A 1NM9A 5JU6A 1JFXA 3E49A 2QYGA 4HQVA 2PCEA 3CZEA 4GY0A 4CD5A 3T40A 1FP9A 5DBTA 3TQPA 4O4VA 1VPQA 3W83A 4EK7A 5HPCA 3W7RA 4CNNA 4OUIA 4YTQA 3CIWA 3DFOA 3QR3A 2Z25A 1P1MA 4CEXC 3E2VA 3W3OA 2JKPA 4XQ6A 4RLIA 3UP8A 4HNNA 1MSSA 3K46A 1YNQA 2Q09A 2OEMA 1OYBA 3W7PA 5CSUA 3NL5A 4US5A 4GXPA 4XD4A 1HX0A 1CXLA 1UR2A 2V63A 2ASHA 3ARYA 3T8QA 3EMQA 3TIMA 1HJWA 2R91A 4MM1A 1F9CA 3RLVA 1XC6A 4UTFA 4GJ1A 4AC7C 1GW9A 1UUMA 3WQFA 2OCZA 3SJNA 1FY6A 2OEJA 1J10A 3LX9A 1QR7A 4PBEA 2A3AA 1HP4A 1JUKA 1ZL1A 2H8ZA 2LLEA 1V6UA 3CUFA 1EO5A 4E2VA 2DQWA 2X1RA 1TMHA 2QR6A 1YPXA 1LRTA 1VYPX 1S5WA 3THDA 7TIMA 5G4HC 4IIGA 1P6WA 5BMXA 4ENLA 3KBVA 5LA2A 2WB5A 3IUHA 3JR2A 1W1PA 3TR9A 5H8PA 2PWFA 2VDHA 1B31A 1KCLA 4Y7EA 4O8RA 3OBKA 1NQKA 7PTDA 1P6BA 3H54A 4DF1A 1OVDA 1BYDA 1QRQA 1TUFA 3BLEA 2AQVA 1WV2A 2XIIA 2J62A 1XPYA 4Y90A 1E56A 5M2FX 5BOEA 2MANA 3QZEA 5CZJA 2OLAA 4IFRA 3MMTA 1I2NA 2Y2WA 1HKIA 4GO8A 4L6OA 3SUTA 3LTPA 3ICJA 3CPGA 4O15A 3VNZA 1EJUC 5L9FA 3HG3A 2WHJA 1YX1A 3K2GA 4M81A 1X38A 3FNDA 1N55A 5AC8A 5I3GA 3WG6A 1R3VA 4LV4A 5CGTA 4DEFA 5FAJA 1F76A 2PTYA 1K9FA 2VUYA 3HMCA 4EWND 2DZBA 3BXWA 3GQYA 1OF6A 2PZ0A 2J7DA 4PUMA 1KBJA 3CQIA 1N8FA 3GTNA 3EOUA 2R1NA 2JKAA 3T05A 4O4WA 4F8XA 4O50A 5AB3A 3WK3A 2YFOA 5J5RA 4WDWA 1FWRA 1ZCOA 3V0SA 2G3MA 2P1FA 1YLVA 3EGJA 2WKLA 4MWAE 4LVFA 1JZ4A 4PB5A 4QISA 3EB3A 1G7VA 2XVPA 1Q63A 1J9YA 4GQRA 4XIMA 4D6GA 1KFLA 1DIEA 1XYMA 5FA5A 4XZ9A 2YYTA 4YS1A 3U3HA 5EMLA 1B30A 2A5HA 2B31A 4GABA 2DIEA 4S2CA 5EL1A 3ERPA 5A69A 3C6CA 3LSCA 4JEQA 3VIPA 3VIOA 1RQBA 5LGXA 2FZNA 1RA5A 2DUAA 5HUPA 1XIBA 1LBLA 2WMIB 2DJXA 2X16A 5F1UA 4K8GA 1XRTA 2IW0A 3WLLA 3T2QA 1LLOA 4QITA 2INFA 4LUSA 2H3DA 1SUXA 1MI3A 3UETA 4GNVA 3MTWA 3W24A 1ALDA 3ARQA 2BHZA 2WC4A 4WVXA 3W85A 1LROA 2QUUA 3IK2A 3M16A 1R9ZA 3MUAA 4JTHA 1J0YA 3CTTA 4QRNA 4KIRA 4ZXLA 5LA1A 1GKRA 2QEZA 4MKVA 1ITCA 2Y88A 5IOBA 1OCQA 3PFRA 3K8LA 4NU7A 3MMWA 3WMSA 3B9OA 4UZSA 2I9EA 1KFWA 3VGDA 4RNFA 4E4FA 1ADSA 2V82A 2ZZ1A 1E3ZA 3DC0A 5F2IA 