3UXIA

Crystal structure of l-rhamnose isomerase w38a mutant from bacillus halodurans
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
413
structure length
402
Chain Sequence
SQFERAKIEYGQWGIDVEEALERLKQVPISIHCAQGDDVGGFELSGDYPGKATTPEELRMDLEKALSLIPGKHRVNLHAIYAETDGKVVERDQLEPRHFEKWVRWAKRHGLGLDFNPTLFSHEKAKDGLTLAHPDQAIRQFWIDHCIASRKIGEYFGKELETPCLTNIWIPDGYKDTPSDRLTPRKRLKESLDQIFAAEINEAYNLDAVESKLFGIGSESYVVGSHEFYLSYALKNDKLCLLDTGHYHPTETVSNKISAMLLFHDKLALHVSRPVRWDSDHVVTFDDELREIALEIVRNDALDRVLIGLDFFDASINRIAAWTIGTRNVIKALLFAMLIPHKQLKEWQETGDYTRRLAVLEEFKTYPLGAIWNEYCERMNVPIKEEWLKEIAIYEKEVLLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based studies on the metal binding of two-metal-dependent sugar isomerases.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Isomerase
molecule keywords L-Rhamnose isomerase
total genus 139
structure length 402
sequence length 413
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.14: L-rhamnose isomerase.
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06134 RhaA L-rhamnose isomerase (RhaA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3uxiA00
1XIIA 8XIMA 3JU2A 1DIEA 1DIDA 4XSMA 4QEHA 5EMJA 3M0HA 3KBMA 3P6LA 2J6VA 1XYCA 3TC3A 3UVAA 2OU4A 4QE1A 1BXCA 1XIHA 4PFHA 1XIGA 3VNIA 4US6A 2G4JA 2X7WA 2XIMA 1CLKA 3CNYA 3CQIA 3CQKA 3FVMA 4QE4A 1I60A 5XIMA 1TZ9A 3M0VA 2GVEA 1XYAA 3CQJA 3LMZA 3ITTA 4HNOA 5EMKA 5B7YA 1DXIA 3KCLA 1DE5A 9XIAA 1XLEA 4Q7IA 3C0SA 5H6HA 4A8NA 1XYBA 1MUWA 1O1HA 1XLIA 4XIMA 3UU0A 4QEEA 4A8RA 4ZBCA 1I6NA 3ITXA 2I56A 2GLKA 1XIEA 3L23A 3ITYA 4YTQA 3C0QA 1YX1A 4YTSA 3QZAA 4EAYA 4K3ZA 3AAMA 3VNMA 1XYLA 4HGXA 3C0LA 1XICA 2QUMA 3KTCA 3QC0A 2HCVA 3BZJA 3XISA 3KBVA 3BWWA 2GYIA 5J8LA 3VNJA 4QE5A 1XIDA 3IUIA 2HK0A 3ITVA 1QUMA 4GJJA 4GJIA 1QT1A 3UA3A 4ZB2A 3BZGA 1XLAA 3P14A 4YTUA 4XKMA 3AALA 3VNKA 4HHLA 1XLJA 4LNCA 3XINA 1A0EA 3KBWA 3QXBA 2QUNA 3BANA 4PGLA 5XIAA 5I7GA 1BXBA 3U3HA 1A0DA 3DX5A 4XISA 4GLEA 5B7ZA 2G0WA 3CWHA 4E3VA 1XIFA 4KW2A 1K77A 4EACA 2XINA 1S5MA 3CQHA 4DUOA 5B80A 4XSLA 4W4QA 2NQJA 3M0MA 1XINA 3WQOA 3ITLA 4GQBA 1OADA 1MNZA 2QW5A 3ITOA 2I57A 2X7VA 5H1WA 1XP3A 8XIAA 5XINA 3OBEA 1S5NA 6XIAA 3KCJA 3U0HA 3M0XA 1A0CA 2GUBA 1XYMA 3KWSA 1XLCA 4QDPA 3XIMA 1XLHA 3M0LA 4ZB5A 1DE6A 9XIMA 3KCOA 4X63A 4YTTA 4G56A 4K1GA 3AYVA 3M0YA 1XIMA 3KBJA 1XLLA 2ZVRA 2Q02A 5FA5A 1XLKA 7XIMA 6XIMA 1XLDA 4A8IA 3KBSA 4ZB0A 1XISA 5C9ZA 2QULA 3UXIA 5EMLA 4DVOA 3BDKA 5AVHA 3DBNA 1XIBA 2HK1A 3AYTA 4J4KA 4OVXA 4X61A 3VNLA 4A8LA 1XIJA 1XLFA 4YTRA 3VYLA 3NGFA 3UA4A 2ZDSA 3TVAA 4QDWA 3IUDA 1XLGA 1XLBA 3N4AA 3QYSA 2XISA 3GNXA 2NQHA 4HHMA 5EMMA 5AVNA 2NQ9A 3IUHA 4XIAA 4X60A 1D8WA 3KBNA 1XLMA 5TNVA 1GW9A 1QTWA
chains in the Genus database with same CATH superfamily
2QCLA 5TIMA 3BICA 4LPCA 1JRCA 4H19A 2JIWA 1ISVA 1ONEA 3WUBA 2G97A 2QLYA 4JYFA 5FEPA 3P2VA 1XI3A 4L1GA 3W1TA 3IRDA 3R5EA 5HMDA 2VT0A 1J01A 2A3CA 3S5YA 1PHQA 1VPXA 2VX5A 2AOSA 1ICPA 2V3DA 1JVNA 1PXGA 5ECVA 1TV2A 2QT3A 2YZ5A 4YTUA 4JNMA 4TVCA 3OHIA 1NSJA 1FHDA 3K8MA 5E93A 1PL9A 2P0IA 3W71A 3VIFA 3HG2A 4IIGA 3DN5A 3W81A 1A0DA 2WCGA 4GBUA 2IKGA 5B7ZA 4EACA 1K77A 1VAHA 3KRSA 3M47A 4A4AA 2GPTA 1X39A 2CPUA 3CWNA 1BAGA 1H7NA 1TWZA 3SAZA 4YPJA 1E9ZB 4RV3A 3G1VA 4WOZA 4WF7A 3IAPA 4BQ2A 4OGZA 1NFPA 1HL9A 1Z48A 1M5WA 4CNPA 4Q4MA 4YWSA 1AD1A 4JEQA 4D8LA 4HA4A 1SFJA 1XCFA 1B3OA 1C91A 2HE8A 3IIOA 1BGAA 3FEMA 3B8IA 4K68A 4Y9OA 4M51A 1TTIA 2Z00A 4QE1A 1J93A 2H90A 3A6OA 1SFSA 5DMLA 1K9FA 1TMHA 3HFTA 3T78A 2GFTA 2OO6A 2I7GA 2NQ5A 5EGRA 4Q4OA 1LG1A 1JD9A 3MWAA 1AK5A 3CV2A 3SM0A 1Z7AA 3OVRA 3WQPA 2WPGA 1X6NA 2PDCA 6REQA 5D2VA 2A6LA 1M68A 3KUMA 1E0WA 2QJJA 3DYMA 4JTHA 3ZVHA 1YQ2A 3DI0A 1HO4A 1XL9A 3PPFA 6A3HA 1ITCA 1AQHA 4GOAA 1IXNA 1Q6FA 2LLEA 4ML4A 4BI7A 3GHSA 2GGGA 4RPQA 3R94A 1GOOA 5A8NA 4MAVA 1NDYA 2OWCA 3LHUA 4BFAA 1F8MA 3W02A 3LCXA 4O54A 2Z29A 6CGTA 3W84A 6REQB 2OMAA 2A2IA 2CERA 2OZ3A 5IHRA 3REQB 2EAWA 1GONA 5DBTA 4GYKA 2ABAA 3C4UA 4Q32A 1H11A 3VGFA 4AWTA 3JZEA 3SY8A 4NJJA 4GI4A 4GIYA 3WYZA 4J3TA 3DHFA 1K9EA 3VKDA 1HG3A 2QVNA 4AVOA 1NWSA 4PUNA 4FALA 6TAAA 1A80A 1Y5XA 5CG7A 1NEYA 1EL3A 4PTNA 1JCLA 5EPDA 4FS9A 3H2FA 3STEA 1Q6OA 2EGZA 1S2CA 4YVVA 4XQ6A 3ICJA 1XIIA 4PRWA 2FLIA 4IPIA 3IJQA 3A3HA 4LAMA 5K9CA 1TJ2A 1CXKA 3KFTA 2OELA 4MUZA 2C1IA 4MY8A 4BWLC 5LHEA 1UG6A 3AHVA 3T40A 1F6KA 1D3CA 1POJA 1TMQA 2KX9A 1FWFC 1PDZA 3QY6A 4YTSA 4G1NA 3EXTA 3FAXA 4MWAE 1YKWA 3KL0A 4C6NA 2DU2A 2O92A 2NV9A 1XLAA 2YDAA 1TTPA 4W7UA 4JIRA 2A7RA 2CETA 1UZ1A 3CZGA 1XINA 4HP5A 5FF3A 8XIAA 1SO5A 2Z1VA 1WZAA 3DKLA 3DG3A 1W5OA 4DUVA 4ERIA 1EDTA 1O60A 3ABRA 1DQUA 3UZXA 2WK2A 4GY1A 1HJWA 4HU8A 3VGBA 1HKKA 3TYBA 1CZ1A 3SCUA 1H7OA 4GFIA 4I6VA 3W6MA 1L8PA 3ZJKA 2EO7A 3HQ1A 5HULA 1CX9A 3RCYA 5I78A 4DJFA 2XGIA 1TVLA 3DHUA 3J7HA 2QJIA 3VKCA 4RLIA 1KLYA 5BCAA 3M0HA 1PIIA 4QLJA 2PP0A 2EHHA 3KS5A 3HQOA 1SFLA 3KZSA 1MNSA 2J7HA 3N18A 3WQ8A 1US0A 4N9CA 3L4VA 3CZEA 4ZBCA 5CBBA 4ZXOA 4FR6A 1K9DA 3I3EA 1OFDA 1R8LA 3MA8A 2DUAA 4A2RA 1JNEA 3R1ZA 1D3GA 5AHEA 3TV8A 4MLRA 1M01A 3OU8A 1BWKA 2FGBA 3MZNA 4OECA 2D2OA 2YL5A 3FS2A 3S9IA 1TB3A 1WKDA 1QI5A 4JTDA 5CH9A 1C7SA 3NM3A 3FSUA 3BLKA 1JXJA 