3OLDA

Crystal structure of alpha-amylase in complex with acarviostatin i03
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
495
structure length
495
Chain Sequence
YSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Structures of human pancreatic alpha-amylase in complex with acarviostatins: Implications for drug design against type II diabetes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 173
structure length 495
sequence length 495
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3oldA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3oldA01
3KE0A 3AYSA 2QV4A 4JIEA 1QNPA 4EE9A 4WK9A 2W91A 2JF7A 3SUVA 3WUGA 1OIFA 5TD4A 2WC4A 1OIMA 4HOWA 1E6PA 3O2LA 5M3WA 1WO2A 4AEFA 4MAZA 3WDQA 3CZGA 3EJQA 1C93A 2ZIDA 2XIBA 3AIRA 3ARQA 3PN8A 3CUIA 3SUSA 5CSUA 4MTVA 1ITCA 4J3WA 2J7EA 3OA5A 3AMLA 1OGSA 3K8LA 1TFVA 1HJXA 1QI5A 2WMGA 3DX4A 5A69A 1WKYA 1B3WA 4XZBA 4F9DA 2YLLA 4LXFA 3U5YA 1VFOA 5FL1A 2EPNA 3BAJA 1V6YA 2ZUMA 2X2JA 4CU8A 3BVVA 3WDRA 3L4WA 2E40A 3RILA 3RCNA 2F1AA 2VZTA 1CDGA 1UD3A 1K9FA 3ARRA 2ZX6A 7A3HA 1W1VA 2WSKA 2E3ZA 4CU6A 5HPCA 3W6MA 1HX0A 1M01A 1E4MM 2ZWYA 2WWDA 4HMDA 3ARYA 4XX6A 4W86A 2YKKA 2GJXB 1FHLA 4AZCA 3T2OA 1US2A 2VX7A 3WMSA 2BNJA 3ALFA 2G3JA 1B31A 1UWUA 4BS0A 2DT3A 1BGGA 2OYMA 4MNKA 1CBGA 1UWTA 3U57A 2WZHA 4OJYA 1E6ZA 3WH5A 3FHQA 5E0FA 2VNCA 4FLSA 1QWUA 4PUDA 1QBAA 4GZJA 3WEOA 4AW7A 4P7QA 4GI6A 1OINA 3CZJA 3UG5A 3GXPA 1CXFA 2UY2A 3VIOA 3VGFA 5GNYA 3VGGA 4QFUA 3DYPA 2V3GA 4U3AA 5JIPA 4EK7A 5LA1A 2XTKA 5I3DA 1OD0A 4AMCA 5FCZA 3MV01 1EDGA 2DPEA 2EO7A 1BG9A 3IJ8A 3EDDA 2MANA 3WDJA 3UESA 5BXTA 1XC6A 2EACA 1NP2A 1E6SM 1DHKA 1E0WA 3B9AA 1HNYA 3LPFA 5M17A 3WDPP 5IFTA 3NDZA 2F2HA 1DWAM 1J0ZA 2WANA 1FH8A 3BUIA 3ZSTA 3UG3A 1RP9A 3ZJKA 1PIGA 3H54A 1T0OA 4LYPA 3OZOA 3S2CA 3AJ7A 2GJPA 1DWGM 1CGYA 2E0PA 3WQ4A 2XSAA 1OSEA 1GJWA 3IJ7A 3MKKA 4PN2A 2AAAA 1W9UA 1XSIA 2YIHA 3CHEA 4FNPA 1JGIA 4OIFA 1GOMA 3BMWA 2Q8XA 3D5HA 3MO4A 4NSBA 1W3KA 3SIMA 1UH4A 1MW1A 4ATWA 1XRVA 1GOQA 4AIEA 2J7HA 4PTWA 1CWYA 4D6IA 1JNEA 1BYBA 1QOXA 2Z1SA 3D50A 4KRTA 2GJRA 3VIJA 3EDEA 1UA3A 1W3JA 4PMXA 1E4LA 4MAVA 1CIUA 3VILA 3VD9A 1H41A 1TQVA 4ATLA 1OWQA 5FIPA 3PZQA 1CYGA 2W66A 3W29A 4E8DA 4UFJA 3PZTA 2X8RA 3EJSA 4NXKA 1CENA 2FYVA 2UY4A 2J7FA 6TAAA 1E5NA 5CPQA 3QHNA 2GJXA 3TTSA 1SMAA 1C7TA 2V38A 1QBBA 2C7FA 4AZ6A 1UZ4A 3AIBA 3D3AA 1R7OA 5EB8A 3TA9A 4BCEA 3WEZA 3WUEA 1GQKA 2XUCA 3WY4A 3FW6A 2EPMX 3VD3A 3VVGA 3BVTA 3IGUA 4OBSA 4E8CA 3WY1A 2VCAA 4EANA 3HG5A 1VEOA 3KEHA 1BSIA 3A24A 1NWSA 1W3HA 1SFSA 1WZMA 3GXNA 1RD6A 5CPTA 2CBIA 1Z32X 1TZ7A 1XCWA 4HPHA 2OW6A 3CZKA 1Q6FA 4FMVA 3W82A 3T0DA 3NIYA 5D9PA 4HZ7A 5CGTA 1E0VA 2WHKA 8CGTA 1TQWA 1KQYA 2X2HA 4BQ5A 3BAWA 1Q6GA 3AHVA 3WN6A 1IT0A 3N9KA 5AY7A 1BF2A 5A6JA 1PBGA 1CXLA 1ZS2A 1EIBA 2XGBA 4WKFA 4FLOA 1R33A 4PYSA 1PIFA 2BVDA 4CN6A 1SMDA 3BVXA 1FA2A 3ARSA 2D0GA 1HL8A 1UWQA 4HMCA 2V3EA 4DO4A 3CHFA 1GOOA 1HN1A 4NF7A 3CZ8A 4WKHA 3GXMA 3A21A 1QI3A 3KL3A 4JFWA 2DSKA 1KGXA 2JIWA 1G1YA 1UH3A 1LL4A 2IUZA 3A4WA 2A3EA 1JYVA 3WENA 1PPIA 3WD3A 3OBAA 3RM9A 1OB0A 1UR9A 2F8QA 3II1A 1CGUA 2D73A 3OLEA 2D3NA 3SCWA 2ZUTA 1GHSA 3QHOA 3W81A 2EJ1A 5JIWA 2E8YA 4FNTA 4TXEA 2EPKX 1JIBA 4KGJA 4BA0A 3T08A 3NYDA 2QLYA 1IZJA 2FHFA 4MB5A 1JYWA 1RPKA 1VFMA 1C92A 5I79A 1QHZA 2BY2A 1OGBA 1HKJA 1A47A 4JKKA 4AD4A 2VZVA 3UG4A 2G3MA 3AIEA 3WNPA 3EMQA 4LYRA 5E09A 4CCCA 4QDMA 3UERA 4PCSA 2BS9A 2E4TA 4KRUA 1QNSA 1W9BM 3G6MA 3QOKA 2F18A 2F7PA 3A6OA 2ZX8A 2XVPA 3WSUA 3EJPA 1JDCA 3BVUA 1BLIA 4GQRA 2VX6A 3GXFA 1EOKA 3LRMA 5EMYA 4CVUA 3CUJA 3VM7A 3UETA 3A23A 2VUYA 4L4PA 3ARWA 1PJ9A 3GTNA 3CTTA 4LPCA 3VGDA 3KLKA 2DSUA 4JZ5A 4D71A 3K1DA 4ZFMA 4PMNA 2WVVA 4D6JA 1PZ3A 1QNQA 1UKSA 2G4FA 1UD8A 3L4TA 1EHNA 3WMCA 5CSYA 1B3VA 2JF6A 4YPJA 1JZ8A 1G01A 2XJ7A 3GDBA 1PX4A 2O9RA 1C8QA 4ATDA 3OZPA 4NZCA 1KFWA 4TVUA 2WWCA 1MYRA 1LWJA 3AHTA 4QCFA 3BAIA 1LF1A 1W3LA 3FAWA 1UA7A 2IGTA 3VOCA 2G41A 1G5AA 2X1IA 1R47A 4MB4A 1W9VA 2VCBA 1R75A 1BFNA 2QF8A 3ARZA 4ZEPA 1UZ1A 1VBRA 4S3KA 3VD5A 1E6XM 1LQ0A 1SR0A 2VR5A 1FP9A 5E1QA 1KR0A 1VRXA 1E6QM 5IDIA 3ZM8A 1K9EA 3RM8A 2ZUWA 3BVWA 4W93A 1NOWA 4UQDA 2VMFA 1DWFM 2Y8VA 1H0GA 2VZSA 1M53A 1CEOA 1HJUA 4MDOA 5A2AA 3T0BA 5BYWA 3DDFA 2CHNA 4JKMA 3QR3A 2XN2A 1FHDA 4U2ZA 4AD0A 2X0YA 4GQQA 3ZT5A 5BROA 3CV5A 1CXEA 1UHVA 3MSDA 4X9YA 3AS0A 3W4RA 1JAEA 2C8NA 3WDHA 3THCA 4X0NA 1QNRA 1J01A 2PWDA 1B30A 1XYZA 4A3YA 3AQUA 2FHCA 3VSUA 3AMDA 5GNXA 8A3HA 1QI0A 3GBEA 5A2BA 2VX5A 3ECQA 4W5ZA 4BQ3A 3L2LA 1QW8A 1ZL1A 3LPGA 3PTMA 2XIIA 1UD4A 1CLVA 2O9TA 3DX2A 2WBGA 3NDYA 4DUWA 1Y7VA 1JXJA 1KBBA 3N18A 3AIVA 1GHRA 3AISA 2Z1KA 3BLPX 4CD5A 1KXHA 2XPKA 3SCQA 3RDKA 1UD5A 3BXWA 1CGVA 4M8UA 3VX1A 1WP6A 1E5JA 4HMEA 3NSXA 1KTBA 3W53A 1JL8A 4GKLA 4MNLA 4A4AA 1KWGA 1WZAA 1UYQA 3IAPA 4AZBA 2WAGA 3DYOA 2CYGA 3BCDA 3AROA 3HG4A 1KXQA 1BGAA 3AFBA 4CD4A 1ZBCA 5D9MA 4JL1A 3UEQA 4JCMA 5D9OA 3CC1A 5EBAA 2XVKA 3M6DA 5ABEA 5DMYA 2WHLA 1M7XA 4DM2A 4AZGA 1B3ZA 1J11A 5M5DA 3PTQA 2WM0A 1J18A 1QVBA 5CXPA 1VJSA 1EA9C 4GXPA 1CZ1A 1GNXA 3RPMA 3PZUA 4S3JA 1AQ0A 2JIEA 3G6LA 3OGSA 5GPRA 2FE0A 2GVYA 