1AL7A

Three-dimensional structures of glycolate oxidase with bound active-site inhibitors
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
359
structure length
350
Chain Sequence
MEITNVNEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVTNIDMTTTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPFLTLKNFEGIDLGLSSYVAGQIDRSLSWKDVAWLQTITSLPILVKGVITAEDARLAVQHGAAGIIVSNHGARQLDYVPATIMALEEVVKAAQGRIPVFLDGGVRRGTDVFKALALGAAGVFIGRPVVFSLAAEGEAGVKKVLQMMRDEFELTMALSGCRSLKEISRSHIAADWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein
molecule keywords GLYCOLATE OXIDASE
publication title Three-dimensional structures of glycolate oxidase with bound active-site inhibitors.
pubmed rcsb
source organism Spinacia oleracea
total genus 125
structure length 350
sequence length 359
ec nomenclature ec 1.1.3.15: (S)-2-hydroxy-acid oxidase.
pdb deposition date 1997-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1al7A00
2ZRUA 3M6YA 2ATMA 1JJKA 3G3MA 3BO9A 3IIZA 2ZA2A 4S2CA 4YCPA 4IMEA 1DKWA 2O7SA 3L9CA 4AVFA 4IXHA 3M0ZA 4N2YA 3JS3A 1FCVA 1B57A 4MIMA 4TX9A 1W31A 3IIXA 2WOQA 4X3ZA 5I3HA 3OVQA 3HO8A 1QPOA 1WOAA 3QMTA 3LHTA 1F2JA 4XBSA 4O19A 4X9SA 2KZHA 3DXIA 1TRDA 2QJIA 1OFBA 2ZRYA 1LTDA 2G96A 2RHGA 1K8YA 1P5BA 4EWND 1P0KA 2E77A 1JUBA 3BLIA 3LI1A 4FF7A 2JK2A 4O8RA 1LBLA 5J5RA 3A23A 3G1SA 4JGDA 4R53A 1EX5A 3NGJA 4JTEA 1SR9A 1I2OA 3GDKA 4UTWC 4O52A 1YTEA 1W5NA 2VEPA 2YCEA 3BG5A 3KRZA 1ADOA 2E6FA 3WJYA 4QIUA 4WY0B 2CLKA 3W1UA 3M47A 4HNTA 3TQVA 3NQDA 2H3DA 5F4SA 4UUIA 1MEHA 3LHWA 5U7SA 3HQ1A 3EKLA 1EUAA 3IIVA 3NL2A 4HHPA 3QFEA 4CQ9A 2W79A 2IQTA 3DFOA 4O4VA 3Q94A 2NWSA 2QUUA 3AJXA 3EXTA 1I45A 3EWUA 1X7FA 2I14A 1M6JA 3UWWA 1G67A 2I1OA 1XBYA 4WXZA 3S5OA 3MI6A 5CZ0A 2FTPA 5G2WA 2PRHA 4HN4A 4LV4A 3PR2A 5I3JA 1V5XA 4A29A 2ZYFA 1X1ZA 5E93A 3STGA 1VYSX 1KBJA 1SW7A 3LHVA 4JN6A 3STCA 4WOZA 4DF1A 2X1UA 4IJBA 1MEIA 3Q2DA 2GUUA 5G4WA 4IMGA 2CLOA 5HWNA 5CPOA 1H62A 3PULA 4MY9A 5GVJA 4EVZA 1GPWA 1KM2A 2J24A 3LLDA 1S5TA 3UWZA 4K38A 1M5WA 3WJSA 3GXNA 5LHEA 4P2VA 3CU2A 2PRLA 4NZFA 4AHOA 4UMCA 2QCDA 4I7VA 3BW4A 3PF3A 4FNTA 1ICPA 3DHFA 3HBLA 3HMJG 4MOZA 3THAA 3MI2A 5DY3A 1QO2A 4JDYA 3DI0A 4J9JA 2J27A 1GOXA 1K3UA 2BLEA 5K7JA 2A7PA 3G0XA 4K39A 3HGRA 1VR6A 5HINA 3DZ1A 4GXMA 3L0NA 1VCGA 4MYAA 6TIMA 3W7OA 1NVMA 3BVJA 4JS3A 5L6UA 5F4WA 2DJLA 1SFLA 3FYPA 1SSDA 3TA6A 3P5ZA 4DPPA 3QQ1A 4LVBA 3O63A 1TREA 4WUIA 2Y85A 2V2HA 3W75A 1E51A 1OFOA 3W7HA 2VEKA 4LU0A 2FDSA 2R91A 1ICQA 1C9DA 4XKYB 3HJZA 4FNUA 1YYAA 3BGGA 4C1LA 1C29A 1TB3A 3MHUA 1J5TA 1WOBA 5D2WA 4QSHA 5DBTA 4MPQA 1GVRA 3PSWA 2Y7EA 5LSMA 3NZ1A 4UTJA 1H7PA 4GRSA 5HWMA 5FESA 2CLFA 3DKLA 4N9BA 2ISWA 2JBMA 2B7OA 5DLCA 3FJLA 3LCFA 2YPIA 2V5LA 3I68A 3R12A 1O94A 5AB3A 4Z1CA 2VEMA 4JYFA 1A5SA 1KLZA 1YDVA 2J88A 4UTIA 3BARA 3B0VC 3MWAA 1W5QA 2GOUA 3PUEA 4KFOA 1Q45A 4MZYA 4UTTC 1TJPA 5FF7A 4AMAA 2DZTA 4FEZA 4GUJA 1XBZA 2XFWA 4AF0A 3GB6A 3EKZA 3SW6A 1QPQA 1F74A 3G1VA 3NXFA 3N19B 1UASA 1IIGA 4BWLC 3C6CA 5F2LA 4N6FA 1TCDA 1EP3A 1W8SA 1QMLA 2QCHA 2HS6A 2VOMA 2R94A 1G7VA 4JTTA 5ABTA 4XQ6A 5CPLA 4RKAA 3SI9A 4JYDA 4NJGA 3KFTA 2QCEA 4PH6A 1F7BA 3L65A 4PTNA 5EA9A 4IX0A 2ZBTA 5HR7A 1QDSA 3DENA 2H8XA 1H1ZA 1U83A 2DZWA 1LYXA 3DGRA 4K6AA 3TAOA 1GTEA 1ONRA 3NQFA 4RZ4A 3TMLA 3NM1A 1MZHA 4R34A 3EWWA 1HUVA 4O17A 3NM3A 1W3IA 5IM51 4JTFA 3ZWTA 4GE8A 3KVMA 4A21A 3SY5A 2C14A 4ZZ9A 3G24A 3LCIA 5F4XA 5AN7A 3H55A 3DKJA 1SUXA 2OX1A 5FEXA 4Q33A 5F1VA 1FWNA 3BW3A 4JEQA 1PCWA 1K7EA 2EAWA 2FPVA 2E6AA 3W23A 3ZR4A 1QR7A 4Z0JA 4DQWA 3QJAA 1TPFA 5T26A 2YGYA 3ELFA 5DY2A 4NX0A 2E1DA 1W3NA 4DO4A 4HSOA 3IGSA 3A24A 4LVDA 1N8FA 4Y8FA 4ZQNA 1HTIA 1FXQA 3I65A 3NG3A 3UNDA 1ZAIA 3TIMA 1Q3NA 2VFHA 2C13A 5HR6A 1SZGA 6ALDA 4JTJA 3U2OA 2QDGA 1W5OA 1KM5A 2ZRWA 3NPVA 1KM0A 2TYSA 5FEWA 4IMDA 1QOPA 2ZZ7A 2CZFA 4WD0A 4BFAA 3DFSA 1ME7A 3S1XA 1OJXA 4O18A 1I4NA 3NYZA 5D09A 1M7PA 2HMCA 1OHLA 1YXYA 3PBYA 5BMWA 3L0GA 2CLLA 3NOEA 3EX2A 3E49A 4O16A 3LV5A 1HL2A 3KAOA 3W07A 3DFNA 3HPXA 4MZ1A 4OBTA 3W1QA 4LC8A 2FB2A 4DF0A 1A5BA 2ATSA 2Y89A 4UTWA 3T44A 5KITA 1DV7A 5HULA 3GYEA 5LNVA 3C2EA 1PCKA 5AC7A 4GBUA 4OE7A 4DBEA 1FQ0A 3SR7A 3FEMA 3QSTA 1OYCA 2WQPA 2UV8G 1W37A 5HUPA 4MUZA 4MFDA 4DEFA 3GXTA 2A2IA 3L5MA 3PBUA 1DQWA 3P80A 1H5YA 1XM3A 1LBFA 3STEA 1G4PA 3L21A 4O14A 1SO5A 3NQGA 4NNCA 5AHLA 5D2VA 4LVGA 3IEBA 3HGOA 2RH9A 1I2NA 3B06A 2G5WA 3YPIA 1FDJA 4RZ5A 2E68A 1XDLA 3C2OA 2EGZA 3MBDA 1IXPA 1L6SA 3W76A 3MO7A 2WNNA 3CIWA 2C0AA 4MLRA 3ABRA 4Z1DA 1OABA 4HNUA 5HJLA 2TPSA 2VXNA 2A7NA 2C16A 1W56A 4OQVA 3O8AA 4LUIA 4LS0A 4XZ9A 3HPSA 2C19A 2ZRVA 2X30A 4IGHA 1WBHA 2DU2A 5KZEA 1LP6A 4WJEA 4O0KA 4ZQCA 3FS2A 3L5AA 4RLIA 5F1UA 2W0UA 4MZ8A 4JTUA 3ABOA 3EWYA 2QEZA 5HWJA 2CZ5A 2RDTA 3S1WA 3U6WA 3UWQA 1SSGA 1JCMP 2JGQA 3NQ7A 5CSSA 1IGSA 1NAL1 2Y63A 3TC7A 3TU9A 1N7KA 4G1KA 3LTYA 1AK5A 5C54A 3OEXA 4DF2A 1MXSA 3HG2A 2QCCA 4O0ZA 1O60A 1YTKA 3QH2A 3BLEA 4CQAA 4QNEA 3CEUA 4IPJA 1GVOA 4NZJA 2F7FA 4LRSA 3OVPA 1XBVA 3C8FA 2ZDRA 3N14A 4ZQPA 3F4NA 2PURA 1QAPA 1WDWA 2ABBA 1TPVA 3W1XA 3E96A 2C1HA 4JX4A 1ML1A 4OHQA 3E0IA 4UFMA 4M6QA 2WO5A 3QM3A 3MYPA 4IQLA 1WXJA 1YADA 2HSAA 