1UMYA

Bhmt from rat liver
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
389
structure length
374
Chain Sequence
b'KRGILERLNAGEVVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASSGQKVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKIFHQQLEVFMKKNVDFLIAEYFEHVEEAVWAVEALKTSGKPIAATMCIGPEGDLHGVSPGECAVRLVKAGAAIVGVNCHFDPSTSLQTIKLMKEGLEAARLKAYLMSQPLAYHTPDCGKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWIRARARKEYWQNLRIASGRPYNPSMSKPDAWGVTKGAAELMQQKEATTEQQLRALF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Betaine--homocysteine S-methyltransferase 1
publication title Crystal structure of rat liver betaine homocysteine s-methyltransferase reveals new oligomerization features and conformational changes upon substrate binding.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 124
structure length 374
sequence length 389
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.5: Betaine--homocysteine S-methyltransferase.
pdb deposition date 2003-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02574 S-methyl_trans Homocysteine S-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.330 Alpha Beta Alpha-Beta Barrel TIM Barrel Homocysteine-binding-like domain 1umyA00
4M3PA 5DMLA 1Q8AA 1LT7A 1Q85A 1Q7QA 1Q7MA 1Q7ZA 5DMMA 1LT8A 1Q8JA 3BOLA 5DMNA 3BOFA 1UMYA 4CCZA
chains in the Genus database with same CATH superfamily
3SRDA 3AHXA 1W2PA 4JQAA 1LDCA 3L4WA 1MEWA 3SECA 3EGJA 2EKCA 2GGHA 4XUGA 2ALDA 3OZYA 3THDA 2O0TA 2QNEA 2Z6IA 5BRPA 2QCLA 2XWEA 2CHRA 3UY7A 1W5OA 1UA3A 4F9DA 4JTHA 3E02A 3PBGA 4IGMA 4MJMA 2R6OA 3UG4A 3VIGA 1GTEA 1XLJA 1NJJA 4PGLA 3W6LA 2P88A 3IJ9A 1W5NA 4S3EA 4XB3A 1R87A 2NZLA 3AYVA 4R7OA 5I78A 2BY1A 1WDPA 3EDDA 4X3ZA 1QNSA 3TAOA 5M1TA 4LBSA 5D2TA 3GZAA 1W8GA 4DB7A 4R27A 2UBPC 1HT6A 4FZIA 4HNOA 1UR4A 2RHGA 4D8LA 2Y6ZA 5IFPA 3T44A 2ACSA 3CHEA 3INPA 3E0LA 1IWAA 1GVRA 1S39A 4UCGA 2QMJA 4FO4A 2QF8A 5FEXA 2JBMA 3QHOA 2C1IA 1ZHAA 1JNEA 1EL3A 4RJEA 1K77A 1Q6CA 2GSJA 1RZMA 1M9HA 1KM0A 2CZ5A 3TTYA 3DI1A 1Q4WA 1J0HA 4D9PA 1UKPA 3E2VA 1W17A 3UBPC 3WBXA 3WCZA 1U5JA 3P5ZA 1WAUA 4O52A 3ZR5A 2QIIA 4YTSA 3QRHA 1YTKA 2ZA1A 5FSDC 1MQQA 7ENLA 1GTHA 4ZO8A 1R7AA 1UPMB 3CIXA 4X60A 3MUY1 3FLUA 3QLDA 1FH7A 2V3EA 1AW2A 2Y8VA 3SJ3A 1IYXA 2V5BA 3QPYA 3MHFA 4JTLA 3FVDA 2G37A 1XIJA 1MFVA 4JN6A 5IBXA 3I7QA 3W81A 5E1QA 4QG6A 3FW6A 3V0SA 3F4WA 2HS6A 4AC1X 5LHEA 4IPLA 3GW3A 3V5FA 1Z89A 3HMCA 1ZBWA 3E2QA 3QC3A 3R25A 3LCHA 2J74A 2W61A 1UHVA 3ZJ8A 4L4LA 4WK9A 3IJ7A 1G6CA 2AOSA 5F2GA 4LPCA 3FNDA 1YLVA 1OYAA 3N34A 3PF3A 4NL1A 1Z48A 2BXYA 1O66A 2C3ZA 2AL1A 3GFZA 4Z2LA 4ZO6A 3T4CA 3N2CA 4NI8A 3S6OA 3N73A 4HOZA 3TROA 4UFKA 2DT3A 4RDVA 1EYWA 3TAKA 4XIMA 1RQEA 2EJAA 2YR1A 3ITGA 2PAJA 5C9ZA 3W27A 4CD8A 1DHPA 1SFSA 4GXMA 5AHLA 5I0DA 1XRVA 1EUAA 1OG0A 1JYNA 2GJRA 3W22A 1I0DA 2HE5A 1Q7QA 1F6YA 4FIQA 1VYPX 3A5FA 1EJSC 1E4IA 3RK8A 3ITXA 3QEZA 4I5RA 1HJUA 1NWUA 3OLDA 2ADAA 4S3BA 2EPOA 3DBPA 3NPVA 3UPMA 4CU6A 3MI2A 4XBKA 4L61A 3H12A 1SFLA 2VJXA 1UWQA 7A3HA 1TELA 3LRMA 1CGXA 1JEZA 2C0AA 4OBRA 1W1PA 1WX0A 3VZYA 2V5DA 4NZ1A 4Q8TA 1V02E 2X05A 7REQB 1JDAA 5I00A 4AQLA 2EQDA 4PA8A 4F4RA 3KP1A 3SRKA 2OYMA 3R5EA 1GOOA 3SCUA 2NQLA 1Y8BA 3R89A 3RUBL 1FKXA 4C65A 4E8GA 2I16A 2J7EA 1OYCA 2G3MA 3C2VA 2PWGA 1VJIA 2X7VA 1PKMA 1E1CA 1Y5VA 3TJ4A 2RDTA 4MYAA 5D38A 2XIQA 2CXGA 3LBCA 2WYSA 3ARWA 5IHSA 3E49A 2OZ0A 5BXTA 4NZFA 4FP1A 4JHMA 1QBAA 3W7LA 3RR1A 2O56A 3PUGA 1TPFA 3NEHA 2NX1A 1EA0A 3G0SA 3LXBA 1KCLA 2H90A 3IK4A 3C0SA 5M17A 1HL8A 4BZYA 3WK2A 4GIEA 3S5OA 3TZNA 4ZENA 1VCFA 4YPJA 2VZTA 5HQEA 1J0IA 3BICA 5A94A 1WKFA 3UXIA 1G4SA 3ATYA 3W1LA 1QXLA 4EAMA 4XZ9A 1XIHA 2UY5A 2BG5A 2POTA 4AEFA 1XIMA 3QR1A 3XINA 4CKQA 1F7BA 3C61A 1ZGDA 1L6WA 5CPOA 4AH7A 3N18A 1PZ2A 1RJPA 5CZTA 1IGSA 4PTWA 1EF3A 3WH8A 3TTOA 1JQXA 5FKYA 3WNPA 2GVYA 2A3EA 3KBVA 1Q6DA 3AMKA 4GCXA 2VQTA 5BZAA 4Z2KA 3A9BA 4WRHA 1NOUA 3M7WA 5LNVA 1QOXA 2Y4SA 4N7QA 1EGMA 1XX1A 2QMKA 1TMQA 4FOJA 3LPPA 2C91A 4TX6A 2G95A 1OF8A 3NQAA 4DVOA 5DCDA 1B57A 1TO3A 3W7OA 1KLYA 5FIPA 2GVGA 4JQ4A 5JU6A 3CUGA 5KINA 2FH8A 2E9BA 4H04A 5HNNA 3LSBA 2YB4A 1Q65A 1ODZA 1HJVA 4JYEA 2VFDA 3CQKA 5AZ0A 2Q01A 2GVEA 3KRUA 3TLLA 2PD5A 3BW4A 2ABAA 3F7JA 1C8XA 3MMWA 3VZXA 3BV7A 4ZTXA 2WSRA 1T5AA 2IS7A 4Q33A 3LENA 2NLIA 4E5TA 4UXDA 2X0SA 4IP7A 4G5DA 3SY5A 3C0LA 1EOKA 1LUCA 4JPGA 3HQ1A 5EKYA 4B4FA 3ZLHA 1E9YB 3PZGA 2ZCGA 3IJ6A 2VVNA 2ZUUA 2DIJA 3A23A 5CPNA 4LJ3A 4L65A 1CWYA 4F2UA 4PTXA 3N4AA 5LGXA 2EJ1A 5C9UA 1ZCOA 1RPXA 1ITUA 5T26A 1P0EA 3ITLA 4JTSA 3KBSA 1KRAC 3BLKA 4UNIA 4OUEA 1FXQA 4O13A 3HPFA 1ZJAA 4AVNA 2NSXA 4XD5A 3V7PA 1JDFA 1XS2A 2ZFAA 5LXEA 2GDQA 1UD5A 3E6EA 3VFLA 4ACZB 2YDAA 3D46A 4DBUA 5SWUA 2XUCA 2VEMA 3MP3A 3S6DA 4HBKA 4BI5A 2Y8UA 5DRIA 4HCHA 1PBGA 1ZNNA 2PP3A 5D2YA 4K8EA 1KBIA 1HX0A 2VX5A 3WNMA 1KV8A 2QVNA 4FB7A 2RUSA 1XLGA 4CVUA 2Y89A 3ABRA 5A6BD 4IQEA 1JZ2A 1WXYA 3RX4A 4O8AA 3M44A 3U7BA 1R5YA 3FEMA 2BB0A 3PNZA 3M41A 1C7SA 3BAJA 1GJPA 3S1GA 1NIUA 2O55A 3BSMA 3FAWA 1ZLPA 3OBAA 3T0DA 2H8ZA 4JN7A 2BY3A 3AIEA 3SBFA 1FFRA 3MSDA 3FHAA 3VOGA 1T41A 2VD9A 3ZFHA 4F2BA 5FOOA 4AIUA 4TMCA 1I4NA 2A0NA 4K1WA 1ZAJA 2YA0A 5DBTA 