3W07A

Atomic resolution structure of orotidine 5'-monophosphate decarboxylase from methanothermobacter thermoautotrophicus bound with ump.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution structure of the orotidine 5'-monophosphate decarboxylase product complex combined with surface plasmon resonance analysis: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 83
structure length 215
sequence length 215
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2012-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w07A00
3M5VA 2H8XA 4ZQPA 1TPB1 4AHOA 2FQIA 2WSQA 5EY5A 4XQ6A 2CU0A 4LV9A 2XN2A 2VENA 1JUBA 1KM2A 2ZRWA 3SR7A 1WDWA 4KFNA 1XCFA 3S5YA 4LT9A 3W1LA 1H51A 4PODA 4HPXA 1KFEA 3BLFA 3PR2A 3NQAA 2VXNA 3NQ6A 3NPUA 1N55A 1SFJA 1N8FA 4O14A 3ABOA 1TPDA 1W0MA 1PV8A 3UNDA 3KRZA 5K4ZA 3C52A 4QJ1A 3W1TA 1FCUA 3N3MA 4K6AA 3GAKA 5CZJA 2BLEA 2CWNA 4FIRA 3BLIA 3L0KA 2C3ZA 4QIUA 4ZQNA 3P5ZA 1ADOA 3CB8A 4DF1A 2YFNA 2WSYA 4CCCA 3W72A 1U5JA 1R2SA 1FQ0A 2QCLA 2A6NA 1DORA 1K8YA 3KVJA 2RKXA 4GUHA 5K9XA 2FIQA 3LHWA 4GJ1A 4R53A 3HG5A 1Q6QA 2I1OA 4LC6A 1WBJA 2QJHA 1AL7A 1YDOA 3FA5A 1LLWA 3QH2A 5K3VA 3S8HA 1HG3A 1W5QA 4PL2A 4BI5A 3WK2A 4YL2A 3M43A 5LGXA 4AMAA 4N4QA 2GJNA 3BGJA 1LM1A 3GXPA 1D9EA 1DQWA 1PHWA 2YYTA 1FDZA 3S1UA 3F4WA 3C6CA 1UB3A 4BWLC 3DENA 5U4NA 2BWGA 4ML9A 3PUOA 3NQFA 5G5IA 1OK4A 5D37A 4O15A 3W1NA 3GVGA 2FDSA 3G0UA 1J4EA 1OF8A 3GDRA 1NAL1 2CW6A 4GUGA 1MEWA 3MO7A 4DF0A 3BLEA 5T26A 2QCEA 3W7NA 3TMLA 1H7OA 2HMCA 3OEXA 1K03A 2NV2A 5D03A 3O63A 3PM6A 4O10A 1WBHA 5HULA 4CNPA 3O6YX 3W71A 5C54A 3KHJA 4JICA 1GYNA 3W76A 3S1XA 4MFEA 4JDBA 3TSBA 5IBXC 4ZMGA 3NL5A 3HGJA 5H91A 3MI3A 4NNCA 5D09A 3S1VA 3I7RA 3IIXA 1LBMA 4OBTA 4N4PA 3FFSA 4ZQRA 1LORA 1VQTA 1LP6A 2YXGA 2GQ8A 3EEGA 3GZ3A 3KXQA 2VELA 4BWLA 5D05A 2V9DA 1FWRA 3TFXA 1DBTA 3TJXA 3GK0A 2BSLA 5K4XA 3NQGA 3GNNA 3O07A 1LCOA 4LRSA 4QISA 3CEPA 4NJJA 2W0UA 5FEWA 4RZ6A 1W5PA 3SW6A 1O5XA 3HIJA 1CW2A 4ZZ9A 1QO2A 3TXZA 1OJXA 2YCEA 4O18A 3IV3A 5DLCA 5L9FA 4CNOA 1SZGA 3NZ1A 3EWUA 4C1LA 3TC6A 1RZMA 3BW4A 4O13A 4U4MA 2J9YA 4LVFA 3MHUA 2YGYA 1OF6A 3G0XA 3PBYA 1FWNA 4EWND 2V2HA 3EWWA 1GTHA 1M7PA 5EA9A 4HIBA 1CI1A 1H1YA 4OT7A 5AFDA 5CGQA 1R46A 1LOQA 2VFGA 3W84A 2JGYA 2ZRXA 1RV8A 4JTHA 3V1PA 3A5FA 3OVRA 4N9CA 1IXQA 2Y62A 4A3UA 3TW7A 8TIMA 4PTNA 3PAJA 2ATMA 4JY9A 2RHGA 5DY2A 3NDOA 3B06A 3BV4A 4K8EA 3I65A 1ML1A 4JTUA 3MYOA 2HS8A 1L6YA 3OA3A 1KLYA 3W7OA 3M7WA 1H7RA 3VFLA 1NFBA 1G69A 1ME7A 3R2GA 1IF2A 1M7OA 4UNKA 2QCDA 3P74A 2Y89A 3R13A 3WJWA 3LX9A 3LCLA 1L9WA 3W74A 4IMFA 2EF9A 3HGOA 3I7QA 1VJIA 2DZVA 2VFHA 1UJPA 2DORA 5FF2A 1N7KA 5HWJA 4GNJA 5BOOA 2ZZ3A 3KFTA 2X1SA 3U8GA 1VRDA 1U83A 4LU0A 2PC4A 2AGKA 2HSAA 3CWOX 3WK0A 1KBIA 2DZSA 3CTLA 3HB9A 6TIMA 3RNDA 4NJHA 5D2YA 5FF4A 3BVJA 3GDKA 4LUJA 5D04C 1J5TA 4JTSA 3NEVA 1TYGA 5G4EA 1VCVA 3QYQA 1EA0A 1OVDA 3LV6A 5E1QA 4BR1A 2NXIA 2ZFAA 4UXDA 1VC4A 3N14A 3LI0A 3SECA 3TUUA 4LVGA 2Q3OA 3NQ2A 4MJMA 3HO8A 1KM0A 4DO6A 5BW6A 1SW3A 2A0NA 3SGZA 5AC8A 3W1PA 3I6RA 2RH9A 4A22A 2XFWA 3EKLA 3USBA 4X9SA 5J5RA 4CCDA 2FB3A 3U6WA 2V2DA 3STEA 3N9SA 4E2DA 1JCYA 4IWWA 4FXRA 4RZ5A 5KTLA 5DY3A 4PL1A 3DH7A 5LNWA 4Y6GA 2ZTJA 3TJLA 5HJLA 1W3NA 2FB2A 3C61A 3HPXA 4CQ9A 3NO5A 4OWGA 1KTCA 3S1WA 1OYCA 1TTIA 1IXNA 1H7PA 1I4NA 2R14A 2G96A 2BXVA 1DQXA 2B7NA 4DXVA 2WOQA 1I2NA 3QMTA 1FCBA 5AHFA 4XBSA 3TR2A 2JBMA 2QDGA 4Z1CA 3DAQA 5GVJA 3W70A 1OFEA 3OVQA 3ZWSA 4DELA 5I3FA 4LS1A 1JVNA 3VKJA 3QSTA 4DO5A 4NX5A 4JTIA 3HG2A 4UTJA 3LTPA 3NA8A 3G1AA 3W6YA 2QUVA 3A22A 3P61A 1ZAJA 1JQXA 4EVZA 3GIYA 2GUUA 3HQ1A 2DZPA 4O8RA 1UASA 4UCGA 1KM6A 3CT7A 3G8EA 5KZEA 3TKFA 1ZALA 1NEYA 1YTEA 2RDTA 4RZ4A 5CPOA 4UIOA 4I7VA 3LRKA 4QNWA 2A85A 4AF0B 4M6VA 1W56A 1YADA 4UR8A 4JIQA 3S5OA 3L0GA 3B05A 4UMBA 4M6PA 4LS2A 3TROA 2DZXA 2UV8G 2BZNA 1RD5A 1PIIA 4MYAA 3NXFA 3FYPA 1K8XA 5D33A 1DL3A 2HS6A 5HNRA 3MWAA 3HJZA 3Q2DA 3RLUA 1X1ZA 3LXBA 3LCIA 4NNAA 5SWUA 2GVGA 4M19A 3SGUA 1TPH1 2RDWA 3O6DA 1SO5A 4IQLA 1H5YA 3O1NA 3FS2A 3PC0A 3PUDA 5KMYA 1DHPA 3G0SA 3M6YA 4LS0A 2G5WA 4GUIA 3NL3A 1FCQA 3UXDA 3LTYA 3LXCA 5HR6A 5IBXA 4FNUA 1VYPX 2GJLA 4IOTA 3N19B 1TB3A 2E68A 2ALDA 1QPOA 2VOMA 3UZJA 2GVLA 1DV7A 1K3UA 2QCNA 2E6AA 3DFPA 4Y90A 4BI7A 5AHLA 5AYZA 1V5XA 4IMDA 4R33A 1OYAA 4RJEA 4RKAA 1R47A 3THQA 5KINA 2J6XA 2DP3A 5J5DA 3GXTA 4ADSA 4UTWA 3OG3A 1W8SA 2ZDRA 3EXSA 2DU2A 3LCWA 3W73A 3P67A 1YXDA 3GR7A 1FBAA 3UWYA 4K8HA 1H60A 4A21A 3TQKA 3TQ0A 3W7KA 1G7VA 4WOQA 3C0JA 4YXGA 1UUOA 4JD4A 1VCFA 4O53A 3PY2A 3M47A 3OBKA 1KTNA 3G1VA 2NX9A 2QDHA 4JTFA 4KFPA 4ONVA 2Y88A 1G4EA 2GPTA 3TXVA 1D3GA 3QEZA 5LNVA 3BW3A 1XM3A 2ISWA 2ZTKA 1GYLA 2X1UA 1JULA 5C5YA 4UTKA 3L5MA 3W1RA 3W7HA 3GDMA 4O17A 3W85A 1XBXA 2A2IA 2NXGA 1X7FA 3E96A 3INPA 4H6KA 4PA8A 3W1AA 3LLDA 2C14A 1LRNA 3DGRA 4FNSA 5HUOA 1AG1O 3RU6A 2A7RA 2ZA3A 2PE4A 4DPPA 1I2OA 3W7JA 1GQNA 2A5HA 3EX4A 4RV8A 2NZLA 1EP3A 5G1TA 3P8JA 4Q32A 3B0PA 4GUFA 1RQBA 2OT1A 2V30A 5DBTA 1EIXA 3VI2A 4O11A 4WX2A 1KLZA 4QNEA 2VC6A 3NQDA 3UY7A 2QCCA 2E77A 4DBEA 2YYUA 1TPVA 3N2MA 1WV2A 1IIHA 1KW1A 4O54A 3MP4A 1SO4A 5CPNA 2DZUA 