5E0CA 3HJEA 2YL6A 1XD0A 3M46A 2YOCA 4W7WA 4PSPA 4DWSB 4W5UA 3QOMA 3SUWA 5JBFA 2VI0A 1V3KA 1TQSA 2OSWA 4CD6A 1EHAA 5FKYA 5GQBA 3FY1A 3WNOA 1HT6A 1XGZA 2WCAA 1J12A 3EDKA 1ZBKA 3HU7A 2WZEA 3ZQ9A 3WUBA 5HOSA 1E1EA 1MQQA 1NP0A 3FXYA 1BTCA 3VTRA 1V08A 2J7BA 1WDQA 3BLBA 4HOXA 3WNLA 4MJ2A 3MUAA 4H04A 1UD2A 1DWHM 4BQ2A 4F9JA 4TX8A 2UY5A 1HJQA 3GXIA 1HKKA 1J0KA 5D8WA 3JUGA 4CD8A 4YHGA 1ISYA 3ZIZA 4W87A 1TE1A 4MNMA 3IANA 4HU0A 3WNNA 4N42A 1QX1A 3WL0A 3WH7A 4HA3A 3ALGA 2YDQA 3GNOA 1XHGA 1UD6A 3BH4A 2VRJA 1B0IA 5BRQA 1C91A 4IPLA 2VZOA 1UWIA 2J4GA 2WYSA 2DIJA 1GQJA 2PC8A 4AYSA 3ZT6A 4P8UA 5IXEA 2ZOXA 3RIKA 2PI6A 2WC3A 1EQCA 2AMGA 4P8WA 4PMOA 1TVPA 1E0XA 1G0CA 3AXHA 1VFUA 4TX6A 4BF7A 1R8LA 3VNZA 3BMVA 3CIVA 4AIUA 3L4ZA 1FH7A 4UCFA 4M80A 1SYTA 4TUFA 1TUXA 2XHYA 4DWSD 1E43A 4RE4A 1VB9A 3MUY1 2XVLA 3VMNA 3SCOA 1CNVA 1QWNA 3CUHA 2OSYA 3BUQA 3WD0A 3BAXA 5GNZA 2GDVA 2XFYA 3WQ5A 2VO5A 1VF8A 1JZ4A 5F7UA 1VIWA 2ZXDA 5HXMA 1V6UA 3CUFA 1I1WA 1ZU8A 4AWEA 3OLDA 2JFEX 3U7BA 1EH9A 3T2PA 3K46A 3KL0A 1KR1A 3WF4A 1PX8A 3GH7A 2W4XA 2W63A 5BCAA 4FF5A 4HTYA 3FHAA 4J7RA 4UQCA 1ZB5A 2WK2A 3VPLA 2XSBA 1EXPA 1XYFA 2WVSA 1NM9A 3WF2A 4W8BA 2ZX7A 4DWSA 2YL9A 1W32A 2D3LA 2F7RA 4D6HA 3L2MA 2W67A 7CGTA 4GPNA 2ZXAA 2ZX5A 1ZBWA 1X6LA 1JYXA 4Q7NA 1EQPA 2VURA 2EBNA 3VM5A 2DT2A 2VC9A 1V02E 2J77A 4JFUA 4HA1A 1UOKA 3WFLA 1UWRA 2DGAA 1MFUA 2EABA 2WLYA 5ABFB 5ECUA 3MMWA 2QHAA 3L4UA 4UOZA 3BSGA 3K4AA 5A94A 2DSVA 1V0KA 5AC4A 3HZ3A 1C90A 1C8XA 3FNDA 3ZOAA 2XWDA 3VUPA 3DHUA 4KMQA 2XVGA 4AZ5A 3POHA 3CH9A 1E72M 4OZOA 5IFPA 5EFFA 1E56A 2HISA 1HL9A 4K68A 4RE2A 2CCRA 4NXSA 4LQ1A 3IAQA 2F61A 3RO8A 4M82A 3GM8A 4MB3A 5A8QA 3ARPA 3AS3A 2D24A 2E9MA 4CCDA 1FH9A 2J79A 3WF0A 2XN1A 2WNWA 5IHRA 4DM1A 4AISA 2W92A 2VCCA 1B3YA 4Z2JA 3SCUA 1GCYA 3AMCA 3BLKA 4C7FA 1OCQA 1ODZA 4CN4A 1E15A 1CECA 2BY0A 4GO8A 3N11A 2PF0A 4CKQA 4P7NA 3W28A 1KWKA 4BZYA 2CBVA 4YN5A 3VIMA 3VX0A 4J3SA 1OBAA 4JKLA 1BHGA 1M04A 1AQMA 3ZJ6A 3H55A 3TONA 3A4AA 2FH8A 2FGLA 3LRLA 3TTOA 2YL5A 4FK9A 2NW0A 3N13A 4E4PA 4H2CA 2ZXQA 5DO8A 1JAKA 3LXBA 2VVSA 3K4DA 4AZ7A 4AY1A 3HG2A 2XYLA 3SCVA 2A3CA 5FOOA 2WMFA 2JE8A 1HP4A 3BUDA 2J7DA 1B2YA 2V3DA 1LG2A 4B3LA 2IXUA 3QHMA 3EJUA 5I6SA 4P8VA 4AD3A 1OT1A 1KB3A 3F5JA 2JEQA 1QHPA 4W8AA 1FP8A 2QMJA 2WMHA 4GZIA 4OUEA 3NSNA 1AVAA 5CZKA 3AIQA 5I5RA 1KQZA 3VIFA 1HJWA 3WL1A 3SCPA 1JF6A 3S6TA 3M7SA 2D20A 1ESWA 1HWWA 3PZVA 3ZO9A 3WNMA 3GYCA 4JHZA 5BRPA 3MMDA 4D6FA 2B31A 3HN3A 4M56A 1NARA 3OLGA 2WMIB 2WW5A 2YA0A 1H2JA 4UOQA 2NT1A 4GZEA 1HTYA 2J7GA 2D22A 4AXNA 3AHXA 4HP5A 1HVXA 4EAMA 4H8UA 4JFSA 5HBFA 2OSXA 4P8XA 3CPUA 2J62A 3AHZA 2WPGA 2GUYA 4CUCA 1VENA 2V3FA 2NSXA 2WCSA 1ITXA 4PTXA 2BHZA 5ABFA 2EXOA 2OLHA 1AMYA 1JI1A 2VZUA 2DT1A 3VMOA 2X2YA 2A3AA 2PWFA 4B16A 1V6XA 5AYBA 4CU7A 1TVNA 3VDHA 3GNRA 3BC9A 1O6IA 4NX0A 3SUTA 2G3IA 1KCKA 3OG2A 2Y4SA 2YA1A 4U3CA 5A8OA 4HZ8A 4R5EA 4FNUA 4AZIA 1XV8A 4PMRA 1MFVA 4U31A 4V2XA 1JNDA 4U2YA 2J78A 3EJTA 4QLLA 1XH1A 1G94A 2EEXA 1U33A 1XH2A 5EFDA 3ZT7A 3SEPA 1IV8A 1UQZA 2WXDM 1NH6A 1UG6A 2X2IA 2VVNA 4B15A 3BAYA 3GH4A 2GK1B 1NWTA 1Q6EA 1J0JA 3LRKA 3BGAA 3PBGA 4GI8A 4L4OA 3L4YA 4HA4A 3KLLA 4EKJA 1E3ZA 4AYGA 4UQ9A 5JBDA 2J74A 2ZUSA 1X1NA 5CJ5A 3GXTA 2DSWA 4AD2A 1NQ6A 5C8BB 3AZRA 4MPKA 1EGZA 4FNRA 3LX9A 2PWHA 5D4YA 1K9DA 4X0VA 1EO5A 4UZSA 4TOQA 4J28A 4P7OA 3CZSA 1JDDA 4A3HA 4H8HA 1UKTA 3VGHA 3L4VA 1E3XA 3MV11 3AXXA 5A6KA 3LPPA 3AHYA 4GIAA 4MADA 2VQTA 2CETA 1E71M 2E8ZA 4AD1A 4D6GA 3VDBA 1GQIA 1CLXA 3WFZA 2VJXA 1B90A 1W2VA 1CXHA 2VOTA 5I23A 3A4XA 1UQYA 5ABHA 3ARXA 1E4NA 2D0HA 3WMBA 4QP0A 3KWXA 9CGTA 1QW9A 2WMIA 4MJ4A 1BG4A 2GDUA 3ZJ7A 3W27A 2ZUVA 1GONA 4PTMA 2DEPA 1UKOA 3MANA 4TVCA 1DP0A 4OBRA 1WZLA 4UNIA 1D7FA 5FD0A 3A22A 2FH6A 1NOUA 4UFLA 1FFQA 1V3IA 3VINA 1P6WA 2RGLA 1FFRA 1KGUA 1G9HA 2GSJA 4Z2GA 1GOKA 2BY1A 5A8PA 2EADA 1R86A 4V27A 3PZNA 3W26A 1LWHA 5HPOA 3CLWA 1DWIM 1OGGA 3OGVA 4NRRA 4HOZA 1DEDA 3W24A 4GO9A 4IUGA 4OOUA 4DO6A 2WLZA 2FHBA 1L8NA 3W25A 5CLTA 2OYLA 3CUGA 1PEZA 3F5KA 3VIIA 4ACYA 5D9NA 5CLWA 3A47A 5AYIA 4AMXA 5C71A 2YBUA 3OGRA 2F1BA 2YBTA 2QPSA 4AZHA 4D72A 3CGTA 1V3JA 3AZSA 4U33A 3O6AA 4Z2KA 3ARVA 2BFGA 2NT0A 3DECA 2CITA 1PZ2A 1E1FA 3WIJA 3VSTA 1VAHA 4AZCB 4QAWA 2EPLX 3VNYA 5DT7A 3DX0A 2V5CA 3SUUA 4ZE5A 3APGA 4PBGA 4W84A 1UR4A 1GJUA 1BYCA 1DWJM 1JZ3A 1H3GA 1WNOA 1IZKA 2BVYA 5E9AA 4DUXA 2GK1A 4CCEA 2D0FA 2CIPA 1UKQA 3OLIA 1JZ6A 3GBDA 4F8XA 3KL5A 2ESCA 1J10A 2VL4A 1KTCA 3DC0A 3WH9A 2GFTA 2VRKA 1UH2A 2QMKA 1GORA 5CPSA 3GZAA 4AD5A 1D2KA 5KZ6A 3SCSA 3AI0A 4W85A 1CXKA 3W37A 3WEMA 4XB3A 1NWRA 4XUYA 3CO4A 3AYRA 1UR2A 3CBWA 3I3BA 4PMUA 1O7AA 4Z2LA 1ZBVA 1UR1A 1TG7A 2PWEA 4ZXLA 1HJVA 3B8SA 1V3HA 4LGXA 1W1TA 2YA2A 4D1JA 3PZGA 3BAKA 3I3DA 3W6LA 4PMVA 4ZXOA 1MQPA 4UFKA 3S5ZA 4P7LA 2WHMA 1CGTA 3CZEA 4NZFA 2WHJA 2X0HA 3SCNA 3A5VA 1JG9A 2YFNA 4D6DA 4KGLA 2VT0A 4M24A 1W1YA 5DF0A 3ZMRA 1S46A 1VJZA 1KGWA 4M1RA 3F5LA 3F4VA 1MW0A 1MW2A 1SZNA 3RJYA 1BYDA 5FL0A 4B9ZA 1K9TA 2X05A 1JF5A 3GNPA 1KBKA 3DDGA 2UWFA 1LLOA 2J7CA 1W9DM 1GVIA 5I78A 3B9EA 1ISWA 3VMPA 3VD7A 1VEPA 3WD2A 4UZUA 1XCXA 2V5DA 1TR1A 1OM0A 