2ACSA

An anion binding site in human aldose reductase: mechanistic implications for the binding of citrate, cacodylate, and glucose-6-phosphate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
314
structure length
314
Chain Sequence
SRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ALDOSE REDUCTASE
publication title An anion binding site in human aldose reductase: mechanistic implications for the binding of citrate, cacodylate, and glucose 6-phosphate.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1994-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2acsA00
1XJBA 3UZZA 4Q7BA 1S2AA 4JQ2A 4WDTA 3WBWA 4FALA 4ZFCA 5C7HA 1MZRA 4WGHA 4XO7A 3GHTA 3EAUA 1IHIA 1AFSA 3M0IA 2HE8A 3WBXA 1QRQA 2INEA 2PDMA 1LQAA 1S2CA 4XK2A 3RX3A 3V35A 2PDYA 1YNQA 3H7RA 3UG8A 4XAPA 2IPGA 4QR6A 3GHUA 1X96A 3EB4A 3UZXA 5HNUA 4ASTA 4H7CA 4OTKA 4AUBA 1EL3A 1K8CA 3UZWA 3P2VA 4PRRA 4YVXA 2R9RA 4XZMX 4HMNA 2IKIA 2IPJA 5AZ0A 4WDXA 5M2FX 5HNTA 2R24A 3UGRA 3M4HA 3CMFA 1T41A 2FZ9A 4YVPA 2IPFA 2ACRA 3GHSA 1A80A 3R8GA 3UWEA 2PD9A 3G5EA 2AGTA 2PDFA 3DN5A 3EB3A 1Z3NA 2PDNA 2PDUA 1RY0A 4YU1A 1YE6A 2HV5A 4PRTA 4QX4A 2ACUA 4XVDA 1UR3M 2ACSA 1EXBA 3LEPA 1PYFA 4Q3MA 3RX2A 3V36A 3CV7A 2PFHA 2WZTA 1S1PA 3ONBA 3CV6A 3LN3A 3UFYA 4XZNX 3CASA 1EKOA 2I16A 1Q5MA 1VP5A 4WDWA 2F38A 4H8NA 5JH1A 4QXIA 1IEIA 4LAZA 4DBUA 1RALA 2J8TA 1J96A 1AZ1A 1QWKA 1R38A 3Q67A 2P5NA 5AZ1A 3V0SA 1S1RA 3GHRA 2A79A 5KETA 1C9WA 1AH3A 2PZNA 4XVEA 4XZLX 2DV0A 4F40A 4WRHA 1AH0A 4MHBA 4L1WA 2PDQA 3LBOA 2IKGA 2IKJA 4JQ3A 1ADSA 2I17A 4HBKA 3LQGA 4XZIA 3UZYA 2FVLA 5LIXX 2NVCA 4YS1A 4WEVX 2HDJA 4R9OA 3WCZA 2IQ0A 4ICCX 4PUUA 3LNMA 2FZDA 4LB3A 4DBWA 2PDKA 4JIIX 4JTQA 2HVNA 3N2TA 4IJRA 4DZ5A 3WG6A 1YE4A 4GACA 2HEJA 1EF3A 2PDGA 4FAMA 1PZ0A 4JIHA 3D3FA 1Z89A 2PEVA 3WBYA 2IS7A 3C3UA 3LUTA 2C91A 5LIKX 2QXWA 2PDJA 5DANA 1PZ1A 1MRQA 2PF8A 4IGSA 4PUWA 3U2CA 2PDIA 4G5DA 2HE5A 1OG6A 2PDHA 5HA7A 3LZ3A 1HW6A 5LIWX 4YVVA 3QKZA 1Z9AA 4JTAA 3CAQA 1T40A 3GUGA 2FZBA 2PD5A 4GQGA 4GCAA 3R8HA 2PDWA 4RPQA 3BCJA 4FA3A 4GABA 3R7MA 1Q13A 1X97A 1AZ2A 2PDCA 4WDUA 2HVOA 4LBRA 4I5XA 2FGBA 3R43A 4QBXA 4JTRA 1Z8AA 4XZHA 2PDLA 3FJNA 2BP1A 3ERPA 4PR4A 3FX4A 4GA8A 2BGSA 3VXGA 3F7JA 3DOPA 3COTA 2PDPA 4L1XA 1XGDA 2DUZA 4JIRA 3UP8A 1XF0A 4JTDA 3MB9A 1YNPA 3BURA 1VBJA 3H4GA 4PMJA 2IQDA 2BGQA 3CAVA 1X98A 3T42A 1ZGDA 4EXBA 1ZUAX 4JQ4A 1LWIA 4LBSA 3V0UA 2PDBA 2DUXA 3R58A 3M64A 1FRBA 2CLPA 2VDGA 3ONCA 4GQ0A 4EXAA 4LAUA 3LD5A 1RY8A 3V0TA 3H7UA 3RX4A 3R6IA 2IPWA 2ISFA 4IJCA 3G1RA 4NKCA 5LIUX 4XO6A 3O3RA 1MI3A 3R94A 5LIYX 1PWLA 2INZA 4JQ1A 3LZ5A 1ZSXA 2WZMA 4GIEA 1ZQ5A 2IKHA 3LENA 1GVEA 2F2KA 3N6QA 2ACQA 1HQTA 3Q65A 2PDXA 1PWMA 2ALRA 1AH4A 3KRBA 3O0KA 3BUVA 3MC5A 4LB4A 3BV7A 3S3GA 1JEZA 3NTYA 4DBSA 4JQAA 4JTCA 5JH2A 4FZIA 2NVDA 1M9HA 2FZ8A 1SM9A 3LQLA 3UYIA 1US0A 3B3DA
chains in the Genus database with same CATH superfamily
1KCLA 2GQ8A 3W7CA 5A6BA 3EWBX 4QM1A 2WMIB 4CNTA 1FWEC 3WELA 4HA4A 1LQ2A 3GHTA 3SUSA 4JNYA 4K8GA 3KDOA 1E1CA 1ZJAA 4GUHA 3A21A 5HATA 2QCDA 2VUNA 5C71A 2W4XA 2PDYA 1QWGA 5HXMA 1V02A 5I24A 1XLMA 2PGRA 3P7YA 4QR6A 3HPFA 4M82A 5C9ZA 1BAGA 1BWLA 3E49A 4O13A 4DNHA 3VNLA 5AHLA 1DXFA 2WZEA 1XDLA 1E6QM 2CIPA 2E6AA 3EB2A 1DTNA 3KBNA 3W00A 4G1KA 4M3PA 2ZQ0A 4HJWA 4PRRA 3CTLA 5BWFA 1BGGA 2R9RA 3UJEA 1QNPA 4XKYB 1E4LA 1VFTA 2Z0IA 1Q7MA 4PUMA 4B16A 1UBSA 3ISIX 2R14A 1KCZA 3VMPA 3GHSA 3BJFA 3OU8A 4LRTA 3SRKA 4WSHA 2PDNA 3G0XA 1NWSA 2PDUA 4BF5A 4LS1A 4R34A 3SCUA 1BTCA 3CL6A 4QX4A 4Q4KA 4Y7EA 1ZCCA 4XVDA 2YBUA 4L9YA 4L4OA 4IIFA 1P7TA 3NOYA 3WD0A 1E9YB 2J7HA 4JFSA 3NL5A 3WYZA 3IAQA 3UFYA 4DI8A 3M07A 1KCKA 1LG2A 2ISSA 3CLWA 3BMXA 4WXYA 2Y5SA 1UUQA 4INFA 5A2CA 2FJKA 3VKAA 3GBDA 1U5HA 3U6WA 1KFLA 4NZJA 2C1IA 4K7YA 5D37A 5ECVA 5CGTA 4KEZA 3OIHA 3TEVA 1LF1A 4AIEA 1WDDA 3VKDA 1I4NA 1OFOA 2GPTA 1WV2A 2P5NA 3BH4A 3ZM8A 3WMBA 1X1OA 1AQFA 3VKBA 3AC0A 2QMJA 3C52A 3DFNA 4L64A 2XH2A 1WXYA 3KEHA 3H2AA 4WJXA 2AL1A 3NQEA 1E6ZA 1B31A 1BQCA 1CBGA 1SFJA 1KRAC 1EWEA 4FI4A 3RUBL 3S47A 2JKPA 3VZXA 1XRSA 3UWQA 4JIEA 3GTXA 1I2QA 5IDIA 3S6TA 5IHSA 2E09A 3BLPX 2HDJA 3W6MA 3ZFHA 5HQLA 3G1HA 1OK4A 4US5A 7PTDA 2DIEA 4IFKB 4LAOA 5FKYA 3B0PA 2ASHA 1A5LC 4LY4A 3N2TA 3ABOA 4JTUA 3EPMA 3AFBA 1YE4A 1EDQA 3WLKX 1GTEA 4RKAA 3DKJA 1PZ0A 4JIHA 3GNOA 3BARA 4RPPA 4TV5A 4HMCA 1UIOA 5DO8A 1OFAA 1XIBA 4V2XA 1GVOA 1TTQA 5K4ZA 1FCUA 5EFFA 3NZ1A 5GJNA 5A95A 1C8XA 5DANA 3TWAA 5A3HA 1FP8A 3H21A 2Y7FA 4G5DA 2YIHA 3GB6A 2J8GA 1XIJA 1XI3A 3AZTA 1E0VA 4X9SA 3WNLA 3AWOA 4LQ1A 4WF7A 2GGHA 1V0MA 3F4DA 4CCZA 5HUOA 5EMJA 4QIUA 4DJFC 1OX4A 3I3EA 4NAEA 4AZIA 2OQLA 2WVUA 1JAEA 1MDRA 4NJHA 2GJNA 2ZKMX 3BCJA 3HA1A 4RZBA 3L0GA 4FIQA 2R8WA 1F2JA 1C8YA 1MRAA 5D09A 3UJFA 3JRKA 4I5XA 4YCPA 2E40A 3UXDA 4D6EA 1UZ1A 3TOPA 2PMQA 3VOCA 3E02A 3CWHA 3S2LA 4AY7A 3EKZA 2VEPA 3L66A 4NHVA 4PR4A 2WM1A 1ZBKA 5AYXA 3UA4A 2X40A 2WYSA 3UY7A 1W6TA 5C9XA 4EXQA 3FEMA 1ECEA 2PDPA 1HKVA 2TSYA 5IDZA 1TMLA 2Z29A 4FR1A 1RVKA 4XSLA 3T2OA 2D3LA 3AIUA 2CETA 5KITA 3BURA 2G5WA 2XH4A 4HU4A 1XYLA 2BGQA 3P8JA 2NUWA 3FY1A 3FDKA 1LWIA 5DT5A 4DM1A 