3MC5A

Human aldose reductase mutant t113v in complex with idd393 crystallized in spacegroup p1
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
316
structure length
316
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPVGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-induced fit affects binding modes and provokes changes in crystal packing of aldose reductase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldose reductase
total genus 107
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3mc5A00
3UP8A 1LQAA 4XK2A 4L1XA 3Q67A 4ZFCA 4XO7A 5AZ0A 4WGHA 3U2CA 4H7CA 4G5DA 2BP1A 4LAZA 4MHBA 5HNUA 1JEZA 4H8NA 4XAPA 3O3RA 1QRQA 4JQAA 2PDPA 1VP5A 4IGSA 1PZ1A 1IEIA 4L1WA 2CLPA 1ADSA 2PDYA 4JTRA 3M0IA 3CV6A 1QWKA 4ICCX 3CV7A 4LBRA 3BCJA 3LN3A 5LIYX 3LEPA 2DUXA 4QX4A 2R24A 1RY0A 3UGRA 3R7MA 3COTA 4YVVA 2IKGA 3V0TA 1M9HA 1GVEA 2HE5A 1EKOA 3GHUA 1ZUAX 2PDXA 1PWLA 5LIXX 2WZMA 3GHTA 1AZ2A 3LZ5A 1S1PA 2VDGA 2PDHA 3WCZA 1LWIA 2PD9A 2J8TA 2FZ8A 1VBJA 2HE8A 1YE4A 4Q3MA 5KETA 3BURA 4JTAA 4YVXA 3BV7A 1AZ1A 1RALA 4XVDA 2PD5A 4WDUA 1Z3NA 3P2VA 4XZLX 3RX3A 4GIEA 4GQ0A 3C3UA 3BUVA 3NTYA 3G1RA 1FRBA 2P5NA 1Q5MA 5HA7A 3RX2A 3GUGA 3UFYA 2DV0A 3H7UA 4IJRA 3N2TA 5HNTA 1EXBA 2PF8A 2PDBA 4WRHA 1ZGDA 4R9OA 1YE6A 1RY8A 4JQ4A 1XF0A 1EF3A 2IKJA 3GHRA 3V0UA 3CAVA 4GACA 2IKIA 4PUWA 1XGDA 3T42A 4XO6A 1EL3A 4XZHA 3ERPA 4Q7BA 2PDMA 3LQLA 1MZRA 3F7JA 4XZIA 2FVLA 3EAUA 5LIWX 2PZNA 1Q13A 2PDWA 4JQ3A 2PDUA 2NVCA 2HVOA 2R9RA 4WDWA 4YU1A 4WEVX 2DUZA 3R6IA 1Z8AA 4JQ1A 3ONBA 3V35A 5AZ1A 4JTQA 4ASTA 3WG6A 3FJNA 2INZA 3LUTA 4FZIA 5LIKX 1HQTA 2PDJA 1UR3M 2BGSA 2FZ9A 1OG6A 4QR6A 2A79A 1R38A 2PDIA 2PDKA 4DZ5A 4JTDA 1Z9AA 2I17A 3Q65A 3UZXA 2PDCA 3MC5A 2QXWA 4LB4A 4DBUA 5DANA 4LBSA 3M4HA 3UZYA 3R94A 4PRRA 3LNMA 3EB3A 4NKCA 3WBXA 4EXAA 1X97A 2FGBA 1X96A 3M64A 3G5EA 3CAQA 1T40A 4WDTA 3R8GA 4I5XA 2PDQA 2IKHA 3V0SA 1X98A 3WBWA 4PUUA 4XVEA 2IPGA 4JQ2A 2HEJA 3MB9A 2IS7A 5JH1A 4LAUA 1US0A 4DBSA 2WZTA 1MI3A 2IPWA 3LD5A 2PFHA 4AUBA 1T41A 1MRQA 1HW6A 3H7RA 2NVDA 4FAMA 1AH3A 3DN5A 2C91A 2ACUA 3QKZA 1C9WA 1S2AA 2PEVA 3UWEA 3CASA 4GQGA 5C7HA 3LBOA 3RX4A 4FA3A 3S3GA 3CMFA 4HBKA 3UYIA 1XJBA 3UG8A 3UZWA 2PDNA 3GHSA 2ALRA 2F38A 4YS1A 3R43A 5M2FX 4HMNA 1AH0A 3V36A 4GCAA 3ONCA 4XZNX 1S2CA 2PDFA 4FALA 3D3FA 2ACQA 2INEA 2F2KA 2PDGA 3N6QA 3R58A 4PR4A 3LZ3A 2AGTA 1K8CA 3O0KA 4JIIX 3KRBA 2ACRA 3VXGA 2IQ0A 1ZSXA 4RPQA 3EB4A 1A80A 3WBYA 1S1RA 2FZDA 3R8HA 1PYFA 4EXBA 4DBWA 1AH4A 3B3DA 4JIRA 2HVNA 4YVPA 1PZ0A 3UZZA 3LQGA 4JTCA 1J96A 1IHIA 1AFSA 2IQDA 4LB3A 2BGQA 3FX4A 5JH2A 4GABA 1YNQA 2ISFA 4QBXA 3DOPA 2HV5A 1SM9A 4XZMX 1Z89A 2IPFA 4OTKA 1PWMA 1YNPA 4QXIA 2FZBA 3H4GA 4GA8A 2HDJA 4IJCA 4WDXA 2IPJA 4PMJA 4F40A 2PDLA 5LIUX 2I16A 4PRTA 4JIHA 2ACSA 3LENA 1ZQ5A
chains in the Genus database with same CATH superfamily
3UP8A 4BWLA 3LGEA 4MKNA 1X1OA 3LXCA 3GDMA 2YBTA 1H5YA 1PHWA 3N34A 3NOEA 1EQPA 9XIAA 3FNDA 3IRDA 4D1JA 1XLIA 1KBKA 1K9FA 4AZBA 1GVIA 1K8ZA 3FY1A 4WK9A 1W6TA 5HNUA 3VI2A 1B1YA 1WZLA 1QR7A 2VX4A 1LUCA 1O94A 3ZOAA 4QDWA 2Y1HA 3EA3A 1BGGA 1HG3A 4MOZA 4Q8UA 5AN7A 4UTWA 4C6EA 1J18A 3BCJA 3EMQA 4BQ4A 2DORA 4IP7A 4R7JA 1QATA 3PWIA 1RY0A 5CPMA 3AMCA 2O9OA 2ZUNA 1ZL1A 3N73A 4K8GA 1H11A 2PTYA 4W7UA 4RXFA 4HPJA 1W32A 1W56A 2QAFA 1ITUA 3ZWTA 4PE8A 1GGOA 3WNMA 1BSLA 1I45A 3CIVA 2OX1A 5FL0A 3CZ8A 1MEIA 1RVKA 2XM1A 4A05A 2LLEA 3PNUA 1VIWA 4EPEC 3U6WA 2FZMA 1LG2A 3H23A 3AIEA 3PY2A 5MF5A 4N4QA 2Y0FA 3N15A 3NGJA 2Q8LA 5I2UA 4IGHA 3TN6A 2AMGA 4REQA 4RV3A 2ZZ7A 5DMYA 4WOZA 4D71A 1I2QA 2PC8A 3FHQA 4IMCA 2P5NA 1GW1A 3CC1A 4UNKA 1CIUA 1L6YA 3T6CA 1UP0A 3M0VA 1W37A 3AUOA 1VGAA 4MDOA 3W2KA 1KCZA 3AYSA 3F4NA 1EWDA 4TVUA 3N2TA 2WHMA 4NRRA 2CXGA 3PPCA 5FAGA 4O8RA 4IMAA 1EX1A 3G1FA 2GJLA 1C9DA 1JDCA 2YBUA 3RK8A 1MXGA 3MO4A 1LBFA 2CWXA 4MFDA 3MA8A 1LUCB 1VEOA 3B8IA 3WD4A 3C2FA 4AD4A 4UC5A 4Q7BA 1K02A 4MB1A 1NOFA 4W88A 2V5BA 4L9ZA 1XH1A 1OYBA 4N7QA 3NA8A 4Z0SA 3QW3A 3WNLA 2PZNA 5G4WA 2Y8KA 3M0ZA 4K37A 1TPDA 3QR0A 4MJ4A 3GD6A 1EWEA 4JQ1A 4HB7A 4JTUA 2R14A 2YL9A 4KCVA 1PTDA 1DJWA 4IQLA 3MZNA 1SJAA 2CEQA 2JKAA 5GJNA 4Y9MA 1RVGA 4MKVA 4A8RA 3EWYA 4BCEA 3F4VA 3NM3A 2XM2A 5IOBA 2P3ZA 3H55A 4K8HA 3UG4A 1VIZA 3W2NA 1D8WA 1QW9A 1TX0A 2A3HA 3TP4A 3TLQA 3MQTA 1YPFA 5C9ZA 2RDWA 4GFIA 2WPBA 5MKGA 2GQAA 1FCQA 1E1EA 5HINA 4MY8A 4B92A 3A4JA 1Z9AA 4J27A 3Q65A 1MSSA 3G24A 2PDCA 4D6FA 2QXWA 1KV8A 1NSJA 2RHGA 1KXQA 4O17A 2R91A 3GVWA 3PZIA 2ZYFA 5C5YA 4J2PA 4S3EA 4MUPA 3PTQA 4OUIA 5I24A 1ZBKA 5AHLA 1JZ4A 2QMJA 3R11A 2YDQA 3ABOA 3GK0A 3OBAA 4A8LA 1XIBA 2GWNA 7REQA 4HNTA 1MNSA 1OIMA 3WQGA 3M44A 4AD0A 5M03A 1KM1A 4AEEA 3LV6A 3W7PA 2AL2B 3PZOA 4CN4A 1N8WA 2QV4A 3TYDA 4AWEA 2WANA 1CEOA 4LCRA 3HZ3A 2WZTA 3WD3A 3QVQA 5BRQA 5JBDA 3QSRA 3GNDA 1Z32X 4AUBA 2D22A 4A3YA 3BJTA 2CBJA 4F79A 4RZ4A 1MW0A 4AU0A 4KWOA 3NQDA 3NL3A 5CBBA 4YWSA 3H2CA 1TVPA 3E9AA 4H83A 4Y8FA 2Y70A 2H6RA 1QNRA 4DO6A 1QI4A 4QJ3B 2ZUUA 4LVFA 1W9DM 1ZCCA 3GAYA 3BLOA 3KM8A 2NZLA 3PPHA 2OXNA 1JYXA 4KEVA 4WJXA 1O68A 1RCOB 3SCQA 2OODA 3WQEA 4DHGA 3LXAA 3MDWA 1ZJBA 2I7GA 3IJ6A 1JQVA 