3PFMA

Crystal structure of a eal domain of ggdef domain protein from pseudomonas fluorescens pf
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
243
structure length
243
Chain Sequence
SNADHHAWHRLLDRALSEQHFQLYFQPVVAARDTHLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTSRLDLLMLEQVLRQMASHEDCLALNLSAATLADPHALNRVFEILRQHSDLGPRLTLEIGEEQLPEQAMLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRDIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELQVIREMGLYGVQGQLFGEPAPWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GGDEF domain protein
publication title Crystal structure of a EAL domain of GGDEF domain protein from Pseudomonas fluorescens Pf
rcsb
source organism Pseudomonas fluorescens
molecule tags Signaling protein
total genus 69
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pfmA00
2W27A 4Y9PA 4Y9NA 2R6OA 3N3TA 4LYKA 4J40A 4HU3A 3GG0A 5MKGA 3GFYA 4FOKA 3PJTA 4RNJA 5M1TA 3GFXA 2BASA 3PJXA 3PJUA 3KZPA 3PJWA 4KIEA 4Y8EA 4ES4A 4FOJA 4AFYA 3S83A 3GG1A 4Y9OA 4AG0A 3U2EA 3GFZA 3PFMA 4F3HA 3TLQA 4LJ3A 4RNHA 4Y9MA 4HJFA 4RNFA 5MKGB 5MF5A 4Q6JA 4F48A 4RNIA 3HV8A 3SY8A 3HV9A 4FOUA 4HU4A
chains in the Genus database with same CATH superfamily
4HOXA 4LS2A 1RBAA 4LRTA 3TYCA 3QC3A 5T9CE 1R3WA 2HCVA 2FTYA 3T42A 1U22A 3EOOA 3LM3A 4GK8A 3NQ8A 3WQWA 2GPTA 1A4LA 3HJEA 1JUBA 1UH3A 1Y7VA 1TVLA 1JQXA 3NVDA 3W23A 4PSRA 5IM51 4W7UA 3HTWA 1TA3A 3LN3A 3JR2A 1V0MA 4FK9A 1F05A 3N29A 4ENLA 2FZDA 4CCDA 4NILA 3F03K 3UF9A 2BLEA 4GXMA 1AQFA 2ZRZA 3RLVA 1XIJA 1V0NA 4GXPA 5DBUA 2ZWYA 1XSJA 2ZRVA 3DFHA 4WHBA 4AZHA 1L6GA 1NWRA 2WNWA 4FXRA 1EEXA 3AMDA 1N8FA 3T0BA 3NQCA 5PTDA 1DKWA 3QFWA 4O19A 1OT2A 4LT9A 2W6RA 3IGUA 1GUVA 5HATA 4F0KA 3B8IA 1UWQA 3BPWA 4IISA 4PODA 2PDJA 2B31A 3WY1A 3EWWA 1DL3A 3Q2DA 4LUSA 2VFHA 5BU9A 3P81A 2PA6A 2E1DA 2PSNA 2AQWA 3NYDA 3W0KA 5CC5A 3F2CA 4XSMA 3NQ7A 4NSBA 3BICA 4BF9A 4QLKA 2OGJA 4FF5A 3H6OA 4AYSA 4OT7A 3EPMA 5BWFA 3TUUA 3VKKA 4KQNA 1LL7A 4KFOA 5C2XA 2D20A 1DQUA 3GWQA 4D72A 1L2UA 5FACA 1MW2A 1VKFA 2B4GA 3GDKA 3PBUA 1T6MA 3WLRA 4LEFA 4JTSA 2ZXQA 4ZO9A 3VXGA 2X8RA 2CWXA 1RQHA 1P7TA 1O66A 4NXSA 3RR4A 3REQA 3LNPA 3CBWA 1C29A 4A8NA 4G5DA 4M6QA 3OYZA 4MIMA 2GOKA 1E4NA 2ZX6A 3ZR6A 5A3HA 1M7OA 1SVDA 5I3JA 1Z42A 1TR9A 2NWSA 3P2VA 3V1HA 3VIGA 4LBUA 1UG6A 1ZGDA 1GQKA 2ISVA 1E5NA 2PUZA 2IKIA 4DLFA 1UH4A 1DWGM 1DWHM 4N9BA 3V16A 2VOTA 1J0KA 3KCOA 1UR8A 3L67A 4M82A 2ZDRA 2XSBA 3AS0A 2QCLA 5KTLA 1Q85A 4Q4KA 4WSJA 3AWOA 1QW8A 5TD4A 3OA3A 2W27A 2PMQA 4GQ0A 4MG4A 1E72M 1RK6A 2DIKA 3W7DA 4AIEA 1QWGA 4EPEC 2V68A 4XQ6A 2E25A 4IMGA 2Z26A 3NDZA 5IBXA 5T8GA 1W91A 1WX0A 2OWCA 4JQ2A 2VDHA 3E2QA 1J0ZA 3DUGA 1M9HA 3WJYA 1E0TA 4UQDA 1DIOA 4GXWA 5HBFA 1V6VA 3W53A 3DC0A 4W86A 5LIKX 3BXWA 7TIMA 4H7CA 4PUMA 4B5UA 3EX3A 2WM0A 4JOMA 2ZUWA 1EYWA 4HMCA 1UWAA 2WZHA 1IZCA 4GNJA 3EMZA 4YL2A 4UR7A 1M03A 5XIAA 3IVUA 1W5MA 3FCPA 2OWWA 1VJZA 3SUUA 2C7FA 1WQ5A 1IZJA 1CGTA 3T08A 4E8DA 1K1DA 1LUCB 3M6YA 3VNZA 2POTA 1DTNA 2EPNA 3Q67A 3N19B 3W81A 3OW1A 5D9PA 3MI2A 3SGUA 3UG3A 2B7QA 5JH1A 5EPDA 2ICSA 3S9IA 2PF8A 4HGXA 5BOFA 3A5VA 2G4FA 3H2EA 4LBSA 4Y2WA 2WMGA 4GUIA 3PJUA 3BSMA 1XGZA 1ZU8A 2PGEA 1GWJA 1OGGA 1WPCA 2AMGA 3UNTA 1R9ZA 2EO7A 3CAKA 2PDPA 4AY1A 3E96A 1B4KA 1UQZA 4S23A 3W7QA 5J8LA 3N2XA 4L65A 2DT0A 3BCJA 2YL9A 4N4PA 2BV9A 1WKFA 4LYPA 1VRXA 4DAIA 1OFEA 1T0OA 2C71A 1NEYA 1UASA 4ZQOA 5D2WA 1FBAA 2PAJA 3FX4A 3U2OA 3WKZA 1DHPA 1WBHA 3TTEA 1PTGA 2Z7GA 3W2NA 4Q8NA 3MU7A 1BAGA 2AKZA 1T8XA 4C7GA 1XLCA 3BQ6A 4LANA 1WOBA 1MZRA 2B7NA 1A49A 1ONXA 1VCFA 4K68A 4P7NA 1JXKA 3L5AA 2TYSA 3OVQA 4NQ1A 2V5LA 1VFHA 2VX7A 1F9CA 3HMJG 4TV6A 2WO5A 3CIWA 4GI6A 4B3LA 3K8MA 4MJ2A 4P7OA 4GIYA 1TZ9A 1J0HA 3L68A 4W87A 3MZ2A 1ELSA 2ZZ7A 3VM7A 5BXTA 2I56A 3T05A 3URAA 4YVVA 2CLEA 1I0DA 4RXFA 3JW7A 1Q7MA 4FR1A 4L9YA 4PBFA 1WXZA 4N9EA 5CBIA 3VYLA 4CU7A 2IKHA 4TMBA 3QGVA 4US5A 2QUTA 2ALDA 3HQOA 4DO7A 3KOWA 5D02A 3TJLA 1H7XA 2WVTA 1C7SA 3HMCA 4L1GA 4DUVA 5CPTA 1VENA 1H7PA 5U4NA 4RV8A 5MKGB 3HIJA 3UESA 1FWFC 2XWDA 3R25A 1UPPA 4D6IA 1DJXA 4FLRA 1P5BA 2YCIX 4EKJA 1NVMA 5KINA 2CITA 2ZA1A 4D8LA 3BLPX 2PTYA 1XLGA 1EJRC 3FSTA 3WZ0E 3ZMRA 5REQB 4LAOA 4MF4A 3V0UA 3ABRA 1R0MA 2PP0A 2PU1A 3T6CA 1UR2A 3WX7A 4H9ZA 5HNNA 4DJFA 3UCCA 4QG9A 4P8XA 4ES4A 5JIPA 1GEHA 1YE4A 1CZ1A 1JPIA 1WP6A 4KEVA 1JZ8A 1AD4A 2ZADA 4MWAE 4J35A 3S9YA 2CFFA 3WFAA 3EGJA 3EEGA 3M5YA 3SUWA 2XVNA 4I6KA 3VK5A 1EP2A 1CX9A 3GVWA 3DBNA 3PJXA 1SW3A 3BANA 1UD6A 2PBGA 4IIBA 2X1UA 2P3ZA 4U10A 3QBUA 1A0EA 2YX0A 3EB2A 5C9RA 1G7UA 4B5VA 4LVDA 4G7FA 3KBNA 4F2BA 1ICQA 4H2CA 4D6EA 3EDEA 1CLVA 3ZR5A 2F84A 2A3BA 3UU0A 4O8RA 5DXYA 2ISDA 3TTQA 3FYYA 3T2OA 1TPC1 1HFBA 3FKKA 4I7VA 1M6JA 3DFOA 3SQMA 2PLCA 2BVTA 2BZNA 3RUBL 4A3QA 2B81A 1MUMA 2J8GA 1M7XA 1RZMA 1T40A 3MA8A 4BKNA 4GX8A 1YADA 2J4GA 2J47A 2XHYA 1E70M 3S5NA 1W0MA 1BYCA 4JHOA 1V79A 3C6CA 2DUAA 3EXRA 4EE9A 4POCA 4TQTA 4H9MA 5C55A 1JCLA 4UQBA 4AB4A 2F8QA 2X1TA 5LIYX 1F3XA 2BGQA 3C5QA 4FMVA 4B5WA 1PE1A 1UKOA 4JAWA 3U4FA 2ZRUA 1EQCA 4OV9A 4M0XA 3WYZA 1KB3A 4PRTA 1TB3A 1WDPA 1ZBKA 3AXIA 1JDEA 2Y5EA 1UZDA 2GJNA 1JDAA 1JCTA 5LHFA 3VGFA 2CCRA 4M29A 1UWUA 