4Q6JA

Crystal structure of eal domain protein from listeria monocytogenes egd-e
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
248
structure length
245
Chain Sequence
DISSTEIWDAIRRNSYLLYYQPKVDAKTNKIIGFEGLVRLKTATTILAPIDFFDDIVLLNATREMQDFVAETAIKQINQLGGRFSISINIPAHYVASSTYMTFLHDYVKEHLKYPECLEIEIIERTELAIADKNLRKIKDLGVKVSMDDFGKGYSSLAYLRSLPIDIVKTDMSFIALLKTDRKQQIIIRAIVNLCHDLGGKVVTEGVEDMEQVEKLREMKVDYFQGYYFSRPLPMEEIKQKYSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Lmo0131 protein
publication title Crystal Structure of EAL domain Protein from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
total genus 83
structure length 245
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4q6jA00
5M1TA 3S83A 4AG0A 3GG0A 3PJWA 4F48A 4KIEA 3GFYA 3N3TA 4RNJA 4Y9PA 4LJ3A 4Q6JA 4FOJA 4FOUA 3PJUA 4FOKA 3KZPA 4HU3A 4J40A 4Y8EA 4RNFA 4F3HA 3TLQA 3GFXA 4RNIA 4AFYA 4HU4A 3GFZA 4LYKA 3U2EA 2R6OA 5MF5A 4ES4A 3PJXA 2BASA 3GG1A 5MKGB 3SY8A 3HV9A 3PJTA 5MKGA 4Y9MA 4Y9OA 4Y9NA 2W27A 4HJFA 4RNHA 3HV8A 3PFMA
chains in the Genus database with same CATH superfamily
1G94A 3TCSA 4GZEA 4PUJA 1OFRA 3GAYA 4OBSA 3RJXA 4KF1A 2A3HA 3SIZA 3K46A 1TFVA 4BJHA 3MUY1 1A0DA 3E02A 1TKKA 1B9BA 4MB1A 2XJ7A 3RUBL 4MY8A 4H41A 1IWBA 3BGGA 2E40A 1D8WA 1CXKA 5FJRA 1L2UA 3GC5A 1H1NA 2P3ZA 3SURA 3M5XA 2DSKA 5CPOA 5I09A 5DCBA 3E38A 4N7QA 1EJRC 2YCIX 5DANA 1K03A 1RAKA 4XZ9A 1E6ZA 1BXNA 3W53A 4I5UA 4JBRA 1M68A 5JBDA 3GFZA 5CPTA 3OU8A 1SZRA 5IDIA 3IVSA 1XP3A 2ACQA 3G6LA 3GS6A 3AXKA 3QSTA 2BB0A 3GKFA 4GYPC 1M6JA 5I3DA 2VGGA 3IJ8A 1ISYA 1AH3A 4C91A 4IGMA 3MI6A 3ISIX 2BGSA 1FVPA 3R6IA 4Y7EA 3R4IA 2XSXA 3UEQA 2C6QA 4Z2HA 1R30A 1O12A 3ABQA 3IPWA 3VIIA 2DZTA 4JTUA 3USBA 4HHHA 4N4QA 4IIFA 4ALDA 5IHRA 2BTMA 4Z1BA 4LVFA 1R8LA 3OIHA 3UZ5A 4ZQNA 4KIRA 4L1XA 3TYBA 4MUPA 2XWDA 2YL8A 3ANVA 2Z2BA 5AC8A 2WMGA 3ARRA 2GJPA 2P0IA 2OO0A 3EOEA 3DBNA 3EB2A 4NI3A 1P0KA 2WSRA 4O4VA 3WMSA 3GRIA 3VMPA 1V08A 1IV8A 4YIWA 2YW3A 1EJ7L 4UTHA 1B3OA 2E5DA 2FH6A 5DQPA 2QS8A 2ADAA 2BNJA 2DIJA 4Q4KA 5DXYA 3THQA 1E70M 1YDNA 2OR2A 3GDBA 2YA0A 3T42A 1T8QA 5A8OA 3NJ3A 1XX1A 1YDOA 4H7ZA 4NILA 3P2VA 7ODCA 1GEQA 2ZXQA 3S1XA 4POCA 5A8GA 4BQ2A 1YTEA 4L6DA 4ADSA 3S2CA 5I00A 2CESA 3QR1A 4AIOA 1E9LA 2VENA 3VKBA 1HZYA 1Y0EA 1PKMA 3NQCA 1PEZA 2PLKA 3LXAA 3BL3A 4LBUA 1DXIA 4LAZA 4YMZA 5A6BA 4PCNA 2WSKA 1A5NC 3TSDA 4AVNA 1NDZA 1GKRA 2RFGA 4GFIA 5CAHA 3UZJA 4GD0A 1E0XA 1YEYA 4DNMA 1OX6A 1E73M 3AALA 4J3UA 5EA9A 4HGXA 3CTLA 2BBFA 4K8GA 2HNHA 2JFEX 3GC4A 1TB3A 4AG0A 2PRLA 3EEZA 2PODA 2PDFA 1H49A 2RUSA 4RX0A 1UA3A 1G5AA 1F4HA 1BQGA 2C8NA 3TN6A 1RLDA 1YPIA 1NEYA 3PZNA 4I6VA 5B80A 4PMVA 3WJZA 4MAVA 3G2GA 3WZ0E 4J7RA 4QNWA 5EKYA 1VBJA 2JIEA 4KEMA 2F2HA 3QR3A 3DGBA 3L4VA 3QEZA 4K8EA 3R0KA 3FKRA 1FHUA 5BXRA 1W37A 3RCYA 2QCFA 3AIEA 5AN7A 4Q8NA 5L6UA 4F4RA 4LCSA 5D8WA 5I7GA 3PZ9A 3RJYA 3N73A 5CJNA 3TA9A 5BZAA 2ZOXA 4OECA 4MSSA 4JX6A 1RZMA 3GO2A 1VFSA 3O0FA 1Z42A 2E28A 4DBEA 1R2SA 2ZDSA 4AZCA 1I9CB 1PE1A 3I6TA 3L5LA 2YXOA 2BASA 2Y7FA 2H90A 4IX0A 1HGYA 1ZLPA 2V2HA 1TWWA 3VCRA 4XWUA 4D8AA 5KTLA 2E8ZA 1G01A 5EGRA 4A2SA 5LXXA 1XICA 5KZ6A 1EGVA 2CKSA 4AVOA 3IJ6A 4OJYA 5U4NA 1X8FA 3DFOA 2Y61A 1CXEA 4BF9A 1MW2A 3BLDA 1Z41A 1F2JA 3R1ZA 1LG1A 1P6BA 4M5PA 5C2XA 3TMQA 2OFJA 4HNUA 4Q33A 2DP3A 1X6LA 2Z1BA 1R9XA 1TIMA 2OLSA 5DMYA 4IICA 2I9EA 2PC8A 4IJBA 1B3ZA 2ATSA 3WIJA 1FCVA 5BMXA 1REQB 3LI0A 3BZGA 1JYNA 3F4CA 2VC5A 1SFSA 2JIWA 1IIGA 1DL3A 3FFSA 3MI2A 3QQ1A 3JUGA 3E9AA 2VYOA 3W83A 3H2CA 1NU5A 4B15A 1WXZA 2FPVA 2ZTKA 1X7FA 5J8LA 1GVEA 3BK0A 4YJ5A 1TE1A 4JY8A 1TJ0A 5LSMA 4MY1A 2J74A 4MVAA 3KBSA 3CHVA 3VMNA 2BS9A 3QH2A 1G6CA 1K70A 3N6QA 1SR0A 2PZNA 2TPSA 2WNWA 1X7IA 3DU0A 3G18A 1EZWA 1WB0A 3L5MA 3S6DA 2HPIA 3W84A 3QPYA 1Q8AA 3TJIA 1E9ZB 1W2VA 3XISA 5AC4A 4AD5A 4J3WA 3SFKA 3GH5A 1OCBA 3GB6A 3H2NA 5HUPA 3S0CA 1RP9A 2MNRA 3WQWA 3MYOA 1D7FA 3M46A 3AIWA 1THFD 4PUUA 3DYMA 3K13A 4WEVX 2QUNA 3HA1A 1QNRA 4NZ4A 3HIJA 8TIMA 1KGWA 1WKDA 1DPMA 3RX3A 2FYMA 3KBVA 2ESCA 1M5WA 1XIBA 1TMHA 2PDMA 2ZZ5A 4KFNA 5BRQA 2VXNA 1RVGA 2Y6ZA 3Q58A 1ECQA 2J8TA 2RH9A 1GJWA 2XINA 4FHAA 1JCXA 1Z3NA 2NQHA 2FFCA 4CN4A 3QW3A 2E7FA 3DFNA 3V18A 2HNEA 3W4RA 4JQ3A 3BO9A 2QCMA 1XBYA 3OZPA 5GJMA 1P0DA 1B3XA 4HK5A 5TF0A 4FEZA 2WZTA 3C0JA 4E38A 4LCQA 5JQ9A 4NU7A 3HJZA 2DSVA 3DYPA 3THDA 1UOKA 3U3HA 2G37A 5FI8A 1FP8A 5F2LA 4R7WA 5HWNA 3N1AA 3ITCA 5K9XA 2GZXA 2DPEA 2QIWA 1PWLA 1V6TA 3S6TA 3G22A 1NJJA 1ISVA 3VCCA 2Z1KA 1BTMA 1TJ1A 3OHIA 3UG3A 3ZWTA 3UR7A 1OCNA 1MDLA 3MYPA 4UTWA 3GC2A 4CCCA 1RY8A 4R33A 2ZUNA 1I2OA 2C7FA 3EYPA 1EJXC 3NL2A 1WKEA 2VQUA 1XV8A 3KOXA 3TDFA 2YSWA 4HOXA 2WPGA 4QX4A 1R3YA 2J78A 2O7QA 1F8IA 1P4CA 2EQDA 5CSUA 1SUXA 4H9ZA 3PZMA 3GM8A 4FNQA 5I3IA 2LLEA 3M0HA 1PKLA 3H54A 4JNZA 4EE9A 3IJIA 1FWGC 4QM1A 3DG6A 3AWOA 4MWAE 4QITA 4YYCA 4GINA 1UG6A 2VEKA 1BXBA 1XIFA 1XLMA 4WDUA 2QHAA 4GXPA 3CL7A 2FGBA 4DO5A 1N8FA 4CCDA 1ITCA 2ZADA 4IFRA 1EP1A 1A47A 3N3TA 5GNZA 2ANUA 1E6PA 4LAMA 1PPIA 3OVPA 2GSEA 1CT5A 2J7BA 4RDWA 2AKZA 1AK5A 2V3GA 4AZ5A 1WAUA 3CGTA 3P0WA 4Z42C 3WMLA 1PBGA 3IIXA 2OEMA 3T4WA 3S1WA 2YL5A 1A5MC 2OTDA 1I75A 