4Q6JA

Crystal structure of eal domain protein from listeria monocytogenes egd-e
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
248
structure length
245
Chain Sequence
DISSTEIWDAIRRNSYLLYYQPKVDAKTNKIIGFEGLVRLKTATTILAPIDFFDDIVLLNATREMQDFVAETAIKQINQLGGRFSISINIPAHYVASSTYMTFLHDYVKEHLKYPECLEIEIIERTELAIADKNLRKIKDLGVKVSMDDFGKGYSSLAYLRSLPIDIVKTDMSFIALLKTDRKQQIIIRAIVNLCHDLGGKVVTEGVEDMEQVEKLREMKVDYFQGYYFSRPLPMEEIKQKYSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo0131 protein
publication title Crystal Structure of EAL domain Protein from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Unknown function
total genus 83
structure length 245
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4q6jA00
3PFMA 4Y9MA 4F3HA 4J40A 5MKGA 3U2EA 3GG1A 2BASA 3GFYA 3PJXA 3HV8A 4Y9NA 4FOJA 4FOUA 5M1TA 3PJWA 3N3TA 4HU4A 3GG0A 2W27A 4HJFA 3SY8A 4RNFA 4Y9PA 4ES4A 4AG0A 3GFZA 3PJUA 3PJTA 4Y9OA 4RNIA 5MF5A 4LYKA 3KZPA 4Y8EA 4KIEA 4LJ3A 2R6OA 4RNJA 4RNHA 5MKGB 4AFYA 3TLQA 4F48A 3GFXA 3HV9A 3S83A 4FOKA 4HU3A 4Q6JA
chains in the Genus database with same CATH superfamily
3SURA 2HPIA 1EJWC 1DJGA 2VC7A 3M9YA 1PZ1A 2V3EA 1YXCA 3AIEA 1WZLA 1BD0A 2ZA1A 4W88A 3IVSA 1PX8A 1FX6A 4PCTA 1LOQA 4OWGA 5F4SA 2Z0IA 2WO5A 3GDTA 2EXOA 3HV9A 2C3ZA 5AVHA 3L4UA 4Q7BA 1JCTA 1ODUA 4B9YA 1KKRA 4KQNA 4NAEA 2WCGA 1POKA 4ZCWA 1WX0A 1LL6A 4YU1A 3M0JA 1ONXA 4GIYA 1JZ4A 3LCIA 1EDTA 2ISSA 3MI2A 1ME9A 2E67A 2GOUA 1EYWA 2AQWA 5AYIA 3K13A 3VZYA 3OLGA 3LCWA 1BWKA 2VQUA 1PTGA 4JAWA 4C7DA 3NL3A 1TUXA 3KRSA 4AG0A 3FJ4A 5XIMA 2DT0A 3OEXA 4P8WA 4S3GA 1Q7MA 3IJIA 2WZTA 1OD8A 4LBRA 4BHYA 4UZUA 1EF2A 4V1XA 5A6BD 3L4TA 3KCJA 1KM3A 3EB4A 2I9UA 4A3UA 3GLCA 4YJ5A 3SN4A 4XB3A 1ISYA 2XWDA 1K02A 2WMIA 4M80A 4XV0A 1QVBA 3EX6A 2XVPA 3P6LA 1W3LA 2BXZA 2WV8A 2E6DA 2A6NA 3TTYA 3ME3A 2P1FA 1XYAA 4TU1A 1TE6A 4QNEA 1RBAA 1ZTVA 4BJHA 4Q7IA 1CXKA 1UHVA 1I1XA 5LIYX 1FKXA 5CJMA 2QDHA 2F9RA 3N25A 3KLKA 2BZNA 4BWLC 4IP4A 5D9OA 4TXEA 3FAWA 1UD5A 5PTDA 4F66A 1PTDA 1EF3A 4HKPA 2IKIA 4UTMA 3S5ZA 1QI4A 2HNEA 4Y9PA 1CTNA 2I14A 3E1F1 5HAOA 2B7QA 2HVMA 3HPSA 2J7BA 2HXTA 3HO8A 5DELA 1VIZA 1TCMA 1EYEA 1LQAA 5A2BA 2WHLA 3QFWA 4GBUA 2CEQA 3E0VA 3EOEA 1O1HA 5IM51 2EEXA 4XD5A 4UQCA 4BQ5A 3AYVA 1EA9C 4BEUA 1E6PA 2DZTA 3LEPA 1GJPA 4R34A 1YE4A 3PVFA 1ML1A 1QK2A 3RFAA 3SAZA 3SCVA 2ZQ0A 1IWBA 3BCJA 1FDZA 4B3LA 4XZLX 4PMOA 1PJ9A 3T4CA 2Z2AA 3N2BA 1IE7C 3THAA 5G1TA 3CLWA 1U1UA 3LLXA 4O8AA 5J04A 4DWSD 3S2JA 4Q8WA 3M7SA 3GDMA 3RN6A 1I2OA 1JL8A 3CPRA 1Z6KA 3W2JA 3BDKA 4CQBA 5FIPA 1IEQA 4B4FA 1NFGA 1J0YA 3VNZA 1LUCB 1KXVA 1CX9A 1V0KA 2DH3A 2UY2A 4EWND 4UNKA 1KM1A 1W2VA 1UKOA 5F4WA 1J96A 2RDWA 4JTEA 4WJ8A 1S1PA 3R4IA 5I2UA 3G1RA 5HNTA 2Z29A 2R9RA 1GG1A 2DU2A 2VHLA 1W1B1 4HCLA 4U2ZA 4PGLA 3S5NA 3H2AA 5IHRA 3AMLA 3ZLGA 4KKXA 1LL4A 3EOUA 1R30A 1EP3A 1CLXA 2GQ3A 4PSRA 4ATWA 1A4LA 1DIEA 4YL2A 3QZAA 3UZYA 5HR6A 1ZP4A 1TZZA 3WFZA 1MRAA 4MUZA 4PRWA 1YPXA 2QF8A 1UZDA 4M6QA 4GUFA 1DKWA 2E77A 1BVWA 2Y7GA 5I07A 4MY8A 5I6SA 3RPDA 2HK1A 4Q4OA 1SVDA 3N15A 5GJMA 2PAJA 2PGWA 4LH8A 1SO6A 3M5ZA 4WGXA 3B04A 1FWFC 3MKCA 4P2VA 4F0MA 1R46A 3VMPA 5FF0A 3H24A 2CZEA 4C7FA 1O68A 2DZBA 4PB4A 3WEMA 3ANVA 3GTXA 4CQAA 3HV8A 1V02E 1E6NA 1XLJA 2ATSA 1SO4A 5LHFA 2V81A 3S9YA 3H4XA 1GZ1A 1GQNA 2VR5A 4ZO9A 3RLVA 5H6HA 4DJEC 1JPKA 1JDAA 3NJ3A 4IP7A 1SFSA 4JTDA 2H90A 1UR4A 4NJHA 4EVZA 1NFBA 3RAOA 3KX6A 5LYRA 1H7PA 2CETA 2C0AA 3PM6A 3O6CA 3WN6A 1EZ2A 1W5QA 1G4SA 4UWMA 3QKZA 2NWSA 3FJ6A 2DSUA 3P5YA 3BJTA 3VAVA 3WNLA 5KMYA 1UA7A 4MFEA 4MY1A 3B0XA 1FDJA 3B4UA 4OECA 1V08A 4AQLA 2J75A 5D9MA 1NIUA 3KZPA 3U2CA 3W83A 1NOWA 3JZEA 4HB7A 3QSRA 5I3FA 2ZTJA 1IZCA 1JDCA 1QNOA 4GUHA 2Y85A 4ZEPA 3AZSA 3QPZA 4IMEA 1VGAA 2VR2A 3EWYA 1BYAA 3GQYA 3M0XA 4LYKA 4US6A 1HL9A 3G0XA 2PWEA 5CSRA 5ABHA 1K4HA 3ZM8A 4DJFC 1KM4A 1F3EA 4BY3A 1TWSA 3R12A 4O0KA 4YMZA 1JZ5A 1B2YA 2R91A 1C8VA 1W3IA 5HA7A 1UR0A 3CASA 1MXGA 1KFJA 2VP8A 2CITA 1NP2A 2QYGA 1E6QM 3WH5A 4KPLA 4HOWA 2V5CA 1TREA 3UG8A 4POCA 1GPFA 2G3NA 5I77A 3OHMB 3OZOA 2R14A 4RK8A 1RXOB 1B3VA 1S1RA 3CMJA 3IV8A 3HOJA 3URQA 3WNOA 4DWSB 4IPIA 1Z7AA 1KWGA 2WJDA 1A49A 2PB1A 5D33A 1D3GA 5DCBA 3BAJA 6XIMA 3QSTA 4L9YA 1F6PA 1QT1A 2VC5A 4DVOA 5LNWA 1W9PA 3QRHA 1J0KA 4C6QA 2YXGA 5AKQA 1IWAA 5CC6A 2EPHA 3FFSA 1V0NA 1W54A 1X1OA 1DJYA 2JALA 1MVYA 1WBJA 3A5FA 2Y8KA 1XD0A 3MP5A 1TKKA 4F0HA 2J7HA 4UMCA 1W1VA 4UTUA 2HTMA 4NUWA 4JICA 3H7RA 1R3QA 4K1GA 3HTWA 2VKZG 2OWXA 5H8UA 2YW3A 2Y5JA 3KUMA 3R2GA 3L68A 1OGBA 1JD9A 1HL8A 3T0DA 2BS9A 2G3FA 2GJNA 5G5IA 2W3ZA 4AXNA 3GNPA 4TVCA 2Z1XA 3N3MA 2WKLA 1KFCA 1EPVA 5K9XA 2W91A 5CC7A 3IEBA 4B90A 4O18A 4BCEA 3QY7A 3W27A 4PTDA 4GXWA 4HTBA 1VZWA 5G1MA 1M7XA 5H2ZA 3G2GA 4WX2A 1PKNA 1B3YA 4R3UA 4DBEA 4CU8A 4A4AA 5L6UA 7ODCA 1TIWA 1LLWA 1XYBA 1RPXA 4AY7A 3DI1A 3QYSA 1EH9A 3L66A 3CIVA 4P8XA 2VX4A 5HR7A 4FNTA 2J88A 1A0EA 1Q4NX 2OTDA 1FWTA 3PG9A 1JR1A 2WM1A 1HVXA 3WUGA 1DQXA 1OYCA 1XCWA 1JCXA 3VINA 4C5ZA 1G01A 1X6NA 5HK4A 4IJBA 1QXLA 3G1SA 2B7OA 1OEPA 3HIJA 2JKAA 2V5DA 1M6JA 2BXYA 4P7LA 1C7TA 3L65A 3BG3A 3ZIZA 2BNJA 3EWDA 1GEHA 1X8CA 1H50A 4GY7A 2GUBA 4KGLA 2PBGA 