3PFMA

Crystal structure of a eal domain of ggdef domain protein from pseudomonas fluorescens pf
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
243
structure length
243
Chain Sequence
SNADHHAWHRLLDRALSEQHFQLYFQPVVAARDTHLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTSRLDLLMLEQVLRQMASHEDCLALNLSAATLADPHALNRVFEILRQHSDLGPRLTLEIGEEQLPEQAMLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRDIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELQVIREMGLYGVQGQLFGEPAPWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a EAL domain of GGDEF domain protein from Pseudomonas fluorescens Pf
rcsb
source organism Pseudomonas fluorescens
molecule tags Signaling protein
molecule keywords GGDEF domain protein
total genus 69
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pfmA00
2W27A 4J40A 4Y9OA 3PJUA 4RNFA 4HU3A 3HV8A 4LYKA 3KZPA 5MKGA 4RNHA 3GFYA 3PJXA 4ES4A 3SY8A 3GFZA 3U2EA 4Q6JA 4HJFA 5MF5A 2R6OA 3GFXA 3TLQA 4AG0A 4FOUA 3S83A 3PJTA 4RNJA 5MKGB 3PJWA 4FOJA 4HU4A 4RNIA 3PFMA 4FOKA 4Y8EA 4F48A 4Y9PA 3N3TA 3GG0A 4KIEA 4Y9NA 4LJ3A 2BASA 4Y9MA 3GG1A 3HV9A 4AFYA 4F3HA 5M1TA
chains in the Genus database with same CATH superfamily
5G1MA 3PUDA 5CPQA 4C5ZA 3W86A 2ZRVA 3OYZA 3MI3A 4BA0A 4DI8A 4XKYB 3LCFA 2PWDA 3MKKA 4NXKA 2PD9A 4UFLA 5T9BG 3TFXA 2YDQA 5I03A 3W2LA 1GZGA 4PCTA 4I9TA 2Z2AA 3JS3A 2OX1A 4JAWA 4M8UA 3V0SA 3W84A 4GE8A 5LA0A 1TV7A 5I06A 3STEA 2HQAA 1XINA 1P0EA 2HBXA 3FK4A 2P76A 3WX7A 3N25A 1AODA 4PCSA 5AHEA 4AD1A 2ODOA 1RV8A 2QJMA 5EGRA 1WXZA 5IHRA 1LL6A 3BLIA 1JCLA 3KBVA 4ZSTA 4DO4A 4LUSB 2NUYA 3ZJKA 3DDMA 1VJSA 3ARUA 3IJ8A 1TZ7A 3FJNA 1RPKA 2D23A 4KRZA 2ZUTA 1FKXA 2X16A 3FY1A 1REQB 1AH4A 2BODX 3M5XA 4Y8EA 1IWAA 2X40A 2RHGA 5FJRA 1XIJA 1HKMA 1F6KA 3Q58A 1ZGDA 3DI1A 2DZPA 3WF4A 2NX3A 3ABQA 5EMJA 4FNQA 6XIAA 3ZR5A 1VEMA 1VP5A 2YCIX 4BEQA 4ZE5A 3GTFA 5EY5A 5I23A 3A64A 2DGAA 3ZT5A 3IIZA 4LWWA 2GJPA 3FKKA 1EJRC 4C6FA 5I3GA 3I7SA 2CFFA 1X97A 1K1DA 5DCDA 2GVGA 3DENA 2DFAA 2WLZA 3TQ0A 3PZOA 1U5JA 4Q7IA 4CCZA 2PODA 4QQ3A 3IGHX 4AD0A 1LROA 1D3HA 3QGKC 3PSWA 1XLDA 5ABFB 4IL0A 3MUZ1 4MZ8A 2W4XA 3GXPA 4CQAA 2Y7GA 3F4NA 4QLJA 3NFUA 1YTKA 3BDKA 4J35A 1CI1A 5D33A 4B5WA 3N2TA 4X2PA 2P0IA 3WF0A 1P1XA 5HAOA 4HNVA 1PVNA 1KC7A 2EAWA 2V5KA 3SN0A 3T09A 3VVGA 3SZ8A 4PCNA 2GGIA 4R7OA 4HYRA 4JYFA 4IOTA 1XYFA 2C1IA 2R1KA 3P62A 3OJGA 2PCEA 1R9XA 1CX9A 3NDZA 1SW0A 2WVTA 4MPQA 1CPUA 4OECA 5KITA 2G4JA 3H24A 4IWWA 3O2LA 2GLKA 2ZTJA 1VC4A 4LUIA 4CNPA 4CU6A 5KMYA 3U7VA 2WC4A 1CXIA 2BY0A 3MZNA 1JD7A 2YBTA 3LXCA 1CBGA 4O10A 3NQVA 2GOUA 3MO4A 3EDFA 3NPVA 2NV2A 1E3XA 4DJFD 4L64A 3E5PA 3AYSA 1W31A 4GIRA 5EBUA 1B3YA 5G1TA 2VRQA 1O94A 2WCGA 4P8WA 2FGLA 3CZEA 1D3CA 3W1UA 4AD3A 5BMXA 4OTKA 2VGGA 4H00A 1ESWA 1QW8A 1EHNA 2NQJA 6REQB 1UH3A 1KFEA 3GVGA 1PZ1A 2PBGA 3PJUA 4O50A 4O8RA 3VIMA 3FLUA 4H9MA 4QIUA 3UWQA 2WOQA 1CGWA 3ZVHA 3NAVA 5DCBA 1IIGA 5ECUA 2BB0A 3QV8A 3SM0A 1V3KA 1GONA 2D20A 4B3LA 1J2WA 4FR1A 1Q66A 4WF7A 1JG9A 3EOLA 1RH9A 1R2SA 3KCLA 2BXYA 3U2EA 2UY4A 3GDLA 1ZP3A 1F6YA 4JTDA 3AHXA 4UC5A 1GK8A 1NARA 3MYOA 5FAJA 4WY0B 4WVXA 3OGVA 4I90A 1TJ0A 3QR0A 1RA0A 3C86A 1RR2A 3LSCA 4YTTA 3N3MA 5D2WA 5T91A 4AAJA 4KFNA 4HCHA 3B8UA 5D2XA 2HNHA 1ADOA 1V3HA 3RF9A 3WKZA 2PF8A 4D6IA 4HK6A 4HD5A 3BLOA 3V35A 1H2JA 5GVJA 4LCQA 2E68A 1R8LA 2XU2A 4IUGA 2D2OA 3QVQA 3SGGA 1ZALA 1UKQA 3K1GA 4KERA 3EKZA 3H2CA 3OBEA 2PWVA 4LVDA 1J0JA 4OIFA 1QWKA 1ZCCA 1XRFA 3GAYA 3OG2A 4OUEA 5D05A 3CZ8A 2C0HA 2P8BA 3S0CA 2VEMA 3M5YA 3MHFA 3KOFA 4QG9A 1VB9A 2VT0A 1XJBA 4XBKA 3S2LA 4J7RA 4Q7NA 2I5QA 2IPGA 4O11A 2CXGA 3BCFA 5IDIA 3ZLGA 3SCWA 3VIOA 4JTIA 4GYJA 3AIUA 1XIFA 3CMFA 1EO5A 1HL9A 4PRRA 4ZVJA 4FX8A 2PZNA 1W3TA 2H6RA 4S1FA 1E71M 2YGYA 3GNOA 4F0SA 1OX4A 3HG5A 1ZENA 3NL5A 4WDTA 1CXFA 2CW6A 3M41A 1OT1A 1DTNA 4AEEA 1X96A 1HT6A 3GVWA 4MB1A 3AMGA 1QU4A 2ZICA 5E5CA 5F2LA 1H61A 4C6DA 1VYSX 2VC9A 4AW7A 2VGFA 1I6NA 3VIIA 3CM4A 2RUSA 2AKMA 4A2SA 4LJ3A 3RG6A 1U33A 3MMTA 2OLAA 1GYMA 3E0LA 4G5DA 1AD1A 3U2ZA 2OSXA 2QDHA 4DPQA 1EOMA 2HBVA 4K7YA 1TTPA 3EX1A 3NQ8A 4A3YA 3VE9A 4CGTA 1VYRA 2AL1A 4RW5A 3UVAA 4JCMA 3TSMA 3GIQA 3FDGA 4DNHA 4JTHA 4PBEA 4XKMA 3EB2A 3P5ZA 3S2JA 4LUYA 3R10A 3BG9A 1G1YA 1F4AA 2QCGA 3WK1A 1XLCA 2F61A 4GUHA 3EA3A 2OLSA 2WNNA 4MDOA 1KCZA 3GY1A 2VC6A 4I3GA 5I3HA 5HK4A 1VGAA 5EFFA 2VJXA 1WXYA 4LV9A 3T2PA 3UR8A 5LNVA 4TTUA 1X1NA 1QJWA 1HL2A 3B9NA 4XSMA 4CD4A 2YYTA 4HGXA 4LY8A 3OQEA 3M0MA 4L4MA 3C2YA 4OU1A 1X6NA 1HX0A 3GO2A 3LDVA 2PMQA 2ZADA 4DELA 4GMEA 1T41A 1K70A 2WKGA 3R4IA 4X0NA 4XAYA 4C6PA 2X1SA 1PZ3A 2OOFA 4HOZA 5C6MA 3RU8X 4C6IA 3GDKA 2HRWA 4L5ZA 3OO2A 3W02A 1KWGA 1J0KA 4H04A 3TA9A 4F0HA 5AHNA 2XH4A 2BNJA 4CEXC 4BQ4A 1CXKA 2Z1VA 2J66A 3AS1A 3VM5A 1UA3A 1ME7A 3AZTA 1Z89A 2C6QA 3VIGA 1SYTA 3PUEA 3IEBA 1DWIM 5GJPA 4UTHA 1ZBCA 2ISWA 3GVRA 3WK0A 4NT0A 5FSEC 3MUXA 4K8GA 3EPOA 3ITGA 5FF4A 1DIDA 4XD6A 3KTCA 2FHFA 3UY8A 1VD6A 3QR1A 4AIOA 3PS7A 4CNUA 1VPYA 4QCEA 3DERA 3VGHA 4EE9A 1RJQA 1SJCA 3HQNA 4MADA 3RM9A 3F2DA 1PIFA 1TWIA 3HPFA 2CZFA 1DJNA 5D38A 1I4NA 2YX0A 3GB6A 4MNJA 4A2RA 2CLMA 4WIWA 1E6SM 2WCSA 2ACQA 5BW6A 3TTQA 1ZJIA 2AGTA 2W63A 3GHRA 