2ACSA

An anion binding site in human aldose reductase: mechanistic implications for the binding of citrate, cacodylate, and glucose-6-phosphate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
314
structure length
314
Chain Sequence
SRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An anion binding site in human aldose reductase: mechanistic implications for the binding of citrate, cacodylate, and glucose 6-phosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords ALDOSE REDUCTASE
total genus 99
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1994-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2acsA00
1ADSA 3V0SA 4Q7BA 3N6QA 1Z9AA 2PDYA 2PDGA 1VP5A 3MB9A 3G1RA 1PYFA 1Q13A 4XZLX 4PMJA 3LZ5A 3O3RA 3D3FA 3KRBA 4FALA 4GQGA 4DZ5A 2A79A 2C91A 1GVEA 2INZA 3GHRA 1T41A 4HBKA 4PUUA 1MZRA 4IJCA 2BGQA 4ASTA 3R6IA 3P2VA 3R94A 3CAQA 3GHUA 3BV7A 1Z3NA 5LIKX 2I16A 3H4GA 3LN3A 1M9HA 1QRQA 1X96A 2FZDA 5KETA 3O0KA 4RPQA 3CV6A 4WDWA 2PDPA 4JTQA 2HE5A 3H7RA 1US0A 3WBWA 3ONCA 3UZYA 1S1RA 4GIEA 4JQ3A 3EB4A 2FGBA 3V36A 3C3UA 3GHSA 3B3DA 2PDBA 4WEVX 2F38A 5DANA 1S2CA 3UZZA 4LAZA 4FZIA 2PDCA 1T40A 4PRTA 1PWLA 2PDUA 1AZ1A 4JQ1A 4HMNA 3UYIA 2R9RA 3R7MA 3ONBA 2ISFA 1S1PA 4FA3A 5LIUX 3LENA 3UWEA 1VBJA 4LB4A 2IPGA 3LNMA 4G5DA 4YS1A 3Q65A 4JIHA 4MHBA 1Z8AA 1EL3A 1IEIA 4YVVA 2QXWA 3LQLA 4QBXA 5JH1A 1ZSXA 3VXGA 1EXBA 4GA8A 3EAUA 2IS7A 3CASA 3UP8A 2IPJA 1XF0A 3UFYA 4R9OA 2VDGA 2ACRA 1YNPA 2IKGA 2FVLA 2IQDA 2PD5A 2BGSA 2IKJA 1RY8A 5LIYX 2P5NA 4QR6A 4XZNX 4L1WA 4YU1A 1YE6A 3CAVA 2WZTA 3LZ3A 1ZGDA 3NTYA 1UR3M 1MRQA 2IQ0A 2PDXA 1YNQA 4JIIX 3WG6A 2DUZA 2HE8A 3EB3A 4XZHA 4NKCA 3R43A 3RX2A 5HNUA 2HDJA 2BP1A 1J96A 1A80A 2IPWA 1RALA 2WZMA 4XZMX 4H7CA 2PDNA 1PZ0A 4PR4A 1EF3A 5LIXX 2AGTA 3R8HA 3COTA 4XVDA 3UZWA 3LEPA 2PDFA 4LBSA 2CLPA 4EXBA 1PWMA 2PDKA 4DBSA 4JTRA 1AH3A 2PFHA 4XZIA 3UZXA 4QX4A 1ZQ5A 2NVCA 2PDHA 1X97A 1AH0A 3M4HA 4XO7A 3N2TA 4DBWA 2F2KA 1AZ2A 3U2CA 2PF8A 2ACSA 4JQAA 3GUGA 5LIWX 3BUVA 1QWKA 3DOPA 3F7JA 1C9WA 4XAPA 4XO6A 3UG8A 5AZ1A 3WCZA 4GACA 2HVOA 2I17A 1AFSA 2FZBA 3MC5A 4JTDA 3LBOA 2ALRA 2IPFA 2HV5A 3RX3A 1MI3A 4OTKA 3T42A 3WBYA 3RX4A 4AUBA 2PD9A 2PZNA 4WRHA 4XVEA 1ZUAX 1Q5MA 4PRRA 2ACUA 1EKOA 2R24A 2NVDA 2FZ9A 1X98A 1JEZA 3R58A 5JH2A 4JTCA 3V0UA 4I5XA 3QKZA 3V35A 4EXAA 2PDMA 3FJNA 4L1XA 4JIRA 3ERPA 5HNTA 4WGHA 2ACQA 2PDIA 4GABA 3BURA 2DUXA 4WDUA 3S3GA 1YE4A 1PZ1A 5C7HA 2PDLA 2HEJA 2IKIA 3UGRA 2HVNA 1S2AA 3V0TA 2PDJA 4Q3MA 4WDTA 1HW6A 4JTAA 3R8GA 2DV0A 1AH4A 3WBXA 2PEVA 1IHIA 2INEA 4LBRA 4FAMA 2PDQA 1XJBA 3CMFA 5AZ0A 3LQGA 2IKHA 2PDWA 3Q67A 4LAUA 2J8TA 4GCAA 4ICCX 4XK2A 3GHTA 4JQ4A 4DBUA 3LUTA 1OG6A 1RY0A 5HA7A 4QXIA 1LWIA 1FRBA 4JQ2A 4WDXA 3H7UA 4GQ0A 4PUWA 3LD5A 3M64A 2FZ8A 4YVPA 4H8NA 1Z89A 1XGDA 3CV7A 4IJRA 3M0IA 4ZFCA 1HQTA 3BCJA 4YVXA 1SM9A 4IGSA 1K8CA 4LB3A 1LQAA 3DN5A 3G5EA 3FX4A 1R38A 5M2FX 4F40A
chains in the Genus database with same CATH superfamily
2KZHA 4LC8A 3NA8A 2GSJA 3SCTA 2PDYA 3BG9A 3B8UA 1TV4A 4M1BA 4PSRA 2G3IA 4GO9A 3BAWA 4X9SA 3LZ5A 1XC6A 4JNZA 1KCLA 2ISSA 3NDYA 4N2YA 1IF2A 3LNPA 2OLSA 3E96A 4LBUA 1EWDA 2WB5A 4KCWA 4FB7A 2YLLA 3OZMA 2C18A 2W66A 3RXZA 2ZTKA 1JJKA 1MNZA 4B5XA 3MBDA 1WUEA 4DPPA 5BXRA 4J27A 3RCYA 1IEXA 3H70A 4GLEA 1SU5A 3RITA 4CGTA 1QRQA 3LG3A 1GOXA 1UC4A 3GDLA 3O0KA 3MCMA 2VC9A 1Y7VA 1TVNA 5A94A 3UERA 3WNPA 4NP7A 1DVJA 1JI2A 4KBXA 1UZHA 3EX3A 4ZA0A 1Q7MA 2YZRA 4PMYA 3QLDA 1NFBA 1FFQA 3PZIA 4JTJA 6TAAA 3V36A 4P8XA 4KW2A 1BD0A 4CCDA 2OPJA 2XHYA 2V6AA 5I3DA 3LXCA 4ZXLA 5DANA 1YLVA 3TLQA 3WLJA 4TMBA 5FOOA 3WYZA 3GYCA 3KOWA 1VFOA 5GVJA 2OO6A 3IJIA 4ZGYA 1JZ3A 1WOBA 1G0CA 4NJHA 3EWUA 1H11A 3R2GA 1HJUA 4C1NA 5AC7A 4AZCB 3VNLA 1Q6FA 2YDAA 4PTDA 1VBJA 3MI2A 3RRAA 1MFUA 2IPGA 3WUBA 2VP8A 5ABHA 4JN7A 3VFCA 3KBSA 1XCWA 1L2QA 1VIWA 2HZGA 4JFVA 1KR1A 3CS2A 4GYFA 5C9ZA 5CAKA 2QXWA 1ONEA 4J2PA 3NOYA 4PCTA 1FWEC 1B1YA 4CVUA 4DJDA 2V68A 3LMYA 4NZJA 1F9CA 4LOCA 4J35A 4MWAB 3TKFA 5T91A 5CBJA 3GNOA 3TC7A 4DELA 4MKSA 4WKAA 2AL2B 5DMLA 4OVXA 3OYZA 3QMSA 4TR9A 3WQ4A 4HYRA 1V02A 1W5QA 5FI8A 1TV8A 4J28A 1K7EA 2H3DA 3W7KA 1W9BM 2W67A 1CX9A 4EF8A 3KP0A 2VX5A 2H3BA 3VCCA 1UUOA 1XLBA 5AC6A 1KW1A 1DWGM 1NQ6A 4POCA 3GNPA 4QISA 3SQSA 2GK1B 4HN4A 4HTYA 3FOKA 3NNTA 3OQ8A 4YXGA 2W4XA 3L5MA 1XBVA 2BMBA 3S5SA 2J62A 3E49A 1HX0A 1OBAA 3WLTA 1RD6A 1W54A 4O57A 1JUBA 3LGDA 4YHGA 1R2TA 3AZTA 3WFZA 1P0DA 3L2LA 4G1KA 4NJJA 2J74A 1T0OA 3BANA 4ZQNA 5CCZA 1RJQA 3PR2A 4MY9A 3VVGA 1JULA 4Q8PA 4O50A 1SW0A 3IJ8A 3U2ZA 2YCLB 3CXOA 4LNYA 3G6LA 2QUNA 1EO5A 4JFTA 4DF1A 3BWWA 5LA2A 4LVAA 1C9WA 1T7LA 2XM1A 3LERA 4N9BA 2QCGA 1JZ2A 1V6UA 3NIYA 1S5MA 3M47A 3BAYA 3LS9A 4NIRA 5XIAA 2D0GA 3MP3A 1Q8JA 3KLLA 2V38A 3ATYA 3TSDA 2W9MA 1EQCA 1HNYA 4GH1A 1OF6A 4BY3A 1OQFA 2V5JA 2YL8A 1BRLB 2Q8ZA 2GVJA 3C52A 3WD4A 5DCEA 4H6RA 4NILA 2OYMA 3V0UA 4Q8VA 4BS0A 5FF2A 3FJNA 2Z27A 3N18A 4WZHA 4WJ8A 5HNTA 4WR3A 5E6YA 2PDIA 4WCJA 4ICNA 3CB3A 3NPXA 3V5OA 4IICA 1JCXA 1KBJA 3IIXA 4C65A 1ONXA 4J3ZA 1JPHA 5FJPA 3W1MA 4MFDA 1HW6A 3DDMA 3G8EA 3I10A 3M0JA 2W62A 5EMLA 4X2RA 1H60A 3H26A 3BJTA 3PBVA 