3UXIA

Crystal structure of l-rhamnose isomerase w38a mutant from bacillus halodurans
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
413
structure length
402
Chain Sequence
SQFERAKIEYGQWGIDVEEALERLKQVPISIHCAQGDDVGGFELSGDYPGKATTPEELRMDLEKALSLIPGKHRVNLHAIYAETDGKVVERDQLEPRHFEKWVRWAKRHGLGLDFNPTLFSHEKAKDGLTLAHPDQAIRQFWIDHCIASRKIGEYFGKELETPCLTNIWIPDGYKDTPSDRLTPRKRLKESLDQIFAAEINEAYNLDAVESKLFGIGSESYVVGSHEFYLSYALKNDKLCLLDTGHYHPTETVSNKISAMLLFHDKLALHVSRPVRWDSDHVVTFDDELREIALEIVRNDALDRVLIGLDFFDASINRIAAWTIGTRNVIKALLFAMLIPHKQLKEWQETGDYTRRLAVLEEFKTYPLGAIWNEYCERMNVPIKEEWLKEIAIYEKEVLLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-Rhamnose isomerase
publication title Structure-based studies on the metal binding of two-metal-dependent sugar isomerases.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Isomerase
total genus 139
structure length 402
sequence length 413
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.14: L-rhamnose isomerase.
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06134 RhaA L-rhamnose isomerase (RhaA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3uxiA00
1GW9A 2QUMA 3KCLA 4J4KA 4HNOA 4ZB5A 1XYBA 3DBNA 3UA4A 4XIAA 5J8LA 4HGXA 1XLJA 4ZB2A 2XIMA 1DIEA 5EMJA 1QUMA 3VNLA 3BWWA 3XINA 2I57A 3AAMA 5AVNA 4QE5A 1XIHA 3JU2A 4QDWA 4X63A 1DE5A 4A8NA 2G4JA 3KBSA 2GYIA 3BDKA 3ITYA 4QE1A 3C0SA 5EMLA 3BANA 4DVOA 2X7VA 4XSLA 4X61A 1I60A 3QYSA 4E3VA 5XIMA 3VNIA 4A8LA 5TNVA 9XIMA 5C9ZA 2ZDSA 3CNYA 1XLIA 3ITXA 4US6A 1S5NA 4YTRA 4ZB0A 3P14A 2NQHA 3TVAA 4XKMA 2GVEA 3CQIA 3U0HA 4GLEA 3DX5A 3ITOA 2HK0A 1A0EA 1BXCA 5XIAA 3NGFA 4YTTA 1QTWA 1XIFA 3XIMA 1D8WA 4PFHA 5XINA 2HCVA 3KWSA 3M0MA 1A0DA 4EAYA 8XIAA 3OBEA 3KCOA 3UU0A 1XYAA 5EMMA 1CLKA 4YTQA 2QULA 1XLEA 2OU4A 1XISA 1XLMA 1XIGA 3CWHA 4QE4A 2GUBA 3UXIA 1XINA 3GNXA 4KW2A 4A8RA 6XIAA 1TZ9A 3KBWA 2NQJA 1XLBA 1QT1A 3KCJA 3QZAA 2G0WA 3ITLA 1XP3A 4PGLA 9XIAA 1XLGA 4XSMA 2XINA 4QEHA 1I6NA 1MUWA 1XYMA 3XISA 2I56A 2NQ9A 1XYCA 3FVMA 1XLDA 7XIMA 1XIMA 2Q02A 3AYVA 3UA3A 3C0QA 2J6VA 3IUIA 2XISA 2HK1A 4A8IA 1XLHA 3KBVA 3VNKA 1DIDA 1XLKA 2QUNA 4ZBCA 3AALA 3VNMA 4XISA 1XIBA 3CQKA 1XIIA 3KTCA 3WQOA 4QEEA 3QC0A 3M0HA 6XIMA 3N4AA 8XIMA 2GLKA 1XIEA 1XLCA 3C0LA 3VYLA 5H6HA 3M0LA 4X60A 2QW5A 1XIJA 5B7ZA 1K77A 4OVXA 4EACA 4HHLA 5H1WA 4DUOA 2ZVRA 4YTSA 3U3HA 4QDPA 5AVHA 1XICA 4GJIA 1YX1A 3CQJA 4XIMA 5B80A 1XLFA 1XIDA 3IUDA 3L23A 4GJJA 3UVAA 3VNJA 3IUHA 3KBNA 3QXBA 4K1GA 1O1HA 3KBJA 4YTUA 3M0XA 4GQBA 1XYLA 4HHMA 3KBMA 5B7YA 1XLLA 1XLAA 3M0VA 3LMZA 3TC3A 2X7WA 1DE6A 3M0YA 4Q7IA 3ITVA 3ITTA 3CQHA 3P6LA 3BZJA 5FA5A 1S5MA 4W4QA 4G56A 1A0CA 1DXIA 3BZGA 1BXBA 5EMKA 5I7GA 4K3ZA 1MNZA 1OADA 3AYTA 4LNCA
chains in the Genus database with same CATH superfamily
2IMRA 2Q6ZA 4DJEA 1XLJA 3XINA 1FH9A 3VD5A 3LCHA 3GR8A 3QW4B 3BOFA 4UFJA 4CQ9A 3MSRA 1R5YA 2GFTA 3G6LA 4U3AA 2VD8A 2B0MA 2HWGA 5E5CA 3NOYA 4UR8A 3OA3A 4RDVA 3GK0A 3ZMRA 3CHVA 1KLYA 1VBHA 2OZTA 3UP8A 4OBTA 4S3KA 4KCTA 2VWTA 3CV6A 1X1NA 1A0DA 5F2MA 3BOLA 3A12A 3TLQA 1A50A 4WSKA 3LHUA 4JFUA 2XFYA 2JBMA 3DFYA 1C3FA 4AZCA 3R10A 5LNSA 2WYSA 3AHYA 4KPLA 1HTIA 2AL2A 3TMLA 4DUXA 1A3HA 4QSHA 1UWRA 1O66A 3IGSA 2XZ7A 3KOZA 4X60A 2WSKA 4ERIA 4RV3A 1C9DA 3H2AA 1ZAJA 1WAWA 1RPKA 1V77A 3MV11 1CB7B 2QCDB 3AROA 5I78A 1SMDA 2HSAA 1WZAA 4U4MA 4IPJA 1XYLA 1MYRA 4R27A 5DY3A 2VT0A 1W8GA 2GJLA 3LEPA 1W9VA 3CQHA 1XDJA 2Y8UA 4WRHA 1KB3A 1U33A 1R85A 5AYZA 3M64A 3ELFA 4PZVA 3S5OA 1TJ2A 4DJDA 4C6DA 2HMCA 1JEZA 5GPRA 3K1DA 2WKLA 1DJXA 3QJAA 3MMDA 3UWEA 1NM9A 1FCBA 3VKBA 1WUEA 5FAJA 2OYKA 3MSDA 2I16A 3WQDA 2AMXA 1QPRA 1ZP3A 1TWWA 4C91A 2DSWA 5CBIA 3PVFA 3TQKA 1FWHC 4MWAC 1EGZA 3DH7A 3NFUA 3C0JA 3SUUA 2PLKA 3MT1A 3TMQA 2JALA 4QG8A 3ZJ8A 4M81A 2OODA 2XVGA 7ENLA 2WJEA 1W32A 1R38A 2REQA 1XRVA 1R46A 2POTA 2BZNA 1GQKA 4JNMA 3PTQA 3FHQA 2G0WA 4K1WA 2VL4A 4DY1A 1VFOA 4HA3A 4KQNA 3AYVA 1I2OA 3RN6A 1MUMA 1HJQA 3K30A 4K6AA 2Z1VA 2YCLB 2WCSA 3C3UA 4IP7A 3S1VA 3NCOA 3JR2A 1Y0EA 4UTKA 2SFPA 1KV8A 4LB4A 4H9XA 2FMOA 3UPBA 4OQVA 3TA6A 1P1MA 1M7XA 1RHCA 3TEVA 1K6AA 1HJUA 4I7VA 4JL1A 1H7PA 4R34A 3NZQA 1U22A 3AU6A 3W85A 1UROA 4GVHA 3NM1A 3VIMA 2Z6IA 4H9UA 1ICPA 1F73A 2G4JA 2YIHA 3GDBA 3IVUA 3V18A 4PMOA 4NF7A 3RCMA 1KFKA 4RE4A 3QY6A 3TSMA 2YL5A 5BXSA 4YIWA 4JICA 3TQPA 1KGWA 3H6OA 3UPMA 4ZOBA 4OT7A 4AX7A 3ANUA 1O60A 4IXXA 2ZDRA 4O52A 4N7QA 4GUGA 2HVNA 2XSAA 4O28A 1ONRA 3B9AA 1FX6A 4AF0A 2OX4A 4EPKA 4HVXA 3T08A 3RU6A 3FFSA 2FYMA 5JU6A 1DIDA 4ILSA 1EYEA 1E15A 3RGTA 3V35A 3ZWTA 2VFGA 4AZ7A 3RITA 4TVUA 3C0LA 1TWZA 1W54A 5EBUA 2IQDA 1RJRA 1LYXA 3TWBA 2W9MA 4O16A 1UBSA 2XG9A 3CPUA 4NKCA 4NAFA 1DTUA 1KFBA 3WNMA 1R7AA 3IGHX 2O9OA 3KBJA 4GXWA 4LUSB 3CASA 4UFHA 2ZUTA 3MY9A 3A3WA 3WJSA 3DAQA 2QCMA 3IJQA 3KL5A 2HBVA 3CLWA 3CHCA 2W62A 4AG0A 3WD0A 1D8CA 4DJEC 2GDQA 2NUXA 3CMFA 1D3GA 3CAWA 2IUZA 3VGEA 5BOEA 2CWNA 2NLIA 5G4WA 1AH0A 3QQWA 3HOJA 2FB2A 3AU2A 4ZFMA 1XJBA 1EZ2A 4O14A 5FJTA 4LCSA 1EJUC 1V5XA 4C6LA 2E6AA 1AH3A 3MCOA 1J0ZA 2KAUC 1RQBA 5LGXA 2CCRA 1DHKA 4EAYA 1QWKA 3DXIA 3SJ3A 6TAAA 5EMMA 4K37A 3PNZA 4AWSA 1J5SA 2FKPA 3SRKA 4ATWA 2X16A 3QH2A 1X8CA 4JR5A 4UTJA 4QS6A 2NZLA 