3CQIA

Crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with sulfate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
277
structure length
277
Chain Sequence
b'KQIPLGIYEKALPAGECWLERLQLAKTLGFDFVEMSVDETDERLSRLDWSREQRLALVNAIVETGVRVPSMCLSAHRRFPLGSEDDAVRAQGLEIMRKAIQFAQDVGIRVIQLAGYDVYYQEANNETRRRFRDGLKESVEMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLKQSGYCGPYLIEMWSETAEDPAAEVAKARDWVKARMAKAGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-ribulose-5-phosphate 3-epimerase ulaE
publication title Structure of L-xylulose-5-Phosphate 3-epimerase (UlaE) from the anaerobic L-ascorbate utilization pathway of Escherichia coli: identification of a novel phosphate binding motif within a TIM barrel fold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 110
structure length 277
sequence length 277
chains with identical sequence B
ec nomenclature ec 5.1.3.22: L-ribulose-5-phosphate 3-epimerase.
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3cqiA00
3TC3A 2G4JA 5AVNA 2HCVA 4QE4A 3BANA 1XLHA 1I6NA 2I57A 4YTTA 4K3ZA 1XIFA 2Q02A 1XLEA 5EMKA 1QUMA 2XISA 4HHLA 1OADA 4OVXA 2QULA 3KWSA 1XLKA 4ZB5A 3AYTA 3ITYA 2XINA 3C0SA 3IUHA 1D8WA 1XINA 2HK1A 4DUOA 2GVEA 5J8LA 3M0HA 4QEHA 3M0LA 4GJJA 4G56A 3KCOA 4XIMA 4E3VA 1TZ9A 3BZJA 3CWHA 3M0XA 5XIAA 1MNZA 4A8RA 4X61A 2QUMA 2ZDSA 1XYAA 1XISA 4HNOA 2I56A 3ITTA 5FA5A 4A8LA 1XIIA 1XLIA 1XYCA 5B80A 4EAYA 1S5NA 4XKMA 3IUIA 3UXIA 2HK0A 4ZBCA 5B7YA 2ZVRA 4HHMA 3AAMA 3KCLA 1XIDA 9XIMA 3CQKA 3VNKA 3P6LA 3ITVA 1K77A 3WQOA 1A0DA 3BWWA 2X7VA 6XIMA 5H1WA 1XLCA 3KBWA 3C0LA 1XLGA 2XIMA 1XLDA 3DBNA 4XSLA 3AALA 4J4KA 5H6HA 1XIJA 5TNVA 3AYVA 3CQHA 3UA3A 1QT1A 1CLKA 4QDPA 4XIAA 3U0HA 4W4QA 2NQ9A 3ITXA 3UVAA 8XIMA 3KBJA 1XLFA 8XIAA 2GYIA 4ZB0A 1DXIA 5XINA 4GQBA 5EMMA 1A0EA 1GW9A 1BXBA 1DIDA 1XLBA 1XLJA 4PFHA 1XYMA 3JU2A 3QC0A 5I7GA 4ZB2A 3UU0A 3VNJA 4YTQA 4YTRA 4A8IA 2NQJA 3M0VA 4GJIA 4PGLA 3XINA 5XIMA 3KBNA 3XIMA 4YTSA 1A0CA 2GLKA 3BDKA 3L23A 5EMJA 3ITLA 3VNIA 2J6VA 2X7WA 3N4AA 1DE5A 5C9ZA 1O1HA 3ITOA 3GNXA 4XSMA 1XLMA 6XIAA 4EACA 1QTWA 3KBVA 1XIMA 3KTCA 1XIEA 1XICA 2QUNA 3VYLA 3CNYA 2NQHA 4X63A 4QE5A 3QYSA 5EMLA 4YTUA 3M0MA 3CQIA 3OBEA 1MUWA 1XYBA 2GUBA 3VNLA 4LNCA 3TVAA 1XP3A 1YX1A 1XLLA 3QXBA 1XIGA 4Q7IA 4US6A 2OU4A 3M0YA 3KCJA 3KBMA 1XIHA 4K1GA 3DX5A 1BXCA 3KBSA 3VNMA 4QEEA 3UA4A 9XIAA 4A8NA 1DIEA 1XLAA 3BZGA 2QW5A 4GLEA 3U3HA 3C0QA 4HGXA 4X60A 1XIBA 5AVHA 3IUDA 4XISA 3LMZA 2G0WA 4DVOA 1DE6A 1I60A 5B7ZA 3NGFA 1XYLA 4KW2A 4QE1A 3XISA 3CQJA 7XIMA 4QDWA 3QZAA 3P14A 1S5MA 3FVMA
chains in the Genus database with same CATH superfamily
1VBGA 4F0HA 1FTXA 4GQRA 1XIFA 3L5AA 4LC6A 4HSOA 3P0WA 3UR2A 4B5VA 3VUPA 3HMJG 1X8FA 4AXKA 4ZQOA 4S3CA 5I77A 1E5JA 3AHTA 3VKBA 2BHUA 1K8XA 1ME8A 3PNZA 3A23A 4PMDA 1TUFA 3GHTA 2H3BA 1JUBA 3HG2A 5REQB 1E4MM 4GI8A 4YPJA 2LLEA 2YCKX 1JEZA 2CLMA 2FTWA 3LLDA 2PRLA 3RCYA 3QGAC 4ACYA 1RLDA 3LTPA 4AF0B 2GVLA 1V3MA 3R7MA 1P0BA 2IXVA 4FIRA 4NZ5A 2A3LA 3I65A 4GBUA 4QITA 4KFPA 5C6MA 5AHIA 4XSMA 3PS7A 3W70A 3M5YA 3I3BA 2GVGA 4ZE5A 3GTFA 4Q32A 4K1WA 1MXDA 1IE7C 1W32A 2DIKA 2OGJA 1O94A 1PWMA 3N4FA 4I9TA 3W1QA 5BU6A 4JTGA 1PS9A 4Z0JA 3QHOA 2ACUA 5CAHA 4QJ1A 3B8TA 4JCMA 2ZRXA 3DENA 5HQLA 3CZJA 5CAKA 3DDMA 3SGZA 3DH7A 4UQAA 4AAJA 1R3RA 2DVUA 2PDIA 2VFEA 4XZ9A 3OVGA 3VMNA 3WLJA 3RX4A 3LQGA 2FZBA 4IMGA 3STGA 3MUXA 1AODA 2NV9A 3CUZA 3L4XA 1MNZA 4B4HA 3G0SA 1W17A 3IK4A 3PAOA 1XH0A 1GYMA 4LT9A 3HG4A 3BLFA 4AHOA 3AWNA 2Z6JA 5A8MA 2D2HA 4Q7BA 1A50A 2J9XA 3L4YA 2WZIA 2DVXA 3DESA 3SY8A 1TMLA 4BF5A 3Q67A 2VJXA 2VX7A 4RNJA 5M1TA 3UWUA 3F5LA 4BQ2A 1E0UA 3GNXA 5AOUA 4WF7A 5AC5A 1QW9A 3GG8A 1KRBC 4UOQA 2H8ZA 2YLAA 1S2AA 1L6WA 1EZWA 4M24A 3B9NA 3SCUA 4OUEA 4IP5A 1CGXA 1QNVA 2GDUA 4NYYA 4GLEA 5CXPA 2YDSA 1OFBA 2PGRA 2WNWA 3SCTA 1AH3A 4FNQA 1AFSA 7XIMA 1SZEA 1VEPA 1QJWA 3PBMA 4MNLA 3XISA 3H70A 2ZFAA 4DBSA 2VZSA 3QOMA 1ZL1A 4D6DA 3V5FA 1TX0A 4ZXOA 4U4MA 5EBUA 4H9UA 5L9FA 2XIBA 2FH6A 5JUVA 1X6LA 3A6OA 3GX9A 1ZP3A 3LRMA 4Z2JA 3GDLA 3UERA 3P3BA 1IR2A 5CLWA 1H49A 4BWLC 1HL8A 3U4AA 3UWYA 5DXYA 3O2LA 4RPQA 4XZNX 3QW3A 2Y62A 1OVDA 5CC3A 1RVKA 3N14A 5EMMA 3FSUA 2BX7A 3SCOA 1BPLB 5D2YA 1Q65A 2ZE3A 1U2YA 1JQVA 3W2UA 2A7RA 1CZ1A 3OQEA 3W1PA 7TAAA 3EPNA 4PBGA 4PUWA 3RO8A 1XICA 3EDDA 3VD3A 2VHLA 2X1RA 4LS0A 2YZRA 3M0MA 4M0XA 1R3VA 4FALA 1ZAIA 2Z1WA 2W91A 5CBJA 5BOFA 4IIHA 2J6XA 1C9DA 3C2RA 1MO0A 2QW5A 4Z2HA 3ZS4A 3FFSA 3MKCA 2HQAA 2WSRA 4IQEA 4K36A 1KM3A 1XYLA 2F6KA 3G22A 5ABFB 1RY8A 1H7OA 4UIOA 2NT0A 3P82A 3EWWA 2J4GA 4OZOA 1K6AA 4JTHA 3QHMA 2ALRA 1N8WA 2HS6A 3TA9A 1LOQA 3N18A 5JH2A 5DMNA 1L6FA 1LP6A 3PUOA 4LV4A 3LNPA 3PZMA 1UQZA 3FJ4A 1V0NA 1XDJA 1DIOA 5G1YA 4NL1A 5TBOA 3TC7A 2F61A 2IQ0A 1WDPA 1DYSA 3EEGA 4AD3A 3APGA 1JCJA 3TWAA 3REQA 4GC4A 1UZHA 2QUVA 3DYOA 1NQKA 2HJPA 4XAGA 3N9RA 5GJMA 1IEQA 1K8CA 3VCRA 3WNKA 2TODA 3T2OA 1YQ2A 5DCDA 2VC5A 3WMSA 4C91A 2DJLA 5DQPA 2NQJA 5AHEA 1JDFA 3PFRA 4UTJA 4XB3A 3FAXA 1YPFA 2QIWA 2A3AA 4KIEA 4C6LA 1WE5A 3NYDA 2A3HA 3CWNA 3O6AA 2FLIA 3VYLA 3WNNA 2A21A 2WMJA 3S9IA 4ERIA 2R1PA 1IT0A 1F8MA 2DIEA 3W85A 2NX3A 2R1LA 4WY0A 2Z1KA 1JNEA 2DSWA 5BROA 