2FH6A 3WF3A 3CO4A 4S2CA 3WNMA 1AODA 1XDLA 3Q67A 3DC8A 2JBMA 3K13A 3UBPC 3K8MA 4Y8EA 4ZO7A 3SM0A 4B9YA 1M41A 1B90A 4E4UA 4OOUA 1WBHA 3M0ZA 4MIMA 1UCWA 2XFFA 3NQDA 1OSEA 5F4SA 5I3JA 4QS6A 3EA3A 1WZAA 4KIEA 3WLRA 2ZXQA 3F4WA 3PJWA 3K30A 1I2RA 4H8NA 1YBQB 4CCCA 4AEFA 1QOXA 1H7XA 5M5DA 4IIDA 2HXTA 3PBGA 4C6MA 3MUAA 1KLZA 3GKAA 3P61A 3FX4A 2CLPA 3LI0A 1E40A 3OJGA 2ZZ6A 1FWBC 3FYYA 1VAHA 2D20A 4UMBA 3NZGA 2GOKA 1A47A 3XIMA 5A2CA 3I7RA 3N73A 1B30A 1FWRA 1MW3A 4NAFB 2XFYA 2W3ZA 4EAYA 3GXFA 4DZ5A 2C14A 4V27A 4EPEC 3WJZA 2A1YA 1UD3A 1TX2A 4R3UA 1KWKA 2C79A 5TQLA 5I02A 3W37A 1Y5VA 3WDQA 2V9DA 2QIWA 1C93A 3QPEA 5FJTA 4RPPA 3LTPA 1K8XA 1TPVA 4RE4A 2J24A 3A47A 2ZRVA 3LI1A 1HL8A 4HNTA 4Z08A 1RVKA 4KFOA 4U31A 3E02A 4GKTA 3H4GA 3NQ2A 1JGIA 1ZS2A 3W7HA 4RLIA 5SWUA 1QI2A 1OIMA 4S3EA 3FS2A 4KMQA 4U2YA 4LCSA 4ATLA 1M6JA 1UBPC 1JZ6A 3LTSA 3THQA 3WBWA 2WWCA 3UG4A 1C8XA 2JEQA 3F4DA 1KC7A 1A49A 4K8HA 3QYSA 2DP3A 3H4XA 3P0WA 5DLCA 4G7FA 4YCOA 5BRPA 4HSNA 3LMZA 3I3DA 4AEOA 1OFAA 2Z1WA 4I90A 1VFHA 4ACYA 2RUSA 1WDDA 3E0FA 1VBUA 1T40A 4JN6A 3CIXA 5I03A 2WLYA 3AWNA 6PTDA 4JQ1A 3R5EA 3ZVIA 3KWXA 4DY1A 1L6FA 3ONBA 2QDEA 1FHDA 4ZR8A 2HPIA 4PCPA 1LLOA 3U8GA 4AY1A 3ABRA 2JGYA 5E93A 3DHDA 4WY0F 3KHJA 5K9XA 2XYLA 4QHRA 1DJXA 4JTKA 3T7VA 3S1WA 4M51A 3NEVA 1QCWA 2OYLA 4FLOA 4E38A 3VD7A 2PU0A 1QT1A 3KDNA 3U9IA 2AQVA 2OWWA 3CZEA 1R86A 5K7JA 3IIPA 1CXFA 2YBUA 3E0IA 3AFBA 3FHAA 3TJ4A 2J27A 4CQAA 4Z1DA 1AJZA 5LSMA 3KBVA 1Q3NA 1LORA 4XD3A 3W1PA 5CSSA 3BLFA 2CLLA 5EFDA 3H21A 3W0KA 3W88A 4UB9A 4GI4A 3WX7A 3W29A 4R5EA 2PE4A 5A8NA 2YDSA 3HIJA 4LV9A 2D24A 1RY8A 3QW3A 4AX7A 5H91A 3FXGA 4YU1A 3W86A 1BRLA 1IT8A 4GX8A 4M7SA 3P84A 1B31A 1XFBA 4DYJA 4XD6A 2A3EA 3S6OA 1IWAA 4YTSA 5F2MA 3A24A 1BLIA 3POHA 1AUSL 3O8AA 4MFEA 3UA4A 3W1AA 1A0DA 3DBNA 1UWRA 4WQ6A 3SJNA 1CTNA 1G01A 2ZZ5A 3HGSA 4L6OA 4AF0B 3TNOA 1JQXA 4M5PA 3HBLA 4X22A 2BP1A 4JDBA 4B2DA 3ZLFA 4GINA 3ES7A 1MZHA 2PC8A 3TCSA 3MHGA 3UR5A 2ISWA 3SIMA 1XSKA 3TSBA 2PWDA 2CITA 4O17A 4OE7A 3N15A 3VIGA 4RKAA 3D47A 1VFTA 3OBAA 3OLGA 2PFHA 1OFDA 3W1RA 4XSLA 5CAHA 1PTDA 4QX4A 2DUAA 1U22A 4DZHA 1I9CB 1P43A 4UTHA 2FPYA 4O15A 5GNXA 1ZAJA 2MUCA 1WO2A 3H7VA 4HA4A 4FEZA 3W7IA 1W1YA 4TX8A 4XB3A 1A5BA 4CD5A 3N9KA 1RD5A 5TD4A 4DLMA 1GKRA 1ISYA 4ZQRA 2ZZ7A 1SFJA 5GNYA 3AZSA 1TZZA 2P76A 1U33A 4H7ZA 3UT0A 3MMUA 4IFKA 1SO6A 1LRTA 3NQFA 4LU0A 1UQYA 4KERA 1XPGA 4AMCA 1MI3A 3UQNA 3VDAA 1FQ0A 4HKPA 2AL2A 2UY5A 4C1KA 4DNMA 3CC1A 2ONEA 2NVAA 3QVQA 1Q5MA 3BC9A 2QCDB 3CUJA 3WQGA 3N6JA 4U28A 1EKOA 4LTSA 1SMAA 3KAOA 1X98A 2WQPA 1NWRA 1JIBA 3R11A 3TJXA 3FKRA 1X8CA 1E55A 3DG3A 2NQJA 1KCZA 4L1XA 1GVIA 5AC8A 2YW4A 5E1QA 4XBSA 5JBFA 1EJTC 4ZQCA 5DX7A 1OCQA 4RCXA 3AUOA 1YE4A 2X1RA 1KNWA 4HCDA 1W3JA 2DSVA 4JBRA 2CCRA 1SZRA 4F48A 5A1AA 3OGVA 4PMXA 2MNRA 1KTBA 2CNCA 2CZEA 2DSZA 4AD3A 1LUCB 3OW1A 3H2NA 1PCKA 4WX2A 2Q3OA 3W6MA 2QV4A 4IMFA 3CQ0A 2FFCA 3C56A 4JNMA 4PEEA 1OC6A 4I9MA 3N12A 3VM7A 2WSQA 1EJ7L 3LLXA 2OZTA 3WQPA 1XYLA 2J9ZA 2VCCA 4LGXA 1GHSA 3H7UA 3VOCA 4GQ0A 3LD5A 1KM0A 4HYVA 2H90A 1A4MA 2Y4SA 4YVPA 1YDYA 3LLDA 3MDWA 5I3FA 4ENLA 3M0IA 2QHAA 2BY1A 1LDCA 3N1AA 3VINA 1K02A 3K4WA 3WBAA 3C2VA 4Y9PA 4HZ7A 5LNUA 4GZ7A 2OLAA 1DIDA 3GIYA 1NOUA 1FH8A 4ERAA 5KINA 1BXCA 1TWSA 4Y96A 2DZPA 1YADA 4I8DA 3G1RA 3B0PA 3H53A 2HS6A 4JNYA 2A6NA 5CPOA 2F7FA 1W3KA 2Q6ZA 3C2RA 4B2DD 3RN6A 4NZ1A 1QFEA 3LHYA 2FIQA 3DAQA 4LSBA 1FXPA 1ZRQA 4ZSTA 3TMQA 1A5UA 4IQJA 1I8JA 2QCHA 4MB3A 1MDLA 3A3HA 1UKOA 1CENA 2VEPA 3H2AA 3E74A 3CWHA 3MHFA 5LYRA 4NG3A 2O9OA 3B04A 2BVDA 4ZODA 3QHNA 1VGAA 5H6HA 4KCUA 4F2UA 3JS3A 3AXIA 2EPMX 4E3VA 1W5PA 4JTSA 3WENA 4O1DA 4ZB0A 4NRRA 4G9PA 4AD1A 5F4WA 1RK6A 2NWRA 3B4UA 5CGMA 2VTFA 3GNRA 3ONCA 2DIKA 3BAKA 1OYAA 2YYUA 3L4UA 1J79A 5JQ9A 3B3DA 2H8XA 4OZOA 1J2BA 4G2DA 1E3ZA 3W02A 1J6PA 2PA6A 4X0NA 1ME8A 1EP1A 1LBLA 1VBHA 4UOZA 4IP4A 2NLIA 2DDXA 5G5IA 1EHAA 4H01A 4XV0A 1XRVA 2ISFA 1BQGA 1XGEA 3GTIA 4DI8A 3G1YA 4OV4A 2MANA 2CYGA 2GZXA 2VR4A 3IJDA 5LGXA 2FHBA 3LCFA 4EK7A 4FNTA 1EGVA 1OCNA 2W79A 5FJUA 1GJUA 4OBSA 1V02E 2XVNA 3QHMA 2OGYA 3Q65A 3UVIA 4CNTA 1WDQA 1HKMA 3FDGA 3P0XA 2O56A 4I6KA 1HKKA 4S38A 3W26A 3WH7A 4B3LA 1EXPA 1E51A 1LT8A 1SO3A 1H7OA 2JALA 1U2YA 1TQXA 5CLTA 3W7JA 4GNJA 3H24A 3NYDA 6XIAA 2Q8LA 1XI3A 4YIWA 3AJ7A 3FVDA 5BU6A 2RAGA 2PSNA 4MNLA 3NSXA 4Q32A 1XC4A 3TWBA 3G1VA 1H5VA 2QZRA 3WJSA 1EA0A 1Z7AA 1XWYA 1JCMP 3S5OA 3NYZA 3V5FA 1UQZA 4QR6A 4L1WA 4YTRA 3IGUA 5T9CE 1DXIA 2TSYA 3LZ3A 4DO4A 4O28A 3BAIA 3MW7A 2WSYA 1PO9A 1SSGA 3SRHA 4PZVA 4XBJA 3SCSA 4LW7A 4NJGA 2EPHA 5FAJA 3WDPP 3MVIA 3USBA 3WQFA 3F1QA 5HNUA 4F2TA 9XIAA 1SSDA 1QTWA 3NPVA 3GSMA 1R30A 3QRHA 4S1FA 2ZRUA 1VJIA 3CUZA 2V63A 3B9EA 4CNPA 7PTDA 3ABOA 1FHLA 1ZY9A 2J4GA 1R9ZA 1TR1A 2Y88A 4W5ZA 2WZHA 4AF0A 3FCPA 1TPDA 1LUCA 3CJPA 3G22A 3M0KA 1V6XA 3VE7A 1TPB1 3RLVA 4HPGA 1K9DA 4XZIA 3UZXA 3INPA 2X09A 3A22A 3RNDA 5J5RA 1RCXB 1XLHA 1W1A1 4B90A 3WEMA 5ECVA 3L2MA 4LPCA 4YL2A 3VOHA 2Z6IA 1BSIA 4GQBA 3FSTA 3CBWA 3DOPA 3P93A 2PRMA 5AHNA 3PZGA 2JIEA 5C6MA 4E8CA 1S39A 3WLQA 3TA9A 2BX7A 1IXOA 5CSUA 2POTA 5C54A 3IJQA 2W91A 1AFSA 2RHGA 