3CQIA

Crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with sulfate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
277
structure length
277
Chain Sequence
KQIPLGIYEKALPAGECWLERLQLAKTLGFDFVEMSVDETDERLSRLDWSREQRLALVNAIVETGVRVPSMCLSAHRRFPLGSEDDAVRAQGLEIMRKAIQFAQDVGIRVIQLAGYDVYYQEANNETRRRFRDGLKESVEMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLKQSGYCGPYLIEMWSETAEDPAAEVAKARDWVKARMAKAGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of L-xylulose-5-Phosphate 3-epimerase (UlaE) from the anaerobic L-ascorbate utilization pathway of Escherichia coli: identification of a novel phosphate binding motif within a TIM barrel fold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords L-ribulose-5-phosphate 3-epimerase ulaE
total genus 110
structure length 277
sequence length 277
chains with identical sequence B
ec nomenclature ec 5.1.3.22: L-ribulose-5-phosphate 3-epimerase.
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3cqiA00
4XSMA 5XIMA 1XYBA 5TNVA 3UXIA 3IUDA 2GYIA 5H1WA 3VNJA 4PGLA 2XINA 3VNMA 3QZAA 5EMLA 3ITLA 4US6A 1DE5A 4ZB0A 5AVNA 3LMZA 1XIMA 2XISA 2X7VA 3BZGA 3UA4A 4QEHA 1XIBA 2QW5A 3C0LA 2GLKA 3QYSA 2OU4A 1CLKA 3P6LA 1BXBA 4YTQA 3VYLA 1XISA 1QUMA 1XYLA 3M0HA 3AYTA 4QEEA 1A0EA 1XIJA 1XLLA 3N4AA 4KW2A 1XLMA 1I60A 1XLEA 1XLFA 3M0XA 3M0YA 1QT1A 3C0QA 1YX1A 3BDKA 3M0MA 4A8NA 3GNXA 5B7ZA 3IUHA 4YTTA 1DIDA 8XIAA 2J6VA 2XIMA 4XIAA 1XICA 1XLCA 1BXCA 3ITVA 2G4JA 1OADA 2I56A 2ZVRA 1XIEA 4DVOA 1O1HA 4XIMA 4GJIA 3ITYA 3JU2A 3IUIA 3BWWA 1K77A 3QXBA 5EMJA 5B7YA 3XINA 2NQ9A 2GVEA 4XKMA 3AAMA 1S5NA 3CWHA 1DIEA 2QUNA 4A8LA 4K1GA 3XISA 3M0VA 3CQJA 5EMMA 5B80A 3CQHA 3UU0A 3ITOA 4HGXA 6XIMA 4ZB5A 3KBJA 1GW9A 5EMKA 3FVMA 3KBSA 1XLHA 1XIGA 7XIMA 4E3VA 2GUBA 1A0CA 3QC0A 2I57A 3CQIA 1MUWA 4QDPA 3KCJA 4ZBCA 4A8RA 3KCLA 1DXIA 5AVHA 4QE5A 4W4QA 4X61A 1XYMA 3DBNA 3KTCA 4XSLA 4XISA 3KBMA 2QUMA 3VNLA 4ZB2A 4OVXA 3CQKA 3KBWA 3VNIA 1XLAA 8XIMA 3AYVA 1XLGA 6XIAA 3BANA 9XIAA 3DX5A 3L23A 1XLIA 4DUOA 1DE6A 1XIIA 3KCOA 3KBVA 1XYAA 5XINA 2HK0A 3U0HA 5I7GA 1XIHA 2ZDSA 3UA3A 4K3ZA 5C9ZA 2X7WA 4YTUA 5J8LA 4HNOA 3BZJA 4PFHA 3U3HA 3VNKA 4QE4A 1XLKA 3AALA 4GJJA 1XINA 2Q02A 1XLDA 3KWSA 1XYCA 1I6NA 4QDWA 5H6HA 1XIFA 4A8IA 3TVAA 1MNZA 3TC3A 2NQJA 4EAYA 3UVAA 4EACA 1XP3A 4QE1A 2HK1A 4J4KA 3XIMA 4LNCA 4HHMA 9XIMA 4X63A 4YTRA 2QULA 4YTSA 3ITXA 1QTWA 3M0LA 4GLEA 4HHLA 3ITTA 4X60A 5FA5A 3C0SA 1S5MA 1XIDA 3KBNA 1A0DA 3P14A 3CNYA 3OBEA 1XLJA 2G0WA 4G56A 4GQBA 3NGFA 2HCVA 5XIAA 1TZ9A 3WQOA 1D8WA 4Q7IA 1XLBA 2NQHA
chains in the Genus database with same CATH superfamily
3SRDA 1WAUA 1SW0A 3N18A 3S83A 1AZ1A 1T8QA 4LVDA 2FYMA 2YXOA 3UWEA 1DYSA 1KTBA 3LRLA 3P8JA 1D3GA 2J7BA 4GH1A 1AFSA 4JIRA 3S4TA 1YADA 3LGEA 8XIAA 5BXSA 4YVPA 1DQWA 3LRMA 2O92A 4AMAA 2DSVA 1VRDA 1HUVA 3NZPA 1RP8A 1XSJA 3UR8A 3WK0A 2QUNA 3S6OA 3VUSA 4BHYA 2NX9A 3AMGA 3VGBA 2ZZ7A 3WDJA 3ANYA 4PMJA 4ADUA 5A6AA 4JFUA 4XD3A 3FJLA 4D1JA 4RE4A 4J35A 4FP1A 4JBRA 2A7NA 2PGFA 5D05A 2G3MA 1EF3A 8CGTA 3U57A 3LCGA 3ZR5A 4ZB2A 1XF0A 1BGAA 3GDBA 4R85A 2DPEA 2PDNA 2FVMA 2ISDA 3W73A 1FP9A 2GWNA 3S6TA 1KTCA 3STGA 3UR7A 3WX7A 3LLFA 1OFEA 1QRQA 4GX8A 4W84A 5EBAA 1WNOA 1YBQA 5FAGA 4HU8A 2WJEA 3QSRA 4XV0A 4KESA 4W9TA 1TUFA 3AHZA 3PJWA 3VILA 4KWVA 3U8GA 4H7VA 2D3LA 4YPJA 5EMYA 1OT2A 3L5LA 1LTDA 3M1ZA 2VYOA 1QNRA 5FL1A 2FPTA 3UWQA 2ZQ0A 3W53A 5M2FX 3KLLA 3T0CA 5HQLA 3GW3A 5F4WA 2ZTJA 3GK0A 4G1NA 3IUDA 1KFWA 1IEQA 4NZ3A 8A3HA 2DT2A 3BH4A 3M41A 4TTGA 1F3TA 2R82A 2Y7GA 3F4WA 5CPMA 1Z8AA 1P4CA 3UG8A 3UWUA 2NT1A 3W7RA 1M7PA 4IL0A 3GU9A 2PP1A 1DJZA 2PPGA 3VIGA 1T7LA 1DIEA 3CIVA 2QKFA 5HQEA 3W22A 4FNSA 5CH9A 4HNTA 2G41A 3KBJA 5DN1A 6A3HA 3UXAA 4Q8QA 4U2ZA 5AVHA 2Y7DA 3TKFA 4MNKA 3KBMA 3SQMA 2Q3RA 3WD1A 4HBKA 5A6BA 3BC9A 1BSIA 4J5NA 1SZFA 1NF0A 1MDRA 1G94A 4TU1A 3HGRA 3P67A 1C7TA 1QASA 3GAYA 2PODA 3GXFA 3L2IA 3TCSA 4EAYA 5AC6A 3EOEA 1KFCA 4UMBA 3W00A 4BR1A 4S2BA 1UWAA 1AJZA 3B4YA 3KDOA 4QAIA 3ZM8A 4A2SA 1EOMA 3VM7A 3DI1A 1RBOB 1UKQA 2EO7A 3WUFA 3R0UA 3S8HA 3BZGA 4Z1AA 4YL2A 3C0LA 2W91A 1EJSC 1V0KA 3GH7A 4F79A 3HPXA 1E72M 2Z7GA 3IUHA 4PRWA 2QCMA 3VI2A 4XIAA 2V38A 3VIFA 4JTJA 3M6DA 1TELA 2OCZA 5EMJA 4ML9A 2WJDA 2VHLA 2QQ6A 3NQ8A 1VLWA 3T44A 4KT2A 1US0A 2QDDA 3DI0A 3CEUA 4HMEA 1E40A 1JZ3A 1XS2A 1OFAA 2OT0A 1K1DA 3QC0A 3HG5A 3KCJA 4CEUC 3DBNA 4AEOA 4TXEA 3VZYA 1T5AA 3EWDA 4CNNA 4LW7A 3BANA 1Q66A 3K30A 4TX8A 2WSPA 4HOZA 2Z27A 4U28A 3FOKA 4S38A 3VUPA 4ALDA 4RDWA 1XRFA 1VIWA 2E1WA 2NXIA 3OHMB 5GPRA 1XSKA 2R1LA 5JIWA 4JEJA 4XTDA 4NJGA 1UZ1A 3LXAA 3AC0A 2A21A 3W7NA 3ABZA 1R3VA 2ZRYA 1N2VA 3HG4A 3AIEA 2EPNA 3LTYA 2WCSA 2PTDA 2FZBA 1UR8A 2DFAA 4LS1A 4G8TA 1GKPA 4R5EA 2TODA 3HQOA 2E0PA 3TLLA 4KGLA 3C0QA 2PDCA 1IGWA 3OEXA 5CSYA 1G7UA 3VD3A 4I5RA 4CCZA 1SJAA 1L8NA 3FEMA 1NFGA 4RZ6A 3IUIA 4P7RA 3TV8A 4DJDC 1EIBA 2H90A 1G7VA 4JX5A 2ZZ5A 3T0AA 2PTXA 2Q8XA 2JALA 2F6KA 1UZDA 1PIFA 1BKHA 2MUCA 1RSCA 3U5UA 3MZNA 1UC5A 4A8RA 1DVJA 2DZWA 4XBKA 4DZHA 1GOIA 3M0JA 3FSTA 1CLVA 3CHCA 4H2HA 3KHJA 3E5PA 2DJXA 4AZGA 3IAQA 1CENA 2OGYA 3ARQA 3LNPA 1XYAA 4GBDA 3MV01 2VRQA 4S3GA 3U3HA 3UJFA 3FFSA 2YIHA 4PCNA 