3CQIA

Crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with sulfate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
277
structure length
277
Chain Sequence
KQIPLGIYEKALPAGECWLERLQLAKTLGFDFVEMSVDETDERLSRLDWSREQRLALVNAIVETGVRVPSMCLSAHRRFPLGSEDDAVRAQGLEIMRKAIQFAQDVGIRVIQLAGYDVYYQEANNETRRRFRDGLKESVEMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLKQSGYCGPYLIEMWSETAEDPAAEVAKARDWVKARMAKAGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords L-ribulose-5-phosphate 3-epimerase ulaE
publication title Structure of L-xylulose-5-Phosphate 3-epimerase (UlaE) from the anaerobic L-ascorbate utilization pathway of Escherichia coli: identification of a novel phosphate binding motif within a TIM barrel fold.
pubmed doi rcsb
source organism Escherichia coli
total genus 110
structure length 277
sequence length 277
chains with identical sequence B
ec nomenclature ec 5.1.3.22: L-ribulose-5-phosphate 3-epimerase.
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3cqiA00
1A0CA 1A0DA 3KWSA 3ITTA 1XLAA 3C0LA 2GUBA 1CLKA 1XLKA 3ITOA 4GJIA 1OADA 4HNOA 4QDPA 9XIAA 2XISA 4XIAA 3FVMA 1D8WA 3BANA 2G4JA 3C0SA 1GW9A 5XINA 3DX5A 3QYSA 1MNZA 4EAYA 1XIIA 4K3ZA 1XYAA 5H6HA 1XLEA 3M0HA 3L23A 4YTQA 2HK0A 1QT1A 2HCVA 4J4KA 1XISA 3P14A 1XICA 4YTSA 1XP3A 4KW2A 5XIMA 3UA3A 1O1HA 1DIDA 9XIMA 4ZB0A 1I60A 1S5NA 3QXBA 4EACA 1YX1A 3ITVA 1XLIA 1QTWA 1XYMA 4DUOA 3KCLA 1XLHA 3KCOA 3U0HA 2G0WA 2GVEA 4QE1A 3AYTA 1XLDA 3CNYA 3BWWA 3IUIA 3VNMA 4ZBCA 4QEHA 6XIAA 3M0VA 4A8RA 1XIJA 4QDWA 3KTCA 3M0YA 5I7GA 1TZ9A 5H1WA 3M0MA 5XIAA 1MUWA 4LNCA 2ZVRA 4X63A 3XINA 1XIGA 7XIMA 4A8NA 1XYLA 5AVHA 5C9ZA 4X60A 3M0LA 2GLKA 5B80A 4X61A 3AAMA 4HGXA 3NGFA 5EMJA 2X7WA 1DE6A 4YTRA 5B7ZA 5TNVA 2XIMA 3BZJA 3DBNA 1XLJA 4QE4A 3VNIA 1XLFA 2GYIA 3XISA 4K1GA 1XLLA 3VNJA 1BXCA 3KBVA 1XIMA 3KBSA 3ITYA 3KCJA 1A0EA 2QUMA 4US6A 3TVAA 4GJJA 5EMLA 2Q02A 3VNLA 1XIBA 1BXBA 3TC3A 3LMZA 2I57A 3ITXA 4HHMA 3UVAA 3VYLA 2HK1A 4YTTA 1I6NA 3BDKA 3KBMA 4A8IA 3KBNA 4G56A 1XLMA 3M0XA 5EMKA 4W4QA 6XIMA 4HHLA 1XIDA 3VNKA 3CQIA 1XLGA 3GNXA 3OBEA 4E3VA 4GQBA 4XISA 4XSMA 4XKMA 3JU2A 4PGLA 3KBWA 4OVXA 5EMMA 1DIEA 1DXIA 3AYVA 4ZB2A 5J8LA 2OU4A 4ZB5A 1XYBA 1XIEA 3IUHA 8XIAA 3N4AA 4GLEA 1XINA 1XIHA 2J6VA 4PFHA 1S5MA 3U3HA 2QUNA 3CQKA 2NQHA 3UA4A 3C0QA 4QE5A 3UU0A 3CQJA 5FA5A 1XLCA 3AALA 1XYCA 3QZAA 3CQHA 3IUDA 3QC0A 2XINA 3KBJA 3XIMA 1XLBA 5AVNA 4DVOA 3CWHA 5B7YA 3BZGA 3UXIA 2NQJA 4A8LA 4XSLA 1QUMA 4XIMA 1XIFA 4Q7IA 3P6LA 2QULA 2NQ9A 3WQOA 1K77A 2I56A 2QW5A 2ZDSA 3ITLA 1DE5A 8XIMA 4YTUA 4QEEA 2X7VA
chains in the Genus database with same CATH superfamily
1M01A 3UPMA 1UA7A 1FWTA 2VFEA 4NUWA 3ENLA 2A7RA 3VKAA 3V5OA 5C2XA 7CGTA 3I7SA 2E5DA 2DUXA 4PTVA 2HQAA 4KW2A 4H7VA 4AVFA 4DNHA 5HBFA 3W26A 1V6UA 1EPXA 1T96A 4PMXA 3DKLA 4MUPA 1E6ZA 4WEVX 5D37A 5CG7A 3QSRA 5K2ZA 3MBDA 1KCXA 1WDRA 1VENA 5C9ZA 4B4HA 3AU2A 4FOJA 3GVRA 2Z24A 1ZUAX 2F61A 4AB4A 1XH0A 5HULA 1VH7A 1YMYA 4PR4A 3SN1A 3CH9A 1XLFA 2WQDA 4FXJA 3V1PA 3TFCA 4IP5A 1BVNP 2VR4A 3LMZA 1VYSX 4GY7A 1RJPA 2QPSA 1V3IA 2G3JA 5SWUA 4C1LA 3ANUA 4KGJA 3BOLA 5PTDA 2QPUA 3SCPA 4LAUA 3L4XA 3C2EA 4J3WA 3IUHA 4C6KA 1UZDA 4H9UA 2JBMA 4B91A 2VTFA 2A3BA 4GINA 1PL9A 3WCZA 3IJ6A 2OX4A 1MQQA 4IQDA 5CSYA 2BGQA 2HTMA 3R4IA 4JN8A 2VMFA 1PX8A 5HWMA 1A3WA 1NJJA 4KETA 4H7ZA 1VB9A 4NI3A 3LZ3A 1LWHA 2GDQA 4UCGA 3KFTA 2PLJA 2FGLA 1QT1A 1EWDA 4PE8A 1S5NA 3AOFA 2PDGA 1OCBA 2PP0A 4H9ZA 4Y96A 2D0FA 3QY6A 1K4GA 4GYPA 3AMCA 3DENA 3TWBA 3EX6A 4R34A 1DXEA 3H26A 1EDGA 2GJXA 2VP8A 4AEFA 3NQ8A 1KXQA 4RZ6A 3T07A 5M1TA 2ATSA 4HNVA 3FEQA 3F4CA 2J9YA 2DZXA 4C6MA 4H01A 1V79A 4O1BA 4IQLA 2CLHA 1BXBA 3B8TA 4C7GA 2PU0A 2PDBA 2OLHA 3VDGA 2DH3A 1E40A 4DWSB 4W4QA 4DI8A 2CEQA 1NU5A 4UBPC 4ZE5A 1BTCA 1REQB 1TJ0A 2DUAA 5FEZA 3C4UA 1FKWA 1YPIA 3I4KA 3FYOA 1W1YA 3MMWA 4AVOA 1PPIA 2YFNA 1K9TA 3TQPA 3SRFA 3L9CA 4M24A 1QI5A 2YX0A 3UXDA 1OB0A 3RO6A 3WQVA 3BCJA 5J5DA 4IFKA 1E9IA 1U33A 4B5NA 2QPXA 1P0NA 2BOGX 1UWRA 5AHMA 2W27A 2PRMA 5E09A 3GH4A 2LLEA 3L5LA 3O6CA 3DFNA 1RY0A 1BD0A 5AYZA 4CQAA 3OTRA 3SW6A 2TPSA 4ADTA 1SSDA 4EXQA 4TTUA 3UGVA 3LPFA 4WIWA 1KM2A 1VBUA 4U3CA 3HZ3A 3PZOA 4WGHA 1QWGA 1N8FA 2A3CA 3GFZA 2J78A 3A9IA 1WB0A 3N2BA 1YTDA 3M0KA 3BG3A 3UCQA 2ZADA 3REQB 3TVAA 3LCXA 3NPVA 5EMLA 2Q02A 2ZRWA 4IMAA 4Q8MA 1OZMA 2I57A 2WNWA 2OT0A 1MRQA 1LQAA 1CXIA 7REQB 4TXEA 1R47A 2J7BA 2R24A 3FGCB 2PWGA 4PL1A 4ZGYA 1KM3A 1W5OA 3HQOA 4UZSA 3KTSA 4A8LA 4IWWA 3ZYZA 2PWUA 1XRVA 3GC2A 4BY3A 1A0DA 1E1FA 4AD0A 3HPXA 4J2MA 5K9XA 3W2MA 1OYAA 5F2IA 3EDJA 4C5ZA 1VBHA 4JXCA 3TDFA 1VF8A 4HZ6A 4CQ9A 3H12A 3KVKA 2XU2A 3CC1A 2IQDA 4IG2A 3S4TA 4PCSA 3CV7A 4PUKA 3KCLA 1DJNA 3LHVA 3SZ8A 1FP8A 6ENLA 1RVKA 4X63A 4Q8VA 5AECA 2BB0A 3HPFA 5EFDA 1ZSXA 3Q4DA 4ILSA 3PWAA 4Y90A 1ZS2A 2VEKA 6PTDA 3QZEA 3Q94A 2GYIA 2Z2AA 1ZRQA 4H9MA 4GI9A 2Z28A 4GVFA 1MVYA 1MQRA 3SRHA 3VYLA 3EBVA 4C6QA 1GQJA 2DZVA 4N02A 4GD0A 2W4XA 3AYVA 4IMDA 1XS2A 3W76A 4MLRA 2J6VA 3L4WA 1EP1A 1IEXA 2QEZA 3W7KA 4L65A 3PTQA 3T55A 2VZTA 3DEQA 4H9TA 5ABFB 1Q45A 1V8EA 2IS7A 3GKAA 2RH9A 3LGEA 4G9PA 3TV8A 1KXVA 4MTVA 3BE7A 3G22A 4OUEA 1J0YA 1FQ0A 5E1QA 