1AL7A

Three-dimensional structures of glycolate oxidase with bound active-site inhibitors
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
359
structure length
350
Chain Sequence
MEITNVNEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVTNIDMTTTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPFLTLKNFEGIDLGLSSYVAGQIDRSLSWKDVAWLQTITSLPILVKGVITAEDARLAVQHGAAGIIVSNHGARQLDYVPATIMALEEVVKAAQGRIPVFLDGGVRRGTDVFKALALGAAGVFIGRPVVFSLAAEGEAGVKKVLQMMRDEFELTMALSGCRSLKEISRSHIAADWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of glycolate oxidase with bound active-site inhibitors.
pubmed rcsb
source organism Spinacia oleracea
molecule tags Flavoprotein
molecule keywords GLYCOLATE OXIDASE
total genus 125
structure length 350
sequence length 359
ec nomenclature ec 1.1.3.15: (S)-2-hydroxy-acid oxidase.
pdb deposition date 1997-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1al7A00
3LV5A 3SGZA 3LBMA 2E5DA 3GZ3A 3W2MA 3G3MA 1T0OA 1TTQA 2DJLA 4OV4A 1XC4A 4XTIA 4PFMA 5F2MA 3SECA 5SWUA 1KTBA 2C3ZA 5DCDA 5EA9A 3LXAA 2JGQA 3BW2A 5HJLA 2ZZ2A 3KXQA 5DY2A 3PC0A 1SW3A 1W54A 1I2OA 1DKWA 1OJXA 1R2SA 1Q45A 2QCFA 3B0PA 5HINA 4NXSA 2A6LA 2V2CA 2ABAA 3ZWTA 1QWGA 3G1YA 2NUYA 4AWSA 1FDYA 4RK8A 3DKJA 2CLFA 1XDMA 4ZQMA 5D09A 2GQ9A 1K03A 2ZA2A 1C8VA 4GC4A 1QMLA 2R91A 2E6AA 1AW5A 3QPZA 3W1PA 1OFQA 1XXXA 2OMAA 3B06A 3DAQA 4O15A 4O1BA 2OJPA 1KFJA 1FXQA 3IGSA 3S5ZA 3NL3A 3D0CA 1XM3A 5ABTA 4PH6A 1TQXA 4UR7A 1XBYA 3LTSA 1K8XA 2Y61A 3QFEA 3FJLA 5HQEA 1RQEA 1SO6A 3M5ZA 3P67A 1R47A 2E6YA 2OT0A 5FF3A 2H6RA 4JICA 3OVPA 4IPIA 3QMTA 4BR1A 1Z44A 4NVTA 4J9JA 1VCGA 1PCKA 2PCQA 3G0XA 3G1VA 2PRLA 2RDWA 3BV4A 2ZZ6A 3S5NA 2WJZA 3TMQA 3EWYA 3UD6A 3MI6A 4NX0A 4HIBA 3Q58A 4S1FA 5AHNA 3GVGA 4HT3A 3GB6A 4N2YA 3BK0A 1KV8A 2Y62A 2ABBA 1WXJA 3C0JA 5EL1A 4UMBA 2YPIA 3S6DA 4CCDA 2QDGA 1IGSA 2XN0A 5LZLA 5I3FA 2GPTA 1KFLA 3UZ5A 5FI8A 2OCZA 2X1UA 3W7GA 5CG7A 3C61A 2AAMA 3CWOX 3GAKA 1Z42A 5U7SA 3C52A 4MPQA 3SSJA 2NX3A 3NQDA 2A85A 5AC7A 4FX7A 1O4UA 4KWWA 4FIQA 1ICQA 2DU2A 3OEXA 4GRSA 5DELA 4QNWA 4E2DA 5D37A 1RQHA 3L5MA 1OHLA 4PC8A 5D38A 3LLDA 1OFOA 3W1NA 2TMDA 1AW1A 3BO9A 1OABA 1FCBA 2ALDA 5LHEA 1TPC1 1PIIA 3HGOA 4UTWA 1FXPA 1LBFA 1GJPA 4E38A 2ZRYA 4JY9A 4UIOA 2ZRVA 3G1HA 5C6MA 1TPEA 1JCNA 3PS7A 3GR8A 1R46A 1Q3NA 4UMAA 4LWWA 1TTJA 1O95A 1XDLA 3N34A 1Q6OA 1WBJA 2VFFA 1DHPA 3QQ1A 5FF7A 1L6WA 4WY0B 3S1WA 2YX0A 3TNOA 1HG3A 1SZEA 5FF4A 2CZFA 4LUJA 1K7FA 4OWGA 3NQ6A 3PBYA 3M7WA 1ZY9A 4MLRA 1VPXA 4DPQA 3RMJA 2O7QA 1I2RA 4HPJA 3TH6A 4QISA 3A23A 3TAOA 3NA8A 3O6DA 4UTIA 2P1FA 4WD0A 1FDJA 1F6PA 2TYSA 1KTNA 3TFXA 3PULA 1YXYA 4NUWA 4HNTA 4MZ1A 3AO0A 1TTPA 3MYPA 1B4KA 5AYYA 3IVSA 3LI1A 1W8SA 5D2XA 4BF9A 3LCXA 4AB4A 2V2HA 4CQ8A 3W7IA 3HIJA 5IBXC 3W7NA 2BTMA 3MP3A 3PM6A 4LY8A 4GUFA 3N73A 1DL3A 3L21A 3UWZA 3UQNA 1OG0A 4FX6M 2EHHA 2I1OA 5CZTA 2ZCGA 1W5MA 2JKPA 3UPWA 1WAUA 4FHAA 5DCBA 1H7OA 3GKFA 5BMXA 1SO4A 3ELFA 1LOLA 1LORA 1O5XA 4CCCA 4A29A 3GK0A 3MMTA 4UR8A 1GYNA 4BWLA 3NQ7A 1J5TA 1GT8A 4JX4A 3STEA 3MP4A 2B7OA 3FFSA 5TIMA 2WSYA 3UWUA 3NL2A 1FUYA 1A5CA 2RFGA 1RR2A 1TPFA 1GWJA 3P5YA 3MP5A 2E1DA 4O19A 4WOQA 1Q6LA 3N19B 1OFDA 2ZZ3A 3CC1A 4ZQRA 2DZWA 1Q6QA 4EF8A 1TYGA 3V75A 1TJRA 2WNNA 5KZMA 2B7NA 1KBJA 4IQLA 4UFIA 3KAOA 2J27A 1KM5A 1SR9A 3DFTA 3BLIA 4RZ4A 1F74A 4IX2A 2FQIA 3LHYA 5F1UA 4CNOA 1K3UA 2Q8LA 1EWDA 1THFD 1EUAA 1WA3A 1T99A 3FKRA 4LS0A 3PUOA 2WPBA 2A2IA 1FCUA 1SSGA 3UXAA 1ML1A 2QCDB 3W76A 2GQAA 4LRTA 2E68A 4ALDA 2J9YA 3MI2A 1H60A 2FJKA 2ZDRA 4JIQA 3TJXA 3VFLA 4JGDA 3B04A 3THAA 3NQGA 2F84A 2VEKA 1H7PA 1Z41A 3DFPA 3GXNA 3L0GA 1C9DA 4RR4A 1JULA 4OBTA 1MSSA 1XBVA 1KFKA 4IMGA 2YFOA 4O0ZA 4A2SA 3T78A 5BNKA 2DZTA 1W5PA 1X8FA 3FJ6A 3PBWA 4O53A 1F6KA 1LOQA 1S5VA 3DHDA 3KOFA 4DO4A 4ZQCA 4XTDA 4GXMA 3M5VA 3PY2A 4DF0A 4DF2A 4O52A 3RF9A 5G2WA 4MKNA 2QCLA 3P84A 4NJHA 1GG1A 2P0OA 2E5BA 1I2NA 3W1XA 1OFRA 3KVLA 1IXQA 2RH9A 3TSMA 3TX9A 3GDTA 2ZRZA 3QH2A 4K6AA 3NQ2A 1OX4B 3IRDA 3RU6A 4IWWA 4RXFA 1VYPX 3TW6A 3P81A 1VR6A 4RKAA 4O18A 4ONVA 4LS1A 1P5BA 1JJKA 3FYOA 2NLIA 3TU9A 1UJPA 3BG3A 1T96A 5E93A 2QJHA 2YYTA 1NVMA 4O4WA 1QPQA 2CW6A 4XKYB 3KRZA 3RK8A 1OF6A 2A7NA 4IPJA 3OVRA 1TB3A 2E77A 2B7QA 1ME9A 3VE7A 3HG2A 3B03A 3LCGA 1H61A 4L4LA 5D04C 5C54A 2Y7GA 2DJXA 3W22A 4UTJA 3N9RA 1GZGA 4QNEA 1A5AA 3QJAA 3FS2A 2Y85A 1OK6A 3C4UA 2YZRA 1B57A 1YLVA 3WK3A 3CIXA 3L68A 2NV1A 1W1ZA 5K9CA 4YXGA 2J9ZA 4I7UA 3LHWA 1G67A 2QJIA 1VH7A 3H53A 5HULA 3I65A 1VHNA 3L0NA 4LV9A 1JCLA 3GKAA 1W3NA 2CLKA 3W75A 1GG0A 3DGRA 3F03K 1GTEA 3TA6A 1YDOA 1HTIA 4H3DA 4FIRA 3NDOA 2NZLA 1SSDA 1WQ5A 3PUEA 5CZJA 1AL7A 1LBMA 3GNDA 3P8JA 4OGZA 3UWVA 3GYEA 3PSWA 4N6FA 1OFPA 1UASA 4NZJA 5K4XA 1PS9A 1M7PA 4MIMA 5I3HA 3NAVA 1QPRA 1NAL1 4LRSA 4UFMA 3T44A 2I14A 4IOTA 3W1QA 3QZEA 3W2UA 2WO5A 2HTMA 4JX5A 2H3DA 5FEWA 3V1PA 1JCYA 3HB9A 4FXRA 1ZHAA 1ZJIA 4GUIA 5AHFA 2E09A 2NWSA 4WX2A 5BMWA 1YTEA 4AHOA 1ME8A 3W1AA 3MHFA 1W31A 3R12A 1TV7A 4UFHA 3WK2A 3CT7A 4O14A 1GOXA 1UB3A 5EMUA 4Y90A 2NUXA 5D03A 1ALDA 1JRCA 4EIVA 3LV6A 5D2YA 4JTLA 2C14A 1QPNA 4OE7A 2BX7A 2V9DA 4IUOA 3WK1A 1L6YA 4N4QA 5K3VA 4LTSA 3VE9A 4LC8A 2ZA3A 