3UXIA

Crystal structure of l-rhamnose isomerase w38a mutant from bacillus halodurans
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
413
structure length
402
Chain Sequence
SQFERAKIEYGQWGIDVEEALERLKQVPISIHCAQGDDVGGFELSGDYPGKATTPEELRMDLEKALSLIPGKHRVNLHAIYAETDGKVVERDQLEPRHFEKWVRWAKRHGLGLDFNPTLFSHEKAKDGLTLAHPDQAIRQFWIDHCIASRKIGEYFGKELETPCLTNIWIPDGYKDTPSDRLTPRKRLKESLDQIFAAEINEAYNLDAVESKLFGIGSESYVVGSHEFYLSYALKNDKLCLLDTGHYHPTETVSNKISAMLLFHDKLALHVSRPVRWDSDHVVTFDDELREIALEIVRNDALDRVLIGLDFFDASINRIAAWTIGTRNVIKALLFAMLIPHKQLKEWQETGDYTRRLAVLEEFKTYPLGAIWNEYCERMNVPIKEEWLKEIAIYEKEVLLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-Rhamnose isomerase
publication title Structure-based studies on the metal binding of two-metal-dependent sugar isomerases.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Isomerase
total genus 139
structure length 402
sequence length 413
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.14: L-rhamnose isomerase.
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06134 RhaA L-rhamnose isomerase (RhaA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3uxiA00
4QE4A 3GNXA 3ITYA 3KWSA 6XIAA 4K3ZA 1XISA 4W4QA 1XIDA 1CLKA 3XINA 1QTWA 4A8IA 4X60A 1XLGA 2GVEA 3OBEA 5B80A 1I60A 5H1WA 4GJJA 3UXIA 4HHMA 3UA3A 4E3VA 4QDPA 1XLLA 3IUIA 1XYBA 4QEEA 1QT1A 1XIIA 1XIHA 5B7ZA 3KCJA 3U3HA 4KW2A 2HK0A 1XYLA 1XLMA 4OVXA 5EMKA 3VNKA 8XIMA 1XLEA 4ZBCA 4G56A 2G0WA 9XIAA 3IUHA 4QE1A 2J6VA 3BDKA 3AYVA 4PFHA 8XIAA 1XLKA 2ZDSA 1XLHA 5EMJA 3QYSA 3M0YA 3VNJA 3L23A 3QXBA 4XISA 3XIMA 3ITLA 2XINA 3N4AA 1XIJA 3M0XA 3KBNA 3NGFA 3P6LA 3QZAA 5H6HA 1DXIA 2NQHA 3P14A 4GJIA 4K1GA 4YTRA 3M0HA 2QW5A 1XLBA 1XYMA 4GQBA 4YTQA 2ZVRA 3DX5A 4PGLA 7XIMA 2X7WA 1YX1A 3LMZA 3BZGA 4XKMA 1A0DA 1XIMA 3JU2A 3KCLA 5B7YA 1S5MA 1XIBA 1DIEA 4EAYA 5XIMA 3AALA 1XLAA 1XP3A 2HCVA 1BXCA 3C0SA 4Q7IA 9XIMA 3VNMA 1XYCA 4HHLA 3KBJA 4EACA 1GW9A 1OADA 4YTTA 4DUOA 2XIMA 3IUDA 5TNVA 1XYAA 2GUBA 3CNYA 2QUMA 4XIMA 4J4KA 3KBSA 2QUNA 4XSMA 1QUMA 1MNZA 1XINA 3ITXA 3KTCA 4YTSA 1XLJA 3C0QA 1XIEA 4US6A 1O1HA 1XLFA 4YTUA 5AVHA 1XICA 6XIMA 3VYLA 4A8NA 1K77A 5FA5A 3BWWA 4X61A 1MUWA 3FVMA 1XLIA 3AAMA 5C9ZA 2OU4A 1I6NA 1A0EA 2GLKA 3M0LA 2NQJA 3KBVA 4QE5A 4ZB5A 3KCOA 1DE5A 4HNOA 1XIFA 3CWHA 4XSLA 4ZB2A 5J8LA 4QEHA 4HGXA 5EMLA 1XIGA 3BANA 4ZB0A 3VNIA 1BXBA 1A0CA 4QDWA 3UVAA 3TVAA 3XISA 3WQOA 4GLEA 4A8LA 3ITOA 3U0HA 2GYIA 5AVNA 3C0LA 2NQ9A 1XLDA 1XLCA 3KBWA 1DIDA 1TZ9A 3CQHA 2X7VA 2I57A 3BZJA 4A8RA 4DVOA 3M0VA 1DE6A 3ITVA 2XISA 5EMMA 2G4JA 5I7GA 3CQKA 3UU0A 5XINA 3DBNA 3ITTA 3VNLA 3CQIA 3QC0A 3UA4A 4XIAA 2QULA 4X63A 2Q02A 3TC3A 2HK1A 3CQJA 4LNCA 3KBMA 1S5NA 3M0MA 1D8WA 2I56A 5XIAA 3AYTA
chains in the Genus database with same CATH superfamily
3GNXA 3ITYA 1YW1A 1P48A 1SFLA 2B81A 5AYIA 5D04C 3GK0A 4H41A 1LRQA 3NPUA 1LL4A 3IV8A 1P0KA 3C3UA 4C7DA 5BWFA 4UOJA 1YXCA 4FF5A 1ME8A 4E5TA 3M0YA 4QXIA 2E9MA 2EG8A 3PNZA 3FAXA 4GQQA 3OZYA 1XYMA 1E56A 3GR7A 4D1IA 4JTEA 3G0SA 2G5WA 3EB3A 3EB4A 5A2BA 3PPGA 4U4MA 4HN4A 3VC6A 1M04A 4PTWA 1AH4A 2HEJA 3RG6A 2RDTA 4J4KA 4UTLA 2NSOA 4HBKA 4C5YA 1R9ZA 1O1HA 1SJCA 2YBUA 4QX4A 2A85A 3QV8A 3W7JA 4PMDA 2Z0IA 2A1YA 4QSFA 2GLKA 2A79A 4ZB5A 1M9HA 3SQMA 1HJXA 2ZXQA 3FJNA 3TTEA 1BYAA 2EPKX 1FCQA 2FB3A 1XIGA 4AD3A 2RKXA 4DJDC 3PUOA 3SY5A 2IQDA 4ZE5A 3DOPA 1IWPA 3L4VA 4H2HA 4IFKB 4XAYA 3V75A 3U2EA 3UJSA 3WQ6A 4NIRA 3NO3A 3ARTA 3WMBA 1KWGA 1ITXA 5H91A 4QBXA 3WQ5A 4AD1A 4JKLA 2GVLA 4L65A 5HUPA 4QE4A 3WLPA 1JPDX 1Y5XA 1R3YA 3T2OA 1JXKA 4HU3A 3UYIA 3GDLA 3MWCA 3K4AA 2PWVA 4Q8VA 3CGTA 4A3QA 3REQA 5AECA 2H6RA 4GI6A 2ZWZA 4ZA0A 3UGVA 1IWAA 2ZRVA 1AZ2A 1GUVA 4LVDA 4S3CA 3GDKA 5K9XA 3AXKA 5CSYA 3AYRA 3E5BA 1IEIA 1QAPA 3WF0A 3FXYA 3LZ5A 2XYLA 3R0DA 4UR7A 1DWGM 9CGTA 1WKDA 1Q6QA 2A7NA 3EGJA 2ACRA 1WZAA 2EJ1A 2I1OA 1XYAA 2NV1A 4O19A 3QQ0A 1HKJA 2XM1A 4YVPA 3ANUA 5AC8A 1Q66A 2XUCA 3BLFA 3GNNA 2DV0A 5JIWA 4PCSA 4L6DA 1XGDA 4FNTA 2ZZ6A 3W1AA 3BG3A 3VK5A 3MHGA 1XDLA 4U3CA 1KFEA 3VO0A 1QWKA 1ONEA 2IMRA 1TZ9A 3W1NA 3CXOA 5EYWA 4JQ4A 1PTGA 3H2CA 3FJLA 4JTGA 3KDOA 5E0FA 3HG3A 4O10A 3MUZ1 3PTKA 2DVUA 3H4XA 1P1MA 1XRTA 4HK7A 1DXEA 2I16A 1IE7C 3GNDA 1PHWA 3WBYA 4DUVA 5LZLA 1K9DA 3CUXA 3IIVA 4V27A 3TMLA 3WBAA 3UG3A 4JYFA 2IUZA 3MI3A 2XIIA 3PTMA 1M03A 1FVPA 1JCNA 3KLLA 4G7EB 1CXEA 1E5NA 2VFFA 3M16A 2BXZA 1ITUA 1OGGA 3WKZA 1CCWB 2Y89A 2JF6A 1UA7A 5C55A 2VNCA 1EYEA 1UD4A 1E1FA 2BDQA 1OG6A 4NZ4A 4UQDA 2C3ZA 5FJTA 5LNSA 3GVWA 5LNWA 1CGYA 2CZDA 3LDVA 3H70A 3QFEA 1FWFC 4Q7IA 9XIMA 1G5AA 3EYPA 1YHTA 1ISZA 3BG5A 2WVTA 4M6QA 1FXPA 3GH4A 1W9PA 1W8GA 5I06A 3WENA 4WX2A 3S0CA 1QRQA 3OHMB 4OQVA 3HB9A 2Y63A 2X0HA 2J9ZA 1EPVA 4WGXA 3RCNA 5AFDA 1M3UA 3VA8A 1XLIA 1XPYA 2CESA 3QZ6A 2BSLA 1M7OA 3E0LA 5F2MA 1Z8AA 1V8EA 3ZM8A 4S23A 2FGBA 4AYGA 4CGTA 1A50A 4CUCA 2FZ8A 4ICNA 2D24A 2Y8KA 2OX1A 4ZGYA 3GTXA 4Q8UA 4YYCA 4ZOBA 3CEPA 4WSJA 3A4JA 1KR0A 3W2LA 4MJ2A 4MZ1A 3LD5A 2V0TA 2QEZA 4RE4A 3AHYA 4MPQA 5A3HA 1FWSA 1GVYA 2V5LA 3A47A 2X40A 1M01A 3GBEA 4RDYA 3VMPA 1GOIA 1UR0A 4JZ5A 3W1RA 3W27A 4Y7EA 4ZOEA 2VGBA 3PBMA 4JTLA 2ISWA 4AWSA 3LS9A 4IFKA 1TPH1 1QPNA 3GX9A 3R43A 3E6EA 1HKKA 3RXZA 