2FGBA

Crystal structure of human 17bet a-hydroxysteroid dehydrogenase type 5 in complexes with peg and nadp
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
323
structure length
312
Chain Sequence
MDSKQQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based inhibitor design for an enzyme that binds different steroids: a potent inhibitor for human type 5 17beta-hydroxysteroid dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C3
total genus 118
structure length 312
sequence length 323
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2fgbA00
3LD5A 4G5DA 4XVDA 3R6IA 1ADSA 4YVVA 1S2AA 2IKHA 1X96A 4XVEA 3V0TA 3LNMA 4YS1A 4JQ2A 4ZFCA 5AZ1A 4DZ5A 3WBYA 3EAUA 2HVOA 1ZQ5A 3KRBA 3UYIA 4PMJA 3BUVA 1ZUAX 2J8TA 2PZNA 1S2CA 2HE5A 4LAUA 4QR6A 2PD5A 4FALA 4NKCA 2INEA 3UP8A 4GIEA 1RY8A 2IPWA 4PRTA 4JTDA 1RALA 1QRQA 3D3FA 3ONBA 1AZ2A 1YNPA 1A80A 4OTKA 3LZ5A 2WZMA 3CMFA 3UWEA 2PD9A 3LQGA 2HV5A 4H7CA 2PEVA 2I17A 4DBUA 1MZRA 5HA7A 1IHIA 3CV7A 2ACRA 3CAQA 3LUTA 2PDIA 3LEPA 3ONCA 4WEVX 1Q13A 1VBJA 3T42A 1AH0A 3GHTA 2PFHA 3MB9A 2FZ9A 3M0IA 4QX4A 3BCJA 5DANA 2A79A 2DV0A 5AZ0A 1X98A 4XAPA 4JTCA 5LIWX 1YE6A 4H8NA 1PYFA 2PDFA 2R24A 2NVDA 2PDCA 1XGDA 4JQAA 3LN3A 2ACUA 4L1XA 3UG8A 4XO7A 4XZIA 1Z9AA 3B3DA 3R8GA 3GHRA 4AUBA 3R7MA 4YU1A 4LB4A 2F2KA 2R9RA 5KETA 4GQGA 2PDYA 4ASTA 1GVEA 1SM9A 2PDKA 3Q67A 1AZ1A 1MRQA 1Z8AA 3F7JA 4JTAA 4XZNX 1S1RA 3CV6A 3UZZA 4WDTA 4FAMA 5LIYX 3V35A 1C9WA 4WGHA 2PDUA 3MC5A 2IPFA 1XF0A 5C7HA 2ACQA 2PDQA 3R94A 1Q5MA 2PDXA 3P2VA 3VXGA 1S1PA 2INZA 4LB3A 4XZHA 4WDUA 2FGBA 2PDMA 3EB4A 4JTQA 4EXAA 1T40A 3N2TA 3U2CA 2I16A 2DUXA 3FJNA 1AH3A 1M9HA 4JTRA 2WZTA 4PUUA 3WG6A 3M64A 4EXBA 2HEJA 1X97A 5LIUX 2FZDA 4QXIA 2PF8A 3UFYA 1EKOA 4PR4A 2DUZA 1PZ0A 3UZXA 2IPJA 1K8CA 3S3GA 4LBRA 4WRHA 1JEZA 1Z3NA 2FZBA 3RX4A 1LQAA 4DBWA 4Q3MA 2F38A 3NTYA 2PDBA 1YNQA 4LAZA 4FA3A 2FVLA 2VDGA 2BGQA 1HW6A 3O3RA 4Q7BA 2PDWA 2BP1A 4IJRA 1AH4A 2ISFA 3V36A 2ALRA 1FRBA 3C3UA 4PUWA 5HNTA 4XO6A 4JIIX 1R38A 2IKIA 2C91A 1EF3A 4JQ1A 3COTA 2IQ0A 1YE4A 4GCAA 3CASA 1QWKA 2IQDA 4HBKA 2IKJA 5JH1A 3CAVA 3O0KA 4RPQA 2PDNA 4PRRA 3LQLA 1ZGDA 4L1WA 1US0A 3EB3A 3QKZA 2PDLA 3G1RA 2ACSA 4QBXA 2FZ8A 3G5EA 4GQ0A 3DOPA 3R58A 1PWLA 3GHSA 4WDXA 1UR3M 1EL3A 3LBOA 2PDHA 5HNUA 4YVPA 3RX2A 3LENA 3R43A 3FX4A 2IS7A 4HMNA 1VP5A 2IKGA 3GUGA 3N6QA 1LWIA 2AGTA 1XJBA 3DN5A 4XZLX 3WCZA 1MI3A 2BGSA 5LIKX 3H4GA 4MHBA 3LZ3A 4GACA 1PZ1A 2HDJA 4XZMX 4JQ4A 2NVCA 2HE8A 4I5XA 2IPGA 1AFSA 1Z89A 3V0UA 5LIXX 4WDWA 1PWMA 4IJCA 2PDGA 1J96A 4JQ3A 3R8HA 3ERPA 3RX3A 2CLPA 4JIHA 1OG6A 5JH2A 1ZSXA 3UZWA 4GABA 1RY0A 2QXWA 1IEIA 3Q65A 3GHUA 4JIRA 4YVXA 3BV7A 3UGRA 3BURA 5M2FX 4XK2A 4DBSA 4GA8A 3H7RA 3H7UA 2HVNA 4LBSA 2P5NA 3V0SA 3WBXA 3M4HA 4IGSA 3UZYA 3WBWA 1T41A 2PDJA 1EXBA 4FZIA 4ICCX 4F40A 4R9OA 2PDPA 1HQTA
chains in the Genus database with same CATH superfamily
4J1OA 2CESA 3ICJA 4N02A 1D3HA 5HMEA 1ADSA 4ZO6A 4XVEA 3QY7A 3SIZA 3LPOA 3L23A 3I68A 4NQ1A 2DT3A 1OCNA 3K1DA 3QLLA 2JKEA 3VOCA 2XSXA 2YCLA 4IL0A 3WNPA 3MT1A 2IXVA 1PCWA 1OY0A 2PP1A 1G69A 1ITUA 1JNDA 2DEPA 4HJFA 4AHPA 4R5EA 1A4MA 1BXBA 1CGWA 1WZMA 2WSQA 4MY9A 4GIEA 4JTGA 2ZX6A 1P6CA 2IPWA 1Q2SA 1XLFA 2XN2A 4JTDA 1UUOA 3CAKA 3LXCA 3GYCA 1K7XA 3LZ5A 5AVHA 4LT9A 3OG3A 4W7WA 3UWEA 2PD9A 4TMBA 1O6IA 1DJWA 1OX4A 1JXJA 4V27A 3TYUA 1ZFJA 3QC0A 4AVFA 2WANA 3BAXA 4KQNA 3ZLHA 1CECA 1GYLA 1LQ2A 4UNLA 4J4KA 5REQA 3W07A 1VBJA 3LB0A 1N7KA 3TCEA 3GHTA 3NQAA 5BOFA 2RDTA 4A35A 3EXTA 1VBUA 5AHNA 1M6JA 3W1TA 3F5LA 1ZU8A 3EA2A 4MTVA 4CNSA 3SY1A 3MVTA 3WLQA 4MZ1A 1KQZA 3G0SA 4K38A 5D05A 1R46A 2YW3A 4B16A 1KGUA 1GT8A 1EX5A 1XPYA 2VP8A 2QIWA 1YADA 1XH1A 3AIRA 4MY8A 4XISA 2DZWA 2QV4A 2EPKX 4QROA 2ALDA 3RR4A 1PYMA 3GTNA 4Q7IA 3U5UA 4CCEA 4HPNA 2JEQA 4J28A 3HB9A 4FXJA 5FJTA 1OFBA 2C3ZA 3GNRA 1B57A 3KS5A 1XF0A 2B7OA 1MW1A 3GK0A 3IACA 2YCIX 1NOUA 3RPTA 3S2MA 3EB4A 3G0XA 1KKRA 4GZIA 3C2FA 3L4ZA 2VDHA 3VD5A 1UIPA 4QEHA 1EJVC 4BI6A 4B90A 5J5DA 1RJQA 1GEHA 1JULA 1XCFA 2QUUA 3FA4A 1TMQA 3P3BA 5A8PA 1UWUA 1SSDA 2PC8A 3S2CA 1U5VA 3F03K 4Z1YA 3AJ7A 4RJEA 3BQ5A 3EBVA 1B4EA 1OFAA 9XIAA 3KAOA 3T07A 1K9DA 3ZM8A 1VCVA 4R7OA 1KB3A 4Y2WA 3EPNA 1VH7A 3H8AA 4PULA 2PURA 1UD6A 4Y8EA 4U5IA 3QJAA 1V02A 3CH9A 4WUIA 4GVGA 3C8NA 1AG1O 4EPBC 4UZSA 1T8XA 2ALRA 3WKZA 3CHCA 2YDRA 1TR1A 4G1NA 2F8QA 4GYPA 1YDOA 3K8MA 1S3HA 1ZJAA 4FIQA 4IL2A 5KZEA 4MDOA 4M19A 2ZRXA 3P6LA 1GQKA 2WJEA 1KO0A 3SCVA 2HISA 1Q7MA 4LGXA 4JNYA 2Q71A 5CC5A 3CTTA 4PRRA 4GFIA 1F6KA 4GY1A 2VD9A 5CGQA 1MFUA 2BHYA 2BODX 5L6UA 2AQVA 3AZTA 3DFTA 2UBPC 4AIBA 3T0CA 3WL0A 4QBXA 1US2A 4A3YA 3SN0A 2EXOA 3GX9A 2PWVA 1H11A 1FDJA 4WY0B 1UR3M 1I2NA 3W7RA 1K3UA 1SZEA 3LBOA 4X0VA 4NRSA 1E6PA 1PKYA 3M5YA 4ZXLA 4ACYA 3M5VA 3MSDA 2REQB 5CG7A 3UR7A 1Q6CA 3GXMA 1GNXA 3REQB 5D2XA 5FEWA 3IK4A 5K4ZA 1L8PA 3TJLA 1BQGA 3ENLA 2VCCA 1FH7A 3SSJA 1ZBKA 4XBSA 4XZWA 2HDJA 2R1PA 4Z1CA 1Z6KA 3WN6A 4IMGA 2IPGA 1WDDA 4INFA 3VDBA 3CV2A 3K8LA 3MYOA 4JY8A 4S3DA 4YCOA 4WDWA 2DZVA 1OWQA 5CPLA 4F3HA 4IJCA 1J96A 1JPMA 2XM1A 2OMAA 1LROA 1VR6A 1A5KC 4ZCWA 3VZZA 2CLPA 2EO7A 3HURA 