3OLDA

Crystal structure of alpha-amylase in complex with acarviostatin i03
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
495
structure length
495
Chain Sequence
YSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Pancreatic alpha-amylase
publication title Structures of human pancreatic alpha-amylase in complex with acarviostatins: Implications for drug design against type II diabetes
pubmed doi rcsb
source organism Homo sapiens
total genus 173
structure length 495
sequence length 495
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3oldA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3oldA01
1I75A 3RPMA 2J62A 3BCFA 4JHZA 3W53A 3VINA 2V5CA 1KQYA 2BY0A 1UQYA 1V3JA 3VGBA 4OOUA 4UFLA 1S46A 2IXUA 4WJXA 4FNRA 5HNNA 1G1YA 4E8CA 4DWSA 4Y7EA 1JDCA 1C7SA 3OB8A 3VDCA 3AICA 3U5YA 3WNLA 2CEQA 4KH2A 3CMGA 1HJVA 4YHEA 5ECUA 4NX0A 3VO0A 3ARZA 2VX6A 2OYMA 4HZ8A 4ZXLA 3VIOA 3QOKA 4AC1X 4CN4A 4BQ3A 1FP9A 2PB1A 3VX1A 2WVTA 2G3MA 3UETA 3NYDA 3HU7A 4P7QA 4UQEA 5A2BA 1K6AA 4V27A 2YL5A 2PC8A 3D3AA 3VD9A 3RILA 4AZGA 4V28A 4YN5A 2WANA 1GHRA 1GOKA 1NARA 4QCEA 2C8NA 1JAEA 3AZSA 4PMYA 3AHZA 3U7BA 1KGWA 1QNRA 5A1AA 2BS9A 3ZIZA 4HOWA 2X0YA 4U31A 1I1WA 1H0IA 5CLWA 5CSYA 1GOIA 4HA1A 4D6DA 5LA0A 1DWGM 1QI2A 1B9ZA 3WENA 1G01A 3HN3A 3MUZ1 4GZIA 5E6ZA 1CIUA 1E6QM 1GQIA 3N12A 3NUKA 5A2CA 3O9NA 3BVXA 1P6WA 2JIWA 4IUGA 1TZ7A 2JF6A 1HX0A 1KBBA 4UQDA 3OGVA 3WEZA 2YBUA 1WZKA 2QPUA 5DT5A 3MUIA 3WMBA 1YHTA 3GXPA 4MB1A 4B9ZA 3EMQA 3MUAA 4H2CA 1CWYA 2BHZA 3AHTA 1E1FA 5I23A 5BCAA 3D50A 1NWSA 5E0FA 1UG6A 1JL8A 1ISXA 1QHOA 4AZCB 3AHXA 2YBTA 3WH9A 5EMYA 3W37A 2VQUA 3O6AA 2DSKA 3WF3A 1B2YA 1YQ2A 4UQ9A 2WCGA 3CZKA 3ZSTA 1W3LA 3WQ5A 1E6PA 3GXTA 1EO7A 2D3NA 3MV11 3RIKA 2ZUTA 4H8VA 2PWFA 3WQVA 1J0JA 3VD7A 1LL4A 2XN2A 1UH4A 1XCXA 3BAJA 3BUPA 1CENA 1EOMA 5FOOA 5A6AA 2YDSA 3SCVA 2DIEA 4Q22A 5CGTA 1QW8A 3ARQA 4GQRA 4C7FA 2X2YA 1MXGA 2W91A 4AD4A 1JAKA 3K8LA 4RE2A 1W1TA 5AC5A 4NF7A 1CEOA 4PCTA 3HG3A 1T0OA 2GDUA 2J7BA 2J77A 3VIJA 2VCBA 5TD4A 3I3DA 3WH7A 4GI9A 1UWRA 3KE0A 5D9PA 4AD1A 5A94A 4D6EA 2O9OA 3CH9A 2FGLA 2X1IA 2DPEA 1D3CA 4BA0A 3KZSA 3WQWA 4L4PA 2YA1A 2DIJA 1UWIA 2X09A 3QHOA 4PMQA 2YA0A 2E9BA 1E73M 6CGTA 4AD2A 3CHDA 3VNYA 2HISA 3QGVA 4JHOA 2EPNA 5DMYA 1MFVA 2CERA 1XD0A 1QNOA 3WDPP 1QWNA 2PF0A 3T09A 1DEDA 1LG2A 4WIWA 1ZBKA 3LPGA 1XGZA 2F7PA 2XG9A 4PTVA 5AC4A 4PUDA 4AIOA 1V6XA 2GJRA 3PN8A 3M6DA 1GQJA 3K4DA 3CMJA 2E8YA 4H7VA 1Z32X 5I0DA 3VGGA 1E70M 3LXBA 3AS0A 1LWJA 3H55A 4HZ6A 4UFMA 2DH3A 2X05A 4PMDA 5HPCA 1WO2A 2GSJA 2VMFA 3EDFA 2TAAA 1AVAA 1HT6A 2BFGA 1CXEA 2VURA 3W26A 2BVYA 1FHLA 1LJYA 3BUBA 2B31A 2CCRA 1MW2A 1E40A 1UR1A 1KXQA 5BXTA 1QBAA 4LPCA 2OYLA 4NRSA 1H2JA 1GOQA 4TX6A 1MW1A 4MB4A 1XSJA 1VFOA 1QVBA 1WCGA 1JZ8A 1BHGA 1Y7VA 4GQQA 2WLYA 3CZGA 4EKJA 1QHZA 3VDHA 3DYPA 4IM4A 2NW0A 1TR1A 2WZEA 4JKMA 2CHNA 1KXHA 1JZ3A 2XN0A 4HOXA 3K8MA 2XIBA 3GXIA 3D4YA 4AD5A 3VMNA 1HVXA 2WKLA 2J79A 2XSAA 5LA2A 4H8UA 2ZX5A 4FLQA 1XV8A 1W1VA 3VOCA 2EPLX 1H4PA 2WMIB 3VUPA 4YHGA 4KRTA 1JDDA 3WEOA 2ZICA 4F79A 1GW1A 3WH5A 3UERA 2PBGA 3WUBA 1V3KA 2EXOA 1EHNA 2MANA 2WBGA 3OZPA 4D71A 1CGVA 1JZ6A 1GOWA 2D2OA 4WKFA 1VB9A 1TCMA 4U33A 2VX5A 1E5JA 4TTUA 3G6LA 1J0KA 4J3VA 1ZJBA 1E6SM 4HA3A 1KXVA 1FFRA 2VX7A 4UQBA 1JFHA 2OW7A 1R7AA 4CU8A 3NSXA 1V0KA 3BLKA 5IDIA 3UEQA 1KCKA 2BXZA 4LYQA 1PX3A 3PHAA 4DWSB 5BXPA 2X2JA 3ZM8A 1CLXA 5DT7A 4FLOA 3HG4A 2GJXA 1QNSA 4PN2A 3A47A 4WKAA 3VMOA 3WF0A 1VEMA 3S5YA 1JIBA 1X1NA 5BXRA 4TUFA 3WF4A 2FHFA 4LGXA 3WUGA 1R34A 3GXNA 4MTVA 3EJTA 2A3HA 1K9EA 1UH3A 1EA9C 1BG9A 3EDEA 4N42A 3RJYA 3AIRA 3CC1A 4GZJA 4HMCA 3AROA 3RDKA 1OIMA 1HNYA 4JFWA 3PZVA 2DSUA 3TTQA 4ZE4A 1BYDA 2WCSA 4GI6A 3B8SA 1J0HA 3GDBA 3VIHA 3MMDA 3SUWA 1TMQA 3DC0A 1XYZA 3THCA 1Q6FA 2NT1A 2BY1A 1E55A 2DT2A 3ZO9A 4J3UA 1NH6A 3CHEA 5D8ZA 1X6LA 3TTOA 3L2LA 1CXHA 2VOTA 5E70A 5AYBA 1XHGA 4B16A 2VVSA 5I2UA 1PPIA 1W9DM 2Q8XA 4B3KA 2WCAA 1UZ4A 4W87A 3OLDA 1MFUA 2W63A 1BTCA 5IHRA 2CBIA 3HG5A 2WLZA 1C3FA 3I3EA 1MQPA 4KMQA 5D8WA 3BSGA 3GZAA 3QR3A 3WNOA 4CD4A 2PWDA 1SFSA 3N15A 4ZE5A 4J3XA 4EE9A 1RP9A 4JL2A 2XVNA 3MMUA 5JBFA 4M8UA 3WN6A 3PTKA 4HU8A 3DYOA 1OBAA 4W84A 1TQUA 3TV8A 4W85A 3WNMA 4OZOA 5DFAA 3ARTA 2VC9A 3S2CA 1HP4A 3EYPA 4JIEA 3GXMA 1KR1A 4WKHA 4PMRA 3W6MA 3ARWA 1UH2A 1KXTA 4UFKA 1KCLA 1TQTA 1QI4A 1UKOA 2CKSA 5JBEA 2XTKA 1O6IA 3W6LA 5M17A 2WC3A 3MMWA 1KFWA 3PTQA 3ZJ6A 4XUYA 2VCCA 1N82A 1BYAA 1JZ7A 3VSUA 2FGZA 2F7OA 5A69A 5ABHA 5I77A 4MDPA 2XM1A 4QP0A 2A3BA 2X8RA 1AMYA 5ABGA 5I24A 2BVDA 3PBGA 2WC4A 2J7HA 3EBVA 1CECA 1GNXA 3L4YA 3VVGA 3IJ9A 5A8NA 1SMDA 2E9MA 3EDDA 3OLEA 3ARUA 4OBRA 5LYRA 3T0BA 4AIEA 1UD3A 1B3YA 1J10A 1R87A 4J3WA 5GQBA 1W9VA 1GVYA 5CXPA 3ARPA 2J75A 2V3EA 4DWSC 2EADA 3IJ7A 2QLYA 5E1QA 1HKKA 3D5HA 2D73A 1JZ4A 3AIQA 1DHKA 3W38A 2EBNA 2QMKA 3WD3A 1C8QA 3BVWA 4AMCA 4C7DA 2XM2A 2BVTA 4JFSA 3EJSA 1E0WA 1EGZA 2GK1A 1EIBA 2FDMA 4W5ZA 3AIVA 2QV4A 1J0YA 5A2AA 1W2PA 2BNJA 1UWUA 2Y24A 4W7WA 1O7DC 2WWDA 4NXSA 2WSKA 2F18A 3WY3A 1E4IA 4ATDA 1J0IA 2DSZA 4MNJA 4AW7A 4GZEA 3A3HA 3GNOA 4HPHA 5FL1A 2PWHA 4F9JA 2G41A 4NSBA 3KEHA 