1YIXA

Crystal structure of ycfh, tatd homolog from escherichia coli k12, at 1.9 a resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
265
structure length
265
Chain Sequence
b'MFLVDSHCHLDGLDYESLHKDVDDVLAKAAARDVKFCLAVATTLPSYLHMRDLVGERDNVVFSCGVHPLNQNDPYDVEDLRRLAAEEGVVALGETGLDYYYTPETKVRQQESFIHHIQIGRELNKPVIVHTRDARADTLAILREEKVTDCGGVLHCFTEDRETAGKLLDLGFYISFSGIVTFRNAEQLRDAARYVPLDRLLVETDSPYLAPVPHRGKENQPAMVRDVAEYMAVLKGVAVEELAQVTTDNFARLFHIDASRLQSIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords deoxyribonuclease ycfH
publication title Crystal structure of ycfH, tatD homolog from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 100
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 3.1.21.-:
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01026 TatD_DNase TatD related DNase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1yixA00
2WJEA 1YRRA 1EZ2A 3WYZA 3IPWA 1IE7C 4DI8A 2GWNA 4WVXA 1EJWC 2FFIA 2PAJA 2P50A 3HTWA 5A6TC 1UMLA 3E3HA 4B92A 3BE7A 1FWHC 3QGKC 3IARA 3S2MA 2E1WA 4DNMA 3CJPA 4IFKB 3MPGA 4QTGA 1E9ZB 3ID7A 2EG8A 4GY1A 4LAMA 4BY3A 3B0XA 4IFOA 1FWJC 1R9ZA 2R1PA 3CAKA 4UBPC 1O5RA 5LXXA 1EJUC 1K70A 1NFGA 2OQLA 3QY8A 4GY7A 3URQA 1A5NC 4C6KA 3KM8A 4QRNA 4Z42C 4ZSUA 2Z00A 3S2LA 2ICSA 4LEFA 2Q01A 3A3WA 3AU6A 2YB1A 4KEVA 4CNSA 1UIPA 4XD3A 4IFRA 1YBQB 4DI9A 2GOKA 2R1KA 4DIAA 5HMDA 1YMYA 1A4LA 3UPMA 4F0LA 4LCQA 4XAFA 4ERGA 4WHBA 1RK6A 4OFCA 3PNZA 4H00A 3DC8A 4NI8A 1M65A 3TN4A 2Z28A 1A5KC 3OU8A 4I6VA 3URAA 4QSFA 3RYSA 2XIOA 5CH9A 2HBXA 4NG3A 2R1MA 1UBPC 2BB0A 3F4DA 3GRIA 3NEHA 4CNUA 4LANA 4GX8A 2R1NA 2Z4GA 3LGGA 3O7UA 1P6BA 4TQTA 4GYFA 4XAGA 1JGMA 4RDZA 4XAYA 4C6NA 1POKA 2YZ5A 2VC5A 3CS2A 3GTXA 3UBPC 4CQCA 2VUNA 2WJFA 2F6KA 1K1DA 4C6OA 1ZZMA 4C6LA 3HPAA 3GIPA 3MDUA 4ICMA 1QW7A 2VM8A 3K5XA 4EP8C 3GTHA 1GKRA 3FDKA 1KRCC 3TN3A 3GU1A 4LCSA 1RK5A 3TN6A 3A3XA 4C5ZA 1PSCA 4GC3A 1I0BA 2CZVA 1XGEA 3B0YA 4HK6A 2FVKA 1XRTA 3ISIX 1E9YB 1V51A 2ANUA 3D6NA 3E38A 2WM1A 4V1YA 4B90A 1WXYA 4B91A 4ZSTA 1RA5A 4HJWA 1BF6A 4IG2B 2UZ9A 3LSBA 4BJHA 2FTWA 3GIQA 3EWCA 4LALA 4V1XA 2P53A 4CEUC 2Z29A 4HA0A 3PBMA 4E3TA 4XD6A 4XAZA 3WZ0E 4CEXC 2O4QA 4C6PA 4GY0A 4JOMA 3PAOA 4XD5A 3UR5A 4C65A 4LCRA 2OGJA 2I9UA 1PO9A 3RCMA 1KRMA 2I5GA 2YXOA 3IACA 3PANA 4CNTA 4UB9A 3E74A 2Z2BA 2FVMA 3DCPA 1J6OA 1YIXA 2Z2AA 4B3ZA 4IGNA 4KEUA 3OQEA 2Z24A 3RHGA 2Z26A 1NDVA 4R88A 3R0DA 4PCNA 5G4HC 4F0SA 4GZ7A 4QS5A 3FEQA 5HMFA 2Y1HA 1NDZA 3TN5A 3RN6A 3T1GA 1NDWA 3WMLA 2AQOA 4CQBA 5HMEA 4CQDA 4IH3A 1EJXC 2W9MA 4HK5A 2QVNA 1FKXA 2DVTA 4R7WA 4DLMA 4M51A 1K6WA 3GTIA 3GU2A 3O0FA 1WXZA 3E0LA 1VFLA 1P6CA 3E0FA 3UR2A 4F0RA 2FTYA 4PCPA 3ITCA 2QPXA 4GX9A 3S2JA 4KF1A 3MKVA 2Z27A 4RDVA 4C6QA 3F2DA 2O4MA 4KEZA 4GK8A 4INFA 4QROA 1A5LC 3T81A 3NQBA 2HQAA 1ITQA 4LFYA 1FWEC 3T8LA 4QS6A 1FWCC 3GU9A 3LSCA 3C86A 3V7PA 4L6DA 1FWBC 1I0DA 4EPEC 3GUWA 3LS9A 1FKWA 1GKQA 2D2HA 3MDWA 3GTFA 1PTAA 4GOAA 4EPDC 2OB3A 4H9VA 4C60A 4RZBA 1V4YA 4C6BA 1RAKA 1W1IE 1RJQA 3LU2A 1YNYA 3SFWA 3NURA 4DYKA 1FWFC 1KRAC 3N2CA 2GZXA 4RDWA 2HPIA 2KAUC 3IV8A 3AUOA 2HNHA 2AQVA 1KCXA 1ONWA 1XRFA 4EPKA 4PBEA 4DO7A 1P1MA 3K4WA 4H9ZA 2WJDA 1A5MC 3IJ6A 2GWGA 1KRBC 3OOQA 1XWYA 2G3FA 3IGHX 3OODA 4H9UA 3F2CA 1POJA 1PB0A 1A4MA 3IRSA 4IGMA 3FDGA 4LH8A 5E5CA 2PUZA 3MSRA 3HM7A 4HK7A 3F2BA 5AKQA 1EJSC 3EWDA 1A5OC 1ITUA 1FWGC 3DUGA 4J2MA 4IQJA 3B40A 1O12A 1R9YA 2BGNE 1M68A 1EF2A 2EG7A 3LNPA 1S3TC 2QS8A 3OJGA 1EJVC 4KIRA 1NDYA 3QGAC 3UF9A 4GBDA 3MVIA 1HZYA 1UIOA 1RJRA 4EPBC 2Z25A 1FWDC 4ERAA 1M7JA 2ADAA 4RE0A 1GKPA 2DVXA 1FWAC 2YB4A 4LAOA 1YBQA 4MUPA 4R85A 3URNA 4DLFA 3JZEA 4NP7A 1V7AA 2HBVA 4KESA 2EG6A 4PBFA 1J5SA 2VR2A 4J35A 3URBA 2Q09A 2PGRA 4D8LA 2IMRA 4IF2A 3ORWA 3OVGA 4KERA 4XD4A 4BKNA 2OOFA 3AU2A 4C6FA 2Z7GA 3ICJA 1EJRC 4G7EA 2DVUA 4ERIA 4H9YA 3S4TA 1EYWA 1RA0A 4C6IA 2PLMA 2AMXA 1V77A 3E2VA 1V79A 1J79A 4DZIA 4DZHA 2GSEA 2R1LA 2A3LA 4C6CA 3S2NA 3GG7A 1QXLA 4C6DA 4PE8A 3SO7A 4C5YA 2QT3A 4AC7C 1RJPA 4J5NA 3MVTA 2UBPC 4GXWA 1FWIC 4P5UA 4G7EB 2D2JA 3K2GA 2HPMA 1EJTC 4KETA 4H01A 3QY7A 3LGDA 1ADDA 3QY6A 3G77A 4L9XA 4H9MA 1ONXA 3TNBA 4LAKA 5FSEC 3MTWA 4KQNA 2VHLA 4AQLA 4C6JA 3PNUA 3F4CA 1R9XA 1DPMA 2PGFA 2E25A 3A4JA 4WGXA 4C6EA 4H9TA 2OODA 2RAGA 2ZC1A 4IG2A 3LA4A 4H9XA 3LY0A 3MJMA 4RDYA 4I6KA 2VC7A 4G2DA 4C6MA 2D2GA 1J6PA 5FSDC 4YIWA 4IFKA 3EGJA
chains in the Genus database with same CATH superfamily
