1XXXA

Crystal structure of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
296
structure length
296
Chain Sequence
GFDVAARLGTLLTAMVTPFSGDGSLDTATAARLANHLVDQGCDGLVVSGTTGESPTTTDGEKIELLRAVLEAVGDRARVIAGAGTYDTAHSIRLAKACAAEGAHGLLVVTPYYSKPPQRGLQAHFTAVADATELPMLLYDIPGRSAVPIEPDTIRALASHPNIVGVKDAKADLHSGAQIMADTGLAYYSGDDALNLPWLAMGATGFISVIAHLAAGQLRELLSAFGSGDIATARKINIAVAPLCNAMSRLGGVTLSKAGLRLQGIDVGDPRLPQVAATPEQIDALAADMRAASVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate synthase
publication title Crystal structure and kinetic study of dihydrodipicolinate synthase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 114
structure length 296
sequence length 296
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2004-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1xxxA00
2X1RA 3BO9A 4A21A 1EUNA 3TXVA 1G69A 3WK0A 1OFRA 1BEUA 3FS2A 4A2RA 2CLEA 3L0GA 1PCWA 5KMYA 1VGAA 1TREA 4JX4A 1LOLA 3BG9A 2AQWA 3W75A 5LNRA 2ATMA 3QW4B 3SJ3A 1K02A 3W2LA 4YMZA 3TA6A 2VFIA 3TDFA 1SW7A 3A5VA 3L5MA 4GE8A 5CSSA 4O10A 4E2DA 3P7YA 1QFEA 2YDAA 1SUXA 2V82A 4M19A 1R46A 3QEZA 3ABQA 3BARA 1B4KA 1F05A 3WK1A 2FTPA 3IVSA 3PY2A 1FUYA 4EVZA 1EUAA 5LGXA 2G95A 4K37A 3VI2A 5D2TA 2CWNA 4JTGA 4NXKA 4BK9A 1A5AA 1UCWA 3DXIA 3FKRA 2BTMA 3HPSA 1ZAIA 4ZQMA 4LVBA 4Q33A 5I3KA 4K6AA 3GDRA 4DELA 3CEUA 5DY2A 4MZYA 3W7OA 1M6JA 4IQLA 1H7XA 2H6RA 1WV2A 4BFAA 3R13A 1QWGA 1GYNA 2NX3A 3SGUA 3GX9A 1JUBA 1Q6RA 4JDYA 5HMSA 2QCGA 3K30A 4MVAA 4TMCA 5J5DA 1A5BA 1KV5A 2VFHA 3P8JA 3BLFA 4KFOA 5HWJA 1L9WA 4LVAA 1O4UA 1S3HA 3LGEA 1VYPX 3FYPA 3W3OA 3EXTA 3GAKA 1KFLA 4LUJA 3LCFA 4POCA 3TJLA 4OT7A 4IJBA 1IIHA 3B8DA 5EKYA 2ZDRA 5G4EA 2NV1A 4HPXA 4O13A 4YXGA 1SW0A 4O17A 3PSWA 3PUDA 2B7QA 2WPBA 3R2GA 4XZ9A 4PA8A 3KRZA 4OE7A 2BZNA 4LUIA 1SZEA 5CPNA 5HUOA 3UWWA 4FNSA 3UPBA 3CPRA 1BKSA 5K7JA 1Q6LA 2YX0A 3QFEA 5EA9A 1VZWA 2ZA1A 1QPNA 1D3HA 4LC6A 3QC3A 1AK5A 4ZMGA 3C61A 5CZJA 3W1RA 1K7XA 1LORA 4Y90A 3N2XA 1EEPA 5DN1A 3UWZA 2ATSA 2XFWA 2C3ZA 5MHBA 2R8WA 3EX2A 2QUVA 1G67A 2VELA 1JVNA 3NR0A 1VRDA 1R2SA 2F84A 2Y7FA 1X6UA 1TPC1 2FQIA 2NX9A 3UZJA 1GVFA 1VHNA 3ATZA 5EMUA 5EPDA 1RV8A 5LHFA 1HL2A 3IGSA 2QCDA 2C0AA 3BW3A 4K36A 3DFPA 2Y62A 1VS1A 5E1QA 1C8VA 1LP6A 1YXYA 3M6YA 1GJPA 3NAVA 3NOEA 5E0KA 5FF0A 3GK0A 5I3IA 1LTDA 3A5FA 3HO8A 4O18A 3LB0A 3L2IA 4ONVA 3LRKA 3MYOA 2RHGA 3NNTA 5CZTA 2GQAA 3LCIA 3ATYA 5LNUA 4TU1A 1OABA 3LTPA 4JN6A 3AJXA 3P67A 4O50A 4K7YA 3S6DA 3W76A 4LNYA 3BV4A 2CLFA 3ZFHA 5BNKA 3BW4A 3F1QA 3TSMA 1OJXA 2C14A 3H54A 4LW7A 1O5XA 3MP3A 4DF0A 2WQPA 1FWSA 3LTSA 1SR9A 2W0UA 3ZS4A 4O52A 4ZZ9A 2FDSA 4RV8A 4N6FA 1K03A 3LERA 4O1CA 1SZFA 1H7WA 2NXGA 2PC4A 4GFSA 3V75A 4UTKA 2DZVA 2ZZ2A 4FXRA 4I7WA 3SY5A 2NX1A 5FEPA 1JJKA 1H63A 4K8HA 3KFTA 4ZL1A 1DORA 1F5ZA 2I14A 1UUOA 2GOUA 2JGQA 3CQ0A 3A9IA 3B06A 5LNWA 5G2IA 3S5OA 4KKXA 3NL6A 1ADOA 3CEPA 3W1XA 1ICSA 5CZSA 4Y8FA 4UIOA 5HR6A 1S5VA 1EP2A 4KFPA 1G7UA 1OFEA 5C55A 4LVFA 4YL2A 4LS1A 1XBXA 4N9EA 4ALDA 3PULA 4O0KA 5D09A 3OVQA 2Z0IA 3EX6A 1IGSA 2X1TA 1LCOA 2NZLA 4AHPA 5TIMA 3TSBA 1RPXA 1AW2A 2QCHA 4QSHA 4BWLA 4H3DA 1TTQA 4DO5A 4I7VA 3HB9A 1QDSA 1TPVA 3WK2A 3L67A 3IIPA 5GVJA 3JS3A 2QAPA 3KVKA 3W2NA 1H5YA 1ZJIA 2RH9A 2QR6A 5AHEA 2A6NA 3HIJA 3C6CA 3W1AA 4DXVA 1FBAA 2V5LA 1GG1A 3AO0A 2QF7A 4Z1DA 1G4TA 3NZRA 4O11A 5K4XA 4XKYA 2ISWA 2QAFA 5CKSA 1VYRA 2E6YA 3PUOA 4CQAA 3NQAA 1I2PA 4MYXA 4CCEA 3A21A 4OU1A 3G0SA 4UNLA 1E51A 3EWUA 1EB3A 3IIOA 3SECA 4QISA 3M47A 3EWXA 4UR8A 4JR5A 1Y0EA 2IQTA 4JS3A 2Y6ZA 3TX9A 3JR2A 5KZDA 3GKFA 4FIRA 2B4GA 5HWNA 3NQ2A 3SSJA 1CW2A 5EL1A 5C2XA 3W74A 3KVJA 1TPH1 4W9TA 1PE1A 3PF3A 3SZ8A 4UTIA 3W7JA 4HSNA 4XBKA 4UTUA 2B0MA 3CWOX 3A23A 1AW5A 1EP3A 2CLHA 4Z08A 1W0MA 1RZMA 3LDVA 3HG2A 2W79A 1F73A 2ZZ5A 3TV8A 2EPHA 3W7GA 1NEYA 4O54A 4IX2A 2QJGA 4LOCA 3RU6A 1PV8A 4GUIA 3W9ZA 3MBDA 3Q94A 1VCGA 4CNNA 4EF8A 1L6SA 4MY8A 1XUUA 3STFA 1KFBA 3GVGA 3GYEA 1B3OA 2GQ8A 3W1NA 3CC1A 2QCNA 1IXNA 1LZOA 1I45A 1J4EA 3MI6A 2C1HA 3W6YA 3EWBX 1Q45A 6ALDA 2UV8G 5AOUA 4XTIA 1JRCA 3FEMA 3W1MA 4IXHA 5I3HA 3G1FA 4AWUA 1WBJA 1TV8A 3FFSA 4AEOA 4HHPA 3W1QA 1KM1A 2J24A 2R94A 2CLLA 5D33A 1RQEA 1EA0A 4R34A 2H8XA 1OX4B 2ZZ1A 1TQXA 4PFMA 1A5CA 4JX5A 1OX6A 1TPEA 1XBZA 3TKFA 4RJEA 1I4NA 2X30A 4CQ9A 1TPUA 4RR4A 3B0PA 1WQ5A 3HBLA 1DQXA 5F4XA 1LOQA 1RQHA 4QAIA 1T99A 1A53A 3DENA 3UWQA 3W85A 4LS0A 3P60A 3QPZA 3G1SA 2C18A 1KTBA 4JTFA 3YPIA 3M1ZA 3MJYA 2G97A 3OEXA 4RLIA 2ISVA 1EIXA 1K8ZA 3LV5A 5D30A 1KLZA 4BI5A 1GVSA 3N73A 2E1DA 3FJ6A 2YFOA 2ZFAA 4Y96A 2V81A 3KXQA 5H91A 1LLZA 2FPVA 3W72A 3MP5A 2LLEA 1ZHAA 3HG5A 3A22A 1VCVA 4G1KA 5AHFA 3TH6A 3W70A 3W07A 3NYZA 3KHJA 2X1SA 2XN0A 1DJQA 4JY8A 1OK4A 4NZJA 3W7EA 4NJIA 2FPTA 1HUVA 2Y88A 4IPJA 1FXQA 1SQ7A 4I7UA 3SFKA 5LGZA 4FX7A 4IMCA 1TJRA 3TIMA 5AC8A 4UTTA 3LHZA 3CM4A 4ZQRA 4X2RA 2E6FA 4ZVJA 2DZXA 3KRUA 1X1ZA 2RDWA 4M7SA 4UFKA 3O8AA 3ZWSA 2RFGA 2WV8A 3FIGA 1UB3A 5AYYA 4LTSA 1OF8A 1RD5A 1AL8A 3C2EA 3SIZA 2V8ZA 3FLUA 5T26A 2J9ZA 1P1XA 4PCFA 4CQ8A 5FEZA 1FWNA 3LRLA 1W5QA 3NQMA 3NG3A 3DHDA 3IIVA 4MLJA 1P5BA 4X22A 2GQ9A 2OMAA 3O6CA 2YZRA 2BWGA 4N9CA 3EWYA 4UTTC 2A7PA 5FF4A 3W86A 3MHGA 