2W62A 1BQCA 3HG2A 2FH6A 3LRLA 4HMDA 4NRRA 1KWGA 2CESA 2XFRA 7A3HA 4FNQA 3FAWA 1UA3A 1OIFA 2DT3A 3A4XA 2CHOA 4IISA 3RMEA 4JCMA 3OZOA 4F9DA 3A4AA 1UD8A 2J4GA 5E0CA 4P7LA 2AOSA 1US2A 3L4XA 4OJYA 1UHVA 1JGIA 3T08A 1HL9A 2YFOA 5BRQA 1V02E 4W89A 1EOKA 5M3WA 4S3JA 1JYVA 2PWGA 3U57A 2EACA 4PSRA 1GQKA 1CDGA 5A8MA 3WDHA 2JALA 4CN6A 1GJWA 4GO9A 2GVYA 3OBAA 1UD6A 1W9PA 1UQZA 3U5UA 2WK2A 1B30A 3AYSA 4MNLA 1TVPA 1G9HA 3GYCA 2VRKA 1U2YA 3CUJA 1SMAA 5A8OA 2XPKA 3VM5A 3UG5A 3K1DA 4M80A 1UD2A 2WHLA 1H0GA 4H04A 2ZXQA 1QWUA 1HKMA 4XB3A 2WPGA 3A5VA 3E1F1 4CVUA 2QHAA 3TP4A 4V2XA 1WB0A 2V5DA 1J0ZA 4KRUA 1R46A 5CLTA 3OLGA 4PMZA 4BQ5A 2G3JA 1NQ6A 4PMUA 4CD6A 2WHMA 4MB5A 3PZGA 4Z2HA 3CIVA 2XHYA 1ZL1A 4PMVA 5EFDA 3NSNA 1PJ9A 3PZUA 3KL5A 3B9AA 1W9XA 2D22A 2WW5A 4GO8A 3BXWA 2G3IA 1E3ZA 3N1AA 3THDA 2ZX7A 4N0RA 4J3TA 1TUXA 2CBJA 3MS8A 3EMZA 2GJXB 1VRXA 1VF8A 2YDRA 3GXDA 4JKLA 1V3HA 5HXMA 3ZT5A 1MQRA 4CD5A 2ZE0A 3WY4A 2ZOXA 1W3JA 1TQWA 3AOFA 5I79A 2V3DA 1M01A 5E09A 1ITXA 1TA3A 1JF5A 4ML4A 3CUGA 1HVQA 4ATWA 4J3SA 1DWAM 2XWEA 2WVSA 3M46A 5DO8A 2CPUA 2ZUVA 2WVVA 4Z2JA 3DHPA 1WZLA 4JFVA 5A6BA 3S6TA 1B3ZA 3W82A 8CGTA 3CTTA 1VFUA 3WDQA 4D6FA 5IFTA 5BRPA 5CPQA 2DDXA 2XVPA 1UWQA 2EQDA 4NZJA 1B0IA 4GINA 3J7HA 3K4AA 4Z2KA 3BAKA 1UA7A 2ZX6A 5DEZA 2A3CA 3WQ4A 1RH9A 4MNMA 3F5JA 2W5FA 3IANA 1KTCA 4UZUA 2CETA 4X0VA 1NP0A 2C0HA 1HKIA 1V6YA 2XSBA 3BAXA 1J18A 1LLOA 2JEQA 2C7FA 2GUYA 1BF2A 1OT2A 4BZYA 3T0AA 3L4UA 1BLIA 4AEEA 3AMCA 3ZMRA 1Q6DA 3DX4A 3D51A 4TXEA 4AEFA 1MYRA 1ZBWA 1UD5A 1VAHA 1UD4A 4D6HA 3FNDA 1HTYA 3VGDA 1B3WA 1QNPA 5GPRA 1RD6A 4D6GA 3KWXA 1PS3A 3AMKA 3WF2A 2D1ZA 5EB8A 1F4AA 2EPOA 1MVYA 1JNDA 4BQ2A 3WDRA 3IAPA 3CZ8A 1W91A 2DH2A 1E4NA 3BH4A 4KGLA 2E0PA 1R8LA 4PMXA 1FFQA 2W67A 2E4TA 3GNPA 4BCEA 2D24A 2Y5EA 2JIEA 2X0HA 5JBDA 1XH0A 3NDZA 1JFXA 2W66A 1HL8A 3ARSA 4AISA 3EJPA 4U5KA 3KLLA 1B90A 1GZJA 1WZMA 3ZR5A 2VO5A 3EJQA 1UR2A 4FNUA 3LPFA 4FMVA 3OGSA 1WDSA 1E6RA 2X2HA 5KZ6A 3OIHA 2CBUA 4J27A 1B3XA 1QNQA 2YL9A 2GK1B 4DO4A 3NIYA 2VR4A 1K9FA 5IFPA 3U7VA 3N17A 1W9BM 3AISA 2YJQA 1E5NA 2FHCA 4C7GA 1JI1A 5CGMA 3SCUA 4UR9A 2XVLA 3L2MA 1RPKA 1J11A 1VJZA 1V3IA 3VSTA 2ZWZA 4CCCA 3RO8A 1XH2A 2BHYA 4UCFA 2FE0A 2JF7A 4DO6A 1R47A 1ISYA 2D0HA 3IJ8A 1CBGA 1WP6A 3AS2A 4W86A 5CQ1A 4B15A 2WNWA 2WVUA 3BGAA 2WZIA 3W4RA 4WLCA 3VMPA 2ZXAA 3A23A 2WYSA 4K68A 3BAYA 3N9KA 3ZT6A 4NXKA 1NOWA 3OA5A 1EH9A 1GPFA 5HOSA 1C90A 2WMGA 3L4WA 1IZKA 1M7XA 2W4XA 1K9DA 1AQ0A 3CZNA 3UCQA 1HN1A 2VZOA 2J78A 1SYTA 2VL4A 1UKPA 3FHAA 2WMHA 4FLRA 1DWFM 4WK9A 4UTFA 5I3DA 4UZSA 1NM9A 1LWHA 4UFJA 2VZTA 3KLKA 4LXFA 3N11A 1OB0A 3AFBA 4CN1A 1ZBCA 1E4LA 1HJWA 2XFFA 3MI6A 1VFMA 5FCZA 1D7FA 1E6NA 1ESWA 1MXDA 1QOXA 4HPGA 2WAGA 1ODZA 1CGYA 4GKLA 5C71A 4XX6A 2WKGA 3GH4A 3AIEA 4QFUA 4UQAA 4D6JA 5D9OA 4GXPA 1OGBA 3QHNA 1FP8A 4TOQA 1E71M 4XV0A 1W3KA 2VZSA 1NOUA 1H1NA 3AHVA 1WKYA 4AZ6A 1EDQA 1Q6EA 1HKJA 5C70A 3AIUA 3WFZA 2EJ1A 2XN1A 2X2IA 3AJ7A 2CYGA 4D1JA 2UY3A 3SCRA 4E8DA 1JD9A 2BY3A 3MANA 2F1BA 2AAAA 4HTYA 1QI0A 1MW3A 2WM0A 3SUTA 4MJ4A 3TONA 3ZR6A 2WXDM 4DWSD 3ZQ9A 3BVUA 4ZENA 4M1RA 4KGJA 2F8QA 5E9AA 4RE4A 3VIMA 4W8LA 8A3HA 2XGIA 3TA9A 1EQCA 1I1XA 3ZJ8A 4IPLA 3A22A 3VSVA 1VENA 3BC9A 3AQUA 2JFEX 3RM9A 1B31A 1DTUA 1R85A 4OKDA 4ZXOA 4JFUA 4FK9A 3WSUA 1OGSA 4FNSA 3AMLA 1V6UA 5JIWA 2VI0A 2XVKA 4P7OA 3SCSA 3WBEA 3WBAA 2V3GA 4W8AA 4U5IA 1L0PA 3A24A 1BYBA 1ISZA 3BAWA 4JFTA 1TA3B 4RE3A 2D23A 2YDQA 4PCSA 4AZHA 1BAGA 1WDRA 1LQ0A 1CPUA 4B3LA 2E3ZA 2WVVB 3CBWA 2DGAA 2FH8A 2OSYA 1GHSA 1LL6A 2YLAA 4BS0A 3EDJA 4PSPA 4CKQA 5BYWA 3UG3A 2Z1SA 1PX8A 1JDAA 3I3BA 2J7DA 1KWKA 3T2QA 2WMKA 3W24A 5A6SA 2BHUA 4LYPA 2UY2A 4CD8A 4NZFA 1G94A 1GCYA 4J28A 3VU2A 1UR0A 3AMGA 3WDJA 3AYRA 3CUHA 3QHMA 2ZUMA 2JEPA 2PI6A 1HJUA 1V02A 2J8FA 1HJSA 1NP2A 3ZSSA 1ZS2A 4W7UA 1PEZA 3WY2A 1CXKA 5A8PA 2F61A 3CHFA 2FYVA 5GNZA 3W29A 1ZBVA 3OG2A 5BROA 3ZOAA 4R5EA 1XRVA 4A3YA 1UOKA 1FH7A 2ZUWA 3WY1A 3VIIA 4PMOA 4W5UA 3KL0A 2IXVA 1E15A 3K46A 4AYSA 3BUDA 1IV8A 3CO4A 3VX0A 1HJQA 3D4ZA 2UY5A 5I6SA 3EMCA 4E2OA 3GTNA 3LPOA 2WSPA 1HXJA 2YIHA 4S3KA 3WEMA 3CUFA 1HP5A 4M56A 1WDQA 2ZX8A 1QHPA 1BGAA 3BUQA 4CUCA 3VIPA 4A3HA 2ALWA 5JIPA 3WNNA 4JCLA 3ZT7A 2WZHA 4Q7NA 3VGEA 4P8WA 3VIFA 5CG0A 4DO5A 1QBBA 1Q6GA 4DUXA 4LYRA 3AXIA 1HIZA 4KWUA 1E9LA 2OW6A 4PBGA 1CYGA 2XJ7A 2CITA 5CPSA 5BWFA 5ABEA 5EBAA 1C7TA 1UZ1A 1EDGA 2VR5A 3UG4A 1M53A 1R86A 2Y2WA 1RP8A 4FNPA 4IPNB 4MPKA 2CKRA 1VJSA 3DX3A 2WMIA 4F8XA 1J9YA 1XCWA 2WBKA 2W92A 2VTFA 4LX4A 3DYMA 3ZJKA 1QX1A 2VJXA 3CUIA 2WWCA 1OD8A 5CZKA 5AYIA 3EJUA 1ZU8A 1UWTA 4OIFA 2VT0A 4U3CA 4AZIA 4ACYA 3D52A 5FIPA 3AHYA 2VVNA 1KBKA 2VNCA 1C8YA 1AQMA 3GBDA 4HOZA 2FHBA 1CZ1A 1ODUA 2J8GA 1BG4A 4W7VA 3LRMA 4CGTA 3APGA 1W3HA 1JNEA 2ZIDA 3UESA 2Z1KA 1TE1A 1PBGA 5A6KA 3SCPA 1MW0A 1KR0A 1R75A 4PYSA 5CPTA 1E43A 1GJUA 5JUVA 4M81A 3WDIA 3RCNA 5CJ5A 1WE5A 3HZ3A 1PIGA 3LXAA 3AIWA 3DX1A 2XWDA 5HPOA 2O92A 3JUGA 5I5RA 3VDAA 1J12A 1EQPA 1JXKA 1E6XM 1US3A 2BV9A 2QF8A 3VIGA 3CZEA 1DWJM 4Z2IA 5BXSA 3M07A 3BUIA 2YL6A 5ABFA 3UR8A 4OBSA 4UNIA 2PBOA 2D0GA 4A4AA 1D2KA 1TG7A 1OSEA 1W1YA 2YL8A 4P7NA 3SCQA 4TVDA 