4XTIA 3AZRA 2Q8XA 3UA4A 4A35A 4QG6A 3K8MA 1KD0A 4AXNA 4RNIA 3TN3A 3TNOA 2J77A 2J24A 5CCZA 4G7EB 1RPKA 3VM5A 2P1FA 5D9NA 4ZOBA 1TPWA 3UWZA 1VBRA 5GVJA 4XZWA 4B4FA 1RALA 2BP1A 2HVMA 1VFTA 1KCZA 5JBFA 1JI1A 1PB0A 5MKGA 1D2KA 3II1A 1P6BA 3MSYA 2CZ5A 2XVKA 4HQVA 2EF9A 2VEMA 4ZGYA 4GX8A 1E3ZA 4E6MA 1Q66A 1YTKA 5A6TC 4ZZ9A 3UZWA 2OZ8A 2ABBA 1YXYA 1E0XA 2X1UA 1D9EA 2DFAA 2YA1A 4GYPC 1ME7A 4ZBCA 2FVMA 1N2VA 5DBUA 3VOGA 2XVGA 3NPUA 3P62A 3TROA 1FX6A 3ZZ1A 6XIMA 5TAOA 2NVAA 2OYMA 1XLGA 2YW3A 2PWDA 3DYPA 1V3LA 3V5OA 1E73M 4IPNB 2DZWA 4GJ1A 1CXLA 3EPMA 5RUBA 3SR7A 3EX4A 3WBEA 1P7TA 4FK9A 4YCPA 5M03A 3W00A 4CU7A 1JQXA 1KQYA 1W5PA 1B9BA 1KRMA 4DZHA 3QKEA 4J3WA 3RO6A 4C6OA 5CSSA 3N17A 1DHKA 3IVTA 1V0LA 3H54A 3CPGA 3TN4A 3G0XA 1AL8A 2PMQA 3DCPA 2HPMA 2PF0A 4OFCA 4IXHA 2WJZA 4IMAA 1LQ2A 1EPXA 2PDJA 4EP8C 2BS9A 1TWSA 4C90A 1PWLA 1BWVA 1RSCA 2E5DA 4QS5A 4JPGA 3UG8A 3UZYA 3CAQA 4M80A 1X1OA 3PPFA 3HTWA 3EEZA 4JR5A 2J75A 3RLGA 4HZ6A 1TFVA 1JZ7A 4GA8A 3M46A 3VDHA 2PDNA 2HROA 1J01A 3ZYZA 4HZMA 3TLLA 1XINA 1IWPA 2FVKA 4NX5A 3WKZA 2DVTA 2E9MA 3N13A 2YBUA 1ICSA 4MF4A 3QF0A 3WZ0E 3R94A 1TIMA 3MWCA 4Q4MA 5DXXA 1XW8A 3BQ5A 3EX2A 1QHOA 4I5RA 4NNAA 3PK7A 3PZ9A 3ZMRA 3THUA 4UCGA 3DFSA 3WQ5A 4PUJA 1F5ZA 2XGBA 4PSPA 4K68A 2QCHA 3O3RA 2MUCA 4J3VA 1Q6FA 5C9XA 4H00A 4D6JA 4JN6A 4NI8A 1OGGA 1AVAA 4R7WA 5D2XA 1PHWA 2ZRZA 4M8UA 3W27A 4Q8VA 1E4LA 2IKJA 2WZMA 3PTKA 2QQ6A 3COTA 1ISWA 2YGYA 2PA6A 1JRCA 1V0MA 1DVJA 1N8FA 3AIEA 3M7SA 4RZ4A 1KWKA 2Y8KA 4PMQA 1F3EA 3GIYA 2DDXA 1H1NA 5J5RA 4ZSUA 1FWHC 4S3GA 1EP3A 2BODX 3QY7A 4S3EA 3KBMA 2IW0A 6CGTA 2QAPA 3VOIA 1V02A 4CD5A 4DJDC 1H09A 1YADA 3R89A 1HFBA 2PODA 2OB3A 3L2MA 1Q45A 2JF7A 3AIVA 2DUAA 2QJGA 4JQ3A 3V0SA 3WH5A 1YTEA 4KBXA 1Q63A 2XISA 1DJIA 4C6FA 3LX9A 3UD6A 1IIHA 1VKFA 5ABEA 4CLMA 1B0IA 4HN4A 4E8DA 1QI3A 3QV6A 3Q58A 4JFWA 1W37A 4FOUA 2OGYA 1YDYA 3AU6A 3U5YA 4YYCA 3NUKA 1LUCA 3MYPA 1KGXA 3GVVA 4JBRA 3O6YX 1GEHA 3LHVA 3LZ5A 3MI3A 3MB9A 1BYCA 4IM4A 1XLDA 4F0SA 3W25A 3FJ6A 3UP8A 3LV6A 3WL1A 1JPHA 4J28A 3GR7A 2NQ9A 4IPPA 1AZ1A 2ZX6A 2IPWA 1EWEA 3QPYA 4H4IA 4JKMA 2PWUA 2UY5A 4HPGA 3WLTA 5CKSA 3A4JA 3AC0A 5DMLA 4DJEA 2VCAA 3WLIA 2QCEA 3V1PA 1HJUA 4AG0A 1OC7A 4KMQA 4LUSB 3TA6A 3QEZA 3AO0A 3H2NA 2ZZ2A 2EGZA 2Y5JA 1GVOA 5AYXA 2NSOA 2V67A 1DP0A 1P4CA 3AIBA 4XZMX 1ESWA 2PDGA 3EXRA 1R46A 1ISYA 3RX3A 2VUNA 5CZKA 4CNSA 3ARRA 2WC4A 3OO2A 2PGFA 1FDJA 1UG6A 3FVMA 4ZMGA 3NYZA 4KQNA 1YW1A 2JKPA 4MADA 4O1CA 1M7JA 2G3IA 1BSLA 3T7VA 4DZ5A 3W53A 1PO9A 1KTNA 2VXNA 4E8CA 2R1MA 1UC5A 4MJ2A 1GT8A 1NP2A 2ISVA 4QISA 5AECA 3EOSA 2PFHA 4K6AA 1M53A 4GXPA 1Y5XA 3MJMA 2C0AA 3Q65A 3O63A 5A8QA 1SPQA 5CG7A 4CQ9A 2P50A 3W83A 5I3DA 4CN4A 1EJSC 2E1WA 5FI8A 4R9OA 1ONRA 2VGIA 3WJZA 1KFCA 3A3XA 2CERA 5XINA 5CPMA 4UTHA 1JJKA 1J5SA 1VBUA 3SEPA 1NDZA 3SN0A 4D8LA 3THDA 3E5PA 3LI0A 1MUMA 3NZPA 2X40A 5M3WA 3MO7A 3T07A 1QR7A 1EC7A 1Y65A 1GOWA 4CCEA 1AW1A 2YA2A 1X39A 3OA5A 2E6YA 1SO6A 3E1F1 4K37A 1NH6A 2H3DA 4GOAA 1RK6A 2DSKA 3U2ZA 3GXTA 1TX2A 1W31A 3U57A 3SIZA 2G0WA 1E70M 3T0AA 3SY1A 4WSJA 1Y0EA 5HJLA 3L68A 4ZFCA 4YTTA 4B9YA 3MPGA 5HR7A 4H6RA 1LCOA 1TUXA 1VBHA 1TVPA 3W2MA 1HW6A 3MMTA 4JFTA 3MKKA 4XKYA 4A8RA 2W63A 4ZXLA 5AKQA 2ZDRA 4H6QA 1ITQA 3WQVA 3ZLHA 1YBQB 3AMLA 4BFAA 2WHLA 4MIMA 2CLFA 4S2BA 4NNCA 3VIIA 5FF2A 4BCEA 5H6HA 3BJSA 3QRHA 5TNVA 4TTGA 4B2DD 4DB7A 1OD0A 1KFLA 3R0KA 4D1IA 2OELA 3WLPA 4BKNA 1IR1A 3S42A 5GJNA 2F2KA 2XGZA 2CZDA 1QNSA 2FMNA 4CU6A 2XM2A 4REQB 1YXDA 2R9RA 3ANUA 3U6WA 2Y61A 3MUY1 1XGEA 4UNIA 3UNDA 1S1RA 1QOQA 2XWEA 3E9AA 3CTLA 2B31A 4ZVJA 5FJOA 5BRBA 2QJMA 4NAFA 5U4NA 4O53A 3GNPA 4FLQA 4QJ3B 1Z42A 4H8NA 3PF3A 3OVQA 3C0QA 4C1NB 4JTEA 3EA2A 4GGBA 1CWYA 4MFDA 2OEJA 1RK5A 1H0GA 4JIIX 4S3AA 4YN5A 1FH9A 3AMKA 5K9DA 4IIGA 2WJFA 4E3TA 3PM6A 2RFGA 3HMCA 5EMYA 1OX6A 3RF9A 4RE2A 2D24A 4AY1A 4WOZA 3OP2A 5I6SA 3VOHA 5D9MA 4LY8A 4IXXA 3AMCA 5I79A 1QPQA 3AWOA 1DJQA 4CEUC 1OYBA 3L4TA 3KBWA 3NGJA 3WLQA 1J93A 3UA3A 1BG9A 3QZEA 4RDVA 4FEZA 4QRNA 5HJYA 5TQLA 4KESA 2PDQA 3W7NA 3L23A 3WF2A 3LRLA 4PEKA 3ENLA 1RVGA 8TIMA 2YOCA 1H3GA 4FNUA 1UMLA 1PAMA 3LK6A 5FCZA 1GPFA 2XZ7A 1EC8A 2J8GA 4UTTA 1V6UA 5LHFA 1S2TA 1P0NA 3CMFA 4CEXC 4MWAC 3QH2A 1KC7A 2FGBA 3A4XA 2ASHA 3BVJA 2IMRA 1AQFA 4RZ6A 3IK2A 1OYCA 2WVVB 1OFDA 3ZSSA 3GDRA 1T96A 1HT6A 3RJYA 5HMEA 1MXSA 1S5WA 2D23A 3WDJA 5D4YA 1C8XA 3DN5A 5IHRA 4JTCA 6REQB 2IUZA 4MY1A 1XLHA 2J7HA 4LS2A 4XBKA 3VGHA 3MHGA 3HGRA 5E0CA 2Q01A 2NW0A 5LIUX 1REQA 4XAZA 3DI0A 3HQOA 3TQKA 1R3QA 1FP9A 5EA9A 3ATYA 2B4GA 4ZFMA 1YE4A 3F4VA 4DAIA 4PUEA 5K4ZA 1S5NA 4H9XA 4U28A 4W85A 2VEIA 3GNNA 1F3TA 5T26A 1ZJIA 4J1OA 2PDHA 2QJJA 4RE4A 3KWXA 2V5JA 2E28A 3Q2DA 4IFKA 3V35A 1CLVA 5BWFA 1D3CA 4PB5A 3IRSA 1O12A 3GRIA 2OLHA 1B9ZA 2EBNA 3LLFA 1I75A 2REQA 1W91A 4Y96A 3BSHA 1EF2A 4MWAE 1R3YA 1Q6OA 3R0UA 3KRSA 3RG6A 1CGVA 4MZ8A 1RD6A 1MFUA 2G3MA 3EWCA 1KM1A 4I8DA 1XYBA 3LPOA 1ALDA 1P0KA 1WDRA 2O9PA 4IMCA 4JZ5A 1A5LC 1DTUA 2E5BA 2PAJA 2W79A 3CAWA 3MMWA 1FFRA 2RHGA 3TJ4A 2ZUMA 4UNKA 3HF3A 4L64A 3QPEA 5E0KA 4Q8NA 1GJWA 7A3HA 3ANYA 3U2CA 2JQXA 4N0RA 3WQCA 3OZPA 2A7PA 1GOMA 5HWJA 1W1VA 3BPWA 4ADSA 3CXOA 4HZ7A 3A22A 4O4WA 