3PFMA

Crystal structure of a eal domain of ggdef domain protein from pseudomonas fluorescens pf
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
243
structure length
243
Chain Sequence
b'SNADHHAWHRLLDRALSEQHFQLYFQPVVAARDTHLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTSRLDLLMLEQVLRQMASHEDCLALNLSAATLADPHALNRVFEILRQHSDLGPRLTLEIGEEQLPEQAMLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRDIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELQVIREMGLYGVQGQLFGEPAPWG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GGDEF domain protein
molecule tags Signaling protein
source organism Pseudomonas fluorescens
publication title Crystal structure of a EAL domain of GGDEF domain protein from Pseudomonas fluorescens Pf
rcsb
total genus 69
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pfmA00
3HV8A 3N3TA 2BASA 4RNJA 4Y8EA 3PJTA 3S83A 2R6OA 5M1TA 4Q6JA 4F48A 3PJWA 3GFZA 3KZPA 4HU3A 3PJXA 5MKGB 4LYKA 3GG0A 4FOUA 4ES4A 4KIEA 4RNFA 3PJUA 3GG1A 4J40A 2W27A 4RNIA 4FOKA 4AFYA 3PFMA 3GFYA 4Y9PA 4Y9NA 3SY8A 5MF5A 4LJ3A 4Y9OA 4Y9MA 4HU4A 3HV9A 4F3HA 4AG0A 3U2EA 4HJFA 4RNHA 3TLQA 4FOJA 3GFXA 5MKGA
chains in the Genus database with same CATH superfamily
3DFTA 1VP5A 4JQ3A 3VKJA 3VMNA 3KVJA 1KKOA 1QRQA 5AYYA 1XKYA 2RGLA 3JVAA 1YXDA 1TWSA 3E2VA 4H7CA 4DEFA 3JU2A 2EF9A 1H7NA 1XCXA 2O4MA 1I2QA 4MWAA 1HKMA 1KGXA 3VGBA 3BLEA 3CZGA 4XAYA 4MOZA 1KBJA 1QPQA 2UBPC 1AH3A 2GWNA 4FOUA 2QDGA 2Y8UA 3IV8A 5E5CA 4C6NA 4CVUA 2CWXA 5LHFA 1W2VA 2X1RA 1A5AA 4W84A 1H09A 3QH2A 3TTSA 1LUCB 3UA3A 5CJ5A 1KXHA 3E0FA 1AQMA 4CLMA 4U28A 2O56A 3WELA 3RO8A 3SIZA 1EGZA 4KRZA 2CHRA 1NSJA 1SZFA 4GYPC 5EFDA 3OIHA 5I7GA 3TNOA 4V15A 2FHFA 1MZRA 3UJRA 3TA6A 3CV6A 1T6MA 2QQ6A 5LA0A 3E5BA 3QY7A 3BVJA 3MB9A 2O9RA 2NSXA 4UQBA 5CZSA 3QMSA 1U30A 5I3KA 1BXBA 3NEVA 4NSBA 4ICMA 4NAFA 3LHTA 5ABEA 4ZB5A 5BRBA 4K1WA 3S2NA 1DJYA 2I1OA 1UROA 2J79A 1XLCA 3DYPA 2QNEA 4GUIA 2ZZ7A 4CKQA 4Q8OA 2G50A 3CMJA 4OGZA 3RNDA 3N2XA 1TWIA 3TNBA 4LEFA 4IPPA 3MDWA 3BZGA 1HJUA 2DW7A 3T1GA 1WDQA 2RDTA 1EJRC 3VNZA 1QU4A 1EJSC 5KETA 2Y5EA 4IL2A 4UQCA 4QEHA 2NZLA 3UJ2A 3G5EA 3L4VA 2YL8A 2PWDA 3LSBA 3M46A 4BHYA 1O12A 3I7SA 4LV4A 2RAGA 5FIPA 1JYWA 1QUMA 5I03A 2XIIA 3T8QA 2YBVA 1ITXA 3SAZA 1DE5A 3VD9A 3UQNA 1UWTA 2YCJA 1DYSA 4ZB0A 2Z26A 1KWGA 3G3DA 5C9WA 1Q4WA 2R1KA 3TYAA 4RV8A 1P1MA 2GGGA 4M1BA 1AD1A 4I8DA 4FAMA 1QPNA 1JG9A 3WD4A 4FNQA 2GGEA 2NXGA 4Y90A 2PDHA 2V82A 5I3IA 3NIYA 4W87A 3PZGA 4UTFA 3MBDA 2Y7FA 5AOUA 4DJFD 3NQAA 2P3ZA 1KQZA 4GVHA 5EBAA 1RQBA 3MQTA 3CLMA 3GVQA 2JQXA 4U33A 1XD0A 3BSHA 3N2MA 4O1FA 3CWHA 3RXZA 1B3XA 1H7PA 3VNKA 5LIKX 3W70A 1GZGA 1KTBA 1T96A 1J96A 3S83A 3FA3A 7TIMA 4UTMA 4PE8A 4NYUA 4NXKA 2YCIX 3N19B 4PRTA 4LYQA 1NDZA 3WF2A 3OGRA 5DY2A 3S2LA 1SO3A 2PDNA 4FALA 5HQMA 3F4DA 5I07A 4YTQA 3W3OA 4JHZA 4PCSA 4PB3A 4GQ0A 4PFHA 1H61A 3MP3A 3V16A 3WQ5A 1E15A 1T8XA 2BY1A 1TJ0A 1TX2A 3OTRA 1XJBA 3CJPA 4XD4A 4HSNA 3MC5A 2Q71A 4HNLA 2W27A 4LUJA 2Z1KA 5AHEA 4N7QA 3MMDA 2F2KA 2OTDA 1L6GA 1A49A 4I6KA 3H7UA 5G4EA 2EPNA 3VFLA 1LQ2A 4CNTA 4R9OA 4AZ7A 2GGJA 1W1YA 3HURA 3TVAA 4O18A 1IZJA 1RP9A 4FZIA 3SSZA 1SW0A 2EG7A 5GNYA 3O15A 2HMCA 3QPEA 3WEMA 3OVRA 2IPWA 1B30A 3BW4A 1SMDA 4O57A 2NLIA 3M1ZA 1V02E 2YCLB 1KRCC 4Q8UA 2BVYA 5D2XA 4ZB2A 4JICA 5C0QA 2GVGA 2HXUA 2Y0FA 1US3A 5CZKA 1W1B1 3C0JA 1K9FA 1UJQA 4R7OA 7TAAA 4AEEA 2VEKA 3ARQA 3UXDA 2ZZ1A 4P8XA 1CLXA 1GW1A 1VFFA 1UP3A 1J2WA 3DAQA 4PTMA 2YCLA 3TK7A 4MWAC 1B54A 3TN4A 5DRIA 2FTWA 2DUZA 4MIMA 4FOKA 2NVAA 4ZGYA 1S2VA 5A8PA 2AL2B 3URQA 5IDIA 4HYVA 3W6YA 1U1HA 1XG4A 1E9ZB 1KLZA 4MTVA 3GB6A 4GYJA 1SO4A 1XYAA 3H2CA 1PWLA 5T91A 3GDMA 3PN8A 2W6RA 4PTWA 1J10A 3SCQA 3QR0A 1RJRA 2W62A 5FJRA 5I79A 1XIHA 2W3ZA 3MWCA 1SZGA 3CIXA 3E0VA 2DZWA 3VAVA 4MB4A 4H6RA 3ABSA 1M7JA 4C7DA 1Z89A 4LYPA 4GH3A 2CHOA 1GYMA 3W7QA 1MEHA 1GWJA 1EYWA 3WH6A 3NPWA 2DORA 4A6GA 2WKGA 4IIDA 1KXVA 3VPLA 5F2LA 4ILSA 1XIEA 3LI1A 5GJNA 3H2OA 4GG9A 4CNOA 3RN6A 2VX6A 4JFTA 3ZT6A 4YHGA 2WLZA 1MXDA 3B3DA 3IIPA 3HV9A 4GYFA 5CBIA 4JFVA 4TX9A 2IS7A 2VDGA 2GJPA 4UQ9A 2PP3A 2WKJA 5EA9A 2GWGA 1PB0A 3FSTA 4Q8WA 1R9ZA 3LRMA 3N34A 3WL1A 1X1NA 1F3XA 2OZ8A 1QI3A 2F7FA 2CLFA 3C8FA 2VFDA 5U4NA 3EX3A 3UR8A 2A2IA 4FLSA 1EXBA 2FJUB 2NT0A 1XIMA 4P7OA 2V3EA 4GI8A 1I2RA 1P7TA 1ZFJA 3B9EA 4F9DA 3TU9A 4L7ZA 4ZL1A 1QXLA 2RHGA 4QXIA 2OMAA 4BI6A 2PWGA 3QOMA 1SM9A 1JXKA 4E3VA 4GI6A 3QY8A 3V18A 1TR9A 3KFTA 3OVQA 2OYLA 2E6YA 2ESCA 3H2FA 1OT2A 4PMOA 1IEIA 2NV1A 3ARSA 3CUXA 1V08A 1I4NA 2XN1A 2ZZ4A 1EQCA 5I09A 3S5SA 2HVNA 3H7RA 4ZO9A 4PMZA 2IPGA 1QOQA 3M7WA 3N1AA 3EA2A 3EBVA 1W3JA 3MP4A 4J3TA 1IGWA 4B91A 5I0DA 3HN3A 2QCDB 1JUEA 2VWTA 2JIEA 4QITA 1FP8A 1JCYA 1S3TC 2VFIA 4IM4A 4XKYB 4M6UA 3W1RA 1EXPA 5BMWA 2W9MA 4H04A 3MWAA 3USBA 1BG9A 1E0VA 2HV5A 1E1EA 1UD3A 1EZ2A 4EKJA 1BF6A 4Q33A 2BXZA 4CEXC 2GK1A 5HDRA 4GZJA 2QUMA 3FX4A 1LOLA 1GGOA 1XQLA 1A0EA 4JTTA 1C91A 1CENA 3V0UA 5DRCA 4F0RA 2QGYA 1H62A 3S6OA 1H5YA 1JR1A 1J2BA 1TV7A 3ORWA 1OGBA 3WDIA 4S3AA 4N4QA 4K1GA 1E71M 3GU9A 4KEZA 2A7NA 4IJBA 4REQB 1M6JA 1DWIM 3PBUA 3IGUA 1KM5A 2QJJA 3AYSA 1JDDA 4EIVA 1W3LA 5HINA 1OCNA 2V5DA 3EWXA 