3MC5A

Human aldose reductase mutant t113v in complex with idd393 crystallized in spacegroup p1
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
316
structure length
316
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPVGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-induced fit affects binding modes and provokes changes in crystal packing of aldose reductase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldose reductase
total genus 107
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3mc5A00
4WDTA 4QXIA 3LQGA 1X98A 4XZHA 5HNUA 3GHRA 3NTYA 1XGDA 3EB4A 4XK2A 1ZUAX 2HEJA 1PZ1A 4F40A 4RPQA 3M64A 2PDHA 2PDQA 4PMJA 3DN5A 4ZFCA 4XZNX 4LB4A 2PZNA 4JTDA 2INZA 4IJCA 4JQAA 3V0UA 4YVPA 1RALA 2PDUA 3H7UA 2IS7A 5JH2A 4LB3A 1US0A 3UZWA 3LBOA 3LN3A 3H7RA 3R8HA 4FA3A 1EXBA 3CV6A 2CLPA 5LIWX 4EXBA 2IPJA 2PD9A 5M2FX 1VBJA 4YS1A 4JTAA 2WZTA 2F38A 4EXAA 1S1RA 1FRBA 4WDXA 3CASA 4XO6A 4JQ2A 3WBXA 1IHIA 5AZ0A 1RY0A 4GCAA 2DUZA 3LZ5A 4PR4A 4JTQA 3GHSA 2DUXA 2R9RA 3M4HA 1X96A 3UYIA 3LUTA 3R6IA 1XJBA 4IGSA 1AH3A 4DBUA 2PD5A 3BUVA 2WZMA 1PWMA 3WBYA 3P2VA 2ALRA 3LNMA 1HW6A 3MC5A 2J8TA 1ZQ5A 4MHBA 3LD5A 4XVDA 1S2CA 4G5DA 3ERPA 1J96A 3BV7A 2ISFA 3GUGA 4HMNA 5LIYX 2PDXA 3COTA 2IKIA 1Q5MA 3C3UA 4PUWA 2R24A 2BP1A 2FZDA 4XVEA 3V0TA 4YU1A 4WDWA 2NVDA 5LIUX 4JQ3A 3N2TA 1HQTA 2PDIA 3UG8A 4Q3MA 4QBXA 3UZXA 4GQ0A 3O3RA 1ADSA 1Z3NA 4QX4A 4FAMA 3CAQA 3LQLA 4WGHA 4QR6A 4I5XA 3WBWA 2FZBA 3V36A 4LBRA 2ACUA 2HE5A 2IKHA 1LQAA 1JEZA 4FALA 2AGTA 1PWLA 1AH4A 4Q7BA 2HVOA 2HE8A 1A80A 3FJNA 4XAPA 2PEVA 2IQ0A 2ACSA 5LIXX 1S1PA 2IPFA 1T41A 3V35A 2FZ9A 2PDCA 3CV7A 2PFHA 3G5EA 1Z8AA 1LWIA 2F2KA 1IEIA 2A79A 1AFSA 3GHTA 1VP5A 1M9HA 2NVCA 2PDGA 4JQ4A 1RY8A 2PDPA 3R94A 2BGSA 4L1WA 3LENA 4XZMX 2PDFA 3F7JA 2ACRA 3GHUA 3R58A 2PDWA 2HV5A 3U2CA 2I17A 4FZIA 1YNQA 3RX3A 2HVNA 2PDBA 3G1RA 1AH0A 3ONCA 2PDJA 3EB3A 1K8CA 2I16A 4JIIX 1PYFA 1R38A 1EF3A 4JQ1A 2BGQA 3UWEA 3EAUA 3MB9A 4H7CA 1OG6A 3ONBA 3RX4A 4H8NA 2IPGA 1C9WA 2IKGA 2PF8A 4DZ5A 5JH1A 1MI3A 4LBSA 4AUBA 3BURA 2PDKA 1EKOA 3LZ3A 3V0SA 2FVLA 4ASTA 2C91A 1Q13A 3M0IA 2INEA 2FGBA 4GIEA 4JIRA 3WG6A 3KRBA 3BCJA 5HNTA 5KETA 4DBWA 4OTKA 1YE6A 3CMFA 4LAUA 3UZZA 1QRQA 4YVVA 1X97A 2PDYA 3T42A 4GACA 1MRQA 1S2AA 3H4GA 1XF0A 3DOPA 3S3GA 3UGRA 3UFYA 1QWKA 2PDLA 4XO7A 2P5NA 4JTRA 1Z9AA 2QXWA 4WEVX 4JTCA 1GVEA 4NKCA 2PDNA 4PUUA 1T40A 4R9OA 1Z89A 3QKZA 2DV0A 4IJRA 3R7MA 3R8GA 3Q67A 1PZ0A 4YVXA 4LAZA 3CAVA 1ZSXA 4PRRA 5HA7A 1YE4A 3WCZA 2HDJA 3RX2A 4L1XA 3UP8A 4GABA 4JIHA 2PDMA 5AZ1A 5LIKX 3Q65A 5DANA 4HBKA 1SM9A 4GA8A 4ICCX 3VXGA 5C7HA 1ZGDA 1YNPA 2IQDA 2IKJA 3LEPA 1MZRA 4PRTA 4DBSA 1AZ1A 3UZYA 4XZIA 3D3FA 3R43A 4WDUA 1AZ2A 3B3DA 3O0KA 4WRHA 4XZLX 2ACQA 2FZ8A 2VDGA 3N6QA 1EL3A 1UR3M 2IPWA 4GQGA 3FX4A
chains in the Genus database with same CATH superfamily
1NDZA 1FWNA 3N2XA 2CZVA 4XZHA 2QCHA 3CQHA 2QR6A 1HTIA 5CPLA 4PFHA 2XYLA 4AVOA 3P0WA 5K4XA 1KD0A 1YPFA 3WLJA 3H70A 1PZ1A 2ZXDA 4AZIA 1G94A 1TPUA 3V3WA 3OOQA 1EDQA 4FLOA 3AHZA 4HCDA 3VNJA 1CXFA 2GJXA 2RHGA 3TQ0A 3KWSA 4W89A 5CJMA 4PTMA 5I3DA 1R7AA 4PMDA 3POCA 3JZEA 3DXIA 3EX2A 3E2SA 4ACZB 2W0UA 3M43A 3TW6A 3LM7A 5EMMA 4JHMA 1EJVC 2YXXA 3LMZA 3CV6A 5LIWX 3G6LA 3BAJA 1AJZA 1V7YA 3AMGA 2E77A 2DJLA 4RUBA 2WZTA 1LLWA 1B3ZA 1DQWA 7ENLA 1V3IA 3FKRA 3WFAA 3GIPA 4ZOAA 3WK1A 1G67A 4AWTA 2EPNA 3T05A 2NXHA 4C1NB 3DAQA 3IGUA 4R7OA 1REQA 3VIJA 3C2OA 4GUIA 5AOUA 1NWUA 1X96A 4NZ3A 4IGSA 1ZAJA 4ZBCA 2GGEA 1OIMA 4DLFA 4Q6JA 4K39A 4HZ7A 1G7VA 1MUMA 1HW6A 1HVQA 2RFGA 1FDZA 1I4NA 1KCLA 2BLEA 3II1A 1NP2A 4DJDA 3AFBA 3GK0A 3MP3A 4IMEA 4CQBA 3EPNA 1WAWA 3P67A 1PIGA 1Z69A 4W8LA 1UA3A 2GWNA 4P7OA 3V4BA 4N02A 3IANA 1YTEA 3GYEA 4HNVA 2VCBA 5AN7A 3LA4A 4F0HA 1KR0A 3THCA 2MNRA 4MWAE 2QCDB 3A3WA 4QEEA 2XH7A 1RZMA 3KCJA 3EYPA 3BOFA 4R27A 1HQTA 4PBFA 1ISXA 1PTGA 1RCQA 4K36A 1TE6A 3VVGA 3VINA 2E3ZA 3H6OA 5ABTA 4P7QA 3CUZA 1BEUA 1REQB 3FJLA 1VFFA 4XSMA 3WBWA 4GUGA 4B5TA 3IJDA 3NQ2A 3GNDA 3IUHA 1R9XA 1HNYA 5BMXA 4GZ7A 3JR2A 1QVBA 1EO5A 1MDRA 3TYBA 2Z7KA 1AH4A 4AXNA 2CPUA 4ZTXA 4GY0A 2CXEA 1BVNP 4GHRA 5CZTA 3XINA 2IQ0A 1L9WA 3PFRA 4GUHA 1KNWA 4DJFD 1Z44A 3Q2DA 5CPTA 1LWHA 1VLWA 4IP4A 3B9NA 1KBJA 4GFIA 1RBLA 1GPWA 1CB7B 3TYDA 5I23A 3NYDA 3W74A 2BMBA 1F74A 1RHCA 1FH7A 1V6VA 2OEKA 4O10A 4I7VA 3IEBA 2V2CA 1J0JA 4QRNA 1U33A 2JBMA 4AWEA 3WH6A 4I6VA 1FWSA 3TC3A 2G8ZA 1M1BA 4O4VA 2W66A 3VZYA 1E72M 4QE5A 3HPSA 3M0HA 3OIXA 3G1YA 1UR9A 2HVNA 4XBSA 3APYA 1AH0A 4MZ1A 3SDOA 2E8ZA 3WD3A 1KFLA 1YDNA 2I57A 3LYEA 2R14A 3K13A 3KRZA 3NL2A 1TQJA 1IGSA 2PS2A 2VTFA 3WYZA 3OGVA 4M56A 5GJMA 7A3HA 1T8QA 1NQ6A 3DYMA 2QJJA 4Q4QA 4JN6A 1OX4A 4P8WA 3AXHA 1LRTA 3BAYA 4PA8A 1CXIA 3MU7A 4QDWA 3TWAA 1KQZA 1RXOB 4J2MA 5M1TA 3TN6A 4Z2LA 1OD0A 4DPQA 2I9EA 1FP9A 2BS9A 5EB8A 4NJKA 4PMZA 4OQVA 3CMFA 4LAUA 4L4OA 4GBUA 2VX7A 3KBVA 3H4GA 1XF0A 2GK1A 1XLEA 1PCWA 3GVQA 2ZX6A 6REQB 3BAIA 4GI9A 1FHDA 1P1XA 2GZXA 3L7RA 1OFAA 3HG2A 4R9OA 1ZRQA 3O15A 1OHLA 1WP6A 3D0CA 1DXFA 2CZ5A 5E5CA 3ZJKA 1TYGA 3WLPA 2EG6A 1J6OA 4AZBA 3C0LA 3QSTA 1UR1A 3SJNA 3TUUA 4EKJA 1Q63A 4BI6A 