4H01A

The crystal structure of di-zn dihydropyrimidinase from tetraodon nigroviridis
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
485
structure length
484
Chain Sequence
AGEILIKGGKVVNEDCSFFSDVHIRGGKIVEVGPDLRVPPGARVIDATDRLVIPGGIDTHTHMELAFMGTRAVDDFHIGTKAALAGGTTMILDFVMTQKGQSLLEAYDLWRKTADPKVCCDYSLHVAVTWWSDEVKDEMRTLAQERGVNSFMFMAYKGLFMLRDDELYAVFSHCKEVGAIAQVHAENGDLIAEGAKKMLSLGITGPEGHELCRPEAVEAEATQRAITIASAVNCPLYVVHVMSKSAADVVSKARKDGRVVFGEPIAASLGTDGTNYWHKDWAHAAQYVMGPPLRPDPSTPGYLMDLLANDDLTLTGTDNCTFSRCQKALGKDDFTRIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSSNAAKIFNFYPQKGRIAKDSDADVVIWDPKTTRKISAQTHHQAVDYNIFEGMECHGVPVVTVSRGRVVYEEGRLKVSPGQGRFIHRQPFSEFVYKRIRQRDEVGKPAVVIREP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords dihydropyrimidinase
publication title Lysine Carboxylation: Metal and Structural Requirements for Post-translational Modification
rcsb
source organism Tetraodon nigroviridis
total genus 188
structure length 484
sequence length 485
ec nomenclature
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4h01A01
3NEHA 2UZ9A 3B0YA 4DIAA 4QS5A 3IRSA 1KRBC 3PANA 4RDWA 3CJPA 1J79A 4AC7C 4LAOA 1PO9A 2VHLA 4B91A 3ITCA 4CQCA 4DZHA 4XD5A 4G7EB 4GY0A 2Z27A 2W9MA 1FWAC 2HPIA 1FWHC 3LA4A 4BKNA 4MUPA 3GIPA 4R7WA 3S4TA 1ONXA 4WVXA 2Z28A 3T81A 4UB9A 4C6DA 5HMEA 2WM1A 3EWDA 3GTXA 4QTGA 4QS6A 3TNBA 2YB4A 3UF9A 4QSFA 2GOKA 4KEZA 2PAJA 3KM8A 3GG7A 3K2GA 3S2NA 1E9ZB 3C86A 4WHBA 4C6MA 1K70A 1V77A 2YB1A 2XIOA 4KQNA 4C6OA 4LANA 1FWEC 3QGAC 2UBPC 3O0FA 4F0LA 1FWGC 3E3HA 4C6JA 4CQDA 1PTAA 4GXWA 2Z00A 3B40A 3NQBA 2D2JA 1BF6A 4J2MA 2Z24A 1EJRC 3OVGA 4PE8A 2VUNA 2FTWA 2YXOA 3LGGA 1A5LC 1V79A 4HJWA 1UIOA 4H9YA 4LCSA 4LALA 4CEUC 1J6OA 3GUWA 1NDVA 4L6DA 4R85A 3QY7A 1EJUC 1HZYA 5AKQA 4C6EA 3R0DA 4DLFA 2F6KA 4C6IA 5A6TC 4AQLA 1DPMA 4KERA 3SFWA 4RDYA 4H9XA 2Q01A 3QGKC 2QVNA 4RDVA 3T8LA 1EJXC 4NI8A 4IFOA 3MKVA 4J5NA 4EPKA 3K4WA 4IG2B 1K1DA 2Z26A 4GBDA 4IH3A 4KIRA 4GYFA 1EZ2A 3GIQA 1NFGA 1R9YA 3ID7A 3AU2A 3OJGA 3S2JA 3UBPC 5HMFA 2WJEA 3MVIA 4CNTA 1V51A 1YBQA 3F4CA 3IJ6A 2EG6A 4LEFA 3V7PA 2FFIA 4CNUA 2GWNA 1R9ZA 2E1WA 4J35A 2WJFA 4GK8A 1A4MA 1EJWC 5CH9A 3E0LA 4CEXC 4R88A 3F2CA 4I6VA 2R1NA 3MDUA 4QROA 1KCXA 1ZZMA 3HM7A 4IF2A 3E38A 1FWIC 4DI8A 2BGNE 4B3ZA 2OB3A 2ZC1A 2HPMA 1FWFC 2HQAA 1EF2A 4NP7A 1KRMA 2ADAA 4F0RA 1V4YA 3LNPA 4ZSTA 4C5ZA 3URNA 3ISIX 2Z4GA 4DZIA 4RZBA 2Q09A 2Z2BA 3MPGA 4LCRA 3E74A 3E0FA 4L9XA 2A3LA 3ICJA 2EG7A 3JZEA 4F0SA 2CZVA 3MTWA 3LU2A 4XD6A 2OOFA 3TN5A 3A4JA 2VC7A 4H9VA 5E5CA 1RK6A 1PSCA 3IGHX 4JOMA 3IARA 4XD4A 3OODA 4LFYA 3IV8A 2D2GA 1ITQA 4ICMA 3OU8A 2HBXA 4XAYA 4EPEC 2R1PA 4M51A 3BE7A 4IGNA 1J5SA 2QPXA 4ERIA 1P6CA 3PAOA 2R1LA 3WYZA 4KETA 4C5YA 1RK5A 1RJPA 2QT3A 4G2DA 3LSBA 2HBVA 1EJVC 4LH8A 3WZ0E 3LS9A 4GY7A 4P5UA 4C65A 3CS2A 3OOQA 3QY6A 4C6KA 4EP8C 3OQEA 1ITUA 2ANUA 5G4HC 1A5NC 3F2BA 1M7JA 2YZ5A 3N2CA 2RAGA 4I6KA 1RA0A 2GZXA 2QS8A 3GU1A 3DUGA 3HTWA 3LSCA 2P50A 2PGFA 3URBA 3CAKA 4V1XA 4HA0A 1UBPC 2IMRA 1KRAC 2EG8A 1FWCC 1YRRA 1RA5A 2HNHA 3A3XA 3MSRA 4IQJA 2OGJA 3UR5A 1ADDA 2GWGA 3PBMA 1EYWA 4HK6A 3GTFA 4GOAA 4KEUA 1WXZA 4PCPA 3GTHA 1I0DA 4EPDC 2DVUA 4LCQA 4BY3A 4YIWA 1RAKA 4XAFA 4D8LA 1FKWA 3RCMA 3PNUA 1K6WA 1RJQA 3UR2A 1PB0A 3RYSA 1XRTA 1FWDC 1QW7A 2Y1HA 3F2DA 4PBEA 1POKA 3E2VA 3IACA 2KAUC 1XRFA 4GX9A 2PGRA 1E9YB 3B0XA 2I5GA 1YIXA 2DVXA 3ORWA 4GX8A 4KEVA 3NURA 2R1KA 2E25A 2Z29A 4Z42C 4GY1A 3TN4A 1FWBC 4C6LA 1POJA 1XWYA 3K5XA 2PUZA 1VFLA 3D6NA 4H00A 1V7AA 1YNYA 2OODA 5FSDC 3URAA 1O12A 3AU6A 4PBFA 1A4LA 1A5MC 3TN6A 2O4QA 4C6BA 3GRIA 4IFRA 1O5RA 4CNSA 2AQOA 4PCNA 1KRCC 2PLMA 1EJSC 1A5OC 2P53A 4CQBA 2VM8A 4RE0A 3TN3A 3F4DA 1W1IE 1M65A 4EPBC 2VR2A 4C6FA 3DC8A 3RN6A 3S2LA 1UIPA 4ERAA 3EWCA 1NDWA 1WXYA 2VC5A 2Z7GA 4B90A 1RJRA 1XGEA 4C6CA 3GTIA 3FEQA 4IG2A 4H9UA 4TQTA 1ONWA 2FTYA 4HK7A 2D2HA 1YBQB 2AMXA 1S3TC 4OFCA 4IFKA 4INFA 3UPMA 2WJDA 4UBPC 5LXXA 3URQA 2OQLA 1J6PA 2AQVA 4DYKA 1GKRA 3LGDA 1FWJC 4DNMA 4RDZA 3IPWA 3MJMA 1P6BA 4C6QA 1FKXA 4GC3A 4E3TA 4DLMA 4IGMA 2O4MA 3FDKA 4ZSUA 4WGXA 2R1MA 4V1YA 3SO7A 4LAMA 4XD3A 3LY0A 4ERGA 3MDWA 4G7EA 3AUOA 2FVKA 3MVTA 4QRNA 3RHGA 4B92A 1IE7C 4C6NA 1NDZA 2GSEA 4GZ7A 4H9ZA 4H01A 4DI9A 4XAGA 3PNZA 3FDGA 4C60A 3GU2A 3GU9A 4H9TA 4C6PA 4LAKA 4KF1A 2FVMA 4BJHA 1R9XA 1GKPA 3O7UA 1UMLA 4NG3A 3EGJA 5HMDA 1QXLA 4XAZA 1NDYA 1M68A 3HPAA 2ICSA 4IFKB 3WMLA 3A3WA 3QY8A 4DO7A 5FSEC 3S2MA 3T1GA 1I0BA 2G3FA 2BB0A 3G77A 1JGMA 1P1MA 1YMYA 1A5KC 2Z2AA 4KESA 4H9MA 4HK5A 1EJTC 2DVTA 2I9UA 2Z25A 3DCPA 1GKQA
chains in the Genus database with same CATH superfamily