4DO7A 3SGZA 1F5ZA 3W29A 3THDA 4DWSB 4WK9A 1GPFA 1H41A 1UH4A 3FYOA 4S3FA 1BLIA 4HA4A 2J75A 2GUUA 5IFTA 3IAQA 3NQ6A 1YLVA 4OVXA 3ITTA 2YA1A 2XVKA 3FXYA 4ZXOA 5CXPA 4ZQNA 4FIRA 1DPMA 1S2WA 4HSOA 4I9MA 3ZJ7A 1P0BA 2X0SA 2Y89A 2WM1A 5K4ZA 3RMJA 2FFCA 4OU1A 4QJ4B 1JYXA 3A23A 4GCXA 3DDMA 4H41A 3L68A 3NPVA 1P6WA 4ICNA 4HCHA 2GPTA 1U33A 2E4TA 2CETA 3NEHA 4XBSA 4Z1BA 3BDKA 1X96A 3B97A 3TN5A 1Q7MA 4W9TA 1EX1A 3VCRA 3W7HA 4H8UA 2IUZA 4ZZ9A 5FA5A 1Q6EA 3O63A 3PPFA 4DUOA 2C13A 3WK1A 1E72M 1HP5A 1A3HA 3QFWA 2WWCA 4ZMGA 3EYPA 2CFFA 3ERPA 4TTGA 4KCTA 4JPGA 4R7JA 3IJIA 3MV01 3OPSA 4MB1A 3AIBA 2XFRA 4GJIA 2WNQA 4HPGA 3HGOA 3GHUA 4KEUA 2Y85A 2PLKA 3D47A 4C1KA 1B9ZA 2J88A 1ISZA 3P0WA 1TZZA 3GTFA 5CSRA 3PJXA 2WSYA 1TTQA 4ACYA 3PZ9A 4BF5A 1LWIA 2C0AA 2J7HA 1MQPA 4J4KA 1HKJA 2VUNA 2WCAA 3UWUA 2G3FA 4M19A 2XWEA 3O7UA 3PZTA 1R46A 5DLCA 3LXBA 4JEQA 5G4WA 3EZ4A 3AS2A 1H0IA 3LZ3A 5I3FA 4D6EA 2RH9A 3LA4A 4GIAA 2ZRXA 1RLCL 2X1IA 3T2OA 4RK8A 3RAOA 3H2AA 5LSMA 1NDYA 1G7VA 4UTJA 4PC8A 3AOFA 4IG2B 5B7YA 4OBSA 4QCEA 3C8NA 3KBVA 1UWIA 2GQAA 4E8GA 1LG1A 1O60A 4JFWA 3NO5A 3G3MA 1F3TA 1NELA 2EEXA 4AZIA 5CAHA 3DKLA 2HDJA 4N4PA 2ICSA 3CQJA 4MDPA 2I16A 2QDHA 1RZMA 2VC5A 4GJJA 1KGWA 3CQIA 3W6MA 5TQLA 1XH0A 3B8WA 4C5YA 3WLJA 1CGTA 1PIFA 1NFGA 1R3SA 3BOFA 1XYLA 2DW6A 2D2OA 1DBTA 2O7SA 3L0KA 1GORA 3BZJA 3OG2A 4LALA 3CL8A 3LHUA 1E6XM 2TODA 4O1DA 4NNCA 1KBBA 5FJUA 4Y6GA 3FY1A 1C9WA 1CECA 3VA8A 1EJXC 4AF0A 4HZ8A 1KCZA 3V1HA 3A4XA 7XIMA 4R34A 2V8ZA 1TVPA 1FCVA 4CD7A 1TX0A 2GUYA 2I7GA 2F84A 2H8XA 2VVNA 3POHA 3SEPA 3R94A 1ME9A 4RW5A 1TPVA 3VOHA 2EPMX 3WLMA 3COTA 4TO8A 1OD0A 3CTTA 3W07A 2A6LA 1GVOA 3N2BA 3TYEA 5BXRA 1KTCA 3T44A 3B40A 1V3KA 1H7RA 3NQ8A 2BSLA 4KESA 3FV9A 1GOOA 3U4AA 3W7PA 2R1MA 3ARTA 3CQHA 1H2JA 2FLIA 5CPSA 1TJ2A 4KWUA 3G1RA 3SCWA 3WG6A 1DOSA 4QHRA 3UG4A 4HNUA 4LCRA 6PTDA 3VNIA 4IHCA 3P80A 2EPLX 3HPAA 5F4WA 4K36A 3WMCA 1E40A 1GZJA 2D23A 3RPMA 1SSGA 2OEMA 4DNMA 4C6BA 3PP7A 4GBDA 2CLLA 3C2RA 3TMLA 4OTKA 1QPOA 3GXMA 1IYXA 4YU1A 3H7VA 1R86A 1CXKA 4O1EA 3LK6A 1L0PA 2VQTA 3NG3A 2PDPA 1BKHA 3HU7A 3NTYA 3UWEA 1SFJA 3AJXA 1JDCA 3CB3A 4OHQA 3HOJA 4HTYA 4OBRA 4N2YA 1HJWA 5HOSA 3NZGA 4WXYA 1VYRA 2VR4A 3NPXA 2OKTA 1PZ2A 1CNVA 3UWQA 2F61A 2OWXA 1QW8A 3IACA 1OIFA 4C5ZA 2ZA1A 1HKVA 3N3MA 1MFUA 1NP0A 4QM1A 1VF8A 2XM2A 3JR2A 3TW6A 2AKZA 3HV8A 1L9WA 3SM0A 3EPOA 4IXXA 3MKVA 4LAUA 4XB3A 1Q6OA 3C2EA 5KITA 3WJZA 1FCUA 1LUCA 3MY9A 2QT3A 4UMCA 3W0KA 1DXFA 5BZAA 5CSSA 4UTWC 3EB4A 3IRDA 4DPQA 3M4HA 4F0MA 2YPIA 4UWMA 3SN1A 1PV8A 1J0ZA 1UZ4A 1QK2A 4R88A 5A8MA 2CZFA 4XTIA 1C3FA 1SJAA 4RUBA 1TE1A 4LUTA 4AHQA 4JEJA 4O12A 4XX6A 2J9YA 4PUUA 1R87A 3M64A 4AF0B 1LQAA 1UD6A 5JH2A 4B3ZA 4YTSA 3DC0A 3VO0A 3EGJA 1OQFA 4UTTC 4A2RA 5REQA 2AL1A 1THFD 1S2TA 5L9FA 1RA0A 3IGHX 5DCEA 4ZOBA 2TSYA 1K4GA 4FB7A 5AC8A 3WO8A 3AISA 2ANUA 4S3BA 5CSYA 1E6RA 2X16A 2DT0A 5CPOA 1FY6A 2PEVA 3MSYA 1JPIA 4KWSA 2I9EA 1H5VA 4MY8A 2C1HA 3W1MA 4DWSA 5JU6A 4FXFA 4M6VA 2YBUA 3TAKA 4H9TA 1TO3A 4Q8MA 5D9NA 3N73A 2ZUSA 2VTFA 3REQB 5HWJA 1N8FA 3HQ1A 2VGFA 3QQ1A 4OECA 5JH1A 4WY0A 1DVJA 4LS0A 3B8SA 3LBOA 5CC6A 4EK7A 4XAGA 4WDXA 5A6LA 4JIIX 4DJEA 1NF0A 3KWXA 1QTWA 2ZRWA 4UFIA 4PUMA 3WLKX 2XIMA 5ECVA 3QV7A 5HJXA 4V2XA 2OLHA 4RZ4A 2QLYA 2OODA 3H54A 4R9XA 1MZHA 2J74A 1FWHC 4KFNA 3S2CA 1DIEA 2FPVA 1V0MA 1Q2RA 4U4MA 3SFWA 4AWEA 3C2VA 1GVSA 2VOMA 3E2SA 3VFCA 5C6MA 1PZ1A 2FZMA 4D1JA 4MKSA 1O6IA 1PSCA 3N9KA 4MKNA 4RDVA 2QF7A 5EL1A 2IPFA 3RLVA 3S46A 3M5ZA 1K9TA 4GRSA 4B3LA 3NWRA 2J8FA 3NQ2A 5E09A 1U5JA 4RE2A 4H83A 4RZ6A 1D8CA 5I2UA 2NWRA 3GH4A 2VX4A 1DWJM 3L65A 2F2HA 1YNQA 4L6OA 4JTJA 1FWDC 1RJQA 1B3OA 4X3ZA 5HXMA 3IIVA 4IMFA 1E55A 4JKLA 2PDGA 1ESWA 4U3AA 3CL6A 4P7RA 1RALA 4FSAA 1C8YA 2Y62A 3P6LA 1FWTA 1VJZA 1EIBA 2ZRZA 4QJ5B 2P5NA 1UKSA 2FKPA 1ICSA 2FB3A 2NVCA 3NVTA 3H53A 5JXQA 1NQKA 3EXSA 3LN3A 3U2CA 1Q5MA 3DFPA 3FK4A 4JZ5A 3UNTA 1TPC1 2YLLA 1XLDA 4A8IA 4JD4A 2RUSA 1AFSA 1M04A 2KAUC 3VD7A 1S5TA 1X8CA 3QGVA 3ZLHA 3NZQA 4NZFA 3FCPA 4CU8A 2WJZA 5BU9A 2MANA 4KMQA 3DYOA 4UMAA 2CLEA 1XH1A 3W85A 3IAPA 3ABRA 1GOMA 1LL7A 2PAJA 5CH9A 4HMEA 3P93A 2ZCGA 3VKDA 1ZS2A 4PB4A 3B8IA 1KLYA 1EIXA 3P82A 3N4EA 2IQTA 3AU6A 4HN4A 1A4MA 3PPGA 3C3NA 2WMIA 4PUJA 1TQJA 4S23A 3SECA 3UXLA 1J6PA 3UBPC 1DJHA 4GE8A 2DZPA 4P2VA 3E0IA 4H01A 5BRPA 5H8PA 4LBSA 3MP5A 3MO4A 3GTIA 1NWSA 2Z25A 1BFNA 4H8VA 4J5NA 1BG4A 1JCMP 2V38A 2VUYA 2OU4A 4AD0A 1TV2A 2OLAA 1F6KA 3K4AA 1JDAA 2VQUA 3SUSA 2OKOA 1UWAA 3SI9A 3CU2A 3HB9A 3GYEA 5D02A 3I4EA 3VGDA 5M1TA 2ZXDA 1ZJHA 4EWND 4JTQA 1F8IA 4LRTA 3WMLA 4NAEB 4OBTA 1OBAA 2NX9A 3M0KA 3SCSA 1GJUA 2HPMA 5HJYA 1JGIA 1D3GA 2UY4A 1VRXA 2J7EA 3I6EA 1WOAA 3LENA 1ZZMA 4RLIA 2HPIA 4PUKA 1HXJA 1OC5A 1L6FA 2J7DA 1WV2A 4ZTYA 1GVIA 3LZ5A 2PDUA 3DI1A 4RR4A 2BHYA 2E9LA 3FVMA 3RMEA 4L9XA 3BPWA 3K2GA 4U31A 4FIQA 3TX9A 4EPEC 5HAOA 2VP8A 5DCBA 3ZJ8A 2EPHA 3QSTA 4BF9A 3BLFA 3LHYA 1K8ZA 3CWNA 2EQDA 1Q8AA 5EYWA 1OFPA 4A8RA 3BCDA 5FEXA 3AHYA 4MF4A 3TOPA 3W1PA 3MV11 4IMCA 5FF2A 3WLHA 2YR1A 3FVDA 1JGMA 3M43A 1GEHA 4YYFA 4Q22A 2CU0A 1VEPA 2PU0A 3P14A 2A3BA 3P62A 1US0A 3L4XA 4WKAA 1FDYA 4Y7EA 3KS6A 1TTJA 1XS2A 3GG1A 1P7TB 1KW1A 