4H01A

The crystal structure of di-zn dihydropyrimidinase from tetraodon nigroviridis
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
485
structure length
484
Chain Sequence
AGEILIKGGKVVNEDCSFFSDVHIRGGKIVEVGPDLRVPPGARVIDATDRLVIPGGIDTHTHMELAFMGTRAVDDFHIGTKAALAGGTTMILDFVMTQKGQSLLEAYDLWRKTADPKVCCDYSLHVAVTWWSDEVKDEMRTLAQERGVNSFMFMAYKGLFMLRDDELYAVFSHCKEVGAIAQVHAENGDLIAEGAKKMLSLGITGPEGHELCRPEAVEAEATQRAITIASAVNCPLYVVHVMSKSAADVVSKARKDGRVVFGEPIAASLGTDGTNYWHKDWAHAAQYVMGPPLRPDPSTPGYLMDLLANDDLTLTGTDNCTFSRCQKALGKDDFTRIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSSNAAKIFNFYPQKGRIAKDSDADVVIWDPKTTRKISAQTHHQAVDYNIFEGMECHGVPVVTVSRGRVVYEEGRLKVSPGQGRFIHRQPFSEFVYKRIRQRDEVGKPAVVIREP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords dihydropyrimidinase
publication title Lysine Carboxylation: Metal and Structural Requirements for Post-translational Modification
rcsb
source organism Tetraodon nigroviridis
molecule tags Hydrolase
total genus 188
structure length 484
sequence length 485
ec nomenclature
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4h01A01
1ITUA 4NP7A 1A5LC 3MDWA 3AU6A 4Z42C 2Z24A 2A3LA 2UBPC 3RYSA 1J6PA 1YRRA 3QGKC 4CQBA 5LXXA 2DVXA 2Z00A 4R88A 2VUNA 3HM7A 1FKWA 1P1MA 4B3ZA 4XD4A 3S4TA 2DVUA 1K6WA 3GTFA 4IG2A 2ICSA 1RA5A 2Y1HA 4ZSTA 2AQOA 2ANUA 1EZ2A 1M68A 1RK5A 4RDWA 1FWIC 3QGAC 4WGXA 4DI9A 4J35A 3CAKA 4DO7A 4GX8A 2KAUC 3GIQA 3F2BA 2QT3A 3MPGA 1I0BA 4UB9A 3K4WA 4C6QA 2R1MA 3TN6A 4G2DA 4J5NA 5HMDA 1PB0A 3AUOA 4DZHA 1A4MA 2R1KA 5CH9A 4H9XA 2GOKA 4YIWA 4C6BA 4R85A 4LEFA 1V77A 3ISIX 2Z26A 4CNUA 2P50A 4IF2A 4G7EA 4F0SA 3URQA 4BY3A 1XWYA 3F4DA 2EG8A 4INFA 3IPWA 1NDWA 2VC5A 4KESA 5A6TC 3TNBA 2HBVA 2VC7A 3ITCA 2OB3A 1J6OA 3C86A 4XAGA 4KERA 5AKQA 3LNPA 4C6LA 2Q01A 4L9XA 4PBFA 4QSFA 4WVXA 3MVTA 3PANA 4CNSA 1QXLA 4LH8A 2PGFA 1WXZA 1UBPC 3UBPC 3TN5A 1PO9A 3GU1A 3S2JA 3CS2A 2FFIA 2D2JA 3A3WA 4XD5A 2OODA 4C5YA 4BJHA 4H9TA 1POKA 2VHLA 3S2NA 4HK6A 1UMLA 4C6PA 3F2CA 2Z25A 1M65A 2HPIA 2D2GA 1V51A 4PCNA 3A4JA 1YBQA 4XD6A 3F4CA 1ADDA 4C6NA 1M7JA 2QVNA 4C6OA 1R9ZA 1O5RA 1K70A 1QW7A 1A5MC 4JOMA 4C60A 1W1IE 1IE7C 4R7WA 1FWGC 1FWEC 4PCPA 3D6NA 4LCQA 4LFYA 4C6CA 4CQCA 1ONWA 4C6JA 2EG6A 4UBPC 1R9XA 3N2CA 1FWFC 1A4LA 3MTWA 1NDVA 4DYKA 4TQTA 3UF9A 2OOFA 4C6DA 1EJSC 4GX9A 1V79A 1GKQA 1POJA 3MDUA 1KRMA 3T81A 3LY0A 4MUPA 3K5XA 1S3TC 1RA0A 4H9ZA 3GRIA 4C6FA 1EJRC 4H00A 3B0XA 1YNYA 4IFRA 3UR2A 4GY0A 3GG7A 4KEVA 3HPAA 1RJRA 1KRCC 4V1YA 4HJWA 4H9UA 4XAYA 3GTHA 3MSRA 4H9MA 1FWCC 3NQBA 2WJEA 1RK6A 4AQLA 4B91A 2YB4A 3HTWA 2EG7A 4C6KA 1YIXA 3JZEA 1A5NC 3AU2A 1YMYA 4DLFA 2GWNA 3B0YA 3E74A 4V1XA 1RJPA 3NURA 3OVGA 3WYZA 3URNA 2GZXA 1UIOA 3EWDA 4QTGA 1R9YA 3DCPA 4LAOA 4KIRA 3OJGA 1JGMA 3PNZA 2IMRA 4DZIA 4ERGA 3O7UA 2RAGA 3IARA 3E0LA 3EGJA 4QS5A 3QY6A 4LAMA 2Z28A 4B90A 2AMXA 1VFLA 2ZC1A 1A5KC 4LALA 1PSCA 4C6EA 2QPXA 1V4YA 3URAA 5E5CA 4LCRA 4DNMA 1XGEA 2FTWA 3OQEA 2UZ9A 4RDZA 2G3FA 4PE8A 3ICJA 4KF1A 1EJWC 1ZZMA 4NG3A 4XAFA 3G77A 4CNTA 1DPMA 2D2HA 3LGGA 4B92A 2P53A 4IFKB 3KM8A 4GOAA 4CEXC 4GZ7A 4E3TA 3V7PA 1KCXA 3IGHX 3WMLA 1KRBC 3E2VA 3E38A 3IRSA 4OFCA 4QROA 4EPEC 4HK7A 3OOQA 4HA0A 2WM1A 4C5ZA 3R0DA 3TN4A 2PUZA 3NEHA 3UR5A 3PBMA 2OGJA 2VR2A 1FWAC 4C65A 1P6CA 3FEQA 4KQNA 1EYWA 4EPDC 3LSBA 4IG2B 2E25A 4CQDA 3IJ6A 3T1GA 4HK5A 4GC3A 3E3HA 4D8LA 3FDKA 2O4MA 2Q09A 4BKNA 2BB0A 1FWDC 1FKXA 2Z29A 4KEZA 4C6MA 2I5GA 3MVIA 2OQLA 4L6DA 2WJDA 3A3XA 4IFKA 2QS8A 3TN3A 4ERAA 4ICMA 3CJPA 4DLMA 3IV8A 2XIOA 4QRNA 1XRTA 1EF2A 3GTXA 2O4QA 2BGNE 1NDZA 1NFGA 3E0FA 1ITQA 4H01A 3DUGA 1EJXC 2Z7GA 4GY7A 1XRFA 3SO7A 4ERIA 2YZ5A 2F6KA 1EJVC 3K2GA 1V7AA 2PGRA 4DI8A 3QY7A 4G7EB 4KETA 3PAOA 1P6BA 2FTYA 2W9MA 1GKPA 2Z2AA 4AC7C 1E9YB 1BF6A 2HPMA 3RHGA 3LA4A 3PNUA 3T8LA 5HMFA 2PLMA 3LS9A 1UIPA 4KEUA 4LANA 2YXOA 3MKVA 3MJMA 1K1DA 4J2MA 4C6IA 5FSDC 1ONXA 3SFWA 2FVMA 2PAJA 1KRAC 2VM8A 3RN6A 3S2LA 4I6KA 4EP8C 1E9ZB 3F2DA 2WJFA 3DC8A 2ADAA 4CEUC 1GKRA 4GBDA 4M51A 1HZYA 2R1LA 3BE7A 4RZBA 3LSCA 3LU2A 5FSEC 3EWCA 2R1PA 2R1NA 4P5UA 2Z2BA 2FVKA 1YBQB 3GIPA 1O12A 2HBXA 3ORWA 4I6VA 3UPMA 3O0FA 4EPBC 2YB1A 3GU9A 2Z27A 2I9UA 4IH3A 2E1WA 4LAKA 1EJUC 3LGDA 4NI8A 3ID7A 3S2MA 3OODA 2DVTA 3GTIA 3GUWA 4F0LA 4H9VA 2HNHA 2Z4GA 3GU2A 4XAZA 4DIAA 1EJTC 1RJQA 1J79A 4LCSA 5G4HC 2GSEA 4XD3A 1FWHC 1RAKA 3FDGA 1A5OC 2CZVA 3IACA 5HMEA 4PBEA 4IFOA 3OU8A 3URBA 4IGMA 4ZSUA 4QS6A 3B40A 1FWJC 2GWGA 4IQJA 4RDVA 3QY8A 1FWBC 2HQAA 4RE0A 4GXWA 3WZ0E 1PTAA 1I0DA 1WXYA 4F0RA 1NDYA 1J5SA 4IGNA 4RDYA 4H9YA 2AQVA 4WHBA 4EPKA 4GK8A 4GYFA 3RCMA 4GY1A
chains in the Genus database with same CATH superfamily
