3MC5A

Human aldose reductase mutant t113v in complex with idd393 crystallized in spacegroup p1
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
316
structure length
316
Chain Sequence
b'MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPVGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Ligand-induced fit affects binding modes and provokes changes in crystal packing of aldose reductase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 107
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3mc5A00
2PDCA 4JTQA 3UZZA 4G5DA 1S1PA 4DBWA 4YVXA 2PD9A 4MHBA 2BGQA 3UP8A 4XZLX 4JQ3A 4I5XA 1QWKA 1XF0A 1XJBA 5HNTA 4PUUA 4WDTA 4FALA 4QBXA 1RY0A 3CV7A 4YS1A 2C91A 2J8TA 3UZXA 3R7MA 4EXAA 4EXBA 1Z89A 2HEJA 2IKIA 3V35A 3G1RA 3UZYA 4GABA 4PMJA 1EF3A 2PF8A 3VXGA 4XO7A 4XAPA 4WDXA 4XZIA 2ALRA 2IPGA 4JTDA 2PDMA 1MRQA 4DBSA 2HDJA 3N6QA 1EXBA 4XVEA 3RX2A 3CMFA 4QX4A 2PD5A 2BGSA 4QR6A 1C9WA 5LIKX 2R9RA 4HBKA 3BURA 2CLPA 2F2KA 4YVVA 1VBJA 3UYIA 2IKGA 1OG6A 1T41A 4LAUA 3CAQA 3H4GA 3EB4A 4OTKA 2PDKA 4AUBA 2PDPA 2R24A 5HA7A 4LBRA 4XZNX 2P5NA 2PFHA 4XK2A 4GCAA 5JH1A 2ACSA 2I17A 1YE4A 4PRTA 2FZ9A 2WZMA 5DANA 2HE8A 3LEPA 3M4HA 1R38A 4JIIX 3LN3A 4RPQA 1PZ0A 3UGRA 4ZFCA 1PZ1A 1RY8A 2DV0A 3R8GA 4PR4A 3UG8A 3LQGA 4DZ5A 3CAVA 1J96A 3O3RA 2ACRA 4YU1A 2FZDA 3UWEA 4H7CA 3ONCA 4ICCX 2F38A 4JTAA 3LD5A 1K8CA 3O0KA 2AGTA 4GQ0A 1ZQ5A 4JTCA 4LB3A 2A79A 3MB9A 1PWMA 3H7UA 4IGSA 1X98A 3DN5A 3BV7A 3Q67A 2PDBA 1LWIA 2PDFA 2PDHA 2I16A 1YNPA 2BP1A 4JIHA 3RX4A 2PDQA 3WBXA 4DBUA 5HNUA 3V36A 3H7RA 3LNMA 3C3UA 4JQAA 1AH3A 2PDWA 3UZWA 3FX4A 4LAZA 1HW6A 4IJRA 5M2FX 2HVNA 4WDWA 2IS7A 1AZ1A 4QXIA 1Z8AA 3G5EA 3S3GA 1ZUAX 2ACQA 4PRRA 2IQ0A 5AZ0A 5LIWX 4YVPA 2DUZA 1IHIA 3LZ5A 3WCZA 4GA8A 3KRBA 3LQLA 2HVOA 4R9OA 4HMNA 3T42A 1AZ2A 2VDGA 3COTA 4JQ2A 1ZSXA 1LQAA 3R94A 1GVEA 2IQDA 3V0TA 5LIYX 2PZNA 1FRBA 3LUTA 3NTYA 1A80A 1AH0A 3ERPA 3EB3A 3R58A 1Z3NA 4Q3MA 1US0A 3LBOA 4JTRA 2QXWA 4JQ4A 2HV5A 2PDLA 2DUXA 5JH2A 3N2TA 2ISFA 1RALA 1EL3A 3D3FA 3BCJA 2PDGA 4LB4A 3V0SA 1X97A 2PDYA 3UFYA 4FZIA 1YNQA 4IJCA 3GHUA 2PDIA 4PUWA 3WBWA 3F7JA 2IPFA 3BUVA 1M9HA 4XVDA 4XZMX 3P2VA 3GHRA 4XZHA 1VP5A 2FZBA 4WEVX 3MC5A 4XO6A 1QRQA 3FJNA 3LENA 3ONBA 4WRHA 1AH4A 3WBYA 3M64A 1MI3A 1Q13A 1PWLA 2IPWA 4L1WA 3Q65A 4FA3A 2PDUA 2INEA 2IKHA 1MZRA 2IKJA 1ZGDA 5LIUX 1S1RA 4JIRA 2PDNA 4FAMA 2ACUA 3B3DA 3WG6A 3DOPA 4H8NA 4F40A 2INZA 4WGHA 1HQTA 5KETA 2WZTA 3GHSA 3R8HA 3CV6A 3V0UA 2HE5A 4GIEA 4NKCA 2PDJA 1PYFA 1IEIA 3RX3A 4GACA 2FZ8A 4ASTA 4JQ1A 5C7HA 3GUGA 1S2CA 3R43A 1AFSA 4Q7BA 1JEZA 3CASA 2NVCA 1YE6A 4GQGA 2NVDA 4WDUA 3U2CA 5AZ1A 2FGBA 1T40A 1EKOA 1ADSA 2IPJA 3LZ3A 2PEVA 3QKZA 1SM9A 3M0IA 5LIXX 1S2AA 2FVLA 1Z9AA 3GHTA 1Q5MA 2PDXA 1XGDA 1UR3M 4LBSA 1X96A 3R6IA 4L1XA 3EAUA
chains in the Genus database with same CATH superfamily
2Y8VA 5D32A 1JYNA 1IE7C 3S5SA 4JN7A 2NWRA 1TVNA 1G4PA 5LA0A 4C5ZA 3FJ4A 2POTA 2FMOA 3D46A 3MZ2A 2E6FA 1Y5XA 2YPIA 3C86A 1TPUA 2W62A 1RJQA 3HPSA 2FDMA 3E5PA 1LLWA 1LL7A 4IPLA 1DE5A 3UCCA 2YA0A 1Z89A 1VEPA 3G1RA 3IGXA 3MKVA 1UYQA 3MP4A 4Q8UA 3NXFA 1JNDA 3C2OA 4XZIA 4KWSA 3WQ6A 2YDQA 3KP0A 4JTDA 3ZXWA 1V7YA 3TYUA 1HL2A 4O1BA 3GTHA 3KAOA 1RP9A 3H22A 2BHZA 1CNVA 1X7IA 1C93A 1Y7VA 4TTGA 4MY9A 4UR8A 3W1PA 5M17A 3U48A 7TAAA 3AAMA 3B8DA 4O0ZA 4F0RA 5A2BA 1UD6A 4QG9A 4HPXA 1JZ6A 1GK8A 2J66A 1JCYA 4MDOA 2OGJA 3CHCA 5A94A 4P5UA 4AAJA 2V81A 3O05A 3MSGA 2BSLA 1RBOB 2B0MA 2OJPA 4NSBA 4WY0A 2P5NA 1XP3A 1BGAA 3QTPA 3VNMA 3ARTA 5HQMA 2QAPA 1KFJA 1W9DM 4UNKA 3GR4A 3KOZA 1C29A 1MNZA 1RV8A 5DANA 3QF0A 3W7GA 3BLIA 1ZPTA 3A5VA 1ISWA 2Y2WA 3MP5A 4AC7C 1MXGA 2XWEA 3WD1A 1UCWA 3VI2A 3M41A 3P81A 2ACRA 1R2TA 1S3TC 1I1WA 3PPGA 1FWBC 1GG1A 3JW7A 3N14A 4GQ0A 4JTCA 1QJWA 2A7NA 3QPZA 3L68A 1K6AA 5BMWA 4Z2IA 3V5FA 2FTWA 1MMFA 2J6XA 3CHFA 3TW6A 1A5SA 2F2HA 1NWSA 1P0NA 3A64A 1PIGA 4CQ9A 3HQ1A 5AC7A 1J18A 4GHRA 2NQHA 2QCEA 3GSMA 2DIEA 2XG9A 1RD6A 3U2ZA 2QCHA 1ZY9A 1K1DA 1X6LA 1MUCA 1QCWA 1AVAA 1LRTA 2ZVRA 3S6DA 1GWJA 4M56A 2AL2A 2J78A 3A3XA 3UZWA 3KDNA 3GIQA 3DFTA 3TA6A 3GTXA 1VFFA 2R1LA 2IS7A 1E43A 3PZOA 1KV5A 2PLKA 5FJUA 5I3IA 1R3RA 4RE0A 3FIGA 2FHCA 1WPCA 3SUSA 4P7OA 3UCDA 1V08A 3W82A 1CGTA 1V77A 3DIPA 1NARA 3PF3A 4L56A 5I3FA 1OX4B 1X7FA 4O1DA 2B31A 4Q4RA 4OVXA 1ZAIA 1RVKA 5I09A 3UJRA 2O7QA 2J7DA 4NIRA 1VYSX 3S9IA 4J5NA 1JFHA 3R25A 3R5EA 4LC6A 4NNBA 3EB3A 4I5UA 4I7UA 2DT0A 1H7NA 2HXUA 1KKOA 1I1XA 1BG9A 3IWPA 1UH3A 1TA3A 1OADA 4ES4A 1Q85A 5EBUA 4AXKA 2B7OA 1IXPA 1UB3A 3WH8A 4NXSA 3ES7A 4L64A 3WBWA 3GZ3A 3SEPA 1M9HA 2W6RA 3AJ7A 3QKEA 2R1KA 4ZTXA 1EDGA 1FCVA 2X1TA 1EEPA 4EP8C 2V5CA 2XVPA 3R4IA 2RKXA 1V4YA 2GFTA 4KH2A 3M0VA 4HNTA 1HO4A 3BW2A 4XISA 3S1WA 1AH4A 3WBYA 2HBXA 4LALA 1MI3A 1UKTA 5G1MA 5KZEA 5CZ0A 1Z6KA 3TV8A 5TAOA 2R82A 5AYZA 3T09A 4ZQPA 1G4EA 2Z24A 4U2YA 2NW0A 5A8QA 3R13A 3C2RA 1S46A 1GKRA 1ZGDA 2JFEX 3V75A 4LYQA 1MDRA 2D20A 3PJXA 3G18A 5FJTA 2PDNA 3DGBA 3IPWA 4W7VA 3NZPA 3CUFA 4WJEA 1D7KA 1W3IA 2ZZ4A 5DY2A 3K8LA 1OCBA 2OOGA 1E6SM 3FN9A 3SQMA 2WJFA 3O0FA 4MPKA 3W7PA 2GUYA 4JTFA 3W1UA 1QNPA 2WXDM 4RK8A 3W7RA 