2NQLA 3RAOA 5FCZA 2C16A 3LXCA 1V3LA 3GBEA 4MZ1A 2B4GA 3TYCA 4HU3A 4OBTA 1O5RA 4UB9A 4NQ1A 5HQLA 3SDOA 3F2BA 3HMJG 4M7SA 5C2GA 3IUIA 3WQPA 4C6IA 3G0UA 1M03A 4GXPA 2W61A 1R3TA 6REQB 1E6SM 3G1DA 2TMDA 4F48A 3VDBA 1MWOA 3V4BA 1GVOA 3V0SA 4KFPA 5BWFA 3QN3A 5I3IA 4L64A 4QBXA 4GJ1A 1HGYA 1IIHA 3GTFA 2FZ9A 4ATLA 2IQTA 2NV1A 3MB9A 1E0UA 1RQHA 1WDDA 3UVAA 4MWAB 3DFYA 3RPDA 3SUVA 3W1XA 1I1WA 2W5FA 2IPGA 4LFYA 3RLUA 2PDKA 1Z6KA 2DVTA 2VOMA 1KTNA 2FVMA 1EF2A 3UWZA 1ITUA 1TZ7A 2VFFA 3INPA 1RLCL 3DYPA 5FA5A 1F74A 4JZ5A 1IHIA 2FJKA 2IPFA 3IGHX 3AS0A 2OYMA 4PMYA 3BQ6A 3P81A 2ONEA 2WC3A 3TSBA 2ZUMA 1T40A 2PLKA 4QDPA 2OWWA 1OADA 4WCJA 4AVNA 3QH2A 1CECA 3FJLA 2XVPA 5BMXA 4LPCA 2QDEA 3IPWA 4A3YA 2HDJA 3CL7A 1IZKA 4CD8A 3UG3A 4R7OA 4HYWA 4RE0A 2ZRYA 4JPGA 5TBOA 1CDGA 2WV8A 4LAOA 1PEZA 2VC6A 3GUGA 3WUBA 4M56A 1D8CA 1I2QA 3G5EA 1DJWA 4PMOA 5CC5A 3S9YA 1EPVA 3ZLFA 3U4AA 2FH6A 1IQ8A 3W84A 1RK5A 3B0VC 3L0GA 5BOFA 4CD4A 5DMYA 4PMZA 3WJWA 3V5FA 3AHTA 1Q66A 3CV1A 1YBQB 1XXXA 2OZ0A 2XIOA 3C3NA 3VNKA 1KXTA 4I9MA 3AZRA 3WQDA 4PN2A 1TWIA 1J2BA 3WDIA 3EDFA 4LQ1A 3SUSA 1UMYA 1SGJA 1TVPA 3C5QA 4DYEA 2PD5A 4LAMA 5HR7A 3H23A 4US5A 3SO7A 2VI0A 1B3XA 3SCVA 4AG0A 1PJ9A 1ITQA 1OJXA 5M03A 4JFTA 4N4QA 5A94A 4J3ZA 2ON3A 1OSEA 3P80A 3KOFA 4JEJA 1UASA 5BOOA 2VEPA 5FEWA 4ZO8A 3W4RA 1KV8A 2WO5A 3FVMA 3RFAA 4M3PA 1K8ZA 1RH9A 1R3WA 4Q4KA 5LNUA 1BFNA 1XBYA 5HJLA 1Q6LA 2YKKA 2REQB 1US0A 3HGSA 1UA3A 1KGXA 2FQIA 3VA8A 4Q6JA 3CV6A 4NZFA 3T6CA 4B5UA 1E15A 1DBTA 1UD3A 1W5NA 4LRSA 4C6LA 1TWZA 1EH9A 3IWPA 1F8MA 1RP8A 3W1AA 3JRKA 1S2VA 4HYVA 3M9YA 1RZMA 3NZPA 1EO5A 2QCGA 2XIBA 1GNXA 1V0KA 2CZVA 4ZVJA 1LG1A 4V28A 3F4VA 4PEKA 5IDIA 1E4MM 3B97A 1RPKA 4YYFA 4JY9A 2NV2A 2HEJA 3BGAA 4JYFA 1NVMA 2C71A 2ZXQA 5FACA 1W9XA 3MTWA 5FJJA 3FXYA 5J8LA 3V35A 1OD8A 3C61A 1MXGA 2VR5A 1WXZA 4H8UA 3DG3A 3VUPA 3CWHA 1B54A 3LPPA 2FHCA 5DCDA 1XDLA 4NIRA 3H2NA 2FVKA 1ZB5A 2J7FA 2X0HA 3O9NA 5HNNA 3FN9A 3UNTA 3RILA 1RLDA 5KEZA 2L5HA 2WKJA 3SFWA 3MANA 1VCGA 2ACRA 3TAKA 1W32A 5K9CA 3SJ3A 5IFPA 1GUVA 1RXOB 2BMBA 4GG9A 1JYNA 4QEHA 4XK2A 1YHTA 4XTDA 3FK4A 3A23A 8CGTA 3TLLA 1F5ZA 3AXIA 3TCEA 3GVWA 2BGNE 3JZUA 1UWAA 4IGNA 3MWCA 1PBGA 2BTMA 2D20A 2HSAA 3W1PA 4KBXA 4DXXA 2C6QA 3SSZA 1S5TA 4MWAE 4O11A 5D8WA 3S5NA 1W9DM 1UW9A 1QNQA 3LHYA 3KW3A 3HF3A 1XI3A 5IXEA 5CSRA 1L6GA 2WLZA 3MV01 2J75A 4IQJA 2FIQA 5EL1A 2Y6ZA 3U2CA 4RNHA 2CZEA 3MKKA 2XINA 4S2CA 4O4VA 4HP5A 1QK2A 1TPWA 3WBXA 2YCIX 3S1GA 3TWAA 1QW9A 3PZIA 2DU2A 4QRNA 3S2MA 4LF2A 2X05A 2XISA 3NPUA 3SIMA 4DY1A 2D2HA 2WXDM 1ZAJA 4IJBA 1IT7A 3IGSA 4DIAA 3HQ1A 3PZ9A 3OIXA 2DJXA 4P7RA 4O19A 3T8LA 2V3EA 2OLSA 4FXRA 2XFYA 4IIDA 3S2LA 4Y8EA 1MO0A 3SCRA 3U2OA 4PUEA 4W89A 2DSWA 3ZWSA 4AD2A 4E8CA 1F61A 1Y8BA 1JF5A 3VIKA 2PGWA 3NDOA 3IIZA 1VFUA 2CYGA 2W79A 4AF0A 1KKOA 1FVPA 2YZ5A 1JCJA 1J2WA 2J7CA 3BTNA 3SCTA 1JCTA 1UD4A 3GYCA 2QJJA 4JQAA 2J8FA 1F6YA 4PCFA 2H8ZA 4D6FA 4PB5A 1QRQA 3G2GA 3WQ8A 2C1IA 1EA9C 3Q58A 1LM1A 3I68A 2PE4A 4YU1A 3EB3A 1ZJHA 1E73M 1XUUA 2OSXA 4UTLA 3OG2A 3GAYA 3H21A 2J4GA 1DIEA 3OBKA 3KHDA 4U3AA 4Q8PA 3VZXA 4LB4A 4DB7A 4J9JA 1R5YA 2WMIB 2DT1A 2HS8A 1OFDA 1L6WA 3IK4A 4WJ8A 2ISWA 1FFQA 3RLHA 4JTHA 2WVSA 2WJFA 3ARSA 2PF8A 4RPPA 4C6JA 2B7OA 4Q4OA 1E6PA 3AU6A 4Y9OA 3SCSA 2A4AA 2TYSA 2FDSA 2PWDA 5FEPA 3G3DA 3L23A 5DCBA 3W7OA 3NQBA 4IIBA 1BQGA 1O5XA 5CGTA 2EJ1A 2JF7A 3ZVIA 2QIWA 5EPDA 3STPA 3RRAA 1KB3A 2PWVA 1AQ0A 4O16A 1GW1A 4S39A 3TONA 1SZNA 3O2LA 5B80A 1BXNA 4HMDA 4DJDD 1E4LA 3GYEA 1XLJA 2OLAA 2XFWA 4ZOBA 3C86A 1VEPA 3A3HA 3POCA 4AYGA 1C9DA 3TIMA 3PTMA 1FWEC 3QKEA 1N7KA 4NAFA 3VD3A 2FFCA 1I0DA 2PWEA 1O6IA 4EPDC 1WKYA 1Y65A 3A4WA 3CHFA 2RDUA 5C2CA 4RDVA 4W7WA 2QMKA 2P0IA 4ZE4A 1T6MA 4AWTA 2HZGA 1O66A 2XM2A 3VKCA 1TJ2A 4IPNB 2QCDA 1NDZA 1QNOA 3EX3A 1V3JA 4S3KA 5HMSA 3HQPA 3DDMA 2E9BA 4RDWA 3QW4B 3TNBA 1W5PA 4M81A 4GGBA 1UQZA 3ISIX 1PCWA 1GOKA 1CGVA 4LVGA 1ZBVA 1TTQA 3K8LA 4U10A 1IT0A 1A5UA 1BEUA 3UR5A 3SY1A 5A2BA 5A6AA 3B8IA 4PTWA 2J7EA 1OHLA 3PG9A 3WBWA 3C2VA 2QAFA 4D72A 1XW8A 4JTLA 3V16A 2WANA 1ZCCA 1ITCA 1O1ZA 3BWWA 5CBIA 4LVFA 1OGBA 1XG3A 1I4NA 4IJCA 4FZIA 1Q7MA 4EWND 1BGAA 4ZQOA 2QS8A 3ARUA 4LALA 2QCFA 3S2NA 2PDCA 1FUYA 1Q8AA 3ZR4A 1HXJA 2C18A 1K8YA 4OV4A 1K70A 2GFTA 4WKHA 2QYGA 4G1NA 1H5YA 5E6YA 5CZ0A 2VEMA 1UD2A 1ADSA 3ID7A 2OB3A 4NT0A 4R27A 1CZ1A 3KVLA 3LTSA 2CLFA 5BCAA 1R2SA 4XZNX 1EFZA 3TROA 4A3UA 2Z1XA 4B5TA 1CYGA 4LY8A 2AGTA 2BODX 5GJMA 5A6KA 2XZ9A 4GO8A 2Y1HA 1PX3A 1W2VA 4GQBA 2G96A 4GHRA 1G0CA 4JL1A 1E6QM 3MT1A 1FX6A 2ZZ3A 5AOUA 4K8GA 2C3ZA 1N8WA 3L65A 2C7FA 5AZ0A 1VFMA 1XLBA 3KM8A 4IFOA 4LCRA 2Y88A 4L9ZA 1UZ1A 3GNNA 4MKSA 4QS5A 2B7PA 4KWUA 1W37A 3AQUA 3S6OA 3C0LA 9XIAA 1ZFJA 5REQB 5JH2A 3QYSA 5KSWA 4OECA 3P3BA 4JHZA 4DHGA 3N2XA 1GVFA 2WMFA 3RM8A 1KM0A 5BXRA 1GZ1A 3QPZA 5F2LA 2JGYA 4ECLA 3ARQA 4F0HA 5CSUA 3PP7A 3PBYA 4UOQA 2YLAA 2BS9A 2PD9A 3T0TA 4Y7EA 2QJNA 3MUXA 3GFYA 1UBSA 3R8RA 3XINA 2QJHA 2P76A 4TO8A 2WNZA 4QSFA 2H90A 4URIA 3M1ZA 2ISFA 3QMRA 2VDHA 3SGGA 5AHIA 1H60A 1QNPA 2F38A 4ORMA 4HYRA 3UEQA 1JIBA 2V6AA 2WW5A 4MWAC 4HHLA 1PWLA 5DXXA 4E3VA 4I7WA 3QJAA 4NHVA 4KT2A 4PGLA 1E4NA 4A2SA 5A8OA 2FZMA 3UG4A 4PFHA 