4HYVA 2DZBA 4Q33A 4C5ZA 4PUMA 1VP5A 4A2SA 4O1FA 5LXEA 2CU0A 3WDIA 3FEMA 4IP4A 1WQ5A 3BK0A 3RLGA 1XGEA 4LJ3A 3G8RA 1KBKA 1Z3NA 1B57A 1K70A 3QPEA 3ANYA 1H61A 2X7WA 1E70M 1ZSXA 4BA0A 1FHUA 2EKGA 1UR9A 1O6IA 3B8WA 3BGAA 3OA5A 4AW7A 3GYEA 1AZ1A 2OT1A 1UWUA 4Q4QA 4HCLA 5G2HA 4DJDC 4F0KA 3GTIA 1UD8A 2OFJA 4DI9A 3BMVA 1RJQA 2V9DA 1B1YA 1DQUA 1PSCA 5C0QA 4IIHA 3VX1A 4XO7A 2C1HA 3L0KA 3DG3A 4F0MA 5HWNA 3N14A 3UWVA 1H11A 3RM9A 2VEIA 3MKVA 1EXPA 5XIMA 4Z2KA 3STCA 3CNYA 3W24A 4GLEA 2V5BA 2FB3A 2PSNA 1M03A 3BW3A 1BYBA 3RILA 4MTVA 5CPSA 2D23A 3VFCA 3L2IA 4JX4A 2A21A 2HS8A 1UP0A 3K13A 5D32A 3TR9A 3WQWA 2WZEA 5CBBA 3RMJA 1JF6A 1VEOA 2ZUNA 3WBXA 3FKKA 1UIPA 3W1XA 2O92A 4JYDA 5A8NA 3WNLA 2XVPA 4FIRA 2INEA 5BYWA 1JPIA 3NQDA 3SQMA 3A23A 1JRCA 1RBAA 1MO0A 5CZTA 3NDOA 3EX3A 1IIGA 2X41A 1BWVA 4W9TA 2HE8A 2X1RA 1EJSC 1W5QA 1XLAA 4G1NA 5CZ0A 1OZMA 1CXLA 1HN1A 5DBTA 3G5EA 4LPCA 4G56A 2YXXA 1G01A 2V5KA 3S6TA 4J4KA 5H2ZA 3QHOA 1GJPA 2VENA 3DC0A 1WZMA 1BLIA 4GI8A 1JGIA 1R3RA 3LS9A 5D2WA 3RX4A 3MYOA 4IT1A 1HJVA 2FVLA 1IEWA 2CZDA 4D8ZA 3DEQA 1R3WA 3SM0A 2PU1A 4PTWA 4S23A 3NO3A 1BWLA 2E5CA 4F0RA 3PUGA 3VNIA 1IZCA 3UCCA 3CEUA 3QPZA 4S39A 3WQGA 4I9MA 3CGTA 4ZB0A 4GYPA 4UXDA 3WX7A 3KW3A 3P60A 4IIDA 3N73A 5LHEA 1HL8A 5I77A 1BAGA 4EXQA 6PTDA 1R8LA 5G4EA 9CGTA 1KTCA 3L0GA 3ZSTA 5I3HA 3A5VA 2VGBA 3EDEA 2VR5A 1TV7A 4S3AA 4JBRA 4ZTYA 4Y9PA 1PTAA 3P3BA 4Q8PA 5CPOA 1GW1A 1EEPA 1W17A 4B16A 4PL2A 4Y96A 5C9WA 1BVZA 1XKYA 3CUIA 1LM1A 3NDYA 1ZJHA 5B80A 3S1UA 4JDYA 4KEZA 2X1SA 4G7EA 3UG5A 3VC6A 1H5VA 3ABOA 3M44A 2EBNA 1NWSA 1RY8A 4ICCX 4M6UA 4RW5A 3CZLA 3WDRA 2HVOA 3VDHA 1IGSA 2A7RA 4WX2A 3WL1A 4R88A 3CZGA 3C4UA 3MDUA 1ZPTA 1YHTA 5DQPA 1E43A 2PAJA 1W31A 4ONVA 5G1YA 2QUVA 4K7VA 1GVRA 4FNTA 1YRRA 3DFHA 5C7VA 3WD2A 5HJLA 3E3HA 4GFSA 2E1WA 3SGZA 1ESWA 1LF1A 1CBGA 1TA3A 1VFTA 3I68A 3A4XA 4GQ0A 4IX0A 1RXOB 4NNCA 4RPQA 2EJAA 2XGIA 1MQRA 5JIWA 2GSHA 2E0PA 4MB4A 1IT0A 4QITA 3TDFA 4MNLA 3LLXA 1UBPC 4IUGA 3MI6A 4GNJA 2OJPA 4M56A 2HK1A 1KFCA 4NZJA 2XHYA 1F2JA 1KCLA 3SCPA 4AEOA 1UZ1A 3WF3A 1IHIA 3VDGA 3WLQA 3T0CA 1H7RA 3GXMA 2BY1A 4B9ZA 2O7SA 3N2CA 1B3YA 3EWBX 1J10A 1AZ2A 2WPBA 1O1HA 3W7OA 3O05A 4LY4A 4AXKA 5F2IA 3RYSA 1TRDA 4U3CA 3BZJA 1DYSA 3GR4A 3K5XA 3CUXA 1GW9A 4YNGA 5LGZA 3CUZA 4MWAB 1ME9A 1HJSA 1KM0A 4W85A 1Q66A 3R8GA 2R14A 3B4UA 4AHQA 3FJ4A 1AH4A 4IG2B 3LXCA 1Z69A 4H1ZA 1ISVA 3GDMA 1Q6RA 3U57A 4PRTA 1JCNA 4M7TA 5C9XA 3PFMA 4CNNA 4NZ4A 4PFHA 3CT2A 4X2RA 3OVGA 3D3AA 3IJ6A 3B8DA 4P5UA 2Y0FA 5LIKX 2R1MA 5CCZA 1EF2A 2XINA 4ROQA 3HZ3A 5EU9A 3ZQ9A 2ZX5A 3M5ZA 1E9YB 4M29A 4S2BA 1DJWA 4XUYA 3G0XA 4HMEA 2CZFA 4PMUA 2P1FA 3WNOA 1RVGA 4DPQA 2J9YA 1K8CA 3RLHA 2FH6A 1US0A 4Q6JA 1UR4A 4ROPA 3LD5A 3O0KA 2PDJA 1VFFA 3EMCA 4XWUA 3WQPA 5HANA 5ABHA 2POZA 4KGJA 3WEZA 3FAWA 3TKFA 3Q67A 4A3YA 1QBAA 1UWSA 1EHAA 4RZ4A 1EPVA 1ZBVA 2YX0A 2FGZA 3R0KA 1DJNA 4NXSA 4W87A 5AC7A 1B9ZA 3MUAA 3T44A 2YL9A 4GBDA 4AD0A 1NSJA 3HTWA 1KRAC 2AKMA 3QQ0A 4XZLX 5EMLA 4DVOA 1BRLA 1KGXA 1KBBA 5KMYA 4A8LA 3LHYA 1V3JA 2PZNA 4D6GA 3VABA 2YGYA 4GYPC 3ZJ6A 3REQB 1J11A 4FOJA 3S9IA 4WY0B 3QKEA 1KD0A 1PXGA 7PTDA 4ZO7A 1KTBA 1UR8A 1JCMP 5D2YA 5CSSA 2R1PA 4FLOA 3E0WA 2PDQA 1XSJA 2EGZA 4WDWA 2XN0A 4GUJA 4XZBA 5AHMA 1MW3A 4MJ4A 4E3TA 4GX9A 3WK0A 4L7ZA 4K8HA 3CIWA 3TC6A 1H7OA 3QZEA 4GCXA 4I7UA 4AIUA 2X42A 5D04C 1UIOA 3S1GA 1D2KA 4Z0SA 3W37A 4FSAA 1IV8A 4M0XA 1MXDA 3LTYA 1H2JA 1GG0A 5HNNA 1W1A1 1OK4A 1WOBA 2TAAA 3A4JA 3BTNA 1PZ3A 4PB3A 2GK1A 5I24A 1H3GA 1Q5MA 3O63A 4XZNX 3RLUA 1JF5A 2AGTA 3LSBA 2OZ3A 1E4MM 4MLJA 1VBGA 1TPFA 1PTGA 1AG1O 3F2DA 4TV6A 1T96A 3NL5A 3W27A 3LI1A 4GK8A 3AHXA 3ARQA 4JIPA 4LALA 4MLRA 5LIYX 3S2CA 4UNIA 4N6FA 2DQWA 1WZKA 4DF1A 2YYUA 1HW6A 1QO5A 4DYEA 1KCZA 4JAWA 3W2JA 1RBOB 3MKCA 1DQWA 3W6YA 2OGYA 1OFQA 1O7AA 2LLEA 2VKZG 1RALA 2BGSA 1KR1A 1O12A 4WSHA 3HG5A 3AUJA 3NSMA 4PN2A 3RR4A 1DVJA 3EKLA 3UWZA 1MXGA 2AL2B 3D0CA 1M53A 4GVIA 4CEUC 4PBGA 3QVQA 4ACZA 4KS0A 4F0SA 1D7KA 1U5JA 2JEPA 3PAJA 4GNKB 3E9AA 3CL8A 3S5ZA 5E6YA 3TNBA 2B7NA 3VOGA 2F7FA 3SCUA 4Z2JA 3VAVA 4L9YA 3WLIA 4GXPA 4H4IA 3R12A 3S5NA 1MEIA 1NWTA 3SUTA 2RGMA 1ADOA 3NOEA 4EX4A 1KRBC 2GJPA 1K77A 1R6WA 5D8ZA 2XIIA 2V2CA 1S2TA 3H24A 3BLDA 4ORIA 2JIEA 3OG3A 4JPGA 3A21A 4CU8A 4O1DA 3ZOAA 1SZRA 3EZ4A 5EGRA 4BEUA 1AVAA 3GHRA 1B9BA 3FY1A 3EWXA 4P7RA 1VENA 2OYMA 1E6XM 4HCHA 6REQB 5JBDA 4DXKA 3STEA 3S3GA 2BY2A 3P7YA 3F03K 4AHPA 4HYRA 1OCNA 3W86A 5T9CE 3EX6A 5C54A 4P7QA 1T99A 2PB1A 3CJPA 2G96A 3AOFA 1QMLA 3OW1A 2VRQA 4TV5A 2WC4A 3L7RA 3AXXA 4YL2A 4XKMA 1QNSA 3E38A 5AB3A 2HK0A 1K8ZA 2XGZA 1MSSA 2DSUA 1MVYA 3LNPA 4J28A 3OBEA 1I1XA 2TPSA 5G2IA 4QQUA 3HN3A 2CW6A 2NVCA 4KW2A 1HX0A 3ZWSA 1R2TA 5F4SA 2VZSA 3AYSA 4L1XA 3R89A 7TIMA 3C2OA 1IT7A 2Z4GA 3DYOA 1NOWA 4PFMA 2ZRZA 4NXKA 4OBSA 3A5FA 2X2GA 3B97A 1C8XA 3ARSA 1O68A 3L4ZA 3BAIA 3ABSA 3CQJA 3W2KA 1BF2A 2ZRYA 5I06A 1UD2A 4YPJA 4YXGA 3VO0A 1G4SA 3B8TA 1G67A 1S5MA 5D9NA 3HG2A 1OFBA 3O07A 1L2UA 1UWQA 4LNCA 4IIGA 3CQ0A 3NEHA 1M01A 1SO3A 4WGHA 1V3MA 3B0VC 4D1JA 2XIMA 4P8XA 3W6MA 1A3XA 2YB4A 4KWSA 3A13A 4YWIA 1ALDA 2QJMA 1TTIA 2BASA 1R86A 1EGMA 4IFKA 1LTDA 4JTRA 1XCFA 3W75A 4AF0B 1XR2A 4W84A 3POHA 1OX4A 1GZGA 