2ACSA

An anion binding site in human aldose reductase: mechanistic implications for the binding of citrate, cacodylate, and glucose-6-phosphate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
314
structure length
314
Chain Sequence
SRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An anion binding site in human aldose reductase: mechanistic implications for the binding of citrate, cacodylate, and glucose 6-phosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords ALDOSE REDUCTASE
total genus 99
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1994-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2acsA00
4DBUA 4YS1A 5C7HA 4ZFCA 4GQ0A 4LAZA 3LQGA 1M9HA 3R58A 2FVLA 2BGQA 4YU1A 2WZTA 4JTQA 4Q7BA 2PFHA 1AFSA 3M64A 3FX4A 1XF0A 2HVNA 4GIEA 2CLPA 3KRBA 1AH0A 3UZZA 2VDGA 1PWMA 4XO6A 3U2CA 2IPJA 4HMNA 2IKJA 3CV6A 2IPWA 1X96A 4G5DA 3COTA 2INEA 4XK2A 3LZ5A 4PUWA 3V35A 1K8CA 3LNMA 2PEVA 4XZIA 2FZ9A 1Z3NA 3GHUA 4FAMA 1EXBA 3B3DA 3CASA 2PDBA 1LWIA 4IJRA 1JEZA 3CV7A 4ICCX 4WDUA 3CAVA 3WCZA 2PDWA 1Q5MA 2PDLA 2HE8A 4IJCA 3T42A 3CAQA 2PF8A 5KETA 5LIXX 4QX4A 1MZRA 4ASTA 1AH3A 1C9WA 4I5XA 1XJBA 5JH2A 2HEJA 2I17A 4WDWA 3BURA 2PDYA 1S1RA 3MC5A 4LB4A 4QBXA 1PWLA 1XGDA 2FGBA 4L1XA 2P5NA 3V0SA 4FALA 4QXIA 4LBSA 1RY8A 2PDCA 3LBOA 3BUVA 4XVEA 1IEIA 3R7MA 4YVXA 4QR6A 3EB3A 1IHIA 1HQTA 3UFYA 1LQAA 1AZ1A 1S2CA 2FZBA 4MHBA 4WDTA 3FJNA 2F2KA 2ACQA 4H8NA 2DV0A 2PDJA 2PDMA 3D3FA 2WZMA 4EXAA 2PDXA 4JQ2A 5LIWX 5M2FX 4AUBA 1ZQ5A 3UZWA 3WBYA 2PDIA 3P2VA 2ACRA 4GCAA 2DUZA 2PDQA 2FZDA 5HA7A 3MB9A 3UWEA 3WBXA 4DBWA 1QRQA 2F38A 2NVCA 3R43A 4F40A 1AZ2A 4WEVX 4XZMX 4DZ5A 3GHRA 3G5EA 2HE5A 3ERPA 4JTRA 4Q3MA 4XZNX 3VXGA 1Z89A 3RX3A 3RX2A 1UR3M 3LENA 4PMJA 2HV5A 1YE4A 3ONBA 3R8GA 2I16A 3WBWA 2IKGA 3V0UA 3LUTA 2HDJA 3LQLA 1A80A 4PRTA 3UZYA 1ZGDA 2IKIA 2C91A 4JQ1A 4PRRA 3ONCA 3C3UA 5LIYX 2DUXA 3CMFA 3LZ3A 2IQ0A 5AZ0A 3WG6A 1RY0A 5LIKX 3F7JA 4FZIA 4XZLX 1T41A 2BP1A 3N6QA 4JQ3A 1X97A 5AZ1A 3GHSA 1ADSA 1Q13A 3M0IA 3UZXA 4XZHA 2PDUA 3H4GA 1Z8AA 1FRBA 4JIHA 4WGHA 1SM9A 3M4HA 1HW6A 4JIIX 4XVDA 1VP5A 2ALRA 2R24A 2QXWA 4NKCA 3LN3A 2PDGA 3RX4A 3V0TA 4DBSA 1ZUAX 3UG8A 3NTYA 3BV7A 1QWKA 2PDNA 1EKOA 4HBKA 4WDXA 4RPQA 1PYFA 4JQ4A 1YNPA 3O3RA 4JTDA 4EXBA 2INZA 3LD5A 4GACA 1T40A 2ACSA 2IPGA 4JTCA 1MRQA 2A79A 2NVDA 4H7CA 3UP8A 2ISFA 4YVVA 4XAPA 3UYIA 4GA8A 3EAUA 2FZ8A 2PZNA 1YE6A 3V36A 4WRHA 2PDFA 4R9OA 2IQDA 1AH4A 4GQGA 4JIRA 3DN5A 3O0KA 3BCJA 3DOPA 4IGSA 3N2TA 4LBRA 1VBJA 4L1WA 1EL3A 2PD5A 1R38A 2PDHA 5HNTA 3R8HA 3H7RA 2AGTA 2J8TA 4LAUA 1US0A 3GHTA 3R6IA 5LIUX 2IPFA 2IKHA 3G1RA 1PZ1A 2HVOA 4GABA 4YVPA 4OTKA 3Q65A 1YNQA 3LEPA 4PR4A 1S2AA 5DANA 2PDPA 4JQAA 1MI3A 4PUUA 1S1PA 3QKZA 1X98A 3UGRA 3EB4A 1J96A 2R9RA 5HNUA 3Q67A 3H7UA 1Z9AA 5JH1A 1ZSXA 3GUGA 2BGSA 2PD9A 1OG6A 1RALA 1EF3A 2PDKA 4XO7A 1PZ0A 4FA3A 4JTAA 1GVEA 3R94A 2ACUA 3S3GA 2IS7A 4LB3A
chains in the Genus database with same CATH superfamily
1CT5A 4AZCA 4ZO6A 3R0UA 4ORIA 2VEKA 5I3GA 4LV4A 1K9FA 4RW3A 3FKKA 2BGQA 1E40A 4RPPA 3PC0A 2D1ZA 2BY0A 1OADA 4FNSA 3KHJA 1K4GA 4R5EA 5DMYA 4F8XA 4BQ2A 1RJPA 1TFVA 1AFSA 5I23A 4JEJA 2OO0A 2VDGA 1W1B1 3UNDA 3CAWA 2E9LA 2J7HA 3GDKA 2OQHA 1RBAA 1B3VA 3U2CA 4J9JA 4HMNA 4C6DA 4HNUA 3O15A 3S46A 4ZO9A 2PC8A 2F2HA 3VD3A 3UJEA 4RCXA 4XD3A 3WFAA 1GQNA 2GFTA 4TVDA 3TE9A 4IIFA 4D6GA 2C1GA 2D2GA 1DJXA 4RDVA 4MSSA 3A13A 4PSPA 3MA8A 2H3DA 3CASA 1YIXA 3W7GA 3QY8A 4O0QA 1DWJM 4D1IA 5A6SA 1CNVA 3EXSA 3BLPX 3UYCA 1FCUA 3BWWA 1HF6A 4ZL1A 3WCZA 4DF2A 5C9ZA 3K8KA 1XCWA 1N8IA 3T42A 3UWVA 2DSUA 1L6WA 4ASTA 4HGXA 1KXTA 1JFXA 2GSHA 4GD0A 3VVGA 1G4TA 2E68A 1A53A 1LWJA 3VFCA 3ALFA 1BRLB 5CXPA 3IK2A 3IACA 4MWAA 3XISA 1PWLA 3ARRA 3O0FA 4R85A 2J8FA 3TXVA 2D0FA 1BVNP 2PZ0A 2R1PA 4G56A 3P67A 1Q6QA 1XYLA 3J7HA 1Q65A 3UFYA 1HL8A 4Y6GA 4AMCA 5I3JA 3U4FA 1LQAA 3V16A 3CL6A 3NQVA 3P81A 4GH1A 3WFLA 3M0MA 5D03A 1U2YA 4WDTA 3L68A 4Z1YA 3KOXA 2DZXA 3W1MA 5I5RA 4HSOA 2YZ5A 4WD0A 3AXMA 3QGKC 2J88A 1GK8A 1C8VA 1TTIA 5LNSA 4TVCA 1JG9A 1WQ5A 2J7BA 3VK5A 3H6OA 4NX5A 3SN1A 1JIBA 4XG1A 1QO5A 4TIMA 1LWHA 4PCPA 3M0YA 2DSKA 4CQ8A 1GKRA 1GJWA 2VUYA 4AQLA 4J2MA 1OWQA 1DE5A 4DBWA 2WNWA 1GQIA 2BLEA 5I2UA 3AUJA 4L4OA 4B5NA 5K9DA 4R33A 1OFRA 3AIUA 3OYZA 4O28A 3S1VA 3R25A 4KFOA 5CBJA 1VJSA 4HN8A 3BQ5A 3PULA 1FKWA 3S6TA 1SUXA 4MWAD 1LBFA 4PMJA 4PMNA 2ASHA 4DJFC 2XFYA 1ODUA 1LJYA 2EPNA 2YYUA 1DJZA 5KINA 3RLUA 5HINA 1KWKA 1JPIA 2FYMA 4IOTA 1VEMA 1ZJIA 4ZTYA 1E9YB 4ADSA 1H2JA 4UTWA 3QTGA 3NDYA 2DVUA 5LZLA 2DT1A 5G2WA 4DF1A 1VH7A 3W7QA 4ATDA 3WQ8A 1RY0A 3VI2A 2H9AA 3M5ZA 1UR0A 3E5PA 4DVOA 5JBDA 3WQFA 1XDJA 1FXQA 5M5DA 1PTAA 1P0EA 3W25A 1YX1A 1ENUA 2E9MA 1E6XM 3S42A 5ECVA 1R0MA 1E1FA 4IP5A 1DJWA 3LN3A 1JDDA 3NFUA 4AVNA 2P10A 2VFGA 1EPVA 2OSXA 5I77A 1RUSA 2PWHA 3VNKA 5L9FA 1VJZA 4M6PA 2CZEA 2YJQA 3IVTA 1QWGA 3O3RA 3GDMA 1HFBA 4KGJA 7ODCA 2JKEA 5F4WA 2XM2A 1L8PA 1YTKA 4K8HA 4ZB0A 3T0BA 4I7UA 4M1RA 5CSUA 2VR2A 1B9BA 4JTSA 2A79A 5T9CE 1YMYA 1JF5A 2ZZ5A 1K8YA 1JULA 3ES8A 1YHTA 3RHGA 3R0DA 4HVXA 1NEYA 3M47A 3P8JA 1NARA 2HSAA 3UF9A 3P8IA 2GLKA 4X2RA 1FXPA 4H8VA 