3FX4A 4HNUA 4G7EB 3ZR4A 4IT1A 2H3DA 4QJ5B 3STEA 4HSHA 5AC5A 4H6QA 1H63A 4D71A 4IUGA 3TWAA 5M03A 3VX0A 3WLTA 2QUTA 1EO5A 3VI2A 2OG9A 5A6AA 3FOKA 1ONRA 3WQEA 2PDBA 3ZIZA 1SW7A 3EOSA 4D6IA 4ORIA 4GIRA 2P3ZA 4NNAA 1P0NA 5L6UA 4IQJA 1UKOA 1DIDA 3TOYA 4R7WA 2UWFA 2D69A 3E3HA 4O0ZA 2PP1A 3O3RA 4X63A 3WQWA 1GOXA 4IGHA 1RJRA 4HZMA 2A3AA 3M4HA 5F2LA 4E8CA 1S3HA 2VEFA 1XYZA 3UR7A 3PJWA 3A12A 2X2YA 4ES4A 2NW0A 4INFA 1JCLA 3ITVA 3UGRA 1AMKA 4LBUA 3CL7A 3CWOX 1K7XA 2QIWA 1LWJA 3H23A 1A5KC 3OBKA 3MBFA 4UTMA 1ML1A 4I6KA 1KKOA 4C6QA 2YLAA 2ZUVA 1XLIA 4FXFA 1TSIA 3V3WA 1QI0A 1HO1A 1UBPC 5IDZA 2QDGA 1JD9A 4P7NA 2X1SA 2ZWZA 4NAFB 1TJ1A 2X0HA 3FGCA 4OQVA 4MGGA 1P43A 4JD4A 1ZBVA 3WFLA 1VYRA 2A6LA 1PWMA 4ZOAA 4UUIA 1QUMA 1OG6A 1POKA 2CWNA 4N0RA 3NSMA 1W3NA 3KOXA 2WW5A 3Q94A 3OIXA 4NI3A 1UUOA 1H61A 2D1ZA 2V2DA 1TJRA 4IF2A 1H7OA 1SO5A 3BANA 4C6KA 4W4QA 4DZ5A 1YDVA 1F61A 3MY9A 3T0TA 1DJQA 4CD7A 1R86A 4GNVA 3QGAC 4NZ5A 4C6MA 3TW7A 5LNWA 4H3DA 1VD6A 8XIAA 1SUXA 3S9ZA 4O17A 3IEBA 1NVMA 5FL1A 2G0WA 5CPTA 3W76A 2C8NA 4MZ8A 3GC5A 1UPPA 1XV8A 1PB0A 1YQ2A 3ZJ6A 3NZRA 3ISIX 2BOEX 3H6OA 3W7RA 4JICA 3W3OA 1DIEA 5G5IA 3P81A 3M46A 5D2WA 3C4UA 1NDVA 3CQJA 2J75A 2MANA 5DEZA 3QTPA 1ITQA 2JE8A 4EAYA 4JHOA 3AXHA 5TQLA 5I3FA 4YJ5A 3W1QA 4LAZA 1RVKA 3SY8A 3AUJA 3PZ9A 4U5KA 1UUQA 3CC1A 4O28A 3CAKA 4YIWA 4E2DA 4R33A 3EB2A 4O1AA 5J04A 1XLCA 4DBDA 3RNDA 2BY0A 1FWCC 3GHTA 3M43A 1GZJA 1QOPA 2EKGA 1J6OA 3RGTA 3FA4A 3CM4A 4C6JA 1K1DA 3G1RA 1B30A 3R58A 5LIKX 3QQ0A 3V1HA 1EC8A 3VNMA 4URIA 3N13A 4XAYA 1LF1A 1KBJA 5FAGA 2FIQA 3IV3A 3BOXA 4KGJA 4QJ3B 1FWHC 4CEXC 3H22A 1X7FA 2GSEA 5BU6A 1CNVA 3CHVA 2QDEA 5LZLA 1XH0A 1V77A 4L6HA 2W9MA 2E40A 4NF7A 4GLEA 1O60A 4F3HA 4QDWA 2DZBA 5HPOA 1OX4A 3DHFA 1YE6A 1B5TA 3ZYZA 1F4AA 1R2SA 1GVSA 4IGNA 6ENLA 1XSIA 1IV8A 4YCOA 1XFBA 4QAWA 1GKQA 4WY0F 1E6RA 3S8HA 4Z1YA 1M3UA 1FOBA 3W88A 2OWWA 5K3VA 3AZTA 2QJIA 1GT8A 4LVFA 2GJLA 3W2JA 1LBLA 3MUZ1 4HA3A 2FFIA 5I3JA 1SW0A 2W62A 4D6DA 1L6YA 1B1YA 4B3ZA 1SJBA 1FWDC 4C6FA 3QY8A 1PCWA 1Z69A 2WMIB 3GTNA 4GCAA 4PMNA 5JH2A 4MNLA 5CSSA 1VLIA 2X30A 4ZXOA 2R24A 4IXHA 3BAXA 1W9BM 3EDKA 3L23A 1MI3A 3S5YA 4PUDA 2OEJA 2QV5A 3K4WA 5TF0A 1Z3NA 1C8YA 4XAFA 1BKSA 3TYBA 3R8HA 5CGMA 3BW2A 4PCPA 1GQJA 1P1MA 2FJKA 2WHKA 3VMPA 4YYFA 1G69A 4LB4A 2PLJA 4WKFA 1UOZA 2HZGA 3LI1A 1D2KA 3O1NA 4M7TA 3NYZA 4CQAA 2X7WA 3WJSA 3W85A 1GOQA 4AF0B 1DTNA 1XIIA 5CPLA 4NRRA 2XM2A 4WSKA 3PZTA 3PZIA 3V75A 3A3HA 1RALA 3VIHA 4UCFA 2NXIA 4QXIA 4MKVA 4B90A 1F3XA 4DNHA 3T2PA 4I7VA 3MZ2A 4OBTA 3CHDA 1DWGM 1V6VA 2E28A 2JGYA 4RKAA 3W75A 2WAGA 1QPQA 3IS4A 3E0WA 5CAKA 3DU0A 4BFAA 2ZXQA 4BQ4A 1MW2A 1JXKA 3AFBA 1ZJBA 3ARUA 4JTGA 1CB2A 1H11A 4ZOBA 5DMLA 1C90A 1ENUA 3GIQA 2GJNA 1BXCA 1OD0A 3C8NA 5A1AA 3K4DA 1X98A 4GINA 4REQA 3TJLA 3W7KA 4HN4A 4ML9A 1E55A 5K7JA 4PL2A 3CH9A 3NTYA 4HMEA 4PFHA 3GXMA 3LERA 2XTKA 4HNLA 3IIVA 3B8IA 4UR8A 2J79A 1J2BA 1D3GA 1NP0A 2WBGA 2FZDA 2Y7FA 3L5LA 2RAGA 3TK7A 4PEKA 1BG4A 1C8VA 2AGKA 3DIPA 3C6CA 3VGHA 4BI7A 3QV6A 5GPRA 4WKAA 1NDWA 1YXCA 1LLOA 3T07A 1SSDA 3PZOA 2L5HA 1XIGA 3S2JA 3CAQA 4K2SA 5AHIA 1LOSA 2XISA 4O1DA 3AS2A 1V6XA 3Q4DA 2GGGA 2PDWA 1AJ2A 1H4PA 1H50A 3PULA 3SQLA 3PZVA 1NTHA 3IAPA 1QCWA 2X8RA 1ZAIA 1AVAA 5ABEA 2YBVA 3TYAA 1UKQA 3O05A 2AAAA 3W7DA 1NFPA 3LV6A 3SUTA 1E0TA 2GUBA 4B16A 3UZZA 4MKNA 3E1F1 3UXDA 2OEMA 5BXRA 3MCMA 3L4XA 5EGRA 1YPXA 3OIHA 3G0UA 1TV4A 3TSMA 1D9EA 1WZMA 2XH2A 1O4UA 1SO3A 3EWYA 4JDYA 5DF0A 2PEVA 3T2OA 3EPMA 4Q4MA 3WG6A 3W2MA 1ZENA 3OU8A 3LBOA 3ZMRA 1EHAA 2FPVA 1KFJA 1YNQA 3QPZA 1SW3A 2NT1A 1M7XA 3TNOA 2PODA 2PZ0A 2OU4A 3ITCA 4YVXA 1J10A 2OX4A 3W1NA 3AZSA 3I7SA 1T96A 1JPDX 2YPIA 3IANA 5BWAA 1HP4A 2Y5SA 3O07A 4W5ZA 5FF4A 4IJRA 4B15A 2WVVB 1AG1O 3MBDA 3W24A 4TVDA 3L2MA 4EPEC 4XAZA 3ZLGA 1BFNA 4PUJA 2PS2A 2PDFA 4LS0A 1KWKA 5XIAA 1BYAA 2OGYA 3FDKA 2PGRA 3GXPA 4FLRA 4ZOEA 3REQB 1TPH1 2ZUNA 3UW6A 1K8YA 1ZBCA 3FIGA 3LCIA 4F0SA 3GTXA 4QG8A 1J93A 3STPA 3IUHA 3IGUA 3L2IA 1J96A 4ERAA 4MJZA 4S23A 2E9MA 4ADUA 3SIZA 2V2HA 3F2BA 3R13A 3UJFA 4Q7IA 4B5XA 1E6NA 3IGSA 4ZCWA 3TYZA 3DUGA 3WLJA 1IZCA 1Y5XA 4N42A 1OGBA 3QLLA 1XL9A 4KESA 3VTRA 4PMVA 4DRSA 3RPDA 1FWJC 4G56A 4Q6JA 2QCFA 2GUUA 1EFZA 1MEHA 3CHCA 3L67A 1FKWA 1P0DA 3PBMA 1HQTA 5PTDA 3M0KA 4Q7NA 3TVAA 1BGGA 1GQLA 2J66A 2X09A 1CTNA 1KXVA 4CCDA 1MDRA 4KEMA 4H9VA 1O5KA 1KXTA 3SCSA 3OA5A 1R3VA 3SRHA 1N2VA 1FWBC 4XIAA 3GVGA 3DECA 1Z44A 2J27A 4Q8WA 5CH9A 4AD2A 1F73A 4AZ5A 3CH0A 3B40A 1EXBA 2HVOA 2BXZA 4OV9A 1KQYA 1GHSA 1KNWA 3WLLA 4HHPA 2YXGA 3MS8A 4H6EA 5GJMA 3DXIA 3BSGA 4OKDA 2QZRA 5KSWA 5CJ5A 1XKJA 2C16A 5I09A 3A47A 3EMQA 2VP8A 2ZE0A 2O4QA 3PBVA 2Y62A 1HJSA 5FJJA 1TPB1 2OYLA 3QMSA 1RP8A 2WHJA 1XFCA 1ONEA 2VC5A 5ABFB 1EP3A 2XJ7A 2NQHA 3IJDA 3WIJA 2YX0A 1GW9A 3DFOA 1MUCA 3F4DA 2W5FA 3R4IA 3AIUA 2V3GA 3MZNA 1VQTA 2IXVA 3E5BA 1UYQA 3OYZA 5CZKA 4CQCA 3E0VA 2OMAA 4UMBA 1XPGA 2VVSA 1L0PA 3MMUA 1Q5MA 5G4WA 4UQBA 1K4GA 2VO5A 3E2SA 2VENA 1O5QA 3ZWSA 3QMTA 4UOQA 3PWGA 2O9RA 1YXDA 5CPQA 4PSRA 1WYIA 2QJJA 3OW1A 1E9ZB 4BY3A 1DJGA 2GGEA 4PODA 1OX5A 4XUYA 5BWFA 1KWGA 3HZ3A 4M3PA 4DWSA 3L0KA 3UCCA 2CITA 4FLQA 1EEPA 2PU0A 4AY1A 4I5UA 5HUPA 3JW7A 3RPMA 5FCZA 4PUUA 5I3GA 