3PFMA

Crystal structure of a eal domain of ggdef domain protein from pseudomonas fluorescens pf
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
243
structure length
243
Chain Sequence
SNADHHAWHRLLDRALSEQHFQLYFQPVVAARDTHLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTSRLDLLMLEQVLRQMASHEDCLALNLSAATLADPHALNRVFEILRQHSDLGPRLTLEIGEEQLPEQAMLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRDIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELQVIREMGLYGVQGQLFGEPAPWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords GGDEF domain protein
publication title Crystal structure of a EAL domain of GGDEF domain protein from Pseudomonas fluorescens Pf
rcsb
source organism Pseudomonas fluorescens
total genus 69
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pfmA00
4F3HA 4Q6JA 4RNHA 4FOJA 3SY8A 4HJFA 2R6OA 2BASA 4Y9OA 5MF5A 4HU3A 4RNIA 3GG1A 3PJXA 4AFYA 3N3TA 4HU4A 3S83A 3U2EA 5MKGA 3HV8A 5M1TA 4LYKA 2W27A 4AG0A 4RNFA 4Y8EA 4FOKA 4J40A 3TLQA 4Y9MA 3GFXA 3PJUA 3GFZA 3GFYA 4LJ3A 4ES4A 4RNJA 4F48A 3HV9A 3PJWA 4Y9NA 3PFMA 4KIEA 3GG0A 4Y9PA 3KZPA 3PJTA 4FOUA 5MKGB
chains in the Genus database with same CATH superfamily
3P14A 2CXEA 2YB4A 4PMDA 4US5D 1TA3B 2WQDA 2ZUSA 1ZL1A 3E12A 2XTKA 4MWAC 2QDDA 4GUIA 3LBOA 4FF5A 3I10A 3W1LA 4BI7A 3V36A 5C54A 3O9NA 3OLGA 2VP8A 2EPNA 3VNDA 1NFPA 2VMFA 4IX0A 2WSKA 4M3PA 5I3HA 2FPVA 2ANUA 2VX4A 3MQTA 4GCAA 2OQYA 2EPLX 4XTDA 3V0TA 4AMAA 5EMYA 1UZDA 5BXSA 4LUSB 3ITLA 2E25A 2ZZ3A 4MLJA 3W1NA 4HZ6A 2ZUVA 3ZT5A 1J5SA 1PL9A 1A3HA 3GUGA 3PPFA 4AEEA 4D6FA 5LNSA 2PBGA 2D2HA 1H5YA 3UY7A 1FDYA 1A5SA 4C1NA 3FGCA 2WW5A 3TXZA 4JICA 3RPTA 1JYNA 4QG6A 3E49A 3IPWA 1CT5A 5FJIA 1ME9A 3CQIA 3S3GA 3S2MA 3WUBA 2PCEA 1FCVA 5ECUA 3OLIA 3VM5A 2AL2B 1Z8AA 1QHOA 4Q22A 4QCFA 2GOUA 3TSDA 1NFGA 3QC0A 1JD7A 2G3IA 3DN5A 4QRNA 5AC8A 3VOIA 5M3WA 1TSIA 4WY0B 4MWAE 2MUCA 5EMUA 3TA9A 3CPGA 3WK3A 4MF4A 5HAOA 1JDFA 1R3RA 4FXFA 1FWIC 1LL6A 1HP4A 4JTKA 1GOOA 1XLKA 5LHFA 1YRRA 3DERA 1S2CA 2C14A 3G0SA 3ONBA 4MSSA 1B3WA 3WDHA 4D1IA 1MEWA 4L9XA 5HQLA 3PZQA 5C7VA 1AH4A 1UASA 1PV8A 3W1MA 3LYEA 5DMYA 1JZ5A 3AC0A 3U5UA 4EE9A 3WH7A 3C8FA 3IK4A 4BQ5A 1XG3A 4PL1A 1LBLA 2VOTA 3CAKA 3N29A 3R11A 5A8MA 2XVKA 3WMCA 4GABA 3HBLA 1J10A 3VX1A 4LV4A 4US6A 3TYZA 4WD0A 1PIFA 2FGBA 2BHUA 1KNWA 3ONCA 1ZAHA 2X1TA 1FKXA 3B8VA 2IKJA 4B5NA 1SUXA 3ZWSA 2IKGA 3SUWA 4Y7EA 3I6TA 4O16A 1OF6A 1BF2A 2FDMA 3TAOA 5A6MA 1Y7VA 3L65A 4XK2A 3AMLA 3SCTA 3AOFA 3ARVA 1TWSA 3SAZA 2UY2A 6CGTA 1Q2RA 3VC6A 2WANA 2AGTA 5CJMA 3IRSA 4ZO8A 3ZJKA 3TTYA 5JBFA 3VZXA 4JCMA 2QR6A 4XO7A 2F8QA 3K1DA 3SCWA 3THQA 3QR1A 2I9EA 1SO5A 1ZCOA 3AU6A 4LUIA 3TMLA 4DIAA 3GNNA 4QM1A 2ACRA 4RNHA 1FCUA 4HHMA 2RGMA 5KSWA 1A53A 3VNYA 4Z1AA 2YCEA 3G6MA 3W2MA 2PU1A 3LCGA 2RDUA 1Q7ZA 2NLIA 4ADSA 1E1EA 3N9KA 1X97A 3N73A 3IIXA 4QROA 3F5LA 4KCVA 2BHZA 1FRBA 1XDLA 1TV2A 5D2XA 4MJ2A 3V1HA 3LERA 3LSCA 2P10A 3T4WA 1EJ7L 4RV3A 3GRIA 1REQB 2R82A 1XLJA 4JDBA 5DMMA 2WMJA 2CNCA 5C70A 1OG6A 1TPDA 4ICCX 4RZ5A 3NQ7A 1QOQA 2IXVA 2IXUA 7REQA 1FHLA 1ZY9A 2RDXA 1IEXA 2XFYA 3HQPA 4FB7A 4LB4A 2H8XA 1GTHA 4JNMA 1ADDA 1TPFA 2VDHA 2QVHA 1CPUA 4IGSA 4XIAA 4DWDA 1K9FA 5A6TC 3LCXA 3ZVHB 4GI6A 3R58A 3UEQA 4XKMA 2WKJA 3TFCA 3FK4A 2YL9A 3E9AA 3FV9A 4M6PA 4R85A 2YXOA 3LOTA 1E0VA 4XIMA 1TPUA 3N1AA 4L4MA 1OM0A 1D8CA 1J0IA 4L6DA 2J7BA 3WJZA 2Q8XA 4MHBA 4W84A 4HK7A 1LQ0A 2SFPA 4JYEA 3KBMA 3HG5A 2Z27A 4GIAA 5JBEA 1DYSA 4UOQA 1TFVA 1UQZA 4L64A 3S2NA 3UQNA 2VZVA 1B0IA 2FZDA 3PY2A 4GUHA 5C9ZA 4H7ZA 1I1XA 2GDUA 1A50A 1TREA 4I7UA 3CL7A 4IQLA 5RUBA 4QFUA 1F74A 1DXIA 1XWYA 1EXBA 1ML1A 3SCNA 4LS1A 4RL3A 1IYXA 3E02A 4PZVA 3UY8A 5AECA 3LMZA 2A1YA 2PTYA 3AICA 3N13A 3DG6A 2RJHA 3CL8A 3GSMA 4OGZA 3UZWA 2BP1A 4L5ZA 4MPQA 3R8RA 1XYLA 4JX5A 1UB3A 5C7HA 1XIEA 2XIJA 3W7MA 3PUEA 3CB3A 5DANA 1MXDA 3U9IA 1NTHA 4H2CA 4IPNB 4LCQA 4MFEA 4LRSA 5A8QA 3WJYA 1SO6A 3W75A 1EHAA 2OCZA 1LCOA 3W7RA 1LORA 3M0IA 4YVPA 3LS9A 4LC6A 3PAJA 3VD5A 4NXSA 4ZOEA 4HK6A 1MUMA 1ZJIA 2VR2A 2DDXA 1A3XA 4KRZA 1CX9A 2EQDA 4NU7A 4YS1A 1XYBA 3L23A 3WJXA 3PBWA 1J93A 3G0UA 8CGTA 1AJ0A 2VFFA 2FYMA 3ZR4A 1E51A 1M53A 4EXAA 1QK0A 5A8GA 1LBMA 3W72A 4C6PA 4HNNA 4IQJA 2E68A 4Y9NA 4WKHA 1S2AA 3WBEA 1QJWA 1CCWB 4L1WA 1HO1A 1QMLA 1HJQA 2WB5A 3NGFA 4M56A 3HPFA 2CLKA 3BV7A 2R91A 5A2AA 2VQTA 2Q01A 4JAWA 1GVIA 1RPXA 1QNQA 3PUDA 2PDHA 4PUDA 4CQ8A 2IQTA 1UA7A 3KOXA 1SFSA 4P8VA 4C6KA 5J5RA 1A49A 1Q7QA 4S3CA 2PMQA 1Q6OA 1PBGA 1BPLB 4H3DA 1EF3A 4DRSA 5M5DA 4EPBC 1GYNA 4RXFA 2NQLA 3POCA 2HXTA 3L2LA 4HA4A 1HJVA 2O4QA 2YDQA 3EKGA 3VKKA 4FX6M 2IPJA 2A85A 1DOSA 1OADA 1RP9A 1L6FA 3S6TA 2ZXAA 3C2RA 1ZU8A 5FAJA 3T0TA 3O1NA 1XHGA 3VTRA 3OZMA 3FOKA 1MQRA 1PWLA 2J7HA 4NRSA 4YPJA 3O6DA 1C8YA 2E40A 2WSPA 3QY7A 4XKYB 3IVTA 4OFCA 4F0KA 1RY8A 2XG9A 3GFXA 3IJ8A 3DAQA 2TAAA 4B3KA 4KS0A 1CGTA 3M07A 4GYPC 5FJTA 1ZRQA 2DH2A 3AMKA 3HB9A 1R7AA 1MZHA 5K7JA 4A2SA 3CMGA 3L68A 1XH0A 1KFCA 5LXEA 1TUFA 2OLHA 4LF2A 1PX3A 5BMXA 1YX1A 1KQZA 1XYMA 2J66A 3CUHA 4YHEA 1VAHA 4FXSA 4XVDA 3HJEA 2J8TA 4MTVA 4QAIA 4BR1A 1IXQA 3GXPA 4F9DA 2WOQA 3SN4A 1N8FA 3S8HA 6ALDA 2YB1A 2QCMA 3S5YA 4GIEA 5AC6A 