3CQIA

Crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with sulfate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
277
structure length
277
Chain Sequence
KQIPLGIYEKALPAGECWLERLQLAKTLGFDFVEMSVDETDERLSRLDWSREQRLALVNAIVETGVRVPSMCLSAHRRFPLGSEDDAVRAQGLEIMRKAIQFAQDVGIRVIQLAGYDVYYQEANNETRRRFRDGLKESVEMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLKQSGYCGPYLIEMWSETAEDPAAEVAKARDWVKARMAKAGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of L-xylulose-5-Phosphate 3-epimerase (UlaE) from the anaerobic L-ascorbate utilization pathway of Escherichia coli: identification of a novel phosphate binding motif within a TIM barrel fold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords L-ribulose-5-phosphate 3-epimerase ulaE
total genus 110
structure length 277
sequence length 277
chains with identical sequence B
ec nomenclature ec 5.1.3.22: L-ribulose-5-phosphate 3-epimerase.
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3cqiA00
2J6VA 2XISA 4J4KA 1A0EA 3C0QA 3DBNA 3GNXA 1XYCA 2QW5A 1QT1A 4QEHA 4HHLA 5J8LA 3C0LA 3AYTA 5AVNA 3IUIA 4LNCA 4XIMA 4DUOA 5H1WA 3KCJA 1S5NA 1XLEA 2Q02A 3IUDA 3ITYA 4ZB0A 3UU0A 4QE5A 2NQHA 3M0XA 3KWSA 3U0HA 2HCVA 4YTTA 1XIGA 3C0SA 1XIHA 2GUBA 1XIDA 2QUMA 3BWWA 3M0HA 1A0DA 4OVXA 2X7VA 3QXBA 5TNVA 3M0YA 4QDPA 3UXIA 4HNOA 5EMKA 3CQKA 3M0MA 3KBWA 4XKMA 4ZB5A 3ITTA 3CQHA 4X60A 3KCOA 1XLMA 4QDWA 3CQIA 6XIMA 1CLKA 1GW9A 4A8IA 4EACA 3KBVA 4QEEA 5AVHA 3M0VA 3CNYA 1D8WA 4YTUA 4DVOA 5B7ZA 1XISA 3CWHA 3OBEA 2XINA 3BZGA 5H6HA 1BXCA 5B7YA 3JU2A 3KBSA 1DXIA 2I56A 4HHMA 1QUMA 3KBMA 9XIMA 4K1GA 3ITLA 4GJJA 3QYSA 1BXBA 1YX1A 3TC3A 2QULA 2ZDSA 3BDKA 3UA3A 1XIIA 1XIJA 3VNJA 3AALA 3NGFA 3IUHA 1XLBA 4ZBCA 1A0CA 3P14A 1XLDA 5B80A 3CQJA 4X61A 4Q7IA 2NQJA 3AAMA 8XIMA 1XLGA 2X7WA 6XIAA 4US6A 4A8LA 3BANA 5XINA 1XYLA 2GYIA 1XIFA 5EMLA 1XLCA 4A8NA 4A8RA 3AYVA 1XYMA 3FVMA 4X63A 1XLJA 1OADA 3VNLA 3LMZA 5C9ZA 4EAYA 9XIAA 3ITXA 4GQBA 2QUNA 3L23A 5EMMA 4PGLA 3QC0A 4YTRA 4XIAA 1K77A 4GJIA 1XLKA 3ITOA 3ITVA 3N4AA 3VNKA 3M0LA 1XLFA 3KTCA 5I7GA 1I6NA 5XIMA 4ZB2A 2NQ9A 4G56A 3KBJA 3DX5A 2XIMA 1MNZA 1DE5A 2GVEA 4W4QA 5EMJA 5XIAA 3UVAA 1XLIA 3BZJA 1QTWA 2G0WA 1XIBA 1XLAA 1DIEA 4K3ZA 1XIMA 3XINA 2ZVRA 3XIMA 8XIAA 2HK0A 1XLHA 3VNMA 1XYBA 1S5MA 4QE1A 4GLEA 1I60A 4KW2A 4XSMA 3U3HA 3XISA 1MUWA 4E3VA 2GLKA 3KBNA 1DE6A 3VYLA 4YTQA 4XISA 1XINA 3TVAA 3UA4A 4PFHA 2HK1A 4QE4A 1O1HA 4XSLA 1XICA 1DIDA 1TZ9A 3KCLA 7XIMA 1XLLA 3P6LA 4YTSA 2OU4A 2I57A 3WQOA 5FA5A 1XYAA 1XIEA 3VNIA 1XP3A 2G4JA 4HGXA 3QZAA
chains in the Genus database with same CATH superfamily
2X1SA 2RAGA 4LQ1A 2NQHA 1SM9A 2OR2A 5I78A 3GAYA 4FO4A 3QV8A 4I8DA 5FF7A 2WZHA 5AB3A 4J35A 4S3GA 3GUGA 4I7VA 3U7VA 2AAAA 2XDFA 5HNNA 3WD1A 2FMOA 2W66A 3WBWA 4B15A 1KFEA 4XD4A 4UR8A 4UC5A 3URBA 4GH3A 2WB5A 4GXPA 1FWDC 1KXHA 1UMLA 5HQLA 3RIKA 3L0NA 1L8NA 2VRKA 5HWJA 2OQLA 2RH9A 5E0KA 3B97A 3ZLGA 5G4EA 2HISA 3EOEA 2VWSA 3W85A 4CQ9A 2VDIA 1HJWA 4HPXA 3GDLA 2INEA 3AXKA 3TN6A 3O16A 1G5AA 5A6SA 1PB0A 2JEQA 4ZSTA 3GU9A 3P93A 4UTMA 4XZLX 3M7SA 1WDSA 3DECA 3NQVA 5M03A 1IWPA 3ZT6A 4GQGA 1YHTA 3LHZA 2AQOA 1QI5A 1XLLA 1UYQA 1UWUA 4D6CA 1TR9A 4HTBA 4CU6A 4IJCA 4IG2B 1ZGDA 3GTFA 1XYCA 1E9ZB 4LY8A 1MWOA 4C7FA 5IRPA 1JCLA 3FCPA 1FRBA 4ZSUA 3QRHA 1JR1A 1S5NA 4Z0SA 1SO5A 4C6LA 1QWKA 1HJQA 2VYOA 1XDJA 3S0CA 1LWJA 2CEQA 4QM1A 2V3FA 4WLCA 4P8UA 3JS3A 2QAPA 5LNVA 3WMBA 1GW9A 4AWEA 3JVAA 3KTSA 4JTJA 4HZ8A 1A5KC 1JRBA 1SU5A 4LYRA 4HHMA 2P8BA 4Q4SA 3IVSA 3W2UA 1XIIA 4NUWA 2WYSA 4H7CA 4PTXA 3PFMA 3FV9A 5AYXA 5H91A 2J9ZA 3HTWA 3W1NA 2G4FA 3A5FA 1G4TA 2ALDA 4PMYA 4I6KA 3CIVA 2YJQA 1XSJA 4L7ZA 4DZHA 1XLKA 4NX5A 4Z1BA 2Y4SA 5F7UA 1RPKA 2QMJA 1X98A 5I7GA 1UJQA 3WMCA 2VURA 5SWUA 2PAJA 1OCBA 5T9CE 3B8IA 2GVJA 3IPWA 3E2SA 3R12A 5FL1A 4PYSA 1I9CB 3BXWA 3DN5A 4BI6A 3W1UA 3PBYA 1AA1B 1WA3A 3W1PA 5L9FA 3QJAA 4MAZA 4F66A 2UV8G 1XINA 3N11A 4CQAA 1T40A 3VGEA 1A5LC 3AS1A 1N8FA 2Z1WA 1EEPA 1H7NA 1PX4A 3S47A 5KSWA 1PJ9A 4QEHA 2Z7GA 2EG7A 4ADUA 3RAOA 4DWDA 3W7KA 3BWWA 2QUMA 2E1DA 4M6UA 4N9EA 3ABOA 4QJ4B 5BNKA 1A5MC 2PCQA 1Q2SA 4JTGA 2HBXA 1BG4A 3UESA 3QTGA 2GOKA 1KBIA 1EHAA 1GVIA 3DYPA 2NUWA 3R11A 2EQDA 1KKRA 4AY8A 1E72M 4S2BA 1F9CA 1UBSA 1UR4A 3OQ8A 3I4KA 1BRLB 4O0ZA 4N9CA 4BWLA 2VGGA 2BXVA 3BUVA 1R9YA 2XYLA 3CZLA 3EMZA 3SCUA 2C15A 3BLOA 3OVQA 1Q8JA 3M41A 1D3CA 4LT9A 5G1MA 2P0OA 3I4EA 3TKFA 1I2NA 4J3SA 4PB3A 3HV9A 4HPHA 2ZCGA 3UBPC 5D2WA 3OLGA 2TMDA 4HKPA 2XH7A 3K4WA 4QXIA 3F2BA 1US0A 1SSDA 4F48A 1PTDA 1ECQA 3HQNA 5D2VA 1ICPA 4O8RA 2WWDA 4U31A 3C2EA 3O2LA 4LH8A 3TWBA 3FSTA 5DT5A 4HSHA 2ZUVA 2JIWA 1S2TA 2A21A 3OP2A 3VC6A 1QRQA 4MMWA 1NP0A 5MHBA 4ORIA 5DELA 3W29A 5EBAA 1C29A 3ARQA 4BEUA 4GO9A 4JTQA 5D9MA 1IWAA 3EEZA 1UP2A 3VTRA 3KRBA 1BPLB 2X1UA 3CEPA 4G7EA 3GFXA 1OGBA 1IQ8A 3UJ2A 2DZTA 3MS8A 1OC5A 3ABRA 5G4HC 2GZXA 3VCCA 2BGQA 2CBUA 3LHTA 3WLHA 1EP1A 2OEMA 1ALDA 5A6JA 1HKIA 4WQ6A 1RBLA 2WO5A 1VGAA 4IFKA 4UTTC 5AC8A 4I9JA 1D2KA 1ODUA 3M5ZA 2WBGA 4FNUA 3OOQA 4E2OA 3N4EA 2GDQA 1MQPA 3NZRA 3B40A 3R7MA 1TVLA 3PPFA 4I3GA 4GY1A 3KDOA 3PFRA 4CNOA 3O8AA 2XM1A 3LCFA 4G7FA 2G3NA 1VJSA 4HOWA 1R9XA 