1H2JA

Endoglucanase cel5a in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-cellobioside at 1.15 a resolution
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Direct Experimental Observation of the Hydrogen-Bonding Network of a Glycosidase Along its Reaction Coordinate Revealed by Atomic Resolution Analyses of Endoglucanase Cel5A
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE 5A
total genus 123
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1h2jA00
2IXUA 1CTNA 2EPOA 4HZ8A 1W3JA 3U5YA 1CGUA 4HA4A 5FL0A 3ARYA 5CLWA 4WLCA 3GBDA 3DECA 3WFLA 1NQ6A 1UWRA 5HPCA 1UD8A 1E6PA 1CXFA 3A4XA 1F4AA 1NP2A 1QW8A 2EPLX 4UCFA 1C93A 2X0YA 2A3AA 3CZJA 4PRWA 3GBEA 4B16A 2DT2A 4AZ5A 1XSKA 3AMDA 3BCFA 1C8XA 1US2A 1CYGA 3WNMA 3BLPX 4JL2A 1L8NA 1MW2A 2OSWA 3SCSA 4OOZA 1JYVA 4XZWA 5CGTA 3PZOA 4M24A 4MJ4A 1U30A 3CIVA 2CHNA 3LPFA 3D3AA 1B0IA 2Y24A 3OBAA 1V3HA 1DWFM 4EKJA 2D24A 1FH9A 3AOFA 4OUEA 4CN1A 1E9LA 3ZQ9A 1V0KA 2YA2A 3RJYA 1QVBA 4M82A 4WSKA 4GI9A 2DT3A 3RMEA 2XWEA 3N1AA 4WKAA 3THCA 3ZT7A 4XUYA 2CBIA 3AIWA 4U5KA 4A3YA 1ZBCA 5DT5A 3SUSA 2VZTA 4PMNA 2YL6A 1H4PA 4P8WA 2XFRA 1J0JA 4CU8A 1JDCA 1EHNA 1KXQA 4KGLA 5EFFA 3IAQA 3MS8A 3M07A 5GPRA 1OINA 1UUQA 3MUAA 4FLSA 1H5VA 5CJ5A 2J4GA 3PZMA 4CD8A 2Z1KA 2D1ZA 1X1NA 3WF4A 1WKYA 4MNKA 1XSIA 1RPKA 3PTQA 1XHGA 2VL4A 4C7GA 1D7FA 1VJSA 2VZOA 4TUFA 5BYWA 2VX5A 3BCDA 4QDMA 1W1VA 1KXVA 1V08A 1JG9A 1ITCA 1E3ZA 2V5DA 3QHNA 4AZCB 3SCUA 1U33A 5ABGA 3WNOA 4W7WA 2A3BA 2BHUA 1BPLB 2V3GA 3NYDA 2FH8A 4H8VA 5BROA 3IJ9A 2JF6A 2QHAA 4TVUA 1WDSA 2YL9A 3U7BA 2FGLA 5HOSA 4AWEA 1XYFA 5CQ1A 5JUVA 1VF8A 1JIBA 2ZOXA 5C8BB 1LL6A 3QR3A 3OZPA 3SCNA 3K4AA 1VEMA 3A47A 5A1AA 5A8QA 2J77A 2BY0A 1VFOA 1W9DM 1MXDA 4AZBA 5LYRA 1E4NA 1EOKA 1Q6CA 2XYLA 1UR1A 3VU2A 3WSUA 2D2OA 3N17A 5AYBA 3TTSA 2CKRA 2DH2A 3AXIA 4HOXA 2JIEA 2XM2A 1CXHA 2X8RA 4CU7A 3DYPA 4Z2GA 4L4PA 1JD9A 3BLKA 4LXFA 5LA2A 1GOWA 4LQ1A 1W9UA 3JUGA 3BMWA 3PTKA 1UA3A 1BSIA 5A6MA 1H49A 3NDYA 2O9RA 1IT0A 1W32A 1E0VA 4AIEA 1GHRA 2XVGA 2QPUA 4AD3A 4P7NA 4OZOA 4P7LA 4W8AA 2VR5A 1QPKA 3PZ9A 3ZR5A 4PYSA 3AIUA 4YN5A 3WH5A 4AEFA 2FGZA 1GZJA 1I1XA 4AD0A 1VENA 1GCYA 1UR9A 4LYQA 4X0NA 3MUIA 1PX3A 4QCEA 1ZS2A 3ECQA 2XVKA 4P8VA 1DWIM 3VD4A 1XH2A 2G3MA 4OBRA 2CIPA 2BHYA 2ZUUA 3EDJA 4W5UA 1ISXA 1JYXA 1K9EA 1ZL1A 4B3KA 2CNCA 1ZJAA 3OIHA 3PBGA 5E70A 3AJ7A 2XVLA 4CVUA 1B3WA 4C7FA 4OOUA 3VX0A 1HL8A 2J7CA 1G1YA 5GNZA 1XRVA 5E9AA 1ZBWA 1V0MA 1HKIA 3IK2A 4MB4A 1OB0A 2DPEA 4LPCA 1GOQA 4W93A 4ACZA 2BV9A 4UQAA 5DF0A 2AMGA 4BA0A 3G6LA 3BH4A 3N15A 2CXGA 1W1YA 1WDQA 1KXTA 3TTQA 5DMYA 1V3LA 2JIWA 1ZU8A 4KH2A 5CG0A 2GDUA 3N13A 2VO5A 4JIEA 2JF7A 2EPKX 4EANA 4UFHA 1V3JA 1V0NA 3OLDA 1H0GA 1W9XA 1C90A 3WL0A 1B31A 1AVAA 4MJ2A 4DWSB 3E1F1 3DYMA 2WMIA 3W28A 2D20A 2VOTA 3W4RA 1GJUA 3OGSA 1KCKA 1TZ7A 3UETA 4BQ3A 4M8UA 1LF1A 4GO8A 1E3XA 3EDFA 3FNDA 5FIPA 4H2CA 3TTOA 1SR0A 1J0IA 3CUIA 2ZXBA 3RDKA 3UG5A 1UKSA 3BAIA 1OD0A 2WMKA 4ZENA 3EBVA 1CLVA 3DHPA 3AZRA 4IISA 3F5KA 4F79A 2WCAA 1W1TA 3A4WA 4PBGA 1JF6A 1PAMA 4M81A 5I77A 3WF3A 1V3KA 2DDXA 2GSJA 4AMCA 3OG2A 3EMCA 3NDZA 1BF2A 2EJ1A 1FP8A 4AD1A 1CDGA 3AS3A 4WK9A 3AS2A 2WAGA 2D3LA 5A94A 2VNCA 1J18A 3I3DA 1QI2A 2BNJA 3BXWA 1W3KA 1WPCA 1UH3A 3BAYA 1ODUA 3POCA 3WF2A 1QHPA 4PN2A 2DSWA 1CGYA 1LJYA 5TD4A 3VPLA 3WMCA 5BXPA 4E8DA 5EFDA 1E6XM 1PZ3A 1JZ6A 3CHEA 4W7UA 3KL0A 1W1PA 3N18A 3MUY1 3HN3A 2V38A 2UY3A 3ZR6A 4B3LA 1SFSA 2CKSA 2WWDA 5I79A 3SUUA 3AIVA 3CUFA 3EDKA 1JZ2A 1ECEA 3AHVA 3L2LA 3CZGA 4AD5A 4EK7A 1O7AA 1LWHA 3UERA 2IXVA 1H41A 4GXPA 4P7OA 2ZUNA 4U3CA 1Q4NX 2YDSA 3ARTA 3MUZ1 3WDJA 1NH6A 3VMPA 2WMHA 1C92A 9CGTA 3UR8A 2Y4SA 3ARRA 3OLEA 4MAVA 5BXSA 1ISVA 2X09A 3UR7A 2CITA 4R5EA 3CGTA 2RGLA 1TCMA 2J62A 4MTVA 1DWJM 1OIFA 3ZOAA 4CD4A 4D6GA 1B3XA 4U31A 3O6AA 1JNDA 1QHZA 4GO9A 4AZHA 3W27A 6CGTA 3GDBA 3ALGA 2TAAA 4MB3A 5IDIA 4CD5A 1JFHA 1H11A 4D1IA 1MYRA 1OM0A 3KEHA 1HF6A 4NRRA 2WC7A 3WENA 5ABFA 4D1JA 1HJSA 3MSGA 3GH7A 4WKFA 4JFUA 5KZ6A 1JYNA 3ARWA 2X0HA 1WDPA 3L4XA 4WIWA 3U5UA 2VX6A 2ZUTA 1E4LA 4UQCA 4UFIA 2D22A 1E1EA 3FY1A 2X1IA 1KGUA 2FHCA 4XZBA 3L4TA 4GQQA 3S2CA 3SCPA 1QBAA 1NOUA 4WJXA 2CETA 2DIEA 1UKPA 1RH9A 3T08A 4Z2JA 3T2PA 3ARVA 2ZUWA 2XVPA 2VI0A 1BAGA 3CMGA 4GQRA 4PUEA 1JF5A 4B9YA 3HMCA 5GNXA 1C3FA 1BVNP 3WD4A 4ACZB 2ZX5A 4P8UA 1W91A 1JDDA 1Y7VA 2W5FA 5JBEA 4HU8A 2DGAA 4PEEA 5D9PA 1NM9A 3ZJKA 5JIPA 3IAPA 3U7VA 4B9ZA 1JNEA 3IJ7A 3EDEA 1WNOA 4AZ6A 3BSHA 2DSVA 1XH0A 3WH9A 2DSKA 4P8XA 3VGBA 2PBGA 3VM7A 5JBFA 1UKQA 3AIEA 3AIBA 4UFJA 1WCGA 2W61A 5AYIA 1CENA 3APGA 1E6SM 1YQ2A 5HXMA 5JIWA 4M1RA 1CGXA 4D72A 3BSGA 1CPUA 4PTMA 4XB3A 5E09A 1NWSA 2C8NA 2BHZA 2ZUVA 3MMUA 2QV4A 4J3WA 5LA0A 1LL7A 1WP6A 5HBFA 3BC9A 1B3YA 3B9AA 3VKKA 1GJWA 1Q6EA 2WMJA 1V03A 4GKLA 1EH9A 3BAXA 3GTNA 2CBVA 3OZOA 4LX4A 3OGVA 4TX8A 4ZEPA 2W91A 2WVVA 5E0CA 3K46A 2O92A 1JI1A 3OGRA 3QHMA 3WD2A 5I24A 3AHXA 3UCQA 4D6IA 5CZKA 3RILA 4J3XA 2YBTA 4W7VA 2GK1B 4NSBA 2C0HA 4GINA 1GPFA 4BQ4A 2WB5A 1DHKA 3L4ZA 4ACYA 5I23A 3AFBA 1E0XA 1HJQA 1BQCA 3ZIZA 3VMOA 4AXNA 2Y8VA 1B9ZA 1J9YA 3WUGA 4JHOA 1BG4A 2DSZA 