2JKAA 5C0QA 4XUYA 3CH9A 1WOAA 2CHNA 4GKTA 5DT7A 2WYSA 1OB0A 3VNLA 3BCJA 1LDCA 1WDRA 1KXTA 2NUYA 3SCTA 3QYSA 2BHUA 1F3XA 4O1DA 4EOUA 7TAAA 1LL6A 3L21A 3PTKA 2PWHA 3I4KA 3CQJA 4C1NB 4U10A 1EYEA 2QYGA 1JCTA 4WDTA 4ORMA 4EVZA 1EHAA 4RNJA 3O0KA 3GW0A 1R5YA 2B7NA 4LNCA 4RDYA 3A4JA 4FIRA 1XS2A 2X09A 3GVRA 3KVMA 3W7NA 2OGYA 2Y5JA 3MKVA 5AYZA 3G3MA 1W1YA 3H8AA 1LOLA 1OX4B 3F4NA 3VD7A 2V5BA 3A6OA 3G24A 4FF5A 1KM6A 2IKJA 3AS1A 3IAQA 1B4EA 1ZSXA 1PS9A 1OINA 3GE7A 4CUCA 3I65A 5JBEA 1UH3A 3CZEA 1V0KA 4ZFCA 4LYQA 2QCGA 3EWDA 1DWGM 1EP2A 1UJQA 5ABFB 3L4XA 2ZRUA 4B5VA 3DOPA 1QW8A 4QJ3B 3U2CA 1FCBA 1M53A 1L6SA 4R85A 4BI6A 4J3ZA 3OEXA 2PU1A 4AY8A 1S3HA 1TPVA 4OT7A 4PB4A 3BV7A 4M8UA 2R1NA 5LNUA 3GG1A 4G1KA 4K68A 4DZ5A 4PBGA 4PCSA 3M47A 1JCNA 3TV8A 1I2PA 4D8LA 4IIGA 3NQFA 1Q65A 1U83A 3B9OA 1JD9A 4LPCA 1XH2A 1TV5A 3I3BA 4L64A 4MZ1A 1V7AA 2RDUA 3GLCA 3ORWA 1WZAA 3SRFA 3W86A 4P61A 1RR2A 4F0KA 3Q45A 4MWAA 3B03A 2E4TA 3MJYA 1E15A 1KRMA 3WD4A 1UWQA 5SWUA 5L9FA 3SSZA 3OTRA 4WKFA 1NDYA 1MNSA 1XDJA 3K2GA 2ATMA 3VOJA 6PTDA 1GG1A 1CGWA 4C5YA 2IQDA 4AB4A 1I2QA 3MUXA 4DJDD 1RCQA 3U8GA 1EZ2A 1FKXA 3LBOA 2H3DA 1ENUA 3OZOA 3Q94A 1TSIA 3LHVA 1K4HA 3UGVA 1YNPA 3W24A 1RD6A 4B5XA 3DFSA 2WWDA 2ZYFA 1W54A 5CC5A 2VFFA 4MKVA 2P76A 4FB7A 4KMQA 2QJNA 3LENA 4H6RA 9XIAA 1O6IA 1XGDA 3STCA 1TPFA 3V5FA 1QNQA 4FS9A 1UD3A 2FTYA 1PIGA 2NWSA 4GRSA 5FJIA 5HPCA 5KEZA 2INZA 1XL9A 2VDGA 1IEIA 4C6CA 1V02E 1I0DA 1X6UA 4JTIA 5HMEA 5BU9A 1JULA 1SFJA 2QAFA 4XTDA 3KVLA 4GGHA 3FJNA 5FKYA 3M0IA 1R3RA 2Z1VA 3UERA 5CGTA 2G5WA 3GVQA 4MPKA 4Q3MA 4W7VA 4HSHA 1KTCA 1NF7A 3EA3A 4BQ5A 2NVAA 5BWAA 3TNBA 1ZBKA 3T6CA 2FGLA 3H2FA 3EGJA 3USZA 1S38A 2E3ZA 3G8EA 1R7OA 2NQ9A 1PDZA 4QDMA 3LA4A 3W2JA 3W6MA 4YXGA 4WCJA 1PHQA 3L68A 3G1HA 4PSRA 5DFAA 4AD3A 2VGIA 2MUCA 1J5TA 3E2RA 4RKAA 3P61A 3ZJ8A 1UZ1A 3BCDA 2Z24A 5FAGA 1OVDA 1KGUA 1BYCA 1QW7A 3S9IA 2VRJA 5BOFA 4GKLA 4JYDA 2BX7A 3EPNA 3VGFA 3WDQA 2WHJA 5CLTA 4GYJA 2PD5A 1OZQA 2ACRA 1P1XA 4AYSA 4D2JA 3MUZ1 3KBMA 4UFMA 4DY1A 1B57A 3ARSA 1GZJA 3H70A 1JYVA 4MB3A 4RZ6A 1M7OA 1E55A 2GDUA 4KWWA 3WH5A 2FH8A 4XIMA 5B7ZA 3K4DA 4HJFA 1Q4WA 4M6UA 3VXGA 4CN6A 1D3GA 4IXHA 4F48A 4RW3A 3FCPA 1BPLB 2NXIA 2PE4A 3KWXA 2X0HA 3DENA 3PBYA 5K3VA 2PGFA 5BROA 3F5JA 4PH6A 2F8QA 4TX6A 3LOTA 3WJYA 2ZWYA 2UY2A 3T78A 3KP0A 4RV3A 4HU0A 2YR1A 4ZQMA 3R7MA 3TROA 2I5GA 4WF7A 4ZBCA 1PIFA 1D3CA 3C2YA 2WK2A 2OQLA 4CD5A 4L9XA 3VGBA 5IDZA 4LU0A 5A3HA 5CGQA 3BZJA 4LFYA 2OSWA 1ECEA 3MVIA 1JZ5A 3O3RA 2GJXB 4Q4QA 4RLIA 5FL0A 1E4MM 3V35A 4UTJA 2X1RA 4MKNA 3ECQA 1U30A 2CYGA 3AISA 3IIVA 4ZGYA 3BICA 3RIKA 1RLCL 1SFLA 1QI2A 4G6CA 3NFUA 5BCAA 4PBFA 3PZIA 2XGBA 4D6EA 3HG5A 1KFLA 1EJTC 3H6OA 3N19B 2E9LA 4GWEA 3KRBA 5FF7A 1Q13A 3WEMA 4AD1A 1UR2A 1EC8A 1M03A 3PUOA 5AHLA 1HNYA 1A4LA 3NPVA 3T8LA 4LS1A 4KETA 3WLOA 1X8CA 3ZT5A 3E3HA 2VEGA 3W7HA 4D1JA 3VOFA 4I7VA 3A5FA 4S3BA 1VBGA 1O94A 4NAFA 4TU1A 1HKMA 5HWMA 3NVTA 4K38A 2D69A 5ECUA 4WGHA 3IVTA 4E3TA 5C2CA 4YHGA 4E4FA 5K9CA 3CBWA 3IEBA 2KAUC 1MFVA 5AYBA 1CGVA 1UWIA 1F74A 2D3NA 2QV5A 5FAJA 1R86A 4XAZA 3KS6A 4YTUA 1V02A 4GIRA 4LRSA 2OCZA 1XHGA 4IGHA 4LF2A 1XR2A 2EG8A 1TPB1 4LS0A 1K8CA 3R5EA 4V27A 3WQVA 2QZRA 1XC6A 3UXLA 4KH2A 3DECA 3W73A 2YGYA 3WLQA 1O7AA 4H9UA 3GG7A 1L6WA 3OVRA 1EKOA 4H8NA 4C7DA 4DBDA 2PDGA 4AFYA 1O5QA 4NJHA 4U33A 3T81A 3UJEA 3P82A 3BURA 1QASA 5A6AA 5FJOA 1B3VA 3FEQA 5LNWA 2QJHA 2EBNA 1ZQ5A 3VE7A 2WJDA 2QCDB 4WDWA 3B04A 3R8GA 1V79A 1GOIA 1XDMA 4TUFA 3WUGA 1GQJA 3WL0A 3EKLA 3AXMA 2R1PA 2I14A 4J2MA 3C86A 4UBPC 2Y8UA 3BDKA 3QGAC 2FLIA 4Z2LA 2OOGA 3KOZA 2A4AA 1GOKA 4NT0A 4D9PA 4NL1A 2L5HA 1BGAA 2C79A 2B31A 1W8SA 1ZGDA 3W7KA 2NX9A 1XLJA 4I7WA 2J75A 4S3EA 1CI1A 4FOKA 4YTTA 4NRRA 3BPWA 4FI4A 1L2QA 3WLRA 3BAJA 4DBUA 1H60A 3VIJA 1WYIA 5CSYA 3WDRA 3ATYA 5I78A 2X16A 1T41A 1H7XA 3HQPA 1ZRQA 1VYPX 4BQ4A 3QLDA 5G4HC 4M6QA 3IS4A 4BWLC 1GT8A 4UFJA 4CQ8A 1UR8A 2VVNA 3UY7A 1XPYA 1XSKA 4XZMX 1B4KA 4DWSD 1CW2A 2OYLA 3LERA 3EOOA 2B4GA 3PANA 2AL1A 2P3EA 3LTSA 3DERA 1F07A 2BDQA 3BSHA 1IZCA 3T2PA 2O4MA 3HB9A 4MNMA 2QCNA 4AY7A 2PRMA 3ALGA 2AL2A 1YXYA 3KFTA 3DC0A 1SYTA 4S39A 1VPXA 3OQ8A 4H04A 4JPGA 1CEOA 1OCJA 2GQ8A 3STEA 5D32A 3I4EA 4QAWA 3RNDA 3CV1A 5CBJA 3A24A 3SCVA 2FZBA 3YPIA 3JZEA 3AI0A 4WRHA 4MLRA 5D9PA 1KKRA 4Q8WA 4JN6A 2ZUWA 1MDRA 2BV9A 3PZOA 3DDMA 1VJSA 1YE4A 3IACA 1JUBA 2PSNA 3BQ5A 1XYAA 3KRUA 3Q2DA 3WENA 3RU8X 3LM3A 1V3IA 4S3AA 5EBAA 1R7AA 3MHGA 4IPNB 4YPJA 3VKJA 3RYSA 1UUMA 1WP6A 1S5TA 1W3HA 1US2A 4HK6A 2E9BA 3UVAA 4F2BA 3H4GA 3KOFA 4E0CA 5IFPA 3S5YA 4TMBA 1WQ5A 3DFYA 4EAYA 1KA9F 1G0CA 4NZFA 3N6JA 3ZSSA 3CQ0A 4PEKA 1LRNA 3HFTA 5D02A 1JDDA 4MPQA 2F7FA 3UETA 4L9YA 2OODA 2WWCA 3TQPA 4ZR8A 1G4TA 2CU0A 4KGJA 3T55A 4GZIA 3ELFA 1Q6GA 3FY1A 4GUJA 4PMDA 2IW0A 4ZO8A 3BANA 1G4EA 4ZO6A 1ICQA 3M7WA 1W1B1 3P0XA 1EWDA 2BMBA 2VEPA 1JCMP 1QWKA 3UXDA 2PMQA 4MTVA 4TX9A 1W9VA 4AISA 4Q8OA 1QNOA 4OQVA 3SR7A 4PSPA 4J3XA 2PD9A 4H9VA 1S5MA 3PUEA 4K3ZA 4CCZA 1NH6A 3UGRA 2J79A 2QPUA 3AHXA 4EF8A 4F2UA 3VDAA 1A49A 1TJ2A 3LLDA 4W93A 4RK8A 1TUFA 4S1FA 3VNYA 3KOYA 4GQBA 3NDYA 4HCLA 3GU2A 4DXXA 2XU2A 7REQA 2XFFA 2EPHA 