3MC5A

Human aldose reductase mutant t113v in complex with idd393 crystallized in spacegroup p1
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
316
structure length
316
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPVGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldose reductase
publication title Ligand-induced fit affects binding modes and provokes changes in crystal packing of aldose reductase
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3mc5A00
4XZLX 4XO7A 3MC5A 4GA8A 1RALA 1EXBA 4WRHA 3UYIA 4JTRA 1YE4A 2IPFA 4JIIX 4DBWA 3UGRA 5HNTA 2NVDA 1Z9AA 3T42A 4XVEA 1QWKA 2PDCA 3LNMA 2PDXA 1AFSA 4L1WA 1XJBA 5HNUA 2PDIA 3ONBA 3UZYA 3Q67A 2WZTA 3CAVA 3LN3A 3M64A 4QR6A 3LZ3A 4JIRA 3ERPA 4PRRA 3R94A 2PDNA 3COTA 3M0IA 3UG8A 4ZFCA 4Q3MA 2HVNA 4LAZA 4I5XA 1S1PA 3EAUA 4R9OA 3H7RA 4HMNA 1EKOA 5KETA 2IKJA 5LIKX 5LIXX 3KRBA 4JQ3A 3UZWA 1ZGDA 2NVCA 3H4GA 1VBJA 4JQ2A 2FZDA 2IPJA 1S2AA 3VXGA 1AH4A 3WBYA 3R6IA 1HW6A 3UZZA 2PF8A 1LWIA 2HE8A 2HVOA 2FVLA 3UFYA 1M9HA 5JH2A 2ACRA 1X98A 3BURA 2R9RA 4JTCA 2PDYA 3ONCA 1MI3A 2IPWA 4XZIA 2INZA 1PZ1A 3P2VA 1AH3A 2PDWA 3V36A 2ACUA 3O3RA 3FJNA 5AZ1A 4IGSA 2IKIA 4PRTA 3GHSA 1YE6A 3BUVA 1J96A 1FRBA 1PZ0A 4XO6A 4GIEA 3UZXA 2F2KA 4ASTA 1T41A 1MZRA 4YS1A 2IKHA 4XZNX 3DN5A 2QXWA 1OG6A 4DBSA 2IPGA 2ACQA 4FA3A 3V0UA 1C9WA 2FZ8A 3G1RA 4QX4A 4XK2A 3D3FA 4NKCA 3F7JA 3GHRA 3CMFA 1ZQ5A 2F38A 3GUGA 4WDXA 3GHUA 4FZIA 2FZBA 1HQTA 3LENA 3CV6A 1ADSA 3U2CA 5LIUX 1ZSXA 2HV5A 1Z3NA 4JTQA 3WCZA 4PUWA 1PWLA 1X96A 5HA7A 1IEIA 3Q65A 3NTYA 3M4HA 1SM9A 1Q13A 3UWEA 2PDMA 2PDLA 4JQ4A 1US0A 2IS7A 1XF0A 3LBOA 4GACA 2WZMA 3G5EA 3R7MA 1X97A 1RY8A 2BGQA 4OTKA 4H8NA 2PDHA 5DANA 3LQLA 1Z8AA 4XZHA 4LAUA 2HDJA 2HE5A 1JEZA 2IQDA 4F40A 4L1XA 2PZNA 4JTAA 1PYFA 4XVDA 2DUXA 3LQGA 2IKGA 3CASA 4WDUA 3FX4A 2P5NA 2CLPA 2PDPA 3LZ5A 1IHIA 4WEVX 3DOPA 1MRQA 3R8HA 4IJRA 4RPQA 3RX3A 2DUZA 2ACSA 2ALRA 4PUUA 3B3DA 4H7CA 4Q7BA 3BV7A 4JQ1A 4YVVA 4PR4A 2PD9A 1UR3M 3N6QA 3WG6A 4GABA 3V0SA 3S3GA 5JH1A 4EXAA 5AZ0A 2C91A 4QXIA 4PMJA 2PDFA 4EXBA 4YU1A 4LBSA 4IJCA 1K8CA 4ICCX 3QKZA 1S2CA 1AH0A 1YNPA 5M2FX 3WBWA 4JTDA 2PDUA 1Q5MA 4WGHA 2FZ9A 1XGDA 3LUTA 2DV0A 3EB3A 1S1RA 1YNQA 2J8TA 4DBUA 1EL3A 1ZUAX 2I16A 3V35A 3CV7A 1RY0A 2PDKA 2PDBA 3H7UA 3MB9A 1Z89A 2PDQA 2AGTA 2HEJA 2PFHA 4LB4A 4MHBA 2VDGA 4G5DA 4GCAA 4LB3A 2PDJA 1VP5A 2IQ0A 2R24A 1EF3A 3BCJA 2INEA 2BGSA 1T40A 3O0KA 3N2TA 1AZ1A 4XZMX 4FAMA 4GQ0A 4DZ5A 1R38A 4WDTA 2ISFA 5C7HA 1LQAA 4JIHA 2BP1A 3R43A 3LEPA 4HBKA 3R58A 4GQGA 3C3UA 2PDGA 4AUBA 4JQAA 3RX2A 3CAQA 2PEVA 4YVXA 2PD5A 1GVEA 5LIYX 3EB4A 3UP8A 5LIWX 3R8GA 4FALA 3WBXA 3GHTA 2I17A 1QRQA 3RX4A 2A79A 2FGBA 1A80A 4YVPA 3V0TA 3LD5A 1PWMA 4QBXA 4LBRA 4XAPA 4WDWA 1AZ2A
chains in the Genus database with same CATH superfamily
2XG9A 3DZ1A 4ZODA 1LL6A 1IWAA 3WIJA 4YJ5A 4TVUA 2XHYA 4E3TA 1IR1A 4JFWA 3ITGA 2XPKA 4Z17A 2JFEX 4DVOA 1V93A 1FBAA 1QW9A 3GR8A 3AIRA 1XUUA 4XTIA 5ABFA 2G8ZA 1AFSA 4UCGA 5HNUA 3A6OA 1UZDA 3AHVA 4HTYA 1E4MM 4RZ4A 4NZJA 1X8CA 4FI4A 4UIOA 2QUUA 3R2GA 4LVFA 4QR6A 4CCCA 3ERPA 5EMLA 2B31A 2P3ZA 2XUCA 1W9DM 2YYTA 4O17A 2B4GA 3GVRA 1KCLA 4EVZA 3TC3A 3TJXA 3GNXA 4YCOA 2WVSA 5F2IA 1BAGA 4DYEA 2C7FA 1XBVA 5MF5A 3DBPA 1KM3A 4PUKA 3IIOA 4WVXA 3V5FA 4D6JA 1GQNA 2VC7A 4J5NA 1ZGDA 3C2FA 3UZJA 2XVKA 1L0PA 4DJFA 1JDAA 3L2LA 3U9IA 2IPJA 1D3CA 1FWHC 5JIPA 4KWSA 1TPH1 2NSXA 4OOUA 3WBYA 1LBMA 3U4FA 2QULA 2O0TA 2ZZ1A 4G7EA 5I5RA 1FXQA 3S8HA 3UR7A 3W2KA 2JIWA 2QNEA 4IIGA 3SQMA 4HGXA 1JUKA 4B5SA 4UTLA 2PDYA 1ZBCA 1NWUA 3MY9A 3IS4A 1QTWA 3D5HA 2Y5JA 5D8WA 4GUGA 4UMBA 1SFLA 1E1CB 3KDOA 4JYDA 3HPZA 1LRQA 3VNKA 3N6JA 3MO4A 3BUVA 3C0QA 2FHBA 2UY5A 3UR8A 1FH7A 1LG2A 1TPVA 1VCVA 4MDOA 5TNVA 5FJJA 2G37A 3KE0A 4UTTC 1RQBA 2GJPA 3W1RA 2W3ZA 3L66A 2IPGA 4PBGA 4KS0A 4A8NA 3W7IA 4GVGA 4XK2A 3RU6A 3AIEA 3LNPA 3C0LA 4PL1A 3GIPA 5D09A 4JPGA 4ZE4A 3MDUA 4ICMA 3T09A 1AMYA 4H9MA 2F38A 3I6EA 3TYAA 3IGUA 4IMGA 3AFBA 3L2IA 3TW9A 3TN5A 3W88A 1MXSA 3TC6A 3M5ZA 4WZHA 2HV5A 1DPMA 3UWZA 2YBUA 1LF1A 2J74A 3WDRA 2CLKA 3NZPA 3EYPA 4KWOA 1V6WA 2XISA 4UFHA 2IW0A 3RK8A 3GWQA 4WK9A 2PDLA 2WQDA 3BH4A 3TC7A 3B9NA 1XLEA 1OFDA 3WMSA 1RPKA 4HPXA 8XIMA 1RK6A 2PI6A 2W92A 4XTDA 1VFUA 4R3UA 4QCEA 4LVAA 4YWIA 2UWFA 1EOKA 4ICNA 3PBGA 1M7PA 4IOTA 4IIDA 4Y90A 1DJXA 4L80A 4L64A 4X2PA 1EBGA 4F40A 3M6DA 3VGFA 1UP0A 2NXGA 4N9CA 3UYCA 3VUSA 3MUXA 1W1A1 1XLHA 3G1SA 4GNJA 4N4QA 3G2GA 3KOXA 1TE1A 3BJSA 5E70A 3GH7A 3UWWA 1E6SM 2CZ5A 3ABSA 1VFFA 4UTIA 2RHGA 3NQ8A 2D20A 3TFXA 5B7YA 3AHTA 3N2MA 1Q6EA 1ENUA 2P10A 3CQJA 1GOWA 4DJFD 4ONVA 5HPCA 1H0IA 4S38A 4IIFA 4AWUA 2XJ7A 4Q8QA 2I5QA 3P5ZA 2Y2WA 1SU5A 5TBOA 2FPVA 1IF2A 4K1GA 2Y8UA 5FF0A 4Y8EA 4PR4A 1EF2A 4Q4RA 1JCMP 3P60A 4W8BA 1A49A 4YWSA 5FIPA 3MHFA 3TSDA 1J01A 4DZIA 3IRDA 3S5OA 3WD1A 3THCA 4QDMA 5CSUA 1M3UA 3CWOX 3IV3A 2WZIA 2B81A 1SO6A 4MKNA 4A4AA 2WBKA 2O55A 4XD3A 2VOMA 1V6UA 1GQKA 1QBBA 1PTDA 3A3HA 3PBUA 3KTSA 1NF0A 4JDYA 1SFTA 2PDUA 3GTNA 5D9NA 1LLZA 5CPMA 2QV5A 1GEHA 1F74A 1M6JA 1MEHA 3EKZA 2RJGA 1O60A 4MYXA 3TJ4A 3YPIA 4C6NA 1OGBA 3TV8A 1BG9A 