2GVJA 1GZGA 3TFCA 1TYGA 3TXZA 2EKCA 1G7VA 2PRHA 5AHMA 5AB3A 2A4AA 2YW4A 3WJYA 3NM3A 1W56A 1UBSA 2E5DA 4QJ1A 4RXFA 1LM1A 3DBPA 4MZ1A 1JUKA 1GQNA 3STCA 3BW2A 2DZPA 4M6QA 3OA3A 3PB2A 1H1ZA 4EIVA 4GWEA 1H51A 1XL9A 4GNJA 3TAOA 4XTDA 2OX1A 3TJXA 3FJLA 2OJPA 4ADTA 4JTJA 3LM7A 1QPQA 2YGYA 3N14A 2HTMA 5CPMA 4AF0B 1MO0A 3HG3A 2Q8ZA 4P61A 3T40A 1TMHA 1XDLA 4JX6A 3MHFA 2OCZA 4BI7A 1TV5A 3NA8A 3UXDA 3MO7A 4X3ZA 1WBHA 4LRTA 5BW6A 5G1TA 3B0VC 1PHQA 3TQ0A 1R2RA 3B03A 1W37A 2DJXA 3N3MA 2Q3RA 4DBEA 6TIMA 3C2RA 2E77A 3L5AA 3DKJA 1TTIA 2J27A 1AL7A 5G1YA 1C29A 3OG3A 1VQTA 3M5YA 1KM4A 4PTNA 5AYZA 3G1YA 3MI2A 1XFBA 5D32A 4FO4A 1GVOA 1VLIA 5KINA 2VFGA 3UNDA 1NF0A 3SR7A 3CU2A 3B05A 5L6UA 3CB8A 1FXPA 1W3TA 3CWNA 2C13A 3G0XA 4MKNA 2EAWA 3I7RA 4QIUA 1H7OA 3BLIA 1QCWA 3R8RA 4JTUA 4O0ZA 3BK0A 3KAOA 1D9EA 3G1VA 3GNDA 3S42A 1TRIA 3LXAA 4O53A 1QO5A 1F7BA 4R7JA 4E2BA 4WQ6A 1K7EA 1T96A 1SZGA 3NL2A 2ZA3A 3W7CA 3FA5A 1OFAA 3C0JA 1TTJA 4FNPA 1XXXA 3S1WA 8TIMA 3LX9A 1KW1A 4NX5A 1H7PA 5F4SA 3UQNA 3MUXA 3I7QA 3RNDA 4FNUA 4UMBA 3VFLA 3WFAA 1QPRA 4AMAA 2ZRVA 4JTEA 3BPWA 1KM3A 4N9DA 2NXHA 5LZLA 4YCOA 3FKKA 2ZRYA 2ALDA 2CW6A 1F76A 4RKAA 3O15A 5DXXA 2FLIA 3GB6A 3W2UA 5EY5A 4BI6A 4UTHA 3PS7A 1OFPA 2RDTA 3O06A 3TFXA 3U2OA 1VCFA 3TW7A 3PAJA 2V30A 1B4EA 3GXNA 1I2OA 4NJJA 3INPA 3ELFA 1MSSA 3HPXA 4KWWA 4YWIA 3EKLA 1GEQA 4LS2A 1NSJA 4JTLA 3M7WA 3O16A 4JTKA 2CLKA 4TR9A 4AB4A 1V5XA 1WXJA 4Z1CA 2QCLA 1AG1O 4FNRA 4NT0A 4ORIA 5EYWA 5K3VA 2JKEA 3CTLA 2EF9A 1ZALA 1TB3A 3W7IA 4LT9A 4H4IA 4LU0A 3LV6A 3NVTA 2Y63A 1F74A 1LRTA 1ONRA 3EWZA 2GVGA 2DP3A 1OX5A 1EPXA 1BWLA 4M6VA 5F2LA 1FWRA 1DVJA 1LYXA 3OHIA 5D03A 3LLDA 3HQ1A 3GDMA 3L65A 2H3BA 2NUYA 1GTEA 4HIBA 3HOJA 5DY3A 2A7NA 2Q3OA 4DF2A 5HNRA 4WD0A 2A7RA 1MEHA 3NQ8A 3M0ZA 4FIQA 4FEZA 4XBSA 3FOKA 4O16A 3NGJA 4QNWA 3QSTA 3DGRA 3P5ZA 3T4CA 4EOUA 3LI1A 3BVJA 2ZZ6A 3M41A 3M5ZA 2ZZ7A 1YDVA 4AH7A 4LWWA 4TO8A 2DZUA 3LHUA 2QCFA 4ICNA 4MJZA 1OHLA 3GXTA 3TU9A 4N02A 2BLEA 3CLMA 3FYOA 1DQWA 1DOSA 4UFMA 1GT8A 1ZY9A 3TUUA 4O1DA 2BXVA 4JTHA 1M7OA 3THAA 3U6WA 3GAYA 3V1PA 1M7PA 2YSWA 1IXPA 1XKYA 4O1AA 2V2CA 1SO6A 3STEA 4ADUA 3IRDA 1SSDA 5DBTA 5CPOA 3P84A 4KWVA 3T44A 1IIGA 3PC0A 3EX4A 5DXYA 1UUMA 3LRMA 3DFNA 3G18A 1OFBA 2QJIA 4JYEA 1FX6A 5I3JA 2HS6A 5DCEA 5DCDA 1KTCA 3BGGA 2PURA 4FNQA 4WY0A 1SO5A 5D04C 4UFJA 5AHIA 3M5XA 4WZHA 4U4MA 1K8XA 2E68A 4JTIA 1CX9A 1OYCA 4NNBA 3C52A 4TIMA 4B5NA 4U28A 2A21A 1XDMA 4PC8A 5U4NA 4ADSA 1DL3A 1L6YA 3ANYA 1GOXA 3R89A 4Z0SA 4JY9A 3M16A 4IXXA 1HTIA 2E6DA 1MZHA 2X2GA 2G96A 5D2XA 4UTWA 4NQ1A 1ME8A 3UY7A 4MZ8A 3P74A 1W3IA 4UFIA 3NPWA 3BG3A 4MJMA 1I8JA 1BWKA 2I9EA 3MHUA 1TTPA 1FCUA 3MYPA 4J9JA 1TIMA 3LCLA 2EHHA 1N7KA 4UUIA 1DBTA 1YXDA 3DH7A 4BR1A 1MXSA 2Y85A 1SFLA 2OZ0A 3PR2A 5HWMA 5LNSA 1X7FA 5HJLA 2Z2UA 3E02A 3W1TA 4CNPA 4PODA 4AHQA 1J2WA 5SWUA 2FFCA 3IVTA 3LCWA 4RCXA 2JKAA 2ISSA 2FJKA 3RLVA 5F2MA 3C2FA 1Z44A 1OF6A 1W54A 3NPUA 5G5IA 3UPWA 3UWUA 3Q37A 1RR2A 1XM3A 2OT0A 4RZ6A 3NQDA 5A5WA 4N4QA 2GJLA 3EWWA 3LHYA 5U7SA 2V5BA 5D2VA 2CLOA 1FDJA 1VJIA 2P0OA 3KVMA 5AFDA 1LBMA 4LRSA 4EF9A 1P0NA 4WOQA 4UTWC 1YDNA 2OT1A 3QMSA 3PM6A 2QCEA 3G1XA 1JCYA 3JRKA 3W73A 2NWRA 4UFHA 2B7OA 3HPZA 3P8IA 4M5PA 5A8GA 1VYSX 1XCFA 2ZBTA 3THQA 3RF9A 1PVNA 3S9YA 4XWUA 1YXCA 4HSOA 3USBA 4IOTA 3LHTA 5L9FA 5K2ZA 1W5OA 2JKPA 3S5YA 3DI1A 2CZEA 3RFAA 4NUWA 3DAQA 2WJZA 3MWAA 3TNOA 3QMRA 1DKWA 1I2RA 3EEGA 1WYIA 1G4SA 1H1YA 4YLWA 3HGSA 4GUFA 3TW6A 1K7FA 3KVLA 3NPVA 2TYSA 5AC7A 1Z42A 4MPQA 1O95A 1K8YA 4MLRA 2QCDB 4NZFA 2PE4A 1YPIA 5E93A 1ZFJA 1HO1A 2GUUA 3I68A 5C54A 1KV8A 4H6KA 3VE7A 5TQLA 5IM51 2YR1A 1GTHA 1J5TA 4IMEA 3NQFA 1SPQA 3IIXA 3RK8A 3MW7A 5HQEA 3GDKA 3DU0A 3L0NA 3TAKA 3W88A 3EXSA 4O57A 4LVGA 2VFDA 2Y7EA 1VLWA 1U5JA 3L68A 4WOZA 4K39A 3T7VA 1T0OA 4O8RA 4D2JA 1JQXA 3S1VA 2J9XA 4UFLA 3UY8A 1L6WA 3O6DA 5KITA 3W87A 3Q2DA 5D38A 2QEZA 3LBCA 5D05A 4AXKA 4RK8A 4ZQOA 1FCVA 3S8HA 1YPFA 5IBXC 5CSRA 2V2HA 3OIXA 2A85A 2ZZ3A 4K8EA 4N4PA 1YTEA 2VFEA 3EXRA 1G6CA 2A0NA 4C1KA 3OBKA 3G0UA 2FPYA 3GDTA 4JIPA 3LHVA 2P1FA 4IX0A 1QR7A 2QDGA 3C3NA 3T55A 3NL3A 5BMXA 4IMFA 3LCXA 3W1LA 3G22A 3W2KA 2FB2A 3MMTA 5HUPA 2DZTA 4AWTA 1KM2A 4N2YA 4RXGA 2DZSA 1IF2A 4UMAA 3I7SA 4E0CA 3DFTA 2ZRZA 3M5VA 1D3GA 1LBFA 1T8XA 1ZAJA 2O7QA 3U8GA 1QAPA 3PWAA 4HNNA 2TSYA 3EX3A 2CLMA 5EBUA 4Y6GA 2VEKA 3T78A 5BRBA 1N55A 3PVFA 2FIQA 1QOQA 1UJPA 3IV3A 3NQGA 1X8FA 4WXZA 3GIYA 1S5WA 4PH6A 1JCNA 3I65A 1HO4A 1I2NA 2J6XA 4MY1A 2VOMA 3W7NA 3H53A 1QO2A 4PL2A 1VHCA 2TMDA 3DZ1A 1Z41A 1FWTA 3MP4A 3GR7A 3LCGA 1R47A 3EX1A 5LHEA 3P82A 4NNAA 1SFJA 4KFNA 2YYUA 1FY6A 5LNVA 4MYAA 4DPPA 3IEBA 5KSWA 4XKYB 3QF0A 3TMQA 4MY9A 2CZ5A 5DBUA 3SW6A 2AGKA 1KA9F 2WSYA 1Q6QA 1FCQA 5FF7A 4I9AA 5I3FA 3CT7A 4QM1A 4OWGA 4RX0A 4S1FA 4XQ6A 1R30A 1LROA 3M44A 5F4WA 1YADA 1X1OA 1YYAA 4L4LA 3QZEA 3VKJA 4Q32A 5FEWA 4Z1BA 2FB3A 1KFCA 3W84A 3OVPA 3E0IA 4IGHA 1KBIA 1YTKA 3NQCA 4PL1A 1FWWA 3QH2A 5F2GA 4R33A 3S5ZA 3L0KA 3UYCA 3QW3A 1XUZA 3LBMA 4RZ5A 1W5NA 1KFEA 2BX7A 1H7NA 2RDUA 3PBUA 1KM0A 3B04A 2WKJA 5CG7A 4UMCA 3TQVA 4A29A 5AHNA 3E12A 3TQKA 3F4NA 4O28A 3SI9A 1HFBA 3W83A 1OFQA 3S0CA 4JXCA 