1W3TA 1H7NA 3HA1A 3L68A 3AIQA 5I3IA 4I90A 1AD4A 5A3HA 1Y7VA 5HDRA 2Q3OA 2ZZ2A 1A5UA 3G2GA 3R0KA 5D09A 5D8WA 2ZZ6A 5HXMA 3VNZA 3K4AA 4WDXA 4PBGA 5A2BA 1TWIA 3KOYA 2QF7A 3N29A 3CMJA 2C79A 1OD8A 5CZ0A 5GJPA 3VIOA 1OK6A 4J27A 3GH7A 1GG1A 3C0JA 4QTGA 1TVNA 2G3NA 2VGFA 3L0NA 3R6IA 4LCRA 1FX6A 5REQB 4GC3A 4H2CA 4QNEA 1KKRA 3GFXA 3QV8A 5CQ1A 4EE9A 2CC0A 5B80A 1RUSA 4LFYA 3NO5A 1MW3A 5D04C 2FFCA 2PDXA 2J7FA 3IVTA 3E74A 1LL4A 2JFEX 4I8DA 1TB3A 4JR5A 3TU9A 4KS0A 4A6GA 1AH3A 1L9WA 2WZEA 5C8BB 1RY0A 3I10A 1KM2A 4N9EA 4LUSA 5FF3A 5BNKA 4K7VA 3UESA 3LBMA 1E71M 3WBEA 4IM4A 3NR0A 3GG7A 2Z2BA 1GVOA 4J3UA 1BTCA 4F0RA 3J7HA 9XIAA 4ZE5A 4AD1A 5I07A 3GNDA 1KGWA 2H6RA 5EBAA 4PMUA 1J0KA 3WLHA 3VILA 1NAL1 1H5VA 3WDJA 1E0XA 3GKFA 3QQ1A 3KW3A 1S38A 4AWUA 4X22A 5CC3A 2NVCA 1HIZA 1S5NA 2FZMA 4QSFA 3L5MA 3NZQA 4M19A 2IQTA 1GQNA 5CXPA 2Z2UA 1TRIA 4H9TA 2CKRA 3VKBA 3QQWA 1RPKA 4Q4QA 4NAEA 3PBWA 1IEIA 5DMNA 3T81A 2INZA 4MADA 3WFAA 3QHNA 1YBQA 2CHNA 4JTAA 2I17A 2XU2A 3MYOA 3FKKA 2WZTA 5U4NA 4OZOA 3WUBA 1WE5A 1UH3A 5HBFA 3U9IA 5FI8A 3GR4A 3WQGA 4A3RA 1TV8A 2PDGA 5RUBA 1UG6A 1XBYA 1XD0A 4AZ7A 3BMVA 2C19A 5JUVA 4CUCA 2MUCA 1V7AA 4J2PA 3STCA 3AXKA 3COTA 3CUJA 3NQVA 4PMOA 1XISA 2QULA 3N17A 1TQXA 1P4CA 4TTUA 4JTUA 4Q3MA 4HHHA 4XKYA 3PUOA 5HWJA 3DFHA 4NHVA 3WEMA 2BVTA 2FTPA 1CXHA 1EWEA 3BXWA 3NM3A 4F0LA 3DYPA 1QI4A 3RPTA 4F2TA 2OQYA 1E4LA 3B04A 2XZ7A 4ASTA 2A79A 4B2DA 5C70A 2VQUA 3PNUA 1FHDA 2BLEA 1PXGA 4QJ4B 4Y9MA 4ZSUA 3EB4A 1W37A 5LNUA 2NWSA 2D24A 1OM0A 3I4EA 4KIRA 3KZSA 5T9BG 4AHPA 4HOWA 4PH6A 5FF0A 2QJNA 3TKFA 4C6NA 1PO9A 1A0DA 5CZSA 1ZP3A 3QW4B 2EHHA 4DEFA 3S83A 2ZDSA 3S5NA 1XDLA 1KW1A 3A4WA 5DELA 2W4XA 3RLVA 2Z27A 1DHKA 3A4AA 1VFTA 1NM9A 4NVTA 2Y5EA 2NX9A 4MNKA 3TQPA 3FV9A 3IGHX 2W3ZA 1DWHM 3TC7A 4AZCA 1XF0A 3PVFA 3W86A 3SCWA 3M5YA 1E73M 2PRLA 3G22A 2GVJA 2NUYA 3SEPA 4MPKA 4AD3A 4WOZA 3OZOA 3V5OA 3ZSTA 3DN5A 2AQVA 3AJ7A 1MQPA 3AIRA 4UR7A 1YDOA 4GABA 3AO0A 2VR4A 4DJDA 3V1PA 1J11A 1GZ1A 1H2JA 2YL9A 1IGWA 4FPSA 1BWLA 2DORA 2DUAA 2F6UA 3P74A 3G6MA 3CO8A 4JX4A 5CJMA 3W74A 4PB3A 2I9UA 4PR4A 1TCMA 3VINA 3VVGA 2VXNA 4PCTA 3B0UX 2VR2A 3CPRA 2Y1HA 4FEZA 1JRBA 4S38A 2Z1BA 4O0QA 1B0IA 3N11A 2D3LA 2GJPA 3FEQA 3K1DA 4GYPA 2QCGA 1K7FA 2DZVA 3EBVA 4BQ2A 2BGNE 2V3FA 3W7CA 2GJXB 3VX1A 3NZ1A 3MTWA 3TDFA 2I5IA 3WNKA 1SZEA 4AD0A 1R38A 4DUXA 2Q71A 2IKIA 1OFOA 2ZUMA 4DI8A 2ZXAA 3VIMA 2IW0A 3PANA 3PZQA 3W7IA 4MDOA 2NV9A 3UZ5A 1CLXA 2CLHA 3M0HA 1BGAA 3AS3A 2JK2A 1J5TA 4AXNA 2VFIA 2QCDA 3ANYA 2QUMA 2GWNA 6A3HA 5HULA 3PB2A 1AA1B 2DGAA 4EXAA 9CGTA 4AYGA 1SZNA 4ONVA 4EXQA 2X42A 1NY1A 1TKKA 4IX0A 4R3UA 4TUFA 3OGVA 3A4XA 1D3CA 1UD3A 1E0VA 3SFKA 4LUTB 1H09A 3I3DA 3GBDA 3KCLA 3E38A 4QGCA 2HBXA 5CC7A 3WD1A 1QDSA 3C8FA 4WDTA 1VJZA 2GGIA 5G2HA 3M6DA 3BGAA 2DP3A 3MDUA 3N1AA 3B0PA 1XLEA 2C13A 4IP4A 2VELA 3B97A 1T0OA 3VFCA 2PDMA 3ZXWA 1SMAA 1KR0A 2YXXA 4OWGA 3BTNA 5ABTA 5AYBA 3L65A 4QITA 1H1YA 3U2OA 3ZWTA 5ENLA 3WO8A 1XC4A 1EJRC 1WDRA 1GOMA 3QSTA 2WCAA 1VCVA 4POCA 4HA4A 4L6OA 4XZNX 1EQPA 4N9CA 1T8XA 3PB0A 2YL6A 1A5AA 3WELA 3OGRA 1DYSA 3FXYA 1ISXA 4W84A 3O0FA 1VBGA 1V6TA 4GWEA 4LB3A 1SPQA 1TTQA 4V1XA 2EPLX 1XRSA 1Q6FA 2AAMA 4QX4A 1YW1A 4A21A 2DVXA 1U33A 1SZGA 3TCEA 4RW3A 1FDYA 4NXKA 5D30A 4MLRA 4NJJA 4KMQA 3TXVA 2PP0A 3WH9A 4K1GA 1BYCA 1BQGA 3EZ4A 1IT7A 4HCLA 1E51A 3VC5A 2HV5A 3T0AA 3T8LA 2HPMA 1V0MA 3H2EA 2C15A 4WVXA 3W00A 3RX2A 2ALRA 2XVLA 4XKMA 3WEOA 2VFEA 3S46A 4C6PA 4YVVA 4RR4A 5H91A 4TO8A 2X1TA 4N4PA 1BYDA 3WKZA 4GI9A 1BLIA 5H8MA 3KHDA 1UWIA 4KWUA 2VNCA 1W91A 3OBEA 3U2CA 3R10A 3VK5A 1QO5A 5FJUA 4WIWA 1EB3A 1LJYA 1GPWA 3WSUA 4QLKA 4UQDA 1E3XA 1IEXA 4R9OA 1S2TA 2YYUA 3WX7A 4U2YA 1EDQA 1OFRA 1UASA 3DERA 2EPNA 2YOCA 5LNRA 3BJSA 2WJFA 2EPKX 3H7UA 1T40A 5C2XA 3CBWA 2YA2A 1VYSX 2PPGA 2YW3A 4Z1DA 2XVPA 3AUOA 1W9UA 1HGYA 4NZ4A 2PDIA 3BUVA 2P5NA 2OO0A 1VFSA 3PTMA 1EJWC 4XZLX 4JL1A 4LOCA 4FX8A 2FDSA 5CLWA 5A69A 4X2PA 4V33A 4NKCA 1JDEA 1EXPA 1E0UA 2GVLA 4XZBA 3NSXA 8CGTA 3LTYA 2I5QA 3VUSA 2J24A 1KFKA 2Z6JA 4K3ZA 1HZYA 3APYA 1O94A 1XH1A 4OV4A 4C7DA 2XN0A 1QVBA 2GDVA 3MP5A 1E40A 3JZEA 1W1IE 1PZ0A 2PZNA 4A8RA 5F1UA 3ORWA 3N3MA 1S46A 3R0DA 4DJEA 3UZXA 2E0PA 3DAQA 3LGEA 2GYIA 5JQ9A 5LIUX 3VOCA 1WO2A 4HT3A 3NXLA 3M1ZA 1ZSXA 2ZBTA 4NILA 1V51A 2WB5A 3SSJA 1J4EA 3ZJKA 3NQBA 1LBFA 1TREA 3SCQA 3W23A 1LBMA 3KWXA 4HU0A 4ZFMA 2J88A 4C6CA 1G94A 3UXAA 1REQB 1UB3A 1XCXA 2E67A 4JS3A 2GQ9A 3PJTA 2QHAA 1DJZA 8TIMA 1KXHA 1XDMA 3W7JA 5JBFA 1WOBA 2CLKA 5HK4A 5L9FA 4QM1A 4RUBA 3LUTA 3MVTA 1XWYA 2DT2A 7PTDA 4RE2A 1OCNA 2BHYA 2Y7EA 3EWCA 4AUBA 4HJWA 3SDOA 1H7RA 4RDWA 3ITYA 4Y8FA 1XGDA 2FB3A 4UOJA 2YGYA 1POJA 3V5CA 2DZAA 2J13A 4UTTA 4AX7A 1FHLA 3G6LA 1HKKA 3EWWA 2O7SA 4AEOA 1GWJA 1QTWA 3CL6A 2VKZG 3PPFA 1PIGA 3CV2A 3GKAA 5FD0A 2YZRA 4JCLA 5A95A 4AD4A 4F0MA 4RCXA 1OB0A 2Y2WA 3C5QA 1KV5A 3WMLA 2A4AA 4LT9A 3OA3A 4Y90A 5G2IA 3UWUA 2PWVA 1AJ0A 3UWQA 4UTLA 1ZCCA 3ONCA 1A49A 4KF1A 4RZ6A 3M6YA 2PURA 3G3DA 2HISA 3G1HA 2VOTA 2FMNA 4L4PA 5KZEA 4C1KA 2CXEA 3IUIA 3IUDA 1VAHA 3DX5A 3DFPA 1S2VA 3CMGA 2FYMA 1EO7A 2EAWA 1BVZA 3RJYA 4DZHA 3ANVA 3E2RA 4HYRA 2FZ8A 1X6NA 3K8LA 3NEVA 2CYGA 2OR2A 5I3HA 4EIVA 4DXXA 3IAQA 1TUXA 1UKTA 1LL6A 