1UMYA

Bhmt from rat liver
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
389
structure length
374
Chain Sequence
KRGILERLNAGEVVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASSGQKVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKIFHQQLEVFMKKNVDFLIAEYFEHVEEAVWAVEALKTSGKPIAATMCIGPEGDLHGVSPGECAVRLVKAGAAIVGVNCHFDPSTSLQTIKLMKEGLEAARLKAYLMSQPLAYHTPDCGKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWIRARARKEYWQNLRIASGRPYNPSMSKPDAWGVTKGAAELMQQKEATTEQQLRALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Betaine--homocysteine S-methyltransferase 1
publication title Crystal structure of rat liver betaine homocysteine s-methyltransferase reveals new oligomerization features and conformational changes upon substrate binding.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 124
structure length 374
sequence length 389
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.5: Betaine--homocysteine S-methyltransferase.
pdb deposition date 2003-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02574 S-methyl_trans Homocysteine S-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.330 Alpha Beta Alpha-Beta Barrel TIM Barrel Homocysteine-binding-like domain 1umyA00
3BOLA 5DMLA 1Q85A 1Q8AA 5DMMA 1LT7A 4CCZA 1UMYA 1LT8A 4M3PA 1Q7MA 3BOFA 1Q7ZA 1Q7QA 5DMNA 1Q8JA
chains in the Genus database with same CATH superfamily
4V27A 5IDIA 3QN3A 2Y88A 1KC7A 2RDTA 1GEHA 1B3VA 3M0IA 5A6BA 1UH3A 5D9MA 1V77A 5CJMA 4ZB0A 1S1PA 4GC3A 1UJPA 3G2GA 3UG4A 3VNIA 2H6RA 4S3CA 1QW8A 1A3XA 4AZGA 1MEHA 3UG3A 1YDYA 1PKLA 1KBLA 1IEXA 2YL9A 4I7WA 1O4UA 4O1FA 1VF8A 1RK5A 1DPMA 4DYKA 4GUGA 4KEUA 4BQ4A 2FIQA 1E5JA 4GI6A 1F8IA 1N55A 3MO4A 3PG8A 3H2MA 5LIUX 3CTTA 4X61A 2NX9A 1GYMA 1ZFJA 1P0EA 3LCHA 1E6XM 2WJEA 1XUZA 3STCA 5EBAA 3AYSA 3UXIA 1F9CA 1RV8A 1POJA 2J13A 1YRRA 1O60A 1CGVA 1IEQA 4GNJA 3PBYA 3RK8A 4G7FA 3UY8A 2W66A 2ZTKA 1EBGA 4LVFA 4HPHA 3EYPA 4FS9A 1VHNA 4PUMA 2AAMA 2ABAA 3A9BA 3PZGA 4JIQA 3K1DA 4ZTXA 2HBXA 3G1FA 4DAIA 4HD5A 3FOKA 1ODZA 3HQNA 1U1JA 3ITVA 3GTXA 1V03A 2GPTA 1ZBVA 2V3EA 4ZB5A 3RPTA 4CN4A 4IJBA 3W2NA 2GGEA 1VLIA 2A3AA 3GXPA 2R91A 4Y9MA 4HQVA 2A7PA 2ANUA 1SFSA 1HT6A 1OABA 3DDMA 2CLIA 1JQVA 4DB7A 2E6DA 3M5XA 2ISWA 3ES7A 3AJXA 3P5ZA 1GVIA 4IM4A 4KWVA 2AKZA 2WZHA 3AYVA 3QBUA 4ACYA 1GWJA 1VPXA 3L4TA 3R5EA 2OT0A 1CENA 2HTMA 2DH3A 4LF2A 1HKMA 1R9ZA 2EQDA 4Q6JA 4W89A 1X98A 4ENLA 1S3HA 4ML4A 5EMYA 4ICCX 5AVNA 1W9PA 3WYZA 2OLAA 2B7QA 5DANA 3W7JA 3RM4A 1RBLA 4NZ3A 4RDZA 2VZTA 1SMDA 2QPSA 4RK8A 4A3HA 1EJSC 4JAWA 5HUPA 3B8UA 4X9YA 2DT0A 3REQB 3BAXA 4WGXA 1K6AA 4UTJA 2FHCA 2VJXA 3EEZA 2NUXA 4ZQCA 4JGDA 3QZEA 1OYBA 1MO0A 1RXOB 3CASA 1QDSA 6A3HA 3BAWA 5CC5A 1J5TA 3LNPA 1MSSA 4L4OA 3K4AA 3H2EA 3LZ3A 2RDUA 3TROA 3KOYA 2JEQA 4EP8C 1G01A 1W37A 3I68A 2YXGA 4KRZA 1E3ZA 4UQEA 1W1A1 4TOQA 1EXBA 5EKYA 3VDGA 2ZA2A 3MP4A 3R94A 5C9UA 2QNEA 2QGHA 5CPSA 2X1UA 2MANA 2BY3A 3PWAA 1LJYA 2P53A 1YE6A 1XDLA 1HXJA 1GHSA 3KOZA 1GJUA 1PPIA 1SSDA 3L2IA 4GUFA 3LBMA 2NQ5A 4NQ1A 3T0AA 2E25A 2ZX6A 1BAGA 3AI0A 2XGBA 3VKAA 4XBJA 1G7UA 1ADSA 2YL6A 3N4EA 3PFMA 2CU0A 4I9JA 5H8UA 4EX4A 1TE6A 3BPWA 3TZNA 1IT0A 3LRKA 5BXRA 4DX3A 1RCXB 2QVNA 3CB3A 4ML9A 1QNSA 1IXOA 4DZHA 2Z4GA 3VMOA 3VX0A 2J9XA 5A8OA 2IKHA 2B7OA 3WF2A 1ZZMA 1FWBC 4B9YA 4AWTA 4HOWA 4IX0A 3TFCA 3GHUA 3W1AA 1EXPA 3CZKA 1WZMA 3LUTA 3LGGA 4M7SA 3L2MA 1I0BA 4XO6A 3FCPA 3USBA 2HROA 8A3HA 1VQTA 4F0HA 2DSZA 2GUYA 5BROA 5I77A 5K2ZA 3IWPA 1JXJA 2R1KA 4KS0A 2G0WA 1OQFA 3QV8A 5EFDA 2VDHA 4A8LA 2WBKA 3UYIA 4C1NB 3TFXA 3V5OA 1VBJA 2QT3A 3RO8A 3H12A 5BU6A 5ABEA 2ZUVA 3GDLA 2ZXDA 4XIAA 3GBDA 1ONEA 4Z2JA 4LCRA 2BWGA 3CV1A 1AQMA 4B5NA 3IIVA 3U3HA 4J2PA 2X1SA 3FLUA 4HOZA 1TRDA 2ZZ3A 3J7HA 3P5YA 1XRVA 5HWMA 1A47A 3WMBA 4JN6A 5BU9A 5FEWA 4K7VA 3TJLA 1A5KC 3HF3A 1VHCA 4LPCA 4JTSA 2JK2A 2UWFA 3GTNA 1GVOA 1REQB 3NQ6A 1JF6A 5BXPA 3NGFA 3QMSA 4Q3MA 2WHMA 1PHQA 4R7OA 2QULA 2XZ7A 2BBFA 4A29A 4JTIA 4H7ZA 1PUDA 3GDKA 2XSXA 1IT7A 5G2WA 5DELA 3C5QA 1HF6A 3UZYA 4QXIA 4MDPA 1JYWA 3Q37A 3UG5A 4OJYA 3P14A 2NT0A 2BGQA 4DM1A 4AIOA 1DQWA 1KTBA 4GZ7A 3S5YA 2PDFA 3CH9A 1XP3A 2XIMA 4E0CA 4LC8A 4LY4A 3W7GA 3E74A 3UCCA 4J4KA 4ONVA 5TF0A 3AAMA 3HG3A 5C6MA 1RQHA 1R2TA 4FX6M 3PK7A 1AQHA 1KFLA 5LA1A 3VCNA 4WSJA 3W1QA 3WBYA 2PS2A 4NZ1A 3N6QA 3R6IA 2TSYA 2E0PA 4V1YA 2VC6A 4Z2IA 2ZC1A 2F6KA 1I2NA 1R2SA 3ZQ9A 3GR4A 1RA5A 3LCIA 4DRSA 5REQA 4EPEC 1B3OA 1XYCA 2BVTA 3KRBA 1Q65A 4NNAA 5TQLA 1S2WA 1AMKA 4FR6A 2VC7A 4QTGA 2BY2A 4LVGA 7A3HA 2VGBA 2J78A 3W71A 3WK3A 2QDGA 5H1WA 1PYFA 5E6ZA 3HGOA 4S2CA 3P8IA 1HVXA 1TCDA 1LUCB 2POTA 2E1DA 2VCBA 1HIZA 4UWMA 3I7QA 4FXJA 3OTRA 3R0DA 3VNLA 3MP5A 3QSTA 2C7FA 3AZTA 4ORIA 1U1UA 3TQPA 5GVJA 5I6SA 3XISA 3WF1A 1LP6A 1ITCA 3T08A 4ZFCA 1EH9A 3CB8A 3K30A 1SFLA 3WNKA 3BUVA 4EVZA 4BWLC 3WD1A 4FF7A 4GIYA 2QMJA 2OQYA 2PLJA 1RZMA 3GR7A 4AD1A 2BZNA 3HQPA 4A3QA 4JZ5A 3LXAA 2DJLA 1JF5A 2P3EA 3WQ4A 1OCJA 4US6A 3L68A 1K70A 5A69A 2X0YA 1XFBA 1MZHA 5DBUA 2VCAA 3VDBA 1A0DA 1R7OA 1K77A 4FZIA 4D6CA 2PZNA 4AC7C 3CQJA 5CZ0A 4IP4A 2YDQA 4XSMA 4DVOA 4HCLA 2C79A 3G3DA 3IJ7A 4UFJA 3NYZA 2PLCA 4S1FA 4O54A 3A4JA 1Q6FA 3QSRA 3SJNA 1MXDA 3Q58A 