3BMVA 5ECUA 5FKYA 3RM4A 3WDHA 2X2YA 5M3WA 1QNPA 3CZEA 3FHAA 2VCAA 2Y5EA 1RD6A 2XJ7A 3W6LA 5DT7A 1VFMA 2JEQA 4PSRA 1BFNA 3AHYA 2WLYA 5BWFA 2JE8A 4UOJA 4Y7EA 3RCNA 4GIAA 3HU7A 3CZ8A 5CPQA 3AS1A 5FOOA 1M53A 4QLKA 4UFMA 1WZMA 4IPLA 3VOCA 3WQ8A 5A2AA 4FMVA 3FW6A 1E5JA 1VEOA 2NT0A 3DYOA 3NIYA 1H1NA 2D0GA 4CN4A 2G3NA 4IUGA 4PMQA 3ZJ7A 1UD2A 2YDRA 1A3HA 3WKZA 2BY2A 3F5LA 4P7RA 4JCLA 3SCQA 3VM5A 2BXZA 3PZQA 4ATLA 2J75A 3RIKA 4KMQA 2JALA 3AMKA 1DEDA 4FK9A 3VD9A 5LA1A 2ZWYA 1EO7A 2W4XA 3VIPA 2ZX6A 3FN9A 1QHOA 2WSKA 1E4MM 3K4DA 4HP5A 2XIIA 4LYPA 3WL1A 4HTYA 4HA1A 3VGGA 1VAHA 4PMYA 1GOIA 5D8WA 1M04A 1B30A 2OWXA 2WANA 2HISA 3AIQA 1B3VA 5A6SA 3WD1A 1GQJA 4TVDA 5ABFB 1DWAM 1EXPA 2WCGA 1JZ5A 1UQYA 1W3LA 2VZVA 2WMIB 4D71A 4AYSA 2OWWA 4FLOA 2QF8A 2BY3A 3TTYA 4PMRA 2BVYA 3WIJA 1PEZA 3VUPA 1UHVA 3QHOA 2NSXA 4HMCA 5CPTA 4AIUA 1XGZA 2FHFA 2VZUA 1UWQA 1V6YA 4AZCA 1SYTA 1WO2A 4WSJA 1EOMA 1BTCA 2D0HA 4UTFA 2ESCA 1OGBA 3N12A 3WQVA 2J8GA 1ISYA 2O9TA 3GXDA 1CWYA 1QW9A 2VCCA 3W6MA 1FH8A 1GOKA 3AYRA 1WE5A 2XG9A 1QI4A 3II1A 3ZM8A 1M03A 3GNRA 1KCLA 2GJRA 2ZE0A 4JCMA 4Q7NA 2WVSA 2JEPA 2YKKA 4CD7A 1JZ3A 4TTGA 1UD4A 2CBJA 1OIMA 4WF7A 5IHSA 1P6WA 2CEQA 1IZKA 2EEXA 1KWGA 3G6MA 1JAKA 1VJZA 3AHZA 1UR0A 1V6UA 3FAWA 3RJXA 1KGXA 1CXIA 4W84A 4HMDA 2QMKA 3VTRA 8CGTA 3W37A 3AXXA 3BAJA 3AISA 3EMZA 5I5RA 3UESA 1CBGA 1GOMA 5ABEA 4PMDA 4IPNB 4N42A 4Z2KA 2VVNA 4FLRA 1GUVA 2E3ZA 1Q6DA 2J7FA 2PC8A 1XCWA 2VMFA 1QNSA 3PHAA 1CECA 3VMNA 1OT2A 4W8BA 5A6BD 2Y8KA 1E0WA 1NWRA 2YIHA 2O9OA 3MSDA 4JZ5A 1Z32X 1XC6A 3WNNA 5GQBA 5BRPA 4AEEA 1GQKA 4QP0A 2UWFA 5C70A 2BY1A 2PBOA 3WELA 2J79A 1DP0A 4UQ9A 3CBWA 4J3TA 1TG7A 3B8SA 4DWSC 4U2YA 5DFAA 3GXMA 2VQTA 2WHMA 3VNYA 1G01A 4U5IA 1E40A 2XTKA 2D3NA 1BYCA 5CGMA 2F2HA 2XPKA 1E6ZA 5M03A 4V27A 3WFZA 1UD5A 5I3DA 2ZX8A 1AQ0A 1ZBVA 3W38A 1HT6A 4LYRA 3NSMA 4MNJA 1TVPA 4NF7A 1R8LA 5A8PA 1QNRA 1JL8A 3NSNA 4CN6A 5F7UA 3WEZA 1GVIA 4MNMA 4V28A 2EQDA 2XWDA 4CVWA 3VGFA 3K1DA 1BGAA 2CBUA 2PWGA 2E9MA 3CHDA 4ATDA 4YHEA 2WMFA 3AS0A 3I3EA 4Z2LA 4ML4A 2W67A 2YOCA 1FHDA 1QNQA 1R85A 1B90A 5AC4A 3F5JA 3LMYA 3ARZA 3VD5A 2EBNA 4HU0A 4J3SA 5IFTA 4CU6A 3L4YA 3NSXA 1TMQA 4GI8A 4CCEA 1SMDA 2J7HA 2B31A 3CZKA 2VX4A 5I0DA 1MW3A 3WQWA 1GVYA 3VDBA 1E6NA 3VIGA 1E55A 5I78A 1JXKA 1HJWA 4UFKA 1K9FA 3WDPP 2OSYA 2WC3A 4J7RA 2WHLA 4BF7A 1DWHM 5AY7A 4HA3A 3WD0A 3K8KA 1D2KA 4KGJA 3WH6A 7A3HA 2XSAA 4H04A 3T2QA 4D6DA 5A2CA 4JHZA 2VRKA 4RE3A 1GQLA 2DT0A 1PZ2A 3WH7A 4A3HA 2E8ZA 2J8FA 1FOBA 1H09A 1FFQA 2DEPA 1EDGA 5CPSA 1J0ZA 2VJXA 1JD7A 1TUXA 2WZEA 3CHCA 4X0VA 2E4TA 3UG3A 3WMSA 3KZSA 2XVNA 1MQPA 1PBGA 4ZXLA 1MQQA 2WYSA 1HNYA 4ZXOA 2HVMA 1V0LA 1KQYA 1KQZA 3CUHA 1EQCA 1H3GA 4W8LA 5D4YA 5FL1A 1TA3B 1E70M 3W0KA 4RE4A 5E0FA 1E43A 4PMVA 1RP9A 1QI0A 3VGDA 2D0FA 2W63A 3TA9A 1NOFA 3N04A 1W2VA 3WF1A 4AZGA 1QOXA 3PZUA 4ATWA 1E73M 1ODZA 2CYGA 2WXDM 2V3FA 2PWFA 4H8HA 1C7SA 4JAWA 2VZSA 1JZ7A 2IUZA 3VIIA 3ARSA 4Z2HA 1WB0A 2F8QA 1GNXA 1CGTA 2WBGA 1N82A 3W24A 2OLHA 3W25A 3A4AA 1BYDA 4MDOA 1FH7A 2J7DA 3AROA 3AICA 4JL1A 4KRTA 3K8LA 4HZ6A 2WVVB 3NUKA 4J28A 1ISZA 5CLTA 1JDAA 3S6TA 4U3AA 3SUWA 2A3HA 5HPOA 3WH8A 3ARUA 3FXYA 3F4VA 1BG9A 5DO8A 2GJXB 1M7XA 1HKMA 3VINA 1E72M 1FFRA 4W86A 1HP5A 4NRSA 3FHQA 1BLIA 3EMQA 1LG1A 1UZ1A 3ZO9A 1AQMA 4K68A 2WHJA 5KEZA 3DHUA 1J0KA 4B15A 2DSUA 4JKMA 1D3CA 1KB3A 3PN8A 4AW7A 1XV8A 1EO5A 4E4PA 4AD4A 1JXJA 1LLOA 1WAWA 1UWUA 1UH4A 4H8UA 2DT1A 3VIHA 4ZE4A 2AOSA 2WM0A 1H0IA 1HJVA 5I6SA 5BXRA 3RM9A 4AZIA 2CHOA 3ZJ8A 1Q6GA 1CXLA 2YA0A 3ZT5A 2OWCA 3EDDA 1EA9C 1QBBA 5D9NA 5A6JA 5C71A 2XFYA 5A6AA 4CCDA 2UY4A 1J0YA 3AMLA 1VEPA 2UY2A 3T0AA 3AMGA 3O9NA 1G9HA 1UWTA 3CZLA 4PTVA 5BXTA 4MB5A 2GUYA 4HPGA 2G3IA 2FH6A 2G41A 2GJXA 1NWUA 3QOMA 1K9TA 2G4FA 4MDPA 5A2BA 5JBDA 4GZJA 2BVTA 2WLZA 1OT1A 2ZXQA 4Q22A 3HJEA 6A3HA 1CZ1A 3LPPA 5EMYA 3PZIA 1C7TA 4TX6A 3W53A 2EO7A 1B1YA 2BXYA 4UZUA 3W82A 1A47A 1C8QA 4UR9A 1V6VA 1GHSA 5D9OA 3M6DA 1EQPA 1JZ8A 2OYMA 3ZJ6A 4AISA 4W85A 3UG4A 2WZIA 5IFPA 1ISWA 3T0DA 1V6XA 4CUCA 3ARPA 4E8CA 1UR8A 3VX1A 4PTXA 3BGAA 3VDCA 5BCAA 1E6RA 1F4HA 3AI0A 4JFWA 2ZX7A 1UQZA 3MKKA 4H7VA 5IHRA 4D6FA 1TVNA 4W87A 1FHLA 2WBKA 1ZBKA 2MANA 1KR0A 2ZWZA 4UQEA 1Q6FA 5CXPA 1UWSA 2VX7A 5E6ZA 4XV0A 3RPMA 4YHGA 4DM1A 2E9LA 1VRXA 1YHTA 4E2OA 3W29A 3SCRA 3WNLA 5IXEA 1CIUA 1VIWA 5HDRA 4TTUA 1UKTA 1VBRA 4FLQA 1MFUA 1VFFA 2GFTA 2E8YA 2J74A 1UG6A 1LQ0A 1DWGM 4N0RA 5A8NA 1HJUA 4D6HA 5EB8A 2OSXA 5CSUA 1HIZA 1ZJBA 5A8OA 1OSEA 1LL4A 1R86A 5FCZA 2ZXAA 2W92A 2DH3A 5D8ZA 1WZAA 3NJ3A 4CGTA 2WHKA 1JAEA 3WMBA 2CCRA 7TAAA 1UD6A 2AAAA 1E56A 1JFXA 3WEMA 2W66A 4D6EA 1TE1A 3VGEA 4D6CA 1UYQA 3T0BA 2CERA 1UR4A 4W5ZA 3AXHA 2VVSA 2VQUA 4X9YA 1QI5A 1JZ4A 3QGVA 1PX8A 5AC5A 1I1WA 1FP9A 1CNVA 2Q8XA 2QLYA 1FA2A 3W81A 1EGZA 4AY1A 1V02A 2WZHA 1UD3A 3CMJA 4U2ZA 4HZ7A 3MMWA 1I75A 4JKKA 4F8XA 1R87A 4DWSA 3GNOA 4PMOA 4PUDA 5FD0A 3VD7A 3O2LA 1ESWA 1HVXA 5A6BA 2GDVA 2E0PA 4BCEA 2VTFA 5A3HA 5HNNA 1W9VA 4RE2A 1NWTA 1XD0A 2C7FA 5D9MA 1E4IA 4TXEA 4S3JA 4BS0A 1PIGA 1PX4A 4M29A 5M17A 1R7AA 2EPMX 3B9DA 4YPJA 2WWCA 1KFWA 4JFTA 3SURA 3K8MA 1MVYA 