2FGBA

Crystal structure of human 17bet a-hydroxysteroid dehydrogenase type 5 in complexes with peg and nadp
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
323
structure length
312
Chain Sequence
b'MDSKQQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Structure-based inhibitor design for an enzyme that binds different steroids: a potent inhibitor for human type 5 17beta-hydroxysteroid dehydrogenase.
pubmed doi rcsb
total genus 118
structure length 312
sequence length 323
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2fgbA00
1S1PA 3CV6A 2PEVA 1QWKA 1IEIA 2PDKA 3WBWA 3LNMA 3V0UA 2HE8A 3R7MA 2BP1A 4LBRA 1EF3A 2R24A 3CASA 1MRQA 4YU1A 4GCAA 2HVNA 2IKIA 4ZFCA 4JIIX 1R38A 4GACA 4XO6A 2CLPA 2IPWA 3KRBA 2PDXA 3BURA 3ONBA 2ACSA 1IHIA 3R43A 1ZGDA 4WEVX 4Q3MA 4PRRA 5AZ1A 3LZ5A 3GHTA 4H7CA 4LAZA 1PZ1A 5AZ0A 1JEZA 3G5EA 2HE5A 3CV7A 4GA8A 4IGSA 4YVPA 2ACUA 2FZ9A 2IQ0A 4HMNA 2IPFA 1RALA 4DBWA 2ACQA 2PF8A 2PZNA 3UG8A 2IKJA 1T40A 1YE4A 4G5DA 4XZHA 2INZA 1EXBA 4NKCA 2PDLA 3LZ3A 3R94A 3UZYA 3C3UA 5DANA 3ONCA 3LUTA 3LQLA 1HW6A 3FX4A 2AGTA 2IPGA 3LD5A 2PDFA 3CMFA 3RX3A 4FAMA 3FJNA 3LENA 1ZUAX 2BGQA 1QRQA 3S3GA 1Z9AA 3RX2A 3NTYA 1RY8A 2HEJA 4H8NA 3UP8A 5M2FX 3WBYA 1ZQ5A 2IQDA 4HBKA 1PWLA 3WG6A 4WGHA 3M4HA 3P2VA 2PDWA 4I5XA 3QKZA 3R8HA 4AUBA 4DZ5A 3V36A 2FZDA 4XVEA 2P5NA 1MI3A 3UGRA 3RX4A 1OG6A 2A79A 1T41A 4XVDA 3R8GA 1S2AA 4XK2A 4EXAA 4QBXA 5LIXX 5JH2A 2PFHA 4IJCA 1EKOA 2IKHA 4GABA 5HNUA 4YVVA 3V0TA 2HV5A 3EAUA 1LQAA 2F38A 5LIYX 4JTDA 4FA3A 2PDHA 1AZ2A 2PDPA 1US0A 2HDJA 4YVXA 1YNQA 1Z89A 2DUZA 3LQGA 1ADSA 1AH0A 3N2TA 2PDNA 1XJBA 3Q67A 4JQAA 5LIUX 4L1XA 3CAQA 4Q7BA 4ASTA 3F7JA 1AZ1A 2NVCA 2C91A 2ISFA 2QXWA 4JQ2A 1PZ0A 4WRHA 1MZRA 4JTQA 3G1RA 1LWIA 3U2CA 1S1RA 1AH3A 2FZBA 4ICCX 3T42A 4GQ0A 4WDTA 4JQ4A 3GHRA 3LN3A 4JTCA 3EB4A 3Q65A 5C7HA 2NVDA 4JTAA 1GVEA 2R9RA 2PDBA 3EB3A 4JQ3A 2I16A 3ERPA 1RY0A 4LB4A 2ACRA 1Z3NA 2FGBA 2HVOA 4DBSA 1UR3M 1VP5A 4EXBA 3R6IA 2ALRA 2PDIA 4XZIA 2IS7A 1ZSXA 4PUUA 2FVLA 4PRTA 1EL3A 3BCJA 3BV7A 4JTRA 4XZLX 3UZZA 1X96A 2FZ8A 5JH1A 4LBSA 1X97A 2PD5A 4FZIA 4LB3A 2WZTA 4PR4A 3M64A 4XO7A 3H7RA 1A80A 2DV0A 3D3FA 3R58A 4DBUA 2PDGA 4JIRA 1Q13A 2PDCA 4WDWA 3V0SA 3GHUA 4PMJA 2VDGA 4OTKA 1HQTA 2F2KA 3UFYA 4WDUA 4FALA 4GQGA 1AFSA 1XGDA 3BUVA 1SM9A 4MHBA 1K8CA 3MC5A 4QR6A 1J96A 3LBOA 3O3RA 3UWEA 1Q5MA 4JIHA 4IJRA 3WCZA 1Z8AA 3CAVA 3WBXA 4YS1A 2PDUA 4F40A 3MB9A 4PUWA 4WDXA 2IKGA 5LIWX 2INEA 3V35A 2PDMA 4XZNX 3UYIA 1PWMA 3UZWA 4QX4A 3H4GA 3VXGA 3B3DA 4JQ1A 1VBJA 2PDYA 1YE6A 3H7UA 2PDJA 1X98A 3LEPA 5LIKX 2PDQA 4L1WA 2IPJA 4RPQA 3UZXA 1XF0A 2WZMA 3GHSA 3M0IA 1C9WA 2DUXA 5KETA 4QXIA 2J8TA 3DN5A 4LAUA 5HNTA 2PD9A 4GIEA 2BGSA 1PYFA 1FRBA 5HA7A 3GUGA 1S2CA 4XAPA 4R9OA 4XZMX 1AH4A 3DOPA 1M9HA 1YNPA 3COTA 3O0KA 2I17A 3N6QA
chains in the Genus database with same CATH superfamily
4EPEC 4B9YA 3CBWA 4LVGA 1V5XA 3AROA 3TJ4A 1A4MA 1YIXA 4CU7A 2DVXA 3V0UA 4ENLA 7ODCA 2E9LA 6ALDA 4X9YA 2QCMA 4MJ2A 5HK4A 2UZ9A 5DMNA 3TZNA 5PTDA 4S1FA 2NXHA 4ZFCA 1R38A 3T08A 3CIXA 3BURA 1T6MA 5BXTA 3UXAA 3NSXA 4X3ZA 4MJ4A 1M68A 2CLLA 1WXJA 3UR5A 1P0BA 1KNWA 3NL2A 2ZRXA 1UASA 4AWEA 1NFBA 3G5EA 1HKJA 1S2WA 2EPNA 3V75A 1QVBA 2VEIA 3HJEA 3MHGA 3SQLA 3OYZA 3RLGA 3A3HA 3L5MA 4B5XA 3SY5A 1EOKA 1QOPA 3FK4A 4UNKA 4P7NA 1J01A 4H9XA 4DBWA 2VGFA 5AHIA 2J24A 3NL5A 1JYVA 4JHOA 4PCFA 2H90A 4GINA 3VMPA 1T40A 1YE4A 2X1TA 3ECQA 4N4PA 1EDGA 1XGZA 4DUVA 3B9DA 3SUWA 4B5TA 5LA2A 5A2AA 5M17A 5I0DA 4DJEC 2HJPA 4FOUA 1QPNA 3SCOA 1LBLA 3MZNA 3ABQA 4QNEA 2PDFA 2G5WA 5AYXA 1GKPA 3R25A 2XZ9A 4O52A 1TUFA 3W6YA 2C18A 1O68A 3F5KA 3MMTA 3SSZA 2R91A 4B91A 2EJAA 1JZ6A 2WNZA 1RBAA 3TR9A 1WKYA 1OADA 2F2HA 2NXIA 4GFIA 1KA9F 2VRQA 1CX9A 3ZJ6A 4JYDA 4N02A 4L80A 1XLBA 2ZZ6A 2PDWA 3QGKC 3QKZA 4IQLA 1U83A 5J04A 4R7WA 5A6LA 3RUBL 3UGRA 4BCEA 3MQTA 1U33A 3T78A 2A79A 3MMDA 1KBIA 4NAFA 3W3OA 5D8ZA 4PTXA 3KBJA 1TIMA 3GDTA 2HV5A 2E8YA 2QCGA 1KXTA 4F66A 1WAUA 3B8TA 3S5YA 2I1OA 2H3DA 2EGZA 3N4FA 4JR5A 4IMEA 1Z89A 2BWGA 4CCEA 1OT1A 1ICPA 2ADAA 3PBVA 3FYYA 3WDJA 4N9DA 1DJZA 3VNKA 1V3MA 2DT1A 3FSTA 5D30A 2WKLA 3PSWA 3OOQA 1NFGA 4LQ1A 1AQMA 3AALA 2CC0A 3BAIA 4ASTA 4LRSA 4QRNA 2NVCA 1NY1A 3NIYA 3WQVA 3EDJA 3MBFA 1Q2SA 4MKVA 2CKRA 3RR4A 1TJ0A 3IANA 3CAKA 4LC8A 4V1YA 5G2IA 4NI8A 1TJ2A 3FEMA 4XKYB 4KEZA 4IFKB 1YX1A 2NX9A 4KH2A 4JQ4A 4PEKA 2P50A 4KKXA 1GGOA 3D3AA 4GJ1A 3HPSA 2PLMA 1ZJHA 1Y5XA 1UPMB 1DWAM 4H01A 1IWAA 1Z41A 3CMJA 1WDSA 4L6DA 2PBGA 1I2NA 1PTAA 3L7RA 4H41A 3DERA 1HGWA 4IG2B 4LUTB 4EXBA 3PB2A 1IT8A 2AKMA 4UFLA 1EP3A 2GJXB 3UYCA 4BA0A 1QHZA 4J3WA 1K8ZA 5AYYA 1Q7QA 2IS7A 4PUUA 2GOKA 3GW0A 2UV8G 4RNIA 4A8RA 4XZLX 2BOGX 2GVGA 5EBUA 1X96A 4QE5A 1Y5WA 4PH6A 4LH8A 1Y0EA 2V5DA 4J4KA 4OHQA 3WLIA 4TV6A 3C2YA 4X63A 3IGSA 4DYJA 4C6PA 4PMZA 2P8CA 2L5HA 4ZB2A 5FSDC 3E9AA 4KIRA 3GTFA 2EPKX 3H2OA 4N9EA 3WJXA 3GO2A 1PZ3A 1RH9A 4DBUA 4MWAC 5DRIA 1MDLA 3DDMA 4PYSA 3P61A 3P0WA 2R1KA 4ZEPA 3NCOA 1WDDA 3NOYA 1XLMA 1AA1B 8A3HA 4WSKA 1L6GA 4LUTA 1EOMA 1V7YA 3BCDA 1EX5A 4I9JA 2PCQA 3WLHA 3GYEA 4HJFA 2Q01A 1M1BA 5IFPA 5A8MA 2E9MA 