3EPMA 3G1FA 4EPBC 2IKJA 1Q6CA 1Q6OA 4Y9OA 1JPMA 3ARTA 1P6WA 3P0WA 3KS5A 1RQEA 4TTUA 2TAAA 4GZIA 1S2UA 3UJ2A 4X9YA 1YTKA 4DPQA 1NWUA 1H7OA 1VFTA 4NASA 5C6MA 2DZTA 2J78A 1EGVA 1F6YA 5C7VA 2PLMA 3P81A 3RIKA 1V6VA 1ZFJA 1V4YA 2PBOA 2PGEA 3GG8A 3CPRA 3MUAA 3ZT5A 2XUCA 2Z24A 2PP0A 1A5OC 4S3FA 2I17A 1M7XA 3RGTA 1JQVA 4LCRA 5HULA 1PHQA 2ZTKA 2HDJA 3LM3A 1YXCA 4EK7A 5C2GA 3L5AA 3PBYA 1JAKA 1ODUA 1AL7A 2FB3A 2A3CA 4DO5A 3TJ4A 3UY7A 3MV11 3CYVA 3Q65A 1NDYA 1DKWA 2GDUA 1AJ2A 3R1ZA 5GJMA 3WQ8A 1TMHA 3S42A 3GXDA 4MMWA 3GH5A 3VNZA 4DPPA 4IJBA 4O18A 3DX5A 5HPOA 3B8VA 2IUZA 2IPFA 4FIRA 2X7WA 1GKRA 3TOYA 4WJ8A 5T26A 3E2SA 3SR7A 2J8GA 4LBUA 1PX4A 2QMJA 3KOFA 1NP0A 3ELFA 5MKGA 3ERPA 4K8HA 4RE3A 2G96A 4O8RA 4GI8A 3H26A 1R9ZA 1K7FA 1RD5A 4KH2A 3E3HA 3H54A 4QJ3B 3L7RA 4MB3A 5AOUA 3WK1A 4PULA 4B3LA 3BMXA 3PF3A 3W74A 4Y9AA 3OBAA 1Q45A 3AISA 1CZ1A 3G5EA 1Q7ZA 1IIGA 1UUMA 4BZYA 1ITXA 5LZLA 1MW1A 2CEQA 5HXMA 1QPKA 1RLCL 3DC0A 3ONCA 3RLUA 4P8VA 2GL5A 5EKYA 1DEDA 2A3AA 2YBVA 2OTDA 5HUPA 4PBGA 1XDMA 3BURA 3V18A 3MYPA 4MM1A 1SSDA 4RR4A 3GNXA 2VFEA 1AMYA 1BPLB 5I3JA 3GH4A 3QHOA 3LRKA 2G4JA 1OADA 1FWNA 4Z17A 2PDJA 3QOKA 3B0UX 3RCYA 1LLOA 2V30A 3WLLA 4O16A 1JCJA 3P7YA 4ZB5A 3KVLA 2QJMA 3KBSA 4Q4MA 3WH7A 4JAWA 1E55A 4H8UA 4XX6A 4BEUA 1U1HA 5D33A 4GIEA 2QCEA 3PUOA 1KKRA 4NRRA 2C1IA 4O4VA 1W2VA 1WDQA 5U7SA 3AIBA 2BOEX 3TAKA 4JN8A 1E6RA 1J96A 4F0RA 3U0HA 2QF8A 4PMDA 3RM8A 2VX4A 4POCA 4OUEA 1SFJA 1ZS2A 3N04A 3GNOA 2TMDA 3AXXA 3U2CA 1WKYA 3W84A 3H23A 3R58A 3H7VA 3M7SA 3P82A 2NW0A 3BLIA 4RNHA 2YBUA 2HQAA 3UGRA 3EXRA 4XVEA 3T9PA 4AU0A 5HUOA 4H9MA 5AC8A 2PD9A 2EPLX 4AEEA 4MTVA 3LBOA 3PZOA 4XD4A 5C9XA 1N8FA 2VEIA 3UA4A 5J5RA 1HGYA 4K37A 2PDBA 4P7QA 3OZMA 5HK4A 2R14A 2PMQA 1Q5MA 1GVRA 3HBLA 3LV5A 1FQ0A 4KRZA 1UZ4A 3L12A 2PAJA 1KM3A 1PKNA 4L1XA 3QPYA 3R6IA 2ZUUA 2YKKA 3KVJA 1ZZMA 1BD0A 2QLYA 4MHBA 1SSGA 3S3GA 1RBAA 2GQ3A 3GQYA 4DM1A 4J3ZA 3C52A 3MUZ1 3T0BA 1OEPA 3GB6A 3PSVA 1MUWA 4PC8A 3LS9A 1E0TA 1LL4A 3Q58A 3GXTA 3D6NA 1QDSA 3TA6A 1WAWA 1Y5XA 4TX6A 3ANVA 1XIIA 3NPXA 2NVDA 4K3ZA 5KEZA 3THCA 2YFNA 4LU0A 4B4HA 4AD0A 5D9NA 3CPGA 1XLDA 3BLKA 2O4QA 4F2BA 4HCHA 3B9AA 4NZ5A 1KFLA 3PAJA 1PE1A 4MDPA 1PUDA 3VGEA 2ISSA 4XZMX 4FEZA 1VP5A 4H00A 3W1AA 2YLAA 4L6HA 1SFLA 1B3OA 3NM3A 4L5ZA 3WY1A 2ZA2A 1LJYA 2OVLA 4Q8WA 2G3NA 4KMQA 2YOCA 3IJ6A 4LEFA 5AYYA 3LMZA 4GFSA 4GUHA 2OZ8A 1XDJA 4DWDA 1KBIA 3HM7A 4MAVA 2WQPA 2A1YA 3SN0A 3OLDA 4FA3A 2Q01A 4OOUA 3V0TA 4AIBA 2GJPA 3ZJ8A 3AHYA 4DVOA 4M6PA 4OBRA 3DFNA 1AK5A 1JDCA 5EA9A 3EZ4A 1JVNA 1G4PA 1D9EA 1JZ6A 4KETA 2X41A 3LXCA 3CMGA 1FKWA 1S1RA 4I90A 3BLOA 4DYJA 3G1DA 4WUIA 3LCFA 3SM0A 3ALFA 1F73A 4TQTA 2O9TA 4UQDA 2X30A 5CPLA 3PR2A 3RPMA 3CQKA 3GFXA 3PY2A 4LGXA 1SW7A 5ABTA 3C5QA 5I5RA 2QGHA 3C2YA 3WLSA 5I23A 3IIXA 1ZTVA 4PBEA 3WELA 1K6WA 2WMKA 3UZYA 2HVMA 5IHSA 3KHDA 2AL2A 3T42A 1KCXA 1W1TA 1AW1A 3WH9A 4ZO7A 4Q6JA 1G9HA 4GNJA 4W7WA 1QTWA 1KFJA 4M6VA 4TX9A 4JKLA 1E6NA 4JQ3A 2NSOA 4REQA 4HVXA 1NJJA 4GIYA 3OLEA 3EA1A 1IEIA 4W86A 5TF0A 2WM1A 5D2TA 1RALA 4HPNA 4Q22A 2V6AA 4MLRA 3II1A 4US6A 1O66A 1TIWA 3TK7A 1OG0A 1GVEA 2VVSA 2P0IA 4Q4OA 3G1AA 4XZHA 1BAGA 3B4UA 4S1FA 3TYEA 5CZJA 4B9ZA 3WJXA 5FJJA 1VFHA 4LANA 3QQ0A 2VNCA 4A3YA 1ONEA 1WXJA 2LLEA 2W79A 3QR1A 3MCOA 1KCLA 4DNMA 5AZ0A 1EIXA 1XRSA 3QY7A 3SCUA 5T9BG 4LUSA 4AX6A 4A3HA 5IFPA 4F0KA 1PXGA 3BCFA 4D6EA 1NWSA 5FESA 4DHGA 1GPWA 4WGHA 4OVXA 4DJED 1DWHM 2Y2WA 1W3IA 1Y8BA 2Y62A 4A22A 3OU8A 4QAWA 3VX0A 5GJPA 5D8WA 1E43A 1RPKA 3PPHA 1YHTA 4KFPA 1FUYA 1XINA 4LB4A 2XDFA 2CHOA 3YPIA 3TVAA 1FWHC 3W27A 4XB3A 4NJJA 2YL9A 2VCAA 4IX2A 2A0NA 4A29A 2OPJA 4UWMA 3VIHA 3UWZA 2XZ7A 3ZLFA 3EKZA 1U33A 1DWFM 4IMAA 4JZ5A 3MJYA 4A6GA 4LB3A 1T96A 3QW4B 2QT3A 1RA0A 1D3HA 1TCMA 4ERGA 3VC6A 2EGZA 4ES4A 3M5XA 2HVNA 1XYLA 4XZLX 4J1OA 1R0MA 3M4HA 1B57A 1H0IA 1OCBA 2BSLA 5I3HA 3BAXA 3DFSA 1TE6A 1XBXA 1GEQA 4Y8EA 3GNRA 2Y5SA 4QLJA 5AHFA 4AD3A 3R2GA 3W6YA 1WOBA 1J12A 4JY9A 4REQB 1CT5A 1J11A 1RXOB 2DT3A 3FXYA 2VD8A 2WHMA 4O52A 4D72A 3BTNA 1VEPA 4JTAA 4BY3A 2P0OA 4J2MA 1X98A 1X6LA 1VAHA 2VC7A 1OC6A 3MA8A 3VFCA 1UCWA 4YU1A 3W82A 1UH2A 1HKJA 3CUXA 5CC7A 2PFHA 2CZVA 1NAL1 2OSXA 3PBWA 4HD5A 2HTMA 4J4KA 1UKOA 3W7IA 3TSBA 4F2UA 4FR1A 4R7WA 5ECVA 4JIHA 5DF0A 3RHGA 5F2MA 3R0DA 2WZIA 1VGAA 5IRPA 3LB0A 2Y6ZA 1QFEA 2E5DA 2FZDA 1DHKA 2CITA 5K3VA 3G1HA 1B54A 1GG1A 1QVBA 4M5PA 4UFLA 1QBBA 3EB3A 1Q6RA 2QPXA 2RDXA 1LBMA 4A8NA 3TN4A 2VRKA 1AQ0A 1VQTA 3B0VC 3LEPA 2P8CA 2P50A 2INZA 3W7OA 2TPSA 3VX1A 1YNPA 3A22A 1GHRA 4P7OA 4LUYA 3UYCA 3HGJA 2X0YA 4J3WA 5BMWA 4PTNA 3WMBA 1IV8A 1GWJA 3HN3A 2W3ZA 2ZUSA 4QP0A 1W8SA 3VD7A 1WUFA 3VKBA 3CAKA 1N8IA 2ACRA 2DIKA 2PDHA 4W4QA 2WMIA 3JRKA 1W5NA 4DUXA 3QBUA 4DLMA 4PCFA 4PSPA 4CD7A 3Q2DA 2F38A 3ZIZA 3QN3A 3K8KA 1KRAC 2F7FA 2YCLB 4K8GA 1I8JA 6TAAA 1NDZA 2DSKA 4PMQA 3IWPA 4UOZA 3VE9A 1I0BA 4LNCA 5D04C 4C6LA 3TYUA 3W6MA 2C3ZA 4B92A 2VC5A 2GJNA 1HJSA 1LWHA 1V77A 2PP3A 5G1MA 2OFJA 4AB4A 1GOXA 1MEHA 4JNZA 4OWGA 5G4EA 1V0NA 3IV3A 3W2JA 2NQHA 1JZ5A 4WEVX 1VFSA 2PDYA 3CV2A 3HV8A 1E3ZA 2EPMX 3VIJA 3WQDA 3LK6A 1EJXC 4PZVA 2QDEA 3DHFA 1O7AA 3GVVA 2WC7A 1L9WA 2WVVB 2VEKA 2XIMA 2UV8G 