3P5YA 1WBJA 2QR6A 2X1TA 4RX0A 3P82A 3QW4B 3M9YA 4Q32A 1TYGA 3R2GA 3MI3A 3N3MA 3O6YX 2VFFA 3B4UA 1YXDA 3C4UA 1F5ZA 3GX9A 1B4KA 1OF6A 1K7XA 1T0OA 3WJXA 5D02A 1XUUA 1AG1O 4YXGA 5BW6A 4MJZA 2YXGA 3CT7A 3KVLA 3O15A 3Q37A 1ZFJA 1JR1A 3IVUA 3OBKA 4KKXA 4AAJA 2GJLA 3GNDA 3W7QA 4LT9A 2VFGA 2WJZA 3LTPA 3I7RA 3TQKA 3KRSA 4WY0A 4UC5A 5AHEA 4M7TA 1QPRA 2B0MA 2NX1A 4E2DA 2ZTKA 3W2KA 4LC6A 5F2MA 4ZQRA 1KW1A 1GYLA 4ORIA 3H53A 3PBVA 1OK6A 1GVSA 3EXRA 2DP3A 3IVTA 4NT0A 1P4CA 3MP5A 2Z1BA 4O1AA 4UTTA 3TUUA 2YDAA 5IBXC 3NL5A 1ZAHA 1GEQA 3HG3A 3NL6A 3KHJA 3MHFA 2VELA 2P0OA 3FIGA 1ZNNA 2OJPA 4BWLA 1PHWA 3W7NA 3IGUA 5AHFA 3TFXA 4PCFA 5SWUA 4Y96A 1RVGA 1MSSA 2I9EA 3M44A 4W9TA 3G3DA 3LCHA 1BWLA 4UNKA 3Q58A 4LV9A 2EHHA 1KA9F 2ZA3A 3W1TA 3LDVA 3NVTA 2E6YA 1TV8A 4RXFA 1B9BA 3W1LA 1VGAA 1PE1A 1SO3A 4O13A 4JY9A 4ADTA 4TO8A 5LNRA 5EYWA 1H7WA 4UMAA 3IGXA 1L9WA 2CZEA 2ZZ1A 4RJEA 3DAQA 1DHPA 5D2TA 5FEPA 3QMSA 4YLWA 4HSNA 3L2IA 3THQA 3E9AA 3VCRA 4ALDA 2DZSA 2CZDA 3QW3A 1SU5A 4IXXA 2HS8A 2V2DA 3GNNA 4JR5A 3W84A 3HG5A 2AAMA 4GC4A 3W86A 1KFBA 3ABSA 3O07A 3KVJA 4A3UA 5KZDA 4O53A 1QPNA 2B4GA 4XBKA 3P60A 2WNZA 1T8XA 1FWWA 1TO3A 2TMDA 5G1TA 3NPUA 2YFNA 4DO5A 1AL8A 3UWVA 1GZGA 1M7OA 1PVNA 2WSQA 4M7SA 4O1DA 1KFEA 2YYUA 4FNQA 4FNRA 3BK0A 3DFTA 3I6RA 2J9ZA 3B8DA 4ICNA 1TTIA 3LOTA 1KLYA 3MP4A 4CCCA 3P81A 5TQLA 3TXVA 1VLWA 1YDNA 1H7NA 4XKYA 2QCFA 5DCEA 3P8IA 3K30A 4N02A 1JCJA 1YXCA 3CPRA 4N9DA 5D03A 3GLCA 3HGJA 1MEWA 4UFKA 1XBXA 3O06A 1FWSA 2JKPA 3A22A 1TJRA 2WSRA 3WK1A 4Z1AA 4ZL1A 4HPXA 2YR1A 3TW6A 2NV2A 4JTIA 2A5HA 2ISVA 1WQ5A 4K8HA 2BWGA 3WK0A 1DVJA 2C18A 4XUGA 1THFD 4LVFA 4DBDA 1TRIA 1UCWA 5DXXA 1TTJA 1PIIA 4ADUA 1A50A 3RLVA 1JQVA 5EKYA 2TRSA 1SW0A 3EB2A 3QF0A 4HPJA 3QEZA 1IXNA 1LOLA 3D0CA 3G1XA 3ABQA 3S0CA 3BGJA 3NQAA 3C0JA 3ZFHA 1VLIA 1H50A 3LBMA 3W70A 1D3HA 2QCLA 4NJJA 4BI5A 5C55A 3FLUA 3LRKA 1Q6OA 1R30A 1AMKA 4AWTA 4DPQA 2TSYA 4ZMGA 4UTHA 3I7QA 4E38A 3GKFA 4O12A 1H7RA 2BTMA 3AO0A 5HMSA 1GVQA 1KFJA 1KTNA 3SSJA 4UTKA 4JTHA 1WV2A 3BG9A 2QCGA 3LM7A 2ZFAA 3F4WA 2GVLA 3T78A 2J6XA 4UMBA 1XDMA 3PUDA 4K7YA 3LBCA 1WX0A 2C15A 4BR1A 2E5CA 1KTBA 1LZOA 4WOQA 3E02A 4NNBA 3TROA 1BTMA 5K4ZA 2CFFA 3EWZA 3FYOA 2Z6JA 1O4UA 4LW7A 2QDHA 4RV8A 2H8ZA 3LXBA 3PWAA 4WZHA 1EP1A 2NWRA 2YYTA 4PL1A 3VNDA 5LNUA 1S3HA 3TC6A 2Y70A 5FI8A 2CLEA 1LRTA 1P0NA 1LROA 5KMYA 2B7PA 4IOTA 1QFEA 1ZHAA 4OT7A 3T40A 2A85A 4FHAA 4UXDA 3S6DA 3W87A 2LLEA 1IF2A 4NUWA 4HNNA 1RQBA 3OG3A 4Z0SA 2FJKA 4CCDA 1GG1A 3NAVA 1JCXA 3TAKA 3FA5A 3GVGA 4QM1A 1K02A 1OVDA 3N2MA 3C3NA 2Y7FA 1OK4A 1W5PA 1JCNA 2PC4A 3BW2A 3B03A 3JR2A 3V1PA 4AB4A 2JKAA 3LXCA 4GJ1A 4OV9A 3W2NA 3M41A 1F05A 2ZCGA 1OFEA 3W7CA 4O50A 1AL7A 1UUMA 1JQXA 1XUZA 4X22A 3G18A 3L5LA 4R7JA 1HO1A 1RQHA 5FEZA 4NX5A 1Z44A 3PBWA 4EF9A 3TR2A 4UFHA 3NQ2A 1JRBA 3F03K 3P62A 4O1BA 1JVNA 2NUWA 3IIOA 3M16A 4QITA 4CQ8A 4HNVA 1WYIA 1EP2A 2A4AA 2P1FA 1BKSA 1A5CA 4RXGA 5KZMA 3E12A 3W9ZA 1H1YA 4K8EA 1KFCA 1IIHA 3HPZA 1MO0A 2A6LA 4JTSA 2DORA 1I2RA 2WV8A 3OA3A 4AWSA 1VC4A 4UFJA 4UFIA 3W72A 7TIMA 3I7SA 1Q6RA 4JYEA 3N9SA 3W88A 1X8FA 1R47A 4RZ6A 3P67A 2F84A 3W85A 2EF9A 5FF3A 4LRTA 3RU6A 2CLIA 3OHIA 1LRNA 1SQ7A 4O28A 1LCOA 2ZTJA 4MFEA 5I3GA 5KTLA 1D3GA 5G5IA 2X1SA 1FBAA 1R2TA 2RKXA 2VEIA 2EPHA 2A21A 4HIBA 1SZEA 1S5WA 5I3KA 2BX7A 1IXQA 3S5ZA 2NX9A 2V82A 3HIJA 3QZEA 4POCA 1EUNA 2FFCA 1GJPA 3L67A 1IXOA 1XC4A 3O1NA 2E6DA 3W7PA 4N4PA 5J5DA 2GJNA 3UPBA 1SW3A 1X1OA 3W7DA 1WA3A 3ATZA 4FNSA 4OU1A 3P7YA 3NQMA 3UD6A 3LGEA 2BSLA 4ONVA 3NQVA 3DI1A 4IX2A 5D33A 3W7RA 1FCUA 3P74A 1TPDA 4PFMA 4Z1BA 2FPTA 4FO4A 1ZENA 5I3IA 3LB0A 1JUKA 2Y62A 5BOOA 1WAUA 3RNDA 4JICA 3WJWA 1LRQA 5DBUA 1H51A 1GQNA 4O10A 2JKEA 4R33A 4NXKA 4LUJA 5LHFA 1B4EA 1BEUA 1OFAA 1RV8A 3GR7A 3UPWA 1F6KA 4O15A 3IV3A 4FX8A 2OT0A 2J9XA 5DCDA 3CWNA 5TIMA 4N6EA 3TH6A 3FKKA 3CB8A 2YW3A 5H2ZA 3C2VA 5EY5A 2QJHA 5K9CA 3QMRA 3MJYA 3CHVA 4E2BA 1XL9A 4TMBA 3EWXA 3W1PA 2Q8LA 3G1YA 4M19A 3TKFA 2FPYA 3GXPA 2CW6A 3W2MA 1AW5A 2JGYA 4LWWA 2NXGA 1FCBA 4I7UA 1H7OA 2QAPA 3G1DA 4M6PA 2XN2A 4Q4KA 2Q3OA 4YCOA 1GG0A 4N9CA 3NEVA 4NJIA 4JNMA 1RZMA 4FXRA 1LDCA 4EOUA 1ZAJA 1ZJIA 3DHDA 1F73A 3MYOA 4UTMA 1F6PA 3M5ZA 3GIYA 1KM6A 3R13A 1TPUA 5K2ZA 1JCYA 1FUYA 1X6UA 4NVTA 2GVGA 2RFGA 4MY8A 3BPWA 1L2UA 1H60A 5AYYA 1XFBA 3O6DA 3TV8A 1GYNA 2Z6IA 5D2XA 3L66A 3USBA 3P84A 3LHUA 3W3OA 1KM1A 2QUTA 1PS9A 5D04C 3MBFA 4DELA 1R2SA 4MYXA 3UZ5A 1CI1A 1ZCOA 4GFSA 3CQ0A 1TPEA 5G2HA 3R89A 3C61A 2V30A 5C5YA 3M5XA 1QNVA 4GUIA 5AYZA 1RPXA 1EB3A 4FXSA 2ZZ3A 4FX6M 4NNAA 2ZRXA 3M43A 4TU1A 4UNLA 5HQEA 3RF9A 3W83A 2GQ9A 4CNOA 2G95A 2QKFA 5LZLA 4RR4A 4YWIA 3BG3A 4JTKA 1JULA 1Z41A 3W7KA 2X2GA 3C56A 1DJQA 2BXVA 4UR7A 4AXKA 1UUOA 3QQ0A 3LCXA 1I2QA 3S1VA 1SO4A 5AC8A 2DZUA 1UJPA 3VI2A 4RCXA 1ICSA 4M6VA 4IPIA 2Y7GA 5D37A 5CKSA 2E5DA 1KV8A 3UY7A 4E0CA 3U8GA 2ZZ2A 2V8ZA 1Z48A 2NXHA 5C6MA 3EX3A 3B05A 1T96A 4ZVJA 2Z2UA 1DQXA 1GVFA 3O05A 5G4EA 2H90A 4OV4A 2HTMA 1G6CA 3QYQA 1F76A 3DU0A 3N9RA 4O11A 5AHNA 1NF0A 3NNTA 5D2YA 3W74A 1EWDA 3H54A 1LORA 3W2JA 5LNWA 3UQNA 3LI0A 1VCVA 1JCLA 1FWTA 1LOSA 3B0UX 5AFDA 2OMAA 3W7GA 3WK3A 4AWUA 3TE9A 2A1YA 4WQ6A 1SFJA 3R8RA 4B5NA 