1YIXA

Crystal structure of ycfh, tatd homolog from escherichia coli k12, at 1.9 a resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
265
structure length
265
Chain Sequence
MFLVDSHCHLDGLDYESLHKDVDDVLAKAAARDVKFCLAVATTLPSYLHMRDLVGERDNVVFSCGVHPLNQNDPYDVEDLRRLAAEEGVVALGETGLDYYYTPETKVRQQESFIHHIQIGRELNKPVIVHTRDARADTLAILREEKVTDCGGVLHCFTEDRETAGKLLDLGFYISFSGIVTFRNAEQLRDAARYVPLDRLLVETDSPYLAPVPHRGKENQPAMVRDVAEYMAVLKGVAVEELAQVTTDNFARLFHIDASRLQSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords deoxyribonuclease ycfH
publication title Crystal structure of ycfH, tatD homolog from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 100
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 3.1.21.-:
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01026 TatD_DNase TatD related DNase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1yixA00
3F2BA 4C5YA 1FWAC 4LCQA 3IJ6A 4WHBA 2EG6A 4IGNA 4LCRA 4B3ZA 4BY3A 4GX8A 4XD4A 4INFA 2FTYA 1J5SA 3LS9A 3O7UA 1V7AA 3K5XA 3SO7A 1FWHC 2UBPC 1RK6A 1M65A 2CZVA 1FWCC 1EJWC 2DVXA 2PAJA 2R1PA 4NG3A 2BB0A 4J35A 3GU1A 4DI8A 4QS6A 4IH3A 2Q09A 3E3HA 4C6BA 1R9ZA 3TN5A 4L9XA 4KEUA 4BKNA 2QT3A 4CQCA 3F4CA 3UR5A 4DZHA 3O0FA 4H9YA 4GOAA 2O4QA 1GKQA 4HK6A 3F2CA 1A5LC 3T81A 1A4MA 4DLMA 1P6CA 4GY0A 3RYSA 3UR2A 1FWDC 5CH9A 1GKPA 3LU2A 4C6PA 1ITQA 3KM8A 4GZ7A 1YBQB 4V1YA 5FSDC 1PTAA 1NDZA 1FWFC 1I0DA 2Z00A 1PB0A 4BJHA 1EJXC 2YXOA 4KETA 3QY7A 5E5CA 1A5MC 3URQA 4KQNA 3MJMA 1KRCC 3RHGA 4LAMA 2EG7A 3IGHX 2P50A 4C6OA 2AMXA 4C60A 2FVKA 2PGFA 2Z28A 3T1GA 4CNSA 4H9VA 3MSRA 1P1MA 4G7EB 2GSEA 4GX9A 2OB3A 4PE8A 2WJDA 4P5UA 3SFWA 4CEXC 2VM8A 4H00A 1FKWA 4IFRA 4HK7A 4OFCA 1GKRA 3MTWA 4E3TA 3ID7A 3TN4A 3E0FA 1EJSC 2G3FA 3LSCA 4LALA 1ITUA 2R1NA 5A6TC 4IF2A 3HM7A 2D2GA 4H9ZA 3TN3A 3ORWA 3GUWA 1V77A 3DC8A 4H9UA 1PSCA 4RDZA 2YB4A 2OGJA 2W9MA 1RJPA 2D2HA 3F4DA 1E9ZB 1BF6A 2GZXA 3GIPA 4PBFA 4LANA 4XAGA 3IV8A 3MDWA 3B0XA 1YRRA 1FWJC 4PCPA 4HA0A 3ITCA 1K70A 2HNHA 1YBQA 2PGRA 2AQOA 4QRNA 4ZSUA 4C6LA 3T8LA 2F6KA 2FVMA 2VHLA 4KERA 3B0YA 3LNPA 1J6PA 3DCPA 4UBPC 1ONXA 2UZ9A 3WZ0E 1EJUC 2WM1A 2IMRA 1EZ2A 3JZEA 4GY1A 2Q01A 4R7WA 5AKQA 1O5RA 3EGJA 4I6KA 1EJTC 1FWIC 4G7EA 3OODA 1YNYA 4LFYA 1WXZA 4ERIA 4PCNA 1V4YA 1YIXA 4EPDC 4LCSA 3HPAA 2QS8A 3RN6A 4KEVA 2BGNE 4HK5A 4RDWA 2VC5A 4JOMA 2Y1HA 3TNBA 4ZSTA 3GU2A 2DVTA 1WXYA 1R9XA 2FFIA 2HPIA 3LGDA 4XAFA 5FSEC 4B90A 1XGEA 4C6FA 5HMDA 5HMFA 1EJVC 3IRSA 4C65A 4DYKA 4B91A 4DO7A 4ERGA 1M7JA 1ADDA 2R1MA 1RAKA 4H9MA 4MUPA 4NP7A 4KF1A 4XAYA 3S2NA 2RAGA 4H01A 3BE7A 4CNTA 3GTHA 1EJRC 1XRTA 4LEFA 4QSFA 3V7PA 1RK5A 3S2JA 4RDYA 4XD6A 2Z2BA 3MDUA 3A3WA 3QGAC 2XIOA 4C5ZA 3CJPA 1ONWA 4H9TA 3OU8A 4UB9A 1RA0A 2ANUA 5HMEA 2Z29A 3A4JA 4EPKA 5G4HC 4IFKB 4C6EA 2Z7GA 1O12A 4WGXA 2D2JA 4ERAA 3E74A 3PNZA 2ADAA 3N2CA 2HQAA 3QY6A 4KESA 2QVNA 2WJFA 3B40A 3QY8A 3WMLA 1P6BA 1K6WA 4WVXA 1VFLA 4C6IA 1EYWA 4L6DA 1KCXA 2HPMA 4B92A 1A5NC 4ICMA 2VR2A 1QW7A 3MVTA 4R85A 2AQVA 1KRAC 2Z4GA 3MVIA 4AC7C 4F0SA 2A3LA 2E25A 4GC3A 2OQLA 1A5KC 3GIQA 4EPEC 3OQEA 2R1KA 2PLMA 4C6MA 3R0DA 3GRIA 1V79A 3EWDA 1E9YB 4QROA 4V1XA 3D6NA 1XWYA 3ICJA 2VUNA 2P53A 3RCMA 4GK8A 4QS5A 4DI9A 4Z42C 3S2LA 3NURA 1NFGA 1UBPC 2ICSA 4F0LA 2R1LA 3IARA 3MPGA 2ZC1A 2EG8A 3GTIA 4AQLA 4GXWA 4RE0A 1NDWA 2O4MA 4IG2B 2VC7A 3GU9A 4IFKA 1UIOA 4EP8C 1UMLA 3PNUA 4C6KA 4C6JA 4R88A 1POJA 4KIRA 4CEUC 4YIWA 4CQBA 3IPWA 3DUGA 4DLFA 3K2GA 1A5OC 3OVGA 3TN6A 3HTWA 3NQBA 3FDKA 3LY0A 1XRFA 1HZYA 4C6QA 4C6DA 2GWGA 4J5NA 2Z27A 3GTFA 3QGKC 1NDYA 3NEHA 1RJQA 1FWEC 1QXLA 4CQDA 2HBVA 1JGMA 3K4WA 1FKXA 3CS2A 4TQTA 4I6VA 3E0LA 4LAKA 3LA4A 1ZZMA 4HJWA 1POKA 3AU6A 1PO9A 3URAA 1IE7C 2E1WA 3UF9A 4GY7A 2PUZA 2I5GA 3LGGA 3PAOA 4LH8A 3PBMA 4LAOA 3CAKA 3GG7A 1FWBC 1I0BA 3UBPC 3F2DA 3URBA 4RZBA 1YMYA 3URNA 4EPBC 3AU2A 4IG2A 2Z2AA 1R9YA 3LSBA 1J6OA 4C6NA 1J79A 4GBDA 2YB1A 3EWCA 1A4LA 3AUOA 1KRMA 2HBXA 2I9UA 2Z25A 3S4TA 1KRBC 4DNMA 2YZ5A 2KAUC 1UIPA 2Z26A 4GYFA 1W1IE 1DPMA 1S3TC 4CNUA 4XD3A 1FWGC 4QTGA 4IFOA 4XD5A 4J2MA 4DIAA 4DZIA 1RJRA 4D8LA 3GTXA 1RA5A 2OODA 4F0RA 3MKVA 3C86A 3E38A 4IGMA 2GOKA 3UPMA 3FEQA 5LXXA 3ISIX 4H9XA 3OOQA 2FTWA 3IACA 2DVUA 3FDGA 4IQJA 3OJGA 4NI8A 2WJEA 3S2MA 1V51A 2QPXA 1K1DA 4XAZA 4M51A 4PBEA 3PANA 2OOFA 4C6CA 1EF2A 3WYZA 3G77A 4G2DA 1NDVA 4KEZA 1M68A 2Z24A 4RDVA 3A3XA 2GWNA 3E2VA
chains in the Genus database with same CATH superfamily