4R7WA 1NU5A 1V79A 3BAJA 2QR6A 4DPQA 5C2XA 5CC5A 2ALRA 3FYPA 2V8ZA 2CERA 1REQA 5KITA 2OGJA 4HZMA 5FF0A 3NZPA 3GXDA 4NHVA 2RJGA 1ICQA 3VIHA 4WXYA 4L9ZA 2VEKA 1EEPA 4N9EA 1ZUAX 3DFTA 3N2CA 4UFMA 5JIPA 4EPKA 5E6ZA 3HJZA 2FZ9A 3FSUA 1WDPA 4A3UA 2WC3A 3A4XA 5I0DA 3V35A 1TZ7A 4A3YA 3WNOA 4K68A 4NF7A 2NXGA 3VNJA 1R3TA 1W32A 2CLHA 3QY7A 3EWWA 3ALFA 3WK0A 1PZ1A 2Y2WA 3GVQA 1E15A 5HR7A 4KPLA 3W2MA 2Z1VA 3CNYA 2GGEA 3OLIA 3DBPA 4C7FA 3APYA 3CQKA 2VD8A 2V67A 4HA0A 5F1UA 1GOQA 1BF6A 2J25A 5D8ZA 3O16A 3WJYA 3FJ4A 4K1WA 4N4PA 5C71A 4R7JA 4A6GA 3BCFA 1A4LA 2NQZA 2Q8XA 4JXCA 2OWCA 1QPRA 2BHUA 3NVDA 3NR0A 1YTKA 3PTQA 1R87A 2PODA 3VD9A 4H6EA 2O9PA 3GVGA 3QEZA 2FPVA 1YEYA 3PZ9A 3IVSA 3AISA 4C6PA 4ZCWA 1FRBA 3VIJA 1X8FA 4LNCA 4LUJA 3CT2A 4FI4A 1UD8A 3RIKA 4QG8A 3DH7A 3VGEA 2WVSA 4IP5A 1HG3A 3THAA 3MUZ1 5CEWA 5REQB 2HISA 4IGSA 1XIEA 1CIUA 4NAFA 4PODA 2E9LA 1OVDA 1X6NA 2Z29A 4GUHA 4GZJA 1EEXA 1F76A 3V0SA 2WBKA 4JX6A 1BQCA 4QRNA 1Z9AA 4FX8A 4GVHA 5GPRA 3W2LA 5C9XA 1VP5A 4REQA 5LHFA 3PAJA 1PYFA 5DBTA 1Q66A 2XISA 1W56A 1XGZA 1P7TA 8XIAA 4QJ4B 1KFEA 2PAJA 2VEMA 2XN2A 3B0XA 2F2HA 4FALA 2JF6A 3ARUA 5DMMA 3R0DA 2C91A 4LAMA 2VMFA 1Y0EA 4TTUA 4P7LA 3T9PA 4EACA 2OJPA 1WX0A 1VCFA 5AY7A 4EAMA 3TDFA 3EPNA 1Z3NA 5I3HA 4BQ3A 1YHTA 1TPH1 1OX4A 5KZDA 5KZMA 1I45A 2WJFA 5HUPA 1OABA 1NP2A 1J8VA 3W72A 2CPUA 5CSRA 3FY1A 5A6AA 4MUPA 3TLLA 3GVVA 3LCWA 1UBSA 1US0A 1EP2A 1GYNA 4HZ8A 3GNXA 4XAYA 3WQEA 1GQIA 4TXEA 2FH8A 4O53A 1UIPA 2DZBA 4DUXA 1VFSA 3DFSA 3B06A 4AVOA 8CGTA 4PSPA 3CHFA 3B40A 3MQTA 1RR2A 1LTDA 3G8RA 3WEZA 1B9ZA 2PDCA 4KRUA 2G37A 3WF0A 3R0KA 1R3WA 5CH9A 2XVLA 4ALDA 4FA3A 1DJQA 5HWMA 1Z69A 2XINA 1W31A 1JDAA 2FMOA 3MSRA 3TFCA 1YXCA 3AHVA 1LLWA 4X63A 4LB4A 3FKKA 4O13A 5DT7A 2A3BA 4CD7A 1PS9A 2V3FA 5HULA 2J7EA 4OGZA 2ISDA 1BGAA 2E68A 1TRIA 1OFEA 4AB4A 1IEIA 1W1PA 1HJWA 2VZUA 2GYIA 2XSBA 2XGBA 3O6DA 3ZS4A 3RCMA 4GYJA 1MQQA 3IVUA 2JK2A 2OEJA 1VH7A 4D6HA 2HPMA 2GGIA 4RXFA 3UNDA 4R9OA 2ZWZA 2HWGA 1EGZA 4DUVA 1WZLA 2P3ZA 2FVLA 3IAPA 1OWQA 2YXGA 1W3NA 3B9NA 4M29A 1CLKA 3VGBA 2A7RA 4F3HA 1QW9A 2P3EA 1QXLA 4M7TA 2J8GA 3ANUA 3TCEA 2E5DA 4RUBA 4D6CA 4FX6M 1P6WA 4F0LA 4LF2A 3ZSTA 4U3CA 1DIOA 1TWDA 4RJEA 1DTUA 1BTCA 3KE0A 3DZ1A 5IHRA 5FJJA 4WY0B 3FK4A 3WUFA 1S3TC 3NGJA 4O18A 4HJFA 4AHOA 2HDJA 3EEZA 3WUGA 1UWSA 2IPWA 3GXPA 2WZMA 3HB9A 3BJSA 3DXIA 1XLGA 4MNMA 1EIBA 4Y9NA 2YDRA 2PDFA 3DFQA 4ZVJA 4HB7A 4EXBA 3L4WA 1PCWA 3TTSA 3PZQA 4C6DA 3B9DA 3OG2A 1ISVA 3G0XA 3GNNA 5H8UA 1C8VA 3MCNA 3G77A 4FOJA 4WOZA 3GKFA 3PK7A 1IE7C 2ALDA 3E1F1 1OZMA 4O11A 4AIOA 2IMRA 1TTPA 1OG0A 5D2VA 3HPAA 3GUGA 5LIWX 5G1TA 1L2UA 1EGMA 3ITVA 1TV3A 5BMWA 4XAPA 1V4YA 4P8WA 3WIJA 2CEQA 3W00A 1AQ0A 4M80A 3KTCA 4NQ1A 3TZNA 3EWYA 1O60A 3CPUA 2Q09A 4PRWA 2OKTA 1JCNA 1ZL1A 5KZ6A 2HV5A 3CH9A 5DCBA 2XGIA 3DHFA 5M1TA 4NRSA 2QMJA 4MJ2A 1G1YA 4H6QA 4QJ3B 1JVNA 1RBAA 1MXDA 4TV6A 3L12A 5BZAA 1I1WA 1V03A 3BPWA 1JUKA 4BHYA 2GVGA 3V5CA 3EXRA 1ZBVA 2OT1A 3SW6A 1KXVA 3E2QA 4QROA 1KQZA 1LZOA 5EU9A 2G3NA 4C6KA 5FEWA 4MDOA 4TX6A 4UTWC 3STFA 2WPBA 3LPFA 3LBMA 1PPIA 1QHOA 1QWGA 4DBDA 3TN4A 2AMXA 1KGUA 3VNYA 2I57A 1F4HA 4S3CA 1FWNA 3XINA 2JKEA 2OO0A 2X1TA 1NOWA 4QS5A 5A3HA 3BCDA 4QSFA 2OU4A 1T8XA 3ITGA 3O63A 5FJOA 5K2ZA 3UPWA 3KUMA 1W1ZA 4IXHA 4LAOA 3LOTA 3DIPA 5CPTA 2Z6JA 1DWHM 4GH3A 1AW2A 4XKYB 2CIPA 2EPLX 4NY2A 1P0EA 2BOFX 4DYKA 4B91A 4O1FA 3PJTA 4MGGA 3BCJA 4HHPA 1GEQA 1FWAC 1UKTA 5BW6A 1KFLA 1XLLA 4Q4MA 3DKLA 3E0VA 1QK2A 1J0IA 1R8LA 3P8IA 1S2VA 2WPGA 1R6WA 4W88A 2NX3A 2YFOA 3MSYA 4ORIA 2CLFA 3MB9A 1UKSA 4JY9A 3BLOA 4L4OA 2I9UA 5AECA 4FNSA 4TVCA 5AFDA 3LHVA 1A3WA 1TA3B 3VKAA 5FACA 4LVGA 3TK7A 5HWNA 3C3NA 4HTBA 1TJ2A 3IRDA 3NURA 1X1ZA 5E0FA 5EKYA 3VCRA 4LCQA 1SZNA 1JCLA 1HJVA 1JAKA 3IPWA 1DE6A 1B9BA 3L5LA 4JFSA 1XDJA 4PMVA 1W0MA 4GY1A 1X96A 3OODA 1KM1A 1H62A 4C6LA 2VR5A 1PE1A 4W8LA 3BW2A 4C90A 3OGRA 1A3XA 1KFBA 2A3AA 2H6RA 5I77A 3LBCA 3W7QA 3UPMA 1IGWA 3VGDA 1FDYA 3CLWA 3EB4A 3HGRA 3AU6A 1NY1A 1DPMA 4HD5A 2F38A 1TJPA 3BTNA 2UBPC 1E6NA 4LAZA 4GUGA 3W28A 3QR3A 2W6RA 3DENA 1RAKA 2JE8A 2FJUB 3ZR5A 1ZAHA 2E6YA 3SN0A 3CTTA 3E6EA 3PWAA 3QPYA 2DU2A 3UZJA 1P48A 3REQB 2F84A 2VZSA 1R7OA 1G94A 5U7SA 4EE9A 4FLQA 2REQA 3A12A 4LEQA 4G5DA 2NT1A 3HQOA 1W2PA 3GXTA 4CUCA 1F3EA 1TPC1 2ZZ4A 1GQJA 2R8WA 1A5NC 2OTDA 4Q8OA 1HL2A 4CN4A 4F79A 3BQ6A 4U4MA 3EWDA 3GDKA 4O4WA 4H2CA 3E5PA 1LBFA 2R82A 4KEMA 3UWWA 3SQLA 2WM0A 1WZMA 1AVAA 2IS7A 1TUFA 3LB0A 4DXKA 3AIQA 3LHTA 3W27A 2WV8A 2GJXB 4UTLA 1G4PA 4LALA 1AG1O 2PTDA 4ZQOA 1K8ZA 3BG5A 1XM3A 1UD6A 1XG4A 4PTNA 2PGWA 4DLFA 2I5GA 2PD5A 2C15A 2Z1XA 1R2SA 1XIHA 1FWJC 3K4DA 4B5SA 4J5NA 3NTYA 4D71A 2A2IA 1O5RA 3O15A 4L9YA 2UY3A 2D2JA 1IV8A 4RZ4A 4QE4A 1BKSA 1MUMA 1NELA 1BG4A 2VFDA 4O0ZA 5CQ1A 4FNPA 3UEQA 1HO4A 2ZZ3A 4HU0A 3K4AA 1BVNP 2YZ5A 3A23A 5D33A 1QASA 5JBEA 4Y9OA 1B4EA 4QCEA 5CPMA 2FVKA 1U5HA 4NI8A 2B7PA 2Z2AA 4Z1AA 2PDNA 3W2UA 2WAGA 4MPQA 4GZEA 4MKVA 1ZJBA 4LBSA 1MWOA 4O1AA 3RFAA 8TIMA 4K6AA 3W7DA 1TB3A 2ZZ2A 4AX6A 3AUJA 1ZP3A 1CXKA 3RO8A 1THFD 2ZDSA 5EYWA 5H1WA 2FQIA 1VENA 1O1ZA 1OGBA 2ZDRA 3WD3A 2YCLA 1IZKA 2X0HA 1E3XA 3GC4A 