1RD6A 1QO5A 3W02A 4ERIA 3W7RA 5HPCA 4RXGA 3FS2A 4PBGA 3UCQA 3LCIA 4MPQA 2WB5A 5C7HA 2IQDA 5XINA 4AB4A 1PX4A 3V1PA 4JTIA 3VZZA 3GG0A 1ODZA 4IFOA 2J13A 2X30A 3SW6A 3A3HA 4ML4A 4N4QA 5KINA 3NL3A 4W5UA 1ELSA 4UFJA 1C8QA 3W7KA 3NQBA 1TWWA 2GJNA 2YCKX 2PZ0A 3URAA 3SQLA 1EBGA 3MSYA 2X8RA 1VFLA 1ZBVA 2H9AB 3LQGA 4NXSA 4ZEPA 1HGYA 1QNVA 3PWGA 4YTSA 3IRDA 1V93A 5EBAA 4LU0A 4EPDC 2DZTA 3K4AA 3BAWA 1LL7A 4KFNA 3WUEA 1GK8A 3HBLA 3PZ9A 2VEPA 1MEIA 3TQPA 1NM9A 3BXWA 4H6RA 1GVQA 2PDHA 3QV8A 5ENLA 3TH6A 5C0QA 3OHMB 5I3HA 1E56A 4ACYA 3UQNA 3G1AA 2PMQA 4LUTB 4L6OA 3P61A 3PBYA 1JZ7A 3DGBA 3C3NA 6CGTA 5A95A 3PWIA 4DF2A 1W9BM 2NUWA 2E5BA 2VR5A 3IJ6A 1GG1A 3U5UA 2YL5A 2FZMA 2Z1VA 3KOZA 1TV2A 3HPFA 3EX1A 3AIWA 4N42A 5CPOA 3N25A 4C6PA 3H7RA 1EXBA 4XTDA 1LBMA 3AYVA 1EO7A 4FLRA 4F66A 5TQLA 1GWJA 5A1AA 3AIRA 1A47A 1W37A 1NOUA 1GOIA 3IRSA 2XIBA 5CEWA 2OVLA 2PWUA 1UROA 5CZJA 2Q02A 2QYGA 2CERA 1O60A 1Y5XA 2QPXA 1OVDA 5BOOA 1U5HA 1E40A 5KZDA 4RLIA 3BSHA 3AU6A 4JTQA 4IX2A 4GH3A 2DUXA 4UCGA 4FNPA 3GTFA 1A5AA 2HK0A 3BJTA 3LUTA 3ARSA 3ICJA 3VMOA 4WJ8A 3BJSA 1BKHA 3CHVA 1F6YA 3G8RA 1P0KA 1EJSC 3B05A 1ONRA 3EMZA 1WDRA 1PIIA 3EOLA 2D3LA 1HT6A 1TJ0A 4PRWA 4JTGA 4X63A 1TWZA 2FFIA 3BVJA 3C3UA 1F8IA 5A5WA 2PI6A 3CTLA 2FMNA 4FEZA 4YN5A 4GZIA 3C2EA 2ZX5A 3OBEA 1JYVA 1XIBA 1AMYA 3THQA 4XVEA 4GQBA 2C79A 4FI4A 3AS3A 1WB0A 2XSAA 1VBUA 1ZCOA 4WDWA 5D03A 3L0NA 4OZOA 1O7AA 3KEHA 4V1YA 3CHFA 1V3LA 3C61A 4PEEA 3W7JA 1NP0A 1UUQA 4HU8A 2V3DA 1TZZA 1BVZA 3ZVHB 3WFZA 1JNDA 4GQ0A 3O3RA 2ZZ5A 1SYTA 4JPGA 4O17A 3VX1A 2F84A 1OFQA 3HV8A 2WVVB 4ZO8A 1OC5A 4FSAA 1C9DA 3FVMA 3UY7A 3V36A 3BLDA 4JFTA 1T0OA 2C13A 5G2HA 3T9PA 2X1SA 3OA3A 1GQJA 3H8AA 1LQAA 3WEOA 1GOQA 4RXFA 3KZSA 1PKNA 4FXJA 3I4EA 4FMVA 1B57A 1W1IE 3BLKA 3WDPP 1KBIA 1A80A 5T91A 1WKFA 1UKTA 1YQ2A 5LIXX 2ZCGA 3LHYA 1QPQA 3NZPA 1V6WA 4IFRA 3W85A 1H7XA 4XIMA 3AS2A 3SGUA 3B9AA 1PB0A 3E2RA 1Z8AA 3CMJA 1XWYA 2A79A 1DQXA 2E1WA 1JYNA 1RY8A 5ABFB 3H2OA 4F2TA 3L23A 3KRSA 1AW1A 3NPVA 1ZPTA 3SBFA 3PZUA 4ZB0A 2DT0A 3OEXA 4WSKA 3WQ5A 4CCZA 2D2GA 2VFDA 5CJ5A 3PNZA 3AHVA 2NQLA 1YADA 5FAJA 5F1VA 4GQRA 3BGGA 4AAJA 4P8XA 4QHRA 4ZSTA 1BQCA 5HATA 1FBAA 1CEOA 4S3CA 2D22A 1ZJIA 4CQDA 3PS7A 3AWNA 4L4PA 1KTNA 3BOXA 1WZLA 3UWEA 1W1A1 1JCNA 1Y5WA 2HISA 1QMLA 2D2HA 2QJGA 4XSLA 1FWBC 3WLTA 5LKYA 5H6HA 1MI3A 4D6CA 3UCCA 4E2VA 4DBEA 3BURA 3OLIA 1K9TA 5BOFA 2YIHA 4NRSA 2O9RA 3VCCA 3WQFA 2ZUNA 4IICA 3EWWA 3CT2A 1KFJA 1MEWA 1PV8A 1K70A 1XG3A 4A3UA 4WSHA 3TN5A 3NQAA 3E2QA 3NIYA 4CQ9A 1R30A 2AOSA 1W3NA 1JG9A 3B8UA 3MMUA 4AZ7A 2WYSA 4PCNA 1UKPA 5IDIA 4R7WA 3CGTA 3I7QA 1EHNA 4K1WA 5BWAA 4JCLA 1MFVA 4NL1A 1TJPA 5HK4A 3FYPA 3T0AA 1O1ZA 1U83A 3U6WA 3UY8A 4B3ZA 2EG8A 1H62A 4A8RA 3R7MA 2P76A 2D0HA 3HV9A 2CZDA 4GD0A 5FEWA 1RV8A 4HPGA 1XH2A 1TREA 3WF1A 1ITCA 4LYPA 2MUCA 3ITXA 1JYWA 1V02A 4L64A 2Y7GA 1B1YA 2FLIA 4IZGA 1H0GA 1RUSA 4FK9A 3MWAA 4E5TA 1WXYA 4ZO9A 1XLMA 4HNLA 4J3SA 3UYCA 2OPJA 2Z1KA 3MZNA 5CGQA 2E5DA 1QOQA 4CNPA 1I8JA 2Z28A 4AIBA 3QHMA 2RDWA 4GRSA 4MJZA 3MKKA 3D3FA 3HURA 2XFWA 3GQYA 1AZ2A 5BXPA 2FHFA 1Q85A 2AQWA 1WCGA 4XBKA 4MB1A 1P7TB 1DTNA 2Y7EA 3FYOA 1D2KA 4DAIA 2IPWA 5ABHA 1KM3A 1X98A 3AICA 3ZYZA 4KFOA 2ZX8A 2J88A 1H0IA 2PTDA 4EAMA 1TX2A 3EB4A 4Q4OA 2VFFA 3TOPA 3WLQA 1HX0A 3H4XA 4CCEA 4H9VA 1FHUA 1MSSA 3RK8A 1J11A 3RITA 4KH2A 4QJ5B 3N15A 2QCLA 2D0FA 1W3TA 4GISA 2ZX9A 1ZP4A 5FKYA 1LOSA 1EGZA 1EP2A 2F6KA 3AIEA 4R88A 3B9EA 4MKNA 3MUXA 1VEPA 3VGDA 2ZA2A 3U8GA 4AW7A 5BWFA 2Z1XA 4AC1X 1QNSA 4QLKA 3QMTA 4O0KA 3UZWA 5CAHA 5T9CE 1SQ7A 1OD8A 4RL3A 3U5YA 3LN3A 5A3HA 1QPNA 2J6XA 4XAZA 1FH9A 3ZWTA 5HOSA 1QR7A 1BRLA 5FEZA 4QM1A 5M2FX 4MUZA 3T44A 3GC5A 3QXBA 1PDZA 4W8AA 4EXAA 3VA8A 4D6HA 1HFBA 2YB1A 3USBA 2CFFA 1J10A 2HRWA 3T2QA 3CWOX 4I9TA 3L2LA 2VEKA 2OT1A 3W6YA 3VUPA 1TR9A 1QNQA 1DHPA 1XLKA 2DUZA 3VOJA 3M1ZA 4POCA 2ZFAA 1DTUA 4TO8A 1VRXA 1YBQA 1B5TA 1KFKA 4OUEA 2B7NA 1GVRA 4WUIA 4DYJA 2HK1A 3UA3A 1JR1A 3UYIA 3WLMA 2C1HA 1UBPC 4HTYA 5KZ6A 1UG6A 3NQEA 3P81A 3WBYA 4A3HA 1XQKA 3WMBA 5M5DA 1TJ2A 6XIMA 3N17A 2QT3A 1UC4A 1YRRA 5CGTA 4AIOA 1DJHA 1XLJA 3N04A 1GZGA 4JY9A 1XLDA 1XRTA 2WNZA 3GXPA 2I9UA 2C7FA 3AJ7A 2OZ0A 4NP7A 4G7EB 1EPXA 1CLXA 4NUWA 3A9BA 1ISWA 3CBWA 3MCNA 1UD3A 3OU8A 3RJXA 2P8BA 2YYTA 2X16A 4AMAA 1FVPA 1H7NA 2HPIA 2DZVA 2GUYA 3SCUA 5DQPA 4ZOCA 4ROPA 4WOZA 3RU6A 1S3TC 4JKMA 3NQ8A 4Y2WA 4AG0A 4GYPC 4Y90A 2VL4A 3CZ8A 2OX4A 5I3IA 3T6CA 2NV2A 3OP2A 3GR4A 1B9ZA 3NEHA 3IVSA 4KCUA 3T0CA 4FAMA 2GQAA 1KTCA 5AVNA 2WVTA 1ZP3A 1LQ0A 4E2BA 2OTDA 1ITXA 4UOQA 4LBRA 1NAL1 1JEZA 3P14A 2D0GA 1E9YB 1EQCA 2J47A 1CGYA 1XRSA 1G6CA 4RZ4A 3STEA 1J0ZA 4IPPA 1JULA 1DIKA 2QF7A 3T0BA 1OF6A 3FK4A 3POHA 3W27A 2YCJA 1HKVA 2YOCA 3OZPA 3W1XA 2WHKA 4GC4A 3BG9A 4RDYA 3ARUA 4HJFA 4DVOA 1S46A 2F2KA 3BGJA 3WH5A 2DT1A 1AODA 3EGJA 5A8GA 3VOCA 1S38A 4B2DD 2YDRA 2EJAA 4TX8A 2DZXA 3PZIA 1K9FA 2C1GA 4UQBA 1HN1A 2AKMA 4OHQA 2Q8LA 1JCXA 2ISWA 2B7OA 1KBKA 4Z0JA 2QGHA 2WXDM 3ARTA 1WZKA 4EXQA 4S38A 1OCQA 4H8UA 2PCQA 1M41A 2YKKA 4FR1A 1KW1A 2W92A 3N2CA 2FDMA 3L68A 1UKOA 1XSKA 2OEJA 4JTLA 2GDVA 5F4WA 1I45A 4OECA 