4LBSA 1GW1A 3N9RA 4D8LA 5JVLA 4NXSA 3PZGA 2DZUA 4UTTC 5JBDA 3NA8A 3ITLA 3P93A 3VOHA 1E3XA 5G1YA 1KRBC 3ECQA 1XINA 2ISVA 3KVKA 3UF9A 3UA3A 4H9YA 3DIPA 3GH5A 4OGZA 1SYTA 3DHFA 1JUKA 4QG8A 1JCNA 1DJNA 3BOLA 3P80A 1VEPA 3C8FA 4GRSA 2GUYA 1WO2A 2J27A 1EQCA 3KHJA 3L67A 4UCGA 1QFEA 1QHPA 3G1SA 3QZ6A 2VX6A 3RPMA 3SZ8A 4EANA 4DEFA 3IK2A 4HVXA 3KVLA 3LCWA 2D73A 2XVPA 1OM0A 1KKOA 4K2SA 5CC3A 3C2OA 3CQHA 1XLEA 3AMLA 3IUIA 1TJRA 1XUZA 1V0NA 2F2KA 1MW0A 3GLCA 1CIUA 3KE0A 3LDVA 4KEVA 1Q6RA 4FNQA 4XAZA 4KCUA 4XAGA 3N19B 3NVTA 3KRSA 3UR2A 2CLIA 4KF1A 1EZ2A 1Q8JA 4HNTA 4JL2A 2QZRA 4ZENA 1GQJA 4KEUA 2Y7DA 3MV11 5JH2A 3HPXA 4UTWC 2UY3A 2CPUA 1W54A 2J6XA 4Q4QA 1OFQA 5EA9A 3LQLA 1D3HA 1A5NC 3VDHA 1LYXA 2X09A 2J7DA 2ZCGA 3P60A 3WBWA 2HJPA 1NAL1 3SCWA 4A29A 1WZKA 3HIJA 2GK1B 1VHCA 3P0WA 1QVBA 5D8WA 5DXYA 4AD1A 1AMYA 5EMLA 1ONXA 4XIAA 2VHLA 3IJ6A 3DYPA 1TRIA 2VI0A 1O5QA 5CG0A 5HANA 1H11A 1C8QA 5E6ZA 1XYMA 1UA7A 5C2XA 5K7JA 1KV8A 2DEPA 1S2UA 1EL3A 2PLCA 4HHLA 3G6MA 3BANA 4IGHA 1XISA 4E4FA 2J7BA 2O9PA 4XTDA 3VIIA 2R24A 3BC9A 4TIMA 1V77A 5GJPA 4GXPA 4TX9A 3O0FA 5H1WA 1PJ9A 3PPFA 2V5JA 2XHYA 1KXTA 3LI1A 3T08A 4Y9MA 2X0YA 3K4WA 1CXFA 4XD6A 2DZSA 3H24A 2X30A 1R3VA 3EXTA 1OC7A 2Z7GA 2Q6ZA 2A21A 4OU1A 2I7GA 1XLKA 2DJLA 1RPXA 4IP4A 3SQLA 4ZTYA 3T4CA 2HPMA 2BODX 4M51A 1E51A 1QAPA 3HURA 2QVNA 4PMOA 3TONA 1MW1A 1H60A 4HTYA 3W1LA 3AIQA 1L9WA 3DH7A 4Z2GA 4ZB2A 5D03A 5D2YA 1FTXA 3CAKA 3KL3A 4IXXA 3OVGA 3QEZA 1I8JA 4Y6GA 2OODA 4O8RA 1CNVA 1RD6A 4GQRA 4RNFA 2PSNA 3Q67A 1QHZA 4PC8A 3HQNA 2A79A 3M0ZA 5DRCA 4GX8A 1SZNA 5I78A 3MYOA 1GG1A 3LI0A 3V5OA 3GVQA 3LRMA 4UWMA 3QV8A 1GCYA 1U1HA 8TIMA 3AS1A 4DZHA 3IGUA 2ANUA 3GVGA 2BY0A 1KTCA 1R0MA 2I17A 3ZR6A 3AYVA 1ODUA 1KD0A 3WUEA 5I6SA 3OLGA 1XC6A 2DSWA 5CJ5A 4ROQA 1BLIA 4UC5A 4IPJA 3T0CA 3ABXA 3CTTA 4UFIA 1ADOA 3FS2A 4DZAA 5FACA 1OWQA 4E3VA 4JIIX 5HULA 2Z28A 3ZYZA 3CUGA 4K36A 2FTPA 3KS6A 1M03A 3H2NA 1ITQA 2E5DA 2BSLA 3I65A 3WFLA 2QJNA 3ARPA 2AQOA 5HR6A 4OOUA 1W3KA 3TYDA 1VJZA 3QVQA 4HA1A 4YJ5A 1R30A 3O05A 4JFTA 2PDIA 3NQVA 1ESWA 1OG6A 1RD5A 3Q37A 3E2RA 2PDHA 5CZ0A 3M7WA 2R1MA 4M0XA 5E9AA 1SFSA 4DJEC 1Q4WA 1P0DA 1PZ2A 1VBUA 4GI8A 4PMZA 5BMWA 3H55A 5HDRA 3QJAA 3XINA 2YYUA 4F4RA 2OLSA 2YXXA 2PWVA 3SCTA 2AAAA 5ABGA 2KZHA 4UR7A 1DP0A 3LHVA 1R47A 1UPPA 4MB3A 1B54A 1JZ2A 3C2RA 1W56A 4IPIA 3S1XA 1CGUA 1W2PA 3W1RA 1BSLA 2GOKA 3GFYA 3N2XA 1UJQA 2H6RA 4XBKA 1A50A 2BP1A 4LUTB 3ZJ6A 1VIWA 4EF9A 5CPMA 2H90A 5BRBA 4HMDA 3B4UA 4DAIA 3FLUA 4MAVA 1KCXA 2ZWYA 2GGGA 3NQ2A 5KSWA 4BCEA 3S6DA 3T81A 4MJMA 1O60A 1EJTC 2VZTA 4JIRA 5J5DA 3C8NA 3SCNA 4C6OA 4A3RA 1F6KA 3W1TA 3W7PA 4ACZB 3I7RA 5AHEA 4E2DA 2YL8A 4EPEC 2PCEA 2XSAA 4XIMA 4BJHA 2VENA 4A6GA 1P4CA 4UMCA 2Y63A 3EBVA 4KGJA 4BWLC 1HX0A 2DZXA 3EDDA 4KWUA 4H9VA 2ZICA 3QV7A 1GYMA 3G1VA 5D2WA 3TP4A 3DZ1A 3W84A 3WZ0E 5PTDA 2RDUA 3NIYA 3UWYA 1QOQA 2VDGA 4PYSA 1OYBA 3S1WA 2BXYA 4LAUA 4QITA 5H8PA 3W7IA 1CZ1A 4H4IA 3RX4A 3R13A 5A6MA 1X1ZA 1FCBA 5FESA 1UD6A 2VDHA 1XIHA 1CW2A 4QEEA 5HJYA 5HK4A 2DQWA 2WO5A 1LJYA 1E72M 3QR0A 4C6CA 1E9IA 1N2VA 4FMVA 3TE9A 1ZQ5A 3ARUA 5D8ZA 2E1DA 5LHFA 1UBPC 4GGBA 4ZSUA 1UH4A 1L8PA 1XH0A 2CLOA 3HGSA 3CUJA 1J5TA 4LW7A 1UR4A 3VFLA 3FSTA 3WK0A 3GW0A 2OEJA 1RA5A 3BUVA 1KRMA 1G69A 2Z6IA 2WMIA 2J9XA 3ZQ9A 3PZTA 3AWNA 1NFBA 3KP0A 4Z17A 3B8UA 1B9ZA 2E8YA 4PMXA 8A3HA 6XIMA 3N11A 1KM4A 4CQ9A 1NP0A 4AD2A 1RCXB 1S2AA 3MCMA 4FALA 1FWTA 3WH7A 4KKXA 1YTKA 2XIBA 2YW4A 4UFKA 3E5PA 4ZXLA 1V03A 4HK5A 2YCJA 4HPHA 3ZWSA 3NDOA 3LYEA 2DP3A 2R82A 1AW5A 1WZAA 4DUWA 2V0TA 1KBIA 4ZMGA 1R2SA 1JNEA 4XKYA 4N4QA 3KBWA 4UZUA 2GSEA 2CKRA 1ZBCA 1I2RA 4A8LA 1EA0A 5A8MA 4HYWA 1G4SA 4C91A 4O53A 2Z2UA 4O1EA 1WDWA 4Q8PA 2ZA3A 3TYZA 3IRDA 1N8IA 1S3TC 4IIHA 3KL5A 3OVRA 2D20A 2EEXA 4CGTA 1RP9A 5E09A 3U3HA 3W7HA 3V75A 5CPTA 1MNSA 3NZPA 2V2HA 3CPRA 2ZX8A 3ZS4A 4PZVA 1R3QA 4JHMA 4U10A 2OOFA 1GTHA 4UQ9A 3CQJA 4AD4A 5DY3A 4G8TA 1AL7A 3FYOA 5E0FA 3FN9A 1M01A 3CPGA 3RR4A 4Q6XA 4EPBC 3PUDA 2ISWA 4P5UA 4CN1A 5DY2A 5AC8A 1GQKA 4AC7C 7ODCA 1TPB1 4H8NA 1EX5A 2BOGX 2XGZA 3GNXA 3LCXA 5J04A 2FPYA 5GNYA 3ITXA 2XIOA 5TF0A 4LF1A 5CBBA 3IIPA 3PPGA 1I1WA 5CPOA 5G5IA 2PRLA 1PTAA 2ON3A 4HIBA 1RK5A 4PUNA 1OF6A 2YYTA 4ZO6A 3RO8A 3S1VA 4BZYA 3MBDA 4ADSA 2HS8A 1GG0A 2VCAA 2XTKA 4FNPA 2IKJA 3O6DA 4QGCA 1YXDA 1E6RA 1LOLA 3A22A 4IFKA 4UOJA 2G41A 2Z6JA 4WEVX 3WCZA 2TMDA 3MO4A 3E1F1 2VD8A 4LVFA 1J0HA 2V38A 3TNBA 2FZDA 1NWUA 3HOJA 4B3LA 2EPLX 2WCAA 5U7SA 4M6UA 3UJ2A 4AZ7A 2FH8A 2AOSA 1K03A 2TPSA 4KWWA 1M7OA 3JZEA 3S5SA 1Y65A 1MDLA 2G0WA 1V51A 5AYYA 4MAZA 1XCFA 3EWUA 1HO1A 4FXRA 4Z08A 1B3VA 1OX5A 2IS7A 1DL3A 1XWYA 3LG3A 1BYCA 5IRPA 5H2ZA 3EOUA 3LZ3A 4ZFMA 1YHTA 1GW9A 4BY3A 3GD6A 4QHRA 2YB1A 4J5NA 5LXEA 3W07A 3AQUA 4DI9A 4ZO8A 3LPFA 5I3GA 2GJPA 3UT0A 4GZEA 4L4LA 2DSKA 2GZXA 4GE8A 2G95A 2FB2A 4U33A 3BZJA 1HJXA 3FW6A 1AUSL 3AXHA 1F61A 2BVYA 1YDVA 3GNPA 5DCBA 1O5RA 1Z44A 3RIKA 3NL6A 5IHRA 1GOIA 2QCEA 1OBAA 2J79A 4K6AA 1UQZA 3R43A 3TDFA 4LC8A 1ZU8A 3W86A 1Q66A 3CZEA 3OPSA 4NG3A 5LNWA 3E38A 4AD5A 3GG1A 3CNYA 4KWOA 1W1IE 1TV4A 5DBTA 4QAWA 2VKZG 1BXCA 4FHAA 3UZJA 5DQPA 