2DZVA 4TX8A 4LCQA 3PS7A 3DBPA 4LRTA 3DG6A 3N2XA 3F4NA 4INFA 5FAJA 1GQLA 1R6WA 3OGSA 3TQKA 1JZ8A 5HBFA 5CAKA 3C52A 1L0PA 3S47A 1AJ2A 3MMUA 4JFTA 2WYSA 4PL2A 8A3HA 4X2PA 2QV4A 4X9YA 2WOQA 3VA8A 3C0QA 1VGAA 1OD8A 1HGWA 4AZHA 3WF0A 2VELA 3KM8A 4OUEA 6REQB 5AHNA 3NQDA 1MW0A 1NWTA 1UP0A 5JUVA 1LUCA 1H62A 2OCZA 2QCNA 2IXUA 1V3LA 2Y5JA 1DWJM 2QR6A 3C4UA 2ZDSA 1V3KA 1W1PA 4UIOA 7PTDA 1QRQA 3GKAA 3BG5A 1TPEA 3QR3A 3TTEA 2TSYA 4PR4A 1OCNA 2HE8A 3P80A 1KWKA 3IGSA 2J7EA 1XLBA 1XLIA 3T2PA 1R0MA 3FCPA 1TR9A 2J47A 4ZB5A 1AUSL 4H6QA 4RDZA 1IR2A 3NQEA 1K6AA 2ZRUA 3M4HA 3AICA 3A13A 5CSRA 2BLEA 1BXBA 1ISXA 3MCNA 1SU5A 3G8RA 2NXGA 1QVBA 4YXGA 2PGEA 1ZBCA 1XIFA 3WNOA 4D6JA 4C1NB 5A69A 3TTSA 3UPWA 1XC6A 1RH9A 3KLLA 3NOYA 2YL8A 4PMOA 3B0YA 4YNGA 3U48A 4D71A 2WMHA 4EF8A 1J0KA 2E9BA 3NZQA 1DJQA 5CJNA 3LHZA 2VRKA 4I6KA 3PPHA 3OODA 3VFCA 4LFYA 2C79A 4S2CA 1JZ5A 4AH7A 4LCSA 5A6SA 1SW3A 1V02A 3WH9A 2PDMA 4DWSB 4WDUA 3OW1A 5K2ZA 2VC9A 3FGCB 1NU5A 4P7LA 2VZSA 5IDZA 5AY7A 3RMEA 3VMNA 3R58A 3VD4A 3TXVA 4X0NA 3TWAA 4AY8A 3BLKA 3BC9A 3IJLA 4O16A 4QG9A 1RP8A 1CGVA 3ONCA 2GUBA 3PJTA 1HUVA 4AG0A 4A2RA 4LS1A 2QDDA 3IK2A 3EX6A 2Z6IA 2UY3A 3HMJG 2HE5A 1A80A 1V93A 1MO0A 2ANUA 1S3HA 1I2OA 3A4JA 5CJ5A 3BW3A 3L2IA 2V6AA 4HOZA 5FF7A 1TZ9A 3H4GA 5HAOA 1TPB1 1YKWA 4U10A 1Z69A 1YTDA 1R85A 4Y90A 1QAPA 5MKGB 3L2MA 4GUHA 1J11A 4A21A 3VC5A 2QV5A 4ZB0A 2DSVA 1Q85A 4WKFA 2C8NA 1ZFJA 1H7OA 2A3LA 2E25A 1E15A 1GCYA 3U2OA 4CUCA 2YA2A 4O54A 2J75A 4GXPA 4IM4A 1ONEA 2PE4A 3WLKX 4HGXA 3TQVA 3VZZA 4QROA 4OT7A 3CUXA 2P53A 3RCMA 1IZCA 4Z42C 3W2JA 1UBPC 2ICSA 1CGXA 2OYMA 3L67A 2ZWYA 3PJUA 4CNNA 1L6GA 1W1A1 2WK2A 1CXFA 3AISA 3EB3A 4OOZA 4DO4A 3GFZA 4PUMA 1LRQA 1W1B1 1BRLB 4JYEA 4KFPA 3WQFA 4YIWA 3WLLA 3UWVA 3IUHA 1A5OC 1U5VA 4ZQCA 1W3JA 2FH8A 4M7SA 3BLOA 1SJAA 1NF0A 2C7FA 3AUJA 4LVDA 4UTFA 4EKJA 4NI3A 2GWGA 1E6QM 4GUIA 2WMIB 4KWOA 3SBFA 5FD0A 3W2MA 1FKXA 1MNSA 3E0LA 1Q4NX 3M1ZA 4K7YA 2WSYA 2L5HA 4N0RA 1VJSA 4GH1A 1RLDA 3GXPA 4FALA 2A6NA 7XIMA 3QSRA 2JBMA 4LY8A 4D2JA 4E2DA 3LZ5A 2HK0A 2E68A 2I14A 4EACA 3P61A 2C19A 3AU2A 2ZA2A 3LV6A 3L65A 3CUJA 1EPXA 3MUXA 2FIQA 4ZOCA 3CQHA 1XLDA 1NVMA 2BXYA 3NM1A 2VR4A 1X97A 1TG7A 3CUHA 2ALRA 1CXKA 1SMDA 4DRSA 4GGHA 4DXXA 1W1IE 4FPSA 3WMCA 3P67A 1EH9A 2BXZA 3OQ8A 4DIAA 1RJRA 3WNLA 3IV3A 2Q6ZA 3HFTA 3P5YA 4JQ3A 2VX4A 3C86A 4TU1A 3L4YA 2C15A 3OG3A 3OOQA 4Q6JA 3VIFA 4P8VA 5G4EA 3GFXA 2WC3A 1I75A 4L6HA 2CCRA 2W6RA 3U2CA 1DXEA 3EX1A 2W0UA 4UFIA 4KEZA 4IICA 1HKWA 4D8ZA 1H49A 2VFIA 4YVVA 4I7UA 2FGLA 4NHVA 1XV8A 4AZ7A 5DEZA 4GKTA 4GX8A 3TYZA 4L56A 1BXCA 2VGGA 2ZWZA 1M5WA 5D9MA 1FTXA 3OBAA 3TJLA 4DWDA 3TCSA 4NG3A 3BDKA 3LI1A 5CCZA 3EB2A 3WQ4A 1Z8AA 2VC6A 3N4AA 4NYUA 2QT3A 1XCXA 3SAZA 1JFXA 5D38A 1JXKA 4LGXA 2OTDA 3OBEA 1VYRA 2C0HA 4GY0A 1GTEA 1N55A 4WSHA 2XYLA 3LPPA 3KBNA 1Z3NA 3H8AA 3GXFA 3PM6A 3NGFA 4NZ1A 4K8HA 3W7OA 1S2AA 1V7YA 4MNKA 3M0KA 1LWJA 1QWKA 3ZVIA 4PRWA 3UZYA 3GR8A 1Y5VA 4E0CA 2R94A 1XBYA 3KBVA 4KPLA 2PGFA 4JX6A 4H9VA 1C90A 1J2WA 2OB3A 4P5UA 4NVTA 3TMLA 4QQ3A 1VEPA 4OFCA 3TSDA 1AH4A 3CV2A 5JQ9A 1H1YA 5G2IA 5CLWA 1V6TA 1NAL1 3RF9A 4JY9A 4S3JA 2QIIA 2DZPA 4GVFA 4H9UA 2NQ5A 1DBTA 3Q4DA 1SZRA 4O1DA 1YX1A 4CD4A 1L8NA 1M3UA 2OYKA 4WF7A 3MYPA 5KZ6A 3PZGA 2JQXA 3IIVA 4QLLA 4GPNA 2A21A 1GZ1A 4CGTA 1OC6A 3OYZA 2YL5A 4XV0A 1K70A 4AZCB 3UXAA 3O06A 3W7HA 2QMJA 2AL2A 2RKXA 3EYPA 4EANA 1TV5A 2VHLA 4UTJA 2PWHA 3V5FA 5CSSA 1DWAM 5CG7A 3GE7A 2ZXBA 1ODZA 4YWSA 1YDOA 3I3BA 2WM1A 2IMRA 4IX0A 1V8EA 4PULA 4BF5A 3LHVA 1JPDX 4BQ4A 1AL7A 1VQTA 4J7RA 3HFYA 3QYSA 2QJNA 1THFD 5AHEA 3DERA 4JTDA 5IHRA 3LGDA 1UR9A 1OZQA 3NR0A 1XGEA 3H7UA 4WY0B 2A79A 1R86A 2DEPA 1WKEA 3M0XA 3IRSA 3EWBX 3ES8A 5GNYA 5ABTA 1TO3A 3WX7A 2FB3A 4GWEA 3W25A 4B4FA 4TO8A 1GVOA 4AISA 1HO4A 1XRTA 1JCMP 1A3WA 5HNTA 1VFMA 2ZUUA 4WX2A 2XUCA 1DWHM 1B3XA 1BVWA 1RA0A 4MNLA 3RK8A 1W1YA 4XO7A 3SZ8A 1J96A 4Q8UA 2Z6JA 4QEHA 4BEQA 1H7PA 3EMQA 3GNDA 4XG1A 4W8LA 2B7OA 3TAKA 5I24A 5AFDA 1D8CA 1EEPA 2H8ZA 5CPOA 1LORA 3DFSA 3MVTA 4FOKA 2WXDM 1H51A 4Q8PA 3DG3A 5H8MA 1W0MA 3OQEA 2YLAA 3OLGA 1K02A 3GRIA 1V79A 3W27A 5E0CA 1U30A 3BAKA 2WMFA 3MSGA 1I2QA 1Z42A 3N2BA 4GCXA 5CGMA 3MPGA 3TZNA 2XISA 5CZTA 1JIBA 1XLAA 2Q3RA 1M53A 1UKQA 3GHSA 2C1HA 2MNRA 2O7SA 4JTRA 1KFWA 2OG9A 3VNLA 3ZLFA 4AYGA 3WD3A 1P0NA 4R88A 5BRPA 3T07A 4QR6A 2EPLX 3C2YA 4U3CA 1Q4WA 1EKOA 2XH4A 3IPWA 3PAJA 4PMNA 1I6NA 4W85A 4HSNA 1G67A 2VOTA 3OVGA 5XIAA 3IAQA 1ME7A 3IGUA 3TV8A 3SGUA 3G2GA 1TPUA 2BY3A 3GTFA 1HXJA 3PPGA 3L66A 5D09A 1BFNA 2ZX6A 4MLJA 3GDMA 1KW1A 3CWOX 4WJ8A 3ABZA 4AD2A 2QEZA 1GVIA 1IZJA 2YW4A 1PTGA 3W86A 4E4FA 2OQYA 1W31A 4FP1A 5EKYA 4DJEA 5A6LA 3Q94A 3ZYZA 1TA3A 3W1AA 1EBHA 1UC4A 2AMGA 5BXTA 4IG2A 4DJDC 5GQBA 1BYDA 3B0UX 3UCQA 4MADA 3WK2A 1PJ9A 3M5ZA 1J79A 4GBDA 5B7ZA 1CIUA 4L1XA 3E96A 1L6SA 4HTBA 1SJDA 2PC4A 4NU7A 1KRMA 5HQEA 3KVMA 2HVNA 4GH3A 3QC0A 1AW5A 3OO2A 2YZ5A 3WD1A 3WQVA 4JD4A 3N6HA 4CNUA 1YXCA 3WSUA 2MUCA 1KM3A 3W37A 1XLHA 1JNDA 4G9PA 4RL3A 2YFOA 3XIMA 3UWZA 3H12A 2CHOA 1XXXA 3CV1A 4AD4A 5KETA 1V6VA 3PANA 3KDOA 5M17A 2PP1A 4D1IA 1UYQA 3RLHA 1JQXA 4GJIA 2RDWA 3VGEA 3W7IA 4GLEA 1LDCA 1R2SA 1TQJA 5JU6A 2BBFA 4YTSA 1DHKA 2QHAA 2WANA 3S42A 1TRDA 1W32A 2V2HA 3UJ2A 1GVFA 4O8RA 3LMYA 3PZOA 3SO7A 2V5BA 1W9PA 2CZVA 3WH7A 4TIMA 3PTMA 4O0QA 3SCVA 3U4FA 3K46A 4Y2WA 4QE4A 4M6VA 3FA4A 3T8QA 1OD0A 2WWCA 3CGTA 3CQ0A 5IFPA 1OQFA 1VLIA 4GOAA 1ZBKA 3UGVA 3ENLA 4MKSA 4DLMA 4JTIA 1A3HA 3GVQA 4DHGA 4P8UA 2W5FA 1E5NA 4LB4A 5C7HA 3LU2A 3DI0A 3FJLA 3RLUA 1YBQB 2A2IA 1PIFA 1PTAA 2PFHA 4ZO7A 3H24A 1K8ZA 2HWGA 3L0KA 1WZKA 2OJPA 3VKBA 1UROA 1VFHA 2V81A 3T40A 1D9EA 4MJ4A 3TFXA 2AOSA 4PB3A 5EYWA 2B0MA 1TX0A 3LHTA 5E5CA 3WLQA 2WC7A 3BQ6A 3B06A 3ZLGA 3MBDA 3UXKA 1TVNA 3PP7A 3B0VC 2ACUA 1YTKA 3MSRA 4PTWA 3C3NA 1UW9A 5T9BG 4JTLA 1HP4A 1EGVA 1TWIA 1MXDA 3W73A 5IHSA 1E4NA 4GMEA 5BRBA 3CUGA 1LG1A 2TYSA 2JKAA 