3IIXA 3JR2A 3STFA 5J5RA 2HS8A 3Q2DA 1PL9A 3UPBA 5FESA 4FNRA 2QUUA 4UTUA 4HSNA 1MEWA 1TREA 2F7FA 1RD5A 4JNMA 2V5BA 1H7XA 3UWWA 1VZWA 1EP3A 4MZ8A 3DH7A 2V30A 5D2WA 1HO1A 5AFDA 4I9AA 3ATYA 5KINA 3NPWA 5AOUA 4LUIA 5EKYA 2NXHA 4UUIA 2VFEA 1H50A 3NGJA 4DEFA 4ICNA 2CU0A 2OT1A 3W2LA 2A1YA 3VI2A 3EX1A 3G18A 1SZGA 3TJLA 1ZNNA 3E02A 1IXOA 4NX5A 1BTMA 3FOKA 3HBLA 3TXZA 3PAJA 4JR5A 3W70A 3LI0A 4TR9A 1JUKA 1EPXA 1YPIA 1V7YA 3S1VA 1CI1A 1X6UA 3UY7A 2B7PA 3M6YA 3HO8A 1WBHA 3WJXA 4ZZ9A 3QYQA 3B8DA 2WKJA 1XBXA 2QCMA 2X1RA 4GUHA 4FEZA 2DP3A 3N2XA 1CX9A 3L2IA 4AF0B 2RDUA 1KLZA 1W5OA 5AHLA 2ZZ5A 1X1ZA 2D73A 3R89A 5D33A 2Y6ZA 4QIUA 2QR6A 2ATSA 1EA0A 1GVFA 1HFBA 1A53A 5LNRA 2DZXA 2A5HA 3QW4B 2LLEA 1TPWA 1UUMA 2W6RA 4WY0A 3EWXA 2YDAA 2QUVA 4M6PA 2FPTA 4AWTA 1G4EA 3O1NA 4G1KA 3TROA 4MUZA 3OA3A 3G1DA 3KHJA 1DBTA 3LCHA 3LERA 3I68A 3T4CA 3DZ1A 3KVKA 4E0CA 3HPZA 3TXVA 4MLJA 4DO6A 2CLMA 4JYFA 5CZ0A 2ISSA 5K2ZA 1DVJA 3CHVA 1GVOA 2Y7EA 3L5LA 4JXCA 4X9SA 1JQXA 3GDLA 1SFLA 2QUTA 1UUOA 5L9FA 1TCDA 3LHZA 3GDRA 2QEZA 3ZS4A 1MO0A 1WOBA 3E49A 4QM1A 2Q3RA 1ZENA 1K8ZA 4UXDA 4RJEA 3TR2A 4ML9A 4NJGA 3QMSA 3O63A 1QNVA 4LOCA 1PE1A 3T7VA 4Y9AA 4W9TA 2RDTA 1HO4A 3O15A 1SZFA 2TSYA 2GJLA 2VFIA 1W0MA 3MBDA 1VS1A 3W7RA 2RKXA 4N9DA 1IXNA 4YL2A 2GVJA 3B05A 3SI9A 3WJWA 1O94A 3P7YA 4AEOA 2VEIA 1QO5A 1TV8A 4JDYA 3G1FA 3S5YA 3W88A 5IM51 2JKAA 2X2GA 1LZOA 2UV8G 4RCXA 4DXVA 4Y8FA 3LRLA 1UBSA 1LLZA 1V5XA 1LRQA 2J9XA 3GIYA 4JIPA 3HJZA 3T55A 3W85A 3O16A 4AH7A 3ZWSA 1LM1A 2ZZ7A 3IVUA 1N55A 2BZNA 1QDSA 3NVTA 1I8JA 1G69A 1IIGA 1FCQA 1VRDA 4KFNA 4XQ6A 3MHUA 1OFBA 1QO2A 3TW7A 1RV8A 3QEZA 2ISWA 3B0UX 6TIMA 4DBEA 2Y88A 3STGA 3F4WA 3LHUA 1VLWA 4N9CA 3W2JA 4HNNA 3VKJA 1K8YA 3W83A 3M44A 3EKZA 4O10A 1N7KA 5LHFA 1D9EA 2VOMA 1M6JA 1XL9A 1QOQA 1XUZA 5HUPA 3R2GA 3S1XA 4K8EA 1VYRA 3CM4A 1F76A 3TFCA 1N8FA 4KWVA 3E9AA 3W7CA 4MVAA 1YYAA 5CGQA 1HL2A 3BLFA 5L6UA 5EPDA 3OVQA 5CPNA 3O07A 5G1YA 4UTMA 1XCFA 1A5SA 1EUNA 3TKFA 5E0KA 2C18A 1RPXA 1JCJA 1XI3A 2YGYA 2QCEA 3LDVA 3NM1A 3H54A 2V5LA 4Z1DA 2Q3OA 3TUUA 4OT7A 2GJNA 1KM2A 2VEPA 2QF7A 3QW3A 5GVJA 2NX9A 4XKYA 1RVGA 2PC4A 2GQ8A 3MHGA 3CEPA 2X16A 3A22A 3Q94A 3W86A 4P61A 3NM3A 4MYXA 1DORA 3MI3A 4N02A 3I7QA 4JEQA 1YTDA 2ZYFA 3Q37A 4O1DA 1NF7A 1OYCA 1TRIA 2P10A 4A21A 1VCFA 4I7WA 4IJBA 1GVQA 1F73A 3CB8A 1NEYA 1R2RA 4Z0JA 1KFEA 5D32A 1I2PA 3OG3A 3LHTA 4LS2A 4FNPA 1KLYA 2QCCA 4YMZA 2C13A 1EX5A 3SJ3A 4AHPA 1EP1A 1IIHA 3NPXA 2C16A 4RXGA 1G4PA 4WY0F 1AMKA 2A21A 5I3GA 2FFCA 2JKEA 1ZFJA 4CCEA 1YTKA 2NV2A 2Z0IA 1FCVA 3P80A 1KV5A 3R8RA 1PHQA 3FKKA 3TDFA 1O5KA 1BWKA 2C15A 1TV5A 4U28A 4BI6A 2ATMA 1P4CA 4U4MA 1B9BA 4HN4A 1L6SA 3NQAA 1QFEA 5AC8A 4UTTC 3FIGA 4AF0A 1EEPA 2YR1A 3EX4A 2H8ZA 4D2JA 3EKLA 2E6FA 4ZQOA 4JTGA 1IF2A 1SQ7A 1EB3A 4LU0A 3G24A 3NPUA 3N3MA 3G1SA 4LW7A 2QCGA 4UC5A 3G8RA 4Q4KA 4MY8A 5EBUA 1GQNA 1W37A 3LHVA 2NWRA 1DJNA 5DXXA 3W7HA 3HQ1A 2VXNA 4EWND 2WNZA 3EXTA 3C2OA 1DJQA 5CZSA 5HR7A 4C1KA 5FF0A 5LKYA 3A5VA 3G22A 3LGEA 7TIMA 3WJSA 3EXSA 3I7RA 4UTHA 4X2RA 2O7SA 3MJYA 4WQ6A 4BWLC 5I3IA 4R7JA 1ME7A 1MXSA 2ZZ4A 5DCEA 3QM3A 3G3DA 1B3OA 3MO7A 1M7OA 3BARA 1IXPA 4BI5A 3O05A 1SZNA 5G4WA 3LRKA 3BW3A 1H7NA 5F4XA 5T26A 3RLVA 1W5NA 1EIXA 3W1LA 5AN7A 1F7BA 2FTPA 1YDVA 3B4UA 3KFTA 3PG8A 1ADOA 3INPA 1K7EA 3F4NA 3BPWA 3C2FA 4PEKA 1S3HA 4UFJA 1NSJA 2XFWA 5KTLA 2CZ5A 3RFAA 3KRUA 4I7VA 4NZFA 1P0NA 1LRNA 3GDKA 2GVLA 5HUOA 2QCDA 4OHQA 4XBSA 1TPB1 1UCWA 1DOSA 5A5WA 2YXGA 3CIWA 4XUGA 3KVMA 1NFBA 3MUXA 5LNSA 4OQVA 3P61A 4Z1CA 3UNDA 2I9EA 4JTSA 4N9EA 3VNDA 2Z1BA 2B4GA 2A0NA 3W7JA 3PBUA 1OX6A 1W3TA 2YW3A 2WSRA 3OIXA 4M7SA 1YPFA 4OU1A 1KTCA 3M43A 4WJEA 4K8HA 3S42A 1ZALA 4BK9A 3SGUA 2DZVA 2A4AA 3W7QA 4O0KA 5BW6A 4E2BA 5AHMA 4IMCA 1AK5A 1U83A 3FYPA 4JYEA 1ICPA 3TSDA 3EX3A 3M5XA 1GVRA 1KM6A 4JTKA 1KA9F 1OFEA 4UTWC 4O13A 2EPHA 4Y96A 3K30A 3SR7A 5CPOA 2Y7FA 2A6NA 2ZRXA 5C5YA 4B5NA 3TCEA 3SIZA 3YPIA 4IMDA 4ADTA 5AHEA 1MEHA 1J4EA 5F4SA 1LBLA 4UMCA 4WXZA 3MW7A 3TQ0A 1VC4A 2VFDA 3BG5A 2W0UA 3USBA 5C2XA 2VFHA 4JN6A 2V82A 3W7LA 3C6CA 1L2UA 1G4SA 3NEVA 1JRBA 1TPDA 3EWWA 3F1QA 4JTJA 4JTTA 1OYAA 5C55A 5AC6A 3ABOA 2A7RA 2AGKA 3LTPA 4ADUA 4AAJA 2ZA1A 5H2ZA 4Z1BA 4FXSA 1AL8A 3CWNA 4S2CA 4EOUA 2QDHA 4AHQA 2FB2A 4ZL1A 1WYIA 3PSVA 1JVNA 5AYXA 1D3HA 4AWUA 2FDSA 2JK2A 3RLUA 4H6KA 4PCFA 1JCMP 3B0VC 5KMYA 4MZYA 2Y7DA 3UZJA 3G0SA 4PL1A 5AHIA 1OK4A 2VKZG 4O28A 4M6QA 4JTUA 3W71A 5CPMA 4NQ1A 2XN1A 4TIMA 4MJMA 3DXIA 1J2WA 5J5DA 2X1TA 3QRHA 2E6DA 1TO3A 2J24A 3JS3A 4RX0A 4C1LA 3O8AA 4CNNA 5LNUA 4R33A 1OFAA 3EB2A 1KM1A 1ONRA 4IMEA 4K7VA 3TQKA 3A5FA 5IBXA 1SW0A 4WZHA 1JUBA 5D02A 5G4EA 3HG4A 2V81A 4O8RA 4JTIA 3M9YA 4IGHA 5LSMA 3S9YA 4K39A 3EX2A 2R8WA 5FEXA 2EAWA 4O4VA 2QCNA 4HPXA 4UFLA 1XFBA 1VGAA 3HF3A 1LYXA 2FB3A 4HKPA 2ISVA 4MOZA 3BGJA 4GFSA 3DBPA 3GXPA 4Z1AA 1SUXA 2ZRUA 4O12A 3ZFHA 3LXCA 3W7PA 1AW2A 3SFKA 1FY6A 1BKSA 1OYBA 4QITA 3NNTA 5KZDA 2HSAA 4JD4A 5F2GA 3NQVA 3P62A 5FEPA 1KW1A 1H51A 3A24A 3C8FA 5EYWA 3TV8A 4M6VA 3L66A 1X1OA 3W2NA 1QAPA 2Y89A 4NT0A 4TMCA 4JYDA 5U4NA 1LROA 5CSRA 4YCOA 3STCA 3IV3A 3W73A 3PBVA 4JTEA 8TIMA 5G2IA 3LB0A 1SU5A 2FPYA 4PODA 3TAKA 2G97A 