1G5AA 1Y5XA 4HHHA 2FZBA 1BVWA 4PFMA 1DXEA 1G4PA 5KSWA 3NTYA 4H9MA 5G4EA 3MB9A 1S3HA 3GU1A 1ISWA 3T7VA 4GQQA 4C6EA 4YXGA 4HJFA 1L6YA 2ZICA 2WHKA 2I57A 2IQDA 4O12A 1KGXA 2IMRA 3NQVA 3F5JA 2ZUWA 2AMXA 1HKJA 4DXVA 1TE6A 2PRHA 2QJHA 1TZZA 2O0TA 2FB2A 1NTHA 1V7YA 3WLKX 2XH2A 4GX8A 4H9TA 3QEZA 4MJMA 3E9AA 3RAOA 1UKOA 1W1B1 4X3ZA 4J3SA 1R2RA 1GWJA 5BRQA 4Y9NA 2YBUA 3E0LA 4CN1A 2VZTA 2YX0A 5T9CE 3BAKA 4JR5A 2RDUA 3H22A 4FMVA 2DP3A 1QOQA 4AWUA 1OCJA 4ZE5A 3REQA 3S1XA 2C8NA 2BODX 3MO4A 1PKNA 2YA2A 2DPEA 3HA1A 5EMJA 4W87A 1BFNA 2J7FA 2AL2A 1OZMA 4NXSA 2OX4A 2YIHA 2F8QA 1OEPA 4RUBA 4AW7A 4Z1CA 1HG3A 4GY7A 1Z7AA 4EAYA 1YPIA 4GBDA 2RGMA 3H21A 4GIEA 2A0NA 1NDZA 3GTIA 4LEFA 4ONVA 4UTIA 1XQLA 4D9PA 1I75A 4CD8A 4FALA 1TR1A 4D72A 1AL8A 4IIFA 4R27A 4PB3A 2V3FA 2BGSA 1F4HA 3FAWA 2V6AA 1BYAA 1J5SA 5BOFA 3PTMA 3DHFA 5LHFA 2V3DA 4FLQA 1UD6A 2PP0A 2GQ8A 5GNYA 5HMSA 4YTRA 2G5WA 1JAEA 2PWVA 3B05A 3G1XA 1QI3A 2I1OA 4XSLA 3EX1A 5FOOA 1HL2A 5A6SA 3PNZA 1FA2A 1LM1A 2D3NA 3CPUA 5DXYA 4UQCA 5H6HA 5CLWA 3W72A 4AMCA 4Z2GA 1BAGA 5E9XA 4HPHA 2QHAA 3LXCA 3DYPA 2GJXB 1I6NA 3UCDA 3Q94A 1H49A 1LG2A 3GVWA 2BBFA 1Q6FA 4PL1A 7TAAA 3AYVA 3CMGA 5EFDA 2ZTKA 1SJCA 1XRFA 4A21A 4G9PA 4FXFA 1HP5A 3V1HA 1A5OC 3LPOA 4HN4A 2UY2A 4TXEA 4AZ5A 4HK7A 2AKMA 4NNAA 4US6A 3BICA 1OFAA 5ABHA 5H8MA 2W62A 4JXCA 4MDOA 2YCEA 1REQA 3NPVA 4GI4A 3V16A 2PWDA 1KFJA 1SZRA 1RBLA 1JD7A 3W87A 2FTPA 1MO0A 4HU3A 3CO4A 4LUJA 2X7WA 1VRXA 2CHOA 5GJNA 4RDYA 2HDJA 5EYWA 2R1KA 1ONXA 1K7XA 4HTBA 1NF7A 1K8CA 4CNOA 3M7WA 2X42A 3DESA 4N9BA 1MEHA 3R2GA 1J4EA 2OZTA 1XXXA 1R5YA 5C9RA 4YLWA 5FAGA 4X0VA 2QQ6A 5C2GA 4MSSA 3CK5A 1UWAA 4GYKA 4R3UA 1S46A 2INZA 2TPSA 1JDAA 4O1EA 1KTNA 1IT8A 1A0CA 2DVUA 3M0KA 1L0PA 3BJFA 1WB0A 3W73A 2HNEA 3ABZA 2E5CA 3CJPA 3VNMA 5FCZA 4ZFMA 3LA4A 3LMZA 2WSRA 1YADA 6ALDA 4KCWA 3C61A 1O5XA 3DYOA 3GY1A 3QV7A 1U2YA 3DXIA 4PMZA 3R94A 3F03K 4OFCA 3EDKA 3VK5A 2V5JA 2Q71A 2JK2A 3VI2A 2OWCA 3A9IA 4BKNA 1XD1A 4UWMA 4FXSA 3OOQA 4GGBA 4AISA 