4WHBA 3A4JA 3OBAA 1GUVA 2EJ1A 2PGFA 3IS4A 4DNHA 1XPGA 2UY3A 5HPOA 1JFXA 2CBVA 1VB9A 3Q94A 4L1WA 1E56A 1EP3A 2ACUA 1TV3A 3RO6A 4Z2GA 3KOWA 5E0CA 3W7NA 1Z3NA 3WMBA 2VDHA 4HYRA 4ADUA 5DBTA 3WQGA 3POCA 3ZR4A 4KGJA 2G95A 4X9YA 3S1XA 1UASA 1OY0A 3CT7A 3BICA 2QMKA 4Z08A 4KBXA 1LZOA 1A5MC 3DHDA 1NDVA 1D3CA 5AYZA 2AQWA 1DORA 3CV7A 5BWFA 2ZC8A 2QCDA 3BGGA 4GZ7A 5I23A 1SUXA 3FSUA 4J3ZA 4MAZA 4DY1A 1VCGA 1Q6GA 1FWRA 2Z00A 3TLLA 2MUCA 4MUZA 3STCA 3C3UA 5D03A 3U6WA 1EB3A 1VGAA 2Y2WA 1QI5A 3NJ3A 4F2UA 4X60A 4H7ZA 3NA8A 1Y5XA 4ZO8A 3SN4A 3CAVA 1VFSA 3DHUA 3GG0A 5ABFB 2Z24A 4JS3A 3WJSA 9XIMA 4IJRA 4GIYA 4G5DA 3VMPA 1M7XA 2W63A 5TBOA 4CN1A 2J7GA 4DWSC 3HMCA 2GOUA 2QEZA 3N25A 3RIKA 4O50A 2RKXA 1KM6A 4J35A 4K39A 4OT7A 3BMWA 4DN1A 1CGWA 3A9IA 4NJIA 1ONEA 1IHIA 3QM3A 1IEVA 3LBCA 1ECEA 1WDPA 2ZXAA 3TXZA 3HO8A 3AALA 3IJ8A 3BANA 2Y1HA 2RDWA 4D2JA 4GQRA 1JF5A 3AXMA 5CG0A 3TAOA 3TH6A 3WJYA 1OZQA 4UR7A 1LWJA 3PPHA 4DF2A 4W85A 3TSBA 1ZNNA 2A3CA 5E9XA 5A6BA 4NVTA 3GHRA 3BJTA 4J2MA 1GKPA 3CHCA 4XTDA 4YIWA 3M0MA 2WPGA 2GQ3A 2QUUA 3LERA 2GSJA 3UCQA 4MPQA 3B0UX 1H50A 1Y65A 4Q7IA 3K4DA 4H7VA 3VIGA 1OCBA 3W7LA 2WMKA 1JZ7A 1J0HA 1TMQA 4L4PA 3MO7A 4HJWA 3B06A 4US6A 1WZLA 2V2HA 3CWOX 1FP9A 4IQEA 1UCWA 3QPZA 1PKLA 1JCNA 3M5VA 1FHDA 3TUUA 5J5DA 1E3ZA 3VE9A 2JALA 3KS5A 1X39A 1NWTA 3II1A 4HPNA 1C8VA 1CEOA 4OQVA 3ZLFA 4ZTXA 4F0KA 4M24A 3KBWA 2YLAA 1GW9A 1AQHA 3S47A 1MW3A 1ML1A 2VZUA 1NDWA 3CPRA 3CZEA 4AZCA 2CLHA 5HMFA 1A47A 4F66A 2WM0A 3ZLGA 4GC3A 3E1F1 5EMUA 2ZE3A 3S9YA 1ZTVA 1WNOA 3PJWA 3WDRA 5MKGB 4DM2A 3KL3A 3UVAA 2R1NA 1UP2A 4H8NA 1O66A 4A3QA 1NFPA 2X41A 1DJQA 3AC0A 1WKYA 4IT1A 1LWHA 2CBUA 2XG9A 2YSWA 1JZ5A 1R3YA 7REQB 4LS2A 3ARUA 4LAMA 4MWAE 1DIOA 3WJXA 3EXRA 2XZ9A 1UP0A 4IUOA 1GVFA 1SMAA 2ZYFA 4A4AA 6TAAA 2D73A 1J79A 4AD2A 1M7PA 2Z1VA 1W54A 2UY2A 5E6YA 1OB0A 1P1XA 2PTZA 1VRDA 3M0XA 3LMYA 4RNFA 1H1ZA 3W86A 1A50A 3LHZA 3WDJA 1FWSA 3DFSA 5U7SA 2ZICA 2ZADA 4C60A 4IIGA 4W8BA 3C0SA 3OYXA 1WBHA 3N9SA 3U9IA 3ZR6A 3WF0A 3QLLA 5FKYA 3W1UA 2QV5A 4QE4A 3CT2A 3EMCA 4Q7NA 1QNQA 1R85A 3B8DA 1V6XA 3I3DA 3SW6A 1NH6A 1U1JA 5LNUA 4AVFA 4GZIA 1K03A 4JIQA 2R24A 1IWAA 1I1WA 1KFBA 2A3HA 2VI0A 4I5XA 2V63A 4N9EA 2G8ZA 2XIBA 2OSYA 1KNWA 3M5XA 5IHSA 3NSMA 1UR9A 4IL0A 3R5EA 1V6TA 4Q4OA 3VNMA 4IOTA 5FL1A 4RCXA 1PE1A 4D6FA 3B8UA 3LNMA 1VFUA 1BPLB 2Q8LA 4A22A 2PGWA 3GIPA 3L4YA 1KR0A 1S39A 3CM4A 1HQTA 4US5D 4D6CA 2E28A 4FO4A 2VX5A 2XFYA 5E6ZA 5A8NA 2QV4A 1REQA 4R27A 1JI2A 4K2SA 3F03K 1HZYA 1XYMA 3O3RA 4HB7A 4GIEA 3DENA 1DXIA 5TIMA 4IJCA 3ZZ1A 2Q3OA 1M3UA 1PVNA 3GAKA 1E1CB 1QI4A 1MRQA 1CIUA 2GJXA 4DX3A 1AQ0A 1YXCA 3DFOA 3DESA 4R7WA 3C2OA 3OO2A 3N29A 2W92A 1E6PA 3QJAA 5T9CE 3C86A 4XG1A 1FQ0A 1P5BA 3UU0A 1QK0A 1UC5A 3LQGA 1EOMA 3QKZA 2WSRA 4B5UA 4A05A 3WD0A 1UA3A 3ZWSA 1H60A 1N55A 3PSWA 4NUWA 1RBOB 3W2KA 3TJLA 3SZ8A 3R8HA 2Z4GA 1UR0A 4DUXA 2YYUA 4W93A 4JTKA 3OODA 4QTGA 1QMLA 2PS2A 4UTTA 1V77A 4H2CA 1DQUA 2OB3A 4KT2A 1EWEA 3P3BA 2VJXA 1XUUA 3PUEA 4W88A 4Y9PA 3CXOA 1UPPA 5ABHA 4B5NA 1TPUA 3C0QA 4O1AA 3JW7A 4GK8A 1UB3A 2GUBA 5I00A 3QQWA 1B57A 1XX1A 3BMXA 3PFRA 3ZVHA 1K7XA 1UH2A 3VOCA 2GL5A 4I90A 1JDEA 5FJTA 3LOTA 1AG1O 2D3NA 4FR1A 2NVDA 1I2PA 4Q6JA 1NU5A 4MFEA 1H1NA 4QROA 2OYKA 5DY3A 7ENLA 3STFA 3P7YA 1EGMA 1YEYA 3C2FA 4XIMA 3W76A 4JHMA 2C7FA 3QC3A 3FXGA 4OKDA 4B5SA 3MKKA 1XLGA 3WUFA 3NYZA 3QLDA 3CTLA 4UNIA 3EX6A 1UR3M 1VAHA 2IXVA 2PMQA 5I5RA 1XIBA 4EF8A 1RVKA 1O1ZA 3EOOA 1UKQA 3W73A 2YJQA 3VOFA 3WLIA 4NILA 2NW0A 4HHHA 4M6PA 3QHMA 1Z8AA 4L5ZA 3W7OA 4CQBA 3RYSA 4ACZA 7PTDA 1E9IA 1TZ9A 2INFA 3QTGA 3GTNA 2XTKA 4Q4RA 1C90A 3WMSA 2F38A 1QAPA 1R2TA 2BX7A 1IXPA 1S5MA 1U22A 3AIEA 1R3TA 1XG3A 1FKWA 3VIIA 4PSRA 2DIKA 5TF0A 4NNAA 4WOQA 2VVSA 1JRBA 1DWFM 2R8WA 1Q63A 2VC7A 3QF0A 2DZXA 1TUFA 4GX8A 2QGHA 1PTDA 3H2MA 3K8LA 4NZ3A 1P48A 3WUGA 1Z9AA 1B3ZA 1W5QA 3SCUA 2OSXA 4JYEA 4MNKA 4GUFA 3WBAA 4I6VA 4E2VA 1MRAA 5LGZA 1SYTA 4AIBA 6REQB 1Z69A 4UOZA 3L4ZA 3RM4A 4EWJA 3W7JA 4O13A 3LU2A 1J6OA 2I14A 3A3HA 2Z2BA 3GZ3A 3G1XA 4C1NB 2WZEA 5DF0A 4H1ZA 2V81A 5K2ZA 1VQTA 2PUZA 1V03A 2YOCA 3LI0A 1W9DM 1EZWA 1S1RA 2QDEA 2OOGA 3NXFA 1V51A 1ONWA 3B0VC 1TTIA 4HTBA 2BGNE 1XD1A 3GFZA 5CKSA 1E0WA 2X8RA 4RDWA 4HNTA 5E93A 1UBPC 5LA1A 2CXGA 5C55A 3WLPA 5FF4A 3UEQA 5IBXA 2ASHA 4TVCA 4JX4A 4ATLA 3E12A 3VE7A 3IVSA 2VWSA 4RE0A 3TC6A 2PTXA 1EBGA 2PF0A 1RD6A 1LP6A 3YPIA 1O7AA 3GU2A 3TZFA 2VOTA 3MCNA 4JTRA 5JVLA 5KINA 2ZIDA 3REQA 3PZOA 1AMYA 4DVOA 3MZNA 1DL3A 1RQHA 3W00A 1JPDX 3AAMA 1SZRA 3KVMA 5I3DA 3F4NA 4EPBC 1E4MM 2HBVA 3WNOA 2BB0A 3PY2A 3W22A 3KCLA 2AMXA 3GXPA 2YL5A 3H70A 4IIHA 1WZMA 4U3CA 4Q8QA 3MTWA 1EDTA 4L65A 1D3HA 2HNHA 1LLOA 2WSPA 2ZUMA 3CUFA 1C8QA 1H4PA 2J47A 3V0SA 3O2LA 3GFXA 2VD8A 1EWDA 4AZGA 1DHKA 3AIUA 2GQ8A 4UQEA 4C6EA 2V30A 1GT8A 2POTA 4M7TA 3V5CA 1LROA 3ZS4A 3W24A 3I10A 2X1UA 3ZT5A 1LBLA 4Z17A 3QYQA 3UF9A 2YIHA 1H0GA 3T0DA 2WPBA 3KLLA 3QYSA 3IJQA 3W2MA 4B15A 3HPXA 4WIWA 3QW3A 1XICA 4XVEA 1FXPA 3CS2A 4C6CA 1QDSA 2XJ7A 1GYLA 2FH8A 3FHAA 4JNZA 3AMDA 1UUMA 2UWFA 3W71A 3VD3A 5CPTA 1VLIA 4JN8A 3GNXA 1F05A 3KRSA 3S0CA 1ALDA 4GFIA 1SPQA 4CN4A 4ZENA 3M41A 3H8AA 1XR2A 2XH2A 1BTMA 1TPEA 