3W7NA 3M5VA 2I57A 1GVIA 2Z2BA 3OBAA 3LZ5A 3HQPA 4P61A 3LDVA 1UKPA 3EXRA 4HT3A 2P53A 1XCXA 4OBRA 1SZNA 1ZJBA 3NXLA 5HR6A 5FA5A 4GJ1A 4ZOCA 3O0FA 7CGTA 5CZJA 3KVLA 4GQQA 1DIOA 3AUJA 1J0KA 4DQWA 2Q3OA 3TC6A 2DIJA 3U7VA 4DJDA 4XTDA 3BJSA 1C8YA 3GDMA 5FSDC 2E5CA 3P0WA 4C6DA 3B03A 3ANUA 3AO0A 1PHWA 1XXXA 2CBVA 4D8AA 4AD5A 1XYZA 2R91A 1YXDA 2VDHA 3KHJA 4RW5A 2PBOA 3BO9A 2OLSA 1UKQA 4MYXA 1EWDA 4JX5A 4AIOA 3QC0A 1UASA 4DAIA 4P8XA 3B0XA 2XFYA 3VIGA 4FNSA 2YB1A 1H5YA 4AZCA 3B9AA 2WLZA 3WD1A 2D0HA 2TAAA 3NO1A 3WLLA 3LEPA 1YPFA 1H09A 3IJ8A 4H6KA 3QGAC 1JDCA 4OV4A 3KOZA 4YVXA 2ZA1A 3AMGA 3CO4A 4DZHA 4LBSA 4JN8A 1HKVA 2VMFA 4NIRA 4KEZA 3ITOA 3A47A 2Y4SA 1MW2A 3QQWA 4LC8A 5CLWA 3WLRA 1FDJA 2NZLA 5LXEA 2QHAA 2QCMA 1YTKA 3T0AA 2VZUA 1L8NA 4NZ5A 4ATWA 1W1VA 3B9EA 2GUYA 2QF8A 2WANA 3PJUA 3S6TA 4HCHA 4CD4A 1UD8A 1EUAA 4WXYA 1F3WA 4NAEA 4KS0A 3G5EA 3ITCA 2E6FA 1TJ1A 4F0KA 1FWIC 2Y62A 3TA9A 4XBKA 3GXIA 6ALDA 4UMCA 4PBEA 4L5ZA 1KRCC 4WSJA 2V0TA 4C6FA 3MI6A 3B04A 4WDTA 2XVLA 2W6RA 3V0SA 4JL1A 1DE5A 2BLEA 3UU0A 4DO5A 3L0NA 3EZ4A 4UZSA 1XG3A 2ANUA 3C61A 4QJ3B 3U2EA 1PZ1A 2DZSA 4GI6A 1M7OA 2AQWA 2G95A 2GYIA 3E0VA 5C7VA 2FJKA 4H7ZA 3BUVA 1Q7MA 1UD2A 1XH1A 3HGSA 3N6HA 2YW4A 3G3MA 3LM3A 1P48A 3PSVA 5C9UA 2QR6A 1HO1A 2XVGA 1UJQA 2ZZ3A 1R2RA 1PWMA 3S6OA 2W79A 2ZZ4A 2FZMA 1TWDA 3TR2A 3A9IA 4CGTA 4H1ZA 5HWMA 1LDCA 4LV4A 4PMZA 3F2CA 4G56A 4Q4SA 2DP3A 1ONXA 4RNFA 4ZE4A 4Y2WA 1JCMP 3E38A 1K9TA 1EH9A 1XLKA 4F48A 4NF7A 2IXUA 1J2WA 3G24A 3SN4A 4O1AA 3TYZA 4MLJA 2B31A 4Q8QA 4S3AA 2YLLA 5TQLA 1XIJA 1OIMA 1MEHA 3GHRA 4N0RA 1FRBA 1OWQA 5H8UA 4IICA 3SCRA 3T2PA 1JGMA 3MCNA 1TR9A 1MUCA 4PFHA 1W2VA 5HATA 1GQLA 1GVYA 4E2VA 3AWOA 3LHWA 3ARTA 4KH2A 3PZUA 4H8HA 3RITA 1KM1A 4O16A 5FF7A 1F5ZA 2RKXA 4ZTYA 1F8IA 1BD0A 1CBGA 1JGIA 5EB8A 5HQLA 2QCEA 1FP8A 5IRPA 5FF4A 1S2WA 1AODA 3I10A 3SFWA 4CD8A 2RDXA 4P8WA 3GNPA 3W38A 1QPOA 4HPJA 4JHOA 4CNTA 5A5WA 1RCXB 2XM2A 3TW9A 3Q58A 4R27A 2QKFA 3WNNA 3EWXA 3PVFA 3QOKA 3WDHA 2OLAA 4O15A 5G4HC 3ZYZA 2WMKA 1W5PA 4OKDA 2OWWA 1GOMA 1P4CA 3OA3A 3M5ZA 1W54A 3ZFHA 3V18A 3WNPA 5IHSA 3PZOA 3LHZA 1A0CA 3TDFA 5LNRA 2G3FA 3AI0A 3TSBA 3VMPA 3QLDA 4KGJA 4AAJA 3ANYA 4GHRA 1UD5A 3P5ZA 1VP5A 4R53A 4PTVA 4L1WA 4O17A 4H00A 3DFPA 4QG6A 1CW2A 1VPYA 1ICQA 3S1VA 4LAOA 3VI2A 5I07A 3KZPA 1CLVA 1MQRA 1HT6A 4CCDA 3DFTA 5DXYA 3TAOA 1QXLA 4HMNA 1ZJIA 2WNZA 2PLKA 3A3XA 3VNYA 4B2DD 3SI9A 4JN6A 1BXCA 4O52A 4HYWA 2WCSA 3UZWA 3CQIA 2NSOA 4HPGA 2O4QA 2GSHA 2CBUA 2WHLA 2ZUNA 1FWJC 2J9XA 3ZWSA 4UCFA 1IR2A 2O9RA 2P1FA 3FVDA 4WSHA 1HZYA 3QZEA 4WY0F 2EQDA 2E3ZA 3LB0A 4QBXA 3S5SA 3MMDA 4ZVJA 4UWMA 5JU6A 4JY8A 4WKHA 4F0MA 2VNCA 2YX0A 3C0LA 3TR9A 1C29A 2WV8A 4JFWA 4WGHA 2QV5A 2J75A 4X9YA 5LNSA 3PZQA 1R3SA 3NYZA 5AHNA 5A1AA 2ASHA 4XSLA 1NF0A 1TCMA 2PDJA 3R7MA 3MSRA 1FWHC 1IEQA 5LZLA 3KHDA 3SURA 5ABHA 3NNTA 3DDMA 3AYVA 2REQA 4Z2LA 3BMXA 1B3VA 5FACA 1UD4A 4NSBA 3NJ3A 3QJAA 4IGSA 2QULA 3O7UA 3RK8A 3WBAA 2X8RA 4L6HA 3AYTA 3VKAA 1MFVA 2XH4A 1ZENA 3HJEA 4Z2KA 3H2OA 1PKYA 1TX2A 5I3JA 4GACA 1AQFA 5I3GA 1KCZA 3G1AA 2AL1A 4MY1A 1KXHA 1M53A 2ZX7A 3BLFA 1W9DM 1LBFA 1UZDA 4AX7A 1P6WA 1ZAJA 1B0IA 2OKTA 3ME3A 1SSGA 2P3ZA 1H2JA 2WSRA 5FJOA 4US5D 3U6WA 5H8PA 5I03A 5C54A 5DQPA 2C6QA 2JEPA 1KR0A 4J2MA 5F2IA 2JIEA 3PTKA 1BTMA 3UCQA 1XV8A 4XBSA 3HF3A 3AIUA 4HNNA 4O53A 4H6EA 4KIRA 2RUSA 5IXEA 4NXKA 3L0GA 5EYWA 3UJSA 1W1TA 4JTFA 1SJCA 3FEQA 1TCDA 4YXGA 4PE8A 3FK4A 2DW6A 1VFFA 2EPNA 4W7VA 3K46A 2HPIA 2CHNA 1Q7QA 1ODZA 3QHNA 1EJSC 4P2VA 3P5YA 1R9XA 1V4YA 2C0HA 1JUKA 4WJXA 4J40A 2ZUUA 4H7VA 4ZQOA 2EJ1A 3QHMA 3WQOA 3M0ZA 2HVMA 4DJEA 4NNAA 3ZOAA 3HG4A 4WIWA 3DYOA 3T4CA 1VS1A 3FYPA 4UNLA 2VGFA 3VILA 3KBSA 1E3ZA 1L6FA 2PF0A 2WQPA 4ROQA 3H55A 5BWFA 5HJYA 4C6BA 3URBA 3G3DA 5L6UA 3VGHA 1PDYA 3SQSA 4OWGA 3C3NA 1XSJA 3CZ8A 2J4GA 5FJUA 3JU2A 1QATA 3VIMA 4HZ6A 1C3FA 5LIXX 4R85A 5G4EA 4O19A 2W61A 3KTXA 2E9MA 1WXJA 1TPEA 4N6FA 2CCRA 4HOZA 1R7OA 3AJ7A 5HDRA 1EZWA 1YBQB 5BNKA 1LOSA 2R94A 2B7OA 5CEWA 1EUNA 2HDJA 1S5WA 5HNNA 4FB7A 3MI2A 3PNZA 4ORMA 4ERAA 4R88A 3LLDA 1K8CA 1K70A 1KRMA 1W1A1 2WJDA 5GJPA 4HYVA 3QMSA 4TO8A 2I1OA 2A0NA 4BI5A 3EPMA 1BXNA 1EXPA 2JGQA 4URIA 1ZFJA 4DHGA 3VK5A 3S9ZA 4ZTXA 1BKHA 1BF6A 3DFQA 3LENA 3N2BA 1WUFA 3N2OA 1V7AA 3W2MA 1EA0A 3VGGA 5A2AA 2Y5EA 2OEJA 2H6RA 2OLHA 1V3IA 4W87A 2EBNA 3PUEA 1ZNNA 1W3IA 2GGEA 4PUJA 3R10A 3I6TA 1A5MC 1QK2A 3WD4A 5A6SA 3A21A 1FH7A 4GVGA 3BDKA 1EOMA 4I8YA 4UFJA 3SJ3A 1XLGA 3PJWA 3WF0A 1LRTA 3QOMA 1TA3B 4XUYA 2BODX 3AZRA 3GIPA 4FIRA 4BY3A 3HV8A 4MPQA 4CU6A 3SCWA 3ZO9A 3D0CA 2WM1A 4AEEA 3PBVA 4MPKA 3PZ9A 2RGLA 1XF0A 5FOOA 1G0CA 2FQIA 2J7FA 1P0NA 1SUXA 3RMEA 3GTFA 1XLIA 1Q85A 4ATLA 4GNVA 4FO4A 3MKKA 5T26A 3SSZA 3RHGA 1KTCA 5DF0A 1V6UA 4V28A 1JCXA 1FXQA 1SZGA 1UYQA 3GNRA 3EEGA 5J8LA 4R5EA 2VM8A 4JQ1A 3VCRA 3P14A 4MTVA 3AALA 4H9XA 2E8YA 3MHFA 5LSMA 1Q66A 2GJXA 3AUOA 1IQ8A 4MG4A 3R4IA 4B5WA 4H8UA 5I0DA 3MKVA 2VEKA 2BASA 1UOZA 4HA3A 3WY1A 3DECA 4HBKA 3H7UA 4C7DA 3NZGA 5M03A 1A5SA 3VZZA 2QJMA 1W1YA 1HJUA 2J66A 3KRBA 1NH6A 5CZ0A 3VKBA 3KBJA 2Z1SA 1V02E 1KNWA 3IV3A 2VRQA 4Q4PA 3H2NA 4MY9A 4HU4A 1V0MA 1E9YB 1O6IA 5BMXA 3MHGA 1QNQA 4S3KA 1X1NA 4JIPA 2YBUA 