3UXIA

Crystal structure of l-rhamnose isomerase w38a mutant from bacillus halodurans
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
413
structure length
402
Chain Sequence
SQFERAKIEYGQWGIDVEEALERLKQVPISIHCAQGDDVGGFELSGDYPGKATTPEELRMDLEKALSLIPGKHRVNLHAIYAETDGKVVERDQLEPRHFEKWVRWAKRHGLGLDFNPTLFSHEKAKDGLTLAHPDQAIRQFWIDHCIASRKIGEYFGKELETPCLTNIWIPDGYKDTPSDRLTPRKRLKESLDQIFAAEINEAYNLDAVESKLFGIGSESYVVGSHEFYLSYALKNDKLCLLDTGHYHPTETVSNKISAMLLFHDKLALHVSRPVRWDSDHVVTFDDELREIALEIVRNDALDRVLIGLDFFDASINRIAAWTIGTRNVIKALLFAMLIPHKQLKEWQETGDYTRRLAVLEEFKTYPLGAIWNEYCERMNVPIKEEWLKEIAIYEKEVLLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords L-Rhamnose isomerase
publication title Structure-based studies on the metal binding of two-metal-dependent sugar isomerases.
pubmed doi rcsb
source organism Bacillus halodurans
total genus 139
structure length 402
sequence length 413
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.14: L-rhamnose isomerase.
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06134 RhaA L-rhamnose isomerase (RhaA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3uxiA00
1XIMA 3BDKA 3CQHA 3M0MA 4HHMA 1DXIA 1XLIA 4XSLA 4HHLA 3ITYA 3QC0A 5EMMA 4A8IA 3KBMA 1TZ9A 2ZVRA 2G0WA 5J8LA 3VNLA 1DE6A 1XLLA 8XIMA 5AVHA 2X7VA 1XIGA 2HCVA 5FA5A 3ITXA 3M0LA 3M0VA 1XLCA 2QUNA 3FVMA 1XLKA 3ITOA 3VYLA 4DVOA 3XISA 4Q7IA 3XINA 4YTTA 1DIEA 3WQOA 1XINA 4QEHA 3KBWA 1O1HA 5B7YA 1XP3A 1XYCA 4YTQA 5XINA 2I56A 1XLBA 1I60A 3VNKA 1XLHA 4ZB0A 8XIAA 2NQHA 3CWHA 1XLDA 2XISA 3VNMA 1MUWA 3QZAA 4X60A 4A8RA 3P6LA 5I7GA 1XYLA 3KBNA 3AAMA 1A0CA 4QDWA 1XLFA 1QT1A 1XYBA 1XLJA 3KBVA 3U3HA 4YTUA 4XSMA 3C0SA 4X61A 5XIAA 3KTCA 1XIEA 3DX5A 3GNXA 4QEEA 4PFHA 4K1GA 3BZGA 3OBEA 2GYIA 4HNOA 3LMZA 3IUIA 7XIMA 2XINA 5EMLA 3M0YA 3UXIA 1XIJA 3P14A 2HK0A 1YX1A 1A0EA 5B7ZA 4YTRA 2XIMA 3C0QA 3ITVA 2GVEA 2GUBA 3CNYA 5XIMA 2QUMA 4US6A 4GQBA 3ITLA 4QE4A 1XYMA 1XISA 4QE1A 2OU4A 1OADA 6XIAA 1D8WA 4EACA 1A0DA 4PGLA 9XIMA 3BWWA 2ZDSA 3AALA 3XIMA 1XIFA 5B80A 4W4QA 3KBSA 3CQIA 2J6VA 6XIMA 2HK1A 4A8NA 2QW5A 3NGFA 4KW2A 3UVAA 1BXBA 3KCJA 3ITTA 3TC3A 3UU0A 4G56A 4E3VA 3KWSA 2NQ9A 3CQJA 4LNCA 4DUOA 5EMKA 3L23A 2Q02A 3CQKA 5TNVA 4A8LA 1S5MA 1XLGA 3M0XA 4EAYA 4QE5A 3U0HA 1XIDA 3BZJA 1XIBA 5C9ZA 4YTSA 1XIIA 1XIHA 1XLAA 1S5NA 3BANA 1XICA 1I6NA 2QULA 3VNIA 3AYVA 3VNJA 3KBJA 3KCLA 2GLKA 1MNZA 3KCOA 4X63A 4J4KA 3N4AA 3M0HA 3IUHA 4XISA 4QDPA 3UA4A 1QUMA 2G4JA 1XLEA 4XKMA 3UA3A 1GW9A 4GLEA 3AYTA 2X7WA 5H1WA 3DBNA 3JU2A 3C0LA 4OVXA 4ZBCA 4XIMA 1K77A 4XIAA 9XIAA 4ZB5A 2I57A 1XYAA 4GJIA 1QTWA 3IUDA 4ZB2A 1CLKA 1XLMA 4GJJA 1DIDA 3QYSA 1DE5A 1BXCA 4K3ZA 5EMJA 3TVAA 3QXBA 2NQJA 5H6HA 4HGXA 5AVNA
chains in the Genus database with same CATH superfamily
4H19A 1B57A 4H9MA 2JALA 2NWRA 4HHLA 2ISDA 4C6NA 3RR4A 4W8LA 4HPGA 1Q8AA 5DY3A 1AW2A 1FWAC 1UR8A 3G1XA 1TWSA 3M4HA 4A6GA 1E0WA 3P74A 1RP8A 4K6AA 4WJEA 4C90A 1AW1A 1DEDA 1ZY9A 1B5TA 3Q37A 2J4GA 4PN2A 2ZRUA 2PTWA 1KTNA 3IWPA 3PG9A 1GJWA 1L0PA 3EWYA 2YFNA 3P8IA 5DXXA 4XSMA 4W93A 1L8NA 3T2QA 1CI1A 3PBWA 1TV7A 2DY3A 3AJ7A 1SMDA 3CHCA 4IZGA 1UZHA 5D9PA 4L4MA 3WQVA 1YPXA 3FLUA 2CNCA 4KFOA 4NT0A 4AIBA 1PKMA 3H4XA 2PDKA 5AZ1A 3PWGA 3L2IA 3SJ3A 1ZLPA 1F61A 1O95A 4HNUA 3UWVA 1EC7A 4GABA 3HG4A 4GZ7A 4CUCA 1XIBA 3ZFHA 2FVLA 2PDBA 5M03A 2VFEA 1FDZA 1KXQA 1F73A 3HGRA 3OVPA 3YPIA 3OG3A 3DHPA 3R2GA 1EWDA 5DMMA 2CZ5A 4LC6A 3BDKA 5BRQA 2Z7GA 2CFFA 4KFPA 4LSBA 2X1UA 2QMJA 2VFFA 2WJDA 4BJHA 2PGFA 2PP1A 1B1YA 3KM8A 1OJXA 1J5SA 3NDOA 4F9DA 4TX6A 1XP3A 4AWSA 4DI8A 1UCWA 5FEZA 5AECA 4QP0A 3P8JA 3KUMA 2AKMA 3HPXA 3U2ZA 2OO0A 1J0YA 4R34A 5HQEA 4YVXA 2V3EA 1FWTA 3SB0A 2X0SA 1TV3A 1R8LA 4FSAA 3DFSA 1UWIA 4BI7A 3W7IA 1EJSC 3SQMA 3AU6A 3RXZA 5DCEA 1VJIA 3VDGA 4LF2A 1XBXA 3GNRA 3HV8A 1W1YA 1GOOA 4Z2LA 4AZBA 1GHSA 4QSHA 4NXKA 5BRPA 3BK0A 3WFLA 1VBGA 1E9YB 1JUEA 1UR0A 2PLKA 2HS6A 1QO5A 3CWNA 4JEJA 4AQLA 1DXFA 3EPNA 2PWDA 3GDLA 1E51A 2GK1B 4FNSA 4BI6A 4K36A 1WP6A 3ARWA 3JU2A 4R7WA 2VC6A 2NXGA 3EEGA 1BXCA 2PDCA 3M7WA 4PTWA 2OJPA 4U5IA 3E2VA 1FWHC 3WQGA 2YZ5A 4I9JA 3HQ1A 1ZSXA 4Z0JA 5CBBA 1KTBA 2UZ9A 3W75A 1XLCA 3IGHX 3VDHA 4UTLA 3VDCA 2D73A 1UR4A 3H2AA 1JYXA 1YADA 1IWBA 4KETA 1E73M 3BJSA 4ZB0A 1RHCA 3BO9A 3BW2A 3U2CA 4Q3MA 4ZQMA 3TNOA 2JK2A 1E0VA 3QHMA 1RLCL 1G9HA 1UQZA 1H7PA 1DHPA 5K3VA 3RG6A 2AGKA 1M7JA 3LA4A 5LZLA 4XZNX 1YDNA 4JTGA 3EWCA 2BASA 4DBDA 3UBPC 1YNQA 3A4WA 4LVFA 3IJQA 4M81A 3T08A 5LKYA 1P0BA 3H70A 2Y85A 1UZ1A 3CBWA 1JZ6A 4WSHA 1O1ZA 3AQUA 2C1IA 4JPGA 1GPFA 1WDQA 3KRBA 3P60A 4KW2A 2VURA 4JCLA 4L5ZA 3VABA 1FY6A 2G3FA 2OLSA 4EANA 3BLIA 1ADDA 4ZO7A 5FSEC 3AROA 4IMEA 4JIQA 1P48A 3EXSA 4N7QA 8TIMA 3MO7A 4IICA 5HMDA 4IHCA 1V51A 2BY2A 4ZXLA 1EDTA 1DWHM 5BXTA 3CGTA 3CJPA 5L9FA 5K9CA 1E4LA 4Z08A 4Q8PA 2FB2A 3HIJA 2QPXA 3E02A 4O4WA 4JOMA 3VIFA 4Y9PA 2XFFA 4KRTA 1GQLA 3Q2DA 4CNUA 1XYCA 4FNRA 3U9IA 3ARQA 3VINA 3P81A 1CGWA 3H2MA 1V3HA 1G4PA 1IT8A 1WBHA 3OLIA 3AMDA 3TROA 5C9UA 1MMFA 1W91A 2INZA 3W7PA 5GVJA 2INEA 3C0SA 4RE4A 3W29A 2C7FA 1W56A 4P8UA 4PBGA 5HUPA 1O5KA 3MWCA 4X9YA 1YDOA 3NQAA 3ALGA 1WZKA 1XD1A 1R7OA 1IT7A 4IT1A 2WBKA 4B3ZA 3NPUA 3C2RA 4BF9A 