3WFZA 4E8GA 1C8XA 4XAGA 4PMYA 5FL1A 3K8MA 4GNKB 4ENLA 2Q8LA 3OIXA 3ZR5A 3V4BA 3S5ZA 3WQEA 2HNHA 3FOKA 5EL1A 1MRQA 4RZ6A 3HJEA 3W23A 3PBVA 3AXMA 3N4EA 3I7RA 1OGBA 2JGQA 1E9IA 3C2VA 2FVMA 2WSKA 1Q13A 1Q6GA 3LNPA 3AYTA 4W86A 4XZHA 2XZ9A 2X7WA 1DV7A 4UBPC 1ZB5A 3R8GA 1DE5A 4N4QA 5CZSA 3ZJ7A 1CZ1A 1J2BA 1SQ7A 1VFFA 3BWWA 4LBUA 4WJEA 2EJAA 1V4YA 5A2AA 1DXFA 3EOUA 3CZJA 1V3HA 3CQKA 2PDKA 4JTAA 5J5RA 4M81A 3QBUA 4ORIA 3S1UA 5FSEC 1UUQA 3T6CA 4GI8A 3S1WA 1DOSA 4LUJA 3BAJA 4R9OA 1XW8A 3VKJA 5FCZA 1MUMA 1QNPA 1OGSA 2DUZA 4DYKA 1SPQA 4DO7A 1ADDA 2R1MA 2CXEA 5M3WA 4URIA 1UB3A 3GBDA 3S2NA 2NUWA 3DZ1A 2WVTA 1MW2A 4FXJA 1TMHA 1IEVA 4CD5A 4JQAA 1HFBA 1PPIA 3EA2A 4H9TA 4NKCA 5IFTA 2WMJA 5A6AA 4HYRA 2GK1A 1F61A 5I00A 2IW0A 4JIRA 2Y5SA 3PHAA 3W7JA 1EWEA 4P7RA 1UA7A 2XIIA 1IWBA 3UETA 3VINA 3UT0A 2FZDA 3H2FA 4AYSA 1AA1B 2EQDA 5LGXA 1EYWA 3IK4A 3VNJA 3TJIA 1KCXA 4TVCA 1AH3A 4I8DA 4N02A 3VMPA 1B9ZA 1ZCCA 3V75A 4GYPC 2D24A 1C9DA 5HWNA 3UCDA 4BHYA 2PPGA 1H7NA 3TVAA 4BQ5A 1A5KC 3U9IA 3AHXA 3MI3A 1N8IA 4D72A 2OWCA 5JXQA 4GVGA 4HQVA 3EWDA 2EGZA 1MVYA 3B9NA 2HISA 2G4FA 3A6OA 4WKHA 3WQDA 4AEEA 1DVJA 3NVDA 4UTWC 3OVPA 2PLCA 2YA0A 3KWSA 2EKGA 4RUBA 1GT8A 5ABGA 4BK9A 3GDBA 3CEPA 3MANA 5CC7A 2EF9A 3T2OA 2WVSA 2BASA 1PX8A 2Y8KA 1D7FA 1GOWA 1C8QA 5F2IA 5HDRA 3AIBA 3Q37A 4GI4A 1XP3A 1LZOA 3ABOA 1Q7MA 4I9AA 1P0EA 1BYCA 3PTKA 3SJ3A 3KW3A 4C6QA 1GVYA 1F4HA 2V3EA 3LTPA 4J4KA 5DLCA 5I77A 3GLCA 5ECVA 1RJQA 3H7RA 1XIMA 3CS2A 2XFYA 4I6VA 1JZ7A 1DWGM 1KGWA 3WDJA 2OWXA 3HGSA 2XN0A 3AU6A 2DZXA 4RW3A 3VGGA 2PWFA 1OX6A 2Q8XA 1TRIA 2ZXDA 3MUCA 3ERPA 3CAKA 4JQ2A 4WIWA 3FAXA 1J9YA 2E40A 3WUBA 3GIYA 3P8IA 5D2TA 2VCAA 3N3TA 1FH9A 2Q3OA 3EWZA 2ZZ6A 4NZCA 3LPOA 2YBTA 1A4LA 1U1JA 3GW3A 4DB7A 2PD5A 2HBXA 1BTMA 1G7VA 4Y9NA 2DP3A 3W7RA 3C0LA 3NZPA 4P7QA 5E6YA 1OT1A 2IKIA 4W8BA 2PA6A 2P8CA 4XD3A 2E6FA 5HMSA 3N19B 3AYRA 2NLYA 3CHDA 2DDXA 2H3BA 4F0RA 5CZJA 3GTNA 4N6FA 3UPMA 5E0FA 1SO3A 2OOGA 1W3NA 3SUSA 3TCEA 3A9BA 4UTIA 5G1MA 1JD7A 3K4DA 5FJJA 1V51A 2EKCA 2QPXA 3DHPA 1FCQA 2ZRWA 1YQ2A 1HKIA 3TH6A 4JHMA 2OWWA 1TZZA 3GC2A 2Z24A 3KBJA 4RDVA 1W1TA 3G1VA 3SIZA 2QLYA 1ISYA 3NSMA 4XKYB 3A3HA 4WHBA 5HPOA 4YWIA 3PZMA 4IMFA 4CKQA 5BU9A 4XZLX 3LCGA 4PMUA 4XKMA 6XIMA 1M65A 4O10A 2VEFA 3WO8A 1XFBA 5CC3A 1QPKA 3BLFA 1GVQA 1MQRA 2J6XA 5DCDA 4US5D 3CT2A 4DZHA 4PB5A 3PG9A 3CTLA 3QQ1A 4H9YA 1ZJHA 4GD0A 5EMYA 2PD9A 1J12A 4IPNB 2FZ9A 4HK6A 3F2CA 2HMCA 3I6TA 3OHMB 3RYSA 4QM1A 3USBA 1XGZA 3S5YA 2ZRZA 3W3OA 3EX4A 4MWAB 2YYUA 2YW3A 4H7CA 4QJ5B 4B3LA 3DYOA 1QI0A 2PF0A 3CUIA 4MWAE 4C7GA 1EF3A 1FWRA 1Q6QA 2EPNA 2GDUA 2EPKX 3E49A 3IGHX 3OGRA 2IKHA 3U5YA 2CLPA 5A8PA 1P7TA 1K03A 3TFCA 4D6CA 3TSMA 3EB4A 3LN3A 3BZJA 3H23A 4OZOA 3SY5A 2PWUA 3MTWA 3LERA 4GNVA 2G8ZA 5BOOA 4WCJA 3AMCA 2D2GA 3PZTA 3AIRA 4ICNA 1V77A 4RZ5A 1OZMA 5A2BA 4WQ6A 4ZFCA 1RJPA 4LVFA 5E6ZA 4LANA 4F2TA 1UQZA 1CNVA 1UR1A 1QFEA 1JXJA 1H4PA 5A1AA 3TQ0A 2BVYA 2G4JA 4NJIA 1PE1A 2XGZA 1RPXA 3LOTA 3W1UA 4AU0A 3SW6A 3FKKA 3PFMA 4QRNA 4FLOA 1WKDA 3T8LA 4FA3A 1T5AA 1H11A 2A0NA 3G1DA 2XM2A 3FEMA 5DANA 3QPYA 4AY1A 2GGHA 3KRZA 4IIBA 4GQBA 2ZXAA 4I5UA 3K1DA 5HNUA 4I9MA 1EZ2A 4FX8A 3UVIA 3L21A 5C70A 4JYDA 2DZWA 1YIXA 4L4MA 1QUMA 6PTDA 2JEQA 2V0TA 4CQAA 1CEOA 2BG5A 3UZWA 4IL2A 3W38A 2VP8A 1B5TA 2W4XA 1GG0A 2NUYA 2WHKA 1Q6OA 4M6QA 3KVJA 4ACZA 4AHPA 5HQMA 3CLWA 4MNMA 2PCQA 4JNYA 4NT0A 3B97A 4I5XA 4JFSA 1B30A 3QFEA 4CNTA 3WF1A 3IRDA 1EBGA 3ARXA 4U5KA 3V7PA 3ONBA 4IQLA 1B3OA 2RHGA 4AVNA 1ONWA 3H2EA 4X3ZA 1W9DM 4ZR8A 4ZQNA 1ECEA 2E6DA 3BL3A 3N6QA 4KFNA 4WGXA 3WIJA 1CLXA 4JY8A 1LTDA 3P3BA 3AC0A 4ZA0A 1CXIA 1CPUA 1LF1A 3M6YA 2WJFA 1E4LA 4AEOA 1VFTA 3ZFHA 1XDLA 3UQNA 5LZLA 1UZ4A 1QASA 1KM5A 3ZJKA 4H8NA 5IXEA 1XINA 3NQFA 3H2CA 1KRAC 2PURA 2G95A 3L0GA 5TAOA 2OQLA 1S2CA 1O5QA 1H5YA 3DGBA 3VKAA 4MY9A 1U33A 2ZTKA 3PBGA 3H55A 4GI6A 4O19A 2PWGA 3F5KA 1GOQA 2J4GA 3R12A 3IANA 1FUYA 4V1XA 1I45A 4B5SA 5IBXA 1GONA 4MVAA 4J3TA 2HROA 3NQGA 3LQGA 3ITLA 1Q63A 2VVSA 3KE0A 2CLOA 2WMKA 5E70A 1CTNA 4RE0A 2GVJA 4OWGA 3CH9A 1LQ2A 2INEA 3VDHA 3LRLA 3VZYA 3NTYA 4C6JA 2DW6A 3GNNA 5AHIA 5EB8A 4J3XA 4EXAA 4BI6A 3ITXA 4FNQA 1TJRA 1UD5A 2O7QA 2WVVA 3OZPA 1LLOA 4MSSA 3ANYA 2CKRA 4Q4MA 4CNPA 3BCDA 4J5NA 3GWQA 5C71A 4GXMA 5G2WA 1XLMA 4E38A 3G1AA 1VEMA 3PVFA 3WJYA 4PSRA 4IUOA 4K2SA 5EFFA 3LA4A 4HJWA 5DY2A 1X96A 5M2FX 4N6EA 2VRQA 5G1TA 5D2YA 2D1ZA 4UXDA 4XZWA 3TU9A 4M6UA 7REQB 3UBPC 4RXGA 3URBA 1GNXA 3OLDA 4DJFA 4Z2HA 2YL6A 5M1TA 3T4WA 1E6XM 2PTWA 4KGLA 3B4YA 1UH4A 1YYAA 3CL6A 1OYCA 4MB5A 4J3WA 1TPC1 3NZRA 5TD4A 2IPGA 3BMXA 1OADA 4PB4A 1KA9F 2VX7A 2HS6A 3KFTA 2PU1A 1Q6DA 4X0VA 1GEHA 1XDJA 3ZT6A 4D1JA 3WLSA 4UTHA 5TQLA 3GR4A 4D8LA 3HF3A 1I60A 4HU3A 3NQ2A 3UJFA 1HQTA 1RLCL 3BCJA 5HNRA 4K3ZA 2WAGA 2DVUA 2OX4A 1B4KA 3O9NA 5DT7A 2ZC8A 4PBEA 3E5PA 2VRJA 2A7RA 1KGUA 3WMBA 2J7GA 4ZQMA 1ISZA 4JS3A 4C5YA 3CV6A 2VWTA 2O9TA 2G0WA 2FGBA 1D3GA 1JUEA 4NNBA 2FTYA 3M44A 3IIXA 4ROQA 1MXSA 1BYBA 4RV8A 2Y88A 3O05A 2VD9A 4Y6GA 1IWPA 3WFAA 2O0TA 3RO6A 2UY2A 2O9PA 2X05A 1T99A 3TAOA 3KOFA 3AHVA 4F0KA 1VJIA 3VFLA 1AVAA 1G69A 1VF8A 4Q4SA 1XGDA 2FHCA 4LUTA 4O17A 2FDMA 3F03K 1BTCA 