1H2JA

Endoglucanase cel5a in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-cellobioside at 1.15 a resolution
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE 5A
publication title Direct Experimental Observation of the Hydrogen-Bonding Network of a Glycosidase Along its Reaction Coordinate Revealed by Atomic Resolution Analyses of Endoglucanase Cel5A
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 123
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1h2jA00
4QLKA 1KQZA 3B9AA 4OKDA 3CUIA 1HJWA 1XD1A 3VX0A 3NYDA 1GVYA 1QHZA 3AIQA 3RM8A 4M56A 1V02E 2CBUA 3M7SA 1FH7A 2XSBA 3AOFA 3WUFA 1DWHM 1XSKA 2W61A 3NCOA 4HZ8A 4BA0A 3WD0A 1V6XA 2PC8A 3AMKA 3CZKA 3O2LA 3VUPA 3ARSA 2HVMA 4P8UA 3AIBA 3GDBA 4GO9A 5C8BB 5DFAA 3K8MA 4JFUA 2FGZA 1UQYA 1X6LA 5E6YA 3NSXA 4F79A 1NM9A 1UR9A 1W9XA 3N04A 4B3LA 2VZOA 4RL3A 3AS1A 1BF2A 3CUFA 5DT5A 3BAXA 4JCLA 2J7EA 4HA4A 3CPUA 3CIVA 2WB5A 1G5AA 4PMUA 3AMCA 1M03A 3VPLA 3LMYA 1KFWA 1IZKA 3CGTA 2YLLA 3EMQA 1WPCA 1KB3A 1V0NA 2EPKX 2XFFA 5CPQA 3EYPA 1W91A 5A2AA 3VIMA 4M8UA 1CIUA 4MB4A 4EANA 1KGXA 1BYCA 3L4VA 1M53A 4PSRA 4PMXA 4QAWA 4MJ2A 1V6UA 3ALGA 4CU8A 1LQ0A 1BTCA 3D3AA 4TOQA 4PBGA 1PEZA 4H2CA 4YN5A 1CGXA 1JG9A 1UKQA 4GZEA 4HU0A 4BQ5A 4KH2A 4MTVA 2J7DA 3BAWA 1V3IA 3KZSA 2QPSA 4OBRA 4PMNA 3EBVA 3WUGA 5A6BD 3ARWA 3L4YA 3AZTA 4F8XA 3FAXA 3SCQA 3WNLA 2WMIA 1R8LA 5GQBA 3SIMA 2WC3A 1OD0A 6TAAA 4J3TA 4OZOA 2NT1A 1AMYA 2BHUA 3AYSA 3PTMA 1WKYA 1RD6A 2CHOA 3AXIA 4J3VA 1GOWA 1XCWA 1QBBA 3BSGA 5HDRA 1S46A 2WZIA 1WDPA 1CEOA 1QBAA 2ZICA 2VRQA 4IPNB 3GXMA 5CPSA 1H4PA 1W1PA 1G1YA 2Y2WA 3SURA 1CGUA 4R5EA 3MUY1 1V08A 2VQUA 1E15A 3WDIA 1C7SA 1WZLA 2OWXA 1B3XA 1CLVA 5BYWA 4JFVA 2D20A 3TTSA 2J7BA 3WQ5A 3EDJA 1U2YA 1VFUA 4CN1A 1JXKA 2W92A 4CD7A 4HA3A 1ZBKA 2YL5A 4XZBA 1JZ4A 3AICA 1FFRA 3MSDA 1MFVA 2GFTA 2WSKA 4WKFA 1ZL1A 2W66A 1I1WA 1E6SM 2DH2A 1OT1A 1CDGA 4M81A 3WD1A 5BXPA 2EPMX 1WP6A 2VC9A 3FNDA 3ARUA 1EOKA 4XV0A 3N18A 3RM4A 4EKJA 3W27A 3TTYA 1E3XA 1M7XA 3VIIA 2O9PA 3AZSA 5ABHA 1Q6GA 2GVYA 4W93A 3W6LA 1EDGA 3PZUA 5ABEA 4OIFA 5LA2A 4XZWA 3RILA 2OSXA 3ZSTA 3WQ4A 1J10A 5FOOA 2D1ZA 5CXPA 2VZSA 4CCCA 2VCAA 4WLCA 2UY4A 2E8ZA 1LG1A 4K68A 4UQ9A 1CBGA 5CG0A 2UY5A 3ZIZA 1B2YA 2Y5EA 1JDCA 2DT1A 2JEQA 3VGDA 3ARZA 4HMEA 3ZSSA 4HZ7A 3SUWA 2WC4A 1IT0A 1XHGA 2EJ1A 3J7HA 5BXSA 3UR7A 1VF8A 4F9DA 3T0AA 2PWDA 3SCOA 3VNZA 4LPCA 1UD8A 2J8FA 4PEEA 2WKLA 2XGIA 4U5IA 3WEOA 3WQ8A 5A2BA 1AVAA 1GOKA 1UOKA 4E8CA 1CZ1A 2YA1A 4J28A 1VEOA 3WN6A 4H41A 4UQBA 1NOUA 2WMIB 1ZBCA 5A69A 2E9MA 4JL2A 3ECQA 3IAQA 3L4TA 2XM2A 1OCQA 1JF5A 1NWRA 1Y7VA 4NZCA 4GXPA 3WNOA 1MXGA 2ZUMA 4D6FA 1Q6DA 1QNQA 2DSVA 3K8KA 2CESA 1UD2A 2DT3A 1FHLA 2D24A 1R87A 1U30A 1W1YA 2J7GA 1JYVA 4MNLA 3PZNA 4U3AA 2PF0A 1KCLA 1JZ7A 4AWEA 4PTXA 2WAGA 1UD6A 5A6JA 2WZEA 2Y4SA 4P7LA 4AD4A 1CGWA 3RPMA 2NSXA 4UOJA 5HXMA 3AS2A 2OYKA 1XCXA 3W25A 1NOWA 3WD4A 5HNNA 3QR3A 1XH0A 3MO4A 3ARQA 1TG7A 4JHOA 2BXYA 4D6IA 5AY7A 2F2HA 2V3GA 2O9OA 1V3KA 2VT0A 4ML4A 4EE9A 5HPCA 3ARPA 5BCAA 3A6OA 1BG9A 3AS3A 3WUEA 4AYSA 4Z2IA 2DGAA 3QOKA 3GH4A 3UG5A 4UZUA 4D71A 4B16A 1WAWA 4A3HA 2QMJA 3VIKA 3VNYA 5JBDA 3WEZA 1E0WA 2CEQA 1LL4A 1OGBA 1QNSA 3WMBA 4PSPA 4UOZA 2BY3A 1EA9C 4JFTA 3N15A 5DO8A 1RH9A 2WK2A 1H41A 1WDSA 3BLKA 4DWSB 1GQKA 5FL0A 5I23A 3U57A 2YA2A 3IK2A 4H04A 4F66A 1PZ3A 2CBIA 3K8LA 3CLWA 3W24A 1ISVA 1UKOA 1UWSA 2CITA 3AIWA 4H8VA 1L8NA 1W1TA 3WF0A 4CN4A 2QHAA 5DMYA 3GM8A 5E6ZA 3VIFA 2O9RA 1BVZA 4AZBA 1TA3A 4LQ1A 5CSUA 3FY1A 1E1FA 1VEPA 1NWSA 3CTTA 4AMCA 2J7CA 3UESA 1Q6FA 1VFMA 1E9LA 4PN2A 4CD8A 4WK9A 4CU6A 1J18A 3K4AA 3L4UA 1TZ7A 4XX6A 1G9HA 2GUYA 5FKYA 5A6LA 1XSJA 2BVDA 2XUCA 4CD4A 1I1XA 4E8DA 4CKQA 3U7BA 2GDVA 4AIEA 3ZJKA 1G0CA 4X0NA 4CCDA 4AZIA 4EK7A 2CXGA 2IUZA 3CBWA 1AQHA 1Q6EA 1V6YA 3W4RA 1ZB5A 5FCZA 5A6BA 1EHNA 2D3LA 4NF7A 2EQDA 1L0PA 2AAAA 4PUDA 3WFZA 3WKZA 2YDSA 2FH6A 3RDKA 2WCGA 3NSNA 1BAGA 3B8SA 3L2MA 1MQPA 3ARVA 3DYMA 5D9OA 1JZ8A 1J11A 2BHZA 1W1VA 2VX4A 5FD0A 1LWJA 1E72M 1R86A 3VMPA 4AEEA 1OGGA 3WNNA 1O7AA 4BQ2A 3W29A 1W3KA 3RCNA 3A4AA 3MUZ1 2BXZA 4AEFA 3FAWA 2CHNA 5JBEA 1J01A 1KXTA 1H49A 4CVWA 1VEMA 3WUBA 2XHYA 2DSWA 7TAAA 1F4HA 4D6DA 4IPLA 2VMFA 2DSUA 2ZWYA 3A3HA 4WSJA 4HOZA 2Q8XA 4CU7A 4PTVA 4AW7A 3SEPA 4MDOA 1NWUA 1QI3A 3N1AA 4Q7NA 5M5DA 1CYGA 4XUYA 3VILA 4AD0A 3M07A 4OUEA 2E4TA 2WZHA 4KRTA 4UZSA 2UY3A 3UERA 3BC9A 3FXYA 4JAWA 2WMJA 3MKKA 3VGBA 4P7NA 4LX4A 3WENA 1GJWA 1PX3A 3KL0A 3MMWA 5LA1A 5IHSA 1LL7A 3RIKA 3CZJA 1CXKA 2WLYA 3SUTA 2A3EA 1GOQA 4CD6A 1BYAA 3SUUA 4P7OA 4PCTA 1VJZA 2BNJA 4TUFA 1US3A 4TXEA 2VL4A 3AYRA 5IXEA 4OBSA 2YL6A 3WNKA 4ZE5A 2VUYA 2G3JA 2ZOXA 3VIGA 1XC6A 3W82A 3AHYA 4S3KA 2X2YA 1W3LA 1KXVA 2YBUA 1UWIA 4W87A 1V0LA 1G01A 1W2PA 2BHYA 3THCA 1CENA 1KBKA 1KQYA 1UKPA 4LYQA 3ZT6A 3TP4A 4ACZB 1BYBA 2DIJA 2ZX9A 2PBGA 2QLYA 1TMQA 4JL1A 3W26A 2GK1B 4FLOA 3TA9A 2AOSA 1LJYA 3QGVA 1W32A 1D2KA 2XM1A 5JBFA 4HOWA 4LGXA 3VIJA 3CUGA 1VJSA 3PZVA 3VMOA 2WW5A 3N9KA 3WH6A 1TCMA 3SCVA 3MANA 2NW0A 1GPFA 1KXHA 5I0DA 2JF7A 3S6TA 2WLZA 2JF6A 4JHZA 3CMJA 5A8NA 1VIWA 3BGAA 1SFSA 1US2A 3BXWA 