2X7VA 3WY1A 3G1AA 2ZADA 1IE7C 3A5FA 1KQZA 1L8NA 1A5CA 2FFIA 3EB3A 3CPUA 4F40A 1UHVA 3UCQA 4GACA 5CZTA 3V1PA 3W82A 4NJGA 1C9WA 1EYEA 3FYOA 4OOUA 1S5WA 1V3HA 3WBEA 2WVVA 3CT2A 2ZXBA 4LBRA 3G3MA 2XVLA 5C55A 3TJXA 1EXBA 2Y2WA 3D47A 4DWSB 3CAKA 1O5RA 3WQCA 5D33A 4O50A 2VFHA 3AHZA 3F4VA 2OWCA 4Z42C 2AKZA 2ICSA 1G4EA 2ZOXA 1OCQA 4CNSA 3UNTA 4PULA 2ON3A 1H7RA 4DIAA 2VX5A 4FLQA 4N42A 1DWGM 3ZO9A 3ERPA 3SRFA 3RF9A 3R89A 2YL6A 1VBHA 3TN4A 2VOMA 5H2ZA 4JTEA 3TW7A 1DXFA 4C1LA 3VTRA 3QM3A 4QSFA 3RYSA 1FHLA 1E9IA 3VE9A 7PTDA 5A2AA 3SY8A 4OHQA 1O66A 1H0GA 1NP2A 2CHNA 3THAA 2OSXA 2VX4A 1Z7AA 2A3BA 3TR9A 1XYZA 2H8XA 1H7WA 4C6NA 4DBWA 1VYRA 4GPNA 1ME9A 1ZS2A 2FZNA 3EOOA 1TPVA 1ZZMA 1TQJA 2PD5A 2OWWA 1TR1A 1D8WA 4YTRA 4QE1A 1VAHA 3GU1A 4KGJA 4Q4OA 1BTMA 1I2QA 1PSCA 3WENA 1LLOA 4S3CA 1JPDX 2AMGA 3B0YA 3U7VA 3TQ0A 1IEIA 1QI5A 2PLCA 4XO7A 4B91A 2FH8A 4PH6A 3O3RA 3WLMA 1NU5A 1Q65A 2A4AA 3S5SA 4LU0A 1XSIA 3QV9A 2Q02A 2YXXA 4BFAA 3WK2A 1JFHA 4DM1A 5DF0A 2DIEA 4CEXC 1OF8A 2DZTA 5D8ZA 4JOMA 4P8VA 3PAOA 4N4PA 2BXVA 2QCDA 4QJ3B 5E0KA 1E4NA 3E96A 3MUCA 4WSKA 3TCSA 1M7OA 1PO9A 2I9UA 2Q71A 1KA9F 1E4LA 3CU2A 3GE7A 1CDGA 2JFEX 1BTCA 1J6OA 2CBIA 2YPIA 4MG4A 1GUVA 3KLKA 4FXSA 3MV01 3CQJA 4IP4A 3P93A 3M0HA 1JDAA 3A9IA 1EUNA 1JQXA 4GZ7A 2IPJA 4GVFA 1MVYA 2WV8A 4ZMGA 3T1GA 1Q3NA 1TQXA 3W87A 3OBKA 4CQBA 1B57A 2HRWA 2PDIA 3O9NA 5HMEA 1KWKA 1TELA 1OGBA 3AFBA 4JTGA 3ZR6A 5A6LA 2QJJA 1JZ7A 2VUYA 4R7WA 3O0FA 3E0FA 1S2TA 2GVYA 2ZRUA 5AYYA 2Z0IA 3RM8A 3BAWA 5C2XA 2PB1A 3VKCA 3TAOA 5BXTA 1TREA 1J8VA 4D6DA 1RH9A 3QR0A 1G6CA 5A6KA 4AZHA 3DFNA 4NKCA 4BI7A 1GKQA 1DJXA 1E6SM 5E93A 1I60A 2NQJA 2BOEX 4E8CA 3F7JA 4XIAA 1R47A 3C0QA 5LNRA 4RDWA 2DT3A 2XG9A 3GNPA 3NSNA 5E0CA 4C1NA 1TPWA 2VWSA 5LA0A 2WWDA 2J24A 3WQ8A 5CLWA 5D9MA 1P1MA 3T0DA 2W91A 5FL0A 3QKEA 3EWZA 1XWYA 1F76A 3FA3A 2E1DA 3PB2A 1CB7B 1UUMA 3FDGA 4GISA 4BCEA 3VGHA 2DZAA 2C13A 5CZJA 5AKQA 3CZKA 1TV7A 3LHYA 4HN8A 4TV6A 2EG7A 3KLLA 1LBFA 4M5PA 3PUEA 1NDYA 2C0AA 1LUCA 3UF9A 4ACZB 2C3ZA 3W24A 2EPMX 5M5DA 2P3EA 1JJKA 1WKYA 5HBFA 3EB4A 4HZ6A 4AXKA 1Q6LA 4H6EA 1CIUA 4GKLA 2VZOA 4QHRA 2ONEA 1VBRA 2DVXA 3NL3A 4LAOA 4IISA 2NVDA 2HVMA 1OYBA 2GDVA 3CLWA 4NP7A 1OT2A 3EMQA 3VM7A 2HBVA 3NQ8A 5ABFA 4YNGA 5I07A 4IUOA 1QFEA 4PBFA 3VKDA 3ORWA 1Z48A 5LIKX 1H1ZA 4GYPC 4JEJA 1TJ2A 4L56A 3GFZA 4C6FA 3QOMA 3NXFA 3L4XA 3NQ2A 3VIHA 4CQAA 1JYWA 3W7RA 1IT8A 1DOSA 1KFWA 1OFBA 1DWFM 2QEZA 4RUBA 4MHBA 2PDHA 1TZ9A 2OYKA 2BHUA 3STGA 3EZ4A 4BF9A 4GUGA 3SUUA 4RNIA 2JK2A 1DVJA 1ZJBA 4NZJA 1QO5A 5TBOA 5KETA 4XZIA 3M5VA 1KNWA 1SW7A 3DHFA 2G8ZA 3V0TA 3G77A 3PTDA 4RE3A 1PHWA 2TMDA 2CW6A 2O56A 1QASA 3UY7A 1FRBA 1EP1A 1MUMA 5K4XA 4EWND 1HN1A 1R9XA 3E6EA 3EEZA 4Z0SA 3ZT7A 1C9DA 2INEA 4LVGA 4Q8UA 4HJFA 3W27A 3S5ZA 3VDCA 3SGZA 3L67A 3V0UA 1BF2A 1SPQA 4LAUA 2W92A 1E0UA 1DKWA 2DH3A 4ZEPA 4AAJA 3CTTA 3GAYA 1EZ2A 3WYZA 3IPWA 4A3RA 4AD1A 4GJIA 2YLAA 4JTTA 3KVMA 4BQ4A 4JN8A 1JDFA 4CN6A 2XIQA 3UJSA 3BE7A 5C9XA 4TX9A 4AMAA 2HCVA 1P7TA 1GW9A 4IFKB 5JBEA 4PFHA 3WQGA 4QJ5B 4E4PA 2WWCA 2R94A 3V3WA 5C7HA 2CZDA 1JD9A 4IXHA 4MDPA 1R86A 2V3GA 3A4XA 4N4QA 2YL8A 4GQGA 3VXGA 1Z6KA 2A3AA 3SEPA 2BP1A 4CCDA 1JG9A 1GVQA 1O5XA 1V6XA 3CZ8A 4KEVA 1HKIA 1J0IA 3WQDA 2REQA 1Q66A 4OV4A 4DI9A 1WBHA 1OFEA 4X3ZA 3WQ4A 1P0EA 2OR2A 2X1RA 4PCSA 3KP1A 4GFIA 1FBAA 2ZICA 3VIOA 5M17A 2QCLA 5FCZA 3URAA 2FHBA 3BLDA 1F4AA 3NQ6A 2R1MA 3IGUA 1KLZA 2X0SA 4HPGA 5CG7A 2NSXA 1KM3A 1DXIA 3S6DA 1KM6A 2P5NA 1EGVA 2VC5A 5ABTA 2VEMA 1HKVA 3TZNA 4GVIA 5F2IA 1SU5A 4DN1A 4S3FA 2PU1A 4Y2WA 1S2CA 3M41A 1SM9A 4GE8A 3WH6A 3C61A 4WKAA 4AHOA 1W1YA 1F3TA 3TKFA 3VOIA 2WLYA 1WOBA 1FFQA 1L6WA 4PCTA 5BNKA 2OLSA 2VEIA 1JAKA 2QIWA 2V30A 1QPOA 3II1A 3STFA 1K9TA 5I0DA 4YXGA 3QLLA 4I3GA 4TX8A 3T78A 2X0YA 2YZRA 3BZGA 3QPZA 3B8TA 1FHDA 3GKAA 4XAZA 2VCCA 1YADA 3AROA 4BF5A 3KVJA 4FXRA 1BWKA 1N8IA 3AYVA 3QHOA 3B4UA 3AMLA 3PBGA 2HK1A 1DWHM 2I5GA 2FPTA 5EU9A 3VX1A 3ZT5A 2WC3A 3GR8A 1XW8A 4JKMA 1OFAA 1Y5WA 4GGHA 4MF4A 1PJ9A 4QEHA 1KLYA 5G4HC 4HT3A 3ZT6A 4ZR8A 1V5XA 4S3GA 4XVDA 4WKFA 1YDVA 3MWCA 1PIGA 2AQOA 4O13A 2NZLA 1BXNA 4CQDA 2ZZ1A 1B3YA 4Q8QA 4PUMA 1WXZA 3QN3A 1TJ1A 3IIVA 4MFEA 4UC5A 1EA0A 2V2CA 1BG4A 3TYZA 3W1XA 1XYMA 3PS7A 1VFOA 3M9YA 1H5YA 4LFYA 2WVSA 1MW1A 3P3BA 4DJFD 4HU8A 2XWEA 3EWWA 4MPKA 5CSSA 3NQ7A 3A21A 4OTKA 2A6NA 4WK9A 1CYGA 1GPFA 1C8YA 3KHJA 5K9CA 4BF7A 1KBIA 3CQIA 1X7FA 3NURA 2OYLA 1O94A 3O2LA 1HKMA 2GZXA 4PMUA 2HPIA 2AQWA 3P14A 1G69A 4Z2KA 3C2FA 1RCOB 4E38A 1JRCA 3BLEA 1ODZA 4H7VA 3LLFA 3VILA 4HNOA 3PAJA 3NL5A 3E12A 3ABOA 4WDTA 2I16A 1TV2A 1U83A 3BJSA 3AMCA 5D2WA 4Y96A 1JXJA 3MSRA 3S9ZA 2CC0A 3A5VA 4N7QA 1CLKA 2E9LA 5FIPA 1H3GA 1E5JA 1S3TC 1WUFA 2I5IA 2YDQA 3GFYA 4Q3MA 3OVRA 3W00A 4DB7A 5KEZA 2Y4SA 3QGAC 2DFAA 3A4WA 2GYIA 4IPJA 3W75A 3P0WA 1GEQA 2CWXA 1V7YA 1REQB 2WZIA 4JY8A 2Y8UA 3P8JA 4D6HA 2WNZA 3CH0A 3UT0A 4CNNA 2PGRA 3GFXA 1UC5A 4CKQA 2HS8A 4KERA 2OOFA 3OW1A 4GMEA 3U57A 3GDLA 3BC9A 1UR9A 3AO0A 3W7GA 3ZVHB 3E2VA 4PCFA 3FVDA 1QNVA 1V6UA 4C6CA 1ISWA 3P6LA 3PBYA 1HKJA 1XBYA 1JCNA 3SO7A 1YDOA 3VVGA 2JKAA 4P7LA 1XFBA 1LBMA 1BVWA 3QY7A 1WDQA 4P2VA 3EB2A 4I9TA 3NPWA 4YPJA 3WLPA 3VKJA 5D8WA 3LMYA 3EMZA 4UQAA 4ZB2A 1GJUA 2ACUA 2Y89A 2ALDA 3UWYA 2V5KA 3SUWA 2XH2A 1OK4A 2VO5A 4DF1A 2OOGA 2VTFA 4I6KA 3QSRA 2J66A 1KTCA 2OFJA 4MOZA 3EPNA 4M1RA 3UVIA 4X0NA 3NOYA 1EHNA 3BLLA 3T81A 1KFEA 1ONRA 4K8GA 4DUXA 3VMOA 3DECA 1U1HA 5FL1A 1BQCA 3P80A 2ZX6A 5FA5A 1ZBKA 2H3BA 5HUOA 3TA9A 1UR0A 1CEOA 1R87A 5DT5A 1E73M 3LOTA 1O4UA 4DNMA 2BODX 5A6SA 3GR4A 5CC7A 2J4GA 4PODA 4IQDA 1XIIA 3CYJA 4HMCA 3GKFA 1W8GA 4IMGA 3B97A 2D24A 4GCXA 4JFTA 5J5DA 1BWLA 3W37A 1AW2A 4ZSUA 3A47A 4IMFA 2OZTA 1PAMA 3SI9A 1FWWA 1Y8BA 4PUDA 3R6IA 2D0GA 4M6VA 1A4LA 2YJQA 3PZIA 4LCQA 4WIWA 3STPA 3U4AA 1RK6A 4QGCA 2WK2A 3CUXA 3P5YA 4O14A 1SO4A 1B3OA 4UNLA 2OWXA 1QK0A 3DERA 3HMCA 5HA7A 4NG3A 1VS1A 1GW1A 