3UXIA

Crystal structure of l-rhamnose isomerase w38a mutant from bacillus halodurans
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
413
structure length
402
Chain Sequence
b'SQFERAKIEYGQWGIDVEEALERLKQVPISIHCAQGDDVGGFELSGDYPGKATTPEELRMDLEKALSLIPGKHRVNLHAIYAETDGKVVERDQLEPRHFEKWVRWAKRHGLGLDFNPTLFSHEKAKDGLTLAHPDQAIRQFWIDHCIASRKIGEYFGKELETPCLTNIWIPDGYKDTPSDRLTPRKRLKESLDQIFAAEINEAYNLDAVESKLFGIGSESYVVGSHEFYLSYALKNDKLCLLDTGHYHPTETVSNKISAMLLFHDKLALHVSRPVRWDSDHVVTFDDELREIALEIVRNDALDRVLIGLDFFDASINRIAAWTIGTRNVIKALLFAMLIPHKQLKEWQETGDYTRRLAVLEEFKTYPLGAIWNEYCERMNVPIKEEWLKEIAIYEKEVLLQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-Rhamnose isomerase
publication title Structure-based studies on the metal binding of two-metal-dependent sugar isomerases.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Isomerase
total genus 139
structure length 402
sequence length 413
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.14: L-rhamnose isomerase.
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06134 RhaA L-rhamnose isomerase (RhaA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3uxiA00
1QUMA 1I60A 3JU2A 4YTUA 4Q7IA 3C0QA 4DUOA 4GLEA 1XICA 3GNXA 2NQ9A 5J8LA 2G4JA 3UA4A 6XIAA 1S5MA 1XIJA 3KBWA 3LMZA 3AYVA 4ZB2A 5B7YA 3KCJA 3VNKA 3OBEA 2J6VA 4KW2A 6XIMA 4GJIA 4HNOA 3ITOA 4A8LA 3KCLA 2Q02A 4J4KA 5I7GA 4XISA 4K1GA 1XIMA 1XLKA 3BDKA 4X61A 3TC3A 4XSMA 5TNVA 7XIMA 3VNLA 1XLMA 3N4AA 2QULA 4A8IA 4EACA 1XIBA 3WQOA 4GJJA 1A0DA 1XYLA 4A8RA 1QTWA 1TZ9A 4X60A 4X63A 4QE1A 4XKMA 3AAMA 3KBNA 1XYMA 4PFHA 3P6LA 5XIMA 3KTCA 3ITTA 4QE4A 3XIMA 8XIMA 1XLDA 2GYIA 5FA5A 1XLGA 1A0EA 4A8NA 5EMMA 4HGXA 4ZB5A 5EMKA 3VNIA 2HK1A 4W4QA 3VNJA 3UA3A 3KBVA 5B7ZA 3KCOA 4US6A 3IUDA 3KWSA 4LNCA 2GVEA 3FVMA 3QC0A 3M0LA 5XINA 2ZVRA 4ZB0A 1DE6A 2X7WA 3DBNA 4G56A 3CQJA 1DIDA 4ZBCA 3L23A 1XLAA 1I6NA 4K3ZA 9XIMA 5C9ZA 4QDPA 3BZGA 4YTTA 1XIIA 5AVNA 3P14A 3KBSA 4QE5A 4EAYA 1XYBA 1XLLA 2ZDSA 3C0SA 2QW5A 5B80A 1XYCA 1DE5A 3KBJA 4QDWA 3NGFA 3ITYA 1O1HA 1XIGA 3C0LA 3M0VA 4YTQA 1A0CA 3AALA 1XLCA 2HK0A 4QEHA 4XIMA 1BXCA 3AYTA 4XIAA 3UU0A 1CLKA 3XINA 2GUBA 1XLBA 1K77A 2QUMA 3CQHA 3CQKA 1XISA 2GLKA 4QEEA 1XIFA 4YTSA 3ITLA 1XINA 3M0YA 4OVXA 4XSLA 3BWWA 2NQHA 1XYAA 1DXIA 1S5NA 3M0MA 4HHMA 3QZAA 5H6HA 1XLEA 1XIEA 3ITXA 3TVAA 1OADA 3U0HA 3QXBA 1YX1A 3BANA 9XIAA 1MNZA 5EMJA 3U3HA 3CNYA 1XLIA 4DVOA 5EMLA 4HHLA 3M0HA 1XIDA 5AVHA 1GW9A 2XIMA 3DX5A 2HCVA 3XISA 1XP3A 3BZJA 3ITVA 1DIEA 2G0WA 2QUNA 3IUHA 1XIHA 3UVAA 8XIAA 3IUIA 2OU4A 2I56A 1XLFA 1XLHA 1QT1A 2XISA 1D8WA 3VNMA 2XINA 3CQIA 4PGLA 3QYSA 2NQJA 2I57A 4E3VA 3UXIA 3M0XA 4YTRA 5H1WA 5XIAA 3CWHA 2X7VA 4GQBA 1BXBA 1XLJA 1MUWA 3VYLA 3KBMA
chains in the Genus database with same CATH superfamily
3PULA 1KFWA 1FY6A 1WKYA 3WELA 2ZADA 4HZ6A 5U4NA 4KQNA 1ZZMA 3TCSA 1UWUA 1EBGA 3B4UA 2Z6IA 3WLPA 2OSXA 4H3DA 1ONRA 4G7EA 1EXPA 1TV5A 2XJ7A 4N4QA 4TVDA 3I3DA 1GYNA 3SW6A 4E0CA 1A3WA 3TONA 2WB5A 1YQ2A 4ECLA 4W4QA 1W0MA 3K4DA 3CC1A 4ACZB 4DJDC 4N9EA 1KCKA 2A4AA 1PX8A 4Y90A 1B54A 4FLSA 4KFOA 5TF0A 3TXZA 4O0QA 3PTMA 5DRCA 3PPCA 1TUXA 3WDQA 1TPC1 2A21A 4UNKA 2UY4A 4GKLA 4Z2LA 1QHPA 1DJYA 3T6CA 4TX8A 4ZOBA 4NYUA 5IOBA 3EDEA 2WCSA 2UY2A 2ZX7A 2VC7A 5DT5A 7A3HA 1V02A 5PTDA 1TJ2A 5MKGB 2D0HA 2QAFA 5AY7A 3LM3A 4F2TA 1E6QM 2IXUA 4DXXA 4CCCA 1XIHA 3UCQA 5D02A 2CHOA 4GZIA 1G69A 1QNSA 1XLHA 1GORA 2Q3OA 1OINA 1F8IA 1UYQA 3L0KA 3PJWA 1KXVA 1CB7B 2EPLX 4FR6A 1TQXA 4S3FA 5FSEC 2PB1A 3T8QA 1FWNA 3OTRA 2DZBA 2XN1A 2X1SA 3P2VA 3WK2A 3LX9A 4H2HA 2OLAA 3N19B 3CV7A 3CS2A 3FV9A 3IS4A 1R86A 1SMAA 1W91A 4XZBA 3HV8A 3CAWA 3P67A 5E6ZA 4HKPA 4WQ6A 3WLMA 3EA2A 3G1HA 4ML4A 2XU2A 4QS5A 3LQLA 3FW6A 4WJEA 1Z89A 3NM1A 1K6WA 3OGSA 4DPPA 5CZ0A 4LCQA 1H4PA 3U2CA 3GHRA 4KCUA 3URBA 4DI8A 1V6YA 5BW6A 4MB5A 3N6HA 2C8NA 1WPCA 1BYDA 4QSHA 1G67A 2J27A 4Y6GA 3ABOA 1M03A 3P80A 3EZ4A 7PTDA 3WNMA 1J11A 1KM3A 2WM1A 5AB3A 5IHSA 5LGZA 1FHDA 2YJQA 2QYGA 2EXOA 4F9JA 1QOPA 8A3HA 1W1ZA 1E43A 3HFTA 5CPLA 3R7MA 2C3ZA 4L65A 3BXWA 1B1YA 4LUIA 4ZOCA 3S47A 4JEJA 4P7NA 3TYDA 4DB7A 5FJUA 3UBPC 4ORMA 4ACYA 3SFKA 4YNGA 4DLFA 4KESA 1DXEA 1G5AA 1W54A 1VPYA 4XZMX 4X2RA 4ZENA 2WJZA 4MMWA 4UNIA 5HQEA 5M5DA 1P6CA 3VM5A 3UG3A 1XHGA 3EX2A 1KB3A 4ZO7A 1QI0A 2VXNA 3W1PA 3EOSA 1JEZA 3FAWA 2NX1A 3QC3A 4P5UA 4UOQA 4JFTA 2GVGA 4NQ1A 3CZ8A 3OGVA 3W2JA 3LBOA 3IJ8A 5JBEA 4B2DD 1XLAA 4YCPA 5HJYA 2YDAA 4AF0A 2R14A 5AVNA 3RRAA 4JTJA 3OZPA 3LPGA 3QQWA 1IEWA 5EKYA 1FHLA 1GYLA 1IHIA 3MDWA 4IFOA 3CQKA 3EGJA 4GI9A 4PSRA 5L9FA 3NGJA 4IP4A 2W92A 1QJWA 2R6OA 2PODA 3NQCA 5KZ6A 3GNRA 4UQDA 1GUVA 1UH3A 3B0UX 4WRHA 4F0LA 2NXIA 2HZGA 1DWAM 2NWRA 3GX9A 4Q8NA 1SW7A 2V3EA 1E9YB 4NRSA 3CPRA 2FB2A 1FWSA 4XD6A 2C0AA 3VKDA 3MB9A 2NQ9A 3DOPA 4MUZA 3LU2A 1E0TA 4WF7A 3S46A 5HA7A 3MUAA 4IQEA 4O1BA 4GZJA 1V03A 3QW3A 3ZT6A 3EXRA 3CAVA 3W1NA 3DFYA 1H62A 1XV8A 1JL8A 4ATDA 4ZQRA 2HE5A 1S5VA 1TPB1 2UBPC 4YXGA 1GVRA 4C6KA 2BX7A 4C5YA 5L6UA 3E0VA 4NX0A 4O13A 5BU9A 2A1YA 2X1TA 3ZIZA 4RKAA 3WD4A 1JDEA 4MKNA 4PMZA 1UMYA 1AQHA 1YHTA 4A3HA 1Z41A 4FR1A 2EG6A 1EH9A 2I5IA 3AYTA 1MUCA 3OPSA 8CGTA 1VP5A 3VINA 3WDPP 3EOOA 2BG5A 2E8YA 3AMLA 