3W2LA 1Q6QA 1LLWA 3W73A 3VFLA 5FF0A 1ME9A 2OT1A 4MJMA 4GUHA 3IVSA 3WJZA 3O6CA 1QOQA 1AW1A 2GVJA 4H4IA 1W5MA 3VE9A 3F1QA 3FJ6A 5K3VA 4K36A 2GQ8A 4EIVA 3RK8A 4LS1A 2DZXA 5E0KA 3N73A 4X2RA 3P8JA 5EL1A 1S5VA 2BZNA 1W54A 1OYBA 4MY1A 1RR2A 3TNOA 3N34A 1RD5A 2QCMA 4ORMA 2E09A 1ALDA 1TQXA 4LOCA 2Y61A 4PODA 1LM1A 1YTDA 5FF4A 3LHYA 1W0MA 1OF8A 3IIPA 5LKYA 2GPTA 1YDOA 3KX6A 2R14A 2Q3RA 1KV5A 3LRLA 3NL3A 3SJ3A 4IWWA 2YSWA 3EWBX 3W2UA 2NUXA 4QAIA 3RMJA 4BI7A 3HOJA 4GNJA 1J4EA 1QWGA 2B7QA 4IMCA 5A5WA 3PAJA 1XXXA 3S8HA 2ALDA 1A53A 3LV6A 3G1HA 4AH7A 4BI6A 2D73A 4NQ1A 5CZSA 3C52A 5LGZA 1G69A 3DH7A 3O16A 1G4TA 3HF3A 1O5KA 3MW7A 5D30A 4YMZA 5F2IA 3UWUA 3TXZA 5H91A 1OX6A 4RK8A 5F2GA 4GUGA 3GZ3A 5CPMA 4PEKA 1YLVA 1CW2A 4O1CA 1SZNA 3T7VA 1G4EA 4GUFA 1FWRA 4FB7A 2YZRA 4U28A 1TTQA 2WNQA 4D2JA 4DXVA 2C6QA 1EWEA 3W7MA 3FKRA 3QPZA 1OFDA 1AW2A 3B0PA 3GDRA 3QRHA 3S5YA 3SGZA 1FDYA 3OVRA 1K7FA 3W7EA 2Y6ZA 5DELA 2QCNA 3W22A 1EPXA 3RLUA 1O95A 2RDUA 2H6RA 3A5FA 2WKJA 1Q6LA 3WFAA 1O5XA 3RFAA 1VQTA 2YFOA 5LGXA 4P61A 1D9EA 3W7JA 3G1FA 1VZWA 4I9AA 4S2BA 2R8WA 4JTGA 1H7XA 4IMFA 4JXCA 1FDZA 1LBMA 4XTIA 4NJKA 1W1ZA 1I8JA 3SECA 1OFQA 4LY8A 4MKNA 2PCQA 1J2WA 1VS1A 1JUEA 4YL2A 4BF9A 1TSIA 5BNKA 1VJIA 4I7WA 4Y6GA 1TPB1 2X1RA 4UTLA 3V75A 2QJGA 1DBTA 3LRMA 1UB3A 2NZLA 2QCDB 3IRDA 1TQJA 3HG4A 4LTSA 3A5VA 3PM6A 4Z08A 2CWNA 1VH7A 2V0TA 3LCWA 3NQ6A 3PG9A 1K8ZA 3HB9A 2VFEA 3TQ0A 1VRDA 2YW4A 2CLHA 3BLFA 1DOSA 3UZJA 3M7WA 1FCQA 3CWOX 4UIOA 4OWGA 4UFLA 3W6YA 2XN1A 2NLIA 3TJLA 5D32A 4DO6A 1DJNA 1U5JA 1FX6A 1OX5A 1W3TA 3UY8A 2OCZA 4XWUA 4ADSA 2PE4A 1HG3A 1Z42A 4TMCA 3MUXA 1HO4A 3TDFA 4O4WA 3TW7A 1LLZA 1K03A 3WK2A 3EX1A 2H3BA 4N9EA 3G0UA 4PA8A 3M5VA 3NR0A 3LTSA 3R5EA 4H6KA 4JD4A 4O54A 1XKYA 2QUVA 3A21A 5D38A 3GAKA 3W1NA 3DFPA 1OX4A 3T55A 4CLMA 1H63A 2FQIA 4LS2A 5CZJA 1KFLA 3VKJA 5I3FA 5CGQA 1G4SA 1QCWA 3PG8A 4JDBA 3TK7A 2A7RA 5MHBA 5AHMA 3G1AA 1OG0A 4NJHA 2C3ZA 1OFPA 3NO5A 1TTPA 2CLMA 2O7QA 4S1FA 3CTLA 5E1QA 4LNYA 3NQCA 3ATYA 1N55A 2VENA 2ISSA 1L6YA 2VKZG 1VYPX 3GAYA 3TFCA 1P1XA 2ZZ5A 5D05A 2QF7A 1XCFA 1SPQA 4WXYA 2DZVA 3SZ8A 2VFDA 4TIMA 3GDTA 2GQAA 1GTHA 3LCLA 3M1ZA 1DORA 4AF0B 1EEPA 4ML9A 4QISA 5IBXA 3UWYA 4CNNA 1JRCA 4HKPA 4KFNA 1OFRA 4EF8A 2NV1A 3MHGA 1SO6A 1TPH1 3LHZA 3QPYA 3NQEA 3OIXA 3TSMA 3STFA 5C2XA 1NF7A 1QO5A 4A22A 1NEYA 2ZA1A 4L4LA 1NSJA 2RDWA 2VFIA 1RQEA 1VCFA 1TPWA 3S1UA 3TX9A 2XN0A 3S42A 3W71A 4AEOA 1PV8A 1EA0A 1OX4B 3LX9A 4BK9A 1EIXA 3PB0A 4FIRA 4PL2A 1V7YA 3G8EA 4NXSA 4N4QA 3SGUA 1ZY9A 3KVKA 3DBPA 5DXYA 3NDOA 3NA8A 4ZQMA 1KTCA 3C2RA 3MP3A 2AQWA 4FIQA 1R2RA 5EPDA 5TBOA 5BMXA 4NU7A 2AGKA 1KM3A 2Z0IA 4PC8A 2ZRZA 4LVAA 3PS7A 4UCGA 5AHIA 4OGZA 3N2XA 3G0SA 2V81A 3NZRA 2B7NA 2Y7DA 3PUOA 1K8XA 3B04A 4FNPA 4KWWA 5A8GA 1ME8A 5DN1A 2DZPA 3FOKA 4JTLA 3CLMA 3LCGA 3UYCA 4MLJA 2FB3A 5CZTA 2WSYA 4JIQA 1G7UA 3CC1A 1PL9A 1KM4A 3DFQA 4CCEA 1FXPA 2OZ0A 4MVAA 4JY8A 1BWKA 5AYXA 3CIXA 5KSWA 5L9FA 2WPBA 4M5PA 3LERA 2A0NA 5K9DA 4C1KA 5G1YA 3EEGA 3GK0A 3NPXA 3TSBA 5BRBA 4UTUA 5HNRA 3GDLA 1B3OA 1XI3A 2EKCA 4K37A 3PVFA 4XTDA 2V2CA 3TCEA 3GKAA 4CNPA 3W1MA 2VC6A 4ZQOA 5CG7A 1CX9A 3L0KA 4Y9AA 1KBIA 5CSRA 1TMHA 5DCBA 4O57A 3TJXA 3M5YA 4H3DA 3FFSA 1VYRA 4FX7A 1KFKA 3W7LA 1L6WA 1VHNA 3VE7A 3UXDA 1LOQA 5AOUA 2V5BA 1YPFA 1H61A 3HGSA 2FIQA 2ABAA 4Y90A 1I2PA 3PB2A 3CM4A 5LNSA 2PRMA 3EXSA 4L4MA 2NUYA 4KFPA 3PSVA 2DJXA 3S9YA 3QSRA 3CEPA 1TV7A 1VPXA 1GWJA 2V9DA 3L68A 2Q8ZA 3KRUA 1T99A 3BV4A 3PC0A 1HFBA 4JX6A 3NPWA 3W1AA 2E5BA 4WY0F 3G22A 4GWEA 1ZALA 3INPA 1TPC1 1VHCA 1NFBA 1PHQA 3C2FA 3TSDA 5AC6A 4QQ3A 3KOFA 4U4MA 2NXIA 2A6NA 1C8VA 4A2SA 2G97A 5K9XA 3PY2A 2W6RA 3ANYA 2J9YA 3EX6A 3G8RA 2QAFA 3P61A 4JIPA 1Y0EA 5FF2A 4A2RA 5U4NA 4JX5A 3GR8A 3SFKA 5CPNA 3ZWSA 2Y88A 3EX4A 3A9IA 4IUOA 1DL3A 3W7IA 3GDMA 1GT8A 2X16A 3NQ8A 3MMTA 1OYAA 5G2IA 2ZQ0A 4AHPA 3ZS4A 2FLIA 3QC3A 4AHQA 1TV5A 5EMUA 3LLFA 2NX3A 2YX0A 3T4CA 2CU0A 5KINA 2ZZ6A 3UXAA 4QJ1A 3LXAA 5EBUA 4UR8A 3S5NA 1TIMA 1UBSA 4HT3A 3W1RA 5HUOA 3TMQA 1A5AA 1R46A 3JRKA 4KWVA 4TR9A 3KXQA 2P10A 4K7VA 5K4XA 1FY6A 1SZFA 8TIMA 1YPIA 4WX2A 4QNWA 2ZZ4A 3SIZA
chains in the Genus database with same CATH superfamily
1W1B1 3MB9A 4B92A 1E56A 2ATMA 5IHRA 4IT1A 1E9YB 3VD7A 4IXHA 5C71A 3M0ZA 4N2YA 3JS3A 1FCVA 2CHNA 3OZPA 1VPYA 2IW0A 3MZ2A 4XKMA 3HO8A 3CUJA 1QPOA 1WOAA 3LHTA 4XBSA 2SFPA 4O19A 4LFYA 2KZHA 3DXIA 4Q8MA 1TRDA 3AXIA 3ITXA 1LTDA 2RHGA 2B31A 1XPYA 2Z1KA 3PZQA 1JUBA 3BLIA 5A1AA 4FA3A 3PZIA 4AVNA 5A6LA 4X60A 1SR9A 3GDKA 3ZZ1A 1W9DM 1H3GA 4XD4A 1W5NA 2YCEA 3QV9A 3T2QA 3GTXA 4WY0B 2CLKA 4HNTA 5F4SA 1MEHA 5U7SA 3VNLA 4EAMA 1UD8A 5E0CA 3NL2A 4IIGA 3WLNA 5DMLA 3B9EA 4RE4A 1RBLA 4CQ9A 3ZVHB 3O0FA 2Y0FA 3CZKA 2D0GA 3AJXA 4DJEA 3EWUA 4H1ZA 1GORA 3U57A 4E5TA 1XQLA 1M6JA 3UWWA 5HPOA 1G67A 2WCGA 3UPMA 1MMFA 2UY5A 3S5OA 2BG5A 4IFRA 4IGMA 2FTPA 4LV4A 5I3JA 4ZFMA 2R1PA 1VFHA 1QASA 3STGA 1SW7A 1Q7MA 2X1UA 1MQRA 4IMGA 4XZMX 5HWNA 4MY9A 3RHGA 5E0FA 4Q7IA 2J24A 3LLDA 4K38A 1M5WA 4IIHA 3VZXA 1DQUA 1ONWA 4NZFA 4PUKA 2QCDA 4I7VA 1WNOA 1ZSXA 1WAWA 2E8YA 3EMQA 1ODUA 1QO2A 2V5JA 2BLEA 2FGLA 3G0XA 1V0LA 2ZX9A 5XIMA 4MB3A 1F3TA 1V3MA 5LA2A 1CXEA 4W87A 