2AMGA 2D2OA 2PMQA 3CUHA 1YNYA 1L2UA 1R7OA 2VC7A 2XZ9A 3W7PA 4KIEA 1FCUA 1A0CA 4EPKA 2WO5A 4ZXLA 4GBUA 4WSHA 4R53A 1KGXA 2VDIA 4R7JA 4HA0A 2J47A 4U2ZA 2VT0A 3C2FA 2UZ9A 3LHUA 1V08A 2HK0A 3L12A 3M16A 5AHNA 3CPUA 4JEQA 2QCCA 2ACRA 3NNTA 3KS6A 3K8KA 1TMLA 3QMRA 2JKPA 1E1CB 3NQGA 2YB1A 3BSHA 5IRPA 2Y7DA 3UWWA 4W89A 1QASA 4TX8A 4ZB2A 1IEQA 4ZQMA 5HPCA 3VXGA 2JKAA 1TE1A 1PEZA 3SO7A 4O15A 3EOUA 2QUUA 2W6RA 4G7FA 4WJ8A 4FXRA 3U2EA 4CCZA 3LSCA 1TWWA 4CGTA 3DHPA 2XM1A 2HXTA 3GWQA 4UTIA 3EPOA 1WBJA 3I7RA 3NG3A 1UW9A 3N2MA 2QKFA 2XDFA 3ZO9A 1O68A 3HGSA 4RL3A 1PYFA 4DQWA 4YHGA 3G24A 2G8ZA 2WNWA 1XCWA 4NP7A 2ESCA 1R85A 1WP6A 4IMAA 1T7LA 1UC4A 2XYLA 1SM9A 3VGEA 2X0YA 1KGUA 3THQA 4J28A 2PWHA 2PLMA 1JUEA 1NQKA 2XH0A 5EFFA 3C2EA 2G41A 4QS5A 3AU6A 5F2IA 4DO5A 1D7FA 3DZ1A 3OG2A 5TAOA 1ME7A 4ZODA 4WXZA 5KZMA 4M6VA 1NF0A 4XD4A 3UJEA 1W1A1 3LCWA 1KM6A 4AIEA 2GOKA 4PMYA 4WGHA 1UROA 1EC7A 4X0VA 1G9HA 4HIBA 4IPIA 2OLAA 1UA7A 5BYWA 3UT0A 3GIYA 4CD6A 1UJQA 2QAFA 2C0HA 5JXQA 1OK4A 1A5SA 2FGZA 1WA3A 4R88A 1OF6A 1V3KA 2WC7A 3OOQA 1KRBC 3WLNA 4WHBA 3GVWA 5DMMA 4Q4PA 2VI0A 2AMXA 3WD3A 1U1JA 2PDLA 4N4QA 4QSHA 4W85A 4H6KA 2WZIA 2J9YA 2YZ5A 3VE9A 3H2FA 4UZUA 4XWUA 1QWGA 2XSBA 1LUCB 5D9MA 1Q7MA 1GJWA 1B3XA 3AALA 4EWJA 1AH4A 4QLJA 3UZJA 3W70A 4AU0A 3DI0A 3LQLA 4MWAE 3K8MA 3PFMA 4OVXA 1JYXA 1JFXA 3H8AA 3VKAA 2PWEA 4AZ6A 2BDQA 3HBLA 4XZMX 2F84A 2WVUA 2OSWA 3NPXA 1WDDA 3APTA 2EEXA 3HGOA 4M80A 2QEZA 4E2OA 3U48A 5D33A 4FIRA 4IG2A 4KCUA 4PTDA 4YWIA 4DWSC 3ARYA 3GUGA 4K8GA 1UP3A 1UD8A 1H62A 2CLEA 1NF7A 4ZL1A 3S9IA 3RM8A 3PC0A 1EGZA 4XSMA 3AHZA 2YCJA 1XGEA 2DSKA 3CQHA 3N4EA 1MW0A 4DM2A 1PCKA 3KVKA 1PZ3A 5D05A 4IZGA 4K68A 5DT5A 3R7MA 2WKLA 4XO6A 2F2KA 4L4MA 2J9XA 2ANUA 3PPCA 2CERA 5HMDA 1SQ7A 3THCA 4BKNA 3P62A 3EXSA 2FZBA 3POCA 1B3OA 5FA5A 2C1HA 4NJHA 4KEVA 4UNKA 5TIMA 4L1GA 5LIYX 1ZRQA 3EMZA 3G5EA 4M82A 1VLWA 4DBEA 2H3BA 3NL2A 5HANA 2XH4A 3UCDA 3URAA 2PE4A 3I68A 4LYKA 3SUSA 2V5CA 5HINA 1RV8A 2YL5A 3FXGA 1U2YA 3AYRA 3LB0A 2F2HA 1L2QA 1F3WA 2PGWA 3AYTA 3W7GA 4QHRA 1Z9AA 1OJXA 1K03A 4V1YA 3E5PA 3HV8A 2ZRZA 6TAAA 2OCZA 1WAWA 1U5HA 3RITA 3M0MA 4ATWA 4IL0A 3LZ3A 3JR2A 1J18A 1BD0A 5AOUA 4H9MA 3BO9A 1ZJHA 3UG5A 4LGXA 1B3ZA 1RBOB 4GPNA 4HPHA 4KEZA 4A8NA 2NV2A 3HN3A 3LS9A 3P14A 4LVAA 1CBGA 2TRSA 3C2YA 3BAIA 1Q6RA 1CGUA 4JYFA 2PRMA 3CZKA 3EMCA 3GVVA 2VEPA 1I2QA 3PBUA 2QW5A 3S47A 1CPUA 2G5WA 4G7EA 5CAHA 4L56A 1Y5WA 3GH5A 3R11A 3DFTA 2H9AA 4LH8A 1FVPA 1A0EA 1VR6A 3LPGA 3A24A 1GVQA 1B4KA 1B3WA 3TNBA 3SUWA 4IMFA 4LXFA 1SYTA 4PZVA 3CIWA 2ZVIA 3FCPA 4C1NA 1S5TA 4DYEA 5ECUA 3UZWA 1DJYA 3M64A 3V0TA 3WF1A 2C18A 3EXTA 5AHFA 1VF8A 3WLQA 3FGCB 2UY4A 4JL2A 2EO7A 4JY9A 1OEPA 1M03A 2E4TA 1OCJA 2BSLA 1FWIC 4IMDA 1GVFA 1FUYA 1YRRA 1JR1A 1H60A 3NUKA 2XFYA 3SCVA 3BLPX 3DFSA 1OGSA 1PTDA 4HPGA 3U3HA 1Z8AA 2POZA 4MNJA 4AYSA 2H8XA 2HPIA 3UP8A 3ID7A 4NAFA 4B5UA 2ZXBA 1WDSA 2QS8A 4FALA 2XVKA 3NSNA 3GXTA 2CHOA 1GNXA 4PRTA 5HMFA 2C14A 3B03A 5KMYA 4EX4A 5BXSA 4MVAA 5A8MA 1QI5A 3FYPA 3MWAA 3VKKA 4EANA 2Z28A 1IWPA 1ONWA 4HD5A 4AG0A 5J5RA 1EKOA 3ARQA 1XJBA 2HXUA 2PDCA 2VL4A 3RRAA 3C56A 3VABA 3BG9A 3OTRA 1FCVA 2WNNA 3I4KA 3D3AA 4WF7A 1Q4NX 3HQPA 1XC6A 1GPFA 4D1JA 3ARPA 4A8LA 3MDWA 1T99A 4GE8A 4M8UA 3EAUA 4LRSA 2OQLA 2DW6A 3PK7A 3LHVA 3ZSSA 1W3HA 1W5PA 3KBJA 3WQ5A 1UR9A 1PAMA 4GVIA 3AQUA 5D2VA 3UJRA 3KOWA 2A3BA 3WLSA 3LI0A 3WBWA 1PKNA 4AWTA 3GS6A 1JFHA 4GVHA 5FF7A 3TYDA 1V03A 2ATMA 2BFGA 4NIRA 2KX9A 1X6LA 3ENLA 3QTGA 2QV4A 3NQMA 3P93A 3U57A 3BAWA 1WZLA 4DJDC 3RN6A 4BEQA 2HVNA 4PMXA 4K37A 3MI3A 4FNPA 4FR1A 1IEWA 2QUNA 1I60A 1EOMA 4OUIA 1WZKA 4PUKA 2VRJA 2XIBA 1OX4B 4IFKA 4YNGA 4RW5A 3TR2A 2XSAA 1K3UA 1I2NA 3PAOA 3BZGA 1W5QA 5C9XA 4GKTA 1VFLA 5BW6A 5HATA 4J40A 5EB8A 4HYVA 4IIDA 3IWPA 4CNUA 2X1IA 4KRUA 1DKWA 1FWSA 3T2QA 3ABXA 5T91A 4ZE4A 3VCNA 1A5CA 1XHGA 1XDJA 1JYWA 1Z7AA 1J79A 1X39A 4PCNA 3W37A 3TA9A 4Y9NA 1QK2A 4JAWA 4M7SA 1MXGA 2V3DA 2R8WA 5FEWA 4D6EA 1R8LA 3QV7A 1S2CA 3PUDA 5C71A 8XIMA 4PCSA 2HK1A 1W1YA 4Q8UA 4ZTYA 1KR1A 4WSJA 1DORA 2YYTA 4HPNA 2GL5A 4GK8A 3MW7A 2V81A 1A3XA 3QZ6A 4XVEA 3VE7A 1NH6A 3AICA 1PPIA 3USBA 2OTDA 3S5ZA 4H9ZA 1UR1A 1YHTA 1XP3A 3P2VA 4UQAA 3VNYA 2B0MA 3CUIA 2OZ8A 2WMIA 1C3FA 3OJGA 5BOOA 3GDLA 4AB4A 1W0MA 4RE0A 3TYUA 4E4PA 4UR9A 5BU9A 5IHRA 3M5ZA 1WUFA 3W73A 4AAJA 1YTDA 3AYSA 4TVUA 1H1NA 3K5XA 4Q22A 2VYOA 1SJDA 2DT0A 4UQ9A 4B3KA 3IGXA 3QKZA 4GACA 3GXIA 3MCNA 3W07A 3N2BA 2BNJA 3NURA 1DWJM 3VNDA 2PBGA 3VD3A 1KCZA 2GQAA 5IFTA 5XINA 3SGGA 2FVKA 5FJRA 3TTSA 4AF0A 3T6CA 2PDYA 3P0XA 3GVRA 5MF5A 5C9WA 4EPBC 4GZ7A 1EJ7L 3CLWA 1GVEA 1ZB5A 1DP0A 3WEZA 1Z6KA 5TNVA 1K9DA 1QNVA 4GY7A 3KLLA 3UETA 1VRXA 5TBOA 3SB0A 3GE7A 4LSBA 3QYSA 4P7RA 3Q45A 1VFFA 2PDHA 3CUZA 1YPFA 4W5UA 1V93A 3TMLA 2VRQA 3MUIA 3WLPA 3HPZA 3GG0A 4Y9AA 2B7OA 3PPGA 3U8GA 3VD9A 2YCLA 4QNWA 3LN3A 3EWXA 5EU9A 3MB9A 2GWGA 3LHYA 4REQB 4X9SA 3BK0A 1XYFA 1BRLA 4S2CA 2DH2A 1ICQA 2WZHA 1QNPA 5AC6A 3N04A 2WANA 4EOUA 1CXIA 3O06A 4HK5A 3SW6A 3UVIA 4KWVA 4RZ4A 3IIZA 2X41A 1X1OA 4MUZA 1Q13A 3LA4A 4M6UA 3QKEA 2ZC8A 4QLLA 1EBHA 3Q37A 3GR7A 4H6RA 4RV8A 1RA0A 3B0VC 1OT1A 3N2XA 3MO4A 5AVNA 4AC7C 3B8WA 1BG9A 1U22A 3HFYA 2FTWA 1UKSA 3H53A 