4KW2A 4CD5A 4GVHA 3C0QA 2KZHA 4UR8A 4UFIA 3ARSA 3GB6A 5I77A 3VA8A 4HPJA 5M03A 1HUVA 3W73A 3C8FA 1RXOB 5CG7A 1BVWA 2HVMA 4MJ4A 3WLHA 3BURA 5AECA 2I14A 2R24A 5I3KA 2Z28A 4F48A 2GVEA 3APYA 4DBSA 5ABHA 2PGEA 5T8GA 3WFLA 1Z32X 4AZCA 3W76A 2UV8G 1KM6A 4Z2LA 3QPZA 2QXWA 5AYIA 4WHBA 3CV2A 1CGYA 1EC9A 3GWQA 2ZZ4A 4YCPA 4CQDA 5K9XA 4C1NB 1CX9A 4WY0A 5FJRA 2OMAA 1OFOA 2BXYA 4DWSB 2PDBA 3O6AA 2XM2A 4BS0A 3RU8X 3VUPA 2HCVA 3G1RA 1Q2SA 2E0PA 1O5QA 2PDXA 1VJIA 4LAUA 3RXZA 4F8XA 1UWIA 1Q4NX 5K2ZA 1H63A 4G8TA 1NTHA 1S2VA 2E3ZA 3BAXA 1H7NA 5A6BA 3LB0A 3IJ8A 2VYOA 3AWNA 4GQGA 1BPLB 1PIFA 2JF6A 4Z17A 1W56A 1J5TA 1FH8A 3NQCA 3SFWA 3H4GA 3BAYA 2E7FA 1SZFA 2WKLA 1XIIA 4XZHA 5C9WA 4DAIA 1IEQA 5CJNA 4E2BA 1KXHA 5FJIA 1YYAA 5KZDA 3RK8A 3N3TA 1GG0A 2MNRA 4GYPA 3VM7A 5AOUA 3AUJA 3WH5A 1MQRA 4CCEA 2EPMX 1PKLA 2YL6A 4CNUA 1SJAA 3W6LA 3PWIA 2ZRWA 2ZUNA 2G0WA 2QJHA 5D9PA 3N6QA 2PDJA 3FN9A 4WY0B 4FR1A 3MCMA 3E0IA 5DQPA 3B0VC 1XBYA 1BKSA 1EIXA 2HQAA 3LX9A 2XH0A 3F1QA 1W31A 1KM0A 2QVHA 3AALA 3W1QA 1B2YA 2A3LA 4AZ7A 5I2UA 2YZRA 1EKOA 4WIWA 4KGLA 1TKKA 2XIMA 4AWUA 5DXYA 1OHLA 2OT1A 3OBAA 1XLBA 4LNCA 1X1ZA 4AEEA 1NP0A 1MYRA 3P62A 3GXDA 3VVGA 2QJNA 2QDEA 5D05A 2TAAA 1RP8A 1HKIA 4AVOA 2ZADA 2R1PA 1D7FA 3ARUA 2IPFA 1L6FA 3IWPA 3KBMA 2GUBA 1RJPA 2V81A 3H23A 2X30A 5A8QA 4PEEA 5GJNA 4L4PA 3ANYA 1ZBWA 3LPFA 4IMCA 1L6WA 2D73A 1DXFA 3UWUA 4FI4A 1W1ZA 4UTTC 3ARTA 1K9TA 1PX4A 1CXIA 2A2IA 2ZRYA 4NAEA 3MSGA 5JIWA 4A3RA 3LSCA 1MUMA 1DTNA 5AZ0A 2GLKA 3M0LA 4DWDA 3CZLA 4V1XA 5HAOA 3REQA 4AEFA 4DYJA 3SCUA 1GYLA 2B7OA 1QUMA 2J77A 3IANA 2DZBA 4RCXA 1Y5WA 2NQHA 1JDFA 3BLOA 1ADDA 3TX9A 5REQB 3LEPA 3GH5A 4EPDC 3LHYA 3N18A 1C8QA 4XX6A 3ATYA 1SJBA 2VDIA 1XSIA 1M7XA 4ZOCA 2CWNA 1HN1A 3OA5A 4AEOA 1POKA 4KRUA 3NNTA 3W01A 2E9MA 4PL1A 5AC6A 3IIVA 2OKTA 1OFDA 5I3GA 3M44A 3K8MA 3OIXA 3NL6A 4DVOA 1WB0A 2XGIA 4O12A 3U48A 3UG5A 3EX1A 4GY1A 3IIZA 1Q5MA 4CN6A 1PBGA 3E1F1 2PUZA 4H3DA 2X42A 7TIMA 5IHSA 4QCFA 4C6BA 3E96A 3REQB 5LKYA 3T07A 3S5SA 1XLDA 3QN3A 1A5OC 2WNQA 4K1GA 4X63A 1C90A 3NSNA 3R89A 3C3NA 1NDWA 2ISVA 4B90A 1GYNA 4HNLA 4TV6A 5ABTA 3CZJA 1UMYA 4MYAA 4C7GA 4DUOA 1KW1A 1X8CA 4LUSB 5F7UA 3RIKA 4B5VA 1CZ1A 2VVSA 4AYGA 3VOIA 2AQVA 4DXXA 4HYVA 2XDFA 4JTEA 3FSTA 3KP1A 1LLZA 4NKCA 5BXSA 1U5HA 4JD4A 4C6QA 1N8FA 3W1UA 4K3ZA 3L67A 3VKAA 4D71A 3BGAA 2C1IA 3W7JA 2FDMA 1ZENA 1HKKA 2IQ0A 4YLWA 2QCCA 1NDZA 5ABFB 4Y9PA 4GZ7A 4QNEA 4HVXA 1ZB5A 5CPOA 4UFJA 4F0KA 3EWZA 1R3SA 4X22A 1JPDX 2OTDA 4CCCA 3O7UA 3EA3A 2BXZA 2GDVA 1UOKA 4S3JA 3EGJA 4ASTA 1ICPA 2V5LA 4NJIA 1UR2A 4G1NA 2DDXA 4EX4A 2GJXA 3B8SA 3A5FA 4L6OA 3FA5A 1UBSA 1Y7VA 3TR2A 1OK6A 3ARPA 2QR6A 2X8RA 2FJUB 4H6KA 2FB3A 2X0YA 4LVFA 2OLHA 2VFHA 1OBAA 4OGZA 1LDCA 4X9SA 1HL8A 1XUUA 4ZOAA 3W22A 4DIAA 3ZVHA 5DMMA 4R9OA 1RUSA 3VCNA 4M80A 3T42A 1LL4A 4KEMA 1CYGA 4LV4A 1CCWB 2XH7A 4A22A 1DIEA 1KNWA 1Y5VA 4LB3A 5FJOA 2PDMA 3GTNA 1PE1A 2QAPA 4V2XA 1VJZA 3SUTA 3N04A 4HMCA 2OZTA 3G6MA 2DORA 4MJ2A 4URIA 3GG7A 1IWBA 1F3EA 2J74A 1K70A 3A47A 1ISWA 2MUCA 4L4MA 4AIUA 5AB3A 5DXXA 1S1RA 2W62A 3UW6A 5M3WA 1SZEA 2BOFX 4MAZA 3OTRA 3VMNA 3SJNA 1TPWA 1XG4A 3B04A 3H4WA 2HISA 3L2IA 5H91A 1AQHA 1KLZA 1VYRA 4DRSA 5I5RA 1N82A 2J9XA 4W7WA 3PB0A 2Y70A 1US2A 3WUEA 3KRBA 5AKQA 1H7XA 3UA4A 5FESA 4PMUA 2HK1A 1RV8A 5A6TC 1JPKA 1GNXA 4FLSA 1VGAA 2VQUA 5C54A 2Y2WA 4PL2A 3TSDA 4B5WA 2RHGA 3HJEA 2WMIA 2V3DA 4NZJA 2CZFA 3EB2A 5C55A 4I7UA 3GHSA 4A8NA 5BOOA 1SGJA 2P3ZA 1GYMA 1H5YA 3OJGA 5HMFA 2B0MA 2WJEA 4FK9A 1XFCA 3CEPA 3BLLA 1R47A 1UD3A 1MUWA 1ONEA 1Z9AA 4I6VA 4NUWA 3DU0A 4OBSA 1UH4A 2YBTA 1KGWA 4DJEA 3JUGA 4Z1BA 3ZOAA 3HOJA 3UWWA 3WQGA 1W1A1 5HBFA 4IXHA 4WDTA 4AIOA 3C6CA 4PB4A 5CAHA 5CZTA 4XD6A 1RBOB 1UWAA 2F7FA 5E9XA 1ZCOA 3W7NA 2PMQA 4PRRA 2QV4A 4JFUA 2HXUA 4XD4A 5CXPA 2QGHA 1XSKA 4PGLA 1J0JA 2WVSA 4IGNA 3KW3A 1TVNA 1U30A 2D0FA 3EOEA 1ZBVA 1CIUA 2I57A 1A0EA 1GHSA 3LS9A 1YTKA 1DJZA 3I68A 2AL2B 4H6EA 1UC5A 4J4KA 4JQ1A 4PTMA 4HCHA 2B31A 2BHYA 1GZGA 4L9ZA 2VR4A 1BTCA 3IEBA 4S3EA 3CHEA 1S2WA 1C9WA 1Q6CA 3B03A 3CAKA 4HA0A 5HA7A 1GOWA 2DIEA 3BG5A 3QV6A 1QWKA 3A3XA 4P7LA 3W1NA 4GNVA 4S2BA 1T8XA 1KWKA 1SO4A 1SZNA 3HN3A 1J96A 3P61A 2RH9A 1A5SA 4RXFA 3W7EA 4GOAA 2NVCA 1ME9A 1WXZA 3QZEA 1I0DA 4AD0A 3CUZA 1KTNA 4YIWA 4AU0A 2ACQA 3NQ7A 4D8LA 2YR1A 1OYCA 1UD4A 2QGYA 4HSNA 4Y9AA 3WF1A 1TCMA 2WMGA 1TQJA 1HJVA 3KXQA 5G1MA 4JICA 2QF7A 2YIHA 4XSMA 2PI6A 1QPRA 1WDDA 5E09A 4LSBA 3WD1A 4UTIA 4ZQRA 3RCNA 3FAWA 3AHZA 1AJZA 1EP1A 1HFBA 3AZSA 2PWHA 3NEVA 3GRIA 4UMAA 1K02A 4PEKA 3W9ZA 3W7PA 1Q2RA 1P0BA 2EXOA 2PLMA 2P53A 1V93A 4C91A 5HQEA 2DW7A 3U6WA 1E0WA 4MADA 1H2JA 4MWAE 1SJCA 4L1GA 2BX7A 1YNPA 2HVOA 2VC5A 1GOXA 1XCFA 3VTRA 3CL6A 2IKHA 2PTDA 3VPLA 3VCCA 3NAVA 3AI0A 2PTWA 1O1ZA 2PA6A 4N6EA 5E70A 4MM1A 1GKRA 4ZTYA 3LGDA 3NZRA 5E6ZA 3NQ6A 1XYMA 3W1TA 3LTYA 4DNMA 3W26A 3K13A 1LOQA 1XIFA 2TPSA 5CZ0A 1FDJA 1MFVA 4QCEA 1JPIA 3I7QA 3ARRA 5HATA 2IKIA 4XD3A 5BYWA 3LY0A 4LB4A 1K9EA 3AXMA 2A7RA 3GDBA 2WC7A 5K9DA 2ISFA 4DN1A 3TXZA 1IEIA 3PFRA 1QO5A 4MB5A 1R0MA 4GUHA 2I7GA 1HW6A 2WBGA 2XVKA 4LF2A 4Y9MA 1TG7A 5D8ZA 2WKJA 2PRHA 1QOQA 1Q13A 4XKYB 3AS3A 1ISYA 2HXTA 4K1WA 1R38A 4F4RA 3W2NA 3LCLA 1Q6RA 1KFEA 1CT5A 3PUDA 2XISA 2A3AA 5HPCA 1Z3NA 3NQVA 4S3AA 1BXBA 3UZWA 4H9MA 3RPMA 4IMGA 3RILA 4U5IA 1BQGA 2DJLA 5AC8A 3VNMA 3VE9A 1MFUA 5FF2A 2VZSA 1BWKA 3L4YA 2NT1A 3W53A 1E15A 3DAQA 4LRSA 1BRLB 2Z27A 5XIAA 4DUVA 2QCFA 4CNNA 1YDYA 5DY3A 3KEHA 4YYFA 2BHZA 3D46A 2PBGA 1XGZA 3GVWA 4KFPA 1XM3A 3PZ9A 1K8CA 4QX4A 3ATZA 3QHMA 4OHQA 4QS6A 3MYPA 1FXPA 1EEXA 4EAYA 1KKOA 1UZHA 1OCNA 1C91A 1W9PA 2CLEA 1OX5A 1R3QA 3FGCB 4I9TA 3C2OA 3TCSA 3WUFA 3EXRA 3WCZA 1MQPA 1YQ2A 1F9CA 3B40A 3IIPA 3AHXA 3FJ6A 1PIGA 1SW3A 1ZRQA 1TWSA 5E9AA 3UWEA 2NXIA 4LALA 4DF0A 1VYSX 