3MDWA 4PTNA 3PR2A 2HSAA 4GO9A 3UVIA 4WRHA 5LIXX 2NSOA 3QR3A 1RALA 2OSWA 2RJGA 3LRLA 1UQYA 3BURA 3VKBA 1TQJA 2IPGA 2IKJA 3N6HA 4B3ZA 1W0MA 4PL2A 5C9RA 1U33A 4XTDA 2AL1A 2NX9A 3M64A 2J24A 2G41A 3AJXA 1EZ2A 4RDWA 4R3UA 5D03A 1K9FA 4DI9A 2D3LA 3SIZA 3GIQA 5REQB 1V7YA 4JTKA 3FA4A 4Y7EA 3M41A 4UB9A 1CXLA 4H8HA 2R1MA 5LA1A 2XN2A 1MWOA 2P0OA 3ZYZA 7REQB 4IJCA 4M1RA 3PBGA 1BPLB 1BQGA 3NL2A 1OINA 1LP6A 3VE9A 3LHUA 4Q8PA 4HA1A 4HTYA 3CC1A 4MGGA 4WZHA 3W6LA 3SJNA 2YL6A 1UR2A 2VZOA 3EX6A 3VFLA 1PCKA 5PTDA 3IPWA 3DI1A 1W2VA 4EWJA 2BSLA 3B8UA 5I3JA 4BK9A 3NXFA 3GTNA 1GTEA 1ME9A 4CLMA 1LT8A 3DI0A 4QNWA 3RCYA 1SR0A 5I5RA 1SO3A 4A8LA 3MVTA 3MS8A 5AHEA 4NAFB 1QXLA 3F5LA 3I65A 5D2YA 3GU1A 4NX5A 5CJMA 1BKSA 3PWGA 3B4YA 1E6NA 5GNYA 5CC3A 3S0CA 3WD0A 2DH2A 3BVJA 3GY1A 1QHOA 1F5ZA 2VEFA 1QOPA 2JQXA 2OQHA 3QGVA 1PZ1A 1ICPA 3AISA 2WMFA 1PWMA 4WOQA 2D2GA 3AFBA 1W8SA 3F4CA 2OX4A 9RUBA 1FXQA 1E3XA 2PWFA 3ARWA 1J12A 4GI9A 1VIZA 3KWXA 1KV8A 3RLUA 1XBYA 3LZ5A 3H4GA 1E1EA 1XPYA 1WKDA 3PZTA 3PTMA 1TE1A 1TWZA 5DY3A 3GVVA 2ZIDA 3OB8A 2W5FA 1OF8A 3NR0A 4HPNA 3WG6A 5BXSA 1DWHM 3UZXA 3NQ6A 5TBOA 1KFKA 3DAQA 3W02A 3MDUA 2CEQA 3CL7A 1UZHA 3FNDA 1MEHA 4PUNA 2Y5EA 4Z2KA 1VQTA 3EWUA 1EP3A 4GY0A 1PZ3A 1HJQA 4J9JA 5XINA 3TR9A 2HXUA 2XTKA 4IXHA 6XIAA 5CPQA 9CGTA 5D38A 3VNJA 1C90A 4MWAE 3HFYA 4PRRA 3AIVA 3KTCA 5DBTA 1TUXA 3L2IA 1KFEA 3LDVA 3PZNA 5K4XA 3SCSA 5FAGA 2CLHA 3WKZA 3NURA 3WYZA 4M19A 3DG3A 3MV01 1UD6A 1H1YA 4I7VA 2PFHA 3VZZA 3RUBL 2ZZ3A 4PSRA 4MWAB 3N25A 2J88A 2ZC1A 4YVPA 5K7JA 1GOKA 4FLQA 4DUOA 4ZODA 4MAZA 3WF3A 4FNRA 1XYBA 1UH4A 4DNMA 3WQOA 4PE8A 1TPC1 4CVUA 4NG3A 3DFQA 4LUSB 3JZUA 1M3UA 2FHBA 2YCLB 2V3EA 4GZ7A 3V7PA 1E4MM 3N34A 3LYEA 4HIBA 5BOFA 2BXVA 2PLKA 4B9ZA 1C9DA 1SYTA 3TP4A 3VCCA 4QXIA 3G1VA 3IJ6A 5I23A 1QBAA 1XYMA 3P3BA 1S5TA 4HOWA 3UY8A 4MFEA 4O52A 4TV5A 2C6QA 3VA8A 3WLPA 1XRTA 2GPTA 4UQBA 1E6SM 3ARVA 4K68A 5CSRA 4O1CA 3GKAA 5FCZA 2ZX7A 4ZO7A 5LNSA 5HPCA 3OQ8A 3TCSA 2V69A 2FTYA 3VUPA 4GINA 2DZWA 1RY0A 4J3TA 2CLMA 4ZVJA 2EPKX 3HZ3A 4B3KA 1GK8A 2YBTA 3GDTA 1W3TA 2VM8A 5A8GA 1X6UA 3EWBX 2X42A 3C6CA 4A3UA 4HB7A 4JHMA 3F2DA 1E4LA 3H6OA 1J0HA 1P4CA 4HN4A 4ZQRA 3ARXA 1VENA 4J2PA 2YPIA 4ADUA 1AUSL 2WANA 3QSTA 4QEEA 3EWCA 3VFCA 1VPQA 5D9MA 1VD6A 1ZJBA 4IH3A 2E1WA 5SWUA 3UCDA 2RDXA 5DELA 3MZNA 3MKCA 2VGIA 3GTIA 4GIRA 1CGWA 5L9FA 4HA4A 1Q6OA 4XAZA 2DH3A 3BAWA 1XLHA 5AVNA 1RAKA 2ZRVA 3J7HA 4BZYA 1XUZA 3W88A 1B3OA 5DMMA 4KEMA 5AYZA 4RDVA 2NXHA 1WPCA 2OO6A 5M2FX 4RE0A 1AQFA 2V5BA 4GUGA 1I0DA 3IJIA 1C7SA 4MTVA 5E6YA 2VFIA 1R2RA 3ARZA 2TRSA 4DN1A 3PJUA 3B0VC 3LBMA 4HZ8A 1QVBA 3ITGA 2QUUA 4GY1A 1H7NA 2DJLA 1XLLA 2B81A 5G4WA 2AKMA 3BWWA 1UP3A 2VRJA 3VNZA 1TTIA 1EFZA 4LBUA 3IWPA 1XYCA 4NYYA 3TYAA 3PFMA 3IGSA 3RNDA 2CHOA 1IXNA 1TCMA 4ZSTA 3U7VA 3UCQA 1XG3A 2D23A 5HWMA 2PDYA 2A1YA 3M47A 1LM1A 1Z44A 4Y9AA 4KFPA 4HTBA 3NZRA 1OCNA 2E6FA 3P8IA 5G2IA 3IRDA 1UR3M 2EGZA 2I5QA 5C2GA 4C6BA 1DORA 4NJIA 2I56A 1UWQA 4JQ2A 1IT8A 2ZCGA 1K9DA 3P74A 4XZNX 3KEHA 1TVPA 1E51A 4J27A 2DIEA 4PB3A 1NDWA 1XBZA 5I06A 3GIYA 1EGVA 4KFOA 4O19A 3BTNA 6REQB 4RXGA 5HJLA 3CZLA 1LT7A 4L9XA 4ZR8A 1E0XA 2POTA 3EB2A 4HPGA 2OEKA 2YR1A 5C70A 3K1DA 2OYMA 4LRTA 4M6VA 1PO9A 1V0MA 1SR9A 1JPKA 2FFIA 2VD9A 1OF6A 1FHDA 2Y5SA 3OZOA 2VOMA 4UFKA 4O15A 2X7VA 2QCFA 4D6CA 4MY1A 4GVGA 4GYJA 1PIIA 3WLJA 4Z08A 5CSSA 1EDTA 1T0OA 1M41A 3H24A 1L8PA 4S3BA 1M7JA 3NOEA 1S5WA 1MSSA 1QATA 2QEZA 2YKKA 5ABFA 3M0ZA 3W7CA 3WIJA 4UCGA 3UGRA 3VAVA 4B5NA 2YDSA 3H12A 1XUUA 3VVGA 1IEVA 1O5QA 3UYIA 1GQIA 4I9MA 1IE7C 1XIFA 3BPWA 1GG1A 3CIWA 4PCPA 3VKDA 3IGXA 2ISVA 4ZBCA 2EG6A 5I3DA 1PJ9A 2DIKA 4GVIA 2WV8A 4EXAA 2CLEA 3S5NA 5LNRA 3NM1A 2YBVA 2OZTA 3ECQA 4DBDA 1H7WA 3QW4B 4PEKA 4XIMA 2PD9A 2X0HA 4AZIA 1PL9A 4R7OA 3LCXA 3ANUA 5ABHA 4ORIA 2VR4A 4F48A 3WDHA 3PBWA 3CQJA 5BMWA 1ICQA 1QWKA 3QR1A 3SUWA 3NCOA 2J62A 4HJWA 3NEVA 8CGTA 1V6XA 3R79A 3B8WA 4TX8A 1HJXA 4P7OA 1YQ2A 4XAPA 3JZEA 2HS6A 1GOXA 3MA8A 1YMYA 4Q8MA 3AOFA 2ISSA 4LV9A 4GIAA 3PF3A 3VO0A 1GCYA 2O9TA 1Q3NA 3COTA 2Z0IA 1QPRA 2HWGA 3PNZA 4UQCA 4WOZA 3CT7A 1N7KA 1R3YA 1WP6A 3O8AA 5C54A 3ARUA 4RDZA 3AMLA 4N2YA 3OA5A 1IEXA 1O5XA 2I9EA 1ODZA 2RDTA 4W4QA 1F3TA 3MMDA 4DO4A 3B9DA 2JIWA 3MCOA 1WUEA 4PH6A 2E6DA 3M44A 4C5ZA 3T44A 3AXHA 2FQIA 4AF0B 1RQHA 3UR5A 3SEPA 1QI5A 3TQ0A 1TPDA 4GYKA 2ZUMA 1JR1A 3WMSA 1JNDA 1X1NA 3FDKA 3HIJA 3D5HA 2FPYA 3GH7A 1ISWA 2Y63A 2OT0A 2QV4A 2GSHA 4M29A 1JI1A 5DQPA 4CU6A 2P76A 1TX2A 4ERAA 4DRSA 4GQQA 2A2IA 3B8DA 2DSWA 2PTYA 1LQAA 2CERA 2A3CA 3W70A 4ZOBA 3VPLA 1M7PA 1AMYA 4KCTA 3TROA 3VCNA 3CK5A 1VS1A 3NQAA 2NUWA 5T8GA 3HF3A 4LVDA 5BMXA 4ZENA 4C1KA 2XINA 1J93A 1M01A 1Y5VA 1MQPA 2J47A 4ZXLA 3FOKA 3V0UA 1XGZA 4TVUA 3CV6A 3KRUA 4WDXA 5FSDC 1JF5A 1DBTA 4ML4A 3SFWA 1U1HA 4LGXA 3SN0A 1L6WA 3C3NA 2ZRUA 3MZ2A 1DJWA 2XIQA 3CUFA 2WNNA 3HPFA 1XSKA 4JTHA 4O4WA 4IPNB 3O3RA 4N42A 1NWTA 2VZSA 1TX0A 1VBHA 2BY1A 4RZBA 1IV8A 5A94A 1EUNA 2Z1BA 5KSWA 1UOZA 2E9LA 3GIPA 1FWNA 5DANA 1WZAA 4UTIA 4U33A 4LNYA 2WPGA 3WUBA 1EJUC 4NI8A 3SRKA 3P80A 3OLIA 2NXGA 1UR1A 4AHOA 1EA0A 3PJXA 4H9VA 3SJ3A 1KQYA 3R4IA 4A21A 1NFPA 1ZBKA 2WVTA 1AMKA 4XZHA 1K7XA 1QU4A 3BJTA 1MQRA 3QKZA 3OU8A 4N9EA 1M1BA 1TJRA 1OSEA 4PRWA 4OE7A 1QW9A 4JIQA 4PUUA 1HF6A 4WDWA 3ARYA 4NKCA 1NELA 3CAVA 1TJ1A 4QCFA 4A35A 4ATWA 4JYEA 3S6DA 2NT0A 3IS4A 2O7QA 1QR7A 2DZVA 3RYSA 2XFFA 3TW7A 2VFHA 3KLLA 5HNNA 5AC8A 2DZBA 4PCSA 1MUWA 3O6AA 1D7KA 4K1WA 3R94A 4WIWA 2ALDA 3BICA 1FWSA 3VI2A 1QUMA 2CZDA 1BYAA 1C8YA 1K6WA 3TYBA 1VKFA 1VPXA 2YLLA 3TC7A 3WFAA 3CIVA 2WC7A 2DPEA 2QQ6A 1JUBA 3UWEA 5KZ6A 1JZ5A 1R8LA 2BFGA 4UZUA 1JPDX 5FF3A 4XBKA 3VNDA 3IIPA 4DZHA 2VQUA 1OABA 2V30A 3K30A 2BBFA 3MO7A 3WD1A 1ALDA 1F2JA 4NVTA 3T0AA 3LXCA 3PWIA 2P50A 