3OLDA

Crystal structure of alpha-amylase in complex with acarviostatin i03
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
495
structure length
495
Chain Sequence
YSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of human pancreatic alpha-amylase in complex with acarviostatins: Implications for drug design against type II diabetes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Pancreatic alpha-amylase
total genus 173
structure length 495
sequence length 495
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3oldA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3oldA01
1DWJM 4W8AA 3DC0A 1E0WA 2BVDA 2WWDA 2F7PA 1PZ3A 1E56A 1C7SA 3SCRA 1TQWA 2BXYA 1V3LA 1V0LA 3MI6A 2VR4A 1E5JA 1NWUA 1V3IA 3ARYA 1E4IA 1JDAA 1MXDA 3MV01 1OCQA 1US3A 4PMQA 3RILA 1OGBA 1JD9A 2XN1A 2A3CA 1JI1A 2EPMX 4J3UA 4CKQA 3NDYA 4HU8A 1GNXA 4UTFA 1EDQA 4HOWA 1W1VA 4U3AA 2D20A 2G3JA 1CIUA 3BMVA 3NUKA 3AYSA 1R7OA 4D6DA 4FLQA 3KL0A 3DYOA 3WY3A 1R87A 1QHOA 1GQJA 3E1F1 4AZ5A 1QVBA 4B3LA 3GNOA 1EO7A 3AMDA 5I5RA 4ZENA 4FNPA 1VJSA 4B9YA 4Q7NA 4MTVA 1QI3A 5I23A 1UQZA 3NIYA 4EE9A 3W53A 3DX2A 3NJ3A 2QLYA 5A6BD 2VNCA 1WO2A 3K46A 1FFRA 4TVDA 5AYBA 1JYXA 1KGUA 1HIZA 3OGSA 2WB5A 1E70M 3ARWA 1BG9A 4JHZA 5A8MA 4UFLA 4NRRA 1CLVA 4U2YA 4GI6A 3K4AA 2GUYA 2TAAA 3UR8A 5CSYA 3AJ7A 3EJRA 1E0VA 1QBBA 2J78A 1W1YA 1XHGA 1ODUA 3MMDA 3EDDA 3BSHA 1HJWA 4OOZA 3U57A 3VGEA 4DWSA 2WHJA 5CG0A 4D1IA 1E3XA 2J47A 4PTMA 1BLIA 5GNXA 1QNOA 1C8XA 2D3LA 1V0NA 1MYRA 2VCBA 1HN1A 3PZUA 1VFUA 4M81A 4HU0A 2BVYA 1OD0A 2J8GA 3WMSA 3FXYA 3UERA 3BUBA 3NSMA 3BAKA 3ALFA 3ARRA 3PZNA 4WKHA 1K9FA 2D23A 3I3BA 1UYQA 3AS3A 4KGJA 4CN1A 3SCVA 4RE2A 1AQ0A 1VFMA 2WMJA 2WBGA 1JYNA 4J3WA 3LPPA 1LG1A 4X9YA 2GJPA 4IISA 2BVTA 1XGZA 4WSKA 1KQZA 3MU7A 3UG4A 3CHFA 3VGDA 1JNDA 1QHZA 1CXFA 3WEOA 4GIAA 3MMWA 2NT1A 3EMCA 2D1ZA 3PZTA 5A2AA 4B3KA 3AYRA 1CECA 3WH5A 3PBGA 2XVLA 1L8NA 3LRKA 1LWJA 5I3DA 4PYSA 2J7GA 2GSJA 5A8QA 1W9VA 2X8RA 2JF6A 4DWSB 4CD6A 2VZUA 3N13A 1ISZA 4HMDA 5ECUA 5A6BA 5DT7A 3WNMA 2DH3A 4MB1A 1ZJBA 4GZEA 3MV11 2VX6A 2EJ1A 4RE4A 1VJZA 5E6ZA 3CZJA 1LLOA 4W86A 2B31A 3ZT7A 3BAWA 4LYRA 4DM1A 1GOQA 1NARA 3WF3A 1QWUA 3CBWA 1TE1A 4QCFA 1FH7A 4FLOA 4DO4A 5JIWA 1HL9A 1MFVA 4FK9A 2W67A 1EO5A 2J7EA 1GQLA 1ZBCA 2OSWA 3BUDA 1JZ7A 2WW5A 1J18A 4WSJA 3W37A 3WQ6A 2W91A 2VURA 4PTVA 2EEXA 2C7FA 2VL4A 1E5NA 4LYPA 2EQDA 2OSXA 1JYVA 3CUHA 1V0KA 1VB9A 1EA9C 1B3VA 1MW1A 1TQSA 3WEMA 4MB5A 1OT1A 2JALA 1R85A 1KGWA 1Q6DA 1RP8A 1WZAA 2XFYA 3H54A 2CXGA 3UCQA 5AC5A 4H8HA 5FIPA 3TV8A 1C8QA 3WBAA 4JFVA 4AMWA 2FDMA 2PWDA 3KWXA 3GH5A 1FP8A 6TAAA 2ZWYA 4AZCB 4P8XA 4CD5A 2YLAA 4H8UA 2WZIA 3WH8A 4KRUA 5D8ZA 1QX1A 3LX9A 3HMCA 2WLYA 1AQHA 3ALGA 1E4LA 1TZ7A 2IXVA 3RJYA 3RM9A 1JZ6A 2CKRA 5BRPA 3RM8A 2ZUTA 4L4PA 4ZEPA 3KLKA 3AIVA 4V27A 2CIPA 1XH0A 3IAPA 1JAEA 1H3GA 2ZOXA 1G0CA 2WBKA 3WD4A 4RE3A 3I3EA 1KGXA 1L0PA 3BVXA 4MPKA 2WM0A 4J27A 1KTCA 3WN6A 2Y5EA 2ZX6A 2ZIDA 3O2LA 4J3SA 3QHNA 4TOQA 4PEEA 1W2PA 3OG2A 3MUIA 2WANA 4LYQA 3N04A 3VTRA 3AMGA 1IZJA 2OSYA 3PN8A 1TFVA 4M80A 3L4ZA 3WUEA 1YQ2A 2XHYA 4XZBA 1AVAA 1B2YA 4H04A 1QBAA 1H41A 1S46A 1NOUA 3DX3A 1A3HA 2UWFA 1UKTA 2QMJA 1NM9A 5D9MA 2EPLX 1WDSA 1CGVA 3EJPA 2DSKA 5BWFA 2E8YA 3FAXA 1W9BM 3VGGA 1QI2A 2XSBA 2XFFA 4UQDA 4Z2LA 4QLLA 2X2HA 1ECEA 4OZOA 4AMCA 1ZL1A 1XYFA 3RJXA 3WF0A 1R7AA 1WNOA 2FH8A 8CGTA 1UKSA 4NI3A 4WLCA 3ARUA 3HG3A 4DWSD 5CLTA 3BLBA 1CGTA 1RP9A 3GDBA 5EMYA 4UNIA 3FNDA 4AZ7A 3EDFA 1E40A 3VD5A 1TQVA 1DP0A 2QHAA 3BVWA 3ZT5A 1XH1A 3RCNA 5IFTA 4JKMA 1QNPA 4N0RA 2VTFA 1JZ8A 1R46A 5BXSA 3WDIA 3VX0A 1LL7A 1KFWA 3S5YA 4UOZA 3WY2A 1O6IA 1O7DC 2J7CA 3W28A 4UR9A 1D2KA 5I6SA 2XM1A 1MWOA 3BLKA 2YFNA 2VZVA 3AHTA 1WKYA 2XJ7A 3GTNA 1KR0A 3VNZA 1PBGA 1ZU8A 2BHYA 3EJUA 4CN4A 2DT0A 1GORA 3WH7A 1JZ3A 1R75A 3SCQA 2UY2A 4CCCA 3ZQ9A 1N82A 4WKFA 4V2XA 4AZGA 1TVPA 1CBGA 2X05A 4AWEA 3WL1A 3BSGA 1CXEA 4X0VA 3RMEA 2CBJA 2JEPA 1R34A 1U33A 2YL6A 1JIBA 3VVGA 2DIJA 3T09A 4F9JA 2XVPA 4XX6A 2JIEA 3WBEA 1J0KA 4E8DA 4K68A 4BQ3A 4DUXA 1GOMA 4OBSA 1WZMA 4OIFA 1V6YA 2PF0A 2YL9A 1XD0A 1C8YA 3CO4A 1FOBA 4PTXA 5FL0A 2XIBA 1M53A 1E4NA 3N11A 2W92A 2X0YA 3T0AA 1FHLA 1J01A 4J3XA 3AROA 3K1DA 4BQ4A 3UEQA 3OIHA 1KCLA 2WZEA 5A3HA 4JKKA 4ZE5A 4PTWA 4EAMA 1UD5A 4ATWA 3VNYA 2F1AA 4FNUA 4U2ZA 2WK2A 1E6PA 3DECA 5JBDA 2PWGA 4FNSA 3FY1A 4TVUA 1H0IA 4KRTA 4D71A 2E9BA 3D51A 3AS0A 1C93A 2XWEA 5AY7A 3WQWA 4NSBA 4MAZA 1ISVA 1CENA 4LQ1A 4DO6A 3FHAA 1V3MA 1XD1A 3ZJ8A 5A2CA 2J8FA 2V5DA 1G94A 2WNWA 3ZJ7A 2VCAA 1UQYA 3A4WA 4HA4A 1JFHA 2JIWA 2BNJA 1HVQA 1R8LA 1GOIA 3VIGA 1K6AA 3D4YA 1E6NA 3VM7A 2EPKX 4P7OA 1CLXA 1H49A 4U3CA 3SCTA 1KR1A 2HISA 2WYSA 4HPHA 2XPKA 2XIIA 5BRQA 1JI2A 3ZJ6A 1TQTA 4A3YA 1EH9A 3WFLA 2OWXA 1UH3A 2G8ZA 3VMOA 3F5KA 4GQRA 4ZFMA 4HPGA 3W6LA 3O6AA 1GJWA 3WUFA 3AZTA 4M24A 3AOFA 1UH4A 3LXCA 1E6ZA 4PMXA 1P6WA 3WMCA 3KZSA 3HG5A 1SYTA 1JDDA 3VIPA 1Z32X 1Q4NX 3THCA 3PZ9A 1TQUA 1FP9A 4MB4A 2WHKA 1V3HA 3BGAA 4HZ6A 4BQ5A 2FHCA 3LXAA 1BVNP 4CCEA 4QCEA 3GNRA 3POHA 2W61A 3DHPA 5KEZA 4NZFA 2O9OA 3A5VA 3A4XA 3BUIA 3WY1A 2EAEA 3WELA 3SCWA 5A8OA 1XRVA 3VO0A 