3W07A

Atomic resolution structure of orotidine 5'-monophosphate decarboxylase from methanothermobacter thermoautotrophicus bound with ump.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution structure of the orotidine 5'-monophosphate decarboxylase product complex combined with surface plasmon resonance analysis: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 83
structure length 215
sequence length 215
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2012-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w07A00
3YPIA 1ME7A 4M19A 2A5HA 4WXYA 1K7EA 5FEXA 3NL5A 1VLWA 4YL2A 1DV7A 2OCZA 4YLWA 1K03A 2DZSA 3NQGA 1VCVA 3CTLA 2E6DA 2I9EA 2B7OA 3GX9A 3CU2A 4K39A 4P2VA 1W3NA 3TW7A 3L9CA 1ONRA 1RQHA 2ISSA 1LZOA 3T44A 4UFHA 3TMLA 2V2HA 3OHIA 1VJIA 4EF8A 1UB3A 1AW1A 1D9EA 4JTEA 4QIUA 1LOLA 2E5DA 3W7CA 1JCMP 5EBUA 5G4WA 4DO4A 3F4NA 4K8HA 1FCQA 5CG7A 3W88A 3TJXA 2PRHA 2J27A 3TNOA 3QPYA 1XL9A 4A2SA 3I65A 3L2IA 3C6CA 3KVLA 2A21A 3O8AA 3MW7A 3I68A 3S1VA 2VFDA 3H53A 4NU7A 4M7TA 1OX5A 5BMWA 5DCDA 1O4UA 1K8YA 1OX4B 4IUOA 1LRNA 4HSOA 4O50A 5L9FA 4POCA 3O1NA 1K3UA 4UTTC 2C18A 4JICA 3PULA 3UPBA 3NQ2A 4EOUA 4ALDA 3LBCA 1I45A 1LBMA 1HUVA 4LY8A 1TPDA 3M5VA 2GUUA 3IV3A 4QAIA 4WY0F 3UXDA 4MLJA 2R91A 4KWWA 3LRMA 2BWGA 2CLIA 1DHPA 3W7OA 2HS6A 2NX9A 1CX9A 4MJMA 4MUZA 5LHFA 4TIMA 3SSJA 3R89A 4K7YA 1M6JA 1QWGA 4O54A 4CCCA 3A9IA 4OT7A 1OJXA 2E1DA 3HPSA 2BSLA 5AC8A 1ZFJA 4CNNA 1TPVA 3DXIA 3LHZA 4TX9A 2R14A 1O5KA 4O1AA 2NZLA 3TROA 3PC0A 1ZAIA 3R12A 4A22A 4UTWA 2RDWA 1F73A 1TSIA 3VNDA 3UQNA 4BWLC 2JK2A 2A7RA 4PCFA 3QEZA 1TJRA 3DFPA 4RXFA 2NLIA 4ADTA 2WV8A 1VCFA 1TJPA 5KMYA 4JIQA 1KFCA 2G95A 4PEKA 3SGZA 3PY2A 3OIXA 4S2BA 2A6NA 4DQWA 1AMKA 4K38A 2NWRA 4CQ8A 3NL2A 4QNWA 3QFEA 4H4IA 2FPVA 3KVJA 4JGDA 4MOZA 3FJLA 3L66A 1C29A 3EXRA 3NQCA 2YSWA 4UFIA 1KBJA 3T78A 3FKKA 4IXXA 4QNEA 3S8HA 4JDBA 3LHWA 5IM51 2FFCA 3O63A 5AC6A 4GJ1A 1M7PA 2E68A 3G1YA 2RH9A 3MBDA 1H51A 5MHBA 3ABSA 3E9AA 1K7XA 5LHEA 2GOUA 1OYCA 1XXXA 3N19B 5D02A 1GZGA 3OA3A 4DELA 4A29A 5I3FA 3W1UA 3FA5A 2X1RA 4AVFA 4YCPA 3T7VA 3CM4A 4O1BA 2Z2UA 4RZ6A 2GJLA 3N2XA 3P80A 3TW6A 1DVJA 1H7XA 3QZEA 5EKYA 3GKFA 1H7PA 3C52A 3W76A 4CQ9A 3WJZA 8TIMA 4JTLA 1LDCA 3GDMA 5A8GA 1W56A 1Z48A 3M0ZA 4PA8A 5LNWA 3PSWA 4GUGA 3HMJG 4JTKA 1TQXA 4M6PA 1HO1A 4HNTA 1IXPA 5T26A 2CLMA 2Q3RA 3I7RA 1Z44A 3C8FA 4X3ZA 2X1TA 5D2WA 3G1VA 3CEUA 3S5NA 1GTEA 1H61A 5CSSA 4ZQCA 3EX6A 1S5VA 1TRDA 4JX6A 3PB2A 1EP2A 4LS0A 3IGXA 3IRDA 3BPWA 2B7NA 4LVBA 3F4WA 3AJXA 3CHVA 3LTPA 1PCKA 5FEWA 1C9DA 4MY8A 1F05A 4ZQPA 1PHQA 4IOTA 1M7OA 4MLRA 3DFQA 2VEKA 3DI0A 2VKZG 4GXMA 3UPWA 3BARA 2NV1A 3G0SA 5BW6A 5DELA 1GT8A 4N9DA 2QDGA 1F74A 3D0CA 1G4SA 3W2UA 3DFNA 2QCDB 3NQDA 5D09A 1W0MA 5EA9A 3GNDA 1GYNA 3VFLA 5I3GA 4JTHA 2DU2A 3C4UA 1HFBA 2RKXA 2CZDA 1DQXA 1HL2A 4O13A 5AOUA 3V75A 2E6AA 1PV8A 4FEZA 5AB3A 2H90A 4UC5A 4LTSA 2YYTA 4OQVA 1E51A 3W7KA 1LOQA 4E2DA 2PC4A 2VFEA 3NQ6A 3N14A 3M6YA 5EL1A 4UTHA 4UFJA 1MZHA 5I3IA 1OFPA 1ZY9A 2YYUA 5AHFA 4NJJA 3GVGA 5KITA 4D2JA 3NQ8A 1QOQA 2DJXA 4PODA 3MHUA 2ZRWA 2FPTA 3WJYA 1AW5A 1FDJA 3EX3A 2C0AA 3E0IA 3OVRA 4UTKA 3LLDA 1TPUA 4WXZA 1LYXA 1SFLA 1I2OA 2EAWA 3EWBX 1Q6QA 2XFWA 3T40A 2DZWA 4EF9A 1TMHA 3MBFA 3DI1A 4JTUA 1IIGA 3CQ0A 3LCXA 1P1XA 1TTPA 1WA3A 2VXNA 5LNVA 1VC4A 2CW6A 4MZ8A 2GQAA 3HOJA 3GDKA 1XBYA 2R94A 1I2PA 2ZCGA 2ZFAA 3MUXA 4ADUA 3G1HA 1GG1A 4FNSA 1VS1A 4UTLA 2J88A 3TXVA 1VQTA 1JUKA 3UZJA 4CLMA 4QQ3A 2Y88A 2VEMA 4HKPA 5HNRA 3G22A 1TTIA 1F76A 3CT7A 1TV8A 4NT0A 3O07A 4UXDA 1TPEA 5CZJA 4HIBA 3LCGA 2NX1A 3PBVA 1XDMA 3OEXA 2WJZA 5J5DA 4X2RA 1LROA 1OVDA 1WOBA 2ZTJA 3NQFA 3BV4A 4Y9AA 3PUEA 3LLFA 5AHNA 3EKLA 5D05A 2J9YA 3HGSA 4MFEA 4KKXA 1W5PA 4QITA 1B57A 3NGJA 3DHFA 4O57A 2WO5A 3W7IA 1SZNA 3SGUA 4FO4A 4FNUA 1NF7A 1JUBA 4CNOA 4MPQA 3NOEA 1KM6A 4LRSA 2CLKA 4O11A 2FLIA 3BO9A 2WSYA 4L4MA 2W0UA 3G18A 4MIMA 2YDAA 3LI1A 1OF8A 1ZNNA 3OG3A 1BWLA 4GUJA 4O28A 1XUUA 3LXCA 3TX9A 3UD6A 1TREA 1IXOA 4IMGA 3L0KA 3UXAA 2VFGA 3NVTA 3E02A 4FIQA 3L5LA 2NV2A 5E93A 3ZWTA 1VYPX 3CIWA 1L6WA 3O06A 5LNRA 4GFSA 3P67A 2ZZ1A 2QJGA 3DENA 1FCVA 2DZUA 3GR7A 4FNQA 4UTIA 3B0PA 5D32A 2CLLA 1WBHA 3WJWA 5LNSA 2B7QA 3G1XA 4UFKA 3W7MA 1A53A 3P84A 3A21A 1YDOA 1A5CA 5AN7A 1EA0A 2JGQA 3W1AA 3RFAA 4YCOA 3RMJA 3SR7A 1W5QA 2CWNA 1S5TA 3MP5A 4Z1DA 3C0JA 3G1FA 5LNUA 3KVMA 3UZ5A 2J9ZA 4RX0A 3W73A 1XBVA 2CLHA 2HSAA 4ORIA 3CWNA 3TQKA 1SUXA 3E12A 4MJZA 2D73A 3QPZA 3QSTA 2QJIA 1YXDA 4I7VA 1TIMA 1KM0A 3W70A 3STCA 5CGQA 2H8ZA 4E38A 3RLVA 4MZYA 3EX4A 4NZFA 2QCEA 4BI5A 2E09A 3W2NA 5F2LA 3RK8A 5F1VA 3W2KA 4AF0A 1IXQA 3PBWA 2BLEA 2NX3A 3P7YA 3LCIA 5AFDA 1C8VA 1FCBA 2J6XA 3LCWA 3NA8A 1ICPA 2A7NA 4FX7A 2C3ZA 3L68A 1GQNA 4GRSA 2ZA2A 5HQEA 4AWTA 1LRQA 3NPUA 1GVSA 3UYCA 1O94A 3GAKA 4PH6A 4N9EA 3O6YX 1SZFA 2TRSA 3DHDA 3KVKA 3INPA 1I2NA 1JULA 2A4AA 3HG4A 2YW4A 3MI6A 5H91A 4UTJA 2Y61A 1VR6A 4G1KA 4JTGA 3F1QA 1YPIA 3ATZA 1HO4A 3HGOA 3G1SA 1YTDA 3M41A 2YX0A 3S5ZA 4AWUA 4HN4A 1EB3A 4S1FA 4M5PA 3WK0A 4WUIA 3G24A 5C5YA 3EWYA 5U7SA 2Y63A 3S42A 1K8XA 3C56A 3FYOA 4IMEA 1BWKA 2V2CA 2FQIA 