2VRJA 4HP5A 4U31A 3LPOA 2CERA 1WO2A 2CKRA 3TOPA 5ABFB 2VO5A 3GBDA 2ZXQA 3WL0A 4DUXA 3UCQA 1U33A 1ITCA 3GXDA 3CZEA 2BS9A 1ODZA 4UQCA 2WWCA 1JNEA 1JYWA 5CQ1A 1E4NA 1GOMA 2C8NA 2WWDA 2XGBA 3GYCA 4E4PA 4TX8A 3W53A 4LXFA 1XGZA 3UR8A 4RE3A 2WHKA 1JNDA 3VM5A 1UD3A 2NT0A 1EO5A 2TAAA 2PWEA 2WVVA 4U2ZA 2UY2A 3RJXA 4FK9A 5I78A 4H8HA 4QCFA 1XRVA 2PI6A 4RE2A 5A8MA 1E0XA 1HF6A 4OOZA 2CETA 3PZOA 3AI0A 1JYNA 1VBRA 2VJXA 2ZUNA 3WDRA 3DC0A 4M29A 3AIUA 1OT2A 1MQQA 1ZJAA 2J75A 1HJUA 4MB3A 1Q4NX 2EPOA 3VIHA 1ZBWA 5EFFA 4HA1A 5C71A 4LYRA 3ARYA 4TTUA 4HMCA 1QHPA 4AZCA 3II1A 4W85A 1NP0A 4PMQA 2XYLA 1M04A 4GZIA 1EXPA 4C7FA 3ZJ8A 5FL1A 5TD4A 5I2UA 4CCEA 1BGAA 5I3DA 3DECA 4LYPA 3E1F1 3THDA 2XIIA 3VGFA 1CPUA 4GKLA 3PZ9A 3VX1A 1XYFA 3WQVA 4QLLA 1E6PA 2WVSA 4WSKA 1UWTA 4V27A 1OD8A 5JUVA 2ZUWA 3VIPA 2BY1A 1HVQA 1GOIA 1SR0A 2ZUUA 3EDDA 2ZUTA 1J0JA 2WBKA 2G4FA 2AMGA 2D23A 2VZVA 4J3SA 5CLWA 1CXIA 1PX4A 3M6DA 2CKSA 4M24A 1M01A 4UNIA 1WZMA 4AISA 1UKTA 2J62A 5DT7A 3VDCA 1FA2A 1O6IA 2DT0A 3CMGA 3CUJA 4L4PA 4FF5A 1PIGA 2CIPA 3WF2A 5E70A 3VDHA 1UD4A 1W9BM 1GHRA 4MDPA 1LL6A 2W5FA 2WBGA 3BAIA 1UYQA 2GSJA 4MB1A 4GQQA 3ZM8A 2J78A 1CGVA 1BQCA 1GW1A 3HMCA 2WCSA 3BLPX 1OB0A 2ZX6A 3GH5A 3MMDA 4QFUA 3U5UA 2PB1A 4WIWA 3VM7A 8CGTA 2V5DA 1V02A 1E56A 2ZXAA 4GI9A 3B9EA 4YHEA 2YKKA 2UWFA 1GHSA 3LPPA 4KGJA 5IHRA 5GNZA 1G94A 5AYBA 3SCWA 4PMYA 4FLQA 2PBOA 1TUXA 2XPKA 3NIYA 3WQ6A 2J77A 1BPLB 3BAJA 1UKSA 3BCFA 3EMZA 1ZU8A 1V3JA 1JZ3A 3W0KA 2VQTA 2XVPA 2IXVA 2YBTA 1E55A 2GJXA 1R85A 3AIRA 4ZXLA 4AD3A 3T2QA 1WB0A 2W67A 1EH9A 3WFLA 2MANA 1UHVA 1JYXA 2VVSA 2BVYA 2ESCA 2BY0A 2XVNA 1HJSA 3VD7A 3F5KA 4E2OA 4GI6A 2ZXDA 4GPNA 2G8ZA 3WH9A 2WPGA 1UH3A 3K46A 3NSMA 2CBJA 2VZUA 1UR0A 2IXUA 3VVGA 3ALFA 1UUQA 1JI2A 1QI5A 4PMZA 3MUAA 1E6XM 1ZJBA 3CHFA 2E3ZA 1BSIA 5EMYA 4AC1X 1ISZA 1K9EA 2E9BA 2WM0A 1JD9A 1FH8A 3ARRA 2WMHA 3OGSA 4MB5A 1XV8A 1LG2A 2XFRA 2BVTA 1UR2A 3LPFA 2WYSA 2PWHA 3VINA 1KGWA 3WDPP 3ZQ9A 3IJ9A 1QI4A 2WCAA 5KZ6A 3PZMA 2EXOA 1WNOA 3MMUA 1KR0A 3G6LA 1MW0A 4GO8A 4WJXA 2QF8A 1V0MA 4D6CA 3VO0A 1CNVA 1GVIA 1ISXA 2YOCA 3GTNA 4HPGA 3WH8A 1BFNA 1XYZA 2VCCA 3PZTA 3MUIA 1GOOA 3RJYA 1MW3A 4W8AA 1PIFA 4C7DA 1TE1A 5HOSA 3WELA 3BMWA 3ZR5A 4JKMA 1B3VA 4IISA 3SCTA 1HXJA 2ZX7A 1MFUA 2O9TA 3PTQA 1JGIA 4GZJA 1D7FA 1DTUA 4MAVA 1RP9A 5D8WA 4UFMA 4AIUA 1E40A 3F4VA 1OGSA 3NJ3A 3OIHA 2EBNA 3DYOA 4JCMA 2D2OA 3ZMRA 1HVXA 1VB9A 3VD3A 4MNKA 2XFYA 1PAMA 1Z32X 1NOFA 4D6JA 1KBBA 1OSEA 3F5JA 4KMQA 5E9AA 4QLJA 4PMDA 4W89A 2OWWA 1CECA 4PMRA 2V3DA 1ITXA 4P8WA 1E70M 4P7RA 2DSZA 3POHA 5BRQA 3HJEA 2VOTA 2WXDM 1JI1A 2E9LA 1V3MA 1E71M 4Z2KA 4WKHA 2VCBA 3I3DA 2J7HA 2XSAA 3W28A 3AMDA 1X1NA 2YJQA 7CGTA 4BCEA 1FP9A 1B3YA 2J4GA 3LPGA 3CH9A 1UH2A 5CSYA 3T2OA 3VOCA 3AXXA 3K4DA 1A3HA 3CUHA 1TR1A 2X0YA 1LWHA 1NH6A 1C90A 4UFKA 4CD5A 4KGLA 1FFQA 5GPRA 1P6WA 2WHJA 2VURA 1I75A 4DWSC 3ZJ6A 2W63A 1MYRA 3FW6A 2ZUVA 4ZXOA 1E1EA 1LF1A 5BROA 4HU8A 4D72A 3T0DA 2DPEA 5CPTA 1B90A 3QHNA 2WNWA 4TTGA 3VMNA 3WDHA 4WKAA 1BHGA 5D9MA 1UR8A 2PWFA 1E5NA 1PPIA 4B15A 4YPJA 3A47A 1V3HA 4D6EA 1MW1A 5A6AA 1HP5A 3AXHA 1VAHA 3QHMA 2FGLA 3TONA 1GQIA 5F7UA 1V6VA 3MV11 4D1IA 4DWSD 5ABGA 2CCRA 2Y8KA 2QMKA 1V6WA 1MW2A 5DEZA 4D6GA 3AS0A 4P8XA 3SCPA 1KXQA 2WSPA 2WC7A 5A6SA 4IUGA 3M46A 3VKKA 1VENA 4AZGA 4X0VA 1WCGA 3T09A 1W9PA 4B3KA 3AHVA 4ZEPA 1E3ZA 1DWGM 1ISWA 3ZO9A 3FHQA 1TA3B 3AHZA 2E8YA 3KE0A 5CLTA 3ARXA 4ZENA 3VGEA 2VZTA 3GNPA 2VVNA 1C7TA 4MADA 4JIEA 5CGTA 1RPKA 2GJRA 4AD5A 5A6MA 3SCSA 4AY1A 2C0HA 1H11A 1K9TA 1E5JA 5C70A 3CHCA 3ZR6A 1QHOA 4W7WA 4PCSA 1W3JA 2ZX5A 3AHXA 4J3XA 3VTRA 4GQRA 5A2CA 3WDQA 4A3YA 2B31A 2YDQA 3IANA 2QPUA 4N0RA 2W4XA 2BFGA 4UQDA 1H5VA 5A94A 3U5YA 1JF6A 2YDRA 4HZ6A 5I79A 3ZT5A 5CGMA 3L4ZA 5EBAA 4U2YA 1SYTA 1WDRA 1H0GA 1UZ1A 1GQJA 1J0IA 3GXIA 2CNCA 3OGRA 3FN9A 1KCKA 4HOXA 1CXLA 3SCRA 4D1JA 5GNYA 2D3NA 1AQ0A 1HJXA 3BSHA 3W81A 2EO7A 4UTFA 2J7FA 4P7QA 4AZ6A 2CPUA 5E0FA 4DUWA 1BYDA 3AIEA 4UFLA 5D4YA 3GH7A 1H2JA 3UG4A 3B9DA 2OYLA 1NARA 1CXFA 1PBGA 3AJ7A 3EDFA 2X05A 1QW8A 1E6QM 4AIOA 1K9FA 2DQXA 4UFHA 1UR4A 3VGGA 3VD5A 3POCA 4W5ZA 4P8VA 4UOQA 3AISA 1H1NA 4J27A 2DDXA 4F9JA 1J0ZA 1IV8A 3QOMA 1WZKA 3WSUA 3GZAA 2D0FA 1QI0A 1NP2A 4PRWA 3WF1A 1EIBA 8A3HA 3HU7A 2BY2A 1E43A 1CGYA 3A4WA 3OZOA 2JFEX 1VFOA 3CHDA 1SMDA 3L4WA 4IM4A 2DIEA 1OINA 1UG6A 3WBAA 1UQZA 2VNCA 1JZ2A 1HN1A 3OB8A 2BV9A 2W91A 3EDKA 1N82A 2D22A 4J3UA 1TVNA 1HKJA 2XVKA 4NRRA 1KGUA 2WHMA 1H3GA 3WDJA 3EDEA 1QVBA 5HBFA 1DHKA 4X9YA 1DP0A 2PWGA 5FIPA 5A3HA 4FMVA 4W8BA 2G3IA 5JIWA 4PMOA 1E6NA 1TVPA 1JXJA 1C8YA 2ZX8A 5A8PA 2D0GA 1FH9A 1QW9A 1WDQA 4TVUA 3AQUA 4U5KA 1ESWA 1VBUA 1EQPA 4MNJA 4V28A 3WF4A 3I3EA 2WANA 3CZ8A 2FHCA 4U33A 4CVUA 3W38A 3GNRA 1H0IA 5I6SA 3O9NA 4W8LA 5CZKA 1GORA 3NDYA 1GONA 3BCDA 1W2VA 2XWEA 3IJ7A 1E4IA 4W7VA 1CXHA 1EHAA 1NWTA 4AZHA 1E6RA 4UFIA 4AD2A 2GJPA 3CZGA 3WBEA 3VGHA 1GJUA 2VRKA 1E6ZA 1CTNA 1IZJA 1MXDA 4BF7A 1WE5A 2JIEA 4ZFMA 2V5CA 4PMVA 2DH3A 4TX6A 2YL8A 1JAEA 4QCEA 2G3NA 2JIWA 2HISA 5BWFA 1W9UA 1DWIM 3WIJA 3WF3A 1JDDA 1QNOA 1EDQA 3AHTA 5LA0A 1W3HA 4UR9A 1FP8A 4M1RA 4PTWA 