1CTNA 1H5VA 4EK7A 3F4VA 1LF1A 3IGUA 1CXLA 1OINA 4ZEPA 3GXFA 2IUZA 4WSKA 3WMCA 3W25A 1GQLA 5D9MA 4QLJA 4FF5A 2V3FA 1JI2A 3FAXA 1JZ5A 3B9EA 4U3AA 1NWUA 2E9LA 3VD5A 1BVZA 4BF7A 1PIFA 3LRKA 1GVIA 2OLHA 1GOMA 1UR8A 3TTSA 4W88A 1C93A 2EPMX 4HMEA 2ESCA 5EFFA 2J25A 3GH7A 4AZBA 4JZ5A 1FHDA 2F7QA 2WB5A 4X0NA 4L4OA 1DWHM 1G5AA 3DHUA 1ITCA 1TFVA 2XUCA 3LPPA 4WF7A 1ISVA 2V38A 3AIBA 3CZJA 4J7RA 1VIWA 2XGBA 4AZ7A 2YKKA 4DUWA 3T0DA 1V08A 2DQXA 5A6JA 1FH8A 3ECQA 2QPSA 2ZUNA 3N04A 1W1PA 4QAWA 2WMJA 2EABA 2IGTA 3CLWA 4M29A 1WZAA 1W32A 4HZ7A 5A6MA 3WL1A 4P8XA 1XD1A 2NSXA 2A3EA 3DECA 2NT0A 1J01A 2AMGA 1PZ3A 1XYFA 2CIPA 1CGWA 3MUY1 4D1IA 3PZ9A 3G6MA 4MJ2A 2OSWA 3W0KA 5DF0A 2CBVA 3MSDA 4U2YA 2DSVA 2E40A 4DM1A 1E1EA 3VIKA 1JD7A 4W93A 2EAEA 1NOFA 3L4VA 3DX2A 2JE8A 2BY2A 1Q4NX 2O9PA 1JG9A 6TAAA 4PUEA 3M7SA 1EXPA 1UKQA 1KTBA 3GNRA 2GFTA 3MO4A 5D9NA 1U33A 1E6ZA 5A3HA 3POHA 1HXKA 3RM8A 3SURA 4DUVA 3II1A 3PZNA 1MQQA 3POCA 3SUVA 2VRJA 2ZXDA 4TX8A 2EPKX 4JKKA 1JYNA 3WH8A 4ACZA 1KB3A 3CZLA 3FN9A 3CV5A 1VBRA 1GORA 5A6LA 4D6CA 5F7UA 1KGUA 3GBEA 4CU6A 3L4ZA 4XZBA 1E4MM 3T2PA 3ALFA 3NSMA 4UOZA 2E8ZA 4RL3A 2RGMA 5C8BB 5GNYA 1FH9A 4TVUA 3ALGA 2VZUA 3SUUA 1VFFA 1VBUA 5KEZA 3FHQA 3NJ3A 5FL0A 1V6VA 1WAWA 2J7GA 1IZJA 4AD3A 2YA2A 2WHKA 7CGTA 1NWRA 3SIMA 3WIJA 1QW9A 3LX9A 1OCQA 3LXCA 2OWCA 3WKZA 4UFHA 1AQHA 1ECEA 1E3XA 1SR0A 4OGZA 1OWQA 3WNPA 3ARVA 3RJXA 4HA4A 1XSIA 2Y4SA 2CXGA 5AY7A 1E0XA 3WELA 1CGXA 3NDYA 3ARXA 2XVGA 3CHCA 1V3MA 3BVVA 3MKKA 2YOCA 6A3HA 3TTYA 3BLPX 1U30A 5IHSA 3VNZA 3OGRA 4CD7A 1JZ2A 4DM2A 1JF6A 1HWWA 5LA1A 3LMYA 4B9YA 3VDBA 4X9YA 2OSXA 5E6YA 1FA2A 3W28A 1C8XA 2G8ZA 1OT1A 3UR7A 3QOMA 1V0LA 3SCNA 4AY1A 4AWEA 3N13A 2F7RA 1KQZA 2UWFA 1W2VA 1BVNP 1O7AA 1C91A 4P7RA 4BQ4A 5D4YA 3H53A 1G0CA 2WHJA 4D72A 1V0MA 1VEOA 3WQ8A 2G4FA 9CGTA 3WD4A 4AD0A 4MADA 1H11A 1XSKA 5FKYA 1UYQA 3VTRA 1VEPA 3K8KA 1B1YA 4URIA 1DP0A 1MWOA 3BMWA 1BSIA 2EO7A 5HBFA 4M24A 2BXYA 3DDFA 4PEEA 3ARYA 3GM8A 1HF6A 1E72M 1XC6A 3WL0A 3OLIA 4QDMA 1KGXA 2OYKA 2RGLA 3H54A 1BYCA 1E56A 2D0FA 3A6OA 4LQ1A 1BGGA 2GDVA 3PZMA 3PZIA 4P8UA 4FNTA 2ZX9A 4AMXA 5HDRA 3KL3A 1BFNA 1WNOA 1UR4A 4UOJA 1XH1A 4EANA 4R27A 3SCOA 2ZXBA 1A3HA 1WDPA 3F5KA 3VKKA 4ZFMA 1JYXA 2CNCA 2YFNA 3W27A 1C92A 3PZQA 1HJXA 4AIUA 2J7EA 5M5DA 1M03A 4PTMA 3GH5A 4MNKA 2Y8VA 5ABFB 3FW6A 3AS3A 4MDOA 4AZCA 2J7FA 2J47A 2J74A 3SEPA 4YPJA 1UKSA 3VPLA 3BVTA 5IXEA 2OWXA 1LG1A 1ISWA 4UFIA 1CLVA 4MAZA 3VD3A 3HMCA 3EJRA 2VQTA 3AXXA 4D6IA 3AXHA 1TVNA 3WQ6A 2D3LA 3WD0A 4U2ZA 3ARRA 1JYWA 4AXNA 2XYLA 3RM4A 4CCDA 1QI3A 1Q6CA 4QCFA 1TQSA 3L4TA 3FY1A 3T2OA 4PRWA 1CXIA 3MV01 4GPNA 3W81A 5A8QA 1OD0A 3B9DA 4CCEA 3WH6A 3CGTA 3PZTA 4FLSA 3SCTA 3AZTA 4PMNA 2DSWA 3IAQA 1V3LA 2DEPA 3AZRA 4QLKA 4PTXA 1GOOA 1EHAA 3WD2A 4JAWA 1R7OA 1ZB5A 2YLLA 4CVWA 3A4WA 1IT0A 3DX0A 4Z2GA 1UWSA 4P8VA 4MB3A 3MSGA 2A3AA 2DT1A 3EDKA 2EEXA 4UQCA 1PX4A 2ZUUA 1QPKA 4NI3A 3VM7A 1PAMA 2WMFA 3BCDA 3NCOA 4NZCA 1UR9A 1EDTA 3WUEA 3SUSA 5A95A 1OGGA 3AMDA 2VRQA 2OWWA 5A6BD 2UY4A 1CGTA 3CPUA 2GJPA 4OUEA 1H41A 4UOQA 4E4PA 4XZWA 3BAIA 2F2HA 4W8BA 3MU7A 4AZ5A 1A47A 3WNKA 2W61A 2ZUSA 1CGUA 2O9RA 4HP5A 2XIIA 3WF1A 4JL1A 1H3GA 4CU7A 1QI5A 2Y8KA 5M03A 1E0VA 4H8HA 4F66A 4QLLA 1BPLB 1H49A 3CZSA 1TQVA 2F1AA 1V03A 1X6NA 2HVMA 3BSHA 2VCAA 1JXJA 4EAMA 4Z2LA 3IK2A 1SZNA 3BLBA 3WD1A 3HJEA 1GONA 4PTWA 3VILA 4H41A 1LL7A 3DDGA 2J7CA 4HU0A 1F4HA 2PWEA 5I78A 1PZ2A 1UKTA 1H09A 4M82A 4AYGA 3TOPA 1UUQA 3N18A 3SCWA 3VGFA 3A21A 4ACZB 3O2LA 5CSUA 4GI8A 3WMSA 2WC7A 1M04A 1CXFA 3WUFA 3S5ZA 4MAVA 1FOBA 1ZJAA 1UASA 3FXYA 3PTMA 5GNXA 1V6WA 3PZOA 1L8NA 1R33A 1B3VA 1V0NA 7TAAA 4ATLA 2VZVA 1W9UA 3VD4A 1EO5A 1OM0A 3F5LA 2G3NA 1NWTA 4OOZA 1GUVA 5FD0A 3VGHA 2VX4A 2XFYA 3BMVA 4TVCA 1DWIM 3AS1A 4AMWA 1K9TA 2VUYA 1CNVA 1WPCA 4WSJA 2QMJA 3AI0A 2O9TA 3WFLA 2DT0A 2ZWYA 4GIAA 3ZJ7A 4TTGA 2D20A
chains in the Genus database with same CATH superfamily
4HGWA 1I75A 1UENA 3RNQA 3P3YA 5B7EA 2P4AB 2RQEA 3TFBA 1U3NA 2HFFA 1AJZA 3MRNB 4F1ZA 4Q6KA 1G1YA 3CSTA 2WUBH 1XGPA 2VERN 1O5QA 5D32A 1OW0C 3JV4B 2GW5A 4YZFE 5F4WA 5B39A 2Y06H 3MOAL 3VX1A 3WTUA 3UETA 2CZ5A 1PZUB 3HUJA 2MEJB 2P8LA 2PC8A 5L8LB 4HAGA 2B1AH 3ZRSA 3FQRB 3BLFA 1GHRA 1NARA 3IEAA 1JAEA 5LWYL 1I1CA 3E5BA 4HOWA 1SRDA 1KPRB 3SE3C 1TQCC 3CU7A 4UTUA 3TSBA 2LU3A 4QITA 3MLSL 5KYWB 4AIXA 4OUUB 4Z3IA 3CXHK 1LQAA 4S3DA 4OHQA 2WIIA 2FZ8A 4B9ZA 1OTSC 2DZWA 3KOWA 4AGLA 5BCAA 1KN2H 2NRDA 1UG6A 4XNUL 4GMEA 3AHXA 5FDWA 5BJTA 4EXPX 2DSKA 2VLRE 4JFQB 2NPLX 3IETA 1W3NA 1I1AB 1KC5L 3R6IA 1AY1H 5F1IA 4ZMAT 1KJ3H 1AA1B 1W31A 2DQFA 4IQHA 3VXSA 2X2UA 2Z9TA 1US0A 3VFMB 3CXDL 1MCQA 5I1JL 4NL1A 5IB4A 3H9ZA 2VDKH 4K7VA 2GQ3A 1BBDH 4Q0XH 4P23B 2X2YA 2W91A 4TUOB 2WHVA 5D1XA 2Z28A 1KGCE 4JEGB 1NFIB 1OCNA 2B1HL 3FPXA 3WH7A 4ZMTA 3W76A 4K55A 5AG8A 5GGQH 1PZSA 3MGTA 1DZ0A 4XAWH 5C7XL 4GRLB 3MV9E 1XGTA 3BI9X 2XACC 3ZVIA 3LKPA 1TPXC 1UWIA 2Z1BA 1H8LA 3MOBH 4B5TA 1FFNA 2JBMA 3KXFE 1OZMA 3P69A 2Y63A 4JHOA 1IKOP 4G1KA 43CAA 4I13B 4P5MA 1GSMA 1IT9L 1OGAE 3CDZA 1QWNA 4NIYE 3Q8EA 1KRCC 4LPTA 3M6DA 1GQJA 3ALWA 4X9BA 3TYEA 4KAQL 3AS0A 4JG5A 2BOLA 4FP8L 