3C2VA 1G6CA 1YTDA 4RX0A 5DXYA 4RK8A 2IQTA 1PL9A 3M16A 2O7SA 2QCHA 1I2RA 1ZJIA 1VPXA 1E51A 3HOJA 2QEZA 4O52A 3ATYA 1EUNA 3GX9A 2QCFA 4FNTA 3NOEA 1TJPA 2CZFA 5AHIA 3W7GA 1GG1A 1OFQA 2W79A 1VHNA 2Z6JA 4O12A 1LRQA 1WXJA 2OT0A 1WA3A 4YWIA 4YCPA 2VFDA 2CFFA 5AC7A 3IGUA 3PS7A 5G2WA 1OX5A 3T4CA 2AAMA 2C1HA 3L67A 4X3ZA 2CZEA 4LRTA 2Z6IA 4JX4A 2DZTA 4Q4KA 1JUEA 3PBVA 3OVPA 3NQCA 5TBOA 4OHQA 4TR9A 4UTLA 1TTQA 5F2LA 4H3DA 3Q58A 1S5TA 3IIZA 1GG0A 4GUJA 2QJIA 1ZAIA 1OABA 2X1RA 1TV5A 3LRMA 4OGZA 3SFKA 3TE9A 3IGXA 3MBFA 1SSDA 1YXCA 5D32A 3JS3A 4ZVJA 1HUVA 3W7RA 4DPQA 4JY8A 2Y7DA 2WO5A 3EWXA 1NVMA 4ZQOA 1XFBA 3KRSA 5AB3A 4O19A 1OFPA 4AEOA 4CLMA 2OMAA 4BFAA 2X16A 4H4IA 3TQVA 5K9DA 1XUZA 1TRIA 3FKKA 4IJBA 3F1QA 2CLEA 1FXPA 3GLCA 1THFD 2HTMA 1SZNA 2F7FA 4EIVA 1TMHA 2P0OA 3STGA 4I7UA 2ZCGA 3TK7A 2CZ5A 3D0CA 2QKFA 4UFLA 2VFEA 1KFBA 3GKAA 1KBJA 1H63A 3KAOA 3IIVA 3B04A 4LNYA 2Q8LA 4UTMA 3M5XA 1VH7A 4UTIA 1IIGA 1OG0A 5CG7A 2FJKA 3ABSA 3L21A 4IPJA 1GJPA 2B7QA 3B4UA 3QQ0A 3TC7A 4GFSA 4WJEA 3BGGA 3CWNA 4A29A 1HL2A 3LBMA 3W1XA 4AWSA 4N9BA 4CCEA 1YLVA 2QCMA 1QPRA 4HSNA 3IIPA 2NUYA 4NQ1A 3S5NA 4ALDA 3WJZA 1XUUA 6ALDA 1K02A 2TSYA 1OFRA 1KM4A 1VLIA 3MYPA 4NXKA 2YW3A 4HHPA 2P10A 1ICPA 4JIPA 4IMGA 3A21A 2C18A 1V7YA 3W7IA 2Y63A 4UFKA 3W7QA 2XN0A 2A1YA 4Z1DA 1ZCOA 2NUXA 2QCDB 4PEKA 1RQEA 3R8RA 1A5SA 1YDVA 3DU0A 2CLKA 4MJZA 3EB2A 2VEIA 5CZ0A 1Z48A 5BNKA 4LVBA 4IXXA 3KVMA 3HPSA 4D2JA 3PVFA 4JTJA 2J24A 4O28A 5I3HA 3ELFA 2Y61A 5F1UA 2V0TA 3EX1A 3P7YA 3DZ1A 3M9YA 5CKSA 3BO9A 1WAUA 1JRBA 1C8VA 2QJGA 3PULA 1YYAA 2Z1BA 2YX0A 1F6PA 4LV4A 1TPC1 1FDYA 1QOQA 1PCKA 4RXFA 5AHEA 3P8IA 1MEHA 4FO4A 4A2RA 1TREA 1ZFJA 4HPJA 1A5BA 3H55A 2Z2UA 3EXTA 4RR4A 1BEUA 1VS1A 2H3BA 3PG9A 1FX6A 1TPFA 3W1UA 4HNVA 3STFA 3ANYA 3N34A 4QAIA 2J88A 3OHIA 1YDNA 5HUPA 4JYEA 3UYCA 2PRLA 3R89A 3WJYA 3UWQA 5CPMA 4MZ8A 3LB0A 4KFOA 3TNOA 1EB3A 4LVDA 1R2RA 4MZYA 2B0MA 2Y7FA 3ZWTA 4WQ6A 4O4WA 1WOBA 1EWEA 1W5OA 3A5VA 1GVRA 1AW1A 3P62A 4JNMA 3UWZA 3WK3A 1HO4A 1G4PA 2V8ZA 4LTSA 3WJSA 3P80A 1PS9A 3LLFA 3W2JA 2ABAA 3M5ZA 3G8RA 3QC3A 5A5WA 1UUMA 3G22A 4CQ8A 2EKCA 4KWVA 1OFDA 1TIMA 3QZEA 1HTIA 1HFBA 3TSDA 4TO8A 4AXKA 1K8ZA 3LCGA 4N6FA 3RK8A 1YPIA 5FF3A 1B57A 4N9DA 4TMBA 1MEIA 1OFOA 3FYOA 3W1MA 2JK2A 4OV4A 4JGDA 1SQ7A 4MYXA 4HNTA 4QM1A 3LV5A 1A5CA 4FX7A 4MZ1A 1M6JA 4FX6M 5LNSA 3E12A 5DCBA 3VCRA 4M5PA 5DCDA 4ORMA 2I14A 1G7UA 1OX4B 5KZDA 2OCZA 3A9IA 3M5YA 3FLUA 4RLIA 2CLMA 5I3KA 4MFDA 1PCWA 4E0CA 1LOLA 2GOUA 3DI0A 1T0OA 1RPXA 3NL6A 3EKZA 4IGHA 1WX0A 4WOZA 4M7TA 4BK9A 1KFKA 2FPYA 2WNQA 1T8XA 1B4KA 1O5KA 3CLMA 3T40A 3C56A 1RR2A 1SR9A 3BG5A 3W07A 1M5WA 3G18A 1CX9A 2PRHA 3RLVA 4O0ZA 4X22A 4PH6A 4EF8A 5H2ZA 2ABBA 3U2OA 3WJXA 2JKEA 3W1QA 4Z0JA 5DXXA 1GVOA 1X6UA 3NQEA 4BF9A 1JQVA 4MKNA 1KV8A 3W7LA 1KFLA 3UWUA 3LDVA 3QQ1A 3PG8A 4WD0A 3TCEA 3OIXA 4MY8A 2YDAA 2JGQA 2B7OA 3NL2A 1ZAHA 5LGZA 1ZY9A 1W37A 3RFAA 2A21A 3W3OA 3C8FA 4RXGA 2FTPA 1Q3NA 4GWEA 1Y0EA 3DFOA 3EX2A 3LHYA 4N6EA 2C6QA 2E09A 2A7PA 2BX7A 3GXNA 2ZRYA 4IMEA 4S1FA 5BRBA 3MW7A 4Y9AA 1OHLA 1TRDA 3MP5A 4I9AA 4XKYB 3SSJA 3PBUA 3VE7A 4UTTC 1QOPA 5KZMA 2PURA 4NJGA 1LRTA 3NPWA 4WY0A 4LW7A 1K7EA 3UD6A 1SO3A 2VEKA 4Z1BA 3YPIA 4IX0A 5LKYA 1LBLA 3PSVA 3NM3A 2QUUA 3TX9A 4XZ9A 1LOSA 3TFCA 4NNBA 4GC4A 3LCFA 2V5LA 4L4LA 3W2UA 3L5LA 1JCLA 1W54A 3LM7A 4WUIA 3TSMA 1R2TA 2YZRA 3EWBX 2YSWA 3MUXA 2GVJA 1GZGA 3PWAA 2H6RA 1EWDA 1QDSA 4OE7A 4CQAA 3G1HA 2YW4A 3MBDA 4FB7A 1DOSA 4N02A 1GVSA 3MJYA 1B4EA 2WKJA 5FESA 5D2XA 3W7DA 2DJXA 3JRKA 4WY0B 5EBUA 1SW0A 2QF7A 4JXCA 3IVSA 3B03A 1H1ZA 3VNDA 1AK5A 4O1CA 4X2RA 2ATSA 2A6LA 5HR7A 1G4TA 1TTPA 5C2XA 3IVTA 2A4AA 1XKYA 1ZENA 4JDYA 3W7CA 4CNNA 4WZHA 3SIZA 1I2QA 4HSOA 4IUOA 2EAWA 3LHVA 2V82A 1Z44A 3DKJA 4QQ3A 2E5DA 2CLHA 3DHFA 4AH7A 4GBUA 1TV8A 1AMKA 1W5MA 2NWSA 1JRCA 4K38A 4MY9A 4E38A 2ZZ1A 3HBLA 1ZHAA 4M7SA 1GVFA 2G95A 2F84A 3IVUA 3L9CA 2EGZA 3UXAA 4JTLA 1VZWA 1XL9A 1YXYA 1O95A 3DXIA 2EPHA 1EEPA 1X1OA 3B8DA 1UBSA 1G4SA 4NZJA 1QFEA 4W9TA 4UFIA 5EYWA 3HF3A 2C0AA 2YR1A 2EHHA 2PRMA 4FHAA 1OFBA 3A23A 1GEQA 2NLIA 2Z0IA 3TW6A 2CLLA 3K30A 3W86A 2WPBA 3MHGA 2C16A 3UWVA 4NUWA 2P1FA 1BTMA 2J9XA 4DEFA 4O16A 3T55A 4LC8A 3LBCA 3P60A 4WXYA 5DELA 1GTEA 1P1XA 3A24A 5A8GA 1FDJA 3AO0A 3HPZA 4O50A 5D38A 4TU1A 5KITA 1LDCA 1ME8A 5LZLA 4LVAA 4MUZA 4Q33A 1PVNA 1BWKA 1NSJA 1T96A 1SFLA 4KKXA 3ATZA 5LNRA 3KVKA 2LLEA 1DVJA 5CZTA 2ZQ0A 2PCQA 4AWTA 3O05A 5EKYA 1QCWA 3NAVA 1TJRA 3C3NA 1F7BA 1LYXA 1LROA 3CU2A 3R5EA 4JTKA 4IXHA 4UUIA 1XXXA 1F74A 1H61A 4POCA 3G3DA 3LGEA 4N2YA 4NJIA 3TMQA 1W5NA 1QPNA 1QWGA 1L6SA 5CPLA 4JYDA 4NXSA 4R34A 1SW7A 4TX9A 1QO5A 3W83A 2V5BA 3HG3A 4UTUA 5I3IA 2A7NA 5L6UA 3W9ZA 2XN1A 4OV9A 5EMUA 3BG3A 3SY5A 1GPWA 5K2ZA 3NQMA 4MVAA 3DFTA 5LNUA 3L65A 3IIOA 4UMAA 3FJLA 3KRUA 3N2XA 2WSRA 3G1XA 3PSWA 1VHCA 3T7VA 1Q45A 4XWUA 2NXHA 4FIQA 4ZQCA 5DN1A 3L5AA 3TDFA 3N9RA 3W7EA 3PBWA 1IGSA 2G97A 1L2UA 1WQ5A 2J9ZA 5DBUA 4FEZA 4LY8A 1D3HA 3LOTA 4XBKA 1JCXA 1H7WA 2KZHA 3CC1A 4FNQA 5F4WA 5AC6A 3LHUA 3QM3A 4JN6A 4K7YA 4OQVA 1TPUA 1ZNNA 2ZZ4A 3L0NA 3GR8A 4M6QA 2NX3A 2NWRA 3GYEA 2FPTA 