4G9PA 2VM8A 3QY6A 3I7QA 5IOBA 2F2KA 3N2OA 1VR6A 4HNCA 1I2RA 3THUA 3LPFA 4DXKA 5CZSA 1KXVA 2ODOA 4ERIA 3NSNA 4QE5A 3W1TA 1OYCA 2CBIA 2CETA 3MYOA 4UFHA 2QF7A 4GOAA 1GVFA 4PTWA 3W24A 2BY3A 4QS5A 1J6OA 1CX9A 4LCSA 3WUGA 2FJKA 3H21A 2YCJA 1ICSA 3AJXA 3P0XA 3E2QA 4DF2A 3M44A 4UFMA 3PUEA 1K7XA 3WMCA 5FJIA 2DZUA 3E49A 3LQGA 4S3AA 3CC1A 2A6LA 5DMNA 3LTPA 4EWND 3ITXA 4GWEA 2XZ9A 1REQA 1FDYA 2X8RA 5J5DA 3KBNA 1O95A 1W5OA 3QFWA 3RLGA 5GJNA 1E4IA 4WKFA 2PRMA 4FXJA 2VI0A 3COTA 4IM4A 3G0UA 1WKEA 2L5HA 4HU4A 5BYWA 2VUYA 3LLDA 1NDWA 4X3ZA 3BJSA 1ZJHA 5FJUA 4ZTYA 1TMLA 5D32A 1FTXA 1TPC1 1UROA 1C9DA 3QQWA 4GC4A 5ABHA 2CWXA 1TZZA 3WD2A 2HJPA 4UXDA 3UG5A 3I3BA 5AYZA 1NOFA 1YIXA 1A5MC 3W71A 4KKXA 5EGRA 1V6XA 3LDVA 4JTLA 4Z2IA 3NPUA 3WK3A 1DPMA 3AXHA 1H50A 2X05A 5IDIA 3N11A 1GQKA 3GC2A 4PCSA 2R1MA 4UMCA 2J66A 3L66A 4RPPA 1EA0A 1AQFA 1JRBA 1OFPA 4B2DA 2VFDA 3CT2A 4PMYA 1EBGA 1GTHA 1GPFA 4YLWA 4QE4A 1ISYA 2GOKA 3EDKA 3WFLA 2P5NA 1ECQA 2XFRA 3VTRA 4B15A 4RNIA 2WVSA 1SPQA 3PPFA 4WDUA 4JYFA 4EXBA 2V5KA 3R89A 4GLEA 4GYKA 3OG2A 1WZLA 4DI8A 2PTZA 3W7CA 3H7UA 7REQA 2IPJA 4Q8UA 1KFBA 5FEWA 1AZ2A 2DIJA 4HA4A 2V2DA 3WNLA 1EBHA 3DHUA 3VIIA 2PLCA 1MQRA 1VPXA 3DGBA 3ARWA 1DXEA 2HEJA 1GYLA 3NO5A 3FA4A 3QKZA 4JTIA 2J6VA 3TDFA 4LS2A 3I4EA 1CB2A 2A2IA 3RRXA 2BVDA 3EYPA 5K4XA 2Z2AA 2WC3A 3LU2A 3U2EA 5D4YA 4OT7A 3CZ8A 1KGXA 4A2RA 1A4LA 1XLHA 3MSDA 2AQWA 4QDPA 2NX1A 1GVQA 1DXIA 1QHZA 4X61A 2GSEA 3KTCA 4XSLA 1KRBC 1QO5A 5HNNA 1TKKA 5C9RA 2VGIA 1KRMA 1K9TA 4CCEA 1YPIA 2C79A 1UYQA 4HK6A 4CQDA 3IJ7A 2XSXA 3T0TA 4H9ZA 4H9VA 1FHVA 3SRFA 4GHRA 4FZIA 1E0XA 2R94A 3JW7A 4MFEA 4QM1A 3S2MA 3NQGA 3PUGA 4PMUA 5KZEA 4PR4A 2Z29A 1JD7A 5A8MA 3T07A 4KRUA 3DDMA 1MUMA 4ECLA 1JYNA 3QH2A 1JCXA 1WDPA 5CC6A 3T2PA 3WNNA 3N4EA 5I3KA 5TNVA 5TD4A 5LYRA 3U9IA 4GKTA 4P8WA 1C91A 2W62A 4KBXA 4IG2A 1JCLA 1MUCA 2EJAA 4NZCA 7ENLA 4MJ2A 3IIVA 3USZA 1QPNA 4TR9A 3S1GA 4D6CA 4UIOA 5DT7A 2QV5A 1HZYA 3NVDA 3PZIA 3DG6A 1EOKA 3ZO9A 1CGVA 3GM8A 4NRSA 2Z0IA 3SECA 4ZOBA 1V02E 4WRHA 3DC8A 4CQAA 3EDDA 1GKQA 4XVDA 3NIYA 4LYKA 1TV2A 1I2NA 1M01A 2YL5A 4WCJA 1OZMA 7PTDA 4N6FA 3FYPA 3E2VA 1K4HA 5CSUA 1A5SA 1XYZA 2PDXA 3TUUA 5FJRA 1PDZA 2W9MA 2C8NA 2VX7A 3UXKA 4L4LA 9XIAA 3MANA 3TYBA 3RF9A 1N8WA 4DM2A 3D47A 2D24A 4HNOA 4QCEA 1UD3A 2BWGA 2E9LA 2VO5A 1R9XA 5AFDA 2J7DA 4PMVA 3TTSA 4Y9MA 2Z1SA 3MHFA 4LC8A 3R8RA 1LQ2A 2XGBA 4ILSA 3TW9A 2NUXA 3CHVA 3AO0A 1PHWA 4XAZA 1CYGA 3V5OA 3MSGA 4GQQA 2HPIA 4IUGA 1X7IA 2D23A 1H51A 2HZGA 2RUSA 4HHPA 1ME9A 4GI4A 4P5UA 4QLKA 1T6MA 2E09A 3EWZA 4IIFA 3QZAA 3ITLA 2P3ZA 2J7CA 4JTEA 1R85A 1UMYA 1J5TA 2RGMA 3TSDA 1UP2A 2QVHA 1CEOA 4TV6A 5BMXA 1YBQB 4S3KA 3WD0A 3SN4A 1GVSA 1JUKA 1OYBA 4WGXA 1PKYA 3QGKC 4C6DA 3I6TA 4NT0A 2VGFA 2PWVA 4KEVA 1J18A 1FA2A 2QIIA 1EUAA 1CGUA 2JQXA 1KNWA 2YX0A 1E4NA 2X1SA 4CD6A 2BY2A 4UZUA 1WO2A 4QNWA 1Q2RA 2E1DA 5LIUX 4Q8TA 2D0HA 3WDPP 4RZ4A 3M5VA 3O06A 4DJEA 3JR2A 4IIEA 5C9ZA 5EL1A 4AHQA 2BMBA 1A5AA 3H2OA 4G5DA 2BBFA 1VPYA 1R3YA 2EPOA 3QHMA 4ZQNA 1PCWA 1TZ7A 3OO2A 3RLVA 1SJCA 1X8FA 1NFBA 1T40A 3M64A 3A6OA 2QGYA 3NFUA 3PTDA 1O6IA 3CNYA 3P84A 4NYUA 4YCPA 2NXHA 4HP5A 3TR9A 1WX0A 4HYRA 5BWFA 3APGA 4ZB0A 1GJUA 1W3JA 3NQ7A 4QG9A 3KE0A 3NO1A 3QYSA 4GZ7A 5M5DA 2BVTA 4QJ4B 3VMPA 1G67A 2Y1HA 3SADA 2ZRWA 1RVGA 1PTAA 2VFGA 2ABAA 4Z2HA 1XG3A 2VT0A 1PKLA 5E09A 3K4AA 3LXBA 1F7BA 4C6OA 3V4BA 2YW4A 3K4DA 1E9ZB 2XJ7A 2NQ9A 1V51A 1HVXA 1MQQA 2HMCA 3XISA 3RX2A 4OIFA 1W91A 3N12A 1N82A 5MHBA 4DI9A 1UHVA 1YNQA 4NL1A 3UZ5A 4HTYA 2EKCA 4OZOA 1Q6FA 3DH7A 3O6YX 1OFQA 3OHIA 1RJRA 3QMRA 3TN3A 1PZ1A 3WUBA 3PZMA 4LALA 2E7FA 4E3TA 4CVUA 5BRBA 1ZPTA 4P8UA 5CXPA 4N2YA 1PTGA 1H7RA 1RBLA 4V15A 4JHOA 1Q65A 3BSGA 3VM5A 1VYSX 1H60A 1PWMA 1WZMA 3U2OA 3AMKA 3LCLA 4HHLA 2R8WA 3G6LA 5F4XA 7TAAA 5I0DA 3QC3A 5J04A 3ZT6A 4DYKA 1OG6A 5A6MA 3UJEA 4B5UA 1A5KC 5A69A 3A64A 3WNPA 3U6WA 4L6DA 1FHDA 2Q6ZA 4LCQA 4JTCA 5A2CA 3CU2A 4LV4A 1H4PA 1XLEA 2WVTA 1LROA 4HA1A 3WBXA 2NX3A 1Y5VA 1PL9A 4GUIA 3TFXA 3UERA 1JCMP 2I56A 4F9JA 3QZ6A 1UIPA 2BG5A 2EBNA 4HZ7A 1W5MA 3AS3A 3F5LA 3AIUA 4PUMA 2ZZ3A 4N9DA 2BB0A 2NWSA 3G0XA 3N6JA 4B16A 1OIMA 2GZXA 1XUUA 3E0FA 4AQLA 3E0WA 4BF9A 2HROA 3IIZA 3KOXA 4HIBA 4TMBA 3SSJA 2V3GA 2V0TA 5HWJA 2PDUA 1W9PA 3N2CA 3HG2A 2BGSA 2UY3A 1GQJA 2FH8A 3M9YA 5MKGB 4Q33A 1R8LA 2X40A 4ZQRA 5AYXA 1SFSA 4H2CA 4UTHA 3I65A 2VELA 5CG0A 5D9PA 1Z32X 2IKHA 1ADSA 2VVNA 2WMHA 3AS1A 3DIPA 3R10A 1E0VA 1C7SA 1F8IA 2V5BA 3R25A 1D8WA 4CKQA 1P1XA 4UNKA 2EG6A 4HOXA 5LNWA 4QEHA 3B05A 1GW1A 2OZ3A 3FA5A 1MI3A 1WP6A 4JTDA 1KQYA 4OBTA 2VX5A 2GDVA 3RR4A 3BMVA 2CBJA 3FCPA 4QJ1A 3LZ3A 3ZXWA 4AD5A 1XQKA 3EEGA 3DERA 4JX6A 1P43A 3KAOA 1A5UA 1F3EA 2OELA 3UNDA 4CNTA 4LVFA 1GJPA 3RO8A 4RX0A 2VTFA 2HVOA 5AKQA 4DQWA 3T4CA 3CM4A 3VD9A 3KS6A 4IFKB 1GOOA 3HPFA 2XVLA 3PZVA 4LAOA 1LOQA 2GSHA 4HPXA 2W6RA 3EGJA 1QK2A 3BGJA 4FSAA 3GUWA 2A3EA 3W7DA 2OT1A 4JTQA 4MWAB 1EB3A 3TMLA 1ZJBA 1MSSA 2Y8KA 4JIEA 3W76A 2Y70A 3AXKA 1P7TA 4GNKB 2ZZ2A 1JPDX 1UQYA 2X1RA 4GZJA 1D3CA 4NG3A 3C0SA 5GNZA 4P2VA 1XLJA 2WO5A 1Q6LA 1ESWA 4AHPA 2R91A 3RM4A 3OVPA 1FXPA 3R43A 3ZLHA 1GYNA 1V03A 4K68A 4O4WA 1M9HA 3LD5A 1B4KA 5FAJA 1WQ5A 