1BHGA 1E3XA 4JIHA 4KESA 4UTWA 3GDTA 5BMWA 4GI9A 3LSCA 2XVPA 4H9TA 4HU0A 4LAOA 3BSMA 4HHPA 3ZQ9A 4OIFA 4GC4A 5BRQA 3BLDA 1PTDA 4HB7A 3WFZA 4L80A 1XBXA 4D1JA 3H12A 2J9XA 3AIVA 4JNMA 3IUIA 2WB5A 3AC0A 3SUWA 4HN4A 1AL7A 4ZE5A 2XTKA 4XK2A 1JG9A 3U8GA 3ITXA 3A5VA 1A53A 4JIEA 3IIVA 1JCXA 3LV6A 1T41A 1KTNA 1LRTA 4F40A 2D73A 5ECUA 1TQXA 1ME9A 1P0DA 3CYJA 3N9KA 2OLHA 4PEKA 1W9DM 1E0UA 4AMAA 3TN5A 4AXNA 4CNUA 3M0VA 2PODA 1TR9A 2XJ7A 3POHA 5I0DA 2YCKX 1O60A 4RV3A 3D47A 3RMEA 2HCVA 3VCNA 3ARWA 1W8GA 2DZPA 3L7RA 3LS9A 4E3TA 1IZJA 1TMLA 4JQ2A 2DVXA 4W5ZA 3W7OA 3CPGA 3CTLA 2B0MA 1ICPA 4DZHA 1J0YA 3A5FA 1QR7A 2NXGA 3W7NA 4RDZA 4PL1A 3CUHA 3TQ0A 1IGWA 1H49A 3HPZA 1KWGA 4IP4A 4J3ZA 3WD3A 1OGGA 1LJYA 1UR9A 1LT8A 2WAGA 2E8YA 1KV5A 3N9RA 5CBBA 1LF1A 2PMQA 5TD4A 2PWUA 1GOWA 1ME8A 4DJDC 2H3DA 3LOTA 3R25A 4HOXA 4DBUA 2WKJA 4FX6M 1H5VA 4J7RA 5G5IA 1PX8A 3PTDA 2BVWA 4ZQNA 3S6TA 1M5WA 4K7YA 4LV9A 2PRLA 2V3DA 1TWWA 4S3FA 4D71A 3AS1A 2XN1A 2W6RA 2Z1SA 3STCA 1V8EA 2ZRZA 5AYIA 2ZUWA 3MB9A 3L4TA 5I09A 1ODZA 4NI8A 3KRZA 3AZRA 4NJKA 3BCJA 1QHPA 2V5DA 3I3BA 4FI4A 4IQLA 4IMEA 4A3UA 2OX1A 4S2CA 1KFEA 4PYSA 1JRBA 2JEPA 4GC3A 4KMQA 2VXNA 3SW6A 3CM4A 3SCPA 3GXDA 1MEIA 3AUJA 1I2OA 1R7OA 1EP3A 1EA9C 1NQ6A 2WHMA 3QGKC 3ALFA 4D6HA 4AHQA 3S0CA 1OF6A 3B03A 4RL3A 2TMDA 3T4CA 4EPKA 3MJYA 4XKYB 2P10A 4CQCA 3BG3A 2ZVIA 1M04A 3LI1A 1XHGA 2ZUMA 1EA0A 1MO0A 4PSPA 4Q7NA 3EDDA 3CIXA 3UXIA 1MNZA 2ZUVA 3BAJA 4EX4A 3CUJA 5GNYA 3EWWA 5BU6A 3PZMA 1XXXA 2D23A 3H2EA 3VAVA 1MEHA 2BY0A 3K2GA 5ABFA 1ZAHA 1KM5A 1NDVA 3VDHA 3CZJA 1ENUA 2H90A 4W8AA 3SGUA 3ITLA 1TPEA 1C8QA 2WNWA 2DT0A 4ZL1A 4K1GA 1YDVA 3ISIX 1AQ0A 4EXBA 4C1KA 3L66A 3G24A 1J0ZA 4PR4A 2KX9A 1KFLA 3SBFA 4AD2A 1R3QA 2PTZA 1UH2A 3II1A 4GUIA 4MKSA 3NQFA 1A5SA 1TUXA 3S1XA 1GG0A 4LBRA 5E0CA 3C6CA 1LQAA 2X09A 3S2JA 3I6TA 4BKNA 3QY8A 2ISVA 3WQ6A 4JXCA 3H21A 1Y0EA 2VI0A 4RXFA 3S42A 1C90A 1BGGA 1F74A 1F4HA 4HZMA 2ZZ6A 3W29A 3WL1A 2RDWA 3ZSSA 4DJDD 3C3UA 3IIZA 4RE4A 4XO6A 1Q6LA 2QAFA 4PA8A 1V0LA 3UPWA 2W91A 3DYOA 4UFIA 4I9MA 8XIAA 2OXNA 1QW7A 1DORA 4K2SA 2XDFA 4ROPA 3U7VA 4IICA 1TVPA 3QPEA 1TV3A 3TNOA 5CC7A 3QMTA 4NI3A 3GRIA 1RXOB 1U1HA 4L1WA 3GR8A 5F7UA 3GIPA 1TMHA 3H22A 4NUWA 3CH0A 2CXEA 3OZMA 2VC7A 4JDBA 4LUIA 5AHEA 2Z00A 4NXSA 1I6NA 4AVOA 2QF8A 1KBLA 2XFYA 3PZGA 3BARA 1Q2RA 3LRLA 3OIXA 4HMNA 1GORA 1U5HA 2CZ5A 1DWHM 1NDYA 1TSIA 5BYWA 3AMGA 2FGLA 3F4CA 3TQKA 1JFXA 5CPQA 4Q8VA 3PULA 4CCDA 4GO9A 4N0RA 2P1FA 3SB0A 3RM8A 1W37A 5LIXX 3WUFA 5D38A 3KOYA 3DG7A 2J4GA 2WKGA 4DO6A 2AMGA 4W85A 1EBGA 3EOEA 2PCEA 2CZDA 2YSWA 3P8JA 4ZE4A 1P0BA 3T40A 2V3EA 4AX7A 2UY5A 4GABA 3WK2A 1OADA 2YBUA 3DHFA 1LORA 2RAGA 1G4PA 3IJ7A 4B5UA 3P7YA 1W91A 5C9WA 1P43A 1TTQA 4KFOA 1LYXA 5REQB 3TH6A 1U22A 1GQLA 3W3OA 3EWDA 1ZJHA 3E2QA 4BCEA 3ES8A 3H7UA 2P5NA 1HZYA 2VELA 2EG8A 4Z2JA 1VYPX 2Z2AA 4FXRA 2IMRA 3PFMA 3GC5A 1CZ1A 4XZBA 3WBWA 1E9LA 3C56A 3PNUA 3W7EA 2CBIA 4GH1A 3WF1A 5CPNA 4R53A 2BWGA 3JW7A 1F07A 1PV8A 5LXEA 3DC8A 3SCRA 4C6DA 4UOQA 3KCLA 1KCKA 4W4QA 5CGMA 2OWXA 4JR5A 2REQA 3PSWA 1ZJBA 4UTHA 3H4XA 5HATA 4DZ5A 5LNUA 5DCEA 3LLDA 1R3SA 3PZTA 3SQMA 3UT0A 2C0HA 3AISA 3PSVA 1ZQ5A 1UP0A 3ATZA 2FFIA 1JAEA 3EX1A 1WP6A 2WCAA 2GSHA 1TKKA 2HE5A 1VBRA 1KGWA 3N2XA 2WHJA 3UP8A 3A21A 3GFZA 3CWHA 2EAWA 3TYDA 3W22A 2NUWA 1UR8A 2QS8A 4RLIA 2E68A 2YDSA 1YNPA 5HINA 4RNHA 1H63A 1LRNA 1ECQA 1NY1A 3C52A 1A0EA 2XH7A 2QCDB 1MSSA 1YYAA 1AL8A 1UBSA 2VC9A 3WD4A 3EWXA 3Q2DA 5EMLA 1UR0A 2D0FA 5I3KA 2ZZ4A 5AYZA 1AQMA 1R3RA 3UXLA 1IT0A 4UTTC 4GIRA 3NQ8A 2F7FA 1DJQA 1DIKA 3PBUA 1UKQA 2QCGA 3VGFA 4GY0A 4A2RA 2VNCA 2JF7A 5LYRA 2XSBA 1D3GA 1XBVA 3B9EA 1A50A 4AD3A 2ZRUA 7ODCA 3TU9A 3TTQA 3HMJG 2ZZ1A 3HG2A 5LHEA 5K4XA 1KTBA 1EIBA 3MSYA 1JYNA 1OX6A 4K7VA 2X0YA 4FEZA 2B7PA 3OLIA 4BF9A 1TZ9A 3B8VA 2ZXAA 3Q58A 1JPKA 2VGIA 3OVQA 1X1NA 3GH4A 5A94A 2X8RA 1I0BA 2HRWA 3GBEA 1SM9A 4L9ZA 3R11A 2OR2A 3W6MA 4IXHA 4HD5A 4WHBA 1S1RA 2GGJA 3UZZA 4JFSA 2OPJA 3S1GA 5AECA 1BKHA 4DO4A 4DWSA 4ADTA 1W1PA 4IG2A 1XIIA 2IQTA 3R94A 1WAWA 4Q8MA 4JFUA 2YXOA 3QV7A 3I6EA 3VXGA 3ABQA 1VS1A 3I7RA 4JHZA 4UTIA 2INZA 3TNBA 3QFWA 3WBEA 2OKTA 2Z2BA 3WLIA 3MUXA 5CPMA 5A8OA 5E09A 4GNVA 3ARTA 3VCCA 3W7HA 4A3QA 4FX8A 3RO8A 6REQA 4IMDA 3U2CA 3PM6A 4GYKA 1W3LA 5GVJA 1GUVA 4G2DA 1J93A 3G2GA 3S6OA 3DKJA 1M9HA 1Q6QA 4PUJA 1OD0A 3H7VA 3W7CA 2Z0IA 3WZ0E 4GKTA 3UFYA 3VGBA 4U5KA 2YOCA 1WV2A 1K7FA 1QOXA 2FQIA 2XZ9A 2XN0A 3A12A 3BOLA 3WLMA 4L5ZA 2XINA 5CPOA 3GAKA 4Q32A 4DBWA 2YA2A 3LNPA 1UZ4A 4HTYA 4O1AA 3CZ8A 1WPCA 5AYYA 4Q7BA 3WEZA 3H2CA 2ISWA 3BLEA 5BROA 1ZALA 2Y8UA 4RDVA 1S2UA 3SSZA 3KBWA 1OFDA 3FLUA 3U0HA 4M6UA 2E9BA 1IT7A 3DFSA 4JHOA 2J7BA 4HK6A 2NUYA 4ZTYA 2YBVA 4JZ5A 3ANVA 3TKFA 5LA0A 3MPGA 3U2ZA 1H61A 1ISVA 1R8LA 4S1FA 4E0CA 1DKWA 2OZTA 4TTGA 4ZR8A 1JPDX 2IKJA 2H3BA 1S3TC 4CVWA 2OLSA 3BTNA 4HYRA 4NSBA 4WOZA 5I2UA 1TJ2A 3KVKA 3WEOA 2Q09A 1HKJA 4S38A 4E4UA 1E5JA 2VO5A 1K4HA 1KKOA 2QPUA 4LALA 3QR3A 3VOHA 1E1CA 1L6FA 3W2LA 2J7HA 3H54A 5A69A 2ZC1A 4CD7A 1OG0A 5F2LA 4FOUA 1XLBA 3W01A 1IXOA 4JFVA 4JKLA 5LGXA 2FH6A 3FX4A 1UD5A 4N7QA 5FF2A 3BPWA 2GSJA 3GUGA 3S5SA 