1E0WA 4LANA 1VYSX 5A2CA 1UH3A 1RPXA 1QT1A 3B8VA 1MMFA 3O7UA 3NOEA 3GC2A 1K7FA 3W3OA 3MMUA 4TIMA 1W9DM 4Q8MA 1K02A 3GTXA 2A0NA 3NQEA 1SW0A 4AIBA 3CBWA 4WD0A 5DANA 5D04C 4C6LA 3K1GA 1AA1B 2VM8A 2NQ5A 4U5IA 4JL2A 3FDKA 2QZRA 3N15A 1CXFA 4F48A 3BK0A 2H9AB 4AWTA 4HK6A 5G2HA 1Q2RA 3DYOA 4PEEA 1A53A 2OKTA 1C7SA 2B31A 1OABA 3SCRA 3WJYA 2I7GA 3H2AA 5I3JA 3H4XA 4ZQCA 2FMNA 2UZ9A 4AB4A 1TPUA 4WDXA 1UWIA 3IANA 1OY0A 4JX5A 3QTPA 4M19A 4B5WA 2WSYA 3S8HA 1RZMA 1YNPA 2J6VA 3KRZA 3N34A 2EJAA 5EGRA 1I6NA 2XH0A 3D0CA 1DL3A 3BZJA 2WKGA 3VIKA 5E70A 3V5OA 2QUMA 3HIJA 3LXBA 1DQWA 5F7UA 3CZGA 5H1WA 1EH9A 4YS1A 1VD6A 3KAOA 3NZ1A 3AIBA 4JICA 4PZVA 5GPRA 4H8HA 1E6XM 3N4FA 2DU2A 3PANA 3E74A 1AVAA 3U4FA 1OT1A 4UFKA 2FVMA 5CCZA 1V3JA 1XLBA 4JDBA 4DO5A 2XUCA 2R6OA 5CPTA 5SWUA 3LXAA 1IGSA 1AL7A 3WLOA 3BOXA 5AYBA 3I10A 4AMCA 3ZM8A 1TV8A 2GPTA 1ZQ5A 2YDRA 3EDDA 1NDZA 2RDTA 5CBJA 2E6AA 4J4KA 1UP2A 4I9MA 3MW7A 4NAEA 3L4VA 1TPB1 4IH3A 3AI0A 4KWSA 4CLMA 4B15A 4QLJA 3WH5A 1VFLA 2NLIA 3TUUA 1P5BA 4PCPA 1BGGA 2HV5A 2WW5A 3UGVA 1FXQA 1EO5A 2JEPA 2QKFA 1J4EA 1KTBA 3POCA 3LHVA 4INFA 4ZXLA 1A5LC 3NQBA 1ITQA 1XDJA 3F03K 4QS6A 1WZAA 3ZS4A 4MUZA 4OUIA 2J7BA 1R6WA 3ARUA 2WSKA 5DN1A 3GUWA 1MI3A 4D8AA 2Y5EA 3PTMA 4AD5A 1PTAA 3LERA 3L4WA 3OTRA 3V5CA 3IV8A 1GHSA 6REQB 4FX7A 4MWAE 3G1FA 8XIMA 1ZLPA 2ZIDA 2HISA 4FNUA 3EWUA 3IJ6A 2GWGA 3TTEA 1KFJA 3USZA 4ORIA 2DJXA 3UZXA 1U22A 1CNVA 2ZUSA 4IGMA 2G97A 1KV8A 1YTDA 1CI1A 2YFOA 3GDTA 4FF5A 1SZRA 3BANA 1YYAA 2C91A 5BRQA 1FDYA 4NVTA 1QNQA 4D6FA 2E6FA 1UKTA 3GDMA 1SMAA 4HNLA 4WUIA 1ZALA 1XS2A 4UOQA 3W72A 1UJPA 4EANA 4MUPA 1OGSA 2Y70A 4H6RA 1V02A 6PTDA 3UXKA 4PUWA 3HZ3A 5T9BG 3RXZA 2WO5A 4X9YA 3RLUA 1L2UA 1D3HA 5I79A 1IT0A 1VCFA 4ES4A 4O1DA 2BSLA 1H51A 3GYEA 3QTGA 3NO5A 1UWRA 3NSXA 4BKNA 1PUDA 4DBEA 2V8ZA 5I6SA 2QDHA 4H8VA 2DZWA 4U10A 2V67A 1O5QA 1J79A 5AZ1A 1ISYA 2OVLA 2GSEA 1ZRQA 1V0MA 4ZVJA 4RPQA 3S2NA 3GXFA 1WDSA 3W7KA 1ZPTA 3CIWA 3NDYA 4HYRA 5F4XA 3QHMA 4M6QA 2CXGA 3WJXA 3TVAA 3WNNA 3EA2A 4ZODA 2C15A 2QDGA 1S5TA 1T8XA 1W8SA 4XUYA 5LA2A 1AH3A 2QAPA 4JFVA 3V0SA 3HQPA 2PODA 4ZOAA 4DNHA 3QH2A 3LK6A 1O1HA 3QMRA 5A8MA 1VFFA 3GR7A 3IAPA 4B5UA 3W6MA 3MJMA 4Y9OA 3NM3A 7REQA 3CC1A 3IUHA 3BQ5A 2GK1A 3LN3A 4AXNA 3NVDA 3O6DA 4GXMA 4FIQA 3PZOA 4JX6A 4TR9A 3NPXA 3CQ0A 4JPGA 1I1WA 1P0BA 4QNWA 3R13A 3THQA 5A6TC 1UMLA 1D8CA 3LRMA 3GW0A 3WFLA 2NLYA 3CHDA 3WF3A 1FWHC 3MCOA 1J2BA 3SY1A 3KRSA 4LXFA 1PZ2A 3RIKA 2I14A 2GUBA 8TIMA 1V6YA 4Q8WA 4LC6A 5LIWX 4IFOA 3WKZA 1HG3A 3CNYA 4S1FA 3P5ZA 3GSMA 2OQLA 2PGWA 3VKBA 1A0CA 5DRCA 4FA3A 2OX4A 1W3LA 1ELSA 2ZE0A 3RR4A 5CGTA 1J0ZA 4QISA 4JYDA 2WVVB 2VD8A 3A3WA 2ISDA 1HL9A 1FH9A 1UROA 3TSDA 4OGZA 3TSMA 2R1KA 3OO2A 4ILSA 1VYPX 4W85A 4DZAA 2WVUA 4JNMA 1ITXA 1XLCA 2FKPA 4FALA 3ABRA 4YCPA 3GBEA 4NXSA 4E0CA 2JGYA 3MZ2A 4WRHA 1OFOA 3NZRA 1MNSA 1F2JA 2XFRA 4I9AA 1UBPC 2B7PA 5F2GA 2PDBA 4XKYA 1S39A 1MRQA 4EXBA 1M01A 2FPVA 1B9ZA 1DQUA 1EFZA 1O7AA 3H53A 1PTGA 1A5SA 4GYFA 4CCEA 3WK1A 7XIMA 2DZBA 3W26A 1HFBA 5HDRA 3MHUA 3DFSA 1XIFA 1XV8A 1Q85A 3SIZA 3IJQA 1UWQA 1SJBA 1H1NA 4Z1CA 3UCCA 2OGYA 4R27A 2XZ9A 2FLIA 5KZEA 4FOJA 4D1JA 4D6CA 3KBNA 2I9EA 4ZE5A 1R3RA 3TQKA 3UG8A 5KINA 4P8WA 3T6CA 4QR6A 3KTSA 4EXAA 3V75A 2J7HA 1ONEA 3NSMA 4K6AA 1M7PA 3QV8A 3H2EA 1JNDA 1EJ7L 3CXOA 3PBMA 3D3FA 2XDFA 3KOZA 1LORA 2QQ6A 3W1MA 5BWFA 1QPRA 2X2GA 4C6PA 1EWEA 1OYCA 3HJZA 1LRTA 5CGMA 4RNHA 5G1YA 1NOWA 2ISWA 2ATSA 4D6GA 5CG0A 4UTWA 2VI0A 3OGVA 3N17A 4BS0A 4NZ4A 4BHYA 3EX2A 2Z2AA 4LSBA 3WJSA 4UTIA 4JIHA 1Y5XA 3RHGA 1RP9A 1XISA 1MW2A 1TPC1 4D2JA 2E09A 3VCRA 1HJWA 4IIEA 4A8LA 2CERA 3LM7A 4NAFA 3FA5A 3MI2A 3WMLA 1DBTA 3N13A 5FJJA 5HJXA 1EJXC 3O6YX 2E5BA 1KFLA 4MZYA 4EX4A 2GQ3A 1X8CA 1UD3A 4GX9A 5I7GA 4AU0A 1PBGA 4RDVA 3F2DA 4XO6A 4HMNA 4PL1A 2WZEA 1T40A 2BGSA 4HMDA 3V7PA 5F1UA 1AQHA 1SZFA 3OVQA 3LS9A 1FKWA 1TSIA 1VIZA 3KW3A 4ROQA 4S3AA 3MDWA 3W28A 3AJ7A 1XLDA 3BPWA 3BURA 4C60A 1YPFA 4XUGA 1TWDA 1XKYA 1JNEA 4LB4A 4CVUA 4DX3A 3TWAA 3VOGA 3C0SA 3BWWA 3UXIA 1M1BA 5MKGB 4HA3A 3QR1A 3UPWA 5A6MA 5EPDA 2BV9A 1EPXA 2CHRA 1EWDA 1V6TA 3F2CA 1POJA 5FESA 4WDUA 3HQNA 2PRMA 4DWSA 3TROA 1XGZA 3WLSA 3IV3A 4GZJA 2VURA 2J8GA 1E1CB 5CBBA 3UWZA 1J93A 1ZSXA 3TFXA 4L9ZA 2V38A 1F6YA 2CLKA 3T0AA 5EFDA 3PUOA 3UCDA 4NASA 4U3AA 3W2MA 1B5TA 1LUCB 3U48A 2PWEA 3VD5A 4MTVA 2EHHA 1B3WA 2VDIA 4O4VA 3DFYA 5AHEA 2VFEA 2FZ9A 4U31A 4DUOA 3FN9A 2HTMA 4JFUA 4AIEA 2AMXA 4AY8A 3C8FA 1GG1A 4FS9A 1JXKA 1V79A 3LM3A 5ABFB 3MP4A 4MNLA 4O0ZA 4M56A 3WDIA 3G1SA 4DZHA 2VGGA 2ZVRA 4QAWA 5MHBA 3M0JA 4L7ZA 1O68A 1B0IA 1CXHA 4J5NA 4UR9A 1MEHA 3FKRA 4XSLA 5IFPA 4PMRA 3KOXA 2VFDA 2FDSA 1OX6A 2JALA 5LKYA 1QAPA 1ONXA 1EHAA 4KQNA 4AQLA 2ZX5A 5BOOA 2QMJA 3F4CA 5A1AA 3RX2A 1HVQA 2GGEA 4N9CA 4FIRA 3CWHA 4US5A 3B8SA 3WQOA 4GXPA 4HPXA 3PUGA 5C70A 1S5NA 4FP1A 2FZBA 5I06A 1YRRA 1MW3A 5FOOA 3ZOAA 1L2QA 2VFGA 1SJDA 4NJHA 4DI8A 1R3YA 3SCQA 4QLKA 1EBHA 1GTHA 1HUVA 5DY2A 1U5JA 4AY7A 3SRKA 5ABEA 2IUZA 3E3HA 4YHEA 2OO0A 3M44A 4P7NA 3TC7A 2FJUB 4XTDA 1OSEA 2E1WA 2QCEA 1TVPA 2WKLA 2Y61A 3BOLA 4WJXA 2ALRA 3LCHA 1HF6A 3MMTA 2QULA 3HA1A 5FJPA 3MKKA 4N6EA 3QY8A 4GO8A 4AX7A 