1T40A

Crystal structure of human aldose reductase complexed with nadp and idd552 at ph 5
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
316
structure length
316
Chain Sequence
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldose reductase
publication title The crystallographic structure of the aldose reductase-IDD552 complex shows direct proton donation from tyrosine 48.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2004-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1t40A00
2PDIA 3V35A 3GHSA 1Z3NA 3R43A 2PF8A 1AZ1A 4XZMX 3UZZA 1EXBA 4FAMA 2PD5A 2WZMA 4YVXA 4LAZA 3D3FA 1MZRA 1SM9A 2PZNA 2C91A 1X96A 4JTRA 3S3GA 4EXAA 2PDHA 4JIIX 3WBYA 4XO7A 5JH2A 1GVEA 2FZBA 2WZTA 4RPQA 2VDGA 1R38A 3V0UA 4L1WA 1AH4A 3UZYA 1C9WA 4XVDA 1M9HA 1A80A 4I5XA 3COTA 3R6IA 4EXBA 2PDFA 4ZFCA 4Q3MA 3R58A 4GQ0A 3LN3A 2BGSA 2PDUA 4LAUA 3DOPA 3RX3A 4XAPA 3BV7A 1HW6A 3N2TA 4DBWA 1XJBA 4MHBA 3UZWA 4PUUA 2FVLA 3B3DA 2F38A 2IPJA 2J8TA 2DV0A 2PD9A 4WDUA 1PZ0A 3R7MA 3C3UA 5LIKX 1FRBA 4LBRA 2PDLA 2ACQA 4JIHA 1EKOA 3LQLA 3VXGA 1LQAA 2ISFA 2PDXA 3U2CA 2PEVA 1LWIA 4GABA 2FGBA 2IKIA 2PDKA 3CASA 4WDXA 4XK2A 4IJRA 1ZGDA 2DUZA 3BUVA 3WG6A 2QXWA 4NKCA 2PDGA 4QBXA 2CLPA 3WBWA 3FJNA 4PRRA 2PFHA 1J96A 3O0KA 1AH0A 1QRQA 2INEA 2I16A 3NTYA 2R24A 4DZ5A 5LIYX 5AZ0A 1RY0A 1Q5MA 3RX4A 2INZA 2AGTA 1Q13A 3M0IA 4GACA 4XVEA 3BCJA 4F40A 1T41A 3UGRA 1S1RA 4JTCA 2PDPA 2ACSA 2F2KA 3LZ5A 5LIUX 2DUXA 3CV6A 3R8GA 3MB9A 1K8CA 4GIEA 4Q7BA 1VBJA 1XGDA 1MRQA 2PDYA 4JQAA 3V0TA 1IEIA 3ERPA 4XZHA 3UWEA 3V0SA 2PDNA 1X97A 4DBUA 5LIWX 2BGQA 2IPGA 5HNTA 2ALRA 3CAVA 3UP8A 4XO6A 3LZ3A 3G5EA 4WDWA 3DN5A 4ASTA 4GQGA 4QX4A 3BURA 3LEPA 3MC5A 3LNMA 3M4HA 1YNQA 4JTQA 3F7JA 4GA8A 1X98A 4FZIA 4XZLX 2IKJA 4JQ1A 1PZ1A 1VP5A 2PDJA 2P5NA 1US0A 2HE8A 3QKZA 3EAUA 3H7RA 4WDTA 4PUWA 2IQ0A 5HA7A 3GHRA 4QXIA 1Z89A 3CAQA 4G5DA 2FZ8A 3GHTA 3CV7A 3P2VA 4JQ3A 4JTAA 4ICCX 4WEVX 2A79A 1S2CA 1EL3A 4YVPA 4JTDA 4XZNX 2IKGA 2HVNA 3EB3A 3UYIA 4YU1A 4LB3A 4XZIA 4H8NA 4QR6A 3T42A 2HEJA 2IQDA 3WBXA 2HE5A 3H4GA 1S2AA 5C7HA 3GHUA 4OTKA 3M64A 3KRBA 4DBSA 3RX2A 3CMFA 1HQTA 1RY8A 1Z8AA 1MI3A 2NVCA 4FA3A 4AUBA 1OG6A 3LBOA 2R9RA 4JIRA 3EB4A 5KETA 1XF0A 2IKHA 2PDBA 2FZ9A 5LIXX 3GUGA 1IHIA 4WRHA 2ACRA 1AH3A 4R9OA 2IS7A 2PDQA 3FX4A 3UG8A 4YVVA 5M2FX 4PMJA 2IPWA 4L1XA 1Z9AA 4WGHA 1RALA 1UR3M 3N6QA 4HMNA 1AFSA 1PWLA 1ZUAX 3R94A 3LENA 5JH1A 3ONBA 2HDJA 3G1RA 2IPFA 1EF3A 4LB4A 2HVOA 4IJCA 4JQ2A 4JQ4A 4H7CA 3UFYA 1ZSXA 3WCZA 3H7UA 2PDWA 1T40A 2BP1A 4FALA 1YE6A 2FZDA 2NVDA 2PDCA 3O3RA 1ZQ5A 2ACUA 4LBSA 3LUTA 4GCAA 3LD5A 5AZ1A 3R8HA 3ONCA 4PR4A 1YE4A 3Q65A 4IGSA 1AZ2A 1S1PA 2PDMA 4HBKA 4YS1A 2I17A 1YNPA 1ADSA 3V36A 2HV5A 4PRTA 1PWMA 3LQGA 5DANA 3UZXA 5HNUA 1JEZA 1QWKA 3Q67A 1PYFA
chains in the Genus database with same CATH superfamily
1Y5WA 1ZPTA 1AW5A 4NNBA 3UD6A 5FJOA 4Y8EA 4M3PA 4MVAA 3EKGA 3VA8A 4AZ7A 1GNXA 4LVAA 3RM8A 3UA4A 3SY5A 3VGHA 3RMJA 1JDEA 2FIQA 3WDPP 2DIKA 3ITOA 2HWGA 2FVMA 2VFIA 1A5NC 2UY3A 3HPSA 2ZE0A 4BWLA 1QHZA 5AYZA 1UR2A 1R38A 4UTHA 1U83A 2WJZA 4AZ5A 5LHFA 3BG3A 4HPJA 3VIMA 1A5SA 4JIPA 2J7CA 5EFDA 4EXBA 2PGWA 1FH7A 3NGJA 3ITLA 3FOKA 3NZQA 3P80A 1AQHA 1CLXA 2BGSA 3BAKA 1FWGC 3HQ1A 3BV7A 5AECA 3JR2A 3TYCA 2NUYA 3WK3A 2EJ1A 3S6TA 5I6SA 4MHBA 3VX1A 3TVAA 4PTNA 5I00A 4IFOA 1E56A 3ANVA 2QCDB 2Y4SA 3DHFA 1DHPA 1H0GA 4P7RA 2RH9A 1RPKA 