3OW1A 3PTMA 1THFD 3WH8A 4GFSA 4HMCA 1KWGA 2WXDM 1Q6CA 3IJLA 3QFEA 2ZIDA 1KWKA 4CNOA 1SVDA 2P53A 1WP6A 1A80A 1A5KC 1KR1A 4DBWA 4C7FA 1S39A 4ZFMA 1PEZA 1F9CA 3GDLA 3L4VA 3O9NA 3SN4A 1UASA 4F8XA 1WB0A 2ESCA 3WLJA 4F4RA 1UWSA 1U30A 3NQEA 2WVVB 1BHGA 2PODA 4F0MA 2YW3A 1H1ZA 4YN5A 4XZMX 1TV7A 4OTKA 4NJJA 4Q32A 3L67A 3B0VC 5C6MA 3UR7A 5A8PA 2QEZA 1BKHA 3W1QA 1TX2A 3VA8A 1B57A 3FEQA 5LIUX 4DJED 3NZPA 1WZAA 3RFAA 2CBVA 3T4WA 4LQ1A 2A3CA 1KTNA 2A7PA 3AHZA 1OJXA 4L4MA 2IUZA 3TMLA 2CZ5A 4U2ZA 4P7RA 4WGHA 3LCLA 4OOUA 4I7UA 5DMNA 4GO9A 3BGGA 4AEOA 5HK4A 1V3KA 4TO8A 1J2WA 4HSNA 2JIWA 1A5SA 4ZQCA 1QRQA 4JQAA 4REQB 4KKXA 3ZQ9A 1VCVA 3BH4A 3SCPA 2ZXDA 2ZZ1A 3KTXA 3VDAA 3TTEA 4Z2HA 2BVDA 3ARRA 2X1TA 3M0JA 3LEPA 4QX4A 4YWIA 3WH6A 3N14A 3R7MA 1ESWA 4YVVA 4MJZA 2BS9A 2HBVA 2B7QA 4ADSA 2BXVA 1UKPA 3RMJA 4B3ZA 1IWBA 2YYTA 1J0KA 4IFKA 1JULA 4UCGA 1LBLA 3TIMA 5CGMA 2PDXA 3ZIZA 5AHFA 5CZ0A 4CQ8A 1ZNNA 4MNLA 3WJWA 1AL7A 3O07A 3P84A 3IWPA 5IBXC 2PSNA 4YVXA 1DE5A 1PIFA 1PKMA 1RALA 1Q7MA 2W6RA 1GJPA 3ITOA 4XKYA 2HXTA 2ZOXA 2GPTA 4HTYA 1XP3A 4C5ZA 1CCWB 3P2VA 4GY1A 1C8QA 3DHPA 5BMXA 5CPOA 3TN3A 1C8XA 3RX2A 2VT0A 5AYIA 5F4XA 2VZTA 1RP8A 3CZGA 3BPWA 1ZBWA 1GZGA 3IVTA 3W7LA 2FTYA 1TMQA 3TC6A 1A0DA 5DRIA 1VD6A 1H4PA 1TV3A 4K6AA 4WXZA 2SFPA 3OZMA 1DV7A 4KPLA 4LGXA 4M6VA 3BV4A 1HFBA 3SW6A 2EPLX 4Q8VA 3SCNA 1XGDA 1ZAIA 2ZFAA 2FHBA 4Z1YA 4ZEPA 3HPXA 3AXHA 1EQCA 2OWXA 1MZRA 3RXZA 1E3ZA 3O6AA 1O7AA 3EPNA 4O57A 4AB4A 3AIQA 1ZJHA 1EGVA 2F6KA 3W7KA 3H70A 4Z1CA 2D24A 1SFLA 4TU1A 3U2ZA 4W93A 3BC9A 3NQVA 1D3GA 2OSWA 2QT3A 4CLMA 1SZRA 3W81A 5B80A 1G01A 1O5KA 2BNJA 1DVJA 1H0GA 1ENUA 3CLWA 1LDCA 4H2HA 4Y9NA 4K7YA 2FDMA 5CJMA 3M0HA 4JIPA 4DJDC 3SZ8A 3KXQA 4FZIA 1TV5A 3A4WA 5CG7A 3KBMA 5AECA 4PUEA 3LRLA 3SRKA 1OCNA 1WDPA 3GXNA 3W7CA 3LYEA 5CSSA 5I5RA 4W5UA 4HHPA 1E9YB 5EMYA 3SUUA 1CTNA 4GOAA 3LPPA 4LBUA 3XINA 2QUTA 3BLLA 3WQVA 1M3UA 3QEZA 1JNDA 2ALDA 3NM1A 4KEUA 2HPIA 3SN1A 1FXPA 2JALA 1U1UA 3R8GA 4I5XA 1G6CA 3EDFA 1R85A 1W3NA 4GJIA 2IKHA 3VNYA 5B7YA 1E70M 1UUMA 3H53A 5A6JA 3ABRA 1CLKA 4MADA 3VD5A 3IARA 1GYLA 2V81A 4AYSA 3DFHA 1XIJA 2CLLA 4L61A 3GNXA 4RCXA 4HA3A 3NO5A 1T41A 3GDRA 4DXXA 2CZEA 5I7GA 2AQWA 4ERIA 3CT2A 1SW0A 2NX9A 2POZA 4Q8TA 3QKZA 1CXEA 4GQRA 1SJCA 1ADOA 4ECLA 3ARYA 3MBDA 3U48A 4QLJA 2Z7KA 2OU4A 2EG8A 3USZA 3U2OA 4XD6A 3UF9A 4GKLA 1WAUA 2XDFA 5HBFA 1J0ZA 1K9TA 1T8XA 1V0KA 3WFAA 1ML1A 5D9NA 1F76A 2BXYA 3T0CA 1EOKA 3W2LA 1IXOA 1GZJA 3BLEA 5M2FX 1R46A 5A8GA 3T8LA 2Y8VA 1P6WA 1NWUA 3F4WA 2OLHA 4N4PA 2VD9A 4L4OA 5I3FA 3TSBA 4HU8A 5AC8A 4ZQPA 4ATLA 1DJYA 1EJSC 5EMJA 3N6QA 3WLIA 7A3HA 4ZA0A 3RCYA 3W7DA 3WUFA 4HMEA 3C2RA 3UETA 3BCDA 3V18A 4H41A 3MP3A 5I3HA 3OHIA 1KFLA 5A8OA 3AOFA 2Y5EA 2FZDA 3AQUA 3QGAC 1RK6A 4YTSA 4MIMA 2CCRA 2JKEA 1XLKA 2E1DA 1EIBA 5A6AA 2ZZ3A 4LAMA 4JTCA 3O1NA 2VCCA 3V1PA 2IQTA 4IGMA 1TRDA 1KBJA 4GQBA 5H6HA 1G69A 3H4WA 3UWUA 1TQJA 1FHLA 4P8VA 3Q94A 1QDSA 2WVTA 2DY3A 4LPCA 1EO7A 4C7GA 2Y85A 4QITA 2OZ0A 4C1NA 2WO5A 3PUOA 3TJLA 3WLQA 1F6KA 3OVGA 4NRSA 4H2CA 3IUHA 4S3DA 3VNKA 1CLVA 1PPIA 3W1NA 3UXIA 2G3IA 4W8BA 4U5KA 4UQ9A 4XK2A 1V51A 3CUJA 3OHMB 3KUMA 3THAA 1ICSA 5I77A 3T7VA 5KZMA 4XD4A 4G5DA 4G56A 2WC4A 4MHBA 4LY4A 1OVDA 1OBAA 2G3MA 3UJFA 3MZ2A 3LCHA 2PWVA 1TA3B 4JKKA 2PGFA 5JMUA 4BF7A 4A2RA 3MWAA 1VJZA 4CEUC 1PZ1A 5EU9A 1EJRC 1CYGA 1C93A 3LLXA 3QJAA 3POCA 1KFJA 3QOKA 1JUKA 4YXGA 3HQ1A 1XYAA 2GZXA 3VOJA 4CQBA 3OODA 3SN0A 4WY0B 3PZMA 2UY3A 2OYKA 1OGGA 5GNZA 3PJTA 3PAJA 4Y96A 1AA1B 5BNKA 3VFLA 3AU6A 2XH0A 3PBYA 1Y5VA 3WEMA 3URAA 3A47A 3EYPA 4POCA 1HL9A 4DF2A 2FZ8A 2FDSA 3DYPA 3CGTA 1B54A 5A8NA 4LANA 3S83A 2J78A 2O56A 3WK3A 2VGIA 1HGYA 4LRSA 2QNEA 1Q6DA 3QTPA 4GYKA 3QGVA 3BLIA 3UWYA 1OCJA 2WOQA 4QEEA 5LKYA 1F61A 3GIPA 3GR8A 1YXYA 5D37A 1XFBA 4JTGA 1KTBA 3KCLA 3EX4A 1IIHA 4IIDA 1WXJA 1RQHA 4MVAA 3N2MA 2A2IA 3AYTA 1OF8A 1VBGA 2CLFA 5FA5A 1SO5A 5HNTA 4IIHA 5FIPA 1SU5A 2WSPA 3EXSA 3T2OA 1RY8A 4PMNA 4D8ZA 3CQIA 3ZJ8A 1Q6LA 3SGZA 1EF3A 3M6YA 1QBBA 4MNKA 3D6NA 4US5D 1XRSA 2NXGA 1L8NA 3LQLA 1CPUA 5E0FA 3ZZ1A 1G4SA 4C6BA 4GH3A 3NG3A 4JX6A 1DORA 4B5NA 2XSAA 4PMDA 4LNCA 4P8UA 2PDWA 3RJXA 3NDOA 3WQDA 1Q6RA 1GW9A 3PPFA 4RV8A 3HPFA 3HTWA 3E12A 5AZ1A 1GCYA 5C9WA 1XSJA 4M1BA 4P8WA 1XWYA 3HGJA 1XLHA 1DIEA 3IEBA 1GT8A 1TV4A 4O14A 2V5DA 3LUTA 2J74A 1ZU8A 3ZLGA 3CNYA 4P61A 1SQ7A 3JU2A 2HXUA 3SGUA 1TWSA 1BYDA 4B2DD 4C60A 4FSAA 3LCIA 3EXTA 1J93A 4U3AA 3NXLA 4AG0A 2BDQA 4J9JA 4KRUA 3S6DA 3RILA 3HIJA 3JZEA 3P93A 1AQMA 4F0HA 1T96A 3VGEA 3GXFA 1OX4A 1JAKA 1XH0A 2TSYA 1X97A 2FGBA 2PBOA 2J13A 4TV6A 1PUDA 3AYRA 1N7KA 1XX1A 5FEXA 5DCBA 2GGIA 2RDTA 1EBHA 3B0YA 4KEMA 3WYZA 3GU2A 3KOYA 4G7EA 4AVOA 3UGVA 4FX8A 2H3BA 4QG6A 4DYKA 4B4FA 3P67A 1T8QA 1D9EA 1US0A 2CBUA 4ZGYA 1ISYA 1GKQA 3T05A 4HJFA 3BVJA 1UQZA 3WH5A 1WDDA 1NAL1 4R9XA 1JDFA 4ZVJA 2DT1A 1QK0A 2C91A 3WD0A 1TFVA 3AXMA 2VJXA 5I0DA 3EKGA 2XGZA 3EMCA 3AO0A 3LRKA 2EQDA 1PL9A 5I3DA 2MNRA 3G1XA 2ZX7A 3CQKA 4MM1A 1T99A 4WZHA 3K4AA 3MBFA 4IIFA 1L8PA 3BAIA 3RO6A 2D20A 3UYIA 3UG8A 3UZJA 4E8DA 4H8HA 6ALDA 4FEZA 4MG4A 5H8UA 3W27A 1NDVA 1E51A 