1ADOA 1J11A 4GJIA 2BS9A 5CAKA 4LYRA 2BY2A 1N55A 5F2GA 2VWSA 1LRTA 2I7GA 5K9DA 5AKQA 3R8GA 1EJ7L 3TYZA 3BLDA 4AX7A 4ZQPA 2GJXA 3CHVA 3V0SA 2OWXA 5HA7A 2WHLA 4MHBA 2OQYA 4H7CA 2CLPA 4Q8OA 2GK1B 2VHLA 4DXKA 3GO2A 4O0QA 2VVNA 4CKQA 4JYFA 3RG6A 4PCNA 3W07A 1LBMA 3A4JA 3G1SA 1F9CA 2X30A 4XISA 3R0UA 1SO4A 2QVNA 1JPMA 3W7QA 3QHMA 1RLDA 3WQPA 1C8XA 1B4KA 1VYPX 1Z6KA 2WWCA 5A5WA 2OKTA 3DENA 2Y88A 4JICA 4DXXA 5I79A 2ISFA 2W92A 1IXPA 1TPB1 3OYZA 1A5AA 4IQLA 1Z41A 2NVAA 5EMUA 4N6EA 4HHPA 2R91A 4BI5A 1OBAA 1XYFA 3TA6A 3STEA 3USBA 1OFBA 4FNTA 2XHYA 4BWLC 3C0QA 1HO4A 5G5IA 3K5XA 3BUVA 1OWQA 2PDWA 2CC0A 3UR2A 1W1PA 3GG7A 3LQLA 3SCQA 1HJSA 4JTRA 1DVJA 4FP1A 4JQAA 3EEZA 1TRIA 2XWDA 3N3TA 4NL1A 1BWVA 5JXQA 5HWNA 4I8YA 1YLVA 4XIAA 5F2IA 3AU2A 2EAWA 3IUIA 4XKYA 2PWDA 1R7OA 3E74A 1OCQA 2B31A 4QITA 4OV4A 1QPKA 3TYDA 5H8UA 1TB3A 3FXYA 4CQAA 1JZ8A 1DXEA 2V5KA 4G1KA 2ALRA 2XVGA 1EWEA 4ZQCA 1I60A 4YMZA 4B90A 1UKPA 4JFVA 3E12A 4FAMA 1S1RA 1XINA 4YJ5A 3OQEA 3LXAA 4E2DA 4Q7BA 1ECQA 1QI3A 2YW3A 1RBOB 3ATZA 3WLMA 3AXIA 4JTTA 4YHEA 1ZAIA 4JX5A 3LCGA 2WMJA 4RV3A 1TPVA 1H50A 1TREA 3CQIA 3G3MA 1V02A 3E38A 1K9EA 2GVLA 4HA0A 1RVKA 1PVNA 3IIXA 4Q4SA 3QPYA 4UR8A 1E1CB 4C7GA 3SQSA 3THUA 1P6CA 3QC3A 2C8NA 2ZA1A 3QSRA 5FL0A 2WLYA 4K38A 3KDNA 4OGZA 1YXCA 1J0KA 3KVLA 2WZEA 1PYMA 3I3BA 7A3HA 2B7PA 1QK2A 3VD7A 2QS8A 2BTMA 1O4UA 2J78A 3ABXA 1FDZA 1TELA 2GUBA 1JJKA 4XTIA 1AG1O 1HN1A 2A0NA 3KL0A 5HULA 4AF0A 2HRWA 2PSNA 3RPMA 2VGBA 1BG4A 1OFAA 3E0FA 1ITQA 2PRHA 1EJXC 3WNNA 1P0EA 1LOSA 3GW0A 3H53A 1DTUA 2PGRA 2GQ8A 1X7FA 1VH7A 1B1YA 4EAYA 4IQEA 1G6CA 3IJQA 3GH4A 1BF6A 1QI0A 4ENLA 2MNRA 2OYLA 1RP8A 4L9YA 4DM1A 4NRSA 4IOTA 3EWZA 1OHLA 1XLDA 2PD5A 3P60A 4LS2A 3KOYA 3JR2A 1JDDA 2OLAA 1Q5MA 5AHIA 3GFZA 3QQWA 6TAAA 1EZWA 3AIUA 4GNKB 2R9RA 3A64A 5LA2A 5M17A 5GPRA 1RD6A 5D9NA 3QBUA 4D8AA 3B04A 2TPSA 4J4KA 2EPHA 3CZEA 2Z27A 2DT2A 3ID7A 1E5NA 1R87A 2X40A 4X2RA 2WSQA 2QR6A 6XIMA 3CL8A 2HISA 5BYWA 1DJYA 1Y0EA 4RNJA 2IPWA 3W84A 1J79A 1FWHC 3S8HA 2J4GA 4M7SA 3S42A 2W67A 3GDMA 1W5NA 4W88A 1VAHA 4ZE4A 2QUVA 5TF0A 1Q7MA 1GPFA 3WH9A 5BCAA 1F07A 1NDYA 2O56A 2Y4SA 1FHVA 1W56A 3L4YA 4RW3A 3LMZA 3NQFA 3GZAA 1V3MA 4PUWA 2VX4A 3UETA 1M7OA 4HMNA 3FCPA 1TR1A 4CUCA 1TWDA 3EOOA 1TTJA 3LM7A 4D6EA 1KKOA 3BMXA 7ENLA 1I2RA 3SY1A 1E73M 1DWAM 3W87A 3WUEA 2QNEA 9XIAA 1P7TB 3KOWA 1A5CA 4GX8A 4DELA 4QJ5B 3PB2A 1RBAA 4GNJA 1YDVA 5C6MA 4C6QA 1E55A 3FIGA 1ZLPA 3WFLA 3C0LA 1PB0A 1QO5A 4ZFMA 1E71M 3CEPA 3KBSA 2VL4A 3B3DA 3ZS4A 4YWSA 3DECA 4RLIA 2HS8A 1F8IA 4CD5A 2FVLA 4I5UA 3THAA 2Z26A 1OJXA 3I3EA 2Q8XA 4BY3A 3CT2A 3TH6A 3V5OA 4XBSA 1B5TA 1UZ4A 3ES7A 2VC5A 4AVNA 1ZPTA 4A8RA 1LL4A 4QISA 2OB3A 2QDGA 2Z1KA 1XYLA 3S47A 3UCCA 4ZO8A 2VGGA 3IK2A 5BXPA 4EOUA 4M6UA 4DAIA 2XPKA 2FLIA 1J0ZA 3AMCA 3FN9A 1ZCCA 3U4AA 2EPMX 3H26A 5A3HA 3PZMA 4AW7A 2FGZA 4KMQA 1DQUA 2QMKA 1WKFA 1XLGA 4BJHA 3BARA 5H91A 3GYCA 1Y65A 1ZFJA 3ZR4A 1ECEA 3FKRA 4ACZB 3N2OA 2VJXA 3ENLA 1XYZA 2WNWA 1VB9A 4AMAA 3UXLA 4RZ4A 1Q2RA 4UXDA 1KTCA 4DY1A 1NARA 4P7NA 2VX7A 3JW7A 1DV7A 3W7LA 4PCTA 4F66A 2OTDA 2CBUA 1DWGM 1KM6A 4DO5A 3BV4A 5CZJA 3WUGA 2Z6JA 4C6CA 3WQWA 1WNOA 4JTAA 4GXMA 3DYPA 1OGBA 1B0IA 3R5EA 3LENA 4O12A 3UWUA 4FIRA 3W23A 2VRQA 3UF9A 1RP9A 1H3GA 4FXFA 2A3AA 3NGFA 4MADA 1KCZA 3OZMA 3SRFA 1XH2A 1KRMA 4WXZA 2PF8A 3M5XA 2QDEA 3S9YA 1EJRC 1U5VA 2Z1WA 5FAJA 2XFRA 1XH1A 3VIPA 4NRRA 5LIUX 5AC6A 4N4PA 3FV9A 1AQHA 1FWCC 3VDCA 3WH6A 4C6KA 4XZMX 4HNUA 5FF2A 3PS7A 1HW6A 2Z1SA 4FA3A 4IP4A 3BZJA 2ZX9A 3QV7A 5BU6A 1K4GA 1SU5A 1PHQA 3ZO9A 1FFQA 5HQMA 4KIRA 3OJGA 3Q37A 1HG3A 4S3AA 1SZGA 4OUEA 2LLEA 4Z1YA 4LUYA 3W2LA 4US6A 3HV9A 1UD8A 4YTTA 3QMRA 2BHUA 4GH1A 4KW2A 2BY3A 1SJBA 2P53A 2AQWA 4Q4MA 1H7PA 1WO2A 4JIRA 1V08A 4ATDA 3IVTA 1U22A 2DJXA 4O10A 1NQ6A 4K7VA 1HP4A 4GQ0A 3GB6A 3NQDA 3V75A 4EPDC 3N6QA 3HN3A 1FFRA 4IG2B 2ZUUA 4CQDA 3E3HA 2NT1A 4KFNA 1KGXA 3HG4A 4AD0A 1TZ9A 1UD4A 1QNSA 4TX6A 1EDQA 3L0GA 3WDRA 1OD0A 4IPJA 2ZXAA 1LF1A 4P8VA 3TQPA 2TYSA 5EMJA 3KVMA 1NFGA 3A5FA 3GAYA 3FHQA 3OGSA 3VNYA 3STGA 2DSZA 5JUVA 3CV2A 2PWUA 3LBOA 1VCGA 3GK0A 4UFMA 3BMVA 1KCLA 4RKAA 3STCA 3ERPA 3LUTA 4U2ZA 4PTDA 3GM8A 4KEUA 4XV0A 3PULA 3RPDA 2YXOA 1XC4A 1J01A 5J8LA 4BR1A 3L7RA 1S1PA 1OGSA 2BY0A 1NF0A 1ZALA 1WOAA 3MI2A 3BW3A 4JGDA 2HK0A 5HINA 4O11A 1G01A 4LTSA 2JBMA 4HPJA 5G2WA 3AZRA 5IXEA 5FJOA 3B4UA 4B5SA 3IIOA 3UR8A 3OTRA 5IHRA 3LSCA 3OHIA 2R1PA 1EGMA 2HE8A 1NWSA 4X22A 3PAJA 1XL9A 3S46A 3W83A 1TQXA 2DT3A 4IHCA 3SCTA 2QF7A 4MG4A 2XIMA 4Y2WA 3KW3A 1XKJA 1EJTC 5T9CE 5LIWX 3R10A 2EF9A 3FDGA 4AISA 2C71A 3T55A 3V18A 1FWJC 1PX4A 2QIIA 2HQAA 1UG6A 4GXWA 2DUXA 4YLWA 2VC9A 3UW6A 4AZCA 4DJEC 4FXRA 3HFTA 1VBJA 2YOCA 4PN2A 1KBJA 4MB4A 1V6YA 4PL1A 3U4FA 3AU6A 4CQ8A 2WO5A 3RK8A 2YCKX 1JCMP 4ZB5A 4FF5A 3AO0A 5KETA 5CG0A 1NOWA 2MUCA 1Q66A 3WJXA 3LCLA 2VUNA 4YYCA 1GVSA 2JGQA 3DHPA 1HUVA 4DB7A 1KXHA 3TSDA 1ONEA 2P1FA 2WNQA 1FWIC 2KX9A 3KOZA 4J35A 2ZZ2A 3WK2A 1YADA 3K4WA 4N6FA 2ZDRA 3AUOA 1RY8A 4JPGA 1MW2A 1DQWA 5E09A 3W2JA 2PDIA 1WDPA 1LRQA 1ZP3A 1KO0A 5I3HA 1K4HA 3DBNA 2I17A 4GIEA 3A9BA 2OLSA 2PDHA 4RK8A 5GQBA 4IF2A 3RF9A 4F0SA 3BL3A 3B9NA 5D04C 3URQA 3NPUA 1DQXA 2RHGA 3G8RA 3U8GA 1CLXA 