3OLDA

Crystal structure of alpha-amylase in complex with acarviostatin i03
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
495
structure length
495
Chain Sequence
YSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of human pancreatic alpha-amylase in complex with acarviostatins: Implications for drug design against type II diabetes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Pancreatic alpha-amylase
total genus 173
structure length 495
sequence length 495
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3oldA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3oldA01
4LPCA 2Y8KA 1RD6A 4HA4A 2D73A 2XVGA 2O9PA 3VSTA 4NX0A 2A3HA 5CPSA 2X09A 4C7GA 4FLSA 2W5FA 2OYMA 3N15A 3W6LA 1UD3A 1AVAA 3ARYA 3N11A 3WH9A 3F4VA 3WUFA 5JIPA 3MI6A 1DWFM 1QHZA 2XFRA 5A3HA 4P7LA 3WL1A 1XH0A 2W4XA 3FHAA 1HJQA 2ESCA 4M24A 1W9DM 4R27A 4D6GA 4V27A 1UR4A 5A2CA 1ZBKA 2UY5A 1XYZA 1GCYA 2FYVA 3D3AA 3SCPA 3SUWA 3EJTA 3W29A 1OINA 5HOSA 5IXEA 1QI0A 4V28A 4PSPA 1M7XA 3VO0A 4IPNB 4R5EA 5IFTA 4UFMA 1XSJA 3BUPA 2WBGA 5A6KA 2XFYA 2WPGA 4N0RA 1W1TA 1UUQA 4JHZA 3ZT6A 3PZOA 2FDMA 3AQUA 1JAEA 2J7BA 1D7FA 2XN0A 1AQ0A 4MNLA 3L4ZA 2D22A 3RO8A 1JFXA 4GI6A 1UG6A 3DECA 1LJYA 2XVLA 1H41A 4UOJA 4TTGA 2YLAA 1E55A 2BS9A 4TOQA 5FL0A 3VMPA 1GPFA 4IM4A 1EHAA 1PIGA 2W61A 1C3FA 3BMVA 3WY4A 3AOFA 1PX4A 1U2YA 2YBUA 2J75A 3VDHA 2VRKA 1FP8A 1JDAA 3TTYA 5A8QA 3L4YA 2G8ZA 4YPJA 1MW3A 4DWSC 3GH5A 1UD8A 1BG9A 1K9FA 3H54A 2IGTA 3ARQA 5E6YA 2EPNA 1OBAA 3ZOAA 1CXIA 3SIMA 3DX0A 5A8OA 4UQAA 1UWRA 4LXFA 1Y7VA 5EBAA 1IV8A 4D6IA 1TQWA 2XN2A 1SMDA 1N82A 5LA2A 3OBAA 1U33A 5LYRA 1XSKA 4AY1A 4OZOA 4URIA 1J0IA 3OZOA 1GUVA 2VZUA 3FHQA 3TOPA 1O6IA 4QLLA 1MQPA 3AIQA 5FD0A 4ZFMA 3T09A 3GXTA 3WNPA 1ODZA 2ZXBA 1TE1A 4UZSA 1E15A 3WNOA 4H8VA 2EAEA 4JCMA 2YJQA 1VJSA 1XD0A 5JBDA 1V3MA 3ARTA 1J18A 2EPOA 1WZLA 2XIBA 3I3DA 4N42A 3M46A 3CZEA 2J74A 1Q6CA 4AEEA 2ZX7A 4MDPA 4QFUA 3CZSA 2ZUVA 5AC4A 1X6NA 1XRVA 1T0OA 2QLYA 4ZXLA 2VT0A 3VGFA 3SEPA 3DDGA 4PTVA 1NQ6A 2YDQA 2V3EA 1ZL1A 1B3XA 2TAAA 4GQRA 3LRLA 1W9PA 3GDBA 1NP0A 2J62A 3VUPA 4CKQA 4AMXA 2WKLA 1W9XA 3WY2A 1HIZA 2ZE0A 2J8FA 2EJ1A 3WFZA 2Q8XA 3KLLA 3EYPA 5GNXA 4Z2LA 1SYTA 1VJZA 2J7CA 3GTNA 4IPLA 1E6PA 3E1F1 4U31A 2NT1A 3B9EA 1V3KA 8CGTA 3U7BA 4W89A 1V6YA 3BVTA 5CLTA 5F7UA 2VI0A 1W3HA 1TQTA 4F9DA 2CXGA 1TFVA 1WB0A 3WEZA 3WNLA 2J4GA 2DH3A 3VMNA 2WWDA 1RPKA 4AIEA 1CZ1A 2VQUA 2ZX5A 1H1NA 2XHYA 3CUGA 1W3LA 4OBSA 4AZBA 2WK2A 1MQQA 1TCMA 4AYSA 3NSMA 5CGTA 5CJ5A 1B9ZA 4FNSA 2CKSA 2C7FA 1FHLA 1GORA 4BQ3A 3WBEA 3WNNA 5KZ6A 1QI3A 4AMWA 5CLWA 2WVTA 3IJ9A 5I0DA 1KCLA 2WLYA 2WCGA 5EMYA 1IT0A 2X2JA 2Y24A 4UFHA 1V0KA 3AIWA 3QHOA 3WH7A 4EAMA 1E4NA 3LPPA 2OW7A 4FLRA 4OGZA 5DEZA 2GVYA 2CBUA 3KZSA 1LG2A 2IUZA 4X9YA 5AYIA 1JL8A 1WZKA 3PZUA 4LX4A 2XGIA 4JKLA 1GONA 1CXLA 4HZ7A 4AXNA 1W3KA 1B3YA 3WL0A 4B16A 4FNUA 4GO9A 1H11A 2GFTA 1MWOA 2VRJA 2V5CA 1JDDA 1EDTA 3CV5A 2J7EA 3AZTA 1E0XA 4OUEA 1HT6A 1LL4A 1E6ZA 3DX1A 3AISA 1EQPA 3RPMA 1ZB5A 4P7RA 3UERA 1JXKA 2WCAA 3RM4A 2J77A 2XUCA 3CUIA 4PUDA 1VBRA 1FH7A 1R7AA 2WSPA 3GXDA 3MUZ1 2ZX8A 4LYRA 4P8UA 1BFNA 4AIUA 4DWSD 3DYMA 2FGLA 1H3GA 1J0YA 1QNPA 5GPRA 1E0WA 4CGTA 5A6AA 3RMEA 2ZX6A 3DHUA 3AMLA 2F7PA 3UR8A 1X1NA 3DC0A 4E4PA 3AMKA 3AMCA 1UD2A 4U5KA 4PCSA 3AXHA 2BVTA 4A3YA 3LMYA 3KE0A 3SURA 3BLBA 1UKQA 1JYNA 1JYVA 3WFLA 3PTQA 3WUGA 3OLDA 1OT1A 2DGAA 1FH8A 5AC5A 2JALA 1V02A 3IAQA 3OZPA 1EXPA 1NP2A 4UQ9A 3VIOA 3AMDA 4JKMA 3L2MA 1PAMA 1VAHA 2OYKA 4AEFA 3EJRA 4HOWA 4U3CA 1QOXA 2Y2WA 1K6AA 3WDRA 4BA0A 5E6ZA 3VGGA 4U2YA 1R8LA 4FNPA 3EBVA 4JFWA 3MV11 3D50A 4M80A 4TVCA 1H0IA 4HPHA 4CCCA 3W82A 3POCA 2OSXA 2CIPA 3LRMA 4QDMA 4WSJA 1UWSA 4E2OA 4A3HA 4UFIA 5HDRA 4XZWA 4DO6A 3WUBA 3WSUA 2UY4A 4D6CA 3GXPA 1GNXA 3D4YA 1CTNA 1V3LA 1PPIA 3VX1A 1F4HA 1PS3A 4BQ4A 4W8AA 3WELA 3MSGA 2BNJA 2WVUA 3WY3A 2OWCA 4JFVA 3AHXA 1SMAA 4TVUA 4NF7A 2A3CA 1UD6A 1DWGM 2VL4A 2VUYA 3WDQA 3ECQA 3GM8A 1JD9A 2YL5A 1PBGA 1GOIA 3CZJA 2NSXA 2J25A 1HF6A 3U5UA 1OSEA 3IJ8A 2C0HA 3WH6A 3ZSSA 4AZGA 3EDDA 1ECEA 3CBWA 1OT2A 3WQ4A 4AZIA 3OLGA 1BHGA 3N13A 5BYWA 4UZUA 1CYGA 4Z2JA 4CN4A 2XPKA 3NSNA 1B3VA 2IXVA 2VC9A 3L4TA 2PB1A 2AAAA 3T08A 2VX5A 3OIHA 1LQ0A 4P7OA 1JZ6A 2J78A 4AZHA 3POHA 4EK7A 4H8UA 5E9AA 1FFRA 2FGZA 1PX3A 4FF5A 3WBAA 3PTKA 1V02E 4PBGA 3W0KA 4TX6A 1V08A 3FW6A 1ESWA 2GJXA 3M6DA 1GW1A 2WMJA 4S3KA 4ZE5A 1W9VA 1BGAA 2AMGA 3IANA 1EH9A 3SCTA 1D2KA 5IHRA 3VDBA 1J12A 5A69A 3VGDA 5M03A 3NDZA 1QWUA 1W2PA 3H55A 3VD5A 3WF1A 4CCEA 1KXHA 4J27A 3AS1A 3CZ8A 1OIFA 4C7FA 3KWXA 1V3HA 2F1AA 2W62A 1HJXA 1QBAA 5BRQA 2UY2A 3ZJ8A 1VFMA 3W37A 3WY1A 3DX3A 3UESA 2EEXA 2ZUUA 2VCCA 4UCFA 1WDQA 3B9DA 3TV8A 1HKJA 3I3BA 2BHZA 2WC3A 1H09A 5C71A 1WE5A 7CGTA 5I3DA 4FK9A 3WF0A 2GDUA 4MJ2A 6CGTA 1C91A 3DX4A 4QCEA 4GIAA 2WZIA 4UQCA 4W93A 1GHSA 1V0NA 2WC4A 4GINA 3WDHA 1OM0A 2CERA 4AD2A 1VEMA 4H8HA 3S5ZA 5GQBA 1XV8A 3K8KA 2G4FA 1EIBA 3PBGA 5CSYA 2GDVA 2UY3A 4HOXA 3I3EA 3RM8A 3VIIA 1UKOA 1CLVA 3CHCA 2E8ZA 3UG5A 2DSUA 4AD0A 2EPMX 5TD4A 2F2HA 9CGTA 1W3JA 4P7QA 4J3UA 5C70A 4NXSA 2WM0A 5A8PA 1NOWA 5I23A 5DT5A 3ARSA 2FHCA 