2WW5A 4OJYA 4HOWA 3GXFA 4UOZA 1MFVA 2J47A 4J3UA 1UH2A 1BYBA 3WDQA 2J7GA 3EYPA 3U57A 2ZXDA 2ZUMA 1QNOA 2YA1A 1NARA 1HJXA 5ABHA 3OA5A 1MXGA 1UOKA 4PSPA 1S46A 1KBBA 2VURA 3D5HA 2PF0A 1J11A 3PZTA 2G8ZA 3POHA 3VD3A 1MWOA 2BS9A 5A6LA 3SUVA 5A6KA 5A69A 4AD2A 4TVCA 3AMCA 3VIKA 2VC9A 2WNWA 4J3VA 4KRUA 2QPSA 3SEPA 4WKHA 3SUTA 1KBKA 3WN6A 2F61A 4W89A 1DTUA 1WZKA 2PWHA 3CO4A 3VO0A 1QI3A 1K9DA 5GNYA 5BRQA 3WNKA 2YBUA 3QOKA 4BZYA 1E5NA 7CGTA 5EBAA 3J7HA 2BFGA 1W2PA 2PWDA 2V5CA 5A8MA 1VBUA 1V3IA 4F66A 4BQ2A 3MU7A 2YDQA 3N9KA 1JGIA 1UWIA 1IZJA 3ARQA 4GPNA 1MQRA 1OWQA 4DM2A 3CHFA 3PZNA 2VRJA 3RO8A 3M7SA 5M5DA 2E40A 1TA3A 2XHYA 4QLJA 3KL3A 3A6OA 4RL3A 4D6JA 3W26A 4KWUA 1K6AA 1XD1A 2WMGA 5DEZA 3SCOA 3VIJA 3VVGA 4ZE5A 3WUFA 3VIMA 2BVDA 4M80A 1VFUA 1JI2A 1JYWA 3BAKA 2WC4A 4C7DA 4UNIA 4PMZA 3WF0A 1UR2A 3ZT6A 4MAZA 1GQIA 1CGWA 1CXEA 2QMJA 1UA7A 1H2JA 2XUCA 1PJ9A 4GI6A 2XIBA 4UFLA 1V6WA 1W9BM 2V3DA 1RP8A 1UZ4A 3RM8A 3VGHA 4DUWA 3L4WA 3KL5A 1B2YA 1LWJA 1KXHA 3BAWA 4P7QA 3MV11 1KWKA 1HP4A 3PTMA 4PCSA 4DUVA 2VR4A 3A3HA 1TFVA 3AZSA 2ZUSA 2VCBA 3WQ5A 1HVQA 1WZLA 1G0CA 1MW1A 4QLLA 2G3JA 3B9EA 2A3CA 3GH5A 3WDRA 1BYAA 1U2YA 3MO4A 1OCQA 1E6QM 1C8YA 4GZEA 3MMDA 2OYLA 4OIFA 4R27A 2FDMA 4EE9A 4AZ7A 1V3MA 1GW1A 2WVUA 4PMUA 2EPNA 1V02E 3GYCA 4IM4A 1CGVA 3FAXA 1BHGA 4MPKA 5E6YA 2YLAA 4NI3A 1BVZA 4OKDA 4BQ5A 3N11A 3THDA 4S3KA 1EDTA 1XSJA 2V3EA 4DUXA 3ARXA 3NCOA 3WNPA 3VIOA 5CSYA 3OLIA 3WBAA 4AC1X 3CUGA 2XGBA 2ZICA 3TP4A 3CH9A 3GXIA 2WPGA 1XCXA 2J7BA 3AIRA 1IV8A 3WQ6A 2YL8A 2EXOA 4ZFMA 1NOWA 4M56A 3L2MA 4U33A 4EAMA 3DC0A 2NW0A 1MW0A 4J27A 4PTWA 1W9PA 2GJPA 3M46A 1M01A 1R7OA 3SCTA 3L4VA 3OLGA 3UEQA 4CCCA 2WVTA 1HN1A 3CPUA 3GM8A 3T2OA 2PI6A 3ZSTA 1O6IA 2ZIDA 2UY5A 1EHAA 3VIFA 3MANA 2E9BA 1EDQA 4PCTA 4W88A 1X6NA 1HKKA 2GVYA 4NZCA 3WUEA 4CKQA 4L4OA 1J12A 1UKOA 2PB1A 2O9PA 4H41A 2WK2A 2CPUA 2VRQA 1E15A 4JKLA 4XX6A 1E71M 2A3EA 2VUYA 3TONA 4MNLA 1GOOA 2WKGA 1CXKA 2WSPA 1AMYA 3WBEA 2XSBA 1X6LA 1XYZA 3VDAA 3IJ8A 4MB1A 3SIMA 2GK1A 2OYKA 4QCFA 3CTTA 3VILA 1CEOA 1WDRA 3KE0A 4V2XA 1OBAA 2J7EA 2X05A 1SMAA 4AIOA 4HPHA 2JFEX 4QAWA 1G94A 1BGGA 1OGSA 1NP0A 2D23A 4Z2IA 4DWSD 3L4UA 1HXJA 1L0PA 1OD8A 3MV01 3SCVA 3VNZA 1J01A 2XFFA 2NT1A 4MADA 2ZX9A 6TAAA 3ZMRA 2W62A 4HOZA 3CUJA 2VT0A 1VB9A 2DIJA 2CESA 3LPGA 1G5AA 3WDIA 4A4AA 1GONA 1EIBA 1US3A 4QFUA 2WKLA 1HL9A 3IANA 2YLLA 1KR1A 4TOQA 4UZSA 3WQ4A 3GNPA 3ALFA 2WCSA 5I2UA 1AQHA 2YL5A 2Y2WA 3PZVA 2XGIA 3OB8A 4GZIA 1ITXA 3AZTA 4FF5A 4F9DA 2PWEA 3GH4A 2Z1SA 4UQBA 3T09A 3GZAA 2XM1A 1OGGA 1XH1A 3WD3A 3TOPA 3WY1A 2DQXA 2YJQA 1GORA 3AYSA 1B3ZA 4PMXA 3I3BA 1HKJA 4LGXA 2J25A 3ZSSA 4OBSA 1C91A 4UQDA 2J78A 1J0HA 1PPIA 1J10A 3PZGA 3SCWA 4URIA 3AHTA 4JFVA 3KWXA 1KGWA 4CD6A 4JFSA 1E1FA 8A3HA 2FHBA 3CLWA 2RGMA 3WUBA 1W3HA 1TR1A 3LPOA 3WEOA 1HX0A 1CLXA 5A95A 3AQUA 1PIFA 1ZB5A 4HMEA 4UOQA 4F9JA 1LG2A 3VDHA
chains in the Genus database with same CATH superfamily
3FJLA 4EPEC 2IXUA 1CTNA 4HZ8A 1ZNNA 3MW7A 5C2CA 3QZ6A 4YTUA 4IGNA 5HPCA 3B0XA 4C6MA 1QW8A 1SO3A 3CZJA 2DT2A 2C0AA 1XSKA 3BCFA 3WNMA 3A13A 5EMJA 3IJIA 4JL2A 3ZVHA 1AL8A 1MW2A 3SCSA 4DZIA 2E68A 1N8IA 4PUJA 3JZEA 4XIAA 1TTQA 4KWVA 4RPQA 5L9FA 4HZMA 4LUTA 5CGTA 3PZOA 1QRQA 1W8SA 2CHNA 3TSBA 3URNA 1VPYA 4EKJA 5G1TA 1IXOA 4OUEA 3BG9A 4CN1A 4YLWA 1US0A 3ZQ9A 3GU2A 3PBWA 4M82A 1ZLPA 2DT3A 2CLHA 1QATA 2HXUA 3D47A 3QPYA 4XUYA 2CBIA 4U5KA 4K36A 5IBXC 1UJPA 4PMNA 2Q8ZA 3UGRA 2PUZA 2XFRA 1S3TC 5AHMA 3H6OA 3AYVA 4LWWA 1OINA 3I6TA 3MUAA 1TTPA 4M19A 3KUMA 1REQB 4QG6A 4HCLA 3GVQA 2O7SA 3NQDA 4HHLA 4ZOAA 3TYUA 1D7FA 1VJSA 3VE9A 3ES8A 1J8VA 3BCDA 1YNQA 5HWNA 1ADDA 1WDWA 1V08A 1JG9A 3NXLA 3SO7A 3W76A 2PAJA 4W7WA 1O5XA 4WXZA 3NYDA 3IJ9A 3NVTA 1Q66A 3N4EA 2X7WA 2FGLA 4GNKB 5G4HC 1W6TA 1DJIA 2HWGA 2HSAA 5JUVA 1W5MA 5AYYA 1JIBA 2ZOXA 4MGGA 4UTLA 3A3XA 1TB3A 2OJPA 2OEJA 4XBJA 1TV2A 2J77A 4US5D 1AH3A 3CB3A 4GFIA 1W9DM 2A7PA 2QNEA 5LYRA 4HYVA 4CQ8A 2RJHA 4O53A 3VKBA 1P1MA 3WSUA 5CSSA 1IIHA 2HDJA 2CKRA 4HOXA 2X1RA 3BW4A 3KBNA 1JCTA 3DXIA 2OX4A 4JYEA 5KITA 2H8XA 3UCCA 4JY8A 1S2TA 3DYPA 4DYKA 1YX1A 4L4PA 3BLKA 1PTDA 5LA2A 1Z8AA 5CG7A 1W9UA 3JUGA 3DAQA 2XIJA 1UA3A 4W9TA 2O9RA 2VEFA 4GKTA 4NT0A 1IT0A 1W32A 4IOTA 4DJEC 1GHRA 3W07A 3ANVA 4P7NA 2QKFA 4OZOA 4LSBA 4DXVA 7REQB 1NIUA 2E1WA 4QNWA 2O4MA 2VR5A 4J9JA 5LIYX 4PYSA 3FJ6A 1PTAA 3AIUA 3WH5A 3DDMA 4QDPA 4R85A 4LV4A 4MUPA 2WNNA 1XDJA 2ISSA 3N14A 2Z24A 1XLMA 3H21A 3KCJA 4DNMA 3IRDA 1GTEA 1FXPA 3EDJA 3GW0A 3BV7A 3K13A 1GT8A 1M7OA 3GKFA 4O4WA 2YB4A 1W3IA 3H2OA 4H9ZA 3OIHA 1Z69A 5E70A 3GB6A 3AJ7A 2DZTA 4Z42C 3VX0A 1HL8A 3ZXWA 1G1YA 4GH3A 1V0MA 1HKIA 1C9WA 3IK2A 4GGHA 1SPQA 4O19A 2A0NA 4ACZA 2BV9A 5AHNA 4Q4OA 3SJ3A 3B0PA 5D30A 4MWAB 1NU5A 5DMYA 2VC5A 1JUEA 4EANA 3RR4A 2C71A 5AHEA 2A21A 3EEZA 1DQUA 4Q32A 4NYUA 2NQ9A 4FNUA 2QDGA 3L5AA 4GQ0A 4CNTA 1SFJA 1C9DA 1KCKA 1DIOA 5CH9A 2D73A 1XIEA 3PY2A 2J88A 1T8XA 1RY8A 2VR2A 4WQ6A 1J0IA 2ZXBA 4KIRA 3LV5A 3BAIA 1R0MA 4K1GA 5J5RA 1XIHA 4MM1A 1R3VA 4GIYA 1CLVA 4QNEA 5H6HA 2PCQA 1P0KA 3SY1A 3TTEA 1OX6A 4S2BA 3VKCA 2WJZA 3A4WA 1JF6A 1PAMA 5I77A 