5BOOA 5J5RA 1WA3A 1IXQA 4X9SA 1W1ZA 4ZQPA 4OBTA 1WX0A 1ZCOA 4A3UA 3UZ5A 4NX0A 3G8EA 1PIIA 3C8FA 4A2SA 3SGZA 3PB0A 4FF7A 4N9BA 2YPIA 2X1UA 2V0TA 2ABAA 4GRSA 1QNVA 3C2OA 2Z1BA 3GNNA 4MIMA 3G24A 1TRDA 4HPJA 3P80A 1GWJA 3VNDA 2CFFA 7TIMA 2B7NA 3TC6A 5I3GA 2NXIA 3GDLA 1OK6A 1RQBA 1THFD 4ORMA 5F1VA 3ZWTA 4UXDA 3W1UA 1GVQA 1LLWA 2C16A 2HSAA 1TPDA 3S5NA 3R12A 4K7VA 4AHOA 1JR1A 4HNTA 1P4CA 4OHQA 2QCMA 2VXNA 3QQ0A 2ZTKA 1TJPA 1XBVA 2GJNA 4JD4A 3C2VA 1FQ0A 3DKLA 2R14A 1UASA 1V7YA 3TE9A 4O1BA 3GR8A 4GJ1A 5FEXA 3G3DA 2I1OA 4CLMA 1ME9A 1PL9A 1GVRA 1EWDA 3NXFA 1OFOA 4WXYA 1HG3A 3W7RA 4S2CA 3M43A 2HMCA 3H55A 1TV7A 1XC4A 3GKAA 1NAL1 4MFDA 1WOAA 2CZDA 1TPWA 5G4WA 1Z48A 5TBOA 2H90A 3QRHA 4JGDA 4DO4A 3TCEA 4C1LA 1O60A 1AW1A 2Y61A 5KZMA 1KBJA 4JNMA 1OX4A 1LDCA 2O7SA 5BMWA 5DCBA 1A5SA 4N6EA 1U83A 4WJEA 3NQVA 2TRSA 1TSIA 1TPFA 1KLYA 3M9YA 5D37A 2E09A 1JCLA 2PRLA 4O14A 2PRMA 3S1XA 3DFOA 2QKFA 3P61A 3RMJA 1WAUA 1FCBA 2XN2A 1EP1A 4DF1A 3MI3A 2JBMA 4NVTA 4JYFA 2F7FA 4IWWA 5K9DA 5K9CA 4NU7A 3CIXA 4OV4A 2E5BA 3W2MA 2NWSA 1GYLA 3G1HA 2QCCA 2WNQA 1H60A 4OV9A 5AYXA 3NQ7A 4XUGA 3TR2A 1GG0A 3HJZA 1LRQA 5D2WA 5AN7A 3W1PA 3N9SA 5DELA 2GVLA 3L5LA 1JRBA 5AHLA 4CNOA 2WNZA 1QPOA 1DHPA 3W7DA 4MFEA 4HNUA 2CU0A 3DFSA 3NDOA 2Y7GA 1CI1A 1TQJA 1AMKA 2JGYA 3PUEA 2ZCGA 5K9XA 3P81A 1W8SA 3PSVA 1VR6A 2ZQ0A 3O63A 4IUOA 2CLIA 4PEKA 3W7HA 3O6YX 3C4UA 2WOQA 3QPYA 3RLUA 4Y9AA 2ZTJA 1TPB1 2R91A 3P5YA 4LY8A 5D2YA 1OVDA 3KRSA 3EKZA 2A6LA 2BSLA 2VEPA 2Q8LA 3TSDA 3GZ3A 3E9AA 1QMLA 2RKXA 4Q4KA 1H7RA 2YXGA 4M7TA 3PBYA 1PS9A 4Z1AA 4GBUA 3W23A 4JYDA 4JEQA 3W2JA 3WJXA 2YW3A 1SO4A 3STGA 1EWEA 5F2IA 3HF3A 4NJKA 1KM5A 3VCRA 4NJHA 2J88A 3NM1A 3W7KA 5C5YA 3G8RA 3IIZA 1XI3A 3NL5A 1OFDA 2VFFA 3PBVA 3W71A 5F1UA 2VEMA 3F03K 3WJZA 3Q58A 4DEFA 2G5WA 1JUEA 4NJGA 4LV4A 4HN4A 4WY0F 3PBWA 1PCKA 2NUWA 4L4MA 2H8ZA 3O07A 3QYQA 3WK3A 3N34A 2ZA2A 4FX6M 3O05A 2E6AA 1H62A 3LXCA 3D0CA 5ABTA 3ABSA 3QM3A 1W5PA 2B7PA 3UXAA 1RVGA 3N2MA 4UC5A 5K4ZA 4O15A 1ZAHA 3KX6A 3PG9A 3R5EA 3P62A 2J9YA 5LKYA 4UTMA 3LTYA 1DJNA 4CCCA 1JCXA 1P0KA 3L66A 3QJAA 2Y70A 4AF0A 4ML9A 1KFKA 1VH7A 4JICA 3LHWA 1S5TA 2VKZG 3QSRA 1W3NA 1Q6OA 4QQ3A 1ML1A 5CZ0A 5HINA 1KFJA 3HGJA 3QQ1A 2NV2A 4CCDA 1LBLA 2ZRWA 4UR7A 2D73A 2DU2A 4BWLC 4M6PA 4TMBA 2NLIA 2DORA 1MEWA 1LRNA 2A2IA 3UD6A 1PHWA 1G4EA 2HS8A 4HNVA 3L21A 5DLCA 5C6MA 1R2TA 2WO5A 3WJWA 5CPLA 4JTTA 1SSGA 2EGZA 1A50A 1F2JA 1ICPA 3NQEA 3BLEA 3LCHA 5G2WA 1EX5A 1JCMP 3NO5A 1C9DA 2V2DA 4IMGA 3TROA 2ZRXA 4FNTA 2ZYFA 3W7QA 4FX8A 3IVUA 2QUTA 3I6RA 2DZWA 2C15A 1NVMA 4GUGA 4DBDA 2QDHA 2Y7DA 5KZEA 4UCGA 3HGRA 3UWVA 2AAMA 3G1DA 5FF3A 3EB2A 3GLCA 2WSQA 4MOZA 4P2VA 3UWYA 4WX2A 5FI8A 3C56A 5IBXA 3NQ6A 1FDYA 2KZHA 3G3MA 1WDWA 3NPXA 4GXMA 2QUUA 4FXSA 3DFQA 4HKPA 1OYAA 3ABOA 4MUZA 2Y89A 2H3DA 2V9DA 3MBFA 3LLFA 4DPQA 4O4WA 1ICQA 1Q3NA 4GUHA 1ME7A 2A1YA 1O5KA 2ABBA 4UNKA 1JULA 3TMLA 1KTNA 2Z6IA 4FB7A 4AAJA 3L9CA 2JK2A 1G4PA 3LXBA 4QNEA 1OYBA 2P10A 2QJHA 3NEVA 3HGOA 2NUXA 5FF2A 3GXPA 1I2QA 4ZQCA 4DQWA 3W7LA 4K38A 2X16A 3G1AA 4HT3A 1SU5A 3ZR4A 1SZNA 3N9RA 1ZENA 3S1UA 4LVDA 4GC4A 3HMJG 1OG0A 4EWND 3TC7A 3N19B 1VPXA 1VC4A 3W7PA 2ZRUA 1L2UA 2A5HA 4S2BA 4O4VA 5H2ZA 3PG8A 5D02A 5LSMA 1ALDA 2XN1A 1TCDA 3BGJA 3E96A 1F6PA 3KOFA 4IPIA 4OQVA 4UTLA 2WNNA 3QMTA 3ABRA 4LC8A 1B9BA 1H50A 4NXSA 4ZQNA 1WOBA 2DJLA 4WUIA 1K3UA 1SW3A 5CGQA 4DO6A 1DV7A 3NZ1A 1W5MA 3DHFA 1ZNNA 2VENA 2PCQA 2ZZ4A 3LOTA 4AVFA 4O12A 2W6RA 3IGUA 4YCPA 1LOSA 2YYTA 1JCJA 4UTJA 4QITA 3HG4A 3B0UX 5HULA 1B57A 5AC6A 4O19A 3A24A 3W22A 1FDZA 3O1NA 1KM6A 2C19A 2Z6JA 1JQVA 2VEIA 3BG5A 1YDOA 3CIWA 1W31A 3OVRA 1F6KA 1SO3A 1XBYA 4RZ4A 1TO3A 3W7MA 4R53A 3LI0A 2TPSA 3DI0A 3VE9A 4E38A 2GPTA 4JDBA 1GPWA 5FESA 4AWSA 2VC6A 1N8FA 4TX9A 4WY0B 4GUJA 4BF9A 3E49A 5G2HA 4IMDA 3WJSA 1O94A 3IGXA 4JTSA 2C6QA 4LV9A 4A22A 1M5WA 1MEIA 1IXOA 1YTDA 4Z0JA 2E5CA 2YCEA 1NFBA 5HR7A 1H61A 4NNCA 3B4UA 5KTLA 1QOPA 3CHVA 4JIQA 4FHAA 4OGZA 2YFNA 3F4WA 1YLVA 2CZFA 3TK7A 1NF7A 1BTMA 2WSRA
chains in the Genus database with same CATH superfamily
4TTUA 2VGGA 1R3VA 4DWSB 3BO9A 4PN2A 3TXVA 4JHOA 1OFRA 3KDOA 3L0GA 1PCWA 2BS9A 4M56A 3Q45A 3KTSA 2WJEA 3W75A 2ATMA 4JNYA 4O1FA 1TVNA 1FA2A 3RPDA 4JQAA 1KGXA 3EPOA 3W2LA 3T0BA 3TA6A 2VFIA 1SW7A 1J5SA 5C2CA 4H04A 4J35A 2NVAA 3L5MA 2FKPA 2Z00A 2PDQA 1UR1A 1SUXA 1R46A 5ABHA 1B4KA 3M46A 2FTPA 8XIMA 4JFWA 5BOEA 1QK2A 4RPQA 3H4WA 4NXKA 3HURA 1B30A 3DXIA 1QW7A 1ZAIA 3R8HA 4LVBA 5I3KA 1R3QA 1R3RA 1TVPA 1BSLA 3CEUA 1ENUA 5HPOA 1E6QM 3CK5A 3ZMRA 1GYNA 3SGUA 3FN9A 5HMSA 2QCGA 3OODA 1KV5A 3A4XA 3BLFA 1BQGA 5HWJA 1T8QA 3DFYA 2CBVA 1E0WA 1PKYA 4I6VA 4IGMA 2Z25A 5M1TA 1KXVA 3LCFA 1V51A 4POCA 4GJIA 3IRSA 1XRVA 1Q6DA 4A8RA 3MC5A 1VFHA 2V3DA 3WNOA 4RE0A 2B7QA 1XV8A 4LPCA 2X0SA 4CUCA 1EHNA 3KRZA 4OE7A 2BZNA 2OWXA 2PC8A 1SZEA 1QNPA 3O2LA 1UH3A 4W7WA 3WH5A 2PFHA 2PDKA 1PZ0A 3QFEA 5EA9A 1VZWA 3AWNA 3QR0A 1QPNA 2HEJA 1AK5A 4ZMGA 2PP1A 3W1RA 1HW6A 1OADA 3PBMA 1EJUC 1VIZA 3TTOA 4ZR8A 4FXFA 1JNEA 1E0UA 2C3ZA 1V8EA 2OZTA 3T9PA 2R8WA 3UXIA 4HU0A 1JVNA 4GH1A 1R2SA 3CUIA 2Y7FA 1YNQA 1GVFA 4HA3A 4UQDA 3ATZA 1DIKA 4H9VA 3IGSA 