4PMNA 1UR9A 1UKQA 2Z1SA 3CUGA 2YKKA 2F1BA 4TX6A 5FOOA 4W5UA 4W84A 3H53A 3LMYA 1J0YA 3GXPA 4AIUA 4WIWA 4WK9A 6A3HA 4Z2GA 1QNQA 4AIOA 3BCDA 1BVZA 1UH2A 5TD4A 3EDKA 3VDAA 1UD8A 1ODZA 5CZKA 4CU7A 1UWRA 1DWGM 1HNYA 2XUCA 1EGZA 4DO5A 2CBUA 3BVUA 3IJ9A 1V0MA 3BXWA 4ATDA 2XWDA 2EADA 4J7RA 1OIFA 4L4OA 4CVWA 2C8NA 1EIBA 4AD0A 1X6LA 2ZUVA 3MO4A 4TTGA 4AXNA 3MUY1 3VDBA 3L4UA 1W2VA 2C0HA 4P8VA 2JFEX 1ZS2A 3CUJA 3PZMA 3BAIA 4EK7A 1PJ9A 3WQVA 2OYKA 3UG5A 4FLRA 3ZM8A 3KL3A 2PB1A 1V02A 1H0GA 2NSXA 3S2CA 1BTCA 2WKLA 1BYCA 3FAWA 3AIRA 4AD1A 5CGTA 4QAWA 1B3XA 2O9PA 5A6MA 1VENA 2G3MA 1BQCA 1UR1A 3UESA 5IFPA 3A3HA 1B3ZA 1CGUA 4JKLA 1E55A 1JFXA 4HOZA 3HN3A 2CCRA 2VQTA 4PSRA 4JCLA 4NRSA 5DF0A 1NP2A 1K9EA 4HMEA 1UD2A 2YL8A 1VAHA 2V3FA 1WZKA 3DDFA 1H4PA 1CPUA 2ZXBA 2A3EA 3OBAA 2CBIA 4W7UA 3W29A 1HJQA 4EKJA 1OM0A 2FGZA 1DWFM 1UHVA 1LJYA 2D3NA 1QI5A 3TTQA 1TUXA 1M7XA 3RIKA 1GVIA 3IJ7A 3W24A 4P7NA 3QHMA 3A47A 3WL0A 3W27A 3KEHA 2V3EA 1WCGA 4NZJA 2W66A 3CLWA 2F18A 3LPOA 1DTUA 5HNNA 4AD2A 1B9ZA 1T0OA 1MQRA 3L2LA 5IDIA 3HG4A 2X0HA 2WC4A 1B0IA 3WFZA 3GBDA 1RPKA 3QGVA 4P7LA 4D72A 1QOXA 4AD4A 3CH9A 2DEPA 1HXKA 1PIFA 1HJXA 2XSAA 4J3TA 3WNPA 1H09A 3GNPA 4V28A 3IJ8A 3LPGA 4AEFA 4PMYA 1Y7VA 3VD7A 1QHPA 1W3LA 4MJ2A 3BMWA 1CDGA 2O9TA 1LQ0A 2VCCA 1IT0A 3EYPA 2JE8A 1IV8A 2UY3A 2XTKA 3AIEA 3LRLA 3WUGA 1HP4A 2YA2A 3BUPA 1HJSA 2FHFA 4UZSA 1GPFA 1X6NA 3ZIZA 3B8SA 1HJVA 4UFIA 2OWWA 4U5KA 4D6JA 3PHAA 3AQUA 2WC3A 2D24A 3GH4A 3VSVA 3SCOA 1V6XA 3GXNA 4F9DA 1E1FA 2ESCA 5BXPA 1E6SM 4QFUA 1RD6A 3DDGA 1SMDA 1JL8A 3MUAA 2XM2A 1MW2A 4ACZB 5BROA 3A23A 1LL4A 1PIGA 2Y8KA 6CGTA 4JFTA 4IPLA 3VPLA 2PWEA 2UY4A 2NT0A 4JL2A 1OT2A 1E71M 3PTQA 5M03A 4CCDA 1QPKA 2JF7A 3DX0A 3I3DA 1UA7A 4BA0A 5E6YA 1X1NA 1ZBKA 5HPOA 2YA1A 3CHCA 1SMAA 1B3WA 1LG2A 1UWUA 1Q6GA 2J7HA 1JZ4A 3L2MA 4ACZA 2VVSA 2WMFA 2BHZA 3S5ZA 4FNQA 4D6FA 2WKGA 5A8PA 1RH9A 1E43A 1VBRA 4W93A 5AYIA 5CPTA 5ABHA 1UWQA 1HL8A 5CXPA 4BCEA 2DSZA 1ZJAA 3UG3A 4FMVA 4TX8A 1UD3A 3M6DA 1J0IA 1QW8A 2AAAA 3A24A 1J11A 3D52A 4R5EA 3WDJA 2WMGA 3T2QA 3AIUA 2V38A 2F8QA 2D0HA 3WMBA 4AD5A 2CESA 4OJYA 1MW3A 1J0HA 4AW7A 5A6SA 5LYRA 4A3HA 1BAGA 2ZUWA 1K9DA 3TOPA 4AYGA 3K8KA 1KQYA 2ZICA 1C91A 2V5CA 1ITXA 5C8BB 1U2YA 2DSWA 4TVCA 1A47A 1WB0A 3VOCA 3VGBA 1EXPA 3CMGA 1TMQA 3WNNA 3WUBA 5A1AA 1V6UA 5FL1A 3VD4A 2OW6A 4P7QA 3OB8A 4UCFA 1JZ2A 4EANA 3WH9A 1UD6A 1UR0A 2F2HA 2BXZA 1W9XA 1DWAM 2XYLA 1JZ5A 4LXFA 1TCMA 3VM5A 3L4VA 1G1YA 1U30A 1XSIA 3SCSA 2EBNA 4F8XA 2DIEA 4N42A 4JAWA 3VKKA 3VX1A 1EOKA 4P8UA 3WY4A 1DEDA 1G01A 2YDSA 5JBEA 3N15A 2WHLA 1E72M 3VUPA 1I75A 5E9AA 1UUQA 4UFJA 1JF6A 1NQ6A 1ITCA 4PMRA 3NSNA 3ZJKA 1HVXA 3HG2A 1B3YA 1TG7A 5FKYA 3CPUA 1GVYA 2QMKA 3SCNA 5A6JA 1WZLA 3GYCA 2WLZA 2VZTA 1US2A 2V3DA 5CPSA 5I79A 4W8BA 4MNJA 2YA0A 4PMZA 5DT5A 5CJ5A 2WC7A 1TVNA 2DT1A 2ZUUA 1DHKA 1B30A 3WQ8A 4ZE4A 2FYVA 5I24A 3WF4A 2WPGA 4JFSA 5FCZA 1M01A 1M04A 3WKZA 3CZLA 2Y4SA 1PX3A 1GW1A 2VQUA 4HZ8A 3BAJA 3EJSA 2A3BA 2EO7A 1QI0A 1E3ZA 4PMDA 3SUUA 2PWHA 2PI6A 2WMIA 4UQEA 3M7SA 3FHQA 4JCMA 2ZXQA 4B15A 1O7AA 4IUGA 1K9TA 2A3AA 3T0DA 2PWFA 1M03A 1LF1A 2ZE0A 4KH2A 1MQQA 3FW6A 7A3HA 1JGIA 4GI8A 1FFQA 4AY1A 2BY2A 2YFOA 3AFBA 3BLPX 3LRMA 3VIFA 4CD4A 5CLWA 4GZJA 1BGAA 4HOXA 3WENA 2O9RA 4W85A 2OYLA 3MSDA 3NDZA 4D6CA 4YPJA 1MVYA 1MXGA 2IUZA 2EPNA 3TP4A 3KE0A 3WF1A 1D7FA 1W3JA 1EDGA 1V6VA 5D8WA 2QPSA 2GK1B 3ZSSA 4URIA 3ZMRA 4CN6A 4GZIA 2PC8A 3ZR6A 2E40A 2BHUA 4U5IA 3UETA 3AMLA 2G3IA 1B31A 4PUDA 5E0CA 1VFOA 1GOWA 3F4VA 4HA3A 1UA3A 3VIOA 3WH6A 3N18A 1UD4A 1B90A 1VIWA 4FNTA 3OLIA 2G4FA 5ABEA 3VU2A 2X09A 5JUVA 3T2PA 2D22A 1TR1A 2FGLA 2CKSA 5A94A 3K4DA 5E1QA 1BGGA 4B16A 4OGZA 2VMFA 3TTYA 4R27A 5EBAA 3IK2A 4TXEA 3WSUA 3F5LA 5A6KA 4H7VA 3MSGA 4PRWA 3II1A 1E6RA 2E4TA 3TTOA 4AD3A 2WVSA 3HU7A 1W3KA 2CITA 4PBGA 1J0ZA 1UKOA 3AHVA 2EXOA 3LPFA 2DQXA 3VGHA 3VSTA 2GJXA 3VIKA 1ISXA 2O92A 4J3VA 2X2JA 2OLHA 5HBFA 1OB0A 4J28A 1J12A 5IHSA 3S6TA 2DSUA 4D6EA 1UR4A 4E8CA 3EDEA 4M56A 5HDRA 3W38A 3PTMA 3GXIA 5I77A 2VRQA 4GQQA 3BCFA 3AXHA 1MQPA 4CVUA 4PMVA 5GNZA 1KBBA 1PZ2A 2VC9A 2FH6A 1FH9A 4Y7EA 4OKDA 4Z2KA 4QLJA 1CXHA 2J7BA 2VJXA 4LPCA 1GHSA 1EQPA 3DX1A 2BV9A 3BUQA 1QW9A 2YBUA 2ZUNA 3WD0A 5HXMA 3GZAA 3WNKA 2VZSA 2PBOA 5E70A 3WDHA 1E15A 4D6IA 3B9EA 4GO9A 2J7FA 2FE0A 2E9LA 5DEZA 5DFAA 3PZVA 3OLDA 1E73M 3GH7A 4W87A 5A69A 1JNEA 4ZXLA 2G3NA 1BF2A 4XUYA 4F66A 3T08A 2CBVA 3OZPA 3N12A 3W26A 4HTYA 3A6OA 4FNRA 1Q6FA 4PCSA 4CGTA 3EMQA 3VIIA 4S3JA 1BFNA 3PZIA 2CHOA 1HKMA 2V3GA 3FN9A 3EDJA 1JXJA 3EBVA 3F5JA 3EJQA 3MANA 5CPQA 1HWWA 3WQ5A 2F7OA 4UQ9A 1W1TA 3THDA 1ISWA 4HMCA 1WAWA 1JAKA 4OOUA 4FF5A 2PBGA 2NW0A 3CUIA 3WD3A 2ZXDA 5CQ1A 3CHEA 3ZT6A 1YHTA 4C7GA 4JIEA 5HPCA 5HOSA 1TA3A 1AMYA 1WP6A 4Z2HA 5DMYA 4P7RA 1GJUA 4OBRA 4JHOA 5C70A 4M1RA 4DUVA 1AQMA 3CMJA 3OGRA 3GM8A 5A95A 2BY3A 2WVUA 4RL3A 4WKAA 2GFTA 2ZX9A 4CD7A 4W5ZA 3VD9A 3OGVA 2EABA 1BYAA 1QWNA 2JEQA 1PPIA 4UQAA 1W1PA 2ZXAA 3NCOA 5BYWA 1G5AA 3GXMA 3CZ8A 1HJUA 2YOCA 3D50A 2W5FA 4W89A 2GK1A 2XFRA 2D0GA 2WSPA 3WNLA 1BPLB 3VILA 1V3KA 1SFSA 4AEEA 4W7WA 4AMXA 4Z2JA 2W63A 3N1AA 2VRKA 1NP0A 5AC4A 