5D03A 4LVBA 2VUNA 3CIVA 3ZOAA 2QT3A 1DP0A 4AH7A 2BY0A 5D4YA 3MCNA 1P0KA 4JNYA 2FZDA 3ZSTA 1EBGA 3WH8A 4WDXA 1K7XA 5T91A 2QW5A 3SB0A 2OGYA 5DN1A 1LROA 4LS0A 2YDAA 4XBJA 3VM5A 1V6XA 4PRRA 2I7GA 1J93A 4PMRA 2XTKA 4EX4A 1W9PA 5H6HA 1QPKA 4CN1A 2NVCA 4Z2GA 1RUSA 3ONCA 4FO4A 1E43A 2DT3A 3H22A 5I03A 3MZNA 5JU6A 4QLJA 1M9HA 1MRAA 1UUOA 1UYQA 5CZKA 1LL7A 4NZCA 1YXCA 2SFPA 3M0YA 1DXFA 5LIKX 5C5YA 5I3KA 2EPLX 1BRLB 1W1TA 4G1KA 4NZ3A 3IACA 4PODA 3HGOA 4NJHA 3WH7A 2BZNA 5HPOA 7PTDA 1R2TA 3HGJA 1UD8A 1VKFA 1JL8A 1QO5A 3BMVA 3BSGA 4A21A 2D24A 2I9EA 4RJEA 4UR8A 2GGGA 1SW3A 5CG0A 3PZVA 4JIPA 3KBNA 3OVGA 1LWIA 3N3TA 1A3HA 4P5UA 4D6CA 2FZBA 1R3YA 3IARA 3BGJA 3FDKA 1KBBA 1S1PA 4ZB5A 1UR9A 1UKQA 2V5LA 1F3TA 4WHBA 1CXKA 3UU0A 2VVSA 2OEMA 5IHSA 1H4PA 3GHRA 1X8CA 4H9XA 3AC0A 3W74A 1H7RA 1XGZA 2ZWZA 4MKVA 5G2IA 3UWQA 4XZMX 3UJ2A 3KWSA 4S3DA 4UQ9A 4DBWA 3BMXA 3E96A 4RDYA 3THAA 2W0UA 2V2CA 1AW5A 3ES8A 5FL0A 4RR4A 3LCWA 4MSSA 3WDHA 3ATYA 3KRSA 1VCFA 4J4KA 4QCEA 4JTUA 1E3XA 3CZKA 4JCMA 5D30A 1QTWA 5FJUA 2WNNA 3TJXA 4R33A 1IE7C 2O4QA 4QTGA 1KC7A 1KRBC 4AWUA 4P61A 3UETA 4ACZB 3PUGA 1REQA 4EK7A 5FF0A 2VCCA 3S2CA 4E0CA 5BXSA 3FAXA 2PCQA 4RCXA 3WYZA 2HE8A 2FJUB 2NQZA 2XWDA 4QLLA 3O6YX 3KOXA 2Y7GA 4HK5A 2BV9A 3VGEA 4UTMA 3TW9A 1NTHA 3SADA 4FB7A 2VZUA 4JKKA 3H54A 3O3RA 1R0MA 3WLLA 4LF1A 3APTA 2NSXA 2QDDA 3QR0A 1JR1A 1V4YA 4MFDA 4GBDA 4QM1A 1ZJBA 4BCEA 2QV5A 2PDMA 1VBJA 1BYCA 4L9XA 4HZMA 4ZQPA 5LHFA 3BARA 2XDFA 4PZVA 4FAMA 3VCNA 1C8QA 5LNSA 1HKKA 3EWDA 3E74A 4AUBA 4BK9A 1G4PA 3MI6A 2VFIA 1QI4A 5I09A 1NF7A 3IANA 5HDRA 3N04A 3K4DA 1MZRA 4F0SA 2V5CA 1W3LA 4HQVA 1UG6A 1FWHC 1HKIA 3KOZA 1X38A 1CXHA 4WRHA 3REQA 4HIBA 1DJQA 4Q8UA 1EJWC 3R94A 2PC8A 1I60A 1GHRA 2FTYA 4FPSA 2OXNA 7REQA 4HK7A 2B31A 3F5LA 3TN4A 1XPYA 1FWJC 1XIJA 2O9RA 1CGYA 5FSEC 1RD6A 4LCSA 3MSYA 3ARVA 1AMKA 4F2UA 2ZTKA 1EJTC 4FS9A 3V75A 4O1DA 4QE4A 2VX6A 2P88A 1TRDA 1UOKA 1VFSA 2AQWA 1BXCA 2QCCA 4GYKA 1VS1A 1X98A 4BZYA 2O7QA 4MPKA 5HJXA 2BY1A 1Q6OA 3PZTA 2R8WA 4H6EA 3CQIA 2GSHA 3MP3A 3HB9A 1UB3A 3PTDA 1ME8A 1JNEA 3DCPA 3BMWA 1YNPA 1JPDX 1TWSA 2VENA 2A3HA 4WKFA 2DSVA 2CITA 3HPAA 4YHGA 3H2CA 3EDDA 2DW6A 3WDJA 3WQOA 1QNVA 5D9MA 1SO4A 1CWYA 3ITTA 1JUEA 4H8NA 3STFA 1I1XA 5I00A 3QR1A 1K8CA 1KRAC 3C0SA 1UJQA 4IGSA 4FXFA 1KBLA 1FCBA 3ARPA 4GI4A 3A64A 2Z6IA 4GO9A 2ABBA 1XSIA 3TJLA 4C1KA 3M64A 2FGBA 2Z2BA 4UFHA 4HZ7A 1FHUA 1EGMA 1TA3B 1WX0A 4OE7A 3U7BA 4JHOA 1YXDA 3CUGA 1SFJA 2XN0A 3CAKA 4ENLA 4PUUA 2HV5A 3LMYA 1TQXA 1QNRA 2DORA 3G1SA 3AMKA 2CLLA 3WFLA 3JW7A 2GVLA 4ZL1A 3GU1A 1RBOB 1V3MA 2ZA1A 2OWCA 2VJXA 2WM1A 3NQ6A 2O7SA 1R7OA 3I6TA 3RLVA 1OCQA 1VYRA 4IMCA 1E5JA 2OT1A 3BLEA 2VGBA 3MJYA 3VD4A 2EPOA 2FVLA 4Z42C 3R6IA 5CLTA 4IHCA 2OKOA 1SZGA 1Q6EA 3WD3A 5I07A 4D1IA 1JPKA 1U1JA 3SCOA 1ZL1A 1HL8A 2BOFX 3NVTA 1OIFA 2V3FA 3MV11 1M65A 3W7NA 3DFOA 4WKAA 3OLDA 3U3HA 3I3BA 3RCYA 4DUXA 2VD9A 3OGRA 1QI0A 2YA1A 3AALA 3LN3A 3XIMA 3LU2A 3GTHA 1K9FA 1QNSA 4BQ4A 5K9DA 2PPGA 3E0FA 1L0PA 4NG3A 1XRTA 4CQ8A 4AYSA 4QIUA 3BANA 4PBFA 2A3AA 4X2PA 4RLIA 3GWQA 4GABA 4QP0A 3G0XA 3AI0A 2BASA 1W3IA 3U48A 2A85A 1HKMA 4MWAA 5E93A 2PP1A 3LSCA 4D1JA 3GVVA 4GI8A 3TJIA 3LGDA 1GOMA 1JI1A 1OYCA 3NDZA 1DJXA 3FY1A 3Q65A 4R9XA 4FHAA 3CUZA 4HNCA 1P0EA 3R11A 4DYJA 3QV9A 1SJBA 1LUCB 1YYAA 3S46A 3R58A 1V3HA 2WZTA 3O0FA 4PCTA 3N34A 3RX2A 3QPEA 1GYLA 4UTKA 1YW1A 5JQ9A 3EDKA 1PTGA 1Y5VA 1VRXA 3OZPA 2BGSA 2OELA 1X1ZA 1K9DA 3MJMA 1NAL1 1BKSA 4S1FA 3WLSA 3FW6A 4DQWA 3E2SA 2V8ZA 1OFEA 4X0VA 3W7GA 4IL0A 4D71A 5FAGA 2ZUSA 3DN5A 3UCCA 4JTRA 2CCRA 1P0BA 4Z17A 2ZX6A 4KWVA 4W88A 2H3BA 1F2JA 1UWTA 1PCKA 3GTXA 5KZ6A 4AX7A 3CQ0A 2GVYA 2G3MA 2GJRA 1UKSA 5JBDA 2EKGA 4IT1A 3K4AA 4WY0F 4CD5A 3PJWA 2BP1A 3LYEA 3BLDA 1JYWA 4AU0A 3E38A 1Q5MA 4L6DA 1NP2A 2FZNA 1V93A 2YCEA 1JUBA 4OBRA 5L9FA 3W6LA 3LQGA 1WPCA 1B90A 3FXGA 1YBQA 2WWCA 3A5FA 1QW7A 3ZZ1A 4QG9A 4MLJA 3DHDA 4K6AA 5BROA 3DZ1A 6TIMA 4AZ6A 3ECQA 3N18A 4GX9A 2PC4A 1OY0A 4GY0A 3QHMA 1ZQ5A 5AVHA 3BPWA 1V02A 1O4UA 4W9TA 3C56A 2YA2A 3OPSA 1DQUA 3C0JA 4YMZA 2AQOA 1GHSA 3OYZA 3F2CA 2WKGA 1ZCOA 4ZXLA 2AGKA 1Z41A 3DGBA 3H2EA 3D47A 3AMDA 2DIEA 4UQCA 1WDPA 3DU0A 4Q33A 1FWIC 3ZFHA 4MHBA 3G1FA 4LGXA 1EX5A 1UR3M 5BXPA 5CAHA 5BU9A 3N4FA 4U31A 2I5IA 1SJDA 1NQKA 5LIUX 3H2MA 2ISVA 2OO0A 4IXHA 2XZ7A 5C9UA 1GVYA 4H6KA 1JNDA 4CLMA 5I06A 1LL4A 1R7AA 2NT1A 2UWFA 4F66A 4F79A 1OCNA 4NP7A 4IXXA 3TE9A 3GNOA 3O6AA 4O0KA 2H9AB 4EIVA 2WSKA 3GNDA 1V7AA 3EEGA 3QGAC 1JGMA 2INFA 2DUZA 3B06A 2YDQA 4D6JA 4XG1A 1J10A 3GXPA 4UMBA 2AL2A 3CNYA 1OABA 3AFBA 3VVGA 2J24A 1AH0A 1E4IA 2WVVB 1JZ2A 5CPTA 3LPGA 2PDNA 1U5VA 4HA1A 4LNCA 3RR1A 3M0JA 3FHQA 3T1GA 2DDXA 2WZMA 1EJSC 3U7VA 3AAMA 5CSSA 4MY9A 1DE6A 2EF9A 4XZWA 6A3HA 2WHMA 3OBAA 3CMFA 2WMKA 3KBSA 3NUKA 4BEQA 4ZO6A 6ALDA 4GZJA 1W5QA 3BH4A 1KFKA 4HHMA 3L21A 2DY3A 1ZBCA 4G56A 2Z00A 4HNLA 3VOJA 1YIXA 1OC7A 4UOZA 2PBOA 2XPKA 2XGZA 3QY7A 4B2DD 1Z42A 3NJ3A 1M1BA 1Z32X 1VPQA 5LYRA 4NJGA 3UGRA 4K36A 3W00A 3O07A 4JTQA 5D2YA 3GG8A 1ZTVA 3EWWA 2VELA 3PSVA 4DO7A 1RCQA 3HIJA 2POTA 4JTGA 3WN6A 3LPOA 4GQ0A 5FF3A 3P0WA 1GYNA 1VQTA 4K3ZA 3ICJA 1UZ4A 1MYRA 4L4LA 1E3ZA 3WBEA 3LV6A 1LP6A 