2FGBA

Crystal structure of human 17bet a-hydroxysteroid dehydrogenase type 5 in complexes with peg and nadp
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
323
structure length
312
Chain Sequence
MDSKQQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C3
publication title Structure-based inhibitor design for an enzyme that binds different steroids: a potent inhibitor for human type 5 17beta-hydroxysteroid dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
total genus 118
structure length 312
sequence length 323
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2fgbA00
4WDWA 1UR3M 3ONBA 2ALRA 3LD5A 4QR6A 3R8HA 3UP8A 3UGRA 3UFYA 1QRQA 4IGSA 3V0TA 3V35A 1US0A 4AUBA 1IHIA 4HBKA 1XJBA 2IPFA 4FAMA 3R8GA 3EB4A 4WEVX 3MB9A 2BGSA 4XO7A 1ZSXA 1HQTA 1Q13A 4GCAA 4JTDA 3S3GA 5AZ0A 4JQAA 4PR4A 4WDUA 4QXIA 4XVDA 3D3FA 4XZHA 3FJNA 3UG8A 2PEVA 4YS1A 4Q7BA 2IKJA 1AZ2A 4L1WA 4XZMX 5HNUA 4DZ5A 4G5DA 3BV7A 4XZIA 3CV6A 4JQ3A 1YNPA 3CAQA 2VDGA 3GHSA 3R6IA 2ACSA 2F2KA 4GQGA 3UZZA 3CMFA 3N6QA 1MRQA 4ASTA 2IQDA 2ACQA 2PDJA 2PDQA 4JTAA 1AH4A 1T41A 2HE5A 4JQ4A 3UYIA 4RPQA 3O0KA 3M4HA 2CLPA 2PDIA 3M0IA 4LAUA 3V0UA 4YVPA 3DN5A 1LQAA 1RY8A 2DUZA 4HMNA 2BGQA 3LENA 4IJCA 5LIWX 2R24A 1OG6A 4LBRA 2PDNA 5M2FX 2F38A 3N2TA 1AH0A 2IS7A 4LB4A 4WDXA 3LEPA 4L1XA 4I5XA 1R38A 2PDXA 4PRTA 1PZ0A 2DUXA 4QX4A 4XZNX 4F40A 2PFHA 2PDUA 4DBWA 3LZ5A 1PWMA 4DBSA 1C9WA 2PZNA 3LQGA 1S1PA 4EXAA 2INZA 2FVLA 3BUVA 4GIEA 3DOPA 1S2CA 1Z3NA 1YE6A 3UWEA 1S1RA 2ACRA 2I17A 3CAVA 1IEIA 1GVEA 1FRBA 3BCJA 4JIRA 2FZBA 2R9RA 4ZFCA 4DBUA 4YU1A 3CV7A 3R58A 2IPGA 2ACUA 1RY0A 1Z89A 3M64A 2DV0A 3Q67A 4GABA 3EB3A 2PDBA 1ZUAX 4JTCA 1AH3A 3GHUA 1Z9AA 5LIXX 3LNMA 4R9OA 1EXBA 4YVVA 5LIYX 2NVDA 5JH1A 2FZDA 1X97A 3MC5A 1QWKA 4H7CA 3R43A 3ONCA 1RALA 1HW6A 1PWLA 3G5EA 2I16A 2PD9A 3WBWA 1ZGDA 1X98A 3BURA 3Q65A 2PDCA 1ZQ5A 2FZ9A 4XO6A 1PZ1A 4NKCA 2NVCA 3RX2A 3LUTA 5LIUX 1LWIA 4PMJA 4LAZA 5LIKX 4MHBA 5HA7A 3RX4A 4FA3A 4JTRA 3NTYA 1S2AA 3WG6A 1VP5A 3LZ3A 2PDFA 2QXWA 3H4GA 2PD5A 4WGHA 3ERPA 3LBOA 2HEJA 5HNTA 2IPWA 2INEA 3C3UA 4XZLX 2HDJA 1SM9A 2PDMA 1EF3A 4XK2A 1YNQA 2BP1A 3B3DA 2PDPA 4GA8A 3GHRA 3VXGA 2WZTA 3RX3A 2PDHA 3T42A 4ICCX 4JIHA 5KETA 3UZXA 3G1RA 3CASA 3COTA 2C91A 3GHTA 3FX4A 1J96A 3V0SA 3WBXA 2IKGA 1K8CA 5C7HA 1MZRA 1VBJA 4JTQA 2PDLA 4JQ2A 3WCZA 4JIIX 3P2VA 4OTKA 4PRRA 4GQ0A 1Z8AA 2FZ8A 3F7JA 2WZMA 1MI3A 1EKOA 4YVXA 4EXBA 4WRHA 2PDYA 1Q5MA 5JH2A 1PYFA 2J8TA 4XVEA 4XAPA 2PF8A 3V36A 2HE8A 1AFSA 4JQ1A 3QKZA 2IQ0A 3GUGA 1EL3A 1M9HA 3WBYA 3LN3A 1XF0A 1A80A 1T40A 2PDGA 2ISFA 1XGDA 3H7UA 1ADSA 4LBSA 3H7RA 4PUUA 2A79A 1AZ1A 3O3RA 3U2CA 4LB3A 1X96A 2HVNA 4FALA 5DANA 4GACA 2IPJA 2HV5A 2PDKA 4FZIA 3LQLA 4IJRA 4H8NA 2FGBA 2AGTA 4PUWA 2P5NA 3UZWA 2IKHA 4Q3MA 1JEZA 3KRBA 2PDWA 3UZYA 1YE4A 3EAUA 4QBXA 3R94A 3R7MA 4WDTA 2HVOA 5AZ1A 2IKIA
chains in the Genus database with same CATH superfamily
3SJNA 1RXOB 3VGEA 4IGSA 4X0VA 1E0UA 3SDOA 2HJPA 2V38A 2V9DA 4Z2IA 3WMLA 3I4KA 4YJ5A 5MHBA 1XYBA 3THCA 1S2WA 4F8XA 2VX6A 3R8GA 2ABAA 3VIGA 5A6BA 4S2BA 2WCGA 1OY0A 3VCCA 1P6WA 4JTDA 1HJWA 1K6WA 3S3GA 3SFWA 2GVEA 5G5IA 4PR4A 4LUJA 2WHLA 1EGVA 1A0EA 3FJNA 1KB3A 1W54A 5IBXC 4V1XA 5E1QA 4AZCB 2Y61A 3POCA 2YSWA 1IEXA 4CVUA 4LEFA 1QT1A 4XZIA 1ISXA 3PP7A 1CX9A 5FF3A 3ABRA 4B5XA 4MVAA 3SUSA 3AZRA 4N4QA 3UD6A 1MEWA 1DEDA 2CWNA 3AJXA 4I7VA 1RCQA 3E2SA 3N6QA 4CNTA 3CZEA 2I14A 2ACQA 2WNWA 2ZA2A 2YXXA 1TPC1 2W63A 1AH4A 4UTLA 1T41A 5AC4A 3UYIA 1BF2A 4BQ2A 3GQYA 3WX7A 1FY6A 1O95A 2TMDA 1GK8A 1FWNA 2V3FA 2VEIA 4MF4A 1M53A 4JTHA 4YHGA 4Y9NA 1W91A 1EJVC 3D6NA 1OG6A 1EOMA 4IMFA 4K3ZA 5M2FX 3II1A 1FWRA 4XIAA 3VILA 4DPPA 2ZA3A 4GQBA 2FTYA 1E6XM 2EBNA 1ENUA 4L1XA 3AIVA 1OGGA 1PZ0A 2I5QA 3CUHA 1IZJA 1R3SA 3A21A 2WANA 4OKDA 1OCJA 3ARVA 3UZJA 4GK8A 2CBUA 4PSPA 1UJPA 4WVXA 1KFBA 1G5AA 1C8XA 2DW7A 4H01A 1XPYA 1E5NA 2WNNA 4UNLA 5AHFA 3T4WA 5T26A 5LA2A 1MEIA 2BHZA 3EKZA 2ZBTA 2UV8G 1ZP4A 4PB5A 2MUCA 2VC7A 2BASA 2GZXA 3NM1A 1E4MM 3LS9A 3DG7A 1HKJA 2Q3OA 3VU2A 1AUSL 3GTHA 3OZYA 1XLGA 3S1XA 3GU1A 1W3KA 4D6FA 4BF9A 3IJ6A 4IPNB 4J3XA 1WXYA 5IFPA 5D02A 2I9UA 1ZNNA 3G24A 3H4WA 4H7VA 4PCFA 3UR2A 3PG8A 5F1VA 4YVVA 3GKAA 5E9XA 4HIBA 3A4XA 2ZCGA 4AZGA 4IL0A 3TC3A 1DJIA 4HU8A 4ENLA 4QEHA 3T78A 3PFRA 1VJZA 3DI1A 1C8YA 1GT8A 2GOUA 3MS8A 2J7BA 1VRXA 2PDCA 3WZ0E 3CHCA 4QROA 3E38A 2WLYA 3P67A 4GE8A 3KOZA 3TYCA 3WNPA 4W89A 2WAGA 4LAZA 4ZENA 3LV5A 3JZUA 1WXZA 1J93A 1PHQA 3V5FA 1FDZA 1EA9C 1BXCA 2O9RA 3WNNA 3FLUA 2XIBA 5A6KA 4EKJA 3RK8A 4O1EA 3N19B 2Y7FA 3NQ2A 5B7ZA 1YNYA 3M0JA 4AQLA 1RPXA 5CSYA 3MMDA 3M5VA 5D33A 1K3UA 4P2VA 5DY2A 2WJEA 3FHAA 3URQA 5ECVA 4NAEA 2BXZA 2YCIX 3GUWA 3CYJA 4E8CA 1OZQA 6ALDA 4C6LA 2G3IA 4W84A 5I0DA 4N0RA 1GVIA 4O12A 1E73M 1XIIA 1KM5A 4KESA 4ZXLA 3PUDA 1Q8AA 3RX3A 2DSWA 4O50A 3T1GA 4MKNA 3NSXA 1EP2A 2CLEA 2DZBA 2HPIA 1GZ1A 5FJPA 2O4QA 2XJ7A 3I68A 4O17A 8A3HA 7TAAA 1PCWA 3EPMA 3QW4B 4BK9A 3TMQA 1JPHA 1VYPX 1WZKA 4Q8QA 3VNJA 4GPNA 4HQVA 1VIZA 5ECUA 5FJUA 3WQCA 1EX1A 4JYDA 1EGMA 5C7HA 4UTIA 2W9MA 1KV8A 4OBSA 4MYXA 2R1NA 5FIPA 2GVYA 1P5BA 4IL2A 1XLEA 