4KWWA 4KWVA 3CPUA 2YJQA 3PFRA 4Q8TA 3W9ZA 3B9EA 4AQLA 4DM2A 1H1YA 1EXPA 1V6XA 4FI4A 4WSKA 1H51A 4YWSA 4L61A 1JI2A 1UW9A 3RRAA 1JZ6A 3BL3A 4Z1AA 3NL5A 2VC6A 4QDMA 4HZMA 2J7DA 3MDWA 1AJ2A 3JUGA 4XZBA 3KHJA 5A6AA 2DUZA 2WC7A 3GC4A 3MY9A 2OXNA 4HT3A 4LBRA 4P8UA 4ERAA 4JICA 3FVDA 3MHGA 3GNDA 3ABXA 3WMSA 3T09A 2JKAA 1S3HA 4Q4SA 3IIVA 2WNQA 3G6LA 3IJ9A 4H19A 4HNUA 1LF1A 3TWAA 3N9KA 1DIEA 1L8NA 1VAHA 2EPKX 2V69A 4WIWA 2VVSA 4GY0A 1KXQA 3GM8A 1YX1A 4H2HA 4D6FA 4XSLA 4C6LA 1J5SA 4X2RA 2BS9A 4J28A 3MP3A 1GQJA 3WDIA 1XYMA 1DJGA 1GTHA 2G37A 4MKNA 3C3UA 4HPXA 4C1NA 2BVWA 4IPPA 3NL6A 4B9YA 2DT3A 3NOYA 5IDIA 5A2AA 4AHOA 2YLLA 1MMFA 1V6TA 3K30A 5I00A 1GJUA 4HHPA 4V15A 1ONRA 4CQBA 1YEYA 3F4WA 1FA2A 3BLKA 3WLIA 3QMRA 4JTCA 2VJXA 4AD2A 1E0XA 4JS3A 3IRSA 3VABA 4GISA 9CGTA 2QW5A 1JNEA 2VZTA 1BKSA 4UMAA 2FVKA 3T0TA 3WIJA 1NAL1 4QAWA 4IIHA 3OGRA 4NHVA 1RLCL 1RVGA 1QU4A 3LK6A 2Z1SA 3NQVA 4ML4A 4C6MA 4U3CA 4PFHA 3DOPA 4XZWA 3P7YA 1I9CB 3MUAA 1OQFA 4UIOA 4GA8A 4LCQA 5H6HA 1GJWA 3AYVA 3LYEA 4KERA 3WUGA 3TYUA 2EG7A 2X40A 3V36A 3AFBA 2TSYA 2QAFA 3U8GA 2YB4A 2VRJA 3V3WA 2O9TA 1MDLA 4C5ZA 1FVPA 1AW2A 4GKTA 5EMKA 2QQ6A 4CNPA 3OP2A 5I79A 1QPNA 2HZGA 4XUGA 1OF8A 4HCLA 2ISWA 4TU1A 2P3EA 1HL8A 2GK1B 5I3IA 3G0UA 3GQYA 3PBMA 1VP5A 3USBA 4B3ZA 1EJWC 1VHCA 3TK7A 4ASTA 4NJGA 1LDCA 2GGIA 4FZIA 3AXHA 4R33A 1PX8A 2YCKX 4K38A 5M03A 4IH3A 1GVOA 1UA3A 3CASA 1ZNNA 4EPKA 5FJTA 4MY1A 2VO5A 1P0KA 1TUFA 2JFEX 5A6LA 2FB2A 3FS2A 4IZGA 1F6PA 3NR0A 3CT7A 2C1IA 4ZXLA 7A3HA 1C9WA 2UY5A 3UFYA 3W84A 2VWSA 1IR2A 1I1WA 1YBQB 4QEHA 1XC6A 4QG8A 3W2JA 3A24A 3VKDA 4C6NA 5DY3A 2IQ0A 1BWVA 2E7FA 3G22A 3WUFA 1WCGA 5EBAA 5H91A 3SJ3A 2Q71A 3R1ZA 1M04A 3LGGA 4ZFCA 3BE7A 4RUBA 3WQDA 4H6QA 1CWYA 4L4OA 4GG9A 5A8NA 1FKXA 2V3GA 4LSBA 3GTNA 2VCCA 3GYEA 2OLAA 3B8WA 4PEEA 5JU6A 4B15A 3NDOA 3QVQA 4DBUA 4B92A 1XG3A 2QCGA 2PRLA 1EPVA 4MGGA 1CGWA 3QN3A 3GH7A 2GQ9A 2PLMA 3L5MA 3DFQA 1AA1B 3FA4A 3OLIA 4LAZA 4BI6A 3MTWA 2G50A 3NEVA 1SU5A 4WDUA 2EKGA 3DFYA 4DBEA 1BTMA 2PD5A 2BNJA 3GHUA 4ZQRA 3PNUA 3FKRA 1P0DA 2JBMA 1MRQA 4WGXA 1H41A 2WPGA 3M64A 4OBSA 1TTPA 4B5XA 4I8DA 3NPUA 3PZGA 4EWND 4DNMA 3TFCA 4ZB0A 4GYFA 1GNXA 1MEIA 1PJ9A 4AWUA 2YBVA 5CCZA 4S3GA 3T78A 3GBDA 3TLLA 2X0HA 1ZBWA 2BWGA 1XIDA 1REQA 4L9ZA 4UQEA 4AD5A 1LT7A 1A53A 2RGMA 5A6TC 1UB3A 5BW6A 3LHVA 5BOOA 1ZLPA 3GAYA 3ZSSA 2QT3A 3XIMA 4W4QA 5GJPA 3GU1A 4JYEA 2WHLA 2H90A 3HZ3A 1UHVA 6XIAA 2QDHA 2VEFA 1C93A 3K4DA 4H83A 2XM1A 3B0XA 3VNDA 5DX7A 2PTWA 3GNRA 4PUDA 1HKJA 1UP2A 4HYWA 2XIJA 4L4LA 1B3ZA 4LYRA 2VDIA 5HJYA 3VDHA 4E8CA 3P67A 4DXKA 2RDTA 4FLSA 4AZCA 1LCOA 3DKJA 4FS9A 1HJXA 3GS6A 4CNUA 1H63A 3IGXA 4Q8QA 3TIMA 1WXYA 3OLDA 3CH0A 4M7SA 3GFYA 1UKSA 4GQBA 1ZJBA 3G1SA 2QUNA 3KAOA 4M3PA 3BMXA 4AEFA 4URIA 3MMTA 5A6KA 1W54A 1G94A 4S3FA 4H4IA 4JZ5A 3E2RA 4JBRA 1QVBA 5IFPA 3MW7A 4FLOA 2UZ9A 3O6DA 3FY1A 4ZQPA 3GK0A 3LU2A 3OHMB 1Z44A 3H7VA 3WQ4A 3LHUA 2G8ZA 2V5CA 2Z1XA 2V3FA 1XICA 1R3SA 3W22A 5CC3A 1OYAA 4DNHA 3B8SA 5DF0A 1J4EA 1PDYA 1PHQA 3WNMA 1D8WA 4Y6GA 4OUIA 3E5BA 2CXEA 1EJUC 3ITGA 1EA9C 3C2VA 1EC7A 4GBDA 4KRUA 4U3AA 2QCHA 5AYYA 3UZYA 1LG2A 4GRSA 2A4AA 3DYMA 4IIDA 1WB0A 3RJXA 3PUGA 4LCSA 2HPIA 4AVOA 5FD0A 4KS0A 1E6PA 1G4TA 3W83A 1ISWA 3OO2A 1MDRA 5LNSA 1VR6A 1XLFA 4W8LA 3M0MA 1UD2A 1JAEA 4G2DA 4LYQA 5FAJA 2D2GA 1FWNA 2Q8LA 1O60A 3IJQA 3F5JA 3ARWA 1L8PA 4CN1A 3H2AA 3TFXA 1F3EA 1QPOA 1K7EA 3T55A 4C6FA 4NT0A 1LLZA 1VPXA 5LHEA 2IQTA 4NAFA 3PZMA 3EXSA 3AIWA 1WXJA 4HHMA 2A7NA 3H22A 1QAPA 1LOLA 4IQEA 3RLUA 1J0JA 4QISA 1JUEA 5GPRA 1VRDA 4IIFA 2PBOA 3OZMA 3ABQA 3BMWA 6REQB 1RP8A 2O4MA 2E6YA 4FNPA 1O5XA 2PB1A 1N7KA 4IQDA 3W86A 2X0YA 1I75A 4PE8A 4IJBA 4LAKA 3EPNA 1BXNA 1NFPA 4Q32A 3ATZA 3CL8A 3MMDA 1GVSA 4QLJA 3G77A 2J9XA 5EMUA 4KGLA 1VIZA 5FF0A 5DQPA 5TBOA 1QNVA 2PDCA 1EP1A 1Z89A 5F4WA 3NTYA 1A80A 1L6SA 1NM9A 4V28A 1JCYA 1EYEA 2RHGA 3FV9A 2HEJA 2IMRA 1KQYA 3EOUA 1VQTA 3HG3A 3QPEA 1NY1A 3VNKA 4J2PA 3VFLA 2V8ZA 1QT1A 3KBSA 5LA0A 1VEPA 4HPGA 3T0DA 1R86A 2D2JA 1EJTC 2Z29A 4LWWA 1KGWA 5IFTA 4FR6A 3C56A 3KTCA 3S1XA 1EHAA 1NFBA 4I9AA 1QOPA 4PMUA 3P84A 4JEJA 1FWJC 3BAIA 1XIIA 4GQGA 6ALDA 5AECA 3PUDA 5HJXA 5HMFA 1KTBA 2NX9A 1BVNP 2XIBA 3QSRA 2WSPA 3CQHA 3NJ3A 3UY8A 3AJ7A 2WB5A 3LOTA 1X6UA 3C2RA 1N8IA 3M0VA 4N9DA 3WJXA 2V82A 4A6GA 2I5GA 1CW2A 3S2LA 2WJZA 2PE4A 3EDDA 3W2MA 1U5VA 2G3JA 5C9WA 1FWIC 3WF3A 1H5VA 4K1GA 1EC8A 3MKCA 3S6TA 3Q37A 1KLYA 3KL0A 1JZ2A 3KRUA 3SO7A 3P5YA 1FHDA 3VVGA 2HNHA 4HPHA 1I2RA 1ZUAX 4R34A 4TR9A 5I3GA 4WRHA 1HF6A 3UVIA 4YHEA 5I24A 3R4IA 3KOFA 3RM8A 3RRXA 3SCQA 4LUIA 3EKLA 4C65A 1W3KA 3WBYA 1ZJIA 1OG0A 1QMLA 1UD8A 5CPNA 3P93A 3RX3A 2YB1A 1Z7AA 2DY3A 4OWGA 3THAA 4KCUA 1FWRA 2H3BA 3B0UX 3UXDA 2WAGA 3T0AA 4V27A 3UCDA 1S5NA 1ZCCA 1KBKA 3DFPA 2OCZA 3TEVA 2ZA2A 2VZVA 2ALRA 4IXHA 3TSDA 2D22A 4MY8A 1TO3A 4GI9A 3GVQA 1C92A 4Q4QA 1MWOA 3NQ6A 1ZFJA 4ZO8A 4QHRA 5DEZA 3T2QA 3NWRA 2X09A 4CQ9A 4DUXA 1XLMA 3NG3A 1A0CA 5HWJA 1QPKA 3AO0A 5D33A 2O9PA 1UR0A 2ZZ6A 4GZJA 3RR1A 3W25A 1S2CA 1JUKA 2QUMA 4DBWA 3LCXA 4UMCA 4E2OA 4HOZA 3GTXA 3AU2A 5I77A 1QHPA 1TPB1 2DH3A 1MQQA 1XD1A 5HQEA 2HRWA 3LY0A 3AIQA 1TCMA 4E2VA 4O0QA 4GGHA 4M8UA 