4B15A 3RX4A 1QW9A 2YL9A 3M0HA 3PUGA 4DJEC 1G4SA 4Z08A 5D03A 2XH2A 1AW2A 2A3HA 2PSNA 3NM3A 1U22A 5CGQA 4POCA 3UNTA 4LBRA 1MEIA 3W72A 3VIIA 3EDDA 1WXJA 1AH0A 1VBJA 4H2CA 4G7EB 1OX4A 4GX9A 2WJDA 3EXTA 2DIKA 3A4AA 3L9CA 4YS1A 3SURA 4R3UA 1E5JA 3E0FA 4O50A 3B8DA 3Q45A 2ZX8A 1HL2A 1W3KA 3A21A 3P0XA 4QCFA 2GZXA 3KZPA 4DNHA 1ME9A 1QTWA 3FS2A 1WUEA 4LV9A 2QF8A 2QZRA 3B4UA 4FSAA 1A49A 2WCSA 4V2XA 4Q8TA 4PCPA 5I06A 2GUUA 2QJGA 4WR3A 3QW3A 2VCBA 2G3JA 1UWSA 6TIMA 1KM4A 1CI1A 2VGFA 4C6LA 1SR0A 4JTHA 2WZMA 2BTMA 3WQCA 3MCOA 4MWAD 3H70A 3VGBA 1XLJA 2VDGA 2Q01A 1TV7A 1A0DA 1FWIC 3GX9A 4XVEA 4HTYA 2REQB 4PMQA 4KEVA 4JOMA 3TW6A 4O52A 5A6BA 2DVTA 4QITA 4ES4A 3WH8A 4KW2A 3TJXA 5F1UA 3RM9A 5TBOA 3IUIA 5C55A 2OSWA 3DFQA 3ZLHA 1A3XA 2P3ZA 4JFWA 1K8XA 2YR1A 1PX4A 3H22A 1HTIA 4LYRA 5C2CA 3UG8A 4UR8A 1QOPA 4QDMA 1KCZA 4H9MA 1WE5A 3T05A 3DN5A 2RAGA 4A35A 3BG9A 1F4AA 1CLKA 4NXSA 2XG9A 1UQYA 1RK5A 3SCRA 3S2JA 1JYNA 3SGGA 2ZX9A 2CBJA 3HPFA 3RM4A 3G5EA 2Z29A 3R11A 4N42A 2ZZ4A 2DSUA 2B7PA 4A8RA 3MMTA 3PB2A 3RDKA 4J27A 1AQ0A 5LA0A 1VBGA 3VD9A 1K6WA 1GGOA 1XLEA 1UD3A 2WCGA 1RD5A 4UFJA 2PDCA 3W82A 1ZPTA 1A5NC 2IPFA 1YPIA 1DJIA 2A3EA 1DP0A 2R82A 4F0SA 5D37A 3V0UA 2NLIA 1W8GA 3F1QA 3AHYA 3NQMA 3VKDA 2FHBA 2PLMA 3G8EA 4NNAA 2DU2A 1XWYA 2ABBA 1F07A 3BGJA 3TA6A 1WDQA 2PTYA 2R24A 3I7SA 1G01A 2E5BA 3W7LA 4N9CA 3GC4A 4RKAA 2GOUA 1AL8A 4O4WA 2GDVA 3PZQA 3W1MA 2CWNA 4LEQA 4JYFA 4ML4A 4HNUA 8XIMA 5M03A 4EP8C 5D05A 1EB3A 5LNUA 1Q6EA 3QGVA 3RLVA 3HG5A 1WQ5A 3RPDA 4CQBA 4XAPA 3EOOA 4S3FA 4UNIA 4LXFA 3VX0A 3LY0A 3C2EA 1VH7A 3I3DA 2JKEA 3A22A 3B04A 1BQGA 5ABFA 3GG8A 2ZVIA 1ME8A 3LX9A 4IMAA 2HBVA 4G6CA 3MJYA 4GG9A 3H53A 4OTKA 1DTUA 2YDRA 3W26A 1PV8A 3DC0A 3KUMA 2QVHA 2IKJA 3G6MA 2HXUA 1JPMA 2F8QA 1RALA 2OZTA 4TMCA 3AYSA 3QXBA 4F79A 4FHAA 3H2MA 3LHYA 4U4MA 3VE7A 2PEVA 4NF7A 1PKNA 4TV6A 5A6JA 2WC4A 1P6WA 3QH2A 5LYRA 3GW0A 2V8ZA 1PXGA 3KL5A 3U4AA 1BGGA 3BOLA 3NDYA 1CT5A 2XIBA 1XJBA 2Z0IA 1PYMA 1FWGC 3HG2A 4GJ1A 2WKJA 4HSHA 3PG8A 4NZJA 4Z0SA 2ISSA 3CC1A 1C3FA 2CESA 1OSEA 2W67A 2I5QA 2Y7EA 3UG4A 5A5WA 5I3KA 4RV3A 5I5RA 3WBEA 3R94A 1XSIA 4JIQA 1GUVA 4IQJA 3E02A 3I4EA 2VWSA 2J13A 2JE8A 4NX5A 3WD4A 1XH1A 4AZIA 1EF2A 2Y63A 2DZUA 3PSWA 1O7AA 5FJTA 4Y96A 4FNUA 2GVYA 3LLXA 1O94A 1EQPA 2I9EA 3H7VA 2Z1VA 3ZVHB 4GUJA 4Y8FA 4LUSA 5JIWA 3HURA 1T8QA 1S5MA 4UWMA 2BZNA 3DFTA 3CHCA 3STCA 4PUKA 3UZJA 3S1VA 4KWSA 2ZBTA 2XH7A 2FDSA 5T9CE 1C93A 3W1TA 2G3MA 1MZRA 1V6YA 1HG3A 4CQCA 5B7YA 5BMWA 4MFEA 1CDGA 4JTJA 4NAFB 2GQ8A 1VENA 3N9KA 3NFUA 3VGDA 1GKQA 5JBFA 4JTSA 4U33A 4XZBA 4K68A 3TMQA 1WAWA 3NO1A 3CMGA 1W9BM 2VURA 5DF0A 3G1RA 4Y9AA 1FWFC 1I0DA 1UD6A 4DF0A 3GD6A 5EA9A 3UCCA 1OFOA 1KLZA 3BSGA 5DRIA 5REQB 1DXIA 1A5MC 1XPYA 1JYWA 4TTGA 2SFPA 3PC0A 2QCFA 4FLRA 2Z28A 1UZDA 5D4YA 1QNQA 3M0IA 2GQ9A 2GSEA 3LTYA 4JQ1A 2VM8A 2CLHA 3I68A 1TTQA 1S2TA 3PZIA 3VDGA 2FJUB 4YTTA 4IMEA 2FVLA 3VOIA 2G3FA 3BV4A 5AC4A 3FJ6A 1KCLA 2A3CA 1FA2A 1UPMB 1W3IA 2E9MA 1F8MA 4KH2A 3VGHA 3ZMRA 4RXFA 4WLCA 4LNCA 1GYLA 3PF3A 2OGJA 4G8TA 2PDWA 1PIGA 3VOJA 2D2HA 3WJSA 3RGTA 5EMKA 3GK0A 4GZJA 1HT6A 4PH6A 3SM0A 3DFOA 3SCTA 5AYBA 5XIMA 1LT7A 4LAZA 3I6RA 4JGDA 4PBGA 4IUGA 4NJJA 5CPSA 3UWQA 1V0MA 5BU6A 4AXKA 1KBLA 5T8GA 1E0XA 2F6KA 3RJXA 3RCYA 1F7BA 2JIEA 4W7WA 4Q4KA 2Z7KA 3VIOA 3WN6A 5LIYX 3QM3A 1K7XA 1WA3A 1TIMA 4FAMA 1FFQA 3M0LA 4OBSA 2BS9A 4AZBA 4FEZA 2BY1A 3E2SA 5CQ1A 4ERIA 1Z44A 4DPQA 1OFRA 1HL8A 3M64A 2Y4SA 4HK5A 4WUIA 2RJGA 1OT2A 2B4GA 1GJPA 5FAGA 1ZENA 1SJCA 5EU9A 2XGIA 3KP1A 4IIHA 2E28A 1WV2A 5FESA 5HMFA 1KWGA 2WQPA 4QAIA 3LD5A 5LHFA 4MNJA 2RJHA 4IJCA 4KF1A 5XINA 5A6MA 4WRHA 4N4PA 2QMKA 1RUSA 3VI2A 5JH1A 3EOLA 4AVOA 3EXRA 1VPXA 4AXNA 1TVPA 2AAMA 4HNVA 1YNPA 2ZTJA 2NXHA 3CJPA 3UD6A 3EDJA 1YDVA 3M5VA 4WXYA 2W3ZA 1W3HA 3ABXA 2BGQA 3KAOA 3MI6A 1GPWA 4A3QA 5BROA 3S9ZA 3NL6A 4GO9A 3KTXA 1WZLA 3V5CA 1P6BA 2HXTA 3PB0A 3NXFA 4WVXA 2WSQA 4AX6A 1B3ZA 4JIIX 4L1WA 3VPLA 1G0CA 4CN6A 1VB9A 1VKFA 4X9SA 3O2LA 2GGGA 1VS1A 2QQ6A 4NZ5A 1M9HA 4GIEA 3SADA 3CHFA 1QHPA 3TOPA 3KS5A 1J10A 1UMYA 3N13A 5HQLA 4E4UA 1E9YB 1ADSA 3WLJA 3LXCA 2PGWA 2ZE3A 2FZNA 4JHZA 3S5NA 4JKLA 4ADUA 3L0NA 1TE1A 3MYOA 4E6MA 1UWTA 1W2PA 2Y5EA 3WLIA 3RO8A 4OBTA 3PPFA 1JCLA 4IFKA 4HNCA 1UMLA 2PZNA 5FIPA 2OVLA 2UY5A 1P0DA 2H9AB 3T4CA 4H2HA 4N9BA 5CSUA 3QW4B 3VNYA 1KLYA 3PWAA 1OVDA 5D04C 3P0WA 1L8PA 3OVRA 4JKKA 4W9TA 4HA1A 2D3LA 1OC7A 3S0CA 4F40A 1QXLA 4HNLA 4N7QA 1TQXA 3L2LA 3WQ5A 4DPPA 4DBWA 1G1YA 3O15A 4LX4A 4FIQA 1C91A 4GY7A 2PUZA 1KBJA 1ZALA 2PP0A 3AJ7A 3M7WA 1XYMA 2CLEA 1EUNA 1GW1A 4W4QA 1FWBC 1H60A 2GJXA 4W87A 3TYCA 2PRLA 4E2BA 1P48A 5FJPA 5K7JA 1QOXA 3LSBA 1FRBA 3CAWA 6TAAA 2PDFA 3K4AA 4FK9A 5CC6A 2E7FA 1WDPA 3SN0A 1Z9AA 1R2TA 2B7QA 1X1NA 3LXBA 2I9UA 4JTCA 3B8WA 3W7MA 4AVFA 1UWRA 4LC8A 1KFLA 4QTGA 4XZIA 2DIJA 4IFOA 3R8RA 4V15A 2VFGA 3N12A 4WSKA 4H9XA 4B4HA 3IVTA 4AIUA 2EBNA 4H7VA 3OJGA 3GVGA 3WJWA 3FLUA 1S1RA 2AQWA 1VD6A 1DQUA 4JXCA 5I3IA 1JEZA 1ZJBA 3PBWA 3SN1A 1LUCB 3M9YA 4OKDA 3MUY1 2GJLA 4U31A 3W70A 5K4XA 2X16A 1E0WA 4LCRA 4BY3A 1FHVA 1XDMA 1W37A 3O7UA 2PCEA 3HOJA 4GGBA 5C9UA 1FWHC 1S5VA 5H2ZA 3MKCA 1J0IA 1EJWC 