5C8BB 3A24A 1EF2A 3UETA 1CX9A 1RJPA 3B06A 4X3ZA 2HK0A 2QCEA 3RILA 3DYPA 4BF7A 4MHBA 4GACA 3U9IA 3OGSA 8XIMA 3U4AA 3T7VA 3CIVA 5CZSA 3TJ4A 2NVCA 1M65A 3HIJA 2XFWA 3IWPA 1X1ZA 4HGXA 1YHTA 4O19A 3V0UA 3K4AA 2R1MA 3LHVA 3AYRA 3LHUA 1FHVA 1B30A 4QM1A 1CXIA 4QJ5B 5CEWA 2UV8G 5T9CE 1QI2A 2G37A 4UOJA 3L5AA 4XAYA 4IISA 3AIBA 1J6PA 4AXKA 3OW1A 3EDKA 4U3CA 4OJYA 4E2VA 4OUEA 2Q3RA 2ABAA 1RCQA 1IXPA 1QPNA 1ITQA 3ARSA 2QULA 3AYSA 2PLKA 4GXWA 2GWNA 1C8VA 1SZNA 3GC4A 3UG3A 1K8YA 1TELA 1VEPA 3OYZA 3NQVA 5CZTA 4WOQA 3LCLA 2A5HA 4MGGA 3OTRA 4PODA 4IGSA 2GL5A 4B3KA 1QOPA 1BRLB 1R85A 1KRBC 4ERAA 1R9ZA 5TBOA 2PDPA 3M0KA 3PZ9A 4Q8PA 3W75A 4XG1A 1HL8A 4JTLA 5KTLA 3WX7A 3APYA 4YVVA 5G2HA 4QSFA 5JMUA 5FCZA 4AW7A 2AAAA 1XRVA 4ZFCA 3AXMA 4CLMA 3RNDA 4KW2A 2YL8A 3VZYA 2QJJA 2DJLA 5HUOA 1OGBA 2ON3A 2BLEA 1EWEA 2OWCA 3UYIA 4DN1A 2ZA2A 2QEZA 3R4IA 2O4MA 1ZZMA 2UWFA 2WPBA 3C0QA 2NLIA 2A85A 1ZAJA 1BAGA 4GD0A 1J0IA 1J79A 4O0QA 2W3ZA 5M03A 3VYLA 1RALA 3UJSA 1BYCA 5D8WA 2PLCA 3B0VC 4OTKA 4XD5A 1XWYA 4DJFA 3GU9A 4X2PA 5HWNA 2X16A 1O94A 1R9XA 1HT6A 3VU2A 4L9YA 6REQB 2ZKMX 1BWVA 1JI1A 3RLUA 3APGA 2PEVA 5DMNA 2I17A 3I7QA 2PGFA 5IFPA 1UWQA 3CV7A 3FAXA 4QJ3B 3UD6A 2GVYA 4Q4KA 4Q33A 1H3GA 1DJIA 3E5BA 5T91A 4LCSA 5A6JA 4DNMA 2G50A 4C6CA 1PUDA 4V28A 5MKGA 3FOKA 4I7UA 4EACA 4B5XA 4A22A 3CQHA 1JGMA 1JCYA 1H50A 4ZQPA 3LLFA 1X98A 2EJ1A 4QLKA 4NX5A 3M07A 4XAPA 1CLKA 3S9IA 1FWDC 3PNZA 4HNLA 2JIWA 5LSMA 3WBAA 1P6BA 1JUKA 1UMLA 4WY0F 3JVAA 2E4TA 1RQBA 3ZVHB 4KERA 3ANYA 4XZIA 1Q6DA 4NG3A 3B3DA 3PWAA 2A21A 3IAPA 2E77A 3XIMA 2V0TA 4D6IA 5CC6A 3FYOA 4L56A 4ATLA 1BVWA 1V6VA 5DT7A 1J12A 5HXMA 3THAA 4XZNX 1EZWA 2NVAA 2OB3A 4MYAA 3ABRA 3MA8A 2W62A 2YR1A 4PMXA 3AMLA 1SJBA 3THUA 3KTXA 3WFLA 3NPUA 3VC6A 5E5CA 1MZHA 4GQQA 4LAMA 5TNVA 1OD8A 3CJPA 3RMJA 4XZHA 3XINA 2EPLX 4I7WA 4HA3A 2VEMA 2A4AA 3TXZA 4KFPA 2PDMA 1FCUA 4Q8QA 3SN1A 3TTYA 3PAJA 4JCLA 5I02A 1LP6A 4CVUA 5FL1A 4HZ7A 1GHRA 3QSTA 3FDGA 1HIZA 5EFDA 2I16A 3WQFA 2AAMA 1DXEA 3I7SA 5H2ZA 4H83A 2FHBA 3CHFA 2ABBA 4UTWC 4P2VA 4ACZA 4RNIA 2V2DA 1CPUA 1RQHA 1ECEA 1UR4A 2FZDA 4U4MA 4O8AA 3J7HA 3A4AA 3PR2A 5F4WA 3QHOA 1ZHAA 3KW3A 3AYTA 1XS2A 1VZWA 2DZSA 2PAJA 2FZBA 4O0KA 4ADSA 4ZZ9A 4PTMA 1WUFA 1H1ZA 1MXDA 1TWSA 2F38A 5FF7A 3VNMA 3HTWA 2FPVA 3OIHA 3W1LA 3DUGA 2BGQA 2WVUA 2J6VA 3NL3A 4LJ3A 4XTIA 3KVLA 2PP0A 3FVDA 1E6QM 3DGRA 3AO0A 1IIHA 3HG3A 1O1HA 4TX6A 1JF6A 4QS6A 4O1EA 1XGZA 3B8UA 4GI6A 2HZGA 1BF2A 3UNTA 4H6KA 1UWSA 3CT7A 3HJZA 2OQHA 2WSYA 3GR7A 3W7DA 3LHYA 3VMNA 3O0KA 1GWJA 2ZUNA 4ZQCA 4AY8A 1DTUA 2NV2A 1F7BA 4RDYA 3WFAA 1TB3A 3W6YA 2OSXA 4YL2A 4I9TA 4AZIA 4Y7EA 1HGWA 3KP0A 4FOKA 2EJAA 1GCYA 3G5EA 3W6LA 1GOKA 3GZ3A 1A5AA 4Z0JA 4C7GA 3D0CA 2XIQA 3EDFA 4W9TA 1EQPA 4O52A 2WMIB 1W3IA 5KITA 2WQDA 5KZ6A 2IKGA 3WD2A 1PXGA 1LWIA 1RLDA 3UY7A 4DO5A 4FO4A 4KEUA 2RJGA 4PBFA 4PCNA 2A6NA 3RRAA 3LGDA 4UQAA 3WCZA 2IXUA 1I2PA 1IWBA 4WJ8A 3GO2A 5H6HA 1QFEA 4JICA 2W5FA 4HA4A 3IVSA 3W2MA 2W4XA 4CU7A 1YPFA 3BJSA 4A29A 3TW6A 4J35A 1Q45A 1RVKA 2GGIA 3FY1A 4FNPA 1B9BA 2DZTA 5GJPA 4C6PA 3W81A 4HP5A 2XFFA 3G22A 4ORIA 3NGFA 3WMBA 1UH4A 2UZ9A 5C55A 4TO8A 4QAWA 1P0NA 1ZL1A 3W02A 1XYCA 5AC7A 1Q8AA 7TAAA 2ZYFA 2W92A 1XLAA 1F9CA 3SI9A 1GVOA 5GNXA 1V3HA 4B91A 1Q66A 1XLGA 1JCNA 1L6YA 4AMCA 4HCHA 3DDMA 2X1IA 4UCFA 5I00A 5BZAA 4JCMA 1NWTA 4GXMA 1Y5XA 4ES4A 3NYDA 2JGYA 2VKZG 3VOGA 3LK6A 1V6TA 3ABXA 4MJZA 1X8CA 3S5ZA 3SRDA 3N2OA 1HXJA 1NIUA 2WVVA 3E2SA 4MJ4A 2ZX5A 3KP1A 2XGIA 1XCWA 3HOJA 2DVUA 4N4QA 3LNMA 4JIPA 1QATA 2ZOXA 1CXFA 2KZHA 2EPNA 1G4SA 4H9YA 3V4BA 5LA1A 1K1DA 1WDQA 3SY5A 3O63A 3EWUA 3EOOA 2FH8A 2PZNA 1VFSA 1UD2A 5HAOA 3QN3A 3W24A 1RCOB 1XISA 3N04A 4GGHA 2MUCA 4H01A 3ARPA 5BNKA 1SZGA 4F0KA 1QPRA 3F4NA 3GXNA 1GTEA 5C54A 1QNOA 3QPZA 1H1YA 2W67A 5GNZA 4JY9A 1W1VA 3C61A 3GXPA 1OGSA 1OFRA 4C6EA 3FKKA 3VIGA 1HKIA 1MZRA 1EPXA 2ACRA 3USBA 3H2MA 3T78A 3LCIA 3E3HA 5BOEA 3WQDA 3VILA 4IPIA 3FXGA 2VFDA 1HJUA 3RYSA 2GJLA 3GDKA 3LTPA 4YIWA 1Q6RA 1RH9A 3KWXA 3VTRA 4F79A 2PBOA 3TN4A 4LX4A 4YTUA 2GJNA 2R24A 2NVDA 4PMUA 4L65A 3L4XA 2BB0A 1NWUA 1HVXA 3FNDA 3G1SA 5D4YA 2BOEX 3R8GA 1M7XA 5I24A 4N42A 1ICSA 2Z28A 3TZFA 3GDLA 1B5TA 3FKRA 3VNZA 1GPFA 3BLKA 5C70A 3LXBA 1E4LA 3FK4A 4P7OA 4TQTA 1LLWA 1F2JA 2WZEA 3PF3A 4Q4PA 4M56A 1OVDA 2CHOA 4K8HA 3O6YX 4AB4A 3CV6A 2QJGA 2GDQA 3B4UA 4L6HA 2OEJA 1VFHA 1HG3A 3KBSA 1XIGA 4GX9A 2MNRA 2GK1A 4N9BA 3S5NA 4US6A 1K6WA 1L0PA 5AHFA 3GKFA 4IGHA 1JVNA 4DAFA 5HQMA 4H9MA 5CJMA 1VJSA 1LTDA 5KINA 1JJKA 3SCTA 4F9DA 3TXVA 1YPIA 2PB1A 1CCWB 4MKNA 1BSLA 4PBGA 2VEFA 1VRXA 3PTQA 3FCPA 5CJNA 3QZ6A 4IIGA 3IVUA 5AB3A 1SQ7A 1XW8A 2Y8VA 3MP5A 1XPGA 5A8QA 4Q4QA 3M6DA 4FLOA 4GNJA 5DCBA 1G0CA 3FA5A 3N2TA 2OFJA 3OZOA 4LNCA 2ZWYA 2V8ZA 1Q85A 4Y9AA 1QAPA 2QQ6A 3VM7A 3C2RA 3UR2A 4JTSA 3BXWA 1XCXA 3CB8A 4PFMA 3H24A 2PF8A 3GC2A 1FWGC 3HF3A 1AW2A 1DBTA 3F2BA 1V4YA 1W2PA 3MMTA 2D20A 3HGJA 5JU6A 2ZZ3A 3MO4A 4J5NA 4Q4MA 1PZ3A 1G1YA 5DEZA 1H7OA 2DIJA 1LBFA 2E28A 2GYIA 2O9RA 1WBHA 5FA5A 2VDGA 2PDWA 1RP8A 2BP1A 4DJFC 1POJA 1TQJA 1U5JA 1JYXA 2VFGA 2X1UA 1W9VA 3HV9A 2E6DA 3NO3A 4DRSA 4H8VA 2BXYA 