4XD3A 4CQBA 1IR1A 1QPQA 1TKKA 4E4UA 2PTYA 4PZVA 4F0MA 4C6JA 3NQ8A 3YPIA 1SFLA 5DN1A 1KWGA 1DWJM 3I7RA 2Y88A 3TCSA 3AMCA 5H2ZA 3W00A 1RQEA 4UC5A 3TJXA 3ZQ9A 2UZ9A 2CWNA 4NZ4A 3W6YA 1W37A 4ERIA 2OPJA 1CXEA 1UIOA 2VCCA 3L23A 3W7KA 3AMLA 1T40A 2H3BA 3LCFA 1QPOA 1H61A 1G69A 2GGHA 2X05A 3GIYA 3S9ZA 3HPXA 3KTCA 2QV4A 3XISA 1UR2A 3LNPA 3SUUA 1GQNA 2CERA 2E25A 4OU1A 5PTDA 1P5BA 1PCWA 2Y85A 4KIRA 1YW1A 4L1XA 3EAUA 1XKYA 4KW2A 5I5RA 4PFHA 2G3JA 2YCEA 2Y1HA 3NQAA 4MYXA 2Q71A 4XG1A 1QO2A 2OG9A 3OZPA 4GYPA 2EPKX 1Q6LA 1THFD 4QBXA 1ECQA 3EX4A 4S3GA 2GLKA 4DAFA 3P6LA 1XQKA 3WF1A 1W5NA 1BTMA 4Q6JA 3WLJA 1E4NA 1C8XA 1JR1A 5CKSA 1ZJAA 4KKXA 4PRWA 1QOXA 2A3HA 1CIUA 4EXBA 4EAMA 2PUZA 3LBMA 2BNJA 2GQ3A 3GXTA 1S5MA 4XAYA 4MDPA 4NILA 4LAOA 4YXGA 4IIBA 5D4YA 1W31A 4XAPA 3GU1A 1GOQA 1NDYA 1FWJC 3SN4A 2TAAA 2HDJA 3TJLA 4S2BA 1XDLA 1D3CA 1FY6A 3FSUA 5E9XA 3P3BA 1N7KA 4M6VA 4QJ1A 3KUMA 2P50A 1XIMA 1G94A 1ZU8A 4KEVA 4CU7A 3W1NA 4DX3A 3WQPA 1BRLA 3TONA 3VIGA 4QNWA 1VBJA 2R6OA 1K7FA 4ML9A 4DM2A 3BW3A 4QROA 1BKSA 1TJPA 3WJWA 1XLGA 2YDRA 2C8NA 3QY7A 3E6EA 1JPIA 3LRMA 1Q66A 1TMQA 1SPQA 1R3QA 2PFHA 3LXCA 2HJPA 2BMBA 4DWSB 1MNSA 4AZCB 5C9RA 2JQXA 1V6YA 1KGXA 3PUDA 4ILSA 3NGJA 1GTEA 1XFCA 3THDA 4UQAA 2VFIA 3WLOA 3QTGA 5FJPA 4FOKA 3M4HA 1J0YA 3DEQA 3KZSA 1B3XA 3DXIA 1J0JA 3GIPA 1AW2A 1TE1A 3S2NA 1XLDA 1MEWA 3UXAA 3RLGA 5HOSA 5I02A 2GJPA 4MGGA 2OLAA 4A35A 5D2WA 1FQ0A 4JHZA 3BC9A 4UTKA 2Z2AA 1F6YA 2CLFA 4F9JA 4ZE4A 3RLVA 1SZGA 3PZ9A 4PUKA 5GQBA 5A1AA 1I2RA 4LCQA 4UZUA 4KCTA 1J0KA 4LT9A 2PTXA 3VMOA 3BZGA 3CAWA 3AFBA 3BV7A 3TTSA 1W3JA 2VEKA 3WH9A 3CEUA 2DT1A 1AL8A 4DI8A 1F2JA 3RX4A 3ITTA 4ZTYA 4Z2GA 3O8AA 1JYXA 1IV8A 4BCEA 4WSJA 4DUOA 4ZB0A 3RM4A 3VOIA 4FMVA 1QO5A 2H8XA 2FQIA 1OFQA 3FEQA 5FF3A 4WHBA 4K8EA 3RHGA 3SCRA 1E6NA 2QQ6A 2HVNA 4C65A 3VD9A 2ASHA 3LRLA 4YWSA 1A47A 1TPH1 1ALDA 3CNYA 3UGVA 1EJ7L 3OGRA 3HOJA 2O55A 5U7SA 2BY3A 4YPJA 3C56A 1EJXC 1SQ7A 4DPPA 2V68A 2NZLA 2OSYA 1HP5A 4LPCA 4HPGA 3GUWA 5EMUA 1AQHA 2QF7A 3HU7A 1YXCA 4WOQA 2Y62A 2EEXA 2ALDA 3ORWA 4U3CA 1D7FA 3C3NA 4D8AA 4ORIA 2ZUWA 1HG3A 1KM5A 1F76A 3T7VA 3LUTA 3D6NA 3P7YA 2ZIDA 1WQ5A 5H8MA 1KM4A 5CGQA 3QC3A 2DUAA 3CTTA 1Z3NA 3C2EA 4QP0A 2DSWA 5XIMA 3WO8A 3ZMRA 1H63A 1H0GA 3U57A 3MUCA 3F2BA 2P8BA 4DO6A 2ISFA 4FLRA 5D2VA 1P4CA 1ZL1A 2RDXA 1QPKA 3UXKA 5KITA 4O57A 3MMUA 2WB5A 4A6GA 4HPNA 1AD1A 1XIIA 2TYSA 3DBNA 3SADA 4QCEA 4O17A 1FWAC 4DY1A 4XZHA 1D3HA 4XO6A 2DSVA 4TXEA 1A0EA 2X41A 3SDOA 3AU2A 1A5BA 1OGGA 3FHQA 3ZT6A 1SJAA 1W1A1 1DQWA 3WFZA 3BV4A 1KKRA 1US3A 3TFXA 4RX0A 2E1WA 3EB2A 3W71A 4PL1A 3V4BA 3M5VA 5GNYA 2DIJA 3ZJ6A 3O6CA 1EPVA 2FPVA 3FYOA 4IWWA 4F8XA 4IQEA 4L9ZA 1LBFA 4KFPA 3O2LA 4AD5A 1NIUA 2VFHA 2A3LA 4UTUA 3PFRA 4LX4A 1WX0A 3WF2A 4CNPA 2CXGA 1O68A 2OB3A 1QATA 1HJUA 2FFIA 3GR8A 4U28A 2XIOA 4LRTA 2R14A 1P0DA 3B40A 3FW6A 4AHPA 1OFBA 1AFSA 4K7VA 1FWGC 2G3NA 2FZNA 2J9ZA 3OBEA 3SAZA 1ISZA 1L9WA 5JU6A 1XD0A 3UVAA 4N7QA 1T0OA 4DNHA 1G4SA 2WMKA 4F2BA 3UZ5A 2J47A 1PKMA 4JX6A 4B4FA 2Y5SA 3M07A 4HNOA 2WWCA 5LIXX 3FLUA 3CQJA 3FS2A 5A8PA 3C0LA 4H8VA 2Y0FA 3TX9A 4Z08A 3HN3A 1JZ8A 3VIHA 3AIUA 2UBPC 3H53A 1TUXA 5CPOA 2V9DA 4PUNA 1E4MM 4A8IA 3VC6A 2VCAA 2EBNA 1J0HA 3BANA 4QG6A 3UYCA 3PSVA 4N9BA 1C91A 2QCDB 5DXYA 3BO9A 2JKAA 4NF7A 2D69A 2Q8LA 3CV7A 1UJPA 4YS1A 1O94A 5E6YA 2VZTA 4FX6M 3ZVHA 5F4SA 1IIHA 3DESA 4C6CA 4H9MA 2G4FA 1BKHA 3C5QA 1RHCA 2CLOA 4BQ3A 3GBDA 3IRSA 2A21A 4F66A 5LSMA 1XRTA 2J74A 2GK1B 4HA1A 4IICA 4HHLA 4Z2KA 3UA4A 2QCGA 1NSJA 1HIZA 1RA0A 3KLLA 4O16A 3EDDA 3CMFA 1B2YA 1XLHA 1BSIA 3R0KA 2WHMA 3VNYA 1S2VA 4CLMA 4IMFA 2GJXA 1VPXA 5I79A 1F74A 1YDNA 4RE2A 2BODX 1EUAA 2PWUA 3SCSA 5MHBA 1V3IA 3S5ZA 3H4GA 4NP7A 5L6UA 1XIFA 2CBIA 4AIBA 4HN4A 3KCJA 1VRDA 5A6LA 3AYTA 3PZQA 1NQ6A 4K8HA 3STPA 4HCDA 1YE4A 4U31A 3E0IA 2V5LA 2REQB 4NJHA 3CLWA 3L4YA 3W53A 3EKZA 3M5YA 4X2RA 2BY0A 4Y8FA 4DBEA 4GLEA 4NT0A 4MLRA 1LG2A 1KM0A 5AY7A 3AHVA 3GNDA 1R9ZA 3P93A 4PCSA 2Y5JA 3QQWA 4JD4A 1OABA 3ITYA 3O3RA 2ABAA 3R11A 3N4FA 4FIQA 5JBEA 3TQ0A 1REQA 1Y0EA 2F38A 1QWGA 2XVNA 1O7AA 1TIMA 4Z2HA 5CC3A 4O11A 1Z7AA 2C1IA 3WEZA 4AW7A 4DLFA 3QZAA 2Z1BA 5A6BD 2DZSA 3HJZA 2EJ1A 2ICSA 1JF6A 1UH2A 4UTWA 2PRMA 3BJSA 1F4HA 3G2GA 2Z1XA 3K2GA 5CPTA 2CETA 3CQIA 1V3KA 2VQUA 3DKJA 4WKHA 3RR4A 2E5BA 4EE9A 4DBUA 2A5HA 1SVDA 4ZFMA 4O1AA 3C0QA 2XM2A 4J3XA 5AC5A 2J4GA 2HK1A 5HNRA 1RP8A 1AH3A 4GIAA 3SURA 2VEFA 5HMSA 2WKLA 1GVSA 2NV2A 1WB0A 4HTBA 1WO2A 3PZUA 2ZUTA 1KFEA 5AFDA 3PTQA 4HPHA 4MMWA 2A6LA 2DEPA 1KC7A 3G5EA 2QPUA 1PCKA 3VM7A 4R7OA 3PZMA 4FLOA 3MTWA 3LZ5A 1S5TA 3WCZA 2WMJA 4QITA 2PB1A 4JY8A 4UIOA 1PVNA 3CZLA 1UR4A 3WD3A 3ISIX 2YL8A 1BAGA 3FVDA 3SW6A 2WM1A 1FWNA 1PPIA 3IJ9A 1AQFA 4JQ2A 1OYBA 3RR1A 3MMDA 1AK5A 2QMKA 3E49A 4X9SA 4NI3A 4LUSA 3IRDA 3C8FA 2EPMX 2VI0A 3AHTA 1E1CA 1K8YA 5AKQA 3LGGA 4JTRA 5DY3A 3W76A 2PTWA 2G50A 4K7YA 1JI2A 5EMYA 3NQGA 1EDQA 2DGAA 4DJFD 3PZIA 1SR0A 3N2TA 2PA6A 2VP8A 1JPKA 1KD0A 3EX2A 2ZFAA 3GD6A 4QSHA 5HUOA 2DZTA 1SUXA 3Q37A 3RO8A 4XSLA 4PUWA 2CWXA 3NQ7A 1LL6A 4RDVA 1H2JA 3USBA 4O8RA 3CWNA 3UERA 1WKYA 4KRUA 1VP5A 2FZBA 1Q6OA 2PC4A 