1E70M 4IQEA 2WQPA 4A22A 3VKDA 5CPTA 4MJZA 2V5LA 4PZVA 4IIGA 1CXHA 2B7PA 5FAGA 4NXSA 2XIIA 3GXMA 1VFLA 2BNJA 4WDXA 3F2CA 7REQB 1HTIA 3GXNA 4HA4A 4U3AA 1M7XA 3APYA 1A5KC 1JFXA 3C3NA 3PG8A 3VDAA 3BG3A 1VFHA 1KFCA 1UWSA 3CGTA 1XIBA 1PWMA 5AHMA 1KTNA 3NFUA 3VXGA 3B3DA 4K7VA 2OQYA 4ORIA 2QJGA 5CC5A 2Z1VA 4DN1A 1P1XA 1JNDA 4BF9A 4J3TA 3OBKA 3IIZA 1MXSA 1I6NA 1K3UA 2MANA 3UZJA 4DXXA 3T8LA 4O11A 4A2SA 2QCNA 2JGYA 1RCXB 4OV4A 1C9WA 2Y70A 2JK2A 2F84A 4EF8A 4XAZA 3AIQA 2PGEA 4QXIA 3GNNA 4DM1A 3ALFA 4LAUA 4GX9A 1FWTA 2Y7EA 5HNTA 2R1MA 4GFSA 4UFMA 4GD0A 5JXQA 1KBBA 1MO0A 4PUJA 2Z0IA 4B9ZA 1YNPA 5D04C 4DQWA 1HGYA 2Y8UA 2GQAA 4AXKA 1DWJM 5IXEA 1GQNA 3WNLA 3GAYA 3KM8A 4CNTA 5BOOA 4H9MA 2YR1A 3KRZA 2HVMA 3CASA 2PE4A 1RUSA 5AN7A 5A8QA 4F0KA 1BVZA 1ZCCA 3W0KA 3UBPC 1UJQA 4GVIA 1R3VA 1W1ZA 4CVUA 1UZHA 3V18A 2DEPA 4EPKA 2PS2A 2VR5A 1TMLA 3VFLA 3N34A 4XV0A 2P8BA 4H7CA 4ZQOA 5G5IA 3THCA 3AZRA 1Q6EA 3ITOA 1JYWA 4U2ZA 4J35A 2ACUA 3LSBA 3WF4A 2A1YA 2BODX 3H2AA 2Z2AA 5DFAA 4WJ8A 1E6SM 1KGWA 4XD5A 4NX5A 3MUAA 2WVVA 1LQ2A 3FCPA 1MFVA 4KCTA 4UZSA 1H41A 4RE3A 3H53A 1EXBA 4FOKA 1EWEA 1W3IA 5EMKA 4A2RA 3DECA 4H19A 4H9ZA 1Q6DA 2FJKA 3AMDA 2AAAA 1H11A 3LD5A 1Q4WA 5G2WA 4HGXA 3RX3A 2BG5A 1A3XA 1E5JA 3UJFA 1PIFA 3ZS4A 3S3GA 4WCJA 1S2UA 3LK6A 4A29A 4FHAA 3QBUA 4O1BA 1VFSA 4ZQMA 1IQ8A 1ODZA 1W5QA 3UG5A 1FP8A 2XTKA 3S2MA 4GI4A 3PPHA 2VQTA 4G2DA 4ACYA 4M6UA 2DDXA 4E0CA 2NXGA 4QITA 3EWDA 3RU6A 4U4MA 1EGMA 4IHCA 2F7FA 2VEGA 4K6AA 3ZLGA 1U30A 1DJGA 3W1TA 1DJWA 4J1OA 4G8TA 4NZ5A 3GFXA 4ILSA 3UPWA 1FH8A 2RGLA 2OZ8A 5KZMA 2WC7A 1EYEA 1UROA 5M1TA 2YA2A 1IWBA 4M82A 3TYBA 1L9WA 2OB3A 3B4UA 4Y9PA 3A21A 1WZAA 5LIUX 3ZR6A 3VDBA 5E93A 1BRLA 5JUVA 3PZOA 3KOWA 3G3DA 1V6UA 4PCTA 1LDCA 3OZOA 5HMFA 3N2OA 1XQKA 2OQHA 3CXOA 4WKAA 1QI2A 5CLWA 3RPTA 1R86A 4J3UA 1H51A 1BKSA 4ALDA 3D6NA 5JIWA 1TMQA 3NQMA 2JE8A 1H7OA 2D0FA 1DXFA 5LNSA 3ZM8A 5E0CA 3OZPA 1SZGA 4D6IA 5K9XA 3EB3A 3NQEA 4AZCA 1GOIA 3AUJA 3TKFA 3WZ0E 3L4VA 4F2BA 3BANA 3QRHA 1TYGA 2VURA 3GH4A 5I79A 3VC5A 4DAFA 2OX1A 5I77A 2PTDA 3TONA 3WL1A 4QAIA 5EY5A 2PBOA 4K36A 3KBWA 3A22A 1HIZA 4FMVA 1NDZA 4MY8A 4ZGYA 5JBDA 4LBSA 3WDQA 4RDWA 4OT7A 1B9BA 2E1WA 1OF6A 3TXZA 4HNUA 4BWLA 1QJWA 1A80A 1A5UA 2DV0A 4BQ2A 2XVPA 1H62A 3W2LA 4YYCA 4NG3A 3OA5A 3SUUA 4HYWA 4I5UA 1F6YA 1XRFA 1Q2RA 3LBMA 2R82A 5AC7A 1K7EA 2WPGA 3QY8A 2GSHA 1WP6A 3FHAA 4EVZA 5HJYA 3Q94A 2FIQA 3FGCB 1T7LA 1XGDA 4UTWA 4URIA 3T0BA 4LVFA 3ZR4A 3BAXA 1N8IA 4UOJA 4XBSA 5C9WA 4G7FA 2WNQA 4DF2A 2DQXA 4GO9A 3W1NA 2ZUTA 1B0IA 1PCKA 1BSIA 1W56A 1VHCA 1CBGA 1QNVA 3NDYA 4DO6A 2YZ5A 3QLLA 1E56A 4EKJA 5HPOA 1YKWA 3VKKA 1Q66A 3BAKA 2OZ0A 2WSKA 1E9YB 3JS3A 3NL3A 5EKYA 3ELFA 1MUCA 2NQ5A 4V15A 1CT5A 4W93A 3I68A 3IGHX 3Q2DA 4QS5A 1CDGA 4REQA 1FCVA 1GOXA 4KERA 4HPNA 1XBYA 1XYAA 4JX5A 1N7KA 3SUVA 1HXJA 4K8HA 4J27A 3OQEA 3CUZA 4L4MA 2X30A 3MDWA 1OVDA 4HYRA 1R47A 4L1WA 3T40A 1WCGA 5FL0A 4DJDC 3P84A 1SZEA 1XF0A 4LEFA 2PZ0A 1XM3A 4Y90A 4PGLA 1LF1A 1KRBC 2CITA 3IJDA 3M0IA 1MQRA 3LI1A 4UMBA 1MEIA 1EUNA 4PUDA 4OU1A 2XG9A 3QEZA 2YCLB 1JXKA 4N6EA 2RGMA 4MSSA 3ZT6A 1ZENA 3DOPA 1WZLA 4HMDA 4LNCA 5HINA 3WLSA 1Q6OA 4X60A 2C0AA 5CC7A 2ZZ4A 2PDKA 2INFA 1VYSX 2PLCA 2VM8A 3QFEA 2XFYA 1HN1A 4B2DA 1AJ2A 1V03A 2G8ZA 1YW1A 3N19B 1U1HA 1PKNA 1S38A 5HULA 1RA0A 2R8WA 4U10A 3VOIA 3GD6A 2OODA 1QW7A 3H8AA 4OUEA 3CK5A 4Q8QA 4WIWA 1DJYA 1ZGDA 1DWFM 2QCLA 4FEZA 3UA4A 1TPDA 3KXQA 1XH2A 3FAWA 3N04A 4ZO7A 3TEVA 1GG0A 1DWHM 4FNSA 1ZBVA 4XD3A 1KGUA 4L4PA 2P3EA 1HKKA 3WUFA 5KTLA 4HCDA 4PBFA 3S2LA 1TE6A 4LJ3A 1S39A 4B3ZA 1FHDA 4UOZA 4JFTA 3HGOA 1RAKA 2PZNA 3GVVA 3NAVA 3OODA 1G5AA 3WJZA 2XJ7A 3QJAA 5CZJA 2VR4A 4FX6M 4PMYA 2QCDA 4MNLA 1TPC1 5F2MA 3WK3A 2Y7GA 2VO5A 1TVNA 1C8VA 3S8HA 1QW8A 1OWQA 4LUIA 1MUMA 4LT9A 3IGXA 1UWUA 1K7XA 2FQIA 3VO0A 1I45A 2EAWA 2I5QA 3OQ8A 3K46A 3MS8A 4EX4A 2PLJA 5EB8A 5G4WA 4Q8OA 4HB7A 3U48A 3UP8A 4PCSA 2PPGA 3AS2A 3KTSA 4H2HA 2REQB 2DQWA 2C13A 3WMBA 3BK0A 3W23A 3PUEA 1DWGM 1ZAJA 5EMYA 1EIBA 1CYGA 4KCVA 4AXNA 3QHNA 4LFYA 2VDIA 1AL7A 3EX2A 3GTXA 1TA3B 3BPWA 4LAMA 3SUTA 2KAUC 1FCBA 4WZHA 1NARA 3E0VA 3O15A 3MMUA 4QBXA 1VPXA 3HPZA 4XD4A 3SFWA 3CL6A 4RLIA 4DBEA 1CXLA 3EA2A 3QTPA 3WD1A 1KM5A 2F38A 2XINA 4LNYA 1NJJA 4LX4A 2GSJA 4WD0A 2HDJA 4OECA 1KBKA 4GYKA 3E96A 3R12A 4UQEA 3W72A 2C71A 2ZC1A 1G4TA 4QCFA 3AS0A 3BAYA 3MO4A 2G95A 3CAQA 1XBVA 3HG2A 2ZZ5A 3PPGA 4FO4A 4C6IA 2CIPA 3P81A 3G1XA 3AIRA 1CEOA 3MSDA 1A5OC 3C8NA 2GWNA 1K4GA 4C1LA 3WJSA 4IPJA 4KW2A 1KWKA 3PPCA 3GNDA 3PBGA 3FJLA 1JPDX 3QZEA 5MF5A 2OQLA 5ECVA 3RR1A 1QNSA 1UQYA 3VINA 4PBGA 4QDWA 2VZOA 4BQ5A 4IP7A 1RVGA 4EAMA 4LB4A 2JKEA 1POJA 4ADTA 3PN8A 4QDPA 1E3ZA 3VIHA 3TTQA 3NQFA 2TYSA 2QUUA 2YXOA 4O50A 1H3GA 1G0CA 1UKOA 1P0NA 2EPLX 4MPQA 2PF0A 4E38A 5ABFB 3QKEA 3I10A 1YTKA 1B1YA 2QEZA 1BQCA 3WFLA 2YSWA 4AG0A 4NX0A 4H4IA 5JH1A 4S3AA 3GDMA 1X97A 3TN6A 7TAAA 4UMAA 2HSAA 3HGJA 4WR3A 3DGBA 4H00A 3WQEA 1RLCL 2XH2A 4GKTA 3FIGA 5DQPA 3AZTA 3GXTA 4Q8NA 3SGUA 1IZKA 4R27A 3B8WA 5I3DA 4WOQA 1GYNA 1T8XA 2PDGA 4L9YA 4UUIA 1WB0A 3V0SA 2H6RA 4FIRA 1OFAA 3P67A 2C3ZA 3EPMA 2YLLA 4WDUA 