2GJLA 3AXXA 4J27A 1TV4A 3UW6A 2CHNA 3LCHA 3B4YA 4BZYA 2A6LA 3LQGA 4JX5A 3SCRA 2QPSA 1W1TA 2WSKA 3WY1A 4EAYA 5KETA 3H4GA 1NDYA 3VOFA 1DXEA 3RLGA 5LNUA 4ERGA 2G4JA 4PMUA 3MCOA 3WENA 5CJMA 3UG4A 4PE8A 2NV9A 1EF2A 1E1EA 1O4UA 4GJJA 2QDEA 2VC9A 1MQRA 3A6OA 1PE1A 2W91A 3U4FA 3QQWA 3PAJA 2VEGA 2RUSA 5GJNA 5HULA 1KM5A 4ADSA 3L21A 3O6YX 2GSEA 4PL1A 4EP8C 3U7VA 3HB9A 1E43A 3QKEA 1OGBA 3MP4A 1F9CA 1XYZA 2UY3A 3D6NA 1EUNA 1NWRA 1NFPA 1CXIA 2VFDA 1JFXA 1Y5VA 2E1DA 3NEHA 4H9UA 1HO4A 1QWGA 2XZ7A 4OZOA 1LJYA 1AFSA 2EG8A 3HG3A 4UR7A 4Z17A 3WJSA 1N8FA 4HKPA 5U4NA 4DNMA 4WF7A 1JXKA 2BHYA 2P53A 5AYBA 1KKRA 3NL5A 5E9XA 1D3CA 3GYCA 4FF7A 1UMYA 3PBUA 3OP2A 4GBDA 5A6BA 1FA2A 1CWYA 4LUYA 4UTHA 2F9RA 4DXVA 3AWNA 3ZSTA 3L12A 4QG8A 1I9CB 1UUMA 3VO0A 2WKLA 3LX9A 3RPMA 3SUUA 1HGYA 1U5VA 4LW7A 3EYPA 3U6WA 1JG9A 4DUWA 1V6XA 1QK2A 2VOMA 3PJWA 2WAGA 2Z00A 3K1DA 2J9YA 4D6EA 2XN0A 5F4SA 2A79A 2WKGA 4MB5A 3S2NA 4IPIA 3LV5A 2PS2A 4NZ1A 3NO3A 5C2XA 3DBPA 1UR9A 1TPWA 4X22A 3IAQA 1MZHA 4KEVA 1Q6EA 1RH9A 4ZCWA 3URNA 1AJ2A 3GXFA 3VIJA 5ABGA 5LA2A 2W67A 1J11A 4PMJA 1C8YA 4MADA 4IJBA 1UD6A 4KGLA 1M7PA 1EUAA 2GDVA 7REQA 2Y5JA 2ZDRA 3GR8A 4PB4A 2BLEA 2OU4A 1DWIM 1Q63A 3G1AA 1ML1A 2XVNA 1EB3A 3KL3A 4ROQA 3RM8A 1GWJA 1JYVA 2QW5A 3BGGA 3QGVA 2BVTA 3PVFA 4IXHA 2OB3A 3WNMA 4L6HA 3IVTA 3THAA 3V35A 2IQ0A 4FNTA 4QQ3A 3GHRA 2J62A 1GUVA 3N6QA 2ZXDA 2W27A 1XSJA 2FFCA 4PSRA 4RPQA 1UP0A 1QPRA 1RBLA 1EBHA 1VIWA 3LLFA 4IQEA 2J13A 1H1NA 4A05A 5CXPA 1V79A 4CNOA 4H1ZA 4R27A 2FPTA 3GXNA 1M65A 2X1IA 1G67A 2A3HA 5CGQA 5I3IA 4RE2A 5DANA 2J78A 3LV6A 3BLLA 3B0UX 3W7HA 1QNRA 3ONCA 4QJ1A 1Z69A 3U5YA 1A3HA 4GKTA 1S39A 4F48A 3VIKA 1ZJIA 3W6YA 2Y8KA 3JS3A 1UKQA 2NLYA 4S3AA 3S6TA 4HJFA 2VRQA 2QT3A 4JFWA 3ZIZA 3UWWA 4UTIA 3DERA 4LXFA 3UYIA 3VILA 4C5ZA 1NFBA 3LNPA 2XINA 4UQCA 5FAJA 1OCJA 3M46A 4HHPA 1J93A 1UROA 3R25A 2XVKA 1VRXA 2NVDA 3S5OA 2HMCA 1FHDA 4HU8A 1EP2A 1TQJA 2PGWA 5HOSA 3I10A 1PHQA 1XUZA 3MDUA 4U4MA 1V0KA 2W6RA 4ADTA 1KD0A 3LGDA 4L9ZA 2DZPA 2OCZA 1C93A 3KOWA 2BG5A 2CXGA 4Q8QA 2FZMA 1POJA 1W3IA 2OZ8A 1FOBA 1AMKA 3C2VA 3IJ8A 4K39A 1X8FA 3NPWA 4J3SA 4UCGA 3K30A 3GG7A 2DIEA 3CLMA 4JNZA 2GJXA 3KVLA 2Q01A 3HGJA 3L2MA 4D6JA 1R7AA 3WNOA 3ZT7A 4IIHA 3NO5A 3GAKA 4YNGA 4QXIA 1F6PA 3I6TA 1UUOA 3ZYZA 4D6DA 1EF3A 4Q7IA 4Y9MA 3BQ5A 3M44A 1WDRA 2FKPA 4DJED 3CPRA 4KWOA 3O1NA 1ADOA 3VD3A 4IIFA 3IJIA 1XH0A 4AIUA 1M41A 1YQ2A 4OBSA 4CNNA 1C7TA 3S6OA 3WMBA 3SQLA 3FJ6A 3OYZA 4GWEA 2O7SA 4FEZA 3UR8A 3FJNA 1WB0A 2VKZG 2XIQA 2I5IA 1BEUA 4RE3A 1XISA 2VEIA 1D8WA 1GQIA 3BWWA 2GGIA 5CPMA 4F2UA 1RR2A 2F84A 3CB8A 3UP8A 4QLKA 4DRSA 4BQ2A 3P82A 3C0JA 3KWSA 2VC5A 4RR4A 2YW4A 4DUOA 3I4EA 1MEIA 1MXGA 2WLYA 4GUGA 2FGBA 4QM1A 1ITCA 1PTDA 1XLAA 1Z32X 4FIRA 4U2ZA 5MKGA 7REQB 1OX5A 2W62A 4WDXA 3ABXA 4QDPA 4ROPA 4BQ5A 3GVVA 2WMKA 3T0AA 3WNLA 1F05A 3EWDA 4RKAA 1AH0A 2O4MA 3VNLA 4LRTA 3WH8A 3CC1A 1W3TA 1R9ZA 4HB7A 4PB5A 1R0MA 1P5BA 1YYAA 2QIIA 1CXFA 2BBFA 4WZHA 5LIUX 4JS3A 3EPMA 3S1XA 2DSZA 1KXHA 4OUEA 2ZUVA 1G1YA 4W9TA 1XGEA 3GDRA 4QEHA 3MV11 4AMAA 1Q2RA 4UIOA 2P8BA 4C7FA 4AU0A 4GUFA 4QLJA 4H9YA 4HPNA 1ITXA 2OOGA 4NZ3A 1D7KA 3VDBA 3IJDA 1ZFJA 1RJRA 4PFHA 1KB3A 4O1EA 1UOKA 1HJXA 3QHOA 3DFQA 5I03A 3L4TA 1YX1A 1KM3A 3ARPA 3VZXA 3OG2A 4QQUA 1W1VA 3G0UA 2E8ZA 1WA3A 4A21A 1GOMA 1TJ1A 4A8NA 3E49A 4RZ5A 1B54A 2WC4A 1BYDA 3PTKA 5JBEA 3ENLA 2OOFA 3B9OA 3BSMA 1TV5A 2ZBTA 4GZIA 5PTDA 3F1QA 4JTIA 1DBTA 2A7NA 3WBAA 2NUYA 2QMKA 4ACYA 1N2VA 3SUSA 2Y5SA 3HQOA 2DZWA 3IIVA 1DJGA 5CGMA 4GNKB 4KFNA 5AB3A 3FOKA 3ALFA 4N9BA 1KGWA 1W5QA 4ZFCA 1E1CB 3W37A 2W9MA 2R82A 3P93A 2B7PA 3GXIA 3N2XA 2CLEA 2G95A 2G4FA 1KQZA 2JBMA 1VCGA 7PTDA 4TVCA 4C6EA 2PTXA 3HURA 2J66A 4O11A 3PZVA 2H8XA 6ENLA 5FF0A 2VZSA 3DX5A 4LS2A 1J18A 3UZXA 4C6MA 4E2BA 3Q94A 4DBWA 4NX0A 2DORA 1UP2A 4JTJA 3ATYA 5BOFA 1WOAA 4GKLA 4H7CA 2OSYA 5AHIA 1BRLA 3STEA 3AWOA 1RCOB 5A6TC 5AY7A 1E6XM 3CMJA 3PBYA 4HPXA 5T26A 1JUBA 4ML4A 4UXDA 4YTSA 3GVGA 1S5NA 4JN6A 3W2NA 5IOBA 4CEXC 2IPWA 5A6MA 2DT2A 2GOKA 5J04A 3UWQA 1XL9A 3OBKA 1GW9A 5I6SA 2XH0A 1LWJA 2VEMA 1D3GA 3QYSA 3RPDA 4IJRA 4OWGA 3TONA 1J6OA 3G1VA 3VD4A 3OGSA 4QR6A 3G0SA 4LBRA 4IWWA 4GX9A 4AVNA 3RLHA 2V9DA 4GYPA 4G7EA 5KZ6A 2BY3A 1CTNA 1SFLA 1TG7A 2QZRA 3MSDA 3TUUA 2V0TA 2YL8A 4GYPC 1A5SA 1OD0A 3HPFA 5C0QA 5BU9A 3LOTA 4XZ9A 3GFYA 4GGBA 1OYBA 3KTCA 1E9LA 2QCHA 4CD6A 3ZJKA 3SCTA 3THUA 3UR5A 2VX7A 5B7ZA 1GONA 2AAMA 2CXEA 3T1GA 4Z1AA 1UPMB 3MDWA 2OSXA 2PDIA 4B92A 3BMWA 3M5YA 2J8GA 2Q8ZA 1RD5A 5M2FX 1GK8A 3E6EA 3N11A 1I2QA 4G56A 3IK2A 4XZLX 1ZAIA 1SZNA 4TX9A 1W9BM 4UTJA 3UPBA 1ZP4A 1FKWA 3H7RA 1Z3NA 4QG6A 2PC8A 1IR1A 2XM2A 5G4EA 3PUEA 4UBPC 4WLCA 3UXAA 2CW6A 3NYDA 3GHTA 5LIYX 4Z2JA 4RJEA 3UPMA 5BXSA 2OT1A 5A6JA 3M0ZA 2YB4A 1BHGA 1H50A 3GVQA 1VYSX 3S5ZA 1UR1A 3EZ4A 4IMGA 1OC7A 2VYOA 4GYJA 1AK5A 5FJJA 2I5GA 4EVZA 1CX9A 4REQB 1VENA 2Q3RA 1LRQA 2VFHA 1JZ4A 3MU7A 4JHZA 2D2GA 1NARA 1TWDA 2VHLA 4PL2A 5AHEA 5I78A 5AYYA 2FLIA 1LLWA 2QAPA 5FIPA 3WLPA 4JEQA 3RUBL 2EEXA 2FTPA 2DGAA 4IPJA 3OZYA 4B15A 2E0PA 4K8EA 3GS6A 4PSPA 4O15A 4QISA 2A6NA 2X09A 4EACA 1I8JA 1NQKA 1VB9A 4JNMA 1QNSA 1TYGA 5IXEA 2WW5A 3DESA 4DXKA 3W85A 4PBEA 2PRMA 1QBBA 