1H2JA

Endoglucanase cel5a in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-cellobioside at 1.15 a resolution
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
300
structure length
300
Chain Sequence
b'SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE 5A
publication title Direct Experimental Observation of the Hydrogen-Bonding Network of a Glycosidase Along its Reaction Coordinate Revealed by Atomic Resolution Analyses of Endoglucanase Cel5A
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 123
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1h2jA00
2NT0A 1C92A 4D72A 1JGIA 4WJXA 4IM4A 1TA3A 2EPOA 2YA2A 1SMAA 1JYNA 1JFXA 1OWQA 5A8OA 1XHGA 1MQRA 2DT3A 3EMZA 1JF6A 4UFJA 2D24A 3IK2A 1W91A 1E6RA 4QLLA 1O6IA 1M53A 3F5KA 4MB3A 5GPRA 5DMYA 1US2A 3N1AA 1BFNA 1D3CA 3AIBA 4JHZA 4WKAA 2ZXBA 5CLTA 4PUEA 3ZJ8A 5FL1A 3GNRA 3W4RA 4CN1A 4DUWA 5I6SA 3VO0A 1CDGA 3VMNA 1MFVA 1YHTA 1GUVA 4PCTA 3NDZA 1E0WA 1RP8A 5A6BA 4QLKA 2J4GA 4XZWA 4GIAA 4X0NA 3KE0A 2VQTA 1EOKA 3B9DA 4W86A 2V3FA 1VAHA 3KL0A 3L4UA 4H8UA 4K68A 3DC0A 4HOZA 2GJXB 2WCAA 3CMGA 2BHUA 5M3WA 5FCZA 4D1IA 1HL8A 1G0CA 1W1YA 2A3HA 4Z2IA 1TUXA 5CSUA 3AZSA 3THDA 3GXDA 4AXNA 3AMCA 4FLOA 2Z1KA 2J8FA 2BVTA 4TOQA 1TFVA 4QCFA 4TUFA 2EJ1A 4YHEA 3SUSA 4C7FA 4N0RA 4MB5A 1H0GA 3NDYA 3WH8A 2JEQA 2YLAA 4PTWA 3G6LA 4Z2LA 1BG4A 1EO5A 1MW0A 3WH5A 3VIPA 2WXDM 4CD6A 4PTMA 1PZ2A 3BCFA 2ZX6A 2J74A 1DWIM 4AIOA 1C7SA 4HU0A 5CPTA 1Z32X 2PWEA 1ZL1A 4XZBA 1X1NA 1UWIA 4W84A 1V3HA 2J7GA 1JD7A 3T2QA 3VDAA 2AMGA 1HVQA 1ZBKA 4GI6A 2FGLA 1DTUA 1C3FA 3AI0A 1TCMA 3WD2A 3WF2A 2VRQA 1AQMA 2BHZA 3AXIA 4W8BA 4F79A 1KR1A 5JIPA 2VRJA 5I79A 3AIWA 1KCLA 1WKYA 3RIKA 5KZ6A 4GQRA 1LF1A 1KFWA 4YPJA 3U7BA 1ZBWA 3T08A 3OLDA 8A3HA 3RO8A 5A8NA 3VD4A 2PWDA 1UR4A 2BVYA 2EPMX 4GO8A 3EYPA 5CGMA 3OGRA 2XVNA 4M8UA 2GDVA 1HXJA 4W7WA 2J8GA 4RE2A 4MB4A 3KZSA 3CZLA 4YN5A 4UFKA 3W6LA 2VUYA 4JZ5A 4CKQA 4E8CA 3AOFA 5A1AA 3MV01 1W32A 5KEZA 2GJRA 4HP5A 4MADA 2YA1A 3DYOA 3BAJA 4AYSA 4H04A 2XM2A 2JFEX 1CECA 2J78A 3AHXA 1CBGA 2DPEA 3W24A 2XUCA 1CXHA 5A6SA 4QDMA 4CD5A 3OG2A 3WQ5A 1UD8A 4ZE4A 3BMVA 2VX6A 3WDPP 2CHOA 3K1DA 3PZUA 3WNOA 2XTKA 4R27A 1EIBA 3AIEA 4TVDA 2A3CA 3CUGA 1UOKA 4BF7A 1GQIA 4P8XA 3FNDA 1U30A 2BVDA 2G3IA 2VCCA 3RM4A 3SCVA 1QNRA 3SCTA 3GTNA 4ML4A 5I5RA 3EDFA 1UUQA 1Y7VA 1CYGA 2CPUA 3NIYA 3SUVA 1W9XA 3WF3A 2D1ZA 3SCRA 4FF5A 1HKMA 1NOUA 2J7EA 4PUDA 2WBKA 3CHEA 3CUHA 5CZKA 4JFSA 3PHAA 4A3YA 2WZEA 2PI6A 2W5FA 2Y4SA 1BG9A 2BY0A 3FXYA 2PWGA 4UQDA 1B31A 1WDQA 4S3KA 2XPKA 1JYVA 1NQ6A 5CPSA 2XYLA 1L8NA 3VNZA 1VB9A 2XVKA 3AS3A 1KBBA 3OZPA 4QCEA 1QPKA 2X09A 1SMDA 3CZ8A 5CJ5A 2WPGA 3MS8A 5E6YA 5AYBA 4EE9A 4M1RA 4PSRA 5C71A 1EDGA 4WK9A 1W1VA 1H5VA 2CKRA 4GZIA 2JALA 2WZIA 1XCWA 3EMCA 3MU7A 2VZOA 3AHYA 3ZSTA 4UFIA 1A47A 2YBTA 2XGBA 3AS2A 1VJZA 3ZT7A 4HA4A 1CGVA 3AIUA 5JBEA 2AAAA 5A95A 1MQPA 4B3LA 4H8HA 3A6OA 4AD2A 1LWJA 1DWJM 1H0IA 1VEPA 4CCDA 4Q7NA 3ARYA 2XJ7A 3W53A 1QBAA 2WVTA 1W9BM 2Y5EA 2VR4A 3WL0A 1E5NA 1HJSA 1UH3A 1UR1A 1E6QM 1J9YA 4LYPA 3OB8A 3CLWA 2Z1SA 3FHQA 1M03A 2ZX5A 2O92A 2D2OA 1TVNA 3PZNA 1JYXA 2VTFA 3RM9A 3CZEA 2CETA 1IZJA 4AD1A 4HA3A 3F5LA 1LLOA 4NF7A 3BLKA 1HF6A 3PBGA 1QBBA 1W3KA 2D0FA 2BY1A 2XWDA 1HN1A 3MUY1 2J7BA 1W1TA 1E6NA 3I3BA 3WY1A 2VZSA 1R86A 4AZHA 4DM1A 1UZ4A 1UWSA 1ECEA 3FN9A 4UQBA 1HJXA 4PMDA 2VVSA 3ZIZA 4D6EA 1GONA 3N9KA 3I3DA 1DWAM 3ARSA 1KXVA 4W88A 2VQUA 3ARXA 4W87A 2GSJA 1PIFA 3IJ7A 1HL9A 2W91A 1OGBA 5FOOA 4CN4A 2RGMA 1B3WA 3VIJA 4MAVA 5LA1A 1UD6A 4W5ZA 1BYAA 3IJ9A 3QHMA 3DHPA 1NP0A 2WHJA 3O2LA 5IFPA 3WQ6A 1H3GA 4ATLA 3PZOA 2QHAA 4AY1A 1UD3A 5M03A 4KGLA 2G3JA 2EO7A 4FK9A 4BQ2A 2XVLA 2XFYA 4ZE5A 3AIQA 4NZCA 3ARQA 3WF1A 4CGTA 1KGXA 1BGGA 3UCQA 2WB5A 5A8PA 3VIMA 1HJVA 3ARRA 3BAIA 1VFFA 1WPCA 1RH9A 2DSZA 2QMKA 3ZSSA 2EPNA 1CGTA 2ZOXA 1KXHA 3WFLA 1I1XA 3VM7A 1GQKA 1JZ4A 1R8LA 5I0DA 1HX0A 4M82A 2D0GA 2DH3A 4H41A 2PC8A 2CXGA 2WLZA 3ZM8A 2V5CA 2F61A 1MXDA 2WMHA 3W25A 2NSXA 5GNZA 1E6SM 5I78A 1KBKA 4TVCA 1H2JA 2CBIA 2XGIA 4GINA 2D20A 2DT2A 3A4XA 5A2BA 1E40A 1QHPA 2ZXQA 4OOZA 2VL4A 2E8YA 1V6UA 1BPLB 1F4AA 1UR2A 3BH4A 2WWCA 5JIWA 2ZX9A 4P7LA 1GCYA 1V0KA 1FH8A 4PMXA 4QFUA 3WF4A 2D22A 3DYPA 2O9RA 5A6MA 2YDRA 4PBGA 5ABFA 1CWYA 1HKJA 2G8ZA 1V6YA 4PMRA 1NWSA 1FH9A 3KWXA 3HJEA 4UCFA 3K4DA 3MUAA 3OLEA 4RL3A 3WD4A 4HPGA 1DWFM 2Q8XA 3K46A 4UZSA 3WEOA 4UQCA 1C91A 5E70A 1XSJA 1E71M 4CCEA 1NARA 1WZLA 4AIUA 2VX5A 2XFFA 1IZKA 1GJWA 5CXPA 1J0HA 3OZOA 7CGTA 5LYRA 2WVUA 2FHCA 1Q4NX 3BCDA 3J7HA 1BHGA 4Z2GA 1IV8A 3GDBA 1BQCA 3QHNA 3K8LA 1GJUA 4JFVA 5CLWA 5A2CA 3O9NA 5I23A 3M7SA 3MSGA 2X0YA 3W82A 3WF0A 3NSNA 1CEOA 3AMDA 2X1IA 1UKPA 3WD1A 1GORA 3MO4A 1CXLA 1QW8A 2WLYA 5FL0A 1EGZA 3VGHA 4WSJA 3HU7A 3CTTA 4GI9A 1PJ9A 4AEEA 3MSDA 2BXZA 3CBWA 1TVPA 3HN3A 2ZX7A 3AHZA 2VX4A 3F5JA 3SIMA 1ZU8A 1UHVA 3S6TA 2RGLA 1V3IA 3GBEA 4HZ6A 1V3JA 4OOUA 1WZAA 4BA0A 1JDCA 4TXEA 2EBNA 1I75A 3CUFA 1BVZA 1E5JA 3VDHA 3VINA 4GI8A 1KGUA 3UETA 1WAWA 2CBJA 3ZJ7A 1ISZA 2AOSA 2Y2WA 3OBAA 3AS0A 2J75A 4P7RA 3PZQA 3QR3A 1JI1A 1FH7A 5D9MA 4HPHA 1XV8A 2JE8A 2G3NA 4HMDA 4AZCA 