4RZ5A 1GVFA 4IWWA 1EQCA 1FWDC 3DAQA 1FWNA 2VX4A 2ACSA 1VFTA 3LUTA 4MF4A 4GXWA 1RY0A 1PYMA 1GQJA 2DZAA 4HN4A 3W1PA 4RZBA 5A6BA 1M41A 3TIMA 3UEQA 1TJRA 4M19A 1JPIA 1XYBA 3GBEA 1AJ2A 4PTWA 1XIEA 2FDMA 3AICA 3L4YA 3FYOA 3W7LA 1BG4A 1SMAA 2ISSA 1PCKA 5A6LA 2YCKX 1LWIA 3KBVA 3BG5A 1KBLA 4XO6A 4Q33A 4FNRA 2OFJA 3LMYA 2HS6A 7ODCA 1H61A 1D2KA 1W5MA 3MSYA 1GKQA 4PCNA 3GDRA 3MU7A 3JS3A 2VCBA 1ZCOA 4KWOA 1NWUA 2EPOA 4O12A 3DC0A 1IT0A 5I77A 3VC5A 4AY1A 4C6JA 1KM5A 2INEA 5LIUX 4C6PA 4KRTA 3BLOA 4S3BA 3SRHA 3TJLA 2DW7A 2JQXA 3P84A 2PGWA 4GUHA 4B15A 3THCA 3EX4A 2Y70A 4U4MA 2OEMA 4KCWA 3RNDA 2Z7KA 4NP7A 1WO2A 1KWKA 1GYMA 1ZALA 2AGKA 4MZ8A 4ICMA 1L9WA 3ARXA 2XPKA 2C3ZA 1QJWA 2DVXA 4FLRA 5E6YA 4EXBA 4E2BA 1N8FA 4K37A 3USZA 2A79A 2OCZA 4D8ZA 1TV3A 3WL0A 5DY3A 2RDTA 1IIHA 1TE6A 4PYSA 3DFHA 5G4WA 3OLEA 2ZVIA 4Q8PA 2F8QA 3LCHA 4IFOA 3S8HA 4QG8A 3WLJA 1LOLA 3MPGA 3ARYA 4B2DA 1T5AA 4WR3A 2YB4A 1BWVA 2OYKA 3UPWA 1DXEA 2RAGA 4H6QA 2W62A 5BW6A 1B3WA 4AHQA 3PSWA 3R13A 4ZB2A 4XKMA 3QTGA 1HL8A 3VNKA 4AMCA 2CZVA 4N2YA 3M0KA 1YADA 1EA9C 3TQPA 1BXBA 3CV6A 1VZWA 2F2HA 3RX3A 4A3QA 4GG9A 4CU7A 3LI0A 4JTTA 3TN3A 4M5PA 2YJQA 4E5TA 4HPHA 2VVNA 1GG0A 2FTYA 3OZOA 4LAKA 1C93A 4HB7A 3GHUA 2QPXA 2PE4A 3APYA 1C8QA 2Z1KA 3VFLA 3MBDA 3W70A 3WH9A 4J27A 3VO0A 4J2PA 3OLDA 3LZ3A 3AJXA 2ISVA 3M5YA 1HW6A 1ME9A 4I9MA 3OIHA 3VYLA 4PB4A 3G0UA 3MJYA 2HVNA 1I2QA 3C2RA 3W7HA 2BVYA 4N42A 3WEOA 1H63A 1EOKA 2RJHA 4PRTA 4PCSA 3MYPA 3IVUA 4RKAA 3ANVA 3VNIA 5C8BB 1FUYA 3TYCA 5AC7A 1EHNA 3H4XA 4JX6A 4TU1A 4L9ZA 5AC6A 4CQ9A 3MI3A 2IPWA 4JQ3A 4JIEA 2ISWA 1KFKA 1EO7A 3WH6A 4UTUA 4CN4A 1BQGA 4MOZA 1J6PA 4W86A 2QPUA 4ICNA 1S3HA 2NV2A 4AY7A 3WEMA 3ZT6A 4QHRA 1VBRA 4GJJA 3S4TA 2E28A 3WF2A 3W1MA 3NO3A 3WQ5A 4M6PA 3GZAA 1YHTA 1DHPA 1H51A 2P50A 3VUSA 3BOXA 5F2LA 3R0DA 4M29A 4H9UA 4OT7A 4HNTA 3ARRA 1MXSA 4LUTA 4J3VA 1J2BA 2FPVA 3F4DA 1XLCA 2WNQA 3NQBA 2DZTA 4ICCX 2ZUTA 2HWGA 1W17A 3LQGA 3LV6A 1R86A 4IPPA 3BH4A 5D9PA 3N25A 2QZRA 1GYNA 4DWDA 2C0AA 3VMNA 3GWQA 3AHTA 2TPSA 1W9VA 4DPPA 1B30A 5T8GA 1GG1A 4GKTA 1UHVA 4GVHA 1HTIA 1DIDA 3WUEA 3P6LA 1BWLA 2CESA 1RV8A 1KLZA 2A4AA 1CLKA 3DHDA 4ZQNA 1EQPA 2OZ0A 3AIVA 4H9VA 3ITTA 4LUIA 3HN3A 2AKZA 5EFDA 3ZJ6A 4UXDA 1V3HA 3FFSA 3BTNA 1SZFA 1IXPA 5DMYA 4FPSA 3VDBA 2IQ0A 1QHZA 3VNMA 2VCAA 1WZKA 1JZ8A 4D2JA 4LXFA 5I00A 2DJXA 4GO9A 3NUKA 3R58A 1GNXA 1K8XA 3DX5A 2EG7A 2V30A 1TG7A 1G4EA 4AYGA 2PWVA 4MKNA 3NQVA 5FJJA 4PR4A 1Z42A 2G3JA 5TD4A 5A94A 1F7BA 3TOPA 4C1NB 2Z0IA 3XIMA 3AMLA 1XFCA 1RALA 5DT5A 3VIJA 2QDHA 3E5BA 1XISA 1S38A 3GNDA 1XFBA 3EWZA 1CXLA 1VBHA 3TVAA 1JD7A 2WSQA 2ZTKA 3N34A 3WF3A 1RR2A 4L61A 2E25A 1E4NA 3UGRA 4XKYA 1J5SA 2QIIA 1TZ7A 2Z6IA 3GNOA 2ODOA 1CDGA 4GYFA 3CV7A 4PEKA 3POHA 5BU9A 2GVEA 4Z42C 2D73A 3N2XA 2Q01A 3G1XA 2PWDA 4IIFA 4QEEA 1E6SM 3RM8A 8CGTA 3WH5A 3PZGA 4FP1A 4PSRA 3TMQA 3LRLA 4I5XA 4C7GA 2X40A 3GW3A 1VPQA 4JPGA 1VQTA 1LWHA 1E1EA 4S3EA 5C2XA 3SR7A 4MHBA 1MYRA 2QCDB 1Q45A 3RX4A 5EBUA 4WEVX 1E3XA 4Z17A 4W4QA 3RR1A 1KC7A 4HQVA 5E0FA 3LXCA 1KM6A 2WNNA 2VR4A 2DT2A 2D69A 1FXPA 3EMQA 4H83A 1NDZA 4Y9AA 1V3JA 1XLLA 3OBKA 1EIXA 2BP1A 4AG0A 4TOQA 4UNKA 1H7XA 5CBIA 5D37A 4XBJA 1MSSA 4YTRA 1AW1A 3AWNA 4HCLA 4CCZA 2XISA 3S1UA 2WMFA 5KZ6A 3QV8A 3AMCA 3APTA 2PDQA 3QH2A 3KBMA 4CNOA 1XYCA 1OY0A 3SRFA 5PTDA 5LNUA 4UFHA 1LT8A 2V6AA 1FWTA 3W7OA 3EX2A 1J10A 4JZ5A 3LYEA 2VEGA 3UWEA 4MB4A 3AFBA 2C7FA 4HSHA 4A29A 4W89A 2WKJA 3QZAA 4KCTA 4AU0A 2CZ5A 4NVTA 1YXYA 2BB0A 2BNJA 1KKOA 1D9EA 1VGAA 1NOFA 1V6VA 4NYYA 4E4UA 3NAVA 2VGGA 4I7WA 1Q8JA 1OC6A 3CWOX 3LNMA 1DTUA 5CC6A 1D3HA 1TPH1 3BMVA 4L6DA 1XBVA 2C91A 3GHTA 2V2CA 4XO7A 2C71A 3UG5A 3W7KA 4YMZA 1P7TA 2VGBA 3VOJA 4QCFA 4FR1A 4HU3A 3RRAA 3N04A 4AZ7A 2WWCA 3H6OA 3WUGA 3WJXA 4R33A 4DYEA 3E0FA 3C52A 1ZL1A 1KFBA 4H9TA 3QY7A 3MV01 1RP9A 4JY9A 3GX9A 1ADSA 2H3BA 2PRHA 5CGQA 1ITUA 1B3YA 4F0LA 2ZZ7A 5I24A 2ISFA 3E3HA 4LSBA 1RVGA 3EB3A 4X60A 3F5JA 3FA5A 2P8BA 1ZTVA 4CQBA 4WQ6A 3MP5A 3WH7A 2BZNA 3QZ6A 1G4PA 2XN0A 1WP6A 4Z0JA 3SUSA 1YDOA 4PBFA 1S5TA 1EC9A 5HQEA 4NZ3A 1XYAA 3TTSA 3T0TA 4PULA 4XAPA 2VD8A 2DGAA 4PH6A 4YNGA 1NVMA 2J25A 3G1RA 1NDVA 4DJDC 1E5JA 1E6QM 4AC7C 1QT1A 3EXSA 4B9ZA 4V1YA 1AZ2A 4J35A 4AZ5A 1W56A 2HNEA 1T8QA 4HMDA 3GUGA 2ZE3A 2O9TA 2QF7A 1FBAA 4FI4A 2XTKA 1GKPA 4A3RA 2VZVA 1IT8A 3U48A 3FDGA 3SCNA 1FWRA 1TPVA 2XUCA 1DE6A 2V3EA 1NP2A 4LC6A 1HXJA 2ACUA 3CHDA 4FIQA 2BHYA 3E74A 3LBCA 3SECA 2ZX9A 2E67A 2UZ9A 2QMJA 1XYFA 3E96A 3W7EA 1BFNA 5BYWA 4IM4A 2V5KA 4A05A 1XJBA 4DBDA 3BC9A 1IIGA 3UP8A 2CLKA 3T44A 1IEWA 1IWAA 2PEVA 3THAA 1WDWA 1OCQA 2FTWA 1NWTA 1PAMA 1G4TA 4NRSA 1OX5A 2C18A 3EA3A 1TV5A 4LH8A 2OODA 3LGGA 3QC3A 3WMLA 3O15A 3GLCA 4JTQA 4LS2A 4FNPA 3CT2A 3WD0A 1UMYA 1E40A 3GW0A 3B8TA 3ITXA 3CUJA 3MUY1 2XSXA 4M1RA 2ZUSA 4O0QA 3NOYA 3MVTA 3FW6A 1RJPA 4O8AA 4MSSA 5LIKX 4J7RA 2Z24A 3V1PA 4DWSB 3WLOA 3AYSA 3NPUA 3LCFA 3Q65A 4BS0A 1JZ5A 2EG6A 1B4EA 3WJWA 4UQAA 1A49A 1J18A 1JYNA 1V0NA 2BGSA 3B9DA 4QCEA 9XIMA 4QX4A 5HUOA 4EOUA 4UMAA 3H24A 3OG3A 1UOKA 3S1GA 1SPQA 1Y65A 1EC8A 1JZ4A 2D1ZA 4I9AA 4MNLA 1PVNA 2POTA 2R8WA 3KS6A 1I9CB 3GK0A 4GUIA 1W32A 4B16A 2CU0A 3ZVHB 1N2VA 4QS6A 4RDZA 4LF2A 4I6KA 1G67A 