3TJIA 3A5VA 2Y24A 2ZC1A 1Q2RA 6ALDA 5FJIA 1GVYA 2AAMA 2WM1A 2GVEA 3QJAA 1KBLA 1XX1A 2V2CA 3AAMA 5H8MA 4CLMA 3JVAA 1RK5A 3WK3A 1P0NA 3SRFA 4DJDC 2ZTJA 3EZ4A 1ITCA 3CZJA 3S5NA 4IFKB 1A0EA 3NQVA 1G7VA 2WLZA 3P5ZA 4NZFA 1RPXA 3NEHA 3EWCA 1E72M 4Q4KA 3MKCA 1R0MA 2ZRWA 1FWTA 2PCQA 4G1NA 1OT1A 4NUWA 3ME3A 5BNKA 1NQKA 1X7FA 4JIQA 1E6RA 1PX8A 2Y7GA 2XM2A 5CZ0A 1B3XA 3SUUA 2VCAA 3VMNA 4ATDA 1R5YA 1O6IA 2ZICA 1VFFA 5A69A 1AJ0A 3M43A 5C9RA 1E70M 1SYTA 2X7VA 2VOTA 4TTGA 3FA3A 4JPGA 3AHTA 2PDMA 1R3YA 4NX5A 4Q7NA 5FF4A 4AIEA 2D0FA 3QQ1A 4MZ1A 4CVWA 4QSHA 4WGHA 1TTQA 3F2BA 5MKGA 3MUY1 2PTZA 4O1EA 5A6SA 4JX4A 2JQXA 1B3OA 2HEJA 1NWUA 2HVNA 4IT1A 1LRQA 2WSKA 2PDJA 1TCDA 3M6DA 3VC5A 2XPKA 4NAEA 5DEZA 1E0WA 2DV0A 4D6JA 4H7VA 3TYAA 4IP7A 4BEQA 3AIRA 5BOEA 1N8FA 4BJHA 4Q4OA 1S5TA 4M6PA 4PA8A 5DQPA 4FAMA 3RU6A 3CMFA 1C92A 5D2WA 2IKHA 3W1TA 3SO7A 1SO5A 1EJRC 1PHQA 1KFCA 3F2DA 4FLRA 3CUXA 3GIQA 3T81A 2QQ6A 2RKXA 2UY4A 3HPXA 4ZFMA 4GXMA 2CETA 4JQ4A 5HA7A 4QXIA 2R6OA 2R94A 1Q4WA 2E09A 1OGGA 3VI2A 2UWFA 1Q6QA 1MSSA 2EAWA 1R2RA 3TN3A 3LK6A 3DI1A 3D5HA 1PIFA 5CPNA 3F4VA 2O92A 2D69A 4XD4A 3WLIA 1Q2SA 4GJIA 4QJ5B 3ABZA 2Z2UA 3BSGA 2QJJA 4LS1A 1XG3A 3M46A 1VPQA 1RHCA 4KCTA 2DFAA 2OEMA 4FXFA 2J7HA 1W6TA 5C2CA 3WFLA 2YCKX 3DN5A 3QMRA 1BAGA 2GWNA 3LU2A 4MJMA 3BGJA 5I3GA 4JTIA 5BYWA 4K8EA 1PSCA 2RDWA 3OLDA 3DGBA 3PG8A 1PL9A 2QPUA 1O12A 4MLJA 5D9NA 5EBAA 2NSXA 3W2KA 4XZLX 3OIXA 4PMJA 1A5AA 4BI6A 5LNVA 1XCXA 3PSWA 4D1JA 4UQEA 3TW6A 3G24A 3L66A 5J5DA 1QNSA 3AS1A 2A79A 3CH0A 1A50A 3ZJKA 1GVEA 1J12A 1IT7A 4CQ8A 4HSHA 1GUVA 1R3RA 1DOSA 2WXDM 3GU2A 4ZTYA 3QC0A 3T8QA 3OQEA 2SFPA 4LUIA 1M01A 4ROPA 4ZE4A 5ABFA 1EC8A 3PZNA 2PF0A 3VABA 3M0MA 5IXEA 4C6BA 3PB2A 3L23A 3R25A 1S1RA 3SN1A 3KXQA 4R34A 5E0CA 4MWAA 1UUMA 3H2OA 4WKFA 1IQ8A 2ZRZA 4GYPA 2AOSA 2XIBA 1MRAA 4K2SA 1U1JA 5A95A 4FIRA 1ZJHA 1AZ1A 3DGRA 4YYCA 2GUYA 1K9EA 4IM4A 4M6QA 3N2XA 3ZJ7A 4WD0A 2ZXDA 1X39A 4EANA 3NCOA 5LIUX 1VC4A 8XIMA 4B3ZA 2RDUA 1R85A 1WDRA 4RXGA 1Q6CA 1XSIA 3WQDA 1FH7A 1K4HA 2E8YA 5MKGB 1J0HA 1UD2A 4KCVA 4DO7A 1WBJA 3ZJ6A 4HVXA 4HHMA 1UOKA 1E6XM 4Q4RA 3VIIA 1Z8AA 4AWSA 1DJZA 1CPUA 2QJMA 1DWAM 2C19A 3FVMA 3ZLGA 3OBKA 1J0KA 3CV2A 2ZRYA 2P0IA 3F4CA 4JICA 5PTDA 3VXGA 1AMYA 1XBYA 1LG2A 4Q6JA 4ZXOA 4QQ3A 5EGRA 4ADSA 4J1OA 1CW2A 3N4FA 2QF8A 1XF0A 2C71A 3CB8A 1EB3A 4LYPA 2VDGA 4ACZB 3H55A 2CLKA 4I5UA 3LDVA 1JYVA 1XBXA 4AH7A 2ATSA 1ISWA 4PYSA 3AXHA 4JD4A 4IIEA 4Q4SA 5EA9A 3VKJA 3K46A 3TYUA 2VC7A 1KRBC 4DM1A 5FSDC 2EPNA 3N4AA 1FP8A 5D9MA 3GVRA 4CEUC 3OHMB 4MJ4A 3TV8A 3VCNA 1Q4NX 3VD4A 3CHEA 3L68A 1EHNA 8RUCA 4WF7A 1V3IA 1TE6A 2X1UA 3N14A 3W23A 3HG3A 3ARYA 3CAKA 4ZTXA 1O7AA 3COTA 3WQWA 3S47A 4OBTA 4PBEA 1YXYA 4LYKA 1L6SA 3N34A 5A2BA 4D9PA 4PH6A 4NJKA 3PNZA 5CC3A 1GVQA 1CZ1A 4DIAA 4DO5A 3DERA 1BEUA 1SMDA 4JFWA 1IWBA 3H2FA 1HGWA 5CZSA 4GGBA 4Q8UA 4OOZA 3M5YA 2Y1HA 4XSMA 5HBFA 1GZJA 2VGBA 3UJRA 2PDHA 1AH0A 1XV8A 5G2WA 1EJUC 4DBWA 2BLEA 3N4EA 2XFWA 3R0UA 1ZAIA 2ACSA 1ICSA 4ADTA 2CHRA 3SFKA 2V30A 4WOQA 5FL0A 2G4JA 4MZ8A 4J3UA 4PB4A 2A7NA 1FVPA 3B9OA 4LS0A 3C0JA 2D1ZA 4I9AA 4KT2A 3PUGA 3NOEA 3EGJA 3N25A 5HMFA 3LBOA 1EX1A 5EMKA 5I3IA 1UP2A 4NT0A 2IPFA 4O0KA 1JXJA 3T42A 2DW7A 3B03A 4LUYA 1FTXA 1WDWA 5HDRA 3A9BA 3THDA 3SEPA 4DWSA 3VIOA 3M41A 3OVQA 2ACUA 4AY8A 2BGNE 2VQUA 3QFWA 3NDZA 1DHKA 1NTHA 2L5HA 9RUBA 2V5CA 4I5XA 1RXOB 1E5NA 2PWHA 1DWFM 3PTMA 3JU2A 1B3YA 2DJLA 2Z1BA 1S2TA 4IIBA 1F61A 1GTHA 2WCGA 3PBYA 5C7HA 4AEEA 2GUUA 4M56A 2EPKX 2W0UA 1ALDA 2ZQ0A 4FK9A 4KKXA 1XPYA 3GAKA 2PEVA 3LHWA 3F2CA 2WMJA 2PGEA 2QS8A 3STPA 1QW7A 2DT3A 2PDQA 1SJAA 5F1VA 4H8UA 3TP4A 4LAUA 1DQXA 3W24A 2V3GA 1UP0A 1HIZA 4AIUA 1ECEA 5LGZA 1FHVA 1WOAA 2GGHA 1EZWA 3QN3A 3VNKA 3S6DA 3MV11 2VENA 5LNRA 1MW0A 4BQ5A 2D3NA 2D2OA 3M0LA 3ZT5A 3VUSA 1H50A 3C0LA 4S3JA 3OVPA 3PFRA 2G95A 1H4PA 1WP6A 2O7QA 4JCLA 4XZBA 1ZBCA 1KGWA 4IMDA 4C6EA 4CNSA 3O1NA 3WJWA 1JRCA 3B05A 2CBIA 2Y8KA 4A8NA 3S4TA 2P8BA 1TX0A 3B8DA 1M7XA 1UWIA 3BLLA 2GGJA 3U7VA 3EMQA 1PHWA 1FKWA 2WHKA 2I7GA 5EMMA 1ISXA 2NXIA 3QOKA 4Z1YA 4E5TA 2ZA2A 3G1DA 5G1MA 2PI6A 2XFRA 3GHRA 1HO1A 2CKRA 1QI0A 3ITTA 3K5XA 3BSMA 4HNOA 4H4IA 3MYOA 4AXNA 2PURA 4L5ZA 4C91A 1GNXA 5JBDA 3PNUA 4BA0A 4NXSA 3MI6A 1TV7A 3AXKA 3CUGA 1DWIM 1B54A 1PB0A 1QPKA 3UU0A 1F8IA 3KVMA 4OV9A 1OF8A 3D0CA 3IS4A 3QTPA 1WKFA 5BXSA 2EGZA 2ZUMA 1PTGA 3QR0A 4DHGA 1B2YA 1JPKA 4GNKB 5C2GA 1FH9A 1VJZA 1NM9A 4JTTA 4A3QA 5KEZA 4M81A 4DZAA 4KGLA 3WJXA 1S46A 2ADAA 4QQUA 1E0XA 3WLOA 2NV2A 5M17A 2YFNA 4GUFA 3GRIA 4CU7A 3GAYA 4I8YA 1G4EA 3W7EA 2OT0A 1J6OA 2YDQA 3S2MA 3P82A 3ZR4A 1KBBA 1KR0A 1OM0A 1J93A 1V93A 1V3LA 1VEPA 3LGGA 3B8IA 1SJBA 1OINA 1XH2A 2WBGA 3NQMA 4H83A 2HMCA 4CD6A 3A4AA 4AVNA 3IRSA 4JY8A 1UZDA 2VQTA 2GSEA 4E3TA 4E6MA 1EL3A 2X42A 4QBXA 5B7YA 2QDGA 5D38A 1ZSXA 4AWTA 1VEMA 5REQA 3PWIA 4G6CA 1OIFA 1XDMA 2QVNA 1O68A 3EAUA 2BXYA 2VHLA 4UTKA 4BFAA 2Y8VA 4B9ZA 3FAWA 4QFUA 2IPJA 4V15A 3TEVA 3NL6A 5D05A 2PWGA 3DC0A 1SZGA 1TREA 1UWQA 1M04A 2IKGA 3KFTA 5DMYA 4OT7A 2BGSA 2C16A 3WH8A 4A35A 1BSLA 1OFBA 1XIJA 2OXNA 3JRKA 4H8VA 2V3DA 2WZTA 1XL9A 2A3CA 3IUDA 2YIHA 