1W5PA 1A5NC 1P7TB 3E2RA 2Y7FA 5HINA 3ARYA 4PGLA 3KOFA 2Q01A 4LBUA 3BMXA 3NGFA 3PWGA 4AZ7A 3H2CA 1ZFJA 4O0QA 1YBQB 1EDQA 3W7EA 1A3XA 1TUFA 3WJZA 3A64A 3GC4A 5C7VA 1GHRA 4HCHA 2OEKA 3M16A 3TYDA 3COTA 2JGQA 4DPQA 4IHCA 3B9NA 1TMHA 2REQB 2Y7DA 1K4HA 2C8NA 2XPKA 3T2QA 4LNCA 4Z1BA 1T99A 5JIPA 4ZB5A 1JEZA 3GXTA 3VIJA 1JCXA 1DJGA 2X1UA 1XM3A 2PTXA 3HPAA 1XLLA 4HU3A 1UD6A 4NNAA 4I7VA 1G9HA 2CZVA 3WF2A 2GQ8A 1CXEA 3GUGA 1XRTA 3D6NA 1SR0A 3TW6A 2VENA 4LYRA 1VPXA 3C0JA 2YX0A 3SGUA 1E6NA 2JF6A 1K8XA 4HSOA 4IWWA 1LDCA 3NVTA 1JPKA 3EKLA 4ADUA 5J5RA 5A6BD 5IM51 2PPGA 4UTWC 2E0PA 1MDLA 1CGYA 3EDEA 2G41A 4OBSA 1XP3A 4R9XA 3K4AA 4KWUA 7ODCA 3RO6A 3C6CA 1SO5A 3W7NA 2J88A 3EYPA 2UWFA 2YXOA 4IMDA 2Z2BA 5D37A 3USBA 3AYRA 3GDBA 1K3UA 1Q6EA 1SFJA 1R7OA 1VF8A 2NQLA 4FNPA 2PDCA 4UNKA 1V0KA 4B9ZA 4LF1A 4AZCB 3P74A 3QPEA 2G5WA 4O57A 4EWJA 2QCMA 1LL7A 1NVMA 3M47A 3PFRA 1ME8A 1VH7A 1ZCOA 3EX6A 1FKXA 2YBTA 4E5TA 4RK8A 3UR2A 1MFUA 4F0RA 4AEOA 3S0CA 3GBDA 5E6YA 2JE8A 3AISA 2W5FA 4AD2A 1V6WA 3M6YA 3PPFA 4NYYA 3WNLA 1B9BA 1R46A 4J3VA 1QNSA 1FWEC 5A8NA 4LYQA 3UU0A 3WQ5A 2YIHA 1TWIA 3VDAA 4EPEC 4PTNA 5AY7A 4LRTA 2WZTA 1W5QA 2QUNA 1MQPA 4FO4A 3GTFA 4GOAA 1VB9A 3GHSA 1E55A 1RAKA 1TPH1 3F1QA 1IIGA 2O55A 3N2CA 4AEEA 2IQTA 1WKEA 3OA3A 3VMNA 3LGEA 1XRFA 4DWSC 2F8QA 5HR7A 4H9ZA 1KFBA 1AH4A 3PB0A 3GDRA 4FNSA 3SBFA 3W7QA 1FDZA 2NV1A 3O05A 3AZSA 1KRBC 1R3SA 3OOQA 4YVVA 2G3FA 3IGHX 1OFDA 4EF8A 2VX7A 1LLZA 2TODA 1N8WA 5LGZA 1ISXA 4S2BA 5EMLA 4NZ3A 2Q3OA 2G37A 4MGGA 3R12A 4AZ6A 2DUXA 1VEMA 3CHFA 4IQJA 4FX6M 2P1FA 1LT8A 1R9YA 4B4HA 4JD4A 3MZNA 3KWXA 2NXIA 5CSYA 3OJGA 3BL3A 3WFAA 1WZKA 4YYFA 2XINA 4E8DA 2BXYA 2NXHA 1I45A 1Z69A 1UZDA 1EEXA 2B7QA 1Y7VA 4XZNX 1IXQA 1DIKA 1SGJA 3T2PA 4AZ5A 5AC5A 3LRKA 1VCVA 1HJVA 4DLFA 3V16A 1X6UA 5D03A 3STCA 3TJ4A 1PIFA 4NZFA 2VKZG 1W5OA 2Y0FA 3URBA 3VFCA 2IMRA 2YW4A 4PUKA 3GW3A 4PSRA 6XIAA 2DZSA 1EDTA 1KR0A 2VQTA 3QW3A 3CUJA 1UW9A 2VC6A 3EOUA 4JTHA 1T5AA 1BPLB 5DLCA 3SQMA 3WNPA 3W73A 3VZYA 3VUPA 4BR1A 1A47A 3CZJA 3CK5A 1RY0A 2WOQA 4XX6A 2XISA 5DQPA 2R1LA 1T0OA 1P0KA 3BCFA 2VEFA 1J18A 4IOTA 4G1KA 1S2AA 2EPNA 3A9BA 1FXPA 3A3HA 3LCFA 2OXNA 4KETA 3QXBA 4GIRA 1HP5A 3KTCA 4NJJA 4H2CA 5BXPA 5FJTA 3N2XA 2PGFA 2QVHA 2WMGA 4LT9A 2RAGA 2JBMA 3WF0A 3IIZA 1FHUA 3DFHA 3E5BA 4TVDA 2QW5A 5HUPA 1LRQA 3U0HA 4FOUA 2P0OA 4NNCA 2WNNA 2HWGA 4OWGA 5HWJA 2CBVA 3PZNA 1B3VA 4HA4A 4MKNA 5K2ZA 1W3TA 2V2DA 3NG3A 2EPHA 3DFQA 3FJ6A 3LLXA 2PDNA 3QSTA 1H2JA 1KM2A 5EMKA 4DXXA 4H8UA 5EYWA 3W7IA 5BW6A 1VCGA 2JIEA 4QJ4B 4M24A 3H2FA 2PF8A 3TP4A 4AX6A 3TTSA 4L4LA 1FWJC 2TRSA 3VGEA 1OX4A 5CZKA 4B3LA 1VBJA 4E8GA 2YCLA 3VNDA 1QI2A 2ACSA 2AGTA 4UCGA 4ZTYA 2HXTA 2YLLA 3AWOA 3AU6A 4AZIA 1R2SA 4S3EA 4JNZA 1LWIA 3LHTA 2WSQA 5DBTA 2VR5A 3W38A 3LQLA 1JYXA 2A3EA 3AS3A 4X2RA 4HHLA 4UZSA 4GJJA 2IPWA 3PNZA 4H00A 3WD1A 3SADA 1OCJA 1IV8A 4A29A 1GONA 1K7EA 3TE9A 1CGVA 3FW6A 4WY0F 4QP0A 3ALGA 2WQDA 5A8OA 4F2BA 3ITOA 1QNPA 1Q7QA 1AJ0A 3HQ1A 4JL1A 5BU6A 2R14A 1WO2A 2WBKA 1GGOA 3R25A 2DUAA 3UFYA 1PCKA 2EPKX 2WJFA 2F6KA 2OEJA 1N8FA 3CHCA 2A6LA 2WXDM 3LPFA 3GTHA 3IJIA 3ZSSA 4DAFA 3VFLA 4LCSA 2IS7A 4Q32A 1X96A 3UWWA 1WE5A 2V68A 3SW6A 1D7KA 2HMCA 4TTGA 1XGEA 5FJRA 4QG9A 2FVLA 3FYYA 5U4NA 1XF0A 2OG9A 1OZQA 4N9EA 4N0RA 4B90A 3B06A 3LZ3A 1XR2A 2BVDA 1CGWA 2OMAA 4JTFA 4LX4A 5HR6A 3AMKA 3R1ZA 2NT0A 1RPKA 3W9ZA 1WZLA 2E4TA 3K1DA 3NGJA 4JYFA 3AIQA 4NT0A 1NF0A 4E3TA 1R7AA 1SVDA 3BAIA 1DJYA 2PDXA 4IP7A 1JF6A 1HJSA 4JYEA 4HGXA 1F07A 1E3XA 3JVAA 4Q8PA 4DO6A 4UB9A 1W1B1 1XBZA 1P43A 5REQB 5G4WA 4B5NA 4Q8VA 4IJRA 3NZPA 4E2DA 4K8HA 4B5XA 3B03A 4MZ1A 1TVLA 3N9RA 1N2VA 4J3SA 4R88A 3CPGA 1PYFA 3GNOA 2QDDA 3ZVHA 4CN1A 1EC8A 1O1ZA 3VABA 5CC3A 4QDPA 3WQEA 2YA0A 3RN6A 4Z2JA 3HGSA 4K36A 2VZVA 4A2RA 4LUSA 5FI8A 4OBTA 3RGTA 2ZTJA 4IGHA 5RUBA 3REQB 4RE2A 4XAPA 1QUMA 3EPMA 4Z2IA 2VGIA 4EVZA 2NT1A 1XYCA 1XQKA 3LBOA 3LI0A 1UH2A 5AYZA 3O8AA 1QR7A 4GK8A 1QDSA 2X05A 1CB2A 3AXXA 3GH7A 2GJXA 2HQAA 3DFTA 1LTDA 3TW9A 3I7RA 2GGHA 1FWCC 3TC3A 2AOSA 4O53A 4AHQA 3GY1A 2DZVA 4Y9MA 5CXPA 3HV8A 3MYOA 2YBUA 4I9JA 1JZ5A 2OB3A 3OP2A 4XBJA 5HWNA 5A5WA 1YNYA 3C2EA 5BROA 4KFNA 1TO3A 3RU6A 1TWWA 3N4AA 3RMEA 2INZA 3AUOA 1XD0A 1ONWA 4DO7A 4PMXA 3RITA 2NUXA 3NCOA 3LTSA 2CBUA 3LBCA 2V82A 1GOKA 4PTXA 3HN3A 5ABHA 3OGSA 3NL2A 1MUWA 4J1OA 1NELA 1OD0A 1ZBCA 3FIGA 1NOUA 2QJMA 2OPJA 3K8MA 4JTDA 4GNKB 3CMJA 1A5OC 2YA1A 3IK2A 4MLRA 4L64A 4QG8A 4MJ2A 2BBFA 4RKAA 3NQAA 4MM1A 4XQ6A 4HPJA 4Q6JA 1H7PA 1M6JA 2ZUWA 1CBGA 1Z89A 4EPBC 3ANYA 4UQ9A 1ZAHA 3OB8A 1TV5A 2ZXDA 1RUSA 1RV8A 4A3YA 3VNYA 6ENLA 5T91A 2OT0A 4WXZA 4LJ3A 4W89A 2FDMA 3PSVA 4BZYA 4LY8A 5F1VA 5F2MA 1ML1A 1YXDA 2WLZA 2B7OA 3N2OA 4UR7A 4POCA 4UOZA 1UG6A 2D20A 3H21A 4G7EA 4GIEA 3S4TA 3CO4A 5HOSA 3TEVA 5T8GA 1YKWA 3WN6A 5D9PA 3DHDA 3TFCA 2XFFA 3MP3A 2AGKA 4UNIA 2Z6JA 1WCGA 4JHMA 4AUBA 4WY0B 1WOAA 2IQ0A 1WZMA 3MVTA 3L0KA 3A24A 5DRIA 1EJTC 4WX2A 3WDQA 3VKKA 2H9AA 4NRSA 3O1NA 1WDPA 4E2OA 1N7KA 3KUMA 3GG0A 3LHWA 4IMAA 2E25A 3OYZA 2WMHA 1WPCA 4UFJA 1GK8A 4JTCA 4R34A 4TV5A 2GVGA 1SSGA 1PKLA 1EZWA 1J6PA 2FHFA 3NZQA 1F6PA 3AHXA 2GQAA 3SFKA 1S5MA 1XC4A 3EGJA 5GJMA 1HT6A 