3QHOA 4EAMA 2VX7A 4OOUA 2EPNA 2VX5A 4FLRA 4JFSA 2W62A 2XTKA 4MJ4A 4UQAA 4BQ4A 3T08A 4AZ7A 4Z2GA 4HTYA 3F5LA 2O92A 1XH1A 5E0CA 4OJYA 4Z2HA 4UCFA 1QOXA 4L4OA 4BQ3A 1PZ2A 1X6NA 3HN3A 2FHFA 4C7GA 3MSGA 3WD2A 3OA5A 1EO7A 2WVVB 2VX6A 2OSYA 3UG3A 4U3CA 4FLSA 1R7OA 3CHEA 2OLHA 1C92A 3WMSA 2RGMA 1W9VA 3WNPA 4DWSA 4S3JA 4WF7A 4BZYA 5A6KA 4Y7EA 3VIOA 4KWUA 1UD5A 7A3HA 4URIA 2ZE0A 1PJ9A 2Y8VA 3AFBA 5LYRA 1E4LA 1B31A 1QNRA 3IJ8A 2QV4A 5I24A 4N42A 3VDAA 1HL9A 1JFHA 3WQWA 3GNOA 4W84A 5HPOA 5I77A 4ATDA 4GIAA 1JZ6A 3MS8A 4W5UA 4Z2JA 1KWGA 2FDMA 4AZCB 1WZAA 4Q22A 3AIVA 2OSWA 5AC4A 2E40A 2X8RA 3KL3A 4KRUA 2FH8A 5AC5A 2ZXBA 3WMCA 2Y24A 3GXFA 1HKKA 1GNXA 1D3CA 5DF0A 1JD7A 1EOMA 1CLXA 3UETA 6A3HA 3VDBA 4W88A 3OZPA 2WHLA 1UWRA 2XWDA 4D6HA 1HIZA 4ATLA 3OLGA 2ZWZA 3O6AA 2WVTA 3PTKA 3AROA 5BRPA 1J0YA 3AMGA 2DSKA 5IFPA 1QPKA 2XG9A 3K1DA 3UEQA 3BMVA 1MWOA 3PHAA 4ZE4A 2A3AA 4ATWA 3KEHA 4PUEA 3T2PA 5I5RA 4DUVA 4W7UA 4AD1A 1HKMA 4MAZA 1EQCA 2XVGA 3IAPA 3APGA 1HP4A 2X0HA 5EFDA 1B1YA 4A4AA 1JZ5A 2F61A 1F4AA 2EPLX 4BS0A 3D5HA 4CUCA 5BXTA 1J0KA 2JE8A 5ECUA 1DWJM 1V0KA 1ISYA 1FOBA 1EGZA 1K6AA 5CJ5A 1FHDA 2VR5A 1DWAM 3BAKA 1HKIA 5IFTA 4B9YA 5D8ZA 1HX0A 4NRSA 5M03A 5BXRA 3WD3A 1EDTA 2A3BA 3WL1A 1R7AA 1W9DM 2VTFA 3A4XA 3OLEA 3DHUA 5M3WA 2YIHA 1XSIA 3WNMA 3PN8A 1BGGA 2E0PA 4XB3A 2C7FA 2WMFA 4UFJA 5D9PA 1CWYA 1HJVA 4MNMA 4B9ZA 2CYGA 2XJ7A 2Z1KA 2WVUA 1CXEA 1GCYA 1B0IA 2J47A 3AZRA 2WKGA 1C3FA 1LLOA 2X09A 4JKKA 1C93A 2XVLA 2GJXB 3L4XA 4GINA 1UH4A 4TVCA 4CN6A 5IDIA 2FHBA 2V3EA 3BAYA 4RE4A 2A3CA 2J25A 1C8XA 1VRXA 4CGTA 1OIMA 4AXNA 1E73M 1MQRA 3EMCA 2D0HA 1UA7A 3TTOA 3WH7A 3OG2A 1E0VA 2YL9A 1TFVA 5GNXA 1BLIA 1ODUA 3U7VA 2JEPA 1AQMA 1JFXA 3ZJ7A 5A8OA 1B9ZA 1A47A 6CGTA 1OBAA 1K9DA 3OBAA 3CO4A 3DHPA 1V03A 1HNYA 2DEPA 3PZIA 1HL8A 1JDAA 2V38A 1BVNP 3OGVA 2RGLA 3DYPA 3S2CA 4ACZA 3FHAA 2GK1A 1YQ2A 4JZ5A 4AZ5A 1JIBA 5AYIA 1YHTA 1E4MM 2Z1SA 1RP8A 1B3ZA 1GZJA 4HMDA 4JFWA 9CGTA 3VD9A 3PZGA 5M17A 1NQ6A 2ZIDA 1PX8A 3SCNA 1XH2A 2V3FA 2J79A 4JKLA 1HT6A 4W86A 1OM0A 1VFFA 4R27A 2CBVA 4HPHA 2WMKA 1UZ4A 3TTQA 4M82A 3VU2A 4DM2A 3L2LA 5ABFA 1OWQA 3OLIA 4YHGA 4J7RA 1B30A 4H8UA 1KR1A 5D9NA 4UQEA 2YLAA 1UR1A 4NSBA 3MU7A 2A3HA 3G6MA 1MVYA 1XD0A 2OYMA 1BG4A 3JUGA 4QP0A 3VD4A 3N13A 1H09A 5A1AA 4Z2LA 3NDZA 1UWQA 1GQLA 1QNPA 3I3BA 1CGTA 3WH5A 1UA3A 2DT2A 4GI8A 2EEXA 3PBGA 3PZQA 1B3WA 5E09A 1C8QA 1V3LA 3RMEA 1JL8A 4M80A 1J0HA 3SUSA 1Q6CA 3GBEA 1JAKA 3ARTA 2VI0A 2JALA 3SUVA 2G41A 1SMAA 2J8GA 4MPKA 5EB8A 1DEDA 2OWCA 4QDMA 3N11A 5A95A 3AMLA 3OLDA 2VR4A 3NUKA 3BH4A 3WY1A 3KL5A 2YA0A 1UWUA 2F8QA 2XIBA 3WEMA 4J3WA 1ZBVA 3N17A 1KWKA 1ZS2A 4DM1A 1J9YA 1HJQA 3N12A 5A8QA 1ECEA 3CZLA 4V2XA 4PTMA 2X1IA 4TVDA 4H7VA 4ACYA 3W6MA 3ZT7A 3ZOAA 3W37A 1C91A 1GUVA 2GDUA 3MV01 1QI2A 1DWFM 1J12A 2G3MA 5JIPA 3SCUA 3RO8A 4NI3A 1OIFA 2J74A 3KWXA 5KEZA 3RM9A 3T0BA 2ZUSA 2WMGA 4PYSA
chains in the Genus database with same CATH superfamily
2IKGA 4IFRA 4L56A 4HU4A 1TE6A 2CLIA 5I3FA 4L9XA 3E0LA 3QF0A 4IIHA 4LB4A 1A0CA 3E74A 2G5WA 2CZEA 4G7EB 3AIQA 4M56A 1V02E 2CBUA 5TNVA 1FH7A 4DBUA 2XH7A 3AOFA 3VXGA 1N8WA 2OMAA 1DWHM 1EJWC 6REQA 4N7QA 3WD0A 1OYBA 4L9ZA 5C8BB 5DFAA 2A79A 1N8FA 3CLMA 1FXQA 1UQYA 3N2XA 5E6YA 2IKIA 4GABA 1NM9A 1W9XA 4ICCX 4IMEA 2A6LA 4YVPA 1AODA 3BAXA 5FJUA 1JQXA 4JCLA 2J7EA 2G50A 4HA4A 4CLMA 2WB5A 4HA0A 3QXBA 5E93A 4BK9A 4PMUA 5XIAA 3AMCA 1M03A 1KFWA 3RXZA 2YLLA 1FWDC 4G8TA 1V0NA 2EPKX 1BTMA 3F4WA 3MJYA 3FIGA 5A2AA 3U2OA 3P93A 1G4TA 2PP3A 3MYPA 1KGXA 1BYCA 1M53A 3CS2A 3A3WA 4MJ2A 1IQ8A 1CI1A 1OHLA 1O94A 3ALGA 1DYSA 1LQ0A 3UPMA 2PLJA 1XS2A 1PEZA 3HQPA 3NR0A 3KBWA 3GTFA 2R1LA 4GZEA 4HU0A 2VEKA 4KH2A 3V1HA 2VHLA 1V3IA 3UU0A 3ARWA 3MMTA 4Q8QA 2Y89A 4HB7A 3MYOA 2Z2UA 2QQ6A 3WJSA 1QPOA 4OZOA 4LV9A 2R9RA 3EX3A 3GDMA 3AYSA 3LHZA 4FA3A 3AXIA 3GR4A 1RCXB 4ASTA 4N4PA 3BSGA 1S46A 2J9YA 2HROA 3RN6A 3GTXA 2PTZA 4YTQA 1FDJA 5HNUA 4RDYA 1KRAC 2PGFA 3C6CA 3T8LA 3NGFA 4YVXA 4WDTA 3W1QA 3WDIA 3MI3A 2H8XA 1W17A 1XYLA 1CLVA 4JN6A 5BYWA 1SU5A 4C6FA 3WQ5A 1M65A 1RLDA 2IPJA 4CN1A 3THQA 1QMLA 4CD7A 4IIDA 2YL5A 3AICA 2WSKA 3GK0A 3PUOA 1RK6A 1OT1A 1XBVA 3TYCA 1EJTC 3TLLA 3UVIA 3L0KA 5BXPA 2EPMX 3FNDA 1BQGA 4XV0A 3EWZA 4JTJA 2YYUA 5HMSA 3N2CA 2HZGA 1ZNNA 3BICA 4K7VA 4W93A 3W6LA 1EDGA 5ABEA 5LA2A 3W72A 4YTSA 2ZVIA 1P5BA 1KRMA 4DF2A 1J10A 5FOOA 1L6YA 3H24A 2D1ZA 5D09A 1EGVA 5CXPA 3ES8A 4WLCA 2E8ZA 1E1CA 1LG1A 3OVPA 3SQLA 3PPCA 1YADA 4FP1A 4PC8A 2UY5A 1TQJA 3NZPA 3R79A 4HZ7A 4HHHA 3QQ1A 3UZ5A 2EJ1A 4HT3A 2KAUC 5G4WA 3CAVA 4HCHA 3DFQA 3CV6A 4M6PA 4QS5A 1V4YA 2XGIA 5H8UA 1YXYA 1TWZA 1GOKA 3DIPA 3F2DA 1EXBA 4UQBA 1TV2A 1QO5A 4QJ5B 4MWAA 2POTA 3ECQA 2RJHA 1PV8A 1EC9A 1XQLA 3L4TA 4O53A 1Y7VA 3ITTA 1EC7A 3IJQA 2XIJA 4NZCA 3TNBA 3WNOA 3O8AA 3K8KA 5CC6A 2C18A 1UD2A 4L1GA 2FJKA 2DT3A 4F48A 1JYVA 1KKOA 3LM7A 4GUHA 1EX1A 2OPJA 1KCLA 5C5YA 1FWRA 4K39A 1S3TC 1UD6A 4J2MA 4NJHA 4P7LA 3UZZA 3RLVA 3I4EA 3GKAA 3U9IA 2NUXA 2C71A 4JQ3A 1A5CA 5HNNA 1VBGA 3MO4A 4JX5A 2BXYA 4D6IA 3W1MA 5AY7A 3UXIA 4ML4A 3W01A 3ARPA 1C8VA 3A6OA 1RR2A 3AS3A 3IK4A 3SGUA 4AYSA 4Z2IA 