1H2JA

Endoglucanase cel5a in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-cellobioside at 1.15 a resolution
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE 5A
publication title Direct Experimental Observation of the Hydrogen-Bonding Network of a Glycosidase Along its Reaction Coordinate Revealed by Atomic Resolution Analyses of Endoglucanase Cel5A
pubmed doi rcsb
source organism Bacillus agaradhaerens
total genus 123
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1h2jA00
1PPIA 3UG4A 2ZUTA 2QHAA 1MWOA 5HPCA 1AQHA 1E6XM 5CPQA 1SFSA 2YA0A 2YL8A 1UKQA 1XH0A 3W0KA 2J7CA 2DT2A 2W63A 1W9VA 4HMEA 3VMPA 4AZ7A 3VNZA 1C7SA 2YKKA 3L4VA 4WJXA 1H3GA 2XVGA 2V3GA 1TE1A 4MNJA 4EAMA 3BSGA 4R27A 1VJZA 3W29A 1B3ZA 2WZEA 1CXFA 2VOTA 3EDFA 1L0PA 1QVBA 2ZUSA 2YA1A 3SEPA 1OINA 1EHNA 2DGAA 2YOCA 2Z1SA 1S46A 4P7LA 2D3LA 4AZHA 3RO8A 1GORA 1OD0A 3VIIA 1CZ1A 3GXMA 4WKAA 3LPFA 1UH2A 4LYPA 5LA1A 3W38A 2O9TA 1OD8A 1JZ2A 3POCA 3QGVA 5BYWA 3MUY1 3WUEA 2XHYA 2Z1KA 2XVNA 3WD2A 4QLKA 2CYGA 4W8LA 5LA0A 4UFJA 1HVQA 2YDQA 1ODUA 3T2QA 3PZQA 1V3IA 3G6MA 2E40A 1MVYA 1CGYA 3VUPA 5FD0A 3RM8A 1XSKA 4MJ4A 3WF2A 1JDAA 5JBFA 4ML4A 2JALA 4IPNB 2DT1A 3B8SA 2ZUNA 3FHQA 2XYLA 5GNYA 1IZKA 4RE3A 2AAAA 2BVDA 3KL3A 5HPOA 2VNCA 1UZ1A 2MANA 1B90A 2GSJA 1DTUA 1BVZA 3WF4A 3LMYA 1DWHM 3HMCA 4GXPA 4ZEPA 2VZUA 3AIBA 1JZ7A 3RPMA 3NSXA 5ECUA 4X0NA 1E73M 5E9AA 1EDQA 2PWFA 3ARXA 5M5DA 4LQ1A 4QAWA 3ARVA 2BVTA 1E43A 1CYGA 1ZS2A 3KL5A 4U31A 2XVKA 1D2KA 5IXEA 4GO8A 5AC5A 4UZSA 1W91A 3BMVA 3SUWA 2WC3A 3BH4A 3POHA 1NWSA 1VJSA 1WPCA 3K8KA 3VIGA 2B31A 3MMUA 4AZBA 2D20A 3QOKA 1VB9A 5A8MA 2WM0A 3ARPA 1DWGM 2DSKA 1ITXA 2OSXA 4UFKA 4JHZA 2TAAA 2WKGA 4P8UA 1GCYA 2VZOA 5A1AA 1M04A 1W9PA 2WMKA 1HJQA 1KR0A 4BCEA 2YIHA 3WQ5A 3MO4A 3WH9A 3AOFA 1CGVA 1GNXA 3W24A 1MXDA 1TG7A 1JAKA 4KH2A 1DWJM 3UETA 4MPKA 3CZKA 3KEHA 3NUKA 3T0DA 3PZ9A 5HNNA 3OIHA 5CQ1A 3U5UA 1W3LA 1V3HA 1CGTA 1E71M 3AXIA 1HKKA 1HVXA 1YQ2A 1QOXA 3RJXA 1TA3B 3WF3A 1H11A 3AIVA 3CH9A 2BXZA 1C8QA 4D6HA 2JFEX 2WVVB 2CKSA 1E0VA 4Z2JA 1QPKA 4JIEA 1VIWA 3UR7A 1HN1A 4TVDA 5D9OA 5TD4A 3ZR6A 3MV01 1BLIA 1OCQA 1ZU8A 4ATDA 1JL8A 2WHJA 2VZSA 2PBOA 8CGTA 1HNYA 2J77A 5A2BA 1H49A 5I79A 2QMJA 1KB3A 3T09A 5FL0A 2A3BA 2WKLA 2OYKA 2NT1A 4PMOA 2FH8A 1E0WA 4UOZA 3M46A 3WDIA 2G3IA 3ZSTA 2WCAA 3RMEA 3M07A 5BXSA 1KCKA 1QNSA 3WNOA 1UQZA 4PSRA 1CXHA 5D8ZA 1KWGA 2VURA 3PTKA 3OGVA 2YLAA 1R8LA 2CIPA 2ZX8A 3PZIA 3FN9A 5DT7A 1GONA 2BY3A 3VGEA 4WK9A 4HP5A 3VILA 1EDGA 4AWEA 4FF5A 1GOKA 1J0HA 2XIBA 1GQJA 2BHZA 1CGXA 4JL2A 1OBAA 5DFAA 1FFQA 3L4ZA 1BSIA 1CGWA 1K9DA 2BHYA 1JI2A 5F7UA 5D9PA 1UWSA 2QF8A 4UOJA 2J7FA 1NARA 2DIJA 4KGLA 3WUBA 4ATLA 3EDEA 2E4TA 1FH9A 4GO9A 1JNDA 2ZXDA 3UG5A 2GJXA 1E5NA 1KFWA 2OYLA 5A95A 1UWRA 3TONA 2BS9A 1V03A 3CHFA 2GUYA 1PZ2A 4UR9A 2CBUA 3T0BA 1KCLA 2EPNA 4X9YA 5CJ5A 4CCCA 1DHKA 3EDDA 2DEPA 3BCFA 3WEZA 3GDBA 3W25A 1I1WA 1W2PA 3WEOA 3O2LA 2X8RA 4JCMA 1GJUA 5GPRA 1GHRA 4Q7NA 3VPLA 3GNOA 2A3EA 3MMDA 3TTYA 3MANA 1KGUA 2CNCA 4HZ6A 1V3JA 4AD5A 1GQIA 3ARZA 2A3HA 3MU7A 1HJUA 4M56A 4WSJA 1HKJA 1J0IA 1VAHA 4OBRA 1KWKA 4CN6A 3QHOA 3AIUA 1CXIA 1OB0A 2ZE0A 2VRQA 1CTNA 1E1EA 4QLLA 3BLPX 3EYPA 1WDRA 3FAXA 4HA3A 4AY1A 3WKZA 5A2AA 1BYBA 3K46A 2EEXA 2X09A 4UQEA 1C7TA 3G6LA 4F66A 1NWTA 2ZIDA 1UA7A 4RE2A 3GXDA 4PTWA 4P7RA 1QI3A 1JYWA 2DH2A 4PTVA 4UFIA 1VFMA 1GJWA 6TAAA 1V6VA 4DWSA 3CZLA 4AEEA 1BYCA 2VJXA 1HL9A 1UD5A 1R85A 2DIEA 3OGRA 4CVUA 1MQQA 1VF8A 2PWEA 2JIWA 4K68A 1HXJA 1MW1A 2ZX5A 6CGTA 1LL6A 1QNRA 4CCEA 1E6NA 2VCCA 1US3A 3OA5A 2FGLA 5FCZA 5EBAA 3BAIA 4C7FA 1OM0A 1UR1A 4W8BA 2QPSA 2G41A 3AIEA 2EPOA 3WN6A 2WZHA 4D6EA 2DT3A 3VMNA 3NDZA 1BG4A 2VL4A 2ZUWA 1FH7A 1RH9A 3T0AA 2XGIA 1U30A 2AOSA 3SCRA 1JZ3A 2J8GA 5A8QA 2EXOA 3CHDA 3W81A 1JDCA 2FHCA 4AEFA 3AHZA 1GUVA 3N04A 2IUZA 2VZTA 2OLHA 3CUFA 1E6QM 1XC6A 4GQQA 3NSNA 2D0HA 3RM9A 4ACYA 2WC7A 4XV0A 2XM2A 2VTFA 2GFTA 3W27A 2VI0A 2V3FA 3WFLA 3IJ9A 3SUSA 5BXTA 3I3DA 1W3JA 1H2JA 5BRPA 2D24A 3OZPA 3CHEA 3VDCA 1YHTA 2E0PA 2WSPA 2C8NA 3WY1A 1K9EA 4U5IA 4UZUA 2F8QA 5CG0A 5DMYA 4JFVA 4LYRA 5EFDA 4DWSD 1OT1A 5IDIA 1EQCA 1UR9A 4J3VA 1HKIA 3TOPA 1E15A 4PMRA 2J75A 1HL8A 1MQPA 2YA2A 1FHLA 3WNNA 2XFFA 3VX1A 1NWUA 2C7FA 4LPCA 1UKPA 3SCUA 2BV9A 3AHYA 1D3CA 2D23A 4L4OA 1O6IA 4JFTA 5BRQA 2Y8VA 3MSDA 2UY5A 2XSBA 2CHNA 5DT5A 3SUVA 1M7XA 3MKKA 3AXHA 1J01A 1ZB5A 3BC9A 3VGFA 4EANA 1UYQA 4OZOA 4E8DA 2E8ZA 4W87A 3K8MA 4J7RA 5A6BA 4P8XA 3IJ8A 4GKLA 2WPGA 3L2LA 2J7DA 2CPUA 3B9AA 3J7HA 1UHVA 3ARTA 5I24A 1Z32X 4KRTA 2J74A 4M29A 1W9DM 2Y8KA 4E2OA 5CGTA 1NP2A 4B3KA 4IUGA 4XZWA 3CPUA 2Q8XA 4PMQA 3VDAA 2WVTA 1UQYA 1H0GA 1MFVA 3AIWA 2W91A 4MADA 2ZUVA 4CD5A 1BHGA 1E56A 3DYPA 2GK1B 1KGXA 1B0IA 2A3CA 3N1AA 4W5ZA 5A6LA 1JXJA 2VCAA 4WLCA 1VFUA 1BVNP 2CEQA 3VD3A 4UTFA 4PMYA 4PMDA 3U7VA 5ABFA 1E5JA 1Q6DA 3VM5A 1JZ8A 3ARSA 5CPTA 1ZBKA 2CITA 1GVYA 3NSMA 3HN3A 4PCTA 2EJ1A 1WDQA 2DT0A 4MNLA 4C7DA 1H4PA 3ZM8A 3WBAA 1UOKA 2FHBA 4JFUA 4CU7A 3RCNA 1VEMA 1CLVA 1C93A 2VX5A 1W9UA 4D6CA 2VO5A 3WUFA 3APGA 2WMFA 2WHKA 1ZBVA 4HOWA 1OGBA 4AZCB 4JZ5A 2VX4A 5I6SA 