1UMYA

Bhmt from rat liver
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
389
structure length
374
Chain Sequence
KRGILERLNAGEVVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASSGQKVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKIFHQQLEVFMKKNVDFLIAEYFEHVEEAVWAVEALKTSGKPIAATMCIGPEGDLHGVSPGECAVRLVKAGAAIVGVNCHFDPSTSLQTIKLMKEGLEAARLKAYLMSQPLAYHTPDCGKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWIRARARKEYWQNLRIASGRPYNPSMSKPDAWGVTKGAAELMQQKEATTEQQLRALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of rat liver betaine homocysteine s-methyltransferase reveals new oligomerization features and conformational changes upon substrate binding.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Betaine--homocysteine S-methyltransferase 1
total genus 124
structure length 374
sequence length 389
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.5: Betaine--homocysteine S-methyltransferase.
pdb deposition date 2003-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02574 S-methyl_trans Homocysteine S-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.330 Alpha Beta Alpha-Beta Barrel TIM Barrel Homocysteine-binding-like domain 1umyA00
1Q85A 5DMMA 4CCZA 5DMLA 1Q7ZA 1Q7QA 1Q8JA 3BOLA 1LT8A 4M3PA 3BOFA 1Q8AA 1UMYA 1Q7MA 5DMNA 1LT7A
chains in the Genus database with same CATH superfamily
1BTCA 1PZ2A 2ASHA 2J9XA 4PH6A 2YCLA 1QW7A 3IIPA 2CFFA 1EP2A 1JRCA 3ZYZA 1C90A 4HK7A 4M6QA 2F7FA 3KAOA 1NAL1 4DF1A 1GYMA 3W53A 3DENA 2WZIA 5EFDA 4LB4A 5LXEA 3CQHA 3UG3A 1XIMA 4BEUA 4JQ4A 4WRHA 4ZA0A 3U7VA 1YDYA 4RDZA 3VO0A 4O1CA 2Z1VA 4O0KA 3O6AA 3U8GA 4HJFA 2XTKA 1CLXA 4LCSA 4NL1A 3LXAA 4LH8A 4D2JA 2VD8A 1JULA 3A4WA 1Z89A 3A5VA 3QV7A 3FA3A 3AIUA 2QDHA 2CKRA 4XD5A 3OU8A 1S5NA 3WMBA 4ZB2A 2UZ9A 1EA9C 2R24A 5CPNA 3BICA 4RPQA 1VHCA 1OVDA 4MJZA 3OIXA 2P5NA 3H2EA 3T4WA 3O3RA 1TPH1 1EXBA 3LPGA 4LANA 4J2MA 3NL3A 1NEYA 1Q65A 3FA5A 3QRHA 3AHTA 2NWRA 3L12A 2E8YA 5F4SA 2C91A 4E2BA 3RDKA 2Y70A 4WGXA 1D7KA 1FX6A 1TV7A 3MJYA 3I65A 5I3IA 1CGVA 4NX0A 1JZ8A 1IR1A 3NQMA 2C0HA 2VQTA 1CTNA 3WK1A 1XYMA 4DBDA 2QPUA 1AG1O 3QSTA 1A0CA 3WFZA 1MO0A 3DFSA 2ZZ4A 1EC9A 2Y62A 4Q8UA 5K9CA 3THUA 3R5EA 1R3TA 1XPGA 3WELA 4UR7A 3OVRA 4HZ7A 3NGJA 1VZWA 3OW1A 3VX0A 3B0YA 1GUVA 3TOYA 3JVAA 5EGRA 3A9BA 3G1AA 2Q3OA 4CUCA 3AXXA 1B90A 4JBRA 4ICNA 1TO3A 3VINA 4YCPA 5DCDA 3W6LA 4FS9A 3IV8A 5AC7A 1FWBC 1SZNA 3EMQA 4I8DA 1RD6A 4O15A 3HU7A 2I57A 1E73M 3E38A 2Y89A 1MI3A 5H2ZA 1IT0A 3GHUA 1OK6A 4OFCA 3GD6A 1DE5A 1Y5VA 2XIIA 2FHCA 3EXTA 1XLLA 1S5TA 5LA2A 3HN3A 3QLLA 3UCDA 3A9IA 2WMFA 2DZSA 5DFAA 1QASA 2FDSA 3V3WA 4REQA 1P0EA 3NQ6A 2IPGA 4NHVA 4WKHA 1HJXA 4DX3A 3VOJA 3M0IA 1KKRA 3FY1A 3TYCA 2YJQA 1ZLPA 1TZ9A 2ZRXA 1CPUA 4MUZA 3KVMA 3CMJA 1NDVA 4XBJA 4L80A 1W3HA 3SFWA 2IKHA 3C8FA 3ZMRA 4E2VA 3QV9A 1M65A 1HP5A 5FA5A 5H8UA 1P7TA 2G3JA 4ZO8A 2QAPA 4IQEA 2P1FA 3ES8A 2E5DA 3A6OA 3LRMA 3TJXA 1TJ1A 4JD4A 4UFIA 2OWXA 5GJNA 3WDJA 3W7JA 1WQ5A 3H24A 5AHLA 2YIHA 1HKVA 1EC7A 2CITA 3CXOA 3HV8A 1KRBC 5CCZA 4JCLA 3QW3A 3IAPA 1CGYA 1L2QA 1PHQA 2BODX 4LAZA 5CC3A 3GW0A 3VI2A 5LSMA 4EE9A 1W3TA 1HJUA 4WJEA 5GQBA 5FEZA 4MFDA 1G4EA 3CNYA 1N8FA 1XICA 1BQGA 1UJQA 1I0BA 1F61A 2E5CA 4Q3MA 1L6SA 3WBEA 2XWEA 5IHSA 1UKOA 3CMFA 1H11A 3BV4A 1PDYA 1ZTVA 1ONWA 2Y4SA 4DI9A 4EPEC 2E9LA 3RN6A 1OK4A 4INFA 5DCBA 4L9YA 3GVGA 1SFLA 2J9YA 4B9YA 1DOSA 1UD6A 1MSSA 4NZJA 3HF3A 2WVVA 2IUZA 3NEVA 3LSCA 3S5YA 7XIMA 2J27A 3QPEA 2QXWA 1MVYA 4L6OA 2CWNA 5DXYA 4A8RA 1PIIA 3L4VA 2PZ0A 3JU2A 4CGTA 1AJ2A 2E5BA 2EQDA 1WKYA 2WWCA 1J18A 1RPKA 5AFDA 3PJWA 2CXGA 4H8UA 4PUUA 5K9XA 5HPOA 4FK9A 2ZC8A 3CV6A 4QQUA 4LVDA 4S3AA 3D3FA 4L1GA 3YPIA 1FCUA 2PP1A 4AZIA 3WDHA 2CZVA 1KXTA 1Z7AA 2ZRVA 5JH1A 1QO5A 1QPOA 1XIDA 4LAKA 3SN1A 1W1B1 1G94A 3FJNA 1VLIA 4GO9A 1PAMA 3E2QA 4QHRA 2HXTA 4IFRA 3AALA 5CZ0A 4CCZA 1H7XA 3LTYA 2GVLA 4WZHA 1YEYA 3PUGA 4UOZA 3DEQA 5KZDA 1VPXA 2ZZ6A 2XVGA 3EB2A 2RDTA 4HD5A 2WMGA 2J74A 3OO2A 1S5MA 4D6HA 4DLMA 4JDBA 1OABA 1TJ2A 2ZA1A 1RALA 3DI1A 4UQBA 2PWEA 4JTFA 2YCIX 2MNRA 1LRTA 1FXQA 5G5IA 6ALDA 2RFGA 4OU1A 4P8WA 3H21A 4NI8A 3E3HA 1WOAA 5C7HA 4ZB0A 2NWSA 3F1QA 3L0KA 1TVLA 4JTSA 1JCNA 4KCUA 4O13A 3KWSA 1VH7A 5I02A 1RH9A 3F2CA 1WAUA 1K02A 2FZ9A 4UZUA 5IDIA 5CG7A 3C4UA 2XG9A 3C0JA 4Q7IA 3T0TA 2DZUA 2EAWA 2NQZA 3N2BA 3ABXA 2RGLA 1WB0A 1U5VA 4YLWA 4AZCA 1X6UA 1X38A 4PYSA 3M0MA 1ME8A 1EHNA 4K8GA 2YBUA 3TN5A 2QV4A 1QPQA 2PRHA 3IV3A 2V2CA 5TF0A 3W28A 1UUMA 4H6RA 1WKEA 2YLLA 1JIBA 1KXQA 4CNNA 4W85A 2VUYA 3KBNA 1JZ7A 5ABGA 3TR2A 3VX1A 5JVLA 3PFRA 4KGLA 1TREA 3KL3A 4HPGA 1FWJC 4DJED 3G0UA 4XD4A 1HO1A 3I7QA 2O0TA 3EWWA 1VBRA 4P7QA 1TA3A 4JKLA 1TPEA 1LTDA 3RM8A 3LHWA 4FA3A 3GDRA 1NQ6A 1BKHA 2NLYA 1JNEA 3DHDA 3WBWA 1J4EA 1QR7A 1A0EA 4PUJA 3W23A 1TV5A 2Q01A 4K3ZA 4QE1A 4TQTA 3VAVA 1CGTA 2HXUA 2WAGA 1NDWA 4MYXA 3NOYA 3V0TA 2WC3A 2OZ0A 1A0DA 3GB6A 5JQ9A 3SUVA 3VIIA 3W83A 3VGBA 1VIZA 4I3GA 2C19A 2ON3A 4M6PA 1VFFA 3ICJA 4TV6A 1OM0A 4O50A 1YXCA 5D02A 2D3LA 4W9TA 3PR2A 5AZ0A 5A95A 3LYEA 4F66A 2PWDA 1VFSA 2BY3A 4GHRA 4JHMA 2UY3A 1CXHA 1FWGC 4WGHA 2EGZA 5I00A 3TW7A 3DXIA 5BU6A 4J3WA 3VFLA 1H0IA 2C7FA 3EDJA 4C5ZA 1IXQA 