4Q6JA

Crystal structure of eal domain protein from listeria monocytogenes egd-e
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
248
structure length
245
Chain Sequence
DISSTEIWDAIRRNSYLLYYQPKVDAKTNKIIGFEGLVRLKTATTILAPIDFFDDIVLLNATREMQDFVAETAIKQINQLGGRFSISINIPAHYVASSTYMTFLHDYVKEHLKYPECLEIEIIERTELAIADKNLRKIKDLGVKVSMDDFGKGYSSLAYLRSLPIDIVKTDMSFIALLKTDRKQQIIIRAIVNLCHDLGGKVVTEGVEDMEQVEKLREMKVDYFQGYYFSRPLPMEEIKQKYSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo0131 protein
publication title Crystal Structure of EAL domain Protein from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Unknown function
total genus 83
structure length 245
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4q6jA00
4FOJA 3GFYA 3N3TA 3HV9A 2BASA 3PJXA 4RNJA 5MKGA 4AFYA 4Y9PA 4J40A 4HU4A 3PJWA 4HU3A 4Y9MA 3HV8A 4KIEA 4LJ3A 3PJTA 4RNHA 4Y8EA 4F3HA 5MF5A 4HJFA 4FOKA 4RNIA 3GFXA 3SY8A 4ES4A 4Y9NA 2W27A 3U2EA 4AG0A 3PJUA 4FOUA 3GG0A 3PFMA 4LYKA 4F48A 3TLQA 3S83A 5MKGB 3GG1A 5M1TA 3KZPA 3GFZA 4Y9OA 4Q6JA 4RNFA 2R6OA
chains in the Genus database with same CATH superfamily
2E40A 2FFCA 2J4GA 2WCAA 1QNVA 3LI0A 4K8HA 3VFLA 3C2RA 1VEOA 3WEMA 1TPC1 4HSNA 1DWAM 2Z4GA 1XD0A 1BEUA 6A3HA 1LYXA 4QQUA 1G7UA 4W89A 2YB4A 2PDCA 4L6OA 3PZMA 2NUYA 3QN3A 4LJ3A 3RMEA 3LCFA 1B3YA 3H4XA 1XD1A 4HMCA 4GO9A 4TUFA 2VGFA 4UTKA 2CKSA 1KC7A 2Y61A 3AIRA 4D6CA 1BTMA 2XIIA 3L68A 1MQPA 3KBVA 1V7AA 3T07A 4W4QA 3LTSA 1OJXA 1UB3A 1TMQA 2G37A 1FX6A 4HOZA 3TUUA 2G8ZA 1AJ2A 3S0CA 1YNPA 2X2YA 2HXTA 1GOXA 3M41A 2AQOA 1W1B1 2ZA2A 3PWIA 3IIPA 4F8XA 5LNSA 4C6KA 4F9JA 4YYCA 5CAKA 3PTDA 3GH5A 3E0IA 1ADOA 2OT0A 1CECA 5CPOA 4X0VA 1EOMA 2W4XA 5A94A 1JNEA 4N9DA 3KDNA 2BVTA 4JICA 1GOQA 4QEHA 3OZMA 4K68A 3C6CA 5CSSA 1O5QA 4ZOEA 3RJYA 1E6XM 4RW5A 3TJLA 5A8PA 4QE5A 3DBNA 3AMKA 2XN2A 2VM8A 4M6QA 4REQB 4LUYA 2QCCA 4AD3A 3VDHA 3M4HA 1W9DM 1W3TA 5ABGA 3DX5A 3L65A 2YA1A 5A6BA 1U2YA 1P4CA 2O4MA 3KL5A 3G18A 3EAUA 1GQJA 3ALGA 4AZ7A 5IXEA 2EF9A 1YPXA 3E2VA 4AZ6A 3S9YA 3CZEA 3VDAA 5I03A 1RPXA 3MVIA 3TA9A 1WX0A 3UG5A 1ISXA 1XIMA 1WZKA 2ICSA 2ZDSA 5HULA 2YXXA 2QUUA 4FX8A 4MUPA 2Z0IA 3QQ0A 3W7RA 2B0MA 2REQB 3AJXA 3AU2A 2EPHA 1D7KA 5CZTA 3SDOA 1GGOA 5A8NA 2INFA 1XIJA 1RBOB 5IBXA 3WELA 3VKCA 4DJDC 3GC2A 5GVJA 5HMDA 4XG1A 4I5UA 2R1PA 4JTUA 3UXLA 2PB1A 5AYZA 4MNJA 4H00A 1EFZA 1KQZA 1OF6A 4G5DA 1R7AA 5D2WA 4AWTA 4KRUA 1EUNA 2HWGA 2NV2A 1A0DA 3CEPA 4EVZA 1P7TA 2CETA 4QIUA 5FF4A 4KPLA 5HJYA 1EP3A 3SN1A 4MB4A 2HDJA 1BKHA 1T7LA 4HCHA 1UYQA 1BG4A 3IJ7A 5H8MA 5HATA 3U4AA 1SZGA 3W6YA 4AU0A 5DMNA 4UR7A 1G69A 1QW8A 4BK9A 3AU6A 2GWGA 2ZTKA 4IQEA 4HVXA 2PI6A 1JZ6A 3FEQA 5FL0A 3BXWA 3EZ4A 2VRKA 5CPQA 2GJLA 3OGVA 3TYDA 1V79A 3HV8A 3STEA 3NYDA 4N6FA 1XDLA 2WC4A 3O6AA 3KP1A 1ZAHA 3B9OA 1UD6A 1PL9A 1ZFJA 2A3AA 3AYVA 3AI0A 2V6AA 4Q7BA 1BG9A 2PDIA 4V28A 4JY8A 3G5EA 4KWOA 5DY3A 3SCNA 1M53A 3F2BA 1LG2A 5H2ZA 4HNLA 3ARPA 4XD5A 4S3CA 2HROA 4ML4A 1Q6QA 3QV6A 4U5KA 3GAYA 2WNNA 1GW9A 1PJ9A 3SRKA 4KRTA 3UD6A 1IE7C 4PL2A 2VFFA 2VR2A 4AWUA 1E55A 2NZLA 1SO6A 1XIGA 3PHAA 3LTYA 2A7RA 3WDHA 1XRFA 1J6PA 1Y65A 4CQ8A 3CUHA 1QVBA 1YYAA 4XUGA 3AFBA 5J5DA 3UY8A 3AXIA 5E09A 4F2TA 1BWKA 3TYBA 2NQZA 1UC4A 3KOFA 3CWNA 1DL3A 3KVMA 3HQPA 3W01A 3GYEA 4AG0A 1GWJA 3I68A 4DO4A 2G50A 4DWSD 4K1WA 2WC3A 1CW2A 3CU2A 1V6UA 3V1HA 4O4WA 1CGYA 3WK3A 1PV8A 1EBHA 4O11A 1VFFA 2VOMA 4AWSA 3WH6A 3KRBA 3ERPA 1TRDA 2VEMA 3C2EA 5HXMA 4E8DA 4B5NA 4AY8A 4WY0B 3W7OA 3ANVA 1QNSA 1XRVA 3RCMA 1D3HA 2XIBA 1NM9A 3EMZA 3XIMA 3KBJA 1EDQA 4MM1A 1ESWA 1TTJA 4CCEA 1Z6KA 2C15A 3BJFA 4OTKA 1WXJA 5EB8A 1T99A 4G7EB 1QR7A 2FDSA 2V8ZA 1TQXA 3STFA 1QI2A 2ZKMX 1EEXA 1R2RA 4IM4A 2OWCA 1Q7QA 2NVDA 1ZCCA 1SR9A 1RBAA 7REQB 3CPUA 2JIEA 3PAOA 3F4DA 3FEMA 4GRSA 1UIPA 2PBOA 1U1UA 2G3IA 2XINA 1O68A 3NZ1A 4AZBA 2POTA 1TV7A 3E49A 1WDPA 3DFPA 1KW1A 3N4EA 4PCSA 3WD3A 3CS2A 4GUFA 1DXIA 4AZ5A 4HHMA 3EWXA 1XLIA 4D6JA 1I2OA 4I6KA 1HKJA 1VP5A 3RK8A 1QT1A 3L5AA 2VQUA 1ZJIA 1ISVA 1R3RA 2CLIA 1VYPX 5D37A 5BU9A 3OTRA 1NELA 3BLOA 1IXNA 3WD1A 3W1TA 1FFRA 3CV6A 4TX9A 1XQLA 3C0JA 4AH7A 2JKPA 1PDZA 1KM0A 4S3AA 4XBJA 3URNA 4HK5A 2AL2B 3WLRA 1H2JA 1VENA 3KRUA 4LV9A 2GJXA 5F2MA 4WSHA 2FB3A 1R9XA 3IJIA 2J7EA 2VXNA 4XAPA 1KR1A 5M1TA 4DXKA 1EDTA 1Y0EA 1QWKA 4JIHA 2JKEA 2QYGA 5IHRA 5T91A 3TEVA 3QPYA 1G4TA 3T4WA 2X1SA 3VZXA 3MCMA 4DM2A 2Z1SA 2VCCA 3QTPA 4PTMA 8XIMA 3BOXA 1NWTA 4CNUA 3CHVA 1CBGA 1FCQA 1F07A 3IIVA 5I3FA 2V5BA 3IWPA 1J01A 2Q09A 1FWSA 1NARA 4ADTA 3HF3A 1QOXA 3P5ZA 4H8UA 3S2LA 1NP2A 2GK1B 4Z08A 3AYRA 4LAKA 5DXYA 3MHGA 4HK7A 3REQB 4AVFA 3W24A 1XBZA 5F1VA 3POHA 3H23A 1EPXA 3R4IA 2NQLA 4PA8A 4H8VA 3NQ6A 4DAFA 1PKLA 3NQ8A 4P61A 1UP0A 3E02A 4LS1A 3H22A 1XFBA 1R3VA 1YLVA 3GVGA 2VGGA 4J1OA 1W1VA 4DPQA 1H1YA 3B8UA 2ZRZA 1O5RA 1G6CA 1XYBA 2QF8A 3VGDA 1TZ7A 4R85A 3SRHA 3HURA 2GZXA 4C6DA 5TNVA 4C91A 3HIJA 4F79A 4K6AA 6PTDA 4IF2A 4B5WA 1MW3A 4X3ZA 3SRFA 1GK8A 4Z1AA 3NDOA 4MJMA 3GIQA 4BQ3A 2XGZA 3A23A 3BJSA 3NPVA 4QQ3A 3B3DA 7PTDA 3WX7A 4GZEA 1BVNP 4HNVA 2ZZ7A 1XCWA 1W9BM 3PNUA 4ZFCA 4NZFA 2I56A 3EBVA 4GHRA 4I8YA 4N02A 3BWWA 4DELA 3L21A 1KBBA 3R0UA 4I5XA 4M24A 