4LBRA 3SRHA 2QT3A 4PCTA 2ACQA 3QKEA 2DJXA 4QSHA 3WLOA 5KZ6A 3QMSA 3BZJA 1EA9C 3EX4A 4UIOA 1J0YA 2ZA3A 3DG3A 3SCVA 3N34A 3BAWA 3CB3A 3JRKA 4FR1A 1SJAA 2ISFA 4MGGA 8XIAA 4ATDA 3LBCA 2Z00A 4A2SA 4US5D 1FHLA 4GIRA 2ZVIA 1E5NA 1NEYA 4C6IA 1O66A 3L0GA 3BH4A 1P0NA 1FDJA 1VFMA 4KEMA 1L8PA 4UFKA 1WXJA 3NDOA 4MJ2A 4D6JA 1HTIA 1JD7A 4H83A 4QJ3B 1SZRA 2HNEA 2E67A 4NG3A 1UWTA 3MUAA 1IT8A 2I16A 3WBAA 3AUJA 5A6TC 1CXHA 1TKKA 5IFTA 5I23A 3K8LA 5HQLA 1ZP3A 1RY0A 3FA5A 1Q5MA 1V3IA 2AGTA 5EMJA 2G0WA 2FKPA 3W6MA 1OQFA 2OSXA 3BSMA 4IMFA 4ZTYA 3KWXA 2XH7A 3WD4A 1XUZA 1W5OA 9CGTA 4V28A 3CZLA 1W9XA 1M7OA 1TQXA 2VGBA 2DZWA 2XINA 1WKYA 4UTMA 4LRTA 1FXPA 4A3HA 4L4MA 3EOEA 1TYGA 2WVVB 1XGDA 3TJ4A 2G4JA 4G2DA 4CNSA 5A1AA 2ISVA 3L68A 3C52A 4DBUA 3O2LA 4OWGA 5LIWX 2BGQA 4AH7A 3TLQA 5A6LA 4WDWA 4EAYA 4IL0A 3K1GA 3MPGA 4JTIA 5F4XA 4MMWA 3A64A 3NWRA 4E4PA 3URAA 1S46A 1RCOB 4GK8A 1IR1A 3VILA 1BLIA 3GG7A 3RO6A 1N8WA 5HNRA 1K8XA 3ARPA 3PSWA 4XZLX 5I0DA 5CGTA 3O16A 3UCDA 2EPLX 1OIMA 4LEQA 3D0CA 3IRSA 4L9ZA 5AVNA 2QDHA 1US0A 1TO3A 1FP9A 3AIBA 5HMDA 1W5QA 2RDWA 5DQPA 4BKNA 2QR6A 2C3ZA 2H6RA 3KOXA 2BV9A 3T9PA 2BSLA 3DGRA 3EYPA 2NQ9A 1BQGA 3QV9A 1DJHA 5ABFB 2Y24A 2PWHA 4DO5A 3VKDA 4IQLA 1BTMA 2IMRA 1Q65A 2NXHA 4U28A 1BF2A 4RL3A 2H8ZA 5DY3A 2HEJA 1J18A 1XXXA 5BW6A 3NO5A 4IG2B 1DJNA 4J27A 4E8GA 5LYRA 1XLFA 1NELA 3SCPA 3VIPA 4Q8TA 3BLOA 4KKXA 3ID7A 3FDKA 1F6KA 2DVUA 3CL6A 1TA3A 4KESA 3CTTA 2BVDA 3WZ0E 3BLLA 2QAPA 2QIIA 3W22A 1J2BA 4MUZA 3S47A 1NM9A 4GGBA 3KZSA 1R8LA 5E6ZA 1OC6A 3W25A 4Q8WA 2CHNA 3RPDA 3UG8A 3VZZA 3ABXA 3NYZA 3LCGA 1NJJA 3W7CA 4DIAA 1Z9AA 5DEZA 4I7VA 1RLDA 2VNCA 4NAEB 3BE7A 3N19B 4LB4A 3W1QA 3WQVA 4S38A 3VNJA 1M7XA 2WCAA 1KKOA 3Q58A 4FALA 5HUPA 1OX6A 3GTXA 1MW0A 2RJGA 2B7PA 2JKPA 3L4ZA 1X7IA 3VABA 3CAWA 4NVTA 1W3LA 4UUIA 1O68A 2ZUNA 3LBMA 4LALA 3E02A 3WNKA 5K4XA 1D7FA 1RD6A 3REQB 3NQEA 4RW3A 4JAWA 1P1MA 3KOWA 4AMCA 3L4WA 4GLEA 3VNYA 3ATZA 3ZSTA 1UIPA 3GC2A 5GNZA 1JEZA 3V18A 4LW7A 3Q67A 2EAWA 4Q8MA 1E0WA 4H9TA 2H8XA 1M6JA 4DNHA 1YBQA 2YR1A 3NPVA 1WKEA 2CLHA 3M47A 1LM1A 1ZJBA 3EOSA 4S39A 2QCNA 1ADOA 3G1DA 2DPEA 5CCZA 3LA4A 4D6CA 4DO4A 3UPBA 3CQHA 3OLDA 3W1TA 3ITVA 4H9ZA 2C1HA 3WF4A 4P8VA 4US5A 5D4YA 2WNZA 3N2CA 4IQDA 1KR1A 3AFBA 3ARXA 3M0VA 1UWQA 2OMAA 3UWWA 2YBUA 5BZAA 1ESWA 4B9ZA 1BKSA 4M51A 4ZFCA 1LOSA 1ADDA 3R58A 4IIBA 1YQ2A 3I6TA 1ZU8A 5XIMA 5FAJA 4L80A 3VIFA 2REQA 5A8PA 4F2BA 1TUXA 1PIGA 2Q6ZA 1G01A 1TJ2A 3U4AA 4TVCA 5FI8A 2PWDA 2ZXAA 3ZVHA 3NZPA 4JTJA 2BX7A 3BJFA 5SWUA 2B7OA 3T07A 1RV8A 1QNOA 4ZMGA 1L8NA 2WMIA 1LOQA 4RPPA 2V68A 1D3GA 3ZSSA 4ZENA 1OFEA 2D73A 4GC3A 2YKKA 3W76A 1RJQA 4EK7A 1LP6A 1WXZA 1PZ3A 2PDXA 1XLLA 5CXPA 1JYVA 2Z2AA 4Z1DA 4ADUA 4KIEA 5HR7A 3DBNA 2GK1B 1VBRA 1JDAA 3PG9A 1Q2SA 4ACYA 1KXVA 1X6LA 2OYMA 5H8UA 2YFNA 2QXWA 4NKCA 1HJVA 4P8XA 3WBWA 4A8IA 2O9OA 4O1AA 3JZUA 4E38A 1KFJA 3GBEA 1TRDA 5LIYX 4TUFA 3HBLA 3WJSA 5HK4A 4OE7A 3P6LA 1E1EA 5FJPA 3SM0A 4BCEA 5FIPA 3TTYA 4DM2A 4ZOBA 2CLOA 3LLXA 1T41A 4Q7NA 4AQLA 1Q63A 4QE1A 2E5BA 2Q3OA 1VIZA 2HJPA 3O8AA 3QVQA 3QR3A 1BWVA 5T26A 5F7UA 2PP3A 3S2MA 3BO9A 1YADA 4PUDA 5C6MA 3EOLA 1FX6A 1HKMA 5FSEC 3SQSA 4XWUA 2D0HA 1HL8A 3AIQA 1CBGA 3UNTA 1EYWA 3LZ3A 4J3ZA 4NZ1A 3CWNA 4M82A 1SFLA 2INFA 1JNDA 3FCPA 2PU1A 3WD1A 2RAGA 3CTLA 3BGAA 4ZR8A 2KZHA 2QJIA 4UR8A 1OCBA 3VKKA 3TTOA 2RGMA 4YNGA 2A3AA 3VAVA 1I9CB 1ZBWA 4U10A 