3MC5A

Human aldose reductase mutant t113v in complex with idd393 crystallized in spacegroup p1
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
316
structure length
316
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPVGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Ligand-induced fit affects binding modes and provokes changes in crystal packing of aldose reductase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 107
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3mc5A00
1S1RA 4WDXA 3UZXA 4H7CA 3GHUA 1SM9A 1Z3NA 3LEPA 1US0A 2PD5A 2PDFA 2IKIA 1M9HA 3O0KA 3VXGA 3R8HA 2ACUA 4XZMX 2FZ9A 4GACA 1MI3A 2ACQA 3N6QA 3ONCA 3UFYA 4NKCA 2I16A 4Q7BA 3BCJA 3M4HA 1ZSXA 3V0TA 1EF3A 4XAPA 1JEZA 2R9RA 1QRQA 1ZUAX 3G5EA 1XJBA 3GHRA 2PF8A 1MZRA 2F2KA 3M0IA 4MHBA 3H4GA 1PYFA 2PDWA 4QR6A 1X98A 3T42A 5JH2A 4JQAA 1YNPA 2PDMA 4FAMA 2PDIA 4WDTA 1J96A 3R7MA 3UGRA 3CAQA 4GA8A 4JTCA 4LAUA 1ZGDA 3KRBA 5LIXX 1PZ0A 3U2CA 2PDJA 4WEVX 4PR4A 4Q3MA 3WBXA 2VDGA 2PDHA 4JQ2A 3O3RA 4XO7A 3UZZA 3GHSA 4EXBA 4RPQA 5JH1A 2P5NA 3R94A 1AH3A 3N2TA 4IJCA 1Z8AA 4FALA 4OTKA 3GHTA 4QX4A 4JIHA 4WDUA 1Q13A 1X97A 3CAVA 3H7RA 2CLPA 1RY0A 1EL3A 2PDXA 2F38A 4LB4A 4PMJA 5LIUX 2J8TA 5LIYX 5HNUA 3UP8A 3Q67A 4GQ0A 3BV7A 3COTA 4EXAA 4ZFCA 1FRBA 1VP5A 2PEVA 3CV7A 1AZ2A 1EKOA 3BURA 4FZIA 1AFSA 4YVXA 1S2CA 1AH4A 4PRRA 3V35A 5KETA 2INEA 3UWEA 2PDYA 3LENA 2ACRA 3UZYA 5C7HA 2IPWA 2PDBA 4H8NA 4HMNA 1Q5MA 4QBXA 4LBRA 1S1PA 3WBYA 1RY8A 2ISFA 2WZMA 2DV0A 3R58A 4FA3A 4GIEA 4JQ1A 1PZ1A 1XF0A 3C3UA 4XVEA 4PUWA 2NVDA 2PDLA 4XZLX 4JQ4A 5DANA 2PDGA 5LIWX 3D3FA 3EB3A 3M64A 1GVEA 1HW6A 3BUVA 4ICCX 3WG6A 2FZDA 3RX4A 4I5XA 3LQLA 2PZNA 1R38A 3RX2A 2FVLA 3MC5A 4JIRA 3WBWA 4F40A 1T40A 3LZ5A 1YNQA 3V0UA 3EAUA 4YS1A 1C9WA 4R9OA 4XZHA 5HA7A 2IQDA 2PDQA 4XZNX 3ONBA 4LB3A 1LWIA 4GQGA 4AUBA 4GABA 3UG8A 2A79A 2FZ8A 4YU1A 3QKZA 2PD9A 3UZWA 3R43A 2IKHA 3F7JA 2HE8A 4G5DA 4WRHA 5LIKX 4IJRA 4HBKA 4PRTA 1X96A 4XZIA 3Q65A 2DUXA 2HV5A 1AH0A 3CASA 2HDJA 4WGHA 2IPJA 2ACSA 4YVVA 4LBSA 3P2VA 3R6IA 3ERPA 4QXIA 4WDWA 4JTAA 1IEIA 5HNTA 1ADSA 2PDKA 2IQ0A 3DOPA 2HVOA 1K8CA 2BGSA 3LD5A 1HQTA 3G1RA 1EXBA 3B3DA 1IHIA 1Z89A 3DN5A 2WZTA 1VBJA 3LN3A 3LNMA 2R24A 3NTYA 1A80A 2IS7A 2QXWA 4JQ3A 1QWKA 3GUGA 4XO6A 3V36A 2PDUA 2I17A 2IKGA 2PDCA 3CMFA 1OG6A 2IKJA 1XGDA 4DBSA 5M2FX 3CV6A 4JTQA 2PDNA 2HEJA 3H7UA 2FGBA 4DBWA 4DBUA 1T41A 1LQAA 3EB4A 1AZ1A 1PWLA 2BGQA 3LZ3A 3FJNA 2FZBA 4PUUA 1S2AA 3V0SA 2PDPA 2IPGA 1YE6A 2AGTA 1PWMA 4DZ5A 3MB9A 3FX4A 2IPFA 4JTDA 3LBOA 3UYIA 1MRQA 1UR3M 4XK2A 4JTRA 4LAZA 2INZA 3LUTA 3WCZA 1RALA 4XVDA 4GCAA 1YE4A 2HE5A 4L1XA 1Z9AA 2C91A 3RX3A 4JIIX 2ALRA 3R8GA 5AZ0A 2DUZA 5AZ1A 1ZQ5A 3S3GA 2HVNA 2NVCA 4L1WA 2PFHA 3LQGA 4IGSA 2BP1A 4YVPA 4ASTA
chains in the Genus database with same CATH superfamily
2ABBA 2EKGA 3NOYA 2E77A 3CWNA 4ZEPA 2ZZ1A 4K7VA 4ZB5A 1F3EA 4L7ZA 1WXZA 1OX4B 4HA4A 4KETA 4JL1A 4XZBA 3O0KA 3L5MA 5M17A 1OX6A 2E40A 3T4CA 5D9NA 3TW7A 4JTSA 3ZR5A 4H83A 2C15A 1MI3A 3TCSA 4UMBA 4HN4A 3BLIA 5CLWA 1SJAA 1FWBC 4AD0A 1HTIA 2A85A 4Y9AA 1GONA 3RM8A 3V4BA 3H23A 4PEEA 1ZSXA 8XIAA 3HG4A 1IT0A 1OT1A 1W3TA 3GNRA 2A1YA 2V5KA 1Q8AA 2AAAA 2BSLA 1TZ7A 3WF4A 3IIVA 4O11A 4LW7A 4ORMA 4B91A 5A6LA 3NNTA 4XD6A 2E7FA 4JBRA 2P1FA 1X98A 1RHCA 4B9ZA 2PDIA 1DWIM 2WPBA 2VDHA 3MS8A 4AC1X 3E0FA 2DDXA 2Q02A 4LAUA 3SN1A 3KP0A 4IGNA 4ERIA 3OVQA 3AHTA 1BYCA 1DJWA 2DQXA 1EJTC 3O3RA 4QE5A 3GHSA 5DMYA 1TTIA 2CBUA 4X0VA 1AH3A 3W0KA 5HINA 3CMGA 1UD6A 2PLKA 1J2BA 4JIHA 3N73A 4DNHA 1Z48A 1IZKA 4JEQA 4TIMA 3CTLA 2FFCA 1UWQA 1EL3A 2PCQA 1W1B1 1E6NA 1SO4A 1MYRA 5C9WA 4JTLA 1XRVA 3TEVA 3BLPX 3C2OA 2VR5A 3BLLA 5G1TA 2WXDM 1CLVA 3BURA 3BAYA 1K03A 3OIXA 3ZWSA 1Q65A 3AXIA 1CW2A 1M65A 4PRRA 3V35A 3SB0A 5D05A 3TNOA 1T99A 4QTGA 4GXMA 1KLZA 2YA2A 3MO7A 3WD4A 1JAKA 3FW6A 1PAMA 3CJPA 4M6QA 1EWEA 3M5VA 4PUKA 5H8UA 4IGHA 2OB3A 3PPFA 1KGWA 3T09A 1XRTA 1AJ0A 4FA3A 3N14A 2Y7DA 1FA2A 4C1KA 1ZJAA 4X9YA 3SQMA 5A2CA 4PODA 4PUWA 3CYVA 3ITCA 3MQTA 3C5QA 3G18A 3LGDA 1G7VA 3NSXA 2HXUA 3CUFA 4Q7IA 3IUHA 3USZA 1GVEA 3HGSA 2CFFA 3R5EA 4IIFA 1JF6A 2C1GA 4R27A 4AWTA 3HQPA 3KW3A 3RX4A 1R7OA 3IPWA 1UWUA 1Y8BA 1SUXA 2FLIA 4LYPA 1I2RA 3EPOA 4QITA 3GAKA 3WMCA 4M1BA 1TUXA 1PHWA 2C14A 2ZE0A 2X1TA 2C13A 4G7EA 3TSDA 4FX8A 3STCA 1QXLA 3ITOA 5D9OA 5I3FA 4HNLA 1RVGA 1CGYA 4DWSC 2QCDB 1PSCA 2QKFA 3VKJA 5DO8A 3P6LA 3CUHA 2XGIA 1ODUA 4UUIA 2NXHA 4IIDA 1W1YA 4URIA 3UT0A 2J13A 2IKHA 3KRUA 2MANA 4OT7A 1P0KA 2ZUVA 1IT7A 5KSWA 3KXQA 1BSIA 3ES7A 2XN1A 2J7CA 3TV8A 4IPIA 1GJWA 2CBVA 3CUJA 5C71A 3WBAA 3WN6A 3E9AA 3MJYA 3UY8A 5IBXA 4GO8A 4DO4A 2P76A 1MW2A 4K7YA 5LNRA 3PBUA 1WKDA 4LVBA 4C6DA 2BOFX 4LOCA 1A0CA 3AIEA 5E6ZA 1W37A 1DHKA 3RU8X 4F2TA 3G8EA 5RUBA 2ZCGA 4HIBA 4W7VA 2O7SA 1EJ7L 3T4WA 1EXBA 3U6WA 3CWOX 1A49A 3D3AA 4RKAA 2DZTA 5G4HC 2R24A 1S3TC 2WVVA 2XJ7A 1EGVA 1A80A 2J24A 3VIJA 3WH8A 4NNBA 1ZCCA 4EPKA 4ATLA 3WNPA 1RV8A 2CIPA 3F03K 1TA3A 3QGKC 2WMFA 3CMFA 4J5NA 4DM2A 4NZCA 4KWWA 1HP4A 4AVOA 1Z69A 2D22A 5CH9A 3NVDA 4R9XA 1JIBA 3V3WA 4ERAA 3OPSA 1MDRA 1E9LA 5JBEA 3XISA 3KFTA 