2Q8ZA 2G5WA 1XYMA 3EB3A 2BV9A 3C0QA 1V3KA 4CD7A 4WR3A 2CLKA 2GGHA 6REQA 3IAQA 3MKVA 4A8NA 4MM1A 3FDGA 1GZJA 5E70A 3UNDA 4TXEA 5FCZA 5LGXA 2C6QA 4ZQRA 4YNGA 1SZRA 3GNNA 3WN6A 2XM1A 3EWDA 4E4PA 2FVLA 3DIPA 1X39A 1Q13A 3N19B 1Y5VA 3DDMA 1IXPA 5CCZA 3OLEA 3PP7A 2E6FA 3NL6A 3A23A 1V51A 2EPHA 3WQ4A 3G1SA 4US5A 2GVJA 4ONVA 4ZSUA 1QCWA 1SR0A 3P5ZA 1EJTC 3OZYA 4LVAA 1YYAA 4DXVA 1HZYA 2CHOA 4KEVA 3UFYA 3MUZ1 4KWUA 2P5NA 5JXQA 5D9NA 3W24A 3FW6A 2FVMA 4GYPA 4EF8A 3GDRA 3MMWA 1IWAA 4GK8A 5IXEA 3KS6A 3R8GA 4BJHA 3WD0A 1MXGA 3CAVA 1RSCA 2VX5A 3WUFA 3UXDA 3S4TA 1E6SM 5A69A 4GGHA 2V3GA 3CAWA 3OVQA 4ADUA 5IOBA 2HXTA 3UBPC 1VYRA 4V1XA 1PTDA 3A4JA 2E9MA 1GW9A 1JPDX 4GGBA 1BWKA 4X2RA 4L65A 3RHGA 2X40A 4KT2A 4UR8A 4U4MA 3S47A 1RQEA 2GGGA 3GR8A 5FESA 4ADSA 3PZGA 2B4GA 1G69A 4D6IA 1S39A 3PVFA 4WRHA 3H2CA 2X0HA 1UR3M 2REQA 4M82A 2UWFA 1WDPA 2FYMA 4CCDA 5C8BB 4RNIA 2J7DA 1ICQA 4A6GA 1H51A 3IIVA 4H7VA 1VLIA 1MO0A 5K9CA 9CGTA 2V68A 4JTKA 4GXWA 3NQMA 3WDQA 3WENA 5EFFA 3NOEA 4LUTA 3G0XA 4JIQA 5HQEA 1B3YA 2PBOA 1KWKA 3GDBA 4G8TA 2JEPA 5REQB 2AAMA 2XFFA 3DKLA 3DFOA 4GNJA 5TD4A 3CPUA 3AWOA 1TTQA 3W2LA 3R25A 1XIIA 4C6BA 4OGZA 2PDUA 2PTXA 5AHMA 4JEQA 4UMCA 2Z1SA 3S9YA 2OKOA 3MHFA 4K2SA 3LGDA 1J5SA 4HSOA 2FGLA 1TMLA 3CH0A 3MV11 2BY0A 4FXSA 1P6CA 4KIRA 5E0CA 2BGNE 1ISZA 2XH0A 2FHBA 4JTAA 1VFUA 4FLSA 1FRBA 3LCFA 4NX5A 1J5TA 1H63A 1K9DA 1ONEA 5B80A 4CNOA 1J93A 1E5JA 2VVSA 5FF2A 2NWRA 3M6DA 2NSOA 1NOFA 2VZSA 1RY0A 2OZ8A 1JD7A 1E1CA 1OINA 4HPHA 4HSNA 3ITYA 3TE9A 1LBFA 4PMRA 4HHPA 1MWOA 4H6KA 1VGAA 3M4HA 1YDVA 4E8CA 1K02A 3M0YA 3A64A 3L65A 3HJEA 1OFPA 2A7PA 3S5SA 3SRKA 5F2GA 1H3GA 2A3AA 5DLCA 1TPH1 1R87A 1CW2A 1HF6A 2ISFA 5LIYX 4NU7A 1W1YA 1BWLA 4O1BA 1FWEC 3CIXA 4R9XA 4FNRA 3JW7A 1SW0A 1XBYA 2FZDA 4HOWA 4OBSA 2DH2A 3E5BA 1I9CB 3K4DA 1KR1A 3BLPX 1O68A 3L2IA 3M0ZA 1DJQA 1HG3A 1ZAHA 2YLLA 3UG8A 2XIQA 2ISVA 1ZZMA 1MNSA 1RAKA 4IISA 4BZYA 1S5TA 4OOUA 1VH7A 4UWMA 5DBUA 8XIAA 5EFDA 4H9YA 2EXOA 3M16A 3MVIA 5D8ZA 5I00A 4HA1A 1I0BA 4MLRA 3UR2A 4DWDA 2ACUA 1CWYA 4AXKA 1E9IA 3E2VA 4HJWA 3MUCA 5M3WA 2ZA1A 4YHEA 1VC4A 4E3TA 4Y8EA 3I68A 3KFTA 3AHYA 4R3UA 1LOLA 1GG0A 4RNJA 3A47A 2OSYA 1S1PA 2B7PA 5G1TA 2VXNA 4L7ZA 3URNA 3NQVA 3KHDA 2JQXA 4PBEA 1JGMA 3FA4A 2PSNA 3EOEA 3ZM8A 1XBZA 1Y65A 2ADAA 1VP5A 4PUJA 2NVCA 2QMKA 4JQ4A 2PDPA 4RE0A 4Z1CA 1VYPX 1MYRA 1QK2A 1LUCA 1ZNNA 1KCXA 4HZMA 4D1IA 3AROA 3R10A 2DIKA 3SZ8A 5D2XA 3MI2A 5FF7A 1K7XA 4B5WA 3FGCA 3W1TA 3GHUA 4R5EA 2VR4A 4QLLA 3M5VA 3WLRA 1ZY9A 4C7GA 3ES8A 4I7UA 2SFPA 3U2CA 1DJNA 3Q45A 2E5CA 4UC5A 1EJUC 1MQPA 5TAOA 2BY2A 4URIA 2OFJA 3W7LA 2XFRA 4QSFA 3UZJA 1FDYA 4HSHA 1PZ2A 3GIQA 4RDZA 3TQVA 3FEMA 3DG6A 3AQUA 3ZR4A 3GAYA 4PTNA 5DMYA 3MV01 1JDAA 4HCHA 1XYLA 1D3GA 5FJJA 2OLHA 3TR2A 5LA1A 4MOZA 3LCLA 1V08A 3S6TA 4PODA 5FF0A 4LAMA 3UEQA 1ZJHA 2TAAA 7XIMA 3A13A 4MY1A 5CPNA 3TJIA 3ZJ7A 3GG8A 1YXYA 1RLCL 1LQ2A 1HXJA 3GXDA 4ZB2A 3M0KA 3NEVA 2J75A 2Y89A 2O56A 1DWIM 4ADTA 1EOKA 2PPGA 2Z00A 3T42A 3PM6A 4GI8A 2VP8A 1N8WA 2W67A 3RR4A 4XO7A 3EDJA 3GO2A 3VM7A 2E6AA 4LV4A 3LSCA 7TIMA 3AIUA 4NHVA 2DZSA 1K03A 4S3BA 3W1PA 1K6AA 1S2UA 1PUDA 4HVXA 5D30A 1UR0A 2OQYA 3H24A 3LCXA 4EE9A 3MSRA 4N7QA 2NUYA 2WMGA 5CGMA 3NG3A 2EPKX 3B0UX 3HU7A 1O94A 4XTIA 5FJOA 3M0LA 2X42A 1GJPA 4UTMA 2VMFA 1TIMA 2PGWA 2WMHA 1NY1A 1SZEA 2ZE0A 3SCPA 1Q4WA 2PDMA 3W81A 3OQ8A 3T2OA 2ISSA 4FP1A 1BQGA 3F2CA 4HZ8A 3H26A 3VM5A 4WOQA 5AYXA 4Y9NA 1W9VA 5JQ9A 3MO7A 1FWIC 1PL9A 4LW7A 3VXGA 3BLOA 4W86A 3LSBA 5A2BA 3ZQ9A 3IARA 1TA3A 2Q8XA 3DC0A 3L66A 4GUFA 3WLSA 2DVTA 3W53A 3B3DA 2LLEA 3O0KA 1HP5A 8RUCA 4JDBA 2D23A 3ZVIA 3CZKA 3MCOA 3WL0A 4NYYA 1GHRA 4I9AA 4WDTA 3WDIA 4Q4SA 4L9XA 1CGWA 2XISA 1JFHA 1QI0A 5GJPA 4DYKA 3BMVA 4J3XA 8A3HA 4S3KA 4ZFMA 1LBLA 2CXGA 5I79A 3HF3A 3P60A 2EPMX 1D8WA 4L6HA 4QS6A 4FX6M 5DT7A 3WLHA 3IJ7A 2IUZA 5GNZA 3G1VA 1W1TA 4J4KA 2YCLA 3ZO9A 3RUBL 4H1ZA 1K8YA 5FEXA 1LUCB 4OBTA 2QMJA 4MY9A 4JX6A 4N4PA 5JBDA 3NGJA 5AC6A 1EP1A 3CMGA 2PBGA 1FWHC 4PL2A 3W7PA 1H1NA 4AX7A 3W01A 2OJPA 2AMGA 4U3CA 4IIHA 2GSJA 2VFEA 1WUEA 4HK5A 4XV0A 2ODOA 1ODUA 5HMFA 1EJWC 3B03A 4EAYA 1J4EA 2G3FA 2JKPA 3VKJA 4TVDA 3M6YA 2NQZA 3MT1A 2P10A 1HJSA 1EGVA 3LZ5A 4PR4A 1U1JA 2WZHA 4MAZA 4L9YA 5H8MA 3I6TA 4DM2A 5TNVA 3AISA 2BASA 4XAFA 1TFVA 1KB3A 2QDHA 2E40A 1UMYA 2V2HA 4CUCA 1U5VA 4S3FA 4YCPA 1XLCA 1HKIA 2YL6A 3GWQA 3JZUA 4UFLA 4IIEA 4O14A 3G2GA 3LNMA 2PWEA 3APGA 3LHWA 3F4VA 4C6QA 4G5DA 3AYTA 2ZXQA 4FHAA 1L6GA 2OYLA 3WLLA 1HL8A 1TPFA 3DYOA 3GUGA 4B9YA 4H9UA 1WKEA 2GOKA 3CZGA 4H9MA 1JL8A 5IBXC 3GVVA 3DGRA 4BWLA 4IQLA 2WK2A 3MA8A 3GYCA 1W6TA 1J2BA 2YB4A 1MW1A 4PCTA 1UASA 1GOWA 2XM2A 2E09A 4F3HA 2VWTA 5LXEA 1JXKA 1XYZA 4GJ1A 3NDYA 4XBJA 2V9DA 4JQ3A 5MF5A 3AOFA 1WXJA 4PTXA 1W9UA 3L4YA 1FWTA 1XIHA 3O07A 3L4VA 3BL3A 4HQVA 2ZVRA 4Q33A 3HQ1A 2DQXA 1UPMB 3FEQA 4DXXA 1BKSA 5LGZA 1B4EA 3R1ZA 3BCFA 2ZE3A 2HCVA 3N2BA 1NQKA 4K38A 4YTTA 2P50A 2OMAA 4JTUA 3RM9A 3TN3A 4D6EA 3WNOA 1GEHA 3SCNA 4M6PA 3CWHA 1N2VA 3K1DA 3NAVA 4HP5A 2QVNA 1J0HA 3GFXA 3EBVA 2QPUA 2PP3A 4QCEA 4MLJA 4A35A 1B30A 4IXHA 3Q58A 3IGSA 1I2QA 2NSXA 3WH9A 2I5GA 