2OG9A 2DZUA 4B92A 3H24A 4C6JA 1EUNA 2ANUA 1H7NA 4IP5A 2HRWA 2RDUA 3DYMA 1PX3A 4GI8A 4IXHA 2A3HA 1EGZA 3GH4A 2BXZA 4D8ZA 1OT1A 3S1GA 1VP5A 1E6ZA 3ARUA 1A3WA 5E6YA 2X2YA 1SFSA 2CWNA 2EG7A 4LWWA 2OEJA 2UWFA 3PJXA 3B8SA 1WOAA 4PMOA 3UG4A 3WMSA 1DVJA 4KETA 2ZZ6A 3EEZA 2YPIA 3BW2A 5I3HA 3THAA 3SUVA 3CQIA 5TIMA 3QV8A 2GWGA 5DMNA 5DCEA 1HNYA 2PZ0A 2OELA 2H3BA 3EBVA 1UH2A 1XIIA 4WEVX 1VEMA 2HBVA 3H2AA 3O6CA 1U30A 3W26A 1HJXA 4GVHA 3ES7A 1SO5A 3N1AA 4RXGA 3FYPA 3O63A 3P5ZA 3VNZA 4WOQA 2P8BA 1H7RA 2VFEA 1UR0A 2FVKA 2PRHA 2NZLA 4UTUA 1PVNA 4M19A 4WVXA 4QAWA 3N3MA 3UWYA 3MANA 3NSXA 2DSZA 1ELSA 2VC6A 2OEKA 4AY7A 1Q6FA 5M03A 3SDOA 4KGLA 1H49A 1MQRA 1KM2A 4AUBA 4O1BA 5E0FA 2R9RA 5D30A 1JUBA 3M7WA 4EX4A 3BAXA 1VYRA 1XH0A 3C2RA 3OZMA 3TTQA 4GZJA 4Z08A 1UQYA 4R9XA 2XG9A 1YMYA 1QI3A 4FXSA 4NZFA 3NEVA 3THUA 3QZ6A 4L1XA 3EGJA 5DN1A 5D09A 1AFSA 1GEQA 3BXWA 1J0ZA 1K7FA 3LENA 4MB1A 2IPFA 1N55A 1TR9A 1UKQA 1HKJA 3LTSA 7REQB 5CBIA 3N9KA 3WLJA 4EP8C 2EG8A 4JFUA 2FJUB 3ZYZA 3PULA 5FD0A 1L6YA 4M1BA 2OT1A 1BTCA 3H53A 1A53A 3U3HA 2W63A 4I5UA 6PTDA 3ONCA 5FL0A 1E72M 4UFLA 4GH3A 3P0WA 3HTWA 1MQQA 1W9UA 3VM7A 3W7JA 2Y7FA 1OX4A 4FOUA 3E5PA 3CZ8A 1XD0A 2CLIA 1DYSA 1A0CA 4XBJA 5HNUA 1BYCA 3R79A 5K9CA 1GVFA 3PF3A 3VGEA 4C6DA 1CI1A 4F8XA 2PLJA 2WMHA 2PDIA 3WLHA 3EOUA 4F66A 3NQVA 4CEUC 4PMNA 4ZQMA 3PBVA 3BV4A 1WQ5A 3JUGA 4IUOA 2W27A 3RCYA 2VO5A 1NH6A 1FHDA 4JTRA 1T0OA 1UUQA 5BMXA 3WLSA 1ME7A 3W00A 3CUZA 1BAGA 5KZEA 3TTEA 3IUHA 2OODA 2B0MA 1JYNA 1JDCA 4C6PA 3N9SA 4CU7A 2Z27A 4GINA 3KOYA 3W86A 1IXNA 1EFZA 1RR2A 2VZVA 3UZYA 4XVDA 4JN7A 1E6QM 1FHUA 3C2EA 2ZICA 4GXPA 5HQMA 3L12A 4B4FA 3INPA 1X1ZA 2OSWA 3PC0A 1OF6A 1P4CA 4MNMA 4IWWA 4C6BA 1BKHA 3MJMA 1BG4A 1LROA 4IISA 4XAPA 3LPPA 1W3JA 3E49A 4GXWA 4Z1AA 3GDLA 1B3YA 5CAHA 1VD6A 3O05A 3UR5A 4YJ5A 3WEZA 3BSGA 1EB3A 2C1IA 4XD5A 3IJ8A 3GDTA 4AU0A 2VGIA 4WDUA 1MDLA 3IAQA 3PZIA 3P60A 3K4WA 1XGZA 1X8CA 3IIXA 2FB3A 2CHOA 1KGXA 4MFDA 3WDJA 1UP3A 2NV2A 3FW6A 5H2ZA 3LQLA 4DAIA 2VEMA 4QJ4B 3N13A 4FMVA 1KBKA 1V5XA 4AZBA 2WANA 3W4RA 3EEGA 3N25A 3AIUA 5LA1A 1KM1A 3A22A 4W89A 1NWRA 1A3XA 3AI0A 4B4HA 1CT5A 4NRSA 8TIMA 4IJRA 2VOTA 5IHRA 3XISA 4F48A 2DUZA 1HKVA 2P1FA 1U5JA 1GKRA 2XDFA 2CLPA 3P7YA 4FSAA 1R3QA 3N4AA 5DF0A 1OJXA 1IT0A 2J4GA 4PMXA 3OG3A 4DB7A 3TW6A 3DFOA 4GPNA 4IMGA 5H8MA 2OLSA 2QJHA 2AAMA 3QGVA 3AXKA 2EPKX 2BVYA 5BRBA 3BCJA 2VYOA 4LBUA 1LG2A 2X1RA 2Z29A 2VFFA 1JDFA 2JBMA 1UUOA 3CPRA 1RCQA 2OB3A 3R10A 1W31A 1QI5A 3GDRA 1S1RA 1E6PA 1VYPX 5D33A 1MW1A 3LZ5A 3SUSA 1E4NA 1JFHA 2J62A 5LIUX 4CQBA 4TX6A 2BASA 3AHVA 4LUYA 4C6OA 2Z6IA 4GX8A 3WENA 4Q8OA 2VDIA 1JXJA 2IXVA 1WO2A 4LUTA 2CFFA 2CBIA 4Q33A 2QPXA 2WVSA 3WFLA 3VO0A 4V33A 3W84A 2YYUA 4JL2A 3QYSA 3KL0A 1BRLB 2C79A 1KBLA 3UERA 5F1VA 1KFEA 4WY0A 3UWVA 5CEWA 3GFZA 3H2EA 3ITGA 4JICA 5LNVA 1TWZA 2X42A 3WQ8A 4MPQA 1KWGA 4DM1A 5FL1A 3HJZA 1CXFA 1G0CA 3EDDA 2O7QA 2Z28A 3TQ0A 3NUKA 2ZXBA 1EJWC 1OD8A 4JY8A 1X98A 2QLYA 3MT1A 3WQ4A 4NYUA 2IKJA 4IF2A 1FVPA 3OGSA 4W8LA 2PF0A 4GE8A 4PTWA 1B4KA 1B57A 1WDPA 2A7NA 3LTPA 2QJJA 3ES8A 4XSMA 3V75A 3FYOA 3C61A 4GNJA 1EF2A 4PUWA 3PSVA 1KQZA 4DXVA 2V30A 1QPRA 4GHRA 2NT0A 1JQVA 5CPLA 3V16A 4A2RA 5FEPA 1B1YA 4DF0A 2ISWA 4KWOA 1X38A 4ZQCA 2YDAA 4BY3A 1SW0A 2A79A 3HZ3A 1HP5A 1NDZA 2E40A 4YVPA 3VM5A 4F0SA 4JNZA 5E70A 4N9DA 3FHAA 3NSNA 2E5CA 1EZWA 2QAFA 1E0VA 1JCXA 2A6NA 3AUOA 2ZC1A 