1XXXA

Crystal structure of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
296
structure length
296
Chain Sequence
GFDVAARLGTLLTAMVTPFSGDGSLDTATAARLANHLVDQGCDGLVVSGTTGESPTTTDGEKIELLRAVLEAVGDRARVIAGAGTYDTAHSIRLAKACAAEGAHGLLVVTPYYSKPPQRGLQAHFTAVADATELPMLLYDIPGRSAVPIEPDTIRALASHPNIVGVKDAKADLHSGAQIMADTGLAYYSGDDALNLPWLAMGATGFISVIAHLAAGQLRELLSAFGSGDIATARKINIAVAPLCNAMSRLGGVTLSKAGLRLQGIDVGDPRLPQVAATPEQIDALAADMRAASVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase
publication title Crystal structure and kinetic study of dihydrodipicolinate synthase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 114
structure length 296
sequence length 296
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2004-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1xxxA00
5DCEA 3H53A 2EKCA 4GFSA 1P5BA 2Z1BA 1Q6RA 5FF0A 2NLIA 3LRLA 3IIVA 3MWAA 4LC6A 3LCGA 3LHVA 2CLMA 3LHYA 1JR1A 4LS0A 3KFTA 1Z41A 3Q94A 1ZCOA 4IX2A 1TV7A 1N8FA 2J9ZA 2Y63A 2CW6A 3O15A 3LCWA 2YW3A 3ZS4A 3M5YA 5F1VA 3C2OA 1VHNA 3R5EA 3L0GA 3B4UA 4RCXA 1KM6A 3KAOA 1OK6A 3MW7A 5CZ0A 2A1YA 4NVTA 5IBXA 5HUOA 2GQ9A 3FJ6A 1JCJA 3QPYA 5DN1A 4FNSA 4O13A 2D73A 5EL1A 4DELA 1EEPA 3LHZA 1Z42A 3N73A 2J27A 5AHFA 5G2WA 3LXAA 1XM3A 4A22A 3EX2A 1H51A 3F03K 2FB2A 3O8AA 3NL6A 3E96A 3PG8A 2AAMA 3NQEA 4P61A 3W7JA 3EKLA 4AEOA 3C2FA 1SZFA 3N34A 1SZNA 4MVAA 3S1XA 2BTMA 2Y61A 1I2PA 2C6QA 4WUIA 3TQVA 1I2NA 3P61A 1AK5A 3IVUA 2FPVA 4R7JA 1X8FA 2DZVA 3F1QA 5AYXA 3EXSA 5BMXA 3HG3A 4MFEA 1GTHA 2BX7A 3OHIA 3NZ1A 4RV8A 3UYCA 3P5YA 1N55A 1KM3A 1X7FA 2ABBA 3BG5A 3NZRA 2H3DA 3MHFA 1FWNA 2G97A 1JJKA 4PL2A 1EWDA 4U28A 2VFGA 1MEHA 2NX9A 3STCA 3ZFHA 1CW2A 2WV8A 4WX2A 3RLUA 3GIYA 4FEZA 5FF3A 4ZZ9A 4ALDA 2DJXA 3TROA 1KFEA 1MZHA 1AW2A 4I7VA 2CWNA 3W22A 4MJZA 4WXYA 2X1RA 3G3DA 2C19A 3TC7A 4LRSA 1F5ZA 4M6VA 1OFRA 3MUXA 4UCGA 4EWND 4NZJA 5IBXC 5C2XA 1G67A 2ZYFA 5DCDA 1QOQA 1GWJA 1HTIA 1LCOA 1RPXA 3P5ZA 3AO0A 4OT7A 1GJPA 1FDZA 4Q32A 1K8XA 3EWUA 4RX0A 3T55A 4UTJA 1UUOA 1FDYA 2OJPA 4TMCA 5EKYA 3SGUA 3HPZA 4QISA 5G4WA 4IPJA 1JULA 1QPQA 5K2ZA 3L66A 4N02A 1XBXA 2O7QA 4RLIA 3DXIA 2CZDA 1XI3A 4OWGA 3M5VA 1TSIA 1W31A 2QEZA 4YCOA 2VEPA 5F2IA 3W73A 3TR2A 2DZPA 3DKLA 3ZR4A 1M7OA 5CZSA 4DBEA 2JBMA 1VYPX 2QF7A 3TUUA 3P60A 3G24A 3BG9A 3R13A 1HUVA 1FWRA 1WA3A 2YX0A 1W54A 3W2UA 4Z1AA 1Q45A 4NNCA 4O28A 2J88A 2ZTKA 1LBLA 4FXRA 2V82A 3SR7A 1UASA 3QC3A 2AGKA 4NX0A 5HWJA 4AHPA 2Y89A 4BR1A 4JY9A 3LLDA 3OA3A 4AHQA 2ABAA 3B05A 3KVLA 4N2YA 1FXPA 1H7NA 3MI3A 4BI6A 1GOXA 4ZQOA 1OF8A 3TMQA 4OQVA 1R47A 4X22A 3FLUA 1W5NA 1PVNA 4QAIA 1LZOA 1I45A 4QQ3A 2OCZA 2QCCA 5EPDA 1B57A 1SFLA 2Y70A 2RFGA 4O0ZA 4NJJA 5G2IA 4YMZA 2QJGA 3I68A 4UC5A 3QQ1A 2YSWA 3M47A 1LTDA 2WSYA 3TQ0A 4LT9A 1TPC1 2ZRXA 1M7PA 1LYXA 1LLZA 4YCPA 4FB7A 4LOCA 3CLMA 3IIXA 1WDWA 2QUTA 4GUFA 5LHFA 2G95A 3RNDA 3DHFA 4JTGA 1PHWA 1A50A 4RXFA 2YDAA 3HJZA 3BARA 3O16A 3W70A 5A8GA 3GDMA 3C2VA 1K8YA 3PULA 1L6YA 2ALDA 4LVAA 2A7PA 1GVRA 2LLEA 3PBUA 3MO7A 3HGOA 1GYNA 3NOEA 2Y7GA 4O0KA 4XBSA 1IXPA 1FCQA 4IMEA 4M7TA 4UMBA 3T44A 4N4PA 1B4EA 3I7QA 2J6XA 5LNUA 1ICPA 5DELA 3W72A 5D2VA 4I7WA 3DENA 2XFWA 4ZQMA 3TC6A 1AW1A 3NPVA 4UIOA 4O12A 3LCIA 1H50A 3GDLA 3G1HA 1ZY9A 5DY2A 1VRDA 3NG3A 3QRHA 3MI2A 3B0VC 4ORMA 1OX6A 4U4MA 3W71A 2Y62A 1L9WA 3VCRA 4AMAA 5AYZA 4H3DA 1OX4B 1GVSA 3SSJA 5F4XA 2GQ8A 4MFDA 5CKSA 4ZQCA 1QPNA 3HPSA 4K6AA 4OBTA 1K7FA 3OEXA 1EP3A 3TJLA 3N9SA 2A2IA 1KM2A 3S5YA 4KFPA 1F2JA 3CIXA 4JDYA 3W2NA 1QWGA 5SWUA 4CQAA 1U5JA 1MO0A 3TU9A 2TYSA 2E09A 1SZEA 1WOBA 1Q6OA 1LLWA 1H1YA 5D37A 2XN0A 1IGSA 2W0UA 2A5HA 3ZWTA 3PG9A 2DZTA 3MI6A 2Z2UA 3W2JA 1EIXA 3A23A 3M5XA 3HB9A 1NF0A 1VCVA 1EWEA 4JYFA 1YDOA 3LCLA 2DU2A 4JYDA 1OYAA 4LUJA 1SQ7A 1NVMA 5AC7A 4IMGA 3LV6A 2Q8ZA 3PBWA 4DO6A 2QDHA 1QO5A 5FF4A 1EX5A 1EB3A 3WFAA 3BG3A 4MYAA 5HWNA 1F73A 3Q37A 3W1TA 1D3HA 3R2GA 1YTDA 5FF2A 5K9DA 2WNNA 2YW4A 5HR7A 3EWZA 2E6AA 5CPLA 3FKKA 1SO3A 1OG0A 1H61A 4O52A 1XKYA 4DF2A 1WOAA 3A5FA 2ZQ0A 1O95A 4IMFA 3STGA 4BWLC 3B8DA 3L5AA 3ELFA 4HPJA 3BLFA 2A6LA 3LI1A 4XUGA 2B7QA 1QCWA 2AQWA 2E6DA 1SR9A 3BW4A 3T40A 2PC4A 3TSDA 5DXXA 4WZHA 1F74A 1N7KA 3HG4A 2H8XA 1EPXA 4AXKA 3LTPA 5F2LA 2YPIA 3D0CA 5LZLA 1K7XA 3MYPA 3NEVA 2ISSA 1P4CA 3ZWSA 3C4UA 2VC6A 2NXGA 2QCGA 1EUAA 3QPZA 3PS7A 4MOZA 4JD4A 1A53A 1F76A 4X9SA 4QNWA 1W5QA 2TMDA 1CX9A 1VJIA 3NPXA 1G7UA 4NJHA 4UMAA 2V0TA 1WXJA 1DORA 3CEPA 1PCKA 3P62A 2TRSA 4K7VA 2NX1A 5TIMA 2ATSA 5I3HA 3S1UA 4IOTA 5G1TA 5KSWA 4RZ4A 5TBOA 1T99A 2WSQA 3GR8A 5C54A 1SW0A 4ORIA 1J4EA 1W1ZA 2VOMA 3CTLA 4LVDA 5K3VA 4UTUA 4M7SA 5G4EA 1W56A 1FCVA 4JR5A 3UWVA 3LCXA 4CCDA 3A22A 2DP3A 5J5RA 2GPTA 1XL9A 3PUEA 4ADTA 4JTKA 3KVKA 3W7OA 4HKPA 4POCA 5AHMA 5F4WA 3H54A 3M41A 1OFAA 1K02A 2ZZ2A 1GG0A 1R2SA 1KTBA 5G1YA 3UWQA 4YXGA 1KW1A 5IM51 5D2WA 2RDUA 1LBMA 3M9YA 3QMSA 1T96A 3M5ZA 2E68A 4LRTA 1A5CA 4NJKA 3M44A 1C9DA 1AL8A 3E9AA 3GKFA 3QEZA 3STEA 1KV5A 3W9ZA 4DPQA 3TAOA 5HINA 3G18A 3SW6A 1TQJA 1X1OA 1TTPA 3C52A 4WY0A 4JTLA 3P7YA 5D32A 5LHEA 1B3OA 1QPOA 4AAJA 2YR1A 4X3ZA 4NU7A 1KTNA 5DLCA 4ZQPA 1FX6A 5BRBA 4W9TA 3EEGA 4AHOA 1GEQA 5AHEA 3S8HA 2FPTA 2C0AA 