1LQAA 4IX0A 4LVFA 5EFFA 4GG9A 3CQIA 2HROA 1UH2A 2CHNA 2BZNA 2EKCA 4Q33A 2A3CA 4UFLA 2Z6IA 3IIXA 3PBGA 3XIMA 1XLEA 4W9TA 4CQ9A 3ZSSA 2I14A 1IWAA 4GXWA 3LCWA 4E8DA 3S2CA 4AY7A 3AJXA 1C8QA 3KBSA 3S83A 2BY2A 1XC6A 3RO8A 4JKMA 1UP0A 4OKDA 2J6XA 4MWAA 5DN1A 1AVAA 4PCNA 2JKPA 1KKRA 2PLJA 3URQA 3OQEA 5K9CA 4W93A 3PZUA 4FLQA 2Y2WA 2V9DA 3A4WA 4GFSA 1H61A 1Q3NA 1L8NA 2RKXA 1DVJA 1JR1A 1H2JA 1H49A 3CQKA 5HAOA 4HHPA 4YWSA 1UQYA 3B03A 1W5MA 3GNXA 2VCCA 2Z29A 4PSRA 1XIFA 4ZOAA 3MMWA 1P0EA 3CB3A 1XX1A 3FAWA 1HKJA 1ICSA 2A6LA 2O56A 2HCVA 4TTGA 4GACA 4A05A 3GXDA 3FSTA 3CT7A 1DJIA 5CBJA 5JU6A 5CC6A 3BCJA 3S2JA 1MQPA 4NJHA 5J5DA 4G6CA 3IJLA 2ABAA 2Q3RA 4FLOA 3FV9A 3F2DA 1VJIA 2PC8A 9XIAA 3FJ4A 1W17A 1KFJA 3L4VA 5E70A 4HSHA 4O1FA 4GVIA 2NX3A 1MMFA 2EPNA 1EEPA 4ZB0A 4XUYA 1VCGA 5JMUA 5EPDA 4KCTA 1H41A 2DW6A 3FOKA 1L6SA 2Y0FA 3W9ZA 4MAZA 4J3VA 4M80A 4PTDA 4U5KA 2J78A 1PZ0A 1GVSA 1R47A 3OLDA 2DVXA 1XM3A 5AC7A 3A9IA 3O16A 4NYUA 4D1JA 3EWUA 4MY8A 4EXBA 1XLKA 4ZOCA 3W2JA 4RX0A 4BI5A 4WK9A 3WBEA 3U9IA 3G1XA 3N2TA 4O13A 1X1OA 3L2MA 3AHVA 2A7NA 4WDUA 4JDBA 3VZXA 4UR8A 2PE4A 2F84A 2WCAA 4IGMA 2GWGA 2VCBA 4TX6A 5HANA 3SSZA 3B9EA 3MVTA 4LFYA 3AIQA 3BZJA 5LSMA 2PURA 5D2YA 4TVCA 1FKWA 1K9TA 3WNNA 1UB3A 3B9NA 2Z1WA 3BTNA 4J2MA 2OSXA 1XLLA 1ZBCA 4H9ZA 3VNMA 2P50A 3LXCA 1D7KA 1OY0A 4TOQA 4YVXA 1XFBA 1OC7A 1BKHA 1QWGA 3VINA 3TSMA 1KO0A 2ZXQA 4GHRA 1PE1A 2NVAA 2Z1VA 5FOOA 3NZPA 3GIPA 1EA0A 2XU2A 2DSVA 2G4FA 2GVYA 4ZR8A 3GU2A 4KT2A 4EIVA 1OWQA 3W28A 3NZQA 7ENLA 2QUVA 1UD8A 4ZL1A 3U8GA 3T05A 2NVDA 2VGIA 2YXOA 1E4LA 4O18A 3W1LA 2WW5A 4AZCB 4GX8A 2W6RA 2PGRA 2A6NA 3KWSA 2BNJA 3MYOA 1YTDA 1JULA 3IWPA 4F0RA 2VZSA 4PUMA 2XN2A 5A6SA 4ATDA 3TA9A 4O57A 2TRSA 4RE0A 3TN3A 3TLLA 4IH3A 1UMLA 2QJMA 3WH5A 2DT3A 4Q8QA 3MBDA 4KMQA 4GJJA 1WOAA 1WOBA 1GYLA 4NJGA 5DMLA 3GYCA 1C8XA 1P0DA 1VBUA 3VX1A 5I00A 2X41A 3TYZA 4HB7A 3S5OA 3FCPA 2W79A 3E2SA 5GNYA 4NT0A 2B31A 3H22A 4ENLA 1J0KA 3SADA 3PJTA 2V68A 3W53A 1WPCA 4IJBA 1IEXA 1XQLA 1NM9A 4DWSD 4GQBA 3S42A 3TTSA 3DYOA 3RGTA 1M6JA 4YU1A 3QKZA 2ZIDA 1CGVA 4LV4A 1QASA 4N0RA 3TN4A 2CLFA 3NL5A 1GOOA 4IISA 2DZBA 4BHYA 3Q65A 3WNMA 4MVAA 4Q4PA 2GJPA 3GW3A 5BRPA 5BRQA 4IX2A 2HBVA 3AMLA 1ZBVA 3GYEA 4HNOA 5LNSA 1FQ0A 4BF7A 1KFKA 2Y24A 4EPEC 1HKKA 2OR2A 4HNTA 4Y8FA 3AMCA 2XH0A 3LD5A 4HK6A 1HJXA 1E0VA 2B7PA 5FJRA 3WF1A 2UWFA 4Z2IA 2OKOA 4TXEA 1Z89A 2D2OA 1UJQA 1F3TA 3LN3A 4IFKA 5KZDA 3NQ7A 3L4YA 4AMAA 4S3FA 4W87A 1ZAJA 5F2IA 2X2GA 2QIIA 3L66A 2JQXA 3V7PA 1JUBA 1C91A 1ISWA 3WX7A 3MW7A 2QV4A 1KBLA 3V36A 5C2XA 4RDVA 1E1CA 4PL1A 4B3ZA 2ZDRA 3OTRA 1SFTA 1XGDA 1IWPA 2CLHA 3GG8A 2PTZA 3CV6A 1TRDA 2JE8A 4LEFA 1JI1A 1W3IA 3OVRA 2QS8A 3H7UA 3G0XA 2WOQA 1XH1A 3WDJA 2D1ZA 3M0YA 4FNTA 4AQLA 4ZE4A 1MUCA 5D2TA 3EB4A 2DSKA 4GH3A 1G67A 2FZNA 3RITA 1BG4A 2QCMA 1AQMA 3GY1A 1AQFA 4BI7A 2GYIA 2AGTA 3S5YA 1VFSA 3ANUA 2TMDA 2P8CA 5GQBA 2IPFA 1Q2RA 4P8WA 2XIQA 4XAGA 3PTKA 4FNPA 1IT8A 4ZQRA 4GI4A 3VNLA 2ZTJA 1UD2A 2FIQA 1W3NA 2POTA 4E0CA 1V51A 4L9XA 1TG7A 3B97A 5AHIA 3AICA 1UIOA 5CPNA 3OB8A 2V38A 1WZKA 3TW9A 1JCNA 2ZRXA 4OECA 4MZYA 3TXVA 3AALA 1TZ9A 4GLEA 4PUEA 1W9VA 1BAGA 4L1WA 2PFHA 1VPXA 1NQKA 1TYGA 1TKKA 3VD4A 1GW1A 2HPIA 5IDIA 1JZ2A 2NT0A 3N29A 4HTBA 2O7QA 3EOLA 3P0XA 4KCVA 4RE2A 3DX5A 2XVKA 4GUGA 2D73A 5E0KA 3G1AA 3F5JA 3DEQA 2CXEA 4N4PA 2WNWA 4GISA 4A4AA 1QK0A 3ECQA 3WZ0E 2RAGA 5M1TA 4YLWA 2VX7A 4UTLA 3QR3A 4TU1A 3T08A 4MNMA 2Y7EA 5J5RA 4FI4A 3W2LA 4QAIA 1GYNA 4DXXA 1HL9A 3PJUA 5BZAA 4C65A 5AHMA 1WKEA 4D2JA 5HDRA 4WOQA 1RPXA 1GVOA 1MZRA 4D1IA 2JKAA 1SO6A 4MHBA 3GG1A 3F5KA 5DRCA 4BF9A 3M7SA 3MWCA 3R0DA 3VOGA 2XIOA 4MUZA 1SSDA 3BAKA 3AYTA 3KBJA 3NGFA 4ZA0A 1UHVA 2WWDA 1QNPA 1NARA 4MLRA 1G94A 2HNEA 4P8UA 1PX8A 4JTKA 4YTTA 4AZ7A 1R2SA 3LYEA 1EDTA 2IXVA 4J1OA 1XKYA 1XBYA 3VIHA 3WFAA 1Y5WA 4FXFA 4IIHA 4I6VA 5BOFA 1JUKA 4GPNA 4QX4A 3WUGA 1UIPA 1X97A 2PAJA 2QUTA 4XD4A 4E6MA 3WFLA 1WDPA 5BOOA 4S3GA 3W22A 4CNNA 4FIQA 4DB7A 5LA0A 4DYKA 4AWSA 4LRTA 1K3UA 2XWDA 4LNCA 3UJSA 3K1GA 3R0UA 3L5AA 4HSNA 1E56A 3BL3A 5BOEA 1S5WA 3VGGA 3OBEA 4PCSA 1OYAA 1QPRA 1TX2A 3GVGA 4OBSA 4GX9A 2O4QA 3WDIA 3IJQA 2XIMA 4B16A 4V2XA 3ARUA 4MZ8A 2ACRA 1I45A 2LLEA 1QW7A 3BQ6A 2WHLA 3CZLA 2J9XA 3DG7A 3EYPA 3WJXA 4U4MA 2PTYA 2XTKA 4EKJA 2QDHA 1OD0A 2YBTA 3K8MA 1TTJA 3N9SA 1GHRA 1PKMA 4I9AA 1QO2A 3OQ8A 1V79A 3W6MA 2J75A 4DNMA 4MJZA 4MDPA 1EH9A 4JR5A 3H4XA 1DJZA 1B3ZA 3SRHA 1NP2A 1I6NA 1J4EA 1WKYA 4JKKA 1MNZA 3EB3A 1VHNA 3GTNA 3W88A 1LRQA 3T40A 2PZNA 4K39A 1PTGA 3QOMA 2W91A 1XC4A 4D72A 4DPPA 3Q37A 4H6KA 1BXCA 2OWCA 2P0OA 1EOMA 4DBDA 2UY5A 2HS8A 5CZKA 2Y88A 2BVYA 2HXTA 4UTMA 1B54A 3I6EA 3EAUA 4ZENA 4DWDA 3VFCA 3TYBA 1Q6RA 1XISA 5CGMA 4XAFA 1GVFA 4JTIA 2OVLA 3M5XA 4DAIA 2CESA 3HB9A 4KCUA 3UG8A 3WDQA 1GKRA 1D3GA 4UTIA 4BWLA 4AMCA 2FHFA 2FZ8A 3UU0A 3DH7A 3R43A 1KRCC 3DIPA 4UQDA 1NDWA 5A6TC 2HE8A 3UW6A 4OOUA 5G2IA 4M8UA 4B4FA 2WWCA 1D3CA 3F2BA 2HDJA 4AYSA 2PTDA 5AY7A 5DY3A 1S5NA 3EDDA 4D9PA 4ZQMA 3LA4A 3AS1A 4KEZA 1IV8A 1TPC1 1IXOA 2Y62A 1F74A 1L6YA 3REQB 2BASA 1RBOB 2GWNA 4DBEA 3GS6A 3VE9A 2GUUA 4E2DA 3A6OA 7REQA 