1MXGA 1TYGA 3WDQA 3FV9A 1SO4A 4LUSA 1QT1A 1I75A 2QCHA 4LEQA 4Y9MA 3VIMA 2Y85A 2R91A 1JR1A 2YA0A 5F2GA 1XH2A 3VIIA 3W37A 3VC5A 1JDFA 2G3FA 3OBKA 2OSWA 3ITVA 2DY3A 2ZCGA 3W73A 3L0KA 4C6FA 5AHMA 1NOWA 3AI0A 1IEXA 2PWHA 2V5LA 4I9JA 1E51A 1GGOA 3FYYA 2QUMA 1A3XA 2DW6A 3LA4A 3A3XA 3EPMA 4CNNA 4R85A 4CCCA 1OK4A 4K36A 5DELA 2G96A 2WMKA 1Q6OA 4D9PA 3MI3A 2QV5A 4QNEA 1NVMA 4XZ9A 4UQ9A 1UP2A 2PPGA 2YLLA 3QLDA 5FEPA 1TTIA 4EK7A 5DMLA 2E3ZA 1W6TA 3BH4A 3KOZA 4LV4A 3LENA 2ZZ7A 3EDJA 5E1QA 2WWDA 1PKLA 1FFRA 1FDZA 3M0JA 2DP3A 1LOSA 2X1TA 3CQJA 3ITOA 5E6ZA 4B5WA 1NTHA 2AL1A 1BEUA 3VD7A 4OOUA 2RGMA 5FJPA 4X22A 2CBJA 2C71A 4M6VA 3LDVA 1KC7A 3ITYA 1EDGA 1DIOA 1H1NA 1JD9A 1J0JA 4HMEA 3OOQA 2YB1A 3WUEA 4PL2A 1EX1A 5BXSA 1PWMA 4DBDA 3TN3A 4BQ2A 2FFCA 4PUKA 3WQWA 4C91A 4O54A 3ERPA 3VD3A 5FIPA 2GUUA 1U1JA 2VVNA 1SW7A 1QO2A 3QTPA 3VNIA 2I57A 3OHMB 3W1RA 3G6MA 3AHYA 1FTXA 1V7YA 2QXWA 5D9PA 2A3HA 4FXSA 1OSEA 4OT7A 2DSZA 3WQCA 4W93A 3CMGA 1UD3A 1C29A 1JZ2A 4EPDC 3N15A 1FWAC 3CUZA 1KRCC 3JRKA 1SR0A 3AHTA 4J40A 2ISSA 3WH5A 3LCHA 8A3HA 4KCWA 4DBSA 3SR7A 3FN9A 1GHSA 1TO3A 4HNNA 4E2OA 1QI4A 1MYRA 4K8GA 1OQFA 3I3DA 1ISWA 2PRHA 1HL2A 2PDJA 5DN1A 1M1BA 3MQTA 3CZKA 1C8XA 3NQ7A 1W3HA 4D1IA 4IFKA 3SUTA 2ZE3A 3A9IA 2CZEA 4G5DA 1EJRC 2PSNA 2IKHA 4LTSA 1IXQA 2GGHA 2FB2A 3WH7A 3CWOX 1XLJA 1GVSA 3DYMA 3DAQA 5DBUA 3GFXA 1XG4A 1I4NA 2E6YA 1H60A 1Y65A 2DH2A 4S3JA 1EEPA 1UJQA 1AMKA 1J2WA 3TAKA 1A5LC 2INEA 2UY4A 3AWOA 2A6LA 3QGVA 1XH0A 1W31A 3LPFA 4WD0A 3M7SA 4RDWA 5AKQA 1Y5WA 2EKGA 3WNNA 1A80A 4HZ8A 3WYZA 1TPB1 3VUSA 1DPMA 1YDNA 5PTDA 2BXVA 5EL1A 2YLAA 4M82A 2VURA 1PE1A 3W1MA 1RVGA 3BK0A 4GVFA 3ARUA 5FJUA 3ZJKA 3IGXA 2ZADA 4YNGA 4W89A 3GIYA 4H9UA 3W74A 4UQDA 3PUGA 2QPXA 1N8FA 1TRDA 3M47A 2VFIA 5C6MA 1AW1A 3ARZA 1FXQA 4QX4A 2WNZA 4S23A 3DI0A 4PCFA 3P93A 2OSYA 4AG0A 5U7SA 2J7FA 1EDTA 4H8NA 2PDFA 4IMFA 4Y9NA 3AHZA 3B0PA 3MUAA 4L1XA 3P82A 1RSCA 4JTFA 4MJMA 4DYJA 3IJ6A 5KETA 3WNKA 3EKZA 3VD9A 3GNXA 1B0IA 1F3XA 4W5UA 3CXOA 2PLMA 4QJ1A 1FCQA 1NFBA 4JX4A 2Y70A 4UTMA 1XGEA 5E70A 4C90A 5I3JA 1EOMA 4HVXA 5D30A 1KBIA 2BHZA 1U30A 1G4TA 3HQPA 4GIYA 1YXDA 4CQAA 2FLIA 3PBMA 4WR3A 5AN7A 2PU0A 3PBWA 5G1TA 1YTKA 2Z26A 5ECVA 2FVKA 2J24A 4US5A 3F5JA 1N82A 2H8ZA 2VYOA 3O07A 3TMQA 1T40A 3RU8X 3MANA 4LF1A 4JYEA 1FH8A 3FJNA 4HNUA 2J7CA 2J7GA 3NO1A 1I0DA 1EUNA 4AWTA 3UA3A 2Z2UA 1FKWA 2YGYA 2NT1A 3JR2A 4MWAC 1LT7A 4MY1A 3VIPA 1VF8A 1PZ0A 1S39A 4EF8A 3E96A 2P76A 1SFLA 3N6HA 1RJRA 1L2QA 3SIMA 5C71A 1JQVA 2D0GA 2VHLA 3I3EA 3ATYA 3G1AA 3OVPA 1H7WA 4GQRA 3KDNA 2CERA 1FWEC 4LAZA 3VNDA 3B04A 1HW6A 3ZVHA 2IUZA 3RN6A 3R79A 2BV9A 3W25A 1AJZA 4ZBCA 4AU0A 1E0VA 3VK5A 4KCUA 4JKKA 1H2JA 1QCWA 2BOFX 4P7QA 4HNTA 3W85A 4C60A 1X8FA 3E0LA 1FHDA 1UUQA 1JZ4A 4ZO9A 1OF8A 1YMYA 4WK9A 1EPVA 3LPGA 1QBBA 2GOKA 1LG2A 1NAL1 1QWKA 1AK5A 1RBLA 3RLHA 4Z2HA 2RKXA 4O1BA 3W1NA 2X41A 2OVLA 2X40A 1NQKA 4IG2B 3GBDA 4HNVA 2GGEA 1IXNA 3SRHA 3BDKA 4H7ZA 4XUGA 2DPEA 4UTTA 1ITCA 1DWAM 1UBPC 2J25A 2POTA 1V08A 1CGUA 3AU6A 3HFTA 1UASA 5HDRA 4GPNA 1FWCC 1XDLA 4A05A 2VVSA 3DG6A 1KWKA 1ISZA 4P7LA 3UU0A 1B3YA 1E1EA 2CKSA 3ABOA 2BZNA 4P61A 5K2ZA 2W9MA 3WMCA 3ZMRA 1BRLA 3E6EA 2G5WA 4HCLA 4AZCA 3BZJA 3K13A 1FX6A 5CJ5A 1WOAA 1V93A 3B9NA 3PWGA 2WO5A 3BOXA 1CNVA 4RE0A 1KTCA 3VMPA 3VMOA 2R14A 1B1YA 2OYMA 1LZOA 3EOUA 2YJQA 1MQQA 4RR4A 3PZVA 1FKXA 4UR8A 5G2WA 1XDMA 3TQVA 1QNRA 1BF6A 2B4GA 2R1KA 2BNJA 3BSGA 3SEPA 1ZCOA 1EEXA 3ZXWA 5CZKA 4DI8A 5D33A 4L1GA 5LIKX 2I56A 4C1LA 5B7ZA 4ZOBA 2E5CA 2GJRA 4NASA 2KAUC 5E0KA 4FMVA 1TV8A 3MMWA 5C9XA 4QE1A 1IIGA 4QISA 1PSCA 4KIEA 3CUXA 4QS5A 3M44A 4I9AA 3T0TA 3RX3A 4EANA 3FEMA 3N1AA 2NV1A 2QMKA 4GUGA 1OG6A 2ZBTA 3GXIA 2R1LA 4EPEC 4E4FA 1RY0A 4JX6A 1UA3A 1V0NA 2Z7GA 5H8PA 4HOZA 4TV5A 3TR2A 1HP4A 3QZEA 3CUFA 1E9ZB 4Y90A 3OVGA 4XX6A 4OV9A 5MKGB 1GOXA 1P1XA 1CT5A 3NO5A 3V5FA 3DI1A 4FHAA 1ISYA 1Q8JA 3UJFA 4A21A 2PU1A 1SU5A 3SZ8A 4LBUA 2Z29A 4OV4A 3CNYA 3UG5A 4M51A 1WZLA 8CGTA 3WLJA 3L68A 4GGBA 3QHNA 5DRIA 2BOGX 4ALDA 4HPJA 3DBPA 4BQ5A 1R7AA 4KS0A 4PTWA 2VZTA 5DMMA 5AHIA 2CWNA 3WELA 2A3BA 4YS1A 1CXKA 3MCNA 2Y7FA 2WC7A 2Q01A 3TOYA 5ABHA 1QNPA 4I5RA 1ZUAX 3UEQA 1XIDA 3CWNA 1K9FA 3KLKA 4PB4A 1S5TA 2D2JA 3B0XA 4L61A 1XSIA 3MI6A 3C2VA 3P5YA 3L4WA 3A9BA 4AHOA 2QDEA 3L5LA 1M68A 4U3AA 4EWJA 1HO1A 4Q4RA 5TQLA 2BY3A 3RCMA 3W0KA 3FEQA 1VIWA 4KCVA 1RA5A 3NQCA 3BJTA 2AGKA 3PZNA 1I1XA 5HA7A 2PGRA 2ANUA 3YPIA 4M6QA 1KNWA 1P0KA 4IF2A 3KHDA 4H4IA 1PHWA 3W2UA 5T26A 2Y6ZA 3L4UA 4RE2A 3EKGA 4UTLA 4LANA 3M0IA 4M24A 4QLLA 4QDPA 5M3WA 5DANA 4Q22A 1LUCA 2DV0A 4OVXA 2FB3A 2WBKA 2YL6A 1K02A 5EMJA 3E0IA 1LQ0A 2XIBA 4NIRA 2NXIA 1TPUA 1D2KA 3B8IA 2PDCA 1UYQA 4FS9A 1US3A 4JIQA 2WQPA 2G8ZA 2GVGA 2DSVA 2VZOA 3GTIA 1HJQA 1ZJIA 1EOKA 5XIMA 4RW5A 5F4SA 3RJXA 3ARVA 4P7NA 3CL7A 1XIMA 1ONEA 2J88A 3VIFA 4JTTA 3OQEA 4BFAA 4U33A 3SDOA 2W66A 2XH4A 1HP5A 4IX0A 1QPQA 1WDWA 2V67A 4WGHA 3PJWA 5C7HA 1W5PA 4YWIA 2ACQA 7CGTA 1TG7A 4K68A 1JCJA 3OBEA 1PAMA 4E4PA 3T8QA 1FCVA 4GJIA 5HR6A 2PZ0A 3CV1A 4WDUA 2FGBA 1DVJA 2TAAA 4JTQA 2H8XA 5C9ZA 4JDYA 2R1NA 4MB1A 1P5BA 4H9VA 1C7SA 4ONVA 