4LOCA 4ZL1A 4MLJA 2YPIA 5HQEA 3O15A 3MP3A 4UFHA 4NX0A 1TSIA 1A5AA 1BKSA 1VLWA 2VFIA 2ISVA 3MMTA 2X1TA 3IEBA 3R12A 4ADTA 4PC8A 1XBZA 3F4NA 1NF7A 1ME9A 2DJLA 3DFSA 3KVLA 1MXSA 3NM1A 4G1KA 1ALDA 4K37A 4I7WA 2X2GA 2C19A 3KX6A 3RMJA 1C29A 3MI2A 3LI1A 4DQWA 3Q37A 1S5VA 4N9EA 1QNVA 2JKAA 3NZRA 1LZOA 3T44A 1XBYA 1JCMP 2VEPA 1S3HA 3H54A 1OK6A 3C2FA 1OFAA 1QAPA 4UNLA 2Y70A 3GNDA 4O1DA 4XUGA 3G3MA 5D2WA 3G1YA 1TV7A 4UTWC 3W2MA 2Y7GA 4O4VA 3QW3A 3THAA 1GT8A 3CPRA 2CLFA 4IMCA 1XDMA 4ICNA 4NZFA 5EL1A 3NPVA 4AF0A 3N73A 1W3IA 3CHVA 3M41A 1ICSA 4BI6A 1LLZA 4HNUA 3O06A 4K36A 1WYIA 3GKFA 4JR5A 2ZZ7A 3E0IA 4FNRA 3W2LA 3M44A 5G2HA 2ZRZA 1C9DA 4YLWA 2QCGA 2Y7EA 3TAKA 3E49A 1EP2A 3GB6A 1T99A 3LHTA 4Y96A 1PHQA 3TH6A 4UFMA 4JEQA 3S5ZA 3UY8A 5K9CA 5E0KA 2CZDA 1XDLA 3QPYA 1AL8A 3SZ8A 1O94A 5CZSA 4XTDA 3WFAA 1F5ZA 4B5NA 3UQNA 1K7FA 4ZQMA 4UMCA 5U7SA 1TQJA 3S42A 5D02A 1OYBA 3EXRA 4RCXA 4QITA 4PFMA 3AJXA 3PB2A 3BG9A 3S6DA 5F1VA 2X30A 4C1KA 1KM1A 1J2WA 2OZ0A 1TPWA 1MZHA 3TA6A 2H90A 4HKPA 1F73A 2ZZ6A 4PCFA 4DO4A 2RFGA 1W31A 2ZRUA 3ABQA 1Q6OA 3I68A 4P2VA 4JTEA 1RQHA 1P4CA 2VFFA 3KOFA 3NG3A 4Z0SA 2DZWA 2E5CA 2ZA2A 3W23A 3TIMA 1F76A 1ONRA 3W88A 2FLIA 1KV5A 1FXQA 1Z42A 5G1YA 2TRSA 4JS3A 5I3JA 4AHPA 5LHFA 3FEMA 5C55A 3UZ5A 4AB4A 3BW2A 2E1DA 1YTKA 1SZFA 4O1AA 3LHZA 2ZA1A 3V75A 4P61A 3W75A 3TAOA 4JYFA 2CLOA 2Q8ZA 1WOAA 3S9YA 1KTBA 5AYYA 1VYRA 5G2IA 5I3GA 1VR6A 3DHDA 3DFQA 5FI8A 3STCA 4UFJA 3LCXA 5G4WA 1O4UA 1LBFA 2E6FA 3ABRA 4NVTA 4O0KA 2JKPA 3QSRA 4QSHA 2W6RA 4FXSA 3DKLA 2ISSA 2QUTA 3HGRA 4HT3A 5LSMA 1A53A 1JCJA 3F03K 3QFEA 3NR0A 3IRDA 4MOZA 4GE8A 3DBPA 3Q94A 1FCVA 3CEUA 3WK1A 2ZZ2A 1DJNA 2RDUA 5F2MA 2E6DA 3SI9A 3C2RA 1Z41A 5CSRA 4ADUA 4JX6A 1FWTA 3P81A 2V2CA 1BWLA 2C13A 3W7PA 1OX6A 5DCEA 4XKYA 1JUKA 1LTDA 3O8AA 1VCGA 4Z08A 3NGJA 2NV1A 1EX5A 4L4MA 2VEMA 3HG4A 3G1SA 2WNNA 1FWSA 3I7SA 3G1FA 3FJ6A 4WXZA 1K7XA 2V81A 2QAFA 1B3OA 4XTIA 2E6YA 2GQAA 1JR1A 4YMZA 3PUEA 4MY1A 3W2NA 2TYSA 3EWZA 5AOUA 5BMXA 5FF0A 1X8FA 4U28A 4JTTA 5D2TA 3W7MA 3NQ8A 1A50A 5HWNA 2Y6ZA 5FEXA 5D30A 2FPVA 3L2IA 4UR7A 5AHNA 1SZEA 1TO3A 1IXPA 2C15A 4S2CA 3M0ZA 4NJKA 1KA9F 3BK0A 4HN4A 3UPBA 3O6CA 1VYSX 3RF9A 3TU9A 5AHMA 1EPXA 3T78A 1TTJA 5AN7A 1YPFA 3C4UA 4AAJA 5IM51 4KWWA 3NNTA 3QW4B 4MPQA 1JJKA 5TQLA 4AVFA 1Q6LA 5MHBA 1FWWA 3ZFHA 1IXOA 5ABTA 4LUIA 5KSWA 2VKZG 3ZS4A 3VE9A 3M1ZA 2I9EA 1B9BA 3E9AA 5F4SA 3P82A 1ICQA 1XBVA 2TPSA 2WJZA 5TIMA 3LCHA 1GVQA 3HGSA 3UPWA 4K7VA 1G67A 3QJAA 2R94A 3H53A 3CM4A 3DI1A 1H62A 3LXAA 2NX1A 4Z1AA 5FEPA 4UTTA 4EF9A 1JCNA 4IPIA 1GOXA 3GDTA 2R8WA 3NYZA 2CLIA 3EX3A 1W3TA 3B0UX 3DFNA 4UC5A 5F4XA 1F05A 1XC4A 1PE1A 3PB0A 3FOKA 4OU1A 4R7JA 1QMLA 5HWMA 3L66A 3EWYA 3FIGA 4S2BA 4UTHA 4TIMA 2B7PA 3O16A 4NU7A 1FY6A 4GRSA 3NVTA 4WY0F 3P5YA 5EPDA 4NT0A 1I2PA 1KFJA 2H8ZA 1NF0A 1O60A 3FKRA 4IX2A 3BARA 3C2OA 4FF7A 3LERA 1S5WA 1P0KA 1KM5A 1P0NA 5C6MA 3PF3A 1VGAA 4HNNA 4MLRA 2ZBTA 3CQ0A 5FF7A 4JX5A 2BTMA 4YCOA 1H7NA 1OX4A 5AYXA 3MI6A 7TIMA 1EUAA 2E5BA 2Q3RA 5HMSA 3W2KA 1AW2A 1MSSA 2QR6A 5D2VA 4JTGA 3S0CA 3JR2A 4A2SA 1GWJA 3GAYA 2ZYFA 2ZRVA 1RVGA 2GQ9A 1Q6RA 4K39A 1SSGA 3CIWA 1DJQA 1TCDA 2FFCA 4O57A 3E02A 2WQPA 3QRHA 1TPEA 5CSSA 2YFOA 2AQWA 2O7QA 3B0VC 3QMRA 2H3DA 4TMCA 1W1ZA 3CIXA 1UCWA 2WV8A 3UWWA 3LTSA 4LWWA 1F2JA 3TV8A 3MHFA 4ORIA 2J27A 4FNPA 1I8JA 4EOUA 3G1DA 4E2BA 3QF0A 5F2GA 5FEZA 1TQXA 1XI3A 1R30A 2TMDA 3LRLA 2OJPA 1KFCA 2D73A 2QAPA 4Y8FA 3EX6A 3QPZA 3HMJG 2B4GA 3P84A 5HINA 5LHEA 1AW5A 1QPQA 4MIMA 1I45A 1KM3A 3IGSA 1SU5A 4FX8A 3NPXA 1H50A 1EP1A 4DBDA 2OX1A 1H7XA 1DKWA 3C2EA 2WNZA 5BMWA 3NQVA 3ZR4A 3BPWA 1QR7A 4GXMA 3QMSA 3NQ7A 2Y85A 1FUYA 1L6WA 4O1BA 2ZZ5A 4DF2A 3W87A 4AWUA 1P5BA 3W22A 2NUWA 3G24A 1SUXA 3SJ3A 1F6KA 4AHQA 3GDLA 5E93A 5K7JA 4J9JA 3L68A 1HO1A 1MO0A 5F2IA 2R91A 1SO6A 1SPQA
chains in the Genus database with same CATH superfamily
3AXKA 3M5VA 3UZZA 2FQIA 5EY5A 4JQ1A 4XQ6A 3TONA 1RJQA 4OIFA 2VENA 1JUBA 4H8VA 3WBAA 3DN5A 4KFNA 3MS8A 4RV3A 5FA5A 4XD5A 1KFEA 3PR2A 4ZO8A 1K9DA 2EBNA 4BQ4A 4AY7A 3QGKC 2AQOA 3WDJA 3WD4A 2X42A 4QJ1A 3WY1A 4NAFB 4K6AA 3GAKA 4FIRA 3BLIA 5FJPA 1TVLA 4HHHA 3I10A 1ADOA 2REQB 3SCRA 2YFNA 1BXCA 4W85A 3W72A 1B1YA 3VVGA 5K9XA 3BCFA 3A13A 1KBLA 1Q6QA 2PTXA 4IFRA 5CAHA 1YDOA 2J13A 3H4WA 2VCBA 1EQCA 5CC3A 4BI5A 4H19A 5I3DA 3R0KA 2NQHA 1MVYA 3N13A 6XIMA 4N4QA 2VZVA 2GJNA 4DM2A 1LM1A 1D9EA 1DQWA 1PHWA 2YYTA 3F4WA 3C6CA 4ICCX 4BWLC 3DENA 3SBFA 5CPTA 4XAPA 4RNFA 1HZYA 3IJ8A 2DUAA 3EDKA 5D37A 4OOUA 3KOWA 4O15A 2FDSA 4FMVA 2WSPA 2XH4A 4GVIA 3TOPA 4GUGA 6A3HA 2EJAA 1SR0A 3T2QA 5HNNA 2IQDA 1K03A 4R5EA 3O63A 3EOLA 4O10A 1XRVA 2PLJA 2NW0A 1GYNA 2GLKA 1VBHA 3WLOA 3WEMA 2CHRA 1T41A 3HGJA 3QHNA 3WQWA 5H91A 3MI3A 5HMDA 4Q8VA 4ATWA 4UCFA 3UR2A 4REQA 3S1VA 3I7RA 3IIXA 4GVGA 5JUVA 3AXIA 4N4PA 3U4AA 4HNLA 4QXIA 4C65A 1VQTA 3WF4A 2D24A 2GQ8A 2OSYA 3URAA 2XG9A 4WKHA 2GVEA 4IH3A 2O55A 2XVLA 2Y8UA 3HZ3A 1TR1A 4DWSD 3WQ6A 3GNNA 3O07A 4FPSA 3CEPA 3PTMA 4GH3A 2WWCA 3K1DA 1KBBA 3CZEA 1J6OA 1UIPA 1NOFA 1FHDA 1QO2A 2IKHA 2X40A 3B4YA 4Q4OA 3GBEA 1J11A 5L9FA 4CNOA 2WMHA 1TV3A 3NZ1A 1D8WA 3TC6A 