3NO5A 3Q4DA 2OWCA 2JF6A 1CXFA 2Y7GA 3UZ5A 1XISA 5KZDA 1ECQA 5I07A 3W7CA 3ISIX 4HTYA 2DZVA 4UUIA 3EWXA 5E0FA 3UJEA 3A4AA 4WSKA 3T0TA 2C13A 2VFGA 2GWNA 2J74A 1CPUA 4HSHA 4PTDA 1BYAA 3C0LA 3R43A 1TKKA 4GUIA 3BOFA 4QQUA 4HT3A 3DG6A 4QDPA 4W5UA 2PC8A 4NZFA 2XN1A 5DFAA 3WBXA 1XRVA 2VDGA 2A3EA 1N55A 1JDDA 5BRPA 3UXLA 3CV6A 1VENA 5D8WA 1MDRA 2QUNA 3UG3A 5LNWA 2WZHA 1UWAA 1MUCA 3BW3A 3PZIA 1EEXA 2DIJA 2EHHA 3KUMA 4FIQA 1KB3A 1RCOB 1TV5A 2QJNA 3KFTA 3MUCA 3GW3A 1DE6A 3C0JA 4ZQRA 3TDFA 3RN6A 4A4AA 4GQ0A 2V69A 4KPLA 1W3NA 2ZZ7A 3ARQA 3CLMA 2J8TA 2E40A 3RPMA 3TYUA 1NY1A 4MMWA 3QW4B 2CPUA 3BE7A 2PI6A 4WY0F 1J11A 1S38A 3W7OA 1VJZA 1HJQA 1TTIA 5A5WA 3E74A 1LG2A 2D3LA 5ABHA 3CM4A 2OLSA 4NT0A 1X7IA 3MV01 1LL6A 2AAMA 2GSJA 4JICA 2X7VA 4JTFA 3NZQA 4W7WA 4EANA 1AH4A 3TX9A 3TU9A 3IAQA 3CH9A 1OGBA 4AZCB 4FOJA 2X8RA 2WCAA 1GJPA 1XYMA 4LUTA 2P0IA 3I4EA 3NXFA 3BDKA 2ZICA 3IPWA 3W74A 1OBAA 3R8HA 3BAIA 5BXPA 1OF8A 5FF3A 5F7UA 3PPGA 3VD4A 3GXDA 3R79A 4B5WA 3IV8A 4C6MA 2V3DA 4EXBA 2C1IA 4GX9A 3LN3A 3JR2A 1E4NA 3PUEA 2WMKA 4UOJA 3KVKA 3U5UA 3TSMA 1UWSA 4NZCA 4LTSA 1JF6A 2PSNA 3FKRA 3G77A 3N9KA 3WJSA 2OODA 3PVFA 3MVTA 5DY3A 1C93A 1UD8A 3WJXA 2GJXA 4OKDA 3AQUA 1VC4A 1JULA 2PLMA 4ROQA 3W7QA 3GD6A 1J10A 1B57A 3FJNA 4X9SA 3IJIA 2ISDA 5CPLA 5A94A 2B7QA 2ZE0A 5LIKX 4E8GA 4L6HA 3AMDA 2J7BA 1B1YA 4J2PA 3W75A 4X61A 1RQHA 3OTRA 1M04A 4FX7A 4HNNA 1WZKA 3NQMA 3BQ6A 4FA3A 3GTXA 3EOOA 3U4FA 4QR6A 3PG9A 2VCCA 4JN7A 8A3HA 1PTAA 3OG2A 1J9YA 1EC9A 3UCCA 1GJUA 3HGSA 2XSAA 4H8UA 2OFJA 1O60A 1JD7A 2QCLA 3LY0A 2I16A 1GW9A 1RA0A 3B4YA 3V75A 3SO7A 4GUGA 4IGMA 1TVLA 3M9YA 2PLCA 2KX9A 2Z6IA 5K7JA 4MDOA 3B9DA 2C91A 1ZNNA 4I5UA 1CGTA 2AOSA 4WX2A 3AS3A 1WP6A 4AB4A 1HKWA 1UJPA 2YX0A 4MWAD 1LWJA 1FCUA 1FHUA 3HBLA 3OIHA 3M43A 2IKHA 3T0DA 3GTHA 3LZ3A 4H01A 3T1GA 2VZOA 3BC9A 4BS0A 1A53A 1YHTA 4KWOA 5FAJA 5LNVA 1OZMA 1OABA 1B3XA 1CW2A 4A21A 5I3FA 2DZTA 4CNUA 4HU0A 2BDQA 4IQJA 4US5D 3LGEA 1OHLA 4P7OA 1TRIA 3W02A 1A3XA 5J8LA 1RLCL 3FHAA 7REQB 4IPLA 4PUMA 4Z0SA 5C8BB 1IEIA 1ZQ5A 3GDTA 3N25A 4AZ6A 4GQGA 4Q3MA 1CECA 3H2FA 2YFOA 3B8UA 4RK8A 1DTNA 4YXGA 4IFOA 2P88A 4XSLA 2BSLA 1K4GA 1F7BA 1NOWA 3UETA 3U0HA 3U7BA 2X2GA 2XWDA 1IQ8A 3G24A 3WDQA 1TTJA 2Q71A 5D02A 3VIPA 2Y70A 1D7KA 1WA3A 2BASA 3QMSA 2WZEA 4AEEA 5C7VA 2W62A 4LCRA 3I10A 4M5PA 1AA1B 3KTCA 3NWRA 1ZP4A 2V63A 2ZA3A 4NP7A 3AZSA 3AXIA 2O92A 1YDOA 3LERA 4IG2B 3G1XA 3E3HA 4UOZA 3LB0A 3FX4A 3RM8A 2Z7KA 2XHYA 1W3LA 5GNYA 4LVFA 1JFHA 4PUDA 4LPCA 1H41A 2R82A 1UH3A 3SCSA 3WFAA 4D72A 1QWGA 3S2NA 1E0TA 3VKKA 2JBMA 3BW2A 3R13A 1GG1A 3FY1A 3BH4A 1CB7B 3MMUA 1QUMA 3CMJA 2OKTA 3WDRA 1D8WA 4O1AA 1EUNA 2GGGA 3VNDA 2ABAA 7ODCA 4LOCA 4U31A 2WMFA 5EKYA 2CBJA 4A05A 3OYZA 3FAWA 1PX8A 2HMCA 2X42A 3WLLA 2BGNE 4RV3A 2QT3A 4S3KA 1I2NA 4I6KA 1LL7A 3VD5A 3CAVA 2VX4A 5I5RA 1KTBA 4IQLA 1G7VA 4PC8A 3MI2A 4NZ3A 2V81A 1OEPA 4G1NA 3W7GA 3NO1A 4GJIA 4O4VA 1YMYA 4AIOA 1GQJA 3TYDA 1TE6A 3GXMA 1DE5A 1PDZA 1O1HA 3AFBA 3EDKA 3MI6A 5MF5A 1LBFA 1LTDA 1WO2A 2VWSA 4QSFA 2HE5A 5CPNA 1R3SA 1AW2A 1O68A 3THAA 2QCCA 2E5CA 5HMFA 2OQHA 4MVAA 4JQ1A 1GVYA 1Z3NA 4ACZB 2RDXA 2C18A 1YEYA 1V3KA 1JUEA 1W0MA 2GGHA 2J9YA 3NDZA 1ZHAA 2D0GA 5IBXC 3VC6A 1E1CB 3S2CA 3N2MA 4Y2WA 2PD5A 3S83A 3WYZA 1UWIA 3LS9A 5M2FX 5IM51 4DZIA 2HCVA 1WQ5A 5AHLA 4GUHA 3NURA 2A6LA 2PE4A 2YYTA 3E38A 2VDIA 1MFVA 1SUXA 1X98A 1OY0A 3TYCA 1OINA 5CGMA 2HVOA 2YCJA 3IJ8A 2D2JA 5H91A 3H7RA 1NTHA 2CLEA 1I2PA 3VNZA 2EEXA 3PB2A 3TN5A 3OHMB 2FB3A 1EBGA 1WKEA 3W0KA 4Y7EA 4EXQA 3TZFA 1T99A 2R94A 2O55A 2E67A 8XIAA 3S9ZA 4L4PA 2PDKA 3QV7A 1K9DA 2QEZA 4PL1A 1P0EA 2GUUA 3QQWA 3ARTA 2L5HA 4R53A 5CZ0A 2QF7A 1G6CA 3MP4A 4BF9A 3MDWA 1A5SA 1PKNA 3RR4A 3PJWA 3C3UA 4XWUA 1GOXA 5BRQA 3R2GA 1R9XA 4O19A 2GK1B 5I2UA 3TTOA 3MP3A 2V5DA 4JEQA 4XD5A 1NAL1 4RV8A 3ZJ8A 2DZUA 3I6EA 1JAEA 2FHBA 5CPQA 3VIGA 1IXOA 1E9YB 1UWRA 2FIQA 4GD0A 1TJ0A 2XTKA 3SQLA 3LNMA 4V27A 1F6PA 4AIEA 3SJ3A 1XGDA 2CC0A 1OGSA 1QPRA 3UR7A 1FVPA 1O6IA 1DJZA 1DWIM 4HBKA 4MAZA 3IRDA 1P1MA 4LB4A 4EK7A 3DHDA 4D8AA 3WH9A 1TWZA 2FQIA 3VDBA 3QGVA 2VGGA 4K8GA 1MWOA 3EWUA 3UWWA 3P6LA 1GUVA 3TTSA 1CNVA 4J2MA 4J7RA 5D03A 3T2PA 4Q6XA 3MJYA 4WHBA 1G5AA 4UR9A 4FOKA 2Y88A 1OG0A 1PXGA 5FEXA 1JIBA 2DZXA 5AFDA 4W8LA 1XH1A 3W6LA 4UB9A 3KEHA 4JDYA 2GOKA 4DJEC 5E5CA 1V79A 3CZKA 2DZBA 4B5SA 1QI4A 3WN6A 4MY9A 1EYEA 1UA3A 1QOPA 3GC5A 2QUUA 3ITGA 4PCSA 2R24A 1V02E 2PU1A 4K39A 3NJ3A 4F4RA 1GOIA 4S23A 1JZ5A 2YDAA 3UCQA 1O5QA 4PMXA 5IDIA 1XFCA 4D2JA 1CIUA 4MNMA 3GU9A 5T9CE 1TJ1A 1RA5A 3VDGA 1WAWA 5I3HA 2JKEA 2P53A 5TIMA 4MGGA 1EOKA 4HP5A 3M0VA 3G2GA 2PP0A 5DT7A 1MI3A 2NXIA 3SI9A 1IEWA 2QJHA 2CZEA 3OZMA 4HPXA 2QKFA 2CLOA 4PR4A 3SRDA 2VYOA 1ADOA 5G4EA 3DHFA 1XSJA 4XAPA 4LQ1A 2QXWA 3ABOA 3EA3A 3IUIA 4DBEA 3T0BA 1ICQA 2NVCA 4OQVA 2BTMA 4IIEA 3AALA 3SFKA 3R11A 2GL5A 2FYMA 3LG3A 1O7AA 3M41A 4V33A 4G8TA 2G4FA 3S5ZA 5I06A 3N3MA 1GPWA 1EHAA 3WK0A 4NVTA 1LQ0A 3M6DA 4HYVA 1E1EA 1ODUA 1VCVA 4JYDA 3VKCA 3N6HA 2A79A 3LHWA 1IGSA 3RILA 3NOEA 3L4VA 1NOFA 2NQHA 1FDZA 1Z48A 4IOTA 3PPCA 4X3ZA 4HA4A 4KT2A 1Q6QA 3WD4A 1ADSA 1I2RA 1DWJM 4BR1A 3PZGA 1B4KA 1OFQA 4HOWA 4P61A 3VZXA 4UQEA 5BU9A 4A22A 