1UMYA

Bhmt from rat liver
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
389
structure length
374
Chain Sequence
KRGILERLNAGEVVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASSGQKVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKIFHQQLEVFMKKNVDFLIAEYFEHVEEAVWAVEALKTSGKPIAATMCIGPEGDLHGVSPGECAVRLVKAGAAIVGVNCHFDPSTSLQTIKLMKEGLEAARLKAYLMSQPLAYHTPDCGKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWIRARARKEYWQNLRIASGRPYNPSMSKPDAWGVTKGAAELMQQKEATTEQQLRALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Betaine--homocysteine S-methyltransferase 1
publication title Crystal structure of rat liver betaine homocysteine s-methyltransferase reveals new oligomerization features and conformational changes upon substrate binding.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 124
structure length 374
sequence length 389
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.5: Betaine--homocysteine S-methyltransferase.
pdb deposition date 2003-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02574 S-methyl_trans Homocysteine S-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.330 Alpha Beta Alpha-Beta Barrel TIM Barrel Homocysteine-binding-like domain 1umyA00
3BOLA 1Q8JA 5DMLA 1Q7ZA 1Q85A 5DMNA 1Q8AA 1Q7QA 1Q7MA 1UMYA 4M3PA 1LT7A 1LT8A 3BOFA 4CCZA 5DMMA
chains in the Genus database with same CATH superfamily
1NH6A 4TXEA 1GKRA 4DYJA 3A47A 4LBUA 3H8AA 3KM8A 3O15A 3SY1A 3W1XA 1Q45A 3FYOA 3TAKA 3TWAA 3S46A 4AY8A 1ML1A 5A6MA 1EDTA 1Q6CA 2Z6IA 4MB5A 2DPEA 2PBOA 1FOBA 4R88A 4JY8A 2PDCA 2RH9A 3QSRA 1CXLA 4A6GA 4ML9A 1EOMA 2WKGA 1BAGA 3MUZ1 1QNSA 1A5NC 2OFJA 3ZLHA 5XIMA 1VB9A 3CHDA 3TJLA 2QS8A 2TPSA 4UTHA 1IEVA 1ISXA 3P80A 2E28A 3OVRA 1XRSA 4MLJA 5EMKA 4LALA 1SYTA 5DRIA 4X9YA 4DJFD 2XTKA 3W4RA 3V1PA 3NA8A 3L4XA 5HMSA 1OC6A 1YQ2A 3WLIA 3GU2A 4AMCA 1EJRC 2CERA 2VCAA 4JR5A 1ZTVA 3GH4A 3H24A 1W8GA 1YXYA 4HPGA 4WK9A 5D9OA 4CD8A 3G6LA 3P8JA 3VM7A 3GNPA 3P2VA 2DVUA 4HK6A 3KLLA 4A3HA 1UPPA 4IQJA 4QLLA 1NARA 4ROQA 4AISA 4NAEB 2V2HA 1VF8A 1VLWA 3MYPA 3V3WA 4B3LA 2ZZ1A 3QF0A 4HSHA 1IT7A 2C13A 4MM1A 1NDWA 2VCBA 3E1F1 1UD2A 5BWFA 4JAWA 1B4KA 2YL9A 2I14A 2VQTA 4KGLA 1KWGA 4KBXA 2V69A 3OVPA 5IOBA 1XBZA 3KOZA 1TVNA 1SFSA 3EWUA 2HSAA 3SUVA 5KEZA 4PSPA 2NWSA 3KBVA 1CGYA 1LYXA 4NZJA 5A6TC 1U33A 4A8IA 3T0DA 3TC7A 5IM51 1V5XA 1E5JA 4QTGA 3IEBA 1JNEA 2CKSA 1KCKA 2EKCA 3O05A 3ABZA 3WMLA 1GYMA 3KL3A 3TNBA 2X2GA 1XC6A 2V3DA 5EB8A 1UYQA 1TR9A 1W1YA 4NZ5A 2Z2AA 3RM4A 3CGTA 5ECVA 4MNJA 1WKDA 3C86A 1BGGA 3TNOA 4W9TA 5I3DA 1CGVA 4QQ3A 3WQWA 3GXTA 2HK0A 4OHQA 4PUDA 3STEA 1WA3A 3UEQA 1RLCL 4Y9MA 1ZSXA 3QPYA 2C79A 1VYRA 3L2IA 2PDBA 3LS9A 2C19A 2GSHA 3TW9A 1XYCA 5JIWA 4FXSA 4U2YA 4ZOCA 4MWAB 1YPIA 1QATA 2V5CA 4FOUA 4HHLA 5JQ9A 1T40A 4RDZA 3FJNA 4DO6A 4HD5A 5GJMA 3TLLA 2ON3A 1KB3A 1AQMA 4CU7A 3BCFA 4NAEA 1SFTA 4DNMA 3SDOA 4OBRA 1KBBA 4NRSA 1F4HA 3Q65A 2A6NA 4J3SA 3XISA 3LB0A 1YPXA 1KRCC 4TTGA 1P4CA 3VD3A 4A3UA 4CCZA 3GIYA 2ODOA 4QJ5B 2E25A 2YCLB 2QJIA 4O15A 3LCXA 1PIFA 4H9YA 5F4WA 3LXCA 3KFTA 4UR9A 3RITA 1JPDX 4HU0A 3ITLA 2BY2A 2OQHA 5K4ZA 4RDYA 1Z8AA 3LLFA 1US0A 4JEJA 2YL5A 4RNHA 5I77A 1OG6A 1DXIA 3KRUA 3H70A 3ELFA 1OZQA 1PTDA 4P8WA 1H1YA 2ZYFA 4QSHA 1OGBA 4M6PA 1GOKA 3DGBA 5L9FA 1ZRQA 2IW0A 3HMJG 2Y61A 3PP7A 1W1A1 5HATA 1QPQA 3VIIA 3LU2A 2XU2A 3B8DA 2OPJA 4NZ3A 3FX4A 3P0XA 3I6RA 3LX9A 3AI0A 3C0SA 1WCGA 3LTPA 4JYEA 3VO0A 2CZEA 4Z1AA 4Z17A 2VD9A 1YNQA 2VI0A 4UQ9A 5LIUX 3MWAA 4AYGA 2A85A 3FNDA 3MUIA 3MP4A 3CTTA 5LNSA 3FA5A 5G1MA 1UWAA 1OABA 3GH7A 4H9MA 3HQPA 4L9XA 3A4WA 4GC3A 1WX0A 3EDEA 3BE7A 3H7VA 4QR6A 2GOUA 2BP1A 2BVYA 2VRKA 1EGMA 2ZZ7A 1ZAHA 4GJIA 4DI8A 3CQKA 3QFWA 4KFOA 3GXDA 2GJXB 3NL2A 1VFOA 4AY1A 1Y5WA 2VX5A 5HAOA 2PDFA 1W37A 2PTWA 4XB3A 1E9ZB 3NFUA 2X42A 1CLVA 4DUXA 2GVEA 3TDFA 4PRRA 1J5SA 1F3TA 3LUTA 4G7EA 4WXYA 2AMGA 2BVTA 3PPCA 5CPLA 4RZ4A 4UR8A 1NP2A 5CZSA 1XYZA 3LHZA 2QJNA 3CH0A 2YCLA 4CGTA 3M07A 1FCUA 4EPBC 2C6QA 1S5WA 3PJTA 4PMVA 3XINA 5K9DA 3KVLA 4EAYA 3W53A 3W86A 4HNUA 4GCXA 4Z08A 2QUUA 3MP5A 4GRSA 4UQCA 1CT5A 1EP2A 1KM6A 1RQEA 1OC5A 4ZB0A 4W5ZA 3QKEA 3A4JA 4IJRA 3G1VA 1D7KA 2A5HA 4DWSC 4DXVA 1XIGA 4GISA 4DQWA 3EX6A 1L6FA 3M0KA 1GVIA 2QZRA 1H7RA 4DUVA 4WY0B 2ISDA 1G7UA 1SSDA 1OFAA 2Y7GA 3T2OA 1QI4A 4LH8A 4BF9A 2PDXA 2GQ9A 2CHOA 3VI2A 1ENUA 2ZUVA 1FFRA 8A3HA 4LVFA 4MIMA 4HZ7A 1ME9A 2QGYA 3CQJA 2W9MA 2IKHA 3F4NA 3W2LA 2ZUWA 4L5ZA 3DCPA 1P5BA 1WE5A 1U83A 4A35A 1X8CA 4RXFA 4GBDA 2A3EA 2GJXA 3RU6A 2ISSA 1YE6A 3M6DA 1V7AA 3HQOA 3TCEA 1MZHA 3C0LA 1V3JA 1V6XA 1I2NA 3DX5A 1KM5A 4JYDA 2E09A 4YHGA 1IV8A 5BOFA 4LY8A 2PD5A 3TSMA 1RALA 4XZIA 3UR5A 3W1TA 3CWNA 3NOEA 3S2JA 1XP3A 4RE2A 2XM1A 4LANA 4H8HA 2QCDB 1G94A 4WVXA 2G41A 4G7FA 1BQCA 3GBEA 2VC9A 4H8UA 2VR5A 3PZOA 3M5YA 2NVDA 4O12A 2D22A 4EWND 3BGGA 3Q2DA 1KRAC 3NPXA 4AIBA 4H1ZA 5BRQA 2ZUMA 1OF6A 1TRIA 3STCA 5DANA 1VPXA 1JZ7A 1W3IA 4H3DA 3CAKA 3LPOA 1B9ZA 3ZJ7A 3B05A 2H9AB 4IFKA 3GTFA 1X38A 2EPHA 4UMCA 4XWUA 3MC5A 1JCLA 3P93A 5JVLA 3LQGA 4TX8A 3C56A 4GQRA 3WK0A 1R3YA 5LNWA 5I0DA 3AROA 3MDUA 1OK4A 4WRHA 4UTKA 4YJ5A 1YADA 4Q8PA 3NPWA 3VE9A 1G4PA 3IGUA 1UR4A 1PJ9A 3AQUA 