3D5HA 4LAZA 4HNCA 3CV7A 4M5PA 3KBJA 1XCXA 2C79A 2PEVA 3STCA 3MMDA 1OGGA 1BRLB 3NZRA 3BVJA 3VOGA 5BW6A 1ITQA 2HBVA 1QTWA 2DT1A 1UZDA 4LYKA 2CERA 3VK5A 1E4NA 4ATWA 1RSCA 3I3EA 3PHAA 1REQA 8XIMA 2QV5A 3FS2A 1QWKA 5FA5A 4GI8A 4YL2A 4HNNA 3WEMA 1PB0A 1DWFM 1KCKA 2PDHA 3PG8A 1QU4A 2J25A 2XDFA 3ELFA 1W5MA 4CQDA 4UFKA 2QCGA 3KP1A 3V5FA 4CCEA 4M6UA 4Q32A 2EPMX 1MUMA 4PTVA 3TTSA 2JIEA 4JCMA 4GD0A 4KQNA 2INFA 3II1A 3SZ8A 1E5JA 2UY4A 4GI6A 3EOOA 4RDVA 4G7EB 1JCMP 3ZZ1A 4K1WA 5DBUA 3AMKA 5BWFA 3MWAA 2J7GA 1W0MA 1EYWA 3P5YA 3VI2A 1T41A 4XD6A 4C6FA 1TE6A 1US0A 3DFTA 3D47A 3OIHA 4WHBA 4DO5A 2ISFA 1MDLA 4J3WA 1I1WA 4QG9A 1UHVA 3UZ5A 2V3FA 1BKHA 4JTQA 1SGJA 3GM8A 2RDXA 5DN1A 4XO7A 5AC5A 2FJUB 3HJZA 3W6LA 1R2TA 1RBAA 4AXKA 5CPSA 3B8DA 4NZ4A 3VOIA 2QULA 1L6YA 4MYAA 3ES7A 1Q6LA 5A2BA 4KGJA 3S5SA 1ISVA 1CLXA 3B8IA 2OEKA 1PV8A 3W4RA 4E3TA 4IPPA 3FEMA 1Q65A 1P0NA 2ZICA 1Q6GA 3BCFA 4Y8FA 3U2OA 1CB7B 4M80A 4V28A 2FH6A 1Q7MA 3CHDA 2ISVA 3W02A 1NWSA 3L4YA 3AHYA 4Q4KA 2BHZA 2QUNA 3C4UA 3VCNA 1B9BA 3XISA 5DRCA 4AEFA 1HUVA 2YLLA 4IMFA 1Q4WA 4GHRA 1SZEA 3RDKA 5JBDA 1E3ZA 1E71M 2V81A 4S23A 2WV8A 3BC9A 4J2PA 5E5CA 4M7SA 1O12A 2GZXA 1H3GA 2P10A 2F6XA 4CCCA 1XLJA 1VLIA 1J0JA 2ASHA 2PDGA 3PPHA 4WJ8A 1R6WA 1AODA 1JNEA 4US5D 3GTNA 2I9EA 2X0HA 3IUIA 3EDKA 1BYAA 3LM7A 2J47A 3A4XA 4BY3A 1GG1A 1B30A 2CBUA 1QNPA 1NAL1 5CSSA 4L4OA 1AQFA 4PUEA 1P6WA 3VE9A 4QLLA 5G2WA 2PSNA 3LZ3A 2W92A 1M3UA 2POTA 5G1TA 1M01A 2NT0A 3RITA 3TC6A 3FYYA 1CGXA 1ZBVA 5BXPA 2CLMA 4YPJA 1XIHA 2TMDA 2EF9A 1H0GA 3VNIA 3VMPA 3VNJA 2I9UA 3G18A 4Z1BA 2V5BA 4H8HA 2PURA 2Y7DA 4XZWA 5BNKA 3PP7A 1JQXA 2HQAA 4BR1A 4UTKA 3FHAA 1FCBA 2XN1A 1RV8A 1MUCA 5M1TA 3WLNA 3FV9A 3G8EA 1QW8A 5HWMA 2VI0A 4PMOA 1UD5A 2WZTA 4UR8A 1ZJAA 1QCWA 3TTYA 1PX3A 3WQOA 3W7DA 3RR1A 4EXAA 1M7XA 3TZFA 2VX4A 3VNMA 3UT0A 4HZ8A 3ORWA 1XYLA 3VKDA 1JPIA 1GNXA 4LBUA 3VFLA 3KZPA 1E5NA 1XFCA 2DIJA 1UWAA 4W87A 4GACA 1D7FA 3CUHA 3WK1A 3SCNA 4HJWA 1EJUC 1P0EA 1MW3A 4IX2A 4A29A 3AHZA 3WK2A 3SO7A 3TYAA 4HVXA 3NIYA 1YHTA 1J10A 3MHUA 3MZ2A 3TCSA 2PD5A 4FX7A 2PDQA 1GYMA 4MAVA 5SWUA 2CETA 2Z2BA 2WPBA 5F4WA 1JPKA 2ZVIA 3RN6A 3F2BA 3DIPA 2XVPA 1EBGA 5DT7A 2ZZ6A 3AHVA 4BCEA 2WZIA 3S2LA 4H8UA 1TMQA 1G69A 2YX0A 3R12A 4LPCA 4QRNA 4PB3A 3CTLA 1ZP3A 2Y88A 1BAGA 1K9DA 2GGGA 4JFSA 4XIAA 4K37A 2VDIA 2YOCA 5FJPA 1H60A 3K13A 3LCLA 2D24A 2Y2WA 4CKQA 1KFCA 1XLIA 3DUGA 3B0YA 1UWRA 3WJWA 4IQDA 3D46A 4Y96A 1HJVA 2B7QA 3ITOA 1WX0A 3L5MA 3CAKA 2XFYA 2GPTA 5AFDA 2VQTA 3Q67A 1H63A 1SJBA 2YDQA 3F7JA 4DEFA 1XG3A 1OFAA 3BAKA 3R94A 2B81A 1DJZA 2QF8A 2XIBA 3PNUA 3RJXA 2DV0A 1M6JA 3GH5A 4XD3A 4FXRA 4MIMA 3WBXA 3UJEA 1Y8BA 3TYBA 3M07A 1GOIA 4ZSUA 3SI9A 1JCLA 1W37A 4HCLA 3UZWA 1HKVA 3G2GA 4RXFA 2RFGA 3LHWA 1OD8A 4AZ6A 1X39A 3RLVA 1GOWA 4JIEA 1OT1A 2WJZA 1Y0EA 2D1ZA 1Y7VA 3PPCA 1ZJHA 2ZX9A 1MO0A 4B90A 1IXOA 4JKKA 3LHVA 2YLAA 4GCAA 2WMIA 3W01A 3V16A 1NOWA 5ABFB 1X1OA 1K7EA 4PMZA 4CVWA 3BZJA 4N6FA 5DT5A 4D6FA 3REQB 4UZUA 2DZSA 3M6DA 3W7GA 1AQ0A 4E4PA 2QJMA 3GUGA 4V1YA 1P7TA 2FJKA 4JIHA 1CT5A 1B3XA 3GBDA 1GYNA 3WD0A 1DJYA 4GO8A 2MUCA 3A47A 1V7AA 2VDGA 3ZS4A 3QPEA 4LVAA 2CLIA 3O05A 4PCSA 4M1BA 4KCTA 1X98A 3M5XA 1W1IE 1OX4B 4O1CA 4MFDA 3NFUA 5I79A 3A4JA 3KDOA 1GOKA 3SN0A 4AVFA 5E6ZA 4HZMA 1OIMA 3G5EA 1PCWA 3H8AA 3SQSA 3MPGA 2CZDA 1AQHA 4DF0A 1EPXA 3VGGA 1XJBA 1BVZA 1TCMA 4CD8A 3K46A 4GXPA 1XF0A 5G2HA 2PB1A 3LLDA 4QEEA 2OYLA 1TUXA 3MI3A 3OBEA 3W07A 1Z48A 4EF9A 2ZZ5A 4UQBA 2XH2A 1FWIC 2V5DA 1J0ZA 2PWVA 3DFOA 2YYUA 5EL1A 3EDJA 3R11A 4UCFA 4G9PA 4QS5A 4GK8A 4PGLA 2NUWA 1SQ7A 1XD0A 2JEQA 1KRCC 1XR2A 1WDSA 2AOSA 1EQCA 4HNTA 2QJNA 4M29A 1TTQA 4M1RA 4HPJA 1MDRA 1KWKA 3RRAA 3MKKA 1KBLA 1ME9A 3PWIA 1QW7A 2OGJA 1KXVA 3BAYA 4AEEA 3H53A 1FDJA 4GI9A 2Y7GA 5C6MA 2EPNA 3T4WA 3C2YA 1V6UA 2D69A 1WZMA 3SGUA 5A6AA 3HFTA 3MCMA 2QF7A 1PZ2A 3UJSA 2XFRA 1FP9A 1P4CA 3NWRA 4DF1A 3V4BA 3LERA 4WDTA 5HQMA 1JPHA 4W7VA 2VZVA 1J4EA 1SSGA 1KCZA 1ZAHA 4AUBA 1UUQA 3A9IA 4JL2A 2EHHA 4ADUA 3DFPA 1AZ2A 2C1HA 2AL2A 5DY2A 3GW0A 3B0XA 2WNWA 5EFDA 3TA9A 3KBVA 1BF2A 3DKLA 2RJHA 1DJXA 4WY0A 3CASA 4GZJA 2GYIA 4G1NA 2DQWA 4H6QA 3FGCA 3GNDA 2J7DA 5DFAA 3WH6A 1BVWA 1OFRA 1XYMA 2AL1A 4AHOA 2J8FA 1OQFA 1HZYA 5H8UA 3IPWA 2VRKA 1LG2A 3WD3A 4YN5A 1JDEA 4LEFA 1BXBA 5JH2A 3W9ZA 3VUPA 3SDOA 5LYRA 3VGFA 3W74A 3LN3A 3KW3A 1J5TA 4GY1A 3UGVA 5CG7A 3ARRA 2PBGA 1JIBA 2X0YA 3N34A 1GT8A 5FJIA 1JF6A 1MQQA 4XTIA 3WQEA 2OEJA 3AZRA 4GLEA 3BUVA 1LM1A 4P7QA 4U31A 3GVWA 3EXRA 2BOEX 3CXOA 4H7VA 4E38A 1WZLA 5HNUA 1H4PA 1TMLA 3RM9A 2D2OA 1OZQA 2E40A 4JTEA 3HN3A 5HMEA 1ZENA 4HYVA 4IFRA 4DB7A 2F6KA 4JTDA 4UR9A 3MSGA 1XLKA 3B9NA 3FYOA 1JZ8A 4O8AA 1DPMA 3Q58A 4K38A 2E8YA 3NZ1A 1ZBKA 4EPDC 1P7TB 4F2BA 3VNKA 2BMBA 1YBQA 5A8QA 3LPPA 5DF0A 4Q4SA 4J3ZA 2C91A 2CWXA 4ZXOA 1ZJBA 5BROA 1BVNP 3OHIA 2VFGA 2Y1HA 3B0PA 1JYNA 3WKZA 1EJVC 3CAVA 4GUHA 4ORMA 2C8NA 3TLQA 4D1JA 3EEZA 2PA6A 1FH9A 2E6DA 3FIGA 4FXSA 4AYSA 2WHMA 2RJGA 3TWBA 2BVYA 1XC6A 3AALA 4ILSA 1W5NA 1SYTA 1I0DA 3GNNA 3S9YA 2QUVA 3CV1A 5DMNA 1IF2A 3POCA 3L23A 5LNRA 3HFYA 4EKJA 1XIDA 1T40A 3TA6A 4LS0A 3MQTA 4AEOA 2VVNA 4DN1A 1AD4A 1S5WA 1PSCA 1JJKA 3UA4A 1W3NA 2YL9A 2PDXA 3G1HA 3VGEA 4IMDA 