2VURA 2OLSA 3GQYA 1VEOA 4DO6A 4XQ6A 3M47A 3LM3A 1UQYA 3AHVA 3D6NA 4JFUA 1IT8A 3WQVA 1DEDA 4QEHA 1Q3NA 5DMYA 3ALFA 1R6WA 3P80A 1OVDA 2Q8ZA 5J5DA 2QUVA 1U30A 3I65A 1UD4A 3EX1A 1PX8A 1W9XA 4LTSA 4HSOA 1TWDA 4M5PA 4O50A 1VEMA 1EJTC 1ZFJA 1ALDA 2RGLA 4AMCA 2V6AA 1H7PA 1OCBA 3WMCA 2YXOA 4HNNA 4Q6XA 3VKDA 1I1XA 1QR7A 1UMLA 3C3UA 3DG6A 1OC6A 1QATA 3HG4A 3GG8A 3ERPA 3U5UA 4UC5A 4WD0A 3AISA 1I1WA 3MUXA 1XQLA 1IT0A 2C7FA 4UFHA 1PX4A 1AL7A 1AZ2A 1TA3B 1EDGA 3CEPA 2F6KA 3GHUA 2Q09A 3TSDA 3QGVA 3WLMA 1WDWA 4L9ZA 3QFEA 2YLLA 4JTEA 3UR5A 1QBBA 1WKEA 3T08A 2J77A 4ZB0A 5FEPA 5D2XA 4JX6A 1KRMA 1X38A 1P6WA 4ERGA 3TW9A 5CSRA 4WR3A 3ATZA 3STGA 1MUMA 3OHMB 2BV9A 2F9RA 2ZRWA 3H26A 2W67A 4DJEC 2FHFA 2QAPA 3BMXA 2WC4A 3H2MA 5AYXA 3V16A 4QBXA 3RCNA 3VOFA 3R1ZA 5M3WA 1U1HA 1XLFA 2FGLA 4I7UA 3S5SA 3HU7A 4HNCA 4NASA 3PG9A 4PBFA 1RD6A 4DXVA 1DV7A 3WH6A 1E72M 1U83A 3MUAA 3OYXA 1JZ8A 5F4SA 3QN3A 4Q8OA 2VCBA 1FCQA 3WD4A 3RR4A 1F4HA 2JF6A 4P5UA 4PCFA 5B7YA 3UG3A 4HJFA 4JIQA 3KUMA 3S6TA 1XRFA 3N6JA 1KTNA 2FPYA 5F4WA 3GD6A 2QCEA 3UWVA 4IIHA 1KA9F 4ROPA 2HSAA 1XLMA 3EX2A 4P2VA 2VX6A 4JFWA 4UFMA 1NDZA 4HGXA 3C3NA 3ZVHA 1BQCA 4UTTC 4JGDA 2WSKA 3GIPA 2QVHA 2VWTA 4K39A 3MV11 4DLFA 2BY2A 2PBOA 1E6XM 2CFFA 3N4FA 4O18A 3CT7A 3FAXA 3QW3A 1EJUC 3AAMA 1X8FA 3BLEA 1ONXA 3F03K 3W83A 4DJFC 4K6AA 1V6UA 1FWEC 4IHCA 4LS1A 1XLLA 5K4XA 4CNPA 3DOPA 5HMEA 1TWZA 1XSKA 4CLMA 5E70A 4FX7A 3W01A 4H19A 4Z1AA 2VTFA 3NOYA 1R9ZA 3VKCA 2WK2A 5HWMA 3SCNA 1H5YA 2FHCA 2I7GA 1V3HA 1L6GA 4AFYA 5AB3A 1OY0A 1K8CA 3WQOA 3WDHA 2FLIA 4GXWA 3ZJ7A 1K8ZA 3K30A 1XCFA 2SFPA 2VGGA 3S9YA 4LAKA 3Q67A 1XIEA 4I9TA 4KGLA 4B5TA 2TYSA 3STFA 4E4UA 1OIMA 1XUZA 3L7RA 5ABFA 1CXLA 3IJLA 4HB7A 2ISVA 1KM4A 4JQ3A 3FJLA 3SQSA 1UOKA 3UWEA 5DBUA 1LOLA 1W1ZA 3A22A 3UA4A 3A4JA 3G1SA 4DWSB 3N9SA 4OIFA 1QO2A 5KITA 1TV7A 1A5LC 3HPXA 3H54A 1UWRA 4M51A 4PSPA 3W71A 1RJQA 3S2NA 1GYNA 3B8DA 4CVWA 2E77A 2YFOA 3IVUA 3S4TA 1IWBA 2TAAA 4S3KA 3WK3A 4DY1A 1V3JA 3LEPA 2D0HA 1VPXA 2E1WA 4GQQA 3D0CA 3GNXA 1AD1A 2D73A 4RNFA 3O15A 1FP9A 1Q63A 4R5EA 3RHGA 4LY4A 2HBVA 4OE7A 3CZLA 2FH6A 1OADA 4AHQA 1QNOA 3SADA 3RU6A 1Q6QA 1XYBA 5D9NA 4F40A 4XISA 3IRSA 1IR2A 4GOAA 1Y65A 3TN6A 3KS5A 1KFWA 1DWFM 3BLIA 1Q6EA 4MYXA 4JFVA 2DIKA 4PUMA 1LCOA 3CMFA 2ONEA 5BROA 3PP7A 3CZEA 4A2RA 2PDUA 3ARXA 1ME9A 5I3KA 3TTQA 1MWOA 3GXNA 1JQVA 4UQCA 1EJXC 1AMYA 5KZ6A 1I9CB 1UWTA 1QOQA 4FS9A 3NQ8A 2HNHA 4IH3A 2AKMA 1GONA 3WFZA 4BEUA 4IWWA 4Z0JA 1UR8A 4DX3A 3SAZA 3H21A 1JZ5A 2FKPA 4GISA 3R43A 1JAEA 1B3VA 4X0NA 2X40A 1G5AA 4JOMA 2XGIA 4FOUA 3WQ8A 4A35A 4I8YA 1HO4A 5H1WA 5ECVA 4UTFA 3N9KA 4XZHA 1VCGA 7TAAA 5MHBA 3CZ8A 2OEKA 4OGZA 3MKKA 4LYQA 1RCOB 3CV6A 5BMWA 3WLOA 4NAEB 3VDAA 3PWAA 4E6MA 2G97A 3DFNA 1AW5A 4ZQOA 2GOUA 3T09A 3FA5A 1YBQB 1L6SA 4HNTA 3BARA 3G8RA 4XTDA 4D6GA 1IZJA 5D4YA 4F0KA 4ZQNA 3ZOAA 1FWWA 5CC5A 4XK2A 2Q02A 4HOXA 4W9TA 1OC5A 1H1ZA 3CAVA 4MPQA 2D2HA 2ZADA 3EDFA 3F4CA 1C9DA 3EYPA 1YX1A 1JZ6A 1H0IA 1KM3A 4UWMA 3ZM8A 4ACYA 1EZ2A 3B9NA 1OWQA 1KRCC 5AC7A 1IZKA 1RCXB 4LNCA 3H2CA 2UY2A 4E8DA 1E0WA 1VEPA 5FJTA 5C7VA 3EEGA 2IKGA 1S5WA 2ZX6A 2ICSA 2BWGA 2B31A 5G1YA 1QHZA 3VNJA 1YMYA 3IARA 3R2GA 4J3ZA 1FP8A 4H2HA 3B9AA 1JCTA 5H8PA 2I14A 4QRNA 2WVSA 4XKYB 1MVYA 4D2JA 1TJPA 2PTYA 2IKHA 2WJDA 5DX7A 4GVGA 3HF3A 1EC9A 4ZGYA 4QDMA 3DGBA 1K4HA 4UFIA 1NARA 3U7VA 4GUJA 4DHGA 1ADDA 1EX5A 4TIMA 3AIWA 5I3DA 1I6NA 3T05A 5AECA 3JUGA 2Y63A 2DW7A 3IJ8A 2VZOA 4LAOA 3RM4A 1ZL1A 5DFAA 2NSOA 1YDNA 5CPSA 3UNDA 3D47A 3W2NA 1W3JA 3UPWA 4LWWA 4J1OA 3TC3A 4P8XA 4TV6A 1JYVA 3S0CA 3KVLA 3OQEA 1Q8JA 4ATLA 4GY0A 2VMFA 2QYGA 3IACA 3BGGA 4NUWA 4TMBA 4YTTA 1UMYA 4JIRA 1PKYA 1QK0A 5XIMA 3WL0A 2ZXDA 5A2CA 3SI9A 4GI6A 1UWSA 4Q7BA 3EX3A 1LG2A 4E3TA 4FXJA 5HNRA 3PTDA 2BP1A 5C54A 4H4IA 2ZWYA 1XR2A 2PC4A 1VJSA 1TV3A 1E56A 1OFDA 3PR2A 5MKGA 1BWKA 1NFGA 2AKZA 2B81A 4LV9A 3NO3A 3QZAA 3BOFA 3DBNA 2PCEA 4JTFA 1EX1A 4BK9A 4W8LA 4MFDA 3WQFA 3LGGA 1B31A 3AS1A 3SCPA 1ECQA 3V36A 2PU1A 4AZCB 4HZ6A 1P6CA 4HU4A 4DAFA 1GGOA 4RZBA 4GYFA 1LROA 2PTWA 2PDKA 4HTYA 3VGGA 3IV8A 3KLKA 3O8AA 1HW6A 4AY7A 1OQFA 4C7GA 5DRCA 2XIIA 3WNOA 1SGJA 3BOLA 3HURA 3WUGA 4XD3A 3G1FA 1K6AA 1SR0A 1BXNA 1JPKA 2WMGA 4RX0A 2BOFX 3KVJA 5GVJA 1VBRA 3AROA 4PRWA 4NX5A 3SIMA 3ABQA 2CZEA 1S5VA 3B8VA 4S39A 3A5VA 3BCDA 5EL1A 1WXZA 2QJHA 4YS1A 4MWAA 1UR0A 1N55A 2YJQA 1BF2A 2DQXA 2CLMA 1T8QA 2VX4A 1B2YA 1XBVA 1K9TA 4O1FA 4A3QA 3GC2A 2PGEA 4DWDA 4C6LA 1E5NA 1MUWA 3WH7A 1P0BA 4JTTA 1OZMA 1YPIA 2WWCA 2P0IA 1XYCA 2CLOA 1P1XA 2F6XA 4L7ZA 1PTGA 3ALGA 4DELA 3GRIA 1MXSA 3TLQA 4B9YA 4O16A 3FVMA 4NJIA 2E5DA 3TN3A 3W29A 3VDHA 1Z41A 3OGSA 4G9PA 2CPUA 4YL2A 3TFXA 2VWSA 4Q8NA 1AQMA 1UBSA 1XPYA 2QQ6A 3LY0A 3BCJA 1A50A 4C60A 1QPRA 1IXPA 2GJXA 1XGZA 1JL8A 4HPJA 1NEYA 4S3GA 3QF0A 4GQBA 1V3IA 4MMWA 3G8EA 3K13A 1B4EA 4YLWA 4PTMA 2ZRXA 4ZSTA 2CWXA 1XXXA 3I6RA 3CQIA 2CCRA 3EPNA 3TFCA 4C6IA 1VH7A 5C2GA 4IQDA 1OT2A 3GAYA 3H4GA 1RAKA 4I3GA 3M5VA 1E4MM 3W1PA 2J7GA 2R1MA 3QH2A 4KFOA 3W0KA 4DN1A 3OVRA 1UH4A 4U3CA 3LV5A 3M7SA 2Z1SA 4GZIA 2ZE3A 1F5ZA 3LHWA 2YIHA 1PX3A 4GUHA 3OG3A 5CBIA 3O6YX 4YXGA 1N8FA 2BHUA 5HQLA 4KCVA 4FK9A 2EPHA 2FJUB 2EBNA 1AQHA 2XFWA 4HNVA 3WQ6A 1HKIA 1EPXA 