4NJIA 1TO3A 3B0PA 5LNSA 4HIBA 1I2RA 3TNOA 3NQDA 1DVJA 3G1VA 1WAUA 3TE9A 2VKZG 1R2TA 5K4XA 2NUYA 1VR6A 3LXBA 1RZMA 1ALDA 1R46A 3STFA 4HSOA 4FHAA 5TQLA 2G5WA 2V9DA 4GC4A 3WJYA 1TV5A 5FESA 2DORA 3FIGA 1Q6LA 1NSJA 4OHQA 4O4WA 1XDMA 4JGDA 3SJ3A 6ALDA 3L68A 1JCXA 2PRLA 4QM1A 4CQ9A 1XCFA 3NA8A 1E51A 1L2UA 3DFTA 3RMJA 1IXNA 4JX6A 2CFFA 2C14A 1A5BA 1VCGA 1W3IA 2OX1A 1J5TA 3DFNA 3IVSA 3JR2A 3VE7A 4QSHA 1L6WA 3PUDA 1FBAA 2GOUA 1ZJIA 3TA6A 3CHVA 5I3JA 3O1NA 4PL1A 4M5PA 1R2RA 1DQWA 4ONVA 2CLLA 2QAPA 3BK0A 3H55A 4M6PA 1ZAHA 2H8ZA 3EX6A 2ZA3A 2XN1A 1VYRA 3LDVA 1V7YA 3AJXA 3R12A 1AL7A 2C13A 3NL2A 4I9AA 4HNVA 2ZZ4A 4UFIA 5HNRA 4BK9A 2XN2A 2B7NA 5C5YA 3TX9A 1BKSA 4EOUA 4JYEA 3NQ2A 2CZEA 4G1KA 3PB2A 2DZUA 4PODA 2ZZ3A 3BV4A 3P82A 1ZALA 1AG1O 2V2HA 1Z48A 3LX9A 4JXCA 5HJLA 4AWUA 3SGZA 2PCQA 1W8SA 4R34A 3UQNA 3YPIA 2WJZA 1FWTA 4NXKA 3P80A 4AWSA 1C8VA 2I14A 3W1LA 1T0OA 1TREA 5KINA 2BSLA 3MBFA 3G8RA 3L2IA 3NXFA 3R8RA 3NQMA 2NXIA 3G0UA 3W7PA 1MEIA 2V30A 3DZ1A 2RDWA 3LRMA 5K7JA 3LHUA 5LNVA 1TIMA 3R89A 4JEQA 4K36A 4O54A 5CG7A 1JRBA 1YDNA 1GQNA 2X1TA 3HIJA 2ZZ1A 1TPB1 1JQXA 4A21A 4M19A 1XFBA 2NXHA 4JY8A 4RR4A 5D2YA 3LBMA 1W5MA 2E6FA 1HO4A 4MY9A 4OGZA 2OZ0A 3NQVA 2H6RA 4O8RA 3KRUA 1KFCA 1GVOA 3LHTA 3BVJA 5FF7A 2QCDB 2F84A 3C2EA 3CT7A 4HHPA 1BTMA 4TO8A 5CZTA 5LSMA 3W3OA 2FFCA 3LI0A 3C56A 3SIZA 2Z0IA 1DKWA 5D30A 3GKAA 4L4MA 3CIWA 4E0CA 3E0IA 3TW7A 3FYOA 4PFMA 1YADA 3LV5A 2EPHA 1UUMA 1ZNNA 3K30A 3GNDA 1DBTA 1CI1A 1S5WA 4J9JA 2JGQA 4JTUA 3HPXA 1ICSA 4LU0A 4LVBA 3O05A 2ZTJA 4JTHA 4RKAA 3USBA 1P0NA 2ZZ7A 3NQGA 3WJZA 3GVGA 2FJKA 4BI5A 1UB3A 4RZ5A 3PB0A 3M0ZA 3GYEA 1LDCA 3RF9A 3P67A 1KM5A 3JRKA 3VKJA 2OMAA 4WJEA 1I8JA 3E02A 3QW4B 2WNQA 4XKYB 1H7PA 1ZAIA 3NVTA 3PF3A 5T26A 1LOLA 3L65A 4O19A 4O14A 3KXQA 3PBYA 3T4CA 5HQEA 3L0NA 3UZJA 2Y7DA 3TFXA 4GUHA 4WQ6A 1FY6A 1H60A 1RR2A 5I3GA 3S1VA 4UFJA 5CPOA 5KITA 5E1QA 1G6CA 2WQPA 1YXYA 3W1XA 3LBCA 2FB3A 3N2XA 3P8IA 2WOQA 5DXYA 5BOOA 4H4IA 3MBDA 3PSVA 2BXVA 4UFMA 4GNJA 4UUIA 1TPVA 2ZRWA 1LOQA 2V8ZA 4CCCA 4AF0B 3W1UA 4E2DA 1DJQA 5HR6A 1RD5A 3M6YA 5LKYA 3M1ZA 1EA0A 3NQ6A 1WYIA 2GUUA 3ABOA 4AVFA 1K7EA 2YZRA 3W7EA 4OV4A 4XTDA 1PS9A 4TX9A 3W7QA 5H91A 5LNRA 3W83A 4Y96A 2QAFA 2E6YA 4CQ8A 5FI8A 3A24A 7TIMA 4M6QA 4A2RA 3DI0A 4ZQRA 3IGUA 2RH9A 3BPWA 2J24A 3TCEA 4HPXA 2V5BA 5CSRA 5HUPA 3UY8A 2GJLA 3FS2A 4N9CA 1FWWA 1EUNA 1HFBA 2VXNA 3NAVA 1O4UA 1QR7A 1YPFA 2QKFA 3UY7A 3P81A 2Y88A 1FQ0A 3G1DA 1OABA 2ZFAA 4LC8A 4LVGA 1I2OA 2HTMA 1H5YA 3GXTA 5D2XA 4JTIA 5L6UA 4DPPA 4FNTA 4RJEA 1VLWA 3UPBA 3BLIA 1P0KA 3N9RA 1ZAJA 5D04C 4PTNA 5ABTA 3BW3A 3PY2A 2QCFA 1TB3A 1OFPA 4JTTA 3UD6A 3G1AA 5D03A 4DBDA 5I3KA 1F6KA 4LV4A 1OVDA 5AFDA 3RFAA 1QO2A 3KRSA 1TPEA 2HSAA 4CNOA 3HO8A 1KFJA 3B04A 2YFNA 3IGSA 2R91A 1ADOA 4O1AA 5F4SA 1IIGA 3GAYA 4YWIA 3P74A 2E5BA 1FCUA 2ZCGA 3THAA 5MHBA 3W7GA 4PA8A 4MLRA 4PCFA 3W7NA 3HMJG 5AOUA 3U8GA 3W86A 4P2VA 4MPQA 1QOPA 3KX6A 1DJNA 5F2GA 2E5CA 1VS1A 4ML9A 3L67A 2P10A 3CEUA 3ABSA 4I7UA 5AHLA 3HOJA 4KFOA 2RHGA 1GTEA 3PR2A 4A3UA 3NGJA 2Z6IA 1IXQA 1GYLA 1YLVA 2X30A 3UWZA 4GRSA 3OG3A 3LTSA 3W2LA 4UNKA 5AC8A 3CU2A 1RQBA 3QH2A 3TMLA 1BWLA 3IEBA 2J9XA 2B4GA 3EWWA 4O15A 1XUUA 3HBLA 4Y9AA 1PIIA 5EMUA 1KM1A 3VE9A 1VH7A 2GJNA 4GUJA 4Z1BA 5AB3A 3UXDA 4MZYA 3QJAA 4EVZA 4C1LA 3L0KA 1Q3NA 3IGXA 3LCFA 4O10A 5KZMA 3O07A 1H7WA 2Q3RA 4QJ1A 1YTKA 4S1FA 3UXAA 3NQCA 3O6CA 3TIMA 1ZFJA 3EX1A 1TTJA 2B7OA 1ME7A 3LLFA 3QMTA 5D02A 2JKEA 2PRMA 3EXTA 5HMSA 4EF9A 3W2MA 1W3NA 5CPNA 5E0KA 3PAJA 1QAPA 4IJBA 5FEZA 3MP3A 1T8XA 1YYAA 1JRCA 1BEUA 4FIRA 4N9EA 3CB8A 2V81A 2W79A 5A5WA 3TK7A 3NQAA 5BMWA 3EX4A 4MUZA 5I3IA 4DXVA 1KM0A 3ATZA 1TJRA 4UMCA 3HQ1A 3DFPA 4OE7A 5AHIA 3GLCA 3O6DA 3QSTA 4EIVA 3E49A 1J2WA 1G4TA 3G1XA 2A7NA 2ZZ5A 5K9CA 3EWYA 3G3MA 3CWNA 1Z44A 3CWOX 2QUUA 3GDTA 4UFHA 3DGRA 2UV8G 4YL2A 3PM6A 1XBZA 2A85A 4DF1A 3WK1A 2QCLA 1B4KA 5L9FA 4FX7A 5EA9A 5FEWA 3EB2A 4LS2A 4NUWA 2VEMA 5HWMA 4NX5A 3O06A 3HGRA 4QITA 4IMCA 2R8WA 2ISWA 1JUEA 4NNAA 2QCNA 3W7KA 1TRDA 1YPIA 4PEKA 1FXQA 4GWEA 1NFBA 5DBUA 2PURA 4O1BA 3OVPA 1SZGA 2G96A 2ZDRA 3W6YA 3L9CA 1NEYA 3U6WA 3P84A 3S5ZA 4OV9A 3W7RA 1W5OA 3W7DA 5K4ZA 1YTEA 3W1NA 1KBJA 3UZ5A 3W07A 3SFKA 3IV3A 3LB0A 3PUOA 1FUYA 3N2MA 2NWRA 2OT1A 4MY1A 5KTLA 3NQFA 4WOZA 4TIMA 2ATMA 5AYYA 4ICNA 2HS6A 3B03A 4MZ1A 3LTYA 1H7OA 3U2OA 4MZ8A 1OFBA 3IIZA 3BLEA 2B7PA 1XXXA 3S5OA 3KRZA 4E38A 1G4PA 1HG3A 2WKJA 1OYCA 1SO4A 3V75A 2X16A 3SY5A 3HGJA 2FPYA 4JS3A 1SW3A 4QIUA 3KOFA 1GVQA 1TPFA 3W1MA 4DEFA 1OHLA 3F4NA 5EBUA 5EY5A 3OVQA 2ZBTA 4AWTA 3W85A 1A5AA 3VFLA 3PVFA 5BW6A 2QCMA 3QZEA 2W6RA 1OX4A 3FYPA 1O5KA 5AC6A 5C55A 1UBSA 3I6RA 4Z08A 5F2MA 3NO5A 1OFQA 2NWSA 2F7FA 1Y0EA 3HG5A 1KFKA 1SSGA 3WJXA 1VYSX 4R33A 3BW2A 4XTIA 3THQA 1SU5A 2ZRUA 2NV1A 3UPWA 3I7SA 4FX8A 3C2RA 1KFLA 4N4QA 1RVGA 4Q33A 3T78A 3DU0A 5DBTA 1KM4A 3RU6A 3QM3A 4Y90A 4MY8A 3GZ3A 1DV7A 3MYOA 3DAQA 4S2BA 4FNQA 5LGZA 4GBUA 3G1YA 5G2HA 4L4LA 1G7VA 1PHQA 3CM4A 1NF7A 3EWXA 3QF0A 3I65A 3MP5A 4LVFA 4IMDA 3M16A 3NQ8A 1H7XA 4KKXA 2ISVA 1KV8A 1DQXA 4GJ1A 5KZEA 2WSRA 2FLIA 1H62A 5D05A 1PCWA 3TQKA 4FNUA 2V2CA 3T7VA 1D3GA 1ZHAA 3PBVA 