2PAJA 2PS2A 3MKKA 2G96A 3WELA 3NPWA 4IH3A 3SCSA 4BEUA 4O12A 2ZRYA 3F4CA 2J8FA 3BLIA 1DEDA 3GXIA 4Q4OA 4AHQA 2VDIA 2ZKMX 3UG3A 4NIRA 3NQ8A 1EC7A 3FYYA 3ATZA 3FXYA 3BAXA 3WBXA 1C8VA 1W5OA 4LU0A 3FN9A 1X38A 1P0BA 1JDAA 1W2VA 4TX9A 5G4WA 5D8ZA 1ZAIA 4DYEA 4N9EA 4PMZA 2GPTA 4M56A 2F38A 1BHGA 1XISA 4NJGA 4DXKA 1T96A 2YCLA 2WLZA 3ZSTA 2HNEA 4L7ZA 1JAEA 2YJQA 3PK7A 1DHPA 3GR7A 4FLQA 4K7VA 5DBTA 2EPOA 1A5AA 4QIUA 4WOQA 4IF2A 4Q4QA 4H9ZA 1J18A 3DH7A 3ORWA 5D2VA 2XINA 3S1XA 3F4DA 5CPMA 3W0KA 3GIPA 1US0A 4KWUA 1HVXA 1U2YA 1CBGA 1EO7A 4MY1A 3OYXA 1RQHA 3WQOA 5L6UA 3R13A 1SSGA 4HA0A 4TXEA 2Q71A 3GYEA 2RDTA 3NYZA 5BWAA 2WPBA 1RV8A 3W2KA 1RP9A 4DBSA 4MWAC 3F5LA 5FF2A 1WUFA 3AROA 5F4WA 1XSJA 4YHGA 3LPFA 4R7WA 4M80A 3EGJA 4PCNA 5BWFA 2EAWA 3VNMA 4AHOA 4HBKA 3B8VA 3GXMA 4UNKA 1QNSA 1W91A 1XIIA 3GU2A 2HJPA 4WY0F 3AXKA 3WLPA 4UR7A 5DCEA 1SZGA 4PUUA 3G3DA 4XWUA 2WQDA 1JD9A 4HPNA 2FTPA 4PTDA 1M7JA 4KCVA 4UTTA 1AJZA 4FNRA 3A64A 5JBDA 3PJWA 1ZP4A 3P82A 3DG7A 1OB0A 3ABSA 2TRSA 3MDUA 2PDQA 4YYFA 3QFWA 4M3PA 2BODX 2WZTA 5I3DA 3QJAA 4J40A 4CD7A 3OU8A 4NZ3A 1R87A 4NZ4A 4BI5A 4ACYA 3OB8A 5BXRA 2NSOA 1YPXA 3HN3A 4YCPA 4GVHA 5C9ZA 3E74A 1C8YA 4A8NA 4Q8NA 4KESA 3TC6A 3U6WA 3VMOA 4DJDD 3E0WA 4WD0A 3C2OA 2ZCGA 3SIMA 1OG0A 4HPXA 1V3IA 4QAWA 2V3GA 2A85A 2QJIA 2VGIA 3AO0A 4ICMA 2YXGA 4R85A 2XWEA 4TVDA 2OPJA 5AHFA 4CNOA 1XCFA 3MVIA 4V27A 1F3XA 1FWSA 1PDYA 1K9DA 3TR2A 1S46A 4EX4A 4K39A 2HVMA 1NIUA 3N4FA 1QI3A 4OV9A 3L5AA 4X2RA 1SO5A 2IUZA 3KS6A 2PODA 3AYVA 5A8MA 3C8FA 4MFDA 1PKLA 4MAZA 2D0FA 4FOJA 4RZ4A 2XM1A 3AOFA 3UWUA 3W7GA 4GC4A 3A23A 3S1GA 3PBUA 2IQTA 2VEMA 2EPMX 3LCXA 1QO5A 2C71A 1GOXA 1E1CA 2KX9A 4Q4RA 2VL4A 1HP5A 1TTPA 2D0HA 3N2TA 2O9OA 3K2GA 1T40A 2JIWA 4J1OA 4GQRA 1NQKA 4O1CA 1W6TA 1HJUA 4UFHA 2VQTA 5A8QA 3DKJA 4UQ9A 2X0SA 3RILA 1NDYA 4LPCA 3RG6A 3VDBA 8XIAA 2CLLA 3APYA 1OCBA 2PBGA 3T08A 1FHLA 4RNJA 1OBAA 1ZAHA 1POKA 3URAA 4XBSA 5FF3A 1TFVA 3DI1A 4U2ZA 2XN2A 4CCEA 2AGTA 4Z2IA 2CW6A 4ZXOA 3M6DA 3BMVA 1EPVA 4RZBA 3URNA 3DXIA 3DFNA 3HGRA 1R9YA 1H5VA 1A5BA 5L9FA 5D30A 4YTQA 3DIPA 2YB1A 1BWKA 1OHLA 4GABA 1GQKA 4DY1A 6ALDA 4R34A 4PUEA 1R3TA 3TYDA 1RCQA 2J7FA 2KAUC 2X40A 5D9OA 3NGJA 4IMGA 1UUMA 1EC8A 1LRNA 3V5OA 5C8BB 3GTXA 2XPKA 1UC5A 1O5XA 2DT0A 3QV6A 5HK4A 2NSXA 4PL1A 1HN1A 1BG9A 4L9YA 3O63A 4YJ5A 3WJZA 1EEXA 4PEEA 2XVNA 3D3FA 1XUUA 2XSAA 3N04A 1L2UA 3TXZA 3LGEA 1JDFA 1H2JA 3WH6A 5HUOA 1M68A 3A3XA 2E9LA 3C0JA 1K3UA 3SFKA 4HT3A 4IGNA 3IJ8A 5LIWX 3NZ1A 1ITXA 1C7TA 3LS9A 4DM1A 4EF9A 1OIMA 1WB0A 1H09A 3SUWA 3OA3A 1XH2A 2D2OA 3RU8X 4DYJA 2QW5A 1TPH1 4IP4A 3SQSA 4GIYA 5CPTA 2WNNA 3D47A 1XIHA 3CIWA 1MNZA 4EAYA 5F7UA 2DUAA 2O4QA 2PRHA 3W01A 3A47A 2A4AA 3QPEA 3TNOA 1P6CA 4QEEA 4I9JA 1Y7VA 5CH9A 1RQEA 4C6PA 1NY1A 3B9DA 4M0XA 3TJ4A 2OQHA 2IPJA 2AL2B 1WZAA 1MDLA 3WNKA 4MF4A 1NJJA 3ITOA 3CB8A 4I8YA 4ZE4A 4HZMA 1F3TA 4IIGA 2A1YA 4Q8OA 2YDQA 3EBVA 1R7OA 4PEKA 1CXHA 3LEPA 4HN4A 2BY2A 1K8CA 1OEPA 2FMOA 1YE6A 2DW7A 4HYWA 4YMZA 5I6SA 2G50A 4CEXC 1AD4A 3BG3A 1PZ3A 1XLFA 1N7KA 4DUWA 1XLGA 1O66A 4QCEA 2E3ZA 1SFSA 4JHOA 1NOUA 2CXGA 3LG3A 2YSWA 3XINA 3VO0A 2YGYA 1FCUA 2W9MA 2NQZA 4S3DA 2QUTA 1KFJA 2E8ZA 4CD8A 4BS0A 1AFSA 4A8IA 3UU0A 1HJSA 5FKYA 5AYZA 1BG4A 4NAEA 1F05A 3EDEA 2NX3A 4Z1AA 4O53A 3N17A 1GQNA 1TE6A 1CWYA 4AMAA 4HD5A 4AB4A 3LB0A 1BAGA 4AY7A 2IPWA 5IM51 4XUGA 3WDRA 5G5IA 4MB4A 5CKSA 4JQ4A 3AIVA 4JNMA 1H3GA 1HL9A 1JCYA 3LENA 2G5WA 2Y8UA 4AC1X 3QMRA 2OYLA 4F0HA 4L65A 1G9HA 3GBEA 5D9NA 1IXQA 3SUVA 3W7QA 4DAFA 4U28A 4ZFMA 1PYFA 3MQTA 2FFIA 4FXFA 1TVLA 2X7VA 2W27A 1VJZA 3NQVA 1OCJA 3VU2A 1FVPA 4TVUA 3BW2A 1RPKA 4OECA 1Y65A 3PY2A 1EJVC 3QZAA 3WDQA 4ORMA 4Z1CA 1E70M 5I3FA 5I3GA 1JDDA 2J78A 5PTDA 5T91A 1RAKA 1VYSX 3SI9A 3AFBA 3H26A 1E9LA 5MHBA 4L4PA 1JR1A 5HATA 2XN1A 1QOQA 4XAYA 2J25A 2ZE0A 2QF7A 1MEHA 4MKVA 4LEFA 1PBGA 3F7JA 1E3XA 2YLLA 1YNQA 5EMMA 4K8EA 4D6FA 2F7FA 4UB9A 5HMEA 3DHDA 3I6EA 4EPKA 2DZAA 4FF7A 1W9VA 2E8YA 2D2JA 3ARVA 2FH6A 4F66A 3IIPA 3PNZA 2WB5A 3B40A 3C6CA 4QP0A 4XTDA 4AWEA 1F8IA 5FL0A 3MP4A 1W3LA 4S23A 4OVXA 3BVJA 3STFA 1CGYA 2D22A 1SFTA 5FJOA 3MSDA 1GW9A 3OZYA 4GC3A 3AHTA 1P4CA 1UR3M 4ADTA 4D9PA 3CM4A 1EDQA 2ZUMA 2XVPA 3AZTA 1TUXA 4F0LA 1X7FA 2EXOA 3W7NA 1KBKA 1TA3B 4ATLA 2Y2WA 4H6RA 1N8WA 1LOQA 4AF0A 3GTIA 4A22A 1CGWA 1FDYA 4B2DA 3SRFA 3LMZA 1Q8AA 2J88A 4IG2B 2B31A 4HHHA 5GJPA 1EP1A 4XB3A 1PTDA 5BNKA 5F2GA 3PNUA 4UOQA 1T41A 3WK3A 4FO4A 4BF9A 1ZP3A 3BV7A 4XSMA 2C91A 1N2VA 3CTTA 1LWIA 2CZFA 2MANA 3PSVA 3FDKA 1XLLA 3NJ3A 2HSAA 3VILA 1EDTA 1JL8A 3OHIA 4EOUA 8TIMA 4MJMA 4RNHA 3QLLA 4J3VA 4XZMX 1BWVA 4HCHA 2A5HA 4IMDA 1UZ1A 1RY0A 3MBFA 5EPDA 1YADA 2OX1A 3GXDA 3UY7A 1FDZA 1EOKA 3MZ2A 1TJ2A 4ICCX 4MKNA 3HBLA 3ZT7A 5A95A 3THQA 3HGOA 2F2KA 4PUDA 4EWJA 4BWLC 3AXIA 2HZGA 1L6YA 5LXEA 2QCLA 1FWWA 4A3HA 4I5RA 1PDZA 2BFGA 1I2PA 2DZTA 2P10A 4CN1A 3CQJA 1VAHA 3G3MA 4QG6A 1EX1A 4B5WA 4HKPA 2D3NA 2CPUA 4CCZA 2YDSA 4X22A 5MF5A 2ISVA 3MHFA 3T78A 3M41A 3RAOA 1JZ4A 1FDJA 3RR1A 3ZJ8A 3RPMA 3WDPP 1VBUA 4TV5A 4ML9A 3FHAA 3HB9A 3T0CA 1JRBA 1V6WA 4TX6A 3ISIX 4ONVA 1RCXB 3WQWA 4KMQA 3POCA 2PB1A 3CMJA 4C6CA 1TKKA 2X1TA 3R25A 1QI5A 4PMDA 