1UD5A 4DN1A 4M0XA 4XAZA 2Y89A 2WBKA 5AHLA 2CIPA 2DZWA 4NAFB 2BZNA 3BPWA 2DZAA 3SJ3A 3W6MA 2VFFA 3WQEA 5DF0A 3EX4A 3PSVA 3NAVA 1E9IA 2GWNA 2CZ5A 4Z1AA 2NX3A 3GNXA 5I0DA 4IIDA 1D9EA 1ML1A 2Y62A 3KOFA 3ANUA 3GXFA 3QMSA 1J11A 4PRWA 4RV8A 3LM3A 1REQB 4V1XA 2DJXA 4JIRA 4ALDA 5BOOA 2V5CA 1WDDA 1YPFA 3BMVA 2HXUA 4NAEA 1QOXA 2C6QA 1ISYA 1V3LA 3OGSA 1DHKA 1HKWA 3Q67A 4BCEA 1KFKA 2E8YA 2VCBA 2J62A 3HG2A 3MJMA 4DJDD 4UCGA 5I5RA 1GZ1A 2XIQA 4ACZB 2PCEA 2EXOA 3GTXA 3LM7A 2J78A 4WZHA 4MPQA 1GEHA 3SIZA 1KBLA 2A7RA 2YBUA 2VR4A 2YL8A 5G1TA 4F8XA 3N2XA 1N8WA 4EWJA 1FFQA 3IV8A 4DM2A 3LHUA 4DNHA 2YFNA 4J9JA 2ZX5A 1XLIA 5RUBA 2DIJA 3L7RA 1A5OC 4REQB 1QPNA 1XLHA 3HB9A 1XD0A 3IJQA 4UTIA 3EMQA 3DFQA 4O4WA 3MP4A 4LVGA 2WSQA 4FNTA 4HCDA 3NQGA 3S1UA 3O0FA 3IIOA 1ZCOA 2C8NA 2GSJA 2YBVA 1V0KA 2VRJA 1VCGA 2VHLA 3LQLA 5CG0A 3VD3A 2PWFA 4JTRA 5HMSA 5IDIA 4NZCA 3STFA 5LGZA 2GOUA 1R2RA 1BQCA 3UJSA 3VU2A 5CAHA 4LW7A 1OC6A 2FZ9A 1XISA 3GKAA 1FWJC 5A6MA 1EQPA 3LUTA 1BXBA 5FI8A 4E4UA 2QR6A 3GG7A 1QOPA 4XBSA 4PEEA 1VH7A 5EMYA 2YCKX 1V77A 4H00A 3WLLA 4Q8TA 1Q6LA 2P1FA 1R6WA 2V5KA 2HBVA 3E2VA 4PCPA 4QCFA 4YS1A 3MSDA 3NYDA 1QW7A 4CNPA 4HSNA 4M80A 3PZGA 4F9JA 3WK3A 2W0UA 3RHGA 1Z44A 1U22A 3EZ4A 2WMGA 3T7VA 4XSMA 1PWMA 1J93A 5CXPA 2F6XA 3WSUA 4NXSA 1E1FA 1EYEA 3MI2A 3CB8A 4DYKA 1G4PA 3N6JA 3T9PA 5A2AA 4MHBA 1XBXA 2Z6JA 5DCBA 1AMKA 1UKQA 3K46A 4IX2A 1PEZA 5K3VA 5CLTA 1UWRA 2HPIA 1E1EA 3L4ZA 4MVAA 1IEQA 3LEPA 2OELA 3CH0A 1WKYA 3VKCA 5DN1A 2VO5A 4R33A 2ABAA 4HCHA 2X41A 1EPVA 1B30A 1PHWA 1ZJIA 1SR0A 1HF6A 3WMSA 3BSGA 3G3DA 3ITCA 2CCRA 5DANA 4GD0A 1YDNA 2BVTA 3EOOA 3CIWA 3H2NA 5FAGA 3WZ0E 4GK8A 3W7JA 1LOQA 2PDLA 3L9CA 2Y5SA 3TTSA 4B4FA 1TE6A 1Z3NA 4PMXA 1V6WA 1PSCA 2IKIA 3SUVA 2Y70A 3CO4A 1NDZA 3ZR4A 3M43A 3PS7A 1A3XA 2YGYA 1E51A 4GINA 5AECA 3E12A 3NQFA 1G69A 2V69A 1BYCA 4LY4A 2X0YA 1ZALA 2ZZ5A 5D05A 4GVFA 4NRRA 1ZJBA 4KRTA 4N4QA 1NDWA 1OGGA 3FLUA 4N0RA 4CCEA 1MVYA 2DZXA 1Q5MA 1FWFC 4PMJA 2ZZ7A 4NJKA 1Z48A 3E38A 3HU7A 4ZODA 4JQ4A 2WANA 4JFTA 3L4XA 4QAWA 4B2DD 3KWSA 4UZUA 3KZPA 3EWBX 3S6DA 1XIDA 4XZ9A 5I3KA 1E4NA 3GIQA 1RCQA 5DY2A 1ONRA 2OWXA 3OA5A 4QFUA 3GUWA 2V67A 2DDXA 2PD5A 5C7VA 1NARA 4WKHA 2VD9A 4PTDA 1Z8AA 3K1DA 1DXIA 1EGVA 2WV8A 5I6SA 3CUXA 4RPQA 2GJNA 3ATZA 4L9XA 2ZXAA 4UOZA 3T8LA 2ZBTA 4UNKA 4FHAA 2CZVA 1Q6EA 2YDSA 6XIAA 4ERGA 3GSMA 4H2CA 4AHQA 1W3JA 2WVTA 1OC7A 5BXTA 1EBGA 1UUQA 4HSOA 1R46A 2VEFA 4NKCA 1TZZA 3W53A 3ITOA 2QCLA 1XFBA 3RR1A 2JE8A 2BFGA 4NJJA 5M17A 1K3UA 3WLJA 3EAUA 3W73A 3ENLA 1MI3A 3R8HA 4EVZA 3XISA 2VVSA 1OFBA 1XUUA 1ISXA 5IXEA 4N9BA 5D09A 4IGMA 1E6SM 5IHSA 4K2SA 5D32A 4FLSA 1FKXA 3BICA 2J7GA 3QGVA 3W23A 2OGJA 4L65A 3BH4A 4GGBA 3AYTA 7REQB 3B9DA 5HAOA 3A64A 5FD0A 3PZIA 1K8ZA 1Q7ZA 1NF0A 4J28A 1KRMA 1REQA 4XX6A 4GISA 2R1KA 4OWGA 5D2XA 3KEHA 4MM1A 2V2HA 2C13A 3LHVA 1EJTC 1Q8AA 4V28A 3GLCA 4D6DA 1S2WA 3LGGA 3WLKX 3LG3A 9XIMA 3THAA 1CLXA 1ZJAA 3W7NA 4YYFA 3BW3A 3DESA 4XZBA 1NSJA 1F3TA 1T0OA 5F1VA 1YLVA 2MUCA 5EMLA 4HOZA 2AMGA 4D6FA 3SI9A 5J5RA 2E40A 2OG9A 4A3YA 1EGMA 3HG5A 5ECVA 4HNCA 5JH2A 1E4LA 1AODA 2WJDA 3CMGA 4CD4A 1FDYA 1XGZA 1TPEA 3KOYA 3STCA 2VWTA 1W17A 1CENA 4C6KA 1JF6A 3EOUA 1YNPA 4LVFA 5E9XA 1A5AA 3WK0A 2PTYA 2E4TA 2YA1A 3A9BA 4CN4A 3HG3A 3QV6A 5D9PA 3VIKA 3DGRA 2WNNA 4HGXA 3ALFA 5CPMA 4GUIA 3UJRA 2B7PA 4QS6A 5BRPA 3MJYA 7XIMA 4H6EA 1TJRA 2Z27A 3GRIA 3W1RA 1UASA 3F5JA 1DORA 2QIIA 5CJNA 2Y7EA 3NPUA 5HA7A 2O9OA 5HWMA 3B8DA 1W6TA 1VQTA 3KBVA 2I7GA 3B0YA 2OSWA 4QX4A 2UWFA 1JPHA 3PZ9A 2QCGA 3LLXA 1HZYA 3WNPA 2XIJA 3A4JA 3HG4A 4MUZA 4S3DA 3OJGA 4ZOCA 1HP5A 2GUYA 3FNDA 3RCYA 2Y61A 2PGEA 4UTWC 3BMXA 4QIUA 3VC5A 2GUUA 1XLDA 4O1AA 3KOZA 3GDMA 1Z42A 1MW1A 2ZX7A 2IQ0A 1HL2A 3EDKA 4X63A 2VZVA 3DCPA 4S3JA 4QDMA 1CXKA 2ZQ0A 4NL1A 3FXGA 1YPIA 3FEQA 4F0HA 2OZ3A 2XSXA 4QTGA 3E1F1 5DMYA 3A3XA 3L4UA 4QG8A 3SBFA 4MWAA 4IUOA 4W5UA 3S9ZA 1H60A 3HA1A 3HPSA 2EGZA 1TJ2A 2PE4A 3N12A 1S5MA 1LBMA 1ZNNA 2A3CA 4NAEB 1RCXB 3PZQA 3PZNA 1L9WA 1XICA 1UOZA 2NVAA 3MSGA 1J8VA 4A3QA 4HCLA 3CHCA 4U2YA 2DVTA 1UZHA 3V16A 1MW3A 2Z1XA 4E6MA 5LIYX 5D37A 4ASTA 2PTDA 4K38A 3N9RA 2PDIA 3BGGA 4O17A 2POZA 4WSHA 2J75A 5F1UA 3AZSA 1WXYA 3AHVA 1Y65A 4H9YA 1G6CA 4QSFA 1CXFA 1GT8A 3MCOA 3WJYA 5CKSA 5D33A 3BZGA 3NEHA 2QUVA 4MKNA 2JEPA 3FFSA 3NFUA 1PVNA 1N55A 1NWUA 3PSWA 3FN9A 4YU1A 2ZDSA 1N2VA 2GJLA 1E1CB 5CG7A 1H62A 4YMZA 5BU9A 1EL3A 4N6FA 8XIMA 2J7DA 3FHAA 1EYWA 1TPC1 2QEZA 2V3GA 1JAEA 4P5UA 2PGFA 1Q7QA 5A6AA 5BOFA 2WMIA 2VFHA 2C1HA 2ZXBA 5EBUA 1TA3A 3HGSA 3W83A 2A85A 3MANA 2DQWA 4ROPA 2PDYA 4IPLA 1E6PA 4O15A 1FWSA 1CYGA 3GC4A 4IFOA 4QG9A 3WG6A 3WQVA 1A3HA 2PDCA 4WF7A 3N2BA 1XCXA 4UTUA 2I5QA 1KM4A 2YOCA 4PUDA 4ZOBA 5C54A 2JIEA 5BZAA 3J7HA 2PDGA 4GHRA 5ABFB 3EGJA 1H5VA 4LWWA 4PL1A 2WJFA 4Q3MA 3ORWA 3PB0A 1Q6QA 4WHBA 1XP3A 4IMCA 1ME7A 4R9OA 3PPGA 4J4KA 5BXRA 3VCNA 2JBMA 1B3ZA 3CEUA 3MCNA 4FX8A 2GPTA 4AD1A 2X7VA 3MZ2A 3WBXA 4JTDA 1ISVA 4A21A 5CZTA 4W84A 1QNSA 3DFPA 1TO3A 1Q3NA 3EB3A 1JFHA 4EACA 1PZ3A 3WQPA 1QNQA 3RU8X 3H70A 4A2SA 2AL2A 3NYZA 3WLPA 3CV1A 1OX5A 2XVNA 4OBRA 3BL3A 1NOWA 4UZSA 3TC3A 3FYYA 2DJLA 3IRDA 3CHFA 3DC8A 1H3GA 1K8CA 1WUFA 2PWHA 