3C2OA 2WVSA 4R9OA 3CUZA 1BXBA 4OV9A 3DUGA 3GR8A 1K8CA 4KCUA 1LLOA 1R38A 1DHKA 1K8ZA 1M7JA 1OD0A 3H22A 2VXNA 1H7RA 1VYPX 2V5JA 2VEPA 3SZ8A 4UIOA 4IFRA 1IR1A 2PDKA 1W1YA 3N4AA 2F6KA 4KH2A 3C52A 4ADUA 3A6OA 3VK5A 2YZRA 5D33A 2GQ9A 3GXIA 3FSUA 1DJGA 4UTMA 2E0PA 4HP5A 5D30A 1DE5A 4I6KA 3EWDA 2QV4A 1ZBCA 3WLIA 4ZZ9A 1EP3A 1QI0A 1VCVA 2DORA 1MRQA 3TONA 2ALRA 4IP5A 4LW7A 3QYQA 3UT0A 4DJDA 4GX8A 4Y8FA 1YKWA 4ACZB 2YCIX 3WDPP 4ONVA 5D9PA 3EX3A 5CGMA 1I4NA 2Z6JA 2BVWA 4HN8A 1XIIA 2W0UA 4JTLA 4J3TA 5CG0A 3GU2A 1TX2A 2C1IA 1VCFA 4WX2A 4DELA 1DIEA 3GTIA 2Q71A 3VNKA 1YBQB 4KF1A 2QPUA 4TXEA 4JFTA 4OUIA 2PTXA 3RJXA 3GG7A 1EGVA 3MZNA 3LQLA 2D0HA 3UA3A 3I3DA 2MNRA 1S46A 3W1RA 1RUSA 4AEOA 2E6DA 3QOMA 1TV7A 3I7RA 4AX6A 1BYDA 4POCA 4ADTA 2B31A 2E6FA 3GVWA 4GZ7A 4E5TA 4LS0A 4S3FA 1Z48A 4I3GA 4TQTA 3DCPA 4M6QA 2PP1A 1UWRA 4NYUA 2D2GA 3P93A 3RGTA 2FVKA 3TKFA 3CWNA 3H4GA 1M01A 2H9AA 4NKCA 2VC7A 2J74A 3B0VC 3I7QA 4W8AA 1IEQA 3P67A 2WNWA 2GVYA 1TMLA 3UXAA 1SW7A 3RO6A 1DWIM 3QFWA 1TJ1A 1KM0A 1TV4A 2X41A 1HKKA 1SFTA 2J24A 2ZUTA 2OT1A 4WY0F 3GAKA 3M7SA 4NAFB 4F79A 1BXCA 2EHHA 1OC7A 3WQ8A 3S2JA 4P7RA 1PE1A 3BSMA 2DU2A 5E93A 1WUFA 2XVNA 2AAAA 4E0CA 5FJUA 4TU1A 1WKFA 2PDJA 1RP8A 2JF7A 1QO2A 3PTMA 5JIWA 4N6EA 2HQAA 2EPHA 4KFPA 1B3YA 2UZ9A 6XIAA 4GQ0A 3GTHA 4WK9A 3MZ2A 1P6CA 2NWRA 2PURA 1FH9A 4HD5A 3PZIA 1HT6A 1OSEA 3AJXA 3A23A 3PS7A 4NNCA 4WRHA 4OBSA 3PBUA 1D3GA 3M0JA 1WDRA 3IGUA 3N4EA 1N8IA 2VI0A 2D23A 1NF0A 4M1RA 3VILA 1JZ7A 5JUVA 1G4TA 3W23A 3GW3A 3OB8A 5ENLA 4I9TA 4K7VA 2W63A 4ZODA 3W1UA 3KBJA 2D3NA 1B3VA 1W9PA 4CCZA 3QV9A 4PUUA 4A05A 2HZGA 4MB3A 1A4LA 4JGDA 1EGZA 2PGFA 1I2PA 4Y9AA 4JNZA 2QLYA 1ELSA 2E77A 3NYDA 4ILSA 3AS3A 4H41A 5AZ0A 4RPPA 3I68A 1DQXA 3RR1A 2ZX8A 1A5AA 1QW9A 3PBMA 4ROPA 3ITYA 4UMCA 3GR7A 1LQ2A 4AXKA 4ZE4A 3VNJA 2D1ZA 1MDRA 3CHFA 4AX7A 1RJPA 3UCCA 4PULA 5CPLA 4UNLA 4HU0A 2VR4A 3L4WA 3S5NA 4AB4A 4QS5A 1MVYA 3QF0A 2O55A 5HXMA 1HJUA 4PCTA 2XVLA 5A6AA 1QATA 1S39A 3SADA 5JBDA 4QTGA 3L4YA 3W26A 1UWUA 2QCCA 2QEZA 4UMAA 3DU0A 2Y4SA 4UFMA 1TWIA 4WVXA 3EX6A 4PTMA 4TX8A 3OLDA 3ANVA 4HNVA 4TUFA 4PTWA 4HPNA 3BV4A 2VFEA 3Q45A 3TSBA 1FHDA 4JL2A 3M4HA 4MNJA 4BQ4A 4TTUA 5H8PA 5FF4A 4DJEC 4C6DA 1XLAA 1B54A 3VIIA 4XZIA 1FQ0A 2FZNA 4QG8A 5KZ6A 4PBFA 2VQUA 4ZSUA 4NI8A 1IIHA 5K9XA 5C9WA 3EB3A 2HXUA 3BDKA 2YFOA 3QSTA 3IIPA 1UUOA 1TRDA 3SCPA 5CXPA 2QJGA 4XBJA 4S2BA 4I9MA 3IIZA 3FFSA 1S5MA 4P7LA 1E4IA 3UXIA 3VGFA 3NG3A 3WF4A 4JY9A 3R79A 1IZCA 3A3XA 3UR5A 3E0IA 1IWAA 5C6MA 1OWQA 3H2FA 3OLEA 5K2ZA 3S46A 4URIA 4NZ1A 2HEJA 1ZBWA 1DWJM 1XLIA 4UTHA 1UH3A 1VP5A 3GXTA 3M5ZA 2J7EA 3QHOA 1WV2A 3C56A 3B0UX 3SCQA 3N19B 3W70A 4J3UA 4ALDA 1H61A 1UWTA 1SMDA 1GORA 1P0BA 1X7FA 2BOEX 3ARZA 2DW7A 1VH7A 1DWGM 4LS2A 4DHGA 2PA6A 1UZ1A 5LNUA 1W54A 5CC6A 1U1UA 4HYRA 3N2XA 1SFJA 2G95A 4LVDA 3W7KA 2ZDRA 3KBNA 1DV7A 4DJDD 1EZWA 3DC8A 1TTQA 3R0UA 4G7FA 3RX3A 3BGJA 4N4PA 3CASA 3PJUA 1R46A 3P3BA 1C7TA 1BD0A 1JNDA 2Y1HA 5DQPA 2DH3A 2EF9A 5XIAA 3GG1A 4LUJA 3CQJA 3S83A 4AH7A 3LPPA 4KFOA 3WBWA 1FCQA 2Q09A 4UZUA 4L65A 3MJMA 3QOKA 2J25A 3R89A 4ERAA 4MNMA 4Q6XA 1E4MM 4KPLA 2F9RA 4HHHA 3W6LA 1L6WA 4M19A 4IIGA 4C7GA 1FXQA 2A4AA 3IVSA 2QXWA 5DX7A 1AW2A 4RLIA 1XP3A 3EGJA 1P43A 5I0DA 2VFHA 1FY6A 2YPIA 5CCZA 4GPNA 2JALA 4GY1A 4AF0B 3EB2A 1ONRA 3HU7A 1U22A 3GZ3A 3RPMA 4D6JA 1E5NA 1VJIA 5CC5A 1IF2A 2J7DA 2QDEA 3B8UA 4FNPA 5M1TA 5HJLA 4DX3A 3XISA 4MOZA 1JUBA 3NQ2A 3WK0A 1Q6FA 4UTKA 4O15A 1ISXA 3LLFA 1XYFA 2WXDM 3VVGA 1MUCA 4DUVA 4LYRA 2FTPA 1W3HA 1UR3M 3TNOA 4XD3A 2Y7EA 3TC6A 1PTAA 4PTXA 4HHLA 1NP2A 1G1YA 2PLMA 3ICJA 1EA9C 2VDIA 3E5BA 4CUCA 5LIUX 2E28A 2DZVA 3GIPA 4DBSA 3TTOA 1G7UA 2V0TA 4GQGA 1IT8A 3WUGA 4XAPA 5FEWA 3UYCA 1UH4A 1AA1B 2W66A 1TPH1 3TQVA 3DBPA 1P7TA 3VMPA 3F5KA 4XX6A 1H60A 1FVPA 4PGLA 1G9HA 2PLKA 2E6YA 3AI0A 3GDKA 3N9RA 4A3QA 1OFQA 3D47A 3MC5A 3U5YA 4Q8OA 4I9JA 2W9MA 4MLRA 5F2IA 3REQA 1IV8A 4AQLA 1M04A 3TCSA 3NQGA 1HVXA 3RAOA 2C1GA 3QMTA 2QF8A 4DPQA 3C3NA 1OYCA 3LGGA 2YXXA 1H5VA 3NQVA 3HG3A 3CTTA 4HMNA 4Z2LA 2REQB 2CZ5A 1AH3A 4ENLA 3IV3A 1CGWA 1I2QA 3Q67A 1G7VA 3STEA 3PN8A 4C6CA 4C6FA 3MHFA 3QY8A 4XAZA 3G3MA 3KVJA 5CPQA 3MI2A 1XW8A 2BX7A 5CC3A 4H7VA 1H0IA 3WLRA 3N15A 4QISA 3VIKA 2Q3RA 3AS0A 1KWGA 4RK8A 4P7QA 2XVPA 5MHBA 3G24A 5ABFB 4W9TA 3KS5A 4MWAD 5AHNA 3GVGA 4HSHA 5FI8A 4AD1A 4MZ8A 3THDA 4NT0A 3TSMA 8XIAA 2HVOA 1GW1A 4C6EA 3PTQA 2BASA 3QJAA 1E40A 1KCZA 4IGHA 5I03A 3ZT6A 2MANA 2C91A 1TZZA 3QPZA 1PS9A 5DBUA 1KXVA 1BWKA 1TE6A 1H41A 1TJPA 5H6HA 2VO5A 1EOMA 4CU6A 5GNYA 3AHZA 3WQ5A 3D3AA 1Q3NA 4ZQRA 1C8XA 2WKGA 1JDAA 3U7VA 4WJXA 3NPVA 4H9TA 2IQ0A 2XFFA 3TQPA 2TRSA 4DXVA 1V3HA 4HPHA 4CCDA 2YCKX 3CBWA 1H4PA 4DXXA 4AVNA 3GNDA 3WMSA 3ZJ6A 4GX9A 3SSZA 1V6UA 3UERA 2XM2A 2GSJA 4HNTA 3IJDA 3UGRA 3ABOA 3UJFA 4LUYA 3LNMA 2PDYA 3B06A 4NVTA 3T0DA 2AKMA 3QHNA 3B9NA 4ZB2A 4XWUA 3EOEA 4J35A 3EPMA 5FD0A 2Z1XA 3PAOA 1EYEA 2XN2A 3OHMB 2VZSA 3QZ6A 3AUJA 3R8HA 2VM8A 3STCA 5FEXA 3DGRA 2G97A 3EWZA 4X9SA 4V27A 4ACYA 3U8GA 1LQAA 1TWWA 1RR2A 1KFKA 3RN6A 1HL8A 3UR7A 4XD4A 3MU7A 3T0CA 3N2CA 4AIEA 4CQAA 4S3BA 3RLVA 5A8OA 3CIWA 2OVLA 3FA3A 1YADA 3WQCA 1B3OA 2PWHA 3JUGA 5CZKA 