5U7SA 3GXNA 2D3LA 3G1AA 1JZ5A 5E1QA 1ZU8A 1MNZA 3PUEA 5HPCA 1L6WA 1GW9A 2CHRA 3S9ZA 1AD4A 3V18A 1XH2A 4X22A 4PMQA 5KEZA 2WSQA 4M29A 1ZBKA 5A94A 1H3GA 3UWYA 3W81A 2GGJA 1CGXA 4L4OA 2HNHA 1V79A 1AL7A 2FLIA 1K9DA 5T9BG 3SQLA 1VJZA 2NV2A 1FCQA 1KGUA 2QCGA 3LPFA 1L6YA 4J4KA 3N4AA 3WF2A 4WX2A 5DX7A 2AL2B 5JBFA 2PDQA 4HTYA 3GZ3A 1A49A 1XLDA 1OFBA 5A6SA 4Q32A 3B0XA 1JFXA 2X09A 1ZS2A 4PTNA 5FKYA 3QFWA 3LHZA 5TBOA 1S5TA 1DIDA 5I3KA 1NM9A 5ABFB 1CYGA 4MIMA 5HNTA 3EA1A 1VC4A 1OVDA 5AC6A 4OIFA 3A9IA 4JFUA 3GLCA 1J8VA 1JCMP 1I9CB 1EF3A 3A21A 3P74A 4RNHA 4AD2A 2QDDA 5JBDA 4BR1A 4A6GA 1XYAA 2V9DA 3I3EA 3HG5A 4AIOA 4WKFA 3VX0A 4IQJA 4WY0B 1GHRA 1JYNA 1PCWA 1KM5A 4ICMA 1HKIA 2FJKA 1IIHA 4H7ZA 3R6IA 2BB0A 4BEUA 4U5IA 2VQTA 1IT7A 3SCSA 4MKVA 2AQWA 3LV5A 4XVEA 4LBSA 1SUXA 1S5WA 2FTWA 3IV3A 1I45A 2PTDA 1LJYA 5HBFA 3EXSA 3STEA 4A8LA 1W3IA 1FFQA 4C6FA 4AXKA 4M24A 4DBEA 2GOKA 2DUZA 4U33A 4MFDA 1EC8A 1E9LA 3P60A 2X1UA 4Y9AA 3TOPA 1F73A 1EGMA 1Y0EA 1OC5A 1F74A 1H41A 5LA0A 3A23A 4G7FA 3TQPA 3VE7A 1EC7A 4JIIX 5EB8A 1LG1A 1PKNA 1OZMA 1Z48A 4LEQA 1LLWA 3PVFA 4MZ8A 3SUUA 3LDVA 2O7SA 3UY7A 1XYBA 4HNCA 3SY1A 4UMCA 2ZUSA 4DQWA 2WYSA 3F4CA 2YB4A 1VBRA 1X96A 3AOFA 4BI6A 3R8HA 3S9IA 1S2CA 1MO0A 3GU9A 2QUTA 4XAPA 3D47A 3N04A 1ENUA 2QVHA 2RUSA 4URIA 3WDJA 1KKOA 1W5MA 3L67A 4Q33A 1UC4A 1FWHC 1EPXA 3TUUA 1V3IA 1ISWA 2YDQA 4YWIA 2REQA 2CZFA 2CHNA 1U5HA 4PEEA 4NF7A 1QT1A 1J79A 3D0CA 4AC1X 1MW2A 2PWEA 3M5ZA 3GC4A 3RJYA 4IQDA 4UQAA 4S23A 2BOFX 3THDA 3TSBA 1WZAA 1ZJHA 3T7VA 5F1VA 4OV9A 4MB3A 1JDCA 2BODX 4GKTA 1SFTA 2PDGA 2DZAA 2XN0A 3KBNA 3CWOX 5GJNA 2WQDA 3CUFA 1UWSA 5DQPA 1NJJA 2ODOA 5AFDA 1IYXA 2D2JA 3O3RA 2ZBTA 5D30A 3KOFA 1JD9A 2SFPA 3PN8A 3QJAA 4LUTB 2O9PA 1OGSA 2OZTA 1Q6GA 1RJRA 3G1RA 4O1DA 3VZYA 2EPHA 3AU2A 2PDKA 4QTGA 4QDWA 3ITYA 2XVLA 4P8UA 1K8YA 4MJ4A 1SR0A 4H04A 1KV5A 2JALA 2XSBA 4Q8OA 4H9XA 4AVNA 3QHOA 4QCEA 3R12A 2Y7EA 3VMNA 4NZFA 2IKGA 4XG1A 1W31A 3W7MA 3WBWA 3JW7A 1UD3A 2P53A 3KZPA 2BVTA 3LENA 1GVSA 3VGHA 3CU2A 2FTPA 4MJ2A 4LCRA 1NEYA 4HTBA 6PTDA 3E38A 2V2DA 3UWQA 3I6TA 3VNKA 3LBCA 4LS0A 2W66A 1F61A 4KEVA 1QBAA 3QTPA 1SQ7A 4OWGA 1YLVA 3IJ9A 3O7UA 3ARXA 2WZTA 3QV7A 5K3VA 1AQMA 1ISVA 2E09A 1JXKA 3CHFA 4W7UA 2DDXA 1KRBC 2D2HA 3BH4A 3W0KA 4M5PA 2YZRA 1PUDA 1D3HA 3K30A 1HGWA 1ZP4A 1BVNP 3LHVA 4PE8A 4MM1A 1KFBA 6TIMA 3IIPA 4F3HA 2J4GA 4UQBA 4NP7A 2YCLA 3I4KA 4LB4A 1PB0A 1F4AA 4J3ZA 1K77A 1TSIA 3MUZ1 4LSBA 4DWSA 1ONWA 4EXAA 1Q6OA 4CD5A 1J4EA 4LRTA 1EO5A 2DZPA 4WXZA 4E5TA 5KTLA 1Q85A 4DZIA 1EUAA 3VD9A 2WO5A 3L2IA 3ZYZA 1DOSA 4C5ZA 1VHNA 4UIOA 5D4YA 4X3ZA 1XC6A 4JOMA 3CZLA 1W1IE 5JXQA 3BUVA 2WAGA 3KRSA 1U2YA 3GXTA 2KAUC 4K8EA 1AW1A 3LZ3A 2G97A 3ABXA 2PD5A 1WNOA 4IX2A 4AD4A 2X2GA 4WGHA 2BSLA 4H6QA 3B8TA 4AHPA 3N2TA 1IF2A 3E3HA 3SUWA 4WJXA 3AJ7A 3GH7A 4GACA 3GG7A 3BOFA 1HP5A 4Q8PA 4EWND 5D2XA 4UOZA 2BMBA 1KA9F 4P8WA 5CSYA 3M7WA 1UROA 4JEQA 4U4MA 1QPNA 5AC7A 2DZUA 3GDBA 1F07A 3WK1A 1R3SA 2WCAA 2Z1SA 2D20A 3TSMA 2V5BA 5IM51 4UZUA 5CXPA 5I02A 1WCGA 2JK2A 2Z1XA 3WLJA 2OSWA 1PWLA 1SU5A 5MKGA 1JPDX 3PY2A 4U31A 2X05A 1XYCA 1BPLB 1V7YA 1A0CA 2X30A 1BWLA 2FJUB 1XINA 3A4WA 2GOUA 1ISYA 2W4XA 4ZVJA 3BJTA 1QASA 4B3ZA 1B2YA 1KFKA 3AIVA 2G3IA 3GW0A 4JPGA 3OU8A 4B92A 1VYRA 4WSHA 1D3CA 3KP0A 3M4HA 1QNQA 1MZHA 3T40A 4YPJA 2UV8G 3VNMA 1BGGA 3URAA 4EOUA 3WUBA 3TE9A 2QHAA 3FJ6A 1NOWA 1BTMA 1WOAA 1QHZA 1WX0A 2R82A 3AS1A 1IXPA 3DKLA 5F2IA 3GYCA 5FF2A 3QVQA 5HJLA 3CH9A 3IANA 1KFEA 4GUFA 1K3UA 2B7OA 1OB0A 1BVZA 2ZRYA 1V02E 1A0DA 1QTWA 3RCMA 1YXDA 1NELA 3IJIA 1K7EA 1WDPA 1RSCA 1H11A 4PFHA 4W8AA 3NR0A 4RXFA 5XIMA 1ZFJA 1GPWA 4XUYA 1FQ0A 1DWGM 4DZAA 3SM0A 1VB9A 2ZX5A 5EY5A 5D8ZA 3TN3A 1S3HA 2OVLA 3AXXA 3V1PA 1AK5A 1JQVA 4FLOA 3MBDA 2BHYA 3N2BA 5DMYA 4H9UA 4W8LA 2BOEX 2DH3A 2QCCA 2A7NA 2J13A 3HBLA 1DJWA 1IXQA 3BGGA 2JKEA 1K03A 5CC7A 5HR6A 4JS3A 2FDSA 4PTMA 5G4EA 1VHCA 4FNQA 1EOKA 3H2NA 3V16A 1FRBA 3VILA 3REQB 5AHMA 4KRUA 4Z08A 1ZBVA 1Z3NA 1YEYA 4Z1YA 3QOKA 2E77A 1T6MA 4NI3A 3DI0A 1RBOB 5A2AA 4HNTA 4CQCA 4KBXA 2VUNA 3I3BA 3MYPA 5D8WA 1V5XA 4DJEC 1UUQA 4Z1BA 3QFEA 3EPMA 3QN3A 4LAOA 1PIIA 2YLAA 4XTDA 2WMGA 2X1RA 1W1B1 4ZOAA 3A22A 5LNVA 4H41A 1S38A 1MW3A 3GC5A 4JCLA 1ADDA 2Y5SA 1US2A 3POHA 5J04A 3BW2A 1CXLA 5HJXA 3RU8X 2H90A 2OQYA 1JCXA 3VNJA 3PSVA 4DBUA 1JYVA 4I5XA 3C56A 4R85A 1KFLA 4K39A 3VGGA 1ISXA 5J5DA 1XBZA 3GVRA 1FDJA 4RE3A 3LGGA 1BVWA 4WKAA 3W26A 4RDWA 2BASA 2V67A 4XIMA 3TK7A 4GUJA 1CLKA 5M2FX 3FAXA 3H7RA 3FKKA 1FWDC 2XVPA 3WL1A 4OOUA 3BV7A 5DY3A 3LRKA 3E02A 2YLLA 4U2YA 1S3TC 3CV6A 3WD0A 4TXEA 3EB2A 3E12A 2VRJA 3DGRA 3LHUA 3WLNA 4J35A 4JTEA 2PRLA 2I57A 3ATZA 3VYLA 1J18A 2EO7A 5DCBA 4GUHA 3FA4A 1GOOA 4FPSA 3HJEA 2VX7A 4GQQA 2J7DA 5IBXA 1ZPTA 2C91A 2P10A 4TO8A 4HK6A 1PVNA 3B0PA 1J0ZA 3GB6A 1HJVA 1E4MM 6REQB 4OU1A 5K7JA 1UR3M 3W7CA 3JRKA 4IGSA 2YDRA 4UTJA 1P6BA 4YMZA 4HNNA 3A24A 4MWAB 2EEXA 3WQ4A 1J0JA 3NZQA 2UY3A 2XM1A 4MPQA 1JNDA 3C8NA 4J28A 3LGDA 4Z2JA 5F2GA 5ABHA 4UMBA 5E9XA 1SSGA 2YCIX 1ZY9A 4RNIA 1PEZA 3ZVIA 4JICA 3PZUA 3W2MA 1HL8A 4W84A 3FN9A 5A5WA 1V0LA 2WMFA 1FH7A 3AZRA 3W82A 4DPQA 3WLRA 2C7FA 1OF8A 2KZHA 5JMUA 1V3MA 4HMCA 2Z1BA 4QLJA 3ZZ1A 4PTWA 3HOJA 