2XVNA 4UQAA 1RY0A 3UA4A 4CQ8A 1OD0A 1RHCA 3C2RA 4LB4A 4HYRA 4PTXA 2DT0A 1XIGA 2HPMA 3ZYZA 4B5UA 4DHGA 3BAIA 2Y5EA 2D2JA 5K4ZA 2MANA 3K8MA 1PS9A 2XFRA 4R33A 1Q6FA 1AZ1A 3CAWA 4HNVA 1QPKA 4XZMX 1DTNA 1GOIA 3ZVHA 1AD4A 1J0ZA 2XFWA 3R58A 3AICA 4L6DA 5D9PA 3BSHA 1V6TA 1RH9A 3U5UA 3W7EA 2WZEA 1F4AA 3CTTA 4FNSA 3V5OA 1TYGA 1UQYA 3W2NA 3NEVA 2YGYA 2F6XA 3ID7A 3HG2A 3NWRA 3UU0A 1O1HA 2VR2A 1A5LC 1WOBA 3DDMA 2BSLA 4XAPA 2YDSA 5BYWA 2FTPA 4ZQOA 1RSCA 3RRXA 2EO7A 2GGJA 3VNZA 3ZT6A 2D2HA 4MJZA 1WXJA 3L0GA 2R1LA 2NWSA 3M44A 4DXVA 2RDWA 1K1DA 2DJXA 4O13A 3MHGA 3TW6A 3LB0A 4JN7A 5A6MA 4WXYA 3ITCA 1QWKA 1V6VA 4XKMA 1AW1A 1FWAC 3VIMA 1JZ8A 5A2AA 2H9AA 3M0KA 4JOMA 3W1UA 4AZHA 4AC1X 3P93A 1BXCA 3GU1A 5LNWA 4DRSA 4O8AA 5LNVA 1QT1A 1W3HA 1NOWA 3KHDA 3BCDA 1DBTA 1Z42A 3H4XA 2DT3A 2QCMA 1OFBA 3KOFA 3GXDA 2J7BA 3NEHA 4ZO9A 3BLDA 4W89A 1BFNA 2R82A 3R94A 1BRLA 1DTUA 4GG9A 3GKFA 3V7PA 2NUYA 5I79A 1FKWA 1DXEA 4AHPA 4MWAD 1W91A 2CERA 1UKSA 4Q4KA 4EK7A 4WY0B 1P0DA 5BW6A 3CL8A 1OC5A 4FOUA 3QTPA 1VBJA 3IARA 4EWJA 1GKRA 2V5JA 3SCRA 1W1VA 5TIMA 1TJ1A 2YFOA 1MXDA 3R6IA 5JBFA 1GVOA 4W7UA 3UZZA 1J12A 5FKYA 2CWNA 1E43A 1J0HA 3PPHA 3KTCA 2WCAA 3ANUA 2Z6JA 1FHVA 1XWYA 5FF3A 4IMDA 1F05A 3RILA 4B5TA 3MP4A 2E9LA 5LKYA 4IGSA 1UWUA 4PRTA 5EMKA 5CH9A 4M6PA 5BROA 1US2A 1QI5A 4HT3A 7REQB 1LUCA 1NFGA 3G1HA 1TVPA 3HJZA 2O9TA 4I5RA 5C2GA 3VM7A 5CEWA 5D02A 4PUEA 2A3LA 2F2KA 3WQPA 3F5JA 3ME3A 2IKHA 3R89A 3QY8A 3QSTA 1UUOA 2DZAA 1YDNA 5A6JA 4DM1A 4UTWC 2E4TA 4Y9MA 1GVYA 1WAUA 3LX9A 4O53A 4KFPA 1B9BA 1A5AA 3E12A 4JYFA 1KCZA 3A3WA 3GTHA 4IICA 3O07A 4NNAA 3EPMA 2P76A 3SECA 4TMCA 3EOUA 1GVFA 2A1YA 4NRSA 3QPEA 1CW2A 4B3LA 1YIXA 4B9YA 5C9RA 1UHVA 3ZSSA 3BJTA 4MJMA 3EWCA 2WSQA 3B06A 4WKAA 2YSWA 4M3PA 3LBOA 4EIVA 4DWDA 2I5GA 1W9VA 4GIAA 3RLVA 4CN1A 4X0NA 5A8MA 1T8QA 1ZJBA 4NX0A 2VO5A 1A4MA 4N6FA 4GGBA 1E71M 3ANVA 2FH8A 1ZU8A 4KEMA 3KWXA 3W27A 1Q7QA 4Q6XA 2YPIA 3S6OA 4Z2HA 2IQDA 3VMOA 4Z1BA 1EOMA 1X6LA 3WJSA 3ARZA 1NFBA 4L1XA 3G6LA 4QQ3A 1JFHA 4M80A 4NT0A 2XM2A 1TMHA 2YZRA 5EA9A 3PZNA 2POZA 2WMHA 2NQ9A 2BODX 4UFJA 1JXKA 1DXIA 1W3NA 3MA8A 3GNDA 1KD0A 4B9ZA 1H7XA 1LDCA 3C2OA 4CU7A 2PAJA 3ANYA 2WMIA 1TCMA 3GR4A 5KEZA 1C29A 3G1VA 5FL0A 1I2QA 2VFHA 3UY7A 4JCMA 4IJRA 4NZ1A 2WJZA 1NQ6A 2ZYFA 5G1YA 3HPAA 2YW4A 3A4XA 5BU6A 5JBEA 3WUEA 3DEQA 4AZ6A 4PUUA 1FCUA 3ES7A 4FK9A 1RA0A 1G67A 4XUYA 3DHDA 3F5LA 2DSVA 1HO4A 3WF3A 4DJEA 3UG5A 3PZ9A 4UNKA 3L4WA 2Y1HA 1PTGA 1OGGA 2CETA 2V68A 4CQDA 4P61A 1XGZA 2GFTA 4QG6A 3MCMA 4EXBA 1BVZA 1F6KA 2Y8VA 2NVAA 3F4CA 1HKKA 4HZ8A 2E09A 4CNTA 2ZUWA 2VRKA 1S2CA 4H01A 5AC4A 5CPNA 4GYFA 1W9UA 4TO8A 3WBWA 1EDGA 2OZ3A 1A50A 1I6NA 2FGLA 1QBAA 1H7PA 1XIJA 2A7NA 4C6PA 4M29A 1S1RA 3WENA 3CQHA 4MNKA 4XAGA 3RMJA 2WC3A 3MZ2A 3IVTA 2PDBA 2FJKA 2J25A 1MZHA 2ODOA 2PDQA 4ES4A 4G5DA 3PFRA 3TYZA 4C91A 2R24A 3L12A 5F1UA 2Z24A 4ROPA 4AQLA 5IHSA 3WNMA 5FSEC 1P48A 3QXBA 4HMCA 3WFZA 1D9EA 1C8XA 1HKIA 1OIFA 1HJSA 4L9XA 2ZKMX 2HXTA 2CIPA 4E4UA 2YOCA 3CC1A 3KRZA 8RUCA 1AL7A 1Q65A 1OGSA 5AHMA 2V2DA 1JPDX 4MJ2A 7TIMA 1R6WA 3R8GA 3ABZA 2IQTA 3AWNA 5CZKA 4ZENA 5DMYA 2OSXA 3SQLA 1GTHA 1UZ1A 3O6DA 3A24A 4RLIA 2Q8LA 1PWMA 1ZJHA 1LOSA 2WQPA 3KP1A 4L6OA 3TK7A 1EJRC 3B0XA 4REQA 3ZJKA 2YZ5A 4FHAA 4CVUA 4DELA 4DWSC 4XO7A 4HOWA 4M24A 1JPIA 3AYRA 1I2RA 1PIGA 2W27A 2ZQ0A 3WNPA 4BCEA 1XD1A 1V3JA 1R3YA 5GJMA 1HO1A 4N9EA 2A7RA 3BLIA 3ZSTA 2QIWA 2PWDA 2WCGA 4IWWA 3OBKA 5FD0A 3LNMA 3PUOA 1CXFA 2OLSA 1YQ2A 1B1YA 1YMYA 3P6LA 3CPRA 3WELA 3MWCA 3FW6A 3ENLA 8CGTA 2Z29A 3OGSA 5ABGA 5CXPA 4DN1A 2XVPA 5KZEA 4HNLA 4KRUA 3B40A 4M6QA 4NX5A 3TSBA 2XIOA 1Y0EA 2FB2A 2RJHA 3WQWA 3NZGA 1UD4A 1LQ2A 1VEMA 4AH7A 5A6SA 2BVYA 4UTUA 1L8PA 3OJGA 3TN4A 2TRSA 4B5XA 3LHZA 3OYXA 3QTGA 2VYOA 4QM1A 3DENA 5CC3A 2QIIA 4JTHA 3C2VA 4Y9AA 4HSHA 4GD0A 3TN3A 4ZEPA 3HOJA 3OGRA 5CJMA 5KETA 3KRBA 3UZWA 4TIMA 3KLLA 2FIQA 1XM3A 4GI4A 2FPTA 3CMJA 1GZ1A 2PURA 2HJPA 4BHYA 3TTEA 4FMVA 1YXCA 4PMQA 4JTFA 3L5MA 1S2TA 2GJNA 3GXTA 2GVGA 4EANA 4JTCA 4GBUA 4GH1A 4ZQMA 1HGWA 4JTUA 5CC7A 1E70M 1H5YA 4DPQA 1THFD 4QCFA 4U28A 1TO3A 4IL0A 2PWFA 2VKZG 2ACUA 3PZUA 1WYIA 1BWVA 2FMNA 1ZCOA 1MNSA 1J93A 4HKPA 1G9HA 1LQ0A 1UJPA 3GG1A 2ZE3A 1OC6A 2PLJA 5K9XA 3N2CA 2P53A 1W3JA 1TMLA 1XSKA 1QASA 4U2ZA 1OYCA 2QZRA 2QXWA 4AAJA 2ACQA 4LS0A 4QJ1A 3IJLA 1XIBA 1EX1A 3C6CA 4AF0A 3I7QA 4PYSA 3QBUA 1BG4A 4PULA 5B7ZA 1QNVA 4Q8OA 4FEZA 2BGNE 2OGYA 3LENA 3ZR5A 1ADSA 3PUGA 1L8NA 4BY3A 4I9AA 3S46A 1HFBA 2FZNA 1C8QA 1VGAA 1KBIA 3NIYA 1VEPA 3BG5A 5XIAA 2Q8XA 3PPFA 3RO6A 5FCZA 4DWSB 1ITXA 3DXIA 4N7QA 2Y61A 4CU8A 4ORMA 4MIMA 1QNPA 1JDEA 4HMDA 5EFDA 3LRKA 3GG0A 2PGEA 1XF0A 1WZLA 1P0NA 3B8VA 2TSYA 1EC8A 3LPPA 2JGYA 5EFFA 1DJWA 4GIYA 3HBLA 1FWWA 3UR5A 1Z8AA 3CT2A 3DFYA 2ZRVA 4PUNA 3UWUA 4Y9OA 4KEZA 1ZL1A 2CKSA 4ZL1A 3JW7A 1MW2A 1WCGA 4IGMA 5T26A 3UJEA 1UIPA 3WL0A 4UOJA 3SRFA 4L4PA 3EBVA 4IUOA 5I3HA 2P5NA 1UR2A 1U2YA 2WJDA 5LA1A 2AL2A 4BF5A 2WPBA 3AIUA 3U5YA 3VFCA 3GVVA 5AN7A 1FWJC 2ACSA 2BOFX 2ZBTA 1CGVA 5F4WA 4P5UA 4Q7BA 1BVWA 5K2ZA 4BFAA 2PGWA 4O1BA 2AAAA 4AZ5A 2PPGA 4IUGA 4L1GA 4L56A 2RH9A 1Q8JA 