1VS1A 3PBYA 2QR6A 1EL3A 1NOFA 2X16A 4R3UA 5HAOA 8RUCA 1XDMA 4YS1A 5KEZA 5ABEA 3ONBA 3IGHX 3AWNA 1E6XM 3UR2A 4BQ2A 1XLBA 3GG8A 2I16A 3R94A 1KBBA 3KDOA 1AFSA 1VYRA 4CGTA 2I9UA 4BJHA 3MVTA 3R2GA 2J7HA 1KRAC 3B0PA 4HZ6A 5ECUA 4HK6A 4IQLA 1CBGA 1S2VA 3UGRA 1P6WA 3VMOA 4DO4A 4DWSB 4FALA 4JYFA 4IX0A 1IYXA 2Q3OA 4Y90A 3E5PA 3OYXA 2A85A 1M68A 1JAKA 4OFCA 1KW1A 2ACUA 3UWVA 1HTIA 1GQNA 1QHOA 1D3CA 1OHLA 4LAMA 1XI3A 4XK2A 4OUEA 2PRHA 4YWIA 4MMWA 1GKPA 2BHUA 4N7QA 3AROA 1LUCA 4H6KA 3SQSA 2HE8A 1QO2A 2DSZA 3BSGA 4MADA 2ZZ5A 1AZ2A 1SO6A 1SJCA 1CTNA 4PMOA 3PK7A 3DFSA 4DJDA 1NP2A 4AWEA 3ZVIA 1KR1A 1R30A 2Z28A 4B91A 4Z1DA 4OQVA 4WR3A 2HXUA 1HJQA 3RX4A 4W89A 3NPXA 3U57A 3KRBA 2WM1A 3WLLA 4PUUA 3WENA 5CJNA 3BLIA 4KRZA 3BZGA 1JFXA 2VZSA 4HJFA 3KZSA 1XYZA 2YCLA 3ONCA 1IEVA 1HL9A 3AIBA 4LUJA 2PDQA 4QQUA 4Q8OA 2PI6A 3FSUA 4MNJA 5LSMA 4M7TA 3AHVA 1JR1A 1P6CA 2V81A 2G0WA 2XN1A 2VDGA 1UR3M 3U2CA 3EX6A 4QGCA 3TCSA 3L4VA 2ZCGA 1DPMA 1XFCA 3BG3A 4P7QA 1A5MC 2HVOA 1E6QM 2NQ9A 1TWDA 1WKDA 4QCEA 2YBUA 5E5CA 2KZHA 3B8VA 2XFRA 5AC5A 3MB9A 4PB4A 1TG7A 2YL8A 5FL1A 4HA4A 1GT8A 1RP9A 4TX8A 3SCVA 4US5D 3BQ5A 3B97A 2VWTA 4RDVA 2F61A 1UROA 3MZNA 3T7VA 4A22A 3WJZA 4UR9A 2VR5A 2Z27A 3VNYA 1PKLA 4N02A 6PTDA 1Z48A 3RM9A 1KFWA 3B4YA 2UBPC 1WDRA 1BWKA 1UPMB 1HL2A 3W1LA 5HDRA 1ZAJA 2OSYA 1JRCA 2O4QA 5K9DA 4O1FA 4HN4A 3SGZA 1NP0A 2AQOA 4I9JA 3OLGA 4J3UA 2EPMX 1XQLA 3W7HA 2HISA 1HIZA 5AC4A 4A8RA 4V2XA 4UB9A 4LC6A 4DJFD 3APYA 3UXAA 5D03A 3TDFA 5E93A 1EHNA 4KWSA 3CQKA 3PPGA 4Q7NA 3PVFA 4CUCA 1CT5A 3VGBA 3GC2A 1VHNA 2EQDA 1RHCA 1I8JA 2HTMA 3BGJA 3D47A 2OR2A 4Z1YA 3FNDA 4KH2A 3R8GA 3VAVA 1TV4A 2JALA 1O68A 3AYRA 1US3A 2WHJA 4HHLA 2PFHA 4Z2IA 5REQA 3MI3A 1VH7A 9RUBA 4GYKA 1F74A 5HPCA 1K8YA 2YLAA 3DYPA 2CW6A 4JN6A 3GIYA 1OX6A 3HOJA 3WBAA 4JX6A 3CHFA 2TPSA 4XX6A 4PBGA 3ABOA 3W07A 1XV8A 3QGKC 3DXIA 2X05A 3IVSA 3FEMA 1PAMA 3UPBA 5HWMA 2JIEA 2XH2A 4HCDA 2O55A 3R8HA 4Q8MA 1IT8A 4HNCA 5A95A 1LWIA 2EG8A 4J2MA 1D7KA 2ZKMX 3I3DA 4XVEA 3VDBA 3W7OA 2NQHA 5BXSA 2EHHA 4IHCA 4XZLX 3GLCA 5CZKA 1VEOA 4G6CA 4A2RA 1ADDA 1Z69A 2WC4A 4IP5A 3MKKA 4O8AA 1FWSA 1EP3A 1XP3A 5A2CA 2HJPA 1NSJA 1W3LA 3IJ6A 5FJPA 3IPWA 3W7CA 5AC8A 4RKAA 4YJ5A 3ZFHA 1UWRA 4RNIA 4M19A 1WKEA 4N0RA 3E0IA 2QMKA 1V6UA 3W6LA 3GC5A 3W7JA 4YTRA 3F4DA 4NU7A 1CGVA 1R9XA 5DY2A 3WBWA 2I17A 4GUJA 4PGLA 2QJJA 3OB8A 1E9IA 5GQBA 4LU0A 3U7VA 3HQNA 3WD4A 1LOSA 1SO3A 2XSAA 2YW3A 4H7VA 5G4HC 1TJ2A 1JDDA 4AZGA 2PDHA 3EWXA 2J27A 2OPJA 3M7WA 5F2LA 2ZUUA 1XCWA 3IJLA 1UA7A 1KM2A 4CKQA 3IUHA 5BMWA 3QLLA 3AUJA 3E2SA 2OMAA 2XVKA 2ZE3A 1UCWA 3SI9A 1TPH1 4Z2LA 5JIWA 1LL4A 1L6YA 4A8LA 2NQLA 1BXBA 3EKGA 4DLMA 4MFEA 2X1RA 2FMOA 1EOKA 1L0PA 4QNEA 1WZMA 3WMCA 9XIAA 3EWZA 4I8YA 4LVAA 2CERA 1SJDA 3ZLFA 3NM3A 3GX9A 1GYMA 2G3NA 3BOXA 4PTXA 3ZJ8A 3UR7A 3S2JA 5JMUA 3S6OA 5DELA 5BNKA 4O0ZA 3E3HA 3W6MA 2OOFA 3PZOA 1QR7A 4S38A 4QIUA 2Z1WA 4Q7IA 2FGZA 6ENLA 2AGTA 3S1GA 2OSWA 3TC3A 3ITTA 4ZL1A 3VGEA 1KFEA 2WMJA 4L4MA 1BKHA 3LCHA 1OX5A 1QW9A 1CI1A 3MANA 4CCZA 4R5EA 2WKGA 3L21A 3TCEA 1A50A 2WZEA 2GVLA 3DG6A 1OFOA 1XIFA 4LEQA 4ZO7A 1VFOA 1V6YA 2ODOA 4FXSA 5B7YA 5FF7A 5ECVA 2EJ1A 1W56A 4DWSC 3NFUA 4BY3A 1TJ0A 3VUPA 3DHPA 3KVJA 1O95A 4N42A 3SSJA 1LWJA 1LJYA 4QSFA 3ZJKA 4ZQCA 2DZPA 3ARTA 1J0IA 2VZOA 5FF2A 3KP0A 4RK8A 2OODA 1CXKA 4B5NA 4CU6A 4DF0A 1OWQA 1V3LA 4OVXA 4UFKA 1PDZA 2VCBA 3W76A 4AIUA 5D8ZA 3TJIA 2Y2WA 3CJPA 4RDZA 3OHIA 4GJJA 1OABA 4Y9PA 5GNZA 2OT1A 3SY1A 3Q65A 4PEKA 4M6UA 3GIQA 1RSCA 2A3HA 3IANA 3VOJA 1RJPA 1KFJA 1W9DM 1DP0A 2Y8UA 1WDDA 1R3VA 5AYIA 1WZLA 3RMJA 4UUIA 3M6DA 3CPGA 1SSDA 3TC6A 1RCOB 3EWBX 3WQEA 1CIUA 1QATA 3IK2A 3C8NA 1OEPA 2WQPA 4TVCA 1Q6DA 1GOQA 3TXVA 3KS6A 1CGYA 1Z41A 4G56A 4DPPA 3PHAA 3N2BA 3ME3A 3U5UA 1A3HA 3B06A 1J5TA 3NPVA 3M0IA 4JX4A 1QI2A 3O2LA 3BAXA 3QZAA 3SZ8A 3S83A 3S1VA 4CQAA 4NYUA 4NJHA 3SFWA 4KCTA 1X7FA 2HK0A 1VD6A 4IFOA 3COTA 1ZBCA 3UYCA 1V51A 1E0UA 2FKPA 2GK1A 3TKFA 3N25A 1PWLA 3QV8A 3FXYA 3ES7A 4PUWA 5H8UA 3M44A 1A5OC 2D0FA 2H9AB 3SCSA 1MW1A 3N04A 1OX4B 4ERIA 1TX2A 4O1EA 5AB3A 4MFDA 1JD9A 4N6EA 2ABBA 1HKMA 2MUCA 2ZZ2A 3S8HA 1AK5A 1DWFM 4C6EA 3GDBA 4XD5A 4W93A 1H09A 1UZHA 2E1WA 5D37A 1BHGA 5EBUA 2BOFX 1E0VA 3PN8A 4Y9NA 3G3DA 3ARZA 7CGTA 4HOWA 1A5AA 4GFSA 3GKAA 4YVXA 4UTTA 4HA3A 1V3KA 2V5KA 3ZO9A 4U33A 3RPTA 3HU7A 1PX4A 3W1NA 5LYRA 1RA0A 4U2YA 1W9PA 3TVAA 1W1IE 4YTTA 1XKYA 1D9EA 3SECA 3NXLA 4J9JA 3N6HA 1W2PA 3I10A 1F3WA 1MW0A 1RR2A 4UTKA 3OG2A 1VFUA 3NXFA 1DYSA 4D6GA 1SFTA 3TN5A 1B3OA 3CUXA 3H8AA 4WDWA 3FN9A 4BZYA 9XIMA 4G9PA 2OQHA 2RAGA 3K2GA 1XG4A 2C0AA 1K4HA 4IGSA 4DB7A 4FOUA 2ONEA 2HE5A 2DVXA 4UOZA 3BW4A 1B5TA 3BDKA 2DZSA 2X2YA 5HXMA 3T40A 3BOLA 1DJHA 2C0HA 2J9YA 3RK8A 4MLJA 4FF7A 5LIXX 3RYSA 1R2RA 1H2JA 2EEXA 2J79A 1EX1A 4FP1A 1XBYA 3U5YA 1WV2A 1HG3A 4WY0F 4B4FA 3SEPA 1DOSA 4UTWA 5LA2A 1AD1A 4P8VA 1IIHA 2BHYA 2VFDA 2J24A 4X0NA 4DPQA 3M0XA 3L4UA 1TIMA 2XIMA 4IJRA 3DBPA 3WNNA 4RZ5A 1LQ2A 1ALDA 1QPRA 2B0MA 3GNXA 1K4GA 4S2BA 1XW8A 2V3DA 4PCTA 3DERA 2CLKA 3VGDA 1Q6OA 4L64A 3TX9A 3IV8A 2FJUB 3VIPA 2OWXA 3TN6A 1DXEA 1TTQA 3WLHA 3N14A 3E9AA 3UR5A 1A47A 3VOHA 4AZIA 3NM1A 1GZJA 2XVGA 3W74A 1FP9A 