3YPIA 1EGZA 3CMGA 3JU2A 1K3UA 3COTA 2CC0A 2QW5A 3BAIA 2CLEA 3RG6A 3RF9A 2NQJA 1XF0A 4JD4A 3CYJA 5I77A 3RRAA 2WC4A 3W73A 2G4FA 3L5LA 3W88A 4L6HA 1OFBA 4DXVA 3PZOA 1W91A 4IOTA 7XIMA 2X8RA 1D9EA 3A13A 2BHZA 4A21A 2WMKA 5BOFA 1UOKA 1W1YA 1LQ0A 4UQCA 4FXFA 3EX2A 1AK5A 4G9PA 3N3MA 3U7BA 3LGEA 4LF2A 5FOOA 1ISXA 2WNNA 4DBDA 3I4EA 4NYYA 1IT0A 5I23A 2BX7A 2YXOA 1V0LA 2FFIA 3FFSA 5E1QA 1HP4A 2V63A 4OV9A 4AFYA 1XLFA 1R9YA 4XO6A 3ITYA 1LP6A 3WLIA 3NO3A 5LIYX 2HPIA 4PMYA 4WKAA 2INZA 3BDKA 3S2MA 2BMBA 1W1ZA 3EWWA 2XM2A 3WH5A 3TC6A 5G2IA 1Q6EA 1LZOA 1FHLA 4YYCA 1R9ZA 3VU2A 1R3SA 1T8QA 4DBEA 2V82A 4ZSTA 1YEYA 1EIXA 1OT2A 1KXVA 3W7JA 4RNHA 2ZRUA 4DAFA 2E6FA 3S3GA 1XIMA 1L6FA 4CQCA 3NTYA 4JTCA 2NVDA 1SM9A 4LNYA 1PCKA 4O16A 4OBTA 2EO7A 3V4BA 2R91A 3PJTA 2GK1A 4AEEA 3OB8A 1W3JA 3UZZA 3W7GA 3WMCA 1E4MM 3SM0A 3MI6A 4AZGA 5HOSA 3WX7A 4X0VA 4LUJA 4IIGA 3GIQA 2PDMA 2G3MA 3C5QA 3TCSA 1TTJA 1NTHA 3V35A 1V0KA 1HGWA 2O7QA 1KR0A 6CGTA 3WJWA 4OBSA 2Y24A 4EE9A 4IX0A 2FPVA 1UZDA 1H1YA 4GISA 4IL0A 1UC5A 5D2TA 3W2JA 4S3DA 4YNGA 4O14A 3P2VA 3GH7A 4JFWA 4KGLA 2RDXA 3QTGA 3W26A 2IKIA 2OEKA 4DPPA 1HNYA 3GXNA 1XRVA 4C7FA 3ALGA 4DJDD 4BKNA 5H8UA 2PP3A 1J18A 3PSWA 4YHGA 5F2IA 5I3JA 1U30A 2ATMA 1F6YA 3UJSA 1TJPA 6A3HA 4HP5A 5I07A 1TMHA 2WM0A 3JUGA 1MXSA 1RLCL 4DLFA 1HJSA 1P6BA 1RY0A 1SW3A 2WHJA 1LLOA 3MMWA 2PZ0A 4DJFA 4Y9PA 3LU2A 1XGZA 4QNWA 1IE7C 1A3XA 3AU2A 3W76A 2XM1A 2NQLA 3QMRA 1N7KA 4IG2A 1FWIC 3AXXA 4XZNX 1WYIA 3AUJA 4ENLA 4FOKA 4JIQA 1CB2A 4CU8A 2H8XA 1Q5MA 4PMNA 3RLVA 3SCPA 5FEZA 2F38A 2PTWA 4N9DA 4LH8A 1IEIA 4I8YA 4QJ3B 1XIGA 2E77A 3PG8A 4LXFA 5REQB 1TYGA 4NJJA 1ICPA 3WQ8A 1I2NA 2Y8UA 2G37A 3R11A 3P81A 4IUGA 4C5ZA 1O6IA 3N12A 5A6KA 3ARVA 1GZGA 3OTRA 3O9NA 2X1IA 3ARYA 4XV0A 3QM3A 3SUTA 4U31A 1VJSA 2WPGA 3VGDA 1C8VA 1VYSX 1R7AA 2VP8A 2ZC1A 4JCLA 2WK2A 5B7ZA 4YS1A 4OT7A 4IT1A 1WB0A 1CECA 1JQXA 5FJPA 3HQPA 3LPOA 1XKJA 1OCJA 4IMFA 2PC8A 4JTQA 4LANA 1DIDA 2A7PA 3WL1A 3MKVA 3C86A 3DC8A 4NP7A 4IFOA 2OX1A 2VX4A 1H1NA 3GG7A 1S5NA 4J3SA 3R5EA 3USZA 3ALFA 3CWNA 5JIPA 4MDPA 4GX9A 1R7OA 4LTSA 1UP0A 4KFNA 3AJXA 5DN1A 1F05A 4X2RA 2OEMA 1PEZA 3P8IA 1J6PA 3GAKA 4KBXA 4NT0A 2WNWA 3IAPA 1RH9A 4XZWA 4Q6JA 3R89A 3L4UA 4JFUA 4LUTA 4Q4SA 4EWND 4ROPA 1D7FA 5GJMA 4MG4A 3I3DA 2QDGA 5AVHA 2PDLA 1NOWA 3THCA 4O1BA 3ZVIA 4JTHA 3JW7A 4Y96A 2F7FA 4ACZA 1BG9A 4D6IA 3RPDA 3PTQA 1RQEA 4AMAA 1H0IA 4P8UA 2A1YA 1V79A 4RCXA 1WA3A 3GBEA 1AQ0A 3PJUA 3MS8A 1G6CA 3UEQA 3PBUA 2E68A 4O4VA 1QK2A 3TA6A 4MKNA 2BVWA 2D0GA 1LORA 3ES7A 2VT0A 1BGAA 1ZALA 5H91A 5D9NA 3W7MA 1SJDA 3FXYA 1WDRA 1K9EA 4JTJA 1W3LA 1ZUAX 3SN0A 5LNRA 3G24A 4JQ4A 3VAVA 4P7NA 2X05A 2OSXA 1W3IA 4M6QA 3ZO9A 5BXSA 1JCTA 1EIBA 3LTPA 5CZTA 4R7OA 3WQWA 2Y70A 4BQ5A 1RY8A 1GJWA 4HHPA 3UVAA 3GDRA 3LA4A 3QSTA 1LRQA 1Y5WA 3W2NA 4IMAA 3P67A 1GVRA 3P61A 7CGTA 4NKCA 3NL2A 1LG1A 4MF4A 4PCTA 1GQLA 4KWSA 3EX4A 4ACYA 1JGIA 1A5CA 4WIWA 2PWFA 3D0CA 3TQPA 4GI9A 4JQ1A 1OHLA 3RO6A 5BROA 2SFPA 3EOSA 3WQ5A 2BDQA 4W8BA 3A3HA 3POHA 3SCVA 2HXUA 2GDQA 1J5SA 4CEUC 5D9OA 3VIKA 4ERGA 3LGGA 2CERA 1DYSA 1JCYA 4FF5A 1KBKA 4GVHA 1PWMA 1ZY9A 5BRQA 3K1DA 4C5YA 3SN1A 1QPKA 1XSJA 4ADUA 4RNIA 2JF7A 3MC5A 3SAZA 1JEZA 1VGAA 2I1OA 2CFFA 4C6JA 3HPZA 1OB0A 3GVWA 4NVTA 3GYEA 1PVNA 4AXKA 2YA2A 3OZOA 4KRZA 2NXIA 2ZX6A 2A6NA 3PZIA 3ITTA 3A47A 4QE1A 3OBEA 3RRXA 1UASA 3MCOA 1PO9A 1TRDA 5C7HA 4D9PA 5I3FA 2QCLA 3IIZA 3ZJKA 4W84A 2JEPA 1TWDA 2J7EA 1X38A 4CUCA 4LAKA 3TK7A 3CB3A 3KOZA 3RX3A 3UXAA 1YNQA 1UD4A 1VLIA 3AIBA 3IV8A 4XAPA 4OWGA 4CCCA 3DFOA 3OGSA 3UZXA 3WK1A 3G2GA 5A8OA 7REQA 3EA3A 3LRLA 2PS2A 3BG5A 2W63A 3MYPA 1UP3A 3S2NA 4YMZA 4Q8OA 5CBJA 3U7VA 2BG5A 1LRTA 4PEKA 1DJGA 5D04C 1B2YA 2VFDA 4K8EA 5M2FX 4E8GA 1IXOA 3GTIA 1AJ0A 1W5NA 1EOMA 1GZ1A 3KOWA 2ACRA 3SEPA 3DGBA 4GNKB 3REQB 6ENLA 2PDFA 4C1NA 1LM1A 1XRFA 3D6NA 1EP2A 4D6HA 4I9MA 3GO2A 2ZADA 4DJEA 4PL1A 2H3DA 1SR9A 2OQYA 1Q65A 1QR7A 5A8NA 3VX0A 1W8SA 1TE1A 1PYFA 5E0KA 4DNMA 2VQUA 4H41A 4B2DA 3UR5A 3CUIA 1JPIA 2WZTA 3ONBA 4HOXA 2ZZ6A 3AXIA 2Z1KA 5DF0A 4GUJA 1LCOA 4O54A 3IJ9A 4JN8A 3AI0A 4DWSD 2I16A 1GEQA 4UTLA 3FXGA 3WQVA 1H5VA 1Q85A 1R3TA 3DFTA 4QXIA 4LAZA 4ALDA 3CO4A 4HHMA 4IGNA 1GWJA 1V7YA 5A8QA 2D69A 1QWKA 2PI6A 1EJ7L 4HOZA 3ATYA 5AZ1A 1SW0A 4GI4A 3DGRA 4GJIA 5KETA 3PBGA 1MW2A 1GPWA 3H2OA 2GGIA 3CL7A 3E3HA 1QNSA 1E6NA 4F40A 1PSCA 3ZR4A 1E1FA 4AB4A 1EGVA 1PB0A 3MUZ1 4LYRA 1B57A 5AHFA 3SI9A 1PKMA 2PDQA 2PWHA 1CT5A 2GVJA 3QYSA 4GVGA 4EAMA 3BTNA 2IKGA 3S5ZA 1W32A 1IZJA 3CUFA 1HG3A 2RDTA 4HCHA 1JXKA 2Z00A 3N2OA 1GVIA 4XZIA 3NXLA 1WBHA 4GLEA 4BWLA 3E12A 5BRPA 2WMFA 3S5OA 1E6PA 1VPQA 5C70A 2IQ0A 2GJLA 5LSMA 3SDOA 4LT9A 5RUBA 3OQEA 3LCFA 4UR8A 4P8VA 1LROA 2PDKA 4Q7NA 2X2YA 4HCLA 1MQRA 3AYSA 2WJEA 3BL3A 4UTJA 3VOFA 5FJJA 3A24A 3D3FA 4E2OA 4DWDA 4C1KA 1YTDA 2PB1A 4P7RA 5DRIA 3M7SA 1F3EA 3UERA 4AW7A 2FMNA 3T44A 2OT1A 4YN5A 1PZ1A 1J0YA 3U2CA 5F2GA 2HRWA 1CB7B 3HJZA 1DJQA 4GY0A 5CC6A 3KCJA 4B4HA 2DT0A 4L65A 5FF2A 3QOKA 1FA2A 2QUMA 1MXGA 3W72A 3T40A 4W7WA 4XISA 3KZSA 4PFMA 4DF2A 3QYQA 4LALA 4LJ3A 3VD5A 4O50A 4D6FA 5BNKA 3ITCA 3PHAA 3RLHA 1NQ6A 4ML9A 2RGLA 