2ACSA

An anion binding site in human aldose reductase: mechanistic implications for the binding of citrate, cacodylate, and glucose-6-phosphate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
314
structure length
314
Chain Sequence
b'SRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDOSE REDUCTASE
publication title An anion binding site in human aldose reductase: mechanistic implications for the binding of citrate, cacodylate, and glucose 6-phosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 99
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1994-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2acsA00
1XGDA 1ZGDA 4XZIA 2ACSA 2PZNA 3FJNA 2INZA 3R43A 2ACQA 4DBWA 4OTKA 4HBKA 4GABA 4XZNX 1EXBA 3COTA 1HW6A 3UP8A 3UZWA 3LN3A 2PDPA 3R94A 1Q5MA 3CV7A 1M9HA 5HNUA 3O0KA 2PDQA 1QWKA 3V0SA 3V36A 2FVLA 2PD9A 1T40A 3R8HA 1EKOA 3GHTA 4GQ0A 4JTRA 4H8NA 3BCJA 2PDGA 4YVPA 4YVXA 2F2KA 3ERPA 2BP1A 4WDUA 4XK2A 1IHIA 4DZ5A 1AFSA 4DBSA 4PR4A 2PDMA 2PDUA 3WBWA 2DUZA 3P2VA 1IEIA 3R58A 1J96A 5HNTA 5JH1A 3GHUA 4WDXA 1EF3A 1SM9A 4FA3A 3CMFA 2I16A 1PZ1A 1GVEA 3BURA 4R9OA 1EL3A 4LB4A 1X98A 3F7JA 3MC5A 3UFYA 1VBJA 3CASA 4WRHA 2R9RA 1PWMA 3O3RA 1HQTA 1LWIA 3UZYA 2DV0A 5DANA 4AUBA 2PDFA 3Q67A 2IPGA 3RX4A 4XZHA 3T42A 5LIXX 3VXGA 3DOPA 2PDNA 1Z89A 5M2FX 3WCZA 2FZ8A 5LIWX 4IJCA 3H7UA 3H4GA 1C9WA 2IPWA 1T41A 2I17A 4MHBA 1Z9AA 3BV7A 2F38A 2HVOA 2PDLA 1ZSXA 3G5EA 1S2AA 3N6QA 1US0A 1PYFA 2ACRA 2P5NA 3WBXA 1S1PA 2PDJA 3B3DA 3LQLA 1YNPA 2R24A 4NKCA 4XVEA 2FZDA 4RPQA 2DUXA 4XO6A 3G1RA 4QBXA 1LQAA 1PZ0A 3DN5A 4GACA 4HMNA 1X96A 2BGQA 1RALA 3UGRA 2ISFA 1QRQA 2IKJA 4GQGA 4PMJA 1Z3NA 4Q7BA 2PDKA 2NVDA 2HV5A 1Z8AA 3KRBA 4YU1A 3LBOA 2IQ0A 5C7HA 4EXBA 4ZFCA 2HEJA 3CAQA 4XZMX 3LQGA 3EB3A 3UZXA 2FZBA 2PF8A 2WZTA 2IPJA 4LB3A 5KETA 1MI3A 1UR3M 4JQ4A 4JQ2A 1AH0A 1A80A 2HVNA 4Q3MA 2PDXA 2PDIA 1MRQA 1ADSA 4JTDA 3EAUA 3M0IA 4QR6A 1MZRA 5JH2A 4PUWA 2PEVA 3V0TA 4LBSA 3GUGA 1YE4A 3R7MA 1AZ1A 4JIHA 4IJRA 4YVVA 1S1RA 2PDYA 2IKGA 2BGSA 4XO7A 1ZUAX 4XAPA 3MB9A 3M64A 4YS1A 3BUVA 2IPFA 4WGHA 4WEVX 3WBYA 1YE6A 2HE5A 5AZ1A 2HE8A 2PFHA 3R8GA 3LZ3A 4XVDA 2PDCA 3LD5A 4LAUA 2ACUA 3UWEA 4JQAA 4PUUA 4JIIX 1PWLA 1ZQ5A 4G5DA 3M4HA 4EXAA 2NVCA 2ALRA 5LIUX 1XF0A 1AZ2A 2IKHA 4XZLX 4L1WA 3LENA 3H7RA 4JQ1A 2AGTA 3R6IA 2PDBA 2J8TA 4GCAA 3NTYA 3S3GA 2PD5A 5HA7A 2WZMA 4ASTA 3UYIA 3LZ5A 4H7CA 2PDWA 1S2CA 4PRRA 3ONCA 2VDGA 4L1XA 3GHSA 1RY8A 1Q13A 5LIYX 5AZ0A 1AH4A 3LUTA 1JEZA 2IKIA 4ICCX 3GHRA 4JQ3A 5LIKX 2C91A 1OG6A 3EB4A 4FZIA 2INEA 3LEPA 4JIRA 4JTAA 1VP5A 4JTCA 2CLPA 3QKZA 2PDHA 3Q65A 4QXIA 4WDTA 1R38A 2IQDA 3V0UA 4LAZA 2FGBA 4GIEA 3FX4A 2FZ9A 4I5XA 3ONBA 1XJBA 3LNMA 3CV6A 3N2TA 1YNQA 4WDWA 2QXWA 3RX3A 4DBUA 3C3UA 2IS7A 3V35A 4IGSA 2HDJA 4F40A 4LBRA 4PRTA 3UZZA 4FALA 3UG8A 1RY0A 3CAVA 2A79A 3D3FA 4JTQA 4QX4A 4FAMA 1K8CA 1X97A 1AH3A 1FRBA 3RX2A 3WG6A 4GA8A 3U2CA
chains in the Genus database with same CATH superfamily
3HG4A 3CUZA 4OJYA 4AVOA 1YDYA 4JN6A 3BG3A 1ZGDA 2ZUTA 2C1IA 3NPWA 3UERA 1FOBA 2VWSA 3HURA 3GIYA 1U33A 1F3TA 3G8RA 1ISVA 2QGYA 3OO2A 1NP0A 3AIWA 3WLMA 2QV5A 3KDNA 3R94A 2Y63A 2RJHA 4X63A 1A0EA 5DRCA 4I6VA 4N4QA 1KBIA 2HCVA 1RK6A 5CGQA 4DUOA 5E1QA 3B9OA 1EHNA 2X0HA 1EPVA 1VH7A 1VIZA 4P5UA 1V0NA 2CLEA 1CZ1A 1Q65A 4ZEPA 1EIBA 3WLJA 3WUEA 1XGEA 2I9UA 2I9EA 3CZGA 1L6YA 3ARWA 4GVIA 4Q4SA 3VI2A 4UCGA 1YRRA 1E9IA 3KDOA 1XHGA 2FTYA 4BJHA 2C0AA 3DHPA 3IARA 4ZTYA 1UWSA 3PZOA 1NF0A 3WLTA 3CLMA 3AU6A 3W7EA 3N4FA 2OKOA 4HHPA 2A0NA 1TKKA 1WDSA 3CMFA 2I16A 2ZA2A 3CC1A 4JTLA 1KFWA 4NAEA 2PU1A 5CBBA 4FXFA 4KEVA 5EYWA 4D6EA 2FDSA 3OGRA 5BU9A 1ONRA 2A3CA 1HO4A 4JICA 1YADA 1REQB 4S2BA 4NI3A 4QG8A 5DLCA 1J79A 4O1EA 5FF7A 2YDSA 2IPGA 1UZ1A 4DF0A 3OU8A 4LV9A 1LDCA 1ADDA 9CGTA 3UU0A 4BZYA 2CETA 2VMFA 1DWFM 2NT1A 2WSQA 3MSGA 3UXKA 2WHMA 1A0CA 2EEXA 4CNNA 5A6MA 3I3BA 3B03A 2BS9A 3AHYA 6REQB 5EMYA 1PL9A 2OPJA 4QQUA 5H8UA 3TROA 1DJZA 3GFYA 2I17A 4MHBA 5KINA 3CM4A 3PBWA 3MY9A 5AC7A 1TZ7A 2XIBA 2ZZ4A 4UZUA 2WNNA 1P7TA 3T9PA 1V6WA 2ACRA 4IJBA 1I0BA 4F48A 2VRQA 3AJXA 4GBDA 2XJ7A 4HCHA 4Q33A 1EDQA 3NG3A 7TAAA 2R24A 2CBIA 2WKJA 3MHUA 1O66A 1QATA 4HKPA 3PTMA 1CT5A 3U4FA 3SR7A 3K46A 2J25A 3GDMA 4QEHA 3JRKA 2ASHA 1WNOA 4CCZA 3ITCA 2Y8VA 3MPGA 3WNLA 2OX1A 3E2SA 1AW1A 2YCEA 4Q6JA 3A22A 4QCFA 1V0KA 1ZAJA 4NT0A 3RLUA 3SDOA 1IQ8A 3T40A 2EG8A 4RR4A 2WPBA 3KE0A 4KCUA 2XHYA 3EA2A 2ZE0A 4IGNA 3MUIA 5DT5A 4AF0A 4XZMX 3UVAA 1FKWA 2YCIX 2XN0A 1CBGA 3PZ9A 1NY1A 1M01A 3S5ZA 2YIHA 2O4MA 2DH2A 1A80A 2RUSA 1F07A 5FF2A 3SRDA 1JFXA 2OWWA 1B5TA 1M7XA 2PEVA 3EOOA 4LBSA 3CT2A 4IGMA 3U2OA 4XG1A 1BQCA 3FXGA 4DB7A 4YVVA 3BZGA 2ZRYA 3OZOA 4EAYA 4NXSA 3VIIA 4JX6A 1MQRA 3NL5A 2G96A 4XO7A 4Q22A 2GGGA 4C6KA 2V5DA 4K1WA 3UR7A 3WJYA 1B3YA 1KM6A 3OLEA 3W1LA 3U7BA 4F8XA 5G4WA 1Q4WA 2ZA3A 2XZ7A 5IBXC 5A6AA 2HE5A 3CU2A 3L4ZA 3QY8A 3EMCA 3JZUA 4AHPA 1OFDA 3R8GA 4XVDA 3TQPA 2OYLA 4IOTA 3LD5A 2F7FA 3LI1A 4FP1A 4X9SA 5IDIA 1UWTA 5JIPA 2RDTA 4AD2A 1FHLA 4IMGA 1OIMA 4ERAA 1XF0A 1QFEA 4ALDA 1WKDA 2CLKA 3S2CA 3KHJA 3FKKA 1K3UA 3Q58A 1U5VA 1JXKA 3EPMA 4D8LA 1ICQA 3B0PA 