4TU1A 3AWOA 3KOYA 5CQ1A 1YW1A 4JGDA 3N3TA 3C2RA 4H2CA 3GXTA 3QPYA 2EPMX 1O66A 1CX9A 3EKLA 3ATZA 2ZZ5A 2ZZ7A 1AUSL 1JG9A 3KRSA 1VYSX 4MNJA 3RUBL 2RUSA 3ZOAA 5FF2A 4DPPA 1KA9F 1V0KA 1KCXA 4I5XA 4UFMA 3I10A 4UNIA 3VCNA 1O12A 2A2IA 1K6WA 3A13A 4C6QA 2GK1B 1A53A 1BYBA 1U33A 2RDUA 2ZXDA 3WQ4A 3P60A 5AKQA 3AS0A 1UD2A 4O14A 3IJDA 3RX3A 1XC6A 2AL1A 1Y65A 4H9VA 3BLFA 4RDVA 3NQAA 2QJNA 3B9DA 4AF0A 2O9PA 1GYNA 3NZPA 2X09A 2XZ9A 2C71A 1MDLA 1FHLA 2C13A 1TWSA 2RJGA 5JBEA 2PBGA 5FSDC 1C9DA 5I09A 1EJVC 3G1DA 3IK4A 3LQGA 1C7SA 5I78A 3SCSA 3LPOA 4YWSA 1KM0A 2X2GA 1OFDA 3MVTA 4DZIA 1DJGA 5MKGA 2BOFX 3TC3A 2X7VA 1ML1A 3OBKA 2QQ6A 3A12A 2GUBA 1ZJHA 2NT1A 3F5KA 3DHFA 4PB5A 3C2EA 4GGBA 1XIIA 4YWIA 1ZP3A 5C70A 3FK4A 1TCMA 3KOZA 4PUWA 5LYRA 1ITUA 1AQHA 3U0HA 1ZRQA 3GG0A 3WO8A 3N2CA 1H5YA 2WHJA 1BRLA 5T9CE 4O17A 3EPOA 4C6NA 1D8WA 4ZQCA 5LIKX 3BL3A 5E1QA 4ATLA 2DVTA 2YW4A 4Z17A 3BSHA 4ILSA 3MKKA 1IEXA 1YRRA 2IMRA 3GIPA 1OBAA 4UQCA 4RV8A 1QNVA 1WA3A 2GFTA 2CHOA 4GG9A 1T96A 1SU5A 3EZ4A 4FALA 3QC0A 2HRWA 3LG3A 4QX4A 4QM1A 1HFBA 3EBVA 1E43A 3RJYA 4P61A 2NUYA 1ISXA 5AECA 3H4WA 4R7JA 3QTGA 3IEBA 2F9RA 3AIVA 3P6LA 1UWSA 2YL5A 3UERA 4ZMGA 4UMAA 3BG9A 2ZVRA 3KOWA 2L5HA 3WQCA 4I7UA 2IKJA 1F6YA 3QGKC 4QP0A 3U3HA 1R0MA 4PTVA 4A3QA 1GVSA 3RFAA 4WY0B 3WF2A 1SJCA 4ZSTA 2R8WA 3UCQA 3NR0A 1UA7A 3MUCA 5FF4A 4DLFA 2E09A 2PCEA 1TELA 1UP2A 1PKLA 5CSUA 3DX5A 1JAEA 1TPUA 3BK0A 2VRQA 1L8PA 3PY2A 4AUBA 2WMIA 3ZT5A 3MSGA 4N6FA 4YHEA 3VD4A 8CGTA 2UY5A 5HR7A 1A49A 4TUFA 2OVLA 4IL0A 3EWCA 4GZEA 3KOFA 1XUZA 4AD4A 3TA9A 3ZJKA 3A3HA 2VGFA 3SRFA 3KBJA 3QFWA 4JX6A 4MVAA 2VC5A 1NP2A 1IV8A 3CIWA 1Q8JA 2PGFA 3W1TA 3PNUA 4HJWA 1H0GA 1DWIM 1VF8A 3T0CA 1MEWA 4ZVJA 3K4DA 1OFQA 5FF7A 4PZVA 4YYFA 1HT6A 4UCGA 3W1UA 3W22A 4G1NA 2PRMA 3EMCA 1RJRA 4OBSA 3FJLA 2PAJA 3V35A 3OLIA 3QKEA 4O1AA 1RCQA 3CU2A 3VD3A 2IPFA 5I3HA 3BARA 4NNCA 3WDRA 4XTIA 2OEJA 3TYZA 3CS2A 2V5JA 2DZBA 4HU8A 4B5XA 2OZ8A 3KVJA 2JEPA 3LZ3A 4KKXA 3V5OA 1EIBA 3LNMA 4G6CA 4IMGA 1LCOA 2INFA 3GHSA 4LUJA 1Z42A 4EAMA 4DAIA 1JPDX 3MHFA 3TSMA 2J7BA 1FH8A 4QIUA 2WANA 1LL4A 2HNHA 1IYXA 2OGJA 1KLYA 7ODCA 1M7PA 1XIEA 4DEFA 3B8DA 2E6YA 1NM9A 3TWAA 4OZOA 2OEMA 3MP5A 3ZLGA 1SW7A 4UBPC 2P76A 4ZXOA 3P93A 1JQXA 1TPDA 3SUSA 2QZRA 5CC7A 4KFOA 2DSUA 1V3KA 3SJNA 1TJRA 5EA9A 4C91A 1R5YA 4IG2A 1EX5A 1QCWA 4WXYA 4J35A 3DC8A 3SJ3A 3VCRA 4FX8A 2VX5A 4JTJA 2GOUA 4YCOA 4WOQA 2GSEA 1DJYA 5BMWA 3V5FA 3M6YA 4LV4A 1DQWA 2ACUA 4NJHA 3B8VA 2QJHA 3N12A 2IKGA 1CXEA 2C15A 4KEUA 2XH4A 3NQ8A 1C8QA 1FDJA 1ZCCA 3KUMA 1P0BA 2QMKA 4CN6A 3PUOA 2YLAA 2EG8A 4JTAA 4S39A 2W61A 3BO9A 4AD1A 5E0KA 3ZT6A 4F0SA 3EOLA 3W7CA 2H8ZA 4O1DA 1KRAC 4AZBA 4BQ5A 3KBSA 4KEVA 4NNBA 4ZO9A 4PTXA 1EO7A 1Q13A 1Z8AA 4LT9A 4QG8A 3LV5A 1JCLA 4U3AA 4WLCA 4MDOA 1G0CA 4G9PA 1SJDA 2Z1SA 3PVFA 4Q8WA 4HNVA 4R7WA 2ADAA 2D0FA 3PHAA 3ORWA 3FYOA 1TA3B 3VDHA 5AYXA 2F6KA 1UWIA 4NQ1A 5A6AA 1VCFA 5A6SA 1K7XA 1IXNA 1WPCA 3EX3A 3QZ6A 1UOZA 4AF0B 2UY4A 2D73A 5DMMA 3MU7A 1X1OA 4Q33A 4EX4A 1LRQA 5JBDA 3VKKA 3WH6A 1UHVA 3FNDA 4AZCB 3Q4DA 1K77A 3CZ8A 4HYVA 4WD0A 3BAKA 2XFWA 3TSDA 3WDPP 1A4MA 4GY7A 2A3EA 3WF0A 1V3JA 1E72M 4JFSA 3TE9A 1YIXA 1LQ0A 1R3YA 3LGGA 3W7RA 4BHYA 4HHMA 5AHEA 2YA0A 3QV6A 3N2TA 2ODOA 3B9OA 1A3XA 3Q2DA 2J66A 3MUXA 1SGJA 3TC6A 2ZIDA 2VP8A 2DP3A 4AZ7A 5HOSA 3CAKA 4O28A 2WC7A 3SCUA 1BGAA 1QI5A 1XYLA 3UPBA 4G2DA 3GVVA 1Q2SA 2WSKA 3U5UA 3L4TA 4BF7A 4RR4A 4QQ3A 3ZFHA 1M53A 3NO3A 3O0KA 1B3ZA 1P6CA 1UC5A 4X0VA 5F2MA 3APGA 4OKDA 4QRNA 1UR9A 1CBGA 1P1MA 2PDFA 2YDQA 3SSJA 1EZWA 3UNTA 5MHBA 3A64A 3ARRA 1DQXA 2WPGA 3R10A 5LHEA 3GBEA 3DG6A 3GNOA 3HFYA 1V7YA 5D38A 3NOEA 3CIVA 2OLHA 1E4LA 3TYBA 3QHMA 2V38A 4LV9A 3PB0A 1Z3NA 4QNWA 1XSKA 5BRQA 5JIPA 4H41A 5C9WA 2ZWYA 1L0PA 2VGGA 4KERA 1AFSA 1F3TA 4AD5A 4H1ZA 3LD5A 3S8HA 4IJBA 1OCNA 1QNPA 3ZT7A 3LI0A 3K5XA 1KM1A 2HQAA 2OKTA 1FFRA 4AX6A 1BHGA 1Q6GA 1SZGA 4JL2A 4Q6XA 2VCCA 1NOFA 4ERIA 1C3FA 1YPFA 3WLNA 4QFUA 4GZJA 1QI4A 1JEZA 4Z2GA 1R86A 3QY8A 3N3MA 1GEQA 4L64A 3PWAA 3CUIA 3BVJA 2Z2UA 2VEPA 1X8FA 1I2QA 2D3NA 2F6XA 5BXRA 5FJJA 4KCTA 2WNZA 1R46A 3SUWA 5MF5A 5AY7A 5F4XA 2ZYFA 4FNQA 1P48A 3SAZA 3PBMA 1B5TA 3M4HA 4IMCA 2G3MA 1B9ZA 3SN4A 5TIMA 2A1YA 3QGAC 1S46A 1OY0A 1W1PA 5BYWA 2VO5A 3U9IA 2WSRA 1J0KA 4ENLA 5FOOA 3R13A 5FJIA 3AIWA 3RR1A 1D3HA 3DGBA 5DRIA 1A5MC 4IJCA 3F4WA 3VC6A 5A6MA 2NT0A 3AS1A 1JRBA 3V0UA 3MBFA 3FS2A 3Q58A 5D8WA 3V36A 1W54A 1EH9A 2WHKA 4PRTA 1SUXA 3FJ4A 1D7FA 1W3IA 1RY8A 5C9ZA 3TYEA 3O6DA 4Q4MA 4QG9A 2HPIA 2G3FA 1CXKA 1XBVA 1SFJA 2PDCA 5CKSA 1I2RA 2VL4A 4DJDD 4EANA 1R47A 2NXHA 2ZE0A 1E1CA 3QMSA 4O53A 4HPXA 1OFOA 4HU4A 1FVPA 4FR1A 3I4KA 3UYCA 4J2PA 4XIAA 2YZ5A 4NZFA 1XD0A 3T6CA 4REQB 2QF7A 5J5RA 9CGTA 3GNDA 3NDZA 3W01A 1OT1A 1QHOA 2VT0A 3RCYA 4X3ZA 1E6ZA 2BMBA 1JZ6A 3CT7A 3IANA 1JCXA 1TX0A 2CLMA 3MS8A 3TP4A 3QYQA 4XVDA 2CKSA 4B3ZA 1PUDA 4H00A 3W73A 4RDWA 1GOWA 2X1RA 2XU2A 3OZPA 1QXLA 1VJZA 3GVQA 2CLLA 2GUUA 3SO7A 4E3VA 4FIQA 1J0ZA 3W0KA 4PMDA 4HU3A 5LIYX 5M5DA 4NZ5A 3QSRA 5G2WA 4DIAA 1DYSA 4PMQA 1QDSA 4E2OA 3AXHA 4GVIA 3SQMA 2XGBA 2QMJA 4FOKA 4C7DA 2WZEA 2BY0A 3LY0A 4J9JA 1LLWA 1KM5A 3S5SA 1NF7A 1HGWA 1U5HA 3HO8A 2A4AA 2VWTA 4JY8A 1UR4A 4XD6A 