3ALGA 2D0GA 2JIEA 2JE8A 3GNRA 3RM4A 2WVVA 1B3WA 2J4GA 4AZGA 1UR8A 4TTUA 2WWCA 4AC1X 3QR3A 3TTQA 2NW0A 4Q22A 2ZX9A 3IJ7A 1UG6A 2XGBA 1XV8A 1NOWA 4TOQA 3SCQA 4W84A 3AICA 3W37A 1GOQA 2VX6A 2XM1A 3FAWA 4WSKA 5A6KA 1UD8A 1BGAA 1X1NA 1XYFA 5FKYA 3WH6A 3W6MA 1EQPA 1PX8A 4H41A 4EKJA 4DUVA 1WZKA 3D3AA 4Z2GA 3GH7A 2WVUA 4AZ5A 5KZ6A 1AQMA 3SCTA 1CNVA 5JIWA 2BHUA 1E55A 1KXQA 2WHMA 4MAZA 3GXIA 1TCMA 3M7SA 1C91A 4DWSC 1GHSA 4ZE5A 3AZRA 1BG9A 2WMIB 1JD9A 4AD2A 3AJ7A 4PSPA 2UY3A 2DSWA 5C71A 1FA2A 3HU7A 4D6JA 4LXFA 1ZJBA 1C92A 3AHTA 4AIUA 1N82A 1W32A 2ZX7A 5EB8A 3VOCA 1NOUA 8A3HA 3VU2A 2AMGA 5ABHA 1ZBWA 1LWHA 2J25A 4HA1A 3KWXA 4AZ6A 4WKFA 2G3JA 1B30A 4AD1A 3F5KA 3WIJA 4PUEA 5I3DA 3B9EA 5A6JA 4BF7A 1JAEA 4NRSA 5JBDA 2WBGA 1E3ZA 1CGUA 5E0FA 1QBAA 3NDYA 1VFFA 1VFOA 1UD4A 4W7VA 1OT2A 5A3HA 1Q4NX 3CLWA 4RE4A 2VQUA 2EPMX 4BQ2A 2Y4SA 3WMBA 2VCBA 1UKOA 3BAWA 4OOZA 1TZ7A 1BFNA 4LGXA 5A94A 2YDRA 4UQCA 4QLJA 3ARUA 4V27A 1SR0A 1ISWA 4V2XA 1PX4A 1V6UA 2QMKA 4ZENA 2YBUA 3WMSA 2E8YA 2DQXA 3FY1A 4W7WA 3VO0A 1QNQA 1B31A 3RIKA 3VGDA 1FFRA 4JKLA 4TXEA 4Z2IA 4UQBA 4FLSA 1R7AA 1OSEA 3EDJA 2OWWA 4C7GA 1XCWA 2V5CA 1CXEA 2WZIA 1Q6EA 5I5RA 1K9FA 3NIYA 3WQ6A 2XPKA 3SIMA 3UERA 1NOFA 1ITCA 1TVPA 2XSAA 3DYMA 1CDGA 3WL1A 3SCOA 2ZXAA 1U2YA 4GZJA 4H8UA 2G8ZA 3T2OA 4M1RA 4U5KA 5CGMA 4J27A 3W4RA 4N0RA 4PMXA 1KXTA 4UCFA 1BF2A 1EO5A 1F4AA 2VVSA 1CEOA 3N18A 1CIUA 3PN8A 1JZ4A 2CHOA 1W1PA 4U2ZA 3AMLA 5HXMA 1WDPA 3A47A 2J78A 3WQVA 1TUXA 2WANA 1RPKA 3II1A 1HT6A 4F9JA 1LJYA 3CUHA 3WDPP 5LYRA 5HBFA 4GINA 2VRKA 4ZE4A 2WVSA 4H8VA 3WDJA 4Y7EA 3BAYA 2XWDA 1JDDA 4XUYA 1V0LA 1OGSA 2O9RA 1BGGA 1E6PA 2EO7A 4AXNA 3NCOA 2JF6A 3ALFA 4S3JA 5GNZA 4W5UA 1W3HA 2BFGA 4JCLA 2BXYA 2E9MA 1XH1A 1V3KA 2RGMA 3GTNA 4BZYA 3CO4A 3L4WA 5C8BB 1IT0A 2W4XA 1TVNA 1UKSA 3VGGA 2CBVA 3CUGA 3K4DA 3WDRA 3DYOA 1CPUA 1C8XA 3BXWA 3NJ3A 5AYBA 5D4YA 7A3HA 1UWIA 5I0DA 1LLOA 1EGZA 4J3SA 3L4YA 2FHFA 1BYAA 3N13A 3VGBA 2D1ZA 2PWDA 3VIMA 3ZR5A 3EDKA 1BQCA 1V02E 2W92A 3WD3A 1ISVA 4ACZA 1TR1A 1QHOA 2W5FA 1XH2A 5JBEA 3KL0A 3ZO9A 1CENA 1JG9A 3UG3A 1SYTA 3PBGA 1E4IA 4ZXOA 3GH5A 1PAMA 4AIEA 4HU0A 3AYSA 2XFYA 3CUJA 1J0KA 1W1YA 3WMCA 1XCXA 2WCSA 1NWRA 4DM2A 1KQZA 4UQAA 3W53A 4TVCA 7TAAA 1J0ZA 2WMGA 2YLLA 4CD7A 2ZXBA 1J9YA 2BVYA 1J10A 1XD0A 3CZEA 1V3LA 2GJPA 4WIWA 3QOMA 3K4AA 2JEQA 2J62A 4MAVA 3JUGA 4A3HA 1MYRA 1KBKA 1B3VA 2GDUA 1QNPA 4JHOA 5CLWA 1XRVA 3LPOA 4HPHA 1D7FA 1CECA 1EO7A 2JF7A 3PZGA 2EBNA 1E40A 1KGWA 2GK1A 1ZL1A 3VVGA 1WCGA 2O9OA 1B9ZA 4MNMA 1V0MA 2J7GA 3ZJ6A 2IXUA 1VEOA 5E0CA 3KE0A 3SCPA 3BMWA 3WEMA 4OBSA 4GPNA 3VD9A 1K9TA 4NRRA 2CCRA 1PEZA 4S3KA 4H7VA 5D8WA 1UUQA 4XZBA 1JNEA 4Z2LA 4HZ8A 3AS2A 4YHGA 5CPSA 1W1TA 5DO8A 3ZQ9A 3OLIA 4KWUA 3U5YA 1G94A 3OZOA 1OIMA 1JYVA 3CTTA 1PX3A 2WAGA 3VTRA 5BXRA 4M80A 4AMCA 3FNDA 4H2CA 1W3KA 2PBGA 1EXPA 3ARQA 5JIPA 3D5HA 2BY2A 1UD3A 2V3DA 4AD4A 2OWCA 6A3HA 1UWQA 4GIAA 3WDQA 3GBEA 4BQ3A 5CXPA 1GOIA 3VMOA 5C70A 4AIOA 3CGTA 3FHAA 4W86A 3AS3A 1H41A 5E70A 1UD6A 1WAWA 4A4AA 2Y24A 1DWFM 4KMQA 2DSVA 1AMYA 2OYMA 3VM7A 4KGJA 1BYDA 3ZT7A 4P8WA 4Z2HA 2WK2A 3MS8A 1DP0A 2Y2WA 3K8LA 5BWFA 1UH3A 2ZWYA 3RDKA 3ZSSA 4TVUA 2W67A 2YDSA 1GZJA 2UWFA 4PBGA 3B9DA 3EBVA 5CSUA 3CHCA 1JYXA 3ARWA 3CZGA 4Z2KA 4PYSA 4CU8A 1VENA 3RJYA 5IFTA 1BTCA 1P6WA 4W88A 1Q6GA 2J79A 3VD5A 4DUXA 1DWAM 2CBJA 3GBDA 3K1DA 3MV11 4NZCA 4IISA 3AHVA 4PEEA 2C0HA 1HIZA 4U2YA 4L4PA 4CCDA 3VIJA 4HMDA 3WNKA 3WENA 1XYZA 2DDXA 5I23A 5HOSA 4X0VA 3UCQA 4B3LA 4J28A 4JKMA 1PIFA 4M8UA 4B15A 1QI2A 1KBBA 3F5JA 2WLYA 3ARRA 2CBIA 3AIQA 4UNIA 4PMNA 3DECA 1CBGA 1ISZA 3DHUA 5I78A 2VZVA 4M24A 1G0CA 1H09A 1TMQA 1GOWA 3I3BA 3PTQA 4LYQA 5KEZA 2VUYA 4J3TA 3WNPA 1DEDA 1E4LA 1U33A 1I1XA 3UESA 1AVAA 5AYIA 2O92A 4AD0A 4UFLA 2VVNA 3M6DA 3WQ4A 1E70M 4MTVA 3AROA 4CKQA 1A47A 1V0NA 1WNOA 3WBEA 4DWSB 3BSHA 3ZJ7A 3WL0A 1EHAA 4D1JA 1WKYA 2BY1A 3CMJA 2X05A 4HU8A 3AS0A 2XWEA 3AMCA 1EH9A 2WWDA 4UOQA 1QHPA 3W82A 2YL9A 1VBUA 1NP0A 2FGZA 1VEPA 1JZ6A 3SCWA 1ODZA 1TA3A 1QI0A 4D72A 4M82A 1B3YA 1IV8A 4N42A 4JFWA 2D3NA 4J3XA 1W1VA 4CVWA 4BQ5A 4RL3A 1E0XA 4B9ZA 3OG2A 2PB1A 1MFUA 2NT0A 2WYSA 4P7NA 3VD7A 4D71A 2YJQA 5A6BD 2ZWZA 1GQLA 3TA9A 5E6YA 3L4TA 2CETA 3N11A 4BA0A 3WNLA 1ISXA 4D6IA 3GYCA 3VDHA 3A4XA 3AYRA 1EIBA 2EPKX 3VIOA 1QW8A 2X0HA 3L2MA 3VX0A 4P8VA 4URIA 1TFVA 4IM4A 3BAJA 3EMZA 1JFXA 2JEPA 2XVPA 2OSWA 1HJSA 3AI0A 3S6TA 1FOBA 4MJ2A 3GXFA 1XGZA 1XHGA 1PBGA 1GW1A 4JAWA 3PZMA 2WSKA 1V08A 3AHXA 3AZTA 1VRXA 3VNYA 2QV4A 3WH8A 1ZBCA 1GQKA 4CD6A 2F61A 5I2UA 4QCFA 2GDVA 1LWJA 2DSUA 1KXVA 3WDHA 4UFMA 1XSJA 3QHNA 1XSIA 4GI6A 2FH6A 1EDTA 3SCSA 4QDMA 3ZIZA 1R7OA 3WQ8A 4EK7A 1J0JA 4PTMA 5GNXA 2G3NA 2WCGA 3O9NA 3W6LA 4W85A 1FHDA 4DM1A 5A6MA 4W8AA 2XG9A 4MNKA 5ABEA 3BAXA 4FLRA 4UFHA 1VBRA 3AS1A 2V38A 1E72M 4YN5A 3WELA 2VMFA 4MB3A 1V0KA 4HOZA 9CGTA 4PMUA 3AMKA 1HJWA 1GVIA 1JFHA 1MQRA 4FMVA 3HJEA 2A3AA 3WF0A 1QNOA 3TTOA 1C8YA 4D1IA 2VR4A 3IK2A 4GI9A 4QCEA 3CZJA 2CERA 5CLTA 3WH7A 1WE5A 4CU6A 1CXKA 2UY2A 5ABFB 1V6YA 1QHZA 3DC0A 1PZ3A 3N17A 4CUCA 3SURA 1ZJAA 4FK9A 2G4FA 2DPEA 1G1YA 1E6ZA 3IANA 5FOOA 4B16A 