4BKNA 4U4MA 3PBYA 1PKMA 5EA9A 4HIBA 3NO1A 5AFDA 1R46A 1LOQA 3W02A 2JGYA 4QJ5B 2D2HA 1CLKA 3ENLA 3OVRA 4W8AA 3VIMA 2ATMA 1ZBWA 4PTVA 3NDOA 4ERGA 3BV4A 2INFA 3MYOA 1AMYA 4JIHA 2HS8A 3OA3A 1KLYA 4EPDC 4FA3A 1AFSA 1B0IA 2PA6A 3R2GA 4Q7NA 4UNKA 4B91A 2QCDA 3P74A 1NTHA 5HPCA 5T8GA 2WCGA 4IP5A 3WJWA 3KBMA 2ZC1A 1GK8A 3LCLA 1F3WA 1MYRA 4IMFA 3E74A 3V5FA 2DZVA 2DORA 4B90A 1N7KA 5HWJA 2PDQA 2WHJA 5BOOA 2ZZ3A 3KFTA 1MW2A 2X1SA 2JF7A 2XPKA 1K6AA 2PC4A 2BODX 1KCZA 2HSAA 3VGDA 3CWOX 3WK0A 1KBIA 3OPSA 3GFYA 4HCHA 3ZSSA 1PAMA 1B3XA 3B9OA 1TYGA 1GJWA 2XIBA 5FJTA 3CMFA 4BR1A 4EAYA 1I6NA 3TUUA 3SECA 1KB3A 3VOCA 3BUVA 4MJMA 7ENLA 2A0NA 1K6WA 1CB2A 1BYAA 4GINA 2O9PA 1C8XA 2RH9A 3I6RA 3W1PA 1B5TA 4A22A 3EKLA 3MDUA 4OECA 4CCDA 3FV9A 5FJUA 4H9XA 3STEA 2OWCA 3WO8A 3WDIA 1BYDA 1S1RA 1W91A 3AYRA 4Q3MA 2UZ9A 3GHUA 3DH7A 4PMRA 1YNPA 1E3ZA 4AX7A 3QGAC 1XIDA 4HOXA 4QLKA 3AC0A 3C61A 2YL5A 4GYPC 4CQ9A 1A4LA 4OWGA 2DVXA 2J66A 1KRMA 3RAOA 3BC9A 4GIRA 4J2PA 3KHDA 1E4IA 2B7NA 4DXVA 1TUFA 4F9DA 4AX6A 1EEXA 3TZFA 4AZGA 2RGLA 1FCBA 4KEZA 2JBMA 4X2PA 1KRBC 2F2KA 3DAQA 1BXNA 4YTTA 3OVQA 3CUIA 3VILA 4DELA 2FH8A 3VKJA 1GHRA 5DT5A 2G50A 1WKDA 2FVMA 1SMAA 4Y9NA 1TZZA 4LCQA 3WMSA 4UTJA 2FTWA 3G1AA 4MB1A 4NYYA 3AAMA 3U4FA 1DJZA 5A94A 2PDHA 3T8LA 2G3NA 5KZEA 2VX7A 2A3CA 1BPLB 4QS6A 4Q8OA 4UIOA 4HPGA 1CYGA 2PFHA 2V3GA 4AF0B 4M6VA 1Z9AA 1W56A 4UR8A 3L0GA 4M6PA 4C6CA 1YKWA 2X09A 2WVVB 2Z1SA 3FSUA 3UR5A 1K8XA 2WLZA 2HS6A 4AYSA 5D9OA 4WJ8A 1Q4NX 5HATA 4ZB5A 3VYLA 4DYJA 2GVGA 3SY1A 1EDTA 1TPH1 2VP8A 1SO5A 3PUDA 3G0SA 4LS0A 2G5WA 3ARUA 1FCQA 3LXCA 3V3WA 4I5UA 3WDPP 4LEQA 2GJLA 4LUTB 4WR3A 4IOTA 3N19B 1G01A 2E68A 3EDEA 3WLTA 1MUCA 3BL3A 4AZ5A 2YDRA 3OO2A 3DFPA 1MQPA 4Y90A 4BI7A 1JXKA 3TWBA 1MNSA 2OFJA 4RJEA 4W87A 5IXEA 4QROA 1JL8A 4ADSA 2XSAA 3OG3A 1M1BA 1JAKA 4EACA 1UWIA 2RUSA 4Y9MA 4MB5A 2PZNA 3ITGA 3GR7A 3V5OA 2XFYA 3BANA 3SCQA 3TQKA 4P8UA 3C0JA 3FXYA 2OSWA 1VCFA 1XLAA 3AXXA 1SMDA 3WDHA 1G4EA 4H00A 1E0UA 2OO6A 1VF8A 2YJQA 3UG3A 2DW6A 3QEZA 1XM3A 2V3EA 2ISWA 2ZTKA 3ARXA 2X1UA 4C6BA 3L5MA 3TN3A 2VI0A 2JQXA 1XIEA 4LUYA 4PA8A 3SEPA 3W1AA 2XFFA 3L4XA 2C14A 1U1UA 1TE1A 3DGRA 5A3HA 3RU6A 4E8CA 2Y8KA 4KEMA 2PE4A 1PX4A 1XIFA 1GQNA 4JTDA 4B2DD 2AQVA 2NZLA 3P8JA 1GPFA 4BQ5A 1CLVA 1RALA 2CBVA 4GUFA 3TN5A 3R25A 3V16A 3VDGA 1EIXA 3N17A 3ECQA 4QNEA 3NQDA 3UY7A 3QV7A 2Z1WA 4LJ3A 4AD2A 4BY3A 3ZT6A 4MTVA 3KWSA 3UG5A 4GX8A 1NQ6A 3N2MA 1Q7MA 5A95A 3UXLA 4L9XA 4G56A 1KW1A 2C91A 5KZ6A 1SO4A 3IV8A 3UJEA 2I7GA 1FRBA 1YTDA 1DYSA 1F4AA 1DXEA 2IQTA 3JZUA 1PL9A 1ZSXA 4IIBA 3ZQ9A 1I2RA 1VPXA 3NVDA 1X39A 1LT7A 1KBKA 2JF6A 3NOEA 4DJED 2GDQA 2CZFA 4WRHA 1GG1A 3IWPA 1KFWA 1WA3A 4KPLA 4U31A 5CAKA 4GZ7A 4YWSA 5G2WA 1FWIC 1OX5A 1Y5WA 4DJFD 3L67A 3EMQA 3RPDA 2W63A 4A8RA 4V1XA 5TBOA 4OHQA 4TR9A 3RG6A 5F2LA 4UQDA 1V6TA 1R3SA 3OGVA 3IS4A 4L6OA 2FGZA 4OGZA 2P5NA 3UJSA 3IUHA 3PPHA 4B5UA 4H9MA 4ZOAA 2XUCA 5MF5A 1YXCA 3AHVA 4DPQA 3W7RA 6PTDA 2Y7DA 3VM7A 3VU2A 3KOYA 1E6NA 3W38A 2WW5A 3KRSA 5AB3A 4AEOA 4CLMA 2IMRA 2OMAA 1J0HA 3BAWA 1I75A 4M1BA 2CLEA 2DSZA 1E0WA 1NARA 2P3ZA 3TEVA 1LWJA 3DFHA 4UOJA 4OBSA 2F7FA 4EIVA 3VZZA 1TMHA 2HVMA 1UWSA 2NQLA 2CZ5A 3C0SA 3RUBL 8RUCA 4IT1A 1MXGA 5GQBA 3G6MA 2O4MA 2VFEA 3IJQA 4I90A 4C90A 3IIVA 4QQUA 2YCIX 4UTIA 1WKYA 3UERA 3LSCA 2PDBA 5CG7A 2Z28A 3FX4A 2CNCA 3W25A 3WLSA 3QN3A 4WJEA 3CWNA 4A29A 2Q02A 4N9BA 2V5KA 2PDLA 4JTAA 1YLVA 3O0KA 2PDWA 4HSNA 3MV01 5CSYA 1HT6A 4F0MA 4GGHA 4GC3A 1T5AA 3QKEA 3E0FA 6ALDA 4S3EA 2YA2A 3DFYA 1OFRA 1KM4A 3TYEA 4EPBC 4HHPA 5BWAA 6XIAA 1VFOA 3ANUA 3A21A 2PPGA 3PPGA 2J7DA 1E40A 4AVOA 2GDUA 3POHA 4KETA 3W7QA 1TWIA 4Z1DA 1ZCOA 3THDA 3UWEA 2HJPA 3Q65A 3OVGA 4UB9A 3DU0A 3CYVA 2PD9A 4PUEA 4HMNA 4LVBA 4UNIA 4UOZA 3KVMA 4F2BA 4JTJA 1TUXA 4KRUA 3UBPC 5C9UA 3ZJKA 3SN4A 2Y61A 3TTYA 2V0TA 3DZ1A 2OXNA 4GXPA 5CKSA 4GI6A 2UY2A 4QSFA 2I57A 2J4GA 4IGSA 1JRBA 3PULA 4W7VA 2YX0A 4ZSUA 1FDYA 1QOQA 4RXFA 5AHEA 3P8IA 2CKSA 1EXBA 1ZFJA 2R6OA 2Z2UA 1BEUA 1XFCA 3SSZA 1BSIA 2R1LA 4JHMA 3PG9A 1TPFA 3UYIA 2Y24A 4LCRA 5GJPA 1F8IA 4QAIA 3AIVA 4MAVA 4A35A 3R89A 3UWQA 4MZ8A 1W32A 3WD0A 4KFOA 1E71M 4D6DA 3TNOA 4MZYA 3T1GA 2QGYA 1P6WA 2Y7FA 2X7WA 4O4WA 4PTDA 3FDKA 1WOBA 4DUVA 3P62A 3UWZA 2YXXA 1W1VA 5CZKA 3TCSA 1XLEA 3KS5A 1PS9A 3LLFA 4GO8A 3W2JA 2CEQA 3VMNA 4CKQA 1SJAA 3UZXA 4CQ8A 4RDYA 2EG8A 1HTIA 1E0TA 1K8ZA 4E4FA 2AGTA 1QHZA 3W1MA 1E9LA 1RSCA 2IXUA 4OV4A 1Z7AA 4IG2A 1DIKA 4QM1A 1U5HA 4FX7A 4MZ1A 1QBAA 4FX6M 2DDXA 4I6KA 1KXVA 4YTQA 4M56A 9CGTA 5E9XA 2OEJA 2DT3A 2WVUA 3BSGA 2OCZA 3FLUA 4Q4QA 4E2VA 2J79A 2JEQA 1WXZA 2DT2A 5EMMA 4MFDA 2VX5A 3KBSA 1T0OA 4TTUA 5LYRA 4AZHA 4AD0A 3QFWA 3MTWA 1KFKA 3AWOA 4M82A 2OZTA 3FXGA 2POZA 3EOEA 3ZJ6A 3BG5A 3GFXA 3T0AA 1CX9A 4D1JA 4PH6A 4EF8A 1IQ8A 1K9FA 2JFEX 2QPSA 4Z0JA 3W1QA 4E2OA 1OBAA 1U1JA 1UZDA 1V3IA 3BJFA 4B15A 4BF9A 1IT0A 1OM0A 4MKNA 1KV8A 3BURA 3VIJA 1XH1A 1KFLA 3S6OA 5LA1A 2VX6A 3PG8A 4JTRA 4MY8A 3IJDA 4GPNA 3TZNA 2XGZA 3LZ3A 3LMZA 3NL2A 3RFAA 2A21A 3C8FA 4RXGA 1CECA 3GFZA 4BJHA 2A7PA 2BX7A 4HZ8A 3CH0A 5AZ0A 1ZL1A 1UKTA 1XG3A 3DX5A 1EXPA 4S3FA 4Z1YA 