1YIXA

Crystal structure of ycfh, tatd homolog from escherichia coli k12, at 1.9 a resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
265
structure length
265
Chain Sequence
MFLVDSHCHLDGLDYESLHKDVDDVLAKAAARDVKFCLAVATTLPSYLHMRDLVGERDNVVFSCGVHPLNQNDPYDVEDLRRLAAEEGVVALGETGLDYYYTPETKVRQQESFIHHIQIGRELNKPVIVHTRDARADTLAILREEKVTDCGGVLHCFTEDRETAGKLLDLGFYISFSGIVTFRNAEQLRDAARYVPLDRLLVETDSPYLAPVPHRGKENQPAMVRDVAEYMAVLKGVAVEELAQVTTDNFARLFHIDASRLQSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords deoxyribonuclease ycfH
publication title Crystal structure of ycfH, tatD homolog from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 100
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 3.1.21.-:
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01026 TatD_DNase TatD related DNase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1yixA00
2FVMA 3AU6A 2IMRA 3LSBA 4R85A 4J5NA 1V7AA 1EZ2A 2Y1HA 1ADDA 3A3WA 3OODA 3LU2A 2FTWA 2A3LA 3GIQA 4YIWA 4PBFA 4ICMA 3UF9A 3AUOA 3F4CA 3FDKA 2XIOA 3IGHX 2I5GA 4C6NA 3HTWA 4JOMA 4XAZA 2Z25A 1ITUA 3C86A 1UIPA 2OQLA 2UZ9A 3B0YA 3MDUA 3LGDA 2CZVA 4HJWA 3TN3A 1V4YA 3OU8A 3NEHA 4IGMA 4H9YA 2YXOA 2VHLA 4CQDA 2Z28A 4OFCA 1R9YA 2RAGA 4KEUA 3T81A 4HK7A 4H9TA 4BKNA 1XWYA 2YB1A 1POKA 3O0FA 4XD6A 3GTIA 2HBVA 4C5YA 1DPMA 4QROA 4G7EA 4ERIA 3GTFA 4UB9A 1A5NC 3LNPA 4TQTA 3N2CA 1ONWA 3FEQA 2GOKA 1S3TC 1QW7A 1J6PA 4C6MA 4RDZA 2HNHA 1YIXA 1XGEA 1UIOA 4IF2A 1EJWC 4HA0A 4NI8A 4LFYA 1NDZA 2WJEA 1FWAC 3WYZA 4C6BA 3HPAA 2DVUA 2GSEA 4D8LA 5HMEA 3UBPC 2BB0A 4CQBA 3RN6A 2PUZA 3IRSA 3V7PA 4H9ZA 1FKWA 3LY0A 3UPMA 2D2GA 4Z42C 1RK6A 3LGGA 1P6CA 2O4MA 2Z2AA 3OJGA 3PANA 1EJVC 1FWJC 4C6CA 1FWFC 3MSRA 2WJDA 3DC8A 4LH8A 3MVTA 3TN4A 4KQNA 3S2MA 1QXLA 4WGXA 2Q09A 1GKPA 4B90A 3FDGA 3TN6A 2R1MA 4QTGA 2Z00A 2I9UA 1FWGC 2EG7A 3LSCA 4LANA 5A6TC 1ITQA 4KETA 4KIRA 1RJQA 2GZXA 4C6QA 4J2MA 4GZ7A 1KRCC 4IG2B 1PTAA 1A5KC 4GC3A 3LS9A 3T1GA 2ZC1A 1KRAC 3EGJA 4R7WA 3A4JA 3E38A 5AKQA 2FVKA 1YRRA 4ZSTA 3B0XA 2R1PA 2Z27A 3URBA 4PBEA 1VFLA 3KM8A 4DYKA 1UBPC 1FWDC 1RK5A 3MJMA 3QY6A 4C6DA 4KEZA 4GX9A 4RE0A 2YZ5A 4LAKA 4EPDC 4C6OA 1M7JA 1NDYA 4XAYA 3D6NA 1GKRA 3DUGA 2Z26A 4RDYA 4L6DA 2BGNE 2AMXA 2OB3A 1ZZMA 1WXZA 4C6JA 4HK5A 4DIAA 2OOFA 3IV8A 1V77A 4PCNA 2VC5A 3PBMA 3UR2A 3E74A 4G2DA 3RHGA 1R9ZA 2GWNA 1PB0A 2OGJA 3CJPA 1XRTA 3GUWA 3MKVA 4QS5A 3GU9A 2AQVA 4CNTA 4H9MA 3RCMA 3MDWA 1HZYA 4CNUA 1I0DA 2PAJA 4B92A 4C6KA 4DZHA 4IFRA 3WMLA 2VR2A 3F2BA 3PAOA 2QVNA 1I0BA 1YBQB 4LAMA 1P1MA 4GX8A 1BF6A 1KCXA 4DZIA 3ORWA 2HQAA 3K5XA 1EJSC 4LCQA 4V1XA 5HMFA 1FWBC 3SO7A 4CEUC 2Z24A 5LXXA 3S2LA 1P6BA 3GU2A 3MPGA 1W1IE 3GTXA 4C60A 4WVXA 1NDVA 4BY3A 1A4LA 3OOQA 4DO7A 2P53A 3URQA 4PE8A 1PO9A 4XAFA 1M68A 1A5MC 2R1KA 4LCRA 3F2DA 1PSCA 2AQOA 4IG2A 3F4DA 4LEFA 4L9XA 3PNZA 3IJ6A 4IFOA 2QT3A 2UBPC 4XAGA 1E9YB 2Q01A 1R9XA 4DNMA 2OODA 3BE7A 3DCPA 4H00A 4CQCA 4IGNA 2VUNA 1V79A 3IPWA 4KESA 4IFKB 4EPKA 3ID7A 4H01A 4QSFA 1O5RA 4GY1A 4DI9A 5HMDA 3K2GA 4F0SA 2FFIA 5E5CA 3E0LA 3E0FA 3E2VA 4GOAA 2QPXA 4E3TA 5FSEC 3F2CA 2PGRA 1RA5A 1FKXA 1JGMA 2DVTA 1XRFA 2R1LA 2HBXA 5FSDC 1KRMA 1EJUC 5G4HC 4GBDA 4C6PA 4J35A 1YMYA 3QY7A 3A3XA 3IARA 4XD4A 1A5LC 4AQLA 3R0DA 4B91A 3AU2A 4LCSA 4EPEC 3ISIX 1O12A 2E25A 4F0RA 3MTWA 2PGFA 3WZ0E 4XD5A 1RJPA 4WHBA 2GWGA 4C6IA 4GY0A 4DI8A 2Z4GA 4IH3A 2YB4A 3CAKA 3EWCA 4I6KA 3ITCA 4NP7A 2O4QA 1KRBC 4INFA 2ADAA 2HPMA 1K70A 1YBQA 4NG3A 4PCPA 3QY8A 2ICSA 1EYWA 1RA0A 2QS8A 4C6LA 3NQBA 1A5OC 1RAKA 3CS2A 1EJRC 2KAUC 4C5ZA 3E3HA 2ANUA 1FWEC 3B40A 4AC7C 2PLMA 1EF2A 3HM7A 1ONXA 4GXWA 1FWHC 2W9MA 1NFGA 2R1NA 3SFWA 4LAOA 4H9UA 5CH9A 2FTYA 3TNBA 3URAA 1J79A 2VM8A 3K4WA 4C65A 4DLFA 3QGAC 4ZSUA 3GRIA 1K1DA 3O7UA 2Z29A 2WM1A 3PNUA 4G7EB 1FWCC 4XD3A 4IQJA 4DLMA 2D2JA 3G77A 3RYSA 1UMLA 4CNSA 3GIPA 2Z2BA 3LA4A 1E9ZB 4F0LA 2EG8A 4MUPA 4R88A 3ICJA 2G3FA 3GU1A 4IFKA 4GY7A 2VC7A 3UR5A 3URNA 3JZEA 3GTHA 1GKQA 1POJA 1V51A 3QGKC 1RJRA 3MVIA 3GG7A 2F6KA 2WJFA 4ERGA 3TN5A 2DVXA 4HK6A 2D2HA 4KERA 4KEVA 4QS6A 4B3ZA 1IE7C 4ERAA 1J5SA 4H9VA 3S2NA 4QRNA 4V1YA 3OQEA 4P5UA 4UBPC 1FWIC 1K6WA 2E1WA 4EP8C 4GK8A 3T8LA 2P50A 4I6VA 1M65A 4RDVA 4RZBA 4BJHA 4H9XA 4LALA 3EWDA 1J6OA 3S2JA 2EG6A 4C6EA 1A4MA 4GYFA 4C6FA 1EJXC 1EJTC 3OVGA 1YNYA 2HPIA 3NURA 3S4TA 1NDWA 4RDWA 4KF1A 4EPBC 2Z7GA 4M51A 3IACA 4CEXC 1WXYA
chains in the Genus database with same CATH superfamily