1WUEA 5CC6A 1I9CB 3U2EA 2DW7A 1GVQA 3GYCA 1Q13A 1AJ2A 3K4AA 2VZUA 3Q65A 3BOFA 4MB4A 4HK5A 2DW6A 2G3MA 3BAXA 3ELFA 1S1RA 1DJYA 1RUSA 3NURA 1W54A 4MNLA 2QPSA 3U7VA 1JXKA 3UJSA 4F79A 3FSTA 1WNOA 2PLCA 4HPJA 2BFGA 2XN2A 3N3MA 3BLPX 2Y63A 3QFEA 4QFUA 1K9DA 3VX0A 2HMCA 5BRQA 1GNXA 1J9YA 1AW5A 3EKLA 2PWGA 4ASTA 1SW7A 1RXOB 3KE0A 3GUGA 3T0CA 1JEZA 4DJDA 4GUIA 1LL4A 1Z44A 3TYAA 1B9ZA 1YE6A 3L12A 2W79A 1MYRA 4HU4A 3LPOA 1GOIA 5AZ1A 5TF0A 4Z42C 1M1BA 3W70A 3HPAA 2OEMA 4I9TA 4WOZA 3LZ3A 4BQ2A 2A7PA 3CL6A 1IEQA 2PEVA 1VCFA 4NASA 4ERGA 3NOEA 5A2AA 3W3OA 3H24A 3GX9A 3U6WA 2C13A 1M03A 2VJXA 3BVJA 3GE7A 4IMGA 1POJA 4UQEA 4Q8WA 1VIWA 5E0CA 1FHVA 1GONA 3L5AA 1KBLA 5FEZA 4MZ1A 1FDZA 1TQJA 2PD9A 2XU2A 4UMCA 3ZZ1A 2ZA3A 1E0UA 2JIEA 4KPLA 2W92A 7CGTA 1RJRA 5ECVA 2I7GA 1B3YA 2X0HA 5HNTA 4WDTA 2CBJA 2PRLA 3W0KA 4Q4MA 2IQTA 3SGUA 3U3HA 1CECA 3B8WA 5CAHA 3UNDA 3W7IA 1QXLA 4FNUA 2ON3A 1H3GA 3SGGA 3N2OA 3VDBA 2XHYA 3QQ1A 5M03A 1PB0A 3VD7A 1Q8JA 1FH7A 4FNTA 5A6AA 3DGRA 4L4MA 3BW4A 1AUSL 1CLVA 4BK9A 2ZUSA 2ALRA 4IMCA 1U5VA 4R53A 1KTCA 2OKOA 3H26A 3SY8A 2V30A 1OC6A 3P5ZA 3N6QA 3QRHA 4M51A 3K13A 1XBVA 2QV5A 1RH9A 2W61A 3RX2A 2ESCA 1Q63A 2NQLA 2SFPA 3NQCA 1QT1A 4PCPA 1C9WA 4WSHA 3LS9A 2OT0A 1IYXA 4DI9A 4PTMA 1JRBA 2CLPA 2V67A 5EBAA 1MXDA 4YVVA 2WBKA 5FOOA 2IKGA 1PIIA 4PULA 4LUTA 3SB0A 3WELA 1G0CA 2OX4A 3W27A 3NQVA 2A0NA 1EZ2A 2DIKA 2OQYA 1H51A 5EGRA 3S6TA 3STFA 4F0LA 2BX7A 2YCIX 4JDBA 4PTVA 3UBPC 3N4AA 1PZ3A 4H9YA 3QV9A 3TSDA 3CGTA 3LN3A 1FBAA 3PUEA 5FSDC 3L4VA 2D73A 4MB5A 3T0DA 4PR4A 4A3RA 4IM4A 4A8LA 3PFMA 4DXXA 3EA2A 3BG3A 3W37A 4B5SA 2Y7GA 3CYJA 3EOOA 1R47A 3G8RA 1EO7A 3ZO9A 4ZA0A 5KSWA 2PI6A 1GJPA 4IGHA 3RCNA 2YCLA 4C6PA 3O0KA 4V27A 2VRQA 2RHGA 3BPWA 1CWYA 2IXUA 2QUVA 1XSIA 3B9NA 3IJIA 3W7LA 3ARVA 3BSGA 2ZXAA 3LMYA 3SRKA 1HJQA 4LQ1A 3B4UA 4N9DA 3MUXA 1YYAA 2VGFA 2J88A 2Q6ZA 4GVFA 1SW0A 3W7CA 2ZZ6A 2ZRWA 4GX8A 4AWEA 4FPSA 3WQDA 2OO6A 3C3UA 3IVUA 5I3KA 4PN2A 4PFMA 3SY1A 4O53A 5HXMA 1GKQA 3F4CA 3LK6A 3TSBA 3IIOA 3MJYA 3L5LA 3E3HA 1CLXA 5BOFA 4O4WA 2DZVA 4F0SA 1ITXA 6TIMA 4GIYA 3ARYA 2AMXA 4GUHA 3ZLFA 4UTTA 2ACQA 4JIQA 3PG9A 5FSEC 1F8IA 3ZT5A 2YW3A 3CLMA 3TIMA 2YL6A 4K6AA 4TVCA 3MKKA 3B0VC 4R9OA 2PTDA 1TV3A 3CWOX 3RILA 3G6MA 4PSRA 3KOWA 4JTEA 4URIA 3OA3A 2CZ5A 4HNLA 4H83A 4INFA 4Y9PA 1NWRA 3UR8A 5C71A 4GWEA 3VKKA 3E5BA 2JK2A 3S9YA 4NAFB 4QS5A 3AJXA 1S5WA 3KFTA 4GE8A 3NQDA 3K8MA 5DRCA 1K7XA 1KO0A 3O06A 4JBRA 4NY2A 1EX1A 3OP2A 1FWIC 4FNQA 1MSSA 4M6QA 3PBYA 2R1NA 5CPQA 2QMJA 3L4XA 1PBGA 1V3HA 3BGJA 1IWAA 2PGRA 1XLBA 3E02A 2WLZA 5HUPA 1QASA 2OEJA 3FKRA 1YRRA 1A0DA 2CESA 2XH4A 3ARRA 1Q2SA 3KOXA 1EWEA 4NJJA 2G95A 1X38A 6ENLA 1E0TA 2YXOA 2DH3A 3ZR6A 2YXGA 3QMRA 3ONBA 3UVIA 2CKSA 3TXZA 4C6KA 5CBIA 5D8WA 2GL5A 4J28A 3VAVA 3TAKA 1TSIA 2OELA 3TLLA 3WMSA 4J2MA 3UF9A 4BEUA 4V1YA 2I56A 3KL3A 3UZJA 1NOUA 2C6QA 1C92A 3SJNA 1E3ZA 2ZC1A 3OBAA 3WF4A 2VNCA 2YDAA 1F7BA 3KS6A 2WBGA 2YCJA 4HNNA 4OZOA 1KFWA 3AISA 4CEUC 3VKCA 4C6DA 4NNCA 3H12A 3SECA 3UXLA 3RX3A 3DYMA 5FAGA 4Z0JA 3WZ0E 4DPQA 3WLSA 1WZLA 2R8WA 4LNYA 2XJ7A 3H4WA 3BOLA 2PCQA 1ITCA 1XUUA 1A53A 4DNMA 1OX4A 4FLQA 1IT8A 4DBDA 3WUGA 4L6DA 1VBGA 1ZFJA 2FMNA 3CHEA 2YFOA 4AHQA 4LC8A 4GZEA 1ZS2A 3D5HA 3PN8A 1QI4A 3OO2A 4IX2A 2QAFA 2XTKA 4CNTA 5E09A 1M04A 1M68A 3QZ6A 2RDTA 5ABFB 1ODUA 4UUIA 1Z9AA 2ZE0A 4AYSA 3GHTA 3NPVA 1TWWA 2PDXA 1IXQA 1M7XA 3MY9A 3F5KA 3PM6A 1AQMA 5CGMA 5HDRA 3QGVA 4WLCA 1YTKA 4NRSA 1W32A 1O66A 4KCVA 4PODA 3KRUA 3UP8A 2VVNA 4RCXA 1XGEA 4W9TA 2D3LA 3VIFA 3S1XA 4B91A 1AG1O 2DORA 2NLIA 1TTJA 3MI3A 3LB0A 5BU6A 1VBHA 5C70A 1E72M 3W7MA 1KM3A 1BXCA 2OODA 1V0KA 4YHEA 4DJDD 4UTIA 2HEJA 4N9EA 3NVDA 4PMJA 4PCFA 2IW0A 3IIVA 5FEWA 2QCCA 4AZ6A 2WLYA 3OYXA 4LBUA 1EA9C 1ZJIA 5AHIA 5FKYA 4DIAA 4KWVA 1JGIA 3JRKA 4DXVA 3W87A 2ZUUA 3M0YA 3T55A 2QZRA 1JGMA 4EX4A 3WK0A 3EMQA 4NX0A 1MEHA 4HU0A 5BWFA 2CHNA 3WK2A 3P84A 3BURA 4FX8A 5H6HA 2Y8UA 3HG2A 1HFBA 2FHFA 1GEHA 2EPHA 2ZTJA 4MM1A 4YJ5A 5FL0A 1JCMP 3CAQA 1FXQA 1OK6A 3CT2A 2A3EA 3SR7A 3J7HA 3VIMA 3P82A 3T6CA 2R24A 4NZ1A 2CLIA 2CNCA 1OZMA 6CGTA 2ACSA 4HZMA 4F2TA 3BDKA 3CPUA 4J3UA 2VCBA 1Y5WA 3H6OA 3WNNA 5I03A 1W5OA 1HVQA 3LEPA 1GYNA 3AQUA 1LOLA 4I6KA 4O1FA 3WQGA 7PTDA 2YYUA 3TYBA 3R8GA 4S3FA 3GVRA 2ZYFA 1NAL1 1SW3A 1ZAHA 2CBVA 3GG8A 3H23A 3OZYA 3ARPA 3GBEA 3NO1A 1DIDA 4GKTA 2NXHA 4REQB 1RZMA 2GVLA 4YU1A 3QGKC 4AWSA 4EVZA 3W7OA 4IPPA 4ZB2A 1FWDC 1R9XA 4OOZA 1WUFA 5D9OA 4O19A 3LM7A 4EF9A 1Y8BA 2WNZA 1X8FA 1VFMA 4PB3A 4UFJA 3VNJA 2ZX9A 1VF8A 4ZO9A 2V0TA 4JFSA 3QEZA 1ONWA 2Z6JA 3I3EA 1GYMA 4RW5A 5K9CA 4YTSA 5BOEA 1NQKA 4JR5A 4BJHA 4DHGA 4AZ7A 3MMTA 2VELA 3CIWA 3IAPA 5M2FX 4O0QA 3PG8A 1QMLA 4RE4A 3N04A 3MJMA 1A5KC 3IGSA 2P8CA 4JNYA 4ECLA 1UA3A 4KCUA 3ZR4A 3PS7A 3UPMA 3TR2A 3OODA 4EPKA 4BZYA 3LV5A 3KRBA 4QAIA 1E56A 3MCMA 5I23A 3HO8A 2E8ZA 3ABXA 2ZC8A 1MW1A 3O6YX 4C90A 3LRKA 2VXNA 3VTRA 1ENUA 4UXDA 3S1UA 2QJNA 4W8BA 5AC8A 4OJYA 4PTNA 4Q3MA 2E6YA 3V5CA 4DWSA 4UTLA 3SY5A 3PVFA 2GUBA 4LAKA 4DRSA 4D6HA 1JDEA 3GWQA 4Q8VA 3RM8A 3MVIA 3OLIA 3EMCA 3R12A 1GT8A 4C6BA 3N2BA 4Z1YA 1F3WA 1IXNA 2P76A 