3W81A 3EEZA 4RCXA 3A4XA 3PZMA 3EDKA 1SU5A 4PRRA 1HKMA 5D2XA 4ZA0A 4JFTA 5EKYA 1QNSA 1AH4A 3W70A 3IGXA 1J2WA 3LTSA 3SCOA 2UY4A 3GSMA 5A8MA 4EE9A 1TR9A 5HATA 2VVSA 4JTCA 1SVDA 1FWFC 4UCFA 1S5WA 1VCVA 4ACZA 1KCLA 3VC6A 3M5YA 2OCZA 4GIEA 4JPGA 3LBMA 1U5HA 2VCCA 1UOZA 3MP5A 5I07A 4TVUA 3GTIA 1OHLA 5FACA 2IS7A 5B7ZA 3TR2A 3TYBA 3FSUA 3H2MA 2DZSA 3UZZA 3WQDA 4P8UA 3HQ1A 3D3FA 2X09A 2QPXA 1P6WA 5A1AA 5CPMA 2YBVA 2QUTA 3GTXA 5CG7A 3CJPA 3C2YA 4K37A 3M0VA 1I4NA 2INZA 4DBWA 1IWBA 4XZNX 2FH6A 2Y5EA 4C6CA 3QPZA 2TYSA 4S3JA 4LUSB 1E55A 3B8SA 3R5EA 4QHRA 4X9YA 3UJSA 2PDQA 3EMZA 3ICJA 2Z00A 3FGCB 3P80A 3WLKX 3MP4A 3DERA 3REQA 2WMKA 3NPXA 3MZNA 1YHTA 3H21A 2BASA 3M44A 3NZRA 1OFQA 4CD6A 4GQ0A 5IHRA 1V6VA 3W7KA 2F2KA 3N1AA 3NQ8A 3UYCA 2QV4A 1VJZA 1B31A 1IEXA 2R14A 4J3UA 5BRPA 4OBTA 3S2NA 2VEPA 3TTEA 3W83A 1KFBA 1UH3A 3R25A 3JZEA 1Q6LA 4FLRA 1RA0A 3VTRA 1V77A 5AC5A 1RBLA 3W1PA 4LU0A 1U1HA 3H22A 3UFYA 1OY0A 4AZCB 3CASA 1WAWA 3PF3A 2R1MA 1AJZA 2G50A 3VDAA 1MRAA 1TX2A 2Q01A 5CPTA 3CYVA 3TYCA 2Q6ZA 3DHUA 3KW3A 3SUSA 2WVVB 5LHFA 1MO0A 3QHOA 3R8RA 3RX4A 4EWND 2FKPA 2PDNA 4JYDA 1SGJA 1OD8A 1GZ1A 4J2PA 5LHEA 3FHAA 1F61A 2O0TA 1S3HA 1SFTA 5ENLA 2QUNA 1XLLA 1A5NC 1XP3A 2O92A 3I10A 1X8FA 3G22A 1CI1A 3WUBA 2GJRA 3WLPA 1XW8A 3PZIA 4HMEA 5HR7A 3W29A 4XAFA 4NYUA 3UF9A 3B9NA 1PB0A 1M65A 5FI8A 3G2GA 4W4QA 3L21A 5A2CA 4PGLA 1NDYA 5IFTA 2XVKA 4IIDA 4L5ZA 1E5JA 5DMYA 1K1DA 3LOTA 3W7CA 3N04A 4AY1A 1JD9A 3WF4A 2TSYA 3P0WA 2O55A 3SJNA 4DNHA 5FOOA 3WDJA 5TQLA 3NEHA 1QHZA 3VD4A 3HGSA 4XB3A 3AXIA 1GOXA 1OT2A 3RXZA 1IIHA 3TV8A 5G2WA 1EO5A 5ECUA 3POCA 2VRJA 5E0KA 1JUBA 3D47A 2WNQA 1C93A 2WW5A 2ZZ1A 3FA3A 1U2YA 4DO7A 3UCDA 1H50A 3E5PA 3VKKA 4HA1A 5F1VA 1FH8A 3QW4B 4C7DA 2X30A 3NYZA 3SN1A 3HTWA 3N14A 1W31A 3POHA 4FF5A 4PMOA 5REQB 2NLYA 1JAKA 1UC4A 4IL2A 3THCA 4MJ2A 3KOYA 1E73M 1CXLA 2Y4SA 5C54A 2PDXA 3QSRA 5HQMA 4Q4OA 4M6QA 1KRAC 2WB5A 2XIIA 2XINA 4RK8A 3ZT7A 3ZR6A 2NW0A 1CGXA 1JUEA 1P0BA 1XLHA 1BGGA 1KKOA 4AY7A 4HTBA 3SCSA 4YNGA 1QHOA 3ZXWA 2X1SA 4AXNA 1E1CB 1JJKA 4F9DA 1J5SA 2DU2A 5D38A 4CN6A 1FWDC 1F6YA 1V3JA 5KZMA 4JIPA 3T1GA 6CGTA 3B8TA 1XYZA 1BYBA 3UWYA 1NF7A 3WD4A 2B4GA 4MM1A 1C8VA 5HNNA 4ERIA 1VKFA 3UEQA 4NQ1A 5CSUA 1SYTA 2VFGA 2NX1A 4DO4A 1SZFA 3EX4A 4G5DA 5DBUA 3TN4A 4XAGA 2VR4A 3QMRA 2D3LA 4RNJA 4PCSA 3N2XA 2ZADA 3CHVA 1UPMB 3AICA 3GM8A 1IT7A 3TJ4A 3AO0A 1XLAA 3KTSA 2CWNA 4B90A 4AZ7A 4IQEA 2H3BA 4WF7A 2GK1A 3ZFHA 3UPWA 3ARUA 4C6DA 3WNOA 1GEQA 3N6HA 3WLIA 3D3AA 3MU7A 4F0RA 1PXGA 3TA6A 5CCZA 1WKYA 2XFWA 4YTQA 5I09A 3V18A 2JKEA 4ZL1A 3VNKA 1WA3A 4XIAA 3I3DA 1A53A 3E2VA 3W85A 4AISA 3II1A 1HO1A 3NPUA 4ICCX 4J3TA 1GOOA 5A5WA 2XSBA 5E0FA 3EPOA 3MCMA 3BSMA 3BCFA 4C60A 1SSGA 2C18A 4IUGA 4FX6M 3UPBA 1VP5A 4NNBA 1BQGA 2QUUA 4MMWA 1R38A 3CIWA 5FEWA 4H3DA 2O4QA 1JQXA 4CQCA 4KCVA 3NO1A 3S47A 1OFAA 3H26A 4L1GA 4J4KA 1Y7VA 4LYPA 2QQ6A 3GFZA 3PUDA 4GYPA 3ZSTA 2CBJA 2WC3A 1X1ZA 1W9XA 4E8DA 4IGSA 3ZT5A 5AFDA 1G5AA 1UR8A 2BX7A 3DKLA 2P88A 3WL1A 4UMAA 2PZ0A 4D71A 1W3KA 1WCGA 4OZOA 4M80A 2XFYA 4R7WA 4XX6A 3WYZA 4D8AA 1M68A 1ZBCA 4KWOA 1E15A 2Y70A 2OKTA 3RFAA 4DEFA 2PUZA 1GTHA 3R43A 5C5YA 1W0MA 2XSXA 5EPDA 4S3DA 3S1WA 1K6WA 1IGWA 1EXBA 4CU8A 4DX3A 4X61A 2PDPA 4N9CA 2YDQA 1XUZA 4R53A 1NDWA 2PTDA 2VC5A 2BDQA 4GUHA 4NJGA 4LXFA 3ITTA 3V0SA 1LM1A 1W3JA 3WBAA 1XLGA 5FJPA 3PN8A 3WDIA 3EWXA 2R1NA 3ITVA 1G4EA 4DAIA 2QCCA 2WCGA 1C90A 1ITXA 2GFTA 4XK2A 1XYFA 2VZUA 4RDYA 3TNBA 4FIQA 2G0WA 2PDMA 3DFSA 4NAEB 4UFIA 3N29A 1MNZA 1BLIA 3W1NA 4ROPA 1FWSA 1KFJA 4FOJA 3RLVA 1OCBA 4M1RA 1SM9A 3WLNA 5JMUA 3HJZA 2WZHA 2OEJA 2R8WA 1I0DA 5FA5A 5G4HC 3RF9A 1XYBA 2WSKA 1DXIA 4AU0A 2ZZ3A 3R11A 1QVBA 5F2MA 2VI0A 1T6MA 4UTTA 2I57A 2ON3A 3JU2A 4QLJA 1VQTA 3HQOA 2P8CA 3L2LA 4AYGA 1HQTA 3S9YA 2FZNA 3WD3A 1OVDA 3ZO9A 2A1YA 3GQYA 3C6CA 1MNSA 1OEPA 2PC4A 1Z48A 1GVSA 4RV8A 5M1TA 3SEPA 3FDKA 1W3NA 1Z89A 3WCZA 1TE1A 4MIMA 3Q4DA 1P7TB 3CPUA 3AZRA 4L4OA 3VO0A 3CEPA 4L4MA 5LA0A 2FPYA 4DF2A 2BODX 2VOMA 4WJEA 1B9ZA 4G6CA 3W1RA 3KWXA 1JUKA 4CCDA 1L8NA 4KIRA 1RSCA 4W7WA 1YNPA 3BJTA 1PAMA 4HIBA 1KLYA 5DEZA 2E5CA 1BTMA 1JF5A 3RITA 4F0KA 3QC0A 3LY0A 1EC8A 2NSXA 1H7PA 4M7TA 3IIXA 3EB2A 4POCA 1XC4A 4AF0B 3IUHA 2X0SA 3IPWA 1LL4A 2Z0IA 3A24A 6ENLA 4LH8A 3TW6A 5CZ0A 1KGWA 1JCTA 1YPXA 3SY1A 1F6PA 2YB4A 4UQBA 1KTCA 5D9OA 2RDWA 4B4HA 1SSDA 2Y89A 2EPMX 2BXVA 3WELA 6TAAA 3WUGA 4PL2A 5E6YA 3LQGA 3WQ4A 2CXEA 4I9TA 3MWCA 2WZTA 1XIBA 1MI3A 3STGA 4PMDA 4YYFA 4AC7C 1JZ3A 5IFPA 1MRQA 1ADSA 1HJVA 3MA8A 4W7UA 1WDPA 1XLFA 3HGJA 5HULA 5BOOA 2V5BA 1S2WA 3TFCA 4QCEA 1R3QA 2F6KA 3B04A 2WBGA 3ZVIA 3QTPA 2FDMA 2CEQA 2XH7A 3G1VA 1JNDA 1KM2A 2H8XA 4E5TA 4RDVA 1LOSA 2XN1A 3LK6A 5EBUA 4O11A 3IJQA 4FLOA 3W1AA 1TPB1 2OT0A 2IMRA 3CPGA 3EX2A 2ZRUA 2B7PA 3DG6A 4KT2A 2CLHA 2PTYA 1YIXA 5DELA 2IPFA 2CU0A 5A6BA 1H09A 4E2OA 2YR1A 2WCAA 4HOXA 3P8JA 2G3FA 3N2CA 3TTOA 4D2JA 4J3XA 2YLLA 1XDMA 5AC6A 4LUYA 4PMYA 3AYSA 4MOZA 3TYZA 2VZSA 1UR0A 3CH9A 3W7IA 4BY3A 3QQ0A 1LF1A 1A3HA 2ZA1A 3CZJA 1XH0A 1HX0A 3HU7A 3BOFA 1U1UA 2G97A 1DIEA 2GLKA 2R82A 3QGAC 5BXPA 5AKQA 3VGDA 3TFXA 1J0ZA 3NZ1A 1L9WA 