2VQTA 2CYGA 4AD3A 3LPFA 3VMOA 1J9YA 1EOMA 4K68A 2EXOA 2VX7A 4LGXA 4JFTA 1W32A 1ZJAA 5CGMA 1CENA 2G3NA 4EKJA 5DT7A 5JIWA 5IHSA 2GK1A 1TVPA 1NWSA 4FLQA 3AYRA 4XUYA 1HXJA 3EMQA 3QR3A 4M82A 4OJYA 1WCGA 4AMCA 1UD4A 1KR1A 1KBBA 3BAWA 1UWQA 4KH2A 2VR4A 3VSVA 1O7DC 4JZ5A 3FY1A 4PMUA 3RCNA 4GI9A 4CVUA 4DO5A 3OGSA 4WJXA 1JZ8A 2XJ7A 3SCVA 1B1YA 4P8VA 2XM2A 4WKAA 4BZYA 5M17A 2YKKA 2G3JA 5CQ1A 1S46A 4YHEA 1VENA 4XB3A 3EMCA 1W91A 3THCA 2OLHA 3VIKA 2BFGA 2CBJA 1HKMA 2F8QA 3KL5A 2E4TA 4W7WA 3CHDA 4AYGA 3T0AA 2FH6A 1E6XM 2FE0A 2XG9A 1K9EA 1E5JA 4PSRA 1GOOA 4WKFA 3ARPA 3SCNA 1UQZA 3ZT5A 1QHOA 3UCQA 1V03A 5DF0A 3T2QA 2PBGA 1P6WA 4HZ8A 5E0FA 5E0CA 3U5YA 2ZIDA 1UOKA 3ZSTA 1Q4NX 4A4AA 2ZUMA 3TP4A 1US2A 4D6FA 1HP4A 4NZJA 2DDXA 2YL9A 4W88A 3D51A 4FNTA 2WC7A 5D8WA 4AD5A 3BGAA 4C7DA 1C8XA 2ZUNA 2XGBA 1E3ZA 1CPUA 4U2ZA 1E4LA 4S3JA 1JZ5A 4GZIA 1JZ3A 4PMQA 2E40A 2YDSA 1W1PA 3AS2A 1PX8A 3VIGA 1GOMA 1IZJA 4J3VA 2F7QA 4ATWA 1WP6A 4JFSA 4AW7A 4MTVA 2DT2A 1JZ4A 2WHJA 2D1ZA 4YHGA 3VD9A 1UR8A 1FP9A 4HU0A 2GJXB 5A8NA 1B0IA 4OIFA 3FNDA 2XVPA 3WMSA 5A1AA 3WENA 2W63A 2ZWZA 4FLOA 5A6SA 4NZFA 1GQLA 3WQVA 1VFFA 3A24A 3TTSA 1V3JA 3MMDA 1R7OA 3A4AA 1C92A 1H4PA 2BY3A 3AIUA 1I1XA 3VIJA 3CO4A 2YA2A 2XYLA 3O2LA 4CU7A 5I79A 2XIIA 1WO2A 1HTYA 3AMGA 1XGZA 3A23A 3ARUA 2E9LA 2YLLA 1QI4A 2VZOA 3VNZA 1SZNA 3WQ6A 3CZGA 5EFFA 2WBKA 1GQJA 5A2AA 4B3LA 6TAAA 4W85A 1J0JA 5AY7A 2WNWA 4JHOA 3ZJKA 2FHFA 3GYCA 1DP0A 2DPEA 4PMXA 2CKRA 2WAGA 1DWHM 3PZNA 1C8YA 3T0BA 4PMNA 4B9ZA 3PZGA 4TUFA 2AOSA 3AI0A 4PMOA 1E6RA 3ZIZA 5LA1A 4DUXA 2WMGA 2BVYA 5CXPA 3NJ3A 2WVVA 4RE3A 5KEZA 4GO8A 1W1VA 1B90A 2EABA 3VKKA 1JXJA 1LLOA 2O9RA 3U7VA 4MB1A 4QAWA 2GUYA 1GJWA 3KLKA 2PWGA 2VZVA 3SCWA 1VEOA 3L2LA 3QOKA 4J3SA 4LQ1A 1QBBA 3SCOA 3A22A 1CGUA 4BF7A 8A3HA 4Z2HA 3S2CA 1LF1A 4UFLA 3ARVA 3RDKA 3WIJA 5BXRA 2J47A 2ALWA 1UKPA 1QWNA 3VD7A 2BVDA 2F1BA 3IK2A 4BCEA 2CBIA 3KEHA 1KTCA 1FH9A 1WPCA 1G9HA 4QLJA 4CD4A 3APGA 4PMDA 3SUVA 1CXFA 3BAKA 4DO4A 1E56A 3VTRA 3AFBA 2BY2A 2CPUA 2J7HA 1BG4A 3THDA 4RL3A 3WQWA 3MO4A 1E6SM 1WDRA 1EOKA 2WWCA 3CZKA 1E73M 3HN3A 1UR1A 2RGMA 4BQ2A 1E9LA 5M3WA 1HVXA 2EADA 4AZCB 3VINA 1AQMA 1BYAA 4XV0A 1DWJM 3HG2A 4HA1A 3O9NA 2E8YA 1BYDA 4MNMA 2ZX9A 1PZ2A 3BSGA 3GXMA 4NXKA 4MB4A 4DWSB 3AS3A 1R34A 2FHBA 3TA9A 1W9UA 4ACYA 2BY0A 4W8LA 3SCRA 4QLKA 1JZ7A 1HP5A 1R46A 4W86A 2DSWA 3CH9A 1HXKA 1ITCA 1E40A 3ARZA 1M04A 5BRPA 1CGXA 4XZBA 1XCWA 3GXNA 5FCZA 2JIWA 2XVKA 1VIWA 2DIEA 1LWJA 1UA7A 3A6OA 3HJEA 4UFJA 1PIFA 1R85A 3PZVA 1PEZA 3WNMA 1J11A 4PTXA 2EQDA 2WHKA 2D0HA 3K4AA 3CUHA 1MQRA 2QMJA 4D1JA 5EB8A 4MJ4A 3W6MA 1AQHA 4CN6A 2W67A 1GQIA 4J3WA 1DHKA 4UFKA 4OKDA 3CHEA 2OYLA 3VIMA 7TAAA 1GOKA 1PZ3A 3WF2A 2HISA 1KCKA 3OGRA 3WH8A 4ZE4A 1GZJA 2ZUWA 1MXGA 3VM5A 2E3ZA 2YFNA 2VCAA 3MSDA 4AZ6A 1ISWA 3SCQA 3W28A 3BMWA 1QI5A 3HMCA 3ARWA 4JKKA 3WQ5A 4KGJA 3SUUA 2WHMA 3BLKA 4UR9A 5E09A 3MUY1 1KGUA 5EFDA 5FKYA 1ZJBA 1CGTA 1EA9C 4GKLA 1UKTA 4KWUA 2WYSA 1O7AA 2XWDA 1E4IA 4BS0A 4AWEA 3ZR5A 3CPUA 5I77A 1BYCA 2E9BA 1C8QA 2VOTA 2J7FA 3UR7A 4AD4A 3GNOA 4WF7A 2EACA 3AZSA 1L8NA 4TXEA 3WKZA 5FIPA 4GZEA 1JI2A 3QHNA 3NDYA 5FL1A 3WMCA 1WNOA 3IAPA 1BLIA 2VZTA 4ZENA 2WSKA 3TTQA 1DWIM 2WMFA 1LL6A 2V38A 3ZM8A 1UWIA 1E1FA 3K8MA 4X0NA 2VZSA 4HZ6A 4MPKA 3BH4A 3PTMA 1V6WA 3ARXA 2OSWA 3M7SA 1W1YA 3WF3A 4AIOA 3VDCA 3WEMA 1C7SA 2QHAA 3RM9A 2XWEA 3DYOA 3D52A 4P8XA 3QOMA 3CLWA 1ISXA 3ARRA 1JF5A 1NH6A 3LXBA 3L4XA 1G5AA 4GI8A 4AZ5A 1JI1A 1E5NA 1GOQA 2WMIA 3MUAA 3ZT7A 4WIWA 2OWWA 2VX6A 4OOUA 3HU7A 2ZUTA 1H0GA 3U57A 4DUVA 1I75A 1GHRA 1JDCA 1JAKA 3OLIA 3WDPP 1UA3A 3VX0A 3EJUA 4CD6A 1Q6DA 4AD1A 1X6LA 3F5JA 1CBGA 4PUEA 3L4UA 3MMUA 4Z2IA 1E6QM 5I6SA 5LA0A 1G1YA 4W8BA 4M8UA 4JFUA 4CVWA 4F9JA 1JZ2A 1J0ZA 1QW8A 1CXKA 3NSXA 1JYXA 1Q6EA 1KR0A 2D2OA 2DT0A 5E1QA 4H04A 2DT3A 2F18A 3II1A 1GOWA 3AXIA 1XSIA 3J7HA 2W91A 2D0GA 2XSBA 1TQUA 4NRRA 3RJYA 2ZUSA 1R87A 2JFEX 3ALFA 1K9DA 3PZ9A 4F79A 2WVSA 4FNQA 4UQEA 1KWGA 4YN5A 4CD5A 3OG2A 1ISVA 3VSUA 2XFFA 2BHYA 1BGGA 1I1WA 5BXSA 2J8GA 2Z1SA 1H49A 1CWYA 1NWUA 4DM2A 4B9YA 5I24A 5ABGA 5JUVA 3AHZA 1CXHA 1OGGA 2WCSA 2X2HA 3DHPA 1TVNA 4FMVA 3AIBA 2DIJA 3HZ3A 4CD7A 1GQKA 5I5RA 3ZJ7A 1EO5A 3DX2A 4KRUA 3NYDA 1UQYA 1OD0A 2B31A 1UH2A 3BVXA 2ZXDA 4GZJA 1DTUA 2DSKA 1KXVA 1V6UA 2J79A 2X0HA 2D23A 4W5UA 4UNIA 3WN6A 4MAVA 3BAJA 2WZEA 1OB0A 3AIVA 1ZBWA 4UOZA 1WZAA 3BAXA 4F8XA 3WD4A 3VIPA 2QPUA 2V3GA 3L4WA 4M81A 1UHVA 1WKYA 1V0MA 1JF6A 2BXZA 3WH5A 4WSKA 4RE2A 1UR0A 1HKKA 3K4DA 4KRTA 2BXYA 1HWWA 1KXQA 4Z2GA 3EJSA 4PRWA 4MB5A 3SCSA 4EANA 2EBNA 2VNCA 2W66A 1BF2A 4TX8A 3WUEA 2CCRA 1LG1A 1V0LA 3G6MA 1HJWA 3CC1A 2OSYA 1R86A 4HP5A 1ISZA 5D9NA 1EDQA 5D4YA 3KL3A 4IUGA 3AROA 4U5IA 2OWXA 1XC6A 1ZU8A 1B2YA 3NUKA 4HA3A 3OLEA 2MANA 5DMYA 1JYWA 3N04A 4JCLA 3ALGA 4HPGA 1TQSA 3B9AA 4TTUA 3PZQA 5BROA 2D3LA 4CUCA 1XH2A 1H5VA 4PMYA 3CZNA 2D24A 5CG0A 3GBEA 3F5LA 3K1DA 3W81A 2FH8A 5GNZA 1QPKA 2EPKX 1RH9A 1KFWA 5HXMA 3MUIA 4P8WA 4UQDA 5A6BA 3UG3A 5CPTA 3WD2A 2HVMA 4M29A 1R33A 2YBTA 1VEPA 1UD5A 1J0HA 1E43A 1VF8A 1XHGA 3CMGA 3BLPX 4AC1X 4PYSA 3A5VA 3N18A 4U3AA 3FXYA 4MB3A 3WD3A 1NOUA 