4CQDA 3B8TA 3T7VA 1RQHA 3TROA 2I7GA 2OOFA 3OG2A 4AMCA 2EJ1A 1FBAA 1FP8A 1NSJA 4RUBA 4WK9A 1YDVA 4GIEA 3S9IA 2PDYA 2ZZ5A 2D3LA 1P6BA 1VHCA 5A94A 3I3DA 1QI2A 1DVJA 2I1OA 3QC3A 2GOUA 1H61A 1U1JA 3M0MA 3P82A 4UTHA 3NQCA 1ODUA 3QKZA 3NO3A 3WF2A 4NZ1A 1QHPA 4S3CA 2DSWA 5TD4A 1LJYA 4E8DA 4XZIA 1PZ3A 1JZ6A 3P61A 4GUFA 3NR0A 2ZYFA 4U4MA 4PC8A 3N18A 2DZWA 3MUY1 3HN3A 2V38A 3R0DA 3ZR6A 4B3LA 1SFSA 5I79A 3EWZA 3SUUA 3CUFA 3PPHA 5KZEA 1F3EA 2R24A 3AHVA 3L2LA 1E9YB 1LWHA 4A22A 2FVMA 4LAOA 2HTMA 2ZUNA 4U3CA 1UP3A 2YDSA 5G4EA 3IWPA 3LCHA 3MUZ1 1NH6A 4FALA 4RV3A 2QUUA 5HA7A 3ORWA 3ARRA 1FY6A 2Y85A 1ISVA 1EF2A 3E0IA 3C2OA 2PRHA 1Y65A 3KBSA 4Q8QA 4GCAA 1A5KC 4DO6A 2C13A 1IXNA 4D6GA 3O6AA 5EA9A 2WPBA 4GO9A 4GRSA 3S5YA 3WLRA 4L4LA 3RPDA 5IDIA 2ABBA 4NG3A 1GEHA 1JFHA 3A5FA 1S2VA 1MYRA 3KEHA 4L6DA 1HF6A 4ZSUA 3E74A 1YMYA 4CCZA 3C8NA 1OQFA 1IHIA 4D1JA 1A0EA 4O8RA 3GH7A 4JFUA 3ARWA 3S83A 4RDZA 1XPYA 3BUVA 4UQCA 3NPUA 2EG7A 3FY1A 4XZBA 3L4TA 4UMBA 3CV7A 1UKPA 3A21A 4O1EA 4N7QA 4Q7BA 1AMKA 3ARVA 3VKAA 2GUUA 1T7LA 3DIPA 2CXEA 1JF5A 3MWCA 3WD4A 4ACZB 1K3UA 5DMNA 3GO2A 5JBEA 4HU8A 4ZO9A 4QEHA 4RKAA 3ZJKA 4KCVA 1X8FA 3WQCA 2CZEA 3P93A 1JNEA 1R3YA 1TJ0A 3TKFA 4JN7A 1XH0A 4TR9A 3VM7A 3AIEA 5AYIA 3APGA 1E6SM 1YQ2A 4H9XA 5XINA 5JIWA 3UJFA 1A5LC 3G24A 1SGJA 1P43A 1V4YA 1M41A 2B0MA 2C8NA 1Q3NA 1W8GA 4JIQA 1HL2A 4JQ2A 3TK7A 3TYZA 4FNPA 4M7TA 3VCCA 4QX4A 1L8PA 1Q6EA 5AC7A 3RCYA 1CB7B 4N4PA 2PFHA 4NX0A 1W17A 2CBVA 3OZOA 3V5FA 2W91A 1LQAA 2WVVA 4IMDA 4GUGA 4F2TA 2O92A 3OGRA 5DRIA 2VEPA 3WD2A 4XTIA 4YXGA 1KM1A 4PL1A 2V8ZA 3BW3A 3U6WA 4B5UA 3M0XA 1SQ7A 2B81A 4NSBA 2C0HA 4GINA 1GPFA 3M47A 1SSDA 4X3ZA 1O5QA 4PTDA 1DHKA 3L4ZA 4ACYA 1ONXA 3AFBA 1E0XA 4IIEA 1GG1A 4DBSA 3UYIA 3IUHA 4G7EB 3WUGA 3P7YA 3STCA 4YS1A 3NZGA 5LIXX 2FIQA 5M3WA 3BE7A 3FHAA 1B9BA 1QWKA 2VCAA 4J2PA 2ICSA 1OC7A 1I2RA 3ZYZA 3AHYA 5BWFA 4DB7A 1GPWA 4Y7EA 4O10A 4GIAA 5BOEA 2VXNA 5FOOA 1M53A 1WZMA 4IPLA 3VOCA 3PPFA 3S9YA 3DYOA 2D0GA 4DVOA 1OEPA 4PMQA 3W2NA 3S0CA 1UD2A 2J9ZA 1A3HA 3TN6A 1VLWA 1XL9A 2CC0A 3VM5A 2BXZA 3GHUA 4ATLA 2J75A 1DJNA 4JDYA 2JALA 3AMKA 3O8AA 4NXKA 4XZNX 1KRAC 4GE8A 3STFA 3VIPA 3FN9A 3GY1A 3KRZA 1E4MM 4KCTA 1PL9A 4AHPA 2XIIA 4WRHA 4HTYA 4M1BA 4JEQA 4PMYA 1F05A 1V6TA 3WBXA 1JGMA 4P61A 4MWAA 3LGGA 1F9CA 1KM4A 4KFNA 4Q8MA 1N8FA 5A6SA 1GQJA 5BMWA 3SRHA 4TVDA 4HCHA 1DWAM 5ABFB 3IK4A 3GK0A 4AYSA 5EPDA 4FLOA 5K7JA 5BMXA 1EJSC 2QF8A 2BY3A 3TTYA 2H6RA 3WIJA 3U0HA 4XAPA 3UR2A 4KCUA 2FHFA 1UWQA 1W5PA 1EOMA 3LRMA 1E1CB 1J2WA 3UZ5A 3WK3A 1EX5A 2J8GA 4Y9OA 2PTZA 4Q8OA 1LBFA 2Q01A 3ZM8A 2NV9A 3W3OA 1M03A 1LUCA 3GNRA 2GJRA 2CBJA 4E2VA 3VYLA 1OIMA 1P6WA 1IZKA 1JULA 3C0QA 2FZMA 1Q45A 3AHZA 4RX0A 3BLLA 1O68A 1AJ2A 4W84A 2F9RA 3VTRA 1C8VA 2W9MA 3ABQA 1GOMA 5G1MA 5ABEA 1GUVA 3EWYA 1IGWA 3S5OA 2VMFA 1QNSA 3VMNA 1OT2A 4MIMA 2ZRXA 4J5NA 1NWRA 5KINA 2O9OA 1QTWA 1Z32X 1I9CB 5C7HA 2VYOA 3EPOA 4XIMA 2GQ9A 5BRPA 3KRSA 4QP0A 2UWFA 1S5WA 3G0XA 4MY8A 1T0OA 2BY1A 4QQ3A 3SFWA 1DP0A 1UUOA 1RBOB 3DBPA 4U2YA 3GXMA 2VQTA 3VNYA 3UQNA 1BYCA 1MDLA 1FWBC 3GC5A 3WFZA 2JBMA 3QJAA 4EF8A 4NU7A 3MZ2A 3W38A 4D8ZA 5E0KA 1RXOB 2PDIA 3CAKA 1JL8A 2GGEA 3LY0A 1GVIA 4MNMA 1TMHA 2EQDA 4PBFA 3ZLGA 2FZBA 3VZYA 4YHEA 4BI6A 3AS0A 4NAFB 1H1YA 4Z1YA 3MYPA 3NAVA 2YOCA 3W1UA 1VFLA 1R85A 4GZ7A 3BTNA 3F5JA 1JCYA 1XLBA 3DENA 4J3SA 4G6CA 1GVOA 4FNSA 3N4AA 4DIAA 1ICPA 5C5YA 1SMDA 1EC8A 2A79A 3EB3A 1P7TA 1X1ZA 3UWWA 4GACA 5I0DA 4L64A 2TRSA 3TWBA 4NXSA 2HS8A 2OOGA 1KV8A 4J7RA 3IGXA 3TW6A 3WD0A 1EZWA 1JPKA 4KGJA 3IIOA 3WH6A 4MFEA 3K4WA 3CEUA 4K37A 3GWQA 4A3HA 3TQKA 4QE4A 2G37A 1W0MA 4NKCA 2ON3A 4X0VA 5TIMA 3O7UA 3WMSA 1AW2A 3KZSA 2Z00A 4LC8A 2ZADA 3DFSA 3ZWTA 1DL3A 1DJYA 3NL3A 4IHCA 2A1YA 3WX7A 2HVMA 1V0LA 3CUHA 1EQCA 4L1XA 3TMLA 1H3GA 3NZ1A 4W8LA 1E70M 2QYGA 1XICA 3W0KA 4LCSA 3H26A 2YXXA 3LCFA 3BLFA 1YTEA 3GAYA 3ICJA 2W63A 4M6VA 3N04A 2YCIX 4MY9A 3F1QA 4TU1A 2G50A 3N9SA 4ATWA 4DYEA 3UF9A 4ZTXA 3UZJA 2Z1BA 1GWJA 5D03A 2WOQA 2PU1A 2OVLA 4HIBA 1HO1A 3OODA 3BOLA 3PBUA 3VIIA 3ARSA 1KFLA 3TZFA 4QGCA 3PFRA 1A53A 3GC2A 1OHLA 1GNXA 3T0CA 3WLJA 3OYZA 2PODA 4WDXA 4FNRA 4HTBA 2OLHA 3W25A 3AROA 3AICA 2Y61A 3G2GA 3S5ZA 1WXYA 4HZ6A 2WVVB 5CLTA 1JDAA 1OVDA 3CM4A 2A3HA 1BXCA 1KBJA 3ARUA 1BG9A 3GFZA 1SUXA 1E72M 1FFRA 3EKLA 1HP5A 1VC4A 5AZ0A 2A2IA 4P2VA 4O1CA 1LG1A 1UZ1A 4J1OA 2WHJA 3RN6A 3T9PA 3T0TA 3FIGA 3DHUA 2OO0A 1D3CA 4AW7A 4E8GA 4I9AA 4E4PA 4E6MA 2JGQA 5GJNA 2GGHA 1JXJA 2GGGA 2IPWA 2XIMA 3GNXA 3FOKA 3VIHA 1TSIA 4C6NA 3MC5A 3UVAA 2FB2A 3PSVA 3RM9A 3APTA 2CHOA 4EACA 4ADUA 1MEHA 3W7QA 4DBWA 1CXLA 3ZT5A 2PTXA 1XKJA 4NAEA 3KTCA 5C55A 2HVOA 2XFYA 5C71A 4GJIA 2NX9A 4CCDA 1VEPA 1YIXA 2VGFA 3O9NA 1G9HA 4S3AA 4MKSA 4O54A 4C6BA 1VYPX 4EOUA 4MB5A 3HPAA 4HPGA 3TQVA 2GJXA 4QG8A 4QITA 1K9TA 2CHRA 3CYJA 4MDPA 2YPIA 5JBDA 1YRRA 2BVTA 1L6GA 1XDLA 2WLZA 3OQEA 3DZ1A 2ZXQA 3HJEA 5HWJA 2DZAA 3NTYA 1C7TA 1HUVA 3A22A 3PZIA 4TX6A 4UR7A 4LAUA 3TN3A 3P5ZA 2QCDA 5B80A 4AWUA 3WFAA 2V0TA 1A47A 1V6VA 3MMTA 3NFUA 1EQPA 4R33A 3E5BA 4DBUA 3VUSA 2OYMA 4ASTA 3SECA 4W85A 1ISWA 4Q8WA 1V6XA 3EAUA 