3WH8A 1XYZA 2VFHA 3CHDA 3QR0A 4D72A 3WF4A 3HG3A 3KOXA 1UUQA 2G4FA 2DU2A 2QUTA 2DEPA 2BP1A 3BWWA 1PCWA 1KLZA 3BGJA 1DWFM 1TE1A 2DY3A 3KL0A 1NU5A 2BGQA 4GUFA 5LA1A 4IPNB 2A5HA 3WQWA 2EPLX 1Q4NX 4CNOA 3SQSA 1SO6A 5EMUA 3TN6A 3A24A 4M7TA 1KFKA 1QWGA 1O60A 3WFLA 3W72A 1BWVA 2X1IA 2GVYA 1S3TC 1CXIA 3SDOA 1WDWA 1UR0A 5CPLA 4JYFA 2PF8A 3ALGA 3S6TA 2CESA 2WLYA 1XGZA 4PBFA 4B5TA 4CCCA 2GVEA 3E02A 3K8LA 3N4FA 1M3UA 3RIKA 4UFKA 1UA3A 2DSVA 3NDYA 1F4AA 1XC4A 3NL2A 4XKYA 3EDEA 1B31A 1QI3A 4UTFA 2DIKA 4HSHA 4JX4A 5U7SA 4RV3A 3RX2A 3EDKA 4MGGA 1JCMP 1QUMA 1O5XA 1OQFA 1OYBA 2WNNA 3U4FA 5I79A 4IMAA 4JFWA 4NJKA 4E2DA 1J93A 4HOXA 4N7QA 1PO9A 3K1DA 1W91A 1US2A 1X8CA 5AHIA 1K4GA 4MLJA 3W7IA 1OD0A 3TTQA 2X41A 2HROA 4L1XA 1SO3A 3GSMA 3ZLFA 5LNVA 3M0YA 2XFRA 1UJPA 4AWUA 1TJ0A 1GOOA 2GWNA 3LA4A 1JDEA 4IPPA 4DZ5A 5D32A 2DZPA 4BS0A 2A7NA 3QY6A 3OJGA 1A3HA 3FVMA 2J7GA 4HSNA 4XAYA 1OSEA 1G5AA 4LS1A 3PBWA 3TW6A 2E40A 1UZDA 2R14A 1HVQA 3CAQA 2XM1A 5FJUA 3TQVA 3GR8A 1J5SA 1XIBA 1UZ4A 1XBXA 4LY8A 3L4XA 2CBUA 3O15A 4GBUA 5CBJA 1OG0A 5DF0A 4HTYA 2I9UA 4FNUA 1JCYA 5AYBA 1GVEA 1WZAA 1YDOA 5TNVA 1I2PA 4X2RA 1EIXA 2ZUNA 1VPQA 1Y0EA 1EEPA 2DT2A 1RK6A 2NQJA 4S3FA 3LGEA 1L6FA 1R8LA 1FKXA 3IIVA 5A8PA 1AZ2A 3O16A 1REQA 3RLHA 1RD5A 1W32A 4YTSA 4IQJA 5EL1A 3VPLA 1GVOA 2FDMA 4V27A 5E5CA 1RPXA 2XIQA 1S2UA 3ANYA 3IGHX 1Z41A 3FJ6A 1XQLA 5CAHA 3WDIA 1GZGA 1V3HA 2AGKA 2ZWZA 1HL8A 1P5BA 2DH2A 1QOXA 4FAMA 3CHCA 1O5RA 4H83A 3GU9A 1XLBA 3BLOA 3EAUA 1U1HA 4YVXA 2OQLA 1OHLA 3FA4A 2VRKA 3DERA 1JPIA 1G1YA 3OZMA 2I14A 3UETA 3UEQA 3S46A 4GXWA 1E55A 2WPBA 4GINA 3SGUA 1POKA 3R12A 2Z6JA 2WMHA 5EMYA 1UR2A 2J8TA 4ZO6A 4ADTA 4BQ4A 4P7OA 2FTWA 1KWGA 4YNGA 2OPJA 3W2JA 3WD4A 1HL2A 1VCGA 1JZ4A 4EWJA 5KETA 3CT2A 4HP5A 3MMWA 4L65A 5LXXA 4H19A 4WQ6A 4LYQA 1R9XA 1TTIA 4NU7A 2RHGA 1C8VA 2ZX8A 3RX4A 1CZ1A 1UH2A 3PFMA 4GKTA 3GFYA 4E4FA 1H7WA 3N4EA 3NJ3A 2Z1KA 3MMUA 4W5ZA 4C6MA 4H8NA 3LTPA 1EOMA 5HXMA 5HWJA 4A6GA 4D6GA 4ZXLA 4B5SA 3CZKA 4XKYB 5AC8A 4YS1A 1Q5MA 1V0NA 4K39A 2DW7A 3UZJA 4IMEA 4PMXA 2X7WA 1ZGDA 4A22A 4I9TA 3TVAA 3STPA 4UTLA 4TX6A 2PUZA 4PE8A 1EYEA 3H2MA 2OX1A 4Z2KA 1EJTC 1E56A 2V63A 3FSTA 5TD4A 4D9PA 1H1ZA 3SB0A 1FHUA 1AJ0A 3H23A 4UOQA 1QW8A 3EA3A 1YX1A 2OSXA 3F03K 4R7OA 2G3NA 2D0GA 2B0MA 4C60A 4ATDA 1TTPA 1VBHA 2YBVA 4GYKA 4XK2A 2G95A 3WQDA 4JS3A 4PMYA 1KFEA 3FKKA 4UMBA 4B91A 4BR1A 2OYLA 4KQNA 4KS0A 3CK5A 1Q85A 4PGLA 5G1YA 2YB4A 3GHTA 2P0OA 3FX4A 4JTIA 4MAVA 3CUXA 4QEEA 4B4FA 4QJ5B 4C65A 5LNUA 4IUOA 4RK8A 5LNRA 2PWGA 4AEOA 5XIAA 3F5LA 2ZE3A 4GUGA 4IP7A 2Q71A 3GU2A 4JHOA 4D8ZA 3LI1A 4AC1X 3R11A 2WZHA 3VIMA 3BQ6A 1FCBA 3R8RA 3W2NA 4JTUA 1IIHA 2VYOA 1GG1A 1OCJA 3AICA 1PYFA 1T41A 5CBBA 1BXCA 2PTYA 3NVDA 1JPKA 3QJAA 3JW7A 5FJRA 1KCKA 3GWQA 2QCHA 2YB1A 1YNPA 4H04A 3A21A 5HPCA 3TSBA 4PR4A 1QW9A 1QK0A 2QGYA 3B9NA 1E6RA 3RLUA 4C6DA 2XSXA 3STCA 2JGQA 1KV8A 1UKPA 4Q8TA 3UWQA 3BLKA 2X1UA 4M7SA 5C2CA 1TUFA 4H2HA 1WZMA 1HJSA 4X9SA 1ZPTA 4W8AA 4EACA 4JTEA 1PEZA 3RRXA 1JR1A 3HG5A 1ZS2A 2QEZA 1VENA 3WEOA 2WM0A 5EMLA 3ZLHA 4JTKA 3C3NA 1CYGA 3BV7A 1NVMA 5K4ZA 4IXHA 1SZFA 4OBRA 6XIAA 3GIYA 4KCWA 5ECUA 2J7EA 1SSDA 3CWNA 3HPSA 4IX0A 3STEA 2OEKA 3MP3A 3IWPA 3ITTA 3PBUA 3R58A 4U4MA 4U2YA 3HFTA 1DJNA 5LNWA 4BY3A 5CPQA 5FAGA 2P53A 4Z08A 5D37A 4AHOA 2GOKA 2XIBA 2YOCA 3C56A 3O6YX 3AMKA 3HBLA 4IMDA 3QOMA 2HBXA 3BSMA 1B3WA 4ZE5A 1M1BA 1CB7B 3M0LA 2FJKA 3A3XA 3CQ0A 1V4YA 1BYCA 3G8EA 4MIMA 3MW7A 4BI7A 1M04A 5JU6A 3T2QA 3JZEA 2YFNA 2VX7A 4J28A 1EWDA 4N6EA 1ZENA 3THAA 5GJPA 3CM4A 2CPUA 3DZ1A 1LBFA 1N82A 1WXZA 3VFCA 3D0CA 3PPHA 3T40A 3S6OA 3GTFA 3WQEA 1ELSA 1HIZA 4MJMA 4GYPC 3WLHA 4PBGA 3MMDA 5D2XA 4C1KA 4TVDA 1OIFA 1DV7A 1WP6A 3LK6A 1DE6A 4ZBCA 1WZLA 4PA8A 4M19A 1V6VA 2Q8ZA 4PCSA 1G7VA 4UTMA 3ARTA 1JQVA 1E0UA 1R2SA 1B30A 1XFCA 2JKAA 3P14A 4WR3A 4P8VA 3GAKA 2X8RA 3B8UA 4Q4PA 4B5VA 3CH0A 2XM2A 1HQTA 4HSOA 4QBXA 5BRBA 1WDRA 4IQLA 1KM2A 2MANA 3ARSA 1DIKA 3LHYA 1W5OA 1VR6A 4PN2A 1L6YA 4LXFA 1QO2A 3M44A 3VOCA 2VQUA 1TV2A 1RSCA 5G4HC 3KRZA 2EKGA 1ZBVA 1Q3NA 3H7UA 2PDUA 4LAMA 4IISA 4IOTA 3FXGA 4M24A 3N9RA 1JGIA 2TPSA 4X9YA 4US6A 2VHLA 1E5JA 2Z26A 2CYGA 2DW6A 5I3FA 1SM9A 5I5RA 4MNMA 3TFCA 5DANA 2DZXA 3MWCA 1UMLA 1RP8A 4FF7A 4GQQA 2F8QA 5CPMA 3DAQA 4Q8MA 4ROQA 4GCAA 1UIPA 3I6TA 4LCRA 3B97A 3MDWA 3BGAA 4FOJA 5IFTA 3AO0A 1VLWA 3G1HA 2PTZA 4ZB5A 2YXOA 1PX4A 3LENA 1ESWA 3AYRA 4K2SA 1CNVA 1ADSA 3S2LA 1J12A 1I1WA 1X1ZA 3LDVA 4GISA 7REQB 3UXIA 4KBXA 1EWEA 3GYCA 4PCTA 4GJJA 1AJZA 2PD9A 1OZQA 3QR1A 5L9FA 3CMGA 1UR8A 3GO2A 3T0AA 3TNBA 2GVGA 5HATA 4LEQA 4B92A 2X42A 1QRQA 3UZXA 1PIFA 2C16A 1TR9A 3WD2A 2PLMA 3WK2A 3XINA 3MDUA 3DBNA 3FYYA 4MPKA 4DJEA 1M41A 4WXZA 2ZFAA 2WCSA 1WBHA 1K70A 3SY5A 3ID7A 4QXIA 1BRLB 4WDTA 3RXZA 3ITCA 3KHDA 4LC6A 4F3HA 1R3RA 4XQ6A 3WQOA 3P74A 5HNUA 1WNOA 5K3VA 3GVWA 2JIWA 1CGWA 1XLMA 3C6CA 4GPNA 1W5PA 1V6TA 5ABFA 1JZ3A 2QJGA 3TCEA 5C2XA 4J3TA 3KZSA 5C55A 4JX5A 3RLGA 5HULA 4NG3A 3EX6A 5HJLA 2ZTJA 3EA2A 2UV8G 3W2LA 1FHVA 1UWTA 5KITA 3B03A 3NPXA 3MV01 2A85A 1H41A 2W5FA 4XVEA 2XVPA 4LYKA 3VOGA 1QPRA 4BFAA 1OFEA 2MUCA 2E6AA 4CU6A 1JZ2A 2HZGA 4IPIA 2VVNA 4OT7A 3OBAA 4FR6A 3MHUA 4JR5A 1A5BA 2V3GA 2AKZA 1S39A 