4GQRA 1IXQA 4GVIA 3QLLA 4AZHA 3SQSA 1UH2A 1Z8AA 1DXFA 1UD6A 2ABBA 4MF4A 1P6WA 4JOMA 1K9EA 3LZ3A 1V3LA 1JGIA 1BYCA 4LS0A 5A6BD 1AQHA 1US2A 1JCYA 1I6NA 2F8QA 3KL0A 4DBUA 4GBUA 4L64A 2PI6A 4H6RA 2PDXA 4E2BA 1TV5A 3KS6A 2FPTA 2EBNA 4PH6A 4Z2LA 3ES8A 1DV7A 1PUDA 3JZUA 3P8JA 3EOOA 4GFSA 5CLTA 5EU9A 2CLLA 1AH0A 4JN6A 1R6WA 5AYBA 5HDRA 3P82A 2ATMA 2BY1A 1YEYA 2X1SA 4YHEA 4PEEA 2JGYA 3BCDA 3VCCA 1C9WA 2HV5A 3DHPA 3TJLA 1P0EA 4FHAA 4JPGA 5T9BG 1JPDX 3W23A 4KWUA 1F2JA 3GH4A 4H83A 4LT9A 4LF1A 3TSBA 1E43A 1EYEA 2GVLA 1QASA 1GW9A 1LCOA 1QJWA 1NIUA 1VFHA 2Y61A 1A5CA 3TN4A 3S2MA 4CLMA 3WNKA 5EMLA 4TX8A 2I9UA 2R6OA 3WF1A 1OCJA 4ZTYA 4F9JA 1SQ7A 3WQDA 2XTKA 4UFKA 4O1DA 3TTSA 4DUWA 3LS9A 1O4UA 4F66A 5JIPA 3WN6A 3U4FA 2VEMA 3ZFHA 4REQA 3R79A 2DSUA 3CL8A 3LMYA 3CTTA 3PZVA 3R11A 1CLKA 1SFJA 3FAWA 4LOCA 3UZZA 1NDYA 4CN4A 2WQPA 5LIWX 1K9FA 1XM3A 2O92A 2GVYA 4R53A 3MHGA 4IPJA 3N15A 5DMNA 3OBKA 2PDKA 1V3HA 1XBZA 3CJPA 2DT0A 1TIMA 1LBFA 3TFCA 3IK4A 4H9MA 3M5XA 2O9RA 2VFDA 3SY5A 3MDWA 5BZAA 4OJYA 3LM7A 2PTYA 4AEOA 1F8IA 1CLVA 2W91A 4ZTXA 4GI8A 4UTJA 3EWBX 1BF6A 4FAMA 2E6YA 4DUOA 4EIVA 3E5BA 4LNYA 3G8RA 1E6RA 5JBEA 2XSAA 1V03A 3OYXA 1FRBA 5CZTA 1OC5A 3W0KA 1SZNA 4E2DA 3TEVA 2BOFX 4MNJA 1OFQA 2HRWA 1FFQA 2Z1VA 2ATSA 2VCBA 1WDPA 4M80A 2A85A 4Z1DA 4QXIA 4IPIA 4D8AA 3VIHA 2R82A 4LB4A 2J9XA 1OCQA 4ONVA 4DNMA 3BE7A 3M46A 2VUNA 3PG9A 2WCAA 2NQLA 3HBLA 5I23A 3ID7A 3N12A 4H01A 1T41A 3PJXA 4DI9A 2VTFA 4U5IA 1RY0A 4PA8A 1PDYA 4P7NA 5AYZA 3E0FA 3AHYA 2YL8A 2GK1A 3RM9A 4ZR8A 4BF7A 1YDYA 2PWHA 3H53A 4L6OA 3W26A 1RA5A 3W6MA 4X63A 7A3HA 4E8DA 2VZTA 3THQA 3LRMA 1W9XA 4IL2A 2GJLA 3VMPA 2HROA 4PMVA 3R0DA 1XC6A 2VFEA 3SRFA 4AZ6A 5CPLA 2EPMX 3N9SA 3V5CA 5AVNA 1BD0A 2OKTA 1XIDA 2NQZA 4ORIA 3WL1A 4NP7A 5D05A 4YHGA 1RR2A 2JIEA 3AYRA 3ZR5A 1TE6A 1KRBC 4WIWA 1PKLA 5CJNA 4A22A 1UR3M 4BI7A 3LQLA 3NM1A 4A05A 4C7FA 1A80A 3UU0A 2TRSA 3WNPA 2J78A 2TMDA 1TA3B 2J13A 3Q58A 5HINA 1M7PA 4KCTA 3DG6A 4QFUA 3HM7A 5KINA 1FWHC 2W9MA 3U48A 3CMGA 1CXEA 2Y8VA 4LUSA 3MUXA 3VGHA 3S8HA 2BG5A 5HWMA 1WAUA 1XX1A 1HL2A 3K4AA 3HFYA 4D6JA 5A2BA 3UWEA 4QLJA 1GVFA 3AXXA 4UQ9A 1S38A 3T78A 4KFNA 4EAMA 2VGBA 3AXMA 2ZXQA 1HW6A 4UNLA 5GJMA 1XF0A 1I2PA 1ESWA 3GTHA 1JPMA 3LHWA 2D73A 4WXZA 1R3QA 3G3MA 1T0OA 4E4UA 1ZAJA 4GHRA 1GZJA 1SO3A 2POTA 3N73A 4XKYA 1H09A 1M53A 2I5QA 4GK8A 1JXJA 3N34A 3B4UA 4Z2JA 2WOQA 1PBGA 5D2YA 2WKJA 4OUEA 3B3DA 1R3SA 2PBGA 3NURA 1S2UA 4B3KA 4EPBC 4WEVX 1XIHA 3IACA 3T8QA 1SMAA 1WXYA 3CM4A 3R10A 4QNEA 1UC4A 3CUZA 3HG3A 2C16A 1LG1A 2I56A 2CLKA 1YADA 3GE7A 4NXKA 4IZGA 1UZ1A 3L4YA 1VIWA 2X7WA 3PUOA 3R43A 1K3UA 4WUIA 4I9JA 2CZVA 2XN2A 3OU8A 3WLMA 3VNLA 2XH7A 3BXWA 3RO6A 4WX2A 1E3ZA 4A21A 3RLHA 2CZFA 2VT0A 4H9TA 3IJ7A 2X2GA 3O0FA 3N9RA 4XVDA 3N19B 3FIGA 2VO5A 1TZ9A 3EA1A 2IPGA 2D0GA 4P8UA 3JU2A 1JDDA 1W1PA 4I7VA 3C4UA 1SZGA 3PTDA 5FEPA 3FVMA 3U0HA 4FA3A 4JQ4A 3MZ2A 4DF1A 1GHRA 3QMRA 1EWDA 3QFEA 1WZKA 2V6AA 2CLEA 2PGEA 3CZLA 1KM3A 1W1ZA 3FY1A 3PPHA 4DBEA 5DO8A 1AQ0A 3FYYA 1FWAC 1V08A 4K36A 3UBPC 1XSIA 4HZ8A 2YA1A 4O19A 1ZALA 3A9BA 4FR6A 2DGAA 2O4MA 2XHYA 2GQAA 3SJNA 2NWSA 5BNKA 4C6CA 2QEZA 3LLDA 3DHFA 3TSMA 5HBFA 4JXCA 1W3KA 4XISA 1OFBA 5D9OA 4JKKA 3AJ7A 3MUAA 2Z1KA 3R89A 1GKPA 1V6TA 2WNZA 1M04A 5KZMA 1X6UA 4JTRA 3FDGA 1LBLA 3MT1A 3I4KA 3B8TA 4NQ1A 2NQ5A 3SCUA 5JH1A 2DP3A 5BXSA 4C6QA 3DFYA 4WLCA 4UFHA 4ES4A 3FCPA 5D8ZA 1GEHA 1XPYA 2OYKA 1AFSA 4EF8A 3PVFA 4RXGA 1LWJA 5G1TA 2PE4A 1OX4A 3M0VA 1NVMA 3RGTA 1UBPC 2AKZA 1RK5A 2F84A 1QPKA 4GX9A 5I6SA 1UWSA 2FKPA 2H9AA 4D1JA 3C2FA 2EJAA 3W7CA 3VIPA 4QR6A 4ZFCA 2G41A 4Q8VA 4Y9PA 4GA8A 1J12A 3E74A 1ADOA 2PWUA 2JF7A 4IJRA 3B97A 1KFEA 4UTWA 3G6MA 1OK4A 3BICA 1JYNA 3AHXA 4ZOCA 3N2TA 3LRLA 1WV2A 3A4XA 4LV4A 4DZHA 3PY2A 1FCQA 1H51A 1YBQB 3G2GA 3ORWA 1E70M 4UFLA 3EKLA 1XD1A 3F5JA 1R7AA 4DPPA 1CYGA 4Y90A 1Q13A 1VF8A 3FGCB 1DIKA 2W27A 3VOGA 4IMGA 3TNOA 1PE1A 3TQVA 4YU1A 3EOUA 1Y5WA 5EMYA 3WLNA 5HXMA 5HPCA 1SW3A 4ZMGA 1JZ7A 3CL6A 4M6VA 4KMQA 3HA1A 1H50A 4AD1A 3BMWA 4GUFA 5KEZA 1WKEA 1W9PA 4QJ5B 1R9XA 5K3VA 4AWSA 2GYIA 2W0UA 4O13A 3C2YA 1QPOA 2PEVA 3GLCA 2QPUA 4IOTA 2TYSA 3AIRA 4WRHA 5EFDA 4M24A 3ZLFA 2GUUA 4FIQA 4JN7A 3HQOA 1S2AA 1IXNA 1QO2A 1M7OA 2WAGA 5I79A 3VNZA 2W5FA 3DBNA 2X1RA 4FNPA 3SCNA 5HR6A 1HN1A 3LHYA 1XIGA 1XDJA 4NNCA 3ZQ9A 5CKSA 4EWJA 1G4EA 3W2LA 1O12A 2E25A 4Z17A 2CWNA 1O1HA 4NJIA 3WD2A 4CU8A 4B5TA 4Q7BA 4GWEA 5M3WA 3MHUA 4Z08A 1UA3A 2ZA1A 4ZGYA 5AN7A 3I6RA 2CZEA 4G5DA 3BPWA 4X2PA 5ECVA 4GZIA 4PTWA 5ABTA 2YZRA 1D7KA 3C3UA 4CNPA 1EDQA 1MO0A 3QQ1A 1CZ1A 5AYYA 5IFTA 4UZSA 4XZIA 1B2YA 1W0MA 3RAOA 3UJFA 1WDQA 1ODUA 1EF2A 4K1WA 1GQKA 3KBSA 3WMBA 2WZMA 4JDBA 1QFEA 1R46A 1SU5A 2FJKA 1GVIA 3NQ7A 1W3HA 2HE8A 2QMKA 3DXIA 4NZ5A 3WNNA 3W28A 3GDLA 4JIRA 4TO8A 2AOSA 1FBAA 3WLRA 4O8RA 1FWCC 3WJSA 5EA9A 2I16A 2Z2UA 1KCZA 5J04A 5CPQA 4PRRA 1W3NA 3QZ6A 2JIWA 1UR8A 2EG8A 1DEDA 4K38A 3I6TA 2NT0A 4DUVA 3L67A 5REQB 2CBIA 1S2WA 1POJA 3OA3A 2WJFA 4WY0A 4HK6A 4N2YA 3TYUA 4IIHA 3KCJA 2HTMA 4V1YA 2O9TA 3OQEA 1UP3A 3W7MA 3RRXA 2V69A 3PZUA 2YL6A 3TDFA 2WMIA 4JTCA 2RUSA 4RUBA 1ZS2A 4O54A 3RO8A 3NQ2A 2ZUTA 1DIEA 1I2NA 4MKNA 2OZ0A 4NRSA 2VVSA 3PSWA 2J7GA 3NDZA 2DZAA 4W89A 3O1NA 4MYXA 2HVMA 1ONEA 3KOZA 3LMZA 5M2FX 1PAMA 4R5EA 2A3LA 4AD3A 3JUGA 3APTA 4D6GA 1RCOB 3FVDA 3AMKA 4JGDA 1C3FA 4O53A 3ZT7A 2ZA2A 1UJPA 5FAGA 3SW6A 3RIKA 4RLIA 1OHLA 3LCXA 4GI9A 4IIFA 1XYLA 1KD0A 2Y89A 1BWLA 3Q45A 4MYAA 4AZIA 5E09A 4KCUA 2XVLA 2QDEA 3OLDA 1OY0A 1OCBA 1XLIA 4XK2A 2VX6A 3S6TA 5CAHA 3DG7A 4LY8A 2YDRA 4BR1A 1VHNA 3MP3A 1F6KA 4U4MA 2TODA 3H4XA 1IT7A 1AD4A 2X1UA 1HKMA 2E5DA 4LB3A 1VBJA 5GJNA 4ATDA 3FHAA 4KGLA 4NASA 2TAAA 2AMGA 1VCFA 2R24A 3IJQA 4MADA 1JEZA 1XSJA 3H2AA 2HISA 1E6ZA 2A2IA 1XYMA 3RN6A 4WDXA 3BDKA 3LY0A 4DJDC 2ZWZA 3WD0A 1V8EA 3VGFA 2CBUA 2Z2AA 3FSUA 4F0KA 4YLWA 4HNUA 1FWFC 3HZ3A 1KM5A 3T4WA 3C2RA 3PZGA 5FACA 2R14A 