5HNRA 5J04A 3OQ8A 1S38A 1OD0A 3SGUA 2EAWA 3N04A 4JKKA 3VX1A 5D9MA 1U5HA 2Z2AA 3LD5A 4QTGA 4NHVA 4Y96A 1NEYA 3KVKA 3CH0A 3LSCA 3QLLA 2V2HA 4NT0A 2YBVA 4OHQA 2ISWA 4R9XA 3ANYA 3SW6A 4EAYA 3QM3A 1XDJA 2X05A 2DZPA 4B3ZA 1J12A 3VIKA 7ENLA 1KFKA 1E9YB 2YYUA 4WY0A 3C3UA 3T0CA 1UUMA 3MZNA 2C7FA 1CT5A 5JH1A 2UY5A 5HMSA 1W9XA 1M7JA 3QBUA 2PGFA 2X8RA 1E56A 3QLDA 4FLRA 4AD5A 2FVMA 3BURA 2EPOA 4G7EA 3G22A 3EXRA 1UWSA 3OGSA 3OBAA 3P14A 3BAWA 1XBVA 2W62A 3D3AA 1XV8A 2VENA 4PZVA 1TV8A 5I3GA 3MZ2A 1ZU8A 1G1YA 1PTGA 3EWDA 4GBUA 1H61A 3W2UA 4QSFA 1KWGA 4B91A 2AOSA 1U30A 3LLDA 3O63A 4BR1A 1EJSC 3HN3A 2Z6IA 2BG5A 3ES8A 2HSAA 1EIBA 1B30A 4DWSC 3N2BA 1ZJHA 3N1AA 3R94A 3NA8A 2X0SA 4WOQA 1W1PA 5ECVA 3H7VA 4WDUA 4P7QA 1RQHA 4JQ4A 2CXGA 4MWAD 3XISA 2V3GA 5M3WA 3WQWA 4YU1A 2R1MA 4YLWA 4GQ0A 1I9CB 3CIWA 1E51A 1OIFA 4YVPA 3CMJA 3CO4A 3URQA 1HL9A 4US5A 4RE2A 1EH9A 2OQYA 5ABHA 4B3LA 1TPWA 1BXNA 2AL2A 2X0YA 2WJFA 4JS3A 3NQVA 1E73M 4ROQA 1MDRA 1GORA 3VOIA 4NL1A 3GH4A 4XZHA 3LQLA 4JZ5A 3GG7A 3ZWSA 2PDYA 4LT9A 4ZXOA 5EMUA 4Z2GA 2WMIA 2PD5A 3Q67A 3RCYA 4A6GA 2DSKA 1FCUA 1KTBA 3GM8A 3PTKA 3NQ2A 5E6ZA 3FXGA 1VQTA 1YDNA 1T6MA 2IXUA 4UTUA 2YOCA 2DPEA 1LOLA 4PMNA 4L56A 1LG1A 2WPBA 1JIBA 4FNSA 5E5CA 4XD3A 4ZEPA 3UPWA 2F84A 1I2NA 4FSAA 1FWCC 3T81A 2Y8KA 4L64A 3UWYA 2D23A 2VURA 4Q4QA 3QEZA 3WIJA 3VNIA 2BASA 4O13A 4GGHA 2I1OA 4U31A 2WXDM 1A3XA 3LYEA 2B31A 5BWFA 3GDBA 3IGSA 3F4CA 2VO5A 3IIZA 1TV2A 1XUZA 3REQA 1AW1A 3TYAA 1M41A 2DFAA 2D3LA 2FZBA 3W2JA 3LPPA 1CB2A 1S1RA 4IHCA 1W54A 2ZYFA 2ZRUA 2NLIA 3USZA 3MMWA 1GOWA 2NLYA 4MOZA 2WJZA 3ZR4A 3U8GA 3A47A 3H8AA 1J18A 4ENLA 2B7NA 4NAEB 3ABSA 2YCJA 1POJA 5A8OA 1JVNA 3GDLA 3GLCA 4C6BA 4TX6A 5K7JA 3RGTA 3E0LA 4A8NA 2ZIDA 1MYRA 5F7UA 3OLEA 1QTWA 5I0DA 4ERIA 3FY1A 1V0NA 1KRCC 4UNKA 2TAAA 1PIFA 3GK0A 2PGWA 3K4AA 3UG3A 2BY0A 1W2VA 4WXYA 5U7SA 2FJKA 5C5YA 3VIJA 1FH8A 4KFOA 2XU2A 1KGUA 1T96A 3ANUA 1DXFA 2DIJA 2CHOA 3L9CA 3L5LA 4Q8PA 2CZVA 1TZZA 3GIPA 4QAIA 3ZVIA 1GVSA 4JYFA 1ECEA 3B8WA 1EBGA 3EWWA 1V7YA 5MKGA 4HU3A 3LM7A 4EKJA 2DZSA 5F4XA 2FTPA 1JCMP 4U5IA 4DLFA 3UGVA 4EPEC 1JZ4A 5KEZA 4JIRA 3NQCA 2ZDRA 3QYSA 1WQ5A 3TTEA 3VILA 3UZ5A 3N4AA 4FO4A 1UC5A 3PZQA 3ISIX 3TWBA 4AHOA 3KVJA 2PDPA 1OG6A 1XG4A 2YFOA 1LROA 3VIOA 3L5MA 1NOFA 3W7KA 3HB9A 1TA3B 3TYZA 3R79A 5HNUA 2QMJA 3UNTA 3WL0A 4EXQA 5DMLA 5REQA 1SGJA 4LUSB 3AISA 4B5SA 4WEVX 4MJZA 5FAGA 3BTNA 3SUUA 5LIYX 1K4GA 1C3FA 3A4XA 3W7EA 3TC7A 2Y5JA 3WD2A 1ME9A 2BP1A 3HGRA 5BCAA 3HV9A 1WP6A 3APYA 1CIUA 5EYWA 4G7FA 4W5UA 3WZ0E 4KWWA 3WF3A 2A6NA 3PG8A 3WNNA 1J6OA 5CJNA 4JPGA 2YSWA 2EQDA 1C91A 3CHFA 2WQDA 3U7VA 1GZ1A 2VX6A 3BH4A 2PDJA 2JBMA 2XPKA 3CXOA 1J0HA 4PRRA 1E6PA 2VRQA 3DXIA 3H2NA 1XP3A 5XINA 4R5EA 4D9PA 4GQQA 3N29A 4GACA 3L4TA 3QTGA 3SCSA 1Z44A 4GPNA 4UTWA 4F2UA 2GVYA 3UERA 5ABEA 1VPYA 3SO7A 4ACZB 1F05A 4YS1A 8A3HA 2WSQA 1OFDA 3VOJA 3GNRA 1HGYA 4UQAA 2YCIX 4J5NA 1D8WA 5LA2A 1J0JA 3EKLA 2I5QA 3SBFA 3MC5A 3W81A 3WQEA 1JFXA 4QE1A 1QHPA 4FIQA 3R11A 3USBA 1GG0A 4W9TA 1EJXC 1ITQA 5I00A 3ONCA 3GBDA 1ELSA 2PSNA 3P62A 3ES7A 3IJQA 3LUTA 1X6NA 4GVHA 1AH4A 5A2CA 3RHGA 3C0SA 5FJTA 1X1ZA 5I78A 3AALA 2QGYA 2VQTA 2RH9A 3W2NA 3O0KA 4GX9A 4HPNA 4IIHA 1LLWA 1ITXA 3OP2A 2DW7A 3URBA 1L6FA 5LHFA 1YNYA 4QRNA 2YA2A 3PJXA 5FD0A 4AF0A 4MWAC 4LCQA 4IMAA 3KM8A 1E43A 2G3MA 1JEZA 1PAMA 2Y89A 4GGBA 1WDDA 1X1NA 1GOMA 4UB9A 1ZCOA 1W9UA 4HCLA 3W7CA 1I2RA 4QISA 1HJUA 4EOUA 1OIMA 1QPQA 3HQ1A 1M65A 3DGRA 4LUIA 1TPB1 4PFMA 2A1YA 1ME8A 3F5KA 2X09A 4E2OA 3VNJA 1MRQA 1QPKA 1QUMA 3OLGA 4WD0A 3HU7A 4HNTA 3HZ3A 4NAEA 3HOJA 4RDZA 5E9AA 3T8QA 1OCBA 1H63A 1FWIC 2WVVB 2WKGA 1L6GA 1QBBA 1PIIA 2J74A 1QI4A 2WJEA 2WZMA 3UNDA 3ZVHB 4ZQMA 4C6EA 3TP4A 1JPIA 3ZSTA 4W8AA 4H4IA 4CD8A 1SR0A 3KCLA 4S2BA 1XSKA 4XBSA 5FEXA 2PTZA 3M5VA 3N3TA 4NJIA 3A24A 3GVVA 2BODX 1VD6A 2QAPA 1VFMA 2PDGA 3FNDA 4GI6A 3IK2A 4A3HA 2GLKA 1B57A 3FAXA 3W25A 2XN0A 2VHLA 1D9EA 1GNXA 2OLHA 4AVOA 2BXYA 3W70A 3B8IA 2CLOA 3BQ5A 1KV5A 2PTWA 3M6YA 5LSMA 1RSCA 2WM0A 4ATDA 2UZ9A 1E0XA 1TYGA 4YMZA 1DJNA 3AO0A 3MI6A 1T8XA 4JIEA 1US3A 2C16A 5I23A 3VFCA 3GW3A 1UPPA 2PWGA 3PSWA 4Q8NA 2XIOA 4GMEA 1PBGA 4ZMGA 2B7PA 2DZUA 3A64A 1H7RA 2PZ0A 3EOOA 4H6KA 2RGMA 1MW2A 1W17A 4EWND 4QJ4B 5CJMA 4J3UA 4TVDA 3VOFA 4DXXA 4YTTA 1OEPA 4IPIA 4DO7A 1AW5A 3ITVA 4MPQA 1P1MA 3C5QA 4Z17A 3ABQA 1JCTA 3IPWA 4IG2B 4KCWA 1TA3A 3QZ6A 4LYPA 3RX4A 2QUVA 5FF0A 4QCFA 1GW1A 3BO9A 3WEOA 5G4EA 2GDVA 4MY1A 1GVFA 2OOGA 2PU1A 4P8VA 5D38A 3VIIA 5AB3A 3AICA 4OZOA 1DYSA 2ZC8A 3W9ZA 3HG5A 3H54A 4IGNA 2C1IA 5A95A 3TTQA 4DYKA 2GPTA 5C7HA 1JZ7A 3JR2A 2PRMA 1IT8A 1SO4A 5LXXA 3UXIA 3J7HA 1FWBC 5JVLA 4NZ5A 2QPXA 1YDVA 1VB9A 3G3DA 5DX7A 5B7ZA 2BVWA 3S2JA 2XH7A 1UJQA 3MKCA 3NNTA 4LF2A 2XVGA 3HJZA 3I6RA 3K13A 4G6CA 1MO0A 1PWMA 2WCSA 5FJOA 2NX3A 4LV4A 2OYMA 4P2VA 3R8HA 4MPKA 4UZUA 5CPSA 2VELA 3TSMA 2Z1XA 1EUAA 1GJPA 5H1WA 3DGBA 4ACZA 2B81A 1PKMA 1AODA 3IS4A 3SY5A 4M56A 5CZSA 3G6LA 2QCLA 3R8GA 4LF1A 3W6LA 3VKBA 1UR3M 2VFHA 1YDOA 2GDQA 1WOBA 2VI0A 3E2SA 4A2RA 2YKKA 5LXEA 2WHKA 3ME3A 3AYTA 4IZGA 4DWSB 5FJJA 1EA0A 1AQMA 2IKGA 1V0KA 3KDOA 3P8JA 4CN4A 1J5SA 3S2CA 