3WUBA 5BXRA 1JYVA 1WOAA 2WSYA 1UB3A 1OYBA 2X1TA 1FUYA 1K9DA 1NDZA 5K4XA 2ZTJA 2BS9A 5E0CA 1UIOA 4UTKA 1WUFA 3KS5A 3TMQA 1OT2A 2QVHA 5DLCA 4C1NA 3PVFA 3B8DA 3LGDA 4AYSA 2Z7GA 4U31A 3BO9A 4GYPA 3QKEA 3SUWA 2TPSA 1OFQA 2BHUA 1BTMA 5LA0A 2CZEA 1XC4A 2E5DA 3TYEA 4ZTYA 3S1VA 3M0LA 4G56A 1B4EA 1XGDA 2DW6A 3S2MA 1KNWA 4NYYA 1YNYA 2PGRA 3WDJA 3BGGA 2AKZA 4IIBA 2CYGA 2VT0A 3M0HA 3GFZA 4AMCA 4D6DA 4NAFA 3GB6A 3CWNA 5HULA 4R88A 1A0CA 1T0OA 4IL2A 1EGZA 1NH6A 4HB7A 1BSIA 2OFJA 2BGSA 3M6YA 3O6AA 4PCTA 1UWQA 3ARVA 2PP1A 1PAMA 3U2OA 1TTPA 2J8FA 2ISFA 5HR6A 1C91A 3QOMA 1A5MC 3RX2A 4X61A 1YEYA 4Q4SA 2GDUA 4KH2A 1ME9A 3QQWA 4BR1A 1W0MA 3WD4A 3KS6A 1NDWA 4DJFC 1XRTA 2A79A 2FGBA 3RX4A 3VIFA 4K7VA 3VD7A 2QCGA 3WDHA 4HJWA 3OU8A 4JN8A 1IWBA 2CBVA 3W87A 3AO0A 1W17A 1EA9C 3S2CA 3RPTA 1YBQA 4ZFMA 3NQDA 5DMNA 4UQBA 1TUXA 3OQEA 2E8ZA 3NDOA 3RHGA 3LHUA 2XGZA 3GW3A 1EQCA 4FXSA 1VYPX 2E25A 3CUJA 3CH9A 1IEXA 2ADAA 2IPFA 3P0WA 1J6OA 1POJA 2WWCA 4RV3A 4XISA 3GKAA 4FOJA 4XVEA 2PDCA 4LUSB 4AY1A 3T44A 4IT1A 2P1FA 3AMCA 2J7FA 4HNNA 5I24A 2W6RA 3U2ZA 4KWVA 3UZYA 1Q6CA 3CO4A 1GQJA 4OUIA 4YPJA 2BG5A 4AY7A 3MCOA 4DO7A 1P7TB 5TQLA 3GIYA 3DFHA 1W1ZA 5EMJA 2V67A 1ESWA 1HP5A 2CCRA 4ACZA 3B8IA 3WLPA 2PDNA 1JUEA 1XLGA 1E6NA 1PDYA 1W2PA 6REQA 2I9EA 2Y70A 1TE6A 4DBDA 4J35A 3KBMA 1TRIA 4ZOEA 3CGTA 3GIQA 2NVCA 4IPNB 2V3FA 3BVJA 3OTRA 5D30A 5HWMA 4PRWA 3NQEA 2Y24A 3M43A 4I7WA 5G2HA 3CV2A 1NJJA 2WVTA 3HJEA 1BEUA 3WJWA 4B5VA 4C1KA 2QJJA 4K6AA 1HW6A 3WK3A 2PF8A 2I56A 3UG4A 4C1LA 1IQ8A 1VC4A 4UQEA 4C7GA 3B9EA 2V5BA 2R9RA 3MMUA 1LYXA 2Z1VA 4O11A 1VRDA 2E68A 4EPBC 3CQKA 3DFSA 1N8FA 4BWLC 2XGIA 3BW2A 2PDWA 3EDFA 3LTSA 1XLKA 3WMCA 3EWBX 2E5CA 4H8VA 4F9JA 1DOSA 2VRJA 3WLKX 4B5WA 2A6LA 1PBGA 3MBDA 4UNLA 1EPXA 4XO6A 1HX0A 3UXDA 1P0EA 4JZ5A 2PTWA 1S5WA 5E6YA 3DFOA 3M5VA 2DQWA 4PE8A 4C1NB 4Q33A 1EP2A 4S1FA 4YHGA 4N0RA 4AYGA 1H51A 4BF9A 1W3IA 3G0XA 2XIIA 3ZT5A 2VFFA 4BI5A 4J3VA 1KFKA 1KGXA 4OKDA 3I7RA 4YHEA 2WJFA 3PWIA 4DO6A 3W1TA 1TPC1 3PJWA 4RR4A 3MI3A 3TJLA 3UXAA 4J3WA 4I8YA 3SCSA 3Q65A 2DZTA 3O63A 4JKLA 3WJXA 1U5VA 2XH4A 3GXPA 2RKXA 4MWAC 1B3YA 2HVMA 1UMLA 1PKNA 2GGIA 2ZXBA 4ATLA 4LEQA 1E9IA 2HROA 1CGTA 1J0IA 5AHIA 1FWTA 5FSDC 4TR9A 4FNTA 2WZMA 2VEPA 4MADA 4Z2GA 1R7OA 4RDWA 1A5SA 1QMLA 8XIAA 1JG9A 2XIJA 3H21A 1XC6A 4RX0A 2F7FA 3HGJA 2BY2A 3NM3A 2DZWA 3OIHA 3O2LA 4MLRA 3I65A 1YBQB 1Y5VA 1PYFA 3UPMA 3VCNA 1A5NC 1JULA 1UCWA 4P7OA 3Q58A 3PZVA 4JCLA 3MSDA 4LUTB 1S2VA 1MFVA 2QUVA 4LQ1A 3NQ6A 3UJFA 2Z2UA 4G9PA 4H8UA 3IAPA 4UR7A 4S3FA 1E0VA 3TFCA 3A23A 2WSPA 2YL6A 2Z1BA 3T0DA 3Q45A 2NWRA 3VOHA 3DOPA 2YW3A 4WCJA 3BQ5A 3W23A 4HZ6A 3LCHA 2QJMA 4U2YA 2GUBA 3CH0A 2WM1A 4ERGA 4JQ1A 4N4PA 3N6QA 4H3DA 1TUFA 4OFCA 4EAMA 4Q4OA 2OX4A 1V8EA 1Q7ZA 3HV9A 5BMXA 4M6UA 3VZYA 1LBLA 3H55A 1XIEA 3WD3A 1A5BA 3PZGA 1SZGA 1KKOA 3C0SA 1O5KA 3RYSA 4UMAA 4HCDA 1OY0A 4B90A 3QKZA 4C7DA 2V5KA 3KOWA 4IQEA 3WO8A 2CITA 4V2XA 1YTKA 3BW4A 3OYZA 4O4WA 5AYXA 4R7JA 3VD5A 2BY0A 2DFAA 2Q01A 4S3DA 3NO3A 3PTDA 3BLKA 1QPOA 3VE7A 2VZVA 1QO5A 3B9DA 3FJLA 4ZVJA 3TTSA 3H7UA 3NCOA 3R0UA 4H19A 2EXOA 4IF2A 2VDGA 1OADA 5C9UA 3W84A 4HOZA 3NAVA 4JFSA 3IWPA 4J28A 3GYCA 5SWUA 4NF7A 4ATWA 4GRSA 1JPHA 2I7GA 1EP3A 3IPWA 2PRLA 3LV6A 4KCUA 3AIBA 3K46A 1VLIA 3REQB 4Y2WA 3STFA 4HOXA 5IRPA 1KKRA 3TSMA 1QRQA 1OJXA 3HGOA 3AAMA 5CAKA 2FLIA 1A80A 4NIRA 2BLEA 4MWAB 3PBYA 2D73A 3ES8A 4JKMA 3UXIA 1V4YA 4EF8A 3WH5A 1P5BA 3A64A 4X63A 2QPSA 3CYVA 1BGGA 2B0MA 4GQQA 1AZ2A 4H83A 1LROA 4UC5A 1ZPTA 2J9YA 4GI6A 2OQHA 5EL1A 2OQLA 4NILA 3GDLA 1ZBWA 4NL1A 3M9YA 3F03K 4U5KA 5BRBA 3UY8A 1IIHA 4H1ZA 1BQCA 3WYZA 1VR6A 1R3VA 2E28A 4HHLA 2ON3A 1HJUA 2OG9A 3WH7A 3JVAA 3TMLA 3SAZA 2C1GA 2FPYA 1IE7C 1W5PA 3CTLA 3PBWA 3W86A 3ABOA 4N2YA 1FWSA 2ZRYA 1JPKA 5CBIA 3WQ5A 4JIRA 5AC8A 5D05A 5F2LA 4TX6A 1XX1A 1TA3A 3QYQA 3WD2A 4HNUA 1JL8A 4GVHA 1X39A 4PBFA 3UD6A 2OGJA 5A5WA 3VOJA 5JUVA 3P3BA 5HAOA 2PBGA 2Z1WA 2VRQA 4L4MA 5E9XA 3VUPA 3LXCA 3W2JA 3I3EA 1FY6A 1WBHA 4MTVA 5LIKX 3W0KA 1TV3A 6CGTA 3PJXA 1ZZMA 3STCA 3JZEA 1RBAA 3ZLGA 5LXXA 2VZUA 3SCUA 4M7TA 4LV9A 5I3DA 2O7QA 2OU4A 3SCNA 4A2RA 4YTTA 3AZTA 4R27A 2AGKA 1KR1A 2G5WA 3JUGA 1V08A 1VENA 3GH4A 1BD0A 2YA1A 5H8PA 5E1QA 5BNKA 3A21A 4GYJA 3O3RA 3GNPA 3NPWA 3FJNA 3SBFA 2IKIA 3TTOA 1XI3A 1SGJA 1H1ZA 2FTWA 1QPNA 1TPDA 3SI9A 2BXZA 3GTIA 1U83A 3FEQA 3T81A 1OEPA 1PVNA 4C6MA 3UZXA 3GH5A 5IBXA 3L4ZA 4QHRA 3WX7A 4X9SA 3ARUA 4H4IA 2J75A 2X16A 4XSMA 4BI6A 2WZHA 1W32A 3MHUA 5I6SA 5BOOA 4RV8A 2ICSA 3SSZA 2O9PA 3VMPA 4RDVA 1GJUA 3V18A 1QPRA 3IGXA 5CPOA 1JRBA 4GI8A 2GK1A 3EA3A 2JQXA 2V5LA 1ZSXA 3GDTA 1WB0A 1JZ2A 1Q6GA 2VURA 4D6IA 3LPOA 3AIVA 2WV8A 3NSNA 5CPLA 2FHFA 3LCIA 1V51A 5M17A 4GGHA 1O1ZA 3WQCA 4LRTA 3KVKA 4F2TA 3N73A 1DIEA 4AZCB 1K7EA 1B0IA 1QI0A 4GACA 1TJ0A 4MVAA 2J8GA 2JGQA 4K38A 2EAWA 4S3KA 4O12A 4AZBA 3KCJA 2QJIA 1JYXA 5FJTA 4NP7A 3K8LA 3RMEA 4HYVA 2OO6A 4PMZA 5IDIA 1A3XA 2J9ZA 1HL2A 2O7SA 4AU0A 1WZMA 1ZFJA 2A85A 3KTXA 4W5UA 4LYQA 4ECLA 2JKEA 2YCLA 3KZSA 1OT1A 2DUXA 1W5OA 2Q3RA 4E38A 2GVEA 3GTXA 3VA8A 4NG3A 2PS2A 4QEEA 2E9BA 4L4OA 5D2WA 3TR2A 1UH4A 