3T6CA 3H21A 1RLDA 5J8LA 4XKYB 3LNPA 5M3WA 5B7ZA 4RDVA 2VJXA 4GACA 5KZMA 3CO4A 4WY0A 3NPWA 4EWJA 1JG9A 1JPKA 3YPIA 4PFHA 3FN9A 4X60A 4WKFA 2QUUA 1LOSA 1R3YA 1Q63A 1W8GA 4GC4A 2FKPA 2V5LA 4L4LA 1PX3A 3P14A 4WUIA 3TSMA 1R2TA 3VOGA 2GVJA 3TTEA 2DSVA 1QDSA 4OE7A 3G1HA 3QTPA 3NFUA 1GKQA 2GGEA 4N02A 1WKFA 3WQEA 5FESA 5D2XA 4UBPC 3DEQA 3GM8A 1S2VA 2QF7A 4R88A 1H1ZA 4E4UA 1AK5A 5GNXA 1U5VA 1YPXA 4JCMA 1XRSA 3ZR6A 2RJGA 5HR7A 5C2XA 3IVTA 3UVIA 4JDYA 1UQZA 4QR6A 4WZHA 3CGTA 3RU8X 4AD4A 2EAWA 1ZZMA 3T2OA 1Z44A 1H2JA 1I0BA 3DHFA 1EFZA 1AMKA 2GGJA 4HOZA 4RE2A 4LBUA 2CWXA 4A6GA 4L61A 1E70M 4M7SA 1GVFA 2G95A 2F84A 3IVUA 4IPPA 3UXAA 4QE5A 4RDZA 1B9ZA 1DXFA 1YXYA 1P7TB 3DXIA 1DJHA 2EPHA 1UBSA 1G4SA 4M3PA 3M0JA 4NZJA 1QFEA 3RM4A 5HBFA 4GQBA 5A1AA 5EYWA 3B9DA 5DEZA 2EHHA 1OFBA 1HNYA 1GEQA 1V0LA 3WENA 1O68A 3K30A 5ABHA 3MHGA 4J3UA 4KMQA 2P1FA 2VZSA 2J9XA 1W1B1 2E0PA 1BLIA 4DWDA 3D5HA 4FALA 1GTEA 3RILA 4WIWA 1SJCA 5A8GA 3CUHA 1NIUA 3BGAA 4L80A 5KITA 2BVDA 4M1RA 2KAUC 3MWCA 1PVNA 2X0HA 1S2UA 2Z2AA 1XYCA 2J7FA 3U3HA 3ATZA 2P76A 1KGWA 2LLEA 3GE7A 1DVJA 4AY1A 3UPMA 2ZQ0A 3VCNA 5HJXA 1NWRA 2VRQA 3H7UA 3C3NA 2Z26A 3CU2A 4IXHA 1F74A 4NI8A 2VM8A 1X98A 2QIIA 4US6A 1QPNA 2XTKA 3MQTA 3WQPA 2D69A 3BSMA 2F6UA 4TX9A 2V5BA 4V33A 3W00A 4UTUA 2A7NA 5EMUA 3BG3A 3NQMA 1OWQA 4EXAA 3DFTA 5LNUA 2V69A 6TAAA 5FIPA 2PDXA 4C7FA 2WSRA 4MAZA 1Q45A 4XWUA 2WLYA 3T0BA 4DWSA 3ARWA 2ZXDA 4GZJA 2OQYA 3LOTA 5G1MA 1Q8AA 3BSHA 4GFIA 5AC6A 4CEUC 5F4WA 3CC1A 1E4LA 3E3HA 3LHUA 4F2TA 3QM3A 3QZAA 5BZAA 2O9RA 5HMEA 3L0NA 1NP0A 3GR8A 7ODCA 1SFSA 4M6QA 4GIEA 2PDIA 4PB3A 2FPTA 4LOCA 3WFZA 1ZJHA 1AH0A 5FKYA 3MP3A 1CXEA 1GHSA 1TSIA 1EJVC 1TWSA 1BKSA 1HX0A 4C91A 2ISVA 2F38A 4DLMA 3IEBA 3OYXA 4ADTA 4PC8A 1XBZA 1JIBA 2J8GA 3MUCA 3WF1A 2XH7A 3DFSA 5TF0A 1JPMA 4WEVX 3GXFA 4EAMA 4H2CA 1OIMA 4Z17A 2X1IA 1JCMP 4M0XA 3LNMA 4DJEC 3VGHA 3C2FA 1RP8A 2D2OA 2J47A 4RPPA 1K1DA 1EYEA 3TTOA 1VJSA 3MA8A 3M64A 3URBA 4XBJA 2DQXA 1MRQA 3THAA 1XX1A 2QMKA 2WM0A 3CHVA 4I9MA 4HNUA 3A3XA 4JR5A 3WD1A 4DIAA 2QGHA 4DYKA 1QI5A 1KCXA 2E25A 3M44A 3BCDA 4YLWA 2VO5A 1EP2A 4WVXA 3LHTA 1H0GA 5CPSA 5JIPA 1JZ7A 3OA5A 1LUCB 5A2CA 4JEQA 5E0KA 1V4YA 4IIFA 1ZJAA 2CZDA 1JZ3A 4J28A 4XTDA 4FI4A 4ZBCA 4B5NA 3UQNA 2FHFA 3RGTA 3C0LA 1TQJA 3S42A 3EXRA 4C60A 4QITA 3AJXA 3BG9A 4Q8PA 1EO5A 5M1TA 1IZKA 1KM1A 1J2WA 1TPWA 3TA6A 1XYLA 3R10A 2VCCA 4GCAA 2RFGA 5FAJA 1UR2A 2Z24A 4P2VA 5AC4A 4MUPA 2I56A 1GGOA 2VFFA 4IQJA 1RK6A 3T09A 3AS2A 4Z0SA 3W23A 4CNUA 2JIEA 3TIMA 1F76A 3VZXA 4CQCA 3WUEA 4QAWA 5G1YA 4PUWA 1UR3M 3FEMA 3EAUA 3UZ5A 2OLHA 2E1DA 1SZFA 2FZ8A 2OGJA 3N2CA 1B90A 3W75A 3KUMA 5AVNA 2ODOA 3F2CA 4EXBA 3VC5A 1PYMA 1WOAA 2R1PA 1VR6A 1LG2A 1XHGA 4I5RA 3LCXA 2E6FA 1NDVA 2JKPA 5B80A 4I5XA 4HT3A 2AL1A 3QFEA 1UR8A 3CMGA 4L4OA 3DBPA 3WBEA 3WK1A 1UH2A 2ZZ2A 4D6GA 4V27A 3C2RA 1Z41A 4H2HA 1F6YA 4JX6A 1FWTA 3P81A 4LAKA 4Z2HA 2V2CA 2R1MA 1JPIA 3N4AA 3S9ZA 4XSMA 3ZJ8A 1KXTA 1OX6A 3VIHA 1SJDA 4US5A 3OBAA 3PK7A 2PP3A 1EX5A 1Z6KA 2VDIA 1E15A 1UKOA 5BYWA 1E9ZB 1FWSA 3G1FA 3DYOA 2V81A 3GXIA 3VNYA 1DWAM 4YMZA 2TYSA 5AOUA 5BMXA 5KETA 2BOEX 1X8FA 1V0KA 4IQDA 2Y6ZA 4XVEA 3RM9A 2FZMA 5JH1A 4Z2IA 4NRRA 4DZIA 2FPVA 4WDUA 2B31A 3T0TA 1MQQA 3M0ZA 1KA9F 3UPBA 1OB0A 4IGMA 1GZ1A 1VYSX 2YCKX 4AZ7A 3TU9A 5A6KA 3W28A 1UH4A 1UD8A 4AYGA 3C5QA 3GWQA 4AAJA 5IM51 4MPQA 3I3BA 4AVFA 1H3GA 5LIUX 3ZFHA 1IXOA 3R94A 4GO9A 3VE9A 3UT0A 1WB0A 3LCHA 2G0WA 3WBXA 2E9LA 3GTNA 4MDPA 3UPWA 1E1CB 4K7VA 1YE6A 2IKJA 5I23A 4JBRA 1S1PA 3LXAA 3C0QA 3R1ZA 2AL2B 4UQAA 1C8YA 1RXOB 3D47A 4UTTA 5HOSA 4HZMA 1YDYA 1GOXA 3SCUA 1FHLA 2ZUUA 1CWYA 3D46A 3CZGA 3CS2A 3QC0A 4XO6A 1C7SA 1QMLA 3OQEA 5HWMA 1BGAA 2D2JA 3BAXA 4BQ3A 1P6BA 3P5YA 1OADA 4L4PA 4HB7A 1CDGA 1I2PA 2WZTA 3GC5A 2NQJA 4IX2A 5M17A 1HW6A 4PR4A 4IIGA 4AEEA 1MW0A 3KW3A 5FF7A 1NH6A 2BTMA 2PMQA 3GVQA 4YCOA 2ZADA 3PFMA 4DI8A 2AMXA 3MPGA 4W8LA 7TIMA 5HMSA 3W2KA 1AW2A 1QI4A 3UESA 2H9AB 2YCJA 4RNHA 3JR2A 4PUMA 4C6FA 1VKFA 1XIBA 4H8UA 4A2SA 4U3AA 3K4WA 1XSIA 1UZ4A 5C0QA 1RVGA 3CIWA 2FFCA 4J2MA 1CENA 2OKTA 2DVUA 3BCJA 1TZ7A 1EC9A 1WZLA 1V0NA 1W1ZA 3GTHA 1IEIA 1UCWA 2QPXA 4W86A 3MV11 4MDOA 4HCLA 3WLLA 3NCOA 4FNPA 2Z7KA 3G1DA 5F2GA 4NASA 3I6TA 1KGUA 2YBVA 3GIPA 1DJYA 2Z4GA 3EX6A 3AALA 2I5IA 3AI0A 3R79A 3HMJG 2B4GA 3PN8A 1UMYA 4MIMA 4YHEA 3BZJA 3IGSA 1SU5A 3ES7A 5C9WA 3NGFA 3W81A 3OIHA 3E5BA 4CD7A 7CGTA 4GXMA 4MMWA 2V63A 1GQLA 1L6WA 3LGDA 4O1BA 1OINA 1P5BA 1UWTA 1SUXA 5CC5A 4AHQA 3GDLA 4K68A 4QE1A 5K7JA 4J3VA 1EF3A 2R91A 1WZAA 2EXOA 1TKKA 3VDCA 2POTA 1ONWA 4LBSA 2XN2A 1KM2A 1S39A 3OLGA 1H51A 3PZ9A 1ECEA 3NQAA 1N55A 4NZ4A 2ISDA 2EJ1A 1FA2A 3KRZA 3KEHA 3W1TA 3N3MA 1RUSA 1K8CA 2BLEA 2CWNA 2C3ZA 6ENLA 2V3FA 3LPOA 3N15A 4HPNA 4R3UA 4QEHA 2OEKA 2YBUA 1EGZA 1XKJA 3CZJA 4RNIA 3PBGA 2QCLA 1RJPA 4HCDA 1K8YA 3NJ3A 1UZHA 2DT1A 5I03A 2FIQA 4LC6A 4QJ3B 2PWGA 1AQHA 1AL7A 4Q8NA 3HMCA 3HFYA 4P7QA 4BEUA 1LLWA 5K3VA 1HG3A 3GNOA 1FKXA 1W5QA 2WKGA 7REQB 2PTZA 5LGXA 3COTA 1XH2A 3LD5A 2BY0A 4P7OA 5CBBA 3UR8A 1O1ZA 1WAWA 3S1UA 2W3ZA 1UB3A 4RPQA 5HAOA 3U7VA 2BWGA 3MO4A 5BWFA 3PUOA 3E2VA 3HPAA 