4M1RA 1JR1A 4BK9A 3WNLA 3LU2A 4H6KA 2J6VA 4JTCA 3GDKA 3OHMB 5G1MA 3TJXA 3GVVA 3CHEA 4Y2WA 4GZIA 4B5TA 1QNPA 1E9IA 1UUOA 1OFRA 3EAUA 2Z7GA 5CPMA 3I4EA 3SN0A 3TJLA 2HPMA 2OPJA 3U2CA 1JZ5A 3W81A 3A47A 4YPJA 4Q7BA 3NYDA 3B0PA 1GW1A 1CZ1A 2P8CA 3GTFA 1PTGA 4MIMA 3J7HA 4Q3MA 3HGSA 4ICCX 3ZT7A 4RNHA 3A4XA 3LGEA 3HPFA 4XZBA 2D23A 4UTTA 3MO7A 3ZVIA 3HG5A 4Q4OA 2J7BA 3ARSA 4AIBA 1DJHA 3NZGA 1VBGA 4C6DA 5K3VA 3S46A 1MQQA 1WKEA 1WOBA 5CJNA 5DY3A 4GKLA 1L6GA 4BQ3A 1KW1A 3GIYA 4PBFA 2CZDA 3PY2A 3UJRA 3T0AA 5BRPA 3EWBX 1IV8A 1GVYA 2VX6A 5FF4A 4B5VA 4PSRA 3H7VA 1ISXA 1WBHA 1TPWA 4KWUA 1AH0A 5I78A 1ZJBA 3EPNA 4DJEA 1E70M 1A3WA 3GXFA 1R3QA 4GG9A 4OTKA 5C9WA 3EEZA 5DY2A 1PSCA 1LBMA 3I7RA 5E0KA 1Q2SA 3W7KA 1NWSA 4O1CA 3NM1A 5IFTA 5DN1A 4P2VA 4L4OA 2WM1A 5HNRA 4NVTA 2GGJA 2OQHA 1LT8A 3W07A 3W82A 2CITA 4LH8A 3WBAA 3EWZA 5JH2A 4UOJA 1U1HA 1OFPA 2PAJA 1OGSA 1L6FA 4QM1A 3AXKA 3U48A 1H0GA 3SBFA 3CB3A 1FH7A 3RXZA 4LWWA 2V5CA 3VNJA 3RU6A 3RO6A 3NDZA 4UMBA 1KFBA 1YQ2A 2ZXDA 3QLLA 1WKYA 5HWNA 1DJIA 3ZXWA 3M6DA 1TPUA 5A6LA 1CGUA 4GZEA 3BARA 1FUYA 3O7UA 3S5YA 1GKQA 4ADUA 4LGXA 4LUSB 1EP1A 2GJRA 4NI3A 3M0JA 1V4YA 1YDNA 5A6KA 1B5TA 3C0SA 3G2GA 3W7IA 4AVFA 2W79A 3BL3A 3MC5A 4BJHA 1RAKA 4MY8A 1E9LA 1UC4A 1I2PA 5I7GA 1PB0A 3RMEA 1HO1A 1WKDA 2NVDA 3DGRA 4JIQA 3H6OA 3AIUA 4ZSTA 4ZTYA 3G1AA 3O15A 2I16A 4KF1A 3HGOA 4FO4A 1JYWA 4Q8MA 4MWAC 1YTDA 3HO8A 2PF8A 3FIGA 4JX4A 2QUVA 2YCJA 3GXPA 3PZIA 3OVRA 3NURA 3TZFA 2GPTA 4KFPA 2WJDA 1CLXA 3WH7A 4UTTC 2J66A 4UNKA 1K77A 1JL8A 1X1ZA 3CQKA 4QNWA 3GDTA 2AGKA 4O8AA 1E1CA 1GEQA 1MVYA 1XI3A 5TAOA 3TFXA 2QCLA 1UD5A 2XGBA 3DFSA 3UVIA 4H4IA 2PU1A 2VZVA 5E0FA 5C7VA 1XSIA 3M0XA 4H8VA 1JUBA 1RLCL 1OC5A 2NV1A 4KESA 2G95A 1XYFA 2YCKX 2B4GA 1SSGA 1IR1A 1BTMA 4DJEC 5DT5A 1I9CB 3WKZA 1UKQA 3CV1A 1IYXA 4JN7A 3IIPA 4J28A 4AUBA 3WFLA 4DZAA 4O10A 3HPAA 4D2JA 2WBKA 1TZ7A 2D2GA 2WNWA 2QPSA 3PM6A 1R7OA 1DL3A 3HFYA 2P0IA 2XWDA 4ZSUA 4ERGA 2QGYA 4LS0A 2ISWA 2AL2B 2NZLA 2A7RA 5C54A 2HEJA 