5D2TA 1GZ1A 2XU2A 4OV9A 1Q4NX 1ZJAA 5D2YA 1E51A 2DSZA 3P82A 3ZZ1A 1B4KA 4WVXA 2P50A 1PZ1A 3N19B 3D5HA 1IWAA 3DDMA 2GK1B 3IARA 1XCWA 4Q4SA 3IIOA 6ALDA 3WBYA 5DCEA 3QZAA 1BG9A 5AHNA 8XIAA 2JEQA 2BMBA 4MYXA 5I3KA 3A23A 1W9UA 4AZBA 1EX5A 4S38A 4Z0JA 3RNDA 5XIAA 5LXXA 1CECA 2UV8G 3IVSA 4ZOEA 4U28A 3MSGA 4RNJA 3DENA 4J2PA 3GH5A 4I5XA 2VGBA 3VKAA 1E0XA 1BYAA 3ATZA 1R3TA 3N73A 3VNJA 5IXEA 3PK7A 5A6BA 1JCTA 1GQNA 3Q2DA 3BCDA 4QIUA 4IFRA 3I6EA 3YPIA 4ZOCA 5I09A 1X1OA 3U2OA 3W74A 4HNCA 3CO8A 3G0UA 3IIXA 4AVFA 4OFCA 2E7FA 1QPKA 1HO1A 5AHLA 3AQUA 2MANA 2EKCA 2HBXA 2W0UA 4W4QA 5FD0A 4P7OA 3W1PA 2ODOA 1FY6A 5H91A 3NEHA 2HEJA 4W93A 4BI5A 1TTJA 1C8QA 2A5HA 4ADTA 1UWTA 2FTPA 4RDZA 5A3HA 3FJNA 1DJNA 3BGJA 4JKKA 4H2HA 4QE4A 3RLHA 1MW0A 2PDLA 1RVKA 4CQ9A 4XZWA 6REQA 2A3HA 4WGHA 4H6KA 4W84A 3RU8X 3GIPA 1B30A 4XKYB 3BG3A 4MZ8A 2PDMA 1GKRA 1M53A 4QX4A 3IJ8A 4K39A 1BXCA 1W5MA 1HL8A 4KCVA 3AIWA 2MUCA 3QPYA 3GNXA 3C52A 5D05A 1CXLA 4RCXA 3E0WA 4CUCA 3IGSA 2FTWA 3VC5A 1LROA 3N29A 2OKOA 2DW7A 4JDYA 3SY5A 3WQWA 1E72M 2J78A 3WO8A 2QCFA 3FYPA 3MV11 1LRNA 4MY9A 1IZJA 1UR4A 3RM4A 5EB8A 1NJJA 4U4MA 3WF4A 3QQ0A 3KBVA 3CV6A 1V02E 3DCPA 1EXPA 4HPNA 4QE5A 3PBVA 3MO4A 4IQEA 5KTLA 1LZOA 4PCNA 1U5HA 2G4FA 3GVWA 2X30A 3TN5A 3UY8A 1C92A 3RCYA 3K46A 1C8XA 1MO0A 3R11A 4HPHA 1A80A 1I9CB 2QVNA 4HIBA 3M7SA 3RM9A 4LVBA 1Q13A 4AVOA 3U5YA 4MWAD 3TJIA 3IRDA 2Z27A 3VOHA 3XINA 3NR0A 4WZHA 5CLTA 4NAFB 4DXKA 2A79A 3MQTA 4UIOA 1F8MA 1TPDA 2WCSA 3T8LA 3R8GA 7TAAA 2YCIX 3ZLGA 2Z1WA 3NDOA 5CJMA 1FWBC 1I0DA 4ZTXA 4GD0A 1L8PA 3VE7A 1Q6CA 1VFSA 5AOUA 4Y90A 2Z2UA 4MFDA 1VPYA 2YDAA 3MP5A 4PUJA 3LDVA 5G4EA 1CWYA 2WPGA 4YVPA 3QMTA 1UQYA 5EL1A 3GLCA 3ARSA 4GZIA 2CPUA 2HNEA 4IL0A 4JTRA 3VU2A 1JIBA 3L9CA 3ZJKA 1H61A 4GNVA 1BVZA 2B0MA 2WJDA 2ZZ7A 4NRRA 2PWUA 3W7HA 2XIMA 1XQLA 4V28A 3P67A 4LVDA 3UXLA 2GJPA 2HDJA 2ZUMA 3HJEA 3ZJ7A 5I2UA 2QXWA 1XD1A 1OB0A 5HPCA 3AZRA 3TZFA 3W6YA 4A22A 1M68A 1GPWA 1W3NA 2QS8A 4QLLA 2CLPA 5I3IA 2Y88A 2PDQA 2QAFA 5AFDA 4JNYA 2J7CA 2QNEA 1WAUA 3H7VA 2Z25A 1WBJA 5LXEA 1H41A 4D1IA 1G67A 3CB8A 2ZZ6A 5IDIA 2WHLA 3U6WA 3WDRA 4AVNA 3P81A 1KD0A 3C2YA 1P6WA 5I77A 1IWPA 1NQ6A 4E2VA 4PC8A 2YGYA 9XIMA 3GS6A 2DSKA 5FACA 1XDMA 2C14A 4JHZA 3AU2A 2XIIA 5AVHA 4JTUA 3ICJA 1CGUA 2I5QA 5HPOA 3FX4A 1YTKA 4WKHA 2G3MA 1B54A 1V77A 4G5DA 3AAMA 3HG2A 4GVGA 4DZIA 2O0TA 2FHCA 2I57A 4A8IA 1BVNP 4PE8A 3CHVA 5CEWA 3W1RA 1RQEA 4N2YA 3TOYA 4Y9PA 1EGZA 2O9OA 3AYSA 1RHCA 3K2GA 2V2HA 4H3DA 4WLCA 3L4ZA 3MI6A 4HHHA 4K7VA 4LAKA 1E43A 2ZX9A 5DELA 3TA6A 2PDFA 2OELA 3ZR5A 1ZGDA 1KM5A 5H8UA 4MJMA 1XH1A 4C6EA 3WBWA 4LY4A 1RCQA 2XZ7A 3ITVA 2POZA 1ZP3A 5C54A 2RKXA 3SN0A 2CCRA 3EDKA 5FSDC 2GJNA 2PI6A 5IBXA 1Q6RA 5EKYA 1QNOA 3H4WA 2J9ZA 1VJIA 1JYNA 3H2MA 4NNBA 4F2UA 2GWNA 3OYXA 2BASA 3W6LA 4IIFA 3CJPA 3RMJA 3ONBA 3A22A 4EIVA 3L21A 1PYMA 3UG5A 3RPTA 2NWRA 3WX7A 1E4MM 2QF8A 4DF2A 5B7YA 3QEZA 4V15A 1GCYA 1OADA 3F4WA 4MSSA 3UXAA 4M1BA 3VMPA 2OTDA 1CXKA 4UFIA 1H50A 8RUCA 2FJKA 1J0JA 2OX1A 2DT2A 3GVQA 3G1DA 3S2CA 3G6LA 3C56A 3CH9A 3AS0A 3P7YA 4F0LA 2WQPA 5FF3A 4QDWA 4DJED 3VYLA 5AC8A 2ZDSA 3FGCA 4KFOA 2WJZA 3OU8A 1DTUA 2PDGA 3IUDA 4HSHA 1JI2A 2PDJA 1EX1A 5XIMA 3UZ5A 2BB0A 4X0VA 2YCEA 4BQ5A 2ZXAA 2H90A 3UZYA 2GOUA 4L1WA 1IHIA 1TV4A 1JGMA 1ICPA 4ZO9A 3MA8A 3PZGA 2V63A 2E6DA 3VNKA 1VP5A 3UBPC 3G18A 3MKCA 1US3A 3FS2A 4IZGA 2VEKA 5MKGA 2XWDA 1OWQA 2IKJA 2DSUA 2DP3A 1E6QM 4UTUA 5LZLA 4PTWA 3BGGA 2QGYA 1GTEA 3WNOA 4JCLA 3CEUA 5HNUA 1I0BA 1XLMA 3LEPA 4ICCX 1C3FA 1RXOB 4MB3A 3LB0A 4Q33A 2BGQA 2PDPA 3HGJA 4ZENA 3EWCA 5EMUA 3CQKA 4EOUA 1YQ2A 4EF9A 2A21A 1E1CA 1XRVA 2ZYFA 1DV7A 1MXGA 1EA9C 3L0GA 1JCLA 3UA4A 3XISA 4F0KA 4EKJA 2V5JA 5LNVA 2Y7EA 3BLKA 2FIQA 4HU0A 1AZ1A 1A3HA 1UR2A 1IZCA 1WDWA 4MVAA 1GZGA 4KKXA 4Z2HA 3CL8A 1OX5A 2PE4A 1NAL1 1E9LA 3NO3A 1EDGA 2F84A 1K8CA 4HN4A 3T42A 4D8ZA 1DIDA 1F3WA 3T55A 3CWNA 3WLRA 4Z1DA 1UWAA 3N14A 4L5ZA 3R5EA 4UQCA 1R5YA 2TPSA 3E0IA 4GIYA 4LRSA 5LNWA 1RALA 3LRLA 2V5LA 4M51A 2NQHA 5AC7A 1DJZA 1W37A 2Y5SA 3SECA 1TR9A 3FSUA 3S2JA 3N6QA 4IIHA 3B0PA 4G7FA 2E77A 3ARPA 3KE0A 3GHUA 3SCOA 4X63A 5CJNA 3JU2A 3C86A 3AHYA 1XLIA 5M2FX 1PTDA 2E9MA 3VD7A 1A0EA 4C7FA 2NW0A 3AOFA 1HP4A 1VLWA 1W1IE 4QQUA 3T2OA 1BWVA 3D3AA 5FJUA 4L6HA 3ZVIA 3PBWA 4IICA 2PZ0A 5BU9A 5GNYA 2UY5A 5F4SA 5TAOA 3W7OA 4PBEA 3AJXA 4JHOA 4V27A 3HFTA 2JKPA 4O10A 5BWAA 2IPGA 1XIHA 4Y8FA 2XGBA 2ZDRA 1DWAM 1TJ0A 5BYWA 3H7UA 2XGIA 3W1UA 1TTIA 3P60A 1LCOA 3FCPA 2A3CA 1LWHA 1MFVA 3WMCA 1GWJA 1UD4A 3PZUA 1HZYA 3N9SA 3VZZA 4RW5A 4YL2A 3QOKA 1E4IA 1GKPA 1PE1A 3VOCA 1YBQA 2AKMA 3CAWA 2J25A 3T0BA 3URNA 1AH0A 3TIMA 1XXXA 4Y9NA 1FDJA 2QCGA 4S2CA 4Q4PA 4KBXA 4GHRA 5A2BA 1GZJA 4LV4A 2Y24A 3M6DA 1ECEA 1OC7A 4MB4A 5JQ9A 3C3UA 1YXYA 2TAAA 4W7UA 4J28A 3ZJ6A 4FOKA 4RXGA 5I5RA 1XLFA 1GNXA 1UOZA 4Q4RA 2PCQA 1UD5A 2J7FA 1RA0A 3OZOA 4M3PA 1XLJA 1AQMA 2NSOA 4MLJA 3OLIA 3DXIA 3C0LA 3O16A 3L0NA 1ZTVA 1UUOA 2GLKA 4C5YA 4WR3A 3DZ1A 3DHPA 2UBPC 4GXWA 3EEGA 1PX4A 2WSRA 5DCDA 4CNPA 5GNZA 4MYAA 2Z6IA 1XGDA 4Z1AA 1W0MA 4PA8A 4YVXA 5K9DA 1G94A 4GI6A 4KEMA 3TAKA 4IPIA 4L4PA 3R94A 3Q58A 3W84A 5IBXC 1BYDA 1ZJHA 4H1ZA 2XGZA 3NQGA 