3S8HA 4K37A 4LB3A 2FHFA 3VCCA 4GVFA 1H7OA 1OK6A 5GJNA 4WGXA 2VZVA 2E40A 4HNLA 2DZWA 2NX1A 5MF5A 4H9ZA 3VKAA 1TR1A 1W5MA 2BMBA 2VRJA 1RCXB 3P5ZA 1FDZA 3TYDA 4J5NA 7PTDA 1S5MA 3JR2A 1IT8A 3GR8A 1K4HA 1UZHA 2JGYA 2HWGA 1QOPA 4LPCA 3UWVA 2JKAA 4Q6XA 1V8EA 2W61A 4LB4A 5CZJA 3BARA 2R8WA 4AX6A 1ZENA 3HOJA 2QCDA 1AL7A 1XKJA 3WNPA 1PYFA 2B31A 4DAIA 4ACZB 1L8PA 4NRRA 3EXTA 4J3WA 4W84A 2E6FA 3KOXA 2BXYA 4YVPA 4JX5A 3MSYA 5ECUA 1YDNA 1D3HA 1LT7A 3UWEA 4AHOA 4UTJA 1WKYA 3CV6A 4DZAA 3MWCA 2QEZA 3KOFA 1AW2A 2NV9A 7CGTA 2VRQA 1QPKA 2JK2A 2W66A 1A3XA 3PZ9A 3G18A 3WUBA 5EYWA 3V0UA 2AGTA 1FWBC 2HVOA 4DZ5A 1Y5VA 3U2EA 3FOKA 4AXKA 3VDBA 1ONEA 2IKJA 3HN3A 3U4AA 4NJGA 2CEQA 3CIXA 3D0CA 3WQCA 3CV7A 1EHAA 4H00A 5M1TA 3QC0A 1T0OA 1UQZA 4P2VA 4DYKA 2XH7A 1O7AA 4L1GA 4IPJA 2V6AA 4TQTA 1NDZA 3E5BA 2DJLA 4Q6JA 2OT1A 5CPMA 3C3UA 1BKHA 3T05A 3LA4A 2CXEA 2EEXA 4LVAA 1AK5A 1KCXA 4Z2HA 2O0TA 3LLXA 1XQLA 3DESA 3AXKA 3NR0A 3KL5A 5E6YA 4XISA 5JBEA 3BQ5A 4HHMA 3W81A 2HPMA 3PPHA 3OLGA 5JH2A 3EA2A 3CZEA 2WK2A 3CL6A 4R3UA 3RJXA 3WDJA 3BLKA 3STGA 1EB3A 1LQ0A 3A9IA 4N9BA 3UJSA 4ACZA 2XUCA 3BGJA 2CCRA 3U8GA 4CQBA 3G3DA 3UNDA 1J10A 1PTGA 4XZNX 5DY3A 1E9YB 3E2VA 5C0QA 4HMCA 2FZ8A 3M9YA 1JXJA 4G9PA 1BGAA 2QW5A 2BY3A 2E5DA 2V30A 1GTHA 1DPMA 3TQPA 1JD7A 4LUSB 1RBLA 4BA0A 4GKLA 1WKFA 4CN4A 2PZ0A 3ZSSA 1Q6QA 2PGRA 9XIMA 3B8WA 3AXHA 1WZKA 3VKBA 4O4WA 2OMAA 2IXUA 2EF9A 5HQEA 2PP0A 4D6JA 3O07A 1KFBA 1PZ1A 2I5GA 2Y5JA 4N9DA 3WQ5A 3WLNA 3MP3A 1AJ0A 1GVSA 3CMJA 1FDYA 3OLIA 3UR7A 2J9ZA 2PDHA 2HVMA 3D5HA 5MKGB 4W93A 4L9ZA 4WKHA 3WNOA 4ZXLA 3H2FA 1VS1A 3W6MA 2UBPC 3CQ0A 5I03A 4PFMA 1QK2A 2J88A 4O0ZA 5CEWA 4G5DA 3MDWA 3U3HA 4TUFA 1S2UA 2J7BA 3ZLGA 2PF0A 1GJWA 3T09A 1XLLA 2DUAA 3QW3A 5A3HA 1TV4A 1E3XA 1DWGM 2UY4A 4KRUA 5GNXA 5AKQA 1E0TA 5F4SA 3NYZA 3HZ3A 1W1ZA 5I7GA 1JUKA 3TC3A 1BD0A 4AW7A 1S38A 3CUXA 3ZSTA 4ERGA 2Z1WA 3PM6A 2PWHA 4BFAA 3AJ7A 3QN3A 2RFGA 2PB1A 3MU7A 2WZIA 1R30A 1YHTA 4H2HA 5KITA 3TH6A 3L7RA 2OWWA 2DW7A 3U2ZA 1V93A 2NX9A 5IDIA 1W3TA 3M0MA 1AODA 4AZCA 3MSGA 5CPNA 5BXPA 3R8RA 3QHNA 4DZIA 3PANA 1CYGA 3MPGA 3FYPA 3BW3A 4K6AA 2R1PA 3UQNA 1J93A 3JZUA 1IZCA 3NSNA 1VYSX 5JBFA 3QY7A 3ES7A 5EA9A 3PTQA 3EDKA 3MHGA 4YIWA 4RDVA 3RK8A 4GXWA 1H11A 3G6MA 3SN0A 2NSXA 4GJJA 6A3HA 4A29A 5MKGA 3POHA 5REQB 3BW4A 2Y2WA 3BAYA 4JTTA 1YX1A 1JR1A 2GSEA 3W1NA 1VFFA 4AHPA 1XG3A 3TN4A 1OGSA 1HUVA 4A8NA 3A64A 3GXIA 2QT3A 4HZMA 3UXDA 1EH9A 4M6QA 2QULA 5TIMA 1KFCA 2OLAA 4OV4A 5FJRA 4JQ1A 3NWRA 1HF6A 4DBDA 3M0JA 3II1A 2KAUC 4B5XA 3B0XA 1KBLA 2E1WA 3TW7A 4LFYA 1VZWA 3W27A 4GI4A 4UTMA 4Y90A 5IBXA 1FP8A 2ZRYA 2VKZG 1GOXA 4AD1A 5D38A 1BPLB 5DXYA 4J2MA 3SCRA 3CL8A 4K1GA 2I1OA 1OHLA 4LSBA 1F6PA 1GVYA 1FWEC 4OWGA 2JKEA 1L6YA 3UWUA 3WEMA 5AC6A 1QI0A 2NW0A 3U2OA 1V3LA 3G2GA 1DWHM 4J3VA 1JGIA 3CUGA 3NDZA 2NQLA 4PRTA 2P8BA 3P14A 3R5EA 1KM1A 3PK7A 1X7FA 3QGKC 2ACQA 3FK4A 3RG6A 2VGFA 1MQQA 1H62A 2QDHA 4JFUA 1SGJA 4B15A 3VKKA 3G8EA 1BYAA 2I5IA 5F2GA 5CGTA 2VNCA 1RP8A 3PTDA 3GU1A 2GGEA 4GNKB 4DJEA 5H8PA 1O5RA 3LEPA 3E0IA 3TR9A 4QAWA 3ZVHB 1ITUA 5FOOA 1C7TA 4B5WA 5REQA 2C71A 1VCFA 2POTA 2G97A 3W2KA 4Q8QA 1QU4A 4PMOA 1T8XA 4GQQA 4GXMA 3W25A 1VR6A 4TX6A 3FGCA 3AU6A 4AVFA 4ATDA 2R24A 2OO6A 1NF0A 5CSUA 5LA0A 1UP2A 3L4UA 1KTNA 1E1FA 3BURA 4YYFA 2Y7FA 1N55A 5BRBA 2VZUA 2B7PA 3GNXA 4V15A 1NWRA 1KRBC 1MEIA 4O1DA 1A5UA 4F0KA 1OX4B 2Q3OA 1LF1A 3STFA 3H2MA 1LOQA 3EPMA 3BMWA 2PBGA 3IIZA 2E6YA 1Z89A 4WGHA 4DBWA 3B8SA 3UG3A 3BXWA 1A4MA 1HW6A 3WENA 1B30A 3M5ZA 4NHVA 5J8LA 1O5XA 4QLJA 3QM3A 1FXQA 2VURA 3H54A 4ZQMA 2Z1VA 3GYCA 4UTLA 3MO4A 3LYEA 1A5OC 3WF2A 3IACA 4AFYA 3I6TA 3PJUA 3AOFA 2J9XA 4M29A 4Z2LA 1GQKA 1H50A 3KCLA 5CJMA 4PTNA 4FX7A 1ODUA 4DELA 4MUPA 2ZUNA 2ZRXA 4Q8TA 4IFRA 1TJ2A 1VP5A 2CHRA 1UG6A 1TQJA 3TQVA 5AZ0A 1H61A 1PL9A 1XXXA 3AUJA 2JFEX 3QTGA 4LBSA 3AWOA 3IK2A 5I3IA 4N9CA 1E1CA 3AS3A 4IPNB 1QAPA 3A12A 2PDIA 3EYPA 1UJQA 4KCWA 3OZYA 3CNYA 2YCIX 4DBUA 1W9XA 2FVMA 3BMVA 4WLCA 1HP4A 2BASA 1Q66A 2NQJA 2Z24A 4LCRA 1ZP4A 4FNUA 2NV2A 4MAVA 1NEYA 1W9VA 2QLYA 1OX4A 1BRLA 4J4KA 2ZOXA 4HPNA 4LV4A 1P43A 1XV8A 2V2CA 2XVGA 4O14A 3VMOA 3RXZA 2NLYA 1JQVA 4PUKA 3RLUA 2Y88A 4IG2B 4J35A 4BZYA 3KXQA 3IIXA 1Z42A 3F5LA 3H12A 3UG4A 2QIIA 1F76A 1UQYA 4UQDA 2P3EA 5H2ZA 4GPNA 1US3A 3FXYA 2X0SA 2IQ0A 3CYVA 2OSYA 3LQLA 3TTOA 4FOKA 4JICA 3P6LA 1NWUA 2WC3A 4O13A 4ZL1A 4GE8A 2AL1A 4ORMA 1MMFA 1OFRA 1UUOA 3UJ2A 1XUZA 3SIMA 5CSRA 1WAWA 5I6SA 3BAWA 4MZYA 3DHDA 2P76A 4BI7A 1EC7A 2WQPA 3K1DA 5HBFA 5DXXA 1J01A 2F2KA 3UA4A 4PODA 1VJZA 5K3VA 3HPAA 2ZXDA 3L23A 1VPQA 3OTRA 4Y8FA 1ZGDA 1FTXA 3B4UA 3W37A 1GEHA 2B0MA 1RD5A 4IIEA 1TV8A 2Z00A 1F3EA 4Y96A 1EFZA 2TMDA 1TQXA 1A5LC 2E9MA 3PZUA 3WK1A 3EA1A 4MPQA 2FZ9A 3ID7A 5JIPA 3PBVA 3IS4A 3CAQA 4QE5A 4E4UA 3LPGA 3DHUA 1O60A 1WKEA 3L2LA 3N4FA 3MJYA 3RO6A 2CWXA 3V5FA 3VMNA 1B5TA 4O1EA 1EJWC 3VCNA 3AHYA 2ZFAA 4ZOBA 3GSMA 2FIQA 3ITGA 1QTWA 3RX2A 5LNRA 5F2MA 2FPYA 3SO7A 1IEQA 3BSHA 1QW7A 2WZHA 2X8RA 3VOCA 5DLCA 4TTUA 4IG2A 1XJBA 2XHYA 1PIGA 1V03A 1VBJA 5H1WA 3OO2A 2VFGA 2TSYA 1BSLA 5D30A 3UA3A 3LM3A 1W6TA 4LCQA 2CBJA 5DF0A 4XK2A 1ODZA 3B9NA 4JDYA 4NP7A 2V9DA 3EWYA 1IXQA 3P82A 1KW1A 3B40A 3SRFA 2CNCA 2VYOA 2CPUA 