1R87A 3GXFA 3NUKA 4AZGA 3K4AA 4MNJA 4DWSC 2G41A 1VENA 1PAMA 2G3MA 2NT1A 1JI2A 4CD8A 3HMCA 2F8QA 4KMQA 2BV9A 3RPMA 2JIWA 2JF6A 3WKZA 1V3MA 1E6ZA 4P7NA 3NJ3A 3GYCA 1OGSA 4DWSD 3W26A 4LXFA 1B2YA 1MFUA 3VIOA 2VRKA 4L4PA 1DWGM 2VZVA 4EKJA 2EPKX 1H09A 5A6KA 2UY5A 3PZ9A 1HJUA 1C8XA 1PIGA 3PZVA 5M17A 4JKMA 5BXTA 3CZKA 4RE3A 4DUXA 4LQ1A 1EQPA 3SUTA 2E40A 2E9MA 2YJQA 3ARTA 5BCAA 2WMIA 3IJ8A 3CMJA 4URIA 4U5IA 1U2YA 1B90A 3MV11 4ACZA 3WSUA 5ABFB 4GQQA 3N18A 2ZX8A 1HP4A 3AXHA 3B8SA 4HMCA 3GH4A 4PSPA 1F4HA 4OUEA 5EFDA 2D3LA 1LL6A 4XX6A 3WDRA 1W9VA 3KEHA 4U3AA 1TMQA 4JCMA 4P8VA 1CGWA 2GJPA 1UWTA 3BAYA 4EANA 1UH4A 4NI3A 3WQVA 1GOKA 3VIFA 3U5UA 3VUPA 2GK1A 2FDMA 1JAEA 2W66A 4W7UA 4W89A 4KH2A 1UD4A 1U33A 1BAGA 4KRTA 2VMFA 4GPNA 3VIGA 4AIEA 2WHKA 4B9ZA 2WYSA 2BY2A 1LQ0A 5HPOA 3UEQA 2YL8A 2OWCA 2CKSA 3MMDA 3OIHA 1ITXA 2EEXA 3M46A 1MYRA 3ZT5A 3WH9A 3BGAA 1H11A 3SCUA 3SCPA 4P7QA 5LA2A 1CXFA 1WDSA 1V6XA 3D3AA 4OZOA 7TAAA 2G4FA 5E6ZA 3W81A 4HZ8A 1TA3B 3WUEA 5BWFA 3EMQA 1BSIA 3II1A 4HTYA 4M56A 4UZUA 4A4AA 1E4NA 3TTQA 4BS0A 4LYRA 1QHOA 2X2YA 5A6LA 2YL5A 2ZXDA 3ZO9A 2WW5A 2J79A 1GQLA 2V38A 3WUFA 3M07A 2W4XA 1VFUA 4AZCB 2FHFA 1I1WA 1SFSA 2PBGA 2DEPA 2ESCA 1JD9A 2W62A 3WDJA 2QPUA 4CN6A 1BTCA 2ZIDA 2ZXAA 4UFHA 2FHBA 1GHSA 3SEPA 5HBFA 2ZUTA 3AMKA 3L4TA 1MW2A 3VDBA 4AD4A 3VX0A 1OINA 4MNLA 2X05A 3L2LA 1ESWA 1WCGA 1NP2A 2VX7A 5C8BB 3T0AA 1H41A 4MB1A 3U57A 3GXIA 4H7VA 4UTFA 1J11A 3BAWA 1WDRA 2DT0A 2E9LA 4KGJA 1DWHM 4PMQA 2VJXA 4FLSA 2WC4A 5EFFA 1S46A 1TG7A 2Y8VA 1NWTA 2XVGA 2GDUA 3ZJKA 2ZUUA 2VT0A 3WBAA 1AQHA 3BLPX 4LGXA 3TTYA 1CGYA 1KWGA 1J01A 2E0PA 4W8LA 5DFAA 1XH1A 1GW1A 2WCSA 1UWUA 4A3HA 1X6NA 2C7FA 3AHVA 3E1F1 3WNNA 2DT1A 3UG3A 2WWDA 1V0NA 2WMKA 1EDTA 4JHOA 3AMLA 3W38A 3PN8A 5IXEA 4JCLA 3WEMA 3PTMA 5BRPA 3I3EA 1LG1A 2VZUA 4E4PA 3BSHA 2Y24A 4TVUA 3VU2A 2YDSA 3KL3A 2C0HA 1FHLA 3CH9A 1UQYA 2ZUMA 3SUUA 4LYQA 2CBVA 4OKDA 1HVXA 3WD3A 1V0MA 3LPOA 3ZMRA 1J0ZA 2GK1B 4OBRA 1HKIA 2WVVA 1N82A 2XIBA 4JFWA 4OBSA 3PTQA 1HP5A 4AZBA 4CU7A 2YL6A 1K9TA 5ABHA 4AD0A 4IISA 5I3DA 1G94A 1MQQA 1UA3A 2CIPA 3VOCA 1KQZA 4W93A 4TTGA 3OLGA 3WUBA 4D6GA 5FIPA 2B31A 1E72M 4WKHA 3TONA 3WBEA 5BXPA 3VGBA 3A47A 1ITCA 1ISXA 4PN2A 1GOWA 1D7FA 1WO2A 1VBUA 1UKTA 1XD1A 2ZWYA 5ABEA 1OM0A 2WZHA 4PMZA 2A3AA 4XB3A 3GM8A 1ODUA 4AC1X 1B9ZA 4Z2KA 2IUZA 4WF7A 2O9TA 3BSGA 2J7FA 4DWSA 4ATDA 1FA2A 3WL1A 3OLIA 1UKSA 3SUWA 3T09A 2YOCA 9CGTA 4PTVA 3WN6A 1JXKA 4S3JA 1GPFA 3FW6A 2WNWA 5E0FA 3WNKA 3L4WA 3CHFA 4WIWA 2XG9A 4IPNB 1B3XA 1A3HA 3IAPA 1J0IA 1UKQA 1OBAA 4F9JA 3WENA 5ABGA 3WMSA 2CCRA 4FLQA 1VBRA 2PB1A 1CZ1A 3N11A 5BROA 3CGTA 5DF0A 3PZIA 5IHSA 3G6MA 5AYIA 3EBVA 3S2CA 4DM2A 3ZQ9A 5A3HA 1XYFA 2E9BA 3AZRA 1QI4A 4GO9A 1KXQA 4JFUA 1Q6CA 4OIFA 1XRVA 1XD0A 1UZ1A 1ZBCA 4YHGA 3ARUA 3VTRA 5DO8A 4PMOA 1C7TA 3UR7A 2WK2A 2Y8KA 1H1NA 3LPFA 2VVNA 5A6JA 3B9AA 4FMVA 2OYLA 1BLIA 3WNMA 2VI0A 4N42A 2CYGA 1K9EA 1JIBA 1V03A 1RD6A 3W0KA 2QLYA 3VGFA 2JF7A 5DT7A 3NYDA 4UQAA 5A6AA 5CSYA 5C70A 1NH6A 5JUVA 1V6WA 1OT2A 2J62A 4MTVA 1QVBA 1ISVA 4BZYA 2FH8A 2QMJA 1KCKA 2J7DA 1E3XA 1EOMA 1NOWA 4MNKA 2NW0A 4NRRA 4CVWA 3WNPA 1B3VA 1M7XA 1ZB5A 5D8WA 3PZTA 5I77A 1E6XM 2HVMA 4F8XA 1PPIA 1LL7A 1KR0A 5EBAA 4TX8A 3EDDA 2WMJA 2DQXA 1FP8A 2E4TA 2V3GA 5LA0A 1VF8A 4J27A 3AIRA 4MJ4A 5GNYA 3W37A 5BRQA 2JIEA 2J7HA 4Z2JA 3CUIA 2YLLA 3RJYA 1UG6A 1XGZA 1CNVA 2EPLX 1QOXA 3U5YA 3AIVA 3WQWA 4WSKA 4C7GA 1EQCA 5GQBA 4R5EA 3W29A 1DHKA 1D2KA 1E4LA 1W9UA 1E73M 1BYBA 3WDIA 3QOKA 1K9DA 1CGUA 4MJ2A 4ZXOA 5I24A 4V2XA 3AISA 1V6VA 4MPKA 4X9YA 1ODZA 2VO5A 4NSBA 3NSMA 2BY3A 1OT1A 1TZ7A 2C8NA 4GZEA 2CESA 1PZ3A 3FAWA 4J3XA 4HA1A 2ZWZA 3L4VA 1E6PA 3VGGA 1KXTA 3SURA 2WCGA 2FGZA 1XCXA 2VURA 4CVUA 1J12A 1E1FA 4LPCA 1E55A 3L4XA 4CU8A 2D0HA 1JZ3A 1SYTA 1QI2A 2CHNA 4ZENA 4ZEPA 4JKLA 3ARVA 5HXMA 4P8WA 1G5AA 3WFZA 2WMFA 5ECUA 2WKGA 1RPKA 2J25A 4U2YA 1L0PA 1EXPA 2WVSA 1J0JA 5EB8A 8CGTA 4PMYA 1GVYA 3W28A 3FHAA 2YDQA 4CCCA 1P6WA 1FFRA 1QI0A 3TOPA 4JIEA 3WMCA 3IANA 1JZ2A 1WNOA 3MMUA 3N12A 1HJWA 1GNXA 2EQDA 1K9FA 2XWEA 1B1YA 4BQ4A 3WELA 1VIWA 1UWRA 3VDCA 1OB0A 3POCA 2A3EA 1AQ0A 1VEOA 2XFRA 1XH0A 1AVAA 3PTKA 3NCOA 3CHCA 2WAGA 2VOTA 2WANA 5A8QA 3OGSA 3VGDA 1JZ7A 1KQYA 5AC4A 1MW1A 1B30A 1GOMA 1JF5A 1V08A 1H4PA 3MUIA 1ZS2A 4B3KA 5BXRA 4IPLA 1KWKA 4MNMA 2VZTA 4X0VA 1HKKA 4H2CA 1VRXA 4PRWA 1VFMA 2ZICA 1JNDA 1W9DM 1NM9A 2WHMA 1SR0A 4JL2A 1WP6A 1OCQA 5BYWA 1NWRA 4C7DA 1XH2A 3WUGA 1HNYA 1NOFA 1ISWA 5GNXA 5HOSA 1YQ2A 3B9EA 1RP9A 2V3DA 1WE5A 2ZUVA 1FP9A 1R7AA 3AICA 4AD3A 5BXSA 3WQ4A 2QF8A 4DUVA 4J7RA 5HDRA 2WMGA 1BYDA 2VNCA 3APGA 3PZMA 1BVNP 2CBUA 5D9PA 1UR8A 3MANA 4W7VA 1VEMA 2IXUA 1E56A 1PX3A 5HPCA 3THCA 4UFLA 3WQ8A 3AS1A 1C90A 3CHDA 4D6JA 3SCQA 1KGWA 1OD0A 4M81A 1WDPA 3LPGA 1GOQA 3GBDA 4AD5A 1JZ8A 2UY4A 1VJSA 3AMGA 1DEDA 1JDAA 3AJ7A 1EHAA 4RE4A 3LPPA 4D6FA 2O9PA 5TD4A 1CTNA 3AYSA 3GXMA 1E0VA 3O6AA 1UYQA 3BC9A 4U31A 3ALGA 1W1PA 3WIJA 3A4WA 2OYKA 4WLCA 4Q22A 3AROA 3RDKA 1X6LA 3ARZA 1W3JA 5M5DA 5FD0A 3VNYA 1JL8A 3K8MA 4UOJA 2HISA 2UY2A 4JKKA 4IUGA 4F9DA 1J0YA 4WKFA 3T2PA 1GQJA 1QNOA 1UWQA 4PMVA 4UFMA 4AEFA 