3NVTA 4YYCA 3DG3A 1Z6KA 5LHFA 4CD8A 3NL6A 2VGFA 1YBQA 4OOZA 4XWUA 1UD8A 4XZNX 2O4MA 2XIMA 4PB4A 4W7WA 2OYMA 4YHEA 2ACQA 5DCDA 3B9EA 3IK2A 4RDWA 4AX6A 2DW7A 4KIEA 3WJSA 1XLCA 2G37A 3W24A 3C6CA 3ZVHA 2UWFA 4R7WA 2QJGA 2GGHA 3O0KA 4NAEB 3B8SA 1H61A 3R10A 2E1WA 3EDEA 2ACRA 2QCDA 3G3DA 4IOTA 3W25A 4GIAA 3AIBA 1OFEA 4EXBA 3K30A 2J7DA 1AH4A 3PF3A 1REQA 3VOGA 2V8ZA 1JPIA 4R5EA 3V5FA 3GVVA 3FYOA 1S3HA 4N6FA 1UWUA 1E1CB 1IHIA 2P8BA 1KKRA 3CH0A 1YW1A 4C6NA 4GY7A 1U22A 3MKCA 2UBPC 1EGMA 4HA4A 4MNMA 3TTYA 2ISFA 3VTRA 2OQHA 5LNSA 4DJEC 3EOSA 2IPFA 3BWWA 4JY9A 4NJIA 1DTUA 4CNUA 4IJCA 1MNZA 3W9ZA 1G67A 3B40A 1I1XA 3ZT6A 1O95A 1HKKA 4DM1A 1NF0A 1Q8JA 5E70A 5T26A 1SJBA 4FP1A 3L9CA 1XCFA 3NVDA 1LQ0A 5AZ0A 1V6YA 3N04A 2YCLB 3IGHX 4H7CA 1R3VA 2QHAA 2XUCA 2YR1A 3KL0A 2VDIA 3TMQA 4H01A 4MY1A 1VLIA 1ZP4A 5EYWA 4E8CA 3L4UA 1B3XA 1FWBC 3AHVA 1Q66A 1JUEA 2FIQA 3EPOA 1JZ6A 3RGTA 7ODCA 3BE7A 4KERA 2NVAA 3B9OA 3ECQA 4M56A 1FY6A 1X8FA 3INPA 3CV7A 1S38A 3BJFA 2QF7A 1TREA 3N6HA 1P0BA 1A53A 5HR7A 5HMEA 3WLHA 5DXYA 3ANUA 3COTA 3VGFA 1G7VA 5C0QA 4C6IA 3MHFA 4E2OA 4ZCWA 4GI6A 4DWSD 3OZOA 4ZMGA 4NJGA 3VD9A 1E6XM 3DBNA 3LZ5A 3P0WA 1FWRA 4O1DA 3ITYA 3ZLHA 3K5XA 2QPUA 4JTAA 1PZ3A 5IFPA 3K1GA 3ZVIA 1U83A 1EOMA 4URIA 2F6UA 2EG7A 1AZ1A 2I9EA 3P82A 4LEQA 4G6CA 4RPPA 2XH7A 3SB0A 2VKZG 1GTEA 3AMGA 2WMJA 1HJVA 3PP7A 4Q7IA 1DXFA 4XZLX 3GBDA 4GQ0A 4TTGA 4DUOA 3BUVA 4ZOAA 4GH1A 5D04C 4XZWA 4XKMA 4DI9A 2D69A 3CV1A 4ILSA 4QS6A 3A3XA 2PCQA 3W76A 3W28A 2C19A 2J7EA 3NQ7A 4JOMA 1VYPX 5DXXA 4EOUA 3W83A 1QPNA 3G2GA 1A5MC 2MUCA 1QAPA 1UUQA 2Z26A 3CUIA 2VUYA 3KW3A 5D30A 1N8FA 2V6AA 4B90A 3PBMA 2ZRXA 3T81A 1IR2A 1SZGA 1V6VA 3FXYA 3DU0A 5E93A 4Q33A 2WZIA 1KM5A 4O53A 3BSHA 3SDOA 2VEIA 3RCNA 2IXUA 2Y7EA 1DBTA 3F7JA 2AMXA 3B04A 3UWWA 2X1SA 3QZAA 5LIWX 1W1ZA 2WLYA 1UHVA 2HK1A 3C8FA 4GXWA 3M0KA 1UD2A 4PBFA 4YU1A 3VUPA 3R6IA 3NDYA 3ITGA 1XBVA 3QY6A 3CTTA 4QJ4B 1TTQA 1W5NA 4WKFA 4L80A 2BVWA 1FWWA 1NJJA 3L2MA 1SSGA 1XIDA 3IJIA 4QS5A 1X7FA 3M5XA 3WG6A 1PTAA 3KAOA 4EF9A 4HU4A 1QPQA 1K8YA 3UXKA 4B5SA 3I4KA 3MMUA 1E6PA 1EC9A 3GVRA 3KX6A 4EWND 3RAOA 2FZ9A 3TYUA 4JTDA 2INFA 4S3KA 4B5VA 3UCQA 3SUTA 1K03A 3H2NA 3K13A 1P0EA 3CMJA 2A3LA 3M5VA 4MDPA 4GYFA 1J0IA 3VCNA 3WLPA 3WBEA 3FVDA 4GVHA 2WPGA 2QZRA 4NU7A 1GQJA 1T40A 4K36A 2QW5A 1V8EA 1KFCA 4ZODA 1EJTC 1XLDA 1XUUA 1TTIA 3IVUA 3HB9A 4AISA 3E5PA 5K2ZA 1U5HA 1Q6EA 2D0GA 2QPXA 5CLTA 3VKBA 2HEJA 1RZMA 5CJNA 2GLKA 4AQLA 2ON3A 3NEVA 3S2MA 4WUIA 4LUTB 3UT0A 2EGZA 5M3WA 2J7CA 2BWGA 3FJLA 4DM2A 4V15A 2IPWA 1EP2A 2E25A 5DBUA 4Z42C 3C4UA 3OLEA 2PU0A 3GIYA 4IIBA 4W5ZA 2ZX9A 5F1VA 1UA3A 1O6IA 3P74A 2VEFA 1AH3A 1RUSA 3IJ7A 3ARPA 2ZE0A 3TYZA 2QUVA 2RFGA 3MMWA 3DH7A 3H54A 1RD5A 4JTFA 2YCJA 2D2OA 1ITXA 4HCDA 4B3KA 5BWAA 4DO5A 1PYMA 3O05A 3CMFA 5C2CA 1VFHA 3L2LA 3LHUA 4GXMA 4NT0A 1EYWA 3S1VA 1BYCA 1Q6GA 2PRHA 1FX6A 2X2GA 1YDYA 3NGFA 4TUFA 3GU1A 4DN1A 2ZDSA 5FEZA 1A5NC 2OEKA 3WK0A 2RJHA 3OVRA 5FJRA 5C2XA 3VKDA 4UB9A 4IXXA 1R3TA 3UXDA 4JTTA 4HMNA 4U31A 3V36A 1DXIA 1M7JA 4Z1AA 1LT7A 2PURA 4H7VA 2J7BA 1E6ZA 1YMYA 3TN4A 2P0IA 3W7HA 4TTUA 3NURA 3TN5A 3SFKA 1JZ7A 4GUJA 1E0WA 3SUVA 1QPOA 4UBPC 3CH9A 4PMVA 3MSRA 5REQA 3OG3A 4UFIA 1OCBA 4Z0JA 2X42A 3QR3A 3LSCA 1AMKA 2HBXA 1W31A 4XB3A 3LCGA 4LX4A 4V1XA 3KHDA 2QCNA 4GNKB 1CGVA 4QE5A 1I4NA 1H63A 4A3RA 2D0HA 1ZS2A 2BGQA 1UD6A 3FX4A 1X6UA 3DFNA 1EEPA 5C9RA 5D02A 3URNA 3W26A 1KXVA 3REQA 1PWMA 1LTDA 2BMBA 2PUZA 3OLGA 1A5LC 2QR6A 3HQNA 1VCFA 3QQ1A 4ICNA 1KD0A 3KBVA 3EDJA 2O9TA 4UTHA 5T91A 3MKKA 3TXVA 4NI3A 1FDJA 4IMGA 2Y63A 2DEPA 2EO7A 1W54A 4DY1A 3W84A 2VC5A 4V28A 3PS7A 2V82A 4GI9A 3OEXA 4CNNA 4UNIA 3CPUA 5FF2A 2BP1A 4ALDA 3ZJ7A 4CU8A 4HNNA 1B4KA 4O50A 3WLLA 5L6UA 4ZTYA 3OJGA 3O3RA 3P6LA 2PDPA 1S2TA 1H5VA 1VFUA 1IEIA 3W7GA 4O1EA 4JXCA 4HOZA 4Q8PA 1HO1A 3FGCA 1V4YA 4KQNA 5AYXA 4XBJA 2V0TA 3K4WA 2ZX6A 2E5BA 1WBJA 4GG9A 4QEHA 3DEQA 1WCGA 4D8LA 4PC8A 2J47A 2W63A 1IT0A 2Y8UA 3VZXA 1OZQA 3PB0A 2QVNA 3WLSA 4FX6M 3CBWA 3F2DA 3V75A 4WQ6A 1XGZA 7TIMA 3GS6A 2O0TA 1EHNA 4AIBA 4XAYA 3G3MA 2OKTA 5CC3A 1H7PA 1KXTA 1W3HA 3AS1A 4LEFA 2V38A 4C6MA 2WLZA 3HPSA 3R4IA 4PMOA 4JNZA 1FWCC 2GSHA 3UR8A 1Q4WA 2I1OA 2GK1A 3WDJA 2JF6A 2HS6A 3B8UA 3BAWA 4UZSA 3IJDA 4YMZA 1JFXA 3SQLA 1FHVA 3U0HA 2WC7A 1P6CA 1TWDA 1E43A 4JTEA 2X05A 1O5RA 1BSIA 1OHLA 4ZQRA 4R53A 3WF1A 3AS3A 3KLKA 1W8GA 3ZMRA 3NJ3A 4GJJA 5HULA 2QKFA 4JKMA 3PZGA 2YXOA 3R12A 1FP9A 2HS8A 3N4AA 5I79A 4J3TA 3RM9A 1GJWA 4YIWA 3MSYA 3EWZA 4EXQA 3QPZA 1OD8A 3S2CA 4YTTA 4PCPA 3M9YA 3LS9A 3FA5A 2G95A 2VX7A 3VM7A 1YDNA 3HV8A 3HV9A 1I9CB 4HK7A 3WJYA 1TB3A 1EXPA 3PTDA 4WGXA 5DT7A 3EA2A 4LWWA 3IIVA 2E8YA 3NQFA 4N2YA 2D3NA 4ZOEA 3N4FA 5K9XA 1HJUA 3T40A 1FWAC 4NZ5A 4H9VA 1F8IA 2BV9A 2GGJA 4OUEA 1IQ8A 4M82A 2WMIB 3TJXA 2QS8A 4PMRA 1BFNA 1WBHA 3QY8A 1N55A 2DIJA 3FJNA 4JPGA 3KTSA 1LL4A 3VE9A 3DESA 1VHNA 4J40A 4Z2GA 1EPXA 1AMYA 1UJPA 1UC5A 4LS0A 3P5ZA 4ZR8A 3WDQA 4DZ5A 4S3AA 2OWWA 2Z25A 1I75A 1KLZA 4J35A 2WMGA 3HJZA 4ACZB 1X1ZA 3RN6A 2FFCA 1GG0A 4YTUA 4N0RA 3WKZA 2GDVA 1Q2SA 2X8RA 3GAKA 4AF0A 4KWSA 3SO7A 5CPNA 4AY7A 5A6TC 4MZ8A 