4S3CA 1GHRA 1M9HA 4H8UA 2VDHA 1RJRA 4XK2A 5I3KA 1IF2A 6ENLA 1K9FA 2BY2A 4MJZA 4AXKA 5C9RA 1F7BA 1VD6A 4PTWA 1H50A 4PN2A 3SUUA 4ERIA 4ZA0A 1J2WA 3VABA 4WXYA 4B3KA 3VNZA 4ACZA 3QOKA 2V0TA 4JKLA 1SJBA 3AWNA 4D72A 4IFKA 1LLWA 3AMKA 2AGTA 1BVZA 4X60A 2XN1A 1NELA 2X0YA 2PURA 2HPMA 1EPVA 1OFEA 1XYBA 4HPXA 2GQ3A 2O9TA 5F1UA 4HTBA 2CHRA 4IL0A 3G1YA 4LAKA 4H6EA 1W1VA 2PWDA 3CM4A 3W37A 4G7EB 4WR3A 1CB7B 1V0LA 1WPCA 4M19A 2ZA2A 3PN8A 2J27A 4O16A 4GCAA 3NQAA 3TN3A 3QOMA 5G2IA 4JTGA 3WLNA 4JFTA 3POHA 4R9XA 4DJEA 1QO2A 1NIUA 2POTA 4W86A 3W9ZA 2FTWA 3TOPA 2PDQA 4IXXA 9CGTA 1TA3A 1V3KA 2YZRA 4EAMA 4AZCB 3T7VA 1OWQA 4JX5A 3FV9A 3ZJ7A 5AC7A 1QPQA 4OUEA 3ALFA 4O0QA 3RK8A 3WQ5A 3UG4A 4LBSA 2DY3A 3LCWA 3G1AA 4CVWA 3TX9A 3G0SA 1PX8A 1WZLA 3MY9A 3EDEA 1DWFM 1KQZA 1E6QM 5EMYA 1J6PA 1KBLA 1E0WA 2W66A 1TCDA 1FWBC 1PWMA 3F5KA 1T8XA 4DJDC 1H41A 3TN5A 3HG3A 3S46A 3O6CA 3NXLA 2OJPA 4ZQRA 4A3QA 3UZWA 4OU1A 2EJ1A 1JGIA 4HP5A 3DEQA 4Z1DA 1BXCA 4B2DD 1TE6A 3C52A 3H2OA 3FLUA 2G50A 3NZGA 2VL4A 3PVFA 3TMLA 3EXSA 3MKKA 4XVDA 4ROQA 3NQ6A 4MHBA 3AU6A 1FTXA 3TTSA 4PB3A 3KAOA 4AZIA 3FX4A 3NOYA 4R53A 1MXSA 5DRCA 4B90A 1Q2SA 3LGDA 3DYOA 3M4HA 1FCUA 4QTGA 2HISA 1YADA 4E5TA 2BLEA 3TZFA 1QI4A 3DCPA 4ATDA 3G3DA 3UPWA 3MB9A 3KRSA 3L66A 2QQ6A 3TYAA 3CUXA 1JYXA 5D04C 1JXKA 3U7VA 1ICPA 4Q6XA 1SZEA 1GWJA 4PCTA 4AWEA 3AYVA 3M43A 3MHFA 1OFDA 4AEOA 2CITA 2W91A 3A9BA 3FDGA 2R6OA 2UV8G 4HMNA 4HSOA 3UWQA 4N9CA 3CYVA 2PWGA 3M64A 4JTTA 5D2XA 1KRBC 3TJXA 1EB3A 5A95A 4W84A 2E8YA 1YDVA 4ZOCA 1W9XA 1EQPA 1AG1O 5DCDA 1O4UA 3GD6A 1GOWA 1YTKA 2B7QA 2VWTA 2ZZ6A 2J24A 1W0MA 4UR7A 5IOBA 2ZA1A 1W5QA 1W17A 4LYRA 4C6MA 3U4AA 3RMJA 1KFBA 3WQDA 1MNZA 1W91A 3MHUA 1WDWA 2IXUA 4V1YA 5DF0A 2HE5A 3EB4A 5D2YA 1W3TA 4OFCA 4Y9AA 2R91A 4A2RA 4DI9A 3LZ3A 3MCOA 1E1CA 4XD3A 4S3DA 4I9AA 3LU2A 3AMCA 1FWWA 4IIHA 3KHJA 3Q65A 5E5CA 4ATWA 2WM1A 3NR0A 1ZALA 1TJPA 1GVIA 3WD0A 3PSWA 1GKQA 1TVLA 1OFAA 2ZC1A 4GPNA 3CMJA 4FXJA 3OODA 1DTUA 1G67A 4GH3A 2NSOA 4MG4A 2Q01A 4KFOA 3DHUA 3FHQA 1ZPTA 1NFGA 6TIMA 4H9YA 2OZ0A 4PRWA 4ZVJA 3O63A 1VFOA 2Y89A 2DDXA 2VC9A 2OXNA 3N9SA 4QLKA 1BFNA 1VCGA 1ZL1A 3WFAA 5E6ZA 1F5ZA 2F38A 3ZYZA 4UFIA 1U33A 1VH7A 3GTXA 2VWSA 3PWAA 1BG9A 4DJFA 3VZZA 2V6AA 4YLWA 2A85A 3SW6A 4CEXC 2GUUA 1VRXA 4FLRA 2YDQA 2YL9A 3SCWA 4J3TA 2BWGA 4EIVA 2ZRWA 3Q67A 4KWOA 1Q6OA 1ITXA 1A3WA 3LLXA 4NUWA 3LQLA 3H7UA 3OBKA 3DG3A 3OGRA 4LUTA 3CB8A 4FF7A 1Q3NA 4D6JA 1RPXA 4QS6A 3AZRA 3MSYA 2VX5A 3EKZA 4K36A 1IE7C 2QEZA 4IQJA 1US3A 3W6LA 1P1MA 2VFGA 2VM8A 2IKHA 5DBTA 4QR6A 1KFEA 3BOLA 4LC8A 2FVLA 5D38A 3QQWA 1RCOB 1TMQA 1H11A 3BG9A 1F61A 1VIWA 3WH6A 2WC3A 1JRBA 3H4WA 1PTGA 1W56A 3RLGA 3M16A 2D20A 3M07A 4MAZA 4L4PA 1S2TA 2W3ZA 1LF1A 2Z0IA 3W7LA 3W28A 5HOSA 2WB5A 4L1GA 4Q8VA 3AXHA 4LVAA 4F66A 4KESA 3UZZA 2G96A 3URBA 4W85A 3LNMA 3VUPA 3W1LA 1P6CA 1XRVA 3AUJA 4ZTYA 1AQ0A 1ESWA 2FHBA 1XXXA 1LT8A 1WBHA 1NQ6A 5G5IA 2B7PA 3WJXA 2JQXA 4UNKA 3ZMRA 1RP8A 5CJMA 8XIAA 3MWAA 5CQ1A 2NV1A 3NO3A 4O10A 4XG1A 1E40A 3EWUA 2QDGA 3NUKA 3W29A 2WNQA 4AAJA 1YIXA 3CZJA 4ZMGA 4ERAA 4GACA 4UMBA 4F79A 1J0ZA 3NL6A 1BAGA 2AQVA 1VLWA 3R10A 4KEZA 3SCQA 1OC6A 4KCWA 1W5NA 5FF2A 3ABRA 1FFRA 5D9NA 3QC3A 1A5CA 1DWAM 1M7PA 4ILSA 3RM9A 1ZUAX 1SJAA 5LYRA 4QSFA 4GO8A 1V03A 5ENLA 3LM7A 4GZJA 4G9PA 4Y8EA 3DG7A 3BC9A 2Z2UA 4XTIA 4YS1A 3W2KA 1VLIA 2XIIA 3GXIA 4DIAA 3LX9A 1Q85A 1X97A 4NXKA 5AHEA 1HL2A 4NIRA 4S3KA 2WLYA 4DO4A 4WOZA 5LZLA 4IGNA 3A3WA 4DWSC 3N2CA 2VHLA 1X98A 1HO4A 3POCA 1DIEA 3O8AA 1V3MA 2OEJA 1DXFA 4M29A 3EWWA 1B1YA 5IFTA 1LP6A 1A0EA 3ZLGA 3T0TA 5T91A 4XAFA 4MWAB 1GOQA 1GQNA 3OA3A 1HKWA 4Q8TA 1VAHA 3WH8A 1B5TA 2VEMA 3QYQA 3VIHA 4Y9PA 1E4LA 3G1RA 3N29A 3NQEA 5AYYA 3D5HA 3APYA 4XZIA 2IQ0A 1XBZA 5IRPA 5MKGB 4UUIA 9RUBA 1TPEA 1R3SA 4F0RA 1H5YA 4A4AA 3WD2A 4E2VA 2PCEA 3AIBA 4HA4A 3O16A 3CUGA 4IG2B 2AMGA 2QMKA 4X63A 1KBIA 1NWSA 2WW5A 2V3FA 2R9RA 1J18A 1JI1A 3GX9A 3OYXA 3OLGA 2A1YA 4YVXA 1TX2A 3R94A 5D9MA 3G1FA 5HQLA 3EOUA 3BW2A 3ERPA 3GR7A 3P5ZA 4A29A 2YXXA 4U4MA 4CNUA 1ZNNA 1NSJA 4UQ9A 1GKPA 1GHSA 5LHEA 3W7MA 5EFFA 4QQUA 2PWEA 4BF5A 2OB3A 3UXAA 4GJIA 5GNYA 1OFBA 1JQXA 1FH7A 1RQEA 3AIRA 3CYJA 5M03A 1RBOB 2Y4SA 2ZVIA 4M1BA 3SQLA 3B97A 3VILA 4NZ3A 3OG3A 4GNKB 4LALA 1UH2A 3PTQA 4CCEA 1LOQA 1C8QA 1XIGA 2QCEA 3LMYA 4JN8A 1B2YA 1I2NA 1BYAA 2DUZA 1JAKA 1VEOA 3UWUA 2GJRA 3GZ3A 5CAKA 2BHZA 1MI3A 1J96A 3GYEA 1BQCA 5EYWA 4FOJA 1S2UA 3FOKA 3IJDA 3PBGA 1A53A 3K30A 3LGEA 1NOUA 5H8MA 2P8CA 3G1XA 4AX7A 2WZEA 4W8LA 3UFYA 1TVPA 3NPWA 3COTA 3S8HA 5I24A 3LQGA 1UPPA 4ES4A 4W89A 2CZ5A 2DQWA 5HWJA 1C8YA 4CQDA 1PKYA 4MYAA 4XZBA 4B5TA 3J7HA 2A3EA 5FD0A 2ZUSA 2ABAA 4UR9A 1VZWA 3KZSA 1UWAA 4NJKA 8CGTA 1BVNP 5REQA 3W2MA 3UWYA 2DZAA 4WY0B 4MZ8A 4GI6A 4B5UA 3VGDA 4BCEA 2ISFA 5IBXC 4D6IA 1FWEC 1EXBA 4OKDA 4PMOA 2X1TA 4G1NA 2ZX5A 2BOFX 3B40A 3U2OA 3NWRA 1I45A 1VEPA 1TR1A 3HJEA 3GVVA 4QJ5B 3WUFA 3R12A 2CPUA 2VVSA 1AMKA 3RDKA 4PA8A 3LPPA 5M3WA 1BYBA 2IPFA 3KLLA 1V7YA 1NP2A 3V1HA 4PGLA 2HJPA 5AKQA 3OBEA 5C71A 1DQWA 2VNCA 1UP2A 4Y9OA 2OKOA 2EHHA 3OOQA 3LGGA 1JG9A 5EFDA 3EEGA 5FOOA 3VD4A 1IYXA 1XIHA 4A3UA 4DBSA 4DO6A 4JXCA 4WJEA 