5H8PA 1XIFA 4JQ3A 5LA0A 1ZTVA 2X2YA 2ISSA 3L2MA 4GUIA 3BO9A 1A47A 3KCOA 4MMWA 2VFIA 4Y9MA 4OHQA 2QKFA 2XH0A 4I5UA 2MANA 4WDUA 3MV01 3LI0A 1XLGA 2P8BA 4R33A 2NQ9A 3A9IA 1LLWA 2EJ1A 1HGYA 3AIBA 1J0HA 4A8IA 4M6PA 4HA4A 2GGHA 4BI7A 4L61A 1HVQA 3QFWA 2W5FA 4KBXA 3PB0A 3N4AA 3VFLA 3HG4A 4N4PA 3BLEA 3DKLA 4AVFA 2O4MA 4LANA 3ZR5A 3N9RA 5F2GA 3ARZA 3UVAA 2X1UA 2FPTA 4E38A 1QCWA 3SUSA 4RDZA 3MO7A 4DEFA 2Y8KA 3E0VA 5C2CA 1EWDA 1Z42A 3TAKA 3RF9A 4LW7A 1ZZMA 2BNJA 4AB4A 3G3DA 2VUYA 5C5YA 1CXEA 2OR2A 5MKGA 4KT2A 1PPIA 3NXFA 3N04A 5ENLA 3N2MA 3PPGA 5D9PA 4TX6A 1I60A 5EMUA 1KC7A 2FZNA 2WZIA 4CNTA 3S2JA 1RQHA 3IJDA 1XL9A 3INPA 2PPGA 3HPAA 1Q6EA 3AS2A 2QCLA 1JDDA 3OZPA 1MDLA 4B3ZA 2CHOA 2AQOA 1GOOA 4XX6A 2HRWA 3MP3A 3S5YA 1H50A 1TPUA 2PDBA 4LVFA 4WD0A 2ZCGA 4S38A 4Z0JA 2PDHA 1LORA 3M5YA 2J7FA 1EKOA 2GL5A 3ZJ7A 3B06A 1XYMA 3TQVA 3G3MA 1MRQA 1NAL1 3FYYA 4AEFA 1US3A 4S3DA 1XDMA 3DFPA 3NZ1A 5D4YA 4UUIA 4LS0A 5AYBA 1NH6A 2DVUA 2WVVB 1ISZA 2B31A 1E6RA 4BF7A 3S42A 4B4FA 5FCZA 2WSYA 3MC5A 5FF2A 3KL0A 1PKMA 3WQEA 1NTHA 2JKPA 1N7KA 4LUJA 4AWEA 3NQMA 3VD3A 4UMBA 4JIRA 2PTYA 3UJ2A 4UCGA 2Y2WA 4GYFA 4JTTA 1A3WA 4RNFA 3M7WA 5A6BD 1TPWA 4CCCA 2YDAA 3PBYA 5HK4A 3TIMA 1PVNA 3H4GA 1OFEA 1OBAA 3K8MA 2WPGA 1EDTA 2VC5A 3HFTA 4S3EA 2ZFAA 1I2NA 1J5TA 1SUXA 5HPCA 1I75A 4YTRA 1LLZA 2FVMA 2IPFA 5DX7A 4DWDA 4IQJA 1TVPA 5L6UA 3O9NA 1PZ1A 3W7MA 1SSDA 1I45A 3QMSA 3MI2A 2DW7A 1CB2A 1YNYA 5I2UA 3TCEA 3LGDA 3AXIA 2A6LA 1QW9A 3W4RA 4P8UA 3WEOA 4AIOA 1XIBA 4LV9A 4RDYA 5KEZA 4OWGA 1MWOA 1TPVA 2RGLA 4QNWA 1B4EA 3CUHA 1UWIA 3HQNA 4HNNA 3W2MA 3VOHA 2PDWA 4JDBA 1CDGA 3UWQA 5AC8A 3QOMA 3FHAA 2FMNA 2PCQA 3H53A 3HM7A 1GOWA 1HKKA 3EOEA 4Q8NA 1QJWA 1ZL1A 3BAKA 3W76A 3WMCA 5REQA 5BRBA 3W1MA 5A5WA 3C8FA 1O4UA 2OQYA 3ARVA 2VEFA 5A6AA 3AMKA 1LCOA 1PWMA 3TTYA 4GRSA 1WX0A 2NQLA 3SRFA 3DGBA 2BDQA 4ZQRA 1DP0A 2PP0A 2HXUA 1ZLPA 2QAFA 1DQXA 2ZDSA 4DQWA 2ZUVA 1PEZA 3P80A 3PWAA 3DFSA 3R6IA 4DBEA 2JF6A 5JQ9A 3W7HA 1F9CA 4DAIA 3UCQA 2BVDA 2VC6A 3F5KA 3Q4DA 4B5UA 3Q37A 4JTEA 3UWUA 3D47A 3ZFHA 1I6NA 4GE8A 3CB8A 4UQEA 4G7EB 3GR7A 1FRBA 2XUCA 4ML9A 4ATLA 2PGFA 4C6QA 3CXOA 1NQKA 3VTRA 2Z24A 3W7DA 3ZJKA 2VWSA 1JIBA 3URNA 5FF0A 2AAMA 3A3HA 4NL1A 4FLQA 1QI4A 3I6EA 4WVXA 1SU5A 1YLVA 4CQBA 1CI1A 4GHRA 1XLLA 3LCGA 2DUAA 2V5LA 3OGRA 4OU1A 1EUNA 3P81A 1V8EA 4O8RA 1LROA 1RD6A 1K9DA 1H1YA 4HA1A 2FZBA 3QMTA 4AWTA 1UJPA 1S3TC 1JFXA 2CNCA 2GDUA 2OPJA 4Q8MA 4IM4A 4I8YA 3WMLA 1J96A 3VIHA 1HVXA 2VVSA 1EIBA 4I9TA 3W7NA 4DJFD 1F3EA 1E73M 4H6QA 1FWJC 3JUGA 1IXOA 4IL0A 5E9XA 3TVAA 1NP2A 3GW0A 1IXNA 4LRSA 2X30A 1Y7VA 5XINA 1Q13A 1F3WA 3PY2A 1SZNA 2OEKA 4D71A 1F8MA 2CHNA 2ZTKA 5BXRA 1CGYA 2QV5A 3UGVA 2RFGA 2ZUMA 2PWUA 2BFGA 4XO6A 3HQOA 3VMPA 3TYZA 3I7SA 5JBEA 1REQA 2YCJA 3T4WA 4CN4A 3DUGA 5HR6A 2CESA 1FWGC 3RDKA 3PZOA 2F6KA 3G6MA 2G3IA 4EACA 1TJ0A 1KLZA 3F4NA 1ZCCA 4ATDA 3N3MA 4IQLA 1Y5WA 3VNJA 4RCXA 3THCA 1RAKA 4ZE5A 2EPKX 2PTXA 4QIUA 3VNYA 3GU1A 1WKEA 2GUYA 2JEQA 1HKJA 4Q4OA 1P4CA 4FF5A 1PWLA 3TJ4A 2D3LA 1NFPA 2NWSA 3TXZA 2OKTA 1CW2A 3KCLA 2PWVA 2VZOA 4PE8A 2PCEA 1LG1A 3DBPA 3AS1A 4K7YA 4Q32A 4ZB2A 2RAGA 4DNMA 2GGIA 3MJMA 4O1BA 4GIYA 3U6WA 5HWMA 3OIXA 1OT1A 3PPFA 1W9UA 3RX3A 1LBLA 3BV7A 1DIOA 3EB4A 3LYEA 1UH2A 5K4XA 4GI9A 5A2CA 1US2A 3AXKA 3CM4A 4EP8C 3WQ4A 4RX0A 1ZS2A 5C9ZA 3UJSA 2Z7GA 4J3UA 2GQAA 9RUBA 1X97A 4LUYA 2A0NA 4ADSA 2UY5A 3KS6A 3MVTA 3PUOA 2VCCA 1SM9A 3EPNA 2GUBA 3WLHA 1MQPA 1TR9A 1LRNA 1XLBA 3ITLA 4M3PA 1WE5A 2QF8A 2Y8VA 2YXOA 3H12A 2VTFA 4CNUA 4UTUA 3EPMA 1E9ZB 1F6YA 2J8TA 4ZO8A 1NF0A 3CAQA 4J3VA 4QEEA 1W91A 4HYWA 1DEDA 4WQ6A 4WCJA 1R2SA 3TYEA 2PTDA 3WF2A 5MF5A 3W2NA 1R0MA 3GDRA 1UP2A 1XIDA 4EOUA 3W0KA 2RJHA 4J3SA 4AZ6A 2ZZ6A 4DM2A 4GC4A 2TRSA 1BRLB 4GIAA 3GG0A 1FP8A 1W3LA 5FEPA 5CGMA 1TQJA 4CNSA 4XAGA 3M46A 2J78A 5D30A 3NQ2A 5I5RA 3T7VA 1QUMA 3ZO9A 3BWWA 1UR1A 3BL3A 4JQ2A 4NX0A 4FK9A 4XTIA 3IJ9A 2EG6A 4ERAA 4E5TA 2X0SA 1TTQA 3O1NA 2HDJA 3UY7A 4H8UA 4IJCA 3VKCA 4L5ZA 1XC6A 3BURA 5XIAA 1E1FA 4BQ2A 2OO0A 4JGDA 3GQYA 1GOMA 1O5XA 3GNDA 3O0FA 1XWYA 2OSYA 4ZGYA 2ZE0A 2ZVIA 3VZXA 2HTMA 3PBUA 1M3UA 2GK1B 3LN3A 2WSQA 4ZBCA 2DVXA 3R7MA 1I8JA 4FXFA 1SZGA 1XLCA 3VYLA 3N2OA 4JXCA 1KWGA 1JCJA 3PC0A 2QMKA 4UCFA 4AYSA 4OZOA 4GJIA 2D3NA 3TYUA 1BTMA 5DANA 1LL6A 4N4QA 4UFKA 2WHLA 1KKRA 2ACSA 1S39A 1JYNA 2BG5A 3MKKA 5HMEA 3EWWA 2QUMA 4HNOA 2GSJA 5T91A 3U8GA 1GKRA 4UZUA 1P7TA 4A35A 4HU0A 4US5A 4JTIA 5AVNA 3T05A 3GFZA 1FXPA 2DFAA 1KV5A 4FI4A 4O18A 5CSUA 2A3LA 4WSJA 2WMJA 4ACZB 4KFOA 3IANA 1AK5A 3N17A 1E1EA 2J74A 3W87A 4BR1A 4AEEA 1BF6A 1JUEA 4LVAA 1JZ3A 5DT7A 4JTHA 4FX6M 4ZOCA 2PWHA 4J2PA 2V5JA 2FGBA 3FW6A 3NNTA 3RR1A 2JF7A 2WV8A 3QGVA 1UYQA 4RK8A 4HHPA 3LPFA 4XQ6A 1XSKA 4S3BA 1ECQA 1HZYA 2AL1A 1DIKA 4BQ3A 4A6GA 1K4GA 2QCNA 3GX9A 3ITGA 1AQHA 3SFKA 5H6HA 3NQ8A 4P8WA 3F4DA 3L4YA 5B7ZA 1VCGA 4JCMA 1L6WA 1JYWA 2E6FA 2W67A 2QCDA 2DJXA 4M8UA 4MM1A 1W37A 4E2OA 1XI3A 5HAOA 2Q3OA 3QLDA 3NPWA 5FF3A 3EWDA 4CQCA 3M9YA 1K1DA 3HBLA 4PCPA 3AYTA 4NVTA 3U5YA 3GAYA 1Z7AA 1R3YA 1C8YA 3SSJA 2P8CA 3R25A 5AHEA 8TIMA 1J6PA 2DZWA 3EXRA 1UQZA 3AXMA 5JH1A 5TNVA 1F07A 1JI1A 3IIPA 5A2AA 4UTMA 3NA8A 3ABZA 4AIEA 2Y5JA 1YTKA 3M16A 