1YIXA

Crystal structure of ycfh, tatd homolog from escherichia coli k12, at 1.9 a resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
265
structure length
265
Chain Sequence
MFLVDSHCHLDGLDYESLHKDVDDVLAKAAARDVKFCLAVATTLPSYLHMRDLVGERDNVVFSCGVHPLNQNDPYDVEDLRRLAAEEGVVALGETGLDYYYTPETKVRQQESFIHHIQIGRELNKPVIVHTRDARADTLAILREEKVTDCGGVLHCFTEDRETAGKLLDLGFYISFSGIVTFRNAEQLRDAARYVPLDRLLVETDSPYLAPVPHRGKENQPAMVRDVAEYMAVLKGVAVEELAQVTTDNFARLFHIDASRLQSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords deoxyribonuclease ycfH
publication title Crystal structure of ycfH, tatD homolog from Escherichia coli
rcsb
source organism Escherichia coli
total genus 100
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 3.1.21.-:
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01026 TatD_DNase TatD related DNase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1yixA00
4ERAA 1P6CA 4QS6A 4IFKA 4H9TA 2HBVA 3EWDA 2VR2A 1V77A 2I9UA 4L6DA 1S3TC 3GU1A 4B92A 4R88A 4J2MA 3IRSA 4KERA 3QGKC 2E1WA 2VM8A 2RAGA 3F2DA 2AMXA 2GOKA 4LAOA 4INFA 2HNHA 2R1KA 2WJFA 1V7AA 4IFOA 5FSEC 1A5MC 3A4JA 4NP7A 1P6BA 2Z7GA 2Z00A 4HA0A 5E5CA 3MDUA 3UR2A 3QY8A 3LSCA 2UBPC 1KRCC 2Z25A 3MVIA 4CNSA 1EZ2A 1ITUA 1PO9A 1NDZA 3URNA 4BJHA 3LA4A 1EJXC 1GKPA 3UF9A 1NDVA 4BY3A 4EPKA 2OODA 4EPBC 3RCMA 3OQEA 3TN4A 4XD6A 2HQAA 3N2CA 1R9ZA 4ERGA 1A5LC 1XRFA 1M65A 1QXLA 4LFYA 2VUNA 4PBEA 4CQCA 4IFKB 5HMDA 1J79A 2WM1A 2FFIA 3AU6A 1RK6A 4C6NA 4RZBA 1UIPA 4J35A 3LGDA 1RJRA 4LANA 4DLMA 1M7JA 2Y1HA 3QY6A 1A4LA 2YB1A 4R7WA 1K6WA 3SO7A 4IGNA 4H9UA 3S2NA 3ICJA 4UBPC 1FWEC 1J6PA 4C6PA 1O5RA 4LAMA 3F4DA 1EJSC 4GBDA 3GTHA 4DO7A 1EJUC 2DVXA 4Z42C 3URBA 1A5NC 3MTWA 3UBPC 3SFWA 3CJPA 1FWJC 4I6KA 3OODA 3WMLA 2FVKA 3WYZA 4RDVA 3E3HA 4KETA 4EPDC 1RJPA 3MSRA 4C6DA 3D6NA 2FVMA 4OFCA 4LEFA 3AUOA 4CNTA 3GUWA 3GU9A 2A3LA 2Z4GA 3FDGA 2EG8A 1KRMA 5HMFA 3TN5A 3RYSA 1FWAC 2ANUA 2R1LA 1FWGC 1QW7A 1A5KC 3S2MA 4HK5A 4R85A 4J5NA 4GOAA 3F2CA 4PE8A 4DZIA 4IGMA 4ERIA 2EG7A 3HPAA 3LSBA 1P1MA 2YZ5A 2Z24A 3HM7A 2XIOA 2Q09A 4V1YA 3T81A 3NURA 3GG7A 4V1XA 4F0LA 3GIPA 1RK5A 4I6VA 3IPWA 1V51A 4NG3A 3GTIA 4QS5A 1JGMA 1PSCA 4KEZA 4DLFA 4H9VA 2Z27A 4C6FA 3K2GA 3MVTA 3OU8A 3B40A 3PNZA 4HK7A 1YBQA 1ONXA 4WGXA 3UR5A 4CNUA 2O4QA 2QT3A 4BKNA 4F0RA 3E2VA 4ZSUA 3F4CA 5FSDC 2AQOA 3IARA 4PBFA 1XRTA 2I5GA 4B91A 1POJA 1I0BA 3MDWA 4RDWA 3F2BA 4QSFA 5A6TC 3O0FA 4RE0A 3PNUA 4GX8A 2D2GA 1KCXA 3ORWA 4G7EA 4C60A 4RDZA 3RHGA 4MUPA 2QVNA 4TQTA 4ZSTA 2D2JA 3FDKA 4GX9A 2OOFA 4C6MA 2WJDA 4C6KA 4C65A 3MKVA 4GYFA 3C86A 3IGHX 4GXWA 4C6OA 4KQNA 2OQLA 1FWCC 2PUZA 2Z2AA 1J6OA 3OJGA 1M68A 2PGRA 1IE7C 1EJVC 1RA0A 1V4YA 3HTWA 3DCPA 3ITCA 3LNPA 4IG2A 4P5UA 4M51A 4KEVA 4C6CA 3E0LA 4G2DA 3RN6A 4CEUC 2Z28A 3QY7A 1PTAA 2FTWA 4H9XA 4F0SA 2P50A 1NFGA 1WXYA 3GU2A 5AKQA 2VHLA 3IACA 3GTXA 2PLMA 3PAOA 3IV8A 1YBQB 2F6KA 1W1IE 3BE7A 2FTYA 2HPMA 2QS8A 4JOMA 4GY1A 2IMRA 4UB9A 4KIRA 2E25A 3FEQA 4DZHA 5CH9A 3ISIX 4XAYA 4G7EB 4HK6A 4C6QA 3S2JA 2WJEA 3EGJA 3IJ6A 4XD5A 3S4TA 4C6IA 1EJWC 1EYWA 4XD3A 3O7UA 4DI9A 4CQDA 2PGFA 3KM8A 4EP8C 2VC5A 3DC8A 4C5ZA 1R9YA 3G77A 2GWNA 2DVUA 1K70A 3B0XA 3EWCA 3TN6A 3URAA 3T8LA 2O4MA 2QPXA 1GKRA 4IG2B 1EJTC 4LCSA 1ADDA 2UZ9A 4IFRA 4KESA 4LCRA 2ZC1A 1DPMA 4QRNA 1WXZA 1O12A 1ZZMA 1FWHC 4E3TA 1ITQA 3GTFA 3CS2A 4L9XA 4CQBA 5LXXA 1RAKA 1FKWA 1GKQA 4XD4A 3R0DA 3LGGA 1HZYA 1RA5A 2R1MA 3URQA 3PBMA 4GZ7A 1NDYA 4KF1A 4GC3A 1FWFC 1YRRA 1KRAC 1KRBC 3E0FA 1EJRC 2W9MA 4YIWA 3OOQA 3T1GA 4WVXA 4XAGA 2OB3A 4XAFA 1UBPC 5G4HC 1EF2A 4AQLA 4CEXC 4IQJA 1ONWA 2GZXA 4H01A 1UMLA 3NEHA 4XAZA 2AQVA 3TNBA 4GY0A 4B3ZA 4IH3A 2VC7A 2HBXA 3MPGA 3OVGA 1YMYA 3K5XA 4LH8A 1FWDC 2BGNE 2CZVA 1RJQA 3B0YA 3GRIA 4GK8A 2OGJA 4C6BA 2ICSA 1YIXA 3A3XA 3E74A 3AU2A 3K4WA 2Z26A 4C5YA 3LS9A 1A5OC 2ADAA 2R1NA 4GY7A 2DVTA 3MJMA 4LCQA 3E38A 3LU2A 2R1PA 4WHBA 2G3FA 4ICMA 2YB4A 4KEUA 1PB0A 1POKA 2BB0A 1YNYA 2KAUC 4DIAA 4DYKA 4PCPA 1E9ZB 3V7PA 3A3WA 4C6JA 1I0DA 4PCNA 1V79A 3CAKA 3TN3A 2Q01A 2Z2BA 1K1DA 4NI8A 1FKXA 4H00A 2D2HA 2GWGA 1FWIC 1XGEA 3ID7A 4B90A 3S2LA 3UPMA 3WZ0E 3GIQA 2GSEA 3DUGA 2HPIA 4H9YA 4QROA 3NQBA 1VFLA 1J5SA 2Z29A 4H9MA 2YXOA 2P53A 4DNMA 4EPEC 3LY0A 4C6LA 4LAKA 4DI8A 3JZEA 3QGAC 1NDWA 1XWYA 4C6EA 4HJWA 5HMEA 4IF2A 4AC7C 2PAJA 1E9YB 1FWBC 1A4MA 4LALA 4QTGA 4RDYA 1BF6A 1R9XA 3PANA 4H9ZA 2EG6A 4D8LA 1UIOA
chains in the Genus database with same CATH superfamily