3LLFA 1EWEA 2GOUA 5I3KA 3NR0A 4IXHA 3EWBX 4XBKA 4TMBA 2DZPA 4CLMA 4WUIA 3HOJA 4OV9A 4EF9A 3S0CA 3C2VA 4Z0SA 4H4IA 1I4NA 1TSIA 4M7TA 3IGUA 1KM3A 3S8HA 1Z48A 4K36A 4GUGA 4MFDA 3LM7A 1ZAJA 3GDMA 1ICSA 1W3IA 1BWLA 4N9BA 4NXKA 3NYZA 4ORMA 2V2DA 4WOZA 3BVJA 3LBCA 5G5IA 1RZMA 4X22A 3U6WA 3DI1A 3IEBA 4ADSA 5DBTA 3NXFA 4LVDA 4AVFA 3GXTA 3N2MA 5G1TA 1H1ZA 2CZDA 5K9DA 1GVSA 2QJGA 3BW4A 3EXRA 1R30A 4CNPA 1H62A 3NOEA 5D2VA 1SO3A 3UWQA 1H5YA 3P74A 1VJIA 3PWAA 2CLLA 3W7KA 4Z08A 4M5PA 4ZVJA 2PURA 4M19A 4HNUA 3NZ1A 4FB7A 3IIPA 1X7FA 5K4ZA 3FEMA 1KBIA 4JX6A 1DQXA 3NQCA 2BLEA 4FNUA 4GBUA 1F2JA 2ZFAA 3WFAA 1B4EA 3W7EA 4JY8A 3IIOA 4NNBA 2AQWA 4LVGA 1H63A 2WNQA 4O57A 1FX6A 3O06A 1TPUA 3M5YA 3W9ZA 4PTNA 3O6CA 4DPPA 1RQBA 2HS6A 4RV8A 1ZAIA 1K7XA 1LDCA 3GNNA 3P5ZA 4R34A 5BOOA 2CLHA 1CW2A 2CWNA 3E96A 3RNDA 4O17A 4IXXA 3W84A 4TX9A 4TU1A 4UNKA 3H55A 2V0TA 3BGGA 3NPVA 2A7PA 3PG9A 2H90A 1OF8A 3G1AA 2Z2UA 5FF2A 3QPYA 3GLCA 4NNAA 5F2LA 3M16A 4O11A 2R94A 1MEIA 3L0KA 4DO5A 2CLOA 1DQWA 2J88A 3TMLA 3CQ0A 1WOAA 4QJ1A 1P0KA 2Z6IA 3OBKA 3NO5A 3LCIA 4N4PA 3PB0A 3NQFA 3HPXA 3CPRA 4UCGA 2XN2A 1GYLA 1DV7A 2QCHA 4FX8A 4LC6A 3L67A 3MBFA 4YLWA 3TC7A 2VFGA 3NZRA 1LCOA 3GAYA 3DFSA 3AJXA 3W7MA 2RHGA 1FDZA 3HGJA 3LXBA 3M0ZA 4LNYA 1YDNA 4CQAA 5CKSA 4DBDA 1QCWA 4Q32A 3PVFA 1H7RA 4FF7A 1FWTA 2NXGA 4GWEA 5G2HA 1TRDA 1KM0A 4A2RA 4QQ3A 1FWSA 5AYZA 1TTIA 1W56A 3OHIA 1SW7A 5TBOA 5DN1A 3LCLA 2EF9A 3M47A 1JUEA 3CTLA 1PCWA 3LRMA 1ZCOA 4UFKA 3EEGA 2GUUA 4NJIA 4P2VA 4RZ6A 3BLEA 4HSOA 2NXIA 3TC6A 2CLIA 1G7UA 1VCVA 3UWYA 3L65A 1K02A 3PR2A 3P60A 2DZSA 1XKYA 3DFOA 4KKXA 3TSBA 1VQTA 2JBMA 1S5WA 3W72A 4ZMGA 2CZEA 3R5EA 3NL6A 1KFCA 1W5QA 2GVGA 3PB2A 2E5CA 3DENA 3W1TA 4GE8A 4Y6GA 1LP6A 1ZAHA 3M1ZA 1TPH1 3LCWA 5A8GA 4WXYA 4DQWA 1QR7A 1FWNA 4A3UA 4O1AA 3MYOA 1JQVA 2V8ZA 2YW4A 2OX1A 3ATZA 2B0MA 4FNQA 1KM4A 3W87A 2FLIA 4RZ5A 5KZEA 1VYSX 3TQVA 3HG3A 1I2QA 1WV2A 4YCPA 4QAIA 2H3BA 2EGZA 3UXDA 1O60A 3CU2A 1C29A 3QC3A 2DORA 2QAPA 5FEZA 5DY3A 1QOPA 3ABSA 1S5TA 3PF3A 1FWWA 3UYCA 3W1UA 3NQEA 4UNLA 3FA5A 2KZHA 3HG5A 4O54A 4UTKA 1L9WA 1G4TA 2WSQA 1T8XA 2CLEA 2BWGA 3W3OA 1U5JA 4JTHA 3W7OA 2VENA 1WX0A 2JGYA 5HWJA 2YSWA 3M41A 4JDBA 4X3ZA 2WOQA 1A5BA 1GEQA 1PHWA 1FBAA 3W1MA 3U8GA 2EKCA 4L4MA 5H91A 3DI0A 3NG3A 2TPSA 2G96A 4YWIA 3U2OA 4MYAA 1TPVA 3E0IA 2HMCA 4DF1A 3P8IA 2YFNA 5HR6A 3THQA 1F05A 2VC6A 3JRKA 3MWAA 5F2IA 1G7VA 5E1QA 2X30A 4FNSA 3SZ8A 1GTHA 4N6EA 4LVAA 3SW6A 4BI7A 5MHBA 2C6QA 2W79A 1NF0A 3QMRA 2Y63A 3DFQA 4GJ1A 2NUWA 1GPWA 3E12A 3L5AA 5D30A 4MY1A 3IIVA 1YXDA 1YXCA 3P82A 1LLWA 3GR7A 1JR1A 4PA8A 4NNCA 2J6XA 4LT9A 1SO5A 4O1CA 1OX5A 4JTFA 3WJYA 3S1UA 5TQLA 2TRSA 1BEUA 2PRHA 1YADA 4MY9A 2G95A 2VELA 4FNTA 3SY5A 1TMHA 4POCA 4S2BA 5HMSA 2VEMA 5D05A 1SPQA 4KFPA 5DXYA 3R13A 3FLUA 5I3JA 3UY8A 3ZR4A 1VHCA 3VCRA 1JCXA 5F1VA 4EVZA 3KRSA 5K9XA 1LTDA 3W7DA 1WDWA 3W07A 4K37A 3CEUA 3NQ8A 3A21A 2QKFA 2C19A 4RLIA 1TIMA 4GNJA 2WV8A 2PE4A 3G0UA 5K7JA 1P1XA 3ANYA 3GX9A 1FWRA 2C1HA 4R53A 2Z6JA 5EY5A 2C0AA 5HWMA 4K7YA 3W2KA 3O6YX 3W23A 3KX6A 1G6CA 3QSTA 2BXVA 3NQMA 1MZHA 3C3NA 2X1SA 4HHPA 2NX1A 4HNVA 1M5WA 1TJPA 6ALDA 3C2RA 3QF0A 4NJJA 3N14A 3QSRA 2QAFA 5LNVA 1Y0EA 3BG9A 4LV4A 2IQTA 4AMAA 5CSSA 1LOSA 1TQJA 4MJZA 3IGXA 3S5OA 1Q6RA 3LOTA 3I7SA 4K38A 4PL2A 3HPSA 2R14A 1H1YA 2Q8ZA 3HGRA 5DLCA 4DELA 4NJKA 1VLIA 3QQ0A 3I6RA 5HNRA 2PRMA 2FPVA 4ORIA 2YCEA 3PUDA 3DHFA 3DKLA 4FO4A 5KITA 4AXKA 4IMFA 4KFOA 1XBZA 1PVNA 2ZRWA 3T40A 4BFAA 3IVTA 1KFBA 1FQ0A 3WJZA 5BRBA 1OVDA 1PV8A 5CPLA 3NL5A 1HUVA 2FIQA 3C2EA 2CFFA 1E51A 1A50A 4A22A 5AB3A 3LTYA 3C56A 3TIMA 3W74A 5D2TA 4LVFA 3EWZA 3A9IA 3G1XA 3ABQA 2OZ0A 1EP2A 3KVJA 3DU0A 4ZQNA 1I45A 1AG1O 3CLMA 3N9SA 4O50A 4NU7A 5HWNA 3WK0A 3IIZA 1SFJA 2H8XA 3LX9A 3W6YA 3ABRA 5KSWA 4Q33A 1F5ZA 1XUUA 2WQPA 1QPOA 4GUJA 4MFEA 4XWUA 5LNWA 4LVBA 3TE9A 5DBUA 3G8EA 2BSLA 3DFNA 3TK7A 2ZQ0A 4UTLA 5LGXA 3L9CA 2ZTJA 5F4WA 1H7WA 3EX6A 1R2TA 4ZQPA 3LCFA 2DZUA 2G5WA 2ZBTA 4TO8A 1LRTA 4O16A 4UTTA 2ZZ1A 4XZ9A 3EWUA 4IX0A 4QSHA 3HGSA 2ZTKA 2Y70A 3HMJG 2YYUA 4CQ9A 4JS3A 1OX4A 5LGZA 1D3GA 3W1RA
chains in the Genus database with same CATH superfamily
3LV5A 3I4KA 3ITOA 4HBKA 3W2MA 2EG7A 1TWWA 1UWSA 3ITGA 3GG0A 3I6TA 4XTIA 3RLGA 3KBWA 4AXNA 5SWUA 3AWOA 4OVXA 4DBUA 4Y8EA 3RO6A 3GY1A 3WQ4A 2OO0A 2JGQA 3WLMA 3KXQA 5DY2A 1SW3A 1FWEC 1DKWA 1OJXA 5LXEA 4NXSA 2A6LA 2OO6A 2EPNA 2X42A 3ZWTA 3W28A 1SR0A 3G1YA 2YBUA 4AWSA 3IK2A 3W4RA 1MW2A 5GNYA 2D2JA 3DKJA 4P7OA 1CLXA 1C3FA 4A4AA 1K03A 2ZA2A 1KCLA 4GC4A 2XH2A 1GQKA 4HJWA 1OFQA 1J01A 1VB9A 1E4IA 3K8LA 1LQAA 3NL3A 2RAGA 4HYWA 1XYMA 3LTSA 2OZ3A 2Y61A 1J0YA 1RQEA 5BXTA 3WQWA 4JAWA 3OVPA 3E2SA 3UJRA 3GG1A 4TQTA 2PCQA 3G0XA 2PRLA 2RDWA 2E9LA 4HOXA 3R79A 3PPHA 4GYJA 4L64A 3NTYA 1XLHA 4ZOCA 3FDKA 4N2YA 2ABBA 1WXJA 2INZA 4CD7A 3S6DA 4CCDA 3KUMA 2XN0A 1NQKA 5I3FA 2FGZA 1KFLA 1FHVA 1WKFA 2PPGA 2F2HA 5FI8A 4J3XA 2BXYA 3C61A 1A4LA 3ANUA 3OZMA 3OZOA 1Z42A 5U7SA 2ZWYA 2GGEA 3NQDA 4GCAA 4FX7A 2E3ZA 1VFTA 2OKOA 5D37A 3RPTA 3ZLFA 1RAKA 3ICJA 1OFOA 2TMDA 1AW1A 1OABA 2HBXA 1EL3A 5LHEA 1PIIA 1H49A 3BSHA 1LBFA 4DJDD 1ZS2A 4L80A 1TG7A 2W92A 2Z28A 1E73M 2DH2A 1AH0A 