4FI7A 2JSFA 1Q0XL 3H42L 2BS71 3GSOB 1RHCA 3P40A 2CCRA 2E7MA 5BXTA 4XGZA 5AYYA 1EJ7L 4PMFA 1GOQA 4H9XA 1ONQB 1U93A 4N9GA 4MB4A 3HKZA 4J40A 4GQQA 3CZGA 5AL0A 1JVNA 1D6EB 2NDFA 4C6LA 2X89D 4ONHA 2NW0A 3KAAA 1O66A 4X6EB 4XISA 4H0HB 3DBPA 1K3UA 1E3FA 4F7EB 4XCFL 2C9UA 5LA2A 1XIGA 4UQ3A 3D34A 4KX8A 5E6RB 4GYJA 5B1JC 4JG0L 3SKOA 4FA8A 5HYSB 3NSDA 2B20A 4M6NH 1HINH 3D08A 3KW7A 1PWMA 1VB9A 2OLAA 1E5JA 5CD5D 2XWBB 1JK8B 2IKIA 3QW9A 3DROA 4OZHB 4XMPL 1T22B 4HK6A 4CW1A 1FKXA 2X12A 1A6TB 5GVJA 1KB5A 5IW1B 2HVOA 3K7UA 4GUHA 2AQRA 3LS5H 2OVLA 4U49A 1N3NB 3LZNA 1UH3A 4MUPA 4R33A 4RCAA 1G43A 3AROA 3CEUA 3TW7A 3PZVA 3S9DB 2J2ZA 2JB5H 3GNXA 3RI5K 4Z7NF 1XYZA 1QZ1A 4X4ZA 2HT4C 4Y5YB 3D85B 1K77A 3E2SA 5F3BB 4C6CA 2Z2UA 4W9TA 1UZ4A 3TJLA 4PEKA 2WLZA 1C3FA 3I3EA 4ICCX 1KM6A 3B2VH 4CD4A 3KLAB 4LCRA 3VWJC 2ZZ3A 1T6MA 3U7AA 1AMXA 4R4BA 1H6EA 5GXBB 3ARTA 3A9IA 1XEUA 4IICA 1LOLA 5J6HA 3VXNB 2PD9A 3OHXB 3GXMA 1EGMA 1GYUA 1H6UA 2CE6A 4GIEA 2E28A 2CLFA 3TN0D 2WMPA 2BSRA 1V7NH 5AW4B 3NZGA 3S7GA 4XUYA 4HLZG 2FYMA 1YPFA 3RB7A 4XC3L 4K37A 1X1OA 3IJ9A 4WNQB 3QPQD 4DLFA 4JTGA 4IW4C 3NFSL 1QVOB 4JFZH 1KRMA 1HKKA 5CJOH 2D73A 2VR2A 4DVOA 1H8NA 4LF3A 2VQ1B 3K5XA 1YLBB 2PCPB 3MLWH 3C09B 3N42F 1E0WA 1NAKH 3JTSB 1NIBA 2B7OA 3AIVA 3GKWL 4TUKL 3V4VB 5A2AA 4UTWA 2OQJA 2KT6A 1UWUA 1O7DC 4ZMVA 2NX5A 3KBSA 4GZEA 4M6MH 4YWGL 2R69H 3P9WB 2QQKL 1GPWA 3FAWA 5KYXB 4GXVH 1MSSA 4DTGH 4O1AA 5EO1B 1B3JA 1R9ZA 1US2A 1HAUA 3QHZL 1RXOB 1TREA 3KEDA 3WZ0E 3T40A 1HL9A 5D7IF 3CB3A 2WN3A 2JQMA 1CDGA 4ANVA 5A8MA 5DHVA 1F1AA 4LKXB 2YPLB 1MF2H 3I10A 3GGWB 3U5UA 3X2QB 4NBXB 3EUUA 1HIML 1WAUA 3GTHA 4GKZB 1CDHA 1JUEA 3R8HA 1ZT4A 4LEOB 1CQYA 2Z4GA 2Y7MA 4HETA 4JY4A 2VLLB 2OJPA 2RGSA 3HHRB 1NELA 2ZXQA 3LNHA 1HW6A 5IFAH 3E1F1 1GT8A 5AOJA 3L1GA 1TIUA 1TLMA 2Y1YA 5TK2A 3SQLA 3CAVA 1DL3A 2DQUH 4TYUA 2W9DH 1FNGB 2FWSA 1LEGA 3QDMD 3TT1L 4PRRA 2C4XA 5SWZD 2D22A 5IW3A 1J88A 2E25A 4KRZA 3BD5A 3MODH 3N1AA 4XPFH 4H6KA 4GACA 2VUKA 4YEFA 4HWUA 4X7SH 2K4WA 3VH8G 2H26A 4NRYB 2MOVA 1WD9A 1H5BC 2DY2A 1W56A 3SY6A 1WKFA 3TYBA 3CVIL 1JMXA 5I79A 5E09A 1UM6L 1XF0A 2DJXA 3CUGA 2RDXA 4OSUL 3RL1A 3C6LD 1H7NA 2DQEH 3QQ9C 3R0DA 3KPSA 1OX4B 4UTBA 4O1FA 2GJJA 5T1DH 1ZIBA 4XPAH 1B5TA 1UA7A 3QQ1A 2ZX6A 2FT6A 1YECH 4ZSOB 4XVDA 5GRVL 1MQKH 4JANB 3WTXA 5H35A 3FH7A 1F4XH 1OT2A 1RZIA 1PD1A 5KSUB 1SHXA 4NKQB 3L5WA 3P14A 3VCNA 3DX4A 4LLVA 3O4LD 4LOFA 2YQGA 1VAHA 3H22A 4UTCA 3WF2A 3UYOD 5TE4H 1JNDA 4ORIA 2FWUA 4C6NA 2E7DA 4S0SD 1FZMB 2OCCB 4X7FC 3BH4A 2ZOKB 2FJFB 3GNPA 3U6WA 2PLKA 1NC4B 1I0DA 1GOXA 4RXFA 3KHQA 4ZAKB 2GHZA 3NXFA 5K9JL 3VFVB 4KHXL 1MUJA 4M61A 5AW8B 2GVLA 2E59A 5KZ6A 2WZTA 5CHNA 4UM8A 3SO3C 1MHPH 4V1YA 1MSPA 3NURA 1KLYA 1YG9A 4KFMA 1V7MH 4GKSA 2EYSA 4G71B 1KM4A 3W7LA 3RP1A 2ZP8A 2AXJA 3B1TA 2AVFA 2XVLA 3L2MA 2V2TB 4C56D 4R7WA 1VJZA 1W3IA 3MZNA 1PQZA 1RBOB 2BGNE 4FYTA 3MFGB 2JF7A 5IIEA 5LQBL 1ZRQA 2MNRA 2D0HA 3N9GH 4ZCWA 2WZIA 1GPOH 4E38A 3N40F 1LRTA 1QRNE 3ZT6A 1N5YL 1NOWA 5BS0D 3A5FA 1XF2A 4MKVA 1OVZA 4Z7NB 2VZOA 1CE1H 1H3TA 4N26A 3OMAB 1WDDA 4JPGA 4HCRA 1MCDA 1FCVA 1YQVH 1DWFM 4MQSB 1T03L 1TTUA 1IGJB 2QKFA 1KCBA 1R6VA 2D7TH 3WHXA 4PB0H 1MAKA 5FPIA 2PWVA 2MCPL 1G9EA 1ZEAL 2VDNB 2HCVA 1F4YH 1G7LB 3QUKB 4E9XA 2B9AA 4XV0A 2QEJA 2CDFA 3HFML 5IG7B 4YO0A 4XPGH 4MNGA 4APXB 1P48A 3G08A 2XUWA 4GX8A 2BNRA 3GMNB 3MANA 3QPYA 4PP1C 2CJSA 1HU8A 4M5ZH 3BGMB 3HZVA 4MNQA 3BVUA 1NCNA 2VXQA 4QRPD 3H3BC 5HDBB 3O3DA 3A22A 4WKZB 4FHJA 1JRHL 5F9OL 4B0MB 1FO0B 4DOHB 4J4PD 1HHIA 4GYBA 3HR6A 4EOUA 3HAEB 1J5IA 2IF7A 3EKCA 3NM1A 1PZAA 3A24A 1Q85A 3N42B 3EOAB 1UM4L 5EUKA 5LAXA 1BZ9A 1P0DA 4B6ZA 3HRZC 1VDGA 1CPUA 3SDCC 4PJHA 4DP5X 5AB1A 5BW7C 4MYPA 4GKOA 1TU2B 1HJCA 2H9AA 4OF0A 2X2GA 2EDOA 5AB3A 4M7LH 4NQDA 2R1LA 4DESA 3US0A 4G8GA 3A3YB 4A7TA 1V02A 2ADGB 3R1GH 4ZMGA 1VGKB 3T77B 3FO9A 5EC2A 3SJNA 3DXIA 4ZXBA 3EOTL 4MA1C 3GUWA 4AIBA 1ONXA 4MXWL 3A6BL 3D2UA 1ILSA 3STGA 3DZ1A 3CXFA 1JUFB 4FXKA 3VRJA 3JW7A 2Z8RA 3KL0A 3B8IA 1NMBH 3BUDA 3JWOC 3VX0A 2MHAB 3P0VH 2UY5A 3IJEB 3UO1L 4TULL 3HGSA 4FQIL 1OF0A 3V0IA 2QPEB 4DP9X 3KS5A 2H1PL 3W0WA 2XXMB 2O0TA 2X70B 3ZT7A 3VXQB 1SOSA 3P77A 3DFHA 2GT9A 5I74B 1U41A 4IJTA 2KZ1B 3HGOA 4S0HA 1UBPC 1HIZA 1RHHB 2ZSVA 3UG4A 4YVPA 3DX3A 3HF3A 1G4RA 3H70A 4A6YA 3F2DA 3M4HA 4YL4A 5AYIA 3EJUA 1QQDA 3THMH 3UCCA 1RJRA 5BV7B 2X16A 1CICC 3O2WH 2NWRA 3DGGA 3XINA 2VXSL 3DAQA 4CRPA 3BJSA 5ID0A 2BSEA 3WLJA 1Z5LA 2FX7L 2XIJA 1GVSA 4KRNA 5C09E 2BWGA 1F3DH 4Z0JA 1PIGA 4LNVA 5LG6A 1J6OA 4B50A 5FHBH 2IMMA 3LK6A 3VOJA 3VDAA 4BV1A 3DFTA 2K1MA 4FAAB 4Z2IA 3C8KB 4FC3E 4RBPH 5BPPA 4OBSA 1J5CA 4KIRA 4R7OA 4P49A 3RX2A 3EWBX 3N29A 1Q1JL 3T0WA 3HPFA 4WD0A 3L5XL 3P2BA 4HBKA 5E1IA 1UGNA 4F8NA 5H2BA 3OPZH 1RJYB 3MAWA 3ZJAA 2B77A 2W0FA 4ABWA 5SWSA 3TO4A 4I5BB 4X5XA 3LQZA 4Q7BA 1HESA 1RU9H 2ALDA 4AWTA 4PRHE 3FFDA 4DUWA 1WBYA 3ZDYE 2A9ML 4F8TA 1KG0B 3JV6B 5F6IB 4DPQA 1DN2A 3MROA 4Y4HA 4HZ7A 4JEJA 4RISH 2CIPA 4KV5F 2HFTA 3AG4B 4D1IA 3STEA 1MFDH 5EUOA 2CBVA 3ARDD 1HFUA 4IDJL 1M57B 4WRLA 3CLFL 1JD7A 1SM3L 5AOLA 3ISWA 2WWMC 4DPCX 2O4EA 4YJZL 2N7SA 1HL2A 1OAZL 4ODWB 4Y19D 5AENA 