5M03A 3PTMA 3OLGA 4HZ7A 2W61A 2QLYA 4QFUA 1UWUA 1QI5A 1E4NA 4D6GA 3EMCA 2YBTA 4J3WA 1KXHA 4BS0A 3EMQA 1BAGA 3CIVA 1J18A 1H5VA 4NSBA 5A8OA 4JL1A 5ABGA 1G9HA 3U57A 1AQ0A 2EPLX 1E6RA 3TTSA 1L8NA 1ESWA 1UR4A 1JYNA 2CXGA 3ZMRA 1RD6A 3AQUA 3MSGA 1W2VA 3A3HA 1MW3A 5JUVA 2ZX6A 5DEZA 3OGSA 1HJVA 4AISA 5HDRA 1WB0A 2J7BA 1EOMA 3L4UA 1PJ9A 2EQDA 5A69A 3F5LA 3MUIA 1F4HA 4CD4A 1W9BM 3CUIA 5D9NA 4HOXA 4TUFA 3LPGA 4PUDA 5M17A 4OIFA 3AMGA 3CBWA 1EOKA 1Q6FA 3WQWA 3U7BA 1JGIA 2CESA 2GVYA 4PMVA 3MMWA 1JF5A 5DF0A 2YL5A 1SMDA 3AFBA 3THDA 3VIPA 1IZJA 3I3EA 4XB3A 1LF1A 3VKKA 5LA2A 1ISYA 5AC4A 5BXPA 4P7QA 1X6NA 3W28A 4IPLA 3PZOA 5A6SA 1UR2A 3OBAA 4YHEA 4NF7A 4E8CA 4B9YA 4CD8A 3AIRA 3T2PA 4QP0A 5IHRA 3A4WA 4AD3A 2ESCA 1LG2A 1E1FA 3PZVA 3TP4A 2WC4A 5A8PA 3A4AA 3WD1A 4AZIA 4HTYA 3VIFA 3E1F1 5CSYA 3SCVA 4OUEA 5BROA 1MW2A 1X6LA 3T08A 2PWGA 4MDOA 4ZFMA 1LQ0A 5EFFA 3N12A 2WBKA 1LL7A 1E6SM 1KR1A 4ZXLA 3ZJKA 4CN4A 1O7AA 3S2CA 1I75A 1UWTA 2XTKA 1QW9A 2WMJA 4OOUA 3WFZA 3GH4A 5AY7A 1G01A 2OSYA 2XVLA 4M81A 4WF7A 4J3UA 3VINA 4KRUA 5D9MA 4U3CA 2CKRA 3SUUA 2W62A 2XUCA 1FP8A 2X0YA 4GZEA 3NYDA 1NH6A 5A2CA 2UY4A 3UR8A 4XX6A 2PWHA 3QHMA 1A3HA 3ECQA 1HP4A 1US2A 1JIBA 2D2OA 4HA4A 2WLZA 4FLOA 1UKTA 4PTXA 2WW5A 2V3EA 3CZ8A 1W9XA 4PRWA 4R5EA 1HF6A 2NSXA 3IAPA 2RGLA 1CLXA 4D6FA 1UH4A 1C90A 4W7UA 3MUZ1 4MB5A 3VD4A 5CZKA 2O9PA 3VGHA 1KQYA 4HPGA 1C3FA 1MXGA 3ZJ8A 1H1NA 1EA9C 3VDBA 3FXYA 4FLQA 1M53A 1M03A 4PCSA 3ZT5A 3VIKA 2PI6A 4W93A 1J0YA 3CMGA 1HP5A 4F8XA 4F79A 5A6AA 3FW6A 2D22A 2BY0A 3UEQA 3IAQA 4JFSA 2PC8A 1WZMA 2VT0A 3BCDA 1M01A 3ZOAA 2W66A 4GI8A 5IFPA 1ECEA 5FIPA 4TX8A 2V5DA 3W26A 2J47A 1OIFA 1WO2A 1JF6A 3WD0A 1V02A 1RP8A 1J12A 3N15A 1JI1A 3PHAA 1UD2A 4PMZA 4A3YA 1R86A 2XFRA 1XD1A 1LG1A 4MDPA 4H8HA 3GM8A 2VQTA 3SCNA 4YPJA 2F2HA 4AZCA 1DWIM 1LL4A 4LX4A 3AZSA 2QPUA 1E9LA 1JZ5A 3KZSA 3AMDA 2VR5A 2Y5EA 2J7EA 4OKDA 1BPLB 5I77A 1MW0A 1G5AA 3VIHA 1WP6A 4BQ4A 5E6ZA 3A6OA 3L4XA 1R87A 2DSZA 1B2YA 4DUWA 4NI3A 3MUAA 3RILA 3WUGA 4OJYA 4TX6A 1UA3A 2GJXB 2WXDM 2ZUUA 1PIGA 1HKMA 1UZ4A 4EE9A 3PZUA 4CGTA 3ZT6A 2IXVA 3AXXA 3WF1A 3F4VA 3GNPA 4D6DA 4AYSA 2E3ZA 4ATWA 4F9DA 1K6AA 2FDMA 2J8FA 4UQDA 1Y7VA 1NM9A 3LPPA 1B1YA 4GZIA 5GQBA 2G3MA 3GZAA 1V6XA 3WNMA 1E4MM 3WH5A 2PF0A 1UR0A 2VC9A 3OLEA 4H04A 2ZUMA 5M3WA 2WHLA 3ARYA 4V28A 3PZNA 3N9KA 4AW7A 4P7OA 2VRJA 3DHPA 1H0IA 1CXLA 2ZXQA 2ZOXA 1GOOA 1WZAA 1V3MA 2OWXA 4GQRA 4TTGA 3WD4A 2HVMA 2YL6A 1HX0A 1J11A 1GPFA 2WMHA 2DH3A 2WMIA 1SMAA 5E09A 5EMYA 5FL1A 4ACZB 2XIIA 4JKKA 2J7HA 2GJRA 3BGAA 4MB1A 5BCAA 3PZTA 4U3AA 3OB8A 2E9LA 2E9BA 3AISA 2WB5A 3BAKA 4PN2A 4HMCA 1HJXA 1QBBA 2X1IA 1QI4A 1RP9A 1CWYA 1FP9A 1JXKA 3WSUA 2XJ7A 1V6WA 4MB4A 1OGGA 5A8NA 3BLKA 2BNJA 1WDSA 1E3XA 1JD7A 4WKHA 2HISA 2ZICA 4CN1A 1WZLA 1GOMA 1NQ6A 3THCA 4W89A 1OWQA 3OLDA 1FH8A 1Q6CA 3O6AA 2WNWA 1B3XA 2VX7A 2X2YA 4UQ9A 4U33A 4E4PA 7CGTA 3SUTA 2D0FA 5IHSA
chains in the Genus database with same CATH superfamily
4EX4A 3CU2A 4F0MA 4WOZA 5HPCA 1AQHA 4EVZA 4EWND 2YA0A 2YCLB 4L6DA 2Q71A 5KSWA 4H3DA 3W0KA 3Q58A 3HM7A 1T99A 4AZ7A 3VNZA 3RRXA 4C6IA 1DJQA 3L4VA 3FS2A 3PPHA 4ASTA 3K2GA 2PWVA 1ZPTA 2BODX 2QCDB 3PUEA 3M47A 4BHYA 3M64A 2OFJA 3P62A 3NG3A 3SGGA 4B5NA 2C1IA 4C60A 3HQOA 1IXNA 1TV3A 4L6OA 3GDLA 1EB3A 1QVBA 4S3GA 3BE7A 3DCPA 2DGAA 1DE5A 1XX1A 2D3LA 4HSNA 1KM3A 2V81A 3LBOA 2BASA 4DZIA 3SRHA 4GX8A 1O94A 1UH2A 3HZ3A 5LA1A 1JZ2A 3QGVA 1XIHA 5BYWA 2GVEA 3V16A 1SSGA 3KAOA 3NQCA 4UIOA 2XHYA 5DCEA 4YMZA 2CYGA 3NZPA 2REQB 2QJHA 2WOQA 3KTXA 3PBMA 2BOFX 5LA0A 1HVQA 2YDQA 1KFJA 1KV8A 1OZQA 2DZXA 4U28A 2WSYA 1UP2A 3B8VA 4OHQA 2E40A 3N2TA 1GVQA 1HGYA 3VUPA 3MBFA 4MLRA 4ML4A 5JQ9A 1DQUA 3L0KA 5AECA 2GQAA 2XYLA 1IZKA 4IQDA 2EJAA 1A4MA 4IG2A 1CB2A 3WF4A 1DWHM 3MT1A 4E4FA 3C2RA 4ADUA 1LTDA 5E9AA 3ATZA 5HUOA 5TF0A 5E5CA 5M5DA 4QAWA 4N4PA 4O8RA 2BVTA 1ZAHA 4B2DA 3HPFA 5LHFA 4IFRA 3HPZA 1W91A 4S39A 1WXYA 2FZ9A 2FPTA 1VJSA 4HJWA 3VIGA 3KOXA 3H2OA 2B31A 4AZBA 1VZWA 5D2VA 2I7GA 1XLCA 5C55A 3VNLA 1VB9A 2A0NA 2GYIA 4L65A 1JCYA 4C6NA 3BLIA 1RUSA 2DSKA 3IUIA 1ITXA 3GXPA 2OSXA 3BV7A 3LCIA 2TAAA 3HG3A 4O19A 2WMKA 3B9NA 1KR0A 3WQ5A 1NU5A 3MO4A 4NG3A 2C19A 2BGQA 1TZZA 3W24A 1MXDA 2C15A 4KH2A 1DWJM 4Q4PA 1J2WA 3UETA 1RBOB 3MHUA 3KVLA 3THUA 1FWBC 3T0DA 1SW3A 3U5UA 3E2QA 4H6KA 1K8CA 1LOQA 2YXOA 3QFWA 2I9EA 4L64A 3PSWA 3P81A 1TA3B 4UUIA 5I3GA 1W1ZA 3CPGA 3SB0A 3BLOA 3SN4A 3IACA 2PCQA 1TTQA 4KWOA 5E93A 3N3TA 4L9ZA 1AJZA 4TVDA 5D9OA 5TD4A 3ZR6A 3W7QA 4TV5A 3M1ZA 1YTDA 3LXBA 4FF7A 1ZU8A 4NAEA 4LBUA 3CMFA 5A2BA 2YZRA 4MG4A 4LUSB 5I79A 3OVPA 3F2DA 3L68A 2ACRA 5DRCA 1TQXA 4ROQA 5F1VA 3TTEA 2FH8A 1LBFA 4IPJA 3U4FA 3WDIA 1UBSA 4XZLX 1KCKA 1UQZA 1TRDA 4K1WA 4JDYA 1DQWA 3OGVA 1R8LA 2Y6ZA 3VGEA 1FWSA 2HCVA 4AWEA 4FF5A 3W1UA 4DPPA 2J88A 4EOUA 3F4DA 2YXXA 1CGXA 2CC0A 4AMAA 1FWWA 3GNDA 5J5RA 5DFAA 3W86A 2RFGA 1MMFA 3LTYA 2ZADA 1K9DA 2NQHA 3CQJA 2ZRZA 1MRQA 5F7UA 5CZJA 1YW1A 2P50A 3CTLA 2WNZA 4QSFA 2QJMA 5EGRA 5H2ZA 3EXSA 1XIMA 2E4TA 4JX6A 3UG5A 4A3RA 4NHVA 1IWPA 2GZXA 2G5WA 1KFWA 4DPQA 3EAUA 2BS9A 4UR9A 3MI2A 2UZ9A 4KS0A 3M0IA 4CCCA 3W2JA 