2RGLA 1M65A 2E6YA 3UCCA 2GVLA 3DEQA 4XG1A 4NX0A 5FI8A 4GK8A 3PY2A 1OF8A 4JTUA 3M43A 3UYIA 1NWRA 3SGZA 2R1NA 4J35A 3FYPA 5CGTA 4KWOA 3APGA 2EAWA 1V3MA 1RY8A 4NI8A 4IPNB 4GNKB 4JCLA 3A9IA 5DRCA 1DORA 3WD0A 3IWPA 2QIIA 4XSLA 4KFOA 3BAKA 3NSXA 2YLAA 2Z1WA 4OV4A 4JQAA 2OZTA 3VFCA 2F6UA 5M03A 3R8GA 2TYSA 2GVYA 1LRNA 4L9XA 1KQYA 4YLWA 2DT1A 4P8VA 2RDUA 5D09A 2GJLA 4MYXA 4ERIA 1SFJA 4Q4PA 4UZSA 3LZ5A 4IFOA 3E0WA 4B5UA 2OQHA 2V30A 1WPCA 4US5A 2VCAA 3LRKA 3FSUA 4WLCA 4ACZB 5FEPA 3A23A 1GVOA 4PTVA 3CU2A 4HA0A 4FALA 1DE6A 1OT1A 5F2LA 1K1DA 1BVNP 2FZDA 2E1DA 3JS3A 3FHQA 5DEZA 2YCIX 4GC4A 2WSRA 4MKNA 1H7WA 3WQ4A 4XKYA 1KFLA 4QX4A 3E5BA 3U5YA 3BARA 1BRLB 4EPBC 1KTCA 1F07A 1VCFA 4MNKA 3WY1A 1TELA 4Q4SA 1B9BA 4BKNA 3KCOA 3AIBA 3ZLHA 3AXXA 1DWHM 4M6VA 1UROA 4G5DA 1OFAA 3IARA 1US2A 5DRIA 4H9MA 3TYCA 3N9RA 1F76A 3W7GA 5HPOA 4OZOA 2PGFA 4ICCX 1VB9A 1TPFA 3K1GA 5HMFA 1OCQA 3QW3A 2XVLA 1DL3A 3WMSA 2QUNA 3GK0A 2AAMA 3ONCA 1ZB5A 4EIVA 2J77A 3OA3A 4X22A 4ZE4A 7A3HA 2MNRA 3TA6A 2IPFA 2J66A 3BL3A 4HSHA 3WZ0E 4AUBA 1QASA 2FPYA 3F2CA 3TQPA 5A8NA 2PC4A 1BSLA 3U8GA 1YNYA 1W6TA 5FA5A 3GR4A 4OBSA 4RJEA 2BP1A 4Q32A 4GI4A 1EUAA 1SZNA 2FYMA 3GC5A 3LY0A 3CB8A 3E2RA 5FAJA 4NZ4A 3NGJA 3VILA 4LQ1A 5MF5A 2YW4A 2J74A 1KRAC 3NNTA 4NJKA 3GR7A 3W23A 4LVFA 3CAQA 3S2LA 3T1GA 3EB3A 4DZHA 1JPIA 1XIEA 1HKKA 1ECEA 3E2QA 3GIPA 3SFWA 2XTKA 3TC6A 3TQ0A 5LA0A 5CPTA 6TAAA 1QW7A 2X2YA 2OZ3A 2OJPA 4JIRA 1WAUA 4UFJA 3M46A 5AN7A 1HIZA 3KOFA 5B80A 3AFBA 2WSQA 4GQBA 1J93A 4A3HA 4XUYA 1MDRA 4QSFA 4RE3A 4CU6A 4X60A 1HKMA 4J1OA 4QXIA 3ZFHA 2YDRA 2D69A 3OBEA 3V3WA 1ADDA 3VX1A 5JU6A 2Y89A 2UZ9A 2I17A 1J0IA 3N12A 3R79A 4PC8A 4AB4A 4JTLA 1PYFA 3UY7A 2ZRUA 2V5KA 4AIOA 8A3HA 1OVDA 1GVYA 2W92A 1AQHA 2Y1HA 4AZGA 3ELFA 1BGGA 5FF7A 4KW2A 1V6TA 2YL9A 3W72A 2QQ6A 1BGAA 3DAQA 4ATLA 4ZE5A 4IQEA 4LUTB 2NVAA 1PPIA 4GMEA 4BF9A 3G18A 2QCHA 1PTAA 3TQVA 3TTOA 4AMAA 4ZQCA 3MO7A 3B8IA 4OBTA 2X30A 3BE7A 1CXEA 4FO4A 3TU9A 2ZICA 2EPLX 5C9XA 3UVIA 5TIMA 2JGYA 3VNJA 4GYJA 3AIVA 4HHMA 3A6OA 4W5UA 2BY2A 1ME7A 2BHZA 3O0KA 4YVXA 3ZT6A 1HO1A 1TFVA 2DP3A 2WJEA 5CPMA 3ICJA 1RALA 1KLZA 4FPSA 4IQLA 1YMYA 4LEFA 2VFFA 2YL8A 4MKSA 2Q8XA 1QHOA 2POZA 2H3DA 3CYVA 3Q37A 1N82A 2NV2A 1A4MA 4XO7A 3C3UA 4PL1A 2X1TA 1F73A 2ZE3A 5M2FX 2PDQA 5BNKA 4O10A 3R1ZA 4ZTYA 3G1XA 4M7TA 3VIPA 4TMBA 3OJGA 3DFQA 4ADTA 1JQXA 4NL1A 1XDJA 2JIEA 1GOWA 5KZ6A 3HG2A 5AZ0A 2X0HA 4V27A 3BGGA 1H60A 3BUVA 4AIEA 3GIYA 4JQ3A 4Q4KA 5D30A 3HMJG 2ZC8A 3UZJA 2XGBA 4E6MA 1S3TC 2BLEA 4L56A 4ZO6A 3RILA 3KOWA 2EHHA 5AC6A 1ISVA 3NXFA 1BYDA 1E0XA 4YHEA 4NAEB 2Z4GA 1RCXB 2QDDA 4JHOA 4NRRA 3HGSA 4QR6A 3WDIA 4Z1BA 3CLMA 4JYEA 3WL0A 3W25A 3W2MA 4NILA 2FVKA 1IQ8A 3WQ5A 4DBWA 3CUFA 1GWJA 4PUDA 1QCWA 2QCFA 1AL7A 2E25A 2WVSA 2WMKA 3NM3A 1A80A 2AAAA 3UXAA 3GRIA 1H5VA 1BVZA 1X38A 1W0MA 2G37A 3DFPA 4XK2A 3AI0A 1S39A 3CM4A 1QFEA 1XBYA 1QPOA 4S3AA 2A4AA 4PZVA 3OP2A 4UTKA 3LNMA 4DUOA 1HJUA 1ICPA 1WUEA 4AHOA 1H49A 3C8FA 3SW6A 2YFNA 3TYZA 1UIOA 5HPCA 2A85A 4U10A 1SW0A 3OOQA 3QV6A 1WXZA 1UD4A 3BVJA 1TA3A 1RCQA 4JN8A 1L6YA 4LF1A 4ZOBA 3SCPA 4DWDA 1EJTC 2EG7A 4H9UA 5DMMA 1O5KA 4F0SA 2VEKA 1T99A 4IICA 5E0CA 2VR4A 3WH6A 4Z2IA 1GYLA 3SQMA 1KM0A 1SZGA 3B0PA 3JZUA 3O16A 3SI9A 5AHNA 4C6LA 4W86A 1L6GA 3WLIA 1R85A 4M82A 4ASTA 4XZMX 3CO4A 4IMFA 4GJIA 4GFSA 1LQ2A 4XISA 3VUSA 4HPJA 3NZPA 3FVMA 4H6RA 5I09A 4EP8C 1VYPX 4LV9A 2V38A 3CC1A 3IUDA 4TV5A 1XINA 5H8MA 1TV3A 4I5RA 1R7OA 1CECA 3FJNA 2ATMA 3EZ4A 2Z2UA 2X42A 3DKJA 3RITA 3NVDA 1WKYA 3MDUA 2FIQA 3WF4A 2XZ9A 1JJKA 3JUGA 4LVAA 3S47A 1V93A 4JTAA 1S5NA 4DZIA 3EEZA 2PPGA 3LBCA 4C7GA 4O1DA 1BTMA 1QU4A 4FLSA 4O1FA 4H41A 3SCWA 5E9XA 4ILSA 1KFEA 4DPPA 3E49A 1JI1A 4F4RA 1QNRA 4ZODA 2VENA 3TN6A 4D6CA 4S3DA 1K77A 3WNKA 4JFVA 4Z1DA 1KR0A 1VCGA 1NQ6A 2ZWZA 4CU7A 4TMCA 4L1GA 4AHPA 4HOZA 6XIAA 5DX7A 1RCOB 1T41A 4CN1A 3WBAA 4ZR8A 1EIXA 4IIBA 5E09A 3WBXA 3IANA 2OSYA 4JKKA 1PKYA 4H8UA 1G4EA 2R6OA 1UC4A 3NDOA 3W07A 1CYGA 4E8DA 1E55A 4UTWA 3W84A 3DDMA 4R88A 1SU5A 4J40A 3GXTA 4Y2WA 3S1GA 1IXNA 5BU6A 4PRRA 4AD5A 2GJRA 3EOSA 1DJHA 3MYPA 3LENA 3MT1A 4GGHA 3WF0A 4GVHA 4UFHA 1PKLA 2A5HA 4LY8A 1PS9A 3GHRA 4OBRA 3GBDA 1XM3A 3BW3A 4DRSA 5B7YA 3T07A 2VM8A 4R7JA 1KM5A 4GXMA 4H2HA 3VD3A 4UTJA 1JG9A 4A2RA 1CGUA 3F4DA 3RU6A 3CZGA 2JF7A 2XISA 3IPWA 1DIKA 1ZBCA 4H83A 1GW1A 4FNRA 4F79A 2OLHA 4AZBA 1GKRA 2CXGA 4O17A 5C0QA 1JCJA 3L21A 3DFSA 5BROA 6A3HA 1JCMP 2QUTA 1OCNA 2NVDA 3O63A 1KKOA 1BF6A 2XH0A 5REQA 3W85A 1IR2A 3WLKX 2O9PA 4L6HA 2X1UA 1TPUA 3G5EA 2ZX8A 3MY9A 4C6OA 1A5SA 3WQVA 3OZMA 1OM0A 4MGGA 4K38A 5G1YA 3GNDA 4R9XA 2Y5SA 4CD7A 2I16A 3MV01 1V6UA 4O15A 3W2LA 1W5PA 4GI9A 2FDSA 4Y7EA 3ZWTA 1VFFA 4GOAA 4KESA 2VC9A 3CHEA 4UTIA 3ZVIA 4QDWA 2ISDA 4JIQA 3GTIA 1Z42A 3OTRA 3HPZA 3OZPA 3L0NA 1MO0A 2DV0A 4WXYA 4S3CA 2UY3A 4DBUA 1DBTA 3R58A 4U33A 2IKHA 4PMYA 2WC7A 2DQXA 1PV8A 1TE1A 4D1JA 4JIHA 4WEVX 4QCEA 4O50A 5FJIA 1GQLA 3LGGA 4BI6A 2JE8A 3AS1A 1NSJA 3C8NA 1P4CA 4TX6A 3Q2DA 4GIEA 1N2VA 4JBRA 4YNGA 4YCPA 2WLYA 2IKGA 3OGSA 3U3HA 4YVPA 3WIJA 4JGDA 3O2LA 3LCFA 4HHHA 1F05A 1YADA 4EWJA 4UQBA 2XSBA 1V3HA 3V1HA 2OZ0A 5FJJA 