2GSEA 4JTIA 1TPWA 3KOXA 4ILSA 3BXWA 5A8GA 3N2TA 3NDYA 2Q8XA 1O68A 1N2VA 1GKPA 3DFPA 3T05A 3SBFA 1QPRA 3BUVA 3SSJA 3GFZA 4LFYA 5ABHA 4LYPA 1ONRA 3L2LA 3TU9A 3E3HA 4DJDD 1T41A 2P1FA 4BZYA 4EE9A 1EUAA 3MBFA 1V51A 1EC7A 3KBWA 1PYMA 1PDYA 3TEVA 3K13A 3L4UA 2XZ7A 3DBNA 2ISDA 1SO5A 2IXVA 4NZ1A 3WLIA 3TP4A 2CU0A 3OB8A 1PIGA 4D6JA 1EP1A 3ZR5A 3THDA 1GGOA 3SCTA 4ACZA 3R2GA 3G0UA 4YVXA 1QTWA 4M51A 4H6QA 2CEQA 2O9PA 3KHJA 4LF2A 2VR4A 1H11A 2BVTA 1HKWA 2BP1A 3LTYA 4C5ZA 4Q4QA 2WSRA 4UTWA 3LSBA 3U2ZA 3VCNA 2V69A 4NXKA 4RK8A 3NL2A 2ZUVA 2PWHA 1GKQA 4PUUA 1TPDA 1G69A 8A3HA 3OZOA 4PMJA 4FK9A 3VNMA 4ZOCA 3NQVA 1DWAM 4DO5A 4MIMA 1SW3A 2CPUA 3SUSA 3DH7A 1EXPA 4Z08A 3PULA 4FIRA 2QDGA 4G7EA 1V4YA 3P5ZA 2HPIA 3EXTA 3HU7A 1PWLA 4FSAA 3U5YA 3Q65A 3THCA 3CYJA 4DWSA 3QHOA 4WKAA 3IACA 4ES4A 1LP6A 2HNEA 1BVNP 3VIJA 3PY2A 2ZA3A 1E3XA 4FI4A 1FCVA 3DFQA 3EOOA 3NAVA 5AHLA 6A3HA 4EXBA 5FL0A 1EDGA 4Z1YA 2A7PA 1C9WA 4K8GA 1TV7A 2ZXDA 2PMQA 1FBAA 2FZBA 1XHGA 4H9XA 2Z6JA 1V6WA 2DH2A 3TWAA 1PV8A 1ZBKA 1VGAA 4JQAA 3BAKA 4MY9A 4ASTA 2WKGA 3RR4A 3G5EA 4K8HA 1JNDA 4JFVA 1CDGA 3SURA 3LU2A 3ZT5A 1D8CA 4ATWA 1CXFA 1MSSA 4YIWA 3BCDA 3WUGA 1DIEA 3U4FA 3EOSA 4GX8A 4HHPA 3EXRA 4Q6JA 4ZEPA 2FZ9A 1GG0A 3RPTA 4LUTB 3WD3A 1LZOA 3TKFA 4CNPA 4HOXA 3BAJA 4PYSA 3I3EA 3EX6A 3NO5A 4HMNA 3WLHA 1XLFA 4LV4A 3W85A 1YXDA 1E0UA 3HJZA 1EIXA 2CYGA 3HA1A 3OA5A 4HZMA 1PKLA 4DXVA 2OQLA 3VD9A 4J2PA 1O4UA 3GS6A 3B0PA 3VIMA 5DLCA 3CL6A 2GYIA 4LYRA 3SIMA 4FALA 4W8BA 5CQ1A 4I6VA 4LYQA 1SZGA 3WMCA 4IMDA 3RRXA 2ZZ4A 1GOKA 5FF4A 2VQUA 4V33A 1XJBA 3OZMA 1BVWA 3R25A 1UJQA 1P43A 3S9YA 5XIAA 3W7MA 4FNRA 5DBTA 4A22A 4JD4A 3VD4A 2E5BA 3LLXA 2YYTA 4YMZA 3UYCA 2QF8A 3MP5A 5JXQA 3SSZA 2Y2WA 1PPIA 3B8DA 3GVQA 2D23A 1UPMB 1E51A 1WYIA 4ZE4A 3M47A 4YTRA 1MEWA 3MCMA 4RNFA 1DWIM 5BMXA 1OGBA 3GXFA 3RITA 5K7JA 1FKWA 2BVDA 4S38A 2P88A 3UR2A 4MG4A 1HKMA 4TTUA 1DJZA 5C54A 4RDVA 2QJIA 3GM8A 3D0CA 4H7ZA 3VE7A 3A4AA 4BWLA 1I6NA 3CWHA 1WE5A 3SCNA 4ZQPA 4H19A 1JQXA 6TAAA 2GGGA 3VNIA 2WOQA 4P8VA 1OT2A 2WMKA 4KRZA 2PZ0A 4PUWA 3BE7A 4C7FA 2NQ9A 5BWAA 3DBPA 4TUFA 3N4EA 4C60A 1NQ6A 4Q8OA 5HOSA 2PLJA 3UXKA 1UD3A 2CLOA 3B9NA 3E0FA 3HZ3A 3WX7A 1TMQA 3ANVA 2WBKA 4LAUA 3N15A 5JQ9A 4ALDA 1RY8A 3V35A 1B1YA 2DFAA 3QLDA 4XO7A 4UQEA 4HPNA 3BQ5A 4KH2A 3GDBA 1LJYA 1UD5A 3C3NA 5EB8A 1FKXA 4P5UA 4HMCA 1GTEA 4BQ5A 1ESWA 3L65A 1I2PA 3NSXA 4YL2A 3LCHA 1HVXA 4WEVX 3STFA 2DJLA 3P6LA 2W5FA 4EXAA 3UFYA 5T9CE 1X8FA 2H9AB 1V6UA 3AHZA 4AZCA 1EZ2A 3W2UA 3LY0A 3ONBA 1E72M 4INFA 1R38A 1YDNA 4HN8A 2Y7GA 3RR1A 3GHSA 1T40A 2NT0A 4K68A 3E2QA 3Q37A 1ONXA 4NRSA 4GUFA 4GC3A 4G1KA 1XCWA 3WD0A 1IIHA 2VC9A 3MA8A 1DIOA 2A3BA 3SI9A 1ADDA 1FWHC 3Q58A 1VFOA 1W31A 1TKKA 4ZCWA 3R8GA 3O07A 1F4HA 4IMFA 2I9UA 3V0SA 3VU2A 1XS2A 2WMFA 1IR2A 1VR6A 3BGJA 4DF0A 4B3ZA 4UBPC 2NV2A 3ABQA 3W00A 4ZSTA 3P93A 3UR5A 4FXJA 2YFNA 2AOSA 2XIBA 3ITGA 2W27A 3W26A 2GWGA 3HOJA 4GX9A 3EX4A 3UP8A 3MS8A 2WHJA 4FHAA 4DWDA 2R1LA 4QDPA 4WZHA 1RSCA 2PSNA 2QR6A 1PDZA 4QE1A 4JPGA 2DUAA 4ZQOA 3HMCA 2Y85A 1E4MM 5C8BB 4DQWA 3VILA 4AD4A 1CW2A 2E6AA 1C92A 2YJQA 1GVQA 1HT6A 2WSKA 1B3YA 3UGRA 3MZ2A 3CL7A 2QJNA 2PS2A 2P10A 4I6KA 3ID7A 3CTTA 4MWAA 1LDCA 1S2VA 4DM1A 1BRLB 2PTDA 4X0VA 3M6YA 4UZUA 3VYLA 2QPSA 5LXEA 4W5ZA 3TQ0A 3TV8A 4PMNA 1TJ1A 2GSJA 3FSUA 3BQ6A 5C9RA 1KFCA 3ES8A 4KFOA 1PAMA 3EPNA 4N0RA 1E4IA 1QU4A 1HO4A 2QUUA 3GE7A 3DN5A 1TTQA 3EKZA 2YL5A 3I7SA 1UJPA 2QCGA 3L68A 3NZPA 4H9VA 3MP3A 1XLDA 1POJA 5D8ZA 1S5WA 3WMLA 4F0SA 4NX5A 7CGTA 1CGXA 4P7LA 3CASA 4IICA 2JALA 3W71A 4KWWA 3TYAA 3MU7A 4R3UA 1ZBVA 4H3DA 4GVGA 4QHRA 3W6YA 2VRKA 4IP4A 3AXHA 3RUBL 2F6XA 1LUCB 4AYSA 5HNTA 4XKYB 2QCNA 1U2YA 3N25A 4ZFCA 2J88A 3KVMA 3MMUA 2OYLA 3AHTA 5KSWA 5HINA 1QPQA 1DXIA 2JIWA 2AAMA 3GKAA 1VHCA 2VCCA 4UMBA 3P8IA 3LPOA 3UWVA 4QCEA 3W72A 2XM2A 4ACYA 4F3HA 3SRKA 1SMAA 3OG3A 4O57A 2CXEA 2O92A 3NJ3A 4MLJA 5D05A 1GW9A 1V5XA 1FHVA 1XPGA 3SGGA 2DVXA 2VX7A 2G96A 3MYPA 2HTMA 1SYTA 3CU2A 1KV8A 1TA3B 4GZJA 1ENUA 3WELA 1X7IA 2H90A 4UTIA 4BK9A 3VZXA 1FXQA 4TX6A 2GK1B 3R7MA 1RQHA 2QKFA 1EP2A 1J8VA 2H9AA 1FCUA 4D6IA 4Q4PA 3ITOA 3GSMA 3AC0A 4WCJA 2Z29A 1IXQA 3H4GA 1ZP4A 1U5HA 1IGWA 4ZR8A 4BEUA 5GNZA 1KGWA 3DGBA 5E0CA 3RX2A 1RD5A 1P0DA 3SR7A 1FFQA 1M5WA 3UZWA 1WBJA 4DBWA 1YYAA 4Q8PA 1JZ7A 5HNUA 5D30A 1EYWA 4NKCA 3HG2A 1B0IA 2VEKA 2GDVA 1YDVA 4IPJA 5LA2A 3S1XA 1E6NA 4K7YA 1ECQA 1TVPA 1UROA 3WQ8A 2HVMA 5HXMA 1AODA 1WBHA 5G2IA 1EBHA 1FCBA 4M81A 3ABOA 4Z17A 4I5RA 2PWEA 1OEPA 4EXQA 4JXCA 1QBBA 1RBAA 5DMNA 1XX1A 2Z2BA 4J3XA 2CZVA 2FTPA 1AQ0A 2GQ3A 4ZQMA 1XBYA 3GYEA 4FF7A 4IHCA 3UBPC 1XP3A 1OIMA 3AIQA 2OO0A 3C2VA 3OP2A 4XD3A 1H1YA 3ARPA 2Z26A 2E8YA 1EX5A 2Z1VA 4CD4A 2IKHA 4XSMA 4MYAA 1VD6A 4PMYA 1JFHA 5FF2A 2VUYA 3NVDA 2VR2A 4GCAA 4M0XA 2D0FA 4RE3A 2W4XA 3B9AA 1R7AA 3TE9A 4KRUA 3CMFA 3V1PA 3OGVA 3IRSA 5M2FX 1L6YA 3N18A 3QM3A 1KTCA 1KW1A 1CIUA 4HU0A 2YCJA 4GO9A 2W9MA 3HV9A 4Y96A 4M6PA 4K37A 1ZAHA 2Y8VA 4CCEA 2YW4A 2OZ8A 4UZSA 1M41A 4W86A 3O05A 3C4UA 1Q4NX 3R89A 3LSCA 4PFHA 5F4XA 4IUGA 3TNBA 3GXPA 1QCWA 1UG6A 3SCQA 5D09A 4I5XA 3N04A 1IIGA 3AO0A 2Y1HA 2QUTA 3LV6A 3JRKA 1NFPA 1DQXA 2QGHA 3PN8A 4ZQCA 5BU9A 3HG5A 1H7PA 4NYUA 2FZNA 