2ZWZA 5GNYA 5GQBA 4NZCA 3T2OA 3GBEA 1OWQA 1KXQA 3NYDA 2AOSA 1NOWA 1R47A 1WDQA 3GXTA 1UZ1A 1W3HA 3BAXA 1WDPA 4BF7A 3AS1A 3NSXA 4B9ZA 3AHXA 3AZSA 1VF8A 3CUFA 3M46A 4M82A 4JL1A 3D3AA 4OUEA 4YN5A 5F7UA 4PSPA 5I2UA 1F4HA 3AICA 4AZCA 3AIWA 1ZBWA 1HP5A 4HZ7A 3KL5A 2DDXA 2CYGA 5M3WA 3WD1A 1WPCA 1UWTA 3VIJA 3MMUA 4LX4A 3AXIA 1GUVA 2WCAA 3ZOAA 1EDTA 2XGIA 3CV5A 3D4ZA 4UFHA 5A2BA 1MFUA 3O9NA 3AHYA 3PZGA 2EACA 4MNLA 5BCAA 1HX0A 4NF7A 3PZOA 2WSKA 1W9DM 3ARPA 4CU8A 1R33A 2YLLA 1BSIA 4CUCA 1E4MM 3WDRA 2RGMA 1BHGA 5I0DA 1CZ1A 2Y24A 1EQCA 2WVTA 2HVMA 3GXDA 4UQCA 1E0XA 1H1NA 1BYDA 5A8NA 3SIMA 5IHRA 2J7DA 3BVTA 3G6LA 2W62A 2ZX5A 3N9KA 1CXKA 1PEZA 2WCGA 1C3FA 3AISA 5ABFB 1NWTA 1I1XA 9CGTA 4GKLA 2GDVA 3WEZA 1H5VA 3K8MA 2X1IA 4MAVA 4AZBA 3VIHA 4GINA 5E0FA 1JG9A 1ZB5A 2VOTA 1ISYA 3HJEA 1UR2A 1UASA 2MANA 2X2IA 1UWSA 1XSKA 3ARZA 4ML4A 3A21A 3AMKA 4PMUA 4XB3A 1UOKA 3L4YA 2WAGA 5EFFA 2GJXB 5BXRA 3ZR5A 3ARSA 3WIJA 1BYBA 3W82A 3J7HA 2CETA 5A6LA 2AMGA 2XN2A 5D9OA 1NWRA 3OA5A 1ZBVA 1H11A 4MB3A 5CSUA 1VRXA 4E4PA 1UWIA 4MNMA 4WF7A 4MJ4A 1XH2A 3CIVA 3WDPP 4NXSA 1KXHA 1KXVA 5C71A 5M5DA 2YIHA 3MUZ1 2EPOA 3VGFA 2VO5A 1QNSA 2VRJA 1D3CA 2YDRA 4IM4A 1FH8A 3CZSA 2A3HA 2WWCA 4BZYA 4IPNB 3SCPA 4ACYA 2QPUA 4TTUA 1OD8A 1XCXA 1E6QM 1TA3B 1E1EA 3A22A 1XYZA 1KWGA 3TA9A 2WCSA 2WMKA 1DWHM 3EJTA 2XVGA 3N17A 3TTSA 4KMQA 3MKKA 3SUWA 4M29A 3DX4A 4S3KA 3UR7A 4W7VA 2WHMA 4QP0A 2VX5A 3EMZA 1EOMA 4LGXA 3WF2A 4UOQA 4BS0A 1CYGA 2CPUA 2Z1KA 2DPEA 1EHAA 4UQBA 1HKJA 4U33A 1OINA 1HKKA 1IZKA 4YHGA 4JZ5A 2IXUA 4FLSA 3U7VA 4M8UA 4MADA 1UZ4A 1W91A 5D9PA 3RPMA 2J74A 3M07A 3W25A 2X2YA 3KLLA 1GOKA 3AHZA 5DO8A 4DUWA 4D6GA 1LWHA 2E0PA 3VMPA 3JUGA 2ZX8A 1R86A 4XV0A 2F7QA 2VZOA 3VDHA 2D2OA 4MNKA 1DWIM 1W32A 3SUVA 4U31A 2F7RA 1PX8A 4DM2A 1VEMA 4X0NA 2Y8VA 3VMNA 3D5HA 3L4WA 3VSUA 2E3ZA 3G6MA 4DWSC 1J9YA 2BS9A 1XSJA 4PN2A 2XG9A 4AC1X 4D1JA 1OGSA 1GHRA 3VIMA 4P8WA 3ARXA 2BY1A 1WDRA 2CHNA 1KTBA 3AXXA 2G41A 4MDOA 3U5UA 5EFDA 2YJQA 4JFWA 1PAMA 1I1WA 2VVNA 5LA0A 1VBUA 2OWCA 2OW7A 1E6XM 1LL6A 2VX7A 3AIQA 3AS2A 3W0KA 4TUFA 2DT2A 4GI9A 2GJRA 3HZ3A 4KGLA 3U5YA 5E09A 2VR5A 2DSVA 2W4XA 3ARQA 2J79A 2ZX7A 3QOKA 4QDMA 5LA2A 3DYPA 1CNVA 4D6HA 4NX0A 3BVVA 5GPRA 5M17A 2E8ZA 3WNOA 1JD7A 1XCWA 3SURA 5JIPA 4CU6A 1KWKA 4KWUA 1WE5A 1HKIA 2GDUA 2J75A 2WMIB 3RM4A 1XV8A 3L4XA 2YL5A 5ABFA 4GPNA 4PMOA 2WVVA 3WDQA 1ESWA 4C7DA 3RO8A 1BG4A 1PX4A 3IANA 3WQ4A 3CZEA 5A6AA 4WJXA 3U7BA 2YDQA 4H8VA 2Q8XA 2J4GA 3OLGA 1V08A 4ZXOA 1GCYA 4CD8A 8A3HA 2WZHA 1V03A 2WVVB 1NOFA 2WXDM 2J62A 4JFUA 2UY5A 2BFGA 2YBTA 1KXTA 2J77A 3AIBA 1QI4A 1OGGA 1HT6A 3A4AA 4Z2IA 1E9LA 3AZRA 4XZWA 1GQKA 3B9DA 3MS8A 3CZNA 3SCUA 3GXFA 2D73A 1W9PA 3L4TA 1C90A 1GQIA 1UR8A 3QHOA 3W4RA 1GOOA 4W88A 3RDKA 1EHNA 5BXTA 1B1YA 4BQ2A 4UZUA 5LA1A 2VT0A 2ZUMA 3DHUA 4NXKA 1KBKA 1FA2A 1Q6CA 1J10A 2IGTA 2OYMA 3ARVA 3DYMA 5FD0A 3WD2A 3ECQA 2CEQA 2F61A 1OSEA 5JBFA 4UOJA 5D9NA 2DGAA 4UFKA 4H41A 1H2JA 5KZ6A 2XGBA 4HA1A 2E9MA 1CWYA 3SEPA 2BY0A 2WMHA 1UKPA 3OZOA 3TONA 1CEOA 3OLEA 1QNRA 1GONA 1SR0A 5IXEA 1CGWA 1MW0A 3H55A 5D4YA 2XN0A 1JDCA 4MDPA 3SUTA 4GO8A 2XVNA 1JXKA 1XC6A 4ATLA 4AZHA 3VINA 2QF8A 3BH4A 2GVYA 3ARTA 1G9HA 3B9AA 3APGA 1CGYA 1OIMA 4C7FA 7CGTA 3BC9A 3POCA 3CC1A 3VD3A 4PUEA 2Y2WA 3W6MA 2QV4A 2XVKA 3IAQA 5EB8A 3CTTA 3VDCA 1PS3A 1V6WA 3CGTA 4GXPA 4F79A 3SUSA 2D0FA 4Q22A 1V3JA 3ZO9A 1SZNA 1HXJA 1C7TA 1JF5A 3ZSTA 5ABGA 4AZIA 1CXIA 3K8LA 3QOMA 4AZ6A 2VUYA 4W8LA 2ZUSA 4AYSA 1UG6A 3QR3A 1CTNA 4H2CA 1CXLA 2DH2A 2ALWA 4PCTA 2J25A 4HP5A 4YHEA 1VFFA 3W81A 3CHDA 1J0JA 5CGMA 1VEOA 2FHBA 5I78A 1HF6A 4QLKA 2CNCA 1JYWA 1Q6EA 4A4AA 1GZJA 2RGLA 2VI0A 3PTKA 2DT3A 1HTYA 7TAAA 1VEPA 1F4AA 3LXBA 4E2OA 3AMCA 1OBAA 3BAYA 1NH6A 1FHDA 4UFMA 3AI0A 4AISA 2CERA 1CGXA 3T0BA 3CZGA 3CZKA 1NWSA 3PZQA 1KCKA 1V02E 2VX4A 3IGUA 1C92A 1KB3A 4AIEA 1W9UA
chains in the Genus database with same CATH superfamily
4MAYB 4LLQB 4Q2ZB 1M6OA 4FYQA 2WINB 4Y19E 5B1JC 1BYNA 1Q5MA 5ENWB 4GABA 3U9IA 4UUJB 2F7PA 3R94A 3ELFA 4U6HB 5DR5H 4AQAB 2QSQA 4DJEC 2HFGH 1TQWA 1RHHB 5DJZA 4WUUE 1NFDF 2BXYA 3QJUB 4K3DH 2MQ0A 5LXGL 1V0LA 3MI6A 2PDGA 4RDZA 4UR7A 4Z1CA 2Y3NA 4QWWD 2BP8A 5CN2A 1XICA 3IJ6A 4L9YA 4NO5A 3ZQXA 1A9VA 1KELL 1OQOA 3CLFL 4K8EA 1PAZA 2O5YH 4H6EA 5CEWA 1CUOA 3HZVB 3LQMA 1JDAA 3MV01 2C3XA 4LRNL 3DIDA 3ZE0B 1N59B 3FCSA 4JX5A 2XG4A 1W56A 5ECVA 4HJGB 5IMOB 4GQ9L 4NM8H 1OGBA 3DX9A 3HHSA 3MU3A 4NWTH 3QV6A 3MRPB 3V0WH 3KCLA 4V1YA 1MAKA 5CJNA 4DELA 4O1FA 3QPZA 4PJGA 1U93B 2AV7A 4F15C 4HU8A 1XLKA 4X7TB 3KPNA 4N6RB 4XVJL 5I74C 3SZ8A 4OF8A 1VR6A 4HOWA 5HYQB 1W1VA 1OC6A 5D96B 5GSVA 2ESVD 1CE1H 2IDTA 4LLAA 4XZ4A 1RUAL 2E9WA 5E94A 4JTHA 1MQKL 3GWJA 1J1PH 4ZNCD 1Q9WA 2F8XC 2QFPA 1W0WA 3FQXA 3P9MA 4FNLL 3D85B 5J9PB 1XF3A 3UO1H 1FWHC 4Z7WF 1GVFA 3CV2A 4JVWA 3CFEA 4LVOC 1NGZB 3DVGB 1ZLSH 1TJ2A 1VYRA 1XLMA 3BSZA 1LCOA 5DRZA 5EN2B 2ENJA 1RZFH 1YY9D 1K4CA 5IQOA 3GNOA 4Q6XA 1Q0EA 2KUTA 3QC5X 1KM6A 2DMGA 4EJ1C 3N14A 5I5RA 4YVVA 1H8SA 3KVJA 1NQBA 2AQRA 4LCWD 4JIRA 3GYEA 3VYLA 3QDJB 3EBGA 5FM5O 4MTVA 4XISA 4YZFE 3W1MA 3WQFA 3EWYA 2WXMA 4ZMAT 4EE9A 3KH3A 3NJ3A 1TJPA 