3U6WA 2F2HA 4GOAA 1GOMA 3GR4A 4HNNA 3KM8A 4G8TA 3QW4B 1Q6DA 4PC8A 1EDTA 3I3EA 3RO8A 1DXFA 4BA0A 2JKEA 3CB8A 3FDKA 3VMNA 4JFVA 2XVKA 3BCFA 5C9XA 1QHZA 1FKWA 4IP4A 3KZPA 3NWRA 2QJMA 4PCPA 4S23A 3MB9A 3TLQA 4XZWA 2CBIA 4JHZA 1PV8A 3FSUA 3AROA 2J62A 3ZZ1A 4FLQA 3KFTA 4JY9A 1N55A 2J6XA 3LHUA 2PA6A 4YJ5A 1V0MA 1RCOB 1OC5A 3CWOX 2POTA 3VU2A 3EX2A 3HJZA 3VGEA 3LM3A 5CC5A 1X6NA 5EU9A 1NJJA 4S3KA 1OF6A 4DVOA 3IUIA 1W5NA 1TG7A 4ERAA 4JTGA 4JN6A 2VENA 3MP4A 2REQA 4QJ1A 3P7YA 3T9PA 3SR7A 1MUMA 1LLOA 3ZXWA 4ZOCA 3TTOA 4GWEA 1EFZA 4S3JA 3BG3A 4AYGA 3KRBA 4M29A 1E4IA 1V77A 1XGDA 2XJ7A 3WLRA 3AUOA 2QUMA 1CGUA 2PURA 4ZQNA 1IR2A 1EJXC 1MNSA 1PTGA 4JN7A 4M5PA 1AK5A 4AISA 4LJ3A 3GAYA 1BXNA 2QCGA 3SBFA 3W02A 2A6LA 3NQGA 2W91A 3FAWA 3VGDA 1Y7VA 1LUCB 1B4EA 4CVUA 3BLIA 3UZYA 5TBOA 3I68A 3QYSA 3FW6A 3KVLA 3M0XA 3TR9A 1FWTA 4GKLA 1QNSA 3I6EA 3LQLA 3SCWA 1V8EA 2FHBA 2F6UA 3PZMA 5F1UA 2ACSA 3FCPA 4IIDA 1BVZA 3NZQA 1CWYA 2HEJA 4D6JA 3W1XA 4DJDA 2Y5SA 2WVSA 2FIQA 5AYIA 1B2YA 2BHYA 1GOXA 5BXPA 3AI0A 5D4YA 2PTDA 5BCAA 3U4AA 1C91A 2HVMA 1ME7A 7ENLA 3W85A 1TPWA 1VFHA 3URNA 3VC5A 4CQ8A 3DN5A 1XLEA 3LLDA 3IIXA 4JTCA 3VM7A 2ABAA 2GK1A 1EUNA 1SO4A 1RV8A 3QLDA 3Q37A 3RRAA 4DQWA 3CGTA 3UXLA 2XGIA 4QEHA 5A6JA 3IGXA 1V93A 4Q8VA 1O4UA 1E15A 3CQJA 2DSZA 1WKFA 5DLCA 5D2YA 1EHAA 2CBVA 2XVNA 2JE8A 1VJIA 3PPFA 3CH9A 4IPJA 4AVNA 1NOWA 1O1ZA 3M47A 2WHMA 3PTKA 1J0YA 4GIAA 5CSSA 1JXKA 1R87A 1EP3A 2V81A 1REQB 1XLDA 2REQB 1SW3A 5HWMA 1KFBA 3TONA 2FTYA 1GYLA 1XF0A 4F48A 1JXJA 1H3GA 3IJ8A 5L6UA 5GNYA 2NSOA 1PZ0A 2CIPA 1B0IA 2Z29A 3K4WA 4GC3A 4LVGA 4IG2B 2AMGA 4CD8A 4RE4A 4Y9MA 2C18A 1NARA 3EWUA 1EJUC 2Z1XA 3B06A 4AWSA 1NFPA 3UWWA 4TR9A 1YQ2A 4E4UA 4DB7A 1IGSA 1DWGM 3WQFA 1XYCA 1H7OA 4DXVA 3GDTA 4R27A 5CH9A 4ZGYA 3P81A 4D71A 2G97A 3WL0A 4AH7A 2E67A 2QCDA 4XBSA 3AIQA 4QCFA 4J7RA 4LS0A 3T09A 3ZVHB 4DELA 1LOQA 2R1NA 3O6CA 4J5NA 1PKNA 4ZQMA 3MI6A 5GVJA 4LGXA 1HKWA 3UG5A 4JEJA 2H3DA 4LY4A 1UP0A 1W56A 1BEUA 3RNDA 3Q67A 3S3GA 5C5YA 5JIWA 1OX4A 2QCEA 3VKCA 4ROPA 3THQA 4GFSA 5FESA 4W86A 2ZUUA 3GC2A 3N04A 2INZA 6REQB 2XGZA 3WQ5A 4ADUA 3M9YA 5DBUA 3M0JA 1M68A 2PGEA 1J0HA 1BGGA 3I3DA 1XGEA 4HNTA 3C2YA 5H6HA 2ZX5A 3LLXA 1E0WA 3SY8A 3I6RA 4UR8A 1RVGA 2O9RA 4MOZA 5JMUA 2VWSA 1J6OA 1SFSA 3NUKA 5I6SA 1OFAA 1Z44A 1WAWA 2V3FA 1AZ1A 4IXXA 2AAAA 5H91A 4MY9A 3TAOA 1U2YA 2OOGA 1LT7A 5F2IA 1XPYA 1WDDA 2TMDA 4PSPA 1HW6A 3PTQA 3PZTA 3KBMA 1R85A 1JCTA 4F0LA 1TMLA 2D23A 1UROA 4XUYA 3VA8A 3BW4A 1TUXA 4HGXA 3UD6A 5G1TA 3LBMA 1AODA 3BCJA 2D1ZA 2OTDA 4PRWA 1EYWA 4WJXA 3A4XA 4Y2WA 4JIHA 1F76A 4F0RA 4J3SA 4IGNA 1KBJA 3I7SA 4B9ZA 1R2TA 3T42A 3PF3A 3E0IA 3VD7A 3H26A 3LOTA 3GE7A 1W31A 4CCEA 5J5DA 1DPMA 1SR0A 3KE0A 3SCVA 1IWAA 4WSJA 3LGDA 3S2NA 2RDWA 5DCEA 4OECA 2OSWA 3F4NA 1VD6A 3GZ3A 4MKSA 5DX7A 3PJXA 1CENA 1ECEA 4IZGA 4GVHA 2Z2AA 3UWEA 2Q6ZA 2H3BA 4QITA 2XYLA 2OKOA 2OQHA 3LEPA 1T8XA 4AZGA 3B8TA 3RILA 2GQ9A 3HGJA 2YL6A 1ISWA 1H51A 3DH7A 1YKWA 3HZ3A 2AQOA 4IL2A 4H6KA 3K13A 4Q4KA 2X30A 2CLKA 2CLOA 4IIGA 5M03A 1EC8A 1KO0A 1E9LA 4ZTYA 2YSWA 4WF7A 1RUSA 3G6LA 4GACA 2A7PA 1K9EA 4QGCA 2OU4A 5EBUA 1EJRC 4UNKA 5REQB 1B54A 4MB3A 3WLOA 1TPB1 1A4LA 3GFXA 3DYMA 4H9TA 4DZHA 3WCZA 2WHLA 4GYPA 2BX7A 4GQ0A 5IHRA 2AQVA 5CBIA 1UR3M 2A6NA 2DIJA 3QTPA 2DDXA 1W9DM 2BOGX 3NQFA 3DG3A 3UZWA 3UT0A 3GH5A 3E2SA 3EDDA 5BXTA 1L6WA 1W5QA 3OOQA 3W7HA 1EF3A 1FA2A 1WXJA 4C6CA 3ZO9A 1OJXA 1N2VA 3B9EA 4NT0A 5HQLA 1PZ3A 1C93A 4KPLA 2TSYA 1F3EA 4MB4A 4JKKA 1LWJA 1ODUA 3EWBX 3VCCA 4E8CA 3V16A 2E28A 2GJXB 1BLIA 2DJLA 4JAWA 1R9YA 3QHNA 3TNOA 1R7AA 3B9AA 2A3BA 1GWJA 4ZE4A 1US3A 1AW2A 3ISIX 1NF0A 1TV3A 1NSJA 2FZ8A 2XISA 4IGSA 1I60A 3W7QA 2ICSA 3W1MA 5CLWA 1GOKA 1TPC1 3IARA 1M03A 4DO4A 3MO4A 2BG5A 4KW2A 3KTCA 4BJHA 3NXFA 3UY7A 3EOEA 2R9RA 2NXGA 3DFYA 3W27A 3OQEA 4WCJA 4K1WA 5LGZA 5AC6A 5FD0A 1C29A 3W1PA 3AXIA 4DUVA 1K8ZA 2J47A 4FXFA 1QAPA 1Q7QA 2Y24A 4Q32A 3TIMA 1JI2A 2Y8UA 5FF3A 4MYAA 5M1TA 2ZDSA 5REQA 1RLCL 3PAJA 1YE6A 3EEZA 4O57A 3BC9A 2GJLA 3AIEA 3C86A 3W7MA 4JIEA 2AQWA 4C6LA 3TXVA 1UKSA 1EDGA 5HQEA 3UA3A 3P3BA 4NIRA 3GXFA 4TX9A 2TAAA 3L0GA 3CQKA 4PCNA 4ONVA 1UKQA 3ZQ9A 2D20A 5HNNA 4UFHA 4A05A 2G96A 1TR1A 2GGHA 3LCLA 3GC5A 1H1YA 3S1UA 3WH9A 4DBWA 1QMLA 4MM1A 1NY1A 2EHHA 4FB7A 4CLMA 4IQDA 2VKZG 4O8AA 2KX9A 2CNCA 3BJTA 4RLIA 3OODA 1SZRA 1ZNNA 4NKCA 4CU8A 1KC7A 4GH3A 4RNHA 4XD3A 3A23A 4UMCA 3CPGA 3W1NA 3MI2A 4HOWA 2ZADA 1UC4A 3MI3A 4ZOEA 4B16A 2BZNA 3ARQA 1M01A 1DP0A 1IGWA 2GYIA 1WX0A 3S1VA 1IEQA 4L9ZA 4PUNA 2EPHA 1LOSA 4LW7A 3C2OA 4CVWA 1J11A 3P82A 3KW3A 2ZUMA 1D2KA 4U5KA 4PBEA 1TSIA 1A80A 3MO7A 2V8ZA 2J25A 4P2VA 3LX9A 3OHIA 4OJYA 1L9WA 4WY0F 8XIAA 1BAGA 2PODA 5KEZA 5BOEA 4B3LA 4C1NB 3WLJA 1E4NA 4MSSA 1YPXA 3K8KA 4TV5A 2QCNA 3B4YA 1B3VA 4C6KA 5IFPA 1W1TA 4UQEA 1W9VA 3FKRA 1UD5A 3MANA 3N4AA 4DYEA 1LL6A 5EB8A 4RZ5A 1SSGA 3AMLA 4URIA 4RZ6A 2P10A 2WVUA 1VYPX 4JEQA 4A21A 4HNCA 3CJPA 1IF2A 4NXKA 3BCDA 2FTPA 3ZVIA 3CHVA 3UY8A 2CZDA 1UUOA 1K7FA 1FP9A 3H12A 1E6NA 3OVGA 2ZRZA 1DKWA 2WZTA 4KRZA 1SZEA 3H70A 3AFBA 2VEMA 1DTUA 2W63A 1G67A 2O92A 4AHQA 1RY0A 4B5NA 1Y8BA 4B5UA 1Q66A 3SN0A 1OFRA 3W74A 3TJLA 5G4WA 4DN1A 1QBBA 5I06A 4IMFA 3DIPA 1KQYA 4V1YA 