3QQ1A 5K4XA 1SR9A 1UJPA 5AHLA 4AHPA 5DXXA 2H3BA 3EWUA 1VHNA 3W1LA 2PURA 4IPIA 5D30A 4WD0A 2Q8LA 2X1SA 1NF0A 4LRTA 4BF9A 1FWRA 4O0KA 5HINA 4Q4KA 4UTWC 3BW2A 2O7SA 3Q37A 1TV5A 1B4EA 3M1ZA 2LLEA 4CCDA 2ZZ2A 3P62A 1THFD 3HGRA 5LKYA 4ZMGA 4WY0A 3NPXA 3BK0A 4L4LA 1RVGA 3LB0A 2XN2A 1MEIA 4DEFA 1ME8A 2GQ9A 5ABTA 4JTIA 1KLYA 1PE1A 2F7FA 1WV2A 2TMDA 4QM1A 4O16A 2YW3A 1QDSA 3NXFA 5U4NA 3ABQA 2QF7A 3EX1A 2NUYA 2ZZ6A 1BKSA 2Z6IA 5EY5A 1XM3A 3A5VA 3MI3A 5G2IA 3BG5A 2EF9A 3UWUA 3DFTA 2PRMA 4LW7A 5I3HA 3CWOX 4LT9A 1R46A 3PB0A 5D04C 4HPXA 4UR8A 4ONVA 2E6YA 3N2MA 4MFDA 4JEQA 4IXHA 1LBLA 4R33A 2P10A 5AYYA 3O6CA 4U28A 4Y6GA 1JRCA 1XDLA 3NPVA 1B4KA 2X1UA 1ALDA 2ABAA 3GXNA 5EPDA 1A5SA 1Q6OA 3W6YA 3QW4B 1CI1A 2TPSA 3TK7A 2V30A 3A24A 3NYZA 1ZENA 1J5TA 1JQXA 2QCLA 1KTBA 1N8FA 5D2XA 1SW3A 4IQLA 3LXAA 3QH2A 1KM2A 2AAMA 1XUZA 2JKAA 4XBSA 1YYAA 2Y7EA 3FEMA 3STGA 4IX0A 5I3KA 1H63A 4RZ4A 4BI6A 2ZRXA 5CPLA 2YCEA 3U6WA 1EP1A 3M7WA 2WNZA 3LXBA 3IGSA 4E2BA 2ALDA 3C2FA 2JKEA 2PRLA 2V82A 3NL6A 1L6SA 5HMSA 1OHLA 2EPHA 1GEQA 3S0CA 3LV5A 5E0KA 1FWSA 4UTUA 5EYWA 3USBA 3W22A 2X30A 2H8XA 2Y7DA 2BXVA 4ZZ9A 5BOOA 1QPRA 3DFSA 2I1OA 2A0NA 3IIVA 4O14A 1F6KA 4N9CA 3LGEA 3HQ1A 3W1MA 2HTMA 3S6DA 3UWVA 3IVTA 4P61A 4UMCA 4AXKA 1JQVA 1QPQA 4IX2A 4N02A 3EEGA 3L67A 4I7WA 5F2MA 2GVGA 1CW2A 3BLIA 3WK1A 4NJIA 2NUWA 4TMBA 5G5IA 3THAA 3IIPA 5D2VA 3G3MA 3W1XA 1OFDA 4MYXA 3TH6A 1K02A 2E6FA 3S1UA 4XKYB 4UTMA 4OV9A 1FY6A 1R30A 4IMDA 1NVMA 1TYGA 3P8IA 4R34A 2E5BA 3RNDA 3W2LA 1I4NA 1EEPA 1L6YA 3QF0A 4E0CA 1WAUA 3L0GA 2HMCA 4MYAA 2V9DA 2YR1A 4OHQA 3RU6A 2W79A 3FLUA 1YDVA 1G4TA 1UBSA 1EIXA 3L0NA 3W07A 3BW3A 3W7EA 4GUFA 4MZ1A 3GDLA 4XQ6A 1KTCA 3BVJA 3DH7A 1XI3A 2PE4A 2ZRVA 1YXYA 4OU1A 1S3HA 2Z0IA 3NL3A 4M6VA 3GR8A 1N7KA 4O19A 5CKSA 1JCNA 4O17A 2VFHA 4XUGA 2A2IA 1UUMA 4JX4A 5D38A 3B4UA 1QR7A 3GK0A 2GVLA 3FKRA 1Z41A 4RJEA 1RV8A 1SO6A 1O60A 1U5JA 4NNBA 3W1TA 3GIYA 4JN6A 5L6UA 3TJLA 1SSDA 1UCWA 3GXPA 1W54A 3TU9A 1P4CA 2GQ8A 3CIXA 4YMZA 3IEBA 1Q45A 3NPWA 3C2RA 3W2MA 4NXSA 5CSRA 1GWJA 4IJBA 2ZA1A 4BK9A 4DF1A 4A2RA 1W3IA 1H1ZA 3DGRA 4ORMA 3OBKA 3G0UA 1EUNA 1WQ5A 4JTFA 1SU5A 1Y0EA 3M5ZA 2Y70A 3DBPA 5G2HA 4O4WA 1QFEA 5DY2A 1XKYA 1RPXA 3NM3A 4NNAA 4HNUA 4K36A 5CZSA 2WSQA 1MEHA 4FXRA 2GJNA 4ZQNA 2FJKA 4KFNA 5LZLA 4DPPA 1WXJA 4Z1AA 4A21A 1W8SA 3BLFA 1EUAA 5C55A 2C6QA 3GKAA 5FI8A 1XCFA 3MWAA 3M44A 2FPYA 5FF0A 1G6CA 2C1HA 2Y89A 3R2GA 3IVUA 4K37A 4NXKA 4TU1A 4XWUA 3PWAA 5G1TA 4RR4A 3ZS4A 3SY5A 4Z1BA 1MSSA 2ZRUA 5C2XA 1J2WA 2QAFA 3A5FA 3FYPA 4MKNA 1O95A 3LRLA 4AHQA 4O18A 1NFBA 3TSBA 5K7JA 5J5RA 3TXZA 3H54A 2YGYA 4Z0SA 3PG9A 5CZ0A 3LHTA 3GNNA 1JCLA 3UWQA 3W71A 4Q33A 4IWWA 3QRHA 5A5WA 3LBMA 3CC1A 1H50A 2ZBTA 2ISWA 2QCHA 1JUEA 2V5LA 3LM7A 3T4CA 1VZWA 3ZWSA 1J4EA 1SO4A 2ZRYA 1AL7A 2JKPA 3TSDA 3R13A 4QSHA 3UY8A 4JTSA 1GPWA 3SFKA 4NZJA 5TIMA 2NUXA 2VOMA 4O10A 2DORA 3MP4A 1FXQA 1LOSA 1T96A 3IVSA 3EWWA 1Z42A 3R5EA 3A23A 4CCEA 1VHCA 1MXSA 3O16A 3BW4A 4AB4A 1JCJA 1KV5A 2ATSA 3BG9A 3TV8A 1G4EA 2NXHA 3NQ7A 1LBFA 3LOTA 5DCBA 1ZCOA 3L5AA 2X2GA 4IGHA 3PVFA 2CZ5A 3TKFA 1DJQA 1SZGA 1FXPA 3NQMA 3DFOA 1ADOA 2C16A 2DP3A 4H3DA 4JX5A 1KM1A 3M43A 5D2TA 4ZQRA 4WZHA 3LCFA 4Z08A 4UCGA 3RLUA 2P1FA 5D37A 2Y7GA 1TV7A 1DJNA 5HJLA 4XKYA 3FS2A 3LCLA 1G7UA 4LNYA 4OV4A 1EX5A 1GVRA 1H1YA 3MYPA 5BRBA 1GOXA 2ABBA 4MY9A 5HUPA 1ZJIA 5CPMA 4JYDA 4LV4A 1PS9A 1L2UA 4IMCA 1KW1A 1TO3A 1W3TA 3C61A 2OT1A 4GBUA 1FX6A 1ZAJA 1SW7A 4UFMA 3LCHA 4AWSA 3HO8A 3MI2A 3PG8A 5LSMA 2QCMA 4JYEA 3HGJA 1R47A 4AMAA 1QO2A 1YPFA 1OYBA 2EKCA 4FIRA 4RLIA 4NX0A 4IMFA 5I3JA 1QNVA 3NQEA 1W5MA 5C54A 4DXVA 3PR2A 1GTHA 4XBKA 3GDRA 4CQAA 4LC6A 5KZEA 4LC8A 2QCDA 2RHGA 3N9SA 1F7BA 4Y96A 3NG3A 3TUUA 3MHGA 4ADSA 2HS8A 4DF2A 2Y85A 5FEZA 3B0VC 4N4PA 3EX2A 4K6AA 3S1XA 3M5XA 1SO3A 3QMRA 3A22A 5DLCA 1UASA 4LOCA 2VFFA 1KFBA 4ICNA 4GWEA 4JNMA 3N3MA 4HT3A 1L9WA 1EP3A 4JY8A 2ZZ4A 2FB3A 4UTTA 3WK2A 1KFKA 3PM6A 3CB8A 4LVDA 4I7UA 4W9TA 1MEWA 2B4GA 1OK6A 5AC7A 3G3DA 2Q8ZA 5KINA 2H6RA 1NEYA 1TRIA 1FUYA 4PL1A 2DZPA 1T99A 3EB2A 3KRSA 1KFEA 2QDHA 2RDUA 1OYAA 1TTJA 3IIZA 3ABOA 1WX0A 1KM3A 3SECA 1DKWA 3TA6A 3LDVA 4HNVA 3QQ0A 5KZMA 3PBUA 3BGGA 4UUIA 2DZVA 3P60A 1AW2A 2YXGA 1A5AA 4NUWA 2NXGA 2QCCA 3G1DA 1SFJA 3STEA 5HWNA 1VH7A 2NWSA 1SO5A 3I7SA 3G0XA 4A3UA 2Y62A 2ZRZA 5AYXA 3F03K 3P82A 1IIHA 3W74A 1YDNA 4FNPA 4DF0A 2A1YA 4WOZA 4WOQA 2CZEA 4LVAA 4XZ9A 1JJKA 3E49A 3DKJA 2BTMA 3W23A 3GLCA 3K30A 3N34A 4TMCA 1XBXA 3PBYA 3U2OA 1H7WA 4LUJA 1H62A 4HSNA 4M6QA 1LCOA 1DQWA 3E96A 1GVQA 4H6KA 1VLIA 1QCWA 1FDYA 5AHMA 1PIIA 2CFFA 1RD5A 1FWNA 2C13A 2F84A 1NSJA 3W7JA 1YTKA 2OZ0A 1Q6LA 5DCEA 4WY0B 1KLZA 3KXQA 3LHVA 5FESA 2OJPA 3H55A 1EPXA 3PS7A 4MVAA 4AHOA 3VE9A 5DBTA 1IGSA 2Z6JA 3QMTA 1HG3A 4NJKA 5E1QA 2WSRA 1EWEA 2GVJA 3SZ8A 2GPTA 2VELA 1FBAA 3L21A 1RR2A 3QM3A 4JTJA 1M5WA 1OFBA 4K7VA 3SW6A 4N6EA 3HG2A 3W7QA 1FQ0A 2WNNA 1T8XA 3UY7A 3BGJA 2YFOA 1KV8A 1OFQA 1GVOA 4AAJA 1WYIA 1KM4A 3HJZA 2VEIA 3TC7A 2C19A 3TR2A 1LORA 4NJGA 3GAYA 4HNNA 2QUTA 3P74A 4EVZA 4U4MA 2WNQA 3WFAA 3M5YA 2G96A 3HPXA 3HPZA 4ZQMA 1W37A 2X16A 5D03A 3I6RA 1VGAA 