2DEPA 4CEUC 2CXEA 4ZE4A 3GD6A 4REQB 3AXHA 3ZR6A 3WH8A 4C6IA 3U0HA 2WHMA 4Q4MA 2O56A 2H6RA 3M4HA 3CUXA 4FSAA 4WDUA 4BQ5A 4ACZA 3MUZ1 1QI3A 5FF3A 3EKLA 3B8DA 1K1DA 4GBDA 2VDHA 2P76A 4GUIA 2D0HA 4JIPA 4HMEA 5D03A 1HL2A 3FJ4A 3O1NA 4M6VA 3WG6A 2FMNA 2XGZA 4DZ5A 3VNDA 1LZOA 1D9EA 3HF3A 4UZSA 5E0FA 4MPQA 4GK8A 1M01A 4J2PA 2VFGA 2ZZ7A 2DZXA 4UTFA 4UQDA 4ICCX 1EF2A 1TVLA 3W1AA 1KRMA 2BGSA 4C5ZA 3EPOA 2VEGA 2WZMA 3G18A 2E5BA 5A95A 5K4ZA 5CPQA 2PRMA 2OO0A 2DJXA 3A4JA 4PUMA 4HTBA 1QO2A 1G0CA 5E5CA 4PUWA 3BAJA 4XAPA 3GC2A 4GIAA 4ACZB 2YXXA 1OFPA 4RE2A 3G8RA 2D2GA 1W3NA 4PCTA 4FNPA 1ZALA 5HWMA 2DSUA 3VGGA 7REQB 4BF9A 1V3IA 1J5SA 2J78A 4KETA 1AFSA 1RK5A 3KBVA 4X61A 1KO0A 5C70A 4ZB5A 4IPPA 4C65A 1TJ0A 5CC6A 4DJFD 3IGUA 4C6KA 3UG4A 1JCYA 4FF7A 2EGZA 2UY3A 4QHRA 3BLDA 3P0XA 2Y61A 3NL5A 3NDOA 2QS8A 4DJFC 3ARXA 1LL6A 3DFPA 1BF2A 4CGTA 4BR1A 1EBHA 1RD6A 5I00A 3DHDA 2GJNA 1AH0A 4NI3A 4JL2A 1O95A 5KINA 3R6IA 4GIRA 4H2HA 3ZT5A 1UC4A 3VX0A 3LXCA 3WH7A 1V3LA 4S1FA 4HOWA 1KCLA 4IPLA 4LQ1A 4WF7A 5F2IA 1TPEA 4IIBA 3KFTA 3VYLA 3TJXA 5D09A 1I2QA 5DCDA 5HUOA 3ITTA 1RP9A 4UXDA 1MZHA 2DFAA 2V5JA 4A2RA 1K9FA 1H62A 1V08A 1JNEA 1CXEA 5HDRA 2PODA 1TV4A 1GW1A 2CW6A 3I7RA 1P0NA 1F76A 4PBEA 2Q3OA 4KWSA 2LLEA 4U10A 2YDAA 4ZL1A 3QC3A 1LRQA 3MUXA 5EBUA 1DXEA 4BZYA 5J5RA 2J9YA 3BG3A 2V2DA 4PYSA 2FHFA 1WDWA 3OZYA 5CPLA 5GNYA 1L6GA 1VFLA 2P0OA 3TE9A 1G4PA 4PUDA 4H00A 3TQPA 5FA5A 3URAA 5FSDC 3PHAA 2FGZA 3B4UA 1MXGA 1F4HA 4BHYA 1G5AA 3S1GA 4CQBA 1TZ7A 3T8QA 1J8VA 5DELA 1J0ZA 4WKFA 2AGTA 3S2LA 3VKJA 3NM3A 1E4MM 2D1ZA 3OP2A 3BDKA 2OLAA 3QZ6A 4LS0A 4PMZA 4B3LA 4RE4A 4YTUA 3ZLFA 3LPOA 3KOYA 3U4FA 1TTPA 1LUCB 1XI3A 2FHBA 4R9XA 3L4VA 4HBKA 2PWDA 3D5HA 1LL7A 1PKYA 5C7HA 1FWJC 4RNHA 4O11A 5AVHA 5TD4A 2GFTA 3KVLA 3KTXA 2RDUA 3BCFA 1Q4WA 2RJGA 2R1MA 3SJ3A 3RJXA 3W84A 4WXYA 3MDWA 4W5UA 4KWUA 3LBOA 3AQUA 2CC0A 1XR2A 4F2TA 1L2QA 1XINA 3GKAA 4UZUA 3I3BA 8CGTA 3PNZA 4ZTXA 1WX0A 4LAKA 4HNUA 4D8ZA 3LGEA 5GNXA 1TO3A 4S23A 1T8QA 2J7EA 3QVQA 1KB3A 1MO0A 4MWAA 4XAZA 3I6RA 3CIWA 2PTXA 1QNRA 3VKKA 2V38A 1IGSA 3WMLA 3NPVA 3QY8A 4AY7A 4DO7A 3XISA 5J8LA 4FA3A 1DJNA 5RUBA 1HX0A 2BB0A 2OPJA 2FVLA 3W02A 2PCEA 1JGIA 4NXKA 2PDHA 3N2XA 1I6NA 3TCEA 3WNNA 1NH6A 2PS2A 3DCPA 4UTHA 2QQ6A 1E1CA 3B0YA 2WWCA 3PANA 5E1QA 1TRDA 3WLTA 3SRHA 2WZIA 4CVUA 2WVVA 3THQA 4QLKA 1XBZA 1FWHC 3LA4A 4E4PA 3AWOA 3DYPA 4XQ6A 3L7RA 2ZC8A 1AJ0A 1V3MA 1GZJA 2QCHA 2C1GA 5A6KA 3GTXA 3SUVA 3LLDA 1UKTA 1M1BA 4KEZA 1KWGA 3CC1A 3TTSA 3LG3A 4C6MA 3TXVA 4MWAB 2ZX8A 5AHNA 1DVJA 3GW0A 4JYEA 3LD5A 3SGZA 2FGLA 2BY1A 3OG2A 4X9YA 3UXIA 1XLIA 2VOMA 1WZAA 1XLAA 3AMDA 2PDYA 2YOCA 4IMDA 6ENLA 3WJWA 1VRDA 5CC7A 5A6LA 2QUMA 4KPLA 5GQBA 1QK0A 2ZWZA 1XV8A 1ZGDA 2P0IA 1C92A 1E1CB 4IJRA 4OT7A 2VUNA 3W27A 1UQYA 1DJWA 3UJSA 1AMYA 4Z1YA 3AIRA 1VBRA 5EMYA 3CB3A 1ZAIA 2WVVB 3UYIA 1R7AA 4KCVA 3M6DA 3M7WA 3R0DA 1TJRA 4O1BA 4MGGA 3BJFA 5JUVA 1CBGA 3HO8A 5A8NA 1QT1A 1A5BA 1VBJA 2JEQA 4ZOEA 3W88A 2DUAA 5BU9A 3ITGA 3QMSA 2JIWA 1T99A 5HWJA 1GJPA 4PFHA 3CBWA 2HEJA 4ZFMA 1EZ2A 3I65A 4F3HA 5F1VA 3KTSA 1H7OA 1HGWA 4QR6A 1HKJA 3S3GA 3UPWA 3M5XA 4IUGA 2EG6A 3VD7A 1RH9A 5D8WA 2WJFA 2RUSA 5EKYA 1VFMA 3NQFA 1GQNA 4UQCA 3WY1A 3ARVA 5MKGB 2BGNE 4B3ZA 3WF2A 4HCLA 9XIAA 2J88A 3AJ7A 3ITVA 5ABGA 4F0RA 3G3DA 3N1AA 4WJ8A 2DGAA 2XFRA 2RDXA 4ZXOA 1JVNA 4DZAA 1JCJA 3TN5A 3B9EA 3MMUA 2O0TA 1R3RA 1AG1O 5A6MA 5JQ9A 1O7AA 1WNOA 1FWNA 2E28A 1B3OA 4YCOA 2Q8ZA 2QJGA 4KCWA 4KGJA 4P8WA 4BQ3A 5FJUA 2R1LA 2X1UA 3T0CA 2OGYA 1G9HA 2OWXA 2VWTA 3N9RA 4LYQA 1UA7A 4HHHA 2CCRA 5LIKX 5B80A 3LLFA 1XW8A 2PF0A 1I9CB 4NZCA 1E71M 2NX1A 5EMUA 2QDGA 1LBLA 4Q6JA 1J4EA 4I7VA 3TMLA 3VZZA 3CIXA 3W24A 3OQEA 1A5NC 5DBUA 3WDIA 3BZGA 1W2VA 7ODCA 4DXVA 4EF9A 1VC4A 4HIBA 4NRRA 3N73A 4EKJA 1LWJA 1LBFA 3OLEA 1OX4B 3S5NA 4LX4A 4O57A 4LS1A 3MP5A 1W3KA 1JL8A 1XYCA 4HMDA 2IMRA 4N6FA 1MEIA 1XKYA 3WBWA 4HOZA 4GGHA 3C4UA 5DX7A 5I3HA 1H5VA 4AZBA 3ZMRA 1JYNA 3QLLA 4DXKA 2ZKMX 3L5MA 2J7HA 3WQVA 2CZDA 1XYFA 2QPUA 2ZBTA 4N9EA 2DVUA 3FLUA 3MP4A 3I7SA 4NYYA 1RAKA 2YA2A 3GNXA 2XVPA 2ATMA 4IGSA 1A53A 2VR5A 3EMQA 3MMWA 1XSJA 3DFTA 5F4WA 4MNMA 4GX9A 3C52A 3EX6A 1E9YB 2WANA 2WCGA 2ZRUA 3VX1A 1W5PA 3G1VA 5M17A 3SRDA 2ASHA 2WMHA 2J6XA 1F3XA 1OZQA 4AW7A 1E43A 3WL0A 2VI0A 3R8HA 5F1UA 4AMAA 1H4PA 3WQ5A 1E6PA 4AC1X 1GOIA 4L9YA 2BP1A 2EQDA 4UUIA 4ADSA 3AIQA 2HS8A 3CWNA 3UCDA 3LQGA 3CLWA 3F4DA 1Z41A 3VIOA 1LWIA 4FEZA 3P2VA 3KOZA 4QE4A 3NPUA 1WCGA 2PU1A 3K4DA 3N2OA 1RJRA 3SFKA 1EOKA 2Y85A 4IG2A 4LAZA 4L65A 1JZ6A 2QIIA 3VGDA 3PFMA 3V1HA 1TWZA 3IJ9A 1P5BA 1E73M 2VC9A 4LV9A 3HG5A 4OBTA 1MW0A 4BWLA 2NUYA 3EYPA 5BMXA 3P3BA 1E70M 2INZA 3HV8A 4K38A 5C0QA 5C9RA 3TIMA 3TYAA 3EWBX 4YTQA 2FPYA 4DLMA 4Y2WA 3B8TA 4OVXA 2ZUSA 1YE4A 2QJMA 4GFIA 3WNOA 4J3WA 3ZSSA 5D38A 5EGRA 4MKVA 1HJSA 1V02E 3GFZA 3W7KA 1YX1A 1DHPA 1S2TA 1W3LA 2C6QA 3SM0A 3VIFA 2ACSA 4Q8OA 4WDXA 3GU9A 1NJJA 3FJLA 1TWIA 3MUY1 1ZCCA 3U7VA 1ONRA 4LBRA 2OZ8A 3G1YA 1BSIA 1AW2A 1R86A 4GBUA 4NAFB 1K6AA 1ZTVA 5ABEA 2X41A 4D6CA 5BCAA 2WLZA 1XLGA 3QOMA 3WMBA 1E6XM 3APGA 5HNRA 2I9UA 2Z25A 3T08A 1GKQA 3UESA 5CPNA 3SCNA 4AC7C 3D3AA 3R0UA 3SQLA 4LUTB 3P82A 2UY5A 1XLMA 2BSLA 3S1XA 1TJ1A 2NV2A 