1E72M 1TQVA 4W87A 1QNSA 4J3TA 4HMDA 2O9TA 1B3WA 3GZAA 2WXDM 2GK1B 3CHFA 1EDGA 5A6LA 3WNKA 2DQXA 3MMWA 1A3HA 5A95A 3A47A 1SFSA 1UWUA 1TA3B 3PN8A 1ITXA 1WDPA 1M03A 1KGXA 4HU8A 1BVZA 2X0YA 3RJXA 4M56A 3BVWA 5A6MA 4CD8A 5D9PA 3EDKA 2CETA 3EMZA 2VURA 2YIHA 2X1IA 2YA0A 3BCDA 3TONA 5A8MA 5CSUA 1BVNP 2CITA 3QGVA 4H2CA 3HG4A 4E8CA 2A3AA 1HL9A 3L4VA 1ZS2A 4NZCA 5I78A 2Y8VA 3T0DA 3AHVA 3MU7A 1QX1A 1MW0A 2EPLX 1TMQA 3H53A 2ZXQA 2GJPA 3VU2A 3MS8A 1J0KA 4CCDA 5AYBA 1AMYA 3BAIA 5DO8A 5HBFA 1EO7A 1WDSA 5CPQA 1KQYA 3CIVA 2BHUA 3A21A 2JIEA 3MKKA 1L0PA 3EJQA 3AHYA 4QCFA 1XH1A 1QVBA 2G41A 1CLXA 7A3HA 3N9KA 1HNYA 4JAWA 4M1RA 4PMZA 1EHNA 4MADA 3BUBA 2WMHA 5D9OA 1NARA 1YQ2A 1Q6GA 5IDIA 3UEQA 4GQQA 4JL1A 1DEDA 1VFUA 4W5ZA 4NI3A 3N1AA 1TZ7A 5BXPA 3ZJ6A 3HG3A 2D20A 3W26A 3EDEA 1M53A 1QHPA 1CGVA 4D6HA 1JFHA 2JEPA 1JNEA 1BQCA 1VRXA 2GSJA 3IGUA 3A4XA 2PBOA 3T2OA 3WF4A 3VPLA 3T2PA 2WANA 4XX6A 1JIBA 4DWSA 3AHTA 2WHLA 2F7OA 4J3XA 2BY1A 2D0FA 1HJUA 5M5DA 1OWQA 3VD4A 3VGHA 2X2IA 3PZTA 2YFOA 1QW9A 3WD0A 2CBVA 3HG5A 2DSZA 4RE4A 5ABHA 2NT0A 1HX0A 3SCUA 4E8DA 2WLZA 1SR0A 5HPOA 2O9OA 3W4RA 3VILA 4QP0A 5ABFB 2PWDA 1CXEA 2V3FA 1CEOA 4GPNA 2PC8A 3W38A 3BAYA 3LPOA 1K9TA 3CTTA 3CGTA 1MFVA 3VGBA 1HVQA 4V2XA 4MAZA 3PZMA 1KWKA 3BSHA 1E1EA 2QPSA 3BUDA 3PHAA 4ZXOA 3VM7A 1BPLB 1UWTA 5ABEA 4H7VA 4JIEA 2IXUA 3NIYA 1G0CA 3UG4A 2WMKA 4OBRA 2VO5A 4F66A 3MANA 4ACZB 1R75A 1UH3A 3TTOA 3VNYA 1XCXA 2F61A 2J7DA 3MV01 3CMJA 3VVGA 2VRQA 1E4MM 4ATDA 1BTCA 1FOBA 2WB5A 1OGBA 3AIRA 2ZICA 2YL6A 3OGVA 3W53A 1B31A 1OGSA 1PJ9A 5ECUA 1NWRA 3A4WA 3AJ7A 1KGWA 1XD1A 1B3ZA 1TG7A 2JF7A 3M07A 5HNNA 1ISYA 1QI2A 1OD8A 4D6JA 4NSBA 3AZRA 2E0PA 1Q6FA 5A2BA 4HMCA 2ZWYA 1MFUA 2CESA 2E9MA 3LXAA 4ZEPA 3AIEA 1VBUA 2X8RA 4ATLA 1HJSA 2A3BA 1QNOA 4MNKA 4ML4A 4HOZA 2XN1A 2WVVB 2JEQA 1TUXA 1DWAM 2DEPA 3BUQA 2Z1KA 1QNRA 3EDFA 1JGIA 6A3HA 2VVSA 3VD3A 2VJXA 1V3IA 4TVDA 1HN1A 4LYQA 3BVVA 3GNPA 1W9BM 3WMBA 4HMEA 4DUWA 1JG9A 2WZHA 4FNRA 1MXDA 1UYQA 1R47A 2CNCA 4HTYA 2XTKA 3K8LA 3EDJA 5GNYA 2G3IA 2XM1A 3N12A 1ZBCA 2VVNA 1C93A 1V6VA 3GH4A 3QHMA 3VDAA 2VX4A 1MW2A 4X0VA 4CU8A 4AZ7A 3D5HA 4NRSA 1US3A 3A3HA 3D4ZA 1OIMA 2CHNA 1KB3A 2Y5EA 3CUJA 4PMVA 1TA3A 3ZQ9A 3ZMRA 3GNRA 5ABFA 1TR1A 3BUIA 4AISA 2XSAA 1WZMA 3NCOA 5BCAA 1C7TA 1ZBVA 2WMIB 4D6DA 1CNVA 4U33A 1GVYA 2ZOXA 3WQ8A 3VOCA 2YDRA 1UR9A 4W7UA 3EJPA 3ZR6A 3N17A 3BXWA 1GJUA 4LYPA 1CDGA 2QMKA 3GXFA 1EQCA 2NW0A 2XVNA 1QNQA 5E70A 4GXPA 1LL7A 3FN9A 4MDOA 4Y7EA 3VIFA 3GH7A 1KXTA 1UKSA 3DYPA 1JD7A 2Y4SA 3WDIA 2JF6A 3BC9A 5I2UA 2OW6A 4OOZA 3WDJA 2DT1A 3CZLA 3FAXA 1NOFA 3WEOA 3JUGA 4D72A 1E6NA 2V5DA 2GJRA 5D9MA 4CN1A 3BCFA 1B30A 1HKIA 1CGWA 4WK9A 1UH4A 1KBKA 1V6XA 4L4PA 3LX9A 3G6LA 1ODUA 2PWEA 5A6BD 3AS0A 4PMRA 2X05A 3GXIA 1WAWA 5FOOA 2PF0A 1J10A 2YL8A 2VTFA 4D6EA 1G01A 3W24A 4W7VA 4EE9A 3DDFA 2O92A 2EO7A 2W92A 1BAGA 3AXXA 4DM1A 3SUSA 1LWHA 2DH2A 1JNDA 3OB8A 1NM9A 2VCBA 2PWFA 3O6AA 3W25A 5D8ZA 2J7GA 5A94A 3VIHA 5BXTA 3CUFA 3ZO9A 2X2YA 3W27A 2CEQA 2BV9A 1H2JA 4J28A 4ACZA 4PN2A 2YOCA 5IFPA 1E70M 1U30A 3S5YA 3AYSA 4WLCA 3OA5A 2RGLA 1D3CA 1E3XA 3RILA 1BSIA 2DSVA 1MYRA 4WKHA 1OCQA 4CU6A 5BWFA 1CECA 1MW1A 4PEEA 1E71M 5JBFA 3AICA 5A6JA 3SUTA 4JL2A 2CHOA 5CZKA 3GBDA 3B8SA 5HPCA 1HJVA 4IISA 1FFQA 1MVYA 1NWTA 1RP9A 4PTMA 5JBEA 3K46A 4L4OA 1HL8A 3LXCA 1UR2A 4BQ5A 1UZ4A 1J01A 2WW5A 2C8NA 1FHDA 3F5KA 4MNJA 1G94A 1KQZA 1W2VA 1FA2A 1RP8A 2V3DA 5C8BB 4Q7NA 3S6TA 3VGEA 5DFAA 1CIUA 1VB9A 2D3NA 1XYFA 3FAWA 2VMFA 4D71A 4UTFA 4AZCA 4P7NA 4PCTA 3UETA 4B15A 2G3MA 1EGZA 4KMQA 3PZIA 2F7RA 3KL0A 1KTBA 3LPGA 2PI6A 3WD1A 2QV4A 1BYBA 1YHTA 1Z32X 2ZXAA 2JE8A 1CGYA 1F4AA 4KGLA 2WKGA 2QF8A 4PTWA 3IJ7A 1VFOA 4Q22A 2YA1A 1M01A 4B3KA 4D1IA 3LRKA 4H41A 4UQBA 4W84A 4J7RA 1IZKA 1UZ1A 2UWFA 2PWHA 1A47A 1C90A 1GVIA 3BVUA 2VR5A 1E0VA 4UOQA 3RIKA 4Z2KA 2A3EA 1UASA
chains in the Genus database with same CATH superfamily
3N42B 1Q45A 3QKZA 1VS1A 1QWGA 4XBKA 1PKQE 3W1AA 2D73A 3FA4A 4H1LH 3GNXA 3BP4B 3L5HA 4HTBA 2O9PA 4NX0A 2NY6C 3VD0A 2CO2A 2VAAA 4ZX6A 3IXAA 3DIFA 3MCLH 5F7AA 5CGQA 4UINH 1VCAA 1GYMA 2W5FA 5DEGB 4NO5A 3T0XA 1Y0EA 4FI8A 1PZ5B 3TYEA 1IJ9A 4EP8C 1KELH 5CPNA 4LLUB 3TN5A 1T83A 4HGKC 4JQXC 2FFIA 1SSDA 1QRNE 3TA6A 2BMKB 4HIIA 5FW7A 1FH2A 3NFPB 2VE6B 2WQAA 2KPWA 1H7PA 3M5XA 3WH9A 4X4KA 4DJFD 3D0CA 2QJIA 3RI5K 4TIMA 3G08A 3TLQA 1OANA 4L0PB 3TYZA 3WUFA 1U3HD 2Z2BA 1I9IH 3MV8B 2AJXL 3ZKXC 1TJ1A 2ENPA 3DO7A 3M0HA 1OLZA 5KVGL 2DZEA 2EINB 3N1MC 5B7EA 2ZCKH 4FI4A 2UZXA 1IT7A 4JG0L 4LRNH 4R27A 3VU1A 1HJQA 1HNGA 1J9SA 1OCCB 5D03A 2Z1VA 4JHWH 1UWGH 1KJ2A 1ZUAX 4Y9MA 3KOZA 1GCYA 1W8EA 1IM3B 2FYVA 2XYCA 3NJFA 5CM1A 4O1EA 2CKBL 3RZCA 1OKEA 3ZVIA 1AOHA 1MQKL 1X5FA 2JK5B 5D1ZI 2ZZ1A 3NQ6A 4NQ1A 2GYIA 4WY0B 2OCJA 2HX9A 3F2CA 4NKOB 1UOVA 1CR9L 3W29A 4P23C 2ZC8A 2XA8L 4I9WD 3CK0L 1RK7A 1QI0A 3VXSA 1OW0A 4GP8B 4PSPA 3NVDA 3G1HA 3TQPA 1RQEA 1A9BB 1JHLH 4JN2A 4MJIA 2NY4D 2INZA 4JO5A 3LPWA 1MFCL 3LQAH 3NJXA 4N9GA 2IV8A 5KBNC 1XSJA 3BUPA 1YY9C 4UT9H 2WBGA 3GDLA 4MNHB 4BI6A 3QWOA 1K6QL 4N0RA 1M7IA 5GS1B 4JHZA 1UUQA 1ZD6A 3QUMA 1SHXA 1WDAA 1YMMA 4NN6B 5DZVA 5E2UH 