1JZ7A 4NUWA 3O6YX 3IANA 1XIBA 2VR2A 1S3TC 1E0TA 4ZVJA 3G22A 2QCGA 4GI9A 2Y5JA 3TK7A 2AKMA 4YNGA 3WLRA 3WF2A 3IRSA 1VENA 1VKFA 3E0VA 3WD2A 3EX4A 4Q6JA 2YZRA 2RAGA 2GOKA 1PZ3A 3OA3A 3LM7A 3CPRA 3C56A 4A3RA 2PB1A 2HMCA 3CZEA 1WKYA 3PAJA 4GYPA 3H7RA 4ZZ9A 2C79A 3DFNA 4FR1A 3URNA 4MVAA 2CC0A 3B97A 4F0KA 4Q4OA 2KZHA 4MNLA 5HWJA 1TX2A 3VGFA 2CLEA 1A5LC 5AECA 3WO8A 3FYPA 4FZIA 1B57A 4ATWA 3AZSA 1BVZA 5E09A 4C6NA 2YDQA 2VKZG 3FAWA 4Y90A 3T0BA 5FL0A 4H19A 4PH6A 3HG5A 4X9YA 4PEEA 4AVOA 4C6PA 1J6PA 1VBJA 1V08A 1F61A 3RK8A 3BSGA 1MSSA 1PAMA 1ZBKA 3RCYA 1OC5A 1U33A 3MTWA 2ACSA 3GDMA 4I6KA 3L4TA 2X41A 3LM3A 1W9DM 4NX5A 5D4YA 1HO4A 3C52A 4PR4A 3DZ1A 3BAKA 3G8EA 5BU9A 3IEBA 4PCFA 4DWSB 3CYJA 2XFYA 1FWAC 3N17A 1OWQA 1PX8A 1SSDA 1OC7A 1GOQA 1C90A 4YCPA 1LUCA 1IT7A 5HJXA 2GSHA 2PRLA 2EKCA 4UIOA 4FNSA 4ERIA 3N2MA 2XVKA 1XSIA 4GHRA 1Q4NX 3M7SA 4AY7A 4DUOA 2EO7A 2ZTKA 3N2XA 3M47A 1QI2A 3MP3A 3A5VA 3CZGA 1RK5A 1FP9A 1Z89A 3R7MA 3ZQ9A 1P0DA 1C29A 2ZVIA 1ELSA 2DIEA 2YBTA 2Z27A 1UC5A 2E8ZA 1QO2A 3PNZA 1LQ2A 3WL0A 3SGUA 1FHLA 2OX1A 1J93A 1EX5A 1ZJHA 4J4KA 3EX1A 1VBRA 4ZSUA 1IWAA 5H8PA 4JFWA 1A50A 5A6LA 3R43A 4R27A 1S3HA 4RDWA 3PBUA 2XYLA 2V3DA 4MTVA 3OGRA 5CPTA 3U2CA 1YW1A 2NWSA 1QHOA 1MW1A 3OZOA 2JKEA 1J0JA 3WQOA 2NV9A 2ZBTA 1MQQA 2O9PA 2HEJA 1PIIA 1Q2RA 3O3RA 4C65A 3RCNA 3MKVA 3NYZA 2PF8A 3C2OA 3S0CA 3M4HA 4GXWA 4E4FA 4IJBA 4MNMA 2GGJA 1RA0A 1CECA 1RLDA 2A79A 4FLSA 1F9CA 2ZXDA 1G9HA 2RDWA 2CU0A 2FTWA 4WSKA 4LOCA 4H8HA 3F7JA 1KTCA 3NZRA 3FKKA 2WMIB 4XVDA 4O53A 4AIUA 2J79A 2POZA 5I09A 4S3BA 5F2LA 1K7FA 3GG0A 4KIRA 3DKJA 4W85A 1JZ4A 5B80A 5CH9A 3ISIX 4MY9A 3H55A 1EGVA 3OQ8A 3SI9A 2WJEA 5IHSA 4XD3A 3NL6A 3W83A 2NVAA 1GYMA 1K4HA 4YVXA 3A64A 2GWNA 1K70A 3FA3A 2P8CA 3V0UA 1TPC1 1UKQA 4AVNA 1XISA 1U2YA 3OLEA 1NOWA 5G1YA 2G4FA 1O12A 3PZUA 4QBXA 2V63A 1P4CA 1WZMA 3FJNA 4G1NA 3EMZA 4W5ZA 3UZJA 4BI5A 3LGGA 3G18A 4UMBA 4UR8A 3URQA 4ATDA 4AZ5A 1FHVA 3MWCA 3PBMA 1GJWA 4GVIA 4IPLA 2FDMA 4GC3A 2XGZA 3MCMA 4EWND 7TIMA 3KRZA 4W8AA 1AH0A 3P7YA 3CV6A 5K9XA 4DJEC 5J04A 3R1ZA 1NF7A 1QI0A 4O50A 3RAOA 3N73A 4ES4A 4AWTA 1UWUA 5TNVA 3OBKA 1WPCA 4H4IA 3G5EA 5C70A 3H24A 5D02A 3ENLA 3VNLA 3LPFA 3TJXA 1H60A 2WHMA 5JU6A 4GUIA 4P2VA 3CZJA 3K8KA 4URIA 1E72M 4YVVA 3U4AA 1EX1A 4POCA 1BLIA 2CLHA 3W3OA 2PDGA 4ZO6A 1HJXA 1CLVA 3FOKA 1HXJA 1SUXA 1JCTA 1WDSA 3GW3A 4GE8A 4B2DD 3EYPA 1BGAA 1Q6EA 2AL2A 2A85A 4GIYA 3FYYA 2RDUA 4L6HA 1BXBA 4I5XA 1SFTA 1PCWA 4AD5A 4OT7A 1KV5A 9XIMA 1DWAM 4QISA 1E0WA 3VGBA 5DQPA 3AYTA 1EWDA 5ECUA 5EGRA 2VEMA 4ZQRA 4H9MA 1N55A 2YXXA 5CAHA 2P53A 3LY0A 4HU3A 2CBUA 1VQTA 2V2CA 2B7NA 2FB2A 1DHKA 1MUMA 2QF8A 4LVAA 2X0HA 1BF6A 1Y8BA 2QEZA 3WQ8A 2R6OA 1ZALA 3POCA 1P6CA 4QGCA 3NVDA 3R0UA 3SCRA 2ZX5A 5CPLA 1GGOA 1VJIA 3IJQA 3DI1A 4JN8A 3KBSA 3S1VA 2V3GA 2RJHA 1PX4A 1B3ZA 3WLMA 4G1KA 3CH9A 1S1RA 3GDBA 2HTMA 1WX0A 5LA0A 3I65A 3NM1A 1CYGA 3R8GA 1TWZA 3CQIA 1GOMA 2PDFA 1NP0A 1R2RA 1WZLA 1V8EA 1GTEA 1FCUA 3VD3A 4HHHA 3R25A 3I3BA 3UF9A 1J0YA 3QBUA 4U5KA 3PPGA 2HQAA 3L4XA 4LFYA 1LROA 1KFBA 2Y6ZA 1MDRA 2XZ9A 3IGXA 3M0XA 3BSMA 3C4UA 1U83A 1AUSL 3CUHA 4D6HA 4NSBA 4QITA 1CIUA 3S2NA 3L0GA 3OLDA 1DXIA 1TJ2A 3HZ3A 2JKPA 2REQA 4W4QA 4Y8FA 5XIMA 4OU1A 1EJUC 4B4HA 4ONVA 4Q8OA 3G1DA 1KFCA 1FWJC 4UOJA 3WF1A 4AC1X 1LLWA 4L9YA 2WBKA 3PZGA 1UOZA 2B31A 1F3XA 3THCA 3A4WA 4CNOA 4E38A 4ZQCA 3VA8A 1QBAA 3PZQA 4N9BA 3TXVA 4DRSA 3N18A 1T0OA 2XSXA 1OFDA 4IJRA 1I2NA 2DW6A 3FDGA 3QC0A 2PC8A 3GVQA 3G3DA 1IGSA 1KRMA 5F2MA 1UH2A 4UNLA 5AOUA 1VFSA 5T9BG 1FP8A 2F8QA 4TX9A 4GLEA 2J8FA 4HSHA 2QQ6A 4R85A 3GSMA 5DBTA 4Q22A 1NELA 3QF0A 1OGGA 4CGTA 3UG3A 1M41A 3QN3A 2B7PA 3KVJA 1AQMA 4AHOA 3NNTA 5K9DA 2XIOA 5C71A 3T81A 5E1QA 3M0HA 5ABTA 5AB3A 3GYEA 1J01A 1KM0A 4W9TA 2DH2A 3AS1A 4DVOA 5G1MA 3FVMA 1W3IA 4D6EA 3THUA 4ZTYA 1JCYA 2B0MA 1DJNA 2VZSA 3L68A 3AHZA 3XIMA 3U0HA 5TD4A 3EKLA 2AL1A 4F0RA 4HKPA 3E2VA 1GJUA 3PFRA 1TKKA 3ANUA 5CJMA 3IIOA 1X97A 1ZB5A 4RNJA 5FACA 4KPLA 3O0FA 2D0HA 2OT1A 1XYMA 2PD9A 4RDZA 3TYBA 3A23A 4IQEA 1OYCA 3SIMA 4GX9A 2WVTA 2J6VA 4M29A 1A53A 2OLHA 1FWCC 2Z2AA 2G3JA 3GQYA 4DF0A 3H26A 4UQBA 1Q85A 4IISA 3G1AA 1D7KA 1W3KA 2FVLA 2X2GA 4HJFA 3Q58A 3M0YA 1XBVA 4ZMGA 4G2DA 5HXMA 2VDGA 3LOTA 4UNKA 2P50A 3QTPA 1NFGA 3T55A 5AYXA 1TPWA 3O8AA 4JYEA 4MJZA 5REQB 3VIGA 2CLKA 4YTRA 1QPKA 3OBEA 1JNDA 3LHVA 3T05A 3DYOA 1G6CA 5DRIA 1PEZA 3NPVA 3QV6A 1J4EA 3A5FA 3G1SA 3OZMA 4NAEA 4IHCA 1GZ1A 1SZNA 2SFPA 4ADUA 1GHRA 4WSHA 3O7UA 3UA4A 4EP8C 1M7PA 1RZMA 1S5VA 1P6WA 1BWVA 1VP5A 3GXNA 4B4FA 5K9CA 1Q63A 1FWTA 1RLCL 1QOPA 3UNDA 2X30A 4C90A 5XINA 2RJGA 4JHOA 4MYXA 3VX0A 1ME9A 3R0DA 3AICA 1PYMA 2X40A 3KZPA 2GOUA 1XM3A 1PXGA 4M8UA 4CQ8A 3ZWTA 2WNZA 1GNXA 2BDQA 2QIWA 2OB3A 4CD7A 2BG5A 1BYBA 1I2PA 2OPJA 2C18A 2QPUA 4WCJA 1B30A 1ODZA 3P60A 3AHVA 5GNXA 2GDUA 4Z0SA 1V6UA 4Y9AA 2V8ZA 3S3GA 3BLLA 1J96A 2HISA 2IPJA 1L6YA 1W5PA 2QCLA 1JPDX 1ZS2A 3PFMA 3PWIA 3KL5A 3PBVA 4Q8QA 3VD4A 1DQWA 1S2VA 2ISFA 1C92A 4KH2A 5M1TA 4JXCA 4LT9A 2J7HA 3S5SA 2GDQA 1GQNA 1PHQA 5D8WA 1X6UA 3PR2A 4AXNA 3APYA 1XFCA 1HJSA 1VHCA 4HOXA 1AK5A 3TTEA 1PWMA 1S5MA 1IEWA 3DKLA 3BCJA 1JD9A 3S5NA 1EHAA 1SSGA 2BOEX 1W3NA 4LYQA 3V7PA 3WD3A 5C2GA 4XBKA 1XGEA 3ARWA 4HCLA 1OCNA 3WZ0E 4CN1A 3PB0A 3EKGA 5I00A 3MUY1 1VB9A 3ITGA 4EPEC 2XZ7A 2PZ0A 5BROA 3MA8A 1LP6A 3AQUA 3H7UA 4PTMA 4HP5A 3DFTA 2D23A 1TSIA 5CXPA 1X1ZA 3TQ0A 2MNRA 2X8RA 1KW1A 4WZHA 4AZGA 5CPNA 1QOXA 4Q8NA 3BLDA 4PUNA 4UQDA 7ODCA 4IFKA 1D3HA 4W93A 5I6SA 4R88A 3H2AA 3NOEA 2Y8KA 4WY0F 3ZJKA 2V0TA 1W0MA 2DSKA 2G50A 4V27A 1IEQA 2ACQA 1ME7A 4LJ3A 3VC6A 3W75A 5CC3A 3A4JA 4NP7A 3MVIA 3KBWA 1ITUA 4A29A 3P0XA 4CNNA 3FW6A 2DUAA 1EDGA 5F7UA 4Y6GA 5K4XA 3QSRA 1Q8AA 3H4GA 3EA3A 4O1CA 2C15A 4M6UA 2HXTA 4ACZB 2FGZA 4XTIA 1R9ZA 2YFNA 1HGWA 1XCXA 1XRFA 4U28A 2OZ0A 2JGYA 2FZDA 4Q4RA 3IIVA 4DWDA 3VNMA 5DN1A 4HMNA 2QHAA 4UTUA 2HROA 1H5VA 5EMLA 