4D6JA 3CLMA 2XFWA 4N9BA 2NXGA 3HO8A 4LV4A 1S1PA 1TUFA 2V30A 4J1OA 4WOZA 1GTEA 4AH7A 3ONBA 4GZJA 4WEVX 1XISA 4CN1A 3R43A 5HJYA 4H9TA 3WLKX 4H6RA 5G1MA 4KRTA 4FA3A 2E6DA 3LLDA 4MDPA 3GBDA 3VK5A 8RUCA 1CPUA 4GX8A 4YHEA 6CGTA 4GCAA 3V0TA 4XK2A 8XIMA 3SR7A 1GK8A 3WBAA 4HHHA 3GRIA 1XBXA 5I3KA 4ZQMA 3LXBA 1TREA 3LMYA 4MAVA 2V3FA 4Q8TA 4PULA 1TCMA 4O53A 2YOCA 4AVNA 2X40A 5E9AA 3M0VA 1OG0A 3PULA 4YMZA 2X1TA 4IFKB 2CLIA 1JCXA 4C6JA 1VFLA 3QRHA 3QW3A 1DJZA 4NJGA 3ZR4A 3B0XA 1BSLA 3GHSA 3C6CA 3SCWA 4XAFA 1EWEA 1OX4B 3N4FA 4LAUA 1JJKA 3FA5A 1ZJIA 2I1OA 5FJIA 1KM2A 3EEGA 5T8GA 5IFPA 3SW6A 4L4MA 3DG6A 3K4WA 3DOPA 1THFD 2O4QA 5D09A 3OG2A 3RNDA 2BTMA 2UY3A 4M5PA 3B8UA 1AQFA 2PLJA 1A5SA 4TOQA 3LCWA 1IEVA 1P0DA 1HKWA 3T81A 2HISA 4UB9A 3HIJA 4J3TA 3W81A 1UKPA 4PGLA 3UR8A 1GOKA 1VAHA 1CXKA 3M0JA 3BG5A 7XIMA 5FEXA 4HSOA 4FNUA 3CH0A 5FJUA 4KWWA 2RH9A 3TQ0A 3QC0A 3T78A 3SGGA 5LIWX 2WQPA 1EIXA 1V3IA 1X6NA 1R3QA 3WY1A 5D02A 4IICA 2Y1HA 3FOKA 3GKAA 4PTNA 1JUBA 3HU7A 3KRZA 1OWQA 4PMRA 1E6PA 4OGZA 2A2IA 3TUUA 4CNOA 3GVQA 1A0CA 3RJXA 3G1XA 1XRSA 3RFAA 2OWXA 5BXPA 1YTEA 4OUEA 4QJ4B 1U83A 3M0KA 3G0UA 4UC5A 4ADUA 3AIVA 2DIKA 1PBGA 2QDGA 1JCLA 1N8WA 3UYIA 2D24A 4S3CA 1U1UA 2X8RA 1A5BA 1XUUA 1S2VA 3STPA 3VCRA 3UZZA 3WQVA 3SADA 3OVRA 3ARWA 2IW0A 4HU3A 3QN3A 2VEPA 5BRQA 4NILA 1KXQA 2GPTA 1V02A 4QISA 5E6ZA 1XLIA 1PTDA 1QXLA 3PHAA 3W7IA 4MOZA 4QJ3B 5I3FA 3GC2A 2ADAA 1OK6A 4UOJA 3HV9A 3M0MA 3SGUA 1GVSA 3HB9A 3BGJA 1XH1A 1TE1A 1CXFA 4OUIA 4Z1BA 3W26A 1R47A 1OD8A 1BWKA 1JYVA 5KSWA 1PKNA 4HMDA 1XD0A 3VZZA 1XLHA 4H6EA 1BVNP 4MAZA 1GQIA 4EANA 2J7DA 2WK2A 4UTIA 4OVXA 4GBUA 3GH4A 5JH2A 1SFTA 3TYAA 3M41A 1Q7MA 4J27A 3H21A 4GGHA 1TVNA 4GA8A 3C5QA 1EA0A 3W38A 2YYTA 3N2TA 4HNTA 3NQCA 4Z1AA 2V81A 4J2MA 4UNLA 3NSXA 2XVLA 3QFEA 1PDYA 4ADTA 2FPYA 1EQPA 4BY3A 4GI4A 4A3QA 1C90A 2HEJA 2DIEA 2XFRA 1Y8BA 5LXXA 3SCQA 4FX7A 3UBPC 4R53A 5A8QA 4EXAA 1PYFA 1PUDA 2IQTA 3BANA 1Q8JA 4LXFA 4P7LA 2QJNA 3E96A 1G4TA 3UWWA 2RKXA 4AD3A 2XJ7A 3BV4A 4R9XA 3U9IA 4DNHA 2ZX8A 2PDNA 4ZQPA 4M24A 4FLSA 4L6HA 5BOOA 3QR3A 2E77A 3UVIA 5AECA 3CWHA 3M6DA 2ON3A 1VYRA 2PF0A 3VIOA 2C7FA 3LQGA 4B5XA 3QYQA 5ABFA 4TX9A 3NGJA 5AHNA 1G4EA 1ONWA 1QK2A 1FWBC 3QV9A 5CJ5A 3DKJA 4PMJA 1W8SA 3AO0A 1DWFM 3TZFA 4E0CA 5LA2A 2IKJA 2FPVA 2BOEX 4AY7A 3LHVA 3NQEA 1E1CB 1KFJA 4YVVA 4W7VA 4CVUA 4Z2HA 4RNIA 5REQB 3WNNA 3TYCA 2YCEA 3W1TA 3W1LA 1V93A 1QASA 1FWNA 1VR6A 3SIMA 4GIRA 3SJNA 4JIHA 1H7WA 2VEKA 5C71A 5K3VA 3LENA 2NT0A 4BI6A 4JHOA 1W56A 1B4KA 3QLLA 2EAWA 2OZ0A 3GIPA 3H2NA 4I5RA 4IPNB 1C7SA 2ZXAA 1OZQA 1HKMA 1W6TA 4G7FA 3B9EA 2VXNA 3NDZA 4LEQA 1FWIC 1F76A 1JPMA 2BHYA 1TJ1A 2AKZA 3GHUA 2XYLA 1JD9A 1EFZA 2OWWA 2PDCA 4XBSA 1TPDA 3WK1A 3VZYA 1L8PA 1OYAA 2PC8A 4I9JA 2VC9A 4ACYA 1V6VA 2V0TA 3MZ2A 1V7YA 2YBUA 2AOSA 1BG9A 3TJIA 3WN6A 1YPXA 1ZFJA 3UESA 3UZYA 1A80A 5JBFA 4JFWA 2A7PA 3GUGA 1NELA 1TSIA 2H9AA 1A5MC 3C2RA 4YU1A 1GOQA 9XIAA 1FHVA 2WNZA 1T5AA 3R8RA 3WLSA 4GI6A 4NJHA 1W5MA 2D2GA 4E6MA 3PBMA 1AMKA 3NYZA 3W3OA 5ABGA 3W7KA 2DZVA 1LUCA 4K8GA 2I9UA 4A4AA 1WBJA 4FOUA 3NQ7A 5I0DA 1RK5A 2F6XA 4PB5A 3QV7A 3BCDA 4K1GA 2QCGA 4X0VA 1K9TA 2EG7A 1FH7A 3CAKA 3LRMA 3APGA 2ACRA 2B81A 1P0EA 2J47A 4F8XA 1H7NA 1Z6KA 1FA2A 1XV8A 1P6WA 3KBSA 5FJOA 2BVTA 2OG9A 3PTMA 3N2BA 2VGFA 3ZZ1A 1GYLA 3PFRA 4B90A 3QTPA 3SN4A 3CMJA 9XIMA 1SW3A 3UFYA 1HXJA 2VC7A 2ISVA 1C7TA 1ZU8A 1TTJA 3ARUA 3F2BA 1LRTA 3MUY1 1NARA 4ZO9A 1REQB 5F1VA 3SQLA 4AU0A 1V0NA 3GDKA 3I3DA 1AL8A 2WMGA 2WNQA 4W8AA 1KR0A 1KXHA 1BEUA 4W89A 5LNUA 4V33A 3O6DA 1XM3A 3GVRA 3NO5A 1F4HA 3S47A 4UQAA 4XZMX 3TCSA 3OZYA 3UJEA 2DP3A 1K4HA 3P82A 2PD9A 1GQLA 4UTTA 1QBBA 4O0ZA 4AZGA 3CPRA 4B4HA 3G1RA 5CKSA 2ZIDA 1DOSA 5AYXA 3IEBA 3W53A 3DU0A 5HWJA 3LCIA 4IMCA 4TMBA 2OSWA 2Q8XA 1AJ0A 4C5YA 2IXUA 3KBMA 3A22A 2HS6A 3BGGA 3OLIA 3IK2A 3MBDA 4NZCA 2ZZ7A 1QW7A 5A94A 3CL7A 1XCXA 2D22A 1Q6LA 3NQVA 3A4WA 5DRIA 3HQ1A 2ZQ0A 3EX1A 5LYRA 4IUOA 1PKYA 3F4CA 2Z6JA 3P5ZA 3G77A 1IIHA 3R94A 1KO0A 1W3NA 5JUVA 4JEQA 3ITCA 3AICA 3SY1A 1GZJA 3T1GA 1JRBA 4QQ3A 1YTDA 1CLKA 2Z2AA 1D7FA 2G3NA 1RBLA 3KRUA 4I7WA 2FZDA 1T8XA 3KBWA 2VGIA 5BCAA 3JZUA 5D03A 4DUVA 3ARYA 4LBUA 1CCWB 1M41A 3MQTA 2L5HA 2NV1A 3H2FA 1ITQA 5MHBA 1FDZA 4IZGA 3FJNA 1EYWA 2BODX 3N6QA 3APYA 3VVGA 4FNPA 3VGGA 5M5DA 2GJXA 3G8EA 3W7QA 5AC6A 4LT9A 3P74A 4PB4A 3VMNA 3G0SA 2BVYA 2BLEA 4HOXA 2QJGA 3WF1A 3GG1A 1SPQA 2Y7DA 4MB1A 5HA7A 2Q8ZA 4A2RA 2FQIA 1MNZA 4H7VA 3GWQA 2QDHA 1QU4A 1XRTA 3G1YA 3WBEA 2PLCA 3TP4A 2WJDA 1GPFA 3BC9A 5HQEA 4IGMA 5DMNA 4I6VA 1TMHA 2YZ5A 3RPDA 2GSEA 3PNUA 1LP6A 1EH9A 1E5NA 4KETA 5E0FA 2F2KA 3AMCA 2ZZ2A 4E4PA 3B40A 3SECA 3ID7A 4MNKA 1FFQA 3REQA 3E2VA 3ZYZA 3I6RA 3R4IA 1EOKA 5ABTA 1FWDC 4UFMA 1D8WA 4U10A 3WDHA 1XSIA 1W3KA 2J7HA 1LBMA 2H8ZA 4Z42C 3MPGA 2DY3A 4QG6A 4EK7A 3SB0A 3G1DA 2Q02A 3VINA 3KWXA 4TVDA 5CZSA 1R3SA 1XFCA 1QNPA 2MUCA 3C2FA 4ICNA 5M3WA 4HPGA 4DO4A 2QJIA 2EPHA 4XD3A 5HR7A 1W3IA 3ATYA 2QMJA 1YE6A 1P7TB 5EFDA 4GISA 1PYMA 1FWAC 1HG3A 2HE5A 2NUWA 3VA8A 3UXDA 4J7RA 4LYKA 3B9NA 3W1PA 4W4QA 1J2WA 3BZGA 4CN6A 4E2BA 4M82A 1UR0A 2OEJA 1PE1A 1JDFA 2VMFA 1ZBWA 2CZEA 4O4WA 2OCZA 3ORWA 3VNDA 3KEHA 4C1KA 1AW5A 4QDWA 1JZ5A 