4ZVJA 2BGSA 4KWSA 5BROA 4FB7A 3UWVA 4GIRA 4QIUA 1LM1A 4EF8A 1H7WA 2YB1A 2B7QA 2FPYA 3K13A 5AECA 2QVNA 4YIWA 1PHQA 1M04A 2JIEA 2Q71A 3PSWA 2PRLA 4C6EA 1F2JA 3OBKA 4P7OA 4Z0JA 4DRSA 1WXYA 1UQZA 3PK7A 4L6HA 2OZ0A 2I17A 2YSWA 3WD3A 4CCZA 1E71M 4DBSA 4CUCA 5M2FX 3WLLA 1W1VA 2F2HA 1TVPA 3K5XA 4GFIA 2FGBA 1RD5A 3L0KA 2NXIA 2F7FA 1C9DA 3B4YA 4R3UA 3BJTA 2GDUA 4DHGA 3NO3A 3W6LA 2R1NA 1V3KA 1AD4A 3CH0A 3LCFA 2Y63A 1UZ4A 3B8IA 3VZYA 4B5WA 3LBCA 1N7KA 1XLDA 3PWAA 4FOJA 3C52A 3E74A 3G3DA 1UWAA 4KH2A 1PS9A 1QOQA 3F5LA 2UY3A 4A3HA 3TQVA 1ZTVA 2PTXA 4HPJA 4Q4MA 3TROA 3SURA 4HU3A 3TOPA 3WQ8A 5EMJA 4L6DA 4PRWA 4U28A 3SCQA 4IMGA 4X2RA 4H8HA 1XYMA 1LQ0A 2ZUUA 3K2GA 4LVDA 4J3ZA 3VNZA 1WDWA 1GQKA 3QY8A 1HIZA 3BGAA 1ADDA 3LQGA 2HNHA 3RR1A 3UJ2A 1SR9A 4LX4A 3GIQA 4RLIA 3APTA 3BW2A 4WKFA 1XUUA 1S1RA 1JRBA 3VM7A 1Z3NA 3IV8A 2NLIA 1BEUA 3GD6A 3PZOA 3SRDA 4W8LA 4LS1A 1KFCA 2O55A 4H8UA 3U7VA 2WBGA 3VXGA 2DH3A 3GFYA 5EMKA 2ODOA 4O1AA 1J6OA 4HKPA 4QRNA 1I2NA 3DUGA 1ZJBA 4GZJA 5HUOA 1XSKA 3QY7A 5TQLA 3QGAC 3EMQA 1E0UA 3M4HA 1L2UA 3N4AA 4CNTA 4ZOEA 3WQ6A 1VJZA 1J18A 4BA0A 2ZXAA 2PDWA 4QR6A 4Y9NA 3T42A 6XIMA 5IHRA 3RXZA 3TC6A 4JNZA 4JN6A 2PZ0A 5EMUA 4PB3A 4Y7EA 4JNMA 2UY4A 3MMDA 3R7MA 3FJ6A 4Z2JA 1XPYA 1SO5A 4X60A 1S5TA 3VIKA 4PC8A 4AVFA 3PJWA 3CL6A 1PX3A 4GRSA 4CD6A 2DSUA 7CGTA 3NO1A 5D8WA 3TZNA 3U2CA 3P8IA 1JCYA 2V0TA 4PR4A 4Q3MA 2PBGA 4HCDA 3U4AA 4JQ2A 3WLSA 5K4XA 3A64A 3R94A 3H70A 3VCRA 1XW8A 1V7AA 1IWBA 3SCOA 5A8PA 3VNYA 5CPOA 4ZZ9A 3MTWA 1F5ZA 2EPMX 4LUJA 4FNSA 2J8TA 2HSAA 1QW8A 3AYSA 5HNUA 3EDKA 2OXNA 5DXXA 4HNUA 1JPHA 4Z0SA 2DPEA 1PUDA 2QW5A 1HKVA 1OK4A 1VP5A 4UZUA 4JN7A 1KWKA 3UR8A 2HWGA 2PS2A 3TJIA 4LANA 2X1UA 4U3CA 4G7EB 1S2CA 3IJ9A 2VUNA 3SEPA 1SPQA 3CHCA 5FF4A 5C7HA 3AIVA 4H8NA 3WQGA 4NF7A 1S1PA 4AZ6A 1XFCA 5D8ZA 1FDJA 4CU8A 1D3HA 4FLRA 4GIYA 1CGTA 3AJ7A 2DH2A 4DYEA 1BWLA 5CBIA 1RA0A 3R58A 5A1AA 4J3XA 2GUBA 5AB3A 4C5ZA 3EA2A 3GC4A 1AUSL 1BWKA 1H4PA 3PAJA 1LYXA 4QROA 1WDSA 2V2DA 3QHOA 2PWEA 1TPDA 4REQA 1R2RA 1XDLA 2VP8A 4JQ4A 1XSIA 4KWUA 3SJNA 1PB0A 5AHFA 4R33A 3TFXA 4GGHA 5JXQA 2WVSA 3QV7A 3H53A 4OWGA 1XCXA 1XLJA 5F2GA 4HMCA 1W31A 1RUSA 1QMLA 4QCFA 4PTXA 3ABXA 3BPWA 2AOSA 1VCVA 5HXMA 4IM4A 4O4WA 3BWWA 5AVHA 1VFLA 4PUJA 2EQDA 3R79A 1UA7A 4CEUC 4EACA 3NPWA 3DFNA 3QPEA 3CUZA 3NXFA 1KR0A 2P3EA 2XSXA 3B04A 1C9WA 4XZHA 3A13A 2ZICA 4LRSA 4WKAA 2PDQA 2FKPA 2EPLX 1U5HA 4LB3A 3AIRA 2WVVB 4O14A 1W1IE 4J4KA 3FVMA 1FWFC 5AC4A 2GK1A 3WIJA 3UA3A 3PPHA 3KEHA 3AQUA 2VL4A 2E9MA 2PODA 1LTDA 1TA3B 1YTKA 4Q8NA 4RZ4A 4C91A 4GBUA 1P0NA 2BOGX 1VFOA 3LXAA 1KBKA 3CL8A 3N12A 1E1FA 2HV5A 2HPMA 2YW4A 3WF3A 1CZ1A 3MCNA 3P2VA 5BMXA 1BXNA 3VD5A 1DORA 1Q6CA 3M43A 4WGXA 2ISWA 4E4FA 2I1OA 4PFHA 1NF0A 3S9IA 4R7OA 4A21A 2UV8G 5CC7A 1VRDA 1DWFM 1XPGA 1THFD 2DVTA 3LV6A 4FNQA 4WSHA 3U4FA 2OYKA 4MWAB 4V27A 3NUKA 3MSRA 4YYFA 5HPCA 4EPDC 2Z1BA 3W73A 4YTUA 3CHEA 3DBNA 4PN2A 1WXJA 1DTNA 3IIZA 2PDUA 3D0CA 2ZTKA 1DP0A 1OG6A 1H11A 3PZGA 4WUIA 1A5CA 4MB5A 4OE7A 4Q8MA 1E6RA 1OHLA 4MFDA 3MBFA 3WK1A 1NFPA 4DBWA 3DESA 4A29A 1JYWA 1RA5A 3R8RA 1R30A 3MO4A 1UKOA 3LSCA 5AHEA 3E0VA 3E6EA 1X8FA 1XINA 3H24A 2Z0IA 1KRAC 2PDPA 1NDYA 2JALA 2WZEA 4DWSA 5HWJA 3ZR4A 4JTUA 1PWMA 4DZ5A 3P67A 3GNPA 1OCNA 3M07A 3MZ2A 4XTDA 4MWAE 1GOQA 3JVAA 2Z26A 1UC4A 4Y9MA 3TR9A 5HQLA 3TC3A 3W7JA 1WZLA 4C60A 2H8XA 3NO5A 1GYMA 1VC4A 4LAZA 4XKYA 4I7UA 4L1XA 3JZUA 2VQUA 3GXNA 4N02A 1VEOA 1RXOB 1TRIA 4XISA 4PL2A 3G0SA 4MKVA 5HOSA 4G8TA 4HOXA 3QHNA 2XFYA 1V8EA 2AQOA 3S9ZA 5I06A 1LJYA 5JVLA 1Q2SA 2GOUA 3OHIA 1JCTA 4MB1A 4G7FA 3UZXA 3ARQA 1D8CA 3ZSTA 3GDBA 3W2MA 3W37A 3UNTA 1DIKA 3A24A 4PUNA 1VLIA 2DZAA 1OFDA 1JPIA 3R8HA 4XZMX 2IUZA 5IRPA 3CYJA 3RG6A 4YN5A 2ANUA 1FWEC 2NXGA 3GUWA 3P5ZA 3BG9A 4GVGA 4OQVA 1B3OA 3I68A 3KL3A 2D0FA 3USBA 4FIRA 1UR1A 1BQCA 1W1PA 1ZJHA 2DEPA 1F3WA 3GC5A 1XP3A 4YTQA 4MNJA 3CL7A 4WR3A 2E6FA 2ZE3A 4U3AA 4GYFA 3WLOA 3B0XA 1O7AA 2DT2A 1E51A 4ML9A 3QMRA 2V5BA 3I4KA 2VQTA 1VBRA 1A3XA 4RXGA 1TTPA 1F6YA 4OZOA 4AZGA 1J96A 3C2RA 3HV9A 3GFZA 4L9YA 4UB9A 2QGHA 3KRBA 4YCOA 1MSSA 2WNZA 2E1WA 2PDHA 4AD1A 5BCAA 1WDRA 3I3EA 1YYAA 4D8AA 3DERA 4DI8A 1ZB5A 4JFSA 4UQCA 5G1MA 3RLGA 1VBHA 1LORA 4IJCA 2ZRUA 4WY0F 3IJIA 1Z44A 1Y0EA 2DU2A 4O16A 3H7VA 1E40A 1Q4NX 2C3ZA 1EIBA 2Y61A 2YCLA 5HK4A 3T0TA 2QGYA 1KBJA 5XINA 2P3ZA 3LTSA 1EGMA 5U7SA 3W1NA 3MT1A 1EF2A 2Y85A 1EZ2A 1AW5A 2WJEA 3MKKA 3MV11 2V82A 5SWUA 3LNPA 2PP0A 1VENA 3NSNA 1VCFA 2WC7A 4P61A 4ZFCA 3W7MA 1KNWA 2GUYA 3B8WA 3SY5A 4H7VA 1KGXA 3GNOA 5A94A 1E1EA 4JYFA 1QCWA 5LHEA 2WJFA 3WQPA 2IPWA 5EL1A 1ECQA 4ADTA 3LBMA 4QLJA 4LBRA 3PUOA 4MMWA 2ZVRA 3W7EA 2OPJA 3FGCA 4NILA 2BHUA 3SUSA 2QZRA 5CSSA 1VGAA 4IQJA 3M16A 5A5WA 2VZTA 3AIBA 4ZFMA 2QCLA 3LS9A 5G4WA 3PBMA 5I24A 2G0WA 1MEIA 3O1NA 3NZ1A 5DANA 2ZRVA 4DPQA 3BAIA 4JICA 1TTQA 3LHZA 1UKQA 2F6UA 3BSHA 1ZLPA 5G1YA 1Q6QA 4IIEA 1TIMA 3VKBA 3LMYA 3U2OA 1E6ZA 1FWRA 3RX2A 3BLFA 3WQCA 2NX1A 3W7PA 3MC5A 1Q63A 5D9MA 3M0ZA 3UBPC 3LLDA 3PC0A 3NURA 1GOMA 4IWWA 3DC0A 5H1WA 1DV7A 2J27A 3LHYA 2W27A 2OLSA 3D46A 1DXFA 3E49A 4YS1A 1OIFA 4XZNX 1E3XA 4IFKB 