3M5YA 2ARJB 3ZKND 2UV3A 1ONXA 4Q8VA 1L9NA 3PP3K 4QE4A 1IGML 4YC2B 4RW5A 3UZXA 1AQ0A 2A4AA 3CQFA 2GAZA 3L4ZA 4XT1C 5JHDD 3REVB 3FSUA 2ZKHH 1P1MA 3VB8A 3HRZB 4K6AA 4PTUB 2VLMD 3DECA 4LL9A 4MZ2A 1MNNA 3S3CB 1LJYA 3DAQA 1QU4A 4ZZFA 2BVQB 4LPUA 3OV6A 4WUUE 1S7RA 1E55A 3P30L 4ZOCA 4BKTC 4N26A 2Y06L 3SYPA 3VMPA 5B1KA 1U93B 4XKMA 2IFGA 4ELKA 2H9GA 1PIGA 2HLAA 2X7WA 4H6RA 1NINA 3G1AA 3G5EA 4MM1A 3AOFA 1RIHH 4KOBA 1IR1A 4NUGH 3OAZK 1S7VB 4R2GB 3SDAB 1FZOB 2Z6FA 4IGBC 4Y9BA 3DRQA 1XFCA 1GGTA 2WYTA 3GW0A 3AU1A 3WBDA 3Q45A 1OADA 4X4ME 4KZ0A 3D25A 5E5UB 2XQYK 4NKIH 4HYVA 4HIQA 3UYPB 3NIGE 2DZPA 4PGCB 2DMHA 1BG9A 1LRNA 5LHFA 3I9PA 3CFUA 3DERA 4G6ML 1LQ2A 3D2UA 3VXSD 3PWPE 4R3SA 3X14B 3CXOA 2XWRA 1M7DA 4FQHA 2XWZA 2DIBA 3N44F 2EPNA 1RK0A 1HCFX 2IMMA 2ZOOA 3LD8B 3KLSA 3QJFB 2IBZY 3RWJA 4QKTA 5IB5B 5D1QA 3SIMA 5A8OA 1KD0A 5IESH 5EBUA 4Y4KC 2C1OA 1KPUB 3IDYC 2A2QT 1PY4A 3RX3A 2VLJD 2IDUA 1GAFL 2V5JA 4TTDC 1ECQA 1P9MA 3RTLA 4QGCA 2XN2A 1L9MA 4S0HA 4GMSH 2FPTA 4X6CA 3GTHA 3WLNA 4FQ2H 1D3HA 5LYRA 1H6TA 3N91A 3CFBB 5CAHA 2HSIA 4NKQB 4AV4A 1E2WA 4UIKH 1VQTA 4HJJH 4I9TA 2VZUA 3C8HA 4JFED 2HFEA 2I32A 2YD7A 3FHQA 2Y6TE 5DRXA 1O6IA 2OMWB 1T04B 3D85D 4Y1AB 1X7QA 4OIAA 4E0CA 3HGJA 5I75B 2LU5A 3HURA 3BFWA 3KPPA 4FTVD 1GYNA 4BHYA 5DJCB 4JE0A 4PYHA 4R97B 2F84A 4XMKH 4I5XA 1DFBL 2A9CA 3WOVA 4CVZB 1WAAE 4F7TB 3JV5A 4NAJA 4S1DC 2NR6D 4ODSL 3KYNB 4BSWB 1F3DJ 1V3MA 4LOEA 1TIUA 3QAQA 5HJ3B 4WRHA 2WKOF 2EPOA 3TN0A 2C4FU 4RX0A 4TV3A 3I3DA 4DRSA 3HBZA 3LS4L 1S7VA 5CJBA 5DMIH 4N8VB 5FKPA 3SDAA 5KVDH 5IQOA 1EJTC 2CUHA 4H25B 1P5VB 1B5TA 1C8PA 3INPA 5JXQA 3Q6FA 2CG9X 3QW9A 1AMXA 2ZX7A 4MCYB 3QPEA 2HXAA 4ATTA 1TZGL 5G4EA 2EG8A 4R4FH 4GKSB 4PI0A 4PJHB 2OB3A 5I00A 3GINA 4U49A 3II2A 4GLRI 3GXUB 3RE0A 5IUCA 3M0JA 3S4TA 1F4YL 2R0WH 3GSVA 1Q1JH 2UXVA 3GIZL 1NJ9A 5F7DA 1D9KB 2CU9A 4K55A 3VAVA 3C09C 4JANA 2V2TB 3BUVA 4PTVA 3WLQA 3U0TB 2YDQA 2V3EA 4QHUB 3DROA 3BGMA 2HRWA 1T99A 2TAAA 3S98A 2D2CC 1XICA 2Y7FA 4U1KB 4L65A 1Q0YH 2OTDA 1QLEL 2DJLA 5LIUX 1NP0A 3VUPA 1TENA 2WJ7A 3LNDA 4OGXH 4OU3A 3ITOA 2KLSA 3Q44A 3G1YA 3WQDA 3KBPA 2K8MA 5HYJA 3WY2A 4A6YH 3QORB 3L48A 4M5ZL 3FONA 4JRFA 5D2LA 5TDNA 2XN9D 5FHBL 3KWUA 3II3A 3MODH 3WFZA 5AG8A 2J8FA 3SY5A 4ZEPA 4XMVA 4BWUA 5F4XA 1EJ6A 1SYTA 3OQ3B 2J7CA 4IPLA 4GW1A 4P3WA 4U05A 1KTJA 1L6PA 1RUAL 3LKQA 5GISL 1IAII 3BD5A 1GYUA 4MMXB 3A3YB 2Y5JA 4J3OG 3KGUA 2FWOA 8CGTA 4DJDA 1JPIA 1QFHA 2F58L 3HAEB 1EO8L 3CYVA 1UM4L 3HG1A 3RJQB 3D9AL 4OV5A 2EDWA 5CPMA 3RTQC 4XC3L 3PJNA 3RZCB 2QYGA 1EHKB 3E2VA 4HXAL 1V6YA 5J5RA 4AL8H 3BVTA 2E25A 2OYPA 4LDOB 1GMEA 3BGFB 1WYIA 5HMEA 2KZKA 2Z35A 5A2LH 3CLEL 4F9DA 1FWWA 3P0VH 2G4EA 2FZ3B 4OJFH 4H5SA 4N8VA 5TK4A 5G2WA 4NFBA 3ZRFC 5C6WH 4I1RA 3S8WA 1WB0A 2VSMB 1VFLA 3WI9A 4ICCX 1DBJL 3WNLA 4AQ1B 2WM1A 4F8LA 2DH3A 1WUFA 2J4GA 1JPFA 1KCVH 4TTDD 4L23A 1JERA 3LEYL 1I8JA 4UTIA 4XBEH 4BZ1H 3NJGA 2P8PA 3X13A 4AIEA 1CZ1A 3WO4C 3TCTA 2ZX5A 1J6OA 4XD5A 5EUKA 2I07A 3FQNA 1H1NA 3CFQA 4LUIA 3OF6A 2QCHA 2GOUA 4AZBA 4O15A 1X39A 5CKAA 1FGNL 2DORA 1TCMA 1N7MH 4OZGA 3NSMA 2F74A 2VO8A 5B7YA 1MWAH 5BZXA 4GBXC 1DVFC 4HULB 3IGXA 1UIPA 3I2CL 1RSFA 4IOIA 2C7FA 2NUPA 1Q7QA 3W5MA 3MBWA 1WLHA 2MQGA 2GTWB 3WNNA 4GG6A 4F2UA 1AGCB 5T5FH 3ID7A 5KZ6A 1KBLA 2QVMA 4JZJA 4ZQRA 4RFNB 5CLWA 5EOCL 5SWZA 1DBML 1X3DA 2HT3D 4YHYB 3TEWA 2PURA 2HPMA 3MJWA 3RVTC 2DZXA 3UG8A 5F7WC 2Y24A 1Y0LB 2Z4TA 4QJ3B 2QT3A 1Q90A 1V0KA 2AEPH 3VFMA 3AIWA 2DD8H 4PJ7A 5IW6A 4NQTA 4JYDA 5KZDA 4PJGA 2OW7A 2QHRL 3GI8H 4I1PA 2V8ZA 1YYML 3VA8A 2CBUA 1YXYA 2CA3A 2WCPA 3ZPDA 1IGMH 3H2PA 4DPBX 4F93B 5JMRA 1QA9B 1JV5B 5I66A 2QGYA 4C4KT 3T8LA 4L4TA 3TEYA 1BZOA 3ECWA 1YMHB 3RHWF 1XGPB 2OMXB 1RSYA 4X9YA 5JW3L 2VLRA 1KXTB 3NQKA 4OJFL 4ZFGL 4K3EH 2CAKA 4A7TA 2HUEA 1JL8A 3B03A 2DQGL 5D93C 3U30C 3PZUA 4R7NB 3GI9L 3JYCA 4ECNA 1OAXH 2Z35B 3ABMB 5AW7B 2HEJA 1NPNA 3GSRA 4PJ5B 3ZE2F 4PGDB 4J2XA 4DT2A 3HCVB 4L8SA 3W1NA 3I85A 3BT0A 2Y70A 4OBTA 1H11A 5D38A 4LCQA 4P9ML 3V0DA 2VRJA 4Y4FD 2CO6B 5GGSB 1NDMB 2RFXB 2XPZA 5GZOA 4X6EA 1XGRB 1HSBA 2OODA 2ADJB 2J7EA 3AZTA 4E8GA 2NQZA 2MMXA 4JM2F 1XBXA 3EYOB 2GZXA 3QQ9D 3WLOA 1GGIL 3NP4A 4J2MA 3GVRA 3MTXA 1XBYA 3BLOA 3FTXA 4BFAA 3B2PA 3I6LD 5CBBA 4AQAA 1A7PL 5EU4A 4K71C 3PULA 3UZVA 4PUBH 3U7YH 5E08H 5HI5D 4LYPA 3RPMA 1PBYA 3UERA 1JXKA 1ZT7A 2QAFA 1EJ8A 3WTSA 2P7TA 2WINA 1A6PA 4Z95L 2E7LA 4A66A 3W6YA 5JH1A 3MOAH 3R0UA 4BFNA 1CE1L 4OV6F 2VDOH 5BS0E 4AJYV 2DQEL 2MQ3A 3OSVA 2ZA2A 3BCJA 1MLCA 5E9DA 3TN0B 5EEWA 2AL2B 2VC5A 4N4PA 1P1ZB 3S88H 1ZIAA 3WS6C 4JM2B 4F58H 5J89A 3W56A 1XLHA 4HB7A 3TE9A 5E7BA 4NVTA 3NH7L 1EYEA 2AI0H 1TU2A 3BH9B 3LKOA 2EICA 3P3UA 4EJ1C 3G08B 4N86A 4B9CA 2FGLA 5GPRA 1J0YA 4K3JL 1Q8JA 3W1UA 5AECA 3RMEA 4KK8C 1NFBA 2ZX6A 1GZQA 4TULL 4Q8WA 5HYFA 1SGJA 5EU6D 4ZS7L 4MA8H 3P82A 1CN4A 1MJ8H 5I15L 1UACH 2C9UA 3AMLA 3H26A 3UGVA 4DWDA 3UR8A 3HNVL 1X1NA 2JF1A 2JKRM 4BEQA 3KXQA 2XC8A 1UD2A 4WUUA 1R9YA 4X4ZA 4NIKB 2XXMB 1W5OA 3WX7A 3V0EA 3NACH 2NX5A 1QHQA 2A1WH 4J3OD 3ZTJH 1JYNA 2E7DA 3CFEB 3TZVB 4K37A 3OLDA 1PY9A 5EOCJ 1UROA 2UBPC 3SDDD 4ZW7A 2FBJL 1W54A 5AC5A 4NM8L 4JN1L 4Z76B 