4XO6A 1UWRA 3FJ6A 3GFZA 4MVAA 3A3HA 2R1MA 3DFOA 1AJ2A 4AD5A 3P61A 2Q8ZA 3BMVA 3F1QA 4HNOA 4KETA 4JQAA 2QLYA 5A8PA 2WMGA 1QAPA 1J0IA 3IJDA 3COTA 1L9WA 1DHKA 3WH6A 1EDTA 5DBUA 1PJ9A 3THAA 3LNMA 4Q4MA 3KW3A 4F2BA 5CG0A 3SURA 1R0MA 3MJMA 5AC7A 4W86A 4KEZA 4A8LA 1Q45A 1KR1A 4N9BA 4ZOAA 1JPKA 1DQWA 2BHUA 1CW2A 4QP0A 1H62A 2BGNE 2PTZA 3TKFA 3OHIA 4TUFA 4YS1A 2WCSA 4JAWA 5D02A 4L9ZA 4X3ZA 3PB2A 2C19A 3VD9A 2XUCA 1KTBA 3IGUA 3CUHA 2F2HA 2QNEA 5CC7A 1BYBA 3EYPA 2AL2A 2ISVA 4JFTA 2NZLA 1ZENA 3XISA 4NUWA 1DTNA 3CL7A 2WC3A 2VR2A 2PURA 3F2BA 3PAOA 1VPQA 1I0BA 1E6QM 3O3RA 1TE1A 1WZLA 1SPQA 4RCXA 2ZOXA 4QHRA 3POHA 2RGLA 5HMFA 4P7QA 5A6MA 3GDBA 5U4NA 3W86A 4UQAA 3MI2A 1LLZA 1A3WA 2MANA 1W1IE 4DY1A 4PUNA 1IWPA 3RLVA 2C71A 3C8NA 1OBAA 1HJVA 4HMCA 3QMTA 1ZBCA 3WNLA 1M68A 1MDLA 1A5MC 1W5MA 3WENA 3F2DA 2ASHA 4AZGA 1PSCA 1GW1A 3FKRA 4L4LA 4HMNA 4EACA 4Z2IA 5D32A 4RKAA 3GFYA 4GH1A 3BSHA 1LL7A 3A6OA 2WNWA 3WLPA 2OWXA 4OE7A 4ZB2A 2OCZA 2QR6A 3GFXA 1TCDA 4GY1A 1X6LA 5BU9A 2NLYA 3OYZA 2ZDRA 5LA0A 1J0JA 3PN8A 4H19A 4LSBA 1WDDA 1BF2A 2PMQA 1C92A 2J27A 4DXKA 1Q6GA 2DIJA 5A5WA 4GO9A 1OF8A 1KXTA 3G1HA 5HATA 4Q8WA 1H7OA 4AQLA 1RBOB 4XWUA 3FA5A 1YKWA 3H70A 1E56A 2WVSA 2XYLA 3WZ0E 1E6XM 1YXDA 4HA3A 4OBRA 3UVAA 1UD8A 4PTVA 2FPVA 2YB4A 1C7SA 1EOMA 4EWND 4MSSA 3GC2A 1PKYA 1CXKA 5C71A 4ICNA 4GRSA 2W79A 3ZOAA 3WQWA 1VFOA 2OYLA 4PL1A 1C8VA 4NILA 1U83A 1R47A 4JTJA 3R8GA 2GVEA 3TW6A 1UOZA 1YTDA 2E5BA 1LJYA 3FFSA 1OFPA 4N9DA 4PB4A 3UJ2A 2X0SA 1NFBA 4WF7A 3EMZA 4PB3A 3PM6A 1Q3NA 2PC4A 4EK7A 4CCCA 4G7FA 3J7HA 3UFYA 4LRSA 3RG6A 1GQLA 2PDJA 1KM0A 2DVXA 2DZSA 4B5VA 4S3JA 3RU6A 2DSWA 3SY1A 2ZVIA 1DJQA 2OTDA 1FWWA 3LHVA 2LLEA 3GVGA 2YPIA 2VEIA 2E1WA 4US6A 4QE5A 2PDQA 1LF1A 3KVKA 3TTEA 3ZJ8A 1TPB1 2J6XA 3S4TA 1RPKA 3A4WA 4GZJA 1W3IA 4D6IA 3OA5A 1Z7AA 1WO2A 4V2XA 4Y9OA 3TFXA 1UR4A 2FTWA 1XH0A 2UWFA 1FHDA 1ZCOA 2I1OA 4S3GA 1EQCA 1HX0A 3RDKA 3AUOA 4MLJA 4L7ZA 7ODCA 2DUXA 1BLIA 3CTLA 2EJ1A 3W7HA 1IZJA 2OQLA 2YW3A 4REQB 1SFSA 5FL0A 1JPIA 3WD4A 4M0XA 4CQDA 4TXEA 4OKDA 1DYSA 1T96A 2ZZ7A 3F4NA 4AY1A 5BOOA 1UP0A 1QNOA 5F4SA 4WD0A 3TROA 5AECA 3OVQA 5AHNA 4ACYA 2X8RA 3P3BA 3SIMA 1E71M 3V36A 1ONWA 3SQLA 3DYMA 4UTMA 1T40A 1UROA 1YDOA 4C6MA 1R3WA 1E40A 3VNMA 3WQ4A 4PMXA 3QPZA 1G0CA 1A50A 1QMLA 3WLSA 4R34A 1GZGA 4ZBCA 1K02A 4FS9A 3G5EA 4QSHA 2OVLA 4LFYA 1G7VA 1FFRA 1TTPA 1NWUA 1R7OA 4UFJA 1BXNA 3T0DA 1R87A 5HAOA 3GS6A 2A7PA 3DI1A 3CNYA 4LYRA 3WD3A 1EC8A 3BLPX 3EDDA 1RK6A 1B54A 3W7OA 1DIOA 1UH4A 3NZQA 3LD5A 1BG9A 1AQFA 2HZGA 4S1FA 3I7QA 5DBTA 1YTEA 3TQPA 2GJNA 1RVKA 3C3NA 1DXEA 2C91A 3KOWA 2EO7A 4XTIA 1Y5XA 2DT3A 1FXQA 2DZTA 4O15A 2PLJA 4HZ6A 5LYRA 4HHPA 2V8ZA 1A5KC 3C2VA 1XP3A 4PTDA 2EF9A 3H4WA 1OT1A 3AO0A 1S2TA 3SCQA 5FF4A 3OEXA 3PUEA 4KRTA 4UQEA 2DSKA 2PA6A 2QULA 2ACUA 4QCFA 2ONEA 3MKCA 1UKSA 2ZUMA 3VDGA 2Z27A 5LIUX 1XS2A 4C91A 4PBEA 3VIMA 4F0MA 1FWDC 1K4HA 3W76A 1VR6A 3NXLA 3BAYA 1M7JA 2GK1B 3C2EA 3WFAA 3DUGA 1JI2A 3ES7A 3PSVA 2OB3A 2Y7EA 5A8NA 4P2VA 4OOZA 3TMQA 1ZP3A 5CSUA 4ZXLA 4UFMA 1Q2SA 3TR9A 1XYBA 4QNWA 3O6AA 3GDTA 4AIUA 4JKLA 2AQVA 2DSVA 3HIJA 3EKZA 4KIEA 1TJ0A 4QEEA 2YBVA 3S1VA 4RZ4A 4MNKA 2DDXA 4LRTA 1TIWA 3NPUA 1S2CA 3U4AA 2Y7GA 1TG7A 1JZ4A 1YW1A 3ANVA 3T42A 1VBRA 2YXGA 3M47A 2DU2A 2YSWA 4IWWA 2BXYA 3VDHA 3PPFA 1RLCL 3UESA 4JCMA 2FZMA 4Y8EA 1HJSA 1SO5A 3VMOA 4LUSB 1PL9A 3M64A 4QG6A 2YCEA 2QDDA 1O6IA 4HA1A 1JRCA 3H8AA 1SUXA 2XH4A 4XB3A 5I3JA 5AC8A 1BKHA 1JULA 3W01A 1QNSA 1HFBA 3QRHA 2BASA 1Y0EA 2NXHA 5K4ZA 4JEQA 3MYOA 3IPWA 4X61A 5BW6A 5HANA 3RJXA 4F0SA 5JQ9A 4AD0A 5I3KA 4A2RA 1DJNA 3NIYA 1G9HA 4AXKA 4BQ3A 3F2CA 2AL1A 1GYNA 1MNZA 1Q6CA 3KRBA 1JGMA 1XRFA 4XKYB 4PSRA 4QG8A 5HQEA 3NYDA 2O7QA 1UWQA 3IV3A 2FB2A 3B05A 3CAVA 5GVJA 3STGA 3W88A 1QWKA 1XGZA 2E77A 3TW7A 3CQJA 4N02A 2QUVA 1E4NA 3PC0A 3SECA 2P88A 4DI8A 1JUKA 1YE6A 5A69A 1RVGA 3ITCA 1YQ2A 4HOXA 1JYVA 2XZ9A 3K8KA 4NG3A 1DWIM 4JTHA 2NVAA 3LDVA 3SN1A 3ITVA 4I5RA 1PIIA 3GXNA 3O05A 1RAKA 3CS2A 3I6EA 3AXKA 1FUYA 1FWEC 4ADTA 2VJXA 1J2BA 4S23A 1UYQA 4YN5A 2J4GA 3T0AA 2Z1SA 2FTYA 1HP5A 1UD3A 2OKOA 4JIIX 4A29A 3CUFA 1I1WA 2ZADA 1HVQA 3EX3A 3PNUA 4M1RA 1TWZA 1SM9A 1E9IA 3NUKA 1EC7A 3UNDA 2OX1A 1KV8A 3A64A 1EH9A 3W02A 4G1KA 4LBRA 1Z42A 4PFHA 1AJ0A 4MUPA 3R1ZA 4IIGA 4OZOA 4AZBA 3A9IA 2PDBA 4ZQMA 5ABEA 5C7VA 4CQAA 2VKZG 5TBOA 1EJ7L 3AMLA 3P60A 1EDGA 1CNVA 1HO1A 3GW3A 3L4TA 4GNVA 2QCGA 1KTCA 1OGSA 4S3AA 3KVJA 3B03A 5E6YA 2EPNA 3B9DA 1M65A 4I5UA 4XBJA 4RZBA 3A24A 3EDFA 1QHZA 2CHOA 3KWXA 3O2LA 4PCSA 5H2ZA 1YPXA 1OWQA 2BLEA 1VD6A 5JXQA 8RUCA 3MKKA 3LCWA 5C70A 2DJXA 4X0VA 4FMVA 4K6AA 5AC6A 3A3WA 3LPGA 1JZ3A 3PWIA 4DJFA 3FDKA 1HO4A 3IGHX 3GUGA 3HTWA 3WIJA 3T2QA 1WOBA 3LGDA 3CQ0A 1YHTA 1VH7A 3CIVA 3CB8A 4RE4A 1OX4B 3OIHA 3TYAA 1SYTA 4OFCA 1M3UA 1LP6A 3T81A 3DGRA 2JKAA 4M82A 3TQKA 3TP4A 2HBVA 5CG7A 2H9AB 3WLHA 3BZJA 3LYEA 3AS1A 3ZLGA 3L66A 1C90A 5GNXA 4W8AA 5BRBA 2DORA 5E0KA 5IRPA 1QW8A 3V5OA 4URIA 3F4VA 1VEMA 1OFRA 4IF2A 1ECQA 2DH2A 2H8ZA 1R38A 2P1FA 1DTUA 3BW4A 3H7UA 2OYMA 3CGTA 3NOEA 2XIMA 4JR5A 3EWYA 1V0NA 8XIMA 2RH9A 4H9ZA 4D6EA 4IPPA 2YFNA 5L9FA 1A5AA 2G50A 4NZ4A 4B4HA 1TVLA 1PZ2A 5GNYA 