4JFVA 3U48A 2NXGA 1MVYA 1I60A 2ZBTA 2VDGA 4W85A 3MDWA 4GXPA 3BLOA 3BAXA 3S1VA 1YYAA 2OGYA 3URBA 1S5NA 4ACZB 1NH6A 5LIYX 1R7AA 1SQ7A 3L0KA 2YFNA 4UFMA 3B05A 4H6KA 3BV4A 4H7VA 1OGBA 2YL5A 1WDWA 1CXHA 3B8WA 2AL2A 4C1KA 1ML1A 5BXRA 3GG0A 4FNTA 1ALDA 3QYSA 4ZO7A 1R9ZA 4DPQA 1WQ5A 5FKYA 1GVYA 3EWUA 4LBUA 3UJFA 1UKTA 4BI7A 1XJBA 3LNMA 2REQA 3GH4A 4CD4A 2QXWA 3LSBA 1R3WA 1SR9A 4K36A 1YTDA 3TN3A 3TMQA 4DBUA 1GGOA 4LUIA 5ECVA 1FH9A 3FCPA 2GGIA 2C16A 2A79A 3PTKA 4ZOBA 4IQDA 1H61A 4ATLA 4XQ6A 1VEOA 5EFDA 3SRHA 1X97A 1ZCOA 4JHMA 2D69A 2QDEA 1XH2A 2H90A 4MZYA 3ID7A 1F6KA 4DI8A 1GPWA 1P0NA 4UFKA 3NSXA 1WDDA 2PCQA 4JYFA 4FO4A 1PVNA 5DN1A 1VAHA 1IYXA 1VD6A 1AA1B 2GZXA 1Y5WA 3HJEA 4I7WA 4KKXA 3AUOA 3ZR4A 3REQB 3SFWA 1KGUA 3NXLA 3S6TA 3LX9A 4X2PA 2E68A 3GU9A 3VE7A 3WEOA 5HNUA 3TJLA 2Y5JA 1UC5A 3AXKA 3LCHA 3LXBA 3UY7A 2UV8G 5LA2A 4AMAA 1DOSA 3FJ4A 3V36A 4IXHA 2OVLA 2DGAA 4MZ8A 3YPIA 3AS0A 1OFRA 3VE9A 3QHNA 1EF2A 1NM9A 1Z6KA 4YVXA 4B9ZA 1W8SA 2BP1A 3QEZA 4KEZA 1W6TA 2Q8LA 5M17A 1KV5A 2OOGA 5JIWA 3HQPA 3R58A 2ZOXA 3LV6A 3ZJKA 4CQ9A 5L9FA 1TX0A 4O1DA 3VINA 4S1FA 3ALGA 2OWCA 1O6IA 4F0HA 2ZUMA 1Q2RA 4FIRA 1XS2A 4V33A 3WQEA 3SUVA 1JQVA 5AECA 4FXJA 3MJMA 4G8TA 2OTDA 2D0FA 4H83A 3UZYA 2GUYA 2GDVA 2XVGA 3F4WA 3RLGA 4N9BA 4XKMA 4KWWA 1E0WA 1V3LA 1ZPTA 5LZLA 3ZJ7A 4KFOA 3O63A 1A3WA 4KPLA 4S3FA 4GVHA 3DESA 5IBXA 5AHIA 5BMWA 4W87A 3PANA 1J8VA 2WLZA 4FNPA 4HNCA 3AXXA 4TTGA 4FOKA 1GQKA 3MI2A 1W2VA 3I4KA 1V0MA 2PLKA 1GG1A 5DCDA 3B8DA 5BWFA 4XWUA 3CXOA 1TMHA 3LTYA 1LTDA 2WJFA 4QE5A 4HT3A 3LRKA 3P6LA 3W88A 2PDJA 3TK7A 5JVLA 4Q8VA 2WJEA 4F2TA 3TQ0A 1TJ2A 3G1RA 4DJFD 1EJWC 3HMJG 1GVRA 2ISVA 4CN1A 1XKJA 4H8VA 3IV8A 4LQ1A 3LGGA 2ZTKA 3TSBA 3KBVA 1ZTVA 3LS9A 3PPHA 1RCQA 2Q02A 2HV5A 3KRBA 4AZBA 4UWMA 1EJTC 2XIQA 3P84A 1VB9A 4MAVA 1UHVA 1TPH1 2NV2A 4F9JA 3DG3A 3SSZA 3FSTA 3AXMA 4IIBA 3S1GA 2EAWA 2GOKA 1UJPA 1EWEA 1W56A 4HU3A 4NG3A 3TIMA 1D3GA 1DJNA 4OWGA 1WBJA 2ISDA 1OGSA 4UTHA 2DPEA 3MQTA 5FEXA 2OGJA 4OVXA 1BVNP 4EAMA 3NL6A 2DT2A 2GVGA 3C0JA 3RK8A 1DWHM 2FIQA 1ZB5A 3WLSA 4EPDC 4IM4A 3OIHA 4M0XA 4MY8A 4ORIA 2NQ5A 1KQYA 4GXWA 5EA9A 4IJRA 3ECQA 2JIWA 1BD0A 4GKLA 3WH8A 2FLIA 3B9DA 2PDYA 2WKGA 1OX5A 3RUBL 5BNKA 4PB4A 2X7VA 2NX9A 3WFZA 4GOAA 1ZBWA 1S39A 2WWCA 3PG8A 5A69A 3L65A 3ATYA 4UTFA 5AHLA 1Q6FA 3CUIA 1H11A 4HPJA 3U2EA 4WEVX 2EPLX 3WY1A 3UNDA 1GZGA 3QQWA 1CENA 5FJRA 3LHTA 3TAKA 4L6HA 5F1UA 3KP0A 5FL1A 1Q3NA 3FXYA 3BMVA 4C7FA 1TQXA 3C56A 4E6MA 5A8NA 2V5JA 2YJQA 2Z2BA 2QJMA 4W5ZA 2GK1B 2ZXDA 1E4IA 1ZJAA 3K8KA 3NDZA 3GU1A 4RKAA 5HWNA 3CZ8A 3BGJA 3KX6A 5BOEA 2AGTA 1T96A 5KZDA 3FW6A 3RN6A 1UCWA 3MJYA 1QI2A 1P1XA 1VHCA 3EA3A 1UB3A 4LEQA 3NGFA 3I4EA 4QQ3A 5C71A 3OVQA 2NWSA 2QLYA 5E09A 1B57A 1SMDA 4G7EA 1VBHA 4OGZA 4Q6XA 1RHCA 3BSGA 3TVAA 5TAOA 3DYPA 3M5XA 1JEZA 1VPYA 4JQ3A 3EOSA 1VIWA 3E2RA 3W24A 4CN4A 2CHOA 2W6RA 1EP3A 4CEXC 2QVHA 4JIRA 4JTAA 1F2JA 3VMNA 2PDHA 3WF2A 4DWSD 1EQPA 5DT7A 3C0LA 1M53A 3CT7A 3FJ6A 3UBPC 2DVTA 4Y9AA 1A4MA 3OLDA 3STCA 2Z26A 2NVAA 2ZUUA 4WSKA 3E49A 3W7GA 4IUOA 5A8GA 2V38A 5E70A 2FHCA 3P5YA 4AB4A 4NAFA 4XBJA 3W1UA 3MYOA 2O7QA 3UG8A 3DU0A 4DJED 1EGZA 4XIMA 4LANA 3RYSA 4WJXA 4GY0A 1LOQA 1OFPA 2VURA 4YL2A 1EGMA 2NXIA 1EUAA 1UP3A 3UNTA 3RR1A 4X2RA 3GB6A 5TIMA 4ZOCA 5MHBA 3C8FA 3DHDA 1KC7A 3JW7A 4MUPA 1Q7MA 4OTKA 4HBKA 1XFCA 1UD8A 3MANA 3SRKA 4L80A 3TNOA 2QCDA 4C6OA 2YX0A 4JXCA 4LS0A 2QJNA 4QG6A 4D6FA 3AMCA 4HN8A 1N8WA 3PC0A 3P8IA 3O0KA 3N34A 3GNOA 3PWIA 3TC7A 4OT7A 2O9TA 4D1IA 3PNUA 3QV7A 3VOIA 4H9TA 2CESA 3W7MA 3J7HA 3OP2A 4MF4A 4ZSTA 5BRQA 3A47A 5BXTA 3CPRA 4PTVA 2P1FA 1TVNA 2Q8XA 4UNKA 1ODZA 1XRFA 4LAKA 3B8UA 2I56A 4H6QA 2XVPA 3STPA 3W1QA 2WSPA 1K4GA 1EJSC 5JH1A 4JCLA 3BO9A 1EF3A 1FUYA 1XGZA 2P10A 3ABQA 3VU2A 1MXDA 5DMLA 3TYUA 1O60A 3T7VA 3A23A 4IP5A 3AMDA 5HXMA 1Q6RA 5G4EA 3KOFA 3L7RA 4LB4A 1HJWA 3SM0A 3OJGA 3A13A 1VRXA 1CGWA 3O3RA 4ZB5A 1XRSA 5D2YA 5HINA 4NX0A 5DY2A 4I9AA 1Q63A 5A6JA 3Q2DA 4MB5A 4LCSA 1LP6A 1OIFA 3VXGA 1OGGA 2VKZG 5GJPA 2OB3A 1PPIA 4UTJA 4LSBA 1X6NA 3PB2A 1Q4NX 4FHAA 1GYMA 2A5HA 1EJRC 2ZX9A 5AYZA 3W37A 1V6YA 5KZEA 1K9TA 1JXJA 1S2AA 1J6OA 4DF1A 2VX7A 4RX0A 4KIEA 4AWTA 5C0QA 2EPNA 1TQJA 4FR1A 2Y7GA 1K9EA 4G9PA 2QJHA 4M6UA 3B3DA 1HGWA 3FAWA 3CLWA 3AMKA 4MWAC 4YYCA 5KEZA 2PP0A 5AHNA 2XM2A 4EF9A 3RM8A 2FTPA 4ZOAA 2C13A 3FS2A 3B06A 3GTNA 3UY8A 2BGQA 3U2ZA 1T99A 3SECA 3TUUA 4IISA 1BYAA 2Y88A 2V3EA 2OZ8A 5ABGA 4H7ZA 4RNHA 5CSYA 2XPKA 3H54A 3S46A 2J79A 1ZL1A 3E12A 1X6LA 2QAPA 4M29A 1Z8AA 3IAQA 2V3GA 2QPUA 4C1NA 3GAYA 2PBGA 3IIPA 5CPNA 2DY3A 1GZJA 4UQ9A 5LNUA 2POTA 3AWNA 3EB3A 4IT1A 2XH4A 3VUPA 3CV1A 4IMFA 3D46A 8A3HA 3DXIA 3GX9A 4J7RA 1PHQA 1O5KA 1YX1A 4BS0A 4C6BA 3IK4A 4S3AA 1XLJA 3P14A 2O7SA 5MKGA 3TWBA 4EX4A 4H04A 3GK0A 2DSKA 3STEA 4MLJA 4J2MA 4B92A 5JBFA 4XTIA 5K9XA 5T91A 3QTGA 3TTYA 3QH2A 3VKAA 4L6OA 3KCJA 3WDRA 3GNPA 4NZCA 1R0MA 3BLIA 1BXCA 1XIGA 4PBEA 1E6ZA 3MI3A 3NURA 1TTPA 4J35A 2FHBA 1J4EA 1XX1A 2XUCA 2VC9A 1S2VA 3BUVA 3W1TA 1HZYA 2HE8A 1J93A 2I7GA 4EXQA 3N12A 3T07A 3BOXA 4IP7A 3V75A 4HZ6A 4PCNA 4ZQMA 1ENUA 1LBMA 1KKRA 2E6FA 3GXFA 1HP5A 1DIKA 1G0CA 