2ZUMA 1L9WA 3L4ZA 4DBDA 5GJPA 2YB4A 4OT7A 1LUCA 1A4MA 3NQBA 3DYPA 2H3BA 3GIQA 3E0LA 1CZ1A 2GJLA 1JI1A 2XH4A 3HM7A 1Q45A 2VQTA 1W5MA 1R30A 1B54A 3URQA 1PKLA 4LWWA 4IMDA 4UQEA 3NEVA 4IQEA 3QBUA 1I9CB 4IT1A 5AVNA 5JXQA 4GABA 4JOMA 4TOQA 1YNQA 1S2AA 3E5BA 1VCVA 1LRNA 4EPBC 4YTRA 3FN9A 1D2KA 1DWAM 2J7EA 4HNCA 3UGRA 4CQCA 3AUOA 1K7EA 1FBAA 1IE7C 4FX7A 3GUGA 5GNXA 2ZUNA 2A3AA 3S4TA 3QZEA 1VFOA 3S9IA 4LX4A 1AQ0A 3GB6A 4V1XA 2CXEA 2YDQA 3LHTA 1Y0EA 4U2ZA 1FH9A 1GOOA 2I5GA 4NNBA 2WM0A 3ZZ1A 4BI7A 2UY3A 1K9DA 2CHRA 2XM1A 4PYSA 3L5AA 4S3EA 4F2UA 2ZX5A 2V63A 1WNOA 3CV1A 4NJHA 3SURA 3AICA 3DECA 2NUYA 1GORA 2WMIB 2A7NA 1QNVA 3PB0A 2X2YA 3FA5A 3WL1A 2XHYA 1P1MA 2IPJA 5I3FA 1TYGA 1KV5A 1WDQA 3S1GA 1VCGA 4PUWA 4AC7C 1A5AA 4I6KA 2BX7A 2WKGA 4C7FA 2JF6A 4RNFA 4KEZA 1I0DA 4J35A 3DIPA 2FTPA 1WKEA 4XKMA 4TX9A 3VUSA 2VX4A 2P88A 3CWHA 3CIWA 1OYCA 4YMZA 3LA4A 3NXLA 1GGOA 4IQJA 3W82A 1DWGM 1UPMB 2WZHA 3WQPA 2O4QA 5HMSA 2FB2A 1WDWA 1GPWA 1OD0A 3OZOA 3TYDA 4NNAA 1JYXA 3PUDA 1ZENA 2B7QA 1Q5MA 3O6YX 3CWOX 1CLKA 2H8XA 3GC2A 4UCGA 1G7VA 3UW6A 3LCHA 3W53A 4CNOA 5KETA 1PIIA 5CCZA 4EXQA 2I1OA 2DIJA 1IZCA 3VDGA 2HS6A 2DH3A 4DXXA 4LSBA 1F4AA 4S38A 3USZA 1AK5A 1BKHA 4LVAA 4YIWA 3TWBA 4IPNB 3KOYA 5C9RA 2ZE0A 2PDYA 1F2JA 3LCFA 2J9ZA 3QHNA 4LCRA 2AMGA 1PXGA 3N19B 4LBSA 4KKXA 2PDCA 1AD4A 3EXRA 2GSJA 5HMDA 1OM0A 1KM4A 5H91A 3QMTA 2AMXA 1DYSA 3T0CA 1F73A 1PHWA 2PTYA 3MUZ1 4W89A 4GY7A 4PCNA 2WZIA 4ZA0A 1YLVA 4JFTA 4CCEA 1NDWA 3QR1A 1OC7A 3PPGA 2OYMA 3B9EA 2O4MA 5FJUA 4GYPA 3CZEA 1IEWA 2Y61A 4V33A 2Y63A 3MWAA 2PDJA 4FLSA 3GNPA 3LBMA 3CPUA 3RYSA 3DKLA 3BTNA 3TYCA 1ZQ5A 1TV4A 5D2YA 4ACZB 1A4LA 2CIPA 4HU0A 3P2VA 2Y5EA 3UWQA 1YADA 1IGWA 2YR1A 3C0QA 3WNKA 4IF2A 1FWAC 3DFOA 4GRSA 2QUMA 1EDQA 4FNUA 1E56A 3WLLA 1I1WA 3H26A 1SZRA 2QJGA 2PTZA 1J01A 3MCOA 3HURA 3QHMA 2QCDB 2O7SA 4NZ1A 1RPXA 4YTQA 1OIFA 3RRAA 1E0WA 3IIXA 5LA1A 4MZ8A 3ZT6A 5EU9A 2X2GA 3PBWA 3MS8A 4G8TA 4Y9MA 1VFMA 1E73M 6ENLA 3ARZA 3LGDA 4WKFA 3VCRA 1TV8A 6CGTA 1SZGA 1DWHM 3TTYA 2OYLA 3WMCA 3AYVA 5LIYX 4O1CA 4DXKA 1XCFA 3TW9A 1S5VA 3QVQA 2ZKMX 1JR1A 2CYGA 3QW4B 1ALDA 4AWUA 4CVWA 3N6QA 4GQQA 3VNLA 3T1GA 4IGHA 3HFYA 1WKYA 2RJGA 2AQVA 2WMHA 4HYWA 2V3FA 2POZA 1Q6FA 2F61A 2E0PA 1ISXA 1IEVA 1C8YA 4DBSA 2XVKA 3T0AA 4O54A 1ZZMA 3KZSA 1ZAIA 2PDNA 1F6KA 1KCXA 2QV5A 4K6AA 2OG9A 1YW1A 5AECA 1DJQA 4A05A 1NFBA 5M3WA 1WDPA 4LGXA 1RA5A 4GACA 3C2OA 1WA3A 4IFKB 3FXYA 4J4KA 1FUYA 3KWXA 4C6EA 1LBMA 1OGGA 3UQNA 1VBRA 3Q2DA 1QPOA 3EA1A 4CQBA 3VOCA 1FTXA 4Y90A 3AMGA 1AL8A 2V0TA 4U33A 4LBRA 3WLSA 1XPGA 1EOMA 5D30A 2OGYA 4JIQA 2NVAA 4GUHA 5D4YA 4H6EA 3E2QA 1QHOA 3AHVA 4MG4A 3IRSA 1JNEA 2OPJA 5CJNA 4QLKA 1G0CA 3T0TA 1F3TA 2AGKA 2FVKA 4B2DA 2TMDA 3FJLA 4J5NA 3W2LA 5I79A 5EFFA 5K9CA 3MUAA 1W91A 3ABXA 4UFLA 2W0UA 4HSHA 2ZUWA 3AYSA 3S0CA 1XXXA 1HT6A 4ZO7A 4ICNA 4P7QA 5BRBA 3MJMA 3SO7A 2Y7DA 1KM3A 2HVOA 4O0KA 6PTDA 3S2LA 3I65A 5DANA 3KTXA 1F9CA 3ZSSA 1AJ2A 4A22A 1KXQA 3BGGA 1OQFA 2D23A 1UH4A 1ZPTA 3GTNA 2QKFA 5KITA 2XGIA 3MCMA 5G5IA 4K8EA 3CWNA 2RDXA 3CZLA 2BGSA 2QF8A 3VD4A 1W9BM 2VD9A 8XIAA 2V5JA 1NIUA 1EJSC 5LGZA 2NW0A 2GPTA 2J7GA 3B0VC 1JQVA 2ZIDA 2J78A 3U8GA 1DL3A 2NSXA 1VCFA 4FOJA 1MNSA 3KLKA 1ZALA 2WK2A 5AHLA 3KHDA 3PJWA 1DJHA 1LDCA 3JU2A 5FOOA 2CLPA 3GC4A 4UTJA 3OHIA 1V02E 4D6CA 1JUBA 3VTRA 4CNPA 4GX9A 3RLGA 1YDNA 4AX6A 3V1HA 2OKTA 4BWLA 1PDZA 5EB8A 1W3KA 1C9DA 2WC3A 1VQTA 3AISA 3SQMA 3A3WA 4YXGA 4M0XA 4MJMA 4JTKA 3DX5A 4U3CA 3D0CA 2QCMA 3TH6A 2J62A 2VRJA 4ERGA 2A3EA 1Q6DA 3CAQA 3C2VA 3H53A 3U9IA 1NF0A 4MB1A 2JKAA 1EDTA 1XH2A 1CI1A 1R3RA 4ZGYA 4GVGA 5I06A 1L0PA 2X42A 3GXPA 2QPXA 5DLCA 1U1HA 1PO9A 2OLAA 4LH8A 3GR4A 4QJ4B 2ZRVA 3GKFA 2G96A 3DESA 1TV3A 2QJNA 1BGAA 3AZSA 4WDWA 4CU8A 5A69A 4BF7A 3W07A 1WV2A 3F2BA 4R9XA 4HCDA 5D9PA 1YRRA 2P5NA 5SWUA 3K46A 1J0KA 4C6MA 1KQZA 1F8MA 3WDRA 2QCNA 1QPNA 1KW1A 2VL4A 3N6JA 4LUTB 2Y85A 1X7FA 2QCGA 4C1KA 4WJEA 3R7MA 2ZX7A 3AWOA 2OFJA 3EDFA 1XYMA 4JY8A 4JZ5A 1OC5A 3O2LA 1I2RA 2WVSA 4PMZA 4TTGA 1VFUA 5G4WA 2YA0A 2RDWA 1IF2A 3ANUA 1ONXA 2QJHA 1KFLA 3H12A 3VIMA 1M1BA 3FV9A 3LLFA 3GZAA 2PRMA 5IFPA 4QE1A 1XIDA 4V27A 2V9DA 1IXNA 3G1SA 3KDNA 1P48A 1EB3A 3UZWA 3ZOAA 4E3VA 1CB7B 1C92A 2PDQA 2JEQA 1QT1A 1B0IA 3ZJ6A 4WR3A 2XUCA 4HD5A 4R88A 3ES7A 2F38A 2WBKA 3NZQA 2D3NA 3GBDA 2X40A 4O52A 3HJEA 4INFA 4GJ1A 2NV2A 1VFFA 2VFIA 4NJGA 1E55A 1GEHA 1OFEA 4K1WA 1UA3A 4GC4A 3AZRA 4XZNX 2E25A 1Q2SA 3IJ9A 3NEHA 5K9XA 3W2UA 3LENA 2GOKA 3WLIA 1CXKA 1QW8A 3CUIA 5HPCA 2GJNA 3CS2A 2G95A 1XH1A 3PG9A 4NAEA 5M1TA 1S2TA 1FFQA 2X1RA 5HNRA 1V4YA 2F6UA 2V5LA 4YTUA 2J6XA 3ONCA 3D5HA 5E0FA 3NURA 1M03A 1IXPA 5LIKX 5U4NA 1T41A 2BP1A 3KBSA 4JR5A 2EXOA 4BK9A 4KWWA 2EHHA 1DVJA 1VGAA 4YN5A 4M6QA 5E6ZA 3C0SA 5D2WA 2OX4A 3GFZA 5AYIA 3CO4A 1JZ8A 1G67A 2Z6JA 2D24A 4QG9A 2DY3A 4M3PA 2NQJA 4CNTA 1GQKA 1EF2A 2UY5A 1EKOA 4KMQA 4O12A 1UUOA 1KCLA 3VIJA 4Q32A 4LPCA 4M7SA 4IIDA 4Y8EA 1UD3A 4P2VA 3E3HA 1OFBA 1KM6A 2ZC1A 5KSWA 2DJLA 2J9XA 1EO5A 4H7CA 4A3YA 4E8DA 5D8WA 1UZDA 2ZRYA 4KBXA 3QPZA 1FWNA 1QI5A 2I57A 2YBUA 3KBNA 3TIMA 2JBMA 1M7JA 5DEZA 2DT3A 1ZTVA 4BF5A 4NZFA 1JYVA 4QE5A 