4XZLX 1A3WA 3UR7A 2VDIA 1FVPA 1DORA 4S1FA 5AC6A 3TWAA 1REQB 3NO1A 3N2OA 3M07A 3FHAA 1JDFA 1PO9A 5HR6A 4BWLC 3FLUA 1F76A 4O8RA 2PF8A 4WJXA 3MSGA 4UQEA 3UA4A 4O15A 2YL9A 4OV4A 2OO0A 3H2EA 3PVFA 5HR7A 5G1TA 3BAKA 3ZIZA 4URIA 2DU2A 3U48A 4DWDA 2CC0A 4FPSA 5C54A 1FCBA 2BHZA 1E5JA 4Z2JA 1R46A 1VCGA 3SAZA 3ELFA 2OXNA 1S46A 2FPVA 1AJZA 3OLDA 1HQTA 5AHFA 3LZ3A 3QPZA 2WZIA 3WQ4A 1D7FA 3TMQA 4QE4A 4DYJA 4CNTA 3BSHA 2WNWA 3AZSA 5DN1A 4O57A 1KTCA 3M44A 2BMBA 2ZC1A 1RJQA 4H6QA 3FAWA 3G6MA 4L1GA 4NAFA 5K3VA 2BOEX 3GZ3A 3PUEA 2BV9A 4PGLA 4GIRA 5CG7A 4GYPC 4A05A 4A3UA 3P82A 1ZS2A 1BAGA 2XIMA 4OWGA 2E1WA 2ZQ0A 2CLHA 5JU6A 1AD1A 3W28A 4D8AA 1O60A 1Q2SA 3O15A 5DT7A 1B3WA 1IGSA 2ISVA 4EF9A 2Z26A 1KXVA 2OEJA 2XH4A 2DUAA 5CLTA 1SW7A 5FF2A 4UMCA 1K8XA 5BNKA 3DG3A 1V08A 2F7FA 3AWNA 4XBKA 2NW0A 4DI8A 9RUBA 3HG3A 5A6SA 1TE6A 3BZJA 1GZGA 2Q8LA 3VUPA 3EXSA 1N8FA 2CLPA 4UFLA 1F3WA 1O1HA 3N18A 1PUDA 1PEZA 3KBNA 2O55A 3UWZA 2EEXA 3MMUA 3GU1A 4B9ZA 2OG9A 4O16A 4XX6A 3TZNA 3ARWA 1VIZA 1LOQA 3W53A 3OZYA 4UFHA 3HO8A 3L23A 4O50A 5A6BD 3HG4A 5E0KA 3RUBL 4L4LA 3GUGA 3VAVA 4IP4A 3B06A 2HMCA 2DUXA 3I7QA 3R8RA 4BY3A 2HS6A 4N7QA 3M0KA 1FWAC 1HL2A 4UMBA 2CITA 4O4VA 2V5KA 3LNPA 3RG6A 4LRSA 3FKKA 2QKFA 3POCA 1CLVA 5A6JA 1B3OA 1BYCA 4W8BA 1KGXA 4XISA 4F0KA 1LWJA 3TW6A 5IOBA 4GWEA 3GQYA 1LUCA 4AC7C 4MTVA 4WQ6A 1JGMA 1FWEC 3K30A 2ASHA 4J3WA 3IGXA 3S3GA 4CKQA 1Q65A 4D6FA 2FFIA 2FYMA 4OGZA 4NIRA 5KINA 4IICA 4WSJA 4JTTA 5DCEA 3EOSA 3FJNA 3T55A 3GXIA 1TX2A 1KFCA 1C90A 2FLIA 4D72A 3PANA 4HA1A 2JKAA 2NUXA 3NZGA 1WDQA 5B7YA 4MVAA 1MZHA 1TFVA 1R47A 1DTNA 5IHSA 5J5RA 2GOUA 4C7FA 3U9IA 4H3DA 4HU4A 1SMAA 3CC1A 2PURA 2RDWA 3MKKA 1HVQA 4LBUA 2VVNA 1JQXA 2YCLA 3K8LA 4AVNA 4M82A 3V7PA 2P88A 4JGDA 1IXQA 4XB3A 1NQ6A 1GVIA 1ZAIA 4GO8A 2Z25A 3UZZA 2OB3A 1MFVA 5FJUA 1V51A 3HGSA 1MUWA 3S9IA 4OJYA 1REQA 1HUVA 4INFA 2OGJA 2LLEA 3SUVA 2EHHA 2PLCA 2WQPA 1DWJM 3XINA 1YXCA 3CT7A 4MKSA 1WV2A 5E6YA 3W7LA 4IT1A 1JDCA 4M0XA 2YBUA 4L9XA 2ZFAA 2UY3A 5TIMA 3W73A 2OVLA 1XLMA 1UD2A 1FDZA 4GBDA 1OZQA 5A6LA 5CH9A 3RRXA 1X1OA 5FJIA 1QPRA 2C71A 3P0XA 3UG8A 4CVWA 4U33A 4DNHA 2P0IA 5A6MA 1Z3NA 3W72A 3TN3A 1NFPA 4EPBC 2VDGA 3TDFA 3WDRA 4D6GA 5I3KA 1XDMA 4I6VA 3M0HA 2RJHA 3OA3A 1X7IA 4S3FA 2QW5A 1ADSA 4JOMA 3PPCA 3IJ9A 1B31A 3EOEA 4JTEA 1OYBA 4H9MA 1W6TA 1KFWA 3LS9A 4S3BA 4MWAB 5H8PA 3NPWA 3HPFA 4MLJA 3W3OA 4JTAA 3T2QA 2A3BA 5D30A 1L9WA 3HTWA 5HQLA 2XZ9A 2VEPA 4O10A 5I6SA 5TF0A 3AHTA 1UROA 3W7NA 1TJ0A 9CGTA 4UQ9A 1E1FA 1NDZA 2Y7FA 4Z1BA 1NF7A 3SCUA 3SQMA 3L67A 2ZRVA 4GNVA 3WBAA 3KX6A 1XG3A 1BRLA 2HQAA 3TLLA 4BCEA 3MDWA 1P1XA 3F4NA 3WFAA 3GXTA 1TMLA 4XAYA 2W67A 2QEZA 1VCFA 3HPXA 2ZE3A 3NG3A 5KZ6A 3APTA 1V3KA 2R91A 3K2GA 3MT1A 3P6LA 4LB3A 3AMLA 1W1IE 3GKAA 3PZVA 4UOZA 3LEPA 4RDYA 5EGRA 2BTMA 4TMBA 4R3UA 1YBQB 1OC6A 3G2GA 4NI3A 3BGGA 1BYAA 2PDBA 4JKMA 5D9OA 1W3NA 3SUWA 3WN6A 3GTFA 5G1MA 2XH2A 4GX8A 3BDKA 1G67A 2FMOA 4GISA 2QJMA 3SIMA 4JBRA 3TC6A 2E77A 2HVNA 4PRTA 3MUAA 1H7XA 1XRSA 3WMSA 4GUHA 5KETA 1ISZA 1GT8A 1UBPC 4FOKA 4Z1YA 1AK5A 3R0DA 1NIUA 4LNCA 4Q8WA 4H41A 4ALDA 1UR1A 2PPGA 2PD9A 3EOUA 2Z6JA 3TTYA 1FOBA 4ZQNA 4DLMA 1OYAA 3E1F1 5FESA 3OBEA 3EDDA 4IX0A 3WJWA 5SWUA 3T0BA 1NAL1 4JQAA 4GG9A 3PM6A 1P6CA 3IV8A 1YKWA 4A3YA 3SURA 1E9LA 2XSBA 4YWSA 3MBDA 4LY4A 3CYVA 1P0KA 2ZXDA 4Y9MA 3QR1A 1OGBA 4DI9A 2W63A 4LY8A 1IZJA 3BICA 1OD8A 3G1HA 1K70A 3TJXA 1EP1A 1TUFA 1VRDA 3U5UA 1UP2A 4WUIA 2XM1A 3EA3A 2C1GA 4C6FA 4PEEA 4AMCA 4F48A 3GDTA 3MSYA 3PWGA 4U28A 3U4FA 4RNFA 3PULA 5I24A 4XSMA 4ZO6A 1JDDA 2HEJA 4HKPA 1I1XA 2X1RA 3QGKC 1R9ZA 1US2A 2C79A 4GUGA 4Q22A 3OA5A 4Y6GA 1T0OA 2VFEA 3UA3A 3PNZA 1E4IA 3I7RA 4EP8C 1EO5A 3MO7A 3A5FA 1G4PA 3S5ZA 1OFQA 1TV3A 3GVWA 2RDXA 1E0VA 2J66A 4AXKA 4GI8A 1OF8A 2YFNA 4H9ZA 4Q4PA 3V18A 1EYEA 3GY1A 2O7QA 1VFUA 1QI0A 2GUUA 4IPNB 4O1DA 3QW3A 4DXVA 3GD6A 2J13A 4FNUA 5CZ0A 3NZRA 3VNMA 1J2WA 1TTPA 3FS2A 1DIOA 2NSXA 2XWDA 4IFKA 3IARA 4OIFA 4DRSA 4ZOCA 1XISA 4C6IA 2JF6A 3VOHA 1I2QA 2NQHA 1K7EA 1HW6A 4TTGA 2X1UA 3EX4A 1XYFA 3TXVA 2XISA 4Y8EA 5JBEA 1JZ2A 4ZGYA 2E09A 3DI0A 1PX3A 5GNYA 3T1GA 3M43A 2HPMA 3TW7A 4FEZA 2A3LA 5DMYA 4DUVA 3TK7A 5IBXC 5BMXA 1JZ3A 2VFIA 3VUSA 9XIMA 3THDA 1Z9AA 1V02E 3RPDA 2DORA 4P7LA 5HDRA 3BV7A 3PY2A 1PKNA 4FMVA 3A21A 2BB0A 3QH2A 5LNVA 1R3YA 4B16A 1PXGA 4F3HA 4M6PA 2BOFX 1S2UA 3H55A 5BYWA 5HJLA 3U2ZA 1B9BA 4CU7A 5LNWA 3PBMA 4OBTA 5D8ZA 3LLXA 2OSYA 1IR2A 2FVKA 4LRTA 3LHTA 2YX0A 5AHNA 5J8LA 2W5FA 1QRQA 4IOTA 4LB4A 2X7VA 1GQLA 3MO4A 5EY5A 2G97A 2PC8A 4D6DA 3UWUA 3CAVA 2A5HA 2BVYA 4XO7A 1CTNA 3M7SA 3UEQA 4WKHA 4CCZA 1OK4A 4KIEA 4GZIA 4RNIA 1XFCA 2ZXAA 1HJQA 3P61A 1Q13A 1GQNA 3LHYA 1E1CB 3OYXA 1P0EA 4HNUA 1YPIA 2VZSA 4Q8UA 4LAUA 1KQYA 1XPGA 3FJ6A 4HCDA 4NNBA 3CL8A 2DZXA 2E6YA 3N6HA 4RE0A 5CZKA 3E6EA 1JL8A 1TJ2A 1CB7B 1GQKA 2QJGA 3MWAA 1XSJA 1YBQA 2NT0A 5RUBA 3L2LA 4H7VA 3WDQA 2VEFA 2DZVA 6CGTA 4LVDA 4HYWA 3SCWA 2YBTA 4UCGA 4W7UA 3LRLA 3QY6A 3RLUA 1GHSA 3T0AA 1WZAA 2XH0A 3M9YA 2QUMA 2E6AA 5A1AA 1M5WA 2AMGA 3GXPA 3CUZA 2GSJA 5CSUA 3ITOA 4LCRA 2E25A 3UWVA 3KOXA 1PWLA 4QNEA 2QDHA 5HNTA 2VGBA 2H3BA 2OZTA 4CCCA 3QHOA 3CK5A 