1QXLA 3LGGA 2VC7A 1MXDA 5AYBA 4W8AA 1K8CA 2V3GA 4RJEA 1RP9A 3W1MA 4JICA 4GVFA 3FJ4A 1XUUA 4F66A 1XICA 3HQ1A 3E96A 1YE6A 3W7RA 4HVXA 5GQBA 4QAIA 4LALA 2OG9A 1M7PA 1M6JA 2WPBA 4HNOA 5FEZA 3H2MA 4MB3A 1Q45A 3E0VA 1JEZA 1W6TA 4QS5A 1ZNNA 2OWXA 3F5LA 2J13A 1JDAA 4JIPA 4AX6A 4F8XA 5REQB 5KTLA 4XZWA 1XCXA 2E28A 1N7KA 3GXMA 3R8RA 1CGUA 4XBSA 2V8ZA 1JDFA 1RR2A 1N8FA 3UR7A 1RBOB 1KO0A 1Z6KA 3UNTA 1TV2A 1GVRA 4PBEA 1JNEA 3AS0A 1Z7AA 1U1UA 3MJYA 4MAVA 6XIAA 1TA3A 2BGQA 4IFRA 3ARSA 3BG9A 2MUCA 4O1EA 3PJUA 3I65A 1SZNA 2GK1A 1SFTA 4B9ZA 1Q7QA 4IT1A 4E4PA 4HA1A 3PFMA 1EHAA 2P3ZA 1MI3A 3P82A 1YQ2A 3ATYA 1QO2A 1B57A 2C1GA 5HANA 2QDEA 5U4NA 3DHDA 4MOZA 1X6UA 2B7NA 2DIKA 1A80A 4GRSA 4P8XA 1VFTA 3H26A 1WXYA 5BOFA 5FAJA 1MW0A 3K5XA 1PIFA 4QJ3B 2V2CA 2X0SA 2Z00A 3FS2A 4H9TA 2QUVA 5G4HC 3MTWA 2Z1WA 2J7BA 3QHNA 1TJ0A 5JUVA 1AJ2A 2WW5A 4JN7A 3SO7A 4A3UA 4REQB 2NUWA 5IFPA 3ONCA 4BF5A 3UZJA 4MHBA 1O60A 1G9HA 2DGAA 2POZA 4OE7A 4R7JA 4KGLA 1JPHA 1TQXA 4O13A 1K3UA 1VBUA 1YKWA 5D9MA 2OLHA 4AAJA 3PBYA 3UWZA 2XFRA 4EWND 5D2WA 2Y88A 1JZ5A 1RQEA 3H54A 1N8IA 3ANYA 4JFTA 3CB8A 2A7RA 3H2FA 1HGWA 1Q6LA 2E09A 1CLKA 3B3DA 5DELA 3EX3A 2EPLX 1KBBA 3GC4A 2AMXA 4XK2A 1VS1A 1GJPA 3TDFA 2BGSA 1AG1O 3A23A 4US5D 1ML1A 3ZT6A 3H6OA 4FLOA 3UERA 2FPVA 4JFUA 3FHQA 2OGJA 3PANA 1REQB 2PDXA 2WVVA 4A29A 4GABA 1FX6A 3H7UA 4GJIA 1QHOA 4G9PA 2YLAA 3GLCA 1SJDA 3IIZA 4GY7A 4PMZA 5HMDA 4WGHA 3C6CA 4LVBA 2MNRA 1OM0A 3TTYA 4M7TA 1Z42A 1Q6CA 1MQQA 1W1A1 3VDCA 1MDRA 3DI1A 4U2YA 1MUMA 3VKKA 2YXXA 4D6EA 4ECLA 4HSNA 2VMFA 1VFSA 1RLCL 1UWTA 3AMDA 3H7RA 1JD7A 3BV4A 4IIGA 3GW3A 1TV4A 3IJ7A 3K8LA 3H2OA 2P0OA 3JUGA 2Z2AA 4CNNA 3T42A 1P1XA 3RJYA 3ZJ6A 2WHKA 2D0HA 2PD9A 1VH7A 5DRCA 3E2SA 1ZFJA 1GVFA 4A21A 4E4UA 4W7UA 2OYMA 2FVKA 4E3TA 3T9PA 3MW7A 4KWOA 4I3GA 4QGCA 3K8KA 2V6AA 1QDSA 4LC8A 2Y4SA 4Q3MA 1CLVA 5A8QA 4X63A 3WO8A 3WZ0E 1TUFA 3OEXA 4AIBA 1UH4A 4MB1A 2NQZA 2QVNA 2OT0A 2HDJA 2ACQA 1KFJA 4MTVA 1EHNA 2GGHA 1MEIA 1W3TA 5DT5A 1MVYA 4GJJA 1K7XA 2HMCA 1C7TA 3WFLA 1A5UA 3H23A 3IGUA 4O1AA 1KFLA 1RVKA 3VNJA 3MCOA 4DPPA 5REQA 1EO5A 2V67A 4XG1A 3RCYA 3M7SA 3GQYA 5F4SA 3LQLA 1KTNA 2CETA 1OYCA 2X7WA 5FD0A 1BG4A 3LEPA 4XQ6A 3TW9A 3MB9A 1EP3A 3JU2A 4GGBA 1XLAA 1J0HA 2WMIA 5HBFA 4PRTA 3BJSA 3RNDA 3FSTA 2VGFA 3CZ8A 1PYFA 1S38A 1EB3A 3NPWA 3DESA 3WIJA 5DXYA 3AS2A 3BMWA 1TSIA 1PHQA 1TV5A 1JZ2A 1DJHA 2P8CA 4B5WA 3BWWA 4UTWC 2CLMA 1M53A 3LTSA 1NEYA 1UBSA 4RPQA 1I0BA 1GORA 1MZRA 2XZ9A 2X1RA 2V5BA 1DJIA 2ATMA 4NAFB 1R3SA 4A2SA 4TR9A 3FXGA 4CCDA 3ZZ1A 1OB0A 3BMXA 5C9UA 2AQWA 1GHSA 2BY3A 3EKLA 1HGYA 2J7DA 3L67A 1P4CA 4QRNA 5XINA 5D03A 3T81A 4XBJA 1E0WA 2CLIA 1ICPA 1H0GA 2QIIA 5G4EA 3GO2A 3WJYA 5E6YA 3S46A 4WF7A 1S2UA 2VWSA 4Q7BA 1KM1A 1UKQA 3S6OA 4DWSC 1O5KA 1FWGC 2FMNA 4A6GA 4FLRA 4R9OA 3N3MA 1QI3A 4C1LA 3LGEA 2D2JA 4OVXA 1QK2A 2Y5JA 3QY6A 5A6BD 3QZAA 1CEOA 1QW7A 2R1KA 2DY3A 3ARQA 3BLKA 2GJNA 2WCSA 1Y65A 3SDOA 5DY2A 2PGFA 5A6TC 3SRDA 1A0DA 4YXGA 3UZXA 3YPIA 1LRTA 1JF6A 2XHYA 1E6SM 4HNTA 1RPXA 3VZZA 1O1ZA 3DHUA 4MUPA 3FVDA 3KRSA 3D5HA 1QPKA 1EWEA 4JKKA 3W7HA 2PDKA 3WBWA 4Z2JA 5CLTA 4GGHA 3SCPA 4A35A 1R3VA 3C61A 3LLFA 1QK0A 4UQ9A 1D7FA 3OYXA 5CC6A 5TD4A 5DT7A 3URAA 4GXMA 1XH1A 3G1XA 1XKYA 2NXGA 1J12A 5I6SA 3WLMA 2V30A 1FDZA 1S5VA 1ME9A 2ALDA 3QFWA 3TA9A 3H2EA 2XGZA 3TTSA 2V3EA 1KCKA 3B06A 1HFBA 4M80A 2BTMA 5BRBA 1KNWA 1BGAA 1JCXA 3HFYA 2NVAA 2C15A 1IWBA 4E6MA 2NZLA 3BL3A 3QOKA 3RPDA 3A22A 5FF3A 1ZALA 1OFAA 3ZJ7A 5H1WA 1TPEA 2C6QA 3L4XA 1FH8A 3TTQA 3PR2A 4XZMX 1UR1A 1S3TC 5M1TA 2J6VA 4BR1A 3NQMA 3KZSA 2JEPA 5IHRA 1XLBA 2NX1A 4LCSA 5CZ0A 3BGAA 4M1RA 4XAPA 1V0KA 4N9DA 5HATA 3L0GA 4FEZA 2PE4A 1HP4A 1S3HA 2JQXA 3C0SA 1BVZA 1YTDA 1K6AA 1EL3A 3CMJA 4NJIA 2A3AA 5L9FA 2BG5A 2GUBA 3PVFA 2QUNA 3OLDA 3W24A 2WPGA 1UD8A 4H7CA 1R86A 4WJEA 2Z1KA 3GUGA 4FX7A 3RK8A 2CLPA 2XIOA 2WB5A 5CEWA 3TN5A 4LTSA 2WV8A 4YWSA 2R8WA 1UR3M 4DBEA 1PO9A 5EL1A 4QROA 4S3BA 3WQVA 1WDSA 1JUEA 5ABEA 3M41A 5G1TA 3LYEA 3HPZA 3F4DA 2CNCA 2XIQA 6PTDA 5DCEA 4J7RA 1G94A 1FWRA 5CG7A 3DC8A 3FN9A 1UOZA 1TPFA 2OCZA 3EWXA 3WNOA 1F8IA 4R88A 3MVIA 1TX2A 3CQJA 1W37A 3TX9A 1KM6A 4Q4MA 2WSQA 2WNNA 1UWRA 1J6PA 5I77A 5DF0A 2X2GA 3MP4A 1QHZA 2XJ7A 1HF6A 3L21A 3OGRA 1FWWA 3AWNA 4TU1A 4F2BA 5LGZA 3B03A 3W7NA 1LG2A 2OWWA 3GVVA 1OC7A 2YDSA 1UBPC 2YYUA 1BHGA 2QS8A 1XLHA 2R24A 2AKMA 1LROA 2XSBA 1H1NA 2NQHA 2V82A 4BQ4A 4HHHA 4YS1A 3CL8A 3HM7A 4YVVA 2HBXA 3CAQA 5HMFA 4P7NA 2YL9A 4KQNA 2VEPA 3WDHA 2NXHA 4HHLA 3SUTA 3GYCA 4HYRA 1JPMA 3DC0A 4YTSA 4AEOA 3CQ0A 4EPKA 1EJRC 2ICSA 2GUYA 2WCAA 1SSDA 2Q8LA 2VDIA 1EJVC 1UIPA 3WLSA 4EANA 4Y6GA 3OO2A 2ZIDA 1DJQA 4N2YA 1H49A 3H4WA 1XH2A 2EPOA 2ZC8A 1NELA 3H7VA 1WAWA 4CQBA 3HGSA 3S1GA 3W2JA 2NUYA 7ODCA 4L7ZA 2CBVA 4AB4A 2Y0FA 4GUIA 1AW5A 1KC7A 3TNOA 1V93A 3V1HA 4CD6A 1OT1A 3KBMA 1FHUA 1NDYA 1WZKA 2ZRXA 1Q6GA 3DUGA 3MCNA 3VKCA 4DWSD 3LHUA 2G3IA 2FQIA 3BK0A 4J2MA 2NXIA 2PAJA 4MZ8A 1I45A 4LS1A 1WDRA 1BKSA 4PR4A 1KWKA 1OFPA 4B5TA 4PN2A 4HSHA 1QOPA 3TAKA 2RDUA 2R82A 3NQDA 2PODA 3OJGA 4LS2A 3VOHA 3PJXA 3SIZA 3GTIA 3GDRA 2YA1A 1DJXA 1JI2A 4DIAA 3EBVA 3LHTA 2YKKA 5K4XA 3IVUA 4Y9OA 1FP9A 3GB6A 3I4EA 4JNZA 4PCPA 2SFPA 1A5LC 1OWQA 