3CYJA 3C2OA 2G4FA 1DL3A 2DIEA 1P1MA 3N1AA 4M3PA 2O9OA 1ODUA 1EJUC 3IEBA 2QYGA 3U9IA 3C5QA 1Q6GA 4WX2A 1CNVA 2OEKA 2CXEA 4JEJA 2FJUB 4M0XA 2FZDA 1F3XA 2PUZA 5A95A 5B7YA 3L0KA 2YXGA 4FMVA 4ZQPA 3BOFA 4MWAA 4J5NA 3UXKA 2BTMA 1OT1A 3W7DA 4WHBA 4YU1A 2HCVA 5GJNA 3NOEA 4IPLA 5DCBA 2OKOA 1E55A 2SFPA 4HHLA 5GQBA 1MQQA 2PLMA 3LCIA 4DLMA 2D2JA 4XISA 3JRKA 2PBGA 2G0WA 2AQOA 5AECA 1MRAA 4IMFA 1CGUA 4CQ8A 4N9EA 1JDEA 2VFHA 1MRQA 2FMNA 4ZQRA 1GZGA 2GUBA 3Q45A 2D2GA 3GAKA 4U33A 1UCWA 4YLWA 4JKKA 4UQDA 5LA1A 5D9NA 4AVFA 3CH0A 4P7RA 4C5YA 4PB5A 3HB9A 3TAKA 4JDBA 2BGNE 2FHCA 1KRAC 4B5XA 3NSNA 3BGAA 2V82A 5KZMA 1TREA 2VEIA 3KLLA 1PE1A 4JCMA 1VH7A 3W25A 3LLFA 2VFDA 3VUPA 1U33A 5HPOA 4DNHA 2PDLA 4R3UA 5KITA 5D2YA 3LS9A 5FESA 2J6VA 2YA2A 2HSAA 2J8TA 4BQ3A 2AAAA 4ZENA 5CZKA 1UA3A 5FJTA 3I7SA 3FJLA 4DNMA 2VEFA 1UR9A 4MGGA 4ILSA 2I56A 1YYAA 1IXOA 2UV8G 3PBGA 3CIVA 3WLMA 5F4XA 4F2TA 3S9YA 3LCLA 4G9PA 3DENA 4XTIA 3XISA 4TVUA 3DFNA 5FL0A 3SUTA 2PGFA 3FHAA 3T0BA 1KA9F 4O50A 2YR1A 3MP3A 4F0HA 1VFHA 4TQTA 1RA5A 3TYEA 3FDKA 4DN1A 3SADA 2YDRA 1YE4A 3OYXA 1XD0A 3W7CA 1L6WA 1W1PA 3CZKA 1RSCA 3WDQA 4W88A 1UH4A 3PAJA 4TVDA 3WQVA 2YA1A 4JQ4A 1DWIM 3V1HA 3W1LA 3UD6A 2EPLX 5D03A 4G6CA 3ZM8A 2WO5A 3O16A 2ZFAA 1RK5A 4ZCWA 4A8IA 4YN5A 5AYIA 4AIEA 3CUGA 2FH8A 3CL6A 1JEZA 2ZZ5A 2ATMA 4K2SA 3HA1A 2ZTJA 3C8NA 2CKRA 1JQVA 3SQMA 3LCWA 5IFPA 4R34A 2ZDRA 4IMDA 1YBQA 4DX3A 5CKSA 2F2KA 3W7JA 4POCA 1UQYA 1OK4A 2I5IA 3IJIA 4IXXA 3ELFA 3B06A 2TSYA 4EX4A 2GK1A 3K4AA 2X09A 3HJZA 5I3KA 4RE4A 5XIMA 3HBLA 4GA8A 3S1WA 1WDQA 2NXGA 3C0SA 1O1HA 4W7WA 4WOQA 3OW1A 1R47A 4LS0A 1R38A 4HOWA 1VIWA 4EAMA 4M6QA 4ZXLA 3P74A 1RXOB 2DSVA 3BZJA 1R3VA 3SCQA 1YTEA 2V5BA 3KTSA 5LNVA 4B5NA 4ONVA 3GTXA 4MNKA 4GH1A 3GS6A 4YL2A 3ZR4A 1G9HA 1IE7C 2W91A 1PJ9A 3FX4A 2QW5A 1UUQA 2HBVA 1M03A 2QCFA 4TXEA 1QFEA 3W2JA 1L6SA 2XSAA 4KWSA 4TX8A 1EZ2A 5CC3A 1OIFA 3T55A 4F2BA 5JQ9A 1ZHAA 4RUBA 2I14A 1E1CA 4B3LA 1S1RA 1R9ZA 4GXMA 3WIJA 2WZTA 1JULA 2I5QA 2VO5A 1RPXA 3IUDA 4QDWA 4JGDA 2XM1A 1OF6A 2DSUA 1JYXA 3PBMA 3GIQA 4GX8A 3B8UA 5MHBA 1HVXA 4C90A 3VGDA 2PDBA 3TCSA 4OUIA 2CLEA 1TTJA 1TJ0A 4F9DA 4QE4A 3W1XA 3NQEA 4KGLA 3T6CA 4HHHA 2ISDA 4E6MA 2TRSA 9CGTA 5H6HA 4ORIA 3QYQA 3AS0A 3WQCA 1I6NA 2DY3A 3NGJA 5C2GA 3ITYA 1XDJA 2ZYFA 4I5RA 2B0MA 1JZ7A 2BX7A 4GI8A 1KCKA 1B3ZA 4DO6A 1CI1A 2W4XA 1FVPA 5BMWA 5K4XA 5HNRA 2PWGA 4HTBA 5F7UA 4IG2B 3XINA 3DGBA 3INPA 1A5CA 4PCPA 1H7RA 2I9UA 1JR1A 4BF5A 3JVAA 1OFPA 2EKGA 2ZWYA 3D46A 4S38A 4RR4A 3DUGA 2QV4A 2GJRA 1UC4A 2DH2A 1J8VA 2WYSA 3DKJA 4NT0A 1LROA 1AMYA 4GYPA 4LVAA 4N6EA 2Z28A 1RD5A 4MWAB 3LLXA 3UY8A 2HZGA 3P61A 1AL8A 1E6PA 3GFYA 2OJPA 3GH7A 1VYPX 4ZSUA 3PZNA 1VLIA 4DWSD 1NFGA 4QEHA 1ECEA 4JTUA 2UY2A 1W3LA 1EPXA 2QUVA 1QHPA 2OB3A 3WN6A 2NVDA 4LB3A 4FF5A 3RUBL 1GYLA 1X98A 2OYMA 3WBEA 1GOQA 2I9EA 2ONEA 3N6QA 3AXIA 5C9XA 1BVNP 1TR1A 3VE7A 1P6CA 3U2CA 3A5VA 3EKGA 1CENA 4TIMA 3K1GA 1XYLA 1ZP3A 2INZA 1A3XA 2XJ7A 4IQEA 2V68A 2CC0A 4FF7A 1I2RA 1MXGA 4LT9A 1ELSA 2E77A 4MB5A 3UJ2A 1UROA 4PL2A 1A0EA 3FV9A 3E0WA 3MUIA 4PL1A 3L68A 2QEZA 2WSYA 3DEQA 2BGQA 1FDZA 1DBTA 3V5FA 3GAYA 3RIKA 2GOKA 1S2TA 1DWHM 3QFEA 4PTDA 3ABQA 3MV11 1M9HA 3V5CA 1XHGA 2XZ9A 2HISA 3MO7A 1Q6DA 3W24A 2BY1A 3H26A 4QJ4B 5REQA 2C13A 2V5LA 1O5XA 1DORA 3QV7A 3PUDA 4F79A 1LRQA 1V51A 2CLIA 3QTPA 4YTTA 4NX5A 2QXWA 4NJHA 5FJRA 1O5KA 4ZMGA 1FHUA 4Y9MA 4OBTA 2IKIA 1PKMA 3B0YA 3V3WA 2O9PA 3GDBA 3WDPP 1EEXA 1SVDA 4XAZA 2DV0A 3WFAA 1AH4A 4UOJA 4LW7A 2P76A 3FGCA 1YX1A 1VYRA 2CWNA 1Q6LA 1YPXA 1MO0A 4MWAC 1ZBCA 1W9UA 1PB0A 3DZ1A 3UXLA 4WZHA 1F3EA 1PX4A 2ZOXA 4GC4A 3STFA 3WNOA 3GXPA 1Z32X 4R7OA 1RLDA 3RPTA 4BF9A 4DI9A 2HE5A 3GTNA 1W3TA 1W9BM 3G18A 3EOLA 4G2DA 4LQ1A 3O9NA 1KM2A 3GH5A 3PWGA 1NTHA 4LX4A 1TV4A 3NR0A 3PY2A 1UR0A 6XIAA 3QN3A 3LXAA 3PBYA 3SCPA 3IIZA 4FXRA 3NL5A 1QBBA 3WLTA 3T4WA 4CN1A 1TFVA 1E70M 1PKNA 1XDLA 4B5VA 1SMDA 4C91A 2Y89A 1X8CA 5DX7A 3MDUA 3VNLA 3CAQA 4H01A 2E09A 1HVQA 3WQGA 1N8IA 4ZEPA 1F6YA 1YXCA 1RLCL 2GJLA 3OOQA 4JIHA 4NJGA 2CHOA 3B0PA 4LCSA 3SB0A 3N17A 2CHRA 4K1WA 4RDVA 4B3KA 1EYWA 3EB4A 4A3YA 4EE9A 1TWWA 1VBUA 3HPAA 2X42A 4OV9A 3TU9A 1GVRA 4W84A 1JCTA 1BTCA 3WK1A 3AC0A 3UWYA 3G6MA 4Q8WA 3K2GA 2AKMA 3IIXA 1ZB5A 1OBAA 3A4JA 1N55A 2ABBA 4L7ZA 1GWJA 2ZZ6A 1OJXA 2VXNA 5IDZA 2PPGA 2V81A 4UR8A 3MUXA 2WVVB 2R9RA 4HNLA 1TO3A 2VYOA 5DRCA 4GQ0A 4Y96A 2WM0A 2PSNA 2ZA2A 3UPBA 3AIEA 1OEPA 1BRLB 3N11A 1E6RA 1H60A 3GSMA 3WF1A 3V4BA 1TMLA 2PTXA 4MB3A 1MDRA 5CGTA 4YIWA 5M1TA 4CKQA 4JD4A 4FNUA 3W7IA 4LV9A 3SUVA 2YL8A 3WJYA 4YWIA 2V67A 3W1RA 2BOEX 1KFCA 4NRRA 8XIMA 4RCXA 4XSMA 4MZYA 1UR1A 4QITA 3IIPA 4IG2A 3QV6A 4ZOAA 3O06A 1JZ3A 2BFGA 1W5NA 2Y7EA 1GQKA 3W23A 3B05A 1BVWA 3RAOA 1ZBWA 4N9DA 4DI8A 2OYLA 3K8LA 3QW3A 5C9WA 2BOGX 1TPWA 4GIAA 3UW6A 1DKWA 3W82A 2B7PA 3W29A 1TPDA 4W9TA 1V6XA 4Z2IA 1AQ0A 3LTSA 4FOKA 2PAJA 1FCBA 3TCEA 3PANA 1E43A 2VC5A 3HGOA 3TXVA 2GJPA 1KGUA 4IJCA 1C8VA 1Y8BA 3BANA 4KFPA 3BVJA 7ENLA 3C2VA 2XU2A 5CG0A 4TMCA 4AF0A 2VOTA 4Z2HA 4ADTA 4KRZA 2WWDA 3EMCA 4JTRA 2Q71A 3PF3A 2INFA 2E6YA 2EXOA 5ABFA 4K7YA 3S42A 5A8MA 4OZOA 1X38A 5D2WA 1JYVA 4PMXA 3BAIA 3LSCA 4DZIA 4X9SA 2EG8A 3ARWA 1U1JA 4RL3A 