4AZIA 4D6FA 2QF7A 2PSNA 1QO5A 1OF8A 4B5NA 3N2CA 1LBFA 2J77A 3AIQA 3MSDA 2WZEA 4UB9A 4KIRA 2ZXQA 4X9SA 1WUEA 2VEMA 4F0HA 3DU0A 5BZAA 5KZEA 1EWEA 1GQNA 1BLIA 4QP0A 3F2DA 4QEHA 5D03A 1DVJA 3FHAA 3OBEA 1OD0A 3SECA 4F48A 1W9PA 3BK0A 4RZ6A 1HN1A 2J7GA 3W7RA 3ZR6A 4J27A 3DOPA 3GW3A 4UTTC 4NF7A 9RUBA 3QFEA 1EBHA 5HPOA 3E3HA 2DQWA 1K1DA 4CVWA 4UMBA 3AWNA 3VUPA 4AMAA 1ITCA 1RCOB 1WQ5A 2CLLA 1QWKA 2W92A 5BU9A 4Z42C 3ZT7A 3OG2A 1SJCA 2A3HA 2RHGA 5I3KA 3W28A 4I3GA 4YCPA 1CCWB 5BW6A 3NSXA 1LL4A 3GO2A 3MKVA 1U30A 5ABEA 3FA4A 1FUYA 4NG3A 1IGSA 4O17A 2WC4A 5LIKX 3GWQA 4DLMA 3S1XA 5T91A 1J96A 3GUWA 5DBUA 3HJZA 1P6CA 2OLHA 1KBKA 2PU0A 3P60A 4PFHA 4XBKA 4DJED 3ZOAA 4HPJA 4M51A 1AL8A 4NUWA 3LZ3A 4JCLA 2OEKA 4L80A 4D9PA 3PBGA 2QYGA 4CEUC 3WLKX 5BMXA 3GZAA 5HMDA 3AAMA 3UXAA 2A21A 2QXWA 1V02A 2JEPA 4CNPA 3MMTA 4QAIA 3WDPP 4LNYA 1K9DA 3HJEA 4QGCA 4QE4A 4CNNA 1XBYA 2PLKA 3UYCA 3STPA 4N9EA 3GDKA 3OW1A 3DFQA 3PBYA 3M0YA 4WKAA 3T4WA 1P7TB 2DU2A 4AD0A 1QK0A 5C54A 3DUGA 4FMVA 2PDWA 4Z2KA 4D72A 2DH3A 3PZMA 3ZIZA 4KIEA 4NJHA 4Q4QA 2BY0A 4CQ8A 2XSAA 4PH6A 3VU2A 4N42A 1DBTA 5RUBA 5BXTA 1KGWA 4RCXA 3C2FA 2E3ZA 4EVZA 2WLZA 4XD5A 2JEQA 4IX0A 1AJ2A 3BGAA 4MKSA 4NI8A 3N15A 1P0DA 3SUWA 4YMZA 1P6BA 1XISA 3PBWA 1TWZA 1XPYA 5BOOA 4D6GA 4Z2IA 1U1HA 3CPGA 5GVJA 2FTYA 2BNJA 1BYDA 1RD6A 2Z1BA 4OUEA 3C5QA 5HDRA 1DJNA 3IVTA 4S3KA 4C60A 3EMZA 1XLCA 3CEUA 1GQJA 5A8QA 5C9WA 2ZA2A 1JZ5A 3R8HA 2ZTJA 1FWGC 2A4AA 5A6SA 1SZFA 1R86A 4JTRA 2BHZA 5BWAA 1KR0A 1X6LA 2ZX8A 4JY9A 1CGWA 2XWDA 1I2RA 1OFEA 3R43A 3R11A 1X97A 3A4XA 4UCFA 1CZ1A 3YPIA 4LV9A 3EX2A 1CI1A 3DKLA 1ITQA 4C90A 3V36A 1HO4A 1MEHA 3ZFHA 4AY7A 3HURA 2RGLA 4L7ZA 4XAFA 2CBIA 1S5TA 1MRAA 2J6XA 5HQLA 3C4UA 3ANYA 5A2CA 2WSRA 1H60A 3LCIA 4LUTB 2DUZA 2WMKA 4NZ1A 2DZUA 3IGSA 1IWAA 1QPNA 2OXNA 2D20A 5AY7A 1WUFA 3IJ6A 1AQFA 2GQ3A 2VD8A 2EG6A 4C6KA 2NQHA 4J28A 1O1HA 5HWNA 1TPEA 2PCEA 3FXGA 3J7HA 3KEHA 4PMJA 1SO3A 3KWXA 4FEZA 2WNZA 3BDKA 1HL9A 1K9TA 1JPMA 3PULA 5FEXA 1DJYA 1Q4WA 2E9BA 5BNKA 3FFSA 3LHVA 1JAEA 3LCHA 3ES8A 4GIYA 2OWXA 4OKDA 1TTJA 1Q6RA 3UCQA 2B4GA 5D2WA 3FJ6A 1LBMA 5FJIA 3NDYA 5CPOA 1ZJHA 2GJLA 4MZ8A 3OVQA 5K9CA 3LGGA 1QI2A 3H55A 3TMQA 3OGVA 3RCYA 4QRNA 3NQAA 4JD4A 1OZMA 1VFHA 3GAYA 3THCA 1MI3A 5CG7A 4KKXA 2WMIB 4KWVA 3FJLA 1M04A 5DMYA 3TN5A 5CAKA 2INEA 4MSSA 4P8VA 1W3JA 1GOIA 4D6CA 3DXIA 5KTLA 3FN9A 1C7SA 4XUGA 2ZE3A 5I24A 1BTCA 3BW2A 5FF7A 1TPC1 1E6PA 4PTVA 2VEPA 4GYJA 1OFQA 3BZGA 4ACYA 3NEVA 2UV8G 4BF5A 3ARXA 2J8GA 4LUTA 3ZLFA 3USBA 3WLTA 1LG1A 1XLGA 3T0TA 4JQAA 1DXEA 2OLSA 3OQ8A 4JKMA 2OGYA 3G0UA 1IZJA 5FI8A 2CLIA 1LL6A 3QR0A 5LGZA 4MOZA 4DXXA 3QBUA 5G2IA 4YN5A 3AS2A 1W56A 5E93A 2CWNA 2VDGA 4DWSB 3VZYA 3THUA 5CBIA 1AH4A 3GC2A 2V3GA 2OU4A 3M0VA 1U5JA 3ISIX 3VGEA 2J13A 3M0IA 4BQ3A 1GW9A 2DIKA 1BHGA 1R2TA 2Y8UA 3ZT5A 1YKWA 4IJBA 3VE7A 4C91A 1OVDA 2J66A 3TQKA 5AHLA 8XIMA 3PJWA 1QDSA 4ILSA 4AVNA 1YDVA 4UTFA 4NT0A 4EWJA 3L66A 5KMYA 4HB7A 2F84A 2FPTA 3PTKA 4S3JA 1MW3A 4ZVJA 4IL0A 3TTYA 2WMIA 1ZU8A 3AYTA 3VOIA 1PKLA 4R27A 5DRCA 2O92A 2G95A 1OCQA 1S39A 2Y7DA 1GHSA 4KWOA 2REQA 4IMFA 3WMCA 2QMKA 1V3HA 2OX4A 1SMAA 3NQEA 2GUBA 4ICMA 2YW3A 1LUCB 2ZWYA 2X7WA 4H83A 3DZ1A 3L4WA 1EJ7L 1RVGA 1JL8A 4Q22A 1C29A 1EC8A 1VD6A 3EX1A 3C8FA 1MQRA 4A22A 1PDZA 1BVZA 1W1PA 4MNKA 5E9AA 1EDGA 3W02A 3QHOA 4KWWA 3G5EA 1XLMA 1ZALA 2NQZA 3TA9A 1TV3A 4UC5A 2QUNA 1UWSA 3H4XA 4L61A 2BG5A 4EKJA 3OLEA 5BU6A 4F0RA 3VZZA 3AALA 3G1SA 5CC3A 4AF0A 1UKSA 2NVAA 1GYNA 3W07A 3NQ7A 3T8QA 1GPWA 2QHAA 3BLPX 3QZAA 1HJSA 5K7JA 2HXUA 2QMJA 1ZB5A 3A6OA 4DWSA 1LT8A 4LS2A 4NAFB 3RJYA 1EJXC 3UETA 2X2YA 4GQGA 4YNGA 3PZQA 4M7SA 4J1OA 2VCCA 3OBAA 1A49A 4V27A 1JG9A 3O0FA 3MANA 3WK3A 1J18A 1EDQA 3RMEA 1SR0A 1Q7ZA 2QAPA 1VFUA 4PBGA 1EHNA 3T2QA 2WQDA 4B3ZA 2PODA 1UKOA 3UVAA 2J8FA 4ZSTA 4JTKA 1WP6A 1MFVA 3VTRA 3GR7A 3BQ6A 1EJVC 5E0CA 4NL1A 3UYIA 5AFDA 6REQB 1V77A 1VENA 4FNQA 2BXVA 2YKKA 2YGYA 5D02A 3EOEA 2GYIA 2UWFA 4ZE5A 2B7NA 1SO4A 2UY5A 3BH4A 3OPSA 3TSDA 1UWUA 1J2WA 1DHPA 1W3HA 2CZ5A 4PCPA 1Q13A 3DC8A 1H49A 5E0KA 3QSTA 3FHQA 3C2YA 3LHYA 4S3FA 4TO8A 1XYBA 1LUCA 1KC7A 3S1VA 1NFGA 3USZA 4GOAA 3WQ8A 1KLYA 4HGXA 1YRRA 4NXSA 3THAA 3CAVA 2EO7A 4HJFA 3MTWA 4KH2A 1HKVA 3W7MA 5CLTA 2XIQA 3GDRA 1XR2A 3EOOA 1QHOA 2VGIA 1V0NA 2FZMA 4U5KA 3O06A 3N6QA 3KCJA 3VFLA 3KHDA 3FKKA 4UTWC 1M65A 1DOSA 2JALA 4QFUA 3GDTA 4OV9A 4UIOA 2AOSA 3QLLA 3AXIA 6ALDA 4RKAA 2E4TA 2PRHA 1WZAA 1QR7A 3DIPA 4B4FA 1ECEA 4NAFA 4LW7A 1A3WA 4QHRA 4JIPA 2Z0IA 4WJXA 1L6GA 4PCTA 3BTNA 5I79A 3AIWA 3CHCA 4JIEA 5C8BB 3RFAA 1FBAA 5FEPA 3ABXA 3HG2A 5CPQA 2SFPA 2XH4A 4D6EA 1FFQA 5BYWA 4ZR8A 3N4EA 2OKOA 1C8QA 2YFNA 3HG5A 2AAMA 1VHNA 4H7CA 5D8ZA 4XSMA 3BL3A 1R38A 3VINA 5DQPA 3UXKA 2PP1A 5EBAA 2CLEA 2WNQA 1H7PA 3LN3A 3WF0A 4C7GA 1TIWA 2PWUA 4EF9A 2WVTA 1Q6LA 1WAUA 4JGDA 2XFFA 4LNCA 3RYSA 3W1UA 4P7LA 5DELA 1F5ZA 1EO5A 4IMGA 1VFTA 2ZRWA 3I4KA 2YA2A 3SFWA 1YTDA 3NL3A 1K8YA 4LQ1A 1YTEA 4PULA 2QDDA 4PA8A 2FQIA 1XRVA 1PBGA 2PLMA 3N2OA 3HO8A 3N6HA 4JIQA 9CGTA 1A0EA 4O53A 6ENLA 1K8XA 4JIRA 2VO5A 4QJ1A 3QV8A 3S6DA 3UT0A 4AU0A 4JTHA 3GLCA 1VCGA 4ZB2A 1VEOA 5C9RA 5G1TA 4TR9A 1H09A 4LY4A 3VD7A 3B0UX 2PAJA 1MDLA 1R6WA 4JTCA 3PSWA 