4OJYA 3N17A 1E0XA 4EK7A 2EXOA 4E8DA 3VD5A 1JDDA 3WMBA 5CG0A 2V5DA 3TTOA 5JBDA 2J7CA 1GZJA 4AZ6A 1MXGA 1UA7A 4V27A 2CNCA 4HOWA 1MWOA 1R7OA 1Q6GA 2D23A 4PEEA 2WM0A 1WZKA 3OA5A 6TAAA 1V02E 1JXJA 3T2OA 5F7UA 2OYMA 3ZR5A 3POHA 1JZ6A 1M04A 1V0LA 2ZE0A 3WDQA 1EHNA 3GH7A 3SCNA 1PX8A 4U3CA 4ATWA 2D3NA 2A3BA 2XSBA 4PMUA 4QP0A 1CXIA 3VM5A 1CPUA 3VD9A 2OSYA 3VGEA 1KB3A 3CPUA 1LJYA 2ZUSA 3EDEA 1OD8A 4LX4A 2MANA 2QPSA 4PMNA 3SCSA 1C8QA 1W2PA 5A69A 3ARWA 1CXEA 3BXWA 4KRUA 2WBGA 2OWXA 2BFGA 3PZGA 3T0DA 3RM8A 5EMYA 2GUYA 4J3VA 3RJXA 4HOXA 4MAZA 4AWEA 4KWUA 3QOMA 2WMIB 3MUZ1 3QGVA 3FAXA 1W3HA 5D9NA 4J28A 3RCNA 2IXVA 4UQEA 1MVYA 1EDQA 4GZJA 1ZBVA 4ACZB 2BNJA 4U2ZA 2X8RA 4W8AA 3UESA 2UWFA 1PEZA 3ECQA 1CLVA 4FLRA 3AHTA 2WKLA 5CGTA 1GOIA 4D6HA 2DSKA 3JUGA 1H49A 3ZOAA 1UD5A 1CXKA 1OGGA 2UY3A 2PF0A 2OSXA 2VC9A 5A94A 3AXXA 1UR0A 1ZJAA 1HIZA 1PBGA 1QNSA 4BCEA 2F2HA 3GNPA 2XSAA 1GHRA 5CQ1A 1TE1A 2XIIA 3VMPA 1M01A 3M6DA 2E3ZA 1B0IA 5I2UA 4J3WA 1FHDA 5D4YA 1UQZA 6A3HA 1PX4A 1DP0A 4W85A 1QI3A 3AZTA 3WH7A 4J3UA 3WNLA 2QV4A 2OWWA 2PBOA 4ZFMA 5IHRA 2W61A 5IDIA 5A6BD 1UR9A 3L2MA 4UNIA 1JNEA 1UKOA 4AZIA 3A4AA 5JBFA 3DYMA 4B15A 1MW3A 6CGTA 3MKKA 3L4ZA 1E15A 3VILA 1OIFA 1O7AA 3IAQA 4TX6A 3VD3A 1FFQA 2WSPA 4QAWA 3VVGA 1GOOA 4EAMA 3WH6A 1AMYA 5E9AA 3VMOA 1LWHA 2OLHA 1BGAA 1E4MM 2YL9A 3TP4A 1EA9C 1Q6EA 1G9HA 5HNNA 1V3KA 2DSVA 3T0BA 1V3LA 2J77A 5AC5A 2X0HA 2VR5A 2YBUA 4HU8A 3N04A 1HJQA 1E4IA 1UD2A 1LL4A 4AZ7A 1FOBA 4L4OA 1EO7A 3CO4A 4U33A 4D6DA 1C8YA 3GH5A 4MDPA 1OIMA 5FKYA 1HT6A 2WHLA 2GFTA 2OSWA 4V28A 2W67A 5DEZA 1J18A 2E8ZA 2BXYA 3VIIA 3GZAA 3W27A 4XUYA 2O9OA 4ZXLA 4HZ7A 1EH9A 1WZMA 5DT5A 2YKKA 5D8ZA 3CIVA 4E2OA 4AZ5A 5CPQA 1B3YA 1B3ZA 4XV0A 1C93A 4J3SA 4MDOA 1W9PA 1TR1A 3D5HA 4UR9A 3SCWA 3VIKA 2W92A 1V02A 4BQ3A 1QI5A 1XYZA 2XVPA 2XM1A 4AMCA 1QNQA 1US3A 3U7VA 3GNOA 4UOZA 4UQ9A 4W5UA 3RMEA 3EDKA 4PTXA 3AFBA 1QHZA 1J0KA 1K6AA 3AQUA 2ZUWA 4P8UA 2PWHA 1CGXA 3QHOA 5AY7A 4PYSA 3K8KA 1W2VA 3TA9A 1GVIA 1E70M 3UERA 1G1YA 2CERA 2CITA 5IFTA 4D71A 4JL1A 5D9OA 2WSKA 4CU6A 1XC6A 4HMEA 1NWUA 1CIUA 4JFTA 4TTUA 3DHUA 3OGVA 3TTSA 3MMWA 2DIJA 3ARPA 1E43A 2WC3A 3WD0A 2PWFA 3BAXA 4GXPA 3BAKA 2GJXA 3WDHA 4AISA 5A2AA 3ZT6A 2WC7A 3WEZA 1E9LA 2VCBA 4PCSA 2BS9A 3NSXA 2XHYA 2W63A 2CEQA 4M80A 2YIHA 1G01A 1Q6FA 4ACYA 1BF2A 4CD7A 3DECA 3N15A 3KL5A 4B16A 1W3LA 3W6MA 1UH2A 3VD7A 1ZJBA 3AYRA 1ISYA 1IT0A 3CUJA 2WVVB 3N13A 4D6IA 1QNPA 3CZGA 3RILA 4D1JA 1Q6DA 4D6CA 3VPLA 3F4VA 1OSEA 4P7OA 4J3TA 4H8VA 1JYWA 1JAKA 4M24A 4CUCA 3CZJA 3ZJ6A 1JZ5A 2GVYA 2J47A 2BHYA 2TAAA 1XSKA 3SCOA 4BQ5A 2FH6A 1QW9A 3ALFA 5A8MA 3L4YA 3LMYA 4F66A 2DIEA 2YA0A 1J10A 1JG9A 4M29A 3VIHA 4QLJA 1R85A 2DH2A 1E3ZA 1E1EA 3FY1A 4AW7A 1CENA 1XSIA 2DGAA 2DDXA 4Y7EA 1BYCA 3ZR6A 2DSWA 4UOQA 3BMWA 4DWSB 7A3HA 3UG4A 1WB0A 3UG5A 5E0CA 1JFHA 1CLXA 4CD4A 3VX1A 3VKKA 4NRSA 3EDJA 4Z2HA 4GKLA 2DSUA 3UR8A 2VCAA 1VFOA 2ZUNA 2V3EA 5E09A 4JAWA 4U5KA 4B9YA 3A3HA 2JEPA 1LG2A
chains in the Genus database with same CATH superfamily
1JGIA 1H5YA 4FPSA 4XZNX 1L2QA 4WDXA 1H61A 4IM4A 1TV7A 1OZMA 4Y9MA 3IIOA 3QM3A 2EPOA 1JYNA 4OQVA 5A8OA 1X96A 2A85A 5J8LA 2ZA2A 1A5CA 4OV9A 4Q4QA 3B4UA 3TW7A 1E6RA 4HGXA 2E1WA 3LHTA 3BG9A 4YCOA 2V67A 4FA3A 3F5KA 4C6DA 1IHIA 4NASA 4GQBA 1US2A 1SSDA 3N1AA 3CQ0A 2PDNA 2HROA 3V0SA 3M7WA 2PDHA 4J40A 4ORMA 3DHDA 2ZXBA 3TU9A 4PUEA 1XLFA 3KP1A 1O1ZA 3F7JA 3PANA 1UP2A 3LYEA 1OF6A 1YHTA 1GUVA 4PCTA 4C6PA 3WK0A 1S2AA 1TTPA 5A6BA 1RHCA 2J4GA 5EL1A 4XZWA 4NVTA 1UOZA 2DZWA 2YGYA 3I7SA 4Q6JA 4GCXA 2YXXA 1L6SA 1IEIA 5E0KA 3ZVIA 1FTXA 3PY2A 4GFIA 3GAYA 3MBDA 2CHRA 2HVOA 4G7FA 2IS7A 3CMGA 2BHUA 1ME7A 4DF0A 1W1YA 4Q4MA 4Z2IA 1ZZMA 1QK0A 3VC5A 3FEQA 4DWDA 3AMCA 2Z1KA 2J8FA 1KV5A 4S3CA 4TOQA 3THQA 2GGEA 4YHEA 3OVRA 3M0XA 3MKVA 3P8IA 4M6QA 3IGSA 3N2CA 4I3GA 4PTWA 4EX4A 3N25A 3KCOA 1WBJA 4JTTA 4PTMA 3BCFA 5CSSA 3QTGA 2HEJA 2V2DA 3E6EA 3MWAA 2WJZA 3JRKA 1UWIA 4W84A 1V3HA 3IJQA 3T2QA 2AMGA 1ZBKA 1SZGA 4GI6A 4F0MA 1KCZA 2P10A 4QRNA 4TMBA 4GE8A 3B04A 4XWUA 3WF2A 2VHLA 3SJNA 2VRQA 5T8GA 3LCLA 3AIWA 3NQ6A 4Q4SA 4CNPA 3RIKA 3E0FA 3P74A 1G4PA 5MKGB 4GQRA 4JTCA 4YPJA 1QMLA 4L9XA 2RAGA 3TJ4A 2ONEA 4GVFA 3VD4A 2AQVA 3SQSA 1VLIA 1VYSX 2XZ9A 4L64A 1SFTA 2QDGA 2IQTA 5CGMA 2QJJA 2XIQA 2ISWA 1NF7A 5DLCA 4YN5A 3ABRA 3W6LA 4HNVA 2GYIA 3MV01 3HTWA 4XTDA 1ZP3A 1DE5A 4H04A 3QXBA 2JFEX 2GWGA 1CBGA 4WR3A 2DPEA 3W24A 1R2SA 3WQ5A 5DELA 3WNOA 2XTKA 3NQCA 1I9CB 3WFAA 5B80A 1EIBA 3AIEA 4DXVA 4GVHA 1VHCA 4JEQA 3VCRA 3NQ7A 3N34A 3FNDA 3Q94A 2VEKA 4QE5A 2A79A 3SCTA 4ML4A 4AB4A 1XQLA 1Y7VA 1YDVA 4O4VA 1FCUA 2J66A 3H2AA 3CUHA 5CZKA 4JFSA 4H9VA 3S1VA 2Y4SA 5H8MA 2OELA 1XDJA 4QS6A 4E0CA 1R2RA 2DJXA 3H12A 3VNZA 1VB9A 4AVNA 1QPKA 3CZ8A 5CJ5A 5E6YA 5AYBA 4PUJA 1EDGA 1XL9A 2DUZA 1EUNA 1H5VA 2CKRA 2R24A 3AXMA 1AMKA 2AL1A 3EMCA 2BGNE 3ZSTA 4AHQA 4IH3A 4ZFCA 3CAQA 1A5NC 1JPHA 3AS2A 4GD0A 2YCEA 3HG5A 2B7OA 4AD2A 4MUZA 3W1MA 1LWJA 1VEPA 1K8CA 2OEKA 3W53A 4IG2B 2WVTA 1TWWA 5ENLA 2VR4A 3B97A 3WL0A 3NZQA 1BXNA 5EA9A 2VFIA 1FUYA 4LYPA 4KESA 2CLOA 3FHQA 2O92A 2VYOA 5I02A 4AD1A 1W1A1 1JYXA 2CETA 2ZRVA 