3PN8A 4WKAA 1V93A 1JCYA 3LS9A 3TCSA 4F9DA 5HULA 3IARA 3DG7A 5I3FA 1CENA 5DY3A 4UTIA 4ZQCA 4WJXA 1MW0A 3CAVA 3QQWA 2CLHA 4GZIA 2E28A 4N4PA 3VD5A 3FNDA 4CNSA 1QO2A 3DEQA 3RCNA 4I9AA 2W5FA 2GDVA 3THDA 2DZSA 4GY0A 3ZT6A 5DFAA 2XIBA 3LXBA 1KCKA 2DVUA 1OYBA 3FA3A 2OELA 2ZUUA 5EMLA 5GQBA 3FFSA 4INFA 3EWBX 4PTXA 1ISXA 3I7RA 1W1A1 4ZODA 2NW0A 1Y65A 3TNOA 3KXQA 3A47A 3ARRA 5LKYA 2X7WA 3WLMA 5DLCA 3W24A 4Q22A 1VH7A 1N55A 3C6CA 4GZEA 4F0KA 3W83A 4C91A 3EDJA 4X2RA 2WLYA 4YL2A 2QAFA 4QQUA 1GTHA 3OBAA 3AWOA 3B4UA 1IXPA 1UCWA 1G94A 4TIMA 1GVFA 3T4WA 1XSKA 1B30A 3ID7A 1UKOA 5BOEA 4M0XA 5HBFA 3GIYA 1EX5A 2Y5JA 1C3FA 5DRCA 4LEFA 2OR2A 5CPSA 1UR0A 2Z27A 1UP2A 2Y7DA 3NQ6A 1G67A 2QZRA 3AISA 3B06A 5DANA 3H7RA 1FUYA 3UEQA 4DYKA 3MO7A 2FHBA 3W85A 1DXFA 2F9RA 3W87A 2E67A 1HZYA 3QFWA 2EKCA 3WMCA 1OCNA 3W7PA 1VFSA 1LM1A 1WAWA 3MWAA 4M82A 1MWOA 3GR8A 2XTKA 4HPXA 3BW4A 1JYNA 4GWEA 1E51A 3K2GA 2QUUA 2ATSA 1M53A 1UQZA 4CCEA 1YTEA 2ZKMX 4NJKA 1UYQA 4JEQA 1S1PA 3B0YA 1K6WA 2NQ5A 4RZ4A 3GC5A 2YL5A 4EP8C 2J9YA 4B91A 3W9ZA 3BJTA 3I6RA 3BG3A 4Y7EA 2WPGA 1GZJA 3TYAA 3IACA 1A5UA 4Z2LA 1X39A 3CXOA 2V5JA 3GIPA 1SW3A 1AUSL 1HW6A 3U8GA 4CQBA 2HVNA 3PR2A 1UR2A 4YWIA 1BKSA 2P3ZA 1T5AA 5T8GA 3VD3A 4LRTA 4XZHA 3CL6A 4ES4A 1V02E 4JIHA 3E2QA 5HQEA 4NZ5A 4REQB 3WDHA 2GQ3A 3ONCA 4MUZA 4C7GA 4L4OA 4JTTA 3N4FA 1KFJA 1ADSA 2ZQ0A 4G7FA 4DB7A 3ISIX 3PNUA 2WYSA 1NWRA 5LNSA 5BWAA 3G3MA 4AUBA 1I2RA 1TZ9A 2G3MA 3ERPA 3WD0A 5RUBA 1UUOA 2J8GA 2CC0A 2HTMA 4N9CA 4TMBA 3OVPA 5G2HA 8XIMA 5FJOA 1A80A 2WAGA 2G41A 5DELA 2C79A 5TIMA 1EOKA 3UWYA 5JQ9A 3VDHA 1W9UA 5I3KA 4PRTA 1GPWA 1QASA 2OYMA 1Q6FA 3AMLA 1WOBA 1L6YA 1T6MA 4XZIA 2O0TA 2QCDB 1D7FA 3ABRA 4QG8A 1J0ZA 1O5RA 4P7LA 3B04A 4ZOEA 3PTMA 3SI9A 3KX6A 4F0LA 1EP3A 2C19A 2NQHA 4LYRA 3LTSA 2ZYFA 4MNKA 4IIHA 4XAPA 4FB7A 2P53A 3CL8A 4Z2JA 4TU1A 4KH2A 4YCOA 2A3HA 1YTDA 3O8AA 2WZMA 1DPMA 2O4QA 3MSDA 3BANA 2REQA 4LW7A 3WJXA 2PP3A 3AJ7A 3QLLA 4GC4A 4YTSA 1BTCA 4AXNA 1E4NA 3HQPA 4E2BA 5A6BA 3C2RA 1A5SA 3UJRA 1KGXA 4GYPC 1XIGA 4IIDA 3SSZA 1V3LA 3G1AA 3DYPA 4QITA 1PCWA 2LLEA 5HANA 3ZJ6A 3AIBA 3BVJA 5M2FX 2I5GA 1XH0A 3ALGA 2C3ZA 4QISA 4RE4A 3EWXA 5MHBA 2R9RA 4GJIA 2OTDA 3XINA 4RDWA 3WQCA 4U33A 3ORWA 3ABZA 3EWZA 1GVEA 4JYDA 4S3BA 3NQ7A 3R6IA 1RVGA 5A95A 1J12A 4LV4A 1VPXA 1A50A 1DKWA 4EXAA 1CT5A 3STPA 1S2CA 3PBVA 4AHPA 2V81A 1FXPA 4S3DA 2X42A 2VWTA 3WFZA 1S46A 3ZLHA 2WJEA 1S3HA 3N2OA 3MC5A 2PP0A 1Q45A 4RCXA 3BURA 3IIOA 4ZQRA 3TJLA 1Q63A 2JKPA 1WKEA 5LIWX 4E5TA 2V5BA 2J74A 1QO5A 3SUVA 5IXEA 1HKIA 2YIHA 3H12A 2F84A 3LRMA 4G1KA 1EPXA 1MRQA 4D6EA 2Y2WA 3R0DA 3T55A 3P82A 1XHGA 1T0OA 3DG6A 1EPVA 2AAMA 1JZ5A 1CLXA 1U30A 1EIBA 2YL6A 3WNOA 1E4LA 5XINA 4HNCA 3EEZA 4XAGA 1U1JA 2XVKA 4HNUA 1YW1A 2WVVB 3DG3A 3R8RA 2Z28A 1P4CA 3VDAA 1HFBA 3H55A 4RNIA 4KWOA 1V3JA 3TWAA 4D72A 4WKHA 2ZA3A 4UFIA 4M6QA 5C9WA 4C6KA 2VEIA 4NUWA 3G6LA 3AHTA 1SFTA 1W1TA 1WZKA 1TELA 1N8FA 3BW3A 1IT7A 2V5CA 5IRPA 3NQCA 1B3WA 2P50A 2XDFA 3OG3A 4FALA 2EG6A 4O18A 5CAKA 2QGHA 5AYBA 4Z1YA 4MJMA 4UB9A 2HZGA 3M6YA 1A3HA 2IXUA 1RCQA 1FCUA 4KKXA 4PTNA 2ZC8A 4D1JA 3PNZA 4M19A 5MKGB 4RNJA 2OODA 4JTJA 1QXLA 3LEPA 3AO0A 2FFIA 3CAQA 2GQAA 3WYZA 1VQTA 1FVPA 3L7RA 3ITVA 1ODUA 1PAMA 3CHEA 2VVNA 3OVGA 2GK1A 2OO6A 3LPGA 1XYZA 4LF1A 2XM1A 4LBSA 3ZS4A 1QI3A 2WKLA 2W79A 2WHMA 4P7QA 1BGGA 4HSNA 1UWQA 2NVCA 2Z4GA 5BRBA 3UXDA 3CH9A 4DQWA 1QW9A 1H7OA 3KWXA 1ZBVA 2X7VA 3RLVA 5KZ6A 5BZAA 3ITOA 5E09A 4CCDA 3CLMA 2X09A 3QY8A 4JKMA 2OB3A 2PDQA 2XGIA 5JIPA 3CH0A 3G0SA 4Z0SA 3M46A 3OLEA 1GYNA 3A21A 2EPKX 1WDQA 2V68A 2BHYA 1W1VA 3V3WA 2ZX5A 3NL2A 3AQUA 1BRLA 5E0FA 2ZZ2A 2RFGA 2EO7A 1CWYA 4C7FA 1AH0A 3P8IA 4J1OA 2ACRA 1DYSA 2BOEX 4GVIA 3OVRA 4JCLA 5LA1A 1IZKA 3D46A 3VOCA 4DM2A 1PUDA 3D3AA 4N02A 3EX4A 4L9ZA 4DO5A 3SGUA 1ONRA 4GHRA 4W8LA 3OZMA 2ALRA 6PTDA 4JHOA 1EEXA 4BKNA 3W07A 1VFFA 4PUEA 1R38A 3E1F1 2PD5A 3WN6A 3G8EA 3RR4A 5A2CA 1R7AA 5FI8A 2QJIA 5C2XA 4JTAA 3UZYA 4KFOA 2W66A 5JH2A 1FHUA 3MV01 3F2BA 4FXRA 1E40A 1TPUA 2EPNA 2YBUA 3PZ9A 5ENLA 2G37A 2ABAA 1VIZA 1E43A 1SM9A 2WW5A 2QUMA 4WSJA 3VIPA 1DP0A 3NPXA 3H22A 2QS8A 3F5LA 2GGJA 5F4SA 2XINA 2ZRXA 1XLIA 1RXOB 1BVWA 5AHIA 5D03A 1QUMA 3D6NA 4AVOA 3TOYA 2PWHA 1JCTA 3MS8A 3RMJA 3PZVA 1UKTA 1L9WA 3RDKA 4GFIA 4GD0A 3RLHA 1XCFA 3EXRA 1DXEA 3V5CA 2PDKA 1C7SA 3E96A 2HS8A 3WEZA 3UYIA 3U0HA 2I16A 4RUBA 1E0XA 2F38A 1BXBA 1UROA 4R7JA 3TLLA 1QK2A 3Q4DA 2JEQA 1M01A 1OFQA 1P0BA 1W2VA 3GRIA 3T05A 2QCLA 1W56A 5HR7A 4JQ1A 4CD7A 3M0YA 2FVMA 4NZ1A 1X1OA 4IIEA 4IPPA 1HF6A 4MFEA 4XVDA 4AZHA 1BWVA 1YPXA 4LB4A 4J3WA 3SQMA 4X61A 4WK9A 1K8CA 1GG0A 3YPIA 3E12A 2XYLA 1V3MA 2VDGA 3W7IA 4MYXA 1LF1A 2BDQA 3I68A 1JULA 3GR4A 4IGNA 1FHDA 1KBLA 1R3YA 3C2OA 4AU0A 1C8YA 2J62A 4HA1A 1KXVA 2CHRA 1SO3A 4C1NB 4UZUA 4YVXA 1E9YB 2FZNA 4HMCA 1K8XA 4GUIA 3R11A 5EMKA 3ARSA 4QNEA 9XIAA 3C0JA 4V1YA 2FPTA 5CJMA 4TXEA 4LUJA 1FWWA 2DUXA 4KESA 3BPWA 3BLPX 2XG9A 3TXVA 4M81A 4QDWA 2V82A 4J3ZA 2BY2A 3TQKA 3CJPA 4LAKA 3CWNA 4UZSA 4D6CA 1SQ7A 3IUIA 1EQPA 3SUUA 2ZFAA 2E3ZA 3P0WA 4Q8NA 3AXHA 5FCZA 1RY8A 1O1ZA 2O55A 2CERA 3NZQA 4EF8A 3AI0A 4DJEC 4PODA 1TWWA 1V77A 2XN0A 2G4FA 2W91A 4RDZA 