3GUGA 3PPHA 4HZMA 4UB9A 4GO9A 2EPOA 4QP0A 4QTGA 1Q65A 4HHMA 1QNOA 5A5WA 3VO0A 3C86A 4NASA 1V77A 1CXHA 2V67A 4I5UA 3T44A 4LANA 4EANA 3W1RA 3QGAC 4C6JA 5TIMA 1EZWA 2EJAA 3QV8A 4PB3A 1CLVA 1SFSA 4B5XA 4AWEA 4R33A 1RBAA 3ES8A 5H8UA 3KL5A 1UW9A 1ZSXA 4MOZA 1VRXA 3K1DA 2J8GA 4LCSA 2I5QA 1PPIA 1P6WA 4N02A 4RNJA 2XJ7A 1YDNA 3UD6A 1UQZA 3GK0A 1T5AA 5C2GA 1BEUA 4RW5A 4QDWA 1MWOA 4X0NA 4QBXA 3C8NA 1H49A 5KZ6A 1XCXA 1NQ6A 2QVNA 5E0CA 3ZJ8A 4XZBA 5JXQA 4IFOA 4WEVX 4MAVA 3WQ4A 3K4WA 3OLGA 3TLQA 4JKKA 4Y8FA 2PE4A 3L2MA 4W84A 2Y8UA 3UETA 2CLHA 2QF8A 3IGSA 4US6A 4KWWA 5T26A 4JQ4A 4IIFA 5HINA 1H51A 3T55A 4UWMA 4Z1CA 1BKHA 3TJ4A 2E9BA 3N29A 1W3TA 1ZY9A 4ADUA 3VUSA 4AZ5A 4CEXC 4E38A 1UZDA 3LK6A 4IF2A 4D72A 2E09A 4W85A 5D2YA 5DN1A 4DI8A 1KXVA 5I09A 4HU8A 2QMKA 4CN4A 2D22A 4FMVA 1I2NA 2QULA 2OX1A 4L61A 1B5TA 2W79A 1IT0A 2CZVA 1B4KA 2OOFA 3B06A 4ZO6A 4O8AA 3TOYA 3H22A 5IFTA 3W0KA 3UJ2A 1JQVA 3H7VA 5CEWA 4FLOA 3WNLA 3TUUA 4TX8A 4EXBA 4EACA 4LVBA 1W5NA 4Q32A 3QFWA 1WZMA 1P6CA 4JYFA 4L5ZA 1PV8A 3UZZA 2DQWA 2OWCA 3CHDA 4LUYA 1R46A 3TTQA 1EQPA 1FWWA 4XO6A 3JRKA 2Q8LA 1CPUA 4YTTA 3VFCA 3LDVA 4DWSD 1OGGA 1C8YA 1XQLA 3PPFA 4FALA 3N13A 3LXAA 1CI1A 3HTWA 3HQ1A 2C8NA 4DBEA 3WDHA 2PC4A 4DWSC 3NCOA 5FF0A 2PF8A 3URBA 7CGTA 3RCYA 4QG9A 2E6FA 1UKSA 1RA5A 4W86A 3IS4A 1MXDA 4OJYA 3JS3A 2BY3A 3MO4A 2IPGA 3WFAA 1Q6OA 5AHMA 2Q8XA 3AISA 3DENA 5TAOA 2L5HA 4KEUA 5EFFA 5D4YA 2GK1B 2QPSA 1KXTA 1JCTA 1OSEA 5I3DA 1TZZA 2ZX7A 1K6WA 2FLIA 3POHA 1NSJA 1JULA 2A21A 3RMJA 2FDSA 2EEXA 3NXLA 1RY0A 4F9DA 1I45A 2EO7A 3NURA 1PYFA 3ZR5A 4FHAA 1DQXA 4FAMA 2X1IA 1FDYA 5JVLA 2OODA 5G2IA 5A6BD 2GJRA 2OELA 3GXNA 3QR0A 3WLLA 5I03A 1ML1A 1GEHA 3BQ6A 1JUKA 3GYEA 3LBMA 4O15A 2XIIA 1KC7A 1PZ2A 5CKSA 4TMCA 3XIMA 2PFHA 3DC8A 4R7OA 3WMCA 2Z7GA 4C6CA 3GHTA 5I3FA 1Q3NA 5U4NA 1J10A 4B3KA 4GXMA 1XPGA 3CPRA 5CSUA 4GUGA 5JH1A 4Y9OA 3QMTA 3TROA 5FEXA 5EY5A 1JQXA 3BLKA 4RKAA 1QJWA 4GMEA 3E2RA 3LCWA 4J3ZA 4XZLX 2A6LA 1HJXA 3JVAA 1UP3A 4QGCA 1P6BA 1Q7QA 4UMBA 4Z08A 2WW5A 3AIVA 1J2WA 1NARA 1IXNA 4N9DA 2XU2A 3O3RA 3EPNA 1JI2A 2OSXA 4WY0F 2NUWA 3EXSA 1PKNA 4XAGA 4NT0A 4MG4A 2WZHA 3SGGA 4IL2A 4V15A 1BAGA 4GG9A 1R9XA 1QI0A 4KCTA 3MV01 3CASA 2Y8VA 6REQA 3M41A 2ICSA 1M6JA 2A7NA 1F2JA 3KVKA 4D1IA 4N7QA 3HMJG 4EWJA 2Z2AA 3V4BA 1K7XA 4MZ1A 1CGWA 2CXGA 2IQDA 4AD2A 1XIMA 5CGQA 1YW1A 1MNZA 1XD0A 3LI0A 3K4AA 3CJPA 2ZUWA 1QBAA 1RLDA 2G96A 3CQKA 4CQCA 1W3JA 1SU5A 3O9NA 2BODX 2QCDB 4Z2GA 2ZX6A 4E8DA 1KFLA 1WZLA 2BTMA 1E6ZA 1X1OA 4WKAA 1TV7A 1V02A 4O4WA 3BJTA 2REQB 4DBUA 4XIMA 1PJ9A 1D8WA 1TV2A 2DW6A 1UP2A 4QSFA 2PP3A 3P81A 1N7KA 3KM8A 3WDJA 4V28A 4GQRA 4Y96A 6REQB 1UJPA 4C6OA 5I6SA 1E0TA 4FNQA 1GQJA 3S6DA 5MHBA 1HVQA 1OQFA 3R13A 1QPQA 4HU4A 3NQBA 1OCJA 1FHLA 2V3GA 4AG0A 2FJKA 4JKMA 3QBUA 1SMAA 4MIMA 3LGGA 3U2OA 1A5LC 4CNPA 2PLCA 3ZYZA 5FCZA 4BK9A 1LOSA 1H61A 4D6IA 3BLPX 5KZEA 2BGQA 2E5CA 3YPIA 2YBUA 4LVDA 4NYUA 4ZB0A 4AHOA 4TVDA 2Y8KA 4YTSA 1YPFA 1EDTA 3GBEA 4J5NA 5F2LA 3DI1A 1JG9A 3TWBA 3W07A 1W1B1 4ATDA 3GVVA 4GJJA 1ZLPA 4AZHA 4H04A 3THUA 4W8BA 4UMCA 2H9AB 3LCXA 1YBQA 3C0LA 4LU0A 3O6CA 3DHPA 3EOOA 5CC3A 1ITCA 2ZZ3A 1DIOA 4TOQA 2PDGA 3W7QA 1XYZA 3GW3A 4WCJA 4M6UA 3E38A 4PSRA 3O15A 3WO8A 1M04A 2ZC1A 3HJZA 4MZ8A 3CO4A 4UOZA 4NL1A 3HG2A 4H83A 4QQ3A 2Z2BA 3N15A 3GE7A 3UY7A 3HGRA 4NNCA 1H0IA 3W1MA 1G67A 2G8ZA 3IGHX 2FZ8A 4J3UA 5DT5A 2HE8A 3ES7A 4J27A 2HBXA 1B3WA 2CLOA 3WFZA 2BOEX 3B9AA 4JTFA 1EB3A 4CKQA 1IWAA 3IRDA 5LHEA 1V0NA 1AQ0A 3CMFA 1GW9A 5TF0A 4C1LA 4QAIA 3SADA 1KM3A 4E8GA 2DT0A 1D3GA 4HHPA 3FNDA 1U22A 2GPTA 1XL9A 3BJSA 4H4IA 1K77A 1HO1A 3WKZA 1EFZA 3ZVIA 4E2DA 1QNQA 4QG6A 2WWDA 2GZXA 1CXFA 2ZUTA 1QHPA 2QCLA 2NVAA 2AL1A 5JMUA 1IEWA 2QUNA 2OYLA 3S42A 2G5WA 1EGZA 5EBAA 5HJLA 3CH9A 1A3HA 3BMXA 1PEZA 4ZZ9A 2XIQA 3SN0A 2CESA 2GWGA 4TVUA 1EYWA 3EOSA 2PDUA 1B3YA 3OPSA 2G3JA 4FB7A 2SFPA 3FY1A 4XAFA 1JAKA 3JR2A 4UTJA 2XWDA 4BQ4A 1US0A 1W0MA 2IKJA 3AZTA 2W5FA 3VD9A 1XRFA 3ALFA 3TWAA 3AYTA 3WMSA 4DHGA 4I5XA 2XH2A 2FPVA 1HVXA 3CTLA 3G1SA 1NOUA 3EKGA 4CQAA 1SR0A 2IQTA 2E25A 3LCHA 5HR6A 5HUPA 1XIHA 1O68A 4UQEA 4D6DA 4PBFA 4EXQA 2OT0A 4HYWA 3PS7A 1DJHA 1OG6A 3BICA 3O63A 1ISXA 1E5JA 1UR9A 1PAMA 1EJSC 5D2VA 1GTHA 4J9JA 4OTKA 3PBVA 1UOZA 2E77A 2ZVRA 4YPJA 2VCAA 1FHUA 3V0TA 2PDIA 3M0XA 4MVAA 4NXSA 1KGUA 3FEQA 4TQTA 3C5QA 1KR1A 1IIGA 4OFCA 1W32A 1FCQA 2B7NA 3AJXA 2A4AA 2CLFA 3PG9A 3CEUA 1TYGA 4YJ5A 1QPOA 3FEMA 1TA3A 3VNJA 4E3TA 1CXLA 3W2KA 4E2OA 5D02A 5AZ1A 1DJYA 4DJED 2ZDRA 3BMWA 5TNVA 1G01A 4KRZA 3DKLA 3WX7A 2V8ZA 3TAOA 4NQ1A 4QRNA 1SW7A 4A3UA 2P8CA 4B92A 1IE7C 3HQOA 4H9ZA 4DJEC 3SCPA 2QUUA 3BO9A 3GU2A 1G1YA 3WBAA 1MNSA 2WBKA 1EP2A 4IJCA 3GXPA 4JR5A 1NU5A 3E0VA 3WJZA 1W54A 3LRMA 1F6KA 3KLLA 3WLRA 4LUJA 1NF0A 2VEIA 1B54A 1UB3A 3RM4A 1E0XA 5FL0A 4G9PA 1GVFA 3S2MA 5CZSA 3WLSA 2PD9A 1QPKA 4FOUA 3H2MA 1XIGA 1TV5A 2Z6IA 4PC8A 4N4PA 1IV8A 3CUGA 3BH4A 5HULA 4QM1A 4R27A 1O1HA 2CNCA 5A94A 3FCPA 2VMFA 3VKDA 3GLCA 1WKYA 4Q4SA 2X05A 3BW2A 3U2EA 1EJ7L 2YGYA 1LOLA 3LNMA 4B5TA 1EYEA 1IZKA 2HRWA 4JTDA 4JXCA 1OF8A 4HOXA 4EXAA 3QM3A 3EXTA 4XO7A 3BMVA 4AXKA 4QJ4B 3QRHA 3OVRA 1ZJHA 1S2CA 4ONVA 3KCJA 2GOKA 4ROQA 1TX0A 4O14A 5DBTA 1GOKA 