4BQ4A 1PPIA 5C7HA 4X0VA 4MUPA 1FRBA 5I77A 3GX9A 1IGWA 1X6UA 3MHFA 2DDXA 2HVOA 2TPSA 5BXRA 1IEWA 3STGA 3PJXA 3IANA 4Q4PA 3KTSA 2ATSA 3T0TA 1J8VA 2WLZA 2I16A 3HQNA 2JGQA 3WQCA 3IGSA 4GE8A 3C2FA 4N02A 5A8GA 1ECQA 1QI4A 1LYXA 3C8NA 1W3LA 3K4WA 3B8VA 3UR2A 1VFFA 4B5WA 4W8BA 1EZ2A 1H62A 4DJFA 4GRSA 2FZBA 2XWEA 5I07A 3WLOA 3BG3A 1EDQA 4AZCA 4DJFC 5D33A 1NFGA 3F03K 3VCCA 4MY1A 1K8CA 2BNJA 3ANYA 1X6NA 1A49A 4KIEA 3WLSA 4I3GA 2PRHA 4ORIA 2Z26A 1NDZA 2C16A 3C86A 3TDFA 1CEOA 4XAZA 3HPSA 3FJLA 2HE8A 4S3JA 5EMKA 2PU0A 4Q8VA 2DSWA 4MWAD 1WBJA 1LQAA 1PTAA 1I6NA 3FGCB 2PTYA 2BX7A 3KX6A 1MNZA 2QUUA 1O94A 4FOKA 5ECUA 1KBBA 5AZ0A 2YB1A 4X9SA 5HXMA 5JUVA 4GPNA 2YXGA 2HSAA 3IUDA 1OB0A 2I7GA 2WC3A 3BMVA 3VZYA 2ONEA 1OGSA 4JR5A 3O7UA 5JQ9A 1S2CA 3AMLA 3MJMA 1DJQA 4JKMA 3L4VA 4C1LA 1PWLA 4GO9A 1ELSA 3SIMA 2FZNA 2O9OA 4FI4A 4N9EA 4QX4A 3ZR5A 4Z42C 4JKLA 3H21A 4JYEA 3V0UA 3CTTA 2DZXA 4FNQA 3TN3A 2Y8UA 3FNDA 2Z6JA 4A8RA 4HTYA 3FKRA 4DAFA 3ARXA 4ZENA 5XIAA 1E0UA 1TR9A 1WOBA 1DIKA 4H6RA 4H4IA 4S2BA 3OVRA 3WLMA 1CPUA 3TW6A 3CO8A 3LK6A 1JXJA 1GVFA 2WCAA 3W7RA 1FXPA 2ZX7A 3QPYA 1A47A 1QI2A 1YBQB 4PZVA 4POCA 2TRSA 5I02A 1U1HA 4O0KA 2DW6A 3W70A 3EGJA 2J6VA 3TMQA 5FOOA 1FQ0A 2EO7A 4DYKA 3MJYA 7ODCA 4D6HA 3FA3A 5CH9A 3N12A 1HQTA 3ZLHA 3F5KA 1NTHA 3SCSA 3VAVA 4PFMA 4O19A 1JVNA 1N8WA 3UG8A 4O4VA 3QC3A 2C14A 4JTFA 1Q45A 3CL7A 2A3BA 3DC8A 3PR2A 4O12A 3LPGA 3PPFA 4RW3A 4AHPA 2GL5A 2FVKA 1LLZA 4D6IA 4GCXA 1H11A 4XAGA 3QY8A 2V63A 4LUTA 2P5NA 3PZMA 1W8GA 2ZA3A 5GNZA 3FKKA 3FAWA 2X7VA 4NYYA 4GQ0A 4RV8A 1C9DA 2J7CA 4A3UA 4NNAA 5G4WA 1KRAC 2E7FA 1AA1B 3GDKA 3WUGA 3VIGA 4AB4A 4ZQOA 3NL3A 3TTEA 1TPH1 2BY0A 1DORA 4WRHA 4O54A 2IS7A 3GC2A 1RVGA 3KVKA 5A94A 1S1PA 1BF6A 2HNEA 1NU5A 4DBEA 4D2JA 5K4ZA 3HG2A 2PCEA 3JVAA 4RLIA 1L6GA 3HGSA 2G97A 5A6LA 3MKVA 1UR2A 1W3HA 1Q13A 3DDMA 4J7RA 4CQBA 3F4CA 4WEVX 3GTIA 3A3XA 4RV3A 4MZYA 3UU0A 1OC6A 3W7LA 1JDAA 1H1ZA 4AZCB 1HL9A 4IPNB 1TRIA 3W24A 5CC7A 2RDTA 4RK8A 3TZNA 3F4DA 3WF3A 4YJ5A 3G22A 1E1FA 4MB3A 2DT0A 1B2YA 4RX0A 5REQA 1GW1A 4PUKA 3G6LA 2D3NA 5EMMA 4S3BA 2IPFA 3UY8A 5GJPA 1NDWA 1LROA 1MI3A 1GJPA 4NIRA 3N18A 3NQ8A 2P88A 2Z1XA 4TVUA 3T55A 1FWEC 4D9PA 2OODA 3QQ0A 3AISA 3CYVA 2ZRVA 2QIWA 1RK6A 4QDWA 5BZAA 2R1NA 1C9WA 3PUDA 4M3PA 3C8FA 1MZRA 2P0OA 3WDJA 1XH1A 1KWGA 1S3HA 2EGZA 3M0YA 3OYXA 1O66A 1SO5A 1SSDA 3LY0A 2GVEA 2NSXA 3TAKA 4IFOA 1KR0A 1PAMA 4IUOA 2GVJA 1KBKA 2CKSA 5IDZA 1OIFA 2Y7EA 2IKIA 3NOYA 4I8DA 4PCFA 3W23A 3W1XA 2J7BA 5KZMA 3UWEA 5LSMA 2PWHA 3TN4A 5TNVA 1TTIA 2NUXA 3P84A 4PCNA 1QHOA 3WN6A 3K8MA 3O8AA 3ICJA 4UFMA 1UP3A 5E9AA 4D72A 4YYCA 1R47A 1UD3A 3VIOA 3KWXA 2PLCA 3AYTA 3DBNA 1THFD 2WCGA 3BAXA 3QGAC 5A69A 3W53A 4PEKA 1C90A 1US2A 3TMLA 1W9XA 1EH9A 1CGVA 4FX6M 4IQLA 4GQQA 1W1B1 2E9BA 2CESA 3HPZA 1E70M 2VCCA 4B2DD 1ENUA 5LGXA 4J2MA 1M68A 3OGRA 3MSYA 1ISYA 2G3IA 2Y89A 4DVOA 1CB2A 2YDRA 4G1KA 4NX5A 8XIAA 1E0TA 4MWAB 1B3YA 1MUWA 5A8MA 3VIIA 5I24A 4LUTB 3IV8A 4PTNA 2EXOA 4JDBA 4HA0A 5HR7A 1FWCC 3NNTA 1TX2A 2WK2A 3GU1A 3NQ6A 3QGKC 1IEXA 3RX2A 1FCUA 3DYMA 3HF3A 1P0KA 1Q5MA 4URIA 4QE4A 1WO2A 3DHUA 4NZFA 5D38A 2YCKX 1WCGA 2BOFX 4ZFMA 3WMSA 5CLTA 4JICA 1A4MA 3R6IA 5BMWA 1H09A 3GR7A 4J3XA 5AHLA 3S42A 1KFWA 3NQVA 1SJDA 1RALA 1KGXA 3FX4A 3HMCA 4XTDA 3GSMA 4MZ8A 1PUDA 1JYWA 1OSEA 3GXPA 4E8CA 4WGXA 1V8EA 5C55A 4ZMGA 2PDPA 5FD0A 3W1AA 4GFIA 2GFTA 2EG6A 1CLVA 3IAPA 4UTTA 1WZAA 4EWJA 4QHRA 1DE5A 1KM0A 3GZ3A 3N19B 3N2TA 2B7NA 4UTTC 5HNRA 2NX1A 3NQDA 5FEWA 3USZA 1YXYA 2Q71A 4AD2A 3VYLA 3E38A 3B8SA 4EE9A 1XM3A 3M5ZA 4P8XA 3ZLFA 2YZRA 1YEYA 2RH9A 4AAJA 1C92A 2VCBA 5REQB 3GNPA 1YTEA 4CNTA 1F5ZA 2V2DA 5AYXA 4DI9A 2Q09A 2HBXA 2OQHA 4J40A 5FF3A 3EKLA 5C9RA 5DMLA 3K2GA 4GIRA 2AQVA 3QTGA 3UJ2A 3DG7A 3RCMA 1YE4A 3WK0A 2EQDA 4F0RA 1X1NA 5AKQA 3A12A 1IXNA 1P1MA 4FLRA 3S3GA 1TWZA 1GVIA 3SBFA 4EPKA 2BB0A 1XIFA 3CHEA 3NTYA 1X6LA 2DT3A 4KEUA 4PULA 1W3KA 4H41A 1SFJA 3B04A 1E9IA 1XICA 3RMEA 3IIXA 3RM4A 4XKMA 1P43A 4Q33A 1Q8JA 1PXGA 1EHAA 4HIBA 1PWMA 1T99A 1AH3A 4XBSA 2P8CA 1T8QA 1GYLA 4G7FA 5CAHA 4XV0A 4O1BA 2V5CA 3RGTA 3WH7A 3H4WA 3FDGA 1H2JA 1FWJC 3M1ZA 1RQEA 3CM4A 1BXNA 3W2KA 1A80A 4L80A 4NZJA 2WZHA 3W72A 3ABRA 2NXIA 2O55A 3F4VA 1K7FA 2BZNA 4O28A 4Z1DA 2J9XA 2R14A 2XISA 1V0MA 1K6AA 1T0OA 1FFRA 5K2ZA 3LRMA 4WXYA 1Q7ZA 3S9IA 4JTTA 5M3WA 1YDVA 2HEJA 1WXZA 2BTMA 3ZM8A 1WKFA 5DLCA 1EOKA 3CUXA 3CU2A 4KKXA 1YXCA 3LSCA 4YLWA 1DJIA 3DCPA 2QJJA 2DW7A 3LBOA 8CGTA 1VBJA 2XM1A 3L5AA 2JEPA 3GVRA 4W86A 6TIMA 5HINA 3EA3A 3ANVA 1ZCCA 4IM4A 2WHKA 3KCLA 3T2OA 5DCBA 5DCDA 4C1NA 3TK7A 3VU2A 1N7KA 4AH7A 1TTPA 5FSDC 4NRSA 4MDOA 1Q6RA 2UWFA 1ZL1A 1JDCA 1QI0A 3QBUA 1XS2A 2OEMA 4DF2A 5KSWA 3QY6A 4ZQRA 1QO2A 2GQAA 1TA3A 1J01A 2ALDA 1ME8A 3QMSA 3KDNA 5IHRA 1VFUA 3H12A 5EPDA 4HSHA 1WDWA 4GISA 3LI0A 3N9RA 3LGGA 2FPVA 1RA5A 3G1SA 5E0FA 1US3A 2Y6ZA 4PUNA 1ZNNA 2R1PA 2E5BA 1JCNA 4GIEA 1Q7QA 1TZ7A 2VDHA 4U10A 4A2RA 3TYZA 1SO4A 2G3NA 2NVCA 2G8ZA 3TR2A 1FUYA 4JN8A 1UIPA 3T2PA 1CYGA 1TJ2A 3HOJA 4AWEA 3S5YA 3CL8A 3OW1A 1KW1A 1VKFA 4J1OA 4U3AA 5XIMA 1XPYA 3WLHA 4DBSA 2QR6A 2J6XA 5A95A 3WLJA 2WYSA 2GWNA 4HYRA 5HDRA 3VKCA 3QR1A 4C7GA 3GH7A 1A5KC 4TX8A 2LLEA 2CLHA 1TKKA 