4Z2GA 4QG8A 1QXLA 1W3NA 3B97A 3QHMA 3RX2A 3G0UA 1QI0A 2BMBA 4IP7A 2V5CA 1J11A 5GJMA 3IPWA 1AL7A 5HNRA 3CUFA 4NZ5A 4KW2A 2YX0A 2W79A 2JF7A 3R12A 5LNWA 1ZPTA 1CLKA 1PX3A 5FL0A 1PE1A 4DYJA 4WJEA 5CLWA 5JBEA 2PB1A 5AZ1A 5JUVA 3MWCA 3VIFA 2OT1A 4QCEA 1V5XA 3SIMA 5LNVA 1R0MA 2GYIA 4MFDA 4DJDA 5AYIA 3GDBA 3P82A 3DCPA 5AYYA 5FAGA 1V3JA 5G4WA 4ERIA 2JGYA 3EWZA 2Q01A 3EXSA 4NF7A 4C6PA 3G22A 4JTAA 1H0IA 2UY5A 1E6NA 4W86A 3MUCA 1KNWA 2DZAA 4NZ4A 4IPJA 2XU2A 2OWXA 4UTUA 1G4SA 1XBVA 3OG2A 1T8XA 4FF5A 3MTWA 2OJPA 4JFUA 1VEOA 4QNEA 1FHUA 1XH0A 2XFRA 3B8IA 1EL3A 3PJUA 3OVGA 4DF2A 2GQ8A 5GJPA 1GKRA 1WOBA 1CBGA 3TAKA 1ICPA 2FVMA 3LMYA 1C93A 5C7VA 2PDIA 2VGGA 1YMYA 3KVKA 3EOSA 3S5ZA 4J3ZA 2YLAA 4LBUA 4CQ9A 1PTDA 1E4IA 4DNMA 4DBWA 2QUUA 4W7WA 2JGQA 4AZIA 3F2DA 1OINA 2NX3A 3A64A 3TYUA 1BF6A 3T0BA 2ZWZA 4CD8A 3IUHA 1W56A 3VDAA 3WQOA 3VPLA 2YXOA 1UR8A 4ZB2A 3VNDA 1X1OA 3AYTA 1NP0A 8XIAA 5BMWA 4RLIA 3P2VA 4JIIX 1F07A 4FX7A 5MKGA 3CEUA 1CIUA 4L4MA 3N9KA 4XBKA 1OF8A 3UR5A 2BGNE 1K7XA 1QHOA 1KFKA 1DWIM 4J3WA 4O0QA 1FH8A 3VZYA 1ZTVA 1HP4A 4CU6A 3POHA 3BLKA 4A22A 2FTPA 6TAAA 5KZ6A 5C9ZA 4I6VA 3QTPA 4P8WA 4QR6A 3BCJA 2YFNA 1GCYA 1ISVA 4NIRA 2E9LA 5AYBA 5K9XA 1K1DA 4NP7A 3WMCA 4H7VA 1A49A 4IGMA 3P0WA 3IAPA 2A3LA 4TU1A 3ZM8A 6REQB 3A4XA 3TV8A 3GZAA 3LYEA 5HNTA 3MHUA 4A2SA 2V5LA 2ZDSA 1WKFA 2C71A 1H1NA 4EOUA 1BXBA 3ID7A 1G0CA 1CWYA 3WLJA 4M6VA 4PFMA 3JZUA 4XX6A 4KEMA 4UB9A 3TE9A 2GJPA 1UMYA 2EF9A 2OLSA 4IICA 3WJSA 1Q85A 2PDLA 4PUUA 5JQ9A 3NDOA 1GQLA 4FXRA 3OO2A 2VDIA 3BLPX 1S5TA 1R3VA 4GG9A 2AQOA 4TMBA 1I8JA 3PJWA 3NO5A 3PBUA 2R82A 3QY6A 2Z1BA 4AC1X 4X3ZA 1AQFA 2V81A 4O17A 3PPCA 4K7YA 2PDGA 2NV9A 4ZOAA 3TOYA 3KBJA 4X9SA 1Y5XA 1L6WA 3TN3A 5E09A 4PL2A 3EDEA 4M7TA 2BOGX 1KR0A 1PBGA 1MI3A 1N2VA 1OM0A 2WKGA 4NZCA 3GHTA 4Q7NA 1Q7QA 3NZQA 4JN7A 4C6QA 1TKKA 2W63A 1AZ2A 1EQPA 3APTA 4ROPA 1XIBA 1ENUA 1EWEA 5F4SA 5CBBA 1GOKA 1DWGM 6PTDA 3M0XA 2IPJA 1V7YA 3TJIA 2VX6A 4K68A 5FF0A 1FHDA 3AUOA 1E55A 3D47A 1XYFA 1C7SA 4QE5A 3OG3A 3U9IA 3W26A 1EX1A 4WCJA 3RG6A 1NM9A 1HP5A 2QCHA 4CLMA 4LVBA 1DTNA 2X30A 3PZ9A 3NSMA 2NUWA 3LLDA 2VX4A 2Y89A 4WKFA 3WD4A 2GJRA 3OZOA 3TAOA 2B31A 2NQHA 3DC0A 1NOFA 1E73M 1V6XA 2KX9A 1FX6A 1F3TA 2YA2A 2D2OA 4FPSA 1IHIA 4WY0A 4L9XA 2ISVA 3DG7A 1JCXA 4JX6A 1XYBA 3OJGA 2GGHA 1YTEA 5D2TA 4HU3A 3E38A 2CFFA 3GIQA 4I9AA 3LOTA 2OX1A 3RNDA 2FZMA 1JPIA 1OYCA 3DYPA 3VE7A 3PNUA 5IOBA 2ISDA 4DNHA 3S42A 1OD0A 3EMQA 2YB1A 4UTMA 1TCMA 4TTGA 3RGTA 5C8BB 3PULA 2O0TA 3CPRA 3ABRA 4RNFA 4N2YA 4D6HA 1VZWA 2OR2A 2VZVA 3ZYZA 4ZR8A 3F4CA 3GB6A 1D9EA 3CU2A 1FHLA 4FNTA 1QK2A 1TPB1 2POZA 1VR6A 3K13A 5FAJA 1TV2A 2PTDA 1AD4A 1WBJA 3OA5A 3MMWA 2EHHA 4NVTA 4PFHA 1JPHA 4G56A 3SUSA 5T9BG 1QPRA 2X1RA 1XBZA 2Z29A 4L5ZA 1EP1A 2WSQA 3LHYA 3PTKA 1AL8A 3ECQA 1RJRA 3S2MA 5C0QA 3LSCA 1XIIA 2CLHA 1UA7A 3VIJA 5BRPA 3ANUA 6REQA 2CW6A 4BJHA 3WH5A 5ABGA 4TV6A 3VKDA 3BOXA 2DVUA 3LHVA 4HKPA 4IL0A 1UBPC 1LOSA 1ISZA 3GC2A 1R38A 1VFOA 4YN5A 4Q4SA 1AH4A 1W6TA 5IFPA 4H9TA 5CBIA 3BLLA 1GHRA 1PYMA 1XH2A 2HK0A 1US2A 3UZJA 1LOLA 3V16A 3KOXA 5EL1A 1W31A 4MFEA 4ECLA 3NYDA 4IH3A 1KBBA 4LAMA 4IQLA 2FB2A 1MRAA 3QQWA 2GJXA 2VNCA 1G5AA 1V3KA 1WA3A 4D1IA 1HL9A 4G2DA 3VA8A 1ADOA 3TX9A 3VOHA 4IMDA 3VIHA 4OBTA 2QXWA 2VFDA 1GW1A 2O7SA 1E9YB 5CXPA 3VM5A 3TYBA 4NX5A 3QQ1A 4IF2A 1H7NA 4AIBA 2VEKA 3LPFA 3IGSA 1UB3A 4GISA 1EEPA 4PODA 1ME7A 3ENLA 3L0NA 5ECVA 1LOQA 2NWRA 4K36A 3GVGA 2XVKA 3FHQA 3I4KA 2DW6A 2E8YA 3WDPP 2PPGA 2WMHA 1NDZA 1P48A 2R6OA 4DUWA 2REQA 2P10A 4K1GA 5FOOA 1KCXA 2V82A 5AHNA 3JUGA 2BSLA 4ZGYA 3W1LA 1I6NA 3KDOA 3AUJA 2TODA 2E40A 1ITUA 2CLMA 1DWAM 2HBVA 4MNJA 2PRHA 4W8AA 4CVWA 1E56A 4PB3A 4KIRA 1I2OA 4B16A 3H6OA 3CBWA 3H4XA 4URIA 3PPHA 1FWHC 2RJHA 2YB4A 3JRKA 3UG8A 3VNZA 2ISFA 1CXKA 4LBSA 3BJSA 1UPPA 1OEPA 1GG0A 8TIMA 3RM8A 3IJ6A 2P5NA 3L4XA 3M5VA 3MB9A 1Q8JA 2FH8A 1N8IA 2AQWA 3N1AA 3MCMA 5CJ5A 4GINA 3SJ3A 1J01A 1ZCOA 4KWUA 5E9XA 3ARRA 1B2YA 2JQXA 2QQ6A 4BQ5A 3EB3A 3ZVHB 3HGRA 1SW0A 2YZ5A 2ZA1A 4JNMA 3TWAA 3RUBL 4U33A 1GORA 2ZVRA 3B8VA 1OCNA 5E5CA 5FCZA 3CLWA 1YPIA 1B4KA 2E8ZA 1GEQA 4DAFA 2Z6IA 4L7ZA 2GL5A 3PC0A 4E5TA 1HL2A 2YCEA 1V3HA 1OK6A 3THQA 1GW9A 3SECA 5AHLA 3DIPA 1TTIA 3LDVA 3LS9A 3M0ZA 5I2UA 4XD6A 1OFOA 2A3BA 4GH1A 4KETA 4AYSA 2IQDA 2H3DA 4Y90A 2CBUA 4AY1A 4Q4MA 3D3FA 1IWBA 4MY8A 2PTXA 4EANA 3GTHA 2WMKA 4D2JA 2WSYA 1SSGA 2ZZ4A 4Q8PA 1E0XA 2BY1A 3EWXA 1M3UA 1TPH1 1FUYA 1H51A 2EG6A 3NO1A 1O6IA 4DZAA 1ZBKA 4JYFA 4MPKA 2Y5JA 5EY5A 3ARWA 1TA3B 1GOMA 2AL2A 1TPEA 1EOKA 4B4HA 1PXGA 3ANYA 3CZLA 3MVIA 4GQGA 2QCGA 2V5BA 4GY7A 3W2UA 3KUMA 4OFCA 1K7EA 3CT2A 3IK4A 2ON3A 1TV7A 3W7HA 4BFAA 2WSKA 3UXLA 5HNNA 1T6MA 2DT2A 1NARA 3AS0A 3I6TA 2ZYFA 4HT3A 3MUZ1 3WKZA 4E38A 1PL9A 4K6AA 3OQ8A 1M7PA 2VVSA 5I7GA 1WYIA 1WDWA 1VLWA 1NY1A 3MDWA 3ARVA 1F3XA 4ZE4A 2QIWA 1S5VA 2A7NA 2YJQA 3GVRA 3QZ6A 1KM1A 2VRKA 5D9NA 3HBLA 3V18A 2HNEA 4JBRA 3O0KA 3FN9A 1MNZA 5CZKA 4HVXA 5EYWA 2OYLA 1XDMA 5TD4A 4HMDA 4R88A 3KS6A 3PBMA 1FXPA 2DGAA 1K8CA 4LTSA 3FS2A 3C2OA 2X0SA 2W3ZA 1FP9A 4NJHA 4NY2A 2PURA 1VFUA 4A35A 4A6GA 3A13A 3WQGA 1VFSA 1UR4A 3TA6A 4ERGA 4DXKA 3AICA 4GBDA 4LS2A 3AS1A 1KFWA 3KBMA 3F7JA 4GVIA 4PMYA 3F4DA 5FJUA 