4A8NA 6ENLA 1EAJA 3MJ6A 5I1AA 1XZ0B 4Y4FD 5ESQB 5A6BD 4CQAA 3FOMA 2EXWD 4A2DA 1JGMA 3K46A 4MKMA 4QF1A 1FFRA 1U8NA 2QQLL 4BHYA 3VOGA 1GTFA 4PRAB 3W6YA 4AVJA 4HS8L 5HDBE 4APQA 3B8YA 4M5YH 1FO0H 3OGSA 1HKFA 3E2HB 3HN5A 1V55B 2V0AA 3QZPA 2Q7NA 2Y85A 2Z8VC 4G7VH 1E70M 1ZT4A 3A3XA 2RFXA 1BG9A 3VFVB 3MC0A 4RGMC 3A4DA 5A8MA 2WBJB 2VLME 2BSTA 3NJMA 4U2YA 3EB2A 4GMTH 4DO7A 1AG6A 2H0PA 2MHAB 2TAAA 3MCOA 5DEFA 2I57A 4YHIB 3EJRA 1QBBA 1V79A 2BIPA 2J78A 4REQA 5HDQL 1AYOA 1GY1A 1H8OA 2MKWA 3P0VL 2N0MA 2WZPD 1M56B 2QLVB 2Z64C 4HWBL 3MMDA 4P46C 4Q9RL 3MLSL 4YWIA 4JN6A 4POYA 3X14B 3MMEA 3GBNH 4AQ1A 4IYKA 3SECA 4D1IA 3NGBC 1H5BB 1S3TC 1NGQL 1E3XA 4K5OA 2VR9A 3AGWA 5H37H 5L8KB 5EL1A 1E9OA 4PTMA 5F4SA 4X6BB 4Y4FC 4RWYL 1ZSDA 4GNKB 5D05A 4LEEA 4XAKD 4UOW0 1N2RB 4DKFH 2WMJA 2EIZB 4PRBA 4Y1AB 3DX7B 2X4TB 4BYHA 4UTBA 3SDCA 2UZXA 1F8TH 4CEUC 4GRWB 4QOKE 1AO7B 2CK2A 4QHPA 2FZDA 1SBSL 2VISB 4NYYA 1L2UA 3ALFA 3ARRA 4RVBA 8PAZA 1OAQH 3PZNA 3OKKB 5EU3A 2NYYD 2X4UA 1YNTA 2R39A 2A3TA 1TCDA 2CLPA 1BXNA 4KJYB 4Q8OA 1K9FA 5F0JB 5I8OL 2D23A 1UYQA 1PEWA 3ZBMA 5D5ME 2OK0L 4BKSC 1NC2A 2PDXA 3ZE2E 3C6SA 1J2BA 1JP5A 2PWVA 2NVAA 4RE2A 5ERWB 2BRRL 3MCKB 5E93A 1PS9A 3L5WB 2PTTA 4PRHE 1EBPA 1VRSA 2A9DA 2VLRB 5HGAA 3G24A 3P14A 1I9RL 1ZP4A 2YZ8A 1XDLA 5ECJE 3RQ3A 5LCVL 2JJWA 3W2LA 4HJSA 1KQZA 3A3YB 5E8NB 4OCMC 3EIFA 1A3RL 1U2CA 5HBBA 4S2SB 3I7SA 5F96L 3K72B 5I66B 1FAIL 3VGDA 2QCMA 1JNDA 5D02A 3ZJAA 3DHJA 4MJ5B 2H5UA 5CINH 4GIAA 1MEXH 4ZJ9A 3WEOA 3MRLB 1MRDL 1KIQA 3P4MA 3EMCA 3EF4A 3QEUA 1H7OA 3IS0X 1RZPA 5A2AA 3IRZA 4QOKA 3ZX1A 2V17H 5EUOF 1ES0A 2ZCZA 4OKVB 5KBMA 2PTYA 3BG5A 3HPXA 3WH5A 2C13A 1TX0A 2DZBA 1FSKC 2PRHA 5B3JF 1HQ4A 1RURH 4P23B 5DRIA 2W9EL 1NQKA 4S3AA 3FJ4A 4AC4A 1KRMA 1FI8C 4N6EA 2E4FA 2YC1A 4PYSA 5EV7A 3SGJA 1Q7QA 4P2QA 4DPRA 2FEDD 1KFEA 4PRPD 3N6HA 1I31A 1F97A 4FOUA 3W1QA 3LEPA 3HG1E 2I27N 3UZWA 2E7DA 3PWUB 4H8WC 1KC5L 1Q1JH 2MOGA 1AMKA 3BEWA 2YPVA 1MCOH 2AL1A 4NASA 1FGNL 2AK4D 3RPKA 2AGKA 2X8RA 1MIEH 2NCEA 1SXZA 1NEZA 2V17L 1NFBA 3NPSB 4KWSA 1C5BH 2JIXD 1XLHA 1QLRA 1YEWA 3LHTA 1SYSA 1PZBA 4I18B 3C75A 4K5LA 4Z77A 1ISZA 2CGRL 3FT3B 3GMQA 1NSJA 4HMDA 2DZPA 5ECUA 4ODBD 3WNMA 4XMPL 1CBVH 4LVAA 4P04A 3SYOA 2ZSWA 4K3DL 4F9LA 2VDGA 4LARH 4NJHA 1P7BA 2BVQA 2WIIB 2K6YA 3R1GH 1L0QA 1VJZA 2NZ9C 4W86A 5FF2A 4F0LA 1XLAA 1N12A 3V5DA 3BAWA 3ZYIA 1UM5H 3DI2B 4N8PA 2XU2A 1A9EB 3L3JA 4KDTC 4N0FA 3OVQA 5KZEA 3D0LB 3U2ZA 5FKPB 3WF3A 2EDBA 1NIEA 4IMLA 3RNQB 2CO7B 3GT6A 4FXLA 3WFBL 5C5YA 2XIQA 3E8UL 3CPRA 4I9TA 2Q2LA 3O45B 2FKPA 3MHFA 5A16B 4LDLB 4NSKB 4FLOA 3TC7A 2VM4A 4L8SC 3W87A 4HBKA 3N1FC 1F6PA 1MFVA 5FYKL 2O4MA 1S9XA 4AZ8A 2Z00A 4X9GA 4N0CC 5IB3B 5KANI 1GQLA 3NPVA 5T9CE 7PTDA 5LZLA 1ZBCA 4QXVA 3U4EB 1G7LA 1MLCA 2HB0A 4OJCA 4ONHB 4UT9A 5CWSB 4S1QH 4P23D 5TQ0H 2EZ0C 1QFUL 2F5BL 2W91A 3EGDB 4PJIF 3OKDA 4ZQTA 2VURA 3QEQE 4HK0B 5G2IA 3THAA 2GC4C 3CDGA 1JHLH 4R8WH 4KK9C 4IK6A 3F1QA 1A1OB 5D71H 1LE9B 2VL4A 2G5RA 3RF9A 3V0IA 1F3TA 1E5NA 4LYPA 4IMGA 3S6OA 2EQDA 3WJMA 1T3FA 4F58H 2YDAA 3VXRB 4WU7A 4HZAA 4DQAA 1JYVA 4PEKA 3F6IA 4UTWC 1ACXA 2CU9A 2J1KA 1PGRB 3WTYA 2YEQA 1IKFH 1PKQB 2NY3D 2YPLB 1Q1PA 3S46A 5DVPA 3ORWA 2WLHA 2E74C 2R56H 4KAQH 3WQCA 5HJ3B 3BN9C 1HFUA 1S78C 3QXDB 2DDQH 4NRZA 1W0MA 3QC3A 3DO4A 2D7NA 3C8FA 2IPUG 4FN0A 3S36L 1R5IA 3MI3A 3QO0A 2QSVA 4LNRB 3MRKB 5IV2B 5KW9H 2VDPB 3H2FA 4UXDA 1N8OE 5F2GA 1J79A 1XQ4A 3WIHH 1AFVL 1XGTB 2XTJB 1WZ1L 2EE3A 3QDJA 3UCQA 2YXVA 4G9PA 5AC5A 5K2ZA 1XGPA 2ZWKA 4H8HA 4EDXA 3ISWA 1VPXA 1MVUA 4DI8A 2RGSA 2RH9A 5IEKA 3PG8A 3RHGA 1GJIA 2FB3A 4JJHA 1UADC 4PYHA 5D8JH 3L7FA 3QE5A 4GJJA 1F4XH 3MJ9H 1FZOB 5DHVB 1HL5A 3ZDYE 3GH5A 4JO3L 3N2MA 4BBWA 4K9EC 4P2RB 4G8FB 4PP2A 2DJUA 3UYPA 4P8XA 4WJEA 3P4LA 4AZCB 2YLAA 5IJCC 5I1IL 3HG1A 5C0CB 1XMEB 3P77B 1IGML 2PTDA 1UWEL 2C3WA 3WIHL 1QJWA 1SF5A 3JVAA 1QX1A 3F85A 1R3JA 1DVTA 2AJYH 3LX9A 3K81A 3QR2A 5FUOL 5AEAA 3JT0A 2CLRB 4AYDC 1SJMA 3F3HA 2XWZA 4JDVA 5FDWB 3S97C 4NENB 4HHAB 1E4LA 1MQKH 2HTMA 3ALGA 4MAUL 4RRPG 1QUMA 2XN9B 4LAKA 4DQWA 4YS1A 4P57B 3DVNB 2GTWA 3T4AC 3U83A 2RH0A 1A5BA 3KLKA 2BSCA 4PGDB 2XIMA 4H88H 4V27A 1E2ZA 3OC5A 2IH1A 5DHYA 4Z0XB 3C2YA 1UYWH 2QCGA 1DVSA 2Z92B 4L37B 2CDFB 1KFCA 2F9RA 4GH1A 3M1CA 3VXQA 3WD4A 4MQXC 1OSZB 3NQDA 3QXDA 2VLJA 3DRTB 3I3EA 5FOBB 1TETL 2PDCA 1KGXA 1L0PA 1JUBA 1MRFL 1MCNA 2Y2TA 2Z7UA 3BP6A 4CBZA 3RRAA 5SWZB 1KO0A 2L8AA 1JCLA 2VYRE 5HJBA 5JO5B 3WN6A 2XY1A 5D32A 3UQNA 5DCCA 1IWAA 3CSFA 1WAAA 3EYUL 4LB4A 1IAMA 3ZE1F 4AYMC 1RZKL 4Y88A 3GS7A 1RAKA 2HT2D 4PEEA 3BESR 2F8OA 5T1LD 2OU4A 3H24A 5F9JA 2VGLM 1ECZA 3ZHNA 4HJ1A 3BZ4A 3N04A 4C59B 1IZJA 4DCQA 5JIDA 4QDGA 4PGCA 1SJEA 4X6FA 4F20A 3QV7A 4JY8A 3O8XA 2MRYA 1TFVA 2ZRWA 1GPOL 4P5SA 1GZHA 5IF0B 4Y5VB 2C3HA 1SLXA 2V5LA 4WDTA 1OF2B 3GYRA 3IMUA 4JK0D 1I7RA 4OT1H 4XBPB 3VG9B 1AVAA 4N22A 4LVNC 5T1KB 2OOGA 2VN5A 2YD2A 4FQ1L 4G8IB 5B7ZA 3NFPA 5AW1B 5IT2H 5JQHC 1K8YA 2P43B 4JRYD 3GJFH 4LAQH 1A4BA 1L0XA 2DICA 3LZOA 4RISL 4MD4A 4JREB 4A21A 1NM9A 3IJLA 3TYEA 3QC6X 2BWIA 4GSQA 4CGUB 3KLHC 4O2FA 2A6LA 3TT3L 2WXNA 3CEPA 5I0YA 1D5MA 4ZO7A 2PP3A 4PP1D 1EEUA 