4MIMA 2TYSA 5FEXA 2O7QA 4EXQA 4WGXA 1FVPA 1GVFA 2W4XA 2WMKA 2FQIA 1GQIA 2ZWYA 4C6MA 2X16A 3WF1A 1A50A 3WD0A 3M0MA 2NV2A 1D3CA 4CU6A 1TX2A 2V0TA 5DMYA 3UQNA 3WJWA 4Z2LA 4BK9A 3BH4A 2DZPA 4B92A 4PB3A 3NQCA 1QVBA 3QV7A 4WOQA 1VZWA 3CIXA 2HJPA 2CXEA 5CJ5A 4GZEA 4UTHA 3L4TA 2OSYA 2R8WA 4AZCA 3A12A 2FH6A 1FUYA 4KRUA 1TPEA 3UWVA 4GY7A 4IL2A 2JIWA 3CL6A 1S2UA 3S9YA 1I75A 4O1EA 4W9TA 3APTA 3ANVA 2YB1A 1C7TA 2F9RA 3UWQA 2G3IA 5EA9A 1V3LA 3W85A 1DP0A 3H12A 1XYAA 2W61A 5ABGA 3WUBA 2J27A 1YNQA 1C91A 4WXYA 1W17A 4LEQA 1OX4B 4HU4A 2V69A 3CLMA 2YCLB 4CU8A 2CZ5A 3OVPA 1E6ZA 3M0VA 2Z28A 3EPOA 4P7RA 1H1YA 1IEQA 4I6VA 3O07A 4MKVA 4RV3A 1WYIA 3B8IA 1N82A 4OBRA 3F4DA 3M0IA 4HNTA 5BMWA 3GRIA 4HQVA 1KFCA 1XG3A 3VINA 4HSNA 3EOEA 3AYTA 3LGGA 3QQ1A 5L9FA 5DFAA 5D02A 3TWBA 3H54A 1POKA 1TRIA 4AF0B 4CQCA 5XINA 3S46A 4K7YA 4LUTA 3S3GA 2PGEA 3PHAA 5CZ0A 1W54A 3A3XA 3HURA 3UNDA 1KBKA 1IR1A 4MWAA 1PPIA 3GG1A 3FXGA 2NX3A 3FAWA 1U5VA 1V51A 3E38A 3K8LA 3HG4A 3L7RA 3LENA 4WF7A 4JTLA 4RPPA 4JIRA 3U9IA 3WH7A 4AD0A 4NUWA 2XH7A 2P53A 4CEUC 2RJHA 1TE1A 4JEQA 1UR1A 1TIWA 4XISA 3DBPA 4XD6A 3RLGA 3M0LA 1JAEA 5CPSA 4NHVA 1SO6A 3D46A 3M5XA 4LCRA 1G7UA 3RLVA 3L5AA 4O4WA 4E4UA 3CUIA 3J7HA 3KHDA 3G0XA 3WSUA 1YIXA 4W7WA 4ZCWA 4KEUA 1NFPA 2CLEA 3PPHA 1NDVA 3R43A 5JVLA 2BTMA 2WCAA 3T09A 1EPVA 7A3HA 3WL1A 2QR6A 4TMCA 2GGIA 3BDKA 4HMEA 2PMQA 3S1GA 4XIMA 2W66A 3QMSA 2JQXA 4HK5A 2AL2A 4FR6A 3DFPA 2J7GA 1K6WA 1A5UA 3GDKA 5JUVA 3BV7A 3BGAA 3ABSA 3NUKA 3APGA 2Q8XA 2J77A 3B9EA 5AECA 1K7XA 4Q8TA 2V9DA 4LUSB 5DCBA 1UCWA 1BXBA 1F6KA 3G1RA 3QKZA 1G5AA 1Q7ZA 2YSWA 3PBUA 4I8YA 3CPRA 4X22A 1UWUA 1HGYA 4EPDC 1T41A 2Q8ZA 4IPPA 4S3KA 1XINA 3QJAA 4E3VA 2GJXB 4AD3A 4N02A 4A35A 1TWSA 3I65A 2J74A 3VGFA 4TUFA 2VD9A 3KZPA 3QV6A 1Q4WA 4WQ6A 3HMJG 3GHTA 1MSSA 4MNKA 3S6TA 1PB0A 2AAAA 4MKSA 3W7CA 1AQFA 3IJLA 4UMCA 2PUZA 3HFYA 4HK7A 1GVEA 3ITLA 1GVYA 1YLVA 4O12A 3DUGA 3TTOA 1JR1A 3OBEA 4ADSA 6A3HA 3B0UX 1EF2A 5DMNA 2GQ9A 4OZOA 2XVNA 1EJVC 4YTSA 2E68A 1KV5A 3GXIA 3OHIA 4IGSA 1UIOA 1J5TA 3KTXA 1FWRA 4L4OA 3WLNA 1FWDC 1G01A 1YTEA 1SR9A 2FB3A 1M7JA 1UKOA 4UMAA 3QC3A 3VD9A 2YBVA 1YPIA 2C18A 4REQB 4A3QA 3SAZA 2D22A 2IPFA 4XK2A 1TG7A 1TJPA 4AHPA 4IQLA 1JRBA 1PKYA 2PSNA 4KT2A 3NYDA 3VAVA 3MYPA 3HB9A 4RV8A 4XSMA 1NOFA 2FMOA 2GUUA 3EKZA 3ITXA 1DIOA 1CZ1A 4PFMA 2XVKA 4QJ1A 2DVUA 5CAHA 1XUZA 1ISZA 1GOIA 3T40A 4MNJA 3ALFA 1ZHAA 5KSWA 4FEZA 3NQMA 4DBUA 2VZUA 2ZRWA 4Q4MA 3AXIA 1WX0A 3GG7A 2D23A 1US0A 4C6DA 4JTKA 2RDWA 1V93A 4HD5A 3WH9A 4R53A 3EWXA 5IRPA 3G1VA 3EA1A 4G7EB 2D2JA 4GWEA 3I6TA 4H9MA 4V2XA 3SGGA 4JGDA 1IXPA 1DWIM 3UA3A 5FSEC 2NUWA 4F2TA 4BQ3A 5BOFA 3M5ZA 2V6AA 4DJEA 2BY1A 4DELA 3SQSA 3ZQ9A 3HO8A 4GC4A 4GG9A 3MSDA 3GH4A 2PWHA 1EEPA 5D09A 1ME7A 4DO4A 2PWGA 1UR8A 2PU0A 1W3KA 2QYGA 2ZE3A 3MUAA 2GGGA 1H11A 5CC5A 3T07A 2VL4A 4A2SA 2I1OA 1CCWB 1KCKA 1AMYA 3L65A 3FOKA 4LOCA 1W9PA 4KRTA 4DF0A 1NWUA 4YTQA 4ZQMA 3QYQA 4ALDA 4GH1A 4O1BA 3H2OA 5BXRA 4R5EA 2X7WA 1GT8A 5A8QA 2DH2A 1I1XA 4ORMA 2C6QA 2VFFA 2P8CA 5REQA 3BLIA 1FCVA 1HVXA 1ZAJA 3THDA 4QTGA 1SJAA 5FJIA 2VT0A 3S83A 2L5HA 1ODUA 2IXVA 5LIXX 4BY3A 3CV1A 1KBLA 2D73A 2WPBA 2KX9A 1RVGA 4O52A 3REQA 3N25A 2B81A 3GYCA 3N1AA 4Q6XA 4XD3A 2BWGA 2C1HA 5MF5A 1F5ZA 3W4RA 2GOKA 5AZ0A 5EBUA 3E1F1 3H24A 2RHGA 4XAFA 3U2ZA 3UR8A 3SUTA 5LYRA 1F4HA 5HQMA 3DC8A 3TJLA 2V3DA 2ZKMX 2J79A 3CTLA 1XICA 1RCXB 2ZRVA 3PTQA 4MAVA 2YL5A 5HJYA 2XIOA 1GVSA 4F0MA 2RH9A 3ZLFA 4AY1A 4XZMX 3VGGA 2PP3A 3BTNA 1NQKA 1Q6QA 2BFGA 2VXNA 1KR1A 1BSLA 2ZVIA 1GVIA 1Z41A 2YZ5A 4MWAC 5U7SA 1GEHA 1F9CA 4KW2A 2PWVA 1MUCA 4C6OA 1KFKA 2EXOA 4RZ5A 1RBOB 2V5BA 5H8PA 1X39A 5G5IA 4ICMA 1XYLA 5C9RA 1R3VA 1RK5A 1E56A 5FKYA 4XZ9A 3DYMA 5HATA 2PDUA 1FTXA 2FVKA 4AW7A 3EXSA 3GHRA 5CC6A 4M82A 1WXYA 3QZ6A 4ZSTA 1JZ2A 1T8QA 5CKSA 3PTKA 1VKFA 4Q7BA 3PR2A 1KGUA 3GIQA 2YDSA 2RJGA 2DW6A 5AYIA 3UESA 4I5UA 3M46A 4JQ1A 1W56A 4CCZA 3DU0A 3G8EA 1XKJA 4IX0A 4IP5A 2OQHA 5FJOA 4GUFA 4ZOBA 1D2KA 2PCEA 1QNRA 2FFCA 3EMCA 3ITTA 2EQDA 1OHLA 3WNKA 4PSPA 4MMWA 1JVNA 1EC7A 3KDNA 4NF7A 3IACA 2X2YA 4MPQA 5KMYA 4GNJA 3QQWA 3W2NA 3BOFA 1EQPA 3B0VC 1H7XA 2D0FA 2E9BA 1J0YA 3NQVA 1D7FA 4WJEA 1KQYA 2C0HA 3RAOA 4PEKA 3L2MA 4F0SA 3QR3A 3WD2A 3TQVA 2A7PA 4QSHA 3RJYA 4WY0A 1JI1A 4ZZ9A 5FF4A 4HTBA 3WQPA 1BRLB 3VOFA 3GU2A 3CV7A 1QCWA 3N2MA 3CASA 3TYEA 1VEOA 4TXEA 2O4MA 1EB3A 3W22A 3KBJA 3UEQA 4Z08A 1ADOA 1PWMA 3IS4A 4KWWA 5B7ZA 2TSYA 5E6ZA 1HKWA 1IZKA 4FX8A 3LHUA 4U2ZA 1Z42A 1WKFA 1XIBA 1QOPA 3W76A 2QJHA 3PG9A 4UTTA 5FF7A 4Q8OA 4PMVA 4JBRA 3WK3A 3M0XA 2FGZA 1PDZA 3NYZA 3N04A 2BVTA 4HTYA 1NSJA 2WC4A 4OU1A 4W7VA 2C79A 1GOWA 3K4WA 3LQGA 2CLMA 1O60A 3R4IA 1NWRA 3HPSA 3HU7A 3LPGA 1IF2A 1KBBA 3IVTA 1HIZA 1W1PA 3F2BA 1EC9A 2VELA 3O63A 9CGTA 1HXJA 2XM2A 1TB3A 2G50A 5LGXA 3S9IA 1XSKA 2GJRA 1CX9A 4X60A 1E40A 4TOQA 2ACRA 2OO6A 4OT7A 2BHZA 2X1TA 3VA8A 1ICSA 3PN8A 3W1NA 4DXVA 3WIJA 4IUGA 2HVNA 4ERAA 1S3HA 1AG1O 1W2PA 3FV9A 4GABA 4PBGA 5IHRA 2YB4A 3SQLA 1JUKA 2CLOA 1W3IA 5HJLA 3RX4A 4J27A 5LIYX 3THCA 2XTKA 3V36A 3IAQA 2ZRZA 4J35A 4PRRA 3L2IA 4IF2A 3ITYA 4NZ5A 5CZSA 2VEPA 2CWNA 3HPXA 3VIMA 1S46A 3SDOA 1HX0A 2A85A 3SZ8A 