5C6MA 2KZHA 2CLHA 3QMRA 1OK4A 2E1DA 5D33A 5LGXA 3W2KA 3W84A 3MJYA 5D2TA 4LW7A 4O1CA 3GAKA 3I7RA 3O6YX 1KBIA 1VHCA 3C8FA 4N9DA 4O57A 4UTMA 1GG1A 1GT8A 3W7MA 3HF3A 1W0MA 3NDOA 1S3HA 3QFEA 3TH6A 2DZWA 1LRQA 2CZ5A 5K9XA 4Z1DA 2VFDA 3VI2A 3F4WA 5H2ZA 3HG2A 5DY3A 4LV9A 4IQLA 1YXDA 4UNLA 4UTKA 1NAL1 2H90A 4IGHA 1AMKA 4JNMA 1PL9A 3W1QA 4H6KA 4B5NA 4UTTA 3TFCA 4Z0JA 4KWWA 1EP2A 5CZJA 3IVTA 1JUBA 3ANYA 3INPA 4LWWA 3WJSA 3BO9A 4LNYA 1ML1A 3LRKA 3O63A 3NPUA 2V5LA 2BZNA 3P8JA 3ABRA 3GX9A 3LGEA 4AB4A 3SZ8A 2FTPA 1W5PA 3W7CA 4JTFA 2YCEA 4JTEA 1TPDA 3G1FA 1WBHA 4RZ6A 2VENA 2JKPA 4UTIA 1TTIA 1B9BA 3A21A 1HL2A 2ZRZA 4HN4A 3TXVA 4JN6A 3M43A 3Q58A 1RQEA 1BWKA 5F1UA 3TW6A 3WK3A 3NM1A 1O60A 4UXDA 4ZQNA 4JIQA 1KFBA 1LP6A 4LY8A 3BGGA 1SO5A 4O16A 1LBFA 1H7RA 1VQTA 1DL3A 3B0UX 1JCMP 4MLJA 4WY0F 3W88A 1IIHA 2RDTA 2YFOA 1G4SA 1TTQA 5FEPA 4GUIA 3TSMA 2GVGA 3CC1A 1W3TA 2CLEA 3EXRA 3QYQA 1TV8A 2FQIA 1OJXA 1IF2A 1SO6A 3N19B 1I4NA 5I3FA 1SFJA 1TCDA 1LRTA 4O50A 2H3BA 2EGZA 1F05A 3S9YA 2V2DA 3L5MA 4NQ1A 3G8EA 1PV8A 3DH7A 4PC8A 3W75A 1THFD 2CLKA 4IUOA 4O1DA 4NJGA 4XWUA 1OFDA 2CU0A 1ME9A 1FDJA 4UTTC 4K39A 3RK8A 1VC4A 3LOTA 1SUXA 1JCLA 2O7SA 3QW3A 3N3MA 3SI9A 1TYGA 1TPWA 3TKFA 3LHWA 2FIQA 1TQXA 2Y7EA 2GVLA 4A29A 2OT0A 2P0OA 1KTCA 1QPRA 4O11A 1UCWA 3GK0A 4WY0B 5U7SA 3S5NA 4CNNA 2P1FA 2Y6ZA 4UFLA 3WK0A 3OBKA 2ZZ6A 4K38A 3TSBA 3KVJA 2WPBA 3MHGA 4O53A 4RK8A 1WBJA 1O5XA 1MXSA 1QDSA 3FFSA 1P1XA 4JX4A 3HGSA 1U83A 1JUKA 5CSSA 3EKZA 5LNWA 3C3NA 3SECA 3IIPA 1W37A 2YYTA 5D38A 1XC4A 4TU1A 2QCHA 1ME8A 1VGAA 4MKNA 5J5DA 4UTWA 6TIMA 3GDRA 2BLEA 4Y6GA 3PC0A 2YGYA 3FEMA 2EF9A 4UR7A 2HMCA 3W87A 2JK2A 1JVNA 5AHNA 4MJMA 3W1PA 3LCHA 4MIMA 5EYWA 4Y8FA 2JKAA 4QNEA 3A5VA 1IXOA 2C18A 4DF0A 2Y85A 1EP1A 2EHHA 3GXPA 2VFFA 3W7HA 2NV2A 4DO5A 2J9YA 3WK2A 1G69A 1K03A 4JTJA 5KZDA 1QMLA 3E12A 4IWWA 3G22A 3UWYA 3NR0A 4Z0SA 4BWLA 1SPQA 2E77A 3DBPA 1M6JA 3EX3A 3MMTA 3OIXA 3S0CA 3Q2DA 4FNRA 3WJWA 1WX0A 8TIMA 3S1WA 1AW5A 1ZENA 4ZL1A 2QDGA 1F7BA 3DHDA 4TR9A 2C15A 3LM7A 2X1UA 4NNBA 2NX3A 1Q6QA 1C29A 4UFKA 3DKJA 2NUXA 1TMHA 1V5XA 2NZLA 1LORA 3W74A 4YLWA 3TAKA 3N14A 4WXZA 1S5TA 3MHUA 1ICQA 1LROA 4XZ9A 3A9IA 3DI1A 4KWVA 5U4NA 1VZWA 2QJIA 4KFNA 2C3ZA 4X2RA 2VELA 1LOSA 1YXCA 1XUZA 1JQVA 3IIOA 3V1PA 3LXCA 1F6PA 4LUIA 3B06A 4UTWC 3W23A 2DJLA 4ADSA 1I2QA 4GUGA 4K8HA 2I9EA 4JICA 1GVFA 2X2GA 4IXXA 1RQHA 1LM1A 2VEKA 3UWUA 3NNTA 3M7WA 1WV2A 4JDBA 5CPMA 1JCNA 2TPSA 4FX6M 1UJPA 1RV8A 2PRHA 3LERA 5FEXA 5G5IA 4JX5A 1H63A 4GXMA 2X1SA 3C6CA 2GQAA 3L5LA 1O94A 3S6DA 2GVJA 2I1OA 4FIQA 1KA9F 2VFEA 3BGJA 2B0MA 2ZRYA 4UTHA 3W7IA 2TSYA 1MSSA 3GXNA 3NYZA 3QSRA 2A0NA 4BFAA 1R30A 1L6SA 4ZVJA 1TRIA 2HS8A 2RKXA 4HNUA 4ADUA 2VFIA 1TPUA 3G0XA 2C16A 3FA5A 2CLFA 1XDLA 4JTSA 4NZFA 1A5SA 4K8EA 3JS3A 3IRDA 3NQ7A 4K7YA 3W1AA 4O18A 1H1ZA 3FOKA 4R53A 2DZXA 3MP4A 2QCDA 4S2CA 2VFHA 2WNZA 2R94A 1QFEA 3G1SA 3DFQA 2A4AA 1M5WA 2A6NA 3S42A 1DHPA 3NL5A 2QCEA 2QR6A 4XQ6A 4NXSA 1QNVA 3ATYA 4GE8A 2DZSA 3EWBX 2CLIA 5AN7A 4Q4KA 4N6EA 1VLIA 2CZFA 4FF7A 2WO5A 2C1HA 1OYBA 1DOSA 3UWWA 2QUVA 4FO4A 4Z1CA 2E5DA 3PSWA 1SSDA 1KLYA 4PH6A 3GNNA 4AH7A 4TMBA 3KVMA 1X6UA 3NM3A 4O17A 1K3UA 4WOQA 5E93A 3L21A 3TJXA 4XBKA 2Z6JA 4FXSA 4IX0A 1OFOA 1XBVA 2YYUA 4K37A 3DFOA 3TDFA 5GVJA 3DFSA 2BWGA 3CPRA 3C61A 3PWAA 3QQ0A 2VEIA 5DCBA 3FJLA 1JCYA 3VNDA 3NL3A 1MEWA 3W7LA 1TJPA 1D9EA 4HNNA 3W1RA 2EAWA 4IXHA 1LRNA 4A2SA 2CLOA 4O4VA 4XKYA 2Q8LA 4EF8A 4HSNA 3RLVA 2R14A 3W76A 5CGQA 3ABQA 4N6FA 3GR7A 4NT0A 4MYXA 3GB6A 4CNPA 3C0JA 1K8ZA 2Y7FA 2YXGA 1FWSA 1X1ZA 4HT3A 1YDVA 4IPIA 1TPH1 3TXZA 2IQTA 4WD0A 3CQ0A 1KLZA 2NUWA 4DQWA 2JGYA 3KHJA 3OVRA 1G4EA 1S5VA 2FDSA 1PE1A 1SW7A 4AF0A 4CCEA 4D2JA 2ZA2A 3GDKA 1HO1A 4E2BA 2QJHA 5HULA 1VCFA 2A7RA 3G0SA 4JIPA 4N9BA 4UTLA 5D09A 1GPWA 2ZA1A 4ZMGA 2ZRVA 4OU1A 2A21A 1OFEA 2PE4A 1OX5A 4LTSA 3TV8A 4CLMA 5KMYA 4HNTA 4DO4A 1OF6A 1VPXA 4RXGA 3NPWA 1XBYA 4BI7A 4LS1A 1GZGA 1WQ5A 2Q3OA 5BNKA 3FKRA 4FNPA 4C1KA 1ONRA 4BF9A 1FCBA 3UNDA 4UR8A
chains in the Genus database with same CATH superfamily
1GEHA 4GGHA 3ISIX 4UOZA 4GQRA 4NZ4A 4E2VA 2POTA 4FMVA 3IIVA 1QNQA 3LHYA 2BG5A 1OQFA 3VIJA 1R3SA 4G56A 2J9ZA 3WD1A 4DYKA 2CW6A 1LWHA 2VWTA 3LCWA 2YW3A 3ZS4A 4ZA0A 4E8CA 3F4VA 3B4UA 1RPKA 1KM6A 4C90A 4JKLA 1OK6A 5I78A 3UCCA 2G37A 3QPYA 4GINA 3GRIA 5EL1A 2WCGA 4LH8A 2ISDA 1VFHA 3N73A 1XLEA 4A22A 2BVWA 1C9WA 1H51A 2G4JA 4HSHA 3F03K 2FB2A 4CD5A 3O8AA 2I9UA 3G1RA 1ZBCA 3GW3A 3W7JA 1E1CB 2PTWA 4LUSB 2E67A 1JZ5A 1SMAA 3SCOA 1FFQA 2JIEA 3I4EA 4BCEA 1X8FA 3CNYA 3F1QA 5AYXA 5BMXA 2FTWA 2NQZA 2BX7A 4YN5A 3ZLFA 3NZ1A 3FJNA 1N55A 1KM3A 4BQ3A 2PDNA 3P6LA 2VFGA 4H9ZA 1MEHA 2NX9A 3MMDA 4RV3A 1RP8A 2OWCA 3SCPA 3AC0A 2DJXA 3TROA 1KFEA 3W22A 2CWNA 3H6OA 4S3JA 2X1RA 4AZ6A 1OFRA 3DEQA 2D20A 2ZYFA 2HRWA 1GVYA 1HTIA 2VEFA 1S2CA 4OT7A 4AISA 4G2DA 4GOAA 2WC7A 2OJPA 1V6WA 3OYXA 1SVDA 4QISA 4MNLA 5CLTA 4Q6JA 1DWJM 3GG7A 1M41A 2GOKA 3VIFA 4AZIA 1EJUC 2O7QA 3N9KA 2P5NA 1ZRQA 1G9HA 5BRPA 2EPKX 1KCXA 3AZSA 4PUJA 4PN2A 3M5VA 4EPEC 1TSIA 1W31A 1QK0A 2XIIA 2VEPA 4QEHA 4UTFA 5E0FA 4W86A 4DBEA 4MWAB 1VYPX 2QF7A 1TZ9A 3F4DA 2QIWA 2VGFA 