3UJSA 1XBVA 4LSBA 2DT3A 1XRVA 1I1XA 4RZBA 4E8CA 2QF7A 3BH4A 1WO2A 5H2ZA 1FRBA 3L12A 3VXGA 2WCAA 1GQKA 4YYFA 3CS2A 4ZQOA 3MSYA 1F61A 4AIBA 4AY8A 1DJYA 2ZX6A 3LGDA 3CZLA 3H6OA 1KV8A 5K9CA 1DV7A 2JF6A 2ZA2A 1F4HA 2BHUA 1BLIA 4CQ8A 3U5YA 5H8PA 2DUAA 3I7QA 5DMYA 5HNRA 1Z44A 2YFOA 4IF2A 1XLFA 1SJAA 3M0IA 4EWND 4LC8A 3TSBA 3JU2A 1E1CA 2EQDA 4JIIX 4V15A 2ZUSA 5J04A 2XZ7A 4Z1DA 3L2LA 3HO8A 4DY1A 2D3LA 2X1TA 3W7NA 1LL7A 1OJXA 3SDOA 1GGOA 4NASA 5CSUA 2VFHA 3NM1A 4L6OA 3AMKA 3TCEA 1WKYA 4DJDD 5I3JA 3S6OA 5HUOA 4WSHA 3U3HA 1UUMA 3GKFA 5AHMA 1JRCA 2FZ8A 1CECA 1XFCA 2OQLA 4QFUA 2VEPA 2DZTA 3CGTA 1KM2A 4QAWA 2WZHA 4IHCA 2CBIA 1TV2A 4PMDA 1P1MA 4PBGA 1ZBKA 4NSBA 2DSZA 4JPGA 1G0CA 5CBJA 4GX8A 3AICA 5CJ5A 3KP1A 1DWJM 3W29A 2DT2A 3AXXA 3GWQA 4WXZA 1XLAA 4ROQA 1V5XA 5JUVA 1D3GA 2A6LA 3LI1A 1MFUA 1OX6A 1AJZA 2PC8A 4ZENA 4D9PA 2VOTA 2ZC1A 4IXXA 3HPZA 4ZQPA 4RW3A 2Q09A 2VFFA 4DZIA 1KFKA 1H7XA 2ZX8A 4NIRA 4X60A 4TV5A 3NQMA 4I5UA 5IBXA 4FOKA 3QC3A 2D0FA 4AVFA 3DYMA 4LVGA 4US5A 2FMNA 4O16A 1QPKA 1I0DA 5FF2A 5AC6A 2AOSA 2V30A 2VEKA 1D2KA 1I45A 6A3HA 1IF2A 2Y8KA 3K4AA 4D71A 3A12A 1I75A 1WDDA 4W9TA 4KEVA 1MMFA 3WQOA 1BXNA 3EKLA 3VZXA 3WQEA 1A3XA 2POZA 3ME3A 1VBRA 2QCNA 4C60A 2H9AB 3UT0A 1OINA 2X0HA 3SIZA 3SAZA 1RQHA 3M5ZA 5AZ0A 3VUPA 4I6KA 2HS6A 3UZZA 3AC0A 3M1ZA 1LBLA 3NTYA 4CQ9A 3DU0A 5GNYA 1EA0A 3UPWA 1HJXA 2ZE0A 2QPUA 1A53A 2E8YA 1HJUA 2Z6IA 3VCCA 4AIEA 2Z1BA 3NZRA 3HQ1A 4CD5A 4Q8UA 4FNPA 3L21A 1V6VA 2WJFA 1PKMA 2QVNA 3KBJA 1SW7A 3FHQA 3LU2A 3L4ZA 1THFD 1TJ1A 3QTPA 5K4XA 4ATDA 3UR7A 4R34A 2WANA 2BTMA 2UY3A 3VNYA 2J79A 4YU1A 1QPRA 4AF0A 4S3AA 3GKAA 4WDUA 4O1FA 4NJJA 1I2NA 2F6UA 2DP3A 5C8BB 1YMYA 5A6AA 3RPDA 3FGCA 2DJXA 3VGGA 1MYRA 4AVNA 2HDJA 2Z1SA 3WSUA 2CU0A 3GXIA 3DGBA 2WSKA 5FOOA 1BQCA 1VEPA 4EPEC 1JUKA 4DWDA 4MKSA 5AHFA 4G6CA 1DJHA 4J3TA 1OC7A 4AC7C 1QK0A 1LG2A 4JL2A 1EJWC 4H7CA 3I10A 4YVPA 3P80A 2R1NA 4UXDA 4DJDC 4PUKA 1TIWA 4U31A 3GDMA 2FTWA 2ZXDA 4QJ5B 3CQJA 1R3SA 4QLLA 4YNGA 1LWHA 4CNTA 1S5TA 2QJGA 3DHUA 2E1DA 4QJ3B 4TVCA 4N7QA 2OZ8A 1UMYA 1NF0A 3T2OA 3VD4A 3OLGA 3UQNA 4DBWA 1UWUA 5CLWA 2J8TA 5C0QA 1P48A 4D6JA 1QTWA 3ITYA 1FFRA 1PDZA 5JXQA 1T7LA 5JBFA 2BMBA 2FTYA 1IGSA 3VOIA 3AIVA 3SY1A 2BY3A 4OQVA 1EF2A 1IWBA 4L9YA 3W1LA 3EYPA 3TZFA 4IMDA 4GPNA 4PL1A 4HHHA 4F3HA 2J9XA 1GYLA 3POHA 4HQVA 2NQZA 5D8WA 3EMCA 2QDGA 4C6QA 3WH7A 3DN5A 4IGSA 3VX0A 2DT0A 2C15A 2QDDA 3H2NA 3BXWA 1K3UA 2V6AA 3UNDA 3W1MA 3BSHA 5F4XA 4IM4A 3DFTA 4GVGA 2QIIA 1WBJA 4F0MA 2J7DA 2YA1A 3SSJA 3DBPA 4Q6JA 4QJ1A 1S2AA 1G7VA 2NWRA 3TKFA 5KINA 2J7GA 3PULA 1XLGA 1JCJA 2V5LA 3I3DA 1EGMA 8RUCA 9XIMA 1B9ZA 3EWUA 4LQ1A 3S6DA 2ZRUA 2D3NA 1GVOA 1IEQA 3KVMA 3ARZA 2CESA 3EOUA 2WZTA 1TUFA 2V63A 4LX4A 2CETA 4GC3A 3H8AA 3IGUA 1UA7A 3B0PA 3E0VA 3MUAA 4QEHA 2X1UA 1SGJA 1DBTA 3LRKA 4XO7A 1XLLA 4B5NA 4ZZ9A 1L2UA 2YYUA 3VOFA 1GJUA 2RDXA 3XIMA 2R14A 1GOIA 2AL2B 5LNUA 2NZLA 5FESA 3CQHA 2ZUWA 3E5BA 4LNYA 3P60A 4W7UA 5HNNA 1RHCA 4ZEPA 3ZSTA 2Z1WA 4ERAA 4V28A 1VBHA 3VIFA 4PMNA 3NGFA 1EHAA 2B4GA 3TSDA 2EPOA 4OOZA 3PC0A 4N9BA 3W3OA 1EZWA 4GFSA 3CAKA 2H3DA 4PH6A 1M7XA 2AKZA 2V2HA 3EDKA 3VI2A 1LYXA 3L65A 3V18A 4DM1A 1ZLPA 3WBYA 2CITA 1K9TA 3ZWSA 2PGWA 2Y6ZA 1OCQA 4XAZA 1IXQA 2VI0A 2E5CA 3NJ3A 5MF5A 5FJIA 3QZ6A 7ENLA 1CIUA 3W53A 2DDXA 2Y70A 4I9MA 1E15A 4J28A 3AJXA 4Z42C 2ZRZA 3EPNA 1XW8A 3PM6A 3KLKA 3BAJA 1ZU8A 4AYSA 4M6VA 4P8UA 5CC6A 5U7SA 3TJXA 2QGYA 3GXDA 1XUZA 3EA1A 5FJTA 5A6SA 4GY1A 3TN4A 3SCSA 3MVIA 5AYZA 3VFLA 4BI7A 3QC0A 3QYQA 3II1A 1VBUA 3MTWA 3LCLA 1JRBA 5C70A 1MZRA 4LVBA 4XZBA 1Q6CA 1PYMA 1FTXA 1US2A 1Q65A 1DE6A 2Y89A 1RLDA 1OFEA 4UWMA 4GVFA 3W38A 3P61A 3TR2A 3UA3A 2YXGA 4BI6A 3N2BA 3CO8A 3WQ8A 3JW7A 3CV2A 3TXZA 2I56A 3CPGA 3E2SA 4BQ3A 2OEJA 4AZ5A 3BAIA 1GNXA 1XI3A 3C3UA 3BMWA 2PRHA 3KLLA 1V6UA 2GWNA 4JN8A 3GUGA 3WMLA 3I65A 4WOQA 3W26A 4LALA 1KFCA 5LIYX 3B0UX 3STFA 2XVPA 4G1NA 2CNCA 3H54A 4PGLA 1RBOB 1J96A 1EXBA 1KM4A 1IXOA 1FWJC 3WQ6A 1JDAA 3T44A 1OC5A 5I00A 5DX7A 3E49A 2E0PA 2ACUA 2VFGA 2XWEA 4ZTXA 3QMRA 1YNPA 4FXFA 2OSWA 3S2CA 2GVJA 4BWLA 4K37A 3D3FA 2Q8ZA 1MUCA 3NQDA 2D24A 5HWNA 3O06A 3T40A 1HGWA 1W9PA 3G6MA 3WD4A 2Q8XA 4QSHA 3G77A 3CQ0A 4YCPA 1UD2A 5J5RA 2VZUA 2FPVA 4ML4A 4BR1A 3A5VA 3UXLA 3SECA 1KFLA 2PGRA 5C9UA 2O9PA 3W7OA 1TA3A 3IRDA 1JDEA 4GQQA 3TVAA 2OGYA 4RXGA 4JZ5A 5AB3A 3BE7A 3F4WA 2VNCA 3TLQA 1EFZA 2PDMA 4IPLA 1EP2A 5FSDC 1X8FA 2Y88A 1LLZA 2JK2A 1TPWA 3S5YA 2OLHA 3DHPA 1SJDA 3MBDA 1DIOA 1TVPA 1WAUA 3GS6A 4U3CA 2VURA 3GVVA 4B5UA 3WUEA 3HGOA 3WELA 1O68A 2CCRA 3WDRA 1EWEA 1FY6A 1JEZA 4O17A 5CC3A 1RK5A 1Z69A 2YDAA 5EFDA 2WSYA 3T07A 3F2CA 3W1TA 3W2JA 2POTA 3QBUA 3RPTA 1LT7A 4MAVA 4R27A 3ARQA 4IPNB 4EPBC 4ZMGA 1ME9A 2BOFX 3GXTA 4MUPA 4IMAA 4KCVA 1LJYA 4KETA 1CGXA 4MLJA 3T8QA 1F2JA 4GUFA 4PEEA 2FVLA 4OBRA 1D8CA 1ISWA 3GG0A 5B80A 1XX1A 3M0LA 4KEUA 3BMXA 5HUPA 4AZIA 4MZ1A 1E55A 1D9EA 1HGYA 1TO3A 3FIGA 4LT9A 3UGVA 1EBGA 4I6VA 1U1UA 3PUOA 2NLIA 2XN1A 3DGRA 4MKVA 3P8JA 1US0A 4M1BA 3A9BA 1JF6A 4A8RA 6ENLA 1IR2A 3PP7A 2TODA 4NKCA 3K1DA 1AQMA 4IMEA 2DZXA 2FHCA 1ZSXA 3UG5A 3HGSA 3UESA 4PMZA 2R94A 2RGMA 3IPWA 4KW2A 1JXJA 4UOZA 5IHSA 3U6WA 3TU9A 3Q45A 