4JPVL 1T66D 2FD6H 1BAFH 1NPUA 1N70A 1YMHB 1OSYA 3P9MB 1GGCH 4OJFL 4P2YA 2A1WH 3MO1A 3RI5F 2ON3A 1G7IA 3PUCA 3K2MC 3NPSB 1V05A 2CLOA 2E8ZA 5GSVB 4RL3A 5C8BB 2P46B 3BPNC 1VFFA 1EIXA 4WI9A 5J1AB 2V9DA 4C91A 1EAPA 1IAII 3MBDA 4OCWL 2YA2A 1JPGB 4YDKH 2ZBTA 5DQJB 1LT7A 2Y72A 4GYFA 3QNZB 2Y4SA 4GY1A 2VMJA 1OKEA 5HDLA 3CQQA 4NWTH 3S5SA 5D70L 3C2OA 3ZXWA 3QC6X 2NLJB 3KXQA 3GR8A 3EYFB 1R3IL 3SCNA 2MCMA 2XXCB 3TVMC 3X12B 1TOXA 3QEZA 5FR3A 5LNGA 3NGJA 1X5XA 3HE7C 1XSKA 4L8SC 4G8EB 2IWEA 3PSVA 3K8KA 1KN4L 3RRQA 1CURA 3GIVA 4RZBA 4P46D 4XN8A 4IIQB 5CEZE 2DQIL 1CR9L 4JQ1A 4NNCA 5E8EB 4B5EA 3AJXA 2RGLA 3IFPA 1BGGA 3TEZA 4EPEC 4FNTA 2I07B 2R14A 3K2UL 1R17A 2JGYA 3VKBA 5I6OA 5IHWA 4ADUA 2DLGA 1YO4A 1I1YA 2ZWNA 4LAQH 4WY0F 5JQ6H 4OF6A 1YYML 1HJXA 4PJEF 3ULSB 4R0LB 3IRPX 1PLAA 5E8OB 2AZUA 4OGYH 2C71A 3M0LA 1XIWD 2OR8A 3VPLA 4OQTL 3IRSA 4RGMC 3L21A 3D9AL 3KYMA 1ISWA 4Q8VA 4GG8A 3Q6GH 5EZPA 5KZDA 4JVUA 1RALA 1ZWIB 5EDXA 2EH7H 1V27A 4D2JA 4GPNA 3OB0K 1DLHA 2Y7OA 1NDGA 2O61B 1FP5A 1S9WA 1UP0A 3CGTA 1UTDA 4HKBB 3ULVH 1RIVL 2OMZB 4YU1A 2GK0B 4IBYA 3WD2A 1QPNA 5T5NG 4R34A 4JR9L 2PE4A 4ZO7A 1ZK9A 3L0NA 1GGYA 4XP9H 5KAQF 4F7CB 3MRHA 3IFNH 3HUJF 4GW5A 2WO4A 2I26N 5FYJE 4RRPM 5E5RB 5HJLA 3TT3L 4KRLB 1P6CA 1TFPA 3SJVB 4EIBA 2ZOKA 3UMNA 2GJPA 3LSCA 2B3IA 4YLQT 5EU3A 4GPVA 5MERB 4O9HL 1FX6A 3F6JA 1YEDA 4U4MA 2DVTA 4PB9H 1X6NA 1JXJA 4XO6A 3KPNA 2JLLA 3HURA 3ARFC 2QCCA 3ZE0B 1LO5B 5I78A 4PC8A 3FDWA 4NM8L 4R97C 2ISVA 3N18A 3T6XA 1FLTX 1VGEH 4ENZA 4OI8A 3MGAA 4P2OC 2EVFA 3MDUA 3MR9A 3RJQB 3WGVB 2DI8A 2EKSB 2X6AA 3VYPA 4RNIA 4F2BA 4QLWA 3W2DH 3KHOA 2DQGH 2JK2A 3VD4A 3P84A 1CFQA 3WBXA 4JREB 4QTHB 4A66A 1GUVA 1HZLA 3W56A 2ALRA 4KNQA 2AFNA 5C08E 5ISZB 1YPIA 3RX9A 2O9TA 1EANA 2NV1A 4HK3N 5FJIA 5B7FA 3M41A 3IGAB 1KY7A 2IAMD 3CZFB 3MSPA 4AQEA 2J72A 4RNFA 3LMJL 3GYEA 4NO3A 2NNCA 3AITA 3CMGA 5IUSA 5FAGA 4N4YB 4LL9A 5ECUA 5B3JF 3VIOA 4AC1X 4GRWH 3IEBA 4N2GA 4KERA 1CK0L 4W81A 5CEYA 2QDWA 4ZFCA 5D7JA 2ZAHA 2Z7ZA 4M1DL 2ISWA 1BBJA 3PAYA 5FEPA 3BV4A 1F58L 4PMYA 1FNSL 3U7BA 3AUWB 1R2TA 4CMMA 1A4CA 4IKIA 2B59A 4HIEB 3ZIZA 3SN0A 1NANI 3TN0A 2H32H 1R5VB 3RN6A 4I7VA 4A7GA 4F9PA 4WHTB 4JTQA 4FJ6A 3GXPA 3KCPB 4HWEH 5CCZA 2N01B 2BHZA 4AVIA 2ZZ7A 5FJTA 1PCXA 5DI8A 2BM3A 5E0FA 4X80H 3T6ZA 1P1ZA 3WE6B 1KFGA 3DOSB 4F20A 2VQUA 2FZBA 3WF3A 1ORQA 1BIHA 1IYXA 4NP9A 2DEXX 3H3KA 4IPIA 1EOMA 2BK8A 2YDSA 4TMBA 1X98A 4NJIA 5CGTA 1IM3B 4JTCA 1VZHA 4Q4KA 1O7DE 1SXBA 1ZLWH 5LNVA 4H20L 2F15A 3SKUD 3C5XA 3QIWA 2ADFL 4NN7C 1MJ8H 4JCWA 4JLRA 1BQHB 3RIAK 5I0XA 4D6EA 2QR0A 5A2FA 2E27L 2X1IA 4DVBB 1I0BA 2BNUB 1CFVH 5IEHB 2CIIA 3O0RL 1A6WH 4FF9A 1F3JB 3LD8C 1CDBA 3QHOA 2ENQA 3R12A 1CFNB 3KPQB 1UROA 4J3OD 2LLGA 3C08H 3T6CA 4PG2C 5JORA 4XKYB 3DURA 1ECZA 3V8CA 4FX6M 4KROC 5J11C 4NUGL 3F7PC 1LWJA 1WRFA 2DH3A 2VXNA 4NQED 5D96B 2JF1A 3TYGL 3SKMA 4Z7VE 2BZ7A 5AW0B 2C1IA 3VH8B 1MNSA 2VR6A 4KJPD 4H2HA 4LVHC 2MWCA 1ELSA 4IBZA 3CT7A 2C1OA 3LN5A 3TR9A 1IQWH 3QDMA 2OL3A 3CMOL 3VA2C 1NGQH 1A9EB 1EXBA 2HT2C 2YXXA 2X1RA 4L2LA 4PY8I 3V4PH 1GJPA 4AYEC 3P11H 1QRQA 4JX5A 1ND0B 5HJDA 3WK0A 3OO2A 3FRUA 4WQ6A 1AZUA 2XISA 3WEOA 2QZRA 3UWQA 5C0GA 2PBGA 1T4KB 1HQRA 2BOFX 2EXOA 3LQAC 1EHNA 2WXPA 2EIKB 3T6QC 3N34A 5HVGB 4DEWA 5I3KA 4HGWB 1E2ZA 2Y6SD 3G6LA 3C6LA 3AQYA 1FFRA 1IXOA 3OA3A 3EYQC 2HFFB 3LD5A 2PDCA 4HU3A 2CR3A 5DT7A 1XGPB 1PYWA 5AAMA 4WOQA 1E9IA 1QNSA 4XP6H 4P48A 3VMOA 4QXGL 2C4FU 3QUGA 5B39B 3WTVA 4LPWA 2NY6D 3EDEA 1RIHL 2FJGA 3KNBA 2P8LB 3HQ1A 1UJTA 3ZGHA 1POKA 2Z8WC 2VHLA 4HZ1A 1KFKA 2FO8A 3FUJA 5E5LA 1Q66A 1X6LA 1FGNH 5KVEE 4KK5C 3VGAB 1SOQA 4BFBD 4HU4A 2YBGA 4W87A 3WKYA 3QY6A 3KVQA 3QORC 5IP4A 3ULUF 1X8CA 2WIIB 2NY2B 1XUZA 4XMZA 4QUOA 4J9JA 3DLQR 4Z7UE 3IMVA 2NZ1A 4P59H 4JK0D 2JGQA 5FDWB 4XAKD 3WNMA 5BJTB 1EC7A 3BWZA 3MRIA 2VC9A 4JQIL 3IETB 5I30H 5F1IB 2Q7AA 4CAGA 2DQFB 3VXSB 1BZDA 3QUMA 1PTGA 5M17A 3WLWD 3DHDA 2APSA 4NAJA 4ODWA 2OBGA 2G0WA 3GZ3A 4BZ1L 3FA3A 1IJNA 1UUOA 1GS6X 2FGZA 5IB4B 4Z8FL 2PDPA 4G8FA 2BFVH 1U2HA 4C56A 4ILDA 4GSXA 5D1XB 3M0HA 2H2SD 1A7PL 1E50A 3H7BA 1SJBA 2RALA 3LH2L 4RMWA 3MGTB 5CH9A 3HS8A 3T2NH 1XGTB 3PTDA 1KCRL 2FDMA 1HOEA 3LKPB 3VXRD 1RAMA 3FTVA 1FFNB 3M88A 3MUJA 3ZE2E 1TJGL 1NFDF 1QFWM 2YXFA 3LV5A 43CAB 4P5MB 1GIGH 3CDZB 4IOTA 2PWHA 4IQDA 1YPZE 1TNNA 3THAA 2W62A 1LROA 3V6FA 2CESA 1PEWA 1HHKA 4M03A 1OIFA 1OARL 3QT2A 4G8AC 3FB6A 1PG7W 4JM0A 2XDHA 1REIA 1IIHA 4FTVA 1NIFA 4DN4L 4XGZB 4XWOC 4IQEA 2EACA 4PSRA 4APQA 1U93B 4N9GB 3IYLW 4QTIL 1CVRA 4H0IA 2P45B 2PODA 3TJHC 2EUWA 5I73B 3P0WA 4ONHB 2FFIA 1KBGH 3NGBB 4RIRA 1ZT7A 1QWUA 4XNXL 3QQXA 3APYA 1S5MA 4UQ3B 4OTXH 4J4PA 4ZMLA 4YTTA 4XN9A 3SKOB 3ZIMA 3EYSL 4NDMA 2IAND 3QJOA 4AG4L 2AQNA 2YCJA 4AQ8A 4IRJD 5TE6H 3DROB 2Y6TE 3FFOA 4LVNB 4U6HA 2Q8AL 4XBPA 3QAZC 3SY1A 3LPWA 2XWCA 1S7TA 1KB5B 3GBML 5EMUA 5I1EH 5HXMA 1I85C 2ZOXA 3LCGA 4FI8A 5FI8A 1EXHA 4QJ3B 4DZIA 4YLWA 5I1KL 1E9PB 4O14A 1JF5A 1KTLA 3IJYA 2NZ9D 2GHWB 4H7ZA 5BOEA 5GGRY 2J2ZB 8CGTA 1VFUA 3U9WA 1KCUL 2GBUA 3K4AA 3BISA 4MBOA 1YYCA 3SHSA 4HUMB 3MB9A 1XI3A 5BOJA 1HKIA 3N6QA 4L9XA 4BZYA 3T8VA 1BLIA 5DGRA 1YSOA 4DX3A 3ABRA 