4OE7A 4DBEA 4FX8A 5K3VA 5C6MA 3NEVA 1WOAA 3NQVA 1JCXA 1A50A 4LU0A 3O6DA 4LV9A 4RK8A 5CZTA 3LERA 5LGZA 5DBUA 3S9YA 4Q32A 2O7QA 5K4ZA 1K8ZA 5IBXC 1I2RA 4GC4A 3VE7A 1K7FA 4NVTA 2ZZ7A 3LTSA 3MJYA 1NAL1 3SI9A 3P5YA 3JR2A 5CPOA 5BNKA 2ZZ3A 3VKJA 2DZTA 3C2VA 3BLEA 5F1UA 1BTMA 1ME9A 1LLZA 3LRKA 1XBZA 2ZYFA 3C2EA 3IIOA 4FF7A 4N6FA 4DPQA 3DZ1A 1U83A 4RZ5A 3W7PA 3EXTA 3TCEA 4O1CA 3GDTA 4B5NA 4XTDA 1ICQA 5F2IA 1F6PA 3P5ZA 2R8WA 1TTQA 4EIVA 4C1LA 2DJLA 4RXGA 5FF4A 3ANYA 4XTIA 1GG0A 1KFJA 3CPRA 3NO5A 7TIMA 3ZR4A 1GYLA 3OVQA 3AO0A 4HHPA 3VI2A 2Z1BA 3B06A 1P5BA 5HULA 2JBMA 2QUVA 3MO7A 2B7PA 3TC6A 1LTDA 2OT0A 3S5YA 4JXCA 4UNKA 2YPIA 4FHAA 2VENA 2QJHA 1ZAHA 1WDWA 3TAKA 4UMBA 1OX6A 2FIQA 1RQBA 4JR5A 3W1PA 2AQWA 1QOPA 1I8JA 2ZA3A 6TIMA 5F4WA 4O53A 3W1NA 1ZHAA 1P0NA 1YADA 2QAPA 4JDYA 5AHEA 1FWTA 5FF3A 3G8EA 3QSRA 3TIMA 3TQ0A 2YFNA 5GVJA 3M9YA 4KFOA 1TPH1 1Q6RA 4OBTA 2C15A 2W6RA 3W87A 4HPJA 1KTNA 3W84A 2TYSA 4GUIA 1EWDA 2BZNA 3O15A 5DY3A 2QCGA 2QCNA 2A7PA 3HBLA 1RZMA 1OABA 1AL8A 3KFTA 2BX7A 4ZQOA 5H2ZA 3NQAA 2DZXA 4JTTA 1JCYA 3NR0A 4NQ1A 1OFAA 4QISA 1O5XA 2H3DA 1DORA 3FOKA 4FNTA 1X7FA 1LP6A 3L65A 4Y90A 3MMTA 3DKLA 2ISVA 4S2CA 1VYSX 3KHJA 4LVFA 2RFGA 3SJ3A 2CLFA 3QMSA 1V7YA 1JR1A 2WOQA 3JS3A 3KRZA 4O4VA 3N73A 3W72A 1SW0A 3W3OA 1LRTA 4PC8A 3TQVA 1VPXA 1G67A 3B8DA 3LV6A 4BI7A 2I14A 1AK5A 4K8EA 1H60A 3QW3A 2ZTKA 3WK3A 3TMQA 3BG3A 2WKJA 2QEZA 3SIZA 4UNLA 4PTNA 3TAOA 5HR6A 4OWGA 3TFCA 3QC3A 4QJ1A 4UMAA 4CNPA 3L5MA 3NZRA 1LM1A 1KM5A 3PAJA 3P81A 4ZL1A 3S5OA 3FJ6A 3QYQA 4LS2A 1ICSA 5F4SA 3W2JA 4NX5A 1PVNA 4ZVJA 1IXNA 2CZFA 4NJHA 2V81A 4X9SA 3HG3A 4O1DA 1F2JA 5K2ZA 4PFMA 1R2TA 3LTYA 3ZFHA 4N4QA 4UIOA 4Y8FA 3LX9A 4C1KA 4RKAA 5HWMA 3UWWA 3U8GA 3B04A 5FF7A 3LI0A 4GNJA 1X6UA 3NM1A 2JGYA 5EMUA 2V5BA 1GVFA 4EWND 2P0OA 2E77A 4AF0B 1QMLA 1G69A 4LUIA 2OX1A 4I9AA 3Q2DA 4KWVA 1TB3A 5G1YA 1D3GA 1T0OA 2ATMA 2QKFA 3W1RA 1W5OA 2XN1A 2YZRA 4Z1CA 1SPQA 1OFRA 4R53A 1IF2A 1PL9A 3N9RA 3O05A 5FF2A 1W5NA 2ZDRA 4UR7A 3W86A 3MYOA 1ZALA 1TPWA 5D2YA 1TPFA 5D33A 1I2QA 5HWJA 2J24A 4NNCA 2VC6A 4O15A 1P0KA 1YXCA 4AH7A 2ZZ5A 5AYZA 5DN1A 2J9XA 3W85A 4LVGA 3GYEA 2NXIA 3TE9A 3NDOA 3NZ1A 1OG0A 2IQTA 4BFAA 2A85A 3IIXA 4JIPA 5KZDA 4OGZA 3TDFA 5F2GA 5KSWA 1G7VA 4BR1A 3CEPA 3B03A 1AG1O 3W7GA 1XC4A 1W1ZA 2V0TA 1KA9F 5K9XA 5BMXA 3HG5A 3GB6A 1D3HA 3C2OA 1PCWA 1X1OA 3W9ZA 4LS1A 4TR9A 2QR6A 5SWUA 1YTEA 4WX2A 1TCDA 1OFEA 1SSGA 2AGKA 4J9JA 3KAOA 1H5YA 5TQLA 1OK4A 2VEPA 4FX6M 3W7NA 3EWZA 3HB9A 1RQEA 1Q3NA 1HTIA 1H7NA 1DBTA 2FTPA 3B05A 3LHUA 3EXSA 3G8RA 3KRUA 5TBOA 1W31A 1WBJA 1TQJA 2V2DA 2Q3OA 3UWZA 1V5XA 4BWLA 4RCXA 1N55A 1FWWA 5K9DA 4KFPA 2OMAA 4FNRA 4DO6A 1FCUA 4JD4A 2G97A 5HUOA 6ALDA 4O12A 4O8RA 3T55A 2WPBA 2KZHA 3W7HA 2WQPA 3OVPA 3W75A 1QO5A 3PF3A 1X8FA 5KTLA 4GUHA 3M47A 1VCGA 4JYFA 3FFSA 3THQA 5HR7A 1R2RA 3GZ3A 1SQ7A 3ATYA 3MP3A 3GXTA 3JRKA 4UFLA 3UNDA 1QPNA 3ABRA 3M16A 1A5BA 1VYRA 2C14A 2EGZA 2PCQA 1PHWA 3S1WA 3CLMA 5K9CA 1UUOA 3NAVA 3W7RA 4AEOA 3NNTA 1B3OA 2V8ZA 3STFA 2UV8G 3IGUA 3VCRA 3HF3A 4M7SA 3B0UX 3WJXA 1ML1A 3FIGA 3V1PA 4YWIA 1QAPA 3C3NA 3W7LA 3DU0A 4GE8A 2B0MA 1LLWA 3HIJA 4LWWA 2CLEA 3EKZA 3Q58A 1H7RA 4IPJA 1TPC1 1DL3A 3TFXA 4DBDA 3QJAA 1DOSA 1QPOA 3UWYA 4O52A 1JRBA 3KOFA 2XN0A 1SZEA 5G4EA 5DXYA 3ELFA 1KFLA 3TSMA 1OX4A 4N2YA 2E5CA 3I7QA 4FXSA 5F4XA 5IBXA 4JS3A 5AHIA 1G4PA 4MY1A 4Z0JA 4N9BA 1XFBA 1H7OA 2FB2A 1R2SA 1BEUA 2G5WA 3PSVA 1X1ZA 4R7JA 2QCFA 3PUDA 2QUUA 3DAQA 5CPNA 3R8RA 4DO5A 3Q94A 1F5ZA 1B9BA 2CLOA 3RF9A 2Y7FA 4PL2A 2VFIA 3KX6A 2CU0A 3P8JA 2Y6ZA 1VRDA 3PUOA 2FDSA 1OF6A 3WJSA 3EWXA 1S5WA 4WQ6A 4ML9A 4FB7A 2TSYA 1KBIA 1GJPA 1YLVA 3G1AA 4X22A 4O0ZA 4TO8A 2EHHA 4RV8A 1OFOA 4JY9A 3W1QA 2ZQ0A 1FDZA 3LHYA 3W83A 4YXGA 5LGXA 1MO0A 2A6LA 3P61A 3W7DA 4WJEA 1TPB1 5FEPA 5G2WA 1JVNA 3MHFA 2RDTA
chains in the Genus database with same CATH superfamily
1Q6FA 1ZBCA 5FEXA 3U57A 1YW1A 1Z3NA 1CGXA 2DQXA 3GH5A 4YL2A 2OCZA 1E70M 3TN6A 2DEPA 1VIZA 3NQGA 3WUBA 3NIYA 2E6DA 2P88A 1W3JA 3CU2A 4CN4A 3L9CA 2XSXA 1RQHA 2ISSA 1LZOA 1JZ2A 4UFHA 3TMLA 2BVWA 1AW1A 3LUTA 4JTEA 5D9PA 4QIUA 1LOLA 3TCSA 5EBUA 1UG6A 5G4WA 4DO4A 3F4NA 4YIWA 3UCQA 2WVVA 3QPYA 3DYOA 1XL9A 4A2SA 3HFTA 3C6CA 3DGBA 3KVLA 1O5RA 4YHGA 1B31A 3H53A 3PP7A 8XIMA 1EDQA 4M7TA 1E0TA 1HW6A 5BMWA 5DCDA 4JPGA 1K8YA 3GNPA 1U2YA 4IUOA 3KCJA 3O1NA 4UTTC 2E9LA 3LBCA 3TLQA 1GPFA 3IV3A 2R91A 5E09A 2CLIA 3ITOA 5JIPA 3W7OA 1RCQA 4IPPA 1ISZA 2ESCA 3U2ZA 4TIMA 4O54A 4OT7A 1OC7A 1UJQA 1ZS2A 1XSIA 4DJEC 3LHZA 3O0KA 1O5KA 2VC5A 5FCZA 3TROA 1E6NA 1ZAIA 3ITVA 1F73A 4HMEA 3VNDA 4BWLC 2JK2A 1K8CA 2A7RA 1TR1A 3QEZA 2WZIA 4C90A 4UZUA 1R87A 4Z2GA 2OGJA 2XVPA 1UZ4A 5CQ1A 1EPVA 4KCTA 2XGZA 4YYCA 3PAOA 2EEXA 5I00A 2YIHA 4CQ8A 3GUGA 3QFEA 3GC5A 3C3UA 2CCRA 4JGDA 3GNRA 3L66A 1R3TA 1C29A 3PNUA 3NQCA 4IM4A 3UT0A 1VENA 2E28A 3S8HA 1FFQA 1L8PA 1QW8A 1TJ2A 1M7PA 2E68A 5LIYX 3TYEA 4KCUA 3RU8X 1IT7A 4S3EA 1KRCC 2GOUA 4TX6A 1OYCA 2GVEA 3O7UA 4DELA 5LIKX 4A29A 2HISA 4MKVA 1MRQA 1RJQA 3W1UA 2W62A 4GNKB 4F0RA 4I90A 3N18A 2VQTA 3N2XA 1FHLA 1UR3M 4YTSA 3WEZA 3GIPA 2PDLA 3C52A 2WWDA 4JTLA 5E9AA 