4WDUA 3RO8A 4EOUA 1E72M 1OFRA 4BWLC 1IEVA 5LIYX 4C5YA 4PTNA 2O9PA 1B57A 1MXSA 2WPBA 1WQ5A 3SUUA 4YL2A 2BXYA 5DMLA 4XBKA 3N11A 1CEOA 1CXLA 2XVKA 3BOFA 3T0AA 4IIFA 4GYJA 4DWDA 4XZHA 2P0OA 4OOUA 2RDXA 1JPMA 4JBRA 2W66A 3KL3A 1A0EA 4W8LA 3H2OA 3WD1A 1R2RA 3UG5A 3PPHA 1CCWB 3VOIA 2EG7A 4JIQA 3ERPA 3EA2A 2JQXA 3A3WA 4IUOA 4NXKA 3SUWA 5HOSA 3KLLA 3CH0A 4TX8A 4BA0A 1S2TA 5DO8A 2PDPA 4DF0A 4RZ4A 3WFZA 4LUSB 1ONRA 1V51A 3UD6A 3WUGA 2Z0IA 3C2RA 1UP2A 3T0DA 1XV8A 4CCEA 4K38A 2YR1A 2E6YA 2VR2A 3MMDA 1OF8A 1VD6A 3LLXA 4V2XA 1G9HA 1SSGA 1TZZA 2IQ0A 3E2QA 2VX5A 1X1NA 1YRRA 4C90A 2V5KA 1AZ1A 4GFSA 3IJQA 4PFMA 3DFTA 1W2PA 2O55A 4J27A 1VEMA 1JD7A 2XFFA 1K8XA 3HG3A 4ALDA 1S2AA 1MFUA 4S2BA 1LF1A 1TPUA 1RVGA 3L67A 5A6TC 2PLCA 2E09A 1CB2A 2XIJA 3NIYA 5HUOA 3B9EA 1TR1A 3ME3A 5EBAA 3IV8A 3AZSA 1A5OC 3SURA 4B90A 2GGEA 4PL2A 3LEPA 1XYLA 3CO8A 1TVLA 2ZUUA 4ES4A 5FSDC 1WDSA 3ARRA 4O1FA 5D09A 4QG8A 4JX5A 3CAQA 4GZEA 3RCMA 1EZ2A 2RDWA 2V69A 3WBYA 4TMBA 3MMTA 4I9JA 4BI7A 1YKWA 2VEGA 3S6DA 1N82A 1F6KA 1E0WA 1XF0A 2PP3A 4XSMA 3RJXA 4TMCA 3WH9A 4IISA 3FDGA 3NQVA 4MNMA 2YW4A 4IMEA 2ZRVA 4XAGA 1XCFA 3QZAA 1XFBA 3PJXA 3WD2A 1VBRA 4GXWA 4PH6A 2IMRA 4H6RA 4J5NA 4UTIA 5BWAA 2QJMA 4J28A 4NVTA 3ZJKA 3W7QA 1PE1A 3WEMA 4HU0A 4UNIA 4TVUA 1HKVA 4XZ9A 1QXLA 2CHNA 3UPWA 1MW1A 4W7UA 4DUWA 2ZCGA 3WSUA 3TJ4A 2BBFA 3W02A 2D2JA 2VGIA 1DJYA 2PRHA 1B3VA 1ZHAA 3PWGA 1XISA 4QDMA 4KRUA 1O1HA 2VC5A 3P5ZA 1LBLA 1ZJIA 1XLDA 2UZ9A 1RR2A 3MPGA 5E5CA 1SZRA 2I17A 2VCBA 3W23A 3EX1A 2Y7EA 2ZUVA 5AYXA 3PF3A 4X60A 3OEXA 2ASHA 3GIYA 4Q22A 1JYXA 3UBPC 3IGXA 3LK6A 5CJMA 1FDJA 1MEWA 3ARXA 1RQBA 4GNKB 3OO2A 1CPUA 4GMEA 3GDMA 3UQNA 3LNPA 4JGDA 1JQXA 3AXKA 5I77A 2CXGA 4O13A 1V0NA 2J88A 2YBTA 3MYPA 1TTPA 4HT3A 4LEQA 1A5AA 1EGZA 4V1YA 2A1YA 4IPPA 3GW0A 2NT0A 3N25A 4AD5A 2P8CA 3L5AA 2PTDA 3GY1A 4KF1A 2MUCA 2Y4SA 4DNMA 3O6DA 1ELSA 1H49A 1WBHA 1YE6A 2VGGA 2X0SA 1UROA 2XVLA 3TN5A 1DJGA 5FJTA 4Z2LA 3TK7A 5F2GA 3CZLA 3TX9A 1BSLA 1L2UA 2EPNA 1J9YA 4B9YA 2QIIA 2BVYA 1XM3A 2CKRA 4H2HA 2NXGA 3LM3A 4GA8A 3LHZA 3MI2A 3EMZA 1F73A 4M5PA 1P48A 2ICSA 3S0CA 5G4HC 2Z1BA 4JAWA 3OGSA 1D8WA 3SGUA 3H53A 1H1ZA 4HPNA 1FFRA 2CZ5A 4JYDA 4MZYA 4PUNA 5RUBA 4TTGA 1KCZA 1EA0A 3U4FA 3FNDA 1XP3A 4PMJA 3W25A 2WAGA 4LXFA 4R7WA 3SRKA 3WL1A 1L6FA 1N55A 5A2AA 2CLKA 1GTHA 1UWIA 4XD5A 4XKYA 1BAGA 3CASA 3RM4A 3VNZA 3WNOA 4ZBCA 2AKZA 1QASA 3MUCA 4QDWA 1JI2A 1BSIA 3WF0A 3SCQA 1VR6A 3N13A 3TN3A 3DBPA 2J62A 1TELA 4K8EA 4NI8A 4KCTA 3FVDA 1P1XA 1B3WA 1WXYA 4LBSA 2A6LA 2AAMA 4GVGA 4PB4A 4Y9AA 3A9BA 3EPMA 2IKGA 4IQEA 1Z9AA 3WJXA 4O4WA 4LANA 2ZUNA 1FA2A 4CN4A 2C8NA 4CNSA 1TV7A 3WLQA 1BYBA 4A8IA 2DEPA 3ZM8A 4FNSA 3QEZA 1JZ6A 4AHOA 1SO6A 3ABXA 4YVXA 4OTKA 1JD9A 3W1RA 1LBMA 2GUUA 3F2DA 1TIWA 5D33A 3WLTA 2CHOA 4JTCA 2CC0A 3GX9A 1NOUA 1M5WA 1CT5A 3AXMA 3UG8A 4ZSUA 4C6PA 1KTBA 1IR1A 3UWVA 2ISSA 2GGJA 3UY7A 1HJXA 2GJPA 5K7JA 3E0WA 1AK5A 2QZRA 3NL2A 1CLKA 5T8GA 3QBUA 4WDTA 4A3HA 1B9ZA 2QUVA 3OLGA 4GIRA 3W1LA 1J0ZA 2FTWA 1XD0A 1E0XA 3EOSA 3O06A 5C6MA 1L2QA 1MSSA 4B5VA 2VVNA 1LWJA 4NU7A 4C6DA 1IXPA 3MS8A 5CLWA 2PTXA 1VFTA 5BOEA 4H83A 1W1IE 4UR7A 2I1OA 3GQYA 3VKJA 3IIPA 2Y8KA 2DSUA 2OOGA 1J18A 4DXVA 1HL2A 2QAPA 3RIKA 4M8UA 3SUTA 3U5UA 2EXOA 5CC7A 3WEZA 1PHWA 4A35A 5T9CE 4GNJA 4WUIA 3EAUA 3UFYA 2CBJA 1OGSA 1JDAA 3AHXA 1M6JA 1ONXA 3BURA 3RLGA 3TC3A 1W3TA 4N9EA 1HO4A 3VIGA 4PMDA 1JRCA 3NYDA 4K2SA 3NWRA 3AXXA 2UY3A 4BWLA 4ZB2A 4DPPA 4OZOA 5LGXA 3B40A 1XINA 1XX1A 1JGIA 1A5LC 3CQJA 4RV3A 3L12A 2ADAA 1U1HA 1XLCA 3PPCA 8RUCA 1KCLA 3M0ZA 4ZXOA 3EEZA 3CTTA 1BRLA 3Q2DA 2ZDSA 3G1YA 4UTHA 3V3WA 1TV3A 4ATDA 4G2DA 4QX4A 4DI9A 1E6XM 1SM9A 2DJLA 4KRTA 4ZCWA 4LC6A 5I6SA 3CIWA 4YVVA 2XGBA 3M0HA 3HFTA 4FR1A 4Q4SA 1NH6A 1OGGA 2E9LA 3LV5A 3OIHA 1FHLA 1GOOA 3JZEA 4LWWA 2FLIA 4GZIA 4XZIA 3U0HA 3AYTA 2OYKA 2ABAA 5JMUA 3IJDA 3A3XA 5LA2A 1G7VA 4JX4A 3ZLHA 4PC8A 3LTYA 2FTPA 1UCWA 1AFSA 3QMTA 3CYVA 1UWQA 1EXPA 1L9WA 5A3HA 2YL5A 1VJSA 4QGCA 4WLCA 1Q85A 2X0YA 3TC6A 1MXDA 3GZ3A 4DZAA 1UJPA 1I6NA 2J27A 3NQAA 4BHYA 4IPJA 2ISDA 3M0XA 1F07A 1NDWA 4PULA 4DJED 3F03K 3BAWA 3HURA 3GW3A 3S2JA 1RJQA 2QCEA 1JXKA 5G4EA 5K4XA 4LUTB 2VT0A 5D2WA 2X1UA 1WZLA 1FRBA 2P53A 3QC0A 4DUVA 1W31A 3AIBA 3CL6A 1OK6A 1RSCA 3UZXA 4E38A 1EC7A 4MKNA 1XDMA 4OT7A 4E4PA 3GR4A 3TYAA 3GXNA 2EHHA 1OX6A 4EAMA 1HP5A 1W3JA 2PGFA 2XYLA 3B8SA 3MSDA 4QROA 3ABRA 2D23A 3FFSA 1VFOA 1KWGA 2DZAA 2PMQA 3W27A 4XD3A 1UKTA 4QJ4B 1H1YA 1Q6DA 1Z7AA 1T99A 1E9YB 5KMYA 1H62A 1NEYA 1V0LA 1R86A 4M51A 3VKBA 3CUFA 4HJFA 3C8NA 3S9IA 1GCYA 2Y5SA 3UJEA 3CS2A 2GWGA 3VIJA 2ZBTA 3M41A 3THCA 4MYXA 5AZ1A 4FNQA 1S2UA 2ZDRA 4H9YA 1O5QA 1BYDA 2CNCA 4W5ZA 3TSDA 4YCOA 2HNEA 2A7PA 3NNTA 3NQCA 1TB3A 3FV9A 2AAAA 3LBMA 3W7CA 4ORIA 4JIIX 3USZA 1P7TB 3B8UA 4KS0A 2GSJA 4CCCA 2RAGA 2Y89A 2X1SA 3CGTA 3PBGA 2DVUA 3SR7A 4GBUA 4UZUA 4YWIA 2X1RA 4ASTA 2HVMA 3WNMA 1YADA 4E6MA 3DECA 2F6XA 4CUCA 2YB4A 3SQMA 3CHVA 3IK2A 4JTEA 1YTEA 4R9OA 4HPJA 4ONVA 4XB3A 4JDYA 4CN6A 2WHJA 1V5XA 2PDFA 3H4XA 2Y8UA 3E5BA 4IPLA 3H7RA 4JX6A 3UXAA 4MFEA 4AEOA 3K2GA 5HINA 3TFXA 3GH5A 3WBAA 3E1F1 4EF9A 3N19B 4JKMA 3FYPA 2D3LA 1VCVA 4K1GA 2ZX7A 3ZVHB 2YCLA 4N2YA 