4O12A 4BZYA 1E6QM 3HPAA 5HXMA 3P8JA 4J3WA 1J10A 2DGAA 3ORWA 3O7UA 3ITTA 4JTKA 1LM1A 1TPEA 1JPKA 1IGSA 4HU0A 2XHYA 3NDZA 1TTPA 2YCLA 3E38A 1Y8BA 3E0IA 3FCPA 4CQDA 3U5UA 3KS5A 4WJ8A 4PTMA 1KM4A 5CPQA 3GFZA 4RR4A 2VEPA 3W1MA 4AHOA 3TXZA 4UMAA 4TIMA 1YQ2A 5GNYA 4GE8A 3A21A 1NDWA 1GUVA 3DECA 3VYLA 4Q4KA 1DWIM 3PR2A 3NNTA 1JL8A 3LLFA 2HCVA 1ISVA 3STFA 2GQ3A 4WKHA 4PCSA 3WUEA 1LRQA 2XN1A 4A2SA 2H8ZA 2TYSA 3K2GA 4GQQA 3PVFA 2C1IA 2WM1A 1WKDA 2J24A 5CJ5A 2QJMA 4ML9A 2HRWA 2VO5A 3R43A 1JDAA 4NJKA 5ABEA 1E56A 1S2CA 2PDFA 3L4XA 1L6WA 3LG3A 1V3JA 2W9MA 2OX4A 4HNLA 3NOYA 3WUBA 5LNRA 1Y5XA 1GHRA 3W71A 2NT0A 2PF0A 1K8CA 1MEWA 5BOEA 3KRBA 4HKPA 2G50A 1C90A 5CZTA 2ZRUA 2PTWA 1HJSA 1ZRQA 4JAWA 3H2OA 1WA3A 1W9VA 4QHRA 3VIIA 2WCSA 1E9ZB 2QCMA 3B3DA 2H3DA 3I68A 4U2YA 2V5JA 3AHYA 1V5XA 4KGLA 1HL8A 3ITCA 5A6LA 4GABA 4PTXA 3W7JA 4LUSB 3E0WA 1OQFA 3E96A 1HF6A 3DOPA 4W87A 2YLAA 3QPEA 5FOOA 3BAYA 2XIIA 3W1XA 1XR2A 2AQVA 3LSBA 1ICQA 1LORA 2HDJA 3TYEA 4C6DA 4DLMA 3NPXA 1X8CA 4A29A 1F73A 3OVPA 1MFVA 2NQJA 3PZTA 1ZQ5A 1H7XA 3CUGA 1D3CA 4DJDA 1JCTA 3UW6A 2PI6A 4HZ8A 2OT0A 3U2CA 3H2MA 1EC8A 4M6PA 2O92A 1R3SA 2OGYA 4PEKA 3VINA 1UR1A 5H8MA 1MW3A 5HATA 1KQZA 1BRLB 4L5ZA 3LHTA 3UY8A 1VYRA 4UZUA 4YTRA 1UKTA 1MW2A 3OG2A 1OB0A 3HG4A 2VFIA 1UKSA 4UQBA 1T7LA 4GD0A 3BICA 4DWSC 3H2AA 3GBEA 4LSBA 3ZO9A 3CEUA 5CGTA 1E9LA 3KVMA 4C6JA 1FUYA 3ARTA 2O7QA 4S3CA 1BF6A 4HHMA 3ZR6A 2ZTKA 4Q4QA 2CESA 5HJYA 5HUPA 3HOJA 3PHAA 3NPWA 4EAMA 3DG6A 2HWGA 3KDNA 2OO0A 5DELA 1K3UA 3W6LA 3WCZA 3E0FA 5AOUA 3TA9A 3C0LA 4IICA 3V1HA 3GY1A 4QE4A 3AXKA 1RBAA 4DRSA 3ZFHA 1W9XA 1WDQA 1BKSA 3AIWA 4ADTA 2FHFA 1J4EA 1XLFA 1SYTA 4X0VA 4B5XA 4CU6A 3W74A 1UMLA 1ZTVA 4I6VA 1JYVA 2JGYA 3GNPA 1CT5A 3FAXA 2QJHA 3GZ3A 4QE1A 3UXLA 4JBRA 2PWGA 4KIRA 1LQ2A 2J7HA 3IAPA 1ME8A 4JQ4A 4YHGA 4GUHA 4MB3A 1MRAA 1IZJA 3CZEA 2VDHA 3M5ZA 4UTKA 3EX2A 2ZDRA 4JCLA 5D2XA 2L5HA 1QOXA 1M65A 3N6JA 4GY0A 4I7VA 5E0KA 4XZIA 3WQFA 1XV8A 3JR2A 4JDBA 4MUZA 1IGWA 1Q13A 2PDUA 3PZVA 2HVOA 2F7FA 3M41A 2BBFA 1UR4A 2BY0A 3A9BA 3AZTA 1UD3A 4MMWA 3H7VA 3RHGA 3VNZA 3WNPA 2EAWA 1UA7A 3AMLA 4HA1A 2FHCA 3TJ4A 4LF2A 4V1YA 4RZ5A 3HF3A 4C7DA 1D8CA 3U5YA 3EX6A 5JIWA 2PA6A 2XSXA 2QDEA 2V63A 2AL2A 4PULA 1R6WA 3VKCA 3WY1A 3N9SA 1MXDA 3VPLA 2ZRZA 3AXIA 4AW7A 5GJPA 5AHMA 1W5PA 4MNJA 2DQXA 2PDIA 5BXRA 1S5NA 2PDKA 3FYPA 4PTVA 2GOUA 1IEXA 1ISXA 2VZUA 3Q58A 1ITQA 3C52A 3SFWA 1YKWA 2YW4A 3CYVA 1A5AA 2HZGA 3E49A 4O54A 3CAQA 3AC0A 4S3GA 1OWQA 3RIKA 1EZ2A 5CZSA 1MUWA 3IGUA 1I8JA 5D33A 5FJUA 2BZNA 4DJEA 4MGGA 1W8SA 1O4UA 1XHGA 2IPGA 4JQ2A 3TNBA 3UR2A 4DJFA 4P2VA 5D2YA 4K3ZA 4GI8A 1F7BA 1M53A 2C16A 1IWAA 4DBSA 2QCGA 4C90A 2PLKA 2BLEA 5EMKA 4Q8NA 1F07A 2ZUVA 3H7RA 4PUNA 4LNYA 3DCPA 4YJ5A 3U57A 3N2CA 4ROPA 1PX4A 2JBMA 1NFBA 2AAMA 4I9MA 4JTHA 3WDIA 3WK2A 3CAWA 4ZB0A 2QMKA 2R1KA 1J12A 2HVMA 2A3BA 3WQ6A 1YYAA 3W85A 4RE3A 1LL6A 3C56A 3CYJA 3E2SA 3GNOA 4HPGA 4ZBCA 3APGA 5CAKA 4UQCA 1XQKA 1VCGA 2Z1XA 3I7RA 1U5JA 3FLUA 1C29A 1QFEA 1KFEA 3SCWA 2X09A 1UWTA 1QI5A 3TROA 3BDKA 4OIFA 4M81A 4KH2A 4GCAA 3NIYA 4BFAA 4L65A 5ABHA 4CNTA 3MW7A 4AD5A 4PFHA 3C0SA 1B3OA 3CO4A 2INEA 2GVLA 3PN8A 2XVPA 4GVFA 4RX0A 3TV8A 5DCEA 2AGTA 3WF4A 3H8AA 1NF7A 3MU7A 4N9DA 2BGNE 2VR2A 2FPYA 1VAHA 3R8HA 2FB3A 4LT9A 1W3IA 3PULA 3I4EA 3S5ZA 2X1RA 4QDMA 4GXPA 2PTXA 4FPSA 1A47A 2IQDA 1HJXA 3FSUA 4NILA 1VFFA 5DX7A 2CLIA 3IUIA 1R86A 4Q8OA 3R25A 1QNOA 3LXBA 3MUXA 1P5BA 3SADA 4IZGA 1F3WA 2NWRA 4LC6A 3WMBA 4D6GA 4GA8A 4LYQA 5G5IA 5KZDA 2VI0A 2BOFX 1BG4A 2XFYA 2IXVA 4X63A 1MO0A 2J62A 4PRTA 4S3BA 2Y7FA 2HJPA 1OC7A 3IGXA 2GQ8A 1TZZA 4ZL1A 2D3LA 1EZWA 2QGHA 2E09A 3CHVA 4PCNA 3W38A 3T0TA 3O16A 3FGCB 2J7GA 1C8YA 2AKMA 4JCMA 3HPZA 4Y2WA 2GJXA 3G22A 3F2CA 2PLCA 3ME3A 3LLDA 1CGUA 2REQA 2EBNA 4L1WA 1PCWA 1I2RA 3L21A 3CV6A 1AQ0A 3ELFA 4DYEA 3G6LA 1Z42A 1KGWA 2QIIA 1MFUA 2CZVA 4LS2A 1HNYA 4UTIA 4I8DA 1US3A 3VUSA 1OFOA 1F4HA 3TQ0A 4EK7A 1J01A 1E6RA 2FB2A 4NIRA 5H2ZA 2HE5A 3HU7A 3GTHA 1P48A 5LIXX 2YFOA 4NYUA 3GG7A 4AHQA 3O63A 1P4CA 2J8FA 2OMAA 2YX0A 2VX5A 1AW5A 1XSKA 5KETA 3MTWA 3BL3A 5I3KA 3APYA 3HO8A 3BV7A 3P8IA 3MMDA 3UEQA 3W7RA 4BQ5A 4DO7A 4GVIA 4JX5A 1OFDA 1ZLPA 4HA0A 3P5YA 4M5PA 2WNZA 2PD5A 5EMMA 3QV9A 1QMLA 3N2XA 2C71A 1IZCA 8CGTA 5CLWA 3T9PA 3Q45A 2C18A 3WH7A 4FNQA 2WNWA 1NY1A 2Y7DA 2CPUA 2WJFA 3JRKA 3XIMA 5D2TA 4IJRA 3W1PA 3TYBA 4R9OA 2C7FA 4NP7A 2PTZA 1TPC1 1WOBA 3PBUA 5K7JA 3RF9A 4DLFA 3B0XA 1RXOB 2XN0A 2WSKA 2FLIA 3CPGA 4JKLA 3MCMA 3W86A 5HOSA 4M1RA 4DBEA 2GDUA 3CUFA 4LJ3A 4MB5A 3PSVA 4UTWC 1LYXA 1W1YA 3V5OA 4QIUA 2OOGA 2BX7A 4IM4A 4UQDA 2R9RA 3MYOA 2PU1A 1QHOA 3DYOA 4H4IA 4FHAA 4MJMA 4Y90A 4PB5A 4S2CA 3PBWA 4K1GA 3U4FA 4JTQA 1J0YA 1Q2RA 4PA8A 5F2LA 4GC4A 4GCXA 4Q8WA 4DZAA 2WMHA 4O11A 1V0LA 3FOKA 4DUVA 2WJDA 4LAOA 2A7RA 2INZA 3IIZA 4PL1A 5FJTA 1UR3M 3QC3A 4WCJA 3MJYA 4AXKA 5DF0A 1JRCA 3PWAA 3AU2A 1JVNA 2CIPA 2C1HA 4HNOA 4LUJA 2Z2BA 3M07A 3STPA 2GGGA 1TPB1 3L12A 4ZSTA 2QV5A 4PCFA 1G4TA 1CGXA 1YBQB 2DW6A 2G3JA 3GXDA 4PRWA 1TRIA 3MDUA 1XSIA 4MAZA 4GX8A 4F2UA 3GVQA 4JFVA 1H50A 5HNRA 1RA0A 1RCQA 2EKGA 3PSWA 4HP5A 4I9TA 3VD4A 