3VW3H 4YMZA 5JQ6L 5BWFA 2A1WH 2YPKB 1E42A 2E8YA 2P28B 2YAOA 4XHQA 1JJKA 5BV7H 2ABBA 1RERA 1TZHA 3MV7D 1AGBA 1PD0A 1BVWA 4TSAH 3TYGH 5CJBA 1QI2A 1BQKA 2XSBA 3CV6A 1PG7L 2FJHA 1G7JB 4K23L 3RZCA 2WYTA 5CLZA 1Z9NA 2VJ0A 3SKJL 1DEEA 1D7CA 4KF1A 1NCDH 3QQ1A 1R24B 3DX6A 3QJHB 1IGYB 4I77L 4OIIL 3VNIA 3RJXA 4YZFF 2RJMA 1A5UA 4PP1C 4WLCA 3SDAB 5JA9A 3WKML 2X87A 5TTRA 1BIIA 3BPNC 4QJ1A 4XWOC 3BLBA 4JPQA 4E2BA 2GT9A 3WTTA 5EO1A 2HKFL 3WFDH 3PJTA 1T99A 4QXGH 5EU6D 4TVPE 5ITFA 4UI2A 1E40A 4PM1A 3TJHD 1F56A 4KFZC 1DP0A 1YJDH 1IT9L 2RR3A 3VD5A 5K9OA 3CU2A 5AC8A 3LZPA 1U8CB 4QDWA 5FM4A 4JKMA 5IFTA 4KS0A 1DUYB 4V1DE 1MJJA 4RDYA 1Y0LA 2YUXA 1RK7A 1QNPA 4V1DB 1ZZMA 3GTFA 2ADGA 1R46A 4GACA 4MASA 3MNDA 4XB7A 4K3GA 4FTVD 5GRXG 1YDNA 4H6RA 4EVZA 1HWHB 4YPGB 1A6VL 5K9JH 2P52A 3EX2A 1SOSA 4DIAA 1FFNA 1PO9A 3N2XA 3BXNB 4MNQB 3ZMEA 2DQ6A 4UR9A 2ARJA 3HPJB 3UY7A 2OTUB 2V33A 2OP4L 4ZXBB 4S1FA 3BLKA 1KYDA 2YFNA 3QNFA 1ZFJA 3GJEA 2B8OT 3VQ1C 1WKYA 1A9BB 4OU1A 1KJ3H 3GTNA 1EBGA 1TNNA 3IDIA 5F93C 4Z7QB 1KR0A 1O5DT 2GBAA 4O9HH 1PBGA 4XXDA 4NBZB 4A55A 1WEJH 3C60A 2H47C 3IFPB 3TN0D 4WSHA 2UY6B 5C0RH 4IFKB 3WH7A 4MY9A 3RGBA 4RFEB 4ONGL 6FABL 3SCQA 5KVDE 1A4JB 2IQDA 1IQWL 3MCMA 3ZQ9A 2GCYA 3AVEA 3KPSB 4IJ3C 4KHTH 5F7EH 4PJ7B 5J3HD 1FHVA 3H7VA 1N0LB 3Q9QA 4YSEA 2V7NA 2X05A 4AWEA 1Z69A 3C5ZA 1MJUH 1R3WA 5IFAL 3WLTA 4FA8A 1CXEA 2R91A 1DQQA 4KJYA 5TF1H 3ZL4H 3RMEA 3TCXA 2CBJA 3NDOA 4P46D 3T4AA 5A7BA 1R34A 1U33A 5TPWL 3UA3A 4NERA 4S3DA 4YHNA 1YEHL 4JD4A 2XVPA 3M0YA 4XX6A 5FDYA 4MVBD 1UW9A 2VFHA 2H26A 2CUMA 3EZ8A 1DVFD 4JO4H 4ZTEA 4F7PA 2OEJA 5D03A 1J9QA 4K68A 3URAA 3V4UH 4DUXA 4KVCH 1GOMA 2OL3A 4OBSA 2E09A 1WZMA 3TX9A 1CBVL 4BFFA 2VN6A 1YPIA 3QXTA 3I02A 3W74A 4XVOA 4HCRL 5CGBA 4C90A 5B1KA 4GS7C 3QY8A 1FNSH 3W9EB 2W92A 3QHTC 5ANMB 3T0AA 1BQSA 3PXLA 8FABA 5KVFH 2E47A 4BZ1H 2EG7A 3WLPA 1RLDA 1II4E 3BIBX 4C56A 2O5XL 1OVDA 4BQ4A 4K8RC 3UEQA 4O8RA 1OPGL 1RZ8B 2NW2B 4HFWA 4PUBH 4Y2DD 5C0IA 4WK2B 1J05A 2NY0D 3GG7A 5DJ6B 3REQA 4LT7A 4AVFA 1UD5A 5E00B 4CLMA 2R2BA 2VC2L 2F1AA 5DCEA 1X96A 1ZNNA 2DZSA 2BPBA 1TTIA 1OPOA 2V81A 3LPWA 3QBUA 2PWGA 2BB0A 3MUCA 1TF4A 4QRQB 1E8XA 1BQHA 5HI4C 4TVUA 3IDIB 1H0IA 2H41A 3FCTA 5DFVC 3THUA 4L5FH 4LSRL 2B59A 3LN9A 1T5KA 3AT8A 2AEWA 4HHWA 2UZPA 4BXSV 5FFLA 4XD5A 3G5VB 3NZHH 4LQ1A 1IAKA 3FHAA 3OB0K 4WI5A 3U4KA 4NYUA 1SJHA 4LKXA 3F83A 1GGOA 4XX1E 4P4KA 4Z3EA 1XDMA 3JTTB 2H0JA 1A6ZA 1UXSA 2DLFL 3ROOB 4WHYH 3VXTA 3KZ8A 1G94A 4OQTH 1SO4A 1IM3A 5T1KD 3RWHA 3S34L 1WITA 1UQYA 2OGYA 2VCAA 3A4WA 1DLHA 2Q2EB 5DQJB 1YC8A 1S7UB 3MLUL 1R8LA 2GPZA 2TPSA 3AWNA 3TQKA 3GC5A 2MEJB 3CV7A 4BCXA 4ZQNA 4MWFA 1PKQE 1YYML 2N59A 3LS4L 5K59E 1H49A 4QHUA 4P7OA 4G5ZL 1MFAH 3VFNA 2HISA 3BUVA 3Q3GB 1EP3A 2XPKA 3SN1A 3V0SA 2VRAA 3S36H 1KCSH 2VXQA 2XIIA 4KDTA 1XS2A 4EX4A 2GITA 3IXTA 5BRQA 5KW9L 4KEMA 3H0TB 2DLIA 4U05A 3S35H 5HI3D 4FX6M 3MO1B 1EH9A 1U3NA 3NGBB 2GPTA 3WFLA 3G6DH 2EIDA 4DP6X 1MCCA 4N68A 3W6LA 4B5XA 3O6AA 3L08A 5AALA 4BFRA 3IMSA 2G0WA 3U2SB 4PMFA 2L5HA 1F1DA 4M24A 1R4XA 4Q58C 3GSWA 4PLOB 5EZIH 3IFLL 3HQPA 1FRGL 3L3IB 3BKJH 2Y88A 4JM2A 1UH4A 4GIRA 2JSFA 3VVWA 4D0BA 3A0OA 2BDNL 3HV8A 2EKJA 2A21A 4PMXA 1FPTH 3VFOB 5IHBA 1BXCA 3KZSA 3EGXB 3HG5A 4Q6IA 5C0AD 2MKLC 1JDDA 3PXJA 1G7HA 1Z32X 4OLXH 1Q4NX 5HHME 4BK8A 2A6DA 4N6RA 5BS0E 5DCDA 2CMRL 3QBTB 4IMCA 3MN8A 4IHBA 5ID1A 1V3HA 2PODA 2VITB 4B3VA 3BGAA 1NJ9B 2ACQA 4OCWH 1O7DE 3M1OA 1E5ZA 2VLLB 3PAUA 3EYFA 5CN3A 1RCXB 3L21A 3LLFA 4QCEA 5LNGA 4R7VA 1NBZA 3IUIA 3WIFA 2GEQA 4OZHE 3HAEA 5SWUA 4EBQH 4FABH 2Q8LA 2A5HA 3A4XA 1RI8A 3BUIA 2V67A 4O8AA 1PYWB 5AHMA 5EPDA 2Y7QB 4Y5YA 5DZ9A 1B4RA 4CNIA 2F8IA 4JFZH 4H8PA 5CO1A 5I1CL 5A8OA 1XRVA 5TQ2L 4YTUA 4DLMA 3HNVH 1P6CA 4KZ0A 4TNFA 1FV1A 4C55A 4QTIL 4K8GA 3CVHL 1K7EA 4HJ0D 1MCPH 4B5EA 1JPGA 2VFIA 2R0ZL 4AJWA 2X4OA 1Q7MA 2QTEA 4Z7VE 2WKJA 4WK9A 1OM3L 1JPIA 2J8HA 3GI9H 1A7NL 5BW7C 1HS6A 3F04A 3NL3A 4UMSA 2IWGA 1TTGA 3BCDA 1XAUA 3BP6B 3UPWA 1SQ7A 3F01A 4JZNB 4M3PA 1UH2A 3OMIB 1YO4A 3ZDZE 3DRTA 4AW4A 1UD8A 2Z7YA 3WIFB 5LNDA 4WO4C 4Z3GA 1P0KA 4LOCA 3NN8A 1BWWA 4XNZB 2ZCHH 5DFTA 5IQNA 3ZKNC 3PHQA 1Y6MR 1BFVH 2ED7A 2VDPH 1R2TA 3PL6C 5I5MA 3O4LD 3EOAB 4KUZL 3B37A 5I8CA 2XUCA 2HXAA 1BMZA 3ETBJ 1EGZA 4LPVA 2VW6A 3QYSA 5C54A 3G18A 2EO1A 1PG7X 2O72A 3CFTA 4FXTA 4KOBA 1AY1L 5GGUB 3U1QA 3MDWA 1A14H 2X7LA 1QU4A 1IEAA 1SQMA 2Q01A 5HDBB 4HHHA 3OGOE 2WQDA 3IIOA 5BZWA 4QRSB 5B3NA 4MNHA 1GCFA 5B7EA 1EO8H 2B7NA 4D0DA 3CC5B 1F7BA 4XNQA 2YAHA 4KI5F 1OGAD 4FXKB 5SWSD 3PSVA 4GX9A 5EIIB 2ZCHL 2K78A 2IAMB 3KYNA 4NUJA 1XGDA 3NEVA 4GY4A 4XBGA 4BEQA 3MUGA 1FDLL 1AGDB 5HHVL 1LYQA 1OARL 5JMOC 3DFYA 3LAFA 1I3RA 4PRHB 4F9PC 2IDQA 3O3RA 2B0MA 4S23A 3MRBB 2WLKA 3C2AH 4GKZA 1SVDA 4GYPC 1CW2A 2J1XA 3LV3A 1I8JA 3PZMA 4EK7A 4I3RL 3H42L 4F57H 3ISRA 5JXEC 4A22A 5E2TL 5T3XD 1BM7A 2G5BB 4XAWL 2FECL 3UG5A 1OZUA 1GGCH 4Y4FA 3KL3A 3MTRA 5I1GH 2GGIA 4YX2H 4FQLH 2F68X 3SPVA 3VWJB 3S4SB 4AVKA 3LCIA 4LB8A 4W4QA 2NSXA 1SEQH 4XOCA 1URZA 2ZOKA 3FRPG 3BD3A 3OR6A 4TVPL 3LHAA 4WY0B 1XF0A 4JHVA 1FE8H 3VRLE 4Z3FA 1BYCA 4NKCA 3QFJA 2Y07H 3T0ED 3QA3B 1D5IH 4RDQF 