4LBUA 1CTNA 3GD6A 1SJDA 3DG6A 4WDTA 1I75A 1PV8A 1RZMA 3AUOA 3MPGA 3WQ8A 4W85A 3AMLA 3M0LA 1RP9A 5XIMA 3IGXA 3TQ0A 1H2JA 3WDQA 2YCLA 5KZDA 2ZVRA 1XW8A 2EEXA 2WMKA 3AYSA 4PTMA 3CTLA 1KXTA 1MUWA 4AD3A 2V6AA 3JRKA 1H63A 4J3VA 3UA4A 4CVWA 4MUPA 2VCAA 2FPTA 3FAWA 5ABGA 4KWVA 2ALRA 2XPKA 2DV0A 1UPMB 1NDYA 1PKNA 4XUGA 1Z41A 1CBGA 2I1OA 1R38A 1KM1A 4XZWA 1KA9F 3MYPA 4POCA 4QDPA 4GC4A 3B06A 4XZIA 3M0MA 3FSUA 4O11A 5PTDA 4O28A 2DVUA 3BV7A 3D0CA 4E5TA 1OFPA 3BCJA 5JVLA 1J0IA 1EJ7L 4YTUA 1P1XA 3S8HA 1TWZA 3TTOA 3RRXA 2PDNA 1K1DA 4WKAA 1NELA 4OV9A 1ZBWA 4RZ5A 1KM2A 2QULA 1XCWA 1Q2RA 4FMVA 1XLBA 2E9LA 4Q8NA 4AZ6A 1FWWA 2CLEA 3H2FA 3DFTA 5M3WA 1X1NA 1H4PA 1K77A 5FJRA 2QGHA 4PMRA 2PDXA 3ZMRA 3GBDA 4LJ3A 4LALA 3MWAA 1F05A 3NL2A 1L2UA 2VZTA 3S2NA 4GX8A 4XD3A 1B57A 1DWAM 4URIA 1ITXA 2HE8A 4DM1A 3AMDA 2BTMA 3TROA 4XISA 3TVAA 5EKYA 4EOUA 2PGRA 4J3TA 1H7RA 1QDSA 3DENA 3OGVA 2YR1A 4NZJA 4TTUA 4DF1A 1IR1A 3UPBA 5AHMA 3C0LA 2OO0A 1YDOA 2YLLA 3KCJA 2Q02A 1KRBC 1SW3A 3SB0A 4L4OA 4X9YA 4ACZA 3OIXA 1J9YA 4WCJA 3S2JA 5CEWA 4HNOA 5CJ5A 1VFLA 4GVHA 1U5VA 4X22A 4KKXA 5G5IA 1QNPA 1NM9A 2Z2UA 2DUZA 2OLHA 1A4MA 4O1BA 2ZOXA 4DVOA 1AVAA 3EWXA 3VDGA 4OBSA 5I77A 3KVLA 4AIBA 4DHGA 1IEWA 3H24A 3ONCA 3DG3A 2G50A 3VNDA 4YXGA 1O12A 4X0VA 2VNCA 4PR4A 1UG6A 2P53A 2DH3A 2AGKA 3CAKA 4CUCA 4DQWA 1M65A 2Z6IA 3IAPA 1WKEA 1EB3A 1OFEA 4MOZA 4GVIA 5U7SA 4DRSA 2R91A 4W87A 3U4FA 1ZCCA 5DO8A 4GMEA 4HA3A 1J5TA 4QLKA 4Q4RA 4GZ7A 3NQ7A 3MUY1 3VD4A 3NO1A 1MNZA 3EMCA 4AZHA 4JOMA 3PHAA 1C9WA 3DU0A 1KB3A 3DXIA 4N9DA 3TE9A 5KZ6A 3QBUA 5A5WA 3T07A 5BROA 4O16A 2OOGA 2D1ZA 4OUIA 3BTNA 4Q7NA 2VEGA 1CGTA 4DZ5A 4KCWA 4JQ3A 4AQLA 3R94A 2QS8A 4U4MA 3VD9A 3RPTA 3S9YA 1SO4A 2NWSA 4JHMA 3ZFHA 1RCOB 4LTSA 1JEZA 3OYZA 1DJZA 1OX6A 3A5VA 3EPMA 3O0KA 3H2AA 3NXLA 1RQEA 1NWRA 4YJ5A 4W93A 3V18A 2QCMA 1WDRA 1QATA 1AQHA 1AH3A 8TIMA 4XD6A 4UUIA 1CNVA 4K7YA 2EJAA 4W86A 4R53A 4UCFA 5HMDA 1X7IA 1F8MA 1NH6A 2V5DA 4GJJA 3TMQA 4KCUA 4RR4A 2PURA 4MDOA 1KBKA 3BURA 3KRSA 4B91A 4P8XA 3BQ6A 1OK6A 3RX3A 1AJ0A 3H8AA 2GJRA 1XPYA 5EL1A 1K6AA 5CGMA 4A4AA 3CBWA 5EMMA 1ECEA 2PMQA 3QYQA 3A22A 3GH7A 2FB2A 4DX3A 1KWGA 4KERA 4JNMA 3WNLA 3BOXA 2B7NA 4HHPA 4QISA 2ZYFA 4MWAE 4Z42C 1S3HA 5DXXA 2A5HA 4O1DA 4V2XA 2ZZ1A 9RUBA 2PGWA 3RUBL 1NFBA 4Q7BA 4Z0JA 1Q6RA 4IJBA 1YXDA 2O7QA 3AI0A 3AIUA 3MV11 3NTYA 1Y7VA 3W2KA 1VJIA 4XV0A 3DHPA 4R9XA 3LZ3A 1ME9A 2NXGA 1RA5A 3LN3A 3UCQA 4IPJA 2VXNA 2Y6ZA 4Q6JA 4E4FA 1G94A 3WFZA 2DEPA 1KXVA 1R2SA 3P2VA 4IF2A 2EKGA 1FXPA 4NASA 1PL9A 4QS5A 5I3GA 4IMDA 4CEXC 1LM1A 1TTJA 4E38A 4FIQA 1UWTA 3B03A 1H0IA 5T8GA 2QDHA 1U30A 1NOUA 2CLKA 1TJ1A 3MUIA 3QQ0A 3DFSA 1EWEA 4OV4A 4PMZA 3SCQA 1AFSA 2NLYA 1HXJA 3GXIA 4C6CA 2J27A 2IKJA 2GGJA 2OYLA 3CT2A 1WE5A 2ODOA 1VEPA 4Y7EA 4R7WA 2GQ3A 3PAOA 1XLAA 4S3KA 3DAQA 2GK1B 3HPXA 3LPGA 1QJWA 3LCHA 1H61A 2P88A 3P8JA 3WH8A 4JIQA 1E5NA 1GKPA 1K9EA 2EG6A 4OE7A 3BO9A 4GJ1A 2BGSA 5DMMA 3ABZA 4R34A 1CEOA 2A3LA 3CPRA 1EC7A 1ZBKA 1DTNA 3WLTA 2R1PA 4G1NA 3W70A 3MUAA 2GVYA 3SDOA 2C0HA 1G1YA 4ZOEA 1QO5A 2CWXA 4LAUA 4WOQA 4AMAA 5A8NA 1UR0A 3C52A 3CQKA 3PJUA 3CC1A 3EDFA 5C9WA 1J6OA 1W0MA 3CAWA 3LS9A 4P7LA 6REQB 2ZXDA 2WKJA 3IV3A 3CNYA 1D8WA 3T0TA 1Q13A 2WW5A 5JUVA 3P7YA 3AXHA 1BXCA 2PPGA 3WELA 1EA9C 3LHWA 5HNRA 1AZ1A 4TX6A 3T40A 4XO7A 3T8QA 1WDWA 4D8LA 1S3TC 3RGTA 2TODA 3F7JA 4HOXA 2D22A 3PZTA 4O52A 3E2QA 4L9YA 4AYSA 5FJPA 3TAKA 3UPWA 1HTIA 3APYA 3R0UA 4YN5A 3N4AA 2ZIDA 1JUKA 4JFSA 1GOQA 4A3HA 1XBVA 3FJLA 1VKFA 1KTCA 1HGYA 1H49A 1XIMA 1UOKA 1NEYA 4PB5A 3UZ5A 4D6EA 3VIOA 5FF4A 3N17A 3W0KA 3DYMA 2XWEA 1DTUA 4W5ZA 2ZC8A 3K8KA 4IQEA 1P0KA 4GC3A 2UY3A 1KBJA 1J96A 5FF2A 2FDSA 1VB9A 4MDPA 3CGTA 3O6CA 4LC6A 2QCDA 3AYRA 2VI0A 3G1YA 2YPIA 3NOEA 4KRUA 3AU2A 2O56A 1V5XA 5AN7A 2Z25A 2OT0A 1D7FA 4AWUA 3WUGA 1KTBA 5JU6A 1J5SA 1RD5A 1F3EA 3QOKA 5TIMA 3VKJA 3WJWA 1NQ6A 3V0SA 3MWCA 3VX1A 5EFFA 4AW7A 4PUJA 1A53A 1ICQA 4A2RA 2UZ9A 3JU2A 1NFGA 2NVCA 1HW6A 4KESA 1EIBA 3THCA 3O06A 4DO6A 2WM1A 4KPLA 1JI2A 4ZFMA 1NWSA 1JCYA 3W38A 1P43A 4DAIA 1KV5A 4JX4A 4GQBA 4GH1A 2VC6A 3G6LA 4DZIA 3Q58A 4JTHA 5I3HA 4GBUA 1O5QA 3LBCA 1B3VA 2NV9A 3E9AA 3QH2A 4LFYA 2QDGA 3MZNA 3VNMA 2ZZ6A 4JYEA 5CGTA 4MIMA 3CHEA 2E9MA 4H8HA 5EB8A 4YTQA 2VC7A 1ZHAA 2FTWA 3CHVA 2YYTA 3ARUA 4RJEA 1BGGA 1FWHC 2J77A 1EBHA 4JN8A 1M1BA 4AEFA 1VBRA 1AD1A 1M9HA 4CGTA 1V7AA 4XTIA 3E0LA 4FZIA 4JL1A 4IIGA 4HHLA 1YE4A 3T78A 1XC4A 3TYCA 1HFBA 3Q94A 1FKWA 1TRIA 3EWZA 2NVDA 5LKYA 2YL9A 3W76A 2GGHA 5FEXA 2NV1A 3FK4A 3TWAA 3C6CA 1VD6A 3W7DA 3LRLA 3FA4A 1GZGA 1RJRA 5FJIA 3R13A 3GXNA 3KS6A 4ICNA 1BF2A 2J7HA 2J9XA 3KHJA 1PHQA 2KX9A 5A1AA 1Z89A 2WC3A 2YDRA 1P6CA 1VCVA 3GX9A 2E68A 3WLSA 1QI3A 2DT2A 3B8SA 3WLQA 1GVYA 3VOIA 3GC5A 1A5SA 2QLYA 1TV4A 1PO9A 4LAZA 2HVMA 4Z2JA 4JNZA 4YTRA 2FGBA 2FMNA 2A7PA 5D38A 4AY7A 3GS6A 1TTPA 2NQLA 3V5OA 1BYBA 2Y8UA 3WH9A 1LQAA 2PDQA 4IQLA 2G96A 2QPXA 1C8YA 4OGZA 3GNPA 4IFRA 3W26A 3WL1A 1VRXA 3R10A 1UH3A 4DBSA 5J04A 3FJ6A 1E0UA 4GABA 2GQAA 3SQLA 3OZPA 4JS3A 4NNAA 5I3FA 1Z6KA 1BTMA 1Y8BA 2QT3A 3C86A 4GXMA 1GORA 3BCFA 2CHRA 4RW5A 1UR3M 3T0BA 1F5ZA 4GZIA 3OHIA 4JCMA 4NU7A 1A50A 4M56A 1V3MA 2XFWA 2OB3A 