3EDDA 2DEPA 2OX4A 3BCFA 4FNPA 4X60A 1EL3A 1AH3A 3W25A 1IEIA 4YNGA 2X8RA 1XYBA 4D8AA 1Z3NA 4NZFA 4PUJA 2PRHA 3ZXWA 3VPLA 3GNOA 1UMYA 3TTYA 2PPGA 3A4JA 3CIWA 1RQEA 2HWGA 2A3HA 1HJUA 1FWGC 1VAHA 1KWKA 1TWWA 3IS4A 1XBYA 1OB0A 2VRQA 5C6MA 3TOYA 4LAMA 3GC2A 4GXMA 3MJMA 3EYPA 1O1HA 2Z7KA 2OU4A 4HA3A 1POJA 1QWKA 2CZDA 4KW2A 3WKZA 1BYBA 3E5PA 3DI1A 3LK6A 1WKDA 4DJDA 1IGWA 3F4CA 1TE6A 1DKWA 2HMCA 3WK1A 2WNNA 1QI3A 3CASA 4UWMA 2P53A 3TJXA 1A53A 1VFMA 1WX0A 3M5XA 4O0KA 5L9FA 2VJXA 2XN1A 1HL9A 1UD5A 3MHFA 3EX3A 3MSRA 4CVUA 2JIWA 4K68A 3G1AA 1LL6A 2I5IA 2FGLA 7ENLA 5D2YA 1AUSL 5D37A 1OM0A 3PM6A 1JCLA 1UR1A 2QPSA 5I3IA 3AIEA 3WN6A 2XH4A 3H2EA 2D73A 3SN0A 1KNWA 3NDZA 1PSCA 3QZEA 4OTKA 2ZUWA 3BANA 3CQ0A 4GK8A 2J8GA 1UJQA 3W7KA 3C2YA 1MRAA 3LXCA 2ATMA 2A85A 1E6QM 1XC6A 2DP3A 4DAIA 4GQQA 3NSNA 1P0NA 3CXOA 3H23A 3DN5A 5DY3A 4XV0A 1YBQB 2OZ8A 1A5CA 3WFAA 4KEUA 4FB7A 5BXTA 2D24A 3G3MA 2FZDA 3WQFA 1R9XA 3EXTA 3TSMA 2NUYA 2E0PA 2PDPA 2X1TA 1YDNA 2F8QA 4EIVA 5CG0A 3GO2A 1K02A 4DWSD 1OT1A 4TMCA 3K4WA 5F2IA 1UR9A 3JZUA 1ZGDA 1E15A 2OB3A 3GZ3A 2J75A 2YA2A 2PTDA 1XM3A 2OT1A 1S2CA 3GUWA 1QUMA 2MUCA 1O6IA 4JFTA 4L4OA 4FXJA 5BRQA 2Y8VA 3G8EA 2XSBA 1UASA 2OQLA 3HQ1A 2CHNA 3SUVA 3W2NA 7PTDA 3BGJA 1WQ5A 2V2HA 3MZNA 3BC9A 4EANA 1UYQA 4OZOA 3PPGA 3UYCA 5I3JA 3IJ8A 4GKLA 4TV6A 3IV8A 3G0UA 2CPUA 1F8IA 1UHVA 4KRTA 2FDSA 3LHYA 1WOBA 4GGBA 2J74A 3GTHA 2GSEA 4QJ4B 3CPUA 5M1TA 5JU6A 5D2XA 3VDAA 3STGA 5GJPA 2WVTA 1FWCC 4F2BA 3GVWA 4UMAA 4HSOA 1P1XA 1KGXA 1B0IA 2A3CA 5A6LA 2VCAA 3MCMA 4WLCA 3NDOA 2GGEA 3O6CA 4UTFA 4PMYA 1NIUA 3U2OA 3LV5A 1V93A 1E5JA 2DORA 3NQMA 3QSRA 1JZ8A 3TQKA 3P8JA 4JICA 3C61A 2EJ1A 4XWUA 3U9IA 4C7DA 2R1LA 4DBEA 3W7MA 1O60A 2PLJA 4JFUA 1PUDA 4CU7A 1JPKA 3KTSA 4IIFA 1C93A 3N25A 2VX5A 1NELA 4PUKA 4NNCA 3AYTA 1AW2A 2VO5A 1XIJA 1JDEA 3WUFA 1MO0A 3APGA 2WMFA 3WLOA 1SO5A 1TJRA 1IZCA 1ZBVA 4NNBA 1OGBA 3TQPA 3EKZA 2D0GA 3GNRA 3RM4A 2WVVA 4B3ZA 2FJUB 3BK0A 3B40A 3H24A 4UMBA 3TTQA 4GUIA 2ZX9A 3A3XA 1FWAC 4US5A 2XGBA 1XV8A 1XPYA 4G1KA 4DN1A 4TOQA 3XISA 3S9ZA 1S3TC 4EACA 1GOQA 4IL0A 4WSKA 1EJVC 5D2WA 1EP1A 4H01A 5LHEA 1XYFA 4LVGA 3WH6A 1SO6A 4H41A 1J5SA 4EKJA 3A12A 2V2DA 4RZBA 3QV9A 1PE1A 4PRRA 4DI8A 4H6EA 3P0XA 1ZP3A 4RDZA 5T91A 1VP5A 1S2VA 1XIDA 3SCTA 3R12A 5CSRA 1E55A 1KXQA 2E67A 2R94A 3GXIA 1TCMA 4OV4A 2XIJA 3UWQA 5CAHA 3MPGA 3UD6A 4ZE5A 2TYSA 3AZRA 1BG9A 1JD9A 5H6HA 3M0YA 4PSPA 5FSEC 4REQB 2UY3A 2ZA2A 2VC7A 1FA2A 3WK2A 3HU7A 4GFSA 4D6JA 5KINA 1EGVA 1A5AA 3F4WA 4C6MA 1MI3A 1TJPA 8A3HA 3VU2A 5JVLA 1SW0A 1PCKA 1LWHA 4K8EA 1QR7A 3KWXA 4AZ6A 1UCWA 2G3JA 5G1YA 4N4QA 5I3DA 5A6JA 4BF7A 2EGZA 1GOXA 1QK2A 2WBGA 1E3ZA 1CGUA 3K5XA 4LUTB 1QBAA 3LZ3A 2ACUA 1VFFA 3GTXA 3CQHA 1UD4A 1OT2A 2EPMX 3W7OA 2Y4SA 2VCBA 1SU5A 3S2MA 4Q4MA 4F0SA 1TZ7A 4J5NA 2B0MA 4G6CA 5A94A 2YDRA 1QPNA 3ARUA 1CB7B 1OFBA 5IOBA 4ZENA 4N02A 1WXZA 3L5MA 4HYVA 3BDKA 2NWRA 2ADAA 2VD9A 3NURA 5G5IA 1LBLA 4C5ZA 1RQBA 2J66A 1TPC1 3SY1A 4PODA 3NOYA 1NFPA 3EDJA 4FP1A 2OWWA 4C7GA 1DIKA 2PFHA 1XCWA 1WBHA 2PDGA 2VENA 3LCGA 1Q6EA 1XI3A 4GIRA 4O15A 1Y5WA 3VOHA 3CM4A 4PC8A 2QIWA 3QR1A 1O5XA 2PDUA 3UJRA 6TIMA 1AD1A 4HHPA 3CUXA 1EXBA 3E5BA 3TW7A 3SCOA 4G7EA 4YLWA 1U2YA 2P8BA 2DQWA 1T8QA 2G8ZA 1TPWA 1EP3A 1JUEA 3OBKA 3ERPA 3B3DA 4V1YA 4WQ6A 1RVGA 2XH2A 1EX1A 4N0RA 4MZ8A 3UYIA 1YTEA 4RZ5A 4EF8A 3CAKA 1CEOA 4AYGA 4WGHA 1LM1A 4RNFA 1JZ4A 2CHOA 4U2ZA 4U10A 2FPYA 4CQ8A 4MUPA 5LKYA 3WQVA 4LBSA 4IG2B 3II1A 5CSSA 5LYRA 4HZMA 2VRKA 4ZE4A 3QW4B 3WJWA 3R4IA 5EBUA 4H8VA 5BRBA 4GUFA 2XWDA 4GWEA 3M0MA 2TODA 2JF6A 8TIMA 1E51A 3HG4A 5C2XA 2Z27A 2EAWA 4LSBA 1QAPA 3NPVA 4UTLA 3SRDA 1YKWA 4BZYA 3SI9A 4GIEA 4LNYA 5F2LA 4JN8A 1IT0A 3C5QA 2W4XA 3VCNA 4WDTA 2CBVA 3SJNA 5HMSA 5HQEA 2Y1HA 1FY6A 1I2RA 4I5UA 7A3HA 1LLOA 4J3SA 5HJYA 3EOSA 4A05A 2C79A 1MNSA 3RK8A 2LLEA 3ITTA 1D7KA 3NGJA 3VIMA 4CNPA 1XBXA 3G1DA 2W92A 4JTAA 1ISVA 1UPPA 1SR9A 1EJXC 2W5FA 5JBEA 1RAKA 3KL0A 3CT7A 4ZXOA 3QF0A 2FMNA 3PG8A 2BZNA 3GHTA 3CUJA 1N8WA 3SO7A 5GJMA 3WMCA 2ONEA 4XO6A 4TVCA 1W0MA 2WMGA 2BVYA 2HK1A 3N73A 3QOMA 2X1SA 4AHOA 2NWSA 1W1IE 4MAVA 3LMZA 1MYRA 1B3VA 4AUBA 1XRVA 2PODA 3LPOA 4NAEB 1VBGA 1PS9A 1KGWA 2Z2BA 3D0CA 3C0SA 2J7GA 4DO6A 1GVFA 1JCMP 1TREA 3KE0A 2Z0IA 3P7YA 4NRRA 2CCRA 4TR9A 4TIMA 4O0ZA 4S3KA 3T9PA 3BOLA 4NT0A 2Q8LA 3BQ5A 4DB7A 2QCFA 4YHGA 1W1TA 1JCXA 5FJRA 4KWUA 3U5YA 3OZOA 4HSHA 3E0FA 1PX3A 2WAGA 2XGZA 5BXRA 4AMCA 4P2VA 2G3FA 3L65A 4KF1A 2PDJA 3LZ5A 3D5HA 2O7QA 2V3DA 2YW3A 1S1RA 1MNZA 2OWCA 3TC3A 6A3HA 1UWQA 2C71A 1KV5A 4WJEA 5CXPA 4MFEA 4Q32A 3GG7A 2J9ZA 1JUBA 3VAVA 1P48A 1D9EA 3LNMA 3FYOA 3TC7A 3AS3A 2QCNA 3EOUA 1UD6A 3R10A 4KMQA 3MQTA 1AMYA 1TJ1A 3VM7A 4HNNA 5C5YA 2OMAA 3KWSA 3MS8A 5BWFA 3RGTA 1SZGA 2ZWYA 3G1HA 3LDVA 4TVUA 2YDSA 3LG3A 5K9CA 1KA9F 1YPIA 5K7JA 5CSUA 5C2GA 2A7PA 3ARWA 3VI2A 1VENA 2GWNA 1O68A 4K7VA 4D8LA 4GNKB 5F4SA 4KCTA 1UP3A 5C9XA 1HIZA 4U2YA 1VLWA 3OBEA 4GIYA 3OEXA 4NJIA 3WENA 4X2PA 3MZ2A 1PIFA 1XG4A 3F5JA 2WLYA 2GVGA 3QGAC 4GYPA 4Y8EA 2O4MA 3DERA 5JMUA 3LCHA 2QJNA 4MWAA 2INZA 4ICNA 1Q8AA 4E6MA 3JZEA 1DEDA 4FALA 1E4LA 2P1FA 1XYMA 