1X6NA 4PEEA 4FLQA 3TOPA 2BHUA 3MUIA 4WSKA 1V0NA 1J0YA 3H53A 2PWGA 3E1F1 1WZKA 1ISXA 1A3HA 2CKRA 5BXRA 3HG3A 1Q6CA 5DFAA 1O7DC 1ZJBA 2WB5A 5CGMA 1E9LA 3MU7A 3VIGA 4D6EA 3EYPA 1TA3B 3WBAA 4HU8A 4DUVA 1E6RA 3W0KA 3WUFA 4UFHA 1N82A 1LJYA 1C8YA 1GQLA 3D52A 1UASA 1GPFA 1HJSA 3WKZA 1GOWA 1VEMA 3D4YA 3T0AA 1US3A 3BUBA 1GVYA 4UFMA 2Y24A 2F7QA 4DO5A 1V6VA 4WSJA 1CPUA 2ZE0A 3AOFA 1WPCA 1W2PA 5BXSA 1E70M 2OYKA 2UY3A 1CGWA 1V02A 4J3XA 1CTNA 1RH9A 4HZ6A 1F4HA 3N12A 3PZ9A 3WD4A 3DX1A 4AIOA 2J8GA 1EDQA 1GZJA 3CMGA 2BXZA 1WDPA 5I0DA 3WQ8A 4NZJA 2YFOA 4NI3A 5A8NA 1MW3A 4CGTA 4H8VA 3BUPA 1MVYA 4IISA 3AZTA 1H4PA 2CNCA 1W9XA 4RL3A 4H7VA 2OW7A 3M07A 1E55A 3VDCA 1JD7A 4W7UA 4TVDA 4Z2HA 4CN1A 1V0MA 2WVUA 4HPGA 2EQDA 2HVMA 3TTQA 4QLKA 4J3VA 1HF6A 5A8MA 5E70A 5AC5A 5I77A 2G8ZA 1HIZA 1RP8A 1QI4A 4UQBA 1UR0A 3OB8A 1R87A 4WLCA 1I1XA 3WY2A 4BQ4A 3VGBA 1C7SA 4DWSC 3EJRA 1W91A 2ZUNA 4AC1X 2W61A 1OT2A 4PMDA 5A1AA 3LXCA 3FN9A 2E9LA 1ZJAA 4OOZA 4PRWA 1B9ZA 1XH0A 2CERA 4GI9A 4IPNB 1PS3A 4R27A 2CBUA 2VTFA 4V28A 1E6NA 1F4AA 3WDIA 3WF1A 2WKLA 1HKMA 1KCLA 4MDPA 4W8LA 5KEZA 4YHEA 4PMQA 3U5UA 2WMKA 1WB0A 1WE5A 5E6ZA 2EPOA 1DTUA 3D4ZA 3AIUA 3T2QA 4OGZA 5A6MA 2X09A 4JL2A 3WBEA 5BWFA 2BY3A 4UQAA 2J47A 2Y8KA 3DHPA 4P7RA 2A3BA 3MS8A 5I2UA 3S5YA 3N17A 3WY3A 3SURA 3VO0A 2W62A 1JDAA 3VD4A 4D1IA 1C3FA 4PSRA 1TA3A 1VFFA 4C7GA 5A6LA 1JFXA 1GW1A 5JUVA 2DSZA 3LMYA 3MI6A 1H0IA 4U5KA 4UR9A 3UR7A 3NUKA 5A6AA 1U2YA 2WVVB 1HXJA 1WDRA 1D3CA 5A6BD 2YLAA 2DDXA 2QPUA 1JZ5A 2EAEA 1R7AA 5A3HA 5A6SA 2E9BA 3WQWA 3T09A 2BXYA 2D2OA 3UCQA 1E40A 2JEPA 4WJXA 2XGIA 3VIKA 3VDAA 3MMUA 1HXKA 4CVWA 4PUEA 1NOFA 5HDRA 1PX3A 2CHOA 5E6YA 3EDFA 3MSGA 4W7VA 5JBEA 4WF7A 1EOMA 4OKDA 1UWSA 1FOBA 2PBGA 4XV0A 3GXDA 2J8FA 1UUQA 2C0HA 2A3HA 4WIWA 1E4IA 4KWUA 4TTGA 4KH2A 2CXGA 5ABGA 2VQUA 1NWUA 1MXGA 3BSHA 1YHTA 4JAWA 5A6BA 1BVNP 4Q22A 4J3TA 1WDSA 4FNQA 4M81A 1V6WA 3U7VA 4ACZB 1ODUA 4F66A 3J7HA 3N04A 3NSMA 3BCFA 3DX3A 4GINA 6CGTA 1LL6A 1ISVA 1J0HA 2DH3A 2OWCA 1V3LA 3ZR5A 5D8ZA 2CKSA 3VU2A 3HMCA 2YDRA 2FDMA 1JI2A 2J75A 2CESA 1MXDA 5A2CA 4D6CA 4XZWA 4N0RA 2Y5EA 4MB1A 3EMZA 2ZICA 1V03A 4J3UA 2PB1A 3VKKA 2CEQA 3IK2A 3EDJA 1R34A 1BPLB 4LYQA 4W89A 3EMCA 2BHYA 3CZLA 3NCOA 5DEZA 1QI2A 1JYNA 1U30A 4U5IA 2YL8A 3AXIA 4CD7A 2XN0A 4M29A 4WKAA 1MQRA 1WAWA 3LPOA 4PMZA 2O9PA 3K8KA 4PMYA 1W9PA 3TTYA 1TQUA 2YDSA 5LYRA 3PHAA 1JZ2A 2OWWA 1JZ7A 3ZR6A 4B3KA 5BXPA 1QNOA 1TCMA 4QCEA 4ZENA 2RGMA 1QPKA 3CZNA 1LL7A 2Y2WA 1MWOA 2XWEA 2G3NA 2IXVA 1VBUA 1J0IA 4JHOA 2WKGA 5M03A 3ZJ8A 1V3MA 3RJXA 3PTKA 2XG9A 2TAAA 1H09A 3WH8A 3VGEA 5LA2A 1V0LA 3LXAA 3EBVA 4MNJA 3WF3A 2AOSA 1QHOA 1KXTA 3GH5A 1I75A 1JXKA 1XSJA 4UOJA 2D23A 1E73M 3CHDA 1H5VA 5CG0A 3K8MA 3TP4A 1LG1A 1ECEA 6A3HA 4PCTA 4LX4A 1H11A 3FAXA 2JALA 2WMJA 2BV9A 1XSKA 3L4XA 3WQ6A 2VRQA 4PTVA 1B1YA 3W38A 1HKIA 2XFFA 1BVZA 1BAGA 3SCTA 3OIHA 2DT0A 4FLRA 2WVTA 3DYMA 1M03A 2PBOA 3POCA 3I3EA 1ISZA 1J9YA 3A3HA 3VIPA 2F7OA 1B3XA 2CBJA 2VX4A 3AICA 4TTUA 1K6AA 2XVNA 4FNSA 3IJ9A 4ACZA 2WZIA 5DT5A 2ZUUA 2WSPA 3RM4A 1JFHA 1EO7A 3D51A 2D1ZA 4NRSA 1R46A 3WELA 2O9OA 3WD1A 1HVQA 4AMWA 3PZMA 1TQTA 1H1NA 2DQXA 4B9YA 3PZOA 1WCGA 4Z2IA 1CXIA 5A95A 1KXVA 4C7DA 1BQCA 3WQVA 2XFRA 2ZX9A 5IHSA 4AEEA 1CGXA 3AIWA 3CMJA 3VSVA 3SCRA 1HP5A 2FGZA 4UTFA 1TMQA 3N15A 4UFIA 4QLJA 5CQ1A 4JCLA 3PZIA 2ZWZA 4RE3A 7TAAA 2BVTA 3MUZ1 4URIA 1AQHA 1JD9A 5I24A 1YQ2A 3KZSA 3WH6A 1L0PA 2OWXA 3ZSSA 3WNKA 1Q6DA 1OD8A 4Y7EA 3AMGA 2ALWA 1UR8A 1W1PA 1R85A 2J25A 2O92A 2DIEA 4JFVA 2XM1A 2WC7A 4ZE4A 3NJ3A 1GUVA 4J27A 2YJQA 3RMEA 2CPUA 4E2OA 3AS2A 5LA0A 4W88A 2ZXBA 3ARUA 4H41A 4UQEA 3ARTA 3B9DA 1H49A 2WCGA 1EDTA 2XM2A 3AS1A 1GOIA 4JFTA 2VR4A 1Q4NX 3TV8A 3VIHA 1XD1A 1PAMA 3CHCA 3AMKA 4IM4A 4ML4A 5C70A 3N1AA 1UKPA 2DH2A 2WBKA 5HNNA 2W5FA 3O9NA 3QGVA 3THDA 3UR8A 1BYAA 4F79A
chains in the Genus database with same CATH superfamily
4L3ED 2QVIA 2D7NA 1ZD6A 1ICQA 5HJBA 4WK9A 1KIUB 2QIWA 5IEHA 3CNYA 3HBQA 4LZKA 5JW4Q 4PJAB 1P1ZB 3C6LB 1FNSH 2F8XC 5H8PA 1GYCA 4PV8B 3MA7A 1OOWA 3GF8A 5DUPL 2ED6A 2XRAH 4BK5C 2IO5A 4ETQA 4J3WA 1UADC 1HJXA 5A69A 1WKYA 1F3JB 1MFDL 4JN2B 5EEWA 4B9KC 4XZBA 4G8IA 1E4XI 4XNUL 3QWRD 5DEJA 4JKPL 2FR4B 1IAOA 3OJDB 3BGGA 2F1AA 3GDRA 4GP4B 4ZUVB 2PYED 4YE4L 2JCCA 4A22A 3GYRA 5D1XD 5CGYC 1EAQA 2AEQH 1B31A 3KPRD 4DK6A 3H2QA 2W07A 5E94B 4XX1G 3Q6GH 1CBGA 1UWTA 3FDGA 2OMXA 1SDDA 4N2GA 1C9DA 3WFCL 2GOKA 3KPLA 4I4WA 3UO1H 2E46A 4LT9A 2PCPA 4C83A 1OCWL 3X12B 4ERAA 3K5XA 4I9MA 3EDDA 2MANA 3B5HA 2W0KA 4E2VA 1KJVA 3V6OE 3OR6B 4I48A 1XR8A 2VABA 3FB8A 1ZCOA 4WGHA 1ZENA 4HWEH 1T99A 4LYPA 1MRFL 1QFWH 4MA3A 5A16B 4AG0A 1XIWC 3GKAA 3A6BL 3KEDA 3F7VB 4HEMA 4OF7A 1OSEA 2XZAH 3MKKA 3H7LA 4HKPA 3RU6A 4NQXA 4ALAL 1FVDA 2BOEX 4QYOA 4TSCH 4LHUD 2X9ZA 4OIFA 3TJ4A 4O4VA 5EZIH 4MAYC 5TE4H 3KS0J 3QLDA 5AW1B 1Q38A 1GOQA 4LEOB 2WOQA 3E0LA 1HQRB 4KRTA 1OWRM 4PMXA 4YXLL 1TQVA 4RGNE 1RALA 1ZLSH 4DKFH 2JK5A 2DQHL 1IE7C 3EJSA 1A6ZA 4HN8A 3K3QA 1R2TA 5I1IH 5BW7A 4CEUC 3IKCA 3DLQR 3TTSA 5IG7B 3EPNA 2WO4A 4N20A 2QGCA 3IFNL 4UQ2B 3D3VB 3WY4A 3TQKA 4XCEA 3WY1A 2VCAA 3ZDZE 3RA7H 4BCXA 4Q58C 4X22A 