2V5DA 3EOSA 3M6YA 5MF5A 2HCVA 5FJRA 1KBIA 3DG6A 2WMFA 3ISIX 5CC3A 2A4AA 2CEQA 3UZ5A 4W85A 5J5DA 1G4SA 4TMBA 2JGYA 2GUUA 4DJFA 2VX6A 3PNUA 3NR0A 4DLFA 3H4XA 4R27A 4C6OA 5CC5A 3E2VA 3S6OA 2EPLX 3PZTA 2Y8KA 5F2MA 4RJEA 4PTWA 3TR9A 2WMIA 1XYAA 3TQKA 1DJNA 2X05A 1GOXA 3ZMRA 1UD2A 4Z1AA 4N02A 3EWYA 2O55A 2YOCA 3WDHA 1NSJA 3B8SA 4GQRA 1O66A 4UR9A 3ALGA 2QULA 2PGFA 1X98A 3LU2A 4AD3A 1IIGA 3U2OA 3K8MA 1SSDA 1CIUA 4DAIA 1CGVA 2R9RA 3HN3A 1CXFA 5GJMA 1J0HA 3OEXA 1W56A 2C71A 1GPFA 1UOZA 1UASA 3CHEA 4PEKA 1W5QA 3ZR4A 2VUNA 4KCVA 4K37A 1IZKA 3PZGA 1M7OA 2POTA 3LCIA 1R7OA 1ISVA 4H04A 3WQGA 3KVMA 1H5VA 4AY7A 4Z42C 1PCWA 1W8GA 3GH5A 4ZSTA 3AHYA 1V3KA 2IXVA 3WUBA 4PMQA 5L6UA 3ID7A 2FVLA 4GMEA 4YU1A 4OUEA 3T2QA 4IMFA 4AHOA 3IK4A 1NQ6A 4QLLA 1XFCA 1FHDA 4K7VA 3M64A 1J10A 1TJRA 1XICA 1XBYA 2WCSA 3A3XA 1FWIC 1XIJA 1S39A 2GDQA 4FO4A 3W01A 2NUXA 4IIHA 1I6NA 3LRMA 3OVQA 3COTA 1BG4A 2WVUA 3K4WA 1KB3A 1XP3A 1I2PA 2V67A 3LMZA 3PTQA 1N8WA 4IXXA 1DXFA 1WB0A 2J74A 3WLHA 3DZ1A 4DX3A 1F3WA 1KR0A 4UMCA 1IQ8A 2ZFAA 4CNNA 3ABZA 3RMEA 4PUNA 5G4EA 5A6AA 1NDVA 5I09A 1LOSA 3SBFA 3TOPA 2DGAA 1IZJA 3WLMA 4HA3A 2DIKA 2GGGA 4H2CA 3UWYA 3WJXA 2CZVA 3WD1A 1GG1A 1EGMA 1RQEA 3EKZA 1K7FA 1WZLA 3MVTA 1LL7A 5B7ZA 4DI8A 3PN8A 4DUVA 2V6AA 2VURA 1JFHA 2DH2A 4ROQA 3DFTA 1KGXA 4E0CA 3SRKA 1F3EA 4DJFD 1BYCA 3PWIA 3AXKA 5CGMA 1EJXC 4N7QA 4PE8A 4H3DA 2DU2A 5EMJA 3HQ1A 2QQ6A 3CHVA 1BXBA 4LB4A 2GWNA 3TQPA 3TN6A 2XISA 1XLLA 1RY8A 3E0IA 4PL1A 3E02A 1AA1B 4K3ZA 4O8RA 2FHFA 1IR2A 3REQA 3C52A 4HU8A 5JIPA 1JXKA 2OSYA 3ARQA 1Z48A 4QR6A 4UQBA 1H60A 4WXZA 2Z1KA 2QT3A 4WSKA 3QPYA 3GVQA 2FZNA 4JIEA 2NQ9A 1SPQA 3FJNA 4QG6A 5G1TA 3FS2A 4D2JA 3G1YA 2EQDA 4IG2B 1WUFA 4LCSA 4GVHA 2YDSA 4A6GA 3D47A 1W6TA 4UC5A 3W2MA 4HPHA 4H2HA 3GYCA 3THAA 1P0BA 2HMCA 1T0OA 5CQ1A 3JZEA 1TTPA 4O1FA 1VBGA 2FFCA 4IM4A 1TPB1 1F6YA 4JQ2A 3S5ZA 3WH7A 2QS8A 1SZEA 4AF0A 1EOKA 3QV7A 1ZBCA 4HA1A 3HG4A 2I5QA 3UWEA 1S2WA 2YFOA 1QR7A 3MUXA 4F40A 1W2VA 4UWMA 4HCLA 1VFTA 1O5KA 3KE0A 2UY4A 3QOKA 1KM5A 3DFNA 4HTBA 3NQEA 1SZNA 1GOQA 3STGA 3C3NA 2OZ3A 1UHVA 3VXGA 2WC4A 1P0NA 4K38A 2PCQA 3B4YA 2CBUA 1RBOB 4Q4MA 2PLCA 1TMQA 2OQLA 4ZQRA 3ONBA 3GX9A 3TA6A 3SECA 3FYPA 3AXIA 3MSYA 4JS3A 4BCEA 3S9ZA 4ADUA 4NXSA 4FR1A 4WVXA 4E8GA 4D9PA 3CQIA 4IG2A 4IFKA 3ZT7A 3F4DA 3VX1A 2FTWA 1A5OC 4JAWA 3S1UA 5FF3A 1WO2A 2G3FA 2IW0A 1K3UA 4HSNA 3WYZA 3LCLA 3PG8A 1FWFC 1OHLA 2HPMA 3VC6A 1AJZA 3DFYA 3IJQA 2XN2A 4GI6A 2QVHA 4OZOA 3TV8A 1Z8AA 5AYXA 5AC5A 1XG3A 1JVNA 4IISA 5HPOA 2W4XA 4Z08A 2Z28A 1ICPA 1PEZA 3P74A 4FP1A 4ERAA 4R7OA 2EG6A 3HO8A 1MQPA 5HJYA 4D8AA 3CL7A 5FIPA 5EGRA 5C6MA 1QWKA 3DBPA 4GUIA 4GUFA 3WLKX 2E8ZA 1XPYA 5CSYA 1YNPA 4JNMA 3CUJA 3ITCA 3NDZA 4PTNA 1W9DM 2VGBA 1B90A 1L2QA 5CLTA 2ACSA 2VM8A 1OG0A 1H49A 1ZCOA 1MRQA 3K1DA 3NGFA 4BA0A 3SQSA 3UP8A 3W00A 3L9CA 5AHIA 1FP8A 3EAUA 3OIXA 2PZNA 5HDRA 4GNKB 1TO3A 3A23A 1XIGA 4UFHA 4NZJA 4QEEA 4AZBA 3D6NA 2PTXA 3PZMA 2VZUA 3QZ6A 1VBJA 1SW0A 3K8LA 4UTIA 4OBRA 3T08A 3A21A 2W92A 1GJPA 1WOBA 3D3AA 3L0GA 2VZTA 3G3DA 4HOZA 3C4UA 1SJBA 1EWEA 4B5VA 3KBMA 3H7RA 3OVGA 2CHNA 4WZHA 1MFVA 3EOOA 5I07A 5TNVA 3L21A 4PN2A 5KMYA 4GI4A 1IEQA 2TRSA 3UBPC 3PP7A 2XZ9A 1UD8A 4REQB 1J93A 4US6A 3EWZA 1HKKA 1DXIA 4I9TA 3A64A 3TJIA 3CZKA 4XKYA 1G9HA 4QJ1A 3OVPA 3WEOA 3B05A 3TNOA 1XLKA 4CD4A 3NO1A 1F74A 3U2EA 4OOZA 2DEPA 2ZUUA 3VM5A 1EUAA 5G2HA 3UXAA 4OECA 4BWLC 3BQ6A 3SDOA 1K4HA 4LCQA 1XX1A 3W87A 2WJDA 3VKDA 3LHVA 4FLQA 4DJDA 1VFLA 1YBQB 3GDTA 3HPZA 3NO3A 2WJEA 4JTAA 3NSXA 4IX0A 3G22A 3LNMA 4AXNA 3GWQA 4DUWA 3OOQA 2RKXA 2DIEA 2I9UA 4QM1A 4BQ4A 2WHJA 3G1AA 2WZTA 3LV5A 3NXFA 1I45A 3RFAA 4TU1A 1MUCA 4ZR8A 4M8UA 2CW6A 4MDOA 2P76A 3PTDA 1UP3A 3NPXA 4KWSA 4L9YA 1I60A 3QYSA 1RQBA 3GDLA 5MKGA 2E5DA 3T07A 1VIZA 3FEQA 2ICSA 5CAKA 2HK1A 5IFTA 1QAPA 4B15A 1K9TA 3FDGA 3W1NA 1HP4A 1V6XA 6ALDA 4TXEA 1W9XA 3IJLA 3BMWA 2PC4A 4FNQA 3SM0A 4LRSA 3GR7A 2A85A 3BXWA 5C9XA 3QR0A 4Z1BA 2O9RA 1VEOA 3FLUA 4O14A 2OYKA 4H1ZA 4KH2A 3VU2A 3GZ3A 2VX7A 5JU6A 5JQ9A 1P6CA 1SR9A 5BW6A 1W5PA 1NWUA 2O56A 1EUNA 4BQ5A 4D8LA 2BOEX 2PGRA 1Q66A 1TJ0A 1IR1A 1QFEA 4PMOA 3BW4A 3EEGA 2GDUA 4RW5A 3W02A 1JJKA 2CBVA 2Q09A 2OOFA 4MAVA 3M16A 1QVBA 5GJNA 1UC5A 3VDCA 4QAIA 2PWGA 3SUVA 4GLEA 2QF7A 3GLCA 4QS6A 5EKYA 1GVQA 4QRNA 4UTWC 4XAZA 4W93A 4C60A 1W9PA 4XD4A 4ZBCA 2PGWA 2EO7A 1MVYA 3BZGA 1DQUA 4IMCA 3SIZA 2VWSA 3PY2A 3L23A 1ZB5A 3M07A 3M7WA 4MB4A 1SJDA 5FSDC 1OSEA 4BKNA 2V2HA 1E5JA 3MANA 5IBXC 1Q85A 1ZJAA 2ZZ2A 2F2KA 1CGUA 3L2MA 5HJXA 3IAQA 4DEFA 5EYWA 3TEVA 3UPMA 3H21A 4RX0A 5A2CA 4PSRA 4GQBA 1I2NA 5LIWX 2B31A 4LQ1A 1TJPA 4NI8A 4RV8A 4DXVA 1XCXA 2W27A 2EPOA 1BAGA 3AC0A 3ZSTA 4AEFA 4S2BA 4A35A 1E5NA 3TW6A 1A0EA 4IIEA 3V7PA 2YXOA 4WEVX 1SR0A 4BR1A 4IPPA 4GNJA 2HE5A 5D37A 3QV8A 4DWSA 5A8NA 3KL5A 1QK0A 3E2RA 2VYOA 4BJHA 1HKJA 4PMDA 4S39A 1YPXA 3CK5A 1JCJA 2VR4A 3CNYA 2BDQA 3IRDA 2XYLA 1D8WA 2HV5A 2QCLA 3E2SA 1XIEA 5E0CA 3IIVA 2Q01A 1HXJA 4NL1A 4GZEA 3ME3A 3HPSA 4E2DA 3UZYA 3NQ6A 3SEPA 3CUZA 3L12A 3LGGA 2YSWA 1KV8A 3W7EA 4HP5A 1R3VA 4JQ1A 3TLLA 1B4EA 3CEUA 3LSCA 2DUXA 2WPGA 2YXXA 5ABHA 3HZ3A 3QM3A 1X1OA 