1WDSA 4I3GA 5A8NA 1Z9AA 2OSXA 4WGHA 4BKNA 1F4HA 3VO0A 4O1EA 1JZ3A 3C8NA 1H11A 3WBXA 2FZDA 1TWIA 3FV9A 2GSJA 4QITA 4AEOA 3UVIA 2OFJA 3WQ6A 3U57A 5J04A 2DZXA 4LT9A 3ARSA 3UR8A 3T1GA 3NQCA 1V6WA 3W2LA 1XLAA 3OVRA 2V6AA 1FWCC 2J75A 1EJWC 1UA3A 2H9AA 3ZVHA 2I5IA 4POCA 5EGRA 1IZCA 2X2GA 1WO2A 2O9TA 3WEMA 3V36A 3W7NA 5I3IA 2J7HA 3WFZA 4NNBA 5FL1A 3QOKA 1QVBA 3L2LA 5I06A 1RAKA 3CZJA 1XKYA 1Q6LA 2HQAA 1R30A 2VL4A 4LRSA 4IL2A 4Y8FA 4FAMA 1I1WA 1PJ9A 2VUYA 1PIFA 1PX8A 5A6JA 4L9ZA 3SQMA 3CQ0A 3TCEA 3QPYA 4PN2A 2NVDA 3GXNA 3VE9A 3SR7A 2AL1A 1UG6A 1NSJA 4OVXA 5D02A 2Z27A 1Z42A 1L0PA 4F9JA 4Y8EA 3HIJA 1SO3A 5JMUA 1L6YA 3WIJA 3NDZA 1XLMA 5ABFB 4LJ3A 3VKBA 1FH7A 3EWBX 3AXXA 1KBJA 1EZWA 1TV4A 5J5RA 2H8ZA 1ZAHA 3U5UA 5A8QA 3ARTA 3BGAA 2GVJA 2Z2AA 1LRQA 4B5UA 2AKMA 2F2KA 2A7RA 2HZGA 4PRRA 3T7VA 2DZUA 3LHZA 1X6UA 2PDCA 3AHTA 4YMZA 5A2AA 4A3UA 1WV2A 2HNHA 3CIXA 2PBOA 4M24A 1X6LA 5IXEA 4DIAA 1M41A 4YTSA 4UOJA 2CZEA 3WL0A 4ZO7A 1A5MC 3H7UA 1PTAA 2V63A 2BASA 1VFFA 1XSJA 1XIFA 3N6HA 1ML1A 3BV7A 2JE8A 3FDGA 1AK5A 1R8LA 3S83A 4RNIA 5HJXA 3A4WA 2E67A 4A8RA 2ZRUA 1RBAA 4KWSA 3O9NA 4ZQMA 3QOMA 2HE8A 3ZR5A 2Z1XA 2BX7A 4I90A 4PUDA 3PWGA 1NVMA 1L6SA 5M03A 2X16A 2CNCA 4D6JA 2X7VA 1PZ3A 4CCEA 2E6YA 5KZEA 4R34A 1Z44A 4J9JA 1TPWA 2V0TA 3L4YA 4CN1A 3RJXA 4HZ7A 3UPBA 5HQLA 5GJNA 1MUWA 3DN5A 4S39A 3K8LA 3WBEA 3OP2A 3GDTA 4GKTA 3W2MA 4HK6A 3LLFA 2ACSA 4BQ3A 3LCGA 3LV6A 3CMGA 4XBSA 4QDWA 5A6AA 3I10A 2O4QA 4WUIA 5A95A 1WAWA 4UIOA 4TX9A 1DP0A 3GXMA 4MB5A 4PBGA 4Q8OA 4RZ6A 1BVWA 2OEJA 3TCSA 1OGBA 3UJRA 3H7RA 3S2LA 2PDKA 4RR4A 1VS1A 4B3LA 2AGTA 2PDJA 5HXMA 2FZ8A 1QBAA 3WD3A 2C8NA 5F1VA 3UNTA 1EA0A 2WVUA 2VO5A 1JZ5A 5E9AA 4NAFA 4XISA 3LGDA 1CYGA 3W7QA 2CXGA 2H8XA 4Z1AA 1UUMA 2BVWA 4QM1A 1XI3A 3V5FA 3QGKC 1KLYA 1FCQA 3DKLA 4MDOA 1PV8A 3S5SA 2OWWA 4YS1A 1CI1A 3BV4A 1K8YA 3MZNA 4JQAA 2INEA 2HVOA 1P0KA 1YBQB 3IAQA 3ZJ6A 2JKAA 4Q8WA 3BLIA 4M6UA 4CCDA 1WKDA 1ADDA 2F38A 3WUFA 4JS3A 5IFTA 5D8WA 3MUAA 3WJWA 2WOQA 1TIWA 3FEQA 4LBRA 1HN1A 1QASA 2JKPA 4JEJA 3CUXA 1FWIC 1EPVA 3N2OA 4A2RA 9RUBA 1F8MA 5CPLA 2Q09A 5HR7A 3OZMA 3R1ZA 3DUGA 5IHSA 3PVFA 3IJDA 4I8DA 3M4HA 3OU8A 1QK0A 2A6LA 1XSKA 5HNUA 1BHGA 2J27A 4WR3A 3S0CA 1R6WA 1T41A 2PBGA 4FNUA 2NQJA 4A3YA 3KXQA 3ATZA 3EDDA 1Z7AA 3PS7A 4XTIA 4JIHA 4EK7A 3IACA 1V3IA 4JIPA 1EHNA 3W81A 3SCTA 5F2IA 2Z28A 3I65A 5B7ZA 4F79A 4E8DA 1MEIA 3T05A 3GS6A 4IQDA 1IWAA 1EIXA 2G37A 4PA8A 3OBAA 2ZCGA 4JHZA 2E6FA 3DZ1A 1GVQA 1QPNA 3U4FA 3BW3A 3WNMA 4FK9A 1XLGA 1JCYA 4U5KA 3MMTA 3WK1A 2J74A 4IIDA 4KGJA 3U48A 4HNTA 1VPYA 2CKRA 3W74A 5FF7A 3KW3A 4WRHA 1GVFA 2XWDA 1G7VA 4CEXC 2Z1WA 3K1GA 1GNXA 1MFUA 1NIUA 3OHIA 1J0ZA 3WQPA 4GZIA 4H19A 3WL1A 2OYKA 1KB3A 1SZNA 1RP8A 3B05A 2OZ3A 1ZJBA 3VU2A 2X09A 5E1QA 1LROA 2PMQA 1AUSL 2A0NA 3BC9A 2RUSA 3UFYA 2DVXA 1ONXA 1XXXA 4C6EA 5EA9A 3S1WA 2EKCA 1RJQA 2X40A 2Q71A 3PUGA 4LSBA 3K4DA 3VIMA 2PSNA 2YCLA 1XBXA 1C8QA 4F0LA 4BEUA 4UTTC 1YTDA 1P0DA 2JKEA 2FPYA 1OWQA 3AHYA 1JGIA 4ZSTA 4FIQA 4D1JA 2G41A 2QJGA 3TW7A 1LRTA 4NKCA 2GVEA 4YYFA 2FDMA 1TG7A 2C91A 5AOUA 5BOFA 4Q8QA 3D0CA 1E6PA 3TC6A 3N13A 1WXZA 3KWSA 4C5ZA 2CHNA 3JZEA 2PTZA 2Z25A 5DLCA 3EKGA 3EKLA 2ZX5A 1BTCA 3WQVA 2W67A 5AC4A 3E1F1 4GZJA 3O6DA 2HDJA 2BDQA 4IJRA 3TVAA 2WMIA 4CD7A 3GH7A 3XINA 1BWVA 4C7GA 4P7NA 5T9CE 1UMLA 4N4PA 1R3SA 1ZJHA 3GW3A 5BRBA 4GVHA 4AXNA 4QIUA 1R3WA 2WNQA 1XIJA 1PZ2A 1E15A 2F2HA 4AX7A 3EOLA 3N3MA 3RF9A 2ZZ6A 4WJ8A 1Q4WA 2OZ0A 3TYEA 1B31A 3HGSA 1FCBA 1DV7A 4UTFA 3CIVA 3KE0A 1JDDA 2Z00A 4XZHA 4YTRA 1E1CB 3AXHA 5LIWX 1O5RA 1BQCA 1KBIA 4WKHA 4AHPA 2I16A 3ARXA 3VUSA 3LBCA 2PWDA 5FEZA 5A94A 4HA4A 3EDKA 2E4TA 1OFDA 3KBWA 2OGJA 4JIEA 2DZVA 3WX7A 1M7JA 4V28A 1X7IA 3KWXA 3AMCA 3GBEA 2CZVA 2C0HA 3AIQA 2GK1A 3UD6A 3WN6A 3AIRA 4IZGA 4GX8A 5I3JA 1JRBA 2C0AA 1FXQA 4QISA 3GO2A 2XPKA 2XH0A 3GTFA 3E0VA 1EUAA 3FAWA 2R8WA 3VGHA 4L56A 2CCRA 2PF8A 4IHCA 1EGZA 3UJFA 4H6EA 4YYCA 3UA3A 4E3VA 2DT1A 3PY2A 2D3LA 2V5JA 1S46A 5DMNA 3BAIA 2V2CA 1OT2A 3GDMA 2PDXA 4N9BA 3WJXA 3RRXA 1YDOA 4LAOA 4DELA 3R0KA 1PKNA 3RR1A 2HJPA 1P0BA 4I6KA 1JZ7A 2ZWYA 4O15A 3L4VA 4JFVA 1EDTA 3VNYA 1HG3A 1NH6A 1YXCA 4PC8A 1QATA 1EZ2A 3S2CA 3USZA 1PHWA 1P6BA 1VBGA 1TQXA 3G1DA 3F4NA 4I5XA 3IJQA 3IVSA 3I6RA 5AC6A 2G95A 3LA4A 3NZPA 2DUZA 3N15A 5LNRA 2VR5A 3S9YA 1TWWA 3ALFA 3MHFA 4ATWA 4DO4A 4LGXA 2D3NA 3Q4DA 2WJZA 3T2QA 5LZLA 3LX9A 3SRHA 1HQTA 3M0VA 1QBBA 1MUCA 1P0NA 1IXQA 4GCXA 3GXTA 3RFAA 2VWSA 1E0UA 1QI5A 1W1B1 1XLJA 1OC5A 3GFYA 2XTKA 3VD9A 4EPBC 4AUBA 3BW4A 1EQCA 4B5WA 3NFUA 7REQA 5A6SA 1RVGA 3PBGA 2XVGA 3R4IA 1TWSA 4AZCB 2TMDA 2ZFAA 1AVAA 1EJVC 2YPIA 3S6DA 4JQ2A 2Y2WA 2RH9A 2PODA 4IISA 4DJDD 4AD5A 3LCXA 3GKFA 3AQUA 4JXCA 2WCGA 4XG1A 4B3ZA 1HX0A 3KVJA 1DXEA 2YBVA 3GTIA 4OOUA 1VYPX 5FACA 1V8EA 4KQNA 5FESA 4RE4A 1BRLA 5I0DA 2BVDA 1NWUA 2QCMA 1QCWA 4WDWA 2VFHA 3NQDA 1CNVA 2JALA 2QVHA 3E5BA 2ODOA 2VFIA 1GPFA 3OIHA 2PGWA 4KCVA 1E1CA 1P7TA 3GY1A 5LIXX 3W1PA 3LV5A 3N9SA 3TSMA 4LUTB 2A6NA 4PMZA 1SMAA 1PIIA 2PDMA 1QHZA 2WHKA 1I9CB 3WLTA 2I1OA 2VWTA 4O52A 4GVGA 1F3WA 3AWNA 1OFEA 2ZUNA 2V38A 3NPXA 3LCFA 4PMDA 4EWJA 1PKYA 4LNYA 1SJAA 2Z1SA 2V69A 1P5BA 1JI2A 2ZOXA 4NXSA 4A8NA 1XR2A 2G4FA 4UZUA 5DQPA 