1GEQA 4K8EA 1YXYA 2JK2A 2FPVA 1ZAJA 3M9YA 3BGAA 4C65A 1P1XA 3NPXA 4CNUA 1WA3A 2ZX7A 4UTIA 1UQZA 1CX9A 4H7VA 3SADA 1DOSA 4HSHA 3ITCA 3KOZA 2Z0IA 2PRLA 1YDOA 2MANA 1VBJA 5CXPA 1Q6FA 3ABZA 4Y9AA 3DFHA 4XQ6A 4JIHA 4YHGA 4DM1A 3FSUA 2W6RA 2E9LA 1V79A 1VRXA 1TV3A 4N02A 4FB7A 4E2OA 1YYAA 2X1SA 4XVEA 3W29A 1UB3A 2QS8A 2VENA 1UKTA 1VBRA 4F4RA 4KEMA 3LTPA 2XISA 2OEKA 2TYSA 3T78A 3SQLA 1UBPC 3SRKA 4N0RA 1KLZA 1HJUA 3C52A 3M0KA 2A6LA 2GYIA 4I6VA 3B40A 2RUSA 5AN7A 1YPIA 3HFYA 1UD6A 2AAAA 1E56A 3I7SA 1YLVA 1KM5A 2A7RA 4GC4A 4N9DA 2PURA 1F74A 2C6QA 4BK9A 2DQWA 2NX3A 3DFQA 3GR7A 1KBLA 4N9CA 1KCZA 3G1YA 1JZ4A 3QGVA 1MEWA 1PX8A 1S1PA 2YX0A 1TIMA 2QLYA 1FA2A 1TJRA 4KETA 3WQOA 3FKRA 2BXVA 1UD3A 1HKVA 1PDZA 2YDAA 3UVIA 2EAWA 4U2ZA 4HZ7A 3IS4A 2PTYA 3MMWA 4US5A 4AF0B 3APYA 4F8XA 5EL1A 1DPMA 2DORA 4PMOA 1KA9F 2IQ0A 1R9ZA 3VD7A 3DEQA 1HVXA 1K8CA 3W87A 2GDVA 1POJA 3WO8A 5HNNA 1W9VA 4JQ1A 5FJRA 4RE2A 4M6UA 3KRBA 3GXNA 2C7FA 5D9MA 1KW1A 2VGBA 1B57A 2NLYA 1RLDA 4OFCA 4QS5A 4BS0A 3EX1A 2EPMX 3B9DA 1KFWA 5JU6A 3QN3A 3MVIA 3SURA 4OJYA 4HOWA 1MFVA 4J3UA 2BGNE 1A50A 1UH2A 3MYOA 1O5RA 4PRTA 3U57A 1QNOA 3H54A 1NARA 2PDNA 1EGVA 1MXGA 4PSPA 1JRBA 4YYFA 1J11A 1A5AA 2G8ZA 4PRRA 3W7KA 3M0YA 4DLFA 3E0LA 2G0WA 3VIKA 3WLIA 2CZFA 3RGTA 5G5IA 4WKHA 1BKSA 4I5XA 3SUTA 4JIPA 5BRQA 3L0KA 3K2GA 2QVNA 2ZVRA 1VPQA 1XG3A 2YR1A 3GNNA 3N9KA 4XAYA 4LB4A 5EGRA 3OW1A 4GCXA 1Q6LA 1Z41A 2WV8A 4GPNA 1MQRA 1I45A 1OADA 4QJ5B 3CHFA 3BLDA 1XC4A 3TXVA 4PUKA 3I65A 1W3TA 4HNTA 4ERGA 5M5DA 4MMWA 2ZC1A 1FVPA 4CNNA 4NILA 1XQKA 3W26A 4KWUA 1XUUA 1XD1A 3SCOA 3WUFA 1AJ0A 2VFDA 4M80A 4RXFA 4EXQA 1HQTA 3GHSA 2R1MA 4NZJA 4PMZA 3B06A 1TJ1A 4Q4PA 3UG8A 1O60A 3QPZA 1CXEA 3F2DA 1W1B1 5E9XA 3W1LA 2GQ8A 3L7RA 4UNKA 2I5IA 4PCPA 2V3DA 1UZ4A 3G3DA 4DUWA 3GS6A 2QPXA 3PTMA 4PCSA 3VZZA 2VR4A 4UWMA 1GOXA 3LI1A 4HHPA 3AC0A 1WZLA 4FX7A 1F8MA 4BJHA 4I7VA 3LNMA 4PR4A 3M0HA 2OZ3A 3FDKA 3QKEA 1QW7A 1BYAA 2IQTA 4ZOEA 2OYLA 4AZ7A 3KWSA 3A9IA 1P0EA 3L2IA 3V35A 5LNSA 4PMUA 2EPNA 3LCWA 3FAXA 1PB0A 2YLAA 4OKDA 1RAKA 5FSEC 1MZHA 1EDTA 2HNEA 3E5PA 3ARXA 1MEIA 3W7DA 3WNPA 1BWLA 4DZAA 3C4UA 4MYXA 5MHBA 4WGXA 3D46A 4OU1A 3TJLA 1UW9A 1XX1A 4DJED 2ZDRA 2X16A 1POKA 3N2MA 3AIRA 1ECQA 3LENA 1VCGA 4LALA 2EXOA 1NOWA 3BLOA 3L2MA 4U33A 3T4WA 2NW0A 4J27A 1XRTA 4BWLC 3EXRA 3IGSA 3N3MA 4EXBA 3L4VA 3UEQA 2WVTA 3GM8A 3TZNA 3LHTA 1YNPA 2NVDA 4AY8A 1EHAA 2YSWA 4QRNA 1TIWA 4GY0A 4AHOA 1EDQA 3ITLA 4W88A 4NZCA 2PCEA 1G4PA 4R53A 3OYXA 1AH0A 1UKOA 4G2DA 3W7HA 2O9PA 2J24A 3DFOA 4H41A 2WK2A 3UPWA 4X9SA 1Z3NA 3T8LA 3WBEA 2XSBA 1U5JA 3VDAA 4ORMA 4PH6A 3SIMA 2HBXA 3N34A 4PODA 3RLUA 4QJ3B 2OG9A 3BQ6A 1O1HA 3CPGA 3LV6A 5MF5A 5FF0A 3C2YA 3P81A 3VAVA 3UZXA 3RMJA 2POZA 2PDFA 4GD0A 4V2XA 4QISA 3TN5A 2J7EA 4OT7A 3DOPA 3FVMA 1G94A 4JXCA 3W74A 3NQ2A 3KVMA 4F40A 2VFFA 1L0PA 3ZLFA 3MV01 4E4UA 1EYWA 1F8IA 4MADA 4E0CA 2A3LA 3NL6A 3GDLA 1LCOA 2VT0A 1Q8JA 3P0WA 1GVQA 1TPEA 4FIQA 3WDIA 1GONA 4A05A 1US3A 4QFUA 4UZSA 1AQHA 5I2UA 4KRZA 2Y2WA 5CGQA 1XBYA 1PKLA 2XGIA 3HPSA 4Q7IA 1RQEA 2ADAA 1QO2A 3GH4A 1JPHA 3Q94A 3N2TA 1D7KA 2E6DA 4R34A 3TOPA 5HK4A 4RNIA 1W5OA 3AYSA 1EGMA 3GIPA 1O4UA 3NG3A 2ZDSA 2J25A 3ZSSA 1FDYA 3OBEA 4RZ5A 3UXLA 1O95A 3SCWA 3C6CA 4IMGA 4URIA 2Y5SA 2PE4A 4CD6A 1Q85A 4PB3A 4JFSA 3LGDA 2VFIA 4K39A 1JCMP 8A3HA 3U48A 4GWEA 3HFTA 3S1GA 2FHBA 1ONWA 4NJGA 3LPOA 3WMLA 4DJFC 4ZQPA 2W27A 1EPVA 3RX4A 5A95A 4PUUA 3W2KA 3U2EA 5EMLA 3TQ0A 4UOQA 4WHBA 2IKGA 4C6LA 3HPZA 3U5YA 3QV8A 1CGUA 1ZY9A 3RX2A 4K6AA 4RJEA 3GRIA 3ARYA 3GBDA 1NQ6A 1E6PA 1KFBA 1CXFA 4NIRA 1F4AA 3CV1A 1NP2A 3DC8A 3S6OA 2C79A 1TPH1 3GBEA 2Z28A 3CU2A 3DCPA 3V3WA 5FEWA 1C8XA 1US2A 5FSDC 3TUUA 3VCRA 2Z29A 3DH7A 2OXNA 3VE7A 4OOZA 2EG6A 2Y7EA 4M24A 3DFTA 2FZ8A 1R47A 4MJ4A 3W2JA 1U30A 3VOFA 2Y24A 1V3HA 5BW6A 3AOFA 3LK6A 2YA2A 1QVBA 1Z44A 4I90A 1KD0A 1M68A 3RMEA 4NNAA 2XWEA 3N1AA 3UPMA 3THCA 3H22A 1GYLA 2YZRA 2ISDA 3SUSA 1H4PA 4P8WA 1EJ7L 1BEUA 2HXTA 1JDCA 1EHNA 1KXQA 5EFFA 3HURA 3M07A 5F4SA 4CQAA 4FLSA 1H5VA 1XIDA 5CJ5A 5HR6A 2JGYA 2PDLA 4IP5A 2NVAA 1IIGA 3NO1A 4DAFA 4LFYA 2VHLA 1WKYA 1AD1A 3NYZA 4XSLA 5IRPA 1RPKA 4FR1A 3PTQA 3TR9A 4HQVA 5FEPA 3R12A 2HS6A 1R9YA 1KXVA 2P5NA 1NVMA 5ECVA 1E3ZA 4LUSA 2XZ7A 3QHNA 2R14A 5ABGA 4LJ3A 3LYEA 5M1TA 4REQB 4H8VA 2FH8A 3MO7A 2C1GA 4J35A 3U7BA 1R3TA 4IGHA 3NDOA 1CLKA 1H7OA 4WVXA 5CQ1A 1VF8A 3W71A 4I5UA 4G1KA 5C8BB 3LXBA 3OZPA 1VEMA 2B7OA 1W1A1 4IJBA 1FDJA 5A8QA 3AU2A 1S2WA 2DVTA 2OKOA 3V0TA 3VU2A 2XN2A 3N17A 3TTSA 1QNVA 3BJFA 5FF3A 3AXIA 4RLIA 1QASA 4FSAA 2XM2A 1CXHA 2X8RA 5AB3A 3ISIX 4CU7A 4JDBA 3PPGA 4NX5A 4A8NA 3ME3A 4XKMA 3BMWA 4Q8PA 3PTKA 1A3WA 4XKYB 1Q2RA 3NWRA 1QFEA 2H3BA 4ZB5A 1D8WA 4AD3A 2O55A 3UXKA 1RCOB 1QPKA 4K8HA 3FEMA 4K2SA 4AEFA 4C6JA 2FGZA 3WLNA 4AD0A 1GCYA 4YTQA 1UR9A 4X0NA 5T9BG 4L9XA 3MUIA 1X97A 3CAQA 1NF0A 1PX3A 4QCEA 5ENLA 3LDVA 1ZS2A 3W7IA 3L67A 1HKWA 2XVKA 3QSRA 3VD4A 4QE1A 3O07A 4OBRA 2CIPA 1O66A 2BHYA 2BG5A 1ITQA 1B5TA 4W5UA 1ISXA 3M16A 2QCGA 3L21A 4UTJA 1K9EA 4ECLA 4B3KA 2CNCA 3A9BA 3VOJA 1OFQA 4ZOBA 1IZCA 2XVLA 1B3WA 4OOUA 3AJXA 5GNZA 3JZUA 3GTFA 