1OX4A 4D6CA 4Z1YA 3N4FA 3DZ1A 3THCA 1H61A 1OF8A 3BLLA 4IFOA 3IJLA 2UY3A 3KEHA 1RBLA 4US6A 3MSGA 1Y5XA 4GBDA 5D9OA 2QJMA 1XDLA 1S5NA 3LPFA 2ZICA 3HPZA 4HT3A 1RV8A 2ZRYA 3CB3A 4ORIA 1Q4NX 5A2BA 4JICA 2QJJA 3NL3A 3A4WA 1PZ0A 4JCLA 4JFSA 4JIHA 1P0NA 2ISWA 3T09A 2DZWA 4DB7A 4JNYA 1OQFA 1KD0A 2OEKA 2CWXA 3NNTA 1BGGA 3N2XA 2PCQA 2W6RA 3M5YA 4CNOA 3TP4A 4GFSA 1E6RA 2CBVA 3CZGA 4EX4A 3HMCA 4RXFA 1RA0A 1CXFA 1VR6A 4EXBA 1KM5A 2WBKA 1XQLA 1JUKA 4LUYA 3TYEA 1ZS2A 1DIKA 3DI0A 3V1PA 4QCFA 3V75A 3EDKA 4Q8MA 4J1OA 3LXBA 3ICJA 2WNNA 1UD5A 4UMCA 3LV5A 4DUWA 3B8IA 2FZDA 1Z9AA 4QIUA 4IP4A 5B7YA 3L7RA 4Q4MA 3T1GA 2VD9A 3DIPA 1QWGA 1XM3A 3CWNA 2WCGA 4QRNA 4ZO9A 4UQBA 3ZZ1A 2EPNA 4DWDA 4U3CA 2VFEA 3C3UA 1BTCA 2PBGA 4RDZA 5DY2A 2E5CA 4OBTA 4HZ6A 4DEFA 3S1VA 2DIKA 2DVUA 1PSCA 3WLTA 4M7SA 1GYMA 4UQCA 4PUDA 4Y90A 3VIMA 1UMYA 5I5RA 2A0NA 3PF3A 2CBJA 1TWIA 3T08A 5A8NA 1Y5WA 1W5OA 3UYCA 2Y8KA 2WSYA 2YDSA 1TV8A 2CXGA 5EL1A 3S2NA 3B0PA 1FBAA 1JPMA 3AIVA 3PZGA 4ZE4A 3BAIA 4JHOA 4QG9A 4FAMA 3KL3A 1QFEA 1E0TA 1Z44A 3E2SA 4HSNA 1G1YA 4J3VA 4DYKA 3TOYA 3ABSA 5FCZA 3LUTA 1ME9A 3BLKA 4AMCA 2E9MA 4ZB2A 5A2CA 3GVWA 3W2NA 1IIHA 4PODA 1ODUA 2KX9A 5GNXA 3VCNA 4RZ5A 3PJXA 5D33A 1UBPC 2DT1A 1ZAJA 3L9CA 2E25A 2PC4A 1WV2A 1KTBA 3IWPA 1B90A 4MNKA 4S3GA 5A2AA 4J40A 1UHVA 2EG6A 2J7GA 1YDYA 1OYBA 4LNYA 1XPGA 2X40A 3KHDA 4JTQA 2AAAA 2ZZ7A 3K5XA 5A8QA 5BYWA 3PPFA 1GVYA 4E4UA 2GK1A 1FWSA 2AL2B 3SO7A 2YXGA 3W23A 4Q22A 3ABXA 1BYDA 4GI8A 4H01A 1N55A 3VAVA 1BF2A 1KXHA 2VFIA 1NTHA 3VK5A 5DLCA 3UR5A 3L0KA 3BCFA 1C8XA 2QCHA 1N7KA 1DXEA 3F1QA 4FOUA 4FMVA 3B0XA 1Z69A 3WFLA 1LUCA 1YNQA 2PLMA 4C6BA 1KXVA 3W1RA 2OG9A 3IGSA 1D3HA 1IQ8A 1U5VA 1Q6DA 5K4ZA 3C2OA 3I68A 3CASA 1M1BA 4ECLA 3IRDA 4AZBA 3AS2A 2J66A 4N42A 3ONBA 3LCHA 4L9ZA 4IJCA 2DW7A 1XYMA 3WNLA 1EYWA 3MBFA 1A3HA 4MJ4A 3GH7A 4JQ1A 4CNSA 4AVFA 4NY2A 2WQDA 1XLIA 1W1TA 3E0FA 1W2PA 1KWGA 3KL0A 3R2GA 3O15A 2VCCA 1DJZA 1EA0A 3AAMA 2VX4A 2JGYA 3THUA 2GJXA 4CNPA 2XFRA 3V3WA 1QT1A 1S5VA 4O53A 3JR2A 4Y96A 4MJ2A 4JFVA 3VNKA 2WZMA 4CEUC 2QV4A 5K2ZA 2F61A 2E77A 2FB3A 1D2KA 2ZE0A 1KBJA 4ZE5A 5BNKA 2PDJA 3L0GA 1LOSA 4UTUA 4J3SA 2R1LA 3GDKA 3VM5A 2XVLA 1KBBA 5K9DA 3D0CA 2C15A 4Z0SA 2QCLA 2XH7A 3NPUA 4IMDA 1ONWA 4DF0A 3SRDA 5G2HA 4KRUA 3UJFA 1V6YA 1KO0A 3U2EA 1SJCA 3W7PA 5HMFA 2RGMA 2HV5A 4I9TA 4REQA 2GQAA 1SGJA 1VPQA 3LCGA 4DF2A 4DJFC 1TV2A 4PL2A 1TR9A 3GW3A 7REQB 1DJYA 2OPJA 3BG3A 3UESA 1PJ9A 1Z32X 4HJWA 2P1FA 3I3EA 2RGLA 3NSMA 3WDPP 4Y8FA 3SECA 1WXJA 2XFWA 5HMSA 3B8UA 5C70A 1XCFA 3N2BA 3IGXA 2OMAA 3R89A 1OSEA 3W71A 2WVVA 4O1EA 5LNVA 5D8ZA 3BH4A 4ACZB 4KCTA 3S47A 2G97A 2W63A 3HQOA 3F5LA 2AKMA 4RW5A 4WKHA 2DJXA 3M0MA 4GYKA 2Y0FA 3BSGA 2BG5A 1OC7A 3L2MA 3BARA 5M2FX 1EX5A 1QPOA 3W1MA 3MV11 1FDJA 5BW6A 1BG4A 2PPGA 3QFWA 4TV5A 3OJGA 2IMRA 5JUVA 3OA5A 3MO4A 1UH4A 3ARQA 1ZBCA 1HKJA 3GNNA 3CL6A 1XIMA 1V6WA 3AHZA 1FDZA 3N18A 4B5NA 5D2WA 2QCDA 3WNKA 1OBAA 3GFXA 3M1ZA 1J01A 4XKYB 2WMHA 4QP0A 2MANA 3TYUA 5H6HA 1TA3B 3GNOA 1UYQA 2DT0A 4H8HA 4MNLA 5A1AA 1LORA 2NW0A 1UROA 4UWMA 3RGTA 3EPOA 3ITLA 1QXLA 5J04A 1GEHA 4LUSA 2WZHA 3GQYA 1A5UA 3B0VC 5JVLA 1NOWA 3QV6A 3T4CA 2DW6A 2NQJA 3ZR6A 2O9PA 2D2HA 5EBUA 4A8LA 1GW9A 4E2OA 4F3HA 3LCFA 4WK9A 4XAPA 1QOQA 2I5IA 4IJRA 1R2RA 3WFZA 4D1IA 1PZ2A 2CBUA 5C7VA 1FWJC 2FHCA 1HKKA 3MMDA 3H7RA 4PTDA 3UJ2A 1SR9A 1W9UA 3MP5A 4G56A 3SUSA 1ISZA 1Q6RA 5AB3A 2WAGA 3KXQA 3UVIA 4FNUA 3W72A 5CKSA 2ZRVA 3IIOA 3VD3A 2GDVA 1CENA 1MO0A 2NUXA 1TV3A 3MC5A 4LWWA 4PE8A 4XBJA 3JZUA 3AFBA 3GR4A 3LN3A 2Y7GA 4XSLA 1ME7A 1KM0A 3PS7A 3L2IA 3HGJA 2C18A 1ONRA 4UMAA 1YLVA 5HXMA 4BS0A 1VHNA 4YVPA 3PNZA 4V15A 1K9EA 2DH3A 3BJSA 3TWBA 2WC7A 3V7PA 3TU9A 1TG7A 3RM8A 3NG3A 1UJPA 1E4IA 1KGXA 3GDLA 1R85A 1DV7A 3NDZA 2ZX6A 1CWYA 4A3RA 4PFMA 3N9RA 3P8JA 3PB0A 4XZNX 5JH1A 2WC4A 2ACSA 3G5EA 1DHPA 4H7VA 1O1HA 1SO5A 2PWVA 2P50A 3N2MA 4O1BA 2PDLA 1H1ZA 1JNEA 5I3HA 5KMYA 1F3WA 1FH8A 4FXRA 4Z17A 5G1YA 4KBXA 5AHFA 5DRIA 4UOQA 3V16A 3AZTA 2EKCA 3W74A 3GKAA 1JL8A 1DJXA 3W2UA 5H1WA 4O8RA 1PZ3A 3A21A 4HVXA 1DOSA 2QVNA 2YFOA 1UZDA 3N14A 3KVJA 4LVGA 1LRTA 1JVNA 3PWGA 2VT0A 1U5JA 1V3JA 5DBUA 1QNVA 4H7CA 3VOIA 1E1CB 3S6OA 2POZA 3ITVA 3ARZA 1BWVA 2VQTA 3FXGA 3DESA 2FMOA 4QBXA 2Y1HA 3E6EA 1O5RA 3WBYA 3MWCA 4LB3A 3E0WA 5HA7A 4IMGA 1I1XA 3PAOA 4Q4SA 3R25A 2HXUA 2GWGA 1E0VA 1M04A 1WX0A 1P5BA 1DYSA 4XO7A 1JZ3A 4UQDA 3CIWA 4JD4A 5HBFA 1U1UA 3CPRA 1P43A 4GH1A 3DKJA 4AZ6A 1AD1A 2E09A 4PMYA 4NJGA 2XUCA 4PTXA 3G8RA 1LRQA 1QU4A 4YWIA 1EDQA 1YMYA 3GBDA 1EWEA 2W67A 1WA3A 1HN1A 2DVXA 4R88A 4JIRA 2GPTA 2FPTA 2Y24A 1SW3A 1T0OA 3W07A 1XLKA 3TTYA 4GUIA 1M01A 1HVQA 1XLHA 1XINA 5BXTA 2I5QA 3P93A 3RPTA 5PTDA 3QTPA 3I3DA 3ENLA 3QTGA 2REQB 3QGVA 3REQB 2E6AA 4JYFA 4LUTB 4JFWA 5CCZA 1AODA 2G3FA 3LK6A 2ZUUA 5CZSA 3NZ1A 1A5OC 4G7EA 2CKRA 5A6LA 3TAOA 4AU0A 5IXEA 4HA0A 3HGSA 1VFMA 4I3GA 2GFTA 2R14A 2PBOA 2NXHA 3R11A 2VFDA 2Z1XA 3CQHA 5FF3A 3H26A 3WDHA 2VTFA 1X1NA 2IPWA 1I4NA 1UC5A 4Z2KA 3VNJA 4LUJA 1H7WA 4A22A 1GYLA 5AECA 2GSJA 2W9MA 3V0SA 4NX5A 5I6SA 3CUJA 2P5NA 3VE9A 2QDHA 2CLPA 3PNUA 2VUYA 4WUIA 1QI0A 5AC5A 1FHDA 4HHLA 1F6KA 3UD6A 