3SW6A 1XINA 2QYGA 3VC6A 3VC5A 4YYFA 3GIPA 4TIMA 5ENLA 3I7QA 3STEA 1JULA 4D1JA 1VPQA 3EWUA 4NYYA 1RQEA 4LB4A 1JXJA 4IMAA 5KZDA 5IBXC 1PSCA 1UMYA 4P7RA 3LSCA 3GXMA 3G1YA 2Z6JA 4S3BA 4Q8VA 4OBRA 5CPMA 2DH2A 2QS8A 4F3HA 5C2CA 3V35A 1LL6A 3LI1A 2VC9A 3STCA 4QEEA 4HKPA 6TIMA 4L7ZA 4OV4A 3N4FA 3PY2A 4XD3A 3SUSA 3H7RA 1XLHA 4HU4A 3VZZA 1Z9AA 3FA3A 5E6YA 1FWDC 3M0ZA 4WLCA 1E9LA 3PF3A 4B5TA 4BCEA 4CD8A 4GQQA 4JQAA 3UJSA 1IF2A 3LSBA 1SW7A 2BOEX 3CZ8A 1E4IA 2WOQA 5CKSA 3NQ2A 4IMEA 5DT5A 3OZPA 2DSKA 1FOBA 1AW5A 1TPWA 1OFAA 3IAQA 1KBIA 1UIPA 4H00A 4ZVJA 3ARUA 5E0CA 3CLMA 3OIXA 3PP7A 5AHFA 4GNVA 3S2NA 1Q7QA 3UGVA 3L0KA 1XC4A 4U4MA 4RCXA 3NQMA 3RCNA 3FAXA 1F61A 1TPUA 4AZ6A 2VGFA 2ISFA 2VOMA 3O7UA 2DQWA 2DIJA 1YW1A 3P80A 3N18A 1YRRA 1GOKA 1K7FA 3G3MA 3HPFA 2VD8A 1GZ1A 3KOZA 3S2CA 3CS2A 1KFBA 5FJUA 2CIPA 2Z2AA 3W7LA 1Y65A 1TPVA 3PPCA 1B31A 2C91A 3GXDA 2HDJA 4PTWA 4NAEB 3W72A 2YXGA 1KFKA 5AHMA 5D38A 1XLEA 1X1OA 3RU6A 5CJMA 1RA5A 3VM5A 1Z6KA 3BMVA 3CMGA 1XIEA 1X1NA 6REQA 1CXLA 5FJIA 4K39A 3SCTA 4CD4A 4NX0A 3FJNA 5AHIA 1U1JA 5TNVA 3VDGA 1QW7A 2FYMA 1TZZA 2FZNA 3VU2A 1Q7ZA 1YTEA 1XYBA 2E77A 3M41A 3MV11 1WDQA 1OFBA 4GI8A 3RNDA 1IXPA 3PUEA 4JHMA 3MKVA 2QVHA 4O13A 3B0YA 4I9MA 1KKRA 4HK7A 3GVRA 2ZXDA 2PDXA 1XKJA 2J78A 3GVGA 3RM4A 3MV01 3ID7A 1EOMA 3GH4A 5GJNA 3HURA 4XO6A 4P61A 3IRDA 4CNNA 1ZBVA 2CLHA 4AISA 3H53A 5CGTA 4H9VA 4F0LA 1FWTA 3ZJ6A 4DO6A 1NELA 1DEDA 1N55A 3LUTA 1O7AA 3M0YA 1JGIA 5J5RA 1GYNA 3U6WA 1AL8A 2XZ7A 1HNYA 1XIMA 5F1VA 4IIGA 4GH1A 1B9BA 1VF8A 2E5DA 1JF6A 1RQBA 4QNWA 1JCXA 3G0XA 2NSOA 3NQAA 1QUMA 3AZTA 4GD0A 4EOUA 1VJIA 3VDCA 4JTUA 2PDFA 1GVYA 3APGA 3LQLA 3WF1A 1IR1A 3DC8A 4AD4A 3N2OA 5CEWA 2ZRXA 4UC5A 1E4LA 4AYGA 4IX2A 5H1WA 3Q45A 2GWNA 2QCDB 2EG6A 3GG0A 3UZJA 1EC9A 2WSRA 3E0WA 4IWWA 1OK4A 1UJQA 5EMLA 3T4CA 2DIEA 3BG9A 5FF4A 1BSLA 3WK2A 4DJFC 2DZWA 3EAUA 5F2IA 4X60A 4CNSA 3ZIZA 3VKJA 2JGQA 4DF2A 1O6IA 3KCJA 4UTFA 2WW5A 3T81A 3VNMA 1C90A 3PZNA 3FYPA 1TMQA 1HVXA 3F4NA 4JTJA 1ZCOA 3IIZA 1BWLA 1X6NA 4W88A 4E5TA 1KWKA 3MCMA 1EXBA 3CMFA 4QCFA 4GIEA 5A6MA 2HROA 1DE5A 2J25A 4EACA 3L2LA 3WNLA 3CZEA 4EF8A 3URQA 4MWAB 3AQUA 3B9DA 3ZWSA 3ZOAA 3A4JA 1UP0A 3C86A 3QGAC 2Z2UA 4JEQA 1QXLA 4E3VA 4XZNX 5CC6A 4F2TA 1OBAA 4A4AA 3AIVA 2WMHA 4IFKB 4MPKA 1MZHA 4D8ZA 3I4EA 4TTGA 3NQBA 4M6PA 1MW3A 1E1FA 2QAPA 2XIQA 2GYIA 4Z2KA 2MANA 3SADA 1EJXC 3C8FA 3TLQA 1GZGA 3EWCA 4ALDA 3A12A 2GSHA 3GR8A 4R27A 2CBJA 3CUFA 3KVMA 1O5RA 1B0IA 2IQDA 3O3RA 4ZENA 2ZUMA 2HV5A 1LRNA 2OU4A 3C0JA 4PMZA 3UWYA 3SGGA 1ITXA 5CPSA 4ZA0A 4DELA 2QXWA 4DN1A 2ZFAA 4JTEA 4EXAA 3ARPA 3VCNA 4F40A 3S4TA 1KR0A 3CQ0A 1V02A 3DDMA 3N3TA 1M7JA 3NPWA 4ZOEA 3GKFA 2QCNA 2ABAA 1KA9F 1ZB5A 1DV7A 1PHWA 3KM8A 3S6DA 3S47A 4JNZA 4Y96A 2VX6A 3SDOA 2I9EA 4DWSA 4DJDD 4I7WA 4J5NA 3VMNA 4WVXA 3ZVHB 5KZEA 1TFVA 3JZEA 3WL1A 1PZ3A 4O28A 4CNOA 3QV6A 4J7RA 2VNCA 3H70A 3GZAA 3T2PA 1YE6A 2Q3RA 2WSYA 1X1ZA 3C3NA 4GH3A 3HFTA 4HSHA 2YKKA 3A21A 3EX4A 3GAKA 3STFA 5LGXA 4JY8A 3TR9A 2VC5A 1F5ZA 1BF6A 3PZ9A 4U5IA 4QDPA 2HVMA 3BH4A 1LYXA 4FXFA 3D6NA 1SO5A 8TIMA 3UEQA 4JIIX 2OFJA 1SPQA 1AW1A 4DIAA 5HK4A 5CQ1A 4L80A 2QJNA 3CUZA 5A6BA 1LBLA 3WDJA 2DZTA 1KFCA 4H8HA 3TW9A 4O16A 2UY2A 3HB9A 3N12A 3VNJA 1QNSA 2E4TA 2FVMA 4RDYA 2REQA 4L56A 4R85A 4ZOBA 4B4HA 1KO0A 4E8GA 2BFGA 4IIEA 1K9FA 3DHUA 3SCUA 3L9CA 5A8GA 3THCA 4MB4A 2OOGA 1OD8A 1DVJA 1PS9A 3MBFA 3XISA 4CLMA 3KXQA 3C0SA 2FDMA 5LNVA 3A4AA 1N2VA 3LXBA 3ZT7A 1XRSA 2JKPA 4F4RA 4H41A 2OX1A 4WCJA 5I02A 3K4AA 4ACZB 3LM7A 3CV2A 1OVDA 1AZ1A 3UZZA 4U5KA 1SJAA 3KLLA 3LCFA 3AISA 1EO5A 2VL4A 1EIXA 3VIHA 4M51A 3SFKA 2FFCA 2WANA 2WMIB 3TW7A 4CEUC 4O57A 2DJXA 2FPYA 2IW0A 1EPXA 3LERA 4EK7A 3OEXA 3MT1A 1JG9A 4CD6A 1E1CB 1XBXA 3FXGA 5D2TA 4HNTA 3MYPA 4D1IA 1E3ZA 3EB4A 5FAGA 4PCSA 1RBLA 4GY7A 3PB0A 3G18A 2C1GA 1DHKA 1EF3A 4PTMA 3OIHA 3W7IA 1TSIA 1H1ZA 5KETA 2R91A 4MJ4A 3W28A 2P76A 3R8RA 6XIMA 1BFNA 4JHZA 4O1CA 3VX0A 1EIBA 4GABA 4R7OA 4JTHA 1W5PA 2D2HA 4L6HA 2R82A 3ES8A 2P8BA 3C2OA 3QTGA 4IGHA 1NDWA 3GDRA 4GE8A 1LBMA 1VPYA 1J0YA 1FDJA 4GQRA 5XIMA 2QJIA 2YA1A 4ZXOA 1U33A 5A6SA 2NSXA 4KBXA 1ZAIA 2QCMA 1DXIA 1UMLA 3AZSA 4JIQA 1V93A 3QSTA 5ABGA 1JJKA 2QIWA 2A3LA 2J75A 2AL1A 2E8YA 3VNIA 3P6LA 4M24A 2PWFA 3S9ZA 3QR1A 1NJJA 4AH7A 3WBEA 4ACYA 1JPDX 3GO2A 2R1PA 2PZ0A 3R0DA 3SY8A 3STPA 4HTYA 4IL0A 1TV7A 1XLAA 3G1FA 5C9XA 1G4PA 3LBOA 4GO8A 4WJEA 4NXKA 1UWSA 3M07A 3TJXA 2TAAA 2XN2A 1FH8A 2NZLA 3RIKA 1HO4A 3G1XA 1W31A 3WLTA 3KBWA 4TTUA 5EYWA 1ZJHA 4PCPA 1XYCA 2W67A 4FOKA 1V3HA 1SMDA 1ZTVA 3J7HA 1U83A 4AHPA 4QITA 4EX4A 4ML9A 2HXTA 1EWEA 2E67A 4Z17A 4REQB 1H1NA 1TWIA 1M65A 5HMEA 3SCPA 3B05A 3LLDA 2F7FA 3WF0A 4QE5A 1US2A 2W66A 2BX7A 3A4WA 2OG9A 1XF0A 3G0SA 4HB7A 2AAAA 1ZSXA 1P1XA 3BAWA 2XU2A 2XJ7A 2XH7A 3HGSA 2RKXA 3A6OA 3SN1A 3CWNA 4O10A 1MVYA 1YMYA 3QKEA 1ISZA 2UWFA 4HK5A 5DBTA 4BI5A 5D05A 3QHMA 3WDRA 2DVUA 2PDBA 1JYWA 2J6VA 1XLDA 4JQ3A 3CMJA 3DU0A 1TV2A 4IQJA 4IF2A 1EF2A 3SRKA 4D9PA 1NF7A 1W3NA 5DANA 2DZVA 1FWBC 1HGYA 3NL2A 4W84A 3TC7A 4V1YA 2WMKA 3QHOA 3GR4A 2V6AA 2J6XA 3VOFA 4EIVA 4EPDC 2Q8ZA 3A47A 3UW6A 1Q65A 1GOMA 1P0NA 3KRZA 1PX3A 1KM6A 1V0LA 3T44A 1JZ7A 5XINA 