3FLUA 1UOKA 3AHTA 4ZSTA 2QDEA 4K38A 2ICSA 4RK8A 2CFFA 2P0OA 3LHUA 1XYMA 3IJQA 2QJMA 2CXEA 3L12A 4AIEA 3MI6A 3T81A 1LCOA 3MTWA 4AZBA 1OHLA 5CAHA 2D73A 1VLWA 2A3CA 3VNYA 4NNBA 2ZZ3A 2VD9A 2ZADA 2VCBA 5EA9A 3R5EA 2XFFA 5GJNA 4Q8WA 5A6TC 2WZEA 3GU9A 4LU0A 4ACZA 1EB3A 2NV9A 5ABHA 3L0GA 4AF0A 2BFGA 3AI0A 3TNBA 1VBJA 1EEPA 1WZMA 2X1IA 4BJHA 1H09A 2Z1XA 2OYLA 3VMOA 2W9MA 1ZBWA 4O14A 1FA2A 4ZVJA 1DJHA 5A3HA 1QUMA 5A6AA 4S38A 2WNNA 3S4TA 3CTLA 3UNTA 2D2GA 4O1FA 2OOGA 5J5DA 2WQDA 2VC7A 3TAOA 2JIWA 4HMCA 4JFVA 2G3IA 1JYNA 1EYWA 1MMFA 4S3FA 5U4NA 3V5OA 3RU8X 3SURA 2ZUUA 4OJYA 1UD8A 4O13A 2ONEA 3RPMA 4XZMX 4NQ1A 1PBGA 2NX1A 1M7JA 3TR2A 3O0KA 4JTUA 4Q8VA 3W74A 3VD4A 3ITLA 2RHGA 1I2RA 1IR1A 2DP3A 1GZ1A 3KBSA 3S1GA 3AXIA 4QEHA 1R30A 4HZ6A 5T26A 4XAGA 2JKAA 4J40A 1LLOA 2IKIA 4L56A 1EP1A 2CLPA 4Q7IA 1NDYA 1RK5A 1NWSA 3IAQA 2A3EA 3LPFA 1ZZMA 4PFHA 3VVGA 1LJYA 5H8UA 3FHQA 3W88A 3F1QA 3QYQA 3LS9A 3IJ7A 2CCRA 1JULA 3KE0A 2I7GA 2C0HA 3PJXA 2UWFA 4JDBA 4WOZA 4AY8A 4PMUA 4D6HA 2YCEA 5D38A 3GYCA 1VRXA 4XSMA 5DELA 1OC6A 2D3NA 1OZMA 4DI9A 4R85A 1M65A 3NUKA 3HBLA 2OZ3A 1P0DA 3U0HA 2QUVA 1G69A 1YEYA 2J79A 3PC0A 2DIKA 2HISA 2HWGA 3N9SA 5DY2A 1JXJA 2PDLA 4UTHA 1CENA 2ZX7A 5FL1A 3KP0A 1ISWA 3LQLA 5GQBA 2Q3OA 3KWSA 4MNMA 1OYCA 3BMXA 3URNA 3QYSA 3OJGA 3WKZA 1B30A 1GOMA 3GNOA 3QQ0A 3ZSTA 2GQ9A 2A6LA 2V2HA 1TPB1 3HN3A 3NSNA 1ICQA 1GKQA 4XB3A 4GH3A 3VKCA 4AC1X 5F4SA 4H8NA 2OU4A 4FXRA 3DZ1A 1A5SA 3B0UX 2WJFA 4GNKB 4DM2A 2Z28A 4JEQA 2E7FA 1QNPA 3C2EA 1XPGA 2W63A 4KEMA 1OFPA 1UUQA 3CO8A 4FXSA 4JAWA 3TVAA 1JCNA 2XIMA 1XIEA 3HPFA 3WLNA 4IJCA 3H6OA 2HROA 5IM51 3WJYA 2VEMA 3BO9A 3V0TA 4NZCA 1XBXA 4GC3A 4Z1YA 1YMYA 4REQB 5JMUA 4UNIA 3VUSA 5BXRA 4MUPA 2P3ZA 2PDPA 2OSXA 4D6GA 1UUMA 1U5HA 3FA4A 2BMBA 4HNOA 1R46A 5A8PA 1IYXA 1ZB5A 3P7YA 1C7SA 4DWDA 4KWVA 2Z27A 4YLWA 1ZRQA 3WEZA 3LRMA 1IEQA 1VIZA 4HVXA 2TMDA 3PTQA 5D9MA 2C91A 4IFRA 3LMZA 1PZ0A 2DZWA 1TQXA 4B5UA 1WZKA 4WRHA 1U5JA 3KDOA 4IPPA 4E3VA 3W76A 1RP9A 3PTMA 2W66A 1VKFA 4EOUA 4JKLA 3M7SA 4HYVA 1JI1A 5LHEA 4GI8A 5IRPA 2ASHA 2BDQA 1BEUA 4N9CA 1J0KA 1P48A 1TWIA 4NRSA 4RDVA 1QO5A 5HAOA 4W84A 2CZ5A 2RAGA 2YYTA 2OWXA 2B0MA 1UW9A 4GUGA 3A64A 1AMYA 3TNOA 2DPEA 4XZIA 4K68A 3QH2A 3GDKA 1W5MA 3BCJA 4KGLA 3DFTA 3BMWA 3GXFA 1FDYA 5HQLA 1VS1A 3KRUA 4RDZA 1SYTA 4W7WA 3WBAA 3ATYA 3QPZA 3W38A 2J8FA 3JRKA 4DAIA 4TVCA 4RDYA 3DKLA 3L0NA 3NYZA 1GG1A 4LW7A 4J2PA 3GHUA 1O1HA 3GS6A 4RV3A 4GWEA 2ABAA 4MVAA 5EGRA 4JICA 1V02E 2J27A 3VD5A 2WLYA 4M56A 4MWAE 4OV9A 4DWSB 4C7FA 1X38A 2CBUA 4AD5A 3FJ4A 4E2OA 4RX0A 3TYAA 4O0KA 3VOFA 4PBEA 3W24A 4IJBA 1WDWA 2P88A 1RD6A 3DU0A 5E5CA 3KP1A 5TF0A 2WM0A 4OKDA 2JF7A 3DFOA 2VC6A 1WUFA 3DHFA 3KHDA 4M5PA 3R0UA 2JFEX 4QHRA 4IP5A 2J74A 3MP5A 3TE9A 2PDMA 4INFA 1RR2A 4FX7A 2PTYA 2Y24A 3UZWA 3KFTA 4BQ3A 4H7VA 2Y62A 3H4GA 5FJTA 4AW7A 3SY1A 1B4KA 4HK6A 2QDHA 1Z42A 1OYBA 2ZWZA 5RUBA 5FA5A 4V27A 1TJ1A 3CTTA 4CNNA 3O6DA 3GNPA 4A3RA 3SCTA 4D6CA 1LRNA 5DBTA 4H9TA 4M8UA 2AAMA 2JKPA 2E25A 2C1GA 1BXNA 5AHNA 1FRBA 2FHFA 4P8VA 1IGSA 3TC3A 4GRSA 1RCOB 6XIAA 3H7VA 3T0CA 4OBSA 2POZA 2I9UA 3L21A 4W8AA 4DJFC 1YDNA 4EPDC 4XWUA 3W9ZA 5TD4A 2C6QA 1Q6LA 1UD2A 2UY5A 3VNIA 1X1OA 4HN4A 1E72M 3NWRA 4J3SA 3W86A 4LBRA 3ZIZA 3TSBA 3O2LA 3WQOA 1MWOA 4KFPA 1EF3A 1KV8A 4C90A 1PKYA 1W3JA 1ITCA 4ZQPA 2HVNA 2X40A 4AQLA 1OYAA 2QF7A 3SB0A 4AVFA 3WK1A 2CWXA 3KS6A 3B8VA 2ZRUA 3E74A 3PJTA 4MADA 5F7UA 4GHRA 1CLVA 1L6WA 2IXUA 4QQUA 2VEFA 1SU5A 3V3WA 1NF0A 3W7CA 2J9YA 4PL1A 1P7TA 1KKRA 3TJIA 1OD0A 5AYZA 2IQ0A 2O9OA 4IIDA 4DXVA 3EEGA 1EJUC 4NJHA 4IOTA 3EOSA 3ES8A 5LNVA 2PF8A 3P80A 1FWIC 4AD2A 3W2MA 3SQMA 3KVMA 3OZMA 3RLHA 4D2JA 2HS8A 4BF7A 4CEUC 1FVPA 2Z29A 1W31A 2VQUA 1KLYA 1VRDA 2O4MA 3CH0A 1HJUA 4O28A 4RJEA 1JZ8A 4NL1A 1N8WA 4B3KA 1CPUA 5DBUA 3GQYA 1DQXA 2WMHA 3GFYA 1M5WA 1RD5A 1MDRA 1KCZA 4C6JA 4L65A 2GYIA 4PULA 1H7PA 2GSEA 3BSHA 4ML9A 3MO7A 1TCMA 2CERA 5FEZA 2GGHA 1F76A 3E02A 2GK1B 3BOLA 4MF4A 4DJFA 2OVLA 2YOCA 4HBKA 3LA4A 3UVIA 3H2MA 3VILA 1XRSA 3W26A 3ZJKA 4RXGA 2QIIA 3U5UA 3R8HA 4PTMA 1TV8A 4Z2KA 5E1QA 2Y1HA 2EEXA 1V0MA 3S42A 3K30A 4EXAA 1E4MM 1UR8A 1R2SA 3LGEA 3H23A 4UWMA 4GCXA 4Y9OA 4ZOCA 2XZ7A 2VOMA 1QMLA 3HM7A 4LEQA 1MVYA 5HWMA 1QDSA 5DX7A 2ZDSA 4GBDA 2VCAA 3W1XA 4KIEA 2O56A 3Q67A 2Q3RA 1C3FA 4Z08A 4US5D 3ARWA 4AIUA 2J47A 4PMXA 2ZWYA 4GQRA 3U7BA 2RUSA 4AVNA 3W28A 4TOQA 1DVJA 1RA5A 1GEHA 3UJRA 1Q45A 1PS9A 2ISWA 1KM0A 3UCDA 3UWWA 2WSRA 2LLEA 4OWGA 1SVDA 1LWIA 2P1FA 3QC3A 2F6XA 4V28A 2E5CA 3UNDA 3V5FA 3S1XA 2VUYA 1KM2A 1SSGA 2ZDRA 1TPFA 3AYSA 4J5NA 3TMQA 4Y7EA 4GUIA 3F2DA 2P10A 1G1YA 1S5NA 2PB1A 3CQKA 4YPJA 5FESA 1P1MA 5DO8A 2ACRA 4O1DA 2FGBA 3TIMA 5AHFA 3H2CA 2QGHA 3UWQA 1EHNA 2XYLA 1ITUA 2HNEA 3W83A 3KL3A 3EDFA 4HT3A 2E6YA 7ENLA 3RAOA 3TX9A 1YQ2A 4DYEA 4JEJA 1WOAA 1R0MA 3BV7A 2ZE3A 2GJRA 1POKA 1GOWA 4WSJA 1F61A 1JF6A 3RF9A 4DWSA 2PD5A 1X7IA 1MNZA 3S46A 1MEWA 3NQ7A 3SCQA 2R6OA 2PURA 1RK6A 2A85A 4MMWA 1EJVC 1JPIA 3EX4A 5HATA 4NT0A 3C61A 3UD6A 4PMJA 5BU6A 3TLQA 1R3RA 3KTCA 1D2KA 2H9AA 3E49A 5D9NA 4DBDA 1V6WA 3A13A 1GJPA 1XWYA 1P0EA 1Q6FA 3KCOA 3U3HA 4BF5A 3ZXWA 