4H01A

The crystal structure of di-zn dihydropyrimidinase from tetraodon nigroviridis
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
485
structure length
484
Chain Sequence
AGEILIKGGKVVNEDCSFFSDVHIRGGKIVEVGPDLRVPPGARVIDATDRLVIPGGIDTHTHMELAFMGTRAVDDFHIGTKAALAGGTTMILDFVMTQKGQSLLEAYDLWRKTADPKVCCDYSLHVAVTWWSDEVKDEMRTLAQERGVNSFMFMAYKGLFMLRDDELYAVFSHCKEVGAIAQVHAENGDLIAEGAKKMLSLGITGPEGHELCRPEAVEAEATQRAITIASAVNCPLYVVHVMSKSAADVVSKARKDGRVVFGEPIAASLGTDGTNYWHKDWAHAAQYVMGPPLRPDPSTPGYLMDLLANDDLTLTGTDNCTFSRCQKALGKDDFTRIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSSNAAKIFNFYPQKGRIAKDSDADVVIWDPKTTRKISAQTHHQAVDYNIFEGMECHGVPVVTVSRGRVVYEEGRLKVSPGQGRFIHRQPFSEFVYKRIRQRDEVGKPAVVIREP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Lysine Carboxylation: Metal and Structural Requirements for Post-translational Modification
rcsb
source organism Tetraodon nigroviridis
molecule tags Hydrolase
molecule keywords dihydropyrimidinase
total genus 188
structure length 484
sequence length 485
ec nomenclature
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4h01A01
3HM7A 3B0YA 3CAKA 4LANA 4IH3A 4DYKA 1A5KC 3GU9A 3OJGA 3MTWA 4DI9A 2I9UA 4EPKA 2VM8A 2Y1HA 4NI8A 2Z2AA 4PE8A 4H01A 4BJHA 1GKRA 1HZYA 3LA4A 2IMRA 4G7EB 3AU2A 3A3WA 1FWBC 1PTAA 4XD4A 1A5LC 3FDKA 4MUPA 2PGRA 4V1XA 4BKNA 4XD6A 4F0SA 1FKWA 1KRBC 1M7JA 4CEXC 3F2BA 3K5XA 4KESA 4L6DA 4IF2A 2FVKA 3TN5A 2GWGA 4KF1A 4LH8A 3PBMA 3LGDA 1I0BA 2FTWA 4GBDA 1J6PA 4C6KA 1KRAC 4GX9A 2UZ9A 4E3TA 1ONWA 3MDUA 4C6JA 4IGMA 3FEQA 1R9XA 2Z28A 1WXZA 1E9YB 1YBQA 3PNZA 3QY7A 2BB0A 3E74A 2DVXA 4DI8A 4GYFA 3GTHA 4C6FA 2VR2A 4GX8A 4P5UA 4C6NA 1V4YA 3WZ0E 4KETA 1V51A 4ZSTA 3GTIA 1XRFA 1KRCC 4EPDC 3PNUA 4ERGA 3IGHX 4IG2A 3N2CA 4XAZA 3UR2A 2Q09A 3HPAA 1YMYA 4TQTA 4HJWA 4OFCA 4HK6A 3URNA 1UIOA 1M68A 3BE7A 3NURA 3QY8A 4DLFA 4CQDA 2R1MA 1V7AA 2G3FA 4QRNA 2R1PA 1P1MA 2PLMA 3ORWA 4RDVA 4CNSA 3QGKC 4LCQA 2HBXA 2GZXA 3RN6A 3PANA 4IFKA 4DLMA 2YB4A 4IQJA 3B0XA 1DPMA 2E1WA 2ZC1A 3S2MA 1XRTA 4H9YA 3F4DA 4XAYA 3OODA 3C86A 4DO7A 1KRMA 2GWNA 4H9UA 4IFOA 3V7PA 3ICJA 2QS8A 5G4HC 4C6DA 1XGEA 2CZVA 4HK7A 4IG2B 4LFYA 3F2DA 4YIWA 2E25A 3QGAC 4QTGA 2DVTA 3E0LA 1ONXA 1V79A 4H9MA 1FWDC 3MDWA 4INFA 5FSDC 1O5RA 4EP8C 3GG7A 1J6OA 1YNYA 4CNTA 3GRIA 4C6EA 2EG8A 2FVMA 4H9XA 1WXYA 3NEHA 3LGGA 4R88A 4C6CA 1ZZMA 1YRRA 4LAKA 1K6WA 2ADAA 4DZHA 1RJQA 2HPMA 3GTFA 4C6OA 1YIXA 3EWDA 4C6BA 4ERAA 3JZEA 4Z42C 4XD3A 3GU1A 2HPIA 4JOMA 1K70A 4CQCA 4RDYA 1EJSC 2OB3A 4KERA 1POJA 3SO7A 2OGJA 4PCPA 5A6TC 3WYZA 4L9XA 2R1NA 4HA0A 1J5SA 1V77A 3URAA 4GOAA 1ADDA 1ITUA 3GU2A 2VC7A 1RA0A 3WMLA 1PB0A 3UF9A 1EF2A 4CNUA 3MVIA 4I6VA 4UB9A 5FSEC 4LCRA 1A5MC 3RYSA 1E9ZB 1A4LA 5LXXA 1NDWA 2W9MA 1PSCA 4IFRA 4I6KA 2Z2BA 3QY6A 4BY3A 4H9ZA 1NDVA 2QPXA 3TN4A 3R0DA 4QROA 2UBPC 3RCMA 1S3TC 2FFIA 5CH9A 1EYWA 3D6NA 3OOQA 2A3LA 2R1LA 4NG3A 1QW7A 3FDGA 3S4TA 1A5NC 5E5CA 2O4MA 4QSFA 2HQAA 2YB1A 3B40A 2OQLA 2OOFA 1BF6A 4PBEA 2EG7A 4J35A 4WVXA 4QS5A 3S2JA 4J5NA 2P53A 3URQA 3IJ6A 3GIQA 4M51A 2DVUA 2D2GA 1EJWC 3OU8A 3HTWA 1KCXA 3T1GA 3K4WA 2WM1A 1GKPA 2D2JA 4R7WA 1RA5A 3O0FA 4V1YA 3MVTA 4G7EA 4RZBA 2RAGA 4C60A 3A4JA 2AMXA 4WGXA 1FWAC 4GY7A 2ANUA 4RDZA 4C6QA 2Z25A 4B92A 1VFLA 3IRSA 4IFKB 2Z4GA 3A3XA 4KEZA 4C6IA 4C65A 4IGNA 3LS9A 1FKXA 1NDYA 1UMLA 1R9YA 3GIPA 5HMDA 3DCPA 4KEVA 4KEUA 4C5YA 2PGFA 3DUGA 3EWCA 4DZIA 2WJFA 3ITCA 4ICMA 1O12A 2R1KA 5HMFA 1XWYA 4PBFA 1JGMA 3UBPC 4GZ7A 4D8LA 3K2GA 3UR5A 4HK5A 4GY0A 3E0FA 1QXLA 3E38A 4LEFA 3OVGA 3TNBA 2FTYA 3CJPA 2XIOA 3OQEA 1IE7C 1EJXC 3SFWA 3E2VA 3DC8A 1YBQB 4LAOA 1FWJC 2KAUC 1RK6A 4H9VA 4ERIA 4F0LA 3TN6A 3E3HA 4NP7A 2VUNA 1RK5A 3GUWA 1NFGA 3RHGA 1UBPC 3TN3A 1A4MA 1RJRA 3AUOA 4RDWA 2PUZA 4LALA 1POKA 2AQVA 3MPGA 3ISIX 2F6KA 2AQOA 3MSRA 2QVNA 1EJTC 2YZ5A 1NDZA 1A5OC 4RE0A 4C6MA 3LU2A 4XAGA 2O4QA 4XD5A 4AC7C 3AU6A 3S2LA 1K1DA 4B90A 4J2MA 4LAMA 2Z29A 3LSCA 4CQBA 1FWHC 1I0DA 2I5GA 3F4CA 1GKQA 5AKQA 4LCSA 1UIPA 4B3ZA 2D2HA 2PAJA 1PO9A 1RJPA 3MJMA 3ID7A 3O7UA 1P6CA 4CEUC 4EPBC 2ICSA 2HNHA 2BGNE 2P50A 3IACA 4DNMA 2Z27A 4B91A 4KIRA 3IARA 4PCNA 1RAKA 2WJDA 3T81A 1EZ2A 4GC3A 2VHLA 4C6PA 3IV8A 4H00A 2Z24A 3KM8A 4C5ZA 4WHBA 3S2NA 3GTXA 5HMEA 1M65A 3URBA 4KQNA 1R9ZA 4DIAA 2WJEA 3PAOA 2YXOA 2Z00A 3LSBA 3LY0A 1FWCC 2EG6A 4GK8A 3IPWA 1EJUC 2OODA 2GOKA 4ZSUA 4F0RA 4AQLA 1FWIC 4R85A 4GXWA 4C6LA 4UBPC 2VC5A 1W1IE 3MKVA 1EJVC 1FWFC 4G2DA 3LNPA 3T8LA 4GY1A 1FWEC 1P6BA 3CS2A 3NQBA 2HBVA 2GSEA 4XAFA 4EPEC 2QT3A 3G77A 4H9TA 3EGJA 4QS6A 2Q01A 1FWGC 2Z26A 3UPMA 3F2CA 1ITQA 2Z7GA 1J79A 1EJRC
chains in the Genus database with same CATH superfamily