4MB5A 1T6MA 4WSKA 1ESWA 5IXEA 3GW0A 5AHLA 4Q4SA 4IPPA 5CAHA 2DUZA 2VGGA 4Q6JA 4IQJA 3REQA 5JBFA 3DZ1A 4NZ3A 4D6GA 3IJQA 2WCSA 1GKRA 3S2LA 1Z3NA 3R5EA 1LUCB 4AYGA 5KEZA 2O9TA 3T0AA 1J11A 4MOZA 3ITTA 1YNQA 3CZEA 4HIBA 1XYAA 4QP0A 3RJYA 5CLTA 4KWUA 1AUSL 2XGZA 2P8BA 2NQ5A 3GYEA 4REQA 1E1FA 3B8TA 4TX9A 1E6RA 1V6YA 5DY2A 3LV5A 5F4XA 4OBSA 4V33A 4PUWA 1OINA 1THFD 3O1NA 1SVDA 4F66A 4ZMGA 4YTQA 1ZPTA 4CU6A 5J5RA 3GSMA 3TONA 1EH9A 2J6XA 4MWAB 2VEKA 2GWGA 1SPQA 3QH2A 3NSMA 3W9ZA 4JBRA 1W1IE 2VD8A 5JH1A 2GK1B 2V5CA 4JPGA 1SUXA 5FAGA 1GQNA 4RK8A 3MP4A 1PPIA 2ATSA 3I4KA 1OK6A 1UQYA 1KA9F 4A6GA 5DF0A 2BDQA 3T8LA 1BFNA 2G4JA 5CC3A 2Z1KA 1E0TA 3N13A 1ADDA 1JNEA 2V63A 2ZWZA 1MEWA 4QE5A 4GYFA 3TTSA 1M03A 3EWYA 2Y7DA 4ACZB 3RDKA 2V2HA 5A2AA 1E3ZA 4L4PA 3G3DA 1VP5A 1WXJA 3WLSA 1K9EA 3N6QA 4HT3A 5LXXA 4ZB0A 5IDZA 3KUMA 3SRKA 2HROA 5HJYA 3BLLA 3W4RA 4DX3A 3SCQA 3WLHA 4QIUA 5D2TA 4YPJA 1XIFA 3LZ3A 2ZTJA 3MV01 1XYBA 3EA1A 4Q6XA 1OC5A 1KFJA 4UQEA 2WOQA 2EBNA 2D2OA 2WMFA 1F8MA 7REQB 2OT1A 4DJDA 4FOJA 5FJOA 5A6AA 1EC7A 5JVLA 2ZZ2A 1JPHA 4FNTA 3S1WA 1DTNA 1IE7C 3ZFHA 3UWQA 3LY0A 1XLMA 1IEIA 3DKLA 3TWAA 3W7JA 4KEVA 2PCQA 2VEPA 3WD1A 4TOQA 1H51A 4TIMA 1HNYA 1FHLA 2BMBA 4AIOA 3CHVA 3TYAA 3KOFA 3AJXA 3DFNA 3VFCA 1RR2A 3MO7A 3FSTA 1C91A 1F4AA 3AQUA 1GPWA 1QASA 4BI5A 2QPSA 3VA8A 1V0KA 2W79A 4C6NA 4W88A 4WKFA 1ZS2A 3T0BA 3B97A 3E38A 2XPKA 5GPRA 1A0DA 3B05A 4J3XA 4OU1A 2TPSA 1YEYA 1Z32X 2FHFA 3OZPA 3R6IA 3EX4A 4GINA 2ZUSA 4GNKB 3BG9A 3NXFA 1DIEA 1R9YA 4HHMA 2OOGA 3V0TA 5EA9A 3T09A 3WLPA 1Q3NA 2XH0A 3KS6A 1FFQA 5B7YA 4Y9PA 1ZBWA 3ZJ6A 4XKYA 4LNYA 4RZ4A 3UA4A 3TWBA 3TA9A 1OT1A 2CIPA 2EGZA 3EB2A 4RE3A 3W38A 3OJGA 2Y89A 5KMYA 3B0YA 4LOCA 2P3EA 4NHVA 1HTIA 3DHDA 3BAYA 1PX4A 3STPA 3W28A 4AZGA 1QRQA 4YJ5A 1WAUA 1UC5A 1UW9A 4QDMA 4R34A 4E6MA 4UMCA 2VRJA 1D8CA 4AWSA 4CQ8A 1E6NA 1M41A 1M7OA 2HS8A 2PDIA 2DZBA 4LYPA 2XVNA 3SQLA 3RXZA 4PE8A 3N3MA 3SGZA 1MQRA 1RUSA 1HVQA 4GY7A 1J5SA 1UJPA 4Q8WA 1UMYA 4YTTA 4HPHA 2FVMA 5G1YA 2Z6IA 1WB0A 2DDXA 4ZQOA 3OO2A 4JOMA 3W27A 5LGZA 1K7EA 1JZ7A 1YE6A 2QYGA 4C6JA 3PUOA 3ZO9A 4IFKB 3KZPA 5HMSA 4KFNA 3UG8A 1ME7A 1O5KA 4BI7A 5AOUA 2R9RA 3SUUA 2GDUA 1UG6A 3WDJA 2YBTA 4WX2A 1SFJA 1BTMA 3CLWA 2CLOA 2YCLB 5GJMA 3TMLA 1AZ1A 1Z8AA 2YFNA 1EHAA 4WXYA 1I45A 3W70A 4JEJA 4YWSA 2Y24A 3IIOA 1TFVA 1TUFA 3VNLA 2FGZA 1S2VA 3MC5A 3RIKA 3TFCA 1B54A 1VFFA 2JALA 3E0VA 1T7LA 2BX7A 1BYDA 1UKPA 4YHEA 3CQKA 4DPPA 1Z44A 4PB3A 5EPDA 3PJXA 3W83A 1WBJA 4V1YA 2DSKA 3SCSA 3TJXA 1FP9A 1R3WA 2WZTA 4AVNA 4K37A 4QAIA 1C7TA 2FJKA 3VIHA 3A3HA 3T05A 5RUBA 5LIUX 1HX0A 3ZYZA 2QDHA 5AFDA 2FZMA 3OU8A 1W1B1 3VIKA 1SJDA 5BRBA 2LLEA 1QK0A 2ZC8A 2UY3A 1MUMA 1SFTA 3ELFA 1EHNA 2EKCA 1DQXA 4UTUA 5CLWA 2H9AA 2C16A 3GAYA 2OZ3A 1V0MA 4LCRA 2JBMA 2V5KA 2PTXA 3OLGA 4DXKA 2FVLA 2NQHA 2YA1A 3B4YA 3DBNA 1NOFA 2J7EA 1PVNA 1ZBCA 3L67A 3W23A 4DO7A 1G67A 1P1MA 4A8RA 2VDIA 2YDAA 4CD4A 1W1ZA 2PA6A 3MJMA 4NJHA 1B3OA 2VRKA 4JD4A 2ZDSA 4C1NA 1VFOA 4BF5A 1SMAA 3M1ZA 4JAWA 4IGMA 4ZOEA 4PCSA 4JQ1A 3O9NA 3C2EA 2AQOA 3IANA 3SFWA 2OOFA 4C6KA 3BAKA 1ZBVA 2PDNA 3GU2A 4GLEA 5EMMA 1Q7ZA 3EMQA 3MWCA 3C4UA 1MWOA 3LQLA 3FVMA 1LWJA 3IV3A 4M8UA 2GJXA 4C5ZA 3LCGA 2HSAA 4GMEA 2PDLA 2J75A 3AXHA 3N34A 3VKCA 4KF1A 2OQYA 1C92A 1P7TA 2C79A 3MDWA 1X1OA 2VGBA 2WLZA 2XH2A 4WDXA 3UNDA 2L5HA 1B90A 1UD8A 1UPPA 3W00A 1A49A 1I2RA 3R43A 3RR1A 4U10A 5LNSA 3CGTA 2XFRA 3K5XA 3NQDA 4D8LA 2ZX9A 5GJNA 3INPA 1MUWA 1JDAA 3OA3A 3BL3A 5DLCA 2QVNA 1EB3A 3PP7A 5SWUA 1JGIA 1NU5A 1RD5A 2F84A 4H7VA 4XZMX 1JFHA 2FJUB 4HZ6A 1R86A 2OZ8A 3BW4A 1AFSA 1SR9A 1OIMA 2PS2A 5G4WA 1FWBC 2DH3A 1VKFA 3H26A 4B4FA 3GG7A 1V3LA 1JCMP 2YXGA 4OWGA 1W2VA 1UHVA 2Y5EA 2PGWA 4R27A 3AMDA 1TA3A 1GVYA 2GGGA 1EYWA 2BASA 4UQBA 2ZDRA 5A6BA 4JIRA 3G1XA 3GG8A 1VJZA 3EPOA 5E9XA 4S3BA 4YVXA 3URNA 1VQTA 4AD5A 4UIOA 4G8TA 1V3IA 3BURA 4CNTA 2Q02A 1X38A 4NZJA 2ZA1A 4A3HA 4MDPA 2GPTA 1NFPA 3SCOA 3P80A 2VOTA 4O18A 3O0FA 2Z25A 1KM1A 3PG9A 4FLSA 3STGA 2QAPA 4RCXA 2XYLA 2ONEA 1HJVA 4M29A 4AEOA 4NZ5A 1WZAA 2J74A 3NSXA 4F2UA 4H6RA 2QCMA 5DT5A 2O7SA 4XVDA 1NWSA 3CPUA 4OBRA 3M6YA 4RZ5A 1TTJA 1VLIA 1X96A 1QVBA 2OGYA 4H19A 3AUOA 1H41A 4WKHA 4K39A 2XGBA 4X61A 5C7VA 3OP2A 1BG4A 4MFDA 4DWSD 2NT0A 3EAUA 3TSDA 1IGSA 4GK8A 1PL9A 3AMCA 3BICA 1C93A 3RAOA 4D72A 2VUNA 1B9ZA 3RM4A 3BV4A 2JFEX 4URIA 2J78A 2ZVRA 2DQXA 1WA3A 4PRTA 4H9XA 3VGHA 3N11A 3D3FA 3RF9A 1H7NA 1GYMA 1BXNA 1UKSA 4U28A 4UFMA 3CMFA 4QLJA 3VDGA 5JXQA 2VFHA 1GVRA 3IIXA 4LVBA 5MF5A 1D9EA 4LSBA 1W17A 1ICQA 4ZOAA 1QUMA 3MZNA 1E6ZA 3FA3A 1NELA 2Y2WA 3GG0A 4QG6A 3CAQA 3LUTA 4I8YA 3QQ0A 1J9YA 3ONCA 3H53A 3A22A 1F73A 3WDPP 2AKMA 3QV6A 1FBAA 2ZRVA 4DYKA 2CKRA 1BVZA 3F4VA 4GRSA 4O12A 1DE5A 1T96A 2GQ8A 2VX7A 1YQ2A 3GZAA 4Y8FA 3EOLA 1Z7AA 1GW9A 2X1RA 1DP0A 4ZSUA 4KIRA 1WYIA 3HQ1A 1LBLA 3HG4A 4JQAA 1BGAA 1J10A 4H41A 3UPMA 1G7VA 1AMYA 1NJJA 2VGFA 2BG5A 3R7MA 3WQ8A 3VOFA 3ZLFA 3FJLA 3T2PA 4B4HA 2AQWA 2PDYA 3MP3A 4L6OA 3KL0A 1VYRA 3M43A 3PY2A 4ZVJA 2D24A 1KM0A 3CL8A 5I78A 3HGSA 4QRNA 8RUCA 3QRHA 4J3TA 2QNEA 3WH6A 1VPYA 3BANA 5D2WA 3UWZA 1C9WA 1GOMA 4LVGA 4AWEA 3NPVA 