4YYCA 4MFEA 2XHYA 3ZVHB 2QQ6A 2AL2A 4LW7A 3H70A 3K2GA 3C0QA 1BKHA 3VX1A 5FF0A 3EEGA 1TIMA 3SGUA 5D32A 1H7XA 1GVYA 4R7WA 3AUJA 3PB0A 3V35A 4HOXA 2ZTJA 1N8IA 4JY8A 5JIPA 3C2VA 1O5XA 1R46A 2QCEA 2A3LA 2BS9A 1ZRQA 5TD4A 1KR1A 2OZ0A 4V15A 1KXHA 2Y0FA 4QAWA 1DWFM 1TVNA 1RUSA 4D6CA 3DBNA 5BXRA 3LK6A 2XGIA 3DXIA 4UCGA 1MEIA 2VZUA 1ZBWA 1BF2A 2HTMA 1PE1A 3QSTA 1FWRA 1RD5A 2DORA 3PB2A 1OFAA 1GCYA 2PPGA 2EF9A 2A3CA 3B8WA 1XCWA 9RUBA 1L0PA 4I90A 3SIZA 4QAIA 3GKFA 2XIOA 3M41A 3WQFA 5A8NA 5CJ5A 1U1UA 1Q65A 4IUGA 1G0CA 1JFHA 3GXDA 3N3MA 4MAVA 5CGMA 3EWWA 2BXYA 2Y8UA 3ZFHA 5BU6A 2GK1B 3QGAC 1EWEA 1TG7A 3N12A 2Z0IA 2QCHA 5AOUA 1TYGA 1V8EA 2JGQA 1US3A 4UZSA 3T0CA 1MXGA 2D23A 4EK7A 5C0QA 1X1OA 2VUYA 3MI3A 2Z26A 1D7KA 4GYFA 4JN7A 1I8JA 3DC0A 2RH9A 5AZ0A 5C9RA 3EWXA 3VABA 2TYSA 3S1WA 4QXIA 2G37A 3ES7A 4F40A 4IFKB 5REQB 3ISIX 3SN1A 1MVYA 4H8NA 1JZ2A 3NNTA 3DYPA 3Q65A 4GIYA 4JL1A 3K5XA 5AKQA 2GPTA 3NZGA 1IZJA 1C3FA 2GVYA 1RHCA 2CZ5A 1GKQA 5FEWA 1AQFA 4UWMA 2QPUA 3BICA 3UXLA 2BGNE 4C90A 3IIXA 1A53A 2PTXA 3ZS4A 3ONCA 2Y24A 3LZ5A 4LCSA 3LD5A 4QSFA 1VCFA 3ALGA 2WLYA 2VD9A 2AMXA 5EA9A 1ITQA 1TWDA 1YNQA 4BF9A 1XLCA 1DQUA 3WLSA 4I7UA 3LOTA 1Z6KA 2PLJA 4OVXA 4GIRA 2CLOA 1LL6A 2DPEA 3M1ZA 3GC2A 4V27A 9XIAA 2JQXA 4Q4KA 4Z2HA 3FGCA 2P5NA 3EX4A 3DHUA 3OBKA 1UUOA 3OHIA 1TVPA 5MHBA 2OEJA 1V0KA 4FOJA 4JKMA 1RCQA 3M16A 1HZYA 3ARQA 5I0DA 1UASA 3GS6A 4O17A 1QDSA 3PG8A 2FHFA 2QUVA 3N6QA 2AOSA 3W4RA 5HNRA 3W1MA 1A5SA 1HJXA 5EYWA 5GJMA 2QJJA 1A5OC 3UR7A 3TSDA 1TJRA 3QEZA 1DIOA 1ML1A 3L4TA 4PC8A 1AA1B 3ZWSA 3R0KA 1FH8A 4DZHA 1X97A 2ZA2A 5CEWA 5HAOA 2FZMA 4R9XA 1O5KA 1IT8A 3MQTA 4ZOEA 1KCZA 3W85A 4X0NA 1XLGA 3UR2A 2GL5A 4WKHA 4O18A 3F5JA 4WDTA 3SZ8A 3ANUA 1CGWA 5LHEA 3V5FA 4UQCA 1ZJAA 1DWHM 2F84A 4S2BA 4AFYA 4JZ5A 1EC9A 5B80A 1VPXA 3CB3A 2Q8LA 3C0LA 1XI3A 4YHEA 3STPA 3W88A 2IPGA 3CXOA 1EX1A 4ZO8A 4CQDA 3KHJA 4KKXA 1EX5A 1Z7AA 1XIEA 5EFDA 5DT7A 3L4YA 4GZEA 3SRKA 4UTTA 4GGBA 3NSNA 4H9MA 3N34A 1W9XA 4IWWA 3H7VA 3R4IA 3AS2A 3VGFA 2EPMX 4JR5A 1JUEA 1QATA 4L1XA 4WSKA 4LC6A 5JUVA 4CCEA 4GI6A 1O4UA 3GG1A 3VNDA 4BWLA 3W74A 4MSSA 3UERA 1FDZA 2P50A 4C6CA 4R7OA 3LMZA 4DWDA 4MJZA 1VRDA 4MNJA 3KCLA 2V5JA 2E67A 2OODA 5CPOA 4PCTA 3S83A 4A21A 1JR1A 4GK8A 2L5HA 1UOZA 4QE4A 3A5FA 3APYA 2IPJA 2VC5A 3MDUA 4Q4QA 1E6PA 1Q7MA 2HK1A 2CBUA 2PDNA 4X9YA 4PTDA 1LOLA 5FF3A 1GG1A 4AYGA 4IISA 2P8CA 5JU6A 5E09A 2VFEA 1W17A 3TZFA 3R11A 2XYLA 5I3IA 1LM1A 3W7QA 2XDFA 1EA9C 5M17A 1TJ1A 2ZTKA 4PRTA 1OM0A 1SO6A 3WF1A 3HQOA 3VUPA 4AY1A 1WZLA 4FOUA 3ZQ9A 2QUMA 3NZ1A 1OWQA 4MLJA 1JF5A 1WBJA 1CI1A 4H7VA 2YA1A 4XAGA 2O4QA 4I7WA 3F5KA 1CZ1A 1NWUA 2ZRWA 1UP0A 1TMLA 1WV2A 4QIUA 2C19A 4J9JA 5TAOA 2VWSA 4IZGA 3KZSA 4HPHA 2B7QA 3VOGA 4RL3A 1HO1A 1NVMA 4KWVA 3DESA 4XZNX 1HG3A 4AZ7A 4AX7A 3FSTA 2AGKA 4HYWA 1VFOA 3NZPA 4LWWA 4J2PA 1CNVA 4Q8MA 4Q4RA 2EPKX 1TIWA 1RK5A 1U5JA 5C7HA 1NU5A 3HZ3A 1EQCA 4O15A 3H12A 3WNPA 4A3YA 2B31A 2J7HA 3GIQA 4Y96A 2OOGA 3S1UA 3EX6A 1SJDA 1VFTA 3W53A 1RY8A 5CSSA 1N7KA 2YW3A 3USBA 2XFFA 4XD3A 4FXSA 4PRWA 2C71A 5BOEA 2E8ZA 4AD0A 1ME7A 3GZAA 4LYQA 2DH2A 1VEPA 1TV8A 3E2QA 5C2XA 3K8LA 1R2SA 1QPOA 1VH7A 2JIEA 3I6RA 4WZHA 3VU2A 4CU7A 1E3XA 3P14A 5D33A 4GY0A 1KRAC 3GDRA 2CESA 4OQVA 4MLRA 3GVGA 3GTNA 2OLSA 3A4AA 4D1JA 2W67A 5FF7A 5FACA 1FA2A 1Y8BA 2DU2A 3AIQA 5D05A 1YX1A 3OGRA 4DUWA 4QG8A 2YB1A 3FJLA 2WC7A 4O57A 1XP3A 3L4UA 3C3UA 3VDGA 5CGQA 2BGQA 1NWSA 2WHKA 4WDWA 1F5ZA 3G0XA 4JFVA 4E4UA 1N55A 4JFSA 3PJXA 4W5ZA 3EOLA 4MOZA 3MO4A 3KBMA 1P0BA 1EGVA 4GUGA 3ABRA 3ZR6A 3QOMA 3BGJA 4IUOA 1S5MA 1JGIA 5A8QA 3OBEA 1ICPA 3AXHA 4M3PA 3T81A 3VA8A 4FIRA 2ZRVA 2D1ZA 3M0JA 3W7HA 3BL3A 3MT1A 1KRCC 4MNLA 1Q6FA 3ZJ7A 4L4PA 2WKLA 4UBPC 2H3BA 3B8IA 1FCVA 1YNPA 2R9RA 3L65A 3PM6A 4F0SA 3VCCA 2ON3A 2I9EA 2NX9A 3W2LA 1ODUA 2RDXA 4MWAD 1S39A 2X7WA 1XJBA 3TIMA 3S2MA 3GFYA 2ZZ1A 1XBYA 3P82A 2FPVA 3TEVA 3F4NA 3LGEA 1CPUA 3UG4A 3W01A 2CLEA 3SJ3A 4LVAA 4M51A 2WK2A 2Y63A 3S2LA 3WX7A 4HU4A 2XVGA 4I5RA 3IGXA 5H8PA 1RLDA 1B31A 3MHFA 3GNNA 2V69A 4DY1A 1V6VA 5C9UA 1RH9A 2XIIA 2P0IA 4C6MA 2GVLA 3CIWA 4L80A 3DG3A 3NAVA 1QNVA 2ZE3A 3W28A 3V5CA 4D2JA 1ZCCA 2YL6A 4IPIA 4Q7IA 3UY8A 3UA4A 1J0KA 1VZWA 4NX5A 2YW4A 2PDCA 3OQ8A 5D09A 4J3TA 3DFNA 4I8DA 4B5NA 1H0GA 4X60A 2B81A 4LXFA 4IXHA 1PKLA 2CFFA 3KFTA 1OABA 1XYMA 3WF3A 3RGTA 3AUOA 3UZYA 2GGEA 3IIZA 1NP2A 3WO8A 7ENLA 4S39A 2OKTA 1EJRC 3QLLA 3LUTA 4L9XA 3MMUA 3QC0A 3H54A 4PB4A 3A64A 4IFRA 1R3VA 5TIMA 2IUZA 4I9JA 1P0EA 3W7RA 2V63A 3ZJ6A 1XG4A 3BOLA 1EA0A 1V93A 4W87A 1K1DA 3NGFA 3G1VA 2XZ7A 1AMYA 4CCZA 2B0MA 4LYPA 3PZVA 4ILSA 2NQHA 3TTEA 3VFLA 2OZ8A 4LV4A 5G2WA 3JZEA 1UKOA 1KC7A 2QJIA 1LL7A 2PU1A 5AHEA 4PMVA 2PDYA 3Q67A 1GQKA 3KW3A 2FHCA 3WY1A 3N11A 1PDYA 1NDYA 4EF8A 3ITVA 4GABA 8XIAA 4JTDA 1E0UA 2V3DA 4GYKA 2BY0A 3CQIA 2NQJA 2R1LA 1ZLPA 2IPFA 2NVDA 1SW3A 6REQA 2V81A 2X7VA 3TZNA 2JKPA 1QWKA 3NM3A 4DUOA 2ZZ7A 4R9OA 1K8ZA 5EMYA 3HPZA 3CZJA 1T5AA 2OLHA 4AWTA 4GVGA 3IPWA 4OUIA 4IMGA 1A5LC 1RQEA 3DHFA 3ID7A 3WH9A 3GG8A 4AHQA 2BTMA 1UMLA 3S1XA 2GJPA 4FNUA 2GUYA 2ZE0A 5EFFA 4ADSA 1XL9A 2YZ5A 2OO6A 1A47A 1WAWA 5CBBA 1LZOA 1PSCA 5HWJA 3QPYA 2IPWA 3T0TA 5CC6A 1JJKA 1KQZA 3NQBA 2YOCA 