2FTWA 1OFOA 1F8IA 4DY1A 1E73M 2Y5SA 2E9LA 2JBMA 1XLFA 4WJEA 4ERIA 5BRPA 4ZGYA 1FWJC 1GZJA 2BVWA 2GDQA 1FVPA 1QNPA 2QUTA 3HGJA 1TPFA 1DIDA 2ZZ5A 1TA3B 1UA3A 3K46A 3R4IA 3GE7A 5I23A 1EQPA 2FMOA 3EX4A 4FHAA 1K7FA 1Z32X 2D3LA 4H2CA 4F79A 2F6UA 3G24A 1L2UA 1ALDA 2WZTA 1JZ8A 1XRFA 4J9JA 4AHQA 3CMGA 1K9EA 1WOAA 4Y8EA 3W74A 4O52A 4PUEA 1DWIM 4IWWA 3QPEA 2WW5A 3ARPA 2BTMA 2R1MA 1LWJA 4XZBA 4BEUA 1PWLA 4L4PA 4NXKA 3DECA 4YXGA 1JIBA 4M80A 4I5UA 3E0FA 1H41A 3WDHA 3QKZA 3UCDA 1IXNA 2LLEA 1K9FA 2F61A 2FGBA 3W01A 5GNYA 3W84A 1EEPA 1YBQB 2YCEA 4WSHA 2Y4SA 3BMXA 1V0LA 4O10A 2XZ7A 2PDMA 2VOTA 1O1ZA 5I3FA 1UBSA 4TVUA 2ZCGA 1F61A 2V5KA 3VDHA 1I2PA 2GVYA 2WMFA 1A47A 1I4NA 1TTQA 5LYRA 4D6HA 3NGJA 2CHNA 4IX2A 1HZYA 2IMRA 1A3HA 1JRCA 3HV9A 1J0ZA 1G6CA 1GKPA 1DJXA 4S3CA 3WFZA 1IT0A 1XDLA 2PI6A 5HOSA 1VHCA 1OINA 1NY1A 3SZ8A 1XLAA 1JXKA 3CWHA 2XM2A 1XH2A 4ZQPA 2Z1XA 4WD0A 2V5LA 2A3BA 1RJRA 3BLEA 4YL2A 2HXTA 1E72M 1TA3A 1JF5A 5CPSA 3ERPA 3G1YA 2D2GA 3GW0A 3IAQA 7ENLA 2V5JA 4HCDA 5C71A 1QWGA 3L4VA 2EG7A 3RPDA 1B4EA 1TB3A 3N1AA 4NVTA 4JNMA 3MHFA 5C2XA 3AXXA 4Y6GA 1XIFA 1OBAA 2O9TA 5ABHA 3PZGA 1JYXA 4XZLX 3WSUA 1TFVA 2CBVA 2IPGA 4DM1A 1T5AA 2WMJA 2ZZ6A 1OCNA 3TYEA 3VIGA 3VD5A 3TOYA 3H53A 3ABSA 1DV7A 1E0UA 4ZA0A 4Q8NA 3PJXA 3UERA 1JFHA 1FX6A 3MY9A 1A4LA 3M0XA 1BF6A 1YW1A 2FB3A 1UMLA 4PCNA 1LBLA 5DT5A 3ARSA 4PMNA 2J8TA 1K6AA 1MNZA 1H0GA 4E3TA 5M17A 3G0SA 1CLXA 4DWSD 4FPSA 1JDCA 2OO0A 1ADOA 4MY1A 2J6VA 3UF9A 1V6VA 3SCOA 4GO9A 4JXCA 1UBPC 1O4UA 2OGJA 5FA5A 4RE3A 3PZIA 4JX4A 3ZR5A 2YDQA 4F4RA 4QSFA 4D8AA 4KERA 2W4XA 4F0MA 2YZRA 2WANA 3M0HA 2WNNA 1LL7A 3B9OA 4J2PA 1R2SA 1JJKA 4HPHA 4V1XA 2W67A 1VEMA 2Q01A 1WB0A 1SZEA 1DWAM 3I68A 3DG7A 4NJIA 5E0FA 3NZGA 4G8TA 3AMLA 3WJYA 3LBMA 8RUCA 2QCLA 4KCUA 1QI5A 3LCWA 3GFZA 2V67A 2J7CA 5I78A 3W1RA 2D0GA 3AIUA 1Y0EA 5FF2A 1DYSA 3DYPA 2PDLA 4IIHA 5HPCA 4LT9A 4XTDA 3QZEA 1H7WA 4HYVA 4RNJA 1M68A 4HQVA 3W26A 3WQDA 4YTQA 3SRDA 1CLKA 2W63A 1ZAJA 4MLRA 2NXIA 3VNYA 1NOUA 3LXAA 1BXBA 1ISYA 3QW4B 1IXPA 1ZJBA 4RNFA 3C61A 1PKYA 3R7MA 1S5NA 3F4WA 3NM3A 4G1KA 3APGA 2ASHA 5H8UA 1RJQA 1KCZA 1GUVA 1FDJA 1DHKA 2P88A 1KM0A 3GM8A 1T7LA 4JTAA 4GVIA 2VZSA 1GKQA 4ZSUA 2IKGA 4CD7A 2GDVA 3CZLA 4RUBA 2Y1HA 1JCNA 1X7IA 1VIWA 3BWWA 3TTQA 4DM2A 3O6CA 1JUBA 3TWBA 3B97A 3H7RA 4NJJA 3VABA 1J0JA 4LF2A 4LTSA 3W3OA 4M1BA 3OYXA 4W8AA 2PTZA 2C7FA 3B9DA 2ZZ2A 4FI4A 2RDUA 4B91A 1M41A 1OFPA 3NEHA 3TN6A 1ICQA 3GVVA 3W1MA 4X22A 6TAAA 3UZYA 2TYSA 5JH1A 5T9CE 4K7VA 4DBEA 1A0DA 3V5CA 2O55A 2EHHA 3JVAA 4QG9A 3KRSA 1H5YA 2ZA3A 3Q4DA 4MB1A 1QNVA 2DSZA 1LROA 1QBAA 1KFJA 1A0CA 1HVXA 3E12A 3VPLA 4QQUA 4MGGA 3NXFA 3LHUA 4IMAA 1JZ2A 1PCWA 1REQA 1L6SA 1KBJA 3AC0A 3RCNA 2C0AA 1MYRA 4IPLA 2PRLA 3KOYA 3AICA 4ROPA 1XG4A 4M0XA 3DI0A 1E9LA 1RPXA 1AH0A 5CC5A 2BVDA 3I3DA 1KM3A 3T1GA 1XYAA 3WQVA 2G37A 3MB9A 2GQ8A 2HBXA 2XSBA 5TF0A 4L4MA 7REQB 3T78A 4LAKA 3C8NA 2BGNE 4F2BA 4QITA 1S1PA 1F9CA 3QGVA 3V35A 2GUUA 3M7WA 4AZBA 3F2CA 1XLKA 4H7VA 3F5KA 5D2TA 3G1DA 1SVDA 1DQWA 5AVNA 4WSJA 2WPBA 3BSMA 1M7XA 2ZRUA 1ZBKA 3AIVA 3L21A 2GVJA 3VIHA 3MQTA 4DLFA 2OODA 2VFHA 4BKNA 3G1AA 3B0VC 3N14A 1IQ8A 4YLWA 1TPDA 1UWIA 5JU6A 4Q4OA 3B8TA 5CH9A 3KTXA 1WDQA 1IYXA 3S5ZA 3SUUA 1RLDA 4MWAC 3NL5A 1Z44A 4C6IA 2P53A 1TELA 3ARVA 3IAPA 3HPFA 1EL3A 4HK5A 3FKRA 2RDXA 4GI9A 4AWSA 5FSEC 1BQGA 4V33A 4ZFCA 4X60A 4KEZA 5CPTA 3CT7A 1ONWA 1TV7A 3MUAA 3O8AA 3UZWA 3BC9A 3ZO9A 3TTEA 1Y5XA 3WX7A 1Y8BA 4PTWA 3F7JA 2CW6A 3RX3A 4RLIA 1FH9A 1XDJA 1AUSL 2E68A 2YL6A 1R8LA 5DX7A 3N4AA 4BF7A 4L1WA 2GGHA 3I3EA 2ZX6A 4H4IA 3LBCA 5EKYA 3UR8A 4EOUA 3M64A 1H5VA 1J12A 2QVHA 1HXJA 4H9TA 4JFSA 3FAWA 4OOUA 1XCWA 4GUJA 1W3KA 3A24A 2PTYA 1GPFA 1MXDA 2VT0A 4JNZA 3CH9A 4NSBA 5IFPA 4RW3A 4LYRA 2XN1A 3GVQA 5AYIA 2DEPA 2E8YA 2I5QA 2QCHA 2G96A 4RE0A 1SR9A 1ZPTA 1VC4A 1CWYA 2Z25A 3E9AA 2ALDA 3VC5A 3IJLA 3O1NA 2PWEA 2FH8A 3KTSA 5CSYA 1WZMA 3EWCA 1PHWA 4LAUA 1HFBA 1YPFA 5CC6A 2HRWA 3POCA 4M8UA 5I02A 3WLOA 4ZCWA 4LRSA 1UOKA 2PC4A 3QMTA 3OHMB 2WVSA 5C55A 3IRSA 4BY3A 1TCDA 1EX1A 2PWVA 2OJPA 1TJRA 1I75A 1HKIA 2PLCA 3KX6A 4N4QA 1TTIA 2E1DA 2WXDM 1LTDA 3DYOA 1CXIA 1C92A 3QH2A 3W7GA 4AXNA 4DYEA 2AMXA 2AQOA 5HINA 3V5OA 2WV8A 2PDYA 5ENLA 3ARZA 4O0KA 1PPIA 1Q2SA 2ZC1A 4GQ0A 1R0MA 2BS9A 3WJXA 3E02A 4TMBA 5MHBA 2Y63A 3WQPA 4I9JA 5EFDA 1S2TA 3OGSA 4H6EA 4C6MA 1SW7A 4H8VA 3HGSA 1XPGA 4R85A 2A3LA 4AZHA 1MZRA 1MVYA 3WQOA 1X1NA 4FX8A 4NILA 3FAXA 4QNEA 1Q4NX 3CZ8A 3CLWA 4UXDA 3M5XA 1IGWA 5FJPA 1XIMA 4C6JA 1RA0A 3ABOA 3OJGA 3M41A 3UJRA 4GBUA 4WDXA 3QY8A 4GIEA 3EB3A 3QMRA 4WQ6A 1QT1A 1QPRA 5DN1A 2IPFA 1FQ0A 1UR9A 4S1FA 1EIXA 4L56A 1VBUA 3ALFA 3W76A 1E15A 2C1HA 1HO1A 2D69A 4OGZA 2AGKA 4P8UA 2CFFA 4R7JA 3O2LA 2VEFA 1I1WA 4DBSA 5AOUA 4GA8A 3MZ2A 4D6DA 5AVHA 1KO0A 3PWGA 5AECA 4HOZA 3U5YA 1DTUA 4AD4A 2XH0A 4PL1A 1XH1A 3CC1A 4Q3MA 3TXZA 3VIMA 5M03A 4N6EA 1FKWA 5FD0A 4ADUA 2ISWA 3E49A 1LRTA 2UZ9A 1UUQA 3FJ4A 4U3AA 5KZMA 1BF2A 2VVSA 2QJJA 4O57A 4BI6A 2BGSA 1T96A 5F4XA 1QHZA 1F8MA 2HS6A 1J8VA 1FHLA 2XFRA 4XZ9A 4D8ZA 3WF3A 4HP5A 4Y9AA 4WSKA 2OYKA 2QF8A 1XC4A 3UZXA 2ZRVA 3B0PA 1XF0A 1DJIA 1ZS2A 2HBVA 3SCVA 1L6WA 2ZZ3A 2OYMA 3IVUA 4G56A 4HVXA 2XZ9A 4JFWA 1MNSA 4HMNA 