2OPJA 4J2PA 4OOZA 4C60A 1BWKA 3N12A 4ML4A 3R4IA 1NU5A 3DGRA 3AHYA 3N34A 1XG4A 2VZSA 4FLQA 1XBXA 2CHOA 3WUFA 3KXQA 3SCQA 1XS2A 1N55A 3IJQA 3NGJA 3VGHA 4IGNA 3TOPA 2V63A 1EDQA 2XFYA 4O4VA 3W7OA 5CJ5A 4KFOA 3QMRA 7A3HA 3BICA 3E2QA 4O14A 5FJPA 3ISIX 4LVDA 4OGZA 9CGTA 1ME7A 4PEKA 3A9BA 4O28A 4DI8A 4A3HA 4E5TA 3WF2A 1OCNA 3A13A 4CNSA 3KL5A 3B05A 1Z44A 3UQNA 1KFEA 1E0WA 3URBA 3BARA 3ZM8A 2PLCA 2FDMA 3DECA 3EPOA 1S5TA 1P6WA 1FWGC 1ZRQA 5C6MA 3I10A 1JQXA 1QHZA 4QJ4B 1IGSA 3W7CA 3LLXA 4FSAA 1F3XA 5E6ZA 2VHLA 2CXGA 2VXNA 4MHBA 1UPPA 4QITA 1Y5WA 4Z2JA 1YTDA 3WMLA 3ECQA 1HF6A 4S3EA 3B0VC 2F61A 3K1GA 3DHPA 4CNNA 3WSUA 3B8SA 1NP2A 1VJIA 1T40A 2XN0A 1XLFA 4GMEA 4FAMA 1R38A 1HUVA 2DZXA 1F76A 2WC4A 4QEHA 3IRSA 1SSDA 3IUHA 1U30A 3AMDA 3MV11 1FWNA 3VGBA 3NVDA 1W1B1 4QG9A 4IP4A 2OT0A 2EKCA 4AD0A 3S1WA 1EWEA 2VEKA 5HWNA 2Y7FA 2NZLA 1J79A 1FCQA 4WHBA 1SR0A 4J3SA 1WDDA 3ZJ7A 3TONA 1E6RA 5XINA 3Q94A 4DJDA 3P80A 2VFIA 1HKJA 2W66A 4ZA0A 4I3GA 5BXSA 4PCFA 1S2UA 1LCOA 5I3IA 2GK1B 1HJWA 5J04A 4KWWA 5C54A 1XD0A 4QSFA 4DNMA 1OIMA 4H9UA 2NX3A 1CXLA 4WUIA 4IZGA 1X6NA 3D3AA 3DFPA 3T9PA 1UOKA 1MDRA 3E2RA 1K8ZA 3LA4A 1BF2A 1X7FA 1PSCA 1FFQA 1R87A 2QQ6A 3WLQA 1NM9A 2Y89A 4TVDA 1YDOA 3QJAA 2ZOXA 3M0JA 3SB0A 4DO5A 4LAMA 3M64A 1TIMA 1PHQA 4PH6A 5CGMA 1P6CA 1NVMA 3GK0A 3GQYA 5DN1A 4CNUA 1ODUA 1KB3A 3NQ7A 4P8VA 4C5ZA 2VD8A 3QMSA 4C65A 4HNTA 5D2TA 2IKJA 3WFAA 2HQAA 3RJYA 2QDDA 2VGBA 2CLIA 3TWBA 5FF4A 1QI3A 3SN0A 1DHPA 1ZBVA 5MHBA 2DEPA 1F07A 3T40A 4MYAA 2GPTA 4O50A 3D46A 1GVIA 1GK8A 2FVLA 1Q2SA 2V0TA 3U4AA 1X98A 5HJYA 1RJRA 3H6OA 4FR1A 3VTRA 2DIEA 4KF1A 3Q37A 3WH8A 1F73A 1U5HA 1YRRA 4J1OA 4QE5A 1BF6A 3V36A 3RM8A 1CT5A 4FF5A 3PULA 1DHKA 4OHQA 4PTVA 4NQ1A 1BSLA 1SJBA 3W9ZA 3DFQA 4IP7A 1KBJA 3LCFA 2OODA 3PZTA 1EWDA 2FVMA 2Z00A 4KGJA 2HNEA 4IIEA 3DN5A 3OIXA 1L2QA 4AZ7A 2RDTA 1RBLA 3RUBL 4JTJA 1MO0A 3D3FA 3ZLHA 4GHRA 4IIHA 4CNPA 1BXNA 3TNBA 3WJYA 1TJRA 1FP8A 2WVVB 3W4RA 2ATMA 3QN3A 4X9YA 3CV6A 1QOXA 4HJFA 3U2CA 4Y7EA 1HIZA 2UV8G 4GZJA 4WSHA 5DT5A 4A3QA 3SY5A 2EPMX 1V77A 3H2AA 2VEFA 1GYNA 3UVIA 4L61A 3IIXA 4MDPA 3GC2A 1VPYA 3D0CA 4HN8A 3E6EA 3HZ3A 5EMMA 1L6GA 2ISVA 3O06A 1D8CA 1WUEA 4U33A 3G5EA 4KBXA 1UWAA 1O66A 4ZOCA 1XLMA 4C5YA 2BOGX 3KW3A 4GYPC 3ALFA 1JZ4A 4ZR8A 4NSBA 2QKFA 5CC6A 3N4AA 1VBRA 4H6RA 3PNZA 4Q22A 4XZHA 2BDQA 4DUWA 5IHRA 4I6VA 4TU1A 1XPGA 5D2VA 3RU8X 3UW6A 2J79A 4JX4A 4FLRA 3QGAC 5DFAA 1IXNA 1RJQA 2YDQA 3PAJA 3FKKA 1JNEA 4WDUA 4GBDA 1OHLA 2OEKA 1ECEA 1G94A 1KCXA 4C6OA 4AZGA 5DX7A 3UJ2A 1LM1A 1IHIA 1ZENA 1XCWA 4JNYA 2OCZA 1XINA 5C9XA 3SM0A 2W4XA 1TR1A 3L7RA 1W9PA 3EX6A 1RPXA 4LYKA 1RUSA 2ZIDA 1X8FA 1I1WA 1GYMA 3T7VA 4JTEA 3XINA 3N2OA 1UR3M 2NLYA 5CGTA 3ITVA 4MZYA 4B2DA 1VRXA 4CNOA 4GUIA 2CZVA 1OK6A 4QGCA 4HK6A 4A29A 5CSSA 3EWXA 4IJCA 2B7NA 1K8CA 4UTHA 5CPTA 4AD1A 1EZWA 5F2GA 4K7YA 5K7JA 1WA3A 2VOTA 1XKJA 4IQJA 3O6CA 4I9MA 3WKZA 3LG3A 3TNOA 4AISA 3UF9A 3LCLA 3W7DA 2X2YA 1GEQA 4LOCA 4DBUA 2C3ZA 1VLWA 4HZMA 3FA5A 2OVLA 3QSRA 2R94A 3QW4B 3SRHA 5AHFA 2AGTA 4S3GA 4MPQA 2YBTA 1ISXA 1IZJA 2G4FA 4RE2A 3W7HA 3K4DA 5A1AA 1TQXA 5FEZA 2OZ8A 1XDLA 5AHEA 3R11A 1EEPA 1NQKA 3N2TA 2WHLA 3UETA 2ZZ5A 3VKCA 1LQAA 1H7RA 4XSLA 3MMDA 3VO0A 1WE5A 3TKFA 4K8EA 3SJ3A 1XRFA 2BOEX 1U33A 4GX8A 3UGVA 4GFSA 3M16A 3NQCA 3U6WA 3RCNA 4CGTA 4NU7A 1DQXA 5FJIA 4R5EA 4F0LA 1OC7A 4Q8MA 4NY2A 3OHIA 4K36A 4HN4A 5A3HA 5IOBA 3IACA 4B92A 1O5XA 3TZFA 1GONA 2OYMA 4CD5A 4EP8C 2QGHA 3S47A 5H91A 1Z41A 3BTNA 2FFIA 3LXAA 2PMQA 2QS8A 5BOEA 1FWCC 1V5XA 3M7WA 5A6BA 2D0HA 4DBWA 4ZCWA 3SY8A 1Q85A 5I00A 2PLKA 2R91A 4PCPA 2JKAA 2PWVA 2G3MA 4EX4A 3O8AA 4LUJA 3VZXA 3G18A 4MB3A 5LGZA 2VGFA 4YN5A 3L9CA 2TYSA 3FY1A 4LNCA 1M7OA 3HFTA 1DJYA 4FX8A 1XIDA 1QFEA 5I78A 5G2IA 5AOUA 5FF2A 4E2OA 4K8HA 2PWHA 2QJHA 1MEWA 3T55A 1Q4NX 4PRRA 3LRMA 4B2DD 4JHOA 3UG8A 3W83A 2BWGA 2E9MA 3EOOA 4IPLA 2V3GA 4TV6A 1P0BA 1G4TA 1WKFA 2YCEA 2HNHA 1A47A 1CLVA 4FLOA 4JQ3A 4HNCA 1OM0A 1PHWA 1B5TA 4DY1A 1B57A 2AQWA 1T8XA 4I9JA 3P84A 3N9RA 5DMMA 3HO8A 3PUEA 5KSWA 1ITQA 2ZDSA 5CGQA 3IAQA 1PXGA 2FDSA 4A22A 1JR1A 3B0YA 3MO7A 3MANA 1EHNA 1Y65A 3ZVIA 4IPJA 4GLEA 2DVXA 3TLLA 4KCTA 4XD6A 1PZ1A 3WQEA 2R6OA 5I07A 5HATA 3T08A 2YDAA 4MNMA 5AZ1A 4GINA 3T0BA 1SZFA 2D69A 1AA1B 3NDYA 1PZ0A 4E8GA 1OX5A 1JCXA 2XGBA 4RUBA 4UFIA 5CQ1A 1DP0A 4TXEA 2OO0A 1JDFA 1S3TC 2CU0A 3QY6A 1H60A 3GRIA 3ZR6A 2WSKA 1EZ2A 2G95A 3G1RA 2FH6A 3R0KA 3QOKA 4GXWA 1E1CA 3E1F1 1LL4A 3CMFA 3QFEA 3MSYA 3OHMB 3CM4A 4XBJA 1JZ3A 1ONEA 1NDYA 5C5YA 3UXLA 4HCLA 2VZTA 2ZZ7A 3LLFA 1JXJA 4BQ2A 1EIXA 4ZQRA 1JRCA 5REQB 1Q13A 5JVLA 3FKRA 3NL5A 1EUNA 3P82A 4Y8FA 3KUMA 1LLOA 5F1VA 3UNDA 3NYZA 1QK2A 4OT7A 3N2XA 3KP0A 4OTKA 1RXOB 1C3FA 3KRSA 1H41A 4MZ1A 1NY1A 2OXNA 3WUGA 3NOYA 4DBEA 4LAUA 1CXKA 3HPSA 5HPOA 1MUMA 1ISYA 3IJIA 4EOUA 4FX6M 3VU2A 1WV2A 5IM51 4MAVA 3BLOA 1QWGA 2PCQA 3N11A 3TVAA 1NOFA 4XVDA 3CLWA 5C0QA 2J6XA 3T6CA 5LXEA 3CASA 1JCYA 4DF2A 1H11A 2HK0A 3MMTA 1PO9A 2JBMA 2EPKX 4L65A 4NJIA 5BMWA 3G0UA 1XRSA 2TODA 2VX6A 3RG6A 3AIQA 1IEWA 1S5NA 5D38A 3K2GA 2ISSA 3WF4A 3NSXA 1MRQA 3W7RA 3WEZA 4JTIA 2VMFA 