1TWZA 1XDLA 4WF7A 1BAGA 1US2A 4NZJA 1ITUA 2AAMA 1OABA 3ARVA 3KRZA 1MMFA 1WB0A 2VD9A 4XO6A 1KTNA 3LLDA 3PULA 1KFCA 2Q8XA 2FYMA 1DHPA 1QT1A 3H4GA 3KZSA 3UETA 3PFMA 1G4PA 4LJ3A 4AZHA 2OR2A 3FHQA 3VX1A 3UZYA 4IF2A 4PRWA 4FNRA 1IEWA 4B2DA 3HGSA 4DBEA 4G56A 3EDKA 3DFHA 3GUGA 1DXEA 2GVYA 1OD8A 1NWUA 3QBUA 4HYWA 1B4KA 9RUBA 4HU0A 5C9UA 4PMXA 1EQPA 3T42A 5K9XA 3GZAA 1E6ZA 4BQ2A 3USZA 3PUGA 3CUJA 4ENLA 4XUGA 1BYDA 3PTQA 4BZYA 1LRQA 2FVLA 3KE0A 1O5XA 4RZBA 3UJFA 4UTKA 4XSMA 4ZVJA 2WMIB 1X7IA 3MCMA 1LLWA 1YNPA 1GHRA 1XFBA 3GX9A 1O68A 1JUKA 4WSKA 1MFVA 2B7NA 3TYCA 1YNYA 5C2XA 5D30A 3HQOA 4POCA 2XVLA 4L6DA 3ZYZA 3ALGA 5AZ0A 4DZ5A 2VXNA 3IGXA 3QKEA 1WAWA 3S3GA 3GNOA 5SWUA 5HR6A 4D6DA 1SFTA 4K8HA 3UYCA 3VGEA 2YDAA 4K8EA 2C14A 1IR2A 4HNNA 3WEOA 2F8QA 1R5YA 1XBZA 2WVVA 4CNNA 4YCPA 3V36A 3VD4A 2A3EA 3GO2A 3T4CA 2PB1A 1C7TA 4ML9A 1LL6A 3GSMA 3QSRA 4U5IA 1UWQA 4F0LA 1MXGA 2PDFA 4AD4A 5G1YA 2ZBTA 4AHOA 4B9YA 1HJSA 3BG3A 3BE7A 3S2MA 3FN9A 1N8IA 2X30A 3F5LA 3EAUA 5ABGA 3CO8A 4V33A 5A6TC 3G1HA 4GA8A 3EMZA 4AG0A 1AVAA 1S2CA 2Y8KA 3NL3A 3EWCA 1FHUA 3KP1A 2HS8A 4AEOA 5LIYX 4XSLA 3CZ8A 3S6DA 4L1XA 5FAGA 3UXAA 5C7HA 4Q8TA 2Q09A 3CMGA 1CCWB 4DAFA 4HGXA 3OQ8A 1XM3A 3R58A 3WQ6A 8XIAA 1E4NA 2VZTA 2QCMA 3N6JA 4MPKA 4DJFC 4E8DA 5AC7A 2R1PA 2BV9A 3R1ZA 3BAXA 3UCCA 5A5WA 1F8MA 3VDGA 4DIAA 1ISVA 5E0KA 3SFKA 3I7QA 3ID7A 2ZFAA 4HMNA 2E5DA 4XZHA 1V79A 2B81A 5ABTA 1J0IA 4KCVA 2Y61A 3G0XA 1S46A 4AEFA 4IP7A 1DJZA 1Q3NA 2V69A 3TDFA 1DP0A 2EPKX 3U5UA 3H2EA 1VHCA 1I75A 1TCMA 1O4UA 1TVNA 3GVVA 3LTYA 3FLUA 1GPWA 2XSXA 4D71A 3BK0A 3MUAA 1W2PA 4IZGA 1H49A 2UV8G 3BJSA 3L12A 5I3HA 1BVWA 1QJWA 3I3EA 5CPLA 3VOIA 4G8TA 3EKZA 4B16A 4KFPA 1K9DA 3K8MA 3NGFA 3WNPA 3PBWA 1ZLPA 3HPSA 3VC5A 3WF1A 5AVNA 1X6LA 4AX7A 3MA8A 4J40A 4U10A 3TN3A 2BHUA 5T9BG 3GXDA 2QKFA 2WANA 1A5LC 3JRKA 2WSKA 1KXTA 3B8VA 3LLXA 3E2RA 1LORA 6XIAA 3B0XA 2C0HA 1E4IA 1OADA 3VNYA 2DSKA 2OOFA 4YXGA 1UG6A 4EP8C 2YCEA 2DIEA 1XGDA 3T4WA 3UWYA 4C65A 1W32A 3LBMA 3Q67A 4GD0A 4ZXLA 1XBXA 3TEVA 1P0EA 2J6XA 5AC5A 1OFEA 1KCLA 2CPUA 3DN5A 1QWGA 2XGBA 2XHYA 1W8SA 2ISWA 4H2HA 2C1IA 3WQFA 5F4SA 4B4FA 1RV8A 2Z2AA 3AIVA 1UC4A 3IGSA 1FTXA 1HVQA 1WX0A 3IIXA 1F61A 3B03A 2J6VA 1KM1A 1F3EA 2VFHA 3OQEA 1W9UA 4AYSA 1PKNA 4V1YA 3IWPA 1O5QA 2D2JA 1KRMA 2IKHA 3S6TA 4C6DA 1YXYA 4ORIA 5A2BA 2POZA 2A21A 4H9XA 3W23A 4I9JA 4NYYA 3ISIX 4GQGA 4CUCA 1VENA 1EF2A 1OINA 3SCVA 2VDIA 4X0NA 1WDSA 4HD5A 1B0IA 1NAL1 3GXTA 1JPHA 4W8AA 1ODUA 2WHLA 1JZ8A 2OX4A 3BC9A 3PSVA 4UFMA 3Q58A 5CGQA 2NQ9A 4PCPA 5H91A 4GOAA 5G2IA 3LGEA 2ZWZA 1AW1A 5DELA 3PZNA 1YPFA 1ONRA 2Y7EA 3H24A 4AZBA 3O06A 2CERA 4JKKA 5RUBA 1HTIA 1UD2A 2D1ZA 1ME8A 5D2WA 3R11A 2QCHA 3APGA 3BAKA 4E0CA 2OSWA 4OJYA 2GDQA 1W5PA 2XU2A 4BQ4A 1XV8A 5ABFA 3WFAA 1IZKA 1OCJA 1A5SA 3ANUA 3SIMA 2ALRA 1VJSA 3AJ7A 1FWIC 2OT0A 5KZEA 2D69A 1JCXA 4GYPA 4Z1CA 3SY1A 1C92A 2JKAA 2CLPA 2B4GA 1OYBA 2EHHA 1Q2SA 2BZNA 4JNMA 2GOKA 5AC4A 5D9OA 3VIOA 2PDQA 2YKKA 1T41A 3IJ7A 3VVGA 4MNMA 2OO0A 1LF1A 4YWSA 3CZLA 1PX3A 1A3WA 1BXCA 4B2DD 2GLKA 4LEQA 3KL0A 1A5NC 1WAUA 1KXQA 3WLSA 5AHMA 3VIKA 4ZO7A 1B31A 2IXUA 3L4WA 3I3BA 4WSJA 2VFFA 4KRUA 4ZOEA 4WDUA 1IEQA 1PDYA 3AIRA 1W5MA 3ELFA 2DP3A 4M29A 4WGXA 1UWSA 2OT1A 3T2PA 4DJDA 4JCLA 1BGGA 3AROA 5IDZA 3B4UA 3SCTA 3OYZA 2NWSA 4YMZA 4FI4A 2NUXA 2WAGA 2ALDA 4JKMA 4WKHA 2VR5A 1JYVA 4FMVA 1XGZA 5BXPA 4CQDA 3VDCA 1FWCC 4QSFA 2C16A 2OVLA 2D24A 3RX4A 3NURA 3KOXA 3WF4A 1G1YA 4K37A 2Y24A 2VO5A 3GH5A 3L2MA 3LNPA 3NDZA 3EDEA 1EHNA 4LVDA 1T8QA 2WJEA 1SJCA 1XI3A 2OQHA 1JUBA 3VDBA 3FGCB 4FP1A 4YJ5A 1KRBC 5CJMA 2VT0A 1GVQA 2VC9A 3CNYA 3DX5A 2QW5A 5C5YA 3KWSA 1EA9C 2CKSA 4KEVA 5H2ZA 4NRSA 1ME7A 3MZ2A 4L56A 4ATWA 3AWOA 3PS7A 4HKPA 3AS1A 4AISA 3CQKA 4BWLA 4JYDA 2FZ8A 2EG8A 2D0GA 3AXHA 2E25A 5JMUA 3WK2A 1IZCA 1YDOA 4E3TA 4PBGA 1H7WA 4LV9A 4L61A 5EFFA 5BU6A 5FEZA 5BROA 3GWQA 4NXSA 4V1XA 4PMDA 3C52A 3GC5A 1NWRA 3CH0A 1OFAA 3KTSA 4CD5A 4TMCA 3CHEA 4AFYA 2OYMA 2V2CA 4XD3A 2OCZA 1JQVA 2PP0A 3VZYA 3TZNA 4DZHA 2FB2A 2HROA 3AS0A 2ZUVA 2BXVA 2EKCA 1LL4A 3FJ4A 3GR8A 1VFOA 1BYCA 1HL2A 4S38A 4P5UA 3MHGA 3NQBA 5D32A 1PDZA 2Y88A 3XISA 1QBBA 4AB4A 3ATYA 2NQLA 2ZUTA 3M6YA 3W72A 3UA4A 1R8LA 4U5KA 1TYGA 5K9DA 6A3HA 4UQDA 3MPGA 4QNEA 3S42A 1CT5A 4AW7A 2QCEA 3SR7A 1Y0EA 1R47A 1S38A 2QJMA 4QBXA 5IM51 2XH0A 4UZUA 1MUMA 1ZALA 3SB0A 4NJKA 2ZZ2A 1HX0A 1MQQA 3QGAC 4GMEA 2HK1A 4L4LA 3QTPA 3TW7A 1DJIA 4TUFA 5EKYA 3VKKA 3R6IA 2ZA3A 3M7SA 2CZVA 1ZBVA 2WLYA 2J25A 1RK5A 3RCYA 4QS6A 3VUSA 3UWZA 4AXKA 4MSSA 3K8KA 1TSIA 5I06A 2IQDA 4HA0A 2UZ9A 2XPKA 3S1GA 4FNPA 1A5CA 2AQOA 1GG1A 4J27A 2B0MA 1J9YA 1X1ZA 1QASA 4C1LA 3LRLA 4GQBA 3OLDA 4I9TA 1VS1A 5AYIA 3SQLA 5G1MA 5CBJA 3RILA 4F79A 4P7NA 4HJFA 5CC3A 1JDFA 4NI8A 2SFPA 3RPDA 2P88A 4E5TA 2EXOA 4LQ1A 3VUPA 4B5XA 1UIOA 4WKFA 1RBAA 3N13A 3E74A 1A5BA 3W1NA 1XLJA 2DY3A 2E09A 2VZSA 4OE7A 1UUQA 3DIPA 2OQLA 3UESA 3FKRA 3G1YA 4UTIA 4YLWA 2DDXA 1X6UA 2VYOA 3BUVA 3FYPA 3PANA 1ISYA 4Y9AA 3NZ1A 4FNTA 3GRIA 3NO1A 1EJTC 2MNRA 5FL0A 4Z1AA 5IHRA 1TIMA 1TR1A 4GUJA 3XINA 4TR9A 3SUWA 3QRHA 4IXHA 2C71A 3WQDA 3RFAA 2W91A 1AJ0A 2PDYA 3GU1A 3ZFHA 4EOUA 1NTHA 1KA9F 4ERGA 1S2AA 