3GH4A 4WOQA 1SO5A 3TFCA 2ZZ7A 4UZUA 1WAWA 5BWAA 3N25A 4DWDA 5EMUA 3WEZA 3PULA 3CEUA 2CEQA 4UOZA 3M9YA 1QDSA 1EA9C 3LUTA 3N15A 3OP2A 3T81A 3L5AA 5I23A 1H41A 3M5VA 1GQKA 1PCKA 2OELA 1QPNA 4JN7A 5D2YA 4LEFA 1PZ3A 2CBIA 3K8LA 1ISVA 3AIWA 2BOGX 3NVDA 1OYCA 1W1TA 3NQBA 5E6ZA 4DXXA 1L2QA 2O9RA 4L1WA 2ISVA 1TA3A 1PTDA 4C6IA 3V0SA 4Q3MA 3ITCA 1E1FA 4JTGA 2MUCA 3CTTA 3GU1A 5CBBA 3R0DA 4OT7A 4CU6A 1TZ7A 4XX6A 3NM1A 2V2CA 4P61A 1PWLA 4X60A 3BOXA 3NG3A 1UROA 4CKQA 1FRBA 2NLYA 5LNUA 4RKAA 2C0AA 2OGYA 1XLMA 3QVQA 2DW6A 4S2CA 1GG0A 1HL2A 1H5YA 1G0CA 4CCDA 4AZIA 1L9WA 4XAPA 4EK7A 2CXGA 2IUZA 4K8GA 4MKVA 3OZMA 5A6BA 1EHNA 1DVJA 1Z9AA 2GQAA 3E5BA 3WFZA 2YDSA 2NWSA 4M7TA 2PODA 4GFSA 4JTTA 1YPFA 2HS6A 2VD8A 3WLRA 4GUGA 3DYMA 4I6KA 1BWVA 5DLCA 1JZ8A 1J11A 2BHZA 4IGMA 5DXXA 4AEEA 1OGGA 3WJXA 4ZO7A 3W7LA 3WNNA 1V6TA 3BVJA 2VFGA 3GX9A 1FWEC 1TJ1A 1W3KA 1DJXA 3RX3A 3KRUA 3LI0A 3MUZ1 3NO3A 4ZTYA 2A5HA 3H4XA 1IXPA 4DJFD 1J01A 1H49A 1BXCA 4CVWA 2PF8A 1PTGA 3PBUA 1F4HA 3VZZA 4RZBA 4GHRA 2QUUA 2Q8XA 4C91A 2Y70A 4LAZA 4GQ0A 1NWUA 1QI3A 4IFKB 4Q7NA 1PO9A 6XIMA 3U3HA 3ABOA 2V2HA 1OFBA 2WZHA 3UERA 3HG5A 1SUXA 4NYUA 4YYFA 2WZTA 3FXYA 3MKKA 4LX4A 4LVGA 4IUOA 3WENA 5F2GA 3EKLA 1PX3A 3QFEA 4QBXA 1RHCA 3NPXA 3SUUA 1VJZA 2BNJA 4O1EA 4TUFA 2VL4A 4QJ4B 3AYRA 5IXEA 1OFQA 2FZ9A 4Y8EA 4JQ1A 3WNKA 1IHIA 1ML1A 5BU6A 4YTRA 2G3JA 5EKYA 3N3TA 1XRFA 3V0UA 3SN0A 2CC0A 1N2VA 3EEZA 1W3LA 1IWPA 4W87A 1G01A 1YNYA 3EZ4A 4QE1A 3LV5A 3M0VA 1KBKA 3SY5A 4IPPA 3ME3A 1QTWA 2ZX9A 4GMEA 4FXRA 4JL1A 1H7OA 3SZ8A 3TA9A 3F1QA 2AOSA 3QGVA 2DUZA 5F2IA 3PZVA 2WW5A 3HQOA 3WH6A 1TCMA 3NTYA 1GPFA 1KXHA 3QTPA 4J1OA 5I3GA 4IMAA 4JTHA 2F84A 5A8NA 1P48A 3SSJA 1US2A 2VRJA 3S6OA 4PEKA 3H8AA 2HS8A 1WO2A 5ABFB 4DUXA 1DJYA 5FSEC 2XSXA 1ITCA 3HFYA 3CL7A 1R3YA 1OFRA 1ODZA 4DY1A 3CQKA 1GWJA 1GOMA 4NNCA 3UA4A 2C8NA 2WWDA 4E4PA 3LEPA 3GFZA 4TX8A 4LXFA 4N9BA 1D9EA 4RE3A 2WHKA 3GVWA 3IIVA 3VM5A 3W6YA 3KHDA 2V5JA 1UD3A 4GIEA 4Q33A 4H8HA 1VFLA 3H55A 1XRVA 2D69A 3O06A 1M9HA 2CETA 3EA1A 4PBFA 2Y5JA 4PBEA 3S4TA 2FVKA 3GWQA 1KM4A 3TCEA 2D2JA 3FYYA 1HJUA 1Q4NX 2EPOA 5EFFA 2Z1XA 4PL2A 1Z3NA 6PTDA 1JPDX 3OQEA 3II1A 4CQCA 3NO5A 3D6NA 1M04A 4GZIA 4FR1A 3CV2A 1W8SA 3DECA 2OT0A 3VGFA 4KCTA 4FX7A 3CMFA 1P43A 4E38A 3JZUA 2WVSA 3L67A 4KEMA 5BZAA 3DCPA 3NQAA 3LXBA 1Q6LA 4K1GA 1A5KC 1OD8A 4NT0A 3UNDA 2OX4A 5I06A 2YFOA 4OECA 2ZUUA 4ZOAA 2ZUTA 1AZ1A 3AU6A 2WBKA 3C3UA 4US5D 2ZZ1A 2Q71A 3ES7A 2CKSA 5DRCA 1WZMA 1KO0A 1UKTA 5KZMA 5DELA 3QPEA 2DT0A 4L4PA 1PIGA 1W9BM 3KVLA 1SM9A 4FNPA 4EPEC 1LL6A 2PAJA 3LQLA 2WBGA 3QZAA 4MB1A 3NXLA 1CGVA 1BQCA 2CLKA 2ZX6A 2Q8LA 4QFUA 1X97A 3VM7A 8CGTA 1XPYA 2Z29A 1GVOA 1V02A 4GI9A 2UV8G 1GHSA 3DG6A 1G94A 4BI5A 3TA6A 7XIMA 3C2EA 4DBSA 1ZZMA 3NPUA 3V16A 2I9UA 2V69A 3ZXWA 4DXVA 2TSYA 4I9MA 4J9JA 2ISSA 2VQTA 4XG1A 2IXVA 4DB7A 1SJDA 2DUXA 3HQNA 4ZXLA 4JGDA 4KEUA 2W67A 1PZ1A 2MANA 4ADTA 2BVYA 3UCDA 4P5UA 2B7QA 3EXRA 3VD7A 1H63A 3VKAA 2ZXDA 3WH9A 3GG0A 3K46A 3U0HA 3NSMA 3GU2A 2EGZA 2IXUA 3BDKA 2QW5A 4PMZA 1LUCB 3M0KA 1R2RA 1ZJBA 5TIMA 2E3ZA 4EWJA 3GHRA 4JTEA 4DJDD 3IVTA 1UR2A 3V35A 3CPRA 2X1SA 4Q4PA 3LPFA 3KOXA 5IM51 2X40A 3WDPP 3ZQ9A 2WCAA 3R43A 3E2RA 3KCOA 1W1ZA 4K37A 2POZA 4QJ3B 1T5AA 4WJXA 1SJAA 4PULA 1IYXA 4CQDA 1V0MA 3B9OA 1TSIA 1T8QA 4US6A 1ISXA 3WH8A 5I3KA 1BFNA 3RX4A 3P8IA 3LG3A 3MP4A 3N19B 3TOYA 4QAIA 5D2WA 3HQ1A 1XLLA 2NV1A 4QS6A 1OZQA 1ZRQA 3WLSA 1XG4A 3LSCA 4BF5A 3LRLA 5SWUA 1LROA 5HOSA 3O07A 1FCUA 4O19A 3BMWA 1IF2A 4PA8A 1ELSA 1RPXA 4IISA 3SCTA 3TSMA 3L5LA 1HXJA 2ZX7A 4FSAA 4GZJA 2H9AB 1WDDA 1IIHA 1V79A 2Z1WA 1E40A 3P14A 4PE8A 4LUTB 1FX6A 3DN5A 4GCXA 1XYAA 1VB9A 3TJXA 2QKFA 2JKAA 3CAQA 1HGYA 2CZ5A 2JGYA 1E51A 4KMQA 4IIGA 5E9AA 4QLJA 3DUGA 5D05A 4O14A 1FWJC 3S1XA 3S3GA 4MF4A 3VFLA 4P8WA 1ITXA 2GGEA 3M5ZA 4P7RA 3POHA 3E96A 3PBWA 3W2KA 3D47A 1V3MA 2GVLA 1E71M 4Z2KA 1Z89A 5EMMA 2VCBA 3I3DA 4A2SA 3O0KA 4UNKA 1EFZA 4LWWA 3FLUA 3PWGA 2G97A 4BCEA 1RA0A 1FP9A 4IIFA 4J3ZA 4PTNA 3WLLA 3CUHA 2Y8UA 3VCCA 5FSDC 1QOQA 1FWNA 4UFKA 4CD5A 4I9TA 4AX6A 4XD4A 2P3ZA 5GPRA 7ENLA 2VURA 1REQA 5F1VA 4GJIA 2DZTA 4Y8FA 4WZHA 4ZXOA 1E1EA 4D72A 3T0DA 1RJPA 3UXDA 4GUFA 1XX1A 4DBWA 4ZVJA 3VMNA 4WKAA 5CSRA 2QYGA 1E5NA 4YPJA 4J5NA 5C9RA 1V3HA 1V5XA 1KFEA 1MW1A 2FQIA 5A6AA 2YGYA 2FTWA 3AXHA 1VAHA 3C86A 3W1NA 1S3HA 1XPGA 4DWSD 1YLVA 1F3WA 5ABGA 2CCRA 3TXZA 1CX9A 4P8XA 1KXQA 4JTFA 3TTEA 2WSPA 4KWVA 5K9CA 3F4CA 1H61A 1EJRC 4ZR8A 1SFLA 2R1PA 5A6SA 1H7PA 4AZGA 1EWDA 1WCGA 3T09A 1W9PA 4O8AA 3CJPA 4ZEPA 3DI0A 1DWGM 1YTKA 1D8CA 3EWXA 3WQCA 2CLHA 3UZYA 3G1RA 3MPGA 4Y9OA 1GK8A 5K2ZA 3ARXA 2VZTA 5EA9A 3GNPA 3R12A 2HTMA 3WLMA 4MADA 3NOYA 1VD6A 1XI3A 1H11A 1K9TA 1E5JA 1LT8A 3TDFA 2FB3A 3AWOA 4W7WA 3WX7A 5G2IA 1E0UA 5D03A 3VTRA 2QGHA 2OKOA 3NQ6A 4NZ5A 3N14A 2B31A 2G4JA 3DH7A 4NY2A 5IRPA 2QPUA 4N0RA 3QEZA 4IQEA 5JU6A 1KM5A 1LM1A 1IT8A 1FWAC 4IFOA 5A94A 2A3LA 1A5SA 1BRLB 3EAUA 2OOGA 3HGSA 2V8ZA 1UZ1A 3CIXA 3LZ5A 1KCKA 4HOXA 1CXLA 5AYYA 3SCRA 3QY7A 5GNYA 4GNKB 1LOQA 1PKMA 2D3NA 4B2DD 1PUDA 4L1XA 1WV2A 3W81A 1G4SA 4XZNX 3GU9A 1A4LA 4YTTA 1OC5A 2CPUA 