4UTTC 1KCLA 4Y9AA 2ZVIA 7CGTA 1RQBA 1NP0A 4J27A 2DH3A 2X05A 1QRQA 4HKPA 4CNNA 3H2FA 3O9NA 4F40A 1A47A 2YXOA 4NG3A 1WUEA 1UC5A 3N13A 2WV8A 4AY7A 3EZ4A 4PB5A 6REQA 2CLPA 3H2OA 1ZJAA 2CWXA 5DXXA 3V5FA 3THAA 1FH9A 3VKJA 2DH2A 2IKIA 5A94A 2OMAA 1KW1A 5DCEA 2EXOA 4XBSA 1ME8A 1H1NA 4YLWA 4I8YA 4TX8A 3K8LA 4PUMA 2PAJA 2OKOA 1VLWA 2R8WA 3GNRA 2QYGA 3RM4A 4PMXA 4DIAA 5BYWA 3O1NA 4DF2A 1VEOA 2J7BA 2E9BA 1NY1A 2DSUA 4O0KA 3JRKA 2O9OA 1P7TB 3HFYA 4Q4QA 3BCJA 3RFAA 3AS0A 3S3GA 4YVVA 4WY0A 1BHGA 3MQTA 3S1XA 1RCXB 4UMCA 2GDQA 1AL7A 1KBKA 2R1LA 1SUXA 2NSXA 3M16A 3MHUA 4UR8A 1PIGA 3KBSA 1YBQA 2VX7A 3WEMA 4QXIA 1TV8A 3L4UA 2J75A 2BFGA 2XH2A 2VR2A 3UVIA 1S2TA 1NQKA 1JFXA 2FJKA 1XRTA 1TRIA 3PJWA 2WPBA 3B9OA 3N11A 2VX6A 3C5QA 3GLCA 4ORMA 4UMBA 1EJUC 1PXGA 2AGKA 2DEPA 3FKRA 3HTWA 3IJLA 3GR7A 5KZDA 3H2MA 3ZXWA 1XD1A 5C5YA 3VNZA 2IKGA 4EAMA 1PHWA 1NF7A 4CN6A 5BOFA 2VQUA 2CZEA 4QDMA 1EUAA 3B8TA 1CLVA 3LX9A 1QDSA 4M24A 1J0YA 3FJ4A 3THCA 3HURA 4DX3A 5KZMA 4DJFC 3K46A 1NP2A 5M03A 4PA8A 2Q3RA 1WDPA 4AISA 2WVUA 3TFCA 4H9YA 1GOOA 1OK4A 2X0SA 2VMFA 4AX6A 1QVBA 1FH7A 2PDJA 4MY9A 1A4MA 4ROPA 1EYWA 1A5BA 4NZFA 5HA7A 1FXQA 3NZPA 1UIOA 1LZOA 1IIHA 4J3SA 1CW2A 1WNOA 3REQA 4DAFA 1IZJA 3VNIA 4AIUA 1GORA 3U5UA 2GSJA 4GKLA 1TR9A 1XQKA 4QE5A 1KCXA 3EXSA 2QF8A 1E73M 3WG6A 4GZ7A 3WDJA 2QHAA 3A4XA 1BYAA 2J9ZA 2VP8A 5REQB 3MVTA 4MB3A 2ZXQA 1XC4A 5E6YA 4M7SA 4ILSA 2NUWA 1QHPA 4PMJA 4MLRA 1Z41A 4G7EA 1E4IA 1P0DA 3PBGA 1WPCA 1WX0A 3CV1A 2AMXA 4LVFA 1IEXA 1Q4WA 4PCFA 1K9DA 1BWLA 1UB3A 1XPGA 1TPFA 4YHEA 4O52A 3LBOA 2YCJA 1KKRA 3B8WA 4CQCA 2IXVA 3NSMA 2FZMA 3M64A 3VNMA 4PTWA 3DUGA 1POJA 4RX0A 3CC1A 1NQ6A 3WFAA 3W7CA 4HPGA 2IKHA 3LTYA 3R79A 3CO4A 1KB3A 2VEGA 4GCAA 3FX4A 3I4KA 3C2FA 2NVDA 1BF2A 1JIBA 4US6A 4PN2A 4F8XA 3G1XA 1KRCC 4V1XA 2ZDRA 3RLUA 1KTCA 5LIUX 4P7RA 2V3GA 1IXNA 2G96A 3BAKA 2GSEA 2ZZ1A 1OGGA 3RMEA 1S3TC 4JTSA 3V16A 4B92A 1W8GA 4PSPA 5FIPA 3CEUA 1PYFA 1FBAA 2YCLB 2OWWA 3ABOA 2PDFA 1QAPA 2PGFA 4US5D 1JAKA 4PCPA 2B7OA 3MHGA 2J47A 3QKZA 3GUWA 3V75A 7ODCA 2E1WA 3GFXA 1QCWA 3VKCA 4HVXA 3PWIA 4MNMA 5CG7A 3BG5A 5EU9A 3PSVA 5CPOA 2OYLA 3CT2A 2H8XA 3TH6A 3BLFA 4URIA 4ZCWA 3UXKA 1DE5A 3IVUA 4B5SA 4TX9A 2WSPA 2BVWA 4BQ5A 4AYGA 1FWIC 3VABA 3HBLA 4MWAB 1H7PA 3VINA 2DZVA 1CZ1A 3CBWA 7A3HA 1W9DM 2A5HA 2O9RA 1R3WA 3TDFA 4IP7A 4C6EA 4E4UA 3IAQA 5CGQA 2GJXA 3IJ6A 3LRLA 1WE5A 1QOPA 1W5NA 1VCGA 1H7NA 9CGTA 2FH8A 4H6QA 2PI6A 3S5SA 1E70M 4E2VA 4FP1A 1W32A 4XKYA 3ABSA 4AF0B 4HPHA 3VKKA 2YBVA 4R53A 1KM0A 1E6ZA 1UP3A 3O0KA 2OQHA 4HMNA 1XWYA 3KRBA 2Y8VA 3UR2A 2PSNA 4NAFA 4O4WA 1VBGA 1TWSA 4R3UA 1P43A 1OYCA 4A21A 2WBGA 4AXKA 4P8VA 4U5KA 1AH3A 4AD4A 3RXZA 2BY1A 1YLVA 3QXBA 3ZIZA 3BICA 1SO4A 3LHYA 1V0MA 1JQVA 3L0GA 1G7UA 5I0DA 1PPIA 2WMJA 1QBAA 3R2GA 1JPDX 1TTIA 3BWWA 3CWOX 1F3EA 4Q4PA 3B0VC 3IGXA 1KFWA 4AEOA 2DY3A 3GH7A 3GVQA 1OABA 1QI5A 3T0CA 2A3CA 1VPQA 2CEQA 2O7QA 1LBFA 1R7OA 3J7HA 3TW7A 4N9DA 3ZWTA 4MYAA 1BFNA 1B90A 3W37A 1T8QA 4FZIA 5CXPA 3K5XA 1FX6A 1JZ4A 4HCDA 3LERA 1LL4A 4ZB2A 4Y96A 3OZPA 2G95A 3UCDA 1M65A 1ITUA 1S5WA 3NO1A 2PC4A 3VA8A 1I2OA 3DFSA 2DSVA 3KE0A 2Y0FA 4JQ2A 2W62A 4IIBA 4L6DA 2VOMA 1Q3NA 1HNYA 4JKKA 5D2TA 4GQGA 2DZWA 2B7QA 3GAKA 4LEQA 1R2TA 2YW4A 1EC9A 1XG3A 2FJUB 3TYBA 4LYQA 3MP5A 3N18A 3T7VA 2ESCA 4XTDA 3VNKA 1Y5VA 1DQWA 2PBOA 3AAMA 2E09A 4WJEA 4DO6A 1R47A 3VIKA 1XDMA 3BAXA 1MXSA 1T8XA 1C9WA 3W7RA 1XC6A 3KHJA 2RDUA 4XQ6A 1S5MA 3B9EA 2BSLA 2HNEA 1W1YA 1Z42A 1FP8A 3FN9A 4NNCA 3UZXA 1V0LA 1HKWA 1BQGA 1FWGC 4ZXOA 4U4MA 4BJHA 1Q6QA 1DWGM 3UBPC 5JVLA 3RCMA 3NL6A 2DIJA 4GY7A 4ZOCA 3H7UA 1G69A 4I7UA 4OOUA 3WQDA 3NEHA 2P8CA 3NWRA 3QV7A 5BXSA 1JJKA 1J8VA 4GUGA 3WL0A 1Q13A 4AMCA 4PMRA 3G0UA 3IJ7A 3DZ1A 1DHPA 2PDGA 4LC6A 1GOQA 2FFCA 1W6TA 3QH2A 4H19A 4MG4A 2GUUA 2V38A 3ARYA 3G18A 1PTDA 4JN7A 3PZTA 4GVHA 1WXJA 4O12A 3VFCA 2PWUA 3POCA 2ZX7A 1W3JA 1QHZA 4EACA 2QCCA 3AZSA 7REQA 4CNOA 1QNVA 2OSYA 3OVQA 2NSOA 4C5YA 1G4PA 3NOYA 3KWSA 4L65A 4IFKA 3CMGA 4FNRA 3WUFA 3GBEA 3TTOA 1RCOB 4K3ZA 4WY0F 3L4XA 4ZTYA 1OADA 3GU9A 3F4DA 3ES8A 3WLKX 2G3NA 3G1HA 1RBLA 4ZSUA 3NPUA 1E0VA 2ZUMA 1J10A 1W37A 4CUCA 3VD9A 3R13A 1NWUA 4MDPA 1QOQA 1XYBA 4NNAA 2D2HA 4RZ6A 3WDPP 3NQEA 4X9SA 3CUFA 1O6IA 3P0XA 1KGWA 4JFVA 5KEZA 4Y8FA 3DKJA 3ZVHB 3NA8A 3EKGA 2WXDM 3G3DA 1WDSA 2OVLA 4PEKA 4YMZA 1JI1A 5FEXA 1RK6A 3QGAC 3EX3A 4H2CA 5DN1A 1J4EA 4RDYA 3GHSA 1YE6A 3WLSA 2PWEA 4DNMA 3NURA 3VNLA 4JIEA 3ONBA 3HPAA 5AC5A 3LI0A 4QGCA 3CZJA 4JOMA 4UCFA 2KAUC 2IS7A 2YB1A 3ZYZA 3JVAA 1Y5WA 1XPYA 4QSFA 1W9BM 5CCZA 4FLQA 3FA5A 4BS0A 1GKRA 4H4IA 4B16A 4KWWA 2E5DA 3GTXA 4GYKA 4PL2A 4N9EA 2GGGA 2VO5A 1UHVA 1ISVA 1HO4A 4UQBA 2GUBA 1U5HA 3SFWA 5FJJA 2CBJA 2I9EA 1L6FA 3CZKA 4KS0A 5BU6A 3R0KA 5IOBA 4FA3A 1WCGA 1BVNP 5E1QA 1EC8A 1CGUA 5A6LA 1SR9A 1JYXA 3F7JA 4NQ1A 2C0AA 1W3HA 1J2BA 5I07A 1LQ2A 4E8DA 2DIKA 3SCTA 1S5NA 1XYCA 3EWCA 4IJBA 2HVMA 2J6VA 1Q6GA 3LHTA 1GHSA 3LHZA 2V9DA 3FXYA 3P2VA 5BXRA 1EEPA 7TIMA 3LBCA 1MNSA 2VCCA 2JIEA 3IK2A 1JYVA 1B3ZA 3E9AA 3WL1A 3WQPA 2V8ZA 4OT7A 3DECA 5I7GA 4ZO7A 4M80A 5AN7A 2BV9A 3LMYA 2NT0A 3PFMA 3UWEA 4Y90A 2GDUA 4UUIA 4QDPA 2OFJA 5CC5A 5D2VA 1OVDA 4HN8A 