4C65A 2J6VA 3SCWA 1HQTA 4LF1A 3RR4A 4E2VA 3DFPA 5I03A 4OKDA 1XLBA 1XGZA 2VWTA 2PDIA 1VRXA 4QGCA 2BOEX 3GVWA 3L7RA 3GK0A 1BVWA 1XLDA 5I5RA 3EGJA 3P2VA 2UWFA 3HO8A 2P8BA 1EPVA 4O18A 4PB3A 5LIKX 3L2IA 1QNRA 1CXEA 4ZODA 4TU1A 1BSIA 3AJXA 4LYPA 1V77A 2PUZA 3P67A 1BWVA 4JPGA 3ZQ9A 4AU0A 4LNYA 3ZFHA 2HVNA 3SN0A 1JYVA 1QNQA 2WBKA 3LTSA 1H0IA 2W0UA 1GUVA 4O52A 4ZZ9A 3N9KA 5A6KA 4D6GA 2FDSA 2OEJA 4N6FA 4NI8A 4CEXC 1H09A 3VXGA 1V93A 2DW7A 1H7WA 2ACSA 4W5UA 4UTKA 2ZZ2A 1V6UA 4GQQA 4U3AA 2EJ1A 2NX1A 5FEPA 1H63A 1POKA 1DORA 3ITYA 2JGQA 1R9ZA 3C3UA 3A9IA 5BU9A 2ZX7A 3W1XA 1XCXA 2XH7A 1UR4A 3C0LA 1KWGA 1W9VA 2J13A 4C7FA 1E0TA 2REQA 4YL2A 3BLDA 2CCRA 1R3WA 1GOIA 3PULA 1ZGDA 4AVOA 1CLKA 4LQ1A 1UP3A 5D09A 1RA5A 2O0TA 3EX6A 2X1TA 2NZLA 3TSBA 1AW2A 1OIMA 3GZAA 4QSHA 2ZUSA 3PZUA 4X2PA 4H3DA 3VNYA 3WX7A 3MANA 4AZBA 2XM1A 1TWIA 1NOFA 1TPVA 3WK2A 3AIQA 3CAVA 4DXVA 5A2AA 5A6JA 2V5LA 5KZ6A 9CGTA 2QF7A 1G4TA 1A5KC 1ZTVA 3W02A 2PSNA 4EXBA 1VEPA 3AIWA 1VFTA 1EO7A 1KFWA 1VYRA 2E6YA 4XO7A 2ZKMX 1I2PA 2XWEA 6A3HA 3WL1A 4CCEA 1WB0A 3A21A 1XKJA 4BQ4A 4UNLA 2QJJA 3SECA 4QISA 1EQCA 4JS3A 1P0EA 3GKFA 2B4GA 3NQ2A 3SSJA 3VZYA 4NI3A 4NZ5A 3W74A 3IJ7A 1TPH1 4W9TA 3ZJ8A 3AQUA 3SZ8A 2PU1A 5EMKA 1EGZA 1FVPA 4XBJA 4IIDA 4XBKA 2QNEA 2HE5A 4IGSA 4DBWA 4GO8A 1KNWA 1JIBA 2VZOA 4F66A 4QEHA 1EP3A 3ITOA 1W0MA 3LDVA 4YNGA 1NM9A 4PBGA 1NEYA 5JIPA 1OC7A 1I1XA 1AJZA 4GUIA 2OEMA 3BZJA 5HNTA 2FFIA 2P76A 4QXIA 4IJRA 1KFBA 3GVGA 4IF2A 1C3FA 1T7LA 1IGWA 1LZOA 1EGVA 3MI6A 3G77A 3W6YA 3WCZA 3VNLA 4HJFA 1UWIA 4KT2A 3WBEA 1M53A 1WBJA 1TV8A 3FFSA 3GNRA 3N3TA 2BASA 3PJTA 5EBAA 3SUUA 2WB5A 1RQEA 4LYKA 2H8XA 4Q8OA 3GYCA 1QNSA 3O6AA 1TQXA 1OX6A 1TPEA 1JF6A 1XBZA 3TKFA 1WZMA 3M0YA 4CQ9A 1WQ5A 2FJUB 3VOJA 2R1KA 2RJGA 6REQB 1W91A 3AHYA 3DENA 3OPSA 4MB4A 4LS0A 7XIMA 1F3TA 3QPZA 2YL6A 2VZSA 4FALA 2G97A 2W91A 3NOYA 2ISVA 4AZ7A 4QR6A 2DSWA 2E1DA 4GX8A 1XW8A 2C1IA 3LA4A 1PX8A 5HDRA 1NDYA 4DUOA 5A8QA 3NYZA 3GVRA 1TWSA 4NZJA 1E6RA 3AZTA 3KLKA 3GBDA 3UJ2A 2FPTA 2AL2B 1IQ8A 1FXQA 3GXDA 3BE7A 1ZS2A 4FX7A 1UR9A 3LHZA 4DN1A 4OTKA 1R7AA 4ZVJA 2DZXA 5GPRA 3QZ6A 5CBBA 3O8AA 1SGJA 1JEZA 2WV8A 3O0KA 4LTSA 4AQLA 1OF8A 4GVHA 4TX6A 3OYXA 4J3ZA 2IQ0A 4DJFC 4XZWA 1REQB 2OYKA 4PUNA 1CYGA 4GVFA 4DRSA 2J9ZA 4GNKB 3JU2A 3B8IA 4PCFA 2OYMA 3W01A 3NG3A 3DHDA 3TW9A 3IIVA 4HYWA 3KTXA 3N11A 1P5BA 3E0WA 3GC4A 4ICCX 2GQ9A 3WQ6A 4EPEC 1Q5MA 3T2QA 4UTTC 4JKMA 1E9LA 3DIPA 1TYGA 3T8QA 2EKCA 1G7VA 3BLOA 2CKRA 2PRHA 5AB3A 1KWKA 2INZA 2PDHA 3UW6A 2A4AA 1JI1A 2YW4A 3GG8A 1EC9A 3NM3A 3QC0A 2MUCA 5I0DA 4QG6A 4FLRA 1JUKA 4PULA 3GVVA 3WD0A 3OA3A 5MKGA 3PB2A 4PMVA 4C60A 3HZ3A 4GWEA 2QYGA 1XL9A 4JL2A 4GNJA 3LQGA 3QPEA 1XIEA 1XC6A 1QPQA 4DUXA 3N14A 4XZIA 2QT3A 5LIYX 1Z32X 1XDLA 4HU3A 4HZ8A 2WCSA 3MO7A 1WBHA 1JZ7A 5BW6A 1LUCA 4Z42C 3WD1A 3TQ0A 3UYIA 2JALA 4XAZA 2ZE0A 4DZ5A 3N2TA 1C29A 1W1VA 2CYGA 1PPIA 3M5YA 1BD0A 4JOMA 2O55A 4H9MA 2PDMA 1PO9A 5D32A 3M0KA 3ERPA 5D9MA 3CGTA 2JIWA 4FO4A 3SR7A 5I77A 1W3TA 4QIUA 4WDTA 4Y7EA 2WVTA 3R8RA 1PUDA 1EF3A 4FAMA 1HVQA 4AXNA 1S5MA 3KAOA 3H4XA 4XSMA 3GNDA 4J3SA 2YA2A 3WDRA 1F7BA 4XZNX 1FFQA 2BY2A 1BYCA 2WC4A 1JD7A 5H8PA 1VPYA 5GQBA 3NL2A 2DT1A 3FJ4A 3C0JA 4S39A 4FNPA 3OW1A 3JZEA 3WQVA 3MJMA 3PPGA 1P43A 2ICSA 3S1WA 3CV1A 3PHAA 3MUXA 3RNDA 4FNUA 4D71A 2V5JA 2VYOA 4JTEA 5D4YA 4K68A 3DYPA 4GGHA 4YCOA 2CZVA 3O15A 1J6PA 1H2JA 2FLIA 3URNA 1E70M 5ABEA 5AVHA 4F79A 1RSCA 3U2OA 3TW7A 3QTGA 3GXNA 4HOXA 4P8UA 3INPA 3ELFA 1MW2A 1MSSA 2BVYA 3TYEA 4Q6XA 3CQHA 3KP1A 3QQWA 1GEQA 1W1TA 1D7FA 3MCNA 4LS2A 1TG7A 3URQA 3V0UA 4GQRA 1MMFA 2ZOXA 3VIHA 4P8WA 3PN8A 4WDUA 1DXIA 4ZB2A 2XVKA 1E0VA 4ORIA 1OB0A 4AX6A 3SRDA 3CTLA 4KEVA 3WBYA 3W7IA 4LT9A 4B91A 4I6KA 3VOIA 1LRTA 3EWZA 1NJJA 4HOWA 4G5DA 5F2LA 3BLLA 3VNJA 2FMNA 2WVVA 2BNJA 3NGFA 4MNMA 1JAKA 3PWGA 4DF2A 5HNRA 1GQKA 2XZ9A 4WD0A 4X0NA 4UQBA 4GCAA 3NQ8A 1W2PA 4XBSA 1XDJA 3ZLHA 3NQBA 3S47A 3VM7A 4FMVA 3GC5A 1KXTA 3RM8A 1OY0A 5AKQA 3M5ZA 2BBFA 2XIOA 4M24A 3KOWA 2PDCA 1OHLA 2W4XA 4YIWA 1FWGC 2BLEA 1X7IA 3ES8A 3UESA 4PRWA 1ZY9A 2VMFA 1VBUA 3THAA 3R6IA 3FCPA 2XIQA 2YSWA 1XKYA 4O1AA 2V2CA 4JNZA 3OIHA 4QROA 5CGMA 3SGGA 1ITUA 3P84A 2RUSA 1Q63A 1IIGA 3R0DA 1UUMA 3GO2A 1FX6A 2HS6A 2YDSA 3BGGA 4WY0A 4C6PA 5I79A 5AHIA 3M5XA 2E8ZA 2D2JA 1IEWA 2PWGA 3A3HA 5IDZA 1JI2A 1J0IA 3RMEA 1CX9A 1FWDC 4G56A 3CZEA 1OSEA 1VBGA 5IXEA 2R24A 2FGBA 1VP5A 1L6YA 4DXXA 1TIWA 1TFVA 3R89A 1CXHA 1AUSL 4IXXA 3T6CA 1A4LA 1MZHA 2X2GA 2G96A 1JGMA 4UTWA 4NQ1A 3UY7A 1IT7A 1UZDA 4QQUA 4UFIA 3BG3A 3QV8A 1I8JA 4DNMA 2X1IA 1FCUA 3MYPA 1MXDA 1XLEA 4S3BA 1DBTA 3PFRA 2GL5A 2E4TA 2FDMA 5REQB 3GC2A 3VDCA 5D8WA 2VR5A 3PR2A 5HWMA 5HJLA 5PTDA 2Z2UA 1WKEA 4PODA 4AHQA 7ODCA 3U4FA 3OA5A 2ISSA 3DYOA 5F2MA 3OVGA 5FJOA 5G5IA 3UPWA 3Q37A 1RR2A 2VL4A 1XM3A 3VDAA 4RZ6A 3NQDA 4ENLA 5FA5A 4N4QA 4DWSC 4Q7BA 3KVMA 8XIAA 3CBWA 3GNOA 1HL8A 4LRSA 1XH1A 2OT1A 2QCEA 5I24A 4PTMA 4QCEA 4PMDA 3TTQA 3THQA 3ARQA 1GVIA 4HNOA 3UA3A 2RGMA 2OO6A 2QDEA 2V3FA 3N4EA 3VYLA 2JKPA 4GK8A 5D9PA 1VPQA 4E8CA 1DKWA 3CYVA 2QDDA 4KCUA 3HGSA 4GUFA 3H2CA 3RXZA 3ARSA 3TW6A 3KVLA 2JEQA 3NPVA 2TYSA 3CUXA 4AY1A 