4Q8OA 4HA3A 5FJIA 3OVPA 3SN0A 3CAVA 2D0FA 2XWDA 4FXRA 1HN1A 2J7BA 5C9ZA 1E6NA 3C8NA 2VZSA 1R86A 1LT8A 1E51A 4DM1A 1UZ4A 1HJXA 2VVSA 4C6NA 2YCLA 3ZIZA 3N9KA 4I7WA 2QKFA 2OU4A 4WXZA 4DVOA 4L4LA 3ARXA 4W87A 1OGBA 1YEYA 1YADA 4L6OA 1B3WA 5LA1A 1GKPA 2WHJA 1ENUA 1H3GA 1SO3A 3G0SA 3ITYA 5M03A 1L6WA 3LZ3A 2G95A 2G3JA 1PHQA 1RCQA 3W7DA 3ARQA 3WF1A 2PLMA 3TN4A 2YXOA 1W31A 3VA8A 2FZDA 3QPZA 3R25A 1HJVA 4LVDA 2Q8ZA 1VFFA 1F2JA 1A0CA 4NZ5A 1WPCA 1YTKA 4IIBA 2OEMA 3S2JA 4JQAA 1CGTA 2ZOXA 1ZLPA 3VM7A 5TAOA 4XZLX 4JTQA 4MKVA 2VDHA 1K7FA 3FYYA 3QY8A 4H41A 2ICSA 3TYCA 2WLZA 1LM1A 1ZSXA 1OFAA 2PDPA 4RZBA 4WX2A 2JBMA 1YNPA 1Z48A 1G69A 3W2NA 4QG9A 4TVCA 3TJIA 2CBIA 2JKPA 2HSAA 4AMAA 1XBVA 3BK0A 2D20A 5D37A 2DT2A 5C9RA 3GDKA 5CKSA 4L9YA 2ZXQA 1IR1A 2VL4A 4FI4A 2E8YA 1BPLB 3HOJA 4GXWA 4U10A 2V9DA 1JPMA 4UIOA 1E0UA 4P7LA 1PIIA 1ZNNA 4PBEA 5A6MA 1CWYA 4OGZA 1V6YA 4PMRA 1NWSA 4C6BA 1EXBA 1OZQA 2F9RA 1IXNA 4L61A 3MUAA 3OLEA 4CQAA 3PG8A 3LTYA 4XIAA 1PTDA 5G2WA 2Q8XA 3K46A 2PD9A 2C79A 4AYGA 1C91A 5E70A 3ELFA 1LTDA 1RA0A 1XM3A 3TLLA 3V16A 3UWVA 1DJHA 1GVQA 3IJDA 4ZB5A 4UBPC 2PZ0A 7CGTA 5LYRA 1XYBA 5AVNA 1M7OA 4IHCA 1BHGA 1IV8A 1TPVA 1BQCA 3GDBA 4O10A 3K8LA 3U2ZA 5CLWA 1N8WA 5I23A 3W82A 3KAOA 1EB3A 3AMDA 1RBOB 1MZRA 1UJPA 2X1IA 3IK4A 3WD1A 3MO4A 4ICCX 5DY2A 5FL0A 3VGHA 1EGZA 3S1XA 4WD0A 1Q7QA 3CTTA 1LZOA 5AHMA 2BXZA 3CBWA 1TVPA 3BGJA 3F5JA 3ISIX 4J2MA 3S6TA 2RGLA 1V3IA 3GBEA 1WZAA 3GVRA 2EBNA 3K30A 2OGYA 3CUFA 3G3MA 1HKVA 4Q4OA 1E5JA 4YCPA 1KO0A 3T6CA 3URAA 4XBKA 3UETA 2QV5A 3ZJ7A 1ISZA 2AOSA 3C4UA 3UYCA 2HXTA 1I8JA 4WOZA 1FH7A 4HPHA 3GZ3A 1XV8A 2VOMA 4HMDA 4IIEA 1AL8A 1JCYA 1JCXA 3K4AA 3KW3A 3OPSA 1VENA 2NT1A 2I14A 3IIPA 4L56A 4KMQA 2TODA 4LVGA 1M7JA 3BVJA 3H2NA 3FIGA 3W26A 2PDCA 3SN4A 1B2YA 2V69A 2VRKA 4L4PA 1P0NA 2VZVA 4EKJA 2EPKX 2H3BA 2UY5A 4LAOA 4FXJA 5HJXA 4EPBC 2WM1A 2PDLA 1OCNA 5BXTA 1SZNA 5FA5A 3CZKA 2BMBA 1EQPA 2CFFA 2QUUA 2YJQA 1EJXC 3ARTA 5FEZA 4TQTA 3KOYA 2QVNA 4MGGA 2F38A 1XUUA 3MV11 2G4JA 2I5QA 3R0KA 3LG3A 1FWBC 3HGRA 3MW7A 2ZX8A 3AXHA 4C6QA 1QU4A 3FOKA 2HPIA 1LL6A 1C8VA 3KEHA 3NYZA 2E6FA 4R34A 3R8HA 3PUEA 1QPQA 2QXWA 4JN7A 1UWTA 4MZYA 2Z0IA 4IIFA 1IEQA 3ITVA 1TWZA 3SRKA 2QEZA 3U5UA 4NJJA 1JUEA 2BXVA 4IPIA 3QSTA 2GK1A 3KBWA 1JAEA 2W66A 4M1BA 1M1BA 2E67A 1S1RA 4KH2A 4KRTA 4O1BA 2TRSA 4G6CA 4ZOEA 5D04C 1OY0A 3L2IA 2VMFA 4QEHA 3LHUA 3LQLA 2MUCA 3BOFA 2HWGA 4AIEA 1NDVA 4O19A 1DIOA 2WYSA 4NT0A 3OQEA 1XLKA 4LVAA 1LQ0A 3NR0A 3DFNA 2YL8A 2OWCA 2CKSA 1DIKA 2EEXA 4O18A 3T0TA 4A21A 1H11A 3IARA 3SCPA 4AH7A 4FIRA 1WDSA 1DBTA 4PZVA 2G4FA 2BODX 5E6ZA 2YZRA 4HZ8A 1TA3B 2NUYA 3N2TA 4FOJA 4LYRA 2ZXDA 2I5IA 1X8CA 2JK2A 4WJEA 2J79A 4I9AA 4JTUA 4MJMA 4P5UA 3M07A 3IGXA 2FHFA 2PBGA 1RLCL 2XH0A 2YFNA 3WDJA 4F0HA 1FWDC 2POZA 1BTCA 3GHTA 3NNTA 2ZUTA 3AMKA 1MW2A 4AD4A 4PRRA 2ZRUA 1OINA 4MNLA 2X05A 2VM8A 3L2LA 4C6IA 4KWOA 1WCGA 4B4HA 4B92A 5C8BB 2QIWA 3WQPA 2YPIA 3G8EA 3GXIA 4EXBA 3BOXA 5LGXA 2E9LA 3B8UA 4FLSA 3W74A 1P4CA 1D9EA 5HJLA 2GDUA 3ZJKA 2OOFA 4AQLA 3CJPA 2PDYA 4LGXA 3W87A 4QE1A 1NFPA 4PB5A 3VUSA 4AG0A 5LSMA 3T1GA 3GKAA 4J5NA 1XLIA 3EKGA 1X6NA 1GYLA 3LZ5A 3UG3A 2VDIA 3AMLA 2H9AB 1TJPA 4OTKA 1TIMA 5IXEA 3I3EA 3PFRA 1LG1A 2WOQA 4WEVX 3VU2A 2YDSA 4H19A 2HPMA 1N55A 3CH9A 2ZUMA 4LYQA 2PDIA 3LPOA 1O68A 4KFNA 3LLFA 1HKIA 1RSCA 2WVVA 1Q6OA 3RMJA 1I60A 5A5WA 5CG7A 1TJ2A 3VAVA 3BJTA 4GC4A 1K9TA 3Q4DA 5ABHA 3B3DA 3TNOA 5I3DA 1TJ0A 2Q02A 1UA3A 4Z1DA 2CIPA 1ZAJA 1KQZA 4IFKB 3NZGA 3OLGA 3WUBA 4D6GA 2B31A 2AL2A 2PDJA 4PN2A 1WO2A 1VBUA 1XD1A 1OM0A 4DBWA 4XB3A 3GM8A 1Q13A 2H8ZA 4HA0A 3TN6A 1YPXA 3S42A 5HMSA 2Y7GA 3CU2A 4GC3A 4ATDA 3SUWA 4XBJA 1RBAA 3N4AA 4PTVA 3PPGA 3WN6A 1AH3A 1MUMA 3FW6A 1XXXA 2PEVA 5E0FA 3WNKA 4LUSB 4HHHA 3CK5A 1WX0A 4MLJA 1A3HA 5GJMA 5LNVA 1J0IA 1UC5A 2QCDA 3UJ2A 8XIMA 3P80A 3HF3A 1EYEA 1L6GA 5I3GA 1JQXA 3FDKA 3PZIA 1H50A 3S9IA 1R3QA 1A5OC 1HGYA 3S2CA 3ZQ9A 1VC4A 1XYFA 2VEPA 4JN6A 4TO8A 4R33A 4Y9OA 5LXEA 3LUTA 1LDCA 1IWAA 4GO9A 1Q66A 1XW8A 3WO8A 3ARUA 3VTRA 4US5A 1OFOA 2PURA 4JEJA 3N2MA 5B7YA 4PMOA 3UR7A 2WK2A 4CQDA 2A7NA 3F2DA 3B9AA 3STPA 4DAIA 3B0XA 3DH7A 4QGCA 4LS0A 2CYGA 3W0KA 3VGFA 2JF7A 2VC6A 1YRRA 2QCGA 1Q65A 5A6AA 1XR2A 5C70A 1RQEA 4HD5A 3EA2A 3ZLGA 2J9ZA 1ISVA 3T42A 2QYGA 1DQUA 3D47A 1KM4A 4ORIA 4QJ4B 4GNJA 2NLYA 4GH1A 4MNKA 3RGTA 1R2TA 3M4HA 1AFSA 1M7XA 4KETA 5D8WA 4K39A 3PZTA 1TE6A 1XBYA 3IVUA 1BKSA 4DZIA 4JYFA 4TX8A 4GY7A 2E5DA 3GRIA 2V3GA 4ONVA 4J27A 1KM0A 5H91A 1XG3A 4DJED 1MSSA 3TC3A 3W84A 1TRDA 1GZ1A 4NUWA 2P76A 4KWSA 1QO5A 1M68A 2IKGA 5CJMA 3W1UA 3CUIA 1WKEA 2QJIA 4KQNA 3PUGA 4LT9A 1UG6A 4GGBA 1CNVA 4ZSUA 3AIVA 3GXPA 3KS5A 4HVXA 3HGJA 3LBCA 2CWNA 4GIRA 3ATYA 3NL6A 1XIEA 4AY8A 1N7KA 1K9DA 1CGUA 4FO4A 1C29A 3INPA 3S5OA 1V6VA 4MPKA 3QFWA 2QGYA 3OOQA 3WLRA 3E02A 3WK2A 3ABQA 2HNEA 2D73A 2CESA 3FAWA 4CNNA 1G4TA 3H54A 4QX4A 3SURA 3E0WA 2FGZA 4I5UA 3TDFA 1TMHA 1E1FA 3Q58A 4LPCA 4KW2A 1KFJA 2V30A 1E55A 1A3WA 1TWSA 3L4XA 5K3VA 4GY0A 4XZHA 4DJDC 1Q2RA 1R6WA 3NOEA 2CHNA 4E2BA 4ZEPA 1TQXA 5D05A 4UMAA 3EOSA 2AKZA 2FZ8A 3TIMA 4U2YA 1L0PA 2WVSA 2ZZ5A 5I00A 3NZPA 