2IMRA 1Y65A 4R5EA 1NM9A 1Q3NA 4LWWA 1HP5A 3AS0A 3V5OA 2FVKA 4M29A 1GOKA 2VFFA 4GKLA 3W81A 1V3KA 1L6WA 5FJOA 1FTXA 4WY0B 3DERA 4PE8A 2DH3A 3WUFA 2YX0A 3KDNA 4D6GA 3S3GA 1SZEA 4G9PA 2WC3A 1K7FA 2EPMX 2OYKA 4OWGA 4HZMA 1ZY9A 3EMZA 3GRIA 4B2DA 4V1YA 3N2CA 1KRAC 3TH6A 4QISA 4E6MA 3NA8A 4MUPA 5EFFA 2TYSA 3TFXA 3PULA 1YXYA 4HNTA 3KCOA 3K5XA 2FHCA 2IW0A 3AS3A 3ZVHB 1E0XA 2OSXA 2VWTA 3GFYA 2DUAA 3ZJ8A 3MP3A 2BY0A 4JQ2A 2IPFA 2XWDA 1T8QA 3FW6A 3OYXA 4BJHA 5CZTA 2JKPA 3R58A 1JDCA 1GPFA 4IH3A 1WAUA 1H7OA 4LY4A 3ELFA 2O4MA 2WZIA 3CHFA 5CSYA 1J96A 1O5XA 4UBPC 2QPXA 2CXEA 1GYNA 3ORWA 5E9XA 3NQ7A 1GT8A 1DTNA 4FXJA 5C2CA 5GQBA 3NL2A 3LZ3A 4YIWA 2WKLA 2DIJA 1AFSA 2PBOA 3GNXA 2RFGA 1MDRA 1XLEA 3OYZA 1GWJA 4IM4A 3MP5A 3NWRA 3AMGA 4DO7A 4IP5A 4ZQRA 2DZWA 1Q6QA 1OC5A 4Q4SA 4EF8A 1TJRA 1KBJA 4IQLA 3SUWA 4GMEA 4UFIA 1IT7A 1SR9A 3WEMA 4RZ4A 3GE7A 4MPKA 4IX2A 1P6WA 2FQIA 5F1UA 3WNLA 2Q8LA 1EWDA 1RY8A 1WA3A 3PUOA 2BY2A 5D9MA 1FWGC 4F3HA 2BVWA 2QCDB 3T0AA 1XKJA 3TP4A 3W29A 2E68A 3WQFA 4OKDA 3O7UA 4F0MA 3LPOA 1H60A 2ZDRA 3VNKA 4ZO8A 1UQYA 4ZO9A 3OQ8A 1C90A 1Q85A 2HBVA 1D3CA 4PMUA 3THAA 4ZB2A 2XGIA 3UYIA 4KERA 4RPQA 2F84A 2VRJA 1UIPA 4OBTA 4PTXA 1GQJA 2OWXA 1YEYA 3U5UA 3WO8A 4DUVA 5BNKA 2DZTA 5J04A 3CZGA 5EMMA 1LOQA 1S5VA 3QHMA 3KOFA 4PGLA 4GXMA 1VIZA 3R4IA 4L5ZA 3ARTA 2V3GA 3WNKA 3SQSA 2XVNA 4H8VA 2E5BA 5HDRA 4Y9OA 1RCOB 2VOTA 3W1XA 4LAKA 1ISWA 1DIOA 3SUTA 2RH9A 2BG5A 3WLIA 1XLKA 4WGHA 1H1NA 3NQ2A 3RU6A 2UY5A 2ZWZA 2QW5A 4GGBA 4GFIA 4O18A 3VZZA 1JJKA 1WP6A 1HGYA 3ZT7A 1NP2A 2NLIA 3LPPA 4U33A 1S1PA 4F9JA 2YL6A 2CW6A 3KLLA 3KRZA 1RP9A 2Y0FA 1OF6A 1NTHA 1WZLA 2PDLA 2B7QA 2I57A 4QDWA 5D04C 1UR0A 2DJXA 3N9RA 3AXIA 5A8OA 4JKKA 2WMJA 1ZRQA 2Y85A 4IGSA 2F6UA 3CZ8A 3C4UA 1B57A 4GIEA 1BFNA 4P7NA 3L7RA 3CIXA 3L68A 1W1ZA 3QV8A 2YA0A 5K9CA 5C2GA 2J9ZA 4I7UA 2VCBA 2HQAA 2QJIA 4E3TA 1RA5A 3REQB 5IXEA 3L0NA 1JCLA 2VX6A 4JIHA 2PDQA 5CPTA 4H3DA 4F8XA 2PCEA 3NDOA 2V6AA 1AL7A 3GNDA 3PK7A 2GWGA 3GYEA 1B0IA 8A3HA 2WSKA 3B8UA 2JF6A 1JXKA 1OFPA 1UASA 3ALFA 4NZJA 4CCZA 3DFHA 1IZJA 4LRSA 4X0VA 3T44A 3QZEA 4HGXA 2HTMA 3MTWA 2J8TA 5FEWA 4AZGA 5JVLA 4AZBA 1ZJIA 4J2PA 1P7TB 2E09A 5BMWA 4AHOA 1JZ7A 4M56A 1TX2A 3R12A 1IQ8A 3A13A 3CT7A 3FGCA 1B3ZA 5JH1A 3A6OA 2OGYA 1UB3A 5D03A 2OOGA 4KIEA 2BMBA 1TR9A 4A8RA 4XAFA 1HL9A 4IUOA 3WK1A 5A6KA 5K3VA 3PZ9A 2EJ1A 4LC8A 2VO5A 3LG3A 3STFA 4C7GA 5ENLA 2AMGA 3BL3A 3S9ZA 3CASA 4UTUA 1MEWA 4AY1A 1TREA 2AL1A 4BA0A 3VGFA 2HZGA 1VZWA 3AUJA 3GVVA 2FZ9A 2IKIA 4GNVA 1HO1A 1IT0A 3ATYA 3UCDA 5KINA 1EGVA 1JYVA 5EKYA 1E43A 1H50A 1M68A 1YQ2A 2CKSA 2VURA 1XYAA 5E09A 3TLQA 3UWEA 2WCGA 1ZNNA 1FWHC 2PWEA 3RGTA 3EOSA 4F48A 1WDRA 3U2ZA 3M64A 1EF3A 3IPWA 1XLJA 4TR9A 2WAGA 3E2RA 1V7YA 4ZODA 4KWUA 2CKRA 3UY7A 2OB3A 4C7FA 3HO8A 1WBHA 2XVPA 3WJXA 4ZZ9A 4IISA 3AS2A 4X63A 2QCMA 2DP3A 1CX9A 3L2IA 3ZVHA 5AHLA 1XRVA 2ZZ5A 1V0LA 2FJUB 2Y6ZA 2QR6A 2ATSA 1XCXA 1HFBA 4S3KA 1LJYA 2LLEA 2XVGA 4WY0A 4GD0A 2FPTA 2QMKA 1V51A 1SJAA 3I3BA 4BY3A 1XIFA 5LIKX 4IIHA 3OA3A 3LERA 2ISDA 3DZ1A 1F6YA 5DX7A 2E8YA 2CLMA 2ISSA 5K2ZA 4LBSA 1DVJA 3CHVA 4Z2IA 3LNPA 1JQXA 2PWGA 2BP1A 4X9YA 4HZ6A 1XLIA 2QUTA 4GQRA 3WLHA 1UUOA 2EG6A 2ZXBA 3LHZA 3H7UA 3E49A 1K70A 3QV9A 2Q3RA 3IJ8A 7A3HA 1E40A 4ML9A 4NJGA 3TN3A 2QS8A 5BU6A 3O63A 3PFRA 4Y9AA 2FTYA 2DEPA 2VFIA 2V68A 1W0MA 4C6DA 3GXFA 2PGRA 4L1XA 3B05A 3PANA 1AZ1A 3SI9A 4FALA 3T05A 4H00A 1A0CA 3N1AA 4G1NA 4JDYA 2I17A 1QK0A 5I06A 2JKAA 1EYEA 4DXVA 1DXFA 2VUYA 2VMFA 1VPYA 4DRSA 3T55A 4AH7A 2X05A 2ZVIA 1N55A 1RLCL 2Z29A 2QHAA 1IIGA 1FCQA 3U7VA 1FWDC 1FH8A 3MHUA 4B3LA 1QO2A 3PPFA 3QEZA 4IIDA 2PUZA 3B0UX 3RCYA 4BF7A 4DBEA 3F4WA 4FMVA 3LHUA 4N9CA 4DBWA 2GSHA 3W2JA 4XAZA 3AHTA 3VKJA 3W83A 2BS9A 4A05A 1N7KA 1GKQA 1D9EA 2VOMA 1XL9A 4K8EA 1ZUAX 5TNVA 3TFCA 2VD8A 5JXQA 3O0KA 1MRQA 1N8FA 3CZJA 1VD6A 3O3RA 1A49A 4LSBA 1V79A 3O07A 1TX0A 1UPMB 3VKBA 5E0KA 1XIJA 1UWAA 1RPXA 2PU1A 3MQTA 3LDVA 2BOFX 4H9UA 1PPIA 4PMZA 5HQMA 2V5LA 1IR1A 4LBUA 4ZOEA 2FHBA 2VEPA 1QBAA 5EMYA 2PC4A 4HTYA 3MHGA 4DNMA 1G01A 1QI2A 2X16A 1E9LA 1K9EA 4MYXA 1YTDA 4M0XA 2NV9A 4KCWA 4A21A 2ZDSA 1VCFA 4I7WA 4NI8A 1F73A 1RK6A 1UKOA 3PZVA 1VBHA 2PP3A 8CGTA 4MGGA 3SJNA 3OG3A 4EXAA 1EX5A 4PUUA 1EP1A 1IIHA 1XQKA 1AA1B 1EC9A 2C16A 3VGHA 3GUWA 4PCNA 3KS5A 2W9MA 2FFCA 1ZFJA 4CCEA 4IFKB 5AY7A 3UW6A 4GIYA 1PHQA 1AH4A 1I0DA 3TDFA 2JQXA 1BWKA 1XJBA 3E74A 4U28A 4BI6A 1M7XA 4QE4A 1P4CA 2PDNA 3VIGA 1YBQA 3K4WA 2QV5A 4HCDA 1L6SA 5KETA 1JZ2A 1QFEA 2XVKA 3P0XA 3CMGA 2Y5SA 4Q7BA 4AF0A 2GK1A 4PEEA 4DHGA 1UD3A 4ZQOA 2WK2A 3RLHA 1U1HA 5EMKA 3NPUA 4HD5A 4BZYA 2X0HA 1S38A 3G8RA 3REQA 2OGJA 4XG1A 5EBUA 1GOIA 4L6DA 1EC7A 1XFCA 2ZC8A 4GX8A 3VU2A 3DIPA 1HKWA 3W7HA 2GDUA 2QPSA 4EWND 3VKKA 3W6LA 1XH1A 3DCPA 1KCZA 5CZSA 5LKYA 4D8LA 3LGEA 4U10A 1RK5A 5MF5A 5HJXA 2YL8A 3RJYA 1HVXA 1RJPA 4X2RA 2O7SA 2V38A 1PZ2A 3PJTA 2G3NA 3BANA 4Q3MA 3BAJA 2EPKX 2ZZ4A 3LM3A 2J74A 2V5CA 1FKWA 4Y9PA 3H23A 3WQ6A 2BBFA 3BW3A 5E6YA 3PUGA 1W5NA 7XIMA 2FTPA 1BPLB 3B4UA 2HV5A 4XAPA 4AIEA 1ADOA 3INPA 1Q8JA 1JGIA 4NAEA 3C2FA 3QGAC 4PUNA 1S3HA 4ZCWA 1TMLA 3W24A 4Z1YA 3RHGA 4NZFA 3FN9A 4HTBA 3GDKA 2GVLA 3DGBA 4C6EA 