3OLDA

Crystal structure of alpha-amylase in complex with acarviostatin i03
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
495
structure length
495
Chain Sequence
YSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Structures of human pancreatic alpha-amylase in complex with acarviostatins: Implications for drug design against type II diabetes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 173
structure length 495
sequence length 495
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3oldA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3oldA01
3OGVA 5I23A 2FHFA 1Q6FA 1QW9A 1RH9A 1EGZA 3T2OA 3ZJKA 1J0HA 3WF4A 2DEPA 1UWSA 2ALWA 2F7RA 1NWUA 3BVTA 2FH6A 1NP0A 3BVWA 4JFVA 2G3IA 4IPLA 1R75A 1QNPA 5D8ZA 1V3KA 3LPFA 1E9LA 1GVYA 1PIFA 1OGBA 2A3EA 1PPIA 3MMDA 2CBUA 1HJSA 4WIWA 1HIZA 2E9BA 4GZIA 1I1XA 2OWXA 3J7HA 1QWUA 2F7OA 3RO8A 2ZE0A 3L4ZA 1V6VA 4GI6A 4OUEA 1MFUA 2BFGA 3AMGA 1E3ZA 2FYVA 1JGIA 5D9NA 4DWSA 1P6WA 1W32A 5A3HA 4UQCA 2XM1A 3MUAA 2XTKA 5BXRA 1LWHA 1LF1A 3WIJA 1PEZA 2WW5A 4AW7A 3B9DA 3SCPA 3MSDA 1OINA 3WUGA 3W81A 3WH6A 3S2CA 3VKKA 1UD8A 4MAVA 4AZCB 3VIOA 3FN9A 3SURA 3D5HA 2OWWA 4UZSA 4CVUA 4D6CA 4QCEA 4HTYA 1JAKA 2DT3A 1NARA 1ZBVA 2F2HA 3F5JA 4U33A 3TA9A 3BUQA 3D4ZA 3VIPA 2VT0A 5A6AA 2WK2A 4HMCA 1EDQA 2CNCA 4OBRA 5A6JA 1A3HA 3UG3A 1BF2A 1E0XA 4ACYA 4UNIA 4DM2A 3A23A 1UKOA 5HPOA 3FHQA 4ACZB 4JCLA 3WY2A 1FHLA 3GBEA 3ZT5A 1E55A 4PMDA 2X2JA 3OZOA 5BWFA 3NSNA 4CD7A 2DGAA 4QCFA 1WDSA 2W4XA 3BAKA 1UZ1A 1W9UA 1E3XA 3PTKA 3PTMA 4UCFA 2F1BA 4HZ7A 4W89A 3WQ8A 5LA1A 3A24A 2OW6A 1OSEA 3VIIA 1L0PA 2FGZA 2WCAA 5HBFA 1U30A 2PWGA 2J78A 1ISZA 1KCLA 1VEPA 4P8XA 2WCGA 4UZUA 3IGUA 1UUQA 3OA5A 5GPRA 2QHAA 1DP0A 1W1TA 4P7QA 1LJYA 3BSGA 3CZNA 3AIBA 2BXYA 2NT1A 3M07A 2VQUA 4LYQA 1ZBKA 1WZAA 1UKPA 1JZ7A 2XVNA 3CZKA 1CGWA 1D7FA 4PMYA 1B3WA 2WM0A 5FKYA 1X1NA 3SUTA 1MQQA 2IXUA 1WE5A 3LPOA 3UG5A 5FL0A 3AXIA 1QNQA 3HZ3A 5C8BB 3GXPA 5TD4A 2FH8A 2D20A 1QX1A 7TAAA 2O92A 2YL5A 1FFRA 3GH7A 3WDQA 4TX8A 3VIHA 4AYSA 3II1A 4ML4A 4WLCA 5A6BA 5A8OA 3VDAA 3VINA 2WPGA 1VB9A 2J77A 1JI2A 1MWOA 3D52A 2PWFA 4C7GA 1BG4A 3HG3A 5ABGA 1BHGA 1QI3A 5EB8A 5ABEA 3LPPA 1KWGA 4LPCA 1JXJA 3AMCA 3NIYA 4YHGA 1UKTA 2EEXA 1I1WA 1E6RA 4U3CA 3PTQA 5EMYA 4E8CA 4LXFA 1OT1A 1M03A 1CWYA 1HL8A 1EOMA 1QVBA 1EDGA 2VC9A 1WB0A 4CN6A 3ZR5A 2X8RA 1E5JA 3CUJA 3SCWA 1H49A 4MTVA 1PZ2A 1TQUA 5CLWA 3SCSA 1YHTA 2F7QA 1BSIA 5CSYA 2BNJA 5I24A 3GXFA 4PTMA 2WHKA 1UKQA 2V3FA 2J7DA 4UOQA 3LXAA 4QP0A 2OYLA 4UFMA 5LYRA 2XGBA 2UY5A 2V38A 3LPGA 3PZOA 4TX6A 3IJ7A 1UWRA 3BUDA 2PI6A 1MXGA 4FK9A 3VTRA 4ATWA 4PSPA 1DHKA 3A5VA 1C90A 1EOKA 2X0HA 3IAPA 1E6XM 5I77A 4MJ4A 2XWEA 3OIHA 2CHOA 3ZQ9A 1G9HA 2VZOA 4AZ7A 3GXTA 2DDXA 3I3DA 1HN1A 2XWDA 3RILA 1EO7A 1J0IA 4AMXA 3N12A 2EAEA 3CMGA 2WMHA 2QMJA 1FOBA 1R33A 2WC7A 4JL1A 4XUYA 1XCWA 3K8KA 1JD9A 3NJ3A 3N15A 3A4XA 3WSUA 1GUVA 4PUEA 3WD1A 3VSTA 1OGSA 2EPOA 4FNUA 2EQDA 1UR4A 3VMPA 2UWFA 8A3HA 5FOOA 1KXQA 4DO4A 4GXPA 4V2XA 1BG9A 1PX8A 3KLLA 3OGSA 4GINA 2PBGA 3S6TA 3W37A 3N18A 2XN2A 3VIMA 1D3CA 4PMQA 4CU8A 4MB5A 4F8XA 2OYKA 4PTXA 3RDKA 4KRTA 2YOCA 3WH7A 2YBTA 3A4WA 1E1EA 4AZBA 3CHDA 5E09A 3VX0A 5A69A 2WMFA 2WYSA 2JEPA 1C7TA 4W5UA 3E1F1 2VJXA 3WY3A 1DWAM 1QI0A 5I3DA 1UYQA 3PZVA 3L4XA 4IISA 1WDRA 4TVUA 2D0FA 3VD7A 4TTUA 1DWIM 3ZJ8A 4BF7A 1QW8A 3VIFA 3WBAA 1V02A 3T2PA 1NOWA 4D6HA 2BHZA 5BCAA 1CXKA 1BYDA 2BY3A 2VX5A 7A3HA 3AS0A 2GDUA 3W53A 1BVZA 1VIWA 2UY2A 3VD9A 1LL4A 2DPEA 3SCQA 3WH8A 1E4NA 1H0IA 1V0KA 1W9PA 1UD4A 3KZSA 3VGEA 5IXEA 3KL0A 3GDBA 4QLKA 2E8ZA 2VI0A 1JZ5A 1JYWA 4AZCA 4D71A 4PMZA 4AD3A 2D0HA 3VILA 4A3HA 1DWFM 3MKKA 1QHPA 2OYMA 1TMQA 1JD7A 2ZXAA 3WUBA 4JFUA 1CXFA 1ODZA 1B30A 3CHCA 1E6SM 1J9YA 3WF0A 4AZHA 1JFHA 1E15A 3EMZA 1SMAA 1HX0A 3MUZ1 3AYRA 2BV9A 1TR1A 1B3ZA 4LYRA 3D3AA 1HXKA 1R7AA 4ACZA 1FHDA 1V0MA 3MS8A 1HP5A 2XSAA 1ZJAA 3OLGA 1HKJA 1GOKA 2VL4A 5A6KA 1OIMA 1VJZA 3EDKA 2EJ1A 4D1JA 1W3LA 1XH2A 1K9DA 2D22A 5A6LA 4W5ZA 2D3NA 4H8VA 1VJSA 3HG2A 3DHPA 1UWTA 3VM7A 1E6NA 2D0GA 4URIA 2ZUNA 1EH9A 3GXNA 2NW0A 1E43A 4EAMA 2G3JA 3KE0A 4HA4A 3AYSA 1H0GA 3H54A 4K68A 5DT5A 2GJXB 1E72M 3MU7A 3AHZA 1PZ3A 2D3LA 5AYBA 2J7FA 3AZSA 1ITXA 3TOPA 3ZIZA 4IUGA 2W66A 2WCSA 1OD0A 1GHSA 2QF8A 1KQZA 1LLOA 1OB0A 2X09A 2E9LA 2ZIDA 2BXZA 1CDGA 4UOJA 2WLYA 1JZ4A 1GQJA 4MDPA 3WF3A 1JNDA 4P7RA 3WNKA 3PZNA 3DX3A 1JYXA 1TFVA 1E70M 4JKKA 4AIUA 4FNQA 1NP2A 3AMKA 4LX4A 3T09A 3AZTA 5E70A 3UCQA 1QHOA 1HKKA 4NI3A 4MNLA 1H2JA 5I0DA 4HPHA 1G0CA 1MXDA 2WC4A 2X05A 3AXXA 2WVSA 3TTOA 1US3A 4PN2A 4M1RA 2XVKA 3WFLA 3WQ5A 2GJPA 3K1DA 5A2CA 1GW1A 2GDVA 1E73M 4M8UA 3N17A 1K9FA 3ALFA 1JNEA 4H04A 2EPNA 3W38A 1W1VA 3CZEA 3EBVA 5M3WA 1BTCA 2WWDA 3PZUA 1UASA 2WSPA 1HWWA 1U2YA 2ZXDA 3WDRA 4UFIA 2G3NA 3SCRA 3W25A 1LL7A 1SR0A 3CUGA 2EO7A 4ZE4A 4NSBA 4TVCA 1J12A 5GNXA 4Z2LA 1H5VA 3KEHA 5JBFA 1H41A 1ZU8A 3N13A 2GFTA 2EBNA 3AISA 5CZKA 2UY4A 4J3SA 4M24A 1B3YA 5AY7A 1G01A 1BQCA 4PMNA 1OCQA 1GORA 1US2A 3NUKA 5ECUA 2DT1A 2JF6A 4ZXLA 3BMVA 4OIFA 3CHFA 4MJ2A 3NYDA 4CD6A 3W28A 4J28A 1ODUA 5A1AA 2YKKA 5A6SA 2E4TA 5D9OA 5AC4A 3U7BA 