1VLWA 2XIMA 3BLEA 1QHPA 3LGDA 3CIVA 3MI2A 3QYSA 4UZSA 4H7VA 3W2MA 1W17A 1ADDA 3ZOAA 1R7OA 5FF0A 2WMFA 1JL8A 4O4VA 2DFAA 4OBRA 4B9YA 1JD9A 5FACA 3P2VA 4X0NA 4A3QA 1B4KA 4UB9A 1R9YA 5SWUA 2QPXA 1FKWA 1W1B1 1H50A 1RK6A 3NQEA 3WLKX 4DO7A 4PMDA 1EOKA 4ZQRA 1XINA 1SZFA 3I6TA 1F05A 3E0WA 4WY0F 1LBLA 1XLMA 2C3ZA 1U33A 2WWDA 2PWDA 5G2WA 1H1YA 5EPDA 1TV2A 3SCTA 1XH2A 3N2CA 4GH3A 1K03A 2JE8A 4CNNA 2QKFA 2V63A 4ONVA 3NL2A 4CNSA 3SSJA 5KETA 3CT7A 1JXJA 1JG9A 3W23A 1DJZA 3PBMA 2G96A 3CUJA 2D23A 4S23A 3W1TA 2E9LA 4K39A 4HHPA 1IEIA 1G7VA 3PAOA 2VX6A 4L1GA 5I3JA 5A6TC 3K30A 3B8IA 4AZ5A 3VPLA 2DJLA 5D38A 4RV3A 4TV6A 4JGDA 4KETA 1E9LA 4O15A 4HOXA 2E77A 4QJ4B 3A9IA 3G24A 1P7TA 4N9CA 3LGEA 2VR4A 4GD0A 4FX7A 3QPEA 1V8EA 4L80A 1M7JA 1ADSA 1G4TA 2E0PA 1EP2A 3PTMA 1C7TA 4MJMA 4XD6A 1DWAM 2F84A 1UZ4A 1DWGM 4ROQA 1ITQA 2ZZ5A 6PTDA 2VZOA 5FIPA 2A6NA 3OLEA 3TNOA 1EC7A 1VJIA 3AIEA 7ENLA 1LOQA 2FTYA 4GOAA 4MNMA 3EGJA 1S2WA 4DJDC 1T96A 4YTQA 3NA8A 4JX4A 3N19B 5G4HC 4KGJA 4DELA 1O5KA 3CPGA 4Z1AA 2DSUA 2JBMA 1DV7A 3PJTA 4E6MA 4QEEA 1VRXA 8TIMA 4UTMA 3QV8A 3F4VA 3UZXA 4A22A 3GC5A 3W26A 2WVUA 3MBDA 1EUNA 1GHSA 4HJFA 2BASA 2XSBA 4HA0A 3WDIA 2VQTA 1TV7A 3NJ3A 2HSAA 4PUMA 3PWGA 4I9JA 3S42A 2C79A 1SMDA 4E2VA 3T44A 5HANA 1ME7A 3M9YA 1QBBA 1RK5A 1EJUC 1E40A 5DBUA 2DSZA 3IGHX 3U4AA 4JDYA 3QSTA 4WZHA 5XINA 3B8SA 4A2RA 5IOBA 3CZ8A 1WKDA 1LBMA 3VIIA 3MA8A 2XFFA 3OQ8A 2NX9A 4M6PA 5DQPA 4AVNA 3ALFA 1OG6A 3THUA 4GI6A 2RGMA 3EB4A 3G1HA 1KV8A 1ML1A 3ID7A 1HKWA 3VOHA 4LBRA 4B16A 4XZNX 4AD2A 4U10A 3G0UA 3ABQA 2FPYA 1A4MA 1DWFM 2PZ0A 3EPOA 1YDVA 4LH8A 1QOQA 3RPMA 2EG7A 4FXJA 4IT1A 3FK4A 2OGYA 4UQCA 4AEEA 3I68A 4AEOA 4RPQA 1V7AA 1J2BA 5AC6A 3LM3A 1W3LA 3QOMA 3I3DA 2AKMA 3THQA 1J96A 1MVYA 1QUMA 2XWDA 1LYXA 1V6WA 2XSAA 2PPGA 4N02A 4W8LA 2YSWA 3HPZA 2VFDA 4HZ6A 4WX2A 1MQPA 1TZ7A 3GNNA 2DH2A 2GSJA 3CUGA 3DI0A 3QMSA 5LHEA 4FF5A 4EPEC 2O9OA 4YWIA 2QCDA 4N42A 4MKNA 1AMYA 4NQ1A 3UWQA 1KRAC 1HL8A 1EOMA 1HT6A 3BGGA 4QS6A 3VIKA 3N73A 4A3UA 5M5DA 3WBXA 3WD0A 1OF8A 3PK7A 2WSQA 2Y24A 4GYJA 3NSMA 2PDWA 2QUMA 3QXBA 5C5YA 3WEOA 4PEKA 5CJ5A 2VZSA 4FP1A 2HWGA 2WANA 4C6EA 4HZ7A 4RW3A 3RCMA 4UFMA 4QXIA 2GK1A 4LYKA 3UWVA 4LUYA 3S3GA 5TQLA 3EMZA 5AHMA 3KXQA 3G22A 2V82A 3ATYA 4NRRA 4F0HA 1ZNNA 4HSHA 1I45A 4GA8A 1B57A 1S3HA 2Z6IA 1UR9A 3LHUA 3BARA 1XV8A 2GVGA 3DHPA 4HMNA 3T42A 1EPXA 4P8XA 4AIEA 1FWWA 4H2CA 2A3BA 1EIBA 3HMCA 4MWAD 1SZNA 3PB2A 3F4NA 1ISYA 1PSCA 2C7FA 1JDFA 2F61A 3LYEA 3WQ5A 3FJ6A 2BVTA 1YLVA 3MSDA 1GVFA 3WQEA 1MW3A 3PHAA 2ADAA 1UC5A 3UPWA 1R5YA 2GOKA 1DTUA 1JF5A 3LHTA 2QCLA 4N6FA 4WIWA 4AZIA 2NQZA 5EMKA 4BS0A 1EL3A 4HYRA 3W1AA 1L0PA 4IXHA 4B15A 4C7GA 1NVMA 2D22A 1P0EA 1EBHA 3AXIA 3ALGA 2Q3RA 4UWMA 2J62A 4XVDA 3H7VA 3CYVA 4TX6A 4MB1A 1TX2A 3WD2A 2B81A 1OYCA 3RU8X 4UQDA 3CO4A 3ICJA 5DEZA 3TMLA 1X1ZA 1QPRA 2Z27A 4KEUA 4LYPA 3T4WA 2CXEA 3O6DA 1WDQA 1M5WA 5U4NA 5GJMA 3R10A 1ITUA 3RDKA 1G67A 2OZ8A 3S2LA 2INEA 2H3DA 3G3DA 1KCXA 1T8QA 4LGXA 4IPNB 4R85A 1BEUA 4J3WA 3V5OA 3WSUA 5AHFA 1OFAA 2HK0A 1A5NC 1UKOA 4K2SA 3WY1A 4WGHA 3AZTA 1TWSA 2Q8XA 1NFPA 4IIDA 1JI1A 2O9RA 4UR9A 9XIMA 5HWJA 4LVDA 3REQA 3EWWA 4H04A 4YTTA 2FZ8A 2CZVA 3UXDA 1WDDA 3AS0A 3MI6A 2OXNA 2JALA 4WJXA 3IIPA 2ZDSA 4LVFA 2J7GA 3RN6A 4A3YA 4HKPA 4GGBA 1R85A 4GC3A 4M81A 5L9FA 1ODZA 4N2YA 3WQCA 2VFGA 1J8VA 1F6KA 3VIOA 1FA2A 5FF7A 1EKOA 1UD3A 3SUWA 3QN3A 4UOJA 4C5YA 1YPIA 5JMUA 4GIRA 1QAPA 1TJ0A 3ARXA 2UWFA 3M0IA 4R9XA 3LPPA 3I7SA 4DF0A 1H09A 1E1FA 5AYIA 3W2UA 3B8VA 4MUPA 1E70M 5F2MA 2NV9A 4J3TA 5LKYA 3U7BA 1WOAA 3SFWA 5CJMA 1W1PA 4F0KA 4K8GA 3ES8A 4Q33A 4DLMA 1B3OA 1RSCA 3QVQA 5FCZA 1UKPA 1CGYA 1POKA 4MHBA 2EPLX 1P6WA 5C9XA 1K7EA 1EC8A 3RUBL 2HNHA 4NJKA 4D6EA 2E1DA 3SUVA 3F4DA 3P8IA 2C91A 3MSRA 3NQMA 1W3TA 3P8JA 2VX5A 4EXAA 2PCEA 4XBKA 2POZA 2JEPA 3FEMA 2VENA 1NOWA 3IJ7A 3L0GA 3LI0A 3LPFA 3P67A 4DYEA 3WL0A 2IKIA 4G56A 1Q6QA 5D8ZA 5KMYA 4I6VA 3KBJA 1PIFA 4JTKA 4RV8A 1DXFA 1OB0A 1NP2A 3PAJA 4E8DA 1XIBA 5KZDA 1C9DA 1Z42A 4U3AA 1RCQA 5C2GA 3Q94A 4QX4A 1RQBA 1XLLA 2ZCGA 1CEOA 3VVGA 3VMNA 2J7CA 4L9XA 2R9RA 2TPSA 1FOBA 4BA0A 2ZVIA 1L8NA 4GBUA 1DXIA 4K38A 2DVTA 4OTKA 2WCSA 2FJUB 1QHZA 5T9BG 3VABA 2W91A 3VMPA 1GG0A 5HNNA 5XIAA 4GNJA 2C1GA 1JZ4A 2BG5A 4PMYA 1PZ0A 2Z0IA 1GJWA 1YPFA 1XRVA 4Y96A 2WHJA 3WK1A 4PTWA 8RUCA 4JIEA 3DC8A 4P7QA 3LQGA 4IIFA 3FHAA 1GHRA 2YOCA 5CZJA 2W3ZA 2WZEA 3NQFA 5T9CE 4CUCA 1RBLA 3EA3A 1U1UA 4N4PA 4X60A 3LD5A 3QM3A 4L4LA 3F4WA 3QLDA 3WLHA 3VOFA 1PL9A 2ANUA 4HHHA 4HA3A 3O9NA 3V16A 3BAKA 3N15A 2A3CA 4IGSA 4NI8A 3T0AA 4BQ5A 4MJ2A 2VDIA 3GDTA 1XQLA 1P0KA 1W2PA 2PDBA 3L4WA 4GQRA 4LSBA 4HU8A 1FTXA 1NF0A 4IMDA 3UCQA 1DBTA 1P6CA 2BTMA 3NPUA 3DC0A 2YFNA 1Z32X 1A5UA 3KRSA 4E3VA 4Q22A 1BVNP 4DF1A 4O1EA 2AMGA 2CBUA 4HCHA 1TWDA 1LM1A 1R6WA 3FOKA 4MWAC 2WM0A 4XUGA 5BRPA 1HL9A 3T2PA 3HJEA 1LDCA 3ARUA 2IQ0A 3CWHA 3AYRA 1VENA 5LIWX 3GW3A 4IHCA 4D8ZA 2OWWA 2ZX8A 4L4PA 1YDYA 4TU1A 3UJ2A 4HNVA 3BTNA 3E2SA 1AZ2A 1XC6A 3COTA 2YA2A 3BWWA 1EFZA 1TPEA 2PZNA 5LIYX 2YZ5A 4IIGA 1IGWA 4LCRA 2CLKA 2GGGA 4DO5A 3UNTA 4JHMA 4Q8OA 3V7PA 4R7WA 4GC4A 2GQ8A 4GY0A 