3QC3A 1R3VA 1E43A 3CAWA 4JTCA 2HVNA 2DGAA 4PMXA 4HPGA 1PKMA 2FTWA 2WVUA 4XIMA 2ZIDA 3H12A 4MB3A 5GNXA 1V6XA 3K8MA 3UESA 4EXAA 8XIMA 3MZ2A 6REQA 1J10A 1REQA 4A8LA 5F1UA 3UBPC 4K39A 4E2VA 1KRCC 4C6MA 5BWAA 1DWGM 4EPKA 3UWVA 1C9DA 3VKJA 5BXSA 3VNLA 2XM2A 1K6AA 1KR1A 3EKLA 5AVNA 1KXQA 1B4KA 4Y8EA 1ONEA 2PD9A 3WF1A 3QV9A 3WD3A 1VRXA 5KETA 4XO6A 3KRBA 3EXRA 5E0FA 1AJ2A 3U57A 1XL9A 2V2DA 1RD6A 1XIIA 1JCYA 1M04A 5AC5A 3VGEA 3W7HA 3GFZA 5A6JA 4J28A 1HJWA 1OG0A 2CW6A 4MZ1A 4L65A 3RX4A 4HA3A 3RU8X 5A8OA 4IUGA 3T44A 3ZMRA 2PWHA 1TPWA 1Q8JA 2PDHA 1L9WA 1WZAA 2CZFA 1FKWA 3UR2A 2ISFA 2C18A 5AECA 1GQJA 1EIBA 2PDUA 1X7FA 4L61A 5GJPA 3QR3A 1F8MA 3GHTA 1AJ0A 3EAUA 1FQ0A 3T08A 3GNNA 1F3TA 1YNQA 4LYQA 1P1MA 3W7IA 4H9TA 4DUVA 4FNUA 3T55A 3MCNA 3BSMA 2ZFAA 4U28A 1JQVA 3NQMA 1V51A 3NFUA 2J7DA 4PUNA 2OX4A 5JVLA 2WC3A 2REQA 2J6VA 5K9DA 5FEWA 2AMXA 2FFCA 2PGRA 5D37A 1ITCA 3AMGA 2HISA 3UERA 2X16A 4GI6A 1S2AA 4ZXOA 1ITQA 3GYEA 3GVQA 4CNSA 4UC5A 1OGGA 4OTKA 3LZ3A 2TSYA 3G1AA 4JTGA 4AVNA 2JQXA 2QJIA 1LG2A 2YCJA 4AVFA 5I0DA 1WDDA 2X2GA 2O9OA 3PTMA 4V28A 2C13A 3KL0A 4D8LA 4AD4A 1NOUA 2AKMA 3IJ8A 3WEOA 1HG3A 3PS7A 3WQEA 3G77A 1CT5A 1UZHA 1KM6A 3REQA 4DZAA 4FXRA 1Z8AA 5DY2A 2G96A 4DJDC 4XIAA 1L2QA 4S38A 1VFLA 1E4NA 4EXBA 2WMFA 5MHBA 1XLDA 3V7PA 3WMCA 4LT9A 2ZUSA 3MCMA 3QHOA 2RJGA 1J2WA 4DI9A 2EF9A 1UBPC 3NUKA 1KXHA 1OYAA 5HINA 2XSXA 4Q8PA 1IT7A 4WY0F 1TWZA 5LIKX 2XGIA 3RLGA 1TV8A 4EF9A 3IACA 4LRSA 3FYYA 1B31A 1GVEA 3W7DA 3QBUA 1H5YA 2YB4A 5AZ1A 4TIMA 1XISA 3FYOA 1T0OA 3WBYA 3V0TA 1GVIA 2HQAA 3MBFA 3R10A 1E4LA 1XFCA 3ONBA 4H7VA 2E6AA 2W0UA 4H7CA 1N8IA 3NQAA 4MB5A 3CWOX 2F2KA 1A5UA 2PZNA 3KOXA 4MVAA 1HF6A 1HJSA 3URAA 1RK6A 2WLZA 8XIAA 3PF3A 4E4UA 2VDHA 4E2BA 3I7RA 3L2MA 4BR1A 3BOFA 5FESA 3K2GA 3K4WA 1DOSA 1MNZA 4RPPA 3O06A 2QV5A 3CWHA 1UCWA 1NTHA 4CNTA 3OGRA 1LF1A 1S2VA 3WLJA 1Q4WA 4HNUA 3VNMA 1KA9F 2XZ7A 3J7HA 1UJQA 4QAIA 2GZXA 3ZT5A 1G9HA 1XYZA 3GUWA 4CCZA 3IRDA 3LSBA 1XRVA 4HP5A 3LXAA 3VXGA 5BXTA 3D6NA 4BEQA 4MWAA 4NI3A 4LC6A 3NWRA 1E1CB 2EQDA 1QNQA 5K2ZA 5DXXA 2CC0A 4HMNA 3H2EA 3TYAA 4Q8OA 4PYSA 2BVTA 1JYVA 4UNIA 4A05A 5H91A 1GVFA 2D73A 3BV7A 4BQ2A 5HATA 4B5VA 3W6LA 1FWEC 2R24A 2XIOA 1TR9A 2WK2A 4QE4A 1ME8A 1M7OA 4BA0A 5GQBA 2PODA 5CPLA 5AFDA 1VHNA 1O1ZA 3WBWA 4C6DA 3OBAA 1P0DA 3VTRA 1CXLA 4C6JA 4Z2JA 4EAYA 1ZGDA 3WK1A 2DZVA 3V16A 1TMQA 1O95A 1ONWA 1EJSC 4AU0A 1FTXA 2A1YA 3BK0A 4XAFA 3WO8A 3STGA 1Q6CA 4ZFMA 2CBUA 4Y9AA 3OVRA 3GU1A 3VOHA 1ZENA 5HMEA 3KS6A 1H7OA 1QPRA 2V5BA 5I79A 4L6DA 2FLIA 2J4GA 4ZTXA 1BYBA 1F74A 3CH9A 1M41A 2PDMA 1VBJA 1VKFA 1WDPA 3KDOA 1H62A 5LNSA 2PDWA 1U2YA 2O0TA 2W79A 3M0VA 5DCDA 3AIQA 3N9KA 3MSDA 4AYSA 5BZAA 1XG4A 2QAFA 4KCUA 1SSDA 4V1YA 4GYKA 1D8WA 4EANA 4WHBA 5LXEA 3UWQA 3WLOA 2DJLA 4AD1A 1XC4A 2QGHA 2X1IA 1SJCA 4DI8A 3CQ0A 1H2JA 4DX3A 4AD3A 4LTSA 1J18A 3W28A 1JXKA 4IXHA 3P3BA 2BXVA 1MQPA 2NV1A 3NZRA 3I4EA 2DVTA 2KX9A 3HG3A 2FH6A 4LOCA 4LEQA 2QXWA 3B03A 4AZCA 4WR3A 2J9YA 3QQ1A 1AW2A 4OV9A 1YTKA 4V15A 3O1NA 3KRZA 4GUGA 3WSUA 3EX4A 3ISIX 3SECA 2Z1BA 3LXBA 4O52A 3SSZA 3NL6A 5FJOA 3THCA 3WQ6A 3FA4A 1VCVA 4UFLA 4W5ZA 1PZ0A 4KEZA 2H8XA 1OCBA 3WLHA 2F38A 1E73M 3M0YA 3BZGA 3H23A 1IIGA 3QQ0A 1DJIA 8TIMA 3C2VA 3BG5A 2Z25A 4MSSA 4JTKA 3PBGA 4NJGA 4HCHA 3ARRA 2O4QA 3ARUA 3BXWA 2Q02A 3DHDA 3W2KA 4HZ7A 1R3YA 1G4TA 5I3DA 1J6PA 3UR8A 2NX1A 3A3HA 5G2IA 2FZMA 1JPMA 1IR1A 2WNNA 2CLFA 3V5CA 3UGVA 2PDCA 3FEQA 5DBUA 1IGWA 4PUKA 1SZEA 3ERPA 1TPVA 3M07A 2DUAA 3ITVA 3AXKA 4L7ZA 1IXPA 4MMWA 4KWWA 4M8UA 4O1BA 4L6OA 2GDUA 3A4JA 3D46A 3N6JA 5CPSA 3IIXA 5HJYA 3G22A 3FV9A 4ROPA 4AWEA 1MYRA 3BLIA 2P53A 3W74A 3RRXA 2HEJA 4NY2A 3WMLA 5MKGB 4EPEC 3SQLA 4DPQA 3WG6A 2E8ZA 4C90A 4U2YA 1OB0A 2NV9A 4GIAA 2ZZ1A 4I5XA 2CFFA 2YIHA 4S2CA 2OVLA 5BRQA 1XC6A 5DY3A 5BOOA 2H3BA 4YVVA 3AYTA 4JTTA 3TJ4A 2ZBTA 4LNYA 1GG0A 2EG6A 2YR1A 4H1ZA 1P0EA 4CKQA 1C3FA 2JKPA 1YDNA 4NZCA 1ONRA 2VX5A 3VABA 5FD0A 5DMNA 1U5JA 1U5VA 2VFIA 2DSWA 3BTNA 3DIPA 1QMLA 2A3AA 4UFIA 2R1KA 1NWSA 1IGSA 2FMOA 3OPSA 2V3GA 1VH7A 4RW5A 4HPHA 3P74A 3PZTA 4M1RA 2Y7DA 4RDZA 2GGHA 3U2OA 1E40A 5J5DA 3W1RA 3LHZA 3S2MA 1Q66A 1YHTA 4ZL1A 4DM1A 4FZIA 3VIKA 1QHPA 1G5AA 2R1PA 1N8FA 2POTA 4NZ5A 4ERAA 3S1VA 5CG7A 2DY3A 3V0SA 2WKGA 1XIFA 1K03A 1NDVA 4AF0B 5TNVA 4IIHA 1JULA 2IQDA 3QVQA 2VDIA 3AWNA 3EMQA 1V3IA 2NQLA 3BQ6A 3OIXA 3MP3A 1O7AA 3VC6A 3LK6A 1EA0A 3PC0A 3NO5A 4RNIA 5EU9A 1V7AA 1W91A 2WCAA 3BLDA 4OJYA 5I02A 2FQIA 4IGMA 4LU0A 2GUYA 2Y2WA 1K8YA 5C7HA 3HPXA 2RFGA 1TJ1A 2RKXA 3N18A 2ACUA 1JFXA 3EX2A 2CBVA 4H3DA 4TV6A 1GEQA 5M17A 2QPUA 3NPUA 4GA8A 2QJHA 1HNYA 2VX6A 2VZUA 3GY1A 4EPDC 2YKKA 1WO2A 3AMCA 3GR8A 1O5QA 1BEUA 1SM9A 3FA5A 3TAOA 2NQZA 4JDBA 4OFCA 3W81A 1YPIA 5A6BA 1LLOA 3W70A 5T91A 1VIWA 3PAOA 4PULA 1AVAA 4BWLA 1R2SA 3CHFA 4ROQA 1AH3A 1FHVA 4OUIA 1QDSA 3LPGA 1DJWA 3AALA 1BHGA 2BHUA 1E70M 3QC0A 2GYIA 3GTNA 4UQDA 4RDVA 3W3OA 2ABBA 3O8AA 3QGVA 5M5DA 2Q3OA 1ZSXA 3UETA 3TDFA 2GLKA 1V8EA 3POCA 3C4UA 3LDVA 4XQ6A 5A6KA 3NOYA 1EC9A 1WCGA 1EPXA 1LOSA 4YYCA 2OO0A 4R27A 3TROA 1O94A 3L23A 5BOEA 3VIHA 3LCHA 4GX8A 4GX9A 4UFMA 3OIHA 1AD4A 4X9YA 1UASA 3AXHA 2QHAA 