1VFHA 4ZCWA 3BJSA 4XZ9A 5BZAA 4KGLA 9XIMA 1I0BA 1CDGA 4GX9A 2J6XA 3CZKA 4GA8A 3UFYA 1FWBC 2YCEA 1GOWA 4W7WA 1TPDA 1PZ1A 2V8ZA 1R0MA 3MS8A 4AZGA 2ZFAA 3L9CA 4ADUA 2MUCA 3RYSA 1BKSA 3IWPA 4GH1A 2G3MA 1CTNA 2R1KA 4H7CA 4QX4A 3WF4A 5I3FA 4CEUC 3FKRA 3MO7A 4ORIA 1MRAA 2GJNA 3W83A 1WB0A 3W7GA 1NQ6A 2ZOXA 3PBUA 4KEZA 1R87A 3HPXA 5JIWA 3CLWA 4MNKA 2VZVA 1J01A 4A29A 4HOWA 4IMEA 3WQDA 1HKMA 5C2CA 1D7FA 5D2VA 4O52A 3VOJA 2OWWA 4JTHA 3UPWA 1S1PA 3M0XA 3AXIA 4Q8WA 1J10A 2E5BA 3PZIA 3RIKA 3ZM8A 5J8LA 2RFGA 1DL3A 3T05A 3Q4DA 4LALA 2X0SA 3L7RA 1G4SA 1W5OA 1EHNA 1VLIA 4TTUA 5LNRA 3QTGA 3ERPA 3CTLA 4FIQA 2WNNA 1JZ6A 4L1WA 3L5LA 4GY1A 2WXDM 4CU8A 2XSAA 3S6DA 3Q94A 3SY5A 3IK4A 1VKFA 3NURA 1NWTA 3TFXA 3RPMA 1F3TA 1AJZA 3AMDA 1K4HA 5EU9A 1DE6A 5FEPA 1OCQA 1TPH1 1O12A 3A6OA 2YPIA 3RX3A 1WUFA 2Y4SA 1HP4A 4M80A 4KERA 1ELSA 4KETA 3BPWA 1LP6A 5CAHA 2C1IA 1NARA 1EP2A 3BLFA 1C8YA 3JUGA 2GK1A 4UMAA 4K38A 2HDJA 3O16A 2C1GA 4JTGA 2OJPA 4GXWA 3UNTA 4UFIA 5A1AA 1EP3A 2BLEA 5LNWA 4GMEA 3UVAA 1E6RA 2WHMA 3ZXWA 5REQA 4GIEA 5CBJA 3EWCA 1WKFA 1YPXA 4JAWA 3GSMA 4GNVA 1HNYA 2ZA3A 3U2ZA 4LS2A 4GNKB 1GVQA 2NT0A 4KS0A 1TV3A 4HN8A 1N2VA 2YBVA 4KW2A 1JDFA 2JEPA 1NOUA 1IEIA 1QOXA 5AHNA 3MVIA 4LF2A 1XD0A 1SJBA 4JYEA 1VIZA 4WDXA 4IMFA 3N2OA 3T9PA 1TE6A 2E68A 4NILA 5A6BD 3UJEA 2CLFA 3ELFA 3W37A 1EPVA 1XSKA 1T99A 3T8LA 1W3KA 1S2VA 2CW6A 4IP7A 3RLVA 4O28A 2CYGA 3W70A 5I3JA 1QNRA 2XH0A 4V28A 2FDMA 1X1NA 2PLMA 2Y5EA 4AZCB 3EB4A 1QWGA 5A8PA 4N0RA 1GTEA 4RUBA 4HK5A 1DJIA 2D0FA 4BA0A 4DJDD 3PZMA 1EJUC 5I77A 4H8UA 2Y2WA 1OGGA 3IVUA 1UWAA 3MUXA 4YIWA 1EIXA 1XS2A 2CC0A 4QG9A 4YVVA 1QPKA 1JPMA 2XIMA 4JQ3A 1JCTA 2ZC1A 1UA3A 4GBUA 2ONEA 3KS5A 3GTHA 3T08A 4H4IA 4TMCA 4PBFA 2E9LA 3LHTA 1ZAJA 4DWSC 4GE8A 3AYRA 2O9RA 3AHZA 1LTDA 5KINA 3OHMB 1PZ0A 3C4UA 1H5VA 2PWFA 1PWMA 4C1LA 2VGFA 1I4NA 2QXWA 2ZUMA 3P0XA 4C7FA 2ZKMX 5LXEA 1X6UA 3G1FA 3HN3A 1DP0A 2XM2A 5LIKX 3GDKA 2Q8ZA 4IX0A 2X42A 4B16A 3W7IA 2VGIA 1AJ0A 2QIWA 4AD5A 1UZ1A 1OT2A 4IMAA 3MWCA 3KOZA 1ITCA 2BBFA 1QR7A 1DJHA 3TCEA 5I3HA 3HJZA 5GPRA 3N6JA 4UTHA 3HIJA 4RCXA 1GQNA 4MJMA 2VR5A 1UG6A 2PBOA 3MANA 3O9NA 3GVWA 1O5RA 1YPIA 4XO6A 3G77A 4LC8A 2CKRA 3NXFA 2E6AA 3BLOA 4C6QA 4JIQA 2WC3A 1VAHA 4K7YA 4RDVA 3WUEA 3A9BA 1X8FA 3AMKA 2WSYA 5FJJA 1E3ZA 3Q45A 4NJIA 4BQ3A 4FS9A 3N29A 4IT1A 5BCAA 5DCDA 3BW3A 3BAJA 3M9YA 3ARVA 4RPQA 1AH0A 3GRIA 1BQCA 3UCDA 4OOZA 1TMQA 1MQQA 4GRSA 1UOKA 5F1UA 2AQVA 5A6BA 5BOFA 2QZRA 1KR0A 2PFHA 1BYCA 3WBEA 3LCHA 2Q02A 3DC8A 1RA0A 5D2YA 4HA1A 2PEVA 4GJJA 1W5PA 4OECA 2XGZA 2WSRA 4XKMA 1DKWA 3NQAA 1VEOA 2HS6A 3WYZA 5D2TA 5D9PA 5FA5A 2IMRA 4ZEPA 2NQ5A 1E4LA 4XAFA 3UNDA 1B90A 2PA6A 3LA4A 3MSDA 1REQA 3ABQA 3SAZA 1W1YA 2FMOA 1QNOA 2V3FA 3OQEA 2VZOA 4JFWA 1O68A 5CPQA 5SWUA 3USZA 4P8VA 4GQRA 3V5OA 1MXSA 3DGBA 4GYPA 4K1WA 4Z0SA 5CPSA 2FTYA 4KFPA 4YTQA 3RDKA 1UKSA 3AISA 1GK8A 2Z2BA 5F2LA 2JE8A 1RD6A 3BW4A 2FZ9A 4WXYA 4GVHA 1R9ZA 3WQEA 4V33A 1VR6A 2OR2A 1PO9A 1VCGA 3BANA 3CAQA 4QNEA 3S4TA 1I1XA 3TW9A 3DX5A 3EWUA 4AIEA 4PUEA 3FNDA 2X41A 1MUMA 1POKA 2OXNA 1TZZA 2P88A 1XXXA 2P8BA 1DVJA 1M1BA 4DO7A 3SY8A 2TSYA 5DBUA 2YX0A 2Z1WA 1F4HA 1W1PA 3OBAA 3UPMA 1GEHA 1AZ1A 2YCJA 4OHQA 4JDYA 2QMJA 3UWUA 4XSMA 4LY8A 1Y65A 4KEUA 5A95A 4NJGA 2E4TA 1MI3A 1HW6A 3VD3A 4GXPA 4JX6A 5DELA 2J7GA 1K8XA 4MGGA 1OQFA 3CMFA 4IGNA 4AD1A 2WWCA 3MU7A 2H9AB 2ACSA 3H2MA 3EOUA 2VD8A 5BMWA 3QR3A 5FSDC 3HF3A 2A6NA 4N2YA 5EBUA 3GW3A 1KO0A 3SRHA 1Q7ZA 2HVOA 3BE7A 4DUXA 1KFJA 3RILA 4BKNA 1QCWA 4D6HA 3MPGA 4FLQA 4YVXA 1OG6A 1ITXA 3K4WA 1XPYA 2V2CA 1CWYA 3CUHA 4DF0A 2DGAA 1VD6A 3BAXA 5T26A 1OIFA 1B3ZA 1YDOA 1XYFA 2OYMA 3ANVA 3RNDA 4R7JA 1TWWA 4O0KA 6A3HA 5BXSA 1GWJA 3T2PA 1VJSA 1AJ2A 4ZODA 4HSHA 4GI4A 2CLIA 1UW9A 4AD3A 1M6JA 3UJ2A 4F0RA 4GCAA 5H91A 5GJPA 3PBGA 1Q4WA 3KBWA 3ZLHA 3BAYA 3RR4A 3W1QA 4FSAA 4AB4A 3WK3A 1FFRA 4JTTA 5FAJA 3I68A 3CJPA 4AYSA 4MY9A 1GNXA 3PTKA 4M0XA 3F4VA 1PIGA 4Z1DA 3HQNA 3ITTA 4D9PA 4MG4A 4YHGA 2C79A 3PNUA 2Y7FA 1YDVA 5IBXC 1YADA 1UR1A 3CYJA 3G8RA 4HNUA 1YDNA 3UWWA 3TJIA 2HBXA 4Z1AA 2PRMA 3MI2A 2DIEA 4LUSA 1OCNA 3N9RA 2AAAA 2PDLA 3IV8A 3E0LA 5C9ZA 1MFUA 3T44A 1JI2A 4AZBA 4QE5A 3G6MA 1XLLA 2DSUA 1EZ2A 3RLGA 3V0SA 1GKPA 3CUXA 3O07A 4YN5A 4L64A 4LOCA 1L2UA 2I7GA 4B5UA 3G6LA 4MB4A 4O1EA 1JUBA 1NFGA 2Y1HA 4MAZA 2X0HA 1PCKA 1E5NA 1E6XM 4P7RA 1BGAA 3BO9A 3KVJA 1A4MA 1VYPX 4BK9A 1UQZA 2VFGA 1DIEA 4F0HA 4B9YA 3TA9A 2Y70A 4BQ4A 4B3KA 3SN4A 3R5EA 3BTNA 4EVZA 1XW8A 1W32A 3AMGA 2P3ZA 2INZA 4UTWA 3I6EA 1EYWA 1U22A 3MHUA 1AVAA 4N6EA 4NU7A 5FOOA 4XKYA 3S9YA 1NSJA 3LI1A 3CASA 2DQXA 1SZNA 4R53A 1UZDA 4R5EA 4US5D 3NCOA 3C6CA 4Q8TA 2GJLA 1H7RA 3FOKA 4CNTA 3NDYA 4ASTA 4LF1A 1Q7QA 3WENA 2INFA 3L66A 4N02A 1Y5VA 4P61A 4IMDA 3RF9A 1RZMA 2YFOA 1TWZA 1E0VA 3UR5A 2VEMA 4I7VA 3AZTA 4DO6A 1EKOA 1LBLA 2VGBA 1GVIA 2YKKA 1OT1A 3C2OA 4GBDA 3PWIA 3GXPA 4PB3A 4PMJA 4F0MA 2QV5A 1KM2A 4TOQA 1WAUA 4L7ZA 3WKZA 3W3OA 4B15A 4ICCX 4O12A 3PAOA 2ZC8A 3CGTA 2QGHA 1X7IA 2ZVIA 4DHGA 3HA1A 1PZ2A 4AAJA 3B05A 2VEKA 1EDGA 4C6EA 1FDYA 1HQTA 1DHKA 1KBIA 3U3HA 4LV9A 5I3DA 4H1ZA 1ESWA 4Q8VA 2Z4GA 3CT7A 1FWIC 2HVMA 2OQHA 4J3SA 4F4RA 1JGMA 2ZYFA 3SEPA 2YDSA 3EDDA 4YVPA 1TV7A 