1KCZA 7TIMA 4AISA 1E72M 3NAVA 4AC7C 2F6XA 3NQBA 3OODA 4CQ9A 3GM8A 2E6AA 3TYBA 5C2GA 2ZZ5A 3IUHA 3BG5A 2GZXA 4M80A 1TIWA 4LRTA 2CLKA 3O7UA 4NY2A 2NQLA 3LM3A 4EXAA 1LLZA 2X42A 1U2YA 2E1WA 1P6WA 1BYBA 4ZQMA 2Y5SA 4GO8A 1A5NC 2QLYA 4PMNA 3SCWA 4B3ZA 1NEYA 2FPTA 4IIFA 3RPMA 1G9HA 1M53A 2DSUA 1PEZA 3VNKA 3GXFA 3EOSA 5I7GA 1OCQA 4A2SA 4HSHA 1KR1A 1S2TA 3NJ3A 3CT2A 3LGGA 4W7VA 3RLVA 3ARQA 1W3JA 5K3VA 1LCOA 2OJPA 2ZIDA 3EKLA 3GNNA 1KFBA 4OQVA 1CXLA 4TTUA 2TYSA 3U57A 3W26A 4LS0A 1FRBA 4ILSA 3LPPA 3PTKA 4ZSTA 1RP9A 3ALGA 1BD0A 1WKYA 4MVAA 2XM2A 1EF3A 3MHGA 3ZJ7A 3WF3A 3AFBA 2V82A 5A8MA 4NP7A 4DWDA 1YE4A 4LRSA 1O68A 4Y6GA 2IQDA 1Y7VA 2BXZA 1KCXA 1RLCL 3TCSA 1GQIA 2WSKA 1IQ8A 4DBEA 4LH8A 3VIOA 1K70A 2F2HA 2JK2A 1ZGDA 3VDCA 3ZT7A 1S5MA 2QCNA 5L9FA 5EU9A 2HJPA 4M7SA 2R8WA 4ECLA 3W76A 4D8ZA 4OZOA 4O15A 3GD6A 3GVVA 3FJ6A 5HWMA 5KZMA 4GQ0A 1FWTA 3T0DA 1DYSA 4WF7A 1ZP3A 4HNOA 2QKFA 4RV8A 1DWIM 3PB2A 4RXGA 3HBLA 3S83A 2Z24A 4O16A 1XLIA 5HQEA 3S46A 4ZENA 1XLLA 2J47A 3V16A 1MFVA 3V7PA 2IW0A 3DN5A 4TVDA 2WJFA 1B2YA 3UXAA 4MJ2A 4C6BA 5I5RA 3LBMA 1KXHA 5T9BG 4HTBA 2H6RA 1TX2A 3IEBA 2VEIA 1KRMA 2DGAA 1TWIA 4IP7A 5XIAA 2WVSA 1WE5A 3TLQA 3RCNA 3GNPA 1JCLA 3IUDA 2NWSA 1PTAA 3LI0A 3QZAA 3W7PA 4UOZA 3AXKA 4Y9OA 1J2BA 1JI2A 1VHCA 1Z42A 1CLVA 1PDZA 2VFFA 1LOQA 3VO0A 3RK8A 5I07A 4PC8A 1OFEA 2VWTA 2YB4A 4X63A 3L4YA 2CXGA 1NP0A 2ZXDA 1DJHA 1FWJC 3AZSA 4ENLA 3E74A 3KCJA 2QCFA 3PJTA 1VAHA 4PMYA 3NOYA 3AROA 1UKTA 5A8GA 2Y63A 3STFA 3I6RA 3TN6A 3S47A 4IIDA 5M2FX 3VKJA 3OQ8A 4MZ8A 1OM0A 4GA8A 4C7FA 4YMZA 4KWVA 3N29A 3V0SA 4FXFA 4IIHA 2Y7GA 4B3LA 1P7TB 1E1CB 2CLFA 2Z1BA 1WNOA 1JUBA 3WLKX 1EJXC 3DC0A 5HK4A 3NEHA 4HN8A 4AZCB 3H4WA 4W87A 2AMXA 3ZZ1A 4F48A 4ZEPA 2ATMA 1V3MA 4JFTA 1PO9A 2WMIA 2QMJA 4PN2A 3BWWA 3PZQA 1OYCA 4JGDA 5EBUA 1IT8A 5AZ1A 3N9SA 4H8HA 3MCMA 4XD6A 4RUBA 4WQ6A 1TPDA 1QHZA 4G56A 3UWUA 4B2DA 3KRBA 1N8IA 1HJXA 4NNAA 3KDOA 4O57A 5F2MA 3LU2A 4PMZA 3RPDA 1OFOA 3FFSA 1TCDA 2XZ7A 4HA0A 1XLHA 2WJZA 4GIAA 1F6PA 3VIJA 4ATWA 2HBVA 4IXXA 1DEDA 4JKMA 3VINA 3BGAA 1SO3A 2DU2A 2X05A 2GDVA 5H91A 5ABFB 2NQJA 1X7IA 2HV5A 4IH3A 3UJRA 2HNEA 1QI0A 5I06A 4H7CA 3BMXA 2RUSA 1JIBA 4DI9A 4E2DA 3TC6A 1IHIA 2DZUA 2ZTKA 3C0LA 1GEQA 1FP8A 1SO6A 3NL5A 1UKOA 3EZ4A 3WDHA 2VZSA 1Q13A 1P4CA 3SGGA 4D8AA 4OE7A 1XR2A 4PCPA 4NAEB 4O0ZA 4S3CA 4QQUA 3WQEA 4C6IA 1OC6A 2E09A 1T5AA 2PP3A 4I8DA 3WQOA 1DJYA 1ZCCA 1UOZA 1JCTA 1IR2A 3QY6A 2H9AB 1GJPA 1JD7A 4BEQA 4Z17A 2RGLA 3PG8A 2V38A 3TSMA 3APTA 2HTMA 1E4MM 3MKVA 1XGDA 4R7WA 1QI3A 2ACUA 4H2HA 3HGOA 4BR1A 2I5IA 4MAZA 1CB7B 1PZ2A 1SJAA 1VLWA 3P62A 3GVQA 2E1DA 3PTMA 1W9PA 2B7NA 3QYSA 3G1HA 5DRCA 5BOOA 2YL9A 2WM1A 3IGSA 3ZWSA 2CBVA 4I6VA 1V79A 3L65A 1EC8A 2WV8A 3V35A 3CPRA 4MZYA 3F4WA 1E4IA 2Z1WA 4K1WA 1X39A 6TAAA 1WKDA 5A6KA 2EHHA 1RBAA 3UJEA 1A5CA 3WH9A 1S38A 1S1PA 2G3NA 2C18A 4LVDA 4WXZA 3T44A 2WXDM 4HU8A 3NEVA 2YZ5A 6PTDA 4HK5A 3GVRA 2W27A 5HULA 4A8NA 4CQDA 3T55A 4CNOA 3WMSA 4IZGA 3BAWA 4IFOA 1Q4WA 3CZLA 1K6AA 1IZCA 3BQ6A 2HEJA 3W1AA 1XUUA 2A3AA 3QV9A 4BK9A 1WKFA 2CZFA 1DJZA 1H0IA 1W56A 2CW6A 1J0KA 3R1ZA 1WO2A 4Q8NA 3BLIA 3ZT6A 3DFOA 3UZXA 3ES7A 1K8CA 3CYVA 4E3VA 3E1F1 3VI2A 3ME3A 3N6JA 1C9DA 1YTEA 3NOEA 3L21A 3FXYA 2OO6A 4Z2GA 3E2VA 2ZQ0A 1QW8A 4KWSA 3CHEA 3ABSA 5EMUA 2GLKA 2PLJA 2XG9A 3PBGA 1W5MA 1ITXA 2VUYA 1QNQA 4OBTA 2OELA 1VIZA 2O0TA 5HNTA 4EAMA 4GQBA 3NZRA 5FKYA 1P0EA 3I4EA 3SO7A 5JBDA 2C91A 3IV8A 2GVLA 3TTOA 4LFYA 2NSXA 1MW0A 1BXCA 4EP8C 5HMDA 1JAKA 4P8VA 3TAOA 5DO8A 5ABEA 2BS9A 1W3KA 1CWYA 2VMFA 3VKBA 4XIMA 1UZDA 3MBDA 4NF7A 1E73M 4O28A 3SJ3A 4IMCA 9CGTA 1K9TA 2A3LA 1W5NA 4HU3A 1VFUA 1DWGM 2YXXA 3QKZA 1PBGA 1I8JA 2E6FA 1V6WA 3L12A 4O14A 3Q4DA 3SURA 2YDQA 4ZODA 1GOOA 3AOFA 3CO8A 3DCPA 3MUIA 3GHSA 4ZGYA 3BAIA 4N4PA 4FNQA 3CBWA 3LCFA 3E49A 2QDGA 4PCTA 4HPXA 4LUTA 4LF2A 9XIMA 4HMCA 1W9BM 1MVYA 3QXBA 1JL8A 1TIMA 3TW7A 4E8GA 4F0MA 1QBAA 5C5YA 2GVEA 5CSUA 3L9CA 3H4GA 2V3FA 5DCDA 5FI8A 1XC4A 3G1DA 4I5XA 5HPCA 3WENA 3QW4B 4DLMA 1GKPA 1V7AA 3ARRA 3VCRA 4N9CA 1GG1A 4S2BA 5A3HA 4S3EA 3LGEA 3PS7A 4IP5A 3PWIA 1NDWA 2CLLA 1O66A 4JN7A 1XKYA 4XV0A 2FDMA 5U4NA 2WC3A 1NSJA 4B9ZA 3CEUA 2B81A 4IPLA 4C1NB 1FDYA 2GOUA 4IFRA 4XAZA 2GQAA 3PJUA 2E5BA 5A6LA 1XRFA 3S9YA 3BMVA 3NM3A 3T08A 1GZJA 4PMVA 3IARA 2VQUA 4K6AA 2VX4A 2NXHA 3W7IA 3E9AA 4WLCA 2W63A 4KGJA 1JF5A 1LLOA 4C6MA 4LBSA 4HSNA 3MKKA 3WBXA 4DM2A 4V1XA 1XI3A 5G4HC 1OX5A 4HK7A 4UUIA 4KRUA 5I3IA 1GJWA 4DUOA 4NZCA 4U2YA 2GQ9A 4FZIA 1JDEA 1HQTA 5BXRA 4XTDA 3O16A 1ZRQA 2JE8A 4S39A 3LD5A 4GUFA 1HL9A 3OYXA 3WO8A 4TVCA 3A3WA 3A4XA 5G4EA 3N18A 2WWCA 2NZLA 4LUJA 3WBYA 7XIMA 4LYQA 3CB3A 2OKOA 2C1IA 2Y61A 4PMJA 3RUBL 3OG2A 1SSGA 2QCLA 3HZ3A 1UPMB 2OQLA 1B31A 3EXSA 1W9XA 2O4QA 4IUGA 4R9XA 4L7ZA 3KOXA 3M0XA 1XFBA 3BLOA 4QGCA 3KWSA 3QF0A 5K9XA 4HOWA 3HFYA 1OC7A 1XYLA 2O92A 2CLMA 2P53A 5J04A 4UR7A 4NXKA 4BS0A 3VUPA 3TA6A 3ZR6A 3BJFA 4AD0A 3MYPA 4O1FA 5B80A 3TFXA 1RD6A 4Z42C 3LEPA 3M5XA 3CEPA 2YYUA 4QITA 1XM3A 3UF9A 3A6OA 3K46A 2P8CA 3O2LA 1GJUA 2V9DA 2VJXA 2NQZA 4RZ6A 4GZEA 1CGVA 3GS6A 1XL9A 3RITA 3N2MA 1CB2A 4C5YA 2Q3OA 1OYAA 