3GBEA 2CBVA 3H4WA 5I02A 3OBKA 4U5KA 2BP1A 3P84A 2V3GA 4MY1A 4O12A 3MBFA 3R0UA 3VC5A 3SEPA 3PZIA 1OB0A 4JNYA 1CGXA 5KETA 1VYPX 1NEYA 1QNOA 3DX5A 1R9XA 2EF9A 3FDKA 1UP3A 4URIA 4MJ2A 2OYLA 4IMDA 1V3LA 2OU4A 4OIFA 1EJVC 2I5GA 4GC3A 4GG9A 4JOMA 5GJMA 1QPQA 1YXCA 3UG4A 5D2VA 3TN3A 3OLEA 2VO5A 4DLFA 4E8DA 1WA3A 3WMBA 3PS7A 3MHGA 3BE7A 3RRXA 3DDMA 4MWAD 5IOBA 4UTTC 1XLKA 2OO6A 3QY7A 2UY4A 1W2PA 5A6LA 4MFDA 1QNRA 4DBDA 3IAPA 4D8LA 1MZHA 3D6NA 2PDFA 4HK7A 1ZNNA 3WH9A 1OIFA 2GWGA 3I65A 1BVWA 4PA8A 3H55A 1UC4A 3H26A 4AX6A 3T40A 2P3ZA 3GO2A 3UR7A 2PMQA 3B8IA 5SWUA 1UA3A 1DORA 2NXHA 1RCXB 3CYJA 3WELA 4KESA 2HNEA 4UBPC 5JMUA 4IJBA 2C1IA 6REQA 2PDPA 4HN8A 3ISIX 4C6PA 4H9MA 2WAGA 3GM8A 4C1NA 3GLCA 2YDSA 5A69A 3BVJA 4H00A 3O7UA 1K8YA 4QJ1A 4AUBA 3B9OA 3BW2A 4XSLA 3SFWA 2MNRA 4XZ9A 1VZWA 1DWIM 3E0IA 1CWYA 4D9PA 4QS5A 1E72M 1KM6A 1IYXA 4B3LA 2ZWZA 3E5PA 4MNJA 3ABRA 4JYEA 2ASHA 1V3KA 2WSPA 3EWUA 4RZ5A 1YNQA 2DGAA 3WQ6A 1JZ6A 1E0XA 3IV8A 4JN8A 2E09A 1B3OA 4ZENA 4HBKA 4DO5A 1KGUA 1TJRA 1TR1A 2WBKA 1EC7A 2XN1A 4GY0A 1T6MA 3TTQA 4EWND 3E5BA 3SAZA 2WKJA 5AKQA 4IJRA 4V15A 4JL2A 4N9EA 2E9LA 4P8VA 1WXJA 2W66A 1PO9A 4I8DA 1A4LA 3LTSA 3BMWA 4QLLA 1PKLA 3UCDA 1O5RA 1ISYA 2J7EA 4NP7A 1E6QM 3CTLA 3TC3A 4DWSA 3UQNA 1OC5A 2HROA 3W25A 2FTPA 5FL1A 3F5LA 4UQDA 1AUSL 4XVDA 2GOUA 3T07A 2A3BA 1EX1A 3UZJA 4LWWA 3NQFA 1DIEA 4Q8UA 3NQAA 4C6IA 1GGOA 3K1GA 5HNUA 4U5IA 3AAMA 4RV8A 5K4ZA 4CCDA 2PGEA 5M17A 4L1WA 3KRBA 3C0SA 1ME7A 1FCVA 2D20A 1GEHA 3Q58A 1L6GA 4XVEA 1GVIA 4UQCA 3MUXA 3RK8A 1UUQA 3EDKA 2QCEA 3P14A 5DCDA 4LC6A 4RZ6A 5CSRA 1Y65A 1OQFA 1P6BA 2OMAA 4DJED 2HZGA 3GZ3A 3N18A 4HIBA 2R8WA 3DHPA 1WDPA 4FAMA 1WAUA 2EXOA 3MWCA 1OG6A 4RJEA 4XSMA 3AMDA 1ICQA 3N6HA 2Q09A 3UXLA 2C19A 3TU9A 1J93A 3AHZA 4DZHA 3PJWA 3HPSA 4LTSA 4LQ1A 4Q4KA 2C6QA 4YCPA 3OGVA 2P53A 1FKWA 1LOSA 1UKQA 2W0UA 1XGZA 4Q4SA 1VHNA 1W5NA 5G5IA 3ALFA 1K3UA 2A5HA 3TW9A 2QJHA 3KHDA 3QXBA 4MZYA 2X1IA 3CHDA 4PSRA 1Q63A 1SJCA 2VOTA 4E8CA 4P61A 4JFVA 4MB5A 3WD1A 2YFOA 4WDTA 2GQ9A 4KFNA 3ES7A 5FI8A 1ITCA 1DXEA 3HG3A 1SJDA 3P61A 2ZZ3A 4JX5A 3W00A 1C92A 3TXVA 4N9CA 4QE5A 4I9AA 1YBQA 2IKGA 4JTUA 1PCWA 1TWSA 4X61A 3R11A 1KM5A 2VFEA 3A47A 3D5HA 4ZXOA 1UA7A 1BGGA 1EB3A 4DJDD 2J62A 2QVNA 2BV9A 2P50A 4CGTA 3K8KA 3WUBA 4MF4A 1KQYA 3SCOA 2XVNA 5I3JA 4MWAE 1A5NC 1AJZA 4LVDA 1MW1A 2E28A 5LSMA 3G1HA 3K8LA 4IF2A 5FJRA 1G6CA 4XV0A 3DFQA 5A95A 2YCIX 2OTDA 2WW5A 4Y9OA 5HMSA 4LH8A 3KVJA 3ZVIA 4NNBA 3HURA 5GJNA 2QXWA 3UW6A 2O9RA 1SQ7A 2WVVA 5E0CA 1Z41A 3GDTA 4YTSA 3WQ8A 3W70A 4RNHA 4TMCA 4HSNA 3LLFA 1RQEA 4JS3A 1KFLA 3NAVA 1B31A 1WYIA 1WPCA 1MFUA 1LWIA 2DT1A 3B04A 5I79A 2QHAA 5BU6A 3UA4A 4K68A 2J77A 2PWFA 4KGLA 3PP7A 3BQ5A 1H49A 1Q85A 3TH6A 3BG3A 1HL9A 2W27A 4QROA 3BICA 1XW8A 1EC8A 3CUFA 1TCDA 1CLVA 3EEZA 1HO4A 3VDBA 5ABFB 2ZZ4A 3FXGA 2XZ9A 4W86A 5D9OA 1U5VA 3CIXA 2DV0A 3EDFA 3WIJA 4HKPA 4OTKA 1UOZA 1W1ZA 1V4YA 2WKGA 4L9XA 2G3FA 4F0LA 2R94A 1WBHA 3NL3A 3RPTA 4L4LA 4JZ5A 2E4TA 4NG3A 3NWRA 1G1YA 1DJIA 1T41A 4QAIA 3MANA 2XH2A 3MU7A 2KZHA 1YIXA 3GSMA 3W9ZA 2OWCA 1CGWA 3VU2A 4C6FA 5LHFA 3AHTA 4ZO6A 3CWOX 4AD5A 3U2ZA 1QNVA 5EFFA 3N19B 2UV8G 3O16A 4CLMA 3LCXA 5D9MA 1KXVA 2ZOXA 2P5NA 3BCJA 1RVKA 1E55A 1PAMA 1KXTA 3VKKA 3MP5A 4RXFA 1PHQA 4DWSC 3HQPA 3S46A 1MQQA 2XGBA 2G97A 2ANUA 4GACA 4UZSA 4H7ZA 3N9SA 2QUUA 3EA2A 3MMUA 4G5DA 4G2DA 3FK4A 2FDSA 4JQAA 4F3HA 2XH4A 5I23A 4F66A 3S4TA 4GXMA 2H8XA 3E2SA 1PV8A 2CZ5A 4N02A 2CIPA 2TODA 2C71A 2H9AB 3W7JA 4EXBA 1QNQA 4MB3A 3WUFA 1IQ8A 1TPH1 3L5AA 4PMZA 1VIZA 2NV2A 3R58A 2OX1A 1SO4A 3EB3A 2BHUA 2TMDA 1N55A 3Q94A 5C9RA 5RUBA 3SY8A 3UU0A 1C8QA 3KVLA 1SFLA 1LUCB 3KP0A 3GH5A 3T9PA 4A8RA 1OSEA 3MUZ1 3G18A 1RZMA 1SJBA 4UTHA 4C7DA 7A3HA 1OFPA 2PDIA 3WFLA 4HU4A 1SR0A 1DL3A 2Z00A 4Y7EA 4NAEA 2NQ5A 1OY0A 4XZHA 4IP5A 3RAOA 4L65A 4NNAA 4WIWA 2ZA1A 4TXEA 5LNWA 2YA0A 2Z7KA 5KTLA 3N9KA 2Y62A 2DH3A 5A2BA 3THUA 3IUDA 3MMWA 3URQA 4CU7A 1MEHA 4W7UA 4WXZA 1L2QA 4JFSA 2P88A 1VS1A 1CXIA 3UXAA 1UQYA 4HB7A 3MW7A 4PODA 1OGBA 2FH8A 1YKWA 2ALRA 3QY8A 5CZJA 4MUPA 5I00A 1GHRA 3VNLA 3MTWA 2PZ0A 4QFUA 2PGRA 3USZA 4HZ6A 4C60A 4HA0A 2BX7A 3PZUA 2WLYA 1QW8A 4FR6A 2YXGA 2CXGA 3LA4A 2CLKA 1PJ9A 1TMLA 3LPGA 4IPPA 4DN1A 3VM5A 3N34A 2DU2A 4B2DA 3ITOA 4R7WA 3P2VA 2Y70A 1HP4A 3VE9A 3DFNA 3C2YA 3K46A 3OO2A 3HPXA 3AIEA 3KOXA 4YTQA 3I3EA 1DJQA 3CL6A 5LNRA 5C7HA 3KP1A 3KVKA 5FSDC 2NQJA 3L2LA 4ZQCA 1GWJA 3OYXA 1MUWA 2R91A 5CBJA 4PBFA 1D3CA 1JXJA 3TSDA 1V6XA 5AN7A 1SSGA 4GVGA 5CC3A 3UT0A 2QDEA 2QGYA 3W2LA 4CKQA 5GNXA 3H23A 4AD4A 2YZRA 1KNWA 4KWVA 1WUFA 5DO8A 3NM3A 3IPWA 4EPEC 2J8GA 2B7OA 1RD5A 4YVPA 3AJXA 5FSEC 2Y5SA 3BUVA 3CUJA 1TWIA 3AZRA 2Y85A 4CQDA 5DLCA 1VB9A 2YR1A 2EPOA 3K4DA 1TWDA 3WLNA 4QBXA 3DESA 1YDOA 4UFIA 5A1AA 1X7IA 5IM51 3SRHA 1TMQA 3VOFA 4JIQA 1LWHA 4U2YA 4QE1A 4PUDA 5C70A 3T6CA 5M1TA 2VCAA 1E6NA 4XZWA 4F2BA 3G1FA 4IMEA 5TIMA 4REQA 4K38A 3HGJA 5DMMA 1A5LC 4FXRA 1G69A 3WLMA 5G1TA 1RCQA 4FIQA 2QULA 5I09A 1DJYA 3NQBA 4M7SA 4W7WA 2GJXB 3AZSA 2PRLA 4IMGA 3KHJA 2YDQA 1KBIA 4Z1DA 4D72A 2XN2A 2EO7A 4AY1A 1XIMA 3GVVA 2WANA 2PEVA 4C1LA 3EOLA 1MEWA 1VD6A 3NZPA 2XIBA 1IXQA 5K9CA 2E25A 3PZMA 4TR9A 4ZTXA 4DZAA 1XIIA 4RDWA 