4CD8A 4GYFA 3S47A 4X0VA 3ABQA 4IMDA 1VZWA 2HPMA 4US5D 1KRCC 3RX3A 4RDZA 3QXBA 5HR6A 5KZMA 1JEZA 1CECA 3EOLA 1QJWA 1A80A 2W66A 3MP3A 3V1HA 2RDTA 1P0EA 4IICA 4AD2A 4LRSA 2F9RA 1JGMA 3I6EA 3PNZA 3BAYA 4JIIX 1YNYA 2X0HA 5BRQA 2ZDRA 1EZ2A 3KL0A 1EF2A 1R2RA 4RPQA 3TQPA 1TR1A 2Q71A 4HNUA 2ATSA 1S2WA 4DF0A 3HJZA 1R86A 2PE4A 1VFUA 5E6ZA 4QR6A 3BCDA 3H24A 4MJ4A 5LHEA 4H83A 4RE2A 2BXZA 1MO0A 1UWUA 1J0JA 1J0ZA 2HRWA 2PWUA 3DFOA 1U22A 1GOMA 2CU0A 1VFOA 3F2BA 1KM5A 4J40A 1HJWA 2DEPA 2NVAA 3LGDA 1RK6A 5AB3A 2CHRA 2DDXA 3FKKA 3W75A 1OQFA 2DUAA 4MJMA 5BOEA 1F2JA 5FF7A 3EX2A 5C2XA 4YWSA 3DOPA 2DORA 3ZS4A 6REQA 3WN6A 4DO4A 3QEZA 1DJNA 3H2MA 3FDGA 4KCUA 4C6BA 4AUBA 1KKOA 3M0MA 5B7ZA 1JF5A 3HPAA 3IGSA 1S38A 3GC4A 4O50A 4MB4A 1I2PA 1XIEA 1O1HA 2XIQA 3RYSA 2P76A 1K77A 3ZR4A 3UJRA 3XINA 3ZSSA 2E8ZA 2PDLA 3RILA 4H8HA 1YE6A 3BL3A 3W7GA 2HS8A 4ZGYA 2G3FA 4PN2A 4WD0A 4GACA 3G22A 3E0LA 4E4UA 3WQFA 3W2LA 4CNOA 2OO6A 3KZPA 2X1TA 1F3XA 2XTKA 3V5CA 1OX5A 1WKFA 5FD0A 2CLOA 1FH9A 3E02A 4EKJA 5T91A 2QCDA 1EQCA 3I68A 4IH3A 1WZAA 4RZBA 1XIHA 3W1LA 1XH1A 3KM8A 1TPVA 3BZJA 1J2BA 1FCUA 5C8BB 2HSAA 1LG2A 1YEYA 3CS2A 4B5VA 2XM2A 2INEA 2WCGA 4OGZA 2FFCA 2OOGA 1H7WA 3RN6A 3PFMA 1H09A 1GTEA 3CEPA 4MY9A 5CC3A 2PGRA 3UEQA 4AY7A 3GC5A 3VINA 4CN1A 3SCVA 4U2YA 1PZ3A 4N4QA 4B9YA 3VVGA 4MZ1A 3WUEA 3W28A 3PZNA 3H2AA 4GI6A 5K7JA 4PMZA 1J9YA 4HT3A 2D2JA 4A35A 3OZYA 4HZ6A 4JKMA 1S3HA 2DY3A 4XBJA 3VNMA 2YYUA 2Y88A 4DUWA 3OZPA 3B8TA 4GY7A 4FI4A 4CEXC 8TIMA 4AY8A 4FNQA 4GNVA 3V5FA 3NR0A 4JCMA 1XLFA 3GTFA 1DQXA 3GZAA 5BOFA 1FH7A 4KWWA 2YDSA 1LL7A 4V33A 5JUVA 4N6EA 3ITVA 1GHSA 1B5TA 4L64A 4Q7BA 1NTHA 4Q4SA 1A4MA 2G50A 2CCRA 4J3SA 1ZBCA 2GUYA 5B80A 2V5JA 3O8AA 3AHXA 1BHGA 1ELSA 4WOQA 1S39A 2BXYA 2G97A 4PUNA 3CHDA 4UTWC 4RNJA 2VQUA 4JGDA 3O63A 2EKGA 1XI3A 1QI5A 3TZFA 3HURA 1EJVC 5HOSA 3GG7A 3O6DA 1B1YA 1PX3A 3H53A 1XV8A 3W1RA 1YPXA 1CPUA 2XN1A 4QDWA 1QXLA 1UUOA 1XBVA 4O8AA 2ZE0A 3UXLA 2ZRUA 2OB3A 2YCEA 3BO9A 1D7FA 3L4VA 1GVYA 3STPA 4ROQA 3K8MA 3PZTA 4I6VA 5JMUA 5BZAA 1OX4A 5XIAA 1XLBA 4IWWA 1QNOA 3BG5A 4IMFA 3WFZA 1O68A 2Z28A 4FAMA 1TTIA 2AKMA 1VEMA 1LWJA 3DN5A 3P6LA 5CPTA 3W29A 3UW6A 2V68A 1T99A 3MUXA 1V3IA 4O54A 2BY0A 2ZRZA 1JFHA 1EWDA 1B3VA 4XAFA 4A8LA 3HQ1A 5E93A 1IWPA 5E9AA 3NOEA 1SZEA 4XKYA 1NQKA 4QQ3A 4KEZA 2JIEA 2BTMA 3DHPA 1H1NA 6ENLA 3UBPC 3B06A 1S2CA 4OHQA 4B5XA 1P0NA 3WK2A 5K4ZA 2EPHA 4Y7EA 2XVKA 2QDGA 3U2ZA 1DE6A 4LWWA 4S39A 1DHPA 1YRRA 4IQEA 5A8OA 5A1AA 4J7RA 3LM7A 3UJSA 3DGRA 4ZVJA 1AH0A 4GBUA 3W6LA 1W3LA 3NL6A 5DXXA 5CLWA 3VCNA 4FOJA 1E4LA 4RV3A 2VURA 1B3WA 3SIZA 1MW0A 1LRQA 3IJDA 1TVNA 1TWDA 3PTMA 5CQ1A 1B9BA 3WJYA 3W88A 1KO0A 3CQ0A 1BKSA 1VH7A 3WH8A 3P62A 1UOKA 3WL0A 5CBIA 3NQVA 1TV7A 5GVJA 3HB9A 1XLLA 2C91A 3KL3A 2E28A 3A5FA 2A3LA 3KWXA 1GOKA 4DY1A 1H49A 1BG4A 2YGYA 3FIGA 4ZQOA 4AZ6A 2UY4A 2DIEA 2FZ9A 3F4VA 5GNXA 1TV5A 4M7TA 1YE4A 1LQAA 2Y4SA 3S1VA 1NOWA 3QV7A 2O7SA 3WD3A 3JVAA 3AU2A 2Y5JA 4UTTA 1KB3A 5I3IA 5G4WA 2WJFA 4Y6GA 2J24A 3HFTA 2YZRA 3MDWA 1OX6A 3AHVA 4F0SA 4GMEA 1XSIA 3AROA 3A13A 2ZBTA 2PUZA 3KCLA 2V9DA 1O12A 4K1WA 1FX6A 3EPOA 3BPWA 4Q32A 3IACA 3O6CA 3V0UA 1TWIA 4O57A 3T8LA 3OIXA 1KXTA 1ZSXA 5XINA 4CD4A 1GVOA 5BCAA 1X38A 2OX1A 4BJHA 4OU1A 4G7EB 4C7GA 4CCCA 5D03A 1QOQA 2YLLA 1L2UA 3P93A 3W7MA 2Q8ZA 2HK1A 4ACZB 2XSAA 1MEWA 3FK4A 5FJOA 4NHVA 4O53A 3EMQA 1XWYA 2PEVA 4R34A 1US3A 4GXMA 3AUOA 4XKYB 2INFA 1PX8A 2WSYA 3MT1A 1W5PA 3WNKA 2X7VA 1VRXA 2ZUNA 2V5LA 1SZRA 2NUYA 5TIMA 4C7FA 4O1CA 3UCQA 3CV7A 3E0VA 2VZSA 4GYPA 3SY5A 2F84A 1V02A 4DLFA 4I5UA 1UA3A 2CLMA 1EL3A 2YPIA 3OA5A 1JI2A 5A6KA 1ADDA 4EP8C 3CUJA 5LIWX 2IKGA 3A4WA 4JIQA 1W1A1 3NQBA 2PDIA 4EPDC 1SZNA 4EXAA 5HWMA 3UD6A 3V35A 4AVFA 2D2HA 2BGQA 1Z9AA 1E6XM 4ATWA 1FWIC 1BRLA 3BSMA 3RITA 5G2IA 4UFKA 4ZENA 4MADA 3IGXA 1VFMA 1HQTA 2YFOA 3QRHA 2BX7A 2WC4A 4IXHA 1IWAA 3WMLA 3BAWA 2VXNA 2ZRXA 2Q02A 1I1XA 1LT8A 4FMVA 1AL8A 3NZRA 4WX2A 3NA8A 3E38A 3L2MA 1F07A 3EXSA 3CO4A 1FWSA 4QFUA 1NY1A 2WMFA 1T8XA 3VDHA 3TC6A 3V75A 4ADTA 2PWDA 5HATA 1OX4B 3S2CA 3EDFA 3AMLA 2XISA 3EWBX 3QR0A 1M65A 4TV5A 3URBA 4AISA 3W07A 2FZMA 3M0XA 3SY8A 4JEQA 4PMNA 1U5JA 3WLOA 1TPDA 2QVNA 2GWGA 1OD0A 5DRIA 4G6CA 3MHUA 1OFBA 1ITUA 3D3FA 1LT7A 2Y8VA 4DBUA 2I7GA 1UP3A 1LUCA 4F0MA 1QR7A 2JGQA 2YL6A 2GJRA 5I77A 1XFCA 2REQA 3PBGA 2WHLA 5AYBA 5BROA 2FTWA 3IK2A 1FWTA 1J2WA 2BFGA 1H7XA 3OGRA 3OG3A 4HPGA 4NZ4A 2C18A 3ZVHB 4Q8OA 2FVLA 2RJGA 4RLIA 4UTJA 1BYAA 1RJQA 1HFBA 4AFYA 5HAOA 5FJTA 1G0CA 2NV1A 1I6NA 2NZLA 3MVIA 4MFDA 3APTA 2DZBA 4AIUA 5I3FA 2CZFA 3LMYA 5CSRA 4X63A 2CYGA 3KEHA 3L4UA 3T40A 2YW3A 1UUQA 1W3HA 1R30A 1FBAA 4UZSA 3OPSA 4M29A 4H1ZA 5DY3A 2ZC1A 3ABXA 2Y0FA 2XFFA 4FNPA 2CBUA 5AVNA 4NAFA 1LG1A 3UESA 5A8QA 3TLQA 2ACQA 3C56A 1H7PA 1KWKA 1K7EA 5ABEA 3FVDA 3IRSA 2BVWA 4ZODA 1DP0A 3BAKA 5DQPA 1JRCA 1AQMA 3WQVA 4LBSA 4IIDA 1ISXA 3LSCA 1JCYA 1P1MA 3NQAA 1IXNA 2PWFA 4ICCX 5B7YA 2P1FA 4A3UA 5I78A 3A3WA 4C65A 3IRDA 4US5A 4QG8A 1HX0A 3DAQA 4DWSB 1KBJA 4IGHA 3LI1A 2WQDA 1S2VA 1YLVA 3ZFHA 3F4DA 2PDGA 3W7KA 4CQCA 2OEJA 2V69A 3NZ1A 3SUTA 1K70A 1HW6A 4J3XA 1ZUAX 3NAVA 1WE5A 2ZDSA 3GU2A 2HNHA 5D9OA 4I8DA 3F2DA 1WYIA 1HN1A 