3MRCA 3NQGA 4R4BB 3SN4A 5EEXA 1FRGH 1CFTA 5J6HB 4XP1H 2A9NH 2EPOA 2WMPB 2VFEA 2BSRB 4GI4A 1NJJA 4YHOL 2R1MA 4KGLA 4PY7A 5EF2A 3WKMH 4LKCA 1EBPA 2J5LB 4AVOA 1YEHH 4XHQA 3VNLA 1I2OA 3R8QA 1OALA 1KDJA 1V5JA 1LD9B 4LF3B 4PTDA 3CX5K 4WRHA 2RDUA 3AM8C 4FMKA 4J8QA 3AISA 4PJHF 2QUVA 1RZFH 3SCUA 5JOEA 3RVVD 2K78A 2VMCA 2YD1A 1ZY9A 2NX5B 4JUTA 4JNXA 2ZWZA 4MXVF 3QFGA 5HYQA 1XH2A 3C3UA 5FJPA 3RU8L 1H7PA 4LRTA 3E3HA 3DARA 3IJ8A 1CBGA 1LM1A 4W86A 4Y9NA 2NQ9A 5FYKL 4Y5XA 1Q6LA 2MUCA 3W4RA 4WLCA 4UNVA 4S1QH 1M6UA 3FO2A 5M1TA 3FO1A 4NXKA 2D7OA 1UGKA 3FTGA 1M7XA 1ETA1 5LGXA 3Q65A 3RDTA 2FUQA 4JFDE 1G84A 5HQMA 5DHVB 1NM9A 3E8UL 4J1OA 4OY9A 2CJUH 4IMFA 3ABXA 3C5ZD 2ADAA 1U4EA 3QFJD 4HNLA 3SOTA 1HZHH 1KIRA 1ZT4B 2OO0A 4JFFB 4HJ0D 1HILA 3TROA 3GH4A 1R3KB 2WO2B 4UQAA 1OGBA 3QQNA 1W3KA 2VZSA 1VFBA 3NZ8A 1EFXA 3WFZA 4U6TA 1D5ZA 5KTEH 4RZKA 2R15A 1YXYA 2AAAA 1LEGB 2INEA 2GI0A 1NUFA 1T6VN 4YZWA 2Y7QA 3C6CA 5KYUA 4L9LA 4LU5L 3GZQA 1NGPL 3PDGA 4JPWH 1I9JL 3QZOA 2H26B 1E28A 5E24E 2JKWA 4P0DA 4B0MM 4Y19A 3H8NA 1BYBA 3OODA 3RGVC 5F70A 4AZHA 3RL1B 1WDRA 1M65A 4OZHF 2AK1H 1A6VL 1L6ZA 1UXWA 3BSZH 1LL6A 4HSCX 3KPSB 3OU8A 2A9BA 5J12C 5D8JL 4RH4A 2GQ9A 3L1OL 3TJEL 1OFBA 3HMWL 3USZA 4L8BA 1XGEA 2PLMA 1XCTA 3B4YA 3Q8FA 4DJED 4NQCE 5H35B 4RZ5A 1IO4C 3FCPA 3KPQA 1RZIB 1IEAA 3O6CA 4LUJA 5C0CD 1JN6A 3L5WB 3MOAH 1KYUA 4LLVB 4P2QD 1J96A 4HHWA 3ZYOA 4MSWA 4TL4A 1QLFA 2V9RA 2PNDA 2V0AA 5FLVA 2Z24A 3OKDA 1TVHA 2N1KA 2VC2B 1HJQA 5LWYH 3PYCA 3EMCA 4HN4A 3LPOA 1GKRA 3NJHA 5J7CC 3IMWA 4CUCA 4Y4FC 2NMSA 2Z65C 3MLSH 1XIEA 1FRBA 3BYYA 1PZCA 1IT7A 3B0PA 3QVAA 4AEIL 2CBTA 1MUJB 3HGJA 2A6DA 4M61B 2WBJA 1IC5H 4IHOA 1VCGA 5IM7A 4CL7A 5CHNB 4UM8B 1CYGA 3FU9A 3N50A 4XNUH 4E3VA 4GKSB 2EYSB 4QNWA 4ODTL 1KC5H 3PCYA 1WHOA 2XPYA 1PQZB 3HB3C 1B9BA 1GS7A 3CXDH 3RIAF 1TITA 5I1JH 1XBDA 5IIEB 2NZLA 2R1WA 5EU6D 4JFOA 2RA1A 5FFLA 2YYTA 3WTYA 3C0JA 2J8GA 2B1HH 4A2EA 4WFFD 4XHJD 1XF2B 3W85A 4AEHL 4ILSA 4AGQA 1IGIL 1HDMA 5CJ5A 3E49A 4YE4L 2H8ZA 3VKJA 2YL6A 3TXZA 3WHXB 4PVNA 2D9CA 1CDJA 4UANA 4PJGE 1TENA 1OINA 3Q58A 1UC4A 2P5WA 3W25A 3CN2A 4KKXA 4KAQH 2CDFB 4YO0B 3Q8BA 3UZJA 1I9IL 3QDHA 3MGOA 5TTRA 4U3AA 3WQCA 3BW4A 4MNGB 4H6QA 1Q0XH 4OCMC 1YTEA 3H42H 5DD1L 2W81C 3G08B 1GVIA 4JE4B 2BNRB 4LHQB 2ESCA 3WLIA 3HZVB 2A6IA 5EOCL 2WB5A 2GVEA 1LMIA 4MNQB 4X0NA 5A2KH 4KY2A 5FEBA 1J93A 1GOGA 3H7RA 1MOEA 4XVUD 5KTLA 4XX5A 3BUTA 3LPPA 3O3DB 2YZ8A 4D94A 1HHIB 3CHVA 4BJLA 3LOTA 4X8JA 4M29A 4XCFH 3NCBB 1GSKA 5EUKB 5LAXB 4PGDA 1WXZA 2PDJA 1BZ9B 1JZGA 4UTIA 1VGAA 3GSXA 2GY5A 4JG0H 1AH0A 3IU3A 4JRYE 4PJHB 2UUDK 1PO9A 4WTQA 2YSTA 4OW6A 4RX0A 3S42A 2B9BA 3DJTA 2H9AB 5C9WA 5IQ7L 1NGYA 1EXPA 3DUGA 4NQDB 3EPMA 2E68A 5REQA 4XMPH 4G8GB 4ATTA 1GTFA 1F3XA 1KY6A 4KVPA 4OZ4A 5IREA 3FO9B 4QG8A 2GVJA 1NLBL 5EC2B 4NLHA 3FQWA 4ZXBB 3O9WC 1K7XA 4F40A 1MAML 2DKMA 1TPWA 2A5HA 1ROCA 1KGUA 4L4VE 1KNWA 3D2UB 4XP4L 4LVBA 1LLZA 2IAMA 2ODOA 3P62A 1OFPA 4FXKB 5LHDA 3VRJB 3H2MA 3CQHA 3Q13A 5GGUA 3L2IA 2MPAL 2XG4A 1H63A 3W0WB 1E3XA 4RLDA 4JNZA 2DBJA 2PTZA 4QWWC 3W1QA 3JTTA 1F07A 3O6ML 3P77B 4N25A 4DJDD 4FKKA 3TTYA 3SFWA 4EP8C 1G7UA 2GT9B 1HO4A 3DIFA 4ZSTA 5LA1A 4NBZB 3UVIA 3V0VA 2FMNA 5CSZA 3W28A 3GQFA 1UOZA 5DRNA 2ZSVB 3STLA 3WLMA 3B7TA 3WJJC 1FL5A 3EADA 1YMME 1BKHA 3B7RL 1I7TA 2LOEA 4MJMA 4A6YB 4YBLB 3CFTA 2I17A 3CUPB 5T8GA 1Q9KB 2H1XA 4PIBA 3S0CA 1QQDB 3M6YA 1FCBA 3LV6A 3WL0A 5MI0C 4XC3H 2IC2A 3QIBD 3FVMA 1CQKA 2Z91A 3D3VD 3S4SA 3DGGB 3A6OA 4LQ1A 5C0FA 1GVOA 3QDJB 1QW7A 1EZVY 5ID0B 3USBA 3NFSH 1Z5LB 3NQ6A 3F62A 4RSYA 4X5WB 4IIDA 3F5KA 1ZNNA 5DCCA 4HUXA 2YFNA 2VLMD 1Y1DA 2E5DA 1IMHC 3GKWH 2EDRA 3HNTH 1E9PA 1CLKA 4R88A 1G0XA 2Y8VA 4H26A 3UYRL 3O8XC 4AX6A 1XXXA 1HKLL 5C6TH 1XEDA 4I3RH 1UKSA 4ZX3A 4YWGH 2WV3A 5HI3D 4K23L 4D6IA 2G37A 3WFBL 12E8H 3UVAA 2CR6A 2YO3A 3UWVA 4O2FA 2QQKH 1S7QA 4NPJA 1NDVA 4IEFA 5H2BB 4A22A 4X5QA 5JQ9A 3QHZH 4PJFE 4Q6YA 3W81A 5I66A 2JJTA 2Q2EB 2GBTA 4HC1A 2YZRA 3CQFA 4X4MA 5LKNA 2QTEA 4PMNA 3QI9D 1XBYA 2W0FB 3BOXA 1EHAA 5SWSB 3TO4B 3VYOA 4CVWA 4X5XB 2EIZB 3LQZB 4K3DL 3DX0A 1WGOA 4YN3A 25C8L 1HIMH 3V6BR 2DT1A 3FFCD 3FFDB 1WBYB 3UY8A 4UQCA 4K3JH 4IHBA 3D18A 1OP3H 3WUEA 3MROB 4Y4HB 2MKWA 1HK6A 3W7EA 4Q4RA 1YDYA 4BK5A 5A6BD 4ZMNA 4UOQA 5EIIG 5HDBF 5EUOB 1EUAA 5GGTA 1ZTMA 3QRBA 5DMGD 5E9DE 4A7GF 4V2BA 3TT1H 3ZE1E 1LD9A 1Q13A 2QR6A 1JGLH 5LN4A 4LY4A 3WD1A 4LIQE 3CM4A 1UKTA 5C6WH 4N0UA 3UCRA 2ZUXA 3CVIH 3MO1B 1G7IB 1UM6H 3APMA 1UB3A 2HMCA 4OSUH 1V6WA 1IAIL 1Z66A 4Y9EA 4Z23A 3R13A 1OC7A 2PN5A 3TJPA 1EAPB 2E76C 2V5KA 1IKNA 3OSVA 4XD5A 1ONRA 3K13A 4KO5A 4JGJA 5J8OA 4XWGL 3VINA 3HRPA 2NXHA 1D5IL 2JJUA 4LBEA 2E7CA 4BCYA 4JFFA 1OK4A 2VABA 4OUOA 3UPCA 3IWPA 4PD4K 3JZUA 3U5YA 1R3KA 4OM1L 1S39A 3NSCA 1Q90A 1E5ZA 3MCNA 3NYDA 2BZDA 1BQGA 3GIVB 3BE1H 4M4PA 2QSQA 2HXAA 2PPCA 3BWWA 5IJCC 3IFPB 5CSYA 1GOIA 3G5ZA 4L0ZA 5K9JH 3KWVA 5TJWK 1K5WA 3MUZ1 1I1YB 5C3TA 2RB8A 4DBWA 1LORA 2Z6JA 1HX0A 5CGBA 2QPUA 2NY3B 4GSUA 5DCBA 1BVNT 4MYWB 3HTWA 1ISXA 3DVNA 5SWQA 4DSYA 3W37A 4IKKA 5I6XC 4N6FA 1JCYA 3KYMB 1BECA 1DANU 4GG8B 2ZUTA 5AECA 5LQBH 1J0JA 3VOIA 2J43A 3VXRA 3RWGA 