1KGUA 4LJ3A 3GNRA 1XINA 3LX9A 4B92A 1Q5MA 2YBUA 3I7SA 3EDFA 4V33A 4R33A 4LOCA 2D2GA 2DT2A 2ZUSA 4PMNA 1GOOA 3AU6A 2R14A 4NZ3A 3WBYA 3CUFA 3LN3A 2DW6A 1V3HA 3THQA 5E6ZA 3C56A 5C9XA 4F2TA 5CJNA 1UWSA 3SY1A 2WKJA 3HGRA 3WQ8A 1WZMA 1DE6A 2PWUA 2INFA 3IVUA 5I3JA 3L66A 3M0HA 5GNYA 3C5QA 2P10A 2XM2A 5CGTA 4FX6M 4YMZA 4F2BA 3CO4A 1MVYA 2JF7A 4FXJA 4US5D 5XINA 1FBAA 4G2DA 1W8GA 2P5NA 1QPOA 3RDKA 1BG4A 3FYYA 3ORWA 1H4PA 3ID7A 4QAIA 1Q8JA 3G22A 2ABBA 3KOYA 4CD8A 1XFBA 1E1CA 3BGGA 1WV2A 3TP4A 3WLRA 5C9UA 2JKPA 3QXBA 3ARQA 3O8AA 3RLUA 3W82A 5DN1A 3SR7A 4HPJA 5C55A 1IHIA 4HB7A 3UVIA 2QDEA 3I6TA 3I4EA 5CC3A 3ES7A 1JCXA 3QR1A 3B9NA 2Y5JA 3EPOA 1TWDA 4D6GA 2BGSA 3MBDA 3PZ9A 4KIEA 2MANA 2PA6A 4DF1A 2AMXA 2DH2A 3AUOA 4JQAA 3UG8A 3UXAA 3UWQA 4A8NA 1ZJBA 1EOKA 2VCAA 3EDDA 1KTBA 4Z2KA 5A2BA 4JYFA 3MMTA 3UPWA 1BSIA 5A6MA 2FVKA 3VIIA 1XYLA 5J04A 4IXHA 3UA4A 5CPMA 3VX0A 2EKCA 3FKKA 2G3MA 4J3VA 4REQB 2BOGX 2PWHA 5DRIA 3M5ZA 1ICSA 3GM8A 4HMCA 1VYRA 4H6EA 2PWDA 3DESA 3RCMA 4NI3A 5C9RA 2VD8A 3N25A 5D2VA 2VEGA 2FPVA 3HQNA 4GGHA 3M1ZA 4QDPA 1PX8A 2H9AB 1H5VA 1H50A 5KEZA 4LYRA 4Z2LA 1G4PA 1PKYA 4XBSA 5AC6A 4Q4RA 2JF6A 1AH0A 2HS8A 4HSNA 5HWJA 1Q6LA 2AKZA 3CC1A 2J7EA 4RLIA 3EWWA 1SR0A 4ZOAA 5EBUA 1F3WA 4QX4A 4RK8A 3AOFA 1PE1A 3ZJ8A 4ZL1A 1CEOA 3V75A 1XIEA 3B9OA 2C1GA 4XV0A 1WKYA 1JAEA 3PWGA 2ZC8A 1E55A 2V5LA 2VGIA 1JF6A 1D7KA 3ABOA 1OSEA 3SFKA 5KZMA 2C13A 1G94A 2YB1A 4LXFA 3AZTA 2IUZA 1CB2A 3W70A 3ZWTA 3W24A 5HWNA 3GG7A 1UWIA 2FKPA 3QF0A 1RH9A 3VNKA 2WC7A 3VZXA 3HQPA 1ISYA 5CZKA 4Y9MA 1D3GA 3LBMA 5TAOA 2WYSA 4HGXA 3C2VA 1JUBA 2CLIA 1A5SA 2VQUA 4REQA 4ZBCA 2I56A 3ARZA 1V3MA 3DKJA 1WKEA 2QCGA 3TYUA 4HSOA 1CDGA 1NM9A 3TC6A 3XISA 2TRSA 4FF7A 4ZO9A 4BEQA 5AVHA 2V68A 4Y2WA 3GR8A 1WX0A 2HQAA 3EKGA 1LUCB 2H9AA 1DXIA 3CIWA 4B4HA 4GI9A 5EGRA 4ATDA 1BKSA 3WF2A 3W0KA 1NWUA 4QJ3B 5BXRA 2O55A 2QUNA 3CTLA 2XZ7A 1E5JA 4GVHA 4GNKB 4CEXC 1P0NA 4MLJA 3BLEA 3WDJA 3PHAA 4DJDA 3UF9A 5AFDA 2XTKA 2JGQA 3BICA 1BKHA 1GUVA 2BNJA 5CZSA 1H7RA 4HYRA 3LGDA 3DZ1A 4U5IA 3ZLGA 1RBLA 1HL8A 2NQZA 3CQHA 3FAXA 4PFHA 3F5LA 1OFDA 4O4WA 3NQAA 3IIXA 2VO5A 4Q4OA 4WSKA 4Q8PA 1I6NA 2PDHA 3HPFA 4ICCX 2EXOA 2GPTA 3SN0A 1PIFA 4YHEA 3KDOA 1WPCA 3LY0A 1AJZA 4RL3A 8XIMA 3ARTA 1DJWA 3MBFA 4AHQA 2GWGA 3OBEA 3S4TA 3I3EA 3SCOA 4A21A 1PL9A 1VFUA 3UCCA 2WPGA 3BC9A 3CL6A 1HKWA 3WBXA 2IKGA 2QIWA 4ILSA 1TWSA 3W1UA 3T8QA 4BQ4A 1E1FA 2A6LA 5CPQA 3NQ6A 1MFVA 2GL5A 3CWNA 3H2OA 4IZGA 1W6TA 3N3TA 1OFBA 2PPGA 4LUSB 2Q8XA 1LUCA 3O6CA 3W72A 1MI3A 1PUDA 2ZUWA 4ZODA 4NZJA 3W3OA 3BZJA 1NFBA 1KC7A 2ZE3A 2I5IA 1DYSA 1KTCA 4MPKA 5FCZA 2ZXAA 3HZ3A 1BG9A 5IDZA 4ZFMA 1AFSA 1GG1A 3GAKA 1FH7A 1KR0A 4A3QA 5HOSA 3DFQA 3OTRA 3O6YX 2BFGA 4QP0A 3SCTA 5E0KA 2WW5A 4QLLA 4POCA 2A6NA 5RUBA 3KP1A 3PPCA 4GKTA 1X1ZA 1G4SA 2FIQA 2XSXA 3TSMA 1OIMA 1PHWA 2FMNA 4BF5A 4HTYA 3QPZA 2J9ZA 3RU6A 3W86A 5A8NA 4HKPA 1VEPA 4MUPA 3QBUA 1DXEA 4AD2A 4LNCA 2W3ZA 3GXPA 3GG0A 1CXLA 3RPDA 4X9SA 5HMEA 4ROQA 3G3DA 1UPPA 3PJTA 3W84A 3R7MA 2V5KA 3LB0A 3CL7A 3UQNA 1GPWA 1EDGA 1SPQA 5CBJA 7A3HA 2XIQA 1V79A 2WSPA 1XSKA 2V81A 3H2FA 4KCUA 1FFQA 3PS7A 4UOJA 3K13A 2E25A 3HPXA 1X6LA 1HL9A 1E1EA 1GVYA 4A3YA 2FZNA 4LUSA 4MWAA 3GAYA 2J9YA 3VUSA 4QITA 3IJQA 4P7RA 1I2OA 1EUAA 4LRTA 1NWTA 3N4EA 1LT8A 3PNUA 2X2YA 2QCDB 1QATA 3DG6A 2G97A 1O68A 2DT0A 4LH8A 5TNVA 4C60A 5HPCA 3DFTA 4X0NA 1TX2A 3K2GA 1NP0A 2A2IA 4IUOA 3BV7A 4ADTA 1RQHA 2F6KA 1YNPA 3M0YA 4W93A 4M29A 3SIMA 3IUDA 2J79A 3EA1A 4JCMA 3WNLA 3TR2A 2ACSA 1ITQA 1FP8A 1XSJA 1TCDA 4AXKA 1C7SA 1E4LA 1E70M 3T05A 5CC5A 5LXEA 3B4UA 5B80A 2J13A 4HYWA 1K7FA 4LVAA 3FY1A 3KOWA 2PDJA 5D9NA 4KMQA 3MMUA 9RUBA 1XDJA 1FHLA 1WA3A 5M17A 5MF5A 1UWAA 1CGXA 4L4OA 2D2HA 3AS3A 4TV6A 2EPNA 3WH8A 3M0IA 2PODA 3N34A 3NZRA 3VAVA 4PCPA 3WDHA 3HURA 4ERAA 1BLIA 4QGCA 4ZQCA 1JCMP 3GTIA 1RJRA 2AGKA 4GINA 3G0UA 5HNNA 6REQA 5SWUA 4U3CA 4ZB5A 2ZA1A 5IOBA 1DJGA 1OF6A 4A8LA 1TSIA 1ZHAA 4PMOA 1EDTA 3BO9A 1JZ8A 2JIEA 4WDXA 4AZHA 2FHCA 1KRMA 4UIOA 3I65A 1GNXA 1GQNA 4GIRA 2PDXA 4QQUA 2D3NA 2HWGA 3UW6A 4W7UA 1XG3A 2ZDSA 5A6SA 5K9XA 1Q6OA 4DWSB 4DJFD 4GWEA 1DBTA 2INZA 3QJAA 3LCLA 3T2OA 2WZEA 5CBBA 4I3GA 2QCDA 1L6SA 1C29A 5D04C 4NHVA 2OQHA 3WLLA 3CXOA 1CXFA 2Z25A 4LCRA 1E6RA 2C18A 3R1ZA 5LGXA 3EX2A 4Q4QA 1HIZA 3S6OA 3F03K 1F6PA 2V3GA 1D3HA 1RQBA 1R87A 4JD4A 2O9OA 3UWVA 4LALA 3H24A 3IK4A 3PK7A 1Z89A 3WK3A 1TIWA 2FFIA 3D47A 4KGJA 3W1XA 3Q67A 5BZAA 2DUAA 3A5VA 1KLYA 4KWWA 2W79A 3V4BA 2J9XA 1AH3A 1Z9AA 2CZVA 3RF9A 3KRZA 2JEPA 4MB5A 4LAMA 5JH1A 3MHUA 3PBVA 4GZ7A 3CMGA 3PB2A 4GJJA 1CGWA 2WHMA 2NWSA 4QE1A 4TTGA 1WOBA 2A3AA 2XIJA 4H9YA 1ZGDA 3GBEA 2QVHA 1ZQ5A 3WJYA 1POKA 3EXRA 2EKGA 5LIUX 3LU2A 3A9BA 4YYFA 4BJHA 3ZR5A 3RX4A 4GX9A 3TLLA 3W53A 2WZIA 2PTWA 3LCIA 1VP5A 4B90A 2EG6A 2VD9A 4H9VA 1NARA 3RN6A 1BVZA 4ZTXA 4K39A 3B0XA 5IM51 4TQTA 1HTIA 2PI6A 4H1ZA 1N8IA 2EAWA 1D8CA 5EMYA 1C7TA 3UG3A 2YXGA 1RAKA 1MRAA 2A0NA 3RM8A 1R3RA 1V4YA 3PBUA 2IPWA 3TCSA 5DXYA 1FQ0A 2XSAA 4N9CA 4WUIA 2XVKA 2PDPA 3TXZA 1Q6CA 1UWUA 2GK1B 3VXGA 4N2YA 3A3HA 5BOOA 3M0VA 1XBVA 4JIHA 4KEMA 4M19A 5REQA 3WQOA 1CIUA 1W31A 1BFNA 