2WMIA 1EHNA 2IUZA 1BQCA 4G9PA 2V82A 5JBFA 2UWFA 7CGTA 2QXWA 2R82A 3QOMA 4I9JA 1DL3A 4UR7A 1XH0A 5M1TA 2AGKA 5HBFA 2TAAA 2ZUVA 3KBNA 2J75A 4A3HA 4AMCA 3PG9A 4AIUA 3P62A 1NVMA 3U9IA 3CAQA 3LRMA 1X8FA 1KTNA 3CZKA 1R3TA 4MJ2A 2EPLX 3REQA 4LYKA 2ZZ4A 1UKTA 4IIGA 5EGRA 1C7TA 2HPIA 3E96A 3A6OA 4JXCA 1GWJA 2EO7A 2G3MA 1Q8AA 4AZ6A 4PTXA 3L4ZA 4REQB 3CUGA 4O16A 4MAVA 3C2OA 3FSTA 4XZ9A 1RHCA 2NUXA 3VU2A 1NEYA 2PURA 3VUSA 1EIBA 4C60A 4NJHA 1W1IE 4R7WA 4JTQA 4LF1A 3T42A 3T09A 3C8NA 2F61A 1W9PA 4B9YA 3W1TA 3C52A 1F6KA 5E0CA 3CHDA 3EX3A 3QQ1A 4DYKA 5HATA 4LSBA 3WLOA 2OOFA 4C6DA 1FVPA 1S38A 1G69A 3GVWA 2ISWA 3LOTA 4E2BA 3T4CA 3ARRA 3LY0A 1CGYA 3B0XA 1OY0A 1RPKA 5I6SA 3IIZA 3ARQA 4IJRA 3GYEA 4FX8A 4JTSA 2GVGA 1Q7QA 3SBFA 3VNIA 2VXNA 1ZCOA 1KFCA 1R3QA 1JXKA 4H2HA 4N7QA 4WSKA 1R86A 5I03A 3UEQA 2CYGA 2QCHA 4UTTC 3NVTA 3WQGA 4LUJA 3E2QA 2YIHA 3K46A 4LVBA 5I02A 1LUCA 3H2OA 4IWWA 4BHYA 3L68A 3H70A 4L6HA 4XX6A 3WLLA 3D47A 3U48A 5I3IA 4QS5A 2W91A 3E0LA 3QY6A 3MUIA 4NJGA 3W1AA 1R3WA 1UD5A 1L0PA 1ZU8A 4FEZA 1UASA 4EACA 4LCRA 1XGEA 3N19B 1LOLA 3IVUA 2Q3RA 3LGGA 3RU6A 2GVJA 4HA3A 2EHHA 3CUZA 3PBUA 2VX6A 1YTEA 2OKOA 2RJHA 2VD8A 4QG8A 1M53A 1XM3A 3HPXA 4LW7A 5E0KA 4AB4A 3ONBA 4WCJA 3TN4A 4NNCA 1XIIA 1QHZA 1J0IA 3U2CA 1HGYA 4ZOEA 3HJEA 3WQFA 1MRAA 2O4MA 5U4NA 4EAMA 1V3IA 4GUJA 3W7NA 3MYPA 1UP2A 4IPIA 3ZIZA 3RPTA 3TUUA 3EWXA 4A6GA 8XIAA 3M5ZA 2YXGA 2ZZ7A 3LB0A 3T9PA 3VINA 2Q8LA 1AQMA 4AEOA 5CZ0A 3FGCB 2HXTA 3EDKA 3NO5A 5KITA 2B4GA 1ZBCA 3AI0A 4H01A 3SIMA 1YKWA 2Z7GA 5GJMA 3FW6A 4MDPA 2C1GA 1FH9A 3ZJ6A 2BHZA 3N17A 3TTOA 5A6AA 3BLLA 4ZQMA 4GACA 4PMXA 3LG3A 4E5TA 3NQ2A 1UJPA 1Z9AA 4QG6A 2PGWA 3S1XA 4LB4A 1ZY9A 1EGZA 2BG5A 1RV8A 4NZ4A 3AALA 1IWAA 4BWLA 3MKVA 4MDOA 1YTDA 1V3HA 1CGVA 2QUMA 2Y0FA 1YNPA 1OIMA 1M6JA 1RSCA 1ISXA 3P93A 3HGJA 2ZDSA 1BHGA 1U5JA 1W1A1 5AHMA 2ZOXA 3M7SA 1BLIA 1Q13A 4I3GA 1Q63A 1A0EA 1KC7A 4UQAA 1B3ZA 4GBDA 2C1HA 5ECVA 3T05A 5FSEC 3U0HA 4LAKA 4XO6A 4I90A 3VDGA 1WOBA 4AVFA 5DXYA 3TYEA 2GJPA 4DYJA 4FX6M 4F0LA 4QLKA 1G5AA 1WZLA 5IOBA 4DIAA 1WAWA 1GTHA 4ROPA 1J4EA 3WK0A 1SZEA 4XD3A 1EF3A 1J18A 5DMLA 5GNXA 4ZSUA 1DXIA 3USZA 3W0KA 1DHKA 2F84A 3TMQA 4V2XA 3HOJA 3N9RA 1BRLB 2PPGA 4YXGA 1WDQA 1J5TA 2WKJA 4IMGA 1AH0A 3N18A 2OXNA 3RMJA 3NSMA 2QJJA 1NH6A 3RCMA 1MXGA 3FKKA 3S2CA 1BWLA 3D3AA 4HGXA 3SCOA 4O8RA 4J40A 3CH9A 3W7KA 2ZTKA 1I1WA 4RW5A 4MZYA 5LXXA 1SO6A 1E9IA 2V6AA 4R88A 4PTMA 1WZMA 3KTXA 3OVQA 3E9AA 1BAGA 4JIEA 3SM0A 1WAUA 5E70A 4QNEA 3W28A 3RO6A 4AVOA 2DVUA 2CZEA 1B31A 2W61A 3BCFA 3R12A 1TUFA 3PPCA 3BLIA 3I6TA 3ABRA 3CNYA 2WWDA 3C56A 3ZLHA 5DMNA 3B8SA 4M6PA 5JBDA 4M0XA 2GFTA 1E0UA 1VHNA 4GNVA 1H41A 1DIKA 4FB7A 4LT9A 5DCDA 2PWVA 3G1FA 3M0YA 4P61A 3AWNA 4JDYA 3KZSA 3ZFHA 3MUY1 3V1PA 2L5HA 4JQ3A 4IMDA 1F3XA 1ICSA 5D05A 3BANA 3C86A 2E09A 3HPSA 2OWWA 5A8NA 4GZEA 2GJLA 3MBDA 4NSBA 4IPPA 1U1UA 1PZ0A 1V3JA 4PTVA 3CS2A 2VQTA 3EXSA 3GXDA 3RX3A 4QE5A 4ATLA 3BAIA 1GVYA 2ZKMX 3DG6A 3MWAA 1R7AA 1VJZA 3B03A 5IHSA 5H8MA 1UMLA 4QJ3B 1P0KA 4AG0A 2YFNA 1YBQA 2V67A 3LLXA 4MYAA 4BI6A 1GJPA 4PRTA 2J9YA 4LAUA 1ONRA 1BVNP 3KRSA 3VM5A 3VIMA 4K7YA 3HGOA 3RIKA 3AXMA 1R9ZA 4XVEA 3LQGA 4J28A 1XFCA 4U28A 1V0LA 5A1AA 4BFAA 1QW7A 1WBHA 4F2UA 1YX1A 1LL6A 1XXXA 1K8CA 1ONWA 4IT1A 3F5KA 1JZ3A 5BW6A 3FX4A 1F6PA 3KRZA 1UUOA 1G0CA 1O1ZA 1POJA 3CMGA 1BXCA 5U7SA 4S3JA 1XLCA 1LG2A 3H7UA 3I68A 1H0IA 1OFOA 1H5YA 1W6TA 3VKCA 5LZLA 2OWCA 1FDJA 2PZ0A 3MUAA 3AMDA 3DOPA 3G0UA 3W76A 3BW2A 3EMCA 3KP1A 4AEFA 3HTWA 5F2MA 5J04A 3M0VA 1AW2A 2GWNA 4K36A 2YW4A 2QF8A 1TV5A 1W5OA 3UXKA 2NX3A 1OG6A 5AECA 3C2YA 3AZSA 3W6YA 4ERGA 1E15A 3IARA 2XZ9A 3E1F1 5LA0A 2NQZA 4K8HA 1JIBA 1FDYA 2Z28A 3GBEA 1YW1A 4LALA 4LYPA 2YL5A 4GQRA 3UGVA 3W81A 3DFTA 3ICJA 3QR0A 1H4PA 4M6QA 4UTLA 4E4FA 1E0VA 3GAKA 1J8VA 3WLHA 4A4AA 4B92A 5G1TA 2IKHA 1B3WA 7TAAA 3HMCA 3OOQA 2F7FA 3L5AA 3ZMRA 1IHIA 4EKJA 3TE9A 3ALFA 3FEQA 4KQNA 3THDA 3ZR5A 1TPH1 4QM1A 4FLSA 4NNBA 4AH7A 4BKNA 4RJEA 4IP5A 3V1HA 4H7VA 3W1PA 2PP1A 2OQLA 2O55A 2XSBA 1ML1A 4PMRA 4C1NA 1P6WA 4UFIA 3NJ3A 4HHMA 4DWSD 2WVVA 4WGHA 3IUDA 4J3UA 1JFXA 1W1TA 4W8BA 3TCEA 1MRQA 4GKTA 4W7UA 4WY0A 1MZRA 3OO2A 2J9XA 4DXVA 3QY7A 3AMKA 4HSOA 2W9MA 2CKSA 2E5BA 3TJLA 1F4AA 4JFSA 4MMWA 5HMFA 2PLMA 3DHUA 4JEQA 4AD3A 3WNMA 4EXBA 2WNZA 5D2VA 1Z48A 2AAMA 3HBLA 4YVVA 2OVLA 3ALGA 3QRHA 2J8TA 3WH8A 4O0ZA 2C0HA 5A8MA 3LV6A 1JZ7A 1WKEA 5IDIA 1CYGA 3M9YA 2ADAA 1KXVA 4GBUA 4LAZA 1BGGA 3BE7A 3W1LA 3RJYA 6A3HA 3GH5A 1RBLA 3VX0A 4JYDA 1THFD 4X2PA 3LGDA 2PC4A 1IXOA 1Z7AA 4NZFA 4KGJA 1NAL1 2XGZA 1JPHA 1UYQA 2Z4GA 2F38A 1OK4A 4Q8NA 4GI4A 1PHWA 4HYVA 3IACA 2CITA 1R30A 1OZMA 5D32A 1HT6A 3CPRA 4EWND 2JFEX 4IX2A 1PTAA 1Q6EA 1WUFA 2BASA 1WXYA 3KBWA 3MMWA 2VCCA 1J5SA 4BF5A 1W3KA 3SR7A 1FWTA 3PZGA 1EB3A 2IXUA 1E3ZA 1EC7A 3EWWA 4JTCA 4AD2A 2PTXA 3EDFA 2A3LA 1YRRA 4NNAA 3WD3A 4CQBA 4C7FA 1QK0A 3ZT6A 5HOSA 2CBVA 2GYIA 3NPWA 2W63A 1BRLA 3W72A 4J7RA 2WKGA 3KAOA 1JGIA 4KWVA 2GDUA 1UKSA 4WQ6A 1NTHA 1OFDA 3L0KA 5BRQA 3RMEA 3AYRA 3M07A 3VGGA 1JFHA 4GI6A 4HMEA 3EA2A 3EOLA 1EYEA 2YLAA 3G2GA 4QHRA 2PB1A 3GQYA 3WENA 1KCKA 1B30A 3TX9A 3WELA 3TSMA 1CI1A 3DESA 1XRVA 4G7EA 4M82A 3QFEA 3Q2DA 2V38A 2GVEA 1KM1A 