4JXCA 3W88A 3WQFA 4GVGA 3VX1A 4HOXA 3JR2A 4R53A 1UH4A 1XCFA 2FMOA 1MEWA 4A8LA 2FTWA 1B3ZA 4NJKA 1F4HA 3M47A 4DJDD 4MMWA 2GGEA 3CUIA 3LHYA 2YBTA 4W84A 1R3YA 3P80A 3EAUA 1OK6A 3POHA 2D0FA 3ARUA 1R38A 1OCNA 7TIMA 3KOZA 1TV2A 2E6YA 2OYKA 2OGYA 4XAYA 4C6DA 1EO5A 5LNVA 1XH2A 1V02E 4QIUA 1Q2SA 3NQMA 2Z27A 1U22A 4H9XA 1LWIA 4O1DA 4FPSA 3I65A 3L4WA 4N9DA 3RX3A 3FVDA 1UA7A 3I7SA 1GKPA 4S3CA 1AVAA 2FMNA 2Y7FA 2WSQA 3UESA 1IYXA 2V30A 4LF1A 3SFKA 3BTNA 4E2VA 2GGJA 1KLYA 4YMZA 2QCMA 4UQ9A 5D8ZA 2PZ0A 1W6TA 2QUMA 3QR3A 4O16A 1OT2A 3ZSSA 5LIWX 4B5VA 3HA1A 3MI6A 3OBAA 3W2MA 4FXFA 1PIFA 3WDIA 4BEQA 3CQIA 6XIMA 1U5HA 2GDUA 4J5NA 2VXNA 5BRBA 1FWSA 1V3IA 4NHVA 2Q02A 1KV8A 3TJXA 3UPWA 2WHJA 1JUKA 2VNCA 4A35A 1TX0A 4QITA 4NAFB 4JAWA 2NX9A 2JE8A 3KHJA 6PTDA 4HA1A 3BXWA 4B9YA 5D03A 2R6OA 4W5UA 3E5BA 1J0KA 4LAMA 3CQ0A 2NV2A 1TMHA 3OA5A 1UC4A 3WD4A 2HJPA 1FH7A 1GTEA 3W87A 4DJDA 3QOKA 3F4NA 3DH7A 4M6QA 2VR4A 2DSKA 4B4FA 4C6OA 4L56A 4DJDC 3KEHA 3ZVHA 3SCPA 1FH8A 3VD9A 4C1NB 3VD7A 3PSVA 3RU8X 1V0NA 1CGTA 2QEZA 1S2AA 2GVYA 1YTKA 1AJ0A 1L2UA 3KBNA 1TA3B 4R9OA 1DTUA 4H83A 5HMSA 3WF2A 1CBGA 1YDYA 3CEPA 1S38A 1X7FA 1W8SA 1YLVA 1DIOA 2CZEA 3KLKA 3GG8A 4NQ1A 2VENA 1JRBA 1LP6A 3RYSA 4HBKA 2OLAA 3WO8A 4KESA 3WNKA 3ONBA 3LHTA 2L5HA 1B4EA 1VPQA 3UNTA 2R24A 4DUVA 2E5CA 3VVGA 3HO8A 4LVGA 2WVUA 4MJ4A 1HO1A 3BCJA 3NSNA 3AUJA 3ZOAA 2I5QA 3MC5A 1UBSA 4JQ2A 1A5CA 4PTMA 3PF3A 3MYPA 4TVDA 3H2FA 3PZIA 1WE5A 4J28A 4O18A 2J27A 3QFWA 3V0SA 1QASA 4DX3A 2CIPA 3AHXA 4HZ6A 3LDVA 3KFTA 2XSBA 3WBYA 3CHVA 4AXNA 1XYAA 4J9JA 2J9ZA 2WOQA 1LT8A 4H04A 5T91A 2Y5EA 3CO4A 2BOGX 3RX4A 3TOPA 1Z44A 3AIUA 4ZR8A 1LBFA 5DELA 4L4PA 3C3NA 1V5XA 4IIDA 3T7VA 3W1TA 1IR2A 2PWGA 4W7WA 3PANA 3SY8A 4AZHA 1V08A 3IVUA 1NP2A 1TIMA 3PUOA 3USBA 3VC6A 3Q4DA 2FFIA 3ZR4A 4D1IA 2YIHA 2ACUA 3AOFA 3NM1A 1NF0A 3KL0A 4AF0A 5A8OA 4ZE4A 1UPPA 4Q8WA 2W79A 3GC4A 1VFHA 2WMHA 2RAGA 6XIAA 3W0KA 4AY8A 2WJEA 3L66A 4NY2A 2PLJA 2TODA 3I7RA 1POKA 3O6CA 1E56A 4HT3A 4I9MA 3UWUA 5A8PA 5K7JA 1E6NA 3AYVA 1IT0A 3BGAA 5FJRA 4ES4A 1NEYA 3VGDA 3BSHA 3QSRA 4LUSA 3C0LA 4XZHA 1AJZA 3AMCA 1QHZA 2X8RA 2A0NA 3UF9A 1HX0A 3EX6A 5HNNA 2OX1A 1AL8A 3VKKA 1PKLA 2PDMA 2BDQA 2DJLA 3B03A 3CZ8A 5IFPA 2NVAA 1EC8A 3PZTA 4UC5A 1E6SM 1J0IA 3H24A 4I5XA 3R8HA 1C8QA 3MMWA 2NZLA 1GZGA 4H6EA 2ZWYA 5F2IA 2HWGA 4LX4A 1V6WA 3WF4A 1M03A 2I56A 3CV6A 3UWYA 1EGZA 1VGAA 4BS0A 4EF8A 3BLPX 1RPXA 3E1F1 5A6BD 2ACRA 4X60A 1RJQA 2PTZA 4BEUA 1A0CA 2KAUC 2W4XA 5LA0A 2R9RA 3CZJA 4TIMA 5I2UA 4N6EA 4HA3A 1W5PA 2ZX6A 3N13A 4JIRA 4KBXA 4YVVA 3TSMA 4HP5A 3DHDA 1A5OC 1KRBC 5HPCA 4IH3A 4RE0A 5HWNA 3BLDA 5FI8A 3LYEA 4QJ3B 3J7HA 4XB3A 4ZOBA 5C54A 1K9EA 2QUTA 4JFTA 3LPFA 1CNVA 2WPGA 5AC6A 1AQMA 1L8PA 2VGFA 3UZYA 2V82A 3ISIX 3N1AA 4RNJA 1JF5A 3FJ4A 2H9AA 1VR6A 5F2GA 4L64A 4Y9AA 1MFVA 4DO7A 1R2RA 1AL7A 3WJYA 4FZIA 4KPLA 4DO4A 2EAWA 4NP7A 1MWOA 3NA8A 3WLKX 4JFUA 3EOLA 1SR9A 1YW1A 1DWAM 2ZUMA 5CQ1A 3PB2A 4Q8UA 4RW5A 1JFHA 3R43A 3H7VA 5DEZA 1RQHA 4LAOA 3CQHA 1A4LA 4GVIA 3GB6A 3NGJA 1B4KA 1H7WA 5CBIA 2FQIA 2A7RA 2RDWA 4NSBA 3DFNA 1WPCA 3VKJA 4JTSA 4DZAA 3CUFA 3RO6A 3PULA 3G77A 3GE7A 5XINA 3U8GA 2XGBA 3WJXA 1MNSA 2CYGA 3RU6A 4O8RA 1FDYA 1JAEA 3AYSA 3AXHA 3GNOA 2FHBA 3MV01 4NRRA 4QJ5B 3GHSA 1ODZA 3VNYA 1TUFA 4ACZA 1QATA 2XIOA 3UERA 4YWIA 1A0EA 3EWZA 3C0QA 2KZHA 1KM2A 3FA5A 2X1RA 3IJLA 4C7DA 1XDJA 3GU9A 3VKBA 3PZUA 3W1RA 1YIXA 3RLUA 1F74A 4JTRA 1PL9A 1I2OA 1H61A 1KBJA 3R79A 1S1RA 1I1XA 3O6DA 1FKXA 3R0DA 3BLOA 4FLQA 3BAJA 4KT2A 2ZADA 4AF0B 2GVGA 3I7QA 4G5DA 3BOLA 5C9ZA 1OINA 3V36A 2Z6IA 2OG9A 1LBLA 4WX2A 4UWMA 3CYJA 2XUCA 2ACSA 5CAKA 1V0LA 3WBEA 1Q6DA 1DV7A 1W32A 4ZB2A 4RCXA 5E70A 4XZBA 1XLMA 4M24A 1ZALA 3AS0A 2VUYA 4D6GA 4GC3A 3TU9A 2FZ8A 3QMTA 1XCWA 5E93A 1UW9A 3T78A 3TIMA 1KNWA 3LTSA 4BKNA 2EJAA 4EIVA 5K4XA 2HZGA 2CWNA 4ALDA 3LGEA 3M7SA 4L6OA 2Z1SA 4LUSB 5HAOA 1IIGA 1RZMA 2FZDA 4L1GA 3WLLA 3A21A 4BFAA 1PX8A 2PDNA 1NIUA 3NEVA 4P2VA 4LFYA 2XG9A 1BSLA 2YR1A 4IGHA 5FCZA 4H8NA 5T8GA 4S2CA 4HCHA 4GQGA 3H26A 2C19A 2Q6ZA 1RA0A 5AC8A 4AZ7A 4CN1A 2BWGA 1EA9C 2XGZA 1Q6FA 2OXNA 3W00A 1BSIA 2FH8A 4DM2A 2CKRA 3UVAA 4FMVA 2JKPA 3EWWA 2ZA1A 1RK5A 5GPRA 1NY1A 2WMGA 2QVNA 3GC5A 4QROA 2D3LA 4X63A 1EP1A 3M0HA 1XLEA 3CPUA 1H7NA 2Z2AA 1K8XA 3OQ8A 5C8BB 3NVDA 3TQKA 2ON3A 4Y8EA 4HHMA 3QPZA 2JKEA 1R9YA 2H90A 4C6KA 1XGDA 2PDYA 2H9AB 1E6RA 3AU2A 4NVTA 3BH4A 4TOQA 3EXTA 1VD6A 4JY8A 2A1YA 3AIWA 4AYGA 4YCPA 1OFBA 4OECA 2WNZA 3FDKA 5EY5A 3SEPA 3PBGA 1HKIA 1LOQA 3W71A 2R91A 3V7PA 3GLCA 1QBAA 5HWJA 2NV1A 4K68A 5H8MA 1JD7A 3EB4A 3NDZA 2NLIA 1JDDA 5IFTA 4HCDA 1EWEA 2VVSA 1QPOA 1J9YA 4KCWA 4QTGA 2BV9A 3WCZA 3QV6A 3W3OA 3WQ8A 1GVYA 1E6PA 1PX4A 5KZEA 2DVUA 4EOUA 3MB9A 4HYWA 1UB3A 1TV8A 3UGRA 4N2YA 2QXWA 2GUYA 4I90A 1OCBA 4OUIA 5HPOA 1D2KA 4AG0A 1QR7A 3LNMA 3ANUA 4PCTA 1V4YA 3SJNA 4DQWA 1FWGC 3MVIA 5EBAA 2VGGA 4JNYA 5MF5A 2X16A 5GQBA 3ITXA 2UY2A 3EX2A 3TE9A 3FXYA 2VWSA 2ZE0A 3NQBA 1HJWA 2GQ3A 3IVSA 1NVMA 5B7YA 2CLLA 4MY9A 1Z7AA 3QW3A 4Z2IA 3D0CA 4GXMA 3CEUA 3I3BA 1PYMA 2DUXA 1EJRC 3S2CA 1SPQA 4P8VA 1WKYA 5HQLA 4Q4RA 1UWQA 5RUBA 3GW3A 4JQ1A 4GVHA 3P14A 3V0TA 3SN1A 4OU1A 1VJZA 1U83A 3GIYA 4E8GA 1XPGA 4ZQCA 