3V5FA 3WD0A 4BI7A 1H62A 1KCKA 2WZHA 4IG2A 4ZO7A 4KPLA 5AECA 1UJPA 1YRRA 1MNSA 3FXGA 3AS3A 3M64A 4LS1A 3M44A 1TRDA 1LP6A 3B4YA 4UMAA 3LRMA 4PUJA 5DMYA 2PWGA 3KL5A 2VCAA 3SO7A 3UT0A 1XQKA 3VOGA 3GB6A 4FK9A 3L2LA 4UFKA 1FOBA 4GIYA 4ZQNA 2EPLX 1M68A 3VUSA 3N12A 3MU7A 1XCFA 4HSHA 2DT3A 1R2TA 1DOSA 1Q7QA 2A4AA 3NSNA 2BLEA 2PSNA 4BF5A 2PDCA 4IFOA 3FKRA 1TV4A 3LENA 2VEMA 1F6YA 3W38A 4ERIA 1E71M 1WUFA 1EOMA 4UFHA 3N3TA 4MAZA 4N6EA 1P0BA 4Q32A 4KS0A 1IIHA 1TRIA 2IPFA 4O54A 4IGMA 5LIUX 1WDWA 4QE1A 4JKKA 2WCGA 3OIHA 1EEXA 3R58A 4FAMA 3KVKA 3TXZA 1K9DA 1AZ2A 1VIWA 4WQ6A 3CXOA 3ZJ6A 3EA1A 3GW0A 4U33A 1OG6A 4H9UA 3N1AA 3GTHA 2Z2BA 3M4HA 2WBGA 2WCAA 4H6QA 4LXFA 4WUIA 3WNPA 4W7WA 1DJWA 4XTDA 3DI0A 1E9ZB 3AZSA 3MI2A 3BSHA 3G0XA 3S9YA 4QSHA 3DAQA 2DZTA 4U10A 3N2OA 3MKVA 5D2XA 2J7EA 1PXGA 5KTLA 1OADA 1KM3A 4NZ4A 4DIAA 4QDPA 2FVMA 4JIHA 3UZ5A 2X40A 2A3BA 2FZDA 2SFPA 1XGDA 1REQB 4DWDA 2QJGA 1B3YA 3L4XA 3CU2A 2OO6A 2DFAA 1GGOA 2NT1A 3TYDA 3MSYA 2WAGA 4H6EA 3ZOAA 4A3UA 2HE8A 1HFBA 4I8DA 3SCWA 2ISVA 3OGVA 1SFTA 1YTKA 1GJUA 4Z2IA 2X0SA 1BRLA 3QQ1A 3HURA 3GC5A 3AWOA 1VYRA 1MRQA 3T0CA 1RCQA 5CQ1A 3KOFA 3VNDA 2VEGA 1KRBC 3S1WA 4EP8C 5I3JA 5D2YA 4H9VA 5EFFA 2IQTA 5DELA 3HPXA 3BURA 1GVQA 1PUDA 1W91A 2PDHA 2A6LA 4XVDA 3WLIA 3ZQ9A 4UQ9A 2R82A 2B7OA 4QJ5B 1PZ0A 1JVNA 1WYIA 2CWXA 4QAIA 1YXYA 4AMAA 8XIMA 2DZPA 2FVLA 1J0ZA 1QHOA 4PCTA 3FJLA 4MNMA 3K4AA 4BQ4A 3NG3A 4ZL1A 3B40A 1QOPA 4NJKA 2ON3A 1I1WA 1EJ7L 4D1IA 3SCRA 3NO1A 3GFYA 3P5ZA 2NQHA 2ZCGA 4JTQA 1XJBA 2PDNA 1QNSA 3TONA 1YTEA 2X1UA 3EWWA 4HMCA 1QI0A 4R85A 1F3XA 3NL6A 4ICMA 3MSRA 3URQA 5BWAA 4DPQA 1RSCA 1T6MA 1GOWA 4M19A 3OVPA 4FNRA 1A53A 3O6YX 1HJUA 4PBGA 1A47A 1M3UA 4L64A 4LBUA 2CYGA 2YW4A 1SO4A 3LBMA 5CPOA 4UNIA 3GIQA 4WOQA 4E4PA 4C1KA 5DCBA 3EKLA 1FWBC 4UR9A 2Z1VA 1JD9A 2AAAA 1YDYA 3VGEA 1KD0A 3SADA 3P8JA 2ALDA 2ZUSA 1QUMA 4J7RA 3WF1A 1XLBA 4RDVA 4V33A 1H0IA 2CEQA 1SR0A 4V2XA 5K7JA 1B4EA 3EWCA 4NZ5A 4KETA 1G4TA 1JCMP 1E5NA 3VFLA 4NX0A 2E4TA 