4ZSUA 1H50A 2GJPA 1YNQA 4C6OA 1ISVA 3UF9A 3VIFA 1PTDA 4J3XA 1X6LA 2XH2A 3B0PA 3MYOA 3REQB 3D3AA 3VABA 3V18A 1XLJA 2GJRA 1W3KA 4ML9A 3AJXA 4YTQA 3CYJA 3HA1A 1DXIA 1LQAA 2FGLA 1YNYA 4NY2A 2IPWA 1XSJA 1CECA 3W9ZA 3N73A 5D9MA 2ISDA 9XIMA 3VIGA 3GDKA 2QS8A 3KDOA 3PAOA 4IIFA 1E6XM 4M6UA 1XIJA 4JYEA 2VDIA 4M3PA 4XBKA 2D22A 4GO8A 2D69A 4I5UA 3SUUA 5C54A 3HURA 3P62A 4FNRA 2Y88A 3VNLA 1CT5A 3PZUA 2WWDA 1UZ1A 2Z7KA 1GONA 5T91A 1H5VA 1TTQA 3E0VA 4JTTA 4RXGA 7TAAA 1BWLA 4C6BA 4JIIX 3V1PA 2WK2A 4XIMA 4EP8C 2G41A 1QNQA 2Y7EA 4F9DA 4OGZA 1RBLA 2XSBA 4RNFA 2YDAA 3W75A 1XDMA 3NSMA 4PMVA 2R94A 3VD9A 2OCZA 3PP7A 5IM51 1A5AA 4LS2A 3NG3A 1NELA 2BGSA 2BASA 1EZ2A 4UTJA 2AMXA 2BHUA 2SFPA 4MUPA 3LLFA 3TLLA 3W2MA 5G1MA 1JUKA 1VEMA 1S5VA 5C8BB 5IBXC 2YFOA 2A21A 1VKFA 3ITVA 3UU0A 3GU1A 4U3CA 4QS5A 1OX5A 2EXOA 4DBUA 3AAMA 4AIOA 5F2GA 1RBOB 3UFYA 2QUVA 2WMKA 4H7ZA 3C2VA 5KTLA 1I4NA 2EPOA 2WO5A 1GKRA 3W7DA 3KDNA 9XIAA 1GZ1A 1KFCA 2BXYA 5A2BA 3MKVA 2QPSA 1MQPA 1ADOA 2WSQA 4XZNX 4HNLA 2G0WA 3W4RA 3TYDA 3WLSA 3B8IA 4N2YA 5E70A 3W7LA 4Z2IA 3W25A 2VFDA 4Y90A 5AOUA 1J2BA 3TAKA 2WQDA 2Z6IA 1UH4A 5JXQA 2PWVA 3LTSA 3SRHA 4IGMA 5IXEA 3USBA 1GQLA 2PGRA 2CZEA 3L4UA 4JQ3A 4CEUC 5CZKA 3ZVHA 3RM9A 4EXBA 4NAFA 2J7HA 3FLUA 1QATA 1R3WA 4RXFA 4RCXA 3APTA 3BAJA 1AMYA 1HJWA 1MUCA 3VYLA 4GY1A 2P8BA 2ISVA 4NZ1A 1R2RA 1GJUA 4O1FA 3PUDA 3ECQA 3VIPA 7PTDA 3BOFA 3T55A 2DT0A 1VBGA 2J88A 2J79A 3NSNA 4A3RA 1O6IA 4GVFA 5FACA 2ALRA 4MY1A 4DO6A 1FDZA 3AXMA 3W86A 2B7PA 4D6IA 4GMEA 2XIOA 3RCNA 4HYWA 3RPDA 3VUSA 3P80A 2ESCA 1Q63A 3S6DA 4GBDA 3ARUA 4FLSA 2ZA2A 2GJNA 4GQRA 3JR2A 3UZZA 4G7EA 3DUGA 3GZAA 2HE8A 2EEXA 4UNLA 1OX6A 3TU9A 5FEWA 5KZ6A 4A3UA 5A6BA 4L7ZA 2G5WA 3XIMA 4IX2A 4GNJA 5HBFA 3P2VA 2DT1A 3G0XA 3IUDA 4IF2A 2I7GA 2XSAA 4Q4OA 3R4IA 3S2MA 2DT3A 1ECQA 5C9UA 3LRLA 3MSYA 3LM7A 1JGMA 1AW1A 3M0KA 3N34A 4UTTA 1E1FA 5CSYA 4J3VA 1AA1B 3EA1A 2B7OA 3P0WA 4B90A 1FH9A 3TDFA 3U2OA 4AWTA 1GW1A 3H7VA 2WXDM 1HP4A 2VFIA 4E4PA 2BFGA 1CLKA 3HIJA 2J9ZA 1JYVA 3BMVA 3IACA 1H1NA 3TMQA 4LNCA 3MJMA 5M2FX 2DV0A 1PSCA 1MFUA 1PJ9A 2E6DA 2UWFA 3GS6A 4F4RA 3T08A 1TIWA 4DWDA 2OQYA 3EPNA 4X63A 4YPJA 1E71M 3FOKA 3TH6A 2BV9A 1YDVA 3GDLA 3ZWTA 1XDJA 4HPHA 2NQLA 2BGNE 3RMJA 2CWXA 2X0HA 3VKBA 1E5NA 4MJ2A 1KM6A 3CV7A 1WCGA 3DFQA 5HNRA 2E77A 3ABQA 4PRRA 1VAHA 3WH5A 2W79A 1TZ7A 3VMOA 4ASTA 3UNDA 5KZEA 2PGWA 2CLEA 3ONBA 2Z25A 4XAZA 1WE5A 4S2CA 3TMLA 4HHPA 3VGFA 4HA0A 3M7SA 3DECA 2Y7DA 2Q02A 2NUWA 3BANA 4QE4A 2OGYA 3LCXA 3SIMA 5T26A 4A3YA 3B8WA 3T78A 3VNMA 4LB3A 2V3DA 1OIMA 3BLPX 1UMYA 3PUEA 2NXIA 4O0ZA 4JNMA 2A0NA 4ZODA 4HMDA 1CIUA 3WLKX 5M3WA 1TKKA 2W0UA 3WUEA 3N6HA 4GQBA 4JTQA 1S3HA 2FPYA 1LROA 1KKOA 1Q6CA 4Q4QA 2C1IA 1SQ7A 4AW7A 4A3HA 1Q6LA 5EPDA 1YADA 3D47A 4XSMA 4K6AA 1JL8A 4BF5A 2X16A 3W87A 3R25A 1GQNA 5F1VA 3TC7A 4HK5A 4PUDA 2X1SA 1B4KA 1IIGA 1QTWA 3QEZA 2PP3A 4R53A 4ERGA 4H9XA 1J9YA 1EB3A 4G7EB 2Q3RA 4QNEA 3GXMA 1YPIA 3WLQA 4F2UA 1ZUAX 3OEXA 5C7VA 4GJIA 3N25A 2GVJA 4PB4A 4ZZ9A 3H8AA 3L7RA 2PLKA 1UW9A 3BLLA 2NVDA 5BNKA 4LSBA 3TN3A 2WJFA 3ZR4A 4KEMA 3VNZA 1ADDA 3W26A 1AQMA 2VEKA 4MAZA 2VZOA 4W8BA 3HQPA 8TIMA 2RJHA 1TZZA 2E0PA 1U22A 5HJXA 1OB0A 4PEEA 1ZY9A 5CC6A 3EOSA 4N02A 3W07A 1E0XA 3T8LA 3CLWA 4GQGA 3O1NA 3VIJA 2WKLA 3NZRA 1OADA 1QPNA 1QU4A 3HM7A 1LZOA 2DZTA 3PZNA 2P88A 4K68A 1PS9A 1C92A 1S2WA 1I8JA 1ZB5A 4DUXA 2RDXA 1ZCOA 4HPNA 4QROA 3ARPA 2BXVA 2B4GA 4F2BA 3IIOA 2DPEA 1XBZA 5F7UA 2VRJA 4HMEA 3RR4A 3DFOA 3NTYA 3AS3A 1QI2A 4LFYA 1E40A 3VXGA 4MDPA 4PFHA 2JQXA 3BZGA 4RW3A 1H2JA 1A5CA 1VB9A 3N11A 1W5MA 2YZRA 3RGTA 4PEKA 4NZ4A 4U28A 4JPGA 4AX7A 1HNYA 1V3LA 1TMHA 4WJ8A 3TZNA 1QVBA 1X97A 3S2JA 3E2VA 2Y6ZA 2QNEA 2XIMA 4HN4A 4KWVA 1P0KA 3H2AA 3UJ2A 4NJJA 4AQLA 3GBDA 2YPIA 4I6VA 4A35A 2VOTA 2QCFA 1FHDA 4AU0A 2OR2A 1MYRA 3AHYA 4NJGA 4B2DA 2BVDA 4PUEA 1QT1A 4AYSA 1NH6A 3IVSA 3UGVA 4LEFA 3LERA 3UWVA 3HG2A 4DO5A 5I3DA 3OTRA 2O55A 1EUAA 8RUCA 1JDAA 3QY7A 4C7GA 2NX1A 5LZLA 3M5ZA 4LX4A 1IT8A 3MCNA 5HUOA 1UBSA 1JDFA 2Y8VA 2ISSA 4UQAA 5EMJA 3LN3A 4BKNA 4DUOA 2R82A 1AH3A 1LT8A 4IJRA 4RE2A 1XYBA 3VTRA 1UD4A 3G8RA 4PMRA 1EPXA 1A47A 4GNVA 1J96A 1KBIA 1XLAA 3H2NA 3QGVA 2NX9A 3UZ5A 4FI4A 2NV2A 1TIMA 1WBJA 3AYTA 5GJMA 4FZIA 1Q2RA 3PC0A 2QDDA 4LOCA 1ZAIA 2Z4GA 2A3HA 4C6IA 5I23A 1KQZA 2BNJA 4OV9A 3FEQA 3UCCA 3HG4A 4JOMA 4C6EA 1JYNA 1EJSC 4O1BA 4J1OA 4EPKA 1PYMA 2QVHA 3NO5A 5H8PA 2CCRA 1XH2A 3L5MA 1PCKA 5GNXA 4TVUA 1PPIA 1H63A 2YL9A 4W5UA 2PD5A 3QN3A 1H7PA 3G24A 2QJJA 1XBYA 5DXXA 3S1XA 2I56A 1DORA 2R1LA 1VFUA 2ZXQA 3KS6A 3C61A 1BFNA 2YL8A 3SQLA 1C7TA 1ZJAA 1OCBA 5FJPA 3GLCA 3RM4A 1ISYA 4DYJA 3WF3A 4DHGA 2F38A 1P0DA 2PTXA 2EPKX 3THCA 4RDYA 3MWAA 5CJNA 5DMNA 4PTNA 3RF9A 3GR7A 2BWGA 1W3LA 4B5WA 3CEPA 3CHFA 4D1JA 4IHCA 1EDQA 2BXZA 2BLEA 1VFOA 2OO0A 2HPMA 2HDJA 4D6EA 1ZP4A 5A2CA 3LPPA 1KBLA 3NSXA 5T8GA 3CIXA 4CN4A 1LQ2A 4PMOA 2I5IA 4G5DA 3TTEA 2X0SA 3PG9A 3GH7A 2PMQA 2NVAA 4KH2A 1ONXA 1TTJA 5K4XA 3V5CA 1M5WA 4C1LA 1V51A 2ZRUA 2P8CA 5E9XA 1EGZA 1VRXA 4GXPA 4UR9A 2XN2A 1RA0A 1B9BA 1R7OA 4HNUA 2BBFA 1BSIA 4L9XA 5HWNA 5A8GA 1JYWA 4A8LA 1UWRA 4W7UA 1GGOA 2B81A 1TWWA 3O63A 1FWAC 2QDEA 2GJXA 1B3XA 1CCWB 3G1SA 3B4UA 4L4MA 1LP6A 