4WSJA 1XQLA 2XJ7A 4O14A 5A6KA 3LHUA 1G94A 4R5EA 2Z1BA 2YBUA 2WQPA 4NNCA 3BOFA 4IGSA 3M6YA 2AQWA 4ZE5A 2A3CA 2XVGA 5AYIA 3VA8A 1E9ZB 5D02A 3DG6A 1E40A 2I1OA 4LYRA 5D37A 4A3HA 3EOSA 3QN3A 2EPHA 5HJXA 3HJEA 5EFFA 3KAOA 3QF0A 4A3YA 1KTCA 4J3VA 2Z29A 3N2BA 4MZ1A 5AN7A 1XKJA 2FDSA 3BOXA 3V3WA 3NL2A 3CIXA 9CGTA 2G50A 2FHFA 3BURA 5TD4A 3N9KA 2O0TA 3IIOA 1W9PA 3GXDA 4QSFA 2PPGA 3R13A 5FEXA 1C8XA 3AJXA 2ZE3A 3O16A 4PRWA 2OZTA 3WLRA 5LGZA 1PYFA 1JI1A 4GY7A 3CWHA 4CD4A 4NF7A 4XD4A 2TYSA 1L9WA 4C6CA 3COTA 3KS5A 2X40A 1X97A 3LM3A 4XD5A 3U3HA 1V3KA 4HN8A 3U5UA 2OVLA 5D2YA 1NF7A 2E25A 3BZGA 1EYEA 4HMNA 1YE6A 4GVFA 4K2SA 4H00A 4GIYA 1Y5WA 4B5TA 3CNYA 1HKWA 3WDRA 4FLOA 2C3ZA 4D8AA 4JTAA 4KEZA 1GVOA 5AHMA 4IFKA 1VQTA 3IJ9A 3DGBA 4WOZA 1OEPA 1Q85A 3H55A 1ZGDA 2QPUA 1IIHA 3BL3A 2HTMA 1O68A 3A24A 2NQ9A 1D3HA 1TJ0A 1R5YA 1TWWA 3PJUA 4MNKA 4ENLA 5DBTA 2XU2A 1UG6A 1I75A 4LAUA 4M0XA 2WBGA 1RXOB 5C70A 3CK5A 3DFYA 1FTXA 4N0RA 2ALRA 3T09A 3ARZA 1YPIA 1OM0A 4UUIA 1IGSA 2BODX 1F3TA 2ZRXA 3MKCA 2OLHA 1GGOA 4LU0A 2GGHA 1I45A 2GJXB 1YTDA 1UQYA 4F2TA 3OVGA 4K7YA 4MB1A 3F4WA 2PMQA 4FO4A 3M0LA 3WNNA 5AC4A 2VFIA 1TPUA 1QI5A 2VEPA 1VEOA 1LL7A 4LYQA 3O06A 1RCQA 3T0BA 3HV9A 4AC7C 2OMAA 3SW6A 4EX4A 4DWSA 4OBTA 1RVKA 3FW6A 1XSKA 3FYPA 1JL8A 2ISWA 4DWSC 3W7NA 4AIOA 3FN9A 4DIAA 5HJLA 4ATLA 4PUWA 2PF0A 2E68A 5I3KA 4FXJA 2QCCA 2QCLA 2DSUA 4UMBA 4I5UA 4R88A 1UD4A 4LB3A 4FIQA 1BPLB 2ZXAA 3M0IA 3LXAA 1VZWA 3PTDA 4B5NA 3C2EA 1K9TA 1W54A 2P76A 2P50A 2VELA 2X41A 1ZBWA 3LCGA 1HJSA 3MYOA 2IXVA 2J24A 1OABA 4JIIX 1GKQA 1YNYA 3HZ3A 1V7YA 5FJUA 1NOUA 4DZ5A 5JH1A 4F9JA 3QLDA 4DBUA 2XSAA 1EQPA 4LY8A 1WUFA 3R58A 5MKGB 3AICA 3T40A 5FJOA 1BTCA 5CJ5A 1D9EA 1LOSA 5EGRA 2CC0A 3GG0A 3K4AA 3OU8A 1JZ7A 1QVBA 4NG3A 4WGHA 3TEVA 4WKHA 5F4XA 2OO6A 1KC7A 2D22A 1WXYA 2A7PA 3ID7A 3MMUA 4D6CA 3T42A 4R3UA 3H2EA 2E4TA 1XINA 1A5BA 4WKAA 3OLDA 1EA0A 5C2GA 4R33A 4RZ4A 1OVDA 4U33A 4PC8A 1ZCOA 1IXQA 2VWTA 1VFOA 2YCIX 1GORA 4GG9A 2BGQA 2F8QA 1XYBA 2DP3A 3B0VC 3N73A 4CU6A 3WX7A 1UC5A 3O0KA 4FX8A 3UVIA 4GX8A 3LBMA 1EX1A 4XAPA 5DX7A 4TQTA 4Z2GA 3EWUA 3ITVA 5E6YA 1ZUAX 4GQBA 1J0HA 3GTHA 3AFBA 3WUFA 3SUVA 1V3MA 1Q4NX 4F4RA 1H41A 2VR2A 4IP4A 1Z89A 1X96A 2IMRA 5HK4A 3VPLA 4WDUA 3MI2A 2NQ5A 3LCXA 2IKHA 2YA0A 3S4TA 4OE7A 1TJRA 2V6AA 5M5DA 1G7UA 3CH0A 4BWLA 3KCOA 2JQXA 2NW0A 3PS7A 3WL1A 1VFTA 3RJYA 2E67A 4BWLC 4IFKB 1FCQA 4GJIA 3CUJA 4LBSA 2EKGA 1ADSA 3GTFA 4ML9A 3THCA 4ZSTA 1T8XA 2DH2A 3DXIA 1WYIA 5AVHA 4NUWA 4HN4A 1QRQA 1NELA 3LBCA 1UIOA 4XAFA 3C56A 4DLMA 1R3VA 1M5WA 2VO5A 1PZ3A 3GIQA 1UASA 4JTKA 1JD9A 1B9ZA 3IS4A 4GUJA 4DPQA 3NZPA 1PDZA 2X2YA 2C18A 1GEQA 4CU8A 3SADA 1R3TA 1TIWA 4FNPA 3S6DA 3KTXA 5KTLA 1OWQA 5CC3A 3BW3A 2VGBA 4IJCA 5D2WA 1B3OA 1KRMA 4IF2A 4DWSB 3FHQA 3LRKA 1S2TA 2DFAA 2VT0A 4MKVA 5GJMA 1R87A 3IGXA 2Z1VA 5L6UA 4ZOCA 2ZYFA 3SCQA 3QH2A 2CLPA 3LCFA 4AD5A 3UZZA 3U0HA 5CZJA 3UD6A 3N6HA 2IW0A 4TU1A 4MVAA 5TF0A 2CITA 2E5DA 1GVEA 2VRJA 3QMRA 2HXUA 4MF4A 3UA3A 3PSWA 4LRSA 3FY1A 4AD4A 1ONWA 2EPLX 2VD8A 4UFLA 2TAAA 3T8LA 3NXFA 2JFEX 5AYZA 5JMUA 5D32A 1OYAA 3ZJ6A 1CGUA 3GY1A 2PAJA 2Y70A 1E6QM 4B5XA 3ES8A 4ONVA 3TN6A 3MT1A 2OQLA 1PHWA 1Y5XA 3FSUA 3SAZA 4S3DA 4NZ5A 1DJNA 3SY1A 3DOPA 3CZEA 2YGYA 1OYCA 3S0CA 3Q65A 3S1GA 2SFPA 1G01A 1DL3A 3VX0A 1K70A 6CGTA 1BG4A 3BE7A 1VBRA 3S5NA 3R8RA 1AW5A 4UMCA 3BV4A 3N4FA 3WJZA 2W66A 2ZRYA 1CXKA 1BGGA 1MSSA 2GUUA 4HMDA 4M6PA 1TREA 3OIXA 3LI1A 2VD9A 1F3EA 4MM1A 3EKZA 3NSMA 3ECQA 5ABHA 3WH5A 3LXBA 1KFJA 4FOUA 2V3GA 4S39A 4O52A 3GHUA 3MS8A 2VP8A 3DFHA 3H23A 3MUY1 2NQZA 2CPUA 4Y90A 4CN6A 4LS1A 4C91A 3DZ1A 4KIRA 2HDJA 1P1XA 1VHNA 1QOPA 3WLIA 1PBGA 3W22A 2Y4SA 4B5UA 5HMFA 2R1KA 5FAGA 1TO3A 4UTUA 5FF7A 4MUZA 2NSOA 2REQA 4CU7A 5KEZA 3MUIA 3HPAA 3E74A 4ZO8A 1A5UA 5CPOA 2C71A 5BWAA 4KS0A 4PRTA 4FALA 1KM6A 3AMGA 3QV9A 1PDYA 4HD5A 1L6WA 2DPEA 3FCPA 3V75A 1SM9A 3P5ZA 3LU2A 2OELA 4UNKA 2Z28A 3LCIA 4LCRA 1GQJA 4HA4A 2ZRZA 3BPWA 1N55A 5HANA 1XI3A 4K7VA 5KITA 4GJ1A 3W27A 5LNWA 1A5MC 3AXMA 5EMUA 1XUUA 1W9DM 3O63A 4FHAA 4OJYA 2BHUA 1UJPA 3N04A 3DI1A 3LTYA 1XDLA 3W86A 3WL0A 3A3WA 5HATA 3UCCA 4CEUC 5H8PA 2QJIA 3GO2A 1OADA 2WMFA 3MP3A 2CLOA 3QOMA 2A5HA 1IV8A 4P8WA 3DYOA 3BLEA 2FZ9A 1G0CA 1Q6CA 5I3JA 3FEQA 1VAHA 3Q45A 1B90A 1QNQA 3PK7A 4R7JA 3VKAA 1B3VA 1I2RA 3DG3A 2HV5A 3V1PA 2XZ9A 2PF8A 1BYBA 1QJWA 5LXEA 1R3WA 3ERPA 1OK4A 1WDDA 3ARTA 3B3DA 4J35A 1XIMA 3RF9A 4EXBA 1NJJA 3APYA 2PWFA 2G5WA 2EKCA 3VXGA 4BF7A 4E8DA 3NJ3A 3TR9A 4MDPA 1REQB 5EA9A 4S3GA 4E2OA 3WF1A 3S1VA 3GZAA 1NWTA 5JXQA 4NNBA 4MB4A 3CZGA 2H8ZA 4ZTXA 2PC4A 1EXPA 1TELA 2ZZ1A 4LVDA 1KCXA 4AZIA 5CSRA 1FWBC 2B4GA 2BY1A 1ZBCA 3BQ6A 4GNVA 3UJFA 3IGUA 2ANUA 3L4ZA 1RCXB 5DXYA 2PGEA 1OC5A 1FP8A 4O1AA 3CV2A 3VFCA 2XWDA 2YA2A 4DYEA 5H2ZA 4ZOAA 4KH2A 2WHLA 4OOUA 3KOFA 2GQ9A 2IQTA 4W4QA 3TLLA 3F2DA 2PCQA 2OYMA 3TC3A 2A4AA 1FFQA 4DM1A 3RCYA 3NM3A 3WK3A 5EBUA 1CZ1A 3QEZA 4IGNA 4PMQA 5DMYA 1VIZA 3WQ6A 3OA3A 1FBAA 3GUWA 2FPYA 3RO8A 2J88A 3SCWA 1NOFA 2Z2UA 3B8UA 2OKOA 3GIPA 4K3ZA 3MMTA 3CB3A 3WDHA 1RAKA 3M0MA 3CT2A 2RDUA 3DENA 4LUJA 1RLDA 3SECA 1O60A 3WDQA 1W5OA 1TZ9A 2YSWA 3AZSA 5DQPA 3S2JA 3IV3A 4GA8A 3SIZA 2HCVA 5I06A 1ICSA 