6XIMA 1Q5MA 4JIHA 2FZNA 4BEQA 3UXLA 3EMZA 1XLLA 2VWSA 4JL2A 3ANVA 1YPIA 4M29A 2GLKA 1ICSA 3BL3A 3PZTA 3E2SA 3SSJA 1QFEA 1TG7A 4FP1A 1CGVA 4K3ZA 4LCSA 4JOMA 3DG3A 3VGFA 1DIKA 5GNYA 3KTXA 3TYZA 4HPGA 3AICA 1GW1A 3OGRA 2B7QA 3I7RA 4UR8A 3G6MA 1XIIA 4JS3A 2NSOA 5D2WA 1DYSA 4M3PA 4ZTYA 4MDPA 1NIUA 3GUWA 5J8LA 1FWAC 4GZIA 4QISA 5LGXA 1FWSA 5E70A 1JI2A 1I8JA 1KRAC 3B0PA 4TTGA 3K8KA 1IT7A 3SCRA 2CHRA 1YRRA 1EEXA 1MYRA 2NZLA 2YX0A 4L1GA 1W17A 1JR1A 2OGJA 1EDTA 3E6EA 1R3YA 4X61A 5BMWA 3O8AA 3GIYA 2DH2A 2PD9A 1W5OA 4QE4A 5FACA 3T9PA 2Q6ZA 2NV1A 3VKJA 3ZMRA 4HNLA 3FV9A 3BG5A 3H2FA 3UPMA 2RFGA 1M9HA 1RV8A 3T7VA 1LBMA 1AW1A 3EDDA 4XUYA 3AXXA 1S1PA 1IEIA 2VHLA 3LGGA 4HA1A 3TYCA 2TPSA 3CYVA 1GVFA 4HHPA 1XLAA 5FJPA 1XLKA 3SCWA 2PTXA 1TE1A 5KMYA 2BS9A 1TTJA 3CO4A 1EJ7L 1YXCA 3CHCA 1KBJA 1K4HA 1K9TA 1V77A 3ONBA 2QVNA 2NQJA 1GWJA 2FDSA 4CN4A 5I3HA 1QBBA 3HMCA 4J7RA 4CQBA 1M03A 4B15A 3M0KA 1JEZA 4Y9NA 4GA8A 1UP3A 3BH4A 3NGJA 4GQBA 2R94A 1J0ZA 3LI0A 1FH9A 4PTVA 3L68A 5I3FA 3KCLA 3FN9A 2WOQA 4NZ3A 3CZLA 1YHTA 4EANA 1WXYA 1G7UA 1F7BA 1W3HA 4KPLA 4C6KA 4IMGA 2PP1A 3CHFA 4NI3A 3F4NA 4GY0A 3VM5A 3MPGA 3JUGA 1VJIA 2YCIX 4UQCA 3LHYA 5CGMA 4O53A 3CUFA 1ZHAA 3GVQA 3OW1A 1PO9A 3MUY1 3DEQA 3KRSA 3LENA 2HK1A 4LUSB 3GR8A 5KZ6A 5DN1A 1UR4A 2C14A 3ITVA 1VF8A 2VXNA 3EX3A 3KOFA 2E9BA 1RJRA 1HKVA 1ZP4A 1QI0A 5BRPA 2WCSA 1PWLA 4WXZA 1JZ5A 3SGZA 4M6VA 3VPLA 4FIQA 3P2VA 3AUOA 3FA5A 3WF3A 3CZ8A 1UZ4A 1XD1A 1WNOA 5HDRA 2P5NA 1DTUA 4YWSA 3LSCA 4UOQA 4JTTA 3S0CA 3R8GA 4I6VA 1F8MA 1FHLA 1UA7A 2XN1A 1LLZA 2W6RA 3MSYA 4JTJA 1SFLA 3I65A 1B3OA 1IXOA 1E1EA 2X0HA 1L0PA 1R9YA 4F2TA 3DHPA 2XH0A 4Z2HA 1KQYA 3TOYA 4V33A 1YNQA 2DUZA 1ADSA 3N2TA 2PDNA 4RNFA 2QW5A 5CPOA 2X2GA 4QLLA 3MUZ1 4DELA 1HKWA 3ZLFA 4W9TA 4H8HA 3BAWA 4S3GA 2VEPA 4L1XA 4X9SA 3CU2A 4D8AA 1QPQA 2V67A 3ES7A 4YJ5A 2HNHA 1GONA 3THUA 2A2IA 3W29A 1TMHA 3LGDA 4LVBA 2WPBA 4S3BA 3MUIA 3WLKX 2WV8A 4JN6A 4UQBA 3U2CA 3WH5A 2YBVA 1XCWA 1JD9A 1AH3A 4LANA 1DWIM 3DYOA 3PR2A 1XLJA 3GFZA 3GHRA 1BWLA 5CSYA 2O55A 2YYUA 3B05A 2EG6A 3CL8A 3EOEA 3M5VA 1XIHA 1S46A 1V0NA 2I16A 1JCYA 1RY0A 5CC3A 4XBKA 4TVUA 5HXMA 3BZGA 4G9PA 2ZX6A 4J28A 4GE8A 3VD9A 1CB7B 2HVOA 3VOCA 3VE9A 3BGGA 3L4YA 1NAL1 3ZYZA 4BI6A 1EA0A 1G4SA 1R87A 1HZYA 2NSXA 1NP2A 2GUYA 2HBXA 5CBIA 1UWIA 3V16A 5BROA 3NZRA 2DZVA 1AW5A 3LYEA 1Q6GA 5M03A 3ARZA 4JTFA 2VKZG 3C52A 4LB3A 4Q4QA 4RZ4A 1Q6CA 1VFUA 2Z7KA 2Z6IA 3EDEA 4LS2A 3W07A 4RUBA 1I2PA 2J6XA 3EEZA 2XUCA 4LAOA 3BGJA 1XIMA 3ORWA 2QUTA 2I56A 2PDCA 4FI4A 2WCGA 4GGHA 3VOJA 1K02A 4OTKA 4YYFA 2Z6JA 3IRSA 4MB1A 1FOBA 1TUXA 4DYKA 4MYXA 4UFKA 3CUJA 4HHHA 4JHMA 4F79A 3AYRA 4R9XA 1DEDA 1XCFA 3NQAA 3AMCA 1OD8A 3QQWA 3GNXA 3LXAA 1DJNA 2WMKA 4QR6A 1WKFA 5C54A 4YCPA 4AZ6A 4P61A 5DMMA 3CAVA 2C7FA 3M0YA 2XN0A 4G56A 3CL7A 3F03K 2FPVA 2OGYA 4WJEA 1JD7A 3AXMA 5TQLA 3H54A 3LXBA 4WUIA 3RLVA 5M5DA 3HQOA 1JZ2A 3NL6A 3W7IA 3W7HA 2IKGA 2XFRA 1E1CB 3LCFA 1XYCA 3N11A 3R79A 4HZMA 3PBWA 4S3EA 3WBEA 5D33A 4KFNA 4FNPA 3H4XA 3S9IA 3OVGA 3H7UA 3WH7A 1CNVA 4OVXA 2ZA1A 3RDKA 1OY0A 2QPSA 5C71A 2XH4A 3QMRA 3VU2A 1VFFA 3S1UA 2WVSA 2Z1SA 4L4OA 4GH1A 1E51A 3GKAA 2GQ3A 3USBA 1ZU8A 2BBFA 2DVUA 2X0YA 3W4RA 1UKSA 4N6FA 4DEFA 1OCBA 2DZXA 2Y5EA 4GC4A 1ZJIA 1JIBA 3OO2A 3O9NA 3N12A 4C1NA 2YFNA 5HQEA 1S3TC 4NASA 4LTSA 1OFOA 4AZ5A 3RM4A 4Q4OA 3PNUA 4Z1CA 1OQFA 3BSGA 3S5SA 4IMAA 1TWSA 3ITTA 4Y96A 1QI5A 4Z2JA 2W27A 4IMDA 2ISVA 1SPQA 2QJNA 1E73M 5F4WA 2WMIA 3LY0A 1EUAA 3R7MA 2F61A 1L8PA 2V63A 5CPQA 4C6BA 5KZDA 1C90A 1MRQA 4K1WA 1HP4A 1U22A 1I0BA 1XH0A 2BVDA 4NZFA 5IFTA 2YFOA 1M01A 3SCVA 2PDXA 3WMSA 3TYEA 5FEXA 3L23A 3NQ2A 1PTDA 2I9EA 1OJXA 2YPIA 4DUWA 1H61A 4TU1A 3TSMA 2HPIA 3AXHA 3NZQA 3NXLA 1DJXA 5CSRA 1EDQA 4I5RA 5DEZA 3WL0A 1B57A 3GG8A 2E09A 2VGBA 2A3LA 5DF0A 3PANA 1K8YA 3VUPA 1QNQA 3W6MA 1B31A 4BKNA 1FUYA 8XIAA 4YTRA 1TVPA 3NJ3A 1B4EA 5T8GA 3PTKA 1HX0A 2ZYFA 3WQFA 5DANA 3ZJ8A 4OIFA 3UW6A 4CKQA 3EPNA 1HW6A 1JGMA 1LOSA 3APTA 2POTA 4Y9MA 4YHGA 3NPUA 1Q65A 3LLXA 1W3LA 4JFUA 3ABRA 2OFJA 4O15A 2VP8A 4WY0F 4PMVA 3ALGA 2UY3A 5LA1A 3NQVA 4E8GA 1QHPA 2JBMA 4MFDA 5CPSA 1B3YA 1H7RA 3CNYA 2X42A 3KZPA 1LRQA 2E3ZA 1HF6A 4KWOA 2NX3A 2Y5JA 1AK5A 2OT0A 1V6VA 3E0IA 2D20A 2DFAA 2ZE0A 4I7WA 5BRQA 4A3QA 4DZ5A 1A5AA 1KCKA 4HA0A 6TAAA 4W7VA 4YHEA 1RBOB 4FK9A 1E4IA 2CHOA 1YBQA 3ANUA 3ZT7A 1ZNNA 4C7GA 1UZDA 3E1F1 3TN5A 3ZLHA 1T96A 1SUXA 1W3TA 1KO0A 4DO4A 4BQ4A 1UPPA 3GIPA 1GPWA 3V1HA 8XIMA 3H2NA 2OTDA 2RDTA 3C0LA 3MMWA 5DMLA 1EC9A 4C6MA 4NY2A 1QNRA 4NUWA 4ZENA 3CUHA 5F1VA 5LIYX 4I8DA 3LNPA 3I3EA 3J7HA 4NYYA 1LZOA 1XLGA 4L61A 1RBLA 2OEJA 3L5AA 5FCZA 5I3JA 3S5ZA 3PZMA 1O94A 3CB3A 1VHNA 3CLMA 4U5IA 3VNLA 4AHQA 1XD0A 4H8VA 5LYRA 2FPTA 3UF9A 1JFHA 3F7JA 4HN8A 3ZVHB 3W7GA 2B81A 3CHVA 2HTMA 4AWUA 3RILA 5AB3A 4R34A 2F6UA 5IDIA 4QLKA 3IVUA 1UKQA 3FJ6A 4AB4A 3HG5A 3N18A 3T4WA 4BEUA 4ZODA 3A6OA 2WLZA 3WFZA 2VTFA 1XUUA 2CLMA 2YW3A 5GNZA 3S2JA 5HR7A 2G3NA 5BCAA 3OA3A 5BXSA 3GWQA 3FAXA 1KLZA 3K4WA 2RKXA 4FNQA 3T09A 4F4RA 1K6AA 1W9VA 4UTTA 5BNKA 1Z3NA 3QV6A 2E28A 1H4PA 3MCMA 2QT3A 1YXYA 1ODUA 1VP5A 5E9AA 2DY3A 4AAJA 