1KM0A 4QJ5B 4X60A 1OSEA 3LMZA 1GEQA 4DVOA 1SSDA 3M0ZA 5LNRA 4W8AA 1V4YA 1E56A 3A5FA 4AH7A 1F07A 1QNRA 1FH8A 4RLIA 1QNQA 2D0HA 3IGSA 3W1MA 3MTWA 4EX4A 4REQA 5A6KA 1PKMA 1CGUA 1W5OA 1E1FA 4U10A 4LANA 2DQXA 3CWHA 1K3UA 2PTXA 1YPXA 2DY3A 2H9AB 4FO4A 3WMCA 3SGGA 1WOAA 1QI5A 4QLKA 2GVYA 1TCMA 4GY1A 4IF2A 4Y6GA 2O9OA 3QM3A 4KERA 5A6AA 4O52A 6PTDA 5EU9A 2WMIA 1T0OA 1W5MA 1UIPA 4O13A 1Q6CA 4TO8A 4ZL1A 1I1WA 1MW0A 3NVDA 2JIWA 4NHVA 2A4AA 3RAOA 4P2VA 3ATZA 1XUUA 4U3AA 3W84A 4EACA 1OK6A 3DGRA 4KCWA 2D22A 3VD9A 3FDKA 2Y7DA 2AGKA 3LXCA 5M5DA 4GZIA 2FFCA 3N2XA 4TXEA 3G1RA 4FR1A 2DH3A 3ZOAA 1E15A 4DF2A 2I17A 3TJIA 2UY2A 5AVHA 5HPOA 1GCYA 1M1BA 1VYRA 2BZNA 5AZ0A 3MANA 1UD3A 1W9UA 4TOQA 3U7VA 3EDJA 3ZR4A 2PDBA 1LDCA 3B8SA 1EBHA 1GYNA 1LWHA 1GYLA 4D1JA 1N7KA 1EX1A 2HK1A 3G1FA 1OC5A 4KRUA 3KCOA 2ZXBA 3BGJA 4XD4A 4JTKA 3OHIA 3MCNA 3H24A 5FEPA 5GQBA 4Y9AA 4HOZA 1GKQA 2ICSA 5CZJA 3D3FA 2JIEA 3GC4A 5CJ5A 2HE8A 2TAAA 1S2VA 2F2HA 4YHGA 3BJFA 1RJPA 1TWWA 3N11A 3URBA 4ROPA 2ADAA 1A0EA 4PFHA 3TSBA 3W29A 1CGWA 1L2QA 2Z24A 5HQMA 1A0CA 2ONEA 3OJGA 1EQCA 4UTTC 1TA3B 1E9ZB 3EAUA 3G6MA 2P76A 3V3WA 1PDYA 3FGCB 5D04C 3CT7A 3LPFA 2G41A 4WR3A 3DERA 4CN6A 4L65A 3BLIA 3IJDA 4K1GA 5HWNA 1LLOA 3UFYA 4C6EA 4QSHA 4MB4A 4RUBA 3QN3A 1GZJA 1C90A 3R10A 1WYIA 3EMQA 4N02A 4XBJA 2VENA 3NL5A 1OC6A 3P7YA 4R3UA 3IEBA 1TJPA 3FNDA 4UMCA 4RNFA 1TTQA 4LH8A 5XIAA 1R8LA 3TQPA 1UPMB 2ZDSA 4JOMA 1B90A 3NSMA 4BA0A 3B9AA 2A85A 5HULA 4ICMA 4PCNA 2GGJA 2PGEA 3VMOA 3KOXA 2OEKA 5EYWA 1EJWC 1QATA 3WUBA 4GZ7A 2Z27A 1J2WA 3K5XA 3DHPA 1TZZA 4EWND 4ZTYA 4BQ3A 1UYQA 3UU0A 3JUGA 2VR4A 3JU2A 4F66A 1TG7A 2WSKA 3ARUA 4F2TA 3GG1A 1GG0A 3M0JA 4LFYA 3RYSA 1SM9A 3KL5A 3F4CA 2OSXA 2QCDB 2EG8A 4ICNA 4Q4QA 2C0HA 4JTIA 3WF4A 2CWNA 4NG3A 3QXBA 1IYXA 5AC4A 4IWWA 4IJRA 3WEMA 1RCXB 1UR4A 3MHFA 4AHPA 3AUOA 4UFLA 4JX4A 4UQBA 1IXPA 1SZRA 5ABGA 2FFIA 3BG3A 1T5AA 1U22A 1CDGA 4RNHA 4PMYA 4JNMA 1DWHM 3W2NA 4ILSA 4FLSA 2YL6A 4B5TA 1XWYA 1W3HA 2CKSA 2BV9A 4L80A 4QFUA 3VM7A 4DELA 1R3TA 3I6RA 5HA7A 1JNDA 3USBA 3QZ6A 2V6AA 2PDPA 2GVEA 4QBXA 2ZRWA 3RIKA 4HIBA 3QY8A 3KLLA 2ZCGA 2Z0IA 3GUGA 2Z2AA 3UESA 4LAZA 1EDQA 2UBPC 3DECA 1B4EA 4GIRA 1TPUA 3O8AA 5DBTA 1E5NA 3CQHA 1QPNA 3KBJA 4HA3A 2CETA 2OQLA 2DPEA 4PB3A 4MM1A 3QFEA 3HFYA 3VNJA 4R5EA 3GY1A 2VM8A 3GTIA 4K7VA 3WQ6A 2DGAA 2VT0A 4S3FA 5A69A 1VJSA 4XTDA 5MHBA 4HCHA 2DUZA 6XIAA 5FJUA 1A5AA 1KXHA 3DFPA 1BTMA 1I1XA 1UJQA 4HSNA 2OWXA 3GSMA 2FZ8A 4NAEB 2GZXA 3GYEA 4PCTA 3BMXA 2VEGA 5DMMA 4QS6A 1PKLA 4H6KA 4HPHA 4U3CA 2GFTA 3BG5A 2C15A 4PCFA 1R9YA 3MU7A 2TMDA 2EPNA 1G01A 2W92A 3HV8A 3TW7A 2AL2B 3BXWA 3WK1A 3UG4A 2A7NA 1POKA 3VDCA 4F79A 1D3GA 3VKJA 1JCNA 2PLKA 2QCMA 4HHLA 6A3HA 3RCMA 4NXSA 4EPEC 3ZO9A 1V3IA 1FWIC 2POZA 3ZJKA 3M0LA 5ENLA 3H2MA 1E0VA 4XD6A 4F2UA 1TMHA 3VZYA 1S39A 3CZ8A 3NQ6A 5A8PA 5IXEA 4E0CA 1B3VA 5DLCA 1MQRA 2QCFA 3HPFA 2VX5A 4PE8A 4JD4A 1QWKA 4HNUA 4F40A 2J7FA 3M47A 5KITA 3NQ2A 3UR5A 1EP2A 4A3RA 5DRCA 1I4NA 3KBNA 4PTWA 4Y9NA 4A2RA 4AD5A 1ZPTA 1DJHA 3ARVA 5I00A 1VCGA 2EKGA 1GVRA 3KLKA 4ECLA 3VCCA 2ESCA 1YNPA 1NJJA 1JCYA 5A6MA 2EPMX 2VZVA 2X0SA 1KFJA 2YL8A 1UOZA 4B92A 2YDQA 2DH2A 2TRSA 3OZOA 4Z2IA 2TYSA 3K1DA 2YCLA 3QMRA 1WNOA 1Q8AA 4W7VA 1NWSA 1XKYA 2A5HA 5ECUA 3ONCA 1L8NA 1PEZA 4LUYA 2Z7GA 4TX6A 3CPRA 2Y5SA 1C3FA 1KV8A 1HKIA 1BTCA 3W88A 3TFCA 1W1IE 2VUYA 3N12A 3SURA 2VC6A 3LA4A 1Z41A 2GQ3A 1B30A 1TZ9A 1X1NA 1TCDA 1BLIA 3WF1A 4B3ZA 4W7UA 1D3HA 1AH0A 3S5OA 3O0KA 2BOFX 1KRAC 3RLHA 1N8IA 4HZ8A 1JYNA 1VEMA 3D0CA 4QG9A 1PBGA 2CLPA 5HATA 1OX5A 3EWYA 4NX0A 1VPYA 4N4QA 1SZGA 4Q7NA 2DEPA 3HGOA 2WXDM 1FRBA 4TQTA 4Y9MA 3BJTA 4MJMA 3EB2A 1KW1A 1TO3A 1JCMP 1XCWA 1X38A 4DZAA 3HURA 2TPSA 3J7HA 3VGDA 1C29A 2CZVA 1XX1A 4R88A 2QMJA 1JAKA 2VZTA 2HBVA 4GBDA 3OLDA 2QDDA 2W66A 3DHUA 4TU1A 3A64A 3E2QA 3WLOA 2NT1A 2RDWA 2FDSA 1JI2A 3KTXA 1KBJA 1LQAA 1O5KA 3UJRA 4PMJA 2ANUA 1CLXA 2PP1A 1P0DA 3M0IA 1Q8JA 4DF0A 2A3BA 4WKAA 3LOTA 1EUAA 3DXIA 3LTSA 5CLTA 4P8XA 1OF6A 5FKYA 2ISSA 1EGZA 5KINA 3E6EA 1AMYA 1QK0A 1XM3A 1JZ4A 1KR0A 6ENLA 2B81A 1GQLA 1E6SM 3K4DA 4Y9OA 1XHGA 1DOSA 1XBZA 3EPOA 3ZWSA 3TYEA 3W37A 2F6UA 5BZAA 4RDWA 3BLLA 3PAJA 4GI6A 4RXFA 4N9BA 2WJEA 2GOUA 1PHQA 2HEJA 1UC4A 4PMUA 3VPLA 2DSVA 4C7GA 4PRRA 2UY4A 2J6VA 3NDYA 4MWAB 1PIFA 1VFMA 1BXNA 4E5TA 4MHBA 5LGXA 4AD1A 5LZLA 1GOOA 4BF7A 3RNDA 3E96A 3HM7A 3G1AA 1ZBVA 1MUWA 1MW2A 3QBUA 1LT8A 1OFEA 2E6FA 3M0YA 3ALFA 3VGEA 1G4PA 2ZX9A 4C6NA 4QHRA 3W7IA 3G1SA 4OT7A 2C3ZA 3KS6A 2ZA1A 3HG3A 2I9UA 4WEVX 1WAUA 1SJDA 4XQ6A 1NDYA 1XXXA 3V36A 3WJWA 1E6QM 3VXGA 5EMKA 3APYA 2CKRA 3EWBX 1E3XA 2AQWA 1WDQA 3ITYA 4LVBA 5HMDA 4H9VA 5E6ZA 4X22A 5KZ6A 4XX6A 2QS8A 2X0YA 1YDNA 3BCJA 4O8RA 3W7LA 2TSYA 1PV8A 2P8CA 4J35A 5LYRA 1FWNA 4BQ5A 1VLWA 4AD4A 3IWPA 1GGOA 1QBBA 3I7QA 3CGTA 3LTYA 5LIWX 5C54A 1XQKA 2XFRA 3LHYA 2DV0A 2VMFA 1CLKA 3K4AA 2DQWA 3TMQA 5DY2A 2XVPA 1TPH1 2EKCA 2V5CA 4I7UA 2VEKA 3R6IA 3CHCA 3M07A 5DEZA 4CD7A 2WQDA 4OJYA 2WYSA 3W81A 2YBTA 2E3ZA 3C4UA 3OZYA 2CLIA 3NZ1A 3WLNA 2PTYA 1S1PA 4N42A 1OT2A 2J88A 1KKRA 1G7UA 1M03A 2OPJA 2PZ0A 4UQDA 4MKSA 3QV9A 4RDYA 4N2YA 3WD0A 1ZJHA 3E0IA 1MQQA 2X2YA 1W3TA 4JQAA 1WBHA 