2GQ9A 2NW0A 4TX9A 4FLQA 1FWJC 2ZA3A 4W5ZA 3EPNA 4AXNA 4L6HA 1XIEA 1OC6A 3M4HA 4MZYA 1Q7ZA 1W9UA 1VRDA 4H8HA 4XUYA 2I14A 4DYEA 1ITQA 2GDUA 3PWAA 3L5AA 2E9LA 5A3HA 3VTRA 1JCTA 4J2PA 3EGJA 3K30A 5BWFA 3E38A 2QGHA 2E6DA 1CGYA 2FPYA 3BAIA 3PBUA 1H41A 3P93A 1FTXA 1AL8A 4DO6A 1EA0A 4UTTC 3GG0A 3KOXA 3QY6A 3BLOA 1OX6A 2CXEA 4GYJA 3EWZA 2H90A 1XFBA 1ZPTA 3L0GA 5FJJA 3F5KA 1U5HA 1ZZMA 5FJIA 4GI4A 1Q6LA 1V77A 3GTNA 3N29A 3DFQA 1ENUA 3MUZ1 4RZ5A 2GJXA 1NM9A 2JKEA 3RMJA 1OJXA 2Z7KA 3GR8A 2C1GA 3SUTA 2ZRVA 1DJYA 3GDKA 3PBGA 4M5PA 1TPUA 5EMMA 4D1IA 1EWEA 4AC1X 3PTQA 3SN4A 8TIMA 1BAGA 1I2RA 3DFNA 5LSMA 7TIMA 1S5TA 2V5BA 3C61A 3UW6A 4HPXA 3VU2A 1CWYA 4AD4A 2ZX6A 4V1XA 3N3MA 4NAFA 4KFPA 3EA2A 3U7BA 2B7QA 4HJFA 1RBAA 2ALDA 2A1YA 3C5QA 1CEOA 4AF0A 4JTDA 3NG3A 4O4VA 3PK7A 1JZ5A 4XAFA 4GUJA 5CJ5A 4OIFA 1WUEA 1UJQA 2GFTA 5J8LA 3W2UA 4CD8A 3KXQA 1V6WA 3AWNA 3W3OA 4F79A 4O1FA 1KCKA 3PNZA 4UTTA 4IFOA 4A3UA 2NXGA 2PWVA 1AMKA 2EHHA 4HCDA 1K8XA 4Z1CA 4RNFA 1XCXA 1BHGA 9RUBA 2YDSA 2IQDA 1H49A 3QEZA 3WDPP 1GZ1A 3HPSA 4Q4KA 3ZR6A 1R2SA 1TTIA 1W5QA 1XC4A 3W7DA 5AHLA 1GYMA 4E8GA 2QJNA 4WY0B 2B81A 2HK1A 1GVOA 3T0BA 2GUYA 4NZFA 1XYCA 1FKXA 3HQNA 2XVNA 1AVAA 2HBXA 2VFIA 2WMIB 1KRMA 2QCLA 4H7VA 3RX3A 2F38A 1V3KA 3G0UA 3E0WA 4GUGA 5K9XA 3MO4A 2YDQA 1E9LA 5JH2A 5C54A 4LTSA 1LBMA 2OZTA 3U9IA 5FF2A 3UG3A 5E6ZA 1N55A 1DQUA 2ZQ0A 3GBDA 4RL3A 3PR2A 3W7IA 1M6JA 3KP0A 1EYWA 1NEYA 3IJIA 3MZNA 1RA0A 4GJIA 3IIVA 1QOQA 4CU6A 5FESA 4NY2A 4M7TA 2XN0A 3B40A 3ABXA 3MI6A 3GDRA 2QYGA 1ONXA 2CLPA 2JBMA 2X41A 1P48A 2R1NA 4TTGA 4NNAA 4S38A 4L4MA 1XIFA 2YCLA 3TTYA 1DJGA 2ISDA 5I3HA 1KKRA 4MMWA 1AUSL 4ZSUA 3G0XA 5DELA 2DT1A 2NLIA 2Z29A 1O5KA 4DVOA 3CH0A 1CB2A 3UXKA 1UB3A 2HNEA 4A8RA 3FYOA 4DLMA 5DRCA 1TJRA 3BSMA 3LA4A 1J93A 1E9ZB 3WQGA 4H8VA 3NEVA 3OZYA 4MAZA 3RITA 4G56A 2JGQA 1FH7A 3S5ZA 3KTCA 2BP1A 4MZ8A 1EZWA 4UFIA 3UWZA 1CXHA 2RDUA 1ZNNA 4LYPA 2D2HA 5LHFA 3M41A 5I0DA 4HU3A 1V3MA 3WQVA 1O60A 3WQFA 2DIKA 2VEGA 1WPCA 2PDPA 3S3GA 3SCPA 1HF6A 3MUCA 2V0TA 5CPTA 2NUXA 3WBEA 3WELA 5IBXC 3G1FA 3W1PA 1AZ2A 3UWWA 4C6FA 5C2GA 4OT7A 2UY5A 1L6FA 3T6CA 3CHFA 2AGKA 2J77A 3GXMA 5LHEA 3ARYA 4KWSA 3LSBA 1Q5MA 3STFA 4TIMA 3LU2A 5LNRA 2XSXA 3MYPA 3QC3A 5H8PA 4WSKA 3RRAA 3VGEA 3VNDA 4LX4A 5AY7A 1I60A 2J47A 4AVFA 2Y7DA 3ZR4A 3K4DA 3S47A 2XFFA 4RR4A 5JUVA 1W1VA 1OF6A 3C2OA 1TQJA 3CHDA 1XL9A 1TR9A 2QJMA 2RAGA 3SEPA 3LQGA 1DPMA 3EXSA 4QROA 4XTDA 3R4IA 1XIJA 3GTFA 1VC4A 1UWUA 1TQXA 2QDHA 3MUY1 1US0A 2CC0A 1PIGA 1KFJA 3VE7A 4JTAA 4GVGA 3W87A 1M5WA 4X9SA 3VKCA 1YIXA 4LVGA 2PPGA 3HGOA 1UH3A 1EPVA 4GNJA 2AL2B 4UTLA 2VC9A 3GC5A 2WJEA 3W53A 1LOQA 5IBXA 4O14A 3H2FA 4MB1A 1SFTA 3ECQA 2X1TA 1GJWA 3VDCA 5EFFA 3VABA 1BTCA 1DORA 4WOQA 3UPBA 3CUIA 4PMQA 5F2GA 1FDYA 2CHNA 3OJGA 2PB1A 3T44A 3L65A 2PTXA 4DNHA 1BVWA 4UR8A 3THDA 3DESA 4DO4A 2G3IA 1C9DA 2Z00A 3FAXA 3U2EA 3VC5A 2FJUB 2QZRA 2V5JA 2V30A 4I9TA 2J6VA 4LW7A 5A6TC 4B15A 2A4AA 4J2MA 4D6DA 3W37A 1PTAA 1ME7A 1XLEA 3GK0A 3MCNA 4HN8A 3T1GA 1W6TA 4ZB0A 2P3EA 1U1HA 4V33A 4HCLA 4RNJA 2DZUA 2CW6A 2XFRA 4HZ7A 5JVLA 4DBSA 3W2JA 2WZIA 3PZTA 1SW0A 2WW5A 3ATZA 3M5ZA 1XBXA 5I7GA 4IJBA 4JBRA 2DT2A 3W07A 3OG3A 5LGXA 5FI8A 5K7JA 3NYZA 3IIXA 2ZXBA 1TUXA 2I9EA 4R33A 3ENLA 4UXDA 3BJFA 3HQPA 5HJXA 3GBEA 3W1UA 2NWRA 1T7LA 3MKVA 2VZSA 1G01A 2Z6IA 1KM2A 5XINA 3EBVA 3TJ4A 1G7UA 3CPGA 4WSHA 3C0JA 5B7ZA 1EIBA 2QVNA 2WSPA 3O6CA 3VD4A 3W7QA 4NZJA 3KBNA 3RCNA 5KZDA 4WDUA 3TZNA 4RW5A 4GZEA 3UCCA 2Z24A 4JFUA 5LXXA 1EB3A 3W70A 6TAAA 4Y2WA 1P6BA 1HKVA 5C9XA 1KBIA 2VELA 4GXMA 4OWGA 4U31A 2WSYA 2XVPA 3BGAA 3WF2A 2WB5A 4MWAD 1KFCA 2F7FA 4IG2A 5EL1A 3VGDA 4L9YA 2QT3A 4H6EA 2O56A 4Q8TA 4DAFA 1HKJA 3CPUA 1ZBWA 1JPHA 1V79A 1IIHA 7REQA 3S5NA 4FB7A 1P0NA 1W9DM 2PF0A 3S1XA 4O8AA 1QPQA 2ZXAA 1UPMB 1AL7A 3UR8A 1OD0A 3UT0A 2BODX 4JIQA 4HCHA 4GOAA 5DMYA 3LHTA 3W22A 5I2UA 4R9XA 5FSDC 4ENLA 1J18A 1DIDA 1MQRA 1Q85A 3QY7A 1KO0A 2ZUNA 1A5LC 2OWWA 1KBLA 2JKPA 3VDAA 4AEFA 3HO8A 4ROPA 3CWNA 4WHBA 3DBPA 1VJZA 3ARZA 3VGGA 3WBAA 4GNKB 4GY0A 2E6FA 3B8VA 3LCLA 3BLDA 3IK2A 4L61A 2GQ3A 4DM2A 3WLIA 3UWYA 3W27A 1G67A 4GVHA 4AZCA 4NIRA 3YPIA 2QIWA 3LENA 4KW2A 3USZA 3TTOA 3VYLA 3VMNA 2NX9A 3NQBA 3UXLA 3WKZA 2V5DA 4M6PA 2XDFA 1N2VA 4XIAA 2V3DA 4Q32A 1MXSA 2HVOA 1NAL1 4YL2A 2NQJA 4LQ1A 3LHUA 3SB0A 4O10A 2G5WA 2VM8A 4YTQA 3RJYA 3GXPA 4IX0A 4DLFA 4A2SA 1MW2A 3GNOA 2QMJA 3OGVA 4MGGA 3VFLA 1K7FA 2F6UA 1RH9A 3ZYZA 4Q8QA 2C8NA 3W75A 4FXFA 2WC4A 1PPIA 3DI0A 1WXJA 1UA7A 3UZWA 5BOEA 4QQUA 4R88A 2H6RA 1LOSA 2TSYA 2VC7A 1TTQA 4BS0A 3AHZA 4TVDA 2G0WA 4ZXOA 2F6KA 4AFYA 5HNTA 4FXSA 5IOBA 2FMNA 2Z1BA 3W84A 3M0ZA 1XCWA 4WJEA 5A8QA 2CBJA 3RPTA 5G4WA 3IVSA 2CBVA 4ZFMA 2E5CA 1C7TA 1XI3A 3NPWA 1U22A 5HPOA 2EPLX 3AC0A 2BGQA 3CUJA 3BOFA 3LBCA 4I6VA 3CHCA 3VCNA 1JCXA 3Q4DA 1E0UA 3NQFA 1UZHA 4FOJA 3R6IA 1WNOA 1TZZA 2HS8A 4CD7A 5I3GA 4M51A 3AYTA 1I2QA 5ABFA 4GFIA 1Q4WA 3W7JA 1E72M 3ZVIA 1UASA 1ADDA 2J7HA 4N6EA 2REQA 3KBWA 5B80A 1XKYA 1IT8A 3PJUA 4H04A 4Z2GA 2CCRA 1L0PA 3OVRA 2V5LA 4CCDA 2C1HA 2XIOA 4HHHA 3OHMB 3RFAA 1D3HA 2I5GA 1O5XA 4C6NA 1F74A 4DQWA 1XLLA 3B0UX 1ISYA 4PTMA 1IXPA 3TYEA 3VOIA 1B31A 