2CZ5A 4EOUA 1J2BA 3GVQA 1YMYA 1RVGA 1TMLA 4DZIA 2WPGA 3CZLA 2NVCA 3QF0A 1EH9A 4GMEA 1KA9F 1AZ2A 1XCWA 4O17A 2FJUB 1XLIA 3A12A 2EKGA 4L1WA 5D9NA 1FWAC 3OZMA 4DO5A 1OFOA 2NWRA 4GIYA 4K2SA 1JPHA 1CDGA 2GVLA 2DZXA 3O07A 2TRSA 2QDHA 1TTJA 1W17A 3CQJA 1E9LA 1X6UA 3LLDA 2BVYA 4Q7IA 4AY8A 2Y61A 3R13A 3SGGA 1R87A 3IS4A 2Z6IA 4NU7A 3B4YA 3AAMA 2AL2B 3TZFA 4BK9A 4CQAA 2NX3A 3RILA 4CU6A 1RJQA 3VDGA 2VR5A 3VDHA 5CBIA 2AKZA 3EOEA 2DP3A 2IKIA 4ZO8A 2XZ9A 5LIKX 2YZ5A 1TIMA 4XZWA 5CAHA 3KOXA 4LUTA 3B0UX 2EPHA 2O9RA 2HBXA 3F2BA 2PI6A 2C0HA 3EXRA 3NAVA 5E6ZA 5I2UA 3IJIA 1WKFA 1TZ9A 4Q8TA 4WDWA 3VDBA 3MMDA 4B91A 1GQNA 5CEWA 2WZEA 3BMXA 4UC5A 2FH8A 4DXVA 1VFSA 3VGEA 1VF8A 1SW3A 4NILA 4QP0A 7XIMA 1GYLA 1W3TA 1BRLA 2BFGA 4O1FA 2YPIA 2Y2WA 4U28A 3O6YX 1K7EA 5LGZA 3O15A 1ESWA 3MUY1 4O8RA 3FJNA 3E74A 1X38A 1F73A 2BMBA 1F05A 1OK6A 4JTFA 4LOCA 1R86A 5GJNA 5A6LA 4HCLA 2ZZ7A 4PTDA 5CZKA 1ICSA 2HXUA 3BARA 3QLDA 1NFGA 4TV6A 2BVTA 3WK2A 3AYVA 3N11A 1W2PA 1U1JA 4HYVA 4LRTA 3EDDA 3PUEA 3OGSA 4NZ4A 3QGVA 3HPZA 1FWHC 1OX4A 1VR6A 4ML9A 3ARPA 4A6GA 4B2DD 1UWQA 2GVJA 3QOMA 2WK2A 1QNOA 1BVZA 4AX7A 2EJAA 4DUVA 1HKIA 4FNRA 4UMCA 1ZJHA 2C79A 3UWUA 3GHTA 3GC4A 3GDLA 3LG3A 3BCJA 4PTNA 5A8QA 1AW5A 3KM8A 3MBDA 4OBSA 1K7FA 1NFPA 4YPJA 3W2LA 3SQSA 4GJ1A 1TVLA 4ICNA 3URAA 1KFEA 4CD5A 3EWDA 8RUCA 2GSEA 3HB9A 2V68A 2GSHA 4AWUA 4IFOA 1HIZA 2GQ3A 2ABAA 5M3WA 2YFOA 2Z1KA 3OVRA 4PZVA 5CGTA 4XZBA 7REQB 2ZFAA 2F8QA 1PCKA 1PE1A 1LL7A 4M51A 2GSJA 2FB3A 3PBUA 1CB7B 2PWEA 4RPPA 4NJHA 3WDHA 2VGGA 2ZUVA 2FQIA 3ARSA 4O15A 5FF0A 4W8AA 4GPNA 6PTDA 4OV9A 2QVNA 1RR2A 2MNRA 2ABBA 2BV9A 4TV5A 3VIFA 3IRDA 4HHHA 3QVQA 3EWCA 3T09A 2LLEA 1XSIA 1YBQA 3QZEA 3LPPA 2E1DA 3XISA 2VWTA 4RV3A 2DIJA 2BSLA 2C1HA 2AGKA 4WY0A 2VX5A 1D2KA 1M3UA 4A05A 5CZSA 3PBGA 3H7UA 1KRBC 1J0KA 1XLKA 2OOFA 2J47A 2SFPA 3UA3A 3JVAA 5LXXA 1FHUA 3CO8A 1JVNA 1O68A 3LV5A 4HYRA 1BWVA 4JFSA 2VVNA 4K8GA 5FJUA 3NQFA 2E5BA 4FB7A 3K1DA 3CHEA 3G3DA 4JZ5A 4GHRA 3UG5A 2G41A 2HXTA 2JF7A 4BKNA 1XIMA 2Q3RA 2HNEA 2ZVIA 3SO7A 4GVGA 2UZ9A 5AN7A 3CMJA 3HF3A 2BOGX 1B90A 4X60A 1DV7A 3IVSA 3QV9A 4R9XA 2EPKX 1TMQA 1KW1A 2IKJA 4LGXA 1DWGM 7A3HA 4CUCA 4K1GA 2Y62A 1RQHA 5DBTA 5HUOA 5C2XA 2PDKA 4JYEA 1M1BA 2X2GA 2AAAA 1AVAA 2QDGA 2IQ0A 4H2CA 4PSPA 4ZFCA 4BI6A 3HV9A 2HEJA 3T2QA 2VDHA 3QR3A 4IPJA 1Y5XA 3MUAA 5XIMA 3FDGA 4R88A 2E9LA 3L12A 1BF2A 2JKAA 2BXYA 2DZVA 3QPYA 5LGXA 3LCLA 2EGZA 1FWRA 3KXQA 3EDJA 2W27A 2HVNA 4U3CA 1N8FA 2C6QA 2YA2A 4CNSA 1JCMP 2HPIA 3I6EA 3RPDA 3MHGA 3NWRA 3NR0A 1YE4A 4IIGA 3S9IA 3R7MA 3N13A 3IJLA 4ZO6A 1Q45A 2KAUC 4HD5A 2V82A 4UFJA 1CNVA 1V3KA 4R7JA 1R2TA 2BGNE 1L6WA 2E40A 2Z29A 4OUIA 4KMQA 1FDYA 1ISYA 3VKBA 4EPBC 3QFWA 8CGTA 2INFA 3A64A 4DM2A 5IXEA 1F3EA 3L0NA 4HSNA 1RCXB 2C14A 2WHJA 3G1YA 2C1GA 4NIRA 4R85A 3M64A 3DFOA 4YS1A 2R1KA 3SCNA 4C5YA 1TZZA 3W7PA 4PEEA 2ZWYA 3MVTA 1S38A 4PMNA 2PFHA 1DIOA 4E8CA 3VNDA 1XH1A 4WJ8A 3WQFA 3ITXA 4I5RA 2D22A 1AMYA 2QHAA 3QYQA 4YCOA 1AD1A 4PODA 4I9MA 4UUIA 4HYWA 4ONVA 2Z27A 3PPCA 3ANVA 3O6DA 4DO6A 4C7GA 1JI2A 3TSDA 2PDBA 1UA7A 4C65A 3L68A 1LYXA 2QKFA 1IGSA 1VJSA 1GT8A 1VRDA 2PGFA 3I68A 1UD5A 4RW3A 4FNQA 4L1XA 4RXFA 2B7NA 1Q13A 1UUMA 2RJGA 2ZXBA 4DNMA 4K8HA 1DPMA 3TQKA 3EB4A 1GPFA 3ITGA 3QQ1A 2D0GA 4RL3A 5HBFA 2R91A 3KZSA 1EDTA 1ZFJA 3AIRA 1XIDA 3CS2A 1I1WA 4YIWA 3V0UA 4LAZA 3WBEA 3V4BA 4NAFB 4ZCWA 3CEUA 4J3VA 1LQ0A 1OCNA 3ONBA 5AY7A 3UQNA 4IX2A 2W63A 3BJFA 1PX8A 1SZGA 1VFFA 4MPKA 3EBVA 2FVMA 3TEVA 1JCYA 4EIVA 4C6FA 3PG9A 5LSMA 1UPPA 1RY0A 1JCNA 2CNCA 3PPFA 2JGYA 1FHDA 4JTQA 1PYMA 4J9JA 1ITUA 1LLOA 2QCDB 4G7FA 4S3CA 3EDEA 4KW2A 3C61A 3C8NA 2ZZ5A 1EYEA 2WMGA 5GJMA 4TO8A 1EZWA 1FP9A 5HNRA 3DIPA 1EC7A 1NTHA 1NOUA 2PWGA 4EP8C 2E4TA 1P6CA 1E4MM 2G4FA 1ZZMA 5HR6A 3OHIA 3TXVA 3LN3A 3N15A 3V16A 1SUXA 4QS5A 3UJEA 3H2OA 1JD7A 1XYCA 1SFSA 4ZXLA 3F4CA 3VOCA 1R30A 4PMUA 2O9PA 2G5WA 4A8LA 1KBBA 4IFKA 4BQ4A 2DZBA 4R3UA 4GFSA 3GTFA 1GNXA 1VFOA 4WDUA 1DJHA 4K7VA 2ODOA 2ZICA 1DJIA 5D30A 4UQCA 5C8BB 2A2IA 1IEIA 4WGXA 1CLKA 2X1RA 3NSMA 4QSFA 3VX1A 3AJ7A 2VDIA 3QLLA 2J7EA 1E72M 1GOQA 4RZ4A 1GUVA 3BJSA 2X2YA 4NNAA 1NOWA 1QR7A 5U7SA 3APTA 1R47A 4F2UA 5EU9A 3DUGA 3BW3A 4LS1A 5KTLA 1U22A 1Q6QA 4P8WA 1BF6A 1QO2A 1EEXA 3DFPA 3S5YA 2VEMA 2PWDA 1XM3A 4MPQA 2DV0A 3ABRA 3ZLGA 2C8NA 4PFHA 2ZZ6A 1WKEA 3Q67A 5REQA 1EEPA 4H1ZA 4OIFA 4XZHA 1H7OA 3WMBA 5HPOA 1KWKA 4W88A 2BY1A 3VD9A 3AQUA 3PFRA 4Q8PA 3MI6A 2NQLA 1AG1O 1RJRA 1YW1A 4ORMA 3H4GA 4HCDA 4JHZA 2YOCA 4F0MA 4YTRA 3GLCA 1Z9AA 3CB8A 2QUVA 3SGZA 5A95A 3ME3A 1O1ZA 1ZSXA 4HA0A 4CNTA 1E1CA 3NJ3A 1US0A 5LYRA 3U6WA 3PS7A 2E09A 2ZUWA 4U4MA 4JIQA 1TUXA 2QPSA 1PTGA 3L4YA 4QS6A 2HK1A 3TZNA 3W7DA 3MV01 4G2DA 4H8HA 4F66A 3NPVA 2VQUA 2V9DA 4RPQA 1VFTA 4GACA 5DMNA 1TWDA 1ECQA 1VYSX 2HS6A 1V51A 2KX9A 5FJTA 3SW6A 1DBTA 2MANA 1C92A 3HA1A 4O4VA 4C1NB 5F4XA 3F4VA 3WFLA 2CLOA 1W5PA 5K3VA 4PMJA 3RMJA 3C3NA 2WNZA 1FWIC 1K03A 4U31A 4N0RA 4XAZA 1PZ2A 2X40A 4O53A 4H00A 3WNPA 2QEZA 1QOXA 4W8BA 3KBNA 4G1NA 2Z28A 2J75A 4IMAA 5MKGB 5T9BG 4I5UA 3EX3A 3A9IA 1JYWA 3LMYA 1HXJA 1MEHA 4IG2A 2IPJA 2CLFA 3T05A 4LB3A 4HU4A 1AH0A 1OF6A 