2XUCA 3VX1A 4HA3A 1MW0A 4W85A 3CBWA 4MNKA 1WP6A 5E0CA 3ZSSA 3BC9A 4QFUA 3VNYA 1UQYA 4PMVA 1TQTA 3T0BA 2W92A 2E8YA 3UETA 1VEOA 1VBRA 3KL3A 4EE9A 1H1NA 1JYVA 1B1YA 3WDHA 2O9OA 2ZUUA 4HU8A 4WKHA 5E6ZA 3RM8A 1UD2A 2FHBA 1JFXA 1GHRA 3U7VA 1J10A 4OZOA 2XHYA 2VNCA 5E1QA 1KXVA 2JE8A 3DC0A 2G4FA 3OLEA 3PN8A 2YLAA 1VRXA 3EDEA 1KTCA 1V6WA 1VF8A 3RJYA 2VZTA 1MYRA 3GNRA 4NXKA 2ZICA 1OM0A 4CCDA 4H2CA 2ZUTA 2E0PA 1B90A 4R27A 4F9DA 3T0DA 4PTWA 3S5YA 3BVXA 5LA0A 1TE1A 3RJXA 4PTVA 2J4GA 3N9KA 3CLWA 1VAHA 5DEZA 1XRVA 3WD4A 5BXTA 1XSIA 3WQ4A 2EPLX 5BXPA 3NCOA 1HVQA 3MO4A 1Q6CA 1LWJA 4B3LA 2EPKX 4NRSA 4AIOA 2CITA 3BXWA 2YDRA 2DSWA 5I5RA 2YFNA 3CMJA 3DYPA 4RE3A 3MV01 1W2PA 3MUIA 3WDPP 2WBGA 2XFYA 1J0ZA 1CZ1A 2ZOXA 1KTBA 2YDQA 4HP5A 3CHEA 1NWRA 2J62A 4JFSA 5D9PA 1EA9C 4EKJA 1SZNA 1H4PA 2FGLA 3AZRA 1UA3A 4AD1A 4Y7EA 2BVYA 4CU7A 3ARRA 3EJUA 1C3FA 1FFQA 3VVGA 3LXBA 4YHEA 3U5YA 3O9NA 4AD0A 1R86A 5A95A 4D6DA 2GJRA 2X2HA 4AC1X 1J0YA 4U31A 3SUSA 4BCEA 2J74A 2IUZA 2WWCA 3WL0A 3JUGA 2ZUMA 3CV5A 4W7VA 1ZS2A 3WF1A 4MDOA 3VDHA 1GOWA 4AD2A 4JKLA 2O9RA 4DWSD 3RCNA 4U2YA 2X2YA 1JI1A 3ALGA 3HG4A 2C0HA 3GBDA 3MANA 3BAJA 3ZOAA 1CPUA 4GQRA 1KGXA 3BLBA 4N42A 3BLPX 5CJ5A 2WC3A 1MQRA 3BSHA 1BYBA 2WHJA 3ECQA 4MB1A 2UY3A 3GZAA 5EFFA 5BRPA 3EMCA 4D6EA 3G6MA 5GNZA 4CN4A 4MNJA 1EXPA 6CGTA 1K6AA 2CERA 3CZSA 1B3XA 3WD3A 4FMVA 2WAGA 1RPKA 1XGZA 4J3TA 1V3MA 1K9TA 3WNNA 3M6DA 4GZEA 1GJUA 1UQZA 1HJQA 4D6GA 3VGHA 2YA1A 1KBKA 2IGTA 3M7SA 4HU0A 2QPUA 5D8WA 5A94A 1BYAA 4AIEA 2YFOA 4GKLA 3QOMA 4MNMA 1HNYA 5LA2A 1D2KA 4X0VA 4TXEA 4FLQA 4MB3A 3ZT6A 2FHCA 3S5ZA 4FLRA 2Y8VA 1RP8A 2VZVA 1J0JA 1GJWA 2V5DA 1AMYA 3PZMA 1M7XA 2W61A 2VZUA 1B3VA 4PCSA 2WMJA 1OT2A 1CGYA 2Y4SA 3AIUA 3MV11 2WZEA 6A3HA 3VGFA 5I6SA 4IM4A 3WMSA 3D51A 4JKMA 3SCTA 2WMIB 3D50A 4GI8A 4H41A 2VO5A 3GXDA 1UWIA 2GK1B 3SCOA 1C92A 1QHZA 5CGTA 2PC8A 2VX6A 2NT0A 1VFOA 2YL6A 2J25A 1V6XA 4AISA 5D4YA 3CIVA 4NRRA 1BYCA 3ZM8A 3AROA 2ZUVA 3WQ6A 1ZB5A 1L8NA 2ZX9A 4PEEA 2WHMA 2WVVB 4AY1A 1JDAA 3WDJA 4IPNB 5A6BD 5HDRA 1VEMA 3ARYA 1IZJA 1HL9A 5ABFB 2XPKA 3W27A 1BGGA 1UKSA 4UQDA 3N11A 3W6MA 3TTSA 3FAXA 3L4VA 3FNDA 1UR8A 2XVGA 1LL6A 4B9ZA 4NZJA 4AEEA 5JUVA 4P8VA 3BUPA 2HVMA 3SCUA 5CPTA 3L2MA 1W3KA 3VUPA 2XVLA 1XH1A 1NM9A 2EPMX 1ISVA 2VX7A 4YPJA 3UESA 4PSRA 3HJEA 5AYIA 4GO9A 2Z1SA 3WNOA 1KGWA 4CKQA 1ZJBA 1QI2A 1G94A 3WUEA 3U5UA 1LG1A 3AS1A 3BLKA 3DX2A 5I78A 1CXIA 1TZ7A 1QBAA 1CLVA 4AMWA 1PX4A 1UG6A 3AHTA 4Q22A 1CECA 4F79A 3UR7A 1GZJA 3AIWA 4U2ZA 1PIGA 4DWSB 3BMWA 3ARVA 2Y2WA 3WH9A 2DIJA 5A6MA 1KGUA 4DO5A 3K46A 2QV4A 4FLSA 4OOZA 2EXOA 4KGJA 3H55A 3BVVA 3TONA 4ZXOA 1TQWA 2X0YA 1ZBCA 1FP9A 5JIPA 1B0IA 3EDFA 1GOQA 1CGUA 1M04A 4U5IA 1EO5A 1GPFA 1JF5A 5I2UA 1UD5A 4B3KA 3T2QA 4A3YA 4GIAA 3VDCA 3ARSA 4MB4A 2XIBA 3AS2A 3ZSTA 1JL8A 1TQSA 4ZFMA 1Q4NX 2GSJA 3WY4A 1HJUA 3D4YA 4W8LA 1VFUA 3F4VA 3VGGA 3KL5A 4QAWA 5A8QA 2FE0A 3PZTA 3CUHA 3GH4A 1I75A 4D72A 1EIBA 1H09A 2D24A 1AQMA 4Z2GA 5C70A 4QLJA 1UWUA 4WKFA 4M29A 1CEOA 3ZMRA 4F9JA 2DIEA 3F5KA 2YIHA 4GPNA 1E71M 2CPUA 2XN0A 2GUYA 3DX4A 3VPLA 2BVTA 5FCZA 2CETA 3MUY1 4N0RA 3A47A 1JDDA 5D9MA 1E0WA 1E40A 1CGXA 1CTNA 4CD5A 3BH4A 4AMCA 4C7FA 2F61A 2X1IA 4NZFA 3VGBA 3GM8A 1O7DC 1XD0A 1UR9A 2ZXQA 1FH9A 2VTFA 3BUBA 1PBGA 3LX9A 1H3GA 3CZLA 2WANA 4FLOA 1O6IA 3B9AA 2VVNA 1TG7A 4D6JA 1RP9A 4RL3A 1J0KA 2C8NA 2OSWA 1E56A 1R8LA 3A3HA 2A3AA 3I3EA 2BHYA 2FDMA 1C8QA 1PAMA 4L4OA 4WSJA 3POHA 2F7PA 1QNSA 3ARTA 3M46A 3ZT7A 1XYZA 5EBAA 2GVYA 1WAWA 2NSXA 3RM9A 1HXJA 1FP8A 3VMOA 3OLIA 3TTQA 1M01A 1V08A 5HXMA 4QLLA 1JDCA 1C8XA 4M82A 3VO0A 4P8UA 4FNSA 2EADA 1OIFA 2WXDM 4DUWA 1HJVA 1Z32X 3QGVA 2PF0A 1UOKA 4HOXA 3SCNA 3G6LA 1NH6A 4EK7A 1F4AA 3CPUA 3OLDA 1J18A 2JFEX 1JYNA 1EHAA 3AHYA 5IHSA 3VGDA 3W26A 2CKSA 2YA0A 3A21A 2D73A 3VIJA 4KWUA 4MPKA 4UFLA 3BCDA 4Z2JA 2J47A 1W1YA 3WEMA 4JHOA 1S46A 3AMDA 5E6YA 3WMBA 1TVNA 3DECA 3SUVA 2JIEA 3AFBA 1X6NA 5F7UA 3AICA 3L4YA 4PYSA 4W8BA 4HA1A 3BAWA 4HZ8A 1W2VA 1QI4A 4RE4A 4CCEA 2CEQA 1BVNP 2WVUA 3SUUA 4UQBA 4U5KA 5JBDA 1R85A 1Y7VA 2A3HA 3WEZA 4W86A 5BXSA 3W29A 1V0LA 2J8FA 2AMGA 2D1ZA 4Z2IA 1BFNA 2DSZA 3UR8A 1DWHM 1GOMA 4BA0A 1KXHA 2WMIA 1WKYA 3LRLA 4W7WA 3BVUA 1CBGA 2DSUA 5I79A 4CUCA 5E0FA 1ZL1A 4AZIA 1FH7A 2D2OA 2DSVA 3A6OA 1XSJA 1UHVA 2DSKA 2E3ZA 1WPCA 1MFVA 2WKLA 2ZX6A 4JHZA 4ATLA 3ARPA 1CGVA 3AIEA 3AQUA 4JCMA 1MW1A 4GI9A 5ABFA 1XV8A 1E4MM 4EANA 5JBEA 4CD8A 2J7HA 5CPQA 3GH5A 3PZ9A 5HPCA 1ISXA 4P7LA 4ZENA 1KR0A 4KH2A 3CGTA 3VOCA 1NWSA 2CCRA 1DEDA 3DHUA 1UD6A 2W62A 1TCMA 5DF0A 4J3WA 1WO2A 2VR5A 4PBGA 2BY2A 3DDFA 1GQKA 3LXCA 3QOKA 1E6PA 1SMDA 4OBSA 3T08A 2VRQA 2X2IA 4GO8A 3CH9A 1Q6GA 3SEPA 1EQCA 2JEQA 4BQ4A 2Y24A 1WZMA 4DO6A 2XN1A 2O9TA 1DTUA 4B15A 2HISA 3THDA 5HNNA 5IHRA 2ZUWA 1OGGA 3WEOA 4JFTA 2TAAA 1KBBA 1GVIA 4BQ5A 3WQVA 2VR4A 4H8HA 4M81A 2XIIA 3DX1A 3EJQA 4B9YA 2BY1A 1NWTA 4M56A 2CXGA 3AHVA 2WB5A 1RD6A 3WQWA 2A3CA 1HJWA 4UQ9A 4ATDA 4UFJA 2WLZA 3L4TA 1SFSA 4TVDA 3HN3A 2WMKA 1CNVA 2ZWZA 3NDYA 4DM1A 3LMYA 1UWQA 4TUFA 1CLXA 1MVYA 2CBJA 1WZLA 5EFDA 5IFPA 1XHGA 4J3VA 1WCGA 1JZ3A 3TP4A 3IJ8A 1AQ0A 3EJSA 4W87A 3PZGA 