3QFEA 2DIEA 2FH8A 2RHGA 2ZFAA 1MO0A 1UD5A 2C71A 5A6AA 1MXSA 3BLLA 3PN8A 3U4AA 3MI2A 2Z1WA 4IF2A 3WQGA 4JTQA 3VE9A 3ATZA 4HZ6A 3QW3A 4G1NA 4S3EA 3WCZA 3GDLA 4PRRA 4ZQPA 5LNUA 1DHKA 4IG2B 1KGXA 2FZ8A 1UMLA 3VKJA 4E4FA 3UWZA 4KT2A 7XIMA 3MO4A 3BGAA 3PWIA 5KZ6A 1I8JA 4MTVA 3WEOA 3S9YA 1VJSA 1Q2SA 5JH2A 3ALGA 3EX3A 1KQZA 4JTKA 4XAPA 1TVLA 4CVWA 4GIYA 4E0CA 3NGFA 1TWWA 2F61A 2WXDM 2ZQ0A 1W2VA 1KFWA 4L6OA 3BLIA 1ODUA 4QSHA 4JTGA 1KM4A 2V2CA 4LU0A 2J8GA 1W5QA 1JFXA 1UKSA 4DJED 3CLMA 1G69A 2HVNA 4HA3A 3CTTA 5DQPA 5I6SA 5HMSA 2WQDA 1TJ1A 4O19A 4XSMA 1XBXA 3UPMA 1K7XA 2PRMA 2B4GA 1G9HA 3N3MA 4E38A 4EWJA 1AQMA 1ODZA 1DJQA 4IX2A 1XG4A 1SJDA 4ZA0A 3CIXA 3EOLA 4YCPA 1PIGA 1XX1A 1BYAA 4N7QA 4O52A 2OCZA 4QBXA 2D23A 1VC4A 4I9TA 4MWAC 1XC4A 1UD2A 4WKAA 5BRBA 4KWSA 2F84A 3RJXA 1Z44A 4TV5A 3VGHA 1QJWA 2HCVA 3NQMA 4H2CA 3UXIA 5EB8A 1RK6A 4UTWA 3G2GA 3QQ1A 4IG2A 1F2JA 1S2VA 1XQLA 1TELA 2VZSA 3LV6A 4CNSA 2BS9A 3VZYA 2HNHA 3QHOA 1ZTVA 3A3WA 1VRDA 1KBJA 2ZE0A 4HK7A 4ONVA 2ATMA 3BWWA 3TTSA 4YTUA 3ARSA 4Q7BA 2DP3A 3FS2A 1V3LA 3WMCA 5BNKA 2RDXA 3IANA 4XZMX 5KTLA 3PANA 3F5JA 3LCFA 3VIOA 2YDSA 4GYPA 1R86A 4O8RA 1PIIA 4B5SA 5EKYA 3TJXA 3WFAA 2ZUUA 1UUOA 3HOJA 2I57A 4W88A 5I23A 1PX3A 5D2WA 1MRQA 2KZHA 1MNZA 5FD0A 2P88A 2NV9A 3E0FA 3RRXA 2R94A 5JMUA 3IJ8A 1C91A 1VPYA 4LW7A 9XIAA 3A47A 2CLOA 2CXGA 4LC6A 3F4DA 1DPMA 4W8LA 4MSSA 3NQGA 3MANA 3NZQA 3HFTA 3S83A 2RGLA 2PURA 3O63A 4GVGA 1IWAA 1H49A 1KM1A 1VR6A 3W2JA 5FEWA 4GZEA 5LIWX 3BJFA 2R24A 4JTLA 3CYVA 1H7WA 4TX8A 3P8IA 5I3FA 2P0OA 5M03A 1TPEA 3NEVA 4B15A 2QJJA 2PB1A 1R38A 3MMWA 3AIEA 1JPDX 2X8RA 2YXOA 3O05A 4RZ5A 2HXUA 4GO8A 1GQIA 1HJVA 1PS9A 1JDFA 1U1HA 1ONRA 4IPPA 3HG2A 4W86A 3KZSA 1F4AA 1S46A 5FJRA 3FN9A 4PSRA 1P6CA 3R0DA 4MAVA 2CZFA 1Z7AA 3QGVA 1S1RA 2VC9A 4E3VA 3FCPA 1TPVA 4JIRA 2YDQA 4JHZA 5F1UA 2YCJA 1OVDA 3MUY1 4J3ZA 3THAA 4EANA 3L23A 4NX0A 4YU1A 3IK2A 4X60A 2IPGA 4PBFA 4FNQA 1LZOA 4S3KA 3BMVA 2VFIA 1J0YA 2E5CA 4JTJA 2ALDA 2X30A 2Z00A 3MKVA 3T08A 4F0LA 4GXMA 4NZ4A 4UQCA 2ZTJA 3LPPA 2NUYA 1M04A 2RDWA 2QYGA 4EPBC 1NSJA 5A8PA 2NX3A 4UTFA 2Y8VA 1U5HA 1ML1A 5CZ0A 3FJ6A 4LANA 2QDGA 2PGEA 2J62A 3HV8A 4DPQA 2OTDA 2DZVA 2IW0A 4IQLA 1CENA 3IRSA 1KBLA 4UFMA 4QEEA 3GZAA 2A3CA 4HU0A 2XWDA 2R6OA 2OLSA 1TUXA 1QFEA 3LUTA 2DT1A 5E0FA 3GXIA 2WSRA 5HA7A 4FA3A 1V6YA 3MP4A 3MUCA 2Z1KA 2WMJA 3ZOAA 3RLHA 4PTVA 2TSYA 3EKLA 2V82A 1LWHA 3RPMA 4EOUA 4M56A 4BQ3A 1S2TA 3NQBA 2QIIA 1PKNA 1TQJA 4MKVA 1W5NA 4FXFA 1KBKA 2OYKA 5ABFA 3BJTA 1FCUA 1OBAA 1T99A 9XIMA 5C9ZA 3QFWA 3WENA 2F6UA 8XIAA 2HDJA 1DORA 3BG9A 1Q3NA 3KOFA 3DFYA 1H7OA 3T40A 1H2JA 1QI0A 1UD6A 1UR1A 1TMQA 4IMCA 1XFCA 1ITUA 4CNPA 5HXMA 2ISSA 1KD0A 1WUEA 4RNJA 4DAIA 3VK5A 5K7JA 2EPKX 3UY7A 3PZOA 5HUPA 3DEQA 5CGQA 4JX4A 4EAYA 3R8RA 5EMKA 1K9TA 4KCTA 1TREA 4O18A 1IZCA 1Q7QA 4CD7A 4GZJA 1HKIA 1D8WA 4E4UA 1EQPA 4AB4A 2X16A 1VBJA 1BGGA 2FGZA 3PF3A 1CXEA 2QKFA 3NO1A 4XISA 1HP5A 1ZL1A 1KXTA 3KM8A 1MZHA 2Z0IA 4EX4A 1EKOA 4MMWA 2BB0A 1AJ0A 3KHJA 5J5DA 2E6YA 4GYJA 4AZBA 1R2TA 3LCHA 3KVMA 3QH2A 1WBJA 4FLSA 1I9CB 4UFJA 3WD3A 5IFTA 1M1BA 3W7MA 5CBIA 1OC6A 4IGMA 3RRAA 4LUTB 4H9TA 1XSIA 2WVVB 1ITCA 3H2CA 2OLAA 4CLMA 1HVQA 3VGBA 7CGTA 2HBVA 2VHLA 1IXNA 4WKHA 1ADSA 3T07A 4LBSA 5J8LA 4GQRA 2A79A 3I10A 1KXHA 3U2CA 5HDRA 3GW0A 1US3A 3WF1A 2IPJA 2VDHA 1LWJA 3LQLA 3BVJA 1ISZA 3CZLA 1XL9A 3BW4A 1NF0A 1DWGM 4Q3MA 4NNCA 4C6EA 3BSMA 3AC0A 3S5YA 3MP5A 4EF8A 1TJ0A 4HPHA 1DJZA 4IH3A 1EHAA 2GQ8A 1P1XA 1EGZA 2OKOA 4TVUA 3TSDA 1BQCA 1E0XA 2CERA 4IFOA 5CH9A 1C3FA 4OZOA 3Q37A 4K6AA 3SIZA 1O1ZA 2FVMA 4ZQNA 2ZX6A 5HQLA 5DMNA 1DTUA 1UR9A 2NT1A 3P84A 2GSJA 3TN6A 3GIQA 3SGUA 3DYPA 4NSBA 4B91A 1Q13A 2VI0A 3K8LA 2YCLB 4GYPC 4P8XA 4KBXA 3D3FA 3E12A 2XGZA 3QV7A 4PULA 4YS1A 1UC5A 4F0HA 4XZBA 3AYSA 3AAMA 3DG3A 1P7TB 3WUGA 3KBJA 4J3TA 4XQ6A 2J74A 4D1JA 1W3LA 4URIA 1LLZA 4WJXA 3L12A 5D37A 4LUTA 1KM2A 2WCAA 4C6CA 5CZTA 3P82A 1KFEA 3L4UA 4HNUA 4AAJA 4E2DA 1GW1A 4LWWA 2VDGA 1Q4NX 1L6GA 4DXKA 3CK5A 3W76A 1WDQA 4FNTA 2Z1BA 5LHFA 1ZS2A 4ATWA 4AEFA 5A2AA 2AMGA 2A5HA 2HROA 1MUMA 2YYTA 3L4XA 4FLQA 2R91A 1KXQA 2PDQA 1A50A 3WQDA 4PMDA 4F9JA 2HBXA 4A22A 3VA8A 1E9IA 2ZTKA 4NVTA 1J0IA 1KKRA 5GJPA 1J01A 2WCSA 1RY8A 5AVNA 1UWQA 2V0TA 3I3DA 2XUCA 1TX0A 3GDTA 3CEUA 4NILA 5I3KA 3ARXA 3TW9A 4I9JA 3WQ6A 1O5KA 3AFBA 1WBHA 2J27A 3N9SA 3UNDA 2HTMA 1BVWA 1UBSA 3AYRA 2XVGA 2Z24A 3HJEA 4I5XA 1AQ0A 1WKFA 1J4EA 4F40A 3M5YA 4DBWA 1HNYA 3E3HA 2ZUTA 4R9XA 3NVTA 2C8NA 2NSXA 3LG3A 3TIMA 3MWCA 4YPJA 4B3ZA 4Q4SA 2YCLA 3DOPA 4G6CA 3U6WA 2X05A 3SUVA 2VZUA 1W1YA 5EPDA 4JFWA 5I2UA 4UFIA 4GIAA 3LM3A 2ACRA 2AQVA 1IEIA 4L4MA 3SRKA 3BCJA 4ES4A 4GLEA 5LNRA 3B8UA 3B9AA 5GVJA 2NUXA 4DBUA 2BVYA 1B9BA 5E5CA 5CLWA 2WJFA 4IWWA 1TTPA 2VWSA 5KZEA 4PBEA 2PDBA 3SSJA 1Z41A 2J4GA 1V6XA 2PCEA 4WHBA 4HPGA 5IDIA 1MW2A 2D0HA 3UXLA 1QBBA 1EXBA 1UA7A 5H8UA 2OSXA 3FVMA 1HKVA 1K9DA 4KQNA 1XHGA 2QJIA 3RXZA 2OYLA 2ZX8A 3HV9A 1EDQA 3ITYA 4XO6A 2VX7A 1JNEA 2DSZA 1BAGA 1KM0A 1Q6EA 2P53A 1GYMA 3BAJA 2HVMA 4N9DA 4H41A 2W0UA 4Z1DA 5K9CA 4Z1AA 1JZ3A 3DX5A 1Z32X 5HQEA 4A2SA 1A4MA 3WH6A 2VEPA 4HHLA 4XD6A 