1OFQA 3OZMA 5CZKA 3MMWA 2ESCA 3FLUA 3U5UA 3BLDA 4JHZA 4OBTA 4M1RA 4DF2A 1IXOA 1VFFA 5EL1A 3EAUA 4JQAA 2BDQA 3HU7A 2WVVA 3QKEA 2E40A 4JNYA 5DF0A 1GPFA 1TZ9A 4ICNA 4PA8A 2DJXA 1JAEA 2CBIA 4A35A 2PDPA 4MZ1A 3P61A 2DW7A 4AQLA 1BLIA 5D2WA 4CQ9A 3E49A 4DUVA 2GYIA 1ALDA 2AKMA 1NIUA 5GNXA 2DY3A 3WDRA 3H2OA 2ISWA 4NZ4A 3ZR5A 3MZ2A 3QR0A 4AWUA 4QLKA 2PLCA 1W1TA 4HJFA 1RCOB 4R33A 5G2HA 1F6YA 4HPXA 1CW2A 1P7TB 4PYSA 2DZTA 3T1GA 1TA3A 2ZCGA 3TLLA 1EQPA 1PXGA 4P8XA 4NAFB 3FHQA 3UZWA 4GJ1A 3C2FA 4NT0A 3LS9A 1OFOA 5ABEA 4PFMA 3MKVA 3L4ZA 1Q6EA 3QGKC 5RUBA 2OOFA 1JCYA 2PDXA 2D3NA 3M5YA 2YA0A 3QM3A 1JCLA 2MNRA 4GFSA 3WQGA 4FAMA 4AX6A 1R2TA 1WZMA 5HNUA 3IJ7A 3CWHA 4RPPA 2Q8XA 5BYWA 1NDWA 2VFHA 3UXDA 4ROPA 1I60A 4JDBA 4PCSA 4K8GA 4ZB2A 4W88A 4S3CA 1HT6A 3UD6A 4JXCA 4H9VA 3UJSA 2GQAA 3G18A 1SZGA 4JBRA 4LH8A 3WFAA 5BRQA 2J62A 5CC5A 2FYMA 3VNLA 4B5XA 2OMAA 1ODZA 2J7EA 1P48A 1XF0A 4NL1A 1A5UA 1OIMA 1B30A 3A5VA 4O0ZA 2CBVA 3VDBA 2Y85A 3DYOA 1UC5A 3S5SA 3GXIA 3SJNA 5A6MA 2FGZA 1DIKA 4L6DA 1GOMA 1ICQA 4XV0A 1MQRA 4Q3MA 3PBYA 4LANA 3P81A 1SVDA 4LVGA 3APGA 3ANYA 4S3BA 4W89A 4RR4A 1XIGA 3BCFA 3PG9A 1TX2A 4MY8A 1JI1A 4XTIA 1LRNA 3MW7A 1GW1A 1K7XA 3UU0A 1WKEA 4CNNA 3SUTA 2XWEA 3ITLA 2QGYA 2FFCA 4C6LA 2DSZA 2VELA 1FHUA 3RM9A 1ZENA 4XVDA 3STFA 3AS0A 3CAKA 3HGSA 4AWSA 2WZIA 2O7QA 1WA3A 4NJJA 2X1IA 1V3HA 1JCNA 4LBRA 5F4WA 1QU4A 2CXEA 3FEQA 6TAAA 4Q7BA 4AMAA 3MMDA 3UZZA 2PF0A 3JU2A 4JTKA 4PR4A 3LTPA 1G01A 1OFEA 2D2OA 2RJHA 2OTDA 5I79A 1UD6A 2VDHA 2VVSA 3U7VA 4E8GA 4IH3A 1C8XA 1J9YA 3F7JA 1Y7VA 3LY0A 2CLHA 2ACRA 3LV6A 5I07A 1YW1A 4FNTA 3L0NA 1PDZA 3TMLA 3G1XA 4LU0A 3RU6A 4RNFA 4ZTYA 2GSJA 2CZEA 2XTKA 4EXBA 2ZZ5A 4LBUA 3FHAA 5FI8A 3FA5A 2XGBA 3B06A 1M01A 1HIZA 1V6XA 1PV8A 1DJXA 3AZSA 7ODCA 1E70M 2AQOA 4HA3A 1UJPA 3VD5A 2NVCA 2WKJA 1C7SA 3GUGA 3WJSA 1SZEA 2O9OA 5ABTA 5G2IA 3BLPX 1R3WA 2GUBA 1XLBA 3G8EA 3CUIA 3W07A 3H23A 2PDMA 2IQ0A 2RGLA 1S46A 4G7EB 5HUPA 4HPNA 4PUUA 3PAJA 4R34A 3G5EA 3CLMA 3GO2A 3LYEA 3ZJ8A 2F6UA 4PUWA 3GTXA 4H9ZA 2GWGA 2UZ9A 1LQ0A 2HCVA 3XISA 5LNUA 3THCA 2PZ0A 4GPNA 3NFUA 3VZXA 5T91A 2WMKA 2MANA 1MUWA 4PBEA 3DFSA 3R89A 3ARZA 4J5NA 1QAPA 1B4KA 3FJNA 3O6YX 3CK5A 4YS1A 4KF1A 3IJQA 3MTWA 1IQ8A 2VCCA 2NV9A 3S6OA 1O60A 3TYZA 1XDJA 1LBMA 4CNOA 4QE1A 3BLEA 1W3LA 5D03A 2WM0A 3CWNA 1P0KA 2I9UA 3L0GA 5CSRA 4QJ3B 1CXFA 1CGUA 2C13A 1NOFA 1OC6A 2HMCA 5B7ZA 5IRPA 3ABSA 4HCHA 1W8GA 1JCJA 1XUUA 3CHEA 4WIWA 4QDPA 1JPIA 4D6EA 1JYXA 3E0FA 3SCRA 1A5MC 4RE0A 3K1DA 4O14A 3TTQA 1RY0A 2R1NA 4JTUA 1EEPA 1UCWA 2OX1A 1PPIA 3VPLA 4XBSA 2DVTA 2DVXA 3P62A 4HK7A 3PBMA 2ALRA 4NVTA 1R3YA 3EBVA 1N82A 3NIYA 3GIPA 2VCAA 3CYVA 1V3JA 1Q6LA 3ARPA 2ZZ6A 2YXOA 4DXKA 2ALDA 4PSPA 4B5WA 2FVLA 3LPOA 3QMSA 3O6CA 4B2DA 3FXGA 3TAKA 3CQ0A 1KRMA 1UH4A 3CZGA 2WPBA 1U83A 3WBAA 1UR4A 2FGLA 4AZ5A 2DVUA 3L4VA 5HQLA 1TE1A 3W2UA 3VGBA 2ZUUA 2B7NA 3RO8A 3AJXA 1JULA 4V1YA 3DYMA 2XG9A 3NQDA 5KMYA 1V6WA 4UOJA 1U30A 2V6AA 1GOKA 1CGTA 2A85A 1P4CA 4N6FA 6ENLA 1I2NA 1GZGA 1YTDA 2J74A 1UWTA 4DJED 3NEHA 4RK8A 2BY2A 1FKXA 2ADAA 1IR1A 3GR8A 2XFRA 4LGXA 3T07A 3QMTA 3U9IA 1RVGA 3M7SA 4GH3A 4ZE4A 1E40A 3ZLGA 3RPTA 3WEOA 3KDOA 2RDWA 4PCPA 2AL1A 1P43A 3A4XA 1GG0A 1DE5A 1B3OA 4PN2A 5CG7A 3SCPA 5FESA 1XRTA 3WNKA 1UQYA 2WMIB 4F48A 5LKYA 3OA3A 1VFSA 1CGYA 3LERA 1OC7A 4HHMA 4MKSA 3TN4A 1KCXA 3VIMA 4DBSA 3VCNA 4CEXC 1XLIA 1Z69A 5BNKA 2W6RA 2ZZ2A 3T78A 4PUJA 2PCEA 3NL5A 1QOQA 1ZBCA 5M3WA 4Q6JA 5H1WA 3NQ2A 2WKGA 2WBKA 4AF0B 5ECUA 4BFAA 3ARUA 4K8HA 3AIWA 1MEHA 1PYMA 2WVUA 4GOAA 2H9AA 5F2MA 1ZAIA 2C6QA 1HN1A 5I6SA 2WHLA 3LSBA 4EPDC 1K9EA 3GHTA 2WMHA 3GUWA 1QPRA 4XBKA 4K2SA 3CIVA 3W87A 2J75A 3AFBA 3W29A 1LUCB 3WFZA 3RM8A 2JEQA 3M0LA 4GIAA 4I9AA 4JTRA 2ZX6A 3KRZA 3MBFA 3FS2A 4Q4PA 4U10A 3DHPA 4B5TA 2R1PA 1JZ7A 3GY1A 4WGXA 2WW5A 3UXAA 1N8WA 4RZ6A 5FL1A 2GUUA 2YL5A 1TTPA 2XSXA 1IIGA 3BWWA 4RE4A 4D8AA 5C9XA 4EIVA 2VI0A 3OVRA 3ME3A 1Q6RA 4O4VA 2HNEA 3SDOA 4DLMA 2DZSA 2PDJA 2J7BA 3M0HA 4TV6A 1CEOA 3GXFA 3IUHA 3N3TA 2ZICA 1S2WA 3WBYA 3QYSA 4W85A 2CEQA 4GISA 3MCNA 3VD4A 4JX4A 4M6VA 1XFCA 3EYPA 4IG2B 3R0UA 4UR9A 4JQ2A 3WH8A 3HGOA 5B7YA 2BY1A 2VX5A 5GQBA 1KCLA 3BOXA 3A3XA 3QPZA 2QS8A 4LJ3A 3DG6A 4HZ8A 4PUKA 3V0TA 3UQNA 3R79A 3TJXA 2VDIA 5DEZA 1C8QA 1HJSA 3SBFA 1TR1A 3CZEA 2GGHA 5K4ZA 4RNJA 4WJ8A 4PTXA 2J25A 1EIBA 1W1A1 3R1ZA 3S5NA 3OB8A 4PCNA 1WUEA 3PBVA 4YWSA 2DZVA 5DFAA 4MUPA 4C6JA 2VFIA 1GHSA 4FMVA 2GSHA 3LXCA 3O0FA 1OF6A 3SQSA 3ATYA 4R3UA 4UC5A 3M0VA 4PMOA 1EDQA 3AIUA 2BWGA 2FZDA 4Y7EA 3EKGA 1XISA 4QEEA 3NTYA 3H2EA 4LYKA 5JQ9A 1SJCA 4RX0A 2YYTA 3N25A 3N1AA 3T4CA 1MQPA 2ACQA 1OD0A 1SGJA 3DHDA 5A2CA 5CZSA 1W1VA 1Z44A 2CLLA 1V3KA 1SMDA 1F6KA 4QM1A 2V5DA 1TMHA 1WBHA 2OEKA 2A3AA 3V0UA 1FWCC 4C6PA 1RJPA 3VUSA 2IKHA 2OX4A 1RALA 4HYRA 3A4JA 1BXBA 2GQ9A 3WL0A 1QPQA 4LT9A 1XICA 1XIJA 1K7FA 4C7GA 3NL3A 3QV6A 1XD1A 3QQ0A 4G6CA 1LOQA 1MEWA 4OJYA 3SIMA 2Z29A 2QT3A 3UJRA 2JF7A 4CD8A 1UP3A 1O6IA 3ARRA 4JQ4A 3E96A 3WCZA 1E4IA 3KL5A 4LB3A 3M0ZA 3VKAA 2GJXB 1W9BM 3HPSA 2GSEA 3FCPA 4Q22A 5F4SA 2XFWA 4I3GA 2ISSA 3TW7A 2ZQ0A 1PTGA 3L2LA 2J9YA 1V6UA 2PTYA 4GINA 6ALDA 1WKDA 5C54A 5I2UA 3B9NA 3WLTA 2A3EA 1VLWA 2HK0A 3O2LA 2X0YA 1IWBA 