1M7XA 3GDMA 3VIMA 1EX1A 1GCYA 1UOKA 4ZR8A 3S5SA 4HNTA 3N3TA 1KCKA 5T26A 4E5TA 2DGAA 3I7RA 3H4GA 3ARPA 5D2WA 3AHZA 1H61A 3WLLA 4ZQCA 4XISA 3RM4A 1ISYA 3H2MA 3K1GA 1EP2A 3IAQA 3T4WA 4BEQA 4LVBA 3F4WA 3CHVA 4P8UA 4REQA 2GJXB 5MKGB 4ZQPA 1PHQA 4IOTA 1M7OA 1T41A 3DFQA 1M03A 3DI0A 3C86A 3UPWA 5JH2A 3BARA 4KWSA 5DELA 3BDKA 4N9DA 2QDGA 1F74A 3Q45A 3DFNA 3AU6A 4HOXA 4YWSA 5EA9A 1NOUA 1GYNA 5I3GA 2DU2A 1QT1A 3S9ZA 5AOUA 3V75A 3SURA 4R27A 1PV8A 4IGSA 1BF2A 3WF2A 4ACZB 3BC9A 4UC5A 1KRAC 4OQVA 4RZBA 5CAKA 3VCNA 3EOEA 2XFRA 3NQ6A 3BMWA 3N14A 1UWTA 5EL1A 1MZHA 1OFPA 4AEFA 5KITA 7REQB 1CBGA 5LIUX 3MHUA 2W5FA 3NZGA 4CD5A 3WJYA 1FDJA 2C0AA 3E0IA 4DAIA 1TPUA 4WXZA 5FAJA 1LL4A 4NIRA 2ASHA 5C7HA 3AMDA 3T40A 3SQLA 2DZWA 4IP5A 2AKZA 1I60A 4AD3A 2BXZA 2E0PA 1WKEA 4JTUA 4DM2A 1BG4A 3CQ0A 1P1XA 1WA3A 4V1YA 1J0JA 4E4UA 4Z2JA 3W0KA 2GQAA 1XLEA 3GDKA 1XBYA 4ADUA 3AU2A 3G1HA 3OHMB 1GG1A 4FNSA 1VS1A 4UTLA 4B5UA 1VQTA 8A3HA 4MSSA 5HNRA 1NARA 1F8MA 4E8DA 2Z28A 2OVLA 2UY4A 3ALFA 4NT0A 4UXDA 1TPEA 5CZJA 4HIBA 3MT1A 3MSGA 5FACA 4X2RA 3OBAA 3SUSA 4K1WA 1TWZA 3WQCA 3NQFA 3PUEA 3EKLA 5D05A 2BFGA 3H6OA 4MFEA 1W5PA 4QITA 2CHOA 3DHFA 3SCPA 5H8MA 3TN4A 3OYXA 1HKMA 3N1AA 4KWUA 1PX3A 3AS1A 3DG3A 5JU6A 4Q3MA 3AJ7A 1L2QA 4O11A 2V3DA 3BO9A 1EFZA 3P3BA 3ME3A 3G18A 4CD8A 3TP4A 3ZVHB 2I5GA 3HV9A 3UD6A 4C91A 4EAMA 1TREA 5EBAA 3VOFA 2VFGA 3NVTA 3P14A 5I3DA 1GVIA 3L5LA 2NV2A 2XIOA 3EAUA 4DBUA 3O06A 2DIJA 1KXQA 3QQWA 1FWCC 5TD4A 1IQ8A 4FNQA 1TVLA 4HZ6A 1O7AA 1SR0A 2QYGA 2CLLA 3MUIA 2YCIX 4QS5A 3WJWA 2XPKA 1E1EA 3G1XA 3OLIA 3W7MA 3A21A 5FKYA 1BYBA 1JGIA 3IK4A 4GY0A 3UP8A 5AN7A 3S2JA 2JGQA 1GHRA 2X42A 3GG7A 1SGJA 3SR7A 3G1FA 3KVMA 2H9AB 5HPCA 2J9ZA 1V03A 3FJ4A 2CLHA 1P0EA 3W53A 3M0MA 2VZVA 1IEWA 4H9MA 1KB3A 3WMLA 3E12A 5FJUA 2D73A 3AWNA 3QPZA 2PDGA 2QJIA 2VYOA 4I7VA 4AQLA 3WQGA 4O8AA 3STCA 4W7UA 5CGQA 4E38A 2PB1A 4MZYA 1HP4A 2E09A 4OZOA 7ODCA 2XIMA 4W7WA 5RUBA 1WZAA 1C8VA 2QUNA 4JHOA 5IDIA 3WO8A 4FX7A 1XISA 4L64A 4XX6A 5CJMA 4XD6A 2XVKA 4AWTA 3D5HA 3UYCA 1O94A 1NOFA 2TRSA 2WHJA 3RRAA 5HK4A 3INPA 3VIPA 3HG4A 3QR3A 2ACQA 1P48A 1YPIA 1YTDA 2G41A 3BAJA 1FWIC 3CAVA 4M5PA 3HFYA 4QP0A 2VCCA 1IR2A 4C6OA 2Y63A 4GY7A 3S42A 3TZFA 4M8UA 3UG3A 1HKJA 3GTNA 4JKMA 1BWKA 3PZ9A 2FQIA 4M82A 4FLOA 5AHLA 1RA0A 4AHPA 1VHNA 3W1LA 2PURA 9XIMA 2Q8LA 1RUSA 2VGGA 3T05A 2X1SA 5MKGA 4LRTA 1FWRA 5HINA 4Q4KA 3BW2A 3Q37A 2HBXA 2VRJA 3P62A 4LUTA 3HGRA 2NVDA 5BZAA 1XIGA 1MRAA 4C6PA 3GC4A 4FF5A 1XYCA 2F7FA 3B9DA 3BTNA 4QM1A 3V0SA 1QNOA 1QDSA 3I10A 1V51A 3HA1A 3NXFA 2CBVA 1HJXA 4H6QA 2NUYA 4J3SA 4Q8TA 3A5VA 3C5QA 2GGGA 3MI3A 3BG5A 3VNLA 1V6UA 1UWUA 1LLOA 2YCJA 3N2OA 3RJXA 1E6QM 4PCTA 1XPGA 2A3LA 2E6YA 2IPGA 4C7GA 1Q85A 3N2MA 2PP0A 4JEQA 4R33A 2CHRA 2QMKA 3ES8A 3O6CA 3AYTA 4PCSA 2VVNA 1XDLA 2FFIA 2YBTA 3K4DA 3GXNA 3TW9A 1SMAA 2HVOA 3VOGA 3WLSA 4ZGYA 2OU4A 1JQXA 1XD0A 1KTBA 1N8FA 5IOBA 1OD8A 4HN8A 4HZMA 5D2XA 2WWCA 4IQLA 3VIIA 2JKAA 2INZA 2F8QA 4OOZA 3H2EA 3STGA 1K4HA 3UETA 4IG2A 3FW6A 4LBRA 3HM7A 2POTA 4E2BA 2QDEA 3KDOA 3T0TA 2PRLA 3NL6A 4NAFA 3IJIA 1GEQA 4H9YA 4EK7A 4QCFA 2BVTA 3LV5A 3SGGA 1FWSA 4UTUA 2XIJA 3W22A 2XFFA 4GYKA 2Y7DA 2FTYA 4DY1A 5BOOA 3QTPA 1R9ZA 4HK7A 4WKAA 3MC5A 1D3CA 4OJYA 3W1MA 3RO8A 4GABA 1UQZA 3IVTA 5G4HC 3CV2A 5M17A 1JQVA 3EEGA 2ZVRA 3ARVA 3WK1A 4TMBA 5GPRA 3WYZA 4ZB2A 1BWVA 1S38A 1ITCA 3ZVIA 3F4DA 1OFDA 1VBHA 2HVMA 4NZ1A 3UGVA 1R30A 1V4YA 4PMJA 3SRFA 3SFWA 3QR0A 1V3HA 3K8MA 3TYZA 3RDKA 1EEPA 1T5AA 4K1GA 3QF0A 2PZNA 2WW5A 4MYAA 3CTTA 1MQRA 4OHQA 2ACRA 3FLUA 3NUKA 4M1BA 3HN3A 1G4TA 1UBSA 1EIXA 3AUJA 3W07A 4MZ1A 4XSMA 1KTCA 2C91A 2VM8A 3DH7A 5A6LA 2PE4A 3V18A 2PWVA 1YXYA 1J18A 3WG6A 1JPDX 3CHCA 4W86A 3GR8A 1N7KA 1JCNA 3N13A 2WHMA 3SCOA 3NO3A 4HNLA 2CBIA 4B3ZA 4W85A 1EF3A 1SO6A 4AVOA 4NNBA 3ARUA 3W1TA 5C9RA 2OSXA 2J7FA 1EHAA 5L6UA 2DSWA 1OT2A 1Z8AA 3WQPA 3W6LA 2PDQA 1Y5VA 5CAHA 4CNSA 1P4CA 5FJJA 5CC6A 5E5CA 3C2RA 3KE0A 5CSRA 2DT1A 1FWDC 4DF1A 4A2RA 4B2DD 4HJFA 5D9MA 2GJRA 3OBKA 3I6TA 3A6OA 4JTFA 1AVAA 1SU5A 3DBPA 1W3LA 2E25A 1MVYA 3WD0A 1K1DA 1RPXA 4E3VA 3NM3A 3IANA 4NNAA 4HNUA 2OWWA 3TR9A 3AYVA 4DPPA 1B5TA 1XYBA 4A21A 4WHBA 1AJ2A 3QOKA 3M0IA 1XIFA 3GKAA 4J2PA 2J7HA 2D1ZA 5FF0A 2Y89A 3R2GA 4K37A 4NXKA 3VIHA 4B91A 2YZ5A 3SY5A 2XFYA 4Z1BA 1J2WA 2QAFA 4MKNA 2P50A 4O18A 3W4RA 2FYMA 4W84A 2W61A 3UW6A 4MNMA 1WDPA 1EJVC 2QPSA 2WQDA 3WEMA 3CZ8A 4QLJA 4R7WA 1JCLA 3R43A 3W71A 1XGDA 4IWWA 5A5WA 2QCHA 1F9CA 4X2PA 3SCSA 2XTKA 1BXCA 2FZ9A 2JKPA 3R13A 3LQGA 1EC9A 4D6IA 1GPWA 3UR7A 2INEA 4HYVA 1TWIA 3MP4A 3ARQA 4BQ4A 1UWIA 3SN0A 4FXFA 1XX1A 4B5XA 1U1UA 5A94A 5HQMA 4HSHA 1G4EA 2NXHA 1Q6EA 4LSBA 2VTFA 4GGHA 3LOTA 1AJZA 4FOKA 4ILSA 4XUYA 1L0PA 1OM0A 3PVFA 2WLZA 2X40A 2ZXQA 3NQMA 5JBDA 3ARWA 1KM1A 1G94A 2IKIA 3RPMA 4ZA0A 3P2VA 3LCFA 4YPJA 2P1FA 3OO2A 3LSBA 5B7YA 1XIEA 1TV7A 3OU8A 5HJLA 1G9HA 4JFUA 4US5A 1Z9AA 2PEVA 3SJNA 5A6MA 3SRKA 1H1YA 3VCCA 1GOXA 5LA2A 4LV4A 1PS9A 4CGTA 1J0HA 1TO3A 1RY8A 1W3TA 1RCOB 3C61A 4GBUA 1FX6A 4ZOEA 2G3FA 4AWSA 3SM0A 5IHSA 4FOUA 3MI2A 2PI6A 1S3TC 2QCMA 4JYEA 1HJUA 4AMAA 2ZUWA 1QO2A 3AIWA 