3NG3A 4UTJA 4XAZA 1ONXA 3JR2A 3DYPA 3W7QA 1E0XA 4UOQA 5D03A 2I5QA 4DUVA 5CXPA 4PTMA 2C18A 7ODCA 2A79A 2CKRA 4AIUA 3H8AA 4Z2LA 2XIJA 3SCSA 4UTTA 1QI0A 5FF3A 4O1CA 4AD5A 1E1CB 4G5DA 4ECLA 3OZPA 2X0YA 1EX1A 1NY1A 5FF2A 4UZSA 1OFAA 4NASA 1J0IA 4FNRA 4UXDA 3CQHA 1EWDA 3ZJKA 1NELA 4QXIA 1O68A 4C90A 3QYQA 5I03A 3LERA 2YL6A 1OABA 3TQPA 3P84A 3PVFA 4GVFA 1QBAA 4A8RA 3CEPA 5LA2A 3NL6A 5A2AA 1U30A 3WJWA 4GIAA 1ZS2A 4AIBA 3UNDA 1DE6A 2YIHA 2WZTA 3URAA 4UFHA 1DBTA 5HBFA 3THUA 3N2BA 1GK8A 1JXJA 1E3ZA 1E4NA 3U3HA 3VA8A 1NTHA 3Q4DA 1A53A 3PM6A 1KBBA 2VX5A 5BXRA 4BS0A 5DELA 4KKXA 4Q32A 3DXIA 3S1GA 1NFBA 3T0BA 4Q4RA 4US5D 2O92A 3VKAA 1EB3A 2HEJA 1KA9F 2GGHA 3DKLA 3FA3A 2WKJA 1NWTA 2H9AA 4JCMA 3UXAA 3NQDA 2BB0A 2OJPA 4ILSA 3KL0A 1SZNA 3FJNA 2I5GA 3MHUA 3FYOA 3PULA 2QJGA 4NYYA 2CLKA 1N2VA 1K8YA 4PMRA 3GG7A 1FFQA 1EUAA 4OBRA 3N6JA 2ON3A 2DZPA 1M7PA 1U2YA 3C8FA 1MRQA 4Y9PA 1Y5XA 1RJRA 4ZQPA 3FXYA 1GQJA 1UKTA 4GZEA 2AQWA 3KL5A 4M7SA 1SMAA 4POCA 5CPMA 3LHWA 1YE4A 3C0LA 1SFLA 1XRSA 4HSOA 3QGVA 3G1SA 1FCVA 3I7SA 2BMBA 4Z1DA 1YMYA 3K4WA 1ZQ5A 1EYWA 1MXSA 3O05A 5CPLA 2BY0A 2J79A 3OODA 5C70A 2OZ8A 1ODZA 3NXLA 4QE1A 3SQSA 3GNDA 3VU2A 3STPA 2GQ3A 1KM2A 1K9FA 3E2RA 3FJLA 4E8CA 3HU7A 2WBKA 3P0WA 1M9HA 3PUGA 4LVGA 5REQA 3KVLA 3KOWA 2ZVIA 4PMVA 3WMLA 1CENA 1JXKA 3VIGA 5CAHA 1UR8A 2FTYA 4O53A 2FHBA 3CZEA 1VFMA 1VBGA 4HPXA 4BQ4A 1YPIA 4RPPA 1R3QA 5AYYA 5I07A 1X6LA 1XJBA 1X38A 5I78A 2YA0A 4J35A 3KE0A 4NUWA 4R88A 1D7FA 2NUYA 1RP9A 5D09A 5I7GA 1W9BM 4O0ZA 4E2VA 1W5PA 4WXYA 2OT0A 1HUVA 5A6MA 4AC7C 2XVGA 2F61A 3BW4A 4LV9A 4TUFA 1YBQA 3ITXA 3LHTA 5CSUA 3O6AA 3V5OA 1ZGDA 3S6DA 5KZ6A 3EDJA 2QJNA 4US6A 3BAJA 5CLTA 1RVKA 2OKTA 5AYZA 2VDGA 2QDDA 2IXUA 2VC7A 2X09A 1LUCA 4RPQA 2FPVA 3W83A 5K9XA 3A3XA 3T6CA 1CTNA 1EJXC 3G1FA 3I7QA 4GY7A 1HL2A 3WLQA 3GVWA 5AC6A 3BXWA 2BS9A 4LALA 3WF0A 5CSYA 5F4SA 2FQIA 3W7IA 2Z7GA 2QDGA 3IVTA 4GYPC 1XXXA 4JD4A 5FAJA 4Y9OA 2BTMA 3M44A 1IQ8A 4F2BA 3G1VA 4H3DA 2WMGA 2WMIA 2OOFA 3ATYA 3R25A 3CV7A 3DFSA 3GC2A 1W3LA 2E4TA 1S5MA 3QN3A 2HISA 2WKGA 4FZIA 3DHDA 3EMCA 3FKRA 3DFYA 1W2VA 3VVGA 2PDBA 4QDMA 3W01A 4RW5A 2X0HA 3RCNA 3BLDA 4QBXA 3ITGA 3VI2A 3QVQA 3A3WA 2NSOA 3II1A 3T0CA 4DEFA 3NA8A 2E25A 4QSFA 3W38A 2NV1A 2E3ZA 2CHOA 3VOFA 3UYCA 4V15A 1SSGA 4HNNA 5I79A 1CI1A 2G8ZA 3LRLA 3L0GA 1NFGA 3QQWA 2OOGA 4XIAA 3O07A 2PDLA 1HVXA 1GKQA 1XGZA 3H2FA 5A3HA 3KX6A 5LIWX 4J40A 5AYBA 3R11A 1VYRA 1GT8A 4G9PA 1DJQA 3C0SA 2ZXBA 4HJFA 4MY9A 1US3A 4RDYA 3KP1A 2FVLA 2CLIA 4KWOA 4LUTA 2E28A 3TJLA 3VNIA 1EJUC 1JCLA 3SIMA 1YXCA 7REQB 3LHUA 3WNLA 4J9JA 1EUNA 5C8BB 2JBMA 4CNPA 3IGXA 1O5RA 2VFFA 3RCMA 3V0UA 1DJNA 4R9OA 1HL8A 3DC8A 1Y7VA 1K4GA 4NG3A 4AB4A 1CLKA 1XYFA 1US2A 3HG5A 3P7YA 4XG1A 1P1XA 3LX9A 5E9AA 2HMCA 4RR4A 4YHGA 3CU2A 2PD9A 1S2TA 1UKSA 3EWWA 1KCLA 2Z1KA 3IS4A 1EDQA 1AMKA 4Z1AA 5FEPA 4RK8A 4N4QA 3M5ZA 2CZDA 4UQBA 2IPJA 4NQ1A 2B7OA 1XYAA 1TPVA 1W5OA 2PLCA 3PWGA 2WJZA 1T8QA 5HNTA 2PDKA 1UOZA 3PJXA 3UG5A 3WELA 4DM1A 3MKVA 2HVOA 3CUIA 3PBWA 4ADSA 1M1BA 1HN1A 2OX1A 3P93A 4UQEA 5A2BA 3PG9A 2WAGA 2BXYA 1EHAA 4DZIA 3S8HA 2Y5JA 3QF0A 1QW9A 5D2VA 5EMYA 1Z32X 5DF0A 3C2FA 4UQ9A 5DT5A 3VD7A 1VEPA 2XZ7A 3HURA 1POKA 2QAFA 3RPTA 1UD4A 3HJEA 1YDYA 3DENA 3E0WA 5E9XA 4XO6A 1Z42A 3VPLA 2O9OA 4W4QA 1M7XA 5ABTA 1XR2A 1V0KA 2R1PA 4I7WA 1WZMA 2IKGA 1M03A 2GPTA 4Z17A 4DO6A 4V33A 3T8QA 1CBGA 3DAQA 3L9CA 1OFOA 3AYRA 4D6GA 3M41A 1R8LA 2CYGA 2WQPA 3C56A 1DIEA 2B4GA 4UBPC 4XIMA 4GQQA 1AZ1A 1PWLA 1XLIA 3EEZA 4H00A 5EGRA 4ICNA 4RZ6A 1K7FA 5GNZA 2WNQA 3T07A 3V0SA 4U10A 4R85A 2DIEA 2ISSA 2ZX9A 4NX5A 1EXPA 4GJIA 3A4XA 3POCA 3LBOA 4D6CA 1XLMA 2GL5A 1QO5A 4Q8WA 4I5RA 1K7XA 3FNDA 2WK2A 2QEZA 2WMHA 2Y8KA 1J93A 3A47A 2INZA 3LM7A 1N82A 1MZHA 3AS2A 4PCPA 1VKFA 3IANA 4ZO7A 3TVAA 3DECA 2OGJA 1TPEA 2RJGA 1OFRA 2R8WA 1E43A 1MFVA 3HN3A 5DRIA 2UZ9A 5CBBA 4IGSA 4NZ1A 2ESCA 4J2PA 2ZYFA 1F6PA 3TQ0A 4DO5A 3SI9A 1HGWA 3GHUA 4WF7A 1P5BA 4IQLA 2PDFA 4IPNB 1LG2A 5DBTA 1O94A 4H41A 5FF0A 3AC0A 1KQZA 3T2PA 1E9YB 4JFWA 1XICA 2Z7KA 4AG0A 2DT1A 3PFMA 2BVDA 2GGEA 4C7FA 2RJHA 3RPDA 3JUGA 2DQWA 4Q8UA 3KLLA 1L9WA 1A5BA 2BHYA 4G1KA 2V3DA 1R87A 4NAFA 2Z2BA 3W7LA 3KBVA 1TJ0A 1QRQA 3I10A 6TAAA 3GTHA 3RMJA 3OEXA 2HTMA 2PF8A 1PPIA 4MJMA 4I6KA 4J28A 1EGZA 4Y96A 3Q45A 1PVNA 1GZJA 3NPVA 3O6DA 1BHGA 1BWVA 1DYSA 2WMJA 3ABRA 3M1ZA 3HBLA 4PUDA 1UP3A 1HFBA 1XIHA 1B90A 4EAYA 1GEHA 3UQNA 3B0UX 7PTDA 4PMOA 2PI6A 3OP2A 1Y65A 4HYWA 3UCQA 1T7LA 2Y5SA 2E5BA 4REQB 1XH2A 2OCZA 3BJSA 4MB4A 4KFPA 2BHZA 2OLAA 3H7RA 5GPRA 2GOKA 1FHUA 4C1NA 4IPPA 1XLBA 2PDXA 2E9LA 1E4MM 3W87A 3UP8A 3TU9A 3EOEA 5HMSA 1GTHA 4WXZA 3OA5A 3GDLA 2ZADA 3FDGA 3ARXA 1OFBA 5EA9A 3SQLA 5D02A 3W71A 4J3WA 3VGDA 1RJQA 3F4VA 4R7WA 1WBJA 1O5QA 3BZGA 3W72A 3MP5A 1J0HA 3FN9A 1WV2A 2I5IA 3PSVA 4GZIA 3WBYA 1LLZA 4J3UA 4A35A 1NQ6A 3QPYA 4UR9A 4PMUA 2QJJA 3N2OA 3RPMA 3WLRA 2NV9A 2GJXA 3B8VA 1VB9A 3TTEA 4BR1A 4EP8C 1PZ1A 1KRBC 5DFAA 4QJ3B 5PTDA 3IJDA 6A3HA 4RUBA 3VDGA 1O4UA 2PDGA 4IXHA 3D3FA 3W74A 3UETA 1PBGA 3TTYA 1V0MA 1LCOA 4L9ZA 7TIMA 2YCIX 2QV5A 3QMTA 3O63A 2R94A 4PGLA 4Y8EA 1IR2A 1R38A 