2J6XA 3N14A 4FLOA 3N12A 3W25A 3VKDA 2OJPA 1PO9A 1CLKA 1US3A 3BLEA 3S9ZA 1KGUA 2BOGX 3URNA 3R0UA 1E1EA 4NNBA 1IYXA 1M68A 4DF1A 3L5LA 2EKGA 4MJ2A 2A6NA 4KIEA 1C92A 1E1FA 2A7NA 2E6FA 5C9RA 3QPEA 1W3KA 1V6YA 1NOUA 5LIKX 2NLYA 3SN4A 4RXFA 3WQ5A 3AIWA 2HK0A 2TPSA 1IT8A 1H60A 1TV3A 1FWFC 1BWKA 3A9IA 3WH8A 2IPFA 1ZZMA 2CLLA 2EJ1A 3OGSA 2FQIA 3B40A 4NAEA 4Q8TA 3AU6A 4GXMA 5AC7A 4LAMA 1FP9A 4KT2A 3UA4A 4BCEA 3QHMA 2OU4A 2WB5A 3LLDA 3WH6A 4EWJA 4ZO6A 4HPJA 2XH0A 4WLCA 3L4WA 4S3GA 5F1UA 3CUHA 3M7WA 3SR7A 5CPLA 2Z2BA 5BOOA 3O15A 4D8ZA 4PR4A 4DI9A 5DQPA 1JXKA 3IIXA 1DJXA 3TE9A 3S2NA 3WBXA 4DWSB 1AD4A 1UP0A 3KRUA 4JHMA 4EXQA 5EYWA 1ZAIA 1UH4A 2X2YA 1J5SA 3B8DA 4X22A 4WRHA 4JQ4A 4LXFA 4IUOA 2BVYA 3LNPA 2BXZA 1WA3A 4GG9A 1UWTA 1X8CA 8TIMA 2BS9A 3H2EA 3JZUA 1VBJA 3VKBA 2PTYA 5A69A 1KNWA 2JF7A 4E8GA 5A6TC 4A8NA 1ZP4A 4FOUA 1UC4A 1VKFA 5A8NA 5FACA 2PDHA 4L80A 1PEZA 3GM8A 4JEJA 3MKVA 4KCUA 3XISA 4Y9MA 4Z2GA 1IGWA 1JZ8A 3WMSA 3T1GA 4UTWC 2JBMA 2WC7A 1OB0A 4QHRA 4MWAC 4O1AA 2OYKA 4A35A 5BMWA 3GW0A 3AMCA 1MZHA 3BOLA 2VZSA 3NO3A 3MU7A 2QJNA 4Q8WA 5LZLA 1HUVA 5AYXA 1S38A 3OW1A 3WLNA 1J11A 1YNYA 4YS1A 3TWBA 2XISA 2A21A 4JTCA 5CZ0A 3I6TA 1HO1A 1H0GA 3UZWA 1NTHA 3AZRA 2VYOA 1ZJBA 2OOGA 4J4KA 2QV4A 1QNQA 1XS2A 2XJ7A 3MB9A 5LNRA 3VILA 1XIBA 4OE7A 2IUZA 3C52A 3PK7A 1OK6A 5F1VA 5AFDA 1XLKA 2WK2A 1GW9A 3MANA 2BGSA 2R91A 4UTUA 2VDIA 1R9ZA 2RDWA 1DJWA 3IVSA 2JIWA 4K2SA 1XH1A 3M7SA 4K8HA 2W61A 3ITTA 1W3IA 3UG3A 6TIMA 1X7FA 3UCQA 1ISYA 1EP1A 1KXQA 3SO7A 2B81A 4MF4A 3N17A 3K4DA 1T96A 1YPFA 2XSXA 4LUTA 3RITA 4GABA 3NEVA 4MPKA 4KRUA 2UV8G 3QEZA 1EGZA 5JMUA 3ZFHA 3TMQA 4B9YA 4GH3A 4G56A 1ZB5A 1S5VA 4AD2A 3W22A 1E72M 2PURA 4HZ7A 2X1RA 4AY1A 1H0IA 3H4GA 2TRSA 4W87A 3WUBA 4AHQA 1GOXA 2PS2A 1A5OC 3V4BA 1Q6EA 4OKDA 2WMKA 2R1PA 2ZUVA 4ICNA 5HPOA 5G4WA 4DUWA 1AJ2A 1TCDA 4MKNA 4UOQA 3G0XA 1GW1A 1YE4A 4HN4A 2QXWA 1ENUA 2PF0A 1Q6RA 3PZMA 1DWHM 5GPRA 5ECVA 3HU7A 3T0AA 5EL1A 5E0KA 3W7HA 2PCQA 4FI4A 1VJIA 1AMKA 4XAFA 4UNIA 3G24A 3VMOA 4I7VA 2NQLA 1G5AA 1DIKA 3IWPA 3P67A 4MHBA 1KBBA 2PRMA 4QR6A 3QFEA 5E70A 1DXIA 3K30A 3ARVA 3WLOA 2RJGA 5HJYA 3T2QA 4NRRA 4V33A 2WNZA 2QV5A 1E5JA 3TV8A 3UFYA 4L4LA 2YZRA 3NNTA 1RY0A 4IG2B 1SO6A 3LK6A 5A2AA 4DJDA 4X9YA 4RK8A 1TX2A 1TVNA 2J88A 1G6CA 3BOFA 1VFMA 4W93A 4XD4A 2F7FA 1H7RA 4ZB5A 1R3QA 2VHLA 4QS5A 4H41A 1KM3A 1TV4A 2E5BA 1H5VA 2YCKX 5TD4A 2WMFA 4RLIA 3U2CA 4IX2A 1FWTA 1DWAM 5T9CE 2FKPA 4H2HA 1XUUA 1OEPA 3ZT7A 3WLTA 3ZJ7A 2J24A 3U2OA 3NG3A 3KBWA 2IQTA 1UR9A 1EGVA 2VTFA 3G1RA 4IP5A 3N3TA 5D04C 3SGZA 1SSDA 4V2XA 4UCGA 5DXYA 1RPXA 3P81A 3W1XA 2ZIDA 1M6JA 2V67A 4IMCA 1TCMA 1I9CB 2XFRA 4HHLA 4QJ4B 3WJSA 4XUGA 1JD9A 5HJLA 5PTDA 4MTVA 2EPMX 3USZA 1NELA 3O07A 2C7FA 3QR3A 3EPMA 3WLPA 5DO8A 1WKFA 3R8HA 3SUWA 3AHVA 1B1YA 2YCLA 3SRKA 3KOWA 3S5ZA 4B5XA 1AL8A 1CNVA 4JNYA 4IIFA 4H9TA 5EMYA 1KM1A 3FJ6A 1OFOA 3VIJA 3LBMA 5AY7A 2BVTA 2YSWA 2ZZ6A 4O4VA 3LYEA 2V2DA 3N29A 5LA2A 1IV8A 1VAHA 3MJMA 4LRSA 4MJ4A 3DC8A 4AX7A 1QNOA 4XWUA 3SQSA 1EQCA 2ZZ5A 4HTYA 3BAYA 3W4RA 1JZ6A 2I1OA 3CAWA 1UBSA 1TJRA 1Z7AA 5HXMA 2FLIA 5LNWA 4K1GA 4JTUA 3A22A 1ADDA 2Y61A 5BCAA 4EAYA 2PTDA 1BG4A 4IMGA 3BSMA 3O05A 2Z1XA 2AQOA 3VGBA 3TC3A 3O6AA 2YPIA 3NQ2A 3A3WA 4UQCA 4JFSA 1UBPC 4S2CA 1EJSC 3AXMA 3LD5A 3FGCB 3QTGA 5B7YA 4YTRA 4Y9OA 3CU2A 1XLJA 3MMWA 1DL3A 1KTBA 2REQB 1OFAA 1L6GA 4M7TA 1LCOA 2OZTA 3FCPA 3QW3A 1QPOA 4A4AA 2ZX9A 3UR5A 3RX4A 1HKJA 3TR9A 4H8UA 4QS6A 1O4UA 4E4FA 3BTNA 1FKWA 1JNEA 3NZGA 4NP7A 4LUSA 2HV5A 4GACA 1V79A 4JIQA 3VNDA 1SZGA 1CEOA 1RP9A 2X8RA 3R43A 3ABXA 5I02A 3UWUA 1EJXC 3PZUA 3VOHA 2NXGA 4ENLA 2H90A 2W6RA 3PY2A 3N2CA 1RA5A 2UY2A 4UTMA 1ZRQA 2Q3OA 2INFA 4UR9A 3U9IA 1EDQA 1SMAA 4PMYA 1OFRA 4KIRA 2FIQA 3NVDA 3WUGA 2HE5A 4W5UA 3APGA 5D8ZA 3KHDA 3BZGA 2PTXA 5LHEA 1XSJA 4MY8A 4RE0A 4QM1A 4NYUA 3ARTA 3WJWA 4GRSA 1DORA 3L0KA 3O0FA 1POKA 2WQPA 1LLWA 3R8GA 2FVKA 4P8XA 1NWTA 3DKLA 2RKXA 2PUZA 2G5WA 4B4FA 5DBUA 2PLJA 4ZO9A 4HSOA 3LHVA 1Z9AA 2ANUA 2Y5SA 4QX4A 3A13A 3T9PA 4GGHA 3TONA 1UW9A 4GJJA 2BBFA 4L56A 2QT3A 1DJQA 3W00A 5GNZA 3EA2A 3VC6A 3EB3A 1V6TA 2INZA 2WVVA 3TUUA 3TTSA 3C8NA 1LQAA 2ZOXA 4QG6A 3IJQA 1CXEA 2FB2A 4K38A 1TE1A 1PDYA 1EIXA 4LBRA 4DUVA 2VEFA 3T78A 2D69A 1YQ2A 3VPLA 2YKKA 3UG4A 3EOSA 4FO4A 3RJXA 4KCWA 1FWEC 3LENA 3ALFA 3DOPA 1XCXA 3IJIA 1TG7A 2P88A 4NXSA 1OFBA 4HJWA 3LGEA 1GVSA 4O1DA 3SIMA 2WZEA 2WJZA 1JYWA 1PKLA 3ATYA 4LBUA 3FSTA 1FWRA 1UR8A 4AD5A 2GSHA 2ACSA 3WLHA 4Q7BA 3KRZA 4L6HA 2QIWA 1PX8A 1TPVA 1XL9A 1IR1A 3ATZA 3SY5A 2XFFA 1ICPA 3NXFA 4RJEA 3WIJA 4PMOA 1FCVA 4DBEA 1BG9A 5FKYA 1SO5A 1VFTA 3ZZ1A 2CLEA 2IQDA 1UZDA 2OX4A 1BVZA 1XGDA 1B57A 3BGAA 3GXMA 3Q94A 3ITCA 4BZYA 1LTDA 5HWMA 4JTLA 3E02A 4X63A 1H62A 3WBEA 1NDVA 3PZGA 2A3EA 3AHYA 2ZRWA 5BXPA 2HJPA 1JZ7A 1OG0A 5A6JA 1HN1A 5F2GA 3B0XA 1MQRA 5JU6A 3AOFA 3IK4A 1SFJA 1G9HA 1HVQA 4IGHA 4FPSA 3HIJA 4CQDA 2WBKA 3QSRA 4L1XA 3PZIA 1ZY9A 6TAAA 1KD0A 4U2ZA 4OV9A 3AUJA 2WMIA 3W1AA 4DXXA 5BRPA 1AK5A 4N0RA 3SN1A 4UQEA 2QULA 1MNZA 2EHHA 2QMKA 1TRDA 3VGEA 4Q4RA 4H1ZA 4NJHA 3NSXA 1KWKA 4C6LA 1N8IA 3IS4A 2ON3A 3BLDA 5CZKA 1R3RA 1QHOA 1EWDA 4GI6A 5A2BA 5M1TA 4E2DA 2G3FA 1Z8AA 