1AZ2A 1XYZA 5GJPA 1E70M 2RJHA 3L5AA 4AZBA 3APTA 4AHOA 3SGZA 5FEPA 5AHFA 1IXNA 2R1MA 4M1RA 4NJIA 1W5OA 1ZTVA 1YBQA 4DBEA 1V03A 1QCWA 2E6DA 2BHUA 1EC9A 3CLWA 1TV3A 2A79A 4QRNA 2IPWA 3BANA 3S2MA 3T0CA 2ZVIA 2PZ0A 4YVXA 1R3TA 4I90A 1XLJA 4PULA 2J9YA 2RJGA 4B5XA 1R3QA 4JIIX 4LNYA 1M04A 3SRFA 4P61A 2NQ9A 3AXMA 3V0UA 4I7WA 1RVKA 4A22A 4F4RA 1K7FA 3WLOA 1QU4A 1TPVA 3DI0A 4U3AA 1GUVA 4PRTA 2VEIA 3BOFA 3IVUA 2E9BA 2OX4A 4BQ3A 1TQJA 2WNWA 3P3BA 2E3ZA 4OU1A 1J0YA 1J01A 2X1IA 1XPGA 1PZ2A 4FX6M 1GQLA 3H12A 2EO7A 2WZIA 3N4FA 3QW4B 4GIRA 1W3LA 1NVMA 4DXVA 1TV7A 5AYIA 4ZO7A 1IE7C 1WXJA 3VOJA 3I7QA 3OQEA 1DHPA 2VCCA 1UUMA 2TSYA 1G4EA 5EMKA 1W9DM 2C14A 2RUSA 3VMPA 4DB7A 1LLOA 2PP3A 1EJUC 2YCJA 3BAJA 2C3ZA 3WN6A 2X2YA 1W5MA 1LP6A 1JCTA 1HNYA 3PR2A 3MB9A 3PP7A 2VR2A 3ATYA 1THFD 2Z26A 4AZ5A 3KUMA 4QJ3B 2PU0A 4C5ZA 1SZRA 3EKGA 2Q01A 3L4TA 1EDTA 1TUFA 1YDYA 4P8VA 3PZVA 3SFKA 5CC6A 1EZWA 2GQ9A 3HGRA 4RK8A 3VNLA 4ORMA 3MA8A 5JXQA 4LYQA 2DPEA 1I1XA 3UP8A 1HJXA 2PA6A 1UUOA 3AXXA 3LPFA 3GVQA 2YW3A 3SEPA 1SO6A 4ZTYA 4LV9A 4WSKA 3RJXA 3VABA 4JX5A 1CGWA 2HNHA 2ZX9A 5AZ1A 1P5BA 4MNKA 3U5UA 4GIAA 1ZP3A 3NQ6A 3AU6A 2Q71A 2Z4GA 1OCNA 4OOUA 1GPWA 4QE4A 4IOTA 4KWOA 3PUOA 3AHYA 5HNTA 8RUCA 4RE0A 5GNZA 2AL1A 2V30A 2OCZA 3Q37A 4H6RA 4U28A 2FZBA 3WLRA 5FF3A 3BK0A 1W9XA 1A5CA 2ZTKA 3W71A 3G3MA 5A6LA 4M24A 2P0IA 4IIHA 4XK2A 5FIPA 2FJUB 2WQDA 5FEWA 1E15A 3NQBA 1L6SA 1RQHA 4EXBA 3VPLA 1AJZA 4NZFA 5HMFA 4AIOA 3PM6A 4AFYA 2QIWA 1A5NC 4A05A 2JFEX 4HMDA 1YNYA 8CGTA 3S4TA 2OOFA 1ITUA 1XSKA 1F3WA 2CNCA 1V02E 4Z2HA 4M1BA 5C9XA 2PRLA 4IQJA 4PCFA 3KLLA 4XIAA 3THQA 5JBEA 3D46A 3VZZA 2EPOA 1DE5A 5A8MA 4ILSA 3GHUA 3TTQA 1MDLA 1B3YA 2O92A 1RR2A 3EWCA 1OSEA 5BW6A 4JNYA 4PH6A 3WF1A 1B3XA 3EX1A 2BNJA 3A9IA 2Z7KA 4HYRA 1VHCA 2VP8A 4AIUA 1R3WA 3PF3A 4J3UA 3WQOA 1J2WA 2CU0A 3I10A 2OWCA 3CM4A 3RX2A 1BAGA 3CV6A 1SUXA 3ZVIA 2DZSA 3MHUA 1QNVA 5G2WA 1OB0A 1JGIA 5H8MA 2RHGA 4KETA 4ZZ9A 1UQYA 4F0SA 2E77A 4CU7A 4YTTA 1HO1A 2VZSA 3C0SA 4F3HA 4RXFA 3G5EA 3W27A 2V63A 2XIOA 3W02A 1W1YA 3UT0A 4Q8VA 2XIIA 4QNEA 5HWNA 3N3TA 5BYWA 3PZMA 3ARVA 1C7TA 3WD4A 5D4YA 4V1YA 2D2HA 1W1IE 3ANYA 2D20A 4WIWA 4A35A 2PF0A 5IHRA 3B9AA 4ADSA 3K8LA 1K9TA 1DWFM 1WP6A 1QHZA 2W9MA 4H9XA 4I5UA 1VZWA 5XINA 4C6EA 3MTWA 4O54A 3UZWA 5D8ZA 1KLZA 3T05A 1OVDA 3E5BA 4Q33A 3HPAA 2CYGA 2IUZA 5FSEC 3HPFA 5G4WA 3VOHA 2Y1HA 4DXXA 1ZBCA 2W5FA 1QTWA 4H2HA 2XSAA 2FKPA 4NF7A 4K8HA 3VIJA 3ZZ1A 5BWAA 1ZAJA 2VM8A 1BHGA 1JZ8A 4NT0A 1TMLA 2V38A 3UCCA 2OJPA 3BLPX 1IXQA 3RO6A 3ZLHA 4P8WA 1DWHM 1GZJA 3LI0A 2BY3A 4UFJA 1OYCA 2QGYA 2REQB 5DBUA 1QT1A 1GYLA 3GC2A 5LYRA 5K4ZA 1SJCA 4JHZA 4FNPA 1TCMA 1LT8A 1TPDA 3VM5A 1AQMA 1P7TB 5L6UA 5LIKX 3N9SA 2PBOA 3RITA 2YKKA 3OA3A 3S9IA 2D23A 3GG1A 2UY4A 1OZMA 3C8NA 3WFLA 1T6MA 4UTKA 1XH1A 3UZJA 4AXKA 1A49A 1J0ZA 1EJRC 4UQCA 3GHRA 4GVGA 1W32A 4Z17A 1FWBC 3MHFA 1FH9A 1IT8A 1ZB5A 4DJFA 3PVFA 3VOFA 1WAUA 4BF5A 2MNRA 3P84A 3EOSA 3OBAA 4JTIA 1F6KA 3W7LA 4C6QA 1TVNA 3AUJA 1ZZMA 1W1B1 3IAQA 2OZ0A 1UROA 4Y96A 2Q09A 4AZ7A 1V3IA 4YHEA 1TZ7A 4A6GA 3EX6A 2O55A 4DUVA 3SUUA 1RLCL 3QY8A 3EBVA 3KFTA 5KTLA 4PCTA 1GWJA 3ARZA 3W07A 3GNOA 4MPKA 3OLDA 4C1KA 3KW3A 1W9PA 3I6RA 3EX2A 3NEVA 1S2AA 3WH5A 3MI6A 1LBLA 2C1GA 3POHA 2ATMA 2TYSA 4MY9A 1E5JA 1YYAA 3TFXA 1IZJA 1EQCA 3TTEA 1QW8A 1BYDA 2BP1A 4JFUA 3ZJ8A 4MNMA 3NQAA 3B0UX 4W89A 1PX3A 1QI0A 4D6HA 5LIUX 4I5RA 4YVPA 3CV2A 1RJQA 1TMQA 3ANVA 1CLKA 3TX9A 1M53A 4QJ5B 1HG3A 2BB0A 3LBOA 4NG3A 5AVHA 3CYVA 4ZE4A 3GZAA 3U48A 1AQ0A 4Q8QA 1C9DA 3PC0A 4CQBA 1GOKA 2J8TA 2DSKA 2VGBA 4MY1A 5I3DA 1F4HA 1SSGA 4ATLA 2PP0A 1FY6A 3LZ5A 3GH5A 3ZVHB 4ZQRA 4UOJA 3FGCA 3I65A 4B90A 1YTKA 3OZMA 4FLRA 5I03A 2PZNA 3IARA 3F4DA 1UPPA 2VX4A 4X0NA 1EOMA 2PSNA 4F0RA 1JPDX 3VDBA 1QASA 3CASA 4KFOA 4Y9PA 4JKMA 3ZT5A 1ZAHA 1XI3A 3MMTA 3GE7A 4LS2A 4TX8A 1FWIC 2JK2A 1S39A 3M6YA 1TRDA 4GO8A 2ZE3A 1CB7B 1IF2A 2E5DA 2ICSA 5HANA 1GOOA 2G4JA 8XIAA 4Y9AA 3STGA 1K9FA 1JPIA 1US3A 4K1WA 5H1WA 3MUZ1 5T26A 2G3JA 3RM8A 2QVHA 2DVXA 1XBZA 1C91A 3G1XA 3EPOA 3VXGA 4YIWA 3IVTA 4J40A 1MW0A 1TQXA 3JW7A 5ENLA 1GQJA 4LYKA 1FCUA 1QO2A 3GG8A 2I5GA 5B7ZA 2NXHA 2YCLB 4AISA 4KH2A 5HJYA 4ZR8A 1QUMA 1EO7A 1JZ5A 3ZSSA 2DH2A 3ME3A 2ZZ3A 2YDQA 4IMEA 5JIPA 2J8GA 4N2YA 3C8FA 3NA8A 4RDYA 4UFIA 3WEOA 3R8GA 3PBVA 1VIWA 3G22A 3SSZA 5LGXA 3R58A 3STPA 3SUTA 4RDWA 1FP8A 5CPQA 1CGXA 2OKTA 1O4UA 3IK2A 5LXEA 2HS6A 1LRTA 4HQVA 3IJLA 4HU4A 2CZDA 2KZHA 3GU1A 4ZQOA 4GCXA 4ML9A 1LRQA 4V15A 2VVNA 3RLUA 2PRMA 1F7BA 1OFDA 3PNZA 3ZWTA 1WXZA 2ESCA 1KW1A 1JDEA 4CQ8A 3ARWA 3G18A 1VBJA 2PDHA 3HN3A 1F2JA 4R7JA 2PWDA 1X1OA 1CGYA 4L80A 4XSLA 1BRLA 2P3EA 2X30A 4HU0A 3N9KA 1XC6A 3T81A 3CZEA 4N6EA 1HVXA 1DIKA 1JZ2A 2QW5A 3NM1A 4GFIA 4RLIA 4FNSA 1X6LA 3K4DA 4RE2A 2HS8A 1LL7A 1JI1A 4UWMA 2QPUA 1QPRA 3LV5A 3B4UA 4UTLA 4PBFA 4S39A 1E0XA 2X16A 1Z32X 2NSXA 3F4WA 1KGUA 2QJHA 3VDAA 2WMFA 1TA3B 5TAOA 2D0HA 3QMTA 1AL8A 1YBQB 1DJYA 4IXXA 1PIGA 4JN6A 4L6OA 3IIZA 3NNTA 4I7UA 4O0QA 2OLAA 4IX0A 4GI8A 2YCIX 5A2BA 2Y0FA 3CL8A 3RPDA 4F2UA 3M07A 5LHFA 5CC5A 3ERPA 5A2CA 1XQKA 2INFA 4JZ5A 1LOLA 3KX6A 1UCWA 1U1HA 2XH0A 4YCPA 3QFWA 4UIOA 4PA8A 4L5ZA 1DP0A 1JYXA 1QFEA 