3GNOA 3CPUA 2WLZA 4JS3A 2OWXA 1ITXA 3MKVA 2BGQA 5CBIA 4PR4A 1TR9A 1EF3A 2YLLA 4RNHA 4DUWA 2R91A 1FWDC 4YNGA 1UMYA 1K9TA 4I9MA 1TB3A 3MHUA 1J5TA 5DF0A 4CD5A 1QBBA 3WNPA 2E4TA 1W2PA 4QSHA 3VKKA 3PSWA 3ZJ6A 4F8XA 5JVLA 5HWMA 2P3EA 1FWGC 3U5YA 2OO6A 2JBMA 5DLCA 3QR0A 3KL5A 3LCFA 1XYZA 3S1GA 4DZ5A 1R3WA 3IV8A 1A5OC 1K6AA 4HYWA 4Z1CA 4ZA0A 1KLZA 4B16A 1M65A 1OT2A 1W5QA 2GOUA 1BF2A 1Q45A 1WKYA 1PX3A 1EBGA 1DJHA 4FEZA 2CETA 5EFFA 3EKZA 1QPQA 4HHMA 5D8ZA 2F2KA 1HJXA 2DDXA 3WH9A 5AECA 1G7VA 3N6JA 1BSIA 4JTTA 3WMLA 3N4EA 4GJJA 1U1UA 2QCEA 1F7BA 1A3HA 3FVMA 3RJYA 1H1ZA 3DGRA 3OP2A 1YE6A 2BFGA 3TAOA 2IQ0A 2PLKA 3T0BA 5BXSA 3MV01 1Z6KA 3TTQA 4PRWA 2REQA 3VNJA 3NM3A 1EHNA 4A21A 3EA3A 4I5XA 3LCIA 5F4XA 3DKJA 1SUXA 5FEXA 1FWNA 1V3HA 3CAKA 3BW3A 1PCWA 3BXWA 2G41A 1O1HA 2WCAA 4WDTA 4JIIX 2E1DA 4DO4A 3IGSA 3GG8A 3I6EA 3VPLA 2OXNA 4B5TA 4LAKA 3PJXA 1HTIA 1FXQA 3I65A 3UGVA 1HJWA 1ZAIA 1Y7VA 1Q3NA 2J7DA 3EZ4A 4NYYA 4RPQA 4DJFD 1L8NA 3BGAA 4Q7BA 4LAZA 1JDDA 1NWSA 1W5OA 3BAJA 1A80A 2FH8A 3H6OA 3LGDA 4A8NA 4BFAA 2OQYA 3DFSA 2VX6A 4H6EA 3APTA 1O68A 1I4NA 1LL4A 1VBUA 3NYZA 5D09A 5I09A 1OB0A 1ZLPA 4U2ZA 3V3WA 3GTHA 2PGRA 3L0GA 2CLLA 1W2VA 4GI8A 1XLIA 5A6KA 3TJIA 2G3MA 4QS6A 3S46A 4JQ1A 5CC3A 1A5BA 3N18A 4TVCA 1XLJA 1TV2A 1DV7A 3GYEA 1DJZA 4O1FA 4XG1A 1PCKA 5AC7A 4GBUA 3VUPA 1FQ0A 5FJPA 4Y2WA 4DXXA 3W27A 1OYCA 3AISA 2WQPA 1XSIA 2VM8A 3KCOA 1JAEA 4DEFA 3WQ6A 1X96A 3OG2A 2ZKMX 1WDSA 1XM3A 3VIOA 5DMNA 1EO7A 3CK5A 1G4PA 1SO5A 1NQKA 1DIDA 2ACRA 3IJQA 1I2NA 3B06A 4DNHA 4AIEA 3OZMA 4RZ5A 1XDLA 3EDKA 3OYZA 4LUSB 3MO7A 5IFPA 1UD4A 4MLRA 5DRIA 4ACZA 3ABRA 4Z1DA 3WD2A 4HNUA 4DJDC 2TPSA 2VXNA 3VKDA 4XAZA 2VZSA 3GHRA 5C9RA 2W61A 4Z2GA 1V0KA 3HPSA 2ZRVA 2ZVRA 3CH9A 3E2RA 4IGHA 5C7VA 3E3HA 5KZEA 2NQ5A 2O9TA 3DESA 4ZQCA 1GONA 3CQIA 1DIEA 4YTRA 4GIAA 3RUBL 2NQ9A 5F1UA 3MSRA 4MZ8A 3EWYA 4MF4A 2QEZA 2CZ5A 2RDTA 3UWQA 3ONBA 1SSGA 3OQ8A 2V3GA 2VJXA 2JGQA 2JF6A 4DWSA 1HKIA 3W26A 3TU9A 3VGFA 1N7KA 4GCAA 4W85A 1QU4A 3HG2A 3KWXA 2EPLX 1ZPTA 4NAEB 4CQAA 1TX0A 3CASA 4IPJA 2XSAA 4CUCA 1GVOA 4NZJA 4GYJA 4LRSA 2Y5SA 4MKSA 4NZ3A 1OINA 4UOQA 4Q22A 2WAGA 3E96A 1HXJA 4XIMA 4MHBA 4E2OA 2ISDA 1ML1A 2WZHA 4D6EA 4IJCA 4M6QA 2GSEA 1AD4A 1WXJA 3CL8A 5XINA 3P5YA 2QR6A 1AZ2A 2X1TA 4RX0A 3QW4B 3M9YA 2PDPA 3ARVA 2R9RA 4AD5A 1LL6A 2XH0A 4FI4A 1TJ1A 2VFFA 4XZIA 1XICA 3W29A 3OGRA 5D02A 1V08A 2P8CA 4BEQA 3GXIA 4YXGA 2WJDA 2NQHA 1XG4A 3OVGA 2I7GA 4MJZA 2PBOA 3CT7A 3K1DA 4NP7A 2GJLA 4LT9A 2VFGA 4MAZA 3LTPA 3VIHA 1R38A 2PTYA 4WY0A 1DE5A 5F2MA 4ZQRA 1KW1A 4QG8A 3SIMA 5M1TA 1OK6A 1GVSA 4H6QA 2DP3A 1P4CA 4JTRA 2OVLA 4O1AA 3V35A 2PU0A 3ZVHA 2HPIA 3KHJA 4HTYA 1ZNNA 1NP2A 4ZXLA 4WKHA 3W7NA 4PUDA 2P8BA 5SWUA 1MSSA 4W9TA 1IEWA 4EXBA 3ZM8A 4UNKA 2XZ9A 3EGJA 5I78A 4G6CA 4LV9A 1XLFA 4F9DA 4GIRA 4LBRA 4W7WA 1C7SA 1CT5A 1PKMA 4TO8A 4UMAA 5A6SA 2ZZ1A 3S9ZA 3DAQA 2NV9A 1F4HA 4YLWA 1NELA 4MB5A 4KWSA 3THQA 1KBLA 3E9AA 1V0NA 3BAKA 2HS8A 2QGHA 5JQ9A 1QNQA 4GC4A 4HA1A 4A3UA 4M24A 1QPNA 4ATDA 1W9PA 2WWDA 3P60A 1FWWA 3FHAA 5HDRA 5JH1A 3M0LA 1TMLA 2BMBA 2XPKA 2F6KA 1Q6EA 3ZMRA 3BLPX 4L7ZA 3E0WA 1M7OA 1N8IA 5JBDA 4O1DA 1M01A 5BU6A 1B3YA 1LJYA 4F0SA 3N1AA 3GTNA 4D1JA 4ICNA 2YCIX 1VP5A 2YCJA 3LOTA 1KLYA 1HL8A 4CCCA 3P81A 5TQLA 2J4GA 3TXVA 1U1JA 1H7NA 2BHZA 1E1CB 4TTGA 2QCFA 4X9YA 3MDUA 3P8IA 3CPRA 4N9DA 3P2VA 2JKPA 1TJRA 2WSRA 3WK1A 4ZL1A 1UPPA 3TW6A 5H1WA 1G1YA 3QBUA 4PMXA 2DSWA 3FXYA 1R86A 3QXBA 4K8HA 1MUWA 1EGMA 3C5QA 3PPFA 4W84A 4DBSA 4XAGA 1ISZA 7ODCA 1RK5A 2D2HA 3CUZA 4DBDA 1E15A 2J66A 4Z2LA 1L2QA 5EMMA 4BY3A 1PIIA 4W93A 4ADUA 2Q71A 4C6LA 4JTCA 2CBIA 5EKYA 1BHGA 4BA0A 3BJSA 1OC7A 2F8QA 3ZXWA 5AYIA 4QAWA 4LB4A 3ZFHA 1W1IE 3LENA 4BQ2A 3LBMA 1BYBA 2QCLA 1EC8A 5C55A 3FLUA 1YBQA 4GY7A 1R30A 6XIAA 1MQQA 4JCLA 2TSYA 4K68A 4UTHA 5CBJA 3I7QA 4LY4A 4O12A 4DJDA 1V8EA 1XRVA 2HNHA 3VD4A 1KTNA 3SSJA 4UTKA 4F4RA 4L9XA 4JFSA 6REQA 3MT1A 3AS1A 1KNWA 5I2UA 2GVLA 2J6XA 4UMBA 4MNLA 2NLYA 4CD6A 2ZXQA 4Z2JA 2FMNA 4HVXA 4K7YA 3VIGA 2D3NA 1WX0A 3TROA 1GOIA 3FYOA 1O4UA 2QDHA 1EYWA 4WKFA 1J6PA 2EG7A 3L4YA 2NWRA 1SZRA 3VOGA 3C86A 2VQUA 2C7FA 2Y70A 5FI8A 4NRRA 5KMYA 1VENA 3M0KA 4XD6A 3ZLGA 4NI8A 1JZ3A 2PDBA 3R8HA 4GKLA 5LIKX 2X40A 3OBAA 2QMKA 3W87A 2QT3A 3HMCA 3N13A 4Z0SA 3CAVA 1U33A 3G2GA 1OADA 1JCXA 3TAKA 1OVDA 3N2MA 4E4UA 1QI2A 2PWUA 1IGWA 4GO9A 5JUVA 1LWJA 3JR2A 3VIMA 3V1PA 2A3HA 4AB4A 2A3BA 3BOFA 3NVDA 3ARSA 1NWUA 3VINA 2J7FA 3W7CA 3AIRA 1AL7A 3D3AA 1DWGM 3VCCA 4X22A 4S3KA 5A95A 4HD5A 1RQHA 2Y8UA 4XSLA 1Z44A 3WH5A 4R7WA 4UFHA 3EB3A 4R5EA 3HTWA 1PZ2A 3P62A 4KEVA 4ROPA 1SJAA 1HJVA 1FHUA 4D1IA 1VD6A 1BKSA 4NAFA 3QZ6A 1WE5A 3E12A 1EOKA 2WSPA 2ZOXA 1TE6A 4C60A 4K8EA 2PWFA 3TTEA 1X8CA 2Y2WA 1XYBA 4JTSA 3B4YA 5GPRA 3SN4A 4U5IA 5GJNA 1HIZA 1QK0A 1X8FA 1R47A 2POTA 1ISWA 7ENLA 1Q63A 5FF3A 3IAQA 1SQ7A 3CUHA 2J75A 2ZTJA 5KTLA 3STPA 1P0DA 2F6UA 2X1SA 2QDEA 2VEIA 2EPHA 1FWHC 3S2CA 3P14A 1SZEA 5I3KA 2BX7A 3O7UA 3H2FA 2VWSA 3MA8A 4BQ4A 1RD6A 2V6AA 4QFUA 4NF7A 2VOTA 3L67A 3TWBA 4IIEA 4U5KA 2V5DA 3CO8A 3F2BA 1GOMA 3SCVA 3N2TA 3AROA 1ONXA 3T0CA 4OU1A 3P7YA 3NQMA 2F6XA 4A3YA 2GL5A 3NQVA 3WSUA 2FYMA 4QGCA 5DMYA 3MUIA 