2QCDA 1ZBVA 2HRWA 3KVMA 1NFBA 2FMNA 3WH5A 4KEVA 3P61A 2XZ9A 6REQA 1E1EA 1OCQA 4IGMA 4QG8A 3MSDA 2A0NA 3PBUA 1OX6A 3OIXA 4M7SA 2VDIA 5DRCA 4K8HA 2DZVA 1HXJA 3KHDA 1UHVA 5AHMA 4IMCA 1AK5A 1FP8A 1U83A 3FYPA 4JYEA 1ICPA 2O4QA 3A3WA 4JTKA 4UTWC 4PTDA 4G5DA 2Q8XA 4JTQA 4NG3A 2X2YA 4KPLA 3CMJA 2ZRXA 4B5NA 4O0QA 3UNTA 4IMDA 1C8QA 3WD4A 4S3GA 4NHVA 1J4EA 2ADAA 4XD6A 3ZO9A 1M65A 4JQ1A 1R6WA 3PJXA 3GBDA 2W0UA 1C7TA 2PMQA 2IPJA 1LT7A 4W93A 4XBJA 2AKMA 1A5MC 1L2UA 3LMYA 3NEVA 1C92A 2WNWA 4JTJA 4JTTA 5ABHA 5C55A 1HP4A 5AC6A 3ITCA 3LTPA 1BF6A 4AAJA 1NOWA 5H2ZA 4O8AA 4DZHA 2D3LA 2NQ5A 1XPYA 4GPNA 1F07A 2QDHA 3STPA 2FB2A 2VGFA 3UCQA 4A35A 3PSVA 5AYXA 2FDSA 3N9KA 1QHZA 3AXXA 2GVEA 4WKHA 1JCMP 1XC6A 3RR4A 5AHIA 1DWHM 1G1YA 5AZ1A 5CPMA 3WD3A 1LWHA 4G2DA 3NZPA 3QRHA 2HVNA 1EF2A 2GQ3A 4QEEA 3VO0A 3O8AA 3B0YA 3RUBL 1I75A 3EB2A 4RE4A 3OLDA 1KM1A 4IFOA 1ONRA 4LAMA 2WB5A 5IBXA 4GNKB 1SW0A 3NXLA 3QFWA 5G4EA 3HG4A 1DIEA 1E9IA 3QOMA 3H21A 2R8WA 5FEXA 2EAWA 3UA4A 3UETA 3HF3A 3SGGA 2DGAA 5A2AA 2ISVA 2H9AB 4GFSA 4PBGA 4RDVA 4Q6XA 3GXPA 3V35A 2ZADA 2ACSA 2NSOA 2WCSA 3KZSA 3ARYA 3SFKA 5BXPA 2WZHA 1FY6A 1BKSA 3SCQA 4R7WA 3AU2A 2HSAA 4JD4A 1UZ4A 5XIAA 3NQVA 2QQ6A 4LCRA 5FEPA 1H51A 4XSMA 4LUSA 1P48A 5E0FA 3T42A 2AKZA 4QEHA 3L66A 1BVNP 1PWMA 4HA1A 5D8WA 2Y89A 2PD5A 4AD5A 1VEOA 1DPMA 4K1GA 5CSRA 4YCOA 3IV3A 4H04A 3W73A 3U7BA 3VNIA 3EEZA 4HU0A 4JTEA 3LB0A 1SU5A 1NU5A 1X38A 3VD3A 3NR0A 3VDGA 2VCCA 3G6LA 2DZPA 3UG4A 1XRTA 4C6NA 1EHNA 4EF9A 3QOKA 4ZR8A 2C1GA 3IGUA 3W6MA 1KM3A 3IS4A 5CC3A 4PMYA 3LM7A 4P8WA 3GDMA 1EJSC 4RZBA 1W3IA 3B97A 4KGJA 3B40A 3S1GA 1J12A 1BLIA 3RU8X 3MSRA 3PAOA 5G5IA 4X22A 3GWQA 3IEBA 1JZ4A 4Z17A 2Z2AA 4A8NA 5DBTA 3WUGA 3NXFA 4LVDA 2Z26A 3FAWA 4BKNA 2CWXA 3HMCA 1P0DA 2HCVA 1R30A 5D2VA 1SO3A 1AQHA 1VJIA 3EB4A 2CLLA 1JAEA 4GO9A 4HU4A 3B9NA 1JD7A 4CU8A 3NZ1A 3SCOA 4FB7A 3PP7A 5H8PA 3IIPA 2V5DA 2BOGX 2DDXA 1F2JA 4HCLA 3WFAA 1XS2A 3UGVA 3W7EA 4NNBA 3VNYA 3CV2A 1B1YA 4O57A 4ROPA 3M5YA 3MKVA 4J3UA 2KAUC 4E4FA 2TODA 1LL7A 3O6CA 4DPPA 2D0GA 1EBGA 5I2UA 4DUXA 1R5YA 4V33A 5FAJA 4IXXA 3NVDA 1KGXA 3MPGA 2V0TA 4DI9A 3NPVA 3RIKA 1K77A 4PR4A 1QNQA 3G1AA 2Z2UA 1UKSA 3DX5A 2XIBA 3KEHA 4CNSA 4DO5A 2CLOA 3F2DA 3WUEA 2Z6IA 1X8CA 3APYA 4RNIA 4ZFMA 4AZ7A 4YTRA 3CPRA 2Z1WA 4AUBA 3UT0A 4ZXLA 1NWRA 4Z2HA 4QJ4B 1J0HA 2L5HA 4LC6A 1IZCA 3TC7A 5HK4A 4YLWA 2YDSA 3MMDA 3NZRA 5I09A 4NYUA 3DFSA 3AJXA 3EA1A 4PRTA 2NSXA 5LIWX 1YIXA 3M0ZA 4YU1A 4DBDA 2YJQA 1QNSA 1XLFA 2ZUUA 4G56A 1QCWA 4AISA 4GINA 3PVFA 2XISA 5IFPA 5IFTA 4PUJA 4FF7A 1FWTA 1TRDA 2HEJA 1RJRA 3P3BA 1P0BA 5TBOA 4MB4A 1A0DA 1C9WA 2EF9A 3M47A 4LUTB 2G4FA 4J2MA 2VI0A 3CL7A 2YBVA 1XISA 3EEGA 3SFWA 2PS2A 2GUUA 4NJIA 3RM9A 3GSMA 4Q4PA 4HSOA 1V0KA 2CLIA 1JD9A 3HQNA 1H11A 2DZSA 4M24A 3PZOA 4GYPC 3DFOA 2DW7A 2VDHA 2GUYA 1ZLPA 4RW5A 3TSBA 1VQTA 2W63A 4ZMGA 2OYLA 4XSLA 1NQ6A 4GGHA 3WBXA 2GVGA 2E5CA 1IE7C 4GE8A 3KCJA 4KCVA 4ZTYA 1ZAHA 3N4AA 3LCWA 4DQWA 4WXYA 1GW1A 1QR7A 2NW0A 3FXGA 1JDEA 2FYMA 1EFZA 2WBGA 3BLOA 4Q8OA 4YS1A 4S3BA 1VYSX 3TQVA 3HG3A 3CL6A 4JKMA 3AALA 1JF6A 4QLKA 2PDPA 1HX0A 1WV2A 3TQPA 1W3HA 3UXDA 4K2SA 3AHZA 1HKVA 4UR9A 4GH3A 1S5TA 3PF3A 4D8ZA 1W1VA 3W1UA 3NQEA 4MF4A 4BF5A 1F4AA 2P50A 4O54A 1B3YA 4H9TA 4JN8A 3BSGA 2WSQA 1Y5WA 2CLEA 3W3OA 1U5JA 4EACA 3W7OA 4QR6A 1NFGA 2IPWA 3DYMA 5HBFA 1IWBA 3QBUA 4HNCA 7REQB 2QLYA 4X3ZA 2WOQA 1RCQA 3GXIA 1A5BA 4FLOA 1GEQA 1PHWA 5H91A 3WF1A 2TPSA 2G96A 4YWIA 3U2OA 3NURA 3WF2A 2DVXA 3CHDA 3E0IA 3ITLA 2HMCA 5HR6A 1VJZA 5A6AA 5E1QA 2X30A 5A8NA 1S2VA 1P43A 4LVAA 1T5AA 2W79A 3BOFA 4LYKA 4FR1A 3E12A 4MY1A 4IPPA 1GW9A 1N8WA 1A3XA 1YXCA 3GR7A 2FGLA 1OADA 3NDZA 4YHGA 4GY0A 2J6XA 2CNCA 2BHYA 3AXKA 2PRHA 1YADA 4GY1A 4IQDA 4TXEA 4POCA 5D05A 1SPQA 4KFPA 5I3JA 3QZAA 4I8DA 1D8WA 1OCJA 2HROA 1HKJA 2FH6A 3KRSA 1UWQA 1FA2A 5K9XA 2ZUNA 1WDWA 4K37A 1XSIA 1R3TA 4GNJA 3MY9A 1P1XA 3ANYA 2ZX5A 1S46A 1W6TA 2Z6JA 4Z42C 2C0AA 5RUBA 4HHLA 4M6UA 1Q4WA 3W2KA 3O6YX 3UU0A 3QSTA 2PP0A 3TCSA 2EEXA 2X1SA 2JIEA 2NX1A 4DM2A 1M5WA 1TJPA 4C6FA 1VFSA 3C2RA 4KRZA 4QJ5B 2QAFA 1JZ5A 6TAAA 2OU4A 1Q6RA 2AMXA 3F4VA 4GZJA 4RW3A 3UVAA 5JIWA 3HPSA 3SIMA 1H1YA 2AQOA 3B9EA 4NJKA 1KKOA 4RNJA 3I6RA 1BVZA 5HNRA 2PRMA 2FPVA 2OG9A 1P0EA 3DHFA 3PJWA 3DKLA 4FO4A 3V36A 3WBAA 1XBZA 2HDJA 4QE1A 1QNOA 4MNMA 4CGTA 2XIIA 3OZYA 1OVDA 3EPOA 4BEQA 1HL8A 5CPLA 3KOYA 2FIQA 3C2EA 4PUEA 4MADA 1A50A 2DT2A 1A5UA 4A22A 3LTYA 1WAWA 3W37A 2VZTA 3LSBA 1Q7QA 1BRLA 4QS6A 2HXTA 1EP2A 1KXTA 1LUCB 1CGXA 2YXXA 4O50A 4NU7A 5HWNA 1FHDA 4I9TA 3GTFA 3CUZA 4Q33A 2CXGA 3WFLA 3OBAA 2WQPA 4MFEA 4QX4A 1NJJA 4ATLA 4F2BA 1KCKA 3VINA 4AFYA 2ZQ0A 4UTLA 3BCFA 2ZTJA 1DQUA 2ODOA 2XH0A 2O9TA 1R2TA 4ZQPA 3EOUA 2G5WA 1E9ZB 3E38A 4R9XA 4XZ9A 5E9AA 1ZJBA 2WKGA 2F6KA 4IX0A 2YYUA 4B9YA 4ERGA 3BC9A 1BYBA 2ZUTA 3N6QA 5LGZA 3AMKA 1D3GA 3LBMA 4Q4MA 1DJHA 3SCVA 3G3MA 3WH6A 4OV4A 1XC4A 4PFMA 4EXBA 5F2MA 4ZGYA 1XIBA 5EA9A 1BXCA 2JF7A 3BTNA 2J62A 3BW2A 1O66A 3NEHA 3PC0A 1I2OA 1Q45A 4CQCA 3GC5A 1YNQA 1EOMA 4IIFA 1FWBC 3ARRA 2VGGA 4XVEA 3HPAA 1IEIA 5D09A 1NARA 4ACYA 3PTQA 2CESA 1Q13A 3AWNA 3CIVA 2E6AA 4UZUA 3W1PA 2J47A 3LLXA 1M41A 1T40A 1XXXA 3M7SA 