4X0NA 5KINA 1NDYA 4UTHA 3AIVA 3SY1A 4LX4A 1T40A 5D2WA 5EU9A 4UR8A 4FR1A 3UZWA 2ACUA 4AEFA 4JKKA 4JKLA 4GIEA 4MWAB 1X8CA 3H26A 3AU6A 1OF6A 1W1YA 2QZRA 3M0MA 1A5SA 1ZNNA 2P88A 3W7EA 1Q3NA 4N7QA 1VH7A 3COTA 5I3FA 1O12A 1MRQA 3JS3A 1KRAC 3HV9A 1JZ8A 5CGTA 2PFHA 1VAHA 1VKFA 3DI0A 4INFA 4B9ZA 1XINA 1JL8A 3NJ3A 4NJGA 2O9PA 1SR0A 4TO8A 3E6EA 4NJIA 3SBFA 3UERA 4UTTA 2MUCA 3W23A 3PWIA 1RHCA 1J0IA 2F84A 4C6FA 1PTGA 4TVCA 4G9PA 5F7UA 5BWFA 1A4LA 4D6DA 4LB3A 3EMZA 1OK4A 1H2JA 2PDPA 2ZZ7A 5AHMA 2VQUA 4GO9A 2WZTA 1VYRA 3ONBA 5GQBA 1QW7A 3H21A 1MQQA 3XIMA 3P62A 1UD6A 4R33A 9XIAA 4ZO8A 1PSCA 3GIYA 1QI2A 3SQLA 1TE1A 1IGSA 2VD9A 4BS0A 1BTMA 4RZ4A 1FBAA 1SO4A 2PF0A 1CXLA 3ITTA 1YXYA 5EBUA 2YW3A 2D23A 3UR2A 5C2CA 2NVCA 1UIOA 2EPNA 4QG6A 3CO8A 1UR1A 2OG9A 3IIXA 4BR1A 1SUXA 3R2GA 3WQWA 4TV5A 3VKKA 3B04A 1RA0A 4DLFA 4LS0A 4ZODA 1I1XA 4NT0A 1ECQA 3P67A 2XVLA 3UF9A 3WD0A 2GJLA 4A05A 3S8HA 1O5XA 3O16A 5LYRA 3IANA 1KCZA 2I5QA 3T2OA 4UQCA 3DG3A 3M5ZA 1C92A 4PRTA 4RNJA 3KLLA 4JTDA 3C8FA 1W1VA 4UTWC 2Y85A 4Y2WA 1DE6A 4O4WA 1B9ZA 1AZ1A 1WE5A 3ATYA 4OT7A 4Q8MA 1VPQA 4IPLA 3HTWA 4C65A 1H7RA 3STGA 2VURA 4H9ZA 1CX9A 5C70A 3K2GA 3WK0A 1F3EA 2ZXBA 2XM1A 1SFTA 5HANA 1S38A 2JIWA 4R7JA 3GQYA 1DHKA 1US3A 2VUNA 4JTQA 4JHMA 3NZGA 3UPMA 3ABXA 3HQOA 1U30A 4PBFA 3PZQA 4GUHA 3HM7A 1XPYA 4HHHA 4US5A 3B3DA 3DFQA 1C29A 3NL2A 3RILA 3W53A 1EJUC 1EJXC 3R8GA 4IGSA 1KV8A 3VVGA 3FSUA 4HPGA 5CGQA 5MF5A 1Z89A 3S6OA 4GX9A 1A53A 1AQ0A 1JFHA 3KS5A 1FDYA 2EPMX 3OLIA 1X97A 1LF1A 3DFTA 4QG9A 4QGCA 1GJWA 4OOZA 2PLMA 4C6MA 3AFBA 2V3GA 1NQKA 3V0TA 1Y5VA 3G3MA 2FJKA 4N9DA 5BXSA 2QUNA 2TAAA 2CLEA 4JQ1A 4S3KA 4PTXA 2OOFA 3IEBA 1TWDA 4KCWA 3TWBA 4RV8A 4OBRA 2Z2BA 4YHEA 3RX3A 5I09A 1YPXA 3DXIA 3UXKA 5T91A 3WFLA 3Q45A 3B9NA 2PUZA 3W72A 4H1ZA 4KMQA 1TMLA 3ARUA 4JKMA 3SCWA 4NILA 5JH1A 4GYPC 1TB3A 5F2GA 1VBRA 1W5QA 3TNBA 3SY5A 3PN8A 2VTFA 4E2BA 3II1A 4JX5A 3DHFA 1J12A 2OYMA 5AYZA 1K4GA 3W4RA 3H7VA 4QJ3B 3VGEA 4PTNA 5EPDA 3L7RA 1E43A 5GPRA 4TR9A 2RGMA 3TTEA 3GAYA 1U22A 3F5KA 3NOEA 3PANA 1I2PA 4DWSB 3LEPA 4PTVA 4E8GA 4XKMA 3PTMA 2DZWA 2D2GA 3LZ5A 3L0KA 4PEKA 1S5NA 1QMLA 4AQLA 3TSBA 1AH0A 3M43A 3QH2A 5F1UA 4PBEA 6XIAA 2W4XA 3TNOA 2UY3A 2W9MA 4GGHA 4RL3A 3WF4A 2Z1KA 4IFOA 4TVDA 3RYSA 3GZ3A 2DZTA 3DYOA 3VDHA 1TYGA 3WNNA 2PC8A 3GKAA 1PWLA 1GQNA 4L4PA 2XFWA 4WDTA 2J8GA 1W9XA 3W7MA 3CAQA 5AC8A 4R9OA 1DIDA 3EEGA 3SUVA 1JCNA 2P8BA 4ILSA 4C6BA 2FFIA 2R24A 4N4QA 5EMMA 1Q6DA 3R11A 5KZMA 2CITA 4U31A 2DUAA 1JPMA 2P50A 4MLJA 3WNPA 4M81A 2A5HA 3WNLA 1I2RA 2YW4A 4JYDA 1EJ7L 3SCVA 4P7QA 4JDBA 3RLUA 3VD5A 1X8FA 4MB3A 2YA1A 1J0KA 1D3HA 3UYCA 2QKFA 3CXOA 4ERAA 1EYWA 3PAOA 3NOYA 4K39A 4UQBA 1NELA 2Z7KA 3DU0A 4PGLA 2PTYA 2JIEA 4ZL1A 4Y9NA 1OFQA 1FRBA 3KTXA 3PPGA 1H5VA 1JULA 4OE7A 2EPLX 3N19B 5B7YA 1BWKA 4NJKA 3M41A 4NG3A 3BSMA 1FDJA 2GOKA 3VGGA 3O63A 1YNPA 5I5RA 2NXIA 3UY7A 2DJXA 5I79A 1B3XA 1EGVA 1J18A 2X41A 4AIEA 2CLFA 4OBSA 1A5BA 3N17A 4AB4A 3U7VA 1TJ0A 2CHOA 5DY3A 1QO5A 3OHMB 1E40A 4YJ5A 4B3KA 1ISXA 2WNNA 1E0VA 2VEGA 3R7MA 3MSRA 3H4GA 2ZICA 2QLYA 2J7GA 3NQEA 1ZJAA 3SEPA 4DJFD 1OD8A 2VCCA 3TUUA 3THAA 1WZAA 3MZ2A 3R13A 4ZA0A 4AFYA 5LA2A 1VENA 1S2CA 3AS2A 3ZR6A 2WNZA 1UR0A 3ARYA 3I7RA 4EAYA 4K2SA 4Z42C 1GTHA 2YCJA 3GSMA 1BLIA 1UCWA 5A6KA 4H8HA 3RJYA 3ZFHA 3WLSA 1UC5A 2WVTA 1FWAC 3TSDA 1DHPA 4J3XA 2WVVA 3IGUA 3SRFA 3BLEA 2C3ZA 3KBSA 5DRIA 1YX1A 2ZZ2A 4LQ1A 4ZO6A 1AJ0A 1KM0A 2CEQA 3N11A 2C19A 1IXPA 1UW9A 1FCUA 2BV9A 3IV8A 3M6YA 1DEDA 4GACA 2EPKX 3S1VA 3HOJA 1EJTC 4TVUA 3T44A 4AZ7A 1KW1A 1XJBA 2ZUWA 4J1OA 4ZQRA 2PDNA 3BDKA 4KEVA 3QVQA 4PZVA 4RE3A 3VDCA 1UR2A 3MSDA 2QAFA 4G5DA 5JH2A 2WO5A 4DEFA 4UZSA 1J6PA 1ONWA 4RZBA 3DFPA 4F0SA 2VI0A 1W0MA 3W6YA 4IT1A 1VC4A 3TR9A 4IMAA 3AROA 3PFRA 3FA3A 3TYDA 1HL8A 4IIFA 1JPKA 3PPFA 1NOWA 4EE9A 3PAJA 4OU1A 5G4EA 3MANA 3GVWA 3DESA 3KHJA 2XSBA 3BOFA 1DORA 3B8DA 2NLYA 2EXOA 3BAYA 2RFGA 4NX0A 5SWUA 1AFSA 1XLDA 2G96A 3DGBA 5CKSA 3G1HA 1E6QM 4RPPA 2PA6A 3A24A 4XTDA 3UJ2A 4N6EA 4X2PA 1DQUA 1EO7A 3RN6A 4Q22A 3UEQA 2JFEX 4K1WA 2PP3A 3STFA 1XGDA 1HJSA 2CIPA 1LT8A 2DU2A 4MYAA 4ZEPA 3NL3A 3I6EA 2G3JA 3JW7A 2IQ0A 4HHMA 4Z1DA 3FA4A 3TN4A 4DBEA 4Q4QA 3CO4A 1JUKA 2J25A 4KF1A 3MS8A 4CEUC 2QJHA 3DC8A 3NXFA 4RE2A 4KWWA 3SGZA 4NJJA 1JJKA 3HO8A 4EKJA 4CU7A 1GVSA 2F61A 3DI1A 1FVPA 1NFGA 5C9RA 3WELA 1YE4A 2ZDRA 1DIEA 2YOCA 5C54A 1JUEA 4HMNA 3T8LA 3W83A 5A6MA 5C2XA 1KTCA 3AMLA 3R79A 5I3DA 2ZE0A 1GONA 1S3TC 5CZSA 3W7PA 5G2IA 4DBSA 1KTNA 1CGYA 3UT0A 4ADTA 1E6RA 1NEYA 4G7EB 4CNTA 2G50A 4D8AA 4PE8A 2DW7A 1UWAA 3FJ6A 2XGZA 4AWSA 4F2BA 1N8WA 3FKRA 4QRNA 4UUIA 3BARA 4GXPA 3PSVA 4GYPA 2IQTA 4IQEA 1EC7A 3W22A 2QEZA 4JTFA 1CLXA 1BGAA 4N0RA 5DCDA 2DZSA 4PB4A 3FAXA 1W5NA 1VGAA 2PWUA 4P5UA 4C1KA 3T07A 3CT7A 2C13A 4N9CA 4X0VA 3PUEA 5LSMA 2D1ZA 3LB0A 3W01A 4A3RA 3HG5A 4H9UA 3TYAA 3ZT7A 4FA3A 2VT0A 1W9BM 2QCDB 4HP5A 4Y96A 1IF2A 3BJTA 4F0MA 3PZTA 3CZEA 3WH6A 2WK2A 2QF7A 2Y8VA 1TWZA 4KCTA 3WLKX 4OQVA 5CC3A 3W29A 3F03K 2GVGA 2IS7A 1UWTA 3LK6A 1JVNA 3SDOA 3AISA 3BO9A 3P8JA 4I7UA 3O07A 4FSAA 4QSFA 3A21A 1CEOA 3SI9A 1VCVA 2ZX7A 2FZNA 1B3WA 4HSHA 3E3HA 2XIQA 4WEVX 3O3RA 3V35A 3CAVA 3EKZA 5HA7A 3RIKA 2F7FA 1IZKA 1MNSA 3SCOA 