4HK6A 2ACSA 1GQNA 1FFQA 3RITA 1V0KA 4DAIA 2WK2A 3P8IA 4GGHA 3WQCA 1GTEA 3QVQA 4AAJA 1IT0A 4FF7A 3VGHA 4O1BA 1TREA 3T55A 1KFWA 4BR1A 3PWGA 1KFJA 2HVOA 4NNBA 5HUOA 4LNCA 9CGTA 4WJ8A 4IGMA 2E5CA 4K7YA 1XSKA 2VC6A 2P0IA 1D9EA 3UP8A 2B31A 4F0HA 3DXIA 1BSIA 4HPXA 4LU0A 4Q4MA 4AC1X 1FWEC 1Z42A 3H26A 1KQYA 4WQ6A 3MT1A 1XCFA 2FPTA 3EA3A 3NQFA 4I3GA 3CO4A 4JY9A 5BOFA 2DVUA 3NQEA 4JNYA 2FIQA 2XSAA 3EKLA 1ZY9A 3VKBA 2DU2A 2WV8A 2WJFA 7CGTA 1VFHA 2NSOA 3QOKA 1DWAM 4S3KA 4R3UA 5EU9A 3KOFA 5DXYA 1HP4A 2A0NA 1ZSXA 3PAJA 5AYBA 5FF0A 3APTA 4C1NA 4GPNA 1TA3A 4MWAB 4NQ1A 3AWNA 3NCOA 2C8NA 4IIBA 1JXJA 3SUUA 1EDGA 1UIPA 3VYLA 2D0FA 3GVRA 3SRDA 2EG6A 2G3NA 5MKGA 4PL2A 3WFZA 4D72A 4TVUA 2BBFA 2PBOA 3E5PA 2H8ZA 1CYGA 1LOSA 4Z2KA 2V5LA 1BWVA 2CBIA 1W9VA 1GVRA 2Z1SA 2Y7GA 5D9MA 3T40A 2PGEA 4LUSA 4EF9A 1VYPX 3TMQA 3W87A 4YTRA 2TMDA 5CC7A 3URBA 1PWMA 1TWWA 4NY2A 3A13A 1TVLA 2A5HA 4XZ9A 5K7JA 4KQNA 3VNLA 2ZWYA 3B9NA 2WMGA 1OT1A 4AY1A 1UWUA 5IBXC 2PRHA 3W75A 4QG6A 2XYLA 1HFBA 2F6XA 4YWIA 1UW9A 3OW1A 4KF1A 2V9DA 4RKAA 4TV6A 3MW7A 1XISA 4TIMA 2P0OA 2WO5A 4LB3A 3QZAA 3WD3A 4LC8A 4G2DA 5CZTA 4HBKA 2VCBA 3BCFA 4HZ7A 3O05A 4WEVX 2A4AA 4D8AA 4GH1A 1LRNA 4A21A 3W81A 3WQOA 3JUGA 1E5NA 5HWMA 4QDMA 1EPVA 4H9ZA 4CU7A 3UR2A 3HIJA 3AO0A 4RL3A 1UZ1A 4O17A 1JULA 3C0LA 4O0QA 2DZVA 3ANYA 4PYSA 3UZZA 2OG9A 4TXEA 1R3QA 3WH7A 1XPYA 5HMDA 1IIHA 4PMJA 4JQ1A 3CQ0A 2E67A 4CQ9A 2JKPA 1E0XA 4GO9A 4IFRA 4IGSA 4H9YA 3UGVA 2OZTA 1QO2A 3EB2A 4XZIA 1XLEA 4GZEA 4JHOA 3JS3A 4BQ3A 2PDWA 2IPJA 2WC3A 1CPUA 3HGRA 5BRQA 4DJED 5IXEA 2YCKX 5C9XA 3HZ3A 3GR4A 4JDBA 4A35A 1AW2A 3MU7A 1ZUAX 3I4KA 3A4AA 1CXLA 1BD0A 2R9RA 3N4FA 3INPA 2PDCA 1H63A 3O0KA 4PRRA 1JZ3A 4LANA 4JTUA 3AI0A 3KRBA 4AY7A 4F3HA 3KLKA 3W88A 1ITQA 2CEQA 3N04A 3DKJA 3RUBL 1EL3A 4A3UA 3N2CA 3ARRA 3DGBA 2OELA 3LCHA 3L7RA 2VNCA 3WD1A 4Y2WA 1F7BA 2V6AA 1KC7A 2CCRA 1JZ4A 4LS1A 4ORMA 2E77A 3AZSA 4XK2A 1CWYA 5LNSA 1G6CA 1Q66A 3W6LA 2QR6A 3WF3A 3RU6A 4MY9A 5LKYA 4JXCA 1HN1A 5CAKA 2NUYA 3CLWA 1A5OC 3WLLA 4LF1A 3ZOAA 2DQXA 3L4TA 4CCZA 4UXDA 3W84A 3M16A 5BXSA 1YBQA 3N12A 3TCEA 4HU4A 5F2MA 1Q7QA 1DEDA 2GGHA 3ABOA 2PWVA 4UZSA 5AYXA 1BSLA 4MHBA 4HNOA 2INZA 2VENA 1EJUC 1BRLB 1CXEA 5GJPA 1S5WA 5BYWA 1WUFA 1I6NA 3L5LA 3DZ1A 1LBMA 3T8LA 2WQPA 4FX6M 5D4YA 1YDVA 4C7FA 4WR3A 1CXHA 1XDJA 2XGIA 1M5WA 7A3HA 4O8RA 5F1UA 1QPKA 3F5JA 3M6DA 3QEZA 2I17A 1EOKA 1U5VA 2DPEA 3GHTA 2WZTA 1W3IA 4PMUA 1QI0A 1GQLA 2WHJA 3VABA 4XWUA 1NVMA 3LGGA 3UPWA 3ZQ9A 1U83A 4IP4A 4O4VA 4RE3A 1A0CA 1X1OA 1WXZA 1U2YA 2BP1A 1VCVA 2W61A 3GFYA 3HA1A 4XVDA 3NZPA 1XUZA 3G0UA 4FXRA 3GC4A 4LAOA 4QAWA 1R7AA 1CTNA 4NF7A 1TJRA 3IUDA 3AFBA 3AIQA 4JIHA 4OUEA 1G0CA 1V5XA 3QPYA 2QPUA 5C54A 3W25A 4XAPA 3IRSA 3GKFA 2CZDA 1EPXA 1K1DA 5A95A 1KRAC 4KPLA 2VRQA 4C91A 4WDTA 4N42A 3QV9A 4J3WA 4RNHA 5EMKA 4CCEA 1M65A 4AX6A 3N11A 4QISA 4JDYA 3PZUA 4K7VA 5LNVA 1Q6QA 5T26A 2X7VA 2V2DA 3A12A 2PI6A 3A47A 3N14A 3RU8X 4OUIA 2EPOA 1HGWA 1DWHM 1FFRA 2IKJA 1IF2A 2ZX6A 1SJDA 2BDQA 7ODCA 5JIPA 3PK7A 5HA7A 1BYBA 4C6FA 3IJDA 4D1IA 3NQDA 2FVKA 3KTCA 3VMOA 1WA3A 3ATZA 5M2FX 2C15A 4S2BA 3MS8A 2QCGA 2O4QA 1Y7VA 1Q85A 1OX4A 1R3RA 1N82A 3STGA 5I77A 3W83A 8A3HA 1FHLA 4QIUA 1NFBA 4AC7C 2QCNA 4J2PA 1CGYA 4PFMA 4PEEA 4PMRA 1OFBA 4ZSTA 5GNZA 4QP0A 4DF1A 1TQXA 1LG2A 2OWCA 5CSUA 4L9YA 1V4YA 1KGUA 4LY8A 4YTUA 5M3WA 3GQYA 3LCLA 5DQPA 3F2DA 3EA1A 3BLOA 4DBUA 1T40A 5D8WA 3ME3A 1JZ6A 3UW6A 1UD8A 3G77A 4QE1A 4DUVA 3PNZA 2NT1A 4KWOA 1XSIA 3F1QA 3QN3A 1HVXA 4GXPA 3BG5A 1I45A 4EVZA 1D8WA 2ZTKA 1VBHA 2YDRA 4Q4PA 1Z6KA 2WVSA 1KWKA 4ACZB 4HNCA 2YXOA 4FXJA 1UA7A 3VZZA 1G69A 3PJUA 3NPUA 2JIWA 2WNNA 2YX0A 3SCNA 1N2VA 3KX6A 4R5EA 2O9TA 5F2GA 4BCEA 2ZE0A 1GQKA 3BWWA 3UXIA 4DXXA 4GLEA 2I5GA 2W5FA 4H6EA 1GCYA 3SDOA 1YRRA 1UH3A 3H21A 1EC7A 3O6CA 4OV4A 1Z48A 3IEBA 1LLZA 2I56A 1IWPA 4C6IA 3AZTA 3GK0A 1GOQA 3A3XA 4NZ4A 4A29A 3EKGA 3AXXA 4DO6A 3CPUA 2VGBA 3G0SA 3FAWA 5HR7A 4C6QA 1PKMA 1QR7A 2J24A 2VELA 3Q37A 2YZRA 2ZXBA 1K6AA 3DERA 3W02A 4DO4A 4FLOA 2O92A 4WD0A 4RX0A 2Z6IA 4LUIA 1PBGA 1I2OA 3OZPA 1OX5A 3IV3A 4AH7A 5D8ZA 3W1TA 3HMJG 1XC4A 3B05A 3UGRA 1PTAA 6ALDA 4B90A 1OG0A 2E6FA 1L6WA 3WSUA 1SQ7A 2XIOA 1B4EA 4W5UA 3IJ9A 1E73M 2B7QA 5EMYA 3VU2A 3HG5A 2PSNA 5TAOA 4XV0A 2G4JA 4EACA 1VPQA 3VX0A 3W37A 5XIMA 5F1VA 4GY7A 3ITYA 4U2ZA 1O95A 4AMAA 1A4LA 2WBKA 1NOWA 3OLEA 3NGJA 3RR1A 4C6JA 4LVBA 2PDLA 3OGSA 4GY0A 3N2OA 1XLFA 3FW6A 4LCSA 2BY2A 5CQ1A 3AHTA 1QATA 1VIZA 5A6SA 1VZWA 4WY0B 2X09A 4HHMA 3VK5A 1VBJA 1IQ8A 3ICJA 4ATDA 4CCDA 4X63A 4JFUA 1G9HA 1J5SA 5DXXA 3LLFA 5CC5A 2FPYA 3NFUA 4HPHA 2EO7A 2VZVA 4PEKA 1OJXA 4PR4A 3HJZA 1POJA 5HQEA 4PGLA 3FJLA 4TX8A 3SUTA 2VEGA 3WQWA 3ZWTA 4LVFA 1Q6DA 1HIZA 1KCXA 4JR5A 1KB3A 3S9IA 5CCZA 1AK5A 2WC7A 4B5VA 4K38A 3NAVA 3RJXA 3GXFA 3AUOA 1TV4A 3NUKA 3OZOA 2ISFA 3FGCA 5LIUX 2WSQA 4E8CA 1TPWA 1SFLA 1HL9A 3R13A 4MGGA 4ROPA 1AA1B 2D22A 3R10A 1YTKA 1QW9A 2F6UA 2J8TA 3VIPA 1ITCA 1ZAIA 2Y5JA 3CV2A 4EAYA 1XLIA 4ZQCA 2VCCA 3WUEA 3AMGA 1J0YA 1MW0A 4CD6A 5C2GA 3JZEA 4KWWA 1UMLA 2CLIA 3KW3A 4D6GA 4YPJA 2J8GA 1I0BA 4LT9A 4LX4A 2A7RA 5KZMA 5BW6A 4KCWA 3MYPA 3N9RA 1E6NA 1Q8JA 4C90A 2Z27A 3CK5A 4AWTA 1FDZA 