1OC5A 2YCLB 3H8AA 3HGRA 4QEHA 1RA5A 4GABA 1UR3M 1ZJBA 3NURA 2VVNA 5T8GA 3NYZA 2QW5A 1X97A 1AQFA 3P61A 5FSEC 2HCVA 5DMYA 5IDZA 1I60A 2VGGA 3UPBA 3R8RA 3M41A 4PR4A 2ZUMA 1E6XM 3QN3A 1V03A 1WKEA 4MLJA 1XRSA 1AW1A 3HURA 2CHOA 4D72A 4UTFA 2FHBA 4IH3A 3M6YA 1DJQA 1BSIA 1XWYA 3WDHA 3T09A 1EOMA 3TZNA 5GNYA 3S5OA 1LYXA 1E9IA 3OVQA 1UH4A 1AFSA 3BANA 4N42A 1XLMA 4EF8A 2J47A 4TTGA 1FH8A 3W1PA 1K8ZA 2AL1A 2QJGA 4DWSA 1R38A 3OG2A 4HA4A 3EOOA 3HU7A 2ISWA 4S3KA 5JQ9A 1S3HA 2BG5A 4PUJA 3ARQA 3GXIA 3B8UA 4OOUA 3AJXA 4R7WA 1HVQA 4M1BA 1HXJA 3PN8A 3ANUA 2FHFA 1WDQA 3LBMA 1TYGA 1B90A 4DLFA 2PBOA 3L4WA 1IF2A 1I2PA 4GZEA 4G2DA 2GWGA 3LM7A 1H0IA 4J3VA 2QPSA 3W71A 3KTXA 1B3WA 3NZGA 1HKWA 1HX0A 3VNIA 4I7UA 3VGDA 4NQ1A 5CSUA 4LWWA 3MHGA 4HNCA 4PBGA 3EA3A 1U1HA 4HTYA 1NFPA 3LGEA 3FY1A 1UMLA 1TPH1 4XAYA 4NAFB 1TIMA 2CESA 1OIFA 1VP5A 2NUXA 1VFMA 3BLOA 2YCKX 3MUZ1 5KEZA 4GNVA 2GOKA 3LPPA 3HBLA 2HS6A 3W73A 1UG6A 2QDGA 3W75A 2Y8VA 3H22A 2WVVB 1FHUA 1PYMA 3THDA 2VI0A 2C8NA 4JIEA 4OKDA 3CEUA 2DUZA 4CN4A 1TWDA 2YDAA 2WWCA 1VHCA 5JBEA 2X7WA 2DIEA 1XLFA 4HU0A 4M6UA 5D4YA 2IPJA 3PTQA 3ZQ9A 2LLEA 3ARTA 4LBSA 2XVNA 3WQCA 4NZ3A 3AJ7A 1ZBVA 1LCOA 2YZRA 3VCNA 4IJRA 4LJ3A 3AU2A 3P5ZA 3MB9A 1WUFA 1YPFA 4LAZA 3ZR6A 3NEHA 1UUQA 3DUGA 4Q7NA 3CHVA 1AH0A 4HNVA 4G6CA 4NJIA 4ZQOA 3IJQA 4IFKA 3E74A 2JF6A 5TBOA 3FXGA 1I2QA 3MU7A 4DJFA 3UXKA 4E4FA 3CZLA 3MKKA 4AX6A 1KBIA 2IQTA 3UA3A 3VM7A 3HM7A 1Q45A 2R82A 3RDKA 3TWBA 3MSRA 4JTHA 2TPSA 3TONA 3HGJA 5J8LA 4L9ZA 5E93A 2NSOA 1OFDA 2UV8G 1UZ4A 4IOTA 4YTSA 2NLYA 3RRAA 1HQTA 3GZ3A 1EB3A 4EKJA 1F61A 5KSWA 3W82A 1YRRA 2GFTA 3E38A 4EX4A 2ZXAA 2DIKA 4ACZA 2CKRA 3DI0A 1UA3A 3UWEA 2ISVA 4B4HA 3I3BA 1FCQA 3GXMA 4BK9A 4Q8VA 1XIJA 2Q8ZA 1PWLA 3H7VA 2PCQA 4LAMA 5EA9A 4H2CA 4FX8A 3QZ6A 1N7KA 2PP0A 3AS3A 3LMZA 1U22A 1BRLA 3WJWA 4ZB2A 2PSNA 2FH8A 4JN7A 2YA2A 3L5LA 2C6QA 1NVMA 2ZYFA 4O11A 3N13A 1UP0A 4G7EB 4E5TA 5TD4A 2C19A 4FXFA 1Z89A 5DQPA 2E9MA 4QRNA 1OK6A 5H8PA 4DYEA 1S2WA 2PWVA 3PTKA 3B8SA 3PR2A 1WDWA 4ZSUA 1DXFA 4KRTA 1H1ZA 1UKSA 2CLIA 2IS7A 4E4PA 3Q94A 3P14A 2PURA 3AXMA 5LXXA 3M4HA 1MEWA 3SGUA 4FOJA 1XIMA 2VX7A 2OPJA 1DTNA 2OWWA 1B3OA 2J24A 2BX7A 4L5ZA 3VU2A 3H4WA 1LRTA 1T6MA 4AC1X 1JCNA 3IIZA 3N6HA 3VKDA 5A6LA 1GVRA 3GUGA 1W1A1 2GPTA 4QAWA 3W24A 3G24A 4ZXLA 1SW7A 1OINA 4EACA 4WUIA 4HN4A 4Y6GA 1GOQA 1YKWA 3GXNA 3EMCA 1W3TA 3G6LA 1W3JA 1VLIA 1PVNA 1YEYA 1YDVA 3K4AA 3UXIA 3EEGA 4MKVA 1Z3NA 3TIMA 1E15A 1KV5A 5I78A 2Y63A 3W00A 4C6EA 4H19A 1X98A 3LB0A 3ZXWA 5IHSA 1DIOA 3A12A 1U5HA 1O6IA 4UR7A 3VKAA 4JHMA 4HMCA 1TO3A 1P6CA 1FWCC 3PP7A 5FAGA 1F3XA 3O6YX 4KT2A 1FHLA 4XBJA 1S5TA 1UQZA 2A2IA 4MB4A 4MWAE 1OGSA 1Q6LA 3VDBA 3OO2A 1XYLA 2OB3A 1JF6A 2ZVRA 2PFHA 4X2RA 4XTDA 4DO7A 1I1WA 4GG9A 3B8WA 3SB0A 3PK7A 3DHUA 1CXHA 4QJ5B 1G0CA 2OEJA 4JY8A 2PDLA 4W84A 5A94A 1E51A 2C1GA 2QJNA 1V0LA 4LCSA 1ODZA 3V35A 2P10A 1IEIA 3IJ7A 2QMJA 3KZSA 2PA6A 3W7QA 2ZZ4A 3HG4A 3P60A 1JRBA 4K2SA 4R53A 3NQDA 5TF0A 4QEEA 1JGMA 4Y90A 2E68A 3PBUA 8CGTA 5I03A 3ABXA 1E1EA 1LWJA 2XVGA 3WFAA 2CZ5A 4AZ6A 3KOZA 3EWXA 3QM3A 1YTEA 1EGVA 3GG1A 2V9DA 1A50A 3PBYA 3QR1A 4M19A 5JIWA 1M53A 2ZXDA 4MIMA 2RJHA 4PODA 2OYLA 4FR1A 1OSEA 3STPA 4KCTA 2WPGA 4H9VA 4JIPA 1ZPTA 3DFOA 4IPPA 4UUIA 5AOUA 3OYZA 3POHA 3VIGA 4QQUA 3MZNA 3LERA 4NNCA 1R9XA 5I3IA 2G4FA 4AIUA 2X41A 1HGWA 6ENLA 2O9TA 3UWWA 3UYCA 3R94A 2C1HA 3EBVA 4FS9A 1EP2A 1PE1A 1K7EA 1EXPA 1QTWA 3GXFA 3QHNA 4MJ4A 3C61A 3CNYA 3CQKA 1FWAC 3GHSA 3MWCA 5I24A 3WLTA 4O1CA 1GZJA 3ZJ6A 3KE0A 3A4XA 1JAKA 1MFUA 4IWWA 3TSBA 1TTPA 3NQ6A 1RVKA 2YGYA 1MQQA 3H55A 4ICNA 1C90A 2ASHA 1YBQB 5CEWA 3SCUA 4NYYA 1UW9A 3U2EA 3WELA 5LNRA 4HT3A 4IIEA 3C6CA 1ESWA 3NM1A 2IW0A 3EMZA 3TSMA 2XFYA 1X6LA 2FTYA 1XRTA 3EA2A 1LDCA 2XIQA 5I3GA 4NNAA 4OGZA 3OLIA 3C2FA 3L4YA 4KF1A 3TUUA 2C0HA 1Z44A 1QW8A 3OVGA 4GWEA 3HA1A 3AIUA 3KP1A 7REQA 1PX4A 3AICA 3EYPA 1ICSA 3LM3A 2BVWA 1K70A 3DHFA 1FH9A 4Y8FA 2GGJA 5AHFA 3UWUA 3MHUA 4HHPA 1GTEA 1S5MA 1UPPA 1WAWA 2GQ8A 3PWIA 3W22A 1EJUC 2A7RA 2ZUNA 2GGEA 4REQB 3TCSA 1A0CA 1GKQA 2DJXA 5DF0A 3H4GA 4WZHA 3CT2A 1N55A 4JTFA 3K46A 1SMAA 2E9BA 4IL2A 3CV2A 1VBRA 4D6JA 3QQWA 4H9XA 1RP9A 2V68A 1R3TA 2FZBA 3RJYA 4IGNA 3QKEA 3KBVA 3TW9A 1A47A 1XSKA 4HU3A 4GNJA 3WD2A 1PHWA 3TTSA 5AB3A 4H8NA 2V8ZA 3EDEA 4I9MA 3IVUA 4B5TA 2EKGA 3BLKA 2XH2A 3VOIA 4DHGA 2XM1A 1K9DA 3RLUA 1EL3A 4E2OA 1O5RA 1ZS2A 5JH2A 3WQWA 4E8GA 3BWWA 1FWRA 3T8LA 2CPUA 4JFTA 3R0DA 1SSGA 1TPEA 2D2HA 5GVJA 2NXHA 4ZZ9A 1KC7A 4BQ3A 1OIMA 4AZ7A 2RDXA 2D23A 4M24A 4D6FA 4DB7A 1RQEA 4M0XA 2QJJA 3C0JA 3A64A 1XCXA 3VA8A 2ZXQA 3CTTA 1C8YA 5LIXX 1EEXA 1C92A 1E5JA 3U5UA 1RBOB 1Q65A 3MYOA 4Y96A 2DSVA 3QV8A 1AJZA 5C9ZA 1K8XA 3DFHA 4FX7A 1WXJA 3GC2A 2DORA 2O9RA 3D5HA 3SRHA 4O1AA 3L12A 4Q8TA 1RUSA 2XIMA 3WL1A 2X05A 2W4XA 1XUZA 2FPTA 4ZSTA 3L9CA 2W6RA 3ZR5A 2I9EA 3LCGA 2A3LA 1ZALA 5CSYA 3UXDA 4C1KA 5I00A 1IEWA 4HK5A 1X6UA 4RE0A 2WSPA 1DV7A 2D3LA 2Y61A 5C7VA 3RGTA 1GOKA 4P7NA 3GNXA 3PPGA 3QEZA 3OYXA 4ADSA 3T78A 3PULA 3N4FA 1A3HA 3E5PA 3PZGA 4K3ZA 2J7EA 5BRPA 1NELA 5A2CA 4F0RA 2XIJA 5C2GA 4EAMA 3AO0A 2OYKA 3BCDA 3ARSA 3MUCA 1CGYA 4E2DA 3VYLA 3IGHX 