4DZIA 3KWXA 4IM4A 2OO0A 1UC5A 4H1ZA 1TPH1 4O17A 5CCZA 2W92A 5LA0A 2Z1KA 3EA3A 4YTSA 4ZXLA 2NQZA 3AWNA 1XH1A 4JTKA 2QJHA 1V7AA 4PR4A 2HRWA 2XISA 4XAYA 3D3FA 4UBPC 4ZTXA 1XUZA 2NUWA 1R9XA 4B4HA 4U5KA 3SRKA 4JIRA 2GK1A 2Y5SA 1DE6A 1ONEA 5CG0A 2HCVA 1NWRA 4PSPA 3TROA 2D24A 3M0ZA 3G18A 1R9ZA 2O92A 1NFPA 4E6MA 5IHRA 1I0DA 1PX4A 3MV11 1U1JA 4LS0A 2JF6A 1ZFJA 3GBDA 4MDOA 1REQB 3GAKA 2DSKA 1ME9A 4QJ5B 1W54A 2IUZA 2Y89A 1BG4A 3WCZA 1Z8AA 3W1AA 3G1VA 3HG3A 4YS1A 1Q4NX 2BASA 3SCPA 2BXZA 2PDUA 3I4EA 4ACZB 3IACA 3ARYA 3TUUA 4JKMA 1A0DA 3FA3A 2XIOA 2YL8A 3N4AA 4HU3A 1ZPTA 3N13A 1E71M 3ARUA 1KM3A 4RNHA 3QR1A 1JG9A 4GUFA 3C56A 2FTYA 2QMKA 4BY3A 4C6NA 5LHFA 3TYDA 1FWRA 3M43A 3WNPA 4AMCA 3PZIA 3BJFA 2VFIA 1XG4A 3KOZA 3A5FA 3AIWA 3A12A 3LEPA 5AC5A 1UKPA 3H55A 2O7SA 5LIKX 1UWAA 2H9AB 1N82A 4M0XA 2YL5A 1F8IA 3U5YA 4JXCA 3EWZA 3BQ5A 4CUCA 2VUNA 1F07A 3LPGA 3GC4A 3M0VA 2WHLA 4V2XA 4D6JA 5A69A 4W8LA 1V3IA 1LT7A 3WLTA 2BV9A 5CLTA 2WHJA 3I6EA 3BCFA 5HANA 3SI9A 4D6EA 1TPVA 4IZGA 5T91A 3MP4A 3STEA 3P6LA 4NF7A 1XLCA 2V5JA 1WAWA 1VC4A 5BW6A 4Q22A 3B03A 2YDAA 3N6QA 5C5YA 3OG3A 3WY1A 4AY7A 3VCRA 3MHFA 4QGCA 4MY9A 1XW8A 3RHGA 1J0JA 1EBHA 4KESA 3R10A 3W85A 2J13A 4MZ8A 1U2YA 3VIPA 1UUOA 1WXZA 4HSNA 4PTNA 3IS4A 1E0TA 3MZ2A 2DGAA 4XO6A 4B90A 1XG3A 4FOJA 3KRBA 3VX0A 4FR1A 1L2QA 3M16A 1CLXA 1ISXA 2Z24A 2OJPA 2QR6A 4HK7A 3R11A 3LOTA 1SO6A 4RCXA 1PZ1A 3LHTA 1K9FA 3ZT5A 3NPWA 3W1MA 3UXIA 1GW9A 1W1VA 1V6TA 5FD0A 1IR2A 4OBRA 3V7PA 2J78A 3WQWA 2A5HA 2CEQA 2FGLA 4WY0A 5A94A 5CPNA 3WUGA 1E15A 1A3WA 2EBNA 4DJFD 1ONWA 2P76A 2GDQA 5D2XA 3OPSA 1V3JA 1G4EA 3EX1A 4MY1A 1XDJA 4G5DA 1HL9A 3LV5A 2INZA 3O07A 4NKCA 1AODA 1W3KA 3N6JA 4IL0A 3ENLA 2E0PA 4L6OA 5HMSA 1FY6A 5DCDA 3MCNA 1GVRA 3HIJA 1WUEA 2FMNA 1E6PA 3B0YA 5G4HC 3VIKA 3M0HA 5CJMA 4AU0A 5HPCA 4YWIA 1Z9AA 3VTRA 2PC4A 3S5OA 2G50A 2Y6ZA 4QG6A 2PWDA 1QATA 4MFEA 5DT5A 3B04A 4ICMA 4UQ9A 1UB3A 2YL9A 3EXSA 2WSQA 3RMEA 1LUCA 4XSLA 2Z1BA 4AUBA 1J11A 1O5KA 4WK9A 2VRKA 1IEVA 4QLJA 5LNUA 4FNTA 3WD2A 3C8FA 4M7TA 4FPSA 4RV8A 3HGSA 3L2LA 4HZ7A 1MQPA 4L6HA 3GY1A 3GE7A 4H04A 4CD4A 1OX6A 1GZJA 2NW0A 1CGYA 4F48A 4FA3A 1M7PA 3AHYA 4N4QA 3FXGA 2EO7A 3VZXA 4GIRA 4YVXA 3L4WA 4H9YA 1K9DA 3TLLA 1D7KA 2D2HA 4D1IA 1AH0A 1WDPA 3HQ1A 2CLEA 5AECA 4LCRA 4ORMA 3BLKA 4LGXA 5EPDA 3B97A 4NJIA 5K9DA 3SN0A 2V30A 4JFSA 2QJIA 4Q8MA 4KEVA 3PAOA 4XISA 5BRBA 3AAMA 5JU6A 4TXEA 4NNAA 3SRFA 4QFUA 1D3HA 3S6TA 3GW3A 1F9CA 3E0FA 4GGBA 1HT6A 4US6A 3E2VA 5I06A 1BWVA 3QV9A 1B90A 3G1RA 1OX4A 2EJ1A 4IWWA 4Q4SA 2YDSA 1EWDA 4JKKA 3PBUA 4X0NA 1OFQA 1OGBA 1TV5A 4ZQNA 3BOXA 3G1YA 3ZWSA 1XX1A 1V02A 1KD0A 4CQ8A 3JZUA 2QMJA 3TFCA 3B9AA 4F8XA 1AQ0A 1XLHA 1B2YA 3DHUA 5TNVA 1I2OA 1R5YA 2E77A 3VNMA 1UP2A 3POCA 4A05A 1TX0A 4C65A 1W9DM 3GTNA 4AIBA 2GGGA 3BWWA 2OLSA 9CGTA 4BZYA 3BDKA 4S3CA 1FKXA 1LG1A 1VFMA 2BLEA 1T0OA 3P8IA 3PBMA 1C7TA 2OMAA 4NIRA 5BOEA 2FTPA 2QV4A 2WHKA 4RXFA 2Z25A 2OSWA 2KZHA 3QSTA 4ADUA 3S1WA 4GXWA 1H5YA 1W5PA 1Q13A 1UBSA 5MHBA 1BAGA 3M0XA 3GM8A 1RHCA 1HQTA 4H6EA 3VAVA 2VENA 2DW7A 1EPXA 4PA8A 4LUYA 3VGDA 2A3AA 4O0QA 2A21A 3C0QA 4PN2A 4B3LA 2QGYA 3O6AA 2XH7A 4M1RA 3YPIA 2WKJA 4ZOBA 3W00A 3LBCA 1FP9A 4A21A 5DLCA 3W1PA 2B7OA 2DSUA 2AL1A 1VPQA 4HTYA 2DZTA 1EH9A 4FXFA 2X2YA 3DFSA 3EWBX 2E5BA 1NH6A 3CAWA 4POCA 2RDXA 4PMDA 3BLOA 6ENLA 2INEA 3NPXA 2HXTA 3TYUA 3UJSA 1W32A 2JGQA 4KWWA 4DUOA 3HOJA 1NU5A 3IEBA 4JDYA 3CV2A 3GDLA 3N6HA 4LBUA 2DU2A 3UU0A 4H9VA 3WIJA 3S2CA 3PFMA 1FWGC 1XIJA 1Q85A 1D8WA 2QV5A 4I9AA 4RPQA 4UZUA 2PODA 2CU0A 4N7QA 3T07A 1PJ9A 3OYXA 4Z17A 2DVTA 4E4UA 4MG4A 1MEHA 3NDOA 1EF2A 4LY4A 2Y2WA 5D32A 4P2VA 4OZOA 5KEZA 1CW2A 2ALDA 3PS7A 5HA7A 3B06A 1RZMA 3OLDA 3VA8A 3NDZA 2GVLA 5AHLA 3S83A 1R3TA 2JIEA 3IIOA 3QXBA 1QPRA 8TIMA 4CCCA 1KR0A 3WEOA 4EP8C 1YTDA 4Q7NA 1WV2A 4CNSA 1IT0A 1VENA 3UETA 5SWUA 3LHZA 3NM3A 3VKAA 3HQPA 1H50A 1H60A 1MW0A 2RH9A 4CNUA 2CZFA 1PIIA 3WNOA 3A4JA 2X0SA 3VDGA 3LG3A 4IIFA 1JAKA 2NQLA 3RYSA 5AFDA 1W1IE 3KVKA 4MPKA 1GEQA 1P6BA 3UXKA 3CLWA 1GOOA 1E43A 4GO8A 4WXYA 2PUZA 2QQ6A 4C1NB 3W7DA 2BGNE 2IW0A 2QHAA 3A4WA 3U4AA 4ATLA 2FDMA 2G0WA 3ZSSA 3SFKA 4IIEA 3KOXA 4FLOA 3L9CA 5E6YA 4EPBC 2HXUA 2PSNA 1ZAIA 4KFOA 4Y2WA 3WYZA 3T1GA 5D8WA 3G8RA 1SFJA 1UD6A 4DZAA 1UA3A 1X1ZA 4GUHA 3RG6A 2CBJA 1X1NA 4UB9A 1TTIA 4O1AA 3WQ6A 2IKJA 1F73A 2RJHA 1Y7VA 3GXPA 4D8LA 2IMRA 3PZ9A 1SR0A 4OUIA 1VQTA 3LDVA 3O6YX 3A9IA 3UA3A 4ERGA 1RQHA 1WQ5A 1KFJA 1EBGA 3FX4A 3SN4A 5HUPA 1QR7A 1R3QA 2J77A 5EYWA 4EIVA 2ZZ1A 1AL8A 2HPMA 3WMCA 3HV9A 3FJNA 2R1LA 1ISYA 3UR2A 1B3XA 3IUIA 2VFDA 1E0XA 1E0WA 3CB8A 4JFWA 4YCOA 3AISA 4HK5A 3NTYA 1S2TA 3TZFA 2V3EA 3D46A 2CHNA 1CGUA 2DW6A 3WBYA 4XZWA 1Q6QA 1H2JA 3G0UA 1J79A 3THDA 2J25A 1WDRA 2WW5A 1FWHC 1GT8A 1TKKA 2ATMA 1Q63A 2J66A 3LRLA 4JNZA 5K9CA 4XVEA 3A9BA 2A3BA 2CZDA 2ZA3A 1UHVA 2ZRYA 1JPKA 1A50A 2WHMA 3TW6A 4IGHA 3P62A 3ME3A 3N25A 3VNJA 3TOPA 5DRCA 4AYGA 1I4NA 4GI9A 3SQSA 2QPXA 2DSZA 3NEHA 2BOEX 4AWTA 4YVVA 3DYPA 2VOTA 1FTXA 3A5VA 2EQDA 4C6EA 3VABA 3CWNA 2XM1A 1F5ZA 3EPOA 5ABTA 4HU0A 5JIPA 2W67A 2XWEA 3CWOX 5D4YA 2QCFA 2DIEA 2HK0A 5I00A 3NQBA 8CGTA 