4JFWA 3ARXA 3Q4DA 2D22A 1UA3A 2XTKA 1J10A 2DQXA 3BOXA 4IWWA 4YPJA 4MWAC 2E68A 4J35A 1H41A 1NTHA 1KV5A 4DUOA 1K70A 3W86A 2ZX9A 1B3ZA 1GZ1A 1XIDA 3H55A 1K02A 5F2GA 2PWUA 4B9YA 4EK7A 5BXPA 4K1WA 3NEVA 4GOAA 3PNUA 4FS9A 3SECA 1ISYA 1NDZA 4CEXC 1R3QA 2WJZA 4LF1A 4TX8A 4ICMA 2L5HA 2Z25A 4NZCA 4XTDA 4GWEA 1MRQA 4BI6A 4IX2A 1RCQA 1DIKA 1V79A 4F9DA 1AD4A 3KRUA 4LPCA 1EF2A 4GJ1A 1D3CA 3B8VA 1IZKA 5KETA 1VFUA 1UKSA 1W2VA 4ZOAA 4D2JA 1D3HA 3E12A 1XC6A 3CM4A 3UR8A 3U8GA 4DPQA 3CPRA 5LXXA 4IXXA 4KGJA 1AJ0A 3IEBA 1PTAA 2O4QA 3CO4A 3FA3A 1V02E 1TMHA 1V6YA 2GQAA 1UH2A 4IFOA 2C79A 3LERA 1YIXA 1OVDA 3C5QA 3ZSSA 2I14A 3AIRA 1Q2RA 1US3A 3BLLA 5HPOA 3FA5A 3A9IA 2XN2A 1J2WA 2O4MA 1ZTVA 4LX4A 3S1VA 1FWIC 3TW7A 4Z1AA 1UZHA 3LCGA 3N1AA 3B8UA 3TC3A 2QMJA 3QPYA 1CWYA 3BV7A 1T6MA 4GIAA 1GJUA 2DSZA 2QF7A 3PBUA 1VC4A 4PC8A 3LCFA 4M6VA 1E5JA 3KRZA 5CSSA 3E9AA 3OBEA 4ZODA 3WLTA 2F2KA 4DJEA 4KETA 3EDKA 3QY7A 4NI8A 1LCOA 2FJUB 1PZ2A 3AZRA 2ZX8A 4H83A 1JVNA 2XINA 3FNDA 4O11A 3KL0A 3QH2A 1L8PA 3CUGA 4GH1A 2V3FA 3CWOX 4FR6A 3M5VA 4BHYA 3V5OA 3O6DA 1IXNA 2DZPA 4UR9A 3V5FA 5TBOA 2YIHA 4PE8A 2J9YA 4GUJA 3SJNA 1TZ7A 3P60A 4Z1CA 4KFPA 1GVSA 1ZS2A 5BXSA 1J0JA 3WDPP 1RAKA 3WUBA 3OBKA 3KWXA 3EEGA 1OK4A 5KINA 1PSCA 2ZX5A 3CPUA 3CHFA 1XDJA 2FB2A 2X8RA 1W5MA 4E2VA 1F73A 4AZ7A 4DLFA 2WXDM 3WQWA 1K6WA 1M1BA 3VDBA 1CXLA 2CKSA 3Q2DA 1TE1A 1VLIA 3RLGA 1RLDA 1Q85A 2F6KA 2G50A 4D1JA 3S5SA 2D3NA 3SCUA 3FIGA 1A5MC 4L4OA 4LRSA 4TV6A 2AL2A 5TQLA 3ZVHB 5G1MA 3PBVA 3W07A 1BTMA 1KB3A 4D8LA 4DZAA 4Z1DA 1XYCA 3WEZA 3O06A 1Z44A 4GQGA 1FY6A 4X2RA 4CQ8A 1IT8A 2WMJA 1O94A 3VIHA 2D20A 1LORA 1UZDA 2CITA 4PMRA 3W6LA 1K7FA 3M0LA 4U5KA 3QF0A 3QN3A 4CLMA 1BSIA 4GNKB 4O0KA 5CJMA 4F0RA 3PWGA 3F2DA 3T4WA 4WXYA 2BASA 3VC5A 1VYRA 3G1HA 2J78A 4MWAD 3UU0A 1JCYA 4XV0A 4WIWA 4D6HA 1CXHA 5E93A 1NOWA 1F3XA 1XFCA 2I56A 3C0JA 2QVHA 2ZZ2A 1OYBA 4L4PA 2PF8A 3B0XA 2PDHA 1RPKA 2RAGA 3F4WA 2OSYA 5CC7A 3WBXA 3CBWA 4DJFA 2ZYFA 2ZRZA 2GJRA 2WSYA 2QLYA 1X6LA 4EF9A 3CAKA 2YOCA 4JS3A 2JKEA 1G6CA 4GD0A 2WQPA 1NARA 3OIHA 2ZOXA 2XVLA 2Z1BA 4KWSA 3AXMA 4BCEA 2PZNA 4WDWA 4EPDC 2X05A 2VX5A 4XVDA 1W3HA 2UBPC 3QKZA 1TJPA 3EWYA 3LV5A 3A12A 3RU6A 2RJGA 3K4DA 2FFIA 3S9ZA 2EBNA 3R10A 3EEZA 3G1RA 4I7WA 1F8MA 3I6EA 4H7VA 1A47A 1PKMA 1L6WA 4UFLA 4GI4A 2XGIA 4TOQA 4G2DA 2UV8G 2DU2A 3L5MA 2VGIA 4QNWA 1SVDA 3KP0A 4K2SA 3TXVA 1KTBA 2TPSA 1TRIA 5J8LA 1GJWA 3CH9A 5I3JA 2ZRWA 1MW1A 1GOQA 5EMLA 5FJIA 4AVNA 2ZUWA 4ML4A 1SZRA 4PA8A 1MWOA 1TIMA 4NJGA 3TOYA 3FEMA 2DUXA 4UCFA 1MDLA 1XF0A 2P3EA 4P2VA 1IGSA 2YDRA 1BF2A 1J79A 2B7PA 3PZVA 3AJXA 3WF3A 5FOOA 3W7PA 1WCGA 5AHEA 2VDGA 3G0XA 3MQTA 3EDDA 4TIMA 4AW7A 4NUWA 4WDTA 1T8QA 4HPGA 1W9VA 3CWNA 2RDWA 1TCMA 2NQ5A 3R94A 2QGYA 3N2OA 2VEMA 3SN4A 1VPYA 5DRIA 1W54A 1J5TA 1UQYA 4Y9MA 1W3IA 3AIUA 2FZMA 3LZ3A 3R58A 4TVUA 1HNYA 1XD0A 2YCIX 2WKLA 3VOCA 1LTDA 1E9YB 4DYEA 3FYYA 1J01A 3T0BA 1OSEA 2C0AA 4F2UA 1HJUA 5J5DA 1AQHA 5DCDA 4CCZA 4GKTA 5AZ1A 2YGYA 3MSRA 5A6LA 1NH6A 1A5CA 1J0KA 4BF7A 4KEUA 1UCWA 1A5BA 1BFNA 3ZQ9A 2IXUA 2CLHA 2PRMA 1UMLA 1K4GA 4O1DA 4CNOA 4MB5A 5M5DA 4HK6A 5KZMA 3B4UA 3LI1A 3WNKA 3G1SA 3W1PA 4OECA 4DB7A 3CUZA 3ZVHA 1W8SA 1KA9F 4HU8A 5ABFB 5C7HA 4N6EA 2GGEA 5HULA 3WLOA 4WY0F 3QOMA 1OHLA 4C1NB 2D3LA 4IMGA 4GZEA 1VKFA 1EBGA 2NSXA 1LWHA 1TUXA 2HPMA 4PTMA 1S46A 2W61A 1U22A 4YU1A 1EDQA 1K03A 3OLIA 1OF6A 3V3WA 5A1AA 3LN3A 3Q45A 5D37A 5AHIA 3TZFA 1W1IE 5HQEA 4L9XA 4G6CA 1GWJA 1ISVA 4H8UA 4J28A 5H2ZA 1YNYA 5AC7A 5BXRA 5A2AA 1ISXA 4OBTA 2Y5EA 3CPGA 4Q6XA 2Z1XA 4RCXA 4LEQA 4HJFA 3W81A 3APGA 1AW1A 3LXBA 1R3RA 4C1KA 1K8YA 3N6HA 3RYSA 3MI2A 5CPOA 2Q8ZA 3W88A 2WWDA 4QFUA 2ZA2A 4MKNA 3T2PA 1MUWA 1UWSA 1VZWA 3AIWA 1E15A 1P6BA 4TVCA 3COTA 3G6MA 3L5AA 4B92A 2XDFA 1TPUA 3T1GA 4IPLA 4H2CA 1IEWA 3QTGA 1Z41A 3BLIA 2FPYA 2XG9A 5LHFA 3S6DA 4J40A 2PWDA 5I24A 2IQTA 1Q13A 1CI1A 4M1BA 3G1YA 5KEZA 3RO8A 4AEEA 2O9RA 1XLGA 4GYKA 5DCBA 3W7IA 1R2SA 1R6WA 2E3ZA 3B40A 4GIRA 4AIEA 4QNEA 3MYOA 2VR5A 2G0WA 3ABXA 4NYYA 5HQLA 4Y8EA 2D69A 2YXOA 1I2QA 3RLVA 1ZAIA 4YHEA 3P14A 3INPA 1UR9A 4KT2A 1HXJA 4HPJA 3SRHA 3U48A 2WC4A 2XGBA 4FOUA 1ICSA 1PZ1A 1XW8A 3VZYA 1Z89A 4QJ5B 4EACA 3TR9A 2QDDA 2CHNA 3IUDA 5I3IA 3GNRA 4GACA 1RY0A 1K7EA 2CZ5A 2KZHA 4JAWA 4I8DA 3W87A 4F4RA 2DEPA 2X16A 1QATA 2VFIA 1GPWA 1LL7A 3NQ8A 1E0TA 4XZ9A 1KFKA 2OU4A 3S1WA 1PIIA 4Y9NA 3KXQA 4RX0A 3UVAA 3WFAA 3VABA 1DTNA 4RZBA 1R47A 2PDLA 4FLQA 4GY0A 3WFZA 4JX5A 4AWUA 2QT3A 1AVAA 2B31A 5AC4A 3PG9A 3GD6A 2VDHA 4QTGA 4LYKA 5LKYA 3L4YA 3TYEA 3AXIA 3VDHA 2A2IA 4K3ZA 1JDEA 4ICCX 3PZGA 3VMNA 4CKQA 4MY1A 4D72A 4RW5A 4YWIA 2Z6IA 5EFFA 4LGXA 4DHGA 4GYJA 4RZ5A 4D9PA 3HQPA 3PC0A 4IMAA 3A13A 2VFEA 5I3DA 1Z32X 3F03K 3S9IA 2FDSA 1A4LA 3IUHA 4P7OA 5ABFA 3IGSA 3MSDA 4PH6A 1DQWA 5AC6A 1FH9A 4Q4RA 4C1NA 4Q4SA 2OKTA 5H6HA 1GYLA 4BF9A 2XVNA 2FVMA 4F40A 3M5XA 1VYPX 2VJXA 3UETA 7XIMA 3UJEA 5C2CA 3WH8A 2I9EA 2QJGA 1DXFA 2BY1A 3O15A 3UG4A 3IGHX 5RUBA 3NOYA 1QOXA 3A4WA 3TMQA 1JD9A 1MXSA 3OODA 2BS9A 3EKGA 3NEHA 3ICJA 4ZO7A 3N14A 3LUTA 2GFTA 2JKAA 4US5A 1TX0A 5MHBA 4BI5A 4HT3A 4WOQA 4KRTA 1FA2A 4OHQA 2QJJA 5HWNA 3FGCA 2A21A 1KBKA 2VCAA 1H61A 2NQJA 2E67A 1KCLA 3OIXA 7PTDA 