3AUJA 2WHLA 1EF3A 3RCYA 1XWYA 3CV2A 3B04A 2DZPA 2ISFA 1IEWA 4C5YA 1FOBA 4K8EA 4Q33A 3KX6A 3AMDA 1IIGA 3BQ5A 3UVIA 1QR7A 2XISA 1LRTA 1HJXA 4F0HA 1Z3NA 2NVDA 2FFCA 5E70A 3OW1A 3FEQA 1XLKA 1PIFA 3P5YA 1MUMA 2R91A 4RDZA 4Q22A 4LBUA 2ZTJA 4DJED 3C8FA 4EXQA 4EAYA 1KR0A 1EXBA 4ICCX 5I78A 4RPPA 4GYPC 1E6SM 2OR2A 4XZ9A 3T0CA 1KM6A 1XQKA 2DVUA 4UNIA 3H4GA 2GSEA 3GHRA 4QG9A 1VRXA 1ZGDA 2WLYA 5D04C 7TAAA 1QI2A 1F6PA 5AHEA 3GNDA 3DOPA 1PX8A 3T07A 1GVRA 1DKWA 3SGZA 3PANA 3LCIA 4OHQA 1OFOA 5HUPA 1W3JA 1SVDA 3KOFA 3SCWA 4GO8A 5I3FA 2QCEA 4BK9A 5T26A 1SW7A 3ZSSA 3TN6A 1AMYA 1KW1A 1YE4A 5EMKA 8XIAA 2YR1A 5D37A 4QLLA 3M1ZA 1LZOA 2ZWYA 1X1OA 4FNSA 3PTKA 1KRCC 1DXIA 2NV9A 2YCIX 1F73A 1KRAC 4R7WA 4IUOA 2UY3A 3PPGA 3EX6A 1AODA 2GGIA 2I17A 4C6DA 3FX4A 2YZ5A 2BTMA 1QNQA 4EPDC 3VZZA 3D6NA 3R94A 4L6DA 1WXZA 5A6LA 2YLAA 1XUUA 2E09A 4KGJA 4J3WA 3ANYA 3KUMA 4M29A 3GNNA 3AIVA 4O16A 2OGJA 2EXOA 3RX2A 3OLEA 3U5YA 3MO7A 4CNTA 4A4AA 4LC8A 3OGRA 3E49A 3ZJ7A 3EOSA 3AYSA 2XH2A 3DEQA 2QGYA 1UR1A 2VFFA 4QJ3B 4LAMA 2D3LA 4Y6GA 2IPJA 4PZVA 2GJRA 2RFGA 2YL9A 7XIMA 3AICA 4JNZA 5BRQA 4CCZA 3DKJA 3ARVA 3VUSA 3VK5A 5HA7A 3EAUA 1RSCA 4OV9A 4B3LA 5EMUA 2Y85A 3RF9A 3L4ZA 4JQ3A 2BVTA 1QATA 4GYKA 3VIOA 1E3XA 3XIMA 1HKKA 4DZAA 1XLHA 1RHCA 1UD5A 2WHMA 1IXOA 5I06A 4LJ3A 1ZJBA 4CGTA 5H8UA 3BANA 1KXHA 1MEWA 1TMQA 3G1XA 4MWAE 2FZ9A 3G8EA 1DWJM 3WFLA 1XRSA 1REQA 1VJIA 3LXAA 2HDJA 4PUUA 2J7DA 1XSKA 1CGTA 4UQBA 3EWXA 2J7CA 3TOYA 4RV3A 4JFWA 2OT0A 3R58A 2IS7A 4OQVA 1B30A 3HF3A 1BVNP 4GABA 4MPQA 2IKJA 4IM4A 3AIBA 2WK2A 4LCSA 1E55A 3NL3A 7ENLA 4NYUA 4L4PA 3SGUA 1TV3A 5C7HA 2ZC8A 1A53A 1VPYA 3W73A 1X7IA 5D2WA 1D3GA 1X38A 2HPMA 1VCVA 1DP0A 3VNYA 2V67A 3PZOA 4E4FA 3N14A 4GISA 2WMJA 3P2VA 2ZCGA 1K6AA 3FEMA 4QAWA 3FS2A 4DELA 1HIZA 4AHPA 4C65A 3VX1A 1A5UA 4O1CA 1YXCA 5A2AA 1F3EA 2EPOA 4X0NA 1BTMA 6CGTA 1O7AA 1SFLA 4J3XA 1XLDA 1ICPA 1LRQA 3CASA 3RYSA 3W1LA 3CUXA 4CN6A 4DB7A 5CXPA 2X40A 3I65A 4KT2A 5JIWA 2QPSA 3UZXA 4HNTA 1Y7VA 1RJRA 3B8WA 3PAJA 3UERA 1US3A 3TN5A 1SSDA 3AZSA 1JCLA 1E1FA 4FOUA 4NJGA 1O95A 2ZZ3A 6PTDA 2BXVA 1F76A 4IJCA 3ZWTA 3GR7A 3S1WA 3AHVA 3T8LA 1TPC1 3QPEA 4RDVA 3PFMA 2XWEA 3ITOA 3CHVA 3ZLHA 1WBHA 4HGXA 4LALA 5E93A 3UCQA 1PCWA 1JCJA 2YDAA 1EUAA 4J3SA 1XLGA 3INPA 3MMTA 3S1UA 3S46A 2IMRA 1JDAA 5C6MA 4Z1YA 3ARSA 4Y96A 2WHJA 3QQWA 1HNYA 3AQUA 4CQ8A 5BXRA 3P6LA 2BVWA 1O5QA 3H21A 1PWMA 3QR3A 3AIEA 2Z25A 4FO4A 2A6LA 2PGWA 1VFSA 4QM1A 4LWWA 1GJPA 2Z28A 3B9EA 4MKSA 4BKNA 1ODZA 3E0IA 3QSTA 5BMXA 1X7FA 3BCJA 1F3XA 3LNPA 1BFNA 4TQTA 3M16A 3NZRA 3QC0A 4IMAA 1KA9F 3S83A 1S3TC 1ZY9A 4ZO8A 3AFBA 5MF5A 1E4IA 2GJXB 1IGSA 2HS6A 1DL3A 2P5NA 2YCKX 1PWLA 1JRBA 1ZU8A 1O68A 1RY8A 5T9CE 2EAWA 5D09A 2DIEA 3CLMA 3EX4A 1KCLA 2W67A 4AB4A 5C8BB 1H7PA 3UY7A 4WKAA 1T8QA 2HJPA 4XAPA 2BB0A 1HP4A 1NF0A 5CGMA 4Y9MA 1KFBA 1W1TA 2J75A 2VENA 3RLUA 3O16A 4Y8FA 3LPOA 3QGVA 1TO3A 3LGGA 8A3HA 4NAFB 5AC5A 1U5JA 2DH3A 4NZCA 1EJVC 3N2MA 1QK2A 2CKRA 3EXTA 4XV0A 2DZBA 1TTJA 4QISA 4OTKA 4WGXA 2Q09A 3MQTA 1B3VA 3FW6A 4AF0B 2OZ3A 2XINA 2B31A 4A3RA 3WQ6A 2BY2A 1J01A 4HBKA 4UQDA 1EQPA 1JQVA 3LK6A 4IP7A 4LANA 1SGJA 3D3AA 3LSCA 3W72A 1W9VA 1CXFA 3TE9A 5M17A 2I7GA 1Q6DA 5BROA 4KBXA 3WO8A 1HJUA 2PWGA 3SY8A 4AY8A 3CYJA 3WNMA 3WUBA 4H41A 4HNVA 4FLRA 2VZVA 4FNUA 1W1A1 5CGQA 2CZ5A 1VFFA 2R1PA 1UHVA 2HXTA 1XLMA 5CC5A 3KM8A 4FLOA 2YGYA 3MSDA 4FNTA 5LKYA 2NUWA 3QMSA 4BCEA 3P62A 3HG2A 2NSXA 4IP5A 1MUCA 3M5YA 4ZO9A 3T0TA 4KEMA 4MWAC 4DRSA 1YLVA 3PG8A 1NH6A 1F6YA 3DECA 3QBUA 7CGTA 1WDSA 4W87A 5D9MA 5JBDA 4PB5A 3VILA 1SJBA 5F2MA 2PD9A 5CEWA 2ZYFA 3R2GA 3TXVA 1EUNA 3CAWA 2BSLA 1WQ5A 2VFGA 4RZ6A 5H8MA 1UKTA 1B57A 3MBFA 2O0TA 1M9HA 3TIMA 2BX7A 3R5EA 3MMWA 3W7RA 3ZT5A 4V15A 5H1WA 4AD2A 3T40A 2UY4A 1FHUA 3H6OA 4CEUC 1UUMA 1X97A 1UZDA 1TVNA 3QLDA 2DQWA 1GGOA 3I3BA 3T9PA 1SZFA 3OQ8A 4AZ7A 4CUCA 5FF0A 3E96A 2YCLB 3K1DA 5HK4A 3GYCA 4M3PA 2A6NA 5HQMA 3BV7A 3VM5A 3FOKA 3OGSA 2JFEX 2GGEA 4L9XA 4JKMA 4CD4A 1YDVA 3D5HA 5A6SA 1QI3A 2V63A 2W63A 4Q6JA 3FJNA 5D9NA 5M1TA 4HVXA 4IGNA 3L5MA 3RX4A 4MWAA 1V93A 4QITA 3WJWA 1R3VA 2OELA 1B3WA 2ZUVA 4S3FA 4F4RA 3SCVA 3NL2A 2D24A 1F3WA 2P10A 4DM1A 4Q8MA 1VLWA 3RPMA 5FL1A 1DBTA 2DVTA 1XBYA 3RR1A 2R1LA 7PTDA 9XIMA 1KFLA 2ZDSA 3TLQA 4XUGA 1XXXA 3CWOX 3NO5A 3BGJA 4GIEA 1EJUC 1XW8A 3QTPA 5G4HC 4XD4A 3K13A 4PRTA 3DFSA 3RXZA 4X2RA 3AIUA 1HG3A 4HYVA 4KPLA 5T8GA 3TCSA 1W2PA 5DLCA 4L1WA 1LT8A 1KBKA 1JIBA 2WANA 1OABA 1IYXA 2XWDA 4W8LA 4UNKA 1GOQA 1MYRA 2G97A 2VWSA 1ZAHA 2YA0A 5TIMA 3UZJA 1VEPA 2OT1A 5FJOA 2W61A 1HKIA 2FTPA 1VB9A 1CCWB 3LG3A 4H6KA 4JTUA 4FZIA 4N9EA 1BSIA 2J8GA 4IQDA 3IUIA 4AHQA 3QSRA 5CH9A 3POCA 2VEPA 3WQEA 3T7VA 3CMFA 1KWKA 4NJJA 1X96A 2HE5A 3GRIA 4AIOA 3MWCA 1KKOA 4JL1A 2D2JA 3KVLA 3H7RA 1UOKA 3GG1A 3IANA 4S2BA 1D2KA 4IFKA 1GOMA 4JEJA 4CVUA 4Q7NA 4UTWC 1V51A 3BLEA 4ERGA 4MTVA 5AC4A 2WBKA 4B3ZA 3GXDA 4HB7A 2DZXA 3E2RA 1F61A 4A35A 4YTTA 2ACRA 1UUQA 4ZQOA 3DG3A 4WR3A 1J11A 3AZTA 1GPWA 4B5UA 2AAAA 1O1ZA 1S39A 2QUUA 4C6EA 4K68A 3T05A 5C9RA 1H4PA 4QGCA 4DJEC 3OVGA 2FZDA 4ZB5A 1GYLA 5M5DA 3WJZA 4B5SA 1N8FA 4INFA 3HPFA 2D69A 1AW2A 2WLZA 3LXBA 1V7AA 2NV2A 5I77A 1CXLA 