5HWMA 4ERIA 4AWUA 3MCNA 5LHEA 1H62A 3K8KA 5A94A 4MB5A 2XHYA 2GVLA 4B5SA 4DJEC 4LNYA 3VK5A 4K37A 4L6OA 2EGZA 4ZXOA 4NX0A 5F4WA 4HBKA 1MXSA 3QY6A 4UTLA 2C16A 1XI3A 1T6MA 4GO9A 2VHLA 2EJ1A 5GQBA 1UKQA 3MT1A 1FH7A 4YU1A 1XYFA 3GAKA 1KXTA 3VZXA 3LA4A 3LCGA 2ISVA 3W25A 2O9TA 4K38A 4A6GA 2D2GA 3KOYA 4HNVA 3VDHA 4ZFMA 1I2OA 4UWMA 2H8ZA 2H3DA 5EFFA 1EUAA 2JKEA 1EBGA 4G8TA 2Z1VA 4DJFA 2VJXA 1U30A 3ARTA 2D2OA 4JQ3A 2XFYA 4P8XA 3UG4A 1FQ0A 3LMZA 1UPMB 1C93A 5I78A 5AHMA 4LBSA 2VGFA 1XCFA 5TF0A 1S2WA 4YMZA 2WAGA 1Z8AA 1F7BA 1HO4A 2WZMA 1UR3M 1SYTA 2WM0A 3PY2A 2ZUUA 4QAIA 1Q6DA 3A13A 4KCUA 3G24A 1J96A 2A7NA 2GSJA 3ARRA 3KS6A 1RD6A 7CGTA 2AAMA 3UWEA 3URQA 1HJUA 2QUVA 3KBWA 4A3HA 4GI9A 3S5YA 3BAXA 1DWJM 1G4SA 2OQYA 3ZSTA 3WLKX 4O1FA 1UOKA 4QBXA 2PC4A 1BAGA 1OJXA 2VDHA 2D0HA 2YXGA 1QWKA 4FPSA 4ML9A 1Q5MA 1DHPA 5HMDA 3RPDA 4DZ5A 1JF5A 2C71A 1YMYA 3RFAA 1BYCA 1AD1A 1RLDA 2J9XA 1ECQA 1M7XA 1Q8JA 5LA1A 4O18A 2CHOA 3JUGA 3NFUA 3B9DA 4ZGYA 3SM0A 1UASA 2OJPA 5G1MA 3WH8A 1W6TA 3STEA 2QJNA 3MI3A 4PB4A 3M64A 3ZJ8A 3W29A 3TTYA 1QJWA 1Y65A 2VX6A 4FMVA 4QG6A 4I7UA 4TQTA 4XAGA 1SMDA 3CAQA 3L4UA 2VRQA 3MB9A 4XAYA 3NO1A 1GJPA 3FGCB 1RY8A 1QPQA 2DIJA 3KDOA 3KXQA 3PUDA 2NVCA 1DE6A 4O1CA 1OF6A 1GYMA 1LG1A 1P4CA 1GJWA 4LTSA 3VM5A 2QCHA 1IXOA 1CENA 2BOFX 3C2VA 3N2TA 4QM1A 5D4YA 4JN7A 4NY2A 2NXGA 3FAXA 4JFWA 1PXGA 3NJ3A 4Y8EA 1Q45A 2CBJA 4HJWA 4W8BA 4K1GA 5BRBA 1HTIA 4L9YA 4IG2B 1E0VA 3LSBA 3MO7A 1TZZA 1PX8A 2QIIA 3E49A 1XLAA 1FWTA 4HOXA 3Q94A 1OQFA 1M5WA 2ZTKA 3R2GA 3SSZA 1X98A 1IIHA 2PF0A 3W88A 1TX0A 3PJTA 1F74A 4IIGA 3W2KA 1IGWA 4O54A 3LPPA 4XD5A 1KM1A 1L6GA 4KCTA 4JIQA 3TX9A 3NPUA 4F79A 2Y5JA 1AQ0A 1LG2A 3RCMA 2VVSA 2ZRXA 1MXDA 2P88A 4CNTA 1TE6A 4JR5A 3WD4A 1W1A1 3N6HA 1I2RA 2CFFA 4RLIA 5CPOA 3HPFA 4B3ZA 1GYLA 3E0VA 2HXUA 2Z26A 4CN4A 1GOQA 2CEQA 3ZWTA 5D9OA 3WUEA 1QOXA 2XN0A 2W6RA 1NDWA 2BG5A 3UZZA 3TR2A 1SFSA 2V5DA 3PULA 1P48A 2DVTA 5JH2A 3LI1A 3CM4A 2X1SA 2CIPA 3KEHA 1JL8A 3EKGA 3IEBA 3ITCA 4KF1A 4RNFA 1W2VA 4PMJA 5BMXA 1ZP4A 3TMLA 4UTTC 4FHAA 1GQJA 4E2BA 3RR1A 2HS6A 3TYAA 3LSCA 4IM4A 5E09A 3AHVA 3PZ9A 3KVLA 1W32A 2G3NA 3MJYA 3VI2A 4A3UA 3UYIA 1G1YA 3JRKA 2DGAA 2C1IA 5I23A 7ENLA 4TX6A 3SFWA 2DY3A 1XIJA 4S39A 1RD5A 1LL4A 3DAQA 5AC4A 4AWSA 4J40A 1GQLA 1I4NA 3GQYA 1TIMA 4F0HA 3W1TA 3LV6A 4K8EA 1FX6A 3IIPA 4DAIA 3AXKA 3WQ6A 3BW3A 3ABZA 3HGOA 2Q3RA 3LBMA 3OEXA 4FLOA 4QFUA 3ZMRA 5KZ6A 1NWTA 4O16A 5ECVA 1KKRA 1GOMA 1G4TA 2Z1BA 1EJSC 1PIIA 3C5QA 1ITUA 1PL9A 5BRPA 3W7LA 3NWRA 3G1XA 3L2LA 1PCWA 3T0CA 3U2CA 3DKLA 1UMYA 5ENLA 3OZPA 3GXDA 4EK7A 1H49A 4RXFA 2XSXA 1B1YA 1YXCA 2F6UA 4HVXA 3QC0A 1DHKA 1HGWA 3F5KA 2D1ZA 2QLYA 1FFRA 3NL6A 4GINA 2ACQA 3DX5A 1XH2A 2LLEA 2MNRA 3ARZA 1J5SA 3JZUA 1WA3A 1MQRA 1O6IA 3V4BA 1PX3A 2PWFA 2DORA 1LQ2A 1WP6A 1I8JA 2Z7GA 1V0LA 4Q7NA 4GRSA 4L61A 4KMQA 2ZUNA 3BSGA 4H9YA 3BXWA 5FF2A 3LTPA 2OSWA 3VDBA 4C6IA 4ML4A 2R24A 2A3LA 3NXLA 4TU1A 1L6FA 5HXMA 3T7VA 4H8NA 1LQ0A 1FWSA 4R33A 2F2HA 3I3EA 1LBLA 4A05A 1OEPA 3CEPA 3TNBA 2RDUA 1BYBA 3T4WA 3V18A 1KCLA 4S23A 2DZUA 1DPMA 1AL8A 4HB7A 2PTYA 5JMUA 3BV4A 1V3MA 1ZAIA 4CGTA 3IJ9A 3PP7A 4DJFC 3LLDA 1Z3NA 4JZ5A 2CLLA 3EWYA 3WLHA 1OFPA 3BARA 1JPHA 1NTHA 5AVNA 4LV9A 1RP8A 1Q7MA 4DYEA 3B4YA 1GYNA 4GJ1A 1J12A 1S5VA 2VRJA 4BA0A 2WMIB 4UUIA 3CUGA 1RBLA 3SRHA 1OC6A 3EWBX 5C8BB 1R2RA 3TU9A 4K2SA 3L23A 2BY3A 2ESCA 1H5VA 4UFMA 1B2YA 4UBPC 5J04A 4M80A 1EJUC 1JDEA 3FKKA 2Y6ZA 4ZO8A 2BX7A 1M04A 2IXUA 2JF7A 4C6KA 4R7JA 2Z00A 4NJKA 4HNUA 3S2LA 3R8HA 2ZC8A 4LEFA 1FP8A 3FVMA 4C7GA 1HW6A 1T7LA 3L12A 4WHBA 1XUUA 2OT1A 4UZUA 3ARWA 4Q7IA 4NI8A 1M65A 2PZNA 2XN2A 3VIPA 2QUTA 2YW3A 5HAOA 5CH9A 4W8LA 2ZA3A 2CKSA 1B90A 2ZZ4A 2J47A 4DPPA 1QBAA 2Z4GA 2VQUA 2WC7A 1KXVA 1P6BA 1VHNA 3AIRA 1NY1A 1V03A 4UTMA 4LS2A 1OIMA 3TDFA 4YHGA 4PR4A 3W0KA 1JCMP 4DWSD 4LGXA 2WBGA 5KITA 4GI8A 3L68A 3TXVA 2GUYA 3MDUA 3GX9A 4NU7A 1W9VA 3OG2A 4GIAA 1OD8A 3TN3A 4KPLA 1H0IA 5DMLA 4GYKA 1W3HA 3FK4A 3EBVA 5D2XA 1LL6A 4F66A 1KWGA 4V1YA 4G9PA 3SCVA 2G95A 1CLVA 2ZZ2A 4LUTB 3UYCA 4Y7EA 3W86A 4H7CA 2I17A 6CGTA 3O15A 3CYVA 4PN2A 4LALA 4AISA 4MWAB 2WVTA 3CUZA 1WQ5A 2C7FA 4I5RA 3DG7A 3KL3A 2YCKX 1MEWA 3S1UA 3QF0A 4ZA0A 3BJFA 4O1AA 1ADSA 5GJPA 3WK0A 4JXCA 4LVFA 3ARQA 5HANA 3TMQA 3L5LA 3UJFA 2E5DA 1CGTA 3RO8A 3JR2A 3WBXA 4WEVX 1DXEA 4RE4A 1H60A 3PVFA 2BY2A 2PDYA 4RZ4A 3WLLA 3M0KA 3QW4B 1KXHA 3NIYA 3RILA 4IGNA 3OQEA 4G1NA 3B3DA 3Q37A 3A4AA 5EMJA 1H7NA 2E6YA 2EPLX 1CGXA 3FEQA 3SCTA 3OBAA 4AD4A 4X2PA 4P61A 3VGDA 1TFVA 1H09A 1NP0A 1PVNA 3O6AA 2QJIA 2PLJA 5DY3A 1W91A 3GB6A 4HZ7A 3DIPA 4US5D 5I3GA 1C90A 1F73A 3E0LA 1P6CA 1W1VA 1MNZA 4CD7A 4W88A 4A8NA 1I2NA 4BWLA 3KP0A 3S1XA 3UG3A 3HG3A 3C2RA 4DJDD 4IXXA 4JTQA 3CZEA 4PTVA 1FHVA 1VLIA 2PS2A 2ABBA 2AL2B 3DGRA 4Q22A 2PDWA 5A8GA 4UFHA 3LTYA 1VR6A 1QHPA 4LPCA 1OVDA 1KXQA 3C2OA 4S3BA 2VEGA 5CPMA 3SRDA 4IIDA 1R85A 1YE4A 1GORA 1UKSA 1XRSA 4YWSA 1UZ4A 1F8IA 4GLEA 4A21A 1PKNA 4ZE4A 3OZMA 3FA4A 3DH7A 2H6RA 3F5JA 1B3XA 2J13A 1UB3A 5GNXA 1UP0A 5E5CA 1ITCA 2FYMA 4FI4A 3KCJA 3O6CA 1AZ2A 4M29A 3MBFA 4ENLA 3BLOA 2X42A 2V3EA 2HSAA 3Q45A 4QCEA 1K03A 2Y62A 2WHJA 3FJLA 3QRHA 5DO8A 3NNTA 4H19A 