3SCVA 1JPIA 3CUIA 1VBHA 3LM3A 1PUDA 1RVGA 4NT0A 1I2OA 2BXYA 5M17A 1UD6A 3VTRA 4ZQRA 1V3HA 4LUSA 4PZVA 3W22A 5I7GA 3M5YA 3NDOA 5I3FA 4GO8A 1IF2A 2HXTA 2AL1A 3TC7A 2ABAA 3GNOA 2DW7A 4PCNA 3S8HA 1WDQA 3W28A 3XINA 4IGMA 3HG4A 3GG7A 4MNKA 4PMXA 4WDUA 1J18A 4UWMA 4GISA 2E25A 2XVKA 2ZZ7A 5B7ZA 5HR6A 4KW2A 4AHQA 4G56A 4AH7A 2VT0A 3PJTA 3N4AA 2J8FA 3ELFA 5GJPA 1CXKA 2DIJA 2PURA 3W1QA 4KF1A 1J96A 2PDNA 2CXGA 1C8XA 3LCLA 3GU9A 4ATDA 5FEWA 2E5DA 3WDQA 2BOFX 1W5NA 4V2XA 1H7WA 2EG7A 2NT1A 1Q7ZA 2PGWA 4JX6A 4Z2IA 3W7KA 1L2UA 1Q6DA 4MM1A 4C6OA 3L4WA 1TPB1 1UWIA 4S2BA 1WKFA 3M0JA 4PUJA 1ZBWA 1E1CA 3TROA 1KRAC 2OYKA 1AJZA 4ZB2A 3IGXA 3CIVA 4DNHA 4IQLA 1J4EA 2VXNA 3HMJG 5EBAA 4QQ3A 3BAWA 3TCEA 1IHIA 4PEKA 3GXTA 3WY1A 4BQ2A 3IJ6A 4ZL1A 4PSPA 4PRWA 1H63A 5TF0A 3HQOA 3W01A 4NXSA 2OWCA 5K9CA 5HNRA 2FGLA 4BQ3A 1D8WA 3LMYA 3EX1A 4MJ4A 4K36A 4C91A 1OK6A 4MLRA 3HV8A 4O16A 1B54A 3CK5A 3WLJA 2OJPA 4U5IA 2A3CA 1DKWA 2A3HA 3ORWA 1GEQA 3CC1A 5LGXA 2HZGA 3OYZA 4IIBA 5DQPA 1E0XA 3T40A 1RCOB 3TAOA 3IAPA 5I2UA 3KUMA 2YXGA 1O5RA 1NP0A 4PTDA 1C91A 4ACZB 4U2ZA 4ZXLA 3L9CA 2QPXA 2X2YA 2FJKA 2VGGA 3GBDA 4M8UA 1F9CA 4O50A 4WK9A 5KITA 4Q7NA 2DZBA 4WJXA 1LBFA 6ENLA 3GVRA 3VKAA 1EX1A 4KCWA 3IVSA 1PBGA 4RE0A 5G4WA 3G2GA 5A6BA 3U7VA 4CCCA 2PDYA 4JTDA 5CPMA 3VM7A 2E9BA 3UXLA 2DJXA 3B9DA 3CS2A 3BOLA 1P7TA 2I57A 4R5EA 3FFSA 5AY7A 2F38A 2G4JA 1I75A 4GCXA 3MPGA 4L1GA 5AYYA 7TIMA 2CWNA 4TV5A 2YW3A 3CUFA 3SB0A 1WPCA 1TB3A 4MUZA 3GC5A 3N11A 4F0HA 4AFYA 3P5YA 4DWSB 2C1HA 3NCOA 4JL2A 3W7OA 3AYSA 1DP0A 5CGTA 2J66A 4TMCA 4J3ZA 4WJ8A 4L4LA 3GU2A 1R87A 1FRBA 4L9YA 4QR6A 3CT7A 1S2AA 4TVDA 1XLMA 3GC2A 4LRTA 4QS6A 2WJEA 4G5DA 4UMCA 3NZRA 4Z1BA 3N9RA 1N55A 1LYXA 4ZENA 1U1HA 2PDCA 4LB4A 3WJSA 4H9YA 3UWEA 2C19A 2G37A 4RKAA 1XI3A 4QLKA 4R85A 4H9ZA 1TR9A 3RIKA 1TVNA 4ZFMA 3WLQA 1LG1A 3N12A 5A6JA 2ZE0A 3NZGA 5FKYA 4NNBA 2XPKA 3M4HA 1NFGA 2RDXA 3TJIA 2Q6ZA 4HNUA 1F6KA 1I0DA 4IJBA 2Y24A 4M82A 3L0KA 5D02A 3RM8A 4HCHA 2VRQA 4O53A 3WF4A 4OOZA 3IV3A 1XDMA 3P62A 3P84A 1SFJA 2NQLA 1IT7A 4OTKA 3AU2A 3F2CA 4WKHA 5G2WA 4ZTYA 1UYQA 3IPWA 2WANA 2E7FA 1PKNA 3N2MA 3GG1A 3HPFA 3NURA 2NV9A 4OU1A 2OO6A 4HA4A 1A3XA 1FWJC 4WOZA 3T07A 1TTJA 4RV8A 1LQ2A 5GJMA 4IGSA 3ARVA 3O1NA 1AH0A 4XB3A 3KS6A 3VGGA 3PAOA 3SN0A 1I8JA 4NX0A 4FXFA 3IAQA 2C14A 4YTQA 2PGEA 3PZNA 1XIMA 1A5SA 2BOGX 2DDXA 2DSUA 1H09A 3LRMA 3WQPA 4CQAA 3W37A 1UW9A 3AJ7A 2GJXB 4FNPA 4DJEC 5BZAA 5TNVA 1SO6A 3BW3A 4XUYA 3K8MA 2X1UA 3LBMA 2ZX7A 4S3KA 3R79A 4US6A 2VZUA 2YBTA 3CLMA 5CCZA 2J47A 1W3JA 4AWTA 3B0VC 3LX9A 1WDWA 1B3XA 1Q8JA 2GL5A 4AXNA 1E0VA 1OX5A 5BU6A 4BA0A 1VQTA 4EIVA 3FJ6A 1AH3A 2CFFA 4RNHA 3G1DA 3C86A 1B4EA 1HL9A 2PDFA 3SZ8A 1VEOA 3VD3A 1BTCA 2V2DA 1XBVA 3LG3A 3I6TA 1AFSA 1EWDA 3DG3A 3LPPA 4C6KA 2WJDA 4UUIA 4OV4A 4HNNA 4IXHA 2VD8A 2OELA 4HZ6A 3EDJA 3QR3A 2V68A 1GVOA 2WVSA 1G0CA 4MJMA 4B90A 4BJHA 3L12A 2JKPA 4W8LA 3VIOA 3TYUA 1C29A 3RMEA 2WNWA 1VCVA 3UPWA 3A3WA 3HJEA 3VX0A 3KW3A 2QW5A 3A9BA 4IL2A 1BYCA 1XSIA 1ISWA 4Q8MA 3S5YA 4UTFA 1B3WA 1AW2A 1UZ4A 4UR8A 1S5MA 5IFTA 3MV11 3HTWA 1JYNA 1H50A 1QBAA 3KBJA 1I9CB 4UTTC 4HB7A 3ZR4A 1W5OA 4OGZA 4I5UA 1PWMA 5CZJA 5JIPA 1JAEA 4GYPA 4OJYA 3FK4A 6XIMA 5EBUA 3DERA 3U4AA 4AZCB 5FF7A 5FEXA 3D6NA 3WQGA 3OQEA 1QNQA 2OFJA 1K4HA 1VIZA 1SUXA 4IP5A 4B5XA 3S2LA 4LAZA 3RX4A 4MJZA 4P7RA 3JVAA 4RW3A 2XISA 4MNLA 2R9RA 3W7DA 3LHZA 3NWRA 3WNLA 4AVFA 3A3HA 4PSRA 1W9XA 3MBDA 2C8NA 1ODZA 4HA0A 3P61A 1NOFA 1QNSA 3PAJA 2FKPA 1E70M 3ES7A 1O5QA 5IDIA 1XLLA 3L4TA 6REQA 1XIHA 2OZ0A 1WKYA 1LRNA 1XYLA 3AMCA 3H21A 4GE8A 2VP8A 4JKMA 5FESA 3LPFA 3L23A 3VOIA 4BY3A 3FA4A 1G4TA 4UTMA 4F79A 4JNYA 2NLYA 3WN6A 3ZT7A 4NNAA 3HBLA 2Z24A 4GHRA 3E74A 3QLLA 4Q8WA 4K7VA 4E2OA 4EOUA 3MKCA 3WH6A 3DDMA 1UUQA 2YA2A 2KAUC 4DJFC 1XQKA 2VC6A 3TC6A 1MNZA 2WCGA 3WUFA 2VOMA 1P6WA 4O1BA 1CXIA 2YBVA 4Z0JA 2WK2A 3RLHA 1AA1B 5JU6A 4LBSA 5H8UA 3HN3A 1ZLPA 2ACUA 2CC0A 2YCEA 4JYEA 1GK8A 4QDWA 1OCJA 3IJIA 2Q71A 3NL6A 2G3FA 2FZDA 4FB7A 4O0QA 1TWWA 4MWAB 2GJXA 1OD0A 1EA0A 1E55A 1Y7VA 4M24A 4UFMA 1ITCA 4CVUA 1SM9A 1FWDC 4ZO8A 5ABTA 3AROA 4HNCA 1S5TA 3AIEA 1NY1A 5E09A 2CZFA 3UPBA 2ZUMA 4YLWA 3KM8A 2DT3A 1RP8A 3B05A 1ONWA 3W70A 1H3GA 3KVLA 4ZBCA 1GW1A 3P2VA 4C6CA 3BDKA 2OTDA 1TIWA 1AZ1A 3N13A 1UKOA 3DI0A 2CERA 1E9IA 3C2RA 1GQKA 3VMOA 1AQMA 5GNYA 5D9PA 1QWGA 3A3XA 1H5YA 2BWGA 1DBTA 2VVSA 4DJED 2PRHA 5LNRA 2YSWA 1CTNA 4W87A 3PZUA 5G1YA 3KHDA 2RUSA 1C8YA 1BKHA 4PTXA 4DBDA 4MDOA 2DT1A 4AD2A 2XU2A 1YNPA 3NNTA 4O28A 4V1XA 2H3BA 3QVQA 4J3UA 3ZXWA 2I5QA 1HTIA 4JQ1A 1P0BA 2QDHA 3EB2A 2PPGA 4BFAA 4DYJA 3IWPA 2G8ZA 1XUZA 4XAFA 4KIEA 1XL9A 2Q3RA 4L4MA 2J7HA 5MF5A 1S1RA 2ZFAA 5CSRA 2X7VA 1OX4A 1VJZA 1SJAA 3MKKA 3TQVA 4CD8A 1ZU8A 5JVLA 3PFRA 3K1GA 3CYVA 2WBGA 3GIPA 1R0MA 4OWGA 4GBUA 1W32A 4UQCA 1XYFA 4C6NA 4AD0A 4UTJA 2TRSA 3APYA 1QFEA 3CHCA 3F5JA 4J3WA 1W1ZA 4U3AA 1RJQA 4AQLA 3LXCA 4N9CA 3N9SA 3HPXA 3W2NA 3DKLA 3QYSA 4IGNA 4HQVA 1TRDA 3KAOA 1KCXA 2UY5A 2XFYA 4AZBA 3RM4A 1TV3A 3NSNA 5JH1A 3H8AA 3L7RA 4I9MA 5KZEA 3MJMA 4NF7A 4K39A 3BOFA 4R33A 5B7YA 2DZVA 3PBGA 3KRBA 2W3ZA 1B31A 2VFDA 3EA3A 1OD8A 2P8BA 3M64A 4NZFA 3IJDA 4IH3A 4JTKA 3IARA 4FAMA 3GH5A 5LA1A 4DN1A 