1TWDA 2A2IA 3H6OA 3WLOA 4C6OA 2Q8ZA 2FYMA 3LHZA 5A6TC 3CU2A 2DZAA 4MB4A 2FZNA 3ITGA 5D9OA 3DFYA 5F2IA 4REQB 5CPSA 3C2OA 1RK5A 2BVDA 3S5OA 3NL6A 1ZAIA 3UY8A 2INFA 1S46A 2F2KA 4ASTA 1V77A 2WSRA 3VVGA 3DIPA 1F5ZA 3WY1A 5CBIA 4WKAA 2WNQA 4AF0A 2AL2A 4JYDA 3QKEA 4GBDA 2OYKA 3PBYA 2C8NA 2X7WA 4LW7A 2ASHA 5C9UA 1F6YA 4X60A 1YXCA 2BFGA 5FF4A 1EBHA 2PDQA 1VGAA 1JPIA 3MHFA 4ICMA 3P2VA 2NLYA 3TP4A 1XV8A 2FTPA 3PC0A 3RM9A 4PTNA 3BGJA 3TUUA 4O8RA 2E25A 1KR0A 1MDLA 3MWAA 3PUDA 2DFAA 2P0IA 3KOWA 4GX8A 4KGLA 2JQXA 2FKPA 4DY1A 1NF0A 4A4AA 4AZBA 4QXIA 2Y88A 4DF2A 4DUXA 5I3HA 4MNMA 3MKCA 3U48A 4CN1A 2HPMA 1CIUA 3MUY1 3VGEA 1JEZA 3EWBX 4EOUA 1YIXA 3RX4A 1EJSC 3H23A 4NILA 1NWRA 2CWXA 4BQ4A 1NDZA 4HHHA 1F8IA 2E0PA 2PBGA 4LS2A 1ZB5A 5E93A 3NQMA 4GYPC 4F0LA 5IRPA 1CXHA 4LPCA 3KCOA 1KFCA 1OABA 2ZUTA 1L8NA 4YHGA 4AWUA 1Q6EA 4AY1A 3S6DA 1NH6A 2WSPA 2V6AA 1EUAA 2Y1HA 2IKIA 3GVGA 4EXQA 2D3LA 3BZGA 3ORWA 1TPC1 2HQAA 4YCPA 1BLIA 1OCBA 3KHJA 5LNRA 2OEKA 4UFHA 5XINA 3RFAA 1FY6A 5IFTA 3MTWA 3D3AA 3C0JA 3L2MA 1DL3A 2G95A 4G1KA 4RPQA 2BHUA 4A8IA 5A6SA 1W1YA 3G1FA 1JZ6A 4JN8A 4NAFA 3LMYA 3OGVA 4UTFA 3G1VA 3IJDA 2QCCA 3IRDA 4GG9A 5FL0A 3M0LA 4JS3A 4JHMA 1JZ3A 1E4NA 4R3UA 3C3NA 4AZ5A 2RH9A 2C15A 1XIEA 1EIXA 1SFSA 2VCBA 1PWLA 4ICNA 3QPYA 3THDA 3R13A 1N55A 3GWQA 3D46A 1TVLA 1OB0A 3GW3A 2FTWA 2PDHA 5HNUA 4N2YA 4FR1A 2E40A 5CSYA 1XYZA 1U1UA 2V2CA 3E0FA 3MVIA 1R3TA 3V5CA 1H09A 1W8SA 3KBJA 3IRSA 3B8SA 4MKVA 5EYWA 3LG3A 5CGTA 3E0WA 3T6CA 6XIMA 1ZENA 3PHAA 4RNJA 1DJXA 3B40A 3PBVA 5FJRA 3WD0A 1E6XM 1M7PA 2WCGA 1Z89A 4PTDA 2G41A 2QUVA 3F2CA 4I90A 4H2CA 3NZQA 4FPSA 4ATDA 3N19B 2PDGA 2WK2A 2X7VA 3UR5A 2ADAA 4XAFA 2EQDA 3LRKA 1OCJA 1E9IA 2PWDA 5JH2A 2F9RA 3NA8A 2Z27A 3TLLA 3OHIA 3GDBA 4RNFA 2V30A 2V81A 3Q65A 4V2XA 4QE4A 4YLWA 3IJLA 2A7PA 4HYVA 3QBUA 3PZOA 2XSAA 1HO4A 4UMAA 1SGJA 4EVZA 3HO8A 3UGRA 4NAFB 4QCFA 5BWFA 5LNVA 1H5YA 1AVAA 2HXUA 2F6KA 1BWLA 4DJEA 2VEGA 1HKWA 4W84A 4DUVA 3DESA 3UZYA 3M5ZA 1HKMA 3BCDA 1JXKA 1OEPA 4J27A 5HPOA 1V02E 1POKA 2J9YA 3WJWA 2E9MA 1UWIA 3DFHA 4M3PA 3UG4A 3VD4A 3W2NA 3KTSA 4X9YA 3URBA 1Y5VA 5LKYA 3P60A 1NP2A 3FIGA 1YRRA 1AODA 1W3NA 2F6UA 1Q4NX 4XBJA 2HVOA 4PTXA 1DIDA 1QU4A 4ADUA 4O4WA 2ZICA 2XWDA 1IEWA 3POCA 4UXDA 1Q65A 2DSWA 2FPYA 4QR6A 3P81A 2ZXQA 4O11A 1B3ZA 2QF7A 1M3UA 4M1RA 5H8MA 4FF5A 1C3FA 2NWRA 1DXIA 1LBMA 3GH7A 3USZA 3QMSA 4RKAA 5CCZA 4XQ6A 2WHKA 2WVTA 1S2WA 3BO9A 1RHCA 4GBUA 4JL2A 1E43A 3P8IA 4NNBA 4N9EA 1T8QA 2VOMA 3U6WA 4C65A 3AIUA 3FJ4A 4NZ1A 3MSRA 2ZFAA 3TQPA 3NZGA 2ZUUA 2D22A 4K3ZA 5CH9A 4Z2IA 4JTUA 1D7KA 1JDDA 3NPXA 1BTCA 3T42A 2QW5A 1YBQB 3VZXA 3UCDA 3M0YA 2WC4A 3NR0A 1Q63A 1JZ5A 1UR2A 4O13A 2E67A 2Q8XA 1W1TA 3SAZA 4CD5A 3PPGA 1PKNA 1I2QA 4XD3A 1NM9A 3PB0A 1HKKA 1TPVA 2R94A 2RDXA 3ZJ8A 4Z08A 5FD0A 1SO5A 3QQWA 3SCNA 2O7QA 1PIIA 4LVAA 1CW2A 1KLZA 3M41A 4LB4A 4AD1A 3EYPA 2PDKA 1CBGA 5FSDC 5G2IA 4L9XA 3AIQA 4OUIA 7A3HA 4GJ1A 5I6SA 3VNJA 4KBXA 3R10A 1KM4A 1F05A 3AS2A 4DELA 4XAGA 5CZJA 2YPIA 5I3DA 3WQGA 3AYVA 2OU4A 4ROQA 1TPH1 5A95A 4ZFMA 4D6CA 1I60A 3LM7A 2FDSA 2Q6ZA 1EDQA 5DXXA 4YYFA 3R12A 5BW6A 2GJXB 3WSUA 4QG9A 3NVTA 3VE9A 3Q45A 2OT0A 3OLEA 1R30A 6CGTA 3VFLA 4AY7A 4JTJA 1X6NA 4J3WA 4DNHA 1A0CA 1VHNA 5I77A 3B0UX 3BSHA 3W53A 4I3GA 2CLHA 4KPLA 1UIOA 3B9AA 1UWRA 4UWMA 3WG6A 5AC6A 3GY1A 1EZ2A 1TPWA 2WKLA 3CUIA 4O4VA 2CYGA 4M0XA 1VB9A 2HBXA 1JRCA 1DWFM 4MM1A 5J8LA 1Q6GA 4IQEA 2G3IA 4PGLA 1DQWA 4GUJA 4JEQA 1W1A1 3WUGA 3LYEA 3P5ZA 4WRHA 3V1HA 1QJWA 3NDOA 4DYEA 1WUEA 1KD0A 5CKSA 4TX8A 3V5OA 1R3YA 3SFKA 1KBJA 2Y8KA 3O3RA 4KWWA 3AS3A 3GQYA 5HJLA 2X1SA 4NRRA 4QG8A 5IHRA 1WX0A 3PVFA 1KXVA 2E5DA 5I3GA 1VBHA 4PBEA 4KH2A 1OIFA 2R82A 3N4AA 4UCGA 1MDRA 3LMZA 3DG3A 1MRAA 1AQHA 1YKWA 3L2LA 3FHQA 1PCKA 4Z2KA 3KL5A 2G3JA 4TUFA 1UCWA 3VGDA 5CQ1A 4B9YA 3S1UA 3H2FA 1QW9A 3UWVA 1EP1A 3G3MA 4NJJA 4F4RA 3OEXA 3OGRA 4HKPA 4H1ZA 2XIIA 4ERGA 4F2BA 5HJXA 4E5TA 1FWNA 1HF6A 1TE1A 2ACSA 3MSGA 2YCJA 1E70M 3BOFA 3G1YA 1JUEA 1S5VA 3CQ0A 4KT2A 4UTKA 3V1PA 3ZWTA 2C1HA 2WM0A 3B9OA 4PMDA 2P3ZA 3HU7A 2ZXBA 3UPBA 1EL3A 1MNSA 3JZEA 3SQSA 4DXVA 3AHXA 3LCWA 4PEEA 1GVQA 3EA3A 2B31A 3BLPX 1TV5A 1W3TA 4W86A 5HANA 4UB9A 3V3WA 3GXTA 4XSMA 4XZLX 5HMFA 1PJ9A 3NURA 3RCYA 4DWSC 4H00A 4QNWA 2RHGA 3VPLA 3ZT5A 2BGSA 3F4DA 4IWWA 4DPQA 2CPUA 1WDPA 4F9JA 1TV2A 4JQ4A 2VZUA 4UC5A 4MWAE 1U33A 4ZB5A 3DXIA 1GW1A 3CK5A 3CHDA 3HQOA 4OECA 2JF6A 3N73A 1XRTA 3JUGA 3U4FA 4Q8UA 1IV8A 1E40A 2FTYA 1BSIA 5A1AA 4M6PA 3N2CA 3N4EA 1YX1A 4XIAA 1OFQA 3TDFA 1JDCA 1X7FA 4I7VA 1WXZA 4V15A 2TSYA 2CLIA 3NQ2A 2G97A 3UCCA 3KZSA 3G77A 2WZIA 3LSBA 2Y7EA 1VYSX 1LOLA 1XINA 1O12A 1IR1A 3DENA 1E0XA 3UW6A 5A6BD 2DT2A 4Y96A 3ZS4A 3QR1A 1XLDA 3GTXA 3GVWA 2VX5A 3BV7A 1BKSA 2G3MA 2ZA3A 3I10A 1GYNA 2WBGA 3KXQA 3NFUA 1SMDA 5EMKA 3D6NA 3KX6A 4W7UA 3H7RA 3LBCA 1EGVA 2YL5A 3AS0A 1GOQA 3RG6A 2FHCA 2BBFA 1OYBA 4ZO7A 1IWAA 3QHMA 2J27A 5D37A 4S3GA 3T2OA 3UXKA 3EXRA 3E02A 1G7UA 2EG6A 5CSRA 3ZVIA 3NZPA 4PRWA 3ZSTA 1UA7A 3N14A 1C8YA 4FNSA 4MLRA 5EY5A 4JTEA 3OZYA 2HS6A 4N6EA 1NFGA 1XD1A 2HXTA 1ZNNA 3GUWA 3BUVA 5JIPA 2W61A 1SW3A 4MPKA 1QI5A 1UH3A 