1Q2RA 4Q4RA 1BYDA 3BLOA 3VKJA 4UFLA 3EA2A 5FEZA 3S2MA 3NWRA 1E6QM 1NDZA 2QCLA 4BEQA 3VGGA 2PFHA 5C55A 1LBLA 3NYZA 2BBFA 4J27A 4EX4A 4JTKA 4F9JA 1LBMA 2X41A 1Z6KA 4TX9A 4N02A 3C8NA 4KETA 4L80A 1VCFA 1KV5A 5MHBA 1E43A 1CGYA 2OXNA 3MQTA 3NDOA 1VS1A 1F74A 3APTA 3HIJA 1ICSA 3LLFA 2DIEA 2PGWA 4MKNA 4Q8VA 1WKDA 3E9AA 3GYEA 1UQZA 1HN1A 2KX9A 3EDKA 4J3UA 2J13A 2EG8A 1TVNA 2OX1A 1R46A 1AJZA 2BODX 1RVKA 2X0SA 2WHMA 4KCWA 2DZBA 3H7VA 4EPKA 1TV4A 4GVGA 5A3HA 3OIXA 4W8BA 1YNQA 1JXJA 1ONRA 2R6OA 3GR7A 2ZX8A 2VC7A 4LS2A 2P5NA 3EWYA 3AQUA 1ESWA 3VCRA 2E5DA 3FA3A 1EQPA 1EJSC 4FNRA 3I7RA 4V28A 3R6IA 1A53A 3WF4A 4FS9A 2A85A 2ZADA 3CZ8A 1MUMA 3W38A 1KV8A 4M6QA 3FYPA 3QQ0A 4DIAA 4H01A 8RUCA 4W8LA 4S3BA 2DZWA 1JCJA 4GXWA 3NDYA 3DESA 4Z1YA 1GONA 4GC3A 4OFCA 1KM3A 1E4IA 4W7VA 4LUJA 5EMJA 3ISIX 1W1A1 4AZHA 1DJQA 3BLEA 4UFIA 3WBEA 2GVJA 4HN4A 3BV7A 1PHQA 1VBHA 2JIEA 3SRHA 2DH3A 2YL8A 1SW3A 2ZFAA 9XIAA 4L5ZA 4OGZA 2JIWA 1Z7AA 1YPXA 3M64A 1JDDA 1QNOA 3DBNA 1W3HA 4UR9A 2Y7DA 4EAMA 2EPNA 4NJJA 2QVNA 4GQGA 4G56A 4Y96A 5F4WA 5J04A 3BL3A 2A21A 2ICSA 1PE1A 4BQ4A 1FWGC 3T08A 4AZ7A 1DXFA 3IGSA 1XH1A 5E0CA 2IKJA 5LNRA 4L4OA 1QOXA 1PZ2A 3HN3A 4C7GA 3QSTA 3WD2A 2QJJA 2ISFA 5FJIA 2OSYA 3WZ0E 1MZRA 4FLSA 3O63A 1EEPA 3WMSA 3DENA 3WNPA 1A5AA 2E7FA 2VC5A 3BSMA 4BZYA 4Y7EA 7A3HA 4URIA 2CWNA 1OCNA 5BW6A 5HR6A 2Y8VA 1B31A 2QV4A 4N42A 4Y9AA 1HL9A 2PTXA 3HF3A 3Q67A 2Z0IA 1T6MA 5I77A 1S2VA 2SFPA 4GIAA 2XH4A 4XD3A 3MS8A 3M6YA 4W5UA 2NQLA 1KWGA 3R0KA 2YXXA 4AZCB 4Q22A 5JXQA 2A7PA 3WMCA 2A1YA 3DOPA 1J96A 1D3CA 3SFWA 2IS7A 1CLXA 1S5WA 3UETA 1KCXA 3KLKA 3L2IA 3U4AA 6A3HA 3VDBA 4W88A 1BD0A 1AW1A 3R94A 2OZ0A 4D6HA 2QULA 1CLKA 2IKHA 3O6AA 2ZC1A 3AMGA 5IFPA 1QPKA 2XG9A 3A3XA 4JTIA 3OA3A 4ZE4A 3PHAA 4LTSA 3KEHA 1F76A 3W2MA 4KBXA 4EACA 4W7UA 4AC7C 1VHCA 4S3DA 3K4WA 1G7UA 3R8GA 3RLGA 1ZENA 5EFDA 3ZLHA 1B1YA 3EWDA 2AAMA 4CUCA 5BXTA 3QKZA 3GTHA 3PVFA 5ECUA 1DWJM 3EX6A 2VR5A 1JPIA 3MUXA 2GZXA 5M03A 1SZRA 1K02A 3WL1A 5HATA 5D37A 5ECVA 2ANUA 4GG9A 1JPMA 2WNQA 2YIHA 3WNMA 3E49A 1OFOA 4UFJA 3EKZA 1CWYA 2Z2BA 1HJVA 1XIMA 2HSAA 1WAUA 1T99A 2QPXA 2PD5A 2Q09A 1LRQA 3I6EA 5JVLA 1EB3A 4AWUA 1Y65A 1S2WA 4O4VA 4EVZA 3EOEA 4GINA 1FXPA 3IPWA 1HUVA 1AMKA 2VDIA 3NL3A 1YBQB 5LXEA 3G1VA 4TVCA 3G0UA 1N7KA 2FHBA 2V3EA 3BLLA 1TUFA 3LD5A 1TJPA 5KSWA 3ANUA 2J25A 3S2LA 1Y5XA 1VRXA 1E9IA 4AXNA 4MYXA 5H8PA 2AL2A 4AF0A 1OYAA 4PRTA 2ZZ5A 4K8HA 3WLNA 3PFRA 4Q7IA 1TFVA 3HBLA 1BLIA 3U7VA 2JEPA 1X8CA 1MI3A 1AQMA 3TLQA 3PUGA 4S23A 1B9ZA 4JTUA 1A47A 1TREA 2YB4A 3MA8A 4O8RA 3GRIA 3OBAA 1LZOA 3EB4A 1HNYA 3M1ZA 4CNSA 3RRXA 5HMEA 1WKFA 3PZIA 4PUJA 4TV5A 1BVNP 3TW6A 3NQEA 2CWXA 2RGLA 2PU1A 3R11A 2YZ5A 3GVGA 2GVGA 1ME9A 3GDTA 4O11A 1WYIA 1PWMA 2F6KA 2W9MA 1YHTA 2ZDSA 4NL1A 4L65A 1E4MM 5C0QA 2Z1SA 1B3ZA 9CGTA 1AUSL 1XKJA 1QU4A 3A5FA 2ZIDA 5L6UA 4G1NA 2QJGA 2GDQA 3T0TA 1HT6A 5HJYA 4QDPA 5A5WA 2WMKA 4M82A 2PTDA 5EU9A 3VU2A 4DM2A 1XL9A 2IW0A 4IX2A 4XVDA 1K7EA 3PUDA 1MDRA 4RW3A 4N9EA 5REQA 1UB3A 4E6MA 4NSBA 3MU7A 4REQA 3G6MA 2VELA 5CBIA 1Q8AA 2FLIA 1BG4A 3PF3A 3LOTA 4AH7A 3G77A 4E2VA 3CM4A 3VD4A 4Z2LA 3NDZA 2QUMA 1P1XA 3HGOA 1QNPA 3O6DA 3WH5A 3ITLA 1B3WA 1V3LA 4MWAD 1JL8A 5HUPA 3PB0A 4LRSA 4M5PA 1SW7A 1JAKA 2DU2A 4FNQA 4XIAA 4AWTA 1OFEA 2JALA 2NVAA 1BVWA 3P67A 1DEDA 2OWCA 4WJEA 3N11A 3RU8X 3BH4A 3WY1A 1DE6A 3N17A 3EPMA 1HJQA 5A8QA 3CZLA 4PTMA 3VA8A 4H7VA 4ACYA 4N6FA 1C91A 1GUVA 2GDUA 4HIBA 3SR7A 3OTRA 2OEKA 1J12A 2OU4A 3BMXA 2WNNA 3SCUA 3LNMA 3U2EA 4PYSA 3LB0A 1XC4A 4ALDA 4QLKA 3BW2A 3MB9A 3CUIA 5B7YA 1QWKA 1SJBA 3VX0A 1R3RA 4UBPC 3TV8A 4LNCA 1UBSA 1GVYA 2BASA 1QHZA 1KM2A 4OU1A 4DZIA 4ECLA 2V5LA 3T9PA 2XSBA 4MPQA 5LIYX 1AH0A 3IUIA 1FCVA 1KBJA 2E1DA 1SFJA 2W61A 3NCOA 5CEWA 4HZ8A 1V6XA 3AMKA 3CZKA 2AGTA 4P8UA 1DIEA 1FCQA 3VE7A 4C5ZA 2YCIX 4PH6A 1X6LA 3UWUA 4XTDA 4XBJA 3N04A 1Q5MA 4LY8A 3L0GA 4Y9MA 4HHPA 3QGKC 2Z27A 1ONXA 3CIVA 3QV7A 3M0ZA 1G5AA 3CB3A 1MRQA 3LMYA 2B7OA 1IZKA 3DG7A 4MY9A 5KINA 3NAVA 1XIBA 3EYPA 1W91A 4EWND 3INPA 3UWQA 1J6PA 5I3IA 3RLHA 5CSSA 3W7NA 4MB4A 4KIEA 1O5RA 3M4HA 3WQGA 4PMXA 3W7GA 3TN4A 4MUZA 1V6UA 1BTCA 3D3AA 1WBJA 1WBHA 5L9FA 4ICMA 1UKQA 4QEHA 2J7DA 3BAWA 4OBRA 2QPSA 2OT1A 5A6BD 3L5MA 4F8XA 3FAXA 2A0NA 4BKNA 3WNLA 3PPGA 3A22A 1OD0A 5AKQA 6TAAA 1DORA 2NT1A 4AUBA 4UTIA 3EWCA 4TIMA 3EOOA 1RD6A 4QG9A 2GLKA 3N2BA 1U5HA 2CHOA 4J3VA 1UPMB 2R1KA 5D38A 4I7WA 3CUXA 3E5PA 1WDPA 1QPRA 1CEOA 3HURA 1W1PA 5D30A 3B40A 1CGUA 4R5EA 4KRZA 4UR8A 1E15A 1WZLA 2OWXA 3GB6A 4U4MA 4RXFA 1GVFA 1S5NA 3NEHA 3MCNA 3C52A 4UUIA 4A3QA 2D20A 4FNSA 1UWAA 5DCDA 1VFUA 2W92A 3PC0A 1QATA 2FKPA 3S5SA 4XUGA 1Y8BA 4LC8A 3W76A 1ZL1A 3KM8A 1I1WA 2BGNE 1EJUC 3C5QA 3WD1A 2YCLA 3FJLA 2VC9A 1L8PA 1SFTA 2F38A 3RCYA 2GWNA 2P1FA 3QMSA 5G4EA 3AZSA 3BJSA 3NA8A 2ACSA 1DHPA 4R7WA 3G1HA 1ZCOA 1PCWA 4MM1A 4F0SA 4O18A 1EEXA 3ZSTA 2DJLA 3WQ4A 1VQTA 3W87A 1F8MA 2IQDA 1E9YB 2VZSA 2VCAA 3T44A 3UWEA 1CBGA 1XICA 4H4IA 5D33A 1D3GA 3VGDA 3UFYA 1UMYA 3ZSSA 3SUWA 4C90A 2WC4A 3J7HA 1EUAA 1RBLA 2OLAA 3BARA 5BXSA 3IJLA 4QM1A 1VF8A 3UR7A 2VOMA 3V7PA 2AGKA 2PWDA 3SCOA 4LUYA 4F4RA 