3P6LA 1MYRA 1S2VA 4C6BA 2OPJA 3V5CA 4GKLA 2VX5A 5D9NA 1O5XA 1E9YB 1IHIA 3UU0A 1PTGA 3N3MA 3L2IA 1QBBA 4IL0A 3E74A 1P0NA 4Q4PA 3GHTA 3ZQ9A 2A3EA 2PEVA 1J2BA 2XH2A 3WCZA 3F5LA 2G97A 1VFHA 2WLZA 2CLLA 1OEPA 3C2RA 3N15A 1FVPA 3U4AA 1UR9A 3D47A 5T91A 4G5DA 1I0DA 3TFCA 3H4XA 3LCXA 1U1UA 2XZ7A 4GI6A 1QK0A 1EF3A 3EDJA 2BGNE 1KFWA 2OZ8A 1US2A 2VUNA 5HMEA 2ZUUA 4W9TA 1YEYA 4Y8FA 4ZGYA 2YX0A 3RCMA 1G9HA 3L4YA 4TOQA 2PLJA 3G1SA 3VNKA 5CSSA 3KLKA 1S1RA 3WH6A 3VX0A 3G1FA 2ZDRA 3A4AA 4C91A 1UKSA 1HKJA 3C0JA 3L68A 4Z1DA 4PE8A 4PBEA 3XINA 1W5NA 3UWVA 2ZWYA 3NZQA 1P1MA 1GYNA 1WPCA 3TJIA 4AZIA 2D2JA 2VOMA 5LA0A 3AS0A 2O4MA 3H2OA 3ARXA 1YRRA 4ES4A 1PCKA 1QPKA 3E5PA 4HT3A 4B3LA 4FK9A 1ONXA 1DJGA 2E6YA 1MEHA 1QR7A 4JHOA 3VKKA 3TAOA 2WAGA 2I9UA 2BVDA 1E3XA 1VEOA 4C60A 4NJGA 2OQHA 1JRCA 3DFHA 2NT0A 4GACA 2A4AA 3IJ7A 2EPNA 4JKKA 4UFLA 1L0PA 2O4QA 1WQ5A 3FEMA 1CPUA 4ZOAA 1BD0A 4KEMA 4B5SA 1VLWA 2X09A 4AD2A 3UYIA 3QR1A 3WK1A 1H0GA 3V36A 1JULA 4H6KA 3F4VA 3S6TA 2WVVA 5CH9A 1TMHA 4Z2GA 3M1ZA 1RHCA 4BR1A 2CESA 4AZCB 3DBPA 3TR2A 4GIYA 3L5MA 4L1WA 1DKWA 1Y0EA 3TN4A 4UMCA 4OOZA 4ICCX 3DHDA 2CKSA 3A13A 1DWGM 2E09A 1K7EA 3SJNA 1CT5A 3UQNA 4DPPA 3UWUA 3XIMA 4Z1CA 2WK2A 3WQ6A 3KHDA 3W6LA 1FUYA 3WD0A 3A3HA 4GUHA 1JNEA 1TUXA 1GQIA 2CWNA 4G9PA 3ZS4A 2Y24A 5GJNA 1QPOA 5FA5A 2BY0A 5HJXA 2A0NA 2FVLA 3LD5A 1MFVA 3FJNA 4PUMA 4ACYA 4AZGA 1XV8A 3AICA 2GGIA 5CPLA 3SAZA 5BXPA 4S23A 2HWGA 1G7VA 1ZFJA 3CUFA 2C79A 4HPNA 2D0FA 2RFGA 1EJVC 2ZX8A 5EFDA 3GO2A 1EC8A 4PMUA 5A69A 2FVMA 3U57A 1RVGA 1ZRQA 3M0VA 4FX7A 4B2DA 4WEVX 3DUGA 1IXPA 1BVZA 3QEZA 2I56A 4GX9A 3H55A 1S5WA 3SN0A 2XGZA 4IP7A 2V9DA 3TC6A 2I14A 2XJ7A 1WDPA 2QDEA 3HV8A 3CT7A 2HPMA 3RF9A 4Y9OA 1AUSL 6ENLA 3IIXA 2BVYA 1L2QA 1OCJA 3C2VA 3CL6A 5I07A 4S3EA 3UWYA 3NQDA 4PMNA 4UTTA 3GNNA 5CLWA 3H7UA 3KTCA 3H7RA 2QHAA 3GIYA 1X8FA 2GWGA 3AO0A 5E6ZA 2XSBA 3KE0A 3N19B 4ZO8A 4DZAA 3WLIA 2ZRXA 1LL4A 3AMKA 3LXCA 1TG7A 3QHMA 5T9BG 4WJ8A 3CAQA 1M3UA 4LB4A 4PL2A 2EF9A 4MAVA 3QM3A 4LF2A 1R5YA 1B3OA 1P7TA 5GNYA 1NQKA 1GOWA 1XUZA 3NZGA 3MP5A 1VYPX 1FWTA 2FZMA 4KWUA 2XISA 4JL2A 3BJTA 1VBUA 3NOYA 4ZB0A 5DBTA 1L6WA 5AYYA 1H7XA 3EWWA 4BQ5A 2VT0A 5C71A 1OF8A 1R87A 3V1PA 1VBHA 1W37A 4QR6A 1OQFA 2C16A 2D69A 4DJFD 2GDUA 4PMOA 5FKYA 1JDAA 1DXFA 4C6NA 5K7JA 1C93A 1I2QA 5E0CA 3S5SA 3W7PA 1NJJA 4IL2A 1PDYA 2FH8A 2YZ5A 3B0XA 2ZUWA 4JFVA 1C3FA 3FHQA 1TPUA 1ZAIA 4LVBA 2J13A 4PFMA 5I06A 5DMLA 1YX1A 4H9ZA 3GK0A 1H50A 3PUDA 2IKHA 4O19A 2E25A 3PJXA 3TW7A 1G4SA 4TVUA 4J2MA 1PCWA 4AD5A 4XZNX 1OIFA 4P7OA 3NDOA 4A3UA 4FPSA 1GW1A 3C4UA 4BWLC 3LMZA 3D3FA 1KCLA 3GVRA 1FH8A 3R43A 2X0SA 5IFPA 1UH2A 2H9AB 3QVQA 5HPOA 3HFTA 3SN4A 3VMOA 4FXSA 3TYBA 4CKQA 4R3UA 3PG8A 1C90A 4K3ZA 2DGAA 2X1TA 3LCWA 2XN2A 4GPNA 1W91A 1XH2A 3I3DA 3UG5A 2BXYA 5JQ9A 3GXTA 4PCNA 3VD5A 3MDUA 2HK1A 4HK7A 2RGMA 3PANA 5A8GA 3FDKA 4GE8A 4EX4A 1VENA 3TJXA 2R94A 5AHIA 2WXDM 4GNJA 3VNIA 1MSSA 1Q66A 4LRSA 4WY0F 1LWIA 1UZ4A 2HE5A 2GK1A 3OODA 2VX7A 1K02A 3HQOA 5I3IA 3B8VA 2OEJA 4Q6XA 3NG3A 2XZ9A 2HDJA 1EA0A 4XKYA 2IXVA 2Q8LA 3O1NA 3OIHA 1KTNA 3BG5A 2Y5EA 1IT0A 3DI1A 2ZA2A 3JZUA 4BI7A 4XD5A 4LF1A 3SZ8A 5KEZA 3VUPA 1F74A 4IISA 1YADA 3KVKA 4FR1A 4Q32A 2YXXA 3CXOA 1WZLA 4IIEA 3CB3A 4JQ2A 2EPLX 5HATA 2XVLA 3ARRA 1ZP4A 3I68A 5F2LA 4D71A 4RNIA 4S2CA 1V0LA 5ABTA 4HNNA 2Q8ZA 1I6NA 3SADA 1OFQA 2DSVA 2VGIA 3EDDA 4HMNA 1JZ4A 3TONA 1DXEA 4H9MA 2WVSA 2AKZA 4O14A 4W8BA 1XRSA 4UMAA 3IIPA 1E1CA 2JQXA 3RDKA 2NT1A 3T44A 3VKDA 2WSRA 3NVDA 3H4GA 3CUHA 1JD7A 3TC7A 3HF3A 3A4XA 5CBJA 4XTDA 5E93A 2J7FA 4OKDA 3M5YA 1DJHA 1VHNA 1H7PA 2XFRA 4DWSD 4OVXA 4JQAA 5E09A 3WY1A 3DOPA 3SSJA 3M0JA 4DJEA 4R7OA 5IBXC 1L8PA 4DYEA 3S6OA 1OFRA 2GJPA 5KZMA 3LLDA 1PYMA 1TV8A 4FS9A 4WDWA 3ZR6A 1JYNA 2ZUNA 2CHNA 5B7YA 1YMYA 1Q6OA 2OO6A 4LV4A 4DWSC 4K39A 3DGBA 4P2VA 2E5CA 3OHMB 4PMDA 5H2ZA 2TRSA 3KP1A 3GXMA 4US6A 1R86A 1Y5WA 5KINA 5AC7A 4AG0A 3GVGA 4DUWA 4XUYA 2WZTA 1UIOA 3BJFA 3AXIA 3TYAA 2BMBA 1ZBVA 2VC5A 1AL7A 4OJYA 4DBWA 2QZRA 4TX9A 4OQVA 2J4GA 1XWYA 4RL3A 3TIMA 1GYMA 2FPYA 3VCRA 4FF7A 1DJIA 1X8CA 4DIAA 3BAXA 1UD3A 4BK9A 5AFDA 1AW5A 4PMVA 4W88A 1CZ1A 3S5ZA 3E49A 4J1OA 1LTDA 1PBGA 4UNLA 2GVLA 4I5XA 5D2YA 5HNUA 2J8FA 1ONEA 4YLWA 4AEOA 1OYAA 3DBNA 1LQ0A 5K9CA 1O68A 4GNKB 5BWFA 2XUCA 1VS1A 1TWIA 2BOGX 3LGDA 4YYCA 2FYMA 4IPIA 1A0DA 3N73A 3GDBA 2XVKA 4RXGA 1VBGA 4JCLA 2BSLA 4XB3A 3W72A 4UQEA 3EB4A 4CD7A 4F9DA 2DZUA 3VVGA 3AOFA 3LTYA 3EKZA 4FNQA 1CCWB 3L4WA 3E2RA 4E2BA 2AQWA 1RQBA 3PTKA 3OB8A 3UWWA 1UQZA 2WCAA 3QOMA 3WMLA 4UR9A 4MKSA 2C71A 4J3WA 3D6NA 3GTHA 3EWUA 1SFSA 2V2CA 2HNEA 4UOQA 4IMAA 1JDDA 2QNEA 3KOXA 2WCSA 4CD5A 2P50A 4KCTA 4LEFA 2R6OA 2V2DA 1EKOA 1FDZA 5BMXA 4TMCA 3W1AA 2J24A 3W01A 4AUBA 5KZEA 3TUUA 4B5VA 4PCSA 3URQA 3IWPA 2H8XA 4AC7C 1XGDA 1DWIM 2WWCA 3V4BA 2XU2A 5FL0A 2HK0A 3ECQA 4YWSA 1I60A 3E0WA 4LAKA 3CH9A 4FP1A 5I79A 1GEQA 2V0TA 1KRAC 5AHEA 3AIEA 1VP5A 3WNNA 1H11A 3TQPA 1XQLA 1Q4NX 2ZRVA 5CC7A 3AHZA 3VIIA 5A8PA 1RD6A 3FKKA 4QQ3A 5CZ0A 1JUEA 3HPZA 3SM0A 4GQRA 2J7BA 3B3DA 1I4NA 5M2FX 1KM6A 4D8ZA 4JIEA 5DX7A 3U2OA 3M0XA 1DVJA 2W3ZA 3NQCA 4CQCA 5HR7A 4FB7A 5JIWA 1IIHA 3HQPA 3QXBA 3ES7A 1VCFA 