5EGRA 2CPUA 2OYLA 2DUZA 3T78A 1VFHA 3MQTA 3S5SA 2DT2A 4ACYA 1QHOA 4PZVA 5LZLA 1IT0A 2X7VA 3USBA 2YCIX 4WLCA 4XZBA 4MM1A 1TWWA 2CBUA 3WG6A 2J4GA 3I3DA 3GG8A 3VINA 4Q7IA 2YB1A 1XLJA 2F2HA 1L6SA 4ADUA 1QOPA 4E2BA 5CG0A 3W71A 3AXXA 1DIOA 1AUSL 2PDFA 1J5SA 2WLYA 1TV8A 3G0SA 4YTRA 1ONWA 1GOXA 3VI2A 2Y4SA 4NI8A 1Y8BA 3WLMA 3U48A 2NLIA 1M5WA 1UR4A 1ZBKA 4NNBA 1TZ7A 4GJ1A 1XPYA 5EKYA 3II1A 2C8NA 2VUYA 5K9CA 2ZC8A 3H54A 3T05A 3W2UA 4WGHA 3TYCA 3DG7A 3MBFA 3FHAA 3ZXWA 4D6GA 4OQVA 1F3WA 2ESCA 3HFYA 1GVQA 1SW3A 4NASA 4MKVA 4CQBA 2I16A 1SZRA 2ZWZA 2TMDA 3L67A 1AQ0A 3MB9A 3S9IA 4K68A 1W3TA 1QUMA 1RP8A 4GNKB 3NL3A 1VS1A 2WKJA 4KQNA 4O16A 3WK0A 3SJNA 2VVSA 3AS1A 1K6AA 2GOKA 3CUXA 4W7WA 3S4TA 4OZOA 2ZUSA 3AMGA 1BYCA 3HF3A 3R43A 1HTIA 3P81A 4O1DA 5LYRA 3RPMA 1CZ1A 4FB7A 1W5QA 3QF0A 4UTTA 1EDTA 5A8PA 3FVDA 4FALA 2I17A 2E6DA 4N6EA 4QRNA 1E40A 3GD6A 3O7UA 3FEMA 4TX8A 4YIWA 2QLYA 4H9VA 4RNFA 4KEVA 4UWMA 3L23A 1YTEA 2XDFA 5A8OA 3N3MA 4XZLX 4R7WA 1XICA 4US5D 2RDUA 1KTNA 2XIBA 1EQPA 1EJVC 2ABAA 1L6FA 2CBIA 2ZA1A 2V30A 1XCFA 4RDYA 3MUY1 1DORA 3UGRA 5HNTA 3VFLA 3C0JA 3Q4DA 4JBRA 4ZGYA 3VX1A 4JY9A 5ENLA 1YDVA 4OIFA 3IJ8A 2UY2A 5H1WA 5GQBA 3KHJA 5FEPA 1CPUA 2WO5A 1OF6A 3V1PA 3SQSA 1YLVA 3EMZA 1TZ9A 4D8AA 4TOQA 3AUJA 4CD4A 5GJNA 3W75A 4QLKA 3SRDA 4M56A 3LZ3A 4S3CA 4F2UA 3QV9A 1PE1A 1TPWA 1AJ2A 1Y5XA 2PB1A 2VR5A 3FOKA 3MUIA 4OBSA 3W3OA 3MI2A 4LAZA 4AHOA 3AXHA 2VQTA 2BB0A 1WP6A 4MY1A 3O0FA 2ZUVA 5MKGB 4HMNA 4HU8A 4JIEA 3MVIA 1CB2A 4Q6JA 1FQ0A 5C71A 2JF6A 4X60A 1J9YA 4UR8A 2H3BA 3NQAA 4KW2A 4QE4A 3NDZA 5CSRA 3SN4A 1XIHA 1YX1A 3QGVA 3UFYA 4HHMA 4AVOA 2WNWA 3EWYA 2CZFA 4I90A 1TRDA 5I77A 1EXPA 4QIUA 1MI3A 1BXBA 2IPWA 4LVGA 2INZA 5DF0A 2WM0A 4WY0A 1VH7A 2Z1SA 5HR7A 3PAOA 3PPCA 4WGXA 4IFKB 4V27A 2VNCA 2Q02A 1NDVA 2YXOA 3I6RA 3RN6A 3TYDA 3M0XA 3HU7A 4IX2A 3RR4A 1TV2A 1LJYA 3S0CA 4J27A 1BPLB 3KBJA 5E09A 4GUJA 1MZRA 1Q3NA 4AY8A 1DQWA 5DEZA 3TW7A 4NJKA 1UZHA 2ZUTA 3HMJG 1K7FA 4PTNA 2Z4GA 5CLWA 5C7VA 1KTCA 3W02A 1CWYA 3GHRA 1R0MA 2V2CA 4E8DA 1J0JA 1XUZA 4WDXA 4DM2A 2NXHA 1W1TA 7REQA 1G7VA 4MMWA 2A21A 4QDWA 4I7UA 2OR2A 1DQUA 3DI0A 2ZUNA 3S1XA 2BX7A 2PTZA 2D23A 3VPLA 2PZ0A 3L5AA 1UP3A 3V1HA 3OB8A 1TPB1 3URNA 2Q09A 4RZ5A 1KGWA 1XH1A 1ONRA 3OBAA 4GY0A 1KM6A 1CNVA 4QAIA 3C52A 1EGMA 3GDBA 4PB3A 3GYEA 1OD8A 3HG5A 2Q71A 4H8NA 3B8WA 3LMYA 2FZMA 5D37A 1FOBA 1R9XA 2KAUC 2QMKA 3WQVA 5GNXA 3LQLA 4FNUA 2C1IA 2YXXA 1SQ7A 3S1GA 5F7UA 3W07A 3BOFA 3P7YA 2HDJA 4XAYA 3CQIA 1JZ7A 2XIMA 5J5RA 1V3MA 3R12A 5FJUA 4KKXA 4D1IA 4KIRA 2WJEA 4LY4A 1B3WA 3BWWA 3VDHA 4LJ3A 3MUZ1 2DZVA 1CGYA 2OYKA 3PBMA 2OELA 1GOOA 4IX0A 4LUYA 3KBWA 1C90A 1Z32X 2A0NA 1R3QA 2VEMA 3LDVA 4BF7A 1T6MA 4JFUA 4XKYB 4R7OA 2DDXA 3R8HA 1RV8A 3UVAA 2J9XA 1F3TA 1LTDA 1M7JA 1RCOB 3BOXA 2VX7A 2FQIA 4U3CA 2YFNA 2PA6A 1B3VA 4PBEA 4P7QA 3W7JA 4GABA 1FWDC 1FDJA 3RLHA 1X1OA 5ABEA 2OX1A 4L7ZA 5DT7A 4MFEA 2W63A 2X8RA 4QXIA 4O1EA 2HBVA 3D6NA 3VGEA 2CNCA 1L6YA 4LU0A 3GU2A 4J3ZA 3KVJA 1SW0A 3LSBA 5L6UA 4A6GA 3USZA 3GVQA 4AEFA 1QI2A 2D22A 3ARTA 1VFOA 3POCA 1PCWA 3EOSA 2O9OA 4QG8A 3VKBA 2O56A 1MVYA 1VEOA 4DUXA 1EL3A 1HT6A 4F0SA 1ZJIA 1EO7A 5G1TA 1M04A 4X22A 1W9BM 5DXYA 3A4AA 3HQNA 2X09A 1V3LA 3IV8A 3TAOA 1GVSA 2X0YA 4M5PA 4LYPA 3VNDA 1XLAA 4LANA 3BOLA 3MVTA 1YADA 3G1FA 1PZ3A 4IH3A 3F4WA 1R5YA 4A05A 4PTMA 1F6YA 3AS0A 2GL5A 4E2DA 2WOQA 2PEVA 4KCWA 4Z2KA 3WFLA 1XL9A 1MUCA 4FLSA 4AW7A 3WK1A 2VC5A 4F0HA 1E3ZA 3PHAA 4TTUA 1I8JA 5BXTA 4S2BA 3V0TA 4UTWA 5TAOA 5I02A 4RDZA 4PEEA 3GAKA 4J3UA 3BCFA 4B5NA 3VKJA 3OGVA 3G1YA 3NGFA 4G2DA 4ORIA 3W29A 4OBTA 2J7EA 5AYZA 1ZP4A 3W7KA 5HXMA 4XD5A 3CUFA 3ZT7A 4KIEA 1RALA 1KA9F 3NL6A 4WRHA 5U4NA 3OVQA 3VOIA 3W1AA 1JCLA 3UJSA 3VOGA 1GHRA 4NJHA 4OU1A 3W00A 1R8LA 4S3JA 2E1WA 2GDQA 3WDIA 2O9RA 3WBAA 9XIAA 3M7SA 3WQ4A 4J7RA 1DWAM 3SGUA 5D2YA 1MXGA 5AYYA 4JFTA 4HVXA 2QUMA 4D6FA 2VEIA 2VD9A 1KBBA 4PMNA 2Y63A 3G8EA 3N13A 4PB4A 6A3HA 4D6HA 2QVNA 1I75A 3O05A 3I4KA 4LC6A 1HG3A 1XIFA 3HPFA 4CN6A 1KR0A 3E0LA 2Z25A 3TCSA 5HJLA 4C7FA 1VF8A 4QJ5B 4XAZA 3RXZA 1TPEA 2XIQA 3JS3A 3H7RA 3TLQA 1OABA 4OE7A 2Y62A 2ZRWA 2JK2A 3S5ZA 1MNZA 3L0KA 3E0WA 3JZUA 4MG4A 1SYTA 1BYDA 1QXLA 1BYBA 3SRKA 1EO5A 1AQFA 5HBFA 3DH7A 2WLZA 1Q6LA 3FGCB 3QQ0A 2BV9A 2WNNA 4ZMGA 3ITXA 3FSTA 4MNJA 4GX9A 3KAOA 5I09A 2O92A 2OOGA 2XH7A 1BGAA 2A5HA 3OODA 2FJUB 3AI0A 5FESA 1BTCA 4M0XA 4WR3A 3POHA 1W3KA 4O0ZA 1X1ZA 4A8RA 3DBNA 4AVFA 1MYRA 3FHQA 3N19B 1F9CA 3GHSA 4ILSA 4GY7A 4E4PA 1TTJA 4M1BA 2V69A 1N82A 1ISVA 1MW1A 3SY1A 2BXYA 1CGUA 2P0OA 3ABXA 3THQA 1H7OA 2G3NA 4GC4A 1Q45A 3XISA 2OZ0A 4IISA 3W1QA 1E0UA 1HJQA 3E0IA 3CIXA 3UXKA 3L68A 3KEHA 4WD0A 2ALDA 2GQAA 3GHUA 2EG8A 1HP4A 1VFSA 4TUFA 2FYMA 1XP3A 2QUNA 3QV8A 3CS2A 3PPGA 1TWSA 3L2MA 1ITCA 4NVTA 1UW9A 1E1FA 2V2HA 3ARQA 3VD3A 3WCZA 1LOLA 1GORA 3SIMA 1AD1A 3NQMA 3LHVA 3W7GA 1EBHA 4UBPC 3S42A 1XYAA 3ZIZA 1CENA 3TAKA 3W74A 4OUEA 3PZIA 1TREA 2F84A 2P3EA 4ALDA 2ZXDA 3RAOA 2PP0A 4NZFA 1V0LA 5HMDA 1WO2A 2HPIA 2I57A 1V3IA 2QR6A 3OEXA 4JHMA 3RPDA 2A3BA 3MTWA 2H8ZA 5DANA 3G3DA 1MQPA 3ZFHA 3QC3A 2DSWA 5CJNA 3BAWA 4M6VA 4G8TA 3DC8A 