1CCWB 2HXUA 4UC5A 1UUMA 3ZLFA 5C7HA 3N6HA 1E15A 1ODUA 3K2GA 3BLFA 2WVUA 1XSJA 1DIKA 4UFIA 3CYVA 4ATWA 3ZT6A 5JU6A 3PBGA 1SW3A 5HPOA 3KLLA 3ZJ6A 1HQTA 4JL1A 3AC0A 3SUWA 4B2DD 1YYAA 4GZEA 2F6UA 3GUWA 4H8VA 2IUZA 4W5ZA 3M46A 3W72A 3DYOA 1V0LA 1I2QA 3M0MA 5G1TA 1QNVA 1P48A 4MLJA 1JJKA 4ZEPA 4DJDC 4PUKA 4S3CA 3C0JA 4O1DA 3W2UA 4UQAA 1AJZA 2J13A 3UETA 4AVFA 4L5ZA 4A29A 1EDQA 2V2HA 3U7BA 1QJWA 1JG9A 3B4YA 5JQ9A 3N14A 5D9OA 2BHUA 3O6YX 5D05A 3MA8A 2HVOA 1R3VA 4V27A 3EA3A 3WLQA 3OVQA 1EGMA 3ZS4A 2E6AA 2DVXA 1IWBA 4CGTA 4RNJA 1S3TC 3PK7A 4H6KA 5A6BD 4D71A 1RJRA 5T91A 4LBSA 2EXOA 4LNCA 1GOQA 4QP0A 1W3KA 5I77A 3S42A 4CVUA 3WFZA 2Z1SA 1CXKA 4C5YA 3ELFA 3V36A 3SB0A 3FVMA 4M24A 1DJZA 2EPMX 4GUGA 3S5SA 3NOYA 3W71A 1FY6A 5CZJA 3EXRA 4H04A 1W5MA 1MNZA 2G95A 4PYSA 2A0NA 7XIMA 2I14A 2HBXA 4RDWA 3SADA 4IICA 3KVJA 1A5KC 5A8OA 5CBBA 3PB0A 3DEQA 3WQOA 3GG8A 1CXEA 1A5BA 5EB8A 2VX5A 1P6CA 1RLCL 2R8WA 2V81A 3WL1A 2GJPA 4JOMA 1F7BA 3SRDA 3IJLA 3E0FA 5FF4A 4JIIX 1GQKA 5EY5A 3ABZA 2WAGA 3GU9A 5G2IA 5EKYA 2NWSA 4RV8A 1FCBA 3WF2A 3GIYA 1XYZA 1M5WA 2V63A 4GQQA 2Y6ZA 3DHDA 3AROA 1W6TA 1OC5A 3NSMA 3GU1A 3DFYA 4HPNA 5HATA 4GXMA 2J66A 2VZSA 1OGSA 1JUEA 2WZEA 1E6RA 4CQDA 3WQFA 4V1XA 4AWTA 2OKOA 3I65A 4S3FA 3NQ7A 3TUUA 1HW6A 1DJGA 4IUGA 4ZB5A 2E9BA 4B91A 2C6QA 3ZIZA 3M41A 5LHEA 5CJNA 1IXOA 1XC6A 3AZRA 1I2RA 3GO2A 4AD4A 3QR1A 4RE2A 4UFHA 3AYRA 3WX7A 1S5MA 1JAEA 2CESA 3FGCB 3T6CA 3WLRA 2BVTA 2ZFAA 3GFXA 1LG1A 4H1ZA 2GZXA 2TAAA 3PZQA 3VCNA 2X40A 3C8NA 2YDQA 1PSCA 2CZFA 3DKLA 1QW9A 3WH8A 3VKBA 4MOZA 1H7XA 3PTDA 1SMDA 1O5RA 3VIIA 3GXFA 1FWCC 4BS0A 3TKFA 3SGZA 4LCSA 3OZYA 4WDXA 4IP4A 2G3NA 3EA1A 5GNXA 2FZMA 4Y9MA 3FXYA 5XIAA 1TIWA 2E09A 3W0KA 4A05A 4EAMA 1IIHA 3ZM8A 4D6GA 2E6FA 1V0NA 4HPXA 3UWUA 4G1KA 4C6QA 3LK6A 4OV4A 1JF6A 5JIWA 4IIDA 1I1WA 3I7QA 2Y8VA 3V4BA 4B5TA 4HD5A 4LJ3A 1OBAA 1ZALA 4F40A 4MYAA 4BQ2A 3UBPC 1YTKA 1J6OA 2DH2A 3UXLA 2YX0A 4U33A 2PDPA 1HVQA 4P8UA 2HCVA 4K39A 4Z2HA 2GJLA 1CGXA 1DWAM 2P0OA 4IH3A 2DGAA 1GQJA 2E8ZA 1NDWA 2GL5A 3U48A 4JQAA 1JCLA 4OBSA 4YTSA 3QF0A 1KV8A 5A8MA 4J2PA 2E6YA 4H7ZA 1F3TA 1ISXA 3VOGA 4EOUA 3VD3A 1TMQA 3DN5A 3GLCA 2WV8A 2FPVA 4GY1A 1E0TA 3OLEA 4AW7A 3TYZA 2J7HA 3CIVA 4W7VA 1C8YA 3VDCA 2J9XA 4Q4SA 2OEMA 4LYKA 2CWXA 1I8JA 3EWWA 4N9BA 1Q4WA 5HDRA 4B2DA 2YLAA 2RJHA 4RR4A 1TR1A 1PZ1A 3F1QA 3W37A 1XRVA 4ACZB 3OLGA 1QBAA 2ZZ1A 3AIVA 1OFAA 2D2HA 1PZ2A 1YXDA 2DY3A 3SY1A 2VZOA 1ITUA 3MTWA 2PAJA 3WQGA 4TQTA 3W7QA 3WD0A 5CH9A 2EGZA 3N2XA 4NJIA 1F9CA 1Z32X 4GYJA 5BCAA 3W83A 1SSDA 1XIFA 2GDUA 2BY2A 2ZRVA 1EA0A 1G7UA 5H91A 5C9ZA 4B5NA 3MU7A 2BY3A 1XI3A 4IGNA 1IT7A 3T42A 2VX4A 5CPTA 3T55A 2SFPA 5A6BA 1PHQA 4LANA 3L21A 1K4GA 3TA6A 2PUZA 3P3BA 4DELA 3LHZA 3TYEA 1UR9A 2NXIA 2ZZ5A 5HWJA 3MWCA 1QNRA 1B4EA 1NDVA 4RNHA 3EX2A 2NVCA 3KBMA 3WLIA 1CGTA 2QDEA 5KSWA 1A5AA 3URNA 5D9MA 1U1HA 3LBOA 7TIMA 3SJNA 4MAVA 3B8WA 2IKHA 1NP0A 5DY2A 1GONA 1PCWA 1RPXA 4JNMA 3RPMA 4DPQA 1XYFA 1JYWA 5D2YA 4XAGA 5LSMA 3NQAA 1TV2A 3N4FA 3E9AA 3G1RA 4JCMA 5D02A 3ITYA 4MJMA 2PTWA 2PDWA 2WM0A 4Y8FA 3ALFA 2XVLA 3ZXWA 2CBUA 4YTUA 5D2WA 1HT6A 1SJCA 5MKGB 3BMWA 2QMKA 2PDCA 1G5AA 3NA8A 3GX9A 4HB7A 2Z4GA 5AZ1A 5DLCA 2PPGA 2PTDA 2FJKA 3WYZA 1PXGA 4JN8A 5E93A 3XIMA 3FVDA 5I09A 2YL6A 2I17A 4C1KA 1Q8AA 4YL2A 1NVMA 3L65A 4Q8NA 1JAKA 2CW6A 2JKAA 4FB7A 4PRTA 4PMQA 4JR5A 3GDMA 4PUNA 3AS2A 2PP1A 4EPBC 5C55A 