4KH2A 1MQQA 1LOSA 1XDLA 1R0MA 1UA3A 2XH4A 2D69A 4LC8A 3DBNA 3JZEA 2NWSA 2W62A 4LYKA 4P7QA 3UZWA 5FEPA 3T0TA 1TA3B 3TNOA 2VR2A 3I68A 3NAVA 3WQVA 4HNNA 4AYGA 3T05A 3OVGA 3GO2A 1OK6A 4HOWA 4UFLA 2ATMA 1EJRC 4JTIA 1G4PA 4ZB0A 4YJ5A 4Z17A 3N9KA 3AXMA 2D3NA 1YPXA 4XBKA 4AF0A 2QF7A 1BSIA 2PC8A 4N9DA 3K4DA 3AXHA 1G7VA 5JU6A 4BEQA 3LCLA 4F8XA 4ICNA 3GC5A 2OZ3A 6TIMA 3H4GA 1CT5A 3EOLA 5K3VA 3P0XA 4ATLA 1ADDA 2IKHA 4UTFA 2XJ7A 4MY1A 4X9SA 1EKOA 2YCJA 4TVCA 3WEMA 3TLLA 4Y9AA 4QQ3A 3QHNA 1OM0A 1JD7A 4NYUA 1J01A 3W02A 3WLJA 4FZIA 4R3UA 4G2DA 4ZBCA 1XIGA 6XIMA 1GOOA 3WG6A 1P1XA 4M6UA 3NDZA 3M0YA 3AMDA 3CT7A 3UXDA 3EOSA 3R79A 4HYVA 3AIVA 5C2GA 1XG4A 1RQHA 4QXIA 4FSAA 3CUHA 1Q6GA 4JFSA 2J8FA 2VZSA 3B8UA 1VENA 1X1ZA 5A95A 4XB3A 1HKKA 2HE8A 4HCDA 3QGKC 3S2MA 2Y63A 1W5NA 3ZIZA 5HQLA 2PTZA 2J8TA 1Z44A 2DSVA 1DIEA 2XYLA 2PA6A 3MHGA 5AHIA 3WBAA 1JZ3A 5C2CA 3UR7A 2VDGA 4AWEA 2Y8KA 1IR2A 1NFGA 1K70A 1JUBA 3F5LA 1XPYA 2INFA 4IPNB 3EX3A 3TONA 4LS1A 3BSHA 2CITA 3W71A 1C29A 1YE6A 3H70A 5I02A 1A5AA 1IXNA 2QHAA 4ZQRA 2GSHA 3PG8A 2R9RA 3N2BA 4NZCA 3UPMA 3DN5A 3S6OA 1AUSL 2ZA2A 4EE9A 1KBJA 2OYMA 5BCAA 3B9OA 3TYCA 3SB0A 1L0PA 2GDQA 1X7IA 3CL7A 1AD4A 2PP0A 4IJBA 1PDYA 3Q67A 3BVJA 3F4NA 2NVAA 1CXIA 3ENLA 4ZQPA 1PZ3A 2YYTA 3KBMA 4PMDA 4F3HA 3MWAA 5FAGA 2EO7A 1M3UA 3I3BA 3M1ZA 1MZRA 2O92A 4Z2GA 1XLKA 2I56A 2PWDA 4M81A 3W7PA 4LF2A 4XZBA 4DHGA 3GNRA 1M9HA 4R9OA 3SIMA 2BY0A 4C5ZA 4G6CA 4F9DA 1YX1A 2HE5A 5JIWA 3ISIX 1X38A 1MYRA 4PUUA 4FLRA 3G3DA 2WM1A 4IT1A 3CMFA 1ZUAX 4ASTA 1RA5A 2ZWZA 1TZ7A 4UQEA 5I00A 1FA2A 4O11A 3TH6A 3N3MA 1QW9A 1TKKA 2WB5A 4IJCA 1PHQA 4DWDA 2Z29A 1FCUA 1ICQA 3OHMB 1QK2A 3O06A 3HF3A 3NQFA 4J3UA 3MMDA 1U1JA 3VD3A 1VFMA 1Q2SA 3DHUA 2QPSA 4REQA 3VC6A 3KFTA 4MJ4A 2P10A 5CQ1A 4RR4A 4N6FA 2OGJA 3KBSA 1UUQA 4AIUA 1UJQA 4PL2A 3GWQA 1SQ7A 1JULA 3QGVA 4C91A 4AZGA 1W9XA 3CAVA 1TCMA 3HV9A 4N9BA 1J11A 1WAWA 3DI0A 3R0DA 4DBDA 1W1ZA 4O15A 1Q63A 5HMFA 4HZ8A 1JUEA 3KL5A 4TMBA 3WFZA 4BWLC 4YCOA 3ZYZA 4MJZA 1K8ZA 3SCUA 1XFCA 1W1TA 3P8IA 2VP8A 3FSTA 3HQOA 1BKHA 4D6EA 3WDJA 4DLMA 3SURA 3EXRA 1JPIA 1QTWA 1P0NA 1HJQA 3MKVA 4RX0A 1VPQA 3QLDA 4KEZA 4CNOA 1TYGA 2OCZA 3KRUA 4X61A 5TD4A 3SSJA 1X6NA 2Y8VA 4CVWA 3QFEA 4MDOA 3DI1A 3GU9A 4PTDA 5C9UA 4IMCA 3LNMA 4L6DA 3E2QA 1F3EA 2CLIA 2DV0A 5DX7A 1QI3A 5A6JA 1QOQA 4B3KA 5JH1A 3KX6A 3OQ8A 1S2VA 2PTWA 4H9VA 4IIBA 3SN1A 1XX1A 1NFBA 3LCXA 1EF3A 3EXTA 2G0WA 3RG6A 1KRAC 4GKTA 1QMLA 5CPQA 1QBBA 1RR2A 1W9BM 2AQVA 1J10A 1K6AA 3JW7A 1BD0A 2BOGX 3W7MA 5TNVA 1B3ZA 4LW7A 1EOKA 3CV2A 5L6UA 4MADA 2NQZA 1IEWA 4KWVA 3ITGA 4G56A 3HM7A 7TIMA 3V5FA 1AW1A 3FY1A 3EWDA 3GK0A 3S42A 1XBVA 3M7WA 3S1WA 3T8QA 4KIRA 1HJXA 4US6A 1K4GA 3FHAA 1MDRA 4UTJA 4H4IA 2B7NA 1D9EA 2BDQA 1X97A 2EAWA 4RE0A 2Z1SA 2VZTA 3VIGA 2VWTA 2CZFA 4ECLA 3GNNA 5D2VA 3SCWA 3WELA 1F05A 5BXSA 4IMEA 5LNUA 2QCDB 4JX4A 3POHA 3S1VA 4LQ1A 3HBLA 1V7AA 1B4EA 2WNQA 3IUIA 1XBXA 1MZHA 2WANA 1K9FA 5I24A 4GUJA 3GIYA 2J7EA 2J62A 3ARVA 3BLFA 2BHYA 1Z9AA 3O0KA 2HROA 4OKDA 1TMQA 5E0FA 4DYJA 5T26A 1EIBA 3SCSA 2QGHA 2PLMA 1A3WA 3GNDA 4JTSA 3DKJA 3G6MA 2GDUA 3IVUA 3QBUA 4CD6A 1QXLA 4OIFA 1X1NA 3BCJA 1E0TA 3RUBL 3GTNA 3E02A 2QT3A 1RJPA 4QITA 4Z1YA 1FWIC 4QEEA 3R10A 2NUYA 4H01A 2QV4A 5E1QA 4CU7A 1AJZA 1M41A 4NSBA 4UMBA 3MUXA 4O28A 4C6JA 2OEMA 3CB3A 3Q65A 1UA7A 1ZY9A 1XHGA 4XVEA 1OBAA 3N11A 3G5EA 3MBDA 3LY0A 1J9YA 1ZB5A 3BMVA 2VC7A 3UJRA 1JPMA 4OE7A 2WYSA 4YIWA 3W81A 3AC0A 9XIAA 3ELFA 1BHGA 1ZNNA 1XLGA 4UXDA 1MRAA 2P76A 3PFMA 4C1NB 1ENUA 4XBSA 3TYUA 4YWIA 3KCOA 3UD6A 2ZXQA 5K9XA 1KM4A 1QW8A 1L6YA 5IDZA 2VVNA 3MPGA 3QYSA 3ES8A 3ID7A 3LCWA 4E4FA 5M03A 1ZBWA 3H55A 3AALA 4ZO7A 3V35A 2VCBA 2GVJA 3M5YA 1DTNA 4BQ2A 5A69A 3M4HA 1DJQA 4TO8A 5C5YA 4H7ZA 5AC6A 3NPVA 4KS0A 2GGJA 2BLEA 3SUVA 2OU4A 2PBGA 1JGIA 1LJYA 2PDKA 1UIPA 1BRLA 3OIXA 4PMOA 4C7DA 4C90A 4CD5A 1IEXA 2G96A 2CLFA 4L1GA 3N6JA 3VD4A 4ZFCA 4Y6GA 4B2DD 1EGMA 3DYPA 4V33A 3LZ5A 1UBSA 1UP3A 4JCMA 1A5KC 2D3LA 3BUVA 3WQFA 4J3TA 2BS9A 4GQBA 2ZCGA 4H83A 4WDWA 2FPYA 4FK9A 4GX8A 5BOEA 1XPGA 4B16A 4JQ2A 2P0IA 3W2JA 4C1KA 2Z1XA 5C6MA 3INPA 4OJYA 1KKOA 3VO0A 3T9PA 2WKJA 3SJ3A 3MSYA 1GQKA 4KWOA 1E1EA 3KOWA 2VUNA 2PTDA 3LYEA 4RJEA 3E2SA 4L80A 5LIUX 1K1DA 2FZ8A 4JIIX 5BZAA 3OLDA 3WLTA 3LUTA 2DQWA 2CYGA 4DVOA 2EPOA 4E6MA 4LUJA 2DSWA 5DMMA 4D9PA 5T9CE 3TV8A 1E9YB 2ANUA 3LV5A 4DJDA 1VJZA 3W7DA 4JIPA 1BF6A 4XKMA 5D32A 4B9YA 1WB0A 2QPUA 3GVVA 1OG6A 1I2PA 3WMSA 1RSCA 1SW3A 4OVXA 4GH3A 4V1XA 3LPOA 3GD6A 1Y5VA 3K13A 3XIMA 1TTQA 3BW2A 2GJLA 3WUGA 3TK7A 3EA3A 4ATDA 1HQTA 2IKIA 3VNLA 2O4QA 4GY0A 4IPLA 1KTNA 4K3ZA 3U8GA 4UQBA 1DORA 3RX3A 1KC7A 1KRMA 3IGXA 2ZFAA 2ZZ3A 2QDEA 3MUY1 3MY9A 3L4YA 5CGQA 2WZHA 2E40A 2W79A 1AODA 5TQLA 1UH4A 1AK5A 4K68A 4I90A 4ZQOA 4B5TA 3DGBA 4NILA 1QO2A 2DDXA 3QFWA 5D9NA 2F61A 3IWPA 3LX9A 1IEVA 1XYBA 4HOZA 1R38A 2O9PA 1TV3A 4PRWA 5JBFA 1OC5A 3H23A 3MHFA 3P84A 4WSHA 1L6SA 4RL3A 1C8VA 5CPNA 1TPFA 4H04A 3HOJA 3GTIA 3KVKA 4Q4QA 1UD8A 4KIEA 3ZXWA 3VNMA 1TWZA 2P8BA 3I4KA 3EX1A 1TJRA 5IOBA 3N12A 4DUWA 1UWSA 2EKGA 2WNWA 2QUUA 5FEWA 1FCQA 1QPNA 3G0SA 4GQ0A 3RCNA 4LB3A 1UZHA 3I6RA 1A49A 1H4PA 5E9XA 1EIXA 4HA1A