1Z32X 4IXXA 1A5BA 2OGYA 4ZQCA 3H2NA 3L0KA 3SSZA 1EP3A 2GDQA 3TN3A 1G5AA 2WBGA 1VHCA 1L6YA 3FA4A 4AU0A 1TV7A 4K7VA 3L2MA 2A21A 1NWTA 5CSSA 1RQHA 4NX5A 3GO2A 1C29A 1A0DA 4FK9A 4RNIA 3GIYA 2OFJA 4UB9A 4JFVA 1CI1A 1H1YA 3CLWA 4N6FA 1EX1A 4ECLA 2XIIA 4N0RA 1TRIA 2VD9A 3PZ9A 1TREA 2GJPA 4PCFA 2V38A 1J6PA 1QNRA 6XIMA 1BKSA 3DC0A 2WC7A 2I57A 2IKGA 1VEOA 2Z0IA 4C7DA 3BWWA 1PHQA 3WJXA 1EJWC 4NI8A 1NDZA 4GJJA 2XGZA 4X22A 3MMDA 2TPSA 4C6BA 2Q71A 3PPCA 1K8CA 3E1F1 5D03A 4DJEA 3CU2A 3JW7A 3IAQA 4E8CA 3OPSA 3V16A 1OYBA 1GVYA 5AYXA 3RU8X 3SCTA 1MUWA 1CTNA 3NNTA 1OD8A 4RE3A 1HGWA 3QR1A 1KM4A 3UG4A 2BDQA 2RDWA 3LGEA 4HYWA 3NQGA 1ZUAX 3W38A 1RQEA 4M8UA 2QCCA 5BYWA 1WKFA 1J5TA 1SJDA 3GM8A 3TA9A 2EG7A 3E12A 3O9NA 4GIYA 4IG2B 5D2XA 1OC7A 3KZPA 3AROA 2PDWA 3WLLA 1YNPA 3FSTA 5M03A 4WDWA 5AKQA 4DWSD 1DWAM 2OU4A 4RW3A 1SR0A 3PBVA 3NZ1A 5EY5A 7REQB 1TPDA 4F9DA 4JZ5A 2DY3A 2WVTA 4EOUA 2J62A 3IAPA 3TAOA 4JNYA 3IVTA 4LC6A 1Q6QA 4B2DD 4RDYA 4U3AA 3ABOA 3SRKA 4HSNA 4QX4A 2G8ZA 1FWRA 2VC5A 4UQCA 1QT1A 3WBWA 1MEHA 3APYA 4JHZA 4QAIA 3WLQA 1PB0A 2OOGA 4K1GA 3ABQA 3MWAA 1ZHAA 4HMEA 5C2CA 3QV6A 2DPEA 1XDMA 4O0KA 4AISA 3RCMA 1GG1A 3WBYA 4XSMA 3V3WA 1J0KA 1GOOA 4IFRA 4YJ5A 2FMOA 4HTYA 1A0CA 2JQXA 1P1MA 4AZCB 4LUYA 4UMCA 4DZIA 3VIGA 4C1LA 2J9YA 3Q67A 5DX7A 1H7WA 2QF7A 1E0VA 2A5HA 3VKJA 2A3BA 2J24A 4W7WA 4A6GA 1FH8A 2FYMA 3W7EA 3MPGA 3W6LA 5HWJA 5EPDA 4O17A 3U3HA 1BWVA 4HYRA 5JMUA 5L6UA 2ESCA 1MW3A 3CIWA 3PJTA 4C1KA 2VVNA 3S9ZA 3FKKA 1PHWA 3S9IA 1GQIA 2ZVRA 2O9OA 4EANA 4Z2KA 1UZ4A 3KLKA 3GXIA 3FNDA 1VCGA 3DX5A 2VFHA 4ZQPA 1BWKA 3T55A 3PF3A 3WUEA 1H7RA 1Z9AA 4J3ZA 4XZNX 4HU8A 3E0LA 4QJ4B 4HMDA 4JTSA 3HMJG 4MPKA 2J7EA 3LCFA 4DN1A 2PP0A 2E8ZA 4DJFD 3LHZA 3PZQA 4W4QA 3SCSA 5CQ1A 3QHMA 3EPMA 4A8NA 1G4TA 1HQTA 2B7PA 4B91A 2IPWA 3EX1A 4PMDA 5E1QA 1P4CA 1JI1A 4XD5A 2ZX9A 5F1UA 4ALDA 2NXIA 5CGTA 3TMLA 5ABFB 4YVVA 3WDIA 1J4EA 1XIIA 4LBSA 3E2SA 5EKYA 1IGWA 4AX6A 4PCPA 4B16A 1ZTVA 4ZENA 1U1UA 2REQB 4FR1A 1LT7A 4QEHA 3L21A 3KBMA 1BEUA 1VBUA 2Y63A 2C3ZA 4WKFA 4M7SA 1NOWA 1XYFA 3NWRA 1P5BA 3K4WA 4P8XA 3TC3A 1H60A 4IMEA 3M0YA 1S5MA 5B7YA 1B3OA 4AVNA 5FJPA 5ABHA 3HV8A 4XD3A 2WMFA 3KBVA 3VC6A 1FHLA 1IZKA 3FLUA 2PP3A 3W83A 5CLWA 1K9TA 2G96A 2G3JA 1CBGA 2V3EA 2G3FA 1ZL1A 2VGIA 3EMQA 2VOMA 5FEZA 2VDIA 1RCQA 4XSLA 2UV8G 4Y7EA 2W62A 4JIEA 2VCAA 4KEVA 3MCOA 2WKGA 3VD7A 3ELFA 4H9VA 3NVTA 3ZMRA 1MVYA 3B9AA 2PDNA 4ROQA 3RPDA 3BG5A 3N18A 3MY9A 3OP2A 2OSYA 3VCRA 3PTMA 3WEOA 1QPRA 2QAPA 3KEHA 5HNNA 1RBLA 4M6UA 2R9RA 4UMBA 3AXIA 3KDNA 5FAJA 3W2MA 1ISVA 3AU6A 5KITA 3B0VC 1CT5A 2YOCA 2CLMA 1EZ2A 5EYWA 3GR4A 5FJUA 3WQCA 2VRQA 4IICA 4Z0JA 3GIQA 3CH9A 3BK0A 3MU7A 1Q65A 1LL4A 4I8DA 1ITUA 1LROA 2UZ9A 1GHSA 1GT8A 4M81A 2IXUA 1JAEA 2W92A 1Q6RA 5BOFA 6ENLA 3R7MA 3M43A 4KEUA 3ALGA 3STEA 1YTKA 4O12A 5CAKA 2ZZ5A 1C91A 3MBDA 3GDMA 1XLFA 1W5OA 2QCDA 3VD3A 3S0CA 3TLLA 3E5PA 3N25A 1FVPA 4MY9A 3EWWA 3NDYA 1HTIA 3W2NA 1KBJA 2J9ZA 1RP8A 4G9PA 4P61A 3CQIA 4Q7IA 2IQ0A 1JL8A 2ZUWA 2HNHA 1V0MA 1XGEA 1M7XA 4POCA 1B4EA 2P0IA 1WX0A 3W1RA 3QOKA 1UPPA 1CENA 1YPFA 3ALFA 2PTWA 5GQBA 4GUHA 5FJTA 3I4EA 1H3GA 4GG9A 2WSKA 2VNCA 2ZRUA 4Q8UA 4L1XA 4WGHA 5F4WA 5G4EA 1PKMA 4HT3A 3KZSA 3CO4A 3WY1A 4NAEA 3FXGA 5HULA 1X39A 1CPUA 4HD5A 1NP2A 1P0DA 3DFPA 3MJYA 4NSBA 5K9DA 3KVMA 1K8ZA 3EKGA 4JD4A 5A6KA 1B3YA 1UMYA 2VEFA 3WK2A 2E4TA 4LYQA 2WNNA 3NZGA 1KV5A 4KQNA 3NSNA 4LAZA 1K03A 3L9CA 1GTHA 4YYCA 1ZLPA 3TH6A 3M0MA 4QTGA 4Q4OA 3GAKA 3EEZA 3HGJA 3UXIA 2FVLA 4JIHA 1F07A 2GZXA 2W3ZA 4JTLA 1KM1A 1BVZA 3ITLA 2ZC1A 3G0SA 3VUPA 1WDWA 4DHGA 3STCA 1JCNA 1MQPA 1REQB 4QE4A 4DXVA 3NFUA 2EPHA 3UA3A 2ZICA 2XPKA 3HFTA 4JYEA 3AMGA 3OZMA 3WX7A 5F2LA 4NNBA 2Y0FA 3MB9A 1G1YA 1OB0A 4US5D 2CLHA 3UR2A 1HL9A 4O1BA 4H8NA 2OG9A 1WUFA 4NU7A 3CWHA 3GUWA 3BMXA 3IUHA 2Z1XA 1UWAA 3HN3A 5DCBA 4I9MA 2W66A 2PRHA 4ACZA 2ZBTA 3CV6A 3LUTA 3TU9A 3C0LA 2JALA 2XFYA 4C6KA 2HVNA 1EIXA 4PTNA 5LA1A 1KQZA 2X7VA 3W6YA 4J3VA 1NP0A 2A3HA 1JNEA 1VBGA 3SSJA 1EXPA 1ALDA 1R30A 3BLLA 3FK4A 2FIQA 1NWSA 2OLSA 2HWGA 5I3DA 1IEXA 1OFDA 3GU2A 3RM8A 1XINA 1ITCA 4ZQRA 5T91A 3TV8A 3DFTA 1V6YA 3OZPA 3MI3A 4JTIA 3T08A 3G1SA 2FDSA 1D7FA 3MANA 1R3RA 4PUMA 1XG3A 3EB4A 2H3BA 4ZO6A 3ZVHA 3KLLA 2ACSA 3NCOA 1ZJAA 2CLOA 3AJXA 1ZAIA 3GNPA 2GVGA 3NOYA 3VIJA 1JDFA 2IPFA 1ZJIA 2GOUA 3BOXA 4U2YA 1PTGA 4O28A 1SSGA 3WDQA 2YCJA 2X0HA 5D38A 1JF6A 3TSDA 3LCHA 5DT7A 2BHZA 4JFSA 3OB8A 4NVTA 3CZKA 2YX0A 3BAKA 2VX4A 4NZ3A 5G5IA 5I5RA 2WSQA 5BMWA 2MNRA 2ON3A 5KSWA 4C6PA 4GBDA 2OJPA 1TJ2A 4EPEC 1XLBA 2XM2A 2ABAA 1UR0A 4K8GA 4GLEA 2P8CA 4RNHA 5CJMA 4C6IA 2DW6A 4AHOA 4DJDD 2UY2A 2E7FA 1GCYA 3P84A 3AMCA 3D47A 5C55A 3B0PA 5CBIA 3G1DA 1U1JA 1NTHA 3G18A 3QY8A 3ONBA 1RLDA 3QJAA 1I9CB 2DJLA 2QS8A 1XIMA 3GKAA 1EOKA 1OVDA 2GGHA 2E28A 5HJYA 3EB3A 3GY1A 3TYZA 4TOQA 4GXWA 4IP4A 4NJKA 3K1GA 4LAOA 4H9UA 3USBA 4HHMA 4U28A 4JHMA 4WQ6A 3L4UA 4AH7A 1EO5A 1D8CA 3O7UA 5D2TA 2XFWA 2WVVA 4YTSA 4MOZA 3V0TA 4YVXA 4OBSA 1CGWA 2WPGA 1S2VA 1FP9A 3REQA 1WA3A 3UWQA 5BCAA 3C0QA 2D0HA 3ICJA 2C14A 3GU1A 1SO6A 1R2TA 3W71A 4IMCA 3JZEA 4LUTA 3E2QA 1MNSA 2C7FA 2CWXA 4KERA 4UR9A 5EBAA 3U57A 2WJZA 2RGMA 4ERAA 