1DHPA 3ANVA 3PSWA 2NSOA 1GQNA 2CLOA 4FALA 5LA1A 4W8BA 4GH3A 3GBDA 5E0FA 2Q71A 2HK1A 1GPWA 5G2WA 4XBSA 3AIEA 2YSWA 3AIRA 2YGYA 2PAJA 4QHRA 2INZA 3MKCA 3N9RA 1VJZA 2W62A 5A69A 4PUWA 2WPGA 1JYVA 2PDIA 4DJDC 3CHEA 5D9NA 1KBJA 3QVQA 5D05A 4AHPA 2Q09A 3L68A 2WSQA 3BAXA 2YXOA 3K8KA 4KWWA 4MNKA 2B7NA 2WCSA 1GT8A 5D9PA 5TQLA 3OA3A 4NX0A 1WZKA 4CU8A 4OFCA 2ZC1A 3WLIA 3WL0A 2NWRA 1AD4A 1YNQA 1GW9A 2GJXB 4S3GA 1T8XA 4RXFA 4N6FA 4JL2A 2V30A 1DTUA 4M82A 1PTAA 1YX1A 2IKHA 2WSYA 5AFDA 4ZOAA 2CERA 4ZQMA 3TAOA 4RNFA 4NF7A 4E4FA 1BVWA 3KS5A 1KM5A 3VMNA 4DAIA 3VNMA 3G6LA 2ALRA 1OM0A 4AIOA 2GDVA 3HPSA 3I10A 3NL5A 3TZNA 1LYXA 2J8TA 3MHGA 3QV6A 1JQVA 3SN0A 3N29A 3AS2A 2D3NA 4DZIA 2PDJA 3GXIA 3W86A 3W7DA 1W56A 4S3CA 4GUHA 4XVEA 2E0PA 3WQEA 3V0UA 3LHUA 2Z6JA 2C1HA 3T4CA 4YPJA 3OGVA 1AQHA 3RU8X 3BAJA 1FWRA 4ML4A 3UVIA 4AW7A 1WCGA 2HS6A 1UMLA 4N7QA 4O52A 1IWPA 4UTJA 2Q8LA 4GQRA 4IFKB 3W22A 3BCFA 2BNJA 1DHKA 4E5TA 1EWEA 4MG4A 4KQNA 3URNA 3GDLA 4CVUA 3R0UA 2ZC8A 3R1ZA 1TPB1 1ME9A 2D2GA 2X41A 2WQPA 2WK2A 4L61A 3AZTA 4D6HA 1L6SA 3MDWA 3NO1A 4WJEA 2C91A 3GUWA 3CMJA 3AUJA 4QNEA 2VQTA 2E7FA 3A4AA 3AIWA 1ZALA 1NWTA 3K46A 3UWYA 4ATWA 1XH1A 5H91A 3BV4A 3MKVA 2G4JA 1H50A 5A2CA 2DFAA 4B4FA 2VX7A 3T0BA 5C8BB 4HU8A 3WKZA 2BFGA 3RM9A 1UR0A 3WMCA 2OTDA 4A3RA 5I0DA 5XIMA 3R79A 4N4PA 1IZJA 1J0IA 1LQ2A 1KNWA 2JKPA 4XAZA 2E5CA 4KEZA 1ISVA 4WDWA 2ZYFA 2OOFA 1PZ1A 5A6JA 3RX4A 1W1B1 3ATZA 1EXBA 3PUEA 2OSYA 3W24A 1E1CA 3WLJA 1ZGDA 3V5CA 1R46A 1JUKA 4FX6M 1EUAA 4IIHA 4G5DA 3VDAA 1G01A 4D6IA 2F8QA 2FKPA 1POKA 1CXEA 4OBSA 2NXHA 2OPJA 2NLIA 3IVTA 3SY5A 2D69A 5DT7A 3R7MA 2IUZA 4TR9A 5HMDA 5HQMA 3W71A 1D7FA 1UUQA 1XH2A 4UFMA 4JYEA 4AHQA 3GFXA 2YLLA 3PANA 4HOXA 3MC5A 2V5JA 4XSLA 2GGIA 3AWOA 1HJQA 5LHEA 3LD5A 4J3VA 1GVQA 4ZSTA 2G8ZA 3W53A 2GUBA 2CBVA 5I3GA 5FI8A 1E71M 3T4WA 3TKFA 3LBOA 4J1OA 1KGWA 1J5TA 3ITGA 2OSWA 4H1ZA 4D6EA 1AVAA 1X1OA 2J77A 3CZEA 1DVJA 3L4YA 1HW6A 4HSOA 4RUBA 3A13A 3B0UX 3BLKA 2DZTA 5DRCA 4FP1A 3TSMA 2PGEA 3KXQA 2VDGA 1PKYA 2OMAA 3P7YA 4XUGA 4WSHA 3EA3A 3RK8A 4F2BA 3WJZA 5HA7A 2ZZ4A 2X16A 2Z1SA 2A2IA 4FI4A 3KRBA 4CQCA 4O1CA 4CNOA 3U2EA 1XRSA 3WK3A 1VGAA 4EXAA 1Y0EA 4S23A 1HJSA 3NA8A 4BR1A 1FWBC 2E40A 1ZLPA 2R94A 4RK8A 3PZUA 3WQGA 1OFPA 1AG1O 1G67A 2WVVA 1BPLB 4UFKA 4O1EA 1E9LA 1CXFA 1XBVA 3I3DA 1EYWA 2WC4A 1D2KA 3GRIA 2E77A 3EXRA 2INEA 4JHMA 3AHZA 1SO5A 4NJKA 5FAJA 1OYBA 1AH4A 2F2HA 3CLMA 3U57A 3VKKA 2G3NA 5KITA 2HK0A 1FWSA 1AJ2A 2AMXA 1AQMA 1THFD 3DIPA 4EP8C 3DKJA 1XLHA 3F5JA 1BG9A 4CNUA 4JCLA 5GNZA 2Y85A 1S39A 4HB7A 4AZGA 2X1IA 1BF2A 3PR2A 4Z0SA 1R9ZA 1ICSA 3M6DA 4ADUA 1BTMA 1RA5A 3H55A 3PUDA 4UIOA 2VXNA 1QAPA 3QM3A 1W3HA 1Z8AA 5B7ZA 3O8AA 1L6YA 3ALGA 3B8VA 4I7VA 4PBEA 4KFOA 1C7TA 5I5RA 3PVFA 3VDCA 3HJEA 1NFBA 1EOMA 4QQ3A 2Z7KA 3LOTA 1G69A 4S3FA 4Q32A 3SGZA 3VPLA 2KZHA 4NJIA 3T09A 4R3UA 1MEHA 2EQDA 4IP7A 7ODCA 3WQCA 3I6RA 1AQFA 3W29A 3H2FA 1GVIA 3P61A 1FDYA 3WNPA 3RNDA 3CQHA 3WH5A 1X7IA 5EY5A 5C7VA 3NM3A 1KQZA 1EDQA 3QV8A 3VINA 4P7NA 1JVNA 4XZBA 5I3HA 4BKNA 3C2YA 4BQ3A 1IT8A 1M53A 3A24A 4ZQCA 3CZGA 2W63A 4LC8A 3WQ4A 1OZQA 4PBGA 1AUSL 3VMOA 5F4WA 1B3ZA 4DJDA 3BC9A 3UZ5A 2QCMA 2O0TA 5A8MA 5BU6A 4WD0A 3GTNA 1O7AA 3QOKA 3E2RA 5G1MA 1CNVA 4JICA 1R6WA 2V82A 3OU8A 3UERA 3YPIA 5EMJA 4ZA0A 4AY8A 1TWWA 3S5OA 3F4DA 1UH2A 4ACYA 1W54A 4FR6A 3VABA 1CGUA 3B05A 1WKEA 4F2TA 2GWNA 4O1AA 4LYQA 4BF5A 3VAVA 4J2PA 1WKFA 1QWKA 1C3FA 4IJRA 3W2KA 4I3GA 5I3DA 2CESA 1FKXA 1GEQA 2Z27A 4IX2A 1KWKA 1JDFA 3T9PA 3B9AA 3TQKA 4L7ZA 1XPGA 1TV2A 1TV8A 4G7EB 3N12A 1XL9A 3TTQA 5CPQA 2NWSA 2Z26A 2BHZA 4LH8A 4NJJA 1EHNA 1UD5A 4AIUA 3VIPA 3DUGA 3W7PA 4PB3A 1DWHM 4LAZA 2PUZA 4K1WA 3T40A 2V81A 3NL6A 4MF4A 3DESA 1TJ1A 1FOBA 3N17A 3IAPA 3WJYA 1JZ3A 2HJPA 5BXTA 3OVPA 4KIEA 3WK2A 3UA3A 4HA0A 4LCQA 3W2LA 1B4KA 2FHBA 2WJEA 4N0RA 4XO7A 3RCNA 1OCJA 5A8GA 4Q6XA 1X6UA 4OOZA 2VD8A 1QOXA 1UC4A 1PHQA 2G41A 1LOLA 3DBNA 4F0MA 5I23A 2PTYA 4I8YA 4E2VA 3VNJA 3R13A 1A3XA 3A22A 5C0QA 1QVBA 3M44A 3F7JA 3LHTA 4ICMA 3LRLA 3TXZA 1H63A 4JTFA 5CZTA 3WDRA 4RXGA 3G8EA 4H4IA 4U4MA 3TYUA 3E3HA 4NNAA 1QJWA 5A5WA 2ACUA 4L1GA 3K8MA 5F1UA 2Z25A 4DO6A 1XUZA 3VC5A 4LX4A 5JBFA 4XTIA 5HANA 3VTRA 1TRIA 2D22A 3EPOA 1OFBA 2CLMA 3SAZA 1ADDA 1QHZA 3AS1A 4Z2IA 3EYPA 2XN2A 4P7OA 1WDWA 4L4MA 3W82A 4AD4A 1G4SA 2YL8A 3E5PA 2V38A 4TVDA 4XUYA 1NIUA 4AWEA 2AMGA 2WYSA 1R3QA 1QPRA 2HWGA 4MY8A 4NKCA 3W28A 4ZTXA 4JQ4A 2RUSA 3ARZA 5FESA 3GR8A 4PSRA 1EDTA 3AICA 3VD5A 4DUOA 4MAZA 3M4HA 1EP3A 4B15A 9CGTA 4XQ6A 3M0VA 1OFOA 5HNUA 4L80A 4GUGA 4IX0A 5AC7A 3S47A 2RHGA 4AZBA 2BY3A 1E5NA 2JEQA 2PDXA 3HM7A 5JUVA 4LU0A 3GVQA 4WGXA 2W3ZA 1HUVA 2HMCA 4AMCA 1SW7A 4NILA 3IJ9A 3MUZ1 1NDYA 3UWUA 3CPRA 2W91A 3KCJA 1RAKA 3E49A 3SCNA 1SW0A 4M6QA 1K7FA 5KETA 3IIXA 1UZHA 1KFCA 4JTKA 4Y6GA 3P5YA 3SECA 3UPBA 4AX6A 2I16A 3CMGA 3CHCA 3T08A 4JY8A 5M5DA 1Q3NA 1G4TA 2DP3A 3JU2A 2CKSA 2PDHA 5AY7A 4Z1BA 1ZZMA 3VZYA 3WMLA 3GNPA 3QGKC 2Z1WA 1FWWA 4Z1CA 1TV4A 3LGGA 1NWUA 4GUFA 3VIFA 2Z1VA 4MAVA 2X8RA 1KR1A 1TPDA 4Q4MA 3TYBA 1AJ0A 2XH7A 1VAHA 1MZHA 4MOZA 2WZEA 2ZRXA 1WBJA 1JDCA 1F6PA 4ADSA 1PIIA 1SVDA 2YPIA 2DQWA 1SQ7A 5DY2A 1GKRA 5H8PA 4IGHA 3BOXA 