3ITCA 1WE5A 2Z7GA 5AHIA 2YL9A 1I0DA 4HMDA 3T0AA 4BF7A 3V1HA 4Z0JA 3EX1A 1Q6QA 2FGBA 2ZWYA 3E2VA 3PPFA 5AVHA 4H6KA 4PZVA 3TN5A 4CD7A 4J40A 2D22A 2VCBA 2ICSA 4L4MA 3OG2A 3T2OA 2HISA 3EMCA 4ACZA 3OLDA 1M7XA 2J9ZA 3FFSA 1AODA 3FK4A 2WNZA 4UTUA 3E0WA 4D72A 2EQDA 4S3EA 3WQPA 1IZCA 3VOCA 3TYUA 3H53A 3GM8A 2VVNA 5CPTA 1PYFA 1AL8A 2Y5JA 4B4HA 3WUGA 3W25A 3NG3A 4TMBA 4XISA 1H7OA 2PE4A 1KQYA 4U3AA 1CGVA 3F4DA 3QY7A 1HL2A 3P6LA 3OVGA 1JDAA 3VDHA 1K9FA 8RUCA 3WLKX 1WXJA 3EMQA 3KP1A 3PS7A 1P7TA 3F2BA 3WQWA 3UJFA 3W00A 4WLCA 2PWVA 1JG9A 1CXEA 4NAFA 3C86A 4XD5A 2E0PA 3GD6A 3GYEA 4NHVA 1Q3NA 4S3KA 5I78A 1EL3A 1JRCA 3C0SA 5AZ1A 3WSUA 3HV9A 1AW5A 3GG0A 3S42A 1OCJA 1A3XA 3IJDA 3UP8A 1O5QA 1OHLA 4MDPA 4GC3A 4AIUA 2YYUA 3B9EA 1BEUA 1X6NA 4IPPA 1O7AA 1DBTA 3WDHA 3NQVA 4YL2A 3NOEA 1LBFA 3H4XA 1K4GA 5EMLA 1R6WA 3TA6A 2G41A 3ZO9A 1TPVA 1KW1A 4RZ4A 2PC4A 3NQ6A 3SCQA 2Q6ZA 4HYVA 4QCFA 5HR7A 4RZ5A 3BG3A 1L6SA 4FI4A 4Y2WA 4LUYA 1M5WA 2FIQA 1KBKA 2GDVA 3KL3A 4B91A 3IGSA 3M6YA 4HPGA 3FDKA 3KRBA 4FHAA 1KLZA 3UWVA 3VMOA 4AXNA 4EX4A 6XIMA 2J6VA 4CN6A 1DJGA 4IXXA 3TR2A 3KM8A 1OFRA 1C9WA 4MTVA 7TAAA 4S3GA 3TN6A 2CERA 1O1ZA 4A8RA 1ZHAA 3SCOA 2XH7A 2QCDB 3DG7A 3CL6A 4ZFMA 5I23A 5LIXX 3HGJA 5E0CA 4LX4A 3IIOA 3SCVA 4QITA 1B3VA 3UT0A 3SR7A 2YXGA 2G8ZA 4DAFA 3WF0A 3V4BA 3ABZA 2J78A 3AS3A 1GGOA 1C8VA 4O1FA 3RPDA 2G96A 3WNNA 1F2JA 3G2GA 1LOSA 4XD4A 4NIRA 3WMLA 1UR8A 3E0IA 3VKKA 1XCFA 4NG3A 4N9CA 1BXNA 4IPJA 1WXYA 3S6TA 3VKJA 1X1ZA 2DSKA 2ZWZA 5K9CA 4LQ1A 1RA5A 1YKWA 5G1TA 1SO3A 1QO2A 1DJZA 1AH3A 1IR2A 1UP2A 2VGGA 3HG2A 2OGJA 1VF8A 1TTQA 3JZUA 4EPBC 1ONEA 3TQVA 3BQ5A 4FO4A 1T96A 1YYAA 4P7LA 3C52A 1OX6A 3CTTA 2QDGA 2Z1KA 4BF5A 1JD7A 3V3WA 1LQ2A 2WWDA 3B9DA 2GGGA 5D9NA 5A6LA 1Q6DA 1ZNNA 1QW8A 2Q01A 1J6PA 1VJIA 2TAAA 1VFUA 4DWSB 3D46A 3M43A 3WEZA 5HXMA 3ORWA 2I16A 3BAIA 1XSJA 3H7UA 1W6TA 1UWQA 1NF7A 3AYSA 3DCPA 8XIMA 2FMNA 1BRLB 2BV9A 2BFGA 3WLOA 2X16A 1C93A 3SGZA 2VRQA 4FA3A 3KS6A 4L4LA 3NQGA 3H21A 1CX9A 4AVOA 1KLYA 3W27A 5CPMA 4Z17A 1LDCA 3PC0A 4KH2A 3S2JA 3COTA 3TMQA 4H83A 2NVAA 2NUYA 4C1KA 2OWCA 3CPUA 1OX5A 2V5CA 2OT0A 4LAZA 5IHRA 4OV4A 3GK0A 2I1OA 2PTWA 3C2RA 4PL1A 4H8VA 1H7WA 2VEPA 3QZAA 4GYJA 2XH2A 3TXVA 5BXTA 2HQAA 4GGHA 4GYPC 3O06A 1CENA 3AO0A 1GT8A 2YXXA 3DBPA 4I5UA 1VBJA 3S5OA 3WQ6A 3U4AA 3GBDA 3KL0A 4FF5A 1WYIA 5LSMA 3PWAA 1SZRA 2ANUA 4XQ6A 3H24A 4ZO9A 3PZTA 3UXIA 4UCFA 4S3JA 3KTSA 4ERAA 3PZ9A 3QKZA 4QROA 4GLEA 1U33A 5HK4A 2W63A 4AW7A 5EMUA 3QHMA 1FCBA 2VOMA 1XR2A 1YTKA 3WG6A 3R2GA 2W0UA 4JN6A 4XB3A 5E93A 1KXQA 4A8IA 1B3YA 4G5DA 1QMLA 2WBGA 1JUKA 1VCVA 4Q8QA 3WLHA 4DI9A 4E8CA 2FZBA 3LLDA 2JBMA 1X39A 1NFBA 3SO7A 4DELA 2E3ZA 2XPKA 3VXGA 2PDBA 1EWDA 5J5RA 4C60A 1IEQA 2HROA 4NYYA 4GI8A 3PANA 2BOGX 2YL8A 1E1EA 1H1ZA 1GZ1A 1TWIA 4DN1A 3R8RA 4A2SA 3WNOA 2PGWA 1UPPA 4QEHA 4TX9A 5FF4A 1H50A 2V2HA 2NV1A 5HWMA 3ARYA 2H3DA 3EPOA 5C8BB 1FOBA 3VIFA 4P2VA 1QO5A 2HBVA 1BYAA 2AAMA 1OADA 2E9BA 4MDOA 5EMJA 1E0XA 1JDDA 1UKQA 3AHXA 3BCJA 3LPPA 4ZQOA 2DUXA 2O92A 5CC3A 1DJQA 2VEFA 4WD0A 3BZJA 2VJXA 5M03A 4I8YA 3DU0A 4NXKA 1FUYA 4IP5A 4U28A 5BXPA 1J96A 2P0OA 4C6NA 4IIBA 2PDWA 4YYFA 2VHLA 1Z9AA 1XC4A 5ABFA 3FSUA 2WVTA 3PZGA 4JTSA 4MZYA 2V5LA 3NQMA 3PJUA 4XAZA 5LIWX 4JTIA 1FWTA 1LWHA 3P84A 2BVDA 2ZXAA 2PWUA 4UR7A 3L4XA 3GTFA 3KUMA 2OKOA 3AAMA 2JF6A 3M47A 3KTCA 1OGBA 4LPCA 1V6TA 3JR2A 1O66A 4WY0A 4RDZA 1LF1A 3F2CA 3IEBA 4J27A 4TIMA 3MSGA 2RGMA 3TC6A 4BQ2A 3NL2A 1BF6A 2WMIA 3VKBA 3P8JA 2PI6A 3FYPA 3LBMA 2D0GA 1BYBA 3QRHA 4IJRA 3WNLA 3UETA 3BZGA 1E1CB 3E5BA 1IGSA 3CO8A 1E1FA 3AALA 1FXQA 4CKQA 3DUGA 1OYBA 3W2KA 1XIFA 1GEQA 4XSLA 1HO4A 1UZ4A 3W22A 4EPKA 3E2RA 2V0TA 4PB5A 3CL8A 2FH8A 4DJFC 3HPFA 4DVOA 2P1FA 1R38A 1VBUA 4X0VA 3AIEA 3W76A 1GOIA 2HEJA 3GBEA 7CGTA 2E7FA 4DYKA 5C70A 3THQA 2Z6JA 4ATWA 1F8MA 3MCMA 4AEEA 3W23A 3WEMA 5XIAA 3WQOA 5JH1A 2PGRA 3CHVA 4GNJA 2ZRUA 2Q71A 4JHMA 4ZGYA 4XO7A 4J3VA 3SCWA 5AHLA 3TQ0A 5HQMA 1HF6A 4X9SA 1LUCA 1R3QA 4J1OA 4AZ6A 4F9DA 1XDMA 1S2AA 3NO1A 4UTFA 1UD8A 3CBWA 3THAA 4UTWC 1PJ9A 4QQUA 3VIHA 2B4GA 1FWWA 2BNJA 1CECA 1E9IA 3IAQA 1G4EA 3SRDA 3DDMA 1I1WA 2DZXA 3S3GA 3K13A 4N9BA 5IXEA 3KWSA 4LNCA 5E70A 3VIGA 1S2UA 2PP3A 4A2RA 5AC5A 4UUIA 3LCFA 1C29A 3T55A 1W9VA 1H49A 3RX2A 3MCOA 4N7QA 2ATSA 3DI1A 5DXXA 4M1BA 3W7PA 3KBJA 3TKFA 1HVXA 1E51A 1B9ZA 3M0KA 4H01A 1RLCL 2W27A 2GLKA 4CD4A 2HS8A 1R85A 2E6DA 5E9AA 2DUAA 4O11A 1SW0A 1ZAHA 3VC6A 3N9SA 3WQ5A 4IG2A 4IJCA 5FD0A 3DIPA 4E6MA 2AKZA 2HE8A 4J3WA 2J7CA 4ALDA 1QW7A 1X6LA 1I2OA 2ZUVA 3EWBX 4LUTA 2QLYA 1PKYA 1UZHA 1FX6A 3F03K 1ZL1A 2XZ9A 4CCDA 1W9UA 3AWNA 1B57A 3NOYA 1V0MA 2LLEA 2E1WA 1XFBA 1XIMA 1VQTA 2PUZA 3DFTA 3ONBA 4V1XA 7XIMA 4PUMA 3N2MA 4RXGA 5M1TA 3SURA 1TUFA 3O15A 4C1NB 4W5UA 3BG9A 3QV9A 4GO9A 3IUDA 4AY7A 3PZNA 2DSVA 2Z24A 1KD0A 4N9DA 1FP9A 1XQKA 4HNVA 3U2EA 4K3ZA 3TYAA 5I06A 3M5XA 3WN6A 4ZMGA 3WK0A 3T4WA 3DKJA 4O4WA 1TQJA 4WY0F 1AD1A 4OT7A 5DBTA 1RR2A 5DMMA 2E6YA 1LQAA 3LCGA 3TJLA 3XINA 3S1VA 3WD1A 3UF9A 4M7TA 4NZ1A 2X8RA 4Q4OA 3MKKA 2CNCA 3KVMA 2G4FA 1UUMA 4DAIA 2V30A 1GOQA 4GFIA 1NFPA 1WDSA 4OZOA 1MW1A 4LFYA 5D9MA 4Z2IA 2ASHA 4HD5A 3TTOA 4HU8A 4CD6A 1JIBA 2D24A 3GAYA 1B0IA 3B8UA 