3WBAA 2EKCA 3V5FA 4NX0A 3TVAA 1E40A 1V0MA 3GW0A 2RGMA 4DXVA 5C54A 1UKTA 5TF0A 1S2CA 3PZNA 4X0VA 4XBKA 2OB3A 4I6KA 3F5LA 4Y96A 3TUUA 4J35A 5EMKA 3B0VC 3W29A 4N4PA 2J13A 4H04A 3UZXA 4LYRA 1MWOA 3OLGA 2VFFA 1KFBA 1KO0A 3MKCA 4Y7EA 2QUMA 4ICNA 4GWEA 2I7GA 3VMNA 3N3MA 4HT3A 4AMCA 5A2CA 3MDUA 4G1NA 2FB3A 3NSMA 3KBNA 4D1IA 5HXMA 4I7UA 1FHVA 4QRNA 1OK6A 1XP3A 2GVYA 5AC7A 3G3DA 1R9XA 2Q8ZA 1KWKA 2H6RA 2D24A 4BF7A 4HD5A 4UOJA 1T99A 3OA5A 4H7ZA 4P7OA 1OYAA 1SFSA 1EDTA 5FAGA 4LH8A 4GIRA 3WX7A 4QDPA 1QHOA 3LDVA 1YHTA 3R4IA 4HNVA 3MANA 1WAWA 2H9AA 1UHVA 1G1YA 3CV7A 3NQBA 2DZVA 3EOOA 2WMJA 2NXGA 2FGZA 2QCCA 5HWNA 1CTNA 1VH7A 2C1IA 4C6KA 2KAUC 4Q4QA 4DWSB 1B1YA 4TUFA 1P7TB 1DPMA 3AS0A 2WCAA 3LYEA 1MW3A 2X05A 3DKJA 3W23A 3GLCA 5CCZA 3N34A 3R1ZA 1CLXA 2X7VA 3PBYA 1H7WA 1E71M 2DZAA 2WZHA 3BOXA 4IL0A 1GVQA 1JPKA 2UWFA 3UZWA 3E0WA 1PIIA 3BAXA 3V3WA 4A3HA 1NSJA 2BGNE 4CN1A 1Q6LA 3DYMA 4CVWA 3FDGA 3AQUA 3H55A 5DMMA 1VJZA 3UZZA 2Z1XA 4PMYA 4XZWA 2J7BA 6A3HA 2GVJA 2GPTA 2VELA 3QM3A 3T42A 1OFBA 2EG7A 4PMDA 1QI5A 3SRDA 4GI4A 3AALA 3BE7A 3PTKA 2WNNA 3MCNA 2Q71A 1T8XA 1KV8A 3GXMA 1KM4A 4D8LA 3VDBA 1TX0A 3TC7A 4ICCX 1LORA 3EA2A 2QUTA 4C6EA 4EVZA 2WNQA 4E6MA 3WFAA 2PTDA 4ZQMA 4FR6A 1W37A 3BUVA 3QC0A 4PTDA 1VGAA 4OE7A 4DBEA 5DX7A 3RLGA 4TV6A 4HMNA 4RK8A 2O7QA 1K8ZA 3F7JA 4HYRA 4UQBA 1E0VA 4GC4A 3VE7A 4W8AA 4NVTA 3LTSA 2IMRA 3BSGA 3KWXA 3VKJA 2DZTA 3M0HA 2WHLA 3U0HA 4D6HA 4AZIA 5HNNA 3C2EA 5TAOA 1K70A 2X41A 1M68A 1TWSA 3IUDA 5I09A 2ZXAA 1U83A 3EXTA 1F3WA 3EB4A 2VWSA 3WLQA 5H1WA 3OGSA 3GFYA 3GDTA 3ANUA 2V63A 1ICQA 1F6PA 3QKZA 2NQHA 1PTAA 4HCDA 1EC8A 5FF4A 1KFJA 3CPRA 2FZMA 1G5AA 7TIMA 1BQGA 2P8BA 3BOFA 3HMCA 4RE0A 4JKLA 3WD3A 4HHPA 3V5OA 4WK9A 5GQBA 2QUVA 3MO7A 3B8IA 4GBDA 1YNQA 4XO6A 5I06A 3TC6A 2OT0A 1V6XA 1FP9A 3VO0A 2VR5A 3S5YA 4JXCA 1GW1A 4UNKA 8CGTA 2QJHA 5C9WA 1ZAHA 4UQEA 4PR4A 4ZBCA 3W1PA 1QOPA 2ZA3A 3PZQA 1LQ0A 5CEWA 1ZHAA 2QMJA 1XICA 1YADA 4TOQA 4JDYA 2QAPA 3SCWA 2D0HA 3CL6A 2OOFA 5GVJA 4LAUA 3I3BA 3RLHA 4QTGA 1KKOA 1YPXA 4H8HA 3SUUA 2TYSA 1EWDA 3BLKA 1R38A 2VO5A 1WZKA 2NT1A 1YDYA 2QCGA 2W3ZA 3BCFA 3CUGA 3VNMA 3N4FA 5HBFA 1QWKA 2BGSA 2W4XA 3VGEA 4ZQOA 5AVNA 2PDYA 4I3GA 2DZXA 3OJGA 2X0YA 4QISA 1FTXA 1O5XA 4M56A 3QN3A 3L65A 2QV5A 1BAGA 5DRIA 4S2CA 4XAFA 4WJ8A 2RFGA 3QMSA 3QV9A 3TJ4A 5FL0A 3KRZA 5HDRA 1JDDA 1EJRC 3W3OA 1WUFA 2HK0A 2BHZA 1GZJA 2I14A 3R6IA 4GIEA 3EPOA 4IIGA 4E4FA 3SIZA 3HV8A 1EYWA 2YXXA 4QJ5B 4G5DA 2YL8A 3NZRA 3WBXA 1KM5A 1RY0A 2CLPA 3FJ6A 2C8NA 5F4SA 2XINA 4IPNB 4ZVJA 4MUPA 3MPGA 4NJHA 1XKJA 2E67A 3HG3A 3BLLA 1F2JA 4QBXA 3LQLA 2OSWA 1R2TA 1WCGA 1VAHA 4UNIA 2FGBA 1EOMA 5CPQA 4DUVA 5FF7A 3VUSA 5J04A 2JGYA 2V5BA 4QG6A 1V3LA 1VFSA 2P0OA 1QMLA 4LUIA 2OX1A 3U5YA 1ZJBA 4JTCA 5G1YA 1T0OA 3VGFA 1EXPA 4GH1A 2CBJA 3S6TA 4DIAA 1E1CB 2Y2WA 2J7CA 3PZIA 4CD7A 5AC4A 1IF2A 3COTA 4UR7A 1TPWA 3AYRA 1I2QA 5M1TA 2Y8UA 4GO9A 4H6RA 2OKOA 5HWJA 3H22A 1P0KA 5AYZA 3U4FA 2J9XA 4J2MA 4LVGA 3GYEA 2NXIA 3NDOA 4NI8A 1UWRA 3LSCA 4BFAA 3IIXA 4JIPA 3VX1A 3MSDA 1FA2A 1KQYA 4BR1A 3CEPA 3SEPA 1BXNA 1HZYA 3MDWA 2GJXA 3PZOA 2HPMA 5BMXA 3KOYA 4P7LA 1PCWA 1X1OA 3W9ZA 4LS1A 4WX2A 1UD5A 2PCEA 4IFKA 2YB4A 2J4GA 3A9BA 2AGKA 2P0IA 3ZJKA 1A0CA 3KAOA 1KXVA 1H5YA 2PDBA 3AIRA 5TQLA 4FX6M 1IHIA 1H7NA 2FZNA 3ABZA 2FTPA 2WJFA 2WLYA 3B05A 4NZ5A 3LHUA 3VAVA 1XINA 5TBOA 3DG7A 3E3HA 3MVTA 3UWZA 1V5XA 3V36A 4INFA 2VX4A 1HVQA 1UYQA 4D6EA 4XZIA 4GLEA 4B5VA 4DO6A 1JYXA 5HUOA 3TONA 4O8RA 2EPMX 1N82A 3FHQA 4JL1A 2Q6ZA 4JTQA 2OZ3A 3W7HA 4KRZA 1RP8A 2WQPA 3OVPA 2P53A 4EXQA 1GK8A 5KTLA 4JTRA 1VCGA 3CMJA 4J7RA 1OB0A 5HR7A 3GXTA 4J4KA 2OQHA 4A4AA 2HXUA 1UH2A 3WNNA 1H11A 1OEPA 3EPMA 1W6TA 3U5UA 3PPHA 1XLFA 1JIBA 3CQJA 3SUTA 1UUOA 3BICA 4EWJA 3ITLA 4FOJA 3NAVA 1O6IA 4BZYA 3NNTA 2V8ZA 2DH3A 1JAEA 3R94A 2PDHA 3IGUA 4PN2A 3HF3A 3VCRA 4EPDC 1V6YA 4Z42C 1ML1A 4YWIA 4G7EA 2DSVA 1M3UA 3W7LA 3DU0A 2B0MA 3JZEA 7TAAA 2AL2A 4QE4A 2GLKA 1H41A 1TPC1 4Q22A 3TFXA 3TYBA 1VPYA 2JFEX 2FMOA 3ELFA 2OLHA 3QHOA 3SUVA 3I7QA 4MB4A 3F2DA 4ASTA 1NU5A 2PDKA 5AHIA 4Z0JA 3POHA 2ZUNA 2HWGA 4DZHA 5GJNA 3MSYA 4NYYA 2G5WA 1ISXA 1Q4NX 4IF2A 1F6YA 3PUDA 5CPNA 3WD4A 5HMFA 4NHVA 4W8LA 3RR4A 3KZPA 2Y6ZA 1VRDA 1M1BA 1BVNP 4WQ6A 4FB7A 2I5IA 1YLVA 4X22A 4ZE5A 4GZEA 2ZQ0A 1UA7A 3WLKX 1PIGA 2OLSA 4YXGA 4OUIA 4OBSA 4IIHA 3AHYA 4QE5A 5FEPA 2IPJA 3KBWA 1X98A 3BOLA 3I3DA 1OY0A 3YPIA 2A5HA 4WXYA 2A3EA 2PGRA 3W00A 3RX2A 3WDIA 4QEEA 4YLWA 4U33A 1VCVA 3G1RA 4S38A 2NLYA 3CTLA 2BY0A 3TLLA 1W3NA 3TW7A 4P8VA 3NWRA 5A95A 3T44A 4PB5A 2V2HA 1VJIA 4EF8A 1UB3A 3KS6A 3IWPA 4GQRA 4J40A 3CUFA 3VNIA 4K8HA 1ZLPA 1FCQA 5CG7A 1DE5A 4DBWA 3TJXA 3BANA 3TNOA 2ZX5A 3UCCA 3S1GA 2QLYA 2D0GA 3J7HA 3MY9A 2A21A 3S1VA 5IFTA 2J8FA 3NJ3A 1J0YA 1NH6A 4G56A 1OX5A 3UXKA 1E0UA 2HCVA 4O50A 1EJSC 1W9VA 1K3UA 3GXFA 5JBFA 3WNOA 3UPBA 3SIMA 4AD0A 3E74A 4EOUA 4ALDA 1I45A 1LBMA 1HUVA 4WY0F 3UCDA 4KCWA 1W9UA 2BWGA 4IL2A 5AECA 1MQQA 1W1A1 4MUZA 1GEHA 4XZHA 1O1HA 3PBMA 1QWGA 5TNVA 3WQ6A 3A9IA 2ISDA 2E1DA 2HJPA 3HPSA 5AC8A 1P0DA 1HN1A 1GQKA 4EPEC 1FP8A 1KD0A 3PC0A 3VILA 3R12A 4A22A 4UTWA 3G6LA 3BJSA 