5EMUA 3WG6A 1HJSA 1EEPA 4M3PA 4PL2A 3GIPA 1J2BA 2PAJA 1F05A 3VZZA 1K4HA 1KNWA 4ZZ9A 3N1AA 4IGNA 3AMDA 2V67A 1XRSA 2HEJA 3GTFA 1W1PA 4CQ8A 2OKTA 1LBLA 1H62A 2RDUA 1G01A 3A64A 1IWPA 2A1YA 1L6FA 4XZ9A 2J47A 3DYOA 3CQ0A 3A4AA 2VENA 3C2RA 2WZTA 2DQXA 3GY1A 3CT2A 1RVKA 4F79A 2X7WA 3TYAA 2Y85A 4MNKA 7TIMA 4GJ1A 1SMDA 3W74A 2GJLA 4HN8A 3GXFA 3AXIA 2H8XA 4HPNA 1M7JA 3AISA 4ZOCA 1KTNA 2P1FA 3WDQA 1CGYA 4PGLA 4WX2A 3WY1A 5D30A 1B31A 4C7FA 4AX7A 2PLCA 1LORA 1XRVA 4Z2HA 2YOCA 1P1MA 3S1WA 1X7FA 2TPSA 1Z8AA 1BYDA 1PEZA 2PLKA 2ZIDA 1XLJA 3K1GA 4WRHA 2VRJA 1DTNA 2VGFA 4M1RA 6TAAA 4IMGA 5MKGB 3TYZA 4PE8A 1QO2A 4MJMA 4MKSA 3ITXA 1UZ4A 1XLIA 1Q66A 2PRHA 4UCGA 2YZRA 4HHHA 4ERIA 2BDQA 3PAOA 1JCJA 2BLEA 2ZZ5A 2QJHA 1X1OA 3EPNA 1A80A 4P5UA 4RV8A 4JNZA 2V5DA 4RV3A 4LCQA 3DFSA 3SCQA 2AAMA 1FWTA 2H3DA 2VDIA 3D46A 3LA4A 2XDFA 1I1XA 2E77A 4PRWA 2ZWZA 4KFPA 2DSKA 5TIMA 1ONWA 5B7YA 5TBOA 1R3TA 1QOXA 2C79A 1E71M 3VE7A 4FR6A 3IIZA 3MPGA 3W7IA 3F2BA 4H6QA 2YA0A 4KWVA 5TD4A 1QUMA 2WMFA 1CZ1A 2OZTA 1QI2A 3ZJ6A 3WEMA 1LLOA 4IGHA 4TXEA 5FF0A 2QV4A 3W1LA 2ZUMA 3D5HA 3MJMA 4TU1A 4AIBA 1XD1A 1GOMA 3N11A 1YIXA 1EFZA 3GXNA 4C6QA 3FGCB 3V5CA 1UWTA 3WMSA 1NFPA 3ZWSA 1YW1A 3H21A 3JUGA 3DC0A 5KINA 1VBUA 3N17A 3KL3A 4C6OA 3E0LA 5FOOA 1QVBA 3UP8A 3IARA 3R11A 2VRQA 1KRCC 2NV1A 2DT3A 5G1YA 3BLKA 1U2YA 1U30A 3E6EA 3KE0A 4RW3A 4M80A 3WLMA 4WEVX 3MB9A 4ML4A 4BWLA 2ZRUA 3DU0A 1R46A 3MKKA 2DFAA 4WDUA 4AYSA 4OHQA 3EWUA 5MKGA 5LNWA 1V8EA 4K37A 3M0KA 7REQB 3W22A 4HK6A 1E3XA 1DKWA 1RD6A 5K9DA 5EFDA 1A53A 3T6CA 4UMBA 3DI0A 4NZ1A 5HBFA 3O1NA 1CLVA 4GXWA 1EJSC 1J2WA 3MUAA 1JZ5A 2XZ9A 3KRSA 1Z48A 1EWEA 4WSJA 2VC5A 2PGFA 2GQ9A 3QC0A 4DQWA 3CHDA 2WHKA 2IQDA 3TNBA 4FNPA 1W56A 2QCHA 2RKXA 1TVPA 2QAFA 1R5YA 3S2NA 2AAAA 4MNMA 4XIMA 1YX1A 1CGUA 1FXQA 4EPKA 4CU6A 4L7ZA 2CETA 2PWEA 2Z2UA 4C6NA 3FJLA 4JN8A 4HNNA 3VIHA 4WSHA 3L4YA 3AALA 5DFAA 3ABZA 2RAGA 3A6OA 3NM3A 1K8XA 4DJFA 1VFLA 2C14A 3WLQA 3W7DA 3FGCA 1W9XA 2VEMA 3VX1A 3WLPA 1AODA 3ZT6A 2VFEA 4UFKA 5FA5A 3FEMA 4WQ6A 4PMQA 1VFHA 3F4VA 4LBRA 5FJOA 2E5DA 5CSUA 2QLYA 4XAZA 2IS7A 4LB4A 4FLRA 3GDMA 1TA3A 1B9ZA 2VQTA 3IIVA 4G1KA 1RD5A 4K2SA 4RE2A 5CEWA 2XVLA 4PMXA 4Q8NA 4DBSA 1BWVA 3ARRA 1IT8A 1SO6A 3IGHX 2QR6A 3P74A 3MKCA 1YTEA 1KWKA 4GIEA 1FWAC 4W85A 1P48A 4FOJA 4HP5A 3U9IA 1VLIA 3DERA 1F4HA 3VNMA 2QCCA 2WSKA 7REQA 3QSTA 4HSHA 3QR0A 2VFHA 1XLMA 4UOZA 1ZALA 1W5MA 1CGVA 3IJLA 6ENLA 1L0PA 4OU1A 3RYSA 1ICPA 3W4RA 4YL2A 2GUUA 3BE7A 3QTGA 1W9DM 2WNQA 2GLKA 2GSEA 2OZ0A 3GDKA 1I0BA 3JS3A 4UQEA 5XIMA 2HMCA 3LNMA 1XYZA 3HF3A 2ZRYA 1V3KA 1CLKA 3LXAA 2VURA 3R0KA 2FZDA 1X97A 2X1TA 3QR3A 4FIQA 3KOXA 1LRQA 4ZE5A 1GEQA 1RCXB 3I3BA 4HU4A 5LKYA 1WB0A 5DX7A 3A4WA 5HULA 2Y70A 3P93A 3GH5A 5EYWA 3Q65A 5AC5A 5FI8A 2DZUA 2NVCA 3BDKA 4KERA 1EQCA 4JOMA 4DXXA 2WVTA 1TPWA 3V3WA 3SRFA 1AW1A 1JD7A 1T6MA 2CPUA 3CGTA 3NTYA 4NF7A 5BCAA 4LY8A 3KEHA 3VNDA 1JR1A 2X0HA 4YTRA 3LZ3A 3EOSA 1E0WA 4M0XA 4H9MA 3DC8A 3DFOA 2D2JA 2PDFA 3VGDA 4JTIA 3WLKX 3G0XA 3URNA 3WQ5A 4PUMA 4JDYA 1RK5A 3NQDA 3CHEA 4MGGA 2VZTA 3W1MA 1SUXA 2E6DA 4F0MA 3V16A 1LT7A 2OSYA 3PZQA 2V3EA 5HNRA 1K4GA 1NELA 2A3BA 2ESCA 5HNTA 1L6YA 3T9PA 4XK2A 1YNQA 4Q8MA 4TX9A 2VFDA 4AWEA 1OC5A 4IQDA 4HJFA 3EGJA 4D6HA 4PUDA 1H3GA 2X41A 3DDMA 3SRHA 4KGLA 1EA0A 3MHGA 4FR1A 2LLEA 3CPUA 4UCFA 1RP9A 3NURA 2QUTA 4DWDA 3KVLA 5G4WA 2RFGA 1IT7A 1VQTA 4PEEA 4XTDA 5C71A 1NP2A 2QMJA 3EEZA 2VVNA 3AROA 2BHYA 2R1MA 4D6DA 2OJPA 1B4EA 2GGJA 3I6RA 3N15A 4Q7IA 1AW5A 1V02E 3TR9A 3IJDA 3M5XA 4R88A 1Q6QA 5D9OA 3WH7A 1HJQA 3AHXA 1WDRA 1C9DA 4HD5A 1V02A 3CBWA 1NIUA 4XD5A 3AIQA 5E6YA 4UTUA 3C2FA 4GY7A 4XVEA 1JI2A 1NFGA 2DH3A 2QS8A 4DLMA 3A24A 2WVUA 4GYKA 3OU8A 4KEVA 5HJLA 5BYWA 1LQ2A 3GVWA 5A8GA 4DO4A 1GJPA 1OFAA 3LHUA 2ISFA 5LHEA 3SGZA 3TYEA 1XGDA 1V6TA 1MDRA 2O56A 3FW6A 4NQ1A 4AD5A 4L6HA 2YL9A 3EZ4A 4HNVA 1QPNA 1GEHA 3MO7A 3U7VA 1A3XA 1JDCA 3LBCA 1XGZA 3UY8A 4FALA 5DBTA 2WKGA 1W1VA 4KPLA 5CGMA 1E4NA 3MU7A 3B0VC 2NVAA 2EPHA 1R3YA 4IISA 4KRTA 1KM3A 2FGBA 3HA1A 4AZ6A 1S3TC 3KDNA 1S38A 2J24A 1GQJA 1XYAA 2DZTA 2PF0A 5H1WA 1ADDA 4PFMA 5KITA 4F0RA 1GOQA 5IRPA 4NJHA 3KRBA 4IIHA 4UBPC 4CNNA 3L5AA 3V7PA 3EAUA 3R94A 5EMLA 3LK6A 3QRHA 2TYSA 2O9TA 3NXFA 1ISVA 3TX9A 4PN2A 4DF2A 3TN3A 3B8IA 1PDZA 1GW9A 4DBDA 3TK7A 4O1FA 1CWYA 1KA9F 3UWYA 3ES8A 1OX4B 1E72M 3IAQA 3CWHA 1US0A 1V0LA 1JRCA 3ZLHA 3AWOA 3VPLA 1XJBA 3B9EA 2WMKA 3UZ5A 1O4UA 3NVDA 2VL4A 3G1XA 1OGBA 3HGOA 1A5AA 3H70A 3GB6A 4N02A 4QDWA 1JUEA 1LBFA 3B04A 2VR5A 5C54A 1J0KA 3N6HA 4PUEA 1UZ1A 3EMZA 1TV4A 2PTDA 2Z7KA 1S5TA 2XU2A 3R79A 3ANVA 4JX5A 3F4NA 2HSAA 1O1HA 3ICJA 3KCJA 3SO7A 3UESA 1A5KC 4ACZB 4O28A 2FPTA 3VGFA 4IP5A 4Y9AA 1GPFA 1VLWA 4LUYA 4UZSA 3PM6A 4RXFA 5I79A 3CV2A 1YXDA 4DJFC 4EWND 1ONXA 1GKPA 5DCDA 1MQRA 2NT0A 1R2RA 1T8QA 1WQ5A 4RPPA 1BQGA 1GONA 3ZT5A 1S5NA 4AZIA 5D9PA 1HZYA 3MYOA 2CLPA 4BEUA 1B3WA 3GXMA 1W3HA 3L2LA 1UOKA 3CJPA 4PMRA 4HMNA 2BGQA 1WDPA 1KM6A 2A7NA 3STCA 2FJKA 4TO8A 3SUWA 4FS9A 3T09A 4P7OA 1NJJA 4IJCA 2J75A 3IJIA 1X8CA 4I5UA 2ZXBA 1JPKA 3N73A 1M01A 4C6KA 2KX9A 5BXPA 2G4JA 4Z1CA 3VKAA 3GS6A 1PO9A 1YHTA 