3UYIA 3DFQA 4DO4A 1NP0A 1E0TA 2ZZ6A 4I7UA 2HBVA 3AISA 4MJ2A 4CVWA 2OZ3A 1IR2A 3QTPA 3ZXWA 5TIMA 3RX3A 4F0LA 5IFTA 2WMGA 3WD0A 4AZIA 1WP6A 1X39A 4QAWA 1PO9A 1A4LA 1VHCA 4A3QA 4L1XA 1O5KA 1B4EA 3NZGA 4GCXA 4CU7A 4OIFA 4K68A 3IVSA 2QCNA 1B9BA 1U30A 4WR3A 3LBCA 4U33A 3VIMA 3ZIZA 5EYWA 4J7RA 1VYPX 5I79A 4DBSA 1EB3A 3GHTA 1YNYA 4HA4A 3SCWA 4N9DA 1P6WA 2P8BA 5HQEA 3FS2A 1KRMA 4EF8A 3KBJA 4Q4QA 1AD1A 2OVLA 3U6WA 1EJ7L 2ATMA 3LNMA 4WX2A 4GCAA 2PZNA 2CLEA 1KCKA 4UUIA 3OJGA 3FA3A 2FB3A 1DWGM 3AIVA 3W7RA 1V3KA 4HNOA 2OZTA 1MDRA 1ZU8A 3NSNA 2VRKA 3EOEA 1H7XA 3LHWA 5ABEA 1TPVA 1ONWA 1W3NA 1RJRA 4Q4PA 2JE8A 3RXZA 4S38A 3E0IA 1JPIA 3SEPA 2G0WA 1NY1A 4HPHA 3WMBA 1HVXA 1FHDA 2GUYA 4NAFB 4YHEA 2R14A 1J6OA 1MFVA 3PC0A 4L5ZA 4H7CA 4GISA 4GUIA 1OD0A 1FHVA 4DWSC 4JDBA 3PZQA 4Y9PA 2JKAA 3L7RA 4TOQA 4AZ7A 3BV7A 1QOQA 3E0VA 2E6AA 4O17A 1S1RA 3EWYA 4UTTC 2ACQA 1OEPA 1A5KC 4M6PA 3ABOA 5HK4A 1OT2A 1ZP3A 4UXDA 4LYPA 3IJLA 3CUJA 4AY7A 1SR0A 3MMUA 5CGMA 1IXNA 3RGTA 4N9CA 5HWNA 2NW0A 4S3AA 3UJSA 3MCMA 5BYWA 2YXXA 2ZE3A 1KM4A 3N2CA 2CZFA 2FDMA 3W2NA 4M0XA 2I56A 1BF6A 4RE4A 4AZ5A 3TH6A 5A6BD 5I24A 4LYKA 1XIIA 3GK0A 3W7LA 2P5NA 4M6VA 4JQ1A 3L4ZA 5BZAA 4L56A 4GI6A 5HNRA 5I78A 3G6MA 3VI2A 2OWXA 2QDHA 3FJ4A 4L9YA 2VEIA 1A4MA 4OQVA 5F4XA 1CBGA 4NNCA 5C7HA 1QPNA 3EXSA 3H70A 2WVUA 2VWTA 3N2MA 1LT7A 4LVAA 4LUTA 4X61A 2OO6A 3DG6A 4NRRA 1ESWA 2PTWA 4MPQA 3BSMA 2DSKA 2NVDA 1WAWA 5LGZA 3EKGA 2ZZ1A 4F0RA 2DSZA 1FWDC 3W9ZA 2YYTA 5E9AA 3EXTA 5MF5A 3LCLA 1TX2A 2Z4GA 4MM1A 3KBMA 1Q13A 4C65A 4RV8A 4ZFCA 2POZA 1DWFM 3W7EA 1I2PA 3WLMA 2G3FA 5EKYA 1V03A 5EGRA 3GNRA 3W7MA 1DQXA 2VRQA 2X42A 4QE5A 2HBXA 1XR2A 4GH1A 2ZXDA 3IUDA 3BLPX 2VWSA 1SPQA 3P67A 5K4ZA 3UXIA 4KEUA 3KOYA 4Q8TA 1H09A 4AZCB 1XLAA 1DWIM 1FDZA 3EZ4A 4O57A 2P50A 4GYFA 1ONEA 2IPWA 4LAKA 4EAYA 1R85A 1GOQA 1DJZA 2PODA 4C7DA 2NUXA 3GXDA 1DIDA 2OX1A 2JGQA 5ABHA 2VM8A 4Q7BA 1Q2RA 4AWSA 3NO5A 4JTIA 1UR1A 5FKYA 1TMHA 1HP4A 5A1AA 2Y63A 1GG0A 2HE5A 2EEXA 4UMAA 5H1WA 2FPVA 2TSYA 1TREA 2X2GA 1LLZA 3WQ5A 4GIEA 4NRSA 3UT0A 2PTZA 5AB3A 2E8ZA 2GGHA 3JUGA 3LXAA 4HNTA 3OVQA 3GG7A 4WY0A 1JULA 3ARTA 3VMPA 2PSNA 3EB2A 4L6HA 4CCDA 1W6TA 1EJUC 2DIJA 3L2IA 4DELA 1WOAA 5DELA 3OBEA 5I3JA 5A8QA 3OYXA 2PEVA 4GLEA 2VZSA 5CZSA 3K13A 3NURA 4KEVA 3EOOA 2TRSA 4CD6A 4FLOA 4F9DA 3W1NA 4ERIA 1W9UA 4W85A 3G1RA 4FA3A 4IIGA 1XIFA 2QQ6A 5CQ1A 4JNZA 4CNTA 2YB1A 3LA4A 3MDUA 4MJ4A 3FIGA 4H41A 4GJIA 2EPKX 1UKOA 1KM1A 3DFSA 5FD0A 3WUFA 3QZ6A 1G94A 4DZ5A 3ZVHA 3VM7A 1B3YA 4X9SA 5DANA 3KWXA 3II1A 1UOZA 4Z2HA 1WDQA 3PNZA 4R53A 4A4AA 3URAA 3P84A 1W1VA 3QXBA 3IV3A 3C2OA 1XC6A 3UZWA 1ENUA 3VGHA 4IFRA 3BICA 4W8AA 3N6QA 2FZ8A 4O8AA 2QLYA 3CUXA 4ZO9A 3ZLGA 4IICA 2GVJA 4MY1A 2NQ5A 3RJYA 2VUYA 1T41A 2F84A 5A6LA 2ZZ2A 1IWAA 3W3OA 1TR9A 4GJJA 2B0MA 2E5BA 1CGWA 2VURA 3HGRA 4YTTA 1MDLA 1WV2A 1F8IA 3CBWA 3OZOA 4HK6A 3G1XA 2NX3A 3UZJA 1XLGA 1O94A 1KLYA 4I5UA 4O12A 2CHRA 2WHLA 4IUGA 1GEHA 3F4WA 2NQHA 1ICPA 4EKJA 4NX5A 1XYCA 4NAEB 4JTTA 3F5KA 3OOQA 3VFLA 4MZ8A 2BXVA 2PA6A 3SI9A 2YCKX 3ONBA 1TV5A 4XIAA 2GZXA 2A5HA 1K3UA 2V9DA 3GR7A 3LI1A 3SQLA 2HXUA 3CT2A 2Y61A 3GXMA 2DT0A 1Q7ZA 4UCFA 2TAAA 3OP2A 4MJMA 2IKIA 5ENLA 1OIMA 5CJNA 2BVDA 3W72A 3KCOA 3HJZA 3UWEA 1SZEA 5EFFA 4U5KA 1J11A 1T7LA 3KTCA 1XRFA 1N8IA 2ZA3A 4KEMA 5I7GA 1RK6A 3M0MA 3BLLA 4UQAA 1EYEA 3FKRA 2WMHA 5GVJA 3STGA 3LXBA 3ABZA 1LZOA 1TJRA 5U7SA 4UQDA 3WD4A 1TUXA 1MUMA 2XGIA 3UF9A 4QFUA 3CK5A 1EQPA 3GG1A 2V68A 2C0AA 3VNLA 1ADOA 1G6CA 1J96A 1VLWA 4L1WA 1Q65A 2ZICA 3O05A 3VNDA 3B8DA 3BAIA 1H1NA 1OK4A 4QR6A 3ZJ8A 5A95A 4FF7A 3GDBA 1Z69A 3R2GA 1FCVA 2XVNA 2YJQA 1LQ0A 5CPOA 1UH3A 4IP4A 3HG5A 4PMUA 1JPHA 1X6NA 3MU7A 1A47A 1H7OA 4LT9A 4CQBA 7A3HA 4CEUC 1SJCA 1PWMA 3NG3A 1KA9F 1V6WA 3VGGA 4DWSA 1EBHA 4JNMA 3N6HA 2OG9A 3CU2A 1JFHA 4FEZA 4HNUA 2J47A 2WBKA 3BJTA 3PAJA 4GC3A 2J7DA 4UTTA 3LRKA 3VILA 4C6NA 4UQBA 2B7QA 3BSHA 3BAYA 1PIFA 3WLOA 3B4UA 3NQDA 3V1HA 1AH3A 4HBKA 4B5WA 2XSAA 4RE3A 4C6CA 1V0MA 1Q63A 3CL8A 3ZO9A 1M04A 4A8NA 3EWBX 1IEWA 2OQHA 1UR8A 4H6QA 2V63A 3AO0A 1R9XA 2VQUA 1S46A 1R8LA 2QVNA 1B5TA 3G18A 4LYRA 3IEBA 3OVRA 3ITCA 3ITYA 2E1DA 1DIOA 2ZXAA 4ZOCA 1RCOB 3CAVA 1T8QA 1RQEA 3VC6A 2CETA 3M46A 1C9WA 4DEFA 4O10A 4B2DA 1WZMA 2EBNA 3NM1A 1TPC1 5F7UA 4FNPA 3H2AA 4N6EA 1PKMA 3WK0A 2EG6A 2Z29A 3C3UA 1GQKA 1XIHA 4YXGA 5TD4A 3LUTA 4PCPA 3CPUA 2ZE0A 4D2JA 1X96A 4LRTA 3HV8A 5KINA 4P8UA 3SCUA 4C7FA 1H0IA 2O9OA 2WWDA 1OT1A 4JEQA 3M7SA 4KKXA 1KM6A 1LOSA 3KTXA 3KZPA 3ITVA 1S5VA 1PV8A 1XGEA 3PB2A 5FEXA 2DVXA 1Q6RA 3FGCA 1QOPA 4BF7A 4AZHA 1FH8A 4JQ3A 3VIIA 1XYAA 1S2WA 1GKPA 1UD6A 3GC5A 4AFYA 2GPTA 4XAPA 4IMGA 3UJFA 1DWJM 3BLFA 4FNTA 3NXFA 1MEIA 5GNXA 1CW2A 3CT7A 2YXGA 4WK9A 1ZY9A 1HKJA 1P4CA 2Y62A 3RHGA 3CWOX 5A8NA 1BKHA 1QHOA 4RDZA 5I02A 1ZNNA 4JIHA 2X1TA 2V5DA 3T81A 3ZR6A 1I9CB 5A6MA 5DMNA 1X97A 3TW6A 2FMOA 1B1YA 5G2HA 3A47A 4JS3A 4F9JA 1K03A 1XKJA 5D02A 4GACA 1ZAIA 1BWKA 1F4HA 2FFIA 3HBLA 5IM51 3KUMA 1SO3A 1IXQA 4YWSA 3M5VA 3AIUA 4E2OA 5C55A 4RNJA 3M47A 1LLWA 3OLIA 3I4EA 2QMJA 3KZSA 3PB0A 3T0CA 5C9XA 2XN1A 4FLRA 4MGGA 4V15A 1QFEA 1QR7A 4LNYA 1L8PA 4UTFA 4REQB 3SFKA 2VRJA 2R1MA 3NQ7A 1UPPA 4OVXA 