2B7OA 3B8TA 2YZRA 4D6GA 1LQ0A 2DUAA 3AXXA 4PUEA 3RR1A 1NY1A 1B9BA 3A21A 1O6IA 2VI0A 3KBJA 2D2JA 4LBRA 3LN3A 1CCWB 1GOMA 5AYYA 4W84A 1JCLA 5HMSA 3MHFA 1B3VA 3UZWA 2ACRA 3KHDA 4XD6A 3WN6A 5B7ZA 3BV7A 1MNZA 4DZ5A 2QCCA 3E5PA 1NOFA 1SFTA 3MP4A 1NOUA 4XZBA 5C71A 3SGZA 1PUDA 2ONEA 3NSXA 3NAVA 2JK2A 4AIBA 4G56A 4H83A 1J2WA 3WQEA 3IAQA 3UZ5A 4QSHA 4Q6XA 4NJJA 1A4LA 3QMTA 2KZHA 3MW7A 3OPSA 5I3KA 4TQTA 4DJEA 1E70M 3QQ0A 3VE7A 1BEUA 4CN1A 2YDAA 1W9DM 1XHGA 4HPHA 1YXDA 3G6MA 2J9ZA 3O06A 4HOZA 4HJFA 2O9RA 3GRIA 1V93A 1YNYA 4JAWA 3QVQA 3ZVHA 2DEPA 3EPOA 1LJYA 3T0BA 1H51A 3HPAA 3G1AA 3AWOA 4FXSA 4IMFA 3F7JA 3V36A 4H9MA 1P48A 4AQLA 3T0CA 3L65A 1I8JA 1X97A 2YCIX 3SDOA 4W89A 4UTWC 3NPVA 1HJVA 3LPOA 3S5YA 2I57A 1XBVA 1UHVA 4U31A 3CM4A 2VR5A 4GUHA 3V0TA 2VEPA 3DCPA 4OT7A 3BG5A 3GLCA 4TXEA 2RAGA 3WEZA 4LAMA 4KRZA 3FYYA 1VFLA 1KA9F 3WLKX 2E40A 2UZ9A 5C9WA 3EPNA 3SN4A 3NYDA 3MUZ1 3MCNA 1TVLA 2PWEA 3KM8A 1U5HA 4CD8A 1FWWA 3VD5A 1N2VA 2QCEA 3VGFA 4KS0A 2W4XA 3KCOA 4XZIA 5EBAA 2ZRWA 2Q09A 2XYLA 1CECA 3F1QA 4UC5A 1FKXA 2Z29A 1S3HA 3N29A 2I5GA 2Q02A 5IBXC 3A3XA 1GUVA 5E9XA 3QM3A 1T7LA 2XIOA 3QLLA 2Z2UA 1ISVA 4RXFA 3KZPA 5DCEA 2XVKA 1QPNA 4K37A 3VDHA 1KBBA 4FOJA 2HDJA 4IX0A 1UBSA 2QIWA 1VEMA 4AWTA 3QYSA 3DHDA 4UTUA 3G5EA 2QDHA 4PEEA 1TZ7A 7XIMA 1M03A 2ZADA 3MU7A 2CU0A 2Z2AA 5C7VA 5CPLA 1JUEA 2PE4A 2G97A 3TXZA 4I8DA 2X05A 1GNXA 3EAUA 3CUHA 3SSZA 4F0MA 3GVGA 1K1DA 1ME7A 4D9PA 1SFLA 3FAWA 2PDPA 1D3CA 2VZTA 3HJZA 2NV1A 4KRUA 4DWSC 5T26A 5CEWA 3DC8A 3LEPA 5C8BB 2CXEA 5A6KA 3GNNA 4PC8A 1IIHA 1JYVA 3LTPA 4TVCA 4UTTA 1U83A 4P5UA 2RDUA 3NL6A 3TOPA 5CSYA 5D37A 1L2QA 4M1BA 1S39A 4V15A 2DT0A 2R6OA 5ABFB 1NU5A 2OT1A 2HNHA 2IQ0A 1OFPA 3IGUA 4O54A 3C3UA 3RDKA 2WQPA 3TXVA 4H41A 3PWAA 5I09A 1ISYA 4PMZA 4M8UA 1XIGA 4L6OA 4JCMA 2PMQA 4CU7A 3BAYA 1XICA 2CETA 3QY8A 4YL2A 4B15A 4OV9A 4PMNA 5HQLA 1LBLA 3WZ0E 3KRBA 2BDQA 5EBUA 5CZKA 1GT8A 2CNCA 1DJNA 3QV8A 4H9YA 4LS1A 4DJDD 1JVNA 1PKYA 3VIGA 4EPKA 2WBGA 1CZ1A 3RRAA 8A3HA 1KGWA 4HU3A 1T40A 2NLYA 3W1RA 3SFKA 4QAWA 3GHSA 2VUYA 4L1GA 2GUYA 1K6AA 1H09A 5BZAA 1I4NA 3HV8A 5BRPA 1GW9A 2V0TA 3E0VA 4MM1A 2X1RA 2Y1HA 4QLJA 2ATSA 4D6IA 4GG9A 4WJXA 2DUZA 2VP8A 4KBXA 1XD1A 4CCEA 4MKSA 1S5VA 1KNWA 5RUBA 1REQA 3DX5A 1JRCA 4G2DA 1CB2A 3INPA 3TTEA 4H3DA 1I2NA 4ASTA 1Y7VA 5BWAA 4H9XA 4O53A 3GSMA 1C9WA 1XISA 1IWPA 3DXIA 4GCAA 3O6DA 5EFDA 1PZ2A 3FXGA 1GOWA 3PZVA 2E1DA 4PMDA 5FIPA 2AKZA 3M43A 1KFBA 4WY0F 3TNBA 2D0GA 2YYUA 4O17A 2YFOA 3AROA 1BXBA 1H5VA 1MQQA 2QDDA 4QSFA 1H11A 2YDQA 5M5DA 4X3ZA 2OEJA 1TPUA 5MHBA 2P88A 3TLLA 1GYMA 4PMQA 3SSJA 3TN5A 2WCGA 2INEA 5FEPA 1DWJM 1JXJA 3EX4A 5CJ5A 4ZQNA 5C9ZA 1E6QM 2V68A 3L5LA 4D71A 1KR1A 1GQJA 2XG9A 4L56A 3VIJA 1KFLA 4AD4A 4HSNA 3GR7A 2I5IA 1OEPA 3PZIA 3N2MA 1R3VA 2X2GA 4HOXA 4HNVA 2P8CA 4L4OA 2G0WA 1DE5A 1A5BA 1ADDA 3OEXA 6ENLA 5D8WA 2J7CA 2D3NA 3QJAA 3Q58A 4B5WA 3IJDA 5LYRA 1PV8A 5J5DA 1GEHA 3W25A 3B0PA 1A5MC 4PGLA 3GKFA 2BHYA 1ZAHA 3VKKA 1XG4A 3LRKA 2D73A 2QCNA 4MZ1A 1XIMA 5EU9A 4Q32A 2ZUWA 2ZWYA 1ZJIA 1S46A 1W1ZA 3RR4A 1OT1A 3UERA 3LLDA 2WMGA 2BNJA 1US0A 2PDGA 2WSKA 2PDNA 1MEWA 4GVHA 3T81A 4RNFA 2XU2A 4KCVA 4RE2A 3GNXA 1KM5A 5FA5A 4MWAD 1GJUA 3ABZA 1WE5A 3B8VA 3EOUA 2QW5A 3HURA 4Q8QA 1C8VA 3HQ1A 3W71A 5A95A 2NVCA 4FF7A 4G5DA 4R5EA 4B5TA 4H9UA 4ONVA 3LPPA 3O15A 4HCLA 1R46A 3A12A 1O60A 3W1XA 1F05A 4JN8A 2D22A 2WZIA 3O07A 1UWSA 3H54A 5M3WA 2CBJA 3R13A 1B9ZA 2EKCA 2VCBA 2HMCA 3RM8A 3GHRA 3W7GA 5C2CA 3GR8A 5CQ1A 2FB3A 4O1EA 3LHZA 4JFWA 1TMLA 1R9YA 1JGMA 5I78A 2OZ8A 4R34A 2VRKA 3HGSA 4BCEA 3EOEA 1L2UA 4JFUA 4MB5A 4LBSA 2O92A 1U30A 5CJNA 4YPJA 1PIGA 4C6EA 4B4HA 3CMJA 4WSJA 3WCZA 5CPMA 1MO0A 2VDIA 4HVXA 4Q4KA 1G4SA 2FDMA 2WZHA 3NUKA 5CGQA 3UNDA 3QEZA 1V5XA 1XCXA 2Z6IA 2E68A 3W85A 4J3XA 3AJ7A 3G8EA 2WM1A 1Z69A 1XLAA 2PDLA 3AMGA 7PTDA 3VIHA 2QCGA 3IVSA 4JX6A 4C65A 4F3HA 1P5BA 4B5XA 3F4WA 1VZWA 1MDLA 4GC3A 3WLNA 1Z32X 5B7YA 2Y7GA 3GWQA 5H6HA 2OGYA 4QGCA 4JIPA 3L2MA 4OZOA 1C3FA 3RX4A 1E6RA 2VYOA 3MVIA 3L12A 1IXQA 3L4XA 1FHUA 1Q6CA 4DLMA 2Q8ZA 1O94A 1G4EA 1BSIA 1NDZA 5IFTA 4WJ8A 1MUCA 3DFOA 2IW0A 1UR0A 3LCIA 4E4UA 2NV2A 4KETA 4LJ3A 4F4RA 5KZMA 3L5MA 3BH4A 4E6MA 5FF4A 3PPFA 2CBIA 4NQ1A 4O28A 4XUGA 4MPQA 3EX2A 4MY8A 1Y5XA 3EZ4A 3R7MA 1QRQA 4QQ3A 4FIQA 4L1XA 2XH0A 3N13A 2GJXB 2Q6ZA 1JEZA 1UB3A 2WM0A 1KRAC 3D0CA 1AODA 3SUTA 3IANA 3S2LA 3SY5A 1PKLA 3SN1A 4KT2A 2ACSA 4NAEA 5F4WA 1IYXA 3ZQ9A 1FRBA 4MJ4A 3TYCA 3U57A 4O50A 4O0KA 3L66A 4GE8A 1QASA 2MANA 2W3ZA 5D8ZA 1ME8A 2C79A 2G8ZA 3S2MA 3RILA 4G6CA 1BGAA 3EMQA 1FBAA 1TCDA 4V28A 3NTYA 1Q45A 3HPZA 3CZJA 5D02A 2WMHA 1YEYA 2CZFA 3IJ9A 3S6OA 4PR4A 4W5ZA 1OCJA 2GSEA 3MCMA 5A8PA 5IRPA 4L4MA 4MLJA 4ZGYA 4FLOA 5CXPA 3OIHA 4PYSA 3WD2A 1PDYA 3A5VA 3CB3A 4CNOA 3AYTA 3FYPA 4IGNA 4RDYA 3UWVA 3T2QA 4U3CA 3W6MA 4BQ3A 4IIDA 3GDBA 4Z2JA 4N9CA 1G4TA 2XISA 2VNCA 3G18A 4N0RA 2WYSA 2XVPA 1CXIA 2Z24A 5EKYA 1FOBA 3LCHA 2DP3A 4GC4A 1JCXA 2C16A 1M9HA 2ZXDA 3GG8A 1E72M 3MWCA 5LHFA 3QN3A 2FPVA 5AB3A 3GXTA 3VYLA 1P1MA 1RPXA 4ZCWA 1TG7A 1MMFA 4Q4RA 1CXEA 3WLIA 4JL1A 2ICSA 2FMNA 3AHYA 4RUBA 4QX4A 3SURA 3RLGA 3HQNA 1FUYA 1I45A 2JE8A 5AOUA 1J0YA 4WEVX 5I24A 4XKYB 3F2BA 5FEZA 2RKXA 4ZEPA 