4NOBA 1BYNA 3SQMA 3QR2A 1YPZF 4H8PA 2NDFA 4N1EA 4PJFF 1CJYA 1AQFA 5K2ZA 3AHVA 3QIBA 3P30L 1EIBA 1PIFA 2L7UA 1OPGL 5I1GL 4XAFA 4H5SA 3CIWA 4OJEH 1MRQA 1IAMA 1TVBA 3QYNA 3CZ8A 1HZKA 1IFGA 2WO2B 5T1MB 3ARED 1FYTD 2GIYA 2GUOB 5J13C 5D1QC 3TBWA 1UR9A 3LN3A 1G43A 5M1TA 2J8UB 5I8KL 2E8YA 2DLFH 1BSLA 3TCLA 3UACA 3RWDA 3O16A 3SADA 4HYVA 3QKEA 3CFKB 2BWGA 4Y9PA 3ZU8A 3K6DA 5D7KD 2A7BA 4GW1A 1A47A 2GJ6E 2X0SA 5CUSL 2FEDD 1IU1A 5IZ7A 1JZDC 1G5GA 4PJIF 1AZCA 4WSGA 1QNSA 3SQSA 5BJTA 1DQQA 3FYYA 3UJJH 1QAWA 1TV5A 2X2UA 2D3JA 1CDBA 3ARBC 2CKBB 3A23A 2C16A 3BGFB 3NL2A 1XR9B 2WNQA 1XINA 4XGZA 3BEWB 2WVVA 4KI5C 1PZ3A 5LXGH 1CE6A 1JK8B 2XCMC 1B3VA 4EWND 1A4BA 1BXCA 1CYWA 4FOJA 2Z1VA 2YZ5A 3W6YA 5EUOB 1NANI 3ZHNA 4AEIL 4DPBX 5AB1A 4ODUB 1MVUB 4HD5A 3VFNB 1TO3A 3HHMA 1QSEE 1FWWA 1GIGL 5HANA 5D38A 3R10A 4TN9A 1BJ8A 4DGUA 2Y5TA 3ORWA 3CFBA 4GD0A 2R69A 2ZOOA 2GBUA 1MHHB 2QVKA 5J8LA 1A4CA 4KOBA 5KUKA 3W84A 2BSSA 4IZGA 4PS4H 1ME7A 5EF3A 2DU2A 2JWYA 3AFLA 4Z95H 1R0AL 3ERXA 4B9IA 2CLEA 5C09A 1WSST 4ZQMA 2X4SB 2W38A 3O8XD 1VC4A 3MZGB 2X7LA 1WTLA 3S96A 1CGVA 2QLVB 3QA3A 5B3JF 1KXVC 4MLIA 4NO5A 1LMIA 1KWGA 1NUNB 4G1MB 2QAFA 1N4XH 4IOFC 1BGAA 1GVOA 3BE7A 1X5YA 1EC9A 3WEXB 1BBDH 3HS8A 4JCMA 5DMYA 1XX9C 1M7XA 4YTQA 4F37K 1J11A 2C3VA 3QY8A 4RFNC 3X3GH 1SM3H 5AKSA 1MLBB 2YAOA 2Z92B 2BOBB 3LRSB 1TEFA 3PFQA 3L6FB 5K59F 3URBA 2NXYD 4W5UA 2WXHA 3ECUA 4AIBA 1SUXA 1XLCA 2XV6B 4ZXBC 4XP9H 4XD3A 1HT6A 4P8QA 2PW2B 3EDKA 3HU7A 1WX0A 2H9AA 3VTRA 1N2RA 1WDQA 1NSNH 3ARDB 1T0MB 2JIXB 3SGKA 4WGVB 5I66A 5HHQA 4CD8A 2ORBL 2G0KA 1IAIH 1B6UA 4P57B 3WNNA 1SHXA 2NY5H 2ONEA 1VZGA 5E6RB 1ZHAA 3JT2A 2J73A 3MKCA 2DIBA 5TK2A 3QUYC 4MYPA 1NJJA 3S1UA 1SY6A 3UWWA 3KPPA 2VENA 4XNZB 1ND0B 4PRHB 3EX4A 1X6UA 2ICWI 1M68A 4YSDA 4QI3A 4Z78B 3HQPA 1P7HL 4BZ1H 4UTAA 1XF2B 3HBGA 1S1PA 3G04B 4HIQA 3QDAA 3GNMH 4U7MA 2OZNA 2VR7A 4NYLA 4FFZA 3JVGA 4PR5A 1TJRA 2VQ1A 3WD0A 2B0MA 4PJ7E 3HKFA 4O2CA 4FFYA 1KCWA 1XJBA 5DLML 1I1WA 3CASA 4LOUC 1EH9A 4GXMA 1LEIA 3WQCA 4FQXB 2Z25A 1DL3A 3T0EE 2W4XA 3MDJA 4UQCA 1BTMA 1LILA 3PWIA 3F4WA 7CGTA 3QUKA 2NUYA 1J9SA 4XC3H 2QCFA 4KTEL 2ZQKA 9RUBA 2CJUL 4HA1A 2YD6A 4RDYA 3TBVA 5FV2A 2WQRA 2V5TA 3WTVA 2CDGB 4NPKA 3PB2A 3HZ3A 3MLTB 5GRUH 4GUGA 1EXUA 2NUXA 4Z08A 2M26A 3EOAB 1XFBA 5IK3B 2XVGA 5AL8A 2HX9A 4R90L 1QYGL 1DANT 3T40A 4YZWA 4P2OC 4NCC2 2IKGA 5JIKA 1FH9A 5TF1H 4HGKC 5D93B 2G30A 3C09B 1TCRB 4B6ZA 2DBLH 1OCQA 3QKZA 2EC9U 4CKQA 1TPB1 4MYXA 1DZBA 1I3GH 4GXUN 3FU6A 4J3SA 4NNCA 4ZMGA 3FO9A 1SFDA 3PSVA 3QEUB 3DX7A 4MMXC 1PFCA 4QE4A 5F2LA 4C6OA 3NQMA 4DP8X 1NOAA 4KAQH 3C5ZB 1KM6A 2I1OA 2IALA 2QR0A 3F5JA 4GSDL 2HJLB 5MP6L 3L7EA 1E4XL 3O45B 2IDUA 3MRJB 1R9XA 5J89A 1T2QL 1TUPA 1XSOA 2PPDA 2H41A 4IIQC 4WCJA 2FJFB 5D7EA 3LCXA 3ZO9A 3MMDA 3OLGA 4DF2A 4GRWH 1MDRA 4OD2B 3DX6B 1ELSA 2IAND 2A85A 1B0RB 4WU7A 1TJMA 2DQFA 3KJ4C 2V3FA 2Z7YA 3OQEA 4BQCA 3GG0A 5IOPA 1INEL 3T3PE 3P82A 2MNUA 1P7KA 1V6XA 4JO8A 2P5WE 3DO7A 4Y9AA 3UCRA 5DUPH 3U6XA 3GNRA 4YTUA 5C0BB 1CBJA 1KTDB 1MF2L 1F61A 1UB3A 3FFSA 4ENEC 1MFVA 1YDVA 4LVHB 2NLJB 5C0GA 3DOSA 1NCUA 2P80D 1TJ1A 4PREA 2YD7A 4XNUH 4CQ8A 4PP2B 1IWAA 5JPMC 5B1JA 1KLGB 4QHLA 1Q6EA 1J0JA 1S7WA 4YE4H 4AYGA 4HNNA 3FS9A 3F7PC 3M17B 2WY3B 4MPKA 4QS6A 2YW3A 5EU6E 3P62A 2B39A 3BIKB 5EC1B 3L4VA 3T8QA 4P5TA 3AXXA 2AQWA 5K9QI 3WFCH 1G7LB 3IPBA 2CLMA 4ADGA 1OCWH 4K8EA 5LHEA 2BH0A 4ODXA 3KYNB 3GNNA 2WJFA 2VYOA 3TX9A 3H3PL 4F7CB 1EBPA 4EPSA 3WIIL 4N26A 1K7EA 2VELA 2WUBH 2VGLM 3H9SE 4HK0B 1MRFH 3N41B 4F15C 2AL1A 1RZGB 3DHJA 1DEDA 3QJZA 4YSRA 1RUQL 1KV3A 1Z3GL 3T77B 4ALAH 3GK0A 5KITA 4J4PC 5DUML 3II3A 4HX1A 5CAHA 1PEZA 2FTAA 4QROA 3Q43A 2H6UA 2QPSA 5HQEA 3NSJA 3DESA 3MP3A 3OKOB 3DUSA 2OZ0A 3QIWC 4LRNL 3NJHA 4AZCB 3HI5L 4LS2A 1OB1A 1RZIA 4YXLH 2DQHH 2CALA 1H3GA 3L13A 1AYOA 3BPNC 4KKAD 2BVYA 1PYFA 4KRNA 2E1WA 2P24A 4R96A 2DQIL 4HJ1A 4MMWA 4KFMA 4Y4FC 3I6GB 2JKEA 3MV9D 2XHNA 3JWDC 3IFNH 5I6OA 2AHIA 3C5SA 3A12A 1F73A 3U25A 1NAL1 1J5CA 1RJYB 2VO8A 1XGPA 5IJVA 4GW4A 1I8UA 1OXYA 3BKJL 1ZBVA 1P2CB 4QY8A 2XI9A 4GX9A 3CPLA 1WWBX 1HKFA 3D47A 1RBOB 3E0FA 1OPGH 5I1GH 4HUXA 4NI8A 1AQDA 2VL5B 3G24A 4M1RA 4H8WC 5L4FA 4TQPA 4FI7A 1NDGA 1UBSA 1U3HA 4UTLA 3N0PB 3R06A 5BXFB 3K2KA 5KANI 2AQVA 3CDFA 4OGAD 1OK8A 1H3UA 1SR9A 5BOPA 3S48A 4CADB 5I8KH 3M0VA 1EZSA 3OBEA 1N12A 4PB4A 3E02A 3NCMA 3EH4B 4CQ9A 1YE6A 1V0NA 1ISXA 2XWTB 4I1PA 1ZJBA 3HIZA 3OPSA 1AIFA 5D1ZA 5CUSH 1BZ8A 2Q8ZA 3GS4A 1P1MA 1MEWA 4DBSA 2BVOA 4KI1A 1T6VN 1HJSA 3ITXA 5CEYB 1W2PA 2J4WL 4EXBA 2BSED 4OFVA 3IJDA 4ZUUA 3PZ9A 5I73C 2CLKA 5CBAB 2X4PA 4L9YA 3U6RA 3CMGA 4DEUA 3K74B 2JKIS 2I7OA 3C8KB 3TH2T 4IOSA 1MVYA 3AZTA 4JZNA 5HI3C 2EEFA 4DPRA 4AEIH 4Q6JA 4L37A 4M6VA 2RCSH 1JD7A 4CN1A 1U92A 4ZOCA 4LVDA 4HHMA 5CPOA 3W71A 1HF6A 4K4KA 1K02A 4G9FB 1GIGH 1PUDA 5IMLA 1XF3A 3PHOB 3ITVA 5E24E 1YW1A 3WMQA 1I1XA 1O95A 1S3TC 3GVGA 1QASA 1BBJB 4KITB 1TREA 2E9LA 3HZVB 1ZJAA 1XH0A 4NEHB 5DMJB 4G7YL 2VEMA 5KEZA 4PG2C 3U5UA 4H1LA 3C6LC 1WB0A 1DTUA 1GZPA 4UDTB 5KTEL 4MZYA 3TNMB 3T2QA 1R0AH 4DETA 2IDTA 4YSTA 5DHVA 4OLYL 1C3FA 2X4QA 2DW7A 3COOA 3MZTA 1I4FA 2XPYA 