3W38A 2OJPA 1KFJA 3BAKA 4H8HA 2Y5EA 3ZSSA 4WGXA 5JBDA 1TQXA 1TWZA 4UR7A 2XYLA 3TZNA 3FJLA 1IWAA 2DT0A 3ME3A 5HQEA 1SMAA 3P67A 1R47A 1XRFA 2H6RA 1UYQA 4IPIA 3QMTA 2E8ZA 3WQEA 4NAFB 4J9JA 1VCGA 3BV4A 2E40A 2ZZ6A 1P1MA 1R8LA 2HJPA 3VNZA 3MJMA 3AYSA 3UD6A 5CH9A 3MI6A 1UOKA 1S3TC 4HIBA 3Q58A 2C8NA 9XIAA 1RPKA 4DJDC 1BG4A 4D1IA 4MDOA 4H19A 3HJEA 2F9RA 2DZBA 1F61A 2OCZA 4URIA 3W7GA 3PWGA 3CUXA 1EJ7L 3V1HA 3ANVA 4QG6A 3D3FA 5AC7A 4TOQA 3ISIX 4KWWA 1I1XA 4C65A 5DELA 4QNWA 4E2DA 1BXBA 1B54A 1RQHA 3L5MA 1OHLA 3LLDA 4QRNA 4MSSA 3ARWA 3W1NA 4IP7A 4HB7A 2AL2B 3BMVA 3T1GA 1E3ZA 3SCSA 4HHMA 1CGUA 2C91A 3HGOA 1ODZA 1FXPA 4E38A 5E0CA 3H2MA 4WRHA 5C6MA 1E56A 4NAEB 3DYPA 3B4YA 1R46A 3NGFA 5FACA 1OT1A 1CLKA 1QK2A 3S1WA 2PF8A 3BUVA 1RXOB 3OB8A 3PHAA 1S5NA 1U2YA 3PNZA 3K2GA 1DWFM 3PBYA 4AVOA 5ECUA 4MLRA 4DPQA 3RMJA 2NQZA 4H8UA 1RALA 3MV11 3A23A 4LYRA 2SFPA 1V0NA 1FDJA 1F6PA 4Q4OA 1KTNA 5HOSA 3AIBA 4H1ZA 3M07A 4RPPA 1RSCA 1B4KA 3SUUA 3IVSA 3LI1A 3U2EA 1W8SA 2XSBA 2VYOA 3L2MA 4GQBA 4CN4A 3BMXA 1PZ1A 3CV1A 3HIJA 1XIHA 5IBXC 4NZCA 5T8GA 2V5JA 3CGTA 1J5SA 1DL3A 3L21A 3L4UA 5DFAA 3V18A 4DB7A 1OG0A 3TTSA 1TVNA 2W3ZA 3OO2A 3BCJA 2OLAA 3GU1A 3QZ6A 1LLOA 3M0HA 7ENLA 1DXIA 2YZ5A 1M04A 1R7OA 2CZVA 1J0KA 3TYUA 1KWKA 4UR8A 1FFQA 3WQCA 3STEA 5CLWA 5TIMA 4EK7A 1ITXA 4KT2A 4HYVA 1FUYA 4GISA 4QTGA 2AGTA 2J7CA 1VBJA 4CKQA 4C1NB 1FWFC 1KR0A 4O19A 1JF5A 1N2VA 4WOQA 1Q6LA 3AU6A 1BTCA 3N19B 2GJXB 2ZZ3A 2Y8VA 3SCNA 3V75A 3WMLA 2B7NA 3ZMRA 2J27A 2CC0A 1UZ1A 3DFTA 2P53A 1F74A 1O7AA 4NRRA 1IWPA 1LT8A 3LHYA 4CNOA 1ADDA 1UW9A 4QLLA 1E3XA 1T99A 3QLDA 3UXAA 4DJEA 4Q22A 2IQDA 5H1WA 1S2UA 2EO7A 4LRTA 3JU2A 3PN8A 5DEZA 2WMFA 2XFRA 1QRQA 4JGDA 3OZPA 3NQGA 4LANA 4GY7A 1Z41A 3DFPA 1X7IA 1JGMA 4U5IA 4RR4A 1JULA 1UZDA 1YNPA 1XYZA 1KXQA 1XBVA 2XPKA 3T78A 3KTCA 5G4HC 3PBWA 3HZ3A 4MKSA 1F6KA 4ZQCA 1MUCA 3H24A 2JALA 1UR2A 4DF2A 2WW5A 4AU0A 5EB8A 4R85A 4MKNA 3JUGA 4B16A 1R3VA 1GG1A 4YTUA 2DV0A 5C70A 1OQFA 1VFHA 3XISA 2PGWA 3GUGA 3N17A 4M51A 2D24A 3TX9A 4LCSA 3GDTA 4YHEA 2ZRZA 1DIKA 3P2VA 3QH2A 4K6AA 1OX4B 1MFVA 3W82A 4RXFA 3R0DA 1OB0A 1VYPX 5AKQA 1Q2RA 3P81A 4D6IA 3TJIA 4RKAA 3N18A 2B81A 4ONVA 3OW1A 1VJSA 2BNJA 3M0KA 1QI5A 4EAMA 4S3AA 5AZ0A 3RK8A 1MFUA 2DVUA 4UNIA 3OVRA 6PTDA 3HG2A 3TJ4A 2GSEA 1UG6A 3W22A 4CN6A 3K13A 1GZGA 1A5AA 3FDGA 3FS2A 1P6BA 4C6OA 4W7UA 1LG2A 2WLYA 3D46A 3IGHX 1SVDA 2V63A 5LIXX 1XRSA 3WK3A 2OEKA 4WCJA 4YWSA 2HPIA 3EDJA 1CXFA 1VH7A 2YA1A 5FJTA 3BLLA 3I65A 4AIUA 1VHNA 1PAMA 1TWSA 4HMDA 3GKAA 3W75A 3DGRA 2PTDA 2ZE3A 1HTIA 4FIRA 3T2PA 4PBEA 4HU8A 3K46A 1REQB 1O1HA 3MSYA 4J5NA 5CZJA 1A5NC 3P8JA 1REQA 3OODA 2REQB 3OGVA 1W2PA 2PLKA 7CGTA 1BGAA 2Q6ZA 1CT5A 1H2JA 1KBBA 2QIIA 4H7ZA 3R1ZA 5I3HA 3NAVA 1NAL1 3WLKX 1WDSA 1D8CA 4IOTA 4LUSB 4JX5A 5ECVA 4AZIA 3VNJA 3PZIA 3UA3A 1ZHAA 2BGSA 4GUIA 1RBLA 1QW8A 4WX2A 3TTQA 1ME8A 3MHFA 1W31A 1XCWA 1GOXA 2QNEA 4E4UA 1S5MA 1ALDA 1JRCA 5D9NA 2WMKA 1A0EA 1LQ2A 4DZAA 2BX7A 2V9DA 1L6YA 1TV2A 2ALRA 4HA0A 5BROA 1QI3A 3VE9A 2OQYA 3IIXA 5J5RA 4H2HA 1L6GA 5A95A 2OLSA 3Q2DA 1PL9A 4W87A 3OLEA 1WB0A 3SCWA 2F7FA 1RD5A 4JNMA 4EXQA 1EP3A 3DH7A 2V30A 4JFWA 4XD3A 5AFDA 3S9IA 1V02A 5AOUA 4LUIA 2NXHA 2VFEA 4RV3A 3NGJA 2J6VA 1X6LA 2CU0A 2OT1A 3F2CA 3VI2A 3I3EA 1X97A 1SZGA 1B90A 5CPQA 3TJLA 1S39A 1IXOA 1BF2A 3FOKA 5C9WA 3HBLA 5ABFB 4QCEA 2VUNA 3TXZA 3PAJA 2OEJA 5D4YA 4D6EA 4ZSTA 1JUKA 1YPIA 3S1VA 4OFCA 1CI1A 2XGBA 1V6UA 2X0SA 4Q8PA 2MNRA 3QYQA 3KDOA 1F3WA 1LUCA 4GUHA 3IJQA 3N2XA 1GQIA 5DMYA 5B80A 2XHYA 5D33A 1S2WA 1A53A 2DZXA 2A5HA 1ONWA 3QW4B 5ABFA 3KM8A 3H2EA 5JQ9A 1BSIA 3CT2A 4AWTA 1A5OC 3O1NA 2PDXA 3G1DA 1DBTA 2XFYA 4DX3A 3I68A 4PSRA 4E0CA 3H4WA 3HPZA 4MLJA 1MVYA 1UWTA 4XZLX 4MWAC 2WZMA 3L5LA 4X9SA 4QQUA 3ZLGA 2CEQA 1SFLA 3ZOAA 1TCDA 3GDRA 2E9MA 4QM1A 4JNYA 5REQB 1ZENA 3CTTA 3TR2A 1E1CB 3KBSA 2Z1SA 4NILA 3H2NA 1VBRA 2RDTA 1HO4A 2CBIA 4V1XA 4DYJA 1SZFA 2TSYA 4WKAA 4X61A 3L23A 3MBDA 3EDKA 3EDDA 3VGBA 3WJWA 1RLDA 3P7YA 3T09A 4IJRA 5LYRA 3CAQA 4B5UA 2WMIB 3G1FA 2ANUA 4QFUA 1KRMA 2X2GA 2UV8G 5XINA 3VDHA 1AQMA 3TWAA 1UBSA 1LLZA 1V5XA 3CV6A 5M2FX 4L1WA 1QUMA 1BYCA 3W85A 1TMQA 4REQB 1LM1A 3IVUA 2BZNA 2G50A 1CTNA 4JTAA 1EXPA 4KFNA 4W89A 4WJ8A 4C91A 1XHGA 1W3KA 4EPEC 5AYIA 1ADSA 1ZZMA 4GH1A 3M44A 4HQVA 5GJPA 1WZMA 5HUPA 3S1XA 1VYRA 3CM4A 2F38A 3AIVA 5I77A 2VZOA 4GXWA 3U5YA 4I6VA 4KWVA 4P8XA 2PGEA 5HNUA 5BYWA 3OVQA 4UTMA 1XCFA 1E0WA 1EUNA 3TKFA 3UR2A 3A4AA 2YCLB 1WXYA 3UXLA 4LALA 3NM1A 2Q02A 4OT7A 1WKYA 5GVJA 3D5HA 1RVGA 1WKEA 4XZBA 2GQ8A 3RMEA 1OC6A 5GPRA 3A22A 2G4JA 4ML4A 3Q94A 2CIPA 1YBQB 1LF1A 3NM3A 2RGLA 3MI3A 4PTWA 3I7QA 4JEQA 2ZYFA 3Q37A 3AIRA 4O1DA 3FVDA 3UZWA 1TZ9A 2V69A 1GVQA 3UR5A 3CB8A 1NEYA 1R2RA 3AISA 1LG1A 9XIMA 3NYDA 3KTXA 4LS2A 4FNPA 2QCCA 4YMZA 2C13A 3B9DA 1CXHA 3SJ3A 3VX1A 1Z69A 2A21A 5I3GA 2JKEA 1WCGA 4HHHA 3RM8A 1KV5A 4NYYA 3Q4DA 3VX0A 5PTDA 3FKKA 1O5KA 3RRAA 4JIIX 1ZCCA 3S2NA 3UG8A 2Z1VA 2ATMA 4RDZA 3N2TA 2W4XA 3MUIA 3TTYA 2GK1B 3NQAA 1GORA 2PLMA 1UD8A 2GWNA 5IDIA 3VK5A 3UERA 3F5JA 4UTFA 2XIOA 6REQB 3EKLA 2E6FA 4JTGA 1IF2A 1SQ7A 3GTHA 4LU0A 4ATWA 2D2HA 3DFYA 3G24A 4B5XA 1DJWA 3NQBA 3AMDA 3WF3A 4UC5A 