2OFJA 2Z7GA 2CLOA 1L8PA 5PTDA 2WCGA 1TMHA 1PJ9A 2QCLA 4JN6A 2PPGA 3RJYA 1ZQ5A 1QO5A 4KETA 3AIWA 5DANA 1S1PA 1T0OA 2R14A 1XHGA 5AN7A 3K1GA 1SR0A 2OQYA 5FOOA 3GVGA 3PC0A 2P8CA 5D33A 3QFEA 3VD5A 2QJGA 3A64A 3PHAA 3LSCA 1U5HA 3WKZA 3LQLA 2PGRA 1AH0A 1FUYA 2W79A 4DXVA 1EA0A 4J3VA 4RNIA 3DGRA 4QGCA 1M9HA 5XIAA 3AYVA 3TOYA 5FCZA 5BNKA 1FWNA 3LGDA 2H3BA 3OB8A 2Z1XA 3R0DA 3ES8A 4P7LA 5HNNA 3GVWA 3MI2A 1IXQA 3NL6A 3D46A 1UR4A 2FDSA 2CYGA 2QAPA 1MO0A 2YL6A 3SN0A 3BMVA 1VFTA 1JVNA 4O28A 1E1FA 4LWWA 3T7VA 2BY0A 1W37A 2VURA 4WX2A 3HG2A 3K13A 3MSDA 1GK8A 1KBIA 3PM6A 1E70M 4JN7A 1HG3A 1TPDA 3AYTA 3SJNA 4ZQMA 3A5FA 5CPMA 2B7PA 3F4VA 2OXNA 2V5CA 1B1YA 5LGXA 5I78A 3AXIA 1V6VA 3VIHA 2XGZA 1E1CA 2QF8A 4PMVA 2YXGA 1OFDA 4I7UA 1GYNA 2HJPA 1FVPA 3D5HA 4YS1A 4IX0A 4DI9A 4TOQA 1YBQB 3R89A 4KIRA 4ASTA 2HNEA 2I5QA 2DZAA 1VD6A 5KEZA 4F8XA 1VBGA 4UBPC 4LVGA 3G18A 4Y9NA 2OX1A 3ECQA 1KKRA 1X7FA 3CL7A 2Z2UA 5KSWA 1ADDA 3OP2A 1EF3A 4UFJA 3LX9A 2ZKMX 1ODZA 3TWBA 2FGLA 5HNTA 3UCDA 4NKCA 2BY3A 4AYGA 3UZ5A 3A3WA 3EB3A 2V5KA 2BHZA 4QDPA 1V7YA 4Z2IA 4MVAA 2ZUNA 1LRTA 3TSMA 5FF3A 1LJYA 3KVLA 4TMBA 5DO8A 4YTTA 3L23A 3ZVHB 4BI5A 4Y8EA 4IFOA 3H22A 4NASA 1V93A 3LM3A 3DI0A 4TTUA 4QSHA 3F5KA 4N02A 4NT0A 1GJPA 1BKSA 1DIKA 2J4GA 1ZBWA 1V3LA 3W4RA 4IG2A 4JTAA 1R3VA 3KHJA 3ZSTA 4W5ZA 3KTXA 3WLQA 3E49A 2DUXA 4LH8A 3NQCA 3VM5A 5DMNA 3THCA 3WBYA 1IXOA 5AY7A 3GY1A 4I9AA 1PCKA 4D8ZA 5CPQA 4F4RA 3PWAA 3WQPA 3EPNA 2PCEA 3R79A 1OSEA 2ZZ3A 3R0KA 4FS9A 4NJJA 3V4BA 1E0UA 3P67A 1YDNA 1J11A 1YW1A 3T05A 4KKXA 2AGTA 2FHCA 3WLNA 2A6NA 4BQ5A 5DMLA 2XIJA 4H9MA 1XIDA 3ITVA 3Q45A 5GVJA 2CNCA 1IWBA 3C56A 1XIJA 3GKAA 2ONEA 4Q8PA 5D38A 4A3YA 3SADA 1KFLA 1RUSA 1LQ0A 2ZRUA 5A6MA 4G7FA 3URNA 2ZXQA 1U1UA 2A79A 1L8NA 1DQWA 3I68A 4UCGA 1VYSX 2NLYA 3GE7A 3OVPA 4DBDA 1NF7A 1WKFA 5GPRA 1EC8A 3B4YA 5C7VA 3FAXA 1IT8A 3MVTA 2PDIA 4KW2A 2YFOA 4OWGA 3O1NA 4MG4A 1CLKA 4L80A 4LYRA 2E8YA 3OIXA 3IPWA 1DQXA 4H4IA 3IK4A 2VEPA 5T8GA 5DBUA 2YW4A 2A3AA 4DI8A 4LRSA 2TRSA 4O0ZA 2X1SA 4QFUA 3WQVA 5JIWA 1W3HA 2CLKA 2DZUA 2JK2A 1ZGDA 2A3LA 4PL1A 2AOSA 2JE8A 2PDBA 2YB4A 2PWHA 4O4WA 1UQYA 1TJ1A 1ZP3A 1E6SM 8XIMA 1CDGA 1TFVA 2ZX7A 4NX0A 1IXNA 3WEZA 1R9XA 4A2SA 4Q7BA 3GW3A 2QCFA 3LPFA 4AIUA 3AMLA 2DUAA 1W17A 2R94A 2BVTA 2W66A 1FH7A 1XYZA 3HPZA 4J28A 3ITCA 2DT3A 3CZKA 4S3DA 1KBLA 1XYBA 2GJLA 2KX9A 4W4QA 2ZQ0A 2ISVA 1RAKA 1XC6A 4J9JA 4D6JA 1IEXA 1LOQA 3RM9A 1WXYA 1HKWA 3EX2A 2HVMA 4HIBA 5FSEC 3R2GA 4WUIA 1VCFA 1C9DA 2NQJA 4IPJA 2X05A 1DIDA 4ZQRA 4M56A 4E2BA 1F07A 1IIGA 3D3AA 1H3GA 1KFKA 1GQJA 1QOXA 4YVVA 4DJDD 4HK7A 5I3JA 4AHPA 2QXWA 4PBEA 3WQ4A 3O6YX 1ZAJA 2H9AA 2Z28A 2J62A 3LTSA 3TC7A 3OJGA 1WDDA 1CB2A 4PSPA 5FJJA 5A8GA 4PCTA 3THQA 5AC6A 1OK4A 1X6NA 4PTXA 1G4TA 4QNWA 4KS0A 3QGKC 4MADA 5HULA 1KD0A 3TKFA 3AICA 2HISA 3EPMA 1ZCOA 2GVLA 4ERAA 4X2PA 2NUWA 4XQ6A 1OHLA 3LPGA 5GJMA 2WZMA 2YDSA 3MSRA 5K9CA 3BOXA 3LTPA 2DH2A 1PCWA 2G96A 1WXJA 1JQXA 3ONBA 3CIWA 2ABAA 1P43A 4JBRA 1JF6A 4B9ZA 1ZJBA 3DFNA 1MEWA 1SFSA 3FNDA 4GI4A 4CQCA 1V6YA 5IFPA 3N15A 2AMGA 5M03A 4GKTA 4LNYA 2DZTA 2EJAA 4PA8A 4JTGA 1FX6A 2WCSA 2ZC1A 4XZMX 4ADTA 4HCLA 2C1GA 3IIOA 1ZP4A 4NZ1A 5J5RA 4MWAD 4QJ3B 5EBUA 3PZQA 2GGIA 4MNLA 3V5OA 4HOWA 1D7FA 3P5ZA 3PWIA 4LBRA 3EX4A 1LYXA 3T9PA 3PVFA 3MCOA 4J3UA 4M81A 3RM8A 2WVTA 4P8UA 4B5WA 2BASA 2FZ9A 3TJIA 3OGVA 3PAOA 1C93A 1YE6A 4PB5A 3OG3A 4AD1A 1NY1A 3KDOA 1YKWA 2EAWA 2E9MA 4RPQA 3UZJA 3CAKA 1K8YA 4M80A 1PX8A 2OEJA 2PTYA 4NRRA 3BO9A 1E9YB 3MBFA 4PTNA 1MW2A 4IMGA 2V3GA 4HHLA 3W74A 3MVIA 2XISA 3ANVA 4C6OA 2BS9A 1OCQA 4NX5A 4ZSUA 3GG7A 3CIVA 5G4HC 3RPTA 4ERIA 3IARA 4JTEA 4RV3A 4UFHA 1JCTA 4JY8A 5D2YA 3UG5A 4IPIA 3BXWA 2XVNA 3PJTA 3S5ZA 3MUZ1 3V1PA 4LBUA 3PZMA 1DTUA 1E9LA 1V0LA 3W53A 4Z0SA 3W1XA 3WUBA 5AFDA 2HEJA 1SJBA 3HQPA 3M0YA 4QLJA 1EX5A 2PZNA 4PULA 3ARYA 1Z44A 5CZJA 3PR2A 1AJZA 2UY5A 3JZUA 1FBAA 4XISA 1A5KC 1E4LA 2X1TA 4UTWA 1TPB1 1PHWA 3M0LA 3T0CA 4DB7A 2FGZA 2E6AA 2BNJA 3OZYA 1DWGM 2G5WA 3EWDA 3FOKA 4DLFA 1B3YA 1V8EA 3OHIA 2QS8A 3TC3A 3O6AA 3ONCA 2DT1A 3H2NA 3GLCA 4EXAA 4YL2A 3S9ZA 3L67A 2RJHA 4MJZA 4QQ3A 3U57A 3UR7A 2PFHA 1W31A 3KOZA 3H6OA 3GDRA 4MB5A 1HNYA 1XFCA 4JOMA 1HKIA 3F2CA 1A80A 4DQWA 1EKOA 4IIEA 2GFTA 5EB8A 1J12A 3NR0A 2AGKA 4MY1A 1NOFA 3G1DA 1TUXA 4ZODA 4WY0F 1RY0A 2VFGA 2GDVA 2JGYA 2PWEA 5HUPA 2YL9A 1J0KA 3U3HA 3CBWA 4Q3MA 2C19A 3SY8A 1WUEA 3F7JA 1GTHA 4JGDA 1C8XA 4QQUA 2Y70A 3OA3A 4M1RA 2ATMA 3T78A 2V3DA 1XF0A 1WQ5A 2ZA2A 3V75A 3MANA 2L5HA 3L4UA 2NQHA 4JFSA 3U8GA 4BA0A 2XFWA 2XWDA 1W1A1 4FEZA 1CGXA 2VL4A 4L1GA 3CEUA 5EY5A 4QE5A 3HJEA 4LUTB 2D2HA 3P74A 3UXKA 1GOKA 2CWNA 3W7EA 1ZBCA 3KBSA 1GKQA 1XDMA 2P3EA 1OC6A 1GOIA 1YTEA 4URIA 2PWFA 3LUTA 1UKOA 4N9DA 2DZBA 3CAQA 4K6AA 1BHGA 2HRWA 4W7VA 3GIQA 3QR3A 1EEXA 3WLOA 4JTFA 1BQCA 1M68A 2IKGA 1RD5A 1BXNA 4QJ1A 4D6HA 1F3WA 1NP2A 4ZOCA 1FKXA 1VEMA 3VCCA 2VGGA 2AQVA 4GNVA 1IT7A 3TONA 5AHNA 2DGAA 1T99A 1OK6A 5AHIA 4A3HA 1YADA 3LMZA 1RJPA 2V67A 3IIZA 4GVFA 2WWDA 4RE4A 4V28A 3KUMA 1YTDA 2PDMA 4MZ1A 4PCNA 4R33A 3ZM8A 1RVGA 3H55A 4JQ4A 1F4AA 3ZXWA 3WFLA 3T81A 4IISA 3WH9A 4GX9A 5D04C 4KERA 4UMBA 3CUIA 2PDXA 5H6HA 3VIFA 2WZHA 4Z2JA 