4K1GA 4AD2A 1H7WA 5CPTA 3O6AA 1E1FA 4AZHA 5FAGA 4ZB0A 4FX6M 4YHEA 2GDUA 1VENA 3B9NA 3LHYA 3TTYA 1SJBA 5ABTA 1V03A 4DBSA 4W85A 2OQLA 4L1XA 1B9BA 2GVJA 2XVKA 1W3HA 3KBNA 4L64A 4P7OA 3C8FA 2DVTA 4JAWA 1EGVA 2ON3A 4UB9A 2GWGA 3H12A 1QI3A 3G8EA 1ECQA 4NASA 3WQ4A 4US5A 2A3BA 4V27A 4LYRA 1ISXA 1TWIA 3IJ6A 4XX6A 4EIVA 3WLNA 1PS9A 3UNTA 3ABZA 4I8DA 4XZHA 5BZAA 4Q8TA 3RU8X 2HRWA 2IPGA 2CLMA 3H54A 1NAL1 1A4MA 5D8ZA 1KWGA 1CB7B 3KP0A 3QW4B 3EBVA 2VFEA 4LCQA 1JG9A 2ZXDA 4XKYB 3ABOA 5CPOA 1DQWA 2H8ZA 2Z6JA 3RG6A 4LBRA 3HM7A 3TWBA 5LYRA 5K3VA 1QO5A 1Z69A 4LJ3A 1W0MA 3DU0A 2WBKA 3NDYA 3D6NA 3K1DA 4IISA 2WC7A 7PTDA 1XRVA 2E9BA 2PGEA 4UFMA 4UIOA 1JDDA 1KBBA 4O57A 2WAGA 4GE8A 4AHPA 2WSPA 3GU2A 5J04A 1DWGM 4S39A 3PPHA 3DCPA 2NQHA 1UIOA 4U31A 1EGMA 5TNVA 3QV9A 5EMYA 4H7CA 4QG9A 4F8XA 3T0CA 4DBEA 3UR7A 3HPSA 6ENLA 3T07A 1EF2A 5KTLA 1KQYA 2PC8A 4Z0SA 2GGHA 3RYSA 1OGGA 4Q7IA 1B57A 4FX7A 4H2CA 4DB7A 3NVTA 2DZBA 4V2XA 3FN9A 2IW0A 3WX7A 1TQXA 3N2MA 1XS2A 4LRSA 1EB3A 2IMRA 1BSIA 4IZGA 4KFOA 3NSMA 4JDYA 5I6SA 1K6AA 3LHVA 4UTHA 4IP7A 1N7KA 4WRHA 2HROA 3G1DA 4ZR8A 4MM1A 3TX9A 1FCUA 1XP3A 3L9CA 5A8QA 4C6CA 1KQZA 2H9AB 3OIXA 4QAIA 4Q8OA 3M0IA 5HBFA 1MI3A 2CFFA 2GSJA 3UF9A 2WHJA 2Q02A 4P7NA 1XLDA 4HYRA 3NQ2A 2B7QA 2PI6A 5D33A 2QDDA 3CUZA 4QRNA 3WQFA 3OG2A 2YBVA 5C70A 1XSIA 2ZCGA 2DUXA 4PTMA 3D3AA 3EOUA 4IIBA 1N8WA 1WE5A 2EPHA 1K3UA 1MMFA 3AU6A 3WEZA 1B1YA 1B9ZA 1VIZA 1GQIA 4UTIA 1L6GA 4PEEA 4BWLA 1RP8A 4JOMA 3W2KA 1GKRA 3VNDA 3QPZA 3OGRA 4H8NA 1SZRA 1WAWA 2P3EA 3L5MA 4L6OA 1GTEA 2XVNA 3L2IA 3GFZA 3Q4DA 5CSSA 2QGHA 3KP1A 3BW4A 1A53A 1M04A 2V9DA 3GUWA 4LUTB 1A5UA 1S39A 4WGXA 2DT3A 1DQXA 3QSRA 2FHFA 2XH7A 1EX1A 1I0DA 3NEHA 3UCDA 1XBYA 2Z4GA 4B4FA 2VC7A 4PC8A 2QVHA 3E2RA 1H49A 4EWJA 1HX0A 4MJMA 1ZGDA 2XYLA 2GJNA 2ZQ0A 2VEMA 1EX5A 4B4HA 5DY2A 4NXSA 2E5DA 1VYSX 1OFAA 1OZMA 3HURA 1CGYA 3GXNA 4IUGA 2OGJA 4GQBA 5G1MA 3QPYA 2J77A 4PCTA 1ISYA 1JCJA 4XUGA 4BA0A 4XD4A 3N4FA 3TUUA 1J79A 4HHPA 1E6ZA 3E1F1 3PUGA 2ATSA 2X1RA 5HANA 1BVZA 1X6UA 2NUXA 3ES8A 5MKGB 3M6DA 1MEIA 4B92A 1MVYA 4K6AA 3B97A 1QI0A 1X8FA 1OCNA 4MADA 4KRUA 1GW9A 2FGZA 4BQ4A 3MTWA 1VBGA 4P5UA 4H9ZA 1DP0A 3UR5A 1DHKA 4JTSA 1HKIA 1DVJA 4GIEA 2CBIA 2G41A 1BQCA 3TFXA 1HKWA 2QNEA 1UWRA 3MSDA 4NL1A 3BQ6A 3BL3A 4UTTA 2O56A 4PMJA 1TTQA 3WKZA 4RXGA 4MJ4A 1H5VA 5FIPA 3GNNA 1HP4A 2XH0A 3WZ0E 4IPNB 2D3LA 8TIMA 1R6WA 2QJGA 3I65A 3W72A 2NWRA 2X1SA 2X1UA 5CJ5A 3R25A 1PIGA 1XIDA 3W6YA 4AX6A 1KKRA 4IIEA 2R1MA 4RW3A 3O1NA 3W7GA 3HMJG 2O55A 5H8MA 5FKYA 2P0OA 5C0QA 4ECLA 2HBXA 3T42A 3UG8A 2NQZA 5SWUA 1F76A 1RBAA 3U57A 3IV8A 3KCOA 1UP3A 3H2CA 3LPPA 3UWQA 2CLFA 4PZVA 1S2VA 1XIMA 4IL0A 1QNRA 3L4XA 3N2CA 1ZLPA 1FCQA 3ZT5A 1B54A 4PA8A 1TIMA 4PUDA 1PV8A 5KZEA 3W7PA 1UMLA 3C86A 2VEPA 1KB3A 1M3UA 1BSLA 4B91A 4UTFA 3TZFA 4OIFA 3IAQA 3R6IA 4L9YA 3KOWA 3A24A 1E4LA 4JTKA 4Q7NA 3W00A 4KBXA 3ITGA 3GD6A 2J88A 4JS3A 4GYPC 3CTLA 2J7EA 3C0QA 1KBJA 4JKLA 3T8QA 1Z41A 4EAYA 2FZBA 2PDKA 5E09A 2WKGA 3VPLA 2WZEA 4GWEA 4LYQA 3UA3A 1JPMA 3BAKA 4JQAA 1XC4A 3IK2A 1X1OA 5CPLA 3FA3A 5I7GA 3FGCB 4IPJA 7REQB 1FFRA 3SCSA 1QW9A 2J8FA 1J0IA 1NOUA 3G6LA 1XRSA 3BLEA 3ZSTA 3F5LA 1X6LA 1C7TA 2X05A 4B5SA 4Q8VA 4D6DA 1EFZA 1O1ZA 1EDQA 2ZX8A 3EMZA 4OHQA 3B0VC 4Q6JA 1DWFM 1GVOA 2WHMA 2R6OA 3NZRA 1THFD 3PB0A 1XPYA 3FXGA 1EBGA 2VDIA 2PWFA 4JFVA 3D47A 4X0NA 4OJYA 1Q8AA 4XWUA 1YPIA 4IOTA 2BMBA 3W26A 1QWGA 4WKFA 1NQ6A 1UQZA 1K4HA 3OVQA 2HXTA 4EPKA 3W86A 5HOSA 3UJRA 2VFGA 3WK2A 4AZIA 4BR1A 1P43A 2ZICA 2WW5A 3TC7A 2DSWA 3V36A 1JZ2A 1GJUA 3E49A 3LSBA 1K6WA 3GU9A 2NQLA 3N2TA 4ZQCA 4ZODA 2XGBA 1Q3NA 4GGBA 3BW3A 4QSFA 3BZGA 2BXVA 3ID7A 5AFDA 3PZVA 4RK8A 1O5RA 4M82A 2WMHA 2GZXA 3WQWA 3ZR6A 1LQAA 4AB4A 3CQHA 5LA2A 3O2LA 4EF8A 3MBFA 1G01A 2E0PA 4GVIA 3DERA 2UY5A 2E40A 3N9KA 1UPPA 2GDQA 3B40A 4Y7EA 5CJNA 4UCGA 4AHOA 3POCA 4IGMA 3BAYA 3MW7A 2ZUWA 4AZGA 3NL2A 4F66A 4Z2JA 2Q09A 2V5JA 2PA6A 1JIBA 3F1QA 3CHEA 3APGA 2GK1B 4H9YA 3UR2A 1K03A 5E70A 3DIPA 3AHXA 3IJDA 4WDUA 2DPEA 3GB6A 3THQA 1GHRA 2EKCA 1EPVA 1T99A 3V0TA 1UR3M 5D05A 2IKHA 1RHCA 3AS1A 3CQ0A 3OZYA 1DTNA 3SUWA 2F9RA 2NLYA 3TW7A 3H2AA 1IEIA 3N12A 4KWVA 3W7MA 4WDXA 1B2YA 3IK4A 2PWEA 2PP3A 5LNWA 4L80A 3TZNA 5IBXC 4Q8UA 1E6XM 1E71M 3IUIA 1AW2A 4DJEC 2HMCA 2V63A 4TTUA 4LAZA 3PG9A 3QXBA 1ADDA 3U4AA 2BY2A 3E2VA 3ZQ9A 4QTGA 4PFMA 1TA3A 1BLIA 2VTFA 1GZ1A 1VCFA 4PUMA 3BLDA 4JYEA 4Y9NA 1V3KA 1QNVA 4IX0A 1UH3A 4NJIA 2F38A 2AMGA 2XSBA 4XZMX 1UC5A 1M7PA 3VOFA 4PUKA 3G1FA 1M7XA 3WD3A 2YXXA 1EBHA 3G0XA 2PDHA 2VVSA 5JBFA 1RCOB 4JX4A 4KKXA 4FXJA 1RQHA 1UKOA 2WVTA 1WBHA 2OWXA 5CBJA 4LWWA 4PMOA 2UWFA 4WXZA 4QFUA 1BRLA 3VE9A 2WPBA 3F2BA 2CIPA 3GDKA 3FJ6A 2NVAA 1PIFA 1CGXA 1RQEA 4DXKA 4G5DA 1ZRQA 1V8EA 3L4TA 4JR5A 3ARQA 3RO6A 1DJIA 3MO4A 1KBKA 3P82A 1WDRA 1Z3NA 3KOFA 5KMYA 3ZIZA 3HZ3A 3M6YA 2VWSA 4NQ1A 1AVAA 2QPSA 2E68A 1HKMA 1BEUA 2PP1A 4RE0A 1OYBA 1E4MM 2GGIA 2A5HA 4A35A 3O05A 1UA7A 4FNQA 3OB8A 4BHYA 4ADUA 4XZLX 2EJAA 4YJ5A 4NG3A 2BOFX 4Y9PA 2C16A 5HUPA 1EYEA 1UPMB 4RZ4A 3KBWA 3VD4A 3BK0A 3KM8A 4FXSA 5DELA 3U5UA 3FCPA 2Y1HA 2AQVA 3EOOA 5DT7A 3KDNA 2YCIX 3RPMA 3VINA 3E2QA 5CC7A 2ZXBA 4PSPA 3N13A 4FNTA 1XLHA 4GYJA 1HN1A 3VABA 