4HMDA 4LYPA 4NX0A 2BS9A 4X9YA 4TTGA 3BAIA 2OSXA 3OGRA 3ARWA 1B31A 4JFWA 3FHAA 3AJ7A 2Z1KA 4WJXA 3K4DA 4XZWA 2XFRA 3FY1A 3VIKA 1C93A 2YA2A 3MMUA 1JF6A 3EDJA 2Y8KA 1V6YA 3W0KA 2VURA 4C7DA 3WBEA 3WNLA 5GQBA 1TA3B 3A22A 1U33A 1QWNA 5A2AA 5IFTA 1R47A 3AHXA 2MANA 2VQTA 3WFZA 2VUYA 4PMUA 1ISYA 1HT6A 3WD0A 3CZGA 2ZX7A 1CXHA 2F18A 3QHOA 3RM4A 3WDIA 3MI6A 3O6AA 3OBAA 5FIPA 1QOXA 1R7OA 1NOFA 3OZPA 5CGMA 3ZO9A 2DT2A 1V3LA 1IZKA 3L4WA 2CBIA 4GQQA 4JZ5A 1HVXA 1E6ZA 5A8NA 1QNOA 2XM2A 4CD4A 4DUXA 4HZ6A 4JAWA 1XYFA 3VDBA 3HG5A 1OD8A 4CCCA 2WNWA 4V28A 3RPMA 2B31A 2VRJA 4LGXA 4S3KA 5KEZA 2OWCA 4ZEPA 2DQXA 5HOSA 3WKZA 3W82A 2W67A 2VCBA 2GJXA 3VD4A 4LQ1A 3WL1A 1NOUA 2V3EA 3UG4A 1AQHA 2BHUA 1GOOA 4YN5A 3THCA 1XH0A 1UR0A 2J7BA 3B9EA 1EHNA 3NDZA 1Q6DA 1CIUA 3SIMA 2J7EA 1BAGA 1E6QM 3ARXA 2J8GA 2VCCA 1C91A 1VFMA 3GYCA 4E8DA 1UH3A 4AZ6A 2XFFA 3HMCA 1VFFA 1CXLA 2RGLA 3UEQA 1VENA 4OKDA 4X0NA 2WKGA 3VMNA 3T0AA 1A47A 5CSUA 1E5NA 2F8QA 2YLLA 4AEFA 1JG9A 1ITCA 4PMOA 5CLTA 1H11A 1W9DM 3POCA 1WNOA 1VBUA 4MADA 3VIGA 5DMYA 1PS3A 3GNOA 3WNPA 1E0VA 4TOQA 3MSGA 3EJPA 1X6LA 8CGTA 1V0NA 1UZ4A 3CUFA 4AD4A 4AZ5A 4D1IA 4Z2KA 3TTYA 1GCYA 5DT7A 4UR9A 4AYGA 2J7CA 4NZCA 2VOTA 3KWXA 4UFHA 2XYLA 3VD5A 4PMXA 1HKMA 1DWJM 1GONA 4UTFA 1GQIA 3CUIA 4B16A 4J3UA 2XVPA 3BGAA 2ZX8A 1ECEA 4UQAA 1V3IA 4J7RA 4W93A 1TUXA 3GXIA 3CZ8A 4P7OA 1W91A 2G41A 1GQLA 2WZIA 3AIRA 1HTYA 3UERA 3WNMA 1UR2A 3WMCA 4AD5A 3IANA 1KXTA 5CG0A 1JIBA 2ESCA 1JAEA 2PWDA 3O2LA 4XX6A 1UH2A 1ESWA 4OOUA 5M17A 1FH8A 3AS3A 3GTNA 3WF2A 4WSKA 1G1YA 3AIQA 4NF7A 1JZ2A 2W63A 4RE2A 4D6FA 1BPLB 2VRKA 1KFWA 1KQYA 2Q8XA 2YJQA 4UFKA 4PUDA 2QPSA 1MQPA 1V6UA 6TAAA 2ZUSA 4PMRA 3WENA 3B8SA 3PBGA 3EMQA 4KGLA 1T0OA 1HP4A 4XZBA 1E4IA 2DH3A 2WZHA 2XSBA 1OWQA 1UH4A 2YDSA 3IAQA 3AI0A 3EDDA 3DYOA 3OG2A 5GNYA 2ZXBA 4ZE5A 2W5FA 4AWEA 2EACA 3QHMA 3W4RA 4BQ2A 1EDTA 2VZSA 1E1FA 1W9XA 1LG2A 1J01A 1WDQA 5FL1A 4E2OA 1K9EA 3LRMA 3BUIA 3H53A 3WH5A 4HOWA 1JXKA 2JF7A 2QLYA 3IJ9A 1CENA 1OBAA 2VX4A 1R87A 4KMQA 1KR1A 3ARUA 3K4AA 1R34A 1AVAA 5C71A 4Q7NA 2CHNA 3BCFA 3HU7A 3NSXA 3BAYA 4NXSA 1QI5A 4L4PA 3RIKA 2VVSA 4BS0A 5BYWA 3AIVA 5M03A 1CGTA 1BGAA 3VSVA 1W9VA 1TVPA 4BZYA 3IK2A 1C8YA 3AMLA 1IV8A 2XJ7A 5CQ1A 4FNTA 2CYGA 5BRQA 2YL8A 1V03A 1UD3A 3AXHA 2JIWA 4W84A 3ZJ7A 1KCKA 1QNRA 5JIWA 1Q6EA 3CTTA 4P7NA 1PJ9A 1V3JA 2ZX5A 4A4AA 3FAWA 3KLKA 3MMWA 4W7UA 3EJRA 2F1AA 3WY1A 3VD3A 2G8ZA 2J7GA 7CGTA 1ZBWA 4CGTA 4Z2HA 1F4HA 3L4UA 1JZ8A 2G3MA 4U3AA 2DH2A 3DYMA 1GNXA 3PHAA 5DO8A 4KRUA 2BVDA 1E4LA 1TA3A 1TQVA 3BAXA 2VCAA 3CO4A 2V3GA 3ZJ6A 1G5AA 4J3XA 1W3JA 5A8MA 4OJYA 1EQPA 3DDGA 2CKRA 3VU2A 1M53A 4W88A 2V5CA 3EYPA 4S3JA 3L2LA 2E9MA 2YBUA 4QDMA 1W9BM 2BY0A 1SYTA 3W24A 4XB3A 3W6LA 2W91A 2C7FA 1V3HA 4H8UA 2PWHA 3APGA 3SUWA 2OW7A 4FNPA 1IT0A 2WSKA 3CC1A 2CBVA 4W8AA 1WDPA 4FF5A 2IXVA 1MW3A 3I3BA 2QMKA 1J11A 1HF6A 1MW2A 2WMGA 2XGIA 3EJTA 4R5EA 3NSMA 1CYGA 1R46A 4PRWA 2XG9A 3QHNA 3RMEA 4OGZA 4GZJA 3TV8A 4WK9A 2O9PA 3QR3A 1XD1A 3WN6A 4CVWA 1LQ0A 1CXEA 4F66A 2AOSA 3VNZA 4AXNA 1PX3A 1HJXA 4DWSC 1XC6A 3WELA 2V3DA 2JALA 3ZR6A 1O7AA 3K8MA 3LRKA 2WHLA 2EABA 5DFAA 3FW6A 4P8WA 4UQEA 5KZ6A 2RGMA 2PB1A 4WKAA 3VM5A 4UOZA 3GNPA 4V27A 2WBKA 2J75A 1YQ2A 1WZKA 3A4AA 2AAAA 4E4PA 1B9ZA 9CGTA 5A2BA 2DT0A 3ARZA 1ISWA 1BLIA 3F5LA 1KWKA 4HOZA 1B2YA 3N04A 4BQ3A 5E9AA 5BROA 4D6IA 2Y5EA 1XSKA 2A3BA 2D23A 4H7VA 1GOIA 2PWEA 2VMFA 5IDIA 2WVTA 4HMEA 2J79A 4CU6A 5CXPA 3U57A 4PCTA 3FXYA 1QPKA 2E40A 1QBBA 4JL2A 4WF7A 3N1AA 2ZWYA 1C7SA 3VSUA 1NQ6A 1UR1A 4XV0A 3PZIA 3WD2A 2GK1A 3GXMA 2OSYA 1UA7A 4DUVA 3CZJA 1V02E 4M80A 4J27A 4MAZA 1HKIA 5M5DA 4HPGA 5CPSA 3OB8A 1W1PA 3ARQA 4AZGA 2YL9A 4FNRA 4JIEA 3PZQA 2CESA 3SCVA 2WVVA 5A8PA 1FA2A 3AOFA 4CN1A 1JZ6A 3WUFA 2OLHA 1W3HA 1XCXA 2PBOA 1DWGM 3K8LA 3DX0A 5FD0A 5AC5A 1N82A 1KB3A 2CIPA 5ABHA
chains in the Genus database with same CATH superfamily
3TZVC 4Q4QA 4FQXB 4PP1C 1J0HA 3B40A 4C83A 4CNUA 2Q3RA 4LUJA 4E41D 5LUMA 3O3BA 3RZCD 5K1JA 4N2KA 2VDPH 1T41A 7REQA 4KJWD 4OFKA 5FA3A 4FI7A 5DX7A 1A8JH 1CCWB 1ZLVK 1OP3H 2IH1B 1PBYA 3EOAB 2XKNA 3ZDWA 2CGRH 4NC2B 3SKMA 3HI6L 3MUAA 1NIBA 3QYMA 3QT2A 1FWNA 5KANI 1OX4B 3ABLB 3FQTB 1AKJB 3CQFA 4C1NA 2V9DA 3SCPA 1OINA 3RB5A 4IP7A 2EJAA 3ULUH 2MPAL 4FN0A 2INFA 4MKVA 3F4CA 4AZCB 5K5YA 3HI6H 3N4EA 4GW4B 2IQAA 5JXEA 1BD2B 4LLVA 1NM4A 2WK2A 4UIOA 2VDNL 1EDQA 2BNRE 2EUWA 3KVPA 1BMGA 4P9MH 1A7BA 4ACYA 3M7FB 3GPEA 4U1NB 1XPYA 2QADC 4U7SA 1KGJA 2HJLB 2VDNH 4QJ1A 4TQEH 5LZLA 3BIKB 1YC8A 2XG4B 3L67A 5GGUA 1KRAC 4D8OA 3DFNA 4AF0B 1EJUC 4GWEA 4RPQA 3H2WA 1GMEA 3D0CA 1ISZA 4CW1B 1VEPA 3UTSE 4U0QB 5F8QC 1L7IL 5B3NA 5JIIA 3O2VH 1QFUH 2BSDA 3L7EA 3M07A 1UKPA 1KB9K 4GJJA 2OXHB 2Z65C 3SUTA 4RAUA 3GMQA 4LAUA 2DZUA 3VIHA 4WLCA 1UROA 5D70L 1ZA3A 2DD8L 4RW5A 4GXUN 1XWYA 3S34H 4I3RH 3CCHB 3FQRA 1JCNA 3M8OH 2PUQT 5IEHA 3V2AR 4NQEA 3II3A 2B4GA 2JKNA 4PH6A 4B50A 2W1NA 4QSFA 1Q9WB 2PDQA 2O72A 4HWEH 1SDDA 2V3FA 4NQDA 2IAMA 1QMLA 2Z1VA 5FECB 3OGCB 1UR3M 3N6YA 2WGXA 3UXFA 1AGEA 4ONGH 1YYLH 2OR8A 3UJTL 1Z5LB 2NW2A 3GAKA 1HN1A 4Z18A 5D6DA 4NLAA 2FSEA 4Y4FC 2OL3L 5CMAB 3BW2A 3CMGA 4CQCA 