4LUTA 3SQSA 2R8WA 4X22A 4H7ZA 1EHAA 2XIOA 2E9LA 4J4KA 4CD6A 2HSAA 2OFJA 5HQMA 2WJEA 4E4UA 2YPIA 4US6A 2XH4A 4UTUA 2TODA 3PZNA 1BTMA 1W9BM 3WNNA 3P61A 5E6ZA 1XI3A 1TMHA 1JF5A 1XUZA 3WNOA 3N1AA 1W5QA 2NVDA 2OSXA 2Y4SA 4AY1A 3P14A 4HCLA 2A0NA 3GYCA 3LHZA 3IIPA 1KBLA 5JXQA 1R2SA 4O0ZA 3GFXA 4D9PA 2EPHA 3K4DA 3MJMA 6A3HA 4IPLA 3MV01 1XJBA 3BXWA 3GHSA 4FIRA 4MY9A 1EEXA 3R79A 3URBA 7XIMA 1OSEA 1B2YA 3A24A 3WF2A 4XAFA 1I0BA 3ES7A 2Y88A 4YS1A 1GOWA 1AH0A 3VK5A 3W87A 1W2VA 1XYBA 4MWAC 1P0KA 3PC0A 1TYGA 1XYLA 3M5YA 3LPOA 3HQOA 1CXKA 1FWDC 1R8LA 3FA4A 1I2PA 1XYFA 4IMFA 5JQ9A 1E73M 2Q71A 2ZC1A 2JEPA 3SSJA 3LCFA 2VD8A 4GUFA 4RPQA 2CZFA 1U1JA 4NQ1A 3FEMA 2B81A 1Y7VA 4R85A 4O1CA 3G1HA 4D6DA 4JIRA 2GJXB 2CITA 3UZZA 1LJYA 2WK2A 3L4WA 1TV8A 2X40A 3AUJA 3ZJ6A 4ZB2A 1RQBA 3VAVA 1TJ0A 1D7KA 1E5NA 2E6YA 3PJWA 4GGBA 5G2HA 1OC5A 4HPNA 3VOCA 2W79A 2ZXAA 4NNCA 4NAFB 5D32A 5TBOA 5BMWA 1XLMA 1QWGA 2W5FA 2VL4A 3W7IA 1K9DA 4BI5A 4US5A 2B7NA 4LV9A 2FZBA 1TSIA 2CLHA 3NQ2A 1LOSA 1HVQA 3NAVA 4OECA 3AHXA 5I3GA 1AVAA 5FF3A 4Z2IA 1L9WA 3HBLA 3S5YA 1JJKA 1UR0A 3QXBA 1QNPA 5F1UA 4F2BA 1JGIA 5TF0A 1IIGA 4ZOCA 1R3WA 4Q22A 4DEFA 2YZRA 2P76A 6TIMA 3KRZA 3AROA 3WDHA 1FKWA 1QVBA 3G1SA 2VFGA 2XZ9A 3QFWA 4B9YA 1GVFA 2VCAA 4QISA 2W62A 4H8NA 3USBA 1T0OA 4AVNA 4ZE4A 3HGRA 1H1NA 3KCJA 3HFYA 4IGSA 3TC3A 5HAOA 2FYMA 4LVDA 4FO4A 2PDYA 2XZ7A 3ICJA 1RH9A 2DFAA 3VGBA 5KSWA 2CXEA 5AVNA 3E2RA 4ICCX 1JI1A 1PIIA 2WSRA 2XN2A 1J8VA 4RJEA 4B2DA 2X2YA 2W92A 4GNVA 2CLOA 4WY0F 2PBGA 3B0PA 3AYVA 3GTFA 3H6OA 3QH2A 2KAUC 5A5WA 1HO4A 4D6EA 2D73A 4B91A 4P7QA 1S1PA 1DWAM 1LWIA 4WOQA 3V7PA 1HVXA 3TWAA 1UD4A 4IX2A 3BG5A 4TX9A 2V5LA 4WR3A 3DAQA 4E6MA 5DY3A 3I3DA 1HX0A 4PN2A 4LYKA 5EB8A 4DX3A 1BLIA 3URQA 1T5AA 3LCWA 1JR1A 1M04A 1M1BA 4A8NA 3STGA 2V30A 1OEPA 1AODA 1XW8A 1A50A 2OTDA 5ECUA 4PTNA 2WW5A 2F2HA 1JCMP 1FA2A 1EX5A 1ONEA 4AFYA 5KINA 3MP4A 5DT5A 1XLGA 1XYMA 3SY1A 1EGZA 3N13A 4UFMA 2BASA 2FPVA 4P5UA 2XSBA 1KC7A 4DZHA 1Q85A 2VGGA 1UB3A 1ICPA 3EOEA 2VZSA 2GVYA 3KRSA 1XXXA 3EBVA 3DFQA 1EL3A 5AYZA 1REQB 2P3EA 3L5LA 2XVKA 1QT1A 3V5CA 4IH3A 1NTHA 5REQB 1RP9A 3GKFA 1QTWA 1M7PA 3N12A 1E55A 2XIJA 3VIOA 2H8XA 2QYGA 3M7WA 3TTOA 3BGAA 7PTDA 5FEPA 2NXIA 4WDWA 5K4XA 1HXJA 4PSPA 3AICA 3EKZA 2CBIA 3QF0A 4M80A 1UOZA 4NNAA 4XAGA 3BARA 2R94A 4KFNA 4JNYA 3BW3A 1JYNA 4JFSA 3W2MA 3VOHA 1QXLA 3NYDA 3NZRA 5AHNA 1MUMA 5I78A 2O4QA 2YFNA 4R34A 4UFJA 3ITXA 4EX4A 1RLCL 4LCQA 4S3JA 3W1UA 4D1IA 4BEQA 1OD0A 1A0CA 3ENLA 4BI6A 4JFTA 4H6RA 4RNJA 3WLMA 4O4WA 1RSCA 3WQWA 4J3ZA 1TE6A 9CGTA 3TE9A 3I7SA 2YJQA 3GQYA 1QNQA 1PO9A 3W1RA 1VFMA 4JZ5A 5EFDA 2WC3A 2AKZA 1R30A 3WBXA 1KM6A 5HQEA 3G5EA 1Z69A 1V93A 4OBRA 3OVQA 5I03A 3W1TA 4I7WA 3WF0A 2E6FA 5LA1A 2EPNA 3E5BA 2ZZ6A 4XVEA 4G1KA 2CWNA 2REQB 4BR1A 3XISA 4PMQA 4D6HA 4DAIA 1CW2A 3CIWA 3Q37A 2EF9A 5EA9A 1DKWA 1CDGA 4LAUA 2Q8XA 2GL5A 4NZ1A 4NY2A 1Y65A 3OLIA 3T2PA 1JYWA 1VC4A 2ZX8A 3LD5A 1XLJA 3LU2A 3TKFA 2POTA 3QMTA 2YGYA 2YXGA 2V3EA 5FF7A 1EJVC 3G0XA 5KMYA 5XINA 2FJUB 1GWJA 2WHLA 4FAMA 2XINA 3L7RA 3K1DA 1OFRA 4LF1A 4C1LA 3P3BA 3DFPA 3QV6A 5FSDC 4MWAB 1XIGA 4L6OA 4D2JA 3G1YA 5A6BD 5GPRA 3SI9A 1CGTA 1HKJA 2G8ZA 2FKPA 2ZICA 2WBKA 3RO8A 3W70A 3UZWA 4DWDA 1VFLA 4V27A 1H0IA 3FJ6A 2C13A 4UCFA 5AYBA 2FPTA 1XC4A 1TR1A 1OT1A 2OZTA 1QCWA 3LA4A 3CTLA 1XG3A 4J2MA 4RW5A 3NQ8A 4QFUA 1OF6A 3MUY1 3N3TA 4LVBA 4YCPA 4NHVA 2W27A 3TW6A 1ZALA 4JX4A 3KBNA 3UBPC 1K8XA 1WQ5A 3THUA 2XGBA 2Z1VA 5J8LA 2MANA 2WHKA 3CL8A 6XIAA 1BVNP 5D8WA 1A3HA 1UP2A 3DFYA 4Z1BA 1RLDA 4TX8A 2AQOA 1V6TA 2PWHA 4JD4A 1W1TA 1XYCA 5F2GA 3ZS4A 5T8GA 2NWSA 1H60A 3NPVA 1PVNA 4ONVA 1F3EA 3UZ5A 1JXJA 1DJXA 4LC8A 3TCSA 4Q8QA 1TUFA 2VR5A 2BY1A 2RDUA 3VX1A 3F5KA 1I60A 2Y7GA 1YPXA 3RNDA 1BQGA 4O10A 1KM2A 4QXIA 1D7FA 3QHMA 2GWGA 4J28A 2WKLA 4EPDC 4RE2A 3ABSA 4C1KA 3GDBA 3LENA 2X41A 3W7NA 1XCWA 3WL1A 5DBTA 5LNVA 4JYEA 5LA2A 1IXNA 1ZAHA 4E5TA 1V03A 3BCFA 1LQAA 4KETA 3K8KA 3SY8A 3GIQA 5IXEA 1EBGA 1TZ7A 3E0LA 2VELA 2QCDB 4N42A 4X0NA 4XD5A 5E9XA 3S1XA 5D2WA 1QJWA 2BODX 1NU5A 1J5TA 4NAEA 2OO6A 5FI8A 1CXHA 1TCMA 3EWDA 4L64A 3ZT5A 1TPH1 1K7EA 1VBHA 3FN9A 3HMJG 1B5TA 1VP5A 1CLXA 3E6EA 1KCLA 3RPTA 1QO5A 2CLPA 1HKWA 3RR4A 2GJNA 2RGMA 5HWNA 5GVJA 3GC4A 2R24A 1DJQA 2PRMA 1QHZA 1M01A 2VYOA 4GIYA 2PWDA 4LFYA 4FNTA 4HZMA 4JDYA 3IJ8A 4H1ZA 2B4GA 1FCBA 2I5IA 3EA1A 1PWLA 2TRSA 3B0UX 1W91A 2WVUA 5BXTA 3AIRA 5TAOA 2GJPA 3A9IA 3SR7A 2D1ZA 3MVIA 1VBJA 2OT1A 4TQTA 1MZHA 2G97A 3BANA 2RDXA 1M68A 1BYAA 3PUGA 2VURA 2WQDA 4FXSA 2YKKA 2WWDA 4GIEA 1EP3A 1R7OA 2WMIA 4L7ZA 4TMCA 2DVUA 3GH5A 2XFWA 4AWUA 3A22A 5BZAA 1UBPC 1TIMA 1W3TA 3GUGA 3UFYA 4IWWA 4K7VA 2X1UA 1WNOA 1OFPA 1XIFA 1AQFA 2CC0A 2PRLA 3NSXA 4TXEA 2J6XA 3NO1A 1U1HA 3W7MA 1RJPA 1W1A1 5CKSA 1NEYA 4Y9AA 5H91A 2VWSA 2VFDA 5U7SA 4LH8A 2OYLA 5BYWA 3WJXA 3WIJA 3S6OA 5C9XA 4EP8C 4KRZA 1CGYA 1VENA 4M6UA 1MEHA 4MWAE 3LRMA 5FJJA 4IIEA 4GMEA 1WUFA 2VRQA 5A95A 1PB0A 3WLTA 1EJWC 4OHQA 4AXNA 4F2TA 2W0UA 3BLPX 4HYVA 3EWBX 3N9RA 4F0LA 1VH7A 3F4CA 2OQYA 3EDKA 3S47A 2B31A 1SMAA 3EX3A 1ODZA 2W3ZA 2P8CA 4KRTA 1ZBVA 4YCOA 3UWVA 3BOXA 4O15A 