2VEMA 1W37A 1GJWA 5BXRA 5EMJA 1HO4A 1DJZA 4TQTA 1E5NA 2BASA 2OT0A 2Z7GA 5HXMA 3LI0A 2GUUA 2X8RA 2ZE0A 1DHPA 1MFVA 3IK4A 2D2GA 2DEPA 4B2DD 5D2TA 5ABTA 1RLDA 4GJ1A 1UWSA 2IKJA 2XDFA 2Z00A 3AZRA 3C2YA 2WJFA 5KZDA 4XBKA 3AS2A 3GFYA 4C5YA 1QOQA 1UQYA 2BVDA 1AA1B 2FB3A 4DJED 2V5LA 2EKCA 1R86A 1A5CA 4I9AA 4RNJA 4W8BA 3FLUA 4LC8A 3SY5A 4K8EA 1H09A 2OODA 1TWIA 3BAYA 1IIHA 4YTTA 4BS0A 2GJXA 2A3BA 1B3XA 1W17A 4PA8A 1M5WA 1H3GA 3GWQA 3VM5A 4K7YA 3B97A 5LIWX 3ZS4A 2BOFX 5KZMA 3TZFA 2WBKA 2XU2A 3UCDA 2C1IA 3FS2A 3U9IA 1S5WA 4O0ZA 4S23A 2FTPA 2D3NA 3QR0A 2P3ZA 5G4EA 4S3BA 1ZNNA 2B4GA 4X9SA 4UTWC 5AC4A 1AW5A 4H6QA 3VD4A 1LQ0A 1G69A 3M16A 3D3FA 6PTDA 4IMGA 2AGTA 1VQTA 5BU9A 1TTQA 3B0YA 1I2RA 3TYDA 1M01A 4I7VA 2VZSA 4WSKA 2VL4A 3AYSA 3TFCA 2GGGA 5M3WA 4FIRA 4DJFD 2FFIA 3NSNA 4G8TA 3SUSA 4QG8A 4GY1A 5DCEA 2INEA 3P80A 2CWNA 1ZJIA 2HJPA 4PSPA 1S2UA 7XIMA 3EXSA 3EWWA 1A5OC 3ZJKA 4BI7A 3B0VC 4RE2A 1R6WA 3GBEA 1XR2A 3EA1A 3BPWA 2PMQA 3F4NA 2PGEA 3S3GA 4CUCA 1UC5A 3VGFA 2B31A 2V3DA 3NZQA 1TX2A 1QNPA 2J8FA 4J3UA 1KRBC 3N2XA 1VEPA 4LYPA 3SEPA 4D1IA 3MPGA 4D6GA 4QISA 1BF2A 3KP0A 2QIWA 3E12A 4DIAA 5FSDC 3SCSA 3HZ3A 2FJUB 4KH2A 1KCZA 4HMEA 1R3WA 5CAKA 4Y9NA 4Z2LA 1EBHA 2D24A 1AD1A 3LI1A 1ITUA 4GC3A 1FCUA 4MJZA 1OBAA 3DX5A 1FFQA 2BB0A 5BW6A 4JD4A 1R9ZA 1H7NA 2A3EA 4PE8A 3O6AA 5LKYA 4RDYA 1TPB1 1ADSA 4TUFA 3MMUA 3OU8A 1XYFA 1CWYA 3L2LA 1TRDA 2RUSA 4I90A 3AROA 2HBXA 4LUYA 3ATYA 3GKAA 2V6AA 3CPGA 4MPQA 3WJXA 2VCCA 3TWAA 3DGRA 3GVRA 1PDYA 2XH7A 3FIGA 1ZL1A 5CSSA 3HF3A 1CZ1A 3DFTA 2YOCA 2ACRA 3NEVA 2V2CA 3APTA 2C15A 3TX9A 1TG7A 5C6MA 4JEQA 3U4FA 2PWGA 5IOBA 2YL5A 2G8ZA 1YE6A 4PB3A 1ITXA 1TB3A 3GVGA 4CNPA 1O4UA 2C71A 4KGJA 1E6RA 5FOOA 1VFOA 3FDGA 3WUBA 4HK6A 4D6IA 1OJXA 2ADAA 4OHQA 1MQRA 1P5BA 3Q65A 2FGZA 4AW7A 2PDJA 1ZHAA 2PS2A 5KINA 1QO5A 3NGFA 1EX5A 3UT0A 3N2TA 1MI3A 5GNZA 3T81A 1XPYA 1DTUA 3ITCA 1DQWA 2OOGA 2ZCGA 1VENA 3UR7A 2ONEA 4ZOAA 2ZX6A 4Z42C 2BY3A 1VR6A 3VO0A 3DC0A 4AWUA 2WMGA 4AD2A 4AY8A 1GHRA 5ECUA 4UTLA 9XIAA 3PSVA 3B8VA 2E7FA 2QUMA 5DLCA 5D2WA 2GQAA 3ABOA 1GOOA 4GQGA 3CGTA 3WENA 1XH0A 4NZJA 1XBVA 3EWZA 1Q7QA 3GAKA 1Y5WA 2O56A 1VD6A 1X8FA 4WJXA 4HD5A 3DU0A 3FKKA 4J2PA 4LX4A 2PRLA 1UUMA 2FVMA 3WJZA 3A22A 2UWFA 1BYCA 3AIRA 1SMDA 1RQBA 2QUVA 4OUEA 3CQJA 4WGHA 4O0QA 5CGMA 3EKZA 1JUKA 4YWIA 4GUIA 1JYWA 2P76A 5CJ5A 1NAL1 1GKPA 5DO8A 1P6WA 3QHMA 4FP1A 4LY4A 2E09A 5HBFA 1CCWB 1YX1A 2PF0A 4MAVA 2OLAA 1ZFJA 4M3PA 4JTSA 2PDPA 3BICA 4J3WA 4H9YA 1ZRQA 2X1SA 3NTYA 1EHAA 3F03K 4MY9A 5EFFA 4HVXA 3S5SA 1O60A 4ZA0A 4GQQA 1UR9A 4IFKB 3NZ1A 4NASA 4UR9A 2INZA 4CD5A 2HVOA 4JX5A 3NYDA 3UR5A 4QDPA 1HW6A 2F2HA 2O4MA 1KO0A 1LLZA 4Q4RA 4P8UA 2P8CA 2QCNA 5EBAA 3DN5A 1PDZA 4ZQRA 1XS2A 4JEJA 4JYFA 4W89A 2WQDA 3IJ9A 3O7UA 1GTHA 1OX4B 4L4PA 1E9ZB 3NG3A 1G4PA 1E72M 4F2TA 1W1IE 1JDDA 1P1XA 4HSNA 5DT7A 3SQSA 4AAJA 3IVTA 5CBIA 5AHMA 1PHQA 3UPWA 4U31A 1V3KA 3NR0A 1MUWA 3RNDA 1TV4A 1SFTA 2IQ0A 3AOFA 2QCMA 1NWTA 5DT5A 5AYBA 1EJVC 2G97A 2Z6JA 1UOZA 1IXQA 2X7VA 1Q2SA 2Q09A 1J01A 2DVUA 2HE5A 4ZBCA 2PTDA 2HZGA 4G9PA 4XZ9A 3N4AA 9CGTA 3LHWA 1MMFA 4A8IA 4F48A 3I4KA 1F7BA 1D7FA 4YWSA 4Q3MA 3G0UA 4XZIA 5A8QA 1E1CA 1P6BA 2PTYA 4Z08A 1NEYA 2EPKX 3T40A 3W7LA 4ICMA 4JQ1A 4CEUC 3MANA 4QSHA 4NYUA 5AHEA 1E0TA 1NF7A 3R25A 3UQNA 5TAOA 4AD0A 3GH4A 1K4GA 3DHPA 2NT1A 1DEDA 1Q2RA 4L1WA 3BLLA 1IEVA 3K30A 1IT0A 5LGZA 3CTLA 1CLVA 4FLQA 4UFKA 3WD1A 2A0NA 4MZ8A 1X96A 3W2NA 2FB2A 4LCQA 3U6WA 1VF8A 3K8KA 5F2MA 4DXVA 4MF4A 3COTA 3ZO9A 1P7TB 4X3ZA 2R8WA 5EGRA 2B7NA 4ORIA 4ZOCA 1H41A 3GXDA 2R1LA 4Z17A 3H26A 4C6PA 2D2OA 4GBDA 4RDWA 9RUBA 3TXZA 4B91A 3VNYA 1POJA 3G8RA 4NXKA 5EMYA 3B4YA 4O54A 3S9ZA 1YYAA 2OEKA 4DJDA 3W1NA 3STFA 1M3UA 3TMLA 3T7VA 3W53A 3B8DA 2P3EA 4MWAC 1H11A 5KITA 5EY5A 1AQMA 2OR2A 3IV3A 4GQ0A 3N29A 3WQGA 2G3IA 3PWGA 2E0PA 5I5RA 3RLHA 5FJTA 4FAMA 1KV8A 4HN8A 2PDGA 1XDMA 4ONVA 5A8PA 4AXKA 1HP5A 1KD0A 4KS0A 4DUWA 4DO5A 3A24A 1K3UA 2DSZA 4A22A 2IUZA 3ARWA 4LSBA 3L4VA 3N2MA 4KWVA 4U4MA 3KL5A 3B9NA 4AZ5A 3V36A 4CD4A 3TR2A 1RJRA 4UOQA 3C3NA 1OF6A 1WZMA 1TTIA 4GZ7A 4HYWA 5F2IA 4L4OA 5CLTA 2BSLA 2PWDA 1SZFA 4NU7A 1T96A 4EE9A 2EJAA 1RBLA 3A3WA 2Q71A 2TMDA 1XLIA 2J27A 3SN0A 3L4XA 3MVIA 4FK9A 1M9HA 4L64A 2I7GA 3GDBA 4WVXA 1OHLA 1R3SA 2AGKA 1TZ9A 1VFTA 1BTCA 3WQDA 3KOYA 4YPJA 1M03A 3SY8A 1Q85A 3CO8A 3EKGA 4BFAA 3T2PA 3IJ6A 3URBA 3SJ3A 3C2RA 2GDQA 1E4MM 1D9EA 3GD6A 4AVOA 4IFRA 4XBSA 5A6MA 1IWPA 1TTJA 1GOIA 1PXGA 3CHCA 3SBFA 1TQXA 4CVWA 3CUXA 2H6RA 1ZU8A 4ECLA 1AL8A 1EHNA 1W3NA 1XF0A 4H8VA 3QMRA 1PIFA 2ESCA 3LV5A 3N9SA 3G1DA 2YDQA 5MKGA 3D3AA 4FOUA 4MNJA 3AZTA 2ABAA 1JNEA 1QK0A 2C91A 3W7RA 4U5KA 3LYEA 1RZMA 4IIFA 1XP3A 3UWZA 4R5EA 1HT6A 1SQ7A 3NPVA 3BOXA 3T42A 5EB8A 3TEVA 4K68A 1OFOA 1XIHA 3ZVHA 3PSWA 4GVFA 2PDFA 3PBWA 2V82A 4FIQA 3F2DA 3RPTA 3KBNA 5K4ZA 3K4DA 4BF7A 3BO9A 3USBA 2WHKA 5FJUA 1J5TA 4Z1CA 4KERA 2XFWA 3ALGA 2VT0A 2O7SA 5HUOA 3SUWA 1GHSA 4Q6XA 1MW1A 4JFSA 3GVWA 5AHLA 1ZCCA 3AQUA 3RK8A 1CNVA 3RG6A 3SSJA 2FGLA 3TXVA 1OC7A 1W5NA 1US0A 3FAXA 3LBOA 3T2QA 3TYBA 3M5XA 1AZ2A 3NPWA 4FHAA 4UCGA 4F40A 2PZ0A 3SM0A 5HQEA 3C5QA 3M0LA 3CT7A 1EJXC 