1GTHA 3UWEA 1MUCA 4DUVA 3HQPA 1CXLA 5FJIA 1X6LA 2UV8G 1P0KA 1AD1A 4XBJA 5FEPA 2VUYA 1H41A 3R2GA 3A5VA 2HV5A 3CV7A 3VDCA 4DZ5A 2UBPC 2F84A 2UY4A 3UR8A 1EXPA 2OKOA 4J35A 4PUWA 4E5TA 2V63A 4C7DA 2DV0A 3OBKA 2DT1A 4DZAA 2FKPA 2QXWA 3WEZA 3CZ8A 4W84A 1NARA 2ESCA 4QE5A 5FI8A 4UC5A 2J77A 1NF7A 1TIWA 1ZSXA 2CZEA 1XQKA 2F9RA 4UTKA 3BXWA 3VOHA 1FP8A 3NO5A 3W83A 3STEA 3W6LA 1B1YA 2ISDA 4BJHA 2POZA 1PVNA 1ZGDA 3P60A 5CPQA 3K8KA 3ES7A 3GHRA 4F3HA 4I90A 3MJMA 1Z41A 2DT3A 4MLRA 3TP4A 1OABA 3FKRA 4HYVA 2QCHA 3WNPA 1XM3A 5I2UA 4C60A 2FVKA 1E56A 4HHLA 4XZNX 5A8NA 1VCFA 4HZ7A 1EA9C 4CU7A 3MB9A 4XUYA 2VNCA 2WZHA 2Y7FA 1JFHA 2WSPA 3D5HA 1JDCA 4PN2A 3C3UA 2VZVA 2J7DA 5DXXA 5HNNA 1NH6A 4UMCA 2WW5A 1JNEA 1FWTA 3UERA 4A8LA 1GYMA 3CPRA 4UUIA 1UR8A 4X63A 4F9JA 2J62A 5AVNA 3V16A 1B3VA 3WUFA 4GBUA 4GNJA 5H1WA 4TTUA 3SJNA 4AD1A 4DBDA 5AC5A 3DCPA 1HJWA 4UZUA 2VTFA 2CETA 1FXQA 2QUMA 1JDEA 2GK1B 5HJXA 4FIRA 1B4EA 1S5WA 5LNSA 2BSLA 3QTPA 4PMVA 4NYYA 3APGA 2BMBA 2GQAA 2VC5A 1TCDA 2Y1HA 4JN7A 4IP7A 1WDDA 4C7FA 1TYGA 2ISWA 1O1ZA 3LDVA 1RSCA 3FFSA 4C91A 3FYPA 4IPLA 2NXIA 2E67A 4K36A 4LRSA 1WZMA 1P1XA 4ZL1A 3E12A 5BCAA 1DJWA 3SY1A 3FW6A 3H6OA 3DECA 2CLIA 2W63A 4ZCWA 5GJMA 3SCNA 4FNTA 1H7XA 3H4XA 1V3JA 3LLDA 4XD6A 2P88A 1ZJAA 3ZOAA 4IXHA 4S3GA 3UY8A 2WVUA 2XIOA 3PPCA 3G1HA 1WOAA 1W5NA 3N11A 4I7WA 3MI2A 3KCJA 5G4HC 2KZHA 3NSNA 3O3RA 3WLOA 3T0TA 1UJQA 3H54A 1KFBA 1MZHA 3MC5A 2ADAA 1ZBWA 5FJRA 2O55A 2PTZA 1C92A 3VOGA 1IGWA 2HTMA 2FPVA 5EY5A 1ALDA 2YCJA 5ECUA 5EMJA 1Z6KA 3MSYA 5HUPA 2ALDA 4AC7C 2CZDA 4YHEA 5EMLA 3HPXA 1H7WA 4QJ4B 1KXHA 3NL3A 1JPHA 3LM7A 3WBYA 2VD8A 6ENLA 1SYTA 3S2CA 4GFIA 1QI2A 3TWBA 4GJJA 1I4NA 3FSUA 1FH8A 1VCGA 3NURA 4GINA 3VIHA 5HWJA 3WQPA 3ZO9A 7TIMA 4K6AA 3PWGA 1WBJA 1LOSA 2BNJA 4L4LA 3KHDA 5T26A 4BZYA 4GXWA 3EX2A 3GDRA 4Z0JA 2A7PA 4E8CA 2CKSA 2HK1A 2DZSA 4Z17A 1Y0EA 5H6HA 1A47A 4CEUC 1XYCA 1JF6A 5DX7A 3JVAA 1RBLA 3LHWA 1I8JA 1LQ0A 4RW5A 3VIJA 3TN6A 5C6MA 1V0LA 1LL6A 3R79A 3V0SA 2WNQA 4J28A 3KOXA 3C2FA 3L23A 1KCKA 2GYIA 2XVKA 4LAKA 4Q3MA 1ZZMA 5GJNA 2GQ3A 2RH9A 3ANUA 2ZADA 3GVVA 4LYPA 2DSZA 3U7BA 2I5GA 3PAOA 1AZ2A 4IGSA 2HRWA 3ALGA 4LAOA 3R6IA 4AZGA 3Q58A 1Q7QA 1Y5XA 2NT0A 3VUPA 1W5QA 4PCTA 3UZXA 3LYEA 3REQA 4J2PA 4RPPA 4M29A 3GDTA 3IJ7A 4DJED 4C6NA 3CL7A 5FF4A 2D0GA 3FY1A 3CWHA 1EZWA 2AGKA 4B5XA 3C0SA 5U4NA 4KCUA 4ADSA 4YTRA 3S9IA 3FX4A 2BV9A 3ALFA 4F8XA 5CPLA 4DNMA 1US3A 3MP5A 3EEGA 3BAWA 3NL2A 1OFQA 2I17A 4KRZA 3T0BA 5J5DA 1D3HA 1M1BA 3O07A 1LQAA 2OODA 3TYBA 3IJ9A 4K1GA 2GOKA 4QHRA 3AZRA 2QDEA 5KINA 2FTWA 3TK7A 1N8FA 5AZ0A 3THCA 3SUUA 2FPYA 1PEZA 1K9EA 1PHQA 3NOEA 1K1DA 4XAZA 3AMLA 1KGXA 2OOFA 3V35A 3FIGA 1PWMA 3W29A 4FX6M 5H91A 3OPSA 3BPWA 3UA4A 2D73A 4MM1A 2QCDA 4Q4PA 2Q8ZA 3O16A 4UFMA 3O6YX 2RGMA 1T6MA 1SO6A 4LT9A 3VOCA 1O68A 1P7TB 4LUYA 1JAKA 3R89A 1FP9A 4DI8A 2NV1A 5GNXA 4PZVA 1UKSA 3TN5A 3NDZA 4LYQA 4JN8A 1E40A 1V3MA 5CJMA 3NWRA 5TF0A 1CX9A 1F6YA 4PCSA 1Q2SA 3EZ4A 1OC5A 1C9WA 1FCVA 5BOEA 1XG4A 1A4MA 2PDPA 1QATA 2V30A 3UR2A 4XVDA 3VX1A 1SMAA 1ITQA 1U1UA 4AZ6A 1QT1A 4IP5A 3BK0A 1QNRA 5FSDC 1D7KA 1DIKA 3UXLA 6CGTA 3WNMA 2Z00A 1REQA 4UTLA 1BWLA 3CHEA 2DFAA 5I02A 2AMXA 3H2OA 1KR1A 2VDHA 4HU4A 3T1GA 3E2RA 3EWXA 4PE8A 3IS4A 2VX5A 2NV9A 3V0TA 2ZIDA 2HEJA 1S5NA 1EJSC 5BXPA 1Q6RA 2OGYA 2R1NA 1ADOA 3TSBA 3DC8A 3E9AA 4Q22A 1EJ7L 4Q7BA 5C9WA 1IV8A 4HOWA 1VIZA 4LUIA 4UQCA 4ACZB 1J8VA 2YX0A 1FWJC 4S3CA 4EK7A 1DWFM 2QUNA 4W5ZA 1XKYA 3HQOA 3STPA 1NWUA 3GUGA 2JALA 3QTGA 1OX5A 1J0HA 2ZDRA 3B8IA 3LNMA 1KB3A 4IJRA 4HIBA 2G41A 3GH4A 2ZA3A 3FA5A 2XWDA 1YNYA 2VFDA 4CU6A 1OFAA 4IPJA 3OTRA 3U3HA 3GNXA 4NZFA 2CLFA 4HCLA 1KV8A 2Z2UA 5KZMA 4RPQA 3DENA 1ZLPA 2WKLA 3RU6A 3DFPA 1OINA 4NNCA 2FQIA 4Y9PA 4OQVA 4J3UA 2WPGA 1S39A 1F6KA 4HHMA 4LYKA 1W8SA 4WSJA 5C54A 1TV4A 1UP3A 2C6QA 3NEVA 3IWPA 4QNWA 2Z1SA 1TWZA 4YU1A 3BGAA 1PWLA 3KBMA 4H01A 1B9BA 3IAPA 2I16A 2ZYFA 1IEQA 1QK2A 3W7PA 3BGGA 2QCMA 3RPTA 2QNEA 2Z2BA 2VMFA 5CLTA 3HU7A 1P5BA 2PF8A 2BDQA 1WYIA 2ZFAA 4LY4A 2V2CA 3V1HA 4IPIA 1GJUA 3AI0A 2CFFA 4UTMA 2FJKA 4JPGA 3N2CA 3MZNA 3L68A 3WENA 4LVGA 2DSWA 4AZ5A 5IRPA 1TCMA 4GYPA 1VYPX 4EXBA 4C6IA 4I3GA 2TODA 4MG4A 2YXXA 3LTSA 3IVUA 2WVVB 2J74A 3SN4A 1MW1A 4FLSA 4B9YA 3R5EA 1QI4A 1E1EA 5HPCA 3VZXA 1Q66A 3N29A 1XKJA 1EP2A 3EMCA 3QF0A 2NQLA 2XVLA 4LSBA 3BSHA 1HKVA 3B05A 4ZEPA 4A3RA 1T0OA 4UTWA 1GVEA 3C2RA 3S6OA 5AC7A 2VUNA 3S2LA 5I09A 1NFGA 3SRKA 1EC9A 4Q7IA 1SSDA 4REQA 4L4OA 4UMAA 5DRCA 1HKJA 4MDPA 5AOUA 4Q8VA 4AQLA 3CH0A 3BJFA 3AXXA 4LV4A 4H41A 3IIZA 3OGVA 5GPRA 3GDLA 5EBAA 4B5VA 1QDSA 1KD0A 4KIRA 4ZO8A 3QPZA 2NWSA 4AMCA 3C61A 1QBBA 5G2HA 5CBJA 4DLFA 1AZ1A 4HA3A 5AB3A 5AYIA 2ZUVA 3QQ0A 2NQ9A 2ZRVA 3W4RA 4ZO6A 1WO2A 4G7FA 2I57A 2Z27A 3P74A 2YOCA 4O1AA 1HF6A 4I9TA 4LTSA 4M5PA 3IUDA 2NQHA 1YDNA 2V5JA 3EXSA 4R33A 3ZR4A 5DMLA 2XIQA 1QPRA 4WK9A 1GK8A 2XSXA 3LGGA 4FS9A 4S3KA 3SECA 3KEHA 5GVJA 1I0BA 2INFA 1PZ2A 1UUOA 3F2DA 1KBIA 3NVTA 1MMFA 4G1KA 2ACQA 1XICA 3E5BA 2WHLA 2IKGA 3MW7A 3CAQA 2P0OA 4JBRA 2Z25A 3MMWA 5CEWA 3NDOA 1KRBC 2A3AA 1V08A 4A4AA 1MUWA 3S5OA 3OA5A 1I1XA 3K13A 3GAYA 4HN8A 5D02A 1DPMA 1Q5MA 2OEJA 1MDRA 4XO6A 4YYCA 