2PWUA 4QISA 2J8FA 6ALDA 1DV7A 3WQ8A 3N73A 1UOKA 2YA1A 3OBKA 3WN6A 1OG0A 2YFNA 2PDUA 1H7WA 2WMIB 3LBMA 1OX5A 4JL2A 4A21A 4YYCA 1OCQA 4K1WA 1MXGA 3EX4A 3KRZA 2WQDA 2D24A 3T1GA 1U30A 3KRSA 4M6VA 4Y9NA 4MNLA 1ZQ5A 2NQHA 2E5BA 1V7YA 1UASA 1JZ7A 3QQWA 3T78A 1S38A 3ABXA 1SSDA 5FEWA 3RPMA 2NSXA 4J4KA 1XCXA 1L6WA 1DIKA 1IXNA 3R4IA 2Y1HA 2PLCA 1XH0A 1FWCC 3B05A 3T05A 1TG7A 2V3GA 4H2HA 3DZ1A 2O4QA 3H2EA 1LQ2A 3WUEA 3MDUA 2DGAA 3QOKA 4KF1A 3SADA 3UG5A 3A24A 4D71A 1RY0A 2H3DA 1NF0A 4O57A 1MXSA 2CFFA 4IF2A 1YDVA 4H6QA 3TZFA 1LL4A 1AQFA 3GY1A 1OEPA 3QKEA 3CWOX 2HVOA 3P61A 1RH9A 2WK2A 3BLKA 4DWSB 3WCZA 3U57A 1ADOA 1FWHC 2YA2A 1D7KA 3BGJA 1UWSA 2CITA 2UZ9A 4IG2A 4OQVA 3TQVA 1PXGA 4B5TA 3WF0A 4CN4A 1T0OA 3A23A 5DMYA 3VIFA 2AKZA 3PJWA 3LY0A 4LQ1A 5CSUA 3FY1A 4AMCA 5A6TC 2J7CA 4WOZA 1EC8A 4PN2A 4CD8A 3LRMA 2EAWA 1OF6A 3K4AA 2GUYA 4R9XA 4LCSA 2XUCA 1XF0A 4ZA0A 4LY4A 2ALDA 1O60A 1VYSX 3C0SA 3U7BA 4AIEA 2NXGA 3G3DA 4KCVA 3W9ZA 3ZVHA 2PDQA 1OC6A 3A12A 2P50A 5FJRA 3TE9A 5CG7A 1AQHA 1Q6EA 1UCWA 5FCZA 4AIBA 4NF7A 4H9VA 4WGXA 3W85A 1XCFA 2FH6A 1TPC1 5LIUX 3NSNA 5AHLA 5FF3A 3CQIA 3L2MA 1MQPA 4J35A 3E0WA 1E72M 3GW0A 2IPFA 3VMPA 4L6DA 4YLWA 3CQHA 1O7AA 3W29A 3RCNA 1DJHA 2BXZA 2YYTA 4Q4MA 2QCHA 5T26A 2I5GA 1AA1B 1VEMA 1NQKA 1FY6A 3E2SA 4QR6A 7TAAA 1ALDA 1P7TA 4IPLA 2DSUA 4WSJA 4ZGYA 2EG6A 2PP1A 2VR2A 4MDOA 1Y0EA 1CYGA 3VILA 3M07A 4OUEA 4ZSUA 4F3HA 4UTTC 4UZSA 3B03A 1W8GA 4A35A 1LOSA 3BC9A 3VGBA 3K30A 4JIPA 4LVFA 1XDLA 3KL0A 1ZUAX 1FHUA 1ME8A 3QPZA 3RIKA 3RO6A 3S83A 5IHSA 2DJXA 4Q8NA 5HWJA 4HBKA 1O5KA 3AAMA 2A3EA 1YW1A 3PP7A 4OBSA 2A6NA 1Q6OA 4S3CA 1ECQA 1EP3A 3TH6A 3W82A 2VFEA 1U5VA 3AHYA 4S3KA 4LANA 2X2YA 1DQUA 2DP3A 3GAKA 2R24A 1J2WA 1KXVA 2J9ZA 1XLCA 2E28A 1YDYA 1V0LA 1P6BA 4MHBA 3NQMA 3QN3A 2ISDA 3TP4A 3USBA 5LIKX 2PRHA 4ACZB 1BYBA 3GVRA 2PBGA 2QLYA 3W1RA 1TMQA 4AHOA 2GK1B 3TJ4A 2G96A 2I5IA 1LJYA 1W32A 2CW6A 1D2KA 3FK4A 4HOWA 4WD0A 1FWWA 1VCGA 2RDWA 1VJSA 4DNHA 4GISA 3VMOA 3BOFA 3IIZA 3F2BA 2EF9A 1OX4B 4NAEA 1VIWA 3BGAA 1SFSA 1O66A 4HP5A 4U31A 2CERA 1W1B1 1EJVC 3GBDA 3S2JA 2ZXQA 1XLDA 1U33A 3VKCA 5JH1A 1TIWA 1F3TA 3UY7A 4MY1A 3GXDA 3WK2A 2BS9A 3MHGA 4UQCA 1JNEA 3GHUA 4OUIA 5CQ1A 3KBVA 3RX2A 2AL1A 2XGBA 4XAZA 4D8AA 1XGZA 4Q4KA 1A3WA 3ID7A 2TYSA 3FX4A 1JNDA 5B80A 2ZA2A 4F0RA 3IARA 3URQA 3M0LA 3P81A 2UY2A 5DQPA 3RJXA 4IXHA 4FK9A 2V68A 5I78A 1TIMA 1A80A 1FTXA 5MF5A 4QCFA 3W1UA 2P53A 3HG2A 3LCLA 5A8MA 1E0XA 1PKLA 4OOZA 3KP0A 1XQKA 5M2FX 1DJGA 1JYNA 3LLDA 1VBRA 2VJXA 2ZCGA 4J2PA 3DC0A 3AIUA 4FI4A 1MQQA 1ZJAA 3IUHA 2WZMA 1AL8A 4HA1A 2QGYA 3P60A 2Q02A 3ARYA 4S3AA 3KW3A 4TTUA 3WK3A 2XGZA 2CLLA 3NL6A 1N55A 1NP0A 4PMQA 2W79A 2XISA 1H62A 3BOLA 1EXPA 2VFFA 4C7FA 3ZJ8A 3NZ1A 4LUSB 5TD4A 5I2UA 3NGJA 3RAOA 5AECA 3VX1A 3WQVA 1E6PA 3W07A 4JQ4A 1I60A 3DEQA 4NXKA 2PPGA 2YBVA 1XLIA 2E25A 3THAA 3ZFHA 1MEWA 1WUFA 4X3ZA 2BY1A 1GOIA 3M5YA 1U1UA 1J0JA 2ISWA 2G4FA 2AMGA 2D23A 1BKSA 4J3SA 4HNOA 3UPBA 1M01A 4GNJA 6REQB 4UNIA 3W70A 1FA2A 1XLFA 3CMGA 5AC7A 3CUJA 3N6QA 4DBEA 2GOKA 2HK0A 5E70A 3T55A 2PDPA 3CQJA 1UD4A 1GHRA 3KRBA 3QC3A 2QCDA 4EXAA 2PA6A 4GQQA 1PS9A 3ZM8A 2J78A 4C65A 4UIOA 2WCSA 3BLPX 4IIEA 3U5UA 4IQLA 3A13A 4O0KA 1GVSA 1V93A 1OFPA 3VK5A 4PZVA 4LS1A 2V5DA 1E56A 1TYGA 4UMCA 3B9EA 4XVEA 4ZQPA 4KEZA 3W84A 3LS9A 1POJA 3V0TA 5GNZA 5AYBA 3E38A 4YIWA 3SCWA 2BGSA 3OVQA 1KTCA 5CZ0A 3PBYA 3JZEA 2XPKA 2VGIA 3WQ6A 3QBUA 4KFNA 4D8ZA 3S5NA 1BPLB 3BCFA 3T7VA 1RSCA 3W0KA 1JZ3A 1IR2A 2XVPA 1K77A 3IVUA 3JS3A 3T2QA 3G3MA 1F61A 5E5CA 3BK0A 1H7RA 3L68A 3QSRA 4NQ1A 2VWTA 2XVNA 1HJSA 2NUWA 3F5KA 4E2OA 1JUEA 2G8ZA 2WSYA 5DX7A 1UH3A 4ILSA 3VVGA 3V36A 1QI5A 3MUAA 1U1HA 3W71A 4FOKA 2QDEA 4OBTA 1EX5A 4UTTA 1ISZA 1K9EA 4I8YA 2X2GA 2YW3A 4WY0F 2WMHA 3OGSA 4MB5A 4WUIA 4X22A 2WYSA 2BOEX 3TJLA 3L7RA 4HNLA 2GOUA 3VINA 1KGWA 3UD6A 5KZ6A 3PZMA 1GZ1A 4H9YA 4FOJA 1WNOA 5HA7A 4XZLX 5G1MA 1P0EA 5DY2A 2GJLA 4O28A 1OQFA 2B4GA 1UUMA 4GYPC 3LGGA 1S1PA 1GVIA 2BGQA 4GVIA 2YOCA 3GTNA 4HPGA 1F3XA 3TN5A 2FFIA 3A5VA 4ERIA 3BJFA 3H54A 1SPQA 1XYZA 4C6EA 4D2JA 4QEEA 1GOOA 2GJNA 3CO8A 3W1LA 4O13A 4C7DA 4GIRA 3FCPA 4JKMA 5H91A 1QFEA 4ZQOA 1QRQA 5DRIA 3PTQA 1TO3A 3STCA 3VI2A 3EX2A 3TYZA 3BPWA 1RP9A 4B91A 4AIUA 3WBYA 3NJ3A 3F4VA 1OGSA 5CCZA 1KRCC 3W2UA 4JCMA 3VD3A 4DQWA 3B0PA 3B8VA 3NQ8A 2AQWA 1PAMA 1Z32X 1NOFA 4NJIA 3RU6A 3TW7A 1IGSA 1QK2A 1KM6A 2WQPA 4PMDA 1CECA 4PMRA 2V3DA 1A0DA 4DO4A 4DYJA 4AHQA 4XKYA 4S2BA 5BRQA 4MWAB 1MEIA 1NY1A 4C6KA 1P6CA 3U48A 1JI1A 2E9LA 3FEMA 4WKHA 4B5VA 3Q58A 4I6VA 5HQMA 3AMDA 1MMFA 3WBWA 1X1NA 5AVNA 7CGTA 3W1TA 1B3YA 1OVDA 1SO6A 1VYRA 1F3EA 3G8EA 2J4GA 1KFLA 4DJEA 3EPNA 3LPGA 2B81A 2CZVA 5H1WA 3VOCA 3MVIA 2GQ3A 3K4DA 4Q8MA 4HNUA 1TR1A 2PRLA 1RLCL 2X0YA 4GZ7A 4DJFC 5LNVA 3ITXA 1P6WA 4QSHA 4FR6A 3ZJ6A 2ZUVA 1T8XA 3NPVA 5GJNA 5CPTA 1B90A 1R9XA 1VKFA 5JQ9A 2PEVA 4LVDA 4TTGA 3WDHA 2PWFA 4XO7A 2X30A 4B15A 1YDNA 4DN1A 2GGHA 1O5QA 1T41A 1HP5A 3QHMA 2FGLA 4LBSA 3SN4A 1V6VA 2ZRZA 4MZYA 2ZKMX 3VOGA 3K13A 1DJIA 1MW2A 5AHNA 4DLMA 2BMBA 3M46A 3VKKA 1RV8A 2VKZG 3GG7A 3GVQA 3AHVA 5KMYA 1E3ZA 1JPKA 4GLEA 