5IBXC 3A22A 2BODX 3N4AA 5AHEA 1UD3A 4RXGA 2B4GA 1CPUA 1VFHA 4CUCA 4IGHA 1A5CA 1J8VA 3VTRA 2VVNA 1FWNA 1L2UA 4DJDC 2ZX8A 4LUSB 1QNRA 2DV0A 2GQAA 1K9TA 1EWDA 4G6CA 1Y5WA 2YSWA 2CXEA 2AQVA 4XKYB 4LCQA 3VFCA 1WXYA 3S5NA 3QF0A 4GLEA 3EXTA 3N2BA 3KP1A 4H83A 2DSUA 1RCQA 4RDWA 3MHGA 2A3HA 5G1TA 3SURA 1TMHA 1XL9A 4DO5A 3GUWA 1C8VA 4BEQA 1YXDA 3UETA 3W7DA 1W1IE 4I5RA 1SQ7A 1XG3A 3CAWA 1XLCA 1TVLA 5KEZA 4H2CA 3PZNA 4YIWA 3UWUA 2WLYA 3AS3A 5FIPA 2UY4A 4U5IA 3R8HA 2OEMA 3B9DA 2R1LA 1T8QA 1NAL1 2V2DA 3N6JA 4FEZA 2CHRA 2I5GA 3E0LA 4ATLA 4UFMA 1Q8AA 4EPKA 4RXFA 1JDFA 1LLZA 2Q3OA 2L5HA 5FKYA 3U2CA 4O10A 2NV1A 1LLOA 3W1TA 3MKKA 2W5FA 3K8KA 4E4FA 4AF0B 3DH7A 4QAWA 5CPOA 1WKEA 2ZUSA 3ZLHA 4LV4A 1FH9A 4OWGA 3W1NA 3MBFA 3VK5A 4O11A 5LHEA 1BXNA 4LYPA 1E9ZB 3CYVA 2QIIA 4OECA 1PAMA 3AJ7A 1W5PA 4FLOA 3UZZA 3LRLA 2DFAA 3DG6A 3H24A 3GFZA 5JBDA 3F2BA 1OJXA 3RU6A 4YTQA 4MNKA 4FXFA 3E9AA 1GQKA 4Z0JA 4PCSA 3FKKA 3SSJA 1S1RA 1UOKA 4H9XA 3FDKA 4L9YA 4ZQPA 3SB0A 5F4XA 1HGYA 4O16A 3AXIA 1CGUA 3WMSA 1QRQA 5I23A 3FVDA 4OUEA 4XZIA 5HATA 5CSRA 4H00A 3SAZA 1A5LC 1EHAA 4UR7A 2WVSA 3P61A 3WUEA 4WSHA 4PMNA 1LORA 3CUJA 2QGYA 4QCFA 1RVKA 3WLQA 1SPQA 3W02A 1HUVA 4HA1A 3UGVA 1FWRA 3W24A 4IMFA 5CPNA 3N04A 3DGRA 2FPTA 4WVXA 1HKKA 1EIBA 3RLHA 3PR2A 1QI3A 3RR4A 4Z2HA 1LG1A 2W0UA 4ROQA 3VIOA 4MPQA 3UWWA 3UCDA 1LQAA 1RUSA 2PAJA 3IJ9A 2PWGA 2EEXA 3SFWA 2Q8XA 4AD0A 1W9VA 5A2BA 4TQTA 2Z1VA 1GVEA 2QF8A 4FO4A 3REQA 5HMEA 3CEPA 2E5CA 4DXXA 2QS8A 3N2MA 4DM2A 5DF0A 4AIUA 3WNOA 3E96A 1Z48A 1QT1A 5I3HA 4W7VA 4HYVA 2YA0A 1BKHA 1ZBCA 4ADSA 1XG4A 1YADA 5FJIA 1ISWA 4YU1A 4HN4A 4GYJA 2NXHA 3LU2A 4HOXA 3EOOA 3URAA 5CBJA 3EX1A 4LUSA 3EWCA 4S3DA 1HKJA 3LSBA 5FF3A 3BWWA 4R5EA 4QS5A 2HS8A 5HAOA 2D2JA 1E6SM 3W2JA 1XIHA 3VMPA 3T40A 2Y4SA 5D38A 3CHFA 4EAMA 3F5JA 2QDDA 3LMZA 2Y8UA 3AHZA 1ODUA 2PC4A 1DJYA 3VZZA 4C6JA 5AC5A 1D3GA 2VDGA 2FKPA 3IJIA 1L8PA 1IEWA 3N73A 1BFNA 1UP2A 1ZSXA 4FNPA 3CTLA 4ES4A 1DWHM 3T09A 3NQGA 1SO5A 3H23A 3F4WA 1S5WA 2FLIA 1SO6A 5LIKX 4YTUA 9CGTA 3CAKA 4NSBA 1UOZA 3S5OA 2PDBA 5CSYA 3IGXA 4XAPA 4TUFA 1B90A 3BCFA 8XIMA 5I78A 2IKGA 3U2OA 1C91A 1LQ2A 3NSXA 3LHWA 3KZPA 5FF2A 4WHBA 3G6LA 2V30A 5JIWA 2INZA 3ORWA 4AF0A 4MB4A 1PIGA 3TMQA 5HUOA 5FEXA 3MO7A 4JDYA 4I9TA 1OG0A 1H1ZA 5FJRA 1QPQA 3W75A 4AZHA 4BA0A 3ZT5A 5CSSA 1J10A 3N9RA 1AODA 1FDZA 3D3AA 1A0CA 1HJWA 3QHOA 1EA9C 3FSTA 3QEZA 4JNZA 1KA9F 3HFTA 3GLCA 1R46A 4PR4A 2YFOA 3HFYA 2VENA 5KTLA 1Z8AA 4PMUA 5ABTA 3BANA 3TYCA 5TNVA 2R1PA 2XH2A 3T81A 7PTDA 4KGLA 1PCWA 1EJRC 5EMUA 4RNHA 5K4XA 2VQTA 3DENA 2V3FA 4H2HA 4C1NA 1GKQA 3H70A 3CHVA 3F4VA 3BOLA 3THDA 3FGCB 3VCRA 4B4FA 4UQDA 3GNOA 3GXIA 4QEEA 2TPSA 2G3FA 1S2UA 1GOQA 2PWFA 3TN5A 1UR9A 3HG2A 4IJCA 1D8CA 4MNMA 4XAYA 3VC5A 2QUMA 2FFCA 1H63A 1DJGA 1FKWA 2EPOA 1HGWA 4M19A 3WENA 1JZ4A 1M5WA 1ZP3A 6ALDA 4MJ2A 1OADA 5I24A 1Q6OA 2CZDA 5IBXA 1REQA 2Y70A 4ICNA 1ISYA 1QOQA 4RJEA 2YCIX 5HMDA 4UQAA 4X2RA 4KIEA 1K9EA 3O6AA 5D8ZA 5LHFA 4MKVA 3B06A 2WNWA 4JNYA 1VBHA 1LDCA 4HNNA 2HEJA 4IMEA 3NAVA 2VC5A 3KLKA 1OX5A 2VKZG 4R53A 4QAIA 4P7LA 4D6FA 1QOPA 1KCLA 1OVDA 3QRHA 2CZFA 2OB3A 3NWRA 3ARZA 1SM9A 4YVVA 3W7RA 4EXQA 3QZAA 5CJNA 3GX9A 2EKGA 3W1RA 3MV11 3W3OA 2CZ5A 4GZEA 1S2VA 3C3UA 3OLGA 3L21A 2BXYA 1Q6GA 2J8TA 3H22A 4WK9A 2NWSA 5JBFA 5LNUA 2E5BA 3M46A 3T0DA 1CCWB 4PCTA 2P0OA 3IV3A 3TMLA 3AMGA 1WDQA 5H6HA 1A0EA 4UOQA 1XGZA 5A6TC 4S38A 3URQA 3QKZA 2VFGA 5HWNA 3WUBA 3SFKA 4DZIA 1WDPA 4M8UA 1PZ0A 2DORA 3KDNA 4PYSA 3ERPA 1GVRA 1I4NA 4R85A 4KESA 4PCFA 1KR1A 4O50A 2EPHA 3QYQA 1OFBA 3HA1A 1N8FA 1E3XA 3OBKA 4RV3A 5D2YA 4IPPA 1IEIA 5RUBA 4MKSA 3UGRA 1LUCA 2J88A 4GVFA 1IV8A 3W0KA 1JXKA 4K8HA 3UXDA 3SSZA 1WNOA 3B0XA 1PWMA 2I56A 2Y7EA 1AW5A 3F5LA 3KTSA 3FJ4A 3CH0A 1BF2A 1FWSA 2PCEA 3E0FA 1KRCC 4C6LA 4KWOA 4D6GA 4MZYA 3T8QA 1XPGA 5I03A 1H1YA 3TXZA 1I75A 4JTUA 3V1HA 4UCGA 4OZOA 3AALA 3A47A 1LL4A 3BE7A 3BSHA 3EDJA 4HNUA 1U33A 5H8MA 2OWCA 3VD7A 5FSDC 2GOUA 4HZMA 4IPIA 4H04A 1TTPA 3FX4A 3ITYA 1O5QA 2FJUB 4MTVA 5I3KA 1Y7VA 1GOXA 3WH7A 1UQYA 2WV8A 4PMOA 1FWJC 3TN6A 2WCAA 3TH6A 3GFXA 2Y62A 1V7AA 1TTJA 3VIPA 3FGCA 2RGLA 3M44A 3WLHA 3SN1A 3PZOA 3UVAA 3RX4A 5LGXA 4H01A 4W88A 5A8GA 2TYSA 2XINA 5DMLA 3IIOA 1DYSA 2NZLA 3MI3A 2BHZA 4XD3A 4HHPA 1U5HA 4Q4KA 5DY2A 3VFLA 5HOSA 3VOGA 1GTEA 3AYRA 2ZTJA 2FMNA 4OTKA 2Q8LA 4XO7A 5DRCA 4E2OA 4UFHA 1ZL1A 3S9ZA 3NQ8A 1S2AA 1K02A 3M0LA 5AC7A 4AG0A 1TV5A 2QDEA 3T9PA 2X8RA 1OSEA 2YGYA 3KL0A 1MVYA 5A1AA 2E68A 1N82A 4DPPA 3C0JA 3G0SA 3TYZA 2XISA 1EDQA 4KFNA 3UPWA 1DQXA 3LHTA 4ZO9A 1LWHA 1XS2A 3PJXA 6ENLA 1JPDX 4WJXA 3N14A 3M7WA 3DHUA 3AC0A 5FSEC 2VZOA 1S5MA 3W7KA 4GIRA 3OVQA 3T0CA 3DYMA 2WW5A 2YYTA 2Z24A 1RCOB 1TREA 3PSWA 2WHLA 1QI4A 2BHYA 1MW2A 2G3IA 2I7GA 4NHVA 4W5UA 5E6YA 2R1NA 1EP2A 2PRLA 5HJLA 3TTSA 3RITA 4HSNA 4O0KA 3URBA 1XDJA 4H3DA 3GW0A 2QJJA 1CXFA 5HR6A 1XYAA 1EC8A 3WQDA 1FHVA 4BY3A 3QM3A 2E5DA 1FWGC 2W92A 4J40A 4LNCA 1XH1A 3HPXA 1OC6A 1AJZA 3FEMA 1OX4B 4ATDA 1BPLB 1R3YA 4Y6GA 2GVYA 4LWWA 5A3HA 3VIKA 3NZRA 2O55A 1M7XA 1XICA 4GHRA 4GO8A 1G4EA 3WFAA 1IXNA 1WCGA 1E72M 2WC3A 3LPGA 4EACA 3LCLA 3E2VA 5CH9A 1K03A 3CHDA 1EDGA 3GHRA 3W76A 2NLIA 3IVUA 3E2SA 4OUIA 4ZQNA 3WG6A 1KBKA 