2OYMA 6CGTA 1SJCA 1YDVA 3QLLA 1JUKA 1TX2A 3GU9A 2OSWA 1TWDA 4LS1A 2G3IA 2PWUA 3MMTA 4TTUA 2I9UA 2B31A 2FZNA 5EMJA 1QW9A 7ODCA 1GVOA 2VGGA 2J6VA 3S83A 1ISZA 5CPNA 4MUPA 2ATSA 1ZJBA 2DY3A 1YXCA 3L7RA 1M7JA 1V93A 4MB3A 1XLLA 2GWGA 2YL8A 5G1YA 3DYPA 5E70A 3TEVA 4UWMA 4QITA 3PJTA 5LIUX 1CPUA 5CLWA 2YCLA 2QMKA 3PBVA 4ZE5A 3PJWA 2D2OA 1A5SA 3G6MA 3S5ZA 1FDYA 1HKWA 1W54A 1M7PA 3GW0A 4DI8A 2PF0A 4MY8A 1E4LA 3W1LA 1NF0A 5AC7A 2UY2A 1V4YA 4IMFA 4ZSTA 1XGZA 2WNNA 2C14A 3VAVA 2BP1A 5DY3A 2A0NA 3QOKA 3BLFA 3VNYA 2Q3OA 3ZLFA 1AQMA 3A64A 1XLJA 3OZOA 1OWQA 1H1YA 1HP4A 1NAL1 4N42A 1HG3A 5CSSA 1TPC1 2R1MA 1QO5A 5K9XA 1HVQA 1RXOB 3KTCA 1F05A 3M07A 1BTMA 3LLXA 3TP4A 4ZR8A 3H4GA 3MSGA 3PC0A 3W81A 2DSVA 1DPMA 3CQ0A 3U57A 2VDIA 3CHFA 2Y0FA 1H2JA 1XW8A 4QM1A 4Q33A 3D3FA 2HS6A 1UD6A 3EOEA 4RKAA 5LIKX 4Y9MA 3GG8A 2P10A 1NFPA 3PUOA 3H8AA 2XIQA 3WL0A 4PB4A 3ARTA 1P7TB 2V0TA 3BV4A 5LNUA 4FMVA 4W88A 4EP8C 5AYBA 3CPUA 1SMAA 3L4UA 3AZRA 4PSRA 1UD4A 1VBUA 3FSUA 1ZBCA 3GRIA 3HURA 1G67A 4MFEA 3OVQA 3W73A 1H4PA 4H2HA 1EWEA 3W1NA 2FMNA 3QTPA 2J7DA 1TR1A 1H7NA 5XIAA 1E6SM 4UFIA 4DAFA 1WA3A 4N9EA 3S0CA 2TAAA 1E56A 4MYXA 4JTEA 4IMAA 3SGUA 4XD3A 3KCLA 3G8EA 3K13A 3IIVA 3POHA 1TRDA 5AFDA 2BX7A 4QGCA 1W0MA 1OJXA 4GWEA 1YADA 2W6RA 4QDWA 4L9ZA 3O06A 5E9AA 4DJDC 2AOSA 2OMAA 3PBGA 2WMJA 5BNKA 1FRBA 2Y5JA 5D9PA 3PZ9A 1H3GA 1O94A 3W7GA 5FACA 5CJMA 3Q2DA 4Q8MA 4JN7A 2UBPC 5I78A 3CLMA 3UETA 1MRAA 4GBUA 1YTKA 1V3MA 2BWGA 2WXDM 4LPCA 4QS5A 3HO8A 1IIHA 3UZXA 2NV1A 1G4PA 4X63A 4Q7BA 1A3HA 1YPXA 4WY0B 3CV6A 2O56A 2JEQA 4UTJA 4IJBA 3MB9A 2RAGA 2WCAA 3ARYA 3LGEA 4I8YA 1LJYA 1Q6CA 3W2NA 2OELA 3FJ4A 4RDZA 2ZTJA 1SFLA 4A3QA 1KLZA 5CQ1A 1HO1A 4WY0A 3BAYA 4HU0A 4XZWA 1XBZA 3G0SA 3MU7A 1US0A 2ZRVA 4PUMA 1AW5A 2PC4A 3BAJA 4AIBA 2BGSA 2HRWA 1XF0A 6TIMA 1MNSA 4REQB 3EOOA 1KKRA 4TUFA 4PBFA 4N4QA 3ELFA 4TV5A 2PEVA 5LNRA 3K2GA 3GE7A 5IRPA 5CZKA 4LEFA 3BZJA 2OWCA 2HWGA 3AZSA 3UWYA 1H0IA 3GDRA 2I5QA 3HQNA 4MTVA 4BWLA 1R3TA 3VNJA 5HAOA 5I6SA 3NQ6A 4F0LA 4U5KA 4LYRA 1F61A 3NL3A 5D09A 3FYYA 3SCSA 3AIEA 1PKYA 2E5DA 2DZSA 1H62A 1I2NA 3WELA 1MXSA 1SVDA 2QVNA 3U48A 1ONRA 4XZ9A 3SQSA 3H4XA 3BO9A 2LLEA 1KBKA 1G4EA 1H7XA 3WLLA 3LBOA 5DMLA 2RKXA 1V03A 4JBRA 1UR0A 2VFIA 3BW4A 1UIPA 1IHIA 2VFEA 3W76A 3L9CA 1V0KA 3ID7A 4IIDA 3O7UA 1W1YA 5CEWA 4MPKA 4CEUC 1W1ZA 4IJCA 2GQ8A 3BSGA 5LYRA 4JYFA 4B91A 5TF0A 3A4AA 4LW7A 1VENA 3Q45A 4NSBA 1J5TA 4YTUA 5CCZA 2EPOA 3UWEA 3GTXA 1GHSA 4HHMA 1QBAA 1U5JA 5HMEA 1JZ7A 1SGJA 3DG6A 4UIOA 3V0TA 3NXFA 1U2YA 1UASA 2V8ZA 4YVXA 4ZSUA 3A22A 1IR1A 3GXTA 1MNZA 2Y7EA 3AYRA 3KOXA 4O8RA 2NXIA 1QT1A 5BROA 1H1ZA 5A5WA 2QNEA 3LNPA 3VOHA 5FF0A 3ERPA 1F73A 4EPEC 2JGYA 1SZRA 2Z1WA 2J7GA 5ECUA 1G9HA 4QS6A 1RHCA 1KBJA 1LT8A 2QDEA 2FGBA 3UY8A 1QOQA 3K4DA 1RLCL 2X1UA 2BTMA 4I9MA 2ZZ2A 3QRHA 1J2WA 3G0UA 4O52A 5CPQA 4DI9A 1F8MA 3TMQA 5K4XA 3ZVHB 1P0NA 4BJHA 3EMCA 4HU8A 2QKFA 4G7EB 3A3WA 2DUAA 4XD4A 4H6EA 4BF7A 1S2AA 1IGWA 2ZXAA 3WFLA 5LSMA 2IQDA 3S6DA 1XDLA 3BDKA 4HMCA 2ZBTA 2EGZA 3K5XA 3U9IA 5D2YA 2E09A 1E0XA 3B8WA 2PWHA 3VNMA 1SW0A 2CCRA 2ABBA 5H6HA 1VIWA 5A2BA 1XKJA 3MDUA 1MDLA 4AFYA 2HISA 4RXFA 2DVXA 4JDYA 2ISFA 2PLJA 3TOPA 1FUYA 3EDKA 1GQJA 1SM9A 1OCQA 1QHOA 3LTPA 4QX4A 2GJLA 1R2SA 4V15A 1KRCC 4A3RA 4ZCWA 3GC2A 1UR4A 1XLAA 3HPAA 3UVAA 4PTXA 1Q6FA 3BOFA 5DCEA 1PZ3A 2HZGA 3L68A 3URNA 3N4AA 4DQWA 4ATWA 1UIOA 2YCKX 3ABRA 1MEHA 3FVMA 4CQDA 1OC7A 2E68A 3LPOA 3TTOA 4XZBA 5CBBA 2ODOA 1CGTA 4O12A 4LAUA 4GUGA 2FJUB 1MFVA 3KBJA 2OKTA 1WB0A 1SJDA 4H9YA 3VX0A 3WK3A 3F4DA 1I75A 3RMJA 3UZWA 4H9UA 4HNVA 4IG2B 1WOAA 5E0FA 1LBFA 4YIWA 1FWRA 4JL1A 3SAZA 2QIWA 3OLGA 4A35A 1DQWA 4LUTB 3HPSA 4DYJA 4N9CA 3MWCA 3RR1A 3T55A 1SJBA 4A6GA 4OKDA 3LI1A 4XWUA 3IWPA 4DBEA 2NWSA 1TUFA 3G18A 1F74A 4YMZA 5IXEA 2CZFA 3ZJ8A 1ZZMA 1E72M 1TTJA 4IGSA 3OW1A 1F6YA 4QBXA 3G8RA 1UKOA 2V3GA 5H91A 1JG9A 2XYLA 1FQ0A 4IL0A 2DJLA 2R1NA 2J24A 2X0HA 1J5SA 5JIPA 1M9HA 3GU2A 2OU4A 1P0EA 4O15A 4AWUA 1GWJA 2NSXA 3LPFA 4UB9A 1A5MC 3A24A 5CLTA 3W4RA 1SO3A 3FJLA 1XLMA 1UHVA 4ZO7A 3B9DA 3MCNA 3LRKA 5A6LA 4WDWA 1BVWA 3Q65A 5F2LA 3RCYA 2VC6A 3W7HA 4FS9A 4ZFMA 3EEGA 2GDQA 3WUBA 3PULA 4XKYA 1S2TA 4JX5A 4DZ5A 3JRKA 4PBEA 2PCEA 4ZOAA 4DJED 1P0BA 4UTWC 4WVXA 3P84A 3TC7A 1MXGA 3GC4A 3M47A 3H54A 1G7VA 1XL9A 2OX4A 3CHEA 1TTPA 1F3WA 5AC4A 3N6JA 3W29A 3WQFA 3BGGA 5HNRA 1U83A 2CFFA 2XFRA 3I4EA 3LCXA 1HJXA 4NRSA 3VO0A 4AZ6A 4UZUA 1SUXA 4IGNA 1UMLA 1BKHA 3VOIA 3WL1A 1DJYA 3W6LA 2WV8A 3VMPA 2XN2A 3DUGA 4Z1BA 1HGWA 4ICMA 3GH5A 2BOFX 2XIBA 1JYXA 1V6YA 4HYWA 1Z41A 3VCRA 1FXPA 3AAMA 4WQ6A 4QFUA 1LG1A 3LX9A 3B4YA 4O11A 1E4MM 5XIMA 3KHDA 1SZEA 2XIOA 4U31A 4JTIA 1A0CA 2DZTA 2VVSA 3PZNA 4GISA 1JULA 4PRWA 4M0XA 1KM1A 1AD1A 3C0JA 3UU0A 3D0CA 3P80A 2Y2WA 3WLNA 4KT2A 4H3DA 4BA0A 1TZ9A 1B3ZA 1UH3A 4GGBA 4NY2A 4O57A 5DMMA 1TIMA 4MKNA 1OCNA 2ZXQA 3R10A 1EC8A 3E0IA 2VCBA 1HNYA 1U1HA 2VGBA 5HOSA 1QI4A 4UTUA 1WDWA 1EZWA 1A5OC 1CDGA 4D6GA 4M56A 4H04A 4AXKA 2H90A 4D8ZA 2BODX 3WJYA 4OJYA 2VNCA 3PN8A 4MB4A 1XC6A 2Y7DA 3WMCA 1VCFA 3FLUA 5HULA 3V5FA 3GDTA 3JR2A 3UG5A 4AZHA 3UEQA 4N9BA 4B9YA 1HO4A 2BXVA 2P8CA 2DW7A 4KWVA 3IV8A 1B3VA 3S2NA 3TQPA 4Q4OA 2BGQA 3U8GA 3W84A 3DX5A 5HPOA 4LQ1A 1SR9A 1E0VA 2CWXA 3WEZA 2GOUA 3IGXA 1DJHA 2XSAA 3QHNA 1YLVA 1FWCC 3TCEA 3E5PA 4Q8PA 4GXWA 3TFXA 4C6LA 2WLYA 4UBPC 3PWAA 2E5CA 3CUIA 3HF3A 5LA2A 3G1RA 4GD0A 2DIKA 1XKYA 3KP1A 3CMGA 2CZEA 2NQLA 5REQA 5A94A 3G77A 2HTMA 5A8OA 4BFAA 4YS1A 1TO3A 2Z7GA 3PBUA 3URQA 4WDTA 4IZGA 3KCOA 5M1TA 1RP8A 3GY1A 3FFSA 1NVMA 3R8RA 1EEPA 1TMLA 3FY1A 3BAWA 1VFFA 4JFSA 1D8WA 4OE7A 4OBSA 1WXJA 4C1NB 2I57A 3W7CA 2I16A 5KTLA 3LENA 3AS0A 3KFTA 4AU0A 4GZJA 5FEZA 4HPJA 5EB8A 2VZVA 3NUKA 3EWXA 2EPHA 4IF2A 4O1AA 5D9MA 1OT2A 1QU4A 3TFCA 