4DJDC 3OLGA 3ABSA 3SCUA 1D8WA 3NVDA 3TU9A 3S9IA 3WMBA 1K8ZA 3PBVA 5LNUA 1HKWA 5EY5A 4CD7A 1R47A 1V02E 2V63A 2WSYA 5HUOA 5A8OA 2R14A 3WSUA 4P7LA 1DWFM 3R25A 3TIMA 1R2SA 1BXNA 5KZDA 1ZJHA 3FJNA 1IEWA 8XIMA 1W1VA 4E3VA 5BROA 4DQWA 5LGXA 1Q65A 3BMWA 4HP5A 2VGFA 2REQA 3PANA 3LBCA 1W3LA 4W85A 3UJ2A 4P8XA 3S5OA 3WBYA 1DYSA 3B9EA 3S2JA 4C91A 4HYRA 3LLFA 4Q33A 2PTDA 1HVQA 3VTRA 1U2YA 1ZAJA 1I2OA 4H04A 5EB8A 4NZJA 2DIJA 4C6PA 3F2CA 1XLBA 2WPBA 4O13A 4XWUA 4MUZA 1W3HA 4WKHA 1GGOA 1QTWA 1RLCL 5F4XA 3TFCA 1SJCA 3EX1A 4WX2A 3S1GA 1TIMA 5AHFA 1N8WA 4G1NA 3GG0A 3W53A 3K8LA 1MDRA 4N9BA 1KQZA 1F8MA 1IR1A 3A4AA 4S38A 2VVSA 5HNTA 5LGZA 4CQCA 4MKVA 4ECLA 1UH2A 3N2CA 4Z1BA 3MTWA 2E5DA 4LC6A 4ZOCA 2F6UA 2YL9A 2V2HA 4IP7A 4EVZA 3NZPA 2Y24A 3VK5A 1GKQA 1QPOA 4AY8A 1GVRA 2OFJA 4OUIA 4V27A 3HG3A 3WDJA 2OX1A 1H63A 2E3ZA 1QNPA 4FO4A 1HL9A 3OP2A 4PTWA 1MFUA 4V33A 1NWUA 4JTFA 1A3HA 1VFTA 5D9OA 1JZ2A 3U2EA 1TV4A 4LUTA 2FH6A 4G8TA 3M0JA 3DZ1A 1BTCA 4OU1A 3TSBA 3GTHA 1W5MA 3HB9A 1I9CB 5A6SA 1ZQ5A 3THQA 2X16A 3WBXA 1VEPA 1TV7A 4QBXA 4QIUA 5FF0A 1NF7A 1SMDA 2W66A 4JFTA 4CNNA 3QXBA 1D7FA 2VX5A 2WXDM 3EBVA 2C19A 3HU7A 1O95A 1UZDA 5AYXA 3TC6A 2ZRXA 4L9ZA 3EWDA 4QTGA 4GYPC 2GDQA 3F5JA 1G7VA 2FIQA 5HAOA 2NWSA 4DJFD 4UFLA 4C7DA 3NL3A 4KGLA 4MWAC 1JYWA 1PSCA 4EXQA 1IT7A 5A2CA 2I14A 2H90A 3KP0A 1EP2A 5G1YA 1UR8A 2BOFX 5FEXA 1XLIA 2ASHA 4Q3MA 5DBUA 4JTIA 4GOAA 3BSMA 2DZXA 1VYRA 1XP3A 1NM9A 1ZUAX 3F4NA 1H62A 1HL8A 2QJMA 3ABOA 3IRSA 3CV7A 2G96A 2QZRA 3C8FA 2PGEA 3GVQA 3PBMA 2E0PA 3ZXWA 1UC4A 4IPLA 1UQZA 2X8RA 1V6WA 3CH0A 4F9JA 5IDZA 1WA3A 5C5YA 5I00A 4ALDA 1GOIA 4YS1A 2XSAA 4XK2A 4KEZA 1H1NA 1IF2A 1D8CA 2NX1A 4ZXOA 1XC6A 1GW1A 1QWGA 3R43A 3TN3A 1UD3A 3PY2A 4QDMA 1JULA 4L61A 5HR6A 3Q65A 3AUJA 4JZ5A 2O7SA 2JIEA 4FALA 1CGUA 4A8IA 4JCLA 6ALDA 1BYDA 4DNHA 4GY7A 2CCRA 2YZ5A 2ZVIA 3K2GA 3LI0A 4ORMA 1YNQA 2P5NA 4L80A 1KV5A 1DP0A 3P5ZA 1TIWA 5AY7A 2H9AA 4JHOA 1XKYA 3VNKA 1E9YB 3UU0A 1XQLA 1VC4A 3HQOA 2I1OA 2UY4A 4UNIA 3VMPA 3VNLA 4Q8VA 3NIYA 4JTDA 3NQCA 2O9OA 3K4DA 1XS2A 3MJMA 3APTA 1ONXA 1XLEA 5LNWA 1LCOA 1E0TA 1HKMA 2VTFA 2VCAA 3W74A 1QDSA 5ENLA 3PZUA 1W91A 1ZNNA 1W3JA 3LGEA 1HZYA 3VIFA 2OZ3A 4RZ5A 1QHPA 4R9XA 2H8XA 1KFJA 1W9XA 3ORWA 3O0FA 1P0DA 4JN7A 1XLJA 4UTWA 4Q22A 3AYVA 3PG8A 3E0WA 4FMVA 4H2CA 4ZFCA 1BVWA 4Z2IA 1UUMA 1LOQA 1QBBA 4LCSA 5AC4A 2A21A 3CB8A 3NFUA 2HV5A 4IGMA 1QI2A 4BEQA 1DJIA 2DZAA 4JNMA 1VGAA 2A3BA 4P2VA 2O9PA 2DU2A 5CKSA 3NZGA 4K6AA 4Z1DA 3TQVA 4GYFA 3K13A 2OOGA 3CUJA 2A4AA 3PC0A 2VKZG 2D24A 3C2RA 1Z42A 5HQEA 3BGAA 1XDJA 1ZTVA 3G6LA 4RX0A 4XVDA 2CLIA 2VZUA 2ESCA 3S9ZA 2DT1A 1TPWA 1MNSA 2PLCA 2FDSA 2P10A 4XD4A 4HMCA 3P0XA 3SGUA 1ZJAA 5LHEA 1VFSA 1F76A 3VGHA 2V2CA 2PEVA 1ELSA 2ZC8A 1M68A 1JAKA 1WDDA 2XUCA 4PZVA 2CIPA 5KEZA 2A6LA 2QCDA 3TW6A 4M80A 3W3OA 1CGXA 4DO7A 1PKMA 5BRBA 5IBXA 4H19A 3GBDA 1ZSXA 1P43A 4GZIA 3CEUA 4W86A 4WDTA 3MPGA 5DXXA 4J5NA 1OFQA 2R1KA 2WCAA 1WV2A 4K2SA 1AL7A 5A6JA 3K4AA 3WBAA 1FHLA 1A49A 3ISIX 3T0TA 4CNUA 5G1MA 2Z1VA 3BCJA 3F4DA 2EG8A 4TVDA 4QP0A 2HVMA 1JCNA 3TQKA 1T5AA 1UOKA 4KESA 4GO8A 3A22A 4YTUA 3GXMA 3EXRA 3VXGA 4C6LA 1UJQA 1FP8A 3AICA 4WVXA 5IM51 4FXJA 1WXZA 3BOXA 1FWRA 4DWSA 1WKYA 3DG7A 3NG3A 3ANYA 4IMEA 1S2CA 5H2ZA 4JIHA 1WDRA 4UQ9A 1UWAA 2CWXA 1POKA 3H7VA 3M7WA 3CLMA 1M65A 3GNPA 3VX1A 3G1RA 3FFSA 4C6NA 3E2SA 4X60A 3WQCA 4YCPA 3DU0A 5AHNA 2QGHA 4YNGA 4Q7NA 1JCYA 2A7NA 3CMFA 2YSWA 4AFYA 3L4WA 3CIXA 4S3DA 1FWGC 2ABAA 3ZWSA 4FNPA 3D6NA 5ECUA 3UXIA 3TJIA 3ZM8A 2W62A 4UFHA 3WMCA 1DJXA 3C0SA 1NDVA 5F1UA 5GJPA 2W6RA 1IZJA 1JCJA 1EWDA 2W79A 4S1FA 3E5BA 3VOJA 4JX4A 2FGLA 5I2UA 4H1ZA 2CWNA 1Q4WA 2CLFA 3BK0A 4U5IA 2G5WA 2FHCA 1C29A 3NPXA 1A80A 3GG1A 2BXYA 4M81A 3CWOX 3HGRA 3ARTA 4RL3A 1L6GA 3XIMA 1OC5A 3BLFA 4ADTA 3KWSA 1R5YA 3WLTA 2DZSA 1R2TA 5E0FA 2QMJA 1W1B1 1RH9A 1PS9A 6TIMA 3P8JA 4L65A 4B91A 3W7EA 1OIFA 3FJLA 1HJUA 2YDRA 3UNTA 4E2VA 5CCZA 2VDHA 4DLFA 2FH8A 1B3XA 3LHVA 3CBWA 4HT3A 1LQ2A 3LERA 4JHZA 3WDQA 4MSSA 3FY1A 3BJFA 2GZXA 1O5KA 1XGDA 4GMEA 3WLSA 2OPJA 3U6WA 4DJED 3EGJA 4M3PA 4UNKA 3VC5A 1BF2A 1VJSA 1W9BM 4AZCB 5L6UA 2I16A 2QKFA 3VDBA 3CZ8A 1ZZMA 1XV8A 1ZBWA 2EJ1A 1OVDA 1DOSA 1ESWA 3ITOA 4X0NA 4CEXC 3PK7A 3O6CA 3WK1A 4E3TA 1NSJA 2ZBTA 3BGJA 4U10A 4EPEC 4A29A 1VEOA 3PJTA 4I9TA 3ZJ7A 1JQXA 3STPA 3XISA 2HTMA 2Y61A 2WHJA 1V6TA 2Z7KA 2GL5A 2A85A 3DYOA 3EB4A 2OCZA 3M5YA 5F2LA 1LROA 4Y6GA 3CGTA 3LD5A 4DJFC 1Q8JA 4QJ4B 1UP0A 2QPSA 4XZWA 2XIJA 3R11A 4AZHA 1TA3A 2CKRA 2E67A 3WNLA 1E0WA 4XG1A 4HHHA 3OA3A 3DERA 2XVNA 4QRNA 2J66A 1KGUA 3STFA 2C7FA 1F73A 1B4EA 4FSAA 1SSDA 2HVOA 3SO7A 2XWEA 2FJUB 2E9BA 4QDWA 2YGYA 3DKLA 3WQVA 3RO8A 1XIJA 3PSVA 4Y8FA 1QPQA 3SQMA 1WQ5A 4LC8A 3L4UA 4NZ5A 2VFDA 3GX9A 2WMIB 4W7WA 3QW3A 1OQFA 5TAOA 3O9NA 2WC3A 1EC8A 1ZL1A 3VIKA 3ZR6A 3EDDA 3N15A 1H0GA 2RH9A 4P8WA 4WXYA 3CHFA 2WMKA 3UWQA 1KBKA 3W1UA 1PDZA 1SZNA 3REQB 4UNLA 5CBIA 4GQGA 3UWYA 4AXKA 1O12A 2HBXA 4I6VA 1QOXA 2QAFA 1IR2A 3UG3A 1BVZA 1A53A 6PTDA 4AYGA 1DJZA 4W93A 1T6MA 3PTQA 4CGTA 3BG3A 3AXKA 4Y90A 3QOKA 3NQMA 3W86A 4W87A 1ZBVA 4YHGA 2X1UA 1FTXA 5TQLA 5F4SA 1UWRA 4UOZA 4F0RA 1PWLA 1OT2A 3IUHA 4ZTYA 4D2JA 4M24A 1PPIA 4YCOA 1XI3A 3GC4A 3MSYA 5XIMA 