2YDAA 3N2MA 4XD5A 1ICSA 2OZ3A 3CYVA 3KTSA 1IXPA 2IXVA 5E9AA 3MO4A 2X1IA 1WNOA 1ZUAX 2XFFA 4LUTB 1EP3A 3RIKA 3BO9A 4NI8A 4V33A 3HG3A 1TV2A 2WJEA 3UZZA 5ENLA 3VKKA 3N1AA 3OP2A 3BICA 3UXDA 4H6EA 2CNCA 1OFEA 2VFHA 1UKPA 1M6JA 1VCVA 1TPWA 1GZGA 4FMVA 2X1RA 2R14A 3F2BA 1TX2A 5DFAA 4ZGYA 2BWGA 4JEQA 4D6HA 4Z2KA 2J27A 2EG6A 2UWFA 4B3ZA 3U7VA 1VHCA 1IIHA 1OX4B 5K9XA 1V7AA 2CU0A 3MHGA 2PDJA 1G4PA 3P8JA 3WLTA 3N2OA 1FWCC 2R1PA 3BQ5A 2RFGA 1Q7ZA 3WQ6A 4H8VA 3VIGA 2Q09A 4OV4A 1R3YA 4W8AA 3ZWTA 4RE3A 2J9ZA 5CBBA 3U2EA 3QVQA 4O11A 1ZL1A 3N9SA 1LBFA 1L2QA 4JFUA 3W28A 2I1OA 4JIHA 4O0KA 4GYKA 4O14A 3ARWA 3RITA 2FGZA 5C0QA 1GKPA 1EFZA 4HPHA 9XIMA 1W1VA 4GZ7A 1H61A 3KCOA 3LLFA 2PI6A 3P93A 2WNWA 3W74A 2YBVA 2HVOA 4E2OA 4KETA 3QY7A 1KV5A 1R3VA 2E6AA 4AUBA 5A6KA 4AAJA 3SQLA 3AWNA 3PZNA 4UZSA 1V03A 1IT7A 3S8HA 3EA3A 3VDAA 4DELA 3GO2A 3SFWA 2ZUWA 3NPUA 5ABEA 2J66A 3TLLA 3GHTA 3AMGA 1LLWA 1LL7A 4LALA 3C5QA 2VXNA 1XRSA 3RJYA 1KQZA 3EDKA 4M8UA 1AQHA 1BVZA 3H2AA 4WDXA 1QO2A 1MXGA 1E9ZB 4EVZA 3G22A 3ZZ1A 2DORA 3ZM8A 4XIMA 4Q7NA 3GDKA 3FJNA 3B0XA 1TWWA 2PGRA 2AQOA 6REQA 1PCKA 5D8WA 4B5UA 4ZMGA 4JTQA 1U5HA 1J6PA 4QSHA 1B57A 2UZ9A 1VPYA 2ZUSA 2VKZG 2WBGA 4O1BA 4QNEA 5LA1A 3B9OA 2QAFA 3DBNA 4C1KA 3GB6A 4JR5A 1V6UA 1OWQA 3H2NA 1XYLA 2BGNE 2NVAA 2V3DA 3WL0A 1R9XA 3TDFA 3I7QA 3FSTA 1QJWA 2NX1A 3GKFA 1JZ3A 2DUXA 2J8TA 3DESA 2QPSA 3K30A 4FB7A 1X8FA 3APTA 3NPXA 3NNTA 2JF7A 4MYXA 2E5DA 1TV8A 1XSKA 2X2GA 3KOZA 4Q6XA 3W53A 3KOWA 1IXOA 4DUXA 4C1NA 2BVDA 4F48A 3W02A 4I7VA 2VX6A 1QK0A 2C1IA 4LWWA 1E71M 4QSFA 4GACA 3CXOA 4L61A 1D2KA 1SM9A 5IDIA 3VD7A 3M5XA 3WEMA 3QGAC 1O60A 4CN4A 2IQ0A 2WLYA 2G37A 2XTKA 1XD1A 4RNIA 3WK1A 5DCBA 3TYAA 3U0HA 4S39A 3W1XA 3AAMA 1VRXA 3MA8A 5JMUA 3RR4A 1H1NA 3KXQA 1ITCA 1XI3A 1XLKA 4KKXA 4DWSA 3GQYA 1QNVA 2DH2A 1UASA 3OIHA 3JRKA 3PWIA 3EWYA 3FGCA 4IPPA 2OZ0A 2ABAA 3BLDA 1QW7A 1X6UA 1JYXA 3M07A 3QSTA 2VZTA 5ABFB 4HSOA 2QAPA 4LS2A 3A5FA 2PP3A 1I2RA 1J01A 1QMLA 5F1VA 1FY6A 2D23A 2R1KA 4R5EA 2ZQ0A 4QDPA 4QS5A 2C16A 4UR9A 3S6DA 5D2XA 4RJEA 1KM6A 1GVRA 3LCHA 3RRXA 3ARSA 3T42A 4MMWA 2VC7A 1FBAA 2JFEX 1HJVA 5LSMA 1HKKA 1EHNA 3ME3A 4C6KA 4D6GA 1UKOA 2E09A 1POJA 3L4ZA 2NVCA 1M03A 2J9XA 5MKGA 3LQLA 4Z2GA 3DUGA 1NFPA 5HA7A 1BSLA 2G3IA 3O0KA 3WLHA 1R3SA 4UFKA 3FXGA 4NRSA 4C6DA 3EKGA 2GDQA 3EAUA 3ARQA 1KNWA 3E0IA 3BANA 1JGMA 2JGYA 2OSYA 5AVHA 3ITTA 2WZEA 4KBXA 1LJYA 3CUFA 3TW7A 1TUFA 1W17A 3M0VA 4L64A 4KEMA 2GL5A 1ELSA 2VZOA 3CIXA 3GNOA 4LNYA 4IX2A 2V5CA 3NSXA 3WF3A 5E1QA 3W1QA 2E5CA 2ATMA 3PBYA 1MEWA 2ZZ7A 4LUSB 3KZSA 3AS2A 1BRLA 1W9UA 3AUOA 4Z1YA 3H4WA 2QDHA 1LRTA 2W92A 4DJFD 1GPFA 2GGIA 2W91A 4GYFA 4FR6A 1K7EA 4TMBA 1H7RA 4DWSD 4L9ZA 2WMIA 2PWEA 1QPNA 1TZ7A 4JTKA 2J7HA 3TA9A 1NOWA 4P61A 1S5TA 4IGMA 3FEQA 3NQ7A 3RRAA 3MT1A 1A5CA 3ARPA 4Y8EA 5LGZA 2P1FA 4HCDA 4AW7A 5F2MA 2ON3A 3KHJA 3G77A 1QBAA 4M1RA 2ZUTA 5AYXA 4AWSA 1W56A 2Y0FA 4J3ZA 2POTA 1R8LA 4BCEA 5A3HA 3CUZA 1XIBA 1MQQA 1B3YA 2WSRA 3Q67A 2J6VA 4NJKA 2PMQA 3W22A 4KCTA 3UWWA 4QS6A 2P0IA 4HU0A 5FJUA 3W88A 4C6BA 3BAIA 4L9XA 3LBCA 4PMJA 4BKNA 4QGCA 3RX3A 2A7NA 1UWIA 3O0FA 3CPUA 3CZEA 1EIBA 1FQ0A 1M7PA 4MZ1A 4XIAA 2ZUNA 3I65A 2GUYA 2X0HA 1MQPA 2QKFA 4UNLA 1NP2A 1NSJA 1G4TA 3WQ8A 2VFEA 4QFUA 1TJ1A 1UR2A 3NZGA 4G5DA 2V9DA 1UOZA 1ODUA 4GISA 1IWAA 4DF1A 3CO8A 2Y85A 4GZEA 4W89A 4GI9A 4KQNA 2XFRA 3Q2DA 3WD0A 3EOEA 2XIJA 3UA3A 2PDHA 4D6IA 3WNNA 2E77A 2CBUA 3BLEA 2W66A 3C56A 3UNDA 2C1GA 4JFVA 2ZZ2A 4GA8A 1GKRA 4B5NA 3TONA 4ZE5A 4ZENA 1KBBA 3VABA 1YE4A 4OUIA 3POHA 3WL1A 3O8AA 1EWDA 3SGZA 1JPIA 1PSCA 4QXIA 3HQNA 2OEMA 1BF6A 4JDBA 4XBKA 3IJIA 5FF0A 2XH0A 3QMTA 3OEXA 2P3EA 4CVWA 4JTUA 1DJXA 3GZ3A 4US6A 2DPEA 5K3VA 2OZ8A 3GHUA 1Q6FA 4K1WA 4O1FA 4ZSUA 3GXTA 4O4VA 4JTGA 2DIEA 4Z2JA 5ABHA 2OLHA 3HPZA 1WBHA 4BA0A 1BKHA 3UJRA 4PGLA 2DQWA 3WUGA 3JZEA 3JW7A 2CLMA 5DMYA 4H8HA 4P2VA 1E55A 2NV2A 1WXYA 1SFJA 2HPIA 5J04A 2AAAA 2ZA1A 1HJXA 3EPMA 2X41A 1QPOA 2F6UA 1ESWA 3B8TA 5DT5A 1NELA 3UESA 2CBVA 3LM3A 5U7SA 5A6BD 2H3DA 1E6RA 3TKFA 2OXNA 1LROA 3I4KA 3LCIA 1FH7A 1EXBA 4PFMA 1OF6A 4AZCA 4JCMA 1NM9A 4BF7A 1RQBA 4Q8WA 2D69A 4RDYA 4YTUA 4ZXLA 4H1ZA 4A29A 3E6EA 3L4VA 3GVWA 2JEPA 4O1EA 1XIEA 4IFKB 3KL3A 2Z7GA 4P8WA 2VEGA 3JS3A 3THDA 4CU8A 4OE7A 3QY6A 3XISA 1JPKA 5EFDA 3IIOA 3VTRA 3G6LA 4AEFA 4L80A 3AALA 4HZ8A 3GM8A 1SUXA 4RLIA 4B92A 3UVAA 5EBUA 2V69A 4WY0A 1Z7AA 2QCEA 4QJ1A 2Z4GA 2VOMA 1OK4A 3BLLA 1YPFA 2PTDA 3TOYA 3GIQA 4UTUA 4E3VA 3EWWA 3T09A 1CGUA 2CWXA 1S2UA 3GG0A 1OG6A 1ISWA 4A3YA 3DYMA 1VFUA 4QX4A 4QJ3B 5HJYA 2FYMA 2HDJA 1TTIA 1H50A 1UWUA 1BXNA 3VIKA 3ZXWA 4GO8A 5FEZA 2PDYA 3G1YA 2GJXB 1WCGA 1NDWA 2GVEA 1UR4A 1ENUA 3GU9A 4WOZA 2NUXA 3QR1A 4TOQA 1CB2A 2C13A 1L6WA 1E1FA 4J3SA 2Y62A 4LAUA 3A9IA 1XRFA 3RCNA 1XD0A 4RX0A 4MPKA 3RFAA 3LCLA 2X30A 2VI0A 3K1GA 4XQ6A 2NVDA 1JULA 3VVGA 1SZEA 2Y6ZA 3USZA 3BZGA 3AS0A 2WWDA 3WCZA 1AQFA 3MU7A 3O6CA 2E0PA 1GZJA 4Y7EA 1MI3A 3P14A 3IVSA 3S5SA 4G56A 1RZMA 4JTTA 4ASTA 3N25A 4PRRA 5BXSA 2FMNA 4HPGA 5FOOA 1BPLB 2BVTA 4XX6A 3F4WA 1XL9A 2OSXA 3PBMA 5KZEA 1MRAA 1E72M 5HWMA 4FNPA 1NFBA 5FA5A 4WKAA 9RUBA 1M41A 5CGTA 5E09A 1OGGA 2VR5A 1Z48A 1FX6A 