2DPEA 3KL3A 4DPQA 5FJTA 5JUVA 3TK7A 1AG1O 3GVVA 1MZRA 2W91A 2DUZA 3I7RA 3FEQA 2F38A 4Z2HA 4FXFA 3RM8A 4AG0A 4MAVA 4J27A 1CT5A 2PBOA 5AHIA 2EQDA 3IUIA 4UCGA 3E02A 1PKLA 2J7HA 8RUCA 3WF0A 1ZS2A 3W7KA 3GC5A 3TTQA 3AXXA 3PNUA 4A4AA 1M53A 3MW7A 2Q09A 1GTEA 3VNZA 1JZ6A 1MWOA 4UC5A 4CD5A 2OJPA 3SN4A 2FZBA 1M68A 3BE7A 3CWHA 1DJXA 4Q3MA 3IIXA 3RRAA 3DAQA 5JU6A 2D3NA 1Q6OA 4XQ6A 4ALDA 2EPMX 3DG3A 3VGGA 1P1MA 1Z42A 5I3DA 4GHRA 4EXAA 1P4CA 4QEHA 1XJBA 3WDJA 4B2DD 2ZC1A 4S3JA 4JX4A 2QV4A 4C1NA 3TROA 4MWAB 1A5UA 1JPIA 4DO7A 3LHVA 1HL9A 1QRQA 1S5VA 3N34A 1VB9A 4AZ5A 4O1FA 3FYPA 1LTDA 1E1CA 1BVZA 4OOUA 1KA9F 1XGEA 3BQ6A 3GUGA 3QGAC 3LYEA 1JPDX 3UGVA 4J4KA 4LYQA 3MO4A 3BLDA 3VNIA 4LGXA 4S2CA 2FVMA 1JUEA 3M0ZA 3TR9A 3RLHA 3UXKA 3E5BA 4OIFA 5AHFA 2QCNA 3VNLA 3PZTA 5JVLA 2HPMA 1XIGA 3T4CA 4BF9A 4B4FA 4PCPA 2DSKA 3AISA 2FHCA 3WQVA 4O0ZA 1T96A 1U5VA 5BOOA 1VFUA 4D72A 1ITUA 3M0XA 1NU5A 3HB9A 1FCUA 3HFYA 3COTA 1RY0A 4HNNA 1EYEA 4X0VA 1IXNA 2Y7FA 3TLQA 4N7QA 4PUKA 5LIYX 3UJSA 1EX5A 2ZFAA 2W9MA 2Z2BA 2V2CA 1EUAA 3QV9A 5LHEA 1VBHA 3WQWA 2FMOA 2XGIA 3AYVA 1Q6GA 1XLDA 3VABA 3R25A 1K3UA 1TKKA 3FHQA 1G7UA 1KM5A 1BG4A 1QW7A 3S4TA 3BG3A 2C91A 2JQXA 2EJ1A 3T0DA 2PDKA 3H24A 1HKVA 3I3EA 3W7PA 1XFBA 1KCXA 3BMWA 2WM1A 2YA1A 3TV8A 1YTDA 1J4EA 3U2ZA 1Z8AA 1B54A 3SW6A 2ANUA 1L6FA 3GXMA 4RZ5A 2FH8A 2WSQA 1UKTA 4MIMA 4HHLA 4FF5A 2ISWA 4R7JA 3FK4A 3WD0A 3OZMA 3A3XA 2PDYA 3R13A 3AMDA 5A6BD 4GQ0A 3W2LA 2Q8XA 3F03K 1HJUA 2NXHA 4JS3A 4W5UA 5F4WA 3GYEA 5EFDA 1F9CA 3QR3A 4PMNA 1W3IA 1UUQA 1DXEA 1Q66A 5C70A 3CV1A 3AMCA 4I90A 4WDUA 1WZKA 3NZGA 4H41A 2VEGA 2WC7A 1UP3A 1GVFA 2FTYA 1UP2A 4F40A 1IE7C 3WFAA 3NTYA 2R6OA 3O8AA 3AHXA 3K8KA 2A4AA 5LZLA 3P2VA 1FWJC 3DFOA 4J2PA 3STPA 1MO0A 3GB6A 2VUNA 1AUSL 1RLDA 5I2UA 5EYWA 3GG0A 3HQOA 3M1ZA 1Q85A 2YL6A 4JNYA 3V18A 1XGDA 2ZUUA 3TUUA 1BGAA 1W8GA 3VDHA 3ZO9A 3JW7A 3AROA 3N9RA 2DQXA 3KOYA 3KBMA 5AZ1A 3VD3A 1Y5WA 3S2LA 1J2BA 5D38A 2AGKA 3UYIA 3THQA 3WUEA 3ZLHA 5DMYA 1Q6DA 2VZOA 4QG8A 3WLRA 5I06A 4D6FA 2E6AA 4RX0A 4H7ZA 2PAJA 1DYSA 3APTA 2UY3A 3UR7A 3L4WA 1FTXA 1SZFA 4HHPA 3G0XA 1GVIA 3LMZA 3WNNA 3VKKA 7PTDA 3WLSA 4N2YA 3C5QA 3AO0A 1D8CA 5DCBA 3PBWA 5DMNA 1ZCOA 4AEEA 3AIQA 1X7IA 3GS6A 1BLIA 1E6PA 2FPYA 1FH8A 2Y6ZA 1WX0A 4HYRA 3VGBA 2QQ6A 1WOBA 3DDMA 3CO8A 2VC5A 3WLIA 5I24A 2DT0A 3KX6A 3QR0A 1FXQA 2PTDA 4TX6A 4GO8A 2CKRA 5J5RA 4CQAA 3MWAA 2OZ0A 2F2HA 2BV9A 1A0EA 2X7WA 1S2CA 3V5CA 2O7SA 4O16A 3KDNA 4CD6A 1TB3A 4M6VA 4WK9A 2HVMA 2L5HA 2DT1A 4IPLA 4ACZB 5A1AA 1LRQA 3M0JA 4O13A 1AODA 1HT6A 2ON3A 3OYXA 4E0CA 3EOSA 1W9DM 3REQA 2Y88A 5H8UA 1E73M 3LCFA 1JF6A 1LG2A 2J25A 3L4VA 3ARWA 5EMMA 4DF0A 2VVNA 4L1XA 1R7OA 1M1BA 2CHNA 3C0LA 4Z2KA 4EK7A 4XSLA 2J7EA 2WSRA 2JKEA 3WX7A 1R87A 4QSHA 3BLEA 1A5BA 4S3DA 2OR2A 4E3TA 4LT9A 1R9XA 3PP7A 3UY7A 5LIXX 1PX3A 1JGIA 2XH0A 4XVDA 1DWGM 4HMEA 2OTDA 1EJ7L 4AX6A 2V38A 2GUYA 3W26A 3VGFA 3UR2A 5I5RA 4TQTA 1PEZA 3NR0A 3VYLA 1YKWA 4P8VA 4IPJA 3LV6A 2CLFA 2MANA 2E5BA 1LLOA 2X16A 1ICQA 4QE4A 4ML4A 1JUBA 1W9UA 5HPCA 3QZAA 3WLKX 1EO5A 5D04C 3WJZA 2PLMA 1WZMA 1JZ8A 1AQFA 2VX6A 4Q8QA 1S2VA 2F6UA 2W3ZA 1ELSA 5AYIA 1QOPA 3W74A 4HBKA 2G4FA 2YA2A 2EO7A 3W02A 4HT3A 3H2FA 4HIBA 3ZVHA 3GNXA 1VS1A 4I9AA 2NVAA 5F7UA 1XDMA 3B05A 1PDZA 2PD5A 4PUEA 1FY6A 4W87A 4QISA 3QKZA 5AYYA 1JI1A 2DFAA 4HNCA 1J0JA 1W9XA 4Y7EA 1H1NA 3B9AA 3VD7A 3KDOA 4NL1A 4L4PA 3QSRA 1XXXA 5JBFA 3U4FA 2CBJA 3LGGA 3PZMA 4C6CA 2PWVA 3LI0A 1PXGA 2TODA 1RJQA 1JXKA 3ZJ7A 4M5PA 1D7FA 5T8GA 4ERAA 1GT8A 4FXRA 1EQCA 3AJ7A 1K70A 5E6ZA 3UG8A 4A8LA 5A6TC 4JN6A 4NJHA 4AH7A 1R85A 5C0QA 2HEJA 4W85A 3ZJ6A 3RF9A 3RDKA 5A8NA 1TR9A 5ECVA 4IISA 1C90A 1PIIA 4MWAD 2J66A 1VPXA 4H8UA 3BC9A 3UERA 3KLKA 4GIRA 4OUEA 3U3HA 3GXFA 3L21A 3NQAA 4E3VA 1J12A 5HNTA 2ZRYA 4B15A 1FFRA 4BEQA 1S3TC 4GA8A 1MFUA 2X09A 2ZZ3A 4L4OA 5REQB 3MS8A 3EKZA 2YB1A 4ADTA 4GQQA 1UWUA 4J35A 2WPBA 1CB2A 1DL3A 1TVLA 3ITVA 4X61A 3VIGA 3R58A 1JRCA 3ZIZA 4IMDA 2V9DA 2Y63A 3O0FA 3M44A 2ONEA 2AMXA 1VPQA 5HUPA 1KCKA 3Q37A 3ITXA 3P0XA 1BFNA 3N9KA 4JIRA 1ZHAA 2HK0A 5HWMA 1IIGA 1WDPA 4N6FA 4N9DA 4XSMA 1W1TA 2YDAA 4GVGA 4RL3A 1WZAA 2CESA 3N3TA 4M80A 1JR1A 4IL2A 4M29A 3TSBA 5AY7A 4KS0A 2VZSA 1EQPA 5IBXA 3UZ5A 5CC5A 5EMKA 5DF0A 1JPHA 1N7KA 4LUIA 3WLQA 1B5TA 4ZQRA 1OG0A 3A5FA 3MP3A 4MG4A 4ZL1A 2ZICA 2XJ7A 3P8JA 1RALA 3HJEA 3OVGA 3ANVA 3WH8A 1S5TA 1W6TA 4B5NA 3E2VA 3ZSTA 2HNEA 4JX6A 3KE0A 4KWSA 4A8NA 3GXDA 1HKJA 3TW7A 3DIPA 4Z0JA 2YJQA 4GUJA 5DQPA 1NOWA 2PDQA 4YJ5A 5LGZA 2XVKA 4UOZA 4XB3A 3UXAA 1LCOA 4D8AA 1XD0A 5KINA 1K7XA 4NZ3A 1CCWB 1WNOA 1DBTA 4FI4A 4CNPA 1YPFA 2UWFA 4HCHA 3PTKA 3AWOA 2WNZA 3LSCA 1VYPX 1H49A 1H7PA 2I5GA 1IQ8A 1S1PA 3UWQA 4JFWA 1DORA 4KMQA 4PL2A 2ICSA 1NWSA 3OQ8A 1UR2A 1EHNA 4MB1A 1WP6A 3E49A 1DTUA 3MUZ1 4HB7A 3T05A 3JZUA 3TYZA 2OSYA 4C5ZA 3SDOA 4IQDA 2ZZ5A 3L5MA 3UD6A 1FWWA 3R7MA 3CL7A 1BGGA 2VXNA 1AJ0A 2PDCA 1JFXA 3KOFA 2X1IA 4GK8A 4TV6A 3D47A 4LVFA 2GOKA 1PBGA 3WQ4A 5I0DA 3STFA 3VIHA 1W1IE 5C9XA 4BWLC 2PP0A 2HBVA 3H4WA 3MI2A 2DQWA 2OLAA 2WOQA 3E0WA 3W7EA 2Z26A 1ITQA 3CMJA 1T41A 2VWTA 3VIOA 1PYMA 1H11A 4IHCA 1LF1A 4GZEA 2YBTA 1CXKA 4AYSA 5CJ5A 2GK1A 2ZRZA 2PODA 1QNQA 2X41A 4CN1A 1QWKA 2E4TA 5BRPA 