1I0DA 4ML9A 1P6WA 4MMWA 1QI0A 2OEJA 2YXGA 1UR3M 1JZ2A 1HJWA 3O8AA 3EOUA 1THFD 2BOFX 1K9FA 4WZHA 4IMGA 2XWEA 1B1YA 2GUBA 3HM7A 2C71A 3TH6A 3CIWA 3EXTA 3VFLA 1VEOA 2XFRA 6TIMA 3M5XA 2W6RA 1KBLA 3NCOA 1JZ7A 3VNMA 5AC4A 5EMUA 4MG4A 3MUIA 3S5ZA 1NJJA 5BXRA 2WPBA 1BWLA 3ZVHA 3QY7A 3PUDA 3STGA 4XTIA 3O16A 3AJXA 1W9DM 3D46A 2C18A 1M65A 3E2RA 4YJ5A 3NM3A 4C7DA 5FACA 1NOFA 1ISWA 3LEPA 1UP0A 3B9EA 5CGQA 1RAKA 4LS2A 3WLOA 4DUVA 4QITA 2VNCA 3QLDA 5D9PA 5BOEA 1UR8A 1VEMA 1PX3A 2HZGA 2P1FA 3I7RA 4Z08A 5CZ0A 2Z1WA 3AU2A 3AS1A 2FVKA 3RO6A 3CHDA 4DJFC 2GLKA 3SCQA 1OD0A 1S2TA 1V5XA 2C1IA 5IBXC 2CWXA 4AVFA 1VLWA 2FTWA 4HPXA 4O0KA 4PUNA 4R7JA 4GUGA 1K8XA 3N6QA 5CZTA 1VJSA 3AJ7A 4AAJA 3OO2A 3E38A 1EHAA 4RE4A 5G2HA 2C0AA 1GG0A 2HBXA 4RZ4A 3GSMA 4D6FA 4LRTA 5TD4A 4DIAA 4UXDA 3N3TA 3GXMA 1VFSA 2H6RA 1E0VA 3ALGA 5D2YA 2XN1A 4WOQA 3T9PA 1S1PA 4LV9A 3GG0A 2BBFA 3GTFA 2UY2A 4JKKA 4F9DA 1J0YA 3T2PA 1GQJA 4MY1A 4J3ZA 2XN2A 3KRUA 4OJYA 5EGRA 4EWJA 3W83A 1JDDA 2H90A 3WMBA 4MWAC 4Q8MA 5K9CA 4H4IA 5JBDA 1MXGA 1UA7A 4V27A 4HOWA 2WZMA 2YBVA 1T6MA 2DU2A 2FB3A 1V02E 4L4MA 4K3ZA 6ENLA 3BTNA 3ZR5A 4LCRA 3BGGA 2NLIA 4EF8A 1V0LA 1P7TB 1V4YA 1EHNA 4RNFA 4U3CA 3LI0A 2D3NA 3EX4A 3V5CA 3BOLA 3VM5A 4H6KA 3USBA 1M3UA 3KDOA 1LJYA 4B2DA 3EDEA 3URQA 4CEUC 2NQ5A 5D38A 1W2PA 1KFKA 2VWSA 5DN1A 3H4XA 4KRUA 4CNSA 2GGHA 2BFGA 2OWXA 3RM8A 2GUYA 3RJXA 4HOXA 1G4SA 2PDGA 2Z28A 4O1EA 4FR6A 4OT7A 3SBFA 2VKZG 1TVLA 1LRNA 3Q65A 1SZFA 3B03A 3GE7A 2PWUA 1UIOA 2ZRZA 1W3HA 4ZB2A 3RCNA 5ABTA 1ALDA 1MVYA 4UTUA 1ZBVA 4ACZB 2V2CA 1HKWA 3M5ZA 1TZZA 3UESA 4BWLA 3VOHA 1PCKA 3BG3A 3ECQA 1QT1A 4FLRA 2IKJA 2PGEA 4FNRA 1H49A 2QQ6A 4Q4RA 2I56A 2OO0A 3M47A 1F9CA 3IVTA 3MZ2A 3WX7A 1LRTA 5BOOA 5DBUA 2XSAA 4Q8WA 2PGWA 1GHRA 5CQ1A 1TE1A 2XIIA 1M01A 1TIWA 4IGMA 1B0IA 5I2UA 3V1PA 3IJ6A 4ZA0A 4IP7A 5HR6A 3QV8A 5AHLA 5AC6A 3WMLA 4KIRA 4UTWA 4HCLA 2PBOA 4LEQA 4ZFMA 5IHRA 5A6BD 5MHBA 1UZHA 1GQNA 4YL2A 1H51A 3H21A 4LY8A 3A4AA 3DYMA 1MW3A 1R3RA 3MKKA 4KF1A 1TUFA 4GX8A 4FXFA 4KRZA 4TX6A 1OFBA 2G37A 3SADA 3VVGA 1DJIA 4EAMA 5FF3A 1E4MM 2NX9A 4PL1A 1EA9C 1V3KA 5GJPA 3VC6A 4LYKA 4DELA 1XJBA 4WY0A 1EYWA 1Y5XA 5AC5A 3FS2A 2YBUA 3M44A 4JBRA 4AZ7A 5D30A 4L4OA 1EO7A 3VNDA 4D8ZA 1YX1A 4D6DA 4QSFA 2OSWA 4V28A 4YTRA 2HS6A 2DFAA 3GNDA 5LNRA 3KBMA 1X39A 1EH9A 1TJRA 1WZMA 3W22A 5DT5A 3LCHA 3NL2A 2YKKA 3HG4A 3M0ZA 5D8ZA 4E2OA 1R9XA 5CPQA 1B3YA 4MOZA 1QO2A 1PDZA 4O1DA 4IP4A 2JGQA 1D7KA 2XVPA 2XM1A 4AMCA 1QOQA 4I5RA 2XH2A 1MXSA 1ZP4A 3U7VA 5LIYX 1VD6A 3KBJA 5IDZA 4AEOA 7REQB 1K6AA 3AQUA 4P8UA 1U22A 4ROPA 4LALA 4UTTC 2PWHA 2CLPA 1E70M 2X1RA 1VFLA 4ADSA 5HINA 4JL1A 3GDMA 4HMEA 4AF0A 1CIUA 4TTUA 1EJSC 4ZQRA 3UP8A 5DXXA 4ZQCA 2OO6A 1Q8AA 2DIJA 1IQ8A 4JQ3A 3W76A 2OODA 4ES4A 1OJXA 4FALA 1F3EA 4PCSA 3CV2A 2VFFA 5F2GA 3NSXA 3OZYA 4UTLA 3PNZA 4A8RA 2CEQA 1H7NA 3GS6A 1MEIA 4ACYA 3GIPA 1KM3A 3KOXA 3RCMA 1X1OA 2J24A 5AVHA 4CD7A 3KL5A 4RLIA 4QTGA 3W6MA 1ZJBA 3AYRA 3C3NA 1IT0A 1L2UA 3N13A 5I3FA 3RILA 4G9PA 1KTNA 1BD0A 4MIMA 3FXGA 4J3TA 3BICA 3G0XA 3LV5A 3XISA 2L5HA 3CZJA 4PUKA 2PLJA 2BHYA 5AFDA 4BQ5A 3ALFA 1P1MA 3FCPA 1XRFA 2DIEA 1XG4A 3KHDA 4M29A 2X42A 3ZZ1A 3W7JA 4DZHA 1EJTC 2DP3A 2DGAA 3B40A 3OU8A 5IRPA 2DDXA 3C2OA 5HNUA 2CZ5A 1SQ7A 2DSWA 2HBVA 5FF7A 1I2QA 4O1AA 2INEA 1EF2A 1WB0A 3UG5A 5I06A 4MPQA 1TTJA 3GU2A 1V8EA 3VKKA 3M9YA 2DSUA 2QULA 3EKLA 3FSUA 1YXDA 3HV9A 4GYJA 4DO7A 2V3EA 4Q32A 3W1AA 3N2BA 2CXEA 5HATA 2NT0A 3BLFA 2ABBA 1DJXA 2Y0FA 2YA2A 4ZO6A 2ABAA 2OLAA 3RU8X 2R82A 3P62A 4IQJA 4NIRA 1XHGA 3M43A 1MQRA 2DT3A 2PRHA 2ZE3A 4ZO8A 3TAOA 3KCLA 3NWRA 4K1WA 3W7RA 4FNUA 4OFCA 2D24A 4LWWA 3VNIA 4MY8A 3ITOA 1XUZA 4QLLA 4LAKA 3NTYA 4DBDA 2E6DA 4X2PA 3PS7A 1BFNA 2RHGA 3STCA 1FCQA 1KLZA 1PWMA 2VFEA 2WJDA 1D3CA 3UJRA 3EA3A 3A9BA 3UNDA 3GNRA 4CN1A 1SJAA 4JQ4A 4O28A 5I6SA 3TW9A 2WNQA 3VO0A 3VMNA 2EG6A 4GG9A 3RITA 1RP8A 4YVVA 4DBUA 3E0VA 2RDXA 2QCMA 4I5XA 2FZNA 3OHIA 1Z8AA 2OG9A 3QR0A 1WOAA 1AL7A 4W86A 2V3FA 4U4MA 3JZUA 2Z4GA 2VDGA 4NY2A 3T07A 4YVXA 3O7UA 2YYTA 3GG8A 3DC0A 4GYKA 3PFMA 4HOZA 2WCAA 2GGIA 4QAIA 1AUSL 1G0CA 2A3HA 3FLUA 4C1NA 1TUXA 2ZCGA 1F74A 3THDA 1GT8A 3GXDA 4AXNA 4FLOA 3TA6A 2BVTA 2EJ1A 3LGDA 3SUSA 1H0GA 2QCHA 1XP3A 1SVDA 4Z2LA 1MW0A 1ITUA 1ZCOA 2WXDM 4CD6A 1ZAIA 4IG2A 4BEUA 2ZX6A 2J74A 1DWIM 4O1FA 2SFPA 3PWGA 2EKCA 2PWEA 1ZL1A 5HWNA 3O0KA 4ZR8A 3VDAA 3LOTA 3NQVA 2B4GA 2ZDRA 1C3FA 4ZZ9A 1NAL1 3WD2A 4X63A 4O12A 1AQMA 3AXIA 4W8BA 1KR1A 3W1XA 2ODOA 2R94A 3EA1A 1KCLA 3DEQA 3MSRA 5LIKX 1R0MA 3U7BA 3T08A 4IFOA 3R13A 3T81A 3CPRA 3RO8A 4I9TA 5A8NA 2PWDA 2O7QA 4PH6A 4JIPA 2Y7FA 2BVYA 4DN1A 1W1B1 3E12A 3P5YA 4M8UA 2GDVA 4GVGA 1UASA 1RALA 4UNKA 4W7WA 4LOCA 4MB4A 3KZSA 3CZLA 3IIVA 4UFKA 3S46A 2VUYA 5A1AA 4CKQA 2NQJA 1FXQA 1W32A 5KEZA 2GJRA 3GVVA 4HP5A 3N2OA 4Q8VA 3DYOA 3TMLA 3TYUA 4DX3A 4E3VA 1CECA 3AHXA 3T0CA 4EACA 2XUCA 3L9CA 3EB2A 2RKXA 1ECQA 3WDPP 3KM8A 3K1DA 3CWHA 1T41A 4GUFA 2A3CA 3C2YA 3JU2A 4BF7A 1S5TA 1U30A 3I6EA 2VCCA 1QNRA 3MCMA 3GYEA 3MUCA 2CPUA 3IJLA 1V77A 1W9XA 2FTPA 3A5VA 2D1ZA 4FF5A 1VCFA 3U2EA 4PUDA 1Z9AA 3UZZA 3PHAA 4A3YA 3FKKA 4Z0SA 3FXYA 1NFBA 