4QX4A 1SZRA 1NQ6A 3TJXA 4O18A 1UMYA 1EF3A 1Y7VA 3XIMA 1XLBA 2D24A 3NXLA 4C65A 5A6BA 4WOQA 4DO5A 4FXJA 1HL2A 2HDJA 3FV9A 4AWUA 1CGTA 1FHUA 3LZ5A 1G4EA 3UBPC 4LVBA 5H6HA 1XYFA 2FFCA 4UTTA 4YCOA 3SCQA 5EMUA 2I9UA 3RR1A 4QCFA 1V6WA 3I6EA 3HM7A 3SI9A 3T55A 1EPXA 1GVOA 2CYGA 5FACA 1R2RA 4NY2A 2FMNA 4OE7A 4KESA 5ABGA 1D3CA 1N8FA 3EMQA 4WIWA 4YVVA 4H41A 1A5AA 2BOGX 1GONA 3ZM8A 1R46A 2O7QA 2VX4A 2OWCA 4R33A 1JYWA 1OQFA 1US2A 4EK7A 2BFGA 3CO4A 3KDNA 4NNAA 2FFIA 1UH3A 2VFDA 4G7EB 1ME7A 1ZHAA 3EX3A 4HTBA 2GPTA 1RV8A 3GFYA 1ECQA 4CQAA 2VR4A 1UOZA 4JTIA 2WSPA 3PB0A 4J3ZA 4EE9A 3DFNA 4XD6A 2BY1A 3RIKA 3WDQA 4MUZA 4BR1A 4Z0SA 1XS2A 4M19A 4M3PA 2ZX5A 2FDMA 1FCQA 4N2YA 3S2MA 3S83A 2FVLA 1WXJA 2OQYA 3CYJA 3QTPA 1OM0A 4Y2WA 4L6HA 1XBVA 2RJHA 4WEVX 1XGZA 1I45A 5LGXA 2PURA 4E4PA 3GG8A 2ISVA 1I9CB 1ZCCA 1B3VA 1EUAA 5FESA 4RZBA 2XIJA 3VAVA 3VOHA 3BJTA 4G2DA 2CITA 2QNEA 5HULA 2WBKA 2VENA 3BLIA 3VGHA 4PUMA 1EWDA 3NUKA 1M5WA 4HTYA 1X98A 1WZLA 4LXFA 4IT1A 1FWIC 3H26A 1ZJIA 2XINA 1XFBA 3TOPA 1GNXA 4C1LA 4XD4A 3AYRA 3FSTA 4HJWA 3CZGA 2V82A 3SADA 1D8WA 4CVUA 2ZA1A 1EOKA 1E3ZA 2D0HA 1NDYA 1KWKA 4MNLA 5DY2A 1F4AA 4O8AA 1PUDA 1HT6A 3L67A 3L4TA 3TVAA 5EPDA 1AH3A 3GXMA 4UOZA 2ZKMX 4CLMA 2X16A 2XDFA 1XKYA 1ZL1A 4PMDA 3OYZA 4UOJA 1LDCA 2ZBTA 4HN8A 3UGRA 7ODCA 3M7SA 1TMHA 2OT0A 3DC0A 1FWRA 3BV4A 3M47A 2QGHA 4AVOA 4JHOA 4XV0A 1MUCA 3QRHA 3P61A 5C2GA 3NO3A 1EX5A 1VLIA 1YMYA 1AG1O 4F2TA 2W5FA 1QW9A 4NNCA 3QQ0A 3S2LA 3W7DA 4MYAA 1AD4A 5CGQA 1JDEA 1U1UA 2F6KA 2Q8XA 5HA7A 2V5BA 1N7KA 4IFKB 4O54A 1E4IA 1XCXA 1E6XM 1SU5A 4K68A 4BQ2A 4Q4RA 3HQ1A 4MDPA 1XUUA 3M1ZA 3LD5A 5D9NA 1UKTA 3WJZA 5B7YA 1W0MA 4IGMA 2I57A 1UC4A 4IMEA 2HNEA 4MG4A 3WD2A 1PWMA 4HHHA 4LC6A 4JFTA 4I5XA 1UC5A 1OC7A 1FRBA 5I5RA 3VDAA 4O11A 3JS3A 2BLEA 5ABFA 2JF6A 1HP5A 3H23A 2WYSA 1EJSC 2D73A 1Y65A 1K8CA 3UFYA 4QCEA 1XDMA 3TZNA 4GI8A 2Y8VA 3EDFA 9XIAA 5A6AA 1U22A 3WLQA 3WH7A 4ECLA 3W83A 3N11A 3W70A 5G2HA 4GFIA 1DORA 1RY0A 3RHGA 4AZGA 2DDXA 1NM9A 1POKA 4ZOEA 3EB4A 4H9XA 4MFEA 1PZ3A 3NPVA 3WJSA 5LIXX 3OOQA 2Z6JA 2XGZA 2VUNA 4EF8A 4DF1A 4I7VA 1DE6A 4B90A 1GOWA 1H3GA 2P5NA 4MF4A 1DJZA 3CQHA 2ACSA 2BDQA 4ASTA 1PX4A 2QJHA 4Q33A 2OZTA 4W8BA 3S9YA 3VOGA 4E6MA 3CJPA 4PUUA 5D09A 4KEVA 3WF4A 1JYNA 5DEZA 1VEPA 4GG9A 4Z1DA 3A21A 4Q4MA 3UP8A 1KKRA 4HKPA 1ADSA 3W1LA 4OOZA 4ZO9A 3DN5A 1LQAA 3LI0A 3F4CA 1EP1A 1E6ZA 3EMCA 3GB6A 3TYZA 4C5ZA 5CKSA 3CLMA 4A8LA 3T44A 4NKCA 4E2BA 2ZRZA 1OEPA 1ZAIA 2ZXBA 3LM7A 1S3HA 1JNDA 4BWLC 1Z3NA 1C8YA 3UG8A 1IXOA 1JQXA 3VDGA 1B57A 4HA0A 3HGRA 2OR2A 2P1FA 2I56A 3MHUA 1K70A 1I2QA 3S1UA 3BVJA 3L0NA 4W88A 3GAKA 1XCFA 4C6EA 3MBFA 1E6RA 3ANUA 4AG0A 2ZWZA 2W79A 3TXVA 1X6NA 1J0IA 2DP3A 3QQ1A 4ONVA 4S3EA 3SSZA 1B3XA 4PUNA 1NP0A 1AZ2A 3DH7A 2OELA 2GZXA 3DFTA 1EZWA 2IQTA 1ELSA 3K5XA 5A6BD 4KFPA 4O1BA 1V02E 4JFVA 1F73A 1GVFA 4JTFA 3U2CA 2YCKX 3K2GA 3ARRA 4XO7A 1G7VA 1UD6A 3T0CA 1W1B1 4BHYA 3GRIA 3NO5A 3QY6A 3P0WA 4S2BA 2FGLA 3M0LA 4E4FA 2DSKA 4A2RA 1PZ2A 5CSSA 1GORA 2ZE0A 4OJYA 4ZQCA 4JDBA 3UJFA 3CZJA 3ENLA 5M5DA 1TUFA 1UZ1A 1H2JA 3E6EA 1HIZA 3ZJ6A 4U3CA 1S46A 4ADTA 4UWMA 3Q58A 3C3NA 3WF1A 1JDFA 3LNMA 3RRAA 3GD6A 4JIHA 3URNA 4CNOA 2VWSA 3KUMA 4X2RA 3T7VA 4B5TA 1BWVA 2QDEA 4O1CA 3B03A 3NQCA 2X0YA 2POZA 3GY1A 1QVBA 3HV8A 2X7VA 1J5TA 2WWDA 3SIZA 2BHYA 2VR2A 4Q7BA 3WD4A 2WCAA 1A53A 3H2OA 4OFCA 4IIGA 3W7OA 3TYAA 3K8KA 4RR4A 4H04A 2PZNA 2O56A 3VC6A 5FSDC 3F4DA 1ADDA 4GK8A 3KP1A 1LCOA 4M1RA 4XKYB 3KCOA 1DKWA 1H51A 2ZICA 4D71A 4LF1A 3VUSA 1UZDA 2F9RA 3TW6A 4KMQA 3RRXA 1VFSA 3TROA 4QM1A 1QOXA 3H2NA 3U7BA 4AIUA 5SWUA 2EKGA 2YPIA 4E0CA 1XYLA 1KBIA 2PGFA 1PKMA 3GX9A 1LOLA 4H6RA 4PB4A 5IRPA 4GLEA 4IIDA 3V4BA 3WNKA 1EGZA 1Q65A 5AHNA 4S3GA 3CQIA 2V5DA 3SW6A 1H0IA 4UFLA 1GW1A 4BS0A 1PSCA 4S38A 4J3UA 4AWTA 4PCFA 3SQMA 5FF0A 3IK4A 1BYBA 3BO9A 2EGZA 4HNTA 2BHUA 1JGMA 2X1RA 3M5VA 3LK6A 4AZCB 3VIJA 1T8QA 2WJDA 1JZ6A 1JCJA 1PX3A 5LHFA 3HF3A 5JUVA 3B8VA 1OY0A 3PUEA 3SN1A 1TX2A 2GK1A 2EJAA 1RH9A 2CZFA 4FR1A 1HQTA 2EAWA 2CESA 2GFTA 3DBNA 4OIFA 4UTWA 3WBWA 1VGAA 1XX1A 1HKWA 4POCA 3G8RA 4W89A 1Q6DA 2GUYA 2EBNA 2BOEX 1B54A 2V0TA 1ONRA 2G3FA 2ZC8A 3K8LA 3OBKA 3EWZA 5XINA 2Y5EA 4O4VA 2TAAA 2BXZA 4KQNA 3LXBA 1BG4A 3QYQA 3SCUA 5BCAA 4Q8WA 3SR7A 3W38A 1DWJM 4XKYA 4DUOA 3AYVA 3RLVA 4MJ2A 4ENLA 3V7PA 2DVXA 2YW4A 4KS0A 3RPTA 2PPGA 5A6JA 3GTIA 2XVNA 2CLFA 3UJEA 1FA2A 4XAZA 4WDWA 3QXBA 1GG0A 3I10A 2WNWA 3IPWA 4AIOA 1Q6FA 3FS2A 1PVNA 1OYCA 5J5RA 4PMQA 4Z1BA 3ABQA 3AHVA 4HU8A 3S5SA 4JTQA 2RUSA 2OZ3A 1P0KA 2TRSA 2JGQA 4PEEA 2RKXA 4C6OA 5E09A 5H91A 4K1WA 3GHSA 3W1QA 3WH6A 3H2AA 1W31A 3NURA 3VOJA 4JTJA 3M4HA 1IEWA 1O94A 1OIMA 1R47A 3H2CA 2CU0A 2WJEA 2VC7A 3S3GA 4IGNA 4UNLA 3V1HA 1LOSA 4FALA 4XQ6A 1HVQA 1R7AA 5KINA 1X1ZA 3M46A 5FCZA 4INFA 4IUOA 2WO5A 4FZIA 1NELA 3ANVA 1RY8A 2V81A 2Y8KA 4IXXA 1UR0A 3BV7A 4R5EA 3LY0A 2P0IA 2MUCA 4CNUA 2NWRA 4OUIA 4WCJA 3A5VA 5A6LA 2VDIA 1LRQA 4MTVA 1RHCA 3WBXA 5CAHA 3QV9A 3B06A 3FGCB 2E6DA 1E4MM 2I9EA 4CCDA 4UFJA 1ISZA 1T41A 3LPPA 3AS0A 3VIKA 1GOMA 3N2MA 3KHJA 1LRNA 2E8ZA 5FF3A 3AIRA 2Z1KA 2PP3A 3MI6A 4IZGA 3ZWTA 2OVLA 1DQUA 1QCWA 3E2SA 1XFCA 1VPYA 3MVIA 1JCXA 1MW2A 4WXZA 4GZ7A 2FZNA 5CZ0A 1FWCC 3VILA 