4DWSA 4ZXLA 3DCPA 3N4FA 3PZMA 2VWSA 4HU0A 3HQ1A 4WKFA 1ZP3A 3GFYA 3CZ8A 2AMGA 4L5ZA 4TQTA 4Q8WA 5I3GA 5DO8A 3CIVA 1F7BA 1PDZA 1N7KA 1OFEA 1SZEA 3ITYA 3QLDA 4AD3A 6TIMA 3B8UA 4RPQA 4B3KA 1GGOA 5IFPA 3B3DA 3IK2A 4LAKA 3BV7A 5LHFA 3G1XA 1FHUA 1DVJA 1EHAA 4YVVA 2CWXA 1OBAA 3TX9A 1V6YA 2RDXA 4AWSA 4J3TA 3CUGA 1B4KA 3HA1A 1TMQA 3WN6A 3DKJA 4GXPA 4UFKA 1FXPA 3LBCA 4FS9A 2VP8A 4MZ8A 4GI9A 6ALDA 1TIWA 3SSJA 5CZJA 5A94A 2C6QA 3EWZA 4ICCX 4G1NA 3W7PA 1OQFA 3KDNA 3FCPA 5J5DA 4CCEA 4XD4A 3AXKA 5F4XA 1XYBA 3B4UA 1V0KA 1I45A 3W24A 3WEMA 2Z0IA 1MQQA 4FNPA 3L4TA 3QVQA 2NSOA 4DJED 2DV0A 5FA5A 1AJZA 1LZOA 4Z1CA 1KM2A 3AZSA 1PUDA 3BLEA 3RCYA 4O1FA 1E4IA 4PC8A 3H7VA 1CXEA 1VYSX 3GDMA 2XSAA 3W1PA 4PUDA 1XH2A 3S1UA 4DF0A 4GO8A 3CYJA 3VOCA 1TQJA 3BMVA 2YYUA 3EWUA 3ABQA 1F5ZA 5XIMA 4DZ5A 3N18A 4HK7A 3JRKA 3SUSA 3FYYA 3J7HA 4PMYA 4AUBA 2I5IA 3INPA 2INFA 5HANA 4KFNA 3AIWA 2VCBA 1WDSA 2PRMA 1EYEA 1FKXA 4C6LA 4JICA 2DJLA 1EJSC 5FAGA 4YVPA 3FDKA 2D3NA 1KM4A 3BQ6A 2EQDA 1RLDA 4GK8A 1WAWA 3AYVA 2A3EA 4X3ZA 3QM3A 2PODA 2WC7A 4TV5A 4W7VA 5KITA 3DI1A 5LA2A 4JTRA 1YE4A 3G1AA 1XDMA 5H8UA 1UUMA 1WDPA 4BS0A 4AWTA 1UD3A 4K39A 5HMSA 1DV7A 3QMTA 3C56A 3QYSA 2QCDB 5AHNA 2QDGA 1QVBA 2ZUMA 1XJBA 4NRRA 1JAKA 1LT7A 1VQTA 3CT7A 3MKKA 4IPIA 1IEQA 2CHRA 2YKKA 1UMYA 4P7LA 3UESA 3Q67A 2OQYA 3LN3A 4FPSA 3W2LA 4AMAA 1TTIA 5BU9A 5K3VA 4RE4A 2YXGA 1ZTVA 2ZRXA 3DAQA 1LL7A 4LXFA 3FSUA 3PUDA 3VC6A 3VNIA 2IMRA 3IIPA 4LUSA 3P8IA 2CLLA 3EAUA 2DZPA 2POTA 3B9AA 2ZE0A 1RA5A 2XM1A 1SO5A 5CBJA 3UR2A 1PEZA 4ZO7A 4RNIA 1J10A 1AVAA 4NUWA 1XFBA 3PBVA 1P7TA 2EPHA 1PKMA 5AVHA 5BWAA 2IUZA 1FA2A 3VCCA 4D8LA 1WX0A 1LT8A 4ML9A 2B7QA 5FI8A 3KX6A 2HE8A 1RCQA 1CGWA 3BURA 4YYFA 1XBYA 1UA3A 1OFAA 2J78A 4RCXA 4O0KA 4C6BA 1M1BA 4W5ZA 3SGGA 1OCQA 1ITUA 4GIRA 4W4QA 4QISA 5GNYA 2ZX5A 3IGHX 1YE6A 1J96A 1Q63A 2WKLA 4NZ4A 3KRUA 4GVIA 2Z28A 4HSNA 2PUZA 3BGAA 4ZO6A 4ASTA 3GC4A 4GE8A 1G6CA 4GWEA 3WH9A 1GJWA 1ADOA 5HMFA 1OG6A 1I4NA 4XV0A 1SJDA 2HRWA 4H6KA 4LF1A 5D2XA 2VFGA 1EPVA 2ZCGA 3SIZA 2OJPA 3UCCA 4M1RA 1TX2A 3HV8A 2DU2A 5M3WA 3EA1A 2DUAA 4P8UA 2J27A 3KCLA 3LHYA 5E0FA 1R3SA 2R1KA 2ZRUA 5LIUX 1ZAJA 4GCXA 1Z3NA 3LOTA 3C2YA 5DCBA 1FVPA 3SN1A 1MDLA 3RRAA 3F4DA 5F4SA 3WZ0E 1XIMA 2H6RA 2Y5SA 1B54A 3URAA 4C6JA 4FX7A 3E5BA 1RD6A 3F1QA 3ICJA 4AVNA 2HISA 3GBDA 5IXEA 1TV5A 2GQ9A 4HHHA 4UQDA 4HK5A 1M65A 3WDQA 4IMFA 3MUAA 4Z0SA 1E55A 1E51A 5H6HA 3LERA 3A4JA 1B9ZA 1KRBC 3LS9A 1LORA 3LHTA 5HUOA 2HS8A 4HD5A 5HJXA 1RD5A 1XIIA 5KZDA 3CUZA 3TYBA 1EP1A 4MLJA 3LQGA 3QY7A 2YL5A 4P8WA 2TAAA 4JL1A 4S39A 1VZWA 5A8GA 1FHDA 3VNLA 1TWDA 4F9DA 2EGZA 2J62A 3N6HA 1VCGA 5AVNA 4AC7C 3BAJA 1PIFA 2HZGA 4JS3A 4DYJA 1CX9A 1UH3A 3HGSA 3N2BA 1GZGA 2DSUA 4PUMA 4WX2A 3GNRA 2ZTKA 2QUTA 1TCDA 4N9BA 1UD5A 4JKKA 5AYBA 4GZIA 3SURA 4LUTA 4UXDA 5G5IA 1F4HA 2J7CA 1E72M 4NAEB 3CPGA 2EF9A 1WDRA 3R8RA 3TR9A 4IG2B 1OWQA 3HM7A 1EFZA 1OZQA 4FXJA 4EPKA 2ISWA 2EKGA 4YYCA 3VKDA 3P0XA 4JNZA 3NA8A 1XQKA 1XKYA 3ATYA 3EX4A 3FIGA 2R14A 4LPCA 3L4VA 5C2CA 1OB0A 2BVTA 4E3VA 1D7FA 1MWOA 1IZCA 3VVGA 4JTDA 2XINA 4V15A 3GW0A 4CU6A 3MW7A 1XYZA 2DZBA 2ZA3A 1JFXA 1I0DA 1Q5MA 2P8CA 3H2EA 1WNOA 2VUNA 3GS6A 2P0IA 1S38A 2BNJA 3AYSA 3M47A 1RVKA 1FWBC 1QO2A 3T1GA 2J8TA 1XLBA 1KBLA 3VMNA 3LI0A 2G96A 4RZ6A 1OVDA 2C79A 2VGGA 2PFHA 4L4LA 4TX9A 3F2BA 1AJ0A 4BWLA 3AC0A 3T4CA 2W79A 3KCOA 1XFCA 1RCXB 3PFMA 4HPJA 1KTBA 4E6MA 4OJYA 1JCJA 3K30A 3H2FA 1KV8A 1W1PA 3AYTA 3W81A 4GQ0A 4WDTA 5JU6A 4ZOBA 5C7HA 5CZTA 3C3UA 3A4WA 4HPGA 1F6PA 1JZ6A 3LBMA 1NAL1 1NEYA 2GVJA 2DPEA 3R10A 2R1PA 2VDHA 4JY8A 4F66A 5ABFB 3MJYA 4Q7NA 5KMYA 3SEPA 4J4KA 1EYWA 3WD0A 3UWVA 2Y7DA 1HJXA 4HPHA 2J47A 5DELA 2E67A 5D9MA 1H4PA 4WDWA 3I3BA 1ME8A 4JDBA 3QPYA 5K9DA 3IUDA 4YTUA 5CC5A 3SW6A 2C16A 3UYIA 3REQA 2B7OA 2BHYA 2ZX9A 3OPSA 3FDGA 3NPXA 1N8WA 2W61A 2GSHA 1XG3A 5D04C 1R9ZA 2Z1XA 3S6DA 2YA0A 1UKOA 2GJRA 4ERIA 1EGVA 1UWSA 1P4CA 4Q4QA 2ZC1A 1VFLA 4MWAA 4M8UA 4PA8A 2J24A 1V02A 3NZRA 3PNUA 1JJKA 3W28A 1GPWA 4J9JA 1OCBA 2VTFA 2PF0A 5A8NA 3ONBA 4Q8TA 1Y7VA 1GKPA 5E93A 4ADSA 2PBOA 1W56A 4A8LA 3LTPA 1IT8A 3NQBA 3NPVA 4JD4A 3WLLA 4GYKA 1LBFA 3KVLA 3UJRA 1A5OC 4G7EB 4KEUA 3SADA 1CIUA 4P7RA 3GNNA 2RFGA 3HTWA 2ZADA 3STPA 1VB9A 2VCCA 1F3EA 3HN3A 1IT7A 2OSWA 5M03A 2GUUA 4IHCA 3B0UX 4DXKA 3H4GA 3GBEA 1AK5A 2CEQA 4XWUA 2J66A 3VOFA 2Q8ZA 3T8QA 3RGTA 5B80A 2VEGA 3SO7A 2HBXA 3IVUA 2MNRA 1SJCA 3GM8A 2WAGA 3GNOA 4H04A 5DCEA 1TX0A 1A53A 5JH2A 1M9HA 1W9XA 2PSNA 2UY4A 3AU6A 4D8ZA 3CL7A 4IFRA 1UD6A 3SUTA 4MSSA 1UG6A 3SCWA 4Z2IA 3AISA 1E6PA 1O68A 3AHZA 3E5PA 1BVNP 4QE1A 3GZ3A 3VABA 5AC7A 2VI0A 1MSSA 5CKSA 5I3JA 1FRBA 1UPMB 3HG4A 3AQUA 1XQLA 3EXRA 4K2SA 3GXNA 2AQVA 1E4NA 2HCVA 3M1ZA 1LP6A 3RCMA 1HXJA 2X0SA 2NXIA 3U2EA 3WQDA 4XZWA 1GHSA 1OINA 4OV4A 1D3HA 3DYPA 3MV01 4KCVA 5A69A 1HVQA 1B3ZA 4PFMA 4V33A 1KXVA 3U57A 2PTDA 2EPNA 2V38A 2XVGA 3CZLA 1ZY9A 5I06A 4RXFA 3OG3A 2QAPA 2YLAA 1B3OA 1X96A 4EF9A 3TZNA 3N1AA 3QPZA 1IEIA 1GNXA 3WQOA 4ZQCA 1JQVA 2PLMA 5HINA 1GPFA 4OWGA 5M1TA 1US0A 4O52A 4I5UA 1MEIA 2VC6A 4I9TA 2QPUA 1Z69A 4ADTA 1X97A 4LCSA 3KZPA 1V6XA 1NF7A 