4C60A 4WXYA 4KW2A 2XSAA 3DG6A 1AQ0A 1EO7A 3NJ3A 1WPCA 2DW7A 3ABQA 1FWAC 4JFSA 1OZMA 3C6CA 1ZP4A 3QTPA 3KAOA 1TCDA 3GXMA 4WIWA 3IJDA 2KX9A 4GMEA 1XSIA 5JBDA 2BLEA 2NSXA 1PL9A 3W1UA 4LPCA 5TQLA 5CPOA 2UV8G 3TJIA 5BWFA 3GR8A 3CXOA 4RZ4A 3P14A 4UOZA 1TE6A 1WZAA 4UOJA 1EYEA 2HPIA 1B54A 1NSJA 1WUEA 3VVGA 1JUKA 1Z42A 3CLMA 4YWIA 4DJEC 1TPUA 4NI3A 3GKAA 1WDQA 3R5EA 3DAQA 1UA7A 2I7GA 3AHTA 2XHYA 4DN1A 4PMUA 4JXCA 4AY8A 4M0XA 1AJ2A 2GGGA 5D04C 1PIFA 2I5GA 1QCWA 4M5PA 1V0KA 3YPIA 1Q8JA 2ESCA 2UBPC 2ZUVA 4X2PA 5A2CA 3WH5A 2J74A 3GVVA 1R3TA 2XM1A 4MF4A 5KMYA 1TA3B 3ZQ9A 3TYAA 3IWPA 1BFNA 2NV9A 2Y89A 4Y9PA 2RKXA 1KXQA 3QW3A 5TF0A 2XISA 1KW1A 3Q2DA 3ZJKA 4D72A 4UQDA 3SCTA 3QGAC 5T9CE 1EH9A 2W4XA 4K68A 1WP6A 2HQAA 3SCWA 1DIEA 4BK9A 1H11A 1LWIA 1PYMA 3HQOA 4O0KA 2OTDA 2XSBA 1MQPA 2CLLA 4RV3A 3WH9A 1XLJA 3FV9A 3FJNA 3KEHA 4GOAA 4YTTA 4LFYA 4QDWA 4Z2IA 1LLZA 1EP2A 3ICJA 1YX1A 2CC0A 4GUIA 3NM1A 3TQPA 3BPWA 1OIFA 1TJRA 1TMLA 3B9DA 3ITTA 1W2PA 2QUVA 5C2GA 2QIWA 4N4QA 1TV8A 5C5YA 2Z2BA 1PTAA 5HAOA 6REQA 4PCFA 1R3WA 5REQB 1ONXA 3WQ6A 1XYBA 4MZ1A 5D9PA 1XINA 5AHLA 4QITA 2WSKA 4PTMA 1UZ1A 2NLIA 5C70A 2GVYA 3WKZA 3KLKA 3BANA 3EDFA 3PPHA 4EPKA 2HMCA 3QY6A 3MI6A 3WFAA 1ECEA 1H7WA 1FWEC 5CJMA 3O9NA 1MRQA 5A8QA 1IEIA 4YLWA 4N6EA 3CL8A 3BSHA 1CGVA 3B0YA 2V9DA 2I57A 1KM4A 4ECLA 4O10A 1PE1A 4Y9AA 3N73A 3EXSA 1LL6A 1LRQA 1IR2A 4LXFA 2GK1A 1S2UA 3DGBA 4LVGA 5DCBA 5F2MA 3DI1A 2CETA 3W6LA 1EQCA 1OFOA 4DJFC 1EWEA 2YBVA 5BXSA 1GTEA 1NFPA 2XYLA 4PBEA 2VI0A 4HMDA 4QLKA 3BQ5A 4JYDA 2ISSA 2E9LA 1Q6CA 3UEQA 1GVQA 1ZAJA 3RRAA 3H7RA 2E6DA 1SZFA 2ZWYA 2HZGA 2Y5SA 2W79A 2X30A 1C90A 3VGDA 4G5DA 1EJRC 2REQB 2Y8UA 2VVNA 1K70A 3T0AA 1IQ8A 2QV4A 1L9WA 4BZYA 1TFVA 1UG6A 4MY9A 2B81A 3W7IA 4KERA 2UY5A 4JTAA 3ZVHB 4UMBA 1R86A 2CZ5A 2C13A 3B05A 3QXBA 3T7VA 2HVMA 3P8JA 5D8ZA 3I10A 4ML9A 3AMKA 4CU6A 9XIMA 2WMIB 3PNUA 5CPMA 2YCIX 5FF3A 1FWTA 5DX7A 4K8GA 2AQVA 3HPAA 5CAKA 5A8GA 3GB6A 1UR8A 1JZ3A 2DUAA 3GNPA 1UJPA 1P43A 4DXXA 1BG9A 2DZVA 1KRMA 1VLWA 4J35A 1LWJA 3L5AA 4AVNA 1OFPA 3OGVA 3CIXA 2C71A 3F5JA 1B5TA 4JX4A 4K8HA 1DIOA 4S3AA 3GH5A 3K46A 1TUFA 3GH7A 4RLIA 1OGBA 1UKOA 3DZ1A 1A47A 1QPOA 1EJTC 2R1PA 1W9PA 1K7XA 1B3OA 1K77A 4JHMA 1JXKA 1AD4A 4H41A 2ZX6A 4DJDD 3THQA 1JD9A 4O14A 5AN7A 2WVTA 4ERGA 1UPPA 2NUXA 3PUDA 4O0ZA 1SUXA 3L7RA 4WCJA 1FKWA 3W7LA 2XGIA 2WWCA 3G1FA 1KBBA 1NWTA 2QKFA 2ZQ0A 3O3RA 1PAMA 2G41A 4PL1A 3CPGA 1CZ1A 4HK6A 3GNRA 4GNKB 4WQ6A 2P0IA 2JKEA 1T6MA 5ABHA 1D8CA 3RG6A 2DT3A 1UH3A 3T0TA 4UOQA 4XZBA 4KFPA 4IHCA 2GVGA 2DEPA 3K4AA 4KQNA 4D1IA 4MKNA 2IW0A 3AICA 3NPUA 4ZXLA 1FWHC 3MUZ1 1JPMA 4IIFA 1PYFA 2I1OA 4PBFA 4LC8A 3WO8A 5FEXA 3GHSA 4E4UA 5IXEA 2ZUSA 3E38A 3CJPA 4JBRA 3PZOA 3W7KA 4XZMX 4I9MA 3UG5A 2PD5A 1QOXA 3OOQA 2WZMA 1OY0A 3UCCA 2DH3A 4AD5A 4RDZA 3B8IA 2C14A 4PUEA 2VJXA 4N4PA 3H7VA 4QCEA 2YCEA 1TPC1 1ITXA 3LSCA 4XIAA 4J2MA 1TQJA 4Q22A 3DFPA 1GKPA 5LZLA 1KM5A 5AC7A 1I60A 2WO5A 1OCQA 4PTDA 4QTGA 3GVRA 4FXJA 3HPXA 7REQA 3E0IA 5AYYA 2H90A 4WGXA 2PE4A 5EBAA 1EPVA 1U22A 4ROPA 1M41A 1EGVA 1I45A 3AHYA 1V6TA 4N0RA 1IWPA 1MFVA 5B7ZA 3HG2A 1GHSA 3J7HA 3NVTA 3P84A 1XLBA 4GQ0A 3VPLA 2JE8A 3POHA 3UCQA 1AW1A 1YPIA 4IX2A 4YWSA 3CLWA 3W81A 1HKWA 3G3DA 3ZWSA 4RNIA 1KTCA 1TTPA 4V15A 4D6EA 1SO3A 2CKSA 4CD6A 1NDYA 1TE1A 1ZFJA 2J8TA 5IOBA 4UTKA 4HNCA 2G96A 3CUJA 1SZNA 2ZUMA 3C3UA 3RLHA 5FACA 4QHRA 1JDDA 2WCGA 