3TNOA 2GSEA 3FHQA 2GWGA 1TA3B 4UTUA 2QJNA 3E6EA 4MFEA 1SGJA 2E8YA 3KE0A 3PBVA 3H26A 4ZENA 3UGVA 4AMAA 5AC8A 3UXKA 2ONEA 4QJ1A 1S1RA 3R5EA 5A6MA 5EMLA 1K7XA 2G3FA 3UR5A 2HJPA 3CHCA 2OCZA 3IRDA 3LNPA 3ZR6A 1ADDA 1SQ7A 1Y5WA 4PCSA 5EL1A 2ZX5A 3AHXA 5A2CA 1FUYA 3STPA 3IANA 1A4MA 3GO2A 3P0WA 3W86A 4IP5A 4UQDA 1H5VA 2O7QA 5I79A 3ZT5A 1Q8JA 1I9CB 4HNTA 1TPVA 4POCA 4ZOEA 1SYTA 3G2GA 1H0GA 2FIQA 4XIMA 2CNCA 4MGGA 1QOPA 2FPVA 4NZ3A 1RXOB 3HG4A 3HV8A 5KZDA 4B5NA 3AO0A 1KNWA 4QTGA 3B0UX 4I8DA 3R10A 2PDLA 3R8HA 1AQ0A 4GWEA 1TPH1 3BSHA 4HNVA 2P10A 2EO7A 3USZA 2EPHA 2J7FA 5FF2A 4GGBA 5HULA 4DUWA 3HG3A 3FVDA 2E6YA 3AIEA 3GNXA 3B9DA 2OYLA 5HANA 3E12A 3IWPA 3AJ7A 2X05A 1QW8A 3BWWA 4OWGA 2DQXA 4IMGA 3F7JA 3POCA 4W5ZA 3L66A 3ATYA 2E77A 1WZKA 3GDKA 3WSUA 4O15A 2D0FA 1NP2A 3WF1A 3RNDA 1M68A 3HU7A 2PWVA 3OZOA 1KM1A 5BMWA 3CHDA 1WKEA 1SMDA 1YMYA 3L4WA 3WO8A 1IWBA 1EL3A 1TTPA 3MWCA 4AYGA 3AJXA 2D22A 1TWWA 5E1QA 3JR2A 4LALA 3V4BA 1KGUA 2FMOA 1H3GA 1XJBA 2HE8A 3PG8A 3WDJA 3EDEA 5HBFA 1S5TA 1DHKA 4X9YA 3P5ZA 1DP0A 5FIPA 4GYPA 3DFOA 4FMVA 4PCNA 2OQLA 2QUNA 2D0GA 3GNDA 1VBUA 1EJXC 3SRFA 1M1BA 4FEZA 2FHCA 4NYYA 4U33A 1OCBA 4CVUA 3SJ3A 2VUNA 3GNRA 5LHFA 5I6SA 1JUKA 4HQVA 5BU9A 3CUZA 3BCDA 2XWEA 3IVSA 5JMUA 1CXHA 1EHAA 2RDTA 1TMLA 1AH3A 1UP3A 5T8GA 3W73A 4Y6GA 1AK5A 1RJRA 2GJPA 1LORA 3CZGA 4PCPA 5CKSA 3TKFA 4KWOA 1JQVA 2VRKA 4QSFA 1E6ZA 2C91A 1MXDA 1XIHA 1XUZA 2V5CA 4PMVA 1JPHA 3NL2A 4NUWA 1HO1A 2HNEA 1JAEA 3QLLA 2TMDA 4QCEA 3AYVA 3QFWA 2GUBA 1DWIM 4Z42C 1I2QA 4JHMA 3WIJA 3WF3A 3VDGA 1TR9A 3P6LA 5LA0A 3FDKA 4M1RA 3QHOA 1EIXA 4OOUA 4FLRA 2ZDRA 1U1JA 4XWUA 1X38A 3WLIA 1ZLPA 4UQAA 3TQKA 1M6JA 4WVXA 5KETA 4OJYA 4UCFA 3BANA 5EGRA 1O5XA 2J6VA 4G2DA 3W1XA 1GOXA 2FHFA 3K2GA 1SSGA 2PU0A 3Q4DA 3ELFA 1TTJA 4XZ9A 3AWNA 3UG3A 5IDZA 3KVJA 4DJFA 5C54A 3CHEA 2OLHA 4OV4A 3BLIA 1AZ2A 2RGMA 4C1KA 3E02A 4WF7A 2Y88A 1JCNA 5AHFA 4Q4OA 4NVTA 1QNRA 3B8UA 1KBIA 3VDAA 4FIRA 3DGBA 1ADSA 4DJDC 3WQWA 2J6XA 4IMDA 2EKGA 2FDMA 1WZAA 2REQA 2V82A 1YTEA 2QCMA 4CCZA 1VLWA 4DYEA 5G1TA 2ZXBA 4QIUA 3GXFA 1HKKA 2EKCA 2OTDA 3GSMA 3B0XA 4B92A 3KS6A 1W1IE 3BG3A 3WMLA 1EOMA 3QMTA 4MZ8A 2WHLA 2C1IA 1UWRA 3APYA 1HIZA 3OLGA 2WVTA 1FWIC 3AROA 1A49A 1RVGA 1QT1A 1K1DA 2H90A 1MSSA 2A3AA 3TAKA 1R3QA 3P8JA 4O10A 1IEQA 3REQA 4DUVA 5AFDA 1G69A 3FGCA 2G37A 4V15A 4AD1A 2ZRWA 2D2HA 4MAZA 5FJTA 2ACQA 4DF0A 1W3IA 4F0HA 3QR1A 3P3BA 1EGMA 4IXXA 5CC5A 4G6CA 3URBA 3VNJA 1OJXA 4BS0A 1RUSA 3TR9A 1J6OA 3GG8A 1UW9A 2X7VA 1ISYA 1AH4A 2NXIA 4ICNA 4ZO6A 3QM3A 3BAKA 1HKIA 1HX0A 3LBCA 4CQ9A 2Y62A 3ANVA 3A4XA 3RGTA 3KDNA 3UY8A 3OLEA 4LVAA 3DHUA 1J93A 1XSIA 3IIPA 2VEPA 2E0PA 4FO4A 1Z44A 4MY8A 3LA4A 3MZ2A 2XJ7A 2Z1KA 4RDZA 3NZRA 1B0IA 2J47A 3AZRA 2PDIA 2ZA1A 3QLDA 1OIMA 4BY3A 1MQRA 2R14A 4FX6M 2D0HA 4H7CA 3TTOA 3WH7A 1E0VA 3NZQA 1ODUA 4GVFA 3KBMA 1JFXA 3VUSA 3FSTA 3S5OA 5A8OA 2X1RA 3ENLA 3G24A 1VFTA 4JICA 1XRTA 3UZXA 1PTAA 2DEPA 3C2YA 1R3TA 4G5DA 4HTBA 3IGXA 3LTPA 3C4UA 3S2CA 3ERPA 3FHAA 3TC7A 3TYUA 1W5QA 1LLZA 4JZ5A 3RPDA 1GKRA 4GH3A 2VDGA 1B57A 3I7SA 1TB3A 3SQMA 2VXNA 3O6YX 4E3TA 2V3FA 3OZYA 1U22A 5FF4A 1G7VA 3LM3A 2B0MA 1MNSA 4JKLA 2C16A 4W86A 3I7QA 2A2IA 1C9WA 1OM0A 2P88A 5LIWX 2CBVA 4US5A 4E2DA 1ONEA 3TTQA 1HFBA 4EXQA 1AG1O 4UCGA 1OWQA 4YHGA 3N2OA 1EPVA 2QCNA 2CLEA 3TQPA 1VGAA 4E4FA 4JX4A 5CPNA 4FPSA 3GUGA 4RR4A 1OY0A 4QG6A 5J5RA 4OV9A 4XAYA 3BE7A 2JQXA 3L0NA 1C9DA 3O3RA 3N13A 1H09A 3UYIA 2YCJA 2V67A 1X39A 4XZMX 3I3BA 3RF9A 1P0NA 3FVMA 1UA3A 2DT2A 4ADUA 1T7LA 3GR8A 3PBGA 1W5MA 3PZQA 4NASA 3RMJA 3STEA 4M80A 1TTQA 1Q6CA 5H6HA 2PZNA 5I3JA 3WYZA 3SY1A 4N2YA 1W3TA 2VI0A 5J5DA 1RCOB 3SUVA 1Q3NA 4LUIA 1FWBC 4NXSA 3LSBA 1TX0A 2Z28A 1HQTA 4QDMA 1YX1A 5A95A 3AMLA 3NUKA 1MUWA 1UWUA 1OF8A 2Z6IA 2XIBA 4XO6A 3PR2A 2VGFA 2DVUA 1ZBVA 4JTRA 4R85A 1VR6A 4FOUA 1Q85A 1XLGA 3ZT7A 3CPGA 2JK2A 3ZOAA 3ZYZA 3MV01 1QI2A 4HNCA 1DWFM 1OG6A 4AG0A 2Y7GA 5BMXA 4N4QA 1J2BA 1D3HA 2B7PA 2NZLA 1REQB 3RO8A 4NI3A 1OIFA 2H8ZA 3KWXA 5AYZA 3GQYA 3ITYA 3MJMA 3H4WA 3RM9A 1J5SA 4Q8WA 4NKCA 3DFTA 4KEVA 4OKDA 4DJDA 4LVBA 2XN1A 3OYZA 1XD1A 4H9ZA 5HWNA 1ICQA 5FJJA 1BF6A 3RM8A 3FA5A 3WLTA 4WCJA 1V7AA 3XIMA 1MNZA 2FPYA 2WJFA 3S9YA 4NI8A 3V1PA 3WUFA 4AY7A 1XSKA 1EWEA 4Z1CA 2PC8A 3EXSA 3O2LA 2DW7A 3HTWA 3KVKA 5TQLA 4HPNA 1L2UA 3AIBA 3GDBA 4GO9A 1GGOA 3I6RA 5CGQA 3K8MA 3BTNA 2ZE3A 2ALRA 3NSXA 3P62A 3CT7A 5D2XA 3RG6A 1NVMA 4PUMA 1QAPA 3AS1A 4PUWA 2KZHA 2DZSA 3CPUA 3EWBX 3I6TA 4A8LA 1RK5A 1GVRA 4QRNA 1EF3A 4MWAE 3VNKA 4H6RA 3EMQA 1Q66A 1WPCA 1Q45A 1KB3A 2UBPC 4HN8A 5CPQA 5F4XA 2XFFA 5PTDA 5FEPA 3VIMA 1XP3A 1CIUA 4O17A 3L4VA 2ZZ6A 3IACA 4PSRA 1VPYA 4K36A 5DBTA 1YDOA 4IWWA 4IT1A 5HMFA 2FB2A 3CIWA 4YNGA 1B4EA 1DE5A 1CGXA 4LEQA 4AHPA 5CBJA 4BQ5A 2RKXA 4PMNA 1HKWA 3WUGA 3L4YA 3WJWA 2WMIA 1US0A 1R8LA 2CLMA 3SIMA 3G1AA 3F4NA 2FFCA 4ES4A 5FEXA 4C6QA 1AMYA 2XN2A 3PTMA 4O52A 2AQOA 4XSLA 4C6LA 1XCWA 3N4FA 4UMBA 1QBBA 5HDRA 3HGJA 4L4LA 4GRSA 4KT2A 2H3BA 1XXXA 3M47A 3OO2A 1QBAA 2VRQA 3SAZA 5CAKA 3GXMA 3PSWA 3CYVA 2CZFA 2FZNA 1H4PA 3DX5A 3WLOA 4YCPA 1G1YA 4MSSA 3SURA 3MUY1 3E0VA 2VQUA 3TWBA 