1JDAA 2A3EA 4PCTA 2C71A 3CUXA 3DGRA 2WYSA 5JU6A 2AAMA 1MZRA 3M7SA 6A3HA 1LROA 3S1UA 5J8LA 1RUSA 4W9TA 5HAOA 1OF8A 2PC8A 5LA1A 3WF0A 1AZ1A 2H9AA 2PB1A 1ECEA 1R3RA 2YW3A 1RQBA 1M7OA 2CC0A 4RDWA 3GDKA 5D2VA 3OZPA 3ELFA 4C6IA 4BI5A 3S6DA 1ZUAX 1K02A 1TYGA 2FYMA 1W9DM 1E43A 4NASA 4RUBA 3WLHA 1V3HA 1ADOA 1TTQA 3SJ3A 1PKLA 3H2EA 2PRHA 3NZGA 3WH9A 1TO3A 2VNCA 3XIMA 4O19A 2ZDSA 4H6RA 2OQHA 3CWNA 1XSKA 2NUWA 1PWLA 1ZALA 2QIIA 3M16A 4FF7A 1R3SA 3EKLA 1QK0A 4NHVA 4HNTA 4J40A 2X1UA 3RLHA 1A4LA 5D05A 4BHYA 3UR2A 2DVUA 2CPUA 1TR1A 4GX8A 3LZ5A 2BY0A 3T0CA 4AQLA 4GBUA 3IV3A 1IV8A 4AZHA 2PDWA 4F3HA 4UB9A 2YA1A 2GDUA 4E4PA 2Y7DA 1IE7C 4LAMA 4LUTB 3W2MA 2D2OA 4ECLA 5F2IA 4E4UA 3KFTA 4BA0A 3OBEA 1VYPX 2CHRA 2YYUA 1S3TC 1UIPA 3OQ8A 4QE1A 3IK2A 4WX2A 4NJJA 4ROQA 4O1AA 4JNYA 2CLPA 4NNCA 3GU2A 1JDEA 4Z2KA 4QXIA 1PEZA 3VD7A 2IQDA 5AC4A 2NUYA 4LYKA 4WCJA 4LUJA 4QDMA 1ME7A 4KRZA 3UVIA 2YCKX 1BRLB 1EOKA 1FVPA 3BG9A 3WKZA 1VGAA 3E0VA 4WR3A 3CUFA 5I0DA 3GZAA 1R3VA 2CW6A 2HVMA 1DQUA 1S46A 2F61A 4FALA 5D37A 4FEZA 3IJ7A 1JCXA 1UD3A 1EXPA 3CQ0A 2BTMA 3M0HA 3W7JA 1E51A 2J7BA 5CZTA 1DIDA 1R46A 5DFAA 1GVOA 3WLQA 3SQLA 1PZ3A 4OU1A 4DVOA 4MWAA 4TR9A 1OX4B 2HROA 4R5EA 5HMDA 3WENA 2J88A 1TV8A 1L8PA 1XBZA 4LVAA 1G6CA 2XWDA 1M7JA 5A2AA 5T9CE 1TSIA 5DCBA 5HJLA 3VGGA 1H49A 3M0ZA 4N9DA 3BLEA 1XG3A 2WAGA 1BEUA 2ZRWA 4LX4A 1QW9A 3KVMA 2EKCA 3IIZA 4WLCA 2VENA 1FP8A 3MYPA 3USZA 3UG4A 4UZSA 4YLWA 3VIPA 3PJTA 4F2BA 5A6SA 3E02A 2D2GA 1VEMA 2JK2A 1AFSA 1QI5A 4YWIA 4QJ4B 1Z69A 4XBKA 1QK2A 1MW1A 3ZQ9A 1WXZA 3GR8A 4HVXA 1J96A 1JYNA 2OZTA 2PRMA 4MADA 5D2WA 1A5UA 3O6CA 1BHGA 1A47A 1NEYA 4KCTA 4ATWA 2A3HA 4JIEA 3M5VA 5H1WA 1W1A1 3K8MA 1UQZA 7ODCA 1HKWA 1PIIA 3UWZA 4TU1A 3BURA 3D5HA 4UBPC 1KR1A 1RQEA 1YBQB 3RIKA 5K4ZA 3CNYA 5A3HA 1J11A 3FKRA 3O9NA 3IRSA 2X8RA 3GH7A 4WY0B 1ISZA 4XD3A 1HJQA 3L2IA 3K5XA 1ONXA 1XKYA 3R79A 3GXTA 1SO3A 3DYOA 2PP3A 6XIMA 3PZQA 4P7OA 4DHGA 2OEKA 3ANYA 2J8GA 2H8ZA 1DWAM 3GIPA 3DX5A 3GVRA 4L6DA 2ANUA 3G1HA 4REQB 3BV7A 1PV8A 4C91A 1RLCL 4ZZ9A 3A4AA 1I75A 1LT8A 1PTAA 3ZWSA 4Y6GA 4DI9A 1K8YA 2FTWA 3MW7A 4DYKA 4LEFA 1TJRA 5H6HA 1Q66A 1MMFA 4XSLA 3KVKA 1C3FA 2ZXQA 4AHOA 1BWKA 3PM6A 3DZ1A 3LBCA 4M24A 2VHLA 1OFBA 1KFCA 1MQQA 4XO6A 4C6JA 1PZ0A 4QNEA 2G4JA 2VX6A 2DDXA 5D9MA 4QNWA 4C6EA 4XD4A 3ZLFA 4H9XA 5HK4A 1V02A 2WSYA 2DSUA 5JQ9A 3WN6A 2ISFA 4P8VA 1QRQA 4O0QA 1AODA 1BXBA 3W0KA 4GZEA 5ABFB 3NIYA 1W5MA 4GNJA 4KQNA 2DSZA 3W3OA 2HZGA 4IPPA 3WQGA 1QUMA 4YHEA 4DWDA 2DW6A 1UR2A 3LSCA 3SUUA 4S38A 5HJXA 1RP9A 1WB0A 4Z1CA 2AMXA 5U4NA 2NQJA 4RE3A 5KETA 4NUWA 3T0BA 4IPLA 2C7FA 4R33A 3T4WA 3QR0A 3H2AA 1QO5A 1XL9A 2PDIA 3DHFA 4JTDA 4CU7A 3FYOA 1KCXA 1MW3A 2FZMA 4ZMGA 3G0SA 1RD6A 4L64A 1UP0A 2AQVA 3IANA 2J8FA 4IPNB 1HNYA 2WMHA 2E5DA 4A29A 1A5BA 2Y1HA 3N6JA 3N18A 3GC2A 3ES8A 4PMRA 1E0UA 3O7UA 2GUBA 1XG4A 3G1SA 3QJAA 1IXQA 4IIFA 1KM3A 3ZR5A 3KBSA 1LQ2A 4GZ7A 4ATDA 4JKLA 1B3WA 4GQBA 3BWWA 2C19A 3M47A 2PP1A 4WGHA 2PTWA 3T8LA 4FXSA 3WBYA 4DPPA 4HPXA 3P67A 3VIGA 4E2VA 1NU5A 1X7IA 4AD0A 1TIWA 1QNPA 3L4XA 4H9YA 3LYEA 2V81A 3WQWA 2AKMA 2YXXA 3GG8A 3XINA 1HVQA 4AD3A 5EL1A 4R27A 3VIMA 1TWIA 2W66A 1EOMA 4I3GA 4EPKA 1AJ2A 3VGFA 4JQ1A 1L6FA 3HFTA 4DXKA 2DFAA 4G1KA 5FL0A 1X1OA 1ISWA 1TPEA 2J8TA 3EX6A 1TV7A 2VC7A 3NTYA 5L6UA 3AFBA 1HJSA 3SI9A 1EUNA 3AMGA 4UTIA 1B3VA 2ZCGA 1CIUA 1H7NA 3OPSA 6TIMA 2IXUA 2RAGA 3QC3A 4Q4QA 1CXEA 1UZ4A 4NZ1A 1J6PA 1A5SA 3LMZA 4GYJA 4Q8NA 3KWSA 1V93A 4NL1A 3QMTA 3KRUA 5CPLA 1ITCA 1SZEA 3UESA 1LBLA 5LNSA 5GNZA 5I3KA 1UP2A 3I7QA 3SB0A 1BFNA 1YNYA 3AMLA 3KEHA 4KRTA 4RZ6A 4FNSA 3Q65A 1Z42A 2V0TA 2WMIA 4LFYA 3GXDA 2PWFA 3LM3A 4WD0A 3O6AA 1W9UA 4HSOA 3V3WA 4CLMA 2UY3A 5I02A 1EQCA 2ZYFA 3WQ5A 4I5XA 3NYDA 1R9YA 3UWVA 1AUSL 3RPMA 2I5QA 3CTTA 1D8WA 1B4EA 3DC8A 4V27A 2NSOA 3K1GA 4F40A 2WQDA 4IH3A 1DJGA 1HL2A 1B1YA 3GG1A 3IWPA 3QRHA 2IW0A 4L9YA 2E67A 1TFVA 4M81A 2PRLA 2XU2A 1UYQA 1DKWA 4H01A 1M04A 3W76A 2F2HA 4Z2JA 3LGEA 3MTWA 4YJ5A 4M82A 4GJJA 3WQVA 3HBLA 1RH9A 3HO8A 3CV7A 3PTQA 2TAAA 4C6PA 4IFKB 4IL0A 3VOHA 1OQFA 1UMLA 3TLLA 4WKHA 4HQVA 3AIQA 1XISA 1TA3A 4NZJA 1UUQA 1WP6A 4QEEA 3LCIA 3IACA 1ODUA 2QGHA 7ENLA 4JY8A 1UBSA 3KL5A 4AMCA 1XRTA 4GNKB 3O2LA 3ZSSA 1BWLA 4YTSA 1RVKA 3OG2A 1QPNA 4QE4A 1W54A 3ERPA 1KXQA 4NJIA 4H9ZA 3QBUA 3E9AA 1HF6A 3IUDA 4PR4A 1E6XM 1LG1A 5KITA 3OG3A 4NP7A 4Y7EA 2QT3A 4KF1A 1CGVA 2UY5A 4PB5A 3NEVA 4L65A 3OVPA 2EF9A 4O14A 4M6VA 3V5OA 1R5YA 1O1HA 4HK6A 2VZTA 1KRMA 1V6TA 1HL9A 3S5OA 2YL9A 2F84A 3I6TA 9XIAA 3PFMA 1VBJA 2VCAA 5CC7A 3RM4A 3AIUA 4GJIA 1NDVA 2D0HA 2J13A 4XD5A 3AS3A 3R0DA 5DANA 1T8QA 3PPGA 2PDFA 4GXMA 3IGSA 3MCOA 4JGDA 1RV8A 4FSAA 5B7YA 4XISA 3K30A 1A49A 1E4NA 2DT1A 2VJXA 3B97A 4YN5A 3W26A 3WK3A 2ZQ0A 5KZ6A 4LCQA 3W6MA 2P3EA 4HNOA 1N7KA 1GYNA 1TRDA 3CYJA 2QUMA 5A8PA 3N6QA 3KTCA 1PUDA 3HZ3A 4DUWA 4JDBA 5I00A 2CKSA 4JKKA 1DJQA 1N2VA 2ZZ2A 1E40A 3LQLA 2EBNA 3APYA 4URIA 4UOQA 4A8RA 2MUCA 1JF6A 1V8EA 3VD3A 4B5SA 1KGXA 1FWEC 1OADA 2V69A 2UWFA 1HN1A 3BC9A 2YL8A 1WZAA 2A4AA 3RJYA 1KBKA 1HTIA 4NZ3A 1PHWA 4A4AA 4HP5A 3VDCA 1KCKA 3THAA 3BAKA 1ELSA 3SFKA 3IUIA 4Q8OA 2OMAA 3LI0A 