5K3VA 4Z2JA 4XZHA 3DFHA 3HBLA 2CU0A 2X16A 3MANA 5D2VA 3SCSA 4BFAA 3MUXA 5FF7A 1J8VA 3GKFA 4HTBA 4J40A 3T4WA 4XBJA 1S46A 3MZNA 2DUZA 3AZSA 1JYWA 4AVOA 3OHMB 3WSUA 2XFWA 3BLIA 2ZX9A 1CYGA 3TMLA 3MB9A 3L2MA 4WSJA 1I1XA 2V5KA 3IPWA 2NQ9A 3IANA 1LOQA 4MSSA 5G1MA 3QPEA 3H2CA 5F2MA 3A4XA 1D8WA 4GC4A 1B4KA 1YNYA 3P84A 2Z27A 1E1CB 3L2IA 1HZYA 4FO4A 4PCSA 7TIMA 1SQ7A 3EOOA 5JMUA 3KW3A 2W0UA 3ONCA 2I57A 4DXXA 3R79A 5CPSA 4EXAA 1GVSA 2DZAA 1TREA 2ZYFA 1GQIA 5CKSA 5L9FA 3Q45A 4TVCA 3AS3A 2VOMA 4HU8A 1W9VA 2AAMA 3CEUA 3W37A 1DWHM 4J2MA 3T0BA 1ITUA 5BYWA 5XIMA 3USBA 2OKTA 2J74A 1V4YA 3GFXA 2CKSA 5EKYA 4A3HA 4LYKA 4JTSA 2FDSA 3LZ5A 4K8HA 1ZSXA 2W66A 3VO0A 4C6BA 2WZMA 1WKFA 3SSJA 4UB9A 2QGHA 1KBLA 2OFJA 1E56A 4B5TA 4DYKA 1NJJA 4LYQA 4H3DA 3TX9A 1RJRA 3SQSA 2R94A 3L12A 3Q65A 5CXPA 3RM4A 1G5AA 3PVFA 1ME7A 5CPLA 2XSBA 5LYRA 2XYLA 3WQFA 4F66A 1U33A 4KCVA 1P0BA 4TTUA 2NLYA 1HKJA 3O0KA 4L4MA 1IEQA 4HYVA 1P7TB 3B97A 1PTGA 3RLUA 4TU1A 5A8GA 3GTFA 3W3OA 3CBWA 3T8LA 1U22A 4HNNA 4KW2A 4LRSA 1FQ0A 5AN7A 3WUBA 1FBAA 1W37A 1Y7VA 4E38A 1P0KA 4LVBA 1UWQA 2AGKA 4M8UA 1ZAJA 2OZTA 1IHIA 1AFSA 3TTSA 2WPBA 4V1XA 3LLFA 3MKKA 3AJ7A 4CNPA 4P7OA 4L80A 1L2UA 1UQYA 2ZE0A 1EP3A 2BTMA 3VCCA 3URBA 3NPVA 4AYSA 8XIAA 1GKQA 3ZJ7A 4F0LA 3F2DA 4N9CA 3INPA 2NV2A 1EJVC 3WLMA 3K13A 3TROA 2J66A 5C8BB 1TV3A 1DJIA 4V1YA 2WW5A 5HNUA 1QDSA 3BW2A 2W79A 1Q4NX 4ATWA 4MUZA 5TBOA 3WMSA 1ZRQA 2Z1VA 5AZ0A 4J3TA 3LCLA 4JYDA 2J47A 2QAFA 1EHAA 2F8QA 4GK8A 2PD9A 1P6CA 2AGTA 2WZHA 1EF2A 5F7UA 4ZZ9A 2EPKX 1XYZA 3KHDA 3EX6A 4YU1A 3WD3A 2E9LA 3VC5A 2ACSA 2DVXA 5FSEC 3WY1A 3QH2A 6TIMA 2IQTA 4MFEA 1CGWA 4PCNA 3RM8A 2VQTA 5CC7A 1PZ3A 2Y8KA 4W85A 3WUFA 4AEFA 1W2VA 3RU8X 3W01A 1SMDA 4J3UA 2OLAA 1EFZA 5REQA 1F8IA 2J8FA 2ZTJA 2NV1A 1OADA 3AMCA 3KCLA 3EWCA 4I90A 3EWDA 5D9PA 1O68A 2BS9A 4FLQA 5E93A 1DV7A 2DSVA 4O12A 3TAOA 4NAEB 3B9AA 4W7VA 1R38A 3UR7A 3LNPA 1EGMA 4BR1A 1OINA 3EEZA 4NAFA 4XAYA 1R3YA 4Z2IA 2DV0A 2XISA 1ZJBA 1NDZA 4TV6A 4HZ7A 4L1WA 3V1HA 3QLLA 5E0CA 4TMBA 3B8IA 1RXOB 3KFTA 4NNBA 4ZL1A 3WLOA 1O94A 3A23A 3VNYA 2IXVA 4R7WA 4HPXA 4JQ3A 4L61A 5CGMA 5AKQA 1ZJIA 1R6WA 2ZA2A 1IXQA 1GUVA 1S3HA 3W7RA 4AZHA 4AMCA 5I00A 3M0XA 4IPLA 2NVCA 3M47A 2QPSA 3EOLA 4NI8A 1H63A 1X8CA 1JFHA 1UKOA 2GQ9A 4GG9A 2QHAA 3E0WA 1AD1A 4JCMA 4QE4A 2J4GA 3AMKA 2VELA 2Z24A 3MTWA 4OIFA 4GACA 4Q33A 4UTFA 4E2VA 2CLLA 1R3RA 2C1HA 3UPBA 3NG3A 1ZB5A 4Y8EA 1OIFA 1YRRA 5LIKX 1Y5VA 2E3ZA 1JZ5A 3E5BA 3G8RA 3WF1A 3ZIZA 4HHHA 5G4HC 3WDPP 1V6VA 2I9UA 4URIA 1P5BA 1V7AA 3WLNA 1E9ZB 2V6AA 4KMQA 2HK1A 3MI2A 4NX5A 5A94A 1DQWA 4JL1A 1DHPA 2OSYA 4JTAA 4RDYA 3BICA 1H0GA 3R8HA 2B81A 1U1UA 2O92A 2OZ3A 2VR4A 3KBSA 3WLQA 4MPQA 9RUBA 3AS2A 3F5LA 4QDWA 2PDCA 1DVJA 5BZAA 3CIVA 2FGLA 2YCIX 3NPXA 4FNUA 1F3XA 3M16A 5LXXA 4LC6A 3ZOAA 4DELA 1JPDX 2UV8G 4GA8A 4HSOA 3A5FA 4GYFA 2D23A 1YDYA 3DOPA 4ZBCA 3CV1A 3NL3A 4MKVA 1CXEA 1XGDA 8XIMA 4EACA 2ZUMA 1E0UA 3IVTA 2QCMA 1PHQA 4RZ5A 3B04A 1J12A 4JTDA 3GWQA 3H4GA 5FJOA 3PBWA 2QEZA 4I6KA 1XLCA 2UZ9A 3ABQA 1QPRA 3AAMA 1K77A 1WNOA 4S2CA 4QSFA 3RFAA 3STEA 1R8LA 2PDBA 3A3WA 4DPQA 2YKKA 3TJ4A 3FHQA 4GJJA 4ONVA 1HFBA 2DZWA 1EPVA 4GKLA 3SFWA 3OODA 1DOSA 3TFCA 2VZOA 4N2YA 3SECA 1AQHA 2QYGA 4BS0A 3LSBA 3SJNA 1KC7A 1JPKA 3N04A 3L4VA 2AMXA 5J8LA 2RDWA 1EBGA 1TVNA 3T78A 3K8KA 3CM4A 2CXEA 5ENLA 1R46A 1XL9A 3LENA 4HNLA 4GYPC 2ACQA 1KTNA 2BY3A 4IZGA 2VX5A 2DZVA 2WVSA 4AZBA 5TNVA 3CAWA 2BHUA 3MSRA 1VB9A 2XVGA 4H9XA 5M17A 3TSDA 4S3JA 2FDMA 2FVMA 3CYVA 2CZDA 4DBSA 2V3GA 4AZCB 4QDMA 5D2XA 3G3MA 3WK3A 4LWWA 3O1NA 3V3WA 5DELA 4FIRA 2F2HA 1H7XA 4NIRA 1VD6A 3HFYA 2A3BA 3E0VA 2TYSA 3VZZA 4WGHA 3FOKA 3DFPA 2X7VA 2J9YA 1TJ2A 3DYMA 4TOQA 4BI7A 4N9EA 3C0SA 4CN6A 4XSMA 3TW6A 4HN4A 3HJEA 1POKA 2OGYA 2O4QA 3VD4A 1JR1A 1KFWA 4PODA 2WVTA 4QS5A 4MB4A 1KBJA 5KINA 3TLLA 4HGXA 1JCXA 2WHLA 4ZO9A 1ISZA 4ZQNA 1ZENA 4D2JA 1DJWA 5A6JA 1TPH1 1VYRA 4YVXA 1R9XA 3OIXA 3RPTA 1KLZA 3QY7A 4XZMX 4M56A 1VJIA 5F4SA 3S42A 1JD7A 4CCEA 3REQA 3WK2A 3NQDA 2WXDM 4PUEA 3GE7A 3GC5A 3M0KA 3GSMA 2WMJA 3F2CA 1T41A 1TO3A 2ZWZA 1W1TA 4NILA 3BLLA 3N1AA 2BFGA 3L4ZA 2RH9A 1HJVA 4GBUA 5A8PA 1HL2A 3OYXA 2BOEX 4Z2HA 4O8AA 2CWXA 2OELA 1DWAM 2YL5A 3HG2A 1TFVA 4TX8A 5HMDA 1PV8A 1W5MA 1ME8A 3PNZA 1J79A 4HPGA 3Q2DA 4OUEA 4L9ZA 4WOZA 4C6PA 1RCOB 4JDYA 1YDOA 1VPYA 3W38A 4DLMA 2VZVA 3CASA 1GZJA 2WSKA 3LTSA 1UHVA 4NZ5A 1REQB 1QHOA 2RKXA 3MQTA 3T0TA 2QCHA 3RCNA 4U28A 3PBMA 2JGQA 3B9EA 1XLDA 2Y88A 2A6LA 4GFIA 1J96A 4A22A 1TQJA 1ECQA 3OBAA 1K6AA 3BLOA 2WSYA 1C7SA 1ZS2A 1LOSA 3BK0A 3PZVA 3QY6A 4UFJA 3MCNA 4WRHA 3NM3A 3R10A 1OGBA 2FHFA 3NR0A 1WXJA 3PZ9A 1WDPA 1AJ2A 2R1PA 3GZ3A 2ZIDA 4PSRA 5BOEA 2D22A 1NDYA 3ZSTA 1MMFA 3QGVA 1A4MA 3G0SA 4MADA 2WSRA 2UY5A 4AD0A 2NQHA 2C19A 3TCEA 5AY7A 3MUAA 5DMYA 3H8AA 4YPJA 4W7UA 3HZ3A 4Q8WA 1D3GA 2POZA 2W3ZA 3THAA 2GL5A 1EPXA 1EX1A 2WVVB 2BV9A 4IWWA 1GQNA 1JPMA 4FP1A 3W85A 4ZOAA 1YDNA 2VUYA 1W9PA 1W3HA 2BXVA 5T26A 1Q8AA 5CC5A 1KRCC 2HXTA 3DBNA 1OCBA 2PDJA 1UUMA 4LEFA 3A4WA 1TUXA 1CWYA 3RHGA 5JQ9A 4QG6A 3N9SA 3GXIA 1SMAA 1T8XA 3F4CA 1UR0A 5HWNA 3MY9A 1H7WA 5LIWX 3NWRA 1GNXA 