2XFRA 4CNSA 4MDPA 1R3TA 3WUFA 1XLDA 4LAMA 2VR5A 1OHLA 2Z00A 3NPUA 3GNRA 3KCJA 3SN0A 3B8SA 3LLXA 3KRBA 2WJEA 1KFCA 3QY7A 3NFUA 5E0FA 2C1GA 4NYUA 3OP2A 3WJZA 4U10A 1AZ1A 3L4YA 1DWAM 4K7YA 5LSMA 3URNA 2V38A 1HVXA 2VC9A 3A3WA 4W8AA 4AMAA 4S3JA 1DXIA 1Q8AA 4CQ9A 4L9YA 3HQOA 4L4OA 4MHBA 4O1CA 3C86A 4QE1A 3T8QA 3BG3A 2I56A 3AIVA 4TX9A 3VAVA 1H7WA 3F2DA 1Z42A 3DKLA 3PTQA 3DG7A 4CU7A 2HEJA 4AWEA 5G4EA 3FA3A 1TFVA 3IIXA 3VCRA 2DZUA 4P61A 1GHRA 3KE0A 4F8XA 1VS1A 1U1UA 2DZWA 4RE4A 3SFWA 1PE1A 3A13A 4CCCA 3B0YA 2HRWA 3EWZA 1EGVA 3VD5A 3WF0A 3LNMA 3WF2A 4JTDA 1ISYA 3F2CA 2WBKA 4IIBA 3RO6A 1XYMA 3ARTA 4MJ2A 1P0KA 1VGAA 5FJOA 5HJXA 4F79A 3MSRA 4LC8A 1EUNA 4Y96A 3HV9A 1K02A 7CGTA 3ABSA 3WQPA 2VUYA 1ISWA 1UR3M 4PUNA 2R14A 4ZQRA 1E4NA 2YSWA 4YU1A 1RCQA 3GYEA 1QU4A 3M9YA 3A64A 4ZBCA 4GRSA 2O92A 5FEZA 2Q8LA 4B4HA 3DHDA 3S1XA 2BZNA 4J3XA 1JPMA 4XAGA 2W0UA 1LT7A 2ISDA 1L8PA 2NUWA 3B8TA 4JZ5A 3UYIA 2P53A 3RILA 2CEQA 4KH2A 1DWIM 4NNCA 5HNUA 4FSAA 4S3FA 1VPYA 5I24A 1P48A 1A80A 3L9CA 1RBAA 4ZFCA 4U33A 4YTUA 1GZGA 3GU2A 1M7OA 3GDMA 5E0CA 1R0MA 3AS0A 2GLKA 3ZS4A 2NQ5A 1BPLB 4GIYA 4GX9A 4RXFA 4GNKB 3URBA 1W6TA 3IRDA 1GORA 1AQFA 4IP5A 4QFUA 1W9PA 3MANA 3RCYA 2PCQA 4BHYA 5A8GA 4D6JA 2XGZA 2ZQ0A 5E5CA 4C5ZA 3BLOA 4FNRA 4XSLA 3ME3A 2X16A 3VM5A 3RYSA 3F4NA 1QPOA 2YL8A 3NCOA 4UOZA 3G1YA 4ZOCA 3NQ2A 3NWRA 1K7EA 5HA7A 4UFJA 2CU0A 1MW1A 3VUPA 1GYMA 5C6MA 3RLGA 1JULA 3AOFA 1P7TA 3TR9A 4K38A 3HFTA 3KOFA 3WZ0E 1Q7ZA 2ISSA 3ITOA 4NT0A 4S1FA 1QNQA 5JVLA 3QR0A 1E6SM 3H55A 2P76A 4DF2A 1DPMA 4BR1A 1YEYA 5EY5A 5LGZA 3EB3A 4AZIA 1REQA 3H4WA 1SFJA 1KFEA 2V68A 3PZNA 3GU1A 4ATDA 1CENA 4HSNA 4FLOA 2WSPA 1TRDA 4LQ1A 2C6QA 3ZT7A 2EXOA 4I9AA 3P60A 1VKFA 2RGMA 1JCXA 2DSWA 3IVSA 3CS2A 2KZHA 3TC6A 4V28A 4UTWC 5H8UA 3F5JA 3LTPA 3ECQA 2OOGA 3UJ2A 4QDPA 1MFUA 1TX0A 3TONA 3HJZA 3P0WA 3LMYA 3LM7A 4KRZA 2BHZA 5LYRA 4XZIA 2OVLA 1CIUA 1W3LA 3RX3A 4IFOA 6REQB 3N12A 3WDQA 4KEUA 1S2AA 1EBGA 4JIIX 4DPQA 2AQOA 3OVPA 3VOHA 3VIPA 3ES7A 4LNYA 4JBRA 1F3TA 1DOSA 3O6DA 2QJMA 3VMOA 4O0KA 1SVDA 2VM8A 4Q4KA 5M2FX 2VZUA 1EA9C 5FF2A 3UVAA 3T7VA 4OHQA 1F74A 2ZA3A 1YTEA 3SCRA 2REQA 1TG7A 3KHJA 4AVFA 2IPWA 1MDLA 5K2ZA 4DWSD 3F5KA 4NNBA 4FLSA 3UXKA 1G4EA 3GDRA 4QS6A 3SUVA 1W3IA 5GNXA 3P8IA 4I5XA 4YTQA 2XHYA 2PDQA 3RCMA 1JNDA 3BVJA 1GKPA 4E4FA 1IIGA 3UU0A 2V9DA 4JTKA 1AH0A 1JDDA 4J5NA 1US2A 3GC4A 1JCNA 5E0KA 2W92A 1LQ2A 3KRZA 4Z42C 3LCXA 1OINA 1WCGA 2QCNA 1FTXA 3VZZA 1QPKA 3NZGA 2PA6A 4QISA 2Y70A 3CASA 2GUYA 3KTXA 2V5JA 3RDKA 4P7QA 3DCPA 3UG8A 4PL1A 5AC4A 5I2UA 3LZ5A 1ITCA 3T40A 1AODA 1G4PA 3W87A 1XI3A 2R9RA 4MB5A 2ZRYA 1TZ7A 4E3VA 3W53A 5A6SA 3VYLA 1TCDA 3D5HA 3O6CA 4BS0A 2QGYA 4OOZA 3W2UA 1Z32X 4WY0A 3SZ8A 3DG3A 1GKRA 4L1WA 2V30A 2FTYA 3T1GA 3KBWA 2BVWA 2JEQA 4X61A 4KFNA 5FJIA 4Z2IA 3O63A 3P7YA 3EKLA 2DFAA 3W82A 1TMHA 2OO6A 3CYJA 1ZS2A 1KXQA 1R47A 4KCWA 4XG1A 3AC0A 2YFNA 1PHQA 1G1YA 3WDPP 5F2MA 1V6YA 2VEKA 4A05A 4O10A 2VOMA 5LNSA 5TD4A 4B5NA 1OFBA 2X1RA 4JNMA 3PSWA 1CB7B 1P5BA 2RJGA 3HMJG 3UZYA 3NQDA 1CXKA 5CGTA 1YDYA 2BODX 3AXMA 4DLMA 1OC7A 3TUUA 1M7JA 3R94A 5I6SA 2ZX8A 3LRKA 1TTJA 3EA2A 1ZUAX 3G1DA 3EWBX 3FJ6A 1E9LA 3LOTA 2WCSA 3BLFA 1GW1A 3WQ4A 5HR7A 3B9DA 1XG3A 1M68A 1GOWA 3E0FA 4GZJA 1XD1A 4GC4A 4O14A 4AY8A 3WLIA 1HXJA 2CLPA 2E3ZA 4JTJA 3N2OA 4D6FA 3ZQ9A 3M5XA 4HCDA 2GGJA 4C1LA 4HU8A 1HNYA 1G7VA 4MSSA 1R2RA 4US5D 3T42A 1BVNP 1TTIA 3DHUA 4JHZA 3WJXA 2OLHA 1V02A 2G3FA 3HO8A 1UP2A 4RNJA 1JI1A 1JJKA 3B06A 2DSUA 4Y8EA 2D2JA 4E0CA 4US5A 5D9PA 2WSQA 3NA8A 4MG4A 1TZ9A 1AQ0A 3GVQA 5CG0A 1X97A 2Y85A 4IG2B 3ANUA 4WDWA 5HJLA 3TX9A 2BOGX 3B4YA 2TMDA 3GHSA 3W7HA 1UUMA 2J8TA 1EWDA 2DJLA 3BC9A 3CTTA 2HJPA 2QDHA 2P3EA 2IQ0A 1MYRA 4U4MA 4GJ1A 4R34A 2VD8A 3VD4A 2J25A 5AN7A 3H7RA 3NGJA 1W5MA 3MC5A 3VIFA 4UZSA 2V82A 3TTEA 4AW7A 4B2DD 1RP9A 3HG2A 3P6LA 1BSLA 4JCMA 4EWND 4MUPA 4PBEA 3DKJA 3PZUA 3OLEA 2A2IA 3T0CA 5I77A 3QYQA 4GFSA 4H7CA 2ASHA 3DGRA 6XIMA 4LX4A 2A7NA 2WC3A 1HVQA 2ZTKA 4X9YA 2E9LA 2OGJA 3RG6A 3AMLA 1CGYA 3VGDA 3CYVA 3VIIA 2AL2B 2GSHA 2EGZA 5A8OA 1C8QA 2ZTJA 2BMBA 3KM8A 3JRKA 3QFWA 2DPEA 2A3CA 2CNCA 5CEWA 3WQDA 1J2WA 4TU1A 1W9DM 1I75A 2XIJA 3WLKX 1H41A 3SR7A 4U5IA 2O9PA 3O7UA 5A6BA 4FAMA 2V2CA 1YKWA 1HKMA 5D03A 4DUOA 3B9OA 1EZWA 4E2BA 1JGMA 1QAPA 1WDQA 3DYOA 1MNZA 3GG1A 4DJDD 5BXPA 3QVQA 4MB1A 4S3AA 7XIMA 3WQCA 3LRLA 2PTZA 3N2TA 1RXOB 4LUYA 3KX6A 4B91A 2QGHA 3DH7A 3NDZA 2INEA 3UWYA 1XIDA 1CYGA 3MKVA 1LLZA 3U2ZA 4QAIA 4O4VA 1VFHA 2HDJA 3W26A 5AKQA 4NX0A 1OX6A 2Y8KA 3FHQA 1B3YA 2QT3A 5F7UA 1Q6OA 4O57A 2D0GA 2RFGA 3GZ3A 3W1XA 5CLTA 3DC8A 3WENA 1JXJA 2FZNA 2DZTA 1S1RA 3LX9A 2H9AB 3SGZA 3TH6A 3GHRA 5K4ZA 4D72A 2DSVA 1RVGA 1NOWA 5J8LA 3NZPA 4ALDA 1HJWA 3KL0A 5KETA 4FR6A 3CXOA 4GYJA 1UD6A 3L4TA 4FNQA 4GXPA 4JXCA 6TIMA 3CQ0A 1R30A 4C1NB 3MMTA 4LUIA 4MAZA 1W1B1 2UV8G 5JBDA 1DQXA 1PHWA 4KBXA 4M81A 2DVUA 2E7FA 3CB8A 3TW6A 1ZP4A 4GKLA 1EIBA 4MOZA 4LEFA 4ICNA 2DT1A 2CKSA 2YBTA 1CZ1A 2GDUA 1GUVA 4MF4A 5A6TC 3B05A 3BCFA 1MMFA 4IJBA 2JKEA 3FKRA 1O1HA 1IHIA 3LTSA 3WL1A 4EVZA 1QW7A 4WOQA 3W1RA 4RXGA 4UTHA 3EX4A 1VENA 1WV2A 1GJUA 1KQZA 1BEUA 2BVYA 2CZDA 3ABZA 2ZUSA 2BASA 1MRQA 3O2LA 4OBSA 4WZHA 5D8ZA 1QT1A 1IQ8A 