2RDWA 4JFWA 1TSIA 5IHRA 4PCFA 4AY7A 2ODOA 1TJRA 1FHDA 1B2YA 1KXHA 1DIOA 3NZQA 2VVSA 1KFCA 4MGGA 4CVUA 2A6NA 4DAFA 1AMKA 4XKMA 2CERA 3WQFA 4A6GA 1E6XM 3KVJA 3MUZ1 3CPUA 4IIEA 2YSWA 4UFIA 4YHEA 2E7FA 1V02A 5DF0A 3M7SA 4GC3A 1OGSA 2HNHA 2JALA 3OW1A 1H5VA 4OTKA 5AC6A 1E6SM 4DZAA 3TA9A 2QJMA 4JQ3A 6REQA 1LUCB 3BV7A 1CGYA 1HGYA 2UY2A 1A5KC 3TC3A 2ZC1A 1FWFC 1M01A 1XXXA 1ZB5A 2CNCA 1XGZA 1VBRA 4JHMA 1VBUA 3TW6A 2QJJA 1DVJA 2PF0A 2GGHA 4XD5A 3QZEA 3GKFA 1LWJA 3UVAA 1UD6A 3TYAA 3W76A 3NXLA 3WJZA 1LDCA 1M53A 3D47A 5A8GA 3UBPC 1W56A 5LA1A 3N25A 3TYDA 3TTSA 4GUGA 3U7BA 4JTKA 3HMJG 4B92A 6XIMA 4RPPA 2AKMA 4X3ZA 1UKQA 4E2VA 3FXGA 3G1VA 3CEUA 3U3HA 7REQA 3S5NA 4TVCA 3AIUA 4K3ZA 5CSSA 2C7FA 2B81A 2RJGA 3LN3A 3OGRA 3AJXA 3LTPA 1C9DA 2DH2A 2WKGA 3HURA 4JIIX 4PMXA 2Y24A 1ISWA 3G0SA 1XG4A 2I5QA 2C71A 4HA4A 1MZRA 2IPFA 1G4SA 2QCDB 4IG2B 5D09A 1W0MA 3AAMA 3T2OA 1CIUA 2CC0A 3GNDA 3VFLA 3C4UA 1HFBA 1UZHA 5BXSA 4Q7BA 1DQXA 1EO7A 4RV3A 4HTYA 4O13A 1UZ1A 2H90A 2QZRA 4HJWA 3K8LA 3W7KA 3MMUA 3B40A 2PC4A 3EMCA 4YNGA 2VFEA 4DN1A 5I3IA 5HMDA 4D2JA 3WBWA 4PODA 2ZRWA 2FPTA 1B3VA 1PZ3A 4UTKA 2QNEA 3LLDA 1MNSA 5JQ9A 3MMDA 3ZOAA 2XUCA 3C8NA 2PUZA 4XV0A 5D8ZA 3AZSA 4EF9A 3PZUA 3MBFA 1IIGA 3LCXA 2PA6A 3FV9A 3W37A 1UPMB 5REQA 3SSZA 2R94A 1I2PA 3MUXA 4NZ4A 4IICA 2ZWYA 3L7RA 3MSRA 3NFUA 3TXVA 1J93A 1B3ZA 3CHFA 1Q65A 1AQMA 3RRXA 5E6ZA 3UZJA 3WDQA 1UKOA 4QQ3A 2VEMA 2YA1A 4UQAA 4NF7A 3G22A 3H8AA 1F76A 1QBAA 3CT7A 3VMOA 3LCGA 3PBVA 5DANA 2Q8XA 2RAGA 3B9OA 3ITCA 1RPKA 3SY8A 3VIOA 1E5NA 1LROA 1WOBA 3WDRA 3CAWA 4KCVA 5AHNA 2J9YA 1KWGA 1B57A 4PBFA 4IIDA 4R88A 1NDZA 4J1OA 2QXWA 1Y7VA 1BVWA 2O9PA 2PTWA 4CNOA 4MPQA 1FWGC 2GL5A 4GI6A 2CLKA 3S3GA 5AY7A 3SCRA 3S2CA 5A69A 4M3PA 2W0UA 3M64A 1UR4A 4IIBA 1ZNNA 1BWLA 3OG3A 3TWAA 4RNFA 3LXCA 3TX9A 4BJHA 1UIOA 2VCAA 3UXAA 3HPFA 2G3IA 4HZ8A 4GA8A 2R9RA 3AROA 4ROQA 4PMOA 1NFGA 5HJXA 3ZWTA 1L6WA 1SYTA 4AW7A 2OX4A 1TZ9A 3P67A 3UJ2A 1A0EA 5BYWA 4UTIA 1XJBA 2BY1A 1WBHA 4J28A 5LNSA 4DJFD 4UFKA 1JL8A 4LALA 4PUNA 3W1AA 3MZ2A 3RFAA 1VFFA 3AXIA 4PCNA 4R85A 3LPFA 1W5QA 2CWNA 1S5TA 4Q8NA 3C0JA 3CWHA 3FVDA 4GH3A 2HRWA 3BXWA 4ORIA 3CWNA 2G3NA 3AXXA 4U3AA 5HQLA 2ZUMA 1SUXA 4MJZA 1F3TA 1DXIA 2DVUA 1DWFM 1E1CA 3GTXA 1KM0A 4IGNA 2CKSA 1WE5A 4NZFA 4GNVA 3W2NA 1S2VA 3RK8A 2OFJA 5T91A 1IXQA 2G3MA 2J6XA 3VOJA 4U5IA 2C3ZA 3L68A 1GQNA 4B5WA 3GU9A 2ZA2A 1TZ7A 3B8TA 1GVSA 1W2VA 1M41A 3WLNA 4PH6A 1M04A 1SZFA 3DHDA 1IGWA 4PMUA 1JULA 2A4AA 1LF1A 3G77A 1VR6A 4G1KA 4JTGA 3GH4A 3V0TA 3ATZA 1J6PA 3MA8A 4DXKA 2YX0A 5G1MA 4AWUA 2V68A 3OQ8A 4FLQA 4A35A 3WK0A 3P0XA 4WUIA 2BOGX 3EWYA 1HKVA 3PPGA 3FYOA 1NWTA 2FJUB 1EJ7L 2R1MA 4TQTA 2V38A 3RJYA 3ZT7A 4IPIA 3AC0A 5D30A 1W17A 3GG1A 1NF0A 4O0KA 4UTWC 1A4LA 1ZBVA 2J6VA 2GZXA 2O7SA 1E0WA 1QATA 1THFD 3WLJA 1HQTA 2GK1B 2J7DA 3NPXA 1DJXA 3BK0A 1BSIA 3LB0A 1MEIA 1ME8A 1CYGA 5ABTA 4JTIA 4GCXA 3AHTA 1KLYA 1PE1A 1QNRA 4OECA 4MF4A 1EGVA 1GUVA 2QF7A 1SJDA 4DJEA 5CBJA 3RGTA 5EY5A 2D2OA 3MKKA 3RCYA 2PRMA 3CWOX 1K6WA 2Z27A 2AL2B 1HJVA 1ZSXA 3WMBA 1PO9A 3VM5A 4ATWA 4MFDA 4HHHA 2QF8A 4IXHA 3QV8A 1LBLA 2BV9A 2DPEA 4J3UA 1WDDA 1PJ9A 1Q8AA 3TN5A 2X1UA 4ES4A 1ALDA 2ABAA 5EPDA 2Y1HA 3ZT5A 1ECQA 4X60A 3WUFA 1Q6OA 1Q6GA 2TPSA 2V30A 3NYZA 4NP7A 2QCLA 3H2FA 1AZ1A 3CJPA 4CEXC 3W27A 4AYGA 1NJJA 1UROA 1EKOA 3LXAA 4W7VA 2QHAA 2AAMA 4XBSA 4L9YA 2Y7EA 3FEMA 1TR9A 4IX0A 5I3KA 1UIPA 1H63A 2X8RA 4ZE4A 3SN1A 5D4YA 3GXIA 3LXBA 3BCDA 3IGSA 4FALA 4H9ZA 1OHLA 3QGVA 1JDCA 4G6CA 1F3EA 3S0CA 2VHLA 5E0KA 2EPLX 3GG8A 3S2NA 2H8XA 4ZZ9A 2DZBA 1QPRA 1D7KA 3DC0A 4HOWA 3TTYA 1X6NA 2I1OA 4GINA 3URNA 5C9UA 3EDFA 4N9CA 1Q6CA 3HQ1A 4W5ZA 4P61A 4AXKA 3KCLA 4N02A 1YNPA 3OLDA 2YA0A 3B8UA 3RX3A 4NJIA 3WQEA 1WZLA 1NDYA 1S5NA 4MYXA 1K02A 4XKYB 2ZOXA 4UTMA 4DLMA 2Z25A 2I17A 3KM8A 1J0KA 4R34A 5EU9A 1QW7A 1HJQA 1I4NA 4EACA 1J0IA 4E0CA 3L0GA 2HMCA 4D6FA 2V9DA 4HU0A 2W79A 4FA3A 2XVLA 3W7EA 4GUFA 4XQ6A 3GDLA 4HP5A 2EJAA 1AMYA 2YBVA 4GIAA 1PZ0A 4OU1A 3UFYA 1S1RA 1S3HA 3CNYA 3NL3A 4M6VA 4PUEA 1V6WA 4O19A 2OG9A 4XUGA 2A2IA 1UUMA 4RNIA 4OKDA 2FGLA 4JBRA 1Z41A 3VNZA 3A4JA 5JH1A 1RV8A 3AISA 2GQ3A 1UCWA 3GXPA 3E1F1 4X0NA 4H9UA 3TU9A 3CIXA 4GXWA 1Q45A 1VBGA 2OELA 4HNOA 1XLDA 1JDFA 4IJBA 1YBQB 3UG8A 2ZA1A 4E3TA 1W3IA 4ORMA 1CLVA 4GHRA 3LU2A 1WQ5A 3AHVA 1Y0EA 2CESA 3M5ZA 4C7DA 3RO6A 3VNYA 3EOUA 2FMNA 4IISA 3IPWA 1XKYA 4AD1A 4BF5A 4IQDA 4EE9A 3VMPA 2J74A 5CZSA 1MEHA 1Q7MA 8XIAA 3UJEA 4KFNA 3G6MA 2ZIDA 4HZ7A 4F79A 3K5XA 3FA4A 3BLFA 1WDQA 1EUAA 3WH6A 1ITUA 5FI8A 2EKGA 1XCFA 1G6CA 2C1HA 1L6FA 4AWEA 3IVUA 4TU1A 2C0HA 4RW3A 1MSSA 2ZRUA 1XCWA 3VDAA 5C2CA 3TOYA 1O95A 1JDEA 4K2SA 3TSBA 1K6AA 1JCTA 4YVPA 4DJDC 4Z0SA 1OWQA 1R7AA 4CQBA 3WQ4A 3E2VA 3GNNA 1ZBWA 3GQYA 3LBMA 1PX8A 2ISWA 1OIFA 3K4WA 3UYIA 2V5LA 3KL3A 4JNYA 1VD6A 1SO4A 5DT5A 1AL7A 4DYKA 5KETA 4QSHA 1KGWA 4WLCA 1KBBA 3CZLA 4JTSA 3SFKA 1J10A 3LEPA 4PUMA 3PZMA 2AMXA 1XLJA 5TIMA 2NUXA 3CH9A 1JD9A 2YLAA 4O10A 5DRCA 2DORA 1MW1A 3KS5A 1FXQA 1LOSA 4LBUA 1LG1A 3EWWA 1B90A 3R5EA 3L2MA 3B4YA 1JCJA 1XRTA 1XLGA 3BG9A 1MW2A 1XRVA 3TV8A 4CCZA 1LBFA 2FZDA 4MB3A 1Y5XA 1VFLA 