3T2PA 3KL3A 4CNUA 5DY2A 1KTNA 1X97A 1CCWB 3VKBA 3W73A 3S2CA 1V0MA 5I03A 4GFIA 5HR6A 1FY6A 4WGHA 4G7FA 4KRTA 4LJ3A 4AVFA 1KBBA 3LNPA 5FL1A 1VP5A 1KFCA 1JD7A 5T91A 2AL2A 3FFSA 1XC4A 3RX4A 1Q3NA 4YNGA 3NOEA 3LV6A 3TMQA 2PLKA 4G7EB 4QJ5B 4HMDA 1BWLA 3SJNA 4HBKA 2OMAA 4KCWA 2BVDA 1XQKA 3P0XA 3W7LA 5LXXA 1JCYA 3GNXA 4DLMA 4EXBA 5FI8A 3LD5A 3I6TA 2G50A 1UCWA 5DCDA 4HTYA 2XSXA 1OIMA 3GS6A 3GU1A 4ZO8A 3L4VA 2CETA 4UZSA 1QBBA 2CPUA 4NX0A 1W0MA 3C2RA 1ISYA 2WNNA 4OJYA 2QV4A 3V5FA 4WRHA 4Q8MA 3ELFA 5CBBA 4AY1A 2H6RA 2FDMA 4HB7A 4XIMA 2ISSA 2PGEA 5M03A 1IT8A 1NM9A 3O6CA 7REQB 3FAXA 3LHYA 4HMEA 4ZOAA 3BPWA 4FIRA 3SCQA 1SFJA 2YCKX 3MHGA 5A6BA 3OGVA 3PTMA 4PUDA 4LT9A 3A6OA 3NL5A 3SCOA 1VPQA 4B90A 4DIAA 2EPHA 3S5NA 3W72A 5E70A 1EJRC 3QJAA 1P0DA 2J9YA 4CKQA 1A5NC 2OB3A 2NT1A 3QKEA 4F66A 4XTIA 3MUY1 4OTKA 2BVWA 5F4SA 3VM7A 3HU7A 3WQEA 1YXCA 3W76A 1KRBC 2VGGA 4O1AA 2QCHA 4DM1A 1TA3B 4WLCA 2Q02A 1FCQA 4IUOA 3Q67A 4K2SA 3VFLA 2ATMA 2ZTKA 2HXTA 2ZQ0A 1ZCCA 5XIMA 5JH1A 3WK0A 4ILSA 1OCJA 1VEPA 1VKFA 1XDLA 1XIHA 1EF3A 3LY0A 4NZ3A 3HPFA 1IXOA 2BVTA 1WE5A 3I7SA 3UT0A 1TVLA 4O50A 1OCBA 1WZMA 3T8QA 3UXIA 3LYEA 1BFNA 3VOIA 4K36A 2NWSA 1XLGA 3ARSA 3EXTA 1HJUA 1C90A 3ITXA 1M01A 1OFDA 5LNRA 2EGZA 3WD0A 1VHNA 4UZUA 1QOQA 1Q6OA 2D2HA 1R2RA 1K7XA 3KBVA 3FX4A 3MSDA 2HVNA 1D9EA 2CZFA 3SUWA 4AZ6A 2WNQA 1XRSA 3TYUA 4RV3A 3LOTA 1PWMA 3RGTA 4US5A 3SUTA 2IPWA 2PWFA 1QU4A 4NRSA 3DG7A 3QR3A 4XV0A 3GO2A 1MRAA 2MNRA 3VGFA 1YQ2A 1TTQA 3B40A 3V4BA 2ALDA 1TX0A 2W5FA 3UY8A 3GR8A 5FF4A 1CEOA 4KEUA 1PBGA 3W27A 3BG3A 1ONEA 2ABAA 2WOQA 2NSOA 2FQIA 4WDUA 1KFKA 1W1TA 3FYOA 1XYBA 5CGQA 2C0HA 1W54A 3CBWA 3RLHA 3WBAA 1X1ZA 2QUVA 1MZRA 2AQWA 3TU9A 2O9PA 1OCQA 5A6JA 3MDUA 3N04A 3BLLA 4L6OA 4LVBA 3WNOA 3PUEA 1BEUA 3MMDA 3MYPA 3CU2A 5D9NA 3F2CA 1R2SA 3AS1A 4U5IA 2SFPA 4Y9OA 2RAGA 5CG0A 3WL0A 2HTMA 3OHMB 4L1XA 3BMVA 3T8LA 3PFMA 4ERIA 3QOMA 3QV9A 1X6LA 2CKSA 3IAPA 4P8VA 1D8CA 1VD6A 3HOJA 4GUGA 4MLRA 1JUEA 3W7OA 5BOEA 2A3LA 1VR6A 4XBSA 4EKJA 2ZZ3A 3N73A 4DJEC 1EIBA 1H7XA 3S6DA 5TAOA 3OBKA 2QUTA 3GRIA 1TKKA 5HWJA 4UTLA 3TMLA 2QIWA 3M0VA 4H8NA 2D22A 4W88A 3VIKA 2VENA 4LEFA 4ZZ9A 3ARVA 4GE8A 2PI6A 1DJIA 4ACYA 4AUBA 4DY1A 3A9BA 4H01A 1WCGA 3KXQA 2RUSA 3NZ1A 2Z24A 3ANYA 1J0JA 3F4NA 5A8QA 1UWQA 1OYBA 3AU2A 3SR7A 2C79A 3CM4A 1SO5A 2GQ3A 5A8PA 2QAPA 1E3ZA 5FSEC 5B7YA 5ABTA 2AKZA 2DP3A 1M68A 2FPVA 3ECQA 2CFFA 3LM3A 1NP0A 3HB9A 3MZ2A 3TYZA 4HPGA 6REQA 4D6JA 4FX8A 3UCDA 1WKDA 2VJXA 3BAWA 4QNEA 2I16A 1DQXA 4O10A 3KOZA 3SCVA 1XGZA 1G94A 1QI2A 3VMNA 2FPTA 5TF0A 5C2GA 3WDPP 4JKLA 3IUHA 3IIZA 4LAOA 4UBPC 1W5NA 1ADOA 4UR8A 1PTDA 3WUFA 4BZYA 2QZRA 4MY9A 2XG9A 2P0OA 4O1EA 4LW7A 3AALA 1BVZA 2EG8A 1W3TA 3TCEA 4CD7A 3RM9A 2QMKA 5G1YA 1OB0A 2X30A 4YCOA 1FRBA 4Z17A 1QNSA 3GTXA 2W9MA 5T9BG 1EC7A 1EHAA 4X0VA 3I7QA 3W1UA 1L2UA 5H8PA 3MCNA 3T2OA 2BMBA 2QEZA 5BRQA 4Y8FA 1RV8A 4PH6A 3UJSA 5CZKA 1SFTA 2AL2B 5DX7A 2E4TA 3POCA 3JUGA 4W86A 2P0IA 3ITVA 3S47A 3KVKA 1KTBA 4L7ZA 2XIIA 3DFSA 1E0TA 2OEMA 3BL3A 2V30A 3G0UA 3HGJA 3N15A 4A3UA 4A8LA 5CG7A 2PP0A 1TX2A 1V93A 3N2BA 2ISFA 4WY0F 4HPNA 4YVVA 5KEZA 5D09A 2GVJA 1LF1A 1AL7A 3VOHA 1HJVA 1LM1A 2ZYFA 2CLHA 4S1FA 5FA5A 4EK7A 1THFD 2ZXQA 1B9ZA 3LB0A 3OLIA 3VKKA 5T8GA 4NAFB 5D32A 2O7QA 4IJBA 2PDHA 3O9NA 3B9DA 3TSDA 4LANA 1XQLA 5HQLA 3GK0A 4FF5A 3NPUA 3EPNA 2PLJA 1FOBA 4Q8UA 1QPRA 3RG6A 4HK7A 4DM2A 1JPHA 4WOZA 1TPDA 1EA9C 4W84A 4JN7A 3UCCA 2FGZA 3SB0A 4V28A 2YA1A 1ECQA 2NXHA 4PGLA 1FHUA 1XIIA 1J0ZA 4UTMA 3XINA 2G3NA 3GBEA 3KTSA 4GZIA 1XIBA 4FHAA 4C6KA 2VC6A 3U4AA 4MJZA 3VKAA 5A5WA 1J6OA 1Z41A 1DE6A 1P1XA 3WLPA 2FH8A 4PODA 3CGTA 2HBXA 2X8RA 1VC4A 3EX2A 1OABA 1EJWC 1UH3A 3PM6A 1H51A 1E1CA 1A50A 2DZVA 3W83A 1ZRQA 3MW7A 2DUAA 2JK2A 5ECUA 2GJPA 1XI3A 3EWCA 3WD3A 1BKSA 3B8VA 2ZRUA 2R1MA 1TG7A 1WDDA 2EAWA 1U1JA 4AYGA 2WPBA 2DDXA 5F2GA 4OKDA 1EJTC 3LBCA 5AC7A 3VX0A 1JZ5A 4LY4A 3BLFA 2V68A 2VXNA 4H7ZA 4NZCA 2QDDA 1QATA 1HKIA 1KLYA 1V0LA 5EMMA 1Z69A 4O19A 1VRXA 3CJPA 2YCLB 3EX1A 1XLMA 1EHNA 2DSZA 4ZE5A 4GGHA 5HWNA 5J5RA 2VWTA 3W7MA 3BVJA 5AN7A 2J66A 2UWFA 1Z3NA 3II1A 3PZOA 1EXBA 4C6CA 2PDBA 2XIMA 2WMGA 1A3XA 1JGIA 2C8NA 2O9OA 4H19A 3H2EA 4JDBA 1UBSA 3VIHA 4KEMA 4AYSA 1M41A 3T05A 3KUMA 3UD6A 3W71A 3K4DA 3OVRA 4O8AA 2ZXBA 4QCEA 4CQDA 5CPOA 4JTLA 4N42A 3GC5A 8CGTA 2W79A 1I1XA 5H2ZA 3FIGA 5F7UA 3SRFA 3TFXA 2G5WA 3W9ZA 3AYRA 4UTTA 4ZMGA 3PUOA 2JIEA 3GNDA 3PJXA 1DHPA 1E3XA 2E6AA 4I5XA 4I7VA 4OWGA 1QTWA 2OEKA 3GIYA 2Q8XA 3FCPA 3B04A 2Q6ZA 5CAHA 1M7XA 4GI9A 5BNKA 1XLFA 2BOGX 1TB3A 2RH9A 2BTMA 4NJJA 1TMHA 1E71M 1BTCA 1W3IA 1YPIA 4DWSB 3V0SA 2LLEA 1XD1A 2X1TA 4FALA 3R10A 4TV6A 2Z29A 4QP0A 3TC3A 3U2ZA 1RP8A 1AVAA 2A6LA 2AAAA 4W9TA 3WY1A 5BRPA 4FNRA 3LI1A 3THDA 2PMQA 2Y0FA 1JZ7A 3LPFA 2D20A 1E15A 3EMZA 3DUGA 4UQDA 4RZ4A 3GTFA 1G01A 3HA1A 3DFQA 1XS2A 3SCWA 3S83A 3PJTA 4WXYA 1KO0A 5D2VA 4C6IA 3VE7A 3UR2A 2F8QA 2R91A 1X6UA 2DUZA 1S2VA 1QJWA 3YPIA 3ZLGA 2WM1A 4N9EA 1A47A 4J1OA 4NT0A 3VGBA 2X1UA 1O95A 3VZXA 1AZ2A 1UWUA 3NAVA 3A22A 1RCQA 1PKNA 3TNBA 1IWPA 4IH3A 2V3DA 4NYUA 4PRWA 4KQNA 4KCUA 2OTDA 2NWRA 4JTTA 3LLXA 1DORA 