4UWMA 1RJQA 3DFNA 5B80A 1MQQA 2QULA 4RL3A 3AWNA 5C71A 3BURA 4L5ZA 1I1XA 2HS6A 3L5AA 2ZCGA 1XIHA 5IRPA 1P6WA 6TAAA 4GE8A 1UZHA 2X40A 3UVAA 5AHNA 4X60A 4V2XA 3E9AA 4BWLC 3AYVA 3GNRA 5GNZA 2BY1A 3W6YA 2ABBA 3AOFA 1TV4A 1C9WA 4ADSA 4HCDA 4AY8A 5FSEC 4CNUA 2YDSA 2VMFA 4V28A 2FH6A 3JRKA 3P8IA 2KAUC 4QJ4B 4HHLA 4M51A 1YLVA 2C6QA 5AN7A 3NNTA 4M6VA 3WK3A 1W1YA 3AXKA 3K2GA 3KBVA 1T40A 3PM6A 1EKOA 4HA1A 3CPUA 2EO7A 3POHA 2H6RA 3H53A 1XRTA 3R94A 4UFLA 2HMCA 4JKMA 5D30A 3TUUA 1U1JA 3UYIA 1FTXA 4L4PA 1NTHA 1F73A 3V1HA 3NO1A 4BZYA 2HE5A 2PU1A 3N6JA 4O4WA 2WJEA 2VZTA 3L2MA 3NYDA 2W66A 3G1XA 2JEQA 1XWYA 4QAWA 4XAFA 2QIIA 1K7EA 3A4AA 4R85A 4RX0A 1UASA 3NQEA 1OGSA 1Z6KA 2JGYA 3LCIA 3KCJA 1ZFJA 4PTDA 5HUPA 4QCEA 5DT7A 5D9NA 1WXYA 3DHUA 1PHWA 3MY9A 2AL2A 4PMJA 2PCQA 3EX1A 3M43A 3SECA 3QKZA 1TV8A 1RP9A 2ACRA 2R1PA 1FFQA 2FB2A 3LCHA 1MXDA 3LBOA 3WLTA 2QV5A 4Q22A 2VR5A 2PTWA 3E1F1 3C0QA 3TV8A 1IZCA 4FO4A 3MQTA 5E0FA 3WG6A 4D6DA 3G3DA 1RCXB 2E7FA 4XISA 3L2IA 2ZQ0A 2WMJA 3EB4A 4MPQA 2CZFA 3MVIA 3OB8A 2ZZ1A 4Q8OA 4O52A 3W7GA 4HMNA 5DELA 1DHKA 1QBAA 1ZZMA 3G77A 1QPKA 2WB5A 1IZJA 1NDYA 3A4JA 5HNTA 3L9CA 1WDQA 3E5PA 1RLDA 5AYZA 4L1WA 2OLSA 4FX7A 3GDBA 3WF1A 3EOUA 2VZUA 3II1A 1GJWA 1A5OC 3CYVA 3AYSA 2BHZA 3UG8A 1JD7A 1GTEA 3KVKA 1F3WA 1FRBA 3LCFA 3SUTA 3IVTA 3UW6A 2H9AB 1E1CB 1GTHA 3KTXA 2FHFA 1K8YA 1XG4A 1Q6QA 2WCAA 1RQEA 4MTVA 3LV6A 1H62A 4MHBA 1V0LA 4Y9NA 3F2DA 5E93A 1W9BM 3CV2A 1FDYA 1RVKA 4FLRA 4FLOA 2WSPA 4NILA 1XP3A 4GVGA 3ZSTA 3VDGA 3WNOA 1V03A 3WL1A 3N13A 3NIYA 1Q6FA 1JDCA 1HJVA 3QQ0A 4EXAA 3IK2A 1TQJA 3EKZA 1TVPA 4O12A 3U57A 4JIQA 2Z1WA 1GOIA 2HK0A 3NA8A 4DWSB 1GK8A 3UPMA 3GTNA 4CKQA 4PL2A 3DU0A 5CZJA 3CL7A 4K36A 1UIOA 2WCGA 3BZJA 2XZ7A 1H7RA 2YYTA 3ZJ7A 2FGZA 3LHTA 3WLIA 4NAEA 1XKJA 2V6AA 1XJBA 4ZQOA 3PZGA 2POZA 1IHIA 4O1EA 1VBUA 4AXNA 3AJ7A 3GC4A 2NV1A 1HJQA 4W89A 2LLEA 1PX3A 3PWGA 3TQKA 3AIBA 3UXDA 4P7NA 4HPJA 5D09A 4LQ1A 1H7NA 4LYPA 5HMSA 3M64A 1TE6A 3VOHA 1VCVA 4PUKA 4FMVA 4MADA 3CTTA 1T7LA 4UCFA 5AVHA 3WENA 1G7UA 4ACYA 3RU6A 2Y0FA 1E1EA 5D05A 3KP1A 1VPYA 3KS5A 1D3GA 1KBKA 1VJSA 2OXNA 6REQA 1XL9A 5E6YA 4Q7NA 4ECLA 4NP7A 2PP0A 3EDFA 3MUZ1 1E70M 4QE5A 5ABFB 4WDWA 1S1RA 3PZVA 3DKLA 3NM1A 2OYMA 3T0BA 4AMCA 4CQCA 3F2BA 1FWEC 3UWYA 5FL1A 4AEFA 2Y1HA 2E3ZA 1CEOA 4RE0A 4CQDA 1V02E 5HDRA 1PBGA 3CUFA 1DBTA 4MFEA 2W3ZA 3TK7A 1MZRA 1W37A 2XWDA 1S2AA 4AG0A 1KGWA 3ARVA 3THDA 2XINA 2GUYA 3BG5A 3S42A 4HYRA 1QFEA 5DN1A 2NW0A 4F0MA 2ZRWA 3VZYA 3W2KA 4WDXA 2IQ0A 1SVDA 4OQVA 1MW0A 3SFKA 4MY8A 3Q45A 3RLVA 3KX6A 3RAOA 3CUGA 2PWFA 1F07A 2DZVA 2HBVA 1M9HA 3WQGA 3DI0A 3WLMA 2ZUVA 1E3XA 3EXSA 1EOKA 3OA3A 3BAYA 3IRSA 1VEPA 4AZHA 5BWFA 2XHYA 3W81A 4DBSA 1W6TA 1U30A 4GIRA 4LBRA 1XIFA 3VNKA 3PULA 3S1WA 4BI5A 1G69A 2WV8A 5DRCA 2AL2B 5HMFA 1TQXA 3C5QA 4EAYA 3ANUA 3EMZA 4UTKA 1T8QA 5BW6A 1ZL1A 1Q6EA 1WO2A 3LSBA 4HB7A 4NX5A 3VKJA 1E6PA 3LXBA 3I4EA 2IQDA 3MUIA 2ATSA 2ZUWA 4OWGA 1FWFC 3ITOA 5H8MA 1AQ0A 1PKYA 4HIBA 3OHMB 3MA8A 3WJWA 4GZIA 4GI4A 2OJPA 4CNPA 2RGMA 5FI8A 4EIVA 3LBCA 5B7YA 4WY0A 4S3DA 1T0OA 1YBQB 1JI1A 4HMCA 4ACZB 2C1GA 3PBVA 1ZJBA 2VFFA 1B57A 4GZ7A 4O54A 4L4OA 2VGIA 4Q8PA 3RHGA 4N0RA 1ZBWA 1Q7MA 3LHVA 4LUSA 1JVNA 2B7QA 3QMTA 4WIWA 4MB1A 1K03A 3N6QA 2PDGA 1GQJA 1FH7A 3LNPA 3QBUA 3WNNA 1RJPA 4W87A 4O0QA 4S38A 4XZHA 3GXIA 3B40A 2XH7A 4BQ2A 3VUPA 2PDXA 2GGIA 4BCEA 1OWQA 2EG6A 3RITA 2ZA3A 2BVYA 1Q6OA 2WZMA 4MWAD 4ZL1A 4Q6JA 1TVNA 2HS8A 5FCZA 4WX2A 3W00A 4DPQA 3PZQA 1G4SA 4IIBA 4IPLA 3BQ5A 2Y63A 4N4PA 3H22A 3CHEA 3ZSSA 3EWXA 2YA2A 4QDMA 5DBTA 2G3IA 3WK0A 4YN5A 4IFKA 4JICA 1WUFA 2IXUA 4F9JA 3UBPC 2BSLA 2D2HA 4GX9A 3VIOA 4BWLA 4ZFCA 1LUCA 2E9MA 4S3EA 2PLCA 4S3GA 2GQ3A 3N29A 3N2MA 3HQ1A 5AZ1A 5BWAA 2J8GA 3PANA 1MRQA 1XD1A 1EXPA 1FCVA 1MNZA 3L4ZA 3BDKA 2NQ5A 2WBKA 3D5HA 3RYSA 1S2VA 2O7QA 2FVMA 1K1DA 3HV9A 3XISA 3KLKA 1A3WA 4AY7A 3IIZA 4EF8A 1ICSA 3TN4A 4EVZA 4C1NA 3L4WA 1EQCA 2YDRA 4ICMA 5FKYA 4QSHA 4AHPA 3FYPA 4MZ1A 5BZAA 3TKFA 3L66A 3VDBA 1GVQA 5E09A 4FNPA 1F3XA 3O07A 3F4CA 4XZBA 1QI0A 4MWAA 3W70A 3MT1A 1YXYA 1QOPA 4CD6A 5DMLA 3EWYA 5ABTA 3AZTA 2QGHA 1K6AA 3ABOA 4W93A 1V6UA 4B3KA 5LHFA 4POCA 4AVOA 1XV8A 3APYA 3SCOA 3GXPA 3PPCA 2ATMA 4GX8A 5AHFA 5JH2A 1GZJA 2GQ8A 4EOUA 3WQ6A 2P3ZA 3S9IA 2WOQA 3GUGA 1ITCA 2XVLA 2QKFA 5D04C 2PDNA 3EWDA 3AU2A 5CGMA 3K4AA 3SEPA 3W84A 4X2PA 3WMLA 1UPPA 2PEVA 1WV2A 3FFSA 2BDQA 3OG3A 4EPBC 1GVFA 1WUEA 4GI6A 2VJXA 2NQ9A 4RZBA 5EFFA 2J7CA 2HCVA 2QVNA 2J75A 3WJYA 2DZWA 3WLPA 3ARYA 5FL0A 2QYGA 1JD9A 4K8EA 4U31A 4HA4A 2HISA 3M7WA 3OP2A 2E6FA 1KV5A 4HNOA 1FWWA 1K8CA 1UKTA 3E0FA 3DCPA 3DDMA 2TODA 1UYQA 1POJA 3GTHA 3IPWA 3TJIA 4JQAA 4JTHA 4BEQA 3FXYA 4AD0A 4UTWC 3RK8A 3CQIA 2A3CA 3ONCA 3LS9A 2A3LA 1F4HA 3HGOA 4ZR8A 4IICA 2PE4A 3FIGA 4DJFA 3ZR6A 2GGJA 1PDZA 2PFHA 3NZGA 4DWSD 2PWHA 4NNAA 4DBEA 4X61A 1CGXA 4H9UA 4MG4A 3TTYA 5A8QA 1JPMA 1PWLA 4LRTA 3FV9A 4NAEB 3CEUA 6ENLA 1L6GA 3AHXA 1RR2A 3UXAA 1NOUA 3URBA 2RKXA 2X05A 1GHRA 4CD5A 1VYRA 1W17A 3W1RA 3LPFA 1KD0A 1KNWA 2V67A 3VMPA 5TAOA 4ZOBA 2VDGA 1HKJA 4NXSA 1ZBCA 1F8MA 3GG1A 4ZQRA 4DXKA 3TEVA 1F2JA 3I3BA 2TRSA 3BOLA 3S47A 4J40A 5LIXX 2AAMA 3P5YA 3S9ZA 4GI8A 3LCWA 4WUIA 1DIDA 4GFIA 1W1ZA 