4FXRA 3OQEA 3GXFA 3SCNA 4HSOA 2XPKA 1P0EA 4Q8MA 4V28A 4GJ1A 3SURA 2FZDA 4J3TA 3MBDA 3EBVA 2CLPA 4BEQA 1GYLA 3TR2A 1W5OA 3WFAA 3L5MA 3U7VA 1XYMA 4ZFMA 2A0NA 1TJPA 4QROA 7XIMA 2J79A 2J7FA 1LWIA 2Z2BA 1QUMA 4XVEA 4O50A 3PAOA 1RPKA 1XLDA 4DZHA 1HGWA 1O6IA 1FWDC 1E43A 1SJDA 4RL3A 4PUWA 1SJBA 5AZ1A 1TPH1 4GXPA 1DQXA 4LC8A 2BGQA 1VFMA 4MB4A 3VNIA 1GQIA 4I6VA 3GHTA 1SW0A 1E1CB 4JTUA 1OB0A 1AZ1A 3FCPA 1UWTA 4QXIA 1J0YA 2A7RA 4H9UA 4PGLA 1SZGA 1CXHA 1YTKA 1TPVA 1R85A 4H8NA 4EACA 1H7XA 1FHDA 3QC3A 4ZO6A 3WQEA 3TKFA 2X05A 1WXYA 1DTNA 3BG5A 3WBEA 5H8MA 1J4EA 4RXGA 4JN8A 4A3QA 3NYDA 3TCSA 3SGUA 1V79A 3WLJA 3UWZA 2WB5A 3GC4A 1QFEA 3TP4A 4NYYA 1M53A 4FNRA 4GCAA 1BRLB 1VCVA 1G69A 3HIJA 2PD9A 1U5HA 1I0BA 3EA3A 3PHAA 4HNCA 4M24A 3LHWA 2Z7KA 4N7QA 5DMMA 4Y9OA 3RLGA 3T8LA 4F9JA 1SO5A 4A2SA 1M1BA 3GH5A 4XAYA 1R3TA 2BOFX 3WH9A 3ECQA 2BSLA 3EOUA 3KVJA 1AW1A 1TMQA 1E6QM 2HMCA 5D33A 4MHBA 4MJZA 2Y6ZA 1BWKA 4QJ4B 5HR7A 5TNVA 4RJEA 1JI1A 2XIIA 1EUNA 1EO7A 1W91A 2WC7A 1YDOA 1TV2A 5LXXA 3WBAA 2J7DA 1KQZA 1IF2A 3QGAC 1LLZA 2QCNA 4B5UA 1M7JA 3DAQA 4PZVA 3L5LA 4TX9A 3TYBA 3W82A 3L65A 4NI3A 3DEQA 4CN6A 1J79A 2AQVA 3W87A 1MQPA 5LIWX 4L4LA 2FJUB 2V3EA 3KBSA 1W32A 2PMQA 1HJVA 3HTWA 4EXAA 1X96A 3PUDA 4AEOA 4NZFA 3BLFA 2NQ9A 1FWFC 2V8ZA 3MMDA 4Q8VA 3DGRA 2VX7A 3B8UA 4CU6A 3NQBA 4YS1A 3VX1A 1B3YA 1QBBA 3E2QA 2QKFA 3AZTA 3DHFA 2OYLA 2VGGA 2QV4A 4ADSA 1QMLA 2J25A 4XTIA 1PEZA 3LRMA 1GJUA 3UG5A 4QDWA 4FLQA 4K38A 1RAKA 3C52A 3PWAA 4W8LA 4JOMA 1E0VA 1EGVA 3NIYA 4LWWA 4K2SA 4XZMX 4TV5A 3LDVA 3U6WA 3WY1A 3CZKA 3MUY1 3WEZA 2QUMA 4AQLA 1JFXA 5HJLA 1UCWA 1C9DA 1TJ0A 1R3VA 1PZ0A 3BSGA 1PDYA 1KXQA 1EA0A 4LOCA 1KFLA 1SQ7A 4TV6A 1NDVA 4E38A 2WSQA 4M56A 2WPGA 5FL1A 3VM5A 8XIAA 4WDUA 5FEZA 1IE7C 3IUHA 1PE1A 2G4FA 2Q09A 2NQ5A 4GX8A 2G4JA 3NQMA 3O7UA 3MYOA 2VQUA 4YWIA 5AN7A 3QMSA 3IVSA 3ABRA 1G4SA 2YXOA 4OECA 4QG6A 3KBMA 4JIIX 4K7YA 3IARA 4QS5A 2CLMA 1QXLA 1W54A 1S2AA 5JMUA 1S1RA 3N9RA 4HIBA 5J5DA 2E6AA 2DZVA 2F6XA 1OFBA 3SAZA 1B1YA 2C0HA 1F3WA 3IJ9A 1W2VA 3FLUA 1DXFA 5DO8A 1GVQA 3U0HA 3I65A 3SSJA 1QOQA 4A4AA 1EYWA 1NQKA 4RK8A 4NASA 2PTDA 2VELA 4GFSA 1V0KA 3TMLA 2E5CA 1IZKA 3S47A 4UZSA 5EU9A 3ME3A 3FVMA 1A5MC 4KWSA 1C91A 1U1JA 1JCTA 2XIOA 2P50A 3VVGA 2PLJA 1FWWA 1D3GA 4NU7A 4OZOA 3AFBA 3U9IA 1XLEA 1L9WA 4IIBA 3TA6A 3DFSA 1DJGA 3WQ4A 2FGZA 4ZQOA 3KRZA 1BKSA 2ZZ4A 1E9IA 3WN6A 3E74A 3ZYZA 1RVKA 1GQLA 2IKIA 2VEKA 4IM4A 1TVPA 2JF7A 2HROA 4U10A 3FDKA 3S9ZA 1CEOA 2GJRA 5C7HA 4IPPA 4ZMGA 1CXEA 4PMRA 4D2JA 4KT2A 2FJKA 2VDHA 4ZQRA 2IUZA 3K4AA 4UFHA 2C15A 3R89A 3HFTA 1BTMA 2VJXA 3GNOA 4ML4A 3A3HA 3WL1A 2ISFA 3AHTA 4CQCA 4DN1A 5GQBA 1WO2A 8CGTA 3NQVA 5EBUA 2QCGA 4LCSA 4DO4A 1KGUA 1FXPA 2ACUA 4WUIA 2NT1A 1HG3A 3UPWA 3ZJKA 3ARQA 3H21A 4HOXA 5T9BG 3RPMA 2P3ZA 2R1NA 3W22A 3EPNA 4C6CA 5CJNA 5D2XA 3LLDA 2DSVA 2QJMA 5BXSA 3KOWA 4MWAA 1KXHA 2JIWA 2KX9A 4FSAA 4GC4A 2C3ZA 2BV9A 3QV7A 3EB2A 1OX5A 3B04A 2VOMA 5F2LA 1HKKA 3GNDA 3LTYA 4XZHA 1XRTA 1DIEA 4OT7A 3TU9A 5DT7A 2VFFA 3OP2A 2PS2A 1VJIA 4FNPA 2NUWA 2Y0FA 3R10A 2WZMA 3Q94A 2XVPA 2OCZA 3C2EA 4MDOA 3GUGA 5HWMA 4UOQA 2FLIA 4TVDA 3DG6A 4U33A 3TIMA 3O63A 2DGAA 4H19A 4CCCA 4MMWA 2QUVA 1AJZA 4E2OA 3HA1A 5LZLA 3VD4A 1S5VA 3QOKA 1V3IA 1VRXA 3VGBA 3BAIA 2HE5A 3ATZA 3SY5A 4GGHA 2R82A 3P67A 4DJDC 1VBGA 4W7WA 5M2FX 5E5CA 3ARTA 5EFFA 4QDPA 2E0PA 3UZJA 3INPA 3OODA 3LCLA 3CUFA 4AIEA 1GHRA 3KP0A 4K8EA 3AIBA 3BOLA 2DT3A 2HISA 3Q37A 3HG4A 2R94A 1OIFA 3I7QA 1A5SA 3K4WA 3S5OA 1B3WA 2I16A 1LQ2A 1KCLA 4EAMA 3PZNA 1DE5A 4IH3A 4OBTA 3W1AA 3GXPA 5HJXA 2A7PA 3AZRA 4GZEA 5LIYX 2XWEA 2DORA 1VBRA 1UIPA 5F1UA 3WLMA 1GG1A 1QHPA 4YU1A 1MUMA 3I4EA 3PR2A 5D2YA 1Z48A 4H7ZA 3IWPA 4C6DA 3T0BA 3L4YA 5D37A 4DI9A 1J6PA 1DWFM 1XH0A 3MZNA 2XVLA 2WVVB 5E9XA 1NJJA 3VK5A 1NU5A 4REQB 2NX3A 1SMDA 3NQ6A 3S2NA 3WFLA 1OT2A 1Q7MA 4JTLA 3U4FA 2YFOA 4XSLA 4N6FA 3CUJA 4IGHA 4TOQA 1XLHA 4WJ8A 2G0WA 4NIRA 1CXKA 1R9XA 3SCTA 3PVFA 1Q8AA 4MYXA 2GGIA 3MV11 3DHPA 4E2VA 3IJ7A 4WY0A 3T40A 4FX6M 3S9IA 1IR2A 5BROA 4JQ2A 1DIOA 5LSMA 4I8DA 1VAHA 2X1SA 3MKKA 3FEQA 5TD4A 4ZZ9A 1PX8A 1KV5A 4LAZA 2JKPA 4HOWA 1GWJA 5C9ZA 1CNVA 3WQ6A 2EPKX 3OGRA 3M44A 4PCSA 3EPOA 3EXRA 3DERA 2BBFA 2YOCA 4B9YA 1SO6A 2GJNA 4DWDA 4GIAA 1W1IE 1SPQA 2PUZA 3LV5A 3TYUA 1RQBA 5LKYA 1LJYA 4LEQA 4JEQA 1PB0A 1XIEA 2DQXA 2ATMA 4L64A 2WHKA 4NZ4A 2YA1A 2ZTKA 3T07A 1E70M 4RNIA 4EIVA 3KL0A 4QS6A 4XD3A 2ZXAA 2WHLA 1YDYA 3A9BA 3CHVA 4QG8A 4C5YA 1G9HA 3R25A 1CENA 1M7OA 3ITYA 3WEOA 3FVDA 4HZ6A 4AD3A 1TWDA 3NL6A 3OG3A 2VM8A 2DZPA 1QPOA 2RGMA 3ALGA 1R87A 1X39A 3AMDA 2WVVA 3W1PA 3UY7A 4CD5A 1FWAC 3IJQA 4REQA 4EXQA 3NGFA 3H22A 4V1YA 1UD8A 4CUCA 3T42A 4JHZA 3CS2A 6XIMA 4A3YA 2H9AA 1TWIA 1KRMA 4TMCA 1TWWA 5HANA 4J3XA 1UROA 3R0UA 3H4WA 4OBSA 3WQGA 3VGGA 1RUSA 2REQB 1JPIA 3I3BA 3EWXA 4X0NA 2Q02A 5G1YA 3KS5A 5HK4A 5I07A 2ZVIA 2GLKA 2MNRA 3EEGA 3WLLA 2VC5A 1JDDA 1I1XA 2GOKA 4H6KA 3PUGA 3NVTA 2VZTA 3HPSA 5KZDA 3GKAA 2FDSA 2ONEA 3MT1A 4EANA 3B0YA 3UGVA 2FB2A 2C1GA 3MI2A 3TC6A 1JYVA 4FIRA 4KF1A 3SQSA 2VWTA 1MEWA 3MUXA 5IDZA 5CCZA 5I3HA 4DIAA 1W8SA 3GKFA 5BXRA 2HTMA 1JPHA 4AF0B 3ZJ8A 1GJPA 2YCJA 3G1HA 2A6LA 5E6ZA 3MV01 3OHIA 4Z1YA 3WLSA 3LTSA 4QLKA 4GO8A 