1X39A 4F0KA 2VCBA 4B2DA 1W1PA 2KX9A 1TG7A 2PI6A 3UF9A 2YCLA 2PU0A 2QYGA 1ZJBA 3PTQA 2GPTA 3GWQA 3PM6A 2G97A 3XISA 4W84A 4L5ZA 3I3DA 2Y7EA 1IZCA 3UJFA 1AMKA 1US0A 5BNKA 1WDPA 5I5RA 3LB0A 3WLNA 1X1NA 1RJRA 2CIPA 2J7GA 3STPA 4WVXA 4QSHA 2HQAA 4GA8A 3W83A 1JXJA 3SUWA 1KBIA 4GQRA 2OZ3A 3W7QA 3QSRA 3NQBA 1TQJA 1SPQA 2QAPA 3KDNA 4JTHA 3RMJA 1VF8A 3UWYA 1X38A 1E1EA 4CU7A 2CW6A 1ZQ5A 1XYBA 4JHOA 3QV9A 1XLEA 5A95A 4UCGA 4F0MA 1Q6OA 4FNUA 3QXBA 2B7OA 4JTSA 4MF4A 1W9DM 3MO4A 3W7EA 1JFXA 4MADA 4EX4A 2G41A 2QXWA 3M1ZA 3NFUA 3SQLA 3BLEA 5F7UA 4IG2A 2QJMA 2WNQA 3KCLA 4H6EA 2QMKA 2X1IA 1NFBA 4GUGA 4DZ5A 4DJFD 1G4EA 2VQTA 1A3WA 1EC8A 3KTXA 2VL4A 3VCRA 4ZQNA 4NSBA 2P50A 3VD7A 4QLJA 3EMCA 3R13A 2ALRA 3BAXA 3SY8A 1S2CA 3AI0A 1RH9A 1R9YA 2ZUTA 1H4PA 1LOSA 3AZTA 2EXOA 3THAA 2WO5A 1DWHM 1PCWA 2V5JA 5CPNA 2F61A 1DQUA 1HUVA 5G5IA 1YE4A 4GNVA 2PCQA 1EGZA 2HK1A 2BMBA 3EDFA 2PBOA 4JIHA 4JOMA 3VGFA 3OQ8A 1MQPA 1PS9A 1UUMA 5IXEA 4UC5A 4O18A 4QQUA 3RO6A 5FJPA 5H8PA 2VELA 3DFSA 2Z2UA 5CPTA 1E9ZB 3MHFA 1X97A 2WMGA 4DM2A 3CT2A 4GVIA 3ZJ8A 3NQAA 2OLAA 2V5DA 3M0XA 4XD4A 2IW0A 4B91A 4C90A 4DO4A 4XZLX 1QHPA 1GVIA 3SEPA 4WLCA 3UD6A 4C6IA 1TWDA 3EZ4A 4AU0A 2UY2A 1QW8A 4BEQA 1VFMA 1V6XA 3KTSA 3P0XA 4AXKA 2CLEA 1J0ZA 3PUGA 1YXYA 4HMEA 4LH8A 1R85A 1JZ6A 1Q6EA 1B3OA 3S5OA 3WNPA 2VUNA 5AOUA 3WD2A 2YX0A 4IX0A 5DMYA 1YPFA 1YADA 4W88A 3MV01 4S2CA 4Q8TA 3IJ9A 4EF8A 3TQKA 4KS0A 3EWUA 3PPCA 1RD6A 1LT7A 4D6DA 4FPSA 2BX7A 3QJAA 1MW2A 4R53A 3G8EA 3NVTA 3NQ2A 3QPEA 1AUSL 2J9XA 3FDKA 5DANA 1JQVA 1TR1A 2FTYA 1OF8A 5C71A 2AAAA 1BPLB 2WM0A 4XZIA 5KZDA 1C3FA 3POCA 2INEA 3QC0A 1J93A 4CQDA 1GQIA 1X8CA 3GY1A 3RHGA 3E0WA 1XISA 3NXLA 5LIWX 1XCFA 4O8AA 4CQ9A 4ERIA 4QJ4B 3RAOA 1EPXA 5MKGA 3P67A 4B3KA 2OX4A 4R9XA 1R7OA 3SCRA 1OG0A 1CGVA 4N4QA 1E6RA 4J3TA 1C93A 3DG7A 3IK4A 1WXJA 3HIJA 3VNDA 3FY1A 6CGTA 3CV6A 4GIYA 4C6PA 5C7VA 1JG9A 4DNMA 1NWRA 4UNLA 3QTPA 1X96A 4JEQA 3D46A 1Q6FA 1YEYA 2DSWA 3KOYA 5CAHA 2WVVB 3S42A 2D0GA 2R91A 5E9AA 4H4IA 3S2NA 1K77A 1KM0A 2Y6ZA 4HZ8A 3AIBA 2V9DA 4XZHA 3ZOAA 3EWBX 5AVNA 1BWVA 1HZYA 4B5VA 4GUHA 1JZ4A 2VOTA 2WKJA 4AZ6A 5A69A 2DZUA 4JBRA 4LUJA 2PLKA 5H8MA 3P74A 3WH7A 2WJFA 1V03A 2CBJA 2E40A 4M3PA 4J3SA 1EJ7L 4DX3A 2V81A 4EKJA 2C16A 1I60A 2IKGA 1Q6RA 1CENA 3UNDA 1JUKA 1QVBA 3MMWA 3NYZA 1OC5A 2WYSA 3WYZA 2CWXA 5EMJA 3RGTA 2RFGA 1SO4A 2YR1A 4XD5A 5D8WA 2W91A 2OZTA 4E8CA 3BSGA 2WZTA 3LCIA 5A6KA 4LWWA 3WK2A 4QDMA 3O3RA 3WDIA 1RK6A 4S3EA 3TFXA 3TJ4A 3V36A 4MGGA 4ERAA 5E6ZA 4NY2A 3MT1A 3MVTA 1N82A 3KBSA 3QV6A 5AZ0A 5JMUA 2VZVA 3JR2A 5BXTA 2E1WA 7ENLA 4HK5A 1K8XA 1OFRA 3VPLA 2PDIA 3KCOA 1VIWA 2NWRA 3QR1A 1QNVA 1GKRA 2XFFA 1WQ5A 2WMIB 1UKTA 3KOWA 3UT0A 2XH4A 4C6BA 4LANA 3U2CA 2WSPA 2OODA 1XC4A 4IOTA 2J7FA 4GIEA 1O12A 1SSGA 1VPXA 4KIRA 1TPVA 3T55A 4D6GA 2WZEA 3FEQA 5CKSA 1O5XA 3LENA 1XSJA 3FCPA 3TTOA 1HX0A 1NVMA 5CBIA 2OSWA 4C6EA 3PZQA 2DH3A 4PEEA 3WK0A 4DRSA 1J9YA 4AISA 3SAZA 1IEXA 1MRAA 7TAAA 4HZ7A 2R14A 4K8EA 1IYXA 4C6QA 2OOFA 1TWSA 3A4XA 2QJHA 5CLWA 5IBXA 3NGFA 3IIXA 1EDTA 3BW4A 1K9TA 1R5YA 2FYMA 4MNMA 5E70A 1FWNA 1KKOA 4J5NA 3LPGA 5D4YA 1LWJA 1XIBA 2C7FA 1VEMA 5D2YA 3O63A 2V5CA 3U6WA 4LY8A 2EKCA 4EWJA 3NZ1A 1SZFA 3TCSA 3WH9A 1J0YA 4RUBA 4ENLA 1E73M 3WK1A 3R8HA 3W82A 2OEKA 3VDAA 3G1VA 1XINA 4ADTA 3B4YA 5AHFA 3TA6A 2PC8A 5FA5A 3OVQA 1KQYA 1A0EA 5IDZA 2OKOA 1BGGA 4LCRA 4DI9A 2GSHA 2JE8A 3F5KA 3VINA 4AY7A 2PP3A 1LOLA 4NJKA 3WLKX 1UP2A 3TSBA 4H8NA 4M7SA 3V0UA 2OEJA 4RZ6A 3LNPA 2ZBTA 3AZSA 3VKJA 3V5CA 2F7FA 4X0NA 1S5NA 1LM1A 2W6RA 3E1F1 3VIFA 2Y8UA 1MFVA 2DT2A 4W4QA 1I4NA 1T8XA 4W7WA 4O1FA 2G3JA 2WWCA 3WEMA 1TELA 4F0LA 4LW7A 2OT1A 3SN1A 1KRCC 4JDBA 2HXUA 3T2QA 3M7WA 4HCLA 3AYVA 4TMBA 2E4TA 3W1UA 1QO5A 1UR8A 4UFIA 1LT8A 2ASHA 4AZGA 1V7AA 3WBEA 4IPPA 4J9JA 3PS7A 1V6VA 1JDDA 3BZGA 3BLOA 3KE0A 1PL9A 3GXIA 3NM1A 3AMLA 4I90A 4EAYA 4WHBA 1E6ZA 3GZ3A 1G1YA 3NYDA 4DYKA 3BAYA 1AL8A 1FUYA 4UFKA 3NZQA 3UQNA 2ZDRA 3CNYA 2WZIA 4QM1A 4IP7A 4DXXA 3S83A 2DSVA 3AQUA 1QUMA 4CU8A 2V5KA 1FHLA 1BWKA 1R2TA 5LNUA 2ZUNA 3QMRA 1U5JA 2JFEX 1PE1A 2P0IA 4QLLA 1RA5A 3THQA 2NUXA 3W2MA 3W53A 2YLLA 2OB3A 1KGUA 5EA9A 4GNJA 1EGVA 4X3ZA 4GLEA 3K2GA 5CC3A 2R1MA 2DZAA 2ZXAA 1EH9A 2BODX 4LB3A 4PCFA 1XRSA 4ROQA 4JY9A 3R0UA 1EGMA 3EWCA 1SZEA 3PB0A 1DE6A 3ITVA 3NSMA 4QG9A 2NVCA 4WKFA 2OSXA 4M56A 3VD5A 3VOGA 4AF0B 1K9FA 3FLUA 1GZGA 3POHA 1WKEA 5A6MA 4X60A 1L6FA 1TJ2A 2I5GA 5IHSA 5CG0A 4NU7A 1OX6A 3UA3A 2VWTA 4KWUA 4UOZA 2ONEA 4DEFA 4B4FA 3S2MA 5EMKA 1HP5A 5HPCA 4MNJA 4TTGA 2FFCA 2IPWA 1KQZA 4CU6A 3WJXA 1TWIA 4R27A 1Y0EA 1ME7A 4FMVA 4A3RA 2DZWA 5I3GA 5FJJA 5CBJA 1FWTA 4NL1A 3NR0A 1NQKA 3CZLA 1VFFA 4R34A 2J6XA 4MWAE 1E40A 4KCTA 4WY0B 1L6SA 3DZ1A 4JNMA 1QMLA 4FO4A 1FH7A 1V0LA 1JYWA 4ZMGA 1R3TA 4NAEB 5BOOA 2DT0A 3W7CA 3OG2A 3UCCA 2PP1A 3OVGA 4Q8NA 1EJTC 1R3WA 4KCUA 1BEUA 4IMEA 1V3LA 1EIBA 1UQZA 3IIOA 5J04A 1Q4WA 4NVTA 2BHYA 5FJUA 5ECVA 1EEPA 3V7PA 3H2AA 4DF2A 3S47A 4QITA 1DIDA 3BCJA 5HDRA 4ADSA 5F2IA 2J27A 1TZZA 3KEHA 3TN3A 2P53A 4EAMA 4JTJA 1RBLA 1JI1A 2UZ9A 3LM7A 4GYPC 3ZR6A 4EPBC 1CNVA 4YCOA 5BOEA 2FDMA 3CV2A 1KXHA 1AL7A 4QISA 5F1VA 1GG1A 2G3NA 3BMVA 3DAQA 5FJRA 2R1PA 2VZSA 3A5FA 3ABRA 