4K5MA 3UAAA 3W83A 4KUZL 1N5YH 3MPCA 5A43C 1RUML 1DLHB 3DKJA 1NDGB 1TZAA 1S9WB 1MCFA 1OFOA 5ESVA 4G9DA 3D09A 1S2AA 3LZRA 3MZTA 3P7YA 1O5DT 1T03H 3FULA 4AVKA 3K6DA 1IARB 5FO8A 1TETL 4E9RA 3MRHB 4U05A 4GW5B 1F45A 4L1LA 2MCPH 5DT1L 2K4AA 1YXCA 1E73M 1ZEAH 4PJBA 5LHFA 1XW8A 4M62L 1MFVA 5J4MA 1HCYA 1GJIA 1DEDA 3HFMH 4EPDC 3VU1A 5EU3B 1VYRA 5DO2C 3RKPA 3GQYA 4IS6A 4Q4SA 1M2VA 1YEDB 4ODBD 3FQTA 3EOEA 3I68A 3WBWA 1EUUA 3MNVA 3QZMA 5L4IA 3KPNB 1G4PA 1CXEA 4QOKE 3NN8A 5HVHC 5D5MA 5IOPA 5CZSA 5ABAA 3RWHA 1QBAA 2IIJA 1TTQA 4N7QA 4EVZA 3UBXA 5F9OH 3H9SE 1UMLA 5HWNA 4TX6A 1MW1A 1AZ1A 2VDOL 5CAYB 3FQUA 3NTCL 1KBIA 2J8TA 3DYPA 4DFHA 3MR9B 1J7VR 3RR1A 3NCYP 4M02A 4NWUL 5HY9A 1SQ7A 3D4YA 2GVGA 4IGMA 2APVA 1CFQB 3WEXA 5I3HA 2B16A 4FLQA 2QJNA 5L2KE 1W1VA 1YDVA 5J6SA 1H4PA 4KK8D 4P23C 3WH5A 5FCUL 3PPCA 3C60C 1JZ6A 3VAEA 3WQDA 4MA8L 3WJXA 3IVUA 1BZEA 4ERIA 4JTSA 5B8CB 3MRLA 4AQEB 2DQ6A 2PRHA 5K9XA 1KCKA 3VNDA 3GTVA 4NO3B 4MXWH 4ANUA 3A6BH 3H1ZA 3VXPA 1QSEE 4DW2L 4CQDA 2PO6A 5CEYB 4JIQA 4JO4L 2BIHA 1BG9A 3QYNA 2CD0A 3AIRA 2YRLA 5D7JB 3UO1H 2PP7A 1OIMA 4TULH 4JHUA 2FVMA 5BNKA 4FQIH 1BYDA 1Z3GL 2PYED 3J8F7 4O4YL 1BBJB 2H1PH 4DBUA 4CMMB 2B59B 3GDRA 4A3QA 3VWKD 4LP5A 2OOFA 2QDGA 5AYBA 1DJZA 3TN0B 2VVSA 4TVPL 1PPIA 3HQPA 2ZA1A 5T3XH 2WCAA 3CHQA 1AZNA 5H8DA 4YUEL 3SY0A 1EO8L 2P5EA 4PBVC 5DI8B 1T1ZA 3APNA 1P1ZB 4W84A 1XL4A 1ORQB 4JIEA 1HP4A 4WUKL 2K7PA 4WKHA 3M7OA 2QCFA 1PW3A 5T1LD 1PKQE 1N82A 2VXSH 1J4EA 4O5LL 1FNAA 1AMYA 2FX7H 4L3CA 5A8NA 3R7QA 3S4SG 3QYMA 3SM0A 3QIWB 3WG7B 3H2WA 15C8L 4JLRB 2DJLA 4YGVA 2ZKXA 1C5DA 1RA0A 2QR0B 3AIQA 4UF7C 4AM0A 4KKBD 1Y0EA 2TSYA 2QQLL 2CIIB 5E4AA 1AZVA 3WHE1 1W2PA 4DAIA 4IKNA 2BNJA 4YSCA 1VZIA 1Q1JH 4PJ8D 5JORB 3L5XH 3DURB 4XZ4A 3DO7A 3B2MA 2VDRL 4FFVC 4PJ5E 4KU1A 4IHCA 5KSVA 3JWNG 1TR9A 3C5ZA 4H9TA 4FQLL 4YHYC 1KTRL 3LAFA 4EPBC 3OQEA 1DQML 2J4GA 4HFUL 4J3OG 4DEPB 3SKMB 1WKDA 2CHXA 3FBKA 3T3PF 3QWRA 3U57A 3WDHA 5C5YA 1SW3A 2A9MH 2P44B 1TVPA 2C1OB 4LNYA 3LN5B 2Z8VC 3QDMB 2OL3B 3OHXC 3CUPA 3W7JA 1Q9KA 5LGZA 4WJKB 3V0UA 3R0KA 5I1GL 5A5WA 4HIHA 5DUBA 3ZE0F 2D03L 5CUSH 4IDJH 5KSAD 3FKRA 3QDJA 3TP4A 1MWAH 3TX4A 3W84A 3FRUB 4FADA 1SM3H 4OV4A 1YKWA 3EEZA 2G2NA 2V5DA 2SFPA 5C0GB 4X5WA 1OAZH 1HQRB 4NO0D 4KDVA 4KF1A 2G3JA 1WWWX 2NY4C 4JQVC 4JPVH 5C0BE 1ZL1A 1A5UA 3LDBB 2Z7YA 1EBGA 3C6LB 2ED9A 5CPNA 2Q01A 3F2LA 4Z42C 1MFAL 3C09C 1E3ZA 3DNKA 3MHZA 4WHCA 2ZX7A 1ZVHA 2VUNA 4OJFH 1PYWB 1WAAF 5A8GA 3VI3A 1ADWA 2X4SA 4I9AA 4GVFA 2A4CA 4MD5A 2QQ6A 3ZT5A 1I9EA 2B1OA 4ZQMA 4M4RA 4WUIA 1EKOA 1TZHA 3EGSA 4DJEA 4DP8X 2L7QA 1FBIL 2FJGB 3KNBB 2AJ3A 5C0CA 1MEXL 3GDTA 3U8GA 3W82A 3TW6A 2R23A 4P2QA 3WDQA 5DMKA 2E9IA 4OB5L 5D70H 2QT6A 5DEZA 2WKJA 3NAVA 2EIZA 4UZUA 4J2QA 2O6CA 3QDGD 2HZHA 4KKRA 2PTVA 1DLFL 1G5GA 1XDTT 4ZG1A 3Q45A 1UOLA 3MV7E 4Q8UA 1U92A 3MRIB 3UPRB 1KTKE 1KN4H 2KMWA 3NSJA 1QNPA 5C7HA 4Q8NA 4DXVA 4Q4OA 2DQIH 1CR9H 4WW1A 4BIKA 3ENEA 3QUMB 4G7RB 1ZE3H 2DQHL 2VLKD 4MZRA 3HI1A 3KRUA 2X0UA 2E5EA 3K2UH 3LEVL 3R10A 4G8FB 4C56B 2HMID 1BP3B 2GSGA 3BP6A 1YYMH 1XGQA 3FPYA 1UUSA 1S5TA 3H7BB 5EU6A 3IKKA 2X2HA 5EGRA 3GO2A 1M42A 4Q6IB 4J27A 2Z7UA 3NIYA 3U7VA 2WB7A 3CV6A 4OQTH 3H7VA 3D9AH 1JI1A 1S3HA 3T8LA 2Q8BH 3E6EA 3DVGA 3SQRA 1YCSA 1PCKA 2GGJA 4V1DD 1R47A 5FWRA 3V6FB 1ZV5A 2VWSA 1L6FA 3BGAA 4NYLA 1JNJA 1HHKB 4A29A 3WLLA 1G6RL 1QXLA 5GHWL 3BAYA 3FB6B 1OP4A 1RIVH 4ORGA 1M68A 2EDFA 3CPGA 4FTVB 4KEVA 2X44D 3QKEA 3WFAA 1SO4A 3FHAA 2JCCA 4WXZA 1ZVNA 3G6JA 3BXNA 4APQB 4ZSUA 3TT3H 4NCDA 2EVJA 3NJXA 5JYLA 5E56A 1HKWA 2WP3O 2WXRA 2KAUC 2E46A 4RIRB 2WKGA 3OF6D 1ZT7B 3WMPA 4GEIA 2GUUA 1FP8A 4O9HH 3IDGA 1DCEA 4BK9A 1WKYA 4GBUA 3C2YA 1I31A 3HFFA 1MG2C 4NDMB 4ZAKC 3E80A 1R1CA 1NCHA 3EBAA 3SUTA 4YL2A 1JNLL 3BGFB 2LU5A 3STPA 5HHXL 1QFHA 3ZQ9A 4NM8H 4U6HB 3VXMD 4JFED 4JM2D 4XBPB 2J88L 3BZJA 1CE6A 3KZPA 1S7TB 2E67A 3UBXG 1P84K 2J1YA 3T0EC 2YGPA 2A0LC 7TIMA 2VGIA 3QUYD 2WIMA 3M0JA 4N2FA 1A4MA 3R4DA 1P9MC 1ISZA 1KTLB 3IJYB 2A0NA 4Z7OE 2E3ZA 4AI7A 3JBG7 3CBWA 4POCA 3PJNA 2F53E 2DWTA 3GMQA 3UZEA 2YCLA 2YLAA 2VGGA 2WLMA 1H3WM 5DMIL 3FONA 2WMKA 1MCRA 2AXHA 1J9QA 1F8TH 1M9HA 2OA9A 2OOGA 3MRBA 3LMJH 3V9EA 2NVDA 4R2GB 1W72L 2Q71A 3QN3A 1PEZA 1QA9A 1QD0A 2ENSA 3GC2A 4EX4A 3R4IA 1ZLVK 3T3PB 1CK0H 1UWYA 3BE7A 3MRCB 1S5HA 3S0PA 1FH7A 1CFTB 2WLLA 4OVUA 1O9VA 4M1DH 2X89A 4BINA 2REQA 1F58H 1FNSH 5I6SA 1ONWA 4E2OA 1HXJA 4PY7B 1HP5A 3NCJL 4LKCB 2L04A 2YD7A 5CCHE 4TPRL 1OCWH 3VGEA 4OT7A 2GQHA 4F8QA 3L95A 1G7PA 5DC0A 1U3JA 2X4OA 2CLVA 3W7DA 1FWIC 1Q9LA 5GGSY 1MIEL 5MF5A 1UZ1A 3BN3B 3APCA 4X6BA 4POYA 2X6VA 7PTDA 2I7GA 2HRPL 4HHHA 1AMKA 4KUCD 5HYQB 5C97A 1X7TA 3GKZA 3K3QA 4H20H 4EZMA 3OM3B 4Y5XB 5B8CA 5JIIA 3O05A 3FO2B 2ADFH 3R8BB 3FO1B 3TNOA 4F24A 1XLJA 3SO5A 4QHMA 1XC4A 1F02I 2B2XL 3FTGB 1Z44A 1IFHL 2WQXA 3LCIA 3RDTB 2YGNA 4E41E 3LCHA 1H9VA 5DVMA 2E27H 4EF3A 4QO1A 1J8SA 2FQDA 1F3EA 1VYSX 2GGHA 1Q63A 3O0RH 2FFCA 1J12A 1EQPA 1E6XM 1US3A 1AR1D 3GJFA 1Q6RA 4U10A 1KIRB 3KGRA 2AK4D 4QNPF 3QI9A 2HV5A 2HTKC 3BD4A 5D4HA 1X5LA 4P7NA 1HILB 4EZKA 2BIQA 2IEPA 2JTYA 1D6VL 4NUGH 1NQKA 4MF4A 3MJYA 3HBQA 1SPQA 1VFBB 