2DIJA 3P74A 1PCKA 2IQDA 3LPFA 2PU1A 1GGOA 1TPUA 2J24A 2QCFA 2D1ZA 2PDPA 1R3QA 4E8DA 4W7VA 1Q85A 1M7PA 3U48A 1YLVA 4CQ9A 2I17A 1EEXA 3N18A 1HJXA 3SM0A 4WHBA 3URAA 4JYFA 3VOFA 2ZIDA 2E7FA 4GHRA 1OJXA 1JCMP 1HKMA 3BLDA 5C9UA 4C7FA 3EWDA 1XL9A 1I0DA 4GD0A 3GIPA 5C5YA 3OLDA 1V6TA 4MJMA 4M82A 5GPRA 5FAJA 2GSJA 2Z4GA 1XD0A 4JS3A 2HPIA 3WD3A 3C6CA 3A4AA 2ZUTA 4MWAD 4FNSA 4XAPA 4EPKA 3BPWA 2V3FA 3R0KA 3GXNA 4AX7A 1OFDA 4IP5A 4JTDA 1F2JA 2FZBA 4ORIA 4Z0JA 3GQYA 3MJMA 3ONBA 1G01A 3BZJA 4B9ZA 3RNDA 4K8GA 3WUEA 3O9NA 3QR1A 3K30A 4NYUA 2Y7EA 3R79A 2DT0A 2ABBA 4BQ4A 2GGJA 4ZO7A 2ZX9A 1S2VA 4AC7C 1A5BA 1XHGA 1PO9A 2Z27A 2YYTA 4JTEA 1SFJA 3PN8A 4LS1A 5HNRA 2XH2A 1NSJA 4AZ5A 1KR1A 5A2AA 5FEWA 1K3UA 3PS7A 3W9ZA 4IP7A 4G1NA 2QCMA 4M6UA 3MA8A 1G67A 4HBKA 1ZZMA 1T99A 4DPPA 1EYEA 3WLPA 1ICPA 3W2UA 3GHRA 1V4YA 3NZPA 1RXOB 2NVCA 1I6NA 3SJ3A 3MSRA 4XKMA 4HHPA 1YXCA 4DF0A 3NOYA 1Z41A 2HQAA 1EQCA 1M6JA 1PXGA 2NUXA 2WKLA 4DJFC 3CUZA 4JCMA 2B7QA 4N02A 1XIHA 2QDGA 4AUBA 1AW5A 3OU8A 2PDJA 3S42A 3W7IA 3IANA 4KRTA 4HU4A 1E6SM 4LGXA 4O28A 3GZ3A 2DW6A 1HNYA 4EPEC 2VHLA 2YJQA 3W2JA 3B4YA 4WR3A 3N9KA 2V68A 5LA2A 1JD9A 1W2PA 4LUSA 4DRSA 1F07A 4EXBA 1RCQA 3VIOA 2Y62A 1JZ4A 5BMWA 1TMLA 3LGEA 2PDQA 4GVGA 5DMLA 1F05A 3FSUA 1EC9A 3OEXA 3UPBA 4DB7A 2ANUA 4PTDA 5HJYA 3W7CA 3SGZA 2CLHA 1KM2A 3SCPA 4S3DA 4JQ4A 3WBYA 1VJSA 1W17A 2QAFA 1SZNA 4S2CA 3GR4A 3PG8A 1HGYA 4OTKA 1NIUA 5EY5A 3CU2A 3BG3A 1AD1A 1JF6A 5F1VA 3NJ3A 3KWSA 4GYPA 4F40A 1L2QA 3CT2A 2G3NA 1WNOA 2ESCA 2IS7A 2QIWA 4GGBA 3PFMA 1JI2A 4R34A 4DX3A 2PEVA 3LMYA 1NF7A 1D8CA 3APYA 4O19A 4ALDA 3QJAA 3TLQA 4NNBA 3NPUA 3BUVA 1YYAA 1XI3A 4AH7A 2DZBA 2DZXA 3S2CA 3GU9A 4QNWA 3KW3A 2QCEA 3CUHA 3S5YA 3S6OA 4I6KA 1KFKA 2HK1A 3VNKA 2CLOA 4FR6A 3LI1A 1MDRA 2WWCA 2RAGA 2VTFA 4LVGA 3P3BA 4FF5A 4JPGA 3TUUA 3KE0A 5B7ZA 1JDAA 3GVWA 1K6WA 3NQGA 2WAGA 4URIA 4XBSA 3HMCA 1JAKA 3KBWA 3DKJA 1BVNP 4PL2A 4UQBA 2OOGA 3V0SA 3ARYA 4BWLA 3CB3A 4GQBA 3VA8A 1XICA 4B2DA 1P6WA 4LAMA 4UQEA 3GTNA 1D9EA 4O1AA 3N12A 3CB8A 3PPFA 4RW5A 1VIZA 3GG7A 3EKGA 5A5WA 2DJXA 2Y70A 3VGDA 3REQB 4RPPA 4NZCA 3HGOA 4X3ZA 2GGGA 5AC4A 4I9AA 1IWPA 3W6LA 1IEXA 3R6IA 5G4WA 3W6YA 1ZY9A 3E0WA 3ZQ9A 3NTYA 4HMDA 5GNZA 3HU7A 4LUIA 3MCOA 4AAJA 1KQYA 3EXSA 4Z1CA 3TK7A 5IFTA 4YTSA 3PAJA 4O1FA 4GY0A 3LG3A 4L9YA 4AD2A 3RCMA 2XIBA 1O66A 1XLJA 1HJWA 2XJ7A 3PBMA 3CMFA 3CASA 2C16A 3WLRA 3NVDA 4IISA 4GUHA 4QIUA 5I00A 4GABA 4NX5A 2HV5A 3IIOA 1SJAA 5AB3A 1XIDA 2R9RA 1N8IA 4IL2A 4WDTA 4B4HA 4C7DA 3ITTA 1UWRA 3KBJA 1U5VA 4FOJA 3H6OA 1E0XA 2FH6A 2EQDA 4GWEA 2Z2UA 3GYEA 1DJHA 2PE4A 3WDIA 2UY2A 4P5UA 4HCHA 2E77A 2BWGA 3TE9A 2H3DA 5CG0A 1YNPA 1V6UA 3M0ZA 3RLHA 1VBHA 2RDWA 3PPGA 3RR4A 4LRTA 3S1GA 3ZMRA 4FS9A 1OG0A 1TSIA 4A21A 2FYMA 1CGUA 1K02A 2OSWA 1R3RA 4MNMA 3S5NA 3S4TA 2QPXA 5K2ZA 3ZS4A 4MY9A 3AS1A 4HCLA 4S23A 1A5CA 3W73A 3AXMA 1MUWA 4R7WA 5G2WA 3REQA 3THDA 4GNVA 4U4MA 1W3LA 3NCOA 3RDKA 2H8XA 4M5PA 2VEGA 4MADA 1O68A 3O3RA 3RU8X 3CUIA 5IHRA 2PF8A 2XGBA 2EPLX 4A8RA 3AUOA 1ZNNA 1OYBA 4YWSA 2DSWA 3CL7A 3ZVHA 1OD8A 2GVLA 2XISA 4LU0A 3GDBA 3N3MA 2L5HA 4ICNA 2Z26A 3RGTA 1THFD 4L1XA 3SQLA 1B90A 4W7UA 1IEIA 5AHFA 2G3JA 3TJIA 3CIVA 5DCDA 1UR3M 2W91A 4KW2A 2PRMA 5D32A 4LAOA 3HQNA 1C3FA 2VUYA 1E6NA 3L9CA 1EKOA 2WOQA 4UUIA 5EMMA 4JX6A 4CCEA 3RN6A 1TRDA 1V7YA 2CXGA 4UZUA 3VIPA 1UR2A 3QHMA 1OGGA 1TCMA 4UTIA 1E71M 3PY2A 1XLIA 1WDRA 1CX9A 3ITXA 3QEZA 1VYPX 2EXOA 3P81A 4XAGA 5AC5A 3BLLA 5DCBA 4KRZA 3OZPA 3AZSA 4IIFA 4ATWA 3BJSA 4QDMA 2R1KA 3C0JA 2IPWA 3RUBL 2GVGA 2Q6ZA 4D8LA 3UCCA 2R1LA 3D47A 4IXHA 4NQ1A 5CXPA 4CKQA 1J11A 2PDKA 1P1XA 4RDWA 3W7QA 1LZOA 4PE8A 7TAAA 1NOWA 1AMKA 1Z69A 4JKLA 3UW6A 3GG1A 1CECA 4FLRA 1QNRA 4IICA 1UR8A 2YX0A 3NZRA 1J2BA 2VC6A 3KDOA 3WMSA 3GVGA 3KAOA 2J74A 3W72A 3LCFA 3VIFA 1UHVA 3WQFA 2VMFA 3ARUA 3EGJA 4LYQA 1XBXA 5I2UA 2YXGA 3JU2A 4W85A 4IHCA 3U5UA 1NFPA 4F66A 4C6QA 1YNYA 1OCBA 3BCDA 3L5AA 3KLKA 2OKTA 4KEMA 1TTPA 2B7OA 1TPWA 3EOLA 3W00A 2PFHA 4H6QA 2C8NA 3BAXA 1P0BA 1SSGA 3TFXA 3K13A 2HVNA 3WCZA 4J40A 3WYZA 4GMEA 4UR7A 3UZZA 2YYUA 4L6OA 3G1FA 3UU0A 3CTLA 2Q3RA 4AZ6A 2BODX 3FIGA 1HL8A 4FLSA 4GX9A 5BOEA 4TU1A 4MAZA 1TV5A 2X1UA 1AA1B 3UWQA 2ZX7A 3CPUA 3WJWA 4GH1A 4ZXOA 1AFSA 3URQA 1BG9A 4F0SA 2OB3A 1REQB 1PYMA 4PC8A 1C8XA 1PIIA 3AJXA 3V0TA 3BJFA 3AMCA 3HPXA 3O6AA 3LV6A 3LENA 1M01A 3WD0A 1LLWA 4WKFA 4C6BA 4HU3A 4P7RA 2A3CA 3A3WA 2RDTA 2B81A 5D2VA 2O9PA 3LHTA 3EKZA 1POJA 1ESWA 3SCWA 4FAMA 3HB9A 4TVCA 2Z28A 2PWFA 4HA1A 1BVWA 3UPMA 1E4LA 2R14A 5T8GA 3AU2A 3TJ4A 4BQ5A 4RPQA 3M43A 4JNYA 1H1ZA 5LA1A 1ZBVA 2ACRA 1CTNA 3A13A 1IIGA 3NO1A 4B5SA 1UD3A 3F1QA 2CZDA 1K03A 4W87A 4YVXA 1GZ1A 2PGWA 4HT3A 2NXHA 5AYBA 3SY8A 2W62A 3AMGA 4PR4A 4GIRA 3MMWA 5HNNA 4PEKA 3MO7A 2DY3A 3W7PA 4F8XA 2PWDA 4UCGA 3G1RA 1E5NA 2VP8A 5HXMA 3VD9A 1HJUA 3C2RA 3HG3A 3DYMA 1GTEA 3CO8A 5A1AA 3F5JA 4GZJA 1J9YA 1ISWA 3M6YA 1G5AA 4B2DD 1SW3A 2J62A 1ME8A 1LORA 3R2GA 4A05A 1OADA 3PSVA 1NOFA 3CV2A 2FVKA 4AD5A 1MRQA 3E2RA 3D46A 4U28A 6CGTA 2DFAA 3VXGA 1IHIA 5DFAA 3IJ8A 3OZMA 3O16A 2QCCA 1ZBWA 3FEMA 4LEFA 1RP9A 3GK0A 3RF9A 3QOMA 3FA3A 3DI1A 3Q45A 4EPDC 4ZO8A 1W5PA 4QE1A 4B3KA 1A50A 1RK6A 5EGRA 2X09A 3ITVA 4US6A 3HPZA 