2NT1A 3G0UA 1J4EA 1NU5A 2CW6A 3MO7A 4DF0A 5T26A 4CU6A 1UWUA 4QCEA 3TMLA 1MNZA 3OEXA 2D2GA 3IK4A 2NVAA 1W9DM 4WK9A 3LGGA 4D6EA 3KHJA 4FOJA 1JNEA 3ARVA 3E2QA 4HTYA 3K2GA 2P53A 4KWSA 4HOWA 3U9IA 1LBMA 4OBTA 3VIFA 3KCLA 1WDPA 1AH3A 3UF9A 1LORA 3B8TA 4Q4PA 3VD5A 3HA1A 3A47A 3CHCA 2VZOA 1UG6A 1OY0A 2ON3A 2J7EA 3KXQA 2VELA 4BWLA 3FJNA 3K8MA 5D05A 5C9XA 4OJYA 1O66A 2NSXA 1FWRA 1I1XA 1GYMA 1DP0A 1R3RA 3SGGA 5DFAA 1DWFM 1W5PA 1O5XA 3VDHA 3A9BA 4ZZ9A 4Q4RA 2D0FA 4HYVA 2IQ0A 4QE4A 1FP8A 3FHQA 3ID7A 4ILSA 5FL0A 4ERAA 1R85A 3CHDA 1SZGA 2X0SA 3ZT5A 1RZMA 4O13A 4QDPA 4LVFA 3MHUA 5B7YA 1UD3A 2V2HA 1G1YA 4UZUA 4DJDA 1GTHA 4DZAA 4E4PA 1XYMA 1YNQA 5E6ZA 3W84A 1RV8A 4JTHA 1EDGA 4Q4MA 1LWHA 2YOCA 3BJTA 3SJNA 3PAJA 5ABFA 2E67A 3RM8A 2RHGA 4K8EA 3GXDA 4JTUA 4DHGA 1R5YA 3AMCA 1XF0A 4XZMX 2OYLA 3W7OA 3M7WA 4NZCA 1NFBA 2ZUSA 1G69A 1ME7A 1IF2A 3NDYA 1K9TA 4CVWA 3LX9A 5M5DA 1Y65A 4AIBA 1A0EA 1E55A 4D6FA 1A80A 3HGOA 2HNEA 5CC6A 1VJIA 2G4FA 1J5SA 3AMGA 4Q8QA 4I8DA 4GNJA 3U8GA 3VFCA 3EEZA 2Q71A 4IF2A 2YCLA 2Z1XA 3B3DA 3RNDA 4V1YA 2E4TA 1M7XA 1A3WA 4ZFMA 4MG4A 5D04C 1J5TA 4PMOA 3CZKA 1G5AA 3P93A 3USZA 1HGYA 1VCVA 2YIHA 2J7GA 1EA0A 1C91A 1OG6A 4RE4A 2ZFAA 1ITXA 2CBUA 5IFPA 1KM0A 5REQA 1SVDA 2P8BA 1SW3A 3I4EA 3G1RA 1XC6A 3WMLA 2WAGA 2DSWA 4FK9A 3U6WA 2V2DA 1XLGA 4E2DA 1XLFA 3GHRA 4PL1A 1KRAC 4S3DA 3TJLA 4UWMA 1HJVA 1IT7A 2VD8A 2GUBA 5HJLA 2FB2A 3F5KA 5XIAA 3ALFA 4A3QA 1X7IA 9XIMA 1H7PA 4GABA 1I4NA 2R14A 2GDVA 3W53A 1ODZA 4F48A 2BHYA 2WOQA 4JKLA 3WQ8A 3QMTA 4XBSA 5D8WA 1UJQA 1XYFA 3AXHA 1E1CA 1V3KA 4BZYA 3B8UA 4LS1A 3D3FA 3ERPA 1AUSL 4XIAA 1RCOB 2VEGA 1M03A 3PWGA 3HG2A 2W5FA 3E5PA 3APTA 1J93A 1AA1B 3LTPA 3S2MA 2PODA 3GIYA 2GUUA 3CL6A 5HDRA 3VC6A 2CXEA 2DZPA 4O8RA 1UASA 2WBGA 4UCGA 3WELA 5IDZA 4JFVA 3F2DA 1ZALA 3T07A 8CGTA 1NEYA 5BXRA 1B2YA 2XIQA 4OTKA 4YIWA 3LRKA 3BOXA 4UMBA 4LS2A 2BS9A 2CZVA 2DZXA 1RD5A 4MYAA 3GXMA 2OOFA 3NXFA 4M8UA 2R1NA 3FYPA 1UOKA 3GTFA 3MWAA 4F9JA 3CIVA 1X1ZA 2WMIB 1EO7A 3UG4A 3M07A 4D6HA 3GYCA 1I9CB 3CV2A 4C6QA 3SGUA 2WHKA 1X6LA 4IQLA 1H5YA 1U22A 3FS2A 5CH9A 3A4JA 3M6YA 3E1F1 2CXGA 4GUIA 3KRBA 2DZBA 5HR6A 3M0XA 5IBXA 4FXFA 1XIMA 1XIIA 3PZUA 1VYPX 3QV8A 1KKRA 4TX6A 1B31A 1TB3A 2GVLA 1POJA 4RE3A 1SM9A 5AHLA 5AYZA 3EBVA 1OT1A 1V5XA 3WLRA 4R33A 2J6XA 5J5DA 4LPCA 2NQ5A 3VGFA 1EBHA 3G5EA 4L7ZA 1KR1A 5I78A 1NWSA 3LCWA 2VX4A 1UROA 1EJUC 1U30A 1XIGA 3UWYA 5JH2A 1XINA 4K8HA 4MSSA 1QW9A 4A21A 1MW3A 4HZ6A 3UZYA 4O53A 4DO7A 3G1VA 4JTFA 4ONVA 4KFPA 3B0YA 3PAOA 2PDGA 1CGUA 2GPTA 1UH3A 2GZXA 3AXMA 4WHBA 4UTKA 3PPCA 3W1RA 3W85A 2NXGA 2WZHA 1N8WA 3E96A 3INPA 3LLDA 3AIQA 1E1FA 3RR4A 1LRNA 4MB4A 2WZEA 2A7RA 1I2OA 4DBWA 5C8BB 3LN3A 1JPDX 3EX4A 5G1TA 1JYWA 2J75A 1TG7A 5J04A 1RBOB 4IP4A 2OT1A 2V30A 3RPTA 2P50A 3IARA 3N3TA 3IJ6A 4O11A 3GRIA 2QCCA 2YYUA 4Z2JA 2AOSA 1EL3A 3MANA 3MP4A 1GUVA 4YN5A 2E8ZA 3PNUA 1Q2RA 2RAGA 4RX0A 4U2ZA 5DXYA 3VCCA 2O7SA 3M7SA 1MI3A 2HVOA 1VD6A 4KEUA 4NAEB 3JW7A 2QEZA 4KBXA 4S3BA 2CC0A 1R3WA 4FNTA 5AHIA 4PRRA 3GC4A 1M3UA 1LRQA 2OT0A 1X96A 4D9PA 4J3ZA 3TYBA 1P0BA 3AZSA 2VFDA 2J7BA 2PBGA 5C9RA 3IGUA 3PS7A 6REQB 3WLJA 2AAMA 2IPWA 3GH5A 4HK7A 5EFDA 4A8NA 1JFXA 1JUEA 3M0HA 4GQQA 3OVPA 2BY3A 4UTLA 4WSKA 3UW6A 4PMDA 1N2VA 1UP3A 1KC7A 2QJIA 1Q4WA 1ZAIA 4QCFA 1OABA 1FH7A 2X1RA 1TV5A 3OLIA 4LAOA 1UMLA 1KCKA 2J77A 3BAYA 3PWIA 3PZIA 3ARPA 1ADSA 3KBVA 5D32A 3EA1A 2BXZA 1HUVA 2ZUVA 4JY8A 3QLDA 1JF6A 4Z42C 1UD4A 5BRQA 1QASA 3TN6A 4DRSA 1NVMA 4ZQOA 4S38A 4J3WA 3PANA 2XIOA 1UR4A 3BV7A 3CK5A 4H7VA 1KWKA 1OFPA 4BFAA 1XD1A 1TV2A 1W17A 1HGWA 2HBXA 4ZODA 1DJGA 3HQOA 3GLCA 1OC7A 1Q5MA 2V67A 1UKQA 3FHAA 1A5KC 4I7UA 2PTYA 2V3DA 2ZCGA 3TK7A 4CD4A 5EFFA 1JI2A 1KBJA 3KAOA 2Q8LA 4UTMA 2DSKA 1VH7A 3KM8A 1BRLB 4JCLA 3L21A 3QQ0A 4IPJA 1GJPA 3B4UA 2DUXA 3AIBA 1E4MM 2VDHA 1G94A 4R27A 1F3EA 3URQA 1HL2A 3LBMA 1E6XM 3SN1A 3LYEA 1EYWA 4CCEA 3PZGA 3K1GA 1QPRA 3AJ7A 5PTDA 2DUZA 2NUYA 3SUUA 1PZ3A 3BJSA 4NQ1A 3S5NA 3WJZA 1XUUA 2C8NA 4H1ZA 4XD6A 6CGTA 1AJ0A 1K02A 2TSYA 2E28A 4K2SA 1VLIA 4NXKA 4ZEPA 2YW3A 2PCEA 1KXHA 3H2FA 1V7YA 3E0VA 2PWDA 3STPA 3VNZA 3W7IA 4B3KA 3VDBA 3WMBA 2NQ9A 3I3EA 5HXMA 2OB3A 2XN0A 1A3HA 2GGIA 2NUXA 3KDNA 2QCDB 3HQNA 3C8NA 1RQEA 3E0LA 2XISA 3MKVA 2CLKA 4MJZA 3EB2A 2ONEA 1EA9C 3T42A 2R1KA 3LU2A 4ZE5A 2QT3A 3UCQA 2DEPA 3HPSA 2BVTA 1QVBA 4MPKA 2J24A 3CZLA 4HHMA 4MKSA 1QXLA 3ELFA 3PZNA 3EA2A 3P7YA 1IEQA 4DAIA 4QP0A 1BAGA 1NDZA 4XSLA 4MWAB 3U5YA 2QJGA 2Y5SA 5DT7A 2Z1BA 1F6PA 1EJSC 4ZXLA 1PCKA 1MEHA 4FO4A 1IWBA 3VD3A 3WNOA 4A2RA 2OLSA 4HPJA 1XW8A 3URNA 2YB1A 3H55A 4D8AA 2H3BA 2GUYA 3STFA 2QQ6A 3VNMA 1JNDA 2FGBA 2VR2A 4ZA0A 1Q6CA 1X6NA 1YDNA 5HUPA 2VZTA 2O56A 2PRLA 2WVTA 3CUJA 4Q8MA 3LB0A 4PUUA 2VC7A 4LVDA 3WD3A 1R2RA 1R6WA 2GJRA 2A3AA 2WJEA 4WQ6A 1I60A 3EMZA 1EWEA 3G2GA 1GVRA 1W1A1 1AW1A 3NIYA 2GSJA 1HO4A 1G4PA 2V8ZA 1W3JA 3WJSA 4TV5A 5TD4A 3SRKA 3MCNA 3M5ZA 5AKQA 1YX1A 2OPJA 1WNOA 1JZ8A 4OVXA 3QYSA 1BF6A 3SAZA 1UWAA 2PGFA 5FF3A 4N9DA 4TMBA 1MEIA 2JK2A 1ZS2A 2XSXA 1HJSA 1XQLA 4MYXA 5M03A 2CLPA 5JBFA 4AG0A 3LV5A 1M6JA 4FLOA 5LNSA 3VCRA 4M5PA 5CPQA 1XLMA 5DCDA 4S3CA 