4NAEA 3OGVA 1JG9A 3C3UA 5D33A 5ECUA 3CMJA 1FCUA 3P74A 1S2UA 3GHTA 4V33A 4F2TA 1U2YA 2XVNA 3LSBA 2HZGA 2UWFA 1RAKA 3VM7A 4JICA 5DBUA 2CNCA 2JKEA 4NXKA 5I5RA 1PJ9A 4LUJA 4LJ3A 5JMUA 1RV8A 4KEUA 3UPWA 1Q7QA 1F6KA 1XDJA 3GIQA 1PBGA 3I6TA 5EY5A 4PUJA 3RMEA 4EAYA 5ABFB 5H2ZA 3A6OA 2QPSA 1XL9A 4TMBA 4US5A 3G1YA 4LEQA 2V63A 2JGYA 4LWWA 1XV8A 1XD1A 4HPNA 4I7UA 1H7OA 2GWNA 3WBXA 3Q65A 2Q3OA 3ARYA 4HN8A 4YCOA 4E2VA 1GG0A 3HU7A 4NJIA 2CBJA 1HN1A 4EACA 2XSXA 2JALA 1I0BA 4UTMA 5FL1A 1QT1A 4FOUA 1F6PA 3LZ3A 4CKQA 1KGUA 2GZXA 3QR1A 1KCLA 1YQ2A 3R13A 1FUYA 3GHUA 2GVGA 1H60A 3PFRA 4PB3A 5AYYA 4Q4PA 1SMDA 3HPAA 1R7AA 4TV6A 5D2XA 1GGOA 2YBTA 2DT3A 3LHUA 1KM1A 4CN4A 3MBFA 1J0ZA 1J0YA 1I0DA 4MYXA 3UZ5A 1LWHA 4Q4QA 4GFSA 1UZ4A 1FWEC 3MSYA 1OGGA 1VPQA 1UOZA 4GUIA 3K13A 5AYZA 2TAAA 2E7FA 3ITLA 4Q6XA 4DAIA 3POCA 4FLOA 4TU1A 3BMVA 5HQEA 3GIPA 3W83A 1REQB 3H7VA 2VURA 1CGWA 3R4IA 3B8VA 4RR4A 2A3EA 1PTDA 3W7KA 2X2GA 1LWIA 2BXVA 4UR7A 4AXKA 3QQ0A 1NFPA 1E4IA 4HCDA 3BCJA 4M6VA 2Y7GA 2E5DA 1KV8A 3UY7A 3O2LA 3U8GA 3PTKA 2PU1A 3CQJA 4WLCA 1XW8A 1S2VA 2WHKA 4M3PA 4ZVJA 3RM9A 5MKGB 5G4EA 2OB3A 4X63A 2C71A 3H24A 2PI6A 3A47A 3H54A 1LORA 3FV9A 3UQNA 3LI0A 4QBXA 1JCLA 3B0UX 1E1CA 4RPPA 3W7GA 4P8UA 5BXRA 1T8QA 3CJPA 5T91A 1SFJA 3BZJA 4B5NA 3W2LA 1Q6QA 1LLWA 3VFLA 4UB9A 3QQWA 5IOBA 1E0WA 1XLLA 1ME9A 1K4GA 1P7TB 2VDHA 5FOOA 1QOQA 4FOKA 4N7QA 5I03A 2JFEX 4PTMA 3F1QA 3BLKA 2WVUA 3KDNA 1L6FA 4LS1A 4D6CA 5EL1A 2BZNA 1W54A 4MY1A 3TNOA 4CQBA 4K1GA 4J2PA 3LQGA 3O9NA 2E09A 1NIUA 3CBWA 3VDBA 1XD0A 1EX1A 4LCSA 4NG3A 1OF8A 3KDOA 4GQQA 2GPTA 1YDOA 4RDVA 3VYLA 4W5ZA 3EWBX 3W2UA 3DG6A 2OO0A 4DYKA 3AZRA 5DANA 3A4XA 4O1EA 4IG2A 2JIEA 4X0NA 4D6FA 2B7QA 5D9MA 2ALDA 1A53A 1OBAA 4UZUA 2J7GA 2Z4GA 5AKQA 1JPKA 2PLCA 3DH7A 5T8GA 4KEMA 2OKOA 3VOCA 2IQDA 2QQ6A 4WR3A 4D8LA 3TXZA 3VKBA 1OCQA 5H91A 3BICA 3N4FA 5B80A 1R7OA 3GZ3A 1GW9A 4TUFA 5CPMA 4J3TA 2WZIA 2PCEA 1FWRA 4FB7A 4U28A 2QJJA 2DUAA 1L0PA 1V6VA 5HOSA 2C6QA 3U3HA 1DXEA 3W7MA 3FKRA 4JN8A 1TJ0A 3QPZA 1AW2A 3GDRA 5GNYA 3M07A 4U33A 1JF5A 1YMYA 3SGZA 2CPUA 1FDYA 3W7EA 1HKJA 2XGZA 2Y6ZA 3L4XA 1R6WA 3A5FA 1S2AA 1A5KC 2WMJA 1O5XA 4P7NA 1ENUA 3VIIA 5LGXA 2UY4A 1GK8A 2R8WA 4ML4A 3MJMA 1H7XA 4IMFA 3POHA 1FDZA 1XLBA 1ZBCA 4XTIA 5GNXA 5FSEC 4GQGA 5CJMA 2IPWA 3AYTA 5FJTA 1OFQA 4LY8A 1Q65A 1J2WA 1VS1A 1JUEA 1KD0A 5EMKA 4RNIA 5BNKA 1VJIA 3TWAA 1UROA 1LLOA 4MNJA 4UTLA 1DBTA 3QKZA 4TVDA 2NZLA 1OZQA 3IRDA 1TQJA 3HG4A 4P8XA 1KXTA 1ZBVA 1EJWC 1K8ZA 2VFEA 3S47A 2CLHA 4LBUA 3S6TA 1HGYA 3MWCA 3M7WA 3ABZA 5TNVA 3LMYA 3OU8A 1P43A 2GK1B 4MPKA 2MANA 4Q8UA 1SYTA 1DJNA 1JPHA 3NSMA 3WN6A 5EBAA 4GXPA 1Q5MA 2OCZA 3W6LA 4ZOBA 1UR1A 2VVSA 4YIWA 3TW7A 1FHLA 2BHYA 3ZVIA 4FAMA 2H3BA 3G0UA 3GFZA 3ARWA 3M5VA 2WC3A 4IH3A 3PPCA 3LPPA 4JD4A 2Q8XA 1ZRQA 5I06A 4MWAC 1EC9A 3W00A 5C2GA 1CXKA 3F4VA 3IUDA 4L1XA 4CLMA 3VIJA 1H0GA 2XVPA 3URBA 3O3RA 3TOPA 2YL5A 5MHBA 1POJA 1OG0A 2WCSA 4W8BA 4CU7A 3CTLA 1PZ0A 2QHAA 3HFTA 3NQCA 4I9JA 1N55A 2VENA 3K8MA 1P1XA 2VC7A 3CV1A 2DZVA 2VHLA 1QVBA 4TIMA 4CCZA 1B31A 2YDSA 3QGVA 2GQAA 1F6YA 1GTHA 3LCLA 3M1ZA 1EEPA 2G3NA 3BSGA 4GIYA 5BRPA 2OU4A 3UWYA 2HVMA 2NV1A 3MHGA 4KRUA 2DT0A 3QPYA 3TSMA 1GOWA 4A22A 1NEYA 4BF7A 3QY8A 5CGTA 3PB0A 3SCSA 1DTNA 2QJMA 1IWAA 1H09A 4U31A 1YHTA 2PDLA 4FIQA 5EPDA 2WZTA 4NU7A 1KM3A 5MF5A 5D9PA 2BV9A 1JDAA 5AHIA 2E9BA 2V81A 2B7NA 2Y7DA 3GTIA 1UG6A 1WO2A 1ME8A 3FOKA 4B4HA 3URQA 1NTHA 3CLMA 1R3QA 3UZYA 4MLJA 5CZTA 2WSYA 4JIQA 2OZ3A 6PTDA 2OZ0A 3WY1A 3ARZA 1BWKA 5AYXA 3F4CA 3VXGA 5LYRA 1P1MA 3SCNA 2A0NA 4GK8A 3N4AA 4E3TA 1QJWA 3ITCA 4G7FA 3EEGA 1GZ1A 3NURA 3CWHA 3TSBA 3VGDA 4EE9A 4KH2A 1KGWA 4C1NA 3GDLA 3FAWA 1RCQA 2EKCA 4K37A 3PVFA 1TIWA 1OM0A 3W1MA 4AZCB 3KP0A 3TW9A 1CX9A 4Y9AA 1KWGA 1KBIA 4LGXA 4TX6A 3FY1A 3L23A 1TMHA 4O57A 3TJXA 2WLYA 2CWXA 4J3VA 4FX7A 1KFKA 4ZTYA 3CUIA 1L6WA 4WJXA 2V5KA 2R24A 1TMQA 3XISA 1X6LA 3HGSA 1WUFA 2FIQA 4RUBA 3KLKA 4Y90A 1Y65A 5LNSA 2EQDA 2NUYA 1WUEA 3PSVA 3V0UA 1AFSA 3S9YA 1Z3NA 3QSRA 3CEPA 1WDRA 1F8MA 1VPXA 3DFYA 2EPNA 3AHVA 4YHGA 2Q8ZA 3WUBA 3KRUA 1T99A 3GBEA 2E5BA 2DV0A 1UWQA 3G22A 4GWEA 5C0QA 1WZKA 2GVEA 3VD5A 1TPC1 4KERA 5AC6A 1HL9A 3KOFA 3FGCA 1R8LA 2PMQA 3AIEA 2DW6A 1QUMA 1PX8A 3V0SA 1B5TA 2QW5A 3KS5A 4A2RA 5U4NA 5DEZA 2OOFA 2J6VA 2PDQA 1C8QA 3H2EA 2Y88A 4ASTA 3A9IA 4IUOA 3W4RA 2ZX5A 3H4WA 3AC0A 4ZOCA 3A9BA 1WPCA 3WBEA 4F66A 1X39A 4QJ4B 3NQ8A 3RR1A 3UCQA 1OYAA 4YTQA 4AHPA 5DRCA 1J6OA 4NYUA 1HVQA 4LUTB 1BFNA 4AZIA 4XB3A 2QVNA 3LUTA 2XVGA 3QV7A 1GPFA 5KINA 3VD3A 2WB5A 4QX4A 3UXAA 4GC3A 3N11A 1B0IA 3T9PA 1A47A 1XLHA 1GQJA 3VKAA 2JIWA 3SUTA 2Q02A 1XJBA 2ESCA 3DX5A 4K7VA 2OYKA 1SZFA 1YPIA 4C6FA 4QNWA 3ID7A 2ZZ4A 3SIZA 2ZRUA 2AL1A 4FS9A 2W27A 4GA8A 4W86A 3G3MA 5FJOA 2A3LA 4HA3A 1EO5A 4AVFA 3RCNA 1XQKA 3R8GA 1B57A 1EJVC 2V3DA 4MTVA 3B8UA 3IIXA 4X3ZA 5I3HA 4ACYA 3MKCA 3OVQA 4ECLA 4L6OA 1B3WA 3AI0A 4IFKB 1F2JA 2E0PA 4GVFA 1XISA 2OOGA 4X9SA 3GBDA 3IWPA 1T5AA 2QIIA 2QJIA 2INFA 3RLHA 5EB8A 1IEXA 1UR9A 2DQXA 4EWND 1P0KA 4KW2A 4MWAA 2RAGA 3TOYA 3LI1A 4V27A 4FF7A 2JK2A 3HURA 1LBLA 3R58A 3A23A 1KCKA 3VUSA 3VOJA 1VBJA 3WLPA 1E9ZB 3UXLA 1MXDA 4MMWA 4H41A 1JL8A 