3C2YA 3QF0A 3URQA 2DFAA 1AFSA 3M46A 3MJYA 1EJXC 2W91A 2GJXA 3BDKA 1PX3A 4Q4SA 2Y7DA 1BG4A 3OLGA 1A5NC 4XBJA 2BGSA 3WMBA 2O4MA 4HQVA 2PGEA 3C5QA 2QNEA 2VL4A 4MB1A 5HULA 5I03A 3TLQA 1UJQA 1ITUA 4AZIA 4XX6A 3KBVA 1BTCA 3KCOA 2Y7GA 4NNCA 3LCIA 3O6DA 1DWJM 4GWEA 2PMQA 4Z1CA 3LN3A 3B8VA 3LTSA 1UD5A 3L23A 5LA2A 3LCLA 2J7FA 5I5RA 1GQIA 2HPMA 4E2BA 4PMXA 2NW0A 2QUUA 2NLYA 4HHHA 2PWDA 2CZDA 4A3RA 5CH9A 4BEQA 5FAGA 1HUVA 3SB0A 4PODA 1M53A 2DT1A 4KPLA 1EB3A 1DXIA 3HTWA 3OVQA 2VENA 3SUSA 5FEXA 3CHCA 1MDLA 2QIIA 1A80A 3VVGA 2FB3A 5FIPA 3CEUA 3B40A 5FJPA 3K8MA 1TV4A 1E55A 3N4EA 4L5ZA 4GQBA 4QP0A 3KDNA 3G1YA 4JIRA 4BJHA 1V7AA 1E5JA 1XBXA 4BQ5A 1Q8JA 1XPGA 3SFWA 4S2CA 2A2IA 5FJOA 1XWYA 4IIFA 1WQ5A 1TJ0A 2WPGA 4AU0A 4FF7A 5LZLA 3R8GA 2E5DA 4DWSD 1MRQA 4O10A 1YTEA 4QS6A 3G24A 3VC5A 1Q13A 1R5YA 2GGIA 5BWFA 3PHAA 4H19A 3FGCB 1M04A 3BSMA 4JD4A 4A8NA 3MSRA 3OA5A 3OZOA 1MNSA 1YDYA 2VURA 2IS7A 4HPJA 3VFCA 4AIBA 1TWSA 3E5PA 3ECQA 4RZBA 2VR2A 4E4FA 3AHTA 2GWNA 3W7OA 3BLKA 3LQGA 2VQUA 1PL9A 1E15A 4LAUA 1LT8A 4UNLA 4FZIA 2POTA 5AYXA 3MHGA 2OSYA 1WDWA 1DXFA 3POCA 4B9ZA 4IL0A 1WDDA 1BXCA 1GJWA 4P7QA 1TRDA 1W56A 1OEPA 3WD2A 1IEXA 4IQLA 1RP8A 4CU6A 1TZ7A 2E28A 2F6KA 3LCWA 1T41A 3QGVA 1FWGC 2Z00A 2FZNA 4YLWA 2VMFA 3UG5A 1XRFA 4PMUA 3UWZA 2DP3A 3WH5A 1AW2A 2VZSA 4P7OA 3TP4A 3DZ1A 4HB7A 1JQXA 3GFXA 4M8UA 1ZALA 2QCDA 3R43A 1PX4A 1HJUA 2CBJA 4D6IA 4MYXA 2GDQA 2EPNA 2Q09A 4M6QA 5CAKA 4KCTA 2JIWA 4QRNA 3GE7A 4GCXA 3DH7A 3DN5A 2NUXA 5AC4A 5KETA 1UWRA 2FZ8A 3H2CA 2DZWA 1AZ2A 3KXQA 5A6TC 3REQA 2XVNA 4HZMA 4NAEB 1KTBA 2A0NA 3TOYA 1F9CA 2QDHA 4NRRA 4WOQA 2WZMA 2OO0A 4LVBA 2E9MA 3FVMA 2HV5A 3QMRA 3UZ5A 3VGEA 4CQAA 3MV01 3K4AA 1DTNA 1AMKA 3HFYA 5CPNA 3MA8A 4JQ1A 5C7VA 3MUCA 1ADOA 3K8KA 4IM4A 1H5YA 4ZL1A 3EXTA 4QJ4B 5AYIA 3NQ7A 2J79A 5TQLA 5GNYA 3EDJA 2XIQA 2YCKX 1B3WA 1GVEA 4IL2A 1UKPA 5EGRA 2VEGA 3RUBL 1XIDA 3KE0A 4ZXOA 1Y5WA 4IICA 3P8IA 3M07A 2GJRA 2NLIA 2VP8A 1L6FA 4EF9A 4J3UA 4GHRA 2EG7A 1XLFA 5DANA 1F76A 4TQTA 4MF4A 4IF2A 1TPUA 4W8BA 4LTSA 3RX4A 3GWQA 4E3VA 4YTRA 3VGDA 1W5NA 1PS9A 5BWAA 4AHOA 1I2RA 2TPSA 3W6YA 3PK7A 1FP8A 3RR1A 1BRLA 3S5YA 3IRSA 1K6AA 4I9TA 1A5KC 4JYFA 4UB9A 1EOMA 3BK0A 2VEIA 1XYLA 2DSWA 1RQBA 3L4WA 2OG9A 2RHGA 3QBUA 1XM3A 1T40A 2PD9A 4UQ9A 2AMGA 5EMMA 4JCMA 3UA3A 5EBAA 3OZYA 3GDTA 5MF5A 5G4HC 3W84A 7REQB 3M44A 4G56A 1F05A 2HRWA 1EJTC 4WVXA 4CLMA 3W1LA 3EWDA 3PTQA 2WSKA 3WIJA 1WDQA 3LSCA 2IXVA 4ES4A 3JS3A 4TR9A 1UR0A 3T0DA 1OX4B 3KWXA 4AISA 3RK8A 3CMJA 1FH9A 4F8XA 1IT0A 2CWNA 1AQ0A 1XLEA 2PTZA 3BAKA 1QXLA 3RAOA 1WXZA 2CETA 3WH7A 2H6RA 1HKWA 4LVDA 3SADA 1TVLA 4MVAA 2I17A 2G0WA 3BC9A 2C15A 3NXLA 5HUOA 1RVKA 4GQGA 3EEZA 4KMQA 3KVLA 4MWAA 2RDUA 5H2ZA 4UFJA 3GIYA 1NAL1 2VX4A 3VIOA 1BAGA 2QCLA 2XWDA 3GQYA 3OIXA 2BVYA 4D1IA 5HMFA 5IFPA 2IQTA 1T8QA 3GNXA 4F2UA 2WCGA 3SSZA 4L9ZA 2Y6ZA 2WJFA 4HSOA 3TJ4A 4N42A 3QSRA 2GDUA 4G2DA 3BMXA 4MYAA 4D6JA 3SRFA 3WLQA 3T42A 4ERGA 1OY0A 4WDUA 4A3QA 3T0BA 3W9ZA 2DW6A 5A8MA 4Z42C 1JXJA 1XYZA 3IACA 4PUNA 3B4YA 1TCDA 1KWGA 4TU1A 3UW6A 4NKCA 5EMKA 2KX9A 3W02A 1BQGA 3AMCA 3VDCA 1HX0A 3ZT5A 3C3NA 2AGTA 3BGAA 4ZBCA 4RW5A 4O54A 3ZVHA 2Z1VA 3TW6A 2RKXA 2DT2A 1O1HA 3GDLA 2GQ8A 5G5IA 1IZKA 1G1YA 3VK5A 4WOZA 1UD4A 2F38A 5LHFA 1H0IA 4BS0A 4QGCA 4IGHA 2PZNA 1CXKA 3OEXA 1C9DA 4IPNB 4OUEA 3B0VC 1E6ZA 1PAMA 3QXBA 4O1CA 1KM6A 1H61A 3MJMA 3O1NA 3RG6A 4R88A 1JAKA 4PULA 2UY5A 4PMDA 4JHOA 4MADA 2WMJA 3U4FA 4JYDA 4TUFA 1YXCA 3FDGA 3G0UA 2H8ZA 3UZJA 4NNAA 1KM1A 3NPUA 3QHNA 3TV8A 5I09A 4O19A 1KXTA 3AYVA 2VKZG 1W5QA 1DHPA 2XH4A 4GX8A 3ITOA 4XZLX 2HJPA 4C6OA 4NJKA 4JKLA 4LAMA 1GJUA 3N9KA 1W9PA 3II1A 1XH1A 3NYDA 3NZRA 5EPDA 3Q58A 1TV2A 2J88A 4G9PA 2PRHA 4RJEA 3CIXA 4A05A 1E1CA 5CZTA 3VNIA 3SN0A 2R24A 4H8HA 1R9YA 1U1JA 1V0NA 4C91A 3DFOA 4US6A 1Q8AA 3QLDA 2O56A 2C16A 4YJ5A 3B8DA 1BWKA 1R3RA 3BSGA 5CGTA 4IIGA 1E6SM 3RCNA 4F66A 4PUDA 2WJEA 3W1XA 1EJSC 1UD2A 1M7JA 2VRKA 3S1GA 1IE7C 4FXRA 3GXMA 4JX5A 4IFKA 1KM4A 4UTLA 1JZ3A 3CQHA 3WDIA 4F0KA 3NQEA 5HNNA 2BXZA 2EJAA 4GO8A 3C8FA 2FKPA 1R7AA 1DTUA 3VNYA 2WZHA 1BD0A 2Z2UA 3B03A 3V36A 3NO3A 2QUNA 4FXFA 5K9XA 1F3WA 1FKWA 1KM0A 2GZXA 3QH2A 4QLLA 2NX3A 4C7DA 2YIHA 3QYQA 5E6YA 4HA4A 3CO4A 1YPFA 4G1KA 4HN4A 2ZXBA 2F9RA 3W7KA 1OYAA 2P3EA 4LAKA 1HJQA 5LYRA 2CKSA 1IEVA 4PBGA 2WOQA 4FNSA 3VAVA 4UTMA 3TAOA 1O94A 5CLTA 3D3AA 4LS1A 1T0OA 1KNWA 3HMCA 2VTFA 3UXKA 2DQWA 1GVOA 1U1HA 2NZLA 2BY3A 1LRTA 5LIYX 5C71A 4W7VA 1Q2SA 4A22A 3MP4A 1XH0A 2TRSA 3K46A 1G9HA 1KBBA 1AH4A 2XUCA 2FVKA 3LCXA 4N4PA 1G6CA 3JVAA 5BROA 3ZJKA 5F7UA 3F1QA 4NSBA 3WMCA 2FQIA 2O0TA 1J6OA 1Z8AA 3O0KA 1GQJA 4EKJA 3OODA 5C6MA 1M41A 3VIJA 1UKTA 4H9TA 4QQ3A 1OD8A 3IK2A 5KZDA 4GG9A 4WR3A 3NSMA 4AEOA 5I00A 4Q6XA 1R2RA 4PMRA 3B97A 4HHLA 4A3UA 4ATLA 3U6WA 1E6NA 4PEKA 1NP0A 1J12A 2DIKA 4GUIA 1QHOA 3M0IA 1C90A 5D04C 2IQDA 3B8SA 2GFTA 2XINA 3GFZA 3LXAA 2EJ1A 4XUGA 5FCZA 3CT2A 3GU2A 2H8XA 3BSHA 3O63A 3UWEA 1O95A 5LA1A 1ISZA 4C1NA 3RMEA 1M65A 3NPWA 4H6RA 3WH6A 4ENLA 3H4GA 2WNWA 4HU3A 4NNBA 4D6GA 4K6AA 1GTHA 2W79A 3EKZA 4TX6A 4L61A 5I7GA 3FYYA 2WJDA 5KSWA 5TNVA 4JIEA 3WQVA 4LUJA 2YSWA 2P76A 3S2NA 2PSNA 4X63A 4XZIA 3SQMA 2C18A 3MP5A 2UWFA 