1GKRA 3AMGA 4C6JA 1EGZA 1V02A 3EMQA 3R25A 1IGWA 4J7RA 4NU7A 3NXFA 4WLCA 3PB2A 1Q4WA 1OFEA 1FTXA 3OO2A 3EDEA 1ICPA 1I6NA 3TCEA 3V36A 1ML1A 1KRBC 4NY2A 3LLFA 3VU2A 1K77A 4X9YA 3GB6A 1XYCA 5L9FA 1F4AA 4ZODA 3UR5A 4EXAA 4Q4SA 3KTXA 2BFGA 2OMAA 2C1HA 4HMNA 4PUWA 3W2MA 2CZ5A 2XJ7A 3W82A 4JQ3A 5BXSA 3N73A 4YL2A 1OFAA 3IACA 3LRMA 3V75A 1A5AA 2OX4A 3SSJA 1NWSA 2NSOA 1RP8A 3OOQA 1OCNA 4J28A 1XQKA 3H26A 4C7GA 4GVFA 1I0DA 4FNQA 1K9FA 1YE4A 3CAWA 4PMJA 1FP8A 1JAEA 1I0BA 3E2QA 1T5AA 3VCNA 1AQ0A 2VKZG 2P10A 3V1PA 2E5CA 5A8QA 1B3VA 4RV8A 2G4FA 1V6WA 3B8DA 3LOTA 2IQDA 2PDKA 2WMHA 3S1UA 5CGQA 3E12A 4OUEA 2WSRA 3PG9A 3SUSA 4NVTA 2WHMA 3VXGA 3B8TA 2DT1A 4V1XA 2WZEA 2OPJA 4PTWA 1GYNA 3WFZA 1UH4A 1EQPA 3WO8A 3VM7A 4N9CA 3BCDA 5LNRA 5BMWA 1V3IA 4QG8A 4POCA 2HE5A 2I17A 3TONA 3PK7A 4K2SA 4QNWA 3QSTA 2JF7A 2WC7A 3KL0A 1J0KA 3MYPA 1GVOA 1V6TA 3KW3A 3RX2A 2CEQA 4L65A 3LCIA 3CHCA 3D3FA 3NTYA 1S3HA 5EBAA 3JVAA 2J75A 2J8FA 2QVNA 1K7FA 2ZXQA 5HA7A 2P1FA 4KEZA 1LRTA 5HMEA 1MXGA 3OVGA 5GQBA 4QP0A 5CLWA 3SADA 4Y90A 2XVLA 4PMYA 2C19A 4I90A 2BGNE 3UWEA 3CQIA 1YE6A 4J3ZA 3ZFHA 5LIXX 1BFNA 3VO0A 1BKSA 4W5ZA 6REQB 3YPIA 1TJRA 4IP7A 2PWUA 3RJXA 3KS6A 4LVGA 3QKEA 2ZX5A 3VOGA 4AD0A 2GJNA 4GCXA 2VOTA 1MVYA 3QV8A 1HZYA 1ENUA 2ZCGA 5E0FA 3GYCA 1OABA 3KFTA 1OC7A 1QFEA 3NQMA 1D3GA 5AHLA 1WBHA 1XCXA 3M0YA 3DN5A 3H7RA 1JUBA 1TWDA 2AGKA 3UXDA 2VFDA 3GVRA 3N13A 4CQ9A 5F1UA 3ARVA 4B5VA 1RZMA 4ZQCA 1UASA 4Z1CA 4XK2A 2JEPA 2WNZA 4LUJA 4C6CA 3A3WA 3QHNA 2QLYA 5GNXA 4U2YA 4GYPA 1JPHA 4MLRA 2WZHA 1H7NA 4UNLA 4MNKA 2OZ8A 4J3SA 2FZMA 1XYLA 5DF0A 1SO3A 1UKPA 3THAA 4J3VA 1RD5A 1W1TA 4FP1A 2HVMA 3P60A 3CUIA 3ARZA 4RJEA 4XZ9A 3KBSA 3PB0A 1UG6A 3IUDA 1PHWA 4YTSA 1ONRA 4JNYA 3ZLGA 5EL1A 3SJNA 4H9XA 1FHUA 4LYQA 3W87A 3DESA 1E72M 3CIXA 1UKTA 1MEIA 3VTRA 4FOUA 4LW7A 1F8IA 1XIBA 4D71A 4XD4A 2X0HA 2L5HA 5GNZA 4MF4A 3WBYA 4AC1X 4FK9A 1SJAA 3ZT7A 3SGGA 2KX9A 4LQ1A 4JTLA 1LL6A 1W5PA 4TMCA 4S2CA 1G5AA 1BYBA 1JJKA 1Y5VA 4E2BA 3QMTA 2DZTA 1TPDA 4YXGA 1EC7A 1ZAJA 4O14A 1CX9A 1PTDA 3B04A 1QW7A 2WWCA 1VGAA 1WPCA 3N25A 1TTIA 3NFUA 5A69A 4LALA 1DBTA 3SY8A 2QJHA 4KGJA 2DV0A 2VC9A 2X1TA 3FOKA 2DT2A 4P7OA 1IF2A 3T2OA 4H83A 3SI9A 3KAOA 3P7YA 1VFTA 3M0XA 3P3BA 4GH3A 3CUXA 3DECA 3SZ8A 3W6MA 4HU0A 4PH6A 2J7FA 1DPMA 3P2VA 1ODZA 1TPFA 4X0NA 2JK2A 3W38A 3NQBA 1OC5A 3CM4A 2Z1VA 3VCCA 4V1YA 3NM3A 1VYSX 2WJDA 5A8GA 4I8DA 1XH0A 3QV9A 3R2GA 5KZMA 3WLNA 4AEEA 3VGGA 3GU9A 1B4EA 4Q8VA 3T0TA 4PUUA 2WVTA 3CAQA 2OEKA 4D2JA 1UWRA 2QDGA 3CUJA 4J40A 4XZBA 2FGBA 1LF1A 3E0FA 3MYOA 4S3DA 4CVUA 1GUVA 3UU0A 1E40A 1KR0A 4AD2A 2W92A 4FALA 2PDMA 1SJCA 3MUIA 4NRRA 1Z89A 3A6OA 2VGIA 3DFNA 3PJTA 1E6ZA 1PHQA 1LQ0A 3UWWA 1LRQA 3EEGA 4JIQA 4GJJA 3NQFA 3UWQA 3UCQA 3U2EA 5FSEC 2E6FA 2XSAA 4JNMA 1EKOA 4JFTA 3W1MA 2QCNA 2UBPC 4UQDA 1UA3A 2AAAA 4LXFA 3O0FA 2Y85A 3IIXA 3NUKA 4WDXA 4UFKA 3ALFA 1UMLA 1FWFC 1ZTVA 3RRAA 1FY6A 4DUXA 4YWIA 3JZEA 4DVOA 2BZNA 1KCKA 4MDOA 1EA9C 3NR0A 2OSXA 4Z2KA 3BMVA 6REQA 3G77A 4L9YA 1OCQA 2FZNA 3WJSA 4YN5A 5LIUX 1WBJA 4LBSA 3VIPA 1UOZA 4ZB0A 3MQTA 2F6KA 3FKRA 2FH6A 4IMGA 2DSUA 5HUPA 2IXVA 3BW2A 1A49A 3RPTA 3K8MA 2IKHA 5AC5A 3AMDA 5XIMA 4ZQRA 3L4WA 3W4RA 3GXNA 3UW6A 3SQSA 1V3JA 2C14A 4ZL1A 3RLGA 4P5UA 4LEFA 3KCOA 3FX4A 1XGDA 1NDWA 2P0OA 2V5LA 1KKOA 1O6IA 1UQZA 5CGMA 5M5DA 4HZMA 3TSBA 2OX1A 1VBRA 1WE5A 4RE4A 1GONA 4ZTYA 5CC6A 1DV7A 2YL6A 2ZUSA 4AXNA 3W7IA 2PLJA 2IKJA 3CQHA 1OHLA 4JEJA 4LTSA 1YW1A 3GXMA 3CTTA 3W83A 4OT7A 3WLJA 1NF0A 3N9RA 2CXEA 4A3RA 3PFRA 3OIHA 4IXHA 5HANA 1JXKA 4E2DA 1P48A 4DNMA 1A5KC 5K4ZA 1KM4A 2CESA 4Z2IA 4D6IA 1I4NA 1L8PA 3RXZA 4DHGA 1H7PA 1XSIA 4W7VA 1RCOB 3SFWA 4RL3A 1QU4A 2G3NA 1W3IA 4FX6M 4IPJA 4JTQA 4DBUA 3M0JA 3E3HA 5AVHA 1UH3A 1FCVA 4FR6A 3NEHA 6XIAA 4MJ2A 1IIHA 3VX0A 4ZOBA 1UMYA 2VX7A 5CC5A 3UXKA 2BY3A 4KH2A 4IMFA 4Q8TA 1A5UA 4PB3A 4QDMA 1PE1A 2PBGA 1WUEA 1BGGA 4LS2A 2XM2A 1WCGA 3OVQA 3DDMA 2BGSA 3UGRA 3M0IA 3O9NA 1FUYA 4O1AA 4TV6A 4Q6JA 2Y70A 3GFYA 4QX4A 3BG5A 4L80A 1EPVA 3PC0A 3UESA 2VP8A 4BJHA 5C2CA 3VGBA 3IK4A 4BI6A 2BBFA 4TTUA 4AZIA 1UR0A 1TO3A 3ZYZA 2ZADA 3B97A 4HZ8A 3LQGA 3GXDA 1BTCA 4PYSA 3UQNA 3SJ3A 5PTDA 3ONBA 3UPBA 1PZ3A 3FK4A 4OE7A 3OPSA 1CWYA 3PR2A 3RM4A 1S3TC 1UW9A 4DYEA 1KFJA 4UTWC 1VR6A 4MB5A 3G8EA 5IRPA 1X7FA 2W61A 2WSYA 4ICMA 7CGTA 4HA4A 1Q8JA 5A6KA 1BXCA 1HFBA 4G1NA 1JI1A 3PSVA 2GJPA 5HAOA 6TAAA 2CCRA 4LAMA 3QW4B 1GHRA 4XUYA 2QCDB 4IGSA 4JTRA 1XC6A 2ZRXA 5JIWA 4K8EA 4QCEA 4YVXA 3MS8A 5H6HA 1KM6A 3WK2A 3TA6A 2WSPA 1EX1A 3GHSA 3C2VA 1A5OC 3GTXA 2QPSA 1PS9A 1RH9A 3FDGA 2WBGA 1G4EA 1G94A 2A3HA 2GSEA 3GHTA 1EJTC 1SSDA 3CQ0A 4H6RA 3M5YA 3TYUA 3DHUA 4GOAA 3DAQA 5DY2A 4QFUA 3UJ2A 1ZLPA 2GJXB 3WLQA 1QASA 4UTMA 4GH1A 4Y9PA 2VUYA 3MUZ1 2ALRA 4HMEA 3TYEA 1Q6CA 4ES4A 3S6DA 4LFYA 2JGYA 3E74A 1UH2A 4IISA 4JDBA 4JX4A 2YW3A 1B9ZA 2CHRA 3EA1A 3VDCA 3A13A 4F0MA 3T09A 3W1XA 1HKVA 2DP3A 1R85A 3AS0A 3VA8A 1H0IA 4MFEA 3MPGA 1DOSA 1LBFA 4P8XA 1M9HA 5T9CE 3CO8A 2PEVA 3WF1A 2WO5A 1U22A 2QV4A 1EB3A 4MAZA 2Y2WA 3UZXA 4Q8MA 4KESA 3SCRA 5H91A 2NWSA 1RVGA 2DZAA 3LX9A 3A4WA 4UTTC 1ALDA 3GDKA 1KGWA 5T26A 4W87A 5DELA 1GTHA 1HJVA 5DBTA 