4J3ZA 4IG2B 2YA0A 3MUXA 1Y8BA 3N73A 4MFEA 3IJ9A 3DFTA 3C2OA 4PE8A 2RGMA 3LDVA 2OQYA 1TJ1A 4Y9PA 1KM1A 3BLFA 4MNJA 1EYWA 2GL5A 3EA1A 5XIAA 2PLMA 5C9ZA 1BTCA 3ZS4A 3UZXA 2C3ZA 4QJ1A 4H9MA 1TVPA 4DWSB 3MV11 3INPA 2VFHA 4Z1DA 1BPLB 3DEQA 4B9YA 3LHZA 3BLLA 2H9AB 1GEHA 4Z17A 4UNLA 3ABSA 3M41A 2GJPA 4MJ4A 2J6XA 3EAUA 3NA8A 1WV2A 2B7OA 3H12A 5G1YA 1AQMA 5C55A 3I6RA 1TG7A 3K4WA 2BLEA 4TMCA 4GUFA 1QNVA 1J0HA 5J04A 3BW2A 3C2EA 1SW0A 1TTIA 1IZCA 2IKGA 1HFBA 3NCOA 4N6EA 3E96A 3L67A 1VEPA 3U3HA 1L2QA 1JZ5A 2HPMA 3RU8X 1H7XA 3WLRA 4FR6A 2RKXA 3CB3A 3CUGA 3LRMA 2FVKA 5I3IA 1SR0A 1KWGA 2YSWA 3LZ3A 2FFCA 2BHZA 1XBYA 5CC5A 1JPDX 1A5AA 1V7AA 4AZIA 2Z2UA 2YLAA 3HGRA 2W4XA 1P0EA 1Q8JA 4JIIX 5LXEA 5D9PA 3NQCA 3T81A 3TONA 1MUCA 1QMLA 4QIUA 4EXAA 5K2ZA 1KM5A 2G8ZA 1E3XA 3CIXA 1XWYA 3WL0A 3R6IA 1ITQA 4W86A 3UR5A 1Q6GA 4L56A 1QCWA 2PD5A 4Q7NA 1W9PA 1DORA 3CQHA 4PUDA 3QM3A 3SY8A 2OT1A 4XZ9A 5LNRA 1GVFA 2F6XA 3DFHA 4WSJA 3ATZA 2GQ9A 5AYIA 4HHLA 4LS2A 5ABEA 2HSAA 2G95A 2VM8A 2XVNA 4ZENA 1KBJA 1SW7A 4K8EA 1ME8A 3THDA 4BCEA 4ENLA 4H8UA 2OELA 4U5KA 4UFHA 2X1TA 3WMSA 2OR2A 3MDUA 3W87A 1CB2A 4BF7A 1O5RA 1ZHAA 2WOQA 3D6NA 3K4DA 2VYOA 1HKKA 4A2RA 1MW2A 3W1XA 4WDTA 1VFLA 3QSTA 2VFFA 4MFDA 4OUEA 3TWAA 4CEUC 4A21A 3PAOA 1ONWA 1K8ZA 3S2MA 3WEMA 2EG6A 4ICMA 1QDSA 2P0OA 1UUOA 1XLEA 4N6FA 3UA4A 3LLFA 2DEPA 2WZIA 4N2YA 1EJVC 5EGRA 3GW0A 2VUNA 1JZ2A 1IWPA 4TX9A 2NQHA 4M56A 4FLQA 4PBGA 3T44A 3TKFA 4MWAB 1FWTA 4IX0A 3B0VC 1UD4A 3BQ5A 1FRBA 1AJ0A 3E0IA 1XFBA 4BEUA 4D6HA 1FDJA 4ZBCA 2AQOA 3KTXA 4GRSA 1K9FA 3UR8A 4OKDA 1VBGA 4H9UA 2ZE3A 3MSRA 3F2DA 2F6UA 4QJ5B 5JUVA 1E6SM 3NZPA 3MO4A 4JTGA 3UP8A 2Y85A 3MP3A 2VELA 2WBKA 3H7VA 2J9XA 3OHMB 5G5IA 1NWSA 3P3BA 1JDFA 4GC4A 2A85A 1JZ8A 4D6CA 1WZLA 2WVTA 2EXOA 3NM3A 1SO4A 3BPWA 2ZKMX 4MJZA 4N02A 1ICPA 3AIBA 4GQRA 2HBVA 1DL3A 4CD8A 2VX4A 5G2HA 4HPNA 2OG9A 3BL3A 3RO6A 1B30A 2OSWA 1KCZA 2HK0A 3EX1A 3LCXA 4HK7A 4RE2A 3IIOA 5HMSA 4YMZA 2ZUNA 1JGIA 2R1PA 1QW8A 4E2DA 4O57A 1CW2A 1B3OA 4L61A 4AXKA 3WUFA 3P60A 4JNMA 4GGBA 3VOFA 1DQXA 3LA4A 2ZX7A 1FWJC 4U2ZA 1JCLA 3VX0A 1HVXA 1EL3A 5AYYA 3F03K 1C8YA 1X98A 3UT0A 3MC5A 5CGMA 1NWUA 3A3WA 3FVMA 4AG0A 4QLLA 1XXXA 4WRHA 4CNOA 3R10A 5C9XA 9RUBA 3F2CA 1H51A 4QROA 3T0DA 4NY2A 4M8UA 4AUBA 4GWEA 3W84A 2QCNA 1L6GA 3TYAA 3L66A 4KWSA 2W91A 4PMZA 4PTXA 4GH1A 3I7RA 3DOPA 4E3VA 1PIFA 2GWGA 5K9DA 1PDZA 5HMFA 2HNHA 2WSRA 2JALA 1X7FA 1PDYA 1R2RA 1EP1A 3VM5A 3WZ0E 3RCYA 2VEKA 3LNPA 2J7CA 2O56A 3WJWA 3IGUA 3NSNA 1H7WA 3EZ4A 3P5ZA 2Y0FA 5C9UA 1DJXA 4M5PA 2W62A 1F8IA 1H0IA 4Y90A 4Z2LA 1CYGA 1GONA 4AIUA 2WMJA 4WVXA 3SCRA 3N2BA 1XLCA 4DBEA 1E6RA 1W3HA 2JFEX 1PX4A 2W9MA 3LM7A 4V1YA 3RM9A 2FJKA 4B5UA 2H6RA 3DN5A 3NQGA 2QIWA 1X96A 1FWGC 4GUGA 4GO8A 3STFA 2XM1A 3VABA 3UGRA 2J66A 5I23A 3EXSA 1EIXA 3NDYA 3DAQA 1V6XA 1HKVA 1GVIA 3KRSA 4EF8A 6ALDA 2AL1A 1OFEA 3AHVA 1A50A 4ZQNA 1P4CA 3E2QA 5CZJA 4ADSA 1XIEA 2QR6A 4PL1A 3WH5A 1OCQA 3LBOA 3CUJA 1HKJA 5BYWA 4EXBA 2J9YA 1QOQA 3LERA 3WDPP 3UETA 3WEZA 2XFFA 3DC0A 3PHAA 4IIHA 5GVJA 5A2BA 1FWNA 4O18A 3NL3A 3VAVA 4IPIA 2XVLA 3MUCA 1HG3A 4IZGA 4V28A 2OFJA 3TC6A 2AQWA 4UMBA 5CBJA 3QXBA 5BXSA 2RH9A 4QR6A 4PUWA 2QCGA 2WNWA 3ARZA 2BY3A 2XH2A 2V2DA 3BSHA 1H63A 1F8MA 4QTGA 4PMXA 1GQLA 4JIHA 1YXDA 3E0WA 4GI6A 3G1AA 4RDZA 1Q6EA 3ZVHA 2A3LA 1ZP4A 3S0CA 3TN5A 3TX9A 1V5XA 5BRBA 5K9CA 5KSWA 4DQWA 2E25A 1MFUA 1ZLPA 4NYYA 1BSLA 3ABOA 4PSRA 4US5D 1EDGA 2HS8A 1NSJA 3N2MA 5D03A 1GJUA 2EPOA 3RCNA 1OYBA 4KWVA 2G3NA 3BH4A 1GW9A 2JKPA 4LCRA 3WLOA 2X7WA 4MYAA 2P3ZA 3AZTA 2ICSA 1YXYA 1UWRA 2YGYA 2W5FA 4WXZA 2ACUA 3CZKA 4GINA 1UZHA 5DX7A 2J6VA 3GXIA 4O28A 4PMQA 9XIMA 1M7PA 1UZDA 1J5TA 5FESA 3M4HA 3ITYA 3EXTA 3ITOA 4DJDD 4PCPA 3GTHA 3FOKA 5AYXA 2IKHA 1WO2A 3BVJA 3LENA 1EC9A 5CJMA 2ZTJA 3NQ6A 1JULA 3P74A 3DH7A 1QI0A 1O7AA 4JTEA 3ABXA 3UYIA 4A3QA 3SCPA 3R0UA 3VCNA 4DJDC 2OLAA 2BZNA 1LOLA 3SBFA 4AEFA 3TW7A 1GOWA 2QMJA 2NV1A 1EP2A 4KWUA 3VOGA 2CCRA 2WMIB 3SAZA 4FMVA 3HPSA 2AMGA 2J77A 4P61A 2OU4A 4V15A 4ZR8A 3P61A 4FPSA 3W7RA 3QOKA 2CKRA 1A5MC 5I6SA 1QPKA 4LVDA 3VK5A 4DYEA 1K77A 1S5MA 1T0OA 3JS3A 4QRNA 2E28A 2QF8A 2FZ9A 1WOBA 1NVMA 4JD4A 1EJXC 1RAKA 2J24A 1FX6A 3OQEA 4CKQA 2R94A 3NQMA 4XUGA 1I2PA 3A21A 4ZB0A 1YNQA 4PC8A 1F3XA 7REQA 3DDMA 1KXVA 4XAYA 1UKQA 1QI3A 4HPGA 2YCJA 1EA9C 1ONEA 2EQDA 3R12A 3S5NA 2XH0A 3KZPA 2FHFA 1JRBA 3SCTA 2CHNA 3JUGA 4UQDA 4NZ5A 2GJXB 3HMCA 4FOUA 3WQ6A 2CYGA 4ZQOA 2BBFA 1XYAA 3MO7A 2OYMA 1K8XA 3NFUA 3NM1A 1S2TA 1NQ6A 2XFRA 4XZIA 3H23A 2ACSA 3S1XA 5C2CA 5FIPA 5AHEA 1OJXA 5DMMA 1TA3B 2V5KA 1UR4A 4D6JA 4L9XA 4ZODA 3UZWA 3M9YA 4PEKA 1Q5MA 4GYKA 3A6OA 2DZPA 3EEGA 2OYKA 5BMXA 1FA2A 1B9BA 1W32A 3L5AA 1L2UA 3IJ8A 2E1WA 1Q6CA 1NJJA 2XISA 1EKOA 4Z1YA 1TUFA 2OXNA 4RE0A 1FWWA 5I24A 3HQNA 1CPUA 4H8NA 4CGTA 2CITA 3PZTA 4DY1A 1W5QA 3TJIA 5TF0A 1R85A 2PDUA 2P8BA 4LT9A 3TJXA 4DJFC 1TWWA 4YHGA 2YBTA 2JE8A 1W37A 3B9EA 4LPCA 5HQLA 3SGUA 3LGDA 3QPEA 3AWOA 4JTTA 4D1JA 3QV6A 5F4SA 2WVSA 1OZQA 1PKMA 1OG0A 1J10A 4HB7A 3WH7A 3CBWA 2FPVA 3M0MA 1GQJA 3S2JA 3QY6A 1C7TA 3IGHX 1KXTA 1OK4A 2PWVA 2GDQA 1JIBA 5EFFA 1Y65A 4JTJA 3DFYA 3UG3A 