2WMJA 2VJXA 2VEMA 3TYUA 3R4IA 3QLDA 5F2IA 4FI4A 3R8RA 3QPEA 3N13A 2VMFA 3S46A 4GCAA 3URNA 1XS2A 1XXXA 2HSAA 4Y90A 4CNTA 4NSBA 1QPQA 4XQ6A 4X3ZA 1UC4A 4C6IA 3ZJ6A 3UGRA 2AKMA 5HQEA 2ZZ4A 1XYMA 2PC4A 4TXEA 4M6QA 4J2PA 5BRBA 3ZSTA 2DT0A 1F6PA 3Q2DA 2QUTA 1WDQA 3B4YA 1XRVA 1V3JA 4H8VA 1NAL1 2FZNA 4R88A 4WUIA 3GM8A 3UR8A 4CN1A 4EANA 3VYLA 4KEUA 4GYFA 3W1MA 2BLEA 3BVJA 4IUGA 2NUYA 1KO0A 1EOKA 5CZJA 1TWDA 2VTFA 4C1NA 1NOFA 3NQ2A 2DQXA 2PRHA 1PZ0A 2X1RA 1JIBA 1POKA 2ATSA 3JZEA 1P48A 1EWDA 3SCTA 4MB4A 2PWEA 3IUIA 5M1TA 4XAYA 1BF6A 2WMIB 3JUGA 3QGAC 2A6NA 5EYWA 3UXIA 4B16A 4FSAA 4TR9A 4YNGA 2WVUA 2DSWA 1SR9A 3QF0A 4MGGA 1NY1A 4DPQA 1MNSA 3AZTA 4KQNA 5BCAA 1XL9A 1OBAA 5M5DA 1OHLA 3LRMA 3O07A 3G1AA 4LSBA 3M44A 3VGGA 4K1GA 4INFA 1LLWA 2EAWA 3G2GA 3UXLA 3UY8A 1A3WA 4CQDA 3U7BA 4WOZA 4XO6A 1JXKA 3AAMA 4NNBA 1C7SA 1IV8A 2OXNA 3EEGA 3LQGA 2NZLA 4IQDA 3LPOA 3O7UA 5FESA 1K70A 2QCHA 3VM7A 1DV7A 1AK5A 4O10A 2QUNA 3L23A 1D8CA 3M64A 3KM8A 4LEQA 3A21A 4Q8WA 3PBGA 2ONEA 5XIAA 3D5HA 1FCQA 1Q45A 1OG6A 4OZOA 3MO7A 4N02A 1CXLA 1ONWA 2ZKMX 2R14A 4JX6A 4LRTA 1H51A 3DFYA 2ZZ2A 4W7WA 4Q8PA 4FALA 2IPJA 3CYJA 3ZXWA 3ZWSA 1O6IA 3LXBA 3BAYA 2VX6A 3RMEA 1BWVA 4RUBA 2XHYA 4H19A 4JTSA 4LUTA 5AYBA 4H7ZA 1O94A 4D8AA 2DZVA 2R1NA 3R2GA 3UEQA 3E3HA 1HUVA 3EYPA 3IGUA 3TOYA 4TTGA 4C65A 4H9TA 3ITTA 3ZO9A 2GGGA 3ZVHA 4QDWA 2CW6A 5LIXX 4IXHA 1Y5VA 4DI9A 4A29A 3QZ6A 3MMUA 5A6BA 4JTLA 1W1VA 4JGDA 4H3DA 2WKLA 3WNMA 4Q8OA 1FHVA 3RM9A 7REQA 4DJED 1CECA 4ZEPA 1EDGA 2OGYA 2CLOA 4TUFA 3W7GA 1QNOA 1VLIA 1U5JA 3VNZA 1GG1A 3V75A 5LNWA 3S1GA 1VEMA 2DP3A 3GY1A 1LBFA 3MUXA 3CZGA 2NQ5A 4ATDA 4FXJA 4HPJA 1AD4A 3L66A 4LANA 5K4XA 3QPYA 1MDRA 2XVGA 5HPCA 3NSMA 3IRSA 1E0VA 1H41A 1TB3A 1UWQA 3TP4A 2E6AA 1XG3A 4KW2A 1GJWA 4NIRA 3OBKA 1E6QM 4KCVA 1KR1A 3EA3A 4YTSA 2HQAA 1TELA 3UFYA 4KFNA 2PDJA 2Y2WA 4F79A 1B9ZA 3WH7A 4AU0A 5E6YA 1UKPA 1GONA 4YL2A 4QE5A 1DIOA 3EA1A 1W1TA 1XD1A 3BLDA 1XRFA 4K7VA 2NXIA 3CWNA 4AD4A 1KQYA 1POJA 2I16A 3SO7A 4O4VA 1K4GA 4UFKA 1SYTA 2WOQA 3ITGA 1O66A 1TKKA 2QCFA 2ANUA 3SCNA 2ON3A 2F61A 3OG2A 3O6DA 5J5DA 4HU3A 3VD7A 3VE9A 1C8VA 4PTWA 2OQYA 4LX4A 1UW9A 1HL8A 5FJOA 3BSMA 3B9OA 3A47A 3S1VA 2NUXA 3TYEA 4Q4QA 1BXNA 3T4WA 2Y8KA 3IANA 3NQMA 2E67A 3QC0A 3OVPA 1R7OA 1PKLA 1BGAA 2J25A 1M7OA 4GI9A 2ISFA 1PUDA 4K37A 3KBJA 2GVEA 3N25A 2H3DA 3BLLA 3RFAA 1HKVA 2JKPA 2QUUA 1EEXA 3VI2A 2POTA 2KAUC 2ZE0A 1DE6A 1NU5A 3G8EA 5DLCA 3E6EA 5IBXA 1KXQA 3H22A 4L1XA 3W86A 4HA0A 3UR2A 3DH7A 2FZDA 4Y6GA 3VFCA 4KWWA 2FLIA 4H04A 4TV6A 1U83A 1CGUA 3IUDA 3LNPA 1GJPA 3MVTA 3P0WA 4H4IA 1EDQA 3GR4A 3GDRA 3CPUA 4HMEA 1M5WA 1SZNA 4RE4A 4XKYB 1RBAA 6ALDA 3PAJA 1CXIA 4MYXA 3N2CA 4DAFA 1DJWA 1FHLA 1EUAA 4ZL1A 3MDWA 4RNHA 2CITA 5H6HA 4AMCA 4J27A 3WJSA 4GYKA 3PN8A 4M7SA 5K9XA 4TMBA 4JXCA 3RO8A 3CUIA 3SY8A 1F61A 3PZUA 3SUWA 1Y5XA 4MFDA 1HL9A 4GUFA 3SRKA 3VFLA 3F2CA 4WRHA 2O9RA 1BLIA 4HNUA 5CQ1A 3RLHA 4JN7A 3HO8A 2VQUA 9XIAA 3PB2A 3LDVA 3AIRA 2VENA 3CJPA 2B0MA 1OM0A 3FAXA 3LCGA 3W2JA 4G8TA 1V8EA 3Q65A 4LCQA 3CUGA 3AJ7A 2OODA 4PEKA 1DIEA 7CGTA 4K36A 5JMUA 3N04A 2PP1A 1X1ZA 1B9BA 4EF9A 2FTYA 4ZQPA 2WKGA 1R7AA 3GAKA 5FSDC 3LB0A 4K68A 1MXSA 3BW2A 4LS0A 4HNLA 1XHGA 3WEZA 1WAWA 4EKJA 2AGTA 1XYAA 1ODZA 3QMRA 1LRNA 3C56A 1SMDA 3G1RA 4HK5A 4NX0A 1H09A 5FACA 1IGSA 4P7RA 1YKWA 4GYPC 4TO8A 3V3WA 4NI8A 5D30A 4W8AA 2D2OA 4NRSA 1FBAA 1T96A 3OTRA 4FAMA 3MBFA 3B04A 1GQKA 3UA3A 2PWUA 5I23A 3VOCA 2IXUA 3TN3A 3V0TA 1J0KA 3P60A 1XFCA 2ZICA 4CD6A 3H6OA 4AXNA 1OFAA 4IGHA 5CPTA 4JDYA 4F2TA 4E2DA 1JJKA 2OSYA 4R27A 1TX0A 1XKYA 4FXRA 2QCNA 4S3BA 3K2GA 4N7QA 4EXQA 4NNCA 1ZS2A 2PDFA 2VL4A 4H8NA 3W7CA 3VK5A 4JTFA 3FXYA 3MY9A 2X40A 1JUBA 2PB1A 3SECA 1A5UA 3TXVA 1V79A 3WDRA 5A6BD 5C9UA 4EWND 2F2KA 1ISZA 4MNJA 1H7WA 3TCSA 3E0VA 1HT6A 1P6WA 3GG0A 3QSTA 3BV4A 4GWEA 3W25A 3GNDA 4FIRA 2WJZA 3WJZA 4O0KA 4LCSA 5A8QA 3VGBA 4IGNA 1FH7A 3LA4A 3SIMA 3L5LA 1UR2A 1B54A 3UNTA 1B2YA 1TJ0A 2VDHA 1G67A 3VINA 3RX4A 2GQ8A 3H23A 3A24A 3LMYA 1Z7AA 2IS7A 3SFWA 1H1YA 4PSRA 3PPHA 3KRZA 4UXDA 1BG9A 2JF6A 3M47A 3TK7A 3EXSA 4L4PA 3WDJA 3B9EA 6REQA 3AALA 3GYCA 1PS9A 1SMAA 5B80A 3UWZA 2PS2A 3FW6A 4LU0A 4NILA 5BMWA 4TV5A 1XYLA 2FHFA 1TREA 1VFTA 2P5NA 3I6TA 3QFEA 3RMJA 1BVWA 2MANA 3MKCA 3M0ZA 1RBOB 4LCRA 3H53A 3OLIA 3APGA 4XBKA 3H2MA 1QVBA 4HA4A 2G0WA 3FDGA 4KT2A 4S1FA 4JICA 3SCPA 4QP0A 4R85A 2WHMA 3U9IA 2O0TA 4OT7A 3TEVA 4JTAA 4GA8A 3KDNA 3QZEA 1JQVA 2PDUA 2WPBA 3GNRA 4D1IA 1S46A 3E0IA 1LOSA 3MKKA 1SO3A 1EGZA 4NZ1A 1BYAA 4JKLA 1X39A 4UB9A 3ZOAA 1E0WA 4HIBA 4GFSA 4B3KA 2W4XA 1LL6A 1YE6A 3CHDA 3GWQA 4XVEA 1UH4A 2OKOA 2SFPA 4ZXLA 3W6YA 4JTTA 1UP0A 4UFMA 2OMAA 1N7KA 3UXAA 3NJ3A 1ZLPA 3QC3A 3SCOA 4BFAA 3HGOA 3CU2A 2E0PA 1UMYA 3W74A 4C5YA 1GHSA 3WQGA 1OFOA 4JDBA 5C2XA 5FJJA 5CCZA 5LNRA 1SFLA 1XM3A 3NDZA 4TU1A 3IJIA 3C2OA 3M4HA 2R1LA 3FVMA 4NYUA 1VRDA 4CLMA 4JY9A 4NYYA 1GGOA 1XSIA 4QAIA 1YDVA 3UY7A 1XLFA 4WGHA 4DEFA 2YYUA 3MI3A 3UVAA 4R5EA 2OZTA 3BJSA 1QHPA 1BSIA 5D02A 3N29A 4HBKA 3UVIA 1R3YA 3U3HA 4XAPA 2VC9A 4UTWA 3WBAA 4JTKA 3FGCB 3KCLA 4AWTA 2CETA 1GPFA 1WUEA 3WYZA 4NZ3A 1MQRA 1EUNA 1JL8A 3WUFA 3V35A 2G3FA 1VR6A 4AZCA 5GQBA 2D24A 