5CLWA 1VRXA 1ADOA 2E6FA 3WJYA 2HVNA 3UBPC 3QGKC 3RPDA 4AD2A 1R85A 2BASA 2H3DA 3SQMA 4UUIA 3HQ1A 5HQLA 3EKLA 1EUAA 3U4AA 2PDJA 4CGTA 4HHPA 2W79A 2IQTA 3DFOA 4H7VA 4WDUA 1T7LA 4LQ1A 1X7FA 2I17A 4QR6A 1ZBKA 1XBYA 3MI6A 1CGXA 2PRHA 1BTCA 1OT1A 2VUYA 1BVWA 4IZGA 3SRHA 3SFWA 4WCJA 1A5LC 1FH7A 4R85A 2ZYFA 4FLSA 3WQGA 5A94A 1VYSX 5BOFA 2W9MA 3LHVA 3KRBA 4WOZA 4XD5A 4IJBA 4ROQA 2ON3A 2CLOA 1H62A 3CHCA 3OODA 4NHVA 2PTXA 1UJQA 3DG3A 2VEGA 1GPWA 2ZWYA 2Z2AA 1R87A 2ZWZA 3UNTA 3UWZA 5XIAA 4B9YA 3WJSA 5LHEA 2XIBA 4P2VA 2X8RA 1M03A 3BMWA 3AWOA 3BW4A 3PZMA 5I77A 3HMJG 3K5XA 4KESA 4ICCX 3TR9A 1EOMA 2J27A 3I3BA 1K3UA 5K7JA 2A7PA 4K39A 4UR9A 5HINA 4D6IA 1EDQA 2GK1A 3DIPA 1CZ1A 2CKSA 4MYAA 3W7OA 3HV9A 2E8ZA 3E38A 1E3XA 5L6UA 1X1NA 4Q8QA 3WX7A 2E9MA 1TREA 1O5RA 4WUIA 2Y85A 3W75A 2W4XA 1OFOA 4JTDA 3CZGA 4AISA 1MNSA 1ICQA 1RPKA 1C9DA 3HJZA 3RXZA 1YYAA 3BGGA 2OEKA 4P7RA 3NXLA 4C6PA 4HMDA 1C29A 3WDIA 1WOBA 4LPCA 5D2WA 2INZA 4S3DA 3TTOA 3OB8A 5DBTA 4MPQA 1GVRA 2Y7EA 3SY1A 1H7PA 5FESA 1H49A 4N9BA 4UQCA 3LNMA 5HXMA 4H2CA 1YKWA 4XO7A 4YTUA 2YPIA 3R12A 4C6IA 3I3EA 5AB3A 1A5SA 3TCSA 2J88A 3MWAA 2R1LA 4FALA 1Q4NX 4FP1A 4MZYA 3F5LA 1TJPA 4AMAA 2PLMA 2VYOA 1EZ2A 2VR5A 4GUJA 1XBZA 3E0VA 3GY1A 1CIUA 1J79A 2A3CA 4LAOA 5F2LA 2QCHA 3G77A 3WF4A 2J8GA 2XGIA 1SMAA 5CPLA 4LBSA 3SI9A 6XIMA 4NJGA 1OZMA 3KFTA 2C8NA 4PH6A 3TTSA 2VRQA 4PTNA 2ZDSA 4M0XA 2YZ5A 5HR7A 2Y4SA 1TZ7A 2H8XA 6ENLA 3SB0A 3GU2A 5CXPA 5IDIA 1XYLA 4RZ4A 3TMLA 3NM1A 1MZHA 4US6A 3EWWA 4J28A 1HUVA 4O17A 5IM51 1B3ZA 3ZWTA 2C14A 4W7UA 4ZO7A 4H19A 4Q33A 5F1VA 2XH2A 3W23A 2EAWA 2FPVA 2E6AA 4F79A 1QR7A 1I6NA 3EOLA 1KKRA 3FW6A 4GNVA 5CQ1A 3LPOA 3ELFA 4NX0A 1W3HA 4HSOA 3A24A 4LVDA 3M0YA 2W5FA 4Y8FA 3CHFA 4ZQNA 3EB4A 3Q67A 2P3ZA 3O6AA 1V6WA 3TIMA 1M53A 3LPGA 2C13A 3OYXA 4GY1A 4I5RA 5HR6A 1OSEA 4QQUA 4LNCA 4YS1A 3LEPA 4Q3MA 2Z1SA 1CB2A 3N15A 2JEQA 4IMDA 4WD0A 4L1WA 1ME7A 5CPQA 3S1XA 3LBOA 1OJXA 3FVDA 1BRLA 4AZCA 2HMCA 3VVGA 4E4PA 5BMWA 4F0RA 3NOEA 3E49A 4O16A 5I24A 3KAOA 3QV8A 3W07A 1UYQA 3LS9A 4J7RA 2VI0A 3OZOA 3WUGA 2PD9A 5KITA 3H4GA 3FAXA 5LNVA 1GHRA 5DO8A 4OE7A 3NDZA 3FEMA 4IUGA 1MVYA 2UV8G 1W37A 4QG9A 1Y8BA 4UQBA 1H2JA 3GXTA 4HZ6A 4S3CA 2A2IA 3CUFA 3L5MA 4S3BA 1MNZA 1H5YA 1UR8A 4QXIA 1LBFA 3L21A 1YDYA 1NOFA 3NQGA 5AHLA 5D2VA 1UD3A 4LVGA 2X2YA 3HGOA 2RH9A 2WPGA 3R79A 3UEQA 2EGZA 3ITYA 3UG8A 5LIYX 1ITUA 3W76A 4GVGA 4KCVA 2DVUA 1XLCA 2C0AA 3W81A 3H21A 5HJLA 1QRQA 1W56A 5M5DA 3TJ4A 1EHAA 3O8AA 4XZ9A 4EANA 3JUGA 3MVTA 3TLLA 4J5NA 1LP6A 2RJHA 4C6NA 4HK7A 1R3TA 4F40A 3KM8A 3VK5A 1M41A 3L5AA 3ABOA 3EEZA 3U6WA 3M4HA 1OIFA 4I3GA 1NAL1 3TC7A 1XLKA 2NSXA 3LTYA 1AK5A 5C54A 4E8DA 2HBVA 3ORWA 3RR4A 4AD0A 2PUZA 3KOZA 3SRFA 4ATWA 1O60A 3IK4A 3DG7A 1AH0A 3V0TA 3QH2A 1XGEA 3BLEA 3E2QA 1VFLA 3C2YA 3CEUA 1UIOA 3IPWA 1ECEA 2F7FA 1G0CA 3DHPA 4OZOA 4IQJA 1KC7A 1TVLA 2ALRA 1HKMA 3C8FA 3SUUA 3OQEA 3GH4A 5DT7A 2ABBA 3E0FA 5HMDA 3DEQA 4Q6JA 4YN5A 1LT7A 4DLMA 3BQ5A 1EFZA 4XAPA 2WO5A 2YXOA 3MYPA 2HSAA 3M64A 5D9OA 3AIBA 3P82A 1W1TA 2Z1VA 3MI3A 1NY1A 4DBWA 2AKZA 1CXHA 4Q4RA 1ZU8A 1DWFM 4JKKA 3SEPA 1QPKA 1T0OA 2VVNA 1XUUA 4MG4A 5BW6A 2YXGA 1C90A 1E0TA 3O15A 4H2HA 4AAJA 3R0KA 3GNDA 2NVCA 3A64A 1VJZA 1E73M 1DE6A 3THCA 1TG7A 1QPRA 4XZWA 2NX1A 3W2KA 4L65A 3PJUA 3EYPA 3PBVA 3RDKA 4JQ2A 3EXRA 4AW7A 4B5VA 3GC4A 2YDAA 5IBXC 3NL5A 4E8CA 1GEQA 3HG3A 3NL6A 3GH7A 4K2SA 1CWYA 3GO2A 2P0OA 1JI2A 2XWDA 1PHWA 2FFIA 3EWDA 3IGUA 2NT0A 1SFTA 4BQ5A 3MUZ1 2I9EA 3PK7A 3LCHA 1KQZA 2NVAA 1W9VA 1JD7A 4QROA 1WDDA 5CSYA 3WG6A 2EHHA 2ZA3A 3BCDA 2VZVA 1RCOB 1TV8A 1CENA 4RXFA 3ITTA 1IZJA 4ADTA 4F0KA 4DXKA 1H7WA 3B8SA 1L9WA 4L5ZA 3KTSA 4A3RA 3G5EA 5FEPA 1ZQ5A 4HSNA 3VCRA 2DZSA 3QW3A 2V2DA 3GNNA 3W84A 1G01A 4B3KA 3EOOA 1KWKA 5KZDA 3UR2A 1YNQA 3BOXA 1QI5A 5E9AA 2WNZA 1T8XA 1TO3A 1XRFA 4UQEA 4DO5A 2OYLA 1VFTA 1PZ1A 3ZJKA 4LCQA 3DYPA 4C6BA 1GZGA 3GU1A 3KL0A 1J11A 4LYPA 4MJ2A 1NM9A 4M7SA 4FNQA 5H6HA 4EWJA 3B8DA 1WCGA 4HSHA 4IGSA 4AUBA 2OSXA 1VLWA 1YDNA 3V5OA 1BKHA 1EBHA 4I8DA 4UQAA 5DCEA 5C2CA 1AQMA 3RX2A 5D03A 2I16A 4IPNB 4I6VA 1MEWA 4KCWA 3O06A 1FWSA 3A22A 4Z1AA 4HPXA 2YR1A 4MNMA 5E09A 4JTIA 1V6UA 3PTQA 3UR7A 1KB3A 3T81A 4PN2A 3AMKA 3C8NA 2HEJA 2GQ3A 5G1MA 2C18A 4XUGA 1AQHA 1THFD 3UG3A 4LVFA 1NU5A 1UCWA 4AC1X 1K6WA 4DAFA 2OKTA 1JYVA 1A50A 4CEXC 4W8AA 3WD0A 2GYIA 2TRSA 1GW1A 4J3ZA 3VNIA 5KZ6A 3EB2A 1ZS2A 4L1GA 3QEZA 1LOLA 3D0CA 3G1XA 3MUY1 4REQB 1VLIA 1H50A 3MQTA 4B5SA 1W91A 3L4VA 4Y9MA 1UMLA 4BI5A 1XHGA 2G50A 4DPQA 4ZMGA 2J8FA 4H7CA 1BLIA 2IS7A 3GD6A 4ERGA 2BTMA 4GGHA 5HMSA 4AD4A 2YXXA 4FR1A 1V51A 1JDEA 4RE0A 1K1DA 3NSNA 3FDGA 1XPGA 4JTHA 1WV2A 3BG9A 2QCGA 4AIBA 2PWDA 4KPLA 3FN9A 3NO1A 2GGEA 3PANA 1IHIA 3AS2A 3LBCA 2E5CA 4L64A 1P6WA 3G1RA 1E9LA 4NNBA 2O55A 1ZUAX 1BTMA 2EG6A 1UR2A 1AH4A 3CZLA 4NZ5A 3TN6A 3DC8A 3GE7A 3LXBA 4WZHA 3U9IA 4PL1A 3FYYA 1UD2A 1K8CA 5C9WA 1WZAA 4ZO9A 1LROA 2JEPA 1XGZA 4M56A 2XZ7A 3BV7A 4ZBCA 4F48A 1QFEA 3HQOA 1UUQA 1IQ8A 1ZHAA 1XCXA 3M6DA 1DIKA 4FHAA 4PMRA 3ES8A 3NZPA 2LLEA 4HNNA 1RQBA 3OG3A 4HA4A 2FJKA 1L6GA 3WLQA 1FKXA 5CBBA 3GVGA 4QM1A 1XIGA 3QYSA 2DW7A 2BOFX 3C3NA 3MTWA 4WEVX 1EJUC 4AWEA 4XSMA 1IWPA 