4XVDA 1VFTA 4HA0A 1FWJC 4TQTA 5KZDA 2CLMA 4E0CA 1RPXA 3WFLA 1TA3B 3IAPA 3NL6A 4HD5A 4AIEA 4NL1A 1ZP4A 4WOZA 4IMAA 4M7TA 4BK9A 5GNYA 4DVOA 5C9ZA 2WNQA 4YVVA 3CLMA 4QGCA 1F07A 1M5WA 3G18A 4O0ZA 1ZP3A 4AXNA 5H2ZA 1VAHA 2WHMA 3WJXA 4WDXA 5DXXA 2PDYA 3NQEA 4L56A 3CNYA 3FAWA 5JVLA 3WH6A 1XH0A 4C6OA 3W7LA 1KWGA 1R3QA 3NYDA 3QQ1A 1GQIA 4D6IA 3PFRA 3N1AA 1VBGA 3VGGA 4JFWA 2B7OA 1N8IA 1ZAHA 3TN4A 1GOKA 2FTPA 1Q3NA 4GWEA 4ZGYA 3LHYA 2C6QA 3DHUA 4B3ZA 4IMEA 2QJNA 1RLCL 4X63A 4Y9AA 1JDDA 1C92A 2EG7A 3GW3A 3MP5A 4RUBA 4I9AA 3SSJA 3VKKA 2CHNA 1S3TC 1R9ZA 4UTTC 2VR4A 4H6QA 2PURA 2UBPC 4G7EB 3L4ZA 4LW7A 5AZ1A 1Q66A 3UD6A 3AOFA 3EOSA 1SO3A 2F9RA 4H6RA 5CCZA 1LBLA 3QHOA 3TX9A 3KDOA 5FD0A 4JIEA 3TFCA 2ZC8A 4DZ5A 3VAVA 4PSRA 3L5LA 2DIKA 4GQGA 1W54A 1E0VA 2GWNA 2YZRA 1GZGA 4QS5A 3AHZA 1EWDA 2VMFA 2DY3A 1TV4A 1FWGC 4CQAA 3DG3A 2JEPA 2OG9A 4KCTA 1P0DA 1XWYA 3FY1A 3MBDA 4FB7A 1OGGA 1DOSA 3ZZ1A 3MJYA 1IHIA 2WKJA 2HISA 3W7DA 1PSCA 2DW7A 4KESA 3WD2A 5EBUA 3BH4A 3IVSA 1TWWA 1PDZA 2A6LA 2HV5A 4ACZA 1G4TA 1TTPA 2HZGA 1CLXA 1CZ1A 4B5TA 4ECLA 1VEMA 4J4KA 3LPFA 1TE6A 1LQ0A 1EC7A 3DKJA 4QQ3A 1AVAA 2E5DA 4DM1A 1H41A 1F9CA 4AD3A 2ZWYA 3WN6A 4E38A 2VWSA 3EB3A 3PJTA 3L9CA 4PCSA 2XGIA 3SCWA 1TWZA 5E6YA 4JTLA 1VZWA 4C6KA 1XL9A 9XIAA 4DN1A 3ARYA 4JQ4A 3SB0A 3TA9A 2PSNA 3OODA 1SFTA 2QZRA 4FLQA 2GJXA 4MWAE 4W9TA 2W27A 3HF3A 2C0AA 3WLPA 2PRMA 2P8CA 3RX3A 2V38A 2Z0IA 4E6MA 3W86A 4MNMA 4KGLA 4YTUA 2WPBA 1Y8BA 2GVYA 3UWVA 1BTMA 1LWIA 4DEFA 4O16A 4LC8A 4CD8A 1QRQA 5DELA 3AWNA 1EHNA 1FDJA 4O50A 5LIWX 5D38A 3A3HA 4PBGA 1LDCA 1ME8A 4MUZA 1HQTA 3FVDA 1BWKA 2UY5A 1F3TA 1SFLA 4KKXA 1Z32X 1E9IA 3KVKA 2OSXA 5H8UA 4AWTA 3LBOA 5A8QA 1NP2A 3VNLA 3DC8A 3OGRA 3QY6A 3NAVA 4QFUA 4CD6A 2EKGA 1GONA 2X2YA 1CTNA 3HU7A 3BZGA 4JTKA 4XG1A 1ZRQA 3CQIA 1Q7ZA 1H61A 1PDYA 4JFUA 3G3DA 3TMQA 4N2YA 1W5NA 2Y0FA 2J25A 4IL2A 3WQCA 1L6SA 5CPLA 1V6YA 4DUXA 1SW7A 4QBXA 4IIEA 5HNTA 3M0IA 3W9ZA 4F2UA 3SY5A 2Z25A 1GPWA 4DY1A 1UD5A 4XZNX 1Q6DA 2XH0A 3C2YA 2UWFA 1KQYA 3L65A 4RL3A 1DJIA 3KRUA 2V5DA 1S2AA 4P8VA 3TQPA 1GZJA 3PSWA 4GBDA 1VHCA 1ZTVA 3AIWA 5JMUA 2DGAA 2EO7A 4FIQA 1JDFA 4ZQCA 2XIIA 3TDFA 3H6OA 3RRAA 1IGSA 3PBWA 4GXWA 1WQ5A 1V7AA 1JCXA 1H7WA 1J0YA 3HV8A 4MHBA 4C6PA 2BV9A 4OQVA 1R3VA 7REQA 4TVDA 1UA3A 2NVDA 1BYBA 4MLJA 2V5CA 4UFHA 3EOOA 3M6DA 2J7HA 1VLWA 3N11A 2PUZA 2V6AA 1NF7A 1ME9A 3NM1A 4G1KA 1MXSA 5FOOA 2Q6ZA 3CAKA 4K37A 1VEOA 4I7WA 5A6LA 1S2CA 2X2GA 3IANA 5DQPA 4XISA 1W3KA 3OJGA 3L23A 4L9ZA 3DCPA 3T44A 1EJXC 1XBYA 1S3HA 1OK6A 3ZVHA 2IKGA 3GG0A 1ODUA 2VGGA 5E0CA 3WDQA 3MUY1 2V5JA 3LA4A 2Y70A 4XUGA 3AS3A 3W6LA 1ONEA 3BXWA 4FSAA 5D2WA 3G1YA 4HJFA 3K8LA 1L2QA 4UTWC 1CXFA 3W2MA 2Y7GA 3PTKA 1QOXA 3V1HA 8XIMA 4A3HA 4ICNA 4LFYA 4HK5A 5EL1A 4AF0A 3N73A 2O92A 5D9MA 2AKZA 1W3IA 3T81A 3SRFA 1ICSA 4K36A 2XZ9A 3GKFA 4FNRA 1ZBKA 3W2LA 3WBWA 5G2HA 2ZRZA 1C9DA 2QCGA 3TAKA 4B92A 3GTIA 4YS1A 3MVTA 2WYSA 3MSYA 4QRNA 2XVPA 4O8AA 3TH6A 1P1MA 1TIWA 4UFMA 1EOMA 3S5ZA 1XDLA 2IPJA 1ESWA 1OYBA 4DJDD 1EJTC 4RCXA 4ZO6A 4PFMA 3TYAA 1FVPA 4E8GA 2HK0A 1VEPA 2CETA 1J0ZA 4HKPA 1W9BM 4XZBA 3RRXA 2ZZ6A 4DO4A 1XP3A 3I68A 1EGMA 3CPGA 3CZ8A 3TOYA 2WPGA 3B97A 3RO8A 1RQHA 1P4CA 3B40A 9RUBA 1YBQA 4I6VA 2DZWA 2ZA2A 1K4HA 1FXQA 4JS3A 5LHFA 5C55A 5EMLA 2OTDA 3ONCA 4HYWA 1LT8A 4IPLA 4P7NA 1CGWA 4P61A 3B0XA 4HBKA 4GX9A 3TAOA 1BGGA 3AU2A 1E6RA 5AYYA 1EZWA 1VYRA 2TODA 5FI8A 3DHDA 3DFQA 1K70A 4UFJA 4RNJA 2AKMA 3ABRA 3VM5A 3KTCA 2HRWA 1T6MA 2W6RA 4FXSA 2QUTA 3HGRA 2QVNA 5HQMA 2E40A 4AZCB 1JCJA 3NR0A 3IRDA 3NSNA 3Q94A 2WMIA 3CEUA 3SI9A 3V5CA 3IGHX 3OZOA 4ADUA 1BWLA 3VD4A 2GFTA 4TUFA 1MFVA 4XKYA 4H04A 3OLDA 3ITVA 1VCGA 3W0KA 4Z08A 3T0CA 4WDTA 2Q09A 2BB0A 5TNVA 4HVXA 2WNNA 3ZLGA 3I7SA 1K7XA 5I02A 2QAFA 1QK0A 4XTIA 4FAMA 3PUEA 1Y5VA 3ZYZA 3BMWA 5D2TA 2QNEA 3NQ8A 1A50A 3WCZA 1SZEA 1GKPA 1X97A 4LUSA 4YYFA 1RD6A 1AJ2A 4XX6A 1RA5A 4GIYA 2OU4A 2G4JA 3O6CA 3LLXA 1HF6A 3CHFA 3HQPA 4C6DA 3VOHA 3W82A 4KIRA 4GKTA 4C6MA 5AN7A 1ECQA 3GG7A 4NRSA 5MHBA 1JDAA 1WE5A 1L6GA 3NTYA 2VKZG 3WQGA 2GYIA 2YXOA 2I9EA 2W4XA 3P82A 1GKRA 4V2XA 2TPSA 5TIMA 1J79A 2PBOA 1WUFA 3HGSA 3ORWA 1S2WA 7A3HA 1HN1A 1QUMA 3OTRA 3DI1A 3EB4A 2QPUA 4Z1AA 1UP2A 3CPUA 5FEPA 4DZHA 3MUIA 1JCNA 5LIKX 4IPIA 3RX2A 3NYZA 4Q8UA 3EX3A 1W3TA 3QV9A 4UC5A 2D0HA 3DFNA 4KCWA 1JDEA 1F05A 1LF1A 1RA0A 1XC4A 1PE1A 3PB0A 3FOKA 2QDDA 4N42A 3VGEA 4PULA 4K1GA 4S2BA 3EWYA 3FIGA 4PRTA 4PUNA 4IPNB 1L8NA 4MNJA 4PCNA 3II1A 4LYRA 1NF0A 3GNPA 1E6PA 1V3JA 1B3ZA 1P0KA 4PCTA 3PZVA 1Q6EA 5C6MA 3GVWA 1VGAA 3RX4A 4MLRA 3CQ0A 1SZRA 1OX4A 3K4AA 1R86A 1EUAA 2E5BA 2X41A 1GJUA 2WMKA 2MANA 2WZIA 2PB1A 3VUSA 3N2OA 4Q8WA 2HE8A 3DC0A 3CO8A 2GQ9A 3SQLA 1FH9A 3CWHA 4KRZA 1FH8A 4KWOA 2A3HA 2I9UA 4JL1A 2UY3A 4O1EA 2IXVA 1L6FA 4HTBA 3B0VC 2H3DA 3KL5A 4D1IA 1QTWA 1TMQA 3M46A 1BVNP 3PZMA 4IGNA 4IIHA 3W6MA 8XIAA 3QHMA 1I8JA 3SCNA 4EOUA 3OBEA 2E8YA 1UKSA 4UOQA 5C7HA 4HA3A 1IEWA 4H83A 1R30A 3LRLA 4W8BA 1OZQA 2OJPA 3WUBA 2D73A 4H41A 1V79A 2X7VA 5HANA 3W24A 3GU2A 1QPQA 3FW6A 1KM3A 2J6VA 5DMMA 5ABGA 1EHAA 4FX8A 3H24A 1PUDA 5DRCA 4DBDA 1WP6A 1H7XA 2XIMA 1DKWA 