1NOFA 2OX1A 3C4UA 5J5DA 4MADA 3ES8A 3H7VA 5BMWA 1B4KA 1X39A 1E15A 3WF3A 3HG5A 4J3WA 3SGGA 3TLLA 5D2TA 4JEJA 4Z1AA 4GINA 3VKAA 1BRLB 3RJXA 4ASTA 1W1VA 2D0FA 4FX7A 3P8IA 1Z48A 2GFTA 4GX9A 1QI0A 2XUCA 1XG4A 1ONWA 2GQAA 4DXKA 1RD6A 4NHVA 1EIXA 9RUBA 1GORA 4C1KA 1DJQA 4JTQA 3E2QA 4P5UA 3BTNA 1GVRA 4H8VA 5FJJA 3HFTA 3WK0A 4JQ3A 4EXQA 4JFVA 2ZWZA 4WKHA 3BLOA 3NGFA 3HG2A 4F4RA 2YCLB 1JAKA 3NQFA 4DEFA 5A6MA 3RCNA 1PWMA 4JXCA 3BLLA 2PTZA 4O1DA 2G3FA 1GQIA 2FHBA 2A79A 1QASA 1LLWA 5JMUA 1A5CA 1AZ1A 4PCSA 3ZOAA 5D9NA 3EWBX 3P67A 4OQVA 3FA4A 2VMFA 3UR8A 5A6AA 4XG1A 1K9EA 2YXGA 4HZMA 4QQUA 3PUEA 3SADA 1P0DA 3BCJA 3O0KA 4IUOA 1CZ1A 3BH4A 2E8ZA 3A9BA 3FA3A 2JE8A 4NXSA 2W0UA 2NQ9A 1EPVA 3LCIA 3DFYA 5G4HC 4BEUA 1R5YA 1X98A 3B9EA 4NJGA 1W17A 5D37A 3F2DA 1B31A 3E0LA 2PGWA 4FPSA 4NJKA 4FLOA 4IM4A 3MDWA 3LQLA 3WUGA 4M6UA 2V63A 3OHIA 1TPEA 2VR4A 5CPSA 3U7BA 2EG8A 3N4EA 1LQ2A 3M0VA 4JKMA 2ZX7A 2J7FA 1YRRA 1JZ3A 1UW9A 4H6QA 2RGLA 4DZHA 1FFQA 1C9DA 1PPIA 3MHFA 2OO6A 3PY2A 4MWAA 2VURA 1TQJA 1CLKA 4FALA 2JKPA 4JIHA 2CYGA 1UOZA 1BXNA 3SRHA 4MHBA 1I2RA 1QK0A 1M04A 5CAHA 3FVDA 4Q4MA 1V77A 1WBJA 5BXTA 4YLWA 3VE9A 3MVIA 4XISA 2P3ZA 3WG6A 3C8NA 2VKZG 3NZRA 2V30A 1NDWA 3H2OA 1QJWA 1XLHA 4CU8A 5D33A 2D20A 3WJWA 5F4XA 4QROA 1JCXA 3ARPA 5C9RA 2PBGA 4ONVA 1E4NA 2R1LA 2GLKA 4L56A 3POCA 3LBCA 4RW5A 4Q8TA 3AXMA 3RUBL 2OQLA 3H6OA 1J0HA 2EG7A 4ZQNA 2ZRXA 1UWQA 2CLHA 3WF2A 4H6KA 4LYKA 4B3LA 5KSWA 5AC8A 4JR5A 5C55A 1JYNA 3K4WA 4IX2A 1RA5A 4ZTYA 4V1YA 2QW5A 5FI8A 3QV8A 5C2XA 3M46A 2AKZA 1L2UA 2HVNA 1TCMA 2VRKA 5C9WA 5I09A 3BCFA 5D03A 4FNSA 2QPUA 2CXGA 1MQQA 4YTRA 2Z4GA 5G4WA 2QCGA 3SFKA 2JFEX 1MSSA 5FJRA 2B0MA 1CXLA 1B30A 5BU6A 1EO7A 3IK2A 1VEPA 5HMDA 4KEVA 3BAXA 4WX2A 5D9OA 1T6MA 4PMJA 2BHZA 1QHPA 2CLIA 1PZ1A 3ANUA 1ME9A 1CXHA 3UBPC 3C8FA 1EA0A 5DCDA 4QE1A 4UQBA 3UJ2A 1CI1A 4HCDA 2XGBA 2AL1A 1I2PA 3QV6A 3BICA 1OX6A 2HDJA 1UUOA 2GPTA 4GQRA 1GZGA 2ZRWA 2C0HA 5BRBA 3IVUA 1HJQA 4QDMA 1WAWA 3G1HA 4MZ8A 1W9BM 2DSWA 4DM2A 1FWNA 3SUSA 1W5NA 3GUWA 4PUUA 1MDRA 2A1YA 1EH9A 1RJRA 2FB3A 2PUZA 3M43A 2AGTA 3PB0A 4BHYA 3CEUA 1ZUAX 2VRQA 3CZKA 3NIYA 5EKYA 4AD5A 4U3CA 1DWAM 4AC7C 1UD3A 1RCXB 3PFMA 4FIQA 1I0DA 4NZ4A 1GKQA 4B3ZA 3KRUA 4F8XA 1YNQA 2PU1A 1C91A 1CGXA 1RBLA 3DN5A 1J18A 3NQ7A 1BF2A 4UTFA 2Z27A 4TVDA 4WJ8A 2DW6A 2P1FA 3IARA 1LL7A 3L4ZA 4PCNA 3N73A 1XSJA 3UJRA 1Z89A 4N4PA 5AHMA 3RK8A 1WCGA 4ACZA 3OB8A 2J9YA 3PPHA 1FWIC 4WIWA 2SFPA 1ME7A 2ZUVA 4GKTA 1P6BA 1E1FA 1EOMA 3SB0A 2AL2A 4RV8A 1IEVA 1T0OA 4ORIA 1I2QA 1WV2A 4P8UA 4IP7A 2GK1B 2PE4A 1PVNA 2XFWA 3DFSA 5BXRA 2G97A 3OA5A 3P82A 3S5SA 1A5KC 4HA3A 3UZZA 4E38A 4BS0A 4JAWA 2WZHA 1N8IA 2BOEX 1SW7A 3II1A 1GCYA 4AD3A 1PTAA 4H83A 1V3JA 4V1XA 1M5WA 4BKNA 1W8SA 1YNPA 2V3DA 2W61A 4AC1X 3GXIA 1KRBC 4GE8A 2POTA 2DDXA 2OZ3A 2ISVA 3QBUA 1XLFA 3MBDA 1CW2A 1RQEA 3LGDA 3VE7A 4UTMA 1EBHA 4EWJA 1ZB5A 4BR1A 1NP2A 2NX1A 4JNZA 1OFBA 3GX9A 1ZALA 3PNZA 1UC4A 3QY7A 2ZIDA 3KTXA 1R3VA 2YLLA 3B8UA 4CQ8A 3PFRA 4S3BA 3HPZA 1KFLA 3JS3A 3VIIA 1XLKA 4WKAA 3DYMA 2X8RA 1I9CB 1V51A 3C6CA 3EBVA 2BHYA 4JHMA 5JIWA 1NARA 1OBAA 1JL8A 2VQTA 1TPWA 2C13A 2GJRA 2W66A 2PDUA 5LXEA 3TQ0A 4IMGA 1ZJAA 1JDEA 1E0UA 1XQKA 3MMDA 4KFOA 1W5PA 2WHLA 5LNWA 3M4HA 4JKKA 5EGRA 3HIJA 3WO8A 1RCQA 3HGOA 1XH1A 1UB3A 3BARA 1UR3M 2XVLA 1F3XA 3T07A 2VEFA 3PPCA 3MJYA 4RNFA 1R8LA 1SZGA 4O0KA 2BFGA 4G1KA 1M7XA 4K2SA 3NVTA 3EOUA 4UMCA 2VL4A 2BVDA 4PMOA 1GOQA 5IM51 1CEOA 2R24A 4KGLA 4INFA 1IYXA 3BUVA 4KH2A 1Q63A 5HXMA 2WKJA 3VNKA 2F6XA 3CIVA 1PZ0A 4UR9A 3A23A 4UTLA 5FEPA 3F5LA 3I3BA 1ZY9A 5F1VA 4JQ1A 4C6EA 5I3JA 4GYJA 1ZRQA 2CZDA 4H9XA 1W32A 3E2SA 1F5ZA 2J7CA 5F2MA 3CASA 5CC3A 1G01A 5DY2A 4NZ5A 4C6OA 4GUHA 3HMCA 1R2TA 3PR2A 4Y9OA 4JQ4A 4Z42C 3H2MA 3RX2A 2E7FA 5AN7A 3SEPA 4YTQA 3SQMA 1PDYA 2ZA3A 2DORA 4GOAA 1B3OA 3AI0A 1NTHA 4S3KA 4H8HA 4D1JA 4ZVJA 4F2TA 2Y8KA 2WVTA 2E8YA 4DBDA 1TCDA 4QCFA 3UGRA 1X7FA 2NUWA 4PMUA 1NDVA 3LHUA 1GOIA 3R0DA 4ZOEA 3WMBA 2EPLX 4MNMA 1YDNA 1OGBA 2PMQA 3VCNA 1IF2A 4DWSA 3GNOA 4XVEA 5M17A 3AALA 1V02A 2OEKA 4YHEA 2GL5A 3EZ4A 3GNRA 1SFTA 4UQ9A 3H23A 4KPLA 2WC4A 3G3MA 3GKFA 4PMQA 3SIZA 4JTSA 5DX7A 5D2XA 5E0CA 2Z1VA 4P7NA 3QMSA 3HA1A 4I3GA 4G7EA 4G7FA 5CJNA 3SY5A 3DHPA 3WENA 3OG3A 3WLMA 1AZ2A 4L1GA 4PB3A 4YCPA 3AXHA 1LYXA 1J0ZA 2YA0A 4HVXA 1B0IA 5G2IA 3BJTA 4JTUA 1QOXA 5C2CA 3S5OA 4ZA0A 1OZQA 7XIMA 2IKJA 5M3WA 4DAIA 3BLPX 3OZPA 5D8WA 4U3AA 3EX1A 1A80A 4ZTXA 4UTWA 3ZT5A 5IDIA 1QFEA 3EX3A 5C71A 1TTQA 2PZNA 2ISSA 4MJ4A 3B0UX 1Y7VA 4ERIA 3W7QA 1LDCA 2FVLA 2PS2A 1UBPC 3H2CA 5BOEA 5BXPA 4RDWA 4OOZA 2XVPA 1X8FA 4Y6GA 5FCZA 3EB3A 3LERA 3V1PA 4RW3A 4K8EA 1EJTC 3CGTA 4RE0A 4JN8A 3UWVA 1CENA 3JVAA 3W82A 4XAGA 1YW1A 2YL5A 4CQBA 5AYXA 1EXPA 2Q8ZA 3GSMA 1VAHA 1QNPA 4UXDA 3B3DA 1XYFA 3G1XA 5C9UA 4OBTA 3STCA 3W71A 4LVDA 4LBSA 3SSJA 4JIPA 5IFPA 3ANYA 3VUPA 3MC5A 4NNBA 1XP3A 3WBWA 1XFCA 3ME3A 4TTGA 1BVNP 3Q94A 2V5DA 1M3UA 4GUIA 2VJXA 1MQRA 3O6DA 4Q8NA 3TAKA 3T6CA 1OF8A 2OODA 3GHSA 2ACUA 1O5KA 3OZYA 1AL8A 4E4FA 3P5YA 4HSOA 3RRXA 4IXHA 4GACA 5CC6A 5MF5A 1QMLA 2VRJA 3ABZA 4DWSB 1V0MA 4XBSA 2GSEA 3FXYA 4WR3A 4RNJA 1V3LA 1GQLA 2WBGA 3U2CA 2G3NA 4H9TA 3EGJA 1XLGA 3F2CA 3TW9A 3IGHX 4MB5A 