3M0HA 4X22A 4AF0A 1NOWA 1LL4A 3E0LA 3IJIA 3K1DA 3IANA 1RK5A 3MHGA 3SFKA 2XIBA 3E6EA 1TJ1A 3W7OA 4Q8VA 8RUCA 4Z42C 1ZAIA 2V5JA 4L65A 1EDTA 1X7FA 1Z7AA 2CEQA 2FGBA 2PDKA 3BQ6A 4QRNA 3R11A 1ZLPA 2JGQA 2CXGA 3DHPA 4OZOA 5BRPA 4Z17A 4MY1A 3PZTA 4LRSA 4RJEA 1OGGA 1UZ4A 1YXYA 1J96A 3HIJA 3O0KA 2GGIA 4DZ5A 2E3ZA 1CENA 2QULA 4IZGA 1YPFA 4EVZA 5LA2A 4ZOAA 3W1PA 1LQ2A 3TN6A 2A7PA 3D47A 4UTTA 3G0SA 4HSNA 5IBXC 3VFCA 4CKQA 2JK2A 4C91A 4JX5A 1OX4B 2Y0FA 4KCTA 1V8EA 3O6DA 3DFSA 4QEEA 3MVTA 1V0MA 2FQIA 4AWUA 4K2SA 5XINA 1ME8A 3CL7A 3C86A 1B90A 1QDSA 4I3GA 1I0DA 3HG5A 1RHCA 3KZPA 4PODA 1EC8A 2YL8A 2IPGA 5DMYA 2WZIA 4QJ1A 1TPWA 3WMLA 1R9ZA 4HGXA 3B06A 1Z6KA 4EWND 5K3VA 3UGVA 4K7VA 2VUNA 3M5ZA 3MC5A 3PFMA 3G18A 2WZHA 3G6LA 3QR0A 1XIDA 4Q6JA 1S5VA 3A13A 1MZHA 4B3ZA 4HHMA 3C2OA 2RGLA 3L4YA 1QK0A 2OU4A 3M7SA 4GA8A 3EKZA 2E4TA 3KVMA 1ME9A 3OPSA 3GAYA 2C16A 4I9TA 2WC7A 1EX1A 1XLDA 1ZENA 1GG1A 3NL2A 2J6XA 3GNXA 3ABSA 3EAUA 4J3UA 1NTHA 2VURA 4WDTA 1BVWA 5FJTA 3OYXA 1HIZA 1W17A 2GGJA 3AJ7A 2HROA 3GNNA 4QXIA 3Q45A 1OYBA 1Z89A 4PUMA 3VI2A 1ZBKA 1N7KA 1S2TA 4S3KA 1BSLA 1GUVA 1PCKA 4D1JA 1KV5A 3TN3A 4R85A 4JQ3A 1Q7QA 4ERIA 1KCKA 3GR4A 4D6IA 4F0HA 4DJDA 3WQCA 3SCRA 1BQCA 2GFTA 4CCCA 1RQBA 2JF6A 2YZ5A 4IMCA 3UYIA 3WH7A 3I6EA 3KCJA 4QR6A 1ITCA 1O5QA 3EWBX 5C9WA 3WUEA 3UNDA 3FAXA 2ZWZA 3TJXA 1RXOB 1TPB1 4FNRA 5AC6A 3UA3A 4TX8A 4DBSA 1NARA 4CCDA 3VNDA 4ROQA 1LJYA 3NQDA 4O53A 2FGLA 3ZR4A 4ZQNA 3EMZA 1WZKA 3BZGA 1OFDA 3N29A 2PC8A 4MAZA 2ZA2A 1UWRA 4LV4A 5KETA 4JZ5A 4D6FA 5BOFA 3R0KA 3DCPA 3G22A 3L67A 4WRHA 2XN1A 4NNAA 1GVYA 3EX6A 1OC7A 3MUCA 1XISA 1OZQA 1EIXA 1VFUA 4GC4A 2PI6A 1OFRA 1V6YA 2PB1A 3L4VA 4GI6A 1HO4A 3LPGA 3KS5A 4JQ2A 1BWKA 4K3ZA 5U7SA 3AXHA 4A3QA 3WCZA 2VC5A 3H7UA 4E4FA 1W1TA 3DXIA 3E2QA 4M6UA 3R13A 3GY1A 2QNEA 3W07A 3H12A 3C2VA 3TN5A 4K7YA 4L56A 2WM1A 5CKSA 1W32A 3VUSA 3PBMA 2ACUA 1U5HA 3OIXA 2J9ZA 1W5NA 1TZ7A 1WE5A 5D2TA 4MY8A 3L2MA 4W87A 3NFUA 3H2MA 3WNMA 5A6MA 1N8IA 3CHDA 4HKPA 4O1CA 3W7NA 2Z2UA 2WQPA 1E4MM 4L6OA 4WY0B 1TWDA 4AHOA 3OG2A 2G4FA 3C0LA 2D1ZA 1NQ6A 4C90A 2V8ZA 1DV7A 3TQVA 3W1LA 1QFEA 3UXAA 2JALA 2E68A 4IMDA 1B30A 3G1XA 2OOFA 1K03A 4AAJA 4AD0A 1FTXA 2CNCA 5ABTA 3LCXA 1V3JA 4LVBA 3ANYA 2VKZG 1J0JA 1RK6A 4DRSA 1R9YA 4E5TA 3W28A 1UZDA 3MYPA 1EBHA 1WNOA 1X96A 3POCA 4XAFA 5H6HA 5EL1A 1JL8A 5H8PA 3F5LA 3SGGA 1W1A1 2G3IA 4L4PA 5I02A 3W7RA 3QZAA 1RBAA 3AYVA 2GJNA 1W37A 4LOCA 1WDSA 3KBJA 2VR4A 3M5VA 2WBKA 2NX9A 5DMMA 4PMZA 2GUUA 2OXNA 4TV6A 3GE7A 2C18A 4GUFA 1V93A 3WBEA 2Y5EA 2X7WA 2YB4A 3KVKA 3T8LA 3IJ6A 4C6KA 1DJIA 3WMCA 4TX9A 1U2YA 3HU7A 3CBWA 3P0XA 2ZYFA 5HULA 3APGA 3WK1A 4K38A 1V79A 3W01A 1UCWA 3ATYA 4O52A 4U4MA 3TXVA 1GQNA 3MCMA 1HXJA 2B7QA 2YA1A 1TTQA 1WAWA 3W6YA 3PY2A 4NYYA 2WKLA 3AALA 5EMYA 3SIZA 4O1FA 3F2BA 2I5IA 2WSYA 1VQTA 2FTWA 2TRSA 1JZ8A 1EJVC 4HVXA 1X1OA 4X60A 2JFEX 2LLEA 4HPHA 1ZCOA 2WYSA 3CUFA 5FF0A 3AIEA 4HSHA 3BCDA 2C0HA 3L0KA 3LHYA 5DBTA 2FLIA 1A0EA 5DT5A 1GGOA 2YLLA 3U2CA 5FESA 4GUHA 3GG1A 1VEPA 1BYBA 2E28A 3V5OA 2IKIA 5LXXA 4D2JA 4GY7A 4AWSA 1BYAA 3CO4A 2OZ0A 1JZ6A 3SN4A 1O4UA 3VMNA 3AAMA 2J9YA 2XJ7A 1TVLA 4M1RA 3TAKA 1HL2A 3KFTA 3S4TA 3LTYA 3P61A 3MV11 3I68A 4E2DA 4JDYA 3NTYA 2GJRA 1XIMA 3U4FA 3WJXA 2W9MA 4CNOA 2X0YA 5AZ0A 3GYCA 2PWGA 3S5ZA 4JTGA 3N4EA 3SCOA 1JRBA 1QNQA 5A6KA 4HZ6A 3A6OA 4U2YA 1XKJA 4R33A 3W7DA 1JULA 2BB0A 3CH0A 3M44A 4LCQA 