3IUHA 1FWRA 1WA3A 1E9LA 4Z1AA 8A3HA 4O28A 4L65A 4QJ3B 2V82A 3SR7A 1SR0A 3ITXA 2AGKA 3I3DA 1S39A 4AHPA 4I9MA 4MADA 4TUFA 3LLDA 3OA3A 2FZBA 2ABAA 3U2CA 3IJIA 4OQVA 2O4MA 1R47A 3GM8A 1K9DA 3FLUA 1F3EA 5I02A 4QQ3A 4R9OA 3VNJA 1B57A 1SFLA 7XIMA 1KCKA 2QJGA 3QQ1A 4J7RA 3LGGA 3TQ0A 2DFAA 4PMOA 4J40A 2GDVA 2VRQA 4N0RA 2OWWA 3DHFA 4ZXOA 3MDWA 3VIHA 2YDAA 3BARA 5A8GA 2OLSA 4WDXA 1GOWA 4LVAA 5F7UA 2LLEA 2DH3A 3PBUA 1N8WA 4AMCA 3NOEA 1GYNA 5DEZA 2Y7GA 4UWMA 4AQLA 3L7RA 1L8NA 5LNUA 4RL3A 4ZQMA 1R38A 4RNIA 4UIOA 4IF2A 3RO6A 3D5HA 5HXMA 5DY2A 1VRDA 1Q65A 3NG3A 7PTDA 3MI2A 2ZADA 4ZEPA 4E4FA 5AZ0A 1F3XA 2Y62A 1QNRA 4AMAA 4HZ8A 3WLTA 4H3DA 4DNHA 4ZOBA 1GVSA 5F4XA 1SFSA 1AODA 5CKSA 4ZQCA 5BRQA 3V5CA 3HPSA 2VCBA 3OEXA 2OU4A 5ECUA 3DDMA 4S3BA 3S5YA 4PRWA 3R8GA 4KFPA 1F2JA 1E43A 3M0YA 3W2NA 1QWGA 3ZJKA 1VJZA 3AHZA 5CSYA 3TU9A 2E09A 3W82A 4B5WA 1LLWA 5CGTA 4FPSA 3LBOA 1JYXA 4C7FA 3QY7A 4J3VA 3F5LA 3EAUA 3POHA 1PX3A 1MNSA 1G94A 2PGWA 4HOWA 3H8AA 4JNYA 3TA9A 4DIAA 2HNHA 1BVWA 1OIMA 3R4IA 3HB9A 5FOOA 4C91A 3LCLA 4D6HA 4KEMA 1IWPA 1YKWA 2WANA 4LAZA 5AC7A 2Q8ZA 2Y4SA 2VVSA 1QO5A 1BGAA 1M53A 3OLGA 3CIVA 2A79A 3EBVA 4MYAA 3Q37A 3NZQA 1D3HA 3R2GA 1PX8A 1SJAA 3R10A 2ICSA 3FKKA 2Z27A 3L5AA 1W9UA 1QPKA 1RCQA 1UKSA 4J3WA 2E0PA 4XUGA 1SR9A 1UH4A 3BW4A 2PC4A 5DXXA 1F74A 1N7KA 1J5SA 5HQMA 2VX7A 3LTPA 3NEVA 2QCGA 1TUFA 3GTFA 1F76A 2ZX8A 3CUZA 4FZIA 4RDYA 3NPXA 1XP3A 3N25A 1G7UA 3IUIA 4D72A 4J3ZA 1S2WA 3FXGA 4PTMA 2PDUA 3W28A 4AYGA 3CEPA 4IIBA 1E9YB 1S2VA 4HU0A 2NX1A 3VOHA 5G1TA 4RZ4A 4JPGA 2WZIA 2WSQA 1HKMA 3NSNA 4QS5A 3N6QA 4NRSA 1QBBA 3L4VA 4QJ5B 1KCLA 1EJXC 4A6GA 5CBBA 3DG3A 3LCXA 3EB4A 1SZRA 1XWYA 3CLWA 5J5RA 4W84A 4JTKA 4WDUA 4POCA 4DWSA 1MQRA 5F4WA 3R94A 5JUVA 4N42A 2VZOA 1RY8A 3FDKA 3N6JA 4ACZA 2YBUA 4GH3A 1Q7QA 1KTBA 5G1YA 2O9OA 4NI3A 1KW1A 3WD4A 1ZUAX 2PEVA 3T1GA 1T96A 2OG9A 3LZ3A 3WD3A 3M44A 1R3YA 1C9DA 2IUZA 3L4WA 5CC3A 2Y5JA 2J7CA 3AUOA 3TAOA 2CXEA 3WLSA 4WY0A 3P7YA 2FMNA 2PLKA 3DESA 2ISFA 4X3ZA 4Y9PA 4A05A 1MW1A 5DLCA 4KEVA 5BRBA 2P0IA 4W9TA 5AHEA 3WNKA 1E0VA 4GYFA 2C0AA 1TO3A 5LNSA 3SCSA 1UROA 3C5QA 3EDDA 3HZ3A 3NQDA 2DVXA 2R1LA 3WY1A 1RK6A 1WAUA 3TE9A 3BJSA 3SDOA 1R2TA 4WF7A 1FKXA 3SCWA 2NUYA 1EO7A 4JCMA 4Z2KA 1ALDA 1R8LA 1R46A 1B3YA 3IJ7A 4FHAA 4HSOA 2NVCA 4GC4A 5TQLA 2X2YA 4AZ7A 8CGTA 4DWSC 4RNFA 3B3DA 2A3HA 1H4PA 3HURA 4XZBA 2MNRA 1EJ7L 4O4WA 1XDMA 3B8WA 1IEQA 4IZGA 2PRLA 3CL6A 5DT7A 2DT3A 1XSJA 1JF6A 3NA8A 1Z9AA 3DFTA 4MHBA 1IXNA 3ALGA 4HZ6A 2CFFA 3CAQA 1XGDA 3ARZA 1A5BA 1TELA 2Z1WA 4F79A 1TG7A 3HJEA 2P53A 3IVSA 3JR2A 4NZ1A 2PLJA 4QSHA 2PPGA 2C7FA 1FBAA 2UY2A 3QV6A 1ZJIA 4XISA 1JEZA 4ZSUA 3TA6A 3WUFA 4GY1A 3CHVA 4PL1A 1R2RA 3P2VA 2QAPA 3BK0A 3WKZA 3H55A 4LF1A 1VF8A 2MANA 2CBJA 2YDSA 2GGIA 4HOZA 2VHLA 2ZA3A 2WMJA 5E0CA 3AJXA 2HISA 3NL2A 3F4CA 3D46A 2XU2A 2ZZ4A 4UFIA 4HNVA 2GGJA 5IOBA 2AL1A 1XCXA 2XN2A 2WB5A 3B8VA 5C5YA 3KTXA 1TJ2A 3WNOA 3MSGA 4EOUA 4JYEA 2CZEA 3PB2A 4Q4QA 2HXUA 3BV4A 1GJUA 1ZALA 3LX9A 4JXCA 2PCQA 1W8SA 3KS6A 4LAKA 3SM0A 3YPIA 1DWGM 1ZZMA 1QWKA 2XHYA 4DAFA 4WSJA 2WJZA 3WENA 1TFVA 4PMXA 1UKQA 1OEPA 1T0OA 5KINA 2BSLA 1H3GA 1QW8A 2E9LA 1TR9A 1Y5WA 2HK0A 3TYUA 3GIQA 1C8XA 3VGFA 3AYTA 2OGYA 3LHUA 5JVLA 2AMGA 4K3ZA 4KWSA 1H2JA 1W1PA 1IWBA 2VI0A 1O12A 3KW3A 1U1UA 1YDNA 2X1TA 2J75A 4UZUA 4Q22A 4RE4A 4W8LA 4FLSA 2D2OA 3MU7A 5HDRA 3PNUA 2A3EA 4F66A 4K1WA 2OZ0A 3U5UA 1KR1A 3PTKA 4AD4A 3KLLA 4NI8A 3U7VA 4Q8NA 1S2AA 5HMFA 3KRUA 1KFCA 4MAVA 3KZPA 2XZ7A 2QCDB 2PGEA 4TO8A 4GYKA 3FW6A 1DHKA 4JTQA 2W62A 4PFMA 4GIRA 4XSLA 5AZ1A 1ZNNA 3AMLA 4GABA 3PFRA 3KDOA 1DBTA 1CI1A 1OB0A 1QTWA 3CMGA 4LU0A 5HA7A 3SB0A 3SRHA 4GX8A 3WJZA 2PAJA 2ZXDA 1UB3A 3VC6A 3PB0A 1US0A 1PUDA 2ZUNA 3M0ZA 3XINA 3A64A 2OMAA 1I8JA 3GD6A 4ZO6A 1PZ1A 4Z42C 3UZWA 1UIPA 4PMYA 1PZ0A 3PANA 3E2QA 3N4EA 3VGDA 1H7PA 3WUGA 5LIXX 2PTXA 3L65A 3WNNA 3KXQA 4WHBA 1WDDA 1QU4A 5RUBA 1AZ2A 4REQA 3E2SA 3SN4A 1IZJA 3G77A 5HK4A 1XLLA 1UP2A 5HQEA 2WVUA 3DECA 1FY6A 1RR2A 3EWDA 4Y7EA 5CPOA 6A3HA 7REQA 1DIOA 5KITA 5E1QA 1G6CA 3PPGA 4GG9A 3W1XA 1B30A 5I24A 4MB1A 3DG6A 4PMUA 4H4IA 4KH2A 1RJPA 4ENLA 1B3ZA 3R1ZA 1V6XA 2QXWA 2PDLA 1XRTA 4CCCA 4DVOA 1LOQA 2V8ZA 4LYRA 2D3NA 2WM0A 5C9XA 3BCJA 1RXOB 1KKRA 4NZCA 4HTYA 3M6YA 5LKYA 2GGEA 3M1ZA 4C6DA 3AMDA 1XKJA 2GDQA 2XIJA 1UP0A 2YZRA 3W7EA 3AIQA 2PA6A 4TX9A 4LYPA 5LNRA 1J10A 3W83A 4QTGA 4UQAA 4NF7A 1V6TA 1KXTA 1U22A 3W00A 4F0SA 5FI8A 4MB4A 4F9DA 4M6QA 4A2RA 4ZQRA 1YBQB 1WKDA 3VMOA 1XINA 2ZC8A 3V0SA 1TIWA 2V5BA 4HPXA 5CSRA 5HUPA 2GJLA 4Y9NA 2XFRA 4P7RA 3T05A 1R9ZA 1N2VA 2VXNA 3NUKA 3NAVA 1YPFA 1QR7A 2D24A 3A4WA 5GNXA 5A6TC 1EXBA 2HVMA 2QKFA 4WK9A 1RJQA 1OABA 4PTXA 1X6NA 3CWHA 4LC8A 3KL3A 5D2XA 2ACUA 5L6UA 4GCXA 4RJEA 2F6UA 3W53A 3UPBA 3BLIA 1XYMA 3N9RA 4PTNA 1BXNA 1TB3A 1W1VA 3G1AA 3OU8A 1A0CA 3MCMA 2ZX7A 2VQTA 4HBKA 3RFAA 1ZLPA 2WLYA 4CNOA 1K4GA 4RDWA 2Z00A 2YFNA 4F2TA 2W66A 2WJFA 5BOFA 3A9BA 3GAYA 4YWIA 3V18A 3HQOA 4PUUA 3P74A 2WPGA 3W7GA 4CN4A 4YU1A 3UJFA 4JOMA 2WLZA 4P2VA 1QOPA 1DJNA 3H23A 4IJCA 5F2GA 3WF2A 4HA0A 4I7UA 5AHLA 1O5RA 5KETA 4A3UA 3NGJA 2Z6IA 2I7GA 4CN1A 5E70A 1IXQA 1VFOA 3W2LA 