5F7UA 5T9BG 3SCVA 4XUGA 4M8UA 3CIVA 3E0WA 1OQFA 5JBEA 2UBPC 2OB3A 4C91A 3MJYA 1CPUA 1SVDA 4Q6XA 4GFSA 3KS5A 2FVLA 4LS2A 2HS6A 4PMZA 4J1OA 3CZKA 3TAKA 1LL6A 4Z1YA 5EL1A 4MDPA 2Y7GA 3BSHA 3UWEA 2I17A 1E15A 1I60A 4MJZA 4RNIA 3PWAA 3GTXA 1KBIA 2PP3A 4CQCA 2GJRA 2OSWA 1V03A 4NIRA 4GRSA 2EG8A 4ACZA 1U5VA 5AN7A 1QO5A 2NQLA 1RY0A 1E9YB 4JKLA 1V6UA 1IR2A 4AWUA 1U33A 4HA1A 4PTMA 4B5TA 4NASA 1IF2A 5K3VA 4W4QA 3EB3A 1ZUAX 2Y7DA 3AIRA 1DWAM 4XB3A 4B3KA 5LIXX 2BOFX 4AIUA 4R9OA 3BG3A 5ABHA 3SN4A 5EMMA 1NOFA 1YDOA 2WPBA 1Y7VA 4JKKA 3XINA 4CEUC 4QM1A 4DO7A 2ZUVA 1QWKA 4GUGA 1Q7ZA 3S8HA 1CCWB 2Z2BA 5F4SA 5HAOA 3AS2A 4L1GA 3U2OA 3R89A 1E4IA 4UC5A 3BLDA 4UTTC 1FWFC 3A5FA 4IIFA 1ZBWA 3NPVA 4GQQA 1DIOA 2PRLA 5A3HA 3HU7A 4UTMA 1YMYA 4W87A 1BWLA 2J25A 2OO0A 1AA1B 3PSWA 1HGYA 4FMVA 2Z1VA 3PJWA 3T0AA 3WQEA 5M1TA 4DRSA 1CT5A 1FTXA 4CU7A 2OQYA 4O15A 5AYBA 3CAKA 2FDSA 4RZ6A 2P50A 1E9LA 1SZEA 1A5OC 1XRFA 4H6KA 3N2BA 1UKOA 3R25A 2NQJA 1Q4WA 2A85A 1EZ2A 1LTDA 1SFSA 1SM9A 4YTTA 4BI6A 3VD7A 4RNFA 4C1NB 1RPKA 1TTIA 2QUMA 3KFTA 4Z0SA 3H8AA 3T42A 4PZVA 4HHPA 4RX0A 3VINA 3DYMA 2BXYA 3G1RA 1FH8A 1KXVA 1MWOA 1JAKA 4U33A 4IMDA 3U2ZA 3M6DA 3TH6A 3FKRA 1LDCA 4P8WA 4GC3A 1KW1A 3WLTA 3HG4A 3PTMA 1RA5A 2J7CA 1XLLA 3C6CA 3EOEA 3VDAA 3LHTA 3VIJA 4CCDA 1H1NA 2V2HA 2PP1A 4U28A 1FWHC 4X2PA 1REQB 2YR1A 3HO8A 4B5WA 5K2ZA 2CCRA 2X1UA 4ERGA 4V28A 3WD2A 4DJEC 1MQPA 3BAWA 1K1DA 4S3CA 2DDXA 4OTKA 1IR1A 1NH6A 5IXEA 1F74A 1TWZA 3B06A 3ZYZA 3UT0A 4CQBA 3ZSTA 3G3MA 1GTHA 2QF8A 1MW0A 3T4CA 1PYFA 5JXQA 2VCCA 5A1AA 3UG4A 1WOAA 2A21A 1UPMB 3V36A 4M6QA 3VD3A 4FP1A 3VUPA 1W1TA 4P8VA 1Y5VA 2Y63A 4K7VA 2ZRZA 4H2HA 1OG0A 3N04A 3CLWA 1H51A 3WL1A 3G77A 1LG2A 3H7UA 1JPIA 4Y8EA 5ABGA 1P4CA 3NL3A 4ZSTA 2Y8KA 2VJXA 1TB3A 4UQDA 3RLGA 1J0JA 1EC7A 1VB9A 5M3WA 3C3NA 4HNTA 3Q2DA 3L2MA 3LDVA 1FWWA 1VEOA 3W1AA 4C1NA 5C6MA 4K8EA 2HV5A 4U4MA 4IIDA 4Q6JA 5C2CA 3T2QA 2ISDA 4GOAA 5FKYA 3WK0A 3W26A 4XKMA 1EBGA 3A13A 3BMXA 3FYPA 3QY6A 3AS1A 4ECLA 1EJXC 2VUYA 3M44A 3CL8A 3IGXA 3EX6A 1I2QA 3GVGA 1B3XA 4WY0B 4E5TA 4FIRA 1I2PA 1NAL1 1GVOA 1LRTA 2HNEA 2D69A 1REQA 2X42A 2YA2A 2FGLA 3T55A 2EJ1A 1QRQA 2G3FA 1WYIA 6TIMA 2V30A 1YDVA 4AUBA 4NAEB 1UBPC 3IACA 2XINA 1WUFA 2OPJA 3UJSA 3EB4A 1JRBA 3WBAA 2BODX 4TX6A 4FEZA 3IUHA 1UR8A 1XGEA 1ZAHA 1HJXA 1ZRQA 2Y62A 4YWIA 2FTPA 2VOMA 4R5EA 2EG7A 3VNLA 3QGKC 1CGTA 5CJMA 1L2QA 1LOSA 2E7FA 2UZ9A 3O16A 3O6DA 4GO9A 3EWDA 3LTPA 3ZZ1A 1B54A 1EEXA 5I7GA 1JUKA 4OUEA 5FJTA 1JZ2A 3L4WA 3CAQA 4PTXA 2D73A 5DY3A 2J88A 3IVSA 4IQEA 4YTQA 1UB3A 1LBMA 1POJA 4ASTA 1FWCC 4AMCA 4O0ZA 4JTFA 3O7UA 1D3CA 3S2MA 2HE5A 3W01A 1MEHA 2FQIA 3OVRA 3VDCA 1PZ2A 4AEEA 3AQUA 4MNJA 1LOQA 2FPYA 1FWBC 4X22A 2QW5A 2PDIA 3USZA 4UFLA 4DM1A 4YVPA 1KWGA 4C7DA 1WCGA 4H9UA 3MV11 4WY0A 2WM0A 1A5LC 4J2MA 4A29A 4A4AA 2F38A 1ONEA 3OQ8A 3TW7A 3TFXA 1AQHA 4AZ5A 3ZXWA 3UXKA 1F9CA 1MYRA 2VRKA 3FDGA 2ZUNA 5C70A 2R82A 1ZAJA 4G7EB 3MCNA 2IXUA 4QRNA 3GG1A 3RFAA 4BI7A 3NOYA 3M47A 5M5DA 5FSEC 4AG0A 4F9DA 3FA3A 1UR2A 2JKEA 1W1A1 1OM0A 5JUVA 1VIWA 4I7WA 4JGDA 1YPFA 3WD4A 3OO2A 2V8ZA 3N2OA 1E1CB 3N4AA 1SU5A 1EWDA 4C6MA 3U0HA 2YDAA 3PB0A 5EBAA 1J6OA 4GABA 3PUGA 3OVGA 3P0WA 3GYCA 3AI0A 4RDWA 3ARYA 1K02A 1CXKA 1TRDA 2NW0A 4L65A 4KF1A 2WMIB 5JBFA 1KO0A 4C65A 2X7VA 3T0BA 1BYBA 2F9RA 1TPFA 3AIBA 4GC4A 2RGMA 1XDMA 2OT0A 3QGAC 3E0VA 3R0UA 3BCFA 2I16A 3VIKA 2GYIA 1X98A 4AW7A 1Q2RA 1JXKA 3WQPA 1DXFA 3QQ0A 1QI5A 2CHNA 3ALFA 3OVPA 2PU0A 1EO7A 3QSRA 1KFJA 4QE4A 3HIJA 5GJMA 3EYPA 4HZ7A 4D1IA 1C93A 3F4CA 3KLKA 1NEYA 1QCWA 1GG0A 2OODA 2H8ZA 4F0KA 4EPDC 3FSTA 1VPXA 4ZXOA 4G7EA 3SJ3A 4Q4KA 2FYMA 2PD5A 4IQJA 4HCLA 1ME8A 1V08A 1A47A 3FV9A 3KWSA 1OADA 3LBOA 4TVDA 3ARPA 3A3XA 4OBTA 3G8EA 5F4XA 4FF5A 3KWXA 2WZHA 4WR3A 1JF5A 2P3ZA 2D3LA 2NX9A 5K4XA 5CPNA 3WLHA 4P8UA 1KQYA 2XSBA 5D09A 4Q7NA 1ZBKA 3BLPX 5LA1A 1JVNA 4GZIA 5T9CE 3CASA 1YDNA 1CLXA 4ATLA 5AHEA 3RO6A 1J96A 3C4UA 1GZGA 3E49A 1OINA 2WMIA 5AYIA 4EPEC 3NAVA 2Y88A 1BXBA 3UWUA 1MZRA 2PDLA 3AZSA 4HN4A 4JQ2A 3PSVA 2DZSA 3Q45A 4MDOA 4MY1A 4NZCA 4PBGA 2WSYA 1ZJAA 3QM3A 2OWWA 5HPOA 1P0EA 5DCBA 1YKWA 1HF6A 1ZFJA 1MUCA 3ITLA 3GNXA 4J40A 4Q22A 4CQAA 4Q8TA 4G9PA 1RUSA 3C8FA 1Z6KA 4QG6A 3RR1A 3DFPA 4E2VA 4PC8A 1IIGA 4DI8A 4PMUA 4S1FA 1TV3A 4F48A 2DJLA 4V27A 3W83A 3VM7A 1WDDA 1H41A 2OZ8A 3S47A 1J9YA 3AXXA 4PUUA 1WXJA 4W8AA 3VC5A 4Z08A 1ME9A 3DIPA 3SY5A 1EPVA 3LHYA 4ADUA 4FXRA 4Q8WA 4QCEA 3V18A 4JEJA 3EDKA 3L2IA 1SFJA 3NQFA 3MWAA 1R3VA 2NX1A 3UZWA 3GXDA 2IKHA 4UZUA 5GNZA 1M5WA 3QY7A 3C52A 1JEZA 1SGJA 4RXGA 3VMOA 2ONEA 5CZJA 2OELA 4PYSA 3UZYA 4X9YA 2Q09A 1OX6A 1YE4A 1VJIA 3L5MA 3SGGA 5CPLA 2D22A 4DJDD 4GMEA 4EAMA 3GNNA 3UBPC 4M7SA 2E5BA 1TJPA 1TZ9A 1EC8A 2BHUA 2DJXA 2ZADA 4H83A 1IT0A 1R7AA 4XAFA 1QDSA 2JBMA 4GI4A 1XV8A 4WIWA 3WJSA 2IPFA 2Y0FA 5DF0A 1V3JA 5BRQA 4HOZA 2V5BA 5EU9A 4IT1A 4LVDA 5AZ0A 3WH5A 2ZOXA 1AMKA 4XVDA 1CTNA 5DO8A 1TE6A 2CZ5A 4O1CA 4M7TA 1FWSA 4PCNA 1JGMA 3ZS4A 2E9LA 1JCLA 1E6SM 1V0MA 3BLFA 1GKQA 6CGTA 3CQKA 5CAKA 3SAZA 4D8LA 3L4ZA 3KTXA 1KFKA 3CV6A 2PLJA 2SFPA 4GUHA 5LNVA 3NEHA 4MJ2A 3DAQA 2ZICA 3R6IA 3OP2A 4GQGA 3NJ3A 