4MWAC 1IIHA 1PYMA 3MDUA 4EOUA 5H8PA 1YNQA 4M82A 4H9MA 1W37A 3EOUA 2O7SA 4PE8A 1PBGA 4CQDA 4Z1CA 2NV1A 2X40A 1F05A 1TPFA 3DX5A 4P7RA 2D22A 3OZYA 1J5TA 3AS0A 2IW0A 3GXNA 2FZMA 1WPCA 1VR6A 5BCAA 3I4KA 7CGTA 3BGAA 1JYXA 3P3BA 1JR1A 4UBPC 1JYNA 2G3FA 1UP3A 3MKVA 1MUCA 2PRLA 4NXKA 4E2BA 3HM7A 3WLSA 4IUGA 4XAGA 1QPNA 1QU4A 1NVMA 3WMLA 2YPIA 3HA1A 3URNA 4DN1A 1P0BA 2DZTA 5AC5A 3AMLA 5FF7A 2QYGA 3W22A 3HFTA 2E4TA 1EA9C 1WAWA 1V7YA 3UG8A 1D3GA 5AZ1A 3LGEA 1MUWA 4HJWA 4BI5A 1QJWA 2PZ0A 1SZEA 3VKBA 5E0KA 1BVZA 1VJSA 5AC4A 1J4EA 4GOAA 2OOGA 3PBUA 4PUJA 5CC7A 4V2XA 3GFZA 3KOFA 1XH0A 2OSXA 1IWPA 4MOZA 3L4YA 3M0YA 1UJPA 3GW0A 3R12A 1Y5WA 3RUBL 1I1XA 4YMZA 2NWSA 1CYGA 3MHUA 4LQ1A 4LJ3A 3PBWA 5T9BG 2WHMA 4PB5A 3KRUA 4YTUA 1UR0A 3R1ZA 3ERPA 1SJDA 1QNQA 4M0XA 2NW0A 3F5LA 2QAPA 4GVGA 1JYWA 1HTIA 1F4AA 4R7OA 2XH0A 4A29A 2X2GA 1ZTVA 3T0CA 1DE5A 3UGRA 3S2JA 1JGMA 2ICSA 3W1NA 4MF4A 4NVTA 4Z0SA 2PLMA 5IBXC 3UESA 5HR6A 1TMHA 4YCPA 4J3WA 1XLMA 1FWHC 1LL6A 4UR7A 3EB2A 1I0DA 1PDYA 4LBRA 2E5BA 4IPPA 1CNVA 5DY2A 1Y8BA 1I4NA 5AZ0A 2DVTA 1EIXA 2BV9A 1VFLA 4HNVA 1I60A 1SQ7A 5A6KA 3A5FA 5D30A 4A8IA 2X2YA 2TAAA 4LFYA 1BF2A 1RY0A 1F5ZA 3N2MA 4HOZA 3AHZA 4GBUA 1F3XA 4UMCA 2CFFA 2XIJA 4PUWA 2ZX7A 2CZVA 1JF5A 1GVFA 1KB3A 3SURA 3ITXA 4IJRA 1JI1A 5D8WA 4FR6A 3MS8A 4GCXA 3B0VC 1LOSA 1KTCA 2ZOXA 1YYAA 4DJDD 1PV8A 5D4YA 3W7PA 3IUHA 1TG7A 2QUUA 3CU2A 3G5EA 1M7OA 1N8IA 2WMGA 1TYGA 4GE8A 2ZXBA 2E6FA 1JZ5A 3MMDA 3VOFA 3NPUA 1WQ5A 1RH9A 1X7IA 1P1MA 1GEHA 2OZ3A 1LWJA 3KZSA 4EF9A 3W70A 1ZPTA 1GGOA 3D6NA 2XIQA 2J7FA 3F5JA 1JQVA 1XUZA 4AISA 4JHMA 2WO5A 1EBGA 4S2BA 5E9AA 1G67A 1VYSX 4IG2A 3U4FA 1QOPA 1QNRA 3SQMA 1HJSA 4AWEA 3T40A 3R6IA 3CTLA 4GG9A 2I16A 1CT5A 1TQJA 4GI8A 2V5BA 1MDRA 2ZZ1A 5EBUA 4YNGA 5G2HA 5CLWA 2PUZA 4CCEA 1RCQA 5E70A 3I3BA 4V1XA 5CBBA 1J18A 1CGTA 4JTQA 4J3VA 1DJIA 3UR2A 3W2NA 5LNWA 3HURA 2ZCGA 3R79A 2YA1A 1WV2A 2FGBA 3G1SA 4US5A 3GHSA 1ML1A 1I2PA 4IH3A 3MUCA 4HPNA 2GPTA 5ECUA 3DFYA 4IFRA 1K1DA 4FZIA 3AZRA 4GRSA 4B3KA 3PULA 2OQLA 2GJLA 4RDZA 4QGCA 4D6GA 2PTWA 4KS0A 4HMNA 1L0PA 1WKDA 1IIGA 4URIA 5A6BA 1LROA 3DU0A 1S1PA 1CB7B 4EXQA 3OGSA 3TH6A 2ZUVA 1KO0A 2ZA3A 3PFMA 1OADA 1BHGA 3S1VA 3RG6A 5EY5A 1EP3A 1XLIA 1D7FA 1Z41A 3LNMA 4G7EB 2VD9A 4K38A 3VM5A 5A8QA 5D32A 1UOZA 4N0RA 1H09A 2WSPA 5BROA 3GWQA 3MP4A 3IGSA 2VYOA 2JEPA 4RNFA 4C5YA 3VIPA 1FX6A 2FTPA 2WMHA 2W92A 2ABBA 3PS7A 7TIMA 1ZJIA 3BLEA 3TWAA 3RDKA 3PPFA 2OQHA 3CLMA 4MB1A 1ZCCA 3L4VA 3PUDA 2E6AA 2R14A 1U5JA 4JS3A 1AQFA 2ZVRA 3BE7A 4FF7A 3GW3A 1GVSA 5AVHA 5FD0A 1KCKA 3P60A 3KBJA 1ZGDA 3ZT7A 4IHCA 2BOGX 2RGMA 2OVLA 5FEPA 3EPOA 1G5AA 3G0UA 1L9WA 2YB4A 4OUIA 2F8QA 5IOBA 1DL3A 1DJYA 2QNEA 4NU7A 3VX1A 3QMTA 4AD2A 3IACA 1J0ZA 1QO5A 1OFRA 5DY3A 4Y9AA 1VFMA 1W1TA 4J3TA 4U5IA 1X1OA 1H2JA 5DN1A 2OZ8A 1OYCA 2QMKA 2WJZA 2QJHA 3H4WA 1NEYA 3IGHX 1YXDA 2PTYA 2QULA 1E43A 1E4NA 1HP4A 1XQKA 1AH3A 3CWOX 1GQNA 1F74A 1H41A 4GKLA 1ZQ5A 1E1EA 4GC4A 4AZ7A 2NVCA 3S2CA 4EP8C 3WDIA 1HUVA 1M68A 3OVRA 3M4HA 2VGGA 3GFYA 1J10A 4HHHA 4DWDA 2RDXA 3C0QA 5D9OA 2WJEA 1TRDA 3RRXA 1UZ1A 2OEKA 1L8NA 1KD0A 3T4WA 2A85A 3E3HA 5EMUA 1ENUA 2Y7EA 3RHGA 5GQBA 3OBEA 1F3TA 3QR1A 4L64A 3CK5A 4A3HA 3U2OA 3CGTA 4PFHA 2KAUC 4Z2KA 3WLKX 3VD5A 3HZ3A 4OECA 2ZX5A 4J3XA 2BSLA 4JEJA 5FESA 5I7GA 3PBMA 3T05A 3CT7A 1A53A 5K4ZA 2YBTA 2Y5JA 3SECA 3MSGA 3VOJA 4MM1A 3W07A 4XIAA 5CJMA 3GH7A 5ABGA 1A5SA 1ODZA 2DQWA 2AQWA 3R58A 1JDCA 5JH2A 5HMSA 1TIMA 3GC2A 4WSHA 2BY3A 2FLIA 3UWQA 4UZSA 2ACQA 3SGGA 5KTLA 3OP2A 1KM4A 1Q7QA 2QGHA 3PAOA 3DHPA 4K36A 5I3KA 4ES4A 3S83A 4BQ4A 4P7NA 3TONA 3CUFA 1TVPA 4R33A 2Y8UA 2VM8A 4L6DA 2C7FA 1L6GA 4OBRA 5A8MA 1XS2A 1KRCC 4HPJA 1QNPA 1R9YA 1RV8A 3PZUA 4I7VA 3TXZA 3BARA 1M1BA 4E4FA 3S6TA 1Q8AA 4UNIA 5CZKA 4LF1A 4FOUA 3IK4A 2J8TA 4YTTA 4GJ1A 1DHPA 4AMAA 1K7XA 5HQMA 4MTVA 3M1ZA 4DBUA 3EKGA 1WKEA 4O12A 1PJ9A 4WDXA 3EOEA 1XYAA 3Q4DA 3ARWA 4IMGA 1KFKA 1KBIA 1GQKA 5CJNA 1POJA 5EFFA 3GE7A 3PZTA 5D04C 3WK2A 4XAFA 4ILSA 3CYVA 3NUKA 5I2UA 3WELA 4IXXA 3IGXA 3L4XA 4ZZ9A 3LHZA 4JFUA 3UWVA 3UVAA 1VYPX 4QNEA 4HNCA 1LQAA 1SJCA 4RNJA 3WQ8A 4AZBA 1OJXA 1R38A 1ADSA 5CJ5A 3P6LA 4BK9A 4JKMA 2PDGA 1W5OA 1H1ZA 1YIXA 3Q37A 3D46A 3UXKA 1GONA 4HN8A 4C7GA 1NARA 1AQMA 1M7JA 4QLKA 1TA3A 4PMNA 1LCOA 1EBHA 1FWGC 3RM8A 4KWVA 5KZEA 2DVXA 5AYYA 3QZEA 1CGVA 3DUGA 4RW3A 4EPBC 3W7MA 4IL2A 4RDVA 3KBNA 5IBXA 3UG3A 1MZRA 4IJCA 1H63A 3R94A 2EQDA 4JYEA 3HFYA 3VA8A 3QSRA 1PAMA 3LN3A 3PJUA 3S9ZA 4DJED 2FZDA 5KETA 1W2VA 1F2JA 5KSWA 4GBDA 1CXLA 2V0TA 2G96A 4K7VA 1QI5A 4WSJA 1O4UA 5AHLA 1NWSA 4YLWA 4XTIA 4HCLA 3HGJA 1KXHA 2AMGA 3P74A 3GU9A 1PKMA 2BXVA 3O0FA 4WEVX 4NL1A 2VZTA 1DXEA 2YCJA 5BXPA 3GFXA 4ZB5A 3VD3A 2VXNA 1F3WA 3MCOA 3W1QA 4BR1A 2Z25A 1P6CA 3TFXA 4AZGA 2NUXA 1XYBA 3M7SA 5A6TC 3QH2A 4OKDA 2OFJA 1TWWA 4DX3A 2HK0A 2EKGA 3HO8A 3APTA 3LENA 1S5VA 3HMCA 4S23A 4UTMA 3MTWA 1H7NA 4F0RA 4BKNA 1XIIA 2F6UA 5FF3A 3ABQA 4OIFA 3KHDA 3UY8A 4LH8A 1J9YA 4AAJA 3VMOA 4H41A 3O6CA 2UV8G 4YVVA 2V81A 4R88A 3CL6A 1M53A 3H2EA 3QXBA 1TTIA 4W93A 1YDNA 1GJPA 1LL7A 1GG1A 4CD8A 4RE2A 4GUJA 1XIDA 3AOFA 4B5TA 3HMJG 1N82A 1NDVA 2NQLA 