1G87A 1JGVL 2XH2A 2JCCE 4B90A 4E0RB 3K8KA 2AHIA 4UB0L 3A4XA 5FV1L 2C3XA 3FTGA 1OP3K 2OJPA 1RURH 1AANA 3LGDA 3MRDB 4BCYA 3W1MA 5FAJA 1JGVH 3OGSA 2YWYA 3IV3A 4KFZC 1D3CA 4UB0H 2P26A 4MJIE 4WWID 5KW9L 5EN3A 3O8AA 4ZQRA 1Y6NR 3SY6A 1T5XB 5GS0L 1UPPA 3KWUA 3WCYA 1DWAM 2I5QA 1DZBA 2OMBA 5AB2A 3FDGA 3L08A 1ZZMA 3ENEA 2Y22A 3FO1A 1U95A 2JLLA 1DWIM 3FLUA 4FGMA 1HH9B 2NY2D 5ECVA 1JDFA 4XCNB 1CXKA 4J3OG 4TV6A 2YD1A 2UY2A 2Y7SA 4Z77B 2LR4A 3C9NB 4AYFA 3UZQA 1SO5A 3UZEA 1D5ZB 3OPZH 3ABSA 3FUHA 4ZFZA 3KHOA 2FGWL 3O7UA 3FFDA 3BPWA 5BOFA 4JFZH 1QHPA 5E6IC 2J8UF 4RDBA 1KCUL 4TTDC 5CC3A 3ULUC 1HX0A 3BZFA 3MUZ1 1DSFH 5GSRA 2ADYA 5SWSE 3U9WA 1ZJAA 1HKJA 4LF2A 2I32A 3R0DA 1KTDB 2PMZA 1KCUH 4GQGA 1W3LA 3N29A 1XMWA 2BCMA 2ZPKL 2EO1A 1OZMA 1MCCA 3ARGC 1NZRA 1QW7A 2ZRUA 3SDXB 5IMKB 2BP5M 3VM7A 4OV4A 5JLZB 5DN1A 5D1ZI 5C9UA 2HRPH 3BD5A 2OU4A 4EAMA 3KE0A 4JFHD 2VW6A 7PCYA 3UZ5A 3QHFL 5EU4A 3TW7A 4FZ8H 3LSCA 3G5ZA 1HUVA 3F7YA 4BFKA 1I8IA 2DMKA 3CIXA 3R1GH 2HFTA 2QVMA 3AZSA 3T7VA 1ITXA 5IMLB 1OGPA 1KA9F 1L6XA 2Y7LA 1NDTA 2W66A 4MVAA 1OD0A 5DQDL 4MZYA 3CDGB 2O61A 1E2WA 2J1ZA 2ZIDA 2RDWA 3DFHA 1JZ4A 3U0TB 1GQJA 5TF1L 3T4CA 5CIPB 5I1CL 4IKIA 4LSSL 5DQDH 3UCQA 5I0DA 3RFZC 1JHLL 1MXDA 3BN9D 1IEXA 4Z7OE 4YDIH 3LZNA 1YMYA 3DI0A 1RVFH 3N17A 5I1CH 1E73M 3GSMA 2HNHA 4WNQB 2A9BA 3PZUA 3T3PB 4HK3N 5D7HA 1P7KB 1SEQH 5E5CA 3W25A 2EO7A 4U1JB 1IIGA 1PKYA 4E42A 4XE0A 4J12A 5JBFA 2XWZA 4GP4B 3O0FA 4Z0SA 3O6DA 2UY4A 4M6AA 2BFVH 3NUKA 2ATAA 4KMTH 2AFNA 3W7RA 2J57A 5JQIB 4FA7B 4IICA 3L7RA 3T8QA 5C2CA 4JQ3A 3T3PF 4OV5A 1HL2A 1VBRA 3UIZA 1EYEA 3BSZL 3FCUB 4I9WD 1K8IB 2NY4C 2J71A 1UD2A 2CK0L 2VGIA 1VPQA 3ZVHA 3OLEA 4KZEL 1NPNA 5JHDD 2DL2A 2P45B 2ZC1A 3MPCA 3FFCB 4PTWA 1TPH1 1HE8A 2JLPA 3BVXA 1T5WB 1LT8A 1FN4A 4ZW7A 4Y1AE 2ZKMX 3E6HA 2OP4L 4LB3A 1ADOA 4NOBA 3KYMA 2QDWA 1NSJA 4AG0A 4UTBA 2CLIA 3MV01 1MSSA 5E94A 3OXSB 3D2TA 1CZ1A 2IS7A 4UAOC 5KS9B 1F3DH 5FJJA 1EA9C 1SZGA 3DEQA 4RFEA 4LLMB 3O9NA 5L6UA 2OO6A 3EFDH 4FABL 4U31A 3TSMA 5FJTA 4HSQA 1X7FA 3LNDA 4JJ5A 5CKAA 2W0KA 3MJ8A 3NIFB 4XP1L 3KBFA 3GBDA 4FABH 3UGVA 1BTMA 3BLPX 4DEPC 3VFMB 4ZTPH 2VSKB 3ULUE 4RGMC 1JR1A 3FOLA 3RU8H 1HQRA 4XP1H 3CSGA 2OK0L 1P5VA 5J8OA 1MZRA 2O5ZH 5BXFB 3PP4H 2ED7A 1HJQA 1RIHL 4P23C 4FR6A 3ZN6A 3JVGA 3H4GA 3B6SB 2CUIA 2QPUA 5IG7B 5D7JD 3E5BA 2IXQB 5ISZA 3M47A 1S7SA 3HE6D 1AY1L 1CIDA 4U4MA 3LHZA 5G1MA 2PW2A 4XXCC 1NC2B 5HI4C 4MKMA 2WIIB 4OZHB 4D9QD 2VDOH 3NNTA 3C60D 1UWGL 5A3ID 3D50A 4GI8A 4LMQE 4PJHF 4Y4HC 1IGIL 2FR4A 1V6XA 5DFTA 1LO0L 3NQGA 2C9VA 4HIJB 3GB7B 3G1DA 3ZM8A 2ZUVA 4FS0A 3K0WA 2G4JA 1ZPTA 3GMNB 1Q72L 1DUYA 4GUQA 1A6VL 4A2RA 5KBNC 1HL9A 1A3QA 3UEZA 2PTWA 3W27A 4FLHA 3VG9B 1IC5L 4PFHA 4HFWB 3ZUNC 5LWYL 1Q72H 4MZIA 3ZBMA 4F0KA 3TLQA 2KMWA 4TM9A 1GVSA 4GO9A 3WJZA 1OCWH 1FFNB 4CKQA 3AUOA 4G7VL 4Y90A 3FU9A 1CE6B 4CMMA 3W7DA 2OXNA 3KYKH 4ZX4A 3V1PA 3UR7A 4S38A 3QJFB 4OD1H 1QSVA 2GHZA 5B1AB 2VFFA 3NAAH 3UP1A 3SODB 4MHBA 4DO5A 2OMZB 1XYBA 2FJGA 1FNLA 3GKWH 3O4OC 5DJ8A 1IILE 4ZXOA 3LTVA 1GPWA 4C1NB 2VEPA 4LDCA 2VL5A 3EH5B 4FFWD 3BRDA 2DY2A 4AQ1C 4B3KA 4MB4A 2XIBA 3MV9A 1TJPA 1XIWD 1S9VA 3F4NA 5AFAA 1BYNA 2OCJA 2O26U 4GLRI 3HKZA 2ARJA 3MU3A 1VA9A 3VXRD 1P53A 4UT6A 2YKLH 1C12B 1TR7A 1CGXA 3OJGA 2K8QA 2MQ3A 4JYFA 3IDNA 1B57A 2X1IA 5GGUB 1F2JA 2CLVA 3STBA 3MY9A 1XD0A 1FH9A 4S2BA 3DX5A 4LOVA 3TJIA 4N2NA 4A04A 1A2YB 5IHZA 1A64A 4F57H 3C6SA 2Z35B 5FFGA 3VYLA 2WQDA 1AG0A 1N2VA 4YSOA 4DN4L 3MMEA 1P1ZA 1R5VA 2ICEC 1UT1A 1J18A 2PGFA 4LC8A 1KZQA 3QUHA 1WA2X 3W26A 2YA0A 4WKXA 1SY6L 1I85A 1RBAA 1F58H 4R83A 2OMVA 5IEHB 4J3BA 2NWRA 2B1AL 3DMMD 4FJZA 2ZYRA 3WEMA 4J8QA 1ZHBB 3WMBA 3SUVA 4K5NA 2HQAA 1C16A 3KCJA 1D6EA 4HA1A 4ZTEA 5DK0A 2B20A 4BF9A 1LO3H 2C91A 3QXTA 4MAYC 1KM4A 1SDDB 1WXZA 4NQDB 1NCHA 1YAIA 2IAMB 2A5HA 3MBFA 5CHNB 3EADA 4Y19D 3BVUA 2DSUA 3S6CA 5I79A 1WFOA 4LCWE 2IGFL 1GKPA 3ATBA 2NW2B 2FSEB 3L3GA 2BNRD 3TJHD 2Q8LA 3AIEA 2IDUA 1AXTH 4KKLD 5T1JA 4LSUH 3CSFA 4EANA 3KXFA 2KH2B 3R4IA 3IKCB 1G9NL 1OK4A 3MLWH 1WO2A 3NACL 2W9LA 3H3KA 5B4MC 2X9YA 3DJ9A 4CBZA 1EC8A 1RK6A 5JQHC 1SHWA 3C12A 2Z4GA 1T4KB 2XN1A 1EFQA 2JI3A 1T6BX 4E9YA 2K8MA 4NI6A 4P8QA 3NACH 5EHFA 3TASA 5IHUL 3UTSD 5FDWA 4N24A 1QWKA 4BUHA 3FO1B 3DX1A 3MJYA 4Z7UA 3RI5K 4LCIL 2V4LA 1QTPA 3BOVA 2CXGA 2QJHA 1BGXL 1TIMA 3BZJA 3ROLA 3HN3A 4ADGA 4WEUD 2ZOLB 1UFUA 2HROA 4W9FC 1NJ9B 4AYFB 3UZQB 1VIZA 3V5FA 1YEKH 2VDKB 1WCGA 4Y8EA 3LD8B 4ZFZB 4LYPA 3VFTB 3FQWA 3HNVL 4JRWA 3FHAA 3AJ7A 3I6LE 3SE3A 1J5OL 1F4XH 3M43A 3R0NA 1IE4A 4AVIA 5GGSA 1QABA 1EZSA 4F58H 4O54A 2WN3A 3A22A 2PKDA 1CO1A 3QJZA 4KXZH 4NUWA 2MANA 4JG0L 3TH6A 3QPQD 3ZXAC 1GZ1A 3G0UA 1J5OH 1HT6A 4MXVE 2JJWA 2E7LA 3K6IA 4KEVA 4JYDA 3TJPA 5AOMA 3GJEA 4OCXH 4N87A 3FS9A 3ITYA 2GLKA 1G7JA 3G5ZB 4FOKA 4V28A 1I8IB 3Q9PA 3QUYD 5CZVH 3TAKA 2PD5A 4PBDA 5FYLH 2VCBA 1INQB 1NFAA 3ZHDA 3WL1A 2O61B 4XMPH 3FTYA 3FEMA 4X99A 1INDL 3VCLA 3LKQB 1FV1A 1PYMA 5DQJA 3BVJA 3TT1L 4Z8FL 4E8DA 2HK0A 1MFEL 3ZL4L 4NGHH 1INDH 4BWTA 2I56A 3BEWB 2WJZA 2AMUA 1HYSC 4BEUA 1BZ9B 3EJPA 3P54A 2FWLB 3DHMA 3T55A 4E42B 3ZS4A 3NZUA 3A9BA 2D4DA 1IM3D 3IETB 