2PLCA 1WDRA 4L5ZA 4LEXL 1AANA 4DP7X 1Z9NA 1NCIA 3V0FA 3A3WA 3FB7A 5GGSY 2OR7A 4F8OA 1T21A 1PX3A 1FTXA 3EO1B 3TW7A 3VFRA 5FPIA 3TYGL 3FIGA 3FQRA 4L2YA 2CXGA 3UJIL 5FB8A 2VQUA 1P5BA 1EGJA 4JAWA 4OUUB 2J57A 1WTGT 1YMHB 3EJYC 4UTJA 4UQIM 1ES0B 3D85A 3GHTA 2R0WL 4PE8A 1GVQA 3A4FA 3QUXD 5IP4A 5D8ZA 1MWAB 2W9EL 1QA9A 4MPQA 1L6ZA 3ASOB 1XWYA 4D6CA 3NCCB 2PB1A 4Z3FA 2HKFL 2CEQA 3HLKA 1DCLA 1RU9L 3IK2A 4WWKB 2AL2B 1BPLB 4CSTA 3SYCA 3UAEA 5L4JA 1NPUA 3ZKXB 3GSNL 3B05A 1YEKL 2ORBH 2NXGA 4GUOA 2R9HD 4WTWA 3KCOA 1LDPL 2Q09A 2O9PA 4B3EA 2XG4A 5G2HA 4B97A 1E4WL 5ABZA 5I0WA 2NNAB 1U8IB 5EBMB 4K36A 4R0LB 3P54A 1FG9C 1RIUL 4DJFC 1IKNA 4F58L 3GZQA 1OF8A 1G7JB 3QPQD 3H7RA 4MNJA 2G5UA 3CHDA 1SYVB 3RAJL 6A3HA 3LZ5A 2GPTA 2BNQE 1XF4B 4TQHA 4IMAA 3P77A 2E6PA 2OELA 4NL1A 4ZYKA 2PCFB 2CR0A 3EYSH 1BWLA 2XVNA 2YAHA 3SN1A 3BI9X 4WHTA 2Y7FA 4HJTA 3CH8A 2KX9A 4KTEH 1R46A 4LQFH 2CJUH 2NUPB 1P0SE 1BZ7B 3PHSA 3H7BB 3I9IA 4IRSD 2HAZA 2P45B 1KGCD 4JDEB 1H62A 4QLJA 2OQJA 4EIGB 4S2SB 3TZVB 2XV2A 1VGKA 2ZWZA 4R90H 1QYGH 3VQLA 3RVUC 3OAZH 2Q86A 1VLIA 4GP8B 1A80A 2X40A 2XYCA 4RSVA 3G1HA 1PU0A 3RYMA 4HWBA 1RSCA 3QORD 3GNXA 2BTMA 4IMKA 3BZEB 5EU3B 1B57A 4FEIA 3AS1A 3BMXA 3C60B 3KYAA 5SWSD 3KOXA 1WXYA 1T83C 4Q4QA 3RWCB 4DVOA 2NY4B 4GSDH 5IQMA 5AD0B 5MP6H 4GNVA 3W7RA 2E7BA 1E4XH 4Q6IC 1WBZA 2F8VA 1I6NA 1T2QH 4PRNB 1EB3A 3RG6A 3W9EA 1X98A 1OIFA 1OIMA 5D6DA 4LAMA 2V2DA 4OQ1A 2ZIDA 3ARQA 5CSUA 1ITCA 1CI3M 1BVLB 4DXXA 3IFPA 1W0YT 2BHFA 4LNVA 4NNPL 3TFBA 4Y5VC 2VEGA 5EIQA 4DPCX 3SPVB 3BAJA 3VXME 3WUWA 4CU8A 1INEH 2UUDH 1S7VA 3RCNA 4PTTB 2MHAA 4WFHE 4M43L 4WW1A 2WSKA 4CC4A 3U2IA 2NTSP 4TNWF 3BZ4B 4FDWA 2YKKA 4FTVA 2OYPA 1MF2H 4C1KA 3CE1A 5AB0A 4DF9A 3ARFB 3LSCA 3L17A 3MOBL 2EDYA 5HGHB 4KTYA 1LHZA 2FO4B 1DUZA 2VXTL 3QJVB 2H9GB 4NN6B 3APMA 4XZUA 2V3GA 4U3AA 5EU7E 5TDNB 5T33L 1GKRA 5M95B 2YRLA 1S9VB 1JWMB 2XFWA 1IQDA 2HT4D 5HYJB 4F0KA 2VLLA 1B9BA 3CHPA 3ECVA 3BUIA 3UG3A 3WBWA 2QW5A 3WN5C 3UBXA 1G87A 1CGYA 1WBXA 1TPC1 2KHAA 1YEJL 3USBA 5T1LB 1N7ML 3TBSB 4FNPA 5INDB 2E7MA 3H3PH 1KLYA 4NJKA 2OI9B 2NZ9D 4NSBA 3O3AA 2BNUB 4QEGA 2WB7A 5HGGS 4DHGA 1OD9A 3T4AA 3WIIH 3PNWB 1QOXA 4AQAB 1UEYA 1U8HB 3D50A 4DERA 3ARDC 1OGAE 1HL2A 1RUQH 4CQAA 1Z3GH 4CLMA 2X8RA 1WZ1L 3WS6A 3UY8A 5CMAB 5DUMH 3HNTL 3WLBB 4GO6B 1ZVYA 1PZAA 4B7LA 4BCEA 2HN7B 4H25B 4LRNH 4FLHA 4XNZC 25C8L 3HI5H 4NKDB 2VITA 3KEHA 1NM4A 4Z7VF 1KT2B 4IGNA 2G2RA 1TZ7A 3N1PC 2H90A 5DMMA 5RUBA 5CGTA 2D9CA 2DQIH 1GZQB 5TDPA 3TEWA 3N9KA 4HIIB 5DGRA 4Q89A 2JQMA 5ESAA 3ARSA 4JKNA 2AGJL 4Y9NA 4LAKA 2MMXA 4GQGA 4LEFA 3HGOA 3RN6A 2DJ4A 3LEYL 1KGXA 2C91A 3MFGB 3DKJA 3SD2A 2F5BH 3BKJH 4LNRB 1OAKL 3OBAA 2I9LA 1WCBA 1ONQB 2APVA 2Q7YB 1EZWA 3W81A 4TIMA 2EJ1A 1UJ3B 4FNTA 4CBZA 2EIBA 5A2JH 2OLAA 2WLIA 2X1RA 4IMGA 3TVMD 4BGDA 1WQ5A 1ADQA 2BJML 3CAKA 3ECBB 4LPUA 4QRSA 2VDOB 1U8CA 2ED7A 3V18A 5EO0A 2OMBA 4BM7A 3FB6A 3G1DA 4LYRA 1LQSR 3UERA 3SI9A 4Q74A 2IAMB 4JYFA 3CAVA 1NANH 2CUHA 3NQ7A 4IJTA 4NRXA 5I17B 5J3HD 2CWNA 3UETA 4GCXA 1WFTA 2OK0L 3ONBA 5BW6A 2MCAA 4JGMA 3C09C 3S83A 3DZ1A 3HBPA 1OAXL 4R9HA 3VFGL 1A6AA 3EB3A 3GDBA 1NIEA 1O7VA 1CT5A 3LH2L 3NJXA 4L8DB 4L9ZA 4JFFA 4QQUA 3C08L 5T3ZE 1AH4A 1HGWA 4YHIB 2J4WH 1BFNA 1E8XA 4N90D 1E6XM 5IDIA 3C5ZC 2ZUWA 4BWLA 5J1AA 3BVWA 1SLVA 5I0YA 2CLFA 1NOWA 2V5MA 3OW1A 2BOFX 1CFTB 4S1DC 4AD0A 4HNUA 3R6IA 4X9YA 1NEYA 2WWOA 4DQWA 1G7PB 1EJUC 1QNRA 4K5PA 1U8NA 3AMDA 2JJSA 5IEKB 1UD4A 2O9TA 4E4FA 5G4OA 1U1JA 1UD5A 1OP5H 3VXRB 3V5OA 4UMGA 3UTTA 4C5YA 3JWDL 3MRPA 4PH8A 5KTEH 1UYQA 4NRZA 3DYOA 3NQ6A 2BSTA 4PRIB 4TUJA 5FJOA 1T80A 5E8EA 4MBRA 2XTSA 3O3EB 4FHKA 4AZGA 2YXVA 4LVHC 3NRFA 3WNJA 4OLYH 3TEZA 4O0KA 5HWMA 2P46B 5ID0B 2GBVA 1CDIA 2QKSA 1O1HA 3PZUA 4R7JA 1FL3B 3EYFB 1GT8A 2JI1A 4LEXH 1QEWA 1NAMA 2BOCB 4H8WL 5FUCE 3RNDA 2WKOA 4G8GE 2Y7DA 3JBG7 3X1FA 2EKSA 4PBDA 1KPUB 4CAGA 5EZOL 3TYGH 1ZBKA 4NQDE 5IF0A 2WZEA 3WUBA 4WEEA 1MQQA 3UJIH 2ACSA 1DWHM 4BQ2A 2A6DA 1BIIB 4L5FL 2UY5A 1J7VR 5KZCD 5IHBA 2R0KL 1QATA 1PQZB 5I1HH 2R0WH 4PJCE 3IANA 5DJCB 1CB2A 2W9EH 1HHIB 5U4NA 1UD6A 1PZ5B 4B9GA 3RFZB 5BQ7B 1QNZL 1WBYA 5J11B 2HKFH 1Z66A 3BGJA 1RU9H 3GFXA 4ZR8A 5E5UB 4N22A 4TL4A 3K72B 3MFFA 3GSNH 5DLLA 1YEKH 4I6VA 1PW3A 3AXHA 4A55A 1LDPH 2A1WL 1FH7A 5KS9E 4FYRA 5EGRA 1JVOA 2V5BA 1VB9A 2INFA 4AWSA 1E4WH 4XT1C 1D5MB 2I69A 4CEXC 3M5YA 1J8HB 5T26A 2ZXDA 1JRCA 5E1IA 5D6CB 5DK3A 2PWUA 2R2EA 3WF4A 2WQ8A 1RIUH 3WG6A 1OADA 3SIKA 4PCNA 3U0HA 4F58H 1UOLA 2E47A 4XD5A 1A0CA 2WVSA 2VM4A 4P23D 3KVDD 1NCAL 3C4UA 2W67A 1JYXA 3IU4L 2N7SA 4Y5XB 2YGNA 4XO9A 5E8PA 1EMTL 1MZRA 1UOKA 4BCYA 4HIJA 4O50A 3FTGB 5I6KA 4XNAA 1MI3A 5A94A 4N2HA 4L6OA 2WQSA 4JN7A 5DBUA 2EGZA 3BGMA 4RDWA 4AZ5A 2N7BA 3WJWA 3JTSB 3RO8A 2OEJA 3T7VA 3FCTA 2ZNWA 3KYKL 3L7FA 2VC2B 5HD8C 2CDEA 2MPAL 1B3OA 5HNUA 1U2CA 5D02A 4BFEA 5CEZL 3KDPB 2VCCA 3BZJA 5H35A 1EYWA 3AXMA 4P5KB 3CT7A 3W28A 3OXRB 5GJTL 2CBVA 1ICTA 3FQNB 3TTOA 2YHGA 2A4ZA 3K4DA 1I2QA 3VKJA 3RPTA 1HXMB 4WDUA 2XU2A 4INFA 2HV5A 2ALAA 4GT7A 3PDOB 3G1XA 3GLDA 4P4KB 4PCFA 1HWWA 4W4OA 3VDGA 1NFGA 3LTSA 1E6JL 4MJIB 1MG2C 3D0LA 3PNZA 1RFDL 2IXQA 4WRHA 