2QCDA 3P62A 3PANA 3TMLA 1V08A 3IWPA 3UPBA 2QCMA 4ZO9A 2C0AA 1R3SA 4JHOA 1CGWA 4QE1A 1VHCA 3AIWA 3EWXA 3W01A 3G2GA 3GQYA 4DBEA 1LL4A 2YXXA 2GUBA 4DYEA 3A4JA 1U1UA 3UZ5A 1UR1A 1S2WA 1V8EA 4HNNA 2BY0A 2Y5SA 4GFIA 4DJFD 2WMIB 1E9ZB 3SB0A 3W87A 1LJYA 4GMEA 1YE6A 1WNOA 4MDPA 1DXFA 3MT1A 4A3RA 3WDRA 2PDXA 4IX2A 1Z6KA 1BGGA 2VDIA 4HSOA 2YLAA 3DG6A 2P50A 1GKPA 3FGCB 4J7RA 4QLJA 4PMZA 5CPLA 4F9JA 3M5XA 1HT6A 5E9XA 2H9AA 1A80A 4GVFA 4INFA 1PZ0A 4UTFA 1CEOA 2AGTA 3LEPA 1H7PA 1JFXA 5A6BD 4MB5A 3LY0A 2NV9A 1QNVA 5J04A 3GBDA 1S3HA 3CUIA 2QEZA 4JN8A 3A64A 1JZ4A 3NL3A 4IMCA 2BXZA 3NQAA 3OTRA 3PF3A 2OB3A 2B7QA 1Z32X 2FKPA 4AHPA 4PTWA 3KP1A 4MSSA 3PSVA 3TXVA 6REQB 4ZOBA 4HZ6A 2DT1A 3B4YA 4US5D 3HGOA 1J2WA 2Z7GA 4PUMA 3N2TA 4GYKA 2F2KA 3V16A 4NX0A 3BOXA 3EDEA 4D6IA 4JYDA 4JR5A 3N29A 4IISA 2R1PA 1TCMA 4A2RA 3WL1A 4GO8A 1J01A 4S3GA 4L6HA 2HVOA 6REQA 1TIWA 2FB2A 4AZCA 5TIMA 4V1YA 4QJ1A 3KVJA 4JTLA 3LPPA 4GPNA 1ME7A 5CGQA 3T55A 4CKQA 3QV6A 4AZIA 4D6FA 1AW5A 2QUVA 1OFOA 5J8LA 2Z0IA 2PD9A 4HHLA 5BWFA 4PCSA 5BXTA 1H1NA 2RFGA 4H1ZA 1FWWA 4PRRA 2VFIA 3POCA 1GPWA 1UR9A 3CZKA 1LOLA 1S2UA 2QDHA 3BZJA 3WNLA 1MVYA 4XUYA 4CEXC 3LCXA 1YTDA 3MWAA 1PVNA 1ITUA 3SDOA 3TYDA 1DQWA 2RH9A 2Z24A 2PP3A 5CC6A 2PDLA 1MEWA 4X60A 1US3A 1LWHA 5DBUA 1RP8A 1UH3A 2A21A 4UFIA 3N3MA 4YHEA 4GIRA 2R91A 1KV5A 3ZXWA 1JRBA 3ARSA 1YPIA 1I75A 2A6LA 2INEA 2E1DA 4RNHA 1PX3A 3EXTA 1XJBA 3WY1A 3L7RA 1R7AA 1BWVA 3O05A 1TMLA 1GOMA 2HJPA 1LF1A 5G2IA 4ZOEA 1AMKA 4HA3A 2BBFA 4IQDA 4JQ2A 5JIWA 5T8GA 1XD0A 4HQVA 1QNOA 1OX5A 2WMFA 3ABSA 2DT2A 3NL5A 1XGDA 2DQXA 3BL3A 1CWYA 4ZFCA 2HSAA 1XXXA 4KWWA 4AU0A 2JFEX 2ZUSA 3E2SA 5D02A 4E8DA 4PN2A 2W27A 3MPGA 1V6TA 5M2FX 4Z2IA 3KRSA 2JGQA 2XG9A 1SFSA 4C1LA 2E67A 5JMUA 1CXHA 2WNWA 4JEQA 1KXTA 1MEHA 3WLNA 5A6JA 3GIPA 5EMYA 1E1FA 3LSCA 5I06A 3U0HA 1KGXA 1XW8A 2E0PA 1MXGA 3N3TA 4MZYA 3I7QA 4N42A 3XISA 3VC6A 1D9EA 2AKZA 9XIMA 3WKZA 2HBVA 5TAOA 3V4BA 1T8QA 4MB4A 2R1NA 2Z00A 3NWRA 4HBKA 3NZRA 4X0VA 1M03A 2JKPA 1VPYA 1XKYA 4IOTA 2GFTA 1LLZA 1DORA 3A6OA 3RMEA 3USZA 3VDCA 3BLDA 2YL5A 3UR7A 4E4PA 1YBQA 2WZIA 4D2JA 4RPQA 3NO5A 6ENLA 4UTUA 2CWXA 3CV6A 4WDWA 3GR7A 3BAXA 2YA0A 4OU1A 1PZ2A 5XINA 4IL0A 2EEXA 3NQEA 2CBVA 1O95A 2F9RA 3U6WA 4QAWA 1OZQA 1UH2A 3BXWA 4MY1A 1MW2A 2VL4A 3CEPA 2VGFA 4RR4A 4FXSA 4LAKA 5CGTA 2OODA 3DI0A 3S42A 3PZVA 1K9FA 2Q3RA 4PUNA 3KRZA 3UXDA 3W75A 4Z2LA 2OELA 3UZZA 2PDUA 3OA5A 1FP9A 1A0CA 2GOUA 2BVWA 3CIVA 1G7UA 5H2ZA 3V1PA 4PEKA 4N9CA 2CESA 4QAIA 1TUXA 3UWEA 1B3WA 3STCA 1T99A 2O4MA 3LM3A 5DCDA 4FO4A 4J9JA 4IFOA 3GX9A 4PMUA 2YKKA 2PWUA 4ZBCA 5I6SA 3FV9A 4CU6A 1TPEA 1UUQA 4PMQA 2ZE3A 3ZFHA 5EL1A 5C9WA 3RYSA 2VVSA 3WLLA 4IQEA 3JUGA 2GLKA 1W91A 3L65A 1L8PA 1YNYA 1R9XA 4BEUA 3ITLA 3UP8A 3VNMA 4J4KA 4IQLA 5HWJA 2NQHA 3PC0A 2Y62A 2EJ1A 2IQDA 3WZ0E 5K9CA 4UMAA 1CB2A 2P5NA 3NZ1A 4JAWA 1KTNA 4FLSA 1MRQA 4O14A 2ZA1A 1ADOA 3N9SA 4HU4A 4I7UA 2ON3A 1LYXA 2CZ5A 3E0LA 4XZHA 4NKCA 1MW1A 1VQTA 1GYLA 3N17A 2WKJA 1YPXA 5G4EA 3CQHA 1OHLA 1P1XA 2OX4A 6XIMA 1W1IE 2YOCA 4UCGA 5L9FA 2VEIA 2XH4A 1K70A 4PR4A 2IXUA 5HAOA 3KL3A 3EX4A 3KS5A 3LV5A 1DV7A 4TX9A 4IPNB 2E5CA 2QJNA 4RNIA 2Y0FA 1IZJA 4HK7A 1VKFA 2DIEA 4Y6GA 2DIJA 3C61A 3OZOA 3EBVA 5JUVA 3PTKA 2D2GA 3WD1A 1V77A 4NAEB 4BWLC 4G8TA 3RGTA 2X05A 5CPSA 3SUSA 2CZFA 1TZ9A 3A21A 2DORA 3H54A 2CBUA 3KM8A 4C6IA 4M1RA 1ZBKA 2DZSA 2JF7A 4MLRA 4P61A 1H0GA 4CNOA 1REQB 3F7JA 4IIHA 4ICMA 1LRNA 1GZGA 4KRZA 2J9XA 1PXGA 3GBEA 5DF0A 5G4WA 4AC7C 2QLYA 2FDMA 3ZR6A 1K77A 1XLDA 5IFPA 3CIWA 4HP5A 3LSBA 1KA9F 4XBKA 5CXPA 3WF4A 1SGJA 3IANA 1YTEA 3GG0A 2ZE0A 1AJ2A 4TV5A 4UZUA 4M6UA 4XVEA 3B0YA 4KESA 3CO8A 3MANA 3QQWA 2H8ZA 3R8RA 3C4UA 5A6MA 5CBIA 3GYEA 3M44A 1OC5A 1J11A 4UTJA 2O4QA 4JTCA 3P80A 4YPJA 1HGYA 2GQ3A 4J2MA 1EC7A 2C1IA 1B4KA 1NH6A 4N02A 1PKLA 4S39A 1W8SA 1GCYA 1E6QM 4ORMA 4WDUA 2VEFA 3EOSA 4IUOA 4JIPA 2KX9A 3V18A 1E0TA 3HOJA 2GQ9A 5LKYA 3SAZA 1IYXA 4Q3MA 5F2GA 3SADA 2XN1A 3T6CA 2W63A 2DZWA 3BLIA 1GOOA 2X16A 4B4FA 3CL7A 1XQLA 5HK4A 3B8VA 1JCJA 4KWSA 1TJRA 2ZC8A 4GUIA 2QVHA 2PBGA 3UR8A 3IIZA 1C90A 2Z26A 4B15A 3GHTA 3CAWA 1UD5A 3LUTA 1BYAA 2WHLA 3L4TA 1EFZA 1LWIA 3SCVA 1NWTA 1NDZA 2TYSA 2WANA 1W9UA 1WZKA 1UD4A 3GR8A 2PLCA 2VC5A 3VUPA 5FEZA 2VNCA 2B31A 3V3WA 3CV7A 5HPOA 2WSRA 2GDVA 2E9MA 1X6UA 3QQ0A 4RZBA 1N55A 1YW1A 2FZNA 4JGDA 4L9XA 5FAGA 1E4MM 4A8RA 1GPFA 1O66A 4F40A 2ZUWA 4WLCA 5A5WA 4IF2A 1M3UA 1JDEA 4WJEA 5DRCA 3QHOA 3ANYA 3EKZA 1UROA 3O3RA 2XWEA 4AFYA 4DWSD 4GQGA 4BF7A 2O9TA 3EYPA 1ZZMA 4RV3A 3S9IA 4PC8A 2PPGA 4KEVA 1I6NA 3GLCA 3VNIA 2CBJA 4FNQA 4PUUA 1VFUA 3IUIA 1DJGA 3GR4A 5D9PA 4LT9A 1A5OC 4PTMA 2HROA 2VFHA 5HPCA 2VELA 3W7NA 3B9AA 3S0CA 4L56A 3BW4A 2HNHA 2R1LA 3WH6A 2INFA 2EPOA 3WN6A 1YDOA 2IUZA 3WMSA 2YL9A 3MVTA 3TTOA 3DFOA 1NDYA 3WH9A 2ZWYA 3SGZA 4LXFA 1DIEA 2WVTA 3UZYA 4NZ5A 2YJQA 1D3HA 7REQA 3UCCA 3CWNA 1XLJA 3TAKA 2TPSA 3SCWA 1BG9A 7A3HA 4GI6A 3UETA 2CLIA 2I5IA 3HQ1A 1J0JA 5JVLA 1T5AA 3QZ6A 3HPSA 3JW7A 4WIWA 3RPTA 4GX9A 2WMKA 4KEUA 4DJEA 4Z0JA 1C91A 2TMDA 4LUSA 2VX6A 1E1CB 1XIMA 4PFMA 3W76A 1QBBA 3GK0A 1QPOA 3ZT6A 3EOOA 3LRLA 2ZUNA 4AZ5A 1R46A 