5C9RA 5I3IA 1GVYA 1WZMA 4V33A 3BSGA 1QNPA 1J8VA 2Z7KA 3WEZA 4B4HA 4UUIA 3CLMA 1B1YA 3M46A 4DO6A 3GFXA 4XZIA 2VD8A 5CPNA 4EE9A 1EYWA 2ZZ6A 2EGZA 4WR3A 1I2PA 4DZHA 2V9DA 1TG7A 4MHBA 2G3JA 2HNHA 4E0CA 3LB0A 3GS6A 3QHMA 4CGTA 1L8NA 5HWNA 1NDYA 3VC6A 2MUCA 1Q2RA 3OODA 3KOWA 1TVPA 2YCEA 3WNLA 4UTIA 2Y7EA 3R1ZA 3WD4A 2VZUA 3DEQA 4ZCWA 2JFEX 4XZWA 3APGA 2VDHA 4AYSA 4PCTA 1H41A 3TN4A 4E6MA 3ZJ8A 4KEMA 5A2BA 2YXOA 3K4WA 3N3MA 1S5MA 1V03A 4IJRA 3E0VA 3B0UX 3WQDA 1KB3A 2G96A 1VAHA 1OQFA 3AC0A 3PPHA 1TVLA 5D2XA 5HQMA 4WGXA 2J6VA 3R43A 1R8LA 2QAFA 4O1BA 3FJ4A 2HPIA 1L6SA 4KF1A 3WQCA 2AKMA 1QI5A 2ZXBA 5G2HA 1WOAA 2OOFA 5FSDC 1WNOA 3DERA 3T44A 3HJEA 2QDDA 2RGLA 4HJWA 3VINA 4JQ2A 1WXYA 3I3EA 1GTEA 3CZKA 1N82A 4A3QA 4C60A 4HHHA 4AW7A 1GVEA 1NJJA 1W56A 2FH8A 2XGBA 4N9EA 4G56A 2BGQA 1EIXA 2ODOA 4JHMA 5F2LA 3VIHA 4C1LA 3IJ6A 1JPDX 4JYDA 2QCMA 2O9OA 1LP6A 3OGRA 3LK6A 2Y0FA 4E8CA 1V3LA 1UR2A 2PMQA 3AXXA 1XLCA 1Q85A 2Y5EA 4UFMA 3ARYA 3RYSA 3Q37A 3MI2A 2F2KA 3T7VA 4A8RA 1R2TA 2D0HA 1YADA 1W37A 2CU0A 5BW6A 3C3NA 3NSXA 4IIGA 4EACA 4RPQA 1DP0A 1Q63A 3QOKA 2QCDA 1TX0A 1Z7AA 2XVKA 3MCNA 3DBPA 1W1ZA 3DKLA 3NXLA 1TIMA 8XIAA 2D2JA 2FTYA 1W8SA 1EXBA 3ARUA 1RLCL 3B0XA 2YR1A 3VD9A 2XYLA 2VRJA 3G0SA 4P7NA 1S2TA 4RZ6A 2IQTA 2OGYA 1DWIM 2ZZ1A 3MDUA 3LCLA 3EKZA 3GH7A 3M5XA 5CKSA 2GGEA 1FWDC 3QKZA 3DYOA 3MUY1 1E3XA 1Q6OA 2XFFA 3GVQA 4I3GA 1IEWA 1WDWA 5F4SA 3VNDA 1XR2A 1W5MA 5GPRA 5C9UA 5E70A 1X8CA 3O6YX 3NGJA 5I2UA 5DCDA 3RIKA 3V35A 5EFDA 1DJIA 3D6NA 3G0XA 4PCPA 4IIDA 4Q33A 5B80A 5K4XA 4M1BA 1M3UA 4NZ1A 4N4PA 3AWOA 2WMIB 3W7HA 5C9ZA 4UZSA 1IZKA 2XVNA 3CL6A 1JXJA 2IKIA 3BCFA 5HINA 3GXFA 2X40A 4UR8A 4NNAA 1EJRC 2G41A 2NWRA 3O06A 4A21A 2EO7A 4XD6A 1YXYA 6ENLA 3WMCA 3CLWA 1NWRA 1UP3A 3RLHA 1ZBCA 2DT0A 4PODA 4IQJA 3MV11 3B0VC 2NXGA 2PWVA 3TOPA 3ARRA 4BI7A 3O07A 5K9DA 1DTUA 3G1FA 5HK4A 3A9IA 1A4LA 3EDFA 3CIVA 3W1QA 4F4RA 1FHLA 1X6LA 2E28A 3TAKA 3WY1A 1IWBA 1IEQA 2EPMX 3A5VA 2W6RA 3TMLA 4AFYA 4NJKA 1B54A 5CSRA 2VCBA 2A7PA 2W91A 4ILSA 1WAUA 2G0WA 5K9CA 1RALA 2XZ7A 1ECQA 3TV8A 4XTDA 1R30A 2J27A 3LHVA 4M81A 3FSTA 1UIOA 3W29A 4DBWA 4ZE4A 5K9XA 4K37A 4O0ZA 2AGTA 3MB9A 3KBMA 4W86A 4B5TA 4I7WA 1K6AA 1QJWA 2PDNA 3O3RA 1VCVA 3WQ5A 3I7SA 4PL1A 2PA6A 5AVNA 2DVUA 3NOYA 1HXJA 2P5NA 3GIYA 1HP4A 3F7JA 4PEKA 2OTDA 5D2VA 1BQGA 1YMYA 3WFLA 3D0CA 3W75A 1F5ZA 4GCAA 5C2XA 1X96A 5AC7A 1HJXA 4FA3A 3DG7A 3N2TA 5EKYA 1XHGA 3ZWTA 7A3HA 2J7BA 4OKDA 4A4AA 5JQ9A 1OZMA 1AMYA 3ZT6A 4AD4A 1UR4A 4LUTA 4BF5A 1SFLA 3LI1A 4XO6A 3BLEA 3W86A 2NT1A 3LHUA 3NOEA 5D2YA 3BLFA 5MKGB 4O0KA 1WYIA 3ID7A 5C70A 1W1A1 2DZWA 3P80A 4HPGA 4GY7A 3N19B 1ITUA 3O16A 1BF2A 1H60A 3VNZA 3W22A 4L4MA 3VD4A 1TV4A 3MJYA 3KUMA 4YTRA 2ATMA 3VZYA 1NU5A 1TWWA 1GVRA 2P8CA 2V2CA 4IMCA 1TWSA 4X60A 4JHOA 1OFOA 2J47A 1VFOA 4AZCA 3G24A 4IMDA 5FCZA 3IV3A 3KLKA 1YRRA 5REQB 5LYRA 5IFTA 2WPGA 4I9JA 4IP5A 1HO4A 1A80A 2QR6A 1VFHA 2X41A 5LKYA 5BU6A 3AXMA 3OB8A 4WDWA 4IIEA 2XIQA 3U2OA 3SUTA 1M1BA 1K9DA 3IAPA 3UZYA 2PDLA 4ICNA 1XINA 4KMQA 4HYRA 1ME7A 4J2PA 4FXFA 3S5SA 1XGZA 3EDKA 3GU2A 5FAJA 3Q2DA 2OYKA 2YYTA 1UPMB 2E5DA 4JR5A 1XLJA 4D6HA 1P5BA 2DJLA 5I02A 2Z1KA 5M17A 4WK9A 4B3KA 3JU2A 1OB0A 3GTNA 4GFIA 3W00A 3TNOA 4DBEA 3VNKA 1QATA 3AHXA 1IYXA 1WA3A 1Q45A 2VZOA 4QAWA 1RJRA 2J8TA 2CYGA 4OBSA 4ZZ9A 3G1SA 4DY1A 1LBLA 4A35A 4QXIA 2NV9A 3TKFA 1QDSA 4QLKA 2YW4A 1EF2A 4TU1A 1U33A 3BG3A 1UWTA 1Z42A 1U1HA 2Y8UA 1PTAA 4KW2A 4A22A 1NY1A 4V15A 4R9OA 3DHPA 1EQCA 1LL4A 3SCQA 4GJIA 1HGWA 2Z28A 4FOJA 5MHBA 2IPWA 3EPNA 4GY0A 4EK7A 3LBMA 2P3EA 1K8CA 3RN6A 1B90A 5EMKA 1C7SA 5CQ1A 1P0NA 3T42A 4OOUA 4AF0B 1GJUA 2X1IA 4HNCA 3AS3A 1B3XA 1MMFA 3WD0A 2A3CA 3QR3A 1MUCA 4TR9A 4DF2A 5ABTA 5CG0A 4IUGA 4LS0A 4XZMX 4B4FA 5F4WA 3EPOA 1AZ2A 1ZB5A 3TU9A 3AMCA 1KD0A 4JTHA 4O1CA 1C7TA 1F2JA 4O52A 3BARA 1ZJAA 2HS8A 1UUOA 4JAWA 4Y9OA 3FXYA 3ABOA 3S2MA 1VLWA 3GG8A 1CXIA 4CN6A 3T08A 4BZYA 1JYNA 3RAOA 3JUGA 3OHIA 2ZICA 2POZA 1C29A 2E4TA 1T8QA 3CTLA 1ZBWA 1GVQA 3FJLA 3CV1A 3MP5A 4NASA 3TN6A 3O2LA 4ZB2A 2PDXA 2OQLA 1PZ0A 2B7QA 1DJZA 4TO8A 3TR9A 1RA5A 3TH6A 5T8GA 3PN8A 2GVEA 2XSXA 3QYQA 4HOXA 1KM1A 1JD7A 4WX2A 1LZOA 3UETA 1OK6A 3QFEA 4MDPA 1K1DA 3PZGA 4E8GA 1J0ZA 1A47A 1W5QA 5D4YA 2VEIA 4AIUA 3UVIA 3V0SA 1R3TA 4KQNA 3FA3A 1IR1A 5JXQA 3FDKA 3VYLA 4KCVA 2E7FA 3K4DA 3EKGA 3OBKA 1XICA 5HNNA 1VEPA 1J0IA 4DIAA 3M0VA 2H90A 4F0SA 2VFGA 4GKLA 4CEXC 4B9YA 1V3MA 1K6WA 2CBVA 3SY1A 4BQ4A 3C52A 1SSGA 2YZ5A 1XXXA 4K8GA 5BRQA 2DJXA 4NYYA 4K7VA 4O28A 2RAGA 1WKYA 4GNJA 1S5WA 3CGTA 4X2PA 3UFYA 4WZHA 5LGZA 1MQRA 4PBEA 1VYRA 3RFAA 5FF7A 2CPUA 1H3GA 3ORWA 1JCXA 4GY1A 5AOUA 3CWHA 1IXPA 3W88A 3V0UA 5IDZA 4IX2A 3UZJA 3HGOA 3LCHA 5G4HC 1QPOA 1FWNA 2ZBTA 4WOZA 2QF7A 2EKGA 2ZUTA 5CAHA 3GNOA 2VZVA 3AHZA 1CLXA 1RCXB 2IPGA 2OJPA 1SZFA 1WDRA 5LIWX 1UQYA 2V5CA 3GE7A 4FZIA 3W1PA 5HPOA 1DWGM 1YDYA 2P76A 2DQWA 1JUEA 2FVLA 1EGMA 1YNQA 3D5HA 3CT2A 3E2RA 3M7WA 3IIOA 2Y63A 3MJMA 1DQXA 4BF7A 3AQUA 3T9PA 3AXHA 1IIGA 3EEZA 3M47A 3H53A 3CV2A 2BY2A 4NRSA 4Q4OA 3ZSSA 4WRHA 3F4WA 1CLKA 4UNIA 2YL8A 1WUFA 2XN1A 1IZCA 2YJQA 3S83A 3TQVA 2JGQA 4TX8A 1XYZA 4CNNA 2J78A 2QCEA 