2W63A 3PFMA 4LEFA 3M0YA 2OPJA 4LUJA 4C60A 4B5TA 3SCVA 4AEFA 1LYXA 3QEZA 4HZ7A 1V93A 4LBUA 1TX0A 3SQLA 2V3GA 4NI3A 3VA8A 3B4YA 4TX9A 2NQ9A 5LXXA 3WMCA 1QOQA 3PAOA 2PD9A 3L5AA 3A5FA 4D72A 4UZUA 1W37A 3WD2A 1WV2A 1C92A 4KCUA 3SGUA 4L4PA 1U1HA 1I60A 1TZ9A 3CBWA 2WNWA 5C5YA 4KCVA 3UR8A 3ZZ1A 3C2YA 3GVGA 2JGYA 1YDNA 1JF5A 2RHGA 3FOKA 1H41A 1GK8A 3FLUA 1SM9A 4BJHA 1W1ZA 2CWXA 1EJWC 3PFRA 3DFYA 4CEUC 4ZGYA 1SYTA 2I16A 3CK5A 2PTZA 3BGJA 4H2HA 1Q13A 1VCVA 3LN3A 4DPQA 1E0TA 3M41A 5A2CA 3U7BA 4CQAA 1Z44A 3G1HA 3E12A 5I3HA 4AH7A 3UERA 2CEQA 3CL7A 1VFUA 1JCNA 3CMGA 3BSHA 4RZ6A 1Z8AA 2F6XA 2X0SA 3RXZA 3TA6A 3DI1A 3UFYA 2CYGA 3ZMRA 3H7VA 2A3AA 1EF3A 3EWBX 3GO2A 1RD6A 2VC6A 4WCJA 1F9CA 4EPDC 4C1LA 4Z1YA 4REQB 2XFRA 2ZC1A 5D38A 4B3ZA 4RPPA 1JRBA 3GYEA 1X7IA 3F2DA 1W8SA 3LD5A 1LUCB 3QKZA 1SJAA 1I1XA 1FKXA 1SJDA 4MJZA 1OABA 4KIEA 1R3RA 1PBGA 4XAYA 5EMJA 1KCLA 4LANA 2JFEX 2VENA 2XDFA 3MCMA 3ZWTA 3TMLA 4I9TA 2NUYA 2Q8ZA 2OSYA 1ZBVA 2YFOA 3E0LA 2XIOA 4RNIA 4XIMA 2JEQA 4WD0A 3W1NA 1T6MA 1FKWA 4HPXA 3VC6A 2XFFA 4UR7A 2R14A 2NT1A 5ENLA 5M5DA 4BI6A 3M4HA 2FVMA 1NF7A 3UGVA 1G69A 4QE5A 3HGRA 3UYCA 2Y2WA 3EDDA 3TTOA 1CIUA 3P7YA 3W75A 2ZUVA 4AQLA 1ZQ5A 1REQB 5K2ZA 2BS9A 1NP0A 1C9DA 1G4SA 1H0GA 1QO2A 3AROA 3CWHA 3NZQA 4RNJA 5J5DA 4R9XA 2PRLA 1WZLA 2E5BA 1FWWA 1I4NA 1KXTA 4DYKA 2G5WA 1YNPA 1WAUA 3TJ4A 1J4EA 1CWYA 2NVCA 2P10A 5I09A 2WZMA 2OGYA 4AXNA 4IHCA 3FJNA 4E4FA 2BV9A 4Z1CA 5K9DA 3FJ4A 4C6EA 3LBOA 1V77A 1UKTA 3SIMA 4K8EA 1GOXA 1IHIA 1D7FA 1T96A 3REQA 3ALGA 1TPFA 3V35A 4M24A 1WBJA 1X97A 2A85A 3NL3A 3OLIA 4HMCA 1QPNA 4A6GA 5BXTA 4OTKA 3F4CA 3F5KA 5JBDA 1S1PA 4BZYA 3GTIA 2Y8VA 2W27A 4AD4A 3W07A 1H3GA 1J5TA 3G2GA 4GQGA 5CPQA 4ZO6A 3R12A 3VX1A 3PHAA 5DFAA 4U2YA 3VIHA 1ONRA 4HZ8A 1P0DA 5CLTA 3QR3A 4LEQA 5AZ0A 3L12A 4EPBC 2J9YA 3W4RA 2AAMA 4FSAA 1GOWA 1ZY9A 4LNYA 3LTYA 3H4WA 4GK8A 1H1NA 4PN2A 4DWSC 1P0KA 4PGLA 1CXEA 2PD5A 4O1DA 3BGGA 2J27A 3F4NA 3DC8A 1V6TA 4D6EA 1IEVA 4S3CA 3OVPA 4Y8EA 3PR2A 5M3WA 3ARPA 4IGNA 3VX0A 2CXGA 1KBIA 4QDPA 4V15A 1JZ6A 1EP1A 3N19B 2HV5A 3QRHA 1FQ0A 2WCAA 3DFOA 3VIIA 3WNMA 3NQFA 4J3UA 4ERGA 1LCOA 1QNOA 5JVLA 1PTAA 3MS8A 4MYAA 4C6QA 2IS7A 3TNOA 3VM5A 1QHOA 3FSTA 1VCGA 4I7VA 1NY1A 4X61A 4A8LA 3CEUA 3GG8A 4PODA 4PMYA 1UIPA 4IFKB 1AH0A 3QBUA 4NAFA 1IWBA 2NLIA 4LAUA 3AISA 3I3DA 2G3IA 3BV7A 1LJYA 3KWXA 1AD4A 2YW3A 2J8GA 4CVUA 2FVKA 4I5UA 3TQVA 3WUFA 1Y5VA 2DZXA 1ZJHA 4P8UA 3OLGA 3UYIA 1I0BA 1Q6QA 2XIJA 1RJRA 4J3SA 2J13A 1UWTA 3SRDA 3N4EA 3VD7A 1AMKA 2VGIA 3DFSA 3BURA 3UXAA 4ALDA 3M07A 1AW5A 4LCRA 2CBJA 2XG9A 3VNJA 4NZ1A 1KTBA 3IGSA 3W9ZA 2Z26A 2GQ3A 3VIPA 1GPFA 1JDFA 2E1DA 3KRUA 1PCWA 3HPXA 3VKKA 3CAKA 4LRTA 1RY8A 2CNCA 3MZ2A 3L4WA 2NXIA 1IZJA 3NWRA 1YEYA 3IPWA 1MDLA 2Y24A 5EY5A 5HQMA 2QDEA 5FSEC 1PEZA 3I4EA 1AZ1A 3KDOA 3W53A 1KD0A 3RLHA 1PYFA 5CC5A 1U5VA 4FHAA 1RUSA 3NQCA 1PSCA 4MWAD 3GY1A 2BVWA 1U1UA 4LVBA 1CTNA 4JQ2A 3PPGA 1WDPA 5LHFA 3ARSA 2VD9A 5J5RA 1MZHA 5E5CA 3F4VA 3RLGA 4WKAA 4NUWA 1T41A 4YVPA 5D30A 4G7FA 1US3A 2JF7A 4S2BA 2JE8A 4HSNA 3CAWA 3W1AA 3CPRA 3FXYA 3AHZA 1KXVA 3HQNA 1MZRA 5FF2A 5RUBA 4S23A 2BXZA 2JF6A 2CZDA 1FH8A 1HIZA 4JIQA 4JTIA 4DJDD 4WJEA 3WLSA 1LWJA 5CPSA 1ISZA 3IGHX 5GNZA 4QQUA 4OOZA 3WENA 4QQ3A 4L65A 1OYCA 1U2YA 5JH1A 5FD0A 3AQUA 4Y90A 3IRSA 5AYYA 3ITVA 3SFKA 5BOEA 5U4NA 5T9BG 1TIWA 4AISA 3AIQA 3N6JA 3GBDA 3OA5A 2A7PA 2D23A 4DY1A 5AKQA 4A2SA 2E9LA 1QPKA 3MUZ1 3USBA 5REQB 1O94A 3NVDA 1DWJM 4NI8A 3LX9A 2V2DA 4C5ZA 1D7KA 1N82A 2BWGA 4CU8A 4HK7A 3KLKA 3NQ8A 2VZOA 1WXYA 1T7LA 4MKVA 1FFQA 5I5RA 1ALDA 4ZFMA 4U5IA 3KW3A 2ZXQA 1R30A 4NZFA 3NL6A 2V69A 5D2XA 1UBSA 1UWIA 3N4AA 2ACQA 3PS7A 1WPCA 1OHLA 3BPWA 5A6KA 2BXYA 2CKSA 4GCXA 3FKRA 1JUBA 4IFRA 3UVAA 7A3HA 3CB3A 2GVLA 4QJ5B 5E1QA 1R7AA 3LA4A 4RXFA 3AXMA 4DJFC 2EPKX 3WLHA 3VD9A 1TQJA 4JHMA 3LMZA 4ROPA 1PWLA 2OSWA 2GDVA 4S1FA 3R8RA 1EWEA 1ZS2A 3I7QA 1OFRA 3CC1A 4C6MA 1I75A 2O0TA 1A5KC 4MNMA 2Z2AA 1XPGA 1BG9A 1I2OA 2P8CA 1QUMA 1W3NA 2OXNA 3P93A 2BHZA 3MDWA 1LBLA 3W6LA 4GFSA 3VVGA 2IXVA 1GEHA 4W5UA 4GLEA 3RLVA 1Q2SA 4XVDA 1QWKA 2BY0A 3PTDA 3SO7A 2NQJA 4UFLA 3CPUA 3K5XA 1L0PA 1Q4WA 5EFFA 3DXIA 5A6MA 3C0JA 4XZNX 2DUZA 3CEPA 4PMDA 3U2OA 5BOOA 4FK9A 2E6DA 5CZTA 3VNZA 3LK6A 4W93A 1JAKA 2ZX5A 3CS2A 3GXDA 1S2UA 1MWOA 3RJYA 3GNXA 1FA2A 3PNUA 2YL9A 1SU5A 1DXIA 4IT1A 1HJSA 4QM1A 2ZADA 5A8PA 4AD3A 3C2FA 1XH0A 3N15A 1IGWA 5DCEA 1IEXA 2G4JA 1K8ZA 3TXZA 3U8GA 1IT7A 4LY4A 3QLLA 4ZZ9A 3QQ0A 3B8DA 3RF9A 3ECQA 1U83A 3OPSA 1BYBA 1I2NA 5EKYA 4HMEA 1E0XA 3THUA 4ZL1A 4DBUA 3PC0A 4ASTA 3QR0A 2X2GA 5DCDA 4LF1A 1KM0A 3VZYA 3UG4A 3V0UA 3F03K 2ZRVA 3P67A 1NWRA 3LHTA 4JYDA 4GZIA 1J12A 2E1WA 1GOKA 4E8DA 4DELA 3PTMA 3T2OA 5E9XA 2YBTA 3GDLA 4S3FA 3ZSSA 3FYYA 3B0UX 5BXRA 5K7JA 2XINA 2X30A 5JBEA 1HP5A 2WOQA 1V3LA 3GFXA 2PTYA 3AS2A 5CSUA 4NAFB 3KCJA 2G50A 1XUUA 2J7CA 2PDYA 4TR9A 2FPYA 3LRMA 2E8ZA 3MQTA 3T1GA 1KCXA 4M7SA 3T2QA 1JDAA 4XD3A 5E0KA 4XZBA 4DVOA 4WJ8A 3CTTA 4RX0A 1LQ0A 1UWSA 1PZ0A 5A6BD 4NJKA 3KVKA 3OVGA 3R0KA 3UESA 3PZMA 1QDSA 5FJPA 4J9JA 1J11A 2I5GA 1A5LC 5F2MA 3A23A 1O68A 3DHPA 3W3OA 2Y7GA 3GRIA 4XZ9A 2OT0A 2J79A 2XIQA 3IANA 1TWSA 3CUXA 3C3UA 3PB2A 2GVYA 2VFIA 1BGGA 