3RFAA 4Z2HA 3S9ZA 5BOFA 3G8RA 1KFWA 2WZTA 1XD1A 4OZOA 2RHGA 2Y8KA 1NFBA 3IJLA 4PA8A 3E2RA 3RCNA 3ZSSA 2CLHA 4WSKA 3O06A 3QGKC 1QK2A 1K7EA 2JKPA 1HTIA 3AMDA 3WF2A 4F48A 5F2MA 4PMVA 3F03K 2JGYA 1U1JA 3W76A 4DO6A 1DL3A 2RDTA 3CHDA 2WMIA 3VFCA 3NO3A 1JF6A 5E9AA 3GY1A 4CQDA 3OOQA 3KLKA 1EXPA 1MWOA 4ZXLA 1MYRA 4G2DA 5FF7A 1I2RA 1ZBVA 2E5DA 1ISVA 3UG3A 1Z44A 4MFDA 4Q8QA 4B9YA 1XJBA 5L6UA 5HJYA 4IIDA 1AQMA 2E3ZA 1R3QA 4H9MA 3P80A 4QXIA 4MY1A 1WQ5A 4IICA 5DFAA 4L80A 1EJRC 5AYBA 1F4AA 1P0EA 3H4WA 3VC5A 1RLDA 2OYMA 3QBUA 3CMJA 4YYCA 1AW5A 3DG3A 4ORIA 3RR4A 3NQFA 2G8ZA 3FCPA 2YBUA 2Z2AA 1Y0EA 4OBRA 3NDYA 2NQ5A 2A5HA 3G22A 3PUGA 1S2TA 4NJGA 1RALA 4P8WA 1OY0A 3SFKA 3EKLA 1DJXA 1MQQA 3TU9A 4H8VA 5A6LA 3V16A 1QNSA 3NPXA 1XGDA 4WDTA 1YPXA 4PTNA 3VMOA 1YE4A 2L5HA 4AWUA 1FUYA 1FWWA 4W7WA 2A3CA 4BF5A 1AVAA 4GFIA 2VZTA 1RVKA 1BQCA 1OFDA 5XIMA 1CB7B 1QWGA 3SBFA 3PR2A 3W1PA 3PWGA 3NO5A 4U5KA 2GWGA 2OMAA 3TUUA 3K4WA 1FX6A 2YFNA 1L6SA 5AFDA 3UZ5A 2G3MA 3OGVA 3UW6A 1X39A 3L5AA 2J88A 1OGSA 2YW4A 4DZ5A 3N2TA 4HCDA 1GZ1A 1ZSXA 2UY3A 3BLLA 3U6WA 3THCA 3BAYA 1W6TA 4ECLA 4MKNA 3M46A 3UG4A 1QBBA 1VFOA 4IX2A 3FJLA 4IGNA 2D2OA 3GD6A 4HZMA 3Q58A 3DXIA 4IISA 1R9ZA 4QLJA 3H2EA 4YTQA 1XLHA 4REQA 1OB0A 3PBGA 4S3KA 2YYUA 4B5UA 1EJVC 2EPKX 1XLLA 5LNRA 3UXLA 4YXGA 4QEHA 3OODA 4RE0A 3N34A 2CESA 5D2WA 3E2VA 1LOLA 2GVGA 1F05A 3EMCA 1W3KA 3AYRA 4MM1A 3EAUA 4FLRA 4FLOA 4E4UA 1FFQA 4AZ7A 1D3HA 3C0QA 4HZ7A 2VNCA 2GYIA 3WBAA 3VIHA 1ITXA 4ZTXA 1JG9A 2HE5A 3VGDA 1QT1A 1DIDA 4HZ8A 4DLMA 2INEA 1EJUC 4BY3A 4Z2JA 1CXLA 1F6KA 5EFDA 3DH7A 3VGGA 4J40A 3VKAA 4B5TA 1N7KA 2PB1A 2ZFAA 3M47A 3AIWA 2J47A 4CN1A 4JTSA 3PHAA 1E0TA 4CVUA 2GGIA 3SUUA 1R2SA 3WUEA 3KTSA 4K36A 3NYZA 4UQAA 3WENA 1RCXB 3INPA 3QPEA 4NXKA 2BBFA 3GDRA 5KZEA 4N9CA 1LOQA 5E70A 4DWSA 3SECA 3ZJ7A 1OT2A 4GUJA 3N04A 4U5IA 4UTUA 1V0MA 1AG1O 1YHTA 5DCDA 2OG9A 4JQ4A 1TJ0A 3DFNA 1CLKA 3QW3A 3R0KA 2OSXA 4JYDA 1K6AA 3ABZA 4FO4A 3FJNA 4NZ4A 2VELA 1X8FA 3T40A 3ARUA 2IMRA 3KL3A 1TKKA 1AFSA 4A3YA 2W79A 3W38A 4GD0A 1S5WA 1L8NA 4MGGA 4HCLA 4JQ3A 5KINA 3CLWA 1R8LA 4ERGA 1XRFA 1Z9AA 1ZQ5A 2EO7A 3KRZA 4H2HA 4G7EB 4J2MA 1ZENA 1WOAA 2FHCA 3T8LA 1EP2A 3MW7A 3AZSA 5K9DA 5B7ZA 4PBEA 3LTPA 1SR0A 3VNIA 4KCTA 4LUSA 4IPPA 1UG6A 3IGSA 4YTRA 3BW4A 2FQIA 1L8PA 2PD5A 2ZUNA 4O18A 2WHKA 3EDJA 2HJPA 2FMNA 2V3GA 2W92A 2PDPA 2C0HA 1FKWA 1UKTA 2C15A 3L5LA 5DXYA 3F4WA 3BZJA 1HF6A 1UWSA 3VIMA 1A5CA 5AY7A 4GIYA 3VMNA 2ACUA 3UD6A 1DJWA 3L0GA 1S2WA 2XJ7A 2WM1A 2E6AA 1A4MA 2ZYFA 2ZWZA 2HS8A 5LNVA 2FH8A 1D3CA 2PFHA 5FF0A 4QBXA 4J3WA 4W88A 1XXXA 1E9LA 2W6RA 3V0UA 1LZOA 1O5QA 4WY0A 5G4WA 3JZUA 3L2MA 2IW0A 5CSSA 4S38A 4D8ZA 2W67A 2PZNA 1RK5A 2WMKA 1R3YA 4GINA 5A8PA 3BLIA 4MAZA 1EJWC 4FF7A 4EXQA 1I75A 5HA7A 4F0LA 3IV8A 2WQPA 4P2VA 1QOPA 4ERIA 1GVOA 4BF9A 2V3FA 3I6RA 3AIEA 4LBUA 4ZO9A 4AC7C 2P3ZA 4NAEB 4HGXA 3GNPA 3PP7A 4C6IA 5T91A 3DOPA 1H7OA 1GQJA 3BAWA 2DY3A 4TX9A 2B7QA 1RJQA 3N9SA 1M1BA 4GXPA 4DY1A 4QE1A 4UMBA 1XIMA 3UU0A 1POJA 3N18A 2CW6A 2DEPA 2OX1A 4ATLA 1V7AA 4IG2B 1FWHC 3DI1A 4P61A 2ODOA 3BLKA 2VGBA 2RJGA 3DENA 1CECA 4H01A 3HURA 3NJ3A 3L4XA 4QHRA 2WYSA 2BY3A 4UTIA 3W7JA 3IS4A 1PCKA 2NV2A 4DF2A 4MDOA 3L0KA 3GWQA 3ZQ9A 4JCLA 5DMNA 3CTLA 3LG3A 1V4YA 3W7IA 4ATWA 5FAGA 3APTA 1KBJA 3K5XA 2YCJA 3P5ZA 2C18A 1V0LA 4KWOA 4UQ9A 2NLYA 3TYCA 1CW2A 2BXYA 1NVMA 4OVXA 4JIEA 6REQA 5AHMA 1R2RA 3WSUA 2FZ9A 1YXDA 2CERA 1P0DA 4IJRA 4GNVA 2QUMA 4WIWA 3W7NA 1QNOA 3DFQA 3KOFA 1X6UA 1S5NA 4FNTA 4S3EA 4UZSA 5D2TA 1KLZA 4JTIA 4OE7A 3W2JA 5IFPA 2PC4A 4C1KA 4ZQOA 3AXXA 2WWDA 2VX6A 2WJEA 2YL6A 1PWMA 3VE7A 2QCEA 2Y8UA 1E15A 1DWAM 4CD4A 3VE9A 3APYA 4RUBA 2ZZ2A 4YL2A 3RJYA 4XZHA 5FESA 1XYZA 4PCSA 3NXFA 1T8QA 1O60A 1KM6A 4ZQCA 3GDBA 4GJ1A 1EO5A 4AD2A 3TQKA 3IUDA 3B9OA 4NASA 1ZTVA 2QZRA 1XKYA 2NX3A 4A2RA 1KM3A 2VC5A 2HROA 3AQUA 5AHIA 4Y90A 2VVSA 2XYLA 3MKKA 4B92A 4G1KA 4GJIA 4IMGA 1DIOA 4J3XA 3GKFA 2Y5SA 3UP8A 4DNMA 4AC1X 2PDMA 1JCMP 4RE4A 5DY3A 2IS7A 3VIGA 5IHSA 3WLPA 4QIUA 3G0XA 1T99A 3EPOA 4RKAA 3C86A 2FJKA 1GG0A 3CPUA 5BRQA 2WNNA 3ZYZA 1ONXA 4D9PA 4R53A 4F2TA 4Z0JA 3IK2A 5REQB 3ARQA 1W3LA 3ZVHA 2RAGA 2ZA3A 2A79A 3A3HA 4LC8A 1F61A 3ANYA 2Y7GA 4LANA 3K46A 2OSWA 2GJRA 4F0SA 4C5ZA 3IAPA 4Q3MA 4NZ3A 2R94A 4UOJA 4DO5A 5JH2A 3IANA 3EB4A 3NZGA 1LLZA 1TPEA 2POZA 2BODX 8XIMA 2A7RA 3IARA 3S1XA 1PIGA 3W73A 4WDWA 3VIFA 1G94A 1GONA 4DJFA 3ARRA 4Y9OA 2VUNA 1ME8A 4A8IA 3B9AA 2DVUA 2QUNA 4H8HA 4PC8A 3R94A 4ZB0A 4AAJA 3OIHA 4B90A 2HVNA 2NW0A 4PRWA 4ZQPA 3VDGA 1ADSA 5CG7A 2CC0A 4AD5A 4O1AA 3WH5A 5C9XA 3UWUA 1GUVA 4NILA 1JCXA 4NZFA 2PDQA 3B05A 1UR9A 1S2VA 2DQWA 4HMCA 3CAQA 3T2QA 2X30A 4DWSD 1Z69A 3BLEA 1XD0A 4LB3A 3F2CA 3CV2A 4J3SA 1XBZA 5G4EA 5A1AA 2QDGA 2F2KA 1FOBA 1V02E 4NZ5A 1E3XA 4L9YA 1EA0A 2A3HA 2Z1WA 3WQ4A 5BZAA 1OG0A 2YDSA 1RY0A 4H00A 3NQDA 2G41A 4W5UA 1SSGA 1M41A 1WNOA 1ICQA 1NARA 2Y6ZA 4JN7A 2XFRA 4LNYA 1NELA 4H9UA 3VOCA 1ITQA 1T40A 5BRPA 4P7NA 4WUIA 3SI9A 4AZ5A 3W86A 4CD7A 4IPLA 2XSBA 3Q65A 1H63A 1N2VA 3R13A 4JY8A 1OYBA 1PSCA 4LSBA 3B04A 3V7PA 3WBYA 3LCWA 1WO2A 2INZA 2QKFA 1R2TA 3P0WA 4Y9PA 1OFEA 3VX0A 4JTEA 3KM8A 2CLOA 3TZNA 2Z26A 2P0IA 4P5UA 