5I3GA 1OC5A 5H91A 3Q67A 4LPCA 1GOQA 3QF0A 3K1GA 4W93A 1SSGA 1LLWA 4H6KA 4IJCA 2GDQA 3N15A 4E2DA 3SN4A 3CTLA 4JYDA 1VS1A 4DZHA 4XZ9A 1AK5A 2PWVA 1YTDA 2GDUA 4TV5A 3N13A 1BRLB 2JF7A 3M4HA 4UFHA 1V0NA 1H0GA 3LCXA 1C90A 3WL0A 1BQGA 4MJ2A 2ZBTA 2G5WA 2CLEA 4FX6M 4B3ZA 1X6UA 1VBGA 1ENUA 4XKYA 3OGSA 2RH9A 1FHUA 1MSSA 1JCJA 3LRLA 3LSCA 3MBDA 1HGWA 3CQIA 2D2HA 1YKWA 3B3DA 3TTOA 3HGSA 3CUIA 1UKSA 2QJIA 1GZ1A 4ZENA 3EBVA 1OC6A 2R82A 1L6WA 4PFMA 4F79A 3AUJA 2WCAA 4HN4A 4NI8A 1W1TA 2EG8A 1R2SA 4H19A 1T8QA 3NOEA 4DF2A 1DIDA 3PNZA 3WF3A 3P2VA 4Z1DA 3UY7A 4H01A 3ENLA 1GKQA 3NDZA 1O5KA 5I3IA 1BVWA 1CDGA 2WAGA 3UGVA 4Q3MA 2VNCA 3HV9A 3ABRA 4KF1A 1OK4A 4H3DA 4A8RA 1G67A 1VD6A 5C2XA 4Z1CA 1W3KA 3VOHA 1VCFA 3S9ZA 3BAYA 5DQPA 5FJPA 4R3UA 3DBNA 4FHAA 1OG6A 4O11A 4W7UA 5TAOA 5LXEA 3G77A 3W2MA 2C1HA 3O6DA 1W1PA 3GHRA 2QCMA 2WWDA 3B8IA 3AIVA 4WCJA 3EDKA 4YMZA 1IEVA 2I17A 2XZ9A 3CZGA 4EK7A 4ENLA 2IXVA 1H41A 4GXPA 4IMEA 4P7OA 3QPEA 2QCNA 1Q4NX 1OCJA 4FOKA 2GVEA 1C92A 1UR3M 2FJUB 4AY7A 2Y4SA 4IMAA 1CCWB 3A3WA 3OLEA 3WCZA 3HQ1A 2X09A 2CITA 4MF4A 3CGTA 3H2CA 4JR5A 1TCMA 3PBYA 1DWJM 5KETA 3N2BA 5LXXA 5DX7A 3OOQA 1JNDA 3B8UA 4AZHA 4DWDA 3FLUA 4N6FA 2XN0A 3GDBA 2OKTA 2IW0A 4Z0JA 4MB3A 4CD5A 1H11A 3GZ3A 4D1IA 3R8RA 3DFPA 2QCFA 5I3JA 4NRRA 3NO5A 1CT5A 1X7FA 3E2QA 5LZLA 5ABFA 1HJSA 1MNSA 1H1ZA 2O4QA 1KCXA 5KZ6A 1AZ1A 2X0HA 3SDOA 3G18A 4KESA 2PGEA 2VX6A 4AWSA 1E4LA 3S8HA 2PD5A 4BEUA 3NQEA 3S2CA 3SCPA 4JTUA 3QH2A 4GVHA 1XP3A 3LBCA 2GQAA 3KOFA 4PCFA 1E1CA 2CETA 4XAFA 1RH9A 1FCVA 2FQIA 3TH6A 3SFKA 3MB9A 2H9AB 3T2PA 3H53A 3B0VC 2I14A 2ZUWA 3DGRA 2J13A 4HHHA 5AYXA 1RJRA 3S42A 3UWQA 3QM3A 1PIIA 5AOUA 3TCSA 3R1ZA 1FWRA 5GNXA 1YW1A 3Q4DA 2PDBA 2ZX5A 4P8UA 1JDDA 3I6RA 1YE6A 1FKXA 2AQWA 3HTWA 5D9PA 3U7VA 3EEGA 3NPWA 3PUOA 3OZYA 3PC0A 3PK7A 3KCLA 2DSVA 3WH9A 1AH4A 2C19A 2DSKA 3VGBA 5FF2A 5ABTA 1YADA 1WCGA 2UZ9A 4E4FA 5HXMA 5C6MA 3WBYA 4M1RA 2AKZA 4GISA 3DG3A 4UXDA 4XB3A 3S1XA 5E09A 2PA6A 4LUJA 2BHZA 2CFFA 1KM2A 1XRSA 4IMFA 1AFSA 1DYSA 3M5XA 4A8LA 1L9WA 1XLIA 4DLMA 4LY4A 5HBFA 3BC9A 1B3YA 1VYSX 3SM0A 2YW4A 1EP2A 4B91A 1EH9A 1P5BA 5CKSA 4IIBA 4I7WA 1GVRA 3TWAA 3K46A 1TREA 2QIWA 2ZA2A 3TFCA 5I24A 3E2RA 3UCQA 3VNMA 2FZDA 2GK1B 3COTA 3CS2A 3R25A 2B7NA 4BQ4A 2WB5A 1VR6A 1DXFA 5I23A 4TQTA 2RKXA 3PJXA 1B9ZA 1BG4A 5FKYA 3RM4A 3WDHA 5CBBA 2X2YA 3CZEA 5KZDA 1G4SA 2XJ7A 3W6LA 5GJMA 1AODA 1T5AA 4A21A 1D9EA 5C2GA 2JE8A 4UOJA 5AYZA 1ZHAA 4ZCWA 3AS1A 2V2CA 1YTKA 1VEOA 2NT0A 3NIYA 1FDZA 2G3NA 1PXGA 2OO6A 4LAMA 4QHRA 1TWWA 3H2FA 3CIWA 3S47A 3WKZA 2BY2A 3SCQA 2C3ZA 1X98A 3RR1A 3PZQA 2ACQA 5AHFA 3P74A 1DEDA 3OVRA 3THUA 5XIMA 2W4XA 3CQKA 3OVPA 2ZX6A 1U5VA 4FIRA 3F2BA 3B05A 4H9VA 2PGRA 4HP5A 2SFPA 4LANA 4LYPA 4DX3A 2RAGA 3WL1A 3VGGA 3OEXA 4DRSA 5D2VA 2OWXA 4JQ3A 3ZWSA 2QR6A 4OE7A 4LYKA 3BZJA 5HMSA 2HISA 4WGHA 4GC3A 2HK1A 4JNYA 3WD1A 3QVQA 3H70A 1EXPA 3KBVA 3S1UA 1UQYA 1W3LA 1EF3A 5G4WA 2WMIB 4D71A 4XD6A 2OWWA 4BHYA 1GW9A 1YBQA 1KC7A 4UTWC 2IPJA 3KZPA 1M9HA 2TODA 4PFHA 1RJQA 1MO0A 4PMRA 1PEZA 3VUPA 2NSXA 4HMCA 2IKHA 3MUXA 1RA5A 1XGZA 3GSMA 2VZUA 1V6YA 2QCDB 1SYTA 4Q6JA 5JXQA 1BTCA 2VFGA 4IQLA 4UTFA 1OGBA 3N12A 4IL0A 4NNCA 3CJPA 3DX5A 1ISYA 3GXDA 3PVFA 1QW9A 4HB7A 5FJIA 1FH8A 1GOKA 2XG9A 3II1A 3D6NA 3KOWA 1XWYA 3TYAA 1L6YA 1KCLA 4JCMA 2V63A 4TTGA 2YKKA 1UD4A 4XZMX 2AL1A 1JPDX 5IHSA 3R58A 4Z0SA 3FV9A 1OFRA 4B5XA 2EEXA 3CQHA 3G6MA 5A6TC 1JAKA 1X39A 4HSOA 3WZ0E 3W1PA 4O13A 4YNGA 1XF0A 3RJXA 1CXIA 3KOXA 1FQ0A 1QJWA 8CGTA 4ZODA 4E3TA 3AISA 3EMZA 2GGJA 2XIOA 4N42A 1X8CA 2XH0A 4FLRA 3P6LA 2E3ZA 1LOLA 1H7XA 1Q6DA 1EKOA 1UWAA 3UWYA 5DY3A 3EOUA 3PHAA 1CECA 3THQA 1KM3A 5A6BD 3WLKX 1E0WA 1LORA 1VPXA 1XFCA 3L12A 3W84A 2YIHA 3SBFA 3TJ4A 3WNNA 1UMLA 4Q4SA 4H9YA 1S2AA 1TO3A 5I7GA 4HVXA 3TYCA 4UQ9A 3FJNA 3CBWA 1TG7A 2QCEA 2YBVA 4DWSC 4FPSA 3VNJA 3ZFHA 1QUMA 1TV5A 4DPPA 2D3NA 3GDTA 1X1OA 2PD9A 4GXMA 5M03A 1I2NA 1ZBVA 3SN1A 1XLKA 4MNJA 1AW1A 1TVPA 2P76A 1K70A 1K4HA 5A8PA 1TV7A 3O06A 3C0LA 3KOYA 3ONCA 1F3TA 1KTNA 4V28A 1LDCA 3STEA 3CLMA 2XWDA 2QGYA 4CVWA 1TR9A 3VGFA 3K1DA 5BWAA 3M5VA 2CBUA 4ICCX 2E9MA 2QUMA 3CHDA 2J9YA 4EPBC 3I3EA 3SGGA 4Z2LA 4MZ1A 4ML4A 2W67A 1FHDA 5I00A 4C1NB 5AC4A 2EJAA 1LBLA 4I8DA 4B5NA 2QXWA 3VD5A 3GKAA 4CLMA 1XISA 3R79A 4CU6A 4GJJA 3ONBA 4LAKA 1TMQA 4JTGA 1SW7A 2B31A 3CZKA 4FX8A 2VKZG 2VX4A 1TZ9A 3WQWA 4ICNA 3UXAA 3RRAA 3VDBA 1E55A 3PWAA 1JXKA 1HJWA 1K9FA 2OSYA 1PDYA 3HPXA 1PYFA 3CV2A 1D2KA 3M0ZA 4ZBCA 3UXIA 7A3HA 3HIJA 2XSAA 4H04A 3DERA 4LF2A 3T2QA 5A2CA 4JTJA 1KFJA 4JHZA 3OVQA 4XVDA 5JH1A 1GQLA 1PZ2A 5C9WA 3KCOA 3WLHA 3CWNA 5T9CE 5D04C 4GGBA 5TBOA 4O17A 1TUXA 2WZEA 3CHCA 2E4TA 4OQVA 4XISA 3UG3A 3KM8A 3TLLA 1Q5MA 3UU0A 4IPJA 2WYSA 3LEPA 1HNYA 5JH2A 2VC6A 3OPSA 4ZXOA 1EP1A 2XGZA 3G1VA 1KQZA 5XIAA 1EEPA 3T81A 4FXFA 1E43A 1RP9A 3UPBA 1RD5A 3TA9A 1NOFA 1W2VA 3WF1A 2Z2AA 3IVTA 1KRCC 4MG4A 4XD4A 3UW6A 4HT3A 1OCNA 2CYGA 1XR2A 2WXDM 4PGLA 2V3FA 3EXTA 2A7NA 4H8HA 5C9ZA 4HNVA 2PMQA 4JAWA 4EWND 3V36A 5HJLA 4QJ1A 4Z2HA 3QQWA 3NGJA 1CGTA 1LQ2A 1TV4A 5BZAA 1FH7A 4KRTA 1A5SA 3LCGA 6ALDA 1W1IE 4AF0A 1RVKA 