2DJXA 3PBYA 3B0YA 1XICA 3L2MA 4DYKA 1XR2A 3MTWA 2WSKA 2QULA 4Y2WA 4TU1A 4W8LA 3KOZA 1FWBC 4WSHA 4L6OA 1JDDA 3N04A 1D3GA 3NO1A 1TPUA 3UWZA 2ZXBA 4CU7A 4J1OA 3F2BA 2FVKA 4O53A 4NX0A 5AZ0A 5A2CA 3BWWA 5DT5A 3NQVA 3S5NA 3W1RA 2V3EA 1XLBA 1V3IA 2BMBA 1NQKA 3WN6A 4C6KA 4CCEA 2XH2A 3GVGA 3RM9A 3G1YA 2BDQA 5F2GA 1H7OA 2YDQA 1DJNA 3EWZA 4IT1A 4B5VA 1OT1A 4DO4A 1ZAJA 3IRDA 3QH2A 1YYAA 1T8QA 3EOLA 2ZE3A 3BLIA 4GG9A 4UUIA 6A3HA 4HMDA 2ALDA 4XUGA 4QP0A 1FHLA 1XRFA 1XPYA 1E1EA 6TAAA 2XM2A 5EMUA 2V68A 3TZNA 4HK6A 4JTKA 3FOKA 2QCDA 2OSXA 3CB3A 3BSHA 3CHDA 5A69A 4UMBA 3BW2A 3R43A 1EP1A 1WDSA 4B2DA 2B7NA 3N1AA 1F4HA 4CNSA 3WF1A 4LCQA 2NVDA 4FXJA 1WBHA 4GJ1A 1TX0A 2DZXA 3GZAA 4GVFA 1OFAA 4LRTA 1EDTA 2JK2A 1R3QA 3S1XA 4W7VA 3W38A 3M9YA 3CQHA 4DJEC 3ABQA 3WQ5A 3NL2A 1KRMA 3V7PA 4GVIA 3W1QA 4MF4A 3I65A 1XBYA 1OFRA 4HK7A 4Q4SA 3HQ1A 4LFYA 4DNHA 3UVIA 3HGRA 3G3DA 5CSRA 2JIEA 3CZJA 2X0YA 4MPQA 1YE4A 3XIMA 4E8CA 3S9IA 2RJGA 3QTGA 4D6EA 5BRQA 3L0GA 4JTGA 4R88A 2O55A 4K36A 1OY0A 2EBNA 2O9RA 5G1MA 4A3HA 3EWDA 5DANA 2CZ5A 4J3XA 1P43A 3B04A 4UR7A 3MANA 1ITXA 1TV5A 4LF1A 4AAJA 2X1SA 3INPA 3RGTA 3FNDA 1GQNA 1DQUA 3NL6A 5K9CA 1RA0A 4BQ4A 5G5IA 2GGHA 3P74A 2G41A 3HBLA 2DEPA 1BEUA 4Q6JA 3MUXA 5LXXA 4I6KA 2RGMA 4O10A 2F61A 1VZWA 4JFUA 1EP2A 3NFUA 2C16A 4NZJA 4PRRA 1A5NC 4A05A 2CW6A 7TAAA 1GJPA 1UWTA 1S5WA 3UJFA 2P53A 3AWNA 4I7UA 4GQBA 3HTWA 4LSBA 1YXYA 3BAIA 3LXAA 5I3KA 3NA8A 3MVTA 4NU7A 3H70A 2CHOA 3MBFA 5CSUA 5DBUA 1EGZA 4GY7A 4DVOA 2J74A 2Z25A 4LUTA 2QJHA 1B57A 2GVLA 3KHJA 2RDWA 3MUIA 3UG4A 1X38A 4IFKB 4DM1A 1NQ6A 4KEZA 3U7VA 1TPDA 1JF5A 4GYPC 2PRHA 5U4NA 4U4MA 3GIPA 1LQAA 3IVTA 4C5YA 2WJFA 2C0AA 2P5NA 4HPXA 3RPMA 1W56A 5KITA 1OIMA 2XWDA 4HK5A 4W7WA 1ZP3A 4I5UA 1W3NA 3ENLA 4PMXA 3O16A 3P7YA 1KFBA 1ZU8A 3MZ2A 4LX4A 5D05A 2NT0A 1IWPA 2OLHA 2DV0A 1JPMA 1KGWA 3PK7A 1YDYA 1OFDA 5C7HA 3ES7A 3W6MA 3CL6A 4M82A 1AW2A 3B9OA 2AQWA 3MUAA 3QZ6A 3N4FA 1TJ2A 4FNRA 3QR1A 4ZQCA 3RXZA 3KLLA 1QPQA 1A4MA 3CK5A 4LUYA 1XUUA 3GIYA 3C56A 4UQAA 4Z2IA 3ZLGA 1IT8A 4ML9A 5FF4A 4YL2A 4IWWA 2YZ5A 3K46A 1RQHA 3ALGA 5HINA 3TYAA 2AAMA 4TR9A 4UTTC 4AEFA 3CL8A 4UOQA 3FGCA 2XSBA 3UJEA 2O7QA 3THUA 4TO8A 1HGYA 2WSYA 3TC3A 1WKYA 1JZ4A 3UQNA 1BTCA 2HNHA 4KCTA 2QAFA 5H8MA 1R7AA 3AS1A 2C71A 4UZSA 1EBGA 4AVNA 4ZMGA 2Z24A 4WJEA 1D7KA 4MY9A 1U5HA 1XISA 2IKIA 4XZIA 2CLKA 4KQNA 1QWGA 2BZNA 3ZSSA 1SR0A 2V5LA 3IPWA 3GXPA 4QE5A 4AY7A 1EP3A 1PCWA 2G3JA 1FX6A 1KWKA 5E0KA 3NQ8A 1SO6A 2HV5A 3DEQA 2X0SA 4B5UA 4L7ZA 5TIMA 1BWLA 4AW7A 1W3HA 4NVTA 3W6YA 3QKEA 2ZVRA 3E9AA 4M24A 5IOBA 3W9ZA 2YFNA 4IOTA 4MJZA 5LHFA 9XIMA 3GHRA 5HQEA 2OO0A 2B7QA 5PTDA 3SCQA 3M0LA 3LA4A 1XIMA 2DZBA 3LCGA 3O6YX 1CB7B 4R33A 4US5A 1BYAA 3DBPA 3U2OA 4AEOA 1RVKA 5BOFA 4CEXC 4AIUA 4ZXOA 1DIKA 3W24A 1Q6EA 4LOCA 4JCMA 3WH5A 4JGDA 4AZCA 1HIZA 2E28A 4MWAE 4IMEA 4L6HA 1B3YA 5CGQA 1WXZA 1E9YB 1DJIA 3PZGA 1V0LA 2TYSA 4ROPA 2VTFA 2WNQA 5AB3A 1XHGA 4LAZA 1RBAA 1OX4B 2FDMA 2WHJA 2ZC8A 2HROA 4PC8A 3CAWA 3DHFA 4H7VA 1YMYA 1TSIA 2G8ZA 1GG1A 4YTSA 1BQCA 2FYMA 1W9VA 1C8VA 3QY8A 3O63A 4DLFA 1U30A 4FNUA 4MFDA 1DKWA 4JIQA 2IPGA 1LROA 4QRNA 4PGLA 1VRDA 1JAEA 1M03A 1A53A 3I4KA 4DLMA 4NT0A 4JICA 4U2ZA 4Z1CA 1TA3B 2J9XA 3DFNA 2EPKX 5BCAA 5AHEA 3GAYA 4XAYA 1B1YA 2POZA 1BG9A 4MNLA 3FAWA 1G4SA 3G1AA 1TJPA 5A2AA 4WD0A 2TMDA 3CUGA 1VD6A 2PI6A 3PZQA 4V33A 1W1PA 4O54A 1A47A 4F66A 3UWUA 1X6UA 3GH7A 5LA0A 2E25A 1NFBA 2P0OA 3M5XA 1FBAA 2H9AA 1TWSA 4EE9A 3DH7A 3EWWA 1OCJA 2QLYA 5IHSA 1OM0A 3VIKA 2YDRA 4RK8A 5H1WA 2WMFA 3VGDA 1GEQA 3NEHA 2Z1XA 1VRXA 1K7EA 3QM3A 1VCGA 4LYPA 3S8HA 1O7AA 1MW2A 4CCCA 3UW6A 4KKXA 4LNCA 4TXEA 4GI4A 3ARQA 2QAPA 2REQB 2PDFA 4GKLA 3U5UA 4LV9A 1JRBA 1LBMA 1KQYA 2V5JA 3W7DA 2RDTA 3TJIA 3WBXA 3OA3A 2HMCA 3FKKA 2VZTA 4S38A 2GDVA 3NQDA 5D30A 4ZBCA 3DFTA 3F5KA 4FZIA 2WANA 1GOXA 2AAAA 2I7GA 4Z17A 2WZMA 1I60A 4GH3A 4D6HA 3GLCA 4EAYA 5HJLA 4GIYA 1Z9AA 4F2UA 1VKFA 4QQ3A 3WD2A 3NVDA 1F4AA 1P5BA 3OOQA 3RU8X 5AHLA 3W88A 3GFXA 2Y85A 1G6CA 2FZMA 3P93A 3P5ZA 4Q8VA 3B40A 1KTBA 1GVSA 1R3YA 4JQAA 2ZX8A 2Z1SA 1XIIA 5G2WA 4KCVA 3ZXWA 1JQVA 1XCFA 3STEA 1OX4A 3T1GA 4X60A 2NUYA 2PDLA 1HTIA 1NSJA 1F6PA 3JUGA 3L5AA 3WQGA 3LOTA 4E2OA 1KFWA 3KZSA 4I9JA 3V35A 4B92A 1OFOA 2GVYA 3IRSA 5MHBA 2WSPA 4AZCB 1X1ZA 2WHMA 3B0PA 3NDOA 3CV2A 3QSTA 4J3UA 1XIBA 3GQYA 4L65A 3BG9A 5FAJA 1PZ2A 1UPPA 1NJJA 4UTIA 1S39A 4NASA 1H60A 4S23A 1LUCB 1GYLA 4YYCA 4UCFA 5HATA 2J7BA 4R7OA 3OIXA 1CIUA 3LD5A 5CC7A 1V6XA 4PUWA 5CG7A 3B97A 1S46A 2GGEA 3TNBA 4JQ2A 3F4VA 3VU2A 4ZGYA 1EXBA 3P6LA 1R2RA 4HOWA 3CAVA 4C91A 2BASA 5I3IA 2VX5A 2NX9A 3ZWSA 3C3UA 3DKJA 4DO5A 1ZCCA 4TIMA 3UESA 1W5MA 4PEEA 4PMRA 3ZR4A 2G5WA 3WNPA 2A5HA 1NFGA 3PJUA 4QJ3B 2XG9A 2QXWA 5F1UA 3CNYA 2J75A 3N15A 3AXIA 3T4WA 4DWDA 3VI2A 2AQVA 4L64A 1T7LA 1TUXA 1KKOA 3O07A 1UBSA 4YU1A 2YYUA 4C6MA 6ENLA 4NAFB 2IPFA 3D3AA 4H1ZA 2ZZ7A 3AUJA 4J2MA 4CU6A 1FWHC 2PWGA 5DN1A 1L2QA 4LCSA 3VZZA 2JF7A 1GONA 1SSDA 1E4IA 3AJXA 4AIEA 4WOZA 4LXFA 1AK5A 1HJVA 2QGHA 5GJPA 1E70M 5DO8A 3EA2A 4PMVA 1R46A 2YGYA 1DE5A 2VUYA 4MVAA 2ZYFA 4CQ9A 1N2VA 3CUXA 2PPGA 4ZQMA 4LWWA 2V5BA 3RPDA 1NOUA 3C52A 3TONA 3LY0A 3CZEA 2XN0A 3I7SA 3OP2A 2QF8A 4F3HA 1FWFC 3UNTA 