1B3VA 4O18A 2NQ5A 3A5VA 3UG3A 2WCAA 3ARZA 2DZTA 4BS0A 3TTSA 5BW6A 2XPKA 1LZOA 1CGWA 2PDJA 3WFZA 1DHPA 3LTYA 4DNHA 2E6DA 4ATDA 4AZCA 2PLJA 1R38A 3OQ8A 1HUVA 1UH4A 4QCEA 3U7VA 4QNEA 3PANA 3H2FA 1RA5A 1ZBCA 5LZLA 1IT8A 2GQ9A 1JUBA 1MDLA 1Z41A 2F8QA 2Z1SA 4ZQNA 3IRSA 1OC6A 1V08A 3ZSTA 4GO8A 1PXGA 2X0SA 1YXDA 1J5SA 3MUCA 5K3VA 1DIDA 3WSUA 1E3XA 1PAMA 4LOCA 3T09A 3G77A 4H3DA 3F2BA 1EA9C 3GG0A 3EWUA 1PV8A 3M6DA 3UXAA 1KRMA 5C2GA 4F0RA 2DP3A 1K9EA 1E71M 1GQNA 4MLRA 3CV2A 1W1B1 3ANVA 3HA1A 3KWXA 1MQPA 2X16A 1MI3A 3KLLA 3U8GA 1WOAA 1KRCC 4AZ6A 3G8RA 3CM4A 5AKQA 5F2MA 4XBKA 2J6VA 3OZPA 1RJRA 1XGEA 1UCWA 4MZ1A 5C9UA 9RUBA 3BLFA 3CQHA 3EDDA 3HN3A 3QGKC 3RU6A 1HTIA 3ARSA 1Q6FA 4JHZA 4C6LA 3KBJA 1HIZA 3R0DA 4B5TA 5BROA 2VFHA 3LM7A 4MPKA 3AI0A 3GRIA 5IHSA 1JCXA 1QASA 1CXLA 3R13A 2ALRA 2G96A 3DBPA 3OIHA 2OCZA 3QLLA 1SR0A 4PUMA 3EOUA 3DYMA 1Y0EA 1POJA 3JW7A 2GFTA 3W1AA 4GUGA 2ZRVA 1TPVA 4M3PA 4MPQA 3DERA 3HG5A 4N9EA 3D3FA 6XIMA 2GVGA 1B9BA 2E6AA 3N25A 4PR4A 3UPBA 3LZ3A 1R3QA 4CQ9A 4E4PA 2Q3OA 1NARA 5JIPA 1S2VA 4CUCA 4JN6A 2Z1KA 2ZZ5A 3BAXA 3EMZA 1PYFA 5EBAA 4DPPA 1VEPA 1K6WA 1PKLA 2CHNA 3FS2A 3FYYA 4KF1A 1EJUC 4LB3A 4YPJA 1OY0A 3MCOA 4XUGA 4AWSA 3GE7A 3V3WA 1U33A 4QP0A 3W23A 5EPDA 4HNVA 4JS3A 2B7OA 3ID7A 3L4TA 5BWFA 2GGEA 1YTKA 2CHRA 2FH8A 4U33A 1GHSA 2HNHA 4M0XA 3LOTA 5T9BG 1YXCA 1ECEA 5EMLA 1F5ZA 2OR2A 1TR9A 5DRCA 5LYRA 3L66A 4UUIA 4TMBA 2W4XA 2KX9A 1GKPA 1RBLA 3H26A 1PDZA 3GUWA 4ZFCA 8TIMA 3BG3A 4XO7A 1TWIA 3CS2A 1XKYA 1J9YA 1BXCA 1UWAA 3U9IA 1XIIA 1XC6A 2G5WA 1LROA 3L65A 1A4MA 4MKSA 1G5AA 1SJDA 1KGUA 1F3TA 1NDYA 2W67A 4JTRA 3WLOA 2HISA 4AAJA 2OZ3A 1AQHA 5LIYX 1A49A 2PCEA 4IG2B 2NQ9A 1RHCA 1H49A 3RR1A 4PODA 3NZ1A 3LK6A 1XDJA 5CPTA 1FCVA 5ECVA 4Z08A 1EIXA 3AHTA 4CCZA 4U28A 1B3YA 2DJLA 2DJXA 4HHHA 3TR2A 1F05A 1LT8A 4LW7A 2PGEA 1OYCA 2E28A 4DELA 1GVYA 4C1NB 4PEEA 3G0SA 3M7SA 1SZFA 4NVTA 3O6YX 3HG2A 1TZ9A 1C7TA 2XIQA 3M0MA 1HGWA 4UR9A 2R82A 3WQ5A 4RE0A 2V3GA 4HOWA 1PTGA 2ZVRA 1JCLA 2PGWA 2XISA 4LVAA 4BA0A 4J1OA 4EWJA 4JTLA 1YDOA 4QGCA 3B8VA 1O5XA 4Q4OA 4XKYB 2PC4A 3POHA 3OIXA 3WFLA 3VD7A 1Y5WA 1LWJA 3G1RA 1WKEA 1VJIA 1Q5MA 5HA7A 4CCDA 2YOCA 3L23A 4TV5A 1P1MA 3VNDA 1JG9A 3W2JA 3WDPP 2ZA3A 4WRHA 2D2JA 3BAKA 2XYLA 4FXJA 2R1MA 4INFA 2IKJA 4H6KA 2OLSA 2DSUA 3CAVA 2Y5SA 3ZXWA 3T42A 1E4MM 5C71A 4WF7A 5BOOA 2Z2AA 4AMAA 2Z1WA 5A2CA 2GUUA 3LI1A 3WELA 3SGGA 2X7WA 2Z0IA 4L9YA 4F9DA 1XKJA 1JQXA 3GSMA 3TTQA 3M0YA 3VZZA 2OEMA 3CQJA 3CZJA 4UMBA 3PZUA 3LMYA 2WSQA 1VFOA 3UESA 1YPIA 2DUZA 2D0FA 3UJRA 3V35A 1GOKA 3GDKA 1AG1O 7TAAA 3S8HA 4UR8A 4H19A 1LBMA 4M7TA 5F4SA 3KP0A 2VR4A 3O15A 5FD0A 4HD5A 1FHUA 3W02A 1SFSA 3WF3A 3FVMA 3ABXA 1PDYA 3TW7A 1L6FA 4NZ3A 5A1AA 5IM51 3QQ0A 4OWGA 4CD5A 3A5FA 2CLKA 3ZR5A 1UUOA 4QR6A 1DIKA 3TK7A 2V3FA 4KFPA 3DFOA 3QHNA 6REQB 5EGRA 3MP5A 1Q3NA 3NSNA 3SRDA 2Z2UA 5DFAA 4LB4A 4PMXA 1O12A 1R3RA 3QKEA 3TYAA 4MWAD 1P7TB 1KFKA 2VUNA 1KM0A 4XISA 1R5YA 3LNMA 4BF5A 3UU0A 2VNCA 1X96A 1GQLA 4W7VA 1GPWA 3N4EA 8XIMA 4FOJA 3UJ2A 4FR6A 4O0QA 1JPHA 1BGAA 5FJOA 4PUUA 1NQKA 1EF2A 1JCYA 3BSGA 4GK8A 1E1FA 3CHDA 4XX6A 4S39A 2HTMA 3DENA 1E15A 1XL9A 3VDGA 2ZVIA 4LALA 1O1HA 4ORIA 1UZDA 1RJQA 4RKAA 2OWCA 3E2QA 4DJDD 4NZ4A 3B4UA 1OYAA 1V7YA 3GR4A 4Q4SA 4O1AA 4FXRA 1JNEA 3PK7A 1XBYA 4HK5A 4D6JA 4MFEA 2D23A 3SRFA 4D8AA 3EGJA 2YCEA 4E3TA 3NYZA 4G7EB 3OTRA 4OZOA 3TYCA 2OVLA 1WO2A 1VYSX 3W07A 1I2NA 2O7SA 2OLAA 4HGXA 3UERA 2PEVA 3W73A 3IK4A 3VOIA 3WD1A 3RU8X 4XUYA 4P7NA 4BY3A 1OX6A 2NQLA 2Q02A 4NXSA 3CUXA 1RQEA 3S9IA 1VHCA 3FHAA 2RKXA 4JTSA 1V3LA 1VPYA 1KQYA 1VS1A 5CXPA 3W00A 1BWKA 2V68A 4Z1DA 3UNTA 3AIUA 5AHEA 1GORA 4W9TA 2I5QA 1PSCA 3AJXA 3KE0A 3GXTA 3GDTA 1JAEA 2ABBA 1QK2A 3GO2A 1E1CA 3OPSA 1GG1A 4FALA 3VNJA 3KOWA 3RDKA 3EOOA 1UD5A 3QBUA 1V3MA 3VIKA 2I5GA 3S2LA 3QYSA 1HKIA 1KO0A 3WL0A 3R58A 3GG8A 3P60A 2HQAA 1SGJA 4H9YA 2YA2A 2BHYA 4Q4RA 1PKYA 2H9AA 3ZVHB 4CQCA 3RJYA 1LCOA 2J8GA 4WD0A 4A3HA 3HQPA 4H6EA 4WIWA 5EY5A 2B0MA 3SECA 1ZP3A 5G4HC 1PZ0A 2QDDA 5DN1A 1GONA 2OEJA 3OOQA 1BVZA 3ALGA 2G41A 1EFZA 4GYPA 2E0PA 5KTLA 1N8IA 4I90A 3UY7A 3WEOA 4HN8A 1UWIA 2YSWA 1UIPA 1JD7A 1Z89A 2ZQ0A 4V2XA 2EPMX 1YNPA 2DSZA 3SCTA 1KNWA 1V6WA 4N6EA 4CKQA 4DIAA 2WKGA 1O5QA 3FA3A 3VFCA 1O60A 4M6QA 4N9CA 5I07A 5CC6A 1JZ3A 3T2QA 2VM8A 3KWSA 4KESA 5CH9A 2EPKX 4V33A 4UXDA 3JZUA 4PH6A 2E5DA 2VC6A 3IAQA 1R3YA 1ISZA 4X9YA 4JYFA 2P1FA 1G9HA 1P1XA 4M29A 4ZB5A 4LXFA 4QCFA 3N11A 3W3OA 4PFMA 4IJBA 4IHCA 3MUAA 4ZSUA 3CJPA 2DZSA 5J04A 1QI3A 1GVRA 3SURA 4DVOA 4O1BA 2J9YA 4G7FA 3VU2A 3LX9A 3WMCA 3MV11 3D47A 5D9MA 5A8MA 2WMFA 1R7AA 2QCLA 4CN6A 2BVYA 2D2GA 1F74A 1HN1A 3SUWA 3WH9A 4DNMA 2OSYA 2WBGA 2BY2A 4J3UA 5U4NA 1GVEA 4MF4A 3RG6A 3WQ8A 1V6UA 4IP5A 3VOFA 1FWIC 1ZUAX 2XTKA 3LB0A 3IIXA 4OGZA 3GHTA 2Z24A 3B9NA 1UZ1A 1M6JA 4IUOA 3BMWA 3PBVA 1KFBA 3I3BA 1TVLA 1AJ2A 3VIFA 1WXYA 3PUDA 3HURA 4AZ7A 3SIMA 3W72A 4J3SA 2ZWZA 4DJFD 1E40A 4J7RA 5CEWA 2XIBA 2NQZA 1YADA 3R89A 4FLSA 3CAKA 1JDEA 3TFCA 1WDSA 2GDQA 5F4WA 1RCXB 1BXBA 1B4EA 1SSDA 2G3FA 2V9DA 3OP2A 3L4YA 3S2NA 4CGTA 1ISWA 1B90A 1MW1A 4YLWA 2BXZA 1GJUA 3BOFA 4GPNA 