1ZLPA 1DIEA 5XIAA 3ZVHB 2Z2BA 3ME3A 1LBFA 5DCEA 3BE7A 3CIWA 4RW3A 4GCAA 1QBAA 1QUMA 1QW9A 2CLHA 1JPHA 2PDWA 5AYBA 3CMJA 2W9MA 5HNNA 3SRFA 3LBMA 3BPWA 3II1A 4XQ6A 3IEBA 4J1OA 1G9HA 1T7LA 3N15A 1JDCA 1FCQA 3PJWA 3BZGA 2PF0A 4O19A 3CXOA 1TMQA 3FJNA 5FAGA 2V5BA 3CZJA 3RAOA 3LHZA 1NQKA 1HN1A 3W23A 5DLCA 4CU7A 1XG4A 1EC7A 2P10A 3VXGA 2FHCA 5IM51 3F7JA 2YCKX 1M6JA 1EO5A 2PUZA 1Q7ZA 1M65A 1KQZA 3O15A 5D02A 5KEZA 1H1ZA 3QPYA 1YNPA 1MVYA 4I9JA 3S6OA 3SRDA 5DFAA 3W83A 3W6YA 3R4IA 1OC6A 2IQDA 3M0JA 5D05A 2CHRA 2WOQA 4EF8A 4YXGA 3RMJA 1US3A 5KZMA 3MBFA 1G7VA 1JDEA 3NCOA 1DXEA 3EWZA 1L6WA 4MIMA 1J4EA 1K8XA 4JTFA 3KM8A 3HF3A 3A9IA 2WBKA 3WO8A 5I09A 1F74A 4C6LA 3V5CA 4L4PA 3IIVA 3V0TA 4X9YA 4J27A 6TAAA 3ZWTA 4WY0F 4L6DA 2X0SA 2YLLA 1MSSA 3L0KA 5EB8A 1K7XA 2C3ZA 5CJNA 2NX9A 4B5WA 3R94A 5GQBA 2VFHA 1CGXA 2ZXBA 3WQGA 3I3BA 4MY9A 3VNMA 3G1DA 4TO8A 4G7EB 1W1A1 5TIMA 1KFKA 4QS6A 3LK6A 3U8GA 4Z1DA 2OWWA 4D6CA 3P0XA 1AJZA 2OZ8A 1RBLA 2VFEA 3C4UA 2QIWA 3RILA 4O28A 1SO4A 3UYCA 2WV8A 4JPGA 4MVAA 4DJDC 2ZZ1A 2V3DA 3RK8A 1G4PA 2IW0A 3SO7A 1I6NA 1W17A 2FH6A 4QDPA 2CZEA 4E8CA 1Q63A 2ZBTA 3ARSA 1VEMA 3WUGA 2C18A 3B0YA 3M43A 3LM3A 1EH9A 4IIDA 5AHMA 5HJLA 2I9EA 4XO7A 4L5ZA 3SCOA 3M0IA 5E5CA 2INEA 3CZKA 4D71A 1JDDA 1SJAA 1XBZA 1S2CA 4EX4A 2JKAA 3GXMA 2PBOA 3UG8A 1SSGA 5FF0A 1BYDA 1X96A 4O11A 3TW7A 2P1FA 3WF2A 3EPOA 3H70A 4LV9A 4DM2A 1F76A 2Z1XA 4ORIA 3UPWA 1L0PA 3FV9A 1QI2A 4OTKA 4AUBA 2EJ1A 4S3BA 1YKWA 4PUKA 3SGZA 4WSKA 1FWJC 5J5RA 2G8ZA 4AHQA 4Z1YA 3AU6A 3ARQA 2YA0A 2OYKA 3AICA 2I5GA 3GTHA 2YBVA 4PTNA 4Z2KA 2Q01A 5IBXC 3UGRA 2VYOA 3CMFA 4JZ5A 3I6TA 3PAJA 4MFDA 3QHNA 2PBGA 1KTBA 1NFPA 3O63A 2BOFX 1JDFA 1GJPA 5G4WA 2VXNA 1QJWA 3MVTA 4NI3A 4F0KA 4YWSA 3M5ZA 3H54A 2W27A 1IF2A 3N34A 3EGJA 1X8FA 3BAYA 2GDVA 4GFSA 2HV5A 1SZGA 3OGRA 3TMQA 5JU6A 2XIJA 4NZ1A 4RV3A 2R1LA 9XIMA 1UWAA 1RCQA 2PLMA 4DZIA 5HINA 2CNCA 3QBUA 3NPWA 4MZ1A 3DI1A 2HCVA 4H9UA 1GT8A 1S5MA 4AIOA 1W9BM 3BLKA 3W82A 3TAKA 3G18A 1HGYA 1I60A 3FJ4A 5LGXA 3EA2A 3WDRA 2ZUNA 1XH2A 5BU9A 1MEHA 1TPUA 3THQA 1KR1A 1UJPA 1T99A 3GU1A 3KTXA 4A35A 3LBOA 3DESA 2YL6A 1QPQA 1L2QA 3DEQA 3G22A 1XHGA 4WOQA 2W67A 5FL0A 4IM4A 1ENUA 2A0NA 2V3FA 3HU7A 1B3WA 4XZ9A 4GIRA 3M44A 4PGLA 4RUBA 4LVDA 4QLKA 4W9TA 2R1KA 1TX2A 4AIBA 1PKLA 2ADAA 4ICCX 1AL8A 3RN6A 2P88A 5EMYA 4JFVA 4AVNA 3LMYA 4LB3A 4BI5A 2VRQA 3A5VA 2GVYA 3C0LA 1I9CB 3N6HA 5IXEA 4UQEA 2QAPA 3WQEA 1RA0A 3C56A 2VCCA 5LGZA 2QCGA 2WMGA 2OOGA 3UWUA 3LUTA 4H9TA 2QXWA 4GH3A 5TAOA 3OZYA 1S5VA 3W75A 3Q58A 3PAOA 2QLYA 1A49A 4Q8NA 3KWXA 4ZB5A 4CU6A 4OKDA 2PTXA 4ZA0A 4GNVA 3W25A 3CQ0A 1XLHA 1O5KA 2J24A 4U2ZA 2ZUSA 4DYJA 2C8NA 3B8WA 4MY8A 3DHDA 1KLYA 4H8HA 4UMBA 1PCWA 3MP4A 3VM5A 3KWSA 2VNCA 1VHNA 3E0FA 1EUAA 3L4YA 1M1BA 1XW8A 2YFNA 4IICA 1M68A 4UR9A 4KFOA 1WAUA 3IARA 1AZ2A 2BHYA 2QMKA 3DHUA 2HVOA 2C1GA 2X7WA 4GVIA 1ALDA 1NU5A 3TQ0A 3HV9A 1MO0A 3K46A 3PJXA 4M6PA 3B8SA 2YCLB 4UQAA 4G7FA 2BGSA 1IYXA 4RJEA 4CNOA 3CT7A 3QKEA 2Q71A 2QIIA 2ZOXA 3M6DA 1E73M 3G8EA 1UWIA 1NWRA 4MGGA 1R5YA 4L9XA 2JBMA 4LCQA 3EXRA 2VEIA 3MVIA 1UD2A 3ARWA 4PEEA 1XBXA 4FNRA 4B9YA 1M3UA 1EZWA 1Q2SA 1SJBA 1XLJA 4QTGA 2DUAA 4O4WA 2DDXA 3DERA 1X98A 3N4AA 1F3TA 1WDQA 3ZLFA 3BGAA 2YW3A 1FKWA 3VUSA 2QGYA 4H19A 3IACA 3T0DA 2XH0A 5FIPA 2EPMX 1LUCB 1OEPA 3QGAC 3R58A 1KKRA 5HR7A 4NY2A 3G1AA 1ICSA 4IMDA 2HISA 3W2KA 2CLPA 1WPCA 2NVAA 1US2A 1WDSA 1UR1A 4YTUA 5XINA 4N0RA 2DU2A 1EDTA 3LD5A 3KVMA 3PUGA 4OBRA 3S2CA 1XCXA 2H3BA 2J75A 3OEXA 5AC5A 1EHNA 3WMLA 4Y90A 3V18A 2F84A 1DWFM 3HGOA 3S5NA 1EC8A 1EJWC 1V3IA 1MI3A 3QFWA 4NNAA 3KZPA 1LT7A 4NL1A 4X22A 4JY8A 2WKGA 3TLQA 4TTGA 3NSMA 1VFMA 3GFZA 3N9KA 3NAVA 3GXTA 4LUSA 3VD3A 5AYZA 3FVMA 6REQA 1DPMA 3W02A 3DXIA 2EPOA 2IKHA 2FJUB 4JTEA 2J78A 4N9BA 3N6QA 2Y4SA 3ID7A 3OP2A 4RE2A 1EWDA 2PDXA 3PG9A 5I3HA 3K4DA 4MB5A 4AZCA 3K2GA 3OO2A 3MV01 1UW9A 1PIFA 5EMUA 2XU2A 1XIFA 5BXRA 3KRBA 3H2FA 4MY1A 2Y2WA 1DQUA 3WJXA 3MU7A 3M0YA 1HXJA 2YDAA 1Q6QA 4IG2B 3URQA 2NQZA 1TPEA 2AL2B 2VWTA 2PTYA 4J35A 2PWGA 4RDZA 3IS4A 3GC2A 4HNCA 4PMQA 3FAWA 3IJQA 2C71A 3GG8A 4B92A 1FH9A 1LQAA 5D32A 2B7PA 3AYRA 4MM1A 1JRBA 3RGTA 3UWVA 4H8VA 2CXGA 3VNKA 1ML1A 4MMWA 3IRSA 4O1DA 5SWUA 4DO5A 3N2BA 2OVLA 4M1BA 4DWSC 4W89A 3ZT7A 1EJXC 4PUDA 4AVFA 2D1ZA 4NUWA 4H7CA 3WH8A 4NRSA 1LTDA 4KERA 3UZWA 2CWNA 3RLGA 1WE5A 3W2UA 5DT7A 4PN2A 5HNTA 1VH7A 5F4WA 4A05A 4GO8A 3WLLA 4GOAA 2IPFA 2EHHA 2QULA 2VURA 2WB5A 2VTFA 3UESA 1KFBA 2VEKA 1Z3NA 4KESA 5GNXA 1WKYA 4BEQA 3S9ZA 4DQWA 4WXZA 3MSGA 2FVKA 1Q6DA 1UR3M 2G96A 3DCPA 4PCPA 1G4TA 3CO8A 1REQA 1FWDC 3M1ZA 2XGIA 4H6KA 1YXYA 4NU7A 1QMLA 4AZ6A 2ZXQA 3KS5A 3F4WA 4OV4A 1JYNA 4K68A 1GYNA 5A69A 4DO4A 1XD0A 5D30A 3QQ0A 3EDFA 3LCIA 4IP5A 4XZBA 5HWMA 2YBTA 4BQ4A 2YLAA 3BCDA 3BSHA 3ARZA 3WQPA 4S3EA 1AZ1A 1UUOA 1VZWA 4BA0A 5CCZA 3WNMA 4CLMA 5AECA 3MKCA 1UKQA 3SADA 4GIAA 3VKKA 1AA1B 4DRSA 1S1RA 4HK6A 1ZBVA 3N18A 4EAYA 1AH3A 4E8DA 4UTHA 4XZLX 3CHDA 4PBFA 4Q4RA 2VZUA 3NQ6A 2D2GA 2A3HA 3TZNA 1GORA 1XS2A 1FFRA 1E4NA 4BQ3A 4ZB0A 3EX1A 5KTLA 3NSXA 4WX2A 4LFYA 2XDFA 1W5QA 2RAGA 3NGJA 4POCA 3TJLA 1XCWA 3MMDA 2WVVA 3LXCA 