3GFXA 3RIKA 4WF7A 1EO5A 3P62A 3S5SA 5HATA 1K70A 1Q85A 3HGJA 5AB3A 3ARWA 4BFAA 2QNEA 1M41A 1SZRA 3OBKA 4UB9A 2J66A 4JTAA 1FKWA 3IS4A 1MNSA 4OECA 3S0CA 3I7QA 1EJTC 3BH4A 3TUUA 2YL5A 1AK5A 3UJRA 3N4FA 3GVVA 3EWXA 3MT1A 2OGYA 3EDJA 2DUZA 2P8CA 3VOCA 1R8LA 5BRPA 1FCBA 4ZO6A 3M07A 2XPKA 4YYCA 4B9ZA 4BF7A 2VUNA 1CW2A 4H19A 3SCWA 4C6IA 4J3SA 4PRTA 1V6WA 1RJQA 2PDUA 2DZPA 3W1TA 4LF1A 4RUBA 3UYCA 4A3UA 5LSMA 3QVQA 2XISA 4B5VA 1S1PA 3GTNA 3BUVA 2WKLA 3W1QA 3OIHA 4DM2A 1DIEA 5LZLA 2XM1A 4AD0A 1HT6A 1I1WA 3TA6A 1Z3NA 3GD6A 3LLDA 1WAUA 1JCNA 2J6VA 4S3FA 4EVZA 3B8VA 1H0GA 1A3HA 2R9RA 4ZFCA 2HK1A 4ZE4A 4CUCA 3RGTA 3K5XA 5JIPA 3QPEA 2ACUA 3AO0A 5HMDA 3U7BA 4MYAA 2GFTA 3KCLA 2UY4A 4MFDA 3E2QA 4Q8UA 1W3TA 3FVDA 3KVKA 3KBSA 3WJWA 5HJYA 1TTQA 3M46A 4MWAB 1TPB1 3B8SA 3BOXA 3SSZA 3SM0A 3O15A 5D8WA 4NL1A 2B7PA 2W67A 4JL2A 1G4TA 4JFVA 4MZ1A 1UH3A 1Z42A 4NYYA 3TKFA 4YCOA 3HGSA 4H9ZA 3NQ8A 3W2MA 1LWIA 2Z6IA 4GVIA 1V93A 2XIMA 1PAMA 4D8ZA 4B4FA 3CO8A 1W17A 1IQ8A 1Q65A 2VFGA 1V0KA 3DCPA 4DELA 2V63A 4UR8A 3QZ6A 2JQXA 5DELA 2XVPA 4WOZA 3GWQA 1V0NA 3IIOA 1I45A 1JQVA 4O0KA 1O5RA 3XIMA 1CECA 4NJGA 1BVNP 3LCXA 3GDBA 3NPUA 3P81A 1FKXA 2CKRA 3DFNA 3MY9A 2DZXA 4XZLX 3FNDA 3DHUA 4S3JA 1SQ7A 3S5ZA 3B3DA 3TJIA 2C19A 4M6UA 2XVNA 3WDIA 1XRTA 2W4XA 3V1HA 3C0JA 3W73A 3AHYA 6REQB 3K30A 3S9IA 2YCKX 1GWJA 1OHLA 4YN5A 4MWAE 3SI9A 4OBRA 3PPHA 5ENLA 3E96A 5FEPA 1S5VA 2E6AA 1CYGA 2I5GA 4A3HA 2E9MA 2PWVA 3LSBA 3W7NA 5GNXA 1JXJA 2JIWA 3AIUA 1IEQA 1RBOB 2OR2A 4IFRA 3QLLA 1OK6A 3AICA 1V7YA 5FL1A 3N2CA 4PTDA 2Z1XA 1DWIM 3B0PA 5CSSA 2Z29A 3P2VA 1YQ2A 1Y5WA 1Q63A 3C86A 5EFFA 3TE9A 1QHPA 4RDZA 5JVLA 2Z6JA 2G96A 1R30A 4Y9OA 1O60A 3WFLA 3PBYA 2C7FA 5AECA 1NDZA 4NAFB 4XD3A 3VCRA 2PZ0A 3M0ZA 3W7JA 2WMHA 3IGUA 2IQ0A 1EL3A 2WBGA 2C1HA 1W9BM 1QNOA 3E5PA 3MDUA 5A69A 2CHRA 3W75A 1XF0A 1N7KA 2QQ6A 2XFRA 2Z2AA 1UD3A 4XBJA 1T40A 2PDGA 3TTQA 1TPH1 1FDYA 2UY5A 3KLLA 3BAXA 3SQLA 5DT7A 2AL1A 1T0OA 2EF9A 4UTHA 2IQTA 3ITTA 4EF9A 3MCMA 3AYVA 3QZAA 1AZ1A 3IRDA 2DZWA 1TVNA 3JRKA 3WKZA 1VH7A 2DU2A 2QCLA 4MB3A 3RM4A 2WM1A 3LMZA 5C2XA 4QG9A 3W6LA 5G2IA 1WP6A 3KX6A 3QY8A 3S9ZA 3H23A 2DY3A 3UG5A 1SJCA 3PPFA 2Z26A 1GCYA 1UP2A 3ARUA 3W7CA 1GTEA 1JFHA 3MUIA 3PAJA 4UTJA 3ZVHB 4XWUA 2IKIA 1U1UA 1RQEA 3CPRA 3ONBA 3NFUA 4DWSD 1G7UA 2X1RA 1TRIA 1FHDA 4QR6A 4JAWA 5DBUA 5JIWA 2CBVA 3P14A 1PTGA 2W66A 3K4WA 5FACA 4IXXA 4R7JA 1RLCL 4Z42C 5J5RA 2AL2B 2OZ3A 3TV8A 3MSGA 3W38A 2BVWA 3NO5A 2ZRXA 1KRBC 3S46A 3W02A 5KZDA 3MSRA 3EMQA 1A5CA 2IMRA 3NG3A 1DHPA 3TTOA 3H4XA 4QXIA 4NAFA 3QC3A 3QPYA 5REQB 4ZEPA 1VPQA 2Z27A 4RDYA 1F8MA 4N9EA 4OOZA 4DZ5A 4G5DA 2J7HA 3WYZA 1OD8A 4KEUA 1P6BA 3Q4DA 1R3QA 2X40A 5HR6A 3UPBA 3VO0A 3UZZA 1PTDA 4Q8OA 2FHBA 3W7RA 3W71A 5G2HA 1LCOA 1O12A 4L9XA 4B2DA 3THUA 4MB4A 3WJZA 3N2XA 1TWIA 3DGRA 4DZHA 4Y6GA 1J12A 1E6QM 3UJFA 2B7OA 3B97A 4JQ4A 1WAWA 1CXIA 3EBVA 2OQLA 4CCEA 3UETA 1TR1A 1OEPA 5DXXA 4W9TA 4LX4A 3L65A 3H26A 1QI3A 2PS2A 3ZVHA 2L5HA 1DQUA 4HTBA 5U4NA 2Y4SA 2AKMA 2YW3A 3SCRA 1VCVA 3AMCA 5I09A 3S42A 3PJXA 4CD5A 1VHCA 5CSRA 4LNYA 3QMTA 1X6UA 4GX8A 4CN6A 3UA3A 1YYAA 5D38A 3TC7A 1UJQA 1YPIA 4XZNX 4Q4PA 4I9AA 2AL2A 1NOUA 3FXGA 5I5RA 3FFSA 4RKAA 2DIJA 5A6TC 4LEQA 4EXAA 3OW1A 1IXPA 4LAOA 3VD9A 1S2CA 3WK2A 3P6LA 1E6NA 3OZMA 3TN4A 3APTA 1JL8A 5HK4A 1YE6A 3OIXA 1FVPA 2E9BA 3MTWA 1VGAA 3GG8A 5HUOA 2FZBA 1XIGA 3BANA 3F4WA 4DNMA 3SCNA 4GBDA 1O5QA 4MJ4A 1J5SA 4IUGA 2BY0A 1MW3A 3CH9A 4GUIA 3B40A 5HINA 2WC4A 1AD4A 1H09A 3ZVIA 2VX4A 2ZVRA 3VDHA 3W7LA 2VMFA 4NNAA 2ISVA 3HJZA 1G7VA 1W8SA 2VGGA 1UKPA 3U57A 2GQ3A 3N12A 2PBGA 4BQ5A 4H8VA 5CKSA 3MC5A 4QE5A 1KR1A 2QPSA 2W5FA 1BF6A 2YL6A 1H7PA 3VTRA 3WIJA 2E8ZA 1KFCA 2PD9A 3DHDA 4AY7A 3N29A 1FX6A 3VFCA 2DEPA 2OX1A 3KXQA 4X3ZA 3PZIA 2Y2WA 2E6FA 1KLZA 2XN2A 2WK2A 3R5EA 3OG3A 2ZZ1A 3P60A 5A8MA 4MHBA 2WC3A 2BMBA 1P0DA 4R53A 1B3OA 1RZMA 5U7SA 4L9ZA 1TIMA 4UNKA 3VIFA 3GRIA 1NDYA 3W27A 1P0KA 1XLAA 4XKYB 3TONA 1W3IA 5BXTA 3H2EA 3E5BA 1R47A 3LGGA 4PCTA 2J78A 1J18A 2OX4A 4PUNA 4OIFA 3S5OA 4XAGA 3O0FA 1EF2A 2BSLA 4QJ1A 4OT7A 2FDMA 2PDMA 1M7XA 2G37A 2VP8A 1B0IA 3G1SA 2A3LA 4N6FA 2VR2A 1XIMA 2POTA 2CEQA 1L9WA 1OFRA 3WLIA 4TMBA 1F3TA 3P0XA 3PZUA 1P43A 4AISA 1IYXA 1VF8A 3W29A 4AZCA 3GH7A 4JN7A 4L80A 3P5YA 2NXIA 2QUUA 3VMNA 5HR7A 3GHTA 1RLDA 2G41A 1LL4A 3V0SA 4ZB2A 4GNVA 5EMJA 1UKTA 1I2RA 1A4LA 2Y24A 3PBGA 1T5AA 2A7RA 1NWSA 4NUWA 1IEWA 4EXBA 1HN1A 3GSMA 2G4FA 3OA5A 4AY1A 4BR1A 4TOQA 3TZFA 3HM7A 3LPOA 2QF7A 4OQVA 1R6WA 1T96A 3OGVA 2PWGA 4XKYA 5A8OA 3NQ7A 5F2GA 1IZKA 1F73A 1J11A 4AXNA 5G4EA 3BMWA 1Y5XA 3NL5A 1V6VA 3FOKA 4LC8A 4KWUA 2POZA 2OLHA 1X96A 4K8HA 4AVOA 3UCQA 3EEGA 4R7WA 1RHCA 3W2KA 3DHPA 1F5ZA 1B2YA 1NVMA 5A5WA 2ZX5A 1EBHA 3MI6A 3WF4A 4C6BA 3CUZA 4PUWA 3G1FA 4O0QA 1FCQA 2CBIA 4IPLA 1HP4A 3NL6A 3KAOA 5A95A 2W91A 1THFD 2G0WA 3SW6A 4C7GA 4JEQA 2CXEA 3DBNA 1PPIA 4UTKA 2BX7A 1XKYA 4O16A 1XIBA 3EXTA 4GUJA 3BK0A 1YEYA 2QJMA 2E67A 1JIBA 3Q94A 2BG5A 2PWFA 1EXPA 4Z0JA 1SW7A 1N8WA 4GFIA 4LCSA 2W62A 3UGRA 1I75A 2WQPA 4MUZA 4O1AA 4AHOA 3UNTA 2X2GA 4W5ZA 1B3ZA 5ABFB 3M41A 3GNPA 1MFUA 4YIWA 1V77A 1SSDA 3BXWA 