2J6VA 2A2IA 3M0KA 3QY7A 2IQTA 2OYMA 4J3ZA 5AVNA 5DMNA 1XLEA 3OGRA 3USBA 3IGHX 1MO0A 3U0HA 4L64A 4UR7A 2QCEA 4MFEA 3MU7A 4AHPA 3G0XA 3UYCA 4ZQNA 1DL3A 1S2UA 4EAMA 3MT1A 2F9RA 3QY6A 4HA1A 2PLKA 3BLKA 4A8IA 1G0CA 1KM5A 2DUAA 2FFCA 3GZ3A 1M7PA 3OLEA 3ABSA 3EXRA 2CERA 3OZOA 2Y7FA 1OK4A 2W92A 4OUEA 4IFKB 4IJRA 3R1ZA 3HFYA 4C6FA 3BDKA 3S1XA 1W54A 2X8RA 2YB4A 1TCDA 1GVOA 1A0CA 5EA9A 3TYZA 3H2EA 2NWRA 4MYAA 4M82A 4IT1A 3RLVA 1B4KA 2D2GA 2V81A 3A23A 3AJXA 3CMJA 3ITVA 1L6FA 4QGCA 5E0FA 4G2DA 1KGXA 1YPXA 3LERA 4XG1A 1W3HA 2ZUTA 3L65A 1CX9A 3N2OA 1B4EA 2PDKA 3NL5A 3VIMA 2OSXA 3SCSA 1XJBA 4Z08A 5E9AA 4OIFA 2CC0A 3WBEA 2DY3A 1LZOA 3AIBA 1WOAA 2X2GA 1OABA 4MZYA 2PTWA 1HJVA 3AMGA 3EWDA 1O1HA 3RXZA 2BY2A 3TNOA 3HM7A 2YFOA 2DIKA 3BC9A 3IGSA 2Q6ZA 4NAFA 5KETA 3AC0A 4Q4KA 1WBJA 2V5BA 3BOLA 4DF0A 3K30A 1T8XA 1W3NA 1AMYA 1W5QA 3NIYA 4QCEA 3GTIA 4L4LA 3INPA 2GSHA 4KFPA 3W1QA 3SURA 1FWNA 5E5CA 3O9NA 2ZRUA 1B1YA 3W75A 2PUZA 3WLNA 1HJUA 4NHVA 5D2TA 2XTKA 4IP4A 1W8SA 4AAJA 3M5VA 2GGEA 3SRHA 1LROA 1X97A 1LQ2A 1MXDA 4BKNA 1FWAC 4IWWA 3EKLA 3WEMA 2XWDA 4IPNB 2P10A 4M7TA 1MEWA 4I9AA 6A3HA 4DUXA 4A8RA 1EX1A 4JTUA 2F38A 2F8QA 2IPGA 4H6QA 1WZAA 4EAYA 1W8GA 4ERAA 3TZFA 5D8WA 4L9ZA 1UZ1A 3TLLA 3OEXA 3KXQA 1QOQA 1K7XA 5MF5A 4BA0A 4MZ8A 4L1GA 4YVVA 1EH9A 3UWEA 3TJLA 4ECLA 1E6NA 2XH4A 3VZYA 3W82A 1WYIA 4KGLA 3EDEA 2ZXQA 1J79A 3O05A 2JGYA 4M29A 3DDMA 3BLFA 3MQTA 1KR0A 4DF2A 4QLJA 3WKZA 4DXKA 4C6PA 1BKHA 3S1WA 1Z69A 3KAOA 4UBPC 5K2ZA 3WQFA 5EGRA 5C0QA 1NP2A 1SZGA 5F2MA 3PY2A 1O5KA 3U5YA 4ONVA 5C7HA 3NR0A 4UQDA 4LAOA 3DC0A 2ZRWA 1KFBA 2B4GA 3AIVA 3VIFA 2HJPA 4FOJA 3POCA 2DZPA 5DXYA 2UY2A 3BAIA 2BODX 4QNWA 4B5TA 1R9ZA 2A7NA 1TPFA 1SZFA 3K8MA 1JZ3A 1PPIA 4H01A 2VFDA 3DHUA 3I6EA 3SY1A 4XAGA 4A3RA 2X7WA 5REQA 1W9VA 1CIUA 3ZR5A 4BHYA 4HTYA 4UFHA 3LCIA 3R79A 3UW6A 1GTHA 1TV2A 2FHCA 8A3HA 3ZT7A 3ZYZA 9CGTA 2YXGA 2PBGA 1BWLA 1D3GA 2BOFX 3C61A 1OY0A 4CD8A 1F07A 1V6VA 4M3PA 2XFFA 1EXPA 3WQCA 4V33A 4ERIA 3YPIA 1E6XM 3UG4A 4FOUA 1B31A 3CS2A 4O1FA 3MKVA 3SW6A 4NQ1A 4QSHA 4PMQA 1X7FA 1Q65A 3ES8A 3P5YA 2P8CA 5BRQA 5HINA 5E70A 3OU8A 1S2CA 4KEZA 4PUKA 1AH0A 2NQZA 5DCEA 1E56A 4O53A 4LBSA 4MSSA 2V5JA 1RJPA 3IIVA 4D1JA 4IIFA 4EE9A 3TSDA 1WV2A 1V6UA 2EPHA 3MHGA 3R0DA 2R24A 1F73A 1FHDA 1Q6GA 2Y63A 4KWSA 1UKTA 4OTKA 1AH4A 4RZ6A 1T8QA 2W63A 4AH7A 3ICJA 3ABXA 4Q8MA 4ZQCA 2QJIA 4JIHA 6CGTA 4GY0A 4HZMA 2ACUA 1JYVA 1GHRA 1V7YA 1KD0A 3S83A 1MUCA 1FQ0A 2O9TA 1ZUAX 2WZEA 5GPRA 4ZBCA 2PDMA 4UQ9A 4DY1A 1DEDA 1KV8A 2DT3A 3FX4A 3AYVA 1B5TA 2ZA3A 3LYEA 3LXAA 3CTTA 3N14A 3EPNA 5D03A 3N2MA 1OIMA 4C90A 1MW2A 2F2HA 1UHVA 4WY0A 3DX5A 3WQDA 1O60A 3F5KA 1WZKA 4KMQA 1AW2A 1I2PA 1Q7MA 3I7SA 4LUJA 1W1PA 3HQ1A 3R6IA 3O6AA 5U4NA 1IZCA 1UKOA 3I3EA 4GUJA 4CCCA 2NV2A 3MSRA 4ZMGA 5I02A 1XIEA 1JCJA 2WNZA 1XKJA 3P74A 1QNRA 1RY0A 1EO5A 5EPDA 7ENLA 2ACQA 1O5RA 3N6QA 5C2CA 1EP3A 1GKQA 3UJEA 4D6IA 4ATWA 4DBDA 3OVRA 4EXAA 4U3CA 5ABHA 4KRZA 5FF0A 4OHQA 1MRQA 2FDMA 4M6VA 1IWBA 3BE7A 1KRCC 1R3VA 3MCMA 3KBMA 3NSXA 4QITA 5C6MA 4EIVA 3W00A 3GR8A 2WQPA 6TIMA 1J6PA 1E3ZA 2ZA1A 3NXFA 1C8QA 3GHSA 1RV8A 1RK5A 3MYOA 3FA5A 5CAKA 1XF0A 1GJUA 1SVDA 1FWCC 1JGMA 1OZQA 4KIEA 5HK4A 1QBAA 3KVMA 4PZVA 3T09A 4B9YA 4JFWA 5KMYA 3IK4A 4F0LA 2CHOA 1ZJHA 1LCOA 4UTFA 2B7OA 1UWAA 5AZ0A 3VNYA 3NPWA 2O7SA 4WGXA 4MB5A 4ZXOA 4EF8A 4QE1A 4GLEA 4HN8A 2L5HA 1IEXA 4F0MA 2ISDA 1ADOA 1VYSX 4LXFA 2H8ZA 1GVFA 4PFHA 4LUSB 3RR4A 1UIPA 3PK7A 1ITQA 1GTEA 2J47A 2I57A 2BXZA 1O95A 3CZKA 1KKOA 3QZAA 5JH1A 2DU2A 1B0IA 4PUUA 2DT1A 3WFAA 2PU1A 4NI3A 4O12A 3HBLA 4ZO6A 3KTXA 2OLSA 5D9OA 4S3CA 3CQHA 2RDUA 2XVPA 3W7QA 3CQIA 3U2ZA 2LLEA 2W91A 3W3OA 5LZLA 4CNUA 3ZJKA 4UNIA 5DCDA 4F2BA 2A1YA 1A80A 4REQA 5DRIA 5F4SA 2QV5A 3GW3A 3VIPA 3IUHA 3M5XA 3UWQA 2W67A 4NXKA 2B31A 2J66A 3G0SA 4MB1A 2GYIA 1E9LA 4BQ2A 2REQA 1V0NA 4JD4A 5CPNA 3VGDA 1W3KA 4LUTB 3ALGA 2ISSA 2QDDA 4PRRA 3GB6A 5CGQA 2BBFA 2X0HA 5H8UA 3WF0A 1E55A 3WQWA 1P4CA 1NF7A 2DIEA 3LBMA 1RP8A 1FTXA 3LHYA 1XX1A 3THUA 4GRSA 1TFVA 4C1LA 2CLHA 2HVOA 2BX7A 5GJMA 4ZQMA 1I2OA 2Z1KA 1KCXA 3RYSA 1VFFA 2YCEA 3GR7A 2VEKA 4NY2A 2Y85A 2Y8VA 1LYXA 2XFYA 3GYEA 1EHNA 1V4YA 3M0HA 4Q4OA 5CSUA 3DKLA 2Q3RA 1JF5A 2ZX6A 2QCDB 2BHZA 3W7IA 1PIFA 1ICSA 3SN1A 4HD5A 3TW9A 3LV6A 4RE3A 3ZM8A 2FTPA 3TJ4A 3B9NA 3UF9A 3NZPA 5C2GA 2CPUA 2E7FA 2NW0A 4H8UA 4C6DA 4HMCA 1KC7A 2XN0A 4A8LA 4JEQA 3PWGA 3CAVA 2G5WA 3PPCA 1YTEA 2WC4A 3ITXA 3BG9A 1PWLA 3WDPP 4FLQA 3TN5A 3M7WA 1LG2A 3ZLFA 1DJQA 3EX3A 4WK9A 1FCVA 4JPGA 4B5WA 1Q63A 2HVNA 4OECA 3NM3A 1HKKA 1FWRA 1PIIA 1LG1A 1WZMA 2WHLA 1F6YA 4MZ1A 2QKFA 3LLFA 4MWAD 1CWYA 3SCRA 1W9UA 3TNBA 3NL6A 4US5D 3L0GA 3KL0A 1S1PA 2RGLA 3M16A 3S2CA 2V3DA 5CSYA 4XBJA 2ZRYA 4JQ1A 2JALA 3O3RA 3S5OA 2H3BA 4Z2LA 4LUIA 1X6NA 2Q8XA 3GDKA 1MMFA 4LBRA 2VOTA 5I24A 1ITCA 2CFFA 3N6HA 3VAVA 1KNWA 1T5AA 5AC4A 2XN1A 4XKMA 5HUPA 1NIUA 3MBDA 2QJJA 3F03K 4WJXA 1P0EA 3NVTA 3URAA 1HVQA 1R85A 2JKAA 2JF7A 2TAAA 1SW7A 2HRWA 2B7QA 2Y5JA 1DQUA 5HUOA 1SZEA 3TZNA 1BSLA 3RJYA 2GFTA 3AS2A 1RSCA 2W62A 1JCMP 2A3AA 5AOUA 4DYJA 4BF7A 1CXHA 4YWIA 1H1NA 1TPB1 1TE1A 2R82A 2FZ8A 3SGGA 4QQUA 5C8BB 1LORA 1TPH1 2G3MA 3QQWA 4PGLA 4UMBA 