3E38A 1J93A 3UCCA 4QEEA 5FEXA 5AYIA 1H1ZA 3QZ6A 2ZRYA 1S5VA 3U6WA 3AO0A 3H21A 4INFA 3AROA 2VGGA 4GNVA 4RV3A 4JTGA 4OGZA 3W01A 1X6UA 4JQ1A 3R0UA 3CMJA 4ZMGA 3UJEA 4O10A 4DELA 4KRZA 5LNSA 1G6CA 3BSMA 2YL9A 3EPOA 4XKMA 4G7FA 1NP0A 3SCWA 4I7UA 3UZJA 3R6IA 4J3XA 3KLKA 4CVWA 4GH3A 2QDGA 2Y70A 3AUOA 4HT3A 4ZSUA 1R2TA 3LSBA 4KESA 1MFUA 1HL2A 1UUMA 1W5QA 1QOQA 3GQYA 1XGDA 4ALDA 5DQPA 1YXYA 3WLQA 4JS3A 5I06A 2CZ5A 2B7PA 3WNLA 3R8GA 1EIXA 1X39A 3VIOA 3ZLHA 1GTEA 3VX0A 3W7DA 2X7WA 3OTRA 2JEPA 3MCNA 5K2ZA 4HCLA 2VGFA 3AI0A 3WZ0E 2QW5A 3W7GA 1XKYA 1XGZA 3S2NA 1BXBA 3RMJA 3EWYA 3KXQA 5TBOA 2QV4A 3WH8A 2PDBA 1AW1A 3T42A 5I2UA 4QCFA 3BTNA 3ZWTA 1LWJA 3S1VA 3WDHA 2IQ0A 1P6CA 3QHNA 3D47A 2XISA 1XSIA 4MLJA 4JYEA 2FH6A 3GD6A 4QDMA 1R7OA 3WQ8A 4EK7A 4YTUA 5GNXA 3FKKA 1EF2A 2G3NA 3O9NA 1LCOA 5A6MA 4QE4A 3GW3A 5ABEA 1NTHA 1FWTA 3NM1A 1IWAA 4UFHA 3W2LA 4MFDA 4NXKA 2JK2A 3AS1A 1Q6QA 3WELA 4DI9A 9CGTA 4OQVA 2R1PA 4QGCA 5HWNA 1HJWA 1GVIA 4V1XA 4FMVA 2OGYA 1IXOA 5CG7A 3TTOA 4LS2A 3ZVHA 3GX9A 1C8YA 4RDWA 4LNCA 4LY4A 1N2VA 5EL1A 1KBJA 3VABA 4Q8UA 3E74A 1Q66A 3SURA 2XH0A 2GVLA 1K70A 4ZQCA 2DPEA 5FOOA 1X7IA 4NASA 3NWRA 5FAGA 4A8LA 1QI5A 1GEHA 2VEPA 3B0XA 3QY6A 3EMCA 4J3WA 1X7FA 1KXHA 1XJBA 3EMQA 3P93A 4H19A 1M68A 3LM3A 3TROA 3U57A 1AQ0A 2HROA 1E6RA 3IJDA 3DHFA 5EMMA 3NZQA 2Q3RA 3B05A 2W79A 2RDWA 1JYNA 1RD6A 2ZX6A 5DEZA 2IQTA 1HJVA 3OGSA 4AWSA 1EOMA 2V5JA 2EQDA 4C6OA 1B9BA 3I6EA 1SPQA 3F5LA 3MUIA 5EA9A 3CUIA 4ILSA 5M17A 4OIFA 1EOKA 2V9DA 1W3TA 3CYJA 2CESA 2GVYA 1TR9A 1ZJHA 2BTMA 4HK6A 3STEA 1JF5A 3F03K 2B4GA 1OG6A 3TC6A 1SMDA 4D8ZA 4BR1A 3GUGA 4KQNA 3I3EA 1LF1A 1ISYA 3WLHA 3JR2A 1W37A 3PP7A 2J13A 4ZO7A 3TSDA 3KS5A 3KVKA 3ITVA 3ITOA 1Y8BA 3PZOA 5A6SA 1UR2A 4YHEA 4E8CA 2YX0A 4B9YA 2C18A 4FIRA 1Z8AA 1JPMA 3NEHA 1MZHA 3F4NA 3LHZA 1S2TA 2P88A 3OYXA 3HPXA 4AD3A 2ESCA 3MKCA 3PZVA 5A8PA 2CHRA 2OKOA 5AYYA 3VIFA 4OUEA 4NZ3A 3A24A 3U2ZA 3TKFA 3CS2A 4DJED 2J8TA 1VCGA 5EFFA 2WBKA 4ORMA 1ME9A 3GG0A 1O7AA 3NL3A 1UWTA 3QPZA 1XICA 3BJFA 1JEZA 4WF7A 4J3UA 1Q2RA 4XSLA 3GR8A 3MI3A 2AGKA 3G3DA 1Q8JA 2W62A 1FP8A 3CPRA 4GZEA 3RRAA 2UY4A 3QHMA 1R3SA 1HP4A 3H55A 4GQBA 1JIBA 4CEUC 3HIJA 5AYZA 2WLZA 4FLOA 1MUCA 4PTXA 2V3EA 2P3EA 1ADSA 4PRWA 2V82A 5DMNA 1BRLB 2H8ZA 3SY8A 1CLXA 3MUZ1 4JNMA 3ZJ8A 4Y96A 3FXYA 1DBTA 3HOJA 2AKZA 1XDJA 3BJSA 3ZT5A 3N2BA 3LD5A 1OJXA 3MP4A 1HP5A 1IXPA 2A7RA 4LC8A 2BY0A 2W9MA 1VFHA 1IEQA 1WZMA 4B5SA 1FWDC 4GI8A 1A5BA 4G7EB 3ZS4A 3PJXA 4WR3A 4DF1A 4YYFA 4PULA 1WXJA 1MZRA 4K3ZA 3PAOA 1JF6A 3G1SA 4LVBA 1RP8A 1J12A 4BI5A 2QVHA 1X96A 1JI1A 4XTIA 1VD6A 1E0UA 4PMZA 4FI4A 4IGNA 2ON3A 4O13A 3MB9A 1XFBA 1W5PA 2IKGA 2VQTA 3OVRA 4OUIA 1DWIM 3HGJA 4H6QA 1E9LA 4NNAA 4MYAA 3AMDA 3EWZA 2VR5A 1DV7A 4OKDA 3N29A 2OEJA 4QJ5B 2CFFA 2JKPA 1WP6A 1OK6A 3BLFA 1K77A 4GHRA 4MWAE 3H2CA 4GH1A 3UZYA 4NI3A 3MUAA 4DYEA 3U48A 4UTMA 4OJYA 4TX6A 1KBLA 4E2DA 2INFA 3S6OA 1GKQA 4PTNA 4EXQA 3CK5A 3ZT6A 1W8SA 3GNPA 4D6DA 4AYSA 3CHVA 2SFPA 4ZZ9A 2OEMA 4LH8A 4LU0A 1NM9A 3LPPA 2DU2A 3A13A 5HR7A 5CPOA 3ONCA 3WH5A 1UR0A 2NLIA 1HKVA 3KVMA 3HTWA 4AW7A 4P7OA 3DHPA 1H0IA 1CXLA 3MY9A 1C9DA 3A9IA 1F74A 1XLKA 1YDYA 3A5VA 1RK6A 3FDGA 3IVUA 2Q02A 1A5UA 2XIIA 5REQB 1ICSA 4NI8A 5F4XA 5G2IA 1AA1B 4MB1A 3PZTA 3H22A 4HMCA 5LIUX 3HGRA 1QBBA 4ROPA 1RP9A 4ZQNA 3H4GA 2Z1VA 1R38A 1CW2A 2OLSA 3WSUA 2XJ7A 3NQDA 2H90A 4N2YA 3TZNA 1OY0A 1JD7A 2HBXA 3B9OA 4WKHA 1H7PA 2HISA 3H2NA 1A0EA 2ZICA 1XLIA 3HG2A 1OWQA 4NYUA 3V36A 3W72A 3WJZA 4M7TA 3TXVA 3SUTA 3VOGA 2XN0A 3V7PA 4DVOA 5IHSA 3UG4A 2ZUTA 2HPMA 1AG1O 1E6XM 2C3ZA 1FDYA 4MVAA 4C6QA 2YL8A 4IQEA 1XH0A 3L23A 1FTXA 1N55A 2J7CA 3PUDA 3R79A 2DT2A 3VMPA 4JPGA 1SJCA 3C4UA 1I45A 4AU0A 2UV8G 2XVGA 2V3GA 3BSGA 3TXZA 1VJZA 1B3ZA 1TELA 2VFGA 3EX6A 3CQKA 4HK7A 1OF6A 4JX5A 2VOTA 1AL7A 3P80A 4KFOA 1Q7MA 4GMEA 3SEPA 1XIGA 3GNXA 2YOCA 3DUGA 2Z1SA 2ISSA 4LAOA 4AZHA 4YTRA 4WGXA 3KOWA 3NXFA 3NEVA 7REQA 1KM5A 2PSNA 2A6LA 3LS9A 3RO8A 3DFHA 4KCVA 1GORA 4RDYA 4A3UA 3TYBA 1PWLA 3BCJA 4LEFA 3LNPA 3TMQA 5KZMA 2CLKA 4S2CA 4U4MA 2XVNA 4QLKA 5C2CA 3KHDA 4IPPA 1GZGA 4X2RA 2E6DA 3ZLGA 3MCOA 3T81A 3UXIA 1KM4A 2IMRA 1LRNA 1U1HA 1MVYA 1CGYA 1XSKA 1TMHA 1JDAA 1E9ZB 4IPNB 3GE7A 2DT1A 3KLLA 4RCXA 1IIGA 1UZ1A 1TPUA 2GSJA 1RY8A 4QISA 2PWUA 4GXPA 2ASHA 2VZUA 3NSXA 4FO4A 2NVAA 1EDQA 2PWFA 3ARVA 4IIGA 3KCLA 2OJPA 4JTTA 4PUNA 5HQLA 4MWAB 1ZS2A 1K7XA 3KL5A 4RDVA 1BWVA 3L66A 2XVKA 1D2KA 4U31A 3O16A 1PB0A 5G2HA 2OZ0A 2BP1A 3I6RA 3L5AA 3QOKA 2DW7A 4WOQA 3NQ6A 4ONVA 5C54A 2I9UA 4HTBA 3BURA 4P8UA 1E1CA 2IPGA 4QDWA 1GCYA 5A1AA 1LBMA 1M04A 3USBA 2X41A 4Y9MA 6ALDA 1JVNA 2QAFA 1QNVA 2YIHA 2X42A 3WH9A 3AOFA 3M0KA 1CGVA 2VKZG 3IVTA 4EF9A 1YNQA 1F6YA 4MPKA 4JEQA 3VNIA 1HW6A 1FXQA 5HNNA 4H9MA 5CQ1A 1HFBA 1W3LA 1V3HA 1E71M 3I7SA 4DXKA 5G4HC 1QOXA 3DFNA 3XIMA 2C16A 4ML9A 3N4AA 3MMTA 3AIVA 1H60A 4FX6M 1FWEC 2A21A 3FDKA 3TW9A 1TPVA 2JFEX 2BLEA 2CKSA 3W70A 4NX5A 4WX2A 1E0VA 4Z2JA 4JIEA 1HN1A 3N6HA 4GVFA 4HHMA 4PMJA 4GRSA 2DUZA 1BLIA 4NJHA 1OCQA 4ATDA 1JL8A 8CGTA 1H49A 1KB3A 4GE8A 3DX5A 3UW6A 2NT1A 4PMOA 3D3FA 3M0XA 3V3WA 1E0WA 1UUOA 3BZGA 