1V02E 3GU2A 2XN2A 2Z2AA 4HT3A 4AF0A 1GOMA 1YXCA 2MNRA 4ZQCA 2E7FA 1TPWA 1R2TA 5LNSA 3VMNA 3CWOX 3U2OA 3WLRA 2JK2A 3GQYA 2ZFAA 3UCCA 4R3UA 3WG6A 2RUSA 4L6OA 4A3YA 2P3EA 1CX9A 3SIZA 3FKKA 1X7IA 4FB7A 3W2MA 2WKLA 1B3OA 1POJA 2PEVA 3C2YA 1NSJA 1OG0A 4REQB 2CHNA 5M1TA 2PF8A 3ZVHA 5M5DA 5HJXA 3BAXA 1QPNA 2OO6A 2ZRXA 2Y62A 1JULA 1MNZA 3WLJA 1JQVA 3ES8A 1F9CA 3MWCA 5KMYA 1U5VA 1Z9AA 4UQDA 4GYPA 3TJXA 5A6SA 3N3TA 1UH3A 2PD5A 3OHIA 4Z1AA 3RXZA 2VRJA 1J0JA 4LCRA 3BMVA 4RE3A 2O0TA 2ZUWA 4OQVA 2QKFA 1IXNA 2GJXA 2OMAA 4I8DA 4UTIA 1MXDA 4KRTA 4WDUA 1TVLA 4W88A 2X42A 1AW2A 1TJ0A 4U5KA 3H53A 2ZRVA 1PX8A 1AODA 1EOKA 1KV5A 2ZZ4A 1E0XA 3NQGA 4O18A 1EB3A 2VCBA 1K9FA 3FYPA 4LGXA 1KM3A 3VGFA 1C91A 4I7VA 4RV8A 1E15A 1TZ9A 4PUJA 1FOBA 2ONEA 5E6YA 2J77A 2Y6ZA 3RM9A 3VK5A 5AYIA 4HNUA 1A5UA 4IQLA 4PTWA 2JIWA 2D2HA 2Z1BA 3IUHA 4H1ZA 1ISVA 3QRHA 2B7NA 4U4MA 4WY0A 1DIOA 3CGTA 4TR9A 2P0OA 3S2JA 1Q6LA 2FLIA 2QCNA 1UH2A 4IIBA 3ARXA 3D5HA 1DJHA 4GXWA 1V3MA 1K6WA 2O56A 4ICMA 5CZJA 3M64A 3E9AA 4M7TA 4DXKA 4E2BA 2Y5EA 1K4GA 3GR4A 4ZO7A 1TPDA 1IT8A 3TTQA 4MJ4A 3ARTA 3VABA 2P0IA 4I3GA 7REQB 3C61A 4DF1A 1E5NA 4AU0A 4R88A 1GEHA 3MHUA 3NEHA 3MZ2A 2NLIA 3W7LA 2VEGA 3HMJG 1FY6A 1HIZA 3G77A 2P76A 3QN3A 3ENLA 5L6UA 2QJGA 2EXOA 1W0MA 2Y5JA 1F5ZA 1NP2A 3Q4DA 4G7EA 2WSPA 3UY8A 5LKYA 3T05A 1KWKA 3LHTA 2P53A 3K30A 2QCCA 1GVEA 2ABBA 2QDEA 3KRUA 3GYCA 4C1NB 2ZX7A 1VFUA 5FJIA 3VIMA 1PKNA 2DIJA 4KPLA 4OUIA 4PULA 3VA8A 3H12A 1Q6GA 1VF8A 4NASA 1LLZA 4DVOA 1R86A 3C2VA 2FB3A 1A53A 3FK4A 4C6QA 1SJCA 4O1AA 1BQGA 2OB3A 3WFZA 3UXKA 3BV4A 1M9HA 4KWVA 2PODA 3GKAA 3W1XA 5EY5A 1ZP4A 5DCDA 4K1GA 4MZ8A 3TC3A 4ZFCA 1H41A 3WLTA 3JVAA 4GNJA 4CCDA 1RQBA 5BMXA 1VENA 3OQ8A 5CPQA 5T9BG 3V16A 1OABA 3QR1A 4HK7A 3H7RA 2XJ7A 3S46A 5KZEA 3KVJA 4LAMA 3K8LA 5C5YA 2V67A 1B0IA 2Y61A 4PL2A 1FHUA 1A5OC 1XLBA 5DBUA 1JXJA 1OFEA 2Y0FA 1BXNA 1Z42A 2Z7KA 3SJ3A 2G97A 3NSNA 3APTA 1AMKA 1UC4A 4PTMA 5F2LA 3E2VA 3HPAA 2JKEA 4IF2A 3CJPA 3W53A 3EMCA 2VD9A 3FNDA 4XUYA 2FTWA 2WKJA 1C29A 2O9TA 3A6OA 3L9CA 1H7RA 2EG8A 3MMUA 1WP6A 2AKZA 4WCJA 2QJIA 1OY0A 5CH9A 3PWAA 1A80A 2QUUA 5C2GA 3UWEA 3P62A 3T2QA 3GRIA 4XG1A 4HNOA 4CD6A 2UBPC 2KAUC 4D1JA 2OG9A 3L4TA 1XYBA 4WKHA 3V36A 1OJXA 2CLKA 1N8WA 3JZUA 2OO0A 3TJIA 2CBVA 2WWCA 3BQ5A 3CV6A 3LN3A 3NQAA 2E5CA 2ZRZA 4HD5A 3NVDA 3QHMA 3EKLA 4WDWA 3T0AA 3LLXA 4J3ZA 1SO5A 3VM7A 1WZMA 3MUIA 4I6VA 5JH1A 1VBRA 4S2BA 1A3WA 1KGXA 1XSKA 3EWYA 7ENLA 5A1AA 3VDAA 1NOUA 3VTRA 1UMLA 5LA0A 4W5UA 5FAJA 3HN3A 3C2EA 1L6GA 1C9WA 3EXSA 5HWJA 1EQPA 5H8MA 4KIEA 3N13A 3IV3A 4D6JA 4CN4A 4IISA 3SGGA 1GONA 2GYIA 4JGDA 1BVZA 3XIMA 3O6CA 3PPCA 3GU9A 5HMSA 2B0MA 2EKGA 2WJZA 4ZVJA 2WAGA 3AIRA 2NW0A 2V3EA 3LNMA 4HZ8A 1M04A 1R3WA 2D0HA 1XV8A 1VR6A 4MNLA 1QASA 3KBVA 3BW4A 4XBSA 1DORA 1E6SM 3WQOA 1KM5A 4X3ZA 4ZGYA 1J0KA 1IQ8A 4UFHA 4P2VA 1CLKA 3QXBA 1Z89A 3S9YA 1PHWA 5G2WA 2NSXA 3W9ZA 4MUPA 2C91A 2HNEA 4H8UA 3VC6A 3TKFA 1J2BA 5MKGA 1E0TA 3PZQA 4HN8A 4ADTA 4IGSA 2XG9A 4QQUA 3HQ1A 2GVEA 3WNNA 4YTSA 5HA7A 5A6BD 1NWTA 3WLHA 1K7EA 3NQCA 2H9AA 2WZIA 4IHCA 3SQMA 4I5UA 1X1NA 3UVIA 3BWWA 1OC5A 3C3NA 3KCOA 4RL3A 1T40A 4TX6A 1TIMA 2XFRA 3W28A 4IMCA 1TZ7A 5LHEA 2XH7A 3KP1A 4DJDA 3W27A 2NT1A 3N14A 2YCLA 4KCTA 2VOTA 1BXBA 4LBRA 1F07A 4JTKA 7A3HA 1WOAA 2XGBA 2GSJA 4JNZA 5AFDA 4IX2A 3E2SA 3FGCA 2ABAA 3UNDA 2VVNA 1E5JA 4RDVA 4FLRA 3QZAA 4TXEA 3QZEA 1RHCA 4JX4A 1BFNA 1RPKA 5IFPA 4LV4A 1A5MC 5AC6A 2YPIA 4V15A 4F0SA 1HKWA 1O7AA 3WH6A 4D8AA 1LUCA 1VBJA 2WLYA 5D4YA 1C3FA 1CCWB 1E55A 1SW7A 1WAWA 5U4NA 4CQ8A 1HJUA 3V5FA 3VMOA 4WZHA 3AHYA 3QOMA 1SSDA 1UPMB 1WKDA 3RJYA 4AWTA 1LBLA 1W9XA 2E9BA 2HBVA 1GVYA 2XZ9A 3PSVA 5JUVA 5IBXA 3TTYA 1JL8A 4IUOA 3IVUA 1MWOA 4AHPA 4HU0A 5IFTA 3GX9A 1P1XA 3GIPA 5T91A 3A64A 4IJCA 4IQEA 3ANYA 4B5NA 4IJBA 3FDGA 1VYPX 2D2OA 1JAKA 3P82A 3VOJA 2BY1A 3ZT5A 2ZUTA 4RXGA 4D72A 4ERIA 4WJ8A 5FF3A 3H23A 2HWGA 3LS9A 3QLDA 4H00A 4F2UA 1UKPA 2O55A 1CXLA 1NOFA 1ZTVA 1XH1A 4A2SA 4NJIA 1Q7QA 2AL2A 3VFCA 4FS9A 4US5D 1JRCA 2E6YA 4KIRA 3BV7A 3N29A 5HMEA 4AHOA 3H26A 3CV2A 3PBVA 4UTMA 4FOUA 4FZIA 1O1HA 4CNNA 2VDIA 3PFRA 1FKXA 2ZVRA 4K1WA 4WDTA 1TPVA 2HVMA 1SR0A 1VC4A 4GUGA 3RYSA 4OECA 3EAUA 5G2HA 3PUEA 2XWDA 3QHOA 3N2CA 4XK2A 2DQXA 1MFUA 4NAFB 1Y0EA 4OFCA 1TA3A 3ABRA 4MLJA 1YPXA 2Y1HA 4B5UA 3DX5A 1FCVA 3GR8A 2VGBA 2C14A 4NXKA 2PU0A 2TODA 2PWUA 1T0OA 3SN4A 2UWFA 3AALA 2B7OA 4S3KA 3WQCA 5C9UA 1R2RA 2WHKA 4MWAE 4NJKA 2ZZ5A 1MW3A 2E0PA 2PGEA 3JR2A 4QISA 4WDXA 2WWDA 1UR8A 1RLDA 2J7CA 2J6VA 3C2FA 5CBIA 4Q4OA 5CQ1A 4GBDA 1JD9A 3LXAA 3CUZA 2OSWA 4GZ7A 4GO9A 1G1YA 4KQNA 5FEXA 1IIHA 4Z1BA 1FVPA 3NM1A 1XFBA 1TELA 3CZGA 3I7SA 2WQPA 3K4AA 2ZRWA 3E0LA 1EYWA 3QW4B 1EEXA 2MANA 2NUXA 4RE4A 3WN6A 3W1PA 3GZAA 2WC7A 1DQXA 4Q22A 3F03K 3R25A 2V30A 2FFCA 1V6UA 3OGVA 4I5RA 1NARA 1T5AA 4OE7A 1L6SA 1K7FA 1JZ4A 3NXFA 5CEWA 1UA3A 1I45A 1J10A 5LA1A 1C7TA 4JHOA 4CD7A 2C6QA 3CQIA 3RU6A 1XUUA 4HCDA 2GVGA 1BRLB 1BWKA 1CLVA 1PPIA 4KRUA 2DT1A 1E43A 3T8QA 1M5WA 3HGRA 5AOUA 2YDQA 3GNNA 3IGHX 2BB0A 1HTIA 2JQXA 3WL0A 5JBEA 1IWAA 1Q6CA 1O1ZA 4JTGA 2RJGA 5CAKA 1BSIA 3AMDA 4FX8A 3BVJA 4H6EA 