3CWNA 3S42A 4F79A 2VRKA 3GS6A 3WJSA 2POZA 5CXPA 4FXFA 2PFHA 1GQKA 4OKDA 2PUZA 1XBXA 3EEZA 2QNEA 3B40A 4PCPA 1ONXA 1R47A 4GI6A 2V5DA 2XH4A 4DO4A 3UT0A 4XG1A 3PFMA 4XZBA 1XRFA 4NI3A 3BG3A 1R3TA 3QQWA 3EWYA 2HS8A 3KTSA 1TQXA 1U1HA 1TPDA 3GDKA 3OGRA 1TMHA 1ZS2A 4M80A 1YNQA 1X1ZA 4UZUA 3MS8A 1XGZA 3MUIA 1XC4A 1SW3A 4LALA 4XAGA 4TV5A 1U1UA 2GJRA 2UY5A 2I14A 3CUHA 4HPXA 2BGQA 6XIAA 1EZWA 5MHBA 1L8NA 4NILA 4MUPA 3DU0A 1D7FA 4J1OA 4DELA 3TX9A 2PF8A 5G2WA 2A4AA 4QNWA 3LCGA 3JRKA 4UZSA 5I07A 3TW7A 4BQ4A 3QZAA 1Z7AA 3T78A 1XISA 4DJDC 5HNTA 4KCVA 2H8XA 2FFCA 1WDWA 3KL3A 1E4IA 3GXFA 2Z27A 3TNOA 2VR2A 2V38A 4LYRA 5IRPA 1RQBA 4GVHA 3K30A 1OFOA 1KXQA 4PN2A 3GTNA 5CKSA 2P8CA 3UGRA 1E4MM 4NYUA 4AC7C 3H2MA 2WCAA 3T81A 3SY1A 4WY0A 5BXSA 1NWSA 2ISDA 1DIEA 1A5NC 3B0PA 1WDDA 4KFPA 3CUIA 3NOYA 4DB7A 2E6DA 3RO8A 1XH1A 2YZRA 3PUOA 4QE1A 3PJUA 3HGOA 1DJZA 3IIOA 2WVSA 2VYOA 4PRRA 5G1YA 1R3WA 1TKKA 3UWVA 3ABXA 4HNOA 4GJJA 2HDJA 1ECQA 4JL2A 4O1CA 3ZIZA 4UNLA 1C8YA 2BHZA 3J7HA 3S2LA 3MPGA 1TELA 4HOZA 1BXCA 3Q65A 2EHHA 6PTDA 1P7TA 4U3AA 3GNXA 3BC9A 4V33A 2OB3A 1XHGA 3AIBA 3L9CA 2OGJA 1DE6A 3MJYA 2WO5A 2Y8KA 3ID7A 4PRTA 3RPDA 5SWUA 4M6UA 4PCSA 1PHWA 4H9ZA 4JN8A 3SUVA 1YXCA 2BODX 1EPVA 4YYCA 2FTWA 4N6FA 4B91A 3EKLA 2VFGA 3BAXA 3GW3A 3N6QA 3AXMA 4LBUA 1QXLA 1UWQA 3W1UA 5E9XA 5CLWA 1AQHA 1EIBA 4MWAA 3GTXA 4W87A 4NAEB 2X09A 3CJPA 4QAIA 3UPMA 1QFEA 4UB9A 3WQPA 4GY1A 5A94A 1D3HA 5HULA 3M64A 3B8DA 3T1GA 1AQ0A 3V1HA 1ME9A 2ZZ7A 4NJIA 1KFWA 5A6KA 4ZENA 4JY8A 1I2PA 2QULA 1Z6KA 4DJFC 3R12A 3PHAA 4BI7A 5CAKA 3KAOA 1SJCA 4UQ9A 2PU1A 3CHDA 4YTRA 3FNDA 3QEZA 3WDRA 3TNBA 1P0DA 2PD9A 2ZZ6A 3EA2A 3LU2A 4QS5A 5F1UA 3EEGA 1MW0A 4YS1A 3TSDA 2CBUA 3BW3A 5HPOA 2VFHA 2F38A 4S2BA 2Z24A 3VIHA 2QAFA 4NJHA 1C8XA 4PEKA 1UYQA 3DG7A 1RPKA 3ZJ6A 4IFKB 2DZUA 1KRMA 2ZRZA 4NZ5A 3HTWA 3ECQA 1SUXA 4J27A 2CBIA 1TZ7A 3IWPA 1MQRA 3NQ6A 3SN1A 4AY7A 1ISVA 1TWDA 4K8HA 3LPFA 3P84A 1XJBA 3PBGA 2FPYA 1IT0A 1V0NA 1Z41A 4PB5A 2VRQA 1AQMA 4XVDA 2PB1A 2OG9A 3BMWA 1J96A 1T6MA 4JNMA 2XN0A 3BV7A 3VDAA 5U4NA 1XDLA 4Z42C 1C92A 4NIRA 1RLDA 1J79A 4G56A 1EDGA 2PLJA 3SAZA 3IIXA 4GVFA 1Q6QA 1EX1A 4PE8A 2FHCA 5G4EA 2XG9A 1XIMA 4D1JA 3ZS4A 1E0TA 4DUWA 1E71M 5E9AA 2W63A 4ZXOA 4K37A 1L6WA 5I3KA 3FA5A 3NDOA 3JVAA 3ZZ1A 1CCWB 4ATDA 3HA1A 3XIMA 4L1GA 3NO1A 1W3HA 3ME3A 1T5AA 1R5YA 4KPLA 2ATMA 3LQLA 1PBGA 3SM0A 1DHKA 3QVQA 2J6VA 2DQWA 1G4TA 3S6OA 1NF0A 2XIJA 4D6DA 5T9BG 1V3JA 2EPOA 5AC8A 3IACA 3UXKA 3REQA 1JDCA 3M07A 2PWHA 4O16A 3P5YA 1RP8A 2C0AA 2FPTA 2WHLA 2NQHA 5H91A 3QC0A 1WO2A 2G3IA 3TV8A 1ZALA 3QH2A 4DF1A 4BA0A 3NPUA 1W8GA 3QOKA 1F05A 4H6QA 1NU5A 1SFJA 1SJBA 3WQOA 3VGGA 1NDWA 2NV9A 4WQ6A 3DZ1A 4HMEA 3UVIA 4S2CA 1KRBC 2FDSA 3KHJA 3TZNA 4ICNA 2BOFX 2PDWA 4JYDA 3W7NA 4Y9PA 1O5XA 3VIFA 4NZJA 5KITA 1XLHA 3ABRA 5I5RA 1UUOA 4ZCWA 3QY6A 4AYSA 5D02A 3VOIA 3TA9A 5I02A 4MF4A 1JZ8A 1OK6A 1QW7A 1EF3A 4ZE5A 2H6RA 4ICMA 5D37A 4AD0A 1W3KA 1A4LA 3P93A 1EC7A 2R1PA 3KBNA 1OG6A 3CQJA 1H7WA 4I5RA 4HA0A 2IKGA 3AALA 1GT8A 4LBSA 1E6PA 4IIGA 1N55A 2QZRA 1X7IA 2YZ5A 5BW6A 4ATLA 4G1NA 3V5CA 1CZ1A 1LORA 3W0KA 4O8RA 3CB3A 4J28A 3S9IA 3BCJA 1RJRA 1A0EA 1ZENA 4AF0B 3FHQA 2O9TA 3N13A 2WC4A 4D8AA 2PURA 3W25A 1JJKA 1KKRA 2A3HA 5L9FA 4GINA 2R1KA 4LAOA 3N9RA 5DCEA 1S2AA 4L5ZA 2ZUUA 1BXNA 7CGTA 4L80A 1UZHA 1V77A 3S1XA 3ABOA 4NF7A 1VCFA 4C1KA 2PDNA 4IL2A 2OXNA 2AL2B 3UNTA 1GYNA 1XIFA 4HTBA 1E43A 2Q6ZA 4IJRA 4HA3A 4JYFA 1H49A 1TTIA 5JIPA 2W79A 1LP6A 1AMKA 1J9YA 2Y70A 1PO9A 3U9IA 1ZCCA 1HJWA 1EWEA 3AS0A 3WQDA 2QCEA 2WWDA 1P6WA 2QCNA 5D05A 1AD4A 3NM3A 3CQIA 4Z0SA 1E73M 2DJXA 3K46A 4DPPA 1MNZA 2OWWA 3H4WA 1SVDA 3VDGA 2RJHA 1MUWA 3LBMA 1YXDA 1TUFA 2XTKA 4WDUA 3C2YA 2FZ8A 1KBLA 1KA9F 2WMIA 2ABAA 2JK2A 1Q6OA 1XYAA 2DH3A 4BFAA 4B9ZA 3FXYA 1HGWA 3FN9A 3L4TA 1U30A 4CEXC 4O54A 4DZHA 1F3XA 4NT0A 2ICSA 3NQGA 5C9UA 4GNKB 5I24A 5C55A 5DX7A 1G0CA 5LNSA 3LDVA 3DBPA 2EGZA 1VHNA 4Y7EA 1XUUA 1NVMA 2V5CA 2PDQA 2RDUA 2QV4A 1XPGA 3CHEA 4CQCA 4ZFCA 3GH5A 4B2DA 3WMCA 2YFNA 1KXTA 1FHVA 3DG3A 1I2NA 3JS3A 1WDSA 3QPYA 1JQVA 4J3VA 3CQ0A 1VPXA 3KCOA 3GH4A 2HBVA 3RG6A 3U2EA 2BX7A 4LY4A 3G3DA 3CV1A 5B7YA 3WELA 1CBGA 3VU2A 1V6UA 3N1AA 3PTMA 3PTKA 4PMVA 3L4XA 5I09A 1HJVA 3ZT7A 4UTJA 4IFKA 5I6SA 1V3HA 4MMWA 2VCAA 3F4CA 1IHIA 3PULA 4GLEA 2O4QA 3KVJA 3UA4A 4U5KA 2GQ9A 3MUY1 3GG1A 4GKLA 5BU6A 3RPMA 1TPC1 2F6XA 3NXFA 1LJYA 5J5RA 3ITVA 1XKJA 2O7QA 1PKYA 3M0MA 2FPVA 1WXZA 2BOEX 1TV8A 4DJEA 2I5IA 4GFSA 3WEMA 2WZMA 3SCWA 1P5BA 1HO4A 4AWSA 5DMMA 3QPEA 5HAOA 5FJTA 3OPSA 2VEGA 3NFUA 4I90A 1T99A 4UR9A 4DEFA 3MP5A 4WCJA 2FVKA 2VHLA 3DESA 4PGLA 2Y7FA 1R85A 3S0CA 2C0HA 3PSWA 4HK6A 1S2WA 5EGRA 4JCMA 4MYAA 3NQFA 4H8HA 4ZQCA 1XINA 1DWJM 1W5PA 1TWIA 3N2TA 4GX9A 4UFHA 3HGRA 4PUMA 1Q66A 4A3RA 2OSXA 1K77A 3PR2A 2CLHA 1A5BA 4S3DA 1BF2A 5FL1A 4QX4A 3S1GA 5A6MA 1K9EA 5CQ1A 2WM0A 1US3A 2PC8A 2KAUC 4KS0A 5A8NA 3HOJA 3PJWA 2IKHA 3TYAA 4JIEA 1CI1A 3PANA 1CTNA 3R79A 1M01A 1RH9A 5EMLA 2QCGA 2G4JA 3PZTA 3WF0A 2VGIA 3ATZA 4A4AA 2QUNA 3SUSA 4Z1DA 4EIVA 4FS9A 4P8VA 3PBMA 1R0MA 3UPWA 1CENA 1T41A 2P3ZA 4PH6A 1QK0A 1YNYA 1RK6A 5CJNA 