5I06A 5LIWX 4IJCA 3TYEA 4UQAA 2JEQA 4PCFA 2ZRVA 4ZTXA 1CLXA 4DXXA 4O1BA 2HVOA 1ZAIA 2POZA 3ARVA 5CKSA 2E9MA 3N9RA 3M0YA 1KD0A 8XIMA 2QW5A 2ZC1A 4OBRA 3U7VA 2XIOA 1J01A 4U3AA 4HNNA 3TH6A 2J7GA 1FY6A 5I3GA 1NAL1 1WPCA 4JKMA 2D1ZA 2QCMA 2QCEA 3UWWA 2GVYA 4L9ZA 5DO8A 2DSVA 3GWQA 8TIMA 1UWUA 3OZYA 3DI0A 1TV2A 3QV8A 1RALA 4N42A 1QAPA 1XYLA 4GY7A 4B5WA 3RDKA 3MUZ1 4MAZA 5FF3A 3P82A 4GQGA 5BCAA 2RHGA 4C90A 3AS1A 4KH2A 3TN6A 1LT7A 2Q09A 3H8AA 5I3JA 2FGLA 3BGAA 1J0IA 3PK7A 1IT8A 4UTWC 2P53A 3CAQA 4KCWA 1THFD 4P7NA 3AZSA 2XSAA 4HN4A 3ABZA 3VNLA 3QZAA 3B8VA 1TPVA 1P48A 3QGKC 2EHHA 2ZX8A 4AD4A 4FXRA 4EVZA 3M6YA 5XINA 4GH3A 1PS9A 4ZO9A 4YCPA 3M0IA 3URNA 3KCOA 2GWNA 3RR4A 1RP8A 1EA0A 1HT6A 1GG0A 3GC5A 4IHCA 4TUFA 1LWJA 2PA6A 4JFWA 4ZSUA 2E9BA 1NFBA 4O54A 1IXOA 2IXVA 4MTVA 5HWMA 2BGSA 2VEFA 1RZMA 3GBEA 4DWSC 1A3XA 4JL2A 1E0XA 3G1XA 2Z1WA 1SZNA 2A7PA 2J62A 4QDWA 5EY5A 1YE6A 1NDZA 3W72A 1Z41A 4OHQA 4A3RA 1HJUA 4P2VA 3QFEA 3GNRA 5CSRA 1R7OA 4UR7A 1YEYA 1TWSA 4YTTA 4UNIA 1ZY9A 1NWRA 4FK9A 3UWEA 2OWXA 4Y9OA 3C2VA 4E3TA 4DJEC 1EBHA 1TPDA 3U4AA 3RAOA 1UBPC 2PTZA 1ZQ5A 2OJPA 2Y5SA 4K6AA 4PB3A 3DFQA 5LIUX 1AQHA 1J0JA 1VENA 3ZZ1A 2V2CA 4X0NA 4PTMA 3W73A 5LKYA 4UOJA 4GK8A 2NQZA 2VT0A 1GHRA 4AC1X 3CHCA 1UW9A 4H7CA 1A5KC 4GCXA 4DZAA 1S2CA 4DBDA 1KTBA 2CFFA 1FWBC 3O8AA 4MNKA 4L4PA 1OX6A 2XIMA 3UCCA 3HV8A 7PTDA 1QHPA 5I3HA 4QJ3B 3P93A 1V08A 1FBAA 1OABA 1E6NA 3W6YA 3LB0A 4FZIA 4LRSA 3FIGA 5AHMA 5D04C 4LV4A 1FCQA 5TBOA 1XICA 3GNDA 5C7VA 4HJWA 3WQCA 3M43A 3B4UA 5D32A 3GRIA 2PBOA 3UGVA 3K2GA 1ZRQA 3CV6A 4WUIA 4QGCA 1FKXA 2X42A 1DXEA 3FYYA 3MMUA 3NXFA 4UR9A 5G1MA 4LBRA 2YBUA 4PRTA 2XGBA 2P76A 1O95A 7CGTA 5FF4A 3EGJA 3EKZA 4NF7A 3A4JA 4ZQCA 1XYMA 1TJPA 2BNJA 4FX7A 3G8EA 2CBUA 3O06A 3OODA 2GJNA 1QPOA 3OOQA 1AL8A 5CPQA 5DXYA 1MZHA 1JFHA 3VYLA 2YDAA 2Z1VA 3EWBX 2WVUA 4GI9A 2A7NA 1KTNA 3N4EA 3BMWA 1ZENA 5I7GA 1BKSA 1XRVA 2BVDA 3THQA 4ML4A 3W86A 3MS8A 4DYJA 1OYCA 3COTA 2XG9A 4JBRA 2PWUA 4GZIA 5G1TA 3VNZA 3OLGA 3PWAA 5CLTA 3R89A 1WBHA 4AH7A 3SCUA 3PTDA 2ZX6A 3E38A 2Y24A 5EMKA 1N82A 1QWKA 1IXNA 4EPEC 3D0CA 2DZWA 5H8PA 2QJIA 1XQLA 3W53A 1H7RA 4LF1A 3SUWA 3L9CA 4S2CA 1GORA 3PY2A 4DBSA 2PODA 1D8CA 3V7PA 3VA8A 5D2TA 3P2VA 4IIEA 5HNTA 3BLPX 3CHFA 4ZB2A 4NX5A 3TQVA 4XSMA 4J5NA 3PJUA 1QJWA 3WIJA 2VR2A 2DJXA 5FEZA 1AW2A 1PBGA 3PZUA 1GVEA 3ZJ8A 3P62A 1GOMA 5CH9A 3SY5A 1CECA 1SJAA 2YCLA 3S8HA 2WHLA 3H4WA 2HQAA 3LCFA 2A21A 1LWIA 3GAKA 3QN3A 2J7HA 1WXYA 4DLFA 4Y2WA 1E6PA 3T42A 1GOKA 5LIXX 4QAIA 2PWHA 3I3EA 3ORWA 4BF9A 2BOEX 4BWLC 1M5WA 2BWGA 3P81A 2FZ8A 5EMJA 3VPLA 2BY2A 3VZYA 2GYIA 4OV4A 3CMGA 2CWXA 2X1IA 1XI3A 5CAKA 4W89A 5E93A 1C9WA 1R6WA 5H91A 3W02A 1J9YA 2VC6A 2WMFA 2PDLA 1D7KA 1HJXA 3HPXA 3F5LA 1KM4A 4N4PA 1V3IA 3LXCA 5MF5A 4PUKA 4A3UA 1HP4A 3TCSA 3ARQA 4RJEA 1BGAA 1QBBA 1JZ7A 1H41A 1S1PA 2ZVRA 4M6PA 1RPKA 3W22A 3LPFA 2BB0A 1J0YA 5BZAA 3ANUA 4MB1A 4PTWA 1XSJA 1FWCC 4FLSA 4MVAA 1I2RA 3RCMA 1C29A 5HQEA 2JQXA 4K3ZA 4HMNA 4LY8A 3WDQA 1QW7A 1W91A 3U0HA 3TP4A 3F5JA 4K7YA 2XGZA 4QITA 1G9HA 3WK0A 4Q7BA 1GJPA 2NLIA 2XWEA 5F2GA 4PA8A 4MJMA 4JX4A 5I03A 2NVDA 2Z4GA 4HZMA 3GVGA 3GY1A 2P0IA 2CLLA 3GNNA 2NUXA 5T26A 5F2LA 4F79A 3VZXA 1QTWA 3NQVA 5JXQA 3TSMA 1XIJA 2WWDA 4IMEA 1EZ2A 3C2RA 4JN8A 1QWGA 4H41A 5CXPA 3TXZA 2PSNA 4NSBA 2ATMA 1LJYA 4BQ2A 1DXFA 4TVDA 2V63A 1V4YA 4WIWA 1PJ9A 3VNMA 1MDLA 4M7SA 4Q3MA 5HJYA 3RRAA 1XBXA 4U10A 3ZVHB 3B0YA 5C9WA 5JH2A 4XV0A 3TU9A 5CJ5A 3KP1A 1JDDA 2QULA 3UCQA 2VFIA 4ZQRA 4YWSA 4B3LA 4H4IA 1LL6A 3AHTA 3MZ2A 3G77A 1LORA 1R8LA 1CXKA 3W27A 3I65A 1JAEA 2ZX5A 2ZWZA 4PULA 4JTUA 5E0CA 3HGOA 4TXEA 2OEMA 1LG2A 4JOMA 4U5IA 5ABHA 3HPFA 3SUTA 4D6IA 1XIFA 4HHMA 1EWDA 1MFVA 1H1NA 4I9JA 4J1OA 5AZ1A 3QMSA 5AVHA 1K7XA 3ALFA 4W7VA 3WQPA 3SZ8A 5LNVA 3FAXA 4IXXA 5GNYA 2PPGA 4PMVA 2G37A 1RD5A 4FS9A 4GD0A 4PUUA 3W7HA 1EX1A 4LALA 3PR2A 3Q94A 1MDRA 3EPNA 3U8GA 4D6GA 4TQTA 2Z2AA 1LWHA 1K70A 3OLIA 2GQ8A 3KRZA 3KAOA 4D6DA 2ALRA 2JF6A 4LYRA 3ISIX 3GDBA 1G4SA 1PKYA 1W1IE 4RW5A 3UZJA 4LWWA 4Q4RA 1E1FA 1P6BA 1UROA 3N9SA 4HSHA 2Q8ZA 5AC8A 4GCAA 3MKCA 3M0LA 4XKYA 1UA3A 1VYRA 3HOJA 1Z7AA 3NVTA 3ZOAA 3ONCA 2G3MA 2O9OA 2E6AA 4IQJA 2FGZA 3SQMA 1CEOA 1WX0A 1B0IA 3GHSA 3SCVA 5AZ0A 3PVFA 3B9AA 1SPQA 2E0PA 3N25A 3GHRA 1QASA 5DF0A 2V67A 2E3ZA 2DJLA 2WO5A 1VBUA 3GFXA 2B81A 4D72A 1EPXA 3CWHA 3KL3A 5IDZA 3VUSA 1QPQA 3BICA 3KBJA 3NO5A 3ZLHA 1SJDA 1JYVA 5BROA 2J4GA 1LCOA 1JRCA 3FX4A 5AYBA 5LNWA 3MKKA 3VOJA 2NQ9A 3VM7A 1CLVA 1W3LA 2A6NA 1TV3A 3ITLA 1BVWA 2FFIA 1T8XA 4RZBA 2E77A 4ILSA 1EJUC 4R34A 4GFIA 3MKVA 1TPFA 1S5VA 2PE4A 1UIOA 3USBA 4G56A 4V2XA 3UWQA 4N9EA 3CAKA 4NJKA 2V30A 4LF2A 4QX4A 3K8LA 3T0AA 1YPFA 3FHQA 2E7FA 4LTSA 2W61A 3WJZA 5C2GA 1XGDA 2QZRA 3BGGA 2I14A 4LJ3A 2YW4A 5AHFA 2PZNA 3AYRA 1YTKA 2I5IA 1GCYA 4GABA 1JR1A 5EMUA 1OYAA 1H62A 3R1ZA 3W01A 4HNUA 4O52A 4Y8FA 3NQBA 2WXDM 4JTIA 1SFJA 4REQA 3MMWA 4YTUA 1OB0A 3NL2A 1TCDA 2B7QA 2D3NA 1G69A 4W84A 3E0LA 2FVLA 3S6OA 1T40A 5DRIA 1GKQA 4MGGA 5GNXA 5KMYA 3AOFA 3PBMA 4BQ3A 1TV4A 2E8YA 4UR8A 1G67A 5HOSA 4CQ8A 3EWYA 1RLDA 1BXNA 1XCXA 3APGA 5FJJA 1CCWB 4BF5A 4S3EA 3F5KA 