2ACSA 5KEZA 3LCGA 2PBGA 2EJAA 3BLDA 3VIHA 4PL2A 3VIOA 2RH9A 4C6QA 4GYKA 3LPPA 5AZ1A 2Q02A 3FV9A 3NVTA 9RUBA 2BVTA 1ZAJA 1ZBWA 2R8WA 4LALA 3U9IA 4L61A 5A6LA 3A4WA 2V5LA 3PBYA 4XIMA 3EWZA 3F1QA 2ZWZA 1XSKA 2G8ZA 5B80A 3CMGA 4CUCA 1M6JA 2HK0A 2ZZ6A 3VIJA 1G69A 3ZLFA 4DHGA 3B8IA 5A2CA 3SUWA 3GHUA 4FF7A 3RK8A 1EB3A 3RXZA 4GFSA 1XS2A 4GMEA 2BVYA 4NZ1A 3TSDA 1ZY9A 2PDLA 4INFA 1DXIA 1SFJA 4F9DA 4AYGA 3QY6A 1SYTA 3T6CA 3WX7A 3LM7A 4YWSA 3WO8A 3H4GA 3H6OA 1H62A 3H26A 2XVNA 1XI3A 5EMLA 4P8VA 2IKIA 4IIBA 3S0CA 4QIUA 4N9DA 1EXPA 2BHYA 3W6YA 3W26A 2C1HA 1RHCA 3PFMA 1NIUA 4F0RA 2PDWA 2VVNA 2PD9A 3H22A 1PIGA 3SADA 1G9HA 4LUJA 3BAKA 3CL7A 4YMZA 3MVIA 2WHMA 4DIAA 4UTWA 3TAKA 3NPVA 2WMGA 3R1ZA 4HPJA 4E4FA 5E70A 4JTSA 3GKFA 3LBMA 2FZMA 2YLLA 4AFYA 2YSWA 3B9EA 3N34A 1LRTA 1IV8A 4AQLA 2O7QA 4LCQA 2NWRA 1G1YA 3L0NA 4XO7A 2E77A 1Q7ZA 3GC2A 1JDAA 1XQLA 4HMCA 3USZA 4LEQA 1TREA 1S2CA 1IXQA 3CHFA 4EVZA 3CYVA 2IQTA 2GYIA 5I02A 1XRTA 4JYEA 1GVEA 1DQWA 2J25A 2O56A 1CXIA 1H7NA 5T9BG 1E40A 4UFJA 1R9ZA 2OO6A 3B9OA 3IGXA 5E1QA 4GCXA 4NNBA 1ZCCA 4LUIA 2GPTA 3NQ7A 3T42A 5LSMA 4DO5A 1XP3A 3MT1A 4KETA 3P0XA 2XYLA 5LA1A 3CBWA 3C2OA 3STFA 4UFHA 2YL9A 1M68A 4E2BA 1KLYA 3QJAA 4A8NA 1JG9A 3VC5A 1HJSA 3B4UA 2QNEA 1XIBA 4HB7A 4QTGA 4IGNA 2NVDA 5JBDA 3PNUA 2MANA 3AXMA 2QIIA 4JFSA 1C8VA 3BURA 4NZJA 2YB4A 3TEVA 3LSCA 4YHEA 3PBWA 4KCVA 4M29A 3QLLA 3RHGA 1LRNA 4S1FA 4OIFA 3GYCA 5BXSA 5FD0A 3ARSA 3QKZA 3TYBA 1FXQA 3PTDA 4JKKA 2V2DA 3EOUA 1R85A 3A9BA 3S2MA 2XH7A 4IH3A 5EY5A 3QTPA 3ZJ6A 3MSDA 1LJYA 4Q8MA 4HU3A 2JE8A 4FMVA 3EA1A 3GH4A 2QYGA 1HL2A 1AUSL 3BO9A 1XLJA 4I9JA 4GE8A 2DT0A 3ZVHA 3L7RA 1HN1A 1PTDA 5D9PA 3LPGA 5DX7A 3C2VA 1MEWA 4FI4A 1MSSA 2CBVA 2Y2WA 3V4BA 4UR8A 3GR4A 3SRHA 4P5UA 1G0CA 1OZQA 3MHUA 4ONVA 3PWAA 3WUFA 3S4TA 1XCXA 3BMVA 1J79A 3OU8A 3N1AA 5C9UA 3CIVA 1HF6A 3P2VA 3W1XA 3NFUA 4DLMA 3VOCA 3U3HA 4ZE4A 3WLMA 1BHGA 3WUGA 4M1RA 4J27A 2PEVA 5CZSA 4S38A 2R6OA 2G95A 3O0FA 1LROA 4QDWA 5CSRA 4I90A 2Y0FA 4Q4SA 2WHKA 3EBVA 4DXXA 3BGGA 2BGQA 4NJIA 4U33A 3T0CA 2VEPA 4DEFA 3REQB 3W01A 1OG6A 3GVQA 3A24A 3K1GA 3M0XA 1SU5A 4CD4A 4FZIA 4MDPA 5CJNA 4L4MA 1A4MA 3FYYA 1HIZA 2X1IA 4KFOA 4LNYA 4IIDA 4NY2A 1A0DA 5G2WA 1QO5A 3PBUA 1VIWA 5A95A 3TNBA 3BLEA 3W07A 4Y8FA 3AHZA 1TR9A 1VFLA 3POCA 2ZKMX 3QC0A 5L6UA 4EPKA 2BXZA 1ZTVA 4OWGA 2Z29A 4CCDA 3C6CA 4WY0B 4OBSA 1NU5A 1PYFA 4MG4A 3W2KA 4E38A 2OWWA 1R6WA 2WVUA 1O95A 1W1PA 4MPQA 1E55A 2G50A 3KS5A 4J3SA 3WD3A 4GUJA 1T8QA 2ZZ1A 3P67A 4D6GA 4CN1A 1A80A 4OBRA 1F61A 4GPNA 4DX3A 4NJHA 3G6LA 4O12A 4HGXA 4KKXA 5AYYA 3NQEA 3NM1A 5MKGB 3G18A 4DF1A 1U30A 2WLZA 5CQ1A 4MSSA 4PUKA 4RW3A 1OFRA 4H8VA 4C5ZA 3OVRA 4WUIA 3BLPX 4PA8A 2WB5A 4PUUA 2A6NA 4C6JA 1PIIA 1MEHA 4CCZA 4LF2A 4GJJA 4N9EA 4HCLA 3L4ZA 3N29A 4Z1BA 4IX2A 5FIPA 4EWJA 3H23A 3H4WA 2CCRA 3HPXA 1R2RA 1V6WA 3THCA 1P7TB 3V0TA 1SW0A 1XLCA 2WJDA 3PBGA 3GFXA 2BWGA 3GVGA 3L2LA 3OGVA 3BV7A 3F2DA 3E02A 3ITXA 4DXKA 4H41A 4AMAA 3R8GA 1VLIA 3SSZA 2J66A 1PSCA 3BAWA 3UY7A 1WXJA 4LX4A 3BOXA 3ITOA 4GIEA 3PZOA 3TTEA 1EJUC 2WOQA 1BGGA 4PTXA 1XIEA 4LBUA 5CGTA 5G2HA 3NM3A 5F1VA 1JD9A 3EX3A 1HP5A 2WSQA 1ISXA 3PSVA 3R12A 3B40A 5CG0A 4ZODA 4C65A 1AQMA 4DJFA 3E2RA 4AWTA 1K7EA 4WKHA 4PSRA 5BNKA 1RCQA 4QLLA 3EMCA 1EGVA 3FW6A 3B8WA 3PZUA 5AC6A 3C2FA 4M6PA 3D6NA 3TW9A 1TQJA 3PUDA 4MAVA 4P7LA 2YKKA 1D8CA 4S3DA 4H9TA 2YB1A 1I6NA 4FXJA 3GW0A 4HNTA 4AYSA 3T4WA 1TYGA 4GVGA 2XJ7A 3NXLA 4L1GA 1YE6A 3FIGA 3A12A 2G37A 3OLEA 3FA3A 3WLKX 4DJDA 3ABRA 4UMBA 1W1YA 2J13A 1XIDA 2YPIA 3CQKA 3JRKA 4QX4A 3HPZA 3TIMA 4N9CA 2XH0A 4JTUA 4LRTA 3T09A 1B3WA 1FKXA 4PYSA 4DWDA 5HR6A 3GS6A 3O07A 1IXNA 1X96A 3OIXA 1IF2A 4WDWA 4L9YA 1HG3A 4H9MA 2ZOXA 1C7SA 4JY9A 4JTJA 1JYWA 1M3UA 1GQKA 3LHZA 1J18A 2WWDA 5CJMA 2X30A 3CTTA 4FNSA 3EKZA 3TV8A 4HA0A 4W93A 1YNQA 3O05A 2F84A 3VNMA 1WPCA 3S8HA 4V2XA 1Z7AA 4MLJA 2QGHA 3R5EA 4GH3A 4JFVA 4ERGA 3QPZA 4QNWA 2XIQA 1R38A 1CGYA 4MYAA 4V1YA 5E6YA 3TC3A 4GWEA 3NQBA 1P6WA 3ABXA 1SJAA 4HMDA 1F2JA 1LUCB 4WDTA 4TUFA 3W6MA 5E09A 2VD9A 4O1EA 2O9RA 3PC0A 4KRTA 3ZT7A 2GQ8A 5CGQA 4NILA 5G5IA 3WQ8A 5AC8A 4HHMA 3AAMA 3MSRA 1YXCA 2YW4A 4A2SA 3E0WA 1EPVA 2JGYA 4RE0A 4CQDA 2BB0A 3CLWA 3C8FA 3CB8A 1L6SA 3SCPA 2VO5A 3XIMA 5HINA 4AZGA 4TVCA 1QHPA 4HU8A 1NF7A 3CUJA 3FKKA 2X7WA 5A6SA 2WANA 3HG5A 2FPTA 3KRUA 1V6TA 4LBSA 3POHA 2DW7A 1ICPA 1F6YA 4HYWA 3BSMA 2C71A 3S1XA 3UZXA 1AD1A 2CHRA 2FHCA 1XIGA 1JCTA 1F3WA 1VAHA 2FZNA 4OV4A 2QV5A 4M51A 5ABTA 4H9ZA 2HBXA 3MBDA 3BZGA 1R0MA 3LRKA 4AZBA 4HHHA 4J40A 1SFSA 4YLWA 5J04A 5A6JA 1IZJA 1F76A 4GC3A 4HVXA 3N2BA 4NRRA 3H2OA 1C7TA 4XBSA 1RUSA 2PDMA 1AQ0A 5IHSA 2YYUA 3GO2A 1T6MA 3C2EA 1UBPC 5LGZA 3PWIA 2VI0A 4G56A 4Q8WA 1QNOA 1XBVA 2FJKA 3HQNA 3C5QA 2V82A 3FYOA 2X16A 2WPGA 1DV7A 1NDWA 4P7NA 3WQWA 3MS8A 2J47A 2VOMA 1C8QA 3S6DA 1SMDA 4O10A 2GQ9A 1WX0A 3JS3A 3F5JA 4RL3A 1XIJA 4KFNA 1QI0A 5GPRA 1ELSA 2OZTA 3BGAA 1E0WA 5JMUA 4LYQA 5D8ZA 2WHJA 1DJNA 1X8CA 3ITLA 1JFXA 4NIRA 3I3EA 2Z1BA 2W27A 4DUXA 4GG9A 3TP4A 3ZIZA 2PTWA 1NVMA 1XC6A 4GO9A 4LVAA 1Q6EA 3MZNA 1TIWA 2WNNA 1P48A 2PUZA 1RJRA 5HUOA 4HK5A 3OA3A 3SRFA 1EEPA 3VIMA 2ZRYA 4HPNA 3LM3A 4X2PA 1UUMA 4Z2KA 4DWSA 1XDLA 