4N42A 4UR7A 1O5XA 3GHUA 2QMJA 4Z1AA 3WD1A 5BU9A 4O54A 3VGDA 3G1DA 1FHVA 4GCXA 2CZVA 4QNWA 3APTA 1U1HA 2ZWZA 2CHOA 1B5TA 1I60A 3KDNA 3W7LA 3LV6A 2Q71A 1P0NA 1QNPA 2YL8A 2PU0A 3OEXA 1J0HA 5DMMA 3KOYA 3UP8A 4JNMA 3PB2A 1TB3A 4QROA 3VDBA 2ISSA 3WNKA 1QT1A 4ZL1A 1EDTA 3T0TA 4NRSA 3LV5A 5FD0A 2QCHA 3C2VA 2J25A 5HMSA 1I2PA 1HVXA 3UZ5A 9RUBA 4FNUA 4B3ZA 5G4HC 3GNNA 1ZS2A 2W67A 3LQLA 3S6TA 3P14A 4K8EA 1DTUA 1XYLA 2OT0A 3S2MA 4E0CA 3L9CA 4XZMX 2GVEA 3HJZA 1OCJA 3DFYA 2PDIA 2DZUA 3QN3A 1GG1A 1O1HA 2DJLA 1LT8A 3SQLA 3WK2A 5G2IA 3RUBL 3GQYA 3TJ4A 3LTPA 4DPPA 2AQVA 1FQ0A 3C4UA 5AYIA 3LCGA 3HGJA 5HMEA 4H8HA 4IPIA 5CLTA 3PANA 3DH7A 1RBAA 4B2DA 1LWJA 3WNMA 3S4TA 3GD6A 3TN3A 1W1PA 4J9JA 1DJGA 4CD6A 4E6MA 4JFWA 3W1RA 1L8NA 1XBZA 2VX5A 5GJNA 2ALDA 2QJJA 3DIPA 3WMBA 1H4PA 2XFYA 3E0FA 2Z7KA 1QBBA 3TEVA 3NYZA 1O66A 4Q8MA 4W5ZA 1E6NA 1B54A 1KR0A 5CSSA 1JPKA 1EJTC 4JY8A 2V69A 3FYPA 1ONEA 3APYA 3P3BA 1W17A 3RCYA 1BD0A 3EEGA 4D6HA 2CLKA 2EBNA 3E2VA 5B7ZA 1MO0A 1OF8A 1WP6A 1QI2A 4UTKA 1ZTVA 3NXLA 1UD8A 3LPOA 1YDNA 2TSYA 4NZJA 4Z2IA 1A5MC 2E6AA 1K8ZA 3OZYA 4EVZA 4JFTA 2FTPA 1S2VA 4DJEA 3S46A 2TAAA 3M47A 1WZMA 4AG0A 1PX3A 2RGLA 1Q2RA 4Z08A 1TPC1 2WSQA 4WQ6A 2I57A 1HJVA 3IJDA 3TW9A 4Q8VA 1NDZA 4XZLX 4HPNA 4IPJA 3WBWA 5D37A 3ENLA 1ZQ5A 3VU2A 3GTIA 1BF6A 4WSKA 1NU5A 1TPH1 4D6DA 3HM7A 3A3XA 5A1AA 5AVHA 2EG8A 4A3UA 4AWSA 4QEEA 4HA3A 4S38A 1R87A 4RV8A 2E40A 2XIQA 3QW4B 3WK3A 1E6XM 5CEWA 1PWLA 1UKPA 3WLLA 3RX3A 4TV6A 3MT1A 4JTRA 3BSGA 3OU8A 4RDVA 1GVYA 2XH7A 3WO8A 1RZMA 4W7VA 3PBUA 4O1CA 2OZ0A 1KBIA 1XIDA 3QM3A 3S1VA 3W82A 2QLYA 3WJZA 3TJIA 3PJXA 2XZ9A 1R0MA 3AYTA 5FEPA 3KVLA 3IJ9A 1GEHA 1C8VA 2D2JA 2QUNA 2WMHA 3C56A 3W1NA 5D2YA 3OIXA 3LPPA 3NPWA 5TNVA 2ZDSA 1B0IA 3CUXA 3FEQA 3QJAA 1DJZA 3B4YA 4FIQA 4DJED 1J18A 4HZ8A 2JQXA 1OYAA 4NILA 5K7JA 5D9OA 3AS2A 3OB8A 1UPMB 3QKEA 2VZTA 3U57A 2Z24A 2PLCA 1PX4A 3IANA 4JX4A 3ZQ9A 5AHLA 1KR1A 1UJQA 3BLLA 3N04A 2C91A 3V7PA 4BFAA 3HB9A 5LYRA 5HDRA 1JUEA 3RAOA 1AG1O 3STGA 4ZXLA 4ZA0A 1NFGA 2WHLA 3FAXA 1FHLA 4WCJA 4GOAA 5G2WA 3OA5A 4H6KA 2XSBA 5DT5A 5H91A 3OBKA 4FLRA 1A0EA 2NXHA 1MDLA 3I6EA 1TV5A 3R25A 3FOKA 4H8NA 1SZRA 3LM3A 2TMDA 3AHZA 2IMRA 2VFDA 3S83A 4PMVA 1W5PA 3R12A 1MW3A 1OSEA 4RPQA 3LCHA 3URBA 1BPLB 3BLKA 3F5KA 3B03A 4HOWA 3RYSA 4LAUA 1JDDA 3EWWA 1YYAA 3MSGA 1QW7A 2NT1A 4H9VA 3HN3A 3MI6A 4I7WA 4HNNA 3PB0A 2R24A 2EG7A 4DUOA 2W3ZA 3M07A 3GDRA 4LFYA 4OBSA 2ZUNA 4YN5A 1Q8AA 3GG8A 3HZ3A 3WQ4A 3KTXA 4GI9A 4HSHA 2BASA 3WQFA 7XIMA 2WJDA 1NOWA 2SFPA 1LOSA 4JYEA 1VF8A 1I1WA 3CHDA 4JTEA 4HIBA 4XISA 1UWRA 3RLGA 1FA2A 5C7HA 2QCFA 2R1MA 3N1AA 1K4HA 1ICSA 3ZR4A 1VIWA 2KX9A 3QV6A 3C0LA 3WCZA 4LCRA 4F66A 4PUJA 1ITQA 2B7PA 2JGQA 5I2UA 1KM5A 3QQ1A 3QY6A 1XSIA 1LP6A 3ZJ8A 1UD3A 3TP4A 3UJ2A 3TK7A 2Y4SA 4GO8A 1L0PA 1JPMA 3BW2A 1PV8A 1IZCA 1L6WA 3SY8A 1SFSA 3QYSA 4KEMA 4YPJA 4R7WA 1UASA 3M43A 1WBHA 1GKPA 3H4XA 3PJTA 2HVOA 3RHGA 4AZBA 3AS3A 3O6YX 4R33A 3F5JA 5C71A 2CLIA 3MCMA 5DT7A 1Q5MA 3TOPA 1X6LA 3V1PA 3NL3A 1KQZA 2EF9A 3GZAA 3ZLFA 3LNMA 3VAVA 4IL2A 3KP0A 3R5EA 4M56A 2IPWA 3M6DA 6CGTA 2J8FA 1PE1A 4FNTA 2E6DA 5AOUA 4PUDA 1XIMA 2Y63A 2GGEA 4DWSD 3S5OA 1B4KA 1EB3A 2QPXA 5TF0A 4BY3A 4WGHA 2JKAA 2R6OA 3PZNA 4FHAA 1V6XA 1UD6A 3E0IA 1TUXA 1V7AA 1YBQB 2A0NA 2OGJA 4AC1X 1FDJA 4AWUA 2ZZ7A 1NOFA 4LTSA 1CGTA 5BWFA 3A6OA 1PSCA 4GISA 2FZBA 4OV4A 1ZNNA 4C65A 4LY4A 4QE1A 1UOKA 1H51A 4CD8A 4JKLA 3M0HA 1PTAA 1W3NA 4M6UA 2DQWA 4Q33A 4W8BA 4RNFA 1KBJA 4WDWA 3LG3A 1EC7A 4GQRA 4LAOA 1GJPA 1UUQA 3RM8A 3DHFA 3VD7A 1RAKA 1XLBA 5AYYA 1W54A 3A5FA 3G8RA 3BGGA 4GKTA 4GNJA 1JFHA 1NDWA 4F79A 5G1YA 4B5TA 2PPGA 3LUTA 3WEOA 2CLOA 1JAEA 4D8LA 4EANA 1YXCA 4MVAA 1OT2A 2GOKA 2PGEA 3E6EA 4J2PA 2HE8A 5A5WA 5KTLA 3RU6A 3H21A 2HXTA 3LXAA 4NVTA 4B3KA 4O1EA 3V1HA 1AQFA 3FVMA 3KZSA 3S47A 1F07A 3L68A 3CYVA 1BSLA 3RIKA 3GC2A 3ITLA 5CPMA 4DYEA 4DEFA 3NQGA 4Q4OA 1J0IA 3GDTA 5REQA 3GNPA 3KS5A 4IFOA 1KLZA 4PC8A 4KEZA 3UNTA 3S9IA 2DSKA 5D9MA 4K36A 1W5OA 5AZ1A 1C8QA 3TC6A 2VFIA 1M3UA 3SCUA 2P0OA 4S2BA 2VXNA 4UNLA 1BYCA 2XPKA 2PTZA 2X41A 1HTIA 1OWQA 4H7ZA 1QFEA 4XV0A 1VRDA 3FS2A 2I14A 5FAGA 2IKJA 5CPTA 1LUCB 3MUY1 3W1PA 3QY7A 4HK7A 4LYPA 4QRNA 3LLXA 2GL5A 2VENA 4YXGA 1Z6KA 1J6PA 3NIYA 2V0TA 2DW7A 2JFEX 1EZ2A 1TIMA 4O8AA 3ZVIA 4HNOA 5K4ZA 3UYCA 2PWFA 1MUWA 4FK9A 2F6XA 3PPGA 2DVTA 5ABTA 4Q4KA 2TYSA 2C71A 3KFTA 2JALA 4DWSC 2AL2A 4J40A 5JH1A 4EK7A 3BC9A 5D02A 3CPRA 1EF3A 5KZEA 2X30A 1NFPA 1CCWB 1PL9A 2P10A 4B9ZA 2PWGA 1M1BA 3VOGA 1Y0EA 4GYPA 3MP4A 5KSWA 4X3ZA 5HOSA 3O6DA 2HMCA 1PS9A 2HWGA 3S1UA 1JNDA 3P6LA 2WSRA 3OZOA 4PRWA 1CB2A 4HU3A 3CL7A 1XH2A 1BYBA 1OF6A 1A0DA 1VLIA 4W88A 4MNLA 4W85A 3WNNA 4O1BA 1ZL1A 3U4FA 3VKAA 2D0HA 2WWDA 1WUFA 3LZ3A 4DZ5A 3GX9A 4Z0JA 3UERA 2VL4A 3C2EA 1CDGA 1AFSA 2CZDA 4MWAA 3UG8A 1JCNA 2A4AA 2Z0IA 4PTMA 4PSRA 3IAPA 3EMZA 3GK0A 1EXPA 1HKVA 2XIMA 3GW3A 2PDXA 3PTDA 3SRFA 3M4HA 2VC7A 4R9OA 5K3VA 1IHIA 1UMLA 3L67A 2YW3A 4UFJA 1NVMA 4E3TA 3PBYA 2QAPA 3KM8A 1A5LC 4JBRA 5FL1A 1RLCL 3P5YA 2GYIA 1Q7MA 4LU0A 2E9MA 2NV1A 1H09A 3EXTA 3Q67A 1WZLA 2O9TA 3DESA 1PKYA 1T40A 4QBXA 1R46A 3DCPA 1E0TA 3TA6A 1GT8A 1J93A 2OWXA 3ARWA 4YTUA 4Z1CA 