1A0QH 4U6YA 3WFAA 1FL6B 4JQIL 2GVEA 2E59A 4Z95H 3C0JA 4QBXA 5IK3A 4DOHB 2ILLA 5D2NE 2H4EA 4UQ9A 1TO4A 1T83C 4JQXA 4DYEA 2P5WA 2DQEH 4O0QA 1F45A 5EZLA 1U8KB 2KBGA 4PFHA 5T3ZL 1VAHA 3T3ME 1XC4A 4NZ3A 4MWAC 5AHNA 4QEEA 4K2SA 2P0IA 3I6GA 3N40P 2VCOA 5EC2A 4KHXL 5BV7C 2GQ9A 4B50A 3MPGA 3P93A 2A2IA 3F62A 3VI3B 2NCEA 2YKLH 4U3CA 4GBXB 2YXOA 3MSYA 3QGAC 4UUJB 1CD1A 5AKVA 1ME7A 1LP9F 1N9PA 4Z7VA 1OL0A 4BA0A 3WDRA 1E50A 3BQUB 5XINA 5TQ0L 3PJWA 2F6UA 2BB0A 1AQDB 2QS8A 3MRQA 3EOYG 2A99A 5F6IC 4LLYB 3CSPA 3V4LA 4M80A 8XIAA 1JHKL 2B14A 4HS3A 4HXAH 5ENWA 3SE8H 3PY9A 3ZQWA 1LNUA 4HPHA 2F08A 5E0QA 5HYSG 1SVCP 2ANUA 2EXWD 4N9BA 3ISIX 5E5CA 1FYTD 3ATFA 3STPA 4JDVA 2CKBB 3D09A 1MFEH 3QXTA 4R83A 3OAYH 5AOUA 3OGCB 4JZOB 2QTEA 3NQBA 1JRHL 4XR8C 3P5ZA 4QDMA 3TO2B 5DD6B 1RY8A 1UWSA 5DHVB 2H8PB 3CYJA 2NDFA 3QV6A 3FVDA 2OJZL 4DI8A 1IEAA 4EEEA 4UANA 3C6LA 4HUKB 1BWMA 1UUOA 5INCA 3GXPA 1ZXKA 2NY0D 2ZKHL 3T0EE 1GNXA 2ZC1A 3MYJB 3TSMA 3FFOA 3THAA 3FU9A 1DL7H 4G82A 3VX1A 3VFOA 2E77A 1F4HA 2WJ5A 3GSUA 1PS3A 4L5FH 5HMFA 3CVCA 4YDVA 4FN0A 4ANKA 3MSGA 2BNJA 2QVIA 1NSNL 3WY3A 3NZPA 3QPQC 4OGQC 4R4FL 4MZ1A 4H9ZA 5D1XC 4LRIA 7REQB 5JLZB 2P5NA 5TFSH 2I5IA 4Y6GA 4Y5VA 4RK8A 3S3GA 3SSZA 1K3ZA 3GM8A 2YL5A 1GOIA 3GSOB 2AQNA 3PLYA 4HBCH 1Q0EA 3V55A 4LEXH 5B39B 3I2CH 3VGAB 3FO0H 4Q2ZB 1QKZH 3IWUA 3KS0J 4BUHA 1CT5A 3PP4L 4X63A 5A8GA 1DZ0A 2PXYD 3AM8C 4AZGA 4OLYL 3TEUA 3EEZA 4K7YA 1U8LA 2W9EL 3DFNA 4IJBA 5HK4A 3W7QA 3LGEA 3S5LG 4NZ8A 1U92A 2OI9C 3WLWC 2YJLA 4JTEA 1IKOP 3VXNA 1ADOA 2W9LA 4UZUA 2I60H 4BCYA 3E0IA 1KOAA 4YC2C 4MS8C 1KV7A 3OZ9L 3V6BR 4EZMA 3FN3A 3NJNA 1JZHA 2Q2EB 4Z2JA 1IL1A 1JGVH 2QJDA 3M9YA 3QRGL 1XCTB 2EDEA 2JB6A 3K0YA 5E8NA 3KW7A 4NN5C 5IR1A 4ZAKA 3DBNA 1BYOA 1CIDA 3ALPA 2VC9A 3KPRD 2CK0L 1T5AA 1TR9A 3OIHA 4MLIA 1LQ0A 1XIWC 3EB3A 4FKKA 3REWB 1JZ6A 2UZPA 5T3XH 2J71A 1CE6A 4QI3A 1PLBA 2J78A 1T6WA 3DWTA 4H8UA 4LLWB 3L13A 5DJXA 5D4QA 3ULVF 2C18A 1FFRA 2PW2A 1ZGLP 1YEKH 2MHAA 4MNGB 5J11C 5E00A 4S3BA 2FPVA 2J4WL 4M6UA 3ARGC 2ZP8A 3FVMA 3W0KA 2P53A 1MCQA 2CLVA 4LEOB 3U2IA 4Z7WB 1ZE3C 2X0VA 4FF9A 2UY7A 3IARA 3LIZA 2OMYA 5DD1H 4LBAA 4TO8A 3M6DA 4HIIB 2J1WA 4F80A 2FD6H 4E68A 2WMJA 1FVCA 3BDBA 2AJUH 4KKRA 1PDZA 1IKNA 2R2CA 4UDTA 1W9VA 2PDHA 3IJLA 5KTEL 3M4HA 4RNRB 1EH9A 2DWEA 3C87A 3K71B 1JCNA 1MCLA 1WEJL 3VDBA 5IHRA 4HSQA 2CO4A 2QVKA 3DI2B 3N6HA 4DI9A 4HNTA 4LHUG 4G1NA 3DG7A 4NGHL 2IH1A 2R0ZH 2XNAA 4PP1C 1UPPA 3EYSH 3UZWA 3OKLA 3NDZA 3AWNA 3ZWSA 4PODA 3KLHD 4A2SA 1E9QB 1EFXA 5FOBB 3M0IA 2GCYB 5BRZA 4Q97A 1GTFA 1F13A 2FIRT 4U1SB 4K94H 5LNGA 4JPIA 1FWIC 1WUEA 1TU2B 3LKOB 3OKDB 3CZ8A 3KWWB 4DETA 4IIQC 4AYFA 4HKZA 1NCCL 5BO0D 1XDLA 4PJ7B 2P8CA 1FIGH 4CMMB 2JKAA 1FL5A 1Q1JL 1QTYT 3OM3B 2W80C 1X5GA 1NLDL 4XWGL 4GQ0A 1U9KA 5DELA 2PDLA 3AU0A 2ZOUA 2UY2A 4NAFA 3EHBB 4WGWB 2VW6A 4LVEA 2AS5M 1VFMA 4BGLA 3QEQD 1QYGL 4LU0A 4DQAA 4YDKH 3GSXB 2HXUA 3ISWA 3MC5A 4L6HA 4LC6A 3GZOA 5D72H 4DK3A 4MFHA 3A13A 3BP5B 3S5NA 3KBSA 3HZKB 5J1SC 3TV8A 2PGEA 5FJUA 2I7SA 2DKUA 3NQVA 3MRKB 1J4EA 4XO6A 4WUKL 1V5JA 2CC0A 4KOCA 3TBTB 1NGXA 2GEQA 4LLYA 4LSTH 1U8QB 3V5KA 3QBUA 3LEVL 4WW1B 2UUDK 1REQA 4GAAA 4JY5H 1XYMA 6CGTA 4KRMB 4NZUH 4TM9A 2C14A 4JB9H 3ESPA 4QCEA 4GIAA 4TQTA 2QADD 4YHNA 4UQCA 2D9CA 4JG5A 1M41A 5AWNL 1EO8H 1HKLH 3KYKH 1OTUC 4NCC1 4NGHH 5CZVH 1H63A 3TO2A 1KN2H 5GIRB 1A9VA 2V5TA 1OM0A 1BXVA 1R2SA 3PJTA 4KIRA 2LGNA 3P0GB 4EI0A 3PV6A 2WGNB 4H8HA 3WTWA 4JDYA 3MR9B 5I19L 4JEQA 3GJFK 1U95B 3NN8B 4NRZA 3S5ZA 4E9WA 2WJFA 2UY6B 4XNYH 4JO3H 3D3VE 4OLUL 1DVZA 5B1JA 1CB2A 1GOOA 4MFDA 5AZ0A 5E1AA 4XVOA 2GDVA 1V7YA 2GK0B 1GY1A 3VKJA 3I3EA 3U6XA 1G4PA 2D4DA 5DXYA 1CLVA 1IARB 3CHCA 5EEVA 3RMJA 2WXLA 2DSUA 5M7QA 1E1CB 2JJSA 5E93A 1YC8A 2DTML 3MKVA 2P45B 4F7PA 1LILA 5TJWK 1OGTB 5DD5H 4YJ5A 9CGTA 1W3JA 4P7QA 2OLDA 3BPNB 4EBQL 1Q9WB 3VXME 2QV2A 4NKIL 2HJFA 4NXSA 4PJBE 5A8PA 1X9RA 2E9WA 4XVTH 1DLFH 2ZG1A 4QRBA 4BR1A 2YSSB 1NOWA 1CK0L 2VHLA 2FHCA 3F05A 2VQTA 4BRJA 4MWAD 1T6BX 4BH8A 1HINH 3HAEH 4NNXA 2R1YB 3BSZL 3AWGA 3OHXC 4R5TA 3GVVA 3VXTB 3WXVH 4DEWA 1J9YA 2QJMA 1VPOL 1EOMA 1ZTVA 4OVUA 4WW2B 5BW7A 3IS1X 4DW2L 5T5FL 1ED3B 3ESUF 2EXOA 2XINA 4P23A 5FO9A 3T8MA 3TA3A 2OXGA 4C5ZA 1N0XL 5DQ9A 2EVJA 1KRCC 1JZFA 5EUOF 4XD4A 1A9EB 4QPEA 5IHSA 1CLOL 4GXUM 4UNVA 1UXSA 1KGYE 4XP1L 4BQ9A 4FLQA 5C7ZA 2V9DA 5DO2D 3N85L 3N9GL 5IMLA 4HQQH 4QG8A 2VUOA 5LBSH 1JPSH 1T2QL 1CICD 3P40A 1HXJA 3QR3A 5CJOH 3GNMH 2HJPA 5JNYB 4M82A 4BF5A 4ONGL 3N06B 4OJYA 1WCGA 1KC7A 4RGNE 1KB5H 4MNQD 4HKJB 4JJ5B 1RA5A 1TV3A 3C8KB 5K9XA 1IM9D 4RGMC 5I3FA 4S1RL 1I0DA 2VR4A 1XCQA 4JDZA 4XO7A 1NFDF 1O7DC 2RD0A 5FYKU 1KKOA 5EZIH 1EBPA 1Z5YD 2PZ0A 4DP7X 3W7MA 3SCVA 1XB6A 5F1NA 3OJMB 4K7FA 1B1YA 3NCWA 3MXWL 1NUFA 3C0QA 2KDYA 4ZUWA 3TOYA 2XM2A 3QHFL 5AZEH 4BZYA 1YPXA 5IP4A 1AJ0A 2G3JA 4YWGL 3BKCH 1RMFH 4LSQH 3WJYA 2P5EB 1I1RA 2D03L 4JPWH 1N8ZB 5ID0B 4OI7A 2HK1A 1BM3H 3CMOL 2QVNA 5F0JB 3M0ZA 3THCA 5LGJB 2VERN 4CNPA 2J88L 2VDGA 1YHPA 2FT8A 2HCVA 4LSSL 4I90A 2CBJA 1FNSL 1HKMA 3L3GA 3AUVA 3WFCH 4IGBA 2N7BA 5HMSA 5TF1L 2HRGA 2UZIH 4NSKA 5I3GA 2VM4A 2ZXEB 1UADC 1EZSA 5IOKA 3H2AA 