1YPIA 3W29A 2DPEA 2XFYA 3BJTA 1XGEA 3PZNA 4EWJA 5CLTA 4RR4A 2VMFA 1MZHA 2QS8A 1VIZA 3GDLA 3DDMA 4O15A 2CLMA 4RW5A 4B3ZA 1GOWA 1K1DA 2OR2A 3ZZ1A 5DMNA 3MJMA 4GJ1A 2C7FA 1HKKA 4R9OA 3TYEA 3GVVA 3NFUA 1JUBA 3M5XA 6PTDA 3OOQA 4RK8A 1TKKA 4K38A 4JEJA 4HSHA 4HYRA 4UMAA 4IJRA 1FWSA 4HQVA 2RHGA 4REQA 2GGJA 4IXHA 4QQ3A 2PDGA 2XVLA 4W8AA 2CITA 2YZ5A 3IIXA 2NUYA 3VIFA 1PX3A 1I2OA 3DU0A 4M24A 4C6DA 3S83A 5CZKA 3OZMA 1F8MA 3LV6A 4QJ4B 2A4AA 3GTNA 5FJRA 4KETA 4KH2A 1VCVA 4EIVA 3UG4A 4PB3A 3WJZA 1A3HA 1VS1A 1MRQA 3JS3A 1QCWA 5KZ6A 3VINA 3DBPA 5A2AA 3AO0A 5K2ZA 4AXNA 1KGUA 3NDYA 3LPGA 1SU5A 1SGJA 2XVNA 2VR2A 1BWVA 1GKPA 3LHUA 1CEOA 3QKZA 4F9JA 3L68A 3TN4A 2ZUUA 4W5ZA 3QR3A 4GD0A 3CUXA 3FAXA 2O9RA 4FR6A 3VD9A 1XBVA 5FJTA 4MYAA 1RJPA 1RJQA 4WK9A 3GUGA 3PPHA 2FZBA 5FEPA 4KFPA 2JFEX 2OX4A 3QQ1A 4F9DA 5ABFA 4WGXA 3B9NA 1XIEA 4LSBA 1N8FA 1FDJA 3RJXA 4J4KA 2QDDA 1TCDA 3HM7A 3QV9A 1JYXA 4EPKA 5C9RA 3UWWA 2NQ5A 1H62A 3WDQA 3ZMRA 3B8TA 3HB9A 4GZJA 5K9CA 3LTYA 2HSAA 2CBIA 3W2LA 4B5SA 3LRKA 1PDYA 3S0CA 1SFLA 4MPKA 3NJ3A 3ERPA 5D38A 2B4GA 1N82A 3CHCA 3EEGA 4X2PA 4C7DA 1W1PA 4QSHA 5A6LA 1J0ZA 1G0CA 4G2DA 4QEHA 1PDZA 3ZXWA 3PB2A 2ZX5A 1PE1A 4S23A 1DJXA 4FXJA 3LSCA 3T2PA 1EUNA 1QXLA 1UIPA 1TPFA 4AISA 3EYPA 2HQAA 4PMJA 3BG9A 4DWSA 2E28A 3MDUA 2OWXA 2VGIA 4D6GA 1S39A 3ZLHA 3ZT6A 3SRHA 3NUKA 3T09A 3V0UA 3R0DA 4HJFA 2X0HA 1UWUA 1RK6A 1WQ5A 5CLWA 1RR2A 2I56A 5I79A 3MSDA 4ECLA 4ICNA 3QW3A 3MW7A 4HZ6A 4XTIA 5AHNA 3R6IA 1JJKA 1H4PA 1FWWA 4F0MA 2C15A 5C0QA 2NWRA 3IWPA 3U2EA 4ZOEA 4BQ2A 1CXIA 3CU2A 3WEZA 1QTWA 2EG6A 1LT8A 1QOXA 3O6YX 4ZQRA 1TVPA 3EDKA 4OJYA 2QQ6A 1F6PA 2PA6A 5C55A 2P8BA 2FPTA 1SFTA 2FZMA 4CD8A 5LNUA 3KBJA 3VKJA 3BSGA 1OFRA 3UR8A 2W62A 3TSMA 2O9OA 4ZOCA 1PIIA 4DB7A 3UQNA 2GJRA 6XIAA 1RP8A 3CHFA 3M0MA 4Q7IA 3QTPA 1K70A 1WKEA 3KX6A 4MNKA 1ITCA 3CB8A 1CXKA 2DT2A 2FZ8A 4I7WA 2RFGA 5DEZA 1KXQA 1C9DA 1I0BA 3PK7A 2YZRA 3M9YA 1US0A 4P7LA 1XJBA 3DFQA 2EKCA 3WD2A 5DMMA 2E25A 4DX3A 1GYLA 4UOZA 1HT6A 3KRZA 3R12A 3DENA 2BNJA 3W7KA 3HPSA 3WBXA 4JX5A 1ZHAA 3RMEA 3BOFA 3OLIA 2WHMA 1NFGA 4UUIA 1X6NA 2PP0A 5BCAA 3EB4A 5KZDA 2KX9A 3TIMA 2J62A 4XUGA 3LLDA 4MWAA 4YTRA 2EF9A 4HPJA 1KA9F 1OZMA 4GGHA 2V5DA 4LS0A 1DEDA 4EK7A 3TYUA 1J2WA 4MOZA 1RVGA 1I75A 3UG3A 4A3QA 4NRRA 3GDBA 3W7NA 4Z0SA 4E0CA 3NQ8A 4NF7A 2XZ7A 8CGTA 1VFFA 4Q8TA 3EWXA 3MUCA 1UZ4A 1V08A 4IIEA 3AHXA 3WFAA 2A3EA 4WUIA 3OJGA 2Z1WA 1SO6A 3TYAA 2HZGA 3EB3A 3QMSA 4B90A 4J3VA 4F3HA 1K4HA 4Q3MA 4G56A 5MHBA 3D3AA 2XN1A 1TTIA 3AISA 3VDBA 4C1LA 2ZXDA 5HMFA 4R27A 1W1B1 4HU3A 1LL6A 3GDTA 4RZ6A 3MWAA 1E3ZA 5EFDA 3ORWA 2VVSA 1KM1A 3A12A 4DUXA 1BF2A 1DE6A 3AMGA 3PNUA 1K9TA 4DBUA 2JE8A 4EVZA 3CZLA 2DIKA 4MWAD 1TR9A 3A9BA 2J88A 3KLKA 2XIQA 4YCOA 3EDEA 5I03A 1FFQA 2XIIA 1MUMA 1TV5A 3S4TA 2PZNA 1XBYA 1AH0A 1EEPA 3TWBA 3ZR5A 4XD3A 1IT7A 2QR6A 1ZAHA 3VIPA 3TU9A 4U3CA 2V5LA 3POCA 3VZYA 3NURA 3PUOA 3LOTA 2J9ZA 4HBKA 3B40A 2FVLA 3GXPA 3QC3A 4U2YA 5LIXX 2ZDRA 4FSAA 2V69A 1EP1A 5DMLA 4DF0A 1W3TA 3GH4A 3HGJA 1OK6A 3M5VA 1WCGA 4DYEA 1HJWA 1V6TA 4YWIA 2F6KA 3B0VC 4PUUA 3NQMA 2G3IA 3F2BA 3PZUA 1OVDA 1PUDA 5CGQA 2OKOA 3BLEA 2QPUA 2R1NA 4JTTA 4QE5A 2L5HA 3W71A 2HEJA 1EF3A 4NNCA 3WDHA 2Y85A 3DFSA 4EOUA 4PTXA 2ZVIA 3RITA 2V68A 3NPUA 3TN6A 2ICSA 2Z4GA 1IGSA 4C7GA 1NELA 5D9MA 4KS0A 3KTSA 1TWZA 1F7BA 1H5YA 2ZA1A 4HA3A 3AHTA 2V5CA 5IOBA 3TOYA 1K9DA 4B91A 2QPXA 2LLEA 3BCFA 5HNRA 1QW8A 3OG3A 1HO4A 3ATZA 2VO5A 1VBGA 1K8YA 3MUY1 4DUVA 1KB3A 1Q6FA 4UOQA 4A8RA 5JBFA 3CZ8A 4TQTA 4QCFA 3PN8A 3PY2A 3WQ4A 3ZSSA 1W5PA 3SY1A 2J7FA 1H61A 1KQYA 3TNOA 1FX6A 1QO2A 2OTDA 1LWHA 4US6A 1VRXA 4JY9A 3BAKA 2VC9A 5A5WA 2HK0A 3HG4A 1XM3A 2BY2A 3TC7A 1XLGA 4JTRA 3U5YA 3CHVA 2CBUA 3VE9A 4U3AA 4B5VA 2PPGA 2DZPA 4ZQPA 5I3KA 4Q4PA 3WBEA 3OYZA 2CZ5A 3PTMA 1KM6A 2VZSA 3L5MA 3W1NA 1QO5A 3M0HA 3PS7A 2BXZA 2J7GA 5CG7A 1BKSA 1OF8A 1UCWA 3R8RA 4YLWA 4PB4A 1ISYA 2NT0A 4QCEA 3AUOA 1YTEA 3N73A 4CVWA 2DW7A 1U2YA 3FCPA 5I06A 4CQBA 3CT2A 1FDZA 4M5PA 3U9IA 1F3WA 2WNQA 1CDGA 4NX0A 3LX9A 1A5SA 2DUXA 3FA5A 1HJQA 1IR1A 4J2PA 4P8XA 1YYAA 2VM8A 5B7YA 3RDKA 3R0KA 3UG5A 4S3GA 3WQ6A 1VPXA 5CSSA 4LX4A 1EC9A 3HMCA 4XB3A 2ODOA 3LY0A 4C6MA 4Z1CA 3STGA 3H2MA 1KXHA 5LIUX 1DIKA 3O3RA 4H7VA 2DVUA 4JKMA 4P8WA 3URAA 2VFGA 1PWLA 3SUWA 1TV8A 3F4NA 1CGYA 1UP2A 3R2GA 5M03A 1GHRA 2BVDA 3IK4A 1KW1A 4GIEA 3D46A 5BOOA 2YDRA 1H7OA 1IZCA 1CLXA 3UU0A 1ZJHA 3DECA 1J0IA 4R7JA 2DJXA 1E0WA 3T9PA 3W1MA 3RCMA 3CC1A 3KL0A 3W7OA 1XXXA 1Q2RA 1VEOA 2XVKA 3SBFA 1OZQA 3AIVA 2DSZA 1P0EA 2YL9A 3WNPA 3WQDA 1Q6OA 3A4AA 1YADA 3S1UA 1EBHA 1NVMA 4FNSA 3STCA 1FP9A 4NJGA 3PBYA 4IMEA 3UYIA 3BLFA 4J28A 1A47A 2AMGA 1RBAA 5HAOA 3W24A 5I5RA 1NIUA 5M3WA 1XIDA 4AEOA 1XICA 3THUA 2HE8A 1D8CA 3KUMA 1X39A 4NQ1A 1ZCOA 4H2CA 1M41A 3C0JA 3B9OA 1OIMA 3N25A 2VGGA 4JN7A 4PE8A 2GDUA 2VRKA 3WLPA 3ANVA 4Y9NA 2QUNA 1PIGA 2BLEA 3D47A 4B5XA 1JI2A 2WMHA 4IH3A 2G3NA 2QT3A 1J01A 3TTEA 1DJYA 1K02A 3TH6A 3B8DA 3G1YA 4HMNA 4KCWA 2DH2A 3NO5A 3O06A 1VBHA 2VGFA 3EMZA 5EL1A 3STPA 1I0DA 3G1XA 1ZNNA 4DIAA 4JTIA 4G1NA 4HA0A 4FPSA 1KO0A 1WZLA 5AC4A 4N7QA 3R8GA 2CLFA 2DFAA 3G5EA 5FA5A 