4ICMA 1AMYA 1VS1A 3OIHA 2XWDA 3QZEA 1TWZA 2Q02A 5E9AA 4JL1A 3VDGA 2BLEA 3CMJA 2ICSA 4D8AA 2VGIA 3T8LA 1NWSA 1XIHA 2VC5A 3EDDA 4GINA 2E9LA 3NQBA 4IJRA 1UWSA 4U10A 3G5EA 3GG7A 5HR6A 1MEWA 1C93A 4FEZA 1XRSA 4LANA 3LM7A 3DXIA 1R2RA 1H1YA 4BF7A 4HOXA 1W9VA 3UPBA 4LAZA 4XO6A 1FWBC 1BGAA 4PTVA 1VYPX 3VCRA 2BXVA 1F8MA 2XSAA 3B3DA 3I3BA 5LXXA 4AZCB 1WDWA 4H3DA 1K7XA 1B31A 2GUYA 2YOCA 3FAWA 1UIPA 3PAOA 2ZZ4A 3W72A 3R1ZA 4ACZB 5ABFA 1PKNA 1RVKA 3H70A 2FDSA 1BRLB 1EA9C 4JIRA 1GQJA 3HPSA 5I6SA 1F9CA 4FAMA 1Q6DA 1XYAA 4PFHA 3DC0A 2OQYA 4HU4A 4IG2A 4C6OA 3MUCA 4Y2WA 4L1GA 1TZZA 4GNKB 4MOZA 4ZO8A 2P5NA 2YDSA 3CLWA 4ASTA 2VELA 1UR1A 3MKCA 4E2OA 1SZNA 3TNBA 4F9JA 2A85A 4DXVA 5FA5A 5CSYA 4X0VA 4S3JA 4N2YA 2QKFA 4E38A 1TREA 1MW2A 4KRTA 1V3IA 3NOEA 3AXKA 4HNLA 1E9LA 3T4CA 4H6EA 4K68A 1HG3A 4MFDA 1E9ZB 3ECQA 1BAGA 1A49A 3W7EA 1GOKA 3EDEA 3PF3A 1ISZA 1QI4A 4U2YA 1PCKA 3LZ5A 2GVYA 2Y1HA 3F1QA 2JE8A 3GTNA 4JTGA 3ZSSA 4M5PA 4GIAA 3TYEA 1RALA 2ZE3A 1OGBA 1ZPTA 4PYSA 2C13A 2J78A 3TYCA 3WH9A 1ODZA 4N6EA 3W28A 1J9YA 5GNXA 2PDYA 1ICQA 2XFWA 1N2VA 1TQXA 1OIMA 4PUWA 1VRXA 1K03A 3H2AA 3BL3A 4NI8A 4JNZA 4LUTB 1MRAA 4R5EA 1PWMA 4A05A 4EOUA 5TQLA 4FNSA 4QAIA 5FF0A 4M6PA 2B31A 5K2ZA 4O15A 1Q4NX 3CTLA 3MY9A 5U4NA 1FWNA 2CPUA 1UWAA 4ZQNA 1TVLA 1HL8A 1OIFA 1XF0A 4ADTA 4PZVA 2DQXA 1LRNA 5ABEA 3OQ8A 1REQA 3MZ2A 1ZAJA 1E9IA 3G1FA 3KZPA 5K9DA 2C1GA 4D6GA 3M5VA 5M17A 3W27A 5CC7A 3DYOA 2ZCGA 1W5MA 3OHIA 5CBBA 3MCNA 4GH1A 1K7EA 4JS3A 5FL0A 1FWHC 4GJ1A 4HMEA 2NV9A 3LCWA 4AH7A 2CKRA 2PU1A 4CN1A 5C7VA 1V08A 2DU2A 1XDLA 1OC6A 3IGSA 4UMAA 1A5NC 1HJWA 5T26A 3B8SA 2Z7GA 3QZAA 4W86A 4XVEA 3HV8A 2VX4A 4PULA 2WVSA 2DORA 2BZNA 1ELSA 1X98A 3HMCA 5L6UA 5IDZA 1NEYA 4UFKA 2ISVA 4DRSA 2I17A 4H01A 1LORA 3BJFA 1ECEA 1Q6LA 4L4PA 4AZ6A 4C6JA 4DN1A 4XTIA 4IISA 4JXCA 1LBMA 3T0DA 4H9UA 1Z32X 4V27A 4K1WA 2OZ3A 2ZVRA 3KW3A 3QMSA 1H5YA 1L6SA 1GEQA 1A3WA 1ZJHA 5A8MA 4HYVA 1PTGA 5BROA 3WLQA 2XIIA 3L5AA 1P6CA 1FWDC 4N6FA 4Y6GA 1R6WA 4LS1A 4O53A 4GYFA 2J7HA 5D30A 1TFVA 5A3HA 4PUUA 3Q65A 1TR1A 4DBDA 1FDYA 1PJ9A 4NI3A 2E25A 4XIAA 4A8IA 3GZ3A 3PZQA 3OLIA 3SW6A 1B3VA 8CGTA 1UH2A 1IE7C 2RH9A 2NVAA 3RR1A 1X6UA 3W88A 2QVHA 4KWSA 2VCBA 2ASHA 2HROA 1H41A 4PUNA 2VDHA 4EKJA 1SU5A 3HF3A 1W0MA 1JCMP 2J7EA 4S3FA 4O28A 4AHOA 3B8IA 2J13A 3IUHA 3COTA 3PPHA 4EX4A 1NAL1 1NIUA 1O5KA 4ZFCA 1CYGA 3GDBA 3L4TA 3KOXA 1W1B1 3WF1A 3TTYA 4J3VA 4W89A 5D09A 1N82A 3N6QA 3GBDA 4QCFA 1A0CA 3M0KA 4RPPA 4U28A 4GZJA 4PB3A 3UZJA 4JN6A 3NSNA 3UJEA 1KRAC 5E0CA 5HMFA 1U83A 3CUZA 3RRAA 1A4LA 4HBKA 3O6CA 4IIGA 5D4YA 3UXAA 1A5CA 3CNYA 5AECA 4NU7A 3NR0A 1W91A 3MDWA 1E56A 3W71A 2GJNA 4MZYA 2G3IA 4G7EB 3TYDA 3AUOA 2AMGA 1SJBA 2E7FA 1K9FA 3UU0A 3PTQA 3QQ0A 4FF7A 1M41A 3W70A 1O12A 1SZEA 4OZOA 3N6JA 3H7VA 4LF2A 2I5IA 1V02A 3W6MA 3EBVA 1JZ2A 2C14A 4AQLA 1W1IE 1KQYA 2FMOA 4A29A 3PWGA 2PP1A 1MSSA 5XIMA 2J77A 3F4VA 1AZ2A 3N19B 3CT7A 1P5BA 5BXTA 5JBDA 3EWDA 3GU2A 1EL3A 4IFRA 4UFHA 3BK0A 1KKOA 3NYDA 2HEJA 1AW1A 1JQXA 1RD5A 2QCMA 3GE7A 3O16A 4RKAA 3TMLA 5I3DA 2Z2UA 4CEUC 1YDVA 3CHFA 1CGVA 3CWHA 3U48A 1H3GA 3EAUA 3B9AA 5IFTA 2W27A 3HQOA 2QCEA 1W3LA 3SUSA 4NZ3A 5SWUA 3G22A 2WMIB 2DT1A 3AXIA 4OHQA 2VR5A 2VD9A 3TC7A 4P7OA 4S23A 2YLAA 1EYEA 2D73A 2E4TA 3VE7A 2I7GA 2GFTA 1E5NA 1ZAHA 3O63A 3NUKA 3MBFA 1Y7VA 1OD8A 5FF3A 1DIEA 3URQA 4F2TA 4JTKA 3PTKA 4AZGA 3V0TA 4CLMA 4A3HA 3PHAA 4GQ0A 3NM3A 1XLHA 3N15A 1P7TA 2V3EA 4FS9A 3WY1A 4A3QA 2PDWA 4BHYA 3JZEA 4D2JA 5A8PA 2H3BA 1LOLA 4F0RA 2QCDA 2BVDA 3OTRA 4DBSA 1XKYA 2PRLA 8A3HA 1F73A 4H83A 2Z00A 1TMQA 3FJLA 3GH5A 1NSJA 2OT1A 2YB4A 4OGZA 3D0CA 2L5HA 4B2DD 1TTQA 3IV3A 1OGSA 3ELFA 4DLFA 2JGYA 1XXXA 5HJXA 1GPFA 4JTQA 4HJFA 5EBAA 3GXNA 1MVYA 1IEIA 1UJPA 3C0SA 3RK8A 3SCRA 4TR9A 2J27A 2NWSA 3BV7A 1TKKA 3N2MA 5EPDA 1I8JA 1TMHA 1WQ5A 3CK5A 1B3XA 2CIPA 4ZR8A 2XUCA 4WHBA 1QPNA 2FGBA 2UY5A 1K7FA 1G01A 3GU1A 1C90A 3V0UA 3MA8A 2F8QA 3KCOA 2PB1A 2PDBA 4NX5A 4YIWA 1LRQA 2PA6A 2Y24A 3RO8A 3WD3A 1GOMA 1F7BA 4C6BA 3GNDA 5DF0A 3UETA 1GTEA 1V6WA 2FB3A 4JHZA 3N6HA 3LMZA 1XG4A 1WV2A 1GZ1A 3EGJA 4NAEB 1JR1A 1ITCA 1N8WA 3AMDA 1EO7A 2VRKA 4B5VA 1XBXA 1TYGA 2EEXA 5D9PA 1ALDA 4LNCA 1XQLA 4JICA 3W1QA 4ZBCA 2XGZA 5KETA 2C16A 1LDCA 4JY9A 3K8MA 4DF0A 1EX1A 3WQGA 3L2MA 3M0ZA 1KLYA 1X38A 1KM6A 1HJQA 1YEYA 1FH8A 3WLJA 2VM8A 2W0UA 4PMQA 3SCQA 1ZFJA 4H9ZA 3G1YA 3DFNA 7REQB 1VCVA 1DWFM 3QV9A 1QNSA 4BI5A 1QATA 2X0YA 1F74A 4XG1A 4FLSA 4BF9A 3IVTA 1GVIA 1XDJA 1B3OA 1H63A 1GUVA 1O95A 3OYXA 5BNKA 3JUGA 4UTWA 4MWAD 1ONWA 5CJNA 3UGRA 1TSIA 2OWCA 3TN6A 3TQPA 1WB0A 3LHWA 3ANYA 1HJSA 2OO0A 4I8DA 3NO5A 5JBEA 1VJZA 4HK5A 1HQTA 4JD4A 1VZWA 3QOKA 4UNKA 3QMTA 3M0VA 4GIEA 2XVLA 5I5RA 2W9MA 2ZWYA 4G2DA 3DX5A 4CVWA 2Q6ZA 2CYGA 4XD5A 3OGRA 3W6YA 3W73A 2RJHA 3BCDA 1AW5A 1ML1A 4ORIA 3DFHA 3DHDA 5DRIA 2ABBA 3QOMA 4EIVA 2Q01A 3T6CA 3LN3A 2QUVA 5M5DA 1FWCC 2BHZA 1YIXA 4XSLA 3L23A 3S8HA 4C6NA 5C54A 3BZJA 3NZ1A 2WHKA 4UTFA 2G0WA 3SCVA 1FDZA 1TX0A 4U3AA 2WZIA 5A8OA 2A3LA 2FDMA 2NUXA 1YDYA 3W74A 4ZOAA 5MKGA 1EUNA 3MJYA 2PDNA 2BWGA 2A1YA 3CTTA 2ZXBA 3L5MA 1R3TA 3I4EA 4GBDA 1HXJA 3W7GA 3CQKA 3VCNA 4FXSA 3FYYA 1RQEA 3H53A 2GK1B 2VUYA 