5LNSA 4FNPA 4EAYA 1KLYA 3MP5A 4ADSA 3C8NA 3LGDA 2OEJA 2X7WA 3MUXA 3MSGA 1KR0A 2CEQA 2C1GA 2WPGA 5HR7A 3V18A 1FH9A 3T9PA 3GTHA 1JPIA 1Z3NA 1UR8A 5A6BD 4I7VA 5LIUX 4DO4A 3AOFA 4JTKA 2WC7A 1LG1A 5JBDA 3ZMRA 5F2GA 5AFDA 5A6AA 4RDVA 1CT5A 1RJPA 4F4RA 1W9XA 2VVSA 4Z2GA 3GU9A 2GJRA 4NHVA 3CAQA 3QVQA 1ISYA 4QDMA 2YJQA 2QXWA 3KX6A 1V7YA 4CCZA 2TRSA 4KKXA 1TCMA 2INZA 3BZJA 2XIBA 3KBMA 5M3WA 2ZYFA 5BMWA 3UXDA 1P1MA 1B1YA 3UETA 3TC3A 3C2FA 3NQVA 3L66A 1E0UA 2VFGA 3IGSA 4F0LA 3HMJG 1M04A 5EU9A 3GIPA 4J3UA 5CPSA 4GQGA 1RPXA 5HPOA 1OB0A 1P48A 1CWYA 4HTYA 4PMJA 2W63A 3N04A 2YYUA 3S6OA 3TJLA 3CLMA 1E6QM 4L1GA 1EDTA 3QRHA 4QDWA 3WLHA 3WNMA 3U5UA 4N0RA 3CIXA 4S3EA 1DIOA 2CHOA 3UZ5A 4AD4A 2O4QA 3EZ4A 4ADTA 1KBBA 3EX2A 4FPSA 1XDLA 1LORA 1QNPA 3SY8A 4AFYA 1VBHA 3C0JA 4C91A 4DBEA 1E56A 4TXEA 3DENA 3PC0A 3ZWSA 4WD0A 1IZCA 4FXFA 2VEPA 4O52A 1LWHA 5DT5A 1X8FA 2FJUB 4GYFA 3L2IA 5BRBA 4OE7A 2VRQA 4IPPA 4OUEA 3NQGA 3N2TA 4P61A 1QNSA 4A35A 3HTWA 5AHEA 1KWGA 3U2OA 1YX1A 5B7ZA 1OADA 3QY7A 2FZ9A 4QLJA 4CCCA 3L9CA 1WXYA 4ZGYA 3OTRA 3IACA 3GTXA 1YXYA 3VOCA 1KM1A 1VEOA 1AW1A 2O92A 1TV5A 3V5CA 3B04A 1UP3A 1HKIA 5J5DA 2PDIA 4GY1A 1IZJA 3W23A 1AVAA 5D38A 3FEQA 2GQAA 3R8HA 3C3NA 4MJ4A 4HK6A 4L7ZA 4HNLA 4RNFA 2XH0A 2DZBA 1UP0A 3PBGA 2W92A 3FGCB 3K4DA 3C5QA 3EOSA 3F5JA 3EWCA 3T8LA 2J78A 4U10A 1NTHA 3R10A 3GK0A 4L64A 2QV5A 2ZC1A 4QRNA 3WJYA 3T2PA 1OSEA 1ITQA 3QPZA 4Z1BA 3GTFA 2Z0IA 5HULA 3HBLA 4CQBA 3GZ3A 5LXXA 2AMGA 3U48A 1HP4A 1E1CA 5TF0A 3ZVIA 4S2CA 3W1QA 2IQDA 4R7OA 1TREA 1NDYA 4ECLA 1RQEA 2PDCA 1EJRC 5CKSA 4Y2WA 1SVDA 1M5WA 2Y2WA 4ZB5A 3VABA 4YVPA 3O63A 4ZR8A 1P43A 1UC4A 1UWRA 2EPLX 4O0KA 2NUXA 4H01A 1IXOA 4UFMA 1KLZA 3FN9A 4F9DA 3E02A 1ZJBA 2VC7A 1XW8A 1KC7A 3KAOA 3MBFA 3CAWA 3B0YA 5DY3A 3L12A 2VX7A 2NX9A 3W00A 3MKKA 3BLFA 4GFSA 3A3XA 2WSYA 4MSSA 4WDUA 2RGMA 4UC5A 1JRBA 2YSWA 2R1NA 3W76A 5C2XA 5C9ZA 1KCLA 4A8RA 1JI2A 2GUBA 1K03A 2PWUA 4ASTA 3QZ6A 3WQCA 5E0CA 2YB4A 3AIBA 1OX4B 2VEGA 3FJLA 2E0PA 4DJDA 4AHQA 1WDWA 1XCWA 3L5LA 4JL1A 4DYKA 3UVAA 3WF0A 4HB7A 1A5SA 5FJTA 4WKFA 1OG0A 3GHSA 3NQEA 2D2HA 1K3UA 3ID7A 4B90A 3GXFA 2GSEA 2J24A 2L5HA 5IXEA 3ZT7A 3N15A 4LAKA 5DFAA 5CC7A 1TV2A 4BA0A 3MB9A 1NDWA 3H6OA 1JUKA 1TMHA 4BQ5A 1E9YB 1YXDA 3NZQA 3G1FA 3UYIA 1WA3A 2V5CA 5D2XA 5AZ0A 3EOLA 4YN5A 1IF2A 5C6MA 4MM1A 1J0KA 5LIKX 1LT8A 3WLNA 3PS7A 2CNCA 4L6DA 3VUPA 5CBBA 3NQ8A 1GYNA 4IQDA 4OIFA 1UA3A 2QPSA 2WXDM 5JMUA 2YL9A 4JYFA 4AX7A 4ZOAA 1D9EA 1AL8A 2FH6A 3OP2A 2YX0A 5IHRA 2E9BA 1XGZA 4INFA 3EDKA 3WNPA 3QH2A 3GNDA 2W3ZA 1A5AA 3A9BA 4KT2A 2R24A 2PCEA 2PP1A 3WBEA 8CGTA 3S9YA 3ITXA 3LK6A 4LU0A 3P81A 1QRQA 1A80A 1FH8A 4REQA 1HVXA 1U5JA 3GFXA 4F79A 1BQCA 5AVHA 3W73A 4L80A 3SCUA 2EAWA 3GFZA 3NR0A 4S3JA 3TLQA 3CIWA 3QPYA 3W86A 4LBSA 4RZBA 3KVKA 1TPEA 1VF8A 4J35A 4DLMA 4LANA 1KBJA 2NQJA 1UZDA 3G24A 1A4LA 3TMQA 3I68A 1C93A 3LCXA 4IGNA 4IOTA 4JPGA 3ARSA 1OHLA 3ES8A 3B4YA 3JUGA 4ZQNA 5EMJA 2X1UA 1I60A 5I07A 1IXNA 2J13A 1WUEA 5HA7A 4RW5A 4AF0A 3HQPA 2A21A 3CJPA 1QVBA 3R94A 1GVEA 5CSSA 1ZAIA 3TSDA 1MUWA 3MZ2A 1RP8A 3ZM8A 3WF4A 1ICSA 5G2IA 3EPNA 5HNRA 1ITCA 2ANUA 2W5FA 1PWLA 3QMSA 2Y63A 4MY1A 4K2SA 1OGBA 5CG7A 2ZX6A 3W1RA 3MV01 2Y7FA 4E4UA 4LUSA 2EG7A 2J74A 3DG3A 1TV4A 1TIMA 4RW3A 2YA0A 2X05A 2VOMA 1MW0A 1QPRA 2P76A 4CN6A 3UJEA 2HK1A 4UTWA 2ALRA 2NZLA 4DM1A 3HQOA 1KM2A 1TWWA 4E0CA 1PBGA 3AS2A 4HQVA 3VFLA 4PODA 2CESA 4RZ4A 4A05A 1QATA 4QR6A 4JY8A 4Q7BA 3SADA 1VFHA 1XLBA 1CNVA 3NQDA 1W37A 3QGVA 2WZTA 3O1NA 4IIHA 4US5D 1E3ZA 4WR3A 3UWQA 2AQOA 4PTWA 1AD1A 1N7KA 1NARA 1OF6A 2PDHA 3AIVA 1QI4A 4FMVA 3HU7A 4J1OA 1I0BA 3NWRA 1R3WA 2V68A 1AMYA 1HJWA 2BP1A 2VURA 1FA2A 1AQ0A 1V0LA 1UG6A 5A6SA 1GVQA 4DZ5A 3O2LA 1XG3A 3RHGA 4MUPA 4UQEA 9XIAA 4ZSTA 3D46A 3BQ5A 2ZFAA 5EY5A 4F2BA 4PUDA 3UERA 2WJDA 4HSNA 3SECA 3TZFA 3W27A 1M68A 2KX9A 4XIMA 3QW4B 3WFLA 3Q94A 5H6HA 3VTRA 2W27A 1XLGA 4LY4A 1K9EA 2VENA 4Y9NA 3DAQA 2VFIA 1VPYA 2ACRA 2EJAA 2WCGA 2H90A 4UTHA 1H50A 3MSDA 5LNVA 2NLIA 2UWFA 2FTYA 1QI3A 3UXLA 3CAVA 4Z08A 1TA3B 2TPSA 4O57A 3ZFHA 3IJLA 1TTJA 4Q8UA 1MNSA 3SRDA 2PDNA 4N6FA 1E4MM 3SDOA 3BICA 5GNZA 3B9AA 4IIFA 5CLTA 3R6IA 1GWJA 1V6VA 1I45A 4M24A 5C9WA 3KM8A 2DZAA 4YTSA 2QR6A 1I9CB 4AUBA 3VILA 1GUVA 2F6UA 4NJJA 2CLPA 2ZZ1A 4CD6A 1GKRA 2DZSA 1EGMA 1THFD 3TR2A 3A21A 1UP2A 4Q4SA 1U1HA 2XM2A 1QNVA 3DHDA 3DC0A 3BW2A 3RU8X 4JFSA 1AW5A 4OUIA 2CZDA 3E0FA 1R2TA 2VGIA 1HGYA 1G0CA 4I9AA 1JRCA 1YDNA 2PLKA 1EO7A 4JN7A 2GLKA 4XAFA 3UZXA 3ZXWA 1JG9A 4NAEB 3GFYA 1ZCOA 3GM8A 1K7EA 2GZXA 1RBOB 3QOKA 1Y5XA 4Z2LA 2H6RA 3LERA 5HWMA 3CMJA 2PDPA 1UR1A 2OSXA 1S2WA 2Y7GA 3P2VA 5H8MA 1KA9F 1YMYA 3IV3A 1FWDC 1JUEA 2TODA 3C0QA 3W1AA 4BF9A 4E2OA 1GOKA 4AX6A 4PUMA 4WOQA 3UWZA 2X1IA 3M43A 3LS9A 1RD5A 4NKCA 4NZCA 1QW9A 3GVRA 1OCJA 1IZKA 4WXZA 1XP3A 2R91A 4JHMA 5CZJA 5CZTA 2J7CA 3VYLA 3VIFA 3GHRA 4JTEA 3M5VA 4HZ6A 5M5DA 3KCLA 1QK2A 4LAUA 1XLMA 4F0MA 1PZ2A 1Q66A 3JVAA 2NX1A 3KOFA 2ATMA 4KS0A 2ZUVA 4IMDA 1R8LA 2ZUWA 2YLLA 3CEUA 2HVMA 1EHNA 5C7HA 2WB5A 1UD6A 4R3UA 4MLRA 2PWFA 1UB3A 3QR3A 5HOSA 3GR7A 3CQHA 5LKYA 1TR1A 5AY7A 1B2YA 4WDWA 6A3HA 3W88A 2ABBA 2HBVA 4EWJA 3IVUA 1B3YA 1S2CA 4QJ1A 