3AC0A 2RAGA 5A6BD 3AS3A 1DJNA 4BI7A 4OGZA 1Z6KA 4FLQA 4ICMA 4JCMA 3SSJA 1OK4A 4HNNA 4I9JA 3IV3A 3QPEA 3UR2A 1DORA 4LANA 4GYPA 1T99A 4X61A 1MXGA 2C19A 1M65A 3O6YX 2BVDA 4QCEA 3QMSA 4JS3A 3ARUA 1RQBA 1JNDA 3SUWA 4GHRA 3FSUA 4HA3A 7A3HA 3TJ4A 4IMEA 5BMWA 4C5ZA 1LLZA 3B4YA 2ALRA 2FDMA 1JQVA 2Z1SA 3GR8A 2V5JA 4M56A 1JJKA 1B31A 1KBKA 1U5HA 2JF6A 1IT0A 1CDGA 4I5RA 2ZZ1A 4NHVA 4LYKA 1MUCA 2RHGA 3KOWA 1OZMA 4RL3A 1UUQA 1TPC1 1E6XM 3GNXA 5JXQA 1XISA 3FA4A 3QXBA 4I90A 4O14A 2A79A 2J47A 2WHMA 4LYPA 4P7OA 2G0WA 4XD4A 4DAFA 2HQAA 4MY9A 3SN0A 1G9HA 3EXTA 3ARPA 1FUYA 3BMXA 1KFCA 4XZHA 2VX7A 2E6FA 1BVWA 2GGJA 1XUUA 3LLFA 4FPSA 4NI8A 4TVCA 2YCLA 4IUOA 3L65A 1YX1A 3E1F1 4GYFA 3W81A 2I16A 4HHPA 1SVDA 3PPHA 2FHFA 2RDTA 5FEZA 4L65A 4DQWA 3PB2A 5BRPA 1ZP4A 1MVYA 1LG2A 2A2IA 1UWSA 3CUIA 1F6PA 1EO5A 7ENLA 2IS7A 1AH0A 3HU7A 1HF6A 2V8ZA 4MFDA 3ZQ9A 3QHOA 3IUDA 4HYWA 2VDIA 2NV9A 4ZCWA 2OKTA 1KV8A 3KTXA 2E6DA 3UR8A 1AZ1A 1JPDX 1VCVA 4S3FA 3AO0A 3VX1A 3QSRA 3BJFA 2OX4A 3W75A 3U2ZA 2YIHA 4GIAA 4MB4A 4HOWA 1W3NA 1A50A 5AVHA 5E0CA 1J2BA 4KW2A 3V0TA 4AW7A 2J13A 2DEPA 2GGEA 2JKEA 3P84A 4HK7A 3BOXA 2ZZ4A 2Z4GA 2V5KA 2TSYA 3HOJA 4O13A 1XI3A 3KDOA 1IXNA 1PCKA 3WEOA 1DQXA 1K1DA 2NZLA 2V5CA 4LCRA 1PYFA 2ISDA 4GY1A 4DAIA 1IXPA 4XZLX 3UNTA 5EMUA 1PKNA 1Q6CA 2CZFA 4GIYA 3ME3A 4JGDA 5G1TA 3RR1A 2ZE3A 1HQTA 4G8TA 5I07A 1XYLA 2F6UA 2WBGA 1QR7A 2Y8VA 2ZCGA 3W1QA 4PUWA 4X3ZA 2ASHA 2ZUMA 6XIAA 2XG9A 1E6NA 3IGHX 2NLIA 1J79A 3E0IA 4YYFA 3B9EA 3HQNA 5CZKA 1UZHA 4YL2A 3BVJA 3I10A 1WDPA 3BMVA 3MDUA 4A3HA 1GQIA 1M7XA 1ZTVA 1N82A 2IPGA 2R1KA 3PC0A 1UQZA 3BUVA 2PWFA 4GLEA 4C60A 4ZEPA 1E72M 2PF0A 2X0SA 2TAAA 2Z7KA 1K77A 3EX3A 4JL2A 3OGVA 2WXDM 3LRLA 3GU9A 4OE7A 4AEEA 1GW1A 2VZSA 2YL6A 4DPQA 3SRKA 4AC1X 1BLIA 4C7FA 5MF5A 5G4EA 1AQHA 1JCYA 1R9ZA 2W62A 4UTMA 1Q63A 1MQQA 3BLFA 4JTRA 4GVGA 4NXSA 4H9TA 2YCJA 5MHBA 2Z00A 4PTNA 2JK2A 3CAVA 2EG7A 5C9UA 4HPNA 3P62A 4ADTA 1GGOA 1KXQA 3ES8A 3HBLA 1JI2A 3ITOA 4YVVA 5REQB 3SIMA 5FEPA 1F05A 1VGAA 1V0NA 3CZ8A 4GABA 3KE0A 3PM6A 4XIAA 2FJUB 3FHAA 1PO9A 4XUGA 4C6OA 1X39A 2YBVA 3BW4A 2XTKA 2VO5A 3C2EA 4IQEA 5FEWA 2CEQA 1MZRA 4OUIA 3Q4DA 4GX9A 4UC5A 2JEQA 1KB3A 4NZ5A 3E2VA 3L2LA 4FR1A 3O6AA 4Q4OA 1WOBA 1K8YA 5AHNA 3T05A 5BWFA 1IXOA 1YW1A 1ZY9A 3IK2A 3MA8A 3IJ7A 2GLKA 2HCVA 3OW1A 4GMEA 4QG8A 3UT0A 1OFOA 1X96A 2NX3A 5D03A 4WXZA 4A8NA 3W27A 2XN0A 1DJQA 5D2TA 1RBAA 4CU8A 4G7FA 2CC0A 2D0FA 3N11A 1MYRA 4NYYA 3U7BA 2Q3OA 1E43A 2XGZA 3N15A 3UF9A 1OGGA 3CUHA 1V8EA 1QNPA 2WJEA 3UU0A 4KCVA 4TX8A 3N17A 3W7RA 4GUGA 3U0HA 1W3IA 3ZM8A 3NURA 3LV6A 4K8HA 4O8AA 3ZFHA 1D9EA 4AZGA 3LCIA 3FVDA 1VFLA 2J9YA 4M82A 2HS6A 2QUVA 3IV8A 3V4BA 2V2CA 3GXNA 4FX8A 3FKKA 3JRKA 4US5A 3FN9A 3NQBA 3KW3A 5C5YA 4LVDA 4IPPA 2YDRA 4JYEA 1CLKA 2FVKA 2OT0A 4BK9A 1XYZA 3AIQA 4NG3A 3U4FA 1RA5A 1JZ7A 3C2FA 2WCSA 3O6DA 2OGJA 1ADOA 1SW7A 2EEXA 4FP1A 3NTYA 5D05A 5I06A 3FAXA 5I0DA 5A94A 3CAWA 3LPGA 2VZUA 2A7PA 3O06A 4WDXA 1SMAA 3A64A 1JCLA 5C54A 2O7SA 1US0A 2OZTA 1K8XA 2VZVA 1T40A 3MP4A 2ZX7A 1RVKA 5KITA 3PUDA 2J7EA 1XIDA 2DFAA 4WLCA 3S5ZA 3KBWA 4U2ZA 1KCXA 3T40A 1KCZA 2OWWA 3K1GA 3S2JA 1MW0A 3GXFA 2XZ9A 3NZQA 3M5VA 4ENLA 4ZQOA 2A5HA 2OX1A 5LIYX 5MKGA 2I56A 2V5LA 3BQ6A 1W1IE 4AZ7A 5M1TA 3QMRA 2EAWA 5A6MA 1C9DA 3NYDA 3AROA 3VGHA 1AZ2A 4TIMA 4IG2A 1TVNA 3S5SA 3PBVA 3ZVHB 1K6WA 3NM1A 5F2GA 4O1CA 3SRHA 4S23A 3W7GA 2W0UA 4O18A 1OYAA 1ELSA 1W9PA 3LBMA 3ZO9A 5LIXX 3K1DA 4RDVA 2D1ZA 2PTDA 2JEPA 1WKFA 3QC0A 4P2VA 1ODZA 2FVMA 1TQXA 3WD1A 3B0YA 1KKOA 3I7QA 2GJNA 3OG2A 2WJZA 1AA1B 5LIKX 5AZ1A 1R3WA 2CLEA 3PUGA 1JFHA 2NVCA 1V6VA 2YOCA 4IT1A 3S4TA 3VKAA 4QJ1A 4IIEA 3QN3A 1EP3A 3PTDA 1F73A 4O19A 1EJWC 1PIIA 1NARA 2VFHA 5ABHA 1LL4A 5A69A 3K4WA 2UY5A 3AS0A 3MSRA 5AYIA 3CWOX 4AY1A 2UY4A 2Q02A 5C55A 1AJ2A 1Q7MA 4JQ4A 1JDFA 5KSWA 1Y7VA 4K39A 3RMEA 1XLBA 5CC7A 4UCFA 3MANA 3KUMA 2D0GA 1ITQA 3HN3A 3PZVA 3UPMA 4MWAD 3VZXA 4WGXA 3WBWA 1KR0A 3II1A 4C6IA 1ZAHA 1JEZA 4GXWA 4TTGA 2DGAA 4N2YA 4MYXA 5DO8A 3N4EA 3MUIA 4KFPA 1K8ZA 4GISA 3TJLA 3E5PA 1P0BA 2BP1A 4E4PA 5E9XA 5J5RA 2GK1B 3CJPA 3WQGA 1KM4A 1VIZA 3WLHA 3S3GA 2EPOA 3FW6A 4FLSA 4R7JA 3R8RA 1SPQA 1W3KA 5D09A 1IWAA 1G4PA 1XLEA 3BGAA 2FMNA 2J7HA 2GVLA 4TVDA 1W1A1 4OBRA 3F7JA 3N3MA 3AHVA 3PWIA 3UXIA 1UIPA 1GOMA 3MZNA 4QLJA 3TN4A 1GPFA 4O57A 5GVJA 1LUCB 1DJIA 1F6YA 1XLAA 4WSJA 3UXKA 3ES7A 1RH9A 1KRAC 3TYCA 1H3GA 3MMUA 4MADA 2FIQA 4DBWA 4M51A 5M17A 1AH4A 2ICSA 3AZSA 1P0EA 1RUSA 1O60A 4WY0F 4WY0A 2IPJA 3RCNA 2AGKA 2Z25A 1S3TC 2VJXA 4OOUA 3HMJG 1V5XA 5E93A 2EKGA 1GTEA 3ZR5A 3EDFA 5F4XA 2ZDRA 1VC4A 2J9ZA 4ZSTA 2H6RA 3W25A 3KRZA 4B3LA 3TA6A 2WQPA 4GQRA 4YTRA 1IR1A 1J8VA 1DP0A 3B05A 5K4XA 2V68A 3GUWA 3WLLA 2QUTA 3WKZA 3WCZA 4A35A 3NGJA 2FZ9A 1IGSA 1OCQA 2H8XA 3IANA 2G41A 3RITA 2BGNE 4MNJA 4X0NA 2X1UA 1IR2A 3AYRA 3NGFA 2W5FA 2CHOA 3KLKA 1RQHA 1EA9C 3ANUA 1SW0A 1AW1A 5E6YA 4GX8A 2PTZA 2VR4A 3BAKA 3GXDA 4LQ1A 1T7LA 1FWTA 2CERA 3OLEA 2D23A 1DJWA 3WQCA 5HUOA 3UZYA 4N4PA 3L23A 3A4AA 4HBKA 1B0IA 3EX1A 3TIMA 3H7VA 4PMJA 1UKPA 3LEPA 2W92A 1VBUA 3LHYA 3D3FA 3RRXA 4JL1A 1S39A 2IKGA 5HMDA 4R7OA 3B4UA 1LJYA 4REQB 3QV9A 1C92A 