2C3ZA 5C97A 2PXYA 5JUEH 3G1HA 2GI7A 4WW2A 4O13A 4GH7B 2P53A 5IROC 3GXIA 4FCAA 5JTWA 4MXQD 5B3JF 2E6AA 3BFOA 3OKNA 2GI0A 1BXUA 4X22A 1UOZA 4YPGB 2ESCA 3HE7D 1QTYT 2NXZB 4YZWA 4OV5B 2AJVH 3HEIB 3ZYOA 4EDWH 3WF2A 1G1YA 1G7VA 3PAOA 1KCSH 1IGFH 5CZXC 3MRIA 1P4BL 2VE6A 2DUXA 4Q33A 5SWSD 2Y7MA 4LDLB 3SGEI 2CO3A 5M1TA 5BOPA 1MQPA 1V6UA 4PMRA 3PFMA 5HD8C 2W94A 2OQYA 1T0OA 1XMEB 3HNTL 4XZBA 3H2EA 3G3LA 3VXNA 1YEFL 4F37F 3WIAA 1P4BH 3GJFH 3AADB 3FONB 1FN4B 5T26A 2OX5B 1RPUA 2APXA 3J2PA 2EXYD 1M2OA 3E6HB 4KMQA 5EU5A 4N7QA 4ONFL 1XGDA 3OMNB 1JNNL 1U8PB 3Q5YA 4EO5A 5E94B 4PGDB 1SQ2N 2XTLA 4IBYA 2VVSA 2XCMC 3KJ6L 4RFEB 1W9VA 4ONFH 1NA8A 3FQ1A 4DX3A 1JNNH 1QNRA 3VFGL 4MCMA 4PB4A 3CLFH 4M6NL 5AHNA 2LT9A 2IPTH 1DBJL 7CGTA 3H3BC 1B0GB 5ANMA 3MJ8B 3DYMA 3JYBA 2W9EL 4FTVB 1MF2L 4S1RH 1S9WA 4O50A 3CH1B 1A4KB 4C5ZA 2PDUA 1THAA 2E9MA 5L88L 1N5AB 1HQRB 4J3OD 4Y5YC 4AJWA 4EJ1C 4RVBA 2NXGA 2MHAA 4G8TA 1F90L 5KG9A 4ZQPA 5FAAA 3L13A 2TODA 1P5VB 3H22A 2XTJB 3BGMA 2VAJA 1MDTA 2P10A 3DBXB 3KHJA 1PY4A 2BVEA 1TVBA 1BAWA 1BFVH 5D37A 5ISZB 1NMCC 2F84A 1S7SB 4OAWB 3KZ8A 4DZBB 1K8DA 2SEBA 3QR3A 1XD1A 2Y7QB 3HB3C 2BDQA 4S39A 1P6BA 1QSFA 4YE4L 1W54A 5BUPA 5B7EA 4AV4A 4UQEA 3E6EA 4F3HA 5KZ6A 4GC4A 2PP1A 4MMXA 4V27A 4KQ0A 4IHCA 3CH8A 4KVNH 2HE5A 9CGTA 5A2BA 3FSTA 4IRJB 1KWKA 2GY5A 4FI8A 3U2JA 4OLWL 2D23A 5IDIA 4HMEA 1W72B 5CUSL 1XLHA 2FR4B 5BNXD 4Y1AD 8PAZA 5KYWA 3GIQA 4UV4H 5FB8A 2HXAA 4HJJH 3NVQA 2WXGA 1E9OA 4GFTB 4J27A 1DUYB 5M5DA 4BZ2L 1UOLA 4IGHA 4D2NA 3QIUD 5CUSH 4WVRA 5I9QB 3ICJA 4YSPA 5IBXA 3B2DC 4ZFOL 4AZ8A 1BVKA 2PU1A 4NBXB 2PBOA 4XPTH 2Y8UA 4KCUA 3GJFK 3SPVB 1TSHA 5D38A 4JTKA 3MJ9L 4FAAB 1TTGA 5LXGH 1PIFA 4FQJL 4CMMB 3J27A 1ORSA 1PPIA 4H88H 2CBUA 1QK0A 2E9BA 4XD5A 1KIPA 3ULUD 2FJGB 3ES6A 3G9AB 5DJ8B 5DMGC 5FF0A 2VDLH 3V7AG 4I0PB 3NCBB 5D2VA 1XYLA 3APYA 3E6FA 2XM1A 3IPFA 1S3KL 3N6QA 3WIJA 2XX1A 2WW5A 3IPBA 3H70A 3Q5TA 3ARGD 5C9ZA 5CSBA 1EIXA 3QQ9D 3ET9F 2E77A 3VIOA 3I10A 3DGRA 2H90A 2ZF8A 2ARJB 3TE9A 3VIPA 1CVSC 1IF2A 2VFEA 4LLYA 4RE0A 1AGCB 2AZAA 5DTFA 4H9ZA 1TETL 4DOHE 1GKRA 4UIMB 3K3QA 3TBBA 4HPOH 5K9DA 2Q01A 3N2BA 1I9JL 1XC4A 2CLVB 5I6MA 1TETH 3ISRA 2FMNA 3N85L 4F8NA 3SGGA 1E4WL 1UZ1A 1VFBA 4UCFA 3O4LA 4Q4KA 3GSUA 1L0PA 1FWFC 1LVEA 4NIYE 1I9JH 5CEYA 1F02I 5C0FB 4NQUA 3SDDA 1U30A 4L9ZA 2R24A 5C0AA 2VR6A 1W0WA 2CR6A 1IIKA 2LU3A 3DLQR 3GI9H 3B56A 5TPWL 3AIBA 3UJIL 3RL1B 1P1ZB 2R14A 2CRMA 4JHWH 1XB3A 1Q7MA 1R5VB 2UVEA 4LVHC 1D7FA 1ZP3A 1IHIA 1KPUA 1U8HB 1YXDA 4R3SA 2FH8A 1FI8C 5JYLA 3GH7A 2WUBL 3ANVA 1T2QL 1Q9LB 3II1A 2OMVB 3F4DA 5TPWH 6PAZA 3ARFC 1W0VA 3DGGB 1BHGA 4YL4A 3AMCA 4KI5F 3NIYA 2Z2UA 1C16B 2WUBH 4QQUA 5T3XL 1D6EB 3QIBB 2GABA 4XMZA 2HYMA 4PJ9A 1OT1A 5BUAA 3GUTA 1QVBA 2VC9A 1UB3A 3FULA 2NY4D 4NKIL 3V7AE 1MELA 2HX8A 3JVAA 5B39G 3G6AA 2Y72A 4JPWH 3MBDA 2M2DA 1FA4A 4GRWB 4UF7C 4ZB0A 2G9KA 4PSPA 4RSYA 1G9HA 3DNKA 3D1MC 1FUNA 1C29A 1AG1O 5SX5K 3NCWA 2V30A 5MP6L 3KXFB 1FOBA 4JL1A 1XCWA 1ML0A 3VNKA 1JWMA 3GEWB 5CEWA 1WH0A 2WBJB 4ALAL 4L8DB 3WKNA 8A3HA 4GRWF 1KNOB 3EWZA 4CU8A 1OFAA 1CF1A 2ZCHL 2OCCB 4I5XA 3BN3B 1TPXB 4ALAH 3O63A 3CAWA 3SDAC 1QRQA 4Z3GA 2LGNA 4Z7UB 3WY3A 1DLHA 3F03K 4U6TA 1BP3B 4QHMB 3MCG1 4I13B 3ZZ1A 4XZ9A 5SX4H 2ANUA 3EOAA 3FN3A 4GG9A 4JBSA 3K6FA 4D6HA 1O6TA 3US0A 4XMKH 1AL8A 1G9ML 4M8RA 4KT2A 3KS5A 4FHAA 2ID5A 1PY0A 1AKJA 4WNSA 3AU1B 4X5XB 2BSTB 4OZFG 3AB0C 1H0IA 1HKVA 1W9PA 3FQWB 5AC8A 4LS2A 5E93A 4B2DD 4AZCA 4D71A 5IREA 3MKKA 1FNHA 4C5YA 1BD2A 3BDYH 4TNVK 1NBYB 1B30A 4DVBB 3T0TA 4AZHA 1KYOK 1WXJA 4I5RA 4JR9L 5FEZA 3GQYA 2CJUL 4LGRB 1OC7A 4LYRA 1P6FA 1GGIL 3MGOA 2HJLA 3RTQD 3W7PA 1NGYA 1V51A 1VJZA 4UV7H 4L4VE 3BIKA 2R4SH 1JPSH 4YXHH 2CJUH 2XG4A 2EG8A 5A6LA 1YMMA 2YD3A 2PDLA 5EUOE 3HG2A 1G7JB 3QO1B 2D0GA 3BHBA 3D85B 1F8TL 4Q4IA 2DICA 1TXKA 5DT5A 2D3LA 4CW1A 4HSNA 1D9KC 1CFTA 5LCVA 4JGJA 3UTZA 2J7FA 4QRPA 4QRFA 1MDRA 3MLPA 4X99B 4M6QA 1FV1B 5FF2A 2J7LA 2OXHA 3O6ML 4G5ZL 4P7RA 2NX5E 1E70M 4LVNB 3PF2A 3U9IA 3T09A 3KGRA 2PWVA 3AZTA 1HKKA 2DZEA 2PTDA 4JG1L 5CCJA 1CMOA 4KO5A 1XLMA 1E9PA 3CCHA 4FHKA 3KVKA 4PV1C 3ALFA 2VXUH 2K9UA 5TE6H 4EXPX 2YD4A 1M41A 2F54E 1TQJA 3AY4A 2PXYB 1TREA 1E50A 4AE0A 1BECA 4ZE4A 4WW2B 1TYRA 4OJAA 4Z2LA 4X4XA 3E2VA 1CE1H 2EBNA 5JYMA 1AHWC 5HJXA 5AY7A 4D8PA 5FECA 1GORA 1N64H 3VNIA 4XBJA 3VE0B 4L3FA 4LBRA 3AO0A 3NG5A 3I6LD 2YXWA 1EANA 2E4TA 1NKRA 4A2SA 1V27A 1MW0A 3CNYA 4UDTB 3MRIB 4H8PA 2VE6B 4O52A 1TQTA 5AZ2H 2E8YA 5JH1A 3B0YA 4WW2F 3EAUA 2CKBA 3WDHA 2DLGA 1MCQA 3MGAA 2VLRD 4AY8A 4X4ME 3MRDA 3VXNB 3W56A 5FUCC 5DJCB 1MAMH 4O15A 4O02H 2OJ1A 2B7DT 2QKIC 2KLSA 2V5SA 4GVGA 4F9PA 4B60A 4PTVA 2X4SB 1ONXA 5EU5B 1Q6LA 2QSCL 1T5XA 1CDUA 5LQBL 1NFPA 1PZ5B 1H3PL 4J8RA 4A55A 3KWWB 4JHAH 5DRWA 3BXWA 2JKRM 4J2PA 3NMEA 5HQMA 2YFNA 3CMJA 3Q65A 2PO6C 1PMYA 2QAFA 4XTIA 2ON3A 4A39A 1JOIA 1IQDB 5DMNA 4L1BA 4Z77A 5DHYB 2QSVA 3WIHH 4O4WA 3UT0A 4AQZA 3PQYE 2IUZA 5FA4A 1DN2A 4JM4L 5ANMB 3JUGA 1DXEA 5GJNA 3CV5A 4NN7C 3WTVA 1E5BA 3FU6A 3TFKC 2XWTA 3UYRL 3RCNA 1R3KA 3BXNA 4M3PA 3WZ0E 1SPQA 3RUGA 3BLBA 5IF0A 5KJRH 2MHAB 3BSHA 1P4LA 5KG9B 3UABA 3UYRH 4WDIA 