1FRBA 3WBYA 4C1NA 4MUZA 3KWSA 2VC6A 3MCMA 4GXPA 3MTWA 3PTKA 4WK9A 2WSQA 1QHOA 3CTTA 3TOPA 4GX9A 4PE8A 3ARPA 5DLCA 1W0MA 4NY2A 4PUUA 3H2NA 1HG3A 1L6YA 4U3CA 3IGHX 5CSSA 4ZL1A 2RDWA 1TPFA 3WEMA 3VA8A 3UR2A 2IQ0A 4MAZA 3C6CA 4LAZA 1PO9A 3PG8A 2ZXQA 3JUGA 1CXFA 1VBRA 2E9BA 2KX9A 4DXVA 1IT0A 3UPBA 5FEPA 3ES8A 1TJPA 3CV1A 3VIKA 1E70M 2QAFA 4Q8PA 1AW5A 2VWTA 3DG7A 4IISA 1Z42A 3CLWA 2IQTA 3STEA 2V2HA 3VOJA 5AECA 5BXRA 3DFHA 4DAIA 3IAPA 2OQLA 4NQ1A 7CGTA 3EWCA 3GWQA 4GO9A 4ML4A 4FF7A 2QUMA 1TA3B 4CLMA 1RV8A 2PURA 3PB0A 3UT0A 2YB1A 3VD5A 4L4MA 3ECQA 2D0GA 3EBVA 5D02A 5FI8A 4HB7A 4H19A 5DMMA 3A24A 1UR3M 4YHEA 2VD9A 5M1TA 5BRPA 4PTDA 3SN1A 3SCSA 1IR1A 4JPGA 4U5KA 2WV8A 4C6NA 4E2OA 1C8XA 3I3DA 4WHBA 2DZXA 3RG6A 1ZCOA 3GR8A 4FIQA 4KWOA 1SUXA 1P48A 3DFPA 1ICQA 3IJIA 3ANUA 1ITQA 2YZ5A 2GQAA 1AMKA 3I10A 2D69A 2D20A 3RO6A 2V82A 4I7VA 4UQBA 4K38A 3EX4A 4XSMA 1FDZA 4XD5A 2Z1BA 2GYIA 2VC9A 1YW1A 1W1VA 3SZ8A 4Q4KA 2BHYA 3VCCA 5BXTA 5TAOA 1A0EA 3N4AA 3FYYA 2XGZA 5LNUA 2E77A 1HKIA 2F6XA 1JZ8A 4BEQA 3BDKA 3LPPA 3ENLA 1I4NA 3WQGA 2BDQA 4AZ7A 1NU5A 3QMSA 4PH6A 4W93A 4UQCA 1X7FA 2QJJA 4AZCA 2WZTA 5DFAA 3CQJA 3ZJ6A 4CU6A 4EE9A 1JXJA 2GGHA 4IMGA 2QAPA 2AMGA 1GZ1A 2TRSA 3R13A 1M68A 2YYTA 3SB0A 3GE7A 3GS6A 4Q4QA 4UTMA 4LOCA 3W72A 2WXDM 3LQLA 3CL8A 3PC0A 2ZXBA 3C3NA 4FX7A 1OINA 4Z1BA 1L6GA 1PIIA 3ZVHA 2ISVA 3FDKA 4N9EA 5CBBA 1LWIA 3GBDA 3QKEA 5IHRA 3MC5A 4H4IA 3WF4A 4M56A 2C13A 5A3HA 3TTYA 2WBGA 3K13A 2YA2A 1W37A 4W89A 3PJTA 4F48A 2GK1B 1KM0A 3LV6A 3ARUA 4UBPC 3BLDA 1H1ZA 1S5MA 4HSOA 3LERA 1V6WA 4S3BA 2B7PA 5JH2A 2ZX8A 3N6HA 1HKKA 4UTUA 1QW9A 1TUXA 2O56A 2YCKX 3NWRA 5ABFB 3PNUA 1M41A 2BNJA 2Y85A 3S1UA 2DJLA 4E4PA 1QI2A 5DO8A 1EQPA 2FVKA 2KAUC 2WKGA 3TQKA 1V7YA 3URQA 2G4FA 4RW5A 4AVOA 3OBKA 1VBHA 3CUZA 4MKNA 3WQWA 1BF2A 2HS6A 1OGSA 1KQZA 4KF1A 4KRTA 3SCPA 1A53A 1K9DA 2FB2A 3L21A 4BF5A 5I03A 1SQ7A 1ODZA 3SGUA 2OKTA 3UZJA 1EXBA 3GDRA 2VFFA 2EF9A 1JF6A 3M16A 3FV9A 3VOHA 4OJYA 3H70A 2J9XA 1EC8A 3LCIA 1XL9A 5LNVA 4GGHA 1AJ0A 1IZKA 1YXYA 3N13A 4UTWA 3HGOA 4C6EA 3RU6A 3SGZA 1QNSA 4E8CA 1ADOA 2Z4GA 3CMFA 2WMIB 2R1PA 2E4TA 3NM1A 2OR2A 3KW3A 2ZCGA 4DUOA 2DVTA 1Q3NA 2OZTA 2QUTA 2I1OA 2AMXA 2OJPA 1BVNP 4W5UA 3LCHA 1XHGA 2I16A 1R5YA 4A8IA 4O28A 2G37A 4JFVA 5LIYX 3WF2A 6ALDA 4FO4A 9XIMA 4QRNA 1VKFA 1V3JA 2X09A 2ZYFA 3B9DA 3BAIA 4UTFA 1GOWA 2I9EA 5LXXA 4TVUA 1XBYA 2PDQA 3B0PA 2YXGA 3VKAA 3S5YA 3OGVA 1YMYA 4UC5A 3U4FA 2X1IA 1W8GA 4XUYA 3LA4A 4LYRA 2V3DA 4JYDA 1DJYA 3LSBA 1PKMA 4NAEA 1XISA 4B5WA 1SGJA 1K8ZA 3ZJ7A 3CJPA 3NL3A 3N2XA 3R79A 3KOZA 5GNYA 4R7JA 1WXZA 3THQA 1A3XA 4OQVA 5D30A 1POKA 3EAUA 3DYOA 1GG0A 4Y8FA 5IXEA 3R0KA 3MKCA 4B4FA 4ERAA 3VD4A 1ZBKA 1R9YA 3TEVA 1T0OA 1QOXA 2XVPA 1FFQA 2TYSA 1C93A 1WDWA 4N02A 4KCWA 4P7NA 4AWUA 3PB2A 1W9DM 3QFEA 1GK8A 3MSRA 4Y9PA 2Z6IA 1Z7AA 3HA1A 4ICNA 1CGYA 2IPGA 3W1MA 3VIMA 5FCZA 1OCQA 3O3RA 2XYLA 9RUBA 2V3EA 1W56A 4U31A 4UFIA 1A3HA 4Q4PA 1MWOA 4AC7C 4MWAD 4ICMA 4L4PA 1QU4A 3MB9A 4XZNX 3NDOA 4NF7A 4HCLA 3VU2A 5JU6A 1XYFA 1PB0A 4GZEA 2PU1A 1TRIA 3VPLA 2C1HA 2AQOA 4AF0B 3LENA 4E38A 5BWAA 1IR2A 3VAVA 4AC1X 2WNWA 4KPLA 4M19A 2J8FA 3D46A 3EWXA 2WAGA 2DVUA 1BXBA 1DIKA 3ALGA 1BSLA 4MYXA 4IJCA 1ZCCA 2X16A 3R8GA 2EEXA 2BHZA 4HPJA 2EJ1A 1FWFC 3EB4A 1JD9A 4FLSA 1XLCA 3DHDA 4MWAE 4Z2JA 4JQ1A 1H41A 3TXVA 1UD6A 4DX3A 1AW2A 4R9XA 1BWKA 1JUEA 3AXMA 3CWHA 3SO7A 5CZKA 3NOYA 3B0XA 3OQ8A 1UH3A 3FA3A 3BMWA 5A5WA 2ASHA 4IFKA 2J62A 4M82A 3CT7A 4D1IA 2J7GA 1EPVA 3NSMA 2CERA 2ISFA 5K2ZA 1HJVA 3LGGA 3QVQA 3VABA 4TO8A 3AMCA 3PK7A 3SAZA 2OX4A 1M1BA 5FEXA 2HK0A 4NAEB 2G3IA 1X6NA 3C61A 3UA3A 1EA9C 5H2ZA 2QJGA 1V0LA 1FWDC 3VMOA 3LHWA 3N73A 1U1UA 3CH0A 4N7QA 2EAWA 1MZHA 2PC8A 3EA2A 2HXUA 2J9ZA 2XFYA 4V2XA 3MKKA 3CHFA 1JI1A 1XKJA 2CLHA 1HL9A 3GFZA 3OBEA 2D1ZA 1JQXA 2OO0A 2R6OA 4HN8A 7REQB 4NJIA 1UKPA 4FXRA 3VDCA 1B31A 4Z1CA 2H6RA 4HA3A 1E6QM 1DWAM 3AIQA 3SURA 3UNTA 4KFOA 5C9UA 3UY8A 2UZ9A 1G4SA 3U4AA 4HYVA 1KCZA 4WVXA 1SR0A 1EHAA 3QR3A 4AY1A 2JF7A 4UTIA 1SO6A 3BLPX 4NP7A 1S2TA 3FGCB 2PD5A 3CYJA 3BJTA 4XKMA 4QQUA 1ONWA 4AF0A 5CCZA 4MGGA 1HKMA 1OGBA 4C90A 3O16A 3P61A 2A3BA 4JTUA 4KWSA 3WQ4A 2GUUA 3VGGA 1VJSA 1EXPA 3AHTA 3ARRA 3TC7A 3GVWA 1KGWA 4CD5A 4BKNA 5C54A 3QJAA 5REQB 4PODA 3TW6A 2W27A 1H62A 1DORA 2FJUB 4MYAA 5FL0A 1BYDA 3ITCA 4TVCA 4KGJA 3UVAA 4BWLA 1XGDA 3XIMA 3E12A 2XH7A 1EJ7L 1EZWA 1A3WA 4E8GA 4ZOEA 3MSYA 4CN4A 4HMCA 1Q63A 4MB1A 4JTTA 4HOWA 2FKPA 3B9NA 1TZ9A 3DENA 3LBCA 3RDKA 3C2OA 4RZ5A 4PGLA 1DE5A 1PJ9A 4YVXA 3TR2A 3C8NA 4YTQA 2YB4A 3E9AA 3AYTA 4WF7A 4D8AA 3W3OA 3WQEA 1I60A 3FS2A 2GVLA 4TIMA 4CGTA 3KTXA 4S3DA 1UW9A 1WA3A 1K02A 1F5ZA 1IQ8A 2A4AA 3NPVA 4R9OA 4EF9A 2A85A 3EMZA 3G18A 2FDMA 2ZXDA 1IXQA 4IPJA 1K4GA 1EFZA 5D2XA 3UU0A 1RHCA 3WLQA 1Z89A 4D6JA 2GOUA 3THDA 3TYZA 1TPEA 1E56A 4Z0SA 3WLNA 4JOMA 3FJNA 3TTQA 3IK4A 1D7KA 1GNXA 1KM1A 3GU1A 4YNGA 1YQ2A 5A6LA 4DBWA 1L6SA 4PMRA 4EX4A 3P8IA 1TTPA 1RVKA 1MRQA 4IX0A 5CPQA 1B3XA 4CQ9A 3GIPA 4GI9A 3DCPA 4BF7A 4Y96A 2FLIA 1OSEA 2DSZA 2C16A 4RDYA 3W87A 1Z44A 3EEZA 4PMXA 3HMJG 5EU9A 2WZMA 4S3EA 1RY8A 3QTGA 5AC7A 2CKRA 1EKOA 3BLEA 4R53A 5KSWA 3VFLA 3CBWA 5IM51 1DIOA 3KRZA 