2WHKA 2NV2A 4DIAA 1CB7B 4D6EA 4AG0A 3BZGA 5TF0A 3HGRA 2C18A 5GNZA 3WDPP 3VYLA 3PC0A 2OKOA 2XU2A 1IYXA 3H12A 3RJXA 5M5DA 3BK0A 4CD6A 4F0RA 2W67A 3OLDA 7ODCA 2PZNA 5ABTA 1A0EA 1K7XA 1J5TA 3AS2A 3EKGA 4AZCA 4IXXA 1SR9A 5LSMA 1A4LA 2ZX8A 2ZUUA 3N17A 4IQDA 3VGGA 3VDBA 1Z48A 3FX4A 3QFWA 4I7VA 3W82A 1R85A 4H7VA 3EDJA 2XWEA 5JMUA 2PU1A 2CLPA 5A6TC 4QFUA 1HL9A 2HS6A 3RLGA 2WK2A 4WEVX 2WW5A 3CHFA 4GQRA 3BMXA 4U10A 5C2XA 1IWPA 4D6CA 1MW0A 3AWOA 4EKJA 4OV9A 2WHMA 3C3NA 4O57A 4D1JA 2GZXA 4PL2A 1SW7A 2XN2A 3DKLA 4AEOA 3E0FA 3W7QA 2GOUA 4ZB2A 1O4UA 3APTA 3ITTA 1C92A 2L5HA 1LOQA 1OG0A 2PGFA 3M5XA 2JALA 3C61A 3CZEA 3W6YA 4B16A 4LBSA 4ERAA 1JZ5A 3PP7A 1AH0A 1DL3A 5FF7A 3W6MA 1K9TA 2X1SA 2ZDRA 1NWSA 4LSBA 4CN4A 3RLUA 2QDHA 3EMQA 3IK4A 4FIRA 3QZAA 1KO0A 2FZ9A 1S3HA 5T9CE 1JYWA 3U7BA 1I60A 3ZVHB 3LUTA 1DJZA 3FXGA 4GOAA 3S2NA 3UT0A 1LRTA 1M01A 3FA3A 2DZSA 3DYOA 3L65A 1M03A 4GISA 1QATA 4IFOA 3DESA 1Z89A 1Q7MA 3THAA 2NQJA 2R8WA 3BAXA 1VPXA 3HURA 4LB3A 2W91A 1KFWA 1VP5A 3DX5A 3TQKA 3BG9A 5CBBA 5CPSA 3GR7A 1ZAHA 1LWHA 1C8YA 3S5YA 2NX1A 2G3FA 4LYRA 1MFUA 4ZQPA 4BEUA 1RR2A 4MY9A 1C93A 1KFLA 1NFPA 3DU0A 4GQGA 2PU0A 5ECUA 3O1NA 4YVXA 1WXZA 2WMGA 2E5BA 2D2GA 3NYDA 1Q8AA 2E6FA 2W9MA 3Q2DA 3UP8A 3WNOA 4H2CA 3EGJA 2F8QA 3DG3A 3NUKA 1DWGM 1Q6OA 1J2BA 3MU7A 5A8QA 3BMWA 4LWWA 4Y96A 4B4FA 5BCAA 3EX1A 2QMJA 1ZLPA 2H9AB 3V3WA 1PIIA 3CZGA 2CKRA 4UB9A 7ENLA 4AX7A 1B2YA 1YYAA 2CZDA 4DUVA 3M41A 1MW3A 4BI7A 4IMCA 4GC3A 5HQLA 3A22A 4NYUA 3AMLA 4QSHA 5LNSA 1QU4A 1MMFA 4JIIX 3PSWA 3DC0A 1TPUA 3WMBA 4K1WA 4DLFA 4H6QA 1OFRA 1OSEA 4RW5A 1BRLB 3T42A 1XW8A 1Q66A 4FO4A 4NHVA 4US6A 3ZWSA 3CK5A 4RE0A 1TSIA 4NJJA 3DHFA 1WZKA 1E0TA 5GVJA 4HSOA 1A3WA 1HKVA 3DUGA 4DLMA 3RIKA 1FCBA 4DJEC 1VFTA 1ICPA 3CMGA 1DJQA 2ZA2A 3KFTA 1VBGA 1E6QM 1UYQA 5CSYA 1JD9A 2NUWA 4M19A 4H7ZA 5E9AA 1LRNA 1XV8A 2P88A 4IMAA 2DQXA 1W1YA 4EACA 3ZLFA 4N9DA 3TWAA 3IJ6A 4JNMA 4KRTA 4NZ3A 1G4PA 2XTKA 3QV7A 1J11A 4PSPA 4CQAA 3BGJA 2EPOA 3G8RA 4GFIA 3WLNA 3SFWA 3CUHA 7PTDA 1IXQA 3CZJA 3AJ7A 4MB1A 2VELA 3VZZA 3TXZA 1XYMA 1UWRA 4U3AA 1LUCB 4CEXC 2BBFA 1QNRA 1NSJA 2VGIA 3C8FA 4QAWA 4HPNA 3P8JA 2X1RA 3GVWA 2HVOA 4RE3A 3F4NA 2A7PA 2QCCA 1GW9A 4PMRA 2VX5A 2NV9A 1SMDA 1W31A 4LV4A 3EB2A 2YIHA 1AH3A 3PS7A 3VILA 5HNRA 4AD4A 3ARWA 4C6KA 1XRVA 2ZZ4A 5FJRA 2RAGA 4ZO8A 4Z1DA 1DIDA 3VIIA 3OZPA 4W9TA 4UOQA 1VHNA 3WQ6A 2BFGA 3UZ5A 1QNSA 2FVKA 2W62A 4EWND 1T41A 5D4YA 2V8ZA 4ZXOA 3GG7A 4LCRA 1KM5A 2ZZ6A 1G01A 4O0QA 5AC5A 2FZ8A 4O1AA 3SUVA 2J7HA 4TVCA 4DB7A 1RLCL 3QGKC 3F7JA 2OKTA 3E9AA 3NPUA 4CKQA 2XFFA 1ZQ5A 3TOYA 2WXDM 4AWEA 3GUGA 2QEZA 4Z1YA 1RK5A 3ZJ8A 2AKMA 4UUIA 1RVGA 3EWDA 3NO1A 3WY1A 5C55A 1JPMA 1CCWB 3WLRA 4HYWA 3SZ8A 3OP2A 4Q8NA 1GZJA 3PG8A 4JTQA 4PUWA 5U7SA 3W1MA 1U22A 1GW1A 3MPGA 4W84A 2X05A 3WH6A 3SCOA 2GGHA 5PTDA 1K8YA 3RO8A 2WVVA 3KM8A 4AX6A 5KTLA 2XYLA 3GSMA 1E3XA 3EOLA 3NM1A 5I3FA 5JXQA 1PX3A 2ZZ2A 3OLIA 1O5QA 2PE4A 4W87A 2WMIB 2YX0A 4CUCA 2IXUA 2WMJA 3WNLA 4HA1A 1A3HA 4GO9A 1QAPA 1U5JA 3VGDA 3BZJA 3AS3A 1PCKA 3M07A 1TG7A 4GY1A 3RM9A 3TUUA 3G6MA 1KM1A 1IIGA 3QW3A 1YXDA 4QROA 2GVYA 2VFEA 2IKGA 3BG3A 1CGXA 4UFLA 1NIUA 2E7FA 3W38A 4WJEA 3W7MA 2IXVA 1R46A 2WWDA 4W86A 4AEEA 2SFPA 4XZ9A 1JYNA 1UBPC 4KRZA 3DIPA 3RFAA 4MB5A 1I2NA 2BY1A 4HZ7A 1S5MA 4ENLA 2GGGA 1ZCCA 2OLAA 4WKHA 4Q8VA 1TVLA 3K1DA 3VKAA 1R47A 4NNCA 1P1XA 5AB3A 1QW7A 3BAKA 4S23A 1FCVA 2I9UA 4HP5A 3UPBA 1F8IA 1OF8A 1W54A 3LYEA 4L9YA 3KBSA 4Y9PA 2Y6ZA 2KZHA 1SVDA 1BLIA 9RUBA 3LPGA 5CAHA 1ZNNA 2CXEA 4FXRA 3K8KA 3R0DA 3FK4A 4F4RA 1PKYA 1AMKA 2F6UA 2GGEA 3T2PA 4GKLA 5FOOA 3FFSA 2CW6A 3NL2A 4PODA 4XUGA 1YNPA 5AFDA 3IIVA 4JYEA 5BZAA 5BOFA 5TD4A 4MB4A 3VE9A 1VIZA 3NURA 1OZMA 4O15A 3T2OA 1HJVA 3DFTA 3B0PA 1K02A 3UG3A 1W5NA 3WLJA 2DH2A 2VENA 4XAFA 3BPWA 2C14A 4LTSA 1UC5A 1ZUAX 5FL1A 3OZYA 2ZVRA 2C71A 3F2CA 1N2VA 3MI6A 2Z2BA 4GZ7A 2ZX6A 4Z1AA 2PDJA 4NXKA 4WSJA 1K4HA 3FA4A 4AIBA 2IQ0A 3PTMA 2FGZA 3BCJA 3DG6A 3N9KA 4C90A 4CCZA 4REQB 1NOUA 4UZSA 4N42A 2HK1A 2NX9A 1IXPA 4CD8A 4WOZA 2PDGA 1JNDA 3CAQA 2ZFAA 5I3KA 4PGLA 1GVEA 4WXZA 4K37A 4DXXA 3NQGA 2DSKA 4UTMA 1V0MA 4F0KA 1NELA 3A12A 3MJMA 1UR8A 2QJGA 2DIJA 4LUIA 1GOMA 4WJ8A 3BSMA 1WDWA 2E40A 3GLCA 3LHWA 1ZS2A 4QS5A 1QPQA 5BXPA 3BLPX 2GJXA 2Y0FA 4QQUA 4PTWA 2X41A 2UBPC 1XH0A 5AYIA 3G22A 3EDKA 4D71A 3MC5A 1W3LA 4A21A 3CBWA 3OG2A 3ITOA 3LCGA 1UR1A 6XIAA 4MUPA 3UPWA 1QW8A 3VCRA 1ICSA 3PJUA 2EG6A 3H2CA 3EX2A 1OFOA 3PSVA 2BZNA 4M82A 4L1WA 8A3HA 4B3ZA 2ZWYA 1CLKA 2ZX7A 2QT3A 5EPDA 2EJ1A 2GWGA 4IMEA 2E77A 1GVRA 4DJDD 1A0DA 3THUA 4LNYA 2HMCA 3LY0A 1GJPA 3FYOA 4LF2A 2GYIA 1H0GA 1PTAA 1L9WA 2D2OA 3BAYA 1FFRA 2Z6IA 3NFUA 1OK4A 1QK0A 2JEQA 4I5XA 1W8SA 2QCLA 1QNQA 2C1HA 3M0ZA 4NZ5A 3QRHA 3L4XA 3GVGA 3CIWA 5D03A 3R5EA 1D8WA 4O8RA 4LBUA 4RL3A 1EKOA 2OZTA 3ARRA 5LIXX 5AHLA 3FJ6A 3LXBA 2PRHA 1OCJA 3KL0A 2XH2A 4Q4MA 3LK6A 1JF6A 3K13A 4BQ5A 2NQ5A 3E2SA 3RM4A 3BDKA 4WQ6A 1J0KA 4AXKA 4UFMA 3OO2A 1QDSA 1LWIA 4MPKA 3CB3A 4UZUA 2WBGA 2QGYA 3H8AA 3B9OA 1I9CB 3GFXA 3LGEA 3EDEA 4D72A 2QF7A 4JFVA 3P2VA 1FTXA 1K4GA 4QS6A 4AF0B 3OVRA 4BK9A 3GO2A 3ZWTA 