4UNKA 3F5JA 1HT6A 1GKQA 2UY4A 3UA3A 3NDYA 3IEBA 3VNYA 4ERAA 2BV9A 4NYUA 1OZQA 1EC9A 3WNMA 3GQYA 1KM1A 2OFJA 3CMJA 3BAJA 2IXVA 4Z1BA 1DQUA 1TE6A 4EVZA 4C1LA 3PZIA 5A3HA 3LCFA 1BRLA 3LG3A 3O07A 3E38A 2FKPA 3A3XA 3O6CA 3C3UA 3HM7A 4W8AA 1HVQA 1Q6EA 2ZUWA 1PAMA 3WBXA 4QCEA 5CSUA 2C8NA 3QV8A 2YL8A 4JAWA 1BEUA 4FIRA 1NFGA 5LIWX 4OOZA 1HJUA 3TK7A 2L5HA 3OO2A 5BMWA 2J8GA 3T09A 1DJYA 5AC5A 4C5ZA 2WQDA 1KM0A 3CZLA 3ATZA 1TJRA 4UQ9A 3QPEA 3CUIA 4GQQA 3DFPA 4D6JA 1WKYA 3JZEA 4GC3A 1YMYA 3ZVIA 4EIVA 4IP5A 3SCRA 2DSWA 3G1XA 2PDPA 4HN8A 3DGRA 3HTWA 3OOQA 1Q4WA 1B4KA 1QOXA 4WDWA 4FAMA 1EC7A 4ZBCA 4OTKA 4LS2A 2WHKA 5DRIA 4FS9A 1JUEA 1TWWA 3W7KA 4XAGA 1SMDA 3F5KA 1NFBA 4GWEA 1ONXA 5CJMA 3QY8A 1SZGA 1V93A 2W67A 3W7RA 3ZR6A 4ZO8A 1YTEA 2EJAA 1KGXA 3W1NA 5IFPA 4KIRA 4B5TA 3M0IA 1RA5A 2GK1A 3GVVA 4WIWA 4U5IA 4S39A 2NWRA 3BC9A 3CH0A 3J7HA 4WOZA 3WD2A 1P1MA 4TIMA 4QXIA 3B03A 4KWOA 3TP4A 3FEQA 4H7VA 3OZYA 3U2OA 2UZ9A 4GXWA 4I3GA 1XXXA 5BXTA 2JEQA 4RDVA 3PBGA 1SO4A 3ZYZA 3SY5A 1IZCA 5A6AA 1GVQA 1RVKA 3BLPX 2W63A 4QBXA 3MSDA 3RR1A 1PSCA 3TJIA 3ZM8A 4TV6A 2E7FA 5BW6A 3QZEA 3GTIA 1C91A 3UJEA 4L9ZA 3PZGA 2HPMA 2NWSA 3E0VA 1C7TA 4AY7A 4HA1A 2F7FA 1Y0EA 3HG5A 4FSAA 4TQTA 3WJXA 1VYSX 3OG2A 5ECVA 1ZBKA 3THQA 4GHRA 1SU5A 1F4HA 3GXDA 1P6BA 3A3WA 2O55A 1RVGA 3WF4A 1U5HA 3DU0A 3AIEA 3V5OA 3GZ3A 1DV7A 4O8AA 3RU8X 1E5JA 4GBUA 3QKEA 4L4LA 3UZZA 1PHQA 1OIFA 4ZE5A 3IACA 4WRHA 3MP5A 5TAOA 4IMDA 3W6MA 4XZMX 3SBFA 1OZMA 2XSBA 3WUBA 4XZIA 3RG6A 5A6LA 4GJ1A 5KZEA 2FLIA 3H4WA 4JFWA 3SY8A 1UHVA 3ES7A 4M82A 4MF4A 3KBVA 1ZHAA 1FWGC 3VIOA 4EWJA 2CLHA 3IV8A 4LX4A 2QF8A 2GJXB 3WIJA 3GAKA 3SCTA 9CGTA 4S3EA 3R25A 5PTDA 1KBIA 4O57A 1VP5A 4H8UA 4ROPA 1UWRA 1S3HA 2DZWA 1LRQA 2CZ5A 3BTNA 5XIAA 5FAJA 3PJXA 3VI2A 4PTVA 5FKYA 2P50A 4LV9A 5DY3A 1TUXA 2EJ1A 2HWGA 3CZEA 4IQLA 1AQFA 1NAL1 2YB4A 1YEYA 4JNMA 2HEJA 1ODUA 3W1QA 2Q71A 4XZHA 2BNJA 4XVEA 2E8ZA 4W7WA 1V4YA 1V0LA 4Z0JA 2XM1A 3IVTA 1V0MA 1M01A 3ORWA 1H0IA 5A1AA 1KXHA 2BZNA 3GX9A 6XIAA 3LGEA 4V2XA 3W7CA 1BAGA 5IRPA 1B31A 1TPDA 2FHCA 2BODX 3EOLA 3SUTA 3M0VA 3AOFA 2JKPA 1B9BA 3A21A 3Q45A 4TVUA 4US6A 6TAAA 2W91A 1BWKA 1GOIA 4W4QA 3TW6A 1UWSA 4ZOAA 4JIQA 1S46A 3L4YA 1ZU8A 1LP6A 3ITYA 1SO5A 1V6UA 4ICMA 1W8GA 3WBAA 2CLEA 3N1AA 3OQEA 1SO6A 3PJWA 1R85A 1I4NA 1J8VA 1TCDA 1UR4A 3FA3A 3BQ6A 4NQ1A 3G8EA 1PV8A 5CAHA 1JPHA 3AYRA 1UKOA 4AIOA 4IUOA 5A6KA 4NJGA 1JFHA 1JG9A 1RUSA 1DJWA 2WKLA 3GU1A 4K39A 4CKQA 4AFYA 1JCLA 1D8CA 3IAQA 4GXPA 3H2EA 3N3MA 1TPWA 1SM9A 1VFTA 2DDXA 1DXFA 3PNZA 4A29A 1JZ6A 5D9NA 2NQJA 1PKLA 3GHRA 1KD0A 4O11A 1O68A 4AD3A 4CNNA 2I56A 4UFLA 2WCSA 3WK0A 3OBKA 2R1KA 3U57A 3KVJA 3V36A 1WBJA 1O5XA 4CQDA 3QR1A 4YHGA 3ZXWA 4GJJA 1GOOA 4B5SA 1MFUA 4D8LA 3FFSA 3HGSA 3B0XA 3EKZA 1HP5A 3SECA 2D0HA 3IIPA 3SJNA 1FWHC 2WVTA 5D38A 1FWEC 3WQOA 2QCHA 5J5DA 4UTWA 2J77A 1JPKA 3GDRA 4UR7A 3BICA 1X6LA 3STPA 3W87A 3DERA 3OB8A 1JVNA 2PP3A 4WKAA 4MJMA 5DT5A 1W9DM 1H5VA 5EYWA 1T6MA 2OELA 4Y8FA 3QV7A 4QNEA 3UGRA 2VCCA 2W9MA 2C18A 3OHMB 3WCZA 3KOWA 4MMWA 4DO5A 2J9YA 4Q8QA 5KZDA 1GONA 4G7EA 2C1IA 2JF7A 4N7QA 3DBPA 1M6JA 3EX3A 3KRBA 3S0CA 3Q2DA 3FCPA 1UWIA 4M6UA 2HE5A 4HMDA 2QW5A 3VILA 4CD6A 1PTAA 2QDGA 4ZL1A 1F7BA 3DHDA 4TR9A 4KESA 4ZFMA 1B9ZA 4L5ZA 3S2NA 2X1UA 3I3BA 2DIEA 3BV7A 3S1GA 2C1GA 4GZIA 3DKJA 3E1F1 3UVIA 1TMHA 3VA8A 4X0VA 3EDKA 4GACA 3N14A 3FGCA 1S5TA 3TW9A 3MUZ1 1LROA 3JW7A 1HL9A 2D0GA 2PC8A 3WEOA 4QDWA 4GIYA 1A5LC 3BAWA 4KFNA 2HXTA 4UBPC 2WJDA 1P48A 2VELA 1YXCA 1JQVA 3V1PA 3LXCA 1F6PA 4GA8A 4PBFA 4TVCA 2X1IA 4MKSA 4UTWC 4ADSA 2R6OA 2I9EA 2OLHA 3IK2A 3UBPC 3R8HA 4WCJA 1P0BA 5JIPA 3K4DA 1LM1A 2OB3A 1HJXA 1M3UA 2PODA 3WF1A 1HX0A 5CPMA 1GCYA 1UJPA 4GVHA 1JI1A 3EDJA 3APYA 5FEXA 4JX5A 1H63A 4GXMA 3DC0A 5DMLA 4GO8A 4L6OA 4PR4A 1GORA 2GQAA 4AG0A 4R7WA 4FIQA 1KA9F 1VIWA 5HAOA 1UWTA 4CNUA 2YBVA 2TSYA 3GXNA 3PP7A 5M03A 3GO2A 5GNZA 3SUSA 2HS8A 4ADUA 5HANA 3FA5A 1AQ0A 4W89A 4JTSA 4H01A 4NZFA 1A5SA 4K8EA 2A3LA 1QNPA 2OSYA 2YIHA 1XIDA 3UR8A 1HNYA 3IRDA 4K7YA 4AX6A 3FOKA 4R53A 1B2YA 1NWUA 1GW1A 3XIMA 4G5DA 3S42A 2J6VA 1DHPA 4WLCA 3VIMA 4W5ZA 3WLNA 2QR6A 3CPGA 3FYYA 4D8ZA 1YE6A 3ATYA 3KLKA 4CGTA 2DW6A 4Q4KA 3OLIA 1WKFA 1DOSA 4HYWA 1RLDA 1OGBA 1I0BA 5IXEA 1PTGA 4OIFA 2QUVA 3LU2A 4Z1CA 5HOSA 1KLYA 3GNNA 4IQEA 4CEUC 2WBGA 1X6UA 3T0BA 2OR2A 4PFHA 1T41A 4DM1A 5I5RA 3TJXA 2WZHA 1OFOA 3DFOA 3TDFA 4ZOEA 1S5MA 1NFPA 5EGRA 3C61A 3VC5A 3S3GA 2VEIA 3O0KA 3AZRA 2YCLB 1LL7A 3W1RA 2VX4A 2HROA 1PWMA 4O4VA 2Q8LA 2JQXA 2R14A 3ABQA 4NT0A 2PLCA 1X7IA 3S9ZA 2DUXA 1XRVA 5LA1A 3PUGA 3SGGA 2V3DA 2YXGA 2Y7FA 2BFGA 2IPJA 1JDEA 1YDVA 4WKFA 4ACYA 3AXIA 4LSBA 1EFZA 3CUFA 3KHJA 1S5VA 2FDSA 3PTDA 1WDSA 3B9OA 4NYYA 4CCEA 1HO1A 3FVMA 2XM2A 1OM0A 1W2PA 1HJQA 4LAUA 4UTLA 2NT1A 2W92A 4ZMGA 4R3UA 1J0YA 3T8QA 4L1XA 1IEXA 4FOUA 4U10A 1MVYA 3H12A 4LS1A 1GZGA 1WQ5A 4C1KA 5I79A 5C8BB 4QLKA 5DCEA 2EKCA 4RUBA 2VP8A 2Z1BA 3KP1A 1XLCA 3GVRA 2VOTA 4TTUA 4LF2A 4Q3MA 2GGGA 3KFTA 3RN6A 1ZCOA 4IX2A 1N8FA 1FHLA 2GFTA 1VHNA 3R5EA 3RAOA 3CV6A 3L0GA 1EHAA 4XD5A 3BZGA 1SGJA 3MW7A 3MMUA 5XINA 4KEZA 1JCJA 2CXGA 4YYFA 3VCNA 4O13A 4YVVA 2J27A 4E6MA 3LXAA 