5D38A 5BU6A 2C16A 3AQUA 3P61A 2QCDA 4JYFA 3SSZA 3LQLA 4MKSA 2ZUTA 3AS3A 6REQB 4CU6A 4H83A 2XVLA 3SW6A 5FJTA 1Q6CA 3P5YA 1HJXA 3LCGA 1EP2A 3MV11 2A7RA 1V3JA 4IP4A 3CTTA 2RDUA 5AZ0A 2E8YA 4XZLX 2OWXA 3ZVIA 2V5CA 2NLYA 3KVJA 1LROA 4AXKA 3F5JA 3I4EA 5TBOA 5DCEA 4HHPA 1ADSA 1BGGA 1O60A 3B9NA 3MP3A 3WX7A 1H3GA 3N3TA 2ZA1A 1SM9A 2MUCA 3MUCA 3WH5A 1H5YA 4H4IA 1F76A 1V6UA 1PX8A 4UUIA 1EXPA 3CB3A 3GU2A 3GNOA 4QDWA 3TZNA 3I6RA 1UKTA 2R6OA 1VS1A 1U30A 1QASA 1R3WA 1XKYA 2QR6A 5ABFB 1BLIA 3CTLA 1JD9A 2G4FA 3PWAA 1GVFA 2WSPA 3VKCA 4JTFA 2NX9A 4OUIA 3IGHX 2QJIA 4MJ4A 5CKSA 3OODA 4JDYA 2NQLA 3W24A 3V18A 4XZ9A 3RJXA 3BCJA 3DOPA 2ZWZA 4JBRA 1S5TA 1JDAA 1VBUA 1EJUC 4L4LA 3HIJA 1EL3A 2QPSA 2CBIA 2ESCA 3A3HA 1CXEA 3MMUA 3IPWA 2PWEA 2GQAA 2J75A 4WSHA 5I0DA 1H61A 1LG1A 1J0YA 3GW0A 1FWDC 3K30A 4XKYB 5EBAA 4GX8A 4LUJA 1CWYA 2OU4A 3HV9A 3IGUA 4O57A 4XD5A 3MSGA 3AS2A 4WSJA 1BSLA 2XJ7A 1QMLA 5AB3A 2BVYA 4DO6A 4WX2A 5ABFA 4HQVA 5TD4A 1FCVA 1V5XA 2PDPA 3WH8A 1RCXB 1C7TA 4BI5A 3TP4A 1LL6A 3QKZA 1H41A 3Q37A 4JFWA 4PB3A 4W4QA 5HNUA 4OU1A 1Q4WA 2VELA 1L6SA 1KRAC 1F7BA 4LUIA 4AD2A 1GCYA 3KRZA 1FWJC 2PDKA 3IUDA 2YFNA 2Y6ZA 1MEIA 2E5CA 1XLJA 3E74A 1FQ0A 5E93A 2RJHA 1QW9A 1EJVC 2ZZ7A 3QV6A 1JF6A 3EBVA 1XHGA 2CZ5A 3M9YA 3LS9A 3N29A 5MKGB 3UPBA 5BWFA 1YTEA 3P14A 1EH9A 4AIUA 1KXHA 1BTMA 1UWRA 5E09A 5HANA 3UERA 4J3UA 3THUA 4MWAE 1UROA 3LRKA 3CQHA 1ZBKA 2E77A 1S46A 1LYXA 5E6YA 1QOPA 2IKJA 1O4UA 4E2OA 1NDZA 4OGZA 1TZZA 4C6PA 2ZVRA 1H50A 2ZTJA 3MKVA 3NQCA 5I02A 3B9OA 1YDVA 3MZNA 4LU0A 4B3LA 3OO2A 2WJZA 2WB5A 4FAMA 3WEMA 3L4UA 3VOJA 4DZIA 4IJRA 5C71A 2QW5A 3ARYA 1EX1A 1VBHA 4O17A 4AB4A 1UP2A 1OC6A 4P8WA 3S9YA 2BB0A 3CC1A 1R3SA 1Y5WA 3OQ8A 4AEOA 1W1ZA 3KOWA 1KKRA 1D3CA 1XYCA 3VCNA 3TDFA 5C0QA 3SRHA 1NOWA 4JX5A 4A2SA 2BXVA 1AW5A 1E51A 2X09A 2W63A 1QUMA 3APGA 3EZ4A 4HNLA 1SW7A 4IQLA 3A12A 3T4CA 1XFBA 3BAJA 3PS7A 1E1EA 3EWUA 4GBDA 3VAVA 1LG2A 4EF9A 4QDPA 4W5UA 5LXEA 1FDJA 4RE0A 4HNTA 2BXYA 4L65A 2E9BA 2R8WA 5FEXA 3WF4A 3ANVA 1BRLA 2P8BA 2XN0A 4B5UA 4MB5A 4OOUA 3W7DA 2BHYA 4UMBA 1GVRA 1E0VA 4LFYA 1X8FA 2QYGA 3VPLA 2NQZA 2V8ZA 3W7RA 1C29A 1NTHA 3PK7A 2VDIA 5BXSA 1AZ1A 1QCWA 3S8HA 4E38A 4HCHA 1OZMA 3UJFA 4CCZA 3VMOA 1ME9A 5D9MA 1YDOA 3GE7A 1E6ZA 1LT7A 5AHMA 4UOJA 2DT2A 3TYAA 1BXNA 3RITA 3ZR6A 3VZYA 1KA9F 1RQHA 4PFHA 4Z2JA 5M2FX 4JYDA 3ARTA 3TTQA 3PWGA 2WMKA 1DP0A 2QJJA 2AKMA 1EC8A 1E4LA 3R43A 4DRSA 5EPDA 2NX1A 2A2IA 4XZMX 3W38A 4M82A 4V1YA 1P6WA 3B0UX 3G5EA 2D2JA 1UWIA 3TKFA 4EOUA 5CZ0A 2XGZA 1UR8A 4Q4SA 2DZUA 4XZBA 3T09A 3EPMA 1A3HA 3RPTA 3SUUA 4LUSB 1VENA 3KTCA 3AXXA 4YLWA 3STPA 1U33A 1JRCA 4EANA 3W1XA 3CUXA 4DUOA 4BY3A 4WKHA 1QI3A 5FJJA 4H9ZA 3C3UA 1KNWA 2J47A 3IJ6A 3LHUA 5LYRA 3BG5A 3NM3A 3CMFA 2HNEA 3B06A 3IJDA 3LZ3A 3HMJG 5A6KA 3L65A 3B8UA 4ZEPA 1RLCL 3VIGA 2ISDA 3OIHA 3L2LA 4ATLA 1OF6A 1H4PA 3HGOA 4JIHA 3TCSA 3TSBA 4TVUA 4R53A 3ZT5A 3N11A 4NG3A 1Q2RA 3LX9A 4KT2A 2NUWA 1N2VA 3CB8A 3TTOA 2IUZA 3QTPA 1FH8A 3WNNA 2E1DA 3H2FA 1TSIA 5JVLA 4DYKA 3AJXA 1W1PA 2OWWA 3EWXA 3L7RA 1NF7A 4YWIA 4QHRA 4PTXA 2CHOA 1XRVA 2YLLA 4H7VA 3UR7A 4UR7A 3CV2A 2C7FA 3TX9A 5BOFA 4I9MA 4XWUA 4HHMA 2XFWA 2QCFA 4UQCA 3LXBA 2J7CA 3KS6A 3N3MA 3E12A 3LG3A 3ARPA 3HPAA 5C7VA 1UR9A 1BF6A 3FSUA 3W2KA 1XR2A 3VIIA 2FZMA 2PODA 2CLEA 4IICA 3V36A 3RMJA 5EFDA 1AH4A 1H1NA 4LVFA 2ZICA 1OBAA 2VD8A 5A3HA 3WNLA 1GJUA 3VA8A 2E09A 1GG0A 1O5XA 5U7SA 3M5VA 3BJTA 4LS0A 1MYRA 2P3ZA 3G1HA 4XQ6A 4I8YA 1H1YA 2Z1BA 4POCA 4AZCB 3CT2A 2G97A 2Y7EA 2RGMA 2QAFA 3GUWA 3SFWA 4QE4A 3BAKA 3MHUA 7REQA 3GHTA 5CZSA 4I8DA 6XIAA 2HJPA 3CLMA 5LIUX 1W1A1 4F0SA 4HPXA 1JDCA 1SMAA 3W86A 4KRZA 3ABSA 1XIFA 3CYJA 3H24A 3FJ6A 3LCWA 1FHVA 1GTHA 2R82A 3W6MA 1QHZA 5AHEA 3NJ3A 3UG4A 2Q8LA 3OLEA 4O1DA 1UMYA 3G6LA 1EYEA 2HK0A 1X8CA 2Z00A 3MO7A 5FEWA 1ISWA 3M0JA 1UD4A 4AHQA 3NDOA 3FDKA 1NFGA 3P5ZA 3QY7A 4BHYA 6TIMA 1KBLA 1UG6A 4PUJA 3DAQA 4KWVA 4XO7A 1XSKA 3NQFA 4JX6A 4CLMA 2NT0A 1GVEA 4QTGA 3DFPA 5D05A 3BLEA 1T99A 4HPJA 2G41A 1IIHA 1XBVA 2JQXA 3LQGA 4XX6A 1TRDA 3GKAA 1K6WA 3KDOA 1KRMA 1PUDA 1TQJA 2X16A 2GGEA 4OBSA 4M7TA 1DJYA 3TUUA 3S5SA 2WHLA 4Z2GA 4ZXLA 1SQ7A 4A2RA 4KIRA 3WQ4A 1RAKA 3C2EA 3PVFA 3IS4A 3EDEA 3CV6A 4XTDA 1W9UA 3O05A 5B80A 5HMEA 4O4VA 4IMAA 4XSMA 2YL6A 3RDKA 5I3KA 2D73A 3UGVA 3HFTA 1FWRA 1HJWA 3SRDA 8XIMA 4H6RA 2VNCA 2DQXA 1L6YA 3H2MA 1J9YA 3TJXA 3WDIA 2ONEA 2TODA 4OFCA 3CV7A 2XZ7A 4KETA 3VIFA 1C8QA 2OZ0A 1V0KA 2XFFA 1PX3A 2PDWA 8TIMA 5LNVA 4PMVA 4IJCA 4MGGA 3L4XA 1OFAA 5IHSA 5C2CA 2QDHA 4FLRA 3W7PA 4XAFA 3I3DA 1GOWA 5G4HC 3U5YA 1TTJA 1BYDA 2X7VA 2GL5A 4F79A 1UWSA 4RZ6A 1WYIA 3QGAC 1XLCA 4DJED 1TE1A 3BH4A 3M41A 1QPKA 1V77A 2I17A 3NYDA 1WKFA 4C7DA 4CD8A 3BURA 4IMEA 5FJPA 1TWZA 2FFIA 4QBXA 3REQB 1JGMA 5AHNA 3DHPA 1Z7AA 4GKLA 3S2JA 4IGMA 5C5YA 4WUIA 5GQBA 2I14A 4US5D 3GFYA 3LBOA 3SIMA 4JCMA 4RE4A 1RK5A 1V6YA 3QSTA 1LORA 1DEDA 1IHIA 1HL2A 3N1AA 1I2OA 1UOKA 1F07A 1VF8A 4MPKA 3OA5A 2FZBA 4GYPC 3LHWA 1M65A 2ACQA 1JDEA 1N55A 2G4JA 5K2ZA 1HTIA 4FPSA 4MTVA 1ME8A 2HQAA 4C6JA 1V8EA 2ZVIA 2O0TA 4H6QA 4NZ4A 2ABBA 3WBYA 4IMGA 3N2CA 3R1ZA 3H2AA 4UTKA 1AJ0A 1R85A 3H2NA 2P53A 