2ANUA 3PR2A 5HMEA 4AIUA 3QEZA 3N14A 3GXIA 4HA4A 5DY3A 4PMXA 5C70A 4DF1A 2WNQA 3EKLA 3LPFA 2DSZA 3T07A 6XIMA 5ABHA 1UWIA 3CPUA 1VCFA 1YXYA 1ZALA 3QHOA 1N8IA 1AG1O 3I7SA 4HMEA 3TE9A 2BXVA 3VIHA 1VBHA 1EUAA 2EBNA 2J6VA 4LFYA 2DW7A 2DP3A 3NQVA 1CYGA 4G1KA 3BJFA 4YTQA 5LNRA 1YDYA 1G0CA 6ENLA 3DHUA 1ECQA 2GSJA 3CNYA 4C6FA 1HQTA 3TQ0A 4IM4A 5HUPA 1Z7AA 2DORA 3PZQA 5DQPA 3AMKA 2NQLA 3B03A 1X7IA 1NWTA 3VIOA 1VKFA 1SSGA 4GJIA 5BRPA 3H2OA 5HA7A 3ORWA 4XIAA 3OLGA 2MUCA 2QF8A 3NVTA 4JTLA 1W1IE 4Z42C 1KW1A 3PF3A 2PDMA 2GDVA 3KWSA 1JGMA 3CXOA 3S2JA 3U0HA 4AZIA 2VZOA 2AQOA 2VJXA 2X0HA 1NTHA 4G7FA 2IS7A 4UQ9A 1UBSA 4BZYA 1CXIA 3WF0A 1PPIA 1ML1A 1D7KA 3S6TA 3E0VA 2DIKA 4QP0A 4DAFA 2AL2B 5A6LA 4MY8A 5E0KA 4GJJA 2WB5A 2QHAA 3MKVA 4C6DA 3SR7A 2XVLA 2VCAA 4NJGA 5REQA 1G7UA 3EWWA 4CQCA 4UNIA 5RUBA 2VX4A 2GJXB 3TIMA 4W93A 3W73A 2KX9A 1SUXA 4INFA 1SPQA 5EY5A 1VHCA 3EX3A 1G5AA 2WNZA 4MNLA 3GZAA 2BY3A 3STGA 5I7GA 2WANA 1O95A 1HZYA 2E6AA 3C86A 3LTYA 2Y8KA 3CHEA 1O94A 2OWXA 3DFNA 1W8GA 1JCNA 4J2MA 2Y85A 2QW5A 3NXLA 4MOZA 2Y7GA 3QZEA 2W0UA 3S9YA 3PJTA 3NO5A 1UROA 3E49A 3H23A 1KXTA 1ADDA 2OEJA 2BASA 1K6WA 4ZOAA 3GC5A 4LT9A 3VK5A 1OFPA 1E4LA 1UR9A 2ABBA 1H3GA 4RPPA 3THDA 1KBKA 3EPNA 2H90A 3UERA 1H2JA 4PMJA 1UWTA 2C19A 2WKGA 4F2BA 3PB2A 1WXYA 3W7LA 2W5FA 4ZE5A 1O6IA 1PJ9A 2X1UA 7TAAA 4JXCA 3PM6A 1TKKA 4YU1A 1CECA 1U1HA 3ALGA 4NAFB 3VD9A 1Q2RA 4KWUA 2P50A 4FIQA 4ATDA 1XLCA 2BVWA 4M7SA 3DERA 4URIA 5M2FX 4HA0A 4YMZA 1R3RA 3PK7A 3KBVA 4GNVA 4ZB0A 5CCZA 3URQA 1E15A 4V1YA 1I2OA 2LLEA 3DYMA 5JQ9A 1DEDA 1K3UA 3P67A 1CXHA 4JL2A 1EIBA 3SCVA 3F2DA 2AMXA 2UY3A 4NXSA 3M0MA 3TEVA 4I8DA 3QR0A 1UKPA 4P2VA 1RZMA 2HEJA 4CCDA 1ZB5A 4GCAA 3IUIA 3ABRA 3AXMA 4A2SA 1W5MA 3N15A 1E6ZA 4E8CA 4WIWA 2G4JA 4MWAE 5HK4A 2BHZA 1V02E 4DI9A 1H7NA 1WBJA 3I6TA 1DKWA 3MT1A 3RNDA 1TPFA 4AD5A 1H1NA 3V4BA 3LEPA 3FAXA 1XLDA 2H8XA 4HHPA 1VD6A 4LH8A 1SFJA 1I2PA 1R30A 1RQEA 4W85A 3GXFA 4LEFA 1H1YA 1H49A 3GAYA 3MUCA 5A2CA 3FVMA 1KRAC 1X1NA 3GHTA 5KZ6A 1RBOB 5HQEA 1JF5A 1PX8A 4F48A 5HDRA 1UP2A 2G50A 3LD5A 5JBDA 1KFCA 3EDDA 1VPQA 1R7AA 4P7NA 2NUXA 2CLMA 2A6NA 3H70A 2GLKA 3ELFA 4ZZ9A 5DCDA 1VAHA 1I0BA 4S2CA 2WHJA 4Z2LA 4XIMA 1Z6KA 9XIMA 4KERA 3S5NA 1EXBA 3VAVA 4JX6A 3S2LA 3APYA 4ACZB 1KQZA 2YL8A 1RP9A 1Z9AA 1S5VA 3OOQA 2C15A 3WBEA 2I1OA 3N25A 4H9YA 3VNMA 3W72A 2Q3OA 4NI3A 3C2EA 2DY3A 6REQB 1TZZA 4X2RA 2PDIA 1XGEA 1XDJA 4G6CA 1GG0A 3N4EA 3S9ZA 5HQMA 4O19A 5EBUA 3HQOA 2WZTA 4CQ9A 4ROQA 4CD7A 4V1XA 3CB8A 3TYUA 1UUQA 3O16A 2NQZA 4R85A 2J77A 3CUIA 1XCXA 3QHMA 3OQ8A 3ZMRA 4M51A 5C9WA 4O10A 4YCPA 5A6BD 1SFSA 1E5NA 1E5JA 2HVNA 1IGWA 1EJXC 4I6KA 3E2VA 1SO4A 1K9EA 1B31A 2PCEA 3AU2A 2WSRA 2ZICA 3LMZA 2F6KA 5EB8A 4JQ2A 2FZDA 3CLMA 3KVMA 1TELA 5EBAA 1EJTC 1S2AA 3VXGA 5D33A 2YJQA 3OVPA 1WDQA 3EOEA 4CEUC 4IQLA 3LU2A 2G0WA 1CEOA 1V7AA 3T4WA 5LHEA 5G4WA 3R1ZA 4HU4A 5AY7A 3GE7A 3OW1A 3P61A 5MKGA 3C5QA 4WOQA 2C13A 4FXFA 3VX0A 4MGGA 4A35A 1KC7A 3FAWA 4KETA 1M53A 2C0AA 5D9OA 3WNKA 4LCQA 1J0YA 1KCKA 3PTQA 4NZCA 1AW2A 1RAKA 2VFDA 3BW3A 1PYMA 3O6YX 4IGHA 4CLMA 4GIEA 3LM7A 2X7WA 1AQMA 4YS1A 4B91A 1O12A 4XZNX 2HSAA 4JR5A 4DBSA 4RNJA 3TQPA 2Q6ZA 3DGBA 6PTDA 2OLHA 2X40A 1KLYA 1A5CA 4IFKA 2FKPA 4NKCA 1FH9A 1E9ZB 3LSCA 1DWIM 1TFVA 4R34A 1GWJA 3CEPA 2JEPA 1EH9A 1VFMA 1BHGA 4FZIA 2Z1KA 3N9SA 1RQHA 4GPNA 4Y9NA 2EPLX 4EXQA 1HKWA 2AL1A 1P43A 1GUVA 4BJHA 1SMAA 2QJNA 5G4EA 2D0FA 2E8YA 1SM9A 3MSGA 1MRAA 2OMAA 3UWEA 4K8GA 3WQGA 5BRQA 5T9BG 4RXGA 4YTSA 3MWAA 3AHXA 1GOKA 3MCNA 3V5CA 5T8GA 5GJPA 3R7MA 2X42A 1CDGA 1RY8A 2Z26A 2BGQA 4MAZA 4R9XA 2R1MA 1E1EA 2QCEA 3CWHA 1B30A 1GYLA 1ICQA 2HE5A 4J3XA 1JEZA 3W25A 4JGDA 1H62A 4ZTXA 3L4YA 3SGZA 5AC6A 1E6XM 5IFTA 4KT2A 3L4UA 4PSRA 1AODA 1M41A 4LX4A 3WEOA 6TAAA 2R1NA 3OA3A 5HOSA 4OVXA 4HCHA 4YXGA 4B15A 4YNGA 4N02A 1ELSA 4DAIA 3IVSA 4JEJA 1R86A 5AKQA 4E0CA 1DE5A 4BA0A 2V5DA 4LRSA 3RX3A 3UCQA 4PN2A 1DJGA 1AW5A 3K4WA 3N29A 1J4EA 5FJOA 3LM3A 3HQPA 4BQ4A 3PG9A 3A5FA 5EYWA 1EA0A 3CL6A 1NWRA 1K8XA 3H22A 3IGSA 2D3LA 3LLDA 4Q32A 2PTXA 4XG1A 2YCJA 2E3ZA 4FNQA 3IJDA 2FTYA 2J7GA 4XKYA 3CJPA 3QC0A 4AB4A 3ZR4A 5CPQA 4PMVA 4GZEA 1QHPA 3FV9A 4FF7A 3JR2A 1BKSA 3U7VA 5IBXC 1XXXA 1Q4WA 2Z7KA 1BQGA 4IP5A 1J8VA 2VR4A 1MUWA 3T2QA 3B04A 3CQ0A 1E0XA 4RKAA 8TIMA 3PY2A 1G4EA 3AALA 2GQ8A 1J6PA 4IXHA 1BYAA 1X6UA 3GXMA 2NT1A 2J13A 4ZB5A 2P8BA 3UWQA 1T99A 1VJSA 1S2WA 5DBTA 2HXUA 4C6CA 1NP0A 2YB4A 1EF3A 4RJEA 4YLWA 3VIGA 2V81A 5EMUA 5GPRA 1SJAA 2FMOA 4U5IA 4IPPA 1JD7A 3D47A 2BP1A 1T7LA 3BXWA 4DO4A 4B4HA 4WJXA 2A3CA 1IV8A 2JF7A 2NT0A 3NJ3A 4MJ4A 3VNJA 5LIWX 2DVUA 3WBXA 3WLHA 1FWRA 1O5RA 1XR2A 2OSYA 2CLHA 4LALA 4QBXA 1T5AA 5DRIA 5F2MA 1IXOA 4ZQNA 4DQWA 3H26A 4UOZA 2PTYA 5A95A 1PKLA 5E5CA 3WQ8A 2H3DA 1QJWA 2YLLA 2CFFA 1UKQA 3B4YA 3E96A 1I1XA 3LRLA 3W53A 1LG1A 4H2HA 1TA3B 3A9IA 4E4FA 2NVDA 4W88A 1AL8A 4Z0JA 1KRCC 1GQLA 4DUOA 2CHNA 1DIKA 3MYPA 3CV1A 7XIMA 1F8MA 3QH2A 3WLOA 3HG3A 3W1NA 4UTFA 3GDKA 3CAVA 1ZAIA 4WY0F 2QCHA 4JTSA 2JKPA 4GXMA 2V3EA 1M68A 3H53A 4LVBA 1YPXA 1CTNA 3AXIA 4DX3A 4LAOA 1TWZA 3K5XA 2E1DA 4KPLA 3COTA 3M0IA 3WLIA 3STEA