3KCLA 2O9OA 1QHZA 1GJPA 4CNSA 3IIVA 3SFWA 2XN0A 1J11A 1HZYA 2QS8A 1ALDA 1KRCC 4D8LA 1QCWA 3O05A 3R43A 3CEPA 3WCZA 4F4RA 4UTWC 3HGJA 4QE4A 5FCZA 3W7QA 2DJLA 4XG1A 4C1NB 3L67A 2J78A 4Z08A 2GGEA 4Q8PA 3FHQA 1AQ0A 2J9XA 1LM1A 1J0HA 4K8GA 3RNDA 2XPKA 3BLFA 3S1WA 1JPIA 4AZGA 1DJHA 1TV5A 3PPCA 2OQLA 3N17A 2XIMA 2VCCA 1YDOA 3E2QA 3VDCA 3CZGA 1ZGDA 3CUFA 2FTWA 3MB9A 7TIMA 3IJ6A 1AJZA 1XF0A 1TR9A 4FS9A 1V5XA 2XZ7A 1JQVA 1QPRA 4DJED 1KW1A 2FHBA 3JVAA 4XKYA 2Y88A 2J8FA 3G1YA 3A21A 1EX1A 3PULA 5EGRA 3M0HA 2NX1A 1CGXA 3I3BA 4O28A 2EKGA 2DSVA 1F76A 3T55A 3LQGA 3IJIA 1E6QM 3VCNA 5BROA 4JFSA 2IPFA 3DGBA 4PCNA 5FEPA 3EPNA 1W91A 2NXHA 3AHVA 3M6YA 3W84A 3D6NA 1W9UA 3SCVA 2QUTA 3GHSA 4LYKA 1VFFA 1PYMA 3SY5A 1XC4A 4BQ2A 1A5MC 1GJWA 1LG1A 3LPFA 4QJ3B 3I6EA 2FB2A 1T6MA 4Q7IA 1JXKA 3SGGA 4UBPC 3K4AA 5LKYA 1PKYA 2NVCA 3MDWA 1K6WA 1K9TA 2I17A 4PMUA 4Y6GA 1QNRA 3E0FA 4MMWA 4E3VA 1JYVA 2VFIA 2GJPA 3LY0A 3H2AA 4GUGA 3UG5A 2CU0A 5DCBA 3CGTA 2WVTA 3KHJA 3F2DA 2UWFA 3SCUA 3GNXA 2OKTA 5HWNA 1EUNA 2Z1KA 2R1MA 1H1ZA 4LY8A 4EKJA 1SQ7A 3AYTA 3VDHA 1RCQA 3M7WA 1I8JA 4A22A 3TMQA 3AXMA 1G4PA 4L6OA 3SY8A 3LA4A 3H7VA 4JTJA 2CLMA 2VURA 1GOQA 1C92A 1W8SA 4US5A 1R3VA 1V08A 1Q66A 4MIMA 3CZJA 2NXGA 4JHOA 2AQOA 4AWEA 2BFGA 1OFOA 3JRKA 1JFHA 4MUPA 1I0BA 2QCGA 3N11A 1ENUA 1S5VA 4H83A 1UR4A 4M6VA 3W2KA 1UD5A 2GSEA 4JKLA 5J8LA 3G1VA 4IXHA 5G2HA 5EMLA 5HK4A 5CLWA 3G5EA 1GW9A 2FJUB 1ZBKA 3GFZA 3SUSA 5CSYA 2NWSA 3AZTA 5FJJA 1H1YA 2X0HA 3W6YA 4O0ZA 1XCXA 4GG9A 2PLJA 3S5SA 5MF5A 2TYSA 2V5CA 3N14A 2PGWA 2B0MA 3WUFA 3WLMA 2UY4A 3TP4A 1NDWA 1RD6A 3WZ0E 5I3GA 5H2ZA 4XAFA 4K2SA 2VRKA 4OWGA 4TTGA 4M82A 2INFA 2CHOA 4RX0A 4NP7A 3A64A 2H90A 2OPJA 3AFBA 3A4AA 3W0KA 1ZAJA 5LA2A 5HNTA 4IMAA 5A8NA 4N7QA 2WCAA 4DN1A 4OOZA 3RCMA 2ZXQA 3OQEA 3XIMA 5GJPA 3KRSA 1RZMA 3WBXA 5TNVA 2GSHA 2OWWA 2CZVA 5HATA 3URBA 1Q45A 1ECEA 3CHVA 3GNOA 2VVNA 1M03A 4MKVA 3C4UA 4XTIA 1EC8A 5J5DA 3HV8A 4H19A 4NZJA 4QAWA 4F2BA 2WVUA 4PUJA 4JX4A 4MUZA 4PMRA 3KEHA 1C29A 2V81A 2P53A 2ZE0A 4JZ5A 2DZTA 2GGGA 3HG4A 4H9YA 3ZS4A 2DQXA 3ELFA 2YIHA 1EHNA 1NDZA 2J75A 5C8BB 3N6QA 4W93A 2CIPA 2OFJA 2RFGA 3TN4A 4FMVA 4ZOBA 3STGA 3TR9A 3WKZA 4PMOA 2CZDA 3W24A 1PTDA 3FSTA 2JBMA 4GVHA 3W81A 4FALA 4JIPA 4DBWA 1W32A 2JFEX 4RNIA 3BJTA 1E43A 1K03A 5A6SA 5MKGA 1B90A 1DBTA 3EX1A 3W29A 3HN3A 1AD1A 1VQTA 4AU0A 3UXKA 1MW0A 1KXQA 1XIFA 3PANA 4ZA0A 2VEKA 3L4UA 5FKYA 4FNSA 5T26A 4QR6A 3MYOA 3P7YA 1TVPA 3VU2A 3BMXA 4ZB5A 3LENA 3MUIA 3R25A 4EWND 3LCFA 1EDTA 4UTTC 2G3NA 3VGEA 2VX5A 1VYRA 4JNYA 3BANA 3CYVA 3CQ0A 3HZ3A 1RV8A 3HOJA 1XRSA 3TROA 3C2FA 1W5OA 3CUGA 1X6LA 1T41A 1IQ8A 1FFRA 3PJXA 3ENLA 4Q4PA 1US3A 2WLYA 2P8CA 3HG2A 2DFAA 4L7ZA 4CCCA 1SJAA 3MCNA 4IJCA 1P0KA 3OZPA 1K4GA 4AZBA 5AHFA 1QHPA 5IOBA 5LIYX 1CLVA 1XIDA 1VEOA 3H26A 3RXZA 3A22A 1BRLB 4OECA 4KEZA 4DO4A 3T08A 4XZBA 1XRTA 4BEUA 4HBKA 6TIMA 1KFEA 3R12A 4PMQA 1IR2A 4WOZA 1CIUA 3LRKA 3M6DA 3EWCA 3CH0A 1VBUA 4GHRA 3CQKA 1TQXA 2QYGA 4JX6A 3M0ZA 4RDZA 3SW6A 1UWQA 2WZEA 3MUXA 1H50A 1HO4A 3H24A 4PCFA 4A4AA 1ZS2A 1AL7A 2O9PA 3DHFA 1I6NA 5CBJA 2I5IA 4DYEA 2P1FA 1AZ1A 2WSYA 3T2PA 3FNDA 1D2KA 3ME3A 4JBRA 2W3ZA 1LLWA 1U2YA 4AISA 2QGYA 1KV5A 2V68A 2OZTA 1XCWA 3QFEA 3L4TA 3QC3A 5HULA 3WN6A 3QZEA 1OZQA 3RLHA 1W2PA 3T1GA 3WK2A 3GDTA 1EOKA 4GNKB 3NQMA 2QHAA 3LZ5A 4HQVA 3RX4A 1FHVA 2ON3A 4MAVA 1S1PA 3H2OA 3BK0A 4AVOA 4GVGA 2R1NA 4H8UA 4JD4A 3MYPA 1GOKA 3CHCA 3BQ6A 1Q13A 3NFUA 1OC5A 4PEEA 1MQPA 2GUUA 3N6JA 1KKOA 3LHVA 1OC6A 3EWWA 1S38A 3O07A 3D46A 1H2JA 3PNZA 4M5PA 2I7GA 1J6OA 3TWBA 4U3AA 1XUZA 2PC8A 4QEEA 1L6GA 2DZBA 2BGQA 1LUCA 3WLQA 2FKPA 1JAKA 3AWOA 1LJYA 3NO1A 3PB2A 1NM9A 4MZ1A 4ZE5A 2HV5A 2XU2A 1XGZA 2JKAA 2R14A 1MNZA 3GG8A 3FAWA 4Z0SA 4YU1A 2R8WA 5FL0A 3MT1A 1FH8A 1EDGA 5M2FX 4K37A 4YCPA 2WJDA 3VCCA 4KEMA 2CPUA 2OO0A 4QQUA 4UTLA 1UWAA 2DW6A 4KEVA 2ZRVA 3FIGA 1NWRA 5IBXC 1UOZA 3OG3A 2ZBTA 1E3ZA 2I5GA 1IEIA 2R1PA 4DQWA 5D38A 2DVXA 2V69A 3N2BA 1XIBA 4HMEA 1VFHA 2ZE3A 3Q4DA 4WOQA 3UWYA 4P7OA 3C0SA 3U0HA 4HA3A 5J04A 1JCJA 3UJEA 3G1DA 4D6DA 2DT2A 4LTSA 1H7XA 3ZT7A 1NH6A 4R5EA 4RJEA 5EYWA 1XQLA 3QLDA 3ZM8A 3H53A 1AUSL 3S9YA 2XIBA 4YCOA 3BUVA 3C0JA 3P6LA 2Y5EA 2ZZ1A 2AL1A 3TA6A 2VHLA 3CH9A 4HTBA 5C9UA 2BOGX 5G1TA 5HNRA 5G2IA 7XIMA 1CYGA 2OODA 3TNBA 3HA1A 3MV01 1PCWA 3BAXA 1JF5A 4AZIA 3K1GA 3NDZA 3B03A 3EDFA 2NSXA 4AF0A 5I06A 1X8CA 2O7QA 1E4NA 3MSYA 5GQBA 1QFEA 3LPGA 1R86A 4PB3A 2TMDA 1F4HA 1F5ZA 2ATMA 4C6QA 4LYQA 4X0VA 3UCDA 3LM3A 1BWLA 1JXJA 4O50A 1WB0A 1ZP4A 3C5QA 4ATDA 3W7EA 3QGAC 4N02A 2VD8A 3AWNA 2H9AB 4FR1A 3EMQA 4LCSA 3I4EA 4PUKA 3U2EA 1UBSA 2VENA 3EWBX 1JPDX 3OZOA 1YW1A 3TK7A 1PKMA 1UD6A 3JZEA 3AS1A 1VPYA 1LRQA 4FI4A 3MUCA 4O11A 3WO8A 4PMYA 5JH1A 4KGLA 4J4KA 2DZWA 1QBAA 1XS2A 5G4HC 2ISSA 4JXCA 2FTYA 2Z28A 4O14A 1DPMA 1FHUA 1W9BM 1K77A 3UZZA 5CPSA 4O0QA 4X61A 3MKCA 3BG3A 1O66A 3QXBA 3WL0A 2P5NA 3TW6A 4IP4A 5KITA 4F9JA 2PS2A 3F4CA 4AWSA 1SZFA 2C16A 4FNQA 1CGUA 4YNGA 4Q4RA 2ALDA 4OJYA 2BY2A 2XVGA 1VS1A 1CXEA 2BGNE 2GQAA 4HSOA 1KLYA 3G1SA 2BSLA 4KEUA 1OX4A 2PRHA 1V6YA 2D69A 1ICSA 1WCGA 2BLEA 6TAAA 3DFPA 2REQA 3G1FA 1FWTA 5BCAA 1O95A 1VJSA 2VGIA 3V5FA 3WD3A 3M0LA 