3CHCA 2DSUA 2WMIB 1XIJA 5EMMA 3NL6A 4QQUA 2EG7A 3W27A 1SZFA 1CBGA 3N34A 1SZNA 1Y7VA 4OUIA 1LQAA 4H9VA 1XLMA 3EOEA 1BG9A 1AK5A 4RNHA 2WC4A 4X0NA 2FPVA 4R7JA 2DZVA 2UBPC 2HZGA 4B5UA 2FDMA 4MFEA 3IJQA 3WYZA 1BHGA 5EU9A 3R6IA 2ABBA 3BG5A 2H3DA 4QGCA 2WK2A 4U28A 5A6MA 5DFAA 2WV8A 1XSKA 4WX2A 2YL5A 3RLUA 4L7ZA 4ZZ9A 4PCSA 4IMAA 3ZJ8A 1MZHA 1AW2A 1JNEA 5A8MA 3TC7A 4LRSA 4M6VA 4D6CA 3MUXA 4GY0A 4UCGA 1LL4A 5E09A 5AYIA 1I6NA 3O7UA 2YOCA 5B7ZA 1GJPA 1IT7A 4U3CA 3SY1A 1FWDC 1NQ6A 4Q32A 2QT3A 5DF0A 5D8WA 2ZICA 4UTJA 1UUOA 1FDYA 4W88A 3SGUA 3MTWA 3MV11 2VZSA 3VIIA 1QPQA 4E4PA 4NIRA 4H6EA 3DIPA 3FHAA 3L66A 1W1A1 1XBXA 3AIVA 5D4YA 3NCOA 3DXIA 4F4RA 2CZDA 1XI3A 1EH9A 3FNDA 2G3MA 3MANA 4C1NB 3EA3A 3W73A 2JBMA 3PJTA 1IR1A 3S47A 2R9RA 3P60A 4R7OA 3PZTA 3WD0A 3BH4A 4DYEA 5HMEA 4B5VA 1XLHA 2YX0A 1W54A 2I16A 4NNCA 3S2MA 4B3ZA 3HPFA 3NO3A 1LBLA 2ASHA 1BD0A 1UASA 1QT1A 3QC3A 5C9ZA 1E73M 1CNVA 3UJ2A 1UD5A 1JPMA 4Q8OA 3B05A 3KVLA 3UW6A 4BI6A 3APGA 2OKOA 5M3WA 2IQ0A 3CHDA 5BXSA 1PTDA 1LZOA 3DYPA 3GY1A 1JXKA 2OCZA 3QYSA 2RFGA 4HYVA 4NJJA 4YMZA 3I68A 2I5QA 4PE8A 1WZLA 5CAKA 1DE6A 1LTDA 2WSYA 4LT9A 2EO7A 3MZ2A 4DX3A 1LLZA 3CZKA 4DO7A 3CLMA 3IIXA 3HFTA 2G95A 1UWUA 4JTGA 1PHWA 4RE3A 4RXFA 4YPJA 3O16A 3S83A 4QRNA 3GDMA 2PZ0A 3C2VA 1B5TA 1L6YA 1EHNA 4Q4PA 5G4HC 4LPCA 1J0IA 4IHCA 1Q2RA 1XGEA 3N2TA 4D6FA 3SQSA 2V6AA 1UKPA 1FCQA 4PCPA 3T44A 3I7QA 2J6XA 4I7WA 3KL5A 4KERA 1ISVA 2OPJA 3DENA 2G41A 1BPLB 3NPVA 3GHUA 3LCIA 1H50A 2DT2A 3GDLA 3JZUA 3G1HA 1ZY9A 3FHQA 4DJDA 3WQGA 1XLAA 4AY8A 3T07A 3QRHA 3B0VC 1V3JA 1OX6A 3CK5A 4U4MA 3WLRA 5J8LA 5T8GA 1AUSL 2OEMA 3VCRA 1NIUA 5AYZA 3HFYA 1H49A 2P88A 1OX4B 3KCOA 5JMUA 5REQB 1K7FA 4MDPA 3VKBA 2G50A 4AEFA 4LUTB 5SWUA 4CQAA 1XIEA 1JZ4A 4JHMA 3LPOA 4MNKA 1F3TA 1TX0A 1SZEA 1Q6OA 2J13A 3E0WA 1H1YA 3LM3A 3TN6A 5D37A 2QNEA 4F0HA 2W0UA 3FAXA 3UZXA 3ZWTA 2DZTA 4DJEA 2OQLA 1GVIA 1GHRA 3AIBA 3M5XA 1R9YA 5C7HA 1EWEA 3LA4A 4JYFA 3QV9A 2D3LA 1OYAA 1SQ7A 3SAZA 3RX3A 1E1EA 1FHVA 4ZB5A 3BG3A 5HWNA 1F73A 3NEHA 3RDKA 3O3RA 1E6ZA 1EJWC 5HR7A 3B9NA 4BF5A 3ONBA 4L1WA 1W3HA 3GNOA 1XKYA 1WOAA 1O95A 4BWLC 1QI3A 2CHNA 3BLFA 4GIAA 2WHMA 2BY1A 2A6LA 3ONCA 3ZOAA 4HP5A 2B7QA 5CC6A 4C5YA 2IPGA 1EDGA 1OD0A 4R9XA 4WZHA 4E3TA 3LN3A 1VJSA 2O0TA 3D0CA 1E70M 1K7XA 2ISSA 1P4CA 1U2YA 4K8GA 2VWSA 3VPLA 4MOZA 4JD4A 1A53A 3FJ4A 4ZB2A 4ZSTA 5FSDC 1GYMA 4J27A 1WXJA 1DORA 1PCKA 3M46A 2DEPA 1ECQA 5TIMA 4GO9A 2ATSA 4DJEC 1BSIA 1T99A 3GR8A 5C54A 4ORIA 1J4EA 1R3WA 1MW0A 2D2HA 3V0TA 5BROA 2VDGA 2VOMA 3QBUA 5K3VA 1RY0A 1VAHA 1IZKA 1FCVA 1T40A 2PMQA 5I2UA 4CCDA 3A22A 1KGUA 3AIUA 1GOQA 1W9PA 3PUEA 4ADTA 3NTYA 1CWYA 3W7OA 3OA5A 2V5JA 4HKPA 4IM4A 3CHFA 4FP1A 1K02A 2ZZ2A 3WMCA 6REQA 2QGYA 3P0WA 5IM51 3UG8A 3ICJA 3RCNA 3RCMA 1LBMA 3SCQA 3S46A 1A5CA 2IKJA 4I9TA 3GKFA 3STEA 4XB3A 1RCXB 7TAAA 4YHEA 3A13A 4HMCA 5HINA 5ENLA 1JDFA 1WUEA 2CNCA 1W9BM 1R86A 3WLJA 1RALA 4JTLA 4GQGA 5LHEA 3WEMA 2WWCA 1U5VA 5BU6A 4B5XA 2E9MA 1QPOA 4AAJA 1XIMA 1KTNA 3VUSA 2HJPA 1FX6A 3SUWA 1EZWA 3EEGA 5CQ1A 4W85A 1JIBA 4PUEA 4US5A 1WNOA 4NJIA 2EG8A 2IQDA 1CXHA 3B0PA 3NZPA 4HIBA 4QCFA 3TNOA 4HCHA 1H41A 2VUYA 5K4XA 1M1BA 4Z17A 2V9DA 3WQFA 3WJYA 2X05A 4WGXA 1TV5A 3WLMA 3EOOA 1BYAA 4KS0A 1NSJA 4OHQA 2QULA 4J3UA 4OUEA 1NJJA 3SJ3A 2ZOXA 2V3EA 1NOWA 4QM1A 4CQ9A 2I5GA 2NVAA 1L2UA 2J47A 3RMJA 2AL2A 3EB3A 3LNPA 4JX6A 4AWEA 1TA3B 5A8QA 1VCGA 1NTHA 1J5TA 1WZAA 2FHBA 4KT2A 5IFTA 1L6WA 2GOUA 1BQGA 4XD4A 1U33A 3MPGA 1YX1A 5I3JA 4I6KA 4M5PA 4FLOA 2CLLA 3ZT7A 3GBEA 3VOCA 4Y8EA 2QLYA 1HVXA 1VYRA 3LDVA 1V7YA 5BWAA 3R12A 1UR1A 2C13A 4I9AA 1MUCA 4TXEA 3UT0A 3ZMRA 1J0JA 2HBVA 4XX6A 4BQ2A 1Q2SA 3N2BA 2B7NA 4J2PA 3TX9A 3AU2A 4BJHA 5A8OA 4RE2A 4DUWA 3NQ2A 4G1KA 3AYVA 2DZUA 1CCWB 1J6PA 5I06A 1A0DA 1AG1O 1Z48A 2I5IA 5HJLA 2INFA 4AZCB 3C8NA 2Q01A 4AD2A 1FWTA 4NXKA 2VM8A 5FD0A 4AWSA 1KNWA 2I14A 5E5CA 4XD3A 4ZR8A 3ID7A 3WELA 1KBBA 3VXGA 1XPGA 3OODA 5LA2A 4LBUA 2PLMA 3MBFA 2Q09A 3G8RA 3L2IA 4PYSA 2P8BA 3R8RA 1C8YA 2NXIA 3G0UA 5CGMA 3BURA 2RDWA 5K7JA 3UCQA 4PB3A 1J18A 1VBGA 4JQ2A 1UOZA 3SCVA 3R89A 1U30A 4DZIA 1JRBA 1QW9A 1GQNA 3RCYA 1TPB1 4JN7A 4A21A 4YTQA 4AC7C 2NXHA 2ZX6A 5D2YA 1TX2A 3TYDA 1TMQA 4MY9A 4OGZA 2BS9A 2VUNA 4IPNB 3NQVA 1ZCCA 4F2UA 2ZC1A 2QGHA 2OGJA 4O8RA 2B81A 1V51A 3E3HA 2F61A 2F84A 1LQ2A 2CZVA 1BTMA 5HJYA 2FFCA 2PTZA 3LI0A 3CO4A 2YB1A 5D30A 4EK7A 4E0CA 3TW7A 1J0ZA 1YADA 3LV5A 2EPHA 1NWRA 2VC7A 1IV8A 1UQZA 1BF6A 3K30A 3L23A 3I6TA 5CJNA 4J9JA 3GUWA 4JTUA 1ICSA 4D8AA 5DMNA 3O05A 4JTHA 3UA4A 5D9MA 3WFLA 3MDUA 2QMKA 4B3KA 1SJDA 1P0NA 3AQUA 3VDAA 3GVGA 3TLQA 3K13A 2R82A 3GYEA 3T6CA 1LDCA 1J9YA 4GI4A 1FWAC 3RF9A 1KM5A 1ITUA 4WJEA 3E02A 4GIEA 3OGSA 3ZZ1A 4NY2A 4LALA 4O19A 4BA0A 1W9XA 4G7FA 4C6IA 1OWQA 4LUYA 2VDHA 3ARXA 3O2LA 4WQ6A 4DYJA 3CUHA 5BWFA 2RGMA 3ERPA 3MC5A 1P6CA 1YXYA 4GI8A 3PZNA 2WOQA 4JEJA 5DXYA 3MBDA 3PSVA 4HMEA 1MWOA 4UUIA 1PKNA 3E5BA 5I7GA 5HR6A 1RD5A 3NQ6A 1WYIA 2GUUA 3ABOA 1K7EA 2NW0A 1E9ZB 1H11A 4XTDA 4AW7A 4IIEA 3VYLA 5I03A 9RUBA 3A24A 5A94A 1WZMA 2PP1A 4LCSA 3WQ8A 2VVNA 3T0CA 3UY8A 3FS2A 3MMWA 4IPLA 1FWWA 1RBAA 3P14A 4IPPA 1O4UA 2V68A 2Y88A 