3MSGA 3P8JA 2G5WA 3AIUA 4M56A 1FWWA 4QE1A 2G96A 1KM1A 4Q4PA 3SIMA 2R1NA 2Y88A 1YXDA 3LX9A 4Q6XA 3R13A 4US6A 1TJ1A 4RL3A 1J01A 5FI8A 1ZPTA 2GUYA 4AY7A 4PC8A 2J8FA 2I7GA 2HSAA 3B8TA 1A5UA 3V5CA 3NSXA 4IPIA 3KWSA 4HMDA 2OYKA 1OJXA 3LZ5A 4R53A 5I7GA 4JDYA 4RE3A 3L2IA 4E6MA 1ZP4A 2DT2A 4O54A 1CXIA 3DFTA 4HP5A 3GNNA 3TH6A 4CQDA 1JZ3A 3NYZA 1YPIA 2WXDM 3CGTA 3W7EA 2AMXA 4ADTA 2QULA 1XM3A 2HS8A 4A35A 2X7VA 4IM4A 1YDOA 4KWOA 2XISA 4FPSA 3TE9A 5LIUX 1EJ7L 4WZHA 5T26A 1WE5A 4HPJA 1K70A 4ZSUA 1CLKA 4ZGYA 4NI3A 1QOXA 1X6LA 1VFFA 4D6JA 2X2GA 3GRIA 1IT0A 3LHWA 3A9IA 3ALGA 2FDSA 5CLTA 1VJSA 1T99A 3QJAA 4QTGA 3MCNA 1QRQA 3CHDA 4IMFA 3V18A 1NIUA 1KXHA 2FH6A 1S5VA 3E0VA 4RE2A 1IWAA 4O11A 2OO6A 3M5VA 3QXBA 2Y7FA 2Y85A 3H4XA 3W1UA 3PG9A 1KCKA 3EYPA 3OQ8A 3W2UA 4CCCA 3WMLA 4B3KA 3CAVA 3W01A 1JIBA 1G4EA 4MUZA 1I2OA 3ABZA 2OKTA 3IJDA 3CUIA 1XPGA 2TMDA 1QNOA 4I5XA 1PZ0A 1TRIA 3E12A 2G4JA 3TWBA 3SUVA 2WJDA 3KFTA 3CLWA 1SGJA 3SR7A 4PN2A 1SR0A 1DQWA 3URNA 3VKCA 2D69A 2YDQA 1ISVA 3TSBA 1OYCA 1EKOA 1WA3A 2FIQA 3GXNA 4GWEA 4UCFA 3UG8A 3CUGA 4PMNA 2ZRWA 1KGUA 2JF7A 4IUGA 3R0KA 4K8HA 1DWAM 4NZ3A 1VEMA 4ZOCA 3DGBA 1VC4A 3GBEA 3CB3A 3N2CA 4N2YA 4PFMA 3WFLA 4L6OA 4DO5A 4KIRA 1J79A 3FAWA 4ROQA 3WDQA 5DLCA 1LM1A 1TREA 1LG1A 4MAZA 1CGXA 4GNKB 4C6CA 4MZ8A 4MJMA 3CHEA 5C2GA 3UPMA 1A3XA 4HN8A 1GW1A 2CZEA 1POKA 3KW3A 3N1AA 5K9XA 1CDGA 4KFPA 2ZX8A 1GONA 3NZQA 1BPLB 2GQAA 3LMYA 4QJ1A 1W37A 1Q6QA 4B5SA 3ANVA 3S0CA 2Y61A 2F38A 1LQAA 5I06A 2J7CA 3WBXA 2V5BA 1QASA 1HW6A 3FW6A 1JQVA 5E9AA 3QRHA 4BI7A 1J6PA 3AS1A 3ITXA 4Z1CA 3QV9A 4XAZA 1HKIA 3IIPA 2C16A 2Y6ZA 1LORA 3GR7A 4GFIA 3WD2A 5CSRA 4X3ZA 3NA8A 1PTDA 4TUFA 2X41A 1SO4A 4Y8FA 1DE6A 1PKYA 4HVXA 1VBJA 4H8NA 2VEGA 3V0TA 4Q4OA 3HV8A 2H9AA 1QPQA 1OX4A 1QDSA 4FXJA 3KE0A 3W1MA 3TXZA 7XIMA 3VIJA 3U2EA 4KF1A 1XISA 3HGOA 4LC8A 2PTZA 2ANUA 3PUOA 1J6OA 1MI3A 3M1ZA 1HJUA 5F2MA 1DJYA 4HTBA 1OADA 3H2CA 2ZX5A 4HU8A 2VURA 3WF2A 2ZA3A 2YR1A 1ME7A 4FX6M 4HYRA 4QFUA 1TQXA 1WOAA 2CEQA 3WLQA 1XIHA 5FJOA 3MJYA 3IGSA 1HXJA 2NLYA 3QQWA 5M3WA 1PL9A 3HO8A 2DP3A 2XYLA 3D46A 4RPPA 1TV3A 3FOKA 3LHZA 2PU0A 5HQMA 3GTIA 2GSJA 1G01A 1VZWA 1OC6A 4M6VA 3T8LA 2VVNA 4JTIA 1TTJA 3ZT5A 3BLDA 2PC8A 2DSUA 5FSDC 2WVVB 3FEQA 5J04A 3AALA 1Q6CA 3E38A 1X8CA 5A1AA 3NSMA 3KCLA 1OYBA 5HULA 4FSAA 4J27A 2GLKA 2VX5A 2PF0A 4ZB5A 3VD4A 1V6WA 3UA3A 2QEZA 2UY3A 4PCNA 3CU2A 2OEMA 1OIFA 2G3FA 3CV6A 4LNCA 2BSLA 1VBRA 4PMYA 2I5IA 3KLKA 4IPLA 3M16A 5CAKA 1B1YA 4U28A 3W7NA 2Z7KA 2QZRA 3M0HA 3MHFA 3ZR4A 3LGDA 3QZEA 1GOXA 1CNVA 3UJFA 3KOYA 3MPGA 5B7ZA 5BRPA 3WLMA 4NNCA 1TWWA 2QDGA 2XPKA 4PUJA 1Q6EA 1YDYA 2CBVA 4GYPC 5LA1A 4WXZA 3C0QA 4XZ9A 1R7OA 2GVYA 3LRLA 5I3FA 3BW3A 1X8FA 4NZFA 4G1NA 3TQPA 4MAVA 4DBDA 3CT2A 3QQ0A 4HMEA 3PBVA 3IK4A 3IJ7A 3USZA 3LA4A 1JDCA 1WO2A 1X98A 3HM7A 3TOYA 1OG6A 4NF7A 3H54A 1LWHA 3CTLA 4K7VA 5I0DA 1SFLA 2FHBA 2OX4A 4WK9A 3SRFA 1HKKA 3N11A 1KM5A 2ADAA 3VOIA 5CG7A 4GBUA 5HINA 2XFFA 4HZ7A 4BA0A 1F76A 2Z0IA 1JZ5A 2UY4A 3FGCA 1KNWA 2IPFA 2XDFA 4P5UA 3N6QA 1R6WA 3L4XA 2OT0A 2HBVA 1ZHAA 4PMVA 3PANA 5D09A 3GXIA 3XINA 2Z24A 3BG5A 4QAIA 3WELA 4GCAA 1JZ4A 4F9DA 4NRSA 2BY2A 2I5QA 1TWZA 1LP6A 3FJ6A 2VR2A 1MUCA 2R8WA 3TR2A 4EANA 4FLQA 1UD4A 3G5EA 3SCWA 3A3XA 4I9TA 4LX4A 3PBGA 2C79A 2OEJA 1P48A 3UXKA 2Y7DA 3EWYA 3TTYA 5IRPA 3HG2A 3O07A 2BOGX 2BMBA 1GHRA 4YVPA 4WJ8A 4X63A 2NT1A 1A0DA 3SBFA 4Y7EA 2ACRA 3ZWTA 5ABFB 3HF3A 4MDOA 1YXYA 2YOCA 2WLZA 3VE9A 1TMLA 2GOUA 2XTKA 4JFTA 4PMJA 1O1HA 1BSIA 4MNMA 4FX7A 1J18A 1HT6A 3QR0A 2P0OA 2D24A 3KVLA 3CUHA 3WUEA 1GGOA 1G5AA 4DJDC 4LCRA 3L4TA 3IACA 3ZT6A 3P60A 2ZC1A 4HIBA 1ONWA 2CPUA 1JCMP 4MYXA 4LAUA 2O9OA 2JEPA 1O12A 4NIRA 3NNTA 4NAEA 2YFNA 2XFWA 4XB3A 4C60A 3QY8A 1BD0A 5G1TA 1UKQA 1L6FA 5KZ6A 3CL6A 3GU9A 1UJPA 5KITA 4CN4A 3KWXA 1W9UA 1GPWA 2ZVRA 4IICA 4UTJA 4DXXA 1OM0A 2RFGA 3P5ZA 3TYAA 3QHNA 4IGMA 2QUUA 3UVAA 4KEZA 2Z2BA 1KM0A 3BURA 3OA5A 2HK1A 3ARYA 4WY0B 2ZC8A 4PMQA 1XBVA 1BRLB 3LBCA 2FPVA 4XV0A 4NVTA 2DZAA 4RX0A 3I7SA 1MYRA 1PO9A 2WVUA 4X0VA 3M5ZA 3W29A 3BK0A 3LDVA 2E6FA 1FY6A 1EZWA 3AYSA 1AL7A 2FHCA 1KTNA 1QI4A 3MHUA 3ZLGA 4E3TA 4RNJA 2SFPA 4Y8EA 2QCCA 5C5YA 1KCZA 2GGGA 1GOIA 2ZQ0A 3ZSTA 2WBGA 4S3AA 4AIOA 4O18A 4F0MA 4QX4A 2C13A 4WKHA 2A2IA 4C6QA 3CK5A 1TR1A 3KDNA 3RITA 2CBUA 1FP8A 3BOFA 4IMDA 3ICJA 5F1UA 2Y63A 3I6RA 1Y8BA 4ZQNA 1I2PA 2WJEA 3QOMA 4QP0A 2O7QA 4GC3A 4LS0A 2VFGA 3R10A 3HA1A 3TNBA 2FZMA 1FTXA 4MZ1A 3T07A 3W3OA 4J3WA 2C8NA 4S2CA 2J7EA 3GE7A 3WQ5A 1V3JA 2HBXA 2INFA 2XIIA 1GVRA 2FVLA 1JDFA 2E09A 3KP1A 4AX6A 1M1BA 1F8IA 5D04C 3KOXA 3WD0A 2X42A 3AC0A 3UWEA 5BROA 8XIAA 1SZRA 3H55A 1L2QA 4JR5A 1RUSA 3V75A 1V7YA 4UTMA 3DN5A 2W63A 1PIGA 4W5UA 2QCDA 3R6IA 1FDYA 1E55A 4PRWA 3GW0A 3W27A 1B9ZA 2F2KA 1GVIA 2OJPA 4DWDA 2ZTJA 4O0KA 4GJIA 2Y62A 2G3IA 4MSSA 4LVFA 4J40A 1H7WA 3QEZA 2WHMA 4MB3A 2D0HA 1GVFA 3NAVA 1CXFA 3EOLA 5C7VA 1IQ8A 2DSWA 1EUNA 1XDJA 2DV0A 2Y5SA 3DG7A 4GC4A 4BEQA 3TYDA 3IWPA 1IXOA 1QWKA 1PIFA 2OSXA 2QF7A 1O1ZA 4YMZA 4A3HA 1EZ2A 4NG3A 2NWRA 3FVMA 3TQVA 2OZTA 3BLLA 3LCWA 5EKYA 1D3HA 2VENA 1FFQA 4MDPA 4QXIA 2D73A 4QR6A 2F2HA 1QNRA 3QC0A 3PTMA 4Z1BA 4MWAA 2ZVIA 3PTDA 1HUVA 