3LNPA 1O1ZA 4IX2A 3W1AA 3NUKA 1ISZA 1TQJA 3VC6A 3TSDA 4HPXA 4U3AA 5HINA 2F84A 5HPOA 3U4FA 4ZTYA 1XDMA 3M7WA 4GJ1A 4QM1A 3B8DA 4W86A 1H50A 3IIZA 2CU0A 2QAFA 3EMQA 1UZHA 5DXXA 1EIXA 1AQMA 1OY0A 1J5SA 2V68A 4QDWA 1J0KA 4B15A 4CQCA 1RUSA 3LG3A 2P88A 3PNUA 1X38A 4H6QA 1XV8A 3MCOA 1OX4B 3B9OA 2Q8LA 3W7RA 1UWUA 3WQEA 4H8UA 2WM0A 2DJLA 4IWWA 4O0QA 3N2OA 5I6SA 4ZR8A 5FAJA 4OV9A 1UCWA 1L6SA 3JW7A 3EDDA 1EA9C 4PUMA 1QBBA 2KZHA 5A6JA 5M2FX 1ZUAX 3CUZA 3AMLA 5K9DA 3JU2A 3T0AA 3G1DA 5C54A 1WX0A 1UWTA 1IGSA 2CWXA 2FH6A 3A24A 1NWUA 4HA0A 1BTMA 4XWUA 3W88A 3G1XA 3W6YA 1IR1A 4YJ5A 5CZJA 1RV8A 2Y1HA 5EMYA 4AAJA 3BGJA 2YFNA 3W53A 1FKWA 1Q4WA 2EO7A 2BXYA 5AKQA 3W82A 1EWDA 1GHSA 3NOYA 1P7TB 3UFYA 4FXJA 3T0DA 3PAOA 4B5WA 4J2MA 2DV0A 4BR1A 1UR8A 1RJPA 1I0BA 4PTXA 2Q6ZA 3UZYA 3VDCA 5BCAA 4LOCA 2V82A 2DP3A 2ZFAA 3H2NA 4YVVA 4NJHA 1H63A 2BP1A 3V5OA 1TVNA 1V5XA 3G0UA 4F0SA 2YFOA 4UQEA 2VX7A 3HG2A 2CZ5A 2Y7DA 2I16A 3SCRA 5D2XA 2VWTA 4V33A 4TTUA 4Y8EA 4FLQA 1MFUA 3OG3A 2QCCA 4A29A 3M5YA 2J74A 3URAA 2FKPA 4AH7A 1LQ0A 2HRWA 4FNQA 3OJGA 3Q45A 5EB8A 1JQXA 3MDUA 4B5TA 1ZJBA 1OSEA 4IH3A 2DH3A 1WZAA 4CGTA 3EX6A 1SO5A 5F4XA 2A4AA 3E0WA 2W66A 4C6DA 3WLTA 1UYQA 3T0BA 1UR4A 1Y0EA 3P84A 3UJRA 2E6AA 1A5MC 5CCZA 4KS0A 4O57A 1S5TA 3K5XA 1RBLA 4X9YA 5DRCA 5AC5A 1CNVA 3JVAA 2IMRA 1EGZA 4EVZA 4MY1A 1QPQA 2OU4A 3SQSA 3CK5A 2WZHA 2FGBA 2G4JA 4TIMA 2EF9A 4DWSA 3B0YA 3LHVA 5FD0A 1TWDA 1ESWA 1YDNA 1VLIA 3UA4A 9XIMA 4BCEA 5A3HA 2V5JA 2YB1A 1XD0A 1TPB1 3QBUA 3A64A 3OQ8A 4M29A 3A23A 4A8IA 1XLLA 2LLEA 2WJFA 4IP7A 1MVYA 3CWOX 4UOZA 3T8QA 1WUEA 3HZ3A 3TXZA 3V4BA 3WDQA 2J7GA 2ZXDA 3LTYA 4R9XA 3IV8A 2NX1A 2HPIA 4WUIA 5ABHA 2H8ZA 1S46A 2AL2B 2VURA 3D5HA 7ODCA 3KP1A 4GH1A 4PTNA 2BS9A 5H8MA 4NJJA 4GX8A 4CNSA 5D38A 4AD2A 3F4WA 4J3VA 5HMDA 1P0NA 1KBKA 4W89A 1DTUA 3VO0A 1IWBA 1K9DA 3LTSA 3IIVA 5EMMA 2YBUA 2INEA 4BZYA 3FA3A 1E5NA 1KRBC 5EBAA 4ERIA 1QPOA 2Y63A 4EPDC 3MU7A 2E5DA 3P80A 3OU8A 3PG8A 3UT0A 4LVGA 1JGIA 3SRFA 2D69A 3NZRA 2F2KA 4C6IA 3ARQA 1J5TA 2GVJA 4HKPA 3MHFA 2OLSA 3M7SA 1F61A 1J4EA 1OABA 1FCQA 3PJTA 4QLJA 3KL3A 3PTDA 3E12A 2P3ZA 3E02A 1G7UA 3VVGA 4H7ZA 1MNZA 3RUBL 4B4HA 3VNDA 1VFUA 4O0KA 4C7DA 4HPNA 4KWOA 1UR2A 4JTSA 1ONRA 8RUCA 4MAZA 3NQMA 4Z17A 2QMJA 1XGEA 3TC6A 4GYFA 4GI6A 2XIBA 4UFLA 3TC3A 1CI1A 3GTXA 1S39A 1W9BM 3VGHA 1Q63A 4NASA 1B2YA 1KXHA 1LZOA 1KWKA 2E5BA 2HROA 4CNOA 1TFVA 2ZUSA 2DFAA 3BVJA 2VCBA 3SGUA 4K8GA 4WDTA 2X40A 3PUEA 4GYPC 1UPMB 4J4KA 1G0CA 1MW1A 4QLLA 1FCUA 1DJXA 2G3JA 2PDUA 3UWUA 2QJMA 4HU3A 4IL2A 4R88A 6XIAA 1OCQA 1E6QM 2EKGA 4GZEA 1RBAA 5D32A 3G8RA 3WLOA 1GW1A 2FTWA 3TW9A 4IM4A 1CGVA 3N11A 4ZQCA 3Q58A 3LA4A 4C91A 4LAZA 1SZEA 2WNQA 3SAZA 4WY0F 4FOUA 1PVNA 5CSYA 3WBAA 4HGXA 2XGBA 3KFTA 2FFCA 3TP4A 2QUNA 2J7BA 4Z1BA 5AVHA 1K03A 2B7PA 4EAMA 2J27A 1S3HA 2INZA 1DQXA 3OTRA 4PTWA 3PSWA 1M01A 3SCTA 4WR3A 3OLGA 4DJDC 4X60A 2WZTA 4UIOA 3EKZA 1O6IA 1F5ZA 5REQB 3E49A 3UNTA 1X6NA 3WUEA 4HHMA 1MDRA 3BK0A 1XXXA 3O0KA 2JKEA 4HN8A 3VK5A 4PUWA 1EBHA 1FWEC 2VRQA 3GE7A 2VDHA 2WSPA 4MWAD 1X6LA 2JKPA 3TW7A 1XYZA 1EA0A 2GVLA 3GG1A 5D09A 2PU0A 1FWTA 4OGZA 2OYKA 3ZR4A 1V51A 3CTTA 3VILA 4L9ZA 1CEOA 4LV9A 1A5BA 1RLCL 3KE0A 3QRHA 1BWVA 1OFBA 3GVRA 1SMAA 3T4CA 4AIOA 2JFEX 5HUOA 4FI4A 2RFGA 1MUWA 4QAWA 2D23A 4DJFA 4DWSD 3MVTA 3CIXA 3RPTA 3TVAA 1OD8A 2QDEA 4MUZA 1IEQA 4NAFA 1XIIA 1W5QA 3H4XA 3GW3A 3RU8X 3HQOA 2NQHA 6TAAA 3ZMRA 4UTKA 5F2IA 1ONEA 1EIBA 3L23A 3B8WA 1HL9A 3IANA 2YLLA 4TOQA 1KNWA 2OB3A 2YL5A 3C5QA 1M5WA 4C6CA 1GKPA 1TTJA 2WJEA 3N19B 1QK2A 4Q8NA 3AZTA 4FF5A 2Z1SA 3RK8A 2XM1A 5LKYA 2AQOA 4WJ8A 3QEZA 3WY1A 2DQXA 4L9YA 1V7AA 2Y7GA 1B3ZA 3MPGA 1SO6A 1HKJA 4BY3A 2GVGA 3GG0A 2BTMA 3KHJA 1Y5XA 2DZVA 3DFNA 4OBSA 1T40A 2J78A 1J10A 3PZGA 4H1ZA 4NY2A 3GUWA 4JFVA 4JNZA 3KWXA 1DXIA 1E1FA 4LEQA 2ZRVA 4JTEA 3NQVA 1JCNA 3WUBA 1TR1A 1S1RA 2VDGA 1U1UA 1YEYA 2B7QA 1HX0A 2WQDA 5HAOA 4HNOA 3KXQA 4L1GA 1KRMA 1ZB5A 1AQFA 3STPA 3BLEA 5BU9A 3QR1A 4F9JA 2WSQA 1OZMA 5F4WA 5AC6A 3S2MA 2GUBA 2QJHA 1W3JA 4DI9A 4HA4A 5FL0A 3CH0A 3FGCA 2CLKA 5CLWA 3QTPA 3WFLA 5U7SA 1UWRA 1UPPA 4ZO6A 3IJDA 2EPLX 1OZQA 4UCFA 1C93A 4PRWA 2DU2A 4AZ5A 3AMDA 1HGYA 1Z42A 1CYGA 4ONVA 1LROA 4YU1A 3GUGA 3HV8A 3DUGA 1JYVA 2E7FA 1XLFA 1UP0A 4ILSA 1H51A 1VFTA 4YWSA 3D3AA 3OBAA 3KW3A 1T99A 1FH9A 2VGGA 4M7SA 2VEKA 1E9LA 3WK2A 1V0KA 4IIHA 4WSKA 3GR8A 5FA5A 1TQXA 2F6UA 1VGAA 4S23A 4B2DA 2JQXA 2YXGA 1SO4A 4A3YA 4L6HA 2VZTA 2YL6A 4GY1A 3D0CA 4M51A 1I2PA 2WNZA 2YCLB 1J0JA 4CU8A 2NV2A 1UC4A 4KGLA 3QFWA 1BF6A 4NZ4A 3IAQA 3MS8A 3BARA 4O4VA 3BWWA 1NTHA 3GIYA 3KDOA 2OQHA 3PZMA 4CD8A 2Z1KA 3HF3A 1LLZA 6XIMA 3ZLHA 4JPGA 4IT1A 1QOPA 2FLIA 1X1NA 2X42A 3WF4A 1RZMA 4MNKA 5H2ZA 5K2ZA 4H83A 1XYBA 1XHGA 4ICMA 2VZOA 3AALA 1K7FA 2VX5A 4WEVX 4UBPC 1A0CA 1EEXA 3MP3A 3RO6A 4MLRA 3VA8A 3SCUA 4GXWA 3C56A 2PC4A 2C15A 3MDWA 4R7WA 5HNRA 4V1XA 1JRCA 2JF6A 2QHAA 1KFKA 3P67A 4TVUA 4H4IA 1WDSA 2YL9A 2C16A 2IS7A 5HOSA 3NURA 3TLQA 2VD9A 1L2QA 1YBQB 1BKHA 2IKIA 2CZDA 2Y88A 4YTSA 3WJWA 5EKYA 3A47A 5A1AA 4ZQNA 3MJMA 1P4CA 3RX3A 2Z6JA 2BY0A 1ALDA 1VFOA 4PUNA 1MXDA 2ATMA 