2WPGA 3IJQA 2YB1A 2OX4A 3TSMA 3BGGA 2J24A 1RCQA 3M7SA 1VLWA 4P61A 1AVAA 3B8VA 3R1ZA 4A3YA 4ACYA 5KITA 5U7SA 1KBIA 1XLJA 1PZ0A 4GI6A 3GZ3A 1W1YA 2FIQA 2PWVA 4AFYA 5DLCA 4AVFA 4JKLA 3PJUA 2BMBA 2J7BA 1JZ4A 3QGVA 3V1PA 2YXGA 3KCOA 3KDNA 2OFJA 2ESCA 2XSAA 3FHAA 3HMCA 1IYXA 4J3XA 2ZOXA 2E9LA 4GVIA 2NWSA 4HD5A 1UR1A 1O6IA 4RDYA 5A6SA 3QGKC 3GG0A 1EGMA 1ICSA 1L6SA 3L21A 3E0WA 1QOXA 2VC6A 3QF0A 4B2DA 4DEFA 3CAVA 3AIWA 4IH3A 1ZNNA 3BLIA 4KIRA 4H8VA 5D2XA 3E9AA 4CLMA 3ZLGA 3EMCA 4DM1A 4RV8A 2H90A 1AODA 3F4CA 3DESA 3V7PA 4H7VA 3BCJA 3W7IA 1CWYA 1EXPA 1ADSA 3HG3A 2EKCA 2PTZA 5AYYA 4G6CA 3ALGA 1OADA 3W28A 3EA1A 2BVTA 3IAQA 2WSKA 4HN8A 4GUFA 1HJUA 1TPFA 1V0LA 1X38A 1ITXA 3URNA 3ISIX 2WNWA 4LY8A 3UWZA 3L9CA 3N6JA 4QISA 4H7CA 1YPXA 1XCWA 5FIPA 5BNKA 1Q6LA 1CENA 1M9HA 3W87A 1F6YA 1M5WA 1W9XA 1JJKA 3M5VA 3RMEA 1JDDA 3T6CA 3P80A 3ZJ6A 1V6XA 3BC9A 1UH2A 3AMCA 1QHOA 3FFSA 3TC3A 1DBTA 2CLKA 3CV6A 4JHZA 1THFD 3SN1A 4C5YA 3H12A 3GDKA 4X2PA 3STGA 3H4XA 3LSBA 1KCZA 3MS8A 1TTQA 3WQFA 3KLKA 3SIZA 1MSSA 2XTKA 4XZ9A 3TAKA 3WQ6A 2W92A 5ECVA 5D30A 1R2RA 2QUVA 2VEKA 5CCZA 2UY4A 5KSWA 3OW1A 3NGJA 3R94A 1P4CA 4JTLA 5C71A 2XG9A 4QAWA 4UTWC 2XINA 4ATLA 3KL0A 5CLTA 1R2SA 1KLYA 4MKSA 4O1FA 1KFKA 1OFRA 5IBXA 1CGVA 1YRRA 1ME8A 4B4FA 3A4AA 2W27A 4B5NA 2YKKA 3N14A 5I3JA 2ZRVA 3PBMA 3VCRA 3NXFA 3STCA 3W2MA 3Q58A 1R6WA 2G3NA 3BXWA 5AC4A 3IVSA 3R0KA 4I90A 1C29A 4AIEA 1DJGA 1DOSA 1VEOA 2UWFA 3QZAA 1PB0A 1SVDA 3GY1A 2YW4A 3W7CA 3UZXA 4PUEA 4C1NA 4EAMA 3RG6A 3TP4A 1A5CA 4BQ2A 3H7UA 5LNUA 4PMJA 3LQLA 1YE6A 2X2YA 1Q8JA 3FOKA 4UIOA 3TTOA 3U4AA 5HJYA 5FACA 4LBUA 1H41A 3TN6A 1EO7A 3QSRA 1S46A 3MCNA 3FX4A 3H2CA 1NP2A 2F6XA 4PUNA 1UWRA 2JGYA 2DZTA 1BD0A 2NXHA 4YU1A 4M0XA 2TODA 3BLFA 4RL3A 3TYUA 1KM1A 5LA2A 4JBRA 1X6UA 3H2AA 3WQEA 3BGJA 2PP1A 4JCLA 3TMQA 3VNIA 1WXYA 3AXXA 4KRTA 4UQ9A 2R6OA 2Y7EA 1UUMA 1HF6A 1ALDA 2CZEA 4H7ZA 2BVYA 2GVLA 4S3BA 3W6YA 2A6NA 3V36A 4Z0SA 4RX0A 3TW7A 3MI6A 3ZO9A 1R8LA 2OQLA 3DKJA 1KFWA 3ZT6A 4LRTA 7A3HA 4L4LA 3WNKA 1KGXA 4IMEA 3VIHA 3G1FA 1TPH1 1B9ZA 1YTEA 3TQ0A 2QMJA 3G2GA 4XUGA 4ZSUA 1QHZA 2NXGA 1XICA 3L68A 5TBOA 4W89A 3TYBA 3S5YA 4Q8UA 3IUHA 1B1YA 8XIMA 4JCMA 1OZMA 1EL3A 1PKMA 1UR8A 2PZ0A 3Q37A 4H9TA 3DZ1A 3SQMA 2XGBA 4PCSA 3W7GA 2BFGA 4ROPA 5CZJA 2FH6A 4E3VA 2WNNA 1Z7AA 3U5UA 1G6CA 5LNVA 4P7RA 1I8JA 5HMDA 3TYCA 1QXLA 1I1WA 3HPAA 1DIKA 3PK7A 2E8YA 3G77A 1HP4A 4ZQCA 4KH2A 2WLYA 3KOXA 3NDZA 3DHFA 1PCKA 4QEHA 5CG0A 3G24A 4H8UA 5FL1A 2ON3A 4K8GA 1YHTA 2XH4A 3IK2A 4TIMA 2ZA3A 3MW7A 4O4VA 1F05A 1VEMA 3ARZA 3L23A 4LC8A 2ZE0A 2A3BA 3WEOA 4DBDA 2PSNA 1F74A 4JN8A 3CUJA 1KFJA 3PTDA 4XVEA 2NSXA 3LCIA 3SEPA 1WKEA 3FS2A 4DUWA 3GIPA 3UY8A 2V63A 4R7WA 4XIAA 3L4XA 4WVXA 1BYCA 2Z1BA 3BSGA 3OVQA 3NSXA 3UF9A 3KX6A 5REQA 1EXBA 4KMQA 3SRKA 3K2GA 1V5XA 1E9ZB 3TC7A 2ACRA 1ZL1A 5HJXA 3SY5A 4JIEA 4H41A 4KQNA 3L5AA 3U8GA 1VQTA 1KXQA 4IT1A 3WNPA 3DG6A 3IAPA 2Z00A 4LYKA 1DJIA 4XVDA 1XJBA 1GVSA 4MB1A 1OD0A 2J75A 1F07A 3GH4A 4A8LA 2UY2A 1AQFA 4MJZA 4HJWA 3OLIA 2OOGA 2V9DA 2DH3A 4UNLA 2H3DA 3TEVA 1NDVA 2VWSA 1HZYA 5HXMA 4C6EA 3HZ3A 4DLFA 3S9IA 3RPDA 4RDVA 3SQSA 4ENLA 1BFNA 1MZRA 1XDMA 1EJXC 2MANA 1EGVA 2JBMA 2W61A 1WBJA 1A0CA 2FFCA 4HA1A 4S2CA 4H8NA 1XKJA 2WHJA 1YXCA 3QH2A 4MZYA 4A6GA 4YVVA 4FX6M 2Y4SA 4JN6A 9CGTA 1V51A 1W91A 3MKCA 4LUSA 4PMRA 2CHRA 4O1CA 5BMWA 3RX4A 4KKXA 1GJUA 3W86A 3NUKA 3MBFA 2YSWA 3VOGA 4IWWA 3OO2A 1BQCA 2BXVA 2QIWA 1ZQ5A 2F2HA 3NL2A 4Y8EA 4XBJA 3OIHA 2PP0A 5FEWA 3UZYA 3N2TA 1KR0A 4LCRA 4LBSA 3EOUA 3JZEA 3EA2A 2QUTA 3ECQA 3HGSA 4DB7A 4H9VA 5ABFA 1KD0A 2ODOA 1SQ7A 1GK8A 1XIDA 9RUBA 1LCOA 4LFYA 1PWLA 3P84A 3ITLA 3GNRA 3ZSTA 1E4IA 5AHEA 3BG9A 2D24A 4UCGA 3UA3A 4EK7A 1CB7B 3BE7A 2DT1A 3WYZA 3QR1A 4MWAD 4QE5A 4PUKA 4HHLA 5H8PA 4RJEA 3LZ3A 4QITA 3VMOA 2DP3A 4IIEA 1J0IA 3TOPA 3AS2A 3VGBA 3PJWA 4WSJA 5B7ZA 1D3HA 3Q4DA 4MWAC 4Z1AA 3SW6A 4PBGA 2YDRA 4GXPA 5F2MA 1JXJA 3ONBA 1S5MA 2RAGA 4Z2HA 1LYXA 1XLKA 1T41A 3KOFA 2AKMA 2Z2UA 4O54A 5KETA 4E8CA 1J93A 2OZ3A 3BTNA 3S1VA 1LG2A 2DQXA 4YS1A 4N9BA 4H2CA 4X3ZA 3Q2DA 2WCSA 1U5VA 1Q6EA 3UGVA 4HPXA 5CLWA 3M6YA 3GVQA 4TO8A 1RQHA 3RM9A 4GJIA 4M19A 3U57A 2FPTA 2OU4A 5FKYA 3GTHA 2CKSA 3TJIA 1R30A 3PNUA 2C16A 1OFAA 3Q67A 2QZRA 1JDCA 1FWDC 1QW7A 4JTTA 1S3HA 5L9FA 3PZQA 1JR1A 4MDOA 3NA8A 3SCSA 2V2CA 4JNYA 1RSCA 3D6NA 4W87A 2QKFA 1UWQA 1LWHA 4IQEA 3UQNA 1A5MC 3W6MA 1UUQA 5CPSA 3ABRA 3UWVA 3UU0A 1QI4A 2VM8A 1Z69A 1WZKA 1LQ0A 1R3VA 3EMZA 2VR2A 1LT7A 4O53A 3OYZA 4PMDA 4A8IA 2XYLA 4H1ZA 4V27A 4U5KA 1FXQA 5AHLA 3TONA 4XTDA 4IICA 2A0NA 2BLEA 5CBBA 1JYWA 8TIMA 5LIUX 4UBPC 3VIKA 3URQA 2VZOA 2DZAA 1GWJA 4BCEA 1IZCA 1MW1A 4UTLA 2HZGA 2VRQA 2XFFA 3P8IA 1KBBA 1VCGA 2V5KA 3MJMA 2QAFA 3ABXA 3FXGA 1RLCL 3H24A 3FDKA 3DXIA 5C8BB 1KTCA 3PZVA 2V68A 4Z2KA 3W85A 5PTDA 3BAWA 3TK7A 1HJQA 2I1OA 1AL8A 3PP7A 3KUMA 2WV8A 4C60A 2NX9A 2YW3A 1HG3A 1KKRA 4B5SA 2D69A 3UT0A 2AAMA 3ZLHA 2GQ8A 5DANA 4FOKA 3PM6A 1JF5A 2W6RA 3R4IA 4H8HA 6XIAA 2DT3A 3OGVA 1PVNA 2V6AA 4WOZA 1GG1A 3T1GA 2Z1SA 3O07A 5CPTA 3LV5A 3R10A 1A5KC 5I7GA 3VZYA 3MUIA 4O0ZA 1JD7A 2AL2A 1TMLA 1OT2A 4S3FA 4UOQA 3O16A 2ABBA 3GXTA 2D20A 3ITCA 2FKPA 3GDTA 4AWTA 4HCDA 2ZXQA 3PAJA 1UROA 3W72A 