3RR4A 3TQ0A 1EYEA 1LQ0A 1L6WA 4CN1A 4QNWA 1EH9A 1UKPA 3LLFA 2QPSA 3NSMA 4RZ6A 3L4ZA 2PC4A 1IT0A 1XHGA 4WJXA 3EOLA 1VRDA 1VLWA 3TTYA 1E56A 3EMCA 4XWUA 3NG3A 3STEA 3W7GA 3SFWA 3GTNA 4GY7A 2OYKA 3BK0A 2XH7A 4UUIA 5HANA 1NSJA 3KDOA 3QC3A 4X3ZA 3FAXA 3S2LA 3KS6A 3AIVA 4JKLA 5DELA 1GOWA 2I56A 2DSUA 5LZLA 3CV1A 2VDHA 2E77A 1ZJAA 3UCQA 4HT3A 4Q22A 3W6LA 5LIYX 4M19A 2EG7A 4H8HA 2DW6A 3RPMA 4BCEA 3UJSA 3M6YA 1ZALA 4KWOA 3A9IA 1HKVA 3IJLA 1J0YA 4F0MA 4CQBA 2HE8A 3ANVA 4YJ5A 3R43A 4K39A 3BW3A 1Z48A 1E6PA 4GJJA 5AOUA 3IV8A 1KV8A 4UFHA 3BZGA 2J88A 3RCNA 4DB7A 3ZQ9A 3U4AA 3F4NA 2WJDA 1IEVA 1KQYA 4H7CA 3LCGA 1D3CA 4XVDA 3MI3A 1GQLA 3C5QA 4QDMA 5IM51 4O10A 4OJYA 2XVPA 2G3MA 4PULA 1FHUA 3P7YA 3ZOAA 5DT5A 1YX1A 3FJLA 2PDKA 1FWFC 3NDOA 4DBSA 3W74A 4GNVA 2PGRA 1KRMA 1A5LC 4YWSA 3S9YA 1TV5A 4EKJA 3G3MA 4MAZA 3HTWA 2A7PA 3V1HA 3SRDA 4P8VA 1WDSA 1V0NA 1CXIA 4MNJA 1U5VA 1ICPA 1AZ2A 3UF9A 4DUOA 3NQ7A 2QGYA 1SR0A 2J7DA 4I6VA 1W3HA 3UXLA 3S1UA 1TPWA 4GXPA 2QV5A 1OK4A 5AVNA 2Z1KA 3O9NA 5AHMA 1H0IA 5E09A 1FA2A 3WQCA 1PKYA 3CQIA 2ZBTA 4DF0A 4PBGA 2WNQA 1NJJA 2VRQA 1MQRA 3P67A 3BG3A 3H8AA 4ACZA 3VO0A 3CHDA 1D8CA 5AHFA 3FXYA 2ESCA 3VK5A 3B8SA 5BRQA 3QOMA 4GYPC 5FIPA 4CN6A 5A8GA 2NX9A 2X1IA 4MAVA 3TQPA 1JXKA 1CECA 3AYRA 3TU9A 4XUGA 3N2BA 2H9AB 2PRHA 1M65A 2OQYA 3C86A 4LV4A 3QKZA 3TOPA 2Z2BA 4B16A 3WK1A 4TIMA 4PUEA 4JIRA 4DO6A 3VFLA 1FBAA 3UJ2A 4YWIA 4BF9A 4OUEA 4GABA 1CGUA 3BURA 2G8ZA 1GW1A 3EDFA 1AL7A 3TYZA 2IKIA 1YQ2A 1TJ1A 4TVUA 5JXQA 2OX1A 2FTWA 2PLJA 5HQEA 5LXXA 1ZP4A 2F6KA 1JL8A 3GTHA 4FIQA 3WBXA 2VKZG 3GO2A 4Z42C 5BU9A 5FKYA 4M8UA 4EVZA 2E28A 4HMDA 1XYMA 3WF1A 5AYZA 4UQBA 1FXQA 3KL0A 3W4RA 1E6ZA 4GCAA 1Q6OA 1WXZA 3A3WA 2OLHA 2VC6A 3EKLA 1BKHA 5CZTA 3SUWA 1KM5A 5D09A 3EDJA 1DYSA 2FZ8A 5IDZA 3EA1A 3DECA 2QIIA 2C1GA 4AVFA 3UD6A 2E6DA 3E12A 1H3GA 3RJYA 3W81A 3VKDA 1SM9A 3OYXA 2J79A 3EX6A 2VX7A 3ECQA 1US2A 1WA3A 4U5KA 4Z17A 3OIHA 4Q4QA 4MUZA 2ZKMX 3RMJA 4W8AA 5EPDA 1SW3A 3CYJA 1C7SA 3T2OA 4H2HA 2P8CA 3ZIZA 1AD1A 1F73A 3ZJ8A 2WC4A 2A5HA 4XISA 3DYOA 3AMKA 1UZ4A 5GJMA 4L4MA 5EMJA 3VIKA 2VUNA 3TJLA 3SCQA 3W82A 2EF9A 1TKKA 3MV01 4GY0A 1DJHA 1K9TA 3VDBA 4RW5A 2GVYA 1GHRA 5AN7A 3VPLA 1F8MA 3VDGA 1UR2A 5BOFA 3SI9A 2TODA 4R53A 1FUYA 1ONWA 3FW6A 2V5LA 2BWGA 2CKSA 1VBRA 4WXZA 3BDKA 1UC5A 3TVAA 5LIKX 1MYRA 3L9CA 4O4VA 2BFGA 3SCOA 3KTSA 3LRMA 1TWZA 5AHEA 1QUMA 1TVLA 3PZOA 2FJKA 4GFSA 3ARXA 4I3GA 2XDFA 2OCZA 2PDPA 2PP0A 4TOQA 3WL0A 1XCFA 7ENLA 3WO8A 4HPXA 2OG9A 1SVDA 3QFEA 2WCSA 3C3UA 1XRFA 2XIMA 1QAPA 1XUUA 5KMYA 3HQPA 2ASHA 3TR9A 4IPJA 2XN0A 2TRSA 5HOSA 3VKKA 1NIUA 4P8UA 3N04A 3U57A 2W61A 5D2XA 2I9EA 3VNDA 3BSHA 1SR9A 5AB3A 3OVGA 1ME9A 4KWUA 4NI3A 3AQUA 3GM8A 4GHRA 2WKLA 1Q6LA 2CW6A 2VUYA 3L21A 1LM1A 1ISZA 3RPDA 5FSEC 1VB9A 3QKEA 5IDIA 1E1CA 4X61A 4M3PA 1W3TA 4Q7IA 3URBA 1GOIA 1FCBA 4U10A 5BRBA 4G56A 2DZAA 4DVOA 4MADA 1PIGA 1Z42A 1M7PA 1MO0A 4QCFA 2CZDA 5I79A 1EJSC 2C6QA 4A21A 3NO1A 4K3ZA 2GDQA 4FOKA 4FHAA 1V3JA 4LUTA 1WUFA 4RL3A 3G0SA 4WGXA 2VO5A 3HPFA 1UPMB 4UQ9A 3TYEA 1JPDX 2W5FA 3DCPA 3OOQA 3C2OA 5LNSA 2XGZA 4A4AA 3QW4B 3M07A 3MJMA 3TR2A 1GWJA 3QGKC 2J7BA 3CAVA 4UOQA 1KM2A 1W9PA 4H00A 1B0IA 3ICJA 3NJ3A 4ZOCA 1NAL1 1JCTA 3ATZA 1BYBA 2QAFA 1G6CA 1VRXA 1RQEA 4ZMGA 4AD0A 1GYMA 3DFPA 3W73A 5IRPA 2VJXA 1D8WA 4E8GA 4Q8NA 1QR7A 1BWKA 2P53A 1AD4A 1O94A 2BASA 1WE5A 3TW9A 3W53A 4RZ5A 3CPRA 2DVUA 3OO2A 1FWSA 3FDKA 3SRKA 1RALA 2BHYA 2G50A 5C9UA 3P8JA 1EF3A 3QPZA 4OWGA 3DESA 3UZWA 2QDDA 2C0HA 5DXXA 3OG3A 5HNRA 4HGXA 1H49A 3FGCA 4C6QA 3K8KA 1JF6A 4XG1A 3FA5A 1JD7A 4H04A 3GNDA 3PVFA 4CNNA 3WDJA 3AMDA 3C0SA 1EWEA 4XZ9A 2VWSA 2CLEA 4QG6A 1DBTA 1ZLPA 2E1WA 1X97A 2WMIA 1LOQA 5AYBA 3UXAA 2NT0A 2B7OA 2X7WA 3P5YA 5D37A 3U2CA 4DJEC 3TA6A 5TBOA 1E9IA 4WSKA 4B5WA 3VYLA 4CQ9A 3UYCA 4KFPA 3LCHA 2XZ9A 4Q8QA 2PMQA 1IEWA 4GACA 1XIFA 3O06A 3GG8A 1HXJA 4O8RA 3TTQA 1BFNA 2I17A 2WCAA 4FNRA 3SGUA 1XH1A 4UQCA 3MO4A 2LLEA 4Q33A 3GUWA 1OD8A 4GI9A 2C3ZA 4PGLA 2NUWA 2G4FA 2BY2A 4O52A 1I2OA 1NF0A 1CDGA 1C3FA 3K8LA 5CG7A 1DJNA 4Y90A 4O1CA 2PZNA 4ML4A 4D1IA 3MO7A 1JZ8A 2WOQA 2WC7A 2GVLA 4ATWA 2GSHA 4IMEA 2NVDA 1JEZA 4HNLA 1IGSA 3E2VA 3LCIA 4MWAD 4A05A 1K03A 2E25A 4I9JA 4TQTA 2G41A 5MHBA 3WLPA 1UYQA 2Y70A 3L67A 2DUXA 2B0MA 3WD0A 4TMCA 2XIOA 2WYSA 4H19A 4W84A 2AQOA 3VDHA 1WKYA 4PTVA 4XX6A 3NSNA 3V0TA 3REQA 3WQ5A 3MYPA 2WK2A 1VZWA 4F0HA 1EOKA 2V69A 5A8PA 3MBFA 1S38A 1ZBWA 2QCNA 1MMFA 3JZEA 3GB6A 5F2IA 4J3SA 3M0HA 4IX0A 1C7TA 2D23A 3N19B 1FCVA 3AHXA 2EKCA 3H6OA 4H9VA 3UWUA 4CD4A 2X1SA 3TC3A 1V3KA 1E5JA 4KH2A 4C6FA 4IMAA 3E9AA 3TZFA 4PBFA 3MKKA 2DEPA 1LG1A 2OR2A 3PWGA 3B8TA 1OD0A 1RLCL 1V5XA 1Q45A 3WNNA 2DY3A 3AS3A 3KL5A 4W7UA 1Z89A 4ZQPA 2XIIA 1HQTA 5I09A 4M6VA 1EJXC 4H9YA 3AS2A 3AXXA 4X9YA 3LRKA 4C6JA 3Q45A 5ABEA 4Q4PA 1KM6A 1V7AA 3VE9A 3RLHA 4L65A 3URAA 5HJXA 3H12A 2Y63A 3KTXA 1SW7A 3PM6A 4GZIA 1VS1A 4FF5A 4WUIA 1W8GA 4K37A 2V3EA 1H61A 1XLFA 4W89A 5C5YA 3W83A 3MZNA 4LYRA 1EDGA 3RM9A 2A4AA 1N7KA 4N6EA 1PKNA 2INZA 5HJLA 4NZ3A 2VFEA 3G6MA 3JZUA 4ASTA 3UCDA 3CAQA 3ENLA 1Y5XA 3AYVA 4MYAA 4C6CA 3ZM8A 2J6VA 4IGNA 3EDKA 1JFHA 2WVVB 