3I10A 4UOZA 4KCUA 2YGYA 1OADA 1EJUC 2OXNA 2WCAA 3RMEA 3M07A 5ABTA 1S3HA 5D8ZA 2VURA 2QJIA 3H2MA 3LY0A 3PZIA 2YB4A 3FN9A 2BY3A 3VILA 1EDGA 3CAQA 1GOKA 1J0HA 1US0A 1OX4A 3N4FA 1LRQA 3B03A 4E4UA 3H4WA 1OBAA 3UZ5A 1FFQA 4JYFA 3L4ZA 3LX9A 3FX4A 3NYZA 1LLZA 1WUEA 4JBRA 5D9PA 1UWSA 1I4NA 1WBJA 3O8AA 2J7FA 1NARA 4AWTA 4ATLA 2CWXA 3EX2A 3LUTA 1KFLA 3P3BA 2PAJA 2ZTJA 4R7WA 2ZXDA 2Z29A 2GJXA 4JNZA 4C1NA 2OYLA 4LS1A 3TONA 2GUYA 1PZ2A 2CBUA 3GNNA 4M5PA 3V75A 3PWGA 2C91A 1XRFA 1U1UA 4XZMX 3WEZA 3V5OA 3UZZA 3ZVHB 1W2PA 2GOKA 4JCMA 2PE4A 4O1CA 6PTDA 1G7UA 4UTUA 4I9MA 1KM6A 1Z89A 2D2GA 1A5KC 3TYDA 3TFCA 1V3JA 4YIWA 3ARZA 3MU7A 1HKJA 1ZALA 1OFQA 4BF9A 4JGDA 4XIMA 3QHOA 3EKGA 1CTNA 3WJXA 1VYPX 1GVSA 3FAXA 1SZEA 3B0YA 3BQ6A 2R8WA 2EEXA 3HMJG 4BI6A 2DZWA 2O4QA 4F66A 4GG9A 4Q7BA 3R58A 4PB3A 1UA7A 3GXDA 4P7RA 3KCOA 3NGFA 1JYWA 2DH2A 4XUGA 4UFIA 3K30A 4DX3A 1GJWA 1KCZA 2Z25A 4DWSA 1YLVA 4ZSTA 1MQQA 1VF8A 3IUHA 3DGRA 2ALDA 2HE8A 6CGTA 2VCCA 3L0NA 5DMMA 2AL2A 2YCLA 2XIOA 5FCZA 4C6JA 3BAIA 2IKHA 4C7FA 4W8BA 2EPOA 4DXXA 3EOOA 2DT3A 4ZQRA 4PZVA 4IFOA 5CCZA 2EKGA 5FJUA 3UFYA 4K1GA 1RH9A 2XGIA 1U30A 1JZ3A 4GX9A 2FHCA 3QZAA 4FNTA 2QAPA 3KRSA 2JKEA 4GXWA 3F2BA 2VZTA 3UWZA 4UTKA 2ZBTA 5FESA 1ZFJA 2OLHA 3CUFA 4AB4A 3O0KA 1F9CA 4A3QA 1PZ1A 3THQA 4J40A 3RM9A 3VYLA 2GFTA 3NQ2A 3GXTA 1QO2A 2VI0A 4L7ZA 4A8RA 4Y9OA 1AL8A 1FUYA 3SRFA 4PEKA 1RCQA 1UPMB 4KKXA 3VDCA 1Q85A 2PU0A 1S1PA 1DL3A 1JCTA 2GQ3A 4IICA 1YIXA 2C8NA 4U5IA 2VFEA 4JFVA 1A5NC 4PCNA 1N8FA 2FIQA 1HKIA 4ZBCA 1HL8A 2A5HA 3W7HA 1ZCOA 3QY8A 1NWUA 4RJEA 4QQ3A 3EXRA 1EFZA 3SCUA 1E9YB 3AHYA 3DFQA 4N9DA 2UY5A 1JPDX 3L21A 3GXNA 5DT5A 1QRQA 1SJAA 3A23A 3MKKA 3GDTA 1J01A 1ZB5A 5LSMA 1ZUAX 1YEYA 2E8ZA 2IW0A 4W87A 3K8MA 5A6BA 2FFIA 4LEQA 1XUUA 2ISWA 1T0OA 2J7DA 2XINA 3THAA 1TV4A 3MVTA 5I24A 1CCWB 2WZMA 4QEHA 3LTSA 4M29A 4XD5A 1P5BA 1NP2A 4B3KA 1AH0A 1F5ZA 2Q8XA 3L2IA 2VWSA 3FJNA 2A79A 1JQVA 3AIWA 4GC4A 4MADA 1L6SA 1JXJA 5E9XA 1BVNP 2CEQA 3CWHA 3VD3A 3URAA 1TMLA 1Q6DA 1MEIA 1F3XA 4FZIA 3AU2A 1SFLA 5FF2A 1ZBKA 3E2SA 1GVYA 3S5SA 3APYA 4CNTA 1NJJA 1W5OA 4MNLA 1JR1A 3M0JA 4L1XA 1K03A 4AH7A 1F07A 1C9WA 2FHBA 2H9AB 3W1MA 3RCNA 1VEMA 3FEQA 4HNCA 2WZTA 4IF2A 4D6CA 2NQJA 4K7YA 3KDNA 3T07A 2NZLA 2WNQA 4YU1A 5H8MA 4HOWA 2VX4A 2JIEA 1D3HA 1B3WA 2Y61A 3HV8A 5LNUA 1PO9A 1DVJA 3CAWA 4TTUA 3MWAA 4AC1X 2NW0A 4Q22A 3EPNA 3IJ7A 2CZVA 1J6PA 4J35A 4MUZA 2HQAA 1NVMA 2ATSA 3LM7A 2ICSA 4I8YA 2XM1A 3FAWA 1PKMA 2PDQA 4HHLA 1UR3M 2WJEA 1DQXA 2Y7FA 1UD8A 1BGAA 3ID7A 4ERIA 1JPIA 4BI7A 4E2BA 2ABAA 3V18A 3ELFA 4A2SA 5D03A 2P10A 1ZRQA 4BK9A 4DUVA 1WZKA 1AZ1A 5BW6A 5CKSA 1P0DA 4ERAA 3GH7A 2WVUA 5A5WA 5C7VA 1KKRA 3ABXA 4LUYA 4L5ZA 4MOZA 5JIWA 2FKPA 3M7SA 1C91A 3CO8A 4I6VA 5TNVA 3AAMA 3UT0A 1PKYA 4Z0SA 5CBJA 4AD2A 3AJ7A 3S9YA 2DSWA 4PE8A 4GVHA 4HPJA 4RLIA 4AIUA 1N82A 1PTDA 1W32A 1TPB1 2ZX7A 3CC1A 1J6OA 3T8QA 5EB8A 5AVHA 4J9JA 1AJ2A 3N2CA 3VOCA 4AVFA 2AMGA 3VFCA 5FF0A 4JTIA 3F5KA 3WIJA 3B9EA 3OQ8A 4RW5A 5D09A 4DBUA 1IWBA 1Z69A 3NDYA 3TYAA 3DI0A 1VFOA 4I9AA 1U1JA 2HVOA 3G24A 5K9XA 1FVPA 3MDWA 1Q4NX 2FFCA 3CQIA 1R9ZA 4BQ2A 3QC3A 2VUNA 1TX2A 1KW1A 2DJLA 4IUOA 5MHBA 1BFNA 3QGKC 4IGSA 2GDQA 1PX4A 1V6UA 3YPIA 3SSZA 5HNUA 4C6CA 3QN3A 1GQNA 3FY1A 4W7WA 1QNQA 1B31A 1E0TA 1M41A 3VGDA 1FFRA 4Z2IA 1WAUA 4IGMA 2I5GA 4B90A 4TO8A 1R7AA 2V2CA 2Z1XA 3G1VA 4WY0F 1SFTA 5BOOA 1YDOA 3KX6A 1A50A 4IIHA 1UC4A 1CXEA 2QDHA 2WZIA 4N9BA 2OG9A 5I5RA 5CAKA 1RJRA 7REQB 3WQ6A 3H6OA 4H9ZA 3SIMA 3M0ZA 5J5DA 2QULA 1JCNA 2V5KA 1VH7A 3DYMA 2GOUA 2ZFAA 4RKAA 5B7ZA 1CDGA 1ADDA 3S2LA 4IIEA 4QJ1A 4UTWA 3TE9A 2ZXAA 3ANYA 3KBSA 3T2OA 4UTTA 3SRKA 3FA3A 1GKRA 4G9PA 4R85A 3L7RA 1H1YA 5CGMA 5HUPA 4J27A 3GFZA 3W4RA 4XK2A 2E5CA 1PDZA 3ABZA 4PMXA 2OO0A 1KXTA 1I8JA 4UCFA 1EO5A 4AY7A 3DGBA 3N18A 3UWWA 3PN8A 5IBXC 1RXOB 4FR1A 1RVKA 4ZCWA 4Y90A 5U4NA 3UZXA 1HT6A 1LJYA 3K1GA 4JQ2A 4GINA 4KFNA 2WVSA 3P67A 2PP3A 3N14A 1IE7C 3BAYA 4ZGYA 1VPQA 1GVEA 4AXNA 2ZZ4A 3NCOA 5D30A 3UXKA 4S3JA 1SFJA 1SM9A 1W3HA 1G4TA 4JCLA 3OODA 3BG9A 2RGMA 3GTNA 3G1RA 1PTGA 3BOFA 3EEZA 1TVNA 3JW7A 3LB0A 1JUKA 5HR6A 4LS0A 3CUGA 1FBAA 3HQPA 4GY7A 3NJ3A 1TUFA 2QVNA 4O53A 2CLPA 3U3HA 2FHFA 3N13A 1EJSC 3F2CA 2YXGA 1U5JA 4QHRA 3Q67A 4DEFA 2PWDA 3ZR5A 2PDXA 5E0KA 1SJDA 2Y63A 1V02E 3I68A 4ACZA 1F05A 1QHOA 3NL2A 2Q01A 2ZCGA 1CENA 1FDZA 1GK8A 1LRTA 3UG3A 1SYTA 3PBGA 1E4IA 2I56A 4DO5A 3NZRA 4AVNA 3V5FA 3NFUA 2XN2A 1U83A 4HU0A 4B5UA 2XFYA 5DANA 2JKAA 2WCSA 1F2JA 1SSDA 1KQZA 2O7SA 3UNTA 7TAAA 1J0ZA 1J10A 1V3LA 5F1UA 1OCJA 4ZR8A 1O5QA 4Q8NA 2J62A 3TAOA 3QKZA 3E9AA 3BG3A 2J24A 2IPWA 3CL8A 2PF8A 5CLWA 2XH7A 1UC5A 4HNUA 1W3NA 5AC6A 1CECA 3VVGA 2O9OA 2ZRXA 1VPYA 1B9ZA 2X30A 4HGXA 5E0CA 3BMWA 3NPWA 3SM0A 4OBSA 3TNBA 1NDWA 3BJTA 1K9TA 4HHHA 2F6UA 1D8CA 3W2MA 1POKA 2AQWA 1NDVA 1J79A 3QJAA 3M6YA 1U5VA 1S2WA 3V0UA 1QPQA 3AS2A 4C6FA 4O1AA 5DO8A 3ZQ9A 3OLIA 4QG6A 1JYVA 1TO3A 3CTTA 1AMKA 3RF9A 3UQNA 4M80A 4NY2A 2F9RA 1OX4B 4DJFA 2QZRA 3KBMA 2OX1A 4C6KA 1W3KA 3SGUA 3ARQA 4AD4A 3L0GA 1P4CA 1DXIA 2WQDA 4GIAA 3S4TA 3HB9A 4XBSA 1ONXA 1K4HA 4NIRA 1GOIA 3VMOA 3CGTA 