1IEIA 2V5BA 2HBXA 3PG9A 3W07A 4RPPA 3TC6A 4Z2GA 1Z48A 3CUXA 3L4ZA 4PMUA 3USZA 3HG4A 4Q4KA 5E0FA 1KGXA 4UQCA 1UQZA 3MP4A 5FOOA 5H8UA 5AECA 3BJFA 3MW7A 3CS2A 3VMPA 3QHOA 2X41A 3INPA 4E8DA 3B9OA 2JE8A 3BCDA 4N2YA 4ML9A 3TTQA 5KEZA 2AQOA 5HMEA 1K8CA 3V16A 1N7KA 5D9OA 3E74A 1FXPA 2CC0A 4C6EA 2ZRWA 4MNMA 2OQHA 1F07A 3R0KA 4FIQA 1TJ1A 4OFCA 4UTKA 1YTKA 4MB5A 3RNDA 3FA3A 4H8NA 4LY8A 1XV8A 1CIUA 2P0OA 3PZMA 1B2YA 3LXCA 3V75A 4DN1A 4LC6A 4ZE4A 2QKFA 3W28A 2WSQA 4JX5A 1TTPA 2Y2WA 3TYCA 3W76A 3L0KA 5BNKA 3W7OA 4C6JA 3MYPA 3WG6A 3ALFA 3G8EA 1L6FA 3W1QA 3MBFA 1X6LA 3WNLA 4AHQA 4KQNA 1IXOA 3B4UA 5EMJA 3ARQA 3IVTA 2UV8G 3DECA 3E3HA 2ZUVA 1ZTVA 1SJDA 3TONA 1QTWA 2JEQA 3OGSA 3S3GA 4DLMA 4NZFA 4DJED 3M47A 3DFPA 1Q2SA 4UR7A 1LLOA 3S1VA 2V5KA 1JXJA 1M7XA 4YIWA 1XYCA 3HMCA 3BE7A 1QBBA 4JOMA 3AI0A 1PX3A 1YDOA 2OOGA 3SJ3A 3ITCA 5AZ1A 2ESCA 5E6ZA 2DT2A 3BK0A 4WKHA 3RCMA 1XPYA 3O6DA 2Z25A 2CZEA 1E3XA 3WKZA 2J27A 5HNRA 2XH2A 4NY2A 3CV2A 4ZB5A 2GVEA 1UWUA 1OX5A 3SECA 1W1ZA 3NJ3A 4MWAC 5DMNA 4Y8FA 3UPBA 4NZ4A 3CL6A 2ATSA 1W1VA 2WOQA 4O13A 3BARA 4HHMA 2OX1A 3EKGA 1GVYA 3R8RA 4NASA 3RCYA 2KX9A 1KXVA 1ZUAX 4MFDA 5CG0A 1BTCA 4F40A 5HUOA 4HU4A 3TXZA 4NZCA 1UZ4A 4JD4A 1EA9C 1GOOA 4MJ2A 2ZRXA 4B3KA 1HP4A 4WY0B 4L56A 4PMJA 2INFA 4XD6A 4FR6A 3G0UA 3HG5A 3IJIA 2WPBA 3D46A 2A1YA 3BAKA 4J3WA 3OB8A 4JTDA 3LCHA 4FIRA 4E0CA 1F5ZA 1JPKA 2DZAA 2WHJA 3C2RA 3ORWA 2VUNA 5KMYA 3C2VA 1OFBA 2RAGA 1IT8A 1XI3A 4GIRA 2V6AA 3PJXA 3WDHA 1QW8A 4HYVA 4KIEA 1I2OA 1SJAA 3NNTA 2GK1B 3R2GA 4LGXA 2JALA 1N8IA 5HMDA 1F2JA 2PLMA 4FNUA 1OIFA 1V0KA 2VDIA 2J79A 4Z2IA 2F6UA 3TYEA 2VWSA 1L6SA 4TX9A 3K8LA 3VNKA 4IPJA 2WMFA 1YTDA 4Z1BA 3SCOA 5K4ZA 3R6IA 1VF8A 1THFD 1E9ZB 2XVKA 1P0EA 2YJQA 4CU7A 2YBUA 2Q09A 4MYXA 3TOYA 4AIUA 1AD1A 3C52A 1UOKA 4OV4A 5REQA 4AY1A 4QITA 3VUSA 1KLYA 3AYRA 4IMAA 3H22A 2DZBA 1L2QA 4RR4A 5D2YA 3DYPA 3H55A 3HPZA 3OQEA 3I4KA 4UCFA 3QM3A 2WKGA 4R33A 1XQLA 3KBWA 1SZFA 1W56A 1EQPA 3H2NA 1A49A 3CYJA 4LYKA 3N3MA 4F2BA 4XD5A 3RM4A 5C9ZA 1JQXA 3CUGA 1KM4A 2VEIA 3W2JA 3BZGA 1OC6A 2O9OA 3EOOA 1EB3A 1BG4A 4QE4A 4B5NA 1H41A 4DWSA 4E6MA 3B0YA 3WL1A 4HIBA 4WGHA 3FAXA 1OB0A 4MAVA 1KCKA 3HO8A 1QO2A 2BVYA 3DFQA 1H60A 2X7WA 1JI2A 1OFRA 2J7CA 2GWGA 1R86A 4Q7BA 2HVOA 3GR7A 3GM8A 2WJFA 1YDYA 4JS3A 4XISA 4XAPA 3CUFA 4H19A 4JXCA 3SGGA 4EX4A 2J74A 2IPFA 1EGMA 3OLGA 3N11A 1SO4A 3CZJA 3QPZA 4MY8A 3OODA 3G3MA 2X2YA 4AD2A 5C7VA 3FAWA 3TTOA 1JF5A 2ZICA 4C5YA 3PTDA 4DWSC 2GJPA 2E67A 5EKYA 4MKVA 2BVDA 1X1NA 5BYWA 1FCUA 4UMBA 3HFTA 4ZOBA 4HGXA 2CLEA 2W62A 3IV8A 3M5YA 5KSWA 2ACRA 3STFA 2V67A 1UA7A 3UERA 1Z42A 2V81A 4PC8A 4Z08A 3A4WA 5AYYA 4IMFA 5DRCA 1EOMA 2YL8A 4FZIA 2VO5A 5D38A 1E55A 4ALDA 2AKZA 1P43A 3D47A 1Y8BA 1M7JA 4C90A 4JGDA 3WY1A 5AFDA 3QV6A 1UP2A 2CESA 4UFIA 2W3ZA 3U4FA 5J04A 1A3HA 2WKLA 4J35A 5CH9A 2XIOA 3MB9A 3V18A 1A5UA 5AYIA 1Q4NX 1JCYA 5FACA 4GKTA 4JFWA 2DVUA 5DF0A 3B04A 3E0WA 1B9BA 1H7RA 4DZ5A 2DUAA 1EJ7L 2REQB 1A3XA 3GH7A 1OGSA 3THAA 3FLUA 5HQLA 4NNBA 2XDFA 1XD0A 1XRVA 1CX9A 4K6AA 4GIEA 3L5MA 4EPEC 4ZTYA 3ALGA 3U2ZA 4H2HA 1W3IA 4PUDA 2XSBA 4DO6A 4C6NA 2VD9A 4GYKA 4FO4A 2DZPA 4AZGA 4XWUA 2PDYA 4F0MA 1FCBA 3QLDA 4O52A 3ARXA 4XZWA 1TWSA 3F2DA 1V02E 1KV5A 4YTUA 4R53A 3IIZA 4JTRA 4UTTA 1E3ZA 3R5EA 4GOAA 3H7VA 1I2RA 1RJQA 1ESWA 2P0IA 5F2IA 1Z32X 4J3TA 5ECVA 1JRBA 4TV6A 1M7OA 2PE4A 1SO6A 4IMCA 4TOQA 2ALDA 3QBUA 5LSMA 1SO5A 3SO7A 4D6GA 4TX6A 5I2UA 2ZKMX 2J9ZA 3VI2A 4UQAA 3NQCA 3DKJA 1GVFA 5DN1A 2UY3A 3RX2A 4L1XA 2Y24A 2PF0A 1LL6A 2WQPA 3E12A 2ZXBA 3WBAA 6ENLA 1ADOA 3UWYA 5DANA 3WD2A 4HBKA 5T8GA 2ZQ0A 2A0NA 4W7UA 3S1UA 2NZLA 1TUXA 3MSDA 1DWFM 1ISYA 3OG2A 4H04A 1PIFA 3GLCA 4CVWA 1FFRA 3O63A 4V2XA 4UBPC 1NWTA 1AZ1A 4XZIA 2WC7A 4DUOA 4US5D 2Y62A 1ONWA 1A5LC 2Y6ZA 5DCDA 4QXIA 5G4HC 1CT5A 1IEXA 1KLZA 2XN2A 3SSZA 3NTYA 4JL1A 4YTQA 2FMOA 2OGYA 1OYAA 3D6NA 3VZXA 4JICA 2HEJA 1EFZA 3LGGA 3TROA 4H00A 1XP3A 4F9DA 4J40A 1IWBA 4WKFA 5M03A 2JFEX 1EC9A 2UZ9A 2FIQA 1WPCA 3G1XA 5IFTA 3MZ2A 2HXUA 1R3VA 1BSLA 1VR6A 5LNRA 4RW3A 3ZLFA 1ICSA 1DIOA 4JAWA 4JQAA 4M8UA 4MDPA 1V79A 3KXQA 3VOHA 2J62A 1OG0A 2W27A 1KC7A 5HWNA 3OYXA 3QF0A 3UG5A 3VX0A 5AKQA 1PKLA 3T0DA 2FJKA 3LY0A 3OVPA 2RGLA 2CNCA 2HTMA 5FL0A 3ZXWA 5C2GA 1A50A 5GNYA 4IOTA 4FNQA 5HDRA 5G1MA 1F6PA 4WDXA 4QEHA 1XCFA 2G37A 4LOCA 5CLTA 5E1QA 9XIAA 4J3ZA 4L6DA 1E6RA 1VS1A 1SW7A 4A8LA 1MXSA 4ZQNA 1US2A 4DUVA 3M7WA 4MSSA 3AZTA 5HANA 1H5YA 5XIAA 1QDSA 1LRQA 1Q45A 2D20A 1YEYA 1P4CA 2E8YA 4UNKA 1IIGA 4LVBA 1EF2A 4DBUA 1LG2A 3LLDA 3MI6A 3H2FA 4JNYA 3UJ2A 4DWSB 1DL3A 4QTGA 3BW2A 3O06A 1TV5A 3VDHA 1J0KA 3LD5A 3GZ3A 4H4IA 3W9ZA 3THDA 3FJ6A 3MI3A 3IJ8A 2PDXA 2ZZ3A 1J0YA 3COTA 2POTA 3W1AA 2A5HA 3KP1A 3CM4A 1CECA 1S5NA 2IXVA 1G5AA 1NDVA 3A5VA 1FDJA 2BP1A 4YU1A 3BO9A 4DYEA 3NQDA 3GTHA 3RPTA 1QW9A 4DNHA 2R6OA 3C6CA 3PSVA 3ZWSA 3PJTA 4L4MA 1VFSA 3CPGA 2UY4A 3UZXA 4H3DA 3UF9A 4HU0A 1Z3NA 1IV8A 2WC3A 2J77A 1BVWA 2NXIA 1E6ZA 4UTIA 4I5XA 1FP8A 1GVIA 5D32A 3GNPA 4HPNA 3GW0A 1QNPA 1VEMA 3WH8A 3OG3A 4R85A 1RK5A 5D04C 4PMNA 1OX4B 3OJGA 4JEJA 2QUTA 1FXQA 4GC3A 4Z2JA 3LOTA 4C6DA 1QJWA 4QLJA 