5GPRA 4EIVA 3GKFA 4WGHA 4MOZA 3OA5A 3DFPA 4J2MA 3GS6A 3IVSA 3WNKA 3TCEA 3VC5A 3RMEA 3T7VA 4CD4A 4JKMA 4L4LA 1JULA 4Z1CA 3V16A 4U2YA 2V5JA 5LIWX 2R1KA 3VOHA 1OFBA 3TAOA 3HO8A 3POHA 1GK8A 1X6NA 1G7VA 4N9DA 5DXYA 3P14A 4CKQA 3BOFA 5I3KA 1K77A 4GJ1A 2E7FA 1TJ1A 3UY7A 1XLHA 4CD8A 3ZR6A 3CL7A 1JQVA 1NU5A 4PRWA 1W5QA 4AXKA 2PC4A 4N02A 4IFKB 1J8VA 1C7TA 2YR1A 5FEXA 2I1OA 1OZQA 4A4AA 1J0HA 3AMKA 3MMWA 1UIPA 1XLEA 4H8VA 1O66A 1QR7A 1W31A 2GFTA 3BMVA 2IPWA 1DTUA 1FUYA 3SCPA 3GHTA 1YYAA 1US0A 2ZCGA 2V3FA 1BG4A 3PUDA 5BRQA 3DIPA 1A5NC 1LOLA 4LVGA 5FF7A 2FYMA 3WN6A 2QDEA 1HQTA 3GVVA 1CTNA 3DESA 3THAA 3VKKA 4YTUA 1O1ZA 1WZKA 3T0AA 1OT1A 3WUEA 4MAVA 1XF0A 4XZHA 3N3MA 3VOFA 4QP0A 1H7PA 1FWGC 3SUTA 1FFRA 4LGXA 2DJLA 1A5KC 2WQPA 4JQ2A 3W24A 2OSYA 4PSRA 3M41A 4WY0A 4XZ9A 4XQ6A 4IPJA 4I9MA 4GACA 1FWRA 4Q8PA 1T99A 2Y89A 2VD8A 1N2VA 1L8NA 1CB2A 4TO8A 1LDCA 2IPFA 4JTFA 1O1HA 3K2GA 3AALA 1ZNNA 2P88A 1V3HA 1GW1A 1YBQA 1X8CA 3CQJA 4BKNA 2XIQA 4GKLA 2V5BA 3DHFA 3IARA 4QIUA 1EC9A 1HX0A 1DOSA 2IS7A 4GNVA 6REQB 2Y61A 3CL8A 1KCXA 2EGZA 4ZOBA 1M7OA 2DT3A 3E0IA 4I8YA 3HQNA 1PS9A 3A13A 3BAXA 1K8YA 1I2OA 2D0GA 2WKGA 3AXKA 4A8IA 3VAVA 3EX3A 4TOQA 4KQNA 1AG1O 2YDSA 1AH3A 3KOWA 4FHAA 4M7TA 5F1VA 4AYSA 1EXPA 1PTAA 4HYWA 4F0SA 2A3CA 4HZMA 3H2NA 4J27A 3D0CA 1W9BM 3H4XA 2VGBA 1XH0A 1UH3A 3TROA 4Z2KA 1FCQA 1F07A 2DIKA 3RUBL 4NZ5A 4KRZA 1K4GA 1KFJA 1SU5A 3U4FA 1MVYA 1YXCA 2Z6IA 3L0NA 1I1XA 1VS1A 5FD0A 4GI8A 3WELA 3LTPA 4I7UA 4MIMA 3PZIA 2XIJA 5FCZA 1JCLA 2PDKA 3UZWA 3WQWA 3M6DA 5HNTA 3URAA 3WQFA 1V93A 2O4MA 1B0IA 1AJZA 3R79A 3VIMA 4LPCA 4AEOA 1BF2A 4DQWA 4HPJA 3CUXA 5F4WA 1VBUA 3BGAA 1VFOA 1BXCA 1Y7VA 1MQPA 4XD4A 1GHSA 5EMMA 4AD1A 3N9SA 4NQ1A 1NVMA 4KF1A 3L23A 1BSIA 4HU0A 2Y5EA 3W1TA 4ACYA 3KOZA 3B8UA 4L4MA 3HB9A 2C14A 4XAPA 3CWHA 2GJLA 1HTIA 1FH7A 3L4VA 1OY0A 4MWAB 2QCCA 5A3HA 4MPKA 4OV4A 1HP5A 8XIMA 4W89A 2Q02A 4KCTA 4XIAA 3NO3A 3VIHA 2P3EA 4ROQA 3RO6A 2GJPA 4Y9OA 4DWSA 5HQMA 3RPDA 4KRUA 4HNOA 1ZCCA 4NL1A 1NWRA 1VRDA 2Q3OA 3NA8A 2V2DA 4EX4A 5ABGA 1QOQA 1OX6A 4KRTA 4GI4A 3S5OA 4AIOA 3P61A 3U3HA 1E1CB 2YL8A 2PA6A 2OEKA 2XN2A 4KEUA 5A2AA 1S5WA 5M2FX 3CPUA 2ZC8A 4ZEPA 3HURA 2G97A 3TN3A 3DHUA 3RFAA 4H00A 1OINA 4M56A 3IIXA 1MXSA 3LD5A 3AIUA 1VR6A 4E5TA 1S5NA 1SJCA 5HR6A 2DORA 1EGZA 4FO4A 8RUCA 3C2VA 4KW2A 2VFHA 3E6EA 5E6ZA 1RV8A 5D9NA 4P7NA 2EG6A 2QUMA 2JEPA 4W86A 2TSYA 1GVFA 1T96A 1MXGA 1GQJA 5A8GA 2CWXA 1VD6A 4JNYA 3TYAA 4O1EA 4FXRA 4UCFA 1C8QA 4LYKA 1TPVA 3QGKC 2VR5A 3NQMA 3W1XA 4UTKA 2VM8A 3TAKA 2VX4A 3BH4A 4DZAA 3ARTA 1UA7A 3PZMA 3I3DA 4BEUA 4CQ9A 2QNEA 1LWJA 2X0YA 3GO2A 4HA0A 4ZQOA 1J2BA 3QY8A 1KRCC 4QE5A 5LA2A 5IDZA 3A4AA 1R86A 3BARA 4IQLA 3MHUA 1U30A 4LB3A 3PF3A 3SAZA 5H2ZA 4HPNA 4N6EA 4AY8A 3UY8A 3PUOA 4DO6A 4H6QA 1EB3A 1QPQA 2BOFX 2CFFA 2PI6A 3VPLA 5D2WA 2I5QA 5BNKA 3NDOA 4LTSA 1NH6A 3WENA 4O4VA 1T6MA 7TAAA 1RJRA 1M7JA 1RUSA 4GO8A 3FV9A 4DJFA 3ARYA 1H7WA 4AIEA 4R53A 4C7FA 3UW6A 2WHLA 2VR4A 2AGKA 4KFOA 4H7CA 4GBDA 2ZDSA 1P0BA 1IT8A 2YGYA 3PZVA 2OKOA 2PFHA 1Q8JA 1F6YA 1KV8A 3QMTA 3D5HA 1L6SA 2PU0A 3E3HA 3RO8A 3LMYA 1QO5A 1Q6LA 3RXZA 3CQ0A 3UJFA 4DELA 4GG9A 3NVTA 1LJYA 3TX9A 1WBHA 4PTDA 1G94A 4LVDA 2YA1A 3P5ZA 3QYSA 3LHYA 4ZL1A 3VMPA 3RYSA 2P5NA 3N4EA 3STPA 2R1LA 5I3IA 3BQ6A 2XU2A 4O1BA 3LB0A 3O6CA 4PYSA 4R7JA 4A6GA 3T40A 2V6AA 1SGJA 3W2UA 4K1GA 1VYRA 1OABA 1RP9A 2EQDA 3HM7A 3OB8A 3W9ZA 2OT0A 3UXIA 5D30A 2E77A 4AEFA 5BU6A 3BXWA 4JTIA 4D1IA 4HIBA 1M6JA 2PLCA 1LQAA 1Q2SA 4H9VA 3QFWA 1Z7AA 5HATA 1FHDA 4DO5A 2WCAA 4CNUA 1XH1A 1LWIA 1LLZA 3GVGA 3QSTA 1XLLA 2ABAA 4JTTA 4AZ7A 2DQWA 2P10A 2J27A 1SJBA 7CGTA 3P0WA 3S9IA 2TAAA 2VFDA 1E55A 2R82A 4RJEA 2WBGA 5I79A 2H8XA 3ARVA 4JQ4A 4EXQA 3VINA 3HPZA 4J2PA 4O13A 4AZIA 4JAWA 4LUSB 1YDVA 5DANA 4AHPA 3WDQA 1V3MA 1VFTA 5EPDA 4IG2A 3KP1A 3NYDA 3KWSA 1K02A 3WQVA 2CKSA 4JN6A 4RNHA 3FHAA 3QYQA 5C2CA 4UQCA 2XDFA 3AJXA 3V1HA 3FY1A 4HN4A 2QCNA 3GXIA 1V6TA 1D7FA 4JDBA 3LUTA 3TOPA 1ME8A 3MUAA 1OFEA 1Q6OA 2WJZA 4UQAA 1XDJA 1AH4A 1GVRA 1NAL1 3MUZ1 4NZFA 1H7RA 1OCBA 2VC5A 2O9RA 2PTXA 4G6CA 4H8UA 1AA1B 3VOIA 1FXPA 4ZXLA 1H0IA 3PVFA 3B0UX 1XLCA 3NCOA 3ONCA 4KESA 3H2MA 2YOCA 3LXBA 5C0QA 3PK7A 3DDMA 5D9PA 3AHXA 4H6RA 2WQDA 1CLXA 1EQPA 3W2KA 3S1GA 3B3DA 3K1GA 2AAMA 4XISA 2PDXA 4PMUA 3TU9A 1ADOA 2PTZA 6XIAA 3OOQA 4K1WA 1F76A 1F5ZA 5BRPA 2Q8ZA 4PTNA 3CM4A 4RPPA 4NJHA 4S3AA 2PDBA 4A2RA 2NT1A 1DHPA 1UUOA 3H21A 1PYFA 3RPMA 3W1MA 6PTDA 1XBZA 3OVQA 2VRJA 2VP8A 5KINA 4HNCA 2G5WA 1LF1A 4UTWC 3UESA 3R11A 5AC6A 1XBXA 2PURA 1RVGA 3H2FA 1QHPA 2E6DA 1HKVA 3PSWA 4PC8A 5KITA 3LEPA 1XDMA 4GZJA 1UR3M 4RCXA 3NEVA 2XGIA 1YNYA 2Z2UA 4S3KA 1KM4A 3DN5A 4HGXA 3JRKA 4Y9PA 1RCOB 1W1A1 2JFEX 2Q01A 2PBOA 4I9TA 2AQWA 1JZ3A 3BMWA 1E73M 2GGEA 1VFLA 3IJ8A 3GNNA 3ATYA 3KXQA 4DI8A 3VKDA 1BSLA 2GQ8A 4C6EA 2J88A 2BTMA 5HINA 4AC7C 1TPH1 3D3AA 3SCWA 3M0VA 1RY0A 3EWYA 8A3HA 2P0IA 5AHLA 1KXVA 5BWAA 1OFAA 3QMRA 3V0TA 3U6WA 2HE5A 4FI4A 3H4WA 3DFQA 1UWTA 1F6PA 3W29A 1Q7QA 2RHGA 3FA5A 1ISXA 3NM3A 3LHUA 2X09A 2G95A 4IP7A 5IBXA 3T4WA 2A2IA 4KFPA 1HJQA 4LS1A 1WZAA 3UD6A 2GGIA 5IM51 2QUUA 5D03A 2GJXA 2Z1KA 2Z25A 3I6EA 4UOQA 5REQA 4BJHA 4O0ZA 