3N2MA 2Q8LA 2QKFA 3WF0A 3EKGA 3GH5A 3SAZA 3HJZA 2WVVB 1NEYA 4LF1A 1S5MA 4PUKA 3REQB 1GVOA 4RL3A 3U2EA 4DPPA 1GQIA 4TQTA 1A5BA 3B9EA 3W2UA 2EKCA 4RZBA 3HG4A 1XC4A 1CXIA 3CM4A 4GYJA 1V3LA 1DQUA 3MV01 4CGTA 3P74A 2J6VA 1OK6A 4O4VA 3KVLA 3SEPA 3EB4A 3NQ6A 2NVDA 4EAYA 1IGWA 5FF4A 4JHZA 1GVEA 2R9RA 3ZOAA 3NQCA 4Q4KA 1KQZA 1OT2A 3CIWA 4B16A 3BMVA 4DBSA 1OGSA 2XGZA 1YNYA 1HUVA 4IGMA 3UG3A 4CD6A 3G6LA 1J4EA 3BGAA 2Y7DA 3VDCA 3PG9A 1YDYA 1E40A 2WAGA 4O18A 3VNZA 1Q8AA 2QZRA 3I7QA 2ZXAA 5CC6A 1WDQA 4I9TA 3P5YA 4ZQRA 3ZZ1A 5HNRA 1E0VA 1BPLB 3IJ6A 4XKMA 1FWJC 3PBYA 4KWUA 3FGCA 3TQVA 5A2CA 5CG7A 2HS6A 3BAJA 2A7PA 4JIEA 3UCQA 1ZP3A 3JU2A 1J12A 4GK8A 1AVAA 3BG9A 2F2KA 1GZGA 4KETA 3UFYA 5AHEA 3VCNA 2GJXA 4ZOEA 4F0MA 3IUDA 1NOWA 3N1AA 5HMEA 4ZCWA 2OWWA 3MDUA 1LLWA 3FKKA 3HGRA 2XSXA 4DO7A 1L6FA 3SM0A 3QQ1A 4OBTA 3S2NA 4HU4A 4U33A 1KFKA 5JBEA 3T05A 1KC7A 2AMGA 4EWND 4IT1A 3PULA 1BYCA 5ABEA 3MB9A 3ZQ9A 1UD4A 2FB3A 3C6CA 1MW1A 3FNDA 4DLMA 4FB7A 4MZYA 3LV6A 3ARXA 1M6JA 2ZQ0A 2DSVA 4DIAA 1EJWC 2YA0A 4M81A 3B4YA 4JBRA 2PWHA 5EFDA 4AZCB 4JIQA 3HPAA 3W6LA 2J62A 2VZSA 1I1WA 9XIAA 1YXDA 2NT0A 3CIVA 4AIOA 2J7BA 3N17A 1JDDA 4X2RA 4RE2A 1EJXC 3BTNA 2Z1WA 3AJ7A 4DNMA 4MIMA 5DMYA 1M3UA 5A6MA 3WLPA 3PZNA 3GHSA 5C9ZA 4MB5A 3Q4DA 4Z1AA 2GJNA 1A49A 1VBRA 4JTIA 4HHLA 1FX6A 2V9DA 3NO1A 1Z6KA 2J8TA 3DN5A 4PE8A 3KS5A 1H1YA 2TODA 3UQNA 3WQGA 5CQ1A 1W8SA 1PAMA 1XINA 1ZL1A 4GZ7A 2NUYA 1S2CA 3MVIA 3H26A 1XPYA 1E4LA 5I78A 1AH4A 2UY4A 4UMCA 2VNCA 1SJDA 2PMQA 3W7NA 3TTEA 2J7DA 2VMFA 4DO5A 3LPOA 2XGBA 3L0KA 1TWZA 5FEPA 5KINA 5JBFA 1W9UA 5AC8A 4C91A 3CYJA 2HE8A 4XX6A 5IDZA 3M7WA 1BKHA 2D22A 1V3KA 3UR8A 3N14A 2GJPA 5A8NA 2XSBA 2R24A 1G4PA 1XYFA 3BLEA 1EO7A 5DXXA 3G1HA 1J18A 2OEKA 3LTPA 2DH3A 4MLJA 4HQVA 4A3UA 2ACSA 2TRSA 3TK7A 3R43A 5LKYA 1XSIA 3AFBA 4CU8A 1I2QA 4Q3MA 1OINA 5AZ1A 1Q7ZA 3GHTA 2B31A 1EC7A 2WANA 3ZVIA 1PHQA 5HOSA 3TN3A 2CBIA 4CD7A 3EB2A 4IICA 2FB2A 1TVLA 1PCWA 4Y9AA 5E9XA 2CZVA 1O5QA 3LHWA 5K2ZA 3QY7A 1JZ7A 1H1NA 2WZHA 3S9YA 2QCCA 2Z00A 1E55A 5F1UA 1LBFA 5C7VA 2EXOA 1CLKA 1OFRA 1EZ2A 3TCEA 3SY8A 3BV4A 4Q8TA 1C8QA 5J5RA 2Z7GA 1KXQA 3LCXA 3LUTA 2V68A 2CLKA 4ROQA 1DE5A 3O16A 2IPGA 1PX8A 2ZTKA 5H8MA 4C6CA 4PUMA 3N2BA 4PB4A 2X16A 3CEPA 4A6GA 5D09A 1LWJA 2QJJA 3GK0A 4JX6A 4UNLA 5FSEC 5A8OA 3RXZA 1CGXA 3QC0A 1QOQA 1O7AA 3WDRA 4CU6A 4WGHA 2CLOA 3BSMA 3M0LA 1W9PA 3RK8A 3FFSA 3OTRA 5B80A 1MI3A 4UIOA 1E6XM 1TZZA 4M24A 3UJ2A 1X6UA 4A35A 1UMLA 3UY8A 1T41A 3IAPA 2OLHA 3HPXA 3LCGA 2WB5A 4JTSA 2CXGA 2Y85A 1FWNA 2HBVA 1JCMP 2Y7FA 4GABA 3OLEA 1BYBA 1ZY9A 5G4EA 4QROA 3BJSA 1KR1A 3W7PA 1DQWA 2WC3A 1O5XA 2X7VA 3W7EA 4MWAD 1LQAA 1UH4A 1JYXA 5CZKA 3TU9A 4TR9A 1VB9A 4HJWA 2V81A 1KV5A 2OKOA 2PGRA 4HNNA 4LRTA 2Y88A 1Y65A 1XIGA 4E4FA 4JQAA 5A5WA 2WJDA 4DHGA 2ZIDA 4JTHA 1E0UA 2GGIA 2XN2A 3L66A 4CNOA 4QCEA 3DCPA 1W9BM 1VYPX 3GBEA 3DC0A 1ME7A 2ISFA 1SZNA 4E5TA 4NHVA 5E6ZA 1DOSA 5DCBA 3NNTA 1LOQA 2CETA 4CN1A 1R2RA 2BB0A 4H83A 4B5SA 3EYPA 4JTQA 3WENA 3NQDA 1I75A 1S1RA 5GJMA 3PFRA 5CBJA 1TRIA 1XSKA 2VGIA 3E5BA 4GNJA 1VJSA 3H24A 1P5BA 4JTCA 1YADA 3BARA 3VIGA 1JUKA 5CAKA 1YDVA 1JAEA 1MXDA 4PUEA 4JQ3A 1QXLA 3Q37A 1BYDA 3OIHA 3RM8A 2BVTA 3W87A 6A3HA 7REQA 2YXXA 3WLJA 3WK2A 1GNXA 1J2BA 4U28A 1QBAA 2BY0A 3AS3A 3MWCA 4C5YA 4H7ZA 1HVXA 1W2VA 4ZO6A 1GHRA 2O9TA 2V8ZA 1NOUA 5CZTA 3UZZA 2FZ8A 4LY8A 4UTLA 4JD4A 5KZEA 1O6IA 3KHJA 4GVGA 1X39A 3CZEA 4FZIA 2ZX9A 1BLIA 4QE1A 1JJKA 3L2MA 5K7JA 3T4CA 4H6QA 1AJZA 3CJPA 2G3MA 2WJZA 3C4UA 4JNYA 1ESWA 4AX6A 2QF8A 2G37A 2PRLA 1FHVA 1NP0A 3IWPA 1MFUA 4GYFA 1EFZA 3NO5A 3R2GA 1W91A 3THAA 4O12A 1JPHA 1M7OA 3S5NA 1M53A 1PHWA 1XL9A 3BLPX 3W7MA 3SBFA 3AU6A 2C8NA 2ISDA 4C6DA 3O3RA 2CW6A 3VGBA 2BX7A 3VZZA 2W61A 2ZX5A 2X05A 2RDUA 2F8QA 2VX6A 1A5MC 2BZNA 3KL0A 3A4XA 4BS0A 5HWNA 4TX9A 1F4HA 3HURA 1ZTVA 3S47A 4PTWA 4QSFA 3WLRA 4IQDA 4LCQA 3P3BA 1E6ZA 1FXQA 1XDLA 2V3FA 1FWEC 3TW7A 3TQKA 2PDJA 4QEEA 2V2CA 1BFNA 3E2RA 2OYKA 4XKYA 1UH2A 5CJ5A 3FS2A 3NSMA 1LOLA 3MJYA 4KRTA 1ZBCA 3REQA 3NG3A 1MQQA 1RJQA 1PTGA 5C2XA 3VIMA 2C1IA 3MJMA 4ZMGA 5KETA 3W82A 4JN7A 3AIEA 4UTMA 4FLRA 1HFBA 2ZFAA 2WK2A 2XDFA 2WYSA 1XHGA 3TQ0A 4PL2A 4FXJA 3GUGA 5REQA 4ONVA 3ITCA 3WDIA 2EKGA 4DZHA 2QVHA 2G4FA 4HOZA 3QHOA 3DH7A 1IZJA 3U4FA 4GXPA 4MWAB 1SO3A 4AHOA 3EOLA 5ABGA 1XQLA 4MNKA 4NSBA 1PZ2A 3H4WA 3LNMA 5DY3A 4ATDA 4I7UA 2BP1A 2CLFA 2W79A 4NAFB 1J0YA 3K1DA 3SUSA 3AU2A 3TA9A 1HKIA 1BXCA 3M5YA 2ZRVA 3T0DA 4ZXOA 2EF9A 1DIDA 1X7FA 1XDMA 1TRDA 4AF0B 3SCSA 3CT2A 1V93A 4XZ9A 1ZBKA 3GXIA 2WVTA 2GGEA 3IRDA 3ZFHA 1S5TA 5FF7A 1ISVA 3PTDA 1XYZA 4P5UA 1ISZA 1L2UA 2PLKA 2ACQA 4AY1A 3LERA 4HSOA 3KVJA 4TTUA 4V1XA 3QGVA 1BRLB 1LROA 3W7LA 5E09A 1SQ7A 4B2DD 2OSYA 2ZX8A 4XG1A 4LUJA 2ZZ2A 3W1RA 3R94A 3ZJ7A 1YPFA 5C2GA 1GQKA 1SFTA 2ODOA 4E4PA 3ITYA 2FPYA 2PGWA 4JTLA 1DIEA 1DPMA 3UT0A 4WLCA 1RPXA 5AYIA 3AMGA 2AGTA 3CC1A 3B0XA 3GB6A 1MW3A 1X8FA 1IXQA 2J8GA 2GUBA 5GJPA 1C93A 2YDRA 1PE1A 4CD5A 1KFBA 1PX3A 5EMMA 5C0QA 4IGNA 4DY1A 3C0JA 4JN8A 1Z48A 1CB2A 1UD5A 4YIWA 3RGTA 1W37A 1ITXA 1KM1A 2OEMA 3IV8A 3LCIA 2E6DA 2FLIA 1D7FA 5D2YA 3G24A 2HQAA 