4YYFA 2IW0A 2V5LA 1F4AA 3TA6A 4C1LA 4LT9A 5EMUA 2A3BA 3W4RA 2CLMA 4CVUA 1KM1A 2V69A 4BEQA 2NQJA 3TTEA 1VPYA 2GGIA 1IR2A 3E0FA 3QLLA 2W9MA 4INFA 1QAPA 1W0MA 4X60A 3RMJA 2J7GA 3MMTA 2E28A 3GNOA 2YXOA 3SQMA 1LZOA 2QHAA 3KL0A 3R94A 3ZVHA 3TU9A 1NEYA 1MZHA 4GZJA 1VRDA 3NVDA 2O92A 3FY1A 4WLCA 2J8GA 2Q71A 2BXVA 3PBVA 4LS1A 4LYQA 2HSAA 2C8NA 4YXGA 4UQDA 3ATYA 1H2JA 2PWDA 2ZIDA 1F3TA 1BXBA 2OR2A 1DIDA 2X1IA 2PDJA 2Q01A 1HJQA 3W1MA 1R38A 4MJ4A 4G2DA 4MJMA 3QW3A 3TAOA 3ZT5A 2ZTJA 1UUMA 1I0DA 3VGFA 2DGAA 3RX4A 1VENA 3T08A 4JTTA 3EWXA 1M68A 1XSIA 2CLIA 4HNCA 3MCMA 1TJRA 3N18A 3RJYA 1R3SA 1GUVA 1J8VA 1AJ2A 4JIRA 2DSUA 1VCVA 4IPIA 1E6NA 2OO6A 4AHOA 4RE3A 3S8HA 2ABBA 1VD6A 3EX4A 3E1F1 4CEUC 1T8XA 3KZPA 2Z2UA 1YE6A 4RZ5A 3OHIA 3R11A 3OA5A 1XIEA 2J9YA 4OE7A 1JAEA 5EMKA 2JKAA 3H12A 3PPGA 1EIXA 7REQB 4NX0A 1A5MC 1X8CA 4PL1A 1Z9AA 3G1FA 2QXWA 3KVKA 4WEVX 3BQ5A 3W88A 3VD3A 5D09A 2WQDA 2NX1A 5CC3A 2C15A 1E1FA 1IIHA 3RMEA 3VPLA 1Q6DA 3AZRA 3BLIA 4AEEA 3AZSA 1JI1A 1DXIA 3UG4A 4TU1A 1E0WA 5JIWA 3RN6A 1NOWA 4CN4A 2W4XA 2OKTA 1I60A 1OZQA 4FXRA 3T4CA 4IUGA 3S2NA 3ELFA 2E68A 3UGVA 1QOXA 2GL5A 3AJXA 1JPHA 3AUOA 1B90A 1UD6A 3MO4A 1G4PA 2XN1A 1E15A 1TO3A 3IUIA 3LEPA 2ZUWA 9XIMA 5DY3A 2OELA 2PTZA 4F0KA 3TSBA 4Z1AA 3HM7A 2H8ZA 4GBDA 3EDKA 3TLQA 1TVPA 1XSJA 4X3ZA 4LRTA 2RDTA 4S3JA 4AQLA 5FJIA 4C6MA 4LXFA 3TFXA 3ZOAA 5LHEA 4BS0A 2Y85A 4X9YA 3TQKA 3EPMA 3L12A 4O28A 5HNUA 3R4IA 3D5HA 2VZUA 5E09A 4AD5A 4U2ZA 3SCVA 3B9DA 3RU8X 3DH7A 1EA0A 4YCOA 2J78A 3UJRA 3WLIA 2QIIA 3M0VA 4TR9A 1C93A 1UWRA 1TCMA 4J3UA 4BF5A 2TSYA 3MSGA 1L0PA 2VT0A 3W6LA 1M04A 1E70M 3LPPA 3ANUA 2EQDA 2DSKA 3XISA 1GYLA 2GQ8A 2JGYA 4G6CA 4LTSA 2DSVA 5FF3A 5ABFA 3NYZA 3QR1A 1Q2RA 3B8IA 4C91A 4LB3A 2GDQA 2VOTA 3DHFA 3SQSA 1DOSA 3HMJG 2PU0A 1IEVA 2CLPA 1TPEA 1OWQA 1V6TA 4HCLA 3PB2A 1DJWA 1GEQA 3BSGA 1M5WA 1GONA 2E4TA 3QTGA 4Y96A 5K3VA 1O1HA 4X9SA 3LS9A 1IYXA 3LLXA 4IP7A 2VI0A 5HXMA 4Q8MA 2EBNA 2J25A 4AD1A 5MKGB 3ANYA 1CB2A 3BLEA 3QJAA 1SPQA 5EYWA 1LM1A 1F61A 2NW0A 1K7EA 1OY0A 3PZNA 3ZR6A 1QOPA 3BLLA 3W3OA 5CBJA 3GVGA 2OYMA 2PD5A 3MWCA 8CGTA 1W5MA 1UR8A 5IBXA 3RCNA 1W54A 4GUJA 4EPKA 4XUYA 1Q7ZA 3U4AA 4KERA 2TODA 2DIEA 1QPKA 3VC5A 3HN3A 2EKCA 4IQJA 4U31A 3F5LA 2Y0FA 4W88A 4XUGA 1UKQA 3CZLA 1EC8A 1XLLA 2WMJA 5C9XA 1XKYA 3QV7A 1IZJA 2QJMA 5FD0A 1XYFA 2JF6A 5BROA 1BYDA 1TCDA 1UW9A 1JGIA 4HPJA 4FPSA 2WNQA 2ZDRA 3CPRA 2PCEA 3HJZA 3ZJ8A 4U5IA 5M17A 4M24A 1C8VA 1WAUA 4BK9A 3QOMA 3F4WA 3GDTA 1XFCA 1R9ZA 1LL4A 1CLKA 4YLWA 2X0YA 4CN1A 3NPXA 1ME7A 4NNAA 3KUMA 1MW3A 1IZKA 2Z29A 1HKKA 3T0TA 1AK5A 1Q8JA 4MDOA 4B5VA 3PPFA 5K9XA 2CKSA 3N4AA 3NSNA 2HNHA 3T7VA 2PLKA 2XU2A 1CXHA 4XKMA 1UIOA 4BWLC 4IGMA 1HO1A 2J4GA 1AJ0A 1FKWA 1WBJA 3NZGA 2QAPA 4MNLA 2NQ5A 5A8PA 4IWWA 3R13A 4E3VA 1WZAA 3F4NA 1BFNA 1J12A 2CIPA 4WVXA 1Q6CA 3SUUA 4W7VA 4JDYA 2QDDA 3P7YA 1BGGA 4CD4A 4XX6A 4EVZA 1K1DA 2NX3A 4F2UA 1DJXA 3QN3A 4LH8A 4CGTA 4ATWA 5JMUA 4TTUA 1Q8AA 3WJYA 1HJUA 4XZMX 2EEXA 5I3FA 4EOUA 1FQ0A 1BWVA 3O9NA 1SFTA 3IIPA 3M5ZA 3PUDA 4IL0A 1LWJA 1GZ1A 2CZFA 6A3HA 2PP1A 3N4EA 3ZR5A 3WBEA 4F0SA 1AVAA 2Z6IA 2WAGA 2H3BA 3ONCA 3WDJA 1GJUA 1EP3A 2X0SA 1TZ9A 3PPCA 4XQ6A 1V0LA 4ZO6A 1FWWA 1ZJBA 2AGKA 3EAUA 4KMQA 3ZLHA 3SCSA 5F2MA 5AHFA 2CU0A 3VK5A 4Z2KA 1EHAA 1QI2A 2Z0IA 3KOYA 3PBUA 2CLFA 1UR2A 1VEOA 3PZVA 3BOLA 3LM3A 3W37A 5CSSA 4FB7A 1XH0A 2Y5EA 1B0IA 2E6YA 5KETA 1UCWA 1O66A 5C54A 4AH7A 1EH9A 3DEQA 4M81A 2VUYA 2GVYA 4W4QA 4DI9A 3VIGA 1MRQA 3PAJA 4GY7A 4I9MA 3QZ6A 4NXKA 4OU1A 1Q6FA 3A12A 3LGEA 1XX1A 1C90A 2DT3A 3SCTA 1UWIA 3KTCA 2RH9A 2CBVA 3WNPA 4A21A 4PUUA 4IP5A 4RNHA 4LANA 4F0RA 4HNTA 3I3DA 3I65A 4JN7A 2Q3RA 3AXKA 4X22A 2NV1A 1W2VA 2A2IA 4LAZA 4QSHA 2PC4A 4A3YA 4HMCA 4IQEA 3WF2A 3IVUA 3PN8A 5AYZA 4Q8WA 4GABA 1GKQA 4J9JA 3D3AA 4E4UA 1SGJA 2F9RA 4Q8TA 4NSBA 4B4HA 5DY2A 3EPOA 1SM9A 4LRSA 2PTWA 2A3CA 1G4EA 2AAAA 1J0IA 4KGLA 3GAKA 4IX0A 2ZVIA 2P3EA 3KOFA 4E2DA 1FHLA 4DBSA 3SCRA 4GIAA 3TDFA 4LVDA 4JZ5A 2Z1WA 3VCNA 3G1DA 2EAWA 4XZLX 2ACQA 5A6BA 4N9DA 1KFBA 3HG3A 2VDGA 5JU6A 3FV9A 4H01A 5A2CA 3S83A 2E7FA 2PWFA 3EOUA 3MVTA 4BF9A 3M41A 3CZEA 2QS8A 1WZMA 3GHRA 3E02A 3IK2A 4U28A 3O6AA 3UCDA 4LX4A 4XK2A 4GI4A 1GTHA 1XIJA 3FIGA 1FY6A 2X2GA 4LUSB 2PRMA 4LUIA 3VKCA 3DBNA 3ISIX 5CSYA 3SN4A 3ARWA 3TJ4A 4TMBA 2G3JA 4WSJA 1A53A 1MFUA 1XLBA 3GXTA 2DP3A 1Y7VA 1I1XA 1VFHA 2R1NA 3BDKA 4Q22A 3EZ4A 4MB4A 1RALA 2PLCA 2UBPC 5JH2A 2VEFA 4J2PA 1BPLB 1P1MA 2YA1A 4N9CA 1PEZA 1F3EA 1FFQA 2R1LA 3PK7A 1CXLA 1RCOB 1ZBKA 4EXBA 4MZ8A 5BRPA 5A6JA 1PE1A 4RNFA 1RBOB 1JYXA 3DHDA 2CHNA 2A21A 1CDGA 5F2LA 2XVNA 3CASA 1OGGA 3VNLA 4QG9A 3CK5A 3WBXA 3ZT6A 5BU9A 4DY1A 1NF7A 3SCQA 6TAAA 2G4FA 4IHCA 4YMZA 2FB2A 1DWHM 3RF9A 1GPFA 3QC3A 3LV5A 4PFMA 1W3JA 3IJQA 3ARPA 1AH3A 1QU4A 1LG1A 4GCXA 5DFAA 3UVAA 3VDBA 5AVHA 1U2YA 2DVXA 1WX0A 1VJSA 1S2CA 3O6YX 3S1WA 3QSRA 4QISA 4OBRA 4IH3A 3P8IA 1LDCA 1C7TA 4CU6A 4US6A 3T55A 4PUWA 3EDFA 4OT7A 1LT8A 3UJFA 2F7FA 3S5ZA 3IUDA 2PGEA 3MTWA 2BHYA 4X61A 4REQB 3N34A 4Y6GA 1XXXA 3QFWA 1NELA 3UR7A 1UD8A 2EO7A 2ZRVA 3VNDA 1P0BA 3VKKA 4JIPA 4HKPA 4DZIA 3SURA 3CO4A 4AEFA 2Y8UA 