3NJ3A 2GLKA 3VYLA 1CXLA 2C0HA 1JZ4A 4UTLA 3FSUA 1R3TA 1VPQA 3WJSA 2CPUA 5HWNA 5I6SA 4JL1A 5I3GA 4IT1A 3WIJA 1YDYA 1OD8A 2FHFA 3E0IA 5D37A 3N9SA 5C55A 4EXQA 1OF6A 1RQBA 2EHHA 2W67A 4O19A 1I9CB 3G6MA 4N0RA 4B5TA 1J5SA 1FHUA 1FCBA 1FDJA 2ZFAA 4AIOA 3RPTA 1ZB5A 2ISWA 2GJXA 3M46A 4H01A 3CWNA 1XCWA 1I1WA 2WB5A 4AZBA 1O5KA 1ZAJA 4JCLA 3SQLA 2CKSA 1VS1A 4LT9A 2VJXA 3C2EA 2Z6JA 1CWYA 3WKZA 1EGMA 3T4WA 3IVTA 1RCXB 4B5NA 4I6KA 3PSWA 2QJNA 3LZ5A 5EPDA 1F9CA 3GR7A 1YDVA 2ANUA 1UZHA 2F8QA 2J75A 5E70A 1TYGA 3TJLA 1AODA 2RGLA 4GABA 1ZJIA 3AFBA 3REQA 2OLSA 4KCVA 4AW7A 1JULA 1HO4A 1IIHA 5BOOA 3QHNA 1LBLA 4PL2A 2VKZG 4O10A 4BK9A 3RCNA 3S0CA 1CXIA 2Y7EA 3W86A 2V3FA 3V3WA 1J93A 3LYEA 5HMEA 1EHNA 1KR0A 4JKKA 2C0AA 3M0IA 1CB7B 3W1NA 4DUVA 1MXDA 1HGWA 3GHSA 3BG3A 1H11A 4DJEC 4KEMA 4J3VA 1C3FA 4OV9A 1ZHAA 3HZ3A 2POTA 3SJ3A 2G95A 4K7YA 3AOFA 3THAA 3QV8A 3AZRA 3VOCA 1XPYA 3CL7A 4E5TA 3C2RA 2R1KA 5L9FA 3VMNA 3EKGA 4JD4A 1LOSA 4GPNA 4LTSA 2WLYA 2VOMA 5A6SA 3GDLA 4MZYA 1MYRA 1J0IA 4LUTA 4JR5A 1WXYA 4H9XA 5REQA 3PM6A 3NGJA 1XH2A 3L0GA 2NQJA 3GSMA 3E5BA 4E6MA 3D3AA 5DX7A 4WDXA 1HNYA 4LUIA 1FY6A 2CFFA 2X42A 5CG7A 1BQGA 3RPDA 3GNNA 1Q4WA 4H41A 3A3XA 1V7AA 1LBFA 2ACSA 4PRRA 2XM1A 2QMKA 3WCZA 3WQOA 2CLKA 1R7OA 4KWUA 3GHTA 3CZEA 1TWWA 4ORIA 2OEMA 3IIPA 1R87A 4C6CA 1DTUA 1IEVA 4QDMA 4GQGA 2VEPA 1W1ZA 3POHA 4W5ZA 3AXIA 1TQXA 3TP4A 1ISWA 4ZQCA 5LIXX 1J0KA 4MJZA 4BQ3A 2IKIA 2VCBA 5HMSA 5LSMA 4XTIA 4IGNA 4O1AA 1UH4A 3UWVA 4C6IA 3QLLA 1OIFA 4IIBA 5CGTA 2PF8A 3GDMA 3HG3A 4AX7A 4QIUA 1M5WA 4UCGA 3HO8A 5CJMA 1HP5A 3GRIA 3UPMA 4LSBA 1AG1O 3RJYA 2QXWA 5AHMA 1WPCA 2BOGX 3ARXA 2V2CA 2XSBA 1DTNA 5JH1A 4QX4A 3CL6A 3GNDA 2BASA 3TWBA 3MP4A 1OCJA 2Z2BA 3HTWA 3BGAA 3VNIA 3W2MA 3H7RA 3WQCA 1JPIA 3AQUA 4JNMA 1HVQA 1VBUA 4LAUA 1K03A 3F5JA 4GJJA 3WQ5A 3C8FA 1JGIA 3AIRA 3LN3A 1PTDA 2UY5A 3SI9A 1UD5A 3NQEA 4J3TA 3S6DA 1Y65A 1G5AA 2ICSA 4TVDA 1L6WA 1S1PA 3WJZA 3WEOA 3SY1A 4LUJA 3V16A 3NYZA 1TSIA 3RMJA 3VKDA 3C3UA 1W9BM 2JK2A 4X2RA 1G4TA 1W9XA 1UD2A 1JFXA 4ZTXA 3UWWA 3BVJA 1UC4A 4TMCA 3PWGA 2VX6A 1UIOA 3TQVA 4R27A 3DBPA 3SSZA 2QNEA 4HU3A 5EB8A 2XIOA 1XRTA 3OLGA 3WNMA 1UASA 2J7EA 3K46A 1V3KA 1CW2A 4C6KA 3MW7A 3BOLA 5TBOA 2E8YA 4QITA 3M47A 3GZ3A 5JBFA 3INPA 4XO7A 4L56A 3ARZA 1RCOB 3DXIA 1RPXA 5E0CA 1S5WA 2JEQA 2E6DA 2WSRA 5FF3A 3CMJA 4B3KA 3FKRA 4XK2A 1UQZA 4URIA 3TTOA 4ZE5A 4IIHA 3R4IA 3ONBA 1W1YA 5HQMA 1S2AA 1M03A 1C8VA 5J8LA 3OVGA 1I75A 2J8TA 4GY1A 4MWAA 1QI3A 3PZGA 1E6ZA 1RA5A 3MMTA 4X22A 3FHAA 2VENA 1JDDA 1VD6A 2Y61A 4C6QA 1V3MA 4AZHA 1UR0A 1TVLA 4FLRA 1GJWA 3NL5A 4G56A 1SZGA 4D8ZA 1QI0A 1A49A 4F9DA 3PP7A 1XJBA 2YBTA 1NF7A 1SM9A 4C60A 3T0DA 4S2CA 3TYAA 3W2UA 4CU7A 1P5BA 1EEPA 4JHMA 1YTEA 4DJFD 1VC4A 5C9WA 3MDUA 1DOSA 1V0MA 1DXFA 4HNLA 2ZADA 2YXXA 2QS8A 3UXDA 4ACZA 4WSHA 3HGSA 3OJGA 4NNAA 3A5VA 3A9BA 4K39A 4M1RA 1G6CA 1K9EA 1E51A 2REQB 3QW3A 1V8EA 4DN1A 1P6CA 3EOSA 1VHNA 2GUBA 3ISIX 3RMEA 1V93A 4L9ZA 4IZGA 1E4MM 4DWSD 5C0QA 3GTIA 1XD0A 4H8NA 3T78A 5A2BA 2X0SA 4NZ1A 4Z42C 2XIIA 1BWLA 2W63A 5FF2A 2CLPA 1C92A 2J9YA 5CPSA 1RP9A 3HIJA 4INFA 1H0GA 2WANA 5F2LA 2OYLA 4LPCA 2QCFA 3QSTA 4J27A 4JIPA 4BI6A 4I5XA 3N2TA 4L6OA 4D6HA 6TIMA 5HPCA 2WHKA 3NDYA 4IJRA 4BI7A 5I02A 5E0FA 2WOQA 4A3QA 3P74A 1F61A 5IBXA 4DZ5A 2ZZ4A 4NZFA 3S2NA 2VWSA 3KRUA 3O9NA 1TMQA 1U5HA 3DZ1A 3W0KA 1Q7QA 1I0DA 1B9ZA 2B7QA 5CAKA 3STFA 1AVAA 3LUTA 3G3MA 3G0SA 1KV5A 2Q8LA 1JIBA 3UPWA 3CH9A 3WBEA 2D2GA 3ZZ1A 2E3ZA 1TO3A 2O9RA 3LHTA 2E25A 1YX1A 3SUVA 1TQJA 4QISA 2QEZA 2Z26A 4H8VA 2JGYA 4LS0A 1OK6A 3S46A 4QLLA 2IQDA 2FPVA 3CZJA 1XGZA 4IFRA 1F8MA 3FEQA 1RK5A 4GK8A 1TX0A 1ME7A 3WDRA 1K8YA 2OQHA 1BQCA 2FQIA 5I09A 1O60A 1XIGA 2YCIX 2ZICA 2O4MA 4GIAA 2I57A 3W02A 4DYEA 1IT8A 1MW2A 3L68A 3UG3A 2PCQA 4U4MA 3R5EA 3OVQA 2AAAA 3H6OA 3KBWA 3F5KA 4IUOA 3WQPA 5EY5A 2JIWA 2R24A 3KCOA 4NIRA 2QCDB 2YR1A 3WBWA 2OWWA 2YJQA 3VNKA 3NQFA 3WLHA 4H6EA 4QG6A 4MLJA 3CV6A 1V6UA 1EX1A 5A8PA 5PTDA 3TMQA 2QPSA 2NXGA 3WLRA 3C86A 4HHMA 2AGTA 2CNCA 1OC5A 3M0LA 1B30A 1K8XA 4ROPA 4GQBA 2O9OA 4DWSC 4ORMA 8RUCA 1EH9A 3O07A 2FGZA 1QCWA 3W81A 1TREA 3OP2A 1FHLA 1UWIA 1JDFA 4LC6A 5CBJA 4WLCA 2XVGA 2AAMA 3LHVA 3WD4A 5MF5A 1HXJA 1O94A 4M1BA 3R94A 3FAXA 1CGXA 3L0KA 4NNCA 1JCTA 1IHIA 1TCDA 2ABBA 4DEFA 3WYZA 4DJFC 2DUXA 2A7PA 4WSJA 3W7HA 3VDGA 2GQ8A 3L5MA 4IMCA 2WK2A 4AWEA 1FKXA 2DZVA 3UFYA 2BOFX 3QY8A 5ENLA 4GY0A 3WLMA 4FNUA 2GQ9A 3QYQA 2ALDA 2J6XA 3N14A 3SRHA 5A6TC 3S5OA 1W2PA 1ZQ5A 1NVMA 1LF1A 3EWUA 3RFAA 2ZC8A 4OUIA 3IEBA 1S5VA 1YXDA 4HU0A 3WLIA 4UMAA 1KGUA 4L61A 1CXHA 4L4OA 1ZY9A 1CGWA 3EX6A 2JKPA 1E1EA 1B3YA 1VFLA 1H2JA 3P80A 3CZGA 1XC6A 4L9XA 4M8UA 5IDZA 2PB1A 2GJLA 4EPEC 4UTKA 4PUWA 4GCXA 3OQEA 5CGMA 2OKOA 3MI2A 3R12A 1POJA 2WWCA 2XH0A 3QTPA 3DYPA 1IWBA 3SCTA 2G8ZA 3GVQA 3N17A 3GYEA 3GG0A 4XAGA 4ATDA 3MU7A 1OHLA 1UWQA 4C1NB 3UYIA 1LM1A 1WB0A 2R9RA 2D0FA 3OB8A 1NFPA 1DV7A 2AL2B 5C70A 2HE5A 4IFOA 1YPFA 5AC5A 2JE8A 3LCWA 4D8LA 1FWWA 2CWNA 3ZWTA 4IQDA 2Q3OA 1IZCA 3FNDA 3ITOA 3S2LA 1B2YA 4HJWA 1B0IA 2VGGA 4TUFA 3VCRA 2QR6A 2P10A 3W1QA 4BCEA 4Z0JA 2XVNA 4KFNA 2F61A 4J2PA 3FN9A 5LXEA 4LX4A 3RR1A 5C71A 4FS9A 6XIAA 3H2FA 3OGSA 