1CZ1A 4JTAA 3QTGA 4GINA 1OCJA 1GYMA 3M0LA 1ITXA 2Y63A 2ZVRA 2JIWA 3DYMA 1GNXA 4BF5A 2E5BA 3LHWA 2ZXDA 1ZALA 1XBZA 2QAPA 2ZXQA 5FA5A 4FS9A 1R7OA 3BW4A 4A3RA 4GMEA 4QG9A 3T8QA 4NI8A 1QFEA 2VP8A 1TUXA 3FCPA 3VOCA 4HGXA 1ZAIA 3CO4A 2J4GA 1ZGDA 1XIHA 2WQDA 1ZUAX 4DYJA 5EBAA 1FWTA 1OYBA 4LAMA 4O50A 5CC6A 3KZSA 3SURA 3GU9A 3WG6A 4WKHA 5LIXX 1VLIA 2YDRA 2F8QA 4HZMA 3VPLA 3FGCB 6ENLA 3W1RA 4H2CA 1DWGM 3DFOA 1KM1A 5BU9A 1TV3A 3PSWA 1FY6A 2ZUWA 2ZA3A 1O1ZA 2W61A 2VX5A 1WKFA 3RLVA 4BHYA 3TN5A 3JRKA 3LZ3A 4M1BA 1NDZA 3VIJA 2VX4A 1QPNA 3LOTA 2YLLA 3UY8A 3WK3A 1FBAA 4CVWA 2FTWA 1GONA 4U33A 1Q2RA 4O0QA 2JKAA 3AIUA 3C56A 3C3NA 2ZWYA 3HA1A 4JN6A 3M0HA 2ZC1A 2DZAA 3QV6A 4HPHA 1BXNA 1DJHA 2F38A 2P0OA 4YVXA 3LRLA 5FACA 4NYUA 2E67A 2Z27A 4Q7NA 1EUAA 3H2CA 2XIOA 4H3DA 3VE7A 2V67A 1W3HA 4RUBA 1X6UA 2ZRXA 3BJFA 1B3XA 1FFRA 3QGKC 2QCFA 3W7GA 3KUMA 5E1QA 5CC5A 3H2MA 4FP1A 2J66A 1LOQA 1B3ZA 2C91A 4FNQA 2BXYA 1XFBA 3TN4A 2V63A 3MMTA 2D0HA 3N15A 5J5DA 2WB5A 1EL3A 2WM1A 4GGBA 5T9BG 1ZBCA 4AMAA 4WF7A 3LU2A 4ZQNA 1X6LA 2PDUA 1E0WA 2D0FA 2IKHA 2HQAA 3SCSA 4US6A 5FF7A 4HSHA 4INFA 4AVOA 1JDEA 3J7HA 1GUVA 1V79A 2G4FA 4X22A 5FD0A 1KRCC 5HNRA 1XC4A 2YA2A 2E1DA 3V1HA 1LQ2A 3IS4A 5I6SA 4JIEA 4S1FA 1M65A 5D2XA 1TELA 2XH7A 1XP3A 3AS0A 2Y7FA 1GVQA 1F05A 1VF8A 1QAPA 3GXNA 2AAAA 2CKSA 3CEPA 1AD4A 1SMAA 3AALA 3TSBA 4M19A 2RDXA 4LEFA 3VM7A 4HP5A 5BRPA 1UPMB 1G7VA 1XIJA 1BD0A 3R5EA 4LC8A 1UH3A 4YWSA 3OP2A 2ZZ1A 2QIWA 7CGTA 3W22A 4O19A 3IIZA 4C1NB 4R5EA 1BGAA 3ES8A 3V7PA 4CD4A 1GYNA 3TN6A 2ZRWA 4F79A 3PWIA 3QPYA 3FJ6A 3CO8A 4Q3MA 1DXIA 4Q7BA 1NDWA 1JZ2A 3GE7A 2ZZ5A 3GDLA 3OHMB 3LM3A 2G50A 2D2OA 2QLYA 3LY0A 3PR2A 4Q4MA 1V6WA 1K7EA 1FWCC 4KMQA 2PC4A 4JQ1A 3PF3A 1X8FA 2ZADA 3GZAA 5IXEA 2GVJA 1E9LA 4DBWA 3WNPA 1VIWA 2EG8A 2W92A 3M07A 3AMLA 1NVMA 5CAKA 3PBWA 3V5FA 3RXZA 1JAKA 3IRSA 4YCOA 2NW0A 2P3EA 4F0HA 3U4FA 3WF0A 1HF6A 1KKOA 3VKJA 1V51A 2YFNA 3OIHA 4KEMA 3CHEA 3E1F1 4RPPA 1QPOA 3O6YX 1YPFA 2R82A 1VEMA 4NYYA 4JKMA 4IPLA 1GOXA 1BYCA 2PS2A 3FYOA 4DWSB 3VD9A 4OJYA 3KBVA 3RUBL 4IXHA 1TVLA 5D2TA 1W3TA 4EIVA 2CETA 3T42A 5EL1A 4IHCA 3VXGA 4H83A 1H60A 3YPIA 4DI8A 4XZIA 2J75A 5U4NA 4LYPA 3KDNA 3VNZA 2FGLA 2YJQA 4NQ1A 4N42A 2B7QA 3ZR6A 3FKRA 3SCTA 3RHGA 3CH9A 1XG4A 4Y6GA 4Q6XA 3ANVA 4PTMA 4WGXA 3KOWA 2YBVA 1M6JA 2V8ZA 5FAGA 3N29A 2A6NA 3LPPA 4XIAA 2W6RA 5K9XA 3RM8A 4BS0A 1NY1A 3L66A 2W4XA 3EX4A 2WJZA 4JHZA 1F7BA 4HNCA 3I10A 1I2PA 1J0KA 4JEJA 3BAYA 4HT3A 5KINA 3LHZA 3ITXA 1A5AA 2DW6A 4XBKA 4W93A 3THDA 4KIEA 4LY8A 4DX3A 4ZZ9A 4ZOAA 2Y7EA 3UNDA 5C2XA 4PSPA 4JY8A 2JGYA 6TIMA 2HPMA 1EBHA 2BOGX 1KWKA 3EYPA 1HIZA 3LV6A 5LKYA 2OELA 6XIAA 3LUTA 2ZRVA 4A3UA 4FO4A 1E51A 2DZPA 4N0RA 3VUSA 3WD4A 5A8OA 4GD0A 3OLDA 3KLLA 3TFXA 2RDWA 3UERA 5A6JA 4ZA0A 1K7FA 3L65A 2A4AA 1UMLA 4R3UA 2A7NA 3R2GA 3UNTA 4H19A 1LOLA 4BK9A 3BLFA 1IR1A 3APTA 4HJWA 3V1PA 3VIIA 3B0UX 1GEQA 5KZMA 4A21A 1YBQB 4PUKA 1H0IA 4WXYA 1GG1A 2I5IA 3OHIA 3GNPA 2F61A 4JTGA 2HV5A 3ABQA 4NHVA 3GTXA 1JDCA 1E0TA 4XAZA 1DWAM 3ERPA 3Q2DA 5DMYA 3DHDA 2UZ9A 3WL0A 2Z26A 1V7AA 4LYQA 1GQNA 1K9EA 4XBJA 4KWOA 4KFPA 3VDCA 4JCLA 3TTOA 4GABA 2G37A 4LCQA 1TIMA 4PUEA 4YS1A 4LCRA 3WENA 2E40A 2C16A 2VELA 3U2CA 2FFCA 2NSOA 1X39A 1K02A 3NEVA 3IWPA 1CECA 1E0UA 5I3DA 4I90A 3W84A 3W73A 1LG2A 5TD4A 4QE4A 3VIKA 4S3FA 4C6EA 1J8VA 3W6LA 1J12A 4J9JA 3NUKA 1V6TA 3PSVA 2O0TA 3C0QA 4IISA 1UD3A 1OFDA 2WVUA 4XKYB 4ZMGA 4LAZA 4H04A 3WDQA 3FV9A 4HPNA 5HDRA 4XUGA 3SO7A 3WQOA 4M6QA 4WJXA 2OVLA 4B5VA 3ONCA 2IPJA 4X3ZA 2Y24A 2QW5A 4GUFA 4LU0A 1CLXA 1MW2A 3FJLA 4IWWA 4DIAA 4QR6A 3IUHA 3LTPA 4JTFA 4HHMA 1XQKA 3RCNA 4Q7IA 1Z48A 1EEXA 2G8ZA 1UHVA 3DN5A 2EPNA 4DELA 3W72A 2V2DA 3QV8A 4GY1A 4PCSA 1IXPA 1JL8A 4KEVA 3C86A 2J7GA 1JI2A 5PTDA 1R3VA 1U5HA 8A3HA 2WLZA 2D2HA 1X38A 1KA9F 3JU2A 5ECVA 1L0PA 1NDVA 4OOZA 3W1UA 1WO2A 4XAYA 1NF7A 3L4TA 1A5KC 3P0XA 5G2WA 4ES4A 5CPNA 4NZFA 4QGCA 1F6KA 2J13A 5IHRA 5FJJA 4Q8QA 3VDAA 1X98A 2W3ZA 3V0SA 3TJLA 3JVAA 5AC4A 1GKQA 4LGXA 4AZHA 3S6OA 4PUNA 3CZ8A 1VBJA 1D3HA 3L4WA 2Z1SA 1IEIA 2AQVA 5EMYA 2D2JA 2CBUA 2VRJA 3UWYA 1M04A 3IGUA 2HBXA 3SZ8A 1E1CA 1U30A 1UOKA 4F4RA 4HCDA 4PEKA 3A3XA 4GFIA 3IJIA 2V69A 2QJJA 3O6AA 4IMFA 1HKIA 3AI0A 3NVDA 4KRZA 3AIQA 4GIEA 8XIAA 3O15A 4WOQA 3KBNA 3MWAA 1S5WA 2OZ8A 3FS2A 2ZBTA 1QI5A 1B30A 4MNMA 4MADA 3NR0A 3CT7A 4LAOA 2WNWA 4LFYA 5C2GA 1E4LA 3VUPA 2PDKA 2OQHA 2WHKA 3WJWA 5CQ1A 1KW1A 2F9RA 1TFVA 1F4AA 4E3VA 2BMBA 1E4IA 1HFBA 3VGDA 1W1YA 4D6HA 1NU5A 2HJPA 3SRDA 4EKJA 2J7BA 1EJ7L 2GVEA 1VRDA 3L5MA 4NAEB 2VR2A 2HXTA 1RA5A 2PDYA 1S2WA 3W02A 2QCCA 1WXYA 2OEMA 3DERA 3HPFA 1KBLA 4GQGA 2FIQA 1H63A 3GW3A 1RPXA 2CXEA 2VX6A 3G24A 4ERGA 4HN4A 4POCA 1H0GA 1K8XA 1E3ZA 5LZLA 4FXSA 4KCVA 2FDMA 1S1RA 1L6FA 1EJTC 4ENLA 2PFHA 5E09A 1WNOA 4P7NA 3IIVA 2PP3A 1EP3A 4DHGA 4HK6A 3FEQA 3CBWA 3VKDA 2UBPC 2IXVA 3B9DA 1V03A 5B7YA 1UJQA 2KX9A 3BARA 3W23A 4LUIA 1KRMA 3HJEA 1KQZA 4HNLA 4FR1A 4OV9A 2O9PA 4DB7A 5AFDA 2J88A 3LNMA 3MHFA 2Q3RA 1TE6A 4HNVA 4ZODA 1J4EA 2JK2A 1E6ZA 4S2CA 2CLPA 1S2CA 1ZBKA 3D46A 4ZFCA 4WHBA 1DJGA 4TTGA 1QHZA 3E12A 4PCNA 4JKLA 2ESCA 3TE9A 5D05A 5DN1A 2IPWA 3NIYA 1P0NA 2Q71A 3DCPA 1XPYA 1BYDA 3E02A 2WMHA 