1DP0A 1X1OA 2AKZA 1TWZA 2J24A 4G9PA 4B2DA 2OKTA 3OLDA 1CCWB 3AO0A 2GGIA 1EP1A 4JICA 2GOUA 3OOQA 1VBRA 2YIHA 1UP0A 3GDBA 3T8LA 2QJMA 1FP8A 2PDYA 3OG2A 4M7TA 1XLIA 3NOYA 1JNEA 3IJDA 3BUVA 1CGXA 5FF4A 9XIAA 2CLHA 4BF7A 1K4HA 4C60A 3VCCA 4KIEA 3MSYA 5CPSA 1RCXB 3VCNA 3S5NA 3BL3A 1Q7QA 1RA5A 2O0TA 4DWSC 2IPWA 1WA3A 3ANYA 3CH9A 2E4TA 3ZLHA 2E5DA 3T0BA 4DUWA 4EACA 4PMRA 1KRBC 1A5LC 4CQDA 5HWNA 1FCUA 2V5DA 4POCA 1SJDA 4IFOA 2E67A 5LIUX 4MADA 3SBFA 1ZCCA 3H2AA 4B3KA 2INZA 1R3WA 5F7UA 1RPKA 2Z1VA 3WQ8A 4PYSA 3FDKA 3QR3A 5CLWA 1TRDA 1E15A 1S5VA 1YADA 2HE5A 3TW9A 3W6LA 1GZ1A 1UHVA 2W9MA 3SZ8A 5D2XA 4UMAA 4JQ1A 1V3JA 3WQFA 4H9VA 4NAEB 3LXBA 4Q7BA 4S2CA 2ONEA 1U2YA 4NZ3A 4GKLA 1PDZA 2NWSA 3TN5A 2C1HA 4BY3A 3F5LA 3G6LA 3QLLA 4DUVA 1XIJA 3M1ZA 1OF6A 4NAFA 1W2VA 1UKQA 3SI9A 1KLZA 2OCZA 5JUVA 2JEQA 1OZQA 4O13A 1B3WA 4QLKA 3S2JA 4GY7A 3VIPA 5E9AA 3QHNA 1X39A 2DVUA 4UQBA 3BLLA 4O0KA 4B90A 4PCTA 1EDTA 5FI8A 5I06A 1UR3M 3T2QA 4ZO7A 5T26A 4AD4A 1EP3A 4LBSA 1LZOA 5TNVA 3AUOA 2HXTA 2YKKA 1JULA 1X96A 1E0VA 1P1XA 2CW6A 5HMEA 3DAQA 1TTIA 4IH3A 3GXNA 4DZAA 1SMAA 4KBXA 3Q2DA 3S2MA 1G5AA 1DVJA 1LORA 3ARSA 5B7ZA 2ZXDA 5I6SA 3GVVA 5CCZA 4QE5A 2BY1A 3NAVA 4L9YA 4XZLX 1QWKA 4IL2A 1S38A 3SCVA 2QGHA 1R2RA 5GPRA 2ZX6A 4XD4A 1RY0A 2NX1A 1BG4A 5HAOA 1XBXA 3T05A 3JVAA 2QJGA 2X0SA 1GVOA 4ZMGA 5KINA 1QNRA 3GVQA 1WXZA 1F73A 5K7JA 2UY5A 3B04A 2G37A 3THAA 3MMWA 1N8FA 1W5MA 3WH6A 3N9RA 4DBSA 4GBDA 4H01A 3W07A 5GJPA 4JFWA 1F3TA 5AOUA 2V69A 4IISA 4J2PA 4DJEA 5A8NA 1A5MC 1J6PA 5DXXA 4E3TA 3GVWA 2FGLA 5BMXA 3T07A 3FKKA 1W3NA 5J8LA 2Z7KA 3ZWTA 4AZGA 1UWIA 4JKLA 2HCVA 5D9NA 4LEQA 4JXCA 4JFUA 3W88A 3T08A 4O10A 3BICA 3CL8A 3NM1A 1V02E 3KVLA 2VT0A 1QDSA 2BHUA 2QR6A 3VGEA 4XK2A 1EYWA 3BJTA 4C6MA 4ZO6A 1NWUA 4AWUA 3B05A 4LF1A 1PJ9A 1BSLA 4JYDA 3S8HA 3W9ZA 2J75A 2QUNA 3NYDA 4RJEA 3VKAA 4AU0A 4S3BA 3TP4A 3IANA 1UKSA 4M0XA 2HPIA 5J5DA 1KFLA 3SIMA 2PRHA 4K37A 2D2JA 2X7VA 3APGA 4AG0A 2NLYA 2YXXA 4FB7A 5ABFA 1N82A 4LTSA 1CPUA 3TC6A 3IUHA 4LWWA 3AUJA 4XTDA 3AI0A 2VD9A 3AALA 1W3KA 4H7ZA 1K8CA 3STCA 4KFNA 4MZYA 2WYSA 5ABHA 3NFUA 4OUEA 2MANA 1WBHA 2FGZA 2P3EA 4RPPA 1PE1A 4E38A 4KWOA 1CGVA 4PA8A 2BWGA 1BYBA 4C6FA 1KRMA 1FP9A 1R3VA 4W5ZA 5GJNA 5CBBA 3TUUA 3KBNA 1V6UA 5G1YA 2GDVA 3ARWA 3OW1A 4YYFA 1H41A 4LV9A 3VNKA 1UP2A 1OFRA 3FA5A 4V15A 1IGSA 1D9EA 2PGWA 6TAAA 4Z17A 3AU6A 1E5NA 4JL1A 4MAVA 4ROPA 5JXQA 2QCMA 4NL1A 4W7UA 5CXPA 3ARQA 1KR0A 4WDWA 3E38A 2WCAA 2V3GA 1FUYA 4Y9NA 5HJLA 2XVGA 1Z8AA 4LS0A 4D6JA 4ZZ9A 2WJZA 3S4TA 3VD3A 5EA9A 1F9CA 4UNIA 5EB8A 1TWIA 2GQ9A 1FWEC 4HNCA 1JPDX 2WVSA 4DF2A 3EX1A 2PC8A 4IX0A 1PTGA 4QE4A 3CTLA 4JTGA 1RBAA 4TX8A 2F6XA 2W63A 4S1FA 5E5CA 2E40A 4XZ9A 1SU5A 4CQAA 2IQDA 4WCJA 1W6TA 1XGZA 4PMNA 5DCBA 4MTVA 3ERPA 2EG6A 3FY1A 2WQPA 4FF7A 3S1GA 2DJXA 4CVUA 3NUKA 3BXWA 1HKJA 2PURA 3LBOA 3MW7A 4CQ8A 1NFBA 2GDQA 2PAJA 3ZM8A 1QI2A 3TCEA 2V8ZA 9CGTA 3OEXA 2ATMA 3LX9A 2CEQA 1XLFA 3AMGA 2HISA 1OCNA 5B7YA 4FK9A 1ONRA 5CEWA 1QHOA 2J8FA 4UCGA 1GZJA 1JQVA 2GZXA 2XUCA 1J0ZA 1H7RA 3W75A 5CG7A 1L2QA 4JHOA 4REQA 3N9KA 3TQPA 4UFIA 4G8TA 1R30A 5K3VA 4D6GA 2EJAA 3WMLA 1QW9A 2HS6A 3VILA 1QW8A 3EXTA 3ZLGA 3FJNA 5DLCA 4F9DA 4PMXA 2ZWZA 5D09A 2DQXA 5ABGA 1SYTA 1VYPX 2YYTA 3OVPA 4N6EA 5CPNA 1TJRA 3DHFA 3HQNA 3L0KA 4KCWA 2H9AA 3G8EA 1I8JA 4Q4QA 3VCRA 3R0DA 1OGSA 4JKKA 3RM9A 5J5RA 2XIBA 2CCRA 2ZOXA 4FAMA 4CCZA 4O18A 3FAWA 1L6GA 3PC0A 1GUVA 4O28A 3N2XA 3DHDA 1OYAA 4XKYB 4HB7A 4M1RA 2G3IA 4UTHA 2R91A 4ML4A 2QF8A 2WZTA 4BF5A 3N13A 4DVOA 1OM0A 1R87A 4FR1A 2V3DA 3H2FA 4K36A 1AODA 4D72A 3QY6A 3MV11 3EWYA 2HZGA 3OQEA 3AS2A 2AGKA 4YN5A 4C1LA 3MHGA 5GNXA 4YLWA 3CQ0A 1KM2A 3R43A 3C2FA 3CUHA 3HB9A 1QFEA 1QNVA 1ME8A 1FHUA 2NVDA 4WDUA 3L2IA 3TOYA 1K02A 5EL1A 4OHQA 4OWGA 3M5ZA 1Q8AA 1JZ3A 1N55A 1DJXA 5T8GA 4Q7IA 2D0FA 4Q6XA 4EPDC 3DFHA 3T0TA 4BWLC 1I60A 1KBBA 4J3ZA 5HPOA 1J01A 4MYAA 1BXBA 4G1NA 1Q5MA 5D2TA 2ISSA 3MT1A 3WNLA 1TPC1 1TPDA 3MANA 1XXXA 4L65A 3PNZA 5DCDA 2V3FA 4DBWA 3THCA 4YVXA 3QHOA 2L5HA 5AHNA 2DDXA 1BVWA 4GQBA 2NV1A 5BYWA 4ADTA 4I5XA 4ALDA 2ZUNA 1XJBA 4US6A 1LLOA 5A8OA 4IMAA 3USZA 1Q7MA 5F2IA 4RNHA 4QEHA 3OHIA 4OT7A 5ECUA 4FO4A 3XIMA 5FJIA 1XBYA 1NP0A 2A7RA 2OU4A 4L5ZA 3GFZA 3D3AA 3UZYA 4GABA 1UZ1A 2DT2A 2OLHA 4Z0SA 1I2PA 3UXIA 1IWBA 3U4FA 1ZCOA 4LVBA 1MRQA 1LRNA 4EK7A 2FB2A 1DWHM 2PWEA 4DUXA 2VL4A 5A8GA 1GYLA 4A29A 1O1HA 2J6VA 2ZZ2A 1GOOA 3SCOA 1W9PA 3MHFA 4AF0B 4HA4A 3RGTA 1OWQA 3LHZA 3E9AA 1OHLA 1VEMA 1MQRA 4LXFA 1QPNA 2HS8A 5EU9A 4M8UA 3RPTA 3GH4A 3LHWA 1H1NA 4J27A 1EJSC 4IF2A 4HGXA 4QLLA 1T99A 2ZUVA 5CAKA 2TSYA 4MFEA 4S3KA 1RJPA 1P7TB 4D2JA 2OQHA 1L6YA 2X30A 2WPBA 4D1IA 4Q8QA 4S3EA 4B5TA 5CZKA 2VHLA 3UGRA 4ZOEA 3G1SA 3AXMA 2DV0A 3HGSA 3LMZA 4AZBA 1HTIA 1V0LA 3VNLA 1Y65A 3JR2A 1MXSA 4OQVA 3W2NA 3PR2A 4ZQMA 4HNUA 4RDZA 2QDEA 3L4ZA 4H7CA 1VKFA 3RFAA 2YLLA 2DY3A 1DOSA 2WJEA 4NYUA 2QULA 1ZQ5A 2BGNE 1UWTA 2AOSA 3MB9A 3RO6A 2DP3A 2CITA 4DJED 1TZ9A 1X98A 3A3HA 1CI1A 4GZ7A 4I8DA 5HQLA 2WHKA 3BOXA 3L2LA 4JTLA 1VJZA 2H8ZA 2ZDRA 3H21A 1Q7ZA 3NL3A 5AVNA 2VKZG 2PS2A 4RZ4A 1UOKA 3GDRA 1VAHA 1ZRQA 3DYPA 