2YXOA 1ISWA 4MPQA 3RLHA 2DZAA 4MLRA 1OWQA 5HA7A 4GBDA 4B3LA 3KP0A 3WUGA 4F0MA 4E3VA 1EGMA 5C54A 1U1JA 1Q8AA 1GTHA 1J5TA 5GNYA 3LZ3A 3NQFA 4AEFA 5C2GA 2KAUC 5FSEC 4R7OA 3RK8A 5BU6A 5HQEA 3TAKA 5LIXX 3EXSA 4Q4SA 4JQ4A 4NAFB 3L68A 3N4AA 4K39A 3T7VA 4W89A 4WHBA 4M0XA 3O6DA 4MWAC 3DBNA 2D0HA 5D38A 4NSBA 1Q6CA 3LBCA 4AXKA 3VGFA 3WQDA 4URIA 4G1NA 3KWSA 2A85A 2VFEA 2DIEA 3LGGA 4PBEA 3G0UA 4K8GA 4Q8MA 2IPJA 2VEGA 1QR7A 2QDGA 3C3NA 3WQEA 3T55A 2VZVA 2WYSA 3NL3A 1HGYA 1EZWA 3N12A 4GI8A 1S5NA 5CEWA 3BCDA 4GACA 2JQXA 3W2KA 3MMTA 2GLKA 4L5ZA 3IJDA 2DZSA 2WM0A 1RCOB 5HQLA 3USZA 2FZDA 2WMHA 4JFVA 4UMAA 4WEVX 3CAKA 2VT0A 1AODA 2O7QA 4Y9MA 3VGEA 2TSYA 2ZX5A 5HMEA 3IUIA 4F3HA 4Z2HA 1MFVA 5I2UA 5FSDC 4IG2A 1NQKA 1X8FA 1ZP3A 5IOBA 5A6LA 2DW6A 3KLLA 3I65A 4QEEA 4AFYA 1VHCA 3MP4A 3VX1A 3GR7A 2GZXA 3LCGA 4R88A 1R47A 4EPBC 1B3ZA 3UR7A 5LHEA 4NNAA 3LPOA 5LA0A 2HWGA 3PTMA 2YYUA 5LNVA 1SR0A 3A4JA 5KSWA 4XKYB 3QF0A 3TMQA 3MDUA 4LBUA 1UG6A 3NCOA 3CB3A 3H4GA 4GC3A 1Q2RA 5I3FA 3CT7A 4ZOAA 3IACA 1BVZA 3H7RA 2L5HA 4S1FA 4XQ6A 2D2OA 1F61A 8RUCA 2IXUA 1JPHA 2Y0FA 3F2BA 4FOJA 4EP8C 2CHRA 3E0IA 4OVXA 4IGHA 2FYMA 5EMMA 1R7OA 3NQCA 3QH2A 4AG0A 4R33A 4DWSD 4DZAA 4C6MA 3L0KA 4IP4A 1R8LA 3RJYA 2Z4GA 4HYRA 3UVAA 2AOSA 1W5NA 1Y5VA 4Q8VA 2OLSA 2RDUA 1KM0A 5CG7A 4IH3A 4UMCA 3TQVA 4A29A 4Q6JA 2V5KA 1BRLA 1WA3A 4ZSTA 1V0LA 4TVCA 4OBTA 2C79A 1WX0A 1E1CB 2V5CA 5H1WA 3G8EA 1ZBKA 4A2SA 4JTAA 3PB0A 2C7FA 4G8TA 3D3FA 2QVNA 4JFUA 2X1UA 2YPIA 1JZ2A 2V0TA 4GRSA 2YIHA 1S39A 4MF4A 2XVGA 3P80A 1GWJA 4HPGA 2WW5A 3PZ9A 2CBIA 3TC6A 1OK6A 1THFD 4ORMA 4DXKA 3EOEA 3AZRA 2QV5A 4AHOA 4HNTA 1P4CA 1XLJA 4OHQA 4C6FA 3E2VA 1TJPA 1VJZA 4KW2A 3BAWA 4JD4A 3C2VA 3BQ5A 1ZBCA 3T07A 1QI0A 1GOMA 3B8SA 3DN5A 1E40A 1V7YA 3TE9A 2NT0A 2W61A 4AZCA 3GR8A 3TC3A 1ME9A 1GKPA 3P0WA 4I8YA 5FAJA 1HG3A 4MWAD 4S2CA 3M43A 2HMCA 1ZCCA 1H5VA 3XINA 1LQ2A 4G7EB 1KBBA 3K13A 1Z48A 4GXWA 2H90A 4IL2A 2HVOA 4JGDA 5T91A 4H8HA 1HGWA 3HQNA 1OX4A 2O7SA 3BL3A 1A5SA 4DLMA 2D24A 1P7TB 3HQPA 5CJ5A 3WBXA 4PUMA 5T9BG 2YXXA 4MUPA 3RX3A 1XPYA 1JCLA 3LPGA 2PRLA 1OGBA 2VC5A 2R1LA 5IFPA 3F2CA 2IS7A 3REQB 1AFSA 3P61A 1J12A 1WAUA 4IJCA 1BGAA 1FCBA 4PR4A 2J78A 2F7FA 2PF0A 3OZOA 1P0DA 1LG1A 5K9DA 4NU7A 3GH7A 4AYSA 3POHA 3W2MA 2QCCA 2XVLA 1HP4A 5AZ0A 4PRTA 4PEEA 3QGAC 4OV9A 2G4FA 1V4YA 3PZMA 3TR2A 3GDBA 3HJZA 1LRQA 2XGBA 1KGUA 5D2WA 3W1PA 5DELA 2GVLA 3L5LA 5ECUA 4H9YA 2YL5A 3VA8A 1JPIA 3II1A 1LWJA 5FJJA 1XIHA 3OJGA 2Z2AA 3DG7A 4V27A 3UG8A 1CI1A 1QBBA 3SURA 3UA4A 3P81A 3PSVA 4QG9A 1WE5A 1M9HA 1EDQA 3ID7A 4B3KA 2BDQA 4Y9AA 3P5YA 2HQAA 3P6LA 1OVDA 3SADA 1TE1A 3OBAA 2A6LA 2WMKA 4IT1A 2VEPA 3GZ3A 2IKGA 3E9AA 3TYZA 3RM4A 4GBUA 2OOGA 3WMLA 4S3DA 4XZBA 1RCQA 1SO4A 1M68A 3DUGA 2XVPA 4GKLA 5GJNA 3STGA 4HTYA 3GTFA 3BJFA 3W7KA 5C5YA 3IIZA 3V1HA 2H9AB 3GWQA 3QHOA 3PBVA 4HSHA 4XVDA 4AD0A 2VEMA 5BOFA 3F03K 3WJZA 4DEFA 4ACZA 1VEMA 4ASTA 2ANUA 2G3JA 4NJGA 4DWSA 4IFKB 4WKAA 1AQHA 1XIJA 4AIOA 4HGXA 1A4MA 1DHKA 3UJEA 1US3A 3B40A 3QYQA 3BH4A 3CO4A 3A64A 4H8UA 2ZA2A 4FX6M 1ADDA 5ABTA 4HCLA 1W5PA 3D47A 1MQPA 3QR1A 1KR1A 3AU2A 1UKOA 2J9YA 2NV9A 4OFCA 1NFPA 3POCA 4YU1A 4AF0A 4ML9A 4DM2A 4X61A 2QIWA 3QSRA 4PTDA 5BRPA 3VIFA 3SY8A 1UR0A 3RAOA 5HMDA 1XRSA 2ZRWA 4HN8A 3WFZA 4KRTA 4LFYA 1XYCA 2D73A 1V3KA 4BWLC 2NLIA 1HF6A 5CQ1A 1MEWA 4CD5A 3MWCA 4BS0A 2J25A 1XWYA 5MF5A 1AD4A 2D22A 3EPMA 2HS8A 3L21A 5C6MA 1KO0A 3WLRA 3FXGA 4JIIX 1A50A 3BLEA 3UGVA 4Q4RA 5I09A 2V2DA 4BA0A 2ZYFA 4FX8A 3VK5A 3IVUA 1NVMA 4DBDA 4PTVA 1E6NA 3UFYA 4XAYA 4UCGA 4WRHA 3CMJA 1XIMA 4CCZA 4MWAA 2CPUA 3W4RA 1DJIA 2YL9A 1YEYA 1I75A 3A3XA 4P2VA 4MOZA 5C9ZA 2GVYA 4ATLA 5FI8A 3C56A 2FZBA 2DY3A 3H23A 2V38A 3H26A 3LENA 5CGTA 4QBXA 2V9DA 3LLFA 4DPQA 2J7EA 2PDJA 1J8VA 3TOYA 1JULA 4PMXA 4FB7A 3L9CA 4F40A 3HGOA 3VZXA 2F61A 4HK7A 3W7LA 2XJ7A 2X16A 3DHUA 4HT3A 4HPHA 1SZNA 3MTWA 2GDQA 5DMNA 4GQGA 1EA9C 4GC4A 5HOSA 4PMRA 1OG0A 3HMJG 2OU4A 3N19B 3EYPA 1VPXA 1VC4A 1GK8A 3AIRA 3AUJA 4O4VA 5D02A 1OZMA 4S3EA 1ALDA 3BGJA 1ELSA 2WNNA 2YLAA 3QMTA 4A4AA 4LC8A 1UD2A 3BWWA 3AFBA 1WOBA 2E7FA 4WF7A 4H19A 3EA2A 3SCVA 4WUIA 1K3UA 5I7GA 1DV7A 3DHFA 4EWJA 2PLJA 4BKNA 1CXLA 2W6RA 2VR2A 1LOSA 1JCJA 3VIIA 3B0UX 4JCMA 4HP5A 1JDFA 3GFXA 3A24A 3V0TA 3W22A 1QHPA 1FOBA 3FDGA 1W31A 1SO3A 1XBYA 3TCSA 3DI0A 3LI0A 1LQ0A 7TAAA 1OC6A 3HFTA 5HBFA 4AWSA 1TUFA 1E1EA 3WJSA 2I57A 1O94A 4GQ0A 3H2EA 4LV9A 3ORWA 1M5WA 4J5NA 3R94A 2POZA 1IXOA 4JL1A 2V67A 1E4LA 4JKLA 4S3JA 1YLVA 2V5DA 3TK7A 4REQA 1NF7A 3LD5A 1GOKA 1AQMA 2VDHA 1ZPTA 5I3DA 3VDBA 2AQVA 3WK0A 4A2RA 2CLEA 5A6BD 4W8AA 3BG9A 3NDZA 2AQWA 3BTNA 1FWJC 3E0FA 1K02A 2RDXA 4RE4A 3WBAA 5EFDA 3RCYA 4EAYA 4DAFA 3ZR6A 4GE8A 5CSSA 5JIWA 3W24A 2EG8A 2YDQA 3UJRA 2HDJA 3AXMA 1GOQA 3TLLA 3BAKA 3ZLGA 1WCGA 4M19A 2Z27A 1B3XA 3ABQA 1JNDA 2J77A 3KOXA 4DJDC 2UY2A 1YNYA 5LGXA 2G95A 3E0VA 2Y8KA 2CWNA 4L6HA 2GQ3A 4ZQMA 4P5UA 4K6AA 1EL3A 1M7JA 2E8YA 5DY2A 4MZYA 1M6JA 2WLZA 5D9OA 3R13A 1QWGA 2GJXB 1Q6RA 1Y5WA 3TZFA 1YMYA 1XIFA 2YZ5A 1A5BA 5IDIA 5DMLA 3IUHA 3T0CA 5C9RA 3IS4A 3M0IA 2DVTA 4KFOA 4OUEA 1L9WA 4F2BA 2Y8VA 1N2VA 1O4UA 4LVAA 1S3HA 1IEIA 1VYPX 4IHCA 2XDFA 