5E70A 2Q3OA 1E9IA 3S5ZA 2Y24A 1DWFM 1H51A 2DSVA 2OYMA 2V5LA 4XVEA 2ISVA 4C1NB 4Z2HA 3B06A 1DP0A 2Y2WA 4AX7A 1UH3A 2QPXA 3OYZA 1FRBA 3QEZA 2P3ZA 3B9DA 4Z1YA 3LU2A 4LRSA 2A1YA 2OQYA 4PYSA 3QQWA 4ERGA 3RJYA 5IFTA 3W02A 3WX7A 4GVIA 3VD5A 1DWAM 4GOAA 2CBJA 3GBDA 3K1DA 4QJ3B 1B4KA 4LW7A 4PEEA 3WLIA 2C0HA 2AQOA 1KTBA 3VIJA 4HMDA 3S5NA 3GVQA 2OELA 1ONRA 3EA1A 2DDXA 4X0VA 4B3LA 1QI2A 1KBBA 2XDFA 2PS2A 4REQA 4JEJA 4XG1A 4UNIA 2VXNA 4L9XA 5EY5A 1L6WA 2Z26A 4M6PA 2TPSA 3DHUA 5I78A 1VCFA 4WZHA 1G0CA 1GOWA 3H7UA 3PTQA 5KEZA 1WA3A 3U4AA 2FPVA 2KX9A 3TQVA 4QITA 1U33A 2OVLA 1I1XA 3NA8A 4UFLA 1W56A 3TLLA 1TCDA 4IX0A 3CJPA 4PL1A 3I65A 3EOEA 1E70M 3PFMA 4JTJA 4M1BA 4CKQA 1A47A 1ECQA 1PCWA 1V0NA 2CZEA 4LUTA 5FJTA 3R94A 1DTNA 2PDLA 1WNOA 2PTYA 3O6DA 4DWSB 5HANA 3GTFA 3RCYA 3TA6A 2Z4GA 3WL0A 1EHAA 4D1JA 2BY1A 3RLGA 4HU8A 3DKLA 3LLFA 4QIUA 3QYSA 1EH9A 4ZB5A 2AL2B 4UOQA 1HG3A 3H53A 3UY8A 3CV2A 1VBUA 2H3DA 3W7IA 4GFIA 1ITUA 4NXSA 1QI0A 2Y5JA 3NO5A 1GJPA 4JFWA 1T5AA 1VBHA 4IMFA 3TU9A 1OYBA 3RN6A 2WPBA 1P0BA 5KETA 2ZZ7A 1E0XA 4NUWA 5FEPA 3JU2A 3OG2A 3VD7A 2NT0A 2YR1A 4Q8TA 2YJQA 3BLLA 5FAJA 4B4HA 1Z9AA 3AU6A 2ZWZA 3LV6A 3FOKA 4RXFA 5E6YA 2X7VA 5K9DA 3EEGA 3RU8X 1GPWA 3DXIA 3CLMA 1OEPA 4W9TA 3A4XA 4AAJA 4IMEA 3N34A 2EPKX 1M9HA 1X8FA 1RY0A 4FNUA 2XZ9A 3E0WA 3VOFA 5LIWX 2OEKA 1LOLA 4XD6A 1G69A 5IDZA 3EMZA 2Z1WA 3DEQA 2KAUC 2XVPA 2OSWA 4ZTXA 1HJSA 4YYCA 4XZNX 5C9WA 3BOXA 4MJ2A 1GWJA 1GGOA 3AZTA 5H8UA 3APTA 1GQKA 3W88A 1FCBA 1OABA 3PJWA 4AVOA 4DY1A 2V6AA 1Q7QA 1OVDA 4UFMA 2Z2UA 4MZ1A 2Q09A 1KTNA 4HNTA 3UPMA 1GVRA 1EDTA 3SCSA 3AXMA 2I5QA 3SECA 1J0JA 4RX0A 2WCGA 3MDUA 3W6LA 2NUWA 1L6YA 1FHDA 4DM1A 3AYVA 4W8AA 2V8ZA 3QH2A 1KBIA 4FOJA 4R9XA 3DFYA 1E72M 1K3UA 4MB3A 4PMUA 4US5D 3WLKX 3UXDA 1TPFA 2Q8ZA 4GBDA 4Q8QA 2JQXA 4D1IA 4QCEA 3EB3A 4O1BA 5CLTA 4Z17A 4CU6A 2ZE3A 4K37A 4LWWA 2GJNA 1V6YA 4K36A 1A3WA 2VR2A 3N17A 1ZAIA 4CUCA 4X61A 4IMDA 3NR0A 4GA8A 5GJNA 1E6ZA 3S47A 4GD0A 3Q94A 3OLGA 3VZYA 4O57A 2E68A 2QLYA 4QFUA 4YVVA 1E4NA 3VA8A 2ZRVA 4D6GA 1GEQA 2YBTA 5HATA 2FTWA 1AODA 4HPNA 3UCDA 3CV6A 3CB8A 5FJPA 1PKLA 3CNYA 4QS5A 4IIDA 4NSBA 3TW6A 2ZVRA 4IIBA 4JL1A 5ABGA 4AIBA 5CBIA 5CEWA 2EPLX 2PDHA 2NX3A 4DJEA 1L8NA 1L2QA 1ESWA 3TN6A 4O8AA 3W74A 3ABQA 1MW3A 5JUVA 3RR4A 5CC3A 3T4CA 3FCPA 3MA8A 3W1NA 3L4UA 5A69A 4OE7A 4PFHA 1F4HA 3USZA 2WM1A 1EP2A 1QASA 4ORIA 4HOXA 4HNOA 4WUIA 2RKXA 3T05A 3LPGA 2PDYA 3GVRA 4L61A 1WDDA 2WQPA 1SQ7A 3U7BA 3WQWA 1NQKA 4S3FA 1R2SA 3PG9A 3R43A 2FVKA 2YL5A 4S2BA 4LAZA 3O1NA 3VIPA 4P5UA 3VKKA 3BW4A 5BXPA 1OFRA 2YSWA 4P7QA 2ZYFA 5A6TC 2BBFA 3W28A 5AZ0A 3ORWA 4K38A 4PB4A 4O1EA 1ITQA 4CD8A 3AIRA 3T2PA 5IHRA 4OT7A 1QWGA 4GISA 3N4EA 4HJFA 3A4AA 4AZIA 3GC4A 1R47A 3SCVA 5CC7A 3P8IA 5EMJA 1X1OA 3PAJA 2IKJA 2RDTA 1T40A 1X6LA 2PWGA 4MDOA 3PANA 3UXAA 4M51A 1L6GA 1DJYA 5G4WA 1RQHA 5LNVA 3M16A 4HCDA 3S2CA 4QNWA 2XTKA 3SADA 1T96A 3A3WA 1ZZMA 3TWBA 3PR2A 1O4UA 3IIOA 1M3UA 3TH6A 1ZTVA 2CKRA 1XYAA 1R5YA 1FHVA 5G2WA 1VS1A 1FWRA 3W73A 1G4EA 2XUCA 4F0HA 4ADTA 2X0YA 6ENLA 1NH6A 5A2CA 2PDIA 4JN7A 2VD8A 3GIPA 2DZBA 1A5LC 3CH0A 3C8NA 4X3ZA 1US2A 2D2OA 1UKTA 1V79A 3KOFA 2WW5A 1VHCA 3CZ8A 1KFKA 1W9XA 3WK0A 1RR2A 3RAOA 1EEPA 3WQPA 5AHFA 2ZQ0A 5CZKA 1IT8A 4RV8A 5FA5A 3VGHA 4HPGA 1C3FA 1MXGA 3H2FA 1XBVA 3UG8A 3VDBA 3P74A 1ONWA 4EPBC 1M53A 5G1MA 1A80A 5HMEA 1EEXA 1OX6A 3GU2A 3HV9A 2UBPC 1QJWA 1X1ZA 3W1XA 3CMGA 3O15A 4F8XA 3VC6A 3ITLA 1XL9A 3IAQA 2YYUA 1EF3A 4RPQA 1A0CA 2I17A 4YTTA 2W66A 1ECEA 4KEVA 4L80A 3TDFA 5AHIA 2V5DA 2EKCA 3W26A 4ZODA 3W87A 3PWIA 5AOUA 3N15A 1WDWA 2E28A 3G1XA 4A3YA 2DZPA 1UIOA 4WVXA 7XIMA 1LG1A 4MDPA 4MY1A 3SCNA 2JBMA 4AZCA 4BWLC 1LL4A 4FPSA 3KZSA 4UNLA 3G5EA 1R46A 1BPLB 3O0FA 4WEVX 5I77A 4LCRA 4WDUA 1BWKA 3P84A 3VIHA 4BF5A 4BQ4A 5E6ZA 5MF5A 3CL7A 3WUGA 1UA3A 2WXDM 1PIGA 4EE9A 4O17A 4CGTA 4XVDA 3F4VA 3R11A 2PGEA 2FDMA 1ICQA 3E96A 2J8FA 2HJPA 1B1YA 4CNSA 2G3MA 3MI6A 1V6XA 4R53A 3TYEA 1E4MM 2PF0A 3OLEA 4H04A 4AF0A 2ZUMA 3CYVA 4UR7A 3ARYA 4IOTA 2JGQA 4H9VA 1LP6A 1EBHA 5KZDA 2VRJA 4CCZA 2ZOXA 3QV8A 5AYXA 4XZHA 4GCAA 1JPHA 3PB0A 2HVMA 3W7PA 2YL6A 4HYWA 2WMHA 3GK0A 5DELA 2DH3A 3IGXA 3QY7A 5C9ZA 5E09A 5FL1A 4ACZB 4JKKA 5D05A 1FWJC 1CI1A 3LLXA 1I6NA 2HTMA 1IYXA 2WB5A 1NAL1 4PN2A 3WQOA 1HJXA 1QI4A 1W31A 4LUJA 5EMUA 2XZ7A 4LF1A 4KBXA 1GVOA 1V6WA 3H2AA 3EX1A 2BNJA 3KRUA 2F84A 1E3XA 5HNRA 3DBPA 4UNKA 1ZLPA 3EZ4A 4CN1A 1OQFA 1XC4A 1NQ6A 4PB5A 4W89A 1FH8A 2WNWA 4BJHA 4WDWA 4U33A 3TR2A 4E4PA 7CGTA 2FVMA 1PPIA 1TWIA 4C90A 1Q13A 3NVTA 1AZ2A 1OCNA 4E38A 1UKQA 3UF9A 1W3IA 1W9VA 4HMEA 3OVGA 1QT1A 2NV9A 2PP1A 3D46A 3V5CA 3VE9A 2PURA 3NOEA 1TE1A 4EAMA 3T78A 4KEZA 5HWMA 1A49A 3EGJA 1IQ8A 3IEBA 4H9UA 4M0XA 4Q7IA 1YE6A 1CXFA 5J8LA 4CQBA 2INEA 1Y0EA 1OINA 4LCQA 1EHNA 3FA5A 4OFCA 1S46A 4P7LA 4TMBA 5DCDA 1FWIC 1GG1A 5D04C 1OD0A 3DU0A 6REQA 1CZ1A 3GXMA 2E5DA 4LYPA 2O9TA 1XLFA 4XO7A 4O4WA 3G1FA 3MUY1 3WUEA 2Z1KA 1TVLA 3WD2A 1BF6A 4GVGA 1AJ0A 2X1UA 3WQGA 4W8LA 3WCZA 1XGEA 1Q2SA 3T2QA 1XBZA 4IL2A 3PZQA 1DJXA 1A5MC 2VP8A 3BZJA 4J1OA 1DJZA 3OU8A 4G8TA 5FD0A 4MJ4A 5LIXX 3B4YA 1M7PA 2C0AA 