3W7JA 3CPGA 3P7YA 3BVJA 1VFLA 3MUY1 3QR1A 1QI2A 4IHCA 4BY3A 4ZSUA 3N14A 3S2CA 2EG8A 1OSEA 1Q63A 4MPKA 3U7BA 1KGXA 1IXNA 1ZJBA 1RBLA 3MSYA 1UBPC 2VT0A 2FVMA 2V68A 2HWGA 1Q2RA 1X8CA 3PUOA 4HT3A 2E25A 2ZUWA 1A5CA 3KLLA 1EJVC 5LXXA 2WV8A 1HFBA 1ZJIA 2TMDA 4HMNA 4FP1A 1RBAA 4WEVX 4EP8C 2YR1A 4HHPA 3M0MA 5HINA 3MWAA 4CQ8A 2J9XA 1WO2A 5IFTA 3FYOA 4S3AA 3VE9A 5H8MA 5DCEA 3CM4A 5A6KA 2OU4A 1TRIA 1RAKA 2A7PA 1TPWA 2DT0A 3TC7A 4CGTA 3LXBA 4LNYA 1RXOB 4EWJA 1BHGA 1L8PA 1MYRA 1XLJA 4XZHA 4B5SA 2EBNA 3VI2A 4LEFA 1C92A 2CWXA 1MWOA 3N2CA 1PHWA 1QNPA 3GH4A 2YFNA 1NF0A 2NQZA 3ARTA 3TC3A 3P93A 4DJDA 2YA2A 4EACA 4E4PA 4KCWA 3GNDA 2OCZA 1ZCOA 3R10A 1MXDA 3PUGA 4FX8A 2DT3A 2HSAA 4HGXA 3EOEA 1F7BA 5FJIA 3THUA 3TWBA 1HJWA 3UEQA 3N13A 3DEQA 4QDMA 2ZX9A 2VDGA 1OBAA 1B3XA 4UFKA 4H6EA 2XIBA 1EHAA 3MY9A 2A6LA 3NUKA 4D71A 1SJAA 1M7PA 1LLZA 1LCOA 3QQ1A 1H63A 4HCLA 4WCJA 3NEVA 1J0YA 1UB3A 1J5TA 3UZXA 3NVTA 3FJ4A 1A5BA 1BSIA 1VBGA 4KRZA 4NI8A 4QJ1A 3PR2A 3H55A 3K1GA 3UGVA 2OB3A 2DEPA 3I7RA 2E5CA 1GYMA 1JPHA 2J66A 4E3TA 3HQPA 3QZ6A 4DM2A 2Z28A 1FWJC 4DBWA 3STGA 4DF1A 5BRPA 2GVJA 4ZQNA 1J2BA 3VCRA 1H51A 3R13A 1YXYA 1VFMA 4X61A 3UR8A 4AMCA 4POCA 2O55A 1I2PA 3ARSA 1M9HA 4BCEA 1K02A 4WK9A 4NZCA 2ABAA 4A4AA 3ALFA 1NQKA 3MZNA 4KWSA 3R94A 1X38A 2QPXA 2PU0A 2QAPA 3QZEA 3EA3A 3LG3A 4ZB5A 4EE9A 2J8TA 4S1FA 3L68A 1NY1A 3RN6A 3C0JA 1QI5A 4KIRA 4NZ5A 1YNYA 2CLPA 2ISDA 3D5HA 4QNWA 2NT1A 3LNMA 1Z32X 2R94A 1KTCA 1XQLA 2A79A 2PURA 1OFPA 3TTYA 3W6MA 3HPAA 1DJNA 2C0HA 5C9WA 3D3FA 4W9TA 4FNPA 1H7PA 1QI3A 3OP2A 1GZJA 5BRBA 1XSIA 3ITGA 4M81A 5GNZA 2EKCA 2F8QA 1XRSA 4K68A 3ITXA 5D38A 1M68A 4GVFA 4X2PA 1TO3A 1ZQ5A 4JL2A 2PP1A 1G94A 2WVSA 1TX0A 3W38A 2E1DA 3WJZA 3OOQA 3INPA 5E0FA 4HZ7A 1X98A 4JN8A 4CNPA 1FHVA 1L2QA 2G3FA 3L5MA 3OW1A 3LLXA 4TVUA 4L6HA 1UBSA 6XIAA 5IDIA 1H09A 4NAEA 1MZRA 1R9XA 1XRVA 4M82A 3OYXA 5DLCA 2I5GA 1MFVA 1W3HA 1XKYA 3UPBA 2OYKA 3DFQA 4Y8FA 4L6OA 3CV1A 3Q2DA 3MMTA 4ZE5A 2QR6A 1E72M 2PF8A 2G5WA 3W6LA 3B9AA 4C65A 1YBQB 3KEHA 3WQCA 5ABGA 2IKIA 2HPIA 3BAWA 3VKCA 5HWNA 4GY7A 3RM4A 3VNZA 4FX7A 2ZUTA 3WQ8A 3AI0A 2ZVRA 1TTIA 3OVPA 1VRXA 5AN7A 1JPKA 1CXHA 2PCQA 3L21A 1I6NA 2ISVA 3RFAA 1S1RA 3SSJA 3W1UA 2QW5A 1DYSA 1WP6A 3AROA 3GTIA 1OFDA 5CJNA 3VO0A 4KWUA 3LHYA 3KOWA 3NJ3A 4CN1A 3N17A 3LI0A 2VC6A 3W24A 3G3MA 1F3EA 4Z2GA 4NJHA 2VX6A 1LROA 8TIMA 4AVFA 2XIJA 3OLEA 3A3WA 1ECEA 3ZOAA 1A4LA 3AC0A 1HL9A 4QJ5B 5E5CA 5DO8A 1REQB 3RLUA 1W3JA 2PGFA 1LT7A 3VZZA 2ISFA 3A13A 2QEZA 3EB3A 3BV4A 1Q5MA 1QK2A 1W3TA 4OGZA 3PZQA 2PDIA 1SFLA 2A5HA 4C6DA 1QI4A 1K8CA 1JYWA 1H7NA 4CN4A 3WFLA 4J7RA 1TFVA 3C2EA 2XFYA 1POJA 3TQKA 3HGRA 4G8TA 1HTIA 3IVSA 1XLMA 1VYSX 1VIWA 7REQA 1ZTVA 3NL6A 2PBGA 3V75A 1L9WA 1P0NA 3J7HA 2V38A 1SYTA 1UA7A 2V3GA 2CLKA 1SO5A 4XZWA 1G4PA 2DJLA 1F6PA 1MMFA 1OX4A 3I65A 3IGHX 1FWEC 3HMJG 1GOXA 1WOBA 3M5VA 2YGYA 3CQJA 2NSOA 3TU9A 3KBSA 1EO7A 2QCMA 4F2BA 3HQ1A 3SCNA 1SZFA 1TELA 3AICA 3TYBA 1G7VA 3M0YA 4NUWA 1MSSA 1TPFA 1DWIM 3B9OA 1R8LA 1SFJA 4BI5A 1KGWA 5C2GA 4RDYA 2DV0A 4HA0A 5CLWA 1J93A 3TTSA 4ZTXA 4FB7A 3IARA 2ZA1A 1EDTA 5D9OA 1K70A 5BMXA 4FALA 4JTCA 4ZQMA 1D8WA 2PWGA 1LORA 4UTKA 3TX9A 4PGLA 5DMLA 3VTRA 4L1GA 1E56A 3W1RA 4F79A 5ENLA 4JTQA 1A50A 1E9ZB 4OTKA 2QJGA 4HP5A 2Y88A 1QFEA 4MNMA 9CGTA 1LWIA 4DO4A 3RLHA 4AZHA 1R3TA 2G3JA 3DECA 3VIIA 3PUDA 4J3XA 2YBUA 2FPYA 1PZ3A 3PPGA 2W5FA 2CITA 3GR4A 2Z25A 4GC4A 4MWAE 1GJPA 1HKVA 4AG0A 4Q7NA 4TV5A 2E6FA 4ZB0A 1W2VA 2D73A 4FOKA 4W93A 4AUBA 4HSNA 2PLKA 1OCBA 1XCXA 3U8GA 4US5A 5CCZA 5GVJA 5A8GA 4AY8A 1GKRA 3NQ8A 3W72A 3FIGA 4HVXA 3CMGA 1EFZA 2BHUA 2QKFA 3GH5A 4IIHA 4ZR8A 3B04A 4ROQA 1ME8A 1S5NA 3VIPA 4HMEA 3TFCA 2QMKA 3CNYA 5HANA 1ZUAX 3NQFA 5A6AA 2ZXDA 4PMYA 3KLKA 3VOFA 2QCFA 1PTDA 2OQLA 3LMYA 4LUSB 3NYZA 3AIBA 1C7TA 4NZ3A 2OELA 2Z7KA 3WLIA 4JTAA 3HURA 1NWRA 3IAPA 5A6JA 2W9MA 3U2OA 2VC9A 2FH6A 2PWHA 1L6GA 2EKGA 1E73M 4MHBA 3OYZA 4DBDA 3FA3A 4WSJA 5DY2A 1RPXA 5KZEA 1E4NA 4M6UA 1P1XA 1CT5A 3GAKA 2VNCA 1TCMA 1J0IA 5K4XA 4Z2KA 3G22A 3PZOA 5A8OA 3IVTA 1JF6A 1BSLA 1XX1A 1C91A 1NDVA 4LY4A 2EHHA 2CLMA 5AYZA 2QPSA 2GVEA 4PMNA 5FL0A 2HXTA 4RE2A 3FVDA 1G4TA 4OE7A 4DNHA 2J24A 3VDAA 4XK2A 4YTTA 1K9TA 4B4FA 4JIHA 2ZDSA 3G1DA 4O8RA 4XKYB 4H2CA 3V7PA 2BXVA 3N2XA 1ZGDA 2ABBA 1UH2A 1UPMB 3QV8A 4XIAA 5CG0A 3BMWA 3TH6A 4IGMA 4RW3A 1EEXA 4PL2A 6CGTA 1D8CA 3LB0A 5LIUX 4UTTC 3U0HA 1TJPA 4O16A 3AXMA 4RV3A 2X40A 1QK0A 3P3BA 2J77A 4KRTA 3IUIA 3GNPA 3PFMA 3F2DA 1M3UA 3QW4B 2VR4A 3R25A 1V08A 5A69A 2PS2A 4E2VA 4BWLC 1D2KA 4AZCA 1VS1A 3C61A 2ZX8A 1PBGA 5DXYA 1ECQA 2VM8A 1J0HA 4REQB 2WLZA 3PP7A 1BG9A 3HB9A 4JKKA 3MI6A 4AWEA 4K1GA 1XLKA 4CQBA 1EF2A 3UYCA 1RPKA 1P1MA 1Q66A 3OG3A 3PWGA 4ZO6A 2R1MA 3SCUA 2W3ZA 2ZXQA 3ZR4A 2G95A 1VPQA 3GHUA 1EJWC 2NWSA 3CUZA 4YU1A 2ZRZA 4KWOA 4E2DA 3W7LA 4E8DA 3PFRA 4O1AA 1OK6A 1QRQA 1DQXA 3ZLFA 3DERA 3A47A 3N18A 3GR7A 4O50A 1KBJA 2ZUNA 3ICJA 1EYEA 1LL4A 1V77A 1H1YA 3W71A 3O05A 4B5VA 3SUVA 3H4WA 4JGDA 2WVVB 5T9CE 3PNZA 4HOZA 4JNMA 4L56A 3R58A 2DIJA 2GQ3A 5G4WA 2OYLA 4OBRA 5DMNA 5AYBA 3KAOA 3H2AA 4TTGA 2NUWA 1EUNA 1ZB5A 5I24A 1FWAC 3DFPA 1FTXA 1G7UA 3L5AA 5I3GA 3NA8A 3OIHA 3WLLA 2Y89A 2YBTA 4Y9MA 3UESA 1YE4A