1XSIA 3GK0A 3M0ZA 3BWWA 4PTVA 1JGMA 1X1ZA 1HVXA 5HQMA 1FWNA 3KL5A 4Q7BA 3AHYA 1TELA 1SZGA 1Z89A 4NNCA 1XLFA 3UCCA 3QMTA 1EBHA 3IJ9A 2PF8A 4X22A 1VQTA 3MMWA 3LI1A 5T9BG 3PK7A 2D22A 2J7DA 3VZYA 3L4TA 1EL3A 5HNRA 4IWWA 4AF0B 3KZPA 2HTMA 4QQ3A 4KEVA 4HCHA 2WVVB 1W32A 4IPIA 4M3PA 3U5UA 4JIIX 3NO1A 5LA0A 3FA5A 3S9YA 1RD5A 2GL5A 5C6MA 1BD0A 2R94A 4WSKA 1NWTA 5FSDC 4QEEA 3ARVA 2ZZ3A 3IRSA 4P8VA 4DRSA 3TZNA 3L4UA 2PWUA 5LNRA 2WJFA 1OFQA 4A8IA 1XKYA 1EIXA 3INPA 2QKFA 3HO8A 3MTWA 4C6NA 2P0OA 1N8WA 1OFPA 5TBOA 4AD2A 2X8RA 3BW3A 1E56A 1WUFA 1JDEA 3DH7A 3T07A 3CMGA 3S5NA 2FZMA 4N9EA 1H7PA 2VURA 1ONXA 1LROA 3FSTA 3HM7A 4NSBA 2D0HA 3WNOA 3A13A 3PZQA 1E5NA 1UD6A 3VKDA 3WUBA 3GWQA 5T8GA 3W88A 4LUSB 3ABOA 3TAKA 3VDGA 4GVIA 4Z1CA 5E0FA 1ZJIA 2BGQA 4P5UA 4ACYA 3CIVA 3WQ6A 4I7UA 2Y2WA 1J0KA 5T26A 5FJPA 2DZBA 1KM2A 3A23A 1QAPA 5LGZA 2QJGA 1H62A 1OABA 2ZRZA 4H19A 2DORA 4U5KA 4DM1A 3ARYA 1FXPA 4QJ4B 1F3TA 3CK5A 2V38A 2A3AA 2TYSA 3KCJA 1OF6A 1P6WA 3KDNA 2PGEA 3C2VA 3STFA 4K37A 5H2ZA 3WMCA 1DVJA 5CXPA 2Z26A 4AC7C 2VR5A 4G2DA 3TW9A 3W70A 3TC3A 2X05A 1JIBA 3W22A 3S42A 4LOCA 1O5XA 4P7QA 3GNPA 4WOQA 5F1VA 1XGZA 4A21A 1XYFA 1PYMA 4C1KA 3DFPA 5H8UA 4ML9A 2XN2A 4FSAA 4AIUA 1CPUA 2X42A 3PBMA 4AHQA 3LTYA 4ZL1A 1TIWA 1EIBA 3FVMA 4XBKA 4GK8A 1EJUC 1ZP3A 4IGSA 5C7HA 1VF8A 3QFEA 1J9YA 4W8AA 2ZXBA 2W4XA 4AXNA 1KW1A 4IMAA 2NQZA 4L5ZA 2OT1A 4I5XA 3ZVIA 3WF0A 5C9WA 2A6NA 2XYLA 4D71A 2QUUA 2XIMA 5CEWA 4JTCA 2QGHA 4Y9MA 3ARWA 3KX6A 2IQTA 4MKSA 1W1PA 1BWKA 1VP5A 1AW2A 1NM9A 1V6UA 3DBPA 3MCMA 4ZZ9A 1UW9A 3P80A 1H2JA 4M81A 1WXYA 1UWUA 2O9OA 1T96A 4GUHA 4FNSA 1E9IA 1DWJM 1ISXA 4B3ZA 4PR4A 3QQ0A 3RU6A 1I60A 1YPFA 1XBXA 1UASA 2ZTJA 3CIXA 3NQVA 1BKHA 1TTPA 2WHLA 4KPLA 3DAQA 4NX0A 3N2OA 2CZVA 2ZXDA 2XH2A 3U9IA 2HVMA 1NWUA 5HULA 2ZUVA 4L4LA 1AL8A 3WD3A 3P6LA 4HNTA 3QV7A 1EGZA 1ZCOA 4UOZA 3APTA 3EMZA 1J0IA 1W9DM 3GY1A 2XGIA 3AXXA 3GFYA 3I6RA 1VFUA 2QR6A 4UTWC 3CHEA 3WBEA 4NJJA 1JXJA 2XDFA 2PAJA 3BAXA 2GVEA 2Y7DA 2OLAA 3BMWA 1SZNA 4AD0A 4PUEA 4EPDC 1PB0A 1TREA 3T8QA 2CLIA 4K1WA 1FX6A 2INEA 4UXDA 1HFBA 3TONA 2NXGA 4TTUA 3W82A 4EPBC 3H2MA 2WMKA 2ABBA 2PFHA 1UKTA 3FJ6A 4UCGA 3C6CA 2VEIA 4ERGA 2OSXA 3GH4A 1CYGA 1GVFA 1HUVA 4UR8A 1WO2A 5C2GA 1CBGA 4GI4A 1M7JA 2DH2A 3GIQA 3S5OA 3SY5A 2DT2A 2J4GA 1QTWA 2E1DA 4JQ2A 4Q8QA 2GSHA 4JHMA 1EC7A 2O56A 4EXAA 3A3HA 1VEMA 3DXIA 4DHGA 4RNIA 1SO3A 4PMUA 5FSEC 3WH9A 3NSNA 1Q6QA 4C65A 2PI6A 1C7TA 1ML1A 2EF9A 4Z08A 1XIEA 1RK6A 1R0MA 1R38A 2OQHA 2PDXA 4C6EA 5HR7A 2Z28A 3UBPC 4HIBA 4BWLA 1LYXA 3MV01 1TPUA 3P60A 4LW7A 4TOQA 6REQA 2YZ5A 3G1VA 1QHPA 3OGSA 5HJXA 4HYVA 2BOEX 2CW6A 3QM3A 5A6KA 4UTLA 4UTKA 4NZCA 2DJLA 2XSBA 2A7NA 3A5VA 3VM7A 4OV4A 4GQ0A 3P81A 4GJ1A 3L4YA 4HU4A 2DV0A 2WO5A 1U1JA 2AOSA 1CNVA 4XKYA 1J0YA 1UD2A 3B8TA 2BVYA 1PTDA 4ZB5A 3OP2A 2EPMX 1WZKA 4HHMA 3CLMA 4JEJA 3TC7A 4Q4RA 3L67A 1PXGA 3S83A 1XD0A 4FIQA 2DU2A 2ZX8A 1L0PA 4IP5A 4YCOA 2P8BA 3VD9A 4AMAA 4NASA 1PX3A 2WV8A 1U1HA 5EMLA 1XRFA 3NPXA 1VS1A 1VKFA 3N2TA 4ZQPA 3OZYA 3GU1A 4PL1A 2PDPA 4O0KA 1BHGA 3BV4A 3HGOA 4DXVA 2PDWA 4CVUA 3C0LA 1VJZA 5JU6A 4GXMA 4PULA 2W61A 4IIDA 3DFQA 3LRMA 4M7TA 4YTSA 1UD8A 1LM1A 3CV7A 5A6SA 2D73A 3KP1A 4QG6A 2FGZA 4B4HA 1E1EA 4PMZA 5KZMA 3QF0A 3VU2A 3VIOA 3KBNA 4NZJA 1ZHAA 3DKLA 4H9MA 4LEQA 4P8XA 3NYZA 1FWCC 3N9KA 2E1WA 1JCJA 3QY6A 5CC6A 3EWBX 4K2SA 1OHLA 1Q45A 2PEVA 4ZSUA 5FEXA 2NVDA 1XRTA 3A22A 3P5YA 4XISA 4X9SA 2VI0A 1DTNA 2PZ0A 4XVEA 4K1GA 2BSLA 1VFTA 5HANA 3GNRA 2OWXA 4H9XA 3SN4A 5FF0A 4F40A 3UCDA 3WDIA 1NY1A 4QNEA 4C6QA 4DJED 2Q8XA 2Y70A 1VBHA 1XLCA 4DZIA 2QCCA 5E09A 1T6MA 3WYZA 3ZLFA 2OO6A 3CHFA 3PPGA 2O92A 2FJKA 3SQSA 5I79A 4EF9A 2P53A 1CCWB 3KBJA 4WHBA 3ITTA 4CLMA 4MWAC 4JTKA 1IZJA 1POJA 1Y5VA 1ONEA 1C8VA 1J0JA 2YCLB 5A8PA 4JOMA 2GUBA 2C0HA 4M24A 1JZ6A 3OVGA 1WCGA 1XLGA 3TR2A 3ZS4A 4YNGA 3IIZA 1DKWA 1OT1A 1XCXA 4QFUA 2A3LA 2CLLA 4URIA 4M80A 3I7SA 1EJSC 3KWSA 5BXPA 1S2VA 4H3DA 3LNPA 4X9YA 5HJLA 4NZ1A 4LRTA 3DFHA 1IEVA 3VIPA 3R8HA 4BA0A 5A6TC 2X1IA 1CXIA 1ZB5A 1RCXB 2CFFA 1ZZMA 1E5JA 3RLVA 4NNBA 2VCAA 3E5BA 1KLYA 5F7UA 1O5KA 1GOOA 2XIQA 4UOJA 4H8VA 2PU0A 2BVTA 2PTWA 2OVLA 2CBIA 4OIFA 4J35A 5H8PA 1HJVA 3PR2A 3HG4A 1W8GA 1MEIA 5G1MA 4BR1A 3HTWA 4JTJA 2FZNA 3FJ4A 2GVJA 3WLSA 3UJRA 3ZJ6A 1A5KC 3XIMA 4M6PA 1X1OA 5E70A 2W27A 4JX4A 1HJSA 3LHTA 1R46A 4GBUA 5AHIA 2BODX 2Z1WA 3W87A 4ADUA 2YCKX 3EAUA 5FIPA 2YLAA 1MFUA 1X38A 4MFEA 2PLJA 1Q7ZA 5D37A 3D47A 2GGHA 3AYSA 4IIBA 1J93A 5TNVA 5TD4A 3KTSA 4NRSA 1LQ0A 4AH7A 4Q4PA 4RPQA 3NQDA 1TTQA 3URQA 1QBAA 3VOHA 2YX0A 5F4WA 3VOGA 2OYMA 1AD4A 1QATA 4EKJA 1UR1A 3H55A 5GPRA 2XVNA 2VR2A 1AL7A 2V82A 2QDDA 2ZKMX 3EDDA 4ASTA 3FS2A 4R3UA 4L80A 4HN4A 2Z29A 3UQNA 5HNNA 3S1UA 3W85A 4KT2A 3LY0A 1GOXA 5C9ZA 1WDDA 2VCBA 1LQ2A 4DJDA 2V63A 2QVHA 3UG8A 2PP0A 4L4OA 3OO2A 2V2DA 4O1AA 3SCPA 5LIWX 3E0VA 3QGKC 1W1ZA 2REQA 4UIOA 4XX6A 1OGBA 3MS8A 3VFCA 3REQA 3TSMA 1QO5A 3HPXA 1S46A 1CTNA 3VI2A 4V1XA 3CLWA 1LL7A 2XVGA 2ZQ0A 4ONVA 2TMDA 3TFXA 4CNNA 1G7VA 2PP1A 1BSLA 2E5BA 3TLQA 1OJXA 4PUKA 2NSXA 1RPKA 4UTFA 1BF6A 4G5DA 4LXFA 3STGA 1QRQA 1W3LA 4JNMA 4DF1A 1XH1A 1CLXA 3FEMA 3LS9A 