2ZBTA 4IPNB 3LTSA 3G0XA 4J7RA 3VI2A 4FNRA 3GG0A 1KFJA 1CDGA 3RMJA 2BVYA 2QYGA 4HA0A 1AH3A 4W9TA 2W6RA 4XZBA 4V33A 2ZZ1A 5G5IA 3P60A 2BFGA 4F2UA 4F8XA 3BK0A 4S3EA 1O95A 4H9MA 3QFEA 2BXVA 3K4WA 2ZRYA 1RP9A 1M65A 1VCGA 1WZKA 3DHPA 2O56A 4LXFA 3W88A 2VGIA 4XZWA 1RALA 1BGGA 3OEXA 2WWDA 3FYYA 2FTYA 4PMJA 2DZPA 3MUY1 4LYKA 5DCBA 2J6VA 2OX4A 3PUOA 1Q7MA 3VGFA 3KVLA 1QW9A 3W1MA 2FVLA 4AZ6A 1QR7A 1VD6A 1A5AA 3FYOA 1E1EA 2ZC8A 4QJ1A 1RY8A 4I5UA 3WBWA 3MT1A 3PUDA 4US5D 4B5VA 4NUWA 4UBPC 4QLLA 1R85A 4HTBA 4LEQA 3MJMA 3RPMA 4FX8A 3MU7A 2XH7A 3APYA 1TVNA 3TQ0A 3ZT6A 3A5FA 2VELA 3CC1A 3RLVA 2O92A 3CNYA 3GG7A 1UKPA 1D2KA 4QDMA 1NU5A 5DCEA 3ZWSA 3KX6A 1JYVA 4G1KA 3AMDA 4U4MA 3B9AA 4XAZA 2C1IA 4LEFA 1KM4A 4L65A 7CGTA 3A9IA 3U7BA 1RY0A 1W17A 3IUIA 5AFDA 3W7CA 3NEVA 3O05A 4DI9A 4MWAD 4K3ZA 1NP2A 3ITXA 1KFBA 1NWTA 4C6IA 1EF2A 4LU0A 4BF9A 3S47A 4ACZB 1J6OA 1UASA 1ITQA 2ASHA 3LPOA 3WJYA 4IGNA 1W32A 5HPOA 1Q13A 2HWGA 3L5AA 3VOJA 1KXTA 3NQAA 1UBSA 2ZRXA 2J66A 3PB0A 4JOMA 3G8EA 3PBVA 1IR1A 1OX4A 2XVPA 1IWPA 2DIKA 4Q7BA 4L4LA 1VBUA 3MBDA 1VJZA 1ZJIA 4AD4A 7ENLA 4HGXA 1DTUA 4LY8A 1OYAA 3SCUA 1RLDA 4Q7IA 3ARQA 4RW3A 4DJFA 3BMWA 1YKWA 2OSYA 3SUUA 2B7NA 1MFVA 3FA5A 3PHAA 1R3RA 4AISA 5HULA 3BAJA 3VIIA 3MSGA 1KGUA 2NQLA 4H8UA 4GNKB 2IUZA 1G9HA 1JEZA 4S3AA 1X1NA 3NL5A 1UZ4A 1DJQA 3W9ZA 2GFTA 1EB3A 4L1GA 1NF0A 4H9VA 4QE4A 5FD0A 2CLKA 2YXXA 4WKAA 3BG3A 4JY9A 3S1UA 1E4LA 4WLCA 1HZYA 2B7PA 3C2RA 4C6NA 8RUCA 3NZ1A 5CSUA 1TZ7A 3HB9A 3GG8A 3NPUA 3ZO9A 1IR2A 3V0SA 3LI0A 1E51A 2Y6ZA 3BLDA 1UIPA 3WDIA 1H4PA 1NFBA 5K3VA 3LCWA 1OZMA 4RE0A 3TU9A 3U2ZA 3O8AA 1TIMA 3RU8X 1H50A 3TA9A 1XISA 3SCRA 2PZ0A 3T2PA 3G8RA 3UWQA 3RRAA 1V02A 2XZ9A 3NIYA 1ICQA 4Z1BA 5C71A 1OCQA 4HJFA 3RLGA 4IIBA 1V3MA 2HISA 3ZR4A 1TJRA 3EPMA 2W91A 3EWYA 4GQRA 3RPDA 4LANA 3BZGA 2VXNA 4TXEA 1XBYA 1FWDC 4K8EA 5TBOA 3DAQA 5I3GA 3UWVA 3WDRA 4FOJA 3A5VA 2AMGA 3CJPA 3M0JA 4HNVA 1C9WA 1UC4A 3ARPA 1J0YA 5BNKA 1JNDA 1V0NA 3TTQA 3MC5A 1B57A 3GU2A 3WLMA 2E3ZA 3B0PA 2OZ8A 3VMNA 2VC9A 1VCFA 1F4AA 4AMCA 4REQB 3MCOA 2HVMA 3T4WA 2J7DA 5HMSA 4ZXLA 3BICA 3P81A 2FQIA 1IEVA 1FWWA 5REQB 4DO7A 4WOQA 3M0YA 4Y9AA 3NUKA 2GGJA 4MSSA 4XK2A 1C3FA 1ZENA 4M80A 5DXYA 4WIWA 4KRTA 1KGWA 1LLWA 1RBOB 4AEEA 5U7SA 2XDFA 1P43A 2I17A 4AW7A 2ZRWA 3LHUA 3TQKA 3UWYA 4ACZA 3FIGA 2NV2A 1KKRA 4WXZA 1Y65A 1YYAA 1OCBA 5BZAA 2YDSA 4M1RA 1BSIA 4XZMX 3RDKA 2HXTA 4HIBA 1SGJA 2YDRA 1QNOA 1H49A 2YKKA 1C7TA 2D20A 2PDHA 2Y5EA 5D30A 1R3TA 1NOUA 3M16A 4C6DA 3BG9A 3SRDA 1GOIA 3A4AA 3V75A 1G4TA 4R7WA 5F2LA 3OQEA 2OCZA 3ES8A 3TQVA 4JTHA 5AHIA 3QC3A 4Y7EA 4KPLA 2A79A 4QDPA 2YR1A 2NUYA 2EJ1A 4GWEA 4PTWA 5K4ZA 1K9FA 1P4CA 3K8MA 2W61A 4AY8A 4X63A 4DF0A 2GGIA 1MQPA 3TJ4A 1QNPA 3R25A 4HPNA 2VZUA 3LI1A 4GI8A 2ZIDA 4DWSD 4IG2B 5BCAA 1ZALA 5CGMA 3BL3A 1BG4A 3C61A 2BS9A 4P61A 4OKDA 1J2BA 1TPFA 5DFAA 4XD5A 4XQ6A 4L6OA 1F7BA 1O66A 2V5KA 3LM7A 4M6PA 1PX4A 1KFCA 1H7PA 4Q8NA 2Y7DA 1JR1A 1Z69A 3OGRA 1J0JA 3AZRA 3VGDA 1JCLA 1XWYA 5AVHA 4ASTA 2ATSA 3L67A 3AOFA 1QPKA 3EB2A 2WZEA 4QLKA 3N2XA 4Q4OA 3ONCA 3BMVA 4DPQA 1ICSA 1YPFA 5EMKA 1V51A 2GSEA 3SCSA 2OO0A 3G1AA 1BVZA 4PB5A 3GYCA 4CNSA 1K3UA 4IFKB 1CT5A 2UV8G 5EFFA 4QX4A 4HU0A 1J5SA 1XCXA 2XYLA 4NU7A 1C9DA 3SGGA 4TTUA 3U4AA 2DUXA 1H3GA 4W84A 3RMEA 3TJXA 1B3ZA 3ICJA 2G3MA 3LXCA 4NZFA 3EXRA 1TA3A 1KRBC 1RLCL 3AIBA 5HDRA 2AOSA 1GG1A 1QWKA 2EO7A 3P7YA 2BP1A 1DWJM 1UUQA 4Z2KA 3O7UA 3S6TA 3PM6A 3HJZA 1PZ1A 3C4UA 3WSUA 3GWQA 2Y63A 1TV3A 1UKQA 1PB0A 3BXWA 4GE8A 3BTNA 4JL2A 9XIMA 1ZBWA 4H4IA 2QCCA 1V0MA 4ZSUA 4CU8A 2DPEA 4REQA 5CCZA 4O13A 4QBXA 4MADA 4LUYA 4P8UA 1Y8BA 3M6DA 1OT1A 4J28A 4IIGA 2FMOA 4NYYA 3N3TA 2WWCA 4NAEB 2R14A 2NX1A 1LBLA 1F6PA 1HKVA 1VJSA 2QJIA 2OQLA 1B9BA 3WLRA 1LYXA 1UR3M 1VEMA 4JX4A 5CC7A 2QCFA 5A8MA 1TPVA 2J77A 2OVLA 4S3GA 5E0CA 3K5XA 1EEXA 2FHBA 4M82A 3P6LA 1ZUAX 3B8TA 3ZXWA 4MHBA 4E8CA 5MKGB 5DBTA 2HXUA 3AXMA 3FJLA 3TDFA 1MEWA 2PDQA 3CV2A 4B5SA 2PDUA 4HMCA 2XH4A 1NDWA 2HPMA 2D0FA 4ZFMA 3VIGA 2PD5A 3IARA 3CV7A 1B54A 4JTRA 3VC6A 4Q33A 1OX6A 3EPNA 2E9MA 3QXBA 1UZDA 5CG0A 2Y8KA 1WQ5A 3M5YA 1MWOA 2DH2A 3P93A 4LAUA 1NF7A 1KWKA 1VP5A 3T4CA 2CETA 1A80A 1ECEA 1SZRA 1TX2A 1LM1A 1OBAA 1DWFM 1BQGA 4AU0A 3VNMA 1XKJA 4JQ3A 2OOGA 1UKOA 2XG9A 1JGMA 1ME9A 4PUNA 4F9DA 1A5OC 3MDUA 4XZ9A 4GQ0A 4IG2A 1SYTA 2WZIA 4YCOA 5LXXA 2NQ9A 4AY7A 4B90A 2HPIA 3I3EA 1XV8A 2ZZ5A 3A3WA 4MJ4A 3YPIA 1D7FA 3A23A 4AH7A 3EX2A 1M01A 4DUXA 4UNKA 5CPQA 3BQ5A 1ITXA 1GUVA 5F2MA 5IDZA 3BGJA 3PF3A 1T0OA 4RZ5A 4UR9A 1J0HA 4HNLA 1RQEA 1DJNA 2WAGA 1GGOA 3NG3A 2ZUUA 3S46A 4ZBCA 4F48A 2XM2A 1CGTA 5EMLA 1UYQA 3KRZA 1AD1A 4DQWA 3GR8A 4AVFA 3L4WA 4J3VA 1ZCCA 1EGMA 4D72A 2WCSA 4IFKA 3R58A 4AXKA 1WP6A 1R7AA 3B03A 5ABFA 4Z17A 1HW6A 3AHVA 3G77A 4PMQA 2PP0A 4HPJA 2OXNA 4V1XA 2IXUA 2BLEA 4FXSA 4BI7A 1JYXA 4HTYA 1XUUA 4LV9A 3WUGA 4N9EA 4J5NA 4TX6A 1PDYA 3GUGA 2CERA 3CQHA 4GRSA 3NVTA 2O4MA 4I7VA 5D4YA 3LQGA 4DWDA 3LLXA 1JIBA 3R0UA 5DEZA 2WLZA 1VEPA 2V9DA 2KAUC 3O6CA 3P74A 1Z6KA 3ZJKA 2YL5A 1A3HA 4DHGA 4IQJA 4IIEA 3E0WA 3QPEA 1WUFA 1G4PA 2A1YA 1V6UA 4Z1YA 5FI8A 3ZSSA 2JEPA 4JR5A 1E0TA 3NO3A 2IKJA 3T6CA 3FXYA 3B8WA 1E4NA 1KGXA 4M5PA 1A5NC 1DE5A 8CGTA 2J79A 4WY0B 