2VRAA 2G3FA 2V3FA 3NZ8B 3FAXA 3RVTD 1NBVL 4PJXA 2XQ0A 3HNSL 1EFXB 3VD5A 1D5ZB 3SECA 2YB4A 4QDGA 3TTSA 5EFFA 2YGOA 5I74C 2QJIA 5IFHL 2MSPA 2CHWA 3N9RA 4DKTA 2Y7QB 1TFVA 3UA4A 3URAA 5KYUB 4L9LB 1V8HA 5GJMA 1FFTB 3PGDA 4XVTL 2X28A 3CMOH 1E28B 1H9DA 1D3HA 5HAOA 5ECJE 3JT2A 4Y19B 3AUVA 4JX6A 4U1KA 4K8RC 3MMEA 3DECA 5BOZG 3M0YA 2OXGB 2V7NA 4MX7A 4DZ5A 3LCFA 4C57C 1UXWB 2H3XC 3QK0A 2MNWA 2R9RA 3NQDA 2JE8A 2VFFA 2ICSA 4H13C 4RDBA 1OD7A 1E0UA 1ME7A 2GFTA 3TBCA 3EWUA 4L8BB 3RM8A 4RDQG 1ZSDA 1XCTB 2Z93A 4G11A 3II1A 4IBLT 1MQQA 1IEAB 4QXGH 4ZB2A 3H26A 1JN6B 1TT6A 1GORA 4LCWE 2ACSA 3T2PA 2WAHA 1RIHH 4MSWB 2VGLM 3TZNA 1OP5H 1QLFB 4NZUL 5HPMA 3ALGA 2VZUA 3SUUA 1KT2A 1VBUA 3OKDB 1JVKA 1TVHB 2CUHA 4JTDA 1B3OA 1QPQA 2FEDC 3D46A 1EXGA 4O50A 2WHKA 2XNAA 1ZSXA 3RCMA 4PZVA 4KC3B 4ZMYA 4K94L 4WO4D 4C4KO 2A6DB 2WBJB 3VDBA 4IHOB 5IM7B 4O54A 5SWZA 3UR7A 5AVXB 5F6IC 3X13A 1KQZA 4JQIH 2WHJA 2O7SA 5B80A 3UAJD 3VTRA 2OV0A 4PHXA 4QG9A 3LHAA 5F7WC 5K5YA 4Q9BA 3VFSA 2HPMA 1ZTVA 3IGXA 4BZ1H 1WDWA 4Z8FH 2BXYA 3DDFA 2R1WB 4JFOB 4A21A 2D3VA 3OLIA 1F3RB 3ES8A 3U2SA 4AMXA 3KL3A 5BOPA 1WNOA 1A7PH 2E7HA 4EANA 4XCCL 4LAUA 4J8RA 5BUGA 1HDMB 3VQLA 3IDNA 1EYEA 1JGDA 2NUTA 1KCRH 4W9JC 3PR2A 1V5XA 4ISVB 1IQDA 5CLZA 1TJGH 3RVWC 1CD9B 3B4UA 3EXSA 2R9HD 3ITLA 5FEXA 2J47A 3HTLX 2OWXA 3TDFA 3WTTA 3O4LA 4A38A 3QXBA 1F97A 4PJ9D 1JQXA 4BA8A 1P0NA 4YWSA 2TSAA 2P5WB 4NP7A 3U4BH 1OARH 3MGOB 1P7KA 3MJGX 3T2OA 3UWZA 2CO3A 5FF2A 4DN4H 2F8XC 1HFBA 4HNNA 2A6IB 1RK1A 3B3BA 2DEPA 4XI5D 4QTIH 4IK6A 3UPRA 2Y7EA 2FCBA 3QC3A 4QHNA 1FCQA 2ZKWA 4X8JB 4YR6A 3BQ5A 1YY9C 3ULVD 4XNXH 4PGDB 3RWFA 4IIQC 4XN7A 5JW3L 4ABUA 3FCTA 1YTKA 4BI7A 3GSXB 3LVEA 3IU3B 3WNKA 1CBVL 1NA8A 4H3DA 3CV1A 3DV4A 3EYSH 3QS3A 4NQXA 1ODAA 1H3GA 1NCOA 4EN3D 3B5GA 3H3PH 2HCZX 1L7TL 4ADSA 3CTLA 3OZ9L 4B5WA 1NGYB 2VE6A 3IK2A 4HPYL 3EX4A 2ZKMX 3TN6A 2VC7A 5REQB 4Q6IA 3SYQA 5JQIB 2Q8AH 2ZP0T 4A7UA 5BS0A 4PTWA 5F0MB 4UB0L 4HU0A 1PZ2A 4JX0A 3ATBA 4OZ4B 3IGLA 4KJWD 3VAVA 5KW9L 3FQWB 1BF8A 5KVGL 5I1KH 1QLEH 4NX5A 3TBWA 2IAMB 2J20A 1EJFA 1YEFL 1T5WA 1UG9A 1A14L 1SFTA 1VACA 5GGUB 2AERT 5FGBA 1EXUA 2TSBA 1KCUH 2XG4B 5LN8A 4HA0A 2XZZA 3WFLA 1TRIA 4L9YA 3CQJA 3JTTB 4JHZA 1QRKA 1IVLA 2V5CA 1I8JA 3ARGD 2YCIX 4KXAA 4MWAD 3DIFB 3E5PA 1EA0A 3V0VB 5CSZB 4W9LC 1JDCA 5DRNB 3TVAA 5IQMA 2PFHA 1OX6A 4QRPA 3STLB 4KH2A 5E8DL 1FL5B 3VO0A 4NYYA 1M05A 7PAZA 4BQ3A 1NPJA 1PHWA 3NJFA 4L5FL 4NSKA 4BXSV 1OE3A 1I7TB 3TSMA 1PZDA 5LBGA 2WQUA 2ZXWB 1QNVA 3I4KA 5IB1A 4AG0A 1A3ZA 2C8NA 2Z91B 3S4SB 4F9LA 5C0FB 2YRBA 1L6YA 5D2VA 2XU9A 3IKCA 4HUXB 4I0CC 3V1PA 3WMBA 2N56A 4W4NA 1RHFA 1CWYA 3AHTA 5LGHL 1NWSA 4H26B 1XIHA 1L9PA 4US6A 4LB4A 5T5NF 3P3TA 3VABA 2D3NA 3RU8H 5GS3A 3ML8A 1JK9A 3QV7A 3VD7A 4G8TA 2V30A 4O2FB 1S7QB 3T1FA 4YK4B 4IEFB 1JBJA 5I66B 3WJLA 1S2TA 1MXGA 1EJVC 2ZYSA 4H00A 5HGBA 4IJCA 4KXZH 2AZAA 2VM9A 5G2NA 3E8UH 5KITA 1RULL 2F54D 1AQFA 2DYRB 2DPEA 4FOMA 1E6JL 2VGFA 4QJ4B 2X09A 1DXFA 2HNEA 3D18B 3ZL4L 1N5AA 2YD9A 4YBQC 4G9FE 2GTWA 2NX9A 4JY8A 4Q3MA 3T09A 5IJDC 4PI2A 2VJ0A 3ARBD 3TA3C 2XG9A 1S1RA 1RZMA 3CMJA 2E8YA 1XX9C 1Y5WA 4X98A 2N59A 1OVDA 3L4CA 1RA5A 1CCZA 1VLXA 5HPCA 2GSJA 3KHDA 3PNUA 3IRZA 4WJG3 2PF6A 1ZAJA 4LU5H 1KEMH 1NGPH 4LPCA 3BDYL 1I9JH 4LS1A 4N0UB 3L9CA 5C2CA 4NO0A 2NUWA 2R0ZL 1WCGA 5HHPA 4DQAA 3LB6D 2WLYA 3VDHA 4IM4A 4YHKL 1QR4A 4MCZA 4NRZA 3KX6A 3O4OB 4F3HA 3VJ6A 4LPYA 6PTDA 1W5OA 3NRPA 1CUOA 3RFAA 2DWEA 1SN0A 5U4NA 3FZUD 4GBDA 3FMGL 1AH3A 1FWEC 3TJEH 3HMWH 1ZT1A 5BZZA 3SQBA 1R5YA 3ZN6A 4GFTB 4K0OA 2AGTA 5FECA 3OJMB 3UTSE 1I53A 2C91A 1SUXA 4LBEB 1VS1A 2W65A 1XFBA 2BXZA 3P3BA 2EDHA 2HXUA 2VABB 3N2TA 3SGKA 5EIIA 4PN2A 4K8EA 4Q9QH 2QCEA 4KKCC 1X1NA 1NU5A 3IIZA 2H6PA 4LS0A 3BPWA 3NJNA 5JW5A 4HMCA 1Z41A 3AG3B 5TE7H 3GB7A 2F7FA 1TMQA 3SE4C 3ES6A 5F9AC 3ARDA 3G5ZB 2XZAL 5TDOA 1E2VA 4AEIH 2AEPL 1PY9A 5DJZA 3KWWA 4B16A 5AUMA 4F3FA 2QGHA 2VLKA 4ICWA 2IQTA 1TTIA 1PL9A 2P24A 4ACPA 1EJ8A 1UPMB 4ODTH 4N9BA 1KMGA 1UB6A 3DVNB 2OXGA 3UZWA 2G5RA 4FG6D 5SWQB 1S2CA 4KOCA 4P9HC 4ZW5A 3NEEA 3RU8X 2W9EL 4OZFA 1RSFA 3L13A 4IF2A 1OC5A 1IUZA 1T2QL 3DU0A 4BUHA 5TH2B 3VXRB 4RDQF 3RWGB 4YHPB 1JZ7A 2I5GA 3B7YA 4AEHH 3R8RA 1M56B 1QR1A 3EOYG 5ESVB 1IGIH 4A7VA 3VI3F 4IUOA 4G9DB 1I1RA 1GVYA 3MTWA 2EADA 2AI0L 3N3MA 3W2NA 1OM3L 2EZ0D 5FO8B 4ROQA 2XM2A 2RMNA 1EIBA 4CC4C 3NSFA 4M7JL 5DYFA 5ICUA 4PJBB 3OVGA 5TQ2L 3TLRA 2NXIA 2OZ3A 3EBHA 1T8QA 2BVOA 3KOXA 4NC2B 2AJZA 4AZUA 2Y6ZA 3GW0A 1I9IH 1S7XB 4OGAC 5IJVA 2WYHA 3LRLA 4HMDA 5DD1H 4LOUD 2NXYD 4P46A 4IS6B 1M2VB 4NZDA 3FQTB 4JZNA 4PJCA 1ZQ5A 1JXGA 3MNVB 5EOCH 4UTMA 1UWXH 3L4XA 4JB9L 3NN8B 1UHVA 3JVFC 5D5MB 3NCWA 5IOPB 3RWHB 3UBXB 2DRUA 1XGYL 4MYXA 5EUOF 2FQGA 2EEBA 3UTOA 2F1EA 3C4UA 2OI9C 3FQUB 3HM7A 5D2XA 4XMXA 4Q4EA 3X3GL 3UG5A 5HY9B 2WHLA 4V2CB 1XIWA 4I9JA 1SNRA 1OOAA 3WEXB 3M0XA 3T0EE 2PDKA 4MKNA 4JNMA 3LLFA 4M1BA 3AAZA 5IQ7H 5CLTA 2WAQA 5D1XC 5C7XH 3GHEL 4RMRA 1IM9D 2O5YL 5AVQB 3KL5A 4ISVA 3MRLB 4Q8QA 1AR2A 3QBTB 1MLCB 5I03A 4ODVL 3ZDZB 5I9QB 1NLBH 1IT9H 3QYCA 4KCWA 1MAMH 4Z7NE 4PBFA 2VWEC 4Z0BL 3R8GA 2ZQKA 1UFGA 1V3HA 2GSMB 3VXPB 4PUMA 1RCYA 3WBYA