1FDZA 1B3XA 4WSHA 2Y63A 3GS6A 3JRKA 4UC5A 1IEIA 1DQWA 4JFVA 1AJ2A 3SM0A 4QX4A 4CNNA 2Y7EA 1D8WA 2J7BA 5G4HC 2GQ8A 3TUUA 2O55A 2WM1A 1JXKA 4UWMA 3VFCA 4NZJA 2OVLA 3UW6A 1ZBKA 2WNZA 1FFRA 4FALA 1MFVA 4WKFA 3N29A 1E6SM 2DH2A 2E6AA 3QV6A 4HHLA 3ARUA 1EOKA 4NZFA 3W27A 4QNWA 1M7XA 4MOZA 3VIIA 3DFYA 2O9PA 5ABHA 1Q6GA 1DPMA 2AQVA 3PZUA 2EHHA 2PUZA 2OSXA 1YE4A 3UCCA 2X1TA 5AHEA 5LGXA 4BF9A 5F2MA 3N4EA 3SI9A 4CCCA 4JTLA 5HQEA 2UY4A 4HPJA 4K68A 3VNLA 2NV2A 4I5UA 2QR6A 1R0MA 1AW5A 1B2YA 2Y5EA 4IQDA 1JDCA 2JEQA 1P4CA 1I0BA 4HMEA 4UNLA 1ZAJA 4Q4QA 2PGEA 1IT0A 2DVTA 1Z42A 1MO0A 4F9DA 3N9RA 2ZC8A 3PBMA 2E67A 3RCMA 3CYJA 1PKNA 3I65A 4PEEA 3GZ3A 5A2BA 1W56A 4D9PA 1CZ1A 4J28A 1QW7A 1PB0A 1K8ZA 2C3ZA 1ZBCA 4IGNA 2E9MA 5AYXA 3W3OA 3IAQA 2XM2A 2IMRA 4B5UA 4E3VA 1JF5A 3EB2A 3UF9A 4WQ6A 4D6FA 2DSVA 4JTQA 2CESA 2NX3A 2I17A 4NNBA 1FHLA 1P0DA 1W1YA 2ACUA 2I1OA 1TMHA 2PF0A 2V5KA 1B3OA 3CWNA 1IEWA 4AWEA 1SW0A 1U5JA 5A6JA 2WZEA 4AD4A 2Q8ZA 2QVHA 1KM0A 1I2NA 1VJIA 3AS2A 2OYKA 4M0XA 1J5TA 5CZTA 2OFJA 1NOWA 3WD4A 2ZA3A 1XLKA 3W7KA 4HCDA 4MKSA 3AALA 5I03A 1S5MA 3TSDA 4LFYA 4B2DA 7REQA 2F2HA 1V3KA 4EE9A 2P76A 5BCAA 1BG9A 7PTDA 4A29A 1L6SA 1W5OA 1MUCA 1TJ0A 3KBSA 2BSLA 4BI6A 5BOEA 4DBDA 5HQLA 3D46A 3VIKA 1NFPA 4CNUA 1E0WA 1SJCA 4V1YA 1QNSA 3WMBA 3HPXA 4JFTA 4ZZ9A 3W23A 1Q6QA 1ZCCA 4HVXA 4Z0JA 4UTLA 2YR1A 2XDFA 2ZZ4A 3IK2A 4H04A 4GFIA 2VYOA 2OZ3A 1AJ0A 2PDBA 3QZ6A 3GC5A 3GM8A 1RAKA 2I7GA 4ERGA 1VEPA 1NWSA 3OEXA 1E9LA 8TIMA 4WK9A 2FDSA 3T4WA 2EG7A 1J18A 3L4UA 3IJ6A 1G9HA 5FKYA 5A6LA 2BVDA 2I57A 1B4KA 1S39A 3MKCA 4AB4A 3TMLA 3N34A 3ZLGA 3XISA 1UJQA 2WO5A 3ZJKA 2PMQA 4YXGA 2INEA 3H21A 3DFPA 3W2LA 4TMCA 4X0NA 4H3DA 1IE7C 6ENLA 1IEVA 3S5YA 3VOIA 5CZSA 4DAIA 1ZB5A 4N9DA 5D32A 2EQDA 4PUDA 3MC5A 1I4NA 4FXJA 5FF7A 3WKZA 3LQGA 3RDKA 3WLJA 2WCGA 2X1UA 3U2CA 3TJIA 1F07A 4MFDA 3B8SA 3T6CA 2PURA 3HZ3A 1HZYA 1R5YA 3N2MA 1W1VA 2VX4A 1QCWA 1R86A 2QJHA 1GKPA 4BQ2A 4S3GA 2PE4A 3A4AA 2NUYA 3HB9A 2OJPA 4H19A 4AEFA 3B9NA 5JBEA 4WXZA 4C6OA 4DHGA 1KXTA 4PB4A 3WUBA 2BWGA 2XHYA 2DSWA 3H23A 4D6DA 4HOZA 2VMFA 4CU7A 4PTVA 4AW7A 2WOQA 3SEPA 3M41A 3N1AA 5M5DA 4XUYA 4AD0A 1R3VA 4JEQA 1BEUA 3D3FA 1PDZA 3VOHA 4KRTA 4NJKA 1DXEA 3WLQA 4JAWA 4HK7A 4P7NA 1Q63A 3EOSA 3GD6A 3MMWA 5LA1A 1B54A 1LL7A 3CZJA 2AL2B 3SUTA 4AF0B 4CD6A 3VZYA 5HMDA 4PCTA 2NLIA 4JYFA 4C6MA 4TXEA 4HYRA 4X2PA 3BLDA 1F6KA 2VUYA 3TR2A 2Y85A 2O7SA 3TZNA 1Z41A 4AWSA 3L21A 1EZ2A 4JS3A 4XBSA 4Q32A 3W2JA 2YBUA 2A7RA 1PYFA 2PC4A 3GNNA 2W0UA 2FVMA 1KQYA 4LYQA 3ZT6A 1EKOA 5AOUA 3S47A 5U7SA 2E6DA 4GY0A 3W26A 1IXQA 1KBLA 3ZR4A 1I6NA 4FLOA 4PUNA 4YCOA 1XLJA 2XM1A 5C2CA 2XIQA 4JIRA 3QPYA 4F2UA 3VIJA 3V75A 4I9JA 3SCVA 3MANA 2NW0A 2ASHA 2JBMA 3LMZA 1O95A 2MNRA 2JF7A 1EYWA 5LSMA 2WLZA 3DGRA 3N6HA 1EZWA 3FS2A 4KWSA 1YXCA 4HK6A 4H83A 3TOPA 2VO5A 1A5UA 1E9ZB 1GT8A 3WL0A 3TXVA 3UCQA 4WY0A 4GKTA 3GIPA 2PDNA 1CW2A 1V8EA 1JYWA 2JKPA 1EP1A 5REQB 3P5YA 4HPXA 4REQB 4C1NA 4W9TA 3EKGA 4TMBA 1XIGA 4IL0A 3ZS4A 3B97A 4RX0A 1DIOA 1VCVA 2CZDA 1IIGA 3HV9A 4DRSA 2NT0A 1EO5A 1R3WA 3M0XA 2PWEA 2WVVA 4U2ZA 3QMRA 5C6MA 2PI6A 3H12A 4BEUA 4RE2A 2OEMA 1HF6A 1TPDA 1IGWA 3PZOA 3T42A 4DZHA 4EF9A 2ZUNA 2PP0A 3M43A 4Z1AA 2J75A 4QGCA 4DJED 2QXWA 1ZBWA 3S1UA 4GCAA 3MP3A 5C71A 4JBRA 1IXOA 3EPOA 4HMCA 2XH2A 2VDHA 3FFSA 5TBOA 3WQEA 4W85A 2Y6ZA 2XYLA 4GE8A 1KLYA 1DQXA 1JULA 3B8TA 3HOJA 4QQUA 3W74A 2VEIA 2PLKA 4PCFA 4UTKA 4N9CA 3E1F1 4LW7A 3THDA 2XIIA 4Y90A 1CPUA 1R38A 4FAMA 4ML9A 1XYFA 3OPSA 4QLLA 2AMXA 2OB3A 3KWSA 3SN1A 5G2HA 2OKTA 3GG1A 2I9EA 4TR9A 4V27A 2V2DA 5JUVA 1QK0A 3WJYA 4NAFA 2NSOA 2ZUWA 3VIPA 1KW1A 1ZAIA 4P2VA 3LHYA 1S2UA 4HD5A 3GFYA 2VZVA 2X42A 2PDXA 2YB1A 1CXIA 3IS4A 3M6DA 2NQZA 4GJ1A 4M24A 3VOFA 1FWSA 4RUBA 5CPLA 3SECA 5JH2A 3VCNA 1Q7QA 3CK5A 3W75A 2QT3A 1JVNA 4DXKA 3BAIA 4R88A 4BJHA 3W7MA 1JEZA 3TN3A 1GW1A 3HMCA 1OB0A 3GH5A 4O50A 3QTGA 4E4UA 1K4GA 1DJWA 3IEBA 3QY8A 2PB1A 3EXTA 2RUSA 4AXKA 3OODA 2HPMA 2BZNA 3W2NA 2DUAA 1R9YA 3OBEA 2UWFA 1G67A 3LPPA 3OVGA 4K6AA 4FLQA 1Q13A 1Q6RA 1UKSA 1UPPA 2GSHA 3EMZA 5LIXX 1V3JA 3PS7A 1FQ0A 3NOEA 4BHYA 4PUKA 2GJXA 1R85A 4C6NA 3AIRA 3G0XA 3ONBA 4KIRA 4AD3A 3CH0A 1EH9A 3LENA 4DELA 2ZTKA 3BO9A 3TCSA 1JYXA 2VVSA 2ESCA 2WSQA 1ZTVA 9RUBA 2DZPA 4GI6A 1RALA 1M7JA 4GPNA 3TYEA 4HHMA 2WPGA 2CBJA 5D2TA 2VZUA 3SW6A 1UR0A 1JI2A 5FJOA 4ROQA 1OFAA 3C3NA 1BSIA 4GVHA 4AC1X 2V6AA 4IMFA 5T9BG 3P2VA 3ARRA 1XV8A 2XFRA 3H2NA 4I7UA 4C6PA 2TPSA 3IJ9A 4Z17A 1S5VA 3MTWA 2RJGA 3C0JA 2EXOA 3MSYA 3RYSA 3CEPA 3TIMA 3G6LA 5K9DA 4GO8A 3NPWA 3FOKA 3HPSA 2QF8A 1PHWA 2FMNA 3VO0A 1PZ0A 4BI7A 2ZQ0A 1CNVA 2YPIA 1R47A 3S6DA 3ATZA 1X96A 2VEFA 2A4AA 4TV6A 2G0WA 2YCLB 4ZBCA 3RJYA 5K4ZA 1MW3A 1XFBA 3RLUA 4ZB2A 1KTBA 2OR2A 3FDGA 1PIFA 3DERA 1TE1A 4K2SA 3ZR5A 1Y5VA 1B3VA 1NU5A 3U8GA 4KW2A 4RPPA 4JNYA 2PSNA 3EGJA 4MMWA 1MFUA 2E1WA 4GA8A 4ADSA 5D8WA 4UFMA 1YEYA 4AFYA 1ZFJA 3LX9A 2EBNA 2D2OA 3ZMRA 1HVXA 3LU2A 4E8GA 3LCHA 5FESA 2NQ9A 3F5JA 2Z1BA 1CB2A 2OWWA 3SIZA 1ZSXA 2NXHA 4LF2A 3QJAA 4GIYA 3JW7A 4NNAA 1PYMA 2J88A 1XISA 3HJEA 1JRBA 4RE0A 2VOTA 2F2KA 3NQGA 3MWAA 3LDVA 3UZWA 3W7JA