4YX2L 2E4TA 4AYGA 5DSCB 2XQBH 1WT5C 4G8GA 3AACA 2FE0A 4NJIA 1OM3L 3S96A 3EB4A 5DD6A 1YECH 2IF7A 1Q0YL 2VLKD 2FYYA 3B9VA 5FV1L 1KCWA 4XOEA 1E5JA 2HRPL 3SCNA 1R9FA 4Y4KB 3UABA 1I85A 4S1QL 5I28A 4B5VA 1KTRL 5FGRA 3IGKA 4K8EA 3FNKA 1KB5L 5MP6L 3GSXA 3CVHL 3PAVA 3P0WA 1MUCA 1Z44A 1P6WA 3RK8A 6REQB 1NCOA 2HT2C 3HLKA 3OG4B 2GL5A 4QOKD 1KJVB 3HMXH 5E0CA 5D02A 1IM9A 2BCMA 1OSZB 1YZZA 2WLNA 4PGDA 2Z92A 2OLSA 1JMXA 5F1SA 4DXXA 3FDGA 1WEJH 4HG4J 4IBUA 1NEUA 3MBED 4H83A 2G96A 1HP4A 3LM7A 1XSOA 3HHMA 3ZZLA 2JB5H 4KTDL 4NZJA 2XN9B 1I60A 2DIAA 4Z6AT 3B0XA 1SW7A 3CE1A 4NUJB 2YAPA 3T0EB 2YL9A 4C56A 3L7FB 5TDOA 5EU6A 4XP6H 5DQDH 3QQDB 1C8XA 4UDUA 3P3RA 4LHQB 1OFEA 3UQNA 1URZA 4Z7NB 4U1MB 3ZIMA 1E3ZA 1CPUA 1NC4B 5CJXA 3GMPB 4U2ZA 4S3JA 3QCVH 3IGHX 3RAOA 3WAKA 1HXMA 4GZIA 5TAOA 2K6YA 5BO1H 1Z9LA 1IXNA 1OYAA 4LIQE 2BSSA 4B9KC 2QZQA 3DJTA 2XG4B 1S7UA 2AMUA 4LL1A 3FBKA 3U9UA 2R1LA 1VFAA 4FD0A 3OP2A 3DGGB 4L3EA 3ULVH 5G1YA 3MBWB 4J3VA 3N2JA 4NQEB 4RMRA 5D8JH 5CU5A 4QF1A 2Y88A 5F71A 4WJ5B 5EO0B 4LLWA 4PWGA 3F65A 5J1AB 3U30B 5AG9A 4N2YA 4WDUA 5EIQA 2ZE3A 4OUUB 1JK9B 4OFVA 3CTLA 4LF2A 2WHJA 2X44D 3UR2A 3T3MB 5IT2L 5B80A 3BGJA 4WNJA 4QRNA 5DS8B 1NBVL 1TNNA 3KBWA 3TESA 4OLXH 3P4NB 1F90H 3KTXA 4HU0A 4TUKH 2GIMA 2W3ZA 2HPOA 5D6CB 4WZHA 3ARDD 5A8NA 2D7QA 4OIFA 4EDWH 5HUPA 4DH2A 5ADOL 2PCYA 4LPVA 3IKKA 2CBMA 3E6HB 4PY7A 5FEWA 1Q9OB 1WV7T 1KGCE 2NYZA 3G6JE 4FLOA 3NDOA 5A6SA 1CCZA 4NIYE 2DKMA 4NZFA 3TZVC 1YEHH 5JIMA 1GVQA 2P88A 3FKKA 3N18A 2FBRA 1OAZL 2XJKA 4AEIL 2CBTA 4HNLA 4OZFA 1XL9A 2XFXB 1DVJA 5EU9A 3SGJA 1C92A 3G5ZB 1WC7A 1BD0A 1WF5A 2OMTA 2YAOA 4LCYB 1HNFA 3UCRA 1J79A 2YA2A 3AIUA 2F8OA 4AENA 1XGYL 3U1PA 1FYTA 3DBXB 4AIZB 5I79A 1ZEAH 1OEPA 2PA6A 1I8IA 4X6DA 2NY0C 3QR2A 2JI2A 4J1UB 4RBPH 2V7NA 4BK4A 2F8IA 2E9LA 1QVOB 3GRWH 1IAKA 3WNJA 4MAYD 2YLLA 4I0PB 4Y4FB 4XO5A 1QI4A 5I3KA 1MLBB 3VNZA 2A6IB 1D9KA 4L9DA 1SZNA 2X41A 5T1DH 1BLNB 3NZ8B 1FWDC 1GVRA 1GZHA 3CZGA 3MV8A 4HEPG 2WBKA 1GQJA 3C2SA 5I8CA 1ZALA 6TAAA 1OF6A 3U9UB 4X6CF 4EOUA 2VFGA 1QUMA 4L56A 32C2A 2ZXCA 4HJ1A 2Z91B 2WNWA 1N3NB 4OWGA 1U3ZA 3JBG7 1KJ2B 1AZ2A 1XYAA 1YMMD 1UXWB 3S35H 3U0PB 3D07A 3LQAL 3TVMB 4BH7B 4E41D 5EB9A 1IT9H 5E08L 5JXAH 5AKTA 4PMXA 2JFCA 4NPJA 2XCMC 3PZNA 4YXLH 1JF1B 2YQBA 1XF3A 2O5NA 3LJ3A 3PDDA 1KFLA 4UB9A 1JHTB 5JUEL 4KAQH 3P84A 1XLEA 3BJ91 4XNQB 5IM7A 1EJRC 4S1RH 2IMNA 1PNDA 4DUXA 5B3SB 1NIEA 3HVDA 2ERJB 4K0OA 3L81A 3QUGA 4H1ZA 1UP3A 2J8UF 3O0RL 1I6NA 2WVVA 4G1KA 4PRIA 4HWBA 4RE3A 4GO8A 2H32H 5TNVA 1ZPLA 3TC9A 4E41A 4UT6L 1B90A 1NFPA 4AEHL 2PDYA 4N9CA 5D96C 3S1XA 3VKAA 3HN8A 4FLHA 3FT2A 3SBPA 5I8OH 2YD9A 5CN1A 5AAWC 1IGTA 2O9RA 3IXTB 1FFTB 3Q5YA 3QZBA 4GUPB 4BSJA 5IEKB 2WXRA 2YXWA 1I9IL 2EKCA 4IX2A 2C1OB 4AVNA 2YGVA 4E9QA 2OFJA 2GUYA 1GJWA 4GGBA 3HUJE 3DI3B 1OYBA 4IL2A 2HE5A 4NILA 4MA3A 1XIMA 1L6YA 1BQRA 2JH2A 1X4YA 1HIMH 1K4HA 3HW7A 3GF8A 1UZGA 3V7MA 3DIFB 3CFBA 2ARWA 4LQ1A 3FO9B 5D9SB 1CGUA 4H3DA 1P69B 3TW7A 2EC8A 4EAYA 3S35L 2L7EA 3Q67A 1M3IA 3S2CA 3MJ8A 4FAAB 2E5CA 2QFRA 1UZDA 4UTAH 1BVLB 2GBUA 3L0NA 4U7MA 4ZNEA 4RDQF 1DQMH 3XIMA 3CAQA 1DKWA 1DSFL 3GJFH 2WOYA 2VDKL 2EEBA 3IK2A 2LE9A 4YVXA 3KPQA 4BCEA 3EH5B 4X9BA 2CBIA 3I6GB 3KEHA 1FH9A 3C5ZC 1FLRL 1WPCA 1VGEL 5CINL 4KTGA 3EF4A 3KPNB 4JO2H 4MTMA 4GEJA 1CXFA 1PLGL 3BAKA 2YCIX 1BA9A 3NXFA 1AO7D 3V0SA 3NSFA 1BG4A 5A2KH 2OZTA 4PCPA 1Q2SA 2D9QB 3MO4A 2JI1A 1IILE 4DPRA 3GR8A 5CEZD 3N4AA 4ICMA 5EU3B 2JQZA 1H5YA 3HN3A 5I16B 3BDYL 4RX4A 4R9XA 1PYMA 4PA8A 5EMMA 3QZPA 3VRIA 3RLUA 2GJ6E 1EBHA 1E9LA 3B9KC 1WBZB 3GAKA 5JA9A 5IV2A 1XJBA 1YPZA 1R2TA 5M3WA 1I9JH 1UJ3A 5D1ZB 1OAJA 1JPHA 4XV0A 2Q1EA 3SDCB 4AQEB 4DZHA 5LGXA 4MNQB 2AABH 4RNFA 1RD5A 2Z1XA 4XN7A 3HB9A 3MRPB 4Q6IC 3VWJD 4YFLI 2ICEA 3ZDYE 3VI3A 2XACC 3W2JA 1EUAA 4GBDA 4QRPA 2ITEA 4OH2A 1VKXB 2R0LH 1BYDA 4MNMA 1WAPA 4G1EA 2KI6A 3BSGA 1FWTA 1W1B1 4O02H 3G6JB 4DWSB 2ZUQC 2J57A 4R2GD 4YLCA 1D5ZA 5IFJB 2EUXA 3D0LB 2QCMA 3EA2A 4OUEA 3VZZA 3L1OL 3DFHA 1MH5B 1QPXA 1UB6B 5T33L 5EGRA 3E2HB 1G7PB 5BO1L 4BQCA 1KIRA 4EI6B 4W8LA 3BP6A 1Z3GL 3P2BA 4GQPH 3UY7A 4TVPL 4HSAC 1ZAHA 1LCOA 4FTVE 1FVDB 2FIKB 4W86A 1BX2B 1Q9LA 2HMIC 1JDFA 1F97A 5DQ9B 1K02A 2AQOA 4P5TA 2DSWA 5KZMA 3GH4A 5LNDA 5I1JH 5IESL 1KCUH 5LLIC 3ARZA 3ABGA 5LN8A 1M3UA 1QPQA 2GSGA 4INFA 3HKZA 2X38A 2WY3B 1V7AA 5E8OB 4LCWB 3IRZA 4MYPA 2IQAA 3NFNB 5DZPA 4ADSA 1YYMH 4GABA 2HXTA 1CT8B 1FNHA 3GXNA 4LTSA 5FCZA 1VIWA 4NQCE 1DV7A 3LH2L 4Q8QA 3MODL 4FJYA 5E1AB 4N25A 1LWJA 1R3IH 3FFCB 3P8IA 1X5AA 3GGWB 4UQ2B 2AJZA 3IS0X 5FYLE 4IRSA 3UADA 2F9RA 1O4UA 2IQ0A 3BQUD 2J1XA 4FKHA 1IC4L 4XP4H 4YLQT 1ORQA 3FS9A 2JKWA 3CO8A 3WFEL 1LDPH 3UAJA 3G04B 3IFOB 5J12B 4ELMF 3FL7A 4IU3B 4UFJA 5DYOA 4MMZB 2R8SH 3GSMA 3LIUA 2AHIA 1CB4A 1N0XH 3RR1A 2MKWA 3T71A 2XKNA 3CJJA 4OJDH 4BWWA 4QHMB 3B56A 4XCFH 1DQQB 3MLZL 1X7IA 4M48H 4EWJA 3H2MA 2NDGA 3GK8H 3VZYA 4YTTA 5GZNC 3W2NA 4IOIB 3VYPA 4C58B 1NF0A 4PTXA 2DUXA 1NFIA 2XXFA 5BPPA 3W1XA 1QPNA 3W72A 4DWHA 5IIEB 3C5ZD 4N02A 5AVXB 1F86A 4J4PC 1OARL 4XHJC 4D1JA 3TV3H 5EB8A 1IT8A 3AU2A 4DJDD 4UIOA 3NGBB 1J8RA 2XPYA 3QUYA 1M7DB 4FQHB 1HQRA 4QTHB 