4Y7EA 2GUBA 4ICMA 3FW6A 1YE6A 3TJIA 3GX9A 5EL1A 3SRHA 4PCTA 5IHRA 1EPVA 1LOLA 2FTWA 4PUWA 4ZXLA 4XO6A 4QTGA 2ZE3A 1K4HA 3RLUA 2VVNA 3TQKA 3CXOA 1V3HA 2NX1A 1KTCA 3ARUA 4OV4A 1UC4A 1XRVA 4R33A 1EDTA 4OV9A 3RCMA 4IMDA 2PAJA 4JQ3A 2NVCA 1OG0A 1OINA 4GKTA 3D3AA 4AZ5A 1UBSA 5CSYA 1C91A 3I10A 1VPXA 3CL6A 4ENLA 1UWRA 1W2PA 4EKJA 4ASTA 2QUUA 3VABA 4WKAA 3SIZA 1JGMA 2C6QA 4RNHA 4X3ZA 1DQXA 4HYRA 1H7OA 1Z7AA 2RJGA 3MCNA 3GC5A 3ABQA 4KEZA 1OK6A 1HJQA 3MKVA 1DJHA 3B9AA 4UTLA 4Z17A 5HPOA 1F2JA 1TJ2A 2A79A 2JK2A 1QI2A 1FH8A 4FX7A 1GNXA 3L0NA 1H09A 1XCXA 1EP1A 1GOQA 1JDDA 1KCXA 4XZ9A 5HQLA 2RUSA 2J4GA 3R94A 2A85A 4PRRA 3P0XA 4QQ3A 2X0HA 2V2HA 4XTDA 1C92A 4ATWA 3B03A 3ARWA 4QDPA 1VBRA 4JNMA 4MAVA 1DWHM 4JR5A 4PTDA 3S1GA 2OG9A 1QW8A 4P8XA 2VVSA 2IS7A 3EOLA 1QU4A 3EPMA 4IT1A 4Z2LA 5KEZA 4J3XA 3U3HA 3REQB 3S42A 3W53A 4M7SA 4C6FA 4D6IA 4JN8A 2G4JA 1FBAA 1JFHA 4PYSA 5HMSA 4H9ZA 1JXKA 2PS2A 3PWGA 4PBGA 1XISA 3R1ZA 4H6QA 5D03A 3VCCA 2ACUA 4UQAA 4R7OA 2A5HA 3TSMA 2DVTA 4LVGA 2NSOA 1NP0A 1EUAA 2QF8A 1TIWA 2RGLA 1XLLA 3IJ9A 4AC1X 4GWEA 4IISA 4MYAA 4NX5A 4HBKA 2PPGA 4NZJA 4HU3A 2HPMA 4WLCA 1GQIA 4IQEA 3B8WA 3T0DA 4ZQOA 4JY8A 1FTXA 2DZPA 3P7YA 1WE5A 3WUGA 3NPUA 3VZYA 2UY4A 3DGBA 4E2DA 4QG9A 3DIPA 3UWZA 5BXPA 1DP0A 5FF4A 4Q6JA 1QOPA 3AISA 4C6OA 1JI2A 3GKAA 3NQBA 1OFAA 5I02A 1SZNA 4HQVA 2KZHA 3IIOA 3F4DA 3M1ZA 1XYZA 1Z48A 4HSOA 3WBYA 2BTMA 3VGHA 1UWQA 2Y89A 2ISDA 3FIGA 4GZEA 4PMYA 1PKNA 2F61A 4YVPA 3C2VA 5EBUA 2JKPA 2PZ0A 5LNWA 5IDZA 1J11A 4WY0A 1AFSA 3A64A 1AJZA 5AC7A 2DZAA 5CPSA 3W0KA 1UZ4A 2E68A 2EXOA 3BJSA 2XVLA 5IDIA 3TCEA 4QRNA 3BK0A 1NFGA 1ECQA 4B3LA 2AGKA 3BQ6A 3R2GA 3T07A 3EXRA 1FWFC 2EHHA 3EX1A 3HG3A 5BCAA 1O1ZA 3TQVA 4D72A 1ZFJA 2WZEA 3T1GA 3VIPA 2E77A 2FVKA 2BHUA 2ZUSA 4ZO9A 1B9ZA 5CAHA 2J9ZA 1IEQA 3T55A 2FTPA 1SMDA 4QM1A 3NEHA 4F0KA 2FFIA 1GEHA 3PFRA 4EPKA 5FESA 1XINA 3MYPA 1LG1A 3A13A 5BU6A 5FSEC 2DT0A 5FAJA 4LUIA 5L9FA 3OZYA 3B97A 4ZOBA 2Q3RA 5HMFA 3S9ZA 4X2RA 5I06A 1V7AA 4PMZA 4AMCA 3DX5A 1UH2A 3QMRA 4GUIA 4GZJA 1MMFA 5AY7A 1MWOA 1DL3A 5HNNA 4XAPA 1TVNA 2GSJA 4OBTA 4H9XA 4PBEA 1KKOA 5AC4A 3AALA 2RH9A 3VIHA 3M0IA 5LXEA 4LBRA 4DO4A 4YL2A 1TJPA 4L1GA 1UJQA 3KVLA 3SBFA 2ZBTA 4ERAA 3M46A 2IKGA 2I56A 3LI0A 2A21A 3IV3A 4IL0A 1W3LA 7CGTA 2VDGA 3K8LA 3FV9A 2PD9A 5G2WA 4DUWA 5CBIA 1Q7QA 4HK6A 1FWJC 5DEZA 2P0OA 2X30A 3TNOA 4HCHA 2VGBA 2NUYA 2NV2A 1WDWA 1QW7A 3RPDA 3DFTA 1X7IA 1TCDA 5EFFA 4NXKA 1I0DA 1XIHA 3A23A 2BOGX 3TDFA 4YTQA 2GOKA 1U2YA 4GINA 1XIMA 2A3AA 5CPLA 2OGJA 3H21A 1UW9A 4IL2A 4UFKA 3H22A 1GK8A 3RX3A 3WN6A 4JN7A 1B30A 3C3UA 4HPHA 1SW7A 3NTYA 3WNKA 3WK1A 1VB9A 4FOKA 1BRLA 2YL6A 3QSTA 4YNGA 1G0CA 3E1F1 4GYPC 1NWTA 2VTFA 3FAWA 1UR8A 3MI3A 2OB3A 3PJUA 4C6KA 3EWXA 2O55A 1EJXC 4DI8A 3U4AA 1R47A 2PDBA 3NQCA 1ZGDA 5HUOA 1E0UA 2X1IA 3V16A 2YYUA 5BRPA 3P62A 3LNPA 2EJAA 3UG5A 3E74A 1YDVA 5D4YA 4GACA 1LLOA 3MANA 2ABAA 4DZIA 5HJLA 4KW2A 1P0DA 2ZADA 3N2OA 1IEVA 2ZXQA 1S2WA 4U10A 3I6RA 3MO7A 2FVLA 1XG4A 4G9PA 3TLLA 5HANA 3WLKX 3TSDA 1LRTA 1W1IE 4F48A 1IWPA 3L0GA 2YB1A 3MPGA 3NCOA 3SJNA 4X61A 3GH7A 3SY5A 3IS4A 1TPUA 3UPWA 2DU2A 3ONBA 1A5OC 1M7XA 1ZPTA 4HMDA 5KZEA 3NL5A 3ALFA 4EACA 3ABZA 1OCQA 2Q6ZA 4HT3A 4ML4A 5DQPA 5FCZA 1KRBC 3PTKA 1XBXA 1A3XA 5M17A 3QY7A 1SFJA 3TU9A 3EWCA 3BTNA 2HNEA 3QHOA 1WAWA 4O4VA 2GVEA 5D38A 3OGSA 2J75A 3HGOA 2BGSA 1L6SA 4CVWA 5CG0A 1HKVA 3KEHA 1N82A 5JVLA 5HDRA 1DE6A 3MC5A 6REQA 2ZZ2A 4O0KA 1UIOA 4CVUA 3WLRA 3ZSSA 4JHOA 4K39A 2VQTA 1S5MA 4NKCA 1TG7A 1XFCA 4G8TA 3UYCA 4TVCA 1RPXA 3VIGA 3CMGA 4HIBA 3V0SA 3W29A 1CXIA 4DBDA 1X98A 2W66A 1BXNA 3WBWA 2R6OA 1NM9A 3TAKA 3T08A 3VM5A 4BQ2A 2QLYA 1FOBA 3MMTA 4ZO7A 4ACYA 3L0KA 2OJPA 1IEWA 4BJHA 5D05A 4O16A 1H3GA 1Q6OA 1NOUA 1GOMA 4UOQA 1EYEA 2QJIA 4ROQA 4ES4A 4ZO8A 5DMMA 3UVIA 3A3WA 3PG9A 1W3KA 3DFSA 1MRQA 1DWFM 3J7HA 4XIMA 1VZWA 4LCSA 3A12A 1YTEA 4S23A 3QLDA 4O28A 4FNRA 1S2AA 4H9MA 3CO8A 4E2BA 3ARQA 2Q8ZA 3RITA 3AXXA 2Q01A 2VFEA 3KBWA 1S46A 4GQGA 1BF2A 5FJIA 4WJEA 2UV8G 1QUMA 1B3WA 3LTPA 1XPGA 2F38A 1UH3A 1FH9A 3ATYA 2WVVA 1KFWA 3FSTA 4GI4A 1KGXA 3KCOA 3PPGA 4KWWA 1VFSA 2CW6A 4ACZA 2JIEA 5LGZA 1LOQA 4MTVA 3NSMA 1RAKA 2FVMA 1Q65A 3GH4A 2RAGA 3CHCA 3GTXA 1WX0A 3S5OA 2DZVA 2H9AB 4K1WA 2H90A 3JS3A 3C2OA 4JIIX 3PFMA 5A94A 4CNSA 4KCWA 2VEMA 3EB4A 3M16A 1WKFA 3LBMA 4Q7NA 5K9DA 4WSJA 3GG1A 2B7PA 3I7QA 5HWJA 3N17A 1BG9A 1E0XA 1GOXA 5GNXA 1VPQA 1R9YA 4NZFA 1PE1A 2ISWA 4P7LA 1CI1A 4FF5A 3RPMA 5XIAA 4JFUA 3S2JA 3QQWA 2XG9A 2YL8A 4AIEA 4RDYA 3TFXA 3WLNA 4XG1A 1FFRA 1W0MA 3ANYA 4EE9A 1CB7B 2ADAA 3H4GA 4ZO6A 1QO2A 2WB5A 3BSMA 2O9PA 1PCKA 3G1DA 2PDLA 4AX7A 3C8NA 3RYSA 2I16A 2CLMA 3PBGA 2X0YA 5ABFA 3ZJKA 1FWEC 3AFBA 6PTDA 4L1XA 4KCUA 3C0JA 4IQJA 1TQXA 2E8ZA 1M5WA 2CZDA 2QULA 1WV2A 3ITLA 4KBXA 2WZHA 3RM8A 1VKFA 5MHBA 4GYJA 3LV5A 1W17A 1DEDA 1PIGA 3TVAA 3A6OA 1DJZA 1SW3A 1SFTA 2TPSA 1KM3A 4DJFC 3VMPA 1ADSA 1XM3A 2FMOA 3VDBA 3NXFA 2ZC8A 1BTCA 2CYGA 5IRPA 1UROA 2PWUA 2OZ8A 1ADDA 4Q8MA 3IGSA 2AAAA 2NQHA 1HL2A 2CNCA 2YCIX 4IFOA 4JYDA 5PTDA 2R1NA 3L4ZA 1J79A 3V0TA 1M9HA 1UPMB 3WMLA 1F8MA 4LV4A 2DH2A 1GEQA 3S46A 