1J5SA 4PC8A 2J88A 4UBPC 4C90A 3V5FA 2VEKA 2RJHA 4EP8C 4F40A 1JYWA 1AW1A 3MW7A 3E6EA 3PBYA 4LY4A 5XIMA 4H9XA 2V2CA 1J6OA 2E40A 4GYFA 1BGAA 5EB8A 4DWDA 4KRUA 2MUCA 1TMLA 4KF1A 2HMCA 1X8CA 1H1ZA 1H5YA 2EPKX 5LIXX 2X42A 3LXCA 1G69A 3MCMA 4TMCA 2VX7A 4KRZA 4GC4A 4LNCA 4AVOA 1OINA 4KWOA 3WEZA 5AHMA 5LIYX 4YIWA 4ICMA 1UBSA 4RJEA 4IXHA 2Y88A 2ZRYA 2CIPA 3W1QA 3DENA 4E4PA 3LBMA 1E1CA 3CZEA 1CGXA 1W37A 2V5CA 3TYDA 3MA8A 1MMFA 1EEPA 1XLAA 1AW5A 3W00A 2Q02A 1SO4A 2YBUA 1Z89A 2PLKA 4FPSA 3NSXA 1GVQA 3SCOA 5AYIA 1VIZA 1GOIA 3K8LA 4GQ0A 2DW7A 3QHNA 3IIPA 1S5NA 3SQMA 1A5NC 3TA6A 1X8FA 2GPTA 1GVSA 4LUJA 2QCHA 4JY9A 1O66A 3W7GA 3PZIA 4GE8A 1AH4A 1DHPA 3GVVA 3Q37A 4MIMA 4DWSC 3AHTA 3JVAA 3A5VA 4OUIA 4IMDA 3I68A 1FCUA 3NQMA 4D6CA 4H7ZA 5A94A 1PZ3A 3KE0A 3A21A 4H4IA 3L68A 4KWVA 1BRLA 3QH2A 3A12A 3CIXA 2F6XA 2WPBA 4O18A 4QCEA 3NO1A 1P6CA 2E3ZA 4YWIA 3NL6A 2KX9A 3BAJA 4LS2A 1V7YA 2F2KA 2JF6A 3NQ8A 3HPZA 1QO5A 4O50A 3F7JA 4B90A 3N1AA 1DVJA 1JD9A 1T8XA 4NHVA 1MQQA 3C52A 1FWGC 4GH3A 5DCDA 1BXCA 1ICSA 3I10A 2VGFA 2WSRA 1FWNA 3CMJA 1TZ7A 1Q4NX 2XZ7A 1EO7A 3NDOA 2FGBA 1A47A 2BVYA 1AJZA 4ZSTA 3B0XA 4JYDA 3LX9A 1ICQA 1IR2A 4MWAB 2V5KA 4DYKA 1QDSA 1TCMA 2C6QA 4DXXA 3SIZA 4YYFA 2X1IA 1XBVA 3FJ4A 3QF0A 4LAKA 5LZLA 4D2JA 4NKCA 1GKRA 3K46A 4DWSA 2CESA 3M7SA 5A6JA 1DJIA 1TJPA 3GKFA 4R7OA 4M19A 4HPNA 2Q8LA 3TJXA 1LM1A 4LGXA 1RUSA 3TVAA 2B7OA 4W7UA 3ONCA 2O7SA 3NZPA 2QUNA 4IIDA 4N9CA 5FKYA 3W24A 3W7NA 1XRTA 2OPJA 4Z1BA 3DGBA 4B2DA 3FA3A 4M6QA 3VA8A 2FLIA 4BF5A 1W17A 1WZAA 1QHPA 2CZDA 2PFHA 5D30A 2CLFA 4N4PA 1F5ZA 2Y6ZA 1KLZA 1I0DA 1Z69A 3W9ZA 3TYCA 2A3EA 3GZAA 3B9OA 1H63A 1KCXA 3P74A 2FGZA 2PSNA 5CZ0A 4DJFC 4LCQA 3NJ3A 3LPFA 3V75A 3SO7A 4UTKA 2FHBA 4YCOA 3VX0A 4W5UA 1A5SA 4WSJA 2CETA 5LGZA 1TV8A 2NX1A 4MHBA 1PKNA 1X1ZA 1LDCA 2P53A 3VOJA 3B8DA 1H2JA 3CT7A 4LCRA 1V6UA 3RM4A 2GSHA 2INFA 4NZ1A 2GGGA 4IIBA 3S5OA 2UBPC 1EBGA 1L8PA 5G1MA 3ITYA 1BQCA 1E5JA 1E9YB 3BG3A 2ZX7A 4ZOEA 2OODA 1KC7A 3WDRA 2PU0A 4IFKB 5F1VA 4CN1A 1O5RA 3VFCA 4B4FA 1WDRA 3WL0A 1HXJA 5HOSA 4JHOA 4PMJA 2C79A 3CO8A 1HKWA 1XDLA 4DPQA 2DQXA 1LUCA 1TWIA 2ISSA 2ZX8A 3ABZA 4AG0A 4MB3A 4FP1A 4J35A 1KLYA 3DAQA 2WV8A 2VI0A 3ERPA 3O8AA 2Y5JA 4H6QA 3TX9A 2YBTA 2ZFAA 1RD5A 1G4PA 4BWLC 1PZ1A 1JZ6A 4I6KA 3DFHA 3EOLA 3HGSA 2V81A 5AOUA 4XKMA 1PYFA 1OG0A 3HJZA 2QV4A 3HPXA 3KWSA 2ICSA 1VZWA 5D2VA 4LVDA 1Z48A 3PZMA 4QDWA 3H7VA 4UCFA 1L6WA 1E0XA 1NARA 4GVFA 1HGYA 1UWTA 4TVUA 1QRQA 2BXZA 1XD0A 5IDIA 2BY3A 2ZZ1A 1ZQ5A 1J79A 1LYXA 1CGVA 3UXDA 3AOFA 3CUGA 4JX6A 3N2OA 5D8WA 5J5DA 3HU7A 4R3UA 5H91A 3LTPA 3I3EA 3QYSA 2JK2A 4WZHA 4PMUA 4IMFA 4IQJA 3CC1A 4F48A 1UMLA 2WZHA 3GIPA 3QQ0A 1H5VA 4F0LA 2DEPA 3ZIZA 3F5LA 1B9BA 1C8XA 4Q4PA 1XR2A 4OBTA 3URNA 3ZO9A 1QI5A 2OQHA 2I5IA 2VXNA 1KGXA 5PTDA 3QVQA 3WUFA 4K7YA 4TTUA 2V68A 3NR0A 2XH0A 3UA4A 3BZGA 3DYOA 3GX9A 5EMJA 4Q3MA 3NL5A 1VJSA 1ADSA 1V0LA 3MV01 4Q4QA 2Z1WA 4BWLA 1JQXA 4AZ5A 1CECA 3DZ1A 2P50A 1JJKA 2XVKA 3F4WA 2A79A 2CNCA 3TK7A 3S2JA 4XO7A 2EG6A 1MW1A 1VQTA 2OWCA 1GEQA 1EJXC 3GXTA 1CGUA 1YNYA 2Q8XA 1NDWA 1TPVA 4ML9A 2Z7GA 5A8GA 3WLJA 1IT0A 4QBXA 1YX1A 3ZT6A 5F7UA 4JIPA 2FVMA 4QDMA 4I8YA 4R85A 3W1NA 4IUGA 1FDZA 5GJPA 4I9AA 2QIIA 4IX2A 1OGGA 1LQAA 1W1B1 1OQFA 1T5AA 1FQ0A 5C5YA 2DFAA 3B0YA 1PV8A 4I5XA 2NSOA 1OIMA 4IGMA 2VMFA 3TZFA 2OLAA 5BXTA 1H1NA 2QCFA 1YDNA 4P7LA 2R8WA 5F4XA 5KZ6A 1KNWA 1VLIA 3VXGA 1QI4A 1TWDA 1VYPX 4G7EA 1KWGA 3TONA 4LXFA 1OX5A 4GI6A 3VGBA 3KP1A 5E0CA 2YA2A 3BC9A 4TR9A 3ZJ6A 3BJSA 1M01A 1QW7A 1XLCA 3L12A 1XICA 1GJUA 1NSJA 3GC4A 4HA4A 3WMCA 3MS8A 1VFUA 4HA0A 9XIAA 3GHSA 1CDGA 2WO5A 3UETA 3Q65A 1R86A 1D3CA 4UTFA 1IV8A 3GD6A 2EEXA 1T6MA 4CQBA 1HT6A 2XSBA 3W1TA 1GWJA 5CPOA 1LOLA 4HU0A 5TF0A 2E9BA 2Y62A 3MSRA 4U5KA 4UMAA 3TJIA 1E0TA 5EGRA 2G95A 5CPNA 1WE5A 3CQKA 1NU5A 1PVNA 4HPGA 4ZA0A 1MZHA 4RX0A 4Y9NA 3O06A 5I03A 1WAWA 4I7WA 1CX9A 2BV9A 1RJQA 1MZRA 3OO2A 3D0CA 5DRIA 3TYBA 2PDGA 3VO0A 1EA9C 1ZJHA 3O07A 1HVXA 3TW9A 1DE6A 1VYRA 4KCWA 2ALRA 4DBDA 2J7BA 4GMEA 4NT0A 5C0QA 4IGHA 3STPA 1W8SA 1QI0A 5I09A 4FX8A 1YPIA 4LVAA 4U3CA 3TUUA 3PZNA 3IEBA 4C6JA 4HK5A 3MP5A 3TC6A 2F9RA 2NT1A 4HTBA 3L7RA 4G2DA 3V35A 3R25A 2VDHA 1JFHA 3HQ1A 3RUBL 4J40A 4UC5A 4AYSA 3SCRA 3ZZ1A 5A6BA 2JEQA 3M9YA 1XH2A 1VENA 1UKPA 2NV1A 4US5A 3FV9A 6A3HA 1P7TA 2PAJA 2GVJA 4G6CA 1ZRQA 1AQMA 3WK1A 1Q66A 3AISA 4BQ4A 3WK0A 3QFWA 2JE8A 3EPOA 3TAKA 3M0XA 1QBBA 2QJGA 3U2ZA 1OYCA 3PJWA 5FF3A 2B7NA 2BOEX 1W32A 5C2XA 3ITXA 1PEZA 4MY1A 1GPFA 4YWSA 2A3CA 2Y8UA 3WD1A 4GQGA 4C60A 3N11A 1NDVA 1W5NA 4TVCA 1JXKA 3KFTA 2WVUA 1G4SA 4ZE4A 4Q4RA 4OVXA 4E0CA 2YIHA 1LG2A 3C0SA 4FOKA 2QAFA 3WUGA 1JVNA 4MDOA 3CZ8A 3F4DA 2PLCA 2PU1A 3GSMA 1ZP4A 3U2OA 3SUVA 4K8HA 1NWRA 3W2KA 1ZCCA 5FF7A 3DCPA 4H00A 4Z0SA 4H1ZA 3VDBA 3T2PA 5I00A 2WWDA 2CITA 4EPKA 4AUBA 4QSFA 4PODA 1ELSA 2C15A 4LEQA 3L4XA 3N3TA 4BI6A 4XZBA 1IR1A 1LLWA 3G1VA 4GPNA 3OTRA 2QPXA 5FSEC 2GQ8A 3TTQA 4LAUA 4PYSA 1Q7MA 2OEMA 4UCGA 1XLJA 4YVPA 2J8TA 3GG8A 2J8FA 2D2OA 4HN4A 1ISZA 3ISIX 2C13A 3BCFA 4F0RA 3JS3A 1JDCA 3ITTA 4AWEA 1VBHA 4PUWA 3IIOA 1Z6KA 5CBJA 1A49A 1QOPA 2O4QA 5KZEA 4FNQA 1K70A 1W3LA 1QW9A 3CV1A 4GCAA 