3GFXA 1UB3A 5CAHA 3M0IA 3FOKA 3DG3A 1Q6QA 3UW6A 3GDRA 4AF0A 7CGTA 7REQB 3EWBX 4B5SA 1BPLB 2I56A 2CERA 1CDGA 1J9YA 2YL6A 4C1LA 1QI2A 2H9AA 3M1ZA 5FL1A 3S9IA 4DN1A 4TX9A 4YIWA 2XIBA 4PBEA 4FI4A 3G6MA 4S3EA 3GW3A 4P5UA 2OKTA 4J9JA 1JVNA 2VDGA 5F1VA 4XUGA 3YPIA 2VOMA 2J7FA 4UOJA 3QYQA 1A3WA 1CBGA 4IG2B 4DYKA 3MUXA 4F8XA 2CLEA 4O12A 4DQWA 2YZ5A 4LAOA 4UBPC 3S83A 3LPOA 3MJYA 1QOPA 2P8BA 2VGFA 2J25A 3SGGA 1TWWA 2DZXA 5LZLA 1JD7A 2G3MA 2VFGA 5D05A 3T4WA 4MOZA 4PTNA 1HFBA 3GTHA 3HGOA 1EGZA 4W85A 4WKHA 3RX3A 5EFDA 2VEPA 3MQTA 2V67A 3LU2A 3VIMA 4GUJA 4ZO8A 1GPWA 2TAAA 4KMQA 1CI1A 3ES7A 4LYRA 4HIBA 1XW8A 1V7YA 4M81A 1WZKA 2ZRXA 2D2JA 1ZJAA 2YJQA 5A2AA 1JPDX 4O53A 4UCFA 1S2TA 4FOKA 5JXQA 3CWNA 4IJCA 2HROA 2ALRA 1J0ZA 4IIGA 1J5SA 1SJDA 1VPXA 3V4BA 3CZKA 2IPGA 4O16A 3VI2A 4QP0A 3SZ8A 4RR4A 2ZA3A 2ZA2A 4IF2A 1XIBA 3MCOA 2YCLA 1VYSX 4B16A 1BG9A 3PB2A 3LPFA 3GVVA 1JDEA 4Q6JA 4RZBA 3K8LA 4X63A 3VKCA 1A53A 1W5MA 1YXYA 1W3KA 4AMCA 2D0FA 1DXEA 3R0UA 2JGQA 4GACA 1JZ2A 3VK5A 1OFPA 2BV9A 3G8EA 3UNDA 3UA4A 1D2KA 1UWQA 3GAYA 2I57A 5LNVA 3BH4A 1EO5A 2A21A 3GX9A 1NY1A 2ZTKA 4Q4QA 5ENLA 1WNOA 3L5MA 4ZMGA 3PZNA 2YCEA 3N11A 3QTGA 5CLWA 3AS0A 5E0KA 3B9EA 3MUAA 2VQTA 4W4QA 5IDIA 1W2PA 1EO7A 4E3TA 5D04C 4AEFA 2Y6ZA 4PMQA 1XV8A 4GXPA 4NNBA 3TMQA 3M64A 1LWIA 4DYJA 3QPEA 2J6XA 3PPFA 4QLKA 5FEXA 5HMDA 4HU4A 1W3HA 5JBFA 3PPCA 1PCKA 4AWSA 1RY0A 3KBJA 3U2ZA 1Q6FA 3TN4A 4HPXA 1THFD 2B81A 1C29A 2FDMA 3SRKA 4Z1YA 4HJWA 3PZQA 3UCQA 1JFHA 2O7QA 2ZZ5A 2PP1A 4B92A 1XI3A 2A3HA 3E02A 3L5AA 2ZZ3A 4MADA 5AY7A 3LXCA 1U1JA 3O9NA 2W27A 2VD9A 3BURA 1E56A 2BODX 2HS8A 1TPDA 1SPQA 4S3FA 1FWBC 2ZZ6A 4D2JA 3T0AA 2VC6A 3WNNA 5SWUA 2G41A 1UWAA 3URNA 3ZJ8A 4NAFA 4GFIA 1UOKA 4LB4A 3NO3A 3U7VA 5I23A 2TODA 4IT1A 4MB1A 1GGOA 1JZ6A 4CCCA 1B0IA 2GVGA 4AWTA 3GG8A 2GJXB 3H2FA 2WVVA 5LNUA 4CN6A 3OGVA 1TJ2A 3F5KA 1JRCA 3WQPA 4DO6A 3PZOA 3CV6A 4JNMA 2ICSA 3VE9A 2QCGA 5CC3A 4MYAA 2ZWYA 4DWSC 1EBGA 3RHGA 5HWJA 4IX2A 5HNUA 4KEVA 4CVUA 1NDZA 1O12A 1Y7VA 3AC0A 2ZRZA 2VGBA 1F6YA 2CBIA 5D2YA 1E3ZA 4I6KA 3QGAC 2QKFA 5U4NA 4PB5A 1TUFA 4PUWA 2D0HA 3QXBA 4IZGA 3W1TA 4C1NB 2W9MA 4I9TA 3S42A 2D22A 2ZRWA 4RUBA 1E9YB 2FZ8A 2NQ9A 5K4XA 1C7SA 1Q6EA 1FWNA 4O57A 1PAMA 1WKDA 1QWKA 1K9TA 3NO1A 3OQ8A 4HMDA 4IHCA 1FUYA 1LG1A 2X40A 3SCQA 2A7NA 3LTYA 1EP1A 3S6OA 1GONA 3W7NA 4A35A 1TR1A 1T40A 3G1YA 2Y4SA 2YXOA 5C8BB 3CIXA 2NWRA 3SCOA 3WK2A 4C6BA 3H53A 1FA2A 3O07A 1R8LA 1QPKA 3BOLA 3BJSA 1G94A 2DZPA 5EBUA 4IMAA 3SUTA 4JTJA 1XHGA 3S2CA 1OYBA 3GZAA 4QE1A 1EOKA 3D47A 3OG3A 2INFA 4O4WA 4H7ZA 2PRMA 1NARA 3VPLA 3M0KA 5A6SA 4ZENA 4UR8A 2VNCA 1T5AA 3OLEA 2UBPC 2GK1B 4GYPC 4ZQNA 4DAIA 1J6OA 4N02A 1V3JA 1I75A 4HZ6A 6ALDA 3CJPA 4MAZA 3ITTA 4R9OA 3AMDA 2BTMA 2ZUWA 1XGZA 1KCXA 3II1A 3A9BA 4FF5A 1QAPA 1W31A 1WE5A 4JN6A 4GHRA 2PLKA 1OY0A 4ES4A 1C91A 4CQ8A 3VKKA 4E8CA 1DPMA 3HPFA 1MZRA 3BAXA 5DFAA 3LHVA 1FRBA 1WYIA 2X0YA 2OU4A 4LS1A 4G56A 3U4AA 3BJFA 1EKOA 5EMLA 3SR7A 2DW6A 3GW0A 3BMXA 4JQ2A 2XIIA 4XD6A 3THUA 2XJ7A 4WOZA 3JRKA 1RK5A 2GGIA 1A5NC 5CZ0A 2PDXA 6TIMA 2Y24A 5T9CE 3RCMA 1HKVA 5FJRA 3APYA 3DBNA 1E0VA 3FGCB 4G7EA 2Y7FA 2E28A 3ITYA 1YTDA 2PLMA 4MLRA 1GJUA 3TAKA 3KBMA 3A21A 1E71M 3P7YA 1ZUAX 2OX1A 4UMBA 1Q6OA 1YNPA 2ACSA 8RUCA 4TX8A 1GW9A 2BWGA 4C60A 4AHQA 4PUUA 4E38A 1MXDA 1WB0A 4WKAA 2NUWA 3DOPA 1VBUA 4UTHA 1TMLA 4R33A 1GVQA 3ZT7A 3QLLA 4LUSA 4UB9A 5DN1A 4GGBA 3KVJA 4LW7A 2FPVA 4PMVA 1OWQA 1VEMA 1DJNA 3CMFA 3USZA 2OSWA 4B15A 5E9AA 5C2XA 3UG3A 1TVLA 4WSJA 1XKJA 2OXNA 1WP6A 2Y5EA 1R9YA 3BLFA 4DJDD 4JKMA 4L4LA 3LG3A 4JX6A 2IXUA 3U48A 4CCDA 5F2GA 1EQCA 4PEKA 4DZ5A 1CLKA 4ACYA 4N9EA 3DYMA 3QGKC 3VMOA 1CGVA 2PLJA 3LTSA 4JIIX 4PMZA 4IXXA 4KWSA 1UWTA 4WY0B 3VC5A 2YB1A 1D8CA 2VVSA 3MBDA 1HTIA 1KBBA 2OFJA 4WQ6A 4YHGA 4HHLA 3P8JA 1AH4A 4GO8A 4M56A 1H63A 1TX0A 3Q67A 4DELA 3PFMA 1FWHC 3RMJA 2GSJA 2PTWA 3R13A 3MC5A 1ZY9A 3GIQA 3I7SA 3QY6A 1CB7B 1MUCA 2HK0A 2WQPA 1AQ0A 1A5KC 1B54A 5LIUX 1BXCA 3G3DA 5EL1A 1XIDA 3CQIA 1UWRA 4R85A 3MUY1 1Y8BA 4AX7A 2PU1A 2E1WA 2J62A 3T8QA 1CIUA 2CNCA 4BF5A 3IIPA 4C6CA 1UPMB 1KGUA 5M1TA 7TIMA 3QPYA 3QF0A 4AZHA 1RLCL 1X7IA 3SDOA 4D6EA 2VZTA 4ENLA 1J8VA 2WOQA 3GS6A 2P0OA 4FF7A 3QZEA 3HQPA 3WK0A 3A13A 4JTRA 1OFQA 1E1FA 3GU9A 3W86A 1WKFA 3UD6A 3IGXA 1NDWA 1OCJA 4HYRA 5A3HA 3PPHA 1EGMA 4OE7A 1PUDA 3ITGA 4JOMA 3T05A 4K8HA 1XD1A 2NZLA 2Z2BA 4L4MA 4LAUA 4QGCA 3V75A 2FGBA 4J4KA 4XWUA 1AMKA 3MO4A 2Q8LA 1LM1A 3C52A 1G7UA 3TN3A 3LHYA 4QM1A 3ARPA 1Z48A 1Q6GA 2EJ1A 3N73A 5EYWA 5ABGA 4G1NA 4I3GA 3RUBL 3XINA 1K7FA 5D38A 2WZHA 3AHTA 3PZVA 7ENLA 2VUYA 1TV5A 3PBVA 1R47A 2ACQA 4PFMA 2G4JA 2CLHA 3HQ1A 4RNFA 4H00A 4MM1A 1UYQA 3KWSA 2PU0A 3S46A 2YFOA 4JNYA 2QLYA 1FXQA 5A6AA 1GNXA 4WDWA 1C8QA 3ORWA 5GJNA 2I5QA 3E2VA 5HANA 3F5LA 4NX5A 4YXGA 4WCJA 1KCLA 2BFGA 1FWWA 4WD0A 3FA3A 3N34A 1HJXA 2ZKMX 4MDPA 1U30A 5FACA 1NDYA 3SFKA 3ITXA 3VNKA 3O0FA 1V5XA 3GU2A 1F6KA 5IBXC 3AHVA 4PUEA 1J12A 1PIIA 1YBQA 3LMYA 4QIUA 1XCFA 5C54A 2P88A 3TW7A 5FF4A 4GE8A 4DBSA 4ML4A 4UTTA 1LTDA 3OW1A 4WSHA 1PZ2A 1DWFM 1ZBKA 4EOUA 5A8GA 1H0GA 4GIRA 4P61A 1VJIA 2I5IA 4RW3A 2VMFA 3O15A 3W6MA 4PCFA 3R89A 