3MUIA 1KFLA 3GU2A 3TJLA 3BLPX 3HQOA 4IJBA 2O4QA 3B8DA 4HHLA 5EKYA 5G4EA 2GJRA 1VFUA 4F2UA 1SW0A 4C1NB 3PSWA 3PUDA 3MV01 3UF9A 4PA8A 2DV0A 5FACA 3TYCA 3UWWA 3BMVA 3CPRA 4UZUA 4D8LA 1WXZA 1J96A 1RJQA 2YX0A 5C9WA 4U10A 2XIIA 1S2VA 3HMCA 3E2RA 1D3HA 4LC6A 5A8NA 1XYZA 1QHOA 2FMOA 3RRAA 3C61A 1QI3A 5CZJA 3PZNA 1K7XA 1XIIA 1LORA 1EEPA 2QHAA 5DN1A 3UWZA 2ATSA 3S6TA 1K77A 4Q4MA 1UWSA 4MGGA 3VNMA 4GY7A 1IV8A 3CMFA 4CQCA 3LYEA 2VELA 3NR0A 2A3EA 1VRDA 2F84A 3K5XA 3OTRA 1TPC1 3KWXA 1VHNA 4JN7A 4V33A 1HL2A 4QG8A 2EBNA 2QCDA 1DWFM 4L80A 1XYAA 5E6YA 3B0YA 3AJ7A 1CXKA 2Y62A 1VS1A 1BF6A 4ROQA 1C8VA 1YXYA 4P7QA 1VBHA 3M6YA 3NAVA 3VNKA 4QFUA 5FF0A 2VGFA 2VD9A 4JN8A 4GIEA 1KRBC 3WLLA 3A5FA 1QASA 4PUJA 4GYPC 2RHGA 5CZTA 4KWOA 1E43A 3LTPA 2DH3A 3VFCA 4D8AA 2E9LA 1LLOA 4K7YA 1BXBA 1V0NA 2WMGA 4AZIA 4F0HA 1H1NA 1UROA 3QLDA 4HTBA 2G3MA 3FSTA 2CLFA 4KEZA 3BW4A 2PDBA 4EXAA 3H54A 3SAZA 4LW7A 1C8XA 2PDFA 1EJVC 2WQPA 2A3AA 3W28A 2UY5A 3L4UA 3R4IA 3N2OA 4RV8A 1B3WA 5HK4A 3EEZA 1CEOA 4NG3A 1K03A 2SFPA 5DFAA 2OSXA 3TVAA 1HKVA 4YS1A 1LL4A 4KEUA 1PTDA 3HTWA 3FV9A 5A6BA 4LUSB 1F5ZA 2I14A 4HNLA 1UUOA 3C2YA 1UR3M 3ANVA 5BXSA 3B06A 1V3JA 2E9BA 1ADOA 1ICSA 4AZ5A 2J8FA 4H8VA 2YA1A 1JDDA 2VR4A 1JGIA 5HR6A 1QPKA 1S5VA 5DEZA 1EP2A 1G7UA 1OCJA 1OFEA 1OZQA 3VKCA 1V3LA 1CGWA 4JTRA 1NELA 1W1IE 3K4AA 4ALDA 1Q2SA 3I4EA 4O0KA 2PLCA 1D8CA 2NVCA 1XYMA 4AHPA 5TIMA 4BWLA 3GNPA 3WY1A 2KX9A 3L23A 4I7VA 2G50A 4ACYA 2W3ZA 4KQNA 2QAPA 2RH9A 1QXLA 4PCSA 1K6AA 1ONXA 3NZRA 4O11A 1KRAC 2QUMA 4PMJA 3AYRA 1HJQA 2QAFA 3PNZA 3NQAA 3S3GA 1E6XM 4MYXA 3SRHA 2QXWA 4L1XA 3MU7A 2QPXA 4OU1A 4D1JA 3G0SA 3WBWA 3IIOA 3M47A 2YBVA 3TJ4A 3EWXA 3T0AA 1Y0EA 2IQTA 3TX9A 4C91A 3JR2A 2CESA 3HPFA 5KZDA 3BUVA 3CO8A 4FIRA 1AH4A 3ISIX 5LA1A 3GHUA 1XICA 3KVJA 4OUIA 4GABA 4TVUA 2Q8XA 3W7JA 3OZYA 1QRQA 3UNTA 1H41A 2V3EA 3IWPA 3CWOX 4Z08A 3VNZA 2W79A 3W7GA 3E0LA 3W53A 3W6LA 1PV8A 3W9ZA 1X38A 1VCGA 4EF8A 3VPLA 3GYEA 1UMLA 1B3OA 2WCGA 3W1NA 5EMJA 3CC1A 1JF5A 1IXNA 1I45A 4IPLA 1J4EA 2XINA 4WDXA 2C1HA 3EWBX 1Q45A 6ALDA 3E5BA 1UD8A 5AOUA 4B92A 3FEMA 3W1MA 5HQMA 4IXHA 3CT2A 4AWUA 3EMQA 3BOXA 4EKJA 1RPKA 4ZFMA 3W37A 3W1QA 1KM1A 2IMRA 3WUBA 2J24A 3ARZA 1YKWA 2X7WA 3JUGA 1TMLA 3WEOA 4HD5A 3RDKA 2FGZA 1HP5A 1TPUA 4RR4A 3B0PA 2Z1XA 3HBLA 4Q7IA 5F4XA 4LH8A 1V6XA 1FWHC 3W85A 4GI6A 3P60A 1EZ2A 2J7CA 1KTBA 2A3HA 3M1ZA 4RLIA 2WMJA 2PD5A 2G3NA 3ZLFA 3MMUA 4IICA 2VGBA 4Y96A 1OC5A 3KXQA 5H91A 3TWAA 2LLEA 5BWAA 4L64A 4HU8A 4G1KA 2CERA 3KHJA 3MSGA 2XN0A 2G41A 4JY8A 2QS8A 1XLHA 1F6YA 1FWCC 4M1BA 4NJIA 2WSKA 3QKZA 3AUOA 1NP0A 2PZ0A 2INEA 3WLTA 3TIMA 3V16A 2EPMX 4X2RA 3SFWA 4A8LA 1VB9A 4EX4A 2RFGA 2Q01A 3SUSA 1UB3A 4B3ZA 5AYYA 4W8BA 4CD7A 2OPJA 3KBWA 2V8ZA 5A2BA 2DT2A 1CGUA 1V03A 1Y7VA 1P1XA 2A3CA 5CPSA 1US0A 3H12A 3LRLA 4WGHA 4E3TA 3BJTA 3ITCA 1BKHA 3I6TA 1SYTA 1V0KA 3EWCA 1OT1A 2TAAA 3GTHA 3SQSA 1FHDA 3O6CA 2BWGA 4N9CA 1W1YA 1W1B1 1V6VA 1U30A 3GTNA 3W86A 3MHGA 4LB3A 4PRRA 3TXZA 2PDUA 3AISA 3WLKX 2OKTA 4J7RA 3AXXA 4D72A 4Q7NA 3W27A 3WJYA 2OX4A 1GOOA 5D8ZA 1MDLA 1LM1A 2O9TA 3BAXA 1GQNA 3MQTA 3STCA 3BW2A 4M6QA 2Y24A 2BB0A 3HFYA 1H1ZA 3FHAA 3K4WA 1JDCA 5DF0A 3HPAA 3MY9A 1RA0A 4XTDA 1YIXA 2OX1A 3TJXA 4XZHA 3OOQA 2DH2A 3GH4A 4CVWA 3LM7A 1ADSA 5C71A 1N8IA 2HTMA 1W9DM 1UP0A 2AMGA 1K70A 2UY4A 4JX6A 3MHFA 4M80A 1TV5A 3VOHA 3S2JA 4LY4A 4LRTA 5G1TA 3FGCB 1CCWB 1R2RA 3WELA 1W37A 4DBEA 3C2RA 2E77A 3L5AA 5EMYA 3CHCA 1TTIA 3HJEA 1AL7A 3WLSA 2QMJA 3U5YA 1W17A 4L1WA 4RDZA 4LBRA 3MI2A 2D3NA 4J2PA 1UZ4A 1CGTA 1GVOA 5KINA 1XIBA 2VFGA 1NF0A 3LLXA 1AMYA 1J01A 3CU2A 1VENA 4JBRA 3CB8A 4QLLA 3G0XA 2EAWA 3I7RA 1H7OA 1EIBA 1QCWA 2XVNA 2QMKA 1E73M 1RBAA 3S42A 5C7VA 3DESA 4HMNA 3STPA 2Z7KA 3WF3A 3T8LA 4CQBA 1BLIA 5A8MA 1OFAA 1TTJA 1QU4A 1XXXA 2WSPA 1ZBWA 1TELA 4C6KA 3LX9A 4AVNA 2OWWA 2DFAA 4NX5A 5GJPA 2OYLA 1IEQA 4UMBA 4AMAA 1RP8A 1WDSA 2NXHA 5A6SA 3N25A 2VNCA 3PK7A 5ABFB 2CW6A 2YCJA 3JZUA 3VU2A 1NOWA 4DBUA 3GB6A 3W2UA 3PTQA 4JIEA 3OGVA 3PZQA 3PS7A 2RDTA 3O06A 3PAJA 2FHFA 1UD3A 1SJDA 2C8NA 4GIYA 1K9FA 2VHLA 4KWWA 1AZ1A 3FYYA 3EKLA 3LU2A 3GUWA 4GGBA 4Z1CA 3GRIA 5FAGA 4FNRA 3JVAA 4JFSA 4NT0A 5EYWA 3DC8A 3B9EA 3CUZA 1TJ0A 4GKTA 2VX6A 5HAOA 3LV6A 2ALRA 2BG5A 1ONRA 2ZWZA 1M3UA 3MVIA 1Z9AA 2DP3A 3TJIA 1BWLA 2AL1A 5ENLA 3UR2A 3ZIZA 1FWRA 4IQDA 1GW9A 5M3WA 5D03A 4BQ3A 3HQ1A 3L65A 4HIBA 3AMDA 4S3KA 3AC0A 5DY3A 1EC8A 3WNNA 2Q3OA 4S23A 4O8AA 2QW5A 1MEHA 4LALA 3WQWA 1QATA 1OCQA 3FOKA 3WNPA 3O7UA 5C9XA 1TZZA 3BV7A 3LI1A 3BVJA 1IT8A 2HK0A 2P53A 1YDVA 3KTCA 5FJRA 3LHUA 3I4KA 4MJZA 3GXTA 3TU9A 1G01A 1VJSA 1MFUA 4JQ1A 1DOSA 1GT8A 3OLEA 4O1DA 1EJXC 3MKCA 2BXVA 3K1GA 4JTHA 2CC0A 1XLLA 1IXPA 4WIWA 2QPSA 4W5ZA 3N18A 3ARYA 4ADUA 4NP7A 1SSDA 5DBTA 3H6OA 3TP4A 4PZVA 4M6UA 3PC0A 3EX4A 3RHGA 3LRMA 3G18A 4JYEA 2PWEA 2BVDA 3HU7A 1KTCA 1Y65A 4UFJA 1R6WA 4FA3A 4XD4A 4MADA 1SVDA 2NLYA 2NW0A 4US5A 4U4MA 4F0RA 4J4KA 4JTIA 3G5EA 3KDNA 4B5NA 2RAGA 2A21A 2XSBA 4PC8A 1QOXA 2OQYA 1KCXA 3UR8A 3E5PA 2A3LA 5LXXA 4Z0SA 4XSLA 1DYSA 3M16A 2DZBA 2Q71A 4XG1A 1HTIA 1ME8A 4ZO6A 4L9XA 1W3IA 2YA0A 4WVXA 2I9EA 1TTPA 1QJWA 2EHHA 4MSSA 1N7KA 2NQZA 2PS2A 