2PWGA 4UQDA 1EEPA 3EWWA 1B31A 3FA3A 4S3KA 3DKJA 3IRDA 1XIMA 2X2GA 3H6OA 4OU1A 3WLIA 4ZB0A 3EEZA 1Q7ZA 2XVKA 3OZPA 2X09A 2WPGA 2VGFA 5I3JA 4EE9A 5C71A 3PP7A 1Q6LA 2JALA 3L0GA 3AHYA 2J13A 4UFIA 3IRSA 3SFKA 4PUUA 2PGRA 1XLMA 3TYEA 2XGBA 1VJZA 3ZT7A 1BTMA 4TX9A 5A95A 3RG6A 1MQPA 1WUEA 3A13A 4H8HA 3R0UA 3NG3A 2H3DA 3V35A 3QMRA 1H0IA 3RR1A 4US6A 4I7UA 4CQ8A 2BTMA 4GYPC 4Q7NA 3HIJA 4HSHA 7PTDA 2XJ7A 3N6HA 4HCHA 1T5AA 4RE0A 1UR1A 3LSCA 1A0EA 3LRKA 2Z1SA 3E5BA 3TCSA 2ZX5A 1VIZA 3KUMA 3RM9A 4Y90A 4XAZA 2E25A 4R9XA 3CEPA 1N2VA 1VH7A 4NF7A 1XYCA 4XKYB 3G1AA 3OEXA 3MUY1 3E3HA 2Y70A 4RKAA 3KVJA 1ECEA 4RK8A 4H7ZA 3UZ5A 2A21A 3FSTA 2HRWA 3RHGA 4WJ8A 5LIWX 3I3DA 1LBLA 3BG5A 4W88A 2VQUA 2XDFA 1PIFA 1HL9A 2W91A 1Z6KA 1O5KA 5FOOA 3C0SA 3G1YA 2WJEA 3SRHA 4LUTB 3VIJA 1F6KA 4S39A 2FKPA 5EY5A 1NP0A 3S4TA 5IFPA 2QJNA 4ATLA 1KBJA 4AY1A 1UD3A 4KGLA 5DX7A 4FK9A 3R94A 3OVQA 4XZMX 3QFEA 3SFWA 1CT5A 3TWBA 1F5ZA 3APYA 3KOWA 1KGXA 4CGTA 1E0TA 1BGGA 3D0CA 5A8PA 4FIQA 2HV5A 3DZ1A 4DRSA 4XQ6A 1W8GA 1RH9A 2DSZA 3ZSSA 4JX4A 6PTDA 1XLEA 4LBRA 1R8LA 1RCOB 4QBXA 4DXKA 1IEVA 3CH0A 1VKFA 1DJYA 5KETA 4ZQOA 2CXGA 2V5CA 3SRDA 2Z1XA 2F61A 1MXDA 1O60A 4NI8A 1UPMB 1J4EA 1XLGA 5GNZA 2PTWA 1V7YA 2P88A 4QJ3B 4GINA 1T40A 2W27A 1EZWA 3URNA 3HJZA 3NQMA 2R1LA 1E40A 1Y0EA 4DYJA 4IXHA 1QHPA 1TREA 3P0WA 2AGTA 1V6UA 1F7BA 5EBUA 3A3WA 5K4XA 3EWBX 1UR2A 3R10A 2WWCA 4DPQA 4JIIX 4MM1A 4UTMA 1FH8A 1HFBA 3DYPA 5FJJA 3PB2A 1AG1O 2G8ZA 2J88A 2Y88A 1ICQA 1QXLA 4IMEA 3KWXA 3HJEA 4UCFA 3K4DA 3RLVA 3WD4A 4HPGA 1AW5A 1YE4A 3NA8A 3WEOA 3MVTA 3BW2A 4PCPA 1XSJA 1HO1A 3CUZA 1CCWB 2CZEA 5HWJA 1GJWA 1U5JA 2BWGA 1UUMA 2X7WA 3CASA 3TSBA 2FHCA 1Q4NX 2KZHA 3IACA 2IQ0A 4LJ3A 1U1JA 1GJUA 2P0OA 4UC5A 4O57A 4JFVA 1TCDA 4H8NA 3D6NA 5AC8A 2RDTA 3GK0A 1GEQA 1B54A 3ITXA 2X0YA 4JTDA 1ONWA 4S1FA 3PVFA 5G4WA 2C14A 4KEVA 4R7WA 1UKPA 1GORA 2J6VA 3W1NA 3NEHA 1YXCA 4GI9A 1YPFA 1PJ9A 1IF2A 2ZX7A 1ZU8A 4H01A 1UHVA 3UXIA 3W2MA 4HZ6A 1TO3A 2J27A 4Q8QA 5EPDA 4TXEA 3CTLA 1I75A 2ZTJA 1CB7B 3VDHA 2G96A 3VINA 3B0UX 2NV1A 1WAWA 3QV9A 2Y2WA 4L6DA 5FJRA 2DVXA 1EPVA 3QR3A 1JI1A 5D9MA 3BDKA 2JE8A 1CLKA 3GY1A 3UXAA 3GXFA 3NUKA 3BQ6A 4L9ZA 4AZGA 1ICPA 4E4FA 4MNJA 4RW3A 5ECVA 2PDKA 1PAMA 3QMTA 1JI2A 2QAPA 4QQ3A 1ZGDA 3UT0A 3PJWA 4O54A 1K7XA 3DUGA 4ZCWA 4M7SA 1V3MA 1RY0A 3GYCA 1SUXA 5HNRA 4XO6A 1MFUA 1XF0A 3O07A 3OBEA 4Z1BA 1DWGM 2R1PA 5A6KA 5DY3A 3PZ9A 4ZO7A 1C8XA 5M17A 4HK7A 3R2GA 4S3EA 2XH7A 4J9JA 2OOGA 3GIYA 4CQCA 2E40A 3P7YA 1GGOA 3CMJA 4RCXA 4BY3A 2X1TA 2B0MA 2GQ9A 2R91A 3BW3A 3WSUA 3MQTA 5ABFB 3N29A 3UGRA 4GQQA 4N9CA 4X9SA 5AHIA 4IGNA 2VGGA 3KVKA 3B8SA 3H4WA 1U83A 3WLHA 1F4HA 5EFDA 2D3LA 3P84A 5EKYA 3WDRA 1W9VA 3N14A 4U3AA 2NV9A 2GJNA 1TMQA 4P8VA 2PTZA 1I2NA 3PBUA 2GJPA 3ZYZA 1OFQA 2ZZ6A 4EANA 1UH4A 3PG9A 4OECA 3WQVA 2QW5A 1TV8A 1NY1A 3PPHA 2BDQA 2G3FA 2FDMA 4F3HA 1RVKA 1W17A 4YMZA 3GU9A 4W89A 1UD4A 1U33A 1AJ0A 1KD0A 4E2VA 5DRCA 3YPIA 4ROQA 1XLAA 3GX9A 1XIHA 3MJMA 1UPPA 4IFKA 2FFCA 2FTYA 1FDJA 4GHRA 4QROA 3QTPA 3OIHA 1GTHA 1GKRA 1ZY9A 3WH9A 4KCUA 4HJFA 2EPHA 1BXBA 4M51A 3BSMA 4HBKA 4E5TA 1L9WA 3LSBA 4DBEA 1HZYA 3B8IA 4JPGA 4BI5A 3HQ1A 5J04A 1TX2A 3ZLFA 1FHUA 4HTYA 1IYXA 4H6RA 1WA3A 4F0RA 4A4AA 1E4NA 4AX7A 2VFHA 3KVLA 1NDZA 3CQJA 4BS0A 2IPJA 1DJQA 4G2DA 2X2YA 1IXQA 2NV2A 1PXGA 2YL5A 4JR5A 5A6LA 5BU9A 3NPVA 4F48A 1KM2A 4GZ7A 4CLMA 1OX5A 2WW5A 3N6JA 1GQLA 1CI1A 1WV2A 4JS3A 4GI4A 2WSQA 5F4WA 1RK5A 3PJUA 2W4XA 5CC3A 3R11A 1WXYA 1Z3NA 2BSLA 1NELA 1SFSA 4QHRA 3H2MA 4NXSA 3CL7A 2PU1A 4LVBA 2MNRA 3WLNA 1LT7A 3BL3A 4CN6A 2P3EA 2ZXAA 4UFHA 2FHBA 1GHSA 3SEPA 5HBFA 1TPC1 3VDBA 1XIFA 1Y5WA 3MO7A 1ESWA 1NP2A 2VD9A 2VX7A 1E9ZB 4Q4PA 4GXMA 1WDRA 1I4NA 5G1TA 1POJA 4PMQA 2WC4A 3KXQA 4FZIA 1S46A 4ZOBA 3FK4A 3JZEA 4ECLA 1NWTA 2VT0A 2ZADA 2A0NA 4UTJA 1AQHA 3BLPX 3TQKA 3MY9A 3UWUA 2J8TA 2P3ZA 1CGYA 3ENLA 2KAUC 3MZNA 3P3BA 1KWGA 1J01A 3DG3A 5T9CE 5I3IA 2NXIA 3UZYA 1OFEA 4RZ5A 1XH1A 1UWUA 4A3HA 4DBSA 3UWYA 3U2CA 2WV8A 2D69A 2C7FA 1LUCB 4G1KA 1EDTA 2PRMA 5CPOA 1RK6A 1V79A 1T7LA 3OW1A 1S2VA 1P0BA 5BRPA 4IIGA 2VZUA 4E4PA 3FJNA 3BSHA 5K9DA 1K3UA 2C0HA 2TYSA 1Y8BA 3OTRA 2ZRWA 2CBVA 1HUVA 1O12A 4XAPA 3UXKA 1Y5VA 4UB9A 1N82A 2QPXA 2I9UA 4XD3A 1MDLA 2XIBA 4GGHA 3PTQA 5I07A 2ZC8A 4CU7A 2YL6A 5AYXA 2YCJA 1XDMA 1MQQA 4A05A 5A8GA 2NZLA 4W93A 2FVMA 4TTGA 3QBUA 4X61A 5FIPA 1G4EA 3B06A 3LMZA 3N3MA 3OP2A 4LC6A 1X8FA 3CV6A 1S38A 2A3AA 2PAJA 1ODUA 1B9ZA 1AODA 4ZQNA 2O9TA 2J7FA 4DWSA 1FA2A 2ON3A 3F2CA 1UKSA 3TTEA 3OYZA 4JIRA 1Q6QA 1JXKA 4S3JA 3NQBA 4PFHA 4GQ0A 3LK6A 2QAFA 1DV7A 3GR8A 5T91A 3LQGA 4IPNB 1EJWC 1B3XA 2PDQA 1ME8A 3MYOA 3GC5A 1OBAA 5ABGA 3WMSA 4AHPA 1XKYA 2IPGA 1FWHC 4WUIA 3N11A 3Q67A 3K4WA 3PB0A 2EAWA 5D2VA 3CGTA 4H1ZA 5IHSA 3A23A 3EBVA 2INFA 4DM2A 1W37A 1FWGC 2ISVA 2E9BA 1ZUAX 2ZZ3A 5CAKA 3JR2A 4LNYA 3W1TA 2HMCA 4XD6A 3O63A 4R9OA 4JFUA 1Q6CA 3UJEA 1ZBCA 4YHGA 4RNHA 4N6FA 5D02A 3QQ1A 3W7LA 3G0UA 3QC0A 3P6LA 4ERGA 5DANA 2OYLA 1TV5A 1BLIA 2VI0A 4N42A 1K9EA 1DJNA 2OX1A 4R85A 3AWNA 3UA4A 3NYDA 4UQAA 1NH6A 3UXDA 3GFZA 5E93A 3MHUA 2VXNA 2J62A 1A4MA 2PD5A 4BI6A 1A0DA 3W72A 