3VNYA 1N82A 2G3JA 2YBVA 4PUJA 4LAKA 1AQFA 4F4RA 4XZHA 1FP9A 3SADA 4YNGA 4QLKA 4PEKA 3IEBA 5EY5A 4G8TA 3QMSA 4D6CA 5G1TA 3CH0A 4JQ3A 2P8BA 2DIKA 4ACYA 1M7PA 3W25A 2WSQA 2CKSA 2PU1A 5DEZA 1F6YA 2JK2A 3AU2A 3MSDA 4GH3A 4C6JA 4HA0A 3CMFA 4U31A 2H3BA 4KKXA 3FJ4A 3L0KA 6PTDA 1BTMA 1R7OA 2CC0A 1UCWA 1SZNA 4KFNA 2NQ9A 3M0XA 2DORA 2P3EA 1TYGA 2QULA 3OYZA 1UD8A 1T8XA 3OLGA 3M4HA 3T7VA 3HQ1A 3SRDA 2B0MA 3L9CA 3TQVA 2Y5SA 4HZMA 3ANYA 1Q6DA 2BY1A 2GVJA 3K8KA 5FL0A 2VM8A 3MHFA 1JDEA 4O8AA 1RR2A 1MUWA 3OLIA 3TTYA 1LF1A 3EX4A 4YXGA 4JPGA 3KBNA 4HYVA 4DIAA 2DUXA 1MSSA 2BVDA 2EJAA 3LZ5A 4NJJA 3GU9A 4JDBA 1RSCA 3WL0A 1JCTA 4N4PA 4A8RA 4TR9A 1OK4A 1J8VA 1MDLA 4L56A 4I8YA 4CGTA 1ADOA 4HVXA 4C5YA 3WNKA 3FSUA 3S2CA 4GH1A 1K6AA 4GUFA 5F2LA 1VKFA 3WDPP 1ZJHA 4M6PA 4DZIA 4E8DA 5D8ZA 1XUUA 4OE7A 1J0ZA 5E70A 4HNLA 1FCVA 1QW9A 4KFOA 1JZ4A 3LERA 5D2YA 4ICMA 5FJJA 2CHOA 4MZ8A 4S3AA 1HG3A 3MCOA 2Q6ZA 1VD6A 1J10A 3KRUA 4UXDA 1M7OA 2A7PA 1XLKA 1JYVA 4H7CA 1OYAA 1YLVA 3AJ7A 3P80A 3R43A 2ZZ2A 3ZR4A 1RALA 4E2OA 2YFNA 1Y0EA 3GFZA 4KRUA 4DZAA 4JNMA 3VCNA 3PUEA 2PSNA 4B3LA 3GKFA 2FZ9A 4OJYA 4NKCA 4O14A 4O57A 3ZM8A 4KCVA 1PXGA 4U3AA 3BL3A 2Q8ZA 4US5A 1WZLA 2RDTA 1QPKA 4ORIA 3NOEA 1C90A 2Q3RA 5CQ1A 1FXPA 1X39A 3NZPA 2E8YA 3PFMA 3QZEA 4MLRA 4INFA 3O07A 4AD3A 1AJ2A 1A5NC 1EH9A 2O4MA 5I02A 1E9ZB 2ZRWA 1F7BA 1NOWA 1GHSA 3VIPA 1W9VA 5KMYA 3QOKA 3TROA 4C6PA 1OZMA 1LP6A 1VFTA 3ERPA 2R1PA 5AHIA 1L2UA 3VMPA 2FMOA 1TMHA 1O94A 1DWJM 3MSYA 5JBDA 7ENLA 3EA3A 1I0DA 1AG1O 5KETA 2VFFA 2G8ZA 2QPUA 5DRCA 5HQMA 3PG9A 2OWXA 1UG6A 3F2DA 3THDA 4J35A 2WJZA 3R4IA 1DVJA 1YXYA 4GXPA 3WELA 3JR2A 2OOFA 1XLHA 1UROA 1RA0A 2J7FA 2D1ZA 3OHIA 2FHFA 3STPA 4WXZA 2GUYA 1HO1A 1KV5A 3BQ6A 4DYEA 4DXVA 3K4AA 5CJ5A 4OOUA 1DWFM 1UHVA 1XR2A 2WZMA 3PZTA 4NZ5A 2XGBA 3PTQA 3K8MA 1XYFA 4OV4A 3W6MA 5TQLA 4A3RA 1TCMA 2VVSA 3AXHA 1SFLA 1VBGA 1NU5A 2NSOA 2PF8A 3C0SA 4U10A 2RH9A 4QJ5B 2YX0A 3NYDA 2GVLA 4DAFA 2OWCA 2WB5A 1UR0A 3HPAA 1RP8A 5A6LA 3NGJA 4JICA 2O0TA 1FWJC 4MY9A 1IGWA 1E43A 3VGGA 2OVLA 5H8PA 3DENA 4Z1BA 4CCCA 4HNCA 4LYQA 4I6KA 1G6CA 2PDKA 1HX0A 3AMKA 3L4TA 4IMAA 1XIJA 2WWCA 4PH6A 3K4DA 4I9MA 2ON3A 3LI0A 3VM5A 1S2UA 3ITGA 2KAUC 2R1LA 3MZNA 4DY1A 3HMCA 1OFQA 2J77A 4J9JA 3U8GA 3CZ8A 4S2CA 4WDWA 4EXQA 3FA4A 1EJUC 2I7GA 3KW3A 3LD5A 4BCEA 4ZQRA 2WMGA 3RJYA 2G50A 3B9DA 2JGYA 4IFKB 3LGEA 4HBKA 4LS0A 4S3BA 3RM9A 3TQPA 4LT9A 3VNIA 3NL2A 2ANUA 3FXYA 1TQXA 4FK9A 3NR0A 2ZXDA 4NG3A 4GCAA 1PVNA 1LROA 1IGSA 2J7DA 5H8MA 6XIMA 2NWRA 3JZEA 2YJQA 4D6IA 4XZWA 2CITA 4RNHA 5AYZA 4RE3A 4F0SA 5I07A 3G1VA 1ZP3A 2VGBA 1XD0A 4JIPA 3S5NA 1W0MA 3G1AA 4Z17A 3MA8A 4S23A 4NXSA 2E40A 4O1DA 2MNRA 3DUGA 2EQDA 3CUGA 2FFCA 2CESA 4BHYA 4M24A 4V1YA 3EWBX 4UMCA 4NXKA 3LSCA 3MW7A 3I7RA 1ZB5A 1AL8A 4QNEA 3O0KA 1A5MC 3VKKA 5HWMA 3H2NA 1DWHM 1XI3A 3SEPA 2ZX9A 5FSDC 1O7AA 3DN5A 4FNUA 5G1MA 1EYWA 2NXHA 2EPOA 1AW2A 2YB4A 5IHRA 1GOXA 1U22A 1XISA 2V5JA 1EJRC 3CUIA 5KSWA 4AVFA 3CQIA 2GOKA 1TZZA 1Y8BA 3TSBA 1WDSA 4J3UA 1SJBA 2A3EA 4IFKA 4PTNA 1A0DA 1I2NA 2PFHA 4MM1A 1UMYA 2B7QA 2QDHA 1LJYA 1ZJIA 1F07A 3MP3A 4IIBA 2XN1A 2G95A 4R27A 2PZNA 3LQGA 2X0YA 4IIGA 1JI1A 3GR4A 4LY4A 4B5NA 2Y89A 2BY3A 4DNHA 2VZVA 5IHSA 1SW3A 4FNRA 1JPMA 4ICNA 3G8RA 4WOQA 3CAVA 4DUVA 1GVEA 1FRBA 4S39A 1Q6FA 4CQDA 4WZHA 1S39A 2QCFA 3W23A 3CHVA 3EB2A 4O11A 2O7SA 4JX6A 3A22A 3URAA 4IP7A 3H22A 2BZNA 4J27A 2ZWYA 4LVFA 5AC8A 1UIOA 4G7FA 3AHZA 1B4KA 1HKMA 2VTFA 2V5CA 3AMLA 4A05A 3EMCA 3TZNA 1LQ0A 1SSGA 3MYPA 2W27A 3PR2A 5CCZA 5I3IA 5E0CA 3KVJA 4AY8A 1XIFA 4D71A 5D05A 3EWYA 1TZ7A 1FFRA 3ONCA 1DJXA 4I8DA 4KH2A 3DFHA 1PWLA 3VOIA 4P61A 3IJ7A 3T81A 2DVXA 1UA3A 3UR8A 3E2RA 4JHOA 4H9XA 1SFTA 4GG9A 1TPDA 3TEVA 3NYZA 3URBA 5CPSA 3RO8A 4E8GA 2C6QA 5XIAA 3GC5A 4QQ3A 1M65A 1B90A 4E2BA 1QW7A 4O1BA 4UNIA 3P3BA 1XIDA 3NQCA 3ISIX 2G5WA 1H63A 5BOFA 4AIOA 3B8DA 4ZO8A 1QTWA 4IJBA 2WNZA 2IXVA 5I78A 3CS2A 1D2KA 2INEA 4NX5A 5BWAA 1JYWA 5C2GA 2BV9A 1IXOA 2OT1A 4QCFA 3G0SA 4LS1A 1JZ6A 1LLWA 4JFTA 3WUBA 4Y96A 3VKBA 3Q58A 3WMBA 3UZXA 1C8QA 4CN4A 3LRKA 3ECQA 3WUEA 3EOOA 2CWXA 3BG5A 2JALA 3CB3A 3BAIA 4CD6A 2UY3A 1TA3B 1R2SA 3CPGA 4JBRA 4HU3A 4FXSA 1UQZA 3WBEA 3W7QA 1PSCA 1VFOA 4QNWA 1K9FA 4AWSA 4AC7C 3QHMA 4LBUA 4UUIA 1B1YA 2CZDA 4R85A 3VKCA 3WD0A 1PZ3A 3NUKA 4JIIX 3G6LA 3PVFA 3EXSA 2VYOA 5LNSA 5AKQA 1JZ7A 3C0QA 4G56A 3AHVA 1BXNA 1HFBA 2YGYA 1XQKA 4X2RA 4PMYA 1FOBA 1NQKA 1O66A 1XC6A 4CD4A 3L4VA 5D9MA 4DJDC 1ZLPA 4YWSA 3IV8A 4KIRA 3U48A 3W7EA 1TG7A 3CV1A 1DJNA 1GVFA 2RJGA 3KBWA 2YKKA 1SO5A 3AWNA 1RCOB 3DHFA 1PBGA 3W9ZA 1FUYA 4JXCA 1OX5A 5BU6A 2FLIA 4KWOA 4AYGA 2O92A 4IPIA 2D2OA 4DWSA 3SUTA 4ORMA 4PTWA 3VOGA 3ZIZA 1QMLA 2Z4GA 1PV8A 3LLFA 3S1VA 1XLBA 4AMAA 2DSUA 3OYXA 4AZ7A 3HB9A 3UJEA 3PNZA 4P7NA 3GH4A 3MUZ1 1DP0A 1BRLB 2PDWA 3LHVA 1HVXA 1BGAA 4TUFA 2D0GA 3KTCA 2HVOA 4D72A 4Z2GA 2XN0A 1PKLA 3W81A 1UR3M 3QMRA 1B3YA 1XYMA 1TV2A 3HPSA 2ALRA 3EDEA 4GKLA 3U3HA 1KCKA 2V2DA 5D03A 2E1DA 1BHGA 4LUIA 3LPFA 1ZBCA 2OU4A 2VELA 3KUMA 1OFOA 4DX3A 3BAYA 2EO7A 1OB0A 4PL1A 3PTKA 2QVNA 3M43A 4FX8A 4J5NA 2F6XA 3N6JA 1NWRA 1OCQA 1J5TA 2PGWA 2I9EA 2PEVA 