2J7HA 4GD0A 1SSGA 1AW1A 5CPMA 2VCCA 4EKJA 4CD4A 1YIXA 2EG6A 4JEJA 3CLMA 4HA1A 3V18A 1IXOA 2F8QA 2ZICA 4LCSA 5EMKA 4L6DA 1LQAA 1M7PA 4CQDA 3V35A 3UJSA 1R9YA 4PMZA 3BL3A 5FACA 4DM1A 1XG4A 1GQKA 3ZT5A 3W84A 4GGHA 3EA1A 3GW0A 3P8JA 1GEHA 1QHOA 3WMBA 2WJZA 5EMMA 3ITTA 4H41A 4V2XA 1ICPA 1R3SA 4O12A 2WLYA 3T55A 1LQ0A 3PSVA 1ELSA 1NWSA 3BAKA 2NUXA 1TUFA 3OPSA 2DJXA 2Y24A 4L64A 4KPLA 3WNNA 3OB8A 1ISZA 3NPWA 3EA3A 1CLKA 3U0HA 1GVIA 1HL9A 3UGVA 1FXPA 4UIOA 4DUVA 4R85A 2DH3A 3CT2A 5EMYA 5H6HA 4EF9A 3KCOA 2B7PA 4IFKB 1BHGA 4QCFA 1M41A 3MKCA 5HMSA 2VGIA 4O4WA 4MWAC 3WLRA 4B3LA 3WD0A 3BURA 3VDCA 1BKHA 2WV8A 1C9WA 4W88A 2GK1A 3EKGA 3ELFA 1W1TA 2O7QA 4O19A 3NAVA 1UP0A 4XBJA 1CGWA 1Q85A 3RM9A 4GMEA 2R82A 1JG9A 1AUSL 3AWNA 4OU1A 3BW3A 1OFPA 2WSYA 3LG3A 2CLLA 4PTNA 4E2VA 2QDDA 4N2YA 1GQIA 1YNPA 1TE6A 2ODOA 3LDVA 1UR2A 1F07A 3NL6A 1F76A 1PTAA 4D8AA 3R8GA 3G1AA 2G3IA 1O1ZA 1VP5A 1PYMA 1G4TA 1HFBA 1MXDA 4LU0A 2VGBA 1F05A 2FVMA 4BWLA 2XFFA 4RV3A 1LT8A 4WJEA 3VNIA 1LWIA 5IXEA 3FSTA 3OHIA 3TWBA 3TQVA 4GJJA 2D3NA 3M0JA 4ECLA 1EQCA 4B9ZA 3O9NA 1KTBA 3BWWA 3PBYA 4IPNB 1QFEA 4W7UA 1K9EA 2ZZ5A 3W6YA 1MEIA 3P84A 3N3TA 4GJIA 2OYKA 2OXNA 4IQLA 4TR9A 1B54A 3ABOA 2D22A 1SO6A 4DJED 1O6IA 2E1DA 2HVMA 3LXAA 1KBBA 3AJXA 1TPDA 2E6DA 3GNPA 4N6FA 3MP4A 4Q4RA 1W2VA 1TR9A 5DLCA 4W7WA 1PL9A 4US6A 3BV4A 3GTFA 3CEUA 5AY7A 2P8BA 3GDBA 1JD7A 4GH3A 3TE9A 3HGJA 1UQZA 1HF6A 4PEEA 3NYDA 4BJHA 4HK7A 3QGKC 3M0IA 4A29A 1X1ZA 5F4XA 3UYCA 4HZ7A 4J3TA 4OOUA 3QV9A 3ARSA 3GH4A 3QM3A 1A3WA 1BTMA 1JF6A 2WNZA 3PPHA 1C7TA 4QIUA 3P82A 2YCLB 4IMEA 4LCQA 4UMAA 4ORMA 3XISA 4FNTA 3AU2A 1BRLB 2BVDA 4RPQA 1QI3A 2NVDA 1D3HA 4M6PA 3TYCA 2PDNA 2G96A 3EOEA 3GM8A 5LKYA 2ZYFA 2A3LA 3BQ6A 4J4KA 3FYYA 4GH1A 2R1NA 3RLUA 5I03A 3I6EA 1MSSA 4LYPA 3QHMA 1V5XA 1SMDA 1YYAA 4H7ZA 4ENLA 2W91A 2R94A 2Y0FA 5K9CA 2JF7A 3KFTA 4JKKA 3UR8A 3M0LA 3OZMA 3APGA 4XD6A 4U31A 1XYLA 1C93A 4NJKA 5I23A 1HJXA 1E3ZA 1R9XA 3L21A 3RU8X 4DBSA 2BX7A 4ILSA 1ZY9A 4P7OA 4IGSA 5C2CA 3U6WA 4DJFD 3E96A 3SN4A 2F61A 4FNUA 4D1IA 2ZC1A 1XSJA 1W8SA 2EF9A 2VDHA 5FESA 2VFHA 4DJFA 4M1RA 2VZVA 4JN8A 1DTUA 3CZJA 2HROA 1GG0A 1WZAA 1XLBA 5GNZA 1YADA 2VRKA 3VNLA 3LNPA 2XG9A 4FXSA 1CXFA 3IPWA 4QQ3A 4GYKA 3AMDA 2ZA2A 5DANA 1AJZA 1TIWA 3S2LA 3RXZA 3KDNA 4H8UA 3SM0A 2Y5JA 4NYYA 4LUJA 5IOBA 3BAYA 1FH8A 4EXBA 1KCKA 3ZVIA 2E25A 2ZDRA 2PFHA 3EWDA 2W63A 4DF1A 1UIPA 1F9CA 1E6ZA 3RRXA 2WWDA 1J01A 4ZO7A 2DUZA 1FA2A 4W87A 2OWXA 5FL0A 1TJ0A 1Y0EA 5IM51 2R1PA 2VCAA 3PWIA 1DE6A 2WXDM 2ZZ3A 1NSJA 5LA2A 1PDZA 4Q8PA 4YN5A 2BGSA 2HE8A 1KC7A 1DIOA 2Z1VA 2GQ3A 3TIMA 4KCTA 3OEXA 1J0ZA 4S3CA 1MRAA 4JIEA 1TPEA 3A9IA 2NQJA 3EKZA 1TA3A 4GQ0A 4MB4A 1JVNA 4H9YA 4NSBA 1HP5A 3CNYA 5BMXA 2BBFA 4AD5A 3N15A 4AWSA 2PTXA 2ZVRA 1S2WA 2CZFA 1V3LA 4QG9A 3CJPA 7REQA 1JDCA 1F3EA 2OX1A 1RH9A 3UF9A 3WBAA 1NOFA 2Z2AA 3NL5A 3LCLA 1KLZA 3TMQA 3LPFA 4XX6A 3MWCA 1HKJA 5K9DA 1RHCA 1TQJA 4DYJA 3LYEA 5AYIA 4ADSA 1NP2A 4NZJA 1GK8A 1V4YA 2OJPA 2AGTA 1VFOA 4XTIA 1UCWA 1QPNA 1HJQA 3WJWA 2J6XA 2FDMA 3WMSA 4KRTA 2V5LA 4L80A 1TX2A 5HNTA 2OSYA 2XN2A 4A22A 4Z2GA 2IMRA 3W7MA 4M1BA 3MMDA 4A4AA 3DYMA 5G1MA 3B9EA 3UNTA 3JS3A 3W6MA 3BPWA 1DJXA 4DNMA 4HMDA 3ZVHB 2E8ZA 3AI0A 1OBAA 2AQWA 3OQ8A 1QRQA 4WJXA 1NDYA 2BS9A 4GO9A 4YVPA 1A5BA 3CWHA 1SU5A 3LLFA 1SZRA 1UD2A 4H00A 5DY2A 5GQBA 3TXZA 5HJYA 4MKSA 2FMOA 2EPMX 1EDTA 2HCVA 4FNSA 4J2MA 1IEVA 3FK4A 4L9XA 2ZOXA 5IBXC 2OODA 5D9OA 2PUZA 2QPUA 2TSYA 3JZUA 1RQBA 1RSCA 2PD9A 1V6WA 4MZ1A 1GYLA 3O16A 1BF6A 4H9UA 3UEQA 3AZRA 1A3HA 3VM7A 4RE3A 1TVPA 2V5KA 1M53A 1NFBA 1YE4A 3UQNA 4HK6A 4MAVA 1TPC1 4PMRA 4NY2A 2ZZ1A 2QJGA 2WM0A 3IJIA 3AHYA 2WKJA 4UB9A 2LLEA 1F8IA 4H8NA 3GY1A 2QCHA 1HTIA 2YA1A 4P8WA 4Q8QA 2Z1KA 4UMCA 1DQWA 5E9XA 3S2MA 2CBVA 5LHFA 2E6YA 4DZIA 2Y7GA 4AIBA 3HIJA 3VDGA 2WHLA 4CD5A 3FS2A 5GNYA 1V8EA 1CX9A 4RNIA 3ICJA 3PHAA 1UZDA 4LVBA 3M0YA 1CW2A 4DXKA 1DJWA 3GNNA 1N82A 4WDUA 3R8RA 2BTMA 4H8VA 1VZWA 4Q4OA 2MNRA 3GUWA 3NL3A 4TXEA 3B8UA 4Q8VA 3M0XA 4PRRA 1G0CA 4JTRA 5FSEC 3L66A 3NGFA 3N9RA 3BGJA 4GNJA 1HKVA 1BAGA 3MHGA 4AHOA 5C7HA 4AZGA 4U28A 5BRQA 2WPGA 1W31A 5DN1A 1B9BA 3GXDA 3HPSA 1HN1A 2JQXA 2WNQA 2A1YA 2OPJA 2O9OA 3W25A 4KQNA 1WKDA 5HR6A 2NXHA 2WMJA 4JX5A 3KDOA 3SJNA 2J8FA 1FRBA 1XUUA 3GDKA 2WPBA 3F5LA 4ACZA 3VOJA 3GXFA 4F9JA 1TV2A 1DXFA 4LANA 4LY8A 7ODCA 4G1NA 1DVJA 1R3YA 1XH2A 3N6HA 1EHNA 3ZZ1A 4OFCA 1Q45A 3RMEA 2VDGA 3KVMA 4QJ1A 1EF2A 5JIWA 1Q6LA 5CG7A 2XVNA 4BF7A 1W3KA 2ZX7A 4IPJA 3ES8A 4Y6GA 2CZVA 1H7XA 2RH9A 1A4MA 4CU8A 2DVTA 5EPDA 3F4VA 1E9IA 4TOQA 2W27A 1FWTA 4A3UA 2VC6A 2I1OA 5E9AA 4X2RA 6PTDA 2I57A 3QY6A 2Q3RA 4P8UA 2WLZA 2D2GA 3KEHA 4NXSA 2ZZ4A 1XICA 4CN1A 2KAUC 4DZAA 1FQ0A 2FPTA 4IPPA 4IL2A 1V3MA 4CQ8A 3OODA 1XYAA 2P0OA 2XWDA 4J3VA 4MM1A 1ZTVA 1RLCL 3VOIA 1JCJA 2VHLA 2JEPA 2PWDA 3II1A 5A8QA 4WXYA 2Z0IA 2DEPA 4LEQA 1WXJA 2GFTA 2P8CA 5AHEA 4S2BA 1VRDA 4JDBA 4O54A 1TZZA 1LRNA 4LC6A 3NVDA 1I2RA 2I9EA 4MTVA 4MY9A 3WUEA 3RLHA 1ZU8A 1DBTA 3MYPA 2WMFA 1QMLA 1RQHA 1XLKA 3CV7A 4LAUA 4JFTA 3GX9A 3MUCA 1JCYA 5HAOA 4YHEA 4GQRA 4M29A 3OLIA 4N9DA 3RMJA 1R3WA 1K70A 4GBDA 4FF5A 4TVCA 4ZO9A 4MNMA 4AIOA 3LHTA 3SSZA 3AMGA 1ESWA 2WM1A 3NM1A 4DYKA 4EACA 3GYCA 