4S23A 3HTWA 2W0UA 1R7AA 5D02A 3P14A 1V08A 3DC8A 3K4DA 2X8RA 3C86A 1VLIA 2J7CA 2VGGA 4CEXC 3OP2A 5BWFA 3QV7A 4J3XA 3S1VA 1VEOA 4IX0A 2ZXBA 2PFHA 4HNTA 3S9ZA 2IKHA 1X8CA 3EXTA 4AISA 3PZGA 5HNUA 4NJJA 3ARTA 5D2VA 2QYGA 2PWUA 3EA1A 3EAUA 1LT8A 3W70A 1S2VA 1ENUA 1US0A 3WNMA 5CH9A 1JCLA 1XJBA 7PTDA 4S2CA 2WWDA 4P7LA 4RZ6A 3O7UA 1G7VA 4Q7BA 3M47A 1LL7A 4F0LA 1EJSC 1JCXA 3WLMA 1DJIA 1R3WA 3O6CA 4HKPA 4A8IA 3DBNA 1SMDA 3GG1A 5T9CE 2O0TA 2Z4GA 1V6YA 3BLLA 4PTDA 3EWXA 3CQHA 4HMEA 2DJXA 1OG0A 2GVEA 2QDGA 3IJ9A 1G94A 3RRAA 1DXIA 1ONRA 3OEXA 3NVTA 2C1HA 3TW9A 3O0FA 3E38A 1WPCA 4QDMA 1KFLA 3IGUA 1EQPA 4O10A 4Q8UA 3EWWA 4Q4PA 4JX4A 2QCEA 4IUOA 2A6NA 4CCDA 3INPA 4F0RA 1IV8A 1GQJA 5CSSA 4R7OA 4EACA 1HL8A 2ALRA 3WX7A 2PDIA 5F2IA 1ZSXA 4MKSA 2CBVA 1BTCA 4PRTA 3LPPA 1WOBA 2HMCA 3PZUA 1EO5A 1V0LA 6REQB 4DWSC 1XIFA 1WYIA 4NRRA 3C2VA 5CBBA 1K6WA 3LM7A 2OKTA 3ABZA 4XO7A 1O5RA 3R8RA 2X41A 1G9HA 3O05A 3R58A 4UTFA 3SECA 1XBZA 5I03A 2D23A 2G4JA 4GVFA 5H6HA 2V38A 4LWWA 3WNNA 3HV8A 1JRCA 3W7OA 3U6WA 4JPGA 2BHYA 4QIUA 2EHHA 4AZHA 3ZO9A 3SGGA 1FWDC 1O12A 6PTDA 1JQVA 2H3BA 2VFEA 3WD4A 4R3UA 2D3LA 4LYQA 4TUFA 1DKWA 2V69A 4IIBA 1KGXA 4ERAA 1BHGA 3MP3A 2W3ZA 1XGEA 5T9BG 4ZO8A 3CV1A 3ARQA 4YL2A 4AD4A 3F5JA 1TPEA 1OEPA 1J10A 1NF7A 3G1DA 1XC6A 1GHSA 3CS2A 4O57A 3TXVA 4LALA 3A24A 4GIYA 3LLFA 3WLOA 2YIHA 4AZIA 3LU2A 1Q6RA 1FCQA 4HIBA 1RCQA 3U2OA 3IJLA 1TTQA 2JALA 4JYEA 3MKKA 4WQ6A 2V3DA 5MKGB 4Y8EA 1XICA 4H2CA 4JL1A 2YB1A 2FTWA 1NDWA 5HWJA 2AL2B 3SDOA 1CCWB 2E6AA 2FHCA 1OX4B 4HU8A 1F6KA 4CVWA 3SCNA 4AEEA 1IWPA 4W88A 5GPRA 4AEOA 1ECEA 1VJZA 2BHUA 3N2XA 6CGTA 1H1ZA 4NP7A 1T99A 4MWAA 1PYMA 2W5FA 1XRTA 4CD8A 3CQIA 1FWBC 1N8FA 1RJPA 2A7RA 3TCSA 4W89A 2I57A 3T0AA 3Q45A 3IVTA 1MUWA 1EA9C 2VC9A 1P43A 1JGIA 3MYPA 2I17A 3P0XA 4AVOA 1DJQA 3ABXA 3CV6A 1OZQA 4QQ3A 4ZFMA 3AZSA 2C19A 1KRMA 1BWKA 3IJIA 3WBWA 1W6TA 5FOOA 3M6YA 1B3VA 4MB4A 4JCMA 2WM1A 2VFHA 2J7EA 1QASA 1NTHA 3S6DA 4YU1A 5CPMA 1ZS2A 2DZSA 3M6DA 1DTNA 5I5RA 4GBUA 2V0TA 3VD3A 3OGVA 3W81A 1JZ4A 1IHIA 1OB0A 1GCYA 1XP3A 5LSMA 3QLDA 3KX6A 1LUCB 3SZ8A 5BWAA 4LYPA 5BYWA 1JDAA 4UQAA 1GK8A 4ZZ9A 2OZTA 2FFCA 3M0MA 4RKAA 7TIMA 1OCJA 2Q02A 5FJJA 1RALA 4UC5A 5I09A 5EFFA 2AL2A 4IX2A 4TMBA 2YW4A 3ZVHA 1ITQA 1FH7A 1SGJA 3JR2A 5EMUA 3MCOA 2NVAA 1A5NC 2CLHA 3PJUA 4IIHA 1JDEA 1XS2A 4CCZA 3MW7A 4FS9A 3SCUA 3TWBA 4I8YA 3MSGA 3N2CA 3MI3A 1R8LA 3ONCA 4XUGA 1TB3A 5LNWA 3AOFA 3FY1A 1J0IA 3CMFA 2XM2A 1MSSA 4HNCA 1FKWA 1JRBA 5MKGA 4GKLA 1WA3A 1NVMA 3RCYA 2EG8A 1QHOA 6TIMA 4C6QA 1QRQA 3I3DA 1XFBA 1J9YA 4UTIA 2EG7A 3DHDA 2X7WA 1VFOA 4FX8A 4ERIA 2WXDM 2BOFX 3VOGA 1YBQB 3MWAA 1B9ZA 4GY7A 3WG6A 5I6SA 4H6RA 1TZ7A 2YCLA 5CGQA 3WJWA 1EXPA 3W73A 3BLDA 2Y63A 4I5XA 1AQFA 1O1ZA 3ITGA 3UWYA 4Y6GA 3V36A 3AMLA 2PRHA 4GIAA 1OCNA 2C16A 3QN3A 4EXQA 4C7DA 1UP0A 5C8BB 5JH2A 3STCA 3C5QA 1O66A 3VI2A 3V4BA 1AJ0A 3B8UA 2DT0A 1MZHA 4UR7A 5FEWA 1VR6A 4C5ZA 2Z2BA 1LP6A 1SR9A 5HR6A 1GOQA 4E3TA 4LS1A 3QSRA 4O0ZA 2VJXA 4CLMA 1CTNA 4Q32A 3OGSA 2YBTA 4DF0A 1ML1A 3EDKA 3KBMA 5D37A 4C6LA 3UPBA 1KFEA 1EHAA 5FAJA 4GUJA 1WKDA 4DJEA 1GTHA 3RRXA 1W5NA 4Y8FA 1DORA 1GORA 5ABFA 4G1KA 2GDVA 1FWCC 3IJ8A 3N3TA 2QNEA 3W53A 3PPFA 1UH3A 1VCFA 3N9KA 3DIPA 1JCJA 4Z0SA 4JY8A 3RLUA 4TO8A 4HOXA 2J7FA 4WDTA 4IP4A 2MUCA 1FWWA 3G2GA 3LN3A 3FYPA 1PVNA 1TR1A 1OFEA 1OC7A 3E5PA 1L6YA 4LYKA 4GJJA 3W2NA 1GUVA 3DBPA 3QTGA 3DFNA 3R6IA 4GXMA 1WKEA 2O4QA 3QM3A 2G3FA 1RQEA 3WELA 2Y8VA 2XVGA 2V3GA 3B8IA 4IPLA 1JZ3A 1LTDA 3OVRA 3WQ5A 4PSRA 5D9PA 2BXVA 2XIBA 4Z2IA 2X1UA 4AYSA 3EXRA 1IXNA 2V5KA 3GU2A 3KLKA 4IH3A 3E12A 3LCWA 3M46A 4GI6A 2WMIB 1QU4A 1TA3A 5EMJA 2VDGA 3EBVA 3MUCA 1KXHA 5BZAA 2YCKX 4WKHA 1HNYA 3TWAA 3R0DA 1V4YA 3EZ4A 5CEWA 3FVDA 3KOYA 3EKZA 1OBAA 1A5CA 4BI7A 4KWSA 4YTTA 3D0CA 4BR1A 3UWEA 2CKSA 4AD3A 3CMGA 4S3DA 1W2PA 2BY1A 1CGTA 3UESA 5D03A 3MHUA 3LTSA 5A6SA 4WY0B 4K37A 1O4UA 2DSWA 4W8BA 3QFWA 2G97A 4YXGA 3WF1A 2OWCA 1TV3A 7CGTA 3CQ0A 1E6QM 5JVLA 2GPTA 1J0HA 2O9RA 2UBPC 3UYIA 2WCAA 2A0NA 4W86A 1KW1A 4AEFA 4EK7A 5K3VA 2ISSA 1FDJA 3AYVA 4DI8A 3NO3A 1PKMA 4N42A 3TP4A 3CHEA 3CZGA 4A3YA 1BD0A 2ZKMX 4K8GA 1RQBA 3VYLA 3T8QA 3O63A 2IPJA 3F2BA 3EWCA 4UTKA 1GJUA 1J2WA 1ZALA 2Q71A 4ES4A 3GXDA 2DUXA 1HJSA 4GMEA 3M5ZA 3MSRA 5I02A 4GVHA 3LX9A 3SJNA 3IK4A 3LCHA 4ZO9A 4UR9A 4HOWA 4MLRA 4E2VA 2VT0A 2ZICA 3CH9A 5KSWA 3PSVA 3VOHA 3AIUA 4W4QA 1J6OA 2FGZA 1QK0A 4HSHA 1QI4A 5I2UA 4WHBA 1J5SA 1UR9A 2GWGA 2J9ZA 3TJLA 4FNRA 3K8LA 4DJDA 4I90A 1F2JA 3OLIA 4MJMA 3HO8A 4DJED 1UIOA 1N55A 2PC8A 3WUEA 3GR7A 2F6KA 1EGVA 3OHIA 4N2YA 1RPKA 3URBA 3TMLA 2ZA2A 1LWHA 4J9JA 1TX2A 2PCEA 4MZ1A 1VAHA 4LF2A 1RSCA 3BVJA 4MNJA 2OT1A 1BQGA 3O06A 4G6CA 4Z42C 4GY1A 3LZ5A 1XISA 2ZTJA 5AZ0A 2PWVA 3K8MA 4DUXA 2XGIA 3QOKA 3M0JA 5AKQA 2PRMA 4RNJA 3AJXA 8RUCA 4B5NA 1VPYA 1F3WA 2YDQA 3W1QA 2FZ9A 2FYMA 3FDKA 3DX5A 2ZC8A 1Y8BA 3PNZA 3JW7A 1TJRA 4I7VA 1JL8A 2PP0A 3L4UA 4KS0A 1NQKA 3G1AA 3II1A 2NWRA 4DVOA 3GH7A 1US2A 3H2EA 3E0LA 4NU7A 4XQ6A 3H70A 3M44A 3PAJA 4HP5A 3W7KA 5H2ZA 4A4AA 2E4TA 1Q3NA 5A6KA 3PWAA 1VBUA 1XV8A 4ZB0A 9XIMA 4ZBCA 1HKMA 4XZBA 2JEPA 1EP2A 2BGQA 