5EPDA 2X30A 2HMCA 3S1GA 2RKXA 1UUOA 3F2CA 2WPBA 3QVQA 5I03A 3HG2A 2XIOA 3FGCA 2ZFAA 4RZBA 4F9JA 2WNZA 1F4AA 1JRCA 2QUMA 3SY8A 4QS5A 3B8DA 1DE5A 2JKPA 5KINA 3C4UA 4RNHA 3HPAA 4FX6M 3KCLA 2A3CA 1EHNA 4W9TA 4Z2JA 1EDGA 4P8WA 1PX4A 3G1SA 3NQGA 1OIFA 2WZIA 4TO8A 4DJFD 1NP0A 3H4XA 2XVPA 3EMQA 1UCWA 1XD1A 4JTLA 5HJYA 3EX2A 3L4ZA 1DWHM 1KRCC 4AWSA 5DMMA 4IL2A 3G77A 4Q6JA 4QE4A 1IT7A 1JZ2A 2QF7A 4GGBA 2JBMA 3W7IA 4GJJA 1B3WA 2HVNA 4AEFA 3LCXA 5CH9A 3RO6A 4RE4A 1GVOA 4JN7A 3APGA 2F84A 1YNYA 3TLLA 1SO4A 1DJHA 4WD0A 3N25A 1PAMA 1LBFA 5HPOA 2VX6A 5I77A 5CSSA 2X7VA 4DYEA 2CLFA 1GVSA 4YU1A 4CD4A 2BY1A 5M5DA 1QVBA 2XSAA 1I2RA 4C7GA 4KWVA 4CU6A 4EP8C 3NZRA 3EA1A 1QHZA 3G1DA 3C0QA 3CO8A 2F6KA 1J11A 3WQOA 1V51A 1XJBA 1QK0A 3VNDA 3AIUA 4J5NA 3GAKA 3SGGA 3GNDA 1KNWA 4FLOA 4WKAA 3UW6A 4N6EA 2Y5SA 1EUAA 1JPHA 3K8LA 2GQ9A 4BF7A 4XD6A 3H2AA 3IGUA 3DUGA 3H12A 3F2DA 3NDOA 4X2RA 4WZHA 3U6WA 1FWFC 4MM1A 3WJSA 2C16A 2CLHA 1M41A 2QPSA 2J77A 3EA2A 3L4WA 1UWTA 1DE6A 2WKLA 3L5AA 3W1TA 3MPGA 4RE2A 4ZOEA 3UNDA 2Q3RA 1A4MA 4LVBA 1IT8A 1GQKA 3VUSA 3G0UA 1FWDC 1R9YA 4P7LA 2E68A 1IWPA 3URNA 4OV9A 3N04A 3RCMA 4W5UA 1JUEA 5AY7A 2OQYA 5D30A 3LSCA 4RR4A 5KETA 4PEEA 4GNJA 2J6VA 4DLFA 4D6GA 2J7CA 5TIMA 3NCOA 1JDCA 2WLZA 4S2CA 1I0BA 1HX0A 3TW7A 5K7JA 4XO6A 3B8SA 3STPA 1EBGA 3NIYA 1OG0A 2DUAA 4DNHA 2WVTA 1GK8A 2F6XA 3UY8A 3B9DA 1OIMA 2QMJA 2D3LA 5J5DA 4JKMA 4NKCA 4DELA 3CV6A 2GVGA 1W31A 2RDXA 1XF0A 1XC4A 4U31A 1D7KA 4QISA 1YBQA 4Z1AA 2C1HA 2VD8A 1XLDA 3ID7A 1QBBA 4F2TA 1FWRA 2H9AA 2V67A 1I1WA 3WJWA 3OLIA 3R43A 3L12A 4ZTXA 1A80A 3D3AA 1UZ4A 4NAEA 3VD5A 1XGEA 1L8NA 2ZRXA 3PG8A 1C93A 4NNAA 2QNEA 1F76A 1ZFJA 2IUZA 1XYCA 4HU8A 3R79A 5EU9A 4RJEA 1IHIA 3LPOA 3PP7A 4X2PA 3SUVA 4XZWA 1PHWA 4V33A 5CLWA 5E9AA 4FXFA 3WQFA 1UIOA 1DWIM 4O52A 1GZ1A 5DXXA 1DBTA 1AFSA 1NVMA 2ZUTA 2VZTA 1NFBA 2P10A 3QZAA 2RJGA 2PDBA 3CC1A 1OADA 1POKA 3TNOA 3P14A 2EXOA 4W88A 1AW5A 1OM0A 1FCQA 1UMLA 4H4IA 1G69A 3SBFA 1ZJAA 1W6TA 2BXYA 4FNTA 2X1SA 1WDQA 4UQAA 1PUDA 1KR1A 3WBAA 4H00A 4MMWA 3SI9A 3EOLA 1IEWA 1GUVA 4BFAA 1E51A 1RJPA 2ZWZA 3VKKA 1J10A 3LHZA 1BWLA 4KRTA 4ZOAA 3OQEA 3C61A 3WSUA 4E8CA 4GE8A 1FWIC 1FWHC 3MP3A 4B4FA 5CBBA 2PP3A 3R0UA 2VZOA 3T0DA 1UOZA 3QY8A 4PC8A 3VGGA 4DWSA 2B0MA 3IARA 6TAAA 4BY3A 5CPSA 5GQBA 3TWAA 4LAOA 4H83A 1OG6A 5F2MA 4B5SA 3QY7A 1UQYA 1GJPA 4YN5A 3LB0A 3NQMA 2PDYA 4FO4A 4R27A 3N12A 1G7UA 3QW4B 4W8BA 4HPJA 1EGMA 2XIJA 1Z48A 4FNPA 3HPFA 2OELA 5HINA 3H53A 3PJUA 4X0VA 1K02A 4R9OA 1UD4A 1CXHA 2XPKA 3WK3A 1UR0A 2DZVA 3SCSA 2BOGX 1VRDA 1LBMA 3EWZA 1NFPA 2V30A 1E3ZA 4NJIA 1SO6A 3R13A 3VFLA 4CQBA 3C8NA 3V5OA 4DUOA 4UTTA 2C14A 3QV8A 3F2BA 4WQ6A 5DEZA 1TRIA 4B91A 3WNNA 1I8JA 2GJLA 1MUWA 3TKFA 5I3GA 4IX2A 3SCUA 2HS8A 1BRLA 1SU5A 3CZKA 4QLLA 3TXZA 3FAWA 4FA3A 1QOXA 3NQ8A 1O95A 4LS2A 3F03K 2WMJA 5CPLA 3OYZA 5I02A 4GG9A 2GOKA 4O15A 1NOFA 2Q09A 5DMLA 3NXFA 5JIPA 5FESA 3ITXA 1UR9A 3TC6A 3MDWA 1L6FA 2KZHA 1J12A 2CIPA 2WMIB 3W1UA 5I2UA 2F2KA 3IUIA 3H24A 4L1WA 3VVGA 3MCNA 3MUCA 2DZPA 2EPLX 1MRAA 2ZVRA 3CV2A 1MXDA 4KEUA 1XW8A 1GTHA 1UR3M 3THAA 1HJWA 1IGWA 4DZAA 4I8YA 3CUZA 3E49A 3AU2A 3W7JA 4DJEC 4GC4A 2G3NA 4U3AA 2VOTA 3AXIA 4CGTA 2PTYA 4QGCA 1T5AA 3D6NA 3PFRA 3EWCA 4O4WA 4O12A 1DJGA 1E4NA 2D24A 3SCNA 1UP0A 1XRSA 5ABEA 2PS2A 3ZVHA 1WUEA 1FHVA 1GORA 1KWKA 5LKYA 3NVDA 2IKIA 1L6GA 3KM8A 1MW3A 2YPIA 3QKZA 3ONCA 2XZ7A 5XIAA 4W5ZA 4PRRA 3ARTA 3TTQA 3EMCA 2PDCA 1C3FA 3BOFA 1HO1A 2HROA 4QDPA 2PUZA 3ARXA 4HN8A 1L8PA 2HK0A 4HNVA 4OHQA 3AYTA 2PDUA 1H0GA 5EMJA 3LYEA 3ZXWA 5IBXA 3HGRA 3AMLA 2PB1A 2WSQA 2OSYA 1E3XA 3KS5A 4B9ZA 3LTPA 3RLUA 2OZ8A 4TQTA 3AHTA 4PBEA 2HZGA 4JTDA 5CZJA 3UJSA 1JZ4A 4PUMA 3TQVA 4EK7A 3EOSA 4W87A 3RO8A 4KS0A 1SFTA 4DXKA 5CC3A 2PGWA 4MDPA 2P88A 3MMTA 3SN1A 4GVFA 2QULA 4O28A 2EGZA 4MOZA 4PMNA 5HR6A 1QJWA 2YLLA 4O11A 1H0IA 1J5SA 4FR6A 4HQVA 4KIEA 4QE5A 3BLIA 1RJQA 4D6HA 1FP9A 4IQLA 7TIMA 4K7YA 5ABGA 4D8ZA 1K9TA 4JFUA 4AIEA 2OLHA 4JAWA 5HAOA 3GDMA 1E0UA 1HJUA 4CKQA 2UZ9A 3T0CA 4LH8A 4C6KA 1OGSA 4UQEA 4JTAA 1UKOA 4PTMA 3GUGA 3VPLA 4GQQA 3UA4A 3RFAA 3OBAA 5AHMA 2HBVA 1ZBWA 4AWUA 2PDIA 2DSUA 4H1ZA 4MB5A 3MI3A 3ITGA 3UZXA 1R87A 5A5WA 1HT6A 1SM9A 4BI5A 2G4JA 1ZJHA 3WF4A 2FFIA 1OC5A 1A5LC 3ZOAA 4GZ7A 3SJ3A 1VYSX 2FB2A 4HU3A 1P7TA 2WKGA 1FOBA 3NEVA 4N02A 3BLEA 2V3EA 2DUXA 1H4PA 3ZWSA 3CTTA 2DZUA 3B9AA 3GSMA 2J62A 4B2DA 1Y65A 2YDAA 3TW6A 5XINA 1LWJA 3C56A 2D2OA 4MZYA 4J28A 3W1NA 2NQLA 4MUZA 3WUEA 4BKNA 4Q7NA 4Y9NA 3BTNA 4ROPA 4J27A 1Q2RA 3XINA 3WELA 2ODOA 1Q7QA 4IQDA 1GPWA 3TUUA 4HNLA 4PRTA 1EEXA 3E2QA 3WLJA 3GG8A 4LUIA 1QCWA 4JTFA 3GTNA 3PBWA 1E1FA 1AVAA 1HGWA 2EJAA 4D6DA 3CEUA 4W7UA 2ZXAA 5DX7A 4XSMA 3OZMA 1A5AA 1QI5A 5BOEA 3VOCA 1SMDA 4O54A 3W0KA 3LCLA 5LXEA 3DC8A 3SCOA 4BHYA 5JIWA 2V81A 3W7QA 1AUSL 1MWOA 4NQ1A 3V0UA 1UBSA 4PZVA 2BHYA 4C6FA 3RX4A 6XIMA 2HDJA 1MUMA 5AOUA 4PYSA 1VJIA 3W3OA 1O1ZA 3GXTA 4RV8A 4LV4A 1ITUA 2OZ3A 1WDSA 3VC5A 4QEHA 3M0JA 4JIPA 3F4WA 3VA8A 1HTIA 3GHUA 4HMDA 5I23A 3WQPA 4JKKA 4E6MA 3TSBA 1HW6A 1KM3A 2Z7GA 3RG6A 1HP5A 4AF0A 3AMGA 4BZYA 4DM2A 4LY8A 3K8MA 5FF4A 1UKSA 1Y8BA 2DQXA 3VKCA 2INFA 3EXRA 