2J7GA 4X6DA 4F2MA 3RKDC 4HP5A 3VRLF 1HVXA 1FNGB 5HI5D 4PCPA 3K81A 2JKLA 2Y25A 3ZTJG 4UU9A 4DFIA 1FGVH 4Y9BA 1VADA 1INQA 2VZUA 3EOLA 4HUVB 2E56A 1WFNA 2GSIA 2X2YA 1H6UA 5L6YL 5D2TA 4OFKA 2Y9RT 3VXNA 1T1XB 1T4KB 3V0SA 4R5EA 1TVHA 4M3PA 5K9DA 2Y7SA 2AQ2A 3WIFB 1U5HA 4DBUA 4NNPH 3LU2A 3F2CA 3T9WA 5EFDA 4KKRA 4UYQA 5F1NB 4QGYA 1ML1A 5BNKA 2KZBA 4XI5D 2OR9L 4X50A 3FQ4A 3HLAA 4M43H 3DI1A 1T66C 4JBSA 2QCDA 4JUSA 2Z2AA 4R2GC 3FO2B 2N59A 3IE9A 1N59A 4XZMX 4XMVA 1MCQA 3MOBH 1P9MA 3S4SG 4W9HC 3GC3A 3SW6A 1E3XA 2VXTH 1L9SA 2KYIA 3GG7A 4MADA 3PDGA 2HT2D 1OFPA 1XIEA 1FWGC 5T33H 4PTUB 4LIQE 2F68X 3W9ZA 1O4UA 3GRWA 3PWUA 2ZUVA 5DHMC 3DSNA 1E5ZA 1U22A 3D2UD 4R7OA 5E5MA 4LNCA 2I14A 4JAMB 3RTQB 3W7KA 5JXEC 3ZLHA 1DCEA 3QJQB 5I0ZA 4XH2B 1O12A 2VDIA 1QUNA 4IBUA 1N7MH 1IE5A 3UBGA 5M7QA 3N4AA 5D9NA 3UT0A 1EL3A 3MJ8B 4UNTA 1G4TA 4H9ZA 3RHWK 4K3EL 4UTWC 1N6UA 2VFFA 3QBUA 1BX2B 3UTPE 4WWKC 5TF0A 2X87A 2CKBL 4WUUE 1DWJM 4EI6B 3ZKXC 4B92A 1WZ1H 2MCPL 4K94L 3HNTH 1E4KC 2G60L 1CFVL 1QLRA 3DC0A 1I4NA 2IWGA 2WBJD 3P11L 4Q2ZB 1IEVA 4QD2E 3SDDA 2CU0A 1WAPA 1HDMA 5FA5A 5LNUA 1S78D 2Z34A 1L7IL 25C8H 1KB5B 4BE5A 2PDHA 4A35A 4AF0A 4NQED 3W37A 2PXYA 1THCA 3X1NA 4ECNA 3TFKC 4KFPA 1YAZA 3MNVA 3HAEA 2A2IA 3X3FL 4RRPG 4ICCX 4B5XA 3FH8A 1PE1A 5K9OA 3PJXA 1JZFA 1ORSA 2P7TA 4D0DA 2C4FT 3V16A 1F5WA 2GJZA 4M7SA 2AGJH 3W7DA 1P4LA 3QUZC 5F72S 3EB2A 3ILPB 3S8GB 4M24A 4GMTL 5T3XE 2HMID 3UZEC 3LEYH 2ZCKL 1MW2A 2W95A 3TJPA 5J7CC 3S9YA 1OAKH 1L0XA 3KWTA 2O93L 5BZZA 1GVEA 2VW4A 3KPNB 3STCA 5B4MC 2XACC 1KELL 4F2TA 3Q48A 2BS8A 2H7WA 3VD7A 3WD2A 2UZPA 1XCXA 2VLRD 2V5DA 1LNUA 2R1NA 1YADA 4M8QA 3SBQA 3BYYA 3E80A 3FT0A 4XSMA 4XZHA 4LB8A 2BJMH 1WZKA 3O2WH 1A3HA 4B4HA 5DFAA 4IQJA 4YLQT 4AE0A 5DK0B 4HFWB 2YBRA 3R8BB 3KPTA 5IY5B 4HG4K 1I7UA 2Z31D 1R5WB 3HC2A 4U28A 4DKAA 3M1CA 3T0AA 5FO9A 5BOOA 3NJVA 2P5ED 2EG7A 3TZVC 5CSZA 5ISZD 3G08B 5BXSA 2OK0H 2CO6B 2VDQB 3V6ZB 4ZUTB 1OFAA 4E8GA 4DP9X 1EDQA 4BKLB 3CYJA 4HWNA 1NDVA 3VFGH 4NI3A 1FVCA 5EIIB 1DV7A 5FFLA 3LH2H 1GEHA 3CK0L 3KH4A 1UT9A 1H4PA 1WUEA 3VDCA 3C08H 2VAJA 4N8CL 5E9DB 2MWCA 3BG3A 3GIQA 5AN7A 2GGJA 2HVKB 3C60C 5ETUA 4FN0A 5EPMB 3LQZA 1RZJC 4N0CC 2NY4C 5D4QA 2E75C 2E86A 3OL2A 3KYOA 4FA6A 4OOZA 1I1FA 2HLAA 4KHTH 3SM0A 1UZ6E 3KG5A 1MFNA 4QEHA 3K5RA 2NY3D 4H7ZA 3ARGB 4WKXA 2L0DA 4JL2A 4OVVA 5E8NA 2J47A 1HH6A 4P7RA 4CMMA 5IB4A 3NQEA 1FKXA 2P8CA 4C7GA 3C56A 4OZIA 3JWDH 4BEIA 1D3CA 3IVTA 4F2EA 2PGFA 3MRHA 1LO2L 1SYSA 1WA1X 2XGIA 2X89D 2VGBA 2A3TA 3BP4B 3ARFC 2CHOA 2IH3B 2ZZ3A 4JZJA 4XCNA 2PBGA 3OKEA 4M7ZB 2DYSB 4Q32A 3QXDA 4HCGA 4OV5A 3W86A 2DZWA 5A6BA 4KESA 1WDSA 4X6CA 4BI6A 3QYMA 3U7VA 5ID1B 3SDXF 4AMAA 4DB7A 4H8WH 3EXLA 2K70A 5T8IA 5FYJE 2OWCA 2H3DA 3PTDA 1FI8C 2F74B 1VESA 5EZOH 2IOIA 3AGWA 4YLWA 2H6PB 2OMZB 5E93A 3VKKA 1HE8A 4WU5A 5C0AD 3BICA 1FH5L 3CZLA 4L5FH 2YJLA 1PG7W 3O4OB 5BRZD 2WMPB 1BXNA 4Z7NF 2R0KH 2XN0A 3SZKC 4BJHA 3SYOA 1WBJA 1BECA 2VYRE 1DJWA 4O17A 3IJEA 1VYSX 2CLRB 1QNZH 4QGCA 3HE7B 3MRQB 4QCEA 5FX3A 3SYPA 4MXVF 2P1FA 3O07A 3SPGA 3MJ7A 5DRWA 4JHOA 1A7QL 2F9RA 1JCVA 1FNHA 5AYZA 4XTRC 4IS6A 1TX0A 4RWYL 1P7TA 1TQJA 5AC8A 3MRFB 3B7SA 3DARA 5SX5H 2A1WH 4WI6A 1S5VA 4MD5B 2FVLA 3ATDA 2D23A 1OE2A 4EI0A 1ZLUK 3BZDA 5CGQA 5C0EA 5TDOB 5AB2A 1I8KB 4HF5L 1YDPA 1JF1B 3DCPA 3NRQA 2CCWA 5HUPA 2PBOA 3I3EA 1J9YA 3RVWC 1B3XA 4I1NB 2EH7L 4TTUA 1NCAH 5EKYA 2WSPA 3IU4H 5DELA 3I50L 3P8IA 1EMTH 3PZMA 4QRFA 3D39D 4JPGA 3VH8B 1CXIA 2EJAA 1FE8L 3TO4B 4XAYA 5EC2B 4MVBD 5JMUA 4PJFE 5HHOB 2Y62A 4KU1A 2B9AA 4M7KH 2WOBA 5KSAC 1S1RA 1XB3A 2A6JB 4ZMZA 3MBWA 3VRIA 2OMWB 3PZIA 1U8MB 3HQNA 3PK7A 4BFIA 3TA3B 1UJ3C 4FXFA 3B8YA 3HPJB 4IIBA 3CAQA 3KYKH 2MOVA 2OWXA 2MPAH 4LK4A 1BV8A 3GHEL 5CEZH 5GGTA 3EX6A 1DE4A 2BZNA 4A6YA 3ZTEA 2XM1A 1RH8A 4JM0A 5DRZA 1A49A 5GJTH 2X2GA 1GUVA 1FFOA 1XM3A 1LBLA 4BSWB 5LA0A 3W01A 3FO1A 4IXXA 2OT1A 4PP1C 4S11A 1YN6A 5CSRA 4I9WD 2Q9OA 4JPVL 4ML4A 2QGHA 1VQTA 1TF4A 4YVUA 3WJSA 2H6RA 1UATA 4W9GC 4MSWB 4HCLA 1HYSC 1E2WA 2W91A 5MEPA 1L9PA 3FOMB 2NYKA 1UZHA 3H0TB 1E6JH 4L6DA 1FO0A 1RFDH 3NIGB 3REQB 1PB0A 3K1GA 2DS4A 2DZXA 3FNKA 4BR1A 3FVMA 4Y89A 4GKTA 1UXWA 5KSVA 3K80A 1RSFA 4KVNL 4LDEB 4XIMA 2PTTB 2A73A 4PN6A 4LF1A 1OK4A 3QQ0A 5BZDA 3L4WA 2EINB 4XOEA 1VGAA 1OFDA 5AG9A 3T71A 2NY0B 5L6YH 3QZWB 3KPSB 2E3ZA 1IKOP 1CR9L 1KCUL 3VFVA 1W2KT 3G22A 3WLOA 2NUTB 2YBVA 3WLTA 1EJ6A 4P2QB 1AZBA 4NO3B 3WJLC 1FFPA 1EEPA 3H9ZA 3COTA 1CD1A 4PJ9C 4RESB 5L2KA 5J4MA 4OJYA 5BVJA 4TUKL 3SQOL 1KNOB 2Z1BA 2OR9H 5FKPB 4BH7B 5IQNA 4O51A 4ZO6A 4XPHL 1TTFA 5FW7A 3W7HA 4BSVB 4HUUA 5LA1A 3GMPB 3B9AA 5KMYA 1ZT1A 2AITA 3FN3A 1DVXA 2WANA 3F7YA 2CZVA 1BQHG 1W0WB 1EVUA 5KN5B 3H54A 2OTPA 2E25A 4N2NA 4RZCA 5C0CB 1CD9B 3TEXA 3KPQA 2Y7EA 3CX2A 3CHEA 3EX2A 2Z1XA 2R59A 1X8FA 4N5ED 3CL7A 3P69A 3D5HA 4HNVA 1A3WA 1OX4A 2NY6C 1T8XA 1UH4A 4DGWC 4ATWA 1FPTL 3MRRB 4R4BA 3FONA 1DR9A 1NCJA 4KEUA 1HESA 3KVQA 2GJRA 1UA3A 1UC6A 4XCYA 1MI5E 1H41A 4GG6A 2ZSWA 4TV3A 1EO8L 4PJEA 3QIBD 2PCEA 4A2SA 2PO6B 4DN1A 1DLHB 3EJZD 4XPGL 5C0JA 3RFZC 3M1OA 4K3EH 3FT3B 2WLLA 3BKCL 5J11C 3GVRA 4YR6B 4KIEA 3E2RA 2CIIA 4UMAA 3DGGB 