3N29A 3BMXA 4TTGA 4LB4A 1MYRA 1UKTA 3R7MA 3KBWA 4QDMA 2XGIA 4E2DA 2REQB 2Y62A 4PMYA 5KZDA 4M56A 4XVEA 4X2PA 3IARA 1LTDA 2GQ8A 3IRSA 4FA3A 1MW0A 1Z8AA 4DXXA 3T0CA 4UFIA 2W63A 1TQXA 4I9AA 3M0KA 2WKJA 1DJWA 1XIJA 4YU1A 1RD6A 2HK0A 2E9LA 3TFCA 1BWVA 1QAPA 4YTRA 4L1XA 4AD3A 4WCJA 1PKYA 4FOJA 2ZUUA 3RAOA 1R30A 3A5VA 5CEWA 2XIIA 1AUSL 2O4QA 3TP4A 2Z1KA 1WXJA 3VMOA 4DZIA 1OG0A 3KS6A 4I6VA 4TXEA 1IZKA 1QNOA 1SVDA 1K8YA 4IOTA 2WB5A 3U48A 3DHFA 3A13A 2X1TA 3H2OA 3LLXA 4HQVA 1RJPA 2QDHA 3L0GA 3ZT5A 2OZ3A 1JCYA 2VR5A 3C2OA 2NXHA 4GZEA 4UOJA 1KFKA 1UWSA 3R0UA 3NAVA 3JW7A 3E12A 3U57A 1HGWA 3CIWA 4R9XA 3TTOA 3A22A 4UTMA 1HFBA 3OTRA 1SFSA 4KF1A 2V5LA 3B40A 4KMQA 3OJGA 4FLSA 2QCFA 5F1VA 1N8IA 1J2WA 2A85A 5EMYA 3DEQA 3E0FA 5G1YA 1S2UA 1UOZA 4DZHA 1HN1A 3AZTA 1R3RA 1VYRA 2ESCA 2BXYA 4ERAA 3UY7A 3EB2A 3APGA 1F76A 4O53A 3LD5A 3LG3A 1TPB1 1CXLA 2WM0A 1W1A1 3AC0A 4QAIA 4ASTA 3UFYA 5KINA 4JZ5A 5LHEA 1IWAA 3OVQA 3PPGA 4AISA 5BYWA 4UQDA 4QGCA 4IIEA 1JRCA 2PDWA 3HTWA 1G4EA 1J6PA 1Z41A 1ECEA 3ARSA 1VHCA 4PBFA 1GCYA 1LG1A 4J3UA 2VMFA 1GHRA 3W26A 3CIVA 3RFAA 2A3LA 1KCLA 4QS6A 2O9PA 4WDWA 2C0HA 3KL5A 3BG9A 4EWND 4PUDA 2O9TA 4UB9A 4L6DA 4E4UA 4QE5A 1LL4A 1ZAJA 3LQLA 4DO6A 2FYMA 2I14A 1ZTVA 2ABBA 4XWUA 1GEHA 2GLKA 3E0VA 1DYSA 3RILA 5IDIA 4W88A 1FWDC 1EL3A 2PLMA 4CCZA 1SW3A 2X7WA 5H1WA 2DVXA 1FVPA 1TPDA 1IE7C 2R1MA 1WAUA 3W7QA 4ZO9A 1TVLA 4GIAA 2YYTA 2P3EA 1DQUA 1TTJA 3W7JA 2G0WA 3PTMA 1VFMA 4HMEA 1I0BA 1MQPA 4RDYA 2D20A 1E1CA 3E2SA 3FVMA 3EX3A 3NO1A 2AKZA 3AO0A 1TPEA 4RZBA 1DP0A 5IHSA 1XRVA 1J96A 3NQFA 4Z1YA 1KA9F 1ISXA 3S46A 1W17A 5CSYA 4CN4A 3N9SA 5T9CE 4AIEA 1UMLA 5A6SA 3GTXA 2WANA 2CU0A 4IP5A 4MJZA 1XV8A 5ENLA 1SZRA 2QHAA 1VC4A 2PU1A 4JHMA 4RDZA 3O07A 1CDGA 1MVYA 4ZGYA 4RNFA 3DKJA 2WZEA 5EU9A 2OR2A 3PZNA 4D8ZA 3VIHA 1H5YA 1TE1A 2C1GA 3ABSA 3L9CA 3B8WA 3N2CA 4O0ZA 1IXPA 2XTKA 3RK8A 4B4HA 3PY2A 3L0NA 2FGZA 1V77A 2HK1A 3IEBA 1XSIA 3LSBA 1A53A 3DN5A 1KQYA 3O0FA 4ICMA 2WMIB 1T6MA 1BGAA 4F0LA 1F2JA 2GJNA 2ZXQA 4WXZA 2J7FA 4YHGA 4S3FA 2WNQA 3TSBA 4O0QA 5CGTA 2V68A 1SU5A 1R85A 2ZZ4A 4O57A 2G37A 4DJFD 4LYPA 1K77A 3A23A 5GNYA 3B9DA 2WVVA 1CLKA 4HOWA 3MCNA 5EMJA 1SR0A 4W85A 5CCZA 3NSXA 1W1PA 4YCOA 4I6KA 2ZZ2A 1M1BA 4H6KA 3STPA 2AQOA 4HK7A 1JZ5A 1DKWA 1XWYA 3EMZA 4IIGA 1EKOA 4P7RA 1VEMA 3B97A 3H7UA 1MEHA 1XLBA 3TJLA 3NCOA 4KWSA 3W38A 1VPXA 3NL6A 2XHYA 1XGZA 4E5TA 2B31A 4JYDA 5F7UA 4IMAA 4LC8A 1RUSA 2A2IA 3RHGA 4FAMA 1JULA 4F0SA 4W7UA 4NKCA 3E5PA 2QV4A 2VC7A 4F66A 3M43A 2XIMA 2R94A 4LV9A 4A4AA 4NZCA 3W7CA 2D2HA 5AOUA 1EGVA 3N6JA 1J79A 4V33A 2HXTA 3EA2A 1NP0A 2EPKX 4C6QA 1K4GA 5IM51 1KKOA 4Y6GA 2Y8VA 3CZLA 2JF6A 3AIRA 4P7NA 4DJEA 4I7UA 1SW0A 3SR7A 3WBWA 4N4PA 3NURA 4KWWA 2HNHA 3G1YA 2GWGA 4NXSA 4DJEC 5E0CA 1VFSA 4GH3A 2OZ0A 3DC0A 4Q8OA 1W2VA 4OGZA 3QJAA 4E6MA 3TFXA 3ABZA 4U5KA 1P6BA 1E4MM 1PEZA 5D04C 3GR4A 3THDA 4O50A 1FHUA 4LT9A 4CQ9A 1FXQA 3AHTA 1HJQA 2ZQ0A 3W82A 2E9MA 3LUTA 4A22A 1JR1A 2CZVA 4AWTA 5AHNA 3SURA 4F0MA 3PTQA 5BCAA 4REQA 1W9UA 1AMYA 1WKDA 2W61A 5F1UA 2WNNA 2MANA 3URAA 4YHEA 4ATDA 1BQCA 1PTGA 1B3WA 3OQEA 1EIXA 3K1GA 2AL2B 4YVPA 2ZUSA 1XXXA 2R8WA 3PBMA 4A3QA 5LIXX 1K3UA 3AS1A 4NASA 4H2CA 5TQLA 3GD6A 3LMZA 1QOXA 4NJHA 4WY0B 3NOEA 4XKYA 4JTUA 4FR1A 5I3GA 3B4UA 1CIUA 4JL1A 2YW3A 1BFNA 1EJ7L 3PB0A 3GAYA 4GGHA 1BD0A 1XBZA 3BICA 2QCEA 2E6AA 4HSOA 3MA8A 4LCQA 3IUHA 5CC5A 1XBYA 3VOCA 1QPKA 1CXHA 3UG3A 2WWDA 3TVAA 2PE4A 3CAQA 2ATMA 1EOMA 1R46A 1H51A 1WNOA 4XBJA 1LRNA 3A64A 2E77A 3IIZA 2GSJA 4HOZA 1ONXA 3L65A 4MGGA 3ZWSA 5FKYA 1IQ8A 1NSJA 1NWUA 5D4YA 4WSKA 5JBFA 5FF4A 2WVVB 2QDDA 3SUTA 5LXXA 1I4NA 1MRAA 3AXIA 4XVDA 1L2QA 3PZGA 3W1PA 2VEFA 4YTUA 2XPKA 1XIEA 3GXTA 4YWSA 1XQKA 2QGYA 4C1KA 2DH3A 2Y24A 4MPQA 7XIMA 4YS1A 4KWVA 3UXIA 3WD1A 1G4SA 2RKXA 3SRHA 4QE1A 3R8GA 4K8HA 2OWCA 5CG0A 2EJ1A 4B91A 1LRTA 4HU4A 3TYCA 4F0HA 3BLFA 3U2EA 2YJQA 2VJXA 3FAXA 4E3VA 3CL6A 4LNCA 1F6YA 4MOZA 1MRQA 4ZTYA 1HKMA 4WD0A 3SRDA 2OQYA 2XIJA 4N4QA 1E72M 3ZO9A 2B0MA 2YCLA 2EPOA 2ZUTA 3I6RA 3LB0A 2NQJA 5CC6A 1NDVA 4MLRA 1HKKA 3L67A 4M8UA 4XSLA 3ZMRA 3V5CA 2GSHA 4NAEA 1DQXA 3CMGA 2Z4GA 4LANA 3NQ7A 4V1XA 3TH6A 2H3DA 4Z2KA 4AX7A 1DIEA 1HIZA 5D9NA 2PRLA 5JU6A 3HM7A 2XN2A 4UOQA 1UD8A 4H8VA 5I7GA 3O15A 3PN8A 2DUAA 4W89A 8RUCA 3QVQA 1UKOA 4IX0A 4RNIA 4X61A 4PMVA 5CPQA 1EXBA 2YCJA 1VBHA 3GQYA 3L68A 2QDGA 4V15A 3WF0A 3I4KA 4HNVA 3AYRA 4LV4A 4DELA 1LUCA 1UWTA 3OOQA 1SMAA 4I5RA 3D3AA 5M17A 2WVTA 2PWUA 4WJXA 1XRSA 3CH9A 4IQJA 3XIMA 3A4AA 1OG6A 2Q3OA 2IXUA 2WMJA 3SUWA 4AC1X 4HSNA 1XHGA 1XBVA 3GDBA 3C6CA 1GPWA 1X1ZA 4XKYB 4EXQA 3KVMA 1SJCA 5CPNA 2JGYA 1R3QA 3KOYA 2ODOA 2ZC1A 2PFHA 3CZKA 4GY0A 3WQ5A 4TTUA 2AAAA 2F2HA 2A3EA 1V3JA 1G4TA 1SJAA 4HHHA 5AVNA 4CCDA 4PODA 1JPDX 3O2LA 3WSUA 3MSRA 1V6TA 2V2HA 4MNJA 4F3HA 5BOEA 2OWXA 3PAOA 3TAOA 3S9ZA 5CPLA 4MLJA 3TJ4A 2ZOXA 3IJ6A 4I9TA 3RCNA 2AMXA 1ME7A 2IQDA 1TR1A 4C5YA 1XYFA 3C5QA 1C3FA 4OQVA 1IEIA 1L6FA 3G3DA 1C91A 2VZOA 4XX6A 4KCUA 4ZZ9A 1VRDA 1YNPA 3SFWA 2E09A 4ZQPA 4MJ2A 1PZ0A 3LRLA 3M16A 5EMLA 1HL2A 3EBVA 1BKSA 3URQA 4MKNA 2V8ZA 3PM6A 3NZGA 3EA1A 1JZ2A 1U5JA 4Z2HA 1VFLA 3S8HA 3DYPA 3JZUA 3TWAA 2QKFA 3R1ZA 4NU7A 4KCVA 4MY8A 1OBAA 1SFTA 