1MVYA 2QJHA 1S2UA 5G5IA 2FMOA 3UPMA 2R91A 3PTMA 4PTVA 3WN6A 5JQ9A 1DV7A 1C7SA 3R8GA 2NX3A 2YA2A 2P10A 4GXMA 1QI2A 4G9PA 3PBVA 4ZQOA 3SY5A 3DFQA 3PUOA 2QYGA 3LS9A 1VHNA 5HQLA 4BKNA 4PODA 1J0JA 3FJNA 4S39A 3MMWA 1G5AA 4GVGA 3LM7A 3T09A 2P1FA 1XYFA 2TYSA 3G2GA 3NO3A 4BI7A 1VPYA 1FA2A 2Q6ZA 3W1QA 3B04A 4O11A 3ES7A 5G2HA 3WQ8A 3GDBA 3RGTA 1ZL1A 1Q4NX 2E1WA 3R7MA 3EWUA 3N4AA 4X9SA 1AZ1A 3STEA 4PCFA 1JFHA 4UC5A 4XZBA 3VTRA 2V68A 3WX7A 1Z7AA 4Y96A 1BEUA 1VIWA 1L6YA 1R2SA 1QFEA 3S5NA 3IVTA 1FCBA 3SSJA 3HFYA 5LA2A 1LCOA 4DJFA 2WW5A 1GNXA 4L4OA 1QWKA 2YDQA 4ZR8A 1SZNA 1UHVA 3EXTA 4ZE4A 3TTEA 4DYJA 1AH4A 3IANA 1RBLA 4IH3A 4Q6XA 1RQEA 5F7UA 2WHKA 3DH7A 2XVGA 4L4MA 1OX4B 1B9BA 4WRHA 3WY1A 1V3HA 1LTDA 1F6YA 3EX1A 2A7PA 1E3XA 2GVEA 1KM2A 4KH2A 2KZHA 2DVTA 3CHVA 4EE9A 3H12A 2PC8A 2ZVIA 2XSBA 1MUCA 3I6RA 1HJVA 3GNNA 3TQKA 1UD4A 1WO2A 1HT6A 4INFA 5REQB 1PXGA 1X97A 3KRUA 1XIGA 2R6OA 3UT0A 4GNJA 4F2BA 3OBEA 4PUWA 1G94A 2FMNA 4ZFCA 2Z7KA 2DSZA 3FA4A 4S1FA 4C7GA 3KBMA 5HK4A 4UTLA 1GEQA 2D3LA 4MYXA 1AL8A 1EHAA 1ONXA 4EPKA 3RLHA 5I6SA 1MNZA 3L5AA 1H51A 4AVOA 4HPJA 1OIMA 2FZDA 4JTLA 1W9PA 2QMJA 4XKYA 3O9NA 5EPDA 3TQ0A 2GYIA 4YYCA 2VEMA 3F2BA 1K8XA 1K7FA 5LIWX 1HJXA 3GDLA 2H9AB 3TLQA 1MNSA 3WDPP 5CLWA 1EBHA 2GVJA 5CG7A 2E68A 3FDGA 4WJXA 4F48A 3IUHA 3A9BA 1E6QM 1TRIA 4CCCA 4OOUA 1CGVA 1ZAHA 2C79A 2PA6A 3OHMB 3PF3A 2QPXA 3B0PA 4XIAA 2HK0A 4GKLA 2E9BA 4J7RA 4RJEA 2CZ5A 1F4HA 1P6CA 2FTYA 1Q13A 1BWKA 3ARWA 4WLCA 1H7OA 4M51A 3T0TA 1T5AA 1VKFA 4HN8A 2YZ5A 1H1YA 4G6CA 2VGIA 5HANA 4I5UA 1OM0A 2J7CA 1FWJC 2HCVA 4ZQPA 2E8ZA 4FNSA 4GISA 1Y5WA 5I02A 4OIFA 5FACA 1KO0A 1WE5A 3Q4DA 2CC0A 1XGEA 3LXCA 2I57A 1AMKA 4NAEA 4J3SA 3BARA 3EOEA 3AMKA 1Q6FA 5LZLA 4GY1A 4P61A 4DO5A 1ICPA 4AXNA 2GQ9A 3GNRA 3TIMA 1DJGA 5AB3A 1V3MA 5A2CA 4ZA0A 1H11A 1GVYA 5DEZA 2X2YA 4IQJA 1JD7A 1UMYA 5HNUA 1F2JA 1CLVA 3C2YA 3M5YA 4UIOA 3PBGA 4W89A 3WJWA 4JCMA 4ML4A 1GHSA 1KM3A 4LB4A 3CUHA 3U0HA 1OFQA 2V5BA 3J7HA 3G1AA 1JPKA 4N6EA 5HPCA 4ONVA 1EP2A 4IMDA 3EOLA 5FJIA 3GC2A 4BK9A 1RHCA 3M47A 2EKGA 2HS6A 4GGBA 4QLKA 5LXXA 1AODA 1KR1A 1CBGA 1T7LA 3CZJA 1K4HA 5L6UA 1GVEA 1CI1A 1J01A 3BOLA 1OG6A 1IR1A 3THAA 2C91A 3VGFA 5DFAA 2E1DA 3W2UA 1P4CA 1O5KA 4UTUA 1OVDA 3CB8A 4I8YA 2W67A 3C6CA 3RX3A 4BWLC 2BOEX 4IQDA 3MDUA 1RCQA 3EWWA 1UD5A 1XP3A 2WMJA 3BV7A 3VILA 3G6MA 4MZ8A 4DM1A 1FWBC 5E9AA 1W91A 4JAWA 2DV0A 2J9ZA 5BOEA 4ECLA 1XRSA 1W56A 3SQMA 4KRTA 4IMEA 1W5OA 1WBJA 5M17A 4H19A 3L21A 2DIJA 4CEUC 4HT3A 1M53A 1OX6A 3NL5A 3NQGA 2C6QA 3OOQA 3SCOA 1VJIA 1XWYA 4WZHA 1K70A 4M3PA 4AIEA 5FD0A 3HQNA 4GFSA 3P8JA 2GJXB 4MFDA 1YPXA 3BSMA 3WD2A 3LCWA 3UY7A 2QIWA 1GZ1A 2Q01A 3A5VA 4XUYA 1X98A 2PLMA 3P2VA 1UQZA 4O10A 2G97A 2ZTJA 4JTCA 2JF7A 4AY8A 3WBWA 1VBRA 1NIUA 2IQ0A 3VKAA 2QVHA 1O5RA 3UJEA 4JL1A 1KV8A 1K02A 5A94A 2YA0A 1DE6A 3BL3A 1VC4A 2JBMA 1I0DA 4BFAA 2AKMA 3PBMA 1EJWC 2CXEA 4AWSA 1K6WA 2G3IA 2OZ3A 3TTYA 1AZ2A 5A6AA 4LFYA 3S1UA 1PUDA 3PTKA 4CD4A 2ZZ5A 6ENLA 4S3CA 5FJPA 3MUIA 3SCRA 3KCOA 3OZMA 2CITA 4IX2A 3KM8A 1YQ2A 3BURA 2H90A 2J7FA 3DEQA 5F4XA 1LM1A 1ZCCA 3I65A 1MUWA 1N8WA 1SR9A 4O1CA 4PMQA 1SSDA 2CBJA 5IOBA 2XINA 3LCGA 1TRDA 3SRHA 1ICQA 1QHZA 2GJRA 1J5TA 2CLMA 3EWZA 3U2EA 3TYUA 1MSSA 1QNVA 1EDQA 2BOGX 5KMYA 2ODOA 1WZAA 2VX7A 4HA3A 2O0TA 4L64A 1XRVA 3BH4A 1MWOA 4Y8FA 5B80A 3N6HA 4KFOA 1UOKA 1EP1A 2PURA 3TW9A 3IK2A 1JCLA 3T0AA 3WQEA 3H23A 3TXVA 3W2NA 3GBDA 4V27A 5CZ0A 1RLDA 1G4EA 2ACQA 4S3EA 3AHVA 1E5JA 2Z1WA 2WYSA 5DMMA 4AD5A 4NIRA 2GDUA 3RX2A 3R43A 1YYAA 3FS2A 4CQAA 4HZ6A 1QW7A 3DU0A 4U2YA 3CUGA 1RCXB 2ZX9A 4EXBA 4JIPA 1CZ1A 4BJHA 3M0VA 3BW2A 4XZLX 2H3DA 2QIIA 2HWGA 2Z1BA 2B7OA 2BXYA 3N6QA 1PAMA 4LVAA 3MSGA 3O16A 3W7GA 1D7KA 4W86A 4TV5A 3W26A 3CHDA 4CGTA 1M01A 2ISSA 3A24A 3LEPA 2WNZA 3TP4A 1RPXA 4MNJA 4NJHA 3BW3A 2DJXA 5DT5A 2YW3A 2Y7DA 2BMBA 1FHVA 1W9BM 5JBFA 3U48A 5AZ1A 4IPLA 3Q2DA 4HHPA 3KBNA 4AVNA 3P5YA 4DF0A 3VIMA 4EXQA 3R8RA 4IPNB 3I7RA 1OF8A 1B5TA 1SZEA 3HPFA 4NP7A 3CYVA 3DG6A 1G4SA 3W7CA 3EWYA 2NV9A 4UFLA 3TYDA 3KAOA 2WBGA 3WENA 3K5XA 4D8LA 3RRAA 3AYRA 2INEA 4UUIA 5D2TA 1PIIA 1ELSA 1SO5A 3G22A 4M82A 3KOYA 3U2OA 1Q6RA 3N2TA 4HMDA 3ABQA 4O54A 3P81A 2WHMA 3WL0A 3MYOA 3QZ6A 1OGSA 1EYEA 3SO7A 2I5IA 4FR6A 4G7EA 3BAWA 4GUGA 1Q65A 2PC4A 3DC8A 4O14A 4X2RA 1Q6CA 1FH9A 4HK5A 4GC4A 1JPMA 4ZCWA 4LSBA 4MLRA 2VRKA 2REQA 3HGJA 3B0YA 4C6LA 1HO1A 4XKMA 1GJWA 4DWDA 3ARXA 3BQ6A 4AQLA 3RK8A 4HQVA 4E2DA 2GK1B 4O19A 2E6DA 1OYAA 4QG9A 5I24A 1KCKA 2HBXA 2P76A 2QDDA 3G24A 3BLPX 1XKJA 1WCGA 3W28A 1UZDA 3SBFA 1FDJA 1LT8A 1PIGA 4H6QA 3GBEA 1JAEA 3E9AA 1PZ0A 3DG7A 1YDYA 4AZ6A 3E0LA 3WDQA 4F2TA 4H6KA 2PODA 5KTLA 4IMAA 4IFKB 2DSVA 2QJIA 2BLEA 3BLIA 5A8QA 1OYCA 2OZ0A 4E4FA 3C4UA 1QPRA 2BTMA 2QULA 3UWVA 2P53A 3FDKA 4JIRA 3T07A 4FPSA 1B3VA 4MMWA 5I3GA 1QNOA 2ZUUA 1VR6A 4M6QA 3GXIA 5TNVA 4YNGA 1ADOA 3GNPA 2FQIA 3L0NA 5FEPA 5A3HA 3QC0A 5F2IA 4B92A 4OOZA 5D37A 4QDWA 1LBFA 2QUTA 1FWAC 3SURA 2BVWA 2WQDA 4MZYA 2PTDA 1EFZA 2RFGA 5FJOA 3G1FA 3SCPA 4NZCA 3WLTA 4DBSA 1V6WA 3PBYA 4XZWA 2P8BA 2XUCA 1IGSA 2C3ZA 1G7UA 4QG8A 1RPKA 6TIMA 2BG5A 3G1SA 3UYIA 2J9XA 4UR9A 3MUXA 3GXNA 2RGMA 4CNUA 2IMRA 4FHAA 1XLMA 