1QOXA 5AC7A 2PLCA 3M7WA 1AZ1A 3N2OA 1FWJC 2OQLA 3CAVA 1RJQA 1X39A 1R87A 1RD5A 1MNSA 2QCDB 2VEGA 4A3RA 4N2YA 4V2XA 1B57A 2P5NA 1W1PA 1OX6A 1RH9A 3PZUA 1OG6A 1QBAA 4W7VA 3E2SA 3E6EA 1KBKA 1VFHA 3HN3A 2CYGA 1TPC1 3NQ7A 1UBSA 3SO7A 3OLDA 3CQHA 3MP4A 2EPNA 3WJSA 2Z28A 4REQA 2RGMA 2WMJA 5C9RA 5H1WA 3R7MA 4D6DA 5JUVA 3MA8A 1CGWA 3UFYA 1MEHA 3TYUA 4HYVA 4W8LA 3R8HA 4UMAA 4XKMA 4RZ5A 2XG9A 4F3HA 4LS0A 1GK8A 3IGUA 2QF7A 1I4NA 1XYMA 3SCRA 3S2NA 4Q8NA 1JCLA 2JFEX 3IAPA 3PAJA 5FF3A 2V69A 3S1UA 3NOEA 3TH6A 2PTXA 3EDFA 4JDYA 3V0UA 5ABFB 1CXIA 1FOBA 3PUGA 1TVPA 2X0SA 1SJAA 4F9DA 1HJVA 1JZ3A 3INPA 3ITLA 4JL2A 1C93A 1VRDA 1HGYA 2WZEA 3B06A 3TNOA 1HKIA 1L0PA 5C71A 4MZYA 4DNMA 1F4AA 2ON3A 2DSKA 1SFLA 3KVKA 1GOXA 1FCVA 3NSMA 3TFXA 3ARXA 4NIRA 3FNDA 3AXIA 2WVTA 2P50A 4PCSA 2VGIA 4JY9A 3CUHA 3S4TA 3UJSA 1UD8A 2GSEA 1KQZA 1QW9A 3AHYA 3WLSA 3DESA 2C7FA 4TTUA 3VGGA 1VPYA 1GQKA 2Z1VA 4NG3A 1VJZA 1IZJA 4LAKA 3WBEA 2CLPA 2O92A 2A3CA 3OZYA 1XJBA 2GVJA 4FLRA 1QO2A 1LT7A 3HG5A 5DXYA 4W8AA 3HPAA 4X0VA 1V77A 5FJPA 2ZRYA 1HP4A 4JFWA 5JBDA 2DT2A 4OU1A 2DQWA 2WBGA 3CL8A 4RE4A 3DG6A 4C91A 4JR5A 3S6DA 2X1RA 3W02A 1KGXA 2HXUA 3ZVHB 5HQMA 2WZIA 5LA1A 3QMTA 3WH8A 4LANA 1J4EA 3CH0A 4PTMA 3IGSA 5KZEA 1Q5MA 4HNOA 1OQFA 3VDGA 5HQLA 4TVUA 3DH7A 3UF9A 4PCPA 5HDRA 3AUOA 4MJ2A 4B9ZA 1AG1O 2OGYA 3ZYZA 1NP0A 3LRLA 2E6FA 2WMHA 3M6DA 5CG0A 1XPGA 4IX0A 1XICA 3CL7A 3VX0A 5C55A 1W32A 4GLEA 2VOTA 1VPQA 3W6YA 4XTIA 5CPNA 1QRQA 4D8ZA 1K9EA 4NHVA 3VFLA 3F4CA 3VOFA 1GYNA 3DYPA 1K9FA 4RX0A 4PH6A 4F2UA 3A5VA 4M51A 2NUYA 4I8YA 3TV8A 1OFRA 3CUJA 1LBLA 2H9AB 4A2SA 5C9UA 1SO3A 3CZ8A 3CPUA 1BXBA 2FZNA 3VZZA 4G7FA 1Y65A 2AL2A 4ZGYA 3Q58A 5CQ1A 3HQOA 1SW3A 5T9BG 4S3JA 2EPMX 5C70A 3VOGA 3CV1A 4JHZA 5CZJA 4YS1A 1VJSA 1VFUA 2Y88A 1FXPA 3CV7A 3T2OA 4K7VA 4AZCB 2NQHA 1H1YA 4KETA 2ZC1A 3UZWA 2QMKA 1XLGA 2YBVA 2WC4A 4ZB0A 2VYOA 1X1NA 3GC4A 3QOMA 1Q8AA 4OIFA 5IFTA 2V5JA 1KFKA 1OX5A 4N9BA 3CK5A 3L0GA 4UQEA 5AYYA 5EMUA 4GISA 1A5BA 2OCZA 1E0UA 3C0QA 1RJPA 2QULA 2QVHA 2DW7A 4WDXA 3TLQA 2E3ZA 1ZP3A 2ZOXA 3C2EA 4RXFA 2W63A 2VO5A 3GDKA 2MUCA 4LCRA 3CUZA 4KCVA 3V18A 5IXEA 1F2JA 1RVGA 3G0SA 1W9VA 2E5DA 2RDTA 4QLLA 1TJPA 1L2UA 1BQCA 4UNLA 3LGDA 1P48A 3F7JA 4PMDA 4GO9A 1FBAA 1UKTA 1XH2A 1UWIA 2DFAA 3KLLA 1EUNA 4X0NA 1JF5A 1UH2A 1UIPA 3F1QA 3DKLA 5D03A 3KHJA 4MHBA 4IM4A 3GG0A 3I10A 1UD6A 3S1WA 3N4EA 4GVIA 3E9AA 3O3RA 3NA8A 2XWEA 3C0LA 3BV4A 3WNMA 2Y7EA 2BBFA 3VE7A 2D0GA 2EG8A 3FN9A 1H4PA 1SO5A 3I7QA 4IMDA 2XYLA 1WDRA 2ZX7A 4JL1A 1VAHA 3ARVA 3MHFA 1UR8A 5BOFA 1NM9A 2HV5A 4QLJA 2WMIB 4JFUA 4IP5A 3V5FA 4KWUA 4JTIA 2Q6ZA 2ZVIA 1BXNA 1EZWA 5CZSA 2HDJA 3C2OA 3VD5A 4PMNA 1OT2A 2H8ZA 4RL3A 5D02A 3MI6A 4LALA 1PZ3A 1JYNA 2G95A 4P7OA 2I1OA 1XBZA 4QQ3A 1R3RA 1DWJM 4UQ9A 1W5OA 3PJTA 1S5VA 1IHIA 2VZOA 1VBGA 3R5EA 3MV11 3IK2A 1JUEA 1ISXA 4CQ9A 1GYMA 3G1VA 3IIVA 3WDQA 3NQCA 4S2BA 1E4IA 3GH5A 1EXBA 3QJAA 3PBMA 1NU5A 4CLMA 3XIMA 2EGZA 4JPGA 1OZMA 3P93A 2XN2A 5HMSA 1XLAA 3PFRA 3GSMA 1SYTA 1MDLA 4GH3A 3UJRA 1JYXA 3T0CA 3IUIA 2AKZA 2TRSA 4JKLA 4I8DA 3BLEA 1SR9A 1I6NA 3HB9A 4N9DA 1K8CA 3VDHA 4FXJA 2V63A 2B7PA 3LA4A 5IRPA 4NJJA 2DZUA 2CU0A 2NQ5A 3PANA 2C14A 1FWSA 1KW1A 1QWGA 2OG9A 3H6OA 3ENLA 5LGXA 3P62A 2VTFA 1LJYA 2CHRA 2PC8A 1FCBA 3WNPA 3DC8A 5G2WA 3UZ5A 3VD9A 1UH3A 1KGWA 4B2DA 1X1ZA 1PIGA 4CGTA 2DDXA 4F0KA 3MMDA 1OABA 3P2VA 4EK7A 2HE8A 3PUDA 4LVDA 4MNMA 3RR4A 4J27A 1NOFA 4LB3A 3ZZ1A 1D7KA 3HMCA 4DJEA 2YLLA 4XSMA 4Z1AA 4ALDA 3ALFA 2NX3A 1P0BA 3WQOA 3FW6A 5DBTA 3NQ8A 2FKPA 3E96A 1OC6A 4WRHA 1KLYA 4AEEA 2BMBA 3RX2A 3P0XA 4DNHA 2NXGA 4NXSA 1XYCA 4HK7A 3TYEA 2VRQA 3VVGA 1UKQA 2Y70A 5AYXA 2Z24A 1TJ0A 4M29A 3V1PA 4B5NA 1NQKA 3WX7A 3WEZA 3NQGA 4TVDA 4YN5A 4A29A 3NL5A 2WPBA 2ZX5A 3KBWA 1VC4A 4MNLA 4LFYA 3GXPA 2P0IA 5DMLA 5BYWA 4A21A 4HNLA 1FFRA 1H1NA 2XSAA 4ZOEA 3MSGA 5TQLA 3UG4A 1XQKA 2G5WA 2J7GA 4PFHA 2IXVA 4AYGA 4BQ4A 4W87A 3W26A 3THQA 3KDNA 3HFYA 3BSGA 4DY1A 5F7UA 4N6EA 2JK2A 3RO8A 2OGJA 2DH2A 2DZAA 3GTFA 2PDBA 3I6RA 4QNWA 1HJQA 3CAKA 3L4ZA 1LL7A 3ANYA 3MTWA 3DFNA 3N1AA 5FCZA 2R1MA 2A7PA 3S5YA 1QNVA 4QHRA 4O8RA 4XZBA 2PE4A 3IS4A 2WWDA 2GL5A 1OX4A 2NQJA 3W2UA 4RZ4A 2KZHA 2WANA 3UJFA 1A5MC 5BCAA 1MSSA 1JPHA 5CPQA 2E5BA 5A1AA 4N4QA 4RZ6A 2CLOA 3VD7A 2BOEX 2QNEA 2ZDRA 3KW3A 4NZ1A 2DZWA 4JXCA 3T6CA 4FB7A 3C56A 3DGBA 2PUZA 2NXIA 2XH4A 3NQEA 1Y0EA 1MW2A 3PZ9A 1FH7A 1R7AA 1DYSA 4QG9A 1CW2A 1A3XA 4XAZA 2YA0A 1M7PA 1QPNA 3BG9A 3OODA 4PBFA 3PWAA 5B7ZA 1Y5XA 1MWOA 4Q4MA 1B4EA 3DYOA 3FK4A 2VD8A 3PHAA 5C5YA 1DWAM 3P8IA 4XVDA 5BMWA 4BI5A 1H7XA 4L80A 3WDRA 1XDLA 2VWSA 1IYXA 1KBJA 3LUTA 4KIRA 4YCOA 5T26A 5CJNA 3S8HA 3VDAA 1QPQA 3GH7A 4US5D 1YDYA 3S0CA 4EXQA 3KRUA 4K8GA 2XINA 1Y5VA 1OD0A 3GDLA 1U83A 1XFBA 3N3TA 4LUSB 2Z1SA 3TOPA 3PTDA 1P7TA 3DFYA 4CEXC 1ICQA 2IMRA 2ZZ2A 1CXFA 3TK7A 2CLLA 1BWVA 4Q8QA 2Z26A 5CC5A 4D71A 1ISZA 1AK5A 1PL9A 3W38A 1GOMA 1CEOA 2E5CA 3W7EA 5A69A 1F4HA 3ZSTA 4TOQA 7TAAA 3R6IA 4RLIA 3SUUA 1BG4A 3QLDA 3GO2A 1E9LA 3OVPA 5FF2A 1RA0A 4UQAA 2WCSA 2F84A 3MDWA 4B5WA 3H70A 2BDQA 2X09A 1F3WA 4N7QA 1P0KA 1RR2A 3N2CA 1Z41A 3ECQA 1I9CB 1RV8A 3UZZA 3KVLA 3G3MA 3VMNA 3I3DA 