3TMQA 2GUUA 4JQAA 1L6WA 4PMOA 4QSFA 1E6XM 2ISVA 3WMBA 1PTAA 3FX4A 3GS6A 3AIVA 4X61A 4ZXLA 1VFUA 4K3ZA 4XWUA 4H2HA 3VYLA 1JJKA 5FF2A 5C8BB 4JYEA 1VB9A 3DFNA 2NSOA 4CD7A 4Y9MA 3TN4A 2WJDA 4JTIA 3HPFA 4LVAA 1S2UA 1K6WA 2ZICA 4B5UA 3HBLA 1Q2RA 4BI7A 3LQLA 3GXMA 3DKLA 5LHFA 3UETA 3KP1A 3PPFA 2VDGA 2DZBA 3CK5A 1KWKA 1T5AA 2ZX7A 5DMLA 3V0TA 1OX5A 5I77A 2G5WA 3OVRA 1CENA 1EHAA 5DMYA 2D2GA 4MY8A 3O6AA 1XLCA 3FGCA 5F4XA 1K77A 4K68A 4Y9AA 1TV4A 3PWAA 3NDZA 2A2IA 4DM1A 4JEJA 4GINA 5LGZA 1CLKA 3D3FA 2QLYA 3VGFA 3WLPA 2FJKA 1V3LA 2P1FA 4H1ZA 4IJBA 1O4UA 1KFKA 4J3VA 5JBFA 4MNJA 3W7JA 4YMZA 3RYSA 3R1ZA 2WSRA 5CSYA 1HGWA 1MDLA 1SSGA 1UD5A 3BG9A 3TE9A 2NQJA 2BHYA 4WEVX 3GXDA 1BF2A 1CX9A 5F4WA 1B0IA 3LA4A 3URBA 3GTIA 2VVSA 4WRHA 1PV8A 3P62A 3AIRA 3M64A 2RDWA 1PWLA 4J3SA 1NF7A 4JTJA 7A3HA 3G3MA 4TR9A 4C7DA 2WCGA 1V51A 1T8XA 4OECA 2Z7GA 1XFBA 3O1NA 3G1YA 1BD0A 5A6JA 3KBVA 3W6MA 2VOTA 4KERA 4ADSA 3GR7A 2JF6A 1DJQA 2XVKA 1KA9F 1Q4WA 5BCAA 2WO5A 3W1MA 3VK5A 3L0NA 3GZAA 4YNGA 3A4AA 1K9TA 5D05A 1HQTA 3BAJA 4GZIA 3SUTA 2ZZ7A 3VZXA 4GH1A 4AX6A 3LSBA 3AWNA 3LI1A 2WZHA 3W85A 1XS2A 3OVGA 3ABSA 4A2SA 4AX7A 2X1UA 4NX5A 3LLXA 3C61A 4HQVA 2OSWA 1ZLPA 2INFA 3OBKA 4PMZA 3KBSA 3CASA 1SSDA 1N8WA 1HO1A 1FDJA 4IQDA 1D3GA 4GG9A 4G2DA 4QCFA 2WQDA 1DKWA 4TTUA 3RLUA 2PGFA 4D6CA 1WZKA 3WQVA 2WNNA 3I6RA 4GI4A 3MS8A 3LHVA 5FJOA 5KZMA 4PEEA 3UWYA 3QV6A 3E0LA 2PMQA 5C9UA 3A3WA 4M7SA 3VGHA 3EYPA 4R7JA 2C71A 3I4EA 4PTDA 1VC4A 2AQVA 5CLTA 1LUCB 4JTSA 4ADUA 3UU0A 3O16A 3KBWA 1R0MA 1XD1A 5C6MA 2GWGA 2QCNA 3LCGA 1BYCA 1TPFA 2J13A 1J79A 1OJXA 4ZBCA 1Q6GA 3U5UA 3N4EA 4ZL1A 1YNYA 4JTQA 1V79A 1OT1A 5CBJA 1GVRA 2Z29A 5LA2A 1H62A 4XAZA 4QLJA 3MUY1 4NNAA 3T4CA 3W74A 2WNWA 4PUUA 2QIIA 1GORA 3MUAA 5AYXA 3HURA 2GDUA 1WZMA 4Z2JA 4K1GA 2B7PA 3GXPA 1LOSA 1TMLA 3WJYA 1WAUA 2OQLA 1XYMA 4AFYA 5GNZA 1UUMA 1E6RA 1OFDA 1U1HA 4FHAA 4NU7A 4RXFA 3EZ4A 1AJZA 3EX3A 3CB8A 3MKCA 3DU0A 2QDHA 3AIWA 1UG6A 3DFSA 5C0QA 3G1DA 3BAYA 2WVVB 3EEZA 3REQB 2WMIB 2QUTA 3W7HA 2XINA 2PGEA 5D9MA 2Z1KA 1H7OA 3WQWA 3UYIA 3GXIA 2CZEA 1LCOA 1QNQA 4FNSA 4PMVA 1N2VA 1DJGA 4PB4A 2AQWA 5BXSA 2NUXA 5HA7A 5C2CA 3ZYZA 1WXJA 4A21A 5D02A 5JH1A 2OO0A 1FH9A 2F8QA 3KVMA 2CLMA 7REQB 1XPGA 3PPCA 3VINA 3TZFA 2WW5A 3DBPA 4R88A 1O12A 1R38A 1PX4A 5A95A 3L65A 5FEXA 1TMHA 2X7WA 5DRIA 4EWJA 1RY8A 1QNOA 1ZZMA 5BROA 4DJEC 2BOGX 3LTSA 1KFBA 2VC5A 2KAUC 3WBEA 3KTSA 2RAGA 3NZ1A 4LRSA 3H8AA 2FZDA 1KQYA 3NSXA 3ONCA 1NDZA 3H2MA 3VOCA 1OCQA 2Y7FA 4D71A 1VFOA 2AGTA 3EXRA 1TVLA 2ZRYA 2FVKA 3FXYA 5I07A 3VDAA 4LF2A 1MWOA 4CN1A 3DHUA 3URQA 1B3VA 1GW9A 1UP3A 3AROA 1DWIM 3DN5A 3BMXA 3RAOA 1W1ZA 4EF8A 4CU6A 4JL2A 3W38A 1LWIA 1IEXA 3TK7A 1DEDA 1YDOA 2WC7A 3LCWA 3AHYA 1R3TA 1TUFA 2X0YA 2AQOA 3W73A 4X22A 3LNMA 4AISA 4UR7A 4B5VA 3ITOA 1EJTC 5IDZA 2F6UA 1LLZA 3POHA 4OUIA 4E8GA 2WKJA 5BRBA 3GW0A 3HG5A 2DZUA 3VE7A 1XWYA 1XKJA 1IWPA 3PNUA 3TYZA 1XM3A 1HJWA 1SO3A 4CD6A 1A5CA 3UT0A 3JS3A 4H6QA 1DJIA 6XIMA 1XW8A 2BOEX 2I1OA 3WENA 1JVNA 3AS3A 3FYPA 2EQDA 3DG3A 2VX7A 5DELA 1V93A 2OYMA 3BQ6A 1LQAA 2F7FA 2RGLA 2RUSA 3HTWA 5K9XA 5T91A 1OQFA 4GJIA 3M46A 4KGLA 3WN6A 4H8HA 5CSRA 1UROA 1KTNA 1HP4A 2WC4A 3FNDA 4ACZB 1JAKA 4AMCA 4ICNA 3WX7A 4EAYA 3W72A 2CYGA 1KBKA 1UQYA 7TIMA 1MUMA 3LPGA 3RIKA 5LXEA 1UMYA 4U33A 1E4LA 5CZSA 4LB4A 3W2LA 1BPLB 4XQ6A 3UFYA 1Q4NX 1TV8A 3U5YA 5LNSA 1G01A 3MDWA 1TG7A 2AAAA 2IPFA 3EWXA 2YJQA 4NG3A 4GK8A 1E71M 3UG3A 3WEMA 3BE7A 1YEYA 5EY5A 1IT7A 4OKDA 3IVSA 2Q01A 3GHRA 1N8IA 3B0PA 2FLIA 2EG8A 1ESWA 1M7PA 3HGOA 3V1PA 4CCEA 1MEIA 1SO4A 4XV0A 4S3CA 2J25A 3T81A 2H6RA 2PWHA 3NM3A 4HSOA 1OIFA 3VDHA 3WUBA 1MZRA 1JZ2A 2IKJA 3C52A 1W1YA 3R79A 3PUGA 3CL7A 2OYLA 5TIMA 2X2YA 3G1FA 1ISXA 4GYKA 4JY9A 2BS9A 3ZJ8A 1BYAA 3M0XA 4H8NA 2JF7A 4KQNA 4M19A 5IHSA 1DPMA 2W27A 1YHTA 4AZHA 1PKYA 3A21A 3T9PA 4QJ3B 5FEPA 1PHQA 1Q3NA 2I14A 3GDKA 3CV6A 4GISA 1BQGA 2HQAA 1WDRA 1UR0A 3CV2A 1TTPA 3E2RA 1IR2A 1RAKA 4M5PA 8XIAA 4GACA 3UY7A 4GYPC 1F8MA 4XAGA 5E6ZA 1KRCC 2O92A 1U5HA 2BV9A 4E0CA 1W8SA 3JUGA 5H91A 4UQ9A 3B8TA 1RCOB 1LTDA 1UD8A 4ICMA 3W86A 5FD0A 3PTKA 3NG3A 3U2CA 4IUOA 3C0SA 3DECA 3UA3A 1CYGA 4B5NA 3M7WA 1EGZA 3VDGA 2YA1A 2OVLA 5REQB 1PAMA 3KDOA 3P61A 2VWSA 3E2VA 3VO0A 4JNMA 2OX1A 1JQXA 5K4XA 2IMRA 2C0AA 2VGGA 6A3HA 1QI0A 5EMMA 4LS2A 4XAFA 2O4MA 4AH7A 4HMCA 1YQ2A 3AOFA 1QU4A 2YGYA 3IJ8A 2V2HA 1XH0A 4AVOA 4P8VA 4XBJA 4RKAA 2ZXBA 3GTNA 4PH6A 1LT8A 1CXHA 1UASA 4BF9A 1ZTVA 4UBPC 2J7FA 3TAOA 3TN3A 4CNOA 1L2UA 3TDFA 1G7UA 3LG3A 2OOFA 3GQYA 4HK6A 4DEFA 3NO5A 5I24A 4JAWA 4A8RA 1GOKA 4NXKA 4LVGA 4GXMA 3N2MA 1UMLA 3VGBA 1MO0A 2PF8A 3VXGA 3UG4A 2H90A 2CZDA 3M47A 2P0OA 4RUBA 2G8ZA 1CXIA 1UUQA 2PDMA 2XH7A 1XICA 1GEQA 5I3HA 2YCKX 1KQZA 2D1ZA 5FESA 1M01A 2BGSA 3NGFA 1H7PA 3TSMA 1DYSA 4L7ZA 3HGJA 3GKAA 5HQEA 1T6MA 4B9ZA 2I5IA 2XN0A 3FFSA 1SJBA 4CCDA 5C2XA 4LAUA 4E4PA 4W88A 5I00A 4Y2WA 4NAEA 4Y90A 3URAA 1EB3A 4FR6A 4ZQNA 4PE8A 4GY1A 4GCAA 5A6MA 2GJRA 4NUWA 1FXPA 1PKLA 4XIMA 2I17A 2VR2A 1D2KA 3TEVA 1SZRA 4YTUA 3ZSSA 3IK4A 4QQ3A 4HK7A 4YHGA 4ZFCA 1CB2A 5B80A 1QK0A 1NELA 4J1OA 4AMAA 3UG8A 4MWAB 5C9WA 1P43A 