1UD6A 2PDYA 3QLLA 3BCFA 1JDAA 4PB4A 2HTMA 4JTIA 3CAVA 2DZBA 3T2QA 5ABTA 2QCFA 2V5DA 5D03A 4W93A 3ZLHA 1F6KA 4LV4A 3U4AA 1QO2A 3V0UA 2WVVB 4ZTXA 2X09A 1GQIA 2VR5A 4AZHA 3WLHA 4BHYA 3V7PA 3VOJA 1F07A 4U5KA 3PTMA 3T0AA 2R91A 4O1AA 3WUEA 1IIGA 3WH9A 4EXAA 1E1CA 2W3ZA 4LUSA 3MUAA 3THAA 3TYAA 4PA8A 1E71M 1L0PA 2V67A 3A4XA 3W86A 2VGGA 5A6BD 2AAAA 3S2CA 2WSKA 2E5CA 1KKOA 3CEUA 3DG7A 1CXIA 4F0RA 1S5NA 1OY0A 1VIZA 1EYEA 3CASA 3UZYA 3VD5A 3GH4A 3PR2A 5T9BG 1PBGA 3W37A 3H24A 2ON3A 2X30A 3OG3A 1EF3A 3GFXA 4D6IA 3N4FA 5AC8A 5JIWA 1U1HA 1CGTA 4PUNA 1RQBA 3QH2A 2EXOA 3N2OA 2J9XA 3IANA 1Y5VA 4Y9AA 1PIIA 2GJNA 1MDRA 1R3VA 4GZEA 4GUJA 1HKIA 3OIHA 2AKZA 1E6PA 1KWGA 3WNPA 3EPNA 4QJ1A 1YTKA 4UNIA 1HN1A 1EJVC 5MF5A 3EX1A 3QXBA 1TTJA 2B7OA 2JKEA 4H1ZA 2PRMA 4GNVA 3EXTA 5HMSA 4EF9A 3E5PA 1ESWA 4PBGA 5FEZA 3MP3A 4U31A 4ZE4A 1T8XA 1YYAA 4H6QA 2W79A 1HIZA 1F9CA 1IT8A 1XLJA 3OLDA 4UMCA 4MWAA 4AVOA 5B80A 4O1FA 3VO0A 3KUMA 2IKHA 2Y8VA 3THCA 2FGLA 3O6DA 3QSTA 3NQBA 4JZ5A 1UQYA 2YZ5A 5K9CA 3FVDA 1FTXA 4G8TA 3CWNA 4AIUA 1IWAA 4UFHA 4AZ5A 4NHVA 2UV8G 4YL2A 2Q02A 3PM6A 1OCBA 1MDLA 4PUDA 3QN3A 4PGLA 3SSZA 4XO6A 4XSMA 4FX7A 4KETA 5EA9A 1HXJA 3EB2A 4A3QA 5CH9A 1KRMA 3L12A 3O06A 3HGRA 2R8WA 2ISWA 4H9TA 1HGYA 8RUCA 1TRDA 1V03A 4IGMA 4PEKA 2QDDA 5JBFA 2VRJA 1FXQA 4GQBA 1G01A 1NARA 5TNVA 2YBTA 2XIBA 2ZDRA 1NEYA 4QSFA 4J1OA 1CIUA 1YIXA 5M17A 3W7DA 2JFEX 3ARPA 4MDOA 4P8UA 4FK9A 4H8NA 5EBAA 3W07A 1FUYA 2Y0FA 1JD9A 3KBMA 4LEFA 3EA1A 1MW3A 1ADDA 1HQTA 4D1JA 4MWAC 2QMJA 2ATMA 2HS6A 4L9YA 3VD3A 1V6YA 1H7OA 2P76A 2J4GA 1OFBA 2Y5EA 1QK2A 3IIZA 1HL8A 3BLEA 5BXPA 2B7PA 1HG3A 4ECLA 4E2OA 3BANA 2YCIX 4JS3A 1SW3A 4QIUA 4R88A 3W1MA 4DEFA 5EY5A 4M56A 2DT0A 3DC8A 3PVFA 1JGIA 2QCMA 4JL2A 3LY0A 1X98A 3DHUA 1O5KA 2YDRA 3QFWA 3I6RA 3ITTA 4Z08A 5F2MA 1MZRA 1OADA 3WSUA 1QVBA 2GSHA 1R3TA 4R33A 4KCTA 2ZWZA 4XTIA 1LQ0A 4BY3A 4L4OA 1KFLA 4WKHA 5FJUA 2CBUA 1KM4A 4XO7A 5MKGB 3QM3A 4FNQA 3AXHA 4OKDA 1HJVA 2BXYA 5A2AA 3CM4A 3ZR5A 2BBFA 3EWXA 2BHZA 3H2MA 3W26A 4LVFA 3M0LA 3OW1A 4S3KA 1QXLA 1XRFA 1CLVA 3TCSA 3COTA 5I09A 5D05A 3H4XA 3TQKA 5CEWA 2XJ7A 5LXEA 4FNUA 3AALA 1D3GA 1D7KA 2WSPA 5HPOA 1E40A 2KZHA 1A3XA 1RA0A 5CPTA 1H1NA 3W2KA 1UW9A 1QBAA 3MJYA 4LW7A 4LB4A 3V5FA 4O1CA 4M8UA 3O6YX 1TMLA 2QJMA 5GJNA 1VHCA 1VEMA 4Q7BA 1UR0A 3UXKA 4UTMA 3HF3A 1W0MA 3NDOA 2VD8A 3TH6A 4U3AA 3NWRA 4DXXA 5D9PA 3RM9A 3HG2A 3BMVA 4DJDD 1YXDA 4P7OA 3VZYA 3WLLA 1JL8A 4B5NA 1J11A 4KWWA 2R1NA 1EP2A 1JUBA 2CLPA 5HNUA 3INPA 3BO9A 4P5UA 4LNYA 1JF5A 3KCLA 3O63A 2NVDA 3NPUA 1KRCC 3FK4A 1EDQA 4A8IA 4DM2A 3SZ8A 2VCAA 1E56A 2VJXA 1KFWA 1WBHA 3REQB 3CL7A 4UTIA 4EPBC 3K1DA 1TTIA 4KCVA 2ZRZA 4NL1A 3AWNA 3CUGA 5GQBA 3M43A 4B2DD 3BQ5A 1J96A 3ITVA 3WK3A 2DUAA 4ZQNA 1KFBA 1U1JA 3BGGA 1W2VA 1FWCC 4DJFD 4IP7A 1H7RA 1DL3A 3QOKA 4WY0F 1BYDA 2REQB 2YFOA 4L1GA 3S4TA 1US2A 3QYQA 1MXGA 2FQIA 3RM8A 1HP4A 1IF2A 2J25A 2VR2A 3N19B 3W24A 2ONEA 5I3FA 1SFJA 2CBIA 3BGAA 3NO1A 3T0DA 2VT0A 4O50A 4AVNA 2H3BA 2EGZA 2PDIA 4CD4A 1UOKA 4MAZA 3DH7A 1C8QA 2CLKA 1TR1A 4XWUA 4A3HA 3IJ9A 3HPAA 4GCAA 3QVQA 3IJ8A 3TNBA 4FA3A 1VC4A 1SUXA 2O7SA 2Y24A 3FSTA 3QW3A 1CPUA 4JTCA 3PZQA 3WO8A 3LHWA 2FIQA 1V8EA 3SCNA 2GVLA 3PZ9A 3EOUA 4XZWA 2P0OA 3VUPA 2A3AA 3UF9A 4MUPA 4A3RA 1UCWA 5U7SA 2Z2BA 1FP8A 2EEXA 2P1FA 3ITLA 2BOFX 3QR3A 1PKMA 2WPBA 1YHTA 4O53A 2XIMA 3AS3A 4RK8A 2PWHA 3WDPP 1QUMA 1W1B1 3WLQA 2TODA 3WBYA 3B97A 3CXOA 4H6RA 2PCEA 2BP1A 3N13A 1QRQA 2OSWA 1W37A 3QTGA 1XC4A 4QLJA 2J7DA 3RLGA 2CESA 2XVNA 1FA2A 2FTYA 2FFIA 4H41A 4EXBA 3ZIZA 1MI3A 1P43A 2G3IA 3W1PA 3TOYA 4MIMA 3B8SA 3HU7A 4OBSA 2EHHA 3W7HA 2XZ9A 3VZXA 1G69A 4CD7A 1QMLA 3E12A 2BXZA 3NR0A 1QATA 1R6WA 4I9JA 3OIXA 3MVTA 2NLYA 3BOXA 2CC0A 4V28A 3WJWA 5BZAA 3S1WA 2XISA 1XG4A 2C15A 1A3HA 4Z2IA 1VFMA 3W29A 1E15A 4V1YA 1AD4A 1C29A 2NUXA 4QROA 1KXQA 3VD9A 1EOKA 4F8XA 3TYEA 2PTDA 1GKPA 3AXKA 2PGFA 4YLWA 4YYCA 1ICQA 3N4AA 2Y2WA 3DUGA 3A9IA 3R0DA 4F48A 4NAEB 4L56A 1Q6DA 1HKVA 1VZWA 2QJIA 4Q4OA 2Z1SA 3WH5A 1K6WA 5FJJA 3VMPA 4LUIA 2Z1XA 3VTRA 4Q8MA 3B06A 3W23A 1I2QA 3UG4A 1NY1A 4J35A 4JICA 2XVLA 1RQHA 1CTNA 2VEKA 4KRTA 3NNTA 1AQMA 1Y8BA 4JDBA 3VINA 2TPSA 4FX6M 1RV8A 3RLHA 3LERA 4I5RA 3AIRA 5G5IA 3W25A 3ABZA 2QPSA 3BSGA 1NDZA 4IG2B 2X1SA 3GZAA 4WJXA 2QS8A 1O94A 3G6MA 2E8YA 2VFEA 5JBDA 1I9CB 1XF0A 3W7IA 4ZVJA 3GWQA 2RKXA 3BAXA 5EB8A 4HNUA 1ITXA 2VFIA 4LYKA 1UPPA 3G0XA 2CLFA 2CKRA 4IFKB 1POKA 3BL3A 2CPUA 1V08A 3RR4A 4GVIA 1PDZA 1JI2A 3TONA 3CV1A 3MVIA 3NJ3A 3IGHX 4PMZA 2QCDA 4S2CA 3VM5A 3KZSA 2WNZA 2A4AA 2GVEA 4IL0A 2A6NA 4HGXA 3NL5A 1J93A 1JGMA 2QCEA 4XQ6A 2WNWA 3AZTA 4H7CA 3EWBX 1K77A 2ZXBA 2CLIA 3KM8A 1VLIA 4FF7A 2WO5A 2C1HA 1OYBA 2PBOA 3UWWA 2ZWYA 1XC6A 3K46A 4Z1YA 4FO4A 1D2KA 1D8WA 1X96A 3PSWA 2PWDA 4TMBA 1S38A 3KVMA 5FJIA 3NM3A 2YXXA 3L21A 4XBKA 4FXSA 3II1A 4IX0A 5BXRA 1PZ3A 1XYFA 3IPWA 1V3MA 3DFSA 1FOBA 4GJIA 3FJLA 3VNDA 3NL3A 2ZUVA 1MEWA 1D9EA 3DYOA 4IIHA 1LRNA 2CLOA 4QHRA 4HSNA 3RLVA 1C90A 2WZMA 1GOMA 3C0JA 1E9IA 4HT3A 4XD6A 2O4QA 1EIBA 4HZMA 2IQTA 2I17A 3CQ0A 4H04A 4KCUA 2PZNA 4UCFA 4DQWA 2XPKA 3OVRA 2WZTA 3CZ8A 4HU4A 3CUJA 3R0KA 1P7TB 1LL6A 3GDKA 1Z3NA 