2YZ5A 3T08A 1XLAA 3FXGA 1XPYA 1AD4A 4O16A 3ABSA 1LM1A 1VHCA 3SIMA 4XKYB 3B3DA 3AS1A 3TYAA 3VO0A 3DOPA 1Q2RA 3HN3A 3DIPA 3EGJA 5HOSA 4DBWA 1G4SA 4NZ4A 1HKKA 1ME9A 1QFEA 4HK7A 4D6EA 1J4EA 1A4LA 4OBTA 4DO4A 3AIRA 3ITCA 3KL0A 3S46A 2Z2UA 3V1HA 2DUXA 3O6DA 3AJ7A 2NZLA 3BMWA 3KDNA 4NXKA 6TIMA 4HJWA 3INPA 3VOJA 2ON3A 3VVGA 9CGTA 4NI3A 4KS0A 1A47A 3DI1A 5FJPA 1A3HA 5PTDA 1EIBA 3KRZA 3G3DA 3AIQA 4PRTA 1TPEA 4Q8TA 1SW3A 4C5YA 1J0YA 3E0VA 1VGAA 1TZ7A 4YTRA 1XV8A 1E6NA 5HBFA 1UQYA 2QDHA 2E09A 4MKVA 1UKSA 4E2VA 1XLMA 4AZHA 1UR1A 1NM9A 3LUTA 4NAFB 2RDTA 2VZUA 4M6QA 3WMLA 2INFA 1OJXA 1HP4A 3BARA 3CQIA 3CUHA 2ZUTA 3IACA 3MP5A 2EQDA 3RU6A 4QDMA 1JF5A 1BFNA 2CW6A 4HCDA 1E51A 1BXCA 1E71M 4F8XA 4EKJA 3UW6A 3WQDA 1EHNA 2I9EA 1KBIA 4N6EA 3AUJA 4PTMA 3R8RA 2UZ9A 5CPOA 1Q4WA 1K7FA 4IUGA 3WD1A 2D2OA 3AMGA 3EX1A 1F74A 3ZM8A 4MLRA 3LMYA 3OLIA 3KAOA 3SW6A 3HB9A 2BGSA 1TSIA 4PMVA 4IJCA 4JTTA 1JZ8A 5BCAA 4IHCA 3QFWA 1FWCC 4H1ZA 3P74A 3DBPA 2J9ZA 2XG9A 3MUIA 4OHQA 2P10A 4LU0A 3LEPA 1BVNP 4FB7A 2BOEX 1WZAA 3HFTA 1FWSA 4B16A 3GG7A 2BOGX 5JVLA 3E0FA 3AYVA 4HA1A 5AB3A 3FK4A 3ZT6A 5HJXA 1OM0A 1Q6LA 3L0GA 4OECA 2Z1SA 3W38A 1UCWA 2J62A 4H2CA 4K7YA 2E9LA 3TN6A 5AYIA 5K2ZA 1H1ZA 3VNIA 4KGLA 3N4AA 3AYRA 8RUCA 3S6OA 1OYAA 1G4TA 1BQGA 3PZNA 5CSUA 3TE9A 3M64A 1F4HA 1XYZA 2OMAA 3LXBA 4JHOA 2ALDA 4W86A 1V08A 1NFBA 1EP1A 3PZTA 1XLLA 5D33A 1UZ1A 1FWTA 4DXVA 1RBAA 3GFZA 3RRAA 4A3YA 1XIHA 1DWGM 4LAKA 4LW7A 4UXDA 1US2A 3OYXA 1K02A 2OZ3A 1REQB 1Q3NA 1UZDA 2NLIA 3G1YA 3W7KA 2VFDA 3N2CA 4DPQA 1BF6A 1W56A 1BRLA 1EJVC 3IIXA 3VUSA 3WQ4A 1B3OA 2VFHA 1Z69A 1UR0A 2VGBA 1RV8A 4XG1A 3OGRA 1HKJA 3A3WA 2ZUWA 1TPVA 3M16A 5H2ZA 2VD8A 1H51A 3BL3A 4CD8A 1FY6A 1WKYA 3B0PA 2WZTA 1ZFJA 3WH7A 1JUKA 1UD6A 4IFKB 1G67A 1R47A 4ZOEA 3T55A 4QAIA 2Z4GA 1EO7A 4XKMA 4DLFA 4D6CA 3NSNA 4IL0A 3UWEA 5A6BD 1XGZA 3D3AA 3HIJA 3HPAA 1T8XA 5C2GA 1X7FA 2R91A 2REQB 3WQGA 2V5KA 4PRWA 4Z1DA 4C1LA 4RXGA 2FHFA 1WCGA 5REQA 4BHYA 3M0KA 3BUVA 1JZ3A 1UUQA 1GTEA 5TF0A 2DZPA 4WRHA 1MQPA 1A5KC 3T78A 3SDOA 4AF0A 4AHQA 4W9TA 1V0KA 1FCQA 3NL3A 1FWGC 4BI5A 3WEOA 4POCA 1X97A 1VR6A 5DF0A 3CPUA 2CBIA 3HA1A 2VELA 5IFTA 3UEQA 2AAAA 5AHMA 1L0PA 5IOBA 4QG8A 4M6UA 2PS2A 1H1YA 3MSGA 2BY3A 1GHSA 3M5VA 3C2YA 3GQYA 3KOYA 4IISA 4Q4RA 4GI4A 3W86A 4LAOA 3SUVA 1UKTA 1UA7A 3WF3A 2CLLA 1SVDA 4D6FA 1Q2SA 3ARXA 1HKVA 1BEUA 1KM2A 3H8AA 1QW7A 4DO6A 1FWJC 2YR1A 3EDFA 4WJXA 4AUBA 1K7XA 2GDVA 3L9CA 1H7RA 3RR1A 4XD3A 4V15A 1E6RA 4OGZA 4LWWA 1DBTA 1QCWA 1GZ1A 2OJPA 1FWWA 2PU0A 1QW8A 1E43A 2V0TA 3S1VA 4NJKA 1ZB5A 4WXYA 2AMGA 3SUUA 4KCUA 3UYIA 4ATDA 4IP7A 5T91A 4JIQA 3QGKC 3JZUA 2OSWA 3FN9A 2FH8A 2D2GA 1I2OA 4X9YA 1RPXA 3KBVA 3WJYA 2PLJA 3QSTA 4XV0A 5K9CA 1E9LA 5HNNA 1JXJA 3NQCA 5F2GA 1EIXA 4LNCA 2VR5A 4LS1A 2W9MA 3IIOA 4PODA 4US6A 1W9PA 1OK4A 3TKFA 3PR2A 2QVNA 2CLKA 3DKLA 1KM5A 2ZC8A 3UGRA 3NQDA 3A13A 3C8NA 4UTWC 1TJ2A 3NO3A 1UR2A 4X2RA 4M1BA 3AISA 3A5VA 3T2QA 4IT1A 1P43A 4ICCX 5F4WA 1QXLA 2WSYA 5CC5A 2GWGA 1MW1A 2XINA 2XN2A 5G4HC 3W73A 3SZ8A 2J78A 1UKOA 2ZZ3A 1V93A 1RBOB 3V18A 5FACA 3W9ZA 4K38A 2DP3A 4CNPA 2VQUA 3GH7A 3SUTA 4C6KA 3CV1A 1WBJA 4D6IA 3ID7A 4LUTB 1KGUA 3DEQA 3UGVA 4CGTA 2R1KA 1QASA 1UW9A 2GGIA 4Q4KA 1QOXA 1RQBA 1ECEA 1XLFA 1K8ZA 4LRSA 3ZR6A 1XRSA 4UNLA 1UR9A 2GDQA 3ORWA 3AIUA 3OPSA 2WV8A 3BG9A 1C91A 2XPKA 2P5NA 4WKFA 1XKJA 1EFZA 3GTNA 2NV1A 3PJTA 2PWFA 3L66A 2YBVA 3T9PA 3UVIA 3W7MA 3PPHA 2GJXB 1AJZA 4ZO9A 4KEMA 2GQAA 1FWFC 4JAWA 3KX6A 3VX0A 1GWJA 1FXPA 3W7EA 4R85A 3ZLGA 2AQOA 1MEIA 3RLVA 1KR1A 2XH4A 1SR0A 1OFOA 1DQXA 5HNUA 4DYEA 4FF5A 1ZLPA 3AROA 4MTVA 2ZYFA 4NU7A 4QROA 1KCXA 1FDYA 1BVZA 4MNJA 1HNYA 3P61A 1QPKA 2C8NA 2VFFA 2YIHA 4RPPA 5A2AA 3WMBA 2J7EA 1OCQA 4W89A 3UZJA 4DUOA 2XZ9A 4P7RA 1XUZA 5ABFA 4DM2A 4QNEA 1JPKA 4CVWA 4A8LA 2NWSA 1OD8A 1GTHA 1M5WA 1GVSA 1MXGA 4IGHA 1GK8A 2W61A 3KOWA 3KOZA 4KIRA 1VPQA 3S5NA 1Q7QA 2W3ZA 1YKWA 3URAA 1HL9A 2WNQA 4OE7A 2BHZA 1DJYA 4ALDA 1OIMA 5EL1A 2J7DA 4JNZA 4FHAA 4PFMA 2WNZA 1TV7A 3AS0A 4ZSTA 3W7RA 1BAGA 2WKGA 1MRQA 3W1RA 8CGTA 3EB3A 3MW7A 2Y4SA 4H19A 3FEMA 5DT5A 3RITA 4CNTA 3RDKA 3TVAA 1MZHA 1AZ2A 4ZOCA 4DBUA 1MDLA 3K30A 2ISWA 4CNNA 4G2DA 4DQWA 1A5MC 1KLZA 2UV8G 5GNXA 2VL4A 4I9MA 3KOFA 3D5HA 1V6VA 2HVNA 1X1ZA 2VDHA 4CQCA 3F03K 4L7ZA 4UTLA 5CC7A 1TVNA 3HQ1A 1S2UA 1KTCA 4IPJA 4KWWA 2Z25A 3BAYA 5HWMA 3K8KA 4IQDA 1OCBA 2PWGA 1TB3A 1H63A 4FNTA 1UUOA 4FPSA 1W1ZA 1Y8BA 1F73A 3VFCA 1UP3A 4AD0A 4O18A 3CC1A 3WQEA 3CO8A 4JX6A 1VP5A 3WNLA 3CYJA 4G7EA 1JPIA 1XLIA 3WL0A 4JTLA 3M4HA 2IQDA 1S5TA 2QPXA 2VKZG 3KCLA 1WUFA 3AHVA 3IJLA 3BLOA 1H5VA 3MUAA 3UWVA 1TV2A 2XFYA 3PP7A 2YL5A 3ICJA 1OCJA 5AYZA 3WBAA 2Y7FA 3W82A 1KV5A 3ECQA 2BFGA 4ORMA 3LU2A 4Q22A 4Q8UA 2E9BA 5C7HA 2GSEA 1NSJA 1MW3A 5XIMA 4PMNA 1A5UA 5LNUA 3LXAA 2H90A 3CZGA 3TYZA 2WQPA 1KCLA 2YA0A 2XIOA 4YTUA 1TRDA 4MZ1A 1QPOA 2YXGA 3BSGA 2A0NA 5A8GA 3TW6A 3LCIA 1UB3A 4BK9A 3V0UA 3W7PA 3VK5A 2NX1A 1Q13A 3VKAA 5C2CA 4LYRA 3TJLA 9XIAA 3WSUA 3MY9A 3VE9A 1K9FA 1UHVA 2QV4A 4ZQNA 1J6PA 1W1A1 1FCVA 1NDVA 4IJBA 3QVQA 1E72M 2GJLA 4DI9A 4M19A 4LSBA 4FX8A 4ADUA 3U8GA 5C2XA 5I3JA 1W8SA 4ZQCA 5A3HA 3GXNA 3DFOA 1GVIA 3FDGA 3IIPA 5IBXA 6ALDA 