2NUYA 4CQCA 3SIZA 3UWEA 4RZ5A 2XIQA 1XISA 4ICCX 4OV4A 3QSRA 2YL9A 2FYMA 1C8QA 4LB3A 2XH0A 1FWCC 5A6KA 4Q8MA 2OFJA 2F9RA 2ZRZA 1OBAA 1QR7A 1JYVA 2CLEA 3WDHA 1A5OC 1PHWA 2HBVA 3B9DA 4CNUA 1BTCA 3KCOA 4WKFA 1QI3A 1XIDA 3S46A 2OZ0A 2PDQA 1H0IA 2GYIA 4HN8A 1V3MA 2DU2A 5K2ZA 2VURA 4TX9A 1H5VA 2OSXA 3UR7A 3PANA 4WKAA 3CZEA 2FPTA 2ZA2A 1UOZA 3ZIZA 4BR1A 1CZ1A 5HMFA 2VGIA 2FVMA 4UOZA 2E9MA 1AZ1A 5A6BA 6ALDA 4OIFA 3E2QA 1XRFA 3RJXA 4MG4A 3TU9A 4PRRA 3S6OA 3T78A 4FNPA 2EGZA 1VBUA 4UTFA 3TJIA 1ICPA 1W56A 1TV5A 3NNTA 2TODA 3ZSTA 3APTA 3E0FA 3WIJA 3N34A 4ZEPA 2A4AA 3CO8A 1LQ0A 4QQUA 2A85A 4CD4A 1VHNA 3TTEA 3W02A 3L9CA 3STEA 5G5IA 4W86A 1TJ2A 1ZJBA 2PLJA 3L7RA 3TOPA 2EPNA 4FOJA 4ATWA 3EOSA 3BLOA 4IP4A 1ZBCA 5CPLA 2PDLA 4EWND 4JKMA 4QAWA 2VD8A 2QDDA 3DDMA 1DIKA 3OU8A 1UUOA 2HRWA 1E3XA 4MIMA 3RLHA 3QV7A 3KW3A 4IFRA 5HR7A 2FKPA 3AYVA 3H55A 3AZRA 1W9VA 2OMAA 1HZYA 1TR9A 4NHVA 4TUFA 3BJFA 3MBFA 3NEVA 3S1VA 3MYPA 1XG3A 1GVYA 3HQPA 5F2LA 3N6JA 2X2GA 3KTXA 1S5NA 1XIGA 3HFTA 4PTXA 1ISVA 4DJFA 4QE1A 4S38A 2Z25A 2P53A 3CC1A 3GFXA 2ZE3A 1TTQA 1K8ZA 3RITA 3PWIA 3GG7A 1XDJA 3EX6A 3N29A 4FEZA 1D8CA 1PO9A 1K9FA 4GNVA 5ENLA 3H2CA 3QQ0A 3QHMA 1HJSA 4KEZA 2V38A 3BLDA 1AA1B 2G41A 4H9TA 2GVYA 4BHYA 1F4AA 4GO9A 5G4EA 3PSWA 3SFKA 3CEPA 4G1KA 4NVTA 4CN6A 2Y89A 3KWXA 4JN8A 4G6CA 5DF0A 3KBMA 3WQ4A 1ZBKA 4AIOA 1TCDA 3Q4DA 2BLEA 4CGTA 1TPWA 3GK0A 2MNRA 4CEXC 3M5XA 1OY0A 1EX5A 3IUIA 3V0UA 3PUOA 5A3HA 2DPEA 4LCSA 5CZTA 3AZSA 4H6KA 1LRQA 5I3DA 3M43A 3RPDA 4C6OA 3TTYA 1X8CA 1K9EA 1FHLA 4G7EB 5C7HA 3WYZA 1F6PA 2BVYA 4Q8TA 4KRTA 4RL3A 3B8UA 4X3ZA 4PBFA 3C6CA 3L66A 3CU2A 4BFAA 1JRCA 3TZNA 4D6IA 3EDJA 4D6DA 5AECA 2B7QA 1WKFA 1EYEA 4GRSA 1XLEA 1HKMA 4MPQA 4GNKB 4RNFA 5TD4A 3QKZA 1WV2A 1SM9A 3DX5A 1VEOA 3VKDA 1HXJA 2FVLA 1QTWA 3UWZA 3EWCA 5LNVA 4I5RA 3DERA 1XGDA 2QCFA 2OZ3A 4B5XA 2VEPA 4GX9A 4AC1X 1E6ZA 3WD4A 3B97A 3AWOA 4IL0A 2CU0A 1FHDA 4C6LA 3F2CA 2O9PA 1Q45A 4G5DA 1I4NA 2ZX5A 3W4RA 5JIPA 1XUZA 5FJJA 3VOJA 1A50A 3IAQA 4XIAA 3LCHA 1MZHA 4XZWA 4FALA 3MO4A 2NVAA 4WGXA 3RMEA 2QEZA 4R27A 3BCFA 2H9AB 1FCQA 2ODOA 1TPVA 1ICQA 3KWSA 1JCTA 2ZWYA 2YR1A 4OE7A 4JEQA 6XIAA 1RLDA 4F48A 2UY4A 3V35A 1HJXA 2VX4A 5CSUA 3EPNA 1XLJA 2DT3A 2VFEA 1JUEA 4JX5A 1J4EA 2IPGA 1LJYA 3V3WA 2QVHA 1V6VA 1EXBA 4XKYA 1JCJA 1VCVA 4W8AA 4XKMA 3KRZA 2PD5A 3BQ5A 3C2VA 2OR2A 1W9XA 3VC5A 4HJWA 2VM8A 3N6HA 2QUUA 3INPA 3TYDA 4UTWC 4MJ4A 2P3ZA 4HSNA 1KCKA 1WKEA 3IACA 4R33A 2FH8A 1W8GA 3IJLA 2OWCA 1AJ0A 5BXRA 3OIXA 3W83A 4Q32A 3LLFA 5DO8A 3WH5A 2YBUA 3MP3A 2IUZA 3C4UA 1H60A 2O7SA 2VYOA 2WZMA 3OHMB 4S3AA 1I6NA 5G4WA 1SR9A 1R86A 4JYFA 3BAIA 4DYJA 3VD4A 1SGJA 4H00A 4ZODA 3A23A 3LHYA 3EA1A 4DZ5A 2PODA 1WXYA 3PB0A 5BU9A 5LA1A 1KR1A 2W66A 1JPMA 2DZWA 1O5XA 1OVDA 3D0CA 1OD8A 4RNIA 3CPRA 1NFGA 4GFSA 4PB5A 1OK4A 4GI9A 1P1MA 5E93A 1VFSA 2G3FA 5D2YA 3LY0A 5C54A 3M0ZA 3TTOA 5M1TA 2UY3A 2ZUMA 3FV9A 1AL7A 1NDWA 2BP1A 3RMJA 1YXYA 4JIHA 3ZWSA 4AWTA 3WNOA 5HNUA 4AY1A 1UC4A 1I0BA 1GOMA 4XX6A 4LEFA 4IP7A 4JN6A 4HZ8A 5M3WA 1EJWC 4EKJA 1VJSA 4R34A 3K4WA 3VFCA 4FS9A 1I75A 4KWUA 1E0XA 2Y70A 3H2NA 3SCPA 5D03A 2NSXA 3GG1A 3AXKA 4B92A 2C19A 3OB8A 1ZBWA 8CGTA 3GDLA 4B3LA 2CHRA 2AAMA 3N12A 2EKGA 4AF0A 1XHGA 3EWBX 3HGRA 2HVOA 1X6UA 2NT1A 2VC9A 1JIBA 1VPQA 1R3SA 2PWVA 1ZJHA 3O63A 1D8WA 4M24A 4H41A 3BMVA 4LU0A 1PX8A 7ODCA 3IK2A 4J9JA 1F61A 2BXZA 4A05A 1A80A 1BHGA 1BQCA 3OTRA 3TWAA 1B4EA 4LW7A 3QGAC 1O95A 3LXAA 3P80A 5DMNA 4Y6GA 5I7GA 1EXPA 4A8NA 3F03K 4R5EA 4RLIA 1A0CA 4X63A 1XLAA 5HJXA 4WD0A 4ZR8A 1Q6EA 3WK3A 3DCPA 5JH2A 1JPHA 3VNIA 4CVWA 3UQNA 1WDPA 3BK0A 1NEYA 4GVIA 1J93A 1RALA 4AD1A 1X1NA 4OBSA 2YB4A 1GVIA 1XYAA 4IG2B 1EIXA 1SFJA 2NQ5A 3CM4A 3IJ6A 1W0MA 4L4OA 5E0KA 3PJWA 3KVJA 3GHUA 3F7JA 4CD8A 1TVPA 3S5YA 3SQSA 3N3TA 4GYFA 3WLRA 4GPNA 4ATDA 3VX1A 4EANA 2YLAA 2PU0A 3IUDA 5EFFA 4Z2LA 4H19A 3N1AA 2ZA1A 2W4XA 3QW3A 4TVDA 3EWUA 1RQHA 4L1WA 4A4AA 1WDWA 3WFAA 2D0GA 1W1TA 3SQLA 1W5QA 2IKHA 1GQIA 3VA8A 1RLCL 1BF6A 3OG3A 3VGDA 1DIEA 2HROA 4ZOAA 3WNPA 3TN6A 2ABBA 1G1YA 4NZ5A 1CB7B 3GNXA 4JIRA 3ABRA 4Q4SA 2ACUA 3WG6A 3QJAA 5CC5A 2XSXA 1GPFA 1H1ZA 3WDRA 5A69A 1O5RA 5RUBA 1H49A 1MRAA 3ZR5A 2R1PA 2OLSA 4LAMA 3GHSA 1M41A 3WJSA 4GIEA 4KWWA 4O12A 1M7OA 4DQWA 2CHOA 1IT0A 4XUYA 2PDJA 1PYFA 4GXPA 4OOUA 3A4WA 3WQOA 4M82A 4MKSA 4Z1DA 3T40A 4FSAA 4W84A 1W91A 3AMDA 2VRJA 2CZFA 1XH1A 4PUJA 3MVTA 1G9HA 1UQZA 4ACYA 1KTBA 2NVCA 1WOBA 2V2CA 5CGTA 4P7NA 4IMEA 5FAJA 2OWXA 3CV1A 3MUZ1 1XSKA 4QDMA 4FXSA 1EO5A 4I90A 2AL1A 2XFWA 1US2A 3FGCB 1Y5VA 1CXKA 3I3BA 3WJXA 3FAXA 1EGMA 1C7SA 3GH5A 4P61A 2ISDA 2E8YA 4P2VA 3NR0A 1HX0A 3WLLA 4JTTA 3EXSA 3CUIA 3F1QA 3EOUA 5CQ1A 4MFDA 3VE9A 1S1PA 3AIBA 3PBGA 1JDAA 4HHMA 4EIVA 1LT7A 5H8UA 1V6TA 4YTRA 2JIWA 4Y9OA 5DFAA 4FLSA 2X8RA 4HP5A 1W1IE 5MKGB 5A5WA 4IFKB 4BI6A 3EDFA 5IFPA 3R7MA 1ZP3A 4ZGYA 5BXTA 5J04A 6REQB 3P5YA 5BXPA 1Z41A 3I10A 5HBFA 1ONEA 3A9BA 4CCCA 2EPOA 3QFWA 1UR1A 1JYWA 1PTDA 3MCNA 3K8KA 3CQHA 5HK4A 4XO7A 2C16A 4J4KA 5KZ6A 3A6OA 4E5TA 4W7WA 2VC7A 4F3HA 3PY2A 1TJ1A 4IIHA 5JIWA 4RDWA 3A4XA 4IQLA 1C3FA 4LOCA 4GJJA 1ZBVA 3CJPA 5A2CA 