1UKQA 4X61A 2PWEA 4AY8A 3W2NA 2WVVA 1OFEA 2YCLA 4O50A 4R27A 1XUZA 1DXFA 3W0KA 5HQMA 3G18A 3L5LA 4R7JA 3VIKA 2CXGA 4NX5A 3IJ8A 4EF9A 4B3LA 3U4FA 3W25A 4CD8A 3NQ2A 3F03K 1JRBA 4O1BA 3D3FA 2WVTA 1UH2A 1WKDA 3FDKA 1JVNA 1RXOB 3IIOA 1MQPA 3M16A 1EPVA 4ZE4A 1WYIA 4HB7A 1A5CA 4HHHA 4XV0A 2DUXA 2X1IA 3HPZA 2CITA 1TZZA 1I2RA 4HK6A 2GJRA 2WV8A 4GGBA 1SJBA 1SVDA 1LF1A 1J0KA 1XLEA 1W1VA 4UFIA 3I7SA 1Q6RA 4JYEA 1V6XA 1RA5A 3W88A 5CLTA 3P67A 3EA1A 3MVIA 2F84A 2C91A 4LRTA 3RU6A 1CTNA 1MRQA 1LRNA 2BS9A 4MFEA 5I3GA 3IUHA 1FBAA 1JI1A 2D2GA 5J04A 1S5WA 4LCRA 3AMCA 4GQ0A 2NX9A 1TWWA 4ZOEA 3AUOA 5HPCA 2CXEA 3D6NA 3PZNA 1ZJAA 4POCA 1EUNA 4HCLA 2WMIB 3L4ZA 1GKRA 3NEHA 3O1NA 2E6DA 5J5DA 2GJNA 3N6QA 4G7EA 1X1OA 2I9UA 3E6EA 5PTDA 1KXHA 4AY7A 3AALA 2C79A 4CQDA 4FNSA 3UD6A 3B9DA 3QVQA 3D47A 4G8TA 3DI1A 2VR4A 3JW7A 1XYAA 1Y5XA 4PMOA 4D8ZA 3MPGA 4Z1BA 2FPTA 5HJXA 4FO4A 3LB0A 2Y62A 1K77A 4J2MA 5BOOA 1WAUA 1LRQA 1H51A 2XFFA 1WKFA 1GQNA 3ZYZA 1ZCCA 3VOIA 4R33A 1YEYA 5LHFA 1W9UA 1BEUA 1OFAA 1KR0A 2AOSA 1QXLA 1VB9A 3TN3A 2FJUB 3GQYA 2J9XA 1MFUA 3L4UA 3FKKA 2PGEA 2QJHA 4DI9A 1Q6DA 3CHVA 1O12A 2EJ1A 2V68A 1PWLA 3WYZA 3TKFA 1VJSA 4GX9A 3PTMA 1TA3B 3GXPA 2CW6A 1AW5A 1AJ2A 1V02E 1QNOA 2ZX7A 1FCBA 4XK2A 1M7JA 4A6GA 2QAPA 3MUAA 2QV4A 4Q4KA 4YWSA 5IXEA 1UKSA 2GDQA 4N9CA 3UP8A 4MAVA 3B8TA 3OLEA 1F73A 3DHDA 2XYLA 4JL2A 3PHAA 3GIYA 3BQ6A 4LF2A 2GJPA 1X6UA 1W3LA 4MY8A 1UWTA 3BPWA 1ZJBA 3FJNA 3QY6A 4ES4A 2CHOA 3O6DA 3TV8A 1RBAA 4NASA 3USBA 4NL1A 3VFCA 2QUTA 3UR8A 2J47A 2KX9A 3WZ0E 2QPUA 2GFTA 5BZAA 4DELA 4CNSA 3CQ0A 5E70A 5KETA 3C61A 2POZA 3VNMA 3AU2A 4HPHA 3F5KA 4Y9OA 1GZJA 4ZO6A 1EL3A 3NTYA 1EB3A 2W3ZA 3GZAA 4FX6M 4NNAA 3M43A 1JD9A 2OQHA 2XG9A 3VX0A 2GQ9A 3RX4A 3SY8A 1S2CA 2FTWA 1RP8A 1UD5A 4YWIA 4QLLA 4AC7C 1Z41A 3C56A 1DJQA 3P3BA 1HKVA 3S1VA 3BOLA 5AC8A 3TA9A 1E6XM 1UJPA 5HNNA 1SJCA 2NVDA 4Q7NA 4V15A 2R1KA 2PD5A 3CV6A 5C6MA 1MWOA 1T96A 5CZKA 3U48A 4RZBA 4M1RA 3O05A 2H90A 4OV4A 2HTMA 1G6CA 1F76A 3BLLA 3AUJA 4JCMA 3UESA 4PFHA 3WMBA 1NF0A 3W2JA 4IJRA 1MW1A 1V79A 3CV2A 4R88A 4EK7A 1O66A 5JIWA 4PCTA 3WK3A 4AWUA 3VGHA 3TE9A 1IYXA 2ACQA 2AL2A 3R8RA 1EF2A 3KOXA 3N2CA 1UWSA 4XIAA 3WD4A 2OT1A 4MJMA 3FK4A 4Q8TA 1N8WA 1CGUA 4NZ1A 3FJ6A 4O0QA 4K36A 2GQ8A 1Q2SA 4P7LA 3M0HA 5CPTA 3HM7A 3MC5A 4U3AA 1QHOA 4O8AA 3P8JA 1RJPA 3EKGA 1OYBA 4GYFA 3UETA 1E6QM 4PSPA 2WMFA 4UOZA 1ALDA 1TQXA 4LOCA 2Y61A 3RRAA 1BYDA 4UTFA 2ZVIA 4PODA 1LM1A 3ZT6A 5FF4A 1W0MA 3WLRA 1ZZMA 1KQYA 3KX6A 3LRLA 3H2MA 4IF2A 4F0HA 4REQA 3DOPA 5LXEA 1IZKA 1PDYA 1PSCA 5EGRA 1ADDA 3NZGA 4WGHA 2FHBA 2F9RA 4GNJA 4PULA 3AHZA 3FEQA 3G1HA 4AH7A 4JKLA 4V1YA 5CZSA 1UH3A 2PDFA 1C9WA 4WJ8A 3O16A 1PKNA 1BXCA 4NRSA 5D30A 1K9DA 1KXQA 2HRWA 4KQNA 3WNKA 2WZEA 3UWUA 3WLIA 1IWBA 4JZ5A 1OX6A 3NUKA 1TVNA 4DWSC 1EC7A 1YLVA 3A3HA 4S3JA 3ZLHA 1BD0A 1LL7A 1SZNA 4GUFA 2DIKA 5H8PA 1TTQA 2PODA 2OWWA 3GW0A 4YVXA 1PYFA 3S2NA 4DY1A 3K1GA 1PWMA 2AKMA 4JNZA 1PUDA 1W32A 3R7MA 1K7FA 3IJ6A 1JZ7A 1EPXA 2H6RA 4H9ZA 2Y5EA 2PGWA 3WFAA 3T2OA 3K46A 3RFAA 3ZSTA 2RDXA 1V3IA 3PFMA 4TQTA 3G1FA 4PMUA 1DJXA 3R10A 4JTGA 3WQEA 2W91A 1W1ZA 3ITGA 4MKNA 1FH8A 3MANA 2VX4A 1TJ2A 4BF9A 1TPB1 2X1RA 1UB3A 4INFA 2XGBA 3T0TA 1GYMA 2QIWA 1OGBA 3A5VA 1GNXA 3BAIA 4DUVA 1VH7A 5FJIA 3B40A 3TQ0A 4B2DA 3TTYA 4UIOA 3CWOX 3WMSA 1FWAC 3AMDA 3W6YA 1XIHA 1XP3A 2IMRA 1HJUA 1W1YA 3DECA 1U5JA 2OTDA 2X09A 1J10A 1W3TA 1XS2A 4HYVA 1HG3A 2XU2A 1BYCA 2PDUA 1LUCB 3QHMA 4IMAA 3TDFA 4O4WA 1M9HA 4GX8A 1LLZA 3EX1A 2BXYA 4UQDA 2VRJA 1AD1A 2VC5A 3R5EA 2ZUSA 3A21A 1DWJM 3W1NA 4DZIA 3DFPA 2PDHA 5G4HC 3T55A 5CCZA 3WQ4A 1XLMA 1KFLA 3GS6A 3TYDA 3VKJA 4CNUA 4CU6A 4JDBA 3TK7A 1TELA 3A3WA 3W6MA 1Q8AA 4PSRA 3UJFA 2C3ZA 3AHYA 3MMDA 1TTPA 4S1FA 2XH4A 4TX8A 5A6AA 2J78A 2ISSA 3TFCA 2ZZ5A 8XIMA 5D05A 2QF7A 1SPQA 2NQLA 4KIEA 3UG5A 3SZ8A 4HNLA 2VFDA 3SJNA 2AAAA 2G3JA 4UCFA 3MCMA 3V5CA 4EF8A 1UQZA 1GVIA 2HXUA 5CJ5A 2OFJA 3D46A 1TPH1 4KRTA 1UKOA 3L7RA 5FACA 1GJWA 2ZA1A 4L6HA 4L4LA 3V4BA 1RQEA 3TX9A 1EA0A 2XN0A 3S42A 1IR2A 1PV8A 1OX4B 3LX9A 5DFAA 2WBKA 3USZA 4FIRA 4ZTXA 4QCEA 4PL2A 2PDMA 1V7YA 4IIDA 3G8EA 1ZY9A 3DC0A 1KTCA 2AQWA 1JEZA 2YA0A 3VM5A 1JXKA 1AJZA 4PC8A 1A3XA 1K9EA 3N17A 4JQAA 3CHEA 3AXKA 4OGZA 3NZRA 4QJ3B 4KWWA 2BVTA 2Z28A 3TVAA 5DN1A 5CPSA 3SBFA 1TWSA 3UYCA 2DEPA 1PEZA 1G7UA 1J0IA 3CC1A 1JPIA 1PL9A 4HMCA 1KM4A 2HXTA 1FXPA 3EWCA 1XIJA 4MVAA 4JY8A 4XUYA 5L9FA 1V93A 2WPBA 3IJ7A 1PO9A 3LERA 5K9DA 1AQ0A 4C1KA 2ONEA 5G1YA 4GI9A 4S3FA 3SRDA 3WF1A 3ES7A 1XI3A 3ECQA 2V2CA 4CNPA 3GKAA 3ANVA 5CG7A 3L0KA 4OUIA 4HQVA 2IXUA 3SQLA 1C3FA 3VOHA 4LALA 2GJXB 1E72M 2P5NA 4AIOA 5FL0A 4NSBA 2VR2A 1WXYA 2WVSA 1FA2A 3EOEA 2L5HA 1JFHA 4WVXA 4D71A 1CYGA 2PRMA 4L4MA 1XLGA 3UCCA 3WUFA 2QVHA 5B7YA 1TV7A 3GNRA 1ZTVA 2BY0A 3L68A 2W62A 1HFBA 4JX6A 2YL8A 2VZTA 4QQ3A 5LXXA 4U4MA 3T6CA 4BCEA 2NXIA 1C8VA 4OVXA 3GM8A 1CBGA 2J9YA 3EX6A 3CZJA 3MSDA 3P61A 5B7ZA 1Y0EA 4C6MA 5FF2A 2I5QA 3GR8A 1XSJA 3B9NA 1E0XA 3CMFA 1XRSA 2G0WA 3PTDA 1CXLA 4PBFA 2QULA 1MW0A 2I5IA 5FSDC 4JIHA 2O4MA 3MMTA 1V77A 2WBGA 4JTQA 4WF7A 1BVZA 5A6BA 2FLIA 3QC3A 1NQ6A 4AHQA 1TV5A 5A6JA 7TAAA 3PPGA 2DT1A 1QTWA 4QJ1A 3MZNA 4NI3A 1FFQA 