3NPVA 1PAMA 3ATYA 8CGTA 2ACQA 4O8AA 3PUDA 3KRSA 1IV8A 2Y5SA 5DFAA 3MV11 5ENLA 3G2GA 3WH9A 4XZNX 4NAFA 4HMNA 2VR5A 4KBXA 1LWJA 3UYCA 1G4TA 3A12A 5T9CE 4GNJA 2XPKA 3VDCA 1Z6KA 3OLIA 2BY2A 1JJKA 3W53A 4A3UA 2XH7A 1OGSA 1ZAHA 2Z2AA 1E9IA 3QOMA 5D8ZA 5TBOA 4HPHA 4GYKA 3AOFA 1TVNA 2GGGA 4RUBA 4JTTA 1BYDA 4GPNA 1K8XA 3EDJA 1GQKA 3FAXA 4F0SA 4KCWA 1BAGA 1V6TA 3W2MA 4DHGA 4KF1A 1LP6A 2XWEA 2GYIA 4M6QA 3STGA 1J6PA 1JDFA 4ECLA 2PRMA 4F0KA 2WYSA 4IGMA 4CNNA 2XDFA 1ZP4A 2H8XA 1PIFA 5ABEA 2PC8A 3T42A 3LZ3A 3KRZA 3KCJA 4C6NA 3USZA 3WZ0E 4KETA 4XV0A 2WVVA 2XU2A 4NNAA 4S2BA 3VTRA 2XFYA 2C6QA 3LPGA 1O5XA 4PEKA 5HNNA 4OFCA 5A6BA 3WQEA 4IICA 4WY0F 3NURA 1Q6QA 1EGVA 4M8UA 4CLMA 3WY1A 2Y61A 1W37A 4MY1A 3RG6A 1JFHA 2AMGA 2ABAA 1EGMA 1UC5A 4G1NA 1JNDA 4HU3A 3BXWA 3QVQA 3DHDA 3PANA 2DSUA 4DUXA 4PB5A 2YB4A 2DH3A 2R94A 2C3ZA 1E40A 3S1VA 2E1WA 4DF2A 3AHZA 1BPLB 1XRTA 2QJGA 4R34A 2F8QA 1UQZA 4X3ZA 3P3BA 3MA8A 3DFPA 1PX4A 3KVKA 1ECEA 1KXHA 2WMGA 4OBRA 4POCA 5D4YA 3J7HA 4OWGA 4QTGA 4W93A 1V79A 3BZGA 4ZQOA 3WDPP 1BKSA 3ZR6A 5HWNA 3VXGA 3TYEA 4OVXA 1JNEA 1O6IA 2Y8UA 3JU2A 2IUZA 1R30A 4Q4KA 4R27A 2WC3A 3W83A 5HR6A 3AHVA 5DXXA 5ABTA 1OYCA 5KETA 2EF9A 4B3KA 5FEWA 4US6A 3IGSA 3QW4B 2YX0A 3W22A 1OK6A 4CKQA 4GI6A 2VDGA 3NZQA 2C8NA 5GPRA 3VOGA 3W75A 5I07A 3NXLA 3NQMA 4TX8A 1VJZA 1Q4NX 4JOMA 2PDJA 1UKQA 9XIAA 3KBVA 4KERA 1JCNA 2FLIA 3WH6A 1CWYA 2HE5A 1OF6A 2G96A 1IWBA 1DXFA 3HV9A 3QPYA 1I4NA 3N19B 5CG0A 4I5XA 3MUY1 4WF7A 5FJOA 2J79A 2BS9A 5FSEC 5MKGB 1A4LA 4Y9NA 3VD4A 1OINA 9CGTA 2GJNA 1L8PA 2CLLA 3T78A 3A4WA 4U28A 2FFIA 3QC3A 1XBXA 1EYWA 1KCZA 3LB0A 1KQZA 3WJXA 2ZVIA 1XYBA 1VFSA 2VFFA 3KVJA 2A7PA 3FXGA 5TNVA 2B7PA 4JTCA 3OBAA 3VOJA 3VVGA 1XM3A 4YYFA 2H3BA 4J5NA 2KZHA 4FXSA 4DY1A 1OFQA 1I45A 3CB8A 1C7SA 2YCEA 3LXCA 5HJYA 2WVSA 4ZFCA 4I7WA 4AWSA 4W86A 2CBVA 4KWWA 2ZXDA 2B4GA 3N2TA 4MOZA 1VFTA 3FJNA 1NEYA 2CERA 3E6EA 1R9YA 3VIMA 4GIAA 3QV7A 4AZIA 3CIWA 1G1YA 1UYQA 1IZKA 1ZBVA 1P0KA 2DH2A 3ITCA 2FGZA 1Q45A 1JI2A 3HGSA 1TV2A 2DZWA 5HMFA 1XWYA 3VDGA 3TQVA 2WK2A 3LM7A 1JCJA 1ALDA 4KEMA 4GY0A 4TVUA 1K8YA 3NDYA 4IIHA 4AZBA 4P7QA 1GJUA 4PN2A 4PMZA 3IANA 1FP8A 3W87A 1JDAA 2C19A 5F2IA 3WQ6A 3YPIA 1RR2A 3A21A 4FNTA 5AC6A 1LT7A 4FSAA 4FNQA 2WNWA 4FEZA 1EB3A 5FAGA 4Z2GA 4GC4A 3WQOA 4GFSA 3IJ8A 3MPGA 3G24A 4UFHA 3ISIX 3OBKA 1VC4A 2F6KA 4NZCA 3S6OA 1NDZA 5BWFA 1OC6A 5HUOA 1GOWA 3MV01 1I2OA 1HJSA 1IXOA 4WXYA 3CQKA 4S3GA 2NWRA 4LAMA 3P0WA 1VPYA 4HOXA 4LU0A 1UPMB 3U4AA 1EC7A 3S47A 1L9WA 4XKMA 5HQMA 1WKFA 1RJPA 3GZ3A 4DUVA 3HGJA 5B80A 3NNTA 1YQ2A 4H4IA 4GYPA 4W5ZA 3PZUA 2P50A 3S46A 3F5JA 3AIBA 1THFD 1EDGA 1FVPA 3T81A 4ZO9A 5EU9A 2A3HA 3NAVA 4WHBA 4NQ1A 5LNVA 1H7WA 1KCLA 3BPWA 3LDVA 3EPOA 1M65A 1W1A1 3URBA 4GLEA 3VX1A 1ADOA 4PTMA 1B4EA 3NQ2A 3O3RA 4DIAA 2WJEA 4LVAA 2CLPA 2QUMA 1IEIA 4Y9AA 1EJUC 4JDBA 4EKJA 2ZX9A 1QNRA 4R85A 1DQXA 2TSYA 4DJDA 1MRQA 1KC7A 1U1JA 3MKVA 3C2EA 2IPJA 4DJEA 1Y5XA 3PWGA 3L23A 3CS2A 3NYDA 2FQIA 3HG3A 3W7NA 5K9DA 1KM2A 3T0BA 4Q6XA 3C2YA 4HN4A 4H2CA 4R9XA 2W67A 5AHNA 1QAPA 1WUFA 4O28A 5CSYA 2Z0IA 3A3HA 3OVRA 1R6WA 1Q7MA 2IMRA 2YZRA 3AU2A 3W1TA 2VFHA 3D5HA 1D2KA 2FKPA 4PBGA 4AY1A 5HQLA 4IPIA 3OTRA 5FIPA 2WWCA 2XIMA 1JVNA 3MKKA 1VHCA 4FF7A 1FKWA 3TIMA 1QK2A 4KIEA 3TN5A 3CC1A 4DRSA 2O92A 5ABGA 4GJIA 2A3EA 4QDPA 1OK4A 3EEZA 2IW0A 5K2ZA 3PVFA 3VM7A 4YWIA 2WB5A 3RFAA 4ZO6A 1Q8JA 1UWIA 3LCWA 2PF8A 2Z2UA 1WPCA 3BLKA 5CPLA 2DP3A 3I6EA 3LHTA 1L0PA 2CC0A 2E40A 1WKEA 2WWDA 3OLEA 1ESWA 1Z44A 1XCXA 5A8QA 2XH4A 4QAIA 2FJKA 3PTDA 4IGHA 2HCVA 3VZXA 4E8GA 1M7OA 1MVYA 4RLIA 1HL2A 3W37A 1EHAA 1UMYA 2Y8VA 4ICCX 5D2VA 3W25A 2FPTA 2ZZ1A 1FP9A 4AF0A 1XYLA 2C15A 5CGTA 1N55A 1XC4A 3QGKC 3DOPA 1IEWA 2WMHA 3QN3A 4IQJA 1B90A 1S5NA 4DJFC 1WDRA 4I9TA 2FZ9A 3ITOA 4EANA 3S2MA 1F7BA 3NZ1A 5CBJA 4MZYA 2XISA 1Q7ZA 1D3CA 4OT7A 1HVXA 3SECA 1VQTA 1KXVA 3MY9A 5FJIA 1AMKA 2ATMA 2PSNA 4YCOA 3TTSA 3NQCA 4MDPA 1F07A 2VEIA 1AVAA 4PUNA 1XS2A 7REQB 1ZSXA 3R0KA 4QLLA 2Q02A 3L4XA 3OVPA 4NYUA 2OPJA 2ZUSA 1XLIA 1ZNNA 2PLKA 2D69A 3EXRA 3R1ZA 4HYVA 4JYDA 4CVUA 2WZIA 1K6WA 1ZBKA 4TOQA 2GVGA 3GU1A 2HPIA 5E09A 1QPOA 1VP5A 4WSKA 1EJSC 2YW3A 3SO7A 2VD8A 5FEXA 4M1BA 1VR6A 3RX3A 1HKIA 1SO4A 3SJNA 1CGUA 4ADUA 1CNVA 3W7OA 4AHOA 1DIOA 4JCLA 2VZUA 4H8NA 4DWSD 2Z6IA 4IFRA 4K3ZA 1UR1A 2VFDA 3TN4A 2QCMA 2DZPA 5A95A 1ITCA 3DU0A 1PL9A 2OFJA 1W2VA 5E5CA 1EF3A 2Z1KA 3USBA 3FJ6A 2DIEA 3RILA 3VGHA 3L66A 4S39A 3GIQA 2D2GA 3OU8A 2WZTA 1B3XA 4ZENA 1GKPA 3CUZA 2ZE0A 5C8BB 2YCJA 3RPTA 3IS4A 1TYGA 3NO3A 4AVOA 4C60A 4QJ4B 4WGXA 5DRIA 4L9YA 2WAGA 3V16A 3W7MA 2V2DA 3AIVA 3CAQA 2HXTA 1VFLA 3N2OA 3PPFA 4H19A 2JKAA 3GO2A 3AMLA 4RCXA 5GJMA 3TZFA 4PCTA 5AECA 4A29A 1I6NA 5BYWA 1MQPA 1F3TA 2E6FA 1UD5A 2PGFA 2ISDA 2Y7GA 3MQTA 3W1XA 2QCDB 3AYSA 1O12A 1N8WA 3ZT6A 2QJNA 2QHAA 4O14A 1OYAA 1LOLA 2WCGA 3PAJA 3A5VA 5KZDA 2QGYA 1MUCA 1ADSA 3EPNA 2YLAA 3SFWA 2A3AA 1K8CA 4UFJA 2O9PA 5CPTA 4WZHA 7REQA 2ZQ0A 5CZSA 1OSEA 1IT0A 4W9TA 1PJ9A 2E3ZA 4Q4QA 3K30A 3DBNA 3DGBA 3MHGA 4K39A 4OU1A 1E6ZA 1XLEA 1V6UA 3QPZA 2PDHA 4BI7A 1Q2SA 1QATA 2A6LA 4MUZA 3PZVA 1NWRA 1QPNA 5CPMA 4GJJA 1MEIA 1K7FA 2PU0A 5GVJA 3KWXA 4YHGA 1MUMA 1E0WA 3T0CA 3DI0A 5FF3A 4X9SA 4L1WA 