1H5VA 3C0SA 4WKFA 4XUYA 1W3IA 3N9KA 2JEPA 3FK4A 1XIIA 1XV8A 4K38A 1DHPA 4FA3A 2E6YA 2QS8A 5K7JA 3VCRA 3HN3A 2Z1BA 4ZE5A 5ABFA 3W7QA 1MQPA 1VC4A 4C6NA 5BU6A 4B5NA 4R9OA 3L5LA 4Z2HA 3RJXA 1UR1A 4LC6A 3F7JA 4HZ8A 4PRWA 4PBFA 3L5MA 1K6AA 1W1ZA 2B0MA 1TE6A 5JBEA 3VZZA 2VGIA 2D20A 1DYSA 1PTDA 1X8CA 4DAFA 2H3DA 1IEQA 4AWEA 1Q7QA 2C15A 1JG9A 3GZ3A 5H2ZA 4GIRA 1GVQA 5M2FX 3C0QA 4FI4A 2VEIA 4DN1A 4CNPA 5RUBA 5K4XA 1CXFA 3UPMA 3DCPA 2V3FA 3GR7A 2FB2A 1R3TA 3NDOA 3PAJA 3WSUA 2J74A 3RGTA 3Q45A 4US5A 1W9VA 1XD0A 2JGQA 1B2YA 3M07A 4K68A 5I5RA 5D8WA 1KFKA 1F74A 3Q37A 2NZLA 3BG5A 3O0FA 2X16A 1E9YB 2CLMA 3W00A 2OX4A 2V8ZA 4O0KA 4A8IA 4NXKA 4ZVJA 3OYXA 2P5NA 1LRTA 3TTQA 3LXAA 4I8DA 4MY9A 1MUMA 1IF2A 1XLBA 3SCWA 3CUHA 1Q6OA 4XD6A 4NKCA 4QBXA 3T0TA 1E0TA 1FTXA 3CGTA 4DJDA 5CJNA 1KRCC 1H2JA 3HG5A 1LUCA 1M41A 1TCMA 3BXWA 1U5JA 1FXPA 1CGTA 1Z3NA 4DM1A 1MWOA 3AIVA 3H2CA 3UZ5A 3BLDA 3WQOA 3DFNA 1L0PA 3C86A 4PUMA 1GTEA 1UJQA 1VS1A 3CH0A 4LNCA 3FV9A 3IEBA 2CLIA 4LYQA 2JBMA 1O5QA 3TDFA 2WM1A 4F0LA 3HIJA 1W5OA 1F3WA 1KB3A 1XINA 2WANA 2DW7A 1I6NA 3LCWA 3DG7A 3W74A 4FNUA 1EBGA 4I90A 2PAJA 2Q3OA 1WUFA 1CWYA 1JPIA 3AYTA 5FAJA 4I7VA 4TVCA 3V0TA 1BG9A 1KBLA 2QNEA 1LZOA 3VIJA 3VVGA 4CCEA 1F4HA 3H6OA 3H53A 1QNRA 2QCLA 3FA5A 3BZJA 1WYIA 3EOUA 4IMDA 5IRPA 2OSXA 1ZJIA 1QI4A 2CZEA 4CD7A 1YXCA 3AI0A 3QHMA 1HUVA 1J18A 2G3IA 3T6CA 3LHVA 1C8XA 4UTMA 1EFZA 1VCFA 2WC7A 1DTNA 2IQTA 1MEWA 2PCEA 4CVUA 4HZ7A 3AALA 3VMPA 3HG3A 3V1HA 1ZBKA 1IWAA 3M0XA 2OLHA 2DVXA 1LRQA 2WC4A 3WX7A 4JY9A 1D9EA 1T7LA 5AOUA 3KBWA 2XN2A 4ZQPA 3NQDA 1R3YA 5IOBA 1RCOB 4ADTA 3FA4A 2W92A 3GXMA 4H2HA 3PWGA 3EKGA 4EWJA 1QBAA 3SIZA 3AROA 3W7OA 3CIVA 2EJ1A 2VQTA 3WNNA 4AD5A 3RHGA 3VIOA 1S5TA 3W75A 1W1TA 4HA3A 5HA7A 1GJWA 4ZXOA 1VZWA 3G24A 4DJFA 1M6JA 3PSWA 3KS5A 2W67A 1MW0A 4AZ6A 1TELA 4R7OA 3NNTA 2R1LA 1DE6A 3PUGA 1ZJBA 5DCEA 2HJPA 3QZ6A 3BCDA 5D02A 3TOPA 1WOAA 3JR2A 2WLYA 3K13A 3G1DA 4I6KA 4LC8A 2WCSA 4A35A 1G94A 2DQWA 3AU2A 3TCEA 3CZEA 3O16A 2V5CA 4WXYA 1UH4A 2WM0A 1XPYA 4B5TA 3F4NA 4TX6A 4HGXA 1WE5A 4MLRA 1MEIA 3DBPA 3VGHA 1RBAA 5FD0A 2A3BA 1O5XA 1BKHA 2G3JA 3FEQA 3U5UA 1D3CA 3N2TA 2X0YA 3S4TA 3W71A 1MUWA 3M1ZA 4HPHA 3RX3A 1I2QA 2ALDA 4WY0F 4IGHA 3RU6A 1EGVA 3BDKA 7TIMA 3UXDA 1NIUA 2VO5A 4JX5A 1OC7A 2HISA 3BQ6A 3H55A 2IUZA 1OSEA 3ZYZA 5CPSA 5FCZA 1IXPA 1V6UA 3DYMA 3BANA 1TRIA 4UTLA 4RXGA 3W25A 1GK8A 4GA8A 5GPRA 4ES4A 1XD1A 2KZHA 4KFNA 3T2OA 2YXOA 2YZRA 1WDRA 5D4YA 3WF3A 1OC5A 2YL6A 3MSDA 1EJ7L 3ARRA 4FX8A 3C4UA 1QXLA 4Q8QA 3BLKA 1WXJA 2VP8A 3L4UA 4ZE4A 1WZMA 2Y6ZA 3TA9A 3DGBA 2Y7FA 1JGMA 1XQKA 3ZMRA 2TODA 2OZ0A 5GQBA 1LRNA 1LLWA 4AIBA 4AEOA 2PF0A 4MG4A 1DP0A 1VFHA 5BWAA 1G01A 3LHYA 3L4WA 4JS3A 1I45A 4CQDA 4TIMA 4ERGA 4GO9A 4US6A 3A5VA 3ARYA 3S2LA 4YVPA 2PDGA 2Z6JA 1QU4A 3NQ7A 1XR2A 1JI1A 2FMNA 1IHIA 3MVIA 4UTWA 2YB1A 4DZ5A 1G7UA 3F1QA 4B5VA 3AC0A 3WBWA 1QT1A 1HGYA 3T8QA 4MY1A 3GHUA 1X39A 2YCLB 2DQXA 2GPTA 4HJFA 3SRFA 3SN0A 2WKLA 1YTEA 4IICA 4L4LA 1TWZA 1TJ0A 3VD5A 3VFCA 1TV5A 2JIEA 1QOPA 1V0LA 5CG0A 4Q4MA 1GKRA 1UOKA 1VBRA 4UFLA 3VKDA 4MWAE 3DI1A 3TTSA 2PURA 3ZWTA 3VIHA 4DWSA 1FFQA 3FEMA 3LU2A 4RZ5A 4BQ5A 1UWAA 3SADA 1O94A 1XLMA 3G18A 4J3WA 1TPUA 1ZP3A 2EO7A 3VGBA 3RMEA 4E2BA 4Z2IA 3G6MA 2HMCA 3R2GA 1F7BA 3WD1A 4P7RA 2IPWA 1WDQA 1T41A 1DTUA 3WFAA 5DQPA 3FVDA 1VHNA 3W2JA 1OWQA 1V7YA 4DJEA 3UJ2A 3CL7A 3G5EA 4QLKA 2HRWA 1GHSA 3NVDA 1F76A 1FCBA 1UG6A 1XIHA 2RFGA 1FDZA 1UKOA 2J27A 2GOUA 4LVGA 3WBXA 2PLJA 4M1BA 5HUPA 3N4AA 4KGJA 3S9ZA 3BAYA 3GXPA 5I79A 2BHYA 2ADAA 3WQ8A 1W1VA 4Z08A 4XVEA 2PGRA 3G1FA 3L23A 3BW4A 4HMCA 1OD0A 1OINA 1IEVA 3W23A 1DVJA 1H1YA 3BK0A 1VFUA 4S3BA 4JFUA 4H19A 4JHOA 4J28A 1P43A 4Z1BA 2DIKA 1G7VA 3OVGA 1KM0A 3IAPA 1I2NA 1UMYA 4AFYA 3N3TA 2XIJA 2E6DA 3OB8A 4EANA 4HOZA 3P7YA 3WJXA 3ENLA 1S2UA 2D23A 3VKCA 1M03A 4WZHA 4GNVA 4N7QA 2FMOA 1E9ZB 2QJJA 1UASA 4JAWA 4AYSA 3CL8A 4W8LA 4O8AA 5CLWA 3A9BA 1ZU8A 5F7UA 3LCGA 1UR3M 2Y8KA 4JQ4A 2EG7A 4JQ2A 5A6TC 1PIGA 3TMLA 1P0DA 5E5CA 2VEGA 4C6MA 1LLZA 1XCFA 4HU8A 4QFUA 1SO5A 2Y7EA 3TAOA 1XBVA 1V79A 2CBVA 5G2IA 3E3HA 4QDPA 1NQKA 3TE9A 3V5FA 2VOTA 1YQ2A 3PZVA 1PSCA 3HG2A 1S1RA 3GUWA 3IJDA 4JN7A 4AVNA 1FH7A 3S5SA 3IVTA 4U2YA 3UW6A 1KO0A 3G0XA 3VNYA 4XAPA 4MWAD 1POJA 5E9AA 1IR2A 2QMKA 1LBFA 3BAJA 1V02E 3E6EA 2QJGA 3CL6A 3FY1A 4E0CA 4P7LA 5I78A 4CVWA 4Q8UA 3G0UA 1F4AA 4AIEA 1W9BM 4OFCA 5C70A 3O05A 4JR5A 4XKYB 1VPXA 2ZRZA 2E8ZA 3TOYA 1F5ZA 4GQQA 3H7RA 3H2NA 4DIAA 4Z1AA 5HDRA 3ZIZA 4QAWA 1R9XA 2QAFA 1B3ZA 5IHSA 4AVFA 3PUOA 5T8GA 4KBXA 4B16A 4GKTA 3VNIA 3WF1A 1R2SA 4O1CA 5HANA 4V1XA 4C5ZA 4GE8A 3HPAA 1RY8A 4HTYA 4NRRA 2VUYA 3LUTA 3VILA 1Q2SA 4L7ZA 3C5QA 4HNLA 3T08A 3CAWA 3RPTA 4WOQA 2GUUA 1SJCA 2TPSA 4GISA 3GR4A 1E3ZA 1PKNA 1MXGA 2V5LA 3LEPA 2CZVA 3AHZA 2W79A 4GI8A 3V1PA 5TD4A 3L0GA 1GKPA 1NOFA 4IMCA 4A22A 2OO6A 1P5BA 1Y0EA 4BWLA 3OTRA 3C3UA 1OCJA 1ZCCA 2QCHA 4KERA 2HDJA 1W1YA 6XIAA 2DZTA 1K4HA 1OC6A 2UY2A 1U83A 4H9VA 4Z42C 1X1NA 2GJLA 5CQ1A 3ZT6A 1JPKA 1JPMA 5D33A 3RX2A 3WG6A 1GOIA 3NO3A 2PGWA 4CNUA 3U5YA 3H24A 1FCUA 3OA3A 1FHVA 4RNFA 1DHKA 2ACQA 5I77A 3UD6A 3AISA 4DRSA 2Z25A