4UUIA 2J7DA 4A3RA 1SFLA 4QDMA 3B8UA 4CNPA 3E02A 5I23A 2FFCA 4PE8A 4RCXA 4D9PA 1SMAA 4H9TA 1Z44A 1W54A 1P0BA 5A5WA 3UXLA 2WJFA 2GJLA 3EWWA 3GUGA 5D2VA 5FCZA 4A8NA 2XU2A 5AFDA 1LBMA 3AICA 3D3AA 4NZCA 4L7ZA 4EF9A 4P8VA 1P0NA 2V6AA 1WP6A 1AVAA 3QMSA 4A6GA 3CL8A 4HMDA 3W73A 2D0GA 4UFHA 3GH5A 3P8IA 2DT0A 1VYSX 2P8CA 2VTFA 2WNWA 1PVNA 3GW3A 3S9YA 4NYYA 4XWUA 7REQB 1EOKA 1Q65A 4IOTA 1DJWA 5L9FA 5RUBA 1W5OA 5B80A 3PJWA 5B7YA 1XSJA 4NUWA 3DAQA 2WJZA 3W38A 1I2RA 3EEGA 1H1YA 1DWIM 3AS3A 1CXFA 1FKXA 3HN3A 4GYJA 3U7VA 5AC7A 1Z42A 2PB1A 1K8YA 2VQTA 4H6EA 2WWCA 3IPWA 4QHRA 4NZFA 1ZFJA 2ZVIA 3WLIA 1KV8A 2OG9A 3ITVA 1W1PA 3VE7A 3UBPC 5IM51 2DSUA 4Z1YA 4ZE4A 1TWDA 3GFYA 3CYJA 3GDKA 3ICJA 3ARRA 3SQLA 3RCNA 4P7NA 5C7HA 1T0OA 4GX9A 1KKRA 4CU8A 1WKYA 3VOCA 4RW3A 1JQXA 2J47A 3S1VA 2J9XA 4UFLA 1L6WA 4U3CA 3P14A 2QEZA 1CPUA 3L4WA 3ZOAA 3ZSSA 1FCVA 1KGWA 3S8HA 3WLHA 2JE8A 1HJUA 3OIXA 3TN5A 2DUZA 4H7CA 5A6TC 1F3EA 5HPCA 3UGRA 1BGGA 1J9YA 2FPYA 3LHVA 4IX0A 3PUGA 1EX1A 2XYLA 5BMXA 4MB5A 3MMDA 3LCXA 3G22A 5CC3A 1YQ2A 4DX3A 2I5GA 2DZTA 4NZ4A 1YHTA 3IARA 2ZUVA 3I7SA 4E0CA 3M5VA 2REQB 4HNNA 3EX3A 5TNVA 5A3HA 4Y6GA 2VEKA 3T78A 1F9CA 4AD5A 4YYCA 5BRBA 2FIQA 1UJPA 3IV3A 3R0KA 4RE2A 4DYJA 3GIYA 3N13A 1JCNA 1HO4A 4C6EA 1S1RA 1W9XA 1ZJAA 4MY1A 2VOMA 1UOZA 3W7NA 4PL2A 4DI9A 1WKFA 2O4MA 2XSXA 4E4UA 4PB5A 1R85A 1ZL1A 3P82A 1SFJA 1US2A 3VGGA 3MT1A 4DPPA 4MY9A 4RDVA 1W9BM 3SW6A 2AGKA 2BODX 1WAWA 2GSJA 1KA9F 1HKMA 3C0QA 2O9OA 5FF7A 2NT1A 2OQLA 4I9AA 2WHKA 2OR2A 4QM1A 4WKFA 4OWGA 5F4WA 4H9XA 2FVKA 5JMUA 1YPXA 1A5UA 5HXMA 3VKJA 3A4AA 5FEWA 4HZMA 1A3WA 4M82A 3MDWA 2PBGA 1XJBA 3JW7A 1SJBA 2W67A 4FXJA 1KBIA 1YTKA 4PL1A 2GWGA 1FWWA 3HA1A 4W85A 1B54A 3FSUA 1LT7A 1EH9A 4EXQA 3RIKA 1E9YB 2DSKA 5AHNA 3TQKA 4R7WA 4TOQA 1HFBA 3W83A 4ERGA 4ZOCA 4C6DA 4JXCA 5BOOA 4CEUC 5J5RA 3OG2A 1J10A 2BVWA 1W1ZA 3BSGA 2WQDA 2PEVA 2EEXA 4NX0A 1EJRC 4N9BA 5ECVA 1LWIA 4J3UA 1UWTA 3F2DA 1UA3A 3C2OA 3GNNA 4L56A 4NF7A 3S5SA 1V02E 4HPJA 4G2DA 3N15A 3QOMA 4KPLA 4XB3A 7TIMA 3EPNA 2PBOA 4Q8WA 4J27A 5F1VA 3ZWTA 2WWDA 1R87A 3QZAA 4UXDA 3LM3A 1LLWA 2XH4A 4IQEA 2C16A 2HSAA 4LCRA 3S5NA 3GHRA 3GXFA 5G4HC 3TYUA 1JR1A 3UEQA 4YTUA 2QCMA 4C6BA 3QQ0A 2ZTKA 2W92A 1UYQA 1XBVA 7ENLA 1F3XA 4Q4QA 4XVEA 3TYAA 5EU9A 1FQ0A 4NRRA 2R14A 1G0CA 3N6QA 5FEXA 4ECLA 3G3DA 4PTWA 2I1OA 3EOOA 4CLMA 1TUXA 1E4NA 5FJPA 1EWDA 1OFOA 4ZXLA 4WXYA 1RBOB 1VD6A 1TV7A 1XC4A 4MFDA 3O9NA 4IIEA 4HHHA 1TPWA 2VRQA 3B9OA 4K3ZA 1TWZA 4WJXA 1FWIC 3ZT7A 4DO4A 4M1RA 4C1LA 1O60A 1AW1A 5KZMA 2ZX9A 1LDCA 1XLFA 3GXIA 2TRSA 1TPFA 1KLYA 2HE8A 2W27A 2HCVA 2PRMA 4O14A 4AIBA 1ITCA 2GVEA 3S1XA 4ERAA 4LAOA 2FH8A 3SDOA 2OQHA 4P8XA 3MI3A 1HXJA 4JYFA 1KCZA 1K9EA 1U1UA 4DUVA 1UA7A 2HBXA 3G1HA 4S3CA 1QW8A 5AYXA 2W63A 3NQ7A 3NVDA 4XUGA 1UD6A 1GG0A 1NP2A 1HJSA 5FJIA 1A80A 3TNBA 4FLQA 3VIMA 3IGHX 1DHPA 1J11A 2OGYA 4HNUA 2CU0A 3DFSA 3RGTA 1CIUA 3MKVA 1H49A 1EXPA 1FH9A 3AIEA 5K9XA 3O63A 4IUOA 2D69A 4MNKA 3RLUA 3A3WA 4PUUA 1IZKA 1JZ3A 3AWOA 4ZE5A 2FTYA 2R91A 4KH2A 1YBQA 2IW0A 1PKLA 5MKGB 2HV5A 5FL0A 1A5NC 1NY1A 2VURA 2FHCA 4NZ1A 2Y1HA 1QMLA 1UKSA 2RKXA 3RLGA 3GD6A 3MCOA 3PBYA 4Z1AA 1Q13A 1KRMA 4JYDA 4PMNA 4JEQA 3W2JA 3WLQA 4Q8NA 3TA9A 4XO6A 4NJKA 1LUCB 3NM1A 4DJEC 3G8RA 3EBVA 1KCKA 3NL5A 5JBDA 3W71A 4PSRA 3SRFA 5F1UA 2OSYA 3Q58A 1FHVA 1JUEA 2GSEA 3WLOA 4AIEA 3UT0A 3BSMA 1PCKA 5EFFA 2NUWA 4YHEA 1N82A 3M7SA 2E6AA 1UR8A 3LXCA 4TQTA 3H24A 1Q7ZA 3WO8A 5A2CA 1FWBC 1SJAA 3T0DA 2VUYA 4I5UA 4W7VA 1EHAA 3M4HA 3TOPA 1O5RA 5LKYA 2IPFA 2OEKA 1DJNA 4L4PA 1F07A 1BHGA 3L66A 3V5FA 3KBVA 3QJAA 2Y70A 2ZUUA 3EAUA 1VH7A 1J18A 1S5TA 4G7FA 2ISFA 1Q6OA 4XZLX 1ML1A 2VI0A 5CZ0A 1A0DA 4GY1A 4GLEA 3GTIA 1TR1A 4B5WA 3GFZA 4UR7A 1SZRA 3S2NA 4M6PA 4TMBA 3NURA 2HROA 3AZSA 3ZVHA 1C92A 3KL3A 1LRNA 2ZICA 2PPGA 1PHWA 4HNVA 1TE6A 1AQ0A 2GDVA 4GFIA 5HATA 3WJWA 5CPLA 1SSGA 2EGZA 3AMLA 1F2JA 2GWNA 5G2WA 1JCMP 4IMGA 5A6AA 3W7QA 4KIEA 1UW9A 4C6QA 3BMXA 1IWPA 2C15A 4W4QA 4GUGA 4HNCA 3KEHA 3VABA 2QDHA 1VFOA 4KF1A 4ZGYA 1QTWA 2E1WA 1QHZA 3CIVA 3EB2A 3GLCA 3NJ3A 1UWQA 3G6LA 4WX2A 1PWMA 3NQ6A 2QUUA 2C91A 3AHZA 3EB3A 1E4IA 4FXSA 1M04A 2O9PA 4Q8UA 2Y89A 4O4WA 3U4AA 5H6HA 1ME7A 2B81A 2A1YA 2XFRA 1O5KA 2ABBA 3ES7A 1HKKA 4IUGA 1DJGA 3F4CA 1KTNA 3UU0A 2JF6A 4LXFA 3QV7A 2WMIA 4QNEA 5A8PA 1OYBA 5FF2A 4DQWA 1MUWA 1OG6A 4P7RA 1SU5A 2NQ9A 3UJFA 3WF4A 3N9RA 2ZVRA 4LVDA 2FGLA 3KUMA 4ROPA 4F0LA 3WQ4A 2A5HA 2GGGA 3VUPA 2Z29A 4IL0A 3C5QA 4H2HA 1TCDA 3E96A 3KOFA 3NWRA 4OQVA 1P48A 1UH4A 1AZ2A 3OQEA 4NXSA 4QCFA 4GCXA 4UBPC 2P3ZA 3CUGA 2GYIA 4FPSA 3LOTA 4O12A 4ILSA 4AD2A 1XR2A 4YCPA 2YYTA 3EDDA 3LG3A 4QITA 3HG4A 4XKMA 2ZWYA 5HULA 1B57A 1ONEA 4IIFA 5JXQA 1KM6A 4AEEA 2G3FA 3S9IA 1E72M 3IJLA 2VEIA 1YDOA 3P0XA 3TQPA 4RZ4A 1TO3A 4Z17A 4R53A 3NZGA 3VE9A 4E38A 4JDBA 1XLAA 4ZFCA 3UJSA 2VC6A 4TX9A 1P6CA 4WY0B 4GUJA 3CWHA 3GU1A 4BF9A 1KKOA 1X8CA 2AKZA 4QX4A 3L2MA 4WR3A 4JTSA 2C6QA 4A22A 3NZPA 1MEIA 5HR7A 1H61A 1V79A 4RL3A 4NNCA 3TYDA 3CHVA 3FY1A 4FHAA 3F4WA 1D2KA 4AYGA 4IM4A 2X1RA 2C0HA 3R25A 3QY7A 4A3QA 4LAMA 1S2AA 4A21A 1G69A 3T2PA 1BEUA 4JX4A 3PAOA 4W93A 2XSAA 1MW3A 1UR2A 5LNRA 