3NQVA 3ZR4A 3BPWA 4AC7C 1IWAA 3QMSA 2J8FA 4ZB2A 3T9PA 3NQ7A 2Y85A 2W67A 3E6EA 1CGVA 2WCSA 3VKBA 4AWUA 3W22A 1PWMA 2XGBA 3SJ3A 1F6KA 3DBNA 2FH6A 2G41A 3RN6A 3L68A 5F2IA 3WLKX 1XYZA 2WB5A 1ONXA 1SPQA 3B8WA 4UQBA 1TPB1 5JU6A 4FOKA 3R58A 3MU7A 2CU0A 4EX4A 2ZRWA 3RCMA 1J0JA 3HURA 1XCFA 3S5YA 4GKLA 4PODA 3W1LA 4HPXA 3BLFA 4E3VA 3NPUA 4KWUA 1SFJA 3S2LA 1N8FA 3UA3A 4O14A 3LG3A 1TPDA 1PV8A 3UNDA 3SCTA 5K4ZA 4Z2LA 1J6PA 3C52A 4B5SA 4XK2A 1FCUA 5CZJA 1JZ2A 1BQCA 4YVXA 3L0KA 1V03A 3CB8A 4DF1A 1WCGA 3OYZA 1U5JA 1R2SA 3DECA 2R24A 2CHOA 1HKVA 2A6NA 4MGGA 1MDLA 4EK7A 3LHWA 4GJ1A 3HG5A 2QJHA 3CUXA 1R9XA 1Z69A 3QH2A 3VKDA 4IQEA 3S8HA 1MW1A 4S3AA 4YL2A 3M43A 4AMAA 3BGJA 3GXPA 3H2AA 2IW0A 3M4HA 3ZVHB 5T9BG 3QOMA 5U4NA 5JXQA 4ML9A 5HQLA 3IPWA 1JI1A 3GH7A 3W1NA 3GVGA 1EPVA 2WVVA 1ZPTA 1OF8A 3GDRA 1MEWA 4D8ZA 1TMLA 3SADA 1VP5A 1YE4A 1SGJA 1UKPA 1XR2A 2HMCA 4OOZA 2CBIA 3HPFA 3PM6A 4N7QA 4LB4A 3O6YX 1QNRA 1UP0A 3W71A 4GQ0A 4AZIA 3S46A 5CC7A 4JICA 1YRRA 2BGNE 4JIIX 2O9TA 2VUYA 1XS2A 4JDBA 3TSBA 5IBXC 2PC8A 1ZBCA 3VNKA 3RJXA 4QHRA 3NL5A 4CVUA 2XIJA 4XAZA 4NNCA 3UP8A 4H9ZA 2Z7GA 2L5HA 4ZCWA 1P43A 3BAKA 4ZQRA 4L9YA 4LXFA 2FJUB 3EEGA 3WNMA 2D3LA 1Q6GA 4DUOA 4GI8A 1QI2A 1HJQA 2AL2A 3EKGA 1DBTA 1TJ2A 1M53A 1ZGDA 3APGA 4G5DA 3NQGA 4CD5A 3VNIA 1UD2A 1LCOA 4NJJA 1CXHA 2W0UA 4L6DA 5FEWA 4RZ6A 3HIJA 1MUMA 2W9MA 3OZMA 3TXZA 1OJXA 2YCEA 1GVYA 4P7RA 4O18A 3IV3A 3WLIA 2HK1A 4HMCA 3BW4A 1H0IA 1IR1A 2J9YA 2YGYA 1OF6A 3VZYA 1EX1A 3EWWA 3ITOA 1M7PA 3ONBA 1H1YA 1JF5A 4NAFA 5CGQA 2VFGA 3R0UA 4S3JA 3V1PA 3NQBA 4N9CA 2Y62A 4A3UA 1OZMA 1GOOA 3TW7A 1US2A 4PTNA 4JY9A 2F6KA 5DY2A 3I65A 1L6YA 1GQKA 3VFLA 3OG2A 1OIFA 1B3YA 2Y89A 1Z8AA 3R13A 4HU4A 4ZOEA 1W1YA 1L9WA 3W74A 2EF9A 5H1WA 3I7QA 2HQAA 2VFHA 1UJPA 1UC5A 1BVZA 1WDRA 4WF7A 4PTXA 1U83A 4LU0A 2BGSA 2VZUA 1E73M 2AGKA 3FAXA 4LQ1A 3CTLA 3HB9A 1XIJA 3R6IA 4CNTA 5FF4A 3GDKA 4JTSA 4N0RA 2FHBA 4LAZA 5G4EA 3QYQA 5F7UA 1BVWA 1NELA 1VFLA 5A6SA 5E1QA 2WHLA 5JBEA 2NXIA 2EPMX 4UXDA 4W5ZA 1AD1A 1VC4A 3LI0A 3N14A 1DHKA 4LVGA 3NQ2A 2OODA 3MUAA 5BW6A 3N6HA 3WG6A 4B2DA 4ZTXA 4B9ZA 1VBJA 2J74A 3EA3A 1Q13A 1S38A 2XFWA 2NSOA 3USBA 3PJWA 5J5RA 2FB3A 2VC5A 3DGBA 5BXSA 1AZ2A 3VPLA 2D3NA 3N9SA 1JCYA 4IWWA 4FXRA 4RZ5A 4S23A 1XD0A 4PMUA 5DY3A 3O2LA 5MKGA 2ZTJA 1E9YB 1UW9A 3BLOA 1XLJA 1W3NA 4NILA 2Y1HA 3MMDA 3VGBA 2ADAA 2WXDM 3NO5A 3M0KA 4INFA 1XG4A 3MDWA 4B3LA 1TTIA 1X1NA 1Z89A 1IXNA 3DYMA 3RXZA 4AMCA 2BXVA 3D6NA 1JZ4A 3KZSA 2CPUA 4JOMA 1MQRA 5AHFA 4LANA 4Z1CA 3MSRA 1PO9A 1NJJA 5GVJA 3W70A 1OFEA 4AIUA 5I3FA 4RW3A 3GR4A 1A5NC 3QSTA 1QNOA 4C5ZA 1HKKA 4JTIA 2PP1A 3P0WA 1IE7C 5DX7A 4GK8A 4LSBA 1HVXA 3A22A 1CGYA 4GJIA 5I09A 3MC5A 3CT7A 3G8EA 1Q6FA 4OZOA 3TKFA 1X38A 1YTEA 4MJ4A 2OR2A 5CPOA 3AIUA 4MWAD 4I7VA 5T9CE 4QNWA 2KX9A 4B9YA 2A85A 2A3LA 3GU1A 5I06A 4EXQA 3R43A 4JIQA 4HYRA 3GG1A 3TROA 3FDGA 2UV8G 2J62A 3QLLA 1H4PA 2BZNA 4NP7A 2WCAA 3U2CA 2XM2A 2YKKA 5D33A 1DL3A 5CJ5A 3HJZA 4U33A 4HA1A 3ISIX 1K77A 2BY2A 1ISVA 3LXBA 4TVCA 3WL0A 3ZSTA 4NNAA 5SWUA 2EG6A 4M19A 4PTMA 1W2PA 1LLOA 1ISWA 1F3XA 4V15A 3XISA 3H4XA 3O1NA 3PC0A 1DHPA 4LF1A 1BQGA 4YTRA 1KCLA 2OQHA 1EOKA 3NL3A 3UXDA 5TAOA 3GU9A 1XGEA 4FNUA 4CNSA 1P0EA 1JXJA 3BOFA 3O9NA 1TVNA 3BOLA 4DJFA 1QPOA 4M80A 2QCNA 4E5TA 3V18A 2PDNA 5BXTA 3H4GA 2WWDA 4IMDA 3C86A 3THQA 1R47A 5KINA 2DP3A 4UQEA 3GXTA 1W8SA 3EXSA 3QXBA 4PB4A 3OGSA 2DU2A 3W73A 4REQB 3P67A 1J9YA 1YXDA 1FBAA 4GH1A 3TYDA 5BCAA 2ZWZA 5DMLA 2WNWA 3CLWA 3TQ0A 3W7KA 2PU0A 3GIQA 3M47A 3OBKA 3TXVA 5LNVA 3BW3A 2O9OA 2FTYA 2G3MA 1JULA 5FACA 5C5YA 1ISYA 4B16A 4LF2A 3VIKA 1T7LA 4AFYA 1X7FA 2WSKA 3M0MA 4Q7IA 2ACUA 4WGXA 4AQLA 1FWCC 1AG1O 3KBJA 1GOMA 2ZA3A 5IOBA 3W7JA 1OEPA 2A5HA 1JPHA 4RV8A 1EP3A 4Q32A 4D72A 2QIWA 4W89A 4NZ5A 4H9YA 2AMGA 2XHYA 3A4XA 3VI2A 4WX2A 1KLZA 2XWDA 2E77A 2VTFA 3OQ8A 1TPVA 2VL4A 3U5UA 1WV2A 2X8RA 1IIHA 2FZDA 2FVLA 4ATLA 1MDRA 4PCPA 3C2VA 1G6CA 3CYJA 1BFNA 4RK8A 1JEZA 2ZE3A 2QCHA 3RLGA 1E51A 3UGVA 3HOJA 1UR9A 1OCBA 3ATYA 3GX9A 1CIUA 1TJPA 3QGVA 3W7GA 4ZSTA 4PUJA 3MT1A 2W79A 4M51A 5LIXX 1VHNA 3UCCA 1KR0A 4O12A 1WXJA 5H8PA 2E9MA 4ZENA 4PZVA 1QNPA 5I7GA 5AC7A 1AQFA 4YJ5A 2FFIA 2Z1VA 3VD7A 2C1HA 4X3ZA 2DPEA 4UR9A 3WNPA 3GTXA 2CZEA 4GVHA 3SCVA 2Z6IA 1B3VA 1CB7B 4Q4KA 3S2CA 3PBVA 3NQCA 2EPNA 3MKKA 4JTCA 4H3DA 4YYCA 3Q58A 4J3SA 3IIZA 4OBRA 1GG0A 1VRXA 4GUJA 3FCPA 1BD0A 3TE9A 1SYTA 1XIHA 5I2UA 4C6LA 4ZVJA 3ALGA 1X8CA 2WO5A 2JALA 4KCVA 3ITXA 5ABEA 4L64A 2FVKA 1S5NA 1FP9A 4LCSA 4GJJA 2X16A 3B9AA 3WNLA 3MZNA 1XUZA 2FZNA 3FKKA 4IJBA 3AZTA 1FXPA 4GI4A 4DXXA 1THFD 4Y7EA 1W1TA 4JTQA 4O1FA 1C8QA 4ZE4A 1ITUA 2P0OA 3STGA 3D0CA 1UWQA 4TOQA 3FYYA 1KFBA 1FKWA 3KP0A 4MM1A 2Z29A 2FJKA 3E38A 3ABSA 1TJ1A 2B7QA 1A4MA 1PTGA 3BGGA 3W1XA 1PWLA 2DFAA 4WSHA 3KL3A 2QCMA 1ZU8A 3IIPA 4IM4A 4U10A 2XWEA 4MWAA 2OO0A 5ABFB 3MYPA 1QK2A 2P10A 5C71A 1XV8A 1C3FA 1W3LA 1ITQA 4IMGA 3BLKA 2R9RA 4Y2WA 3VX0A 3WZ0E 1H49A 2Y63A 2PS2A 3QVQA 3G6LA 1UR0A 3J7HA 3LS9A 4GI9A 3S6TA 4PEKA 4NG3A 3VUPA 2CBJA 1VFFA 3GNXA 4CCZA 2I17A 4WGHA 1QJWA 4R7WA 3WF0A 3JUGA 4D2JA 3PVFA 3PNZA 4O28A 5I3HA 3EMCA 3W37A