5CC6A 1ADSA 1XLIA 5HNNA 4C6FA 1JPIA 3WK2A 3W2MA 4QR6A 4BQ2A 2FZBA 3QW4B 3SIMA 1TTJA 2HZGA 3A3XA 1KM2A 3WJWA 2CEQA 2A85A 3GG7A 4GO8A 2HE5A 1P0NA 3MDUA 4JTHA 2E9BA 1PWLA 4C1NA 4H6EA 4H9XA 5BOEA 2VJXA 2CCRA 2WBKA 3GC4A 4DQWA 2ACSA 1FTXA 3BICA 3K5XA 3QQ0A 4KEZA 4QDMA 3WLNA 2EKGA 4LS2A 2YFOA 3TN4A 4XIAA 5A6BD 4K7VA 4NI8A 3RIKA 3T09A 3S5NA 1TPB1 3E0VA 4AZ6A 3VIIA 1UKSA 5L6UA 1OFEA 2R1MA 4RJEA 1G1YA 2VDHA 1SMAA 4O12A 4W85A 4JX4A 5DBTA 4AY8A 1VB9A 1AW5A 2PRHA 1X8FA 1MW2A 5CC7A 1FX6A 3UG3A 3LI1A 1DE5A 3TYUA 3VC6A 1ZHAA 5A2AA 3U7BA 3RX3A 1R2RA 3CH9A 3UXIA 3QQ1A 1GKPA 2A6NA 4DWSD 2I16A 1XM3A 1OYBA 4LUSA 2VCCA 2DFAA 3M9YA 3THUA 1GHSA 1TE1A 4LCQA 3ITTA 3IJ9A 4H7CA 1K4GA 3PB0A 1VJZA 3PC0A 4KW2A 4ZZ9A 2C19A 4KCTA 4KGJA 1SSDA 3P0XA 1BG9A 1XDMA 1DJIA 3L2MA 2GSEA 4LPCA 3LRMA 5BXTA 3SADA 4M6VA 1EKOA 2G96A 4OIFA 4FF5A 1EEXA 1JDFA 3W38A 5FJUA 4IQDA 4J7RA 2WJZA 3VGHA 2WPGA 3B4YA 4LS0A 4DBWA 1WQ5A 1ZU8A 4P2VA 2YL9A 1AL7A 1XR2A 1X6UA 2BY3A 5E0KA 3I6EA 5G4WA 4UIOA 2VQTA 2NUXA 2X1UA 1O4UA 3DOPA 1YPXA 3RGTA 2Z6JA 5GQBA 1OK4A 3E6EA 4GYJA 4GXMA 2GVGA 4NVTA 2QUMA 1QHPA 4LUYA 1OM0A 1ADDA 3GRIA 1VIZA 1T40A 3GVRA 2G41A 5I03A 4MTVA 2ZUMA 3I6RA 2GQ3A 1SFLA 4MB3A 4TTGA 3ZSSA 3N73A 3Q37A 5ECUA 2DPEA 4G7FA 3CIWA 1ZSXA 1FWRA 1KTBA 1F8MA 5J8LA 5C5YA 3AHXA 3QZEA 4DNMA 4AFYA 4IM4A 3CL8A 1RPXA 3KDOA 5BRQA 1A5KC 3KBMA 4Y9MA 1V03A 3A21A 3LNPA 2WLZA 2HWGA 5D8WA 3F03K 5DXXA 5C2CA 1G4SA 4JHOA 2J8FA 4LNYA 1VFMA 1XICA 2B0MA 2CBJA 3RRXA 1NFBA 1YNPA 4E4FA 1I1WA 1V6XA 4UTTC 4IGHA 3BWWA 1B4KA 3SIZA 5EY5A 4PULA 3NM1A 4YPJA 1U5JA 4ROQA 1DP0A 3CNYA 4M51A 4NJJA 5DO8A 3WEZA 1H1YA 1EWDA 4C6KA 1BTMA 1XL9A 3VKAA 3SY8A 1MUCA 5D4YA 4ECLA 1MDLA 5HR6A 3FCPA 4ENLA 3KX6A 1JZ5A 3VD7A 2BSLA 1R9YA 3W71A 2XVPA 5BMWA 1K8ZA 2WVVA 1ICPA 1DWAM 2OCZA 4AU0A 4MADA 3LX9A 3GDLA 5IM51 4HYRA 3ARZA 3SRFA 4WKAA 4WK9A 3CQKA 4PYSA 4FNSA 1WYIA 4YWIA 2HPMA 2XGBA 3KTXA 3BPWA 2INZA 3VKBA 4CNSA 1XD1A 3VNYA 4S3AA 1T96A 2FB3A 1TPWA 4HNUA 3W7HA 2Q3OA 2VRJA 4AVFA 4PCFA 4AEOA 1E4LA 3R8HA 1EBHA 3PNUA 1PTAA 3RDKA 2YCEA 4QG6A 4AMCA 3RRAA 2HNEA 4L9ZA 3WJZA 2C3ZA 1JCMP 1F7BA 4ZXLA 1E6QM 3GBDA 3QYQA 3WQEA 4CN6A 1S2TA 3URBA 1OCNA 1H09A 4C7DA 3AMKA 3MUAA 4RDWA 3GHSA 1RVGA 4C6LA 4B5SA 2GPTA 2VZTA 1VBHA 4E2OA 2XIMA 4IIDA 1E4NA 2VGBA 4AZCB 5FSEC 2ALRA 1GVOA 4LWWA 3OO2A 3O16A 5AC4A 2EJ1A 3C5QA 1LRNA 3GTIA 4RX0A 1UD5A 4RZ6A 1VBRA 3N4FA 4WXYA 2VGGA 4P7LA 4CD6A 6ALDA 3DFTA 2ASHA 5D2WA 1Q7MA 2OQLA 2AL2A 4REQA 2JIEA 3UR5A 1IEQA 2ZA3A 4H8VA 1L2UA 1F76A 3LB0A 1XBVA 9RUBA 3O1NA 1E9LA 5LA2A 5EBUA 3MBDA 5D9PA 2B7QA 1SFSA 2C71A 3B06A 2HQAA 2L5HA 5CPSA 4LNCA 1PXGA 3SUWA 3UXAA 2OO0A 4O53A 4I3GA 4P5UA 4MFEA 4O18A 2GGJA 1W1B1 4M29A 1V7AA 1JCTA 1NIUA 3PPHA 3TTSA 2CLLA 2X05A 1MMFA 4FALA 5FF4A 4FX8A 3QTPA 5MKGA 2O55A 2E1DA 3H54A 3NSMA 4OUIA 2D2OA 3ARVA 4LC8A 1UD4A 5AC5A 1OADA 2PEVA 5CSUA 3RLHA 3W7MA 3W6MA 2BG5A 4EP8C 1TR1A 1ZBCA 2YYUA 1UD2A 1PSCA 3M44A 3STPA 1G7UA 2OU4A 3G5EA 3E0LA 3W1NA 2WCGA 4M5PA 4FNTA 4KEMA 3RILA 4Q8OA 2DSWA 4PB4A 3SY5A 3TIMA 3G77A 1KV8A 3HQPA 2BGSA 4K1GA 3ZSTA 5FAGA 2OZ3A 2DZWA 3R58A 4G1KA 2PWVA 2ZZ4A 2HV5A 3P82A 4RE4A 4ZGYA 3A22A 4RK8A 1H11A 3AIVA 2YBTA 2FH8A 4Q8QA 3TCEA 3PZQA 3B8VA 4AVNA 3JU2A 4P7RA 2J7HA 4PTDA 3SB0A 3BH4A 3W29A 4NJGA 3I3EA 3DX5A 4BCEA 1N8FA 1DQUA 4EANA 4W8BA 1GOKA 2G0WA 3ONBA 4D71A 3FOKA 1WV2A 1LROA 2QQ6A 4F8XA 1WDQA 2YDQA 4CCCA 4JKKA 4CNNA 3AYSA 3SUTA 3PF3A 2C14A 1ZFJA 3LZ3A 4ILSA 2QUUA 3M0IA 1HJXA 4GWEA 2BVWA 1VZWA 4LCRA 4OTKA 4Y9OA 1CLVA 1S5MA 5DT5A 3PUEA 5CBIA 1QRQA 5GVJA 3I3BA 4DAFA 1H4PA 2FKPA 2W91A 5AB3A 3PZOA 4IUOA 4IJBA 4OOZA 2ZDSA 2BOGX 3NL5A 1ALDA 5EU9A 1HIZA 2BNJA 4H7ZA 2JF7A 2CHRA 4JTCA 1GVEA 1CGVA 5FIPA 1ZLPA 2CYGA 1PCKA 3B8WA 1IXNA 4PMYA 2NXGA 3QRHA 2VURA 4YVXA 3W26A 1H1ZA 3WF4A 1CGTA 2Y63A 2D3NA 1QPOA 3PG8A 4KRTA 3L4WA 1R7OA 1OBAA 4QG8A 4LVGA 3OIHA 3WK0A 4YWSA 3DI0A 7REQA 2WSRA 5HWJA 5C71A 3R89A 1UWTA 1MQQA 3M7SA 2QEZA 1KO0A 1CPUA 5DMLA 2ZRYA 4KBXA 4AWUA 1CXEA 1R6WA 4QDPA 4GXPA 3CEUA 4B90A 2WJDA 2ZBTA 2WLYA 2XUCA 4BQ3A 3KOWA 3U3HA 4GVGA 3UJSA 3K2GA 4HK7A 3MQTA 4QQUA 3FX4A 1W9XA 5B7ZA 1H7OA 5CPMA 4MPKA 4HD5A 1TIWA 2OWCA 2XGIA 2P1FA 2XSXA 3PUGA 4A2SA 1GOMA 3WUGA 5AYBA 1KQYA 1DEDA 3WQGA 3HFYA 5KZMA 2ZRUA 1GW1A 2Z1BA 1JPMA 2DW7A 1ENUA 3N2OA 2V0TA 6TIMA 4Q4MA 2BDQA 4X0NA 4O11A 2YDAA 1YPIA 1JD9A 1AW2A 5DRIA 1QUMA 3RO6A 2Y1HA 1SR9A 4XZNX 5CBBA 2BVTA 3N9SA 2PZNA 3HZ3A 3QY7A 1VQTA 1AUSL 4ZMGA 4YVPA 1EXPA 2QCDA 2VX6A 5HINA 1US0A 5CSRA 1O5QA 3GUWA 1JNEA 3O0FA 5C6MA 1POKA 1UOZA 3NURA 2Y5SA 4PMOA 4R7JA 4FA3A 1KWGA 3U57A 3C56A 1M65A 4AISA 1HVXA 1NJJA 3QHNA 1W31A 2J24A 2XPKA 3LLFA 1S1RA 3QGVA 4CNTA 1DJGA 3OYZA 5A6SA 5ABEA 4K8EA 3CYVA 3LHZA 4KWOA 2W6RA 3BW4A 3CUJA 5LA0A 1MEHA 4MVAA 2R91A 4O4WA 3U48A 2YLAA 1RA5A 2V3FA 4GCAA 3ES7A 3EX3A 1XYBA 3GKAA 1C91A 1BAGA 1VCGA 1PJ9A 2CW6A 3P62A 2VC5A 1E0UA 1I75A 3SSJA 4LSBA 2J7BA 5I3GA 4WHBA 1SSGA 1W5OA 3KRUA 4Q8NA 1H61A 3WF3A 3RYSA 3UETA 5CZ0A 4WZHA 1PWMA 3P2VA 3O7UA 3ZFHA 2NT1A 2ZX7A 3MDWA 5TF0A 1Q6GA 2QIWA 3VCRA 4JNZA 2TMDA 1EX5A 3E5PA 3AMCA 4QJ4B 1CYGA 3U0HA 3EDDA 