5EG6C 2CKBH 3V4UL 1UJTA 1MREL 4L1XA 4Y9FA 3O2DH 4K94H 3O6DA 2QVNA 2WNZA 1CFVH 4QRPE 5F3BA 3GSUB 3DURA 2AXFA 4DO4A 2P8BA 1L7IH 4DBDA 4L8BB 3QC6X 3A21A 6FABL 1EJTC 4I87A 5F7BA 1XGDA 4ERSL 1QP1A 2XNAA 3X3FH 5I3JA 4JRXA 3FJ4A 4WI8A 3PANA 1KZQA 5FHBH 4FG2A 1OD7A 3KCLA 3CQQA 5D7HA 3EHBC 1U58B 4US5A 4GMTH 2AXGB 1WAUA 4UANA 3FBKA 3ULSB 4Y5XC 2P9RA 1OK6A 1YLBB 2ZCKH 1Q7MA 1EGMA 2VE6B 3QUMB 4X3ZA 3QWQB 2MQ0A 1RXOB 1YXCA 4PCSA 3CUPA 1MFDH 1ONEA 1KELH 2G2PA 5GGRB 1JDCA 5JIQA 1XTLA 3DX5A 3TCEA 3NA4A 3GXFA 4JKPH 5EMYA 4ZDHA 5BRBA 5LXEA 3OKLA 3WEBA 3ET9F 3VQ2C 3MRCA 4NHUB 5DJZA 2FPVA 3KS5A 4ZFMA 3DHFA 1TWDA 2G4FA 3AY4C 5IESL 3MRGB 3L4TA 5DMGC 3O4LE 1OTUD 2VLKB 3AU2A 3QS3A 4LSPL 2GAZB 3H12A 4HS3B 3ZKSD 1AGCA 3L5IA 4WI2A 2V69A 3MCNA 4M3KB 1G5AA 2IPUK 4JNMA 2VCBA 3IIXA 3IRZA 4YGVB 1G6VK 5JZ7C 2CM5A 1KFCA 4Z7UA 2GCYB 4BEUA 5C09D 4FQQB 2IV9A 2PCXA 2VMFA 4J8RA 1WS7A 2CJTA 3QE5A 4XRCA 1TMCB 4B60A 3CK0H 4I9TA 2QGEA 4HNLA 1CCWB 3WSQL 3PWGA 1CLZL 2M8XA 4AV5A 4N8CH 5BS0B 3WDHA 3QCUL 2JCCF 2FZDA 3QQ9C 3A6BH 3RBGA 3QFJB 1CZ8L 4ANUA 5ESQB 4KO7A 1ZL1A 2WBGA 4RZ5A 3W39A 2Z1KA 4HSNA 4PJHF 4MJ6A 1QZNA 3NSXA 1T5KA 4P3DB 3XIMA 4LUSA 3V7AE 3KUMA 3BP7A 3VI3A 1V51A 4X63A 4PJBF 3N9GL 4NAMA 2I17A 3M6DA 3RL1B 4MMZC 3D3FA 4F24A 4M61A 1SVBA 4Y1AE 2C71A 4UM8A 4IQEA 4P46A 3SE8L 1FWIC 1CZ1A 4XO7A 5GS0L 2YOCA 2R1WB 1LO2H 1HS6A 4XZ9A 1T5XB 4XVDA 3LQAL 2TRHA 1I7ZA 2R83A 4YFDB 4MNQB 1JCYA 2XX0A 3P30H 2O0TA 3STGA 2XTJE 3K6IA 4JPIA 5F2IA 4YPGB 1F9CA 4HSHA 1NWPA 2MNRA 1TWSA 3UYPA 5J9PA 4IOTA 2AS5M 1RAMA 1RK7A 4HAGA 4BK9A 2VAAA 4UTHA 4LOFA 5D2LB 3VOJA 3RTQC 3N73A 3REWA 1AXSB 1FH5H 2HSAA 4PMOA 2I5IA 4ZGYA 4LJ3A 2OMAA 4F8NA 5DHYA 1VFUA 3CIVA 1QSZA 1II4E 1R3JA 3RRQA 3VMNA 4G5ZL 4YTRA 1U4EA 1HHJB 4I18B 3QEHB 5CZXD 4BFOA 3FF7A 1TENA 4A7VA 3SRDA 1FCGA 1C08B 3LN5A 1A7QH 4UT6L 4XHQA 4RWYH 2Y61A 7ENLA 3AC0A 3P2TA 3HBZA 4LCSA 4RFEB 1RZJL 3VFCA 4KK9C 4FQJL 2ZTJA 3DMMA 2E6YA 3FFCA 1CURA 3CH1A 2VURA 1AOZA 1H6FA 2BCKA 4HF5H 3AQYA 4U4BA 4YH6A 3RX9A 4E42B 3DTXA 3G8RA 4XVTL 4C56A 4UOZA 3V52L 4TVSa 5FKAB 3U46B 3BSGA 4QNPF 2UY6A 3FJLA 2O72A 5AW7B 4JZOB 3HA1A 1ASQA 1XQ4A 2EH7H 3FNDA 4X5WB 1TU2A 3DHUA 3I75A 3ZE2F 3BO8B 4HS6A 1Z0MA 4JDYA 3RITA 2VD8A 4PGEB 3I50H 5TQ0L 3QC3A 4ZAKB 2P5PA 2PDBA 5IHRA 1OM9A 3DFNA 1KD0A 1FE8H 1B3YA 2W65A 1ODAA 3SCUA 5TK4A 4LRIA 3P0XA 1EFXB 5DI8A 3C87A 3VFSA 2ZZ7A 4FRWA 4PUUA 2A83A 4R7VA 1L8PA 2NW0A 4EMZA 5AHEA 2YGQA 3HG2A 1FRBA 5T9CE 5AW6B 3GHEH 5DXXA 4EDXB 4P8VA 4ES8A 2JEQA 5CD3A 3W2DL 3L3KA 2L3BA 2DLEA 1ONWA 5L6UA 3D34A 2O5XL 5C3LD 1Q7ZA 4H00A 2EDEA 3EWUA 4N2CA 3N9SA 4US5D 3S9DB 1Z9SB 4FI8A 2B31A 5CJXC 1GH7A 4LMQI 4ZUWB 5I3FA 3AXKA 4EP8C 4JPVH 4K3JL 3QMSA 5MEOA 2PYFB 5DZ9A 4ISVA 4OZHB 3HS0A 2WCSA 2IW0A 4PTXA 2LTQB 4C6PA 3OKMA 4YWIA 4BJLA 5KYNA 4X7FC 1KIQA 2O5NA 4DVBB 3BISA 3PWJB 4CNSA 3WBDA 2FJGA 3C5QA 3VTTA 1GMEA 4NGHL 2A6KB 3PB0A 3C9NA 4KVNH 2Z9TA 4U2YA 2BINA 1G94A 1U33A 4JFHD 5MERB 4DWDA 4P5TD 2X9WA 1UM6L 1U8JA 1NH6A 1MJ8L 2GJNA 1WYJA 5FGRA 4ZX3A 4HAFA 1CR9H 1KCUH 4EKJA 3B9KB 5HJ3A 3ES6B 1K5WA 3EWWA 5KSBB 3N19B 4FZ8L 2I5QA 3DETC 2VIRA 4QCIB 3L0KA 3MO7A 3NN8A 4J28A 5FAGA 2BGSA 3NYZA 1WUNT 2ACRA 5ALBL 4TUKH 3SQOH 4XAKE 2YMOA 5D4IA 3D05A 3FCGA 4GIAA 4HD9A 2IMRA 1T0PB 4XPHH 5DO2C 5DJDB 5G4MA 1CXHA 1R3KA 3IFLL 1T6BX 5I82A 3C86A 3UABA 5DLMH 4B7IA 3K1KC 5I5JA 4NM8L 2XU9A 1KKRA 4PEKA 4Y19E 3QQWA 4XBPA 1D7FA 1NOUA 2Y1AA 4M7ZC 4ONFL 1V3IA 1T41A 2V7NB 4N02A 2ZRUA 4E9YA 2E6FA 5A8PA 4V27A 4PW3A 4BE6A 1LWHA 5LWYL 2XPGB 1OGGA 1ZP3A 3PP4L 3H9HB 2XN9E 2WOYA 3VWJB 3MC0A 2ZOWA 4KJPC 3SECA 3T6ZA 2VDOL 1HQ4B 3QEQB 1XBRA 3LRGA 4F37F 4ACYA 3US9A 5IIEB 3OGRA 5HQMA 2V30A 1OAJA 4FFVC 1FPTH 4HT3A 5C6PB 3ARVA 3DECA 1O60A 1NKRA 1V5JA 3VSTA 1Q8JA 4A7SA 2C1IA 4ORMA 3UJFA 4Q8TA 1VLXA 3EAKA 3NL5A 1F11B 4O16A 1SJHA 3STEA 1BWVA 3D0CA 4DUXA 4JFXA 1NGQL 2OLDA 4N0FB 3NQ8A 1T20A 5XIMA 4N8VG 2ESCA 2VL4A 1P48A 5CD5C 3Q0HA 4XPGH 3NQCA 5I1DA 1XH3B 2QMKA 4Y9MA 3HE7C 4GRMA 3MMEA 3MZ2A 4Z9KB 1BLNB 4JM2B 5J56B 1VPQA 3N4FA 1U3HD 1TFHA 1CT8A 1U93A 3BGFC 1MREH 4QKTA 2PWEA 4K94C 4A38A 3IIPA 4U1MA 3LCYA 3SKMA 1V6TA 4LBRA 3S5ZA 3MRIA 3A5VA 2K4WA 5GRVK 4LY4A 2Z65C 2CGYA 4Y4HA 1KKOA 6FABH 1XEDA 3F4VA 3NSDA 1FZMA 4ERSH 1LE5B 5D1ZD 1IIIA 1ZTXE 5FJRA 3GAYA 4H9VA 4V2CB 4HNTA 1OY3B 2J8HA 2AJ3B 5F1KC 3TO2A 5TPWL 1OM0A 2RJMA 4PEEA 1HO1A 3ZFHA 3E1F1 1VRDA 2Z7KA 1O7DC 4MDJB 4JDBA 1E6RA 4LLUB 3TO4C 3N2JA 2RMNA 3UBPC 3DMMD 3DRQB 1N8IA 4IOSD 1R3RA 1RUKL 1WUFA 1A1NA 2FEEI 2OG9A 4UFMA 4NG3A 4DO5A 3TA3C 3RLHA 3CBJB 5F7DB 1WPCA 3EA3A 4Q8UA 1FORL 1V02A 1UROA 4FERA 3EGSB 1A9BB 1ET8A 5JQ6L 1Z44A 5IESH 4HSAC 1H15A 3F01A 4G42A 1J9TA 5MENB 4GISA 2Y3AA 3GTIA 1NF7A 3QJHA 3TM6A 5IB2B 2HVBA 1WIUA 3T55A 5AC5A 1HIZA 5HGAA 2ENPA 5FSEC 3F2DA 3WY2A 4ES9A 3VGBA 1C7SA 3EJRA 5E6IB 1XYMA 4ZMYA 4MZ2A 1Z5HA 3WSQH 3H2WA 1CLZH 1DQJA 3QCUH 5EWIL 4FCHA 1WE5A 1IM9A 3F7QA 3WBEA 1OF0A 1HI6B 1CZ8H 2R1YB 3THML 3VO0A 3MYPA 1IEAA 1IC4L 4KKCC 3M0KA 1ZDSA 4JY6B 4R3SB 1JFXA 5MI0B 1SPDA 4HQQL 3LZNA 4YU1A 2PLTA 3K71B 2DDXA 2QVTA 3ZBMA 3T0XA 2GL5A 2IVFC 3T09A 2D2OA 3H4XA 5FM5O 5K9KA 