1KTDA 4B9FA 3RVVC 2J4WL 3G6MA 4Z7NE 5JOPE 3KR3L 1GEQA 2CERA 3UMNA 3PWPE 4KKAD 3SDXA 4Y16B 3RQ3A 4JM2D 1TVBB 4HQQL 3WNNA 3UJFA 2J4WH 2SEBB 2YA1A 3O07A 3RITA 4LW7A 4POZC 2WTOA 4LC6A 1XGQA 4MNHA 3KYOA 2WWKT 5FSDC 1J1XL 4AV5A 3BLEA 1QSFB 5IMLA 2R6OA 3W7HA 4TXEA 4NP4L 1DE6A 4MMXB 3CDGA 3WXVH 4QEEA 1CQYA 3U0TA 2EDXA 1M7XA 3RPIB 3C0QA 1EWHA 2I60H 3WV0A 4H9TA 2AJZB 4HUWB 4AYEC 5DZAA 5B4MD 2EIEA 2RTTA 5KYWB 4HJTA 3C0LA 3SRFA 1S5MA 2DJXA 2ZCLL 3UTTD 5CJXC 3EB2A 3ALWA 4WNQA 4C54A 4GRLC 2WTPA 4JZJC 2VOMA 1KLUA 3MJMA 4WW1A 2C9PA 4CKVX 1U42A 1BF8A 1P7KA 3W7IA 2ZCLH 4AZ8B 4U1JA 1Z44A 1ET7A 2FGBA 3QDME 1BVKB 4J1OA 1UKSA 2FSDA 4GBXA 3T05A 5AYUL 4FC3E 4DP9X 2ZXEB 4MXWL 5H94A 1E3FA 2N0MA 1A7QL 3A5FA 1ORSB 5FGCE 1P6AB 3GPSA 2I7OA 3KUMA 4APQC 3DBNA 3AS1A 5T3XE 1KCVL 1OF0A 3O6LH 3EPNA 4WDXA 1PIGA 1QK2A 3E6FB 1QT1A 3EOTL 5AKRA 4OOZA 3UBXA 3H55A 1TQWA 3PBMA 2EXWD 5GRXG 5FUCE 4OR1A 3DX9A 5IWLC 4AT6A 1KB9J 1JF5A 1ECYA 4OLZL 3ARSA 1TQSA 2UYLA 4M43L 1GAFL 4LLYB 5KUKA 3VGGA 1W2KT 4UNUA 4RZ4A 1A3LH 3W1TA 4IFKB 4GNVA 3OXSA 1PSCA 3GXUB 5KS9A 2HWGA 3CMOL 5IESH 2LLEA 2J24A 2YIHA 3KBSA 1TJIL 1QLRA 5C3IA 2XOTA 1FORL 1IGML 1TZHA 3AW5A 3O4LB 5A6IA 4WNJA 3UGXA 3GM8A 2WAQA 3IDMB 1PBGA 5CEYB 2WANA 3KVJA 3SDDB 5F1KC 1GKQA 5AKVA 3BE1L 4XGZB 1W0WB 1XL9A 3ABKB 1TWIA 1HYSD 1GA2A 3OAWA 1VCFA 3F3HA 3VI4A 4DAGL 3IJQA 4W6XB 3VFMA 1HXJA 1IVTA 2CR0A 3HUJA 1S7VB 1KPUB 5CU5A 3HI1A 3ANYA 4KRPD 2VDRB 2HCZX 4H6KA 4M7ZB 2IDSA 1U8JA 5I6PA 5HHVL 1BA9A 2NYYC 3NURA 1ZY9A 1ASQA 1FGVH 3JYCA 4M7LH 3B6SA 3KBEA 4MQSB 2IXQA 2W8CA 4KO6A 1LRQA 4PJ9B 3DECA 5IBLD 5BS0B 3GUTB 3C2OA 5HHVH 4JAMB 2FFCA 5D03A 1HOEA 4HZ8A 3E0GA 4M1DH 4OZHA 4O10A 4OJFL 3G6AB 1R85A 1NIEA 1TPFA 2FATH 2ADJA 5IMMB 3UR8A 1XEDA 3ZHKA 2VQ4A 4RGNC 1GY2A 3PS6A 1OHZA 3RHGA 3CVIL 1AW2A 4A67A 3NPWA 2WQSA 3I7SA 2G0LA 3DAQA 1MFVA 2WKLA 4HIJA 3THAA 1T7XA 2HMIC 1IXPA 3PBUA 3KHQA 3LCIA 1MW1A 3CVIH 4YLCA 3JWDH 2N7SA 3W2UA 3FTUA 4NUGL 5GJPA 4HFWA 1NOAA 2VDPL 4KY2A 2AQOA 2VR5A 2R82A 2YAOA 4CNNA 4WHYH 3GRIA 4MWAC 3G3MA 2ZSVA 5G4OA 3GRGA 3N0PB 2CGRL 4NUGH 4YL9A 4J2MA 5AB0A 5J57B 1FFNA 4OF3A 1IZCA 3LB6C 1CE6A 1M6UA 3LY6A 3WEOA 1DLHB 2X4NB 4BE5A 3QJFA 3ULUL 1RQEA 4DO7A 2OMZA 5LSMA 4O0KA 1F73A 2VGBA 4W9DC 1A53A 5EFDA 5FJIA 1YECH 3AUJA 1JZ3A 5CP3A 4P9ML 4W87A 5D05A 2ZA1A 3URNA 4NZ1A 1BBDH 1SHSA 4WJXA 1BEYH 2MTAA 2P1FA 4TQEL 2FMOA 1JF6A 1ZHNB 4MS6A 4R88A 2F1EA 4C90A 1CD0A 3LAFA 4S3EA 2NQ3A 2TYSA 1KGYE 2KHAA 1D8CA 5DMKB 4NJHA 3MGOB 4H9UA 1NGYB 3QPXL 3W7EA 1C12A 4JJOA 4ZSUA 1YMMB 4LOFA 2CBIA 4RX4A 3O2VL 2OEJA 1QFUL 3BHBB 1QNOA 4MS8C 3QPXH 4DUXA 4TQ8A 3MUHL 3ZL2A 5JIHA 5F2MA 4HS8H 2WNWA 4EWND 3RPMA 1Q90A 2GSGB 1CFTB 1I9RL 3UTZB 5KEZA 5B38A 4C55A 1A2YA 4QRPB 2ZNXA 3WKZA 5DO2D 2Z35A 4LQ1A 4P5KA 2V3EA 3UG4A 1UA6H 3S34L 4JMNA 4ZX5A 4I3RL 1RULL 3M8OL 4ZJ9A 1I9RH 4OFDA 3V75A 3VRIB 5U7SA 1A3RH 4ZBCA 2NUWA 1ZT1A 2CBMA 4DGIH 1E9PB 4FE9A 1RULH 1E5NA 1PZCA 3N1PC 4ADUA 3GKZA 4HWEL 1UATA 1ZHBA 2WLNA 3O3EB 3GS4A 5AQ0A 1XINA 2HMCA 1WTLA 4A8NA 4ZR8A 3IFOB 4ONGL 2FX8L 4BFIB 1YYLL 2J7CA 4X4XB 5DMGD 4QO1B 3CUIA 4K2UH 3AC0A 4D8PB 1L6GA 1OAKH 4UQAA 3O8XA 3ONBA 5CHNA 4K8EA 2FX8H 4DSYA 3TR2A 1CL7I 2NX1A 4MHHG 5T91A 1RURL 3S8FB 2DJMA 5DUJA 3AS3A 4DXXA 3F01A 2W63A 2CKBB 1KFWA 1P69B 3ZDZE 5CJOH 3IKCA 2GQAA 1SEBB 4HU2A 1LDSA 3B8SA 3US9A 2ZG3A 3OBEA 2DH3A 1EEXA 3N3MA 5BZDA 4DK5A 3JWDC 1T4KA 3JWNH 15C8L 5BJTA 3KRSA 4MRCA 1NL0H 1UYWH 1XB6A 2VX4A 4J8RB 4FD0A 4C6BA 5DRWB 4ERAA 5ID0A 1SXCA 3AG2B 4U6XB 1ZHKB 1U8IA 4QKXB 5JVLA 4K23H 2CHNA 1A9EB 3NSXA 15C8H 3OPZL 1L0XA 2YW3A 1QOPA 3QUML 4JFZL 4TNWK 5AVUB 1NKGA 2ZOLA 5CCGE 1NJ9A 3FO9B 1MHEA 2NX5D 5SV4A 4IPJA 4BWLA 5C6MA 5AVRB 2WPBA 4PY8J 3AWOA 1KM3A 2CHXA 1DSFL 5FA4B 3QUMH 2GOKA 4IU2A 1V7YA 2A7RA 3VFTA 2Q71A 3FXIC 2IBZY 3H2OA 2XWTB 4KETA 1R3KB 3BXNB 5H91A 3CWGA 1M6JA 2BVDA 2F54D 1MPAH 3RUGB 2D3VA 3CO4A 3VI3E 4HJEA 4RETB 5IF0B 1S5HA 1P4LB 1TMCB 4I18C 4MZ3A 2RMNA 4W88A 2HRPL 4WDIB 3BGFB 4QDMA 5FV2A 2C13A 2EIBA 3UZWA 4FZ8L 2VSDA 4LHQB 4UR8A 3NH7H 3R1GL 2AXJA 4IU3A 1XCFA 2X1SA 3CC1A 2BWGA 3S3DB 4F7MA 2DQWA 4IHOB 4R5EA 3DJZA 1CYGA 1XGQB 4MNHB 3KYOB 3RUGF 2YZRA 1FWHC 1CXEA 1INQA 1D5XB 4PBWD 1L9OA 2YK1L 1RCYA 4WHYG 4HUVA 3MC0A 4BJHA 3K8MA 5DFAA 4YDIL 3TN5A 2WQVA 1EYWA 1WIOA 1RVFL 3SDXF 3CHSA 3LKQA 3PK7A 1J4EA 1FKXA 1QPOA 2YK1H 4KS0A 2V7NB 4Q3MA 4X9IA 4NHCH 2CAKA 4DERA 1F3DJ 1SEQL 2A3BA 4H7VA 2VMFA 1COBA 3BEWA 4R5XA 4WF7A 4HBQA 4BHYA 1KLUB 4WW1B 3MA7A 1BZ9A 4BE6A 2BFVL 2VMJA 3QC5X 3S2AA 4KMTL 4TUUA 3N1GC 2NY7H 2GPTA 1TEFA 3IETA 3OB8A 4UBDC 3D2UB 1NGZA 3L68A 3EBHA 1X6UA 4Q0XH 3Q7JA 4OVVA 4A2HA 4GBXB 2NQZA 1EMTL 3B7RL 1SR9A 1U3HD 3PQYD 1MRAA 5H94B 2YR1A 1RH9A 3T2OA 3ZJKA 4YPGA 2YD8A 4HSAC 1XVSA 6XIMA 4N3UA 5HVHB 6XIAA 1EMTH 1SJXA 3WS6A 2GK2A 3S9DB 4YWIA 4LEFA 1QWUA 2CXEA 4ZB5A 3KTSA 3UBXB 4WSGA 4PRHA 2QIIA 3AMGA 4J9JA 5JOPD 3I85A 3DX9B 2HVBA 3ZO0A 3PWPD 2XTKA 4AT6B 1KYFA 1IB5A 3FONA 2OX5A 2A9CA 1QZ1A 2UYLB 4JQ2A 3WH6A 3CFEB 5GS3A 1UD8A 4ODWB 1QNZH 3CFUA 3FOKA 3SRDA 1CW2A 4YTUA 4GOSA 4D6CA 1U8PA 3EFDL 3JWNC 4PGDA 5K9XA 2BSED 1E0XA 1FWCC 3KPSE 4UNIA 2Y0FA 1QLRB 