2JKPA 3T44A 3M07A 2OO6A 3JS3A 2NUXA 4LWWA 4YXGA 7REQA 4R5EA 4LC8A 4I9AA 3S4TA 3LZ5A 3CUJA 1MWOA 3KP0A 3A47A 4O19A 1QOQA 3GUWA 4PULA 3QZEA 1DL3A 2Z27A 4XZIA 5K2ZA 3GM8A 4LUTB 3PZ9A 2VNCA 4NSBA 4UQDA 1GPFA 4R33A 1FWCC 1UWAA 4S1FA 2G4JA 1ZHAA 3KTSA 2ISWA 2JK2A 3WDQA 1F05A 4ES4A 3BJSA 1NWTA 3WN6A 3AZRA 1OFBA 3W2UA 1OD8A 4W84A 1IWBA 2FKPA 2HNEA 3AUJA 3ATYA 3PK7A 3R7MA 1QWKA 3UJSA 5I03A 4R3UA 2V2DA 1JCJA 4NZ3A 4GNKB 2YW3A 3C2FA 4RZ4A 4XO6A 5KZMA 4OOUA 2V3EA 3HMJG 1KR1A 1XDLA 5EBAA 3KBWA 2PZNA 2A3AA 1IZKA 4Z2HA 2PS2A 1LDCA 4NI3A 3R2GA 5E6ZA 4MNLA 5LIWX 3G1VA 1QNRA 3RU8X 4QG6A 1GCYA 3TZFA 1KTCA 4JQ2A 4WOZA 5FJTA 3KHJA 1B3OA 1W9PA 4PSRA 2Y61A 3SGGA 4HZ6A 4ZQPA 2QHAA 3M0HA 1LG2A 3W37A 1HKMA 2W92A 3B3DA 1J8VA 1TWDA 3D46A 1CI1A 4R88A 3AMCA 4KFNA 4QR6A 5AYYA 1S2TA 2G50A 4PUMA 3PNZA 4P8XA 3NQ2A 2EPNA 1W3JA 3S5OA 3HQNA 3OIHA 3V4BA 1DJQA 5XIMA 3T07A 4BQ3A 4FHAA 4EK7A 2I17A 2VD9A 1NIUA 4B4HA 2WVVB 4Y96A 3S1GA 4EF9A 3QF0A 1XYFA 2GQAA 3WD3A 4Q4RA 3NCOA 3H6OA 4UTIA 2E68A 4FIRA 4LVBA 1TMQA 4X22A 4PMZA 4DWSC 2ALDA 4YTUA 1MQRA 1JFHA 4Z42C 2CHRA 5EMKA 3MKCA 4US5D 3IJQA 1XH1A 4CD4A 4CQBA 4PODA 3P61A 3WUFA 1EPVA 3FEMA 4NYUA 2EJAA 2IS7A 3CUZA 4DJEC 2GDQA 1BF2A 3G1YA 5D2TA 1UH3A 4KWUA 1XCXA 4AIUA 1G6CA 2Y7FA 4LBUA 2DIEA 5CEWA 4H9MA 3GG8A 3K30A 3HJEA 5C2GA 4HCLA 4LAOA 4JN8A 1S2CA 1CXLA 3GX9A 3VDCA 5XINA 4H7CA 1YE4A 4LVAA 5AB3A 3V7PA 1CB2A 4JTDA 3O7UA 4YVVA 5FAJA 1LORA 4MKVA 2CC0A 2NX3A 3OYZA 4QDPA 3QZAA 1Z9AA 4LBSA 4Y8FA 3E6EA 5LIUX 3BPWA 3IAQA 3PWIA 3SZ8A 2GPTA 3Q94A 1J01A 4QAIA 4LF2A 2W9MA 2GGGA 4OUIA 3MUY1 1MXGA 4O18A 1ZBKA 5J8LA 4W8LA 1IEVA 3SI9A 4FP1A 4WVXA 2B31A 3WMSA 2X2YA 3CL6A 3DYOA 2JFEX 4W7VA 1MW1A 3NVTA 1R30A 5SWUA 1HZYA 4XG1A 4AZ5A 4BF9A 2VC7A 3GYEA 2HVOA 5FJOA 4I5RA 4DNHA 1SYTA 1BXBA 4GYFA 2QW5A 3PN8A 2QCDB 4ZOAA 3BSGA 3CAWA 3BH4A 3G22A 2DGAA 4PCFA 2CU0A 1UP3A 4L6DA 4MZ8A 4R9OA 3TYAA 1XHGA 3BLDA 4ATWA 1HTIA 3T4CA 4Z1AA 4GGHA 1DJXA 1EX1A 1JJKA 3BMXA 2FZNA 1QNOA 2D2GA 4PL1A 5A3HA 3LB0A 1XXXA 3E49A 3NURA 2QUUA 3GKFA 2XUCA 4LALA 4O11A 3TQ0A 3L68A 3B0XA 1J2WA 3WUBA 4JTLA 2GGEA 3H54A 1GQIA 4WHBA 2V5LA 5D03A 1BVNP 1EP1A 2XDFA 1P1XA 3JUGA 2X1TA 4RPPA 3UR5A 4P7LA 2W27A 2OX4A 3HTWA 3B04A 3ARZA 2OOFA 4IH3A 5C6MA 1EEXA 2EF9A 2W6RA 1AMKA 3VGGA 2WNWA 4OTKA 2VVSA 3M16A 5D2WA 3ITGA 2GLKA 1YHTA 3WBAA 3GVRA 4TIMA 4CU7A 2FZMA 4H6EA 3FN9A 3PB2A 1G01A 1UWQA 5E9AA 5AC5A 1I45A 1SMAA 4GLEA 1V7AA 3EX4A 3VNJA 1E6SM 1GOQA 2BS9A 4E8DA 2FLIA 4WDUA 1VC4A 3DFPA 1JUEA 1ZALA 3DESA 4YTTA 3OZOA 2B7NA 1P0NA 2JBMA 4XAGA 3NL5A 4EXQA 5EMMA 3G1FA 4K7YA 1J6PA 5A5WA 4DI8A 2BVWA 3FGCA 2C1HA 2R1KA 4RJEA 3UVIA 3MBDA 3EWZA 3QHOA 5HQMA 2GZXA 4AMAA 4N9DA 4HKPA 4EPDC 1BD0A 1SJBA 3NAVA 2HV5A 4G56A 3WD1A 1YTKA 3WD0A 3VNIA 1KBBA 3FGCB 5AVNA 3W1LA 4XZMX 3CL8A 1A5UA 3GTXA 3EYPA 2IPJA 4TTGA 1H4PA 2CW6A 4FNSA 1OYAA 3OGRA 3I7RA 2PDPA 1TFVA 1UCWA 4GY0A 1M7OA 2XN0A 4J3ZA 3AHVA 5CGTA 5K9DA 3CASA 2ZRYA 1A50A 3BMWA 2QT3A 2O56A 5FIPA 3MPGA 4KWSA 5IOBA 2C0AA 4Q8QA 5AHMA 3INPA 3P5ZA 3UR2A 1R3VA 1HUVA 3ME3A 4E6MA 3UWUA 1XS2A 2DUZA 2YCLB 3T8QA 4DRSA 1GHSA 4RW5A 3M0VA 1ICPA 3T2OA 3BW3A 1T6MA 1OZMA 3WKZA 2Z00A 3SW6A 1CLVA 2CLPA 2H8XA 1AVAA 2V9DA 4FSAA 1KR0A 3MSRA 4H7VA 4DZAA 4J4KA 4GI9A 4HOZA 1I6NA 2ZKMX 2ZDRA 2WKGA 3WNPA 4ZENA 3M1ZA 4DF2A 4ZO7A 3URAA 3LXCA 1UPMB 5D9PA 2PRLA 4Z2LA 3OGSA 1VBJA 3UPWA 3SRDA 4HQVA 3M6DA 3AISA 3NXLA 1E3ZA 2WNQA 2DFAA 3SCPA 1YTDA 4M1BA 4N42A 3WJZA 2CERA 3ITYA 3N14A 4JFUA 3N19B 2PWUA 1RK5A 1MUWA 4I6KA 1M7XA 1JNDA 1OG6A 2FJUB 3H7RA 1MEIA 2FQIA 2O4QA 1C8XA 1XLHA 3R89A 2Y85A 2OSYA 4LAUA 3COTA 1KRMA 4JIPA 4QSFA 4JNZA 3AIRA 1GVIA 4AY1A 6XIMA 3M5VA 2JF6A 4HZMA 2G37A 1VQTA 2H9AA 5U4NA 1XG3A 2V82A 1XX1A 5I24A 4UQ9A 1FQ0A 4AB4A 5J04A 4MNKA 4MF4A 1AH4A 3PBYA 4TVCA 4A29A 1YXDA 2V5BA 3SCTA 1ITQA 3L23A 1JUBA 4WSKA 4DM2A 1E4MM 4O8RA 4FEZA 1A5SA 1E0TA 5KSWA 2VURA 5I3GA 2OYKA 2O9TA 3SY1A 1IE7C 2QUNA 5DEZA 2NSXA 3E2RA 2WQPA 2VUNA 2ZX6A 3IJLA 5IDZA 2P0IA 4MKNA 1HN1A 4DJFC 2ZX9A 1S5WA 2QPXA 4KIRA 3N1AA 4ZCWA 3STGA 1JF5A 3T2PA 1BVWA 1X1NA 1I75A 3VOIA 3ABZA 3F7JA 5LGXA 5KINA 2W4XA 1OEPA 3S0CA 4J27A 1HL9A 4FXJA 4G1KA 1K9DA 4FXRA 1V02A 2CLIA 7A3HA 4W88A 1F8IA 2I1OA 4OBTA 5FEXA 4O16A 2YCJA 2AKMA 4XZLX 2VOMA 1XI3A 2O9OA 4H9ZA 5ABHA 4G7FA 3PJUA 1V3IA 4Y9OA 2J4GA 1LBLA 3WH7A 1Z32X 4RNIA 4GC4A 3R0UA 3NEHA 3ANVA 4JTRA 5FEPA 4IM4A 1W1VA 3PG8A 3F5JA 1LG1A 5CZSA 3NGFA 1XR2A 1UQZA 1V6XA 2D0HA 1WKDA 1XQKA 2PDQA 3N2XA 4Y8EA 1V3MA 4UFJA 5DQPA 1HGYA 3ZIZA 3OPSA 3LCGA 3OLDA 3O9NA 1V79A 4JXCA 3L2LA 2YGYA 2VEGA 3U2ZA 4HU0A 4M0XA 3REQA 3STFA 1N7KA 1EGMA 1GNXA 2FMOA 4YYCA 4GJ1A 2WJDA 1ALDA 3R0KA 2VGBA 4M81A 3QOKA 2VC9A 3W88A 2C14A 2ZBTA 3ARWA 4UXDA 1K3UA 3DOPA 4DYKA 5AC4A 2YBTA 4F2TA 2A79A 1PX8A 1GJPA 2I9EA 2YCKX 4UB9A 4K38A 4JIRA 1AD1A 2FGBA 3MYPA 3EGJA 4CD7A 1IEWA 5F2LA 1LJYA 3BJFA 1B3YA 2OELA 4F79A 5A8NA 2VR2A 4I9JA 4QLJA 4UZSA 1MFVA 3TW9A 4N9CA 4IIEA 3NFUA 6CGTA 1W3NA 2OWCA 3SCNA 3TOPA 4Z2JA 1EJ7L 3MTWA 3OVPA 1KFJA 2WW5A 2V5CA 4P8UA 4TTUA 3BAIA 4L4LA 7TIMA 4GRSA 1LF1A 5LNSA 3A5FA 3NDOA 3FHQA 3ZJ6A 4A8IA 1L2UA 2W62A 3BLEA 3M46A 3GTIA 1THFD 1R3QA 4UTUA 3NPWA 3NL6A 4NASA 1EBGA 2E8ZA 3BAXA 1AD4A 1VFTA 