2OSWA 5HK4A 4C7DA 2CBIA 4XZLX 4GC4A 1UH2A 2DSWA 2ATMA 4JEQA 4B91A 5BMXA 1LCOA 4NAEA 4ZQOA 2WM0A 1WKYA 1DJZA 1I60A 2ZRVA 2XIIA 3TC3A 5BXTA 3VOIA 3EDFA 3TW6A 2D69A 1G69A 3H53A 3ZJ7A 2I9EA 1KXHA 1XRFA 4WX2A 5AN7A 3WLLA 4JTJA 2BNJA 3L4ZA 2PI6A 3POCA 3WQ5A 2ZKMX 4J27A 2BOFX 3R89A 4MOZA 3VOCA 2FYMA 3L0GA 1M04A 4UCFA 4E6MA 2X1TA 2QV5A 1ESWA 1B30A 1VIWA 4MY1A 5HJYA 2J62A 4OIFA 3GNDA 3KBNA 4UTLA 3WF3A 5CEWA 1W9DM 3LTPA 2DT3A 1R87A 4CKQA 2NVAA 3Q94A 3ELFA 3PZVA 1RR2A 3PJTA 4WDXA 4KCUA 1H7OA 3CHEA 3KFTA 4IUOA 3PG9A 1CLVA 1IQ8A 4H41A 3MCNA 3OW1A 4GUIA 4IWWA 1ZLPA 3WMLA 3KL5A 5DN1A 1XYMA 3L12A 2VEIA 1YBQA 4JFWA 3S4TA 4WD0A 4UNIA 3T42A 1XHGA 3T0TA 5I00A 4JCLA 4GI9A 4Y9OA 2VZSA 3AIEA 2XUCA 6CGTA 3KCJA 4JY8A 4HCDA 4MZ8A 2R1MA 3WY1A 4LYQA 3E5PA 3BJFA 4MUPA 2FB3A 3BURA 1MYRA 5A6LA 1TUXA 1JD9A 3LN3A 3W73A 3AMKA 2BTMA 2CBJA 2GJXB 4MKNA 3E2RA 1BWLA 1LBMA 3MKCA 3LPPA 4JICA 4Q6XA 3MVTA 1R5YA 1QUMA 4GPNA 3QR3A 3SUTA 5DT5A 1W54A 4L64A 5AB3A 4Q4PA 2Y0FA 4RX0A 2B0MA 3PTQA 2EG8A 4PMVA 1XLFA 3CPUA 2OQHA 4F0RA 1ALDA 1RH9A 3NQMA 3HQ1A 3W28A 4DJED 4M1BA 4DO6A 3QV9A 4FMVA 4NRRA 4PULA 5M2FX 3VINA 1X39A 1RD6A 1BSLA 2A85A 3TLLA 1KCKA 1QNVA 3TTOA 4Q8UA 3FK4A 2W27A 1ZAJA 4LUIA 5LNSA 2V2HA 4BQ2A 1ONRA 2REQB 3EOUA 3M9YA 2WKLA 1M53A 5LXEA 3WDQA 1UWUA 4CQCA 1J93A 5C5YA 4BCEA 1V08A 1W3HA 3U5YA 1G67A 5KITA 4X60A 2D24A 3W6LA 1WOAA 3VKCA 4CQAA 3U6WA 1QTWA 4MWAC 3GU9A 3KBVA 3KTCA 1EOMA 3JR2A 4QSHA 1IGWA 2E28A 2C1HA 3JVAA 2WSRA 4DBUA 1J4EA 1XD0A 2WBGA 2R94A 3HMJG 4FNSA 3B9EA 3BLOA 1H61A 5CZJA 4HA3A 1TV8A 1X96A 5AECA 3I4EA 1QNQA 3ITOA 3B9OA 4GH3A 1HO1A 4DUVA 1VIZA 4MY9A 4PUEA 1ME8A 1YHTA 2GWGA 1KM3A 2GVLA 2QHAA 2ZA3A 3G1RA 4PEEA 3MI6A 1KM5A 2BXZA 2P3ZA 2FDSA 7TIMA 3KCOA 4UTKA 2QUTA 2O7QA 4B2DD 4PCNA 4BWLA 3ZSTA 1E1FA 4O57A 5CAHA 4GY0A 2WMJA 4NASA 3QY8A 3DFYA 3KP0A 3U8GA 4FOKA 3QR1A 1JNEA 2RJGA 3G5EA 3VUPA 3NM3A 1V6VA 3LNMA 4O1DA 1U1HA 2F6UA 1ZB5A 3P3BA 1M1BA 3DEQA 4W8BA 1VYSX 2CLOA 4HNCA 1W8GA 3ZZ1A 4CD5A 2OU4A 1KXVA 2ZXQA 1MMFA 1TJPA 1W3LA 2DQWA 4JQ4A 4J3UA 4MVAA 1CXHA 1ZU8A 4JFSA 5DXXA 1KM6A 4YNGA 1DVJA 4ZE5A 1NQ6A 4B5TA 1GJPA 1MXSA 2QW5A 3CHCA 3DHDA 2WJFA 3W70A 4O28A 5EB8A 3M64A 4BI6A 3QKEA 4LAZA 1ZS2A 1GPWA 4IXHA 5CC6A 1EYEA 1KXQA 1SZGA 1OFAA 1O1HA 2ADAA 1THFD 4ALDA 5HQEA 1LG2A 4JTCA 1U2YA 2GDQA 2AL2B 4HYWA 2YYUA 3O06A 3EOEA 1CXIA 1SJDA 2Q02A 4GY1A 5C55A 2C15A 2P8CA 1EF3A 3HMCA 2XGIA 3OLDA 2CKSA 4GNVA 1XC4A 5AY7A 4D8ZA 4WZHA 2ZADA 3A6OA 4FALA 4ORMA 3I3DA 3NM1A 3AHXA 3GC4A 4NYUA 2E1WA 1DXFA 1LT7A 2GUUA 3TZFA 2HMCA 4LAKA 3TK7A 4CVUA 3QPZA 1SU5A 4PSPA 4X22A 1DJIA 2V8ZA 3NQVA 2J7BA 2EBNA 3A12A 3GU1A 1T99A 2VEPA 3EX3A 4KFPA 2E09A 3O1NA 3WLPA 1CW2A 3TXVA 3G18A 1U83A 3PP7A 1UZHA 5D37A 2ZVIA 1YIXA 1AJ2A 1VJIA 1W1TA 4PTDA 3W82A 1PVNA 4P2VA 3N25A 1V79A 1H60A 3B0VC 3EMCA 1FWFC 2V68A 1GT8A 3OGVA 1YDNA 1YNQA 2WM1A 4A4AA 3NPWA 1JFXA 1DBTA 4ZTYA 1FWTA 1WZLA 1E0WA 1N7KA 1KFEA 3B8SA 1F74A 4C5YA 1FFRA 1NDVA 1WDRA 5D04C 3SN4A 4HSOA 5HMFA 4D6EA 1GOOA 2Y1HA 4JL1A 3ZMRA 1ELSA 3W1XA 4XUYA 1UKSA 1U5VA 3QV6A 4L6DA 3PZUA 4S3FA 2DIEA 1EO5A 1AG1O 5M3WA 4UFLA 1UD2A 3KOFA 3BLFA 3WK2A 3T78A 2I14A 3WD2A 1F2JA 3QR0A 4AZBA 3OOQA 2Z0IA 3NDYA 1JDAA 3AU2A 2F8QA 2ONEA 3VGBA 1XIDA 5CPTA 1LWJA 3QHNA 3UNDA 3WO8A 5HQMA 1BYCA 1PS9A 3CS2A 2W62A 4BZYA 4U10A 1Q63A 1BKSA 1OIMA 3C2VA 1DJXA 3QC0A 2H9AB 2INFA 1AW1A 3NURA 4Q8VA 1F6YA 4MG4A 3EWDA 3OPSA 3W87A 3KRSA 4IX2A 5C9XA 2QV4A 4PSRA 1J9YA 4K37A 3KAOA 4C7FA 1YQ2A 4C1LA 1HKIA 1PEZA 2DSVA 1C8YA 2DEPA 2J47A 4DWSC 3OB8A 3GC5A 4FB7A 1SW7A 1F61A 3NQFA 4AMAA 2AGKA 4YTTA 3ZJ8A 4HMEA 2EAWA 4AZCA 3L9CA 1SR9A 3ZWTA 3TTYA 3MA8A 3SCPA 2J7FA 2R9RA 3LD5A 1C8XA 1XLHA 1B1YA 2JF6A 6TIMA 2GQ3A 1IZJA 3HJEA 2IPGA 3UBPC 3HURA 1E9LA 3MYOA 3B4UA 2WYSA 4RW5A 1UPMB 2ALRA 3ITGA 3S1GA 1XIEA 4UNLA 2NSOA 1MDLA 4GYFA 4GUJA 1EKOA 3DBPA 3GVQA 3IJ8A 5IM51 3CL7A 3LTYA 3UA4A 3PNZA 2OTDA 3UZ5A 4OV4A 1GKPA 2XFFA 1IE7C 1NWSA 4HB7A 3WLIA 3GRIA 2VHLA 4LUTA 2ICSA 3CUGA 3UESA 3FW6A 4H8NA 2OPJA 4CNPA 1SVDA 4O0ZA 4LVDA 4V15A 2MNRA 3H4WA 1TPC1 4JPGA 2PGFA 5D9OA 1NWRA 3THUA 5D9PA 3W85A 2D2HA 2RKXA 4F3HA 4IMCA 4MJMA 4XD4A 1KD0A 1V6YA 3QMRA 4PL1A 1QFEA 1K9DA 1HKWA 3S9IA 4PMRA 1WUEA 2F6XA 1V4YA 4OV9A 3A3XA 1TZ9A 3E02A 2J7EA 4DZ5A 3CQKA 2QPXA 4FNQA 1W3TA 4U2ZA 4CNNA 3G24A 1L6GA 4F40A 1X1ZA 4ZOCA 1YW1A 5K9DA 4R27A 2DY3A 4HNOA 1UROA 2X1IA 3BCDA 3CL8A 1B3YA 1UWQA 3V0UA 2J6XA 2I57A 1WPCA 3UJEA 4MWAA 2GDUA 3NPVA 3KVMA 3B4YA 4PCPA 1NJJA 2PDWA 2ACQA 3S2NA 4CCZA 3WCZA 5G4HC 4H6QA 5XIMA 3EPOA 1ZP4A 1CB7B 3M7SA 1LRNA 1XRSA 3TONA 1WX0A 2G8ZA 3EGJA 2WPGA 2C18A 3C2YA 3G1YA 3IRSA 3WZ0E 2V67A 3HU7A 1UP0A 5FJPA 3H2NA 1CXEA 1Q2RA 2RDWA 1XYZA 5GNXA 4NAFB 1O68A 4GMEA 3NNTA 3C2FA 2OGYA 4CCCA 3D5HA 5FJJA 2PRMA 5AKQA 1VRDA 2PU0A 1TJ2A 2X7WA 1TRIA 1W9UA 1QPOA 1TVPA 2VEFA 1A5UA 4Z2LA 1V93A 2WQDA 1M6JA 3MMUA 1XGEA 4K38A 4GKLA 4LW7A 2OLHA 2OKTA 1JAEA 2VGFA 4JCMA 4GA8A 4FI4A 3VD3A 3CWOX 1LL7A 4QE1A 4HZ6A 2QJNA 3GIPA 4GIAA 4DXVA 3S3GA 1Q2SA 3IIPA 1BD0A 3ZLGA 1V6TA 2UZ9A 3GAKA 4WY0F 2J9ZA 1V02E 2GSHA 3CIWA 4MAVA 1K7FA 1TFVA 2D0GA 1XC6A 2AMXA 5M17A 1XYLA 3ISIX 1W5OA 5A6BD 4CNUA 1XCFA 4MB1A 1O7AA 4NL1A 3N18A 4U3AA 4CQ8A 5FJTA 2KZHA 