3KZPA 4MKVA 3RLGA 3O2LA 1JCYA 3GTNA 3CQIA 1ICSA 2J88A 4WCJA 1P6CA 4PH6A 1H61A 4CD8A 4O0QA 1E6NA 3O9NA 2OGYA 1PYFA 3OEXA 3W07A 2I1OA 1ZQ5A 4HZ6A 3TYCA 1FCBA 6REQB 1RSCA 3UCCA 3WLPA 3NOEA 2KX9A 1X96A 5L6UA 1R9ZA 5HJXA 1VH7A 4R3UA 3CM4A 1GPWA 1KBIA 3DXIA 2E6YA 2YXOA 2Z00A 1VBRA 3B8IA 1QPRA 4Y90A 3ITGA 2C1GA 1B9ZA 5D2WA 1S2WA 3SUTA 2MNRA 4UQDA 2BLEA 3SUUA 1N82A 4AWTA 2QJIA 5JQ9A 4LEQA 4DWSC 2WKLA 3FS2A 2EJAA 1RH9A 5HWJA 2X2YA 2F9RA 3TXVA 5JBDA 3OHMB 1FCVA 3MMUA 4CVWA 1DV7A 5KMYA 3GM8A 4BQ2A 2D0GA 4NI3A 2C7FA 1HUVA 1V5XA 4AXNA 2QDGA 4NYYA 3L0NA 4ZB0A 4LTSA 1Y65A 3H2NA 4LY8A 4F0HA 5CZJA 3ATZA 1LLZA 3SJ3A 3DC0A 3KS5A 2DIJA 3NDZA 1KXQA 2CLOA 1E71M 3IJIA 4MKSA 4NAEB 3BANA 2GDUA 4W8BA 4S1FA 3BJFA 4M19A 4PMYA 1LORA 3SURA 4AD4A 4FLRA 2A6NA 1WAUA 4IIBA 4ZOCA 1DJGA 2UZ9A 1KM0A 3W1MA 2XZ9A 3DI1A 3V0SA 1AW1A 5AC5A 4AZGA 4UQEA 2O9TA 3WF4A 4YTTA 2OQHA 4IIEA 4B5TA 4C6FA 5HMSA 2VR2A 4GX8A 3TWBA 4A22A 3H22A 3F4WA 3W2UA 4XAPA 3LCLA 4EPDC 3DYOA 5HR7A 2DGAA 3U6WA 2NV9A 2X42A 3U0HA 1DE6A 3MYOA 3WUFA 2ZUNA 3G1VA 3BOXA 1TE1A 3WCZA 3ZYZA 3M41A 1Y0EA 3M5ZA 3CYVA 3RNDA 3IAPA 1SQ7A 1OD8A 3SCPA 2HBXA 4G8TA 1OD0A 5A3HA 4Z2JA 3B0XA 4Q4RA 3K8LA 2FPVA 5I3HA 2I5IA 1KV8A 1UWSA 4S3FA 1ZJHA 4F0MA 3T09A 1JQXA 3N6HA 2V6AA 1SFJA 1W3JA 3S5YA 2CWNA 3MI3A 2QUNA 2PP1A 1GOMA 5T91A 5M2FX 1XYCA 3OGVA 1LRNA 4H9MA 4X0NA 5FSDC 3TSDA 3QMRA 3WDQA 4EXBA 3KP0A 5IHRA 1KFEA 1KM6A 4IIFA 3VOFA 1FA2A 2RUSA 4UTHA 3GHTA 3WLJA 1J01A 3Q4DA 2R14A 2GUBA 1LQ0A 4NRRA 3TCSA 1TQXA 4AVFA 3GW3A 4LAKA 3W7RA 1UQYA 3V4BA 1V7YA 1GOOA 5EY5A 4NNCA 5CKSA 2YYTA 1KB3A 3LRLA 5FKYA 1UZ1A 4H7CA 4M7SA 1POJA 2XGZA 4RE3A 3L2LA 3M5YA 4FOKA 1S1RA 1PTDA 3W1UA 3K1GA 3KS6A 3MSDA 3SR7A 4ZB5A 1V6VA 3VKCA 2OEJA 1QDSA 1GEHA 4IP5A 1PCKA 4I8DA 3RYSA 3TYDA 4TMBA 1XIEA 3RMEA 1IXPA 4GH1A 3QZEA 3B4UA 1D3HA 5AVHA 2PZ0A 2DZUA 3CHVA 3A4XA 1I1WA 2VEKA 2ZADA 1M6JA 2NW0A 3CH9A 4FAMA 1KBBA 4PFHA 2X30A 3BGAA 3S2JA 3C2OA 3KL0A 1UH2A 3DENA 5I77A 2VOTA 3IJ6A 3CZLA 3R0UA 1LWIA 4DJFD 2D2JA 2VT0A 2ACRA 1E6RA 1G94A 1SMDA 2Y5EA 2NV2A 4QIUA 3B8VA 3TE9A 1EKOA 1FCQA 1YEYA 4RE2A 1K77A 1QPKA 1A3WA 2YW4A 1LM1A 3WQPA 1IXQA 3NQEA 3MI6A 1J0KA 4GNVA 4J7RA 4ZO8A 1NDYA 1WDQA 2RFGA 3TSMA 2ZTKA 1SU5A 5C5YA 3TYBA 3VINA 2DUXA 1O1ZA 1Q3NA 3NM3A 1BSIA 5KEZA 4AD2A 4PTNA 1TJRA 1FDJA 4GGHA 4LRSA 4ICNA 3ZWTA 3CXOA 1IEQA 1H7RA 3LZ5A 3LNMA 3OQEA 5IDZA 1CGYA 3MMWA 1S3HA 1EJXC 2VX7A 3DC8A 2V2HA 3N2MA 3PWIA 1RK6A 1XRVA 3DFHA 1PIGA 3VILA 3UG3A 2C79A 2INEA 1YXDA 3AUOA 3KBNA 4FX6M 2BSLA 1WUEA 4N02A 3M0HA 2ZCGA 4XKYB 3MSRA 3GBEA 1KNWA 2BNJA 1ECQA 3AU6A 1X97A 1OEPA 4JIIX 2Z29A 2YCIX 4HHHA 2OT1A 1W3LA 4PTDA 1TG7A 2QZRA 3WBYA 1FWSA 1T8XA 2WLZA 4LF2A 3MJMA 2Z6JA 3H12A 1DXIA 3A47A 5I23A 2A7RA 5DELA 1KO0A 2AL2B 3N25A 1EZ2A 4H00A 1EL3A 1BSLA 2XIIA 2JEPA 3EXSA 3KM8A 3BOLA 2CLEA 4W89A 3FCPA 1NIUA 1HP5A 1GTHA 3ARSA 3PG8A 1GW9A 4GXPA 4MMWA 1ZFJA 3I3DA 3VK5A 4F0RA 1YX1A 4AF0B 1AH0A 1KM3A 3QGVA 3TJXA 1D9EA 2AKMA 3PSVA 3TOYA 3B8TA 2DU2A 1FWEC 2CXEA 3N2XA 3NJ3A 3K8MA 4XAFA 3T8QA 4PZVA 1PKNA 1UUMA 2WQPA 4HKPA 4NKCA 3HQPA 1KBLA 4MLRA 4K1GA 4F9JA 4XZLX 4ZXLA 2WQDA 3OJGA 4HJFA 5DLCA 4K7VA 3VGEA 2HE8A 2IQ0A 1TTIA 4ADSA 5ABFA 1H63A 1DP0A 4V27A 4MM1A 3FDKA 2PGRA 4XO7A 5IBXC 3V1HA 4O4WA 3A9IA 3K1DA 1E1CB 1K6AA 2Y70A 5KZEA 2FTWA 3TVAA 2ZX6A 4UQCA 3SN1A 1NM9A 2QCHA 1YBQA 1W31A 3PZOA 3CIXA 2ZKMX 5E93A 2F7FA 1L6YA 3RR4A 3G1FA 2Y4SA 2X05A 3N29A 2ALRA 5BW6A 2PDXA 1ICPA 1A0DA 1J8VA 3QYQA 5LIWX 3ARXA 2X1TA 3ZVIA 4G9PA 3E12A 1KTNA 1PS9A 3WK1A 4FLQA 5FJPA 1X6LA 4MLJA 4HTYA 3LHZA 3UCQA 1J93A 3VIPA 4K38A 2R1PA 2IXUA 4AY8A 1LWHA 2P3EA 5A8PA 4MWAC 1GW1A 3GYCA 3HPFA 1OX5A 4GQGA 4E4PA 1HXJA 4IFKA 4CCDA 1LOSA 3WDHA 1MMFA 2ZX5A 1XDJA 3VOCA 2E6DA 1KR1A 3NPUA 3NSNA 1GVEA 4JKLA 3OODA 3C86A 3BW3A 1X1NA 3NPXA 5HANA 1EWDA 1XD1A 3ICJA 3ZJKA 1DVJA 4FX8A 7CGTA 1ISWA 1OIFA 1ZLPA 3IK4A 2JALA 3I6TA 1TFVA 1O5RA 1Y8BA 4LVBA 1P48A 1J6OA 4B16A 1TV8A 3GFZA 3RU6A 3L12A 3QJAA 2YOCA 1JIBA 2QCLA 2ADAA 3UPWA 3SCNA 1NP0A 3B8DA 1MI3A 4S3AA 3NZPA 4DO6A 1SPQA 3VMNA 1Q8AA 4MNKA 5C9ZA 3FGCB 2INFA 3TA6A 4L9XA 3WQ8A 1LL4A 3EMZA 4HA0A 3WLTA 4EWND 1H41A 1W3TA 3GD6A 3ZM8A 3IGUA 2VC7A 1DWIM 2PGEA 4DUWA 3UF9A 1XIDA 3L4YA 2QJJA 2R82A 4QJ5B 1E9ZB 3QY6A 2QPXA 1XPGA 2EKGA 5I7GA 2YFOA 1US3A 8XIMA 1NWUA 3N17A 2A3LA 3H7RA 3CLWA 4NG3A 4BI6A 2O4MA 4DJFA 4Z08A 4UFMA 4PYSA 1LOQA 3F4NA 1RVGA 2VWSA 1IWAA 2XZ7A 1L8NA 5HBFA 1EJWC 2I14A 4URIA 4PUJA 3HG4A 2DT2A 2Q71A 4ATDA 3R8HA 3CH0A 3A4JA 3C2FA 1VYRA 4U2YA 4C6QA 1GVQA 4HN8A 4D6JA 6REQA 4AISA 4EX4A 1E3XA 3SCTA 3EKLA 2WMKA 1Q6LA 1SSGA 5G4EA 4DZAA 4R9OA 3UFYA 1CXEA 3N6QA 2WVUA 3GDLA 2I17A 1QW8A 1XSKA 3CYJA 3EWCA 2FZDA 1GZ1A 1RQBA 3P60A 1QNOA 1ML1A 3UA4A 4K7YA 2ZUWA 2INZA 2R1KA 4JTJA 1ZJIA 1JGMA 3EX6A 3SM0A 4D8LA 2Z7KA 1E5JA 4XO6A 2YPIA 3R8GA 3E38A 1TMHA 4B5WA 4MGGA 4NZFA 1S2UA 3E96A 2PWFA 3MUCA 1RUSA 2EAWA 1UWRA 1H5YA 1AJ2A 2CNCA 2XINA 3IV3A 2KAUC 3VCCA 3SRDA 4LUSA 3TN6A 4O1EA 5HDRA 3W0KA 3IJLA 2CLMA 2QDDA 1U22A 2E67A 4JHZA 5BMXA 5GNYA 2GJPA 3LMYA 3KXQA 4YN5A 2J6XA 1NY1A 7TIMA 3E2RA 4K8HA 1LL6A 1S5MA 2D73A 1W5OA 1R86A 2D2HA 2J77A 1PO9A 1KD0A 3B0VC 4L4LA 3NL5A 4P61A 3W7JA 1C8QA 1O95A 3IACA 4MYAA 