2C91A 3QZEA 1W5PA 3SGZA 4I8DA 2DIEA 1TUXA 4CD6A 3O1NA 2O9RA 2W79A 1CGXA 2CXEA 4RNFA 3AJ7A 3MW7A 3CZLA 1E6SM 6REQB 1KCKA 5I3JA 4K7VA 1IEQA 1OYCA 4KGLA 6A3HA 4O0ZA 1KM1A 1FWAC 4AZHA 2PDKA 5FA5A 3R58A 4N0RA 3H23A 2J88A 3L0NA 7PTDA 1MRQA 2X2GA 1N8IA 1DEDA 4JZ5A 4IMFA 2AAMA 3SDOA 1MEWA 3T0AA 1UKQA 4ZENA 2OYKA 3CL8A 3EDJA 1LT7A 2B81A 3OLDA 4KERA 3WLKX 3BAWA 5FJUA 4O17A 1AJ0A 5G4WA 1HXJA 1XH0A 4ICNA 1CZ1A 2J7FA 2C1GA 1UA7A 1TPDA 1A0CA 2G3MA 5CJ5A 1XIJA 5LA2A 2OWCA 3SADA 3SGUA 1B9ZA 2ISSA 1YKWA 2UWFA 4JTEA 2WVSA 1A3XA 2ON3A 1SSGA 2CWNA 1YQ2A 4DI8A 3H22A 3QHMA 3M0KA 2Y5EA 2WOQA 4IPLA 2D2GA 3NA8A 1YYAA 3UA3A 4B16A 3HPSA 1VYRA 3GDRA 4LX4A 3DHPA 2PDHA 2VRQA 3LSBA 3E12A 3W1AA 2ZA3A 2NQ5A 2FDSA 1C29A 1MZHA 5EMMA 4HYRA 2GOUA 1CIUA 1QDSA 4GQGA 4NP7A 1Q5MA 2E6YA 1F9CA 2QJIA 4QDWA 3WMBA 4LF1A 4D6FA 1FA2A 4HZMA 1FXQA 2C1IA 1W9BM 2VUNA 5EB8A 4AUBA 3ANYA 2Q8LA 3EB3A 4KRZA 1JFXA 3GZAA 4H6QA 4EPKA 3K4AA 4RE3A 4JTHA 5FACA 1PVNA 4J2PA 3TEVA 4LTSA 5XIMA 3PZTA 2WHKA 1H63A 2DSZA 4GC3A 1Q66A 3G6MA 1J4EA 3GTIA 3M7SA 4PMQA 4O1FA 2DT3A 3VO0A 4DVOA 3URAA 1GZGA 5HNTA 3TTOA 3GHSA 2H8ZA 3SFWA 1YXDA 4OVXA 4C90A 3NZPA 3AMDA 4NF7A 4AD4A 4J9JA 2VMFA 4L4MA 3UG5A 4HMEA 2YA2A 3CNYA 1S1RA 1HKIA 3TK7A 1GQLA 4C6PA 3W7CA 4GI9A 1PTAA 4LEFA 1YXCA 4QE1A 4UNLA 3VGEA 2G4FA 4EXQA 4P8UA 4IPJA 4MJMA 1FKWA 3LXCA 4U5IA 4YTQA 3NM3A 1S2WA 3VIFA 3NOEA 4GCXA 4HPHA 4EPEC 4P7NA 1SQ7A 2CCRA 3WK0A 3BE7A 1KV5A 1SZFA 1DIDA 3S9ZA 1O68A 3PBUA 4ZODA 2DVTA 4ICCX 3C3NA 3QBUA 4UFLA 5ECVA 2YBUA 3P3BA 1YTDA 3AICA 4GIEA 1XCWA 4HNOA 3ZSTA 2DSWA 4DLMA 3N4AA 3QRHA 2Y62A 1K4GA 5BRBA 5EY5A 1O66A 5BU6A 1W3JA 2QF8A 3GHRA 1JZ8A 3VX0A 1G4SA 2YCEA 5JMUA 1EC9A 2FQIA 3HF3A 3MO7A 8A3HA 2ZZ2A 4M1RA 1ALDA 1LTDA 2HK1A 1OD0A 3SY1A 3CEPA 4ZB0A 3LG3A 1JF5A 4JQAA 3UYIA 2JGQA 2YJQA 2ALDA 1WE5A 3HURA 4CD8A 1VHCA 4RE0A 1HG3A 2HRWA 4PFHA 3DX5A 4E3VA 2ZBTA 1JD7A 3EWYA 3FIGA 1K3UA 4PMRA 3AUOA 5AZ0A 2J25A 2J8FA 4N9BA 2XH0A 2Y63A 3WX7A 4WJXA 3UWEA 1TWZA 2QGYA 2CLMA 2A21A 4OWGA 2Q71A 3DHFA 3MU7A 5H91A 6ALDA 3JVAA 1AQFA 3UPBA 4MF4A 4U28A 2GYIA 4P7RA 1GVRA 1EPXA 4CQ9A 3NAVA 4RUBA 2ZC8A 1L6YA 4YWSA 4XAGA 1REQA 3W38A 1ZCCA 2F9RA 3MUAA 1EXPA 3S2LA 1PZ1A 1WZMA 4F0LA 1Q8JA 1WBJA 2GGGA 3SM0A 4UFKA 1A5SA 2PLCA 3QHNA 2YFNA 1LWHA 3P67A 4GY0A 3WQ4A 3FXYA 4WX2A 1XFCA 1M3UA 5GJPA 3M0LA 3WQEA 2VC7A 4Q8PA 3BLPX 5KZEA 3NQ7A 3TCEA 3VNIA 3TTEA 1NWRA 1GJUA 4JIEA 4PCPA 3GG0A 4KCUA 4XKMA 3WEZA 3CXOA 2YB4A 3RXZA 3BGJA 2G8ZA 3CHDA 1JR1A 1EFZA 2Z27A 3VDBA 4AX6A 1MQPA 4WSHA 4ZFMA 4OZOA 3GIYA 2VC6A 2XM2A 3H2EA 1XBVA 2CZEA 1IXQA 1E71M 1EF3A 2WKJA 1EUNA 2JE8A 3LZ5A 1KQYA 5FL1A 4RPPA 3IK4A 3FGCB 2EO7A 4UTIA 1VB9A 1J0HA 3VNMA 4LV9A 1X6NA 3CHCA 3HV9A 1QPRA 4OOZA 2RDWA 3LBCA 3VTRA 1C90A 3U57A 2O4QA 2DZSA 2OU4A 3B8WA 5G2WA 2RJHA 3HFYA 3KCOA 4GY7A 4IH3A 1TZZA 1ZAIA 3TQKA 1V77A 2BFGA 1LQAA 1YHTA 3G0XA 4HKPA 1H5VA 3GHTA 4QXIA 4H2HA 2V3DA 4S2BA 3T2QA 4IOTA 4F0HA 5LIUX 1YPXA 4OTKA 3BXWA 3CH0A 1WKYA 2CNCA 3F4DA 3QPZA 3EBVA 3BSMA 3B0UX 4UTTC 4I9MA 2OOFA 4UFHA 3GDTA 3PAJA 2I17A 2BXVA 2BY0A 2XFYA 3A4XA 3GXPA 3H21A 4A6GA 2YYUA 3GTFA 2HEJA 3D46A 1HP4A 4GOAA 2VOMA 2BY3A 4MDOA 3M41A 3FYOA 3CAKA 1HJQA 5FJJA 4M0XA 3I6EA 4JR5A 2YW4A 4MLJA 3JS3A 1UB3A 3N34A 3SCRA 1LWIA 4ZQCA 4FK9A 3RILA 2V9DA 1PL9A 3M9YA 2VKZG 2PGRA 3WH7A 1UPMB 3WO8A 5E0KA 1EQCA 3RRAA 3FDKA 1VCFA 2YKKA 1FRBA 5U7SA 4RXGA 5DY3A 2B7OA 1S2CA 4HTYA 1KFWA 4DUXA 3VDHA 4AHOA 4HOZA 5CG0A 1VFFA 4E8GA 1KTNA 1CB2A 2QXWA 1TTIA 1KLZA 1NDVA 2DZXA 2IXVA 5HQEA 4L61A 4C6DA 2R8WA 5EMKA 3BLOA 4KWUA 1CX9A 1EF2A 3K8KA 2AQOA 3BG5A 4Y6GA 3RM4A 2HE8A 3P8IA 2HWGA 3TH6A 4Z0JA 5CZTA 2VGBA 2R82A 3TFCA 3W2LA 3HQ1A 2GUYA 1R3VA 4PMXA 4HZ7A 4W7WA 2WMFA 4IMCA 1CGUA 2E67A 3GVGA 4MIMA 4CU7A 5HDRA 4H6KA 1MQRA 2I7GA 3TVAA 3ZR4A 9XIMA 1F8MA 2Z6JA 3GTHA 2QIIA 5CBIA 1K9DA 2XHYA 4L6OA 1V3HA 3PULA 4R34A 2XWEA 3CPUA 4LSBA 3DI1A 1ADSA 1E9YB 1TPH1 1EO7A 1CGYA 1FDYA 4ZOBA 4ZO7A 5KZDA 3NEHA 4HZ8A 3JW7A 3NQ2A 3QKEA 1JPIA 4Q8UA 5F2IA 5RUBA 2G95A 4N6FA 4FNRA 2FPYA 3NL5A 1RSCA 2E0PA 2ZIDA 3PSVA 1TWDA 3GXMA 3RHGA 2WCAA 4C1NA 3WN6A 2QLYA 3EX6A 3DFTA 1V3LA 2TRSA 1YBQB 2Z6IA 5HNUA 5CSRA 3MQTA 4JDBA 3QJAA 5CPMA 3SQMA 2H9AB 3WL1A 1Q6LA 4L6HA 4DYJA 5F4SA 5JH2A 1EOKA 1VENA 3MJMA 4NAEB 4V2XA 2NT0A 1RXOB 2O55A 4RZ4A 4HD5A 5JBFA 5DT5A 5T9CE 1TCMA 4JIQA 1BEUA 2NX1A 3KVKA 3GYCA 3O9NA 1DHKA 2VELA 2NT1A 1HL8A 1ADDA 3WNPA 3GBEA 3MZ2A 2AMXA 3VINA 1FFQA 4Z2IA 4A3YA 1OD8A 3S2MA 3V36A 2HSAA 2JALA 3TE9A 5BXSA 3F4VA 5I3FA 1H7OA 3NO5A 1RALA 4W4QA 2VEFA 4TV6A 1TJRA 2QAPA 2J6XA 1V4YA 3IIPA 3T2OA 3PZUA 5ABFA 3W26A 2FTPA 4NAFB 3TR9A 2HVOA 1QNSA 2CETA 3O05A 4QSHA 2VP8A 4C6LA 3PJWA 2C0AA 4TMCA 1CECA 3KTCA 3VYLA 7XIMA 1UWRA 2G3JA 3O2LA 3V5CA 3FA3A 3LD5A 2Y7EA 1LCOA 2QT3A 5D2VA 4F0SA 2SFPA 4L56A 4GA8A 4HA1A 2O0TA 3E74A 4F8XA 3C0SA 3BAYA 3W00A 2XISA 3E96A 1YE6A 2XIBA 2YB1A 3IAPA 5C8BB 2TODA 4CNTA 3RLHA 1FHLA 1BKSA 2GGIA 4HNCA 3ZT7A 5LHFA 1KC7A 5LGXA 3LMZA 4AYGA 3B06A 3C5QA 4UNIA 1EX1A 1XKJA 1XSJA 4LY4A 1HL9A 3M0XA 3AQUA 1R6WA 4DWSB 1H09A 2BZNA 3CPGA 3PTMA 3WLPA 4BEUA 1MMFA 1NAL1 2J8GA 1FQ0A 4IHCA 4PB5A 4DZHA 1SSDA 3VC6A