3AIVA 2FGLA 4N9BA 1YIXA 5IBXA 4NZCA 3CZKA 3PNZA 4FF7A 3UQNA 2V2DA 2CKRA 4FLRA 1Z44A 1FQ0A 3FDKA 2QCCA 3NQMA 3WDRA 4BK9A 3WENA 4PMUA 1YE4A 1DYSA 4Q3MA 4RZ6A 2G0WA 2NV1A 2WKJA 3STEA 1FWGC 3WJZA 1MVYA 1NDZA 3HFTA 5DLCA 5E1QA 5A3HA 3WQOA 3VVGA 3S1UA 1V79A 4IPPA 1F3XA 3VE7A 4LAKA 2GSEA 4W8LA 4QSHA 4NG3A 2GJRA 3BG9A 1ZB5A 4WDUA 1Z3NA 5BXSA 4TOQA 3AAMA 2PGRA 3R0KA 4LY8A 4A8IA 5JUVA 3IPWA 3KFTA 3MI2A 1FCUA 3QOMA 3KVKA 3UCDA 2Z1BA 1DQUA 3IACA 3SCVA 2C1GA 2NV9A 4I9AA 3RLHA 4GNJA 1M7OA 2PF8A 1K77A 3BQ5A 2NLYA 3UJEA 2G3NA 4UWMA 3CUZA 4RNFA 4A21A 4RW3A 3TW9A 1SR9A 1QHPA 2IKIA 5A6BA 3O06A 1CB2A 2WCGA 4XZHA 3ERPA 1YX1A 5J5DA 3GXIA 5J5RA 2R1PA 4QROA 3LPFA 3II1A 1L2UA 4PUDA 3VDHA 2PE4A 3TZNA 4A3QA 1IF2A 3BLKA 4E38A 4WX2A 3T0AA 2XU2A 1NH6A 1ZJAA 3C3NA 4H00A 2YBVA 2NSXA 3TAOA 1W5MA 4A4AA 2ZUTA 2J66A 1TPWA 1AW2A 1BQCA 3P80A 1X1NA 2E9BA 4RE4A 2WHJA 3LMZA 2J27A 4ZZ9A 3ATZA 2DZWA 3C2EA 4W4QA 5A6SA 5A8QA 3EEGA 1G4EA 5KITA 1PS9A 5A69A 2XH2A 2ZKMX 4GX9A 1Q63A 1EA0A 3I65A 3CWHA 6CGTA 1NP2A 2I17A 5MKGB 3ZM8A 3FXGA 1GPFA 2NUXA 4EF8A 2Z29A 4FNUA 3VIMA 2CFFA 3EB3A 4Q6XA 1A0EA 3ITVA 1W1PA 2NLIA 1EDQA 4HZ7A 3AZRA 2NX3A 2Z4GA 4MSSA 4QQUA 2PWEA 4O8AA 5I6SA 2PDQA 1WPCA 3IVSA 1MDRA 4L4LA 4S3FA 1ALDA 2VC9A 3C0QA 4ORMA 2J88A 2A1YA 1N2VA 4NF7A 5I09A 1HKMA 1GOIA 1K7XA 3STCA 2DIEA 1VBUA 1XRFA 4TR9A 3UD6A 3F5LA 3DXIA 4TX6A 3MHUA 3QV7A 1S3TC 2JFEX 3GR7A 3THCA 2PFHA 5ABFB 4P7OA 1H51A 3NZQA 1DOSA 1UYQA 3E2VA 2V67A 1E0VA 3VKKA 4B4HA 3U7BA 1AL8A 5G1TA 2GUYA 1LL7A 4JFWA 1JCNA 2ZUMA 1TWZA 2BG5A 1G4PA 1QI0A 5M1TA 1H41A 3W7OA 1FWNA 3VILA 2AOSA 3MVTA 3O6CA 5ABTA 3THDA 2BOEX 5C7HA 3GC2A 3PAOA 4O1FA 2QCEA 3B8DA 3W1LA 3TOPA 4AD3A 2ONEA 5D9OA 3KDOA 4H9TA 1MXSA 2JE8A 1A4LA 2UY2A 3KS6A 2TMDA 1GVOA 4GIRA 2GVJA 4K2SA 4CN1A 5I23A 2X7VA 2JEQA 1KBBA 4JTIA 1J2BA 1LLZA 5C54A 5AC5A 3N2BA 2FGZA 2F84A 3DI1A 2BHZA 2PDGA 3SJ3A 3TOYA 1H62A 2CU0A 3AJ7A 1BEUA 3G1VA 3SCUA 2YDRA 3EEZA 5AC6A 2PP0A 1H2JA 4L56A 1XPYA 3D46A 3GFYA 1ZCOA 5LNUA 4AZGA 4WSKA 2OKOA 4E2VA 4G2DA 3GU9A 2YCKX 3CIXA 2ZRWA 4PL2A 4JEJA 1OX5A 1WZKA 2WV8A 3MUZ1 4UIOA 1J96A 1QPRA 3EB2A 4C6QA 3WEZA 2XVNA 1KBIA 3H12A 1XLAA 1EC7A 3NZGA 1OX4B 3G8EA 3LGDA 2VENA 4AZHA 2DSWA 3VO0A 2ZA1A 3OLDA 9XIMA 2XVGA 3VCRA 5G1MA 4DB7A 2XGIA 4PMJA 2O9RA 3CB3A 4DF1A 3E02A 3OO2A 1H1YA 3LPGA 3VMNA 4C6PA 4JIEA 2V69A 4KS0A 3DGRA 4W89A 1R2RA 2C79A 4LUYA 4MJ2A 3OB8A 1RBOB 1OIFA 1RK5A 4HVXA 3NQ6A 1XICA 2JQXA 1W5OA 1DHKA 4LAZA 1H7NA 3UJSA 3HM7A 4JIQA 1FWTA 4KWUA 3ZLFA 3APTA 1V0MA 3BMXA 3L68A 2VHLA 1M41A 2E67A 4GGHA 1ZZMA 3U2EA 5G2IA 2DSKA 2YA0A 3LHVA 3L5MA 5TNVA 4OKDA 1DJGA 2I57A 2DH3A 4M19A 4PB3A 3LN3A 1IYXA 3PJXA 3N19B 1LRNA 4W84A 3B06A 3UGRA 1XRTA 4RLIA 3LBCA 3GLCA 1X39A 2OELA 4NSBA 4NX0A 2OOFA 3B05A 3WBAA 1FP8A 1V77A 3T78A 3NFUA 1KR0A 4U3CA 1NQ6A 3FJ4A 3M0XA 2PDHA 1CZ1A 4RZBA 4DXVA 2VXNA 2J8TA 2F6XA 4KT2A 1UOKA 1XS2A 3BURA 2GYIA 1KW1A 1FDYA 4XQ6A 1SPQA 4HPXA 1ZY9A 4Y9OA 2Y6ZA 3AS2A 3VMOA 3WQPA 1GYMA 1L0PA 4OVXA 3C2YA 4TVDA 4C91A 4OQVA 4QAIA 1KCKA 2VZOA 1B3ZA 4JICA 4A35A 3OA5A 5E5CA 4FLOA 4UOZA 2CETA 3W37A 1V3IA 3B8TA 4AY8A 1GTHA 4LYPA 1EO5A 3Q4DA 3FK4A 3W22A 3GM8A 1KLYA 1ZHAA 3ARXA 1TMLA 1JZ2A 2PWFA 5AVHA 1E4LA 2XJ7A 1GKRA 2XWDA 1XF0A 2ZUWA 3FKRA 3ARVA 2E7FA 3BLDA 4ADUA 3GHRA 3N3MA 3DZ1A 5LGXA 3JVAA 2YDAA 4IIGA 1VEMA 1UR9A 2ATMA 2PP3A 2PDMA 1A3WA 3SEPA 5FKYA 1AW1A 3BW4A 1J6OA 1I2OA 3QM3A 4FNSA 3W6MA 4GISA 4NI8A 3IJQA 3ZR4A 1XH2A 5GJMA 4O52A 4IGNA 4G1NA 4S2BA 1FHDA 1MUCA 2PMQA 5D9PA 1UR2A 5JBEA 1Z8AA 3KOZA 3QYQA 3SCSA 3IV8A 1QNSA 4D6CA 4RNIA 5DY2A 1C3FA 1M03A 1VF8A 3RUBL 4XD3A 1IV8A 2WSYA 3H2EA 1IXPA 3TWBA 6ENLA 4U5IA 3UNDA 4GRSA 3YPIA 1TTJA 3F1QA 3VNMA 1VR6A 3UWQA 3GXPA 3TZFA 1HQTA 4UTFA 5EKYA 4HOXA 2V5CA 4IG2A 1TPFA 5CC5A 3KRUA 5C55A 1POKA 4BF9A 1K4GA 4HNUA 3G0UA 1R9XA 3GTIA 3VDCA 3O0FA 4LBSA 4FI4A 3UZYA 4X2PA 1TUXA 4EIVA 4XSLA 4AF0B 4EXAA 3VGDA 2QPSA 2NT1A 3M64A 1L6GA 4WDTA 3Q2DA 1LF1A 4CQAA 3W01A 4WSHA 1HP4A 1XLEA 3K46A 3RMEA 1BAGA 5I3IA 4NNBA 4PZVA 4OFCA 1A5CA 4MLJA 1OADA 4RK8A 1B31A 1CECA 1YLVA 3WMSA 4S1FA 1RR2A 5JBFA 4BEUA 5TIMA 1KRAC 2A6NA 4JTJA 1BWLA 2CLEA 4AC7C 3GW0A 4DQWA 3DKJA 1OK4A 3CZLA 3C86A 3LHWA 2W61A 3OGRA 2ZX5A 1FDZA 4XIAA 2YA1A 3QZ6A 1X6NA 1SUXA 3KP1A 5KZ6A 4AD1A 3VNIA 4K38A 1YEYA 2WYSA 3W75A 3GWQA 5LHEA 3D5HA 1E6SM 3RLVA 3S5SA 1JZ5A 2YL5A 3KBSA 3T4CA 3UWEA 5H1WA 3CASA 4Q4PA 2Y2WA 1W1VA 5AB3A 2P10A 3QC0A 4QJ5B 3LBOA 3RX4A 1PX3A 1ME7A 2ISSA 3S3GA 3OYZA 1DTNA 4HNCA 4U4MA 3UA4A 3BO9A 2QGYA 2G4FA 1E5JA 2VQUA 3WX7A 3DHDA 7ENLA 4FR1A 5BOFA 1OZMA 3ONCA 4CCCA 1JD9A 2YXXA 4JHMA 2AL1A 3V4BA 2A4AA 4NUWA 2F2KA 4CU7A 4R27A 1UZHA 3LGGA 4FS9A 3KOFA 4A3UA 2Q09A 1A5BA 3O2LA 2HMCA 3VXGA 5LXXA 2J25A 5CC7A 1GVSA 1CBGA 3I6TA 1ITCA 1AK5A 4DXKA 3BW2A 1E9IA 4KFOA 4DYJA 3N29A 4MZYA 3NWRA 4GBUA 2QJNA 4HJWA 3KZSA 1V02A 4GVGA 3CUHA 1LWHA 1DJIA 1WZMA 1JCJA 2VCBA 3NQGA 1RPKA 3SM0A 1G94A 3A3HA 4J3VA 4L6HA 2Z27A 3D0CA 4WDXA 4QJ1A 4AH7A 1JPMA 2WAGA 1WDRA 4F40A 3S0CA 1CX9A 4FXFA 4F0SA 2ZXBA 4NAFA 3MSGA 4PSRA 4KCTA 3Q67A 1NELA 4W85A 3THQA 1NWSA 1S2UA 1DQWA 3HGSA 2C8NA 4FOUA 2ATSA