1BF6A 2ALDA 3H2EA 4CVWA 4JTEA 1G4TA 3EX4A 1IZCA 4IXXA 2XGZA 4UNKA 5KTLA 3HF3A 2WHMA 1NWUA 2G3FA 4DZHA 4ZO6A 4ORIA 3J7HA 4C6BA 3TONA 4DYJA 1BXBA 1U1HA 1Z41A 4XD3A 5FACA 4H6EA 4BY3A 2PB1A 4HYRA 1UZDA 3E0IA 5F4WA 1ZHAA 4ZGYA 3QSTA 4C6MA 3WK2A 1KFWA 3C3NA 2QAPA 3K4DA 1I75A 1VFTA 1ICPA 3IJ8A 2YOCA 2G96A 2E5CA 3O06A 1E5JA 1W3HA 1U22A 3GXFA 2VD8A 4O15A 2AL2A 4JTAA 4QG8A 1HT6A 2WYSA 3ZVIA 4WHBA 4L4MA 3FEQA 2Q8ZA 3IJ6A 2C0HA 4MM1A 3DOPA 1RZMA 4DWSB 4NZ3A 1AJ2A 3TSBA 4DXVA 1PIFA 4C6IA 4K36A 2PWUA 1DE5A 3G1RA 3AHXA 3L21A 3E02A 3CEUA 3FS2A 3N15A 3TN5A 1VBJA 4PTWA 1ISVA 1JDEA 2EPOA 2E8ZA 3SFKA 2GSEA 2RGMA 3BV4A 4B5SA 4XKYB 5G2WA 4QE4A 2I56A 4LUSA 1RBLA 4E2BA 3FLUA 3PBYA 1GHSA 2E6YA 2P10A 3UEQA 1AW1A 4X63A 3RM4A 1EPXA 5CG0A 2V8ZA 3QPZA 2WPGA 3WQ4A 1OGSA 3CH9A 5FJJA 1QI4A 3N13A 3CS2A 1LOSA 3UA4A 1F4HA 4RCXA 4HNVA 5LA1A 2AAMA 1J2WA 1R3YA 2R1KA 3A5FA 5EY5A 4EAMA 4LC6A 3RR4A 5EBUA 3PTDA 4IUGA 3UXIA 1SZFA 2OSYA 3OGSA 3KS6A 3UR7A 3FXGA 1EJSC 3MB9A 5AHNA 1HG3A 2JK2A 2Z2UA 3SUUA 1XYBA 5ECVA 4WX2A 3U57A 1P6WA 1XYCA 1KWGA 2VFEA 3WD2A 1FTXA 4JTRA 2VVNA 3MWAA 3QQ0A 1CB7B 3CHFA 3QSRA 3JU2A 1JZ4A 4XVDA 2V63A 4HPNA 3LPGA 3M6DA 4JS3A 3ZLHA 4TX9A 4E3VA 1XH0A 3BO9A 4HHHA 3BMVA 2TPSA 5AZ1A 4UOJA 1F61A 4UTHA 2HVNA 4LS2A 1CIUA 2NVCA 2GQ9A 1M53A 4RNJA 1QI5A 3WLTA 1Q7ZA 2VR2A 3MI3A 3P80A 1E0WA 2PWDA 1V93A 1XIMA 3RF9A 5DCDA 4DVOA 1SM9A 4MADA 1V3HA 5JIPA 1GNXA 3ALFA 1ISYA 2IKIA 3W2NA 3BH4A 3W7GA 3UD6A 4CN1A 2J4GA 4NY2A 3GR4A 3NSMA 4P7RA 1W1A1 4M81A 2QQ6A 3RRAA 3O6YX 4NKCA 3B8SA 4WY0A 3PZMA 2YCLB 2GVJA 1EQCA 3AMDA 5DQPA 4US5A 2XFWA 1FWSA 4QQ3A 3LLXA 4C6CA 4H2CA 3WMSA 5G2HA 4Y6GA 3GHRA 4LCQA 2G50A 1GVQA 3SIZA 4NVTA 1JGMA 4P8VA 3GU9A 1GJPA 4RV8A 4CCDA 2XM1A 3KVJA 1YNPA 3MDUA 4FMVA 4GUIA 4FAMA 4C6OA 2WANA 1BYDA 1H1ZA 3W07A 4FNUA 3M47A 4JDYA 1XSJA 1E5NA 3GM8A 5LIXX 1VF8A 1B0IA 3GH5A 3FGCB 1JDDA 1FP9A 4MG4A 3UGVA 5HMFA 1TSIA 3TYEA 5HULA 8TIMA 3VK5A 1I1XA 2OELA 3A22A 5A6KA 5F1VA 4LUIA 3TN6A 2VRQA 2FTWA 3VMOA 2Z27A 3ZWTA 2G97A 3S0CA 1G6CA 3PTMA 4K3ZA 3LB0A 1XYZA 1ZP3A 1PZ2A 1W5QA 3EGJA 1RBAA 4DJFD 4OV4A 3N25A 4LPCA 1O5XA 4XV0A 5FJPA 4A22A 4DJEC 5A6AA 4IFRA 2PDYA 3LENA 2E68A 5AN7A 3W7RA 2C79A 3LI0A 1UH4A 3VIPA 3UWWA 5BRBA 3C0QA 3GU1A 1MW0A 4H9VA 4QS6A 4ACYA 2WM1A 4M56A 1G5AA 1BVNP 1R3WA 1BYBA 4EX4A 4P7LA 1W9UA 2VD9A 4GYJA 1HF6A 4AY8A 2BWGA 3ANYA 1O5KA 1H5VA 2CITA 4GI9A 2V67A 1J5SA 4GE8A 2DP3A 2Q01A 5FA5A 3MY9A 2A3LA 4Q22A 2J7BA 1MVYA 1SU5A 2QCNA 3WG6A 1AQ0A 3LG3A 1GGOA 3NPUA 2XINA 2FZDA 3WLNA 5B7YA 1AA1B 3FDKA 2VFIA 2WSKA 3QLLA 1SYTA 1EEXA 1QPOA 1A5UA 4K8GA 1J6PA 3ZVHB 1I1WA 3AOFA 2VEPA 3TWAA 2REQA 1KRMA 4TVUA 5AC5A 1OCQA 3GH7A 1FWIC 3LCHA 4TTUA 5FF7A 1DWAM 1I9CB 3AIUA 1ZAIA 3DHPA 1NWSA 1Q6DA 4MKNA 3EOSA 4JTJA 1B3VA 4Q4KA 1LRTA 4U2ZA 3A3HA 1YRRA 1ELSA 3TQKA 2XH4A 3E2QA 4TX8A 3U5YA 3W7NA 4HBKA 4KW2A 2HVMA 2HBXA 3GR7A 2PMQA 3WDRA 3VC5A 4GOAA 2R6OA 3MSGA 2VZVA 2H9AB 1ONEA 5K7JA 4LJ3A 1OG0A 3HPZA 3ZLGA 1HO4A 2I57A 1ZBWA 5FSDC 4UQAA 2FH6A 3DG3A 2FVMA 3VKDA 1Q6OA 1TPB1 1P4CA 1XLFA 2QNEA 2ZUMA 4PSPA 1HJQA 1OT2A 1K8CA 3F4CA 4WIWA 3BDKA 3PY2A 4MZ1A 2H90A 2X1SA 1GOXA 2AKZA 4H19A 4O52A 4PCFA 3O6CA 2QIWA 3BE7A 5G4EA 2YCEA 1MXDA 2CZ5A 2YA1A 4JPGA 2PGWA 2XM2A 1RK6A 5E1QA 4GBDA 4MPQA 3VDHA 2J7FA 4KRUA 1XDMA 2XH2A 4HZ7A 3CZKA 3W1UA 3EWZA 1HP5A 3GXTA 4ZTYA 4F79A 5M5DA 5EYWA 1TPUA 1JD9A 3ZM8A 1OVDA 2NQ5A 4W5UA 1QOPA 2GDVA 4GMEA 3NDZA 4L80A 1NWRA 1RCQA 2GQ8A 1BD0A 2NQZA 4F66A 2QT3A 4JAWA 3T44A 1CXKA 5I2UA 4LWWA 4PB4A 1BFNA 1PTDA 4GNVA 5REQB 5FI8A 1GQNA 1UZ1A 3FX4A 2ISVA 1VS1A 4PBFA 3WNOA 3HMJG 2NT1A 2QCHA 3VE7A 1HKIA 3SGZA 4S3CA 4X22A 1R9ZA 2V81A 1B9BA 2WLZA 4F0HA 3EX1A 4GC3A 4UCFA 4M0XA 3XINA 4QAWA 4I7VA 2VHLA 2XISA 4D8ZA 3H6OA 2OFJA 3VUPA 4UR7A 4B5UA 3MJMA 3CMJA 3SY1A 4ATWA 4M6UA 3T0DA 4GJ1A 2ZA1A 4WQ6A 1GVRA 4DI9A 3EWBX 1UCWA 3GWQA 4ASTA 3N18A 1O60A 1E6SM 1YBQB 3MUAA 2HK0A 2ZA2A 5T26A 3GTFA 2QCFA 3AS3A 3GQYA 5D37A 1SMDA 3OLEA 3BOLA 4IMEA 1S38A 1US0A 1SQ7A 1JPMA 1YW1A 4WSKA 1JL8A 3PHAA 1MO0A 1QNQA 2DZSA 3P61A 1LUCB 3TXZA 1S39A 3FFSA 3GDTA 1C8VA 2ONEA 2VWSA 3I65A 4TVDA 1LG1A 2DFAA 2J66A 5GJPA 8CGTA 4BK9A 1UR9A 3SBFA 2V30A 3PB2A 1FXPA 1EF3A 1JEZA 3VO0A 2D23A 4CCEA 2WMIB 1XQKA 1CYGA 1TQXA 3EEGA 1F8MA 1KFBA 3EKLA 4JIEA 1RJPA 4DLMA 1FY6A 2O0TA 1GW9A 2ZQ0A 4IF2A 4AHQA 3RLUA 3V1PA 1H62A 4IPJA 1PJ9A 3MUXA 1AG1O 1UWRA 4D71A 3CQ0A 4ALDA 4I8YA 4YL2A 2WV8A 1JG9A 1A3HA 4MIMA 5HR7A 1MUMA 4B5XA 3S2NA 3ZT6A 1KTBA 5DBUA 4A2SA 4L56A 2GVGA 4ZSUA 3GXMA 4CD8A 2P5NA 1HJUA 4HT3A 1KXQA 4FK9A 3GK0A 4OTKA 1VH7A 1F9CA 1Q13A 2KX9A 5JBDA 1A5LC 4S3KA 3AXXA 4MF4A 2F38A 2EGZA 4LB4A 2YXGA 4G56A 3RRXA 1A47A 3ZS4A 2VNCA 3TA6A 3MCMA 2DZVA 3TYDA 1LT7A 5HJYA 4L65A 1NU5A 1ITCA 4EXAA 5EU9A 1HJWA 3UZJA 3VFLA 1RLDA 1C90A 2BY1A 4LUTB 1ZRQA 1J9YA 4JZ5A 3EBVA 1AJZA 1H1YA 1VRXA 4P2VA 5CZ0A 2WHKA 4W85A 2FYMA 4LTSA 3W6YA 1QT1A 1QTWA 6PTDA 4AAJA 3NYZA 3A21A 3GFXA 4DJED 4Z08A 4DJDC 3MUIA 1P6CA 4D6FA 4DUWA 4IIGA 5E5CA 3LM3A 1BPLB 4L4OA 1F76A 1V6UA 3HPSA 3V1HA 4I90A 2VGGA 4IP5A 3TP4A 4QG9A 1GORA 3T9PA 2DT0A 1ITQA 4IQEA 4Q8TA 3ARSA 4LCRA 