1ME8A 3UGVA 2GVJA 2QJIA 1C29A 3VKJA 1QO2A 3ZVIA 3PWIA 5A8GA 1R3RA 3GIYA 2DZAA 2FFIA 5DT5A 3DECA 4H9YA 3VDAA 1WV2A 3MWCA 4TOQA 2WMGA 2D22A 2HWGA 3PBUA 4EVZA 1DQUA 4L80A 4L9YA 3NXLA 4H04A 3LHYA 2G3JA 3PBMA 5SWUA 4H9TA 3NQMA 3EB2A 2NUWA 4UNIA 4NX5A 3GD6A 4IQLA 1IT7A 4LUSB 1O5RA 3FY1A 1V6YA 1KWGA 1E1CA 1AH4A 1R2TA 4R88A 1SJBA 5LGXA 4AXNA 1Q8JA 1N7KA 2P88A 3M0YA 3B40A 3MJMA 5K9DA 2Y63A 3GY1A 3SCWA 4MIMA 3ZT7A 1MW3A 4AH7A 1TWSA 4IPIA 4FNRA 3GBEA 3QGVA 3EDEA 1EO7A 3CAVA 5CLTA 5A6JA 3W4RA 4IGMA 4F66A 2RFGA 1A5NC 3LX9A 1V79A 1UD8A 4LNYA 2Z1WA 4GQ0A 3GIQA 4FB7A 3MHGA 3RX4A 3WNOA 1FH8A 4QSFA 1R3QA 3G77A 4XISA 4UUIA 3PULA 1QBAA 2OMAA 3NZGA 4GKLA 1Z41A 4BQ4A 4K8EA 1Q6QA 4WY0A 3HJEA 3NCOA 1UOZA 2XH2A 1ZENA 2NQ5A 2C1GA 1OGGA 1SO4A 2B81A 3VXGA 2ATMA 1W9UA 1JZ7A 3T2OA 4JHZA 1XP3A 1SR9A 3PANA 2E5BA 5HBFA 2QPUA 4ZSUA 2PCEA 3I4KA 3WO8A 3OA3A 2G5WA 3LI0A 1EDTA 4AD1A 1OFOA 4UTTC 3UWYA 4O11A 1IXPA 4HKPA 1V08A 1BYBA 3CIWA 4JTHA 3PFRA 3QOMA 3ZYZA 2OYMA 3OZOA 1C8QA 3D0CA 2BY1A 5I2UA 1HJUA 1WBJA 1WBHA 3UCDA 1TIMA 1GCYA 2C7FA 3B0YA 1KV8A 2H8ZA 2O55A 2GVYA 1YDOA 2HXTA 5D09A 1ZAIA 1S5NA 1AH3A 4UOQA 1CTNA 3FYOA 1UD4A 4HCDA 2OSWA 1G1YA 4GE8A 3PG9A 3T08A 5ABFA 3KVKA 1MVYA 3T05A 1JCNA 3G3DA 4WKAA 3BGGA 4DZAA 1W32A 3TX9A 2VEMA 2VRJA 3TAOA 1E3XA 4IL2A 4PCPA 2J25A 3H22A 3ATYA 5KMYA 5H8UA 5JBEA 4UOJA 5D8ZA 1K6AA 1RUSA 4LAKA 2ADAA 2FZ8A 3ZLGA 1F3WA 3SCQA 4CN6A 3W23A 1A5CA 1TV4A 3BSHA 2OLHA 2H9AA 3CUIA 3TE9A 5KETA 4GFIA 3RM9A 1VBJA 5XIMA 3E96A 3NEHA 1XG4A 3AJ7A 2OGJA 1BYCA 3S5SA 3KFTA 5H8MA 1KXQA 4QEEA 1X1NA 2V8ZA 3HFYA 1UKTA 2PTWA 3ZR6A 3N34A 2WZEA 3ZWSA 2BXVA 4D71A 1QW8A 1TE1A 3CASA 3OODA 3W9ZA 1LZOA 2ZUMA 3ARYA 4PTMA 1KBKA 1H5VA 4FK9A 3U5YA 4XG1A 1AD4A 4UQ9A 3FVMA 1EP2A 1LUCB 3UZZA 1AUSL 2B0MA 1G01A 4IP7A 3KX6A 4PTVA 1E9LA 1UJPA 5DMLA 1EDQA 2QUVA 2UY2A 2WSKA 3K2GA 4X9SA 1TJ2A 1FXQA 3TNOA 1EC7A 2WNQA 4S3CA 3HPSA 4MSSA 5BU9A 4PFHA 4AD4A 4JN6A 1JYVA 4IPLA 4LY8A 2H3DA 1F76A 3B8UA 1EJTC 3K4WA 4XQ6A 1E71M 3O7UA 4NXKA 3DU0A 3UQNA 1JNEA 2PC4A 2PI6A 2WPBA 1HKVA 3MUY1 4DAFA 2I5GA 5BNKA 4JY8A 4C7DA 4CQBA 3SQSA 3TYDA 2Z1XA 3S5NA 3ARVA 2F6UA 2EG7A 2FGBA 4MOZA 4RKAA 5K9CA 2PBGA 3QZEA 1E0WA 3H4WA 3KTSA 1UA7A 3G2GA 7ODCA 3MO7A 3F4CA 2BS9A 1VCFA 4W8BA 3U48A 1KD0A 3N9RA 2J88A 1RD6A 1BXCA 2IXVA 4GUFA 3SCOA 5KZDA 3W01A 1BTMA 1LRNA 3WZ0E 2J4GA 5FACA 1TJ0A 2WCAA 4IPPA 4W7VA 5M3WA 2VQTA 4HGXA 4LF1A 1KM4A 2VZUA 4PUKA 4W88A 1TV3A 3N3TA 4JQ2A 1YKWA 2H9AB 4O12A 5JIPA 3IANA 2ZX6A 1UR4A 3DESA 1NWTA 1C8YA 1D8CA 2DH3A 1F74A 4EAMA 4WY0B 3U7VA 3SEPA 3BV4A 4PUDA 2PF0A 2BVYA 3M7WA 3TTEA 3URNA 2VP8A 2VR4A 4HK5A 5AZ1A 3UF9A 1MDLA 3VK5A 1E5NA 1H3GA 1UKSA 3ITTA 3UZWA 4GG9A 1FCVA 4HZ8A 3JZUA 4V28A 5C7HA 3GVRA 3APYA 4MZ8A 1Q4NX 4QS6A 2PDMA 3L4WA 3DKLA 3GUGA 3SUSA 1CCWB 4C5YA 3M0HA 3GW0A 3D5HA 1IE7C 2YDAA 1EYEA 2ZWZA 2RKXA 3TN6A 4DNHA 3EWWA 3PTQA 3BG9A 5DMYA 4JQAA 3M0ZA 5AYIA 3RUBL 4RL3A 5D38A 5DCBA 3B8DA 3B8WA 2ESCA 1JPKA 4CQ8A 3F2CA 2CZEA 2BGNE 4O17A 5H8PA 1DJHA 1PDYA 3E1F1 1GW9A 4AAJA 3Q94A 4JDYA 3S2JA 2DQXA 5M03A 1YYAA 4O0KA 4N42A 3KL5A 4NI8A 1PEZA 1KBBA 1OFRA 1WDDA 4H9UA 3EMCA 4Z1YA 3KOYA 2PS2A 1NP2A 3NQCA 3PZUA 4XZ9A 5D2VA 5FKYA 3FXGA 1LCOA 2J13A 4N9BA 4FF5A 3AI0A 4O0ZA 4EIVA 4XUGA 4JNYA 4XZIA 5DXYA 2HNEA 2W0UA 1ZJAA 1EP1A 1ZL1A 4YTRA 1R3SA 4RXFA 2VCCA 2VZVA 2VL4A 1TTQA 3EKLA 1DWGM 1XCFA 1QOPA 3AIWA 3NZQA 4M7SA 1KLYA 4S23A 5CJNA 1L0PA 1KC7A 3FJ4A 5CEWA 5HJYA 1X96A 3TW7A 1XIBA 2OEKA 4DO6A 4CNUA 1XLMA 4JDBA 4WXYA 3AS2A 3DYMA 4WZHA 4C1LA 3FAWA 2AL1A 5I00A 3IJ9A 3ITYA 1ZAHA 1CI1A 3TJIA 2CXGA 1UR2A 2B4GA 4YVVA 5CC5A 1H5YA 1W3TA 3RNDA 3FJ6A 4FALA 4N4PA 1VENA 2C71A 4HZMA 1U30A 4F3HA 1H61A 3CB8A 2NSXA 1CDGA 2A79A 3P5YA 2H3BA 1FP8A 1A5BA 1KFKA 2ZWYA 3VIPA 4RDVA 3ZOAA 1QPQA 2NLIA 3BICA 1GZJA 1ECEA 1KLZA 4ZQMA 2I5IA 3FLUA 2UWFA 4HN4A 5L6UA 4UNLA 2J47A 4HJFA 5DANA 4YS1A 3M5ZA 4EF8A 4FOKA 1XGEA 3K1GA 3IGUA 1XDLA 3W26A 1OVDA 2GGGA 5FJPA 1VCVA 1P0KA 1RR2A 3W7LA 5LNSA 4JQ4A 1SVDA 4Z08A 2J7HA 1J79A 1E73M 4X60A 2OLAA 3A4AA 1B4EA 4OFCA 4LEQA 1Q85A 3NURA 1VYRA 4PTXA 5E0KA 1J01A 3OTRA 3N9KA 3JS3A 3P60A 1CLKA 5I79A 3DG3A 4ADSA 4LFYA 3W7PA 3B04A 1RY0A 1E9YB 3OLIA 2WM0A 1JZ2A 5HR7A 2ZVRA 2CLEA 3IS4A 3TFCA 1E6PA 1TV8A 4RW3A 2ZX7A 3BWWA 1BF6A 4HHHA 5CGQA 5F1UA 4M0XA 5I3DA 4B5SA 1ZGDA 2J77A 3WSUA 4I8YA 2EPKX 1LDCA 1QW7A 3MPGA 4PBFA 4JTFA 4ZOCA 4AVNA 2A7RA 3A4JA 4Q4RA 2ON3A 3T7VA 1GT8A 2ALRA 2AOSA 5E6YA 4PSRA 2XH4A 1VJIA 3N25A 3QV6A 3W7JA 1XYMA 4IF2A 1EEXA 5ECUA 1FWBC 3NPWA 3WH5A 5EBUA 3L67A 3N2BA 4EWJA 4CUCA 4ZEPA 2X2GA 3RK8A 5JXQA 3NL2A 5CJ5A 4RJEA 5A6BD 2ZX5A 1GQLA 4J9JA 3GKAA 4LXFA 4ZO6A 2PRLA 3WDHA 2VZTA 1G69A 3TC3A 4YXGA 5H91A 3L4YA 5JQ9A 3L65A 1GONA 3CB3A 1W31A 4AYSA 3VIOA 1CGTA 4K2SA 4F2TA 3DEQA 4D2JA 1LRTA 1BG9A 5LA1A 3VO0A 3LBMA 4BI5A 4AHOA 2GJXB 4DB7A 1A0DA 2PTYA 1J10A 2VDIA 4M51A 3W1UA 2X2YA 4O1EA 1Q6EA 3S5ZA 3GFYA 3FW6A 2FTYA 4QNEA 4LAMA 3E6EA 3NYDA 3IIOA 1XXXA 1WUEA 3BXWA 5AHNA 5G2WA 4JX4A 3VDBA 2BZNA 2FDSA 4IG2B 1FWJC 3P2VA 3GXIA 4LV9A 2V63A 1I2QA 1TG7A 1DIDA 1F6PA 4GA8A 4DXXA 3O05A 3MI3A 3C2VA 2UBPC 4DBDA 1R47A 2ACUA 3HF3A 4R33A 1F4HA 4HSHA 5EMMA 3GHUA 3REQB 1XH0A 