3PWIA 4QJ5B 2VEPA 4PN2A 3N11A 2OSYA 2OX4A 1VENA 3SCUA 2WKJA 3T05A 4H19A 2R1KA 1N8FA 1DJWA 1K8CA 3VC5A 2PLCA 4GIEA 4KH2A 1EXPA 1XQLA 3I3BA 3MSDA 1C91A 2PDYA 3KUMA 4TOQA 2ZTJA 1EC9A 4O28A 3ERPA 3UWEA 1NOUA 4MSSA 1A49A 3IEBA 1QI2A 1KM0A 4GO8A 4XG1A 2ZDSA 1HFBA 4DZAA 2O92A 3EDJA 1JZ5A 4E6MA 4BJHA 1REQA 2GYIA 1TSIA 3C2YA 3IS4A 1VGAA 1XIBA 3QH2A 3QQWA 2J75A 3BURA 3B9AA 1GOIA 3WSUA 2C15A 4BWLC 1MEIA 2VELA 3QV7A 4JTQA 3EPOA 1F8IA 4JN6A 2ZZ7A 1QK2A 4DYJA 4AISA 4QQUA 1PJ9A 3PZUA 4RXFA 2BTMA 3LXBA 2J27A 3AISA 5F2LA 4CD5A 3STCA 1E55A 4JKLA 5IM51 4LAOA 4ZO9A 1S39A 3U2EA 3IJ9A 3QBUA 4ORMA 2YB1A 4DJFD 4I7UA 5D8WA 4UR7A 4NIRA 6XIMA 5A6SA 1M53A 1DTNA 4O8AA 3WK0A 4UNLA 5HWMA 3H54A 1P0KA 3F4CA 3OYZA 4UMCA 3QTGA 5CSUA 4LS0A 1Q45A 3KRSA 4JEJA 5CC7A 3QSTA 1W8GA 1UROA 3NQGA 5F2GA 3FA3A 4HA4A 2WSPA 3HGOA 1WX0A 2CKRA 4XZIA 2Y5JA 4ZO6A 3EWCA 2DT2A 4LS2A 1LL7A 2QCMA 4I6KA 1O94A 3W70A 2WW5A 1YDYA 4W8AA 4FNUA 4O57A 1E3ZA 1B9BA 1IF2A 2ABBA 1TB3A 4PB5A 2B7NA 3FN9A 1QVBA 4FA3A 4L7ZA 4PFHA 2PC4A 2NQZA 3AOFA 4CQ8A 4WJXA 1C9DA 2GQAA 1ZZMA 1WBJA 2Y1HA 4ACZA 5RUBA 2OZ3A 4QS6A 2PWUA 1UYQA 2QUNA 3TCSA 3L4TA 1NY1A 5G1MA 3UR8A 2IPWA 3IVSA 4TXEA 1VS1A 1CIUA 2O0TA 3N6QA 2PLMA 4OT7A 3OQ8A 1SJBA 4GZ7A 5FJRA 2WNWA 1KXTA 3IIPA 4MZYA 1E40A 1KGUA 3SUTA 4DBDA 4ZE5A 1HGYA 2FH8A 1ML1A 2EEXA 2ZRXA 3PZVA 1R47A 3UR2A 4Y7EA 4RZBA 1TV5A 4WKAA 4QE4A 4HZ7A 3GXIA 2W62A 3BJSA 4P7QA 1AQFA 4GISA 2ISDA 3HG4A 1GOKA 2WC4A 1VBHA 4B16A 2R6OA 3QFEA 4Y9OA 4DO6A 2HV5A 3KBWA 4DJEA 1K9FA 5D2VA 3LCWA 3VE9A 4GYPA 1XLKA 3II1A 2GDVA 3NZRA 3WQDA 1U1JA 4PB3A 2QV5A 3BAIA 1Z3NA 1H3GA 3KDOA 4Q32A 1H51A 1XRSA 3U57A 4AZGA 3HM7A 3GR7A 2Z1VA 5FKYA 1O7AA 3NCOA 5AOUA 2F61A 4PCPA 4MWAC 3TNBA 5BOOA 1AW2A 3NQ2A 2PDHA 3R89A 8CGTA 4XO7A 4YHEA 4MYXA 2NW0A 3UVIA 3BLPX 2FZBA 1BVZA 3UJ2A 1PKYA 1XYCA 2J8FA 4M6VA 5TAOA 2A6LA 2WC3A 5D32A 3NQBA 5K4ZA 4GJIA 3QY7A 4HCHA 4ATLA 3MI3A 4E2OA 1XYAA 5MKGA 2EHHA 3S46A 4AD2A 1Z48A 5BMWA 3TC3A 4A8NA 6A3HA 7ODCA 5A69A 5AHEA 2PTZA 3LM7A 3O7UA 2V82A 3K8KA 4MNJA 1IE7C 4Y2WA 3TX9A 3FYYA 3T81A 4IPLA 4D8LA 3NEHA 3QPYA 1F6YA 3E2RA 2G5WA 2GGHA 3PP7A 4PH6A 1MW2A 2GVEA 2QCLA 2VXNA 1R0MA 4FLRA 4PULA 4MKVA 4AFYA 1E51A 1RBOB 4P7OA 1BXCA 3VDBA 3GVGA 3GDKA 4PMVA 3HQNA 1UMYA 5D03A 4XD4A 1CNVA 4XZWA 2YA0A 3TC7A 3OODA 1C92A 1PBGA 3KP1A 3DFNA 2YDSA 3ZT7A 1J79A 1PUDA 4ZODA 5EPDA 1RP9A 1CGYA 2R1LA 1FWJC 3ANUA 3B04A 1R9XA 5CG7A 2ZX8A 1XIHA 3TV8A 2WXDM 4L64A 1TREA 3UWZA 3O0FA 3QC0A 1YW1A 1Q6GA 1ZGDA 1IEVA 4DLFA 4NT0A 4ZXOA 4PRRA 2WHMA 4LT9A 3N9RA 4N9EA 1QRQA 1EC7A 4EIVA 2INEA 5JBEA 5CSSA 3S9ZA 2GUBA 3UYCA 3K8MA 2A5HA 5I07A 1W91A 3HB9A 4ZO7A 1OFQA 3ABRA 1IEXA 1QW8A 3GKFA 4M81A 4MJZA 2E8YA 1EJUC 2VT0A 4HIBA 3OBEA 2W66A 4G7FA 3STEA 2ATSA 3UJRA 4M56A 1WDWA 1QO2A 4DJFA 4JTLA 2E1DA 4N02A 2IXUA 4MUPA 2ACSA 3OGRA 2WLZA 1DPMA 4OOUA 1TX0A 1XLIA 1D3CA 1KR0A 2DU2A 3L23A 2CBJA 2NUWA 4I5RA 1JCTA 1KRBC 4DNMA 4OFCA 1QASA 3RMEA 3VDHA 5MHBA 1EDGA 2XU2A 1UKPA 1UP2A 3LDVA 1X8FA 1RZMA 1KTBA 3FFSA 2ADAA 5G1YA 3KRUA 6CGTA 2PRLA 3Q94A 3TU9A 4GFSA 4XISA 4LV9A 3GXNA 1YNYA 1JPDX 1GK8A 1XLMA 2DQXA 3VKAA 3LNMA 1E6SM 2CZVA 3WF0A 3UPMA 4QNWA 3CZEA 3ZMRA 5E09A 1KWKA 3M16A 3QPEA 3UZJA 2XZ7A 3QYQA 4Y9NA 3QEZA 4CQCA 1XCFA 3DHUA 3B9EA 5CSRA 3QRHA 2YA2A 3CUIA 3C5QA 4M6PA 1FDZA 3NNTA 4J3VA 3WUGA 4JIEA 1XPGA 3ARRA 4BEUA 4CLMA 4LUSA 4BI6A 2ZX7A 3KWSA 3QMTA 4J3WA 