1NDVA 4XVEA 5A6BD 1XV8A 2PGEA 4BI6A 3UCDA 1WAWA 3KCOA 3HTWA 2CBJA 1V3LA 3BICA 3BUVA 2ZZ4A 1O6IA 1SZRA 4RE3A 3LPOA 3UJFA 3LQLA 2C7FA 4PMYA 2P88A 1VPYA 2VELA 2NQHA 3O2LA 3R89A 3VABA 3HGRA 3GO2A 2NWSA 3SZ8A 1GQLA 1RQEA 4HA3A 1QNSA 3HV8A 1UPMB 4CEXC 2XG9A 3NQBA 3HQNA 3N1AA 4RL3A 5F4XA 1B3WA 3R13A 3MA8A 1XYLA 3VOJA 2CZEA 1TWIA 2WC4A 2QUUA 2J77A 1ZNNA 3MV01 5A8OA 3M0JA 1G9HA 3LMZA 4F48A 1O1ZA 2QUNA 3DHUA 3B9OA 3SGUA 2ICSA 3K4AA 4GYPA 3GIYA 4GUFA 3C8NA 3JZEA 4WJ8A 5HQMA 4HD5A 4UFMA 2WLYA 1TJPA 3CASA 9XIMA 1FWAC 1CCWB 2ISDA 2J9YA 2P8BA 3MKCA 2V5JA 4YYCA 4YVVA 1QNOA 1NOWA 3CBWA 4A8LA 4B5TA 3KOYA 3AZRA 4E3TA 1L6GA 2IQ0A 3N2XA 3SN4A 3MSYA 5D2XA 1EFZA 2Y7GA 4UCGA 3UXLA 3PAOA 5I3DA 2F9RA 3WK0A 4Q8PA 2W66A 1YDOA 2X30A 1YX1A 1FH9A 1PIGA 1RPKA 4DLFA 3N4EA 4UFIA 3SECA 1FH8A 4HU4A 2DSWA 1XIDA 4FP1A 1E0TA 1F07A 3WUBA 4OOZA 1VD6A 3S5SA 3UVAA 3WH6A 3CUXA 1A5NC 4K1WA 3H2MA 1R5YA 4NZ4A 4FX6M 5HNRA 2J88A 1B3YA 4ML4A 1I4NA 5TAOA 5BWAA 3BC9A 3KS5A 3L65A 1A50A 3UWZA 4CNUA 2BODX 1EBGA 1FDYA 3ZT7A 4IP7A 3WUEA 4WZHA 4YJ5A 4WKHA 1OM0A 3KCJA 3VYLA 2BY3A 2X7VA 4S39A 5BW6A 4X2PA 2QLYA 3B8TA 1PKLA 1CXIA 1HKWA 1LOQA 1RR2A 4GQRA 4EPBC 4NAFB 3CO4A 4Y90A 4KRZA 3L67A 1V03A 5IM51 1OB0A 1JVNA 2VRKA 3W1QA 3WCZA 4KERA 1W91A 2ZUNA 1KQYA 3S1VA 2OYLA 2HRWA 3ARRA 4M29A 4WD0A 4F2UA 1AL8A 2G41A 2WVTA 3QEZA 1R85A 3N34A 3U0HA 1UD3A 1BGAA 4MPKA 4CVUA 1TIWA 4JX5A 1PCKA 2W4XA 1QK2A 3KDNA 3ATZA 1WNOA 3S6TA 4AX6A 3RK8A 3TUUA 5BXSA 1H60A 1KTCA 1QDSA 2XSBA 2Z2AA 4N42A 3THQA 4O19A 4HTYA 2DVUA 3T55A 3KUMA 4KIEA 3G6MA 2CETA 3CPRA 4QS5A 1Q6FA 5E0CA 1ZJIA 2RH9A 4A6GA 3S1UA 2Y5EA 1I2PA 3NQFA 2A3BA 3NQEA 3H2CA 3KDOA 1MRAA 1ZFJA 2VOMA 4XAPA 3MVIA 1TVNA 4PZVA 1TWSA 4QLKA 3SDOA 3E96A 1Q8JA 4OBTA 5IDZA 1JZ3A 3VNJA 2OLHA 1SVDA 3OIHA 3TR2A 2OODA 4A3QA 1B4KA 4GVHA 4JCLA 3LCLA 3WKZA 5ABEA 4AZ5A 5EMMA 3TYCA 4EVZA 1GVIA 4CD4A 4MKSA 4KS0A 2QYGA 5CZTA 1GUVA 4M5PA 3KHDA 2QF7A 3VGBA 1ONRA 4H6QA 2QULA 3BLEA 1N55A 2ZDSA 2PDJA 5CAKA 2WB5A 2J74A 5H2ZA 4J3SA 1BLIA 5CJMA 3MI6A 2C19A 4KEMA 1EIXA 4RZ5A 4NX0A 5DMMA 1O95A 5BYWA 4CLMA 1BVWA 5HNNA 3WQ5A 1T96A 3R1ZA 1GG1A 2XHYA 1EQPA 3GSMA 2XVLA 3UR5A 5M03A 3SM0A 3K46A 1MXGA 3MSDA 1ITXA 5KZMA 5LIYX 3APYA 1ZP4A 1FP8A 1KXTA 3T8LA 1FRBA 4MLJA 3CIVA 2Y89A 3W29A 3LY0A 3OOQA 4IOTA 1N8FA 1NOUA 2NZLA 5CGQA 1NOFA 4E38A 1E4IA 1JRCA 3LLFA 3AISA 1VYPX 1VR6A 1V3MA 1M5WA 3PANA 3UJEA 2RUSA 5FL0A 1U33A 3WLPA 3WD0A 4ZE5A 1FWDC 4DJDD 1FCQA 3L2IA 3TX9A 3CM4A 5H91A 1W9DM 4H04A 1QOXA 3WQVA 1K8ZA 3O7UA 2A5HA 4JN8A 2Y8VA 1Q7QA 2YYUA 4GY0A 2R14A 3DDMA 3M64A 1HW6A 4HCHA 2YZRA 3TIMA 3N4FA 3TC7A 3C2EA 1T6MA 3TTOA 2AL2B 3P5YA 3RIKA 2YDAA 2FTPA 3D6NA 4Z1CA 2Q6ZA 4AHOA 2R1LA 4UNIA 4JYDA 3WJSA 4X0NA 4DQWA 3IVUA 4AD2A 4UTKA 1ZZMA 5EFDA 4C7DA 3TKFA 3ZZ1A 1QATA 3LTYA 1MUWA 4JFUA 4ZMGA 1LWJA 2Z00A 3CLMA 5E6YA 4PMZA 5KZEA 1GZ1A 2ATSA 2YW3A 4HQVA 1K77A 4AIEA 3CTTA 1TX0A 1Z6KA 3G0UA 2VOTA 3TYUA 2ZOXA 1BTMA 4LUSB 1AQHA 1XIEA 1MW3A 1FWNA 1EC8A 2C16A 3MU7A 3P3BA 2OYMA 1OX5A 4DJFA 1DJHA 3PPCA 4GKTA 4IT1A 2D20A 3M7WA 4DN1A 2RDUA 4WRHA 5CPSA 5LIKX 3VMNA 3WQDA 8XIMA 4XWUA 2D2HA 2IQTA 3KVKA 4P7QA 4XZIA 1JFHA 1AH0A 4GCXA 3BGJA 2IW0A 1TV2A 3F4NA 2H3DA 5C2GA 2PWVA 1TPWA 4EE9A 3QMSA 2GJRA 4AEOA 1I2OA 4UFJA 1ADSA 5D38A 3SY8A 5I02A 2SFPA 1Q6LA 1GKPA 1RSCA 2OEJA 3EB2A 3SUWA 4D6JA 3GH4A 3RJYA 1P7TA 2W63A 1C7TA 3BVJA 1DWJM 3WQWA 3S47A 1NJJA 1X7IA 6REQA 1RQBA 3QV8A 2FMOA 1R86A 2FZMA 5F1UA 5FEZA 1Q4WA 3VNDA 1FOBA 1X39A 5CZSA 1ECEA 4LAKA 4NL1A 2PUZA 2HK1A 1NP0A 4KCWA 1BQGA 2IS7A 3K8KA 4UIOA 2QXWA 2ZRWA 2XWEA 1F73A 3BJFA 4HNCA 2OWXA 4F9DA 1L2QA 2XYLA 1J11A 2J9ZA 4C6QA 3KHJA 2V6AA 4KGJA 2FMNA 1V0LA 4HP5A 3CV1A 3BK0A 1XBXA 3URBA 1J8VA 1QBBA 3C2YA 4B92A 2CKSA 1RLCL 3CC1A 4DBUA 4CGTA 1DQWA 1UR2A 3AWNA 3M0XA 2PU0A 3B0PA 2NQ9A 2VYOA 4C6LA 3NWRA 3GNNA 3L4XA 3ITTA 4M1RA 1TMLA 3BMWA 4CKQA 1HO1A 3VILA 1BSLA 4QNEA 5MHBA 4S3EA 3PB0A 4WY0B 3ITYA 2AL1A 1X1NA 4CQDA 1XIGA 2YLAA 4HHLA 4FR1A 2VX6A 1Q6EA 3W7KA 4XTIA 2CZVA 4H7ZA 2VC6A 2HE5A 3QYSA 9RUBA 5BU6A 3B0VC 1QJWA 2C91A 3MDWA 4S3DA 3RX3A 2RDTA 2J7GA 3FVDA 1TMQA 5ABHA 1V02A 4LU0A 4QGCA 1V0NA 3KRSA 3V5FA 3EXTA 3LSBA 4INFA 5JQ9A 4GGBA 6CGTA 1E55A 1V6YA 2OQLA 4WDXA 2J7HA 1XUZA 3G1YA 2GGIA 5FJUA 3AU6A 1XBVA 4Q6XA 4MB3A 1QR7A 3W1AA 4XUGA 3GDMA 2XVPA 3KOFA 1UH3A 1E73M 3QKEA 3WYZA 3KAOA 1JGIA 3N6QA 4ZQCA 3M0VA 1HXJA 1IEQA 2DGAA 4UTUA 4Q7BA 4AD3A 1GZGA 4S38A 1V6VA 1XLGA 3RLVA 3NEVA 4YCPA 4BCEA 5CGTA 1XCWA 3WQFA 2OMAA 3EWXA 3PS7A 1WP6A 5JH2A 4JQAA 4S3JA 2X40A 3QR1A 4UMAA 3FEMA 1H7NA 4WDTA 3WQEA 3VOCA 3GAYA 3UGRA 2VEKA 3GBDA 3WNKA 1TE6A 4X9SA 2F6KA 1IE7C 3P60A 4M19A 4LY4A 4MSSA 3TNBA 4IZGA 1SGJA 1DL3A 4XO7A 2WO5A 3VDCA 1REQA 4JY9A 4P5UA 4ZCWA 2GFTA 4CQCA 1G4SA 2DZWA 2CCRA 1EP3A 4S3BA 3CWHA 1TWWA 1CT5A 1K6WA 1XG3A 1W8SA 3IV3A 1ISZA 3G8RA 1RD6A 1B5TA 4IG2A 3POHA 3NQ2A 3OHMB 2XSAA 4H01A 1JJKA 3SW6A 3H26A 3PZQA 1KR1A 1X8CA 4ERGA 4AVNA 4I3GA 1EJRC 1UBPC 4S2CA 1A0DA 3VDBA 3W1XA 4NI3A 1WKFA 3GZAA 1ONWA 2D69A 1OK6A 1A3WA 1AFSA 1DJGA 1UJPA 3KTXA 3M0LA 4RV3A 2REQB 3SJ3A 2G3IA 4JNYA 4WSJA 4AH7A 3WLJA 2PWHA 2JKEA 