2QDDA 1GKPA 5DMMA 4D6DA 3QLLA 3WH9A 4BY3A 4JCMA 2R94A 4AYGA 5A8QA 1ZFJA 1PZ0A 3TN4A 3T6CA 3N2CA 2WLYA 2ZZ2A 5JIWA 2BXZA 5FEWA 1EFZA 1BKHA 4D1JA 1MI3A 2CITA 2QCEA 1H0GA 4W7WA 1MO0A 1IYXA 4HZ8A 4UTIA 2HS8A 1SJDA 5KTLA 1E3XA 3MZNA 4JHZA 3ARXA 3KRSA 1ZRQA 2PDMA 4W8BA 1VFMA 3I6TA 1IV8A 2OYMA 3R58A 4ZBCA 1QJWA 3WJWA 2ZZ4A 4IL2A 1R3RA 3UBPC 4S38A 3PTQA 2H9AB 4ZFMA 4X2PA 5E0KA 3BVJA 1XUUA 4NZJA 3LCFA 3G0SA 1AODA 4EF8A 2B81A 1EL3A 3AXIA 4O10A 3S2MA 1WV2A 3ITLA 1S39A 4DZIA 2CYGA 2V5LA 1RXOB 3N25A 1MEIA 3CGTA 2J7DA 4TVCA 3AC0A 3KLKA 1JR1A 3VCRA 1BQGA 4GQRA 4YHEA 4PRTA 3W87A 5AHNA 4M5PA 2CLFA 2F2KA 4YWSA 2QW5A 4HHPA 4WJ8A 3LN3A 1YEYA 4IUGA 3KE0A 4DPPA 1UWQA 1TWIA 4FX7A 4AWEA 2A3BA 1I6NA 2FZMA 1OK4A 2ZIDA 1P0KA 1T7LA 4MKNA 1PZ1A 1IWPA 1CCWB 1YNPA 3FAXA 3MSYA 1DJYA 4CVUA 1HJUA 4J3XA 1XIEA 4J3WA 1XS2A 3QZEA 3SN4A 3SEPA 1XIDA 1V6XA 1DXEA 3FSTA 1NM9A 3II1A 2OOFA 4C6MA 1XLIA 2X42A 3CLWA 2QCDA 1A47A 1W2PA 2C0AA 1FWNA 1FXQA 4ROPA 4ZB0A 1J6OA 2V5DA 2E9MA 4UTLA 1IE7C 3HPSA 2ZXAA 3B9NA 2PD5A 1CGYA 3LNPA 3EB2A 5KETA 5BYWA 1CGVA 1UWSA 3VIKA 1X96A 4A8NA 4HD5A 3S9ZA 3WF3A 2O55A 4GH1A 5DX7A 5D9MA 4QQUA 3M0ZA 4CLMA 1DWJM 1LYXA 1YBQB 2F6KA 4GRSA 4PMOA 1VBGA 4QEHA 4ALDA 3UA3A 1PHWA 3WJZA 4O0QA 3T0CA 4UFJA 3WH5A 2XGBA 1NF0A 3N6QA 1B3OA 4X0NA 3QHOA 3KS6A 1FWWA 4J40A 3NQAA 4JNMA 2DW7A 2OZ8A 4JS3A 2DY3A 1T8XA 4YTQA 1VIWA 1ZQ5A 4PSPA 4UTTC 4Q8MA 4DI9A 3C2RA 2QV4A 4C1LA 4C5ZA 3AROA 4A3QA 1QAPA 2XVLA 3WD4A 1LRNA 4I8DA 3CIVA 1BGGA 5JIPA 2BXVA 4ACZA 1VC4A 1R85A 4HPGA 4JL2A 3ANYA 2Y8UA 1DQUA 2GGHA 4WJEA 1XIHA 4ORMA 3SRKA 4L9XA 1HG3A 4OBTA 4FIRA 5HMSA 4EACA 4NZ1A 4XBJA 4DBUA 1HL9A 1HF6A 5JH1A 1ZGDA 2DZVA 3E0WA 1W6TA 4F3HA 1RR2A 5I23A 2GPTA 3SUVA 1R3QA 4K37A 3B05A 3W02A 1N8FA 3ZJ6A 3EPMA 1UBPC 2PPGA 3B8TA 4XX6A 2DDXA 3LZ3A 4DJDD 7XIMA 3AIWA 2HVOA 2V38A 3N2OA 3W7LA 1ML1A 4GKTA 4GY0A 1EP1A 2WNQA 2EEXA 2MANA 1XINA 4P8UA 3RX2A 3CK5A 1H7XA 1VAHA 1IWBA 3EBVA 1US2A 4MKVA 1XLAA 1F3EA 1R6WA 3GB6A 2E5DA 1W17A 4W8LA 3Q67A 4DYJA 3R8RA 6ALDA 1Q6RA 4FX6M 3OW1A 4NXKA 2IXVA 2ZA3A 4JFTA 2PODA 4LSBA 1TRDA 5CC5A 2YCIX 3HGJA 1WYIA 1R5YA 1LBLA 1HKWA 2CZ5A 3BCFA 3P8IA 4PCPA 1DJIA 1WXJA 2ZVRA 2BXYA 2GL5A 3NGFA 3I7QA 3TQPA 3DYPA 1FKXA 1G4SA 1V6YA 4FA3A 1FCVA 3UJSA 1XUZA 1JCNA 2X16A 3SJNA 4WJXA 3SUUA 1XIGA 4H9YA 1OIFA 1XYZA 2OZ3A 2QJGA 1DJZA 1QBBA 2YXOA 1NJJA 2F2HA 3ABQA 3IJ7A 4GIEA 2QCHA 2C7FA 3P84A 3TCSA 3LV6A 4KIEA 2JALA 3GC4A 4IF2A 2QUVA 3AWNA 1YE6A 2PAJA 2VMFA 4H41A 1Q6GA 1ZENA 2C6QA 2PDWA 1EBGA 4WDTA 1DXFA 1PE1A 1B90A 1UHVA 3A24A 2I14A 3VMNA 4J28A 4D8LA 4KEMA 5A8PA 1SMDA 3MO7A 4EXAA 1H63A 3EEGA 3ZZ1A 3QR0A 3K30A 4JTDA 3DG6A 5DMLA 3FFSA 1JYNA 5FAGA 3K8LA 1FDJA 1KFWA 3KFTA 2YLAA 2NQHA 1KQYA 4A22A 2RUSA 1Z42A 3E5PA 3KZSA 4KWOA 3AHTA 4IFOA 1VFUA 3SRHA 3T0TA 1KBIA 2Z7GA 4GCAA 4RPQA 1F8MA 1EZ2A 2YW3A 1EJXC 2XH4A 2D24A 5I03A 5I5RA 2Z6JA 1W1TA 2XUCA 3WBXA 5FI8A 3RRAA 1DE6A 1YE4A 3KWXA 4JTGA 5KEZA 4TVDA 4LC6A 2RH9A 1GTHA 3FGCA 1XLDA 4ZOEA 3AU6A 3H2EA 3ARUA 5DRCA 1OK6A 3SSJA 3A9IA 1HKMA 3QEZA 1TG7A 1B31A 3FIGA 4H9UA 4UBPC 4KWSA 3W1PA 4TVUA 4TIMA 3SQLA 3QJAA 1P1XA 2XHYA 3BV4A 1Z8AA 2QAPA 3RR4A 3MHGA 4KETA 3U9IA 3L0KA 3W7JA 4EPDC 4PL2A 2QCFA 2V2HA 4DWSC 3I3EA 3O0KA 1ZBWA 4OBSA 2VCAA 2ZUMA 3LGEA 3PM6A 3GD6A 4DUVA 2FZ8A 2UY2A 3UGRA 1LL7A 5ECVA 3WLSA 5CSYA 3WDJA 2VL4A 1IQ8A 1KR1A 1UH4A 3AJ7A 4S1FA 4PCSA 4GNJA 3ZJ7A 3W7HA 2ESCA 1ENUA 3RLGA 4RUBA 2WHJA 1V0MA 1TMQA 3WMBA 4R34A 1A0DA 3RLHA 1MW2A 1ZBVA 1A49A 1KBLA 2QULA 2ZZ5A 3B40A 1DORA 1OX4A 4LYRA 5FEZA 3UCQA 2BHUA 3F4CA 1A5BA 4IXHA 2DT0A 3IRDA 5FSDC 3E49A 1F3TA 5BCAA 3LHTA 2QJHA 3W1UA 2EXOA 3NO1A 4G7EA 1WOAA 4GNKB 1SMAA 1TR9A 1SFJA 1GZGA 1YTEA 5H8UA 3TYCA 3G6MA 2ISVA 1TWDA 3PY2A 3C86A 2E3ZA 1X39A 4KCUA 4RE2A 3LCIA 1XIFA 3AMGA 3SURA 1ZSXA 2Y5SA 4LQ1A 3H2CA 4C6CA 4PUEA 1AJ2A 4QAIA 1Q7ZA 2ATSA 1XQKA 2NQ5A 3UU0A 3GU2A 4HA4A 4GFIA 2PLMA 4LVBA 1J9YA 4ILSA 1JQXA 5C5YA 1EA0A 4W87A 5DF0A 3OHIA 3V35A 2I17A 1H2JA 1C9DA 4ZENA 4ZQMA 3E2QA 4IPNB 4DJEA 3N1AA 1PIFA 3U57A 3CV2A 3RR1A 3U5YA 3S4TA 4I7WA 1UUQA 4N4PA 1EYWA 1WE5A 3BC9A 4BWLA 1SZEA 1E0VA 2GVEA 3CZKA 3WDIA 1GQIA 2JGQA 1VLIA 5CGMA 3C8FA 3UWEA 2DVUA 3PPCA 3L5MA 1MFUA 3ITVA 1EUNA 2WKJA 2WV8A 3GAKA 3M46A 5CJNA 4AU0A 3OIXA 3HG3A 5A6BA 2QF7A 1W1B1 4BCEA 4IG2B 2VVNA 4AMAA 4MGGA 3VNYA 1CGUA 2OZTA 3BURA 2RDTA 2W91A 3DGBA 3W74A 1ZHAA 4PMNA 3ES7A 4M3PA 1EOKA 2YXGA 3IUIA 2WMGA 1ADSA 3KHDA 2XVPA 2AKZA 3QHNA 4NIRA 5CAKA 4R33A 3CQKA 1DIEA 4MMWA 1GZJA 4ZA0A 3U8GA 4BQ4A 4HVXA 5EB8A 2C71A 2FTPA 1TJ0A 1W5NA 2IQ0A 1UMLA 3SM0A 2ISDA 4B3ZA 1Q7MA 4DF2A 5DMYA 2ZX9A 4WKHA 3VZYA 2G3IA 1GVOA 3GXMA 3REQB 2CZVA 2NQZA 4IZGA 1Q3NA 4C6BA 4NX0A 3LG3A 3QHMA 3VK5A 1YIXA 5D9OA 1TPFA 1VLWA 3GDTA 4XO6A 3K4WA 3BZGA 4D9PA 2ADAA 2VUYA 3AO0A 1K7XA 3BCDA 3W53A 4E6MA 2G3FA 4GCXA 4ICMA 3KCOA 4DHGA 5A6KA 1GEQA 2POTA 4UUIA 2W4XA 1E4NA 2D3NA 3TWBA 4NY2A 1WQ5A 4AW7A 3M1ZA 3W85A 3ZT5A 1VGAA 3F1QA 5AC4A 2VZUA 1NEYA 4OQVA 3QQWA 4NZ3A 2Z2BA 4MG4A 3O16A 3TTSA 1XYFA 4C7GA 1QWKA 1XYBA 5I02A 3GZAA 3WFAA 4Q7IA 2WC4A 3LHZA 3I4KA 4AZ6A 4UXDA 2FQIA 3TE9A 3EDJA 1AZ2A 4C6LA 3O6AA 1F4AA 4OOUA 3LRLA 3OYZA 3QFEA 4QTGA 