3H2FA 2JALA 1IIHA 5JIPA 2XFWA 3I10A 4C6DA 4NZ5A 3P67A 4UFMA 1HP5A 3FAXA 1WUEA 4WSKA 5I07A 2OWWA 2Q6ZA 1W1VA 1J2BA 3ZZ1A 1DWFM 2PAJA 3S2NA 4NJGA 4NVTA 2ZRXA 1W3IA 4GYJA 3B9DA 1BGGA 2XVGA 5E93A 4HNTA 2UBPC 1CGXA 1XG3A 2AMGA 3TW6A 3ZM8A 2HS6A 2J27A 1PTAA 2QV5A 1GPFA 4Q8NA 3GNPA 2CU0A 3R25A 1WE5A 3ZS4A 1BF6A 3EEZA 1ZBCA 1UP0A 4NZ1A 1V6YA 4HSHA 4ZVJA 4Z2JA 3CQIA 3APTA 4H9YA 1GQLA 5J5DA 3BAKA 4PMNA 1T0OA 1SPQA 1J6OA 4FR6A 3L0GA 4L6DA 3LMZA 1EJUC 1OM0A 2HSAA 1GUVA 1KBJA 3PJXA 2J6VA 3ITOA 1UKQA 1CGUA 3QQWA 4WKHA 3UNTA 6PTDA 1IF2A 4BFAA 4HSOA 3A4WA 3T2PA 2EAWA 2ALDA 1DEDA 2Z26A 3BV4A 4JTQA 4ZQOA 4HMNA 3CZKA 1TMQA 3G0SA 4BEUA 4RK8A 5AN7A 1E0UA 3AU2A 4JFSA 3WK1A 4NIRA 1PS9A 3MVIA 3RUBL 1DWJM 4Q8QA 4WXZA 4IPNB 4FS9A 4ATWA 5JBDA 3E12A 3W83A 1DV7A 1A4MA 2F61A 3F2CA 1FFQA 2QJIA 3VIGA 2YLLA 4WDWA 3LCFA 4ML9A 2NWRA 1U83A 1LP6A 4I9MA 4L1XA 4B9YA 3MHGA 7PTDA 1AMKA 4BWLC 1Z44A 3F5KA 1FWSA 3QSTA 4Q7NA 5EMJA 3E0FA 3ICJA 3KOWA 3MTWA 3WLPA 3MZNA 3G0UA 3ZWSA 1RBLA 1J0YA 4KWVA 3LYEA 2A3EA 1DE6A 4M1BA 2VD9A 3VIIA 5G4EA 1JNDA 1EA0A 2C0AA 4RR4A 2GQ9A 3F4WA 2J62A 1TQXA 5HQLA 1MI3A 3AAMA 2XZ7A 5EB8A 1UWTA 4XAYA 4P8XA 2JF7A 1XF0A 4XWUA 4M7SA 2QPXA 3M43A 3EX4A 1HIZA 4F40A 3N2MA 1XP3A 4QJ5B 4XKYA 1EJVC 3QFEA 4HPHA 4MNJA 4IIGA 3PWGA 1XUZA 2DZPA 2ANUA 1XPYA 2ZTKA 2X09A 3EDEA 4JTCA 1B90A 1E6QM 4PTDA 1AH3A 2B4GA 5KMYA 3RR1A 1G4EA 1P48A 4QG8A 2E68A 2QHAA 4N9CA 4GABA 2NW0A 5AHFA 4TTGA 4PMYA 3O2LA 3P74A 4GYKA 2X7VA 5AHIA 3VXGA 3LERA 3PZNA 2NV9A 1VR6A 2Z1WA 3ANVA 4NSBA 1GOMA 1L8PA 1D8CA 2ZFAA 1BRLA 4IQJA 1I60A 5LNWA 2X0HA 1SZRA 4PH6A 4IJBA 1YDOA 4LTSA 1PTGA 3S6TA 4DNHA 4GZJA 3USBA 2PURA 1C93A 3UEQA 2VJXA 4LCQA 4MFEA 3G6LA 1NY1A 2NV1A 2Y6ZA 1Z89A 1ZP4A 3F5LA 3WD3A 4OU1A 4DF1A 4GE8A 1DWIM 3SRFA 1TUFA 4O17A 1BYAA 3E2VA 3FGCA 3ANUA 2RFGA 1EX1A 4BEQA 3BOXA 2VENA 4UTWA 5J04A 3MUAA 1RCOB 2Y88A 4JQ2A 4Z1DA 2WSRA 1VCFA 2PD5A 4KIEA 1J01A 3BSMA 2C19A 2A3HA 4EE9A 3RFAA 2ACUA 1W17A 1AZ2A 4NNAA 4NY2A 3NPWA 3H21A 4GACA 2D2OA 4E4UA 3BVJA 2XSXA 3HA1A 1OT1A 4ZQPA 4REQA 1C8VA 1XBXA 3CMGA 5DCBA 1PXGA 4C90A 3WF3A 3HURA 2ZXDA 2X1TA 1UIPA 2AOSA 4JTHA 1F8IA 1OK4A 4H19A 4E2VA 3T0TA 5BXPA 2YCLB 4IFKA 4U3AA 2WJDA 3EOLA 5FOOA 1GVRA 2OG9A 2E5DA 3BAIA 1G4TA 3UFYA 1J6PA 4IP4A 4N0RA 3WLQA 2VO5A 3I3DA 4PTVA 3LM3A 1NOFA 5JU6A 3LOTA 3PG8A 3C2YA 2AQWA 3KZSA 5DFAA 1UD2A 1U5JA 3VDCA 3WD0A 2WK2A 4V1YA 1XDLA 4WJEA 3VM5A 4ERGA 7XIMA 1TB3A 3QMRA 4JN7A 1YLVA 3VDGA 2GSEA 1ZPTA 3W2LA 4DI9A 1QI2A 3II1A 4AX7A 3LUTA 2CLIA 2VELA 4GZEA 3LTPA 2WC4A 5M2FX 4GVFA 3PTMA 3ABSA 6TIMA 3QEZA 2ISSA 7REQA 4IFKB 3RLGA 4RNIA 4RUBA 4TX9A 4JIRA 2V30A 3GVGA 4GFSA 1DYSA 5LHFA 1P1MA 1YMYA 1TR1A 3OEXA 3SURA 4RLIA 5AVNA 4MNKA 4HK5A 4HYRA 2OEKA 1S2UA 4PR4A 5T9BG 3KWSA 4I9AA 4QS5A 2PB1A 2VHLA 1IGWA 1V6WA 1XH0A 2HROA 4K39A 4DZHA 2QNEA 1JZ7A 1UKPA 5EMMA 3AO0A 4CVWA 5C7VA 5HNNA 1VIWA 4FLQA 1W5QA 3W70A 4BKNA 3ELFA 3LENA 4M1RA 3N6HA 1QW8A 1X8FA 4JIIX 2ISWA 3T81A 3TYZA 3H2NA 3B0UX 5A2CA 2P1FA 1OABA 1ZS2A 3ME3A 3AZRA 3JU2A 3W4RA 2IPJA 2A1YA 4M3PA 2G95A 3CUIA 4BI5A 1TFVA 1N8WA 2NT0A 1XH1A 4P7NA 3AC0A 5CPMA 4G56A 1TJ2A 3CZEA 4J2MA 4LY4A 4JQ3A 1EF3A 3V5FA 3PBWA 3WH9A 1LQAA 3GNOA 5AC5A 2DSZA 3H55A 3M46A 3GAYA 5JH2A 3UG3A 3W71A 5C9UA 5JBEA 4FPSA 1BVZA 1RPXA 1TMHA 2YBVA 2Z7KA 3PUEA 1NWSA 3L12A 1OEPA 1PZ1A 1H7RA 4KERA 1GOQA 4ZFCA 2HV5A 4ZB2A 2DZUA 4BF7A 3T8LA 1W8SA 3LLXA 3TLLA 4JFWA 3S8HA 3WBXA 3L4ZA 2GQ3A 1FUYA 5C6MA 1QFEA 4GYFA 3FJNA 4M6PA 1NFGA 2HJPA 3MA8A 1PDZA 4MPKA 4DY1A 1R3WA 2DUZA 1E51A 5CC5A 4LEFA 2FFIA 4JEJA 4R34A 3M1ZA 3M0VA 1R9ZA 1Y65A 3HPFA 1KV8A 1QK2A 3SCRA 2ZZ5A 3UCCA 2GUYA 1LUCA 5M5DA 1FHVA 4R88A 4WJXA 1YXDA 4YHEA 4LOCA 4HZ6A 4JY9A 1FY6A 3TH6A 5XIMA 3NM1A 3R2GA 3HQNA 4ZSTA 1HTIA 3V18A 1IXPA 3U7BA 5F2GA 2ZXAA 4F0SA 1QRQA 3K8KA 3B97A 4KWOA 2GGEA 4JOMA 3CV7A 4AD5A 3DX5A 3NDYA 1A5UA 5CQ1A 4XBSA 3BV7A 2XVLA 9XIMA 3QV7A 1QWGA 4QFUA 4HPNA 3WZ0E 3S83A 3E5PA 3QY6A 4EP8C 3MZ2A 1M7OA 4YNGA 1EUAA 2VURA 3CAWA 3EDJA 1VP5A 8RUCA 4C1KA 1TPC1 1P7TA 1OX6A 1UG6A 4O13A 4S3CA 3P8JA 3DUGA 1GZ1A 1XRVA 2WXDM 3W38A 2G4JA 3T2QA 1V0KA 2YCEA 1UHVA 3G22A 2OEJA 3LHVA 3BPWA 1UBPC 3W7MA 4PTNA 4N4QA 1FWCC 3M0HA 3S1UA 4AAJA 2OGJA 2CLLA 4PMVA 3TQKA 4AZCB 1WQ5A 1JDAA 5XINA 3VOHA 1KQZA 3MANA 4HK6A 3FA4A 2AAAA 1OC7A 4YXGA 1D2KA 3AIUA 1UASA 3AOFA 3SZ8A 2VT0A 2E4TA 4IZGA 2ZZ6A 1JCLA 3THDA 4K8HA 3VD5A 3DHUA 3NFUA 3EX2A 3SAZA 4IX2A 3O06A 4LF1A 2GGIA 2ZRZA 3OHMB 2ZDSA 2O55A 1X7FA 3V16A 3NGFA 3LHZA 2R1KA 1EBGA 1FOBA 1P7TB 1POJA 3K5XA 3IJDA 4D6HA 3MMDA 4M8UA 4FNTA 1A3XA 1V7AA 2INFA 3AU6A 3EAUA 1MRAA 1C8XA 4UOJA 1XH2A 3KZPA 3M0JA 4IFRA 4K37A 3M0YA 3MV11 3N25A 4I7WA 4PA8A 3VD3A 4XZMX 2D3LA 4LUIA 4CD7A 2D0GA 3UXDA 1EWDA 2Y0FA 3CNYA 3W7LA 1MXSA 1S2AA 3B8IA 1Q63A 3CT2A 1CDGA 2OXNA 4NRSA 4ZR8A 3GTIA 1F73A 1V8EA 1XD1A 1TPVA 1S3TC 1JRCA 3Q94A 2GVJA 4W7UA 3UPMA 4A35A 5C2CA 3R8GA 4MB4A 4MKNA 5BW6A 3VOCA 3RITA 2I56A 4GC4A 1OFQA 3E2SA 3GKFA 1IQ8A 4TR9A 3XINA 1JI1A 3QTPA 1NEYA 1UA3A 1UH3A 1LM1A 2J47A 4UR7A 1F61A 1G7UA 1BLIA 2GJPA 4J7RA 4RV3A 4IGMA 4D8AA 1XX1A 5SWUA 1XGDA 2C7FA 5MKGA 2PGWA 3S47A 3LBCA 4UTUA 1W3HA 3SO7A 3WQOA 2XIBA 4UR9A 4D6GA 2FVKA 3MVTA 1FDZA 2NVDA 1B3VA 