3BQ6A 3T2QA 4JTKA 2V6AA 1KCKA 1OIMA 4G8TA 5EB8A 5HMDA 3IRDA 2CHRA 1RV8A 3PK7A 4XD5A 3HFYA 3V4BA 1R2RA 1VKFA 2WO5A 3TONA 4NX5A 2XSBA 5M2FX 5TBOA 1Z8AA 4HMCA 3ME3A 1OGSA 2VZVA 4FXJA 1YPIA 3OTRA 4LBSA 2E6YA 4F9DA 1CX9A 1JNEA 2QF7A 3GIQA 4J40A 4DPPA 1S3HA 1MXSA 1V6YA 4C6NA 1Q6GA 1UKOA 1YQ2A 1EHNA 5BMXA 4QDPA 2D69A 5E93A 1XLFA 3HMJG 4HU8A 3U2EA 2RDTA 2I5QA 2V3EA 1RK6A 2B4GA 4CNPA 3GXIA 1SFSA 3ZSSA 3N11A 1QOQA 2O55A 2DZTA 4XB3A 4REQB 1RUSA 3GC5A 5HBFA 4C65A 4HD5A 1JPKA 3TOYA 3U4AA 1FDJA 3LRKA 2VQUA 3G1AA 3I7RA 3WUEA 3LPOA 1QI3A 4BF9A 1CTNA 3N25A 4PMYA 3W88A 4PH6A 1IE7C 4CD6A 4MGGA 2BWGA 1ZB5A 5HQMA 1TPEA 4L1GA 4N2YA 4AZIA 4L56A 2WZHA 3GC4A 4MZ8A 3TK7A 3EKGA 5DRCA 1UD6A 1DKWA 3BLKA 4ZQOA 1XX1A 3BMXA 4MZ1A 4MG4A 4NRRA 5A6KA 3T2PA 1EJWC 2QR6A 3E0FA 3WF4A 2ABAA 4UTFA 1ZCOA 5IFTA 2Y6ZA 1W1TA 1YE4A 4O4VA 1IWPA 3QBUA 3WFZA 4AWUA 4V1YA 4C6BA 1M5WA 3I3BA 3T55A 3UJRA 2Z29A 4ZR8A 1EF3A 4PC8A 1M9HA 3B05A 4H2HA 2V2HA 3MS8A 4JFTA 1RJPA 2P10A 5DCBA 4DO6A 3CQKA 3KTCA 4OECA 3E49A 2O56A 1WXZA 2JGQA 5K9DA 5AHIA 1X1OA 3G22A 1XBYA 1NFBA 1UD5A 1V08A 2PBOA 4H8VA 4OKDA 1I2RA 3URBA 4ASTA 3CZKA 4YYFA 4RE0A 3IJ8A 3AUOA 4NJIA 4PEEA 1XYBA 3MVIA 7ODCA 3VD7A 1E0VA 4B9YA 3SIZA 2EPLX 1ODUA 1Q4NX 4AZ5A 4CD8A 4MSSA 4O8AA 1LLOA 1H7XA 2GGJA 3QYSA 1F61A 1TJPA 5KITA 2VFHA 4EE9A 3DECA 4D1IA 4IPIA 3T4CA 1PDZA 3BH4A 4MPQA 3IAQA 3NGFA 2VFFA 4J3ZA 1WDSA 3GS6A 2H3BA 5A8GA 1CGUA 3KTXA 1MUCA 2GJRA 3SCRA 1POJA 1XLMA 4O13A 1M7JA 4WY0F 3UXIA 4AC1X 4IX2A 1FHDA 3TC7A 4PCTA 4L6OA 5LNVA 5BNKA 4O11A 3B8SA 3QHMA 3EOUA 1VJSA 3DHFA 5G4HC 4IIFA 3WJZA 2VVNA 2C13A 2DT3A 3VMOA 3LERA 4D6DA 3BLLA 1C93A 4L4PA 3VNMA 3UZXA 5H91A 1XS2A 1C9WA 1B54A 3GKFA 3LM7A 5CG7A 1FVPA 1VQTA 5H1WA 1AW2A 1LDCA 7REQA 4WKAA 4Q8WA 3ZT7A 2JFEX 3CV1A 1FWRA 3O06A 4GKTA 2GWNA 1V0LA 2VYOA 2WJFA 4PMNA 4EF9A 1SR9A 4CQAA 1U1JA 1PIFA 3WCZA 1C8VA 2QYGA 1EDGA 1SW7A 5KZDA 3KL3A 4D6IA 4JTSA 1OC6A 2E3ZA 5FIPA 4IGSA 4BI5A 1QWGA 1B2YA 2VM8A 3WZ0E 3URAA 3A4AA 1MRAA 3WJYA 4B92A 3KLKA 4Y9NA 1LT7A 4ZOEA 2Z25A 1S5VA 4ZSUA 1QOXA 1S5NA 2WHMA 1ME8A 4NT0A 3FDGA 2J25A 5HOSA 2WXDM 3TNOA 4Z1YA 3VIFA 2VQTA 2Z1WA 2H90A 2NUYA 1HT6A 3KCJA 3AISA 2BHZA 4R7OA 5FEZA 2OKOA 5H8UA 1FCQA 3ZVHA 4HOWA 4MVAA 4M51A 2W63A 4FX8A 1UC5A 2GGEA 4AD1A 1OCQA 5E70A 2VEGA 4CUCA 1FUYA 5AVHA 4PL1A 4J35A 3KE0A 1JFHA 2AGKA 1ZJBA 3UD6A 2WC3A 4LRTA 1TPB1 3AWNA 1LQ0A 3FIGA 3PBVA 4HZ8A 5I3IA 2EHHA 3GIYA 4A3HA 3P8IA 2V68A 3T0BA 3T09A 3AIWA 4GZEA 5HPOA 1GZ1A 1NJJA 4QCEA 1H51A 1WKYA 5AYIA 5AHFA 3C61A 1E71M 2X7VA 3LK6A 1P1XA 4ZXLA 4ZSTA 5EY5A 2ZTJA 4QLJA 4Z2GA 1JNDA 2PUZA 4JN7A 3F4VA 1OYCA 1Q2SA 4JTLA 2FVKA 1UCWA 3SUWA 2J9XA 1U1HA 3A9BA 4QXIA 3T0AA 1G9HA 3P5YA 4Z2LA 1O5QA 4GO9A 2CZVA 4IFOA 1VCVA 4KF1A 1WOAA 2DIJA 1IWBA 1XINA 3NVTA 1E4NA 1UPPA 4PR4A 4FZIA 1TV4A 2PI6A 4RR4A 1JG9A 1OHLA 1E40A 2WMKA 2XPKA 4AZCB 4F2UA 1QVBA 2E9MA 3BSMA 3AMGA 1VGAA 2XISA 3PUEA 3BXWA 1UZDA 3V5CA 3DG7A 2QGHA 2YBTA 3D3FA 3FX4A 1KM4A 1SJAA 4Y2WA 3SCVA 4IGHA 3GXDA 1XUZA 3HGSA 3CUGA 2XM1A 1EJRC 2WCGA 1JDAA 3E0LA 2QV4A 2F6UA 3LXAA 4GPNA 3WLLA 1XF0A 3HGRA 3P6LA 2ZUUA 4H8HA 1TV5A 1DBTA 3SUVA 3OQEA 4HQVA 3M6YA 4JY9A 2BBFA 3ATZA 1MW0A 4JTQA 3DHUA 3GUWA 4LVBA 2Z28A 2CLEA 2I17A 1TO3A 1UWTA 3VOIA 1O95A 3MJYA 1SGJA 5A8MA 4CCEA 2ODOA 2NX1A 4Q8VA 2E8ZA 3BOXA 4TVCA 2X0HA 1Q6CA 2BS9A 4OBRA 3MYPA 2WWDA 2CERA 1VYSX 3I4KA 3WUGA 4G6CA 1JUKA 1SZEA 3WJXA 1P43A 4W8LA 4NUWA 1TZZA 4OOUA 3GHTA 5A6MA 1PIIA 3HGOA 4US5D 3KWSA 5HXMA 1EZWA 3GG7A 3P67A 3S0CA 3CTTA 2R1KA 2REQB 4QRNA 2HVMA 3W7PA 1CIUA 5IRPA 1BHGA 3H7VA 3GFYA 5E0KA 3B3DA 3SCNA 3PG9A 3DYPA 3SSZA 3M43A 4BKNA 1W2VA 4EWJA 3IUIA 1UMYA 4O10A 3EWCA 4DZ5A 2DDXA 4NASA 1N8FA 4Z2IA 1SFJA 2TSYA 4HTYA 1BG4A 1PS9A 5A6BA 4V2XA 3WLJA 3WDJA 4CEXC 2NSXA 1A5CA 4GJJA 3T2OA 4RL3A 3A24A 3R1ZA 3L12A 1VHCA 3E74A 4Q4PA 1EO5A 2Z2BA 3W74A 1WDDA 1J0IA 2P0IA 2XVKA 4P7OA 2R6OA 4AAJA 3UGRA 2H3DA 2QZRA 2ZYFA 2PU0A 1AQMA 4IL2A 1XH0A 4V27A 5FF4A 1VRXA 1UH4A 1AW1A 1PCKA 3DC8A 1S2UA 1HL2A 1ONEA 1JAEA 1VPYA 4X63A 3KX6A 3QR0A 3AHVA 2P76A 2RUSA 4ORMA 2C18A 1WB0A 1XH2A 3UPWA 1CENA 1E3XA 1TIWA 4FMVA 1SW0A 1OC7A 3BLOA 5CZKA 3RM4A 3II1A 1CGVA 1S38A 6ALDA 4B5TA 3AIRA 1JPHA 2FZ9A 1XYAA 4GOAA 1RSCA 4AHOA 1MI3A 2PWGA 2OSXA 3WLRA 3VGBA 1DWHM 1UUMA 5CJMA 3C52A 3W1NA 1EP2A 5I07A 5LA1A 4JIIX 3RPMA 3PWGA 1XYCA 5GJPA 2DQXA 4KCUA 4PMDA 2X09A 2H6RA 5BWAA 4QHRA 2QNEA 2XDFA 1ICSA 1W9XA 4W8BA 5ABEA 1YMYA 3H8AA 3T8LA 4NAFB 4LAKA 2BOFX 4PTXA 4NJJA 1YDVA 1QDSA 3TLLA 3AJ7A 2ZRUA 3F5JA 1W1IE 3M0YA 1JVNA 3ITVA 3EDJA 3EX2A 3OBAA 2ISWA 4C6CA 1XHGA 5EPDA 5CGTA 2PDLA 3LHTA 5AOUA 4MIMA 1Z9AA 1OF8A 4LF2A 4L4OA 2I9EA 2CBJA 2VX7A 3M4HA 3WBYA 1L6SA 4LS2A 4PTDA 1WCGA 1S46A 2G95A 1E6SM 3NTYA 1R9ZA 4N9DA 4GKLA 3WLTA 1RP8A 5BXTA 4UQBA 3FA3A 1I0DA 1O94A 3W71A 2C14A 4D8AA 3M47A 4F2TA 1I4NA 4Z08A 1G0CA 1IWAA 3PM6A 3TV8A 2JQXA 2WWCA 2FFIA 1GPWA 4QP0A 5DT5A 4C6OA 3MSYA 4AD2A 2DH2A 4HJFA 3LG3A 1RR2A 1VFHA 4LS1A 1VBUA 4FOKA 4JHMA 3TWAA 1PZ2A 1IT8A 4NRSA 1MDRA 5F1UA 2I56A 2VZTA 4UMCA 5DF0A 3FVMA 2J6VA 3POCA 3OVPA 4E4FA 1V6UA 4XISA 4GZIA 1J6OA 1XIEA 4GQQA 1YADA 1TPC1 4GO8A 2G5WA 4QDMA 1GVYA 2YL6A 1FXQA 2AQWA 3BJTA 4CCZA 2CWXA 