1MQQA 1TPB1 3AMKA 1VGAA 5AVHA 5IM51 1PZ2A 3G0XA 4FNRA 3UWWA 4JIPA 3DUGA 3WJZA 1VFTA 1XYFA 1YX1A 3QPYA 3EDKA 4LNCA 2FIQA 4JTUA 3CHDA 4IUGA 2ZRXA 2VWTA 1OIMA 3ABZA 3VGGA 1XCFA 2ZRUA 1LF1A 3GTFA 3E1F1 1U1JA 2X1SA 1V02A 4DZHA 5I2UA 2ZADA 1UJQA 3V1HA 3TVAA 2J27A 4M3PA 2GSEA 3W1QA 3A47A 4TMCA 4W4QA 1EZWA 1FKXA 1O60A 4DAIA 1EH9A 1PZ1A 5HATA 2VRKA 2ATSA 3DFOA 8A3HA 4ZVJA 4UTTC 3Q58A 3L67A 1PS9A 1UWRA 1LUCA 1PYMA 1C8VA 4RDYA 1UPPA 1OFPA 1SO6A 1UZHA 1MFUA 4QRNA 4ZENA 3AXHA 1XBZA 3LDVA 1MW0A 4AYGA 5C9ZA 2VTFA 1YKWA 3KLKA 5AHEA 4HYWA 2A79A 2VC6A 4YCPA 3MDUA 4RR4A 4UTJA 1EA0A 5AHLA 5D9PA 2A3AA 3KHJA 3I65A 3A5FA 4KS0A 2WSKA 1HKIA 3DG7A 1YBQB 1JUKA 1YNPA 3W7DA 2YBVA 3PPHA 4C1NB 3H7RA 5HULA 5JQ9A 1EC9A 1L6SA 3ITVA 4M80A 4MNKA 3W1LA 1E6QM 3ITCA 3SM0A 3KEHA 4TVUA 2VO5A 3LLDA 3RG6A 3KCLA 3ZJKA 1XPYA 3SN0A 1J11A 2NX3A 4DWSD 3BMWA 4QHRA 2OEKA 3APYA 3B9OA 3PZVA 4GMEA 1E0WA 3LCLA 4NYYA 2ZZ1A 3OJGA 4AHOA 4YVPA 2DUZA 3GDMA 4XD5A 2WVVA 3E96A 1Q6RA 5BZAA 2WMIA 4ZB5A 3TH6A 3L21A 4I9AA 3KL0A 1KXVA 2YDSA 5AYYA 3RRXA 1HUVA 3WNMA 2GGEA 1ZSXA 4W85A 5ABTA 3GC4A 3MYOA 1WDSA 3QBUA 5JBDA 2Z26A 1SJCA 2YZRA 5CC7A 2QS8A 2E5CA 1H4PA 1NU5A 1GOXA 3FA4A 3HA1A 1LWHA 4WR3A 3BAWA 4L61A 1VHCA 3GU9A 4ZE5A 7REQA 3NPWA 1JDDA 5IRPA 3NEHA 3MQTA 1F07A 5BWAA 1BVZA 2QDGA 2DZPA 3OYZA 3G1XA 1TIWA 3ZVIA 3CZKA 3TYCA 8XIMA 3QMTA 2I9EA 4HT3A 1K3UA 4ENLA 3GO2A 1V0NA 1LWJA 1AQ0A 5CSSA 3G1AA 3M0JA 3EDEA 1V03A 3NDOA 2CC0A 1R46A 2Q09A 4K1WA 1RVGA 3UJFA 2PDUA 2PBGA 1ONXA 4P7LA 4FI4A 5LNWA 2OTDA 3ANVA 3VZYA 4PGLA 2QT3A 1H11A 1S2TA 3CH0A 4N4QA 3M0LA 3P74A 1O1ZA 3TC7A 5EMJA 3DOPA 3ITLA 1B30A 1TE6A 3TNBA 1TREA 3W24A 4AD3A 2BOFX 1LQ2A 4H9XA 4S3JA 3A22A 3SJ3A 3SRFA 4JOMA 3GY1A 2WNQA 4MJZA 4NKCA 1YTEA 3S2CA 2G4JA 4DJFC 2CPUA 4BI5A 1E9IA 1DL3A 1RD5A 3RXZA 3CS2A 1GKPA 3GYEA 3A13A 1S2CA 1LP6A 2J7BA 3CHVA 2O9TA 4WY0B 1XSJA 4E4FA 4MB3A 4PCNA 3W7EA 3M0MA 3CQKA 4D9PA 2P88A 1H7WA 3WDQA 4YYCA 1ZAJA 2TMDA 1F3EA 2IPJA 4ACZA 4I9MA 4N0RA 1E6PA 1VCGA 1R3YA 1EQCA 2FFCA 2HPMA 1E73M 1VZWA 3M7SA 3UR5A 3U8GA 3NO3A 5EMLA 2I57A 2GPTA 2EAWA 3R6IA 3BZJA 4DXKA 2FDSA 1F5ZA 3IIXA 4C6NA 4E2BA 3PZNA 3U9IA 1U22A 3B03A 3L5MA 1GQKA 1WE5A 2OYKA 1OGBA 2G97A 1JFXA 4I7WA 2PBOA 1HN1A 5DX7A 1DQUA 4JNZA 2J8TA 1XCWA 4L6HA 3NZQA 5EYWA 3E0VA 2GVEA 1VFLA 3MZNA 2YBTA 1I2QA 3GXFA 4EOUA 2AL2B 3GC2A 3NPXA 3QR0A 2VR5A 1JCNA 1FWHC 3WL1A 4UMBA 3UJEA 4WDXA 3G77A 5I3GA 2WAGA 3BH4A 1EWDA 5EKYA 5HINA 3W28A 3QYQA 3STGA 3DFQA 1XL9A 3ITGA 3GAKA 2Q3OA 2GSHA 1GPWA 3S47A 1IXOA 4IQJA 5LIKX 3K1DA 1JD7A 4QISA 1NTHA 4MVAA 2XZ9A 3ENLA 1B5TA 4H6EA 3L4TA 3MWCA 2DSKA 4AVFA 3CBWA 3G0SA 3NL5A 4O54A 4J7RA 3BSMA 3HM7A 2BVDA 3GLCA 1UWUA 2C0HA 3EPMA 1GJUA 4HIBA 2PDPA 1XG4A 3AS1A 3VOGA 4GCXA 3DH7A 3LCIA 1GQLA 4NZCA 1Q6CA 2RJHA 3WNKA 4HMEA 4V28A 1UA7A 3R89A 2GVJA 2QHAA 4JS3A 1H5YA 2HE8A 2QVNA 2X42A 4I7VA 1TA3B 4H9ZA 4KEMA 3U2OA 1JCXA 1B54A 4UFLA 1I2OA 3LTPA 5REQA 5BW6A 4J40A 1DHKA 3R0UA 2PE4A 3KZPA 3RF9A 5IFTA 1KB3A 2Q02A 4JTAA 4C1KA 2TRSA 3H4XA 3TJ4A 1OD0A 1SZEA 2PWFA 4HD5A 4W5UA 2J7EA 1UZDA 4KF1A 1TR1A 3MHUA 3H7UA 1OX6A 3BSHA 3PBVA 1UW9A 2XISA 3NQ2A 4IGNA 3Q67A 2Z00A 4AQLA 4CD5A 3MO7A 3NDYA 1DIOA 2QIWA 1WYIA 2WMHA 4TMBA 1OSEA 1JZ5A 3SO7A 5LYRA 2BZNA 4O50A 4D1JA 2DZAA 4LAZA 1KBJA 4CKQA 2KZHA 4IJRA 4U5KA 3EOLA 2Z4GA 3UESA 4B4HA 3QW4B 3WLIA 1FWTA 5H8PA 1XDMA 1KXHA 2PP1A 2WSPA 1ZUAX 1TZZA 4AD0A 5AZ0A 1Q65A 1IZCA 4WXYA 4RNJA 3CMGA 2WPGA 3OGVA 1M65A 2X40A 4YL2A 4IOTA 3FCPA 3K5XA 5DT7A 3NZRA 1JUBA 4GQQA 1YXDA 1KCZA 5MF5A 3GM8A 1SFTA 1VS1A 2XH2A 2C14A 3OZMA 5IBXA 2VDHA 5AN7A 1WAWA 2WVTA 3M6YA 4PMQA 2WHLA 3W84A 1X6NA 4X0VA 4V2XA 5LGXA 4RZ6A 1XR2A 3DI1A 4UOQA 3PZTA 3T1GA 1BFNA 3HF3A 2IXVA 1PEZA 3W29A 2HV5A 3UR2A 1BWKA 1XI3A 5C55A 3VFLA 2DUXA 2XN1A 1QOPA 5BOOA 2WK2A 3K1GA 5GVJA 4ORMA 3PBUA 5I78A 1FH8A 3BCJA 5BNKA 2VEMA 2VOMA 3RJYA 4WF7A 4R3UA 5FL1A 3V0SA 4MWAA 5E0FA 4P8UA 1YNQA 2PDIA 2BB0A 1DJNA 2LLEA 1CT5A 5HWMA 1WCGA 1HKKA 3HIJA 2EKCA 3MUIA 2BDQA 2Z1SA 2WZIA 3LENA 4PMUA 2BXVA 2GWNA 3VUPA 5TBOA 3ABOA 3OGSA 3B0YA 3VKJA 2P10A 4AXNA 4GVHA 3QY8A 1UH4A 3R2GA 4RZBA 4FA3A 3NWRA 3SCWA 1YTDA 1HNYA 3SCUA 3TXVA 4GVGA 2EXOA 3OVQA 2E3ZA 4PUEA 1WP6A 1NH6A 3M16A 4IPIA 4BKNA 4RXGA 4UFHA 1NM9A 1MUWA 4PBGA 3TROA 1KBIA 4LV4A 4XZBA 4NJIA 4PSPA 1M6JA 4LANA 3RCYA 3N17A 4L6OA 3R8HA 1QI5A 3FVMA 3TWBA 3ANUA 1XIHA 1BRLB 4W89A 4H6RA 2PP3A 1B90A 3B9AA 2YB1A 3UG5A 2VEGA 1EQPA 1XYBA 4QNEA 1ME9A 1HF6A 4RE3A 1OFEA 1E9YB 3EOEA 4PL2A 4HMDA 4AZCA 1M53A 1KM1A 1LG1A 4O1CA 4EPBC 1KGWA 1DQXA 4H4IA 4ZXOA 4B5WA 4U4MA 4XBSA 1KW1A 5DT5A 3W2KA 4AY7A 2E6AA 2A1YA 3GKFA 4OV9A 4F4RA 2B4GA 4CN4A 4C6IA 1QBAA 2VEIA 1PUDA 1ZENA 4AEFA 1O6IA 4HOWA 2R1MA 1H7XA 2ZKMX 4HTYA 5D33A 1UWQA 1W1VA 3F2DA 3JZUA 2EO7A 3SCQA 2C15A 4TO8A 3GVGA 2I5QA 2Y5EA 5A6SA 1C8YA 3VNDA 3DG6A 3MU7A 2PDCA 3S0CA 1FCBA 3KM8A 4ZSTA 2KX9A 3CZGA 3OLGA 4JQ3A 1CGWA 1XF0A 3CIXA 3AYSA 1FFQA 2QYGA 1UWAA 1YMYA 1TQXA 3SCNA 3IGUA 4Q4KA 1BGGA 3PZGA 2MUCA 3HG4A 5E1QA 1EJVC 3D47A 3DFYA 4UNLA 5A8MA 3TW7A 4OFCA 1IQ8A 1XX1A 1EHNA 4LY8A 1GGOA 4Y8EA 4AY8A 2Y7EA 1UWSA 2HTMA 4CU8A 3PP7A