4IL2A 3TK7A 3MSRA 4JFUA 3TTSA 1I2QA 2VFDA 4X60A 3EWWA 4XIAA 3KBJA 3F4WA 3FAWA 1QHPA 3ICJA 2TAAA 5KZEA 5DN1A 3G0SA 2G37A 2Z4GA 3TQ0A 4CN4A 4F0LA 3PANA 3GHRA 7TAAA 4R7WA 4MB3A 4I9JA 1T7LA 4IFOA 1OY0A 3WQOA 3ENLA 2VEGA 3LLDA 2D3LA 1R9YA 3WNPA 1EA0A 4PMUA 4N9DA 1RK6A 3K13A 2E6DA 3V75A 1EQCA 2YDRA 3VYLA 4AEEA 2D0HA 4C1NB 2PTDA 4L1GA 3F03K 1RJQA 4GO9A 4FOKA 3N17A 1FDYA 1B57A 1V79A 4LUSA 5H8MA 1WXZA 3CZJA 5IHRA 2OT1A 1W32A 1JCMP 1MUMA 2Y88A 3PBUA 3VKJA 1CECA 2VCCA 3CPRA 4U5KA 3M0IA 4XZHA 3L67A 1D7FA 1RLDA 5C8BB 3MU7A 3NGJA 5D9OA 1HW6A 3HG3A 3T55A 3CAKA 3G1DA 2ALRA 4U28A 1PSCA 2PDGA 3ZJ7A 4XSLA 1H0GA 1K1DA 2VC9A 2AAMA 1W17A 5LA2A 5CPLA 1GVYA 4FXFA 3W7HA 2YCIX 1E4IA 1JRBA 3A4XA 1TIMA 1GOIA 3KOFA 3KRSA 1PYFA 1B31A 2F7FA 2YYTA 3QLLA 4JTDA 1TJ2A 1QI0A 3AOFA 3N12A 2PBOA 3E0FA 1CB2A 4IXHA 4BFAA 1PZ2A 3HQNA 2L5HA 4J28A 4R34A 3W1TA 2OEJA 4AFYA 1TA3A 3GTIA 2QMJA 3RU8X 4NIRA 1XG4A 5AY7A 4HOWA 4X61A 4R9OA 2WXDM 3P93A 2IXUA 3O0KA 4B2DD 3TAKA 1CGTA 3Q4DA 4HZ7A 4IGSA 4Q22A 5BMWA 3BICA 3R2GA 1VYSX 1TZ7A 1F8IA 1R87A 3N2XA 3AS0A 3SGZA 2J24A 1ONWA 3WLJA 1JAKA 1E6SM 1Q6GA 3SY5A 5DF0A 2J8TA 3AZTA 2QLYA 2X7WA 4FNPA 3PUGA 2VZVA 1B3YA 3SCUA 4N2YA 1NFPA 2J7DA 1US0A 2D69A 1F5ZA 1LL4A 2PWUA 4L64A 2E40A 3VNIA 4UTFA 4JCLA 1XM3A 3B8WA 4J3XA 3BJSA 1KM2A 4Y9PA 2WMJA 1CENA 4PCTA 2VCBA 4PUEA 4YTSA 4P5UA 1HGYA 4NHVA 5JMUA 2PLMA 2OR2A 3EB4A 2RFGA 2XPKA 2Q8ZA 4DNHA 2WCGA 2EPMX 9XIMA 4QS5A 3GH4A 4PUMA 1J4EA 2FHCA 2OELA 2F9RA 1A0CA 2YX0A 2OX1A 5EMLA 3WFZA 5DQPA 3ZFHA 3DC8A 2I7GA 4FA3A 1JDFA 4UTHA 4O53A 3PPFA 4F2TA 1UB3A 5C2XA 3MDWA 4JTGA 3VGGA 2Y1HA 3AXHA 3PR2A 5DY3A 1XKJA 5FEPA 2VFHA 2HRWA 4QNWA 1SW3A 1GYNA 4ONVA 4ML4A 3WUEA 3KZPA 1V6VA 4JTQA 2ZZ1A 1E43A 1KLZA 4O11A 4Z1CA 1CW2A 2BY2A 1BWKA 2D2OA 3GH7A 3NL2A 1XH0A 3WF2A 4WJ8A 2XIJA 4WQ6A 2H90A 1B5TA 1X96A 1WOAA 4G5DA 3MI6A 5GNYA 1FKXA 2INEA 3MBDA 1MZHA 4PC8A 5AOUA 4DWSC 1ML1A 4HK5A 4S3JA 1TUFA 4XZIA 1AQFA 1WZKA 5BCAA 4W5ZA 3I68A 4OIFA 3I3BA 2G3JA 2VDHA 1US3A 1XRFA 4L5ZA 3BCDA 3V5OA 3ZO9A 2CCRA 2DSWA 4PBGA 3CAVA 5BMXA 1PAMA 2ZUSA 2YZRA 1X7IA 5C70A 1U83A 4TR9A 1H62A 4HHHA 1GHSA 2J79A 2XH2A 4QX4A 2QUNA 3W28A 4E2VA 5CPQA 1MEWA 4TMCA 1ZLPA 1LP6A 4OV9A 2XVGA 3WELA 3HBLA 5CZJA 1FWCC 3MJYA 3AIVA 2HEJA 4ECLA 4Z0SA 4LYQA 1NH6A 2Y5JA 4PMYA 2X1IA 1U5JA 3F5LA 2JFEX 2DZWA 1S1RA 1ZBWA 2FGBA 1SGJA 4GVFA 3FNDA 3N4AA 2VMFA 1J12A 2Z0IA 4GH3A 1IT0A 4PZVA 2VGFA 3ABOA 3GXIA 1ZL1A 4MWAB 3WQ5A 4CQAA 2BGNE 3MMTA 1PS9A 4M80A 3LPPA 1S2CA 1QNPA 4LYPA 2CBJA 3CUGA 1J5SA 2QJMA 3UG5A 3BAYA 4Q8OA 3B8DA 1D7KA 2DV0A 3PSWA 2C13A 4MKVA 3K4AA 2PRHA 4Z0JA 2DVTA 1QNOA 2F6KA 4DPQA 3P80A 4K1GA 1A49A 2BXZA 1EJ7L 2CU0A 4HZ6A 4UMAA 2ACRA 4UTUA 3M6DA 5CJ5A 3IUIA 4O0ZA 3THQA 1JZ2A 3W6LA 2TSYA 1WXYA 1QRQA 3ZLHA 2DPEA 1OT2A 3ITOA 3T0DA 1CGYA 1VYRA 1YTDA 3KP0A 1RVKA 3W1QA 4JTRA 4EACA 1MMFA 3ZWSA 2XWEA 3EKLA 3AAMA 3RX2A 1GZ1A 4LY8A 1RXOB 3WQDA 1ZBVA 1V3IA 3TTEA 4KEVA 3OG2A 3GXNA 1SO3A 4NZ5A 1R3QA 2ZZ6A 2ZRZA 1UZ1A 1BYBA 3UY7A 3T44A 4J3WA 4PRRA 4RNHA 3HQPA 3NG3A 5LGXA 2IQ0A 1TIWA 3T4WA 4A3QA 3AI0A 1RR2A 1XDMA 2WWDA 4RUBA 4ACZA 4YJ5A 4N9BA 1OVDA 4AF0B 3DBNA 3A4AA 3QSRA 1A5BA 4GYFA 2OT0A 3FHAA 1M53A 2YDAA 4RLIA 2G8ZA 1MW0A 3EYPA 3B03A 4UFIA 4C5ZA 3M4HA 5BWAA 4E4FA 3RR1A 3RO6A 1IYXA 5FAJA 4GINA 2JALA 2GK1B 4Y2WA 4NKCA 1AMYA 3BZJA 3R12A 1R3YA 1GVSA 5DRIA 3BCFA 3WJYA 3CEPA 4BI6A 1T8XA 4KPLA 3PSVA 3WQ6A 1W1VA 3SCRA 1E0XA 4Q7NA 4S3KA 1HO4A 1LT8A 3POHA 4HOXA 3S5OA 3V5CA 1BXCA 4E5TA 1ZS2A 2YIHA 3HPXA 4RZBA 2Z1WA 2VRQA 1OZQA 5JBEA 3CIXA 4BEUA 5EL1A 1DKWA 2B7PA 1C7SA 4RNIA 4LALA 4CEUC 4MYAA 5XINA 3DCPA 3EDJA 3WLQA 1KM1A 4NNCA 2Z26A 3WD4A 4JIRA 4ORMA 2CKRA 1T5AA 4DB7A 1O1HA 2REQB 5I3DA 4K7YA 3KL0A 4QJ3B 1UD6A 4AH7A 1J2WA 5D02A 2FPYA 5BYWA 2PU1A 4JL1A 3VE9A 1EWDA 3BSMA 3UCQA 1H7RA 4H9MA 1B3OA 3H7VA 4CNSA 4CGTA 4ZE4A 1XL9A 5FJIA 4QSHA 3W1RA 2I9EA 3L2IA 3CMJA 3GM8A 3EWDA 1GWJA 2CWNA 4N4PA 5C9WA 4L61A 4B9ZA 1P5BA 1MWOA 1FHLA 2P50A 3Q65A 3FHQA 3KBWA 2XSAA 1OX4B 3PBYA 1Q8JA 1V3LA 3UZJA 3SAZA 1G5AA 1ADDA 4AZGA 1ICSA 3HG5A 1J6PA 3E9AA 1HL9A 1R9ZA 4HIBA 4QIUA 3TYEA 3MT1A 5BXPA 2JGQA 3H8AA 2GWGA 5D8ZA 5LHFA 1CGXA 5BXRA 1RALA 1S3HA 4MUZA 4MAZA 1N8FA 1GW1A 4EWJA 4LEQA 3S3GA 1TPEA 3M0LA 3ATYA 5A6BD 4XUGA 5FKYA 1TMLA 1M9HA 2Z1SA 4D6IA 1YXYA 4IPJA 4I6VA 4JHOA 4X2PA 2TYSA 1R46A 3BOLA 3GXDA 3O06A 1DWFM 3STCA 4ZOCA 1GQLA 1OYAA 1Y65A 2R1NA 1AH0A 4MM1A 4DUXA 4PB4A 3I4KA 4D6EA 3GSMA 3M1ZA 3MMWA 3WF1A 2VFEA 4C91A 2J25A 4LAKA 1TV2A 1RH9A 1UW9A 1RBLA 1K8CA 2FVMA 4L4MA 3WH6A 3KW3A 3O8AA 1H7NA 5TIMA 1VRDA 4TQTA 3KS5A 3AIRA 1ZAJA 3G2GA 1RA0A 2ZRXA 3PZQA 3STEA 4JN8A 1TPWA 1VPXA 2VEMA 3WDJA 5AC8A 1E1CB 2QIIA 1IEXA 4KRUA 5DT5A 2HXUA 3QFWA 4L9ZA 2ZC8A 4GG9A 1HN1A 1E72M 2E5BA 4JTIA 4RR4A 4ZB2A 1UP0A 1G7UA 4JYEA 3VILA 1VJIA 4UXDA 1F4HA 2BY1A 2PA6A 3S5YA 3JS3A 4FXRA 4ZTXA 2DQWA 4YHEA 4F3HA 3B4UA 2VEIA 3MI3A 4C6LA 2R1KA 5FF7A 5DT7A 2VC7A 3PNZA 3CH0A 4K39A 1ITUA 4C6FA 4D72A 1ECEA 3FEMA 1MW3A 5CEWA 4E6MA 1D3GA 3M5YA 4HNVA 2QDEA 3M0ZA 3DERA 3QEZA 4J40A 4M24A 4AAJA 1B1YA 4Q4RA 4PUKA 1KBKA 1BSIA 3L66A 5E9XA 1B2YA 1V03A 4FI4A 1VPYA 3W84A 