1XIIA 1JN6A 2M8XA 2UUDH 4N20A 1TZHB 4A05A 5KBDA 5BWFA 3ZTNH 4ZTPL 1M42A 3AG1B 4NYYA 2F1BA 3WQ8A 3RU8L 1ID5I 1B0GA 3OJVC 3TBWB 4PG2C 3QJVB 5KS9F 4FTVA 3VI4B 2AJUH 2X44D 3AGVA 2O5ZL 3CH1A 3ITXA 4BXVA 1A4KA 4YSQA 4HJIA 4OIIH 1T1WB 1N5AA 3PP4L 3HUJB 1AHKA 2JI2A 5CP7A 3HI1B 2QHAA 2NYZA 3WX7A 1ZBKA 4G1EA 5CJNA 4X9BA 1U8JB 4MNQA 3DBXA 4AIBA 2AXHA 2YL5A 4BJLA 3NIFF 3H2NA 1R3RA 2EIDA 5A8OA 5A6BA 3VINA 5GRWA 3T4AB 5HDBE 3DV6A 1TQBB 4N0FB 4OAWA 4ORZC 1FYTE 2BJML 3BWAB 5T3XD 4DZBA 2A6KA 2VDOL 1A25A 1KWGA 2Y7QA 2DQJH 3QEQB 1PO9A 3JWNG 2BJMH 4KK8C 3Q6FA 1TQUA 2ADJB 2NNFA 4KRNA 5F9OH 3K1GA 3RAOA 4IRJA 4ONHB 5I24A 3M7OA 4UYQA 3JRKA 3UGRA 5AYQA 1W72A 3BDXA 1YXYA 2HXUA 4FK9A 2BLFA 2NZIA 3PAYA 2WD0A 3K2UL 1YA5A 4OZHF 5BVPL 1PLGH 4PD4K 3LIUA 3N12A 2WMHA 2CGZA 1A5CA 1OCWL 2YD6A 3VWJA 4PUEA 1QFOA 3K2UH 2IH3A 4B9PA 5TH2B 2EPOA 5BVPH 4HZ1A 5F1OB 3KYKL 2ZSVB 3SPVA 4OD1L 1FE8H 4LL4A 1DIDA 3T6VA 5L8KB 1OFPA 3NAAL 4O0ZA 1W8EA 3GKWL 3LNHA 2YBTA 4IJTA 4TSCH 5TDOB 4NWTL 4HXBH 1S9YA 1QFPA 2BIOA 3KTCA 2DVUA 1ES0A 2QCEA 4I0PA 4LFHG 4N1EA 5K9OA 1QW8A 4GJ1A 2GJNA 2UUDK 4HAGA 1H9DA 4NWTH 3FB7B 5C09E 5HUOA 3VD9A 3DG7A 4JGNA 4AGOA 4RMSA 4OLXH 4RV8A 1UZDA 4X7SH 2YKLL 2GK0B 3RBSA 1PZUB 4A3HA 1RUAH 3TEUA 4JFUA 5D7LA 3NTCL 1K1DA 2A3TA 4POZD 1AGCA 4O18A 4WGVB 1ZRQA 1YPZB 2C4FU 1NF0A 4UIMA 3T3MB 3LK6A 3JWNE 1R7AA 2MNWA 3HMXA 4L7ZA 2EDFA 3UYPA 3NTCH 3Q44A 2XSXA 5BU9A 2PLMA 1AIFA 4F57L 1R9FA 3DO4A 1CWVA 4EIUA 2D22A 1P43A 4AIXA 5HVWA 3CHVA 3RWDB 1CC3A 4YBLC 5C0FA 5B38B 2G3JA 1RAMA 1I82A 4E9RA 3AXKA 2DTMH 1E72M 1PZ3A 4P5KB 1ME7A 1ETB1 3V0EA 1F58L 3F64A 3RL1A 3MODH 3GVRA 4O5LL 3TU9A 3MRBA 2Z8SA 2E9LA 4HK5A 4OCMC 1U8HA 1ZT1B 3GG1A 4IOTA 2D31A 4KBXA 1Q9LA 2FLRT 1GGUA 4DK3A 4LQFH 4P2QE 1LO3L 1JEZA 4PRPE 4O5LH 4NAMA 3T0CA 3DGGA 3GYRA 3WFLA 3B2VL 1XQKA 2GJPA 5CAYB 3QIBA 1JNEA 4APQD 3TN0C 1A4MA 3KBMA 4DQAA 2NVAA 2X0VA 3GNMH 3RVTC 2JKPA 2Q5BA 4Z7QB 2QXWA 5E6SB 4FXRA 1DL7L 3B2VH 2ZZ4A 4HNNA 3O8XB 2JWYA 1ZU8A 1ITUA 4FEMA 1BFSA 3AISA 2F19H 1B3YA 3UR5A 1AXTL 3CTLA 4LSUL 3O45B 1O5QA 4OH2A 2JKIS 5DJZA 3H7VA 4YLBA 4OLUH 3NEEA 1DL7H 4CD6A 3LKOB 3MLWL 3LEVH 4HA3A 1WRFA 4MNKA 3RKDD 3W01A 2X1WL 1KTKE 2FJKA 2HXTA 5MEOA 2RDXA 3HG0A 1RJLB 1B1YA 2OMUB 5E6ZA 4X5PA 1GHRA 4C58B 1YEGL 2WBJA 5E1QA 4L8DA 4L1GA 5BZDB 1KNOA 3RLHA 2NUYA 4US6A 3QKEA 3G1YA 5BJTB 4GUCA 1B90A 1NFIA 4F9DA 2PTZA 2EEAA 1OM9A 1YEGH 1OJXA 1CD9B 5DEZA 4QJ4B 5LNVA 2LU7A 2EPLX 2IOIA 5ID0B 1YEKL 1U8IB 3QC3A 3MO4A 3FHEA 4B3LA 3U25A 5FWRA 1F8IA 1KNWA 4QHMA 3IS0X 3KAAA 1MHEB 3V6ZA 4N9EA 1F4XL 4PJ7A 1PKQB 4HP5A 1NWRA 5AAWC 1G0YR 4JFXA 3LIZA 4F58L 4X5XA 3AU1A 3CL8A 3EJUA 2BSTA 4IU2B 4PW3A 4YHEA 1UXMA 4U1LB 5E08H 4HUXA 4AC1X 1N59A 1X5GA 4W9LC 4UZGA 2J74A 5IM7B 2ZUMA 2YXXA 5G1TA 1S4IA 3H7LA 1NBYA 4DVBA 3QE5A 3ALGA 1S5HB 2VISB 4X5WB 3ZE2E 4OCXL 3PDGA 5AYXA 4WTXA 4Q6IC 1CPUA 3L7FA 3UY7A 2XWJA 4N42A 5HANA 2WC3A 1G4SA 1MCIA 3G0SA 4IU3B 5CZVL 5FYLL 3V6BR 4B95C 4F7MB 3NXFA 1CDYA 5D04C 3FU0A 4MSSA 3TOYA 1AQ8A 3QO1A 4XMPL 4B3ZA 3D85A 3E49A 1I4NA 2G2RB 3VCRA 1TQXA 5BZAA 2G3FA 1LILA 3GMRB 4ZS6D 3APFA 4HUVB 2YEQA 3ANUA 3QG6A 4NGHL 4Q6XA 4WJ5B 4M6PA 5DRIA 1J8HB 2Z7KA 3K74B 4MJID 3K91A 1XBXA 3TZVD 1OT2A 1SN5A 2J6EA 4PP1D 1TO5A 2NQDA 4ZPVA 3V0GA 1KM1A 4OFYA 3S3JA 2WSQA 5JUEL 3TJLA 3MA7B 1P4IH 5CJ8A 5CGTA 2JKTM 2IFFH 1DJQA 1HGYA 4LLWA 2VDQH 3AROA 3T9PA 4IF2A 1NGZB 2VN6A 3PJXA 4HGKC 3PIQA 1G67A 2OZ4H 1CD1B 1B4EA 1BGGA 2AJVL 4NN5C 4OCYH 4EDWL 3TTSA 1SFTA 1KCSL 1IGFL 4LUTB 3HRPA 3G5XA 3WE6A 5JUVA 5DELA 5CPTA 3XISA 3VE0A 3QLDA 4K7PH 1S7WB 3SPCA 1XH1A 2GIXA 1G4EA 4YPJA 5KVEL 4WAFA 4YVPA 3MTWA 5AYIA 3HBQA 4UDTA 3PB0A 4X6CE 1XLGA 2VR3A 4XVJH 1NINA 1CXIA 4K5LA 2HP4A 4XX5A 1CECA 2NTSP 4PRHB 3WKPA 5KVEH 3GTFA 1PE1A 2QADD 4PJBB 2FPVA 5E2WH 5DJCA 4KKNA 5TIMA 4PMJA 3TROA 3TONA 3RY6A 1RVKA 4U5IA 2X4SA 4GIAA 4W9ZA 1CZ8H 4GISA 4A7GA 1PZ5A 5IIEB 5D72L 3CLFL 1WUEA 3KWWA 1G7IA 4QAWA 4QTHA 2IPTL 4C6IA 2D24A 1JN6B 3EHBC 1KGCE 4M29A 5D72H 5EF0A 1IQDA 4HK0B 4UT7H 2XN0A 2D8KA 3DX4A 5DHYA 1JDDA 3E38A 5T1DH 4S1RL 4KX9A 4CD5A 3MJ7B 1FAKT 1ML1A 2B1OA 3QDJE 1HC1A 5E6UB 1L9NA 4ZMXA 3KWTA 5CJMA 3TC9A 4HCLA 4CQAA 4BZ1A 3ZT7A 1ZLSH 2EVHA 5CP7B 2A5UA 1LZOA 4P0DA 4E9XA 4O1DA 1BFVL 1Z9AA 3P2VA 4G1EB 4RISL 4MNQB 4HV8A 1WIUA 2O6DA 1EJ6A 4N68A 2VQ1B 4HOXA 4KWVA 4LAOA 3TNOA 4Y16A 3AAZA 3DV6B 2XZAH 4RISH 2A6KB 3HZKB 4KVNL 4JXCA 4Y4FD 2CRZA 1T6VN 1ID2A 4Y4KC 4Q8MA 5LBSH 2B7OA 4X5LA 5C8JB 4GIEA 3BQUB 4NI8A 3BAWA 3Q6FB 2DEXX 4AHPA 4DJMA 4UV4L 1UEMA 3EZJB 1FWDC 4HJJL 2IPFA 3RPIA 4NVTA 1DVJA 4MLRA 1S9XB 2DBJA 2AJZA 4OJCA 4HUWA 5L2KB 1TF4A 1S7TB 5IRPA 1MFNA 2Q76B 2D2OA 3FYOA 3QC6X 1SN2A 2E3ZA 4XPTL 3Q6GH 1J9QA 4KQNA 1XKYA 1PZSA 1MUCA 4RDQG 1ADDA 3KPSD 3VWJB 4AITA 1HHIB 1KN2H 3X12A 5LXGL 4OIAA 2IH3B 3PZ9A 3I6EA 4H88L 1HCYA 1BSLA 3MBXH 3WLJA 1KYOJ 3QNXA 4ZMPA 3GHBH 1UD6A 4EPKA 3O1NA 4RESB 4RNJA 4HX1B 4OBSA 2VRQA 3AWNA 3D05A 3CH9A 3SEPA 4PVNA 2VDLL 3QYCA 5DLLA 3SCMC 4DO6A 5I09A 4Q8BA 3FUNA 5E6ID 4B15A 4DBEA 3MUUA 5HNNA 4XN2A 4GY1A 5EO1B 4TTDD 4GG6E 1S9YB 1OHQA 2PW1A 4GCAA 2TAAA 1ES0B 2FTAA 5CBBA 2BY1A 5TFSH 5K9OB 