1YNYA 2BASA 5DCBA 4CNUA 1ZCOA 3L5AA 2X2GA 4IGHA 2FHFA 1KR1A 1AUSL 4L5ZA 4IJRA 1DJQA 1SZGA 4NSBA 3E0LA 2OQLA 3GFZA 3DFOA 1ADOA 2YLLA 3AFBA 1GQIA 4I9TA 5I03A 3M43A 2G8ZA 3GM8A 4ZQRA 4Z08A 3CUHA 4UCGA 1C90A 1V08A 4WGHA 1F07A 3MQTA 1MUWA 1CDGA 2TAAA 1TWWA 4GX9A 1XCXA 4Y9PA 1JNDA 2VUYA 4XKYA 3FS2A 1DWHM 4J3XA 1V8EA 1GHSA 1EX5A 1GVRA 4EAYA 5BRBA 2ABBA 4MY9A 3FGCA 1L2UA 1LUCA 1KW1A 2J78A 2WC7A 1ZAJA 2PS2A 1SW7A 1SZRA 1EQCA 5CXPA 1QPKA 4PSPA 1WP6A 3KBSA 3N4EA 5ABFA 1YPFA 1UW9A 1GW9A 1OYBA 3N15A 3VGDA 4E4PA 3BJFA 3ECQA 4RLIA 4OVXA 2YXOA 4GGBA 3T0BA 1JYWA 1W5MA 3VD7A 3PR2A 1GTHA 2VQUA 4JL2A 3CQHA 4O0QA 4AZ6A 2WVTA 5KZEA 1ZU8A 3N9SA 1XYAA 1F7BA 3VIGA 3MHGA 1Q63A 1GOKA 4PRWA 4B5TA 2HS8A 5FEZA 4MB1A 1UR8A 3WLTA 1IR1A 1XLKA 4IIFA 4ZSTA 3B97A 3S1XA 2WZEA 3M0KA 5DLCA 3A22A 4KEMA 1POJA 1IV8A 2HVNA 1GONA 3N6QA 4JY8A 2ZZ4A 1FWBC 3WH9A 3NYDA 1KFKA 4H8UA 4X61A 2XSBA 1ONWA 4PUJA 3EOSA 4W9TA 3CL8A 3VU2A 1H3GA 2Y5EA 3W24A 5HJYA 3DDMA 5KINA 1LL7A 3UF9A 1FUYA 2DY3A 1U1JA 2QDHA 1S2TA 1J9YA 3IIZA 2G50A 1D7FA 3TA6A 1DKWA 1QK0A 4QG9A 3PTDA 2CIPA 2CYGA 4D71A 1GKQA 3PBUA 3B0YA 1W1TA 4LQ1A 4HVXA 1XG3A 4ECLA 1TJ0A 3WH7A 4GVGA 2R1LA 2W27A 3NDZA 1SFJA 5FSEC 4AC7C 1OCQA 2NWSA 4KGLA 2PDCA 4A3UA 1KGXA 2ZRZA 5AYXA 4GG9A 3W74A 1IIHA 1DWGM 3GY1A 2A1YA 4WOQA 4XZ9A 1Q5MA 5CBBA 2BTMA 3IJDA 3PZGA 1Z89A 3U2OA 3RILA 4LUJA 4H1ZA 5AKQA 1H62A 1YKWA 4AC1X 1VLIA 4U10A 4XZNX 1FWNA 3GTFA 2F84A 3W7JA 3EA1A 3BURA 4LB3A 3KXQA 2OJPA 3T07A 1I9CB 3DHUA 3TYCA 1IGSA 2Z6JA 3DERA 1HG3A 2EPNA 4B4HA 1N8IA 5E1QA 4DM1A 4J3ZA 2IQ0A 2VP8A 4WGXA 1VEPA 2BODX 3SW6A 4N6EA 1KCZA 5IDZA 2UY3A 3KP1A 3UY7A 1EQPA 1QI3A 5A6SA 1GVOA 2WB5A 4AAJA 4F0LA 2XIIA 1ECEA 3TR2A 4DX3A 2SFPA 4S23A 4U4MA 4I8YA 3M5YA 4WVXA 3HPZA 2PWEA 2X16A 4QFUA 3SRHA 3I6RA 4FX8A 1WDSA 4LPCA 2PFHA 1A50A 4LU0A 3O6DA 3W81A 1QHZA 4LV9A 3LERA 5LGZA 1WXYA 4Q32A 3OB8A 4JQAA 2G0WA 1DJGA 3UJSA 5FL1A 1PB0A 1LG2A 4DJDA 4WDXA 1F4AA 4KPLA 2GGJA 3TTQA 1TA3B 3M4HA 3A3HA 3LRKA 1XBZA 3ITTA 4FF7A 2Q02A 4N6FA 3PTMA 4DPQA 4MDPA 3TCEA 2DT3A 3CAQA 3HPAA 3H4XA 4W89A 4UOQA 1Q7QA 2ZX7A 4G9PA 1RXOB 2IQDA 3NSNA 3MVIA 3P5ZA 2R8WA 1QHPA 1TTQA 4JQ1A 2DJLA 4GK8A 1ZCCA 3NO5A 4LFYA 1V6VA 3VVGA 2IKHA 3BAYA 3OVQA 3JU2A 3AO0A 3ZJ8A 5HULA 2B7PA 2GGEA 3DEQA 4Q4MA 3VKAA 1LTDA 1O5QA 3W01A 4JNZA 4NL1A 4URIA 4L61A 4KESA 4I5RA 4ZOBA 2FIQA 2WCSA 3IUHA 4AIOA 2J8TA 2AQWA 1K9FA 3ZT6A 6TIMA 4U2ZA 4C6NA 1XFCA 2O0TA 3SQSA 1XYMA 3G8EA 2ZXBA 3TIMA 2PWGA 4HMCA 3GXDA 1TPH1 4OBTA 2C15A 2W6RA 1HT6A 4FK9A 2J7EA 2BZNA 3O15A 3KOZA 3GSMA 3I6EA 3ARYA 1JI2A 3M0LA 4CD6A 1W2PA 2BX7A 4MB5A 3NQAA 4NQ1A 2VRQA 1OFAA 4DRSA 1XRSA 2H3DA 2D20A 4FNTA 5LA0A 2KX9A 3N12A 4Y90A 1JXJA 3DKLA 4Q7NA 3TN3A 3UJRA 2XYLA 1UOZA 3SJ3A 1JXKA 5JVLA 1JR1A 4H19A 2XZ7A 4ZODA 1XIJA 3JS3A 2R24A 3N73A 4PMQA 5EFFA 1UWQA 1B9ZA 3AMGA 1VPXA 1G67A 2O4MA 1EGMA 2C1GA 4YVXA 1EJWC 1IZCA 1H60A 3WK3A 4AY8A 4LAOA 3BG3A 1TUFA 3VIJA 1UKPA 5BRQA 2NQJA 5FJTA 3TTOA 3GW3A 4UMAA 4CNPA 5CLWA 3L5MA 4UQ9A 3PAJA 1JNEA 3WL0A 3LNPA 3W2JA 4E8GA 4ZB5A 2GUYA 3LA4A 2CWXA 4KETA 4PFMA 5EMMA 3LTYA 5D9OA 2QDDA 5E0CA 3ZFHA 4Y8FA 1FH7A 1P0BA 3GWQA 2PODA 5BU6A 3LI0A 1RK6A 1DJZA 1DYSA 1GVFA 2E77A 4I5UA 2WMIA 1U22A 2V5DA 1TV2A 4KWVA 2QIWA 1D3GA 1L6GA 1RD6A 2NQ5A 3ARRA 4Z1CA 1OFRA 4LEFA 1PL9A 5FF2A 2ZDRA 3W86A 1ZALA 2F2HA 4W93A 4GQ0A 4AZCB 4I9JA 1YXCA 4AH7A 1BF6A 2ZZ5A 3KTSA 4WCJA 1OG0A 4Z2IA 2A85A 4A8LA 1OD0A 3WQ8A 2GDQA 1VFMA 4CKQA 5K9XA 1W1ZA 1KA9F 3GB6A 1OADA 2Y0FA 4W4QA 1D3HA 2OZ8A 3VNKA 2J75A 2WSPA 5FD0A 3OVGA 5FJIA 4TR9A 5SWUA 1YTEA 1UUQA 4KF1A 1TCDA 1HX0A 1Q6DA 3CLWA 4QXIA 3EDJA 5BOFA 2VEPA 4M0XA 5HA7A 2E9BA 1DIKA 3HB9A 1Q3NA 4GZIA 3T0AA 1PWMA 1E15A 3KL5A 4GQBA 4ACYA 3LENA 1W31A 4PUWA 2V2DA 1JAKA 4PYSA 4GIYA 3HQNA 2OEJA 1FKWA 3OGVA 4CN6A 3XINA 4PEEA 2OMAA 2QVNA 4FNRA 2BDQA 4JD4A 1XC6A 4QQUA 3E38A 1CZ1A 4G7FA 1PKNA 2KZHA 4EXAA 2PC8A 5LXXA 1J01A 4ZCWA 3H7RA 3M47A 1F61A 2BS9A 1PKLA 3R0UA 1FVPA 3GZAA 1R2RA 1SQ7A 3MP3A 3JRKA 2NVAA 3DIPA 5GNXA 1GKPA 1W9PA 3ABRA 3FK4A 2F9RA 1A5BA 1S2WA 1VYRA 2C14A 2XG9A 1J6OA 3CUZA 1YX1A 2EGZA 2PCQA 4IFOA 4D72A 4OIFA 3CLMA 1LWHA 2PTXA 4Z17A 1B3OA 2UV8G 3LY0A 4M7SA 1QI2A 4J3TA 3I3EA 1XYZA 5LYRA 2X7WA 4RUBA 4A3YA 3FIGA 5I5RA 3V1PA 2I57A 3GHTA 2DUXA 2PGWA 4GE8A 1LLWA 2CLEA 1RBLA 3Q58A 1H7RA 1D8CA 1PBGA 4IPJA 1DL3A 3LPGA 3QJAA 3UWYA 1QPOA 1JZ5A 5M03A 3KOFA 2VGFA 5HOSA 2A3CA 1SZEA 4JTDA 5DMNA 2QVHA 1KFLA 2B31A 1R85A 4N2YA 5A6BD 4XO7A 3CQIA 2OWCA 4N9BA 3VC5A 3OIHA 4GQQA 1H7OA 2FB2A 1W9BM 4HMDA 1BHGA 1VP5A 1R2SA 3MUY1 4XAGA 3PSVA 4P5UA 3MZNA 3ZSTA 2QCFA 2QUUA 3R8RA 2BG5A 3Q94A 4PTMA 1F5ZA 1C7SA 4YU1A 3RF9A 4AZCA 2Y7FA 3K1DA 4GMEA 1K77A 5REQB 3DFYA 1LT7A 1OF6A 1S5WA 1R3VA 1FWAC 1KBIA 4CU6A 3MV01 4L56A 4B9ZA 2V3FA 3W1QA 3MUCA 3VKDA 4I8DA 1XD1A 2A6LA 4ZOAA 4FS9A 3CB3A 5BXPA 3CYVA 5G2WA 1CXEA 3R79A 1JVNA 4IP7A 1UP0A 4C6IA 3PWIA 1ME7A 4M19A 1K7EA 4HA3A 1BQCA 5I77A 1DJHA 3FJNA 4F8XA 3NL5A 3CYJA 4H8NA 5A6KA 2DZSA 9XIAA 1JF5A 5LXEA 2I9EA 3GU2A 4K39A 4KBXA 4C6FA 4IGMA 4ZB0A 4WIWA 4DUOA 4Q8WA 3CASA 4KIEA 4D9PA 1C92A 4F2BA 2XVNA 1D9EA 4H01A 2E5DA 1C8QA 