2DSZA 1FHVA 4WGXA 3WN6A 4HU3A 2I5GA 3W1UA 1EJVC 3G0XA 3WYZA 5U7SA 3T4WA 1PWLA 1V79A 5AFDA 1VPQA 2WZMA 2V8ZA 3WY1A 1RR2A 1D8WA 4AEEA 1QW9A 3CO4A 4PMJA 1PSCA 2W79A 2OSXA 3OZPA 3THAA 4G6CA 1FWRA 3L4VA 1NWRA 2J9ZA 1J8VA 2PGFA 4LBRA 4NQ1A 3GO2A 4ZQPA 3HOJA 4YCPA 1UH2A 3I6TA 5JMUA 4WLCA 1DIKA 3MSGA 5CBBA 2WKGA 1OSEA 3NVTA 4JFSA 3RAOA 2P50A 1KTCA 4ADTA 4TTGA 2IXUA 5HUOA 3G3MA 4HYWA 3WNLA 1S3TC 4Z1BA 4FOKA 2DUXA 9RUBA 1A53A 5JBEA 4FA3A 4RNHA 1Q66A 3R12A 4V27A 4UNLA 2VFGA 4LW7A 4P7LA 4QE4A 2B7QA 4IIFA 4C6EA 4JY8A 1M6JA 4CNOA 1X8CA 1CI1A 4GI8A 1PIIA 1WBHA 5BOEA 1M5WA 3GFYA 4ZMGA 4DI9A 2PLCA 8RUCA 4TV5A 2EG7A 1FY6A 4O11A 4J3SA 4JKMA 2VEIA 5MKGB 4M24A 4P8VA 4BF9A 3HB9A 3BJTA 1TPUA 1KFLA 1TYGA 4EF8A 1S1PA 1XBZA 4MY1A 1UZ4A 4BQ3A 1VFUA 2BGQA 4W8BA 1H49A 3W38A 3S1VA 1RA5A 4J9JA 4AISA 4D8ZA 1OYBA 5CBJA 1N8WA 5D32A 4O8RA 1JPHA 3O6AA 3AMCA 4LRTA 4I9JA 3EOOA 1RK6A 1LLWA 3HTWA 3W2LA 3CUFA 3LU2A 3JVAA 4ZVJA 5HOSA 1F8MA 3WBYA 2QPSA 3UY8A 5LA1A 1FDJA 4NZCA 1LOQA 1E6QM 1X96A 5JIPA 3EDJA 3QJAA 4MWAB 3VO0A 5G1TA 1AL8A 2F38A 2NQZA 4K36A 2NQ9A 3LPOA 1R3QA 1IIHA 5A6KA 1EH9A 3GLCA 1SJCA 4ZB5A 2XPKA 1OGGA 2O4MA 3LCFA 2O9TA 2Q6ZA 4JTQA 3LK6A 4JYDA 3AWOA 2D0FA 2P10A 3BH4A 1V7YA 3HM7A 2D23A 4KT2A 1VC4A 4WCJA 1B9ZA 2E68A 3CPGA 2J6VA 2OB3A 4PB5A 1S5MA 5LA0A 4I7WA 5FAJA 4UTKA 4F66A 3G1XA 3POHA 3OLGA 3AXIA 2XIMA 4YYCA 1JUKA 3A6OA 2IPJA 3CAWA 4GUIA 1UIOA 1XKYA 4FMVA 4H83A 4N9BA 2FVLA 2B7NA 3THUA 1JPIA 1MQRA 3MI6A 1KCXA 5B7ZA 3PS7A 3L4UA 1I8JA 2XH7A 2PC8A 3FDGA 4DIAA 1ME8A 3URQA 2DDXA 3WJYA 1OFAA 1ZPTA 4JQ2A 3KZPA 5T8GA 3ARRA 4Z0SA 2E8YA 2RKXA 2XVGA 3IJQA 1E70M 1OIFA 2YBUA 5KZDA 2E5BA 4QP0A 1ZALA 4JTIA 1KBKA 2Z1XA 2ZZ7A 3QOKA 2G4JA 4JNZA 3LD5A 4KFPA 3FYOA 1V0NA 5AZ1A 3OO2A 3UD6A 4JNYA 4W7VA 3V0UA 2JIEA 5CCZA 2CBIA 1LYXA 4LALA 1U5VA 5ABHA 2A85A 3EDEA 2QXWA 5BCAA 3CGTA 3L0GA 3HQNA 4C90A 4LS2A 1G01A 5DQPA 3H4XA 3WDIA 3LLDA 1B90A 1LM1A 2ZX5A 1DJHA 2A3HA 2WVTA 2YDRA 3WD2A 4HN8A 3IK2A 3MPGA 2OKOA 2PDJA 2XINA 1JUBA 1C29A 1EYEA 1ZAHA 1XLAA 1O5XA 2E6AA 2IPFA 2J7DA 4LVGA 1H3GA 4Z17A 1M04A 4M0XA 3ZLFA 2PF0A 5CKSA 1VHCA 3TJXA 1UWAA 4D6CA 4M6QA 2GPTA 2BXVA 1F2JA 1PUDA 4ML4A 4H01A 4HHMA 3N6QA 1AFSA 5HQMA 5ABGA 4CCEA 1XM3A 4IXXA 3H70A 1SR9A 4UTWA 5D37A 4WUIA 4FX6M 4GY1A 4UTJA 3MCOA 3W7QA 4H8HA 5AYYA 2OKTA 1V0KA 3QXBA 2NV1A 3DFYA 3NDOA 2VEGA 3S1WA 1C92A 1HG3A 3FN9A 1VBHA 3VU2A 2WMKA 3PUEA 4RK8A 4OTKA 4B5SA 1A4LA 1JI2A 1BVWA 3EEZA 3KRSA 3MHUA 1J0JA 1DE5A 4DBWA 4QROA 3MU7A 4U3AA 4PTVA 2HMCA 1LL7A 3W7EA 3PM6A 2ZUWA 5K9XA 5E6ZA 3QZEA 2JGQA 2Y61A 1O12A 1I2PA 2HTMA 1S2UA 1ZQ5A 2OZTA 4BWLC 5EA9A 4GQGA 1M1BA 3GTHA 3KBNA 2FZ9A 4PUWA 3N14A 5I5RA 2DV0A 2Y88A 4UFLA 3NQFA 4HHLA 1XIBA 2CIPA 4WX2A 7TIMA 1L6FA 3ARVA 4UTUA 2IQDA 1XQKA 3TQ0A 3IIOA 2J7BA 2Z7KA 3WF4A 1VIWA 2QR6A 2RDUA 1ZBKA 2J8GA 4Z2JA 4WQ6A 1DJIA 1WKYA 4L1XA 2TODA 4JKLA 4XO7A 1UWUA 4NRSA 3DENA 2YCKX 1J5SA 3SCOA 2ATSA 1Q2RA 5CJNA 4GHRA 3TJIA 5AVHA 2ISWA 2ACQA 2YDQA 4IOTA 4F0HA 2A7RA 5I06A 1JAKA 3EWUA 3KBMA 2OWCA 1MZRA 4N6EA 4C6BA 1J9YA 1NELA 3BZJA 2XN1A 3B0XA 2PDPA 3Q58A 1A5OC 2PLKA 3E12A 3XIMA 1I2OA 2DZPA 2WVVA 3W9ZA 1KBLA 3SCTA 4J7RA 2FB2A 5AC8A 4QQUA 1JCMP 3L4ZA 3LHZA 6CGTA 3QBUA 3Q65A 1E1EA 1KD0A 3BQ5A 2ZX9A 4CQBA 4W93A 2XIOA 1XBXA 2J78A 4AVOA 1P7TB 1LZOA 4Q4SA 5M5DA 3REQA 1LTDA 4CN4A 1CLVA 2VX7A 2P1FA 2IPGA 5CC6A 3SY1A 4B5WA 4HTBA 3GTIA 4ZQCA 5DO8A 4F48A 1O95A 3PZMA 4BQ5A 4HQVA 1W32A 2INFA 4EPDC 3KWSA 5DXYA 3VGFA 4IIEA 3H2NA 4CNTA 3CU2A 3HG5A 1WNOA 1GOIA 3V4BA 3SGUA 1TWSA 3W72A 5A2AA 2Z7GA 4O1EA 2V0TA 2ZRUA 4YTRA 4A2SA 2YW4A 1VFMA 2V67A 3NQ6A 4DUWA 2OQHA 4E38A 5HWNA 2DZXA 4H7VA 4QE5A 2XSXA 3HG3A 1NQ6A 3GK0A 5A6JA 1F6PA 3BLLA 3N19B 4QEEA 2E6FA 4OT7A 4OJYA 4IICA 2Z4GA 3VPLA 4Z1CA 1FWNA 1PZ1A 1W9VA 4J35A 4NZ3A 1Q6GA 4RDZA 1E5JA 1QW8A 2WMHA 3PY2A 3UA3A 1BSIA 1VHNA 1X7IA 3R79A 3OVQA 3EX6A 2WOQA 3WH5A 4MFEA 3UWZA 3NQ7A 1BXBA 1KM1A 3G77A 4LYRA 3S3GA 3WDRA 1JRCA 2QLYA 1SFTA 3I3EA 2VUNA 1CDGA 1ADSA 3Q2DA 2A21A 3CIVA 3SRFA 3S2CA 4IUOA 4MB3A 1FBAA 3UPBA 3U4FA 2REQB 3MSYA 2VFFA 6REQA 2G3JA 4AZBA 5E93A 3VA8A 5D02A 5AHMA 3W4RA 1YXYA 1ZZMA 3GU9A 1FDZA 3VMNA 3RFAA 1RY8A 4HMNA 3PJUA 1BWVA 4CNNA 4G2DA 3W1AA 1R2TA 2A7PA 3NDYA 4PN2A 2NLYA 1IF2A 4IMGA 2Q8XA 2W66A 3ARZA 1OABA 3C0QA 3HGRA 4JIPA 4BI6A 1D8CA 3FY1A 5A5WA 4A8IA 3ONBA 5EMUA 1FWFC 2TPSA 1EPVA 2A6NA 4XV0A 1FHUA 3UCQA 5C9RA 2WQDA 3C2RA 4H1ZA 3TEVA 1TR1A 3EXRA 1DL3A 1X6UA 3W28A 1GOKA 3DFQA 3I3BA 1CGTA 4EP8C 4MZYA 3PTKA 4GUGA 3E0IA 3KOZA 4RZ5A 1SZFA 1GCYA 1JZ7A 2YKKA 4WY0B 2CW6A 1A5NC 3KAOA 5BOFA 2QCMA 5IDIA 3W02A 4QR6A 1US0A 1EEXA 4MIMA 4NU7A 5EBUA 3TA6A 3TP4A 4HP5A 1F6KA 4KW2A 3A3XA 4GGBA 2X2GA 4AZHA 3H2OA 2ON3A 1EP1A 2CLIA 1QHPA 3T0BA 3KL5A 5G2WA 1TVLA 3QR3A 4HZ8A 1PS9A 5REQA 5C55A 1PV8A 1UZ1A 3LCGA 1XIFA 2DY3A 3P67A 1P6BA 1FWAC 1XRTA 4LUSB 3USZA 4KWWA 1HL2A 2JIWA 2DQWA 1C91A 3CHFA 4JQ1A 2YCEA 1WB0A 1NWTA 5C5YA 1RK5A 3FSUA 1R46A 1RBLA 3RO8A 2A5HA 1CGVA 4PB4A 3RF9A 3TSBA 1J6PA 5AYZA 1DQUA 1US3A 4XAPA 3RJXA 1QI2A 1UJPA 2E09A 5EMLA 4L5ZA 4YMZA 3MO7A 1ITXA 3GSMA 1OFEA 3SN1A 4JIHA 5KEZA 1T6MA 5A6MA 4ICMA 2CBJA 3DC0A 4C6DA 2ZKMX 4RLIA 1SO4A 3AHTA 4MLJA 1M65A 3CUXA 1WPCA 2V69A 3NQE