2ICSA 3M0IA 4C6MA 3KP1A 4NY2A 3CT2A 1RQHA 2EKCA 1KRMA 4JL2A 4GVHA 1LF1A 1UP0A 4I5UA 1F8IA 3WLPA 1H60A 1GYLA 1EA9C 1RHCA 5GNXA 3C52A 3DZ1A 4ZODA 3W0KA 1TMQA 5EA9A 1ZJAA 3SCOA 5D9OA 2Q8LA 1GOQA 2DZUA 2FH6A 2CBVA 2OYMA 4MFEA 3A4WA 2IXUA 1XP3A 1G7UA 3UXAA 3PSWA 3WJXA 1J5TA 5FJUA 3K30A 2OTDA 4JFTA 3PPGA 3GX9A 4S3JA 4FNPA 3AS2A 1Q7ZA 2OOFA 3M1ZA 5M17A 4HNCA 3RNDA 4E8GA 2AKZA 4ZQOA 4FSAA 2ZWYA 4HHPA 1UWIA 4Q4QA 3WBWA 3P81A 1TVNA 4E6MA 1NELA 1V02E 2FB3A 3KDOA 2TRSA 4RZBA 4ICNA 4QCEA 2NUXA 5HK4A 3SQMA 3VA8A 1GVEA 2RUSA 4ZZ9A 4PE8A 4I9JA 2PDGA 2C13A 1SO6A 1DWFM 3B06A 3TWBA 2G50A 3AS0A 4UTWA 5BNKA 1F2JA 1DWGM 4C91A 2WV8A 2D73A 2J13A 2V30A 3ZT5A 3UA3A 4LBSA 1QHZA 4B15A 1AQ0A 4WIWA 3BTNA 1V3LA 1NVMA 1E3XA 2Y7FA 2X30A 1SFSA 4IPIA 1WA3A 3S6DA 1V0LA 4Y9OA 1WDSA 4HMEA 1GQLA 1XLEA 2CNCA 1E6XM 4BA0A 5AHFA 3WQOA 1FCQA 3TTYA 1E6PA 2EPMX 1EWDA 5KINA 2YBTA 4GX9A 1XYZA 4KEVA 4S3FA 1OFQA 5CZ0A 1M5WA 4L56A 4A05A 1Z32X 4PTVA 3B9NA 1YMYA 3L23A 3W22A 3AMLA 1HIZA 4A3QA 3CASA 4P7NA 4GVGA 5AHEA 5AZ1A 1B9ZA 5I00A 4EX4A 3ID7A 1XLGA 4LYRA 1OB0A 3ANVA 2FH8A 3QC0A 5I3FA 4ZB0A 3RJYA 3NQEA 4DN1A 4TQTA 2VR5A 2A79A 3OLGA 3EBVA 5KMYA 1TREA 1L8NA 3PZVA 3TAKA 1HJSA 2P5NA 3A3XA 4MNLA 3LXBA 2PD9A 4C6FA 4QG6A 3LI0A 2A6NA 1VHNA 1V3HA 2EJAA 3KBMA 4P8UA 3NSXA 3UR7A 4V15A 2C1IA 7XIMA 1E1CB 1TV2A 3ITVA 4Z0JA 1W3NA 3W7QA 3WELA 2PE4A 3WMLA 3LHVA 1JI1A 2Z4GA 1EOKA 2RJGA 1Z6KA 4CKQA 1TPB1 1W9DM 5HR6A 1DJYA 2HBVA 4FLOA 2QCGA 3KRBA 4IH3A 4P8WA 4IL2A 4WKFA 1UBPC 3IJ9A 3KEHA 2VENA 3KUMA 3QR0A 2ESCA 3GD6A 4D6CA 2BS9A 5FJRA 4RKAA 4ZENA 3BQ6A 5CZKA 3THUA 3L4WA 1XDLA 3MKKA 1UD4A 1SO3A 2C7FA 5A8PA 1W32A 2DIJA 1TB3A 5CC3A 4AQLA 2NVAA 4OBRA 2VFFA 3PZ9A 1WAWA 3B97A 1UD8A 3LM7A 5IRPA 4I8YA 3KOWA 3KHJA 1PZ2A 2C19A 5LGZA 2PLCA 1GYMA 2ZWZA 4N4QA 3I3EA 3VM5A 4EACA 3WSUA 1E4MM 1QJWA 3R0DA 2BDQA 4Q33A 4F2BA 1NY1A 1IWPA 3DC8A 1K4HA 3LGGA 3IRDA 4KRUA 3STPA 4AF0A 1ISVA 1EUNA 5E9AA 4L65A 4AVNA 2GLKA 4IG2B 3SIMA 2VFDA 5CH9A 3AFBA 4XUYA 4JIIX 