3HN3A 3S6DA 2TAAA 2OFJA 1GZJA 1A3WA 4L6DA 3NA8A 2IKJA 1XLFA 1FWGC 5FF4A 1M6JA 1QBAA 1OCBA 3GVRA 5HNUA 1BPLB 2AOSA 2Q71A 1FDJA 3E74A 1K8ZA 1UKQA 4E4PA 1UR4A 1BWKA 3DGBA 3PY2A 2F2KA 4Z2JA 1SO3A 3ITOA 3TXVA 5TF0A 3HTWA 1UH4A 2XYLA 2ZVIA 3N9RA 4R7OA 4AWTA 4Y9PA 4FOKA 8TIMA 5BROA 1FWDC 1DOSA 1XUZA 4C1KA 1QNPA 3BCDA 2D0FA 2Y1HA 3G6MA 4JHMA 3FA5A 2OG9A 3WQWA 1CNVA 1F3EA 4RPQA 5CC7A 4DI9A 4KETA 2OEMA 1VCGA 4DLFA 4LAUA 1BRLA 4JKMA 1LQAA 1K03A 1NF7A 1QK0A 1GYNA 2GK1A 3EOUA 2GUBA 3STGA 3RMJA 3LENA 4UTTA 2DSVA 4M82A 1E3ZA 2FZMA 3UVAA 3E9AA 3WDRA 1CBGA 4WJ8A 2PP0A 4R34A 3LEPA 2WHJA 3R2GA 3BQ5A 3PZMA 1NTHA 2VEFA 1VYSX 3EWCA 2EPLX 1S5WA 4NJIA 3SURA 3TW6A 1GORA 1B57A 2PUZA 1Q6RA 2G3NA 1XKJA 1JD9A 1LYXA 4FOUA 4D9PA 1KCLA 3GLCA 3ZJ7A 2XH0A 3TDFA 4L61A 3JU2A 1QW8A 3B05A 2O7QA 4AH7A 4EACA 3VVGA 3UEQA 2Y5EA 1MW1A 3VOFA 1OWQA 3ZR6A 3R58A 1HUVA 1JJKA 3IUIA 1O5XA 1YBQB 1VFSA 1RBAA 4HOXA 2TODA 3WQFA 2DV0A 1R3WA 4HCDA 3S2LA 1OT1A 1IV8A 3WN6A 2Y7EA 3UJ2A 5C9WA 5L6UA 3A12A 2HPMA 2WJDA 3UCDA 3TNOA 4UQAA 2DVUA 4CN1A 1D9EA 4QAWA 2VR4A 2GGGA 4AD4A 5H2ZA 1FHVA 1ITXA 3RITA 3UXDA 3WNMA 4A2RA 1GQLA 1X38A 3DBPA 4DO6A 4DJEA 4HHMA 4AX6A 3PULA 3WBWA 4ZOEA 4WK9A 3BURA 4JCLA 2NLYA 1WNOA 4E6MA 4PB4A 3CMJA 3NPXA 1W9UA 3RX2A 1OT2A 4JYEA 4HZ8A 3KL0A 4JY8A 1QAPA 3VD4A 1EP3A 1XICA 4LPCA 3RAOA 3HFYA 4U5KA 1CB7B 3RLVA 3T2PA 3L0GA 5DCEA 4K38A 4QS6A 1HJUA 1WO2A 1ZY9A 4V15A 4Q4MA 1NY1A 2E09A 2QHAA 5HJXA 3TAOA 4GGBA 3TCEA 2XIOA 4HOWA 3DECA 4WGHA 3R10A 4DYKA 1LRNA 1PCKA 4DEFA 1A5UA 4OWGA 5F4WA 3GU2A 3U4FA 2ATSA 3PZVA 4GY1A 4ZO7A 4AEOA 4ZGYA 4LV9A 5E9AA 1M3UA 3DH7A 1A0CA 1YBQA 2OGJA 3H7VA 3HQOA 3K46A 3F5KA 1QPRA 3BTNA 1B3VA 3QN3A 4JS3A 3KS6A 4TVCA 1ZZMA 3C2YA 2XFFA 5I3GA 2B7NA 3N18A 4PUKA 1KKOA 3NO3A 3KL5A 4R3UA 2QUVA 1E51A 2V69A 2WOQA 4UFHA 2XHYA 5FAJA 4KEZA 1ALDA 3W1RA 2WVSA 3TJLA 5CG7A 3APGA 2ZX7A 2CW6A 2PDYA 1QNQA 4JTEA 3W7PA 2VKZG 3ENLA 1V7AA 1JG9A 1ZAIA 3NXLA 1VENA 1X8FA 3WH9A 1D7FA 1H61A 4AD1A 3W1NA 4IHCA 4MFEA 1BSLA 3KP0A 1TO3A 4QTGA 2YDRA 3GNDA 1M03A 4DWSC 4JZ5A 1UQYA 3P5ZA 4D8AA 2H6RA 1XIHA 1ECEA 3E0IA 3CAWA 3J7HA 3L21A 2XH4A 3WLOA 3IPWA 5FJIA 4WD0A 3VOJA 1XLDA 5A2CA 4RZBA 1SO4A 3REQB 5LA0A 3G1HA 2VCBA 4GACA 4ZVJA 1ICQA 3W07A 3CUXA 3P8JA 1SZGA 3CZJA 1ECQA 4FO4A 5BXSA 2ZC1A 4H8NA 1XCFA 2Q02A 3W1PA 3SCSA 4O54A 3ZFHA 4RDVA 1XH2A 3NCOA 4N6EA 3BV4A 2FJUB 3LRMA 5FEZA 5A94A 4H7ZA 1JYNA 1OC7A 3JVAA 2HISA 5E09A 3QYQA 1Y65A 3HG3A 4BS0A 3GZ3A 4PMVA 2PCQA 1ZCCA 1XH0A 4MPQA 4MZYA 4C90A 3TOYA 3V0TA 3V35A 3TYDA 1VBHA 1DJHA 1TJ2A 2DGAA 1G1YA 1OYCA 2AQOA 4GD0A 4NT0A 3OB8A 4MADA 3G1DA 2GGEA 2XH7A 4BI5A 4XO7A 1SR9A 3VOHA 1EX5A 3LXBA 5CPOA 1T7LA 4JTUA 9CGTA 3R12A 4LRSA 3H55A 2O9PA 3H54A 5FESA 3OZPA 1GOWA 4JY9A 3LMYA 4UR7A 4GBUA 4AVNA 2YPIA 3WJXA 4WCJA 3OOQA 2GGIA 5AHLA 5DT5A 5A6BD 1KFLA 3SB0A 5CLTA 3TQKA 4RW5A 4NJKA 3GNOA 2BBFA 3REQA 3BSGA 2WLZA 3T0CA 3L5LA 1JDAA 2QGHA 4ZSUA 1SJAA 3NDYA 5A8QA 4XTIA 2GJNA 3R13A 4QISA 1X7IA 4I5RA 4H6RA 3TTEA 4LVGA 2YZ5A 4JNYA 3W2NA 3LCWA 1PB0A 1HXJA 5PTDA 2OXNA 4LQ1A 3W7GA 1DL3A 2Y6ZA 2YW4A 3S1UA 4GHRA 3GIYA 4IOTA 1B5TA 1L8NA 3OLEA 3N2TA 5LYRA 3TJ4A 3B0UX 1OFEA 4XD4A 4UTWC 3PC0A 3D3AA 3OJGA 4UWMA 3O6AA 5LXXA 2HK0A 2YBTA 1PWMA 3C2EA 3SECA 3NDZA 3G18A 1GYLA 5DLCA 4HA4A 4LVBA 4B9YA 1YDYA 3CU2A 4FHAA 3RCNA 4HPXA 3KZPA 5JQ9A 3VC6A 4BZYA 1ZCOA 1QXLA 1F61A 1N8FA 2V6AA 4RZ4A 3GK0A 3W85A 4AC1X 1N55A 1US2A 3CV7A 1EB3A 3W2LA 3B4YA 3M64A 1OFPA 1P0BA 5AHMA 4GI6A 3GX9A 4JTCA 3QLDA 2WVVA 3LXCA 3GE7A 2YL8A 4L9YA 3KBMA 2YLAA 1MXDA 1E0VA 2NVDA 1VHNA 3T0DA 3VIMA 4F2UA 1ZENA 2P0IA 2ICSA 3GFYA 1PYMA 2B81A 2ZZ4A 1ELSA 3G5EA 2ZDRA 1FWIC 4HMDA 3H53A 3UU0A 3M7WA 5ABEA 2XGIA 5I06A 3PTDA 4J3WA 3VFLA 1XDLA 3AUJA 8RUCA 4HMEA 3LNPA 4J4KA 2GJXB 4HNOA 3SY8A 3HMJG 3MZ2A 4DBEA 4LTSA 1QNVA 4FPSA 1X6NA 1S2AA 3MVIA 3RHGA 2Q01A 2GGHA 3QQWA 1R85A 4DUOA 5T91A 1W3JA 2OOGA 2VT0A 1YXCA 3NIYA 4C6FA 1Q7MA 2J7GA 1JYXA 3OZOA 2CZEA 3N14A 4F3HA 2JE8A 4K68A 4BA0A 6A3HA 1R9YA 1PKMA 1BEUA 4L64A 4NNBA 3ELFA 4LYKA 4GA8A 3WFZA 1UIPA 5I00A 2GDUA 3GHRA 3NNTA 3KTSA 4I7UA 1TUFA 3UWWA 5EA9A 1NQ6A 3QOMA 1MXGA 1NDVA 2C0HA 1UH2A 2PTZA 4J2PA 1P7TA 4M81A 3PBMA 4UQ9A 1HO4A 2YYUA 2C91A 1VS1A 3FX4A 1TJRA 5GQBA 3FIGA 3POHA 2WBKA 3ABSA 4IM4A 4ZTYA 3JW7A 3EA2A 2XIIA 4H8UA 1VEMA 5D2TA 2NQHA 4UOQA 4RE4A 4FNSA 1EJ7L 3SN1A 3AMGA 3OPSA 3D0CA 4ZQOA 1UP3A 1H0IA 3BAKA 4WLCA 4NI8A 3ABQA 3E1F1 3L0NA 2YFOA 2GJXA 2J8TA 3C61A 3T8LA 1F3XA 4JQ1A 4K36A 3QKZA 3QV6A 1VBRA 1LOLA 1KCXA 3DKLA 2PE4A 4HJWA 1SW0A 3F2CA 4M5PA 2DPEA 3IGSA 2NZLA 2XFYA 2VNCA 3UERA 2V3DA 1XLCA 3SUUA 1F8IA 3STEA 3WK1A 4OVXA 3ANUA 4ZR8A 2A4AA 3NZGA 1FWEC 1BD0A 2QJGA 3TOPA 4LB3A 2GDVA 3NQEA 2F8QA 3DXIA 2JKAA 4W7WA 2Q8LA 1DE5A 5DANA 4MAZA 1H7NA 2ZZ6A 3H6OA 4IX0A 1H1ZA 1UOZA 1ZBVA 1TR9A 3CB8A 4A6GA 2DZAA 3PJUA 2AGTA 3K1DA 2BOEX 4IP4A 5C5YA 3IWPA 4HK5A 5BW6A 1A5BA 1KCZA 4RR4A 1G67A 1WZAA 4BKNA 1G0CA 1QPQA 2NV2A 6XIAA 4QIUA 2X1IA 1OYBA 3BGJA 3C0LA 7ODCA 1K7EA 5D4YA 3F1QA 4X63A 2ZKMX 3OVQA 2RUSA 3ABXA 1GOIA 3R8HA 1GQKA 2QCMA 2FH6A 2BGNE 3INPA 3W7OA 1VZWA 4S38A 4IICA 3O06A 3M6YA 3HPZA 5DMMA