2KZHA 2CITA 4W8BA 3IJ7A 3L4YA 1R86A 4P7LA 3T9PA 3ZVHA 3EGJA 1SSGA 1FWSA 3DC0A 5FEZA 1FFRA 3WSUA 2O9TA 3VD7A 3ZJKA 3RF9A 1WXJA 3PZVA 4NXKA 3LK6A 1SO4A 4AWEA 3URBA 4F48A 1R9XA 3KCJA 4H9VA 1W3HA 5IM51 2VP8A 3H54A 4LVDA 3P60A 4S3GA 1A5MC 4LBUA 5KZMA 3NSNA 5A8OA 4XAGA 2PWVA 1L8NA 1US2A 2IMRA 3WF0A 4ZB5A 1OK6A 3WNMA 2DZSA 4Y96A 3RPDA 3ZM8A 9XIAA 4Q4KA 4GPNA 4S3CA 3P6LA 3UG3A 1Z89A 3RX3A 1UR3M 2H8ZA 4S3DA 3SCNA 5AYZA 3KX6A 2YW4A 4H9XA 1KCZA 1WP6A 2VZOA 1CX9A 1OFQA 2I56A 4EPKA 1QBAA 3R89A 2VVSA 3WD2A 1NJJA 3QHOA 4PRTA 3GIPA 3MTWA 4NJKA 1JL8A 4EPEC 3TYBA 3H4WA 4GOAA 1XLAA 3BDKA 4AU0A 4QLJA 3GXMA 1UUMA 2XWDA 2HISA 4YPJA 3AMDA 4WCJA 1HVXA 1QW7A 1TPVA 5TQLA 4C65A 4MADA 5A2BA 2WVVB 4ZENA 3VGHA 3O6AA 2OJPA 3UR5A 2ADAA 3WJZA 5LHEA 1WBHA 3NM1A 2E7FA 1FWHC 2YL9A 2Z2BA 3F1QA 4OQVA 3VCCA 4E8CA 3SY1A 4Q8PA 4CD5A 2WSQA 4HYRA 3EX3A 3WN6A 3G8RA 3OBAA 4QG8A 4H00A 2PTWA 2XIQA 1ZP4A 4KS0A 3RM4A 2WJFA 3E38A 3GVGA 1H7WA 3FY1A 2OO6A 5H6HA 3ZYZA 4M1BA 4JICA 3CQKA 1XBXA 5A6TC 4K68A 1REQB 4URIA 1F6PA 1JPMA 3SGGA 4B5SA 1V7YA 2ZXAA 2ZWYA 1E9ZB 3IJIA 1ICQA 4L56A 4EF8A 3BOFA 3BK0A 3RILA 4Y9AA 2NVDA 2WANA 3WK1A 4Z2HA 3M0HA 1FH7A 1SYTA 1FWBC 1WUEA 3U48A 1FA2A 4HA0A 5CPMA 2REQA 2WSKA 5A2AA 1LOQA 1NAL1 3G0XA 4YTTA 2IQDA 2G0WA 4GQGA 4F0KA 4S3BA 2H9AB 4ZVJA 4KFPA 1AW1A 3QY6A 3URNA 2BOFX 3GNRA 3OBEA 4GGBA 3QXBA 1EP3A 3DKJA 4DELA 4IIGA 1FVPA 1RCOB 1LCOA 1ESWA 5DXYA 2GJRA 3IEBA 5CLWA 2XIBA 4JNZA 4PBFA 3G6MA 2C3ZA 3QMSA 4UNKA 4RXFA 1V3MA 1LOLA 3DHFA 2CESA 5D33A 2QCCA 4UFJA 4UNIA 3STFA 3W74A 3H22A 3WDQA 4M6UA 4U10A 1QO2A 4RDWA 4Q7IA 4XBJA 1T6MA 5HNNA 2GDVA 1YNYA 1TE6A 4Y9NA 3TZFA 7XIMA 4PR4A 4AZ7A 2IQTA 1S1PA 1E70M 2PBGA 4RKAA 3N4FA 5I3IA 1S3TC 2WLYA 3NL6A 3FVDA 3A5FA 4LS2A 4M51A 4MDPA 1B30A 1GKQA 2ZA2A 3TN3A 4DZHA 2VVNA 4O16A 1YBQA 2PD9A 1ITXA 2HBVA 3D46A 4Z2LA 3QMRA 3URAA 5K7JA 4O18A 4O4WA 1AW2A 4DF0A 2PP3A 3R13A 1W3JA 1XYFA 3E6EA 1UR4A 4DBUA 2GVLA 4QEHA 5C7HA 3CQJA 4ZFCA 2NV1A 4UFKA 4GQ0A 1RPKA 4LAZA 2EG7A 3UXKA 4B92A 1TCDA 3UR8A 1CBGA 5FAGA 3F4CA 1MQQA 1SO6A 3CLWA 2Y7GA 1JCNA 1JXJA 1XUUA 4CN1A 2XGBA 2V38A 4XUYA 3H70A 3TJLA 1HP5A 3E0WA 3KRUA 4XO6A 1E6RA 2QGHA 3DEQA 3QQ1A 3LTPA 4G1NA 3GVVA 3ABQA 1VFHA 4CCCA 3UNTA 3O16A 5FF0A 1Q6EA 4LRTA 4S23A 4DPPA 3E0VA 1SZFA 4YWSA 5BROA 1LLZA 1Y5VA 2FMOA 3GHUA 2WZEA 3SY8A 2FJKA 4JN6A 1LWIA 4IFRA 1XISA 4XD6A 4YHGA 2EKGA 4CVUA 2ZDRA 4Q4PA 4MZYA 3RPMA 1W31A 1BPLB 2VTFA 2X1SA 5HR7A 4HT3A 3FYYA 3UETA 4GXMA 2F84A 1Q63A 1XLHA 2GOUA 5DFAA 3JR2A 3VGEA 1MSSA 5IXEA 4DWSD 3VIOA 1H7PA 4RXGA 5A95A 3VIPA 4V15A 1V6WA 1ITQA 2XVPA 3N18A 1TV7A 3GU9A 3XIMA 5AYYA 4WF7A 1HKMA 3VNZA 2A5HA 4CCDA 2EKCA 1W5OA 2Z6IA 4RNJA 1O6IA 3NQ2A 1EO7A 4GI8A 4PBEA 1HZYA 2NQ5A 3NCOA 4PFMA 2KX9A 3IARA 3BUVA 3NZPA 1X6NA 4LNYA 2PB1A 1WPCA 3BOXA 1J2BA 2OWCA 3VNMA 3C6CA 2P3EA 3BAIA 4N4QA 1SJAA 1CXLA 1J79A 4DAFA 4WK9A 1FWEC 1NQKA 4GIRA 3M43A 3INPA 1NWSA 3NQGA 3ZWTA 2C0AA 2ZUVA 4EVZA 1YEYA 1LLOA 1DOSA 1JCXA 4M19A 5F1UA 1GVIA 4FF7A 3W4RA 3SGUA 3N14A 5DMLA 3IGSA 2BASA 2CXGA 2PDXA 3PTKA 3NO5A 3ZVHB 5HQEA 1KCKA 1TVPA 5HXMA 5GNZA 2FZDA 4EIVA 6TAAA 2BFGA 3FOKA 3W7CA 1QDSA 5E1QA 4RZ5A 2QHAA 4G1KA 1FWTA 2Z2AA 3L0NA 3W70A 4QQUA 2OGJA 1XSJA 2WCAA 4P7OA 3WUGA 4JX4A 2WBGA 1YPFA 4JY9A 3I7RA 4N6FA 4MZ1A 3RR4A 2QPUA 2C15A 3UXDA 3QGVA 3AYTA 4NQ1A 1KWGA 1FP9A 2PU0A 1V08A 3MP5A 4NSBA 5JIWA 3SUSA 4NU7A 4Q33A 2MANA 1R2TA 1GZJA 2W62A 1YE4A 1ZJHA 2Q3OA 3MHFA 1HJSA 3V0UA 3M0KA 4DO5A 4KCTA 1GZGA 5DMNA 4RL3A 5CZTA 3IANA 3N2OA 4WKAA 4B4FA 1ZGDA 2B7NA 2VI0A 3SCTA 3R8RA 3NQAA 4ML9A 4XB3A 3BSGA 2NXIA 1P4CA 3QFEA 2DFAA 4FZIA 3W1LA 2BG5A 2CLMA 3G1VA 2QUUA 2VEPA 2PURA 2DW7A 9CGTA 4DJEA 2J27A 4B5XA 3VOFA 4XVDA 2FDSA 2GGIA 1BWVA 4FNTA 4N0RA 2QXWA 3MUIA 1UWAA 3CUFA 3CPGA 2Z1VA 1AMKA 4JPGA 1E9LA 2PP1A 1TV5A 1DIOA 3OLGA 1LBLA 5DCBA 4PTDA 4MFEA 5H1WA 1OT1A 1ONRA 2PF0A 3NVDA 4S2CA 3TR2A 1EEXA 3R11A 4ZQCA 7PTDA 1OX4A 2TPSA 4H8UA 1N82A 1U22A 1UIOA 2IPGA 2DORA 5F1VA 1VYPX 1P43A 3GTHA 4S3AA 3EDDA 4D6HA 3NSMA 5E0KA 3RUBL 2Y89A 1S5WA 4YL2A 5CC6A 3OB8A 3VD5A 4B3KA 3CUHA 2FZ8A 2BODX 5AKQA 5FCZA 2C1HA 4QITA 1MO0A 3C56A 1Z32X 2GSEA 4X0NA 3CH9A 2RGLA 4FLOA 5IDIA 1B4KA 4GXPA 2FTYA 2PD5A 1UJQA 2UBPC 1UPPA 3E96A 4ZQMA 1Y7VA 5BXTA 2PAJA 2CZDA 4JKKA 4D6DA 3LPGA 1OD8A 1S2UA 2AGTA 3FW6A 4ZQPA 4FMVA 3VDBA 4PULA 3CZ8A 3HV8A 1XLIA 4KFNA 4LNCA 1NDYA 2BBFA 3MVIA 3G77A 2FH6A 1HUVA 3OZYA 3MP4A 4R3UA 4TX8A 1PZ1A 2ON3A 4JTEA 3EB2A 1PVNA 2E28A 3PBGA 4HK6A 5K4ZA 2YLAA 4JQAA 3APYA 4Q8VA 4PUUA 2PRLA 4B9YA 1XSIA 3UVIA 2PSNA 2GZXA 1TREA 4HKPA 2E6YA 2VO5A 1J8VA 2YL5A 4MOZA 2J7FA 1OFPA 4UOZA 4ES4A 2JE8A 4FEZA 3LERA 1UZ4A 1GYMA 3EMCA 3W3OA 3W75A 1YDYA 3PZNA 3QYQA 3USBA 1PZ0A 5LSMA 2DT0A 4ICMA 4O13A 4GY1A 5AFDA 1Q4NX 5F2LA 4YS1A 3RCNA 3NOYA 4WHBA 1KRCC 2C14A 3FVMA 3C0JA 4UQ9A 4TUFA 4Q4QA 3TAOA 3FK4A 1DPMA 3R58A 1K77A 5BOOA 5LA0A 5K3VA 1MDRA 2HWGA 2I5IA 2ISWA 1CPUA 2PFHA 1CDGA 2C1IA 4YYCA 4X3ZA 1WZAA 1AODA 4H41A 1HJQA 2R94A 3BARA 3HMCA 4ZOEA 3P62A 3W2NA 4GO8A 1AQHA 3UZZA 3K5XA 2ZRWA 1HKWA 1QNQA 1N7KA 2YGYA 4ATWA 4FX6M 4ZXOA 1RHCA 2XH7A 4XK2A 5FESA 3BLIA 3SCPA 3PFRA 3TOYA 