3DH7A 3RO8A 3RU6A 1DJNA 4R7WA 2X16A 1TE1A 1WOBA 4GCAA 1FH9A 4DEFA 4K8HA 3P81A 2YXOA 3AXXA 4K8GA 3LOTA 4GX9A 3BV4A 3IJLA 3BQ5A 4DXVA 2GWNA 3P62A 1UH2A 3VOGA 1FWAC 5FEWA 3TYDA 3DGRA 5EMUA 4KERA 4X22A 5DO8A 2VC9A 4W8AA 3TROA 1QI4A 3NM1A 1ML1A 5AY7A 1WA3A 5M2FX 3CXOA 1VEOA 4RNHA 1LL6A 5ABGA 4BK9A 3KVMA 4TUFA 1LRNA 1PKLA 3FA4A 3TP4A 3CIXA 3BAWA 1MQPA 3ONBA 4UQBA 3A12A 5I79A 4AZBA 1TELA 1SW0A 1TPB1 3L67A 5H2ZA 2CZFA 4MMWA 3DG7A 1K4GA 3RDKA 1YMYA 3NZ1A 1JUEA 4JTCA 4J28A 3WK0A 3T09A 2WZHA 2YGYA 5IFTA 2R1NA 1JFHA 3THDA 1VHNA 1UW9A 3WBWA 3VZXA 1PX3A 4XAFA 5KINA 1H0IA 1XKYA 2JALA 4K7VA 2OG9A 4L4MA 1XCWA 1QRQA 5ABFB 5HK4A 1UZ4A 1ESWA 4BQ5A 3NQMA 2ALDA 1XM3A 1SO4A 1U30A 1K7EA 2JKPA 5BXSA 1HQTA 2VURA 1HL2A 4LUYA 4JFSA 2ESCA 1CB2A 2IPFA 2PLCA 3PZTA 2Z27A 1LM1A 3NQ7A 3WO8A 3B8WA 1IWPA 5A6JA 1WZMA 4NNBA 4D6JA 3BE7A 3HTWA 4Q8NA 5DLCA 5XIAA 4M1BA 2NT0A 3AZTA 1J0YA 3MANA 4PCFA 4AC1X 4IX2A 4DM2A 4UFIA 3K8KA 3IJ7A 1CGWA 1NM9A 3BAJA 3GE7A 3Q94A 4JKMA 1LL4A 3KWSA 1V3MA 2BVTA 1EJVC 2VI0A 3OEXA 4DUWA 4GISA 4D6FA 1HJVA 4NU7A 3EKZA 1ZPTA 1B5TA 3ZJ7A 2Y7FA 3GXMA 4NILA 2B4GA 4REQA 1OB0A 1I45A 1UR8A 1IR1A 5AVNA 1MW1A 2FB2A 3LERA 1VFSA 4ACZB 1Y5WA 3Q2DA 3T05A 1H4PA 2HS8A 3VD5A 4GMEA 1GVEA 1GOIA 2Y5JA 1ME7A 4IIHA 1OVDA 2PWUA 4O11A 3HG5A 2X0HA 1YNQA 4LGXA 2W67A 3H23A 4IJRA 1E0VA 1SQ7A 2A1YA 1NQKA 1TUXA 1LOQA 1XSKA 1E6NA 4GUFA 2GQ9A 4I9JA 2WVUA 4EANA 4YYCA 2QQ6A 2YL6A 4BCEA 1EJ7L 5IOBA 3LTPA 1LG2A 1F05A 2YSWA 4FLSA 1JXKA 3HOJA 3PTQA 3CAVA 4CNNA 4LVGA 4C7FA 1XH2A 5C6MA 4Z1AA 2Q8XA 3O07A 3H70A 3M0JA 1WDSA 5AOUA 2F6UA 4K36A 3GC2A 5C55A 3CMJA 1QMLA 2VRJA 1A50A 5FI8A 1G1YA 1TPC1 3ERPA 2VELA 3VXGA 1O12A 3UXIA 1AFSA 5KSWA 1JAEA 1K7XA 3N9SA 2DZPA 5A2BA 1OX4A 1TVNA 1POKA 5A8GA 5KETA 2BY3A 3AS3A 2J7BA 3EAUA 3F7JA 4ZO7A 3W01A 4E0CA 1BYAA 4QLLA 1DIKA 5CAKA 4UQEA 3VIOA 2QUTA 2ICSA 3G77A 4HPNA 4ES4A 2POZA 4PMVA 2OVLA 3EDFA 1TUFA 3UZJA 4IQDA 4QDMA 3WBXA 1LLOA 1R9YA 3HGJA 1JI2A 3UZ5A 1NARA 4M7TA 4EWND 4IGHA 5CZSA 4A8RA 1OG0A 4O1FA 3SCTA 2UY3A 5KZDA 1WNOA 4DJFD 3LI1A 5AHIA 4IMGA 3WL1A 3UWUA 3TYAA 3NTYA 3E0IA 2NSXA 2B7NA 3RX2A 1EHAA 1AQMA 4L4LA 2FYMA 4O13A 2ZRXA 3L2LA 1S3TC 3EYPA 5BRPA 3T7VA 1CXIA 1QVBA 4CVWA 1Z89A 3PPCA 2YCLB 3NXFA 2R1LA 1EKOA 3S83A 3U0HA 4UOZA 3JUGA 1CLXA 4W8LA 1OFOA 3IGUA 4IL2A 3PP7A 5F2GA 1HJXA 4CD6A 4WK9A 2OX4A 2HTMA 1GT8A 3H2MA 1P6BA 4G1KA 4EKJA 3ZR5A 4RE3A 3C6CA 4HJWA 4WY0A 3TN6A 1FCVA 4IFKA 1TJPA 3UVIA 3TJXA 3SUUA 3NGFA 2XFWA 3PN8A 1UWAA 3W1UA 1E73M 3ONCA 3DG6A 4L56A 5JUVA 2DT0A 2WJFA 4ML9A 3W83A 1HFBA 4MKSA 2O4MA 3V16A 3P3BA 1ZAIA 3S2MA 3OODA 1W1B1 3DBPA 5TAOA 3P60A 3ZVIA 8RUCA 1FOBA 3KE0A 2V5DA 1H62A 3MVIA 2AGTA 3RLUA 3Q37A 2QAFA 1CGTA 1VFLA 3L23A 5EL1A 3CASA 4HGXA 2QUMA 1Q5MA 4H04A 2QMKA 2FKPA 4D6IA 3WCZA 4D9PA 4UTJA 2ZWZA 3R8GA 3TNBA 3I6EA 2CLOA 2DQXA 3ORWA 4P7QA 1JNDA 2W9MA 3TKFA 2WVSA 4DUOA 5GPRA 3ARZA 2NX3A 2X0YA 2KAUC 4X3ZA 2GSEA 4C6KA 4TX6A 4O14A 1M1BA 5HMEA 1MW0A 4NZ4A 3AYRA 1IXQA 4LUSA 4PMQA 1BPLB 1KFLA 2HEJA 3O6CA 3MUAA 1FWSA 6TIMA 2MANA 2BVDA 3WLIA 1RA0A 5D09A 4Q22A 1HNYA 4YYFA 4HNUA 4J3ZA 5AB3A 3CB8A 5AVHA 3OZMA 4H3DA 3NG3A 3IVTA 4LOCA 3LPOA 4FX8A 3CO8A 1AG1O 1O7AA 5BRQA 3N73A 2YFNA 3GKFA 3AOFA 1VRXA 4HKPA 3SZ8A 1RCQA 3TTQA 4F40A 3D3FA 3G1YA 1V7YA 3S2JA 4Q8MA 4MZ1A 4WLCA 1JF6A 1LORA 1GUVA 2Z1BA 4O8RA 2XIIA 3CQKA 3EWYA 4CN6A 3GR7A 3DYPA 2F61A 1Y0EA 3H53A 4XG1A 2G37A 3GM8A 2AL2A 3MY9A 3L4UA 3IIVA 3ISIX 3NPVA 4JXCA 4KMQA 2J7GA 1PX8A 2PC4A 1YDYA 4GC3A 1Y7VA 4CD5A 4K3ZA 3TQKA 4D6GA 4GI9A 1UP2A 5M17A 4QGCA 1RBLA 3AXHA 3EDKA 4KF1A 3QM3A 2PDNA 4O0ZA 3PZIA 2VZTA 4C65A 4E3VA 4KEUA 5HA7A 3UPMA 1JJKA 3RR4A 2OOGA 5H1WA 3SBFA 2X7VA 1G94A 3PWIA 4IIDA 3OZPA 2QJHA 2FTPA 1A47A 4ZFCA 3FIGA 4QAWA 3W7QA 4U3AA 1VRDA 5A69A 4QIUA 1TVPA 3WG6A 3STPA 1B31A 1A5BA 3U5YA 5TBOA 2A3EA 1W91A 3ARUA 5G5IA 3VMOA 1V6YA 3ATZA 1K8YA 3WH8A 2MUCA 3RMJA 3WDJA 5D9OA 5A6TC 4I7UA 4X2PA 4ZE5A 3GYCA 1E4IA 4JN7A 3U2ZA 1TV8A 1XIHA 3V75A 3ARVA 4HU0A 4WVXA 2X7WA 3OGSA 1WDDA 4AEOA 3CM4A 3URAA 4H9MA 4KEMA 3VTRA 4C6IA 1OINA 4ZSTA 2OTDA 4S2CA 3S6DA 3LGDA 2R1KA 2WJZA 3QQ1A 4X2RA 1OT2A 5KEZA 1DJWA 3EPOA 4EXAA 2FH6A 3NQDA 4MJ2A 1LBMA 3CHFA 2VKZG 4HSOA 4ENLA 3H21A 3TW6A 1GPWA 3L7RA 4LNCA 3VDCA 4LYPA 3CL8A 4V33A 3HV9A 1H7PA 1OFBA 1YW1A 4H6RA 4PB3A 3QHOA 2DT1A 1OM0A 4P8VA 4AZCB 3S47A 4N9BA 3EPNA 3CYVA 3VFCA 1PTGA 4NHVA 1KM4A 5GNXA 1RK6A 4PTXA 2DVUA 5LKYA 3ABSA 1J9YA 3KVJA 2OOFA 3W87A 3U4FA 2NV1A 3S2CA 3RCNA 3BJFA 4KQNA 4OU1A 1ICSA 2Y0FA 5I23A 5CSRA 1ZBKA 1EJTC 4HTYA 3EOEA 1W1IE 2Z1XA 3MHUA 3ATYA 4NKCA 1T0OA 1OX6A 2VUYA 5HPCA 1A4LA 2O7SA 2OU4A 4CLMA 3HU7A 5F1UA 3BG3A 3P8JA 5A3HA 2D3NA 3UETA 1DWAM 3WMSA 2YPIA 5FCZA 1VR6A 4KWWA 4IMEA 2J9ZA 2PCQA 2R24A 3BW2A 3K4DA 4O1CA 3URQA 2GLKA 1AA1B 1IGSA 4UBPC 3EDEA 2TYSA 3MWCA 2VP8A 3W22A 2PDFA 4DO4A 4CQDA 2OQYA 1NJJA 2QUNA 4AMAA 2W66A 1R87A 2X1IA 1R5YA 1OFQA 2VZSA 2JKAA 4JIIX 1SW3A 1VFMA 2A3LA 1KFWA 1P0BA 5AYXA 1O95A 3OGVA 2A7NA 2A21A 3R0UA 1YNYA 3MP4A 2QCHA 2Y88A 4LU0A 4HVXA 5CPMA 1QAPA 2ZKMX 1KFJA 3VCCA 4OUEA 3VOIA 2G3MA 2CLLA 2Z2UA 1WUEA 4G7EB 1RPKA 5EMLA 5LGXA 1FHLA 4B90A 2PCEA 1O4UA 5HXMA 4JTJA 4EK7A 3CZJA 3S3GA 4DZAA 1QTWA 