4U2YA 3TJIA 4DBEA 1OYCA 1C8YA 1ME7A 1CW2A 2AMGA 3ABSA 2ZKMX 2JEQA 2BOEX 2NLIA 1SVDA 2ZZ2A 3FA4A 2DEPA 3WNNA 3E6EA 3NQBA 4HT3A 5GNZA 4Z17A 1CT5A 3PUOA 2ZZ7A 3IJLA 4O16A 1UR0A 3RM8A 2GQAA 1S39A 3S1GA 1HKVA 5F4SA 5GJPA 3VNYA 1I2OA 1EF2A 4MY9A 3XISA 3VDBA 4NKCA 4HOWA 5I0DA 1FVPA 3SGZA 1S2UA 3U7VA 3S6TA 2E5DA 1IQ8A 3VKAA 2OT1A 4LYPA 3L7RA 2CBIA 1OK6A 3C3UA 1AL7A 3N15A 4XZHA 3LXAA 3PPCA 2H3BA 3OJGA 4ZQCA 1S2WA 2VHLA 3P61A 5HQLA 3VU2A 5D02A 3ATYA 3FS2A 3ZJKA 2ZXQA 2P0OA 2J6XA 2QKFA 3FDKA 2E28A 2PUZA 3UVAA 3C8FA 1R3WA 4MB4A 3T9PA 3TE9A 1OHLA 1UG6A 4DM1A 2F6UA 1AZ1A 2G41A 3VCCA 2CBJA 2J9XA 2Y4SA 4JHOA 2AGTA 1MW0A 1QMLA 3TC3A 1OT1A 4IGHA 6PTDA 4GFSA 4HSOA 3QPEA 3POCA 4GVIA 3ZIZA 3NCOA 4UQDA 1PIGA 4EPEC 3C2YA 4C1NA 1KM2A 3BV7A 1TELA 3CUHA 4EF8A 2HSAA 1VF8A 2IKIA 3UZXA 4HB7A 2F38A 4O1AA 4D6EA 2ISDA 2R14A 1EJSC 1W8SA 1BRLB 2OG9A 3HBLA 3PUDA 2ZRYA 3QGVA 4LX4A 5C2CA 5LIXX 4A8LA 3ITYA 2J24A 1KV5A 2D0FA 4K36A 2VX5A 1UKPA 1T0OA 1JDEA 3VMNA 4NP7A 1JJKA 3MI6A 1HW6A 2Y8UA 3LCIA 2CZVA 3UXDA 5D9PA 4XZMX 2OU4A 1FWGC 2PU0A 2RH9A 3DFNA 3H7UA 4B5NA 3CH0A 2R24A 4IPJA 4OUEA 1LLZA 3RYSA 3N4FA 4GUGA 1J6OA 1Q66A 3ZYZA 1BKSA 5FF3A 3M46A 2OWWA 5EBUA 1P0KA 1DQWA 1JRBA 2V5BA 4MKNA 1SYTA 3ITXA 3PAOA 1PHQA 4ZOEA 3QLDA 2FMOA 3ZWTA 3QOKA 1JCYA 2AL1A 2QJIA 2W61A 3W1NA 1PZ1A 1KCZA 5DRCA 4D6IA 1US2A 1GZGA 3W2MA 1RY0A 4IJRA 1OFOA 2TODA 1XICA 4LSBA 4AEEA 2JKEA 3JW7A 3SY8A 3K1DA 3HQ1A 3QW3A 2GGEA 1OGGA 1FWJC 4K2SA 5JBDA 4YCPA 2W5FA 4Q8VA 4IFKB 2XN1A 3IAQA 4QS6A 2J7CA 3U2ZA 3O6CA 5BXRA 1NWRA 1EJXC 2GK1A 4Q4RA 3SCUA 1V3JA 3W1UA 4YTUA 1E0XA 2WHMA 2ANUA 3N17A 3SN1A 3B9DA 4AB4A 3UPBA 3QGAC 2GJPA 3CWHA 3IIXA 5D33A 1EA0A 4X2PA 2PGRA 4Q8UA 3B3DA 2QCMA 4WR3A 3AJ7A 1Q5MA 1L9WA 2PBOA 3VGHA 1CB7B 3AYSA 3MY9A 4QE4A 5FL1A 4MDPA 4PMUA 3W53A 2X09A 3PBVA 3LV6A 4IJBA 2VUNA 3WYZA 1U1JA 1XISA 1VAHA 3MQTA 1TIWA 1TJRA 4MGGA 3M5ZA 2CHRA 1IR2A 3W2LA 3B8SA 3BLPX 3LD5A 3GU9A 4FF7A 3TOYA 3PC0A 3THQA 4B5XA 4OHQA 3VIIA 1OSEA 4LVBA 2BHUA 