3EWBX 2ANUA 3WFAA 5GNZA 3UWYA 4DRSA 3II1A 2J13A 3CEUA 4LRTA 3NVTA 2BG5A 4W8BA 2EXOA 4I9TA 3HF3A 1GORA 2Z7KA 3MMTA 2HNEA 5C70A 4XKYA 4BI7A 1YPFA 4IIGA 4US6A 3W1LA 1W1B1 2QCEA 3MP5A 2CLOA 4LRSA 1UKQA 1CLVA 3CPGA 3RK8A 5I5RA 1HVQA 1KCXA 1MNSA 5LA1A 2B81A 4QDPA 4JL2A 2PDBA 5ABTA 2HRWA 4DI9A 1RBLA 4Z2JA 4LVFA 4GD0A 1UPPA 1EPVA 4IG2B 1S2CA 3R13A 1JDFA 3H22A 3TOYA 1R3VA 1VCGA 3G1AA 2E3ZA 1PWLA 1Z44A 2Y5EA 3NM3A 2ZUTA 2GGGA 4W7VA 1NDWA 4AD5A 1IZCA 2DGAA 3CQJA 3N2OA 4F66A 2QW5A 3U5UA 2XU2A 3IK2A 4IZGA 1XICA 4B5VA 1WXJA 1Q6EA 4HNUA 1SFTA 5D2YA 4RDYA 1CXEA 3W38A 1JD9A 1N8WA 4QTGA 3ORWA 4TUFA 1BVWA 2C13A 4MHBA 3B97A 1EOMA 2J47A 1XLKA 3AHYA 1PZ3A 3LQLA 3RILA 2ZX8A 4NSBA 5AYXA 2DH3A 3KOXA 1U30A 3ZO9A 1EXBA 2BODX 4AW7A 4UR9A 1FWCC 1PUDA 3BMVA 4KFNA 1NP0A 1TTJA 2X0SA 1SUXA 1OK6A 3BOLA 3T2QA 3B8WA 3S5YA 3T09A 3PZMA 6A3HA 1LP6A 4EIVA 3WBEA 4D8LA 3AMCA 3PPGA 2ZVIA 5DRIA 4AYGA 4XZNX 1GVRA 3ID7A 4L61A 1UR3M 4E2VA 2IQ0A 1K6WA 4JIIX 2WNNA 2PWVA 1JDDA 2DUZA 1J5SA 3A13A 4XIMA 4GC3A 3SJ3A 3M16A 1FCQA 4GWEA 3UNTA 4JHZA 4F4RA 3MUIA 2DZUA 1XSJA 1IEQA 1V6VA 1AW1A 2FGLA 4XZMX 4EX4A 4MVAA 3FJ6A 3SUTA 1HKWA 3ALGA 3KCLA 3R8HA 4XKMA 1VF8A 2YGYA 1R3QA 2GJNA 1RA0A 1EDTA 3YPIA 4UTWA 4K8GA 4BQ2A 4JTRA 4HU8A 4UWMA 2DZVA 5AHIA 4JYFA 4PL2A 4DJFA 1EUNA 5CPQA 6TIMA 2PF8A 3E5BA 2GJXA 1QWKA 4C60A 4QEEA 2X8RA 1F6PA 1FWIC 3HV9A 1GK8A 2VEGA 1T6MA 3UA3A 1H1YA 3I3EA 2GJPA 4GGHA 3AXMA 2FZBA 2HBXA 3MC5A 4UTIA 4JX5A 1ITXA 2D2HA 3SCUA 1K6AA 2VOMA 2P1FA 3VGFA 4P5UA 4QIUA 3F03K 4XZWA 2CC0A 3HJEA 4W87A 1LQ2A 3G1FA 1Q6RA 3KEHA 3AJXA 2REQB 3WLHA 1QVBA 5A8OA 2J78A 4G7EA 1B5TA 1AQHA 1IR1A 2VI0A 5IHSA 4DAFA 5BMXA 2ZIDA 2RJHA 1EJWC 2G5WA 2J77A 2CXGA 2QJIA 2ATMA 1FY6A 1OC7A 2IQTA 3QM3A 4LCRA 1BPLB 3S5ZA 3ZZ1A 1W1VA 3M0VA 3BO9A 3TN6A 3QGAC 3NO3A 3NQGA 3S3GA 3HV8A 4QG9A 2R1MA 3KLKA 4NYYA 3RLGA 1FOBA 3AROA 5AYIA 5U4NA 1KWGA 1WCGA 2DJXA 1S5NA 1IHIA 1OT2A 2XTKA 1EZ2A 1ITQA 2RDTA 4U33A 1XISA 3WF2A 2EO7A 3A4WA 3MUXA 2ZUUA 2NUYA 3LQGA 4PCFA 5FEXA 4IWWA 4JTGA 5FJRA 3WQOA 5CZJA 3NFUA 3PTDA 3KWSA 3CUHA 2HXUA 4WKHA 4AXKA 3NXLA 1JUEA 3FNDA 3GG7A 1OCBA 3I6EA 4UIOA 3ARPA 3ZVHA 1OX4B 3VILA 1K4GA 3T0BA 4KIRA 3CHCA 1RQBA 3BMWA 3GXIA 5FL1A 1G9HA 4FR1A 3RU8X 3W85A 5HUOA 1HVXA 1DTNA 3PPHA 3WLMA 3Q2DA 3SR7A 4Q7BA 3O6YX 4PMDA 1BTMA 3NQ8A 2WZEA 5IFTA 3TSMA 3SIZA 1TSIA 1GTEA 2Y7FA 4Z2GA 1U1HA 1QBAA 2WW5A 3QGVA 3VX0A 1TO3A 5M3WA 2ZX9A 2G97A 3QV8A 1QK0A 4QDWA 3IAQA 3LX9A 1XYCA 2OSYA 4XD5A 3NPWA 1AK5A 2E7FA 3APGA 1W5MA 4HOXA 3GVWA 2HTMA 3M5ZA 1BYCA 1V3HA 1N2VA 3P2VA 1XBZA 2BVYA 3GHUA 3BV7A 1HP5A 2QUTA 1KKRA 1M9HA 1EF2A 3PP7A 6CGTA 3ZVHB 3OHIA 3KVLA 4FPSA 3MU7A 4J40A 3SUVA 3TAOA 4UR8A 1EPXA 2YYTA 4AY7A 4ML9A 1XLAA 3G3DA 4GQQA 4GVIA 3VIMA 1O5QA 3AIEA 2FVMA 4WVXA 2BOEX 3T1GA 2BNJA 4L4LA 4GIEA 3CZGA 2P88A 5DXYA 3GDBA 1AA1B 1UA3A 2DPEA 4I7WA 3M9YA 3MZ2A 3ISIX 4KRTA 3W6YA 4ERGA 1O1HA 4QITA 3WSUA 4PRTA 4Z1BA 4ZENA 3GC5A 3AI0A 1TELA 4ZE5A 1FWDC 1V6YA 3J7HA 3C2FA 1B3VA 5M03A 4IJBA 3GH5A 3GTFA 1FDJA 5TNVA 3MY9A 3N11A 4DUWA 3AC0A 1K7FA 1EDQA 1DIKA 2QCLA 4LX4A 3OLEA 3AYSA 3WD2A 4UNLA 2HVMA 1NOFA 4DZIA 5JH1A 1UB3A 3JR2A 4H9TA 1HZYA 1ODUA 1TV2A 3P14A 3O2LA 2Q01A 3GDTA 1LT7A 2B4GA 1E9YB 1QDSA 3CASA 1RVGA 5C55A 3VOIA 3NM1A 4HU3A 4UC5A 3SY8A 3UFYA 1E0UA 5I00A 2ACRA 2VRKA 3HG2A 4DJFC 3PG9A 1WAUA 2ZXAA 5DFAA 1OCJA 1E73M 3QBUA 1OFPA 1XRTA 1ZNNA 1PEZA 2Y7DA 2E40A 2VR2A 1VLIA 1PIIA 2RGLA 4W85A 3Q94A 3DYPA 4C6OA 5HINA 4JTEA 4TO8A 4JL1A 3M7WA 1P5BA 4MKNA 3RO6A 1UIOA 3WG6A 1CCWB 4A22A 2PWFA 4OHQA 4FS9A 2EG6A 3GDRA 4N4QA 3I68A 4MMWA 2NSOA 1J96A 3RM4A 5B80A 1MEIA 1G4TA 2P0OA 3ZMRA 2CLMA 5BWAA 5LIXX 1UASA 2VVNA 1I2NA 2WNZA 3W84A 3CMJA 2QF7A 3EWZA 1QI4A 1PWMA 2QT3A 3VGGA 4P7OA 4E0CA 4RE3A 3BH4A 4ZQMA 1CLXA 2XSXA 1SO4A 1XRSA 2YB1A 3LCLA 2O9RA 1BWLA 2I14A 3BV4A 4ZEPA 4UTTC 2FMNA 4HA1A 2I5QA 3QV7A 1RA5A 4HCHA 2WKGA 2EJAA 4AHQA 1OB0A 1QW8A 3VMPA 3W1UA 4IPIA 2DSWA 4LANA 2AGKA 3O6AA 4GIYA 2F61A 2D73A 4JQAA 3BUVA 3TN5A 7ODCA 4JTFA 4XO6A 3L0NA 5MF5A 4O0QA 4EWJA 1FDZA 1G69A 2YCIX 2NQ5A 2BHZA 1RQHA 2PS2A 1QHZA 4JTDA 4B5NA 2CHNA 1NFPA 5GJNA 4W9TA 4LEFA 4HK5A 3HPZA 3QYQA 4CQCA 7XIMA 5C0QA 4R27A 2OZ0A 4XTDA 3WBYA 1TFVA 1ZB5A 4UNKA 1TR9A 2XVGA 3MWCA 3TYBA 1A3HA 4GQRA 3N6HA 3AIBA 2WQDA 1EO7A 3ZWSA 3T8LA 3MMWA 3NQCA 4Q8MA 4BF5A 4PCNA 1UWUA 1VHNA 2G0WA 3MSDA 3FIGA 2J7CA 1FCUA 5I23A 2POZA 2YSWA 1QHPA 1W5NA 3STGA 3K2GA 4IPLA 1UMYA 1L6YA 1S2AA 2FHCA 2YL6A 3THCA 2JIWA 4JTAA 2AAAA 3D3AA 4HMCA 3ELFA 1AH4A 2EG8A 3DEQA 4IGMA 4QM1A 1Q6DA 1AL8A 1K3UA 2FPTA 3OB8A 4MPKA 5XIMA 3SY5A 3OZPA 4O1BA 2BZNA 3GU1A 7TAAA 3TIMA 4DF2A 3GZAA 4BWLA 2A3LA 2QUMA 4LYQA 3WMCA 4O16A 2ABAA 4RDWA 3FN9A 1JAEA 2XJ7A 1UR4A 4AG0A 3UXIA 4UOJA 3K1GA 1XR2A 3VIFA 3R4IA 3QSTA 3M64A 4LUTB 3EX2A 2ZYFA 1OY0A 3H2CA 1C29A 3WNKA 2XH2A 1VD6A 4UQAA 3VZYA 1JZ7A 4A2SA 3VAVA 1RJRA 1P7TB 2Z1SA 3KCJA 1JG9A 4O19A 3UY7A 3FYOA 2GQAA 4LB3A 5E5CA 1EC9A 3W1XA 1XP3A 2ZRXA 1LBMA 1QO2A 3I6RA 2EBNA 3W2JA 3GD6A 3S46A 1GVOA 5HATA 3BMXA 3VNZA 4NZ4A 4D72A 3TUUA 3WEOA 1XFCA 4WK9A 4Z2HA 1XINA 2C8NA 4DM2A 4AQLA 4AD4A 2WHJA 4XQ6A 4PTXA 1E71M 2PCEA