2FMNA 3U8GA 5TF0A 1VFHA 1MW3A 1UIPA 3L2MA 3A21A 2OR2A 4QS6A 3OW1A 3S83A 3A5VA 1P43A 4DF1A 2G5WA 3GDKA 4HD5A 1QBBA 1WE5A 1EEPA 3VUSA 1M68A 4DJFD 3KS6A 3BG9A 2F6UA 4XD6A 1IGWA 1W5MA 4FXSA 2VFDA 2DQXA 1ODZA 2Y8VA 1XDJA 4H3DA 2X7VA 3ARYA 2HPIA 4IH3A 2JIEA 3W1MA 4DJEC 5HMEA 1GONA 3LX9A 4EXBA 1TCMA 3TA6A 4OU1A 3KDNA 2ZTJA 3G1HA 3EWZA 4RPQA 1LT8A 1DTNA 1SMDA 2HRWA 5EBUA 2YZRA 5ABFA 4O0QA 1C8VA 4ZB0A 3WY1A 2Z7GA 2VZOA 3HG2A 3NQGA 4W87A 4C6EA 2P10A 4ZENA 4FIQA 3OQ8A 4A8RA 2G50A 4GQGA 3CZ8A 3POHA 3KVMA 1GOIA 2CLIA 3UESA 1S3HA 3BVJA 3WG6A 4HCLA 5KZMA 1PDZA 5AC5A 3A4JA 3M43A 1Y5XA 4HNNA 5TNVA 2DW7A 2VGFA 3S5YA 3WUEA 3WLNA 1BG4A 2QNEA 1J6PA 1VIWA 2C1GA 1H7NA 1XHGA 3W1UA 5AC4A 4NZ4A 4JTJA 4PEEA 1Z48A 3MBFA 1DKWA 2DH2A 3GD6A 3PBMA 4MMWA 3S3GA 1W3KA 2C13A 4B3ZA 6REQA 5D2TA 4CNNA 2YDSA 1TE1A 3PTKA 1XIEA 4CU6A 3N14A 1F05A 4M29A 3D3FA 3EX2A 3LZ5A 3B04A 3MVIA 3TOYA 1KQYA 4KWOA 1GG1A 1UP0A 3G1AA 3GIQA 2EG8A 2DIKA 4XIMA 4CNPA 1YQ2A 4RNIA 2VYOA 1KFJA 2ZKMX 1OVDA 3S1UA 4HOWA 3QFEA 4FK9A 2ZZ7A 3QY8A 1JZ8A 2PZ0A 3MA8A 3ZJ6A 3GH7A 3D3AA 2GOUA 1TX0A 5LSMA 4F40A 4QE1A 4JOMA 1G7UA 5FF4A 1CLXA 4RZBA 2E3ZA 1CGTA 1TJPA 1MMFA 1VBGA 4XAYA 3UCDA 2D0HA 2AL1A 2QHAA 4A29A 3B03A 2GQAA 1CX9A 4DYKA 3CEPA 1VFFA 1YDVA 4G7EA 4M6UA 1ISWA 3EWXA 2A6NA 3KOWA 1HJUA 4FMVA 5JIPA 7TIMA 1XIMA 3QQWA 1ML1A 2WCGA 1XIBA 4WVXA 3UZZA 5CZJA 3SQSA 3DFPA 4MADA 3W6MA 3PM6A 3WNNA 5BRQA 4TU1A 1WO2A 1A5CA 1K02A 1TCDA 2FH8A 3VX1A 3IRSA 2G4FA 3FJ6A 3VOFA 2FPTA 3CV2A 2BOEX 1EKOA 2Y2WA 4GIAA 4WJXA 4GOAA 4MNLA 5FJRA 1U83A 4DBDA 5CC3A 2AL2B 3P2VA 1HJVA 5K3VA 1DE5A 4F4RA 4IZGA 3UW6A 4C6FA 3H7VA 1GJPA 3VK5A 2BXZA 4NL1A 2WJZA 1BWVA 3WNLA 4HN8A 4YS1A 2O92A 3BO9A 3GU2A 4BI6A 5CEWA 2NVAA 3EKLA 5H2ZA 1HN1A 3PBUA 3DYOA 2GVEA 2DPEA 1HO1A 2GL5A 1K7EA 3TP4A 2W6RA 3TW7A 4MVAA 4HSHA 4ZFMA 4HHHA 4NZ5A 3LDVA 4ICNA 4Y9NA 1GJUA 4G6CA 4GE8A 4JD4A 4YTRA 2OZ8A 5DBTA 3BZJA 1NQ6A 3SJNA 1Z89A 2E28A 1DIKA 2REQA 3VNIA 2OCZA 3ZT7A 2BSLA 4O8RA 3N1AA 1US2A 3W38A 1K4HA 3R43A 4LTSA 3GHSA 3DC0A 4H8VA 3RITA 1AL8A 1JRBA 3DC8A 1W1ZA 1HGWA 2VZVA 1R9YA 1H11A 4FOUA 1KFBA 2F9RA 2XFRA 2D1ZA 3DI0A 1UUMA 5C54A 3WF4A 1CIUA 1IIGA 4I9TA 3BK0A 3WF3A 1C90A 1FBAA 3HG4A 3BZGA 4HJWA 2E4TA 3M5YA 3P6LA 2NXIA 1H41A 2E9MA 2QVHA 3T2QA 3MUIA 2WSPA 4HCHA 3ITOA 1R30A 3NFUA 1JDDA 2WCAA 2BVWA 3NGJA 3MWAA 3MP5A 1WAUA 4I8DA 2XJ7A 4FNUA 4MUZA 3KL0A 3W7JA 2WJDA 1H51A 2PWFA 1QPQA 4OKDA 4P8XA 3TQVA 1M3UA 1WUFA 4I5XA 5DQPA 3LCGA 1DPMA 3UR8A 4IGMA 1G5AA 3B0PA 2NUWA 3IIOA 5BW6A 1QPOA 5GQBA 3MCOA 3TZFA 1RP9A 2Y24A 3WFAA 3PZGA 2G95A 5E0CA 3T42A 3A6OA 3PAOA 3XISA 8A3HA 1E51A 3W37A 2H8XA 1PX4A 3QHNA 5FL1A 1XSJA 3BW3A 5GNYA 2X30A 1NOFA 1V7YA 3W7HA 1ZBWA 3W01A 1XIDA 3TOPA 3P93A 4HMNA 3R8HA 2EPHA 1JDEA 2E6DA 4GY1A 3N15A 3RMJA 1S5MA 3L0KA 2XHYA 1S5WA 3VZZA 4EPEC 1Z3NA 1GOXA 2V0TA 4Q7IA 1LOQA 1T0OA 1IEQA 2R1LA 4HPGA 2WB5A 3TYDA 3VGFA 4RE2A 5FF2A 1NDVA 3MSRA 5LNWA 1TQJA 1C29A 1R3VA 5FIPA 6CGTA 1A80A 4PTDA 3W85A 4A22A 1V02E 3QYQA 4WSJA 3RMEA 5DF0A 4N42A 2J9XA 2EPMX 4Z0JA 2KAUC 1RD5A 1FWGC 1EIXA 4C6BA 1QU4A 4MB4A 4ZZ9A 1VLIA 1QCWA 1XCWA 2VDIA 2RGLA 3L5MA 4XV0A 3WELA 3K1GA 4R85A 3PULA 3W88A 3QLDA 5EMYA 2YDRA 4B5XA 5A8PA 1JCMP 1TVNA 4AC7C 1RBLA 3HTWA 2PB1A 4C6OA 2OKTA 4DJEA 3KX6A 2PWHA 4TVCA 4FSAA 3DI1A 3MQTA 5FJIA 5MKGB 1EC8A 3PK7A 4D6DA 3P82A 4BI5A 3B0YA 1PDYA 3EMQA 3N4EA 4LV4A 1DJIA 1XYBA 3KLKA 1KR0A 2VKZG 1TO3A 4JIEA 1EX1A 3TC7A 3UR7A 1US3A 5CH9A 1KTCA 1H7PA 4H00A 1P6CA 4WOZA 3VKDA 1NOWA 2Z1KA 3WJSA 1DL3A 2BG5A 1RCXB 2QJIA 3OODA 4LB3A 3N6JA 3S8HA 2HNHA 2EKCA 1G4EA 3GIPA 5HNTA 2J25A 1B3OA 4NXSA 4JFWA 1RHCA 5JH1A 1GOWA 1SUXA 2WMIA 1ECEA 1XYMA 3NPWA 2QCLA 3CUIA 1UHVA 1A5MC 3OZMA 2MANA 3DFHA 3CWNA 3N9SA 3AJ7A 1KBIA 1J79A 4UMCA 2YYUA 1FXPA 3NTYA 3AXHA 1NFPA 4GC4A 4J3UA 2ZRUA 1AMYA 4UWMA 3G77A 3R89A 3RYSA 3R10A 4YCPA 3IS4A 2VFHA 5LXEA 4UNLA 3MI3A 3U9IA 1UBPC 1Q6FA 1HJWA 5ABTA 4GPNA 4MJZA 3ZS4A 3WLHA 3P0XA 1XLMA 3FYYA 3NQ2A 3TR2A 3IGUA 4ZQNA 3ANYA 3NSMA 3H8AA 4C1NB 3KEHA 1UR4A 2UBPC 3QV7A 1KXHA 8XIAA 3ARWA 3BGGA 3NQFA 3WDQA 1GGOA 1G1YA 3LLDA 5GPRA 2Y0FA 4DZHA 2PDYA 4NNBA 2E25A 4Y2WA 1LRTA 1R87A 5D9OA 3TN6A 4XKYB 1EIBA 2QULA 4US5D 3WZ0E 2A0NA 5CPMA 1IEIA 4QEEA 1OFAA 1LBFA 1QDSA 4JTDA 2PURA 1SFTA 3AMGA 2A3EA 2EJAA 3BCDA 1WOBA 1JCNA 4LVDA 5JBEA 3B9OA 4AAJA 2A7NA 3GE7A 2J79A 1I2NA 4POCA 4S3BA 4JQ2A 3EA1A 1M7OA 2E8YA 4BJHA 2G3IA 3HQNA 4KWSA 3N73A 1PYMA 3T8QA 3FJNA 2JF6A 3IJ8A 1KO0A 3ZJ7A 2C14A 4NZ1A 3LTPA 4M19A 5AYIA 3P60A 1UKPA 3C6CA 4HHPA 1LCOA 1IXOA 2OEJA 2YIHA 3QR3A 3N3MA 4GXMA 4E8GA 3HU7A 2IXVA 4US6A 4AZCA 3WLRA 2C79A 3LENA 2QF8A 3BW4A 4Z1YA 3MHFA 1XD1A 3RF9A 1XBXA 1QHPA 1FH9A 4TQTA 4PMNA 5JIWA 1NF0A 4Q8QA 3VX0A 1GZGA 4MB5A 4QLKA 4XKMA 4I9AA 2GQ8A 4LS2A 2E68A 4AEEA 3QRHA 4YVPA 2GJLA 3OG3A 2H3DA 1QMLA 1TG7A 4E4UA 3DHFA 3TTSA 3B3DA 3F4NA 1A0CA 3V0TA 2C19A 5AN7A 2DZBA 1OX4B 2GQ3A 3ZMRA 1LTDA 1IYXA 4ZTYA 4ZMGA 3CM4A 1W17A 1V6VA 2QUUA 3C52A 2F2KA 3A12A 4U2ZA 5CPSA 3WENA 4EACA 2H6RA 1EO7A 1YE4A 2PU1A 4HMEA 3RU6A 2ZA2A 2BLEA 3RN6A 3NZQA 3KRZA 1RALA 3AROA 5REQA 3ABSA 2J8GA 4QQUA 3KVJA 2OQLA 3VCCA 3WX7A 1FY6A 2DV0A 4FNRA 3PFRA 2ZX9A 1SZFA 1DJHA 