4US6A 1UC5A 2PA6A 1B3VA 4MY8A 1IR2A 3AIWA 3K1DA 3MO4A 4RUBA 1W37A 3LHVA 5CGTA 4QDPA 1DJNA 5DXXA 3VGDA 3C2OA 1DJQA 5HR7A 3RPDA 3WDIA 5LA1A 3MUZ1 3SM0A 4C1KA 3OP2A 3G22A 4U31A 3BJTA 3MJYA 5REQA 2WMGA 4JQAA 5JBFA 3GZAA 5DCEA 3A12A 3BWWA 4WJXA 1B3OA 4PMRA 3WEZA 2GVYA 3UCCA 1E15A 1IXPA 1V6XA 4F66A 4BQ5A 3O05A 4E8CA 3GG8A 2VZSA 3LRKA 5F4XA 5T26A 3W1LA 1VIWA 1EOKA 3WL1A 4LFYA 4GK8A 4MWAB 3A9BA 4Y9MA 1K7EA 1K8CA 4PEKA 3U57A 3VZYA 4UFJA 2CZ5A 3RFAA 3KRUA 4I7VA 1LRNA 2IPGA 3WDHA 4XBSA 4Y2WA 4LX4A 1DOSA 5A5WA 3CIWA 4Q8TA 3QKEA 4OQVA 3H22A 2I9EA 3WFZA 4EAYA 4JTSA 2F6XA 1ITCA 2PFHA 1ZJAA 2B4GA 3W7JA 5BXRA 3OJGA 3FY1A 2F2KA 1W3TA 3VDAA 1YPFA 3GO2A 2J77A 4WJEA 2IXVA 3S42A 4S39A 2VHLA 3W7QA 2P76A 4YPJA 1PTGA 4CVWA 5BRPA 3EX3A 1KM6A 1E4MM 4YYCA 2G41A 3KP0A 1M7JA 4O13A 2EPHA 5ABEA 5FSDC 1AJ0A 3AXMA 2Y7FA 2I16A 4ASTA 3SIZA 1V6TA 3APTA 5BOFA 1EQCA 3CUGA 2D2GA 3FSUA 1U1JA 3QYSA 3IUHA 3A3XA 3R43A 3BJSA 2FVMA 5D8ZA 2V82A 4PMQA 3C6CA 1G4SA 1MRAA 2BODX 4H2CA 3F1QA 4J1OA 4HK6A 1GGOA 1OYAA 2XGZA 4PUMA 1FOBA 4ADUA 2VTFA 2ZA1A 3R25A 1UR3M 4FXSA 4AEEA 1GOWA 1QPKA 2ZKMX 5HNTA 4J4KA 3ZIZA 1D3HA 2OSWA 2RGMA 1XP3A 3B0VC 3KL3A 2XIJA 4MNKA 3G0SA 4PL1A 5A6TC 4H9YA 1R9XA 3KOXA 2VKZG 4M6QA 3CPGA 4J3ZA 4ZE4A 1SGJA 4NQ1A 5AVHA 3M0IA 3APGA 1J2WA 5J5DA 3MC5A 4DXKA 2Y2WA 3SUVA 4C6JA 3KW3A 4RX0A 5I78A 1LWIA 1QNPA 4P7QA 5LNUA 1MUMA 3VCNA 1ITUA 2R1PA 2EG8A 2PTWA 3RYSA 1ZTVA 2UZ9A 3WG6A 5CBIA 1R86A 1SYTA 2E0PA 1CGTA 3MKCA 2V81A 4KF1A 1A80A 4XX6A 2G37A 3R11A 4CU7A 4HPXA 1VGAA 1HJSA 1LYXA 4KBXA 4MOZA 3SRDA 3GC2A 3DBPA 1ISZA 4O12A 3ZFHA 4ECLA 2HVOA 1NDWA 3W7PA 1MNSA 1OINA 1F9CA 4DYKA 4W85A 4UOJA 1TV4A 4LCQA 5F2GA 3B9OA 1OIFA 4C7DA 2GDQA 1DWAM 3JZUA 3WENA 1XR2A 3TV8A 4MAZA 4S3FA 4W7WA 1X1OA 3O0FA 2BY3A 2PDKA 4PMJA 4PBFA 3QHNA 4IT1A 1LROA 1GONA 3STCA 3WIJA 5G2IA 3LLFA 4KGLA 4MB3A 4IXHA 4FLSA 4BQ2A 4UB9A 2WHJA 2E9BA 3HOJA 4J7RA 5C7VA 3C2VA 4Z0SA 3UZZA 3EOOA 1Y8BA 1TSIA 2PDMA 1D7FA 4GUGA 4MFDA 2YCIX 3VGGA 4CEUC 4NXKA 4CQBA 1WDQA 4ORMA 1JDFA 2V2DA 4WOZA 5KEZA 1V3LA 3D47A 4ADSA 1XIDA 4AD3A 4Q8UA 1SJCA 3NFUA 1H1ZA 3MT1A 2CZDA 1XLMA 3S46A 2UY3A 3GM8A 4CNPA 1UQZA 3SBFA 2F8QA 4NL1A 1TJ0A 3N6JA 5T91A 4M5PA 4ZVJA 3FYYA 4MJ4A 5A8QA 4HNUA 1Y5XA 1Z9AA 3GR4A 1W2VA 1PIFA 1KCXA 1A5LC 1X7FA 3CUIA 3FEMA 4ICCX 2BLEA 2VRQA 4D1JA 4W5UA 4JY8A 1DJIA 5CJMA 5TAOA 2WNQA 1TELA 2J7GA 1PBGA 3VMNA 4F79A 4H8NA 4WKFA 1TPUA 2GGHA 4WR3A 1XGZA 5IOBA 3C8NA 4XO7A 3GXMA 4D6DA 2CLPA 4RV8A 1ZAIA 1K7XA 5CAKA 2WM0A 3G1RA 1CW2A 3E96A 3RPMA 2PB1A 4B92A 3MVTA 4RE3A 3KZPA 3W84A 3WLNA 3VOIA 4UNKA 3T0CA 1E5JA 4LPCA 1DWIM 1CZ1A 3E0WA 2DSZA 4NASA 4U5KA 4R27A 1BAGA 1OF8A 5FF2A 4JQ4A 4NNAA 3M16A 1EGZA 1MEIA 3L0KA 4NRSA 5CJNA 1JPDX 1P0KA 3OBKA 1QWKA 3NO5A 5AYBA 3LCIA 3PB0A 3QLLA 4A3HA 1V6VA 4UCGA 2XN2A 4PB5A 3CAKA 1PDZA 4BCEA 3MBFA 1PKLA 2EXOA 1PKYA 4DWDA 1XGEA 3GAYA 3W7MA 4HZ8A 2W61A 3HV9A 3H7RA 4KW2A 3TYZA 4PTMA 4GWEA 5G2HA 1RUSA 1KM0A 4QQ3A 1IGWA 1W56A 3OHIA 1SW7A 2AAAA 4S38A 1PCWA 1ZB5A 1SJDA 3BLEA 3M0LA 2DZAA 3TC6A 1G7UA 1VCVA 1XIIA 3QR3A 3WSUA 4C6QA 3PR2A 5CPSA 1UWRA 2YOCA 2Z1KA 3O9NA 4KKXA 1VBGA 4LH8A 1CWYA 3NIYA 2ZC1A 4X60A 2NLYA 1KFCA 4I8YA 1W5QA 1HJWA 4QAWA 2D22A 3GG7A 1S1RA 1XLBA 4F2UA 3MCOA 4O1AA 4K8GA 2V8ZA 2PWUA 3ATZA 3CK5A 1DJYA 1EJXC 4FNQA 4YYFA 1KM4A 3W87A 4QBXA 2Y4SA 3GNOA 3USZA 1HT6A 3GW0A 3CO4A 1QHOA 4ILSA 3UJFA 1Q63A 2DORA 3MMWA 3ABSA 4AIBA 4GZEA 1R85A 3T8LA 1E9YB 1FWWA 3I6EA 3FA5A 2KZHA 3CS2A 5I3DA 5AC5A 1C7SA 4LB4A 1KGUA 1T8XA 4J3SA 1UR9A 2VR4A 2QJJA 1J11A 3M41A 2QZRA 4DJDA 3E5PA 3NCOA 3WDJA 3W1MA 2IUZA 4L4MA 3NG3A 1ELSA 2X0YA 4GQQA 3IJLA 4DF1A 3U48A 5F2IA 1CDGA 3MWAA 4J35A 3VAVA 4LAUA 1XW8A 1GTHA 3XINA 3GH4A 1PZ3A 3N15A 3IAPA 1GPWA 1EZ2A 1JR1A 4PA8A 4NNCA 3H12A 3TZFA 1OX5A 1TV3A 4YNGA 3FJNA 3EA3A 5BU9A 1TFVA 2TRSA 4MY9A 2G95A 3IRSA 3BMWA 3WBEA 4S2BA 2VEMA 3VTRA 3TTOA 5DXYA 4NF7A 2OZTA 3VCRA 5D9PA 4QLJA 2XU2A 2HK0A 3VD5A 2OWCA 4UQDA 3MSGA 2PWDA 3CEUA 2JFEX 3TW9A 4RLIA 1Q2SA 3R7MA 2IXUA 2PE4A 3G0UA 5K7JA 5DMLA 1CIUA 1OT2A 3VIMA 1W1TA 4US5D 1GNXA 2WQDA 5EY5A 4K7YA 2DSUA 5LXXA 1KKRA 1S2CA 4WVXA 1I0BA 4ZO7A 4UWMA 1ZBKA 2WSPA 4IGNA 3C3NA 4HHPA 4Q7NA 3RRXA 4HNVA 1PKMA 2BVYA 3QF0A 5LNVA 1Y0EA 2A79A 4AMAA 5CSSA 1LOSA 3LOTA 1E72M 4E5TA 3QXBA 2ISFA 3I7SA 1EJUC 4K38A 4PL2A 2QF8A 5GJNA 5A8MA 5DLCA 3QV7A 4DELA 1VLIA 3QQ0A 4FLQA 1TZ7A 4KMQA 1V93A 2YCEA 3PUDA 4XD4A 3LBOA 3N2OA 3GTNA 1RH9A 4LEQA 2ZRWA 3WF0A 3IUDA 4OOZA 2PDFA 3PNUA 1GVIA 3CXOA 5BRBA 1M9HA 2PTXA 3KOWA 6XIAA 3CUHA 1E0VA 4TVCA 3OBEA 3BCDA 4HYRA 2NQHA 2JE8A 1NP0A 4LVFA 2ONEA 3C3UA 3A9IA 3G1XA 3ABQA 4ZQNA 3DU0A 4M1BA 3AIEA 2GSJA 1XF0A 2H8XA 3ZSTA 2G3MA 3ABRA 1TKKA 4W84A 4BHYA 1NWSA 3PZGA 1BVWA 1QPOA 3MUCA 3T9PA 4LVBA 1GVYA 3TE9A 3U3HA 2FZDA 2CCRA 2A3CA 2J75A 3G8EA 1NH6A 2J13A 5F4WA 4GOAA 3GTIA 3UFYA 4F2TA 4EPBC 2V3EA 3LCFA 1WUEA 4O16A 1DHKA 3CLWA 1YDYA 3EWUA 2OYMA 4MB1A 1W1IE 2OVLA 1OX4A 1FWJC 4LGXA 3W1RA 1QASA 3DEQA 6A3HA 1TTQA 4OOUA 2WVVB 1AD1A 4JKLA 3SECA 1ONXA 2YCLA 2C3ZA 5DCDA 4QJ3B 3WEOA 5HJLA 3MCMA 3LXAA 1I1WA 1J10A 3KCLA 5I23A 3MB9A 4I9MA 2QCFA 1KXHA 3B0PA 5HINA 3CH0A 2ABAA 2X7VA 3VA8A 1QWGA 1PEZA 