5FFOA 1UMYA 4G5AA 4CN6A 3DGGA 1E9PA 3LTVA 3W84A 3BO9A 2YZ8A 4J3WA 1GOHA 4WIQA 2K8QA 4UFKA 5J6SA 2OCZA 3TMLA 2YRPA 3PXJA 2FWLB 5BV7L 1VFBB 3NA9L 3BO8B 5JOPD 4FALA 1S7TA 4AM0Q 3QP3A 2CHWA 1RPQA 2DQWA 3IJQA 3VIJA 2KX9A 2VKWA 4R0LC 3QEUB 1KCKA 3FC8A 1SEBA 3CUZA 3OGRA 4IBYA 4AKOA 4ZE4A 4I5BA 4PV1C 2X4TB 3MRFB 3VCLB 4H88H 4AQZA 2E3ZA 4CVXA 1IT9L 8FABB 4NAEA 3Q7JA 2YFNA 2YAQA 1H3PH 2CNZA 3ULVL 4W1TA 4AZ6A 4TYUA 4AUBA 5E8DL 3O3AA 3FTUA 4HNCA 3HS0C 1J9CT 3SCQA 1Q94B 1MWAA 4FFYA 2PDFA 4R7DA 2DB8A 2XWTB 3B7SA 4OQTL 4UUJA 3EX6A 3PL6C 4GYPA 1ZDSA 1XAUA 2YZ5A 5E09A 1XLKA 1WXZA 3KW3A 1RKRA 3ARDA 3MUY1 5B4MD 1KGUA 3EHBD 1IEWA 2OR2A 4OCRL 4TVPD 1TTCA 1TTUA 2P5EA 1Q9KB 1EX1A 1G7UA 4KFOA 5KSWA 3VTTA 3FV9A 1P7QA 2WN3A 3HZKA 4NHUB 5D5ME 1ZS8B 2B16A 4GKLA 3TPUB 3HNVH 5L7XH 1BRLB 4P4RA 4PG2A 4KWUA 1UA6L 5HHMD 3QSKB 3VH8B 5K59E 1LRTA 1PZCA 2XKNB 4GUJA 5B21A 2GGGA 4L1XA 1R24A 4AWEA 3ZR5A 3CPUA 5ACZA 4M5PA 4Y9NA 4FULA 3WQCA 1V5XA 1INDH 2CHDA 1SFDA 3M16A 2XIDA 1QFWL 1YEJL 4HETA 3P74A 3T0CA 3TAOA 1DQKA 3E74A 3OVQA 1NPJA 4JK0D 3QJAA 2A5UA 3IJHA 5HINA 3S96B 4U7KA 3GNOA 3ZO0A 1TCRA 1T7XA 4F5CA 5J1TC 3HPZA 3QY8A 3MVSA 3APTA 3GG8A 4F7EA 2ED9A 3AWEA 3OXSB 4G9FD 1L8NA 3B0YA 3EOEA 4OAWA 4P4KC 2G50A 3GG0A 4P8QA 2ITFA 5FIPA 1F6LL 2ONEA 5E2WL 5EDSA 1QR4A 4O2EB 1H0DA 3EH4B 4GRWF 3HAEA 5D1ZC 4XVSL 3WUWA 3VRJB 3HS0B 1E2VA 3IAPA 1NDTA 3M7OA 1QZNA 5J4MA 1ML0A 2VWTA 2X2GA 2Y0FA 5G4HC 3BZEA 3LENA 3TBWB 1GIGL 3IE9A 1P0EA 1DQML 5LIKX 3VFLA 1WG3A 3QDJA 3TTQA 1SYVA 7PTDA 2I17A 4HF5L 1DWIM 3PQYB 4R85A 3VCCA 1RUPH 4P2RD 2W0UA 3Q13A 4Y1TA 4A6GA 2CLHA 2ADFH 4D9QE 3B2UD 1Z1WA 1LL6A 4BSWA 3GO2A 1UWIA 1W5NA 2BSTB 2X9YA 3U46A 5K9JL 1RALA 3SPGA 3W9DB 4HZ6A 4MPKA 3V0WL 2Y7QA 3KCPA 4NAMA 2F5BL 2ZAHA 1GC1L 3BH4A 1CFVL 2GTZB 4OV4A 1BFVL 5EOQH 5ICUA 2GJNA 4ANXA 3ESNA 2QCDA 4DKAA 4AIOA 1ZAIA 3WQPA 3MLVH 3QDMB 2QVTA 3LS5H 4Z0XB 3SY0A 5CEYA 1PHQA 2QSVA 4U1LA 5DEFA 2CWXA 3UCCA 2V17L 4HJFA 3UVAA 3DYOA 4M3HA 1URLA 3QOMA 4P2OD 4GLRH 5MEQB 4Y1SA 1YRKA 2E46A 2P7TB 3ARRA 1PCXA 5BV7B 4H9MA 4OZHB 4UMGA 3VSQA 2VEFA 3JTTB 2Z31A 3SBQA 1KFBA 3LXBA 1M1XB 1NGPH 1UQSA 1XGDA 3KPNA 4GI8A 3V4PH 4AZ5A 4G71B 1OCZB 3GD1C 3M17B 1CFQA 2YBRB 4G3YH 1GOQA 2WMIA 2WN2A 2MH4A 2WXOA 3D3VB 3K13A 4HKPA 3PG8A 1RZJL 1D5IH 1M9WA 5BUGA 4JHUA 1KNWA 5CMAB 4LANA 2H3BA 1H0GA 3K2MC 4DUVA 3WIFA 3GS7A 3K4WA 3GNML 1JDCA 4P9MH 1Q63A 3SKMB 3NZRA 1NMBH 3TYFA 4IQLA 3WDPP 1TZIA 1QRNB 1GQNA 4N6FA 3QZOA 4PY8I 5DQJB 3T05A 5H8UA 2J9XA 1DSWA 1S7QA 4AD1A 4LEXL 3R79A 3R1GL 2Z34A 2QPFA 1CBGA 1BKHA 3MMUA 1ES0A 4IKKA 4PUEA 4Z2IA 3VCNA 4XZIA 4ELDA 1A0CA 1CW2A 2JMRA 1M4KA 1KTLA 4M8UA 1K72A 2ICCA 4A8RA 1CQKA 1PU0A 2YPKA 5G4OA 3C8NA 3R43A 1PG7L 3LLFA 1NAMA 1PKQB 3O6DA 5IEHB 3ZHKA 3PB2A 1WCBB 1T1ZB 5HGDA 3U3HA 4F9JA 3ABZA 1J0ZA 3PL6D 1TYGA 5C7VA 1P1VA 3DJRA 5DK3A 1GY2A 3QXBA 4QT5A 2D2OA 2APBA 1OAKH 7TIMA 1PQZB 3MOQA 5E1QA 3D0AA 4JKNA 2GC4C 3COOA 3MUJA 1XSIA 4O5LH 5ITFA 1LBFA 5IB4B 5ITBL 4JFEE 4U1JA 3QM3A 3WMLA 2CBOA 1DVSA 35C8L 3KPLA 1R87A 3QN3A 1K9DA 1E2ZA 1UATA 1UB3A 3QWRA 4EUPG 3PZ9A 1E6OL 4M93C 4FNQA 3DKJA 1KWGA 4CD5A 2J8HA 4NHCL 4KXZH 2GQ3A 3A5FA 1OE3A 3NH7H 1VHCA 4H00A 3WKMH 4O12A 3FA5A 1DBAL 2I1OA 4US6A 3EYQC 3LZNA 2VJ0A 4MXWL 1Y6MR 5IFAL 1IGSA 2XFFA 2BNRE 4FXFA 3QW3A 1RURH 2CHRA 3TR9A 2Z1SA 2W0FB 4B9YA 1T1XA 2CDFA 3C3NA 5ABGA 1QD0A 4OCSL 4GUOA 3OHIA 5GGRY 4N5UA 1LXMA 4OGAD 4DJDC 2WSQA 3ZZSA 4B90A 2V4LA 3CLFH 4HK0A 4JUTA 4X4MA 3BURA 4JTUA 4ODBD 3OZKA 2IPKA 4I0KA 3Q1EA 1V05A 4OFYD 4WQOA 5D7JD 1DJXA 2VL5B 1TWZA 4FX8A 5K2ZA 4JE4B 3FH7A 4L4VB 2A73B 2CJSA 3MRIB 2UXTA 4WY0F 4DJEA 1A7OL 1E4XL 3QQ3A 5SWSD 5CD5C 3JSSA 3O45B 1XF3B 4CKVX 1GQKA 1X38A 3FRUA 4YIQA 3VFUB 2FJKA 2X3AA 1KEML 4UXDA 2Y72A 3GHSA 1JR1A 3VG9C 5AHEA 2ZF8A 5KETA 2DWEB 4MNGE 4P3DB 1LQSR 4JM0A 2R27A 1A1OB 1FIGL 1ITQA 4EUPH 1ZGDA 3KHOA 2H9AA 1QPPA 4DXVA 1VCGA 3P67A 2WXIA 3B3IA 2DSKA 5IB1A 5L9DL 5IROD 1KNOB 2EH8H 2NY6D 3T78A 3L7EB 5ECGA 2Y5SA 3ES7A 3HZVA 5HVGB 5HPCA 5C6PB 1A50A 4W5UA 4GD0A 2I69A 4NN6C 3CSBA 2X9XA 1OB0A 4G7VH 2OZNA 4U0RB 3UAEA 4C55A 4A04A 1ZBWA 4S3GA 4X5LA 2DZWA 4MJIB 1TWDA 3BAXA 1YC7A 5AB0A 4B92A 5FF6B 3VIPA 2IQ9H 3BZFA 4PV9B 2V3GA 3PUOA 4HK5A 4QE5A 1CLKA 1DJGA 2Q2LA 5FGCE 3LH2H 3VNDA 2X40A 1A4CA 2YQGA 4D8AA 4BXSV 1U58B 3EJJX 1EL3A 1WBZA 3KBEA 1L7IL 1V0MA 3ZKMD 3RWEB 2X1SA 4WSKA 1G84A 3WSQL 3STCA 5DRCA 1RZMA 4K5MA 1UR0A 1D6VH 3MGAA 4N6EA 1NGWB 3K4DA 3ZE1E 3QZAA 4TQHA 2NV9A 2ICEB 1I1FB 2IBGA 4IGNA 3W7RA 5LBVA 3E6HA 1LT8A 3ARDB 5F0LB 4Z2GA 4DP6X 2NNXA 3EAUA 3FU6A 2NW3B 3ZZ1A 4HPYH 4OSUH 5IR1B 5DD1L 2EBNA 2YYTA 4F33A 3TO4D 3Q6GH 5IF0A 5ADOH 5JW3H 3MACH 1XGRA 4NZTH 1LG1A 4MG4A 5HI3D 4P5SA 1TUPA 3T8VA 2K0RA 4LVHB 4X7SH 1A3LH 3OHXA 4M8QA 3HAEG 3PWUA 4DPCX 1IFGA 5T1JA 1HJWA 4I9MA 2VXTL 2A6LA 1G0DA 4ZUUA 5LXXA 2XGZA 4WWKD 4DP9X 1J2WA 3QZWB 3L08A 2AABL 4IUGA 2OXNA 2VR6A 1PKLA 3PWAA 4XE0A 3TVMC 5C0IB 2NTFA 3AROA 2OWXA 1XC6A 3MJ8B 4GS7C 5K39A 2ISFA 2YC1A 5KYUB 2BASA 2HVOA 4JXCA 2H1PH 3NUKA 4YCOA 1LO3H 1OLLA 1RUML 2FFCA 1B3JA 43CAB 4QRUB 2ZXWB 2R8WA 3C60D 1CD1B 3W75A 4IFKA 4X99B 2R7EB 3CFJA 2MANA 5DRZA 