5GZNA 2VELA 2JWYA 5A6MA 1YXCA 3HS8A 2FSEB 4FOJA 3VXGA 4JHWH 2A9MH 3U0WL 4YXLL 3WZ0E 4J3OF 3RURA 2K70A 2GSGB 4BELD 3TA3D 1CGUA 2XIOA 1JFXA 4HOZA 1K2DA 1EJVC 3OAZK 5JXEA 4FQLL 4PSRA 4ZOCA 1IBBA 1KBGL 5DF0A 3D3VB 4CVZA 2JCCA 5FS5A 3T78A 1RMFL 5JQIB 5KWYC 3JR2A 1HHKA 2CLVA 2DY2A 1IM9D 5LXVA 4PW9A 2JFCA 3X11A 1VAHA 1ZDSA 2QGEA 3NQMA 2PNDA 2XBTA 1X5HA 3KJ4C 3QJSB 1I9JL 1YEYA 2P8PB 2VABB 2ZXBA 4FTVB 3UTPE 2WNKA 3LH8A 2AJZB 4ETQB 3F64A 5KN5A 2RFGA 3KBMA 3NG3A 4HB7A 3RG6A 2XZAH 4HFWB 2RALA 3Q7JA 5GZOA 1MCWW 1WTGT 2P8MB 5CZXC 4ICMA 3P40A 1DBMH 5HYIA 4W7UA 6TIMA 1DXEA 4PJEA 4YBQC 3UTZB 3DENA 3O16A 5C7HA 2P53A 3FFCE 1P7TB 1C5DA 2CO6B 1DWFM 3PBMA 3TTQA 4I9JA 4HLEA 4JN8A 2J4WH 1UP3A 2QPFA 2IH9A 3OZLA 2MMXA 4JG1H 3CFCH 1LQSR 4U1LA 5H2BB 1F6AB 3RIKA 5KVFE 2VDKL 2I9TA 5ACMA 1A9EA 2R69H 2H9GA 3L3JB 4LP8A 3PL6A 4CNUA 1Z9PA 4P7NA 1NCTA 5JW4R 1GTHA 3NFSL 1SR9A 5CBIA 1R0MA 1SXCA 3BZGA 2W66A 2V3EA 1X9LA 4NZJA 3CLWA 2F18A 3LPOA 3PQYB 1LUCB 1OGTB 1AIFA 1CE6B 1RQHA 3ATEA 3ZU8A 4AD2A 2BGSA 2VEGA 4F0RA 5IDIA 3MOBL 4ERSH 1ETB1 2RKXA 1SDDB 3BL3A 5CBEA 1VIZA 2BNRE 3BW9A 2Y25A 1RPKA 5I1HH 4RZCA 1LE5B 4RA0C 5TJWK 2GSMB 5JIQA 1RK1A 4YWSA 1HXKA 2YRLA 4NN5B 5GJNA 2BDQA 4HW6A 4JFPB 5I15H 2XSAA 3RO6A 3WCYA 4PJEE 5C0BE 5TDOB 3IB4A 3VFTA 2G9HA 3GNPA 1U83A 2YXFA 3IJ8A 3K2IA 4U7MA 4MS6A 1A3QA 1V27A 2GJ6D 1G84A 3CDFA 4I5BB 1Y7VA 5DDHA 5LG1A 5D2LE 2VFDA 4JVUA 3PSWA 4GFSA 4LVFA 1QHPA 4D2NA 3A9BA 3TZFA 1W3LA 4A8LA 5C07E 4DWDA 4C6IA 4PMEA 4YDVB 3BMWA 1CDGA 2O9TA 1XDTT 4N2IA 4TTDC 3DARA 4KK8D 1C5DB 3SO5A 3QYMA 3BVNB 4TXVB 2PYFA 4WW1B 4H26B 3E2SA 2UY3A 3Q5TA 5D2NE 4OCWL 5FB8B 2OELA 2XTKA 4G8TA 4GISA 4KCWA 3K2UH 1I1CA 2FZBA 1NCJA 3AACA 1HP4A 3WUGA 1CX9A 3BUPA 1YPZE 1AFVH 4FDWA 4LCIL 4CJ1A 1WFIA 3LQZB 5AKRA 2PGWA 3UWQA 1MHEB 3K3QA 3L9BA 4UV4L 5I28A 4PRNA 5DD3H 4UZSA 5E1GA 1HQRB 3RUGA 5IJBC 3JWOC 5L9FA 2XPGB 2QNEA 4Y5VC 3ET9F 4O1BA 4U5KA 1WAUA 5L0QC 2B1HH 1CWVA 5BMFH 3AQUA 4BI6A 4AV0A 2WC3A 3HG0A 3NPZB 1V8EA 3GSMA 3SCOA 3VSVA 2YCEA 3J2PA 4NUMA 3ZDXB 3DSNA 1JVKA 5AYUH 3SJVA 4D9RD 5CEZL 1E6SM 4Y16C 1AOZA 5TDNB 1DQWA 1FVPA 3EB4A 1JV5B 5E6RB 4ES4A 4UIKL 3HB3D 1UEYA 3OKKA 5ACZA 3GI9L 5I1EL 2A7NA 3DX6B 3TK7A 3H7LA 3QN3A 1Q9OB 4AG4L 3DI0A 4BH8A 3OD3A 1UOWA 2HVJB 1JL8A 3M7FB 1N8IA 2NNAB 2DWDB 3S35L 2XM2A 1NKGA 3TU6A 1PIGA 3M88A 4HKPA 3VQLA 4EN3A 1XTMA 2EG8A 1L3WA 1ET7A 1UEMA 4GW1B 3ARFD 1ZSDB 3HFYA 4GXUM 3ZDYF 3KDPB 3U4FA 2FFIA 3B4YA 5DK0B 3P82A 1E71M 4X4ME 4NL1A 1UJ3B 4LLYB 3LEYL 3OF6D 4H1LH 3QY6A 4XWGL 4NO0D 2D2HA 5FK9A 4MWAC 4A1RA 5E08H 1VHPA 5KSAD 3I3DA 3H4FA 4PGZA 4BA0A 1Z9LA 2EKCA 2WNZA 1M7DA 3ULVL 3DTXB 3Q6GH 4I9WE 4ZOBA 2VAAB 3B9VA 1SMAA 4DSYA 5IKCB 3NVTA 4QROA 3T81A 1ZLSL 4Z95L 5DUJA 4DWHA 3A4EA 4L0ZA 1FN4A 3BWAA 3CX5J 2ZKXA 3H3PL 4TLSA 1Q6GA 3L2MA 1W1IE 2CLFA 2J7HA 3N1GC 2ESVB 4JO1L 2P5ED 2VXTL 4QXTB 2DZTA 2AV1B 3BIAX 5CNHA 2BHZA 4D6FA 4AH7A 1YNYA 5FM8A 4TQIA 2WKGA 3JWOL 1RH9A 4AC7C 15C8H 1O6TA 4JBSA 4QRSA 3BSMA 5I19H 3LI1A 3ZR4A 2ZDRA 3TLLA 3FFOA 1T7XA 3CFQA 1X9QA 3B7YA 3CMOL 4RPQA 1NC4A 1VHNA 5TE6L 5BO1H 5ABHA 1UWQA 2NX3A 4JAMB 2FEEL 1S5NA 1VS1A 1XQKA 1WTLA 3ECBA 5IJVA 1ZJAA 2OFJA 3GO1L 4FMVA 4QF1B 1UWXH 3BH8B 3S42A 1KC5H 3M6DA 1LK2B 1QW8A 4TLKA 1J11A 4O51A 3QGKC 1U3HB 1XJBA 4YBLC 5FYLL 3ZTJG 2GHWB 4RZ5A 1MREH 3AIUA 2V38A 2F8QA 3UJFA 1ZALA 2DZXA 1YDVA 3TT1L 4AD5A 2NXGA 4OJYA 3LRSB 3MRRB 4OD1H 3WLLA 5HGHA 4PLJC 3G1VA 1J0HA 3VFMA 2BIIA 1PD6A 4Z7OE 4A3HA 2DQEL 2ZUWA 3C2SA 2YARA 4GG8A 4AE1A 2Q09A 3GU1A 5B3JE 4GXWA 2DV0A 3UP6A 4O19A 5KSVB 4ODWA 4PGBA 3H6JA 2ZICA 2V2DA 1UJPA 3I4EA 4GNJA 5U7SA 3QH3A 4PV8A 3T3MB 4MWAE 2V5CA 3QK0A 1KJVA 4IRZL 5C92A 1UPMB 4ZOAA 1ITXA 1TPWA 1N8ZA 4US6A 4XTDA 1TKWA 3FU0A 5HHPB 4KKNA 2JMRA 3RP1A 3UVAA 4UTMA 5KZMA 4HWZA 5HAOA 4K0OA 1OAKL 2K3TA 2M26A 3EXSA 5IRPA 1ZP3A 3LMJL 1KT2B 2P80A 5K59F 1CI1A 3T6ZA 4JO5A 2QADC 1ZVNA 3MRIA 1O7SA 2IQ0A 4GQZA 1FWTA 4AM0A 4NZ1A 1KLYA 3H23A 3EBAA 5HHVH 3L95B 3NFNA 3S98A 2PO6B 1FWBC 4FD0A 4HT3A 5FL1A 5AZEL 3O9WA 3MPCA 1XIGA 3DVNA 5L88L 3EO9L 4R4BA 4DN4H 3OXSA 2ZVIA 3ZDZB 4Z0JA 4DAFA 1JZ2A 4AU0A 1I4NA 4GEJA 3WH9A 3W00A 2G50A 1UD6A 3DOIA 4ODXA 4L8DB 4OM0H 3EX1A 1EA0A 4HT1H 4OGXL 4O0KA 4U1IB 4YDLB 2FTAA 3B06A 1CFMA 1CFVH 2Y6SD 3ASOB 3RX9A 2BP8B 3L3IA 3OZYA 1HI6B 4H1LG 4PBDA 5D4QA 1GWJA 1NEZG 3VH8G 4ORGB 3S8WA 3V0VA 4ZNEA 3TBSB 1K4GA 4XAYA 1BEUA 4NFCA 4B5UA 1D5RA 4BSVA 4LXFA 1TCMA 4MA8H 4YIQA 5E2VH 2K6WA 5J6SA 4DGVH 2OTDA 3I68A 3L4VA 4LAZA 1OAXH 1U30A 3E2QA 4MKSA 2H0FA 5CGYD 2DIEA 1F4WL 4I3SH 4NQVB 3G1XA 1BX2A 2OULB 3SYCA 4GJIA 3GX9A 3KWVA 3VKKA 1U3ZA 1D6VH 2J8UF 3Q3GA 3I9IA 2O26U 4OLZL 5BW6A 2X4SB 3HJ0A 4XWOD 5AOIA 1RR2A 2VN3A 1DVYA 3CBRA 4EXKA 1BXAA 5KVMC 1OYAA 4LLMB 3GLCA 2WHLA 2QHRH 3GVWA 1MKFA 1FAIH 4G70B 3PUOA 1KV7A 2NXYC 3UXLA 4JM0A 4IMAA 5I6PA 1TSRA 3QY7A 3LGEA 5E9AA 5K39A 2IJ0C 1YZZA 1C08B 1WLHA 2I5YL 1UUQA 2PTWA 5IWLA 4UFJA 2JK2A 4QWWC 1NMCC 3QZ6A 3ATYA 4PMRA 4YHLL 1XUZA 4NQEE 3STGA 3RFRA 1PVNA 2FRGP 1HVXA 1B3YA 3VYPA 1JHLL 3CPUA 5DD6B 2IKIA 1GVYA 5FKYA 5T1MA 3PFQA 3ESPA 1W6LA 3TYFA 3UTQB 1VPOL 3N2BA 2VSKB 3V4PB 5HQEA 2FQGA 1KXTB 