1A5KC 4XAPA 3DECA 2W4XA 3TQKA 4YXGA 1IEIA 4BHYA 2TRSA 2F6UA 3ENLA 3GUWA 4IFKA 3WNKA 4PTDA 3O06A 2Y7GA 2GL5A 4G7EB 2ZXBA 4Q3MA 3TZFA 4PR4A 1M7PA 1PZ2A 4AF0B 2IKGA 1E5JA 3S5OA 1P4CA 3ORWA 5CH9A 3H2OA 1OB0A 2QLYA 7REQB 4DWSD 1F6YA 3P82A 3F4VA 3W7MA 3CEPA 3GFXA 3OU8A 1U5JA 3T1GA 4H9TA 4ZZ9A 2OYLA 4PB5A 4FNQA 1JGMA 2R24A 5DMLA 2VP8A 4NJIA 3F5LA 1EB3A 4R88A 1FWAC 1UUQA 1PZ1A 4ILSA 1C8QA 1YQ2A 1B54A 3N13A 4ADUA 4WOQA 5I5RA 2PPGA 4LV9A 3GDLA 3DGRA 3MS8A 4HHHA 1QNQA 1XXXA 3QF0A 1I4NA 5FJJA 4LJ3A 1FXQA 3GH5A 4UFHA 2Y70A 4X9SA 5A69A 3KL3A 3WQPA 1W1TA 3G1DA 3JVAA 3WF4A 1J8VA 4W7WA 5FSEC 2WJFA 1BG4A 1X96A 3ZVHA 1L9WA 3CYJA 5A6BD 5BCAA 4OZOA 1W3TA 3W1PA 3LCGA 4F2UA 1XIBA 2VFEA 3B9OA 2VC7A 2J88A 1ESWA 4D6HA 5HMSA 2J66A 2ZUVA 1OFDA 4TVUA 3TN4A 1GG0A 4FHAA 2IPGA 4ICMA 5LNWA 3S5ZA 3RGTA 1S2UA 4XTDA 3I3BA 3R0UA 1E51A 1Y5WA 2ZUNA 4AAJA 4HBKA 4RLIA 2OZ8A 5DCBA 1W32A 1GW9A 1I6NA 3EA2A 5FOOA 3FDGA 4Z0SA 3C61A 3O05A 4PZVA 1KV5A 4BR1A 3T0CA 2BVDA 5CLWA 3UWUA 3CIVA 1OGBA 4ZBCA 2AGKA 4C6BA 4ZEPA 3MSDA 1LRTA 4GLEA 3EZ4A 3G1RA 4AVNA 1RCQA 1SFJA 2QJHA 4WF7A 1H0IA 3SCOA 4R7WA 4JL1A 4NJKA 1S39A 1W1VA 2PTDA 1PXGA 1TJPA 1V7AA 5I78A 4H9YA 3W88A 3AICA 1W9XA 3VCCA 5D2XA 3MUXA 3L7RA 3OG3A 3WUBA 1F6KA 2Z1VA 5CPQA 3U3HA 5FEWA 2YZ5A 3N34A 3TONA 4DZHA 1NWSA 2C15A 1RVKA 2RDUA 5D9MA 5T91A 3MP4A 5A5WA 4ACZA 4DZIA 3UPWA 4DF1A 2INZA 1O5QA 4XUYA 3DHFA 2J77A 3I4KA 3H21A 4RZBA 1NFGA 2GGHA 1K9DA 5LNRA 5BYWA 2WMIA 4F0RA 5D2VA 2O9RA 1FDZA 1FWEC 1I2QA 4AXKA 3WEOA 1E1CA 3EEZA 3HPXA 1LZOA 3K4WA 1VCVA 2C1HA 4EAYA 1T5AA 3ANUA 4CQ8A 4C6OA 5TIMA 4Q8UA 3W6YA 5K7JA 3EA1A 2F6XA 3W75A 1XYFA 3N4AA 3F7JA 4JX5A 1VBGA 5LIWX 3WK0A 3UXLA 3SY5A 4PTNA 3BUVA 3T4WA 3MQTA 2Z4GA 5K2ZA 1J2BA 2QCEA 3TP4A 3S5SA 3IARA 1E4MM 5A2BA 3OGSA 4ROPA 5D4YA 5C71A 4E4FA 3BGAA 4J4KA 1U1HA 4XD6A 1XDLA 3RN6A 2CBIA 2R1KA 2YBTA 3K1DA 1JL8A 4KFNA 3VILA 2YPIA 4UFMA 3TA6A 3DKLA 4UFLA 3ABSA 2NXHA 1OIMA 4UWMA 1UZ1A 4FAMA 1Q4NX 3WK3A 3PZUA 3P62A 3BJFA 4H1ZA 3WLKX 4HNNA 5A6JA 1JEZA 1B30A 2BHZA 3UA4A 1B3VA 2A3CA 3THUA 2OELA 1F73A 4F79A 2OGYA 1V03A 4U31A 1PTAA 5KZMA 2EJAA 5C54A 3U4AA 2CHOA 3E74A 2XGZA 3WQOA 1U30A 5JH2A 3SRDA 2F6KA 5M1TA 1K03A 2PCEA 4JGDA 3AMCA 5BXRA 3U0HA 4M1RA 5DXXA 3AIEA 2PDMA 3OPSA 3ZQ9A 1KRBC 5FEXA 3LEPA 2GDQA 5DCDA 1GJPA 2CLMA 3NO3A 2PWHA 1VFTA 4IXXA 1Q2SA 4REQA 4LXFA 1GKRA 3QV7A 1YLVA 2WNNA 2P1FA 1HN1A 4GYPA 1OY0A 4UQAA 2YFOA 4UTTC 4PCFA 3MVIA 5H8PA 1W6TA 3GYCA 2ATSA 3G24A 3DI1A 2QF8A 3EMQA 2BASA 1TPEA 4AW7A 3GG1A 4Y9OA 1JYVA 1FH7A 1X39A 1ISYA 2ZUSA 1W1PA 5GNYA 2QGHA 5SWUA 1MQRA 3CUJA 3PM6A 4J3SA 2A6NA 2A0NA 1PBGA 5G2WA 4PYSA 1R3RA 2PWUA 3VD3A 1AH3A 3WLOA 3WJSA 4XAGA 1YKWA 1RAKA 1OCQA 3NZPA 3FFSA 4ECLA 1TV5A 1YDVA 3QMSA 1EGVA 4IG2B 2VT0A 3WQ8A 3P8IA 2A79A 4XO7A 4NNAA 3VKBA 3OBEA 1RCXB 2D2OA 3PSWA 1FCUA 1K6WA 3MI6A 1ODUA 2YCLB 2GWGA 2YCJA 2YSWA 1SFSA 5HNUA 1C8YA 1PYFA 2INEA 1GVQA 3WD1A 1V0KA 5MHBA 3CWHA 4UTWC 2QDEA 5HANA 4NNBA 2L5HA 2FZ8A 3ZXWA 1ME8A 3PNZA 4H01A 3C2FA 3HPAA 4GVIA 3PZIA 3V5FA 2DZXA 1KM3A 1LROA 2BG5A 4HJWA 2H8ZA 3W87A 1C7TA 2DW7A 1IEXA 3RG6A 3M9YA 3W7PA 1DWIM 1UZ4A 2PDKA 4K8GA 3LBMA 2DPEA 3KX6A 5I23A 4A8IA 4K1WA 4HNVA 4D71A 3H2MA 1DJWA 1XCFA 2A3AA 1UR1A 1S5MA 3IUIA 2YXOA 4OGZA 3GVVA 2WV8A 2CZ5A 2DSVA 4MM1A 1SZEA 3A4XA 2WZMA 3NQDA 5BWAA 4UTUA 4RXGA 1Q2RA 2FFIA 4AY8A 2WZIA 1RY8A 1ZL1A 1E40A 1AQ0A 1OFQA 4QJ5B 3ERPA 3B8UA 4HYVA 1AQMA 2BXYA 2C6QA 1O5KA 7ENLA 2DW6A 4OHQA 1H4PA 3LCIA 1J9YA 4GYJA 4BQ3A 4NZ4A 2AKMA 4J1OA 1H62A 1TCDA 5CPLA 1MFVA 2ZIDA 1KBLA 1CYGA 4DXVA 3WDHA 1EFZA 2ZICA 3AS2A 1GTEA 1EWDA 4L4PA 1OCNA 3CHCA 3RFAA 3B0VC 2NT0A 5IXEA 3L5LA 5AHEA 5IHRA 5J5DA 5GNXA 1M41A 1FH9A 2H8XA 3W71A 3B04A 2VHLA 3NURA 2JE8A 2PDUA 4HNLA 5TF0A 4DVOA 1CB2A 1Y5VA 4OU1A 3NO1A 3UXIA 1ML1A 4C6IA 3RF9A 1KRCC 5DN1A 1OFRA 4JDBA 4S3JA 3E02A 3M7SA 4DBSA 2A21A 1FWCC 3UBPC 4GGBA 5AC7A 1DIDA 1H7OA 4D2JA 2HS6A 2DVTA 2Y24A 1R47A 1WZAA 1NWTA 1TYGA 4MNKA 3HQPA 3OVGA 3R79A 2QVNA 3EDJA 3A3HA 3IV3A 1AJ0A 2VFIA 1QI3A 4GUFA 1MQPA 3NGFA 3KVKA 3UJEA 1SZNA 2BP1A 3NZRA 1NDZA 3EPOA 3NL3A 4JQ1A 1EH9A 5A8OA 3PZVA 4ONVA 2O92A 3W24A 1ZALA 3CXOA 4DHGA 1YPFA 4DJEA 3VO0A 3R12A 5GVJA 2WSKA 3H4WA 3MWAA 3UERA 1ZQ5A 2AOSA 3VPLA 2BXZA 4WKFA 1UH2A 2PWEA 3ELFA 1W3HA 1F8MA 3UG5A 5MKGA 1F3TA 3LS9A 1WDWA 4ZQMA 4AD1A 1DJQA 3T9PA 2WC3A 5HR6A 1QI0A 1PIIA 2UV8G 4NZ1A 3CEUA 5DMYA 4TOQA 2R9RA 1BLIA 4UFJA 4K7YA 1GEQA 5DO8A 1B4EA 2A7RA 4JIRA 2Z1BA 4JTRA 3FK4A 4LPCA 5AZ1A 2EPOA 2QGYA 4E0CA 4MB5A 3RLGA 4CD7A 4TX9A 3QY6A 5DT7A 3INPA 1E43A 1AH4A 3EX2A 3Q58A 3DEQA 3OVRA 1MXGA 4LV4A 4A21A 1M53A 3HG5A 1C8VA 3N15A 1IXNA 4QDWA 2W5FA 3AYTA 4JTDA 1A5SA 3CZJA 2QPXA 4B90A 4TMCA 3LB0A 3TYZA 3EMCA 3I6EA 5I3KA 3ZJ7A 4O14A 3G8EA 1W2VA 3W82A 4PMDA 2POZA 1EGMA 5ABHA 1W9VA 4L1XA 2VX4A 5KSWA 3ITVA 2E6AA 4RW5A 3O9NA 2AL2B 1XSKA 1KD0A 3WH9A 4JKLA 1I60A 5JBFA 2Q6ZA 1RJQA 2QCFA 2V63A 3HBLA 4WUIA 3ZM8A 2A1YA 4RZ4A 2ON3A 1VLWA 5I3HA 2PGRA 4QJ3B 4QE4A 1DJNA 3QW4B 1R3TA 4MKVA 3QPYA 1G0CA 5C0QA 2WVVA 4MVAA 2YYUA 5FESA 2J7FA 3AHZA 1UD5A 3P0WA 3OOQA 1MFUA 1PKNA 4QQ3A 8CGTA 5F4XA 4C1KA 1IXQA 3R5EA 4ATLA 3II1A 3ITOA 2D3NA 5C7HA 4XWUA 3ALFA 