5BXRA 3HMJG 3AXKA 4DM2A 1E71M 4XO6A 4C7DA 1CTNA 3STFA 1EBHA 3NWRA 3QLLA 1ICPA 4JL1A 1S1RA 5GPRA 2G50A 1XLMA 3BCJA 4XZLX 3TXVA 1MXGA 1VHCA 2OEJA 4CQ9A 1VIZA 2Z6IA 1IHIA 2I16A 3BH4A 3WL1A 3DHDA 1E1CB 1E1FA 1M5WA 1NOFA 3CHEA 1XH1A 2D0FA 5ABFA 1I45A 4Q7BA 3GIQA 1W3JA 1E4LA 2Z7GA 3KXQA 1RPKA 1UKQA 4LAOA 3SUTA 3CB8A 1JZ2A 3F7JA 1T0OA 1TYGA 4HNCA 4AZ6A 1K4HA 1QUMA 1YQ2A 2QF7A 2X1RA 3WQWA 1UD4A 2B4GA 2PDFA 1HKVA 1T7LA 2WC7A 2J6VA 4Q33A 1KM4A 1IZKA 5T9CE 3DZ1A 5GNZA 3IJ9A 1QTWA 2GFTA 3MVTA 4W87A 5AYYA 1B9BA 3T9PA 2B7OA 1PO9A 2PTWA 3W2LA 3P0XA 3LGDA 4GKTA 2F84A 4NZCA 1VRDA 1IGSA 3VAVA 1US0A 3EEZA 3EWUA 1GHSA 3EDDA 4LAUA 1FWJC 3P8IA 4ZVJA 3DX5A 2ADAA 2Z00A 1W3TA 3OVRA 4O1FA 2PDIA 2D0GA 4OTKA 3EMZA 3LTYA 3F4VA 2X7VA 4JQAA 4C5YA 4GBUA 1RK6A 2GGJA 4KIEA 4NF7A 5CZJA 3F5JA 2GL5A 3VPLA 4EAMA 4U28A 2A2IA 3SCRA 2YA1A 2ZZ4A 3BWWA 4QJ1A 3QSRA 4B5WA 1UJPA 2GLKA 4IMDA 3C0LA 4NNBA 4WJEA 5CPTA 2E1DA 2QJMA 1MI3A 3S4TA 4JEJA 1DJYA 4LYPA 4V2XA 1QI2A 4N9EA 1MEIA 1WDSA 3L4VA 2O0TA 1P1MA 1BYAA 1XLFA 3ARPA 1OHLA 4CD6A 3ZWTA 3TTSA 1K7FA 1SZGA 5HMEA 4S3GA 2Q02A 3W1XA 4RW5A 3VDAA 4DVOA 3KOYA 4GQRA 4PTDA 1ZFJA 1S5TA 4Q7NA 4HVXA 1UIPA 3MV11 4GNJA 1QPKA 3DHPA 3M41A 3CJPA 2HVMA 1GPWA 4DM1A 3IGHX 2PUZA 4JFWA 1S3TC 1GG1A 3GHTA 2B81A 2PPGA 4AD3A 3KBWA 3SIMA 3VIPA 5FF2A 2HSAA 2W91A 4L1GA 1WXYA 1VLWA 1W1VA 2NV9A 1LF1A 3HFTA 1WE5A 4DZIA 2VC6A 1NWSA 2HS6A 3MKVA 4WKFA 1XM3A 2HDJA 4Y8EA 1EF2A 1Q6GA 4DNHA 1JZ4A 1ZUAX 1UD3A 5DLCA 2XDFA 3G18A 5AC5A 1NJJA 5HUPA 2B7NA 5AYZA 4Z1DA 1J9YA 4GWEA 2DZPA 4X9YA 2YDRA 2CBJA 1ZJHA 2OU4A 3AIRA 3KP0A 3PK7A 5I07A 3ARWA 1RAKA 3V18A 3QPYA 3DFSA 5E09A 2J77A 4D72A 1Q8JA 4GGBA 1KBLA 3NQBA 1UYQA 1W1ZA 1RSCA 4A8RA 4JTDA 2Z1BA 1VEMA 4K6AA 1PX4A 2VDGA 4RPQA 1XG4A 3MBFA 1KCXA 1H7WA 1EX5A 3L2IA 2V6AA 3S1GA 1UKPA 1HGWA 3MVIA 5BU9A 3QM3A 3PB0A 1YYAA 2YZ5A 3URQA 3CK5A 2V67A 4FOJA 4HOWA 4Z1YA 2VFGA 1TPB1 3KBSA 5D8WA 5D8ZA 2QULA 1GQLA 1IWPA 1VEPA 3NQCA 3MUY1 3QQWA 3UJSA 5BXPA 2VWTA 4GXWA 4W7UA 1R3WA 4GC3A 4XAGA 3HFYA 3WH9A 1V7YA 3M1ZA 3O2LA 5A6JA 2VWSA 1MRAA 3ITCA 2P88A 4IMEA 3VD9A 4IPJA 4FHAA 3QGVA 3WQPA 5C55A 2VCAA 4GISA 3WLTA 1G4EA 4AG0A 4D2JA 4TMCA 5F1UA 2AQWA 2Y89A 1GTEA 1WPCA 3FA5A 1VCGA 3VABA 1O4UA 2PWUA 4JHMA 5HMFA 1PZ1A 4B5VA 1KCLA 3W02A 3CC1A 3KL5A 3ZR6A 1EP1A 1R3SA 5KTLA 1RA0A 2BS9A 2PRLA 3T05A 3DKLA 1RVGA 4JIQA 2PI6A 3CLMA 2J62A 1QVBA 4NY2A 2PCQA 5DCEA 4UUIA 3SDOA 4R33A 2WJZA 1BF6A 4WR3A 2VEIA 1KC7A 4LH8A 1HKJA 1Z32X 4IPIA 1OGBA 3TW9A 3W7HA 3GQYA 3OPSA 1TPC1 4X63A 3LHYA 4AMCA 5GNXA 2DIEA 5H8UA 1TMQA 3COTA 3CIXA 1W0MA 1P7TB 3USZA 2QUVA 2KAUC 3DC0A 1FWCC 3O7UA 3CUXA 1TO3A 2Z4GA 1SVDA 3EXRA 5KETA 3NVTA 1PXGA 1V8EA 3MMTA 4W8BA 4CD5A 3NAVA 4NRRA 4AHPA 3VGHA 4DLFA 1JL8A 4KMQA 1GHRA 3FN9A 1SW0A 5D05A 1GPFA 3ARTA 2PTZA 1TPWA 6A3HA 4FNRA 1JDEA 1H49A 1O68A 4CNTA 3EXTA 3VUSA 5KZMA 4YTTA 3LRLA 4GYKA 2NVAA 4XBSA 4GXMA 4PN2A 3DIPA 4BEQA 1BGGA 3BQ5A 3LBCA 3QRHA 1KB3A 4E2OA 2QGHA 2AMGA 3ZOAA 2WPGA 4JTQA 5D2VA 3S2CA 1WOBA 4B3LA 2ZZ6A 2OJPA 1SJCA 1YTKA 3GX9A 1GGOA 1GEQA 3SEPA 1XINA 4H6EA 9XIMA 4Q32A 4PSRA 3B8TA 4R7WA 4FR6A 2PWGA 4ZL1A 4QITA 4M0XA 3UCQA 3KTXA 1OJXA 2C3ZA 3NOEA 2PWDA 2BHYA 3WLOA 5EMKA 1J0ZA 5CSRA 4ZTYA 2NUXA 1DXFA 1UD8A 3FVDA 4QP0A 3SQSA 1TCMA 1M3UA 4ZQNA 3SRDA 3AALA 1XX1A 3BOXA 3F4DA 4P8XA 4B4FA 4CNOA 3OZYA 2HCVA 2QV5A 3MP5A 3AHTA 4DZHA 5BNKA 5EY5A 2C7FA 2D2JA 4TMBA 4G7EA 4R27A 3F4NA 4UFJA 5CLTA 5K4ZA 3CV7A 2FZBA 3IUHA 5AYIA 4S2CA 3TZFA 2WNQA 5EBAA 2Y70A 2ZA2A 4FXJA 4OV4A 2P50A 2PWEA 3P74A 3PSVA 2X0SA 2F6UA 3R1ZA 4CKQA 4NYYA 4EXBA 2X16A 1RHCA 4KFNA 1W9VA 1DHPA 4DPPA 3W2UA 2PZ0A 2V2CA 7CGTA 4RV8A 3AXHA 2YLAA 2J4GA 4AIOA 4EPDC 3WF3A 1SZNA 4IMFA 4MY9A 1BSIA 1H62A 3WDRA 4F66A 4C6MA 1C8VA 1XFCA 1GWJA 4N4QA 2R6OA 4LAZA 4N9DA 3MWCA 4CGTA 1O1ZA 1TQJA 5G5IA 1ITUA 2FVMA 4W5ZA 2QCNA 2QVNA 2O4MA 1J0KA 2AMXA 3MTWA 1ME7A 4Y9MA 1NAL1 1C3FA 2FB3A 2ZZ7A 5BOEA 5I3IA 2OGJA 8TIMA 3PPGA 2X1SA 1TV8A 2YXGA 5KMYA 3GXFA 3VZYA 1FWGC 1Z41A 3MSRA 5F4XA 4YYFA 5FJRA 2GWNA 2PBOA 1H0GA 1CXIA 2OZ0A 2RUSA 3LV6A 4JFVA 4Q4SA 2GK1B 1EO7A 4NAEA 1KXHA 3NGJA 4GJJA 3VA8A 1VD6A 2AGKA 1ZCCA 5T9BG 2PU0A 5HR7A 1PYFA 2DZAA 3K30A 1QI3A 1WA3A 4V33A 3T09A 3W1AA 2CFFA 1BTCA 4L4PA 4CQBA 1P0NA 1WDPA 3ITXA 1AK5A 2QPSA 1I2OA 3ITTA 3WQGA 1XYCA 3BARA 2WHJA 2OYKA 4IG2A 2HNEA 2OB3A 1M9HA 4FX7A 1WBHA 1H09A 3LXCA 2AKZA 4KGJA 3UZJA 1JR1A 2VT0A 4EP8C 1JI2A 3HGOA 3ZSTA 4BWLA 8A3HA 3T0BA 3CPRA 1JAEA 4NJKA 1EFZA 3CU2A 2VL4A 3GDLA 2ZX9A 2Z1VA 1RH9A 2VC9A 3BC9A 2XINA 2OYLA 1R85A 1RCOB 3WFLA 3GFYA 4DJDC 3KBVA 4S23A 2PAJA 3UZYA 1U5HA 1P6BA 4BHYA 3W37A 4MWAA 3T2OA 1VJZA 1J01A 2D73A 1HG3A 3VUPA 1GOWA 1TJRA 3LCLA 3WQDA 2V82A 4R3UA 2CCRA 1ZZMA 5JIPA 2R24A 1E6SM 3MP3A 3EA3A 4AD0A 2QUUA 4I9AA 2YGYA 3S47A 2GJNA 1W1PA 3IRDA 3O16A 3M64A 1DP0A 2NSOA 1R3TA 3CWOX 2E9MA 3TLLA 4MDPA 2I5QA 2YA2A 3NZ1A 3WH8A 4PH6A 4HIBA 4I5RA 4LX4A 1AL8A 4PB5A 2Z2UA 1V3MA 4K1WA 1BTMA 4HJFA 2H3BA 3QZAA 5TD4A 3A9IA 3NTYA 2QJHA 5XINA 5HQEA 1PAMA 2OQHA 4M51A 3U48A 3B0XA 3DFOA 2YKKA 3TH6A 4IHCA 2WMHA 5CPMA 4JQ2A 5SWUA 1FWNA 4AEFA 1CXHA 2QJJA 3NPWA 5D03A 4AZHA 2HBVA 3LK6A 3N2OA 1J96A 4S3DA 1VFLA 