3SADA 3M1ZA 3K13A 1KFWA 2OG9A 2D0GA 3T44A 3TSDA 4O19A 4L5ZA 3SO7A 3M4HA 3S6OA 4BHYA 4WF7A 4S3JA 5BMXA 4MM1A 4ZR8A 4YNGA 1PDYA 1TV4A 2FZDA 3NXFA 1HO1A 2E6FA 3ICJA 1SZFA 1BSLA 3OBAA 3UJEA 3VZYA 1DHKA 1Y5VA 2NQHA 3P93A 2EPHA 3AWOA 3BZJA 4IG2A 2R1NA 3ABSA 2WKGA 2YKKA 1AMKA 1OIMA 2B7NA 3KL5A 2WZIA 4O1EA 3R4IA 2BVYA 4LV4A 3MVTA 4GLEA 3WQPA 4GZJA 2ZCGA 1SW7A 1XKJA 4JGDA 3VIOA 1G01A 5FF3A 3NZ1A 3N9RA 2E67A 2J75A 1BVWA 4PB3A 3RCNA 4B5WA 1R2TA 4GISA 1KBLA 3BE7A 1AW2A 5D9OA 5CZ0A 4GPNA 5ENLA 4PUNA 1EJRC 4JQ2A 3VKBA 3KBNA 1BGAA 2DORA 4DWSD 2MNRA 2WNWA 4W87A 4WSHA 2ZOXA 4JY9A 1MZRA 4J2MA 1C8XA 4I3GA 1C91A 1BTMA 4HPJA 1PIGA 1J93A 1HJVA 3GZ3A 4ATWA 3STGA 4GQ0A 3G8EA 2ON3A 1R7OA 3CWHA 4S3KA 1G67A 3EWYA 5C7HA 4JTAA 3VDHA 3WH8A 4AX7A 1XLDA 1QOXA 4HPXA 1SJAA 2J88A 5A2BA 3N73A 4E8CA 2QDDA 4DRSA 2WMFA 1H7WA 4AD0A 3RM9A 3UWZA 4Q6JA 4IXHA 1QK2A 1CECA 4NAEA 2NV2A 3KZSA 4D9PA 1V51A 4JTRA 3FOKA 1UR1A 1HJXA 1XI3A 3C2OA 3MKCA 3QR3A 3F4CA 4D6DA 2J7HA 1PUDA 1TCDA 4L9XA 3UZ5A 4BWLC 5BU9A 4IISA 3FEQA 1KXVA 4Z0JA 3CUXA 2VFFA 1VFTA 5I23A 1MW2A 4D71A 3HA1A 1QPOA 3DESA 1KCXA 3IK2A 4GZEA 3K5XA 4L9ZA 4NXKA 1GTEA 2YLAA 2QUMA 2VR2A 4F9DA 3W25A 4GQGA 1YDOA 3EOOA 1PPIA 3AQUA 4FF7A 3BC9A 4NJGA 4TV5A 1SM9A 4AWSA 4C6OA 3SRDA 3LBOA 3MUXA 1XFCA 3F5LA 3NOEA 2VEKA 4I6KA 1TTPA 3A4AA 4AZGA 2VD8A 3DAQA 2GGJA 1OM0A 3GDBA 4QG8A 3VD7A 1QW9A 3WQ8A 4Z1BA 1C9DA 3XISA 1B3ZA 1A0EA 2ZUSA 1E9ZB 3RO6A 1VEMA 1LORA 4TMCA 5I3KA 1CI1A 5F2GA 2DZAA 3FSUA 3MBDA 4JQ1A 1O95A 4AZ7A 4K8EA 5G1YA 4MAVA 3GX9A 3HFYA 4KGJA 1X98A 2ZXDA 2AOSA 1ZJAA 3CT7A 4R53A 3HQNA 4ECLA 2PDQA 3WUBA 1BVNP 1XYBA 3VGEA 1TFVA 3K1GA 2CLIA 3UZXA 1VBGA 3TJXA 4S39A 1OIFA 1GVQA 3VCCA 4O1CA 1G6CA 3GLCA 3OIXA 4A8LA 2X09A 4D72A 3KW3A 1OSEA 1CXEA 4H8UA 3QW3A 1TZ9A 4U31A 1V3HA 1XLIA 3BXWA 1VIWA 2QS8A 3AYTA 2BGSA 4US5A 3W71A 2BXYA 1LM1A 2NLYA 3W02A 5A8GA 2YCJA 1L6SA 4UTUA 3RFAA 3DFHA 3VGGA 4M7SA 2PEVA 5H1WA 3F4VA 2YZRA 1GQLA 4LYRA 3G1SA 4LPCA 4HCLA 4I9MA 1DP0A 4HD5A 4NVTA 3A3XA 5I7GA 4G7EB 1VEPA 2IPWA 1UR0A 3T2OA 3A47A 5L6UA 3B8DA 2VDHA 4TX8A 4WEVX 4PRWA 3WFAA 3UGVA 3PJWA 3TC6A 1H7NA 4MTVA 3LM3A 3W84A 7XIMA 5IOBA 4R88A 3G3MA 1OX5A 1FDZA 4C1KA 4KQNA 4QNWA 4PB5A 5U7SA 3ARPA 4IGSA 4NYUA 3UG4A 4YVPA 2FHBA 1NWTA 2ZUWA 3IIVA 5CZSA 4HMNA 1P4CA 3DFPA 1GKRA 1EIXA 5EMLA 3CZKA 1UC4A 3TFXA 5AVNA 4YTUA 4HZ8A 3DKJA 1UOZA 3F4DA 3NZGA 2PP3A 3K4AA 2WWCA 2DT3A 3QMTA 2ZRWA 3IPWA 1SW0A 1CIUA 2XIQA 4AC7C 3PM6A 1KCLA 1XR2A 3UZYA 4B4FA 3UVAA 1PSCA 4ICNA 3N15A 3MT1A 1I60A 4P7RA 1MXGA 3GU1A 5A6BA 5IHSA 1EQCA 4O16A 3WH9A 2CWNA 4NZ1A 2D0HA 5LXXA 4TX6A 3GDRA 1ZUAX 5GNXA 2Y61A 3GG0A 3KCJA 3W27A 1J8VA 2WVUA 4GG9A 1FCUA 2ZRZA 1B54A 3L5LA 4QSHA 1SSDA 4PMQA 5G1TA 3GC5A 2QIWA 2YBUA 2ABBA 4RR4A 1T8QA 2PA6A 4KCWA 2AQWA 1VGAA 2DJLA 2W91A 3APGA 1QI3A 4LV9A 4GX8A 4YMZA 1J5TA 2ESCA 3RX4A 2G41A 2FVMA 2I14A 4P7OA 4IQJA 2BHZA 3CPGA 1HL2A 1S2AA 4XK2A 4PCNA 1KKOA 5LIXX 4UXDA 5BOFA 1DIOA 1EKOA 2FJUB 4E2BA 4BFAA 5C6MA 1XRVA 3QPYA 2XHYA 1YPXA 3SIZA 2GL5A 4GQQA 1HJWA 2H8ZA 3LCLA 3G1FA 3H22A 3ARRA 3TC7A 4M6QA 4P8WA 3VMNA 1QO2A 3TV8A 5ECUA 3GZAA 4AFYA 2PDHA 5E0FA 2B4GA 4X2PA 1AUSL 2W62A 2VZVA 3R0KA 4EE9A 1W8GA 2J9XA 1GYLA 3M07A 4U3CA 3STFA 4TVDA 2P53A 1RXOB 1FFQA 5DT7A 1GVIA 2ZVRA 3C2FA 6REQA 2A3HA 3AHXA 1JCTA 4MYAA 2PGFA 1OCQA 3W22A 4MKNA 1H63A 1M41A 3ZWTA 4IXXA 3W37A 5AOUA 1NQ6A 4GOAA 4M1BA 1JDCA 3M5XA 2D69A 3BQ6A 1LL4A 4D1JA 4KRZA 3NYDA 3DI1A 2Q8XA 3CPRA 3ERPA 1IE7C 2Z2UA 2ANUA 3RCMA 3E2QA 1LRTA 3ID7A 2PWEA 1UR3M 1OABA 1R85A 1KTCA 2P0IA 2AGKA 1V8EA 5FJRA 4K2SA 1TV7A 4J3VA 4XTIA 3DG7A 1P7TB 3T0TA 3IARA 4TIMA 3UR7A 2VL4A 1JQXA 2O7QA 4W7UA 3Q58A 1EL3A 2GOUA 4FSAA 1NELA 1H49A 3MI2A 3E0WA 3L2IA 3WLLA 4QJ3B 3QR0A 2BTMA 4IPNB 1WX0A 1UWRA 4XIAA 3URQA 3FXYA 1LYXA 1D3CA 4L7ZA 5JQ9A 1FXPA 1IIHA 3IUHA 4UCGA 4UTTC 3GIQA 3KBVA 4IUGA 1HG3A 3DFQA 5IBXC 4N9BA 2XU2A 5BXPA 3G77A 1Q7MA 4MOZA 1AFSA 1E4NA 2V6AA 2H8XA 3QW4B 1UR2A 2FVKA 4CNPA 5DCEA 4MHBA 1K8CA 1QAPA 1A5LC 4PFMA 4IJRA 3IVSA 4JNMA 3AC0A 2WBKA 5I3IA 3BJTA 1EJTC 3GKFA 3H21A 3NVDA 1HP5A 5G2HA 3PUDA 2FH6A 1TO3A 5A6BD 5LGZA 2VWTA 3VIIA 4CQDA 1E1CA 3GG7A 4PUWA 3TTOA 4A8NA 3EKLA 5LIWX 3UEQA 3O1NA 2QULA 3NM1A 2CPUA 3EWUA 3V35A 1FQ0A 4Z2GA 3DYMA 4KF1A 2E68A 1S5WA 2OLAA 3ISIX 4KT2A 3VIFA 3MYOA 3QPEA 5I3GA 2C15A 2PDYA 1YE6A 3EMCA 3QY6A 5AC6A 3OBEA 3MANA 3MA8A 1NDVA 4ZSUA 4F9JA 5KITA 2Y0FA 2F9RA 3K2GA 5HBFA 2ZVIA 4HHMA 2PWGA 2VRJA 5AYBA 3DGRA 2QCDB 1FHUA 4LVAA 3QMSA 4PMNA 2G3JA 3N4EA 1SW3A 4F0HA 4Q4RA 3EOUA 4JYFA 4HNVA 4NZJA 3PY2A 2Y4SA 4P8UA 1THFD 2RJGA 3OVQA 3NA8A 3SJ3A 4OOUA 3R89A 1UZ1A 1IEXA 4XAPA 4H9UA 4KBXA 3WDPP 2GQ8A 4QM1A 3LB0A 3HZ3A 1H0IA 4FF5A 5I24A 3VIJA 2NUXA 1W3NA 1S5VA 2KX9A 1E3XA 4KCUA 2BSLA 1CZ1A 3D47A 3KLLA 1QTWA 5XINA 3GTIA 1S3HA 4Q4MA 4Q33A 3B8SA 1WO2A 4FLSA 3I3BA 5C55A 4L4LA 3NGFA 3AMKA 4CQCA 4ADSA 3V1PA 3MKVA 1TSIA 3I7SA 4GCAA 1OGGA 1XLFA 1K8XA 1KB3A 4JIIX 4GACA 4ZQCA 3T2QA 2V5BA 2J7GA 1OK4A 1TIWA 2DZPA 1ZLPA 5A6JA 4PRRA 5CPLA 3PF3A 2R1PA 2QAFA 1GVYA 5IBXA 4LAZA 1H5VA 3C0SA 3U7VA 4FLQA 5HMDA 4G1NA 1SZRA 1V0KA 2Q09A 3F4WA 2IXVA 3IIPA</