1YEYA 1VBJA 3RF9A 4PR4A 3L4XA 1MI3A 3EWBX 5A8MA 1AL7A 3VZZA 3AYSA 4IJBA 3TQPA 4UWMA 1E5NA 2F38A 2NXIA 2D0FA 2VWSA 1XCFA 2VJXA 3H2AA 2XG9A 3WBEA 1TELA 3G0UA 1DJQA 1EDGA 4JQ1A 4ZSUA 3VPLA 4B5XA 4C5ZA 4UOQA 1LOSA 1AG1O 3L4YA 1LTDA 1W3KA 4CQDA 1UOKA 5D8WA 3WUBA 2CZDA 3WLSA 3NL5A 4TIMA 1V6YA 3TX9A 5FEPA 1JF6A 3GFZA 2PP1A 4RNJA 2FGZA 4DJED 1HKWA 4AX7A 5AY7A 4MJ4A 4HT3A 3SCOA 3EXTA 1F6KA 2Y88A 4LC8A 1M68A 3AIQA 1A50A 5CBJA 2G3FA 4HOWA 1PZ2A 3VM5A 5GJNA 3V5OA 1UZ4A 1JFHA 4LSBA 4CU6A 4GIEA 1WXZA 3U57A 3EDJA 1W32A 2C18A 3D47A 2VMFA 3BOFA 3CUGA 3GX9A 4FNPA 1R0MA 3HQNA 1N55A 3VABA 1PB0A 1UKOA 2Y1HA 4X22A 5CZJA 2BS9A 3WQFA 1BXBA 4Z1DA 1EXPA 1TCMA 3DG6A 2Y62A 3M1ZA 2XFYA 1U5JA 3IGUA 4UTTA 2XHYA 2GQ9A 5EMJA 2I7GA 3FN9A 4NAFB 3OHMB 3VOCA 1PX4A 1SVDA 1S2CA 4G9PA 4H7ZA 1Y8BA 2R1NA 1E71M 4QGCA 1NDVA 3N2CA 2D73A 1M03A 4E4PA 2OSWA 1W91A 2WZTA 1BSIA 5EMYA 4H19A 3HM7A 4FLSA 2QJIA 1UWUA 1Z48A 4C90A 3DHDA 1NSJA 3VGFA 1GKPA 4N0RA 3UPMA 2ADAA 5DRIA 3TZFA 4IQDA 3UG4A 3V5FA 2GVJA 2AQVA 1GKQA 4C1KA 3AIWA 4JTJA 1CENA 2BXVA 5U4NA 4OU1A 1TMHA 4XTIA 4LAOA 1ITCA 1L6YA 1F8MA 4XAFA 4JTCA 3S5OA 1R5YA 4W88A 1QK2A 1KKRA 3B9AA 1W2PA 1C8YA 3CB3A 2R14A 1KNWA 2WSKA 2ZZ5A 3ECQA 4JL2A 1FHDA 1SZEA 1EJ7L 3SN4A 4M51A 5HWJA 2HCVA 2NX1A 4ZO8A 1E0UA 4FX7A 4QG9A 2BLEA 2DH2A 4LVBA 3KBWA 2A7NA 3R89A 3VNYA 1OSEA 2GYIA 4LU0A 4U10A 3G3MA 2CFFA 4UC5A 3DFYA 4KERA 3IJLA 2YXGA 2UV8G 1XLGA 4MIMA 2ACQA 2CKRA 1R2SA 2OODA 4FXJA 3WMBA 3DZ1A 4MY9A 1JYWA 5JMUA 1FWJC 4TQTA 4JD4A 4ZR8A 2F61A 4CNSA 4O1EA 1LUCB 2XFWA 3WDPP 4U3CA 1MDLA 1EX5A 5BRBA 1BWVA 4KBXA 1TPH1 3EWZA 2BNJA 1DIDA 1J11A 3OG3A 1TR9A 3WL1A 3VGHA 3AIEA 3OJGA 3INPA 1WB0A 4ADSA 2CLLA 3CV7A 3V3WA 5D09A 4AB4A 3U7BA 3MVTA 4IL2A 1K7XA 1IT7A 4PUMA 2DT3A 1A5CA 3VI2A 1SPQA 2ZZ3A 2O9TA 1AQFA 3WNMA 4E38A 5CPLA 2J24A 2YCLB 4C6PA 1JYVA 5CPTA 4KT2A 2F6UA 5FJRA 4JN7A 1BD0A 1TPUA 1M01A 2Z7GA 2ZWZA 3AOFA 4IPLA 4NXKA 1FBAA 3WKZA 1ZQ5A 4RDVA 1H1NA 1RV8A 1LT7A 1JCJA 1DWHM 3FVMA 3LMYA 4R7JA 4G8TA 3MWCA 3PBWA 4OQVA 4LCSA 4J27A 4EX4A 4QR6A 3CB8A 4XVEA 1U83A 1ZHAA 1HL8A 3G1AA 3LGDA 4KKXA 3VC5A 4H2HA 1MXSA 2A79A 3GR8A 1HJSA 5DLCA 4HN8A 2Q3OA 3MMTA 3VK5A 3V4BA 2QHAA 3DU0A 3BQ6A 3EX2A 2CZFA 2RDTA 4HPHA 1NWUA 1E1EA 3LTPA 5AECA 3STGA 5D2TA 3SFKA 1AH3A 5E0CA 4CD7A 5ENLA 1HG3A 4FF5A 3U2CA 2PP0A 3AS2A 4BS0A 1L6WA 3UZWA 4RR4A 2YZRA 4WKFA 1FXPA 3W84A 1LWIA 3BLLA 4RPPA 4TVCA 3VMNA 4PCFA 1VH7A 4US6A 1TQJA 3I3BA 2VT0A 4DBDA 3C2OA 4KFPA 1H4PA 5DQPA 2EG7A 4DPPA 1S2AA 4ERGA 1TIWA 2IMRA 3PUOA 3LPOA 2Z24A 3UJRA 2CLMA 2J9XA 5A3HA 1XJBA 2XFRA 1VIWA 2V81A 5EPDA 3URAA 4DJEC 3N2MA 4GXMA 3SM0A 3VKDA 7TAAA 1B4KA 2WBKA 5LGXA 5TD4A 5C0QA 1RY8A 4REQA 3DFQA 3TXZA 1BRLB 1XYMA 4O17A 2QGHA 4JX5A 4HIBA 1YTKA 2NVCA 4GXWA 1MW0A 5I77A 3VMOA 3ITCA 3MANA 5CJ5A 4G1KA 4ZA0A 4F66A 3Q58A 1FH7A 4JKLA 2F6XA 3LPFA 4C6OA 4B15A 3LHWA 2Q02A 2JE8A 4L4PA 3UR8A 2J7CA 2BXZA 3BPWA 3ATZA 3BOLA 3MCOA 5LA1A 3WG6A 3EGJA 1FWHC 3MKVA 1GQIA 3PBGA 5GJPA 4HSOA 2UY2A 1JZ8A 3ZMRA 4CCDA 4U3AA 3VDBA 3DKJA 3FYOA 3K46A 3A12A 1BSLA 3UCCA 2OEMA 3BG9A 2Q8XA 5CBIA 3WH7A 1R7OA 4N2YA 2J7DA 2RJGA 3GNXA 2C6QA 1O94A 3ABRA 3ARSA 2FMNA 4QITA 7TIMA 1EJVC 1GYLA 1GJWA 4FXSA 2DY3A 2REQA 3G8RA 3W7DA 4PC8A 1UWAA 2HBVA 2FZ8A 2GUYA 3LU2A 3HPZA 3NJ3A 4OUIA 3H2OA 3KXQA 2ZUNA 3UJFA 5TBOA 2I5IA 4JNZA 3L2MA 2CERA 1QPNA 1TWZA 3A3HA 3BK0A 3QXBA 1UZDA 3IJ8A 1F7BA 3KOZA 1XLFA 3B40A 3KZPA 4Y7EA 1FRBA 1O95A 1U1JA 1AMKA 2FGLA 3OQEA 4J9JA 1ZBVA 2DVTA 4B92A 3VMPA 1R86A 3O05A 4PRWA 5FA5A 2GGIA 3GBEA 3OIXA 2GGJA 4I7VA 4ML9A 3O8AA 1XKJA 2R24A 1VJSA 3KL3A 4GNKB 1Y5XA 3TLQA 1U5VA 1UD3A 4J4KA 3NCOA 4QLLA 3BUVA 3U3HA 2OKOA 2IS7A 4JFWA 3VD3A 4TXEA 3OZOA 1X6UA 4O12A 4E4UA 3B9DA 3MA8A 2V0TA 2CLKA 3F03K 5M2FX 2IW0A 2FTWA 1SFTA 4NZJA 4R88A 3CL7A 3N4FA 3RR1A 4I9AA 4H01A 2R1LA 1A5NC 1HKMA 4WVXA 1OG0A 5BZAA 4MY8A 4BF9A 3QJAA 1DXEA 4KIRA 1GOKA 3NL2A 1S2VA 2V5DA 3UF9A 3LM3A 3K1DA 3L0KA 3W0KA 2WAGA 4PBGA 1E0WA 4M5PA 4MB3A 4HA0A 4L5ZA 1KBJA 3WLMA 1E4LA 3CUFA 1FKXA 2YCKX 4IFKB 3TFXA 1BGAA 2PWDA 1KM3A 4ASTA 1V3HA 1OX4B 1WKFA 1VFSA 3OYZA 3E0WA 3VKAA 3K5XA 3F2CA 2OU4A 4E3VA 4DBSA 4GZ7A 1A0EA 1WKEA 5E93A 1FWRA 1OY0A 4QSHA 1HJWA 2QIIA 3KTCA 4HJFA 5IM51 5C9WA 3EWYA 4UTJA 1K02A 4IGHA 4GYJA 3CHEA 4HA3A 2BOGX 3MSRA 2OO6A 3MP3A 5KZDA 5TQLA 1X38A 3UBPC 2VD9A 1KBLA 4RK8A 4DF0A 3P0WA 3IANA 1A5MC 3W27A 3GTHA 3RCNA 5AHIA 3PZIA 2PZNA 3CYJA 3NPXA 2E67A 1PCKA 3GRIA 3GDMA 4RX0A 3WNPA 1V93A 3HFYA 1XBXA 3DCPA 2WLYA 3CQKA 3O1NA 1XLAA 2O4QA 1QAPA 4QG6A 3NIYA 4MYAA 1I1WA 2DH3A 2QMKA 3C56A 5TAOA 7XIMA 1N8WA 5KTLA 3WNKA 3W1NA 4HPXA 2V3EA 3TTSA 1ZENA 3KRSA 5HQEA 3EYPA 5CXPA 2IQ0A 2YA0A 4QEEA 3ZLFA 1IT0A 3PBVA 1VLIA 3RR4A 2INEA 5CPMA 5FACA 4MSSA 3IVTA 4H1ZA 2WVSA 7REQA 2V67A 4X61A 1PYFA 4EIVA 3G1VA 1N2VA 2JEQA 1RA0A 4GK8A 4HZ7A 1UZ1A 4MKNA 1ZALA 7ODCA 3QC3A 1OADA 1QNRA 3PUGA 2EG8A 2YDAA 1GPFA 3GZAA 3PJWA 2OZ3A 1TJ1A 2VNCA 4IUOA 2QDEA 4QS5A 5A2AA 5D05A 3NAVA 4XKMA 5C2GA 3ATYA 4LVAA 1UA7A 5DMMA 1OFPA 3KLLA 3WSUA 1XM3A 4JTDA 1DIEA 4AZGA 4JTGA 1FDYA 2ZA1A 2CNCA 1R6WA 1DQWA 3C61A 2NVAA 2C3ZA 3LXAA 4HHLA 1XLHA 1XIEA 3K1GA 5JBDA 4TVUA 