5EU9A 4CD7A 1X7FA 2PMQA 3B8VA 1XBXA 2Y7DA 1DEDA 1GHSA 2RDUA 3WK3A 1QR7A 2VOMA 3M0VA 1E9IA 4AXKA 1BYDA 3QPEA 4IH3A 1UBPC 1YE6A 1ITXA 2ZE0A 4IJBA 3EWDA 1RH9A 2ZUMA 3O63A 1E56A 3M43A 3MMTA 1A5NC 1OZQA 4TMBA 1WKEA 3ALFA 2A3HA 2IPJA 3GVRA 1GEQA 2O7QA 1XLJA 4MFEA 4FEZA 4GBDA 3WELA 1M65A 1ZP4A 1TV7A 3LXBA 2F6KA 1S5MA 1KFEA 1UZHA 1O5QA 1W3KA 1OADA 3BMWA 3OQEA 3CUIA 4O0KA 4DJED 1R2TA 3HMCA 1CXFA 4DRSA 1VBJA 3PUOA 4LS1A 2VFFA 1U5HA 5AC4A 3BOLA 4LFYA 5L9FA 1V0LA 3BCJA 4GNKB 4UTLA 2JK2A 4O1EA 3SSJA 3SRKA 3L4ZA 1T40A 2HK1A 3C2EA 4J4KA 4QNWA 1K02A 1QW8A 5FEZA 3W2NA 1U5JA 3G8RA 2WSKA 1R3QA 1AH3A 3EX6A 2GJXB 5FL1A 3M46A 4D6HA 2DEPA 5CSYA 4DWSA 3CJPA 2FPTA 4P7LA 3UWWA 2OZTA 2XN1A 4GQRA 1VD6A 4PBGA 2Y5SA 3AHYA 3KCLA 1Q65A 5GNYA 3AXKA 1OG6A 2DFAA 1VJZA 2ADAA 1XKJA 4YTQA 6PTDA 1QNPA 3NIYA 4KEVA 2XVPA 2E7FA 4GINA 3LCGA 2FVLA 4NAEB 3LBMA 4C6OA 4UOQA 4DF2A 2XGZA 3VGEA 5D32A 3TQ0A 3CHVA 3EWWA 4E38A 5JIPA 3UWVA 4E8CA 4E4PA 1DPMA 3O0KA 4IF2A 3WFZA 4NYUA 1Q6EA 1OF8A 5AN7A 1FY6A 4OQVA 1SZEA 3NZPA 3EKLA 1S5VA 2W0UA 1S5NA 2PZ0A 1SW7A 5CJMA 1DXFA 1M7JA 4WDWA 4ZB5A 3MKCA 4FA3A 3R79A 1U22A 1UR2A 5U7SA 2V2HA 4MVAA 4ZO8A 3QVQA 5D02A 1XIBA 1L2UA 1SO6A 3SN1A 4S3JA 4U2ZA 4Q7BA 3NO5A 2Q6ZA 2OQHA 1R3TA 4LY8A 1WOAA 1ZU8A 2PZNA 5AC8A 5F4WA 1ZCCA 3VAVA 1XUZA 1WB0A 4XK2A 3W76A 5ABEA 3OP2A 3ZJ8A 3E5PA 3TC3A 1I2PA 3CLMA 5F4SA 5IBXA 1XIGA 3AIRA 3I7RA 3WDRA 4V1XA 1TKKA 4HNOA 2GUUA 2PDGA 4N4QA 4JTAA 4AUBA 1TRIA 3IWPA 4LUSB 2WJEA 2PDUA 9XIAA 1H50A 1AJZA 3BXWA 3TOYA 1MUWA 2ZRZA 3ZLGA 4HNCA 4KWUA 4M80A 3R2GA 1W3JA 5BU6A 3M7SA 5C9RA 5DN1A 3MMWA 4F4RA 2PDIA 2G3NA 2HJPA 3P8IA 3AMKA 1A5AA 3GVWA 2OO0A 2Y85A 4M6VA 3QR1A 4OE7A 1SSDA 3LRKA 1KO0A 2R82A 2FZ9A 5HNTA 1GGOA 4PMRA 3TK7A 4R9OA 1AUSL 3EWUA 3LG3A 4J1OA 3OQ8A 1RAKA 4BF7A 3QMTA 3JZUA 1K7FA 3ITLA 1C90A 2VQTA 2PLJA 2GQAA 1DJZA 1NIUA 1FWGC 1V79A 3OYZA 3QFWA 4X63A 4XV0A 2V5CA 4PUEA 4F9JA 1UD3A 5HJXA 3LQLA 7XIMA 4Q4KA 3AU2A 3EA1A 4N02A 2PDWA 2WMJA 1L6YA 1XX1A 1PPIA 3UWZA 3W85A 1G5AA 3SDOA 1HJQA 4L4OA 4JFUA 5DXXA 2RH9A 1CGVA 2GGJA 1MUMA 2H8XA 2VWTA 4IP5A 2J47A 4JICA 1UWUA 3OBEA 3TYUA 3WSUA 1XRTA 1OX4B 3S46A 1TYGA 2MNRA 4MIMA 1YRRA 4UTKA 4BEUA 1J0JA 1P7TB 2QIWA 4ACYA 5LA0A 3W2LA 5HWJA 3RGTA 1QI2A 1Q2RA 2YYTA 4F0RA 3NQAA 2X1TA 3W7RA 3LGEA 3H22A 1HKJA 3URNA 3GR4A 3A4WA 2DSZA 3M1ZA 2ACRA 2PDXA 5AZ1A 3F4WA 4DF1A 4LYKA 3BLPX 2XIBA 1QU4A 1VC4A 5FF0A 1HF6A 1VJSA 3QMRA 2C19A 4BKNA 3EEZA 1A3HA 1OCJA 3N29A 4H4IA 4H41A 3GH4A 5FAJA 2C1HA 3GDTA 2YYUA 2Y8KA 3EA2A 4X0VA 4DAFA 2DIKA 5CCZA 4CCEA 3L65A 2YIHA 4UTTC 3KOXA 5CPNA 2QCGA 3NURA 2PRMA 1SR0A 2VDGA 3UG3A 2VJXA 2QS8A 5FEXA 1XC6A 3D5HA 3ZLFA 4F3HA 2Z1WA 4YCPA 2V38A 3QYSA 2C15A 1LP6A 3UZYA 3VDAA 4D1IA 4ADSA 4A22A 5C7HA 4Q4QA 1KGWA 5CXPA 3L2MA 2DORA 3Q67A 4HOXA 3GC5A 3IS4A 4DXXA 5JIWA 3FVMA 1RQBA 4JTLA 4HK6A 5EMKA 3SGGA 1OSEA 5JMUA 1ISWA 2OX1A 1KV5A 3NPWA 5AHMA 2ZRUA 4J3WA 4IP4A 3H7RA 5AYZA 4M6UA 1WCGA 1BKSA 2WHKA 2DSKA 4E3TA 3W28A 4R7JA 3PWAA 3WFLA 3NQGA 2L5HA 5E6ZA 5G2HA 1R2SA 2VRKA 1OC7A 4F0SA 1B4KA 1EP2A 2XN2A 4E2OA 1HGYA 1UB3A 1QCWA 1SR9A 2C79A 5C2CA 4HA1A 1WX0A 3EX3A 1WYIA 1XDMA 1GQNA 2PTDA 3ZXWA 4AW7A 3NQ6A 3UBPC 4JFTA 1JPKA 5CQ1A 2CW6A 3WQ6A 2OZ8A 2OT1A 1W9XA 4GVFA 3VM7A 1QPQA 4N7QA 4QS5A 1EJRC 2GOUA 1F73A 3GVQA 4GZ7A 2PTWA 4UR9A 2BG5A 1E51A 2WKLA 3VKJA 1GW1A 3STCA 1IZCA 2Y63A 3KOYA 3FHQA 3CMFA 2PODA 2PDPA 2YCJA 3GG7A 3PBWA 3LY0A 3CLWA 3M7WA 3N9RA 2WZIA 3L5LA 2AL2B 5E9AA 1XD1A 1F3TA 2FHBA 2REQB 3H4GA 2PDMA 5BROA 3NFUA 1XWYA 1XLEA 1YTDA 4UTMA 4LVFA 3BCDA 4RV8A 1OCBA 1OQFA 3WMBA 4MUPA 2WLYA 1XQKA 4XAGA 2D20A 1KV8A 3VDGA 3WLKX 1JPHA 5JH2A 2HK0A 1DJGA 3ES7A 3JR2A 2VX7A 4JBRA 4U5KA 1JI1A 4O10A 2UBPC 3W27A 1SGJA 2D0FA 2W92A 4IMAA 3K30A 1W2PA 4AZ6A 1XRFA 4INFA 4S3DA 1SO3A 1FP9A 4W8BA 1MNZA 5HINA 2NXHA 4C6LA 3L21A 5HNUA 2V3FA 2XH2A 4QSHA 5IDIA 3N3TA 2PF8A 1DOSA 4KETA 3OJGA 2VX6A 4XD6A 1LUCA 3B4UA 1J0HA 2Y6ZA 3MT1A 5LGZA 1F4HA 4UQCA 4MAZA 1UR4A 3UQNA 3DBNA 4LVDA 1OK6A 3NSXA 4HN8A 3GG1A 1BYCA 1LL7A 3UA4A 1XLBA 5I02A 5EMMA 4J3XA 2EEXA 4O1BA 4HD5A 4HA0A 1KR1A 2NX1A 5GVJA 4Z2GA 3M44A 3BG9A 3VCNA 1CEOA 1OD0A 3QGKC 2YCLA 4QR6A 2WMIB 4AVNA 1VEPA 1ZJAA 3TLQA 3I6RA 3TN4A 1FWCC 3QF0A 3BSMA 4YS1A 4FLQA 2I17A 1NFBA 1XGDA 4ZOBA 1QBAA 1I8JA 1CT5A 4GPNA 1GJWA 5HMFA 4A3UA 2FGLA 4B9YA 2RFGA 3KTCA 4O4VA 3B9OA 2XWDA 3UZZA 4OFCA 3VOHA 1PZ2A 4W5ZA 2H9AA 1Q4NX 4BEQA 4YHGA 4LTSA 3S1XA 3TSDA 2Q3RA 3M64A 5DANA 1UKSA 2DZWA 5A6AA 1W5QA 4EVZA 2P88A 5DMNA 4GZJA 1G7UA 3M0MA 3PJTA 1F74A 4QNEA 4Z1BA 4DO7A 5D2TA 4H8VA 5AC5A 3W2UA 2YOCA 3GVVA 7REQA 1E72M 3BLLA 3MC5A 3STGA 4LB4A 2ZVRA 1TPUA 8A3HA 2GQ8A 4AIBA 1EO5A 4KESA 1E0UA 3GIYA 3IGXA 2R1PA 1C8XA 4G8TA 4AYSA 4GZEA 1XLFA 5HJLA 1QOPA 1G7VA 1LF1A 3LPFA 2ZDSA 2V8ZA 3EOSA 3AIWA 2BSLA 2FFCA 1R3WA 4JNYA 1UUMA 3CZLA 3GTHA 4G7EA 1KRBC 1WXZA 3S2LA 1P1XA 2TODA 2VR2A 1QASA 3E02A 2ZIDA 2PU0A 3YPIA 2CLPA 2ZRWA 3UCCA 2GL5A 2H3DA 1DJYA 4DIAA 2NX9A 1ZSXA 4OOUA 4WY0B 4GGHA 4Q4RA 1VB9A 3A22A 2YDSA 3WBYA 3HO8A 4CEXC 1EGZA 1F6PA 1JYWA 4TV6A 1WKFA 3TEVA 3QGVA 2DZUA 3U3HA 1IZKA 3CH9A 4ZOEA 5EBAA 1M6JA 3WLPA 1J96A 4CCCA 4JL2A 5G2WA 2D2HA 4AWUA 5AHLA 5CGMA 4QLKA 3NCOA 1DJHA <