1CENA 2OU4A 2TRSA 3B9DA 3AXMA 1D3CA 3LV5A 1OCQA 2ACUA 3KLLA 1GVQA 4H9MA 4O17A 1V3LA 3L0NA 3VIOA 4CEXC 1N55A 4BI6A 3FA4A 4H04A 3E6EA 3CV7A 1C93A 1OFPA 1OFDA 1BRLA 3QSRA 4NYUA 3G1FA 1TB3A 4ZEPA 5AB3A 2G3JA 3VNIA 2W91A 1EKOA 1LWJA 4IQDA 9XIAA 2P50A 3XISA 2VJXA 3SB0A 1TPC1 4IP7A 1JGMA 1QNOA 3NQFA 2J8TA 2Q8ZA 1DE5A 2OQHA 1LDCA 9CGTA 3S8HA 4W4QA 5BU6A 4YIWA 5JIWA 4GXMA 4UTKA 3OW1A 1Y8BA 4H6QA 4L7ZA 3UNTA 1Q45A 3B06A 1M7PA 2P8CA 5EMMA 4AAJA 3F1QA 3TXVA 1AW1A 1TIWA 5LA2A 1X7FA 4BEUA 3KOFA 1ITXA 4MTVA 5HBFA 1G7UA 2AQWA 1QU4A 5F1UA 3T7VA 2E4TA 1QT1A 3THDA 1VAHA 5I3DA 1S38A 3NYZA 1QI4A 2PTZA 3CHEA 4RX0A 3CUHA 1H3GA 1TCMA 2Z1SA 2BGNE 2BWGA 2YCEA 1JIBA 3GS6A 4ML4A 3VCNA 3L7RA 2C0HA 4JKKA 2QF7A 1TX0A 4A8IA 1F73A 1I2PA 1UR9A 3OVQA 4FAMA 1YX1A 3QQWA 4HB7A 3SUVA 1XQLA 3WF3A 5HPCA 1XDMA 2J25A 2FYMA 4DY1A 3T1GA 3C6CA 1LL4A 4E6MA 3DUGA 2E5BA 2PAJA 4R5EA 3IIOA 1GKRA 1QW7A 5I7GA 4AD3A 3VILA 1S2VA 1W5OA 3IJLA 1HW6A 4I9TA 4Q8UA 3AOFA 5BW6A 3NGFA 2E6DA 3W87A 3WNOA 4XWUA 3I4KA 1XPGA 4GQGA 4AIUA 1X6UA 3F4VA 1XG3A 4AY8A 2XUCA 1CGTA 1PXGA 3EPNA 4LUSB 6REQB 1Q13A 1X97A 2Y89A 3FJLA 1YBQB 4S39A 1M7XA 4P61A 1VLWA 4QBXA 1C92A 4MDOA 1ICQA 4GQBA 1OSEA 1EJRC 1JVNA 2P3ZA 3PTDA 1EJSC 3NZRA 4O52A 1HKIA 1A4LA 1RZMA 5AHIA 3IJIA 1J93A 1CTNA 5CSYA 4BHYA 3SCQA 4XD5A 3GM8A 2A3LA 2X1SA 3OG2A 3IJDA 1XP3A 5E70A 4CQDA 2CESA 4NZFA 4ZODA 4ZTXA 4KEMA 1V3KA 1WUEA 4ILSA 4E5TA 1GPFA 1DTUA 3PWIA 4PBGA 3DKLA 1ONRA 1EDGA 4RZ4A 4DJFD 4C6NA 1DBTA 3N4EA 3QY8A 4WVXA 4JBRA 4GHRA 5EMKA 1BEUA 4UTTA 2VX7A 3TR9A 4GZIA 1Z32X 4NSBA 3AHVA 1WXZA 4UNLA 3GDKA 2EPNA 3IGXA 2BVTA 4LEQA 4M81A 1BYBA 4GQ0A 1UROA 3UWZA 1BVNP 3SY8A 3HO8A 5C6MA 3DYOA 1VCGA 3TUUA 1PYMA 2OT0A 2OYMA 3H7UA 4F0RA 3O6AA 1JDAA 2OJPA 3VOGA 2V2CA 4HOWA 2NWSA 4H83A 2XIMA 3S5YA 3NYDA 3DAQA 2CW6A 2V2DA 4LY8A 1R87A 2F61A 2ZE3A 4AZ5A 2HBXA 4U5IA 4ZQOA 3EMQA 3T55A 3LERA 1MEIA 3ARRA 4Y9AA 3RNDA 5LNVA 3U48A 2VEFA 2ZZ2A 1ZL1A 1QPOA 3CS2A 4B4FA 4HNVA 2YX0A 4W93A 1XD1A 3STFA 4UNKA 4M7SA 1V93A 2ZDSA 2ZUVA 3APGA 1A0DA 3TW9A 3HQOA 4QNEA 4EKJA 3AHZA 4UTWA 2GQAA 4FX7A 3DI0A 3EDJA 4WQ6A 3TV8A 2RGMA 2G3FA 3EZ4A 3MO7A 4ZE5A 4JQAA 2MUCA 1TG7A 2C0AA 3A3XA 2GWGA 4FK9A 4PCFA 3T6CA 3B0XA 1QBBA 3B3DA 1ONWA 1XLLA 4AX7A 4Q7BA 4JQ2A 4XX6A 3VVGA 2HTMA 3DC0A 2WBGA 1TSIA 4Q8QA 3VOIA 1J9YA 3MDWA 4X60A 2PU1A 1UG6A 1FXQA 2XPKA 1CXHA 1SZRA 1QRQA 2X2GA 1RSCA 1UWSA 1E70M 1XPYA 1FHDA 3IVSA 3PP7A 3T07A 1LBMA 4UNIA 3TYBA 3FEQA 3GHUA 2I14A 1TR1A 2JIEA 3WLSA 1HVQA 4JOMA 3WBAA 3GR7A 3LB0A 4MNJA 3WNKA 3G3DA 2GFTA 1RAKA 1PKYA 1CGVA 3SURA 1QI3A 4Y9OA 4BK9A 4O1FA 2WC3A 4J9JA 1H7NA 3S1GA 1K8CA 1H2JA 4GUIA 2BBFA 2GWNA 3MT1A 5ABHA 2NXGA 1TWIA 1AG1O 1TQXA 4AF0B 3BGGA 1QOPA 3M4HA 4YVPA 1NEYA 4GI6A 1MQQA 4JHZA 3CL8A 4UFLA 1UB3A 1JZ7A 1GOQA 4PMDA 1UYQA 3LCGA 2J13A 4GUFA 4AWEA 4JKLA 4JDBA 1T6MA 4I7UA 4HKPA 3LCHA 4GC3A 4C6IA 2DSUA 2GGEA 4EPDC 1H49A 1XDJA 3MPGA 1KFEA 3W1QA 3L21A 1YIXA 1S1PA 1W31A 3PZMA 1U5JA 3KBMA 3UGVA 4GIYA 1TJ1A 1IWBA 4PH6A 4S3AA 1W9UA 2V8ZA 3OLDA 1VP5A 3L4XA 3VI2A 4N6FA 2QJMA 1UMYA 3H4WA 4F0HA 3NEVA 1SZFA 1ME9A 3L65A 4XKMA 1H09A 4LUIA 2Q02A 2B31A 1NDVA 2YOCA 1G67A 1RQHA 3E74A 3VGEA 2YDSA 4M19A 4CNSA 1IR2A 1KWGA 3GHRA 1IIGA 3L2LA 1HKMA 1BG4A 1SPQA 1UWTA 3QF0A 2ZTKA 4LCSA 5E9XA 1FUYA 5AC7A 5FCZA 2GJXB 1IV8A 2O4MA 4GMEA 3VDCA 3ANUA 3L5AA 5CJMA 3U4AA 1NF0A 3M46A 1XR2A 4Y8FA 4TVUA 2FTYA 1SO3A 2YA1A 3LQGA 2VFIA 1MYRA 3MP3A 3GUWA 3UZYA 4YTTA 2E1WA 4N4PA 5FD0A 3G6LA 1XYAA 3FVDA 3NDZA 1SUXA 2D3NA 1B1YA 3GY1A 4NZ4A 1FWNA 5TD4A 1O66A 5HQEA 1BKHA 1OCNA 3W70A 3GW3A 2QDHA 3B4YA 2EPHA 3E0IA 1JZ8A 3BO9A 4WY0B 2HVNA 4DZ5A 1XX1A 3GAYA 4M80A 3W22A 1UWRA 4N02A 4S38A 1E9LA 1FDYA 4AWSA 2IMRA 2WCGA 4IL2A 3BGJA 2Z25A 4Z42C 1IWPA 3PR2A 3LGDA 4V33A 1YLVA 3P6LA 1FH8A 2OXNA 3R0UA 3WENA 3I7QA 2HE5A 1ZFJA 3UETA 2PGWA 3BAJA 1TZZA 3ITGA 4DUOA 3H4XA 1VKFA 3VD7A 3PFMA 2YSWA 2G50A 1THFD 5A2BA 1QATA 3W7EA 2A3AA 1H51A 3I10A 4BF7A 2HS6A 3PANA 2PLJA 3EKGA 1L8NA 3R1ZA 2PC4A 3FHAA 4GABA 3EA1A 2GUUA 4GCXA 4V27A 2YJQA 4M6VA 3NZQA 3WDIA 1V6WA 2ATSA 2FGBA 2FGZA 4JXCA 2OZ0A 3GNDA 4AC1X 4GYKA 1D7KA 3LMZA 3S9IA 3BMWA 1IGWA 1GOXA 1VRDA 1J6OA 1E1EA 1KFCA 3B0UX 1BF6A 1JI1A 3K5XA 1P1MA 1UKSA 5H6HA 3QPZA 4RDWA 3WIJA 3UP8A 1XRTA 1YQ2A 3H2EA 1A0EA 1GVFA 1DJZA 1MUCA 4J3XA 4DJED 4DO7A 4CQAA 1OX6A 1V6XA 3WF0A 3GG0A 4S3FA 4PSPA 1BHGA 4CKQA 1YW1A 4K7VA 3K8MA 4B2DD 2QV5A 2VC5A 2D0FA 2VL4A 2D2JA 2REQB 3UXIA 1O4UA 4FEZA 3SSZA 2F9RA 2IXUA 3V1PA 3GXFA 3DG7A 2NX3A 2DORA 2ALDA 1R85A 4R9XA 3SUUA 3U4FA 1HVXA 4CVUA 1ZZMA 3H7VA 3OA5A 1S5TA 1GOOA 3MSYA 5MF5A 3G1RA 1KFJA 4LPCA 4N42A 1JFXA 1VFOA 2DGAA 2Q8LA 4S3CA 4WLCA 3HFTA 1JNDA 4ZE4A 5GVJA 3E2QA 1V8EA 4JN6A 1RUSA 3WD4A 1UR2A 2VC7A 1H7PA 3OZPA 2QUVA 3OA3A 4F79A 4YTQA 5GPRA 4GY7A 1S5WA 4ATLA 3AZRA 3E96A 5HPOA 2FHBA 1VQTA 1G94A 3TXZA 3UW6A 3C0QA 4NZCA 2OGJA 2ALRA 1AH4A 4DHGA 1NF7A 3MHFA 4LB4A 2X41A 1V3JA 6ALDA 3CH9A 3KOXA 4HSNA 3VNDA 3LHYA 4FXSA 1ADDA 1OD8A 2CZFA 4GQQA 4LNCA 5BXTA 4A2RA 2OPJA 3CLMA 1IXPA 5CSUA 3M6YA 5DX7A 4ATDA 4GVFA 4UFMA 2WANA 2POTA 3RCYA 4GH1A 2XWEA 4H2HA 3GK0A 4A3UA 4AH7A 3O07A