3DG7A 2VFFA 4B16A 2I7GA 4FSAA 1HN1A 4QFUA 5BXPA 1H41A 3IAPA 5FIPA 2DZXA 1V03A 1XC4A 4W88A 1RVKA 5EBAA 5J5RA 4O8RA 4JX4A 3NZGA 2XVNA 1TE1A 3BO9A 1B4KA 1L2UA 3SGGA 3E9AA 3WJSA 1ITXA 2J8GA 2PDYA 3HG4A 4LS2A 1CI1A 1CDGA 1TUXA 3VO0A 2VZVA 3G1YA 1TPB1 2VJXA 4XKYB 5FF3A 4N9CA 5DT7A 3THQA 3UR2A 1SR9A 1YPXA 4M82A 5K3VA 3TEVA 1TA3A 3L4ZA 4ICNA 3RM8A 5E9XA 1EXBA 2OODA 4MYAA 1I4NA 1QPOA 2DGAA 1WAWA 2QGHA 3P6LA 4MDPA 3I7SA 2HK0A 3VDBA 1V3IA 3D3FA 3MANA 4UTFA 3ITOA 4P7LA 3TONA 3LCHA 3SGZA 4PMZA 3HIJA 1JFXA 3BLPX 2NT0A 3M0MA 4IT1A 2Y1HA 1OEPA 4L65A 5C8BB 2OU4A 1EEPA 2GVYA 1HFBA 5FEPA 1BFNA 1O5RA 1TTPA 2PWDA 3GDLA 1TTIA 2BNJA 3KRUA 3W7EA 1UR2A 4AZBA 2A3EA 3VDGA 3WNOA 1V02A 3LNMA 3NDZA 3SFWA 2GJXB 1XIMA 2FMNA 3WL1A 4DBSA 4JR5A 3WMLA 5FJIA 4DYEA 3USZA 3PZ9A 4WRHA 4X60A 3ZJ8A 3GUWA 4CNTA 1G67A 4KGLA 3R13A 1ZJIA 4U3AA 3WD0A 1KXHA 1SO3A 3WFZA 1FTXA 2Z7KA 3ABSA 1E6XM 4HK5A 1VJZA 3NFUA 3F2CA 3WDRA 5HDRA 1FHUA 2QDHA 4NYUA 4ZQPA 2FZBA 4IM4A 3NURA 4EVZA 4AG0A 4W5UA 1AMKA 4GQBA 1JL8A 2DUXA 1V51A 1E0XA 2FMOA 4LB4A 4PTVA 3EX6A 1V0NA 1QU4A 4QS5A 1EH9A 5I24A 3G3MA 1C7SA 3AUJA 5EMUA 3OVRA 4NI3A 2ACUA 4GABA 5CPQA 3VE7A 2X1RA 4J7RA 4IMCA 4P8WA 3LTSA 1POJA 3EA1A 4QE1A 3O6DA 2IKHA 3RG6A 4DPQA 4Z2IA 4GIAA 4QCFA 2D2JA 4HNVA 4JQ3A 1YDOA 1XR2A 3T09A 4I90A 2HWGA 3IGHX 3VNJA 1KWKA 2DP3A 4FAMA 3C2EA 1QCWA 1SZRA 3WG6A 2FKPA 1H09A 3CUGA 2Z28A 5IBXC 2A1YA 3INPA 1GORA 2QIIA 4O1DA 2OQHA 5HQEA 1W5OA 3FXYA 1R38A 2PBGA 4U3CA 1JDDA 3TJ4A 3RX4A 4IL0A 3NPWA 5DY2A 1M1BA 1W1ZA 1JF5A 2XPKA 4MFDA 1L0PA 4DZHA 2JE8A 2BHZA 2ZZ6A 2UY4A 1JPMA 1PTGA 4L6OA 1SM9A 3EGJA 4XD5A 2ZDRA 4J3SA 1OVDA 2OMAA 1MEHA 1WDDA 4N4QA 1WKEA 1FBAA 2G3MA 2QCDB 3ZS4A 4CQDA 3QV8A 3DC8A 3PP7A 2EPKX 1VEMA 5LNWA 5HJYA 2C3ZA 4Q8VA 4EF9A 1DIKA 4LCRA 3AWOA 3W2JA 3MCOA 2BY1A 3GNPA 1ZZMA 1PDZA 5LNUA 3O06A 1CENA 4DWSD 3VKAA 1UWIA 1KFKA 5CEWA 3BOXA 3F5KA 3NZPA 3V3WA 3NSMA 2J9ZA 1FWFC 3HOJA 3NPXA 1F4HA 1JXKA 3EXTA 1CEOA 3BAJA 3ALFA 4FP1A 4AY1A 3HQ1A 1UUMA 2JIEA 3NZ1A 1CB7B 4AQLA 4JEQA 3HV8A 3WK1A 2NVCA 2QKFA 2VEIA 1WCGA 3S1XA 4AISA 5SWUA 4JCLA 2X1TA 2FDSA 4YLWA 4PMXA 3T8QA 3PTKA 3BTNA 1BRLA 1TVNA 3W4RA 3VNDA 4EOUA 2CWNA 3WEOA 3YPIA 3W6YA 4HMEA 1JCMP 3ATZA 2EHHA 4MDOA 4C5YA 2OLSA 1BYAA 2PWVA 1Q5MA 1GPFA 5CLWA 3DYMA 4TTUA 5CZKA 5K7JA 1UYQA 1V3KA 4IGSA 5IFPA 4J3TA 1EPXA 2PF0A 5BZAA 3VM7A 2R9RA 1XIJA 5F1UA 3UJRA 3C0SA 3HF3A 3LI0A 1JGIA 1UASA 5F4XA 5I3GA 3LCLA 3MBDA 2YBUA 2RDXA 1ECEA 4X63A 5HMEA 3SY5A 3L4WA 2VEKA 6REQA 3MQTA 1FWBC 2V81A 1A4MA 3TYUA 1P7TA 4H9ZA 5AN7A 3WQEA 1TTQA 3THDA 1UIOA 4ZODA 1O95A 1V5XA 2EPOA 2G3NA 1WB0A 3RITA 4ZE5A 4GUFA 3N3TA 1R3TA 3VIPA 1I1WA 4WXYA 2ZTJA 3EMCA 4KCWA 4CN4A 1Z6KA 3RGTA 4QG9A 2CXGA 3BAYA 3STCA 1MXDA 4JYDA 2CW6A 2WJFA 1OFOA 4JKLA 2DQXA 3JW7A 1YADA 1GOIA 1X38A 1PO9A 3EWUA 2WMJA 4LX4A 2GUYA 3EOEA 1W3LA 3LZ5A 1JI1A 3GG1A 5H91A 4ZO7A 3K13A 3EWWA 1K6AA 2ZRXA 3G0UA 1T8QA 1ZJAA 5RUBA 3NQ6A 1BKSA 4DXXA 5E0FA 4B5XA 1B3XA 3EMQA 3IWPA 2J62A 1O7AA 3DERA 2AGTA 4IP5A 1LQ0A 3AI0A 3CB8A 4BF5A 1Z41A 3K46A 5E9AA 1CXIA 2VC9A 4QJ4B 4RXGA 4B9ZA 1EP3A 1LTDA 4FNUA 2A0NA 1UD4A 3BOLA 2TYSA 4XK2A 3LQGA 4G8TA 5G1TA 2RKXA 3KS5A 1TWSA 3OEXA 3WLOA 4GYPC 3WSUA 2GQ9A 1D3CA 4M1BA 3PHAA 1ZPTA 3HPXA 2VDHA 3GBDA 1YLVA 3LXAA 5LA1A 2OQYA 3S46A 4PUJA 1A3HA 2YBVA 3MSRA 4Y96A 3AUOA 4MAZA 4LV4A 2A3LA 2NUYA 3PPFA 2V67A 2CKRA 1UZ4A 5EMKA 5HMFA 3TN5A 4XZNX 4MWAA 3VZZA 1H1NA 3CMGA 3KTXA 4LF1A 4S23A 1ZU8A 2A4AA 1WNOA 3APGA 2XINA 2VT0A 1REQB 2RFGA 4JQAA 4ZTXA 3HA1A 1VRXA 1G4PA 2VYOA 3WH8A 1W1YA 4WEVX 4V1YA 1KKOA 4V33A 2VGGA 3WJXA 6CGTA 4E4PA 3JU2A 3TIMA 3K8MA 3IPWA 4MB5A 3VD5A 3GTIA 2ZX8A 1C3FA 5LYRA 1TCDA 1UZ1A 1DQXA 3MVTA 4HYVA 2I16A 4ZB2A 2PLJA 4QJ3B 3TWAA 1ONXA 1NIUA 5IRPA 2WVSA 1LBFA 1IXQA 4RL3A 1YHTA 1PKMA 4Q32A 5EMYA 4IIDA 3KW3A 3GX9A 4F8XA 3MDWA 2TMDA 2YFOA 5BWFA 4XVEA 2PE4A 3T07A 3RMJA 1SPQA 3G1VA 4E2VA 2XH2A 5I3DA 1X6LA 3FDKA 1VIZA 2W6RA 3WNNA 3GXDA 3UZYA 5LHFA 2J8TA 1UCWA 4AVFA 4C6OA 4X0VA 3VDHA 4GC4A 3OJGA 3V5OA 1DJXA 3TYZA 1W8GA 2OSWA 4RKAA 2YCEA 2CXEA 1QTWA 1W54A 3KDNA 1ICPA 3JZUA 2NQ9A 3E0LA 1EQCA 4CEUC 5KMYA 1K9FA 5CJ5A 2V3EA 3WEZA 1NWSA 4NNCA 3VKBA 2WSRA 1ISVA 3K1DA 4NRSA 2NV1A 3VX1A 2YDRA 1IIHA 3WDPP 2I9EA 5LNRA 3CASA 2VRKA 5D09A 4UB9A 4C7DA 4ZXOA 1EC8A 4JZ5A 4S3DA 3MC5A 4G7EB 4M6VA 3NQFA 3LRMA 2QMJA 1H7OA 2D69A 2IKGA 3H2OA 3WBWA 3MI3A 4FS9A 3BANA 3B8IA 3V0SA 2G41A 1R9YA 3WQ6A 5BOEA 3AS3A 3LCGA 1S2AA 3DFOA 3S2CA 1FWHC 4E3TA 5DBUA 1JXJA 1CZ1A 5L9FA 4R9OA 3V4BA 1WBJA 4LV9A 3PZNA 3QOMA 2NVDA 1BAGA 5D33A 1KM6A 1V02E 3CTLA 5TIMA 3VMOA 3UCCA 5KSWA 2CLOA 3VU2A 5FESA 3A4XA 2VEFA 3M16A 4IQJA 3GXPA 4RZ5A 1DJHA 5HBFA 2C1HA 3STEA 3F4VA 3WBAA 3UXAA 2JF6A 4S2BA 3TVAA 3L5AA 4HHMA 3MPGA 1EDQA 3EOUA 4HTBA 1IR2A 5E93A 3TW6A 3GRIA 4GH3A 2OGJA 4FLQA 3SN1A 9CGTA 1KXTA 1F05A 2O7QA 2DSVA 3BJSA 3IK2A 4XB3A 3E12A 5BMXA 3GC2A 3SQSA 1O60A 3UWUA 2DVTA 1NOFA 3DU0A 4ICCX 3C2YA 2OO0A 2R1PA 5JUVA 2FLIA 4V2XA 1KGWA 2FPVA 3PB2A 4TMCA 1G69A 2AAAA 1OM0A 1XHGA 2C8NA 2H3DA 5I0DA 1JAKA 1GVYA 1F2JA 4WLCA 2AOSA 3ARQA 2Z1XA 1TUFA 1MW3A 3MV11 4JQ1A 2VZTA 4OJYA 2IXUA 4NI8A 5CZ0A 4PMYA 8TIMA 2GWGA 3WUGA 2QJJA 