3DC0A 3FLUA 5FA5A 4HMEA 3UPWA 3N73A 3WQPA 1VFUA 1NP0A 3MO4A 4Q8PA 2W0UA 3VINA 1ZALA 2Y24A 4C7FA 4ORIA 3DFHA 1WUEA 4E2DA 5D38A 4IIFA 3I4KA 3AOFA 4NJJA 1YPIA 1DIDA 2V68A 4KCTA 1XDMA 3D47A 1O5RA 5LNSA 2OXNA 1A3WA 4GYJA 3ALGA 4XZIA 3KRBA 3G1HA 4GO8A 4IMEA 4DJFC 3P84A 3R58A 1EXBA 4ZA0A 5LA2A 5IDZA 4UTUA 3UWQA 3R4IA 4I6VA 4AIBA 3S5SA 2RKXA 5D2VA 1BD0A 3GAKA 3TC6A 3UNTA 3NZRA 3VIKA 4DRSA 4TR9A 2V2CA 2DT1A 1UIOA 2Q6ZA 4DUWA 1K8YA 1PPIA 4JIPA 4TVUA 1V3HA 3UCDA 2WC7A 3I68A 3C61A 5AVNA 3GFYA 3S2JA 2VURA 5E9XA 3L65A 3NCOA 2V9DA 2X1SA 4PTVA 4JQ2A 4MJ4A 2VFIA 3PY2A 4L4LA 3ZXWA 4LVDA 3TQ0A 1J0IA 4A29A 2QUMA 4LF1A 4HNOA 5A8NA 1DJGA 4M7SA 1WXZA 1LRQA 3QMTA 5FOOA 4RZ5A 1TE1A 1Y5WA 3RGTA 4KH2A 1S3TC 1LOSA 1F05A 3WQOA 1JYVA 5D30A 4FXSA 4YCOA 3DBNA 2PWVA 1W9VA 3KXQA 4R7JA 1U1UA 2WC3A 4RKAA 1HQTA 2ZBTA 4GFIA 2A3CA 3LCXA 1RY0A 3GUWA 3W24A 2C16A 1OQFA 1TWDA 1QO2A 5C9WA 4A8IA 3XINA 3NG3A 2VRKA 3ZWTA 3WLRA 2E4TA 4F0LA 5HQEA 2OT1A 1U1JA 4JTQA 5D9OA 4CNOA 3LHTA 3GHSA 2GUBA 3ZT5A 5E9AA 3WIJA 4JTDA 4O50A 5BWAA 4B15A 2OX4A 3W7JA 1IZKA 1O66A 4LUSA 5DMYA 1TTPA 4XZBA 1P6CA 4FR6A 3T8LA 3CL6A 1A5BA 1RJQA 3NQGA 3SCWA 4C7DA 3FXYA 1RH9A 3ZVIA 3CQ0A 5F2IA 1EL3A 5I23A 4HNCA 4FSAA 4RJEA 1W3IA 3WG6A 4WLCA 1O4UA 3B0VC 2EPHA 5CSYA 1LLZA 2XFWA 4MNKA 3WDIA 4QCEA 2NUWA 4ATLA 1ZENA 1FUYA 5KSWA 3BZJA 2YCEA 1UP2A 1EWDA 4I7VA 1S2WA 3TWBA 3UXIA 1FHVA 3MQTA 2WKJA 4WVXA 2GSHA 3CIWA 1FKWA 2VQTA 3W87A 2ATSA 1ITUA 4NQ1A 3RJXA 1QT1A 3CH0A 2G5WA 2QHAA 3LGGA 3SCQA 3G5EA 4ZB2A 2INEA 4JX5A 4UZUA 2Y1HA 1FP8A 3URNA 3B0UX 2H8XA 5C9ZA 5LXEA 1BG4A 1EDGA 1VFHA 5H8UA 3AXHA 4A3QA 2QPUA 3QYSA 3N6JA 3QQ0A 1R7OA 3UT0A 4MFEA 5CBIA 3IVSA 2Z26A 4HOXA 1FHLA 4M81A 3PTQA 5G4WA 4EPBC 2NXGA 2VCBA 3O06A 4C60A 3ARYA 2WCGA 2V3EA 3S3GA 2V2HA 1NELA 2AL1A 1NARA 4MY8A 3ABQA 2BMBA 3AICA 3T81A 1LT7A 4H7CA 2SFPA 3M1ZA 1EJXC 1AW5A 2PC4A 4WIWA 2E68A 4GQQA 3DFTA 4I9AA 1UH4A 4O8AA 1S3HA 1UR8A 2ZIDA 4OVXA 5A8OA 1DWFM 4B90A 1OIFA 1YRRA 4BEQA 1AG1O 2HISA 1SR9A 2YDRA 3VGBA 2HXTA 3URQA 2A2IA 2CHOA 3GG0A 2R1NA 4YWIA 2PRMA 1EKOA 1GQIA 1TPC1 3MMDA 4WGHA 2EXOA 2HZGA 2Q8ZA 3VNKA 3UZZA 4TMCA 3L12A 4XZHA 5JBEA 2E7FA 1W1TA 3OVPA 2PB1A 1I0BA 2W4XA 4KWSA 4AVOA 2QVHA 8XIMA 3KW3A 2PBOA 1VYPX 4JDBA 4C6IA 5AC7A 1DKWA 4UFKA 1JL8A 1W8GA 1TPFA 1YBQA 3IIZA 4PEEA 5BXTA 2GVJA 4XUYA 1DEDA 2I1OA 1WZLA 1A49A 1FCBA 4GNKB 4TMBA 5HDRA 2QJIA 2B0MA 1PZ3A 2ZUUA 1DJWA 3TCSA 2BVWA 3I7SA 1SGJA 3AU2A 4UQCA 2EG7A 1KXVA 1J2BA 1IT7A 1YX1A 3OEXA 1TJRA 3DUGA 3IJ6A 2GJPA 5FF0A 2FPVA 3H12A 1YNYA 3WY1A 4DWSC 4ML4A 2DW6A 3RFAA 2FDMA 4AW7A 3HJZA 2CNCA 1XL9A 3HV9A 2EAWA 5HAOA 1V3JA 3NQAA 5B7ZA 1ITCA 5GNZA 5HPCA 2NXHA 3LD5A 4AZIA 3S47A 3IANA 4GY7A 1ZU8A 5KETA 2D3NA 1SFLA 3H55A 3M7WA 1MYRA 2C19A 1XC4A 4Q6JA 1WDSA 4ZB5A 1U5VA 3AYTA 1EJ7L 4C1NA 1WOBA 4H9YA 2BG5A 4DO7A 4FX6M 2QCGA 4FLOA 4ZO8A 4L9ZA 3QHNA 5K9XA 3GZ3A 1SW7A 2VP8A 4DNHA 4O17A 3BAJA 2WMIB 4P7QA 2F6XA 5FJTA 3NQ8A 1Q6DA 4JHMA 2FZ9A 2XIMA 7TIMA 4QJ4B 5ECVA 1UZ4A 4RR4A 4Y90A 1KA9F 4O1BA 5AYBA 2XIJA 3VZZA 2C6QA 5KTLA 1K6WA 1XLBA 2OYLA 4M6VA 1OWQA 1FQ0A 4NRSA 1FA2A 3UPMA 3MDUA 2DSUA 3PULA 5DANA 2AKMA 3VGFA 1XIMA 1W9XA 4ZOAA 2CXEA 1ISVA 1WKDA 3VIFA 1VS1A 1CCWB 4ASTA 4JIHA 4DJFD 3QYQA 2DJXA 3PANA 1POJA 2ZXDA 2QCNA 4GNJA 2FB2A 4JQ4A 1ONEA 4ADTA 3EX6A 4XISA 3UG5A 3S5YA 4TTUA 4ZCWA 3GH5A 3TK7A 3CT2A 3IGHX 1BKHA 2PDYA 4BI6A 1HX0A 2WVTA 3WH6A 1F3XA 2WVVA 4PTNA 1OX4B 1H5YA 5D05A 1YYAA 4QEHA 1SQ7A 3IAPA 3P8JA 4MJZA 6REQA 4N7QA 4DJDD 4E4PA 1XYCA 1K1DA 2Z00A 3VA8A 1KNWA 4OU1A 1HJVA 2VC9A 4LGXA 2RDUA 2XN0A 3MC5A 2VR2A 1TQXA 1P1XA 3UPBA 3NPWA 5SWUA 2PCQA 4IMDA 2MNRA 3CK5A 2V3FA 1ENUA 4K8EA 4RCXA 2ZWYA 1J8VA 2Y6ZA 1VFOA 1Q4NX 3WEZA 1H61A 4JXCA 4BI7A 1PZ0A 1M7XA 4AZ5A 4J3XA 2OCZA 2WSPA 4QGCA 1J0ZA 3B06A 1JR1A 3SJNA 3GB6A 2QMKA 3MKVA 3ES8A 1K03A 3SRKA 5EGRA 1AMKA 3ME3A 1FBAA 4Y9PA 1AJ0A 1JXKA 1VBJA 3NPXA 1TPDA 2P8BA 3KP0A 3TJXA 5CZTA 3DKJA 2V38A 2Q8LA 1UR3M 4Z1CA 1UBSA 2OKOA 3P5ZA 4GKTA 4AVNA 2YFNA 3F7JA 3B0YA 4CQAA 3UQNA 5HUPA 3YPIA 2NX9A 1UD5A 2BY2A 3DFQA 1W2PA 1EA0A 1S5MA 3O15A 3MV11 1VCFA 1XBXA 3KWSA 4UTIA 3G1DA 1W9BM 4R34A 3WNPA 2QDEA 1KBLA 4PZVA 3LGDA 1JDCA 1I2QA 2JFEX 1DORA 1DL3A 1EF3A 1IT8A 3CUGA 4O11A 4L1XA 2FMOA 4UR7A 3E2VA 1M41A 3HO8A 2VNCA 2DSZA 2ZVRA 4L1WA 2HPIA 3BK0A 5FEWA 3B05A 5C70A 4PBFA 4GNVA 4I7WA 4DBDA 4W8BA 4XIAA 1V03A 5C71A 3E49A 2QLYA 4RZBA 1MVYA 4AY8A 4E4UA 4JYFA 4EIVA 2Y8VA 4Z1AA 4YTQA 1CBGA 3CJPA 5AN7A 4V28A 3TR2A 2NLYA 1LWIA 4Q8OA 4JL1A 3N2OA 3EMZA 3F4DA 3EKGA 3NOYA 3TAOA 3KHJA 3OW1A 1DPMA 4B91A 4NF7A 1CT5A 5DO8A 4NYUA 4AWEA 3PJXA 1H7PA 1VFFA 1KWGA 1MNSA 2WBKA 1Q7MA 4O14A 1YLVA 3CAKA 2V5BA 5DRIA 4GACA 4W88A 1W3JA 1KGWA 2QPSA 3L5MA 3PB0A 3PWGA 3THQA 1V5XA 3W72A 3H2EA 4QAWA 4WOQA 1QI2A 1PZ2A 2WK2A 4K3ZA 1BSIA 1ZRQA 3SGUA 5A6BA 2FGLA 5U7SA 2JGQA 1J0KA 1DHPA 5G1MA 3IUHA 1JPMA 1S46A 2ZADA 2HTMA 1J96A 4J5NA 2O9TA 2VEFA 4AEOA 1K4HA 2OG9A 2P0OA 1Q6RA 4PULA 5LKYA 1VRXA 1J0HA 1JDEA 4C6BA 4JS3A 3BW4A 3FA4A 4MKNA 2JKAA 4LXFA 5JU6A 1UD4A 1EX5A 1NF0A 1K77A 3G8EA 3QV8A 4V1XA 2X09A 1ODZA 1M7OA 3SN1A 1CXHA 3B0XA 1T7LA 2PP3A 4O0ZA 4YTSA 1YDVA 3HJEA 4K8HA 1PL9A 1M01A 3EZ4A 