2B81A 2J7DA 4N2YA 3VKJA 1P6BA 1EOMA 3BQ5A 4RV8A 2ZZ7A 1ZHAA 4JOMA 2NW0A 4KPLA 3SGUA 4CVWA 3WNPA 4H6QA 4DJEC 2WNZA 5AOUA 1VFTA 3T05A 4QG6A 3KWSA 1IXOA 3EDDA 2G5WA 1VF8A 4G8TA 4MJ4A 5GNYA 3DG6A 3G1VA 3W37A 1PSCA 4FNTA 4I8YA 4BKNA 1JQVA 2GVEA 5D33A 4B2DD 1A50A 3H7UA 3RJYA 1H63A 2R6OA 2EPLX 3WQWA 1EQCA 1YTDA 6REQA 5KITA 3S0CA 4R5EA 3DAQA 3SI9A 2XZ7A 1E73M 2X1SA 1BYBA 2YCLB 5L9FA 3QOKA 3I10A 5FF4A 4LB3A 3UPWA 1AQFA 3HGOA 3V1HA 3W2LA 1H1YA 4ZXOA 4V2XA 5I24A 3AISA 4X9YA 2OT0A 1A49A 3WQDA 3NSMA 4D9PA 1OT1A 1P0DA 4J3XA 4HA1A 1MZHA 3L4VA 1ZTVA 3VGGA 2OKTA 4IFRA 3LXCA 2PU0A 3WCZA 1VPQA 2VURA 3QY6A 4JIHA 2WQPA 1PE1A 2D0HA 2QS8A 3N2XA 4JTIA 4O0QA 4I90A 4ENLA 1QI2A 3STFA 1H62A 2ATSA 4ZENA 1PKLA 5C55A 4J2PA 5HXMA 4P8WA 2Z7KA 2PGFA 2Z6IA 3NO1A 5F4XA 5ECUA 1RPKA 3TOYA 2O4QA 2NQLA 1GEHA 3NO5A 5EB8A 3R8GA 3TVAA 4PMYA 1I0BA 2YDQA 3L67A 2I9EA 1MNZA 4AIBA 1TX0A 1O1HA 3FA5A 3G1DA 1VIWA 1HQTA 1AQ0A 3PTDA 3VCNA 3EOEA 4L1GA 2PDMA 3PJXA 4PC8A 1AVAA 4FNQA 1J2WA 1F07A 5LHEA 3CHCA 3R7MA 3VGDA 3KP0A 3GDLA 3LCFA 1MW1A 2ZTKA 3IV3A 3B8VA 4B3KA 3CUXA 3ITCA 5FJTA 2D2JA 4PEKA 4GABA 4PULA 3WK1A 2VZTA 3W88A 4BR1A 1HKKA 4H2CA 1VRXA 2ZICA 3CB8A 5LNSA 3QZAA 5JVLA 2Y62A 2BX7A 4MHBA 1S5VA 1WP6A 1OCQA 3PBMA 3SGZA 1XH2A 1HNYA 4Q8UA 3OYXA 1YQ2A 3BLIA 1K1DA 2E77A 3U4AA 1WE5A 8RUCA 1FP9A 5LHFA 2QF8A 4J7RA 2WMGA 1BYDA 3APGA 1J8VA 3MANA 3BLDA 2Y7EA 2OPJA 3THCA 3WQ8A 1C90A 4O0ZA 4AWUA 1WDPA 3WLSA 3LB0A 1TV4A 3W75A 4GCAA 2GWNA 1GOQA 3GBDA 1DJGA 4XKMA 4AD5A 4S38A 5AHFA 1EC8A 3AMGA 2OQLA 4Y8FA 2PDFA 3EPNA 3MI6A 1XRTA 3W00A 3AYSA 3QPYA 3O6AA 1UYQA 3BC9A 2WZTA 4U31A 3S2LA 4H9TA 2J9YA 4Q22A 3AROA 3RDKA 1X6LA 1TJ1A 3ARZA 1W3JA 3S9YA 5M5DA 5FD0A 1HW6A 2FB2A 2IPFA 4UFMA 5EMKA 4CQBA 3M1ZA 2DVTA 4QISA 4KEZA 2V82A 1F3WA 3TTOA 2VFDA 4IIHA 4AZ6A 1YYAA 4IQEA 2ZYFA 1WAUA 2O56A 2V0TA 3OA5A 3WQGA 1NFGA 4FB7A 1T8XA 1HO4A 3KBSA 3EX3A 1ONEA 4Y9PA 1JZ6A 1OCJA 5CZJA 2ZE0A 4ZSTA 3RRXA 1PX8A 3EB4A 4ATWA 4YWSA 4QP0A 3MP5A 4DY1A 4L80A 2C3ZA 2OSYA 1AZ1A 1RR2A 1XIJA 5JMUA 1I45A 2QDDA 2V81A 4PMNA 2PE4A 4C6OA 3ARWA 1VGAA 4LTSA 4DNHA 2VR2A 4WDTA 3BXWA 4O15A 1EP2A 3PZGA 3T0DA 4S3DA 4K38A 4F2BA 3QOMA 4C90A 3MUZ1 1EA0A 1FWIC 4J28A 1EDQA 1VHNA 4U2ZA 4DI9A 4O11A 4W8AA 3W2KA 2UWFA 3LI1A 2OQHA 4UTIA 2WKLA 3NVTA 2V68A 3O6CA 1PTAA 3ZOAA 1UD5A 2HVNA 1CXKA 5HUOA 2PWVA 2A7RA 3SDOA 3S1UA 2VC9A 4HHPA 2OCZA 1XLDA 4BCEA 1GW9A 2PMQA 2Q71A 4BHYA 1PYMA 1A5LC 5JXQA 1FHDA 1LOLA 3W7QA 2Z2AA 3LRLA 2DJLA 3BJFA 1UQZA 3LM3A 2QNEA 2X40A 6A3HA 3O0FA 4NZJA 3QVQA 3HMJG 4DB7A 3NVDA 5BRBA 3WH7A 4J3UA 2ZDSA 5IDIA 2ZBTA 2GGGA 2GOUA 3ZFHA 1JNEA 3LBMA 2EGZA 5I09A 3NDOA 1OIFA 3F2BA 4KEUA 3GHUA 3VD3A 4ZTYA 3L21A 2XSXA 2P0IA 5HAOA 2VFGA 1GOOA 3IS4A 1LWHA 2OLHA 1EUAA 1FQ0A 3TP4A 5KSWA 1Q6EA 1G9HA 2BGQA 1S3TC 1U5VA 2RJHA 2DSVA 3S1WA 1RUSA 2ZRYA 3WLMA 2J77A 3UZWA 2X0HA 2VR5A 3UWEA 4HU8A 1E4IA 1LL4A 3IWPA 1FOBA 1YKWA 5KZEA 3HPSA 3CO4A 2NVDA 4U33A 3TC7A 4UMCA 1OIMA 5XINA 3JS3A 5DEZA 4JTLA 3NEVA 3GZAA 3W27A 2IQDA 3KLLA 4XUYA 4MFDA 1XQKA 1YDOA 3CIVA 3V3WA 4YTSA 3UFYA 4AZ5A 5DMNA 2PCEA 4YXGA 1YMYA 4XV0A 1C93A 2PDUA 2F7FA 1W5NA 4M6UA 2X0SA 1RBLA 2TMDA 3ERPA 3SCWA 3VIKA 2R9RA 1TMLA 2OB3A 2W92A 1VZWA 1XYZA 1YDNA 3I65A 4FX7A 2JKEA 5TNVA 1P6CA 4PGLA 1XDLA 5KZMA 1WQ5A 2YFOA 4RZ6A 1VBHA 3BLLA 1QHZA 3VFCA 2ZUWA 2ZA3A 4Z17A 5AY7A 3P61A 4I7VA 3RFAA 2PSNA 1GVIA 2CERA 3H22A 3OODA 2X7VA 5IFTA 4HTBA 4B5SA 4D71A 3UQNA 4HZMA 4P2VA 4WVXA 5D9OA 1ZPTA 2I17A 2PFHA 1XC6A 3O06A 3QZ6A 3AYVA 4JFTA 1PZ1A 3IUHA 4DZAA 4ZODA 3P5ZA 3MVIA 3TTSA 3O6DA 3ME3A 4XBSA 2WC3A 2VEFA 3WD0A 1EEXA 2PWFA 4GXPA 4J1OA 3WDHA 4TIMA 2GVGA 4PFMA 3WEZA 2VCBA 3LY0A 3E0LA 3I68A 4NJKA 2R1NA 1K77A 1Q6FA 3H2OA 2Q3RA 4UCGA 3W85A 4O8AA 2FPYA 3VD7A 1U5HA 5XIMA 1ISYA 2REQA 2WVVB 4I6KA 4H3DA 1ICSA 3UCDA 1FRBA 3USZA 3F4VA 4P7OA 4H8VA 1JYWA 1JAKA 2P8CA 2Z24A 1Q6RA 1TV3A 2P8BA 4HPJA 2GVYA 4PCFA 1XSKA 3LHWA 1TPWA 1QW9A 2AQWA 2Z7GA 3LMYA 1J10A 3TXZA 4V33A 3VIHA 1R85A 3DBPA 2DH2A 1E1EA 1A4LA 4XAFA 4AW7A 1XSIA 4Z1YA 1BYCA 3HPFA 3ZR6A 2GPTA 3BURA 4UOQA 4REQB 3ITGA 2FDSA 3BMWA 3UWQA 1JCMP 5E0CA 2NX1A 3GXTA 3QQ0A 4N4PA 2CLMA 4OWGA 4GKLA 4LF2A 1SR9A 3UR8A 3C2EA 3WBWA 1PVNA 1AJ2A 2QCDB 5E09A 5J5DA 4JAWA 4B9YA 4QJ5B 3A3HA 3LHVA 4N6EA 4N9EA 5U7SA 1KNWA 2QUNA 5LZLA 3AUJA 3LHZA 4EXAA 3EMZA 4FOKA 4LS1A 1RQBA 4UFJA 3EEGA 1W91A 1O6IA 4MB3A 5GPRA 5DMYA 1I2RA 3AALA 4JTFA 3NQFA 1IWPA 3NL3A 4JHZA 3BARA 3H53A 3PUOA 5HQMA 1ONRA 3ONBA 5CLTA 1W5PA 6XIMA 3GFYA 3QV7A 4DUWA 5L6UA 2PLCA 3IIXA 4R7OA 2FVLA 2C1HA 3LU2A 3UW6A 1YDYA 1CDGA 2P53A 2I1OA 2W0UA 3DENA 1Y65A 2UV8G 3T8QA 3WQFA 2DQWA 2QCNA 3DX5A 2NXGA 4GIAA 4X0NA 2FMNA 1Q63A 4IL0A 8TIMA 2VQTA 3QV6A 1EOKA 4NYYA 3QKEA 3B9DA 3CT7A 3KL0A 3L4UA 4H8UA 4OE7A 3ES8A 5CSRA 5BW6A 1UBSA 3DFYA 4C1LA 4B4FA 3KRSA 3TFXA 5CSUA 1FWTA 1POKA 2ISDA 2D2HA 2OR2A 2BB0A 4JD4A 1TFVA 4Q8TA 5C9UA 4QR6A 4C7FA 1PKMA 4N0RA 3DIPA 3UY8A 3UPMA 3CQIA 3WH8A 2JEQA 4JIQA 1KRCC 3S8HA 1P5BA 2IKHA 1PZ2A 4JTSA 1K70A 1XBZA 4AIOA 3TYZA 4L1WA 4HU0A 5DBTA 3GTXA 4KT2A 5CPTA 1PYFA 2WQDA 3GHSA 2DORA 1Z32X 4XZBA 1XIIA 4UTHA 2J7GA 2ZZ4A 1W3IA 1HVQA 