5H8MA 4JY9A 3NVTA 4Q8PA 4GI4A 2PD9A 4INFA 1W8SA 1W9BM 3E1F1 3WQGA 3PTKA 6CGTA 1LRQA 3ATYA 2FLIA 1FHUA 1W1ZA 4GZEA 1ZY9A 5AFDA 1JCJA 3W26A 1UKPA 3BAKA 2NVDA 1HP5A 1H7NA 1XS2A 1KC7A 3GFZA 2BBFA 4ZOAA 4UNIA 2GVGA 2Q8XA 4YHGA 1A5LC 2IXVA 3Q4DA 1W1A1 3G1VA 5D30A 1RALA 4XG1A 1CEOA 4G8TA 1XCXA 4J3TA 1R85A 4A29A 2VUYA 3GDTA 4FEZA 2J74A 1BG9A 7ODCA 3TMQA 4ICCX 3AMGA 3MUIA 3HQ1A 2OQYA 2V30A 3TQ0A 1F2JA 1WBJA 4N6FA 5I07A 2XH4A 1QFEA 2WSQA 3M0JA 5CC7A 1RJRA 2GJXB 1RY0A 1G7VA 4WJXA 2ZXAA 1KTCA 1WNOA 4PSPA 1Q4WA 1R7AA 3O6AA 1PWMA 3WDPP 3OBAA 1FHLA 4KMQA 1FCBA 1GPFA 2HNEA 1E56A 1MO0A 2BXVA 3BLEA 3H24A 2O56A 4ZFMA 1UUOA 3SURA 1TPDA 2QV5A 3AOFA 3M4HA 1RXOB 1UYQA 2QPSA 3VOCA 1EDTA 1TRDA 1S1PA 3BVJA 2O7SA 1C91A 2OZ3A 2P10A 4EAMA 1XIGA 2IS7A 1XH2A 3IAPA 1HJSA 1VBHA 3PG8A 4WDTA 3I68A 3O0KA 2YZRA 3TW6A 2J9ZA 1RPKA 1LLOA 3MDUA 3PC0A 3PWIA 4LY8A 3L0NA 3DAQA 2XINA 1R87A 5AN7A 4F66A 1XWYA 4L1WA 1SUXA 1Q6FA 2OZ0A 2PDLA 2BVYA 1AJZA 4I5RA 4C6DA 4ERGA 4PB3A 3O8AA 3NQEA 1YNYA 5ABFA 1YPXA 3WLJA 4YPJA 1E6SM 2NV9A 1TE6A 4JL2A 4YU1A 5G5IA 1ECQA 3ARSA 4LFYA 4BK9A 1TE1A 1VGAA 2FGLA 4S3DA 2ZRYA 4QBXA 1E15A 5T9BG 4GACA 2ZX9A 1QOQA 2V2HA 4UTLA 2NQZA 4O50A 4UOJA 3PWGA 1V77A 2V67A 2P53A 3QQ1A 3LXCA 4BF7A 2G41A 1H60A 1MNSA 4AC7C 3NDYA 4X9YA 1J11A 1K7XA 3WNOA 4K3ZA 1YYAA 1VYSX 2NW0A 4AZ7A 2VCAA 4OKDA 2FH8A 1VB9A 5CZ0A 4KPLA 4WGHA 4YLWA 5D8WA 4AWSA 3W38A 1ZRQA 4CQCA 4GY1A 4LNYA 2CC0A 4LVBA 1RD6A 3CNYA 2ZTKA 5BRBA 4IOTA 3GZ3A 4YNGA 4LH8A 3G1HA 2A3EA 4C5YA 2CLLA 3MMUA 3B40A 3AS3A 3BZJA 3DH7A 3OZOA 2NUYA 2PDYA 4UQ9A 4Z0JA 4NASA 1KKOA 2Z00A 2W62A 1I2NA 2QIIA 1WAWA 1TTIA 1NH6A 4WY0A 4XBSA 4YCPA 4P8WA 1BRLA 4JCMA 1OF6A 3L12A 2XVLA 2P5NA 3O1NA 1WDSA 4N9CA 1IWBA 2CWNA 4JFUA 1Q45A 3STGA 1CPUA 3WNPA 1W17A 1ZS2A 2NX1A 4QSHA 1M01A 2WPBA 4NRRA 3LTPA 5F7UA 1UIOA 3OVPA 4OTKA 2GZXA 2YL5A 2RJGA 3KHDA 3VX1A 4D8AA 1UBPC 2ZWZA 2VEMA 2R94A 3E0LA 4NZ5A 1YBQA 4C6PA 4W5ZA 1S2AA 4M80A 4IPNB 1CCWB 4K37A 1U1UA 3IS4A 1AVAA 1JD7A 5F2GA 1AODA 2BTMA 4GKLA 3W1RA 4A05A 1ADSA 1Q5MA 3EBVA 1XRVA 1JVNA 3G2GA 1FWHC 5TQLA 2V2CA 5L6UA 4YYCA 2GUBA 1K8XA 1QBAA 1GCYA 2EBNA 2WWCA 3LV6A 4IL2A 3SUTA 4A3UA 2NUWA 2WWDA 3UWQA 3VZYA 1ENUA 3LXAA 3N17A 4EWJA 1G4SA 5CZSA 2BY3A 3MBDA 1B3XA 3UD6A 5A8QA 4RW3A 2V9DA 2FQIA 4F48A 1I45A 4FNSA 5LXEA 1EDGA 4JIHA 2Z6IA 1US0A 3L23A 3LQGA 4MWAD 2ATMA 1DJIA 3WO8A 1H0GA 3I65A 3N9RA 3JRKA 4H3DA 3PPFA 4I5UA 2PTXA 3A64A 3NUKA 1XUUA 2WLYA 3WEMA 4ICNA 2WYSA 4PL1A 2PDNA 4A3RA 1H49A 2P88A 5EL1A 4PMXA 3NQGA 3WLSA 4EF9A 3UETA 2ESCA 3O6CA 1XH0A 1Q63A 1CLXA 4OIFA 2AQVA 3KS5A 4DYKA 4JTTA 3PAJA 3T8QA 4QRNA 3TV8A 1VCGA 5F4SA 3MJMA 4UZSA 1BQCA 3ISIX 3D0CA 3L2MA 2PODA 2YXXA 3RJYA 1KRMA 4HCHA 2GQ8A 3W7KA 2FHFA 1XBZA 1U2YA 1DWJM 3CWOX 4PL2A 1G69A 2E3ZA 3FA5A 2JIWA 1P0BA 2GQ3A 2X0SA 3O15A 4G7EA 4BEUA 3B9AA 4ZTXA 1BYAA 2ZYFA 2XUCA 3V1PA 2VQUA 2GDUA 4AF0A 1EO7A 1E3XA 4B9ZA 3G6MA 4ORMA 3CAWA 5AOUA 3S1WA 5E09A 7REQA 5AY7A 1S5WA 3U2ZA 4DUWA 2B7OA 1G9HA 1ME9A 3K1GA 1QK0A 4JNMA 4OJYA 2ZBTA 1TVPA 2BDQA 8XIMA 3K46A 3WN6A 3OTRA 2PZNA 3GW3A 1JNDA 3B9NA 1WZKA 2YDSA 3URBA 4BF5A 2IPJA 1GOWA 2ISSA 4WX2A 5CGQA 4WKAA 3PWAA 5E0FA 1Y0EA 3N2TA 4O1BA 1XLKA 2A6LA 3GNOA 4G1KA 4MNLA 2VGBA 5AC6A 5CJ5A 5CG0A 5HA7A 1ICSA 4PTVA 4MOZA 4KRTA 2ACQA 5G2IA 2PS2A 1T7LA 1BEUA 4CD5A 1XGEA 3RDKA 4CN6A 4UNKA 2Q01A 1Q8AA 2DZUA 1IEQA 4JKKA 2VMFA 5E0KA 1VBUA 3LLXA 5FEZA 1UP3A 1QBBA 3K8KA 1TZ7A 1NDYA 3KTSA 3SN4A 2YCEA 4YTUA 4LUTB 1R2TA 3THDA 3C2YA 2IUZA 3KTXA 3VA8A 5I09A 3BAJA 2W61A 3N4EA 1C8XA 1OZMA 4HU0A 4OE7A 4K36A 3TNOA 4AZBA 1XLLA 1HKVA 1J12A 1SSGA 1TPFA 1R38A 2X1IA 1Z32X 3CIXA 4Z08A 3RHGA 3Q94A 1TJRA 1KCXA 3TYBA 2VGIA 4HSNA 3EDKA 3KBVA 3VD5A 3ZZ1A 5B80A 2Y0FA 4MB1A 1A4MA 2VEKA 2CLFA 4IP4A 2VXNA 2WMFA 3MUCA 3HFYA 3EXTA 2PGFA 4C6JA 3QR3A 4KIEA 4AX7A 3KEHA 4FIQA 4D6DA 4HZ8A 3V0SA 1XFBA 2FPTA 2VQTA 2OLHA 1SYTA 1OINA 5CSYA 3GB6A 5ABTA 5JBEA 2OTDA 5EMJA 5CBBA 2E6DA 2QMJA 4DZAA 3W37A 4BS0A 3TN3A 4M1BA 2IPWA 4TX6A 1XD0A 3W85A 3BC9A 3DX5A 3PAOA 2PP1A 4JXCA 4AEEA 3ITYA 1V3IA 4ORIA 1YHTA 3N73A 3G1AA 1ZZMA 3H4GA 4Q8WA 4QS6A 2XGIA 3F1QA 2GJRA 5AHLA 4WEVX 4PUNA 1K9TA 3POCA 1WUFA 7TAAA 2NQJA 1B3YA 3GDMA 5EMMA 1ISXA 4WXYA 5IHSA 2GGEA 4PH6A 4C90A 4MPQA 2FMNA 4FNTA 2YDAA 4EXQA 2QV4A 3NIYA 1EGZA 2NVCA 5I2UA 1M5WA 2Y8VA 4CNTA 2GJLA 4Q4RA 2C18A 1E9ZB 2ZDSA 3LCLA 4HSOA 3H2NA 2PDGA 4RE4A 2W92A 3AXXA 5D32A 4ZO6A 3IUDA 1OD0A 4H6EA 2AAMA 3WFZA 5A8MA 5BOEA 4I3GA 2W3ZA 3VDAA 3B8DA 5C70A 3LRMA 4GX9A 1V08A 1VFSA 2RH9A 4OBTA 3GG7A 3GXTA 1EBHA 3KL5A 5AZ0A 4W7VA 4M5PA 4Y9AA 2JQXA 5G4WA 1D3GA 2P50A 5DMNA 1GORA 5BMXA 1OT1A 2EPLX 3MP5A 1NF0A 2ZUTA 5I6SA 3ECQA 3S42A 3LGEA 3VMPA 3IJIA 2CLOA 4JFWA 2LLEA 4WD0A 3CV1A 4NZCA 3D3AA 3VIIA 4JTQA 1UR9A 3NZ1A 1P6BA 1S2TA 1YIXA 5U7SA 5I3DA 2ZZ4A 1FRBA 3BTNA 2PWDA 2E5CA 1K3UA 4XKYB 4H8UA 3GHSA 5FKYA 5D9OA 1P43A 2YL6A 2GDVA 3NSNA 4GVGA 1YNQA 1YTDA 1PB0A 2NQ5A 4UZUA 4NKCA 2E28A 2CESA 4GVFA 3A22A 4TO8A 4O12A 4LY4A 1H5YA 1ADOA 4UQCA 1SW0A 1NQKA 4ZR8A 1ZJAA 3KUMA 2P0IA 5C9UA 1AUSL 1G6CA 3MUZ1 5FIPA 1KV8A 2Y7EA 1RD5A 3LPPA 3OGVA 4KESA 4JPGA 2XWEA 1OC7A 2WK2A 3VINA 1RPXA 3OJGA 1NOUA 3MO7A 2EGZA 