5G4WA 4RE3A 4K1GA 1TV5A 3T8LA 4K3ZA 2BHUA 1VF8A 4F40A 3THCA 4RCXA 3JW7A 5I3DA 3Q45A 2VL4A 4JIIX 1T40A 2PC4A 4PBFA 2PFHA 3W76A 4R7OA 1E4MM 3O7UA 2WWDA 2PU0A 4NF7A 1CGXA 1O4UA 2GVLA 1YIXA 4ZVJA 3CASA 1GCYA 4KEVA 5AHMA 1FHVA 4C65A 3H7UA 3DUGA 5LIKX 4S3GA 2QPUA 3PZTA 1UBSA 1YXDA 5LZLA 4LWWA 4QROA 5AYBA 1FXQA 3HA1A 1VJIA 1S5VA 1M6JA 4M3PA 1OFRA 4DZAA 4C7DA 3U6WA 1IV8A 2ABAA 3HG2A 3MSDA 2TRSA 3OU8A 3WH9A 2D20A 5HBFA 3RPMA 4DB7A 2FZDA 2GK1A 2HNEA 1CXLA 4ATWA 3C0QA 3NVDA 2EKCA 1MWOA 1G0CA 4OOZA 4UTFA 1JCNA 4K38A 1K9EA 1JR1A 2RDUA 2E9BA 1KXTA 3RM9A 1CYGA 1LJYA 2QT3A 2ZA3A 3AAMA 4UCFA 5I09A 1DHKA 2ONEA 5LHEA 1V0MA 1QOPA 4HU8A 3PUDA 1US0A 3BW3A 1Q5MA 1LL7A 1NFBA 1TUXA 3DI1A 3STCA 1HKKA 1W31A 4CQCA 5BXPA 1EGVA 1UD4A 1HO1A 3LZ5A 1R9YA 3FYYA 1NH6A 4H9UA 3UJSA 1E9ZB 3L0NA 2PDUA 3OVPA 5FJPA 2W9MA 5FI8A 4UFIA 1D3CA 2GUBA 3L4VA 3LERA 4ZTXA 1F6PA 1GEQA 1ZPTA 3IRSA 2YL5A 3VIFA 1TR1A 2UWFA 3MI3A 1SM9A 2ZX9A 4PB5A 2QUNA 2J7GA 4FS9A 1FH9A 3AHVA 3P93A 2E3ZA 3WJXA 1OX4A 3DFTA 2VTFA 3EX3A 2ZRYA 4K39A 2CZEA 4J3TA 2V68A 3AROA 1MZRA 3NQGA 2R9RA 4R27A 3WQPA 3VGEA 2DZBA 1G01A 5AYYA 3QY8A 2UY4A 2QJJA 3L4UA 5CC7A 3R10A 4B90A 4NX5A 2QV5A 1SYTA 3NO3A 3G1RA 3A4JA 3W2LA 1RQEA 1EF3A 4MB1A 4EPDC 3L4ZA 3W2KA 4LVFA 4RUBA 4PSRA 1XLKA 4KWVA 3F1QA 3LSBA 9XIAA 3ARQA 3LDVA 1HIZA 3CNYA 3MV01 1ODUA 1QOQA 3CMFA 2VZTA 4H7CA 1H5YA 3NZPA 3WBXA 3B0YA 3ZT5A 3ZJKA 4XIAA 1GZJA 4D8LA 2D3NA 4JCLA 4IFOA 3W7MA 3CPGA 4O18A 3EX6A 1B5TA 3T05A 5BWAA 4LC6A 2C0HA 2Z29A 1W9PA 2J25A 3WLPA 2ZVRA 4YHEA 3SSZA 4PUEA 1BVWA 2FHCA 2WB5A 2KAUC 3RO6A 3BW4A 3T40A 1H09A 3L0GA 1O7AA 4IFRA 2RFGA 1SZRA 3LCXA 4R53A 5F2GA 2TYSA 4YTUA 2PLMA 1QBAA 4NJHA 1CGVA 4GVIA 4QDWA 1QNQA 2CBJA 1M7PA 3W07A 1ZL1A 2A0NA 3W02A 4R34A 1CGUA 3BLDA 4MYXA 4JIPA 1XF0A 3TSDA 1RY0A 2E1DA 3THUA 1DQUA 4YCOA 3TTOA 1DWFM 5A6AA 3I6TA 4ORMA 4MUZA 3QZAA 2PF0A 2BWGA 4DZIA 1S5TA 4MMWA 1DJHA 1KM5A 2O9RA 1BHGA 3N15A 2WLZA 1F3TA 3BMXA 4HPJA 1CXEA 1Q6LA 2R8WA 4YJ5A 2DSWA 5EFFA 1ZUAX 2FIQA 4KCTA 3II1A 5KMYA 4GLEA 3AIUA 1PX8A 2VC6A 3PBUA 2XIJA 1JYXA 1G7VA 5DCBA 3T78A 5CEWA 4AIBA 3B4YA 3WLOA 4QJ5B 5DANA 3S2NA 3NQAA 1VRXA 3MP4A 1M7XA 2OLSA 4JX6A 2OWXA 1IWAA 3CZ8A 6ALDA 1H11A 4NQ1A 1S1PA 1GPWA 4JFVA 4PMXA 4A2SA 1TB3A 1DIKA 4FI4A 4QS6A 4YPJA 2YDRA 2E0PA 2PCEA 1XH2A 1XLDA 4HTBA 3S42A 3Q65A 1E6NA 4AZHA 2E9LA 2HVOA 5I3JA 3ARTA 1H49A 5BOFA 1FKWA 4UQCA 3KOYA 4JN6A 4HMDA 5EBUA 2WKLA 4MADA 5C6MA 5HOSA 1KCZA 2Y5SA 3A4AA 3N11A 3W23A 3WMLA 3ZQ9A 1QO5A 4X63A 2ZX8A 2BDQA 3PF3A 3M0MA 1LRNA 2PGEA 1VFLA 4M19A 4DJDA 5E9XA 2INZA 2I16A 2OT1A 4JFSA 4H2CA 3I4KA 2J7HA 1BF6A 1AA1B 2ON3A 1MNZA 1P6WA 4BA0A 3T2PA 1ICQA 2TODA 4B2DA 5MF5A 4GA8A 1IQ8A 3B4UA 1T41A 4AIOA 2F9RA 3LHZA 3SB0A 4DJFD 2ZTJA 4EF8A 3N9SA 4ZO7A 4AWEA 2R94A 4FLOA 1VEMA 1JPMA 3RMJA 3AUOA 3WYZA 4KETA 2B7OA 5D33A 1AVAA 1J2BA 4ZFMA 4O1FA 3G1YA 4DQWA 2OZ0A 1FDJA 4AEFA 5CSYA 3IUHA 1S2WA 4D1IA 3B9EA 3FVDA 4F0RA 3BGJA 1AZ1A 3EWUA 4M7SA 3V16A 2D24A 5HMFA 4ZE5A 3N14A 4C6LA 4RNHA 3ARXA 3FSUA 2QS8A 4EPKA 3KRZA 3W74A 2J9ZA 4V27A 4N9BA 3WQ8A 1AFSA 4ROPA 3EB2A 4LAZA 2OKTA 3JZUA 1J96A 1KFLA 2DIEA 2V3FA 3IUIA 2OFJA 4JFUA 4H6EA 3RILA 3C2YA 1X39A 2QULA 2WW5A 3CZJA 4MNLA 1ADDA 4UQBA 4RLIA 1ZNNA 4TV5A 1OX6A 4WJEA 1XLBA 1E4NA 3GG1A 4ACYA 1MUMA 1Q66A 5DFAA 2RUSA 4PMZA 3SCVA 4CD4A 4WIWA 2AKZA 4XZNX 2E6DA 4Y8FA 3BLPX 5HJXA 3CH9A 4LUSA 5DXXA 4RZ4A 3NEVA 1C93A 3R5EA 2GVGA 5AC8A 1BVZA 3MHFA 4HSHA 4BQ5A 1MQQA 3C4UA 2D1ZA 3AUJA 4K7YA 4AMAA 3AS1A 3LGEA 3JS3A 4C6QA 4L6DA 3P81A 1LLOA 4LYKA 2VEGA 1ISWA 3LCGA 4U2ZA 3AHYA 1CNVA 1XC4A 5G2WA 1V77A 1ZY9A 2HISA 1FA2A 1C9DA 3M5ZA 3H2CA 4K36A 4JEQA 2EJ1A 1C92A 1M7OA 4PMRA 1A5BA 2YDQA 2QNEA 1RPKA 3W7QA 2PTYA 2Z1WA 2QZRA 3I6EA 4NI8A 2PDFA 4YIWA 8TIMA 2XUCA 1KCXA 4GABA 4AIEA 5L6UA 2FPTA 3ITXA 1RHCA 4S3EA 1OFBA 1XS2A 3ITGA 4CUCA 3SR7A 1QCWA 3WK1A 1KFEA 3OW1A 4ERAA 4KGLA 1JRBA 5KZEA 3VCRA 4DJEA 1NFGA 1XX1A 3CHDA 3W7GA 3GHUA 3VKKA 3NQEA 1UUQA 2O9PA 3MU7A 4PUJA 3UJEA 2ZX7A 3UVAA 1OWQA 1L0PA 2ZUVA 1QWGA 2ZWYA 2E5BA 5A5WA 1J9YA 3VD5A 3WLKX 1GYMA 4C5YA 4PFHA 2QCFA 1XLLA 3W1AA 1H1ZA 2YIHA 3GO2A 1KWKA 1IWPA 1LBMA 1SFSA 3QQ1A 3LRKA 2DSVA 3NWRA 1ICSA 4G2DA 3PBYA 1VPXA 1NOWA 4XVDA 1VHNA 3TNBA 4XAGA 2O7SA 1DJWA 4DEFA 5FEWA 3M64A 1LWHA 4UR9A 1OYCA 4R7WA 2HTMA 3ZLHA 4IWWA 3WQOA 3WLTA 3LBOA 5G5IA 4NYUA 4DN1A 1EWDA 1DE6A 4MFDA 1B3ZA 1MRAA 4GINA 3TR2A 2O56A 2QIWA 4LNYA 3P5YA 1QHZA 1Q4NX 3N9KA 3L66A 2X2GA 1CXFA 1PIGA 2V38A 3QF0A 3O6CA 1HX0A 1VBGA 3KE0A 4IPPA 4C1NB 1P43A 4UOJA 1IEXA 2PUZA 3EMCA 3W7PA 1OM0A 1MW1A 2TSYA 1QW9A 4WKAA 2WVVA 3ITYA 1QXLA 1E9IA 2BSLA 3GHRA 1FWGC 1RK5A 3ZVHA 4M6VA 5D9NA 4NX0A 1R38A 3E5PA 4Q8OA 2ESCA 3D46A 4PB4A 1RCQA 2Q8ZA 2HJPA 3I10A 1JI2A 1Y5WA 5BXRA 2F8QA 2A6LA 2NUWA 2WM1A 3WBWA 1YTDA 2ACRA 4S38A 4NILA 1VBHA 1K8ZA 1F3EA 3T6CA 2V3DA 1Z8AA 2QUTA 5BOEA 4Z42C 2H8XA 1E6SM 1CGTA 1EOKA 2QXWA 4KWUA 3OLIA 4NXSA 5LNUA 2V2DA 2PCQA 3WJZA 3TJ4A 1DE5A 2Q3RA 3E9AA 4AYGA 3KS5A 4C6MA 3PZ9A 4S23A 5D03A 2ISSA 1WKDA 2Y8VA 4AUBA 2WMJA 2V5JA 1RVKA 1D2KA 1KLYA 2G95A 4MG4A 1X98A 2IPFA 5CC3A 5HPCA 2MANA 1O5XA 1NP0A 5H8UA 1O66A 4Z0JA 1RAKA 1MXDA 