5CBBA 1A5LC 1PIFA 4Z42C 5LSMA 3WBEA 3WJSA 3ITYA 1UD2A 1EA9C 4IGSA 4IJBA 4GH3A 4B16A 3IV3A 3KXQA 1S2WA 1V6UA 3KOFA 2WKLA 3H2MA 3RLVA 3M1ZA 3ONCA 1EL3A 3GTFA 4YYFA 5MKGA 1UA7A 1W37A 4QAIA 1UROA 2ZA2A 2ANUA 4AHPA 3WLQA 1YDOA 4WGXA 2BOEX 3CAKA 1LUCB 2OU4A 4OJYA 1IZKA 1L6YA 3UJSA 2J7BA 2WK2A 1HTIA 5C2XA 4AUBA 4QLLA 2GGJA 3GD6A 4IGHA 1A4MA 1NJJA 3WDIA 1H7XA 1EHAA 2DSUA 4LVGA 2DDXA 3QLDA 3TOYA 4GA8A 3SZ8A 2GOKA 2NVDA 3UZZA 5I3FA 2ZVRA 4LNCA 4LEFA 1YDYA 2CHRA 4PUDA 2OLHA 5FACA 1N8IA 1SO5A 1FCQA 3N4AA 3G1DA 1YPXA 3ARSA 3AIEA 3IJ7A 4KCWA 5D2XA 3ZJKA 4Q8TA 4LF2A 3UPWA 2VELA 1F4HA 5A6TC 4F8XA 1GHSA 4UIOA 3KVJA 3BLOA 4KERA 4S23A 2GJRA 3AC0A 3SY8A 2VDGA 3UJEA 4TUFA 1JDCA 1CB7B 4ADSA 2PGFA 1PTGA 4GISA 5AZ1A 3H7RA 1UA3A 3M5VA 4L4LA 1TMHA 2QHAA 2H3BA 3WK3A 2OODA 1Q2SA 3S2NA 5CAHA 3M0KA 3A3HA 1H1ZA 1LWHA 1AJ0A 2XFYA 1LG1A 1WBJA 2D69A 5HNRA 4BQ5A 4O18A 1CXKA 3MMUA 2Q3OA 3BLEA 3WNPA 5A6MA 1PX3A 1IGWA 3W1QA 2PU0A 3T0DA 1O66A 4F0HA 1YDNA 3LHYA 3FEMA 3VKAA 3MSDA 3EOSA 4DBSA 4JTUA 4RE3A 3WH5A 1R9XA 1JRBA 2TODA 3KX6A 1G4PA 4AAJA 3Q4DA 3SECA 1TSIA 1CDGA 4EK7A 3KS6A 5DN1A 2FTPA 1VIWA 3R8HA 4C90A 1OZQA 3E0IA 2XDFA 3H2FA 4YTRA 2V81A 4H00A 1ENUA 4FHAA 5HANA 4US5A 1Y8BA 4QR6A 3RU8X 1GOOA 3OBEA 4PB5A 4UUIA 5GVJA 1DKWA 5FD0A 2ZE0A 2G4FA 3M4HA 4HMDA 4ILSA 2TMDA 3NQBA 3VZXA 5CLTA 3W2NA 2BZNA 3D46A 4PFMA 5CBJA 4Y96A 5CGTA 3VD4A 4NJKA 1SQ7A 2QJNA 3N14A 1J10A 3NO1A 2RGLA 1A5UA 3WH7A 4CCDA 5REQA 1CGTA 3NWRA 4DJDA 1VRDA 2VZVA 7REQA 4F2BA 3WL0A 4DZIA 4A22A 5I77A 5C9XA 4UMAA 3MUXA 2PZNA 2DW6A 4MJMA 4UTHA 1A5KC 4NXKA 3PPHA 4AYSA 4DF0A 2CFFA 3W7JA 2VEMA 1ITXA 3W37A 1Z3NA 2NQJA 4XAFA 3C2EA 5FJJA 4OECA 1X96A 2D2HA 4FS9A 1MUMA 1PYFA 5JVLA 1IT0A 1GYNA 5CZTA 1K8YA 2HVNA 3W2MA 1GPWA 3IGHX 1GQKA 3P84A 4DO6A 3TC3A 5TIMA 4NAFA 1Q6LA 2DY3A 2PUZA 3LPGA 3U2ZA 1S2AA 2OGJA 4UTJA 1UUQA 1CENA 1EYWA 3UJRA 1LORA 1KFWA 4QJ1A 1RCQA 2V3FA 5LKYA 1E40A 1G7UA 3TVAA 3WF4A 3A4WA 5T91A 5DCBA 2VC6A 2WJDA 4LQ1A 4FI4A 3L21A 4ICMA 5FEWA 1Q7ZA 1UPPA 4FPSA 2OYKA 4PUKA 3WX7A 4GPNA 2V5LA 1LZOA 3G1HA 3N1AA 3C5QA 4ERIA 3HG5A 2FJKA 3C0JA 1T96A 1KM2A 2BP1A 4H6EA 1AJ2A 3AS1A 4AC7C 4PB4A 2E77A 1TWWA 1LWIA 4G7FA 4HU0A 4DYEA 1EH9A 4IM4A 3NDZA 2D2OA 2F8QA 3GXIA 1YPFA 1HKJA 3UG5A 3C2VA 2FVMA 4FX7A 4LRSA 3WEOA 4XSMA 2VMFA 4I6KA 7TIMA 1E9ZB 5B80A 3TJXA 3UXAA 4CEUC 1PE1A 1TTPA 4FR6A 2OMAA 4M51A 3G1YA 3DFSA 4PUMA 3CU2A 2V3DA 3NDYA 1R3RA 1YBQB 4JL2A 1XX1A 5FI8A 5D09A 1DTNA 2ACQA 3GU9A 1A0DA 4IIFA 1AVAA 2Y85A 5I07A 3OBKA 3LMYA 3GU2A 1JCTA 3FAXA 3QYQA 1EBGA 4ZTXA 4GYPA 4AU0A 4PBEA 5DT5A 3CYJA 4MWAA 3B06A 2W0UA 2D0HA 1BD0A 3A9IA 2QLYA 3VZYA 2Y7EA 3TZFA 3OZPA 2PC8A 1X6NA 3ZWTA 4LUSA 1L6SA 5EYWA 2VEGA 1XLMA 2YCLA 2BGQA 3LZ3A 5JU6A 3SRDA 4BF7A 3ITVA 2DFAA 4HD5A 2VFFA 4Q4QA 3T40A 4GXPA 5JH1A 1O7AA 2PWGA 3MBFA 3CLWA 3IJLA 4TMCA 5MF5A 3PFRA 1A3WA 3GXNA 2WW5A 3UA4A 2XN0A 3S5SA 3N3MA 5ABTA 3GS6A 3NOYA 1VP5A 3PTDA 1TJ2A 3SW6A 2ZZ6A 3TFXA 3PZQA 2DW7A 1TV8A 1WB0A 3VIIA 4DAFA 4J1OA 1TYGA 4GI8A 1DIDA 4YIWA 3VOHA 2PDKA 1W3IA 5DEZA 1SZRA 2EJAA 1E56A 4MNMA 1B2YA 4L7ZA 4E8CA 3V5CA 3P5YA 4BA0A 2J8FA 2PDCA 4H4IA 3BCDA 3SQLA 4Y9OA 3SUVA 3M0LA 3V4BA 2RFGA 1VLWA 4HU4A 1DHPA 1W8GA 3U5UA 2X2YA 3B0UX 3GC5A 1OYAA 3ME3A 1AK5A 1CLKA 4XAGA 2WBKA 3LNPA 1GZJA 4MYXA 3VGDA 4GUFA 2Y8KA 3MJYA 2GGHA 2CLKA 3UWWA 3UBPC 1UBPC 3BSHA 3CUIA 3UT0A 3VDAA 4WK9A 1K8XA 3G1XA 4RCXA 3KBVA 1GG0A 3Q94A 3ZLFA 4C1NB 3TTQA 1LBFA 5KTLA 1OADA 1S5MA 1P1XA 3HO8A 3N73A 2WVVB 3DGRA 5CPNA 1IZCA 4ZB0A 1O5RA 2VO5A 3T7VA 4Y8EA 4S2CA 5AN7A 4O1DA 3CHEA 4DBEA 1XJBA 1JL8A 4WY0B 3APGA 4TU1A 3KBMA 4JY8A 1E4IA 3M0MA 4UOQA 2EPNA 1VRXA 1R85A 3SUSA 1ISZA 1IQ8A 4B2DD 1MZHA 3QHNA 1TE6A 8TIMA 1V8EA 2Y62A 4GX9A 2PTWA 1YTKA 1AFSA 1T41A 3ATYA 4BI7A 3IAPA 4HPXA 5HPOA 1RXOB 2CPUA 5AFDA 1I1XA 4GGBA 4TTUA 1BG9A 4JTEA 4NASA 1XYAA 1RJRA 4E4PA 4V1YA 3GE7A 3CASA 3RITA 2FZ8A 4A3QA 3MSGA 4XBJA 4IICA 2IKGA 3C61A 5FESA 4B5VA 3CWNA 3PHAA 1A5NC 1PAMA 5AHLA 2VFGA 4B4FA 3TKFA 4LY8A 5C0QA 4JY9A 1RJPA 3OVGA 2J7GA 4HZ6A 4AZ7A 2BMBA 2VENA 5AVHA 4TX9A 4XUYA 1JI2A 2AMXA 4AHQA 3UXDA 3VIOA 1JPIA 4FOKA 3N9SA 3QF0A 3B9AA 2G3FA 2YX0A 4X61A 3CHCA 2NQLA 3PP7A 4F40A 2WSPA 1I6NA 2ZUSA 4AXNA 2ZX8A 5FF7A 2HZGA 3ELFA 4TIMA 1KBLA 1XIEA 6REQA 2J7FA 3JU2A 5E1QA 2H8ZA 3FSUA 5JIWA 4Q8WA 5DFAA 3NEHA 3RM4A 3LI1A 2UY2A 3VNMA 3RFAA 2DQXA 2J79A 4HK5A 5F1VA 2FZDA 3D3FA 3LTYA 1FWDC 1VCVA 1YE4A 1PKNA 1W54A 4C6MA 3FVDA 4Q7IA 1M04A 3M16A 2PRMA 5LXEA 4S2BA 3IV8A 5CC6A 4DF2A 3GTXA 3CQ0A 2DZUA 3QKEA 1F6YA 1C91A 5TD4A 4BQ2A 4GWEA 4L1WA 5FJIA 1W5PA 1XIBA 3KFTA 4ZOAA 4AWEA 2RUSA 1HKKA 4C1LA 1OFRA 3GZ3A 4P7RA 3VKJA 4G7EB 2R94A 3SADA 4Z1CA 4YTQA 3WEMA 2BX7A 2CHNA 2FZ9A 5M03A 1C92A 3LA4A 2GGIA 1EO5A 1FP9A 4JTGA 4GIYA 1JUKA 3FA5A 4JIIX 3M46A 1GVQA 1XCWA 4O8AA 4P7QA 5AC5A 2XH2A 3OG3A 2PDBA 3I7QA 2E8ZA 4C6IA 3T8QA 3NA8A 4J3ZA 5JBEA 1EPXA 2NV9A 3WY1A 4D8ZA 3BDKA 1EBHA 1EOMA 2A5HA 1HNYA 2IPFA 3M6YA 2PP3A 1GKRA 3L67A 3BW4A 2GQAA 3W38A 4H6QA 2E6AA 3UPMA 1AZ1A 1E6PA 5BOEA 3BGGA 4NXSA 4AY7A 3GUWA 2X09A 3WQ4A 4YVXA 1R6WA 3N4EA 4A2SA 4PMOA 3W9ZA 2Y8VA 5HMEA 5J5RA 4IFOA 1VHCA 3URBA 1MEIA 1TPEA 4QS6A 3WNKA 1TV3A 4D6JA 3NQVA 1FWBC 3WL1A 2OEMA 3G0XA 