2CERA 4J28A 1OG0A 1DWAM 4H01A 2BASA 1WYIA 1NWUA 1ZUAX 1Q66A 1TV3A 1B4EA 2GGHA 1V03A 3E2QA 4DO4A 1EHAA 2G4FA 2DIJA 1ODZA 1UPMB 1DHKA 4JQAA 2DIKA 4NG3A 1I2OA 4CU7A 3P0WA 1P43A 3CQHA 1SSDA 5DCEA 5D2WA 1W6TA 5G5IA 4CU6A 3VMPA 4YWIA 3RAOA 1JDEA 1U1HA 2GSHA 5FSEC 1LG1A 1I0BA 5G2HA 1DE5A 4NAEB 3RX3A 2EBNA 4CD8A 1LQ2A 1N2VA 4PSPA 1C7SA 4K36A 3T09A 4B15A 4RDWA 4TMBA 1LF1A 2YL5A 1PO9A 1H11A 1F5ZA 3TC6A 3J7HA 2YCJA 1FWTA 1OX4A 4X60A 5A3HA 1DTUA 5FF7A 3UJRA 3LI1A 2W9MA 1RVGA 5CJMA 2EJ1A 2GDQA 1XXXA 1EUNA 4IP5A 1O94A 1L0PA 3HIJA 3GR4A 3WQWA 1TRIA 1LBMA 4WLCA 1OB0A 2YB4A 3MI2A 1QTWA 4DO5A 3OGSA 1Y0EA 2XN2A 3ZT7A 1RPKA 1US3A 5DT7A 2BBFA 2PDWA 1FWGC 1PHQA 1BSLA 1PX3A 1WDRA 4DPQA 1QNPA 3B05A 3UP8A 1OCQA 1GGOA 1V3JA 4W4QA 2R14A 4FO4A 2OCZA 4MFDA 1XLCA 2Z24A 1MUCA 3QYQA 2VGFA 2YFNA 1EJRC 3AHYA 2FTWA 2XN1A 1HJWA 3GH7A 4GQQA 3NIYA 3PC0A 4P7QA 3U9IA 3RJYA 1QASA 5A69A 3SCTA 4O8RA 2FYMA 2VFFA 1ESWA 4OZOA 4HNVA 4RNFA 4JTGA 2J66A 3MKVA 4A21A 3AIBA 2C1HA 3COTA 2QCMA 3NQMA 1T96A 3GIQA 4JTAA 1PZ3A 3ID7A 2NQJA 1SSGA 2JKEA 1U1JA 3WNMA 5D33A 3M5ZA 2VDGA 1KFBA 2DZSA 3VOFA 1AA1B 2ZQ0A 1HKWA 5F4SA 1V7YA 3WD4A 6TAAA 4WK9A 3GM8A 2JFEX 1FA2A 5D2TA 1VENA 3UJEA 3KP0A 2OYMA 1KCXA 2QCNA 1FWIC 2YJQA 3FVMA 2HPMA 1FWFC 4LS2A 3VC6A 2ZYFA 4C7DA 2JQXA 1BYDA 5E6YA 2Z4GA 4DZIA 4PUJA 3A9BA 3BUVA 4L9XA 1B57A 1WV2A 3GFYA 1WBHA 2VC7A 4HU3A 4AIBA 1RK6A 2JK2A 1X1NA 1XLFA 1F7BA 3AXIA 3MJYA 5D04C 2QLYA 1BXNA 3OODA 3IV8A 3E5BA 2BDQA 4EPEC 4M51A 2GJXB 4GNJA 4QE1A 4QEEA 3PAOA 1T40A 3LRKA 1VB9A 1TTIA 2I16A 3N9KA 2A7PA 3NPXA 3KVMA 2CBUA 1EC8A 1FP9A 3PTKA 3PZTA 2H3BA 3M0KA 3S46A 3CPGA 1X98A 4NAFA 4CQ9A 3A64A 3CZGA 5IDIA 2ZA1A 1S5TA 1M7JA 3ZVHB 4Q8VA 1VF8A 3WEZA 3WLKX 3KBWA 3BW3A 3T0AA 3ZJ7A 1TVPA 2ZA2A 2VEFA 3GDRA 3GS6A 4I3GA 3WL1A 3R11A 4IIHA 1OYAA 2WKGA 3STPA 3M9YA 4ZXLA 2O9PA 3VGHA 4LUTA 2PDQA 1PUDA 3EDFA 2GSJA 3MSRA 3CXOA 2FZNA 2YA0A 4A8RA 5M1TA 1ME7A 2RGLA 3W74A 2F84A 4O28A 4TVCA 4NJJA 1R85A 4LNYA 4NJHA 1LLWA 3V75A 3QJAA 2ZZ1A 2PDPA 3SDOA 1JIBA 4Q3MA 1ECQA 3MYOA 4GVGA 5EFDA 2W67A 3WF0A 2KAUC 3OGRA 5A8OA 2ZTJA 1DKWA 4FIRA 3QOKA 5GJMA 1YIXA 3G1HA 1UZ1A 3NQGA 4Q4PA 4DUXA 1VFFA 3PZMA 1ZJIA 2CLMA 3KCLA 4D6JA 3HGJA 2Q02A 3LCGA 3EBVA 1EDQA 1UZ4A 2PDCA 2R9RA 2C3ZA 3UPBA 2IS7A 3L4TA 4Q8MA 1AUSL 2YL9A 4IQDA 5I23A 2F6UA 4PULA 2VFIA 2WMIB 3ZJKA 3MT1A 4GIEA 3CTTA 3TN3A 3DFQA 1W1IE 2P5NA 3GXFA 1X97A 3SR7A 1QAPA 4B2DD 4B4HA 5A8MA 1MEWA 4JGDA 3TFXA 4HU0A 2GL5A 4H9UA 1BHGA 1VBHA 3KRUA 2XHYA 3WK2A 4AUBA 2Y89A 4GD0A 1TJPA 3CT7A 3WQCA 5LNRA 2AKZA 4M5PA 1MRQA 2X40A 2VL4A 3NO5A 4HKPA 4GJ1A 5CSRA 2OQYA 4JFTA 3AYVA 3W3OA 3LN3A 3BARA 1W5MA 4B16A 5C9XA 3QC0A 3UYCA 2H8XA 2G97A 1GTEA 2W4XA 4GH3A 4MSSA 5GJPA 3W23A 4G7EA 1AL7A 1EPVA 4Y7EA 3H8AA 1X6LA 3C56A 3DN5A 4WX2A 1M03A 3A12A 4QLLA 4BI6A 1S38A 3FDGA 2DY3A 1HXJA 1NELA 2A3CA 3DGBA 1Q6FA 4DBWA 3H2EA 4AVNA 2NQ5A 1CW2A 2O92A 3ZIZA 3I4KA 1WAWA 1G94A 1A49A 1W9VA 2QDDA 3VNYA 2WHKA 3UWYA 3QHOA 2Y7DA 1EA9C 5LIYX 4FZIA 2JKAA 1VFUA 4JYDA 1N8IA 3QR3A 4O10A 1ADOA 4UTKA 1Q6QA 4Y6GA 1VBGA 2DPEA 3WLIA 1ODUA 3HG4A 2R8WA 3WK3A 3VGFA 1J79A 4LAOA 2V5BA 4NZ3A 3KVJA 2YA1A 2IW0A 2PCQA 1FQ0A 3UR7A 1V0MA 4G7EB 1NQKA 5BXTA 3B8UA 4D6FA 3C3UA 2FB2A 3KBJA 4DJDA 2CZ5A 3CYJA 2CKRA 1ONXA 1GVIA 2ATSA 3ENLA 1H7WA 1QMLA 3SIMA 2HVNA 5DMNA 3PUOA 3S1WA 3BW4A 1RHCA 5IBXC 4FLRA 3CZ8A 2EF9A 3H7RA 1W9DM 3RO6A 1WP6A 1BVNP 1VFHA 1RCXB 2GK1A 4UFHA 4IGHA 1E9IA 1GHRA 4GA8A 3WJYA 4F0LA 3E3HA 1YNQA 3VNKA 4MLRA 1OGSA 1SM9A 1U33A 3NG3A 2RGMA 3W7RA 4WGHA 3USZA 3SN4A 2P10A 2VEMA 2IPWA 3NQDA 4GQ0A 2FTPA 3TVAA 3N17A 4LWWA 3DFSA 1TIWA 3TW9A 4GKTA 5BZAA 3W75A 2BY2A 2B7QA 2WPBA 5G2WA 3IGXA 3DH7A 4IMAA 5C2XA 1OWQA 1VPQA 2WYSA 2BWGA 1D3CA 4NI8A 3DEQA 4FXFA 4DELA 2VQTA 4U2ZA 3BK0A 3STEA 3PY2A 4TU1A 1W37A 1EO5A 3EDKA 3T4CA 3NYDA 4K7VA 1R9YA 4MY8A 3RPTA 2PLKA 2Z1VA 1W9BM 1SZGA 3IJ6A 3RNDA 2BS9A 1F4AA 1TELA 2GWNA 1AK5A 3ZQ9A 5AYXA 4WR3A 5I79A 1FCVA 2E1WA 3W81A 4DM2A 1OINA 3MDUA 3HM7A 1VFSA 4LPCA 1RY8A 4TV5A 4AD1A 3SCVA 2ADAA 2VX4A 3FSUA 1JUEA 2X0SA 3LNPA 4AWSA 1PDYA 3NJ3A 3THAA 5AYBA 3KS6A 4HZ8A 4S3KA 1REQA 3W2UA 1L8NA 3TU9A 4FNRA 2DZVA 3PSWA 4IQLA 4RXGA 1Q45A 1UD8A 3VC5A 2PRLA 1G7VA 3AXKA 1S5VA 3DECA 3H6OA 2OVLA 3CIVA 4HT3A 1H50A 1E3XA 3L4UA 4J1OA 4OQVA 1QR7A 3EWXA 4ERIA 1IT8A 4LJ3A 2Z0IA 5H1WA 2ZCGA 3GC5A 4M82A 4JX6A 1XDJA 3GC4A 3VNZA 4OUEA 4Y90A 4JS3A 1NAL1 3R12A 1I2PA 4Q4OA 3OZOA 1JFHA 1WAUA 3UXAA 1RA0A 3GU1A 4XISA 1O5XA 1AD1A 1X7IA 3LM7A 3CYVA 1WDSA 1REQB 3BSHA 3EEGA 1VPYA 1Z8AA 3QW3A 2EG8A 1ZAJA 2CYGA 3CUFA 2QCDA 1UUOA 1PCWA 2J13A 3UR5A 1BYBA 4OIFA 2ZUVA 5CZKA 4E6MA 1K4GA 3L66A 6A3HA 1VCVA 5H6HA 1D7KA 4AF0A 3WQ8A 2WO5A 2REQA 1GOOA 2GVYA 4Z2IA 4NX0A 5EL1A 1XYBA 2FZBA 1JZ5A 5DMLA 3NQAA 5ECUA 3F2DA 1CLXA 5IM51 3ONCA 3KDOA 3RDKA 2NQ9A 1CTNA 3ITYA 2J7GA 2O7QA 2ALRA 2I5GA 3G3MA 5IFPA 2GYIA 2BVWA 6CGTA 1NM9A 3R5EA 4C6LA 1FH9A 4AY1A 4C7FA 1HQTA 4Q4KA 1C7TA 4CQ8A 1T7LA 3PPCA 1YNYA 1O12A 4CUCA 2VX5A 2VGGA 4AY8A 1KQYA 3EPMA 1LT8A 1EDGA 1NVMA 4HQVA 3PUGA 2WCAA 4LYPA 4CNSA 4PCNA 5MF5A 2XIJA 2Z6JA 3SECA 3CPUA 3WN6A 4S3GA 4G5DA 1Q6DA 3UGRA 2CHNA 1EPXA 5IHRA 3RN6A 4M56A 4AF0B 1IR2A 2J7DA 4PN2A 4X2RA 1JCXA 