2Q8XA 5GJNA 4UTWC 3S5SA 2ZIDA 2UY4A 3VNYA 4D9PA 3GS6A 2B81A 4PUDA 3UWWA 3LG3A 3DERA 4YJ5A 4K7YA 4Z1DA 5G1TA 8TIMA 4JFUA 2XG9A 3CXOA 1U22A 4MYAA 4UR9A 3VCRA 4DRSA 1KW1A 4LV9A 1BWLA 1TSIA 3OLEA 4E3TA 4HVXA 2PI6A 2YBVA 1POJA 2JFEX 2WBGA 4D8LA 4QJ5B 1K6AA 5DX7A 4FLSA 2O56A 3KHJA 4Y9MA 5CCZA 3EWUA 3K5XA 4UFLA 3QC3A 4JFSA 1GVSA 4L4OA 4KPLA 1UR2A 4AD3A 3THUA 2QV4A 4KESA 1FWNA 5F4SA 1S2CA 1ISXA 1J12A 3WQFA 4M1RA 2WSRA 4QXIA 3WIJA 2HVOA 3U2ZA 2XUCA 4H8HA 1KV5A 1HTIA 4K37A 1NARA 4W5UA 3MO7A 4MIMA 3NOEA 5H8MA 3GZAA 2UY5A 3H7UA 4ROQA 7XIMA 2CFFA 2PRLA 2OJPA 1LORA 3RPTA 2ODOA 4GVIA 4IOTA 3GDTA 2YL9A 4M80A 4NAEA 3V7PA 1ECQA 2GVGA 3ZT5A 4BF9A 4FOKA 3B8WA 1W91A 4Z2JA 3L2LA 7TAAA 1TKKA 3FA4A 4GVHA 1R3RA 4P8VA 1VJIA 4IMFA 3QTGA 3ITXA 4JTAA 3BDKA 3FX4A 1XYFA 3UR2A 4A2RA 4L6OA 3T7VA 1V77A 1O12A 4B5SA 2TODA 5BNKA 2GK1B 2X2YA 2GJNA 3DHPA 1YTKA 3JS3A 2OEKA 3MUAA 2J74A 3CQKA 2XH2A 3GAKA 1OC6A 4K7VA 3KP0A 5DY3A 3RR4A 3Q67A 3W1QA 3CZJA 3O7UA 3GTIA 2QGHA 1JAKA 3PUOA 3UP8A 5T26A 4JTSA 1O95A 3TUUA 4F3HA 4XX6A 3OA5A 2G97A 1QW8A 3DAQA 2Q01A 1LLOA 1N2VA 2V2DA 5CXPA 1O60A 1JFXA 4QJ3B 1WA3A 3S42A 4UTUA 3BQ5A 3W83A 3OB8A 4KCVA 3AWNA 1SFLA 2I9UA 2WC7A 3TMLA 3VFCA 4IIEA 4INFA 1PZ2A 3HN3A 3PBWA 4KERA 1TZ9A 5IBXC 2PFHA 4EPBC 4CEXC 1ZAHA 2BY2A 1NWSA 3CB8A 3URBA 4RKAA 2PDQA 5HATA 3TLQA 3QOMA 3UXLA 1XKYA 2XIMA 4PMVA 5CBBA 4WSKA 4QITA 1OQFA 1GYMA 4XWUA 4LBUA 2QUMA 4UFJA 4Q8OA 1EQCA 2ZRZA 1A53A 5DEZA 3NEHA 3NL3A 3USBA 2ALDA 4ACZA 4Q8WA 3T78A 1FXQA 1VPYA 5I2UA 2OODA 3GNXA 3WQ6A 1GQIA 1XGDA 1VZWA 3VD9A 4EANA 4FLQA 2IPJA 3NZRA 4EE9A 4HU4A 5EMMA 1DEDA 2OU4A 3LM7A 2QUNA 2J9ZA 5AYYA 4HSNA 4EPKA 3C0QA 1D3CA 3RG6A 5G4WA 2NV9A 5CPNA 1OWQA 1PSCA 1I2RA 1YDOA 4G8TA 3E2VA 1Y7VA 1DYSA 1QATA 3CTLA 4QNWA 2CBUA 2AKMA 1J0JA 4JKLA 3SSJA 1M7XA 4LEFA 1YEYA 2Y5EA 4HTBA 3CEUA 5XINA 3ZT6A 1PXGA 4DX3A 3A4XA 4YTQA 3PS7A 4YTSA 1PB0A 2QXWA 4QSHA 2XWEA 4QCFA 4GK8A 1GK8A 1M7PA 3IIVA 1E9ZB 1XQKA 3G0SA 2YCLB 4GFIA 1OFQA 1UP3A 3EKZA 3NYZA 3QF0A 1E56A 3EOLA 2ZX5A 4O15A 3QSTA 1NFGA 1EJRC 1D9EA 4PTXA 5FF7A 4E2BA 1OG0A 3GSMA 4OJYA 1NM9A 3M0LA 4WXYA 3NGFA 2ZWYA 1LG2A 3NEVA 3VO0A 1TE6A 2PDLA 1OX5A 3NOYA 1GTEA 4KH2A 3WNKA 4X2RA 1EHAA 9RUBA 3GXFA 4X3ZA 1EJXC 3QHOA 1FTXA 1RV8A 2X09A 3L4VA 4PMQA 4J40A 2ACSA 1DORA 1UIOA 4V33A 1VFLA 2CPUA 3M16A 3MZ2A 1JZ5A 5D2XA 4R7JA 4ZODA 4P8WA 3DYMA 5M17A 1V6TA 3O15A 4B3KA 1PZ3A 4DM1A 4IM4A 2VCAA 3NZ1A 4N9BA 4J35A 3NCOA 4D8AA 3URQA 2QKFA 1JG9A 1J0KA 1VIZA 1BYAA 3BUVA 1PKNA 3PZMA 2EAWA 5C70A 1MQPA 3QPYA 3RRXA 3NDYA 1ISZA 1F9CA 4AQLA 2WNQA 4BQ2A 5G5IA 1K9EA 1XYZA 4NASA 1C8YA 3K1DA 2HVNA 4QJ1A 1FWAC 3T05A 1OBAA 3QMSA 4CCZA 4KCWA 3WO8A 1FWCC 2PCEA 5BMWA 3WMSA 2R9RA 3L0NA 3R12A 5A6SA 1TPFA 1TTJA 1W0MA 1IV8A 2P1FA 3WQWA 3I3EA 3PHAA 4REQA 4BFAA 2XM1A 3IJIA 5C9WA 2NLYA 3AYRA 3GU9A 3UZYA 4OV9A 3PNUA 3BG5A 3EWCA 5CC6A 4KRZA 1U2YA 1XLLA 1TMQA 4I90A 3Q45A 2YOCA 1TA3A 3CUHA 3AIQA 2OQYA 3UXKA 1JZ7A 2VFGA 1C8XA 3B9NA 3DGRA 3BXWA 5DBUA 1HX0A 1KKRA 1GVEA 2QJGA 3KAOA 3L4TA 3ABQA 3LSBA 3KBWA 3EMCA 1IF2A 4WF7A 3WF1A 2JKEA 3E02A 3N4AA 3LI0A 1ZP4A 5I3FA 1EUNA 3APGA 2ZZ5A 2RKXA 4ZO7A 2V3DA 4AXKA 2NX9A 1I2OA 1MUCA 2R91A 4X22A 1PZ0A 4I6KA 2ZX8A 3E9AA 4GKLA 1LJYA 2C15A 1I8JA 3EOUA 3AHYA 3TA9A 4UTWA 5E9XA 2EGZA 1E1CB 4PSPA 4MDPA 5ABGA 4UC5A 3DX5A 1CGXA 4FX8A 3WDPP 2RJHA 5F2MA 3EDEA 1Q7QA 3MYOA 5LXXA 2HCVA 1UPMB 3MVTA 3TEVA 4XAFA 4B9ZA 2J7GA 1LL6A 4B92A 1YXYA 4K39A 4KIRA 2PS2A 4HCDA 3ZQ9A 1XQLA 3E0LA 4PA8A 5AHNA 3GC4A 2XH4A 2Q3RA 1NWRA 4F8XA 5IHRA 4RL3A 3H4GA 3FOKA 3RDKA 4Q4RA 1UH4A 2WHKA 4HPXA 5DMMA 4WOQA 2BVTA 3CLWA 1EL3A 5EA9A 2WZIA 2Y70A 1DWAM 1LUCA 2W92A 5L6UA 2JIWA 2EO7A 5GJPA 4LSBA 1C91A 5LIWX 3T44A 3GLCA 1DOSA 5J04A 4BQ5A 3W07A 4W86A 4D6GA 1DQWA 2IKJA 5B7YA 3STCA 3LLFA 3QQ1A 1XJBA 1M7JA 1XLKA 2BHYA 1GPFA 4GGHA 3V18A 1ZJAA 2GOKA 2FGZA 4OGZA 5EB8A 4JR5A 2DZWA 3VE7A 3AUOA 4TX9A 1KBKA 2E6FA 3WK1A 3G3MA 1FP9A 2AQVA 1A49A 1YPXA 3MY9A 2DZSA 1IGSA 3CB3A 3SBFA 1DV7A 2CBIA 4DWSD 1ZENA 3Q37A 3PPGA 5JVLA 3G24A 1EC9A 3DG7A 3QKZA 4NYUA 4Y8FA 2Q8ZA 2PF0A 1EGVA 2X7WA 4Q3MA 3M7WA 1RBAA 3IVUA 3H4WA 2I14A 3MUY1 3KL5A 3VE9A 2V67A 5EU9A 1V6YA 3CHDA 3GB6A 5M3WA 4IG2B 3TMQA 5AHLA 2WOQA 1OINA 4ICCX 2HXTA 1MI3A 2XSBA 1X7FA 3N2TA 1K1DA 2R6OA 3BLOA 3CAWA 3KRUA 2FYMA 1XG4A 1P0DA 3PG8A 3STEA 3FAWA 1T5AA 5IBXA 1AA1B 2CW6A 1ME7A 2W9MA 4FIRA 2BWGA 1MNSA 3COTA 3UNDA 4YTUA 3GG0A 1HKWA 3B4YA 1QI2A 5LKYA 4A6GA 3MP4A 3TNOA 4LS1A 3NQEA 4YNGA 5KTLA 4DBEA 3OQEA 4PUJA 1XLEA 1FCUA 1S3TC 2ZVIA 1Q6CA 3LB0A 2XIQA 4UFIA 4EWJA 4K8HA 3NSXA 2ANUA 2BX7A 3W2JA 5LA0A 1BLIA 1ODUA 5AHFA 3HFYA 2R1KA 1XCXA 4O18A 2YCJA 4KFNA 4H04A 6XIAA 4D8ZA 1B0IA 1J4EA 5C9RA 1BQCA 2H9AA 2V5BA 4TV5A 2DT2A 5XIAA 1MUWA 1NELA 2J66A 4Q8NA 5CPLA 3DOPA 1I0BA 2GLKA 3HMCA 3VXGA 1J0HA 4HGXA 2IXUA 2NZLA 4Z1AA 4AC1X 3TYZA 1AW1A 2Q3OA 4XZLX 1PVNA 4HKPA 4LJ3A 4P7LA 1YPFA 1LRNA 3L66A 4QISA 1P5BA 1PUDA 3SRDA 6XIMA 1SYTA 4O0ZA 1EZWA 4MB3A 3G1VA 1D3GA 5DRIA 2FHFA 2Y5JA 1H0GA 3TR9A 3KP1A 3MO4A 3UY8A 3AMLA 1H2JA 3HO8A 4P7QA 4GRSA 3AYSA 4F0KA 1PAMA 5H8UA 1J01A 4L4PA 1XFCA 2NQJA 5E6ZA 1V08A 4C60A 3VIHA 1W8SA 5DFAA 1PIGA 1HG3A 3ITLA 4WXZA 1F