5JBFA 2JALA 3Q65A 2DZAA 3FHQA 3LRLA 4G5DA 5GNYA 1TTJA 2MANA 3IK4A 1B90A 2IQDA 1DTUA 1VRDA 3AIBA 1JZ7A 3RPMA 4X0NA 2NLYA 2VEMA 4JIIX 2OOGA 1XQKA 2R1NA 3E12A 2W27A 1E43A 1CYGA 4HKPA 3BL3A 5IXEA 4GO8A 5AC5A 4UZSA 1RHCA 3URQA 2V0TA 3FFSA 5EKYA 1DJWA 2WC3A 3BH4A 1KC7A 3CT2A 1WPCA 3K8KA 3BARA 3IIPA 4XKYA 3WQDA 4MIMA 2QUUA 3EWCA 1Q65A 3FIGA 3ATYA 3ARPA 5AHEA 4BWLA 2OQHA 3DFOA 4UFKA 2KZHA 3HF3A 5T9CE 2WKGA 3I4EA 2RHGA 2VZOA 1W9PA 1HJQA 3PNZA 4BCEA 3NXLA 4D9PA 4RXGA 1GNXA 1TG7A 4BY3A 2HS8A 3LCFA 1TYGA 2QYGA 3CZKA 3KEHA 1W17A 1ELSA 3PZ9A 3GW0A 3OIHA 4PTDA 3VKJA 1VYRA 3WJYA 4M3PA 1CGTA 3MWCA 1KRCC 3AXIA 1HKKA 1YQ2A 1SZNA 2Y8UA 5D32A 5CGQA 3V0SA 4GJIA 3ZFHA 4LANA 4NL1A 2BXZA 1C8QA 3C8FA 4S3DA 4YJ5A 3UR2A 4D6HA 1BRLA 1TQJA 3LGGA 2GVJA 4Q4RA 2IKIA 1VIWA 3BUVA 2WSQA 2FB2A 3H4XA 3IGSA 1KRAC 3UY7A 4B5TA 2DUXA 4CNNA 4XTDA 2PBOA 2ZTKA 2VELA 3CWOX 2YYTA 2QMJA 1Y5VA 4DQWA 1YXCA 3LQGA 2A3BA 3O07A 2FZNA 2WKLA 2OYKA 3LCWA 4R7OA 1QU4A 1TZ9A 2HSAA 4LALA 1DORA 2G3IA 3ZSTA 1BXNA 1CXHA 1KWGA 3IPWA 3C6CA 3PTKA 4LC6A 2YLAA 4ZOBA 2CIPA 5BMXA 4HP5A 4MMWA 3ITYA 3SQSA 1DIDA 2ANUA 1GQJA 2A4AA 4CLMA 2QDEA 4K39A 5BOEA 3CWNA 2JGYA 4A21A 1GKPA 3I6TA 1BSIA 8XIMA 1JI2A 5DMLA 3WJSA 1XP3A 2ZA1A 4UOJA 2DIJA 3P61A 4KGLA 3MBDA 3EDEA 2E5BA 1FH9A 4GO9A 1XDMA 5K3VA 5A95A 4DZ5A 3CHFA 4Z1BA 3T0BA 1KCLA 2EPNA 4X9YA 3WLNA 3OOQA 4CQAA 1RZMA 4R88A 4F0KA 3R0DA 2BOEX 3O2LA 1WV2A 1GJUA 5GPRA 4HIBA 4CEXC 4QS6A 1FHUA 2G97A 3NQGA 4NZ1A 3MMDA 1KGUA 4ZOCA 2QCHA 4AD5A 5REQA 4WSJA 4OBRA 3WBXA 4CN6A 3AIUA 2X2GA 2ZE0A 3LRKA 4QG9A 3KOYA 1GTHA 4QLLA 3BLPX 3OA3A 3VK5A 1JRCA 4FA3A 4AY1A 3W1RA 1NFGA 2ZDSA 4O18A 4ECLA 2XU2A 4MY8A 1J96A 1IR2A 2VFFA 2ZIDA 3UNDA 3GU9A 3P5YA 1PYMA 1F61A 6TAAA 3MW7A 4UR8A 2QDDA 2OKTA 4MHBA 4LCSA 4OWGA 5U7SA 1R85A 3FJ4A 2DIEA 2PWEA 2HK0A 1GYMA 2NQ9A 3H7RA 1HXJA 2ZX5A 3W2UA 3KDOA 3HA1A 1US3A 1T41A 4EWJA 5HQMA 3OA5A 4KWWA 4XAGA 2HDJA 3GAYA 4FXSA 3S3GA 1FKXA 2G41A 1R3TA 2B7QA 4FS9A 1ADOA 2GGHA 2P8CA 3LTPA 3VMNA 5T9BG 3RX3A 1BG4A 4DUOA 1XIIA 4Z1DA 5D02A 3T0AA 2QUNA 1PKNA 2AOSA 3SCRA 5A8QA 5DX7A 3CHDA 1BQGA 4AEFA 1DXEA 3AHZA 2IUZA 3NQAA 3GIYA 5EMKA 3V0TA 1ALDA 1H7RA 3R5EA 1JQXA 4QROA 4GCXA 3UPWA 5CZSA 5CBBA 3OZYA 2D0HA 3GFXA 4EAYA 1KM2A 1TWZA 4ACYA 2WC7A 2XM2A 2VTFA 3RX4A 2V3FA 3NPXA 5C9UA 1V7AA 2QCGA 1W3JA 4KWVA 5BRPA 4XD4A 3E2RA 1QATA 4UTJA 4ZB0A 1KTCA 2NV2A 3LCLA 3DAQA 5DCBA 1YHTA 3O05A 3GKAA 1XIEA 4Y9AA 4UZUA 1YX1A 2AQVA 4R7JA 2ZC8A 5EFDA 3OJGA 4DHGA 5IDIA 4KEMA 1OG0A 1J2BA 3TOPA 2EG6A 1IGSA 2PDMA 1MQPA 1FHLA 2OT0A 3VX1A 2C7FA 1PV8A 4YTQA 1XRSA 2BV9A 2NSOA 1FCVA 1XINA 1D3CA 1OX5A 3PUGA 4FOUA 1M7XA 3AXHA 1M65A 3VGFA 4E8DA 2A7NA 4GABA 3C2EA 3M0HA 2Y89A 3AWOA 3UWUA 3L2LA 4Q4OA 3S9IA 3W83A 3TJIA 4IPIA 3J7HA 1D8WA 2CU0A 3T55A 1D3GA 3RLVA 4E2OA 2Y8KA 3UWVA 2OR2A 2QXWA 3FYPA 3H8AA 4XZWA 4AEOA 3N2MA 1UOZA 1XQLA 2RAGA 4S3BA 2QKFA 5AHLA 1H0GA 3TUUA 2NX9A 4IJRA 2ZUVA 4CD5A 1BHGA 3DYPA 2GK1B 4PUWA 4ENLA 3VC5A 5HAOA 3TSBA 1EC8A 4TQTA 2Y0FA 4PMDA 1ZJIA 3U7VA 5ABFA 3ITGA 3HO8A 5CPTA 5XINA 3NSMA 1CLKA 4ZL1A 3W1PA 2PGFA 4PCTA 4LBRA 4ZB2A 2BB0A 2YZ5A 3ZM8A 3U2EA 1QPOA 4O11A 1UOKA 2C1GA 3UVAA 2PRLA 3DIPA 2ACSA 1YNPA 4C6PA 3C3UA 1MDRA 3BG5A 5LXEA 4AZCB 4AY8A 4JZ5A 1DOSA 2JE8A 2J4GA 3VNJA 3WLPA 1VPXA 4KIEA 5CJMA 4AZGA 1UR8A 2PDWA 3QR3A 2CLHA 1K8ZA 1TIMA 5FF3A 3U8GA 5SWUA 2TRSA 3OO2A 4XBKA 5FF4A 3E02A 2X40A 2FZMA 3B97A 3NM3A 8XIAA 4KPLA 2PZ0A 4O16A 5I03A 1Z7AA 4JNYA 3C52A 2WJDA 1X1NA 5FKYA 1ZHAA 2OCZA 4UB9A 5FI8A 1OZMA 4LB4A 4QR6A 1EQPA 4POCA 4DJDC 4IH3A 3RU6A 4AF0B 1EYEA 3HPSA 2GGIA 4YCPA 1W1B1 1AQMA 1TPEA 2BHUA 4WXYA 3UVIA 4MAZA 3VE7A 2HNHA 3L9CA 1QK0A 1P1MA 1LT8A 2PLKA 5C71A 1S39A 1BXCA 3QSTA 3PJTA 4LXFA 1UWAA 3PNUA 3TQ0A 1C92A 3AHTA 3PC0A 3PPCA 1OFAA 1NOUA 3JVAA 1BSLA 1XXXA 4FR6A 4PA8A 3VKBA 3TNOA 1ZBWA 2YFOA 5I09A 3DC8A 4HA1A 3S1GA 1TPDA 3SSJA 4Y2WA 5HMFA 3O06A 4YS1A 4GJ1A 5E0FA 2IPJA 4O52A 1K8YA 1CX9A 2ABBA 3SFWA 1NDYA 2QIIA 5A3HA 3HQNA 3NQ7A 4XZ9A 2VQUA 5G1TA 3WMBA 4JIQA 3BAWA 3E0LA 4N6FA 4OOZA 3R0KA 1SR0A 1ISWA 4V2XA 2R1KA 2YBUA 2ZZ6A 1TIWA 3WMSA 3QV6A 4N9EA 5FJJA 4XD3A 4IQJA 4QSHA 1F8MA 3P82A 3AALA 4MKSA 3RIKA 1DXFA 1XYCA 4FLSA 1OSEA 5KTLA 5AN7A 3S46A 1PHWA 2V5CA 3FYYA 2XPKA 1VHNA 5XIMA 1ZENA 2R91A 1ITCA 1TVPA 3KBWA 1Z48A 4LAUA 6REQB 1KRBC 3ZYZA 3WL1A 2PTWA 3R2GA 1L6FA 4V33A 1GG0A 4U5KA 3N6QA 4JTQA 2D69A 4WDXA 3W07A 2XSXA 4EPDC 2VVSA 2FYMA 3SQLA 1L2UA 1CIUA 3IARA 1W1PA 4NJKA 5HXMA 2HXTA 3A47A 2J78A 1LYXA 1TUXA 2WANA 1Q4WA 3HFYA 4A29A 4F9JA 3CUHA 5L6UA 4MJZA 3LSCA 4ZO9A 4YWSA 4MYXA 3TVAA 4NU7A 2E7FA 4XUYA 4Q8VA 2H6RA 4K8HA 1BGGA 4LV4A 1XYLA 2PC4A 5GNZA 4W5UA 3LRMA 2BXYA 1XH1A 3PBUA 3G2GA 3GFYA 4QTGA 2NXHA 4GI4A 3WQCA 3L4WA 5C8BB 3CAVA 3VGGA 3K4DA 4XKYB 2ODOA 1CPUA 1C8XA 3TYCA 3BXWA 5AYBA 3KRBA 1UWIA 1EGZA 4ICCX 3L4YA 4DBSA 3WLLA 4IMCA 3VGBA 2D1ZA 1R0MA 3EDKA 5DLCA 1BQCA 3WD3A 3AXKA 1BD0A 1XH2A 1AD4A 2C1HA 5AZ1A 1KM0A 1PAMA 2VEFA 4AIEA 3Q45A 3AYSA 3A9BA 1J0KA 1W1YA 1XCXA 2B81A 3RCMA 3ME3A 3EWXA 4UQAA 3W53A 2YLLA 2ZXBA 1XD0A 4RNIA 2VEKA 4AC7C 4WIWA 3K4AA 1FWNA 2DVXA 2JEQA 3W85A 4XISA<