1KFEA 2ZRZA 3MWAA 1TZ9A 3DUGA 2Z29A 4IWWA 1KGUA 1VYPX 3IJIA 4F2TA 5CBJA 3UP8A 4GBUA 7PTDA 4GJJA 4WQ6A 3VE9A 4PB3A 3GR4A 3MUCA 5FJRA 3HGRA 2QYGA 3S8HA 4KGJA 1FFQA 3PANA 8XIAA 1TFVA 1FY6A 1JVNA 4N2YA 4Q8WA 3MUIA 4QEEA 4E3VA 1Z48A 4GJIA 2FFCA 2VCCA 3EWDA 3G0XA 3VNZA 4UTMA 1S1PA 1PUDA 1P5BA 2NLYA 3NL3A 3RDKA 4FXJA 2V5KA 1TX0A 2H3BA 3ZR5A 3VGGA 1TVPA 4IIBA 2E1WA 3B06A 1R30A 4YCOA 2NW0A 5AHFA 4MB4A 1OX5A 3GDRA 3VDCA 4GISA 1BG9A 1JYXA 1LZOA 1GCYA 4GYKA 1A5MC 2CBVA 4BWLC 5CSRA 4O15A 3LSCA 1VH7A 1ALDA 2JIWA 5BXRA 1NDZA 3S42A 1EA9C 4B9YA 1AL7A 3TJIA 1RCXB 1UZHA 2ISSA 3WIJA 4DBDA 3N13A 2VXNA 1BWKA 2GK1A 4XD6A 2G8ZA 2D3LA 4C1KA 1Q6DA 1UKPA 1VCGA 3FCPA 1DWFM 3AZTA 3I10A 4U4MA 3CO4A 4CQCA 5FKYA 4MKSA 3W82A 5C9UA 1K8CA 3N4FA 4HN8A 5I77A 1XXXA 4LY8A 4QXIA 3PJWA 2Q8LA 3B8WA 1YPIA 3A22A 3NAVA 3PG9A 1PVNA 4Z1DA 3SQMA 4LUTA 3T0DA 1TYGA 2W79A 4O8AA 3H7VA 3O9NA 1FCBA 1PKLA 4OTKA 3QV9A 4K7VA 3HGSA 4C6DA 3W70A 1IXPA 1DTNA 4JICA 1DKWA 2VNCA 2WZIA 3N6JA 2EG8A 1U5VA 2QMKA 3PPHA 1SW3A 1MUCA 1H1YA 4DM2A 4D6FA 5HANA 3GNRA 2PZNA 3FYOA 1DV7A 3S83A 4PE8A 3RM9A 3VGDA 1UD2A 1KQZA 5I3FA 3TMLA 1MRQA 1BTCA 3W01A 2IKIA 3WMCA 2Q09A 3AIRA 1XV8A 4XZMX 2BY2A 4FALA 3H8AA 1AQFA 1OF8A 2WNNA 2PRHA 3CUFA 3PN8A 5AHIA 3GY1A 2PTWA 3BDKA 3MY9A 1XYLA 3AYRA 4FLOA 3W28A 2ZUNA 1XQLA 4MZ8A 1TZ7A 3ALGA 2QT3A 1HIZA 3W7KA 3KBNA 1AZ1A 2DPEA 1IGWA 3F4NA 3P8JA 5A1AA 4P7RA 3IIPA 3F2BA 4QSFA 2XWDA 1DIDA 1A5CA 2NQLA 4JGDA 1BWLA 4I5RA 4Q7NA 1X1OA 1RPKA 4NJKA 1G5AA 3NJ3A 5FF2A 3CV1A 1H3GA 1UKTA 2ZE0A 4QSHA 3T44A 4QE4A 3DBNA 2IUZA 2PGWA 4NNAA 4UZUA 2WANA 2D20A 1PTDA 4QCEA 3AXMA 2PGRA 1UKOA 2WHKA 4YPJA 2GSJA 5AHMA 4RXFA 1HUVA 3RILA 1JZ8A 4IMFA 4GINA 4UR9A 5I3JA 3UR8A 4JX5A 1XPYA 1WDPA 3H12A 4Q33A 2NXGA 1H5YA 3BE7A 4TU1A 2GJNA 4BZYA 4EE9A 3QXBA 2FJKA 2BOGX 4NNBA 1TJRA 1EUAA 1XD1A 3W72A 3M7WA 5F2IA 2NSOA 3FJ6A 4UNIA 3OGSA 1I2QA 1XX1A 4H6KA 3IJ6A 3WLKX 4C6IA 5TQLA 1XI3A 3Q45A 4N9EA 1Z69A 2VWSA 3CNYA 2WWDA 3QKEA 3SN0A 3QZAA 3RU6A 2XN1A 3VKCA 3CWOX 2EPMX 3FNDA 2O0TA 3T4CA 2XTKA 1TE6A 4JY9A 1ADDA 2UZ9A 1WXZA 1EIXA 4FNRA 3B8VA 4BK9A 2WNWA 2OR2A 2QUNA 1ISWA 1E1EA 4HCHA 4PUWA 1H49A 3VUSA 2Y0FA 3LQLA 1CXHA 4GZ7A 3OLGA 1W2VA 1I8JA 4O12A 4DB7A 1HW6A 4K8HA 4GYJA 3G1HA 2WC3A 1VFFA 2IPGA 2CHNA 3SUSA 4CCEA 4HZ7A 3W7DA 5G4HC 1EF2A 2E1DA 3QQ1A 3MJYA 3TA6A 1K9DA 2H9AA 4IH3A 2PWEA 2VCBA 4MB3A 1XC6A 4MWAE 5LSMA 2HBXA 4GI6A 3K5XA 4MY8A 1O68A 4KWWA 5DCDA 1FQ0A 5JBEA 4Y9MA 1HNYA 4L1WA 2OELA 2GQ3A 3DOPA 3E74A 3FSUA 1A5OC 3BW4A 4GY7A 4ML4A 2PWGA 5FJUA 1DWGM 1E6RA 1GEHA 4Q3MA 1JDFA 2VOTA 4BQ3A 2WKLA 1DVJA 7REQA 2FH8A 4ZFCA 4O54A 1JCXA 1A0CA 1I75A 1E9ZB 4GD0A 1L6FA 4JTAA 3TA9A 3FXGA 1LLOA 1CGWA 1MZRA 4DX3A 3AYVA 3GBEA 4P7QA 1J5SA 3WX7A 3NL5A 4NYYA 3W2NA 1UPMB 4TX8A 3N9KA 2ZZ3A 4B5SA 1BRLB 4M80A 1US3A 3QGAC 4PTXA 4A3YA 1HT6A 5AC7A 4HMDA 4U5IA 1ZP4A 4LS0A 2CPUA 4LBUA 1TV7A 3W7OA 1R7AA 3NDYA 4GWEA 3UYCA 1P0EA 3QM3A 2VDIA 4QS6A 4H9TA 1DBTA 2QAFA 4ZE4A 3GU1A 1S38A 1EOMA 2Q8XA 2PMQA 1GQKA 2HJPA 1QNRA 4XZWA 3AXHA 4Q4QA 4E2DA 3C3UA 4GUJA 1UW9A 1W8SA 4JIEA 3W1LA 3J7HA 3G2GA 4UWMA 2A3HA 2DZTA 5C7VA 1V7AA 3M5XA 3LRKA 4S3FA 3M5YA 1E70M 2PP0A 2LLEA 1H1ZA 1KCZA 3LA4A 3WEMA 3F5LA 3RJYA 1HKJA 3IGUA 5I06A 4EPKA 3L67A 5HPCA 4EPBC 4DBWA 2FHFA 2WO5A 2D2OA 2WVVB 3BJTA 5JH2A 1P7TB 3EDEA 3QC3A 4ERGA 3IK4A 1ZBCA 1M65A 3HV9A 5DCEA 4PBEA 4I3GA 1CXEA 5ABFB 3AHYA 2HXUA 2OG9A 3CO8A 2INFA 3H53A 5C55A 1A0EA 1UROA 2DSZA 2E5BA 1XLKA 2JK2A 5GJPA 5HJLA 1TELA 1UMYA 2YB1A 2C1IA 3ZR4A 2WOQA 3SO7A 4PCTA 4CUCA 1KFLA 1EJSC 3N9RA 3R89A 4OECA 5XIAA 2DVXA 3KBVA 2IW0A 4EAMA 2WYSA 4H1ZA 3CYVA 2PDUA 2XG9A 2OGYA 3TYDA 3FHQA 1C9WA 3MMUA 4LUJA 4K3ZA 1TIWA 3UG5A 1H51A 2V9DA 1LM1A 1XD0A 5FOOA 2C19A 3RIKA 1R7OA 9RUBA 3WDHA 4AZCA 4JDYA 4AD2A 5GJNA 1N8WA 2QVHA 4TV6A 4OGZA 2BBFA 2ZX7A 2YZ5A 1KTBA 2O7SA 3DFHA 5J8LA 1XCFA 1OJXA 3ME3A 3RM4A 3UCDA 1LG2A 1GOOA 1G4TA 3KBJA 3L65A 2XIIA 4WX2A 5GVJA 3BW3A 3TFXA 3GH5A 1CLKA 3F03K 3OU8A 3EWBX 2JEQA 3ABXA 4IIGA 1G01A 3VGEA 2PTYA 4GGBA 5JXQA 1W1PA 4LBRA 1SW0A 1XSKA 2O9TA 4O18A 4PBFA 4RE3A 2YDAA 3NXFA 5A5WA 3ZLGA 3W7IA 5TBOA 1TB3A 5JBFA 4HNUA 1PX3A 1UR4A 1WDRA 2WMKA 2ZRUA 3VOGA 5BXTA 1WAUA 4DJED 4IMGA 1UPPA 2PUZA 4P8XA 3AZRA 1B54A 1RHCA 4AIBA 1SYTA 4IMEA 4IICA 1E1FA 1G1YA 3DCPA 1C8XA 1XH2A 2OFJA 4LUYA 3PBYA 1XJBA 1J11A 4MADA 1YNQA 1VCFA 5T91A 3UVIA 4PN2A 4PBGA 4JIHA 2Y7EA 2OTDA 4BHYA 4KCVA 1QNOA 3BPWA 1TMLA 2ZXBA 2VI0A 3GDKA 2OKTA 2X2YA 5D32A 5JQ9A 1R47A 2G37A 1F73A 1GVIA 1O5KA 2WMHA 5LGZA 3S2JA 2FPTA 3ERPA 4TUFA 5A6MA 1EJWC 4XZLX 4B5WA 1F74A 2ZKMX 2P0OA 3TR9A 3DEQA 3OG3A 3RJXA 3B8DA 1FDZA 4HT3A 4JFVA 3N11A 3B0XA 2ZRYA 2DT2A 4DN1A 3VDAA 3GNXA 3UR7A 1EJTC 1EYEA 4IFRA 2PU1A 2YIHA 3CC1A 5M03A 4A3HA 4RX0A 1OBAA 1ODUA 3CZLA 4HSOA 1MDLA 2I5IA 3TTOA 4A3UA 3EXRA 1RAKA 4H2HA 1FKWA 5PTDA 4D6CA 4QG6A 1E6NA 1RA5A 4H3DA 2JKAA 2WW5A 5LIYX 3KHJA 3HN3A 3NTYA 2CHRA 1WDQA 2E5CA 1QHZA 1C8VA 4B5TA 1XICA 4MWAC 3LX9A 1GG1A 1PCKA 3L2MA 3CHEA 1IIGA 3CBWA 3E2SA 2PCQA 4DF1A 1U1UA 1LUCB 4JKKA 4D71A 3RPTA 4A21A 1JJKA 2PTDA 1OYBA 2CLLA 1J10A 3W71A 4Q4MA 5TAOA 3FLUA 4MB1A 3MT1A 4O11A 3MCNA 4GK8A 1L9WA 2ICSA 2BGSA 