2X41A 2WZEA 4RK8A 2CLFA 1XDMA 4ZQMA 4FF5A 3TOPA 2GQ9A 1C8VA 4IPLA 1QMLA 1K9DA 2R91A 3QPZA 3FCPA 2OMAA 3SY8A 3DAQA 4O15A 4XZWA 4B3KA 1FXQA 3LPGA 2C0HA 3D0CA 1XM3A 5ABTA 5A6BA 3SO7A 1K8XA 4KESA 3URAA 1IHIA 5E5CA 4LF1A 1MXDA 4A8LA 2E6YA 3CBWA 2OT0A 5FF3A 2OQLA 4TV6A 1Z44A 4NVTA 1PCKA 4C6MA 2XFFA 2PLJA 1QI0A 3EWYA 2P8BA 4HK5A 5AHNA 2VQTA 2WHKA 4HT3A 4HSHA 3H7VA 4Y7EA 2ZIDA 4LUTA 4S3EA 3TC3A 3BK0A 1KV8A 2Y62A 5EL1A 4NIRA 3F5KA 4UMBA 2QDGA 2POZA 1JPMA 1MQPA 3UZ5A 2O92A 2R1NA 3BOXA 3HM7A 5CG7A 5DMMA 3BZGA 2AAMA 4E2OA 1GZJA 2Z00A 3GAKA 2FHFA 3VUPA 3LY0A 1E4LA 3SSJA 2NX3A 1M01A 3DUGA 2A85A 3QKZA 2FDMA 1LQ0A 3AROA 4FIQA 4GRSA 1JDAA 3S2LA 1CXLA 4PC8A 3ITYA 1NDVA 3GVWA 1PX4A 4WLCA 3PZUA 3BO9A 3W27A 1CYGA 1FCBA 1ENUA 3ARVA 4GX9A 4BEUA 4H9MA 2ZRYA 2BASA 4JY9A 1V77A 3JVAA 5JIPA 2ZRVA 4F0HA 1B5TA 3PS7A 1ZJHA 1Z3NA 4UMAA 1O95A 1MW0A 1XDLA 5A94A 5A6JA 4W8AA 2QVHA 3EWCA 3TNOA 1HG3A 3WX7A 2VL4A 5M03A 2VWSA 3LK6A 5FF4A 2CZFA 3AMCA 4ZB5A 3DG6A 1JXJA 2O7QA 1HJUA 1BG9A 5A69A 2BGNE 1A4MA 2P1FA 4WD0A 4NUWA 4MZ1A 3AO0A 1TTPA 3LYEA 4HCHA 4NZ1A 5D2XA 1U22A 1TUXA 3LCXA 3VD9A 3C0LA 4B3ZA 4CQ8A 2Z25A 1GHRA 3W7IA 3WD0A 2BTMA 4D8AA 4LY8A 5HQLA 4GUFA 2OX4A 2Y5JA 3BAWA 3UWZA 4XZMX 3UQNA 4L6HA 2EHHA 1W5MA 3LSCA 1AH3A 3UPWA 3RX2A 3PZNA 4HK7A 1OGSA 4FHAA 5DCBA 5LIYX 4PULA 1SO4A 3N11A 1LORA 3GK0A 1FP9A 3MMTA 1AQ0A 4J3TA 4IHCA 3IJ7A 4JX4A 3KE0A 3MP4A 3VCCA 2B7OA 3FFSA 3UWUA 3W02A 3CHCA 1RR2A 2YBTA 4GJIA 1TPFA 2D0HA 1PDYA 4DY1A 4TX8A 3CZLA 1JZ3A 1Z89A 2R9RA 3BE7A 3V5FA 2D23A 3CC1A 2J8GA 1TYGA 1Y7VA 2Y8UA 5KZMA 4F0LA 3FEQA 1KM5A 4H6EA 1XSKA 4PMOA 4LS0A 1JYXA 4JIRA 2WPBA 2VGBA 1FCUA 1SSGA 2WJEA 4MKVA 3ONBA 1HJQA 2GQAA 4V2XA 4ALDA 2J9YA 3QGKC 3MI2A 2FJKA 1WUFA 4JIQA 3ZT5A 4J28A 3TJXA 4F9DA 2HE8A 2GLKA 3B04A 4GKTA 2O9RA 1H3GA 3I3DA 3FX4A 2VEKA 2CYGA 1H7PA 5JU6A 4JHOA 3GXNA 1Q4NX 2I56A 1TZZA 3DECA 1KFKA 1F3XA 2VVSA 4IMGA 4O0ZA 5HAOA 1W5PA 3FJ6A 4O53A 2QIWA 3VXGA 4RNFA 3M5VA 4DF0A 8XIAA 4M3PA 3GIPA 5G2WA 2QCLA 3P84A 1Z32X 1W32A 4MJ2A 4HNOA 1K9FA 2Q71A 5DQPA 4XVDA 1R9ZA 1IXQA 3GHUA 1V0MA 4PMNA 1GJWA 5HXMA 2G0WA 2J79A 3PJUA 1W3JA 3TSMA 1H5VA 4KS0A 3IRDA 1DYSA 4IWWA 1TJ2A 3C5QA 1VR6A 3VYLA 4LS1A 3H2OA 2VC9A 3K8KA 3KL5A 3TU9A 3BG3A 1T96A 5E93A 1MNZA 2QJHA 2FGBA 2R1KA 4CD8A 1NVMA 4XKYB 1QPQA 2W27A 5C0QA 2NT0A 2E77A 3VE7A 3B03A 2DUXA 4MDPA 5I00A 2VQUA 5A6MA 2OQHA 3L4TA 1E6PA 2YZRA 2VVNA 1YLVA 5MKGA 1SFTA 4QCFA 4YXGA 3RDKA 1CECA 3LHWA 1G67A 3WMSA 4NY2A 4W8BA 2FFIA 1W3NA 3AZRA 3TA6A 5H8MA 2E28A 4XISA 1R3RA 1SSDA 3FA4A 2HE5A 3B8VA 1WQ5A 3PUEA 3M0XA 1LBMA 3K4AA 1XIEA 4TTGA 3PSWA 1UD6A 4H7CA 4MWAD 1PS9A 4NZ5A 4UFMA 3PZTA 3W0KA 4N0RA 3W1QA 3W2UA 2ON3A 4FXFA 2H3DA 5FJUA 1JCYA 1HVQA 3AUOA 3CO8A 3W1AA 1TV7A 1F8MA 1DXEA 4GVIA 5EMUA 4Y90A 4JOMA 2NUXA 4EIVA 2BVTA 3LV6A 4PMDA 3V0SA 4JTLA 1UA3A 2P0IA 4I3GA 4OE7A 4DXXA 1E1FA 3PTMA 4LTSA 2GOKA 3NO3A 2ZA3A 1TUFA 2HS8A 1IEXA 4UQAA 4EANA 4FNRA 2QUUA 3DESA 1VFLA 1L0PA 2V5BA 1PJ9A 1H7XA 1NDZA 3UWWA 4LYPA 3CV7A 4US5A 1YRRA 4MZ8A 3EZ4A 5EBAA 5FIPA 2BDQA 2E4TA 5D2WA 4R7OA 5CC7A 3Q65A 1F4HA 2E7FA 1PWLA 2AOSA 3MZ2A 2CERA 3NPWA 4JN7A 4UUIA 3WUBA 1AUSL 1VPQA 1DWJM 3W2LA 3HA1A 2A1YA 3SCPA 3EX1A 2GGJA 1PO9A 3UR7A 2WXDM 3E02A 4NX5A 4PMVA 4JTRA 1ODUA 1V3MA 1CGWA 7ODCA 4JR5A 3W70A 2QXWA 3WBYA 3KOZA 3Q45A 3UJSA 4IICA 3I4EA 4OECA 4IF2A 4PCPA 2UWFA 3L4ZA 2B7PA 3LQLA 3M6YA 1BYDA 3WNNA 2WKJA 1XBXA 1TJ1A 1EDQA 4FEZA 4I5RA 8RUCA 1XWYA 4AF0B 3QY6A 3BAXA 3F5LA 2RDUA 1W5OA 1QW9A 4LAZA 4HPHA 5IHRA 4P8VA 1JNEA 1ZBWA 3HFTA 3ARZA 4BQ4A 1GVFA 4BQ3A 1W9DM 1EIBA 1YHTA 4YVVA 4RE2A 1TPWA 2W6RA 3EWXA 2NVDA 2FH8A 3VIPA 1G4EA 1TIWA 1XINA 1ZU8A 4MUZA 2ASHA 3VDCA 3KHJA 3LCHA 3G77A 1HQTA 3KVKA 1VBUA 4DO6A 3R6IA 4JYFA 1XSJA 3LGDA 1GVOA 2Y7EA 4JXCA 2O9OA 4LXFA 1L6FA 2PAJA 3U9IA 4XKMA 4G7EA 1CBGA 3E0LA 4ENLA 4JFVA 5BWFA 3WLQA 2OPJA 3VOGA 4AG0A 4GXPA 3WF4A 3ZS4A 1MO0A 1WOBA 1GKRA 1AJ2A 1M53A 1K8ZA 4UXDA 6CGTA 1JL8A 3VMPA 4C1NA 1IEVA 3QMSA 2PBGA 5M1TA 1PE1A 4S3JA 1L8NA 3O15A 2G8ZA 2GJLA 3U4AA 2J66A 1GOQA 1WDDA 1X98A 3W7RA 4A6GA 4YL2A 4XD5A 3R8GA 4L61A 3H2AA 1OWQA 1O94A 4AEOA 2VEIA 1QO5A 2UY2A 2ZUVA 1TV8A 1CGYA 1N8IA 1UR4A 3S5YA 5IM51 1LZOA 3R0UA 2QPUA 3ZJ6A 4Y8FA 3HQOA 5GJMA 5EFDA 4HMNA 2J9XA 3VPLA 3GIYA 4JIPA 4D6JA 3HJZA 3AYTA 2XG9A 3O16A 4PMXA 1A5KC 2ZZ7A 2ACQA 4JZ5A 1QDSA 3HV8A 1I8JA 3UF9A 1EJVC 2ZX6A 1VRDA 3VOCA 4XQ6A 1OFBA 4GJJA 3R8HA 1HN1A 1RV8A 5CLTA 4EP8C 4D6HA 3HPFA 4U3AA 4GZIA 2FZNA 1VLWA 2YDQA 1MW3A 4HNNA 3CAVA 3VIIA 3EKZA 4XAYA 3VVGA 4H7VA 3R0KA 4M81A 3R2GA 1RHCA 4UQEA 1F76A 3DHUA 3T6CA 3E9AA 4MVAA 5M17A 4FI4A 4TX6A 4B4HA 1BSLA 5L6UA 5CPNA 3MCNA 1A5SA 1W9XA 3GBEA 3PTDA 2VC5A 1JCJA 1XI3A 3DC0A 3FHQA 3H54A 4M82A 7PTDA 1ISYA 1QNRA 4Z1DA 3TUUA 3FXYA 4PUDA 2WANA 3QTPA 4ATDA 1EYWA 4JEJA 4XKYA 4Q8VA 4B15A 3KBJA 4EPDC 3W86A 1E71M 1DORA 1EC8A 1SM9A 1TRIA 5I0DA 2P10A 4PB3A 2WCAA 3WMBA 4IJBA 3EWDA 1KFEA 4GQ0A 1ISXA 4DIAA 4Z2LA 1Y5VA 3WQPA 2WWCA 3NPXA 2RJGA 1US0A 2VD9A 1KBKA 1YTKA 2NV2A 3QPEA 3BLDA 4KEMA 2AL2A 3R8RA 2PDYA 3GHSA 1GHSA 1FH7A 2PDHA 3UXIA 4C60A 3JZEA 4U4MA 4HN4A 3TLLA 1UH3A 3CUFA 5AC8A 4UTTC 3S5SA 3W00A 3IJIA 3T0TA 3ZJKA 2ACRA