5D2TA 2QCFA 3RFAA 4E3VA 2YDAA 4LAMA 4LS0A 2X1TA 4LVAA 4DF1A 4CD5A 1PEZA 3N2CA 4N6FA 3GNPA 2PA6A 4W7VA 4NILA 3EWZA 2CLKA 1X1OA 2WLYA 3A5VA 4FP1A 2X30A 1NM9A 3IJQA 5I02A 4HCDA 1NJJA 4UTKA 4DELA 3FW6A 3QPZA 1OINA 2QUMA 3EXSA 3RX3A 1DWJM 2FTWA 2CBUA 1Z9AA 3W29A 3O6AA 3I7QA 5AVHA 2VTFA 2FPTA 3QR0A 4L56A 4LC6A 2ZA1A 4PB5A 3VOFA 1VAHA 1DE5A 3O9NA 2PLCA 3EMZA 4FX8A 3DYOA 1D7KA 1F74A 3TYCA 4RPPA 4NP7A 4UTHA 3GTNA 4PUEA 2GJPA 2VI0A 5LA0A 3EA1A 2EPNA 2YA0A 1BQGA 2O7SA 4V1YA 3PUDA 3QQ1A 1O7AA 1EEXA 4W9TA 3I4KA 4XD6A 3MUXA 3M0MA 2CHRA 4XISA 1V0MA 3SUVA 3AYTA 2X42A 1F61A 3P3BA 3R0KA 3G3MA 4QIUA 3LLDA 3B0UX 3PSWA 1E6PA 4FXSA 2XH0A 1FTXA 5HQMA 1RXOB 4UTUA 4ADUA 1I1WA 4KMQA 4W5UA 4DZIA 2ZC1A 1NAL1 3DYPA 4QEEA 1A5OC 1Q7MA 3VIPA 5LIXX 4YJ5A 3PUEA 3C2YA 3R12A 4H1ZA 4HTYA 1V6TA 2NX3A 3TONA 1XRVA 3L66A 3DXIA 2IS7A 1KLYA 3N17A 2NLIA 2PTYA 1PTDA 4Y90A 4HKPA 2ON3A 3APTA 3BPWA 2H8XA 5HJLA 3VXGA 4C7GA 4JTUA 4AF0A 2VEIA 2ISVA 1V3JA 2VVNA 1LWIA 5JH2A 5CBBA 1HVQA 5AB3A 3OZPA 5CXPA 2OOGA 5TAOA 3GHRA 3B9OA 3O0KA 2B0MA 3T0DA 2ZTKA 1OFDA 3W73A 3WJWA 1HL2A 4I7VA 1SR0A 3UZYA 1TFVA 2QHAA 2XN0A 2I7GA 2J62A 4CN1A 5A2CA 3U0HA 2PWFA 4WY0A 1POKA 1H0IA 1O66A 3MZNA 3AS3A 1B3VA 1ZPTA 3LGDA 4XZNX 1ZAJA 3RPMA 1IZJA 3VVGA 3DFYA 4NAEA 2FGZA 4LAOA 2W0UA 1KXTA 3BTNA 2H3DA 1Q3NA 1KLZA 3K4WA 3QGKC 2HISA 3F1QA 1WA3A 3WL0A 3EOLA 1D3GA 4HYVA 3VKBA 3M43A 1OZQA 4Q32A 3M44A 4JIQA 3NQFA 2JF7A 3U3HA 3CZKA 1JCMP 4MPKA 4G1NA 3PWAA 4DUWA 1EJUC 1FHDA 3MO7A 2QCMA 1E9LA 5FEPA 5GPRA 1T0OA 2CLLA 4R7OA 3C52A 4JN8A 1DHKA 2RHGA 3D47A 4PUDA 3QRHA 1H62A 3NM3A 2D2GA 3GVGA 4LOCA 5FCZA 2CBIA 2PCEA 2ZCGA 1ZENA 2O9OA 3H2NA 3SCSA 4AEFA 4PTNA 2VX4A 1JPKA 1GCYA 4J1OA 3IS4A 2IKJA 4D6FA 3F7JA 3PZ9A 4P8UA 3Q94A 1ZP3A 4HIBA 4MAZA 5K9DA 3DEQA 3LHWA 3N9KA 4H9MA 3G77A 2VFHA 2ZUSA 3W3OA 1KKRA 2FMOA 3USZA 1G7UA 5C9XA 1YNQA 1F5ZA 1M7JA 1LL6A 3TYZA 1XR2A 3T6CA 4NASA 3ZWSA 3V0TA 3G1AA 3NPXA 1GEHA 1A49A 4RV3A 1CECA 3UEQA 3GXNA 3H22A 3AU6A 2QULA 3DECA 3LNMA 2Q02A 1ZGDA 1XFBA 5K2ZA 3C56A 3ZFHA 1WOBA 1GQLA 1KFBA 4GVHA 1LQAA 3SCOA 3F4VA 1WO2A 3IJLA 1B2YA 4DBUA 4NG3A 5IOBA 4Z0SA 4JR5A 4BKNA 3OBAA 4ZO6A 3IUIA 3BSHA 3G6LA 1FWEC 4LUTA 1OFEA 2MANA 3AOFA 2C91A 4FX6M 1FFRA 1PXGA 1MW3A 2DW6A 4KERA 2E6FA 2D2OA 3R1ZA 3GIYA 1IXPA 3ZSTA 1DORA 4JHZA 4GQBA 2E5CA 5CZTA 1AD1A 3UG5A 3WCZA 1XRFA 5CPLA 1NWUA 1UH3A 4HP5A 4PB4A 1TE6A 5CH9A 4AVOA 2PC4A 3BLPX 5I09A 4YNGA 5A94A 1TCDA 2GGJA 2W66A 4MDPA 2QCEA 1UOKA 3CIXA 1SGJA 4IJCA 4JTCA 2GWNA 1NU5A 2V38A 2HVOA 2BB0A 2YFOA 4DAFA 3TN6A 5LNVA 3RF9A 1LBMA 4ML9A 4UFJA 2AL2B 3BSMA 1TWZA 1C7SA 3AAMA 1QR7A 1ICQA 2DSKA 3EWWA 2I5IA 3DG6A 4XSLA 5F1UA 3I68A 3QW3A 3FDGA 2PDBA 3WQCA 1E6QM 1Q8AA 1GHRA 4B5SA 4D71A 3T8QA 2WNZA 1NIUA 1LLOA 3CQKA 1JR1A 2ZQ0A 3OVPA 5I3KA 3DX5A 3M0KA 3T7VA 1TTPA 4JEJA 3TLQA 1F6PA 1GTHA 3ALFA 3TLLA 1YTKA 4TQTA 1JGMA 5U7SA 3HGRA 3QSTA 3QBUA 3AHXA 1FDYA 1XV8A 4UQAA 3B8WA 1JCLA 1UASA 2J7EA 4MSSA 4I9AA 1S39A 3BARA 2QAFA 3L2IA 3ARYA 1TO3A 1ECEA 2AGTA 3KP1A 1WUFA 4C6JA 1DJNA 4PL1A 3VOJA 4HOZA 1A5NC 2POTA 3LXAA 1EFZA 4PFMA 1ADSA 1GQNA 5EKYA 4QP0A 4C6DA 3UPMA 1KBLA 2JIEA 4O52A 3ZS4A 2XIMA 4YHGA 5F4WA 1YPXA 3W23A 2BXVA 3KFTA 5I03A 4DI8A 1XKJA 5EMUA 4WDXA 3WD4A 1WUEA 5HK4A 1I2RA 2ZZ5A 5HA7A 1YTEA 2ZE3A 3M9YA 5EGRA 4RXFA 3TJLA 2GOKA 3PZMA 4R7WA 4X9SA 4Z2HA 2BHZA 2DORA 3LRLA 3NIYA 1IT0A 1XG3A 1A0CA 3S2JA 2P5NA 3BLDA 1X1ZA 2QCHA 2QPUA 1W3LA 4NHVA 1XBXA 2C0HA 4LQ1A 4IPNB 2WZHA 4ZO9A 1JF5A 5CSUA 1PKYA 3P0WA 1SR9A 1DYSA 3ZVIA 4IF2A 3NQGA 1SJBA 3BCFA 3VIGA 2AGKA 1P6CA 5FJOA 1QI0A 5G2HA 1CB2A 1A5AA 1ZRQA 4JQ3A 5B80A 3MHUA 3L5LA 2XH7A 1BXNA 5A5WA 3LI0A 1VRDA 4ZZ9A 1V3IA 4RR4A 1XLKA 1B30A 2E1DA 2XH2A 5AHMA 4H04A 1YMYA 1YLVA 3B04A 4IQDA 4A4AA 4HU4A 5GJNA 1DL3A 5I79A 5FI8A 4GQ0A 4PUMA 4QG6A 3RILA 3F4CA 2IQ0A 4U31A 4QCFA 3MKVA 1JGIA 3IK2A 4OUIA 3E2RA 2QV4A 4YTTA 3DYMA 1GNXA 1FWAC 5HUOA 3C8NA 4DO6A 2XVPA 2PFHA 3STEA 4PCTA 3NGJA 4KFNA 3TWBA 3H53A 1KRBC 1W9UA 3VNYA 4A8NA 1FDJA 1OFOA 3ZLGA 1UWAA 5CC5A 5A8OA 3B8TA 1UR2A 4RDWA 1MUCA 2EAWA 4H6RA 4MZYA 4HJWA 1PVNA 3WEOA 1THFD 4JQ2A 1YDOA 4URIA 5DMMA 4UTTA 5JBEA 2EO7A 2R6OA 1U5VA 4HMDA 1EA9C 1UD2A 1VHNA 4CD7A 5BRQA 3DU0A 3ITTA 4AHPA 2WZMA 2GJLA 4B2DD 4O8RA 5J5RA 1TPC1 3O6CA 2J77A 3HF3A 4FLSA 2VRJA 1H7XA 2F6UA 3F4NA 2A5HA 3T0AA 2OVLA 5LHEA 1VBRA 4D8ZA 1F3EA 1KXQA 5BMWA 1PZ3A 3KS5A 4Y2WA 2GQ9A 4UQBA 3ZYZA 3UWWA 3N2BA 1JYVA 4IM4A 2HK0A 2RGLA 3CMGA 1WXZA 2W67A 3T08A 1BRLA 2EPMX 4ZSUA 3ZJKA 4PBFA 2NX9A 3RJXA 3W84A 4WD0A 3E02A 2PWGA 1LLZA 3A64A 2WHLA 5CPSA 3BC9A 2ZVRA 3QEZA 3MUIA 1G7VA 2F8QA 2ACSA 1CBGA 4JIEA 1SU5A 3A6OA 2ZRUA 4KCVA 1V77A 3NPVA 4WUIA 3DHFA 1OY0A 4HOWA 3KVJA 1TV8A 1VCFA 3VE9A 2ZKMX 1RJPA 5I0DA 2PBGA 3AUJA 3W76A 1T5AA 2YDQA 3S5ZA 5A6AA 4UMAA 5A8PA 1HN1A 3M0ZA 4GI9A 1TMLA 4L6OA 2ZWYA 3U2OA 1JCJA 3SGZA 3BVJA 8CGTA 1QI2A 1V7YA 5EU9A 1J2BA 1RALA 3NTYA 1JULA 3GIQA 1LUCA 3QYQA 3ARWA 4XKYA 5LIKX 5ECUA 4RXGA 2PDWA 3W6MA 1Y8BA 3SRFA 3C8FA 1BAGA 5C6MA 1LF1A 2PDUA 1VJSA 3QKEA 5ABGA 1N8WA 5SWUA 3W1XA 4GYFA 2OXNA 3W25A 3PPFA 2Z1SA 3SUUA 2V3DA 1FP8A 1RK5A 3PZIA 4JTQA 1QT1A 4PODA 3LBCA 4S3FA 3CZGA 3RLUA 2ODOA 1EZWA 5L6UA 4IIHA 3THUA 4O12A 