3PZIA 4NXKA 3LXBA 4N6FA 1EO5A 3UERA 3B06A 1YHTA 2Z1XA 1LROA 3WL0A 2WNNA 1B2YA 1R2TA 4HMDA 2ISFA 2YKKA 4JKLA 4AEFA 2OEMA 3ABZA 1R7AA 4Q4QA 2EPHA 1OC6A 1W9PA 2Y7FA 3DU0A 3GVRA 3CAWA 1EC7A 2CLMA 5U4NA 4B9YA 3NPXA 3VIMA 3T81A 1LF1A 3Q94A 2CLLA 4KQNA 2DUAA 4I5XA 1YQ2A 3SGGA 2R91A 2CU0A 1TV4A 3LDVA 3EPMA 2NUXA 4LS0A 3TOYA 4F40A 2ZRZA 4FOUA 3DKJA 1DHPA 3ISIX 2EG7A 4HA0A 4LF2A 3LRKA 1YNQA 1RQHA 2VX4A 1VAHA 3NDOA 4NZ5A 2A4AA 3RNDA 1J5TA 3ONBA 3FA5A 3SRFA 2A7PA 4DUXA 1CGXA 2WSRA 4AUBA 4O1BA 1H09A 1HVQA 3AS0A 1UWIA 1OFEA 4UTTC 2GJLA 4S1FA 2ZBTA 3S9YA 3F7JA 3N11A 4ICMA 3TCEA 2W5FA 4PBEA 1SJDA 1VLWA 1TZZA 2VR4A 3W7CA 1XLCA 1X96A 3DYMA 1DXEA 2VVSA 1UUOA 1W5NA 2ZC8A 4WGHA 1SW7A 4LCSA 1PKNA 3VTRA 3R10A 4ONVA 4A8NA 3GW0A 3NZRA 3LOTA 4DJEA 3G6LA 3JS3A 1CECA 1ZL1A 2PA6A 2VEFA 3QXBA 2D24A 3U5UA 5BXTA 5I77A 3THCA 3SO7A 3WEMA 1XIIA 3EWDA 3KBMA 3RU6A 3UF9A 5K9DA 3G3MA 1IHIA 3EKZA 2J6VA 1OIMA 1MFUA 1V08A 5A6BA 4EF9A 3DN5A 3MI2A 1ME9A 2YDRA 1R3RA 4AZBA 3ZOAA 1IEVA 1KXHA 7TAAA 3QBUA 5T9CE 4HK5A 4LEQA 3SCWA 3B40A 3IARA 4Q8VA 4JQ3A 2X0SA 5C2CA 1QWKA 3GUGA 2X05A 4DY1A 2V5CA 4J7RA 1DEDA 2IKJA 2P0IA 2R82A 5C9XA 3UCCA 2CWNA 3VD9A 3PBVA 4XSMA 1CDGA 1R9YA 4AF0A 1XCFA 1W1ZA 3A4AA 4I9TA 3BCFA 3LPPA 4JTQA 4UFKA 3IACA 3MP4A 4FXSA 5LXXA 1U1UA 3GVQA 2OO6A 5EB8A 5HJXA 1BYAA 4OHQA 4DF0A 2X7WA 2EHHA 1W3JA 3PF3A 4PMXA 2IPGA 3DBPA 2OTDA 2D0HA 4LBUA 1T8XA 2J7DA 1L6WA 4MGGA 4AU0A 4E5TA 4W8AA 1JFXA 1E15A 1XI3A 1PO9A 4A3UA 3I3BA 4LYRA 3GTXA 5DX7A 2JIWA 1E9ZB 1PYMA 1FHVA 4D6HA 2ZKMX 1EOKA 3PNZA 4F0LA 3QOKA 3AWOA 4MAVA 1TELA 3KOZA 4JIIX 2ZA3A 2FJKA 2ALRA 4IPLA 1W3KA 1M68A 2AGKA 4GUHA 1YEYA 4ROPA 4OJYA 4QEHA 4A2RA 4CQAA 1PV8A 1TPFA 1MNSA 3NR0A 4QLLA 1JZ6A 4GY1A 1WBHA 2WSYA 4QQUA 3L0NA 5E0FA 4Z2HA 1LL7A 4GUJA 4XKMA 3ZT5A 4O0QA 2W9MA 3K8LA 4YXGA 3C2VA 5LKYA 1ZENA 4YTSA 4ZO8A 3SCNA 3MUZ1 2XGBA 4HK7A 3DHFA 2VO5A 2FZ9A 3D5HA 4NSBA 4H8VA 5FAGA 3ONCA 5CQ1A 1IYXA 3EOOA 3OZYA 4KESA 1DOSA 1H50A 4O8RA 1PDYA 1IIGA 2CLEA 4IMDA 3CGTA 3E2VA 5IHSA 2OQHA 1MQQA 3IJ7A 2FH8A 3AI0A 3UR2A 1SFSA 3M0IA 4HJWA 4JTTA 3W84A 4LUYA 3NCOA 4LSBA 3STGA 3GDKA 4NIRA 1XL9A 1EC9A 5DXYA 3EWCA 5EMLA 1EPVA 1YPFA 6ALDA 1P1MA 2JFEX 1UKPA 1MWOA 3BANA 5FESA 3H12A 1SFJA 2C1HA 5IFPA 3NQAA 3WBXA 3WFZA 2RDXA 3ZLFA 1FKXA 1K02A 2EF9A 4LXFA 1OYBA 2YCKX 1IXPA 1MDLA 3QFEA 1TCDA 1UBSA 2H3BA 4CU7A 3CAVA 4H9XA 2VT0A 3STFA 4AWUA 4L4LA 2X1RA 4MJ2A 3DFTA 3MHFA 1TV3A 2BDQA 2DORA 1CWYA 4JX6A 3GKFA 4HMEA 4IIBA 1XG4A 1EBHA 3RCYA 4KGLA 3ABOA 2Y1HA 2EPKX 3GKAA 4F9JA 5LGXA 1J79A 1FWTA 1GCYA 2J25A 3VC6A 2RGLA 2E6DA 1G69A 2E9BA 3QR0A 4ACZA 1WDDA 2WVUA 4AISA 3PZTA 3UWEA 4QDPA 3S1WA 4HN8A 1LT8A 2X16A 3AXHA 3UZYA 5IFTA 2BXVA 5TIMA 3GXIA 3ITLA 3H54A 4HMNA 1Q5MA 3GDRA 3QW4B 4TV6A 2A3HA 3DFPA 3SCUA 4PFMA 4LNYA 3GZ3A 4AHPA 2JEQA 2FGZA 1TV5A 1D9EA 2Z1SA 4H1ZA 2G4JA 1P6BA 3MYPA 3LPFA 1FX6A 1QUMA 4EK7A 2C0AA 3OLIA 4FLSA 3BLOA 1B4EA 4XZLX 3ELFA 1H7RA 3PUEA 4ZBCA 1Y5VA 3G2GA 2VC5A 4AXNA 4ICCX 3C4UA 3PR2A 5ABFA 3IEBA 4C7GA 3MUY1 3OG3A 3W1TA 3GX9A 3WH7A 4ADUA 1AMYA 4RNIA 2ZRYA 5DCEA 3IAPA 2DJLA 3VKCA 3LV5A 4O1EA 3TW6A 6XIAA 4GK8A 2E0PA 3W7DA 3GBEA 3CPUA 3WBWA 1T40A 1OFPA 2C1IA 4AFYA 5FJOA 6ENLA 3ZO9A 3KRZA 3AHYA 5AYXA 3QC3A 1EYEA 4LYKA 3WDHA 2V2HA 1ZAHA 1A5MC 2FB3A 3WY1A 4LF1A 4Q6JA 3RHGA 4ZOBA 4ZXOA 1NSJA 1TQJA 3BAXA 2EBNA 3KOXA 1J12A 4M6PA 2O9PA 1GEQA 3NGJA 3TYAA 4O0KA 3HQ1A 1IGWA 3F4DA 3HPAA 2PWFA 2PSNA 4IJRA 4ZTXA 3AUOA 3E12A 1FWJC 1PCWA 1M01A 5KMYA 3JRKA 3VCCA 3LI1A 4Z1YA 2ZUTA 2PC4A 2UY2A 4CU6A 2V3FA 3BW3A 3ERPA 4KBXA 1CLXA 4W86A 2PP3A 4U31A 3CPGA 3N9KA 3E3HA 5HR6A 3A23A 3P81A 4DJDA 3KBWA 4TQTA 1HQTA 5E09A 3TMQA 3CNYA 2TODA 4FR6A 3FAXA 4ZQOA 1K9DA 4F0MA 4GD0A 4PH6A 3UWUA 1J0YA 3NYDA 4I8DA 3LNMA 1B30A 1FWGC 3DGBA 5BNKA 3T7VA 1GTEA 1QI3A 3IVSA 3KTSA 4E4UA 4RE4A 1XGEA 4G1NA 5IOBA 4HGXA 3WL1A 1KM0A 3DGRA 5I23A 4PMDA 1UR4A 2MUCA 2QJIA 4HCLA 5AYIA 1SR0A 4WOZA 1W32A 1EDGA 1U5JA 3BOFA 5AKQA 1ISXA 5H6HA 4MNKA 1V6TA 2QDEA 4QJ1A 1T41A 4Z2GA 3VOHA 2V3EA 4H9MA 2IMRA 2CW6A 4QHRA 1RK5A 3W76A 3L4WA 1JYXA 1OQFA 2C6QA 1YLVA 1MEWA 4ZO9A 2XDFA 4AYGA 1UG6A 1M7OA 3EZ4A 1FH7A 4JTDA 5FKYA 3UYIA 2VRJA 4X61A 2W61A 3W85A 2X2YA 3AUJA 1WO2A 1XD1A 1GOIA 3TH6A 1WUFA 4JX4A 1QFEA 2DIJA 3SUVA 3OG2A 1UD5A 4GINA 4XB3A 2OGYA 5JIWA 2Z24A 2NX9A 1TJ2A 5C54A 3B8UA 5LZLA 1X7FA 1JD7A 1S5VA 5C9RA 2VURA 3R8GA 2J47A 1VHCA 3MCOA 4OIFA 3VDAA 4FOKA 1PXGA 1TO3A 4XBKA 4NU7A 2CERA 1GG0A 3W02A 3N2MA 1OD8A 3N9RA 3NM3A 4CNSA 1R46A 5HMDA 1ESWA 3M5YA 3CV2A 1UYQA 3ZJ8A 1UC5A 3UJRA 2PPGA 3CAKA 2PD5A 2J8GA 4QDWA 3WQOA 3IGUA 1QHOA 4JXCA 1PDZA 1BRLA 3OYZA 1R3VA 5I3GA 3RMEA 5I3KA 1DIDA 1VEMA 3NQGA 4QG6A 3WLHA 4PTVA 1XDJA 1XBZA 1TCMA 1SZEA 2Q3OA 2DSZA 4NRRA 1K6AA 3AYVA 3HPXA 3FKKA 3V16A 4K68A 3UWQA 1IEWA 2QUMA 3P74A 2R9RA 4GNKB 2W0UA 4R34A 1QPNA 1XIBA 3G5EA 2DZUA 2YPIA 4Z1BA 4JTHA 4EWJA 1LBFA 3IGHX 2F2KA 3T2OA 4C6PA 3C61A 1ENUA 2W62A 2Y4SA 2R1MA 3IAQA 2PDMA 2CC0A 1JCJA 2VMFA 2WSPA 2VDIA 4GA8A 4RNHA 1B31A 3PTQA 2GZXA 2CPUA 4G2DA 1XLHA 1KCZA 2B0MA 4JEJA 1ML1A 3HG3A 4B5NA 1P43A 4UMCA 3N17A 4K1GA 4TR9A 3ZR6A 2ZXDA 