4WQ6A 5CAHA 4MWAB 2BOEX 4TU1A 1ADOA 3UNTA 4EXQA 4ZMGA 4F0LA 1YBQA 3MJYA 3MP4A 2BLEA 4YYFA 5JIPA 3TZFA 1DHPA 2DUAA 4X3ZA 4WRHA 5KZ6A 3O6YX 1GPWA 1FVPA 1KFWA 1ZBWA 5KINA 4R88A 8A3HA 3C8FA 4GY1A 5AN7A 1AJZA 3R58A 3GXNA 1ME9A 2HCVA 3EYPA 4XIMA 1G67A 2XVNA 4NX5A 1QK2A 3SN1A 2A6NA 3QKZA 2J8GA 4JZ5A 5D2XA 3VZYA 4JYDA 4POCA 3O05A 3PWIA 4AYSA 2XM2A 3WQCA 5BU6A 3SY1A 3TE9A 1FWAC 2CLIA 5A6SA 1D8CA 3V4BA 3G1RA 4GACA 3UA3A 3W23A 5HQLA 3BMVA 1R47A 3S5YA 2VX6A 2A6LA 2CHOA 3PZUA 4YNGA 2YB4A 4R27A 5H8PA 4TVDA 1GWJA 3CUGA 1UOKA 1GQIA 4ERAA 3HGSA 2G3IA 2HE5A 3KOZA 3SSZA 1M7PA 3TAKA 1PTGA 1UUQA 3RCYA 1A80A 1T0OA 1CYGA 1OG0A 4NNBA 1W0MA 2XISA 4K7VA 3SCRA 2OKOA 4NAFA 3Q37A 3AYTA 1NOUA 3UF9A 2WBKA 5LGZA 1Q3NA 1F61A 4GJ1A 3CV7A 3H2CA 2PI6A 4O50A 4K36A 4HIBA 1WDQA 2POTA 2V5KA 3FYOA 2XPKA 1JYVA 1NQ6A 5CPSA 4GNKB 3A9IA 4XVDA 3LCIA 3AS3A 1HTIA 1KBBA 4A3UA 4QCEA 2Z00A 3CHVA 3PPCA 7ENLA 2JKAA 4WK9A 3L0KA 3EWUA 4PRTA 4XZ9A 1XCWA 2ZVIA 2VZOA 1GJPA 2YCIX 3AIUA 3PJTA 4FEZA 4J35A 5F1UA 4MFEA 2VC5A 2GDQA 3I7QA 3G1FA 1PCWA 3QRHA 4PB3A 1SU5A 1IIGA 3M5YA 1W9BM 1XLCA 3P0XA 4JNYA 1E5NA 4HNUA 2Y5JA 3U2OA 4HHMA 5SWUA 3CLWA 4W9TA 3MC5A 4HU4A 1TSIA 2OLSA 1AZ2A 3WLJA 2WSRA 2D2OA 1XFBA 1XX1A 3GW0A 3PZNA 3G3DA 4YYCA 1IZJA 3GG1A 3F5LA 1IWBA 3MKCA 1JCJA 4DHGA 3PBGA 1W3KA 5CPLA 1DVJA 2YDAA 3FKRA 3TZNA 3MT1A 3WY1A 4AZHA 4UQBA 4S3AA 1GONA 1DWAM 1W3TA 1KXVA 2FPVA 4NILA 2GSJA 3BO9A 3QLLA 3IJ7A 1WUFA 3PSVA 4FP1A 2DW7A 2RGMA 4JTRA 3TMQA 3B4YA 1UD6A 4W5ZA 3DHPA 3O2LA 2QCCA 3WQ6A 3FGCA 3PZOA 2QHAA 1MNSA 4XG1A 1VRDA 2XFYA 3ABSA 4DI8A 1OYAA 3AIQA 3T55A 3LV6A 1RPXA 1R30A 1OC5A 4XD5A 2WB5A 3VIMA 3ARRA 4QNEA 3BAIA 3NQEA 3TQ0A 4IX2A 2EPNA 1K4GA 4UNLA 3SY8A 4GWEA 1EX5A 3E74A 1GQKA 2Y89A 1JZ4A 3NZ1A 4Z42C 3GC4A 3VNJA 1LBMA 4M82A 3REQA 2D0GA 2DH3A 2PC8A 3GVWA 3LCWA 3ZM8A 2Z2BA 4Z1AA 4XZIA 3E96A 2GQ3A 3W25A 3H70A 2NSXA 1YNQA 1E6SM 1UROA 4X60A 1H2JA 2XGIA 4XISA 1IGSA 5G5IA 2AMXA 3ANUA 3DERA 2QUTA 2QDHA 1XC4A 1MO0A 1FWNA 1OX4A 5REQA 5JIWA 2DZSA 2ZX9A 5BOFA 1A5KC 1DJWA 1GCYA 3TNBA 1NF0A 4PUWA 2XU2A 5FJPA 8XIAA 1V0KA 4B90A 4PMXA 4QFUA 4G1NA 2G50A 2D22A 1FWEC 2O9RA 4IPJA 5ABFA 2EKGA 5D32A 1GVOA 3EWDA 4RL3A 3TLQA 4GIYA 3KHJA 2DZPA 1A5AA 5TF0A 1DWFM 5HR7A 3RX4A 1X7IA 5I03A 2W3ZA 2PTDA 1S5MA 3RAOA 3UR5A 4UTKA 3WQOA 4UZSA 3TYAA 3R1ZA 1QRQA 1PUDA 5CC5A 5KZDA 4CCEA 1NARA 4YTQA 1WZLA 1VBGA 1J96A 2VX5A 1V6TA 5CXPA 1J0HA 2YYUA 2ISFA 1OQFA 4XD4A 1TKKA 3K13A 3BCDA 3TW6A 2VWTA 2KX9A 5A2CA 3O9NA 3H8AA 4WY0B 3MSGA 4IQLA 3NSNA 3SSJA 2WLYA 1EJUC 3HU7A 3T8LA 4LEFA 2I16A 1AD1A 2GZXA 4HNOA 3SIMA 4MYXA 5DQPA 1QPNA 1SFLA 2FJKA 2VD8A 4XO7A 1XIDA 4IGHA 1BVZA 1DQWA 3H4GA 4A35A 5B7ZA 4DO4A 2CBJA 1WYIA 4Q7BA 2J75A 4P7RA 3PZQA 1PV8A 5FEWA 3CMFA 3EGJA 1E9IA 4NZFA 3QW3A 4PMJA 1E1CA 3EXSA 1DTNA 1FWSA 1R46A 2JQXA 3G22A 3WLPA 3HMCA 1DYSA 2BV9A 3RPMA 4LFYA 5FSDC 4RXGA 2JF6A 3WKZA 1O94A 1ZENA 4IICA 1E6ZA 1I2OA 2C1GA 4JX5A 2J9XA 1WOBA 4RDZA 4DWSD 4AF0B 3WYZA 4IIDA 4O14A 3VIOA 2FMOA 4ZOAA 3LDVA 4ZO9A 4NG3A 3LERA 1PIGA 4FX8A 3BJSA 3GAKA 4RE3A 4DUXA 3B0PA 5CC7A 2HNHA 4YWIA 2ATMA 3SUTA 4A3QA 3E0IA 1P48A 1TPDA 4Q8PA 2ZVRA 2Z6JA 5BCAA 2WMIA 1KTBA 2IPWA 4KWVA 4PB4A 4URIA 4U5IA 1UUOA 1QJWA 1U2YA 2DZXA 5T26A 5K7JA 4I9JA 3NQAA 1UBPC 3TR2A 1KFCA 1LUCA 4X2RA 3MHGA 1HP4A 1MUWA 3CV1A 3LNMA 4AXKA 1TPFA 4HMCA 5BZAA 1JCNA 3N19B 4OUEA 1B5TA 1UP3A 4AUBA 5AKQA 3IPWA 1CGWA 3CAKA 4UWMA 1FKXA 3NQDA 1OX6A 3RR4A 3BAYA 4C6LA 1GOKA 2P5NA 3VUPA 4AX6A 1PS9A 2Z2UA 4DO6A 1BEUA 3VIGA 4LW7A 2BVWA 2WHKA 4B9ZA 3S5SA 2BY2A 1FX6A 5EYWA 4WXYA 5HPOA 3ONCA 3A5FA 3EX6A 3MMDA 1ITXA 4MF4A 4HNLA 1DOSA 3M46A 1H7PA 3ZT5A 2HS8A 3B0YA 3M41A 3AWOA 3OJGA 3BGAA 4ZVJA 1JPDX 4NJGA 1F6YA 4H83A 4ICNA 4LVFA 1ZJIA 4O1CA 4OZOA 2R1MA 3D3AA 3L66A 4NAEA 1QWGA 3K5XA 3TXVA 5BWFA 4W4QA 3EMQA 1BSIA 3II1A 4M56A 4UZUA 3EZ4A 1M41A 5D09A 2VEGA 2GSHA 1QTWA 3G1XA 4PTDA 1JUBA 3U6WA 1KFLA 4KERA 4ZL1A 3ZO9A 4X22A 1IT8A 3NGFA 4IMCA 4S23A 1DXIA 2WJFA 1ZFJA 2V38A 3WUFA 2OZ8A 4QJ1A 2A1YA 1A53A 2QGHA 1OC7A 3G24A 4AZCB 5AZ0A 1I1WA 1RLDA 2DEPA 2ESCA 2X16A 5IM51 2W62A 5K4ZA 2PS2A 1MEHA 1QOPA 3XINA 2ZIDA 5AB3A 1GZGA 3F4NA 3BMXA 4H00A 1IXPA 2RUSA 4DAFA 2BOGX 3CYVA 3VX0A 2QCEA 1F8IA 3T0AA 4MB1A 2OGJA 4H7VA 1FKWA 4UTFA 4ICMA 3LS9A 2DT0A 4JYEA 4KGJA 3W2UA 3KVMA 2VJXA 3PPFA 2LLEA 2V5BA 3WBAA 2IMRA 4C1NB 4G7EA 3UU0A 4QG8A 4W8LA 5DFAA 3FJ4A 5G1MA 1GW1A 4L7ZA 1JJKA 3SECA 3GU1A 4JN8A 3UR2A 1OK6A 2Z25A 3E1F1 2XINA 1X38A 1V0NA 4JHOA 1JR1A 1N8IA 2GSEA 3RUBL 3W38A 3PN8A 3HB9A 4XAGA 3WEMA 3PTMA 2Y24A 3KL3A 3AC0A 4TR9A 1FHLA 3PR2A 3SUUA 4OKDA 3AXKA 3UCCA 1ML1A 1HVXA 4WSHA 3ZMRA 3HQOA 3KCJA 1J0ZA 4OBRA 1RV8A 4LUJA 4LBSA 4OBSA 5JH1A 4OUIA 4DNMA 4GA8A 4IISA 2C16A 1KRAC 4JTHA 3L0NA 3KRBA 3VOCA 5EMLA 2F6XA 3DFSA 3W7NA 3GVGA 1ADDA 4WKHA 3TONA 3WBEA 5BXPA 1IGWA 3VGBA 1ITCA 1ISXA 4Y8EA 1M9HA 1UKTA 3DC8A 2ZWYA 2WZHA 3E2SA 4UMBA 1W5QA 4LU0A 4S2CA 2IUZA 4OHQA 3BSGA 4B3ZA 1K4HA 1EWEA 2NUWA 3F1QA 1QWKA 2NVAA 3WL1A 3OLIA 4LAZA 1X7FA 4A6GA 3T09A 3TC6A 1O66A 3C0LA 4IGSA 4CCZA 3MSYA 1GPFA 1K03A 5TQLA 3L4WA 2VP8A 1RJQA 3SGGA 3M0IA 2HTMA 4WIWA 4F0SA 1YPIA