1BWVA 4BEUA 2QJHA 5E6YA 4HNCA 2UY3A 3GXIA 3K4AA 3AXXA 2HBXA 1VCFA 1VKFA 4NKCA 4AZGA 3G0SA 4JIPA 4N9BA 4D6GA 3MJMA 1FWBC 4MTVA 2NQ5A 1XIHA 1BKHA 3UESA 3BMXA 4QG8A 2PE4A 2AOSA 2HNEA 1KRBC 1OX5A 2UWFA 4JN8A 4PULA 2WCAA 4YIWA 1YBQA 1PYFA 4HJFA 4DO4A 5TF0A 5HNTA 4RXGA 3NPWA 1XBYA 4KWUA 3FKRA 3Q67A 4FNPA 1JZ3A 1F61A 4UR8A 4XAZA 2VZUA 5IHRA 3GS6A 4B4HA 2PUZA 3CZJA 1P5BA 1Q6RA 3TTOA 3LNMA 2FH6A 5FF0A 3HMCA 4QG9A 3LRLA 1PX4A 4C6BA 1US3A 3H2CA 1Z41A 3Q94A 1TV7A 2Y63A 3QLDA 1MQQA 2PDBA 1OGGA 3C2OA 1XDJA 2ACQA 3KBNA 1REQB 1JYWA 2CKSA 3BCDA 3ANVA 1AMYA 2A1YA 3SQMA 3W0KA 2E4TA 1C92A 2INEA 3OBAA 2GQ9A 4FNSA 2D73A 3UEQA 4HPHA 1Z42A 3RRAA 1Y5XA 5G2WA 4H8VA 2VD9A 4MJ4A 3URQA 2NQHA 3M0KA 3E96A 2AMXA 2AAMA 3NQEA 1L2QA 4P61A 3ZQ9A 4H7ZA 3EKLA 3RRXA 5A2BA 3C0QA 4MVAA 3R11A 3S1XA 2BY0A 2BTMA 1I2PA 1RD6A 4WUIA 1I2NA 1K9EA 3B40A 3P61A 1O6IA 2PU0A 3VGGA 4OZOA 1R7OA 3EXSA 4L9XA 3LQGA 2YJQA 4JBRA 3CS2A 1VPQA 2OYLA 2GSJA 1X7FA 3QC0A 3DYMA 4F0LA 1V3HA 3VABA 3MHFA 1FWNA 4PL2A 4QEEA 4KPLA 3STCA 1CW2A 2CYGA 4QDPA 3GIYA 4FEZA 4IT1A 4ALDA 2PWEA 2YLAA 4LBSA 4I7VA 4PEEA 4MJZA 4WXYA 1G67A 3RJYA 3VNLA 1QOQA 1MRQA 1RPXA 3P5ZA 1FWIC 1ZP4A 4JFSA 4C65A 1FDZA 3VDBA 3DBNA 2IPWA 2CETA 1EGZA 1K8XA 1QJWA 4RX0A 3T55A 3PTQA 4DB7A 1XHGA 5EKYA 3HPZA 2PU1A 4M51A 1XH0A 5G4WA 2FGZA 4IPJA 1JULA 1RK5A 3VIGA 1ZGDA 2J8TA 3OTRA 4HK7A 4N02A 3WN6A 1R9XA 4MPKA 3UR5A 2RDXA 4OWGA 3MZNA 3GFYA 2QEZA 4YCOA 4JCLA 2GGHA 2E25A 2DZPA 1MNZA 1ZL1A 3ZR4A 1M7OA 5G1MA 1ITCA 1UP3A 2OWXA 1UBPC 3GC4A 2J7FA 4QE4A 3BG9A 3R13A 1EA9C 1HUVA 1M03A 1XIFA 3GW0A 5DRCA 4ZO9A 2Q6ZA 5HWJA 3PBMA 2Y89A 4BR1A 2PDWA 2Z4GA 3W02A 3QGAC 2HK1A 1CYGA 4AHQA 1QW7A 1H7NA 4N2YA 1GOXA 1W17A 1DWHM 1LUCB 3UFYA 2G0WA 1PVNA 2J7GA 2QCCA 4Z2GA 1J2BA 2Y70A 4JQAA 4O0ZA 2RUSA 4UC5A 2YCJA 3N29A 4NRRA 1TPC1 5LYRA 2ZRXA 3V35A 2XUCA 2Y5SA 4YCPA 4I8YA 4FB7A 4LOCA 1UC4A 1W6TA 3GHSA 2QUTA 4GUFA 1DWIM 3RNDA 1AFSA 3BLOA 4HD5A 4B9ZA 3HJZA 4ZO7A 2PI6A 1GVRA 1IT0A 2VC5A 2D23A 3QHNA 3VMNA 2HPIA 1VBJA 3MO7A 4Q8WA 1JNDA 3HGOA 1IXPA 4IMEA 4M7TA 1B4EA 1BYBA 2FZ8A 5D2VA 2VNCA 4J2MA 3LPFA 3TWAA 5C9RA 2XFWA 3F2CA 3TC6A 1AW1A 1W3JA 4O12A 2YL9A 1EXPA 2JIWA 3CQKA 3AMKA 3WX7A 1XG3A 1JYNA 3AHTA 3SSJA 2GQ8A 4YTSA 4MFDA 1QPNA 5GJMA 4OBTA 1NDVA 1EP3A 3N9SA 2A2IA 4L6DA 4F2BA 3CIXA 1Q7ZA 1KO0A 3MKCA 1MO0A 1NDYA 2TYSA 1XIBA 5FIPA 4ZENA 3RPDA 1M7JA 1IGSA 5DANA 2A5HA 1L8PA 3L4UA 4CQBA 1UD3A 1J79A 2W5FA 5H8MA 1FH9A 3MI6A 3W2JA 4GNKB 1NF0A 1RJRA 3W4RA 4ATDA 1YDOA 2GJXA 1O5QA 3VKCA 4ES4A 1XJBA 3AFBA 2PWUA 3PBWA 2QDHA 4LNCA 4PTWA 1EX5A 1ZJAA 1IGWA 3WFAA 4URIA 2CBVA 3LLXA 3TYCA 3VDCA 2EPNA 5FF2A 1OBAA 1RCOB 3BOLA 2WNNA 2YW4A 5CPLA 1UZ1A 3NYDA 3ZSSA 1XD0A 1H61A 2XH4A 4DF2A 1M9HA 1K9FA 2PSNA 4IMFA 3STGA 3G5EA 2O9PA 3KBJA 4JTAA 4Y2WA 1E0UA 5LXXA 1QCWA 2AQWA 1GUVA 3U0HA 1OT2A 3HG4A 2H8XA 3U9IA 5F2LA 2YPIA 4XUYA 5LIYX 5LZLA 3MYPA 1JYVA 3C4UA 2VC6A 2NXGA 3PS7A 3RGTA 1E4MM 4QNWA 5CC5A 4F0MA 1W5QA 1SFTA 1OC6A 2XVGA 2Z26A 1ZBWA 1ONWA 4YWSA 3PN8A 4FR1A 4NJHA 4UMAA 1A3WA 3N17A 2XVPA 2QPUA 1XLFA 3P62A 2TRSA 1YE4A 3H7RA 1VBHA 2OZ8A 5KSWA 4IOTA 1LF1A 5TBOA 1R87A 4HJWA 1W1ZA 1L6GA 3CTLA 4UTUA 2DZAA 2PS2A 1W56A 4JR5A 4NASA 3UWVA 2DGAA 4X9YA 4KEUA 5ABFB 1XX1A 1ISXA 2DP3A 1OC7A 2TAAA 4PUMA 2F38A 1XL9A 1XLGA 3TZFA 3EWCA 5AHMA 3H54A 1TWIA 2BB0A 1R2SA 5I23A 3UWQA 4YXGA 2RDUA 7CGTA 3M9YA 2E68A 4X61A 1UPMB 1AL8A 1D7FA 3FV9A 1TCMA 2PGRA 2GJPA 3W9ZA 4DN1A 4DPQA 5JU6A 2ALRA 3SW6A 2OYMA 4JIEA 3XISA 1TTPA 3C52A 4ERGA 2QPXA 1EBGA 5D32A 4HYRA 3R58A 2E40A 1B3OA 3GC5A 3IUDA 4AU0A 2YR1A 1WKEA 1DJIA 3T9PA 1EL3A 1A4LA 3S8HA 2DVUA 2FPTA 2A3CA 4GGBA 1I2RA 2WAGA 3THDA 1DVJA 3G1VA 4IIFA 4L64A 2VKZG 4A8LA 1BFNA 3ARVA 1EPVA 1VR6A 2GQ3A 1FWJC 1NELA 1XCWA 3ARSA 3STFA 2G5WA 5FESA 3FIGA 4CNTA 4FXJA 1EEXA 3SRFA 1DWAM 1QNSA 1T5AA 1H0GA 3EOSA 6ALDA 4Q6XA 4XIMA 1XCFA 3UYIA 1ISWA 2EQDA 3ARYA 3GH7A 3LK6A 3M7SA 1W3IA 2RGLA 4PUWA 5CC7A 3VE7A 2D2GA 3KTSA 1GQKA 3PUDA 4CU7A 3H7VA 2A3BA 2NSXA 3O1NA 1DQWA 1XSIA 1ZAHA 3EX6A 1ITQA 3KOXA 1J6OA 1PO9A 4B4FA 2DPEA 2DH2A 1D3CA 2B31A 4AYSA 5HNRA 2VO5A 4HU3A 1EJRC 4AIEA 3H2FA 2ZZ3A 3P82A 3UXLA 1WXYA 1UR9A 3SGZA 4BQ5A 5GNYA 4R34A 3P80A 1XW8A 4Z2LA 1C8VA 4OBRA 3AHXA 3VOFA 5DMMA 2WMKA 4QR6A 1KWKA 1M68A 3NXFA 3NQMA 2FGBA 3UGVA 5FL1A 1NH6A 5HATA 2Q8XA 2V30A 1IHIA 3LRMA 5LNVA 4JHZA 1TIMA 3QGKC 1ZTVA 4XAPA 4K36A 4O54A 2XDFA 2BY2A 3HIJA 3VFCA 2G8ZA 4F0KA 1JQXA 4M19A 3CL8A 2VTFA 1XFBA 4GVFA 4JY8A 4AD5A 4RR4A 1V3KA 1VFSA 4XV0A 3LBMA 5BCAA 2ZDSA 1XLIA 2XVKA 2OZ3A 1YNYA 5FCZA 3AYSA 4D6EA 1DEDA 2AQOA 2H6RA 3N11A 1CXKA 1K1DA 3PPCA 5H8PA 2GZXA 3LHTA 5FF7A 1DTNA 4M3PA 3ARUA 3C56A 3BSMA 1DKWA 2CERA 1UUMA 4TV5A 2D1ZA 3KS5A 4DZ5A 3GNDA 5GPRA 1E3XA 4DBSA 2FH8A 2YCLA 2E1WA 2WVSA 5I00A 3OBEA 3M64A 2ZZ7A 2DQXA 4MB3A 3NQGA 2DUZA 2KAUC 3U2ZA 4BI5A 4RZ5A 3PPHA 1PWLA 5JH2A 2BMBA 3ZVHB 3UXIA 3P67A 3VKJA 3SRDA 1CGVA 3QW4B 2WNQA 4XKYB 2V3FA 1ZAIA 3NVTA 5T26A 4LB3A 3H2OA 4O14A 4OVXA 3SURA 1IEVA 3PBYA 5A6SA 2P8CA 2PF8A 2Y1HA 3T4CA 4PMDA 3L0NA 3UZJA 3TFXA 5LIKX 4XZNX 1H60A 1G0CA 4UFJA 5FAGA 3VOGA 1A47A 3QHMA 4OFCA 2WQPA 3N2XA 5BOOA 2CIPA 3NSXA 4UFMA <