2QJHA 3I7SA 4KWUA 4UWMA 3MY9A 4AIOA 3WD4A 4FNSA 2QUNA 4FZIA 4GK8A 1K03A 2AMGA 3H55A 3H2NA 1W5QA 4QQUA 2ZUTA 4W5UA 4HCDA 4ZZ9A 2XSXA 3ZVHB 1J6PA 1OYBA 1LTDA 1OG0A 1TVNA 1T8XA 3M0IA 1DJHA 3QV6A 4RPPA 1A5SA 3DFYA 5CC5A 2A3HA 1SZFA 3C2FA 3WDPP 1JF6A 2FFCA 2BGSA 3S4TA 5DRCA 1RR2A 1BYCA 4FOUA 2H6RA 2QJIA 1V6VA 2PI6A 3CPUA 3UQNA 1RA5A 3F03K 4GRSA 4MIMA 2AQOA 1UKQA 5BOOA 1JD7A 1B57A 4DJFA 1KW1A 4D6FA 5GJNA 3UA3A 1FY6A 5CPSA 4Z0JA 2FB2A 4R27A 3SGGA 3W22A 1PXGA 1I0BA 2P0IA 3GNOA 3OIXA 3H4XA 2J77A 3UVAA 2EQDA 5EL1A 2WHMA 4UQDA 3NM3A 4HNLA 5D9PA 2HEJA 4NX0A 3VD9A 3I6RA 4R85A 3FHAA 3GDLA 1XLFA 4UOJA 3S1VA 1HX0A 1AW1A 3SCPA 4Z1AA 1AZ2A 1EDGA 3U3HA 2WLZA 4CCCA 3OGRA 2HBVA 1AH3A 1JZ4A 3NQGA 1QNVA 5K4ZA 2A7RA 4LU0A 3NYZA 4LH8A 4NILA 4LWWA 2GSJA 4WKFA 4JD4A 4EF9A 3A3WA 3IJ8A 4JBRA 3S1UA 5FJPA 1NP0A 5DY2A 2FGBA 4ZA0A 2BVTA 3L4TA 3QHOA 3ITXA 2G37A 5AYBA 1CTNA 3VCRA 4L64A 4HQVA 4MZ8A 4HYWA 4M5PA 2WZTA 4C6OA 2V5DA 4U3AA 4AD5A 4PCFA 2Z1XA 3CQKA 3DBPA 2GGGA 1AH4A 1K3UA 1TJ0A 1VF8A 3OG2A 4JKKA 4P8UA 2HE5A 4YWIA 1PCWA 3AIQA 3II1A 3SUUA 4C6JA 2AGTA 3KLKA 4UBPC 4S3KA 1QW8A 1PTDA 4UMBA 1FWFC 4PSPA 3VILA 2WAGA 2E7FA 1X1ZA 1SJDA 2INZA 3W1MA 5A6BA 1LLZA 1V79A 3B9OA 1H7OA 2DQWA 4PUJA 2YYTA 4UCFA 1W32A 4H9ZA 4C6FA 1VFUA 1WXJA 5TNVA 3TEVA 4TV6A 2C0AA 2E8YA 1HQTA 4IFRA 5I0DA 3MHUA 3GVRA 3QTGA 1OK6A 1AD4A 3H21A 3LM3A 1X7IA 3W1NA 2JEQA 1RK6A 2Y7FA 3TZNA 4E38A 1KLZA 5DO8A 1W3NA 2WHKA 1YIXA 3Q45A 3VGEA 1H49A 4HBKA 3GHUA 4EX4A 2FMOA 4FNQA 3B0YA 3QPEA 1ZENA 2F9RA 3URNA 1B3YA 3KHJA 4KPLA 1Z8AA 2IMRA 1UH3A 3O7UA 2BOGX 3TK7A 2X41A 2INFA 4ICNA 3DFNA 5I7GA 3GDRA 3FA3A 2QPXA 1PBGA 5E5CA 3AHTA 3W26A 3ZJ8A 1SW0A 2JF6A 2GLKA 4HNTA 1TPFA 4OBSA 4XZLX 2Y89A 3E2VA 5E9AA 1Q4NX 3MUCA 2YL8A 1TWSA 3TTSA 1KTBA 3EEGA 1FWAC 4LS0A 3A23A 4AC1X 1CW2A 3AIRA 3T1GA 2GK1A 4PMYA 3P0WA 2PF0A 4OBRA 5E93A 3SI9A 1J96A 1QFEA 1REQB 4DF1A 4H8NA 2XM2A 2CXGA 1QT1A 2PODA 3UYCA 1Q6FA 2X0YA 3OW1A 3NZQA 2B0MA 3EXTA 4DPPA 1FH8A 4WUIA 4KWWA 3NQ8A 2VT0A 2WQDA 1JYXA 4F0KA 3R0KA 3FJ4A 3ZVIA 3CO8A 4Z2HA 4H7ZA 3H23A 1EJVC 1HGWA 3UR7A 3S6TA 2QVHA 3MYOA 1SFSA 3M0HA 3WF2A 1D9EA 3PAOA 3R6IA 2ODOA 1A50A 3TW9A 2Y70A 4QEHA 1CPUA 5D2TA 2EEXA 4DPQA 3L23A 3PNUA 3T8LA 3U7BA 1GJWA 5K3VA 1Q6QA 1SSGA 3H2AA 4H6RA 5H8PA 3I10A 1H61A 4UZSA 1KXQA 3DN5A 3R89A 2ZQ0A 2BLEA 4BF9A 1FA2A 4IQDA 2WJFA 1GVOA 3PSWA 1K9TA 1Y5WA 2X7WA 4WJEA 3K8MA 3KCLA 4RPQA 3WF1A 2R1LA 3WNOA 5JQ9A 4JS3A 3QMSA 2G50A 4J3WA 1SGJA 2ZZ1A 2EKGA 4LXFA 4GD0A 3HA1A 4AZBA 4OQVA 4O14A 4Z2GA 1DIEA 2GQ9A 2J6VA 4DUXA 2R24A 1X8CA 2HNEA 1OFEA 3LV5A 1RJQA 3LTSA 3R2GA 5G4HC 4W7VA 3T2PA 1YYAA 3A47A 1UPMB 3ZT7A 3P82A 1DJQA 3B40A 1E9LA 2GWGA 2QYGA 3PBYA 1EP1A 5C9UA 3DFHA 1OX4B 4GJJA 4FR1A 1CXHA 2X0SA 3GR4A 3GNDA 3QTPA 3V3WA 1D2KA 3BLKA 3O05A 3CTTA 1JDEA 3KL5A 1S2TA 3AHVA 1I2PA 4R7JA 1E4NA 2TSYA 3W4RA 3VM7A 2Y6ZA 1UR4A 2ZTJA 2G3JA 5EA9A 2Z00A 1E1CA 1FKWA 4NY2A 2G3IA 4W8LA 4AZ5A 3BZGA 1AW5A 4D6DA 2OZ0A 1QI4A 2OSXA 4UQEA 3CO4A 2E6YA 5EFFA 2PRLA 3TONA 3VGBA 4EE9A 1DXFA 4B5UA 3ZOAA 2P3EA 4O1FA 4HKPA 2JF7A 4I7UA 1KB3A 2OR2A 2VOTA 3EKLA 4LOCA 5CH9A 1JDFA 4JR5A 5K9XA 3W82A 3AS0A 1GOQA 5G2HA 3EYPA 2E4TA 3CWHA 4RZ6A 4XQ6A 4F2TA 3AHXA 2V2DA 3YPIA 1K77A 5AZ0A 2UY5A 4KIEA 2CZ5A 4N02A 4QG9A 5HJXA 4L4PA 3MI3A 2ZICA 1VR6A 1J6OA 4OHQA 4QDPA 3N6JA 2Q01A 3KL3A 2PWHA 1EQPA 2ZUNA 1HP5A 1SJAA 4QE4A 1LLWA 4MNKA 3G24A 4IIBA 1UR9A 3UESA 3TWAA 1F7BA 2CW6A 2C13A 1UKOA 4DBUA 3QZ6A 3BXWA 4C5YA 1KWGA 3BSGA 4W9TA 1Q6GA 4HK6A 1K7FA 2G95A 2EPOA 3PVFA 3GHTA 1V51A 1CLVA 1C93A 3UZJA 4EF8A 1I75A 2BXZA 2F2HA 5D33A 1N82A 1VPYA 3L2LA 1K70A 4X9YA 2BVWA 4KCUA 1XR2A 4Q4PA 3B97A 3VOIA 3W7RA 3MB9A 4HU8A 3HMJG 4JTJA 4N4QA 1EEPA 1XSJA 5IFPA 3VD3A 2JEPA 3T6CA 3JUGA 3VMNA 3EMZA 3WFZA 4NZ3A 5C55A 2ZX5A 1QMLA 1FQ0A 4Z2LA 4Z17A 1GZ1A 2YJQA 1G94A 2V3GA 1RA0A 3PUOA 4GABA 1S5NA 3LPFA 4GZJA 3GUGA 5CSUA 4DBWA 7ODCA 2NXIA 5ABGA 3BAJA 2H3DA 5HK4A 1TTQA 5FJTA 4NAEB 2ON3A 4E0CA 3I4KA 1KRCC 4MNJA 3NGJA 3CV1A 5FL1A 3N11A 5K2ZA 4I9AA 3RRXA 3WJYA 3PN8A 9XIMA 2FYMA 4NF7A 3RJXA 3H8AA 1P7TA 2IS7A 3P61A 1ZGDA 4HN8A 5KMYA 4V1XA 3SCNA 4PMJA 5XIAA 3GXFA 3W2KA 4LEQA 4GUIA 1A3XA 4AIEA 2DGAA 1HFBA 5CPOA 3C4UA 1F61A 3NSNA 4GLEA 2PDJA 5HUPA 3AIWA 4BQ4A 2QCLA 3E49A 5CLWA 3ZZ1A 3URAA 4X0VA 1RQBA 3MMTA 1U1JA 1EJWC 1TMQA 3W7PA 1PX8A 1MI3A 1KLYA 1PEZA 2D20A 3ZSTA 3H4WA 4US5D 2VEKA 1CEOA 4BEUA 1MFVA 1OX5A 2PDQA 1MXDA 2FZMA 4GKLA 1L9WA 3WMLA 3UG4A 5A6LA 1MW1A 2FPTA 3MANA 3JS3A 2UV8G 2GQ3A 4OOUA 5EPDA 4U5KA 4A05A 3FVMA 4KKXA 1D3GA 2Y8UA 1EOKA 3LSBA 1FXPA 2O0TA 4D8LA 4D1JA 4WD0A 4HNOA 2QCMA 4GGHA 3SRHA 3EDEA 2YA2A 3DGBA 4GVFA 2BVDA 3H2CA 4CCZA 1W1YA 4U2YA 2J6XA 2HCVA 1WX0A 4ACZA 3EWYA 3PM6A 4ZMGA 2V5CA 4IUGA 1J9YA 2IQTA 2BGNE 3BO9A 1OGGA 1BSLA 1XF0A 2IQDA 3U2OA 2J8GA 1XRFA 3WQ8A 1SW7A 5D30A 2F6KA 1SW3A 4DI8A 4GFIA 5LNVA 3O6YX 1WYIA 1WZKA 3CYVA 3SCRA 4FK9A 4DZAA 3I3DA 3AS3A 3VMOA 2HPMA 4HNNA 3RHGA 2ZXQA 2QAPA 4RR4A 1OC7A 1UIPA 4JEJA 1ITCA 3UJFA 3TA9A 4ZL1A 2REQB 3E6EA 5KZEA 3TAOA 4CN4A 1BFNA 2PAJA 4UTMA 2CLLA 1DE6A 4ZB2A 3IEBA 4NIRA 1BKHA 1IWBA 2A6NA 2EBNA 4HNCA 1VBGA 2GDVA 3EA1A 3TJ4A 2A79A 5K9CA 1Q6RA 3V35A 3WJZA 4TTGA 4LY4A 3BOFA 2R1NA 2Z2BA