3AXMA 4B2DA 1LLWA 3KRSA 3GHTA 1W1B1 3GHRA 4IUOA 4J3ZA 3RILA 3WJWA 4MYAA 1BVWA 2R6OA 4O4VA 4UXDA 3FDKA 4EPBC 5RUBA 4UCGA 1TELA 3EOEA 3QW3A 2RJHA 4Q22A 5H2ZA 2ZZ3A 5CBJA 5HWNA 2X1SA 1UD3A 3CPRA 3QFEA 2CKRA 3M5XA 1W1YA 4AVFA 3RCMA 3RPMA 1BGAA 2VI0A 3WD3A 1G67A 5LZLA 2WBKA 1EDQA 3KBMA 4IG2A 3H26A 3I7RA 1KXTA 3N9SA 2REQB 1Q6RA 2C19A 2JKEA 3UNDA 5HMDA 4MTVA 3OZYA 3PB2A 3V7PA 3VGHA 3UZWA 2E5BA 3DESA 3WEZA 3QY7A 1FKWA 3RO8A 4LW7A 4RE0A 2DUXA 2X7WA 1XJBA 4EXBA 5BU6A 1UWTA 2DDXA 3ARQA 1FFRA 2Z25A 3DG3A 1XYAA 1NDVA 4AFYA 2EAWA 4H9XA 2I1OA 2NX3A 1BTCA 5E70A 3R89A 3U48A 4N4QA 3UWWA 4K6AA 5HR7A 1M3UA 3P0XA 4KEUA 1FCVA 1IWPA 3FHAA 2VTFA 2CYGA 4FB7A 3QKZA 2DU2A 2GSEA 1DBTA 1Q6LA 1X97A 2D0GA 4XIAA 4P7LA 4DRSA 4XZMX 1OK6A 4DUOA 3DZ1A 3APTA 3CO8A 3MUY1 4RZ6A 4GUHA 5FJRA 3ITCA 3A9BA 4QJ4B 5GJMA 2QHAA 1ECEA 2ZZ1A 1TX0A 3MCOA 3E49A 3W7GA 4W85A 4DI8A 2DGAA 1FXPA 2PWGA 1TA3B 4MZYA 4GVHA 2XH0A 1EA0A 5JBDA 3E0FA 1XGDA 1ODZA 3POHA 1SR9A 1QJWA 3DFNA 1Z3NA 5AVHA 1GG1A 2XN0A 3LZ3A 3NZGA 4ZSTA 1EJSC 3AI0A 3L66A 3V5OA 3GU2A 3PBWA 3WH8A 2HPMA 1E0WA 2H3DA 3FJ4A 4NI8A 1XPYA 4Z2GA 5KMYA 1DXFA 1IEWA 3EDFA 3RU8X 1R9YA 1JPMA 5K4XA 3W73A 1IIGA 1Q13A 2A7PA 2VZUA 1E6RA 1GYLA 3R7MA 3M43A 3LHTA 3NO5A 1BF2A 2WHKA 6A3HA 2EF9A 1XX1A 3UR8A 4KT2A 1B90A 4BWLC 3W4RA 4DI9A 2BGSA 4LUSB 5CPOA 1QO5A 1RV8A 1NWUA 5LKYA 2ZOXA 3RLHA 1NARA 2YDRA 1K02A 4X22A 1ZAHA 4E2BA 5HQLA 4ADSA 2DZBA 4DJED 1PCWA 4XBJA 2OLSA 1BQGA 4O52A 4RDWA 4DX3A 3JU2A 5C8BB 3LPFA 2R1LA 3ARRA 4QM1A 5G1YA 3SRHA 1L6WA 4O4WA 1XLIA 3SCRA 3HPZA 1F7BA 3HPSA 5LNUA 3BLFA 3QLDA 2CXGA 4PUKA 1V4YA 1R3YA 1S3TC 1P7TB 5AVNA 4JTFA 1LT8A 3EKZA 3UY7A 3REQB 1V5XA 2V2DA 3QTPA 2WZTA 4EVZA 3WG6A 3DHDA 4HD5A 3NEHA 4C7DA 4ZE4A 4ATDA 4LF1A 2V3EA 1MUWA 4I7UA 2KX9A 3SM0A 4JD4A 4I90A 4E38A 2XG9A 4LGXA 3MSYA 2FJKA 2FZ9A 2CHNA 1UUMA 2E9BA 1PPIA 4KETA 2Y89A 1UOKA 4Z2HA 4BQ4A 4Q7BA 1E9YB 4M81A 5FL0A 3VGGA 2MNRA 4E2DA 1DTUA 4DY1A 3GSMA 4NL1A 5DMMA 1EBGA 3AHYA 4R9XA 2V38A 4ZTYA 1W3IA 3P3BA 4Q6JA 1R3QA 3TSMA 1XLJA 4IPJA 2YIHA 3ITLA 1K6AA 1KXVA 5FCZA 1PYMA 5BRQA 2VGGA 1J10A 3WH7A 4A3YA 1WKYA 5FF3A 3DCPA 3A23A 3CV7A 1UKTA 1AG1O 2P8CA 3V4BA 3MMWA 5A94A 1GQIA 1DQXA 2OVLA 5M17A 4OECA 3IEBA 4FNRA 4NUWA 4JFSA 3SIZA 2XSXA 4FX8A 1Y5XA 3TJ4A 5CSUA 4H6RA 4AG0A 3BV4A 2CZVA 1ICPA 3LPOA 4JTGA 2WKLA 2CU0A 3DIPA 5IDZA 4JTAA 3W7RA 1FWGC 2PCQA 2QUVA 4DM1A 1YNPA 3LD5A 2VUNA 1T8QA 1IZKA 4RNHA 3H7UA 2AL2A 4LALA 1HJWA 5HNTA 3VOGA 1A5CA 4IMCA 4AC1X 4FA3A 4O15A 3HGJA 1Z8AA 4JCLA 1LOQA 5E1QA 4MJZA 1XH1A 1BXCA 4YIWA 1KFLA 4V33A 1UBSA 2WCAA 5HOSA 4XISA 4ATWA 3AMLA 2VR4A 3L4ZA 3LPGA 4H8VA 4W8BA 1IGWA 1C9DA 3S46A 2RUSA 3W1TA 1NTHA 1CXEA 1OC5A 2JF6A 3D5HA 4UR8A 4RNFA 3R43A 4LS1A 3LLFA 2D23A 2DQXA 5FEPA 1SMAA 4I6VA 2W79A 3PJTA 1H7RA 2B7PA 3PZTA 2OKOA 3ZYZA 1Q8JA 3ANYA 4NJJA 4LUYA 4HPNA 1HJVA 2Y4SA 3TAKA 3CM4A 2W9MA 3NCOA 3VCRA 1HO1A 5CZTA 1XRTA 1TKKA 4AD0A 1NQ6A 1PEZA 1W5QA 4NP7A 2Z1KA 3O16A 1HGWA 1BYBA 4S1FA 2JGYA 4ZB2A 4MWAC 1E1EA 1BGGA 3O0FA 3CC1A 3H2FA 3EX1A 3S5YA 3BJSA 4KWUA 4X61A 1T41A 1J2WA 2PRMA 4AIBA 2VRQA 2NXIA 1GK8A 1WUEA 4Q33A 5A8PA 3L4WA 4CVUA 1YDNA 4WDXA 1THFD 3WSUA 1WYIA 2VYOA 3PPHA 2HQAA 4MHBA 4IFRA 2GJXA 5CSSA 1E6ZA 3GTHA 5DRIA 3P14A 3EA3A 1W8GA 3H12A 4A2SA 3BW2A 5IOBA 3P61A 1CXHA 3EB3A 1FUYA 4J3XA 1E71M 1MRAA 3AJXA 4UNLA 3VKAA 4LRSA 1AH0A 2PURA 2QNEA 1H11A 2CETA 1V3MA 2CLPA 2GUUA 3AIRA 3FLUA 3UQNA 5I03A 5L9FA 3UJRA 4XZHA 1EJVC 3G8RA 3FHQA 3VIMA 4HMNA 3VIOA 2BY0A 2OQLA 1K8ZA 1ITCA 4Y9MA 4ZE5A 3MWCA 4WOZA 1MXSA 3RCYA 4DQWA 1B2YA 3SAZA 1YTKA 3VE7A 4AEOA 3W2KA 4JIEA 4RR4A 1EX5A 3DENA 3M46A 1S1RA 4DAFA 4DYJA 3GD6A 3LG3A 3TZNA 2XM2A 1MXDA 2E9LA 3L65A 3QYQA 1WAUA 4JN7A 3DI0A 4Q4MA 3YPIA 3K8LA 2VD9A 1BYDA 4S3KA 3F2DA 1AQHA 2IXUA 4PRRA 5BZAA 3U9IA 2XGBA 4IP7A 1IE7C 3B3DA 1XSIA 3KBJA 4F0HA 3GXPA 1X7IA 5EB8A 3HN3A 3NOEA 5EU9A 2I14A 4HU3A 1GOOA 2EXOA 4F9JA 2Q02A 1UC5A 1I0BA 3SB0A 2WKJA 4RJEA 2E68A 3QPZA 1BVZA 1W5OA 2V5JA 3PULA 4LB3A 2KAUC 3PZQA 2Y8KA 6TAAA 1IHIA 4S39A 3VTRA 4C7FA 4FO4A 4CVWA 3BCDA 1VFMA 1KM4A 5EFFA 4XZIA 3UP8A 5HPOA 2BGNE 3PJWA 1IGSA 1XRFA 1FCQA 1GQLA 3VFCA 1H3GA 4XBKA 3JZUA 3S3GA 1V02E 4CEXC 1DJZA 1QCWA 5CGMA 4KCWA 3O6YX 3F5KA 2CLIA 3IIOA 4XKMA 5HJLA 3TMLA 3WH5A 1JF5A 3N6JA 3TROA 2EPHA 3EOSA 1D8CA 1HP4A 4OOUA 1H61A 2QPUA 4C91A 4Z42C 4MLRA 4V1XA 2Y1HA 4H9UA 1PKMA 4QROA 4K2SA 1YXCA 3JS3A 1GKQA 3R11A 2DT1A 2CZFA 1LQ0A 2NVAA 1RK5A 3R58A 3EWDA 2ZX7A 3WQ6A 1S5TA 4KEMA 5CAHA 5EMYA 2CHRA 1Q66A 3CB8A 2A5HA 5DRCA 4O17A 4C6KA 4GMEA 1ITQA 1TMHA 1EUAA 1F07A 4ZMGA 5AKQA 4F0SA 3WCZA 1J93A 5K3VA 2J8TA 1D7FA 1TWSA 1SJBA 4AUBA 5K9CA 3TYEA 4GCXA 4PBEA 5G1MA 3C0LA 1CECA 3SCNA 1K77A 4BFAA 5JQ9A 1JPHA 3LTSA 3BSHA 4AMCA 5LXXA 3C2EA 1DIKA 4GIRA 1OCJA 1QNPA 5E6ZA 1MEWA 4E4PA 4W9TA 3TU9A 1JYNA 2YYTA 1VFLA 2PC4A 1TVNA 2OYMA 1GHSA 2YW4A 3AXKA 1XR2A 1HZYA 1VYPX 3GUGA 3UG4A 2X30A 3E6EA 2QJGA 4GZ7A 3ZS4A 2W91A 3TTOA 3FGCB 1R2SA 2R1MA 4CCEA 3CZLA 3K13A 3WQVA 1B3WA 1O94A 3BO9A 1JYXA 5CZJA 4UMBA 2W0UA 4H7ZA 1RLDA 3CQIA 2RDXA 5TAOA 1MEHA 1CB7B 4MUPA 4XD4A 4HA0A 1N8WA 3THQA 1TUXA 1CENA 5HNRA 4AWTA 1HQTA 3DYOA 4AU0A 3NGJA 3L4YA 4MY9A 3MC5A