3KBNA 2YCKX 3URQA 3CV7A 3ZMRA 5EY5A 4AC1X 2QCCA 3P8JA 3CO8A 6ALDA 3HFTA 3AHVA 5LYRA 5LIUX 3GXDA 4IUOA 1B9ZA 3OOQA 2FHBA 1WOAA 4A3HA 1DOSA 3BURA 2HNHA 3ZLFA 4BS0A 1KCZA 1QI5A 3OGSA 4PB3A 3QQWA 3E0IA 4CEUC 3VKDA 1XLJA 1XQLA 5FAGA 3NG3A 2HS6A 3IANA 1XGZA 4WR3A 2YB1A 3UG8A 3D3FA 2OQYA 1TVLA 2XWDA 3SQSA 5IBXC 2PB1A 1HJSA 1NSJA 2VZTA 4QE5A 1KR1A 3NDZA 3VFLA 4IQJA 1RUSA 3TH6A 1OCBA 1O6IA 1DJWA 1MYRA 5CJ5A 4ROPA 4LSBA 3BZJA 1W1YA 1C90A 4HYWA 2EG6A 3DGRA 3IIPA 2HV5A 3LA4A 4OBRA 3VCCA 3ZO9A 4PUNA 2QIWA 3SGUA 4JTTA 1MNSA 1XYZA 2E77A 4RE2A 4FOJA 3FAWA 1PB0A 5HMSA 1KRMA 4UXDA 1ZHAA 1WV2A 9XIAA 1GVEA 1WZMA 3OVRA 3ITLA 4TO8A 1HG3A 1YDYA 4L1XA 3M6DA 3S5NA 1JJKA 2VEFA 1SW0A 4DAIA 1W5PA 2J8TA 3LQGA 4MKSA 1JZ3A 3B9EA 3TN4A 4Y9PA 4XVEA 2FVLA 4LV9A 2DPEA 4JGDA 1XBZA 3BW2A 4LXFA 4Q22A 1GOWA 2ZICA 1YBQB 4FR1A 1D9EA 2O7QA 4X22A 4PMQA 4L9ZA 4XIMA 3SADA 4LVGA 1Q65A 1JL8A 4IIFA 4RNJA 3R5EA 3W4RA 1EQPA 3PB2A 4WQ6A 2XSXA 1OIFA 5E0KA 4QEHA 5T8GA 3TYDA 4ZB0A 2GVGA 1V02A 1J6OA 3HQNA 1JYXA 2YL8A 4DLMA 1VJIA 1XLCA 2C18A 2HJPA 2B4GA 1WNOA 5I78A 5EMMA 3UWUA 4JFSA 3PZTA 3MWAA 2F84A 3KOZA 4JY8A 5FSDC 3E5PA 3RU8X 3FGCB 5DN1A 3T09A 5D2VA 3W38A 2XWEA 2VO5A 5T9BG 3GTHA 4S3DA 4B4HA 1YPIA 2PF0A 2DUZA 2C1IA 2FH6A 1M7XA 1T99A 4LUSB 3BGGA 3N3TA 1KM4A 3O6YX 3TJXA 3WL1A 3ZWTA 3WMSA 4F48A 4ORIA 1YX1A 3Q67A 5HAOA 3GFXA 3EX2A 3M07A 4E8DA 3CZEA 3SM0A 4QG8A 2W79A 3OU8A 2TAAA 3H24A 3G3DA 3GTFA 2VYOA 4H01A 2BY2A 1WB0A 3II1A 2BVYA 3C0QA 3UXAA 3R6IA 2ZXBA 1QNPA 3QW4B 4FIQA 1IV8A 4MVAA 3VDGA 3GZAA 2HE8A 1E4NA 1HW6A 2PP0A 3SFKA 2ZZ1A 1A53A 4LVFA 4OV9A 4YYFA 1KBJA 2XIJA 5HWJA 1U33A 2VC5A 3DENA 4N4PA 2JK2A 3WK3A 3MY9A 1X6NA 5BW6A 3CQHA 4AD5A 4L6HA 4MFEA 4IIDA 3CAWA 4LEFA 4HNVA 4XBKA 3O0FA 3P81A 1E1CB 2IPFA 2BOEX 1KM5A 3KZPA 4MB4A 5TIMA 3V18A 2ZTJA 3ME3A 1DWFM 3MMDA 3O7UA 4OZOA 3S2CA 4FZIA 2PU1A 2O56A 3UXIA 4G8TA 4L61A 5D38A 4MFDA 3GRIA 3KCJA 4AHOA 2EJAA 3K1DA 2GVYA 2G3MA 1K8ZA 1V3KA 3V16A 3UXDA 2BNJA 3VUSA 5GVJA 3GH7A 3T4CA 1W56A 8RUCA 4REQA 3CEUA 4N02A 1TTIA 3FKRA 4NRRA 4O4WA 2JEQA 3P80A 2AQOA 2YB4A 5CJNA 5I3HA 3MC5A 2F2HA 1B4KA 1C8VA 5C2GA 2OGYA 1QNRA 1JIBA 3O16A 3S4TA 3AXXA 3KTCA 1G01A 4DBSA 2DZXA 2DZTA 5CPQA 5JBDA 3G1FA 2PTZA 5DEZA 3OLGA 4L64A 2VURA 2BFGA 2B7QA 4P61A 3IJ8A 3R4IA 1EF3A 1K9EA 3CB3A 1HL8A 4MMWA 1H2JA 2BBFA 3TSMA 4B5UA 7A3HA 1YBQA 1CLXA 2QCLA 1REQA 1HJWA 2BGNE 3UW6A 3LCXA 4UNKA 2QV5A 2ESCA 1OFQA 3JZEA 3MUAA 4LNCA 3OW1A 1XSKA 4YTUA 5CZSA 1T96A 2EGZA 1Y5WA 4GY1A 5A6SA 1VFHA 4AZHA 2E0PA 4HTBA 4GC4A 3ECQA 4N7QA 4RNIA 4W85A 2PTXA 1P7TB 2UWFA 1SMDA 2PRLA 4GG9A 3FYPA 5AN7A 5K3VA 3WD1A 1RHCA 3UCQA 4ATLA 1IR1A 5A8MA 4C6MA 1H7OA 2R94A 1WP6A 3A24A 1J0IA 1PX3A 1OCNA 3J7HA 4LUIA 4DUXA 3UY7A 1H7NA 3MMTA 4OUEA 1EJXC 3MI6A 1NOUA 4CN6A 4CNSA 1A3HA 2HVNA 5D9OA 1C9DA 1EOMA 1W5QA 1MMFA 3I10A 5BYWA 1L8NA 4W93A 1DPMA 4L80A 3W74A 5JBFA 2PDQA 2ZX6A 3ARUA 3EDEA 3UWQA 2VKZG 1RZMA 3VAVA 3B8SA 1MXGA 1FQ0A 4HGXA 4Q4OA 1BXBA 1ZCCA 3N2XA 4H9UA 4ZTXA 1UUOA 2A6NA 4XWUA 3NA8A 1AK5A 4WSHA 4O4VA 4O0ZA 3WQEA 3N34A 3ERPA 1SFSA 2WM1A 3VNLA 4JL1A 2W62A 1U30A 3GDMA 1DHPA 2X09A 5GNXA 1JAKA 3GUWA 3E2VA 4OIFA 5CAKA 1CB7B 4IQEA 1P0NA 2GVEA 2HROA 1ZJHA 3KL5A 4JYDA 1E6XM 1KFWA 1SQ7A 3S3GA 4F9JA 1U1JA 3GU1A 1BF6A 1XIJA 1DJYA 4HNLA 4BWLC 3PJWA 4KESA 1GOXA 2WC7A 4E8GA 3PZOA 3AMKA 4Q33A 3TQPA 4DJDA 2Y7FA 1CGTA 3PHAA 1BLIA 1B9BA 5BRPA 2J75A 3B97A 3N73A 2PDMA 4S3JA 3L0NA 4NAFA 1MEHA 4G7FA 5E1QA 3UY8A 2E6YA 4LT9A 4OOUA 4GZ7A 1R2RA 2IPGA 2J79A 3TUUA 4B16A 3E38A 4FNSA 3IRDA 4X61A 1D2KA 3DFNA 4N9BA 4AZIA 4LU0A 3KBVA 3VI2A 5AKQA 3U5UA 1UWUA 2CHOA 3GAYA 4IIEA 2TMDA 2ZZ3A 3WH5A 4NZ5A 1CT5A 1BWLA 1NDWA 1IEQA 5DBUA 3M0VA 4GMEA 5ENLA 1IQ8A 1F6YA 3UA4A 2X41A 4NQ1A 1JDCA 3AFBA 2TYSA 3O8AA 4PMUA 3QZEA 4RLIA 3FYOA 2O55A 4M19A 4FNQA 3DHPA 4S3GA 2E8ZA 3I7RA 2REQB 4O14A 4XO6A 9RUBA 2DVTA 4PRRA 2O0TA 4PULA 1RCXB 3FKKA 1W3KA 3MANA 3VNKA 3OHIA 4M6UA 1HJVA 1KXVA 4WSKA 3HGJA 4U33A 2DZSA 3M0IA 4ZXOA 1RQBA 3CUJA 2CZEA 2A3LA 4QAWA 2VX6A 3P7YA 5C70A 3URBA 3ZIZA 3AALA 1UR4A 4PMVA 1TYGA 2OLSA 3LTPA 2BVWA 2F9RA 1EJWC 5FF0A 5DO8A 4Q4KA 3LOTA 2EPHA 4XX6A 1PX4A 3PK7A 5IM51 3SFWA 1FWCC 3QC3A 3T78A 3W02A 1NF0A 5C9ZA 2GDUA 5T26A 2Z7KA 3VFCA 1W2PA 1UP3A 2OR2A 4PBGA 2AQVA 4AG0A 3UVIA 2ISSA 3ZLHA 5E9XA 3W1LA 2YL6A 2NVDA 4XUGA 1NF7A 4DVOA 4F2TA 5HR7A 4AZ5A 1GQJA 1UKPA 1A4MA 1F07A 1VRXA 4PUKA 3T8LA 3ALGA 1OC6A 3DKJA 4OT7A 2Y5SA 4OBSA 5DX7A 5AHNA 3CHDA 1OABA 2D73A 1B90A 4E4FA 5M03A 4HHMA 2EF9A 3NXFA 3CH0A 2TODA 8XIMA 2W92A 1SW7A 5HJXA 3KOFA 2CKRA 1QASA 2YZ5A 3VUPA 4UIOA 2ZDSA 3CIWA 3WUEA 1CYGA 1QJWA 1F4AA 2ABBA 1PX8A 3AMGA 4L1WA 4MKVA 4K1GA 3SW6A 3WF1A 2D2HA 5FL1A 1ZJIA 2OEMA 3C2EA 1A5KC 4DO7A 4C65A 1GYMA 4Z2GA 1VYSX 4GH3A 4Y9AA 2OMAA 1CZ1A 1L6GA 4LNYA 3U9IA 5HNNA 1Z3NA 4S3AA 2JGQA 6REQB 1L2QA 2QNEA 3QV7A 1ODUA 2W63A 3CHVA 1E3ZA 1XM3A 1R30A 1ADOA 2PUZA 4FXRA 1EXBA 3TK7A 1WZLA 3USBA 2HS8A 5CGMA 2Z28A 1ZCOA 2PEVA 1ALDA 1XIFA 2WVUA 4IISA 1HO1A 2R1NA 4IPIA 4AIOA 1P0EA 1QW9A 1Q5MA 3V4BA 3NQEA 3C0LA 4J27A 4DZHA 5K4ZA 2FIQA 1TJRA 1Y5VA 5IRPA 3CUHA 1WAUA 4A8RA 2Z7GA 5CZKA 1GZJA 2P76A 4JCLA 3PWIA 3WNMA 2UY4A 1VBGA 5EFDA 3RRAA 3WLLA 1UMYA 1UC4A