4Q8MA 3CQJA 2QGHA 2QNEA 3B9AA 1NM9A 3TCEA 2XFWA 2POZA 1O5RA 3NQCA 5A8NA 5A5WA 2KX9A 1MFUA 4JTCA 3CMFA 3K8LA 2VZTA 2FGLA 2D2JA 2DZTA 3LPOA 4Q6XA 4LUIA 2QJHA 2CLFA 4XIMA 3S47A 3ITGA 2I57A 4INFA 3W7OA 1WUEA 3NDYA 3N25A 5LA1A 5CKSA 3E96A 4UZSA 5AHFA 2ZXBA 2X2GA 1O7AA 4AX6A 4PUJA 4MTVA 2ACQA 5I3FA 2DVTA 3UCQA 3UXLA 2JF7A 4L9XA 3ABQA 1YMYA 3CHFA 2J7HA 1LOLA 5T9BG 3L7RA 2YCLB 5I09A 4OV4A 3PZ9A 4YTQA 4QCEA 3QV7A 4IL2A 1XLHA 1FWRA 3K8KA 3VCRA 3QM3A 5IBXA 4P7OA 1LZOA 5CJNA 3PBVA 5E0KA 5IBXC 1KV5A 4NAEB 4FNUA 2DZVA 4TV6A 5EB8A 2MNRA 1Q66A 1S5TA 3M5VA 5K9XA 3T07A 2HS8A 2Z1WA 3URBA 1QNVA 4OHQA 1WDPA 3F2CA 1QHPA 1A5NC 2FIQA 3IJ7A 2W3ZA 4OFCA 2QAFA 1TPC1 1GJUA 2WZMA 2DZAA 4JGDA 3TYEA 1KFBA 1N82A 1WAWA 3G8RA 1UJQA 4OKDA 5FACA 1I2PA 3SSJA 5ABFA 5C5YA 4QCFA 1EFZA 3GKFA 3H2NA 1M7OA 1S5MA 2D0GA 1LUCB 3REQA 2GOUA 2ZUNA 4G6CA 4BI5A 3EDFA 2E28A 4NI8A 5I3HA 1P6CA 2OSWA 2PDUA 9XIAA 3UNDA 4XUYA 2J79A 4E4FA 3KXQA 2OT0A 3FK4A 4GQRA 3WMCA 4HPHA 2YA1A 4HU3A 1I2NA 1VBUA 3CWOX 3C3UA 3W1QA 4KWUA 2BXVA 4AMCA 4ZQNA 4Y9OA 1DWGM 1OX4A 4ZA0A 4PTDA 3CPGA 3MHGA 3LENA 1KFEA 2QVHA 2Z7KA 4FB7A 2VM8A 4FS9A 3O9NA 4IPLA 4C6LA 3NUKA 2HE5A 2H3BA 4QNEA 3V1HA 3R10A 4AW7A 4LOCA 4OV9A 4LVBA 2B7OA 4Q7NA 2IUZA 1ICPA 4JTLA 3PNZA 4AD0A 1T7LA 4RXGA 3WQ4A 3WNPA 2CBVA 5FL0A 3VGHA 1VCFA 4M82A 4IG2A 3EMQA 4M6VA 1TPFA 4AY7A 4CNPA 3VOJA 3PC0A 4PMDA 4UQAA 1M04A 3KBSA 1UA3A 2QLYA 2WQDA 3MUAA 4WKFA 4JDYA 1QI3A 3OODA 4ECLA 3A3HA 4Y2WA 3LZ5A 4GUIA 4DWDA 4U28A 3SRFA 2G3JA 3FXGA 1B0IA 2O7QA 4WUIA 4US5A 3W28A 3IIPA 3VM7A 5G5IA 3QW4B 3C52A 3GYEA 3K5XA 3V5OA 3HBLA 4HZ7A 3LCWA 3P0XA 2OKTA 5C9WA 4K8GA 1NH6A 5G1MA 2ZTJA 1KR1A 3QZEA 3PZQA 3BLKA 4YIWA 4FF5A 3UEQA 3MW7A 4CNSA 4H9TA 4JX6A 2OX4A 7CGTA 5A2CA 4JQ3A 1A5LC 3ARYA 1KM1A 1O5XA 2CHRA 4HK6A 1IWPA 5ECVA 1R2SA 1HXJA 3QTPA 3WEZA 1SO6A 3VOHA 4AY1A 3EDDA 1XFBA 4NJIA 2PDLA 3WDPP 1V6VA 3A9BA 3W2UA 4F79A 3AXKA 4LH8A 4JN7A 3R4IA 1E0XA 3GG1A 2GJRA 2DEPA 2GUBA 4NI3A 5CZ0A 3S2MA 3ZVIA 3TQVA 3IK4A 3TOYA 2F38A 7TAAA 3W1NA 3OZPA 1J2BA 4LCSA 1HL8A 1ZS2A 1E15A 2QYGA 2Y61A 2PP3A 2V3DA 1EX5A 4JFVA 4P5UA 1F3WA 2BVWA 3L0KA 3NQ2A 4L7ZA 4GBUA 5A1AA 4DNHA 4L1WA 3M0XA 4MNLA 3ZWTA 1ISZA 3E9AA 1OY0A 1EJXC 3VNZA 1JZ3A 3VTRA 3RIKA 2CEQA 2PWEA 3VDAA 1HNYA 3ZJ8A 2FHCA 3P2VA 1GZ1A 4EAMA 3ME3A 3TC7A 3O6AA 2R1LA 1PKNA 1ZQ5A 1LCOA 3V18A 4ZL1A 1QDSA 1DWJM 5TIMA 1H7XA 3E2RA 1OCQA 1WQ5A 4L65A 3W81A 3I3DA 2QQ6A 1WV2A 3TYUA 1S2VA 3CUGA 3SGZA 3OZMA 2WJFA 3R0KA 2TSYA 4HK5A 3GNXA 4BK9A 1F8MA 3TW7A 1JEZA 3OO2A 1U1JA 4AZGA 4N9CA 4XQ6A 5I23A 2WC7A 3TQ0A 2E1WA 2Q8LA 1ITUA 1HTIA 3TTQA 3ZR6A 3MO4A 1EDGA 3DECA 1H49A 1U2YA 5EYWA 4MSSA 4XG1A 1ZHAA 2QS8A 3G1DA 3LHZA 3MY9A 4E0CA 3ATZA 2QCDA 1JQVA 1TCDA 3HG5A 4JX4A 4Q8NA 2V5JA 4LQ1A 4IL0A 5HJYA 4IG2B 1FWWA 1AD1A 1F3XA 3SCVA 5I0DA 3EX1A 2C15A 3VM5A 3WQWA 1J12A 4QFUA 2YPIA 4BF5A 1SW7A 3WFAA 3KP0A 1W3JA 2ZVRA 5J8LA 4MFEA 8A3HA 1IZJA 2HVMA 1RQBA 4C60A 3VMNA 2CCRA 1TPVA 4GC4A 2X30A 3DGRA 1DTNA 5TBOA 2J74A 1XLDA 3QZAA 1HF6A 5D30A 2VUNA 3GFXA 3SM0A 4A2SA 3IRDA 1FWNA 1G6CA 3M0JA 4IXXA 4CVUA 4Q6JA 3N14A 3U7BA 5K9DA 1FHLA 3DU0A 1JI2A 4ERIA 2PD9A 5G4HC 2FVMA 5EKYA 2GJPA 4PR4A 2FDMA 1VJSA 4PCPA 5D05A 3P3BA 5CZSA 2ZFAA 1VLWA 1ALDA 1A0DA 1RY0A 4PYSA 3JRKA 3T6CA 3AUOA 4Z1CA 3G1FA 1U1UA 3NGFA 1UR3M 2IKGA 1CCWB 3B9EA 2ADAA 4RNHA 4MYXA 3BCDA 4WY0F 2QCNA 1OHLA 3MUZ1 1H5VA 2DZUA 2WO5A 1QUMA 2ZUWA 2WSPA 1KGUA 1F6KA 2DZBA 4I7VA 2RGLA 2ZIDA 4PMXA 4DY1A 4C6PA 1MW2A 1FX6A 3QXBA 1K03A 4RZ6A 2EG7A 1HP4A 3KBMA 1HVXA 1F8IA 3INPA 4MHBA 5LHFA 1K8ZA 1LT7A 4QAWA 1PJ9A 3XINA 3QZ6A 1DVJA 1H7OA 1U30A 3QR0A 4JTHA 1I60A 4C6JA 4CQAA 1CXEA 3T0DA 3LTPA 4WK9A 3CAWA 4R85A 5HUOA 5BU6A 1XDMA 3AIQA 3KE0A 2XSXA 1R86A 1TVNA 1BQGA 4P7LA 4PRRA 4TMCA 3MUXA 4Q7BA 1M9HA 4ZVJA 4Q4OA 2ZCGA 1EC9A 3GXMA 4GXWA 3BJTA 3G6MA 1OFPA 1HW6A 3T8QA 3JZEA 3WMLA 1E4IA 1Z42A 2ZWZA 4V2XA 3N3MA 4QBXA 3VGBA 2BXZA 2JIWA 3TX9A 1PIGA 4I8YA 5F2LA 1UZ4A 2PDJA 2J77A 2Z0IA 2ISSA 2WWCA 3UJRA 3B06A 6A3HA 4QNWA 1E3XA 4EPBC 3GFZA 4F0KA 5I00A 4WQ6A 1GOQA 3M9YA 1QXLA 3MZNA 3OPSA 3PZOA 3E2QA 5D9OA 4O17A 5C2CA 3VUSA 4ZBCA 4CD5A 3W7KA 2XYLA 4LGXA 1PO9A 1LQ0A 1EEXA 4C6IA 3DI0A 1KBIA 2PZNA 3KRSA 3OZOA 3KRUA 2QCDB 1C29A 1DXIA 2PP0A 3NPXA 3EWBX 5F2MA 1EPVA 1A3WA 3BW4A 5TAOA 3W83A 1W31A 1Q3NA 4V27A 1HG3A 1DJHA 3TW9A 1TSIA 2NT1A 2YDSA 3EOUA 4NYUA 2G96A 2HPMA 4XK2A 4C6BA 4LNYA 3UG5A 2WVSA 1EEPA 2CBIA 2OFJA 3KOXA 2DUZA 4D8LA 4IP7A 4PUUA 5HBFA 3LMYA 2UV8G 1G7VA 1LL6A 2ZRWA 5G2IA 2Z24A 4DUXA 3H6OA 5C71A 3N2MA 5BMXA 2CHOA 4PH6A 3B05A 1QK0A 4Q22A 4Q4MA 4LAKA 3EX4A 1JCXA 4Y9NA 3BARA 2PODA 2DIKA 5CSUA 2PUZA 4TV5A 1XKYA 4W8AA 5CLWA 1W9VA 3KCJA 3UQNA 1XC4A 4GH1A 4B5SA 1VF8A 1XIIA 1ESWA 4L61A 1W1ZA 5FL1A 4S3EA 3ZLGA 3TXZA 1Q6OA 1BYCA 1KO0A 1A3XA 1DIDA 1F07A 1GVRA 1VCVA 1ZB5A 4ICNA 3WD2A 2WSYA 1FHVA 1KLZA 1BTMA 2BSLA 2D0HA 4ICCX 3N3TA 4JD4A 4ZODA 5CBJA 4IUGA 3TN5A 5HR6A 3STFA 4TR9A 1EGMA 3VC5A 4CQCA 3LEPA 3EWXA 1GKRA 1UBPC 4L4LA 4N42A 3ZVHB 3E0LA 3SSZA 1MW1A 1QMLA 5AC7A 4B9ZA 2WCSA 2QJGA 3NQEA 1OFQA 4HTBA 2UBPC 3GK0A 4WVXA 1K7XA 3T05A 2BVDA 4WOQA 5CZTA 1ICQA 3K4DA 1V03A 1LDCA 2D23A 2VQUA 2YL5A 4D71A 4CD7A 3QQ1A 2F2KA 3PFRA