1DHPA 2WLZA 3D0LA 3B04A 1GGIH 1MUJA 3N44B 1FVDA 5DXWA 5DHMC 3TBVA 3MJGX 3DEQA 1FL6A 5DY2A 1LEGB 2KC0A 4GY1A 1BKHA 2CLIA 5CPSA 4G1MA 3NZRA 4BIKA 1AIZA 1V5XA 4US5D 1DBBH 1T6VN 2K3HA 3BKML 4FQXC 2Q8BL 4S2BA 5EMKA 5I30L 3ZDXE 1NFKA 1XF2A 5C6MA 2R56L 1LBMA 2NNFA 3CN0A 1DJNA 2AMUA 1AO7D 1ZAGA 2HJFB 4YLQT 4E36A 4G6JL 4F5CA 3RAOA 1IU1A 5H35A 2NUXA 1CD9B 1U42A 1R3IL 2FYVA 5E8DH 3UYCA 3WQ8A 5DJ6A 2BVPA 3EB3A 5HK4A 4ELDA 5M1TA 3Q2DA 2Z24A 1FVCB 1AHWA 2GI0A 2WPGA 5FCZA 3K1GA 1M04A 2RDXA 1BMWA 5AHEA 3CZLA 4UBPC 2Y4SA 1XR9A 5JW3L 4DXKA 3WEAA 1PX3A 1ZVSB 4S1RH 2FL5A 1IBGL 3UWVA 4UNTA 3KWUA 2LU7A 4LSRH 3EO1B 1TCRA 4KXAA 3GBNL 4LLDB 4M43H 5CSGA 2VWTA 1LNUB 4J8QA 3ITTA 4XPFH 2XSXA 1FNFA 2OMXA 2FO8A 4J3BA 4R26H 4KKBC 3EHBB 4Z9KB 1I3UA 2PI6A 2WMIA 3ARBB 4YDKH 5T8IA 4FFZL 1AAJA 4UQEA 1UWYA 2GK0A 3FHQA 4JCMA 3QDGA 5AUMA 1CTMA 2ZXQA 2Z31B 4B15A 3MRJB 2Y6TE 4PUKA 3E0GA 4WV1B 3RYSA 1G0DA 1ZV5A 3O3EB 4JN1H 1MLBB 2PWFA 5E95B 1U8OA 4C8XA 4MXVF 1E0TA 3TX4A 4PJEB 3UTZA 3HFFA 1FGVL 2I85A 3VE9A 3NT0A 1MQQA 4WQ6A 1MH5A 2DQTH 3OXRB 4A8RA 2W65A 7A3HA 1JGIA 4HN8A 1FFQA 4AY1A 1P7QB 2R2HB 5E8NA 3E6FB 1OOWA 2BY2A 1MRQA 3BPWA 3E74A 1XCTB 3OL2A 2OFQA 4R8WL 1O60A 4E0RB 3SBWC 3LLDA 5D6CA 1EXUA 4AOFA 3VIFA 1WF5A 1XGYL 3C5ZD 2VLKE 4H1ZA 4GZJA 5J6HB 2C9SA 3LCHA 3U0HA 3K2UL 3WTSA 2WLNA 3AC0A 4JZJB 3L5LA 1M41A 3B8VA 1KEGL 4FQCL 3Q1SH 2ICCA 1A66A 2OYLA 3SDXA 2ABAA 2H90A 2ROXA 4M7LH 3ULUH 4MKNA 1V8HA 5EIQA 5IFHL 4D6CA 5B39A 1MVYA 3ZKXB 1ET5A 2HPMA 1N4XH 2CLOA 1DJQA 5J89A 3N73A 1U8HB 1IQDA 3L45A 1ZA6A 5JA8B 5JH1A 1J48A 2WV8A 3R89A 2XZ9A 2BG5A 1GQNA 4OF7A 4LCWB 3QDMD 3BQ6A 2ZADA 3GI8L 2X1TA 1V6VA 5K69A 5D8WA 5D7KD 2GK1B 5BOFA 4TOYL 3S1UA 3ZSSA 3ZMRA 4DP1X 4QIUA 4J40A 4CN6A 5DLML 4GZIA 2ZYHA 3R06A 2OMWB 2BHUA 1MJJB 2E40A 2WTRA 1OQXA 1GPOH 3D48R 4FI6A 4OR1A 4F91B 1TPFA 4LBAA 2UZYA 3ABRA 1SJBA 2AK1H 2XWCA 2XZCL 4HJTA 1NDGA 1VKXA 2N7BA 2G3IA 4NKMA 2Z2AA 3KZPA 5TH2B 1Z8AA 4DB7A 2EG6A 2EH8H 3MMEB 4H8QA 1NCCL 1P4IL 2XA8L 4L8BA 4XI5C 5L4IA 2I07B 1B31A 4NGHL 1EKOA 4GUHA 3EKCA 2AOSA 1GOWA 1FL3B 4APXB 3DOPA 5GGVL 4HA3A 4NT0A 4OIAA 5CZRA 3QZNA 3VIOA 1XEDA 4E41E 2H7WA 2QSCL 2WO2B 4QJ5B 4M62H 3MP3A 5HDLA 3I7QA 1UA6L 3LA4A 5MENB 1OXYA 1T8XA 2JK5B 2WTRB 3FB6B 1FY6A 1XG4A 1VIWA 3FDKA 4TUOA 4PY8J 1ICSA 3G5XB 3K6SB 4QS6A 1I7ZA 4MA1B 5LUMA 2G4FA 4GAAA 4HX1B 5DEGB 2CBTA 4H6KA 4QISA 3TZNA 4A3UA 1EAPB 1PD1A 4MNQE 5IQ9B 2X4RA 4UT6L 3BZEB 4X3ZA 4LOFA 3PUCA 5F1NA 4HAGA 5C0JB 2L7EA 2NW3A 3SKJH 3BGJA 4HVXA 1K8DB 2ZQKA 3JZUA 3CT2A 4XN4A 1ED3B 2NQJA 1IQDB 3PGDA 3S35X 2I7OA 1ZENA 1WAAE 2GY5A 3QO1A 4OGZA 4KFNA 4PH6A 1PFCA 2VMFA 3KH4A 3TTYA 1VGKA 3IK2A 4AQ1B 4Z7WA 4K7PX 3CZUB 4C6PA 4H7VA 1I1RA 2XZZA 3R79A 1CDJA 3DK2A 3HA1A 1MNUH 3II1A 1RK0A 3UCCA 1OG0A 2C34A 4PHZA 1TYGA 3OBEA 2XQ0A 1NGWA 1BD2E 1VFAA 2BMKB 4HWEL 1W3KA 1H6TA 3D3VD 3I50H 1OX6A 1A7QL 2FGBA 3DAQA 3E96A 5CJMA 4N2CA 3PGCA 4N0UB 1H0DA 4PV9B 2NY1B 3QPXL 3LKSB 4M1CD 4RLDA 4Y2LA 2O61A 2QVTA 3OAUH 1K6WA 3PG2A 1M1XB 1NAMA 3PQYE 1OE3A 2NZ9D 3QNXB 4QRUB 3ZDZF 2BODX 2CITA 3M0JA 4OFCA 1FSKB 3WFEL 1TJ1A 1LO2H 3I6SA 5FSDC 4D8PA 1FWIC 2HRWA 3D39D 3OMAB 5K9KA 5FC9A 1YTEA 5EO0B 5BPPA 3ILQC 2EXOA 1GOXA 2GK0B 2HUHA 2IDUA 3P9MB 4CNIB 2Q7AA 5J9PA 4H6QA 4RDQG 4KOCA 4PJ5B 2XWTB 3VSTA 1RFDL 2WKOF 5JHDB 3L9CA 1MF2H 1P1ZB 2IH3B 3GO2A 4J3VA 2FJSA 4L6OA 3IDJB 1G7PB 4J28A 1R0AL 1HDMB 1DE5A 4KCUA 4KY1L 3UXDA 3VK5A 1G67A 4X7TA 2QT3A 1BQHG 1UR4A 1W8NA 4BD4A 4LEFA 3EDEA 3O41B 2YAFA 4JGUA 3IJDA 3BEVB 1A7OH 3BE1H 4WWOA 1Q13A 1S5MA 1AQKL 3H12A 3MRDB 1UENA 2Z0BA 5FX3A 4URTB 1CFSA 2WQXA 3LD8C 5ADOL 2VDIA 4IMKA 2BNUA 4TSAL 1WUNT 3RVUD 3TYGL 2FBOJ 4AJVA 3W38A 2OO6A 3PTMA 3SAZA 3W1PA 4EP8C 4JPGA 3PWJB 4GUCA 3D3FA 3FT2B 3P4NA 4GQQA 4KNTA 3OJDB 1RSFA 5HI5C 5EPMB 1MQPA 4L9DA 1P1ZA 1R3JB 4EAYA 4WEBL 4MXWH 2FH6A 1N70A 3HW7A 1GA2A 1G87A 3P1VA 4KMLB 4LFHG 1KY7A 1XF3B 4OKDA 2Q7YB 4BE5A 1DXFA 3UYPB 3VWKC 1PUDA 1ND0B 2Y7SA 1DQMH 3IWUA 4WI8A 2X44D 1THCA 4LPCA 3TXAA 4EE2A 1QOPA 3DX1A 3HS9A 3LK6A 3UPBA 1M4KA 4XGZA 1M6OB 3SYAA 3VUSA 5HXMA 1U8IB 4MA3B 5DRNB 3VABA 2VZSA 3IGKA 4KO7A 5EBUA 3CPLA 4XPGH 1E15A 1F2QA 3NXLA 1N3NB 4OV4A 1XGPB 3B9EA 4GS7B 2R7EB 1HGYA 5E9DA 2FE0A 3SJ3A 5BS0A 1HSAA 3KYOA 3R4RA 4PS4H 4PWKA 4F8NA 4Y9NA 5HULA 5GGSA 4YVNA 4S1SL 4IIEA 3GH7A 3QEGL 5ESVA 4JGDA 3HNSL 2IWEA 1T2QL 1MFAL 5AD0B 4HKBA 2OX5A 1TIWA 2YXXA 1JK9A 1M05B 3P0YH 2CR6A 3PIQB 2YD6A 5F3BA 4MQ7B 4HIEB 3SN6N 5I3JA 1VGKB 1ZHBB 4F66A 2C7UA 4YTQA 4K8RL 4QNWA 3IFOA 4ADSA 1TUPA 4G5DA 2EKSA 5JHBA 1AL8A 3HZMA 4AEHH 3WS6C 1KLZA 4O1CA 4L5FE 3A6OA 4HTYA 2XDFA 5F9AC 2NW3B 1UT2A 3VG0L 1SY6L 2JJSC 4KQ4L 4CGTA 3U8GA 1AH0A 3BPLB 5L2KB 3ITVA 1HESA 3I4KA 3FU8A 3DGDA 4LQFH 3VWKD 3P6LA 4I6KA 3PZIA 5D1ZD 2EF9A 3NOEA 2V3GA 1HI6A 4XPHH 1D7KA 4KWOA 2ADIB 2XBZA 1KLGA 1JXJA 1RV6X 5DVMA 4U1IA 2IFFH 1RY8A 1I9IH 5I3FA 1RY0A 5CPQA 4GQGA 3LNGA 2JNZA 4J4PA 1HWWA 3T8VA 4PL1A 4O28A 1ITQA 5HINA 4K9EL 5CJQL 2HX7A 3S6CA 2F7OA 2I07A 4PTUB 1S9XB 1FNGB 2DKMA 2LAAA 4NKIH 5FHAL 4AZ8B 3MV9E 4OZIF 1QT1A 1FHGA 5IVZB 3S9YA 1SY6H 1K72A 3FF8A 3GIVB 2H3DA 5IBUB 1T66C 3EH1A 3JS3A 3MGOB 