1Q63A 2C14A 1ZUAX 4DNHA 3E0VA 3W0KA 1QRQA 2IXVA 2WSYA 3QV6A 3NDOA 1MSSA 3C2VA 3T4CA 1WXZA 3THQA 3IRDA 3MCNA 1W9BM 2ATSA 3S0CA 1TKKA 1P48A 1QW8A 4LYKA 4ZTXA 4GI6A 4PB3A 1FY6A 6XIAA 1HX0A 5TAOA 2XYLA 1BXNA 1EPVA 3GTHA 4CD4A 3CIWA 4PRWA 2O9OA 3KVMA 3T81A 1W9DM 1AQ0A 4A3RA 1UWQA 3GG0A 4P61A 3F03K 1L8NA 3N2TA 1CXFA 1XWYA 3EWBX 4U2ZA 3N73A 1GK8A 1PHQA 2X30A 1GZGA 3P62A 3R58A 5HWJA 1XINA 1Z9AA 3WH5A 1O5KA 2YB4A 1JVNA 3RO8A 4X61A 2ADAA 3H4GA 2VZOA 1A80A 1Q7QA 4AEEA 4IQLA 2PDNA 1UR1A 2XIMA 5AYZA 4JTSA 1H4PA 3GBDA 3SRKA 4LBRA 2OG9A 1G4TA 1AQHA 5CZKA 4L4OA 1UPMB 4Q4KA 1OCJA 1KTCA 3OIHA 5EMYA 3E0LA 2E5BA 3VZXA 2W27A 3GVRA 3QPZA 3DFOA 2EG8A 1MW0A 2OTDA 4V2XA 3MUCA 5GJPA 3GDLA 4GUFA 1XGDA 1GVRA 2TODA 1MO0A 1CPUA 2YLLA 3QVQA 3BANA 3VDCA 1WOBA 3IUIA 4P7QA 3CK5A 1V51A 1E1EA 1PKNA 1W1VA 1P7TA 1KXVA 3W7LA 2WM0A 2J9YA 4S39A 2XG9A 3EZ4A 3F2BA 3WZ0E 4Q7IA 2OOFA 2A2IA 2D2OA 3DG3A 1ICSA 3E5PA 1UKQA 2X1TA 3WD1A 4Q8UA 4JL2A 3G3MA 3CHFA 3DENA 1EA9C 2QPSA 3UWYA 2ICSA 2F7FA 3T0AA 1UD5A 4JL1A 5I3GA 3R8GA 4ZB5A 1X6UA 5C70A 1FKXA 2INZA 1LP6A 1SUXA 4JN6A 1BYCA 3ZT6A 4GZIA 5L6UA 3SJNA 3WIJA 2W3ZA 3W24A 3PZVA 3WLHA 1DP0A 4HK7A 5AHMA 1TREA 1ZBCA 3L68A 1EJTC 2OEJA 4PN2A 1ZJAA 3VGFA 4UFMA 3CBWA 3SRHA 2WCGA 1RZMA 2H6RA 1QO2A 1B3ZA 2WSKA 7TIMA 3SUSA 2ZUUA 2F8QA 4WZHA 4W4QA 3AHXA 1B2YA 4BI5A 1E0WA 3SN4A 4S3AA 3N25A 4PTMA 4HYRA 3G22A 4F2UA 1UKPA 3V18A 2NZLA 1W5QA 5KSWA 4IGSA 4WX2A 1UH4A 1WV2A 1LM1A 4R9OA 5CBJA 3ONCA 4HZ8A 4AC1X 3GC5A 2G8ZA 2VGBA 5U4NA 2XSXA 4E3VA 1BSIA 2MANA 1FH7A 3GDMA 4ZODA 3WG6A 4KETA 4X2PA 3GFXA 1F3XA 4PMZA 2CIPA 2J78A 2BZNA 3DFHA 2X1IA 3VFCA 2O4MA 4HSNA 2HEJA 2PTXA 2ZDSA 1MFUA 3ORWA 3B9AA 4JZ5A 4FLOA 3I7SA 2WBGA 1IWBA 3TONA 4JN7A 3W7EA 3BLOA 5F2IA 1ZP3A 3H2EA 3RX4A 1VRDA 4IUGA 2OZ0A 1C8VA 3B8IA 3O6YX 1XD1A 4FO4A 4KWUA 1R3SA 3L12A 3WL0A 3R12A 4B16A 3IV3A 4JTGA 3VYLA 4M81A 2AKZA 3UXLA 4GVHA 4JKKA 2BB0A 1ZQ5A 2A7NA 1KLZA 2BX7A 1FP9A 2O7SA 1ITXA 3UY8A 5JXQA 4LUJA 3UVIA 1XGEA 3MKCA 3PC0A 1IIHA 4R53A 3CM4A 1FWSA 3QYSA 3T2PA 3BOFA 1C93A 1TO3A 5J04A 3U57A 3SB0A 4KCVA 2G5WA 3N2XA 1TIMA 5FIPA 1XW8A 4FP1A 1OX6A 3EDDA 1XSJA 3UR2A 2YBVA 3TSBA 1DIKA 4IMDA 4P7NA 1Q2RA 3GNNA 3JUGA 4ZQNA 2WVUA 2ZDRA 2IPJA 4DUWA 5FKYA 1UA7A 3S6TA 4MJ4A 1UJPA 3N17A 1C90A 3NQ8A 5A8MA 1FH8A 5KZ6A 1NAL1 3TN3A 3W29A 4ATLA 3IIPA 3OIXA 1H63A 1UW9A 4TIMA 1AVAA 2X41A 4UQAA 2VVNA 2OSXA 3CXOA 1DJQA 3MCMA 4CNSA 4WY0F 3RILA 1KD0A 3W7KA 5AYYA 4Y9NA 3W2NA 2D23A 1XM3A 3N19B 1HTIA 2Y85A 1K7EA 1PS9A 4HNVA 5IXEA 3F4VA 1JUEA 1AMYA 4XUYA 4C6PA 1TE1A 4ZEPA 5DCEA 3V75A 5HR6A 1GVEA 4QBXA 5LHEA 3P7YA 3WH8A 1J0HA 1UZ4A 3KS6A 4AZ7A 2YSWA 1N8WA 3AIEA 3PWIA 4D6IA 1E40A 4DJDA 1P1MA 3SEPA 1FHVA 4L65A 1BFNA 1UUMA 1W1TA 4W5UA 2XN0A 1LLOA 4U31A 1LG2A 1EZ2A 1VH7A 2C18A 2GJPA 2KZHA 4IQDA 1Z7AA 1Q6EA 3LCGA 4FK9A 3ATYA 2QVNA 1L0PA 1F6KA 4Q7NA 1EBGA 4Q8OA 1TPB1 5I06A 2CBUA 4ES4A 3K1GA 4D1IA 1Z6KA 3SBFA 1TZ9A 3OVGA 5K9XA 4P7OA 1V3KA 5LNVA 2E67A 1EJUC 2R91A 1YE4A 5TQLA 1FWHC 1PV8A 1X8FA 5FJUA 2W0UA 4N4PA 1V3MA 1JCYA 2JIEA 3UZ5A 5ABFB 1SM9A 5HQMA 4PMXA 5HUOA 2QV5A 2EJ1A 4XZWA 3GTXA 3N6JA 4CEXC 1K4GA 4OU1A 1RBAA 1TVLA 1O12A 1TX0A 3P5YA 3GNRA 1YIXA 3P84A 3E96A 1KM4A 4ZENA 2QPUA 1M9HA 3LRKA 3W7JA 3VKCA 3ZXWA 4WF7A 2YDRA 4GY7A 4RV3A 4ERAA 4E8CA 3TFCA 4C6FA 1Q5MA 1NTHA 3A23A 3NZQA 5TBOA 4EP8C 2VFEA 1WDSA 1YXDA 5C7VA 1KV8A 2QJGA 3B3DA 3W71A 5PTDA 4CNTA 1KNWA 3ITCA 6TIMA 1ONXA 1GCYA 2VFIA 4XG1A 5I09A 2CETA 2DUXA 1V0MA 5XIAA 4PBEA 2J4GA 1S3TC 3IJIA 2ABAA 4IQEA 4LYPA 4E2DA 1J0KA 1UB3A 4GY1A 4RZ5A 4O16A 4UNKA 4MPKA 2WMHA 2V38A 3SUTA 3LSBA 6REQA 4IFOA 1DEDA 1B0IA 4XIAA 3VKDA 4JQ3A 1NWTA 5CJ5A 1KFEA 4XVDA 4YTTA 5D05A 2Y89A 4KFNA 1P0NA 1F7BA 4AYSA 1M3UA 3R94A 1ZFJA 4F9DA 4LUYA 3CV1A 4C6NA 5CC7A 3BG9A 4L6DA 6PTDA 1I8JA 4GACA 4ZOAA 1W5NA 5A94A 4B92A 2GDUA 3FDGA 1R7OA 2O9RA 5CZTA 1GEQA 3PTMA 3GS6A 4DEFA 2NXGA 3KZSA 2VX6A 3FY1A 5FJJA 1NWSA 1TJ1A 5FJOA 2DT1A 2ZADA 4CN1A 3NG3A 3WUFA 3W88A 3AMKA 3IJDA 2D3NA 3VNDA 3TX9A 1V6YA 1RQHA 3DFYA 4IMCA 1CBGA 4LS0A 4Y7EA 2PDUA 3MI3A 1TWSA 1B3OA 4YYCA 4XX6A 3QQWA 3L2MA 1F6YA 2JE8A 1I2OA 3RMJA 5A95A 4UFIA 1TZ7A 1N82A 2NLIA 1DL3A 1H1NA 1QI3A 1RR2A 3V16A 1RBOB 4K39A 3WNNA 3D3FA 3NSMA 1RK5A 2QR6A 1SFLA 3FW6A 4ICCX 1UH2A 2DIEA 3H7UA 4GYPC 4YTUA 1O5QA 3W23A 3ARWA 2PA6A 4M7TA 2HZGA 4AEFA 1RSCA 2XN2A 5E70A 3ZWSA 3KVKA 3VNMA 1WDDA 4HMEA 3VMPA 3CEPA 2FKPA 2AQWA 1E4NA 3PNZA 3OB8A 4GUGA 2OZ8A 5B80A 3HBLA 4MWAE 4I90A 5LXEA 2DVTA 1XQKA 3D6NA 3OZOA 4P8XA 5G5IA 2X0HA 4HA4A 4I5RA 3BCJA 5IBXC 2YDAA 3C0QA 3WO8A 4HPXA 1W3NA 3RM8A 1FWTA 3D3AA 2AL2B 4QEEA 3WMBA 4CQDA 3AO0A 1PAMA 2HJPA 4Z2GA 3T9PA 2G3MA 4ZTYA 5I3JA 2OEMA 3OA3A 1C9WA 1Q6GA 2YLAA 3RM9A 3M16A 2Q71A 3PB2A 3K8MA 3PF3A 3VX0A 2NV1A 5D04C 1QJWA 4X0VA 1KKOA 2EPOA 1PTAA 2YL8A 4B5VA 2R6OA 7A3HA 1DJWA 4US5A 4LX4A 1CIUA 3TQ0A 4HYWA 4EX4A 1K77A 3PUOA 2HCVA 1WBJA 1QNQA 2OQLA 4CD6A 4F3HA 3N3TA 3N29A 4K36A 2P8CA 4GINA 4IJCA 3ZZ1A 2Z1SA 3W2MA 2GWGA 3VKJA 3NNTA 3E38A 1XSKA 3W7HA 4PBFA 4HN4A 4AWEA 3TAOA 4DJEC 1MW1A 2YA0A 3ZVIA 1MXGA 1OWQA 2Y24A 4PMYA 4DPQA 1O95A 1VFLA 1IR1A 2RJGA 4XO6A 4X63A 2DV0A 3G77A 3O0KA 3URBA 3DDMA 1OT1A 1QASA 4GYFA 2D2HA 3Q67A 1WDWA 3I7R