5CGQA 3P62A 4H4IA 1AMYA 4B5XA 2ZTKA 4XZNX 5REQA 4U2ZA 1TG7A 4PRRA 1V77A 5DXXA 3OP2A 2VGFA 3RMJA 1YIXA 1ZJAA 4LEQA 1G69A 2HE8A 4HPJA 2OXNA 1GQKA 1XBYA 4M7SA 3NEVA 3ABXA 2YBTA 1GKPA 3AMCA 4LRTA 2JK2A 4EPKA 4C65A 1JUKA 1Y65A 3LHWA 3EDEA 2Q6ZA 3GBDA 3FS2A 2TODA 3SURA 2EJ1A 1W9DM 4DUXA 3M0XA 3GC5A 3EOOA 5CAHA 4MJZA 4IL0A 3ABRA 4IFKA 4MB1A 1EKOA 1UWIA 5A94A 3NQEA 1WXJA 1F07A 3HPZA 2C0AA 4TR9A 5A95A 3QVQA 4RDWA 1KTBA 1KCKA 2VX7A 1E72M 3OIXA 3E6EA 4BA0A 3CT7A 5LIXX 1GVFA 1F6PA 5C2GA 2Z29A 2J9ZA 1SGJA 1I0DA 4E38A 2PDNA 2LLEA 1UQYA 3WD4A 1I60A 2H6RA 4XSLA 1E6PA 4XZWA 5I5RA 5LA1A 3TAKA 4ZEPA 2EKCA 3BZGA 1XKJA 3BAIA 2ZRUA 3BOLA 3U3HA 3O6YX 3N25A 5I3FA 3HTWA 5AN7A 1P5BA 1BWVA 2FZMA 3PUOA 3QEZA 2H3DA 1PJ9A 3M5XA 3OTRA 3DYPA 2BOFX 4J27A 4GI8A 3R7MA 2VKZG 1N55A 1WDQA 4MADA 3URAA 4YIWA 3W2NA 4HMDA 1EJTC 1Q6QA 3MMUA 1U30A 3FJ6A 1T96A 4HA1A 2HPMA 1ZB5A 2I57A 1LDCA 2DP3A 2EGZA 3UJ2A 1VPXA 4LEFA 3B0PA 5LGZA 1OD8A 1JCNA 2QCDB 1MXSA 5H91A 3R4IA 1RBOB 1W1TA 1KM1A 4IJBA 3LPOA 3V4BA 3RCYA 1VFSA 1XICA 3RDKA 5FL1A 3KOZA 3LCHA 1E70M 1DTUA 3O8AA 1SZRA 1LROA 2NT1A 5GJMA 5E0FA 4K39A 1YNQA 4JTCA 1RQBA 3FW6A 3VDBA 5H8MA 1OCBA 1XGEA 3O6AA 1XSKA 1UKOA 1O5KA 2HTMA 3GO2A 1V6TA 4C7FA 2OWXA 4DYJA 2PE4A 4RDVA 4GCXA 4H9XA 4U10A 8RUCA 3WLKX 3KTCA 4CD8A 4BK9A 1DTNA 1HX0A 1UZ4A 4MNKA 3LEPA 5D32A 4JOMA 5HMDA 2V5BA 3VD7A 5T8GA 3KOWA 4G5DA 1UC5A 1KKRA 3MHGA 1ITCA 2PWFA 5C5YA 3OHIA 1R30A 3AS2A 4W89A 2VOMA 3I7SA 4R34A 3NL5A 2JF6A 4H04A 1UA3A 2DZSA 4PODA 4Z1CA 3E74A 4M81A 1BGAA 1G5AA 4QDWA 4H6RA 5DMLA 4LBRA 2C19A 2Y61A 3CUJA 4GI9A 5DT5A 3AIUA 4XUGA 1EQPA 3LD5A 4GE8A 3LXBA 1GKRA 1KBKA 2V63A 1W1A1 3APGA 2XZ9A 3ES7A 1YXCA 1G4SA 4IOTA 5GVJA 4KKXA 1PKNA 3OA5A 5DF0A 3BJFA 2WC4A 3V3WA 3ALGA 1P1XA 4H6QA 3TYBA 4PE8A 1B5TA 4WXYA 4GZEA 4LBSA 1PX8A 1WBJA 4GYFA 3O6CA 5C9RA 5ABGA 1GOMA 4O8RA 1HL2A 9XIAA 3B97A 2YDAA 3V5CA 3JR2A 5HNNA 2R1LA 1GOIA 1FTXA 3CO4A 3QTPA 4JTHA 3JW7A 2V9DA 3QHMA 1V3IA 4O17A 5I3KA 2Y62A 5TQLA 4O4VA 4QDMA 3VKDA 4IZGA 3QQ0A 3C61A 4D8AA 3C2EA 3TTEA 1Q6RA 3H54A 6REQB 4JPGA 3BSHA 1OK6A 3RM9A 4R7OA 3V1PA 4AFYA 1ZAIA 2J13A 3PWIA 3PTDA 1A5LC 2CITA 2YLLA 3GHUA 2VRQA 2HPIA 4RZ6A 3AU2A 3PZVA 4GVFA 2YCLA 4EPEC 4F0RA 1WDDA 3T78A 1U1HA 1HKIA 4YHGA 3P61A 2X2GA 1KBBA 1LL7A 4QNWA 5I77A 1UMYA 1V3KA 2OKOA 4NG3A 4JDYA 4CEXC 2WVVA 4FNUA 1Q65A 3AO0A 3DG7A 2ZX7A 4ML4A 3QQ1A 1L6YA 3W7PA 4I8YA 4TX6A 1CXFA 3KRBA 1QRQA 4JIIX 3PBVA 3E0LA 4UFIA 3L21A 5BOOA 3ALFA 1WKDA 2XGIA 4PUMA 3QY6A 4MJMA 3DEQA 3L66A 2CEQA 1PZ2A 4JQ1A 1F73A 1DWHM 3AZRA 1UH2A 4IUGA 1H1NA 4ZFCA 1QW7A 1KM2A 3W4RA 1E6RA 2ZWYA 4GBDA 3IEBA 1RQEA 5C0QA 2E8ZA 1OFAA 1VBHA 2YA0A 1V3JA 3MPGA 4YWIA 3OYZA 2OLAA 4FA3A 2A3AA 4O1BA 2ZADA 1SR9A 3USBA 1QPQA 4CNNA 1NQ6A 1Q2SA 3MSGA 5HMSA 3EOUA 5IRPA 3TVAA 3HQNA 4GLEA 2YOCA 1R9XA 4W86A 5A2CA 1A3WA 3FAXA 3WQOA 4ZGYA 3CS2A 2OEKA 3OBEA 4NJJA 4GYPA 1PTGA 2A21A 4FIQA 5LYRA 3PFMA 2VTFA 1YPFA 3O0KA 5DRIA 3NL3A 2OR2A 3NZPA 3FYPA 3V75A 1ISYA 2HISA 1OABA 2HK0A 3HGRA 4ZBCA 3UJRA 4HJWA 1E6ZA 1SSDA 2D20A 5EMMA 3B4UA 2CYGA 3GVVA 3AIVA 3SO7A 1UC4A 3M0YA 1MFVA 6PTDA 4AIUA 1YTEA 3TWAA 1DVJA 2WSRA 5FJOA 1WZLA 1ONWA 1IGWA 3L5MA 1IZJA 1VF8A 2QNEA 1XIJA 1C9DA 3WMLA 1HKWA 5DBTA 5I24A 2NZLA 2IPWA 2V3EA 3TC7A 3M0VA 1JCYA 3PC0A 1W1B1 2GZXA 3NQ8A 1VHNA 3MANA 2YJQA 2B7PA 3MWAA 9CGTA 3PF3A 2POTA 4IM4A 3DHUA 3MMDA 3GW0A 3OG2A 4W4QA 1C93A 2ESCA 4ZCWA 3GC2A 1NOWA 2QCLA 3ZLHA 1JCTA 3IGXA 3UWZA 1GZJA 3RK8A 5IXEA 4YVVA 1UUQA 1B9ZA 3B8IA 3N3MA 2W27A 4D6CA 3W1TA 1Y5VA 3H70A 1L2QA 3M16A 5F2GA 1KRMA 3AYSA 1NP0A 3QN3A 5JXQA 1YPIA 1JI1A 3QTGA 3P2VA 1XLBA 3LUTA 4C6NA 1IXNA 5HOSA 3UR2A 1Q7MA 2WAGA 1WX0A 3IIOA 5G1MA 1BRLA 1WZAA 4J2PA 1POKA 3OQ8A 3SY1A 1H7PA 4I6VA 4WGHA 1NIUA 4GACA 3VINA 4KWSA 3E3HA 4C6JA 1OVDA 2WHLA 3PZOA 3BTNA 1LTDA 1WKEA 3MY9A 3ECQA 1BVZA 3A4WA 2PGEA 3S0CA 1OCQA 4X3ZA 4LVBA 1S3HA 5FA5A 2WJFA 1PDZA 3GH7A 3QMSA 1W5PA 2BXZA 4EANA 1W8GA 1EEPA 3TN6A 2YBVA 2ZKMX 4BI6A 4V1XA 1WZMA 2NXIA 1KTCA 4C1LA 3LB0A 3W27A 1YDYA 2XWEA 4G6CA 5D4YA 1EPVA 5KZDA 4GO9A 1R47A 1PKLA 2ZDSA 1JNEA 4GK8A 4MYXA 2EPOA 3NUKA 3OW1A 2CLIA 3WNNA 3DFYA 4QJ5B 1N8WA 3QR0A 4O1EA 3W88A 3IJQA 3RX2A 4CEUC 1B30A 4F8XA 3ABQA 2A3BA 3LM7A 2WZHA 2I9UA 1W5MA 3TOYA 5FSDC 3WNOA 2FFCA 1O94A 4WJ8A 1HP5A 5AHLA 5D9MA 4RZ4A 1X96A 4ZQMA 4X22A 3PJTA 2PF8A 4JS3A 5BYWA 3WY1A 1PDYA 3L7RA 4Q8NA 3LCIA 2HK1A 4LUTA 2NT0A 1EWEA 1VIWA 3DKJA 3WNKA 1B2YA 1BHGA 3MUZ1 4O0KA 5IFTA 3TIMA 1M65A 3PBYA 4WZHA 2I1OA 3HPAA 1JPKA 2CZFA 3GVRA 1LOSA 5CPNA 1XSIA 2DGAA 3N6HA 1EJXC 3FA4A 2EEXA 3NM1A 5HQMA 3PZMA 1UD2A 1F7BA 1WUEA 3SGZA 4N0RA 2ZXDA 3WDQA 4W7VA 1WDWA 4LALA 1VB9A 2Q8LA 3EDKA 2UY5A 4JTAA 1THFD 4CLMA 3HMCA 2D3LA 1WXZA 1A5BA 4K7YA 1UCWA 3GHRA 1OEPA 1XLEA 4LXFA 2C1HA 2J6XA 1EGMA 3N4FA 3A4JA 2GJLA 3SGUA 1BFNA 3FX4A 4XUYA 3GLCA 1TELA 1GZGA 1JYXA 5U7SA 1JCLA 4HOZA 4PCPA 1AZ2A 4I8DA 2NUWA 4JHZA 4FX8A 3VOHA 4K3ZA 4YJ5A 2Y7DA 5IDZA 4NJIA 2DSUA 1TA3A 3UPBA 1YEYA 5AHEA 2I14A 4JR5A 3TLQA 2NQJA 1HN1A 4N9BA 4WKAA 3M0MA 4E2DA 2Q8ZA 1NSJA 2ZRWA 1VKFA 3SRFA 5JVLA 7ENLA 3VOFA 4JTUA 4KRTA 1E0WA 2EG6A 4GFSA 3FDKA 1D9EA 3ZR5A 2GQ8A 1I2NA 1QPNA 2OSYA 1ODZA 3UWVA 