4AD5A 3NEVA 5I23A 5FESA 4BY3A 1XIIA 1I8JA 4ZE4A 3AIQA 3URBA 3TU9A 1TV5A 1F05A 2V2CA 1Q85A 1KXTA 1JPIA 4V1XA 4GC3A 4D8ZA 5AFDA 3LSBA 1GNXA 4LQ1A 4AIEA 4HYRA 3E0IA 4OU1A 2ZE0A 3GNDA 4F48A 1YPFA 4NNCA 5HNUA 3KCOA 1EYEA 3SGGA 4GD0A 1OD0A 4NJJA 3U5YA 4NZ3A 3G8EA 2XHYA 1NOFA 4Q8PA 2XM2A 1FFRA 2C0AA 5IDZA 2Y5SA 4O18A 1ML1A 3THAA 3IIZA 3M47A 1KQYA 2E25A 5LIKX 5A8OA 1SO5A 5DANA 4MYXA 4TV6A 2YA1A 2WSQA 2WZMA 3DCPA 3LQLA 4B16A 3H8AA 1T99A 3GXTA 1EJWC 1HJVA 3BG3A 4Q22A 5EBAA 3W6YA 3FGCA 4JY8A 5FI8A 3H4GA 3ARPA 4IPNB 1W3KA 5REQA 4A4AA 4UTLA 3WJZA 2PDXA 3UCQA 2A7NA 5SWUA 3LTSA 1ENUA 1EQCA 3CT7A 4JDBA 3USZA 1W8GA 3H26A 1X97A 3AHTA 5F4WA 3G1VA 1Q7MA 2NVCA 1XINA 1H2JA 3LCHA 2PWEA 3OQ8A 1CGWA 3PR2A 1QBBA 1XIDA 4HVXA 4I7WA 3W70A 3NPWA 4BFAA 1E6NA 3B04A 1H7OA 2NSXA 4HJWA 4IOTA 4A22A 3NZQA 1DJQA 2EG7A 2X1IA 3SAZA 4EF9A 4RPPA 1BPLB 3EWUA 4KRZA 4OQVA 1O68A 4XX6A 1PKMA 2P50A 4UQBA 3MANA 5AN7A 3EA2A 3WCZA 5HPOA 5C7HA 3RRAA 2G3FA 5ECVA 2YCIX 3THCA 4UR8A 3M5XA 4DZ5A 5G4WA 4F79A 3WQ4A 3W26A 2CC0A 3MJYA 1HZYA 5CJ5A 3PBWA 5M03A 2BXZA 4QLLA 1FWWA 3GIPA 3N6QA 2QV4A 3U7BA 5KZ6A 1EEPA 1GKPA 2ZE3A 3EX2A 2DZSA 3LPFA 3W25A 3COTA 5CG0A 3WF0A 3APYA 5DX7A 4CCZA 5CGQA 4DF2A 3LG3A 4X9SA 2PI6A 3A24A 4P61A 1R9YA 3GR7A 4DNMA 2F6KA 3SCTA 3PUGA 3WQ6A 2XIOA 1IT7A 1XGZA 1FKXA 2WOQA 3LQGA 1VB9A 3IAPA 2YDQA 4P7QA 5LZLA 4RZ5A 3W01A 4XKMA 4IGNA 3HG4A 2VKZG 3EXRA 5AC5A 2GJNA 2O55A 3QY6A 3T42A 2E1WA 3WQEA 3E96A 2ZZ3A 2PDJA 4DWSC 3QV8A 2HK1A 2NXIA 3ONCA 1XM3A 3B8TA 2E68A 1PIIA 3MWAA 4GYPC 5A1AA 1E55A 3WEOA 3UWEA 3MSDA 5F7UA 4ROPA 5MF5A 1GG0A 1K1DA 2OVLA 4PZVA 5HMDA 3VILA 4D6DA 1VQTA 2GSEA 2TYSA 3TN3A 3S83A 4XK2A 2BVWA 2QF7A 1XG4A 1XCWA 5FEWA 1QDSA 4Z0SA 1NAL1 4IXXA 4F0SA 1GEHA 3S1UA 3UZZA 2WXDM 3AOFA 1VBHA 3VPLA 3H2OA 4F2UA 3EDEA 1KRCC 3PNUA 3GAYA 2ALRA 6XIAA 3KVLA 4OT7A 5XIAA 4OKDA 1Z89A 5FSDC 1KFCA 3GDLA 3P93A 1FWEC 3KCLA 4DNHA 3BLFA 1W5OA 3SRKA 4FNQA 3IJ8A 4BQ2A 3E02A 1QCWA 4TMBA 3QY8A 4NRSA 4HSNA 4G5DA 4W7VA 4KEZA 