3EX4A 3U7BA 1E9IA 1Q6RA 3F4VA 1M6JA 1ZHAA 1HG3A 3DFHA 1O7AA 3LGEA 4OVXA 1PZ3A 5I00A 1WAUA 4X63A 7CGTA 3NL3A 1EPXA 4KESA 1MFUA 3IIPA 1JI2A 3ZIZA 2FMNA 2AQOA 5H8UA 4GXWA 3K2GA 1KFWA 2HE8A 1NVMA 2XVNA 3KAOA 3NVTA 3UA3A 3KCLA 2W6RA 1UC4A 2RDTA 4W8LA 3S1XA 2Y8VA 3BV4A 2VX5A 4AHPA 3CL8A 4UTTC 4IIBA 1NWTA 1ZY9A 1NELA 5CPNA 4P8UA 1DIKA 4UNLA 4UQAA 3GVWA 2YKKA 4E2BA 1KD0A 3QPEA 4JTHA 1UR1A 5CSRA 1PIGA 3TW7A 3QLDA 2EF9A 1VLWA 2A6NA 3NPWA 3QF0A 3EB3A 4U3AA 1D3HA 4MFDA 4AIBA 3R0KA 4MHBA 1EC9A 1YYAA 4D71A 1JCTA 2J6VA 5IDZA 5CC7A 4C6QA 3D3FA 3LPOA 1DBTA 3CHCA 3F5KA 4EXAA 1OX6A 2PUZA 4TO8A 4IPIA 1EFZA 1A3WA 2CLFA 2OVLA 3GAKA 2J13A 3FXGA 5HA7A 2J8GA 1H63A 2E1WA 3S2MA 3RRXA 3MB9A 3EDKA 3WBXA 1WDRA 2NVCA 1TZ9A 5FACA 1HO1A 4W7UA 3W6YA 4EP8C 2ZX6A 1LZOA 4LYKA 3AJ7A 2GJXA 4B4HA 4DZ5A 3KCOA 3CXOA 3ERPA 4AD0A 1O5RA 1ODZA 3E1F1 1UD5A 1A5LC 4WIWA 4XAYA 2Q3RA 4DHGA 4GWEA 2DSVA 4F0MA 3WQCA 3SSJA 3WLNA 2VGIA 1W8SA 5D2TA 1HIZA 1DXEA 1OGSA 1F3XA 4S3FA 1EBHA 3CYVA 5IRPA 1QOXA 1A80A 3BGJA 4KW2A 1E4MM 2DZBA 4NP7A 1NU5A 4DO7A 3TA9A 5HJLA 3P84A 1KM0A 2HNHA 3RM8A 4MF4A 1GT8A 4F9JA 1DIEA 3UXLA 1MQRA 3NZGA 5CBIA 3WK2A 3EOUA 4CD6A 4ADTA 4IUGA 4J3SA 2GVGA 1A5CA 3F7JA 4G2DA 4NY2A 3W0KA 1GYLA 4GY0A 3MI2A 1UQYA 3IIOA 1M3UA 4CEXC 3GG8A 3UZXA 2W61A 5DBTA 4EAMA 5IBXA 4XISA 3LCXA 4PTVA 3Q94A 1HVQA 4AVOA 5KTLA 2EBNA 3DGBA 1OINA 3S2NA 1C93A 3EMQA 1KR1A 3V0TA 1ZUAX 1IWAA 1AQMA 1UH2A 3NTYA 1RP9A 1T8QA 2QDGA 2BNJA 3C8FA 1Q7MA 4R7JA 2J77A 1BG9A 1NP2A 3FA4A 3G18A 3F2DA 4W7VA 1SU5A 1UJPA 4AIOA 3WMLA 3MV01 3A24A 3TVAA 1XIMA 4JFVA 2FGLA 4FOUA 3BE7A 4JTCA 4ZOBA 3PHAA 4O15A 5REQB 2JEPA 5MHBA 1UA7A 3QC0A 1MXGA 2DZTA 1W2PA 2YXGA 2WVVA 4LTSA 3I6EA 1SJCA 4GZJA 2PDFA 3L4TA 4EWND 2ZOXA 4IPLA 2E3ZA 3BAXA 3M44A 3OP2A 4W8AA 3AWNA 3IV8A 3TROA 2NX3A 4AW7A 2VZSA 2WHMA 3R8HA 3AROA 1M7PA 2CERA 2HS8A 4J3TA 3GQYA 5LNUA 3WQVA 3AO0A 4F4RA 3JW7A 2VC5A 1R7AA 2R1LA 2XN1A 1Z44A 4MIMA 3W2JA 3TN4A 2JIWA 2QCEA 2IPFA 2VKZG 2FKPA 2IKHA 3DHDA 3G1RA 1PL9A 4YVPA 4FR6A 3LEPA 3PAJA 3LTSA 1IXQA 1Y5XA 1EDGA 3TC6A 3W26A 3WKZA 1CYGA 4L9XA 3AMKA 3ZXWA 1XLEA 4FS9A 4FB7A 2GGJA 4LVGA 3OPSA 5DO8A 1GHRA 3LMYA 1XLDA 4O1BA 4C1LA 4I3GA 3RNDA 4X9YA 3PZIA 1XRTA 3V3WA 3LRLA 2E67A 3PBVA 5A8GA 3B0PA 1A5KC 1EEPA 4XBKA 1WAWA 2FB3A 1XUZA 4EX4A 1ZP3A 2BWGA 1SVDA 3L5LA 5RUBA 5JBFA 2ACUA 1LUCB 5AC4A 4LB3A 1XLBA 2WAGA 4D8ZA 1JZ6A 3NZRA 1AUSL 1ISZA 4JL2A 2V3EA 2WKJA 2Y4SA 2YB1A 4I5UA 3N2MA 4JNYA 1TWDA 3NUKA 3UWUA 3G3MA 4GHRA 4Q7BA 3ITGA 3NNTA 4IQDA 2A3CA 3TONA 1TQXA 3N4EA 4MWAC 4E4UA 3AHTA 4GIEA 4BQ3A 4QSFA 2G3MA 3KRBA 3TWAA 2V2DA 1Z42A 2WO5A 3THCA 3CIVA 4CQ9A 2YBVA 3UESA 1A0DA 4GIAA 1OJXA 3BG9A 3KP1A 2YCJA 3B0XA 3GG1A 1Y8BA 2NLIA 4KERA 1E6PA 1XW8A 2CLIA 4GJIA 3JVAA 4OHQA 2FZ9A 3UA4A 3B8TA 3A4JA 3DU0A 1U1UA 5BZAA 3RCMA 5EMYA 4KWOA 4AG0A 4N9CA 1JEZA 1WDSA 1CLXA 4I7WA 1OX5A 1UKQA 1XBZA 4DNMA 4M56A 4Q6JA 4A21A 3PF3A 3SI9A 1GOMA 1FCBA 1Z6KA 2NZLA 3ITTA 3VC5A 5DBUA 1K6AA 1XYZA 3NQ8A 5CPTA 3W22A 1AH3A 1ZJBA 3AIQA 1RSCA 1O68A 3N34A 5C55A 2BV9A 3MC5A 4W7WA 3PZ9A 4DI9A 4KGLA 4AC1X 3Q58A 3P82A 1E4NA 2ZBTA 1E0UA 1JAEA 2A3BA 1XINA 1A5SA 3EWBX 4XVEA 1IEIA 2Y70A 3ARWA 4YVXA 3O63A 7A3HA 4GKTA 5HUOA 2O92A 1NOUA 2DZAA 1VIWA 3VO0A 7TIMA 2HVMA 1ME7A 3KEHA 5FD0A 3ARXA 4PTMA 4DYJA 3ZR5A 3SJ3A 4GZ7A 2WZMA 4QISA 4IHCA 4H9TA 3QQWA 4UOQA 1XD0A 2WKLA 1DTUA 3QN3A 2B0MA 4I5RA 3WO8A 3M0XA 3OYXA 1PJ9A 4P61A 2ZA3A 3G24A 3NIYA 5F2IA 3DXIA 1FWGC 4GK8A 3VDHA 3OGSA 4AIEA 4LS1A 1H7OA 1EZWA 3NYZA 2YPIA 3W7IA 1EZ2A 3MWCA 3WMSA 1KKOA 3WZ0E 3AMLA 3LDVA 3UJRA 4J3VA 1XV8A 3R5EA 4QQ3A 3WLOA 4JKMA 3EPOA 4FIQA 2B4GA 4H8HA 3LSBA 5GVJA 5DXXA 4LXFA 2VOTA 3LUTA 2A1YA 4KIEA 5E5CA 3VNJA 4XZWA 3MYOA 1ITCA 4C6NA 2CLLA 1CGWA 1UIPA 5DRCA 2X41A 2IKIA 4C1NA 3HG2A 4MY1A 4HU3A 3WJWA 2C91A 1EYWA 3VNDA 3JRKA 3OW1A 3H2OA 4BS0A 3UPWA 2WHKA 5G1MA 3GDBA 4BF9A 2GUYA 5I3HA 1KGUA 4WOQA 4DBEA 3E49A 4GJJA 3B0YA 1TPFA 4H6KA 3NPVA 3HGSA 3FJ4A 4GIYA 3FGCA 5DELA 1H1ZA 2PDUA 2X0HA 4MNMA 2PS2A 3DGRA 4Q8NA 4PCSA 2XINA 3QH2A 1DQWA 1O12A 2A21A 3P3BA 4DJDD 3IV3A 3OJGA 4JIIX 1P7TA 1REQA 2OXNA 4L4PA 2Z2UA 2BS9A 3H55A 3TJ4A 3BV7A 4Q6XA 1PIFA 8RUCA 3O07A 4FSAA 4RPQA 4JQ4A 5A6MA 2WSYA 3T40A 4QROA 5I7GA 3WEZA 4P7RA 4G7EA 4LYRA 1UKOA 4KF1A 3RCYA 3T7VA 3PAOA 1T40A 4CU7A 3CHDA 4ALDA 1KTCA 2BSLA 4G6CA 4U4MA 2E6FA 4FXJA 4HN4A 1H0IA 4XAPA 3UYIA 1OEPA 1M04A 5I6SA 1V3HA 4G9PA 2XFRA 1KFJA 1YE6A 2W67A 4AZHA 1MUWA 4I90A 3AMCA 3WJSA 1IWBA 3H23A 3AHXA 3WLTA 2C18A 1UYQA 5EY5A 5CGTA 1GW9A 1X1NA 2WVTA 3PJUA 2VRKA 2XDFA 4GBUA 2W3ZA 3MY9A 1P7TB 4HHLA 3W7NA 4E4PA 2Y62A 3IVSA 4MLJA 2V2CA 4C90A 3EA2A 2GQ8A 3W85A 1MXDA 1HNYA 3IVUA 1C3FA 1YKWA 1R3TA 3GD6A 1ELSA 3VABA 1X38A 2NQHA 3N9SA 1PE1A 2OCZA 1MDLA 2WSRA 1TPUA 3WIJA 4M29A 3NA8A 3FSTA 4JTUA 3H7UA 2GQ9A 1PYMA 2ATSA 3U57A 3DYMA 4JXCA 4L6DA 4NAFA 3SN4A 3OGRA 4Q8TA 3W88A 2C19A 2ZDSA 3B97A 2IS7A 3OZMA 3JZUA 1LTDA 1W3NA 4LAMA 1CXHA 1P6BA 1UKPA 1B3ZA 5J8LA 4OE7A 1Q7ZA 4D1JA 4PCFA 3VUPA 4JHZA 2JKPA 2ZX9A 3ATZA 2CNCA 1BD0A 1DJGA 4REQA 3BLDA 1NY1A 3CHFA 3W1PA 2PCEA 3WENA 4B3ZA 1WBJA 3K1GA 1IT7A 5DMMA 2VCAA 4AWSA 3GG0A