3LPGA 1AW2A 4ZQOA 4N6EA 5DRCA 4F0LA 3NSNA 1F74A 4GXPA 3Q4DA 3S4TA 2H9AB 3QGAC 1HN1A 4RZ5A 3DH7A 3MHUA 3WF0A 3BL3A 1I45A 2GQAA 1A53A 3DYMA 4CD5A 4DJFC 2AQWA 1ZBKA 1TVNA 3TVAA 4OVXA 3KTSA 4OV9A 1RBLA 3FCPA 4IG2A 3QY7A 3RITA 1H50A 4Y9AA 4ATLA 3QMRA 3BCJA 3BC9A 4E4FA 3H70A 5DO8A 2PDHA 3GNDA 4LBRA 3AZRA 3ZM8A 1VC4A 2VWTA 1B2YA 3PS7A 1AUSL 4IIFA 2EG6A 4LH8A 1LDCA 1YHTA 3DC8A 4L1WA 3GUWA 4BEUA 1CCWB 3GDRA 3BANA 4CNPA 4W93A 1V5XA 3MY9A 2W27A 2KZHA 1RK6A 1XW8A 3DOPA 1CI1A 4L1XA 3BE7A 2GJRA 3LV6A 3NM1A 4CU8A 4GUJA 3UR2A 2ACSA 1CPUA 3SEPA 3R7MA 5LA0A 4A8IA 4AD1A 1SJBA 1EJUC 1R3QA 3N6JA 1M04A 1JDAA 2FKPA 1JULA 4GC3A 5BOOA 2HK0A 1OVDA 5G2IA 1PPIA 4RZBA 3OEXA 4M80A 1ZP3A 2ZUWA 2OLAA 2CLEA 4KS0A 1OT1A 1Z69A 1ZZMA 1POKA 1B0IA 2YDSA 3SCPA 3GTIA 3PAJA 1WZLA 4Y2WA 3WLHA 1XL9A 3N2XA 3H2FA 1JCLA 3V0TA 4FB7A 1F4HA 3I65A 2GL5A 3O6DA 2QVHA 1P0BA 1YX1A 3SRDA 1CDGA 3WDIA 5JH2A 1PVNA 1MFUA 3KWSA 3TIMA 3W1RA 3C86A 4M7TA 4DWSA 4DAIA 4CN1A 1EJWC 4Q6XA 2ZOXA 2HRWA 2BVDA 5AHEA 3FGCB 1HF6A 4GIAA 1SW0A 5AC4A 2CBIA 1DEDA 3RU6A 4N4QA 3QVQA 4GYKA 1JD9A 2CWXA 2HBXA 4X9SA 1EZ2A 2EJAA 3WF2A 4I7UA 3IAQA 4OFCA 2WHLA 2PRHA 2A4AA 5FKYA 4AY7A 1ZJBA 3EB4A 1JQVA 3JRKA 1EL3A 4LX4A 3AIVA 3LNMA 3H21A 5DEZA 2OR2A 4GD0A 2W0UA 1J10A 3KEHA 1NQKA 3WJYA 2VX4A 4ZXLA 3NGFA 1ISYA 1W5OA 1E15A 1YTEA 1JPKA 4JDYA 4PUKA 2DUZA 2V69A 2WNQA 1FFQA 4F9DA 4NJJA 4Q8QA 1Q3NA 3HGJA 1E6RA 4A29A 2D2HA 5FIPA 2D22A 1UCWA 1KFBA 3KCJA 3BZGA 2ATSA 4C1NA 2Z27A 3K8KA 4M29A 1NOUA 3BGAA 3V5CA 4HB7A 4ADUA 1TPEA 4CD6A 2G4JA 1AH0A 1XI3A 2Q01A 2H6RA 4AHQA 1IEVA 1EO7A 4LPCA 1G4SA 4DM1A 1VS1A 3E5BA 2H8ZA 2ZX6A 2ZUMA 2VYOA 1E0TA 1SZNA 4RXGA 4MGGA 4F2BA 1WO2A 3A22A 2P53A 4IMEA 2J6XA 4HYVA 2I5GA 2VC7A 3RLVA 2YGYA 4S3KA 1OBAA 4JY9A 2OYLA 2PLKA 2WOQA 1OGSA 1LCOA 1GOIA 1XIFA 6TIMA 4XKYB 1UR9A 1DVJA 1C8XA 4ZENA 3IVUA 3P67A 5IDIA 2FHBA 1SMDA 4FAMA 1BPLB 2C13A 2CHNA 1TSIA 3NO5A 1VJZA 2GQ3A 2QCGA 1RJPA 4AX6A 1DHPA 2OELA 3AZTA 3S1GA 2AL1A 3ZZ1A 2FB2A 3ZJ7A 2H9AA 2JQXA 3EA2A 2J8GA 3S46A 2Y4SA 5M03A 3WUGA 1L2UA 2WMKA 2ZZ4A 1MNSA 1K4HA 1QI3A 3VVGA 1AJ0A 3C8FA 1TE1A 5JUVA 4EANA 3PWAA 3QZEA 4O19A 8CGTA 3ZJ6A 5ABFB 1KRMA 4NUWA 4DO5A 5HUOA 1DJXA 3ZS4A 4NJGA 4Q4MA 3W1UA 3U5YA 1RUSA 3B0PA 4GYFA 1LQAA 1V0LA 1JG9A 3R6IA 1I60A 2I9UA 3NDZA 4WCJA 1KXQA 1G9HA 3NPUA 1K3UA 2ISFA 3DC0A 2VR5A 4Q3MA 4EAMA 3S5NA 4O54A 2CLFA 2P8BA 1JGIA 4DX3A 3NSMA 4E2VA 4E5TA 1C9WA 1A3HA 4GQRA 1UJPA 5CBBA 4XQ6A 3QC0A 1X8FA 1O12A 4J35A 3GNNA 4JL1A 4MWAE 4CEUC 3TQ0A 1ZSXA 3KHJA 4QBXA 1XLEA 1V6VA 1I75A 4L7ZA 4UFJA 3QSRA 2OCZA 3LXBA 2NQJA 2Z1BA 3G1DA 2CW6A 3CEUA 2VC5A 2FHFA 4CQAA 3B8SA 2J9YA 4L4OA 1V6XA 3ABZA 4GIYA 3SGZA 4IIBA 1JF5A 3LGGA 3RO8A 3DFOA 3T0DA 1TKKA 4BHYA 4I9TA 1W1YA 4YCPA 1UZHA 4H9YA 4L9ZA 5D04C 4J3XA 1OT2A 4GI4A 4NZ4A 1C8QA 1XWYA 3W26A 1CZ1A 3BMWA 4MZYA 4ZSTA 1DJYA 4NP7A 5FF3A 2DDXA 3M16A 3FGCA 4FNRA 3TN5A 3HPSA 2QQ6A 1IEIA 4DF1A 1EWEA 3MW7A 1HT6A 1GG1A 2HXUA 2YB1A 1VHCA 1V4YA 3EWCA 4M1RA 4J2MA 3HQOA 1Q8AA 1N7KA 3S5YA 5XIAA 2HV5A 3LG3A 4WGHA 2V82A 3GR4A 2NQ5A 2RHGA 2H3DA 3GC5A 5BROA 4LUTB 3ZO9A 4GFSA 1FP9A 2O92A 1W3JA 1JCYA 1R87A 1Q7ZA 3BAYA 2F2HA 1KA9F 1A5SA 4KFNA 1WAWA 3SCTA 3H2MA 4YYFA 4H04A 2ZVIA 3EB3A 2HK1A 5ECUA 1TZ9A 2PDWA 3PFMA 1TTQA 3W85A 4R33A 5EA9A 4PULA 3S6TA 1SJDA 3HFTA 1A4MA 5D32A 3WCZA 1HVXA 4QJ1A 1HKIA 4PTXA 2WV8A 1W9VA 3R0KA 4PMQA 4XIMA 3CMGA 4PN2A 1ZRQA 4Q32A 2I57A 3N12A 5DT5A 2PRLA 3W37A 1E70M 3THQA 3ZOAA 1XKYA 4YTQA 4MWAA 1CGWA 1I8JA 4NG3A 4OECA 2X42A 5DBUA 2GDUA 5I3HA 2QJNA 3WUEA 3WQVA 3FIGA 4H9VA 2QCHA 4AZCB 1KLZA 1GEHA 2CBUA 1TPVA 1O5KA 2VX5A 1UHVA 3GC4A 4ZB5A 3PZNA 5C7VA 1Q6RA 5G1YA 2FPYA 4XKYA 1BLIA 4IL0A 1LLZA 3PTQA 1VZWA 3H6OA 4PMUA 3CQJA 5AYIA 4JYEA 3WQ6A 1KM2A 2Y7GA 3FYPA 2PTXA 1EEPA 1RXOB 2HZGA 3FW6A 5IFPA 3NURA 5C55A 5C9XA 1RD6A 2C8NA 1N8IA 3CAKA 3NVTA 1HP5A 1J93A 4WDTA 1F9CA 5I06A 2J62A 3C2FA 1VPQA 4JHZA 2NXHA 4QM1A 3PTMA 2PAJA 2WK2A 3F4VA 1UR8A 3UP8A 1WDSA 5CCZA 4LYRA 4PMDA 4HNNA 5HWMA 3FA4A 1H7WA 1K8YA 1XGEA 4AQLA 3TAOA 3UXAA 2PWFA 2Z2UA 1UD8A 1EC9A 1EP2A 4PTVA 1DKWA 3OZPA 5AZ1A 5ABFA 4Z0SA 1Q6DA 2NX9A 3ZR6A 1SQ7A 4WJ8A 3TW9A 1ZP4A 3KP0A 3TYCA 3B05A 1BYDA 3DIPA 1SW3A 3VKJA 3VE9A 4DZ5A 3RM8A 1W0MA 4KWSA 5I79A 1TCDA 3PP7A 4EXBA 2TPSA 1JDEA 1PDYA 4KCUA 3H4GA 4NZCA 3S1WA 4UTHA 2XWEA 3TFCA 2ZE0A 3BAXA 3NZQA 2TMDA 3FFSA 3W71A 8RUCA 2OWWA 3EX1A 4NNCA 3TC3A 4RXFA 1A0CA 1SUXA 1QMLA 4QHRA 1Q7MA 2FDMA 4US5D 3QMSA 2EBNA 1P0DA 3ZR5A 1DJGA 4IXXA 4PMOA 3TJIA 3RDKA 3W7JA 4CLMA 2IUZA 4Y9NA 1O1ZA 4L61A 1HNYA 1J4EA 4FIRA 1UWQA 1TWIA 1CXKA 4HHPA 4AEOA 2VUNA 2R6OA 4H9TA 1FQ0A 3F2DA 3I3DA 4FXRA 3C8NA 3VNLA 1H5VA 1XH1A 3DFHA 4JTKA 1PZ1A 2CIPA 1RLDA 4WHBA 2FZ9A 2Q71A 4KEUA 3TROA 1W8GA 4LOCA 1Z41A 4FNTA 1PKYA 1VKFA 2Z2BA 2E9MA 2X16A 1EC8A 3CZGA 5AKQA 4O8AA 1CXHA 2DVXA 2Y24A 3ENLA 3B9NA 2GFTA 4LEQA 2XVPA 2WKJA 3WNOA 5I07A 2I9EA 3S8HA 1S39A 3GG0A 3QOMA 4W8LA 1NTHA 4M8UA 4B5UA 1KV8A 1LM1A 4W85A 1OINA 2VR4A 3BSMA 1EZWA 1Q6GA 3UYIA 2C0AA 4P7RA 3E96A 1UWIA 3PZUA 4HNOA 5D02A 1AL8A 3DYPA 1VBUA 2EPKX 3T4CA 4IH3A 3L7RA 3PJUA 5FL1A 3ICJA 1QO2A 2PTDA 3EPMA 3QGVA 4PTDA 5JBFA 4H8HA