3W7CA 4MM1A 3S2MA 1H09A 1AFSA 1U30A 2PRHA 3T8LA 2ACSA 2J27A 2IKGA 3I65A 5FOOA 4YVVA 2VR4A 5IRPA 2VZOA 4XZLX 3O8AA 3MW7A 4F2UA 2D2HA 4NU7A 1REQA 3PPFA 4V1XA 4LANA 1UR9A 4ZENA 5GNYA 4YTTA 2IXUA 5L9FA 2A3AA 4POCA 2I56A 3JW7A 2FZBA 2C18A 2JE8A 4L80A 5BROA 4ZTXA 3NQ2A 2YL9A 1Y8BA 4X63A 2FVMA 3IRSA 4LY8A 4ML4A 2GUUA 4PRTA 2F6KA 3VD3A 4QAIA 2D69A 1XLLA 2D22A 4MLJA 4MHBA 1ZJAA 1DXFA 4MADA 3KLKA 2WMGA 3FY1A 2A79A 3QKEA 4Q4SA 1CX9A 4RDZA 5LHFA 3R89A 3SY1A 1M6JA 2OO0A 4CCCA 5PTDA 1OJXA 2V5KA 4DBSA 1NFPA 1ZFJA 4CNNA 4TX9A 2R14A 1W32A 4O1AA 2NZLA 3C0QA 3L4TA 2PLKA 3ID7A 4DUWA 3T9PA 4Z2HA 4JFTA 4WDTA 1UC4A 3DFPA 2WV8A 1VCFA 5KMYA 1CWYA 1GQLA 2WANA 3T2QA 1J12A 3SGZA 3PY2A 3D3AA 4S2BA 3DECA 1XH0A 2IPWA 4QNWA 4H4IA 1X7IA 3VKKA 2VEGA 4FP1A 5DFAA 4LUYA 1KBJA 3CUXA 3T78A 1ESWA 2XJ7A 4IXXA 4QNEA 4JDBA 3LHWA 2FFCA 3GVQA 4IQEA 4GJ1A 1QI0A 3G1YA 3GR4A 2RH9A 3MBDA 1F3XA 1HXJA 2O92A 3E2SA 1H51A 3CS2A 3MB9A 3NURA 5MHBA 3WLPA 4F0SA 1VEMA 5LHEA 3EMQA 3N19B 5BU9A 5D02A 1GZGA 5AZ1A 2WHKA 2OWXA 3FA5A 2X1RA 4YCPA 5I78A 3T7VA 3CM4A 1P6WA 4O1BA 4RZ6A 2DSKA 2GJLA 2PBOA 1O1ZA 3P80A 3DN5A 1HF6A 2QJNA 1H7XA 5EKYA 5C9ZA 4AYSA 2PMQA 1N2VA 1H7PA 1KBLA 8TIMA 2WVUA 3FAXA 1Z48A 3PSWA 1WKFA 1XV8A 2OGYA 4FAMA 1IEIA 3H23A 2WC3A 3KBJA 4ATLA 1EC7A 2MNRA 4PUDA 4MWAD 1PAMA 3VZXA 3OG2A 1P6CA 1S5VA 1ZTVA 4MNJA 1TRDA 5B7ZA 1H0IA 4JX6A 3UERA 3BPWA 4GYPC 2B7NA 4DYJA 4DLFA 3KTCA 1WB0A 4MY8A 1F05A 7ENLA 4QSFA 1V3KA 4N0RA 3RCMA 2DW7A 2VEKA 2DIEA 2VKZG 1PKMA 2NV1A 2DT0A 2NQ9A 2JIEA 2Z7GA 3M0XA 4E8CA 4C6BA 4I9MA 3WY1A 3OZOA 2JF7A 4WR3A 3UA4A 1UMYA 4JTHA 3N6JA 5BXRA 4YYFA 1HL2A 1E5JA 3RAOA 2PGEA 4H9TA 4MWAB 4AFYA 3CZGA 3W38A 2YYTA 1E51A 4S3JA 4UBPC 4LCSA 4PBEA 2OQYA 4TTUA 1IWBA 4UFJA 5CPTA 2YYUA 3F5JA 2DJXA 5XIMA 3D6NA 2Y8KA 4YTRA 1V77A 3OVRA 5CH9A 3H2CA 5ABEA 4JHZA 3URAA 1LYXA 1IT0A 1UD2A 1I2OA 3EWBX 2XFWA 3POCA 1A3XA 4AD5A 2ZUTA 3QHNA 1TMHA 5GJMA 3WFLA 4DWSA 1MDRA 2VXNA 2WZMA 2CW6A 4MZ8A 4PZVA 4PUKA 3HOJA 2VWTA 1OGBA 1T7LA 2ZCGA 2ZFAA 1C8XA 3IJ9A 4QJ3B 3TZNA 4CLMA 2Y88A 4HKPA 2VDIA 3GTIA 2YKKA 4JN7A 3LMZA 3QPEA 1Z32X 4DNMA 1DIDA 2OR2A 2WJZA 5J5DA 1YE6A 4QX4A 1JPHA 1R6WA 4B3LA 3LLFA 3V35A 4HOZA 2ZWZA 5CC5A 4KKXA 2DUAA 3VGHA 3NGJA 2D2GA 4O57A 3W7IA 1SZNA 3AWOA 4AISA 4FO4A 4FNUA 1NF7A 1JUBA 3KWSA 3AXKA 1KM6A 4LRSA 4KW2A 4NAFB 3H26A 1C8YA 2FLIA 4GO8A 2G4FA 2WBKA 5CBIA 4MIMA 3R11A 1GQJA 3FSTA 4L4OA 2YDAA 4UQCA 1OF8A 4OFCA 4WRHA 2UBPC 4GUJA 3AI0A 1UPPA 1XUUA 4JIHA 4GACA 3L0KA 1E9ZB 4FIQA 2X0SA 3QLLA 4MPKA 3GH7A 4MJ4A 4BQ3A 1MFVA 2IS7A 1UWSA 3P6LA 3RX4A 3CIWA 2CEQA 2WAGA 1VFUA 4D6GA 4GFSA 3FNDA 2QJGA 5C0QA 1CGUA 3WSUA 1JFHA 1KFWA 4B16A 2GUBA 3ZZ1A 3B0PA 2VGBA 1U5HA 4R5EA 3SCTA 2B7QA 3P84A 1YDOA 5IFPA 1A5CA 4S3KA 3WNMA 1UC5A 5HANA 2MANA 2AQVA 2GSEA 1B3WA 3BSMA 4YCOA 1R3YA 3RMJA 4XSLA 2ZDSA 4Q6JA 1IEXA 4DI8A 3MP5A 3PUGA 5LNUA 1UD3A 1J0ZA 1DJWA 4RX0A 3W73A 3IAPA 1GOOA 1JDAA 3ICJA 1CB7B 7PTDA 1R8LA 2Y8VA 2XGIA 3ZLFA 1H4PA 4Q8VA 4L7ZA 1EBHA 1JZ6A 3LBOA 2CETA 4YS1A 1JYNA 4FR1A 3W70A 3SADA 2H8ZA 4LJ3A 4JQ2A 3WKZA 3EX4A 2QCEA 1YBQA 4ERIA 3A47A 5F2LA 3W2KA 4GYJA 3PBWA 2BLEA 4X9YA 3LCWA 3NA8A 5ECUA 2A7NA 3THCA 1SJAA 3MWCA 4GRSA 1B3XA 3S46A 3EOLA 2QS8A 1RSCA 2E4TA 4QDWA 2VGIA 4N9EA 2BY3A 3BGAA 1CECA 3AMLA 8RUCA 2YW4A 3WZ0E 5H91A 2DV0A 4RW5A 1A49A 1PSCA 1HNYA 2VOTA 1HO4A 3HGOA 1DXEA 4ICMA 3M41A 1GOWA 3S5ZA 2ALRA 3DOPA 2F6XA 3LNMA 1JZ3A 3VA8A 1EB3A 4S1FA 3U4AA 4HU4A 3G24A 5C5YA 4QEHA 4B9YA 4RE4A 5U7SA 1UD4A 1K8XA 3N17A 4KWOA 4L9ZA 3PFMA 4XZBA 2OKTA 3QQ1A 1SR9A 1UJPA 2H3BA 3EWUA 2WMIB 1E9IA 4C6LA 1XLIA 4EXBA 4F3HA 3FHAA 5C71A 1PTGA 2OOGA 3A3XA 1V0KA 2WBGA 2DT2A 4LBSA 1B4EA 2WM1A 3M1ZA 2LLEA 4CCDA 2ZZ2A 5C2GA 4NASA 4CU7A 5HNUA 1PX4A 2PAJA 4WY0A 3URQA 4D1JA 4L4LA 1RVGA 4L1GA 2VJXA 2GQ9A 3GHRA 3P0WA 2ICSA 4N42A 1KXTA 1WV2A 3WF1A 2YW3A 3N2BA 1H1NA 5CSUA 4RNHA 4JCMA 2PTYA 2TODA 3EX1A 4PE8A 2ZZ6A 1BKSA 2DW6A 2CPUA 5G2IA 3DFTA 4LW7A 5I3HA 1QI4A 2Z2BA 1Q7ZA 3MCMA 3PB0A 4WDUA 2FKPA 5D04C 4XAYA 2P3ZA 4B15A 4LB4A 4ONVA 4IHCA 4Q8QA 4DVOA 3TQPA 4OUEA 3GHSA 5AYYA 4U28A 1JRCA 3IJ6A 3NPVA 1AD1A 1LJYA 1U5VA 4XB3A 2XWDA 5XIAA 2ZX8A 2E8ZA 1BTCA 3W6YA 3QW4B 3T0DA 7XIMA 3MKVA 3TK7A 3QR1A 3CUJA 1ZENA 2HROA 3DHPA 3UPMA 4G2DA 4F0KA 2JEQA 3QH2A 3CBWA 3WL1A 2PDFA 3SUWA 4RZ4A 1O66A 4BI6A 2ZRXA 2YCEA 2WNZA 2QULA 4M81A 5A6TC 2ALDA 2JKEA 2V82A 1L6SA 1LT8A 4QLKA 5H8UA 5CGTA 3B9EA 5EYWA 2X30A 2BXVA 1GJUA 3DFSA 1J96A 3ZJ6A 1DE6A 2HXTA 3IIVA 2YL5A 3CMGA 4Q4RA 3N11A 1A5NC 4GFIA 3OLEA 4NZ3A 3LGEA 1BPLB 2HTMA 3S6DA 3UWVA 1UD8A 4UMCA 2V3GA 2FDMA 5I79A 4HCLA 4I7WA 5F2MA 2GVGA 4CQCA 2NUWA 2CITA 2WYSA 5G5IA 1RP9A 3THAA 3V0UA 3VC6A 1XWYA 4S3DA 3S1UA 1KCXA 1FY6A 3B9AA 3WELA 4Z2LA 4IMDA 4AXNA 4Y9MA 1QUMA 5I24A 2E5BA 1ZUAX 3W2LA 2PP1A 4QAWA 3UR2A 4KEUA 1WAUA 1UP3A 1F4HA 1HIZA 1J5SA 3HQOA 3L4ZA 3RU6A 3SCVA 3L0NA 3GVRA 4HK5A 3BVJA 3G2GA 3BLDA 1WPCA 1XI3A 2ZRVA 5A1AA 4TX8A 4P7NA 6REQB 2R6OA 2OO6A 2GOKA 4B2DA 4IQJA 3L4WA 3II1A 2P5NA 3L4VA 3L4YA 4JX4A 5D38A 3EB3A 2WCGA 2OODA 3B4UA 4PMZA 2D2JA 4RJEA 3LK6A 4WSHA 4ACZA 1O60A 4GOAA 1U5JA 5E9XA 1EL3A 1Z7AA 1EIBA