1GVRA 1TPWA 4M51A 1EP2A 4I9MA 1V6YA 5EMJA 3UR5A 3AHTA 2YL6A 3THDA 3R0KA 1K9DA 3NWRA 3E0FA 3F4CA 1TJPA 3W4RA 2GJXA 4B5UA 2FH6A 2ISVA 1TYGA 3VDCA 4FEZA 3VKBA 4M6PA 4U33A 5A8OA 4O57A 3ONBA 4N4PA 1U2YA 4H9VA 4C1NB 1WOBA 2HTMA 4ML4A 6PTDA 1VYRA 3BGAA 1VFMA 2Y7DA 3G1DA 1PZ1A 4PSPA 1OINA 2OFJA 1XR2A 4GKTA 7A3HA 3WX7A 3VA8A 1LJYA 4X60A 2X42A 5TQLA 1KFLA 2ACRA 2ZUSA 3BSHA 1CGVA 1DBTA 3FIGA 5LSMA 3QV9A 4J3XA 1PX8A 3DEQA 1JD9A 2NX1A 2VD8A 4GIEA 1OD0A 1QXLA 3AS3A 1OCQA 3C2YA 1WX0A 2IPFA 1HJSA 2TPSA 2HZGA 3A6OA 1OGSA 4MLJA 3UXDA 1ZPTA 1XYFA 2ZC1A 3BW4A 1UA3A 2VUYA 2YW4A 4U5IA 3TQKA 3U8GA 4HZ7A 3SUSA 7PTDA 2ABBA 2WJEA 1L6GA 4JYDA 3WO8A 1M01A 4CCZA 4Z2KA 4N42A 4IPPA 1BEUA 2E1WA 4QROA 1Q4WA 1QWGA 5HDRA 1EIXA 1IYXA 3LNMA 4UQAA 4LAMA 3VZXA 1EF2A 4AVNA 2FJKA 2VQTA 4E3VA 1B90A 1DYSA 3P61A 4C6MA 3UXKA 5CZKA 4X2PA 1XGEA 1W1ZA 2Z1SA 3WENA 4HHHA 3GDTA 3M0IA 5TF0A 1Q6CA 1UB3A 2VFEA 2FB3A 4PUWA 1KQZA 3S5YA 4C7GA 4CNNA 2JGQA 1EPXA 3G24A 2Z28A 5DRCA 1V6XA 3UETA 1KGWA 4O18A 4AB4A 3TR9A 2QF7A 3AIQA 4NZ4A 5DY3A 1LT7A 4GXWA 1R2TA 4ZE5A 1HQTA 3BCDA 2OEKA 4JAWA 2XG9A 2CZEA 3V5FA 1WBHA 2E5BA 2J6XA 3O15A 1DQWA 3JR2A 4D72A 2DW6A 1HO4A 1W3IA 4E4PA 3VILA 2GDVA 3ITLA 1OF6A 4M8UA 3V1HA 1LUCB 4US5A 4E8GA 3RPMA 4ROQA 3USZA 5KITA 1VJZA 3AIWA 1A47A 2A3BA 3TV8A 3B05A 3PZOA 4A8NA 2CXGA 4MG4A 4HZ6A 3WQ5A 2CLFA 5C5YA 3BMWA 4L61A 4P7QA 3EXTA 4AX7A 3PBMA 3WBYA 2VRQA 4WVXA 2CLPA 4HB7A 1FWGC 4ZB2A 4E8DA 1EFZA 1TIMA 3W87A 3OO2A 3ID7A 3UR7A 4L56A 4WJEA 1RH9A 3CV7A 4DI8A 5HR6A 3LX9A 1KCZA 2UBPC 3C2FA 1HX0A 3T4CA 2QJNA 3MV01 1GVQA 1GKRA 1YIXA 4L6HA 1F3XA 4IICA 1BQGA 5I2UA 2W61A 4LPCA 1CW2A 4MJMA 3DKJA 2XM2A 3ARTA 3S2LA 1V93A 1H5YA 2DORA 5FEZA 2JKEA 3L12A 4PUNA 4MF4A 4IGSA 2H9AA 1NWTA 4MNLA 1ENUA 1J12A 3MO4A 4IM4A 3COTA 3R25A 2F84A 2ADAA 1PE1A 4Z2IA 2X05A 3W1XA 3LU2A 4B5NA 4LB3A 3AROA 3W1LA 3OW1A 4QEEA 1W31A 3QKEA 3CWHA 4JEJA 4K8EA 2WMHA 4AD0A 2WPGA 1V3KA 3F1QA 2BV9A 4C7DA 3EWYA 4GGHA 3QYSA 4L4MA 2V5LA 1T7LA 1UBPC 3W1TA 1UD8A 1L6YA 2EKCA 1MZRA 2H90A 4IZGA 3W84A 1NDVA 4Q7IA 3SRDA 2VFIA 1HP4A 1SPQA 4S3AA 4K6AA 3DFNA 3W7HA 1UWIA 3T2PA 1QHOA 2C91A 1I45A 1J4EA 1YW1A 4DLFA 1EZ2A 3PTMA 4Y9NA 2V3EA 4EPDC 3MUCA 1SFTA 1GK8A 1P0BA 1T41A 4RX0A 4IMFA 1IZKA 3WF4A 2AOSA 5CJMA 1N82A 2VZUA 5H8PA 3LK6A 3VGHA 3ZJ7A 4EPBC 4MWAC 3NO3A 1WCGA 3OZYA 3QR0A 1XYBA 3KS5A 3G6MA 4D6JA 4AIEA 3W81A 2Z29A 3NQEA 1TTQA 4V27A 1NTHA 2HROA 2WC7A 1TZ9A 2CBVA 1OT1A 3TMLA 3H7VA 2VFGA 3P80A 1VPYA 3L2MA 2VR5A 1W2PA 4WY0B 1BTCA 3C0QA 5TD4A 3PTQA 1PKMA 1LLZA 1GQNA 4DJEC 2QCCA 1KM3A 4ZA0A 3LENA 2QQ6A 3KWXA 5REQB 3OG3A 1JZ6A 1ZSXA 4HK6A 2FIQA 1IEIA 3RRAA 1GOMA 4XAFA 1OT2A 1QI4A 4J5NA 1NFPA 3BGJA 3FS2A 4G7EB 5LXXA 3T6CA 4MY8A 1H1ZA 4WDXA 1JVNA 1JQXA 1XCFA 1O7AA 4JY8A 3PBWA 3QSRA 4I9TA 3LPPA 3BARA 4AF0A 4PODA 2YL5A 2FHBA 1VAHA 1PDZA 5DFAA 4JTCA 1QI2A 4LS1A 4HJFA 2FPVA 1E0TA 4GBDA 1TIWA 2C7FA 1R47A 1FFRA 1SJBA 2V68A 1HGWA 4TVDA 4DWSA 1G7UA 2DUXA 2CZFA 4IHCA 4AC1X 4PTNA 3W9ZA 1OX4B 3G77A 3W7MA 1GVEA 4GQ0A 2HEJA 2BWGA 1J0HA 2WSKA 1RALA 1VF8A 2DSZA 3AZRA 3O6YX 5AC5A 3KVJA 1QK2A 2ZTJA 3I7RA 3G0UA 1ZENA 1A0EA 3P82A 3QR3A 1K8YA 4LNCA 4GOAA 2OYKA 4OFCA 2HCVA 5IDZA 1XIGA 3GU2A 3AWNA 1IEVA 3NGJA 1MZHA 3GW0A 4DJDA 4PB4A 1JDFA 4O50A 1BFNA 2PI6A 4MTVA 2E6FA 1IR2A 3H4WA 3IJ6A 2BVWA 2PLCA 4QBXA 5BXSA 1D3HA 3H26A 3KL5A 4AYGA 4IIBA 2EPKX 1KBBA 1DWJM 3NPVA 3NURA 5BU6A 1KWKA 2FGLA 5FJTA 2F6UA 4B3ZA 4O1CA 3Q45A 1KCKA 4F40A 4DELA 1V08A 1OADA 3EB2A 2PDWA 3QTPA 3N2TA 4FXFA 4BS0A 2QVNA 4H1ZA 5K9DA 3UCDA 3F4NA 3L67A 4RDVA 3S3GA 4FF5A 3UERA 3WDIA 1RPXA 3HURA 1FCBA 2J7EA 4MJ4A 1X6UA 1QMLA 4PN2A 3VUSA 4LOCA 2WSYA 1JPMA 3W28A 2I17A 2EBNA 2CXEA 2Q3OA 1J18A 2BASA 2P3ZA 2GLKA 3R5EA 5F4XA 1E4IA 1JNDA 2DZBA 2R9RA 2AMXA 5CC3A 3TOPA 3FYOA 1LF1A 5MKGA 2Y7GA 4HN4A 3FJ4A 4WD0A 3OVGA 3MW7A 1XIHA 3G1HA 5CBIA 2IMRA 2Y88A 2YBTA 3WDHA 3W2LA 3TA9A 3P81A 4PTVA 3RCNA 4H41A 1LDCA 1C92A 4Y2WA 2BHYA 4ZENA 3OYXA 1PKYA 4LVAA 4X61A 2BOEX 3PJWA 1JAKA 5IOBA 4QHRA 3AHXA 3MMDA 4AVFA 3A12A 3MP3A 4ADTA 2PWGA 2YA0A 3CZJA 4I8YA 3ARPA 4C6OA 2V8ZA 3UG8A 4JIPA 4HPGA 4HYWA 2RKXA 4PBGA 3RU6A 1H7OA 3T2OA 4DJFC 4ZFCA 1E4MM 3QW3A 5F2GA 3CUZA 1CDGA 1ISWA 5HXMA 1M7XA 3TH6A 3W2NA 5ECUA 2F7FA 3N34A 1YXCA 2CBJA 1GCYA 1YNQA 1M6JA 2EG8A 4D6GA 7ODCA 4CU8A 5FOOA 2QF8A 1EJWC 3REQA 3II1A 3WD3A 2GL5A 4AEEA 2PF8A 2Z2BA 2EJ1A 3UZYA 4RW3A 4E3TA 2G41A 5TBOA 4Y8EA 3PNUA 3REQB 2GVGA 4L6DA 4AF0B 5BOEA 2PTZA 4RZBA 1I0BA 2W6RA 3WUBA 3PBUA 4FR6A 5GNXA 3F2DA 4RNFA 4RDZA 2C1IA 1MRAA 3GTNA 2XGBA 3MVIA 3VGFA 1FOBA 3G1VA 3OPSA 4Z1YA 3KBSA 3P5ZA 2YXOA 5I09A 3BAKA 4F0KA 2O9PA 5AY7A 4RPPA 3VNJA 2WVVB 3C3UA 2E8ZA 3UD6A 3LOTA 3AWOA 1W56A 1VFSA 1X96A 2Z1VA 2IKGA 2FVKA 1MEIA 5CZSA 3W7EA 5G1YA 4TVCA 3QKZA 6TAAA 3LTPA 4ENLA 5F4WA 3HOJA 4RZ4A 4CEUC 2J74A 3S5NA 4WSJA 4NZ5A 2YA2A 3FVDA 1VFUA 1K03A 1X38A 4NJHA 3GIPA 1O1ZA 7TIMA 3C3NA 3BZJA 1PAMA 5A95A 1RA0A 3TSMA 3WD2A 3U2EA 3IACA 2D3LA 4JBRA 3B8UA 3KBNA 4W7UA 5I3JA 3WQ4A 3CWOX 3R89A 4YCOA 4P7NA 2F6KA 4LYPA 5DQPA 4GQQA 3WJXA 2RDTA 3LY0A 1KLYA 4W7VA 4W8LA 2RDXA 3W24A 2QAFA 2WZMA 2G8ZA 3FA3A 2VDGA 4GZJA 3HGJA 1IIGA 1LUCA 3ITYA 3N1AA 1M03A