1D3CA 4ERIA 1HUVA 3M46A 5FJJA 1FXPA 4LC6A 1KW1A 4IIEA 1RY8A 1XSJA 2I9UA 3PPFA 3L0GA 3H2AA 4LY4A 1CLXA 1AZ2A 4GI4A 1DWJM 3WJSA 3LX9A 3BC9A 3UXDA 3BMWA 3FDKA 3LQGA 4QJ4B 4MSSA 1QPKA 2YW4A 1K03A 3MZ2A 2DIEA 1PTGA 2XVGA 2DT1A 4QQ3A 2YKKA 3NL2A 1XYFA 1F3WA 5CZ0A 2CCRA 1W32A 1TX0A 3OBAA 1WKEA 1A5MC 3TSBA 2Y4SA 4BEUA 4MUZA 4RPPA 2JKPA 3PANA 3PZUA 3AXXA 2CHRA 2P50A 4JTCA 3AICA 3P74A 5LIWX 1JZ8A 4ZO8A 1XICA 3G8EA 4AC1X 1G01A 1SW0A 1SYTA 3LN3A 1NARA 1Z9AA 2QUTA 4AZ6A 1MW2A 2QR6A 4XWUA 1PIFA 3G6LA 4XKMA 2OTDA 4EAYA 1WDSA 4WJXA 4AYSA 2PC4A 4UNKA 3N12A 4NZ4A 4JTAA 3QEZA 2QJHA 4LS1A 2CZVA 4TXEA 2F61A 4WDTA 1G94A 1J4EA 1TJRA 2YX0A 2QGYA 4AX6A 4PH6A 1OT2A 2ZRWA 2DORA 2GUBA 1N8WA 5C0QA 2PDXA 1FWFC 5ABTA 1UP3A 4E8DA 1KFKA 4YYCA 3GLCA 5EKYA 4LY8A 3TVAA 2WLYA 2GQ3A 3CLMA 4LYKA 1KBBA 6A3HA 4MYXA 3M0ZA 3MUZ1 3T9PA 1G5AA 1CYGA 1IF2A 5D2VA 3WQ4A 1IYXA 3ITCA 4XBKA 2WHLA 5CBJA 3M64A 2DW7A 1EO7A 4BHYA 2QHAA 1FWHC 3MMDA 3P61A 4B92A 1PDYA 2MANA 4MIMA 2WZHA 3BVJA 1XFCA 4XD4A 4DUWA 3TW9A 3SRFA 3HA1A 3S3GA 3VOJA 2BSLA 3N3TA 1TV4A 2I5QA 3JZUA 5D09A 1H4PA 1A5BA 1XUZA 2C7FA 3EGJA 3LRMA 2D3NA 1H7XA 4ML9A 3LERA 4PUEA 2DVTA 3V75A 1FOBA 1OZMA 3EWZA 4Z1DA 4MLJA 4DEFA 3EMZA 1AH4A 1ML1A 2ISFA 3GFYA 1QXLA 2PUZA 1RBOB 4TVUA 5IBXA 3PPCA 4BWLA 4YTRA 4Z1AA 1AA1B 3EEZA 1R38A 3EDEA 5I03A 3SUVA 3I65A 3IGUA 2ISDA 5ABGA 1R2TA 2AL2B 1QHOA 4AIUA 2IQ0A 3ANUA 1W5OA 3QGAC 1BWKA 2VT0A 4DF1A 1E71M 4GE8A 2I9EA 3ECQA 1XBZA 2D2GA 4DF0A 1UUMA 2C0AA 5D02A 2WMGA 2DZXA 3W88A 1Z48A 3O6CA 4L4MA 4UNIA 3RU6A 2O9OA 2HK1A 2VTFA 3DU0A 3GDRA 2O55A 1J6OA 4Q4OA 4QEEA 1J8VA 4O53A 3DHUA 2CBUA 3MS8A 3SCUA 3WJXA 3MDUA 2WVVB 3MI2A 1KLYA 3WF4A 2IS7A 1PB0A 2TODA 4PUDA 1MUCA 5D2YA 4FF7A 3AIWA 4IMAA 3NUKA 2HVMA 5IOBA 3L2IA 4M5PA 2RFGA 3HM7A 3WQ5A 3KBMA 3EX6A 5AY7A 2VWSA 3E2RA 2C13A 1XRSA 1MW3A 1FA2A 2PTWA 4GFSA 4IPNB 4JFWA 3THCA 4POCA 1CI1A 4ORMA 1A4LA 1MQPA 1E5NA 4HA1A 3W7LA 3R8HA 1XKJA 5FESA 4R7JA 4PMRA 4X2RA 3MY9A 1EGMA 4KRTA 1HKVA 1R2RA 2PRMA 4XUYA 2V3GA 1ODUA 4JTIA 6ALDA 2XIOA 4MF4A 2VCAA 2PTYA 4KRZA 4GXPA 2J66A 4BJHA 7ENLA 3WLTA 2X30A 4FLQA 3DERA 1I9CB 2PWEA 5JBEA 2XWEA 1ELSA 1YBQA 3W2JA 3T2QA 4LC8A 2OODA 4N9DA 3QOKA 2NQ9A 3W7MA 3PFRA 1TJPA 1OBAA 2UY2A 1YPXA 2CC0A 4P7RA 5C9RA 3M4HA 4P8UA 3P0XA 1DHPA 1DXFA 2Z6JA 1E0WA 3TROA 1RV8A 1PKMA 4R9OA 4DM1A 1Y8BA 1UZ1A 1XIHA 5DXYA 4GUHA 5KZDA 1V6UA 2QIIA 3TX9A 3TV8A 4KEMA 1KCLA 4L64A 4NYUA 4GWEA 4HSOA 3P14A 1L6WA 2RJHA 3HPFA 1GZ1A 3UESA 3M16A 1EGZA 5EGRA 1FUYA 4KCTA 3UJ2A 3ID7A 2VM8A 4NU7A 4NVTA 3GNDA 1AD1A 1XIBA 4G7EB 3LHWA 1DQUA 2PD5A 4PTVA 2C14A 4CCZA 4HU4A 3DECA 3G8RA 5FSEC 1BYAA 1QNSA 4IOTA 3ONBA 5TAOA 3ZR5A 4U2ZA 4MADA 4E8CA 3GE7A 1GTHA 3UBPC 2NX9A 2TRSA 1TA3B 1E9YB 1N2VA 2HPIA 5CSSA 3QVQA 2ZRYA 2R6OA 3B8WA 3O8AA 1F76A 2YIHA 4ZQRA 4LAKA 1Z41A 5A6MA 2PGEA 2CNCA 1CEOA 4WEVX 5CXPA 4NNCA 3LTSA 1XDJA 2XVKA 1A5UA 2D0HA 1AH0A 4OFCA 4CKQA 5AYXA 1V03A 4X9SA 2A79A 4IQDA 3P84A 2DQWA 2XIJA 4J3UA 3S2NA 4PZVA 1P48A 3UWWA 3QSRA 3KM8A 4MWAD 6ENLA 1PYFA 3UWYA 4GKLA 4I6KA 1VFLA 4ZOCA 2OG9A 5K9CA 1RAKA 2J7DA 1CENA 1GKQA 4YU1A 3KTCA 4QTGA 1YLVA 5FEZA 2VZVA 1VEOA 3T4WA 4HQVA 1QO5A 1MRQA 3UR8A 2X2GA 1D8WA 4IIBA 1IEVA 4FP1A 4JTHA 4LXFA 3KVJA 5EBAA 3XISA 4K8EA 5H1WA 5HUPA 2QT3A 2JGQA 4D6DA 1ADOA 3N17A 3TIMA 1QMLA 4LEFA 4LB3A 3NGJA 4UZUA 3WK3A 2HMCA 2NUXA 4CUCA 3CL6A 3W7KA 1GOIA 2J62A 2OX4A 2A3EA 2JKAA 3BGGA 3A64A 3HQNA 1WQ5A 2Z7KA 1O7AA 3MV11 3T1GA 4U31A 1REQB 3FGCB 1ZLPA 4KETA 4OOZA 3MW7A 4BZYA 3TYEA 3DEQA 3R89A 1EKOA 4NAEA 4FK9A 2J79A 3WK0A 1KFWA 2C1GA 2IPJA 4DZIA 2RDUA 2GJPA 3URAA 5D9MA 4UR9A 4E38A 2PI6A 2X0HA 5C2XA 3LXAA 4Q3MA 4PUMA 1B3XA 5DMYA 1IWPA 3AMKA 2BGNE 4ZXOA 3WJZA 3F2DA 4FLRA 4LU0A 3UZ5A 3U7BA 3A13A 4CEUC 1UOKA 3V36A 3R0UA 4DB7A 1G6CA 1E15A 4IGNA 5G1MA 4LYRA 4DVOA 1KQYA 2QJIA 1RCXB 3WUBA 4C7DA 1CGTA 1BQCA 3OPSA 4MNKA 1T99A 2ZX7A 1GVFA 4DWSB 3CAVA 1EJUC 1ISXA 1QPOA 3CAWA 1V3JA 4LUYA 5E6YA 1WZKA 3GH5A 3W1PA 1W9UA 1Q7QA 1SZRA 3DFPA 1US0A 5BMXA 3WLLA 2AKZA 3QC3A 4AZHA 2EPMX 5BWAA 1QOQA 1H62A 3W2KA 1HGYA 2I14A 4ML4A 3WIJA 1FHUA 3CS2A 1OZQA 2EEXA 1F3EA 1H7RA 3QFEA 3R58A 5HOSA 2ZX8A 3NCOA 5AVNA 2VENA 3SM0A 4KKXA 2XUCA 4YVPA 3KFTA 4B5NA 3NQEA 2ODOA 2OCZA 3M0MA 4CD8A 1IEQA 1TV7A 3P67A 1VPXA 3PK7A 2QJMA 3NG3A 1MI3A 1OHLA 4EKJA 4MNLA 4DIAA 3WQVA 4NJIA 5AC4A 2V5BA 4H6EA 1FCBA 4GOAA 3HMCA 1K8XA 3DX5A 1AJ0A 3DH7A 4JQ3A 3EWCA 3THQA 1QDSA 1YNYA 4NL1A 1WCGA 1ZSXA 4DQWA 2QCDA 4ZA0A 4WIWA 2WNNA 3W72A 3NPWA 5LHFA 3WF2A 1TREA 3SY8A 4GZ7A 3TE9A 3P0WA 4DZAA 3IVTA 1VCGA 2VR2A 3NXLA 1L6SA 4CEXC 3UGVA 2CHNA 3BE7A 4MUPA 3SECA 3N25A 1A47A 5FF3A 4DHGA 3VDAA 1LRQA 2HVNA 3AXIA 2ICSA 1VFTA 4TR9A 2Y62A 2CITA 4YN5A 3PUEA 3KRUA 1LL4A 2Z1VA 1EXBA 4OHQA 4ICCX 1W5QA 1K4GA 4UFKA 1KBKA 4S3KA 1UR1A 4CU8A 3WJYA 3U2EA 1PHQA 4LUTB 1S5NA 3N4FA 1S2AA 1VCFA 2D69A 2OYLA 1RQEA 1RZMA 1WXYA 4H6QA 3NQ6A 3BLFA 3IJ9A 5CPTA 4WGXA 4AF0B 4FX7A 3WDRA 4KEZA 4IUOA 2DJXA 4CN6A 1L6GA 5LZLA 3CMJA 2WMJA 3MCOA 4NX0A 2CU0A 3C0SA 2J8TA 5FEXA 1GZGA 4F0SA 1S2CA 3GIQA 2WPGA 2OEMA 4NKCA 1TJ0A 4DLFA 2QJNA 3K30A 7REQA 4D6EA 1QNVA 4OKDA 2J9ZA 4EWND