1Q6CA 2XYLA 1VHNA 3V1PA 3PWGA 1FWAC 4H2HA 1F3XA 4TV6A 1VKFA 1GOWA 4LQ1A 3PJWA 2PDJA 2B4GA 1H49A 3NDYA 3M44A 7ENLA 3W23A 1ICSA 1OFOA 2X30A 1E0VA 3MSRA 4AIEA 1GGOA 3JRKA 2QPUA 2EPHA 4GOAA 2Y89A 2TSYA 4L6OA 4CEUC 4RZBA 2ABAA 3OO2A 4WDUA 6REQB 3P8JA 3HA1A 1VBHA 2P53A 4YN5A 1PYMA 2CLFA 1GZJA 1UJQA 3HPFA 1I1XA 4FA3A 2P3EA 1VENA 4LYQA 2OMAA 5HANA 3OHMB 1ZZMA 4LU0A 1ITUA 3T44A 3C2EA 3ECQA 3HGRA 4P8VA 1DWIM 3V5CA 4HK5A 2G3MA 3QQ1A 1WOAA 2ZUUA 3T40A 4A2RA 3RF9A 4I9JA 1NDWA 3H4GA 1JYXA 4C6EA 3RHGA 1ZJAA 1TWZA 4CVUA 4C7FA 2J7CA 4JOMA 4MOZA 5E9AA 2DZBA 1ZBWA 2FPYA 1N2VA 2DPEA 3UJSA 4JN6A 2CLIA 1TPVA 4BA0A 3V7PA 2ZCGA 1VZWA 3BH4A 3FDGA 2CXGA 7REQA 1KXTA 3TTQA 1V3LA 3B9NA 1Q7QA 3NEVA 1VCVA 4KH2A 1V8EA 1JDEA 2VO5A 3GFYA 2EPKX 3WQGA 2E1DA 1K8YA 3QSTA 4O1DA 4YYCA 1V3JA 2YCKX 3OLDA 6REQA 1W9XA 4K7YA 4MJMA 1XLEA 3S46A 3E1F1 3CEPA 4OECA 3LI0A 2WMIA 2D20A 2VOTA 3W4RA 1GJUA 1U83A 3FYOA 3UETA 3BL3A 3G1SA 3KLKA 4BQ3A 2E77A 4Q4RA 4WY0A 1LF1A 4LRTA 2AGKA 3GIQA 4LS1A 4GO8A 1E3XA 3EDFA 1J96A 3FNDA 4H2CA 3DI0A 1DBTA 3NQAA 3UG5A 1W5NA 1OD0A 2WMKA 5GVJA 1Z89A 2ZRYA 1F07A 3NXFA 3AZRA 5I3FA 3F5KA 3BMXA 1RK6A 1K4GA 5KZMA 1IWPA 5D2YA 4G7FA 5DCBA 4NYYA 3EMCA 1BF2A 4E5TA 4AD1A 4K1WA 3KBJA 3AS2A 2QZRA 4RXGA 3USZA 3LCLA 2BNJA 4EAYA 4H9MA 1W37A 4S3GA 3R6IA 1WPCA 1H62A 3W83A 4PN2A 2ISFA 1YNYA 2W3ZA 3PANA 1PHWA 4IFKA 3LX9A 1NDYA 5EFDA 3KBWA 3U3HA 2PGFA 5CPLA 3KL0A 3SY5A 1QR7A 4AQLA 1HO4A 5EY5A 2PDQA 3E2VA 1F3WA 3NQ6A 1JZ2A 1ECEA 1DHPA 4AD5A 2ACUA 3GU1A 3UERA 2ZZ3A 4JX6A 5K4ZA 1XLCA 2GWGA 1DJWA 3WLQA 3WDJA 2Z1WA 3UR8A 4QAIA 1UIOA 5JQ9A 5BXSA 4XUGA 1GK8A 3UR7A 4Q4QA 1TPDA 1DE5A 3UZWA 2RGLA 3SR7A 2DUXA 2J62A 4PULA 2WSYA 1OIFA 3ZOAA 1B3XA 4LNCA 1XS2A 3PB2A 2NXGA 1FWNA 1Y8BA 2BVWA 3V0SA 1KTCA 1R38A 3TN4A 3W27A 6CGTA 1PV8A 2TAAA 4F48A 4Y90A 3MCMA 3GVVA 1K1DA 1OM0A 3M0IA 1XPGA 3QZEA 2Y8UA 2I57A 4QQUA 2QJGA 5DCEA 3V75A 3OA3A 3MSGA 4WKFA 3H7VA 1WDPA 4UUIA 4C1NA 1E1EA 5CJNA 5BRBA 4BWLA 1K8ZA 2VM8A 3W75A 1H7PA 4GQQA 4ZO8A 4OV4A 3TYBA 2WQPA 2DIEA 3F4CA 1GYMA 2HNHA 3P5YA 3FXGA 4Z2JA 1FWFC 3LN3A 4U10A 2VI0A 1BAGA 3W7EA 3CMGA 1XGDA 4HNCA 4PUEA 3HOJA 4WXYA 1RALA 4B9YA 3HMCA 2E25A 3KX6A 2REQA 1JJKA 3M0JA 2DGAA 2DW7A 1IEIA 3IIXA 3IAPA 2PDHA 3PP7A 3PR2A 3IJ7A 3Q65A 3GD6A 5IOBA 3EDEA 3H4WA 1YPXA 4AZ6A 4KWSA 4FXSA 4P8XA 1HTIA 5H8PA 1UKQA 5JBFA 1BWKA 3AIBA 4UFJA 1K02A 5DMMA 4J40A 4L65A 1PKNA 4GBUA 1SJBA 2V2DA 3BSGA 4PTMA 4A35A 4K38A 2NLIA 4O15A 4J3WA 4XD3A 3EA3A 2BASA 3RG6A 1DIKA 3B9AA 3VKKA 1GJWA 1XIFA 1V03A 3BAXA 4TX8A 4M3PA 4ZEPA 1XUZA 5E0CA 4YCPA 4ES4A 1IYXA 1ZJIA 3LERA 4IG2B 4H00A 3AHXA 3S2NA 1T6MA 3SSZA 3KVLA 5CAHA 3PG9A 3RILA 4J3XA 2YBTA 1KKOA 1YPFA 3TOYA 3O15A 4R9OA 2Z26A 4Q8TA 3ZIZA 1J9YA 1H5YA 3IJQA 4RR4A 1FWHC 4LBSA 2P8CA 1RD6A 1K7EA 3G22A 2DZUA 2PLKA 1VFMA 4I5RA 4PSRA 1GTHA 4MJZA 2WLYA 2I56A 3RCNA 3H2MA 3HU7A 4UNLA 5CPQA 1EJUC 3ITXA 4UFMA 5AVNA 4LCRA 3LOTA 5A2AA 4LS0A 1E5JA 4RV8A 2AMXA 1IF2A 4ROPA 4CN4A 3B04A 4IUGA 2ODOA 3R0KA 4DAIA 3ZJ7A 2BDQA 1Q7MA 3SIZA 1CW2A 4RNHA 4LS2A 1R2RA 3ZVIA 3PM6A 2Z25A 1KFEA 1EJXC 2Y62A 4FK9A 3VD9A 5LA1A 1EJVC 2RDWA 2ZWYA 4QBXA 4IQDA 1XYMA 4GUJA 4WSHA 1RCQA 3UYCA 1FX6A 4BFAA 5G2WA 4HA1A 1VAHA 1GOIA 2PDCA 5D8WA 1M04A 1B30A 2WANA 1XCFA 3WK0A 3AIQA 1XLHA 1REQA 2HJPA 1EUNA 4OVXA 2WCGA 1SM9A 4QG9A 5HQMA 1I2QA 3CV6A 1TWSA 4HD5A 2WZMA 1UHVA 3PUGA 3QHOA 3U4AA 3WG6A 4N6EA 4YCOA 3B97A 4AZCA 4W4QA 4I9TA 1WO2A 1SZGA 4EP8C 3WQVA 3YPIA 4AU0A 4ZQMA 5DELA 1CWYA 2VCCA 1J6OA 1WE5A 2Z6IA 3FKKA 2PDGA 2ZQ0A 2ZE0A 2JEPA 3E2SA 1T41A 3QGAC 3CAVA 4WF7A 3RCMA 2CEQA 5K9CA 1UR0A 3E6EA 1UZDA 4HMDA 3LLDA 2PZNA 4HJWA 3W37A 2NQZA 3LU2A 3LGEA 4D2JA 2FFIA 5I5RA 4TMCA 3AXMA 2OELA 1D8CA 3KRUA 4PMDA 4IPNB 4Z2KA 1ZP3A 2ISVA 3BO9A 5G1YA 3QFEA 1I6NA 4H6RA 4F0HA 2ZRUA 3EB4A 2Y8KA 3WJXA 2XFWA 2DZPA 5DLCA 3N9RA 1XBXA 4JYFA 1XC6A 4GNVA 1GQKA 5C70A 1ME7A 2PBOA 4K3ZA 2GJNA 1JUBA 3FJ4A 4J3TA 3B8SA 3LBMA 4IZGA 3UR5A 3ABSA 2HV5A 1M1BA 1G01A 1OX4A 1E40A 5EBUA 2XTKA 5CGMA 2F2HA 3WBWA 1E6ZA 1KV5A 4KWWA 5B7ZA 2BLEA 2PLJA 4V27A 1UD5A 4IG2A 4U28A 5I3DA 3MI2A 2W0UA 3I68A 2ZX8A 5LNUA 4DUOA 4J3ZA 2ZA3A 1JVNA 3NSMA 3PULA 1R9XA 4NF7A 1R8LA 5F7UA 1PWLA 3WEZA 1AD4A 3BLIA 4JTRA 2PWGA 4GMEA 4HYWA 2R1LA 3W73A 4ATDA 2WMFA 4GK8A 1AJZA 3GHTA 3W85A 1QNQA 4O1AA 1B90A 1B54A 3JS3A 4IGSA 3LMYA 3ARZA 4Q8UA 2EBNA 4HU0A 4F0RA 4HK6A 3L68A 3L4YA 3M41A 4GVGA 1AA1B 1F6YA 2J7HA 4FO4A 3VI2A 2EHHA 5BNKA 1MW3A 1E6NA 5E1QA 1OFDA 1IWAA 1M65A 2V81A 3LSBA 1UP2A 4JBRA 2PSNA 4GY7A 4XZHA 3WDPP 2WC3A 1DWHM 4C90A 3A4JA 1WUFA 4H9TA 5AY7A 6ENLA 4HA3A 3K8KA 3L65A 3WLSA 3H7RA 1VQTA 1IXPA 1R2TA 4KKXA 2FMNA 3LLFA 2E8ZA 3B8VA 3WYZA 2J8FA 5FJUA 3R7MA 1H09A 1N8WA 5U4NA 2HMCA 5CPSA 2VJXA 2PDWA 1B3OA 1NDVA 2XVNA 1SJDA 1MQPA 1PBGA 1X96A 4ZXLA 1J93A 2ASHA 3GU9A 1MQQA 3ABOA 4Y8FA 3EPMA 3FS2A 3LMZA 2XDFA 3NVDA 1KQYA 5D4YA 2Z27A 4Q4KA 5E0FA 4XK2A 1QI0A 4LT9A 3N73A 1BXBA 4XD5A 3VGDA 2D0FA 4JQAA 4WD0A 3TAOA 1QOXA 5D02A 1E73M 1ODZA 1TRDA 1NFPA 1NJJA 4GUHA 1C7SA 5K4XA 4WOZA 2Z2UA 1N7KA 2VZSA 4FOJA 4DJDD 2IUZA 4RPPA 2DUAA 4GYJA 1WB0A 3AAMA 3PF3A 2F8QA 1CB2A