1U8MB 5DMYA 5DJDB 5FGBC 4IQEA 1FQ0A 4YTSA 4FI6A 3MLVL 4NU7A 3N04A 3WJMB 5B38A 5DEGA 3ALGA 5FJTA 4PJFA 5FOJA 4X5RA 5HDWA 1LNUB 3B9AA 2YXGA 1CFMA 3RFZA 1T7YA 4X6CB 3SPIA 1A0EA 2JQAA 1MHHA 3BWUC 3UTSB 3KZPA 2DW5A 3ZMNA 2QADC 3S34L 1ROWA 2A0LC 1K4DA 4GGHA 5GRWA 4LIQL 4JFQA 1KM3A 3LBOA 2F6XA 5I73C 4OCWH 1AZCA 4DJMA 3A4DA 4OZIF 3VE0A 3W9EB 3F5LA 4I77H 3HE7C 3GMQB 3IDJA 4MD0B 1PZ1A 3N2MA 3MCG1 4G9DA 2WUCL 2P8LB 3UJIL 5IOPB 3TZVD 1QPKA 1AOZA 1XLMA 4LY8A 2QCDB 1C9WA 4XH2A 3GRGA 1B4JL 5I8KH 4DGIL 3QRLA 3N17A 4X61A 4UQDA 2NOYA 3V0HA 1BREA 3Q01A 1BAFH 5GJSH 4UTAA 3WD2A 5HGDB 4E41B 3SOBH 3HBGA 3M8OL 3PWLB 1R33A 3V0VB 2DJUA 4OKVA 5E03A 4BHUA 1A3RL 1OWWA 3IDMA 5EIIG 1F3JA 1ZIBA 2EVFA 3C2EA 1UD5A 3C09B 3WMQA 4KETA 3O0RH 7XIMA 1SF3A 4QGYA 4W9CC 4XE5B 3KBJA 1YTEA 2F53D 3V7AG 5FB8A 3BW3A 3GDRA 1RUMH 4PYSA 2WOBA 1X5KA 2FGWL 1BJ1J 2XQ0A 2J7LA 1RJPA 3VWKB 4CSZA 2ZRVA 3FXYA 4G7EB 2BS8A 1INQA 3MFFB 3WD3A 1CDJA 5CZRA 4W87A 3BP6B 2N1TE 3E12A 1QNSA 4V1DB 1ETA1 2OQJA 1G1CA 4YUEH 4N2LA 2OTWB 1DE6A 1P7KB 4B91A 2JLPA 3GJFA 3UTOA 4IRZL 4I6VA 1F3RB 5LAXA 3G9AB 4XX1G 3LAFA 5E4OA 4YX2H 5C0EA 3BZGA 3CVIL 4S39A 5FPIA 1KM6A 3EKCA 2DDQH 2BXVA 3PB0A 2DQXA 4IOSA 4PRNB 2BC4B 5EZOL 4FP1A 2I27N 1OF2B 1M6JA 1S5WA 3SE6A 5A95A 4EF3A 2IPUG 3OC8A 1UWUA 2HWZH 2VH5L 4ONFL 4P3CH 1ZLSL 2DQIL 4WNQA 5I1AB 1YSOA 1LE9B 1E4XI 3PN8A 3DXIA 1IAOA 4TQEH 4QDGA 1X5YA 2X0YA 2Q20A 1HQ4A 4O1FA 4Z8FL 4LOFA 2MJWA 2PR4L 3GDKA 4IH3A 1OXYA 2WB7A 5C0GB 5D9PA 4CD8A 1BQKA 3VI4A 3EDKA 3HLAA 4PH6A 1FLRH 1RJCA 5CINH 3EMZA 3PFQA 2VURA 2NR6C 3G6DL 5JPNA 3SZ8A 4H8WC 2YIHA 3BCDA 3M8OH 3TONA 5A8MA 5CSUA 3C0LA 2EIZA 4WJ8A 4LW7A 3VXRB 4OAWB 1AQKH 2CPCA 1G69A 2WBJA 1HL9A 2DW7A 1NUGA 3FU3A 2G37A 3LSBA 2YR3A 3FJTA 3WXWL 5JQ6H 5I71B 4ZJ9A 2ZKWA 5F9WC 3V4UH 5KZCB 1J8HB 1TPDA 2V82A 3VD1A 2P3ZA 2ZXQA 3P4OA 3ZDYB 3QDJD 4P06A 4L8CB 4DPPA 3VU2A 4QISA 2BHFA 3QXAB 1J0KA 3QDJB 1KM0A 3BH8B 2AJXH 4AI7A 6PAZA 3AREC 4PJ5E 4QY8B 4P2AA 3K6SA 1NL0L 4QXTA 3KYMA 4CCDA 4BE5A 4IMLA 1MPAL 3GUGA 2FLBT 4JNMA 1YNLH 5HBFA 1WDSA 4IS6B 3B2VL 1OGAA 2OTWA 4P5UA 3FQUA 1RJQA 2QGEA 2ZCZA 3QMRA 1IAIH 2AZAA 4W70A 1L0PA 1XH1A 4PRHE 5I6XB 2J8UB 1BVWA 1P0BA 2HWZL 3T4AB 1KJ3L 3U9WA 1OK6A 1BF5A 4IOSD 1IIIA 4YSUA 1OW0C 5EO9B 5I1CL 2FCBA 1CLXA 2OMZA 2NV2A 2WSRA 2EZ0C 1HNYA 4PRNA 3X11B 2FMNA 2K7QA 3CFCH 4EBQH 3TN0C 3KTSA 1GIGH 4P4KD 1XLLA 1B6UA 4R7DB 1SJHB 2GBVA 2O7QA 4A2EA 3M5VA 4MADA 2VYOA 4OLXL 3N4EA 2BOBB 3UYPA 2Z27A 1YQ2A 3OAUL 2CR0A 2X4RA 1LORA 1AD9A 4ANUA 4LL4A 4HALA 1SSGA 1YQVL 3BARA 4ZI8A 3D39D 5BXFA 3MJ7B 5FR3A 4KNUA 4LU5L 3GG1A 1MQ8A 1NBQA 1M68A 2YB4A 1S2UA 2INFA 3QY6A 3UVIA 1NMAH 1D6VL 3OKDA 2EXWC 2BOLA 2F58H 5HHOD 3TU6A 4ELKB 4K7PH 3ITXA 4AKQA 5MEPB 3VAEA 5I30L 3IV3A 2WJEA 3IPFA 4ZODA 4HSNA 1QHPA 4Y16C 3C86A 3WD5H 4OZHF 1IC4H 1AP2B 5E9NA 3UBXG 4WCYH 9XIMA 1JDEA 5BOZG 4XH2B 1BQCA 1VRXA 3K71A 4MJ6B 4KY2A 3IDIB 1KBIA 4XVDA 4GKZA 4NOBA 4YHKL 5LGKA 2GLKA 5D05A 5I5JA 2RA1A 4KW2A 3KS0H 2ATSA 3WF4A 1I7TA 4R3SB 3T2PA 2D8KA 4LDEB 2F0CA 4XGZA 4G6JL 3X14A 5ISZE 3QV9A 4ES9A 1GPOH 1W8GA 1D7CA 1IFRA 2FECL 2GCYA 1P0SE 2MNJB 5BRZB 4GXMA 4AWUA 1IKNC 1TJGH 4F0HA 3DETC 4WI5A 2R56H 3VXRE 4AQ1A 3X12A 2VQ1A 3TT3L 2HG5B 1JJKA 2C79A 2H26B 1U91A 3S36L 4X9SA 4IKNA 2H3DA 1KYFA 3C52A 4PEKA 1FL5B 2ZONA 1LDCA 1AKJD 1NWPA 3Q2DA 4XN9A 4WK0B 4XZ9A 3U83A 4N9OB 5DBTA 2JKTM 4XPHL 5IWLC 2L0DA 4Q7IA 3RG6A 4P99A 3O6FC 1U93A 2XA8H 3TN4A 1QW9A 1SZFA 3V0UA 2DSZA 5HJGA 4YE0A 2NT0A 5AW2B 3SCUA 2FJGB 2EC9U 3M7FB 4E8DA 1OF2A 4W4OA 5F21B 5TE7L 1OOWA 2VXQL 3MNMA 1FY6A 3N4FA 5ILTL 2V8MA 1OM3H 2YWYA 3W4RA 3MRCB 3T5WA 4OCXL 1TWSA 1NBVH 1FTXA 5E8EA 3V95A 2BIIA 1CXEA 3QJHA 2QQKH 4HKJA 3JV4B 4H26B 4M4PA 4QHKI 5EV7A 4LQFL 2DQCL 4HHAB 3NIDB 3P1VA 1IVTA 1JUKA 2O6FA 3LERA 1LO2L 4ZAKB 4KWWA 4WOQA 3AGWA 3O2VL 1QEWB 5C0JB 4XAKD 5I73B 4G5DA 3L5AA 5LQBH 2CLLA 3CIAA 3Q65A 1S9VB 2ARJQ 2BMKA 2QGDA 1MFVA 3Q6FB 4V1DE 4X98A 5E4EC 4YHMH 5FW6A 2QEZA 3LY0A 1Y5XA 1J5CA 1HVQA 2ZUQB 1QXLA 2XIQA 3TJLA 4N22A 3EOSA 3GC4A 3PZMA 3RPTA 3SDAD 1Z9PA 4M8VA 3ANYA 3HOJA 3E2HC 4QYOA 3WJZA 1NJ9B 5F7DB 3UH8A 1Z9AA 3WJLC 4ZXOA 2M1KA 1F6PA 4MX7B 3VM7A 3ITTA 5FJPA 1BPLB 5GRYA 4AIBA 1H5BC 1FL3A 2NRDA 5F9DC 2YMXL 3J2PA 1VHPA 2E47A 5DLML 3RLGA 4XP6L 3Q8AA 1MRAA 1YYAA 5HGBB 2YS4A 1WFNA 1JVOA 2IXUA 2FO4A 5EBMA 2ZJSH 4C6QA 2DDQL 2WXHA 3P54A 4L1HA 2Y7LA 2DM4A 2VO5A 2I5YL 1EC9A 5HYIA 3IDMB 4LGPB 4IRZH 4DTGH 3GU1A 3WG6A 3RITA 4ACZB 2FMOA 4UMSA 3FYYA 5F3FA 4JTTA 4JGDA 4APQA 4PJ8D 3TTOA 1DUYB 1L6WA 3SGDH 1KLUB 5L4MA 3LSOB 3PGFL 5C9RA 1BQ5A 1BZ9A 2F61A 3BVNA 3DJZA 1XQLA 4PE8A 6ALDA 3S37X 5FA3B 1KFKA 2CRZA 4HWNA 1GKQA 2TPSA 2EDFA 1FVEA 2EKGA 3BXNA 3IGFA 5F9OH 4AYBA 1I8MA 3P73B 1DN0A 3VVGA 1DQDL 1GPWA 4XNXH 1FZOA 3TA4D 3AWFA 3LHPL 3X1GA 4EVZA 4PLJD 2FQDA 3J27A 4NQEE 4OCYH 4D3CL 3QC6X 2WB5A 4TN9A 1X5XA 2Q3AA 4PD4J 2XTJC 1NCIA 2QDVA 1MFDH 1OALA 5DHYB 1KB5B 2YL6A 3OGVA 4WR3A 3GKAA 3PS7A 1PJ9A 2OCCB 5ECUA 4Y16D 4Y2DA 3AJ7A 3PWPB 3A4WA 1XD1A 1F6AB 1CDUA 3BEVA 1B3ZA 5FJRA 3W1PA 1EK3A 4O2CB 2JF7A 3MV7E 3ITLA 1FWFC 4EDWL 5HNNA 3T0EA 2ZP0T 2E7BA 1C5DB 4BH7A 3FH8A 3AAZA