3HPXA 2ZUTA 4JQ1A 4A2RA 4ZFMA 3WNMA 4GH1A 3CBWA 1F6KA 2WKJA 3F4VA 2F61A 3DFTA 4J3UA 3NZ1A 2QCCA 1SJAA 3ELFA 4TMCA 1MDRA 3CZEA 4UTHA 2PDMA 4TMBA 1SW0A 4N9EA 4AC7C 1XSIA 3QXBA 1TYGA 1UD3A 3FAXA 1O5KA 3B8SA 3GNPA 1KM3A 2QAFA 4YHGA 4QDWA 2BVTA 2VFEA 3HMCA 3CAVA 4E38A 4C6PA 3UG4A 1BF6A 2Z7GA 1DJZA 1O68A 4DM1A 2V68A 1JDDA 2VM8A 1DWJM 2PPGA 3IGUA 1DIOA 3FVDA 1V6YA 1ODZA 2FH8A 3C8NA 4DO7A 1IEIA 2DH3A 1HVXA 1PIGA 1SO5A 1XYAA 3CLMA 4JZ5A 3VVGA 3WQVA 3N2OA 4K1GA 5CLTA 3SGZA 1IT7A 2FFIA 3C0SA 3EEGA 3P84A 1AQFA 1N8WA 4JCMA 1XRVA 2J6VA 4HT3A 2XFFA 1EA0A 1R38A 2WC4A 4N9BA 2JALA 4TXEA 1GG0A 4LVFA 4CEXC 2C3ZA 3CPRA 1HO4A 1BKSA 1WZKA 5MKGB 3L0NA 3NPVA 3A22A 3WMCA 1DWHM 3OZYA 3O8AA 1G4TA 5K7JA 4H9YA 3AQUA 3B0UX 1GVRA 1UOKA 4GUIA 1Y5XA 1O95A 2YCEA 3PZIA 2WMIB 5DY2A 4AZ6A 2E1DA 2FB3A 4XUGA 1JFXA 2J7DA 3RCMA 3TQPA 1RQBA 3KLLA 4C6JA 4HVXA 2BOEX 3QH2A 3PSVA 3DG7A 2G8ZA 3EB3A 2XIJA 2IW0A 4A2SA 3DGRA 1OYCA 4YVPA 3R43A 4HN8A 3AS2A 4MZYA 2PSNA 1ISZA 3GNNA 4P7RA 3U7BA 2ZTKA 2UBPC 4CQAA 1W2VA 3L4YA 1K9FA 2PB1A 3CTLA 3UJEA 3K8MA 4FXSA 4LUTA 2E25A 3T05A 4LYRA 2JIEA 5RUBA 5D8ZA 1DHPA 5HA7A 1A5LC 3NYZA 2DUAA 2ONEA 1DVJA 2R6OA 4B15A 5B7ZA 4LUYA 4TOQA 1GVYA 5E0CA 4UTWA 5JUVA 4DF0A 1UR1A 5KMYA 3T0DA 1UWUA 4L61A 1GKPA 1NWUA 3GFZA 1W9XA 1F6PA 2DZAA 1Q4WA 2FFCA 7CGTA 1XCWA 1LBMA 2QCLA 3QPZA 4IUGA 1O5QA 5CPTA 3PSWA 3MHGA 2OODA 4YTRA 5CJMA 3L67A 4JYDA 5F4WA 2J7FA 4U5IA 3N15A 1CDGA 4M1RA 3TROA 4UIOA 4C6FA 2QIWA 4S2BA 5LKYA 1J5TA 4Q4SA 1UBPC 3G6MA 1UQYA 3LHZA 1V08A 1HF6A 3F4DA 5CAKA 3R1ZA 1AL8A 3G2GA 3UESA 1B1YA 4GCXA 3LUTA 2VR4A 4Z1DA 2F84A 1IQ8A 2VELA 3WNKA 4QISA 1BWKA 3OYXA 4D6FA 1EO5A 4XB3A 5A8OA 2CLHA 4FX6M 1UB3A 3PTMA 4DUWA 2PI6A 1EL3A 2V5KA 3URQA 3PTDA 2YXGA 1J79A 3MMTA 4I8YA 1V5XA 4S3BA 3LU2A 3POCA 4DAFA 3QM3A 2J78A 2VC6A 3ITLA 4QTGA 2CXEA 3N9KA 3VIHA 2EKCA 3MUAA 4LF1A 2WVTA 2V5DA 3BGGA 4Y9AA 2WBGA 2YXXA 3CC1A 1FCQA 1NP0A 3O2LA 1PXGA 4AXKA 3D6NA 3IUHA 3P8JA 3ZR5A 1I9CB 3MCOA 5BROA 3T1GA 4C90A 3GKAA 1X7FA 1X96A 2YR1A 4F0KA 3CZGA 3EKGA 5A94A 4H01A 1MXSA 3CB3A 4ALDA 2WJZA 5H1WA 2PDBA 1ONRA 4CN1A 1ZQ5A 4M8UA 1NWSA 1O1HA 2YA1A 2VI0A 3EPMA 1OC6A 1CXFA 3DC0A 3VKAA 4KT2A 4QS6A 4TX8A 4HBKA 2ANUA 2XH0A 2FVLA 3KWXA 1KCZA 3VD5A 3W71A 3W29A 5DT5A 3R6IA 4AEEA 1XW8A 4XKMA 4OVXA 2CZ5A 1KXHA 4I7VA 3W1AA 1ZU8A 2NQHA 3RJXA 3HPFA 4U2ZA 1XLIA 1U1UA 1OGBA 3E0WA 1FOBA 4WSHA 4H6QA 2FYMA 1TPFA 1GW9A 1JPHA 2PU0A 3RMEA 3WYZA 1RQHA 4JNYA 4U10A 2I5GA 4H8HA 4U33A 4IWWA 1U83A 5A2AA 4CCDA 2DVUA 3IS4A 1RXOB 2GWGA 3ZWSA 4GUHA 1TWZA 2Q09A 4K37A 1OINA 4KWOA 1W8SA 5HK4A 3VGHA 1TX2A 1BG9A 4W4QA 1E51A 4PMUA 3GHRA 3W38A 1XISA 2CLFA 4GYJA 5CXPA 2C79A 3O06A 2Z28A 3UGRA 2Q8LA 4D6CA 3QVQA 3IJ6A 4KETA 3WZ0E 4AIEA 1ZJIA 2VX6A 1J10A 4BK9A 4FNTA 1S1PA 1CW2A 2V30A 3L21A 1XLGA 4NYYA 1P7TB 1M6JA 3LMZA 2FMNA 3IVUA 4F8XA 4M82A 1DIEA 5T9BG 1D8CA 4MLRA 1HXJA 1S38A 3GG7A 3SURA 2R91A 3GRIA 3V75A 1W9UA 4PMNA 4ZTXA 3OG2A 1OFPA 2J24A 3WEZA 4IP5A 2R1MA 1VGAA 4HA3A 2OZTA 3CWHA 5I3KA 3HGRA 2PC8A 4QLLA 1DWAM 1DJWA 3GNXA 1LM1A 3P0XA 4PB3A 1HX0A 1Z69A 3VILA 1YDNA 2Q8XA 3VZZA 3KRUA 3OQ8A 1XINA 3R79A 4UC5A 1H09A 1OF8A 2WM1A 5CPOA 1PB0A 3PBGA 3U48A 4V15A 1H60A 3A3WA 3W7EA 4QLKA 2OWWA 3FDGA 3AU6A 3USZA 4PTMA 3HPZA 3RPMA 3TCSA 3NQVA 5A8MA 4GABA 1OGGA 4KESA 4NZCA 3W6MA 3UA4A 4KMQA 4AAJA 4GUJA 8A3HA 4KF1A 4QJ3B 1XLFA 4ORMA 4KFPA 1PL9A 2NLIA 2OZ3A 2ZUSA 3G5EA 4IGHA 3SSZA 1YYAA 1Z48A 4F0HA 4DWSA 4YU1A 4HTBA 4RKAA 1GQKA 5JBFA 1EGVA 5A6KA 1LL7A 1FUYA 2ZC1A 1WDPA 4HHHA 1XUUA 4US5A 1LOLA 4MMWA 2VZVA 2GSJA 1XH0A 2PDIA 1P4CA 4OIFA 5PTDA 4ICCX 2PDKA 2ZXBA 4GXMA 4RNJA 1TB3A 1MMFA 5HINA 3PZOA 4F40A 2DSKA 1VS1A 2QF8A 3EXRA 5A1AA 2Y5EA 1FWSA 3QQWA 3KEHA 3MV11 4S3CA 3IJ9A 1KB3A 4E8GA 2O7SA 5TQLA 3S2CA 4JDYA 3BUVA 1TRDA 2J13A 4LRSA 4MJ4A 1F7BA 1SPQA 4C7FA 1LWIA 3UR8A 4XTDA 2DJXA 1VHNA 1QHPA 1XLKA 2AGTA 4TO8A 4O10A 3S5ZA 3G0SA 3GDMA 5HAOA 3UR7A 1T99A 2ZICA 3BW2A 2PF0A 4H4IA 4NAFB 3ARXA 1BSLA 6TIMA 1DEDA 2W67A 4FOUA 3H4XA 4V1XA 1JYXA 1SR9A 3C0LA 2QDGA 3CV1A 3AHZA 5A69A 4LCQA 1LLZA 5ENLA 3B0VC 1FBAA 4L6HA 2A7RA 4C5YA 4AWEA 3B05A 2VZSA 3U5YA 2WSYA 5BOOA 1FY6A 1AW5A 2ZZ3A 3TX9A 3OGVA 4A8NA 2P3EA 4ZEPA 1XKYA 1FWNA 4K7VA 4AD2A 2OFJA 4YL2A 3Q65A 3T81A 2FZBA 5LA0A 1KGXA 1AH0A 1VFMA 1I2NA 2P50A 4YMZA 1GEHA 4ML4A 4OV4A 1R3SA 1RA5A 1KFWA 2VTFA 1I0DA 3N9SA 3G18A 3LMYA 4NF7A 3QMRA 1KM4A 6A3HA 3W24A 1PZ1A 2PDYA 3GY1A 4E5TA 3BAWA 3S5NA 3WJSA 1KWKA 4GA8A 4Z0SA 3W76A 5I2UA 1OC7A 4PFMA 3L5LA 1F5ZA 1FWRA 1BTMA 4XV0A 4KRTA 3U2CA 2I5QA 3PJTA 3PPGA 3QC3A 3ZS4A 1N8IA 3WUGA 5BOFA 2DQXA 2Z0IA 2DSWA 4NRRA 3VOFA 3SCRA 2HWGA 4GIEA 3RPTA 4OHQA 4FPSA 1P6BA 1WOBA 4LUIA 3ABRA 3G1RA 2ZOXA 1GORA 4YIWA 2Y8KA 2PDLA 1V6WA 1K9TA 2QJIA 3S9YA 3MZ2A 3S83A 3VDAA 3GIQA 1BYDA 3DKJA 1X7IA 4P5UA 1D3CA 1RHCA 2Z24A 1DQUA 4KGJA 1KFLA 3H2FA 4PTWA 1H49A 2DUXA 3RG6A 4E0CA 1W0MA 1E9IA 2QR6A 1J0IA 3W7NA 5DY3A 4EWND 1GPWA 4K8HA 2Y5JA 4OUEA 5D9OA 2RAGA 1U5JA 2OT0A 4H3DA 1JAKA 4AIBA 2ZXAA 1KXVA 3UJRA 2BY2A 3KXQA 2EJ1A 1KRCC 3UJFA 1Q6RA 2QLYA 3VE9A 5BU9A 1A5KC 3OBEA 1MZHA 2DVXA 1YMYA 1LRNA 3VNDA 1E0VA 2BB0A 5G2HA 3KL5A 2JF7A 3DHPA 1KTNA 4D8AA 3VE7A 4Q8NA 4N4QA 2E9BA 1R6WA 3K46A 4HK6A