3S5OA 1RBLA 4O1CA 2GJXB 3GXMA 3PZGA 2DIKA 4B5SA 5CPOA 1O12A 3BW3A 1OCJA 3GU1A 1TTIA 4LNCA 1EJSC 5HJXA 3BG5A 5E5CA 1N82A 2WPBA 4PFMA 3A5VA 1OQFA 5I78A 3D5HA 3SJ3A 3W00A 3WF1A 4V15A 3WLJA 3M5VA 3VGBA 5EB8A 2A3EA 1FWBC 2CWXA 3P81A 3UWEA 4QNEA 2ZCGA 4NNAA 1NY1A 3NSXA 4O54A 5LNWA 3HV9A 2QCHA 2XH0A 3CNYA 4P8UA 4ZMGA 4CQCA 3RF9A 3UWQA 3GTXA 5K9CA 3QKEA 4YMZA 3HQOA 4TVUA 2DZXA 3BGGA 3EOLA 3FKRA 5GJNA 1FWAC 4GZJA 1A5UA 3MJYA 1KTNA 3B8DA 1NQKA 4DBDA 3H8AA 4A3HA 3WNLA 1V6WA 2DPEA 2AL2A 3NPUA 1K02A 3TYDA 3B40A 4WSJA 3LMYA 4HN4A 1UP3A 1VRXA 1K9DA 2P0OA 2ISWA 3PG9A 5TF0A 3UZXA 1X1NA 4QSHA 4EX4A 1JEZA 4LJ3A 3WDJA 3WNMA 4G56A 4JTFA 3T6CA 5AOUA 3OEXA 2BVDA 1S2UA 4DJEA 4KWVA 4RW3A 3BOFA 1G6CA 1HFBA 1H7NA 1UIOA 1TTPA 4FXRA 2GDQA 1ZALA 4ROQA 1KWKA 1E73M 3H23A 1MUWA 5A3HA 4KCWA 5CEWA 2OOGA 3YPIA 4UTFA 1E56A 3Q37A 1W37A 4UQDA 1K70A 1JRBA 1MMFA 2WM0A 4H6KA 3ZJ8A 2XISA 2ISDA 3KX6A 3CIVA 5MKGB 3A3WA 1UUMA 3G77A 1IWBA 2QMJA 3NSMA 5EMJA 1A80A 5E6YA 3E0WA 4KQNA 5U4NA 5DRCA 1NWUA 3H55A 1FBAA 2X2YA 2X40A 1AW1A 4PFHA 2XSAA 4JTTA 3EZ4A 3W7GA 1EH9A 4NSBA 3FEMA 4DWSC 7TAAA 2NX9A 1BKSA 4GH3A 1YNYA 3NVDA 3CZKA 2XIQA 3BMVA 2I56A 2ZVRA 2XGBA 1VBJA 1CEOA 3HIJA 3EA2A 4UR7A 1V6XA 4B15A 3UNDA 1G67A 4W8LA 2AAMA 2YR1A 3VIOA 3TYEA 1NDYA 4UC5A 1E1CA 3MO4A 1QOXA 1PVNA 5CZSA 1B1YA 2WV8A 5IM51 3KFTA 4O4WA 3BAJA 4IIHA 5LHEA 5LGXA 1BSLA 2DUXA 3HPXA 2O9TA 3VNMA 3GR4A 2AQVA 1SO4A 1H11A 4Q4OA 3RITA 1FP8A 1PPIA 3LHZA 3LHTA 3DECA 4AZCB 4RE2A 1OK4A 4GVIA 1EUAA 1XYAA 4H7CA 2GVLA 1F8MA 1ZHAA 2GGHA 2XSXA 1J12A 4UB9A 3VCRA 2V5DA 5DT7A 4K68A 1REQA 1OZMA 2X1IA 3E38A 5ABEA 4YTUA 3V35A 4CN6A 1BLIA 1EZ2A 3OBAA 1XSJA 1LWIA 2IKIA 3QW4B 4K38A 2P8BA 2FPTA 4GIRA 1SW3A 2WC3A 3K8LA 1I9CB 3W71A 4X0NA 2EG7A 2EJAA 3MSDA 1TVLA 1J8VA 4C6LA 1DQWA 3W22A 1OBAA 1GQIA 1ONEA 4OQVA 5E1QA 3ID7A 4FPSA 3RU6A 3SN1A 2V30A 4XV0A 4QG9A 3VOGA 2JE8A 4KERA 2Y7FA 3U7BA 2QIWA 2Y8VA 2EPMX 2ZUMA 4KRUA 4RE3A 3WLSA 4PUWA 1QASA 1EIXA 3B4YA 3H7RA 3T7VA 3G6LA 3BG9A 1UHVA 4Q4MA 4HYVA 3P84A 1HJWA 1BKHA 3RILA 1OINA 3SIZA 1O5RA 1OT1A 3PJWA 1BVWA 4JN6A 1WZKA 3ITVA 1UPPA 2Z25A 2CWNA 4LVAA 4JEQA 3UVAA 2GOKA 3DYMA 2ONEA 3GIYA 4TIMA 4BF7A 4HKPA 1GQNA 3TCEA 3BMWA 2VEFA 3MA8A 3PG8A 2JQXA 3KZSA 2VFDA 3OA3A 3S1VA 1XLGA 4GA8A 1LUCB 3HJZA 3ZLGA 1CDGA 1YDNA 3BLPX 3RM8A 1P48A 3JU2A 4HHPA 4IH3A 4HK5A 1AQFA 3ZMRA 1RA5A 1BQGA 3GM8A 3ITGA 3CZLA 3NQAA 1GK8A 4S1FA 2FLIA 4EWJA 1Q6DA 3QMRA 2Z7KA 4BJHA 3C8NA 4BKNA 3LI1A 4PUEA 2DUZA 3GB6A 2J8GA 1JRCA 2PDLA 3EX4A 5G1YA 4IIBA 2WZMA 4E4PA 1J2WA 3HQ1A 2NQ9A 1RQHA 1XLCA 2VUYA 3WF0A 1X1OA 2F38A 3BGAA 3GBEA 1W1IE 4BS0A 3NL2A 4D6HA 2E09A 1OGGA 1BEUA 2YSWA 3KWXA 5BRBA 5JMUA 3WH6A 4MVAA 1GT8A 3A4XA 4WXZA 3RLUA 3THUA 2XIIA 1BVNP 3KLLA 4Z1BA 3WLNA 3R5EA 4LAMA 4GOAA 4MY8A 4GQBA 3DESA 4A3UA 1QNVA 2PRMA 1B4EA 1UZHA 1XH2A 3T4CA 4J7RA 1JZ3A 3A47A 4I5UA 3CWHA 3ISIX 2V38A 1M6JA 1EYWA 3UYIA 2GUYA 1NOUA 3RLGA 4QSFA 3NA8A 3TJXA 3O15A 4RNJA 3PFRA 1Q5MA 3MMWA 4NUWA 3NSNA 3PVFA 3WQ6A 3FGCB 1KR1A 1O6IA 3TJLA 1B3ZA 2E5BA 3R2GA 2VRJA 4LGXA 2E5CA 4FAMA 4ZR8A 3FHAA 4GZIA 3ES8A 1KGWA 2H8ZA 2ZX6A 4GO8A 4I90A 2QAFA 3U57A 4OUEA 3IVUA 1VLIA 3WJSA 3KAOA 2IUZA 3CL6A 4AY8A 4GH1A 4LU0A 4UCFA 1VPQA 3MP4A 3TEVA 3NL6A 4XISA 4XB3A 1NF7A 3WJWA 3S2LA 5HWMA 1ADOA 4QGCA 2OOFA 1EEXA 3HM7A 2OLSA 1QWKA 3HGSA 1Q85A 1KGUA 3KCOA 4IQDA 4JIRA 5B7YA 2C79A 1J5TA 3BE7A 4GY7A 2ZXBA 1E9IA 1Y8BA 5AVNA 4PRTA 5BU6A 2A7PA 3NZQA 2Z2BA 2BY1A 3BJSA 2BZNA 5I79A 1LYXA 3WFZA 3PZ9A 3NOYA 4DJFC 3DFTA 3PZNA 4AY7A 3L0NA 1F2JA 4O57A 4R88A 3WEMA 1HVQA 1TCDA 1TTJA 1LT8A 3IAQA 1HXJA 2WMGA 1FDZA 3ZXWA 4PB4A 4GC4A 3MI3A 5LXXA 4UR9A 4Q6JA 5PTDA 4YLWA 1VR6A 1Y5XA 4EOUA 5E0CA 2WBGA 4DI9A 3MI6A 4WLCA 2BVTA 3GYEA 4E8DA 3U2ZA 4S3AA 3DFHA 4PMNA 4UFLA 4DYKA 1OX4B 1QNPA 4Q8UA 3QV7A 3ANUA 4HPXA 1XBXA 2DT1A 4ML9A 4AUBA 3H4XA 4I5XA 2PDWA 2FPYA 2PDXA 1GVSA 3WD2A 4FP1A 1ZP3A 1L9WA 1VFMA 2KX9A 1CB2A 1EDQA 2CBVA 5D9OA 1E6XM 1FXPA 4YN5A 3W7LA 1H3GA 3MHUA 1CNVA 5CSUA 2E8YA 2D24A 3WK1A 4GQQA 3OVGA 2VGGA 2F61A 4WF7A 1MSSA 3ZLFA 2BMBA 3I65A 1UPMB 3GH4A 1JPHA 2CHRA 4LWWA 1GNXA 3M9YA 3LHUA 3CZEA 4HYWA 4ACZA 3IUIA 5M17A 3FVMA 5EFFA 1XI3A 3M44A 5DELA 1BXNA 1C91A 3HF3A 3ORWA 3TFXA 1K7XA 2CZEA 4IQEA 4UNKA 1XPYA 4DAIA 1GYMA 4W85A 1LT7A 1YBQA 4QLKA 2VEGA 3DI0A 4O13A 4XZMX 4B9ZA 5JU6A 3RPDA 4JIHA 4KWWA 5A6BA 1QXLA 1BYCA 4U4MA 2X8RA 3WQEA 1M7OA 2F6XA 2ZC1A 3NR0A 2VEMA 5E9XA 7REQB 4GY0A 1V03A 3T44A 2R9RA 1J4EA 1YNPA 3OGRA 4Y2WA 3W7OA 3MDUA 1Q6CA 2TPSA 1LL4A 4X2PA 1EB3A 3W3OA 1OFBA 1XBVA 4WEVX 4TVDA 2CLFA 3K2GA 3A5FA 1VGAA 2J79A 3CAVA 3W53A 2ZC8A 1D7FA 2RGLA 2O9RA 2ZICA 3RO8A 1BG4A 3W85A 5FSEC 5CBBA 4OBTA 1CGVA 1UMLA 2NUYA 2RH9A 3KP1A 1ZJBA 2XN1A 4TO8A 3A24A 3E96A 2ZUWA 3QKZA 4IWWA 3FLUA 4L61A 4MG4A 4NAFA 1SZEA 4HA0A 1A5OC 3TQ0A 1Z6KA 4XBKA 3LBMA 4KBXA 4OOUA 4AHOA 3H7UA 4E4FA 1C9WA 1ZLPA 3KVKA 3PM6A 1HIZA 5A6KA 2J7GA 1E9ZB 4AYSA 1KXTA 3S9IA 3WD1A 2WCGA 4F40A 2GK1A 5C2CA 1TV3A 3G3DA 5ABHA 1US2A 2W61A 3NXLA 4RCXA 3GG0A 4PMXA 1HKMA 4M6UA 4GGHA 5TAOA 4ZENA 1TMHA 2JEPA 2Z0IA 2CLEA 1QI5A 3LLXA 2GQ3A 3K8MA 3QV6A 4B16A 4WQ6A 2PDBA 1W56A 2V2DA 2O56A 4H9ZA 4S3JA 3CZ8A 