1UIPA 2D0FA 3SJ3A 1I6NA 4LBSA 4UB9A 3A5VA 1HKIA 3RM9A 1NWUA 2WZEA 4O10A 4AW7A 2Q09A 3P7YA 1QFEA 4FP1A 2V82A 3QEZA 3BARA 1F05A 4E8DA 3WK1A 1EO5A 5CXPA 2TODA 3PY2A 1FUYA 4GIRA 4EVZA 1EUAA 4AMCA 3VI2A 5D2TA 4B9ZA 1XLMA 3VKBA 4JTGA 2QUNA 4BK9A 5I78A 1UCWA 3FKRA 5FD0A 1B31A 3DFHA 4KIRA 4Q33A 2YCLA 3AYVA 4LUTA 1UKQA 3MSYA 4DELA 2GOKA 2POTA 3W7OA 1U1HA 4IQLA 2H6RA 3W6MA 2NX3A 3GX9A 1JUBA 2DPEA 3K30A 4MVAA 5J5DA 3NDYA 1UUQA 3P8JA 4QAWA 4I3GA 3NUKA 1VFFA 1Q6GA 3W3OA 3EXTA 2W9MA 2P0IA 4TXEA 1HNYA 1KB3A 4H8NA 3MZNA 2GK1A 3B8WA 4YXGA 2HBVA 4XZMX 2WPBA 3R2GA 2VJXA 2RJHA 3GU9A 3EOLA 2Z7GA 5CPNA 4GZ7A 1JPKA 3GNXA 5CAHA 3KCLA 4ZBCA 1Q6LA 2G4JA 4Y9NA 5BXTA 1K8CA 1XYLA 1UWAA 3URAA 3UERA 3GS6A 4AY8A 1XFCA 4ZTYA 1I9CB 1V02A 3V3WA 2VX4A 4LEQA 4Y90A 4L65A 1W32A 1MW1A 4KEMA 4XX6A 3N29A 2XFWA 1W8GA 5MHBA 3WQ5A 3WH9A 4NIRA 3EX2A 4MAZA 3CNYA 3ABZA 3LGDA 4WGXA 1E3XA 3UZJA 4K1GA 1HJXA 4MM1A 5EMUA 3KL0A 5EPDA 5LHFA 2ACUA 2PDWA 4JIHA 1M7XA 4K36A 1C8QA 1PZ3A 5E1QA 3LZ5A 1KCLA 2DEPA 3LNMA 1IEXA 3LSBA 1B3YA 1F8MA 3NOEA 5E0KA 2BY1A 2G0WA 3VO0A 1LTDA 1JDAA 3LB0A 3LRKA 3NNTA 2GQAA 3LCIA 5LNUA 4DJFD 4JN6A 3KZSA 2FH6A 3R10A 4O50A 3S6DA 1AH0A 3WLNA 4L1GA 3V5CA 3VAVA 4IQJA 3BV4A 4LANA 3F1QA 3DGBA 3VVGA 1O5XA 1AJ0A 3MP3A 4DF0A 4IG2B 1FWSA 1E4MM 1SR9A 3ZS4A 2X09A 2FTWA 4A35A 1YNPA 4ZB0A 4O1CA 3SBFA 1GQLA 1PWLA 2WHMA 3Q4DA 3V75A 3OZPA 4EPDC 1UKPA 1XPGA 3UG4A 1NDZA 1JJKA 4K8HA 4LB4A 1S2UA 1WZAA 3KFTA 4JIRA 2GOUA 5JBEA 3CQ0A 4NASA 2JF7A 5LNWA 3S5OA 4KKXA 3CEPA 3IUDA 3CHDA 3FX4A 4Y8FA 3MV11 4MNLA 5A1AA 4UIOA 4PCNA 1C91A 3M0JA 5C55A 4LVFA 2X42A 4LS1A 4CN1A 1QWKA 1XBXA 1RK6A 3KHDA 1GVYA 1DPMA 1I0BA 2Z0IA 1XIGA 3VMPA 2QCHA 1QI2A 1TTQA 5T9CE 3HB9A 4MKSA 1XG3A 3IJ8A 3CS2A 5H8MA 3L67A 3JS3A 3KVKA 2A6NA 3HIJA 3C6CA 3DG3A 4NL1A 1FBAA 1GG1A 2ONEA 4CNUA 1GQIA 4Z1DA 5K4XA 2ISWA 2PTDA 4IGNA 4QJ3B 5GNZA 4CQAA 3ALFA 1GW1A 1E51A 1EB3A 1D8WA 3IANA 1E55A 1PTAA 1AA1B 1EC7A 1R9YA 3H2OA 1YE4A 2Y6ZA 3CQJA 3WEMA 1EYWA 1Q6FA 5HWNA 1CW2A 5EL1A 3R79A 3B8VA 3CHFA 3PF3A 4UTIA 4HSNA 1MVYA 4J3TA 2B0MA 3NO3A 1ITQA 3A23A 4MWAE 2CLHA 4H7ZA 2IPGA 1RZMA 4H41A 1F73A 2ZZ5A 3TV8A 4O54A 4IX2A 3WH8A 2ISDA 3SCUA 2XFYA 4LOCA 4D6FA 2HRWA 3VKKA 4XD3A 3RU6A 3WQCA 1X1NA 1ZZMA 3Q94A 4CNNA 1L6SA 3WLPA 4MY8A 4KRZA 3WUEA 1M1BA 4AZCB 3SCTA 2WVSA 4HA0A 4NAEA 1BAGA 2QCNA 1IZCA 2QF8A 4HZ6A 4A8IA 3DEQA 3BURA 3S2MA 1X6LA 2DIKA 5I3HA 3WKZA 3RX4A 2NVDA 3LS9A 2O92A 4HHPA 1ODZA 2VDGA 1EOMA 5D33A 1CGYA 2XISA 6XIMA 1OX4B 2ZZ1A 1MQQA 4JHMA 4PFMA 2J7GA 4JX5A 1OCBA 3VCNA 2BY3A 4RJEA 1NTHA 3KS6A 1DQXA 2ZXQA 1FWAC 2F2HA 1RQHA 1V3MA 1L6FA 1T99A 1A53A 2EPNA 3J7HA 3UWQA 4UR9A 4ICMA 3BAJA 3UETA 3G1SA 1DWGM 1E71M 3YPIA 1HN1A 3VGDA 3MJYA 3OEXA 1UC4A 1K8ZA 1U22A 3LV5A 5D30A 3H2FA 1ECEA 1KLZA 1XGDA 4H2CA 4IP5A 1DWAM 3FJ6A 4DJFA 1MNSA 3W72A 3MP5A 5XIAA 1EKOA 3WFLA 3HG5A 2Z1VA 3W70A 3SCQA 5M5DA 2DVXA 1DJQA 2JEPA 1CB7B 4HOZA 4QP0A 4V1YA 4HBKA 1GJWA 4MNJA 1RBLA 3THUA 2X7VA 1SQ7A 2PA6A 2J62A 3SFKA 2OOFA 5AC8A 2F9RA 4UTTA 3CM4A 4ZQRA 3TYBA 2DUAA 3PNUA 2BXZA 4GVIA 2RDWA 2X2YA 2PGEA 3EA1A 4GY0A 1HJVA 1LG2A 4MB1A 2OODA 3C2EA 4GINA 2VWSA 2ACQA 2XWDA 3FLUA 1O66A 3TN3A 4ZTXA 1C93A 4KWUA 5FEZA 1FWNA 2OB3A 3CZGA 3NQMA 4WSJA 4QE1A 3A6OA 1J0JA 4HU4A 1RK5A 1CXIA 4MLJA 2XM2A 1E15A 3SY1A 3E1F1 3Q67A 3EWYA 1LF1A 5FF4A 3TFCA 2GVJA 1GZGA 1DP0A 4ACZB 1TVLA 4X63A 1CGVA 3VDGA 3CUFA 4OECA 5I00A 3UZXA 1W3JA 2J7BA 3AALA 3ZZ1A 4D6EA 5CLWA 1W56A 5A8OA 2IQDA 3KBSA 2E5DA 1TA3A 4RXFA 3DBPA 3C8NA 4MZ1A 2YCKX 2PDLA 1WUFA 3BDKA 3EOUA 2YOCA 3T09A 3TAOA 4FSAA 3FJLA 2DSZA 2FZ8A 1HZYA 1JYXA 3SRKA 3CV7A 5CPMA 4GYKA 3PPHA 4AF0B 3ZVIA 3B4YA 3HG3A 2D20A 3T40A 3LQLA 4PCPA 3XIMA 4BI7A 3NA8A 4UQCA 3LPPA 4DUWA 2BGSA 1YDYA 1LL7A 3B03A 3AI0A 2Q3RA 3F4DA 6TIMA 3DKJA 1UJQA 5G1YA 2ZXBA 3OG3A 2PWUA 1VQTA 2E40A 4QRNA 1KM4A 4PTNA 5AYZA 4CD4A 4GA8A 1MRAA 1XFBA 4I9MA 5XINA 3FVMA 1VLIA 2IKHA 4H6QA 1M41A 3UNDA 2AGTA 4GD0A 3B05A 2D2HA 2CLPA 5L6UA 2C13A 1KR0A 3CLWA 3RPTA 3VILA 3AU6A 4JTUA 1Q8JA 4GI9A 4NHVA 4O0ZA 1GHSA 3L4ZA 2CHOA 3MMWA 4A3HA 1D9EA 2ZX6A 1TRIA 3LXAA 4MWAB 2CIPA 4O53A 1OGSA 1QO5A 3WEZA 4R7JA 3TLQA 4E2BA 4WQ6A 1SZGA 4AD3A 2ZA3A 3FA5A 2F6KA 2I5IA 4HVXA 4CNSA 1JZ8A 4LYRA 3A12A 4Z2JA 1KW1A 5F4SA 1H7PA 1E6SM 3VGHA 1R3TA 4J3VA 3WFAA 3PJUA 1RH9A 2ZRVA 1CWYA 1KM3A 4N9DA 2ZRYA 1V3HA 1RHCA 4RKAA 5JQ9A 5DXXA 2VD8A 1HVXA 7REQA 2VRKA 1GORA 4UTHA 3AIUA 1A47A 3PZOA 3TFXA 1VCFA 2F8QA 3CH9A 3RR1A 4TV6A 3HPXA 2R1MA 5JU6A 5EGRA 4YWIA 4QJ4B 2WANA 1NSJA 2B31A 3LBOA 4F9DA 3W29A 3M7WA 3O16A 2CLKA 4EPKA 2PODA 4AB4A 1V5XA 4FLSA 4M51A 3B97A 3WDPP 4LYQA 1YW1A 1ZALA 1TB3A 1XH2A 4XD5A 3ZJKA 4U2ZA 4N7QA 5DANA 3NVTA 1P6BA 4J2MA 2Y63A 4ZOEA 1F74A 2GVGA 3DDMA 3WD4A 1EPXA 1PJ9A 8A3HA 1LYXA 4B4FA 3OHIA 3WDJA 2H3BA 4E4FA 2NUYA 3IK2A 2PWVA 2A7NA 4DLFA 1HX0A 3OP2A 3M0ZA 4O1EA 4AD4A 1EBHA 4OJYA 3U2ZA 4OOZA 4O16A 1IZJA 3NGJA 2PLKA 4QNWA 2ZZ6A 3M41A 2EKGA 4CGTA 2PDPA 2ZUNA 1GONA 4AH7A 3LMYA 2DZUA 4ICNA 3WMBA 4DBSA 2DUXA 2J75A 3AS0A 4N02A 5JH1A 3CLMA 2FZMA 1DQWA 4UFMA 1TR9A 4REQB 4Y9OA 3TUUA 1CNVA 3RN6A 3GIQA 1E9ZB 1M7OA 3KOZA 3U6WA 1PAMA 1M7PA 1DQUA 1QK0A 3STEA