4XVEA 4J3ZA 3PB2A 4JTIA 1AD4A 3E2QA 1IIGA 3L2MA 3AS1A 3ZJ8A 4HHLA 3B8IA 4I90A 1O1ZA 1KM4A 3K8KA 4YMZA 3KBSA 3BW4A 2REQA 4N9EA 3GTXA 1V3MA 2Y89A 5AVNA 1UYQA 1ZPTA 4KGLA 4B5UA 3UBPC 1QO5A 3E12A 1V51A 2PTDA 2X2GA 3EXTA 4FOJA 3AXHA 4PMVA 1HT6A 1IHIA 3SCNA 4C1NB 3INPA 1XLIA 4QGCA 2VGGA 1I2RA 3LUTA 2W0UA 3OYZA 4XO7A 4BF9A 1Q6CA 2UY4A 4F3HA 3N2BA 1LRQA 2CHNA 2EQDA 2WMKA 3STFA 4Z2JA 1JYVA 2GQ9A 1GQKA 4IISA 4S39A 1CLVA 4JICA 2JBMA 2HS6A 1U5VA 3NQ8A 3P8IA 5JH1A 4D8LA 3W76A 4JQ2A 1P4CA 1K6AA 2VM8A 3KRZA 3T0BA 2ZDSA 3ENLA 1ESWA 1ODZA 1FDYA 2WJZA 1F3WA 3PBGA 4F0KA 4W89A 3MW7A 2EEXA 3SUVA 3L2IA 2X0YA 2OKOA 1DQXA 4LB3A 3NGFA 1RPKA 1W6TA 2V2HA 4TVUA 4Q8TA 3T2OA 2W91A 3NSMA 4E2BA 4LJ3A 4WY0A 1MW2A 5M1TA 4M8UA 5DCEA 4K8HA 1B3WA 1RALA 5AC7A 1R3TA 7CGTA 1NDYA 1TJPA 3GH5A 1UR1A 3O0FA 3Q2DA 3LMYA 4MKSA 1XUZA 4OJYA 3T0DA 1C3FA 2WZTA 4AU0A 1GG1A 4Q6XA 1V03A 1EPXA 4NRRA 2BNJA 2YA0A 3QKEA 3LHWA 1G4SA 3MP4A 2ABBA 4LS2A 5A2AA 3ZVHA 3V75A 3CGTA 3SGUA 2Z29A 1F6KA 4Y9MA 4PCSA 4C6JA 3DERA 2BVYA 1XYAA 1PS9A 5CC5A 1O66A 5A6MA 1UWRA 5C5YA 2OKTA 1M1BA 1XYLA 5G5IA 2V5KA 2I7GA 1ZBVA 3SURA 1BQGA 1PYFA 1UQYA 3STCA 4TVDA 2GK1B 1Y8BA 5AHNA 2J8GA 5HBFA 4CQAA 2DUXA 1H4PA 1K8XA 3L21A 4PUWA 4O53A 1V08A 3KP0A 3GNXA 2ZZ6A 4DO6A 4GUFA 1WXYA 6TIMA 1UR8A 1IWAA 5FF2A 4GCAA 3NZPA 3NPUA 4P7LA 1ZBKA 2DIKA 4W9TA 2FPVA 4HOZA 3HPZA 3MV01 3VKJA 4J3WA 1W5NA 1RBOB 2BMBA 2C71A 3U5UA 2BHYA 2FQIA 4TUFA 2FVKA 1O1HA 3LPPA 3SUSA 2V2DA 1XYCA 4L4LA 4R34A 1K6WA 3TTOA 4XAPA 1KR1A 3WN6A 3QYQA 2CW6A 3BPWA 3K13A 1LQ0A 2W6RA 3E0VA 1EJRC 4MJ4A 4IHCA 2DSKA 3KVJA 3WF4A 5ENLA 3HGRA 5BWFA 3T55A 2DZXA 3PZOA 1EKOA 3TLLA 1CNVA 4MTVA 5T8GA 3V36A 2FFCA 4UQEA 4EXQA 3EMZA 4IUOA 4Q4PA 4UTUA 2XINA 2FGBA 1FCUA 1ZP3A 1EL3A 1S2VA 3W7EA 1P0EA 1T41A 5D8ZA 3UERA 2RHGA 1F5ZA 1D7KA 4NXKA 1KB3A 1BYBA 1B54A 4YL2A 4GI8A 1DTNA 4U31A 5LA0A 4RJEA 3OU8A 3UQNA 1R7AA 2VGBA 4WDXA 3CWNA 3VC5A 5F4XA 1RQEA 5EMMA 4AY1A 1GONA 1V6YA 2D22A 1BG4A 5LIWX 2O9TA 1QNOA 4POCA 4JS3A 1I