2O92A 4U2YA 2X05A 4MZYA 4HCHA 4Q4KA 4X60A 2PF0A 3H2CA 3BLOA 4MJ4A 3B9EA 5LIKX 1KFJA 2BXVA 1GOXA 1KD0A 3AMGA 3TC3A 1CI1A 3W6MA 1CBGA 4UFKA 4PYSA 3SCSA 4KT2A 2QQ6A 1OIFA 5C71A 1GVEA 5KEZA 5F4SA 4H9VA 3BL3A 3VXGA 2OELA 3F1QA 3OVPA 3GK0A 4DEFA 1GJUA 4ZSTA 4CU7A 2QIIA 4H1ZA 1F3EA 4TV5A 1MO0A 3IACA 3T81A 1Z89A 4O52A 1GKQA 1TIWA 1YDVA 3CXOA 4HNLA 4BCEA 1XR2A 1Q6LA 2PEVA 4J1OA 2QAPA 4D6GA 2FGZA 2PDCA 3TJIA 2CETA 5BWFA 3UA4A 2V3DA 1ESWA 1XUUA 5AVHA 4I7WA 4AIBA 4QJ4B 3PPHA 4IXXA 2Z24A 5I3DA 2HBXA 2X09A 4IL2A 3K13A 2PP3A 3T07A 3EWYA 3BICA 4AVFA 1K1DA 1UR0A 1XL9A 4L9ZA 4A8NA 2BGSA 3ZIZA 4IP7A 4YTSA 5F7UA 3J7HA 2J9YA 4IF2A 3ZVIA 1DWFM 3KUMA 3AYVA 4O12A 4INFA 3N3TA 2PDGA 4AHQA 4C90A 4HT3A 3UR8A 4DI8A 1A5KC 1JUEA 1V3LA 1W5NA 1JZ6A 1O7AA 2A0NA 1QU4A 3URNA 3CEUA 1YLVA 1J18A 2XGZA 1JQXA 3WYZA 2EG8A 5FIPA 2KZHA 3UBPC 4MNLA 3PZTA 1XISA 1TVNA 5F4WA 2G0WA 2JIEA 2XFWA 2NQHA 5F1VA 4M7TA 1CGYA 2FMOA 3T8QA 2Z1SA 3E1F1 1MW2A 5CZTA 1G01A 4QE5A 4NQ1A 2CBUA 3L12A 2EBNA 1AMKA 1PUDA 3C2VA 3DYOA 3ERPA 1ZNNA 1SJDA 4FEZA 3VI2A 4C60A 4K1GA 2ATSA 2BTMA 1W2VA 1J2BA 4Q8WA 3ARXA 3A12A 2DSKA 3QYSA 2C71A 1TIMA 2PLCA 4TVCA 2ZUUA 4KW2A 1QAPA 2ZVIA 4N6FA 2QCFA 1C90A 4D71A 3WQFA 1UROA 3UETA 1NEYA 3H2NA 3KVMA 3WELA 4JYFA 1XPGA 3KRUA 1DORA 4PMZA 1Y5WA 1JPMA 4NL1A 5DY2A 2OZ3A 3F2BA 2QT3A 1P4CA 3L4ZA 2QJIA 4D1JA 7ODCA 5K4XA 2Y63A 3NM3A 3WD0A 4XSMA 2XHYA 3BO9A 4HB7A 4B2DA 1EIBA 4E6MA 3G8EA 1HW6A 2ASHA 3TN3A 2PGRA 3LGEA 4QQ3A 3TDFA 4UQCA 1B57A 1IT0A 1C8QA 1VYSX 3UESA 4LFYA 2DSWA 4ASTA 1Q8AA 1Z42A 3B8SA 1ISWA 1IT7A 1UJQA 1FA2A 2F7FA 2A3LA 3ITOA 1JD9A 1UKSA 2DVTA 3MBDA 1KO0A 4IT1A 4HU4A 3B8WA 3BLDA 4L4LA 2XWDA 3VYLA 4F0MA 1LWHA 1KM5A 3GVQA 5B80A 4CU8A 2X42A 3EWXA 5AC7A 1SU5A 3SJNA 2XUCA 1QO5A 2JKEA 1Z7AA 3BURA 3CV1A 1CZ1A 5A6BD 5AB3A 3R6IA 5H1WA 2QCDA 4Q8TA 1RD5A 2CLPA 3TYAA 5D9NA 3MS8A 4KWUA 3GU9A 4EIVA 1DEDA 3LZ3A 3FDGA 5FF3A 1A5NC 2FDSA 4JKKA 2G3JA 1GVQA 1QI4A 3PWAA 3M5YA 3GUWA 5TBOA 3S6DA 4EACA 1VBGA 3A9BA 2X0YA 1XFBA 3HO8A 1W31A 1KFLA 5CJNA 3VO0A 2RDWA 1YTDA 1MZRA 2CKSA 5ECVA 1HUVA 3CO8A 1K8YA 3E2SA 3UF9A 3W83A 2PWVA 1SYTA 4NHVA 1HL9A 1DJQA 4AD4A 3CYJA 2GDVA 1V02A 1VFUA 2ACSA 3D3FA 4BI5A 5K3VA 1Q6EA 4O8AA 1SM9A 2ZQ0A 5I2UA 4F2UA 2FZ8A 4L6HA 3PSWA 2E4TA 2G5WA 3LN3A 1HGYA 2W62A 4Y96A 2P3EA 2WLZA 2NVDA 3ARSA 1U5VA 1JJKA 3L9CA 4IIFA 2ZTJA 3W25A 4YVXA 1UR1A 4I7VA 3KZPA 3AXIA 3V0SA 3GS6A 5E0KA 1PHQA 1UOKA 4K8EA 3AISA 4QLLA 5AKQA 3POHA 1YMYA 2VCBA 4GYJA 1K3UA 2PTDA 1WP6A 3N12A 3NIYA 1G0CA 3GAYA 1CLXA 3SN0A 2A6NA 4A8LA 3LTSA 4OIFA 3RM4A 5F2LA 2C8NA 6XIMA 3N2MA 3NCOA 3I4KA 3FY1A 1NU5A 3OU8A 2PD9A 3K8KA 1E55A 2PODA 2FVLA 4Z2IA 5CBIA 1V0NA 4BQ3A 4U31A 3S5ZA 1DIKA 1LWJA 2WK2A 1PEZA 2HWGA 1UBPC 3DBNA 4QDPA 3RIKA 2V8ZA 4L4OA 4O19A 5LSMA 3SQMA 4JTRA 1FCBA 4RNFA 3MCMA 1XDJA 3VD3A 1HNYA 4FOKA 1JGIA 3LLDA 3I3EA 2A7NA 5HPCA 2VJXA 3KW3A 1JDCA 4FZIA 4ORMA 2Q3OA 2OTDA 3WX7A 7PTDA 1W9XA 3OYXA 2PSNA 3KWSA 3NEHA 1MW1A 4GMEA 1TR1A 2G3FA 3UXDA 2WNZA 4JKMA 4RR4A 4QS6A 2TSYA 3KCJA 4KESA 3QV8A 3C6CA 4MWAB 3OO2A 3E0VA 1O5XA 4DAFA 2OT0A 2QMKA 1W3IA 4DB7A 4Q8VA 2V2HA 4PMJA 1QR7A 2X1UA 4QX4A 2ZOXA 4UNIA 3TV8A 6ENLA 3NURA 1MFUA 1E6NA 2V5KA 3FYOA 1GCYA 3OJGA 1IXOA 5CGTA 4A3RA 2BB0A 1P6WA 3RRXA 1FWDC 2E9LA 1WKYA 3KDNA 2WKLA 1LP6A 4R7JA 3VKBA 3LI0A 2ZA1A 4UTWA 3TJ4A 4PUNA 3ATZA 4R9XA 2XM1A 2W4XA 1C7SA 4LV9A 4B4HA 1X1ZA 3C2YA 2WMFA 2XH7A 2C13A 1Q4WA 2PDUA 3NZRA 1TWZA 4E2VA 4G1NA 1JIBA 3GC4A 1JFXA 1U33A 4LVFA 3BPWA 3WIJA 3LSBA 4HOXA 1KQYA 3RUBL 5EA9A 3ZO9A 4PSPA 4E3TA 2IKHA 4GUFA 3TE9A 3VKJA 3UPWA 1H51A 3EBVA 4QCEA 1HQTA 4L1XA 4ZOCA 5AYXA 1UR2A 1EPXA 4BZYA 5EU9A 1E9YB 2CXGA 1AQHA 3GDMA 2G4FA 3RRAA 1RBAA 3CT2A 5CQ1A 4NX0A 2X7WA 2D22A 4DZAA 2DZUA 1FWFC 4TOQA 3TOPA 5CJ5A 1JDDA 3LDVA 2Y85A 2BV9A 4HTYA 4LT9A 2DIJA 3HPSA 1OCNA 1ECQA 4DUWA 1TUXA 4WCJA 2ISVA 4IFKB 4B3ZA 2DSZA 4FLQA 5I6SA 4HU3A 4RXGA 2J27A 1UW9A 1UP2A 1GEHA 4B2DD 1BG9A 5IDIA 1SJBA 3EOSA 1KR0A 3W07A 4N42A 3ATYA 1WYIA 3O63A 2BY0A 3A13A 4E8GA 1W17A 4ICNA 4MKSA 3M0KA 1T8XA 5HBFA 4AW7A 2CHNA 3BCDA 3GE7A 1CWYA 1XCFA 1KA9F 3P82A 1R9YA 3XINA 3CMFA 3VKCA 2OZ8A 1XRVA 3MCOA 1EQCA 4IFOA 3II1A 2QPXA 2QW5A 3U4AA 5CH9A 3T0AA 2OO6A 2FFIA 3P8JA 3TR2A 1X98A 3W1QA 2VD9A 3W28A 4A6GA 1SMAA 1PZ3A 3ABSA 1R5YA 1W5QA 2VZOA 1X7IA 1M68A 3UNTA 2GVEA 3UPMA 4V28A 2G4JA 1OFPA 2FGLA 3KE0A 1TB3A 3H2MA 1D8WA 4XD6A 1A0EA 1TRIA 1QW8A 2A6LA 2WZIA 2ABBA 3W7DA 5G2WA 3DDMA 2BVYA 4E2BA 4D6EA 2WBKA 3R8GA 3LU2A 1XDMA 3TYUA 3BCFA 4CVWA 1LRNA 2DT0A 4J3ZA 1BYBA 3VIJA 1VC4A 4HNOA 4S39A 1EC7A 4LQ1A 5FJPA 4Z17A 1OFRA 2UBPC 4ICMA 4OKDA 3UG8A 4IGMA 3TW7A 1IEWA 4LPCA 4AYGA 4U33A 2ZRYA 4GKLA 2PP0A 1J79A 3LRMA 1DE6A 3EX2A 2EAWA 3AHYA 3NDOA 2J7CA 3QH2A 1JZ8A 5I09A 5DO8A 1I1WA 5I02A 4YWSA 3CV6A 3SCOA 2YYTA 4IUOA 2IQDA 4M24A 1YE6A 1AH0A 5EL1A 5EPDA 2J7FA 5FACA 3GXNA 2VZUA 4FOUA 3PTKA 4PEKA 1O1HA 4KETA 4G9PA 4DF1A 4C91A 2OX4A 4PBGA 1RJRA 4PR4A 2XH2A 3T42A 4BFAA 2EXOA 3W87A 4NJHA 5CZ0A 1FWRA 1VENA 4UCGA 1KBIA 2BG5A 2IPGA 2XIOA 4OT7A 1JULA 3GTFA 1JVNA 3THAA 1TWDA 7A3HA 1DJNA 3WEZA 1MEHA 4O53A 1R7OA 4XVEA 2F2HA 4JTGA 3C3UA 4UXDA 3PNUA 3G2GA 5HANA 2WCSA 1MDLA 5I3JA