1PPIA 1HO1A 2E9LA 2DEPA 3AU2A 4AZHA 3G6LA 3NSNA 3PTMA 5E6YA 3BG9A 2FZNA 3CUIA 4LUIA 2CZFA 1YQ2A 2VQUA 3CHDA 4FEZA 4UR7A 1QW8A 3DFYA 5AC5A 2J7GA 1PB0A 3GC5A 1EF3A 1UQYA 3DXIA 2KAUC 3UG8A 4DIAA 1NQ6A 3WK3A 4PGLA 4K38A 1VHNA 1O4UA 3W6LA 4IIEA 3A3WA 4MPQA 1QI5A 1V79A 1XLJA 2JBMA 3Q65A 4Z1YA 4Q4PA 1OIMA 2BVTA 3S2LA 2E6FA 3GIQA 1YTDA 3HGOA 3VNIA 3WK0A 2W61A 5U4NA 2HPIA 3UXKA 3F4WA 3ARPA 4DNMA 3C6CA 3H23A 4YHGA 3M07A 5G4EA 3PJUA 3BG3A 1MFVA 3SZ8A 2GVLA 1BXNA 3EDFA 1Z44A 2YL5A 4RDYA 1R9XA 2VD9A 2VGFA 4M0XA 4UFIA 1GJPA 1FX6A 2GVGA 3NO5A 1BPLB 5BOFA 3U7BA 3ZO9A 2HZGA 5C54A 3CPGA 2I9UA 1GOXA 3ZLHA 3P82A 4OBRA 1TPUA 4DJDC 1JYWA 1T41A 2DZPA 2XVGA 1ZY9A 5F4SA 2BASA 2FHCA 3UEQA 4R9XA 2GDVA 4P8VA 3SB0A 3NXLA 3CMFA 2PDQA 3N14A 3UFYA 5E70A 4B5VA 3DBPA 2V82A 3SUWA 3UPBA 1P6BA 4C1NA 4YS1A 3MDUA 2A7PA 3G8RA 2Q71A 4PMDA 3CUZA 4MLJA 4XV0A 1BVWA 2X7VA 1NSJA 2E8YA 3N19B 2ONEA 4J9JA 3OQEA 2VELA 1SO6A 3W26A 1Z32X 4A8LA 5I3HA 1UJQA 1J79A 2WM1A 4JBRA 3BSHA 4AD0A 4IX0A 3VKJA 2QUTA 3JS3A 3A12A 1TVLA 1DWHM 4HHLA 3PUEA 3KVMA 1FOBA 2BS9A 2PWHA 4R7WA 4HA1A 3ICJA 4FOUA 1L2QA 2YCLA 1UR0A 3BJFA 3P5YA 4V15A 3TQVA 5BOOA 3PZOA 1VYSX 1NY1A 5A8OA 3WH7A 4AWSA 5A6JA 4QNEA 4X2RA 3APTA 3D6NA 3NUKA 3E2RA 2E09A 1K8ZA 3FVDA 5FF4A 2VX6A 2GK1B 2Z4GA 2ASHA 2F9RA 1M7XA 4WF7A 3RLUA 1F7BA 1Y65A 3ARZA 1Q45A 4IUOA 3WLLA 1MQRA 1OD0A 4DAFA 4KFNA 1CGTA 4FOKA 4UZSA 4GOAA 3SCOA 4PUUA 3OVPA 2IKJA 1ISZA 1XBYA 1W91A 3VCNA 5FJPA 3REQA 2AL2B 1NQKA 3GG7A 1EJ7L 1RY8A 4PMRA 3TSMA 3P80A 4CU7A 3T2QA 3H22A 1W32A 3ZOAA 3C61A 1PSCA 4KEZA 1CXKA 4AD3A 4NAFA 4LUTB 5G4WA 1U5HA 4MJMA 4YMZA 2XM1A 1H61A 3W7RA 4J3ZA 1U1JA 3UR5A 2XH7A 1J12A 4XUYA 5DLCA 4RLIA 1TRIA 2VTFA 2WSPA 1TV8A 3WLJA 1XIIA 2I5GA 4HCDA 3W6MA 4B91A 2XN0A 3ONBA 5CZSA 3PNUA 2D2GA 4O4WA 3ORWA 6TIMA 4XO7A 3UPWA 3TTYA 3BL3A 4C60A 2E68A 4DUXA 3VIIA 4RZ6A 3TH6A 2QJNA 4GIRA 1R87A 1PL9A 1J2WA 3PJTA 2QLYA 2ZXQA 1E4IA 1Q4WA 5GQBA 2XSAA 4X3ZA 4YYCA 2Y8VA 4FK9A 2GYIA 4GUHA 4NJIA 1SR0A 1CW2A 3OO2A 2ZWYA 2CLMA 3EXSA 2VHLA 2ZICA 2A6LA 3NQCA 3KOXA 2FIQA 3SCVA 3DGRA 1ONRA 4GMEA 5A95A 3SY1A 3CB3A 4E8DA 1V3JA 1MNZA 4NILA 4I9JA 4LEQA 4OWGA 3VCCA 1VZWA 5FA5A 3IAQA 3PULA 4C6QA 4FXSA 1BYCA 3P67A 3LENA 4XKYA 2X0SA 1BVNP 1CGXA 4W7UA 5HNUA 2Y24A 4TR9A 1QDSA 3ZLFA 5EL1A 3M0LA 2WVUA 3S5YA 1KO0A 3TV8A 1RQBA 2PSNA 4JTCA 5AYYA 1O5XA 4IXXA 4CVWA 1A3WA 3QTGA 5HWNA 1DEDA 5CQ1A 3HG2A 1M03A 2WMFA 2DZWA 2REQB 3U2EA 4Z17A 4UFHA 2OOGA 2YL6A 5LZLA 2XIMA 4HA3A 4BF7A 1O6IA 4LNYA 2XFFA 1YRRA 2OVLA 1KRAC 3OGVA 3W1NA 4JTLA 1VPQA 3N2BA 4NU7A 1XPGA 3W22A 3UQNA 2Q3RA 1RSCA 4WSJA 3N6HA 1AD4A 5ABEA 4UTJA 3DFSA 4CEXC 4XSMA 2OYKA 4D72A 1ONWA 2DZUA 2AQVA 3UWWA 2J7BA 4M6QA 4WOZA 1W9PA 1QMLA 2VWTA 5FAJA 2CZEA 4B3LA 3TP4A 2WPBA 1J0ZA 1NWTA 2DFAA 4P7OA 4TTGA 5AYZA 3VFCA 3V75A 4JTQA 3PJXA 4OHQA 1A5UA 4EKJA 1G7UA 4LCQA 4E8GA 1XRSA 3E1F1 3XINA 3VD7A 1VPXA 3AISA 1FRBA 2HE8A 3FKRA 3GLCA 1CXFA 1LBMA 3MMTA 5K4ZA 1ZAHA 5HNNA 4IX2A 3HMCA 3AFBA 1WUFA 4NASA 3NGJA 4FNQA 3AIQA 4HOWA 2ZUUA 1AJ0A 1KM3A 1HL8A 5U7SA 4AH7A 5EYWA 5BXSA 4GQ0A 3NQBA 5CG0A 4L1XA 1RBLA 4I5UA 4HJWA 4FLRA 4RV3A 2ZQ0A 3WQ4A 3UWVA 3TW9A 1RCQA 4QNWA 4B2DA 3TUUA 4LRSA 4ERAA 4IPIA 1X98A 3KVLA 3L7RA 1ECQA 1EPVA 4YU1A 1ZLPA 1HJVA 3VI2A 3AS0A 4ENLA 3KEHA 5T8GA 1GOWA 7REQB 2NXIA 3BK0A 3WLQA 4V28A 5A69A 1B3WA 2I56A 1W5MA 2NUWA 3CU2A 1L6GA 1MRAA 2Z1WA 1HKKA 2DSWA 4GPNA 4H2CA 1BEUA 2W67A 1B3VA 4BI6A 4G56A 3SCQA 4O19A 4BR1A 3TDFA 5A8NA 4GZEA 2X1SA 2EPHA 2Z00A 4F48A 2J47A 2UBPC 4X22A 3WLTA 3LHWA 4K36A 4CNSA 1DJQA 5KZEA 1Q65A 2WZHA 3T2OA 4HU4A 3RLVA 1NDVA 2W66A 2F7FA 3SJ3A 4QJ5B 5D2YA 3COTA 3WKZA 4D6GA 3RCMA 1GVSA 1OYAA 3GUGA 4KMQA 3W2MA 4K39A 3WH6A 1OG6A 1CX9A 1KKRA 1KCKA 3SIZA 1SQ7A 4BI7A 3EA2A 2J4GA 3R4IA 3GKAA 4O16A 3CXOA 4MWAD 3KUMA 2D22A 4QM1A 5FJJA 3B9DA 3ABOA 3AMLA 3GH7A 4ML9A 1F6KA 4L56A 2OCZA 3LTYA 6XIMA 4UCGA 4HYRA 4JIQA 2VQTA 2J25A 4DO7A 4PL1A 1IEXA 3URBA 3SCSA 3EWXA 4AEEA 4H7VA 3R12A 3EB4A 3OODA 2NWRA 2FVKA 4HU8A 4Z1AA 1XYAA 1E5NA 2FVMA 4OFCA 1NFBA 5D2TA 1FVPA 3T78A 2OWWA 4NZ4A 1YPFA 3TC6A 4Y8EA 2FGBA 4W7VA 2FB3A 4UMAA 1KXQA 2OO6A 3EKZA 4PULA 1QW7A 1SW7A 4A2SA 1OFQA 3AIEA 3CHVA 4RK8A 4IGHA 2PRMA 4IGMA 4XG1A 2W62A 2Z24A 3LPPA 3B9EA 3L4YA 4F40A 4WDXA 2YA2A 3GIYA 1MMFA 2HCVA 3GXTA 3QQ0A 4DXKA 5FF0A 1MWOA 2C16A 3TZNA 5AC8A 5LGXA 1JDEA 4MNJA 3NPUA 4GXMA 3I4EA 4H04A 4DUWA 1QT1A 3M0KA 4C6FA 3PUGA 4GVFA 5LIXX 3RNDA 2P8BA 4IP4A 3CZ8A 4WGXA 3SR7A 1JIBA 2NV2A 4LYPA 2D1ZA 3WLIA 2PDJA 1GQLA 4BEQA 1WP6A 5CPOA 2ZADA 3BGJA 4XBSA 4E8CA 1XSJA 1QWGA 4AZCB 1SZFA 3KL3A 1S46A 3MHFA 3FS2A 4C6KA 3O07A 4UTTA 4UFKA 4HBKA 2EKGA 4YWIA 4GZIA 2ALDA 2OQLA 1A3XA 1Y0EA 3T42A 3FX4A 2IQTA 5KZ6A 1R0MA 4S3CA 2WM0A 3MI2A 1E6ZA 3S47A 1BD0A 2P3ZA 2V30A 1ONEA 3W81A 2BX7A 2BWGA 4LWWA 4GXPA 5HQLA 4K8GA 5AKQA 1RD6A 1UWAA 1TJPA 1W1IE 1E9IA 1VCVA 4F2UA 1P0NA 1XL9A 2H8ZA 2VX5A 3LV5A 4PEKA 1KNWA 3TNOA 1W3HA 3SBFA 2WZEA 3U2ZA 2IMRA 4YTTA 3M0IA 3KCJA 4FB7A 2E25A 3MW7A 3ECQA 2A7NA 4TMBA 1PV8A 3HPFA 5D37A 4W84A 5I7GA 3WMSA 4PB4A 4DY1A 7A3HA 3MKCA 2EPNA 1R3SA 5EKYA 3OBAA 1EWEA 3GG8A 3ZVHA 2PGFA 3NQ7A 3DI0A 4LVFA 4O28A 4PUKA 1E6PA 2HSAA