3VXGA 4U6XA 1LORA 3QTPA 3D85D 1HXKA 2B7PA 2L7EA 3N9GH 4YZFE 1MIEL 1KRMA 2FL5A 3EXRA 3RWIB 3P8JA 3SE8H 4AK1A 2ZTBA 3DX8B 3CO8A 1YUHB 4UV4L 1YHTA 2C9RA 4LGPB 1ZLDA 2WSYA 4JGNA 3TU9A 3NJFA 3NSMA 1KENL 1U5VA 3KM8A 3KXFE 4DELA 1E8WA 4FQXC 4WW2B 4AVKA 2WWNA 3UZQB 3L9BA 1ZXKA 2B81A 3HG1B 3ZHFA 1E7UA 1V03A 1VF5C 5DCEA 3QDJB 2BHYA 4GVFA 5J6GB 3P9MA 5FF0A 4G72B 2VC2L 2KBGA 4M29A 3QO1A 1C5DA 3LPOA 1QABA 3VE9A 1RJQA 3EJCA 4KX9A 3TSDA 4MFEA 3SY0A 4JO3L 4RAHA 2RGMA 1URLA 1BP3B 3E9AA 1ZTMA 2BP8A 3CLEL 3H6JA 4IBQA 1FWXA 1MJUL 5D93C 1BIHA 1I7RB 4X9GA 5ADPL 4G5ZH 4XCCL 5CG0A 2PO6C 1F6FB 4L0ZA 4UT6H 1WEJL 4BFFA 3ZYOA 3OIHA 2GBAA 1A4LA 4R83A 4D7PA 4TVPD 4PRPB 3BD5A 1RZJH 1G7IB 4JREB 1PV8A 4O2FA 1ZT4A 4FQJH 5C0QA 2DVUA 5I2IB 1KGYE 1P6BA 3PP3H 1QKZL 4NERA 4JN8A 3IDXL 2FYYA 2E7CA 4F9PA 4Z7VE 2EE3A 3FQXB 4X7CC 3PZOA 5EEZA 4E41E 5CIPH 4M4RA 3W1AA 4C7DA 4MWAB 4XVTH 3V52H 3MR9A 2NX1A 1ZFJA 1MH5A 2QJNA 2ODIA 4JRYB 1FIGL 4E9XA 2YSTA 1QR4A 3VXQA 5TQ0H 1HXYA 3CFJB 1L6WA 4G7YH 3O9WB 5SWQB 1Q6DA 3VXSB 4Z7WF 2DLTA 3SJVA 1S7TB 2GQ9A 3BP6A 2YQ3A 1EUTA 4GQPH 2CHWA 4PIRF 4K8RD 4ES4A 4XNBA 3ARUA 4KKQA 5DD1L 1WRFA 1IL1A 1Q4NX 1OCNA 2ZWKA 5EYWA 5AYXA 1J9RA 5KVFE 3DI0A 2WBKA 3B0YA 4OVXA 2O5XH 3CHOA 4GHRA 1JTPA 5JOPD 1U36A 3CEPA 2WC4A 1ML0A 3KZ8A 5HGBA 4OV4A 2XFGB 4FTVD 3RDTB 3VJ6B 4K3JH 5C5YA 2C9AA 4KEVA 3WFAA 4TTDD 5FL1A 3ELAT 3ZUCA 3SY1A 5FLVA 2ZUMA 2UV3A 3BDYL 1U95A 4UIMA 2YX0A 3MRNB 3GVVA 1QPRA 2VZTA 3N2CA 2R7EB 5EFIB 4I7VA 3MUGB 3ABSA 4W86A 3ES7A 3TBYA 1YDOA 4NGHH 1FBIL 4NP4L 3V7AG 2PW1A 3OVRA 3WLJA 3NQKA 4JEGB 3QC0A 3F12B 1UM6H 3GPEA 1QWUA 4ZSOA 4LLDB 43C9B 5LQBL 3WD5L 2UY2A 3VGFA 5E23A 4MX7A 1W8GA 3G7TA 1TTGA 1EDGA 4Y8AA 2HKAA 1KB5L 3IJ8A 1CDUA 3PQYE 4X9SA 1E6SM 1HNGA 4FZ8H 4XG1A 1HZYA 3URNA 3TIDB 4LLYA 4MRBA 3Q8FA 2VN3A 4MHHG 5LIXX 5ALBH 2ISWA 1FH8A 1I45A 1QNVA 2V2WA 1SJEB 4F7MA 3M0IA 4MD4A 4X4ZA 3ZJKA 4N9BA 5G1MA 3S2CA 3RAJH 5BOEA 4QLWA 3IFLH 5GRJL 1DWGM 4J3OC 2E0PA 3WQ4A 2HWGA 2VWSA 4GIRA 1ZHNB 4NM8H 4ODWB 5HNRA 1RK1B 2PKDA 1MCHA 4RISL 2WZ5A 1JCTA 4ONFH 1LOQA 2EDRA 1XF0A 1CFSA 4D6IA 3ZDYF 1BYBA 4GKSB 2Z1SA 5JO5A 3RUGF 3EO9L 5G2IA 4KJQC 3VSQA 3UFIA 2X4UB 4JQVA 5LWYH 3PP4H 5FIPA 4L4TB 5HYSA 2KL6A 5IVXE 4K9EC 5JQHC 5I18L 2FYVA 2VDOH 5AZ2L 3QDMA 3RI5K 3ESUF 3QHNA 3DJZA 2VGFA 2V38A 2CLVA 3VFUB 3F3HA 1UZ4A 2X1QA 3DG6A 3IPEA 2WD0A 4TV6A 3GWJA 5DSCA 2I5GA 2K78A 4XOAA 2FBRA 1M7DA 3VVGA 3LZLA 5GGUA 2PDIA 3V0GA 2NDGA 2HLFC 1BSIA 1BFOB 4PLKC 3N91A 3BRGC 3VFTA 1WZMA 1GS8A 4FR6A 5E4EB 2VDQL 4MKSA 4F2FA 2UZIL 1N6VA 4F3HA 2CLZB 3BWUC 3NXLA 5JR1L 1AMKA 1R5IA 3NOEA 1RLDA 2B20A 1GOOA 4BKNA 3MLZL 1MJJA 3QG6A 4C4UA 1ZGLA 2NNXA 5B8CB 5DK2A 4TL5A 4F0MA 1V10A 3JTTA 2FEEL 1D6EB 1M3IA 2DZAA 1ZHKB 1BM3L 3V5DA 5GSVB 3FH7A 1FUNA 5DC4B 1KTKE 4W6WB 3CIXA 2JJTA 1MZZA 3NJNA 3AIEA 4CCCA 2E7FA 3UTSA 4YOKA 2E4TA 1W9BM 3QOKA 1IM3A 3W87A 3EJPA 5TPWH 1OP3H 4JFFD 1D9KB 1MFMA 4QHMA 3Q6FA 2WJDA 4AY0A 3O81A 1MPAL 3EOYG 3SSJA 4PMNA 2RDUA 5E4IA 4HIBA 4N0UE 1K7XA 4AIZB 4H6EA 4RA0C 4YMPA 1JZ8A 2Y8UA 4ATDA 2OBGA 1RUKH 1KFWA 3R11A 1JGLL 2VJ0A 1CICA 4G80B 2QDGA 3QV9A 2QADD 2G41A 4GH3A 1G7HA 1FORH 2ZC1A 1R75A 4JPSA 4YJZL 3ASNB 5H94A 3WO8A 1SR0A 2AAMA 3IDIB 4G9PA 5JQ6H 5E1QA 4FXGB 1MNZA 1E6QM 1Y18B 3P93A 1NEZB 1KPRB 4KZ0A 1PHWA 1YNTF 4M7TA 5JH2A 3W7LA 2XN2A 2EIJB 4UBPC 2MH4A 2R39A 2V9QA 4GQQA 2X4OB 3OVUB 3UTTD 1UHVA 3MSDA 2HXTA 5FF7A 1D5ZB 2F9BT 2PWDA 2OMYB 2W79A 1OQOA 2P0OA 1QI0A 1KRAC 3ECQA 2RHEA 1XLDA 1YEJH 3BSZL 3C0LA 3OF6A 2X70A 4LPTA 4NOFA 5C07A 4CW1A 1BFVL 4AEOA 3BL3A 4U3SA 2LTQC 4V1DA 2BC4B 2BP3A 3RE0A 3UIZA 4WENB 3WLRA 1FNFA 3U4AA 5EWIH 1TWIA 2W80C 2WQVA 3LB6D 2PF6A 3MPGA 5EA9A 4GJTB 4QXTB 3BCDA 3AROA 2YN3A 1DDHA 3AQDA 5BO0D 3D07A 2C9SA 1PKQB 2C9UA 3THMH 3O6YX 3O6LL 1ZLVH 2NQHA 1IC4H 4H9XA 1PNDA 2UZXB 4QRQB 4GXPA 4LOVA 4MCZB 3F7RA 5J5EA 4HQQH 4IU2B 4F7TA 4JFYB 3LDVA 2NX5B 4X5QA 3FQ2A 5C8JA 4PSPA 3E6FA 4KJWC 3B9KC 4JTSA 4R0LC 1S2TA 5KYYB 3QDGA 1MIEH 4YAQB 1I9JL 3PVFA 1UB5A 1LE9B 4ZZKA 2PPGA 3MV8B 5IR1A 3C2EA 2QPDB 5GS0C 2HEJA 4OZGA 2QHRL 4UV4H 4HJ0C 4H04A 3LCFA 4P4RA 1K3UA 3PAZA 3KYMA 3UWVA 1NBQA 5D8WA 2V7HB 1KENH 3LQAC 5HI4D 4NZ1A 5FM8A 3HE6A 5EZLB 3WH7A 3L45A 4G71B 3OAZK 4PUMA 2ICEA 2FGBA 4L18A 1EAPA 1I8MA 2V81A 3VRJB 4WTZA 1PXGA 2VC2H 2W81C 12E8L 4GKZB 3VWJC 3IS0X 4O52A 2MOGA 3BMVA 1KFJA 3QHTC 1N5AB 3MUY1 4JO3H 1G7QB 3BXNB 3S2NA 5GNZA 3WQ5A 3OVPA 2PPAA 3DO3A 4V11A 3AW5A 5DY2A 1U91A 3CLEH 3RWJB 4E9WA 2XA3A 1XS2A 2WPBA 3L9RA 2H1PL 1MJUH 1B4JL 1OAXH 3M7OA 5ADPH 1AGEB 4ZFZA 2B1OA 3LKPB 1Z48A 1EQPA 4XWOC 2BASA 1WEJH 3P4MA 2QHAA 1Z8AA 3DIFA 1M05A 2DSVA 4HK5A 3ZWTA 1V0KA 4X0KB 3E49A 4K73A 4KMQA 2AV1B 4KQ4L 1RQ5A 1E56A 2HISA 1H0DB 1KN4L 3DI3B 1HWHB 1QKZH 4NXSA 1HOCB 2Y6SC 3IDXH 3LGEA 5KZMA 3KPOA 2G0WA 2GVEA 5JHDA 1E9IA 3VI4A 1RPXA 3GMRA 1CECA 3G6JE 5AKTA 2COQA 1FIGH 5HY9A 4Z7OF 3U4EB 3VIMA 3T8XA 3ZJ6A 3Q8AA 1EJOL 2VLJA 4FK9A 3RAOA 1YPFA 1ERNA 4DXVA 1CK0L 2AK4A 1RPQA 5LIKX 1AJ7L 2A3CA 3WIHA 1OY0A 4IEFB 2WXPA 1VCBC 4GYKA 1QHPA 2GY7B 5F97E 1IEBA 4GUCA 4GZIA 2D31A 4DOHE 2QJDA 2R91A 1XBVA 3EYQD 4GA8A 2OKMA 4N1CA 3LVEA 2HXUA