4LH8A 1X38A 3IIZA 1H7WA 2IXVA 4YVPA 4AAJA 4M3PA 7TAAA 4I9MA 1W3IA 3L4UA 2ESCA 3EBVA 2B81A 1HJVA 2CLLA 1HTIA 2PWEA 4HU4A 3P80A 1NTHA 3W27A 2XFYA 2WMFA 4HK5A 3F2CA 4J2MA 4HHLA 1IT8A 3DERA 1JG9A 1M03A 1XSIA 4LUJA 5I02A 1KQYA 4O8RA 1JDEA 1TR9A 4YWIA 3UWEA 2ACRA 3FFSA 4QHRA 3EA2A 1K6WA 3AWOA 3QW4B 3NXLA 2FZBA 4J3TA 1R2RA 3EX6A 1MZRA 3GH4A 4ZZ9A 2P76A 3V5CA 3FNDA 2VOTA 4B92A 3W38A 3D6NA 5AHFA 2G3NA 4LB4A 2IW0A 1Q6RA 2PE4A 3CWNA 3GD6A 2I9UA 1Z41A 3TEVA 2AAAA 4S23A 1F5ZA 5DO8A 3RCYA 3D46A 1GYLA 3WQFA 3WEOA 2DP3A 1L9WA 3MUXA 3WDHA 2WHJA 1F6KA 3MJYA 4QNWA 2WKJA 2ZE3A 3RCMA 1FKXA 3NQBA 2VM8A 2QPUA 4U2YA 3WH8A 4BK9A 2YCLB 4XVDA 4UMCA 4DN1A 1GVYA 3FHAA 4ZXOA 3RAOA 4YVXA 2WQPA 2FGBA 4WDUA 4FOUA 2ALDA 1DIKA 2HV5A 4XSLA 2WMGA 1Y0EA 4XAGA 1Q4NX 4YWSA 3CMFA 5BRQA 5C7HA 7ODCA 4GI4A 1RJPA 4N42A 1G94A 3LENA 1P6CA 3ALGA 5D09A 3IS4A 2YBUA 2FGLA 3MW7A 3O0FA 3W86A 3VZXA 3EZ4A 3LGEA 3H2OA 3NQ2A 1ZAIA 1YEYA 2PWVA 1HJXA 1A4MA 1SJCA 1TTQA 2WMIB 1GQIA 1LZOA 1RPKA 3R10A 4YXGA 4DBDA 1P1XA 4DWSA 3R43A 4RKAA 4NNCA 3N4FA 1DXIA 3FXGA 4E3TA 4L80A 3KHDA 5HBFA 2XSAA 3PB2A 1E5NA 3QW3A 2DSKA 2OMAA 3UU0A 2Y7GA 4AD2A 3OZPA 3GYEA 4QQ3A 5G2HA 5CZTA 1HJQA 4JIRA 2Y7FA 1OGSA 1Q6CA 1RSCA 1HNYA 3UR7A 4GABA 2A3EA 4JTGA 4JHOA 3ZOAA 2PWHA 1W5MA 2DDXA 3HV8A 3SCNA 4AD3A 1BYDA 3SGUA 1OB0A 1E4MM 3H54A 1EX5A 4DI8A 1MUMA 1V0LA 5BWAA 3QYSA 3DFNA 2IMRA 4QS6A 5IHRA 4QQUA 3PBWA 3CUHA 3OLEA 4HZ8A 3E12A 2WANA 4UFKA 3HZ3A 3M0KA 1XLLA 3V7PA 4KKXA 2GK1B 2QMKA 2HSAA 4AHOA 2JBMA 5C2GA 1JDCA 3ABQA 2O9OA 5HWJA 3EAUA 4Q4RA 1PKMA 3EA3A 4AVOA 3QGAC 1XLEA 1DOSA 4GYKA 2A3CA 3BW2A 3GNRA 3PZIA 1SZFA 2SFPA 3HGJA 4JD4A 1H09A 5L9FA 3NQ7A 2PU1A 5C9WA 4H6RA 2CESA 4NI3A 3VOFA 2GQ9A 3A3HA 1TELA 4DJEC 3QJAA 2QCLA 4GJIA 4MNLA 1D7KA 3L66A 4EF9A 2YL8A 1I0DA 4MAZA 4RCXA 2RDXA 5LGZA 1YNYA 3AIUA 5LA0A 1F73A 4YHGA 2A4AA 5AYXA 4KFOA 4AWUA 1SFJA 1OIFA 2Z2UA 5D03A 3U2EA 1K4HA 1R47A 1BYBA 3GK0A 3IJLA 1UUOA 1GZ1A 2Y5SA 4IMGA 1A3WA 2E77A 1W2PA 1JQXA 1UZ1A 4DF1A 4LRTA 2TRSA 4EIVA 1US0A 7XIMA 4GCAA 4Q8TA 4O53A 4NI8A 2Y61A 3W7LA 3WLOA 1X6NA 3GNXA 5DX7A 4V2XA 4PUJA 1QWGA 3HPFA 3ABSA 3QFWA 3CPGA 4WQ6A 1L6FA 5U4NA 1XW8A 3OA3A 3DKJA 1ZGDA 4J35A 5G1MA 1XM3A 4HYRA 3AO0A 3NSNA 2FVKA 1Q6EA 2J24A 3SZ8A 1NFPA 4R9XA 3MP3A 1W3KA 3PTDA 3CUZA 3C86A 1W2VA 2HE5A 2CBVA 3I7SA 2VFEA 2Q3RA 4C6KA 2OEKA 7REQB 4OHQA 3MWAA 3FYPA 1JCMP 4UXDA 3SRKA 1R9XA 4W7UA 3IK2A 2HRWA 4UMBA 1XLBA 2PP1A 1HFBA 1O1ZA 1OGGA 2VYOA 1VRXA 4D9PA 2ZXAA 4O14A 5F4WA 1J2WA 4CGTA 2PLKA 4KT2A 1TJ1A 4JTLA 3N12A 4UQ9A 2J8FA 3BQ6A 2EG7A 1BRLB 5A2CA 4RUBA 4XWUA 2PD9A 2XN1A 1W8SA 4ADUA 3W25A 3VYLA 1R3QA 4DUOA 2QJMA 1K8XA 5JU6A 4WSKA 1GOWA 5AZ0A 5DMYA 3QGVA 3DOPA 4UFIA 4LS1A 3SO7A 5FEPA 1P7TB 2XJ7A 1LBFA 5H8PA 4LFYA 1JAKA 3NR0A 3VKJA 2C6QA 3M47A 3EWWA 3C6CA 4GQQA 4GJJA 4O1CA 3O2LA 3KCLA 2V3DA 2XIBA 2PEVA 5XIAA 3L5MA 4C6CA 1Q6QA 4MYXA 2CWXA 3ZIZA 3CYJA 1RK6A 1LTDA 3TC7A 1M68A 1DL3A 3VILA 4EWND 2Q8ZA 3RM9A 3CZ8A 3QV7A 1QU4A 3WQCA 4L1XA 4XV0A 4D6IA 3NEHA 3WBAA 5G1YA 4F2TA 3KM8A 3KL3A 4CNOA 3OODA 4L1WA 3I3BA 4XB3A 1TR1A 1GYNA 2BHUA 3FJNA 4AZ5A 4ZENA 4W5ZA 5BOOA 1SZEA 1YDVA 3MSYA 4E2VA 3W07A 1XLKA 4JYEA 3N2TA 1E71M 3F1QA 2BY0A 4H6KA 1EC9A 4YL2A 2YDAA 2OZTA 4A21A 1JUBA 5BOEA 1LWIA 3QY7A 2ISSA 4FLQA 1OFRA 3ITLA 4QROA 1H62A 1GZGA 4G7EA 3UXAA 1BG9A 2FHFA 2FH6A 4B5XA 3GE7A 2ZUMA 3CK5A 4U28A 4LALA 2ZQ0A 3C56A 2GWNA 3W84A 1T5AA 1XQKA 2FPVA 3IUDA 3MV01 4BF7A 1W3JA 5GNZA 4Y9PA 3CUIA 3GHSA 4E2DA 2BB0A 4RDVA 3LQLA 1BYAA 3DFSA 2HCVA 3WQ8A 3Q2DA 4P8VA 2A2IA 3V4BA 2QAPA 4MM1A 4W93A 2UY2A 3VAVA 3OGSA 1UJQA 2QCDA 2XVNA 4PUWA 5TAOA 1ZY9A 3MI2A 4WOZA 3BVJA 4O12A 3CGTA 3R8RA 2EGZA 2IPFA 5JVLA 1VFTA 4Z1CA 2VR2A 1SW3A 1EFZA 4JN8A 4LC6A 2QR6A 1UD5A 4XAFA 5LKYA 3BMXA 4LF1A 3SN0A 5FJOA 2WB5A 1FOBA 2VX7A 3H55A 1JCTA 4FP1A 2NXGA 4HN8A 3V3WA 1DKWA 3OVPA 4ICMA 4KEZA 1IIHA 3E49A 2BOEX 1H7XA 2BGSA 1A50A 4L61A 3ZVIA 4HCHA 2C1GA 1G6CA 3LM3A 3EA1A 1CGWA 2UBPC 4TMCA 4FLRA 2J7CA 4QLJA 3WJZA 5DMMA 4C60A 3L23A 4MF4A 1JYNA 2XIOA 2NW0A 3MMDA 3B40A 1W1ZA 1KRMA 4FHAA 2PGRA 3GDRA 3KRUA 5M1TA 4G1NA 5EMJA 4H9YA 4XKYA 2WJDA 1RQBA 1KV5A 2WC4A 1MW1A 3RXZA 2XWEA 5ECUA 5CG7A 1QHPA 3CMJA 3EB4A 5I07A 1FP8A 5KSWA 3OBEA 3OYZA 2OKOA 2DIJA 2FTWA 3RHGA 3W37A 2FZ9A 2Q6ZA 4DJEA 3VD4A 2YLLA 3BAKA 3ZLFA 4RPQA 3T55A 1DJWA 3BSGA 2O9RA 2XIJA 2GGGA 3MPGA 3GH5A 2VFFA 2F9RA 4D8LA 3W7IA 5A5WA 5IRPA 3CZGA 2VOMA 4ZVJA 1K8ZA 2G4JA 1E9IA 1GQJA 2VR4A 1I45A 3L65A 1X7FA 3TLQA 4W8LA 3W7OA 3GM8A 3SCQA 1DIOA 1U5JA 2XHYA 1FTXA 2E6AA 2VRJA 2P1FA 1EUNA 1QJWA 1KM2A 3G1XA 3QLLA 2XN0A 5E70A 3KEHA 5CPMA 3RO6A 4HJWA 5JXQA 4W85A 1P1MA 5D32A 3STEA 3L5LA 4H8VA 4MZ1A 2GZXA 5CQ1A 3VNJA 4CD4A 1ZHAA 3C0LA 3Q67A 4KRUA 4K8GA 1F76A 1PCKA 3G6MA 1O94A 5BW6A 4UMAA 3HPSA 4DYEA 4GGBA 1CGXA 1XX1A 2H90A 3S2JA 2Y24A 3S1XA 4PMXA 3M07A 5ABHA 4IUGA 4U3CA 3GG1A 4JTEA 3FY1A 4Z08A 4IXXA 4CQBA 4R3UA 3NL6A 4M0XA 1D8WA 3TW9A 3WQEA 4GXMA 2IKIA 4B2DA 1S2TA 2DZBA 2WC7A 3H2AA 4QFUA 2LLEA 4F4RA 4MLRA 1JRCA 3Q65A 4S2BA 5TIMA 1B4EA 1E6ZA 4S3BA 3MYPA 3HG4A 2RAGA 5K7JA 3WEZA 1BXCA 1JCJA 3BG5A 1UD4A 4GBUA 5D2VA 3KZSA 3URNA 5CAKA 1H0GA 1Q66A 4EPDC 4CQDA 2BG5A 3W6MA 4PUKA 3H2CA 1FCVA 3O15A</