3TV8A 3VIJA 2C79A 2CBJA 4XTIA 1ONWA 1EX5A 2D2HA 1J11A 2AMXA 1O66A 1LJYA 4INFA 3TNOA 4BI7A 2F38A 3MBDA 3H26A 3G0XA 3U3HA 4WZHA 4PMOA 2H9AA 2ZE3A 3BLEA 3HGOA 4GISA 4NNBA 1E6NA 3WH6A 2ZX9A 1XIBA 5AY7A 5D9NA 4TX6A 3VDHA 5FI8A 3VOJA 1FKXA 4G1KA 1ZP3A 2FHCA 3FXYA 3IVTA 4GINA 2VCBA 2X2GA 4FXSA 3P7YA 1CXKA 5BOFA 1I75A 4LAMA 4QDMA 5BOEA 1VBUA 2Q3RA 1V6VA 4RZ6A 3V5OA 2E6AA 1H1ZA 3AIEA 5KEZA 3A3HA 3GYCA 1YXYA 4KFNA 4O50A 1WKDA 1G69A 2CETA 3VNLA 4I5RA 1A50A 2WMJA 1TCDA 3WUBA 1E72M 3T78A 1Z42A 1E56A 2VP8A 1NOWA 1O4UA 4UTTA 1VIZA 2ONEA 1J0HA 1VH7A 4GUJA 3KBSA 2CHOA 3RLVA 3F03K 5DO8A 4ECLA 1TPDA 5BXRA 3G8EA 4Q4RA 1WA3A 1P1XA 1GVYA 4LXFA 1NWRA 4U33A 2DVTA 3CU2A 1MW2A 2J7CA 3W29A 1MVYA 1VHCA 3UERA 1VEPA 1HNYA 2PPGA 1CLKA 2OSWA 4U28A 4L56A 4AD4A 1B30A 4D6EA 4ZBCA 4L6HA 3WIJA 4U2YA 4GY0A 4Q4QA 3VD4A 1FWAC 2HPIA 4ZO9A 4XUYA 2BY0A 4JNZA 4MUPA 2BV9A 2X7WA 3S4TA 1K4HA 2YX0A 4MNLA 1YPIA 4NF7A 4KCUA 3F4VA 4JDBA 5CJ5A 3LXBA 1KBKA 3V5CA 3QXBA 4RPQA 2TRSA 2C13A 3EWUA 2ISDA 2OSYA 1JXKA 4E5TA 3MHFA 4JZ5A 1JZ3A 1XIJA 2F2KA 1FWEC 2WSPA 4W7VA 3SSJA 5K3VA 2Y63A 4H6RA 1VLIA 1BG4A 3SSZA 1SMDA 1VPXA 1ZHAA 3WEMA 3K8LA 1B0IA 3IVUA 3NZPA 2DU2A 3ERPA 3HPXA 3O6DA 3R43A 1TUXA 4JTRA 1UIOA 3S9YA 4W88A 1XYAA 2DZWA 4Q7IA 4A3HA 3GUWA 4R85A 3PR2A 4R5EA 1OF6A 4NX5A 2RDWA 3EX3A 1EIBA 3NZGA 1DPMA 3NOEA 4AQLA 2TMDA 1N55A 2Q01A 1GQKA 2HMCA 2PDLA 4O1AA 5LNSA 4FXRA 4ZCWA 1QNSA 4MY1A 3ABQA 4DX3A 2NZLA 3NO1A 3KWXA 1TE6A 3L65A 3N11A 4BA0A 3AHTA 3MSDA 3U2ZA 1QU4A 3P93A 4US5D 5ENLA 4I8YA 3MWCA 5A8PA 4GLEA 5EMKA 1OFBA 2E6YA 1EJWC 4HA3A 1FH7A 4S38A 1WPCA 3DGRA 3VKBA 5KZMA 1GORA 3F7JA 3RLUA 1OCBA 4NP7A 5HOSA 1OIFA 1TE1A 1QOPA 3I4EA 4JTKA 3TZNA 4ILSA 4UNKA 3E74A 2VRJA 1EP3A 2WNZA 3LU2A 4DO6A 4GGBA 3PSVA 3A4XA 2QJJA 3QV9A 1HO4A 1PSCA 1UYQA 3IARA 4QJ1A 5C9ZA 4NJKA 5BROA 3N4FA 3SY1A 4MF4A 2OEMA 1ENUA 1OC6A 3OU8A 3UNDA 2ZXBA 3F5JA 4F9JA 3WBEA 3VILA 2OZ0A 4P8VA 2CLPA 4LGXA 3NOYA 4IPJA 4B5UA 4ZA0A 3EB4A 3N9SA 2E6DA 3PF3A 3AROA 2HBVA 3C61A 3OLDA 1VAHA 1IEXA 1ITUA 1SR9A 1FTXA 2YZ5A 3N2CA 3S9ZA 4I6KA 2B7PA 3MHUA 4NZ4A 3CM4A 1MDLA 1OIMA 3B9NA 3LPGA 3N2BA 4IIDA 2PWFA 3C2RA 3AMGA 4YN5A 3GDLA 2PDKA 3TZFA 4ML4A 3CWOX 2HNHA 4AX6A 4O19A 1OGBA 8A3HA 3LRLA 4UQAA 3DYMA 1I1XA 4XV0A 3OZPA 3MMTA 2OQHA 2W63A 3IV3A 3KE0A 3LHTA 1B31A 1H3GA 3U5YA 4JL1A 4MTVA 2WMFA 1R7OA 4F79A 4YVXA 4BY3A 1V6TA 1FRBA 4JTIA 3KRZA 3M0IA 5EA9A 5BRBA 1H09A 2XFYA 3WJXA 1S5WA 1EOMA 3UR2A 3RYSA 4A29A 1XRTA 1C3FA 4MMWA 2OLSA 3NYZA 5HK4A 4K2SA 3EKZA 1VFTA 2BVDA 3RU6A 2Z29A 3T4WA 5KTLA 1GT8A 5LA0A 3FVDA 2JIEA 2B81A 1UR0A 2AGKA 3T9PA 5DF0A 3H54A 3Q45A 1NF7A 1LRTA 3G5EA 4HN4A 3DERA 3FYPA 4DAFA 4JEQA 3DFHA 4AHQA 3HPSA 4D2JA 4ZO7A 4F0MA 5BRQA 5CSYA 2I5IA 3EWCA 4F2BA 2RKXA 1X6NA 1XBVA 1R5YA 2E67A 2FTYA 1XC4A 4ES4A 3DFNA 3AICA 2WVUA 5FAJA 2IXVA 2C15A 2C91A 3VFLA 1SO3A 4PFMA 3GHRA 4HNNA 2GOUA 5TQLA 1UPPA 3M0MA 2A79A 3N19B 3MU7A 1J0KA 2R91A 3KTCA 3QPEA 4GC3A 3WENA 2FQIA 3FKRA 4CN1A 1K8ZA 4WGXA 4DQWA 3PZIA 3T0BA 4JIQA 2GUUA 5EYWA 3IUDA 2BZNA 2G41A 4A2SA 2EKGA 3BZJA 1JEZA 4K6AA 1RD5A 4PB5A 5IDZA 3OB8A 5HMSA 3CAQA 4XZIA 2C71A 3NZ1A 4C6PA 4IP7A 1Y5XA 3WUGA 4IOTA 2PLJA 3TR9A 1GKPA 2GVGA 2YDQA 1MEHA 3PBYA 3GSMA 5G4WA 3LTSA 3LPPA 1NDYA 1SFLA 1JF6A 1F8MA 5DEZA 3TA9A 2DH2A 2ZIDA 3QPYA 2O9RA 2G3FA 3B0PA 3MB9A 1BGAA 1H7PA 1O60A 4S39A 2RDTA 1JZ2A 3MP3A 1EJTC 1WUFA 1A0DA 2WSQA 1KRBC 3I6EA 3SUWA 3VI2A 1AZ1A 4B91A 3PVFA 2YDSA 1DWGM 2PDFA 3E02A 2G37A 4WUIA 3T0DA 4XD5A 5FD0A 5G1YA 2JEPA 3NZQA 4KBXA 4LEQA 4QDPA 2E40A 4I9JA 1JYVA 4HJFA 3GQYA 1QBBA 4MYXA 3QLDA 1P0EA 1E4NA 1OY0A 2RJHA 7ENLA 3EWDA 2CIPA 3A24A 3C0JA 4Q8PA 3AYSA 2FZDA 3WDRA 3KS5A 5CGMA 4EF8A 1BWLA 2WSYA 1VKFA 4GXWA 4CCZA 2ABAA 5D37A 1MQQA 3WLJA 3KL3A 4P7OA 1H1YA 2WHLA 1JCNA 3HFYA 3BOFA 1JFXA 3GDMA 3TKFA 1V79A 2NLIA 1DL3A 4O16A 2WC3A 4JTSA 4RW3A 4RE3A 3TJLA 1DORA 3UVIA 4O18A 1E3ZA 1DXIA 2G3MA 4Q22A 3CHVA 4CU8A 3MO7A 3VABA 1GVQA 1JD9A 4HZ7A 2VCCA 3N4AA 1UR3M 4EPKA 5T91A 4IG2B 1IWPA 5FJJA 2J7FA 3GR8A 1P0KA 2C18A 4XK2A 2CBVA 1SW0A 1TSIA 4K68A 2FZ9A 3T7VA 2XWEA 3FYYA 5T9CE 3P60A 3UBPC 3P14A 1IXQA 1EH9A 4GPNA 3BCDA 2WB5A 3VDAA 4JDYA 3VDBA 3W7HA 1XQKA 3RRAA 2P3EA 1B3XA 5CH9A 3T2OA 1I2RA 3N4EA 1CEOA 2YCKX 1UD5A 3VAVA 5LGZA 1TPB1 3WDQA 1Q6GA 2IXUA 1BWVA 2OJPA 2Y5JA 1V4YA 3B4YA 4O1EA 4GCXA 4RZBA 4JX5A 3RR4A 2OYKA 5I0DA 2EG7A 3W7OA 1B3ZA 4YMZA 5A8GA 3FHQA 3VZXA 5A1AA 2NQLA 3EWYA 1VJSA 1AH4A 4ZQNA 4WQ6A 3S2CA 2ZUUA 3LZ5A 5I06A 1Q85A 3VU2A 2XM1A 4M7TA 4W8AA 4QXIA 3W7DA 2VGBA 1FHDA 1SFJA 3AFBA 2JE8A 2VZUA 3FA3A 1PWMA 4WD0A 1E1EA 4YYCA 2V0TA 4G2DA 4XB3A 3MSYA 1O5KA 3VINA 4XZNX 4LH8A 3W1LA 2IKGA 4P5UA 1W1PA 1JZ8A 2Z1XA 1UCWA 1Q7MA 3MQTA 4S3DA 1DJQA 4JTJA 1VS1A 2BNJA 1H0GA 3S0CA 1J12A 1VFOA 5E0KA 3WD2A 2FZMA 3UWQA 1ZJAA 4TUFA 1K8XA 1EWEA 2PWGA 2OO6A 5FAGA 1SO5A 3CQJA 1E6RA 3NVTA 1KRAC 3AMKA 2EPNA 3CL8A 1E0VA 3RLHA 2GJLA 2Y24A 4NU7A 2X16A 3WLMA 3GG8A 2VVNA 1BG9A 3GTFA 1WDQA 3UVAA 2JKPA 2J8FA 3KRSA 4A05A 4POCA 1OC5A 3N34A 3LHUA 1XFBA 2QCEA 1TWDA 3C0SA 1HKVA 2BHUA 1RJQA 4JIHA 5I02A 5GPRA 3PULA 4PCFA 3U2CA 1W2PA 2NQZA 3QW4B 3IACA 3KAOA 1DIDA 2GGJA 1XLHA 3ORWA 3DBNA 3L0KA 1PTDA 4Z42C 1SJDA 4ZQMA 2ZICA 4EWND