5HNRA 2WVSA 3E5BA 3GIPA 1ITXA 2CZFA 3M5XA 4NASA 1VRDA 4HD5A 4AZCA 3QR1A 1AK5A 1PE1A 4PMOA 1F9CA 4C1KA 4EF8A 3CZLA 4Z17A 2ZXQA 1WV2A 2ACRA 1XFBA 3PJUA 2OU4A 3SM0A 2BBFA 3C56A 1UMYA 3GKAA 4BQ4A 2Z28A 3NA8A 2V8ZA 4LC8A 4DWSD 3NR0A 5C55A 5M17A 5I78A 2NQZA 4J9JA 5E93A 3TR9A 2PF8A 2IXUA 2ZUSA 3N2TA 1ZJAA 4JTRA 3NGFA 4NJGA 1ZS2A 3A21A 3G0UA 1DXFA 4XAYA 4R27A 3Q45A 4F48A 3V7PA 4XAFA 1KO0A 2QULA 3TTYA 4GK8A 1XSIA 4UCFA 4DM1A 2WPBA 2P3EA 3H53A 3LSBA 2G96A 3WUEA 2JALA 4Z2GA 1RP9A 2VWTA 4EAYA 4TV5A 5DN1A 3QR3A 3OBAA 5D2WA 4WK9A 5B7YA 1NWRA 3BWWA 4LY4A 3GHRA 3AIWA 3TOPA 2E0PA 4ZQPA 2Q3OA 2PDXA 4I8YA 1MRAA 2PDCA 5HMSA 1KFKA 2UWFA 1PKYA 4TX8A 3WDHA 4CD6A 4A6GA 1E6XM 1WZMA 2BVDA 3UXDA 1VQTA 4JHZA 2W5FA 2UY3A 1T41A 4B3LA 3RX2A 3TOYA 4Y8EA 2EPLX 2X0HA 3B8VA 3W1LA 7ENLA 2J7GA 2PTZA 2XIIA 2YCLB 1NQ6A 3UXKA 1HKMA 1E6ZA 4ZTXA 4D8ZA 2CWXA 4YS1A 4ES4A 3PUGA 2ODOA 2KAUC 1L2UA 4QM1A 3HGJA 1VH7A 1Y5VA 3IUDA 1SO4A 1FHDA 4KEZA 4O28A 4GGHA 3HPSA 1XD1A 4FNPA 3GNOA 3KZPA 4GXMA 4L56A 5A1AA 1IIGA 1CXKA 3K8LA 3B97A 1RXOB 3NSXA 3L21A 3V5CA 2OQYA 2CIPA 3GXFA 3OBKA 3NZGA 3W71A 2POTA 3C3NA 1JYXA 2XDFA 3D46A 4M3PA 7REQA 3WLHA 3AJXA 2NUYA 3G1VA 4GQBA 4YL2A 4GCAA 1NFPA 2CEQA 1UP0A 5F4XA 5JIWA 3SB0A 5EMJA 1W54A 1ONXA 1R2TA 1QHZA 4AY7A 6TAAA 1K9TA 5J5DA 3L4UA 3WH8A 1NWUA 1SJBA 1GKRA 2Q09A 3LI1A 2HRWA 3NIYA 1HGWA 1W5NA 1CEOA 2XH2A 3LHUA 1V8EA 3VKDA 1KCKA 3MYOA 4IX0A 4MUPA 3MCOA 3PHAA 2ACQA 2B7NA 4S3JA 4AIUA 4GUFA 4IMFA 1B3ZA 4GI9A 3B03A 4I3GA 3GBEA 1Z8AA 4MYXA 2WM1A 4GINA 4YYFA 5CEWA 1I60A 3W1AA 2WBGA 5I09A 5HNTA 2OOGA 4IG2A 1PX4A 1U83A 3ZQ9A 3GE7A 1LBMA 4YVPA 3SFWA 1GHRA 4KGJA 4W87A 2W6RA 1JZ6A 2OEMA 1ZGDA 3T8QA 3EKLA 2G3NA 3QR0A 2O7SA 4UC5A 1M9HA 3NDOA 1IWAA 2I56A 3CWOX 2V30A 1EQPA 1LORA 2ZX7A 4HHPA 4S2CA 4KF1A 1KFBA 1TMQA 1WXYA 3PN8A 4RDZA 3M6YA 5I24A 4J4KA 1XBYA 1GORA 3CEPA 4S39A 4F3HA 3WELA 4AISA 1ML1A 2XM1A 3AZTA 4ZO7A 2RJGA 4HTBA 3TLQA 4DNMA 2EPKX 2V3GA 4XUGA 1CENA 2OOFA 3EDEA 1C9WA 2CU0A 4WZHA 4X63A 2D1ZA 2ZX8A 1H4PA 4ZEPA 5I3IA 1HXJA 3STPA 1AQHA 4N6FA 2F38A 3IJ7A 4C6PA 3CUIA 4YNGA 2NUXA 3KBSA 3ANVA 1U33A 1ZBKA 3DFNA 4X0NA 5FJRA 3RPTA 1SSGA 4ACZA 3L4WA 4HMNA 1CX9A 2CLHA 4GZJA 4H8HA 4Z42C 2OR2A 3IGUA 2XSBA 5FEZA 3VI2A 3S1UA 1OADA 4H6EA 1X6UA 4NUWA 3GVRA 1UWTA 3GDMA 1E1CA 5CPSA 4AZ7A 1KM4A 1JZ2A 3WK2A 4BY3A 4O54A 3DG3A 1AL7A 2VOTA 1Z6KA 2I5GA 4R7OA 3TQVA 1KFEA 4HYRA 1FWEC 2C14A 2INZA 2Z1XA 4EF9A 4L4OA 3RM4A 5DCBA 3AHYA 4OV9A 3ITVA 5CPTA 4O57A 5JQ9A 5EBAA 3OB8A 5DCEA 2PDUA 3KL3A 1EZ2A 2PTDA 4WGXA 3KVMA 3UJ2A 5I03A 3T4CA 4OUIA 4IGSA 4B3KA 3EB4A 3W23A 3BICA 4XO6A 1O5XA 1SO3A 1N82A 4GH1A 4MB3A 5HANA 3CS2A 1H7XA 3WQFA 2ZUVA 4PN2A 1FWAC 3DGBA 3HOJA 4YU1A 3O6CA 1XCFA 1US3A 2PWEA 3H21A 5TD4A 4GZEA 4KRZA 5BW6A 3NNTA 1H7WA 3G3MA 3BTNA 4NSBA 4Q4PA 4U5IA 2AGTA 2HNEA 2VVSA 3E2SA 3U48A 1W9DM 1W2VA 2ZRUA 3LENA 4ZQMA 3OQ8A 3I3DA 3QC3A 3RU8X 5JXQA 1Z89A 4JIEA 2X05A 3RRXA 1FWRA 5H8MA 4L9XA 4Z2LA 2GK1A 4LV9A 4R33A 4KW2A 1RD5A 1IWBA 4XVDA 1NWTA 3W7DA 3W76A 2QZRA 2E25A 3IJQA 2IPGA 3KVLA 1NEYA 4D6HA 4DN1A 3ARPA 1XLKA 2A1YA 3SY5A 4CQBA 2VRQA 5EFDA 3L0KA 1KBBA 1GVFA 3CB3A 4WCJA 5GJPA 3PBVA 3ITTA 4CKQA 3QOKA 3UR8A 3CHVA 1EO5A 3KTSA 1US0A 3A47A 1WDWA 3DFYA 1BGAA 1THFD 2G3JA 1UKPA 2FZDA 3VD7A 2IPFA 1VEOA 5EB8A 4ZB0A 1TV8A 1X6NA 3LCHA 4HKPA 2BY0A 2F9RA 4JTAA 3T05A 3P5YA 3K46A 3P93A 4PGLA 3Q37A 4F9JA 3UBPC 3EYPA 3BV4A 1V77A 3TFXA 1E6PA 1HTIA 1EYWA 1PCWA 3UJFA 2VC7A 2PURA 5CH9A 1JVNA 1FFQA 2IS7A 3EOEA 3S9YA 3QQ1A 4WSHA 3OBEA 3QSRA 1KBKA 1JRBA 1OT1A 5AHNA 2OTDA 3RMEA 1EA9C 2F8QA 3F5KA 3KP1A 1TV3A 3SCRA 3VAVA 5I3KA 3GDKA 1UOKA 3WCZA 2F7FA 4U2ZA 2HNHA 2ISFA 2FTYA 3VGGA 3LYEA 3FJLA 2YXXA 4LAUA 1KFWA 5FF7A 1B54A 3WFLA 2W67A 4JIRA 5A2BA 3AXKA 2GGEA 3IV3A 4EAMA 5I3GA 4HU4A 4OOUA 1BWKA 3KZSA 3NQVA 1QVBA 3WK3A 5LA0A 2J27A 3C0SA 4TX9A 1J5TA 5FF4A 1L6YA 3LDVA 1CXEA 1XPGA 1FWBC 1F6KA 4R9XA 3I7RA 1OB0A 3H7VA 1GNXA 5KZMA 4GY0A 2FJUB 3GXIA 2QUTA 3NEVA 4RX0A 4BWLA 7CGTA 4EXAA 2WW5A 2QAFA 5F2MA 1ONWA 3TXZA 3W2JA 1LYXA 2CITA 1EDTA 1BXBA 2WAGA 3UY8A 4DY1A 1PX3A 5D2TA 5BXRA 1CI1A 4UFMA 3DU0A 2QDGA 2OZ0A 3E12A 5FL1A 2PRHA 3FCPA 4GKLA 4QE5A 2X41A 1V7YA 3AI0A 1KXQA 4UFIA 1BF2A 4MB5A 2VX6A 3VMPA 3N15A 1VPXA 4C6DA 1TV4A 4AX7A 1B5TA 1DIKA 2ZC1A 1NOUA 4TV6A 1BYBA 1LG1A 5KZEA 4KWVA 4GYFA 3L2IA 1BWLA 2Z1VA 2DZAA 4XVEA 3GU1A 3UYCA 3W3OA 1UPPA 5BOEA 2O0TA 2X1TA 2RGLA 2E1DA 3SCVA 1RR2A 2YXOA 3BOLA 4MB1A 1XLEA 2WLYA 4PUNA 3G8RA 4ZR8A 3SUSA 4G6CA 4LJ3A 5LXXA 5IFPA 1L9WA 4G5DA 3S1WA 4F2BA 4UMAA 4S3BA 4EE9A 1LZOA 3MWAA 1QU4A 2O4MA 4EOUA 1P5BA 5BOOA 2DT3A 3MUZ1 3CIXA 1LL4A 4B9ZA 4PCPA 2Y5EA 2HXUA 5F1UA 3ZVHB 3H2CA 2H9AA 2J8FA 4UBPC 2XUCA 4CVUA 3N6QA 3ZR5A 3CV2A 5I7GA 5F2LA 3W7HA 1MMFA 2WWCA 2I5IA 1ZCOA 4DYJA 1K9EA 3CASA 1G94A 1VJIA 2RUSA 2ZQ0A 2DT2A 3GU2A 1XJBA 2ZZ5A 1UROA 5K4XA 2CHNA 4FLRA 4DUVA 4H3DA 4EPDC 1C92A 3F4NA 4G1KA 1IGWA 1U1HA 4Q7IA 4H7VA 3R25A 3WF0A 4LBRA 4JL2A 1ZSXA 3DAQA 3W1UA 3NEHA 1HUVA 4D9PA 4WQ6A 4FS9A 4O0KA 4D71A 3DYMA 2ZTJA 3RCNA 2P3ZA 3B8DA 3P14A 3UF9A 4Q8QA 1UD2A 3W1TA 1ADDA 4J3TA 3F2CA 4JFUA 4WJEA 1DQUA 1XRFA 3P8IA 1A5NC 2B7PA 4AU0A 3RUBL 3LBOA 4A3HA 1F4AA 1LLW