3H7RA 3S5NA 3KZPA 3G6LA 4Q4MA 1R46A 5TD4A 1GVEA 3WQPA 4RDYA 1OCJA 4UBPC 3SCPA 3DFHA 4AG0A 3M6YA 1EXPA 1DIOA 5CH9A 3V36A 3BSMA 3VCNA 1ZBWA 3AHTA 4HNCA 2DIJA 2ZA2A 4S2CA 5BXPA 3MKKA 2O7SA 1PB0A 1WZLA 3T42A 4OIFA 3CTTA 3HA1A 2Y8VA 4WDWA 3PZGA 3GC5A 2J13A 1DJYA 5HMFA 5HA7A 1BG4A 3QLDA 1PTAA 3CUGA 4MDOA 2G96A 1K8YA 1P5BA 4UOJA 3UZWA 2E77A 5F7UA 1O7AA 5HATA 4O8RA 3AXMA 5J5RA 4XZHA 4CVUA 3G1SA 3CYJA 3ALGA 1I2OA 2GOKA 4B9ZA 1S2TA 3QOKA 3KRZA 1UKTA 3PZ9A 3UA4A 4LANA 3R94A 3W1UA 3M47A 3NQDA 1AMYA 2ZUTA 3LHWA 3S9IA 1E5NA 2BXZA 2NQZA 3TYAA 3KUMA 3WDRA 3OW1A 4OBSA 2C1GA 4O4VA 3Q94A 2NWSA 4HP5A 4PUNA 1VBHA 2JE8A 1BVNP 2D0FA 3BJTA 4YVVA 2I1OA 3A4JA 4WXZA 5CZ0A 3APYA 4DUOA 5G2WA 3DYOA 3PR2A 2PLJA 2VX5A 4A29A 3OIHA 1UWUA 3U2ZA 4UNIA 2F61A 5HMEA 1KBJA 4JN6A 3STCA 4KWUA 4DJED 3Q2DA 2Z25A 5G4WA 2CZVA 4HBKA 4EVZA 2XM1A 4JHMA 5CAHA 3NJ3A 1S5TA 2DIEA 3CHDA 3GXNA 3CU2A 4AZ5A 4UMCA 3PF3A 4FNTA 1QOXA 1ICPA 3HBLA 3PPHA 4MOZA 4QJ5B 1TE1A 3VIFA 4JDYA 3DI0A 4J9JA 4G56A 4PTVA 1MYRA 1VR6A 3BLOA 3DZ1A 4GXMA 4J3UA 2FZMA 1X7IA 1E71M 3FXGA 3ZOAA 1NDWA 4H7ZA 2ZE3A 1VCGA 1UHVA 6TIMA 2FDMA 3BVJA 2DJLA 1UW9A 1SFLA 3FYPA 3EMCA 3P5ZA 3TQPA 3R43A 1FWFC 3QQ1A 1E51A 2VEKA 4C6QA 4HTBA 4LU0A 3CO4A 4FNUA 4PMQA 3TYUA 4P7QA 4C1LA 1EKOA 3C0SA 1J9YA 3ITVA 1V6TA 3LSCA 5A2BA 4GRSA 1S38A 1MDRA 3DKLA 2ZADA 2ISWA 3UW6A 2GLKA 3FJLA 2BVWA 2V5LA 3I68A 3HPFA 2OODA 4JYFA 1YDVA 3UXKA 3CQKA 4UTIA 3BARA 1G5AA 4M1BA 3B0VC 3PUEA 4KFOA 4UTTC 3IJ9A 3VNKA 2DZTA 1EQCA 2XFWA 3SW6A 2VL4A 1F74A 1UR0A 3NXFA 3T0AA 2PFHA 3VU2A 3GVRA 3N19B 1UASA 1GQLA 3C6CA 1HX0A 4N6FA 1TCDA 1EP3A 1W8SA 1QMLA 4GI6A 2DUZA 4XQ6A 1J0JA 4RKAA 3AYVA 4QSFA 3L65A 5EA9A 2DY3A 4IX0A 4I9TA 1UC5A 3DENA 2J77A 1U83A 1XIIA 3T0DA 2DZWA 2PGFA 3WNNA 3ARRA 4HU0A 4HU3A 3ONCA 1ONRA 3W01A 3WQVA 3WEMA 3WDQA 3WLHA 4R34A 3BDKA 1W6TA 4JTFA 4GE8A 4H8NA 3KVMA 3EDJA 4XBJA 3SY5A 4ZZ9A 3MMUA 3NCOA 5AN7A 3PNUA 1M1BA 5CGMA 3LM3A 4UQ9A 2OX1A 2O92A 3EDEA 2DGAA 4Z0JA 4DQWA 3QJAA 3PAOA 4HNOA 4DJFA 2XFRA 2VQTA 1TPFA 4G2DA 5T26A 4L9ZA 1NDZA 5DY2A 3NOYA 1DWHM 1N8FA 3WDJA 3M46A 1U1HA 1GJUA 4GPNA 2VFHA 3EA2A 1TV4A 1OC5A 2XIMA 6ALDA 3AYSA 4AD3A 2QDGA 3ME3A 4LAMA 5CC7A 2CBUA 3NPVA 1W3KA 1KM0A 3UJ2A 1OWQA 1IT8A 1SM9A 4QE4A 1F3EA 4AXNA 4QG6A 5I02A 2UY3A 4XZLX 4M6UA 2X7VA 1X98A 4O18A 2IKHA 5JBFA 1M7PA 1ECQA 1NH6A 3ZQ9A 4LUSA 1JIBA 1XIBA 1OHLA 1YXYA 3PBYA 4JKMA 2MNRA 4QDWA 1J12A 3VTRA 3R0UA 2QS8A 1RK6A 4GISA 2R1NA 3LV5A 2GJXA 1V3LA 2XSBA 4GACA 3DDMA 4CQCA 3DCPA 3HPXA 3QLLA 2G8ZA 4MZ1A 4OBTA 3W1QA 2FB2A 1YRRA 4QEEA 2ATSA 3T44A 1J93A 2DVTA 4G5DA 4RDWA 3RIKA 2HJPA 4Y7EA 3C2EA 2EKGA 1YNPA 4FOJA 5FD0A 1E1FA 3BTNA 5HUPA 1FHVA 5A8OA 3AIWA 4OBRA 2XIOA 3P80A 1KO0A 4S38A 2WHLA 4O14A 2FZ8A 2ZUMA 4Z42C 3OZYA 2G5WA 2E68A 3C2OA 1IXPA 4ZGYA 2EG8A 2WNNA 4IIBA 4H8UA 2ZICA 2HQAA 4QE5A 1E3ZA 3WNLA 4H9YA 1US0A 2A7NA 4H9XA 1DEDA 3NO3A 5CG0A 4OQVA 2PAJA 3N25A 4LUIA 2EEXA 3CB3A 4C6EA 2C19A 4OKDA 5A2AA 2X30A 4TVUA 1ZP4A 1D7FA 3IJDA 4GVHA 3SAZA 5IRPA 4JPGA 3VGGA 4O0KA 5LIWX 2VCAA 5FAJA 1SFSA 3FS2A 5EMLA 1UA3A 1GKPA 4YU1A 4JTUA 1XR2A 2V5CA 4GKTA 4A8LA 2VZOA 3APGA 3GRIA 3THDA 1DTUA 1GOOA 2QCCA 4O0ZA 1FP8A 2A79A 1I75A 2DH3A 1EJTC 3GC2A 4QNEA 3NQBA 3OVPA 1XBVA 1S1RA 4IP5A 2ZDRA 2E3ZA 4S3EA 4ZQPA 4BKNA 4XAYA 1WDWA 4DWSD 4ACZB 1TPVA 3FA4A 1Z89A 3W1XA 1KBBA 9RUBA 5A8QA 4OHQA 3E0IA 3CZ8A 3WLJA 5LIUX 1K9FA 2P76A 1A49A 3U2CA 4IICA 1GHSA 1DJWA 2WYSA 3TYCA 3R2GA 3N3MA 4GLEA 1EJ7L 1NARA 3O6YX 3C4UA 4MWAE 1B4KA 1OF6A 1UP0A 4WSHA 4DWSB 2VWTA 3JVAA 3MV11 3KVLA 3Q37A 1ZFJA 4C6DA 4DI8A 1OCBA 3I7RA 3TQKA 4UC5A 5AHEA 4M7TA 2ADAA 2WZMA 4LC6A 1FRBA 1GYLA 3H53A 4MB1A 4CD7A 4DZAA 3XINA 1AQFA 3LA4A 1IE7C 8RUCA 3MP5A 4UTTA 3TUUA 4YVPA 1V03A 1UR3M 2VDIA 1ZAHA 4GO8A 3IK2A 3U2EA 3AMLA 3MHFA 4IFOA 3T2PA 3QHOA 2O4QA 3K8LA 1EDGA 1JNDA 2OJPA 2FVLA 2ZUWA 3T8QA 4DX3A 4JHZA 3IARA 4Y96A 1RVGA 3QHNA 1Q6GA 3M44A 3E74A 3TZNA 4WGXA 4Q8OA 5TAOA 3WH8A 1V4YA 1KA9F 3JU2A 3W1TA 3CIVA 3NVTA 4AU0A 3SCRA 2CESA 3RLGA 3VC6A 1R3VA 4IL0A 4JY9A 3TLQA 3JZEA 5BOEA 5LNRA 5EYWA 3IGXA 4GNKB 5T9BG 2AMXA 2ANUA 2CZEA 5TF0A 5CSUA 3WUEA 1DHPA 3L2IA 1QW9A 4AZHA 4ALDA 3EBVA 2CZDA 4JR5A 3R25A 2GVYA 1ONEA 3HG5A 1E6RA 3W86A 1KFBA 3KVJA 4O53A 3ZLFA 2B4GA 3VMPA 4AMCA 3UVAA 2VD9A 1ADSA 2TMDA 3WFZA 3OGSA 3VX1A 2VD8A 1EGZA 2YFNA 3NPUA 5A2CA 3UWVA 2WMGA 2YYUA 5ECVA 3N12A 4H8VA 4FNRA 2J79A 3GYCA 2O9PA 2CC0A 3I6RA 4QTGA 1XLAA 4GCXA 2J9ZA 1TTIA 2OLAA 4J4KA 3RILA 1Z69A 3L2MA 4X2PA 2EPKX 3CAWA 4JFWA 2WHJA 2PA6A 1UPMB 1JCJA 3GLCA 3HGJA 4YYFA 4DIAA 1XBXA 2ZE0A 3AICA 2NV2A 3DBNA 1ODZA 1WQ5A 1EJRC 5BWFA 3LNPA 5DX7A 2BWGA 2RUSA 3T09A 2IKGA 1B30A 3KOYA 6CGTA 1XIFA 2CLPA 4QHRA 5DXXA 1AJ0A 3SDOA 1TTJA 4LYKA 4JAWA 3KBWA 1ISVA 1SW0A 3BWWA 1XC6A 1EGVA 3ARUA 4E6MA 3TZFA 4P8VA 3H7UA 1IXNA 3S0CA 2PDKA 1ITCA 3DERA 3BGJA 3C0JA 1ZGDA 4M51A 3W70A 2DZBA 4MM1A 3LRKA 1Q6OA 4AWTA 5CAKA 4AZ6A 3BE7A 4B5WA 4E38A 1UOKA 3GKFA 1JGIA 1H7RA 3AO0A 5ABHA 1GVQA 2Y5JA 5BCAA 2BVDA 4FXJA 2GUBA 3SM0A 4A8IA 4IPLA 8CGTA 3GNPA 4R9OA 3F4WA 4IIFA 1LQ2A 2PTWA 5FAGA 3PUDA 4WSJA 4RW5A 1XYMA 3NFUA 3CPGA 4DJDD 1KTBA 3MUCA 3WF3A 1B90A 1LZOA 4V28A 3P0WA 5K4ZA 2HK1A