4B4HA 4UQ9A 3FO2B 2N56A 1H5BC 1MHPH 5E8PB 1U1UA 3VNMA 2I5IA 4J3VA 3N41B 3QJQB 4KX7A 3P82A 4S2SA 5IOKA 1OW0A 4X9YA 4HUCA 3R89A 1FYTD 4HPOL 4FG0A 1AMKA 1ANUA 5D7LB 4OCSL 1YX1A 3MMUA 2J72A 3FSVA 5BVJB 2K6WA 3WNLA 5D7SH 4IFKA 2YGNA 5GGTH 1A6WH 5ICUA 3UYPB 1TTPA 4OCSH 2K7QA 3QUKA 3NBNA 1AIFB 4LKXB 4KESA 4AVJA 2FRGP 4HULB 1M1SA 4HA0A 3GI9L 2OJZH 2BS8A 3X13B 1QSEE 3IDMA 2JB5H 4HUUB 5A8NA 4FFYH 4JHWL 2EAWA 3NQAA 2DMBA 5FO8A 4XGZA 4YIQA 4LGXA 4XR8C 4QRUA 2CO2A 1WHPA 1TWWA 2GJXA 3MRBB 2X9ZA 35C8H 5CO1A 1S7VA 3NDZA 4NP7A 2WO2B 3OWRA 4WZHA 1CIUA 4B5NA 2D31B 1A7OL 4UQ3B 2ZP9A 4ORGA 2J8GA 2OKOA 1VFMA 1VRDA 3H3PL 3D8MA 1NCAH 1AS6A 2X1QA 5H2BB 5T5NG 1A7OH 3LJ3A 2AVFA 3EOSA 1YNPA 4JPWL 5BS0A 3H3PH 4PL1A 3H2AA 1RY0A 1WTGT 4JAMA 4TOQA 1XAKA 5FLUA 1LUCA 1L0QA 3DRQB 3H2QA 4YL2A 3IN2A 4ROQA 3BTNA 1RCOB 4OCRL 3G6JB 3T78A 5IMMA 5C09D 5FYLE 3TSBA 5DJZB 3UBPC 3QQWA 3MHGA 4OCRH 4KNUA 3VTTA 2VHLA 3QXBA 2X2UA 1JAEA 4BHUA 1W8NA 2ZRYA 1UH2A 5MEOB 3TWCH 4XCCH 4QS5A 2A7PA 5IJDC 4RE2A 4LVGA 1XBDA 3TV3L 3G6DH 1DXFA 2WWMC 5LGKA 1ZGLP 5BO0D 1NFIB 5EZJB 3AI0A 3OG2A 3TV3H 1WDQA 1I8LC 3S4TA 4XMKL 1YW1A 3SQRA 2QLYA 3IJ9A 2BX7A 3FU3A 4Y5VB 2X4NA 1JK8A 1PG7X 2XZZA 3QRBA 4PB5A 2JB6B 3AUVA 3V6ZB 4PJ7B 1NAL1 1CDBA 2OGJA 3K81A 4JFXB 3VXUE 4HCFA 3BDYL 3QHZH 4FNTA 4CEUC 2YL8A 1UD3A 1KCKA 1CN4A 3CTTA 4P2QD 4HUXB 1N59B 3CVDA 4PRPD 4Z7WE 4Z7UF 4W7UA 4P23D 2WOYA 1H3WM 5KVEE 1X9LA 2BHFA 4XAWH 3VQ1C 4N9CA 2XA3A 4UV7L 1F4HA 2R4SL 3DHDA 4Q9CA 3B4YA 1JPSL 1ZHNA 4YXHL 3L17A 3RGTA 3BAXA 1U91B 3IDYB 3W7CA 3L7FB 2WMPB 2V3GA 2BVUA 2XWJB 2KERA 4KKQA 4MZRA 3QV8A 5HI4D 4LFHD 5DMKA 2FT6A 2XC8A 2PPDA 3V4VH 3W24A 4XB3A 4LCWD 2E75C 1D3HA 1IT0A 4E68A 4NO0B 3P4OA 3ARBB 4MDIB 1T04B 4Y4HD 1MW3A 2GJLA 1JWSA 5JIMA 1OP9A 4L1DA 1BRLB 3E1ZA 4HH8A 5AFDA 2GSGA 1AC6A 3E3QC 1HSBA 2ZYHA 4G11A 3QG6B 4NRXB 2AOSA 2A6NA 4JYEA 4N8VG 3QYNA 3QQXA 5EORH 1H15A 2NV2A 5B7ZA 2F53E 4H0HB 2N7AA 2PB1A 3U1PA 2VXUL 4ZPVB 3VRIA 4LS1A 5TE6L 2PUZA 2BRRL 3GSVB 3A67H 4C8XA 2KZHA 2NY0C 1RLWA 2F9BT 4D0CB 1NUGA 3T42A 1CE1L 2DWEA 3O3EA 4RMBA 4GKSA 3N1AA 5G4EA 4LLWB 1EPXA 2BRRH 1N64L 3PIQB 4O00A 4DGYH 3ZRCC 3IFOA 5ENWB 4BFIA 4REQA 2BP1A 2XH7A 4QO1A 1I7UA 3G5XB 3WE6B 3HG1A 1W3HA 1OGTA 5AZ2L 4JHVA 2P4AB 1ETZB 2ZAIA 5IBUG 2R0KL 1TJMA 3IIPA 4AQEA 1MAML 4UUIA 3BVTA 4QTFA 1G69A 4O02L 4IPLA 4L4JA 3MZ2A 3LPFA 3NRPA 3NJNA 3TXVA 1SSDA 4JE0A 1HIZA 4FXJA 2R0KH 3J7HA 4YDJA 2ROXA 4PJGE 1FCUA 2ZZ7A 1WYJA 2GZXA 4Z0BH 4NM4H 2ZE0A 3LKSA 4GT7A 4F9LC 1SEBA 4ESKA 2FVLA 2VMCA 4DWSA 5DVLA 4JHAL 3N14A 4K8RH 4OCNC 5I1EL 5EU7C 4Z1AA 5EMUA 4AW7A 5D1QA 2OMAA 5DVMA 1L9PA 1G7IB 1ZE3H 3SURA 1K2DA 5I1EH 4QTHB 4XVOA 5PAZA 4PWGA 1ZHKA 4U6XA 4GXWA 5DZ9A 2VIRA 1VJIA 3H85A 3WIHL 1A9EA 2APWA 3FN0H 5D2NC 4QI3A 2VRAA 1U8QB 3L5JA 1OO2A 5GS1B 3FO9A 1XIJA 1JGLH 4LTSA 2ZWKA 1E55A 2EKCA 4KHXH 1EAJA 3GINA 4QCFA 5KJRL 2QJMA 2W4XA 3P4MA 3ZTCC 1FG9C 3BAKA 2R29A 4ZMTA 3QWQB 3DBSA 3EYFA 3OF6D 3P3YA 1X96A 5HMFA 3OXRA 1D9EA 4P8XA 4MAYD 3KLDA 1BQSA 3W84A 3MDJA 4HV8B 3CZNA 3N43B 4A2FA 5C7ZA 2RFXB 3FF7A 2OCFD 3AAZB 1WE5A 2H0FA 1SO3A 4IHOA 1QX1A 3OKKB 3WXVL 4ML4A 1P1MA 2RACA 3G5YB 2I60L 2DQ6A 4BK8A 5AW9B 4NHUA 5ABGA 3W5MA 1KV5A 1D5XA 3FB8B 5BOJA 4LXFA 4NKCA 1CLZH 1H1YA 3G3DA 3WTUA 5FR3A 2V7NA 2ZAGA 4NJKA 2BNJA 4YVUA 5K2ZA 2AI0L 3NL2A 4GVIA 4HHPA 3UP6A 3RWFA 3QUXB 4MFHA 8TIMA 3KDMB 5KZDA 1MXGA 3IAPA 1PKOA 4MG4A 2AI0H 4ICMA 1WGVA 3X12B 2E7CA 5CBJA 3S0CA 1FWJC 3D2UA 1KGCD 1R33A 1A3ZA 3LPWA 4JGDA 4N9BA 2C15A 2NNCA 3QNXB 1YDOA 1CS6A 4JTUA 2AEOA 1PCXA 3FYPA 1KXQA 2Q8ZA 4ABVA 5E8OB 1WA3A 5E1HB 2Z4QB 3O6LL 2H6UA 3LZQA 4LJ3A 3QDJD 4LSRH 2VLKE 2V6AA 1A6TB 5C3TA 4F8XA 5D7IE 2OYKA 1B0RA 5FGSA 3L1FA 2YOCA 5FGBC 1E1EA 3CM4A 4AEOA 2PW1B 3VX0A 3VXTA 2KQNA 3EBGA 2E3VA 3TCLA 3OP2A 4GH3A 1W16A 1N0LB 3CYVA 3AT8A 2EEDA 2Y1AA 2IQ0A 2W79A 3CDYA 5AZ0A 3FJ4A 3ZJ8A 4F2TA 2PYEE 3WLTA 2DV6A 2VX5A 1A3LL 1FHNA 1BQRA 5F6HI 4PH8A 4S2SB 5EU6E 4OZIE 5IESL 4EKXA 4UR7A 5EU7E 3CFEA 2WCPA 4ODWA 1JZ5A 4AD3A 1EF2A 4K8RC 1DWFM 3TA3C 2ZXAA 4KK9C 3T44A 4KNTA 2NY1B 5E4AA 3B8TA 3ILDA 2X1UA 2NNAA 1TOXA 2HB0A 5C0CE 3QUKB 5KBLA 1ZE3C 3D3AA 3RN6A 4OZGB 4LESA 3F5WB 4PJEA 4XTRC 1ZNNA 5ACZB 3PWLB 3EDKA 4NAFA 3L3JA 3VD2A 1OFOA 3RKPA 4DQWA 3I68A 5DEFB 3BWWA 3TBWA 5FO8B 4Q4MA 4YIQB 3VQ2C 3MTRA 4O12A 3UBHA 3GSNL 2FZBA 4QRUB 3TMQA 2GJXB 3ZPDA 2RR3A 1FGVL 1T1WA 2H3NA 4M7LL 3UAJA 3GSNH 1KEGH 2V68A 1LLOA 4S1FA 2X09A 4ORGB 5IROD 2P8PB 2FQEA 3HLKA 2WXJA 4AY0A 4ZTOL 2LV4A 4OT1H 1TX2A 4LLQB 2ZYFA 2C3HA 3SBFA 3DTUB 3SGKC 4M1DL 4WHBA 3GD6A 5BQDA 3T4AA 2OT0A 2NSMA 4N0FA 3SE6A 3TBCA 3BWAA 2PODA 2FATL 5CZXD 3EXSA 3QEQA 4ZTOH 1RZ8A 1LUCB 2NXYC 1THCA 3OQEA 4D94A 3MPGA 1ACCA 3HI5L 3NZSA 4Y7OC 5HD8D 4L2YA 3CUGA 1YYML 4NSBA 2YARA 3HPSA 3BW4A 5E9XA 4ONHA 1L3WA 4P2YA 1N8ZB 2CWXA 1XICA 4GAGH 1DJXA 3JWDL 3HI5H 1HZKA 2FIQA 4QEHA 1YYMH 3STFA 1U4FA 1Q13A 4Q6KA 1G4PA 4PCYA 4B53A 3S97C 1KPRA 4YFDB 3FSWA 4TKWA 4IQJA 3PY9A 1T4WA 3WMPA 3N1QC 2PPFA 1RL1A 2B8OT 3L3OA 1KJ2H 5DVOA 5K9QI 5FPIA 5TH2A 1U3NA 3VWKC 4X4YA 4EAYA 1QYGH 3PN8A 4IGBC 2OZNA 3F85A 5KWYC 3RJYA 5HYSG 4H0GA 4CCDA 3N34A 3NQMA