4RV8A 2ZRZA 3QM3A 4DJDA 4E2VA 2D22A 4FX6M 6REQA 3KDOA 3P80A 2A7RA 1K77A 1T99A 2J79A 3I3DA 2PLMA 3QYQA 4IISA 3QN3A 1Q7QA 3SFWA 4S2CA 2XVGA 4OU1A 4UOZA 3BW3A 3PS7A 3TNBA 3U5UA 3M0LA 1TWWA 1W5PA 1GOXA 3TCEA 3LI1A 2YL5A 2VGGA 3PB0A 3QGAC 3KL3A 1KXQA 2WWCA 3H26A 2QCDB 1PX3A 1UUOA 3LTYA 3KAOA 5JU6A 1E6PA 2OXNA 1Q8AA 1TPH1 2POZA 4I7UA 1OGBA 1J0YA 2WNQA 1TPWA 4FXRA 1S1PA 1EHAA 1GKQA 2GGJA 4GD0A 3IGXA 3M6DA 3GG7A 2G37A 3H2OA 3B8IA 3GW0A 3LOTA 3UCDA 1XYZA 2YKKA 3DHDA 3IJLA 4I3GA 4WJ8A 1L6SA 3GZ3A 3R0UA 5DCEA 3VPLA 3W4RA 1DWGM 2YXXA 3ARQA 3WLKX 1GVEA 3OBEA 2E67A 5DY3A 4NAEB 4DF2A 4IPLA 1LWIA 5CZJA 4H3DA 1KXVA 1W2VA 2PRMA 4RDWA 2PDIA 5AHIA 1OT2A 1UG6A 4BFAA 4Q8OA 4J5NA 1I4NA 5GPRA 3VNKA 1XQLA 2H3DA 4J3UA 2CERA 4J4KA 2J25A 5AVHA 3LCGA 3TR2A 3F4CA 3LTSA 3LV6A 2VYOA 3DERA 3W29A 2RDXA 5HUOA 3W74A 5F2IA 3MDUA 4HJWA 4XBSA 3G6LA 3DDMA 4E38A 1BYAA 2E9MA 2BZNA 5FEWA 2Y70A 3BQ6A 3BG9A 2PF8A 3BLKA 4IL0A 4A8IA 2ZE0A 4UR7A 2PTDA 3EZ4A 1YYAA 5DXXA 2XGIA 3KRSA 5MKGA 3II1A 3H2EA 4JTEA 2A3AA 1HUVA 2Q3OA 2ZKMX 3GB6A 1S46A 1SJCA 1WKDA 1UIOA 2DUAA 3R12A 4D71A 4ACZB 4GCXA 3SJ3A 3R0KA 3HPAA 3FJLA 4AWUA 3GVQA 3E9AA 3WBXA 3IRSA 4WKHA 3V7PA 1FKWA 3EEGA 4PUEA 2X30A 4Z42C 1B9ZA 4AMAA 1RQBA 1MW0A 3VINA 4Q6XA 3DYPA 4S3EA 2DZVA 3OVPA 3ZWSA 4QE1A 2ZZ6A 3G1RA 4YMZA 4WK9A 3IVUA 4PEKA 1XKJA 3SUWA 1H0GA 2VUYA 2E0PA 2QCNA 4A3YA 3UEQA 4GZ7A 1EGVA 3MV11 3S6DA 3ZVHB 3LN3A 3FHQA 4PR4A 3KOYA 3UYIA 3CPRA 3GYEA 1TR1A 5E9XA 4AY7A 4XZHA 2FVKA 4LVBA 3OLIA 4MFEA 4K3ZA 5D9PA 3NGJA 3TWAA 3B8UA 5HMSA 5I07A 6ALDA 3P67A 3CQHA 1GG0A 3BV4A 2XG9A 3QR0A 2D23A 3H23A 4J3TA 1BXBA 1RXOB 2P8BA 5G2IA 5BRPA 4KCVA 5E0FA 1A0EA 4DIAA 1FX6A 5CSRA 3S42A 3L2IA 3IUDA 3UY8A 4X60A 5KMYA 4AAJA 2E8YA 2ZUSA 4GQBA 4QS5A 2OQYA 1DQXA 1HL8A 3GU9A 3H54A 3LBOA 4UZUA 4W84A 3M0JA 3W1AA 4BA0A 2Y7FA 1H0IA 1H7XA 5EBUA 3XINA 2FDMA 4D6FA 3PHAA 4B92A 1W91A 4CKQA 1M1BA 4L1GA 1E1EA 1K4GA 3H2CA 2PCQA 1XJBA 4W8BA 4C1NA 4RPQA 1KQYA 1XH1A 4TV6A 3BH4A 4J9JA 3VZXA 3WK3A 1OIFA 3UWVA 4YCPA 3HMCA 4LVFA 1FWBC 5AB3A 3E02A 4B5NA 3S2LA 1U2YA 4FX7A 4GUIA 4X9YA 5LXEA 3EA3A 1J0ZA 5TQLA 4S39A 4ZL1A 3OOQA 4MNMA 1NFPA 3VIKA 3URQA 4MJ4A 3MUIA 2WVVB 4B9ZA 4P8WA 2E1DA 1CIUA 1IEIA 2ZIDA 3WQ5A 2WYSA 3IJ6A 4ZOBA 4HHLA 3REQB 1Y5VA 2VURA 1GORA 2OO6A 1TFVA 2IKIA 3BVJA 1Q6FA 4D9PA 1JZ8A 4E6MA 4KESA 4U2ZA 4HSHA 4PMZA 4IHCA 3QZEA 4LUTB 5HMDA 4IQEA 1JD7A 3H22A 3M5VA 4XZMX 5E5CA 4DZ5A 4A3HA 2QHAA 1PS9A 3CB3A 3S5YA 4PTXA 2Q6ZA 1XV8A 2PGRA 1U33A 3M0HA 1BSLA 3HOJA 3AYVA 4FSAA 1SMDA 1J0HA 1BQGA 1I8JA 3GNRA 4IQLA 2OX4A 5DMLA 2AQWA 3O6DA 4LYKA 5XIAA 5K2ZA 3L2LA 4M56A 2EGZA 5I3IA 4UTIA 2VP8A 4NI3A 4P8VA 2BGSA 1IZCA 6XIAA 4IH3A 3VIIA 1O94A 1EFZA 3V1HA 1UKOA 3PFRA 4PUDA 1E6NA 3FN9A 4MB5A 1ZBKA 5J5RA 3SADA 5DXYA 3LM3A 1V0KA 4O1AA 4MNLA 3AS3A 3LB0A 3E3HA 1J10A 1MWOA 2RKXA 5IM51 1E1CB 3A23A 4HNNA 3IIZA 2D3NA 4ZZ9A 3PP7A 5FD0A 2IUZA 2YYTA 3AXHA 4AIBA 1OG6A 1FCVA 4DX3A 5A1AA 1L6GA 1TB3A 3CZGA 1JNDA 1L2QA 3MP4A 4V28A 3P0WA 3VAVA 1RV8A 2VWTA 1EX5A 2PC8A 3PULA 3MSGA 5G2HA 1N8IA 4BF9A 4JICA 1E4MM 5C9UA 3NA8A 4W9TA 5TD4A 4HOZA 1W9BM 5FIPA 1YNQA 4EE9A 4BEUA 1Y65A 2VR5A 3ARRA 3U6WA 3D46A 3M7WA 1BRLB 2VX5A 3ITGA 3BUVA 4XIMA 1QU4A 3CT2A 2O55A 1QWGA 2A7NA 5DEZA 3WLOA 4NYYA 4JQ1A 4DF0A 2C18A 3NSMA 1FCBA 3BL3A 1W56A 1I1XA 1J2WA 1EJTC 4S3KA 2V82A 4CD6A 5K9CA 3CZJA 1Y8BA 5HNUA 2PWDA 4HIBA 1IQ8A 1F8MA 4XX6A 2PDUA 1WOAA 4MFDA 5CC6A 3UF9A 4PRWA 2ZE3A 2CYGA 3GH7A 3MC5A 3EOEA 1S5VA 4MG4A 1G6CA 3IRDA 1UIPA 1QNVA 2YYUA 3NEHA 4NF7A 4PL2A 2VHLA 3BURA 2J66A 1OADA 1Z41A 4ZQNA 3UPWA 1OYAA 3KRUA 3A22A 5A6AA 3K8MA 1POKA 1HJQA 1MXDA 4RE2A 2SFPA 3ARPA 3UP8A 3AIWA 1Z44A 1K8YA 2ZX5A 2W4XA 3EXRA 4FI4A 4DWSB 3V0UA 4ADUA 5DN1A 3BTNA 1TSIA 3B4YA 5A8MA 5LNWA 1C93A 1R8LA 4GGBA 2D1ZA 2PCEA 3UGRA 2GOKA 1A3XA 2XN1A 3ARXA 3CK5A 4PBGA 4L5ZA 3SM0A 2J74A 5IHRA 4O52A 1OZMA 2AAMA 5E9AA 3T09A 4D8ZA 1TPEA 3UYCA 3WYZA 3G24A 4EXAA 1VFTA 4O4WA 5DMMA 4D8LA 1V5XA 4FNRA 4S3CA 4MUZA 3VNIA 1WB0A 3BAXA 3KCOA 2D2GA 1ZB5A 5BWAA 2WCGA 1VPXA 3H12A 4J1OA 4E5TA 2PDMA 4NX0A 3W1XA 3S5SA 1OFAA 1X6NA 3EDEA 5DF0A 4QQ3A 1OSEA 2Y4SA 1AH3A 2FB3A 3S9YA 3MVTA 3ABSA 3ME3A 3UXAA 1N82A 1MEIA 1AK5A 2BFGA 2NUYA 2VQTA 1GUVA 1K9DA 2WZEA 3N9KA 3UGVA 4LU0A 3GQYA 5D4YA 2VOTA 4Q4SA 5RUBA 1JR1A 2IKHA 3LI0A 4YTRA 1ZFJA 3NQAA 3LLFA 3QOMA 5A95A 3AAMA 2WQDA 2RJGA 3C56A 3KHJA 1MRAA 1VFLA 5ABGA 1PYMA 2OLHA 3WSUA 4L80A 3WMSA 4PSPA 4RXFA 1AA1B 4C6OA 5HR7A 3VZYA 4AIEA 2AMXA 3DIPA 2DUZA 3S2CA 5U7SA 2OOFA 3EWUA 1LUCB 1C8YA 1FDJA 3UR7A 1MDRA 1R9ZA 3ARUA 3IJ8A 1P1XA 5ENLA 5FEXA 1BGGA 1QTWA 1ECEA 1GOKA 1QK0A 1LL6A 4DYJA 3HJEA 4TMBA 1THFD 2ZZ4A 3WMLA 2ZUUA 4D72A 2PWEA 3NGFA 3I7RA 1FA2A 3ZS4A 4S3DA 2YLLA 3U8GA 3ANUA 3M0IA 4PN2A 1XIBA 2QW5A 2BNJA 3RMEA 2XM1A 4MLRA 4DAIA 4NXSA 1C8QA 4R7JA 3P0XA 1LORA 1KGWA 3NVDA 1AG1O 3B9NA 4BY3A 2C0HA 3ZSTA 2V2HA 3SI9A 4KWWA 1EP1A 4PE8A 5IHSA 5LNSA 4P7RA 1QHOA 1OFEA 1RCXB 1R2RA 1PXGA 5H6HA 3N4FA 5HWNA 4GJ1A 1S1RA 1NOFA 3PBWA 4LEFA 2PD5A 1J8VA 3UZ5A 5CZKA 1EBHA 4XAGA 4ORMA 1LWHA 3VIFA 1QOXA 1R3YA 1TX2A 2CFFA 1JZ2A 4CQCA 4NJHA 3WH5A 5BU6A 1WZMA 2INZA 1RPXA 4K37A 3SUSA 1E4LA 4FXJA 1E5NA