3O8AA 4Z1YA 1VEOA 1I60A 5CGMA 5H1WA 3DOPA 3UR5A 2DZSA 1TMLA 2VEIA 2QUVA 5GNXA 2CKRA 4IUGA 4FA3A 2XZ7A 4AZ5A 4N0RA 1WDRA 4XZNX 3RCNA 1WOBA 5BMXA 2WZIA 3AHXA 1BVNP 2FVMA 3NOEA 3VXGA 1UJPA 2DEPA 3AU2A 1B2YA 2YYTA 3U7BA 2Y8VA 3EEGA 3CUZA 3FYYA 3UY8A 4GYKA 4C6MA 3GNDA 3PPCA 1MDRA 3W7KA 1JNDA 4HOZA 1BVZA 2XN0A 1F76A 2O7QA 2WKLA 1FXQA 1S3HA 3VCNA 4X61A 1EJ7L 3SJ3A 1V7AA 1VH7A 3NQVA 2BOFX 3RRXA 3UNDA 2QJNA 4J1OA 4B3KA 3VI2A 5D2VA 6REQA 2X2GA 4LOCA 1Y5VA 4MJ4A 2ZZ6A 5MHBA 4XBJA 4LPCA 1QOPA 4DYKA 4RZ5A 3UJSA 1PYMA 3W2JA 3AHZA 3B9DA 4UQAA 3KXQA 5C71A 3DCPA 2JEPA 4FX7A 3E0WA 4JYFA 3BG9A 3HFTA 1AUSL 1R9YA 1S5VA 2FGBA 3MHFA 2DQWA 4MYAA 3BCJA 5EMLA 3WK3A 2VZOA 4UOJA 4CD8A 2PBGA 5DMYA 4YVPA 1TE6A 3DHPA 4UNLA 3CYJA 3R4IA 2CW6A 1NARA 5CJNA 4OV9A 2JEQA 4Q4SA 3LRKA 3W7IA 3WZ0E 4FNUA 2ADAA 2F6KA 1JI1A 3RLGA 3MMTA 4MKVA 3WH8A 5MF5A 4IWWA 1JYNA 3CMFA 3BSGA 4QLLA 2PDJA 1RSCA 3WNNA 3E96A 3BGJA 1KV5A 4RNJA 1EJVC 1K8CA 2E0PA 5G2WA 3TWAA 3ZIZA 4HU8A 3A4WA 4JTDA 1CB7B 2W4XA 1GKRA 5CPNA 4GUHA 2J13A 4O8AA 3OU8A 5C2CA 4FF5A 5A69A 1MYRA 4N9BA 3BAIA 3GAYA 3VINA 2QZRA 1TWDA 2X40A 1CW2A 4CQ8A 5HNRA 4Z42C 1XXXA 3E3HA 3ENLA 3EWBX 1I8JA 1AD4A 5C9RA 1SO6A 4REQA 2XDFA 3T6CA 4GI9A 4Q8NA 2XN2A 1XLKA 3OLIA 5FAJA 4PMNA 3W27A 4M8UA 4PN2A 5LIXX 4QR6A 3ITGA 3QHOA 4ICCX 4G1NA 3NDOA 1HUVA 1R3WA 5IRPA 3VC6A 3A6OA 3KHDA 4R85A 1YPIA 2EBNA 3NSNA 1QNRA 1TV5A 1FCQA 2XVPA 4A8NA 1PX4A 2CIPA 3R25A 4IFKA 1BGAA 4L6HA 4WGHA 3N3TA 3EOUA 3LCIA 3ITLA 3MI6A 3OA5A 4GXWA 1FWFC 3CAWA 2BGSA 3P60A 1TELA 3CH9A 3V3WA 3E2QA 1EH9A 3S5OA 1DJXA 4CN6A 4I7WA 1GOXA 4QRNA 1KM4A 4I7VA 3ZSSA 1PO9A 4IGNA 1UZHA 4YHEA 2RJGA 3MKCA 1A53A 3M07A 2IW0A 4NU7A 2QPSA 3HM7A 5CGTA 2QAFA 1QVBA 3HG4A 3GW0A 4ADSA 4Y9MA 5JUVA 3BAYA 1BWLA 2FTPA 4JX5A 3KEHA 2EGZA 3ZR5A 2O55A 1CX9A 4PZVA 4ZE5A 1PS9A 3ZJKA 5HJLA 3KVKA 3V35A 5HWNA 4US5A 2VFEA 3AQUA 3KL5A 4W7UA 4IQLA 4GINA 3UPBA 3VDHA 2PZ0A 3EDJA 2A1YA 2V5JA 1JEZA 1PEZA 3FJ6A 3S2JA 4UB9A 4MUPA 2V0TA 1EC9A 1TB3A 3STPA 5K3VA 3CGTA 4NZ5A 1W9XA 3DG3A 4NAFB 3W9ZA 1QBAA 2PLJA 3H4WA 3LXAA 4LUSB 3RR4A 3ARZA 3NSXA 1K7EA 2PE4A 1C29A 3VIJA 1ZU8A 4NHVA 1W3TA 2IKIA 3S1VA 1DTNA 2FJKA 3M44A 4W8LA 1XIFA 3R12A 3FIGA 1XLLA 1RA5A 3LHWA 2VR2A 4XD5A 1FWGC 5DN1A 3UWWA 2XM1A 1HJQA 2G3MA 3NDYA 3N18A 1RK6A 3UZXA 6XIMA 1OC7A 2O9OA 1NM9A 4G1KA 4Y9OA 4CNPA 4G7EB 2FFIA 1YHTA 1HF6A 1XIIA 4LY4A 1TG7A 4PUDA 3MUCA 2VMFA 4JX6A 3DBPA 3B8TA 3U4FA 4FX8A 1W1TA 4P8VA 1HW6A 4PBFA 5AHLA 3CC1A 5K4XA 4HA1A 3BLDA 1GQIA 4MJMA 8CGTA 4JQ2A 3BJFA 5CBBA 1PYFA 4GVIA 4WDWA 3VOJA 2R1LA 3EDFA 4PUNA 2ZOXA 3WYZA 3QV8A 2HXTA 1XCWA 2Y6ZA 4CVWA 3K1DA 2DFAA 4GJ1A 4H3DA 3UG8A 1O1HA 1RR2A 1JCJA 4MDOA 3A21A 4HZMA 1H7XA 3LV6A 3TYZA 3DUGA 5AKQA 1OFOA 3GH7A 3S5YA 1OZMA 3AZRA 1WPCA 2PDKA 3IJ6A 3PG8A 4ZOAA 3E6EA 2JFEX 1XRFA 1P0NA 2TAAA 3EEZA 2NQZA 4RDZA 4O52A 1F6PA 2DSUA 4A3RA 1HGYA 1XBVA 2BWGA 4X0VA 3AMCA 1PKYA 4M5PA 1JD9A 3BLKA 1ZRQA 1P0KA 4Q32A 4YN5A 1TCDA 4LF2A 1YMYA 1SW3A 1XLAA 5AVHA 2XFFA 4BF7A 3TR2A 5E0FA 3T2QA 4DELA 1BTCA 2PCQA 3W01A 2Q8ZA 1EEPA 2W0UA 1XH2A 2Q3RA 3TFCA 1OF6A 1TKKA 2PP1A 4HVXA 2Z6JA 4P7QA 4Z2LA 1UWRA 2ZX8A 3VDAA 2CHNA 3RF9A 4F9JA 2ZVRA 3TQPA 2WXDM 3U2ZA 3PG9A 1M1BA 3BLLA 2PRMA 4S3JA 3LCFA 2HZGA 3ITXA 2FZNA 2ZDSA 1LT7A 4Z1DA 1TJPA 3URAA 1LDCA 2WC4A 5BWAA 5ENLA 1RCOB 3O6DA 3GDKA 3LDVA 1E0TA 3QHNA 4CU6A 4A8LA 1ZJAA 1J4EA 1MW1A 2NX1A 1WYIA 4N9CA 4I5RA 3TJXA 2WMFA 2ZRVA 3NXLA 4NI3A 2OWWA 2JKEA 2G41A 1Q7ZA 4QAIA 1JJKA 3CHFA 4LGXA 2ATSA 3GG8A 5HMEA 3P61A 1TIWA 2Y4SA 1UPMB 2CESA 3LCXA 3MJYA 5A6KA 1TPH1 3N17A 3UZWA 4L9ZA 2E3ZA 1TZ7A 1R7OA 3LG3A 1MQRA 3M0HA 1EUNA 4XAFA 4TX6A 3O07A 1ISXA 3RHGA 2HE5A 4JTIA 4ZEPA 3TQVA 1G67A 2WVUA 3MUY1 4GACA 4IP5A 4PUEA 4R53A 3EOSA 1J18A 1SW7A 4UFKA 1DKWA 3KCJA 1TPFA 3LY0A 4B4HA 2WOQA 4RDYA 3XIMA 5AHFA 4D9PA 4HMCA 5KZ6A 3NQMA 4WOZA 4H9UA 3VM7A 1MEIA 1XRTA 4GQQA 4PH6A 1UKPA 4QX4A 4TU1A 3PTDA 1V3JA 3EDDA 4O53A 4MB3A 1NOUA 2WB5A 5FI8A 3TYBA 3WNKA 3IVUA 3OEXA 4AIOA 5D09A 3PB0A 3UD6A 1KFEA 3CV1A 2RDXA 3GUWA 3HTWA 3QQ0A 4EPDC 5LNRA 1FRBA 1EUAA 3L2LA 2OGYA 2HQAA 1SU5A 1DJNA 4RPPA 8TIMA 5A8OA 2OGJA 1XLHA 2ISDA 4KEMA 1JIBA 1W3KA 4HSHA 3W1AA 1HL8A 3VNJA 2X0HA 5FESA 4DXKA 2PWUA 3T0BA 3E38A 4PMYA 1V02A 2J27A 2GSHA 2DT2A 4BEUA 1K9EA 3GS6A 5J8LA 1Q45A 1YX1A 1WKEA 1R0MA 3V5FA 1VPXA 5FF7A 1K3UA 2V3FA 1L6SA 3WCZA 4LUYA 2GSEA 4LTSA 1VBUA 3CASA 3BGAA 4UCFA 4LW7A 1NQ6A 2X0YA 3OBKA 3QW4B 3TROA 2FZBA 3RCMA 3BTNA 1G01A 4KWVA 1PTGA 4F0SA 1W1PA 3HF3A 1ADSA 4E38A 1WP6A 3FKKA 4GABA 3ZVIA 3IUIA 3QV6A 8RUCA 3G8EA 2F9RA 4KIEA 3QMTA 1HKKA 4ZBCA 3ABXA 3T08A 2QCCA 4WXZA 2YB1A 2Z0IA 1GG0A 3I6TA 2Y5SA 5EGRA 3A22A 2X7WA 2RDUA 3OVGA 4E4PA 3S4TA 4WSHA 2YGYA 1R38A 4ES4A 1R6WA 4GWEA 3SQSA 1TA3B 2ZUWA 1VFLA 3PZIA 4LCQA 3AS3A 1POKA 2VHLA 4ZFMA 3GHSA 1MI3A 3RLUA 3F4WA 3TJ4A 5A1AA 3M0JA 1AQFA 3KZPA 1QNPA 3MJMA 4M0XA 1FOBA 2GJNA 2OLSA 3NM3A 1OGGA 4AWUA 1SVDA 4QEEA 1KBKA 3GTHA 1HO4A 4UOQA 1ENUA 1EO5A 1L2UA 4HU3A 4AZCB 3SRFA 3ITOA 2CZEA 1UYQA 1ZENA 4HCDA 2R82A 1TTPA 4Q4KA 3L0GA 3DYMA 3Q65A 3DBNA 4AD3A 3B9AA 1GOWA 1RP8A 1V0NA 5M5DA 1WKDA 1R2RA 3M0IA 2ON3A 1IV8A 4QCFA 2ABBA 2BODX 1XLBA 2VM8A 3M0ZA