1HKMA 1L8PA 5JH1A 1OJXA 3L7RA 3C0JA 2CWXA 1BTCA 4YPJA 1Z8AA 5D30A 3H2OA 3BSGA 3WF2A 1YKWA 3RJXA 2VC9A 1OZQA 4LQ1A 1DQXA 2QMKA 5G5IA 1Q66A 3MPGA 5XIAA 1OINA 3I4EA 4BQ3A 1W54A 3TFCA 1WDQA 2CZFA 4S3AA 2WSQA 3BOXA 3Q67A 4AW7A 4XBJA 2PEVA 3N19B 4H9TA 1Q85A 3IRDA 4C1LA 4FXJA 2WMKA 4LC8A 4B3LA 3ZMRA 4QSHA 5HPOA 4TMBA 1X6NA 1TPH1 3CZ8A 4IMAA 3DCPA 4N9CA 3VIIA 1QAPA 4S2BA 4WCJA 2YR1A 1KBIA 3BG5A 3VGFA 3JW7A 4OGZA 3W25A 2VFGA 3PNUA 4L64A 1JYNA 2WZMA 2G3MA 3R0KA 1GPFA 3NIYA 2QCEA 5I3HA 1EP2A 2YGYA 1JDFA 2TAAA 4GIEA 2ZX7A 4BFAA 3LGEA 4JYEA 1F05A 1KV5A 3S5ZA 1TWDA 3N04A 1RCOB 5H8MA 4IFOA 5C6MA 4AWEA 5B7ZA 1YADA 4B2DD 2QMJA 1FDZA 2WM0A 2PU1A 4UTWC 4AY1A 3P14A 1L6FA 7XIMA 1KKOA 1A4LA 3NJ3A 1JF5A 2X1IA 1LOLA 2D0GA 1CNVA 2FHCA 1P7TB 1UMYA 4NJIA 5FCZA 2F6XA 1TR1A 6REQB 1WAUA 2QF8A 3CZJA 1U5VA 4K2SA 4JFTA 1B57A 5I3JA 3R12A 2IQDA 1W8GA 3TWBA 1XKJA 3M0HA 1OBAA 1EHNA 3AROA 1LWIA 4N9EA 3OO2A 1KC7A 3W1MA 2YL8A 1CX9A 3ICJA 3HIJA 4PMNA 3IRSA 1JQVA 3P82A 3LK6A 3FSUA 4R7JA 3EKGA 1XD0A 3OW1A 3LCGA 2EJ1A 2Q09A 4FEZA 1BGGA 2EJAA 3H55A 3HO8A 1VFFA 3WSUA 2DIKA 1LLOA 3EDEA 4LVAA 3S5NA 4LBSA 3R6IA 4GNJA 1K8XA 3ZJ6A 3EXSA 1A5AA 4B4HA 4AEEA 4KIRA 1DIOA 1KV8A 2NWRA 2JF6A 2CBIA 3BQ5A 4XBSA 2O9TA 4JTFA 3CHDA 2E67A 5K4ZA 2H6RA 2W92A 2NQJA 1M41A 4O50A 1FXQA 4H2HA 1NDZA 4O4VA 3GVVA 4O54A 1QNVA 2V5DA 4FPSA 4GXPA 1TJ1A 3VGEA 1F7BA 1UA3A 4MYXA 4QEEA 3TJ4A 5I3IA 1G4PA 3EX3A 3OZMA 5TD4A 4NZJA 4O10A 2CXGA 1OCJA 4WLCA 2QR6A 1ALDA 3DI0A 3FY1A 3NZGA 3C6CA 3KTCA 5CZJA 4NNAA 4Y2WA 3NQVA 4X3ZA 5CCZA 4PMQA 2NSXA 2BGQA 1UPPA 3EX6A 3ES8A 1S2AA 4KF1A 3H2AA 1UUMA 1YPXA 1OSEA 1D8WA 1OGBA 1KB3A 1L0PA 4P8XA 4NAEA 2GGGA 1JNEA 1A5KC 4C6JA 4J27A 4L5ZA 1UR3M 1Q7MA 1HX0A 1VFUA 1UASA 1G01A 2AMGA 4RZBA 1H5YA 3W2KA 4O1DA 3KM8A 1YIXA 2XFFA 4DZAA 3W3OA 3UPMA 4CQBA 2ZFAA 5KINA 3WEZA 1V02E 5DCBA 1WQ5A 4B3KA 2XIBA 1QU4A 4DAFA 4AIOA 2PRHA 3NAVA 2YX0A 3S3GA 3PP7A 2CNCA 4ES4A 2AMXA 1IR1A 5BMWA 3U48A 2OU4A 4JHOA 1UROA 1C7SA 1LZOA 2BP1A 2ZC1A 5KEZA 3WUFA 3IIPA 5BXPA 1VYSX 4BEQA 2DW7A 1LRNA 2VWTA 4GKLA 1JZ5A 1YDVA 1TB3A 4H7CA 1VJSA 3LEPA 1R6WA 3CUGA 3ORWA 4YMZA 5AVNA 2PLMA 1HJVA 1W9XA 1S2VA 2KAUC 5LNWA 1REQB 3UZ5A 1W6TA 3SCPA 5C5YA 4R5EA 4B90A 4W7WA 2GK1B 3UFYA 4JY8A 3PN8A 4HOWA 4IG2B 2DJXA 1UUQA 3QV9A 1EO7A 1E9IA 4MTVA 1CGWA 1B9ZA 4M7TA 5ECUA 3OA3A 2A21A 5MKGA 4N9BA 2VXNA 3OU8A 5FD0A 1ZY9A 1LL6A 3ZIZA 1AODA 1HZYA 2GVLA 2PTWA 4W5ZA 2Q8XA 3V75A 3SN0A 4KFNA 3TLQA 3W1PA 3HOJA 1YDNA 3PZ9A 4BJHA 1QPQA 4LAOA 1ICQA 1KLYA 1EA9C 5AFDA 2Y6ZA 4JTCA 3W2UA 2E1DA 2XH7A 1Q45A 2PBOA 4A8IA 1SO3A 3WH9A 4WEVX 1OX4A 3FK4A 4FF5A 4XX6A 2EG8A 4QNWA 1XWYA 4KEUA 3K1DA 3QZAA 4PTNA 4LY8A 4FALA 1KFLA 3W24A 1GQIA 3UY7A 5A8GA 4PBGA 1GOWA 4IP4A 5I6SA 2CLPA 2X8RA 2XZ9A 1IXNA 3O15A 5LIUX 1AK5A 2XVNA 4FO4A 2VEIA 1TMHA 3GE7A 1I60A 4GQ0A 1JAEA 1GJUA 4WVXA 3TE9A 4TV5A 4K37A 1DWGM 3THAA 4CN6A 1S46A 1EKOA 1UOKA 2XPKA 2Z28A 1ZPTA 1JPDX 4BF5A 7A3HA 3E5PA 1IGSA 2PP1A 5IBXC 4O8AA 1AH4A 4F4RA 5KETA 4TMCA 2INEA 4QISA 1FVPA 1V77A 4CN4A 3GLCA 3QV6A 1AL7A 4L1GA 3NQCA 2Q8LA 2I9EA 2ZWZA 3HGJA 4JTGA 2VZUA 4BKNA 2G5WA 3I3DA 2BX7A 1Z7AA 1CEOA 4I9MA 3VX0A 2YXXA 2B7NA 5ENLA 4M82A 2FPTA 5HWNA 4JQ1A 1XS2A 3T2QA 3P8JA 4W84A 3GB6A 3V5CA 5F2MA 3C3UA 5I0DA 1HGYA 2V5LA 3T0AA 1LLWA 3A4JA 1KTNA 1YTEA 2QPSA 1J10A 4V1XA 3VMPA 4NRSA 3H21A 3R4IA 2VGBA 1A4MA 2EXOA 1E72M 3B0YA 5JBFA 3EX2A 3CB8A 2X42A 1KM6A 4RW3A 3STEA 3NEHA 3LRMA 1JDCA 1BVZA 3RDKA 3E0LA 3LU2A 1CB2A 3QHMA 3LZ5A 3MHGA 2BVTA 3RAOA 5XIMA 3OGRA 4OVXA 4CNOA 3QTGA 4Z2KA 4FXRA 1KM5A 4ROQA 3ANVA 3WENA 2NUWA 1C8YA 1FBAA 5L9FA 1J0ZA 1CPUA 4GABA 1UZHA 4B5VA 1FFRA 3GR8A 3YPIA 1SJBA 3UZWA 5E93A 4MWAC 1KFEA 4IL2A 3BMXA 1NIUA 3LGGA 3G1HA 4AF0B 4PRTA 3VGHA 3OGVA 3OJGA 1OCBA 2ACSA 4KPLA 4GH1A 1N8IA 1TJRA 3A9BA 1FCBA 4FHAA 1VIZA 3ARWA 1M3UA 5CSRA 1OFQA 4WDWA 5HMEA 3I6RA 1J0JA 3ZQ9A 3KBNA 1IEIA 3T78A 3SUTA 4ZSTA 5FL1A 2GQAA 2F8QA 3BGGA 2QCGA 4LGXA 1OYCA 2TSYA 1DJYA 4PULA 4RJEA 4QM1A 4ZXLA 5HUPA 3B3DA 2TYSA 3LHVA 3B05A 3WLMA 2VJXA 5A69A 1S2WA 3B8DA 1JCXA 3L23A 4K6AA 2QCDA 4Q8OA 5GJNA 2VTFA 3IK2A 1G4EA 1OZMA 8A3HA 3T1GA 3W00A 1A0EA 3SRKA 5F7UA 2PRMA 1DQUA 1O12A 1P0BA 3PZVA 4DF2A 4V1YA 1JYVA 5LHFA 4GO9A 4S23A 4XAYA 4E4PA 1RH9A 4LYQA 2P53A 4YWIA 3CK5A 1E6PA 2PDNA 4PEKA 2RDWA 1VPQA 1D2KA 4XD5A 3G77A 1UWSA 1S3HA 4CCCA 1K70A 8RUCA 2BVWA 3S2MA 1I0BA 3W7OA 2WC3A 4K38A 1NEYA 4H9YA 5D2WA 5LGZA 3VOIA 5IXEA 4HZMA 5A95A 1AW2A 3GXPA 4MY1A 3IUDA 2GVEA 1EX5A 5CJ5A 3F4WA 1H1NA 1KCXA 2OO0A 3NFUA 4XK2A 5D32A 3VAVA 3B9AA 5DLCA 2OT1A 3DZ1A 3CQJA 1RALA 4GCAA 1V3JA 2NLYA 1BG9A 4K8HA 3AU2A 1O66A 4HU8A 1XIJA 5AZ0A 2CHRA 2DUZA 3HQOA 2RHGA 1UR0A 3ARZA 3G22A 1E6QM 4D6IA 3QQ1A 3FYPA 1UWTA 2VFDA 1J01A 3UPWA 5CC5A 3DG6A 3L5LA 3O8AA 4YVPA 2BGNE 3CLWA 1W56A 5GNXA 4WJEA 4OFCA 3H2NA 4O28A 3ZVHA 1K1DA 3PUDA 3WJYA 3ALGA 5HWMA 2E6AA 3QZ6A 4NNCA 4W7UA 2MNRA 3N6HA 1C93A 3CT2A 1JCMP 3C86A 3FYYA 5T8GA 3DFOA 3OZOA 2A3EA 3BAWA 4UC5A 2Z6JA 3A12A 1WA3A 3L4TA 4GWEA 2E09A 4OV9A 2CEQA 1OF8A 4F3HA 1ZALA 1UP2A 1V7YA 3TJXA 3PWIA 3ID7A 2EO7A 4AXKA 2ZX8A 1KM4A 1E70M 3QY6A 5MF5A