3S9IA 1HT6A 3H8AA 4MKVA 4ZE4A 4PCTA 1XW8A 4YYCA 1W1B1 1P6BA 1PAMA 1Q7MA 3TONA 2DSUA 4MG4A 5RUBA 2WNNA 4GC3A 2W61A 2QIWA 2RJHA 1OM0A 3TWAA 3L23A 4Y90A 1SYTA 4C5ZA 2ZZ6A 3B8SA 1FWAC 3BARA 4WQ6A 1EX5A 1E0UA 2EQDA 1MXSA 3QPZA 4IP4A 1EGZA 4UR9A 4G1KA 1QPRA 3PPGA 2POZA 2WMJA 4GYJA 3PUDA 3HMCA 3UVIA 4E2DA 1UWSA 2IPWA 3FGCA 5G1YA 4HMNA 4NJHA 5HDRA 3CGTA 2Z2UA 2QZRA 3W1XA 1GZGA 2CZ5A 3N15A 4I9AA 1XYBA 3MS8A 3GVGA 2ZVIA 3H4XA 3BK0A 4AYGA 2BV9A 1S3TC 4YYFA 2FPYA 3W2NA 1QT1A 5DEZA 4B90A 4D6FA 4WJXA 1F6KA 3GAKA 1NDVA 1RZMA 3TJXA 4HA0A 4GRSA 2ZXAA 5FOOA 1R46A 3SJNA 5FF0A 3WLKX 4GXWA 1VF8A 3URAA 3EPNA 4XZBA 3KXQA 4QSHA 2ONEA 2PDWA 4K1GA 1HKWA 4HQVA 1KXHA 3KRBA 6XIMA 1H7NA 3WLTA 3OYXA 1JDEA 1O1ZA 4MUPA 3G8RA 1V6TA 3C2FA 5LA2A 3ABSA 3DFYA 1DL3A 3NTYA 6REQB 3PWAA 1MMFA 2NQZA 2JF6A 3GXPA 1BVZA 3POCA 4QJ5B 4F8XA 4UQAA 3QQ1A 4R3UA 4OKDA 1MFUA 5I24A 1KR1A 3G1VA 4GVIA 5HA7A 1E15A 3WG6A 2I5QA 3QLDA 3ABOA 4JL2A 3GHRA 2QCCA 3VGFA 1WCGA 3B97A 4LVBA 3CTLA 2E9MA 2JBMA 3BLFA 1VIZA 2FMOA 1R7AA 1QNVA 4YTSA 4W85A 2TSYA 2FGLA 3NUKA 1T41A 2EG8A 3PS7A 5T9CE 2IXUA 4P7LA 3WENA 2E6FA 4D6GA 1OJXA 2WZHA 1FVPA 5HNRA 1G4EA 4ONVA 2DGAA 1W5QA 3W83A 1XQLA 1CBGA 2FHBA 4IP5A 1BVWA 2HV5A 3MMWA 3SFKA 3PJXA 2ZUTA 1UPPA 4DIAA 1UWTA 4WOZA 3IV8A 3K8LA 4HK7A 4YCOA 4H6QA 2VUNA 5I06A 4JFSA 2GDQA 1NEYA 1XBZA 4PB4A 1U1JA 3AU6A 4NI3A 3F4NA 1VCGA 2PGWA 1I45A 1J4EA 1XUZA 1X8CA 2P3EA 2DT1A 4GO8A 4CU8A 1XLGA 5DCDA 2EXOA 2E5CA 2O7QA 3SIMA 1NIUA 5DY2A 3BQ5A 2C6QA 4EANA 2YDQA 5U4NA 1XLKA 2MANA 1LORA 2XWDA 3EOOA 3J7HA 4CCDA 2CLLA 4H3DA 2GPTA 1WKDA 3BW2A 4YHGA 4ASTA 3BCJA 3GX9A 3KUMA 2NWRA 4S3JA 3OYZA 4KS0A 3N1AA 1JNDA 3LCXA 3LG3A 1JDAA 5K9XA 2PU0A 1XIMA 4UQEA 4GH3A 4LJ3A 1THFD 2QW5A 3EA3A 4RXGA 1NARA 2ZX9A 3V1PA 3LLXA 2VEGA 4PA8A 4JTRA 4M81A 4YIWA 1JAEA 4E8DA 4GISA 1Z48A 3PZQA 1JG9A 4F40A 1OWQA 4NUWA 4LF2A 1ZP3A 3MZ2A 1WZKA 3W2KA 5E9XA 3WF3A 1P7TB 1DWIM 1KA9F 1IF2A 3G8EA 4UCFA 1TB3A 2OOFA 4MY8A 4IQJA 4M6UA 3BLLA 3IJQA 2QV4A 1HJXA 1OT1A 4RE0A 2MNRA 4QROA 4KIEA 2D73A 4GVFA 1CXKA 3IARA 1VEOA 5G4HC 3WDIA 5KITA 3UR5A 2R1NA 1TX2A 3BJFA 3TXZA 2RH9A 3LHUA 1XR2A 1OFDA 2OODA 1OB0A 1S5TA 2QULA 1CNVA 1BFNA 1SO5A 5FEZA 2ZA3A 4XO6A 4N9CA 1W6TA 4ZOAA 5CKSA 1ALDA 2HCVA 3NVTA 4HYWA 1IEWA 4GVGA 4AZIA 3LHZA 4LH8A 4WSKA 4ZSTA 3ATZA 4NKCA 5EFFA 3O15A 5EMLA 3HQPA 1MFVA 2PRHA 5DBTA 2QCGA 1KM6A 3F1QA 1RLDA 3BW3A 1N55A 1NSJA 4PYSA 4JXCA 1JYWA 4V1XA 3A3HA 3T2QA 3C4UA 1TJ1A 4BWLC 4GUJA 2WBKA 1R3WA 3O0KA 1VHCA 3BOFA 3TN5A 3GXMA 3EOUA 4HSNA 4HTBA 3A47A 1E9IA 3G24A 2O0TA 2O9PA 1OF8A 1U5VA 4FLQA 3E74A 1NELA 4ENLA 4IMEA 1K3UA 1OBAA 3Q37A 2V5CA 1FOBA 3A23A 1L2QA 4WY0F 4CNSA 4D9PA 4DBEA 3AYVA 5G2HA 3TROA 3GDTA 4WDTA 4R7OA 3AYSA 4L65A 1TPUA 2Y5EA 2ZOXA 4DBSA 4J28A 3CUFA 3KOWA 4J3UA 3L4XA 4RV8A 1UJQA 5AHEA 3DUGA 3SGGA 5F2GA 4RUBA 5D2YA 5JBDA 2FH6A 3GTNA 4FXFA 3KRSA 5F2IA 4W7UA 4KEUA 3G1XA 1MRAA 3NEVA 1OABA 2QYGA 5FF4A 4PRTA 1JL8A 2X1UA 1Q8AA 4AMCA 1ENUA 2W92A 1IZJA 4L7ZA 4L1GA 4G7EA 4I9MA 3QF0A 2PWGA 3AZSA 1EJRC 2ZA1A 5ABGA 3ICJA 5HINA 3IVSA 4DO7A 4A21A 2GVEA 1IXOA 1J0HA 1XKYA 1A50A 1LOLA 4AXKA 2FHCA 3CUHA 1HTIA 4LVAA 3CPUA 1EDGA 2OZ0A 3GO2A 2HISA 4ATLA 2C19A 3N6QA 2JFEX 5FSEC 2V67A 2JKEA 8XIMA 3RU8X 2E67A 3CZLA 3M43A 1PBGA 3BW4A 5M17A 2CW6A 2DUZA 5I7GA 2WYSA 4DRSA 2XHYA 1AD1A 2VR2A 2BLEA 1Y5WA 4LUTB 2Y24A 1NH6A 4O15A 3M0KA 5LNRA 3NNTA 2NV9A 4BA0A 3I6RA 4MY1A 1HIZA 3OVRA 2QHAA 2BHUA 1IEXA 2G0WA 3VOGA 1C9WA 3ES7A 3NGFA 3T1GA 4MNMA 3PN8A 5I07A 2JEPA 2XPKA 3B9OA 4B3ZA 1UG6A 4DJFA 4W8LA 4Q3MA 4A3RA 2NT0A 2RHGA 3HQNA 4PL1A 2DV0A 4KW2A 3TCEA 2XN2A 4K7VA 4FPSA 2PSNA 4X0NA 3IVUA 3SUUA 1PSCA 2XGIA 5D9MA 1GQNA 3M5YA 4ZO9A 3HV9A 3JU2A 3GKFA 3CXOA 1RAKA 4PEKA 1EUNA 5CPNA 4NJKA 1UBSA 2A6NA 2XFWA 4DWSA 3PPCA 4CNPA 2A5HA 2RDUA 3T6CA 4KCTA 3AZTA 4UR7A 1W3NA 1XM3A 2B7NA 4FHAA 4QXIA 3L4TA 2DQWA 2WWDA 3V36A 2XWEA 5EMUA 1TJRA 1SO3A 2YL8A 3ID7A 3P5ZA 4XAPA 2WPGA 4DZIA 4H6KA 1XLIA 2YCLA 3RJXA 1SJDA 4JFWA 3H2EA 5GQBA 1Q6GA 2WLZA 2J74A 1WDRA 3CIXA 1C90A 1IYXA 1TFVA 3AYRA 4OTKA 4Q7NA 4W87A 3I3EA 3SBFA 2E68A 1V3HA 2ZZ1A 5G5IA 2DSWA 4HNVA 3NO3A 3PAOA 1LL6A 2XIBA 4MDOA 1XCXA 3O1NA 3R11A 4F0HA 1O4UA 4DJDD 1P0BA 4RNFA 3GDKA 1KBLA 1VLIA 1RJPA 3VGDA 2WJZA 3T55A 2J7FA 2WKJA 4O1FA 3RLHA 5D2WA 1PPIA 3IPWA 3G1SA 2VOTA 4JYEA 1F05A 3N3MA 2DZPA 1LQ0A 4JICA 4G7FA 4O13A 3MUCA 1PCKA 4C6JA 3WFAA 4YTTA 1M3UA 3QM3A 4ZO8A 1XFBA 3SFWA 4IHCA 1EPXA 2JKAA 2PA6A 3KP0A 1PZ0A 5F1VA 4AWTA 1HF6A 4MPQA 4NX0A 3B3DA 3N19B 1ML1A 4GQRA 7TIMA 2Z1KA 4V1YA 1EWEA 1O5QA 3SCRA 1ONXA 2CXEA 5DRCA 2CHNA 1EP3A 2D3NA 4PUEA 5IBXC 1E1CB 4ZCWA 4NAFB 4NZJA 3MQTA 3R8HA 3AUJA 1HJQA 3ME3A 1KTNA 4C1KA 4PMOA 1KM2A 3GTXA 3WBAA 3CAQA 4XBSA 2PWEA 1H1YA 4Z1DA 4LYPA 2B7OA 4PB3A 3LOTA 1ZLPA 3EXTA 3DKJA 2J27A 3MCNA 4MPKA 1FWGC 3IJLA 3MKVA 2NLYA 4PEEA 3N4FA 3NXFA 3Q45A 5AY7A 4QBXA 3TSMA 4P8XA 3MMDA 3S9YA 3I7RA 1GEHA 4OECA 3HU7A 1NM9A 3HOJA 1X6UA 3PHAA 1OCNA 1GYMA 3AWOA 5E1QA 2OWXA 5F4SA 2AGKA 4NU7A 4JTGA 1O5XA 1FWCC 2WNZA 3EX3A 2GVGA 3BAJA 4M6QA 4OE7A 1US2A 2FTPA 4XIMA 4H6RA 1QATA 3N29A 2VEFA 1ISZA 2VFIA 3MBFA 1M04A 4L1WA 1B3ZA 3MUIA 2ZE3A 1TVPA 1UR9A 3WMSA 2D2OA