2PP1A 4DXVA 1JYXA 4XIMA 1Y5XA 4U31A 4J3XA 1VJZA 3GNNA 2VI0A 5HMFA 1GCYA 2QUTA 2ZC8A 5FOOA 2CKRA 4M1RA 2GVYA 4DJFA 3PZQA 4LNYA 2DSVA 4U2ZA 4MJZA 4GH3A 2VDHA 3PZ9A 2R1LA 1B3WA 2YL8A 3OB8A 4A29A 2VRKA 4H41A 2XU2A 3IK4A 1MNSA 3NZRA 1UW9A 4IMAA 4KERA 4UMAA 1FDYA 2FHCA 5DEZA 2PD5A 2VDGA 4H8NA 4HPJA 4UQ9A 4W5UA 2GQ3A 2TYSA 5FJPA 1QI2A 3EOSA 2OGJA 1QPKA 4BJHA 2Y4SA 5M03A 1LL4A 3V16A 3LBOA 2F2HA 2ZUSA 2WMIA 1TG7A 3GNXA 3KM8A 1VBRA 3IIXA 1U2YA 3QZAA 4EPBC 2DUXA 3I7QA 4H9YA 2J6XA 4UFLA 4ZCWA 5HUOA 3OLGA 3RO8A 5DMLA 4Q8OA 3OZMA 1OEPA 2ZICA 4MDOA 3DENA 4NIRA 2Z1BA 1GVOA 3M5XA 4O15A 2VGGA 4KEUA 4KKXA 2VFDA 2GLKA 2A3EA 2E9BA 1JGMA 3E2RA 2VDIA 3GB6A 5FL0A 5A3HA 2UWFA 4CD5A 4TU1A 3CU2A 4F40A 2ONEA 1BKSA 4GH1A 4H01A 5C9UA 3M7SA 1V0KA 3L5LA 1OFAA 2BVWA 3ITTA 2PBGA 1LZOA 1N82A 2YKKA 5IHSA 4FHAA 1HP5A 5J8LA 1VFMA 3EGJA 2NVDA 1FWEC 2PRHA 4XG1A 4DXXA 1DE5A 4QTGA 3I6TA 2YPIA 1GHSA 3DIPA 1ZAHA 4HMNA 4TO8A 3W7RA 4B91A 1HGWA 3P93A 1T40A 2BY3A 5AHLA 3WH7A 4JYFA 5A6SA 1TZ7A 5DXXA 5L9FA 1B90A 2Z1XA 3OVQA 1FCUA 1ONXA 2A3CA 4YN5A 4UTLA 4NZ1A 3MSGA 1FQ0A 4LF1A 2VD9A 3XISA 2GJNA 3UA3A 3NPUA 3WQCA 4RW3A 3CZJA 1RY0A 4TIMA 4YHGA 5F4WA 4WZHA 5BROA 3PAOA 3VCCA 3ZXWA 4DAFA 4D6CA 3UEQA 4N6EA 2DORA 4AISA 2VEMA 2CLOA 5EKYA 1OT2A 4PBEA 4WR3A 1K03A 4V1XA 3COTA 4E2VA 1MZRA 4HTBA 2ZA2A 1AFSA 3LCFA 4DM1A 3QC3A 2CITA 3LMZA 4JTDA 2GVLA 1DWJM 1XYZA 4R7JA 1FOBA 3EB2A 4LVGA 1VLWA 2EPMX 2XWEA 1X96A 3H2EA 1Q65A 1CYGA 2OOGA 4H7CA 1UG6A 2E8YA 1H5YA 3GNOA 3EAUA 1CEOA 1VFSA 3CYVA 3E2QA 3NXLA 4PUUA 2QPSA 4BZYA 1ODZA 3PJTA 3P8JA 3IACA 1YYAA 1WKDA 4MKVA 5CAHA 3GVGA 4NU7A 3GVWA 2XM2A 4FNRA 1QTWA 4AFYA 3TW7A 1TA3B 2QQ6A 2WNNA 1P0KA 1ZQ5A 3QHNA 3UR2A 3EMQA 1XIGA 4O1AA 3GD6A 1D9EA 1EDQA 3L0NA 2GQ8A 1W1B1 4UTWA 1M1BA 4AZBA 4QEHA 5I3GA 1RP9A 1R3TA 1W9BM 3B0PA 2D1ZA 4KRUA 4KCWA 3PZGA 3QZ6A 4FPSA 4RXGA 2XWDA 2A79A 3S9YA 3KVMA 4GYJA 3MCMA 5BW6A 3UJFA 2F84A 3CS2A 4DF2A 1T0OA 5EA9A 3V5OA 3OEXA 3WMSA 1GOIA 4UWMA 2FHFA 3M0XA 3S2LA 3L4VA 3FLUA 4DJFC 3LCLA 1XG3A 1XCWA 2NVAA 1PX4A 3ARXA 1V3HA 3JS3A 5F7UA 4ZB5A 3H7RA 1FWSA 2X05A 1UR3M 4IGNA 4PUJA 2WVTA 3UG3A 4G1KA 3HV8A 3NJ3A 1EC9A 4X0NA 3ZM8A 1T7LA 1QRQA 5AYYA 3N4EA 4CU6A 2VNCA 1Q3NA 2PGWA 3U7VA 5CH9A 3NURA 3FGCA 3NG3A 3V0UA 4FALA 1A0EA 2RDUA 3VX0A 3PB2A 3BSGA 2OB3A 2C1GA 3IV3A 4D6FA 1LL7A 1V02E 2HCVA 3GH7A 4K36A 4RE3A 4ZVJA 3NPXA 4WDXA 4PRRA 1OM0A 2PURA 4L80A 2NXIA 3TZNA 3VI2A 4LUTA 4PTVA 3IIOA 3O6CA 2JE8A 1QOPA 3F7JA 1CGTA 7REQB 1XRFA 1A53A 2I14A 1LQAA 2NX9A 1K9FA 3W7CA 3V75A 1NIUA 1JZ7A 1XYFA 2PRMA 4MJMA 1M7OA 1HO1A 3UZ5A 1NWRA 2CEQA 3AQUA 4LB3A 3DFTA 2V38A 4EAMA 5HNTA 2V5CA 1Q7ZA 1AJ2A 1OD0A 2DT0A 2R24A 3PPCA 1Q6DA 3U3HA 4YYCA 3WBWA 4ECLA 4YTUA 1AMYA 5CJNA 2DJLA 3W82A 1NFGA 5GNZA 2BB0A 2Z1KA 3EOOA 1F6PA 2CFFA 1DE6A 4K8EA 1BYAA 3L68A 1R87A 1UKSA 2WZTA 2GUUA 3HF3A 5ECUA 3S1WA 2OT0A 1OADA 4GVFA 3LGGA 3KXQA 1Q4WA 3SI9A 3JZEA 5AY7A 1GORA 3H70A 1L9WA 3ZT6A 3BAWA 1GQJA 4H9ZA 1UUOA 4L9ZA 1PIGA 1J9YA 1H4PA 1Z44A 3OODA 2PDMA 2WHJA 4Q4RA 4WJEA 2OLAA 3VKAA 3EDDA 3VOJA 3ZVHB 1DPMA 3UYCA 1SVDA 1W9DM 2Q8LA 3GXTA 3GY1A 5CG0A 2QCHA 1ECEA 3AS3A 5D37A 4UR7A 4QX4A 1WZLA 3WQ5A 1MFVA 1EQCA 2VR4A 3AYRA 1OGGA 2BGNE 2PWEA 4MY8A 3WNKA 2YB1A 4C7FA 3S6DA 1XLDA 4MHBA 3GG8A 5F4XA 3QSRA 3FA4A 4OFCA 1OF6A 4BWLA 1V0MA 1PB0A 2VURA 2DVTA 2A3AA 4LOCA 3FSUA 2IS7A 3ABXA 4WKFA 1UWAA 3ZLFA 3DI1A 1HJXA 4O57A 3KOFA 1Q6FA 1B0IA 4GWEA 1YXYA 1QATA 3QQ1A 3M5VA 4AMCA 1S2AA 3VNKA 1JZ4A 4W5ZA 3NPVA 4O54A 3TW6A 1VPQA 1X1ZA 3VGHA 4TUFA 5CLTA 3USBA 1K6WA 5DFAA 1UR2A 2QT3A 2V5DA 3KAOA 3FVDA 1C29A 3Q45A 5FEWA 1S5TA 1Q6QA 4TQTA 1PZ0A 2CC0A 3KRSA 4YJ5A 3AWOA 3CV7A 1XD1A 2NX3A 1ML1A 4DF0A 3IJ7A 3VD4A 1KFEA 1RH9A 1SZFA 4GUHA 1W9PA 4HZ7A 3NZGA 4GYKA 2A85A 1ZRQA 2QPUA 1JCTA 2WM0A 1ITUA 4ZL1A 2YA1A 1L8NA 1LWJA 4IH3A 3WH6A 4UTWC 3UG8A 1F74A 3G2GA 4AIBA 3EXTA 2YLAA 4LYRA 3ZT5A 2HNHA 3WK2A 5CGQA 3BLPX 4X2PA 2ISFA 4L6DA 1Z89A 2IKIA 3B03A 3NL6A 2FZMA 3ZLHA 4HHLA 1FP9A 2ISDA 1XICA 4HPXA 2PTZA 1YX1A 2JKEA 3MI3A 3W1QA 3L23A 3LB0A 3CHFA 1OFOA 3ARRA 5FKYA 4XD6A 4PRWA 4XD4A 1ZP4A 1H41A 5U7SA 3KS5A 2J79A 2OLHA 1VCFA 2VJXA 1DXFA 3K4AA 3WLPA 2DZUA 3THAA 1LRQA 2NWRA 4D6EA 1I1WA 2C0AA 2WSRA 2PF8A 3ICJA 1QK0A 3OPSA 2GVGA 3I4EA 3ARPA 4EPDC 3CB3A 5GVJA 3V36A 1AODA 4IQDA 1FH8A 2VUNA 4Y90A 3M0IA 2WOQA 3PTDA 4JNZA 4NZ5A 1BQGA 2WC7A 2OLSA 5IBXA 1EX5A 2QS8A 4EF8A 1A49A 5AZ0A 4HK5A 5D38A 2PTWA 3OGSA 4Q22A 2CLHA 5D33A 3BG9A 3ECQA 5J04A 2O7QA 1PX8A 1W1PA 1F3TA 3S2MA 1UZ4A 3F4WA 1DV7A 3N2XA 2WCAA 5BMWA 2XTKA 1B3VA 3GTNA 3LDVA 1F3XA 4O1CA 4MYXA 3OOQA 3KDOA 4LBRA 3L4XA 3EBVA 3EXSA 3OYZA 5HINA 3NL2A 3A6OA 2X0YA 1IEQA 2FZ8A 1BQCA 1HKVA 1KCXA 4GQRA 3TROA 4V28A 3W01A 1A4MA 4AQLA 3LSCA 4PCFA 5IDZA 3NQ6A 3GTFA 4H9VA 3AZTA 4LX4A 2YCLA 5IDIA 3K2GA 2PODA 3FXYA 2NT1A 2YSWA 4DYKA 3W2UA 3PPHA 3RRAA 3DBNA 2G3MA 2DEPA 2Y88A 2V3DA 3BDKA 1Y5VA 3FAXA 2WVSA 1UKTA 1X7FA 5CPTA 1OX5A 5TF0A 2VOMA 1R9YA 3QGAC 4XTDA 1EPXA 3EA3A 3T0TA 3WSUA 5C8BB 3W7LA 1TB3A 5H8MA 3XIMA 3O2LA 4WK9A 1TV2A 3MA8A 3C8NA 4JD4A 3LX9A 2XFFA 1IGWA 3WEMA 1FKXA 1VEPA 4WLCA 1G5AA 3RU8X 1ISWA 1TZ9A 1IZKA 3N1AA 1UB3A 3ENLA 4MKNA 1VC4A 3GXPA 3IARA 1H62A 1K7XA 3HPZA