3DHPA 1QATA 1QHZA 2PRLA 3M0XA 4AZ5A 1OX6A 4B5XA 3V0TA 7TAAA 2VOMA 3AXXA 2NVDA 5LIUX 2RUSA 4F4RA 2EF9A 1XLFA 2PWGA 2OOFA 2ZC8A 3EWUA 4XKYB 3OVGA 4ZL1A 3GX9A 1GKRA 3SI9A 3NO5A 1OT2A 3C0SA 3G22A 3O6CA 4X0VA 1DXEA 3DC8A 3LERA 3VE9A 3CAQA 3LRLA 2V5JA 4CD5A 1WOAA 3V5OA 1V3MA 2VVNA 2XINA 4CNUA 1JF6A 2QGYA 1KFCA 3LTYA 4ZQOA 1XW8A 1IWPA 1JRCA 3C8FA 1OGBA 2JKEA 4O8AA 1BD0A 3VFLA 3W1LA 3KS5A 1JIBA 1QT1A 3NXLA 3ARRA 3VGBA 3V35A 1JZ3A 3CTTA 2XIIA 2FZ9A 4AZHA 4E8GA 4B16A 1FWAC 1TB3A 2GOUA 2WANA 3ABZA 2C18A 3NQ7A 1H50A 5GNXA 4OV9A 3QKEA 3EWBX 3F2BA 2NLIA 8XIMA 4D9PA 2V63A 3LENA 4PSPA 4EF9A 1FCQA 3F7JA 1YIXA 1Q3NA 3LCWA 3GU9A 4IPLA 2VNCA 4UTHA 4WXZA 4ZO7A 3OVRA 1LLZA 1VKFA 1QNRA 1M7PA 4MG4A 4BQ5A 2EG7A 5AHLA 1M53A 3KWXA 3I7RA 2PDBA 3VFCA 3IAPA 4ES4A 4Q6XA 3SEPA 4DBDA 4IG2B 3U7VA 1YBQB 4JTSA 5T26A 1PYFA 2WHMA 4IGNA 1U22A 1XCXA 3CL7A 1M03A 3S6DA 3B8SA 3BTNA 4HB7A 1NSJA 4C7FA 4JTJA 5AC7A 3OZMA 1BHGA 4KEUA 4L4LA 1OABA 4O1DA 4FF7A 2ZZ1A 1UH4A 5JH1A 1BYBA 1OFDA 4JR5A 4UTUA 4HZ6A 5JUVA 3W7EA 1EJXC 3EKZA 2C91A 2O9PA 1X6NA 3IPWA 2YDSA 3PY2A 1GYMA 5BRBA 2INEA 3IGXA 1K6WA 4L61A 3OW1A 3KVMA 3LHVA 2XZ7A 3W22A 3A6OA 1TX0A 4LEFA 2BY1A 1EJRC 2XGZA 3O8AA 1B54A 1WUFA 4PUEA 4Z17A 3TC7A 1FOBA 1ECEA 3NCOA 1OQFA 2YSWA 3VIOA 4HMDA 4GO9A 4QJ1A 1V4YA 1PDYA 3B8TA 2QCMA 2BTMA 2GSHA 3WD4A 2V3EA 4H41A 5CG7A 3UWZA 3L5LA 2G3MA 3QKZA 2H90A 1H7PA 4G7EA 3TMQA 3P80A 1S3HA 2B31A 4N0RA 2Z26A 3Q67A 2I5QA 1ITUA 1XIDA 1ZL1A 2ZADA 3CLWA 3O2LA 4KWSA 3QGAC 4NAEA 1TPVA 1X7FA 3G0SA 3S46A 3KBJA 3W23A 4AIEA 1JVNA 2J66A 1HUVA 3UP8A 1L8PA 4H83A 1BLIA 3DERA 5LIKX 1XLGA 2Y61A 2X7VA 4EACA 4P61A 3TR9A 3GXNA 4GZEA 3KP0A 4TVUA 3KLKA 4AF0A 5HJLA 4W5ZA 4GA8A 2G50A 4PSRA 4Q32A 5HBFA 4C65A 1GJWA 2IKJA 3NA8A 3SRHA 1HKJA 1E1EA 1UZ1A 5GJNA 3UZYA 3R43A 1XLAA 2YW3A 2WKJA 1MXDA 3TK7A 4BI5A 1S2VA 4M6QA 3DHUA 1EDTA 1C29A 1UC5A 1UJPA 5HMSA 1EL3A 4D72A 4LQ1A 1QNOA 4CLMA 1R3RA 3KDNA 1O5RA 4YHGA 3WO8A 1VAHA 4TVCA 2ZUTA 2OLSA 3GVWA 1J2WA 1XGDA 3EXSA 2Y4SA 5J5DA 2AQVA 3UW6A 4Q8UA 3WMLA 1RBAA 4C6OA 4MWAD 5U7SA 3NO3A 3AC0A 4LAKA 4K68A 4Q7IA 2DY3A 4PB3A 5H8PA 1XC6A 3DN5A 3L0GA 4XKYA 1OT1A 5LXXA 2A7NA 4RZBA 2OODA 3VIKA 2DDXA 1QHOA 4UTLA 3HPXA 4A2RA 3V0UA 3H7UA 4K7YA 2GLKA 3LXBA 1GGOA 2BZNA 2C1IA 2PODA 4UXDA 1YHTA 1ZB5A 3LHUA 3NWRA 4AYGA 3MHUA 4DO7A 2XHYA 3G1HA 1SZGA 3QR0A 2R8WA 3W7GA 4W9TA 3BLFA 1BYCA 3M46A 4D6JA 3WQVA 2XZ9A 1YLVA 5CPQA 4GJIA 5F4XA 3QFEA 1DYSA 4JQ2A 3ITOA 4KESA 2VD8A 4P7NA 1V0MA 1IXQA 2FQIA 3GZAA 4DI8A 4PTWA 5PTDA 3K4WA 4S1FA 3LTPA 1DPMA 2GYIA 1LOQA 4U33A 1IQ8A 1F4HA 3CU2A 1R2SA 1WOBA 3NGFA 1POJA 4FX7A 3S5YA 4BF7A 3L67A 1Y0EA 4U10A 5A8MA 1QPRA 1GQNA 1Q6EA 1CGXA 1WA3A 3BUVA 3NZ1A 4WIWA 1RD5A 1W8SA 4O1FA 4F48A 4NZ1A 4DJEC 3N12A 4MHBA 3GDMA 3ERPA 1OC7A 5D33A 1O95A 2X1RA 1ZAIA 1Q7QA 1R2TA 2NWSA 4S3EA 5EMYA 4AX6A 4JTFA 5K7JA 3WH7A 4IG2A 3AMDA 3RLVA 4LVFA 2RJGA 1PKMA 1UHVA 4O57A 3DI1A 1OCBA 4TIMA 4RV3A 1FWDC 3W75A 1MRAA 3OTRA 1S5WA 1GNXA 2PDIA 4Q3MA 2HROA 2ZXAA 3AMLA 1E5NA 1XS2A 3FVDA 1NDYA 3LK6A 3VIPA 3F4DA 1K7FA 4V28A 4U2YA 3YPIA 1L6YA 1D8CA 3KCLA 3LI0A 1PPIA 3T8QA 5I77A 3EA3A 4LV9A 4I8YA 1UWAA 2AGTA 5XIMA 2ZTKA 2H9AA 3EOSA 1RCXB 3STCA 2RDXA 2YX0A 1UZDA 1MVYA 4I6KA 3CXOA 3UR8A 1J6PA 2CETA 3GD6A 3TJXA 3W7IA 5EPDA 4GH1A 2XJ7A 3GXMA 1Q6LA 4OJYA 3GIYA 4MZYA 2R94A 2ZWYA 3N3TA 3SR7A 2WM1A 1LCOA 3QR3A 4MNJA 2WNWA 3JUGA 1BRLB 3VNMA 1TRIA 2CWNA 2XVGA 5AY7A 4PZVA 1DKWA 4L1WA 1I6NA 2A6LA 4EWND 3GU1A 3BANA 3Q94A 1J18A 4A05A 3VTRA 4GPNA 1AA1B 3UZ5A 1TVNA 3NVTA 3N6HA 4CD8A 1XGEA 1D9EA 2WSKA 3T07A 4RCXA 2WZIA 2PTYA 4UFMA 1WKDA 5A6TC 1UMLA 3LV6A 2VENA 2VZOA 3W7QA 1PVNA 4ZQPA 5F7UA 3WSUA 2J7FA 3VE7A 1N82A 2WJEA 4K8GA 3H2EA 4ZOEA 3H2AA 5DXYA 3MANA 4MKSA 1F3WA 3WQ8A 1Q65A 4ZVJA 3RR1A 1EZ2A 4EK7A 3PBWA 2E0PA 1C9WA 1DVJA 3U2OA 1O5KA 4Q7NA 2Y5JA 3KL5A 1G01A 2CWXA 2Y7DA 4ZODA 4C60A 3ENLA 3FXGA 3OZOA 5ABGA 1W5NA 3WZ0E 2FGBA 4BEUA 4Q8VA 3H53A 2I1OA 4QCFA 3LHTA 4GVIA 3M5XA 1QASA 3G6MA 2XVLA 4QP0A 3WQCA 3UZZA 5TBOA 1B3XA 3CAKA 3SRDA 2JIWA 1TVLA 4XD4A 5AHNA 1GQLA 4GACA 1RP9A 3P3BA 2EPLX 3NR0A 4ZA0A 3FYYA 1RA0A 1RVKA 4GIYA 1IE7C 1HL9A 3IJLA 3Q4DA 1E0XA 1Z89A 2DV0A 2WNNA 2WZEA 5LNWA 1W32A 4UFKA 4GE8A 5A6AA 2PAJA 3VD5A 3W82A 1DBTA 4N9BA 4AD3A 1A5OC 3UJEA 2O7SA 4UTWC 2D69A 2VX4A 5HA7A 1YE4A 5CC5A 2GFTA 3WCZA 1NFGA 4QGCA 5A8QA 4JFSA 1ZJAA 3KW3A 3DFYA 1A0CA 3PTQA 1KRCC 1SZNA 3W72A 4JIHA 5I06A 3A4AA 3CEPA 1C3FA 4O0QA 5HWMA 4AD4A 1UP3A 1KCZA 1YX1A 3C8NA 4QFUA 5AHEA 4AZCA 5LNVA 1KKOA 4JKLA 1CNVA 1RJPA 2GDUA 3R0DA 3RLGA 3EMQA 5CZKA 5FA5A 3GU2A 3I7SA 3QYSA 1DJYA 3VDCA 1JAKA 4YJ5A 3BMXA 4IXXA 3AO0A 3GY1A 2VZVA 1V8EA 3MKCA 2VC7A 4KCWA 1GCYA 3W2UA 1OYCA 1G9HA 2QPSA 4JHZA 2R82A 3VD4A 5TIMA 4JBRA 3CHCA 2YCIX 1B31A 3UWWA 1K8XA 4PUKA 2MANA 2C16A 5K2ZA 4RPQA 4WJEA 3LBCA 1W5QA 3LPGA 4GG9A 1ME8A 3V7PA 4IT1A 4WY0F 4WGXA 1ML1A 3IS4A 3BSMA 5G5IA 3GFZA 4W7WA 2VGFA 4FOKA 2Z2BA 3WK3A 3W7CA 2ZZ2A 3VABA 3W86A 3GNRA 3K8MA 3GE7A 3KOXA 2DW6A 4IJCA 3TEVA 5BXRA 3FFSA 2QDGA 2AMXA 4OVXA 1B3VA 3W70A 3T4WA 1NTHA 2V8ZA 2FTYA 4B5UA 3NSXA 2E9LA 3PWAA 3STGA 2GJLA 4G9PA 1HL2A