2R91A 3L12A 3MWAA 5HULA 3HV9A 2J7BA 1OF8A 5AN7A 3DU0A 2ZX7A 3BTNA 3MWCA 4X60A 1UIPA 3DFYA 1Q6CA 1F3EA 3FK4A 4GCAA 4YPJA 1KM0A 3WLMA 3UFYA 4GUFA 1OIFA 4A6GA 3EOSA 1AJ0A 5DQPA 1UA3A 4DZIA 5AHMA 1GWJA 3EPOA 3P84A 3W84A 3QEZA 4GVIA 4Z1BA 2I5IA 4KIEA 4O15A 3TQPA 3KBSA 1T7LA 3G0UA 1C29A 1E4MM 3W2LA 2WZIA 4PA8A 1OFPA 4FXSA 3SCQA 3V36A 3S2MA 3JUGA 3VD3A 4M51A 1LM1A 3VKCA 3RM8A 1GHRA 3WYZA 5I79A 3GSMA 1LWHA 5BOFA 2VEKA 1X98A 1JI1A 4ILSA 3PZVA 1ZQ5A 2X42A 4S3BA 4JL1A 2YCLB 1J5SA 5CZ0A 3K5XA 3B3DA 3SCUA 4BI7A 4PC8A 4US5A 1RHCA 1RK6A 1NEYA 3FA3A 4N9DA 3PZ9A 4O0ZA 4XK2A 4ZODA 1R9ZA 1E0VA 3CBWA 2QJHA 5HOSA 3I3EA 5LKYA 4AX7A 1JCNA 3T81A 3U5UA 1AW1A 3IJQA 4H04A 3TR9A 1KFKA 3AMDA 3M0YA 3P7YA 4HNNA 3KDNA 3S46A 1VBHA 4O28A 3HO8A 1HO1A 3WFLA 2OFJA 4TR9A 4ZVJA 4L5ZA 3ANVA 4ZZ9A 1PB0A 1WP6A 3UR7A 4NL1A 4WXZA 1PX3A 3ABQA 2YKKA 1R3QA 4DN1A 1GOIA 1KXQA 1KRCC 4DO5A 1UP2A 4DVOA 1R7AA 5I23A 3AJXA 1DIEA 2CERA 4JAWA 3BAYA 4O13A 3TE9A 4MOZA 3PR2A 4LC6A 1QWGA 1ZY9A 4IFRA 4JZ5A 1GOOA 3SRDA 3CHVA 3MV01 4S38A 3TN4A 1UPPA 2QJJA 4O18A 3UWYA 5A2CA 2OMAA 2OO0A 2NWRA 3OVQA 1LCOA 1UJPA 4EIVA 3TW9A 2Q02A 3EKZA 3ITVA 1ZS2A 3VCRA 2BY0A 2P8BA 1X1OA 1XYFA 3BURA 5J8LA 3V18A 1JCTA 1WKFA 2V67A 5TNVA 3G0XA 2H6RA 4S3EA 4UQAA 2V82A 4IXXA 3M5YA 4R7JA 1YBQA 3AZSA 2X2YA 3COTA 3YPIA 3WDIA 1YDYA 4NSBA 3V3WA 4JTFA 4KERA 1IYXA 1WPCA 4PMXA 3CEUA 1TSIA 4GQGA 4OGZA 1ONXA 3WZ0E 4FI4A 1S2VA 3GY1A 2WBKA 3II1A 1QU4A 1TV3A 1SZNA 1XYAA 2BVWA 3QKZA 1WXZA 4PTVA 5M5DA 4YVXA 3KX6A 3HPAA 5E0KA 4QDWA 4S2BA 1VR6A 3Q65A 2WKGA 1XG3A 1M01A 4JIPA 1UBSA 1Z32X 2Y70A 2OELA 2R9RA 4Q8QA 4PCFA 3AQUA 3DAQA 3CZLA 1X8CA 2YPIA 1ZCOA 4GE8A 4PMRA 4Z1DA 4MUPA 4AIBA 3R8HA 3CLMA 3E0VA 3NIYA 3BJSA 2PDUA 5E93A 1EUAA 1H1ZA 1W1ZA 3HMCA 4RCXA 3VIMA 3TROA 3GTHA 3K8LA 3RXZA 3DDMA 4DXVA 4IISA 3BLPX 4H4IA 4HMNA 3A3WA 3T0DA 5HJLA 2PZ0A 4X61A 4G1NA 3EWUA 2H90A 2C18A 4RE2A 3DHUA 1DQXA 3BOXA 3BCFA 1E1CB 5SWUA 1CYGA 2B7NA 4MDOA 3IGXA 4YVPA 4CD6A 3QY8A 3E2QA 5HR7A 2DZBA 1DJHA 3B03A 1W9XA 4FR1A 3RMJA 5HINA 5CZKA 4NILA 1LBMA 1VBRA 1XIDA 1EDGA 4IIFA 1DJZA 4LOCA 1LYXA 3DFHA 3W2UA 4S3AA 4F2BA 1MYRA 4L1GA 3W7CA 3WH5A 4QISA 2NT1A 3HIJA 4MYAA 5FEWA 1E51A 1NTHA 2QIWA 1DWIM 4OHQA 1QCWA 4CCCA 4EPEC 2YZRA 1TMLA 5RUBA 4XZ9A 1QHZA 2PWVA 2GJPA 2O9RA 4ZBCA 3GH5A 3D6NA 5I03A 3ZT5A 2X1UA 5K9DA 1XBVA 1DL3A 4LF1A 3IARA 1GYNA 1EGZA 2ZC1A 1GHSA 1MW3A 1OFDA 5IBXC 3JU2A 2ZOXA 4ZTXA 4P8XA 1Q3NA 4DM2A 2PLKA 2O4MA 1EOMA 4MIMA 2W62A 1VP5A 4F4RA 1ICQA 2CZ5A 1E6ZA 5F4XA 1FFRA 4IZGA 3V1PA 3O6DA 1F76A 4PTMA 3DGRA 3CAVA 1TWDA 2LLEA 3VE9A 4AD0A 4IOTA 5C2GA 3MCMA 3W6YA 2P5NA 2XSBA 3P2VA 3QGKC 3BARA 2FPTA 4IHCA 2BOGX 3WDHA 1K77A 4HNOA 1N82A 4ALDA 3WK0A 2PU0A 1PO9A 3R43A 3UF9A 1M04A 3UPBA 3EX3A 4LH8A 5LA2A 1RBAA 2BXVA 2FLIA 3B0PA 3R4IA 5DMMA 2C0AA 1EX5A 1YXDA 3UJEA 4FXRA 2XU2A 2X0YA 3MO7A 4H6KA 3BUVA 1Q45A 4UQEA 4PODA 2QUVA 4JTEA 3L7RA 3LI0A 1J0ZA 3EWCA 4DJFC 1TELA 3S4TA 2Z26A 3L4XA 4DWSC 1B90A 3FVMA 4GRSA 1LG2A 3UEQA 3AXHA 3QV9A 3WEOA 4J2MA 1VHNA 3GVRA 4NUWA 1DKWA 2NX9A 1TR1A 3GNRA 1V02E 4LQ1A 2H8XA 3N34A 1ML1A 2ATSA 3W71A 5LXXA 1OJXA 3M0JA 1A50A 2WO5A 2RUSA 3ZJ6A 1K4HA 5HANA 1PL9A 5DMNA 1Q8JA 3BMWA 7ENLA 1YLVA 1TWSA 3NYDA 5AECA 2FZMA 4G2DA 1NDVA 1AK5A 2VT0A 2GSHA 4ROPA 3T0AA 1KC7A 1JF5A 1TREA 3E2VA 3N3MA 4RR4A 4A2SA 2YYTA 2BGSA 3IJ6A 3I10A 4IMCA 3VIPA 1Q2RA 4YCOA 1HJQA 4XD4A 1W3TA 4MUZA 3MUZ1 5AC8A 1DJNA 2ISFA 2IQDA 1E0TA 1UH2A 2DVXA 2W61A 2BB0A 1F74A 3GU1A 5KITA 3WD2A 4PYSA 2J24A 3QYQA 3TUUA 3ARUA 3KRSA 2NW0A 1PZ1A 2OLSA 3SSJA 2DQXA 4OBRA 1A5UA 3NQCA 4BQ3A 4PFHA 1A5LC 3WLNA 4A3UA 3IEBA 3TX9A 1FWDC 1PS9A 1DJGA 1TB3A 3QC3A 3A24A 1H0GA 4ZOEA 4NAEB 2O92A 4D6DA 1PZ0A 1SGJA 4LVAA 3GS6A 2Y61A 3W85A 2BHZA 1F9CA 3VNKA 2YXOA 1BVNP 1F5ZA 2BHUA 1I9CB 2GJNA 4HPJA 1ZHAA 1O6IA 4XKYA 4JCLA 3RHGA 5AZ1A 2ODOA 3MS8A 2RDUA 2Z1WA 4CNSA 2INZA 4EAMA 4S1FA 3M47A 1XX1A 1BSIA 1FKWA 3M0MA 3QN3A 2JKPA 2ZZ1A 4E3TA 5LIUX 3U57A 3LSCA 3T44A 2E6YA 3TN3A 4KRTA 1UD4A 1JCJA 4M82A 1JI2A 3QHOA 1E73M 1E6NA 4YN5A 4E2VA 4CQ9A 1HGYA 4GHRA 4O8AA 1UWQA 4XTIA 3CASA 3MDWA 4NQ1A 1P43A 4LS0A 2PDBA 4MWAA 1H0IA 4UQBA 2NQJA 3BH4A 1JYVA 1D8WA 4RE4A 3WMSA 1V0NA 1ZTVA 4H83A 3ECQA 5TIMA 4PUJA 3SR7A 4MTVA 1UH3A 1VLWA 5LHEA 4PTNA 5CC5A 1X7IA 1LOLA 1TJPA 4UFLA 2GGEA 4GY1A 4KWVA 2F2HA 3WF2A 1O5RA 1EJTC 3D3AA 3M16A 4MB3A 1KTBA 4IQEA 3W87A 1ZRQA 1G7UA 2J9YA 4FX7A 4EPDC 3W7KA 3WQGA 3RN6A 2QULA 8RUCA 4K8GA 3A4XA 2HS8A 4AIEA 1RXOB 1OY0A 4ECLA 1DYSA 2VO5A 4B90A 3QHNA 1S2WA 1KQYA 5HMDA 1GQIA 4B91A 1RCOB 2YCEA 3PUOA 1BGAA 1BEUA 1DE6A 4NP7A 1VZWA 1CB7B 4K38A 5BYWA 1UHVA 1KM1A 1EJRC 3ARZA 4KWWA 4TUFA 3A12A 4ZQRA 3W9ZA 3AIQA 3FAWA 3VD5A 2ZZ5A 4MHBA 3AS1A 4V28A 5LIKX 1CCWB 1R46A 3MUIA 1UD2A 3LCWA 4AF0B 4WGHA 1LLZA 5DELA 3CU2A 4Y9MA 1CECA 1V0KA 4ERAA 9XIAA 1VFSA 4Q8MA 2DJLA 2CHRA 1VFLA 3U8GA 1G4EA 2GJRA 4RNFA 1E3ZA 4IJBA 1W5MA 2HPMA 1SJBA 1VIWA 4WEVX 2VR2A 3G1FA 1DIOA 2AQVA 3TLQA 3KP0A 1S38A 1BYAA 4W5UA 4UCGA 2VFFA 4M24A 2OEKA 4C6MA 1TJ0A 3R1ZA 3PJXA 1CGTA 2O56A 3R0DA 5LNWA 4K37A 5C9XA 3DKLA 2ACRA 3VGFA 4Z2LA 4DQWA 3KLKA 2QUUA 1YTEA 1VC4A 5F2LA 2EG8A 3O6AA 3VOFA 4KFOA 4GQQA 3ZWSA