4W9LC 1WAWA 1GTNA 3HQ1A 2V5MA 4OOUA 4R88A 1CQKA 4NZRL 3T8MA 1QUNA 1IXPA 1A02N 3CHRA 2YJLA 4I1RA 4IMLB 3WKNA 4QUOA 1IRAY 1M1BA 4U6TA 4A7TA 4DN3H 5IJKA 4ZA0A 5MF5A 1BF8A 1M7IA 4DYEA 3G6DL 1I7TB 3ZT6A 4WK0B 7XIMA 5DY3A 3RI5K 2IQAA 4JIEA 2Y5TA 3C5SA 4HZLB 3ILQD 1LP9E 4YTTA 5JXED 4L9ZA 1T7WA 4KK8C 5HHOB 1BTMA 1CD1B 1XX1A 1DFBH 5HPMB 4ZVJA 4Z2HA 2R9HC 4Y89A 5T3ZL 3CK0L 1U41A 4LFHD 5FO7B 1IM9A 4JHOA 4DEUA 4ZK8A 4AQEA 4FQ2H 3ONBA 1TB3A 4H13C 4QYOB 3EXLA 4OFYD 3VFMB 1P4LA 3JTSB 2FR4B 1KTDB 2BY3A 3W7EA 2N3JA 5AAWC 2BS8A 3I6EA 4WKAA 4HTBA 2VC7A 2XICA 2ZX9A 2I32A 4WIQA 2QW5A 4CD7A 2DB8A 3H9HA 2YCLB 3GB6A 2UY6A 3MREB 1UQSB 3GIZL 2NUTA 1I0DA 4EF3A 1IBDA 4IG2B 1WIOA 5HJYA 4IRZA 4XO6A 1IARB 1PZCA 2AEPH 3BFQG 1PPIA 3UYOD 5FO8B 3JVFC 1X7IA 2JEQA 4ZMWA 2R24A 2EDKA 5GGQL 1U58A 2PGRA 4F2UA 1KOAA 4HSQA 5DC0A 2O6EA 2X5PA 3KHQA 5D2LF 1FHNA 1HJUA 4IRSC 3H7RA 1MY5A 3ILDA 4GRWE 4QOKB 4W89A 3DTDA 3RRXA 1Q38A 2XFRA 4EF8A 5C1MB 1S2VA 3MCYA 4JG0L 3PJNA 1OARH 3QDGE 3QQDA 4H8WL 4JY5L 1HXMB 3FU7A 4LMQE 2W8CA 3RL2A 5KYYA 4DGIH 5FKAB 2BBFA 3O0RH 3BQUB 4X7SH 3FO0L 2E7MA 1BFOA 4S2SA 2ESVA 1EHXA 1TRIA 4C47A 1GL4B 1YEIH 3VXRD 2D7MA 1T03L 4XB8A 4IXXA 3S1GA 4Y9BA 3CN4A 4HQVA 3ZGHA 5EUOB 1PE1A 3QVAA 3DJRA 1GKQA 4JN7A 4FQHA 4N86A 5E1AB 1OWQA 5D09A 1CZ8L 1I3GH 4KJQC 1EUNA 3CS2A 1YCSA 3TIMA 2C19A 4QHMA 4YGVB 3MTXA 1ONXA 4NP7A 5IBXA 4XMXA 3BAXA 2PPEA 3TYCA 4PZVA 4BF7A 3AS1A 1I9RH 4FMFA 3SQLA 1INDH 3TNMB 3EOLA 4LW7A 4M7KL 3AHXA 3H3PH 3FK4A 5BNKA 1TMCB 3QJFB 2IMRA 5G2WA 2XXMB 3L6FA 2PO6C 3UTTE 6ALDA 1KFAH 3CVIL 4PJ9C 4HS3A 2A2QT 2GJ6A 4OUEA 1DVFB 4O13A 4AI7A 2DMBA 3OKOB 1C9WA 4I5UA 1PF3A 2CUHA 2JJTC 2O5NA 1EO8L 2FJHB 2EDQA 5F0PB 2GG1A 5TPWH 4P06A 5C08A 4EI5B 1LK3H 2DLHA 1KTRL 2EIZA 4PRBB 3AICA 3HPSA 2NNCA 2YPKA 1YNKH 4HZ7A 3AREB 3HKZA 3URBA 2ZOLB 5LGHH 5M3WA 4HN4A 2NNRA 1TJHH 2P88A 2ATSA 3KPSD 3URQA 1KTKE 2Z2UA 4BI7A 1H5BA 1O1HA 3HTWA 4GI4A 5E56A 5IVZA 3TEUA 5H2ZA 2FWUA 4I3RH 4IJRA 2UYLB 4C6OA 1XSOA 1GUVA 4OV9A 2MPVA 4BHUA 5LBSA 1BMGA 2OMAA 2XGIA 4DJDC 3CV5A 1GZQA 5D1QB 5T1DH 3ZYOA 2VSMB 3QIBC 1NF0A 1WBZB 2KL6A 5FI8A 2MCAA 5A2BA 5A2JH 1BM3H 3O9NA 3AUOA 4MD5B 2KX9A 2VKZG 3EYSH 4UU9B 1T7ZA 3D9AL 4HC1L 1QWHA 1U95A 4IDJH 4IMFA 1GVEA 3TWAA 4G82A 3IRSA 2FJKA 2IPWA 4ZSOB 1P6BA 2EDLA 3GHEL 1HINL 3BVNA 4WW1A 3HOJA 3MZNA 4DJED 1JGUL 1E8ZA 1Z9SB 2VUKA 4G6FB 5I17B 2GGGA 1QSFA 5BMWA 4IU2B 3UDWC 4K7FA 1CLZL 3WJSA 2W27A 3U1PA 1XC4A 1XYLA 1XR2A 5D55A 3MWCA 4Q33A 2JI1A 2Z35B 3IFOB 3TWCH 4W9KC 3ZE1E 4APQB 1E4MM 1LRQA 3C0QA 1GC1H 1BHGA 2XFXB 3PAVA 3V5KB 5CD3A 4CVXB 4NO2A 3MHZA 1QLFA 4JRXE 1H7XA 1TZ9A 3BPLC 3TEVA 1CZ1A 4A67A 1IQWH 3ARDA 4DNLA 2E9IA 4M4RA 1KXQE 1PDKB 4L9LA 3MOBH 2CJUL 4IEFA 3BARA 4FOKA 1KLFB 4LSSH 4FZ8H 2F54D 2PCFB 3SIMA 3O9WB 5LN4A 4M9PA 4RGOH 3WQOA 1XCQA 1I8UA 3VFWA 2A4AA 5EEUA 3RLVA 5F2MA 1XL4A 3U4BL 1L5GA 5DRXB 4PL2A 2AXGA 3DJ9A 3T2LA 1Z3RA 3MRIB 4IIBA 3K71A 1MI5E 5DRZB 4ZW8A 4MVAA 3VNKA 3W01A 4LBEA 1CXKA 4GFTB 2WCGA 5EF3A 1C3FA 4HWZB 1RQEA 4LF3B 4MM1A 3TJXA 3QCVH 4HD5A 5AVVB 1Y18B 4N24A 3KLAA 9CGTA 3Q37A 4GKLA 3BN3B 3JWNE 1RUKH 2NY5C 3QG6A 4IHOB 3GSNA 4WHCA 1EJOH 5ADPH 3FH8A 5KSVA 1DJSA 1XGQA 3AQZA 1OX5A 4MAVA 2E5EA 2QQKL 4PG2C 3VIHA 4XO8A 3LKPB 3BO9A 1JG9A 4IBZA 1KEMH 1HZHH 2IBZY 4JRXA 2XKSA 1DBKH 4NWUH 5CEZE 1EC7A 2AV7B 1W5NA 4I5RA 1E9YB 1ISYA 3O07A 1CFSB 2NY7H 4XI5D 4MYAA 3UTSA 4PJ9B 2ZCGA 3GE7A 5CP3A 4ZRGA 3F6JA 3H6AA 1DVFC 1E1CB 1YX1A 2OSLB 3A21A 3ITYA 3DGGA 5BRBA 2EXYC 2QPEB 3NH7H 3HZVA 43CAA 4IIGA 3FOLB 3P67A 1DDHB 3RN6A 5T26A 2YMTA 3VD0A 2XETA 4ZD3L 4R90H 1FH2A 1A4MA 3UC0L 4FI4A 3ARSA 5CKAA 1NL0L 1JDFA 3WIJA 1QO3A 3AREC 5E2UH 4FL4B 4D9LL 3NZHL 1KPRA 3FRPB 4FJ6A 2BNQA 2NY2C 2C18A 5A6LA 4OZIA 2WGNB 1FXQA 1DBBL 2AMGA 4NJ9L 3FUKA 3CHXA 1QVOB 3P9WB 5HDBF 3TLRA 4AVIA 4MB3A 3BWUC 4LLQA 4W4OC 4Z18A 4BDVA 3O6KH 3TBWA 3H9YA 3TH4T 1XCFA 4P5KB 1UWEH 1RVFL 3CSPA 3QNXA 5D7EA 2R8SL 1U95B 2BZ7A 1MDAA 5BZZA 4G6JH 4DVRH 1ENUA 2HS6A 3MKCA 3QW4B 4AT6A 1ZLUK 4Q6IC 1IXOA 2NXZC 1D9KA 3M1BB 3PWLA 2EVFA 3DBNA 2VWEC 4KKAD 1CFTA 4NZUL 1Q8AA 5M5DA 3VOJA 1MLCB 4ONHA 1QTYT 4JM2C 1ZLVH 4HUMB 4KNUA 3GBLA 3GINA 3C6LC 4KXZH 5FSEC 2XN9D 4FHBD 4N2HA 5MENE 1HYSC 1FJ1A 5AFAA 4UFLA 2Z7ZA 2PLTA 1D3CA 5D9SA 3TLQA 1ZANL 2PSNA 3TSBA 2PLMA 3C8HA 3HIZA 3GVQA 1RUSA 1K8DA 5CIPB 4QHLA 1UZ6F 2PDPA 3SPIA 4PJ7F 5FKPA 3STZA 4JCWA 1SW3A 3APCA 3MRQA 4IPNB 3SCPA 2MIZA 4Z7NF 2YD0A 2V6HA 4NY2A 2OR9L 2XV3A 5I1EH 2PU0A 2V8ZA 4ZTOL 3KPPB 1XYZA 4JFFB 3RR1A 2HCZX 4XO3A 2BGQA 2XNAB 1DWHM 5BOJA 1HEZA 1JFQH 1I3GL 4ZPVB 4X42A 3TIDB 3N17A 1BZ8A 2WLIA 4N2EA 4HS3B 4NAEA 4HC1A 3TTSA 3UO1L 1P7QD 2AEIT 4NZTH 2WQVA 3OG4B 3FT0A 1CD8A 3KTXA 4XNUL 2GDQA 3FT3A 3GMQB 1FL3A 3FH5A 2LLGA 3O3UN 4HPYH 5FYJE 5D72L 3CWHA 3NVDA 2QCFA 3QGAC 4M29A 1MI5B 1HHGA 4BK4A 5G1TA 5IQMA 4OFPA 3DNKA 3CZFA 2WN2A 3P9LB 1WSST 3CVIH 4R5EA 1P6AB 2F1EA 4XVUC 2PDLA 3PJSB 1EOMA 3CSYA 4UOQA 3QXWA 1H3WM 5GRJH 4BS0A 3FUHA 2CPUA 3JQOB 3WO8A 3NYDA 4C6LA 2IV9A 4X6CA 4JFYA 4PS8A 1B5TA 2C1HA 1EHAA 1CICA 1IC4H 1YAIA 1A1MB 4LVOB 4XVSL 2EJAA 2DQJL 4L23A 2C5DC 3UIZA 3I6RA 3P2VA 2V5TA 2LW3A 1FFTB