4S3EA 1Q6OA 4IX0A 3CUJA 3MYPA 5CH9A 4O19A 1NFBA 1F3XA 1W9XA 4HU0A 3VIHA 3AWNA 4K7VA 1JDCA 1QWGA 2WNWA 2YDRA 4GI4A 3M9YA 2WM1A 2D0GA 3O7UA 3PUGA 2BGNE 4B4HA 3QPZA 3UW6A 1QOXA 5E93A 4KFPA 2D1ZA 4MGGA 1XIEA 4C1KA 1HP4A 2MUCA 3JR2A 1PHQA 3W81A 5I3IA 3QGVA 1OM0A 1F8IA 1HP5A 3P7YA 1YDOA 4XZNX 1AQ0A 2A7PA 4B90A 5G5IA 2G8ZA 1A5AA 4L1WA 3KVKA 5M3WA 3CB3A 1TPB1 3HGRA 3W6LA 1G4SA 3VM7A 5CPNA 2YL9A 3N9RA 1AVAA 4O0QA 1UD4A 3MUIA 2CBUA 4R85A 4AZ7A 4PTDA 1GQIA 4YHGA 3W01A 5AC8A 4WDXA 3AIQA 3ARXA 2OXNA 3CB8A 3T42A 4ACYA 3UWVA 4R9XA 3WF2A 1NH6A 3DFPA 1JL8A 4FX7A 1NDYA 2QW5A 4DZHA 4WD0A 1CXLA 3STCA 1JDFA 1OZQA 3MWCA 2FH6A 3N9KA 3KL5A 3RPMA 4NL1A 1V0KA 4JTFA 4PE8A 5I09A 2QUTA 4IZGA 3RNDA 1CTNA 3CUIA 4UQAA 3VZYA 1C9DA 5ABHA 3BO9A 1TA3B 1YNQA 3L66A 3SCNA 4EF9A 1BKHA 3OODA 3WQWA 2PDPA 4NJGA 4GGBA 4DYJA 4P61A 1OX4B 2IQ0A 2Y8UA 1D8WA 5HWJA 2RDTA 3W2KA 1YRRA 3TYZA 1JCXA 1B2YA 3EX2A 3DAQA 4TUFA 1KTNA 1LRTA 3LB0A 1FWSA 2NX9A 3PVFA 4DZAA 3TZNA 3GSMA 2VKZG 5FJPA 1E0UA 4RE2A 4TTGA 4EPDC 2A3AA 2E77A 4OUIA 2Y5EA 1JZ3A 1OZMA 1Q7ZA 3G2GA 4YJ5A 4ZGYA 3WENA 4IH3A 1QR7A 4CU8A 5FEZA 4F2BA 1SPQA 1JVNA 2DZBA 1F76A 5F7UA 4ZOBA 4TQTA 4GO9A 4RL3A 1C7TA 3OOQA 4HA0A 5C55A 3MPGA 1E1CB 3TN5A 3UD6A 3R58A 3W0KA 3KEHA 3KBMA 4E3VA 3E38A 2KZHA 2QNEA 4DJFA 4A22A 3CASA 2F2KA 4CCCA 2XVNA 5CQ1A 4Q6XA 1N7KA 1OFPA 1R30A 2FPYA 5EKYA 1TJ2A 4NJIA 1WOAA 3KDOA 3WF3A 2ADAA 4ATLA 1Q7QA 1O7AA 3N4EA 4JX5A 4TOQA 4Y9PA 1V03A 3LQGA 1ZBWA 3EOOA 4LB3A 1OFDA 1EJ7L 4LS0A 4U5IA 4ONVA 4GQBA 3W7KA 3LHUA 1MQQA 2OEKA 3GFZA 1GKQA 2ISDA 3AROA 2HSAA 4H6RA 3W2NA 3GNXA 4AMAA 4LH8A 4MSSA 2ONEA 4AWTA 5E9XA 4NZCA 3D5HA 8XIAA 4HZ6A 2GGHA 1K77A 5CGTA 2PLKA 3AIRA 4JR5A 4WR3A 1W1ZA 4A6GA 3PG9A 2WWCA 4FSAA 4KWUA 1FWAC 2GWGA 2A79A 4YYCA 3AFBA 2DW6A 1P6BA 1KRMA 1NJJA 3DFQA 4MY1A 4G9PA 1BTMA 3L4VA 4JFUA 2A2IA 1M5WA 3R7MA 4S3KA 1JGMA 1P6WA 4ADUA 2EPHA 3VUSA 5K9XA 4DUXA 1Q2SA 4D1IA 3CHVA 2VD8A 2C8NA 3VGFA 4JGDA 5HNTA 4XZWA 3VX1A 2HK1A 1U5VA 3R89A 3T08A 1B4EA 1Y8BA 4PFMA 1UPPA 1TTJA 3N2XA 1EH9A 3KTSA 3W2MA 4FX6M 3NCOA 4UTJA 3NQAA 3FVDA 3B8VA 2EGZA 4IMFA 1J01A 1E0WA 3F4CA 4EPKA 2VVSA 1LOQA 1KFBA 3INPA 2MNRA 1XCWA 4DVOA 3MP3A 3W7MA 1MXGA 3URAA 3CQIA 2WM0A 4IT1A 4MAZA 2NQ9A 1YX1A 4XB3A 3H26A 1QMLA 1XKJA 2E8ZA 3G1VA 2YZ5A 3UWZA 4I5RA 5CZTA 4MM1A 1S39A 5HATA 1RUSA 1XGEA 4NHVA 1UZHA 3HA1A 4OVXA 1RSCA 5XIAA 3S1WA 1J79A 4OFCA 1WKDA 4IXHA 1VR6A 1XIIA 2BGQA 3Q2DA 3P74A 1JGIA 1CGYA 3QF0A 1IEWA 3GC4A 3PPFA 3SJNA 2D22A 3M0JA 3HV9A 2B7NA 2C18A 2HISA 1XBYA 3TYUA 4LYKA 4ATWA 3MCOA 3W7JA 2AAAA 1SFLA 3Q37A 3PG8A 3VO0A 1Z48A 3PAJA 1GQLA 3WQVA 4Z2KA 3FV9A 2PTWA 3NDYA 5TBOA 3KL0A 2O7SA 3FA4A 3H23A 1F5ZA 4J5NA 3UJFA 3VYLA 3W7QA 3MW7A 2YFNA 1OHLA 3WLRA 1H50A 2BG5A 4WUIA 2ISFA 2VZOA 5CZJA 4IQEA 1BEUA 2R82A 3PBWA 2ZXAA 4TVDA 3FYOA 3LA4A 3RGTA 1XYMA 3TQVA 4UOJA 2QDEA 5FF7A 2MANA 4RZ5A 6ALDA 2GQ9A 3WLIA 1G4EA 3TIMA 4HZMA 2C1HA 3DBNA 1UWIA 1F3WA 3HG2A 3G1SA 2DUZA 2PDLA 3ZOAA 3LCIA 3ZMRA 3UWWA 2GPTA 3B97A 3QSTA 3TW6A 4GK8A 3SUTA 5LHFA 4XK2A 4HU8A 4QP0A 4HYWA 4K6AA 3SCPA 1XLEA 4J2MA 1XFBA 3OLDA 1E4MM 3BQ5A 5IBXC 1K6AA 1VCFA 1M9HA 1W8SA 1GQNA 1DOSA 3WDIA 1Q8JA 2Z6JA 3WD2A 1HIZA 1KV5A 4PB4A 4JDYA 1KO0A 3WNLA 3QLDA 3GTHA 1TMLA 4RNHA 5D9NA 3KS6A 3MDUA 4B15A 5H1WA 3A4WA 3S5NA 1E6RA 4HMDA 4S39A 2X2GA 2GQ8A 3AALA 2CLFA 3MI2A 4Q3MA 2ZA1A 1FCBA 1TPEA 2G50A 2FGZA 3S42A 2Y7FA 3IUDA 5AKQA 2B0MA 3PWAA 2GZXA 2YXXA 1G4TA 1M04A 4L9XA 4XD3A 4FXJA 3RILA 3HPXA 3UXIA 5LIXX 4C7DA 4DAIA 3ZO9A 5HPCA 4KWVA 2OKTA 4QE4A 4R88A 3S9YA 5LGZA 5HMDA 3TAKA 3W7DA 3RRXA 2VRJA 1GVRA 5JIWA 4L61A 1R5YA 3CUGA 3E74A 4REQA 3DFOA 1A5KC 3L4YA 5G4EA 4IGMA 5CSRA 3BOXA 5H8UA 4KQNA 1VFOA 1W5QA 4GI8A 3BJSA 4BK9A 4NZ4A 1XV8A 3SJ3A 3HJEA 2W92A 4LVAA 1H11A 4I9JA 1IQ8A 3WDQA 2VCAA 2GJRA 1OG6A 4F4RA 2HCVA 1MXDA 5L9FA 4M3PA 1OD0A 5I77A 1ONXA 4RE3A 4P7NA 4KF1A 1ZCOA 2FZ9A 3CIVA 4DHGA 3VNJA 4MJZA 4WEVX 1SVDA 3REQB 3FXGA 4IQDA 4KGLA 3RJYA 1R9YA 4YTQA 3LLFA 5DBTA 3OA3A 4W8AA 3K13A 4AEFA 4QTGA 1ITXA 3CIWA 3WBAA 1UZ1A 4LPCA 4Q4MA 2YLLA 4IFKB 3QHOA 3LGGA 4HCLA 4C90A 3ICJA 3SBFA 4JIPA 3IV8A 2YR1A 3W76A 2XIJA 1OY0A 3WH5A 4NY2A 2O92A 1YXYA 1C29A 3N73A 6XIMA 5ABGA 1VFUA 4H8VA 4A3RA 3GHTA 4UQDA 3SFKA 3VC5A 3EMQA 3KAOA 4DWSA 5A8QA 3SRDA 1B9BA 2EJAA 3GFYA 3NDOA 2V3DA 4W84A 2OEMA 1LWIA 4NAFB 3KOZA 3E3HA 5A6MA 2V5DA 1Y5XA 2FZDA 1QPQA 1EKOA 3QRHA 1V8EA 4FF5A 4I5XA 1IEVA 3FHAA 3HOJA 4BEUA 3B9DA 5F2IA 1OCBA 1FCQA 1ECQA 4CN4A 4TX6A 2UWFA 2DZAA 4MB4A 4TMCA 4HP5A 3K4WA 3N9SA 4H9XA 1RJRA 2PE4A 2CHNA 3S1GA 1UOZA 1E3ZA 1X7IA 2IPJA 1UD5A 2Y62A 2ZRYA 2FYMA 1MI3A 3OP2A 1R85A 3E2RA 1PZ0A 4BWLC 4PMUA 2HXUA 3KBNA 4UFMA 3ITXA 4Z2HA 3VMNA 2F6KA 4OWGA 1CB7B 4DBUA 5EMUA 2P1FA 3FEMA 3CEPA 2YCEA 2DIEA 3DI0A 4XX6A 2ZZ3A 1K9EA 1BYDA 4S3CA 4KGJA 4WZHA 3FW6A 3C0QA 5HINA 2WQDA 1H1ZA 3EX6A 4P5UA 2XIOA 4NX0A 3UY7A 3T81A 4W4QA 5TAOA 1X1ZA 3MV11 3CIXA 1KXHA 5CZSA 5CKSA 5F4WA 2H8ZA 2BP1A 2XHYA 3GXFA 3PBMA 4NF7A 1UKSA 3CPUA 4D6FA 2DPEA 4PBFA 4O0ZA 4Z17A 5D32A 3EWYA 3BQ6A 2Q8LA 4LGXA 5DY2A 4AFYA 1JF5A 3LY0A 1KA9F 4P2VA 4CVUA 5A8GA 3QPYA 1XLMA 1LQ0A 2GJLA 1L8PA 5LXEA 3U4AA 1GHRA 4GXPA 1YPIA 3SEPA 3K8KA