4E2BA 1QNSA 4W7UA 4TX9A 2H3DA 2VHLA 2RDUA 1JEZA 3W70A 2YXXA 2OZTA 4HTBA 2EKCA 3W86A 2O9OA 3CQJA 1B3WA 1UA3A 3DHUA 3L4TA 1ODZA 2YDSA 4W84A 1WQ5A 4UFKA 3PAOA 4UTKA 3FV9A 2EG6A 3DG7A 2XM1A 3QC0A 2NLIA 1OHLA 2PDWA 5D32A 2GVEA 2UY5A 2ZOXA 4DELA 1HKKA 4IX0A 3UT0A 1UZDA 2W79A 3QPEA 4RZ6A 3NQBA 2QJMA 3IVSA 1CXFA 3PTMA 2J4GA 2Q01A 3S2CA 3KUMA 3PHAA 1J79A 3RM4A 2GSHA 3GR8A 3WLHA 2CBIA 1TPB1 3S6TA 3EB4A 5B7YA 2A85A 2PP3A 4EAMA 7A3HA 4HOZA 3NM1A 1R3WA 4US5D 1PE1A 1MW1A 4NI8A 4D1IA 3M0YA 3M6DA 4Z1DA 3SN0A 4IIGA 3WD1A 4DX3A 5TD4A 4UTTA 3T0AA 4JD4A 3CZ8A 4ZB2A 2NZLA 2REQA 3KEHA 3AHTA 1DTNA 2PCQA 3GNDA 4KW2A 4BF5A 3C0SA 5KZMA 2OCZA 1MXDA 3B8SA 3IIZA 1E51A 4XX6A 3RITA 3WNOA 2I56A 1K8ZA 4JY9A 2QUUA 3SCVA 3MSYA 1I0BA 2VGFA 4X2PA 4L80A 1ZL1A 1JXJA 1TRIA 2Q6ZA 3QEZA 4DUOA 4LY4A 1QCWA 5EFFA 3XISA 2H9AB 1E5NA 1P6WA 3KRBA 3GTHA 2RJHA 4R5EA 5CZTA 1QBBA 1ZGDA 1ONEA 4JTFA 2MUCA 5BWAA 4DYEA 4ERGA 4IG2A 4XAZA 4JTLA 2OYKA 2FGLA 4HJWA 1GVYA 4CD7A 1VJIA 1TREA 2QV5A 4LUSB 3WK2A 3CBWA 2OEMA 1TA3A 2PLCA 4U10A 3TTEA 1HN1A 1V7AA 3E0VA 3NGJA 3ORWA 5M5DA 1F6KA 2R91A 3M0KA 2NVCA 2FZ8A 2GZXA 5K7JA 4D2JA 5G1TA 2P76A 1TPVA 3I10A 4F79A 1C7TA 1BXBA 1BQGA 3APGA 1VLWA 3N2BA 4ZZ9A 1OFEA 4K8GA 6PTDA 4UNLA 3IUHA 4GVHA 3RLVA 2V5CA 4OZOA 1LRTA 4AZ7A 2CZVA 3ZZ1A 1V0NA 4KFPA 1DIDA 3B9NA 5EMYA 1R0MA 1RD5A 3LRMA 4JTRA 2PDNA 3ABXA 2RH9A 1QHZA 3MYPA 4O1BA 3WDIA 3FKRA 3H26A 5CBIA 5C7VA 2PDPA 5JXQA 3LQGA 1CLXA 3AIRA 1YNYA 2PWDA 4HGXA 2OLSA 3EPMA 4DJDD 1FHUA 2QCFA 1EFZA 2IKHA 4I5RA 1XI3A 3GAKA 2OXNA 2BY3A 2HJPA 4LUJA 5E9XA 1AJZA 5TQLA 2NUXA 3GFYA 1JD9A 3JZEA 5FF2A 4RNHA 3QQ0A 3H2AA 1WYIA 3PZIA 4CQCA 3NSXA 3DECA 1IR2A 3CHCA 3WYZA 2NQJA 1NH6A 1BHGA 3QF0A 3QQ1A 3THCA 3MCMA 2CETA 2PTWA 1SO5A 3TA9A 2PDBA 2CU0A 3KTSA 5LKYA 2D1ZA 4CNUA 4I6VA 4N0RA 4QLKA 3BMXA 4D6DA 3F7JA 1R47A 3S1GA 4BY3A 3ARRA 3DZ1A 3AXKA 2WBKA 4IQLA 5I79A 2PTYA 1GYMA 2G3MA 3GNPA 1CLVA 2GQ9A 3V36A 4B5SA 1SZNA 4JEQA 1HKMA 3SQLA 3W23A 3NEVA 4LC8A 3LXBA 3OLDA 4I7VA 3VC6A 2OYLA 3LN3A 1F2JA 1KFCA 4FOJA 2DVUA 4B4HA 2A7NA 2V3FA 2ZRUA 3L67A 5RUBA 4R7WA 3W3OA 2VEPA 2ZZ4A 4LNYA 4E4UA 3OG2A 1VHNA 3S3GA 2C18A 4FHAA 5A6SA 1XYAA 3OGSA 2ZWYA 1CGVA 1MZHA 1XUZA 3EYPA 3FIGA 5FOOA 1CGWA 2VDHA 3FYOA 2NQHA 4PULA 3QFEA 1YTEA 4NILA 1C29A 1L6GA 3QHMA 4Q8WA 3IIOA 2E9BA 4KGJA 3AMKA 3NPWA 2PTXA 1Q4WA 3CEPA 3MP5A 4GZ7A 3ZT7A 3UR5A 1P1XA 1PUDA 1E43A 1UKPA 4PCFA 3E0FA 3G5EA 4A21A 2G0WA 3HV8A 2BHUA 2VCAA 2CKSA 3LM3A 3N13A 4FK9A 4PA8A 1YBQB 3C3NA 4H6RA 4HP5A 3HJZA 3CU2A 8A3HA 2XTKA 4KWUA 3IAQA 2OVLA 1DJZA 3HMJG 3E3HA 3G6LA 4HSHA 1XLCA 4K1WA 3RHGA 3TN3A 4GI9A 4QCEA 3VC5A 1CX9A 5CPOA 3THDA 3S1UA 4Y9PA 2PDIA 2CITA 5D02A 3SCRA 4HU4A 1EEXA 4NUWA 3EX2A 3CO4A 2FIQA 3SBFA 1MUWA 2O4QA 2V69A 1AD4A 4QG6A 4LBRA 2R8WA 4F2BA 5ABHA 2GQ3A 2ZA2A 4FOUA 4PMDA 1VLIA 1ZPTA 3AQUA 1L6WA 2FH6A 3W2JA 4DB7A 1H0GA 3ARUA 1JPKA 3WD3A 4N6EA 1FDZA 2WM0A 3PTQA 3DKLA 2WJDA 4L4MA 2ESCA 1MW0A 2BVYA 4OUIA 3QW3A 4X2RA 1TZ7A 5FL0A 4XZMX 2J78A 4WJXA 2ACSA 2E0PA 3VMOA 2PD9A 3BJSA 4RPPA 4K6AA 3ONBA 1Z7AA 2J8TA 1GOKA 3LK6A 5B7ZA 3GR4A 4RE4A 2VGIA 3TWAA 4A8IA 3NOYA 1EPXA 4OECA 3P62A 3TH6A 3TDFA 1ISVA 3VDBA 4K37A 2O0TA 3NCOA 1YHTA 4QNWA 1OC5A 4HD5A 4A8RA 1I1XA 1H50A 2IPWA 3CAKA 2V67A 4Y96A 1A50A 1RZMA 3B03A 3W7IA 4IH3A 1OZMA 1Z3NA 3EA3A 5I02A 1VFHA 5F4SA 3UXLA 8TIMA 1DWFM 2VM8A 1EDQA 4S3EA 3SI9A 3EB2A 1GKRA 1HZYA 4E6MA 1Q6RA 1FWTA 1UOKA 4J28A 5LA1A 1QR7A 4WGHA 4XD6A 2QPSA 5MKGA 3EA1A 4FP1A 3HN3A 4NZ1A 1O66A 2XVNA 1BRLA 1YPIA 3H2EA 3FSTA 6ALDA 1AMYA 1VJSA 3TJLA 1N8FA 2V5KA 3UWWA 3GHUA 2H6RA 2NQ5A 3GNNA 4FIRA 2Z1BA 5I3GA 2UY4A 3DESA 2Z28A 1AA1B 2XIJA 2BB0A 2RHGA 2QR6A 3E74A 1AH4A 3TC6A 1W9PA 1XIJA 2Y89A 4GYFA 5EBUA 3MZNA 4LS0A 4CN6A 2GGJA 3WEMA 1ZENA 4IMCA 2P0IA 3W01A 3AYTA 5U7SA 3LTYA 1KW1A 5GNXA 4O17A 3WNKA 6XIMA 4D71A 4GUFA 1PHQA 3UPBA 3W1AA 5CGMA 1REQB 1W1B1 4BQ5A 3OPSA 2CBUA 1VBJA 4G5DA 2W5FA 5HK4A 1W5QA 4ZEPA 2HVOA 1OVDA 1V3HA 5EMLA 3AIWA 4OHQA 3BL3A 3DGRA 3IIPA 3R94A 2FDSA 1JYWA 5GQBA 3T2QA 2BY0A 4CCZA 3OYZA 3UP8A 3SCUA 3QQWA 2YL9A 1EUNA 4HNLA 3L65A 1V3KA 2CPUA 3T08A 2QUVA 4AHPA 2BXYA 3EDEA 5FJUA 4EACA 2GWNA 3SCOA 2QS8A 2D23A 2D22A 5K4ZA 3AS3A 3MCOA 4JNMA 1C92A 4C7FA 2DVTA 3ZMRA 3RAOA 1FWDC 2IQTA 3ONCA 3Q58A 5DXYA 3T9PA 1XQLA 2D0HA 4NF7A 3UZYA 1G69A 1HF6A 2VX4A 1OG6A 3W7LA 2BVWA 3KVLA 3WKZA 1RPKA 3RO8A 4LS2A 3LHYA 1L6SA 1PX8A 3N3MA 1KGXA 2HSAA 2ZDRA 1JZ5A 3EKGA 1Q65A 1J96A 1XINA 1YIXA 4KRUA 3LBMA 3TTYA 1IGSA 1Q7QA 5JH2A 4MJ2A 6XIAA 4WLCA 4P7LA 4AX7A 3M6YA 4FA3A 3CWNA 1HL8A 3WDRA 1XYMA 3T2OA 3URAA 1XCWA 2A2IA 3FN9A 3WMLA 1PB0A 4GIEA 1EF2A 3ZS4A 3FA5A 1HW6A 4J3SA 3EWYA 3VFCA 4LCRA 5EL1A 4O50A 2JGQA 1C9WA 1RBOB 4P8WA 1GYNA 1BWVA 4IXXA 2B81A 3W00A 4HNUA 4TMCA 1SJAA 4J3TA 2W92A 3RCMA 5CH9A 4RXGA 1GNXA 2EEXA 1V02E 4PFMA 2PA6A 4IPPA 3U2EA 2C1IA 3G1DA 8XIAA 2HQAA 2WO5A 4NJJA 4UMAA 5A6KA 1BF6A 4HZ8A 1IEXA 1R3SA 1K02A 1WKDA 3N12A 4D9PA 5J8LA 4CD4A 2OWWA 3TMLA 4QR6A 4RJEA 1A3XA 1ISYA 3C2RA 1XRSA 1JYVA 3BURA 4A2RA 1ZAIA 3TX9A 5EBAA 1XX1A 4U33A 3G1SA 4C65A 1R3RA 1W91A 4P8XA 3LS9A 4JIEA 1B2YA 1ME8A 4Q8UA 1XIFA 3AMGA 3PB2A 4WXZA 5H2ZA 3EWUA 3DCPA 2GJXB 3IUDA 4AD1A 5M03A 4Z1YA 3R12A 2ZZ6A<