3N04A 1QBBA 3B9DA 3TQKA 3QMSA 4DLMA 3F5JA 1R5YA 2FJKA 4I7WA 3EPNA 2QT3A 2FZ9A 3OHIA 1MEIA 1OZQA 3I6TA 1W9BM 2VEIA 5HWNA 4MJMA 1P43A 1QUMA 3B40A 3IAQA 4C6FA 3UPMA 2OSXA 4IGHA 3VCRA 2RAGA 1MRQA 1ZJHA 1A0DA 4ZO7A 3I65A 3MMWA 3W29A 2BGNE 2F6XA 3LHUA 1JUBA 3A47A 3EX1A 4J3ZA 3ZLFA 2L5HA 2VZVA 4FLOA 3ATZA 3E0FA 3UWYA 2Q3RA 1UD2A 4IPLA 3TC3A 3FKRA 3H54A 1H7RA 3XISA 3VGHA 4HNNA 3WK3A 1Q63A 2JIWA 3W1UA 4RKAA 3WYZA 2XN1A 3FVDA 1PSCA 3HQNA 4DAFA 4NSBA 2YX0A 5K9CA 2MANA 4RV3A 1VBHA 1NH6A 3VUPA 3W7CA 4DO4A 1ZAIA 3QTPA 3GE7A 4KEUA 5CH9A 2VRJA 5LSMA 1F5ZA 2F8QA 3VCCA 3VNDA 2AMGA 1Q13A 3RIKA 3WCZA 1T8QA 4LUJA 3DERA 4WDTA 5BWFA 2QR6A 5HJXA 4FNQA 1PBGA 2VWTA 5CZTA 3DENA 3KVMA 3P81A 5A8MA 1E3XA 2GJPA 3NIYA 3OB8A 2QGYA 4F2BA 4KEMA 2PDIA 3C0SA 2DIJA 3RM4A 2HWGA 3N17A 1SJBA 3MJMA 1XXXA 3W0KA 1UUOA 3AWOA 4LXFA 4XD3A 4FMVA 2CHNA 1VEOA 3WD4A 1JIBA 3FDKA 1WOBA 4NVTA 1W1ZA 1YW1A 3SRFA 1VYRA 4CNUA 1SR0A 1UR1A 3SCTA 3LV6A 1PCWA 1Z32X 4D9PA 4YYFA 3PNUA 4MDOA 4LNCA 3M5VA 2BOGX 2WNZA 3BAIA 4XD4A 4HZMA 1QATA 3M0HA 5ABEA 4GJJA 2ZUTA 4HOXA 4Q33A 1IEXA 4B3ZA 1XIGA 3LLDA 4XX6A 4Z2KA 4QCFA 5I3JA 3N6QA 3DG7A 3UNTA 3CS2A 1ZBWA 1GVSA 4GCXA 2UY4A 1SGJA 3CUIA 1KB3A 1Q3NA 3QY8A 3W7OA 4MPKA 2KAUC 2PDNA 1Q6DA 1ADOA 3ABQA 5G4WA 1ZAJA 3WH9A 1EDQA 1D3CA 3OBKA 1JAEA 4QBXA 3L7RA 4LV4A 4PRTA 1WA3A 1LBFA 3LCXA 4XKYB 2Z1KA 1DHKA 3W87A 5KTLA 3ABSA 4C6KA 4TR9A 5JIPA 3DECA 2WNQA 2BGQA 1FY6A 4ATDA 3UVAA 4W93A 5J5RA 4I9JA 4ERGA 1J79A 5E5CA 1W56A 4GZJA 3VDCA 4H4IA 3FEMA 3VIFA 3KM8A 5FL0A 2BY0A 1FP8A 1XUUA 4Q22A 2QAPA 3ABZA 5I06A 3IJLA 3RJXA 4QJ1A 2W67A 3P84A 3STEA 3TSDA 5EMMA 4IG2A 1DXIA 1Q6RA 2RHGA 5D8ZA 4IGSA 1LROA 5HUPA 2YBUA 3W7MA 1XQLA 3CHDA 3WDJA 4K1WA 3MS8A 4GKTA 4Z2HA 1CPUA 2C79A 2W61A 3LCLA 3H2MA 4PMUA 5CKSA 1BKHA 2XVKA 3JVAA 1PX3A 1S2CA 1EFZA 1WOAA 1HZYA 1KBLA 4J2MA 4ZFCA 3WLNA 1LP6A 2HRWA 3TCEA 3W1XA 3EDJA 3KXQA 3TLLA 3CBWA 1CGTA 2ALDA 2G0WA 4DUXA 4GRSA 2ZXBA 1SZRA 4FNPA 2CBJA 3EX3A 3CIWA 1R2TA 3M0MA 4GPNA 4L1XA 3T0TA 3KWXA 2J9ZA 4H6KA 3VOCA 2BGSA 4Z2GA 4IQJA 5EPDA 1G67A 3A4AA 1J11A 1QJWA 2PRHA 4QS6A 2XPKA 3PJWA 3LN3A 2NT0A 3G1HA 3O6DA 5FKYA 3UJ2A 4J3SA 2G50A 3AMKA 2OO6A 4I6VA 2NX9A 1FWDC 1V79A 3LOTA 2Y8UA 2F61A 4CCEA 1M1BA 3P82A 3FSTA 2PDYA 3IRSA 1TJRA 1J2BA 4ZQPA 4E0CA 3L67A 1O5XA 2NVCA 3FX4A 3AHXA 1UD3A 3A4WA 4X2PA 1KTNA 7PTDA 1R0MA 2F6KA 1XGEA 2BY1A 4URIA 3MSYA 2ZDSA 2ZX9A 3WUEA 3N14A 1TZ7A 2J79A 3G1FA 2PF8A 3W1LA 1F9CA 4FNSA 5LHEA 1RP8A 1NF0A 3BZJA 2G3JA 2WB5A 1EC8A 1RPKA 1YIXA 3NDYA 3P0WA 3RM9A 3RYSA 1V6YA 2J8GA 3F4WA 4HSOA 4E3VA 3GHUA 2E9LA 4A6GA 2OOFA 2XGZA 1XRFA 5D32A 1SUXA 4PMRA 3TVAA 3TP4A 3PNZA 1UKPA 2WM0A 2ZADA 2J9XA 3BLPX 4NT0A 9XIMA 4AISA 3SCNA 1XLEA 1I0DA 3GYCA 2W62A 3RCYA 3KAOA 3WDPP 3WMBA 2E8YA 1LORA 3ARZA 3S1XA 3WQ8A 3PZIA 3GB6A 3W7JA 1B30A 1GCYA 4JCMA 4AC7C 2VCBA 3SUVA 1PB0A 4PTXA 1V3LA 4WJEA 3W88A 4AZIA 3KTSA 5HJLA 3W4RA 2QJMA 5K3VA 1ZZMA 1OFBA 2I5GA 4W7WA 2A79A 2VXNA 4LVBA 2AL2B 4V33A 3PG8A 4PCNA 1BFNA 2PD5A 4IMCA 5EMKA 3QFEA 1TQJA 4J7RA 3WUFA 2YSWA 2YYTA 3M47A 1ISWA 4C65A 4MUPA 1LUCA 1XSIA 2CZDA 4QFUA 4Q8UA 3LQLA 3RMEA 4CNNA 1E6SM 1PWMA 4AY1A 4RV8A 3WJYA 1WBHA 3B0UX 2DPEA 1EJ7L 2FHCA 1Z9AA 2VELA 1J0JA 2OT1A 1PEZA 1MZHA 2V3FA 2GSHA 1MXSA 3B3DA 3KL3A 4O14A 1E0WA 5AC8A 1GUVA 3QOKA 2QUUA 1TSIA 3CZEA 1AUSL 3HJZA 1OADA 1C8XA 3KCLA 1XSJA 1EEPA 1M7JA 3W1MA 4O19A 4UIOA 2IPWA 2PI6A 4A8RA 2AQVA 3WH7A 3MWAA 1NWUA 2UY5A 4WF7A 3TTEA 2ODOA 4D8AA 4NRSA 3RPMA 3K1DA 3BGAA 4NZFA 1XH1A 4Z0JA 4Y9MA 4HZ8A 1ZQ5A 3TC7A 2QCEA 4C1NA 3VGBA 1Q7ZA 2QZRA 1I0BA 3R0KA 1IXOA 2VUNA 1P0NA 2D1ZA 1T8XA 1S46A 3GKFA 1YQ2A 3AAMA 3C86A 4M7SA 4J3TA 5E6YA 1UWUA 3MUIA 3BC9A 4QITA 3QW4B 3WLQA 2WHJA 1DIDA 2ZRVA 3LLFA 4QROA 3BW2A 1QI0A 1H51A 1OK4A 1ECQA 4DXXA 2GVEA 4AH7A 2OEMA 1KFBA 1RQHA 2JBMA 4U3AA 5AYZA 1OFEA 1EC7A 1LT8A 1TA3B 4QG6A 3KEHA 1MUMA 5BMXA 3KBSA 2F7FA 4HA1A 4Z0SA 5HOSA 2GK1A 2Z6IA 3ZR4A 4PEEA 3UGRA 3AYRA 5IFPA 3U0HA 4WOQA 5D2XA 3VOJA 2XUCA 4O13A 4KRZA 2YYUA 3UP8A 4O1EA 1A5LC 1YLVA 4NP7A 4LS2A 1QHZA 3AUJA 3HJEA 1XKYA 1W1YA 5JMUA 3SY1A 3PJXA 4CQCA 2PCEA 1F8IA 3E3HA 4GY0A 3UJEA 4PUMA 3H7UA 3LD5A 3LSCA 3TJLA 5HNRA 1IT8A 2Z7KA 3FHAA 4ORMA 3SIZA 4M6PA 5D9NA 3F4VA 5BXPA 3JR2A 2BVYA 4HNTA 4JYDA 4BZYA 5ECVA 3LHTA 1ALDA 1QNSA 1W8GA 4KBXA 1TMHA 4GYFA 1K6WA 3VZXA 2DUXA 2CKSA 4OQVA 2E40A 2D20A 2OMAA 3FGCA 3LNPA 1V02A 1DVJA 1W9XA 3AISA 4MTVA 4HPNA 3BMWA 1KTBA 3SRDA 3NVTA 4IPJA 3ZSSA 5HULA 3WQFA 3UEQA 1TVNA 3KTCA 2OYMA 4D6HA 1LRQA 1TV2A 3AHZA 1I2NA 4G1KA 4FEZA 4QE5A 3B05A 3BCFA 3OQEA 3AIWA 4LBUA 3GNOA 1HKJA 1IZKA 2VFDA 4HJFA 1BQGA 2NLIA 5DANA 2J7CA 5AHIA 5I7GA 3LX9A 1A5AA 1B3ZA 3NQVA 2FMNA 4N4PA 1QR7A 2FVLA 4H04A 1VLWA 3UY8A 4GH1A 1GQIA 2EO7A 4CNOA 4W7UA 2QS8A 2Z27A 2V0TA 1I8JA 5F4XA 4QTGA 3ABRA 1JZ7A 1XGDA 3WLLA 3BGJA 2ZZ7A 4LRTA 1WQ5A 5CXPA 3UXLA 5G4HC 3EOLA 3KFTA 3BAWA 3STCA 3FXYA 3TTQA 4O28A 1JDFA 2OZ8A 3W7KA 3ZWSA 5BRBA 3MI3A 3B9OA 4JS3A 2WKJA 4C6NA 4B5XA 1L8PA 2RH9A 1ZAHA 4DEFA 1HL2A 1XLKA 1QI3A 2DVXA 2WSKA 4GKLA 4WY0A 2A6LA 3KS5A 2WSYA 2GQ9A 3L0KA 3NPXA 1JI2A 1UZ1A 3MVTA 3EWCA 5E6ZA 4F9JA 4ZQMA 1FP9A 2YDSA 3RM8A 2C16A