1F3WA 4O13A 5REQA 4IL2A 4ZVJA 2DDXA 2PWFA 3CV7A 2VWTA 3ARSA 5FCZA 3B0PA 2A3LA 4W5UA 1V02A 4QDPA 1EL3A 2DZBA 4PGLA 3OP2A 2JIWA 3TMLA 4XZNX 2QW5A 2HVNA 4KEVA 3IUDA 1IIGA 1ISVA 1QOPA 4H8NA 4WKHA 4X9SA 1ISZA 2OO6A 2ONEA 1D9EA 5I03A 3CT7A 5IHSA 1Q6QA 3EPMA 1PDYA 3OIHA 4JKKA 4NASA 4IM4A 3PZNA 4CVWA 1FWNA 4UNIA 2W61A 3APYA 3VCCA 4MFEA 4NZ4A 3WLPA 6TAAA 2PLKA 1NF0A 3NIYA 1PTGA 1TWIA 3P93A 5HQEA 3AIWA 1AH3A 2V69A 3BLKA 3MCNA 3NURA 1BXNA 4YYFA 1ICQA 1CXIA 4GYKA 4TVDA 4NHVA 5HANA 1ZUAX 4FNSA 3CWOX 5EYWA 6REQB 2WQDA 3IV3A 2F8QA 4IJCA 5FJIA 3FAWA 4PB4A 1XDLA 1ZSXA 3VC6A 1I2OA 2GGEA 1Q2RA 3VD5A 4W9TA 2BDQA 1Y0EA 3TSDA 4E3VA 3TH6A 3HGSA 1RJPA 1DKWA 1U33A 3MZNA 1J11A 3W1MA 2D2GA 3IRDA 2BBFA 1GQIA 1MUMA 4OOZA 1SW7A 4J7RA 1TV7A 2X1IA 2PCQA 2Y61A 2I56A 3IV8A 3MP3A 1GJWA 4Q4OA 1AZ2A 2YJQA 2ZA1A 1JQXA 1R85A 1YNPA 1ADSA 1J9YA 4U31A 3LCLA 2A3CA 3TSBA 4B5WA 3GTNA 3E2SA 3ZLHA 4AYGA 3V3WA 4K1WA 2VX7A 3W2NA 4X9YA 3WQ5A 3WF1A 3LI1A 4W88A 1DQUA 1UASA 2P3ZA 2V5BA 5M17A 1JVNA 3TSMA 3AXIA 3UZZA 4UCGA 5I3DA 3CHCA 1MRAA 3RGTA 1V7YA 1XD1A 2PSNA 3IGXA 1SMAA 2CU0A 3B03A 3S0CA 1BGAA 3VNLA 4L6HA 5LXEA 3HO8A 3SSZA 3LHWA 5M3WA 1D3HA 3MO7A 3DDMA 3GWQA 2Z1KA 4RNFA 2OX1A 3EWDA 1X1NA 3BGGA 3MCOA 4JFWA 1TJ0A 1EP3A 3VMPA 1M9HA 1E4IA 3COTA 1FXQA 2VFDA 1XC4A 5AHNA 1A5CA 4OQVA 2OWCA 2XVGA 2PDFA 3F4VA 2BVWA 1IEWA 3LN3A 1Q3NA 5FAGA 4LAUA 4WX2A 2FHBA 2GQ3A 2F6KA 1B3VA 1J5SA 2GDQA 1VFLA 3EZ4A 1IZKA 3H22A 2XWEA 2IPJA 1DP0A 3U5UA 1MSSA 4UFJA 4KWVA 1VR6A 4MDPA 4YHGA 3OEXA 4LS1A 1A5MC 3LGEA 3NQ6A 1QXLA 4UQ9A 1QPQA 3N2BA 5CC5A 1UJQA 4Q8PA 3A4AA 1R30A 1CDGA 1HKIA 1XG4A 3LYEA 5LNRA 1T99A 5IBXA 1NFBA 2RFGA 3N15A 4MNKA 3SJ3A 1K6WA 3U7VA 4ICNA 3DFQA 4GJJA 1PKMA 1IZCA 3A5FA 4NX5A 1AODA 3BL3A 4UTIA 1IWAA 1PIIA 3ORWA 4GNVA 3EB2A 1J10A 3H70A 1OEPA 5C71A 1IV8A 3ZT5A 4OKDA 4H9VA 1K8ZA 4CCEA 1VKFA 2GLKA 4X61A 3DIPA 3D46A 1S3HA 3MSRA 4QNEA 4F4RA 3WG6A 1R2SA 1GT8A 3BLIA 2WNNA 4POCA 2PFHA 4UQCA 3FLUA 3KTSA 5GJMA 1F61A 1ZRQA 4KCUA 1S2WA 2AGKA 3VD9A 3I3EA 5K9XA 1HJWA 3BG5A 2C1GA 4F0KA 3M0IA 4HP5A 5E5CA 4JDBA 4FEZA 3EMQA 4GACA 1XIEA 4HTYA 4ZBCA 3G1HA 1Z69A 5D2XA 1PV8A 1HN1A 3UXDA 1AMYA 3D6NA 3M1ZA 3AHZA 4JTCA 4GCXA 2PGEA 4AD3A 4C6LA 2F2KA 3RR1A 3C3NA 1VIWA 3UXIA 1XH1A 2DUXA 3CV6A 2NV1A 3R8GA 1TPDA 4AZ6A 3CEUA 5LNSA 3FJ6A 1CEOA 4P8WA 2JEPA 1GVIA 4BI7A 2CPUA 3GSMA 1EUAA 4JHOA 4J3XA 2J8GA 3A47A 1WKDA 3ZVIA 1SO6A 4XX6A 3F4NA 4MNLA 4TTGA 3M4HA 1E4LA 1LYXA 3T0DA 3QGKC 3SY8A 3HGJA 5KITA 1OINA 2PA6A 2Z1XA 3UJSA 3RO8A 3P74A 3N04A 3G3MA 2BHYA 1PX4A 3PTQA 4J40A 1KLZA 1KO0A 2AOSA 5KTLA 1LZOA 1GWJA 3T8QA 3WMBA 3DESA 1Y5XA 2XGZA 3F2DA 4DZHA 4HU0A 4OUEA 2GQ8A 3WQWA 1S5WA 1CX9A 2V3FA 4BF5A 3KS6A 3N2OA 4HJFA 1GG0A 3GHTA 1Y5VA 5JXQA 2QJMA 3TROA 1KCXA 1XCXA 4AB4A 3PNZA 4PMYA 3B0XA 4LQ1A 4PCSA 2UZ9A 2V3DA 1GJUA 4LUJA 4AEOA 4M80A 5FEWA 1LUCA 4AF0B 1W56A 4UWMA 2EJAA 3WBXA 4AIOA 4LF1A 4A3YA 3G8RA 4B3KA 1XBVA 2G3JA 2QF8A 4OTKA 1JCMP 2D20A 4NP7A 1EEPA 3LV6A 3SN1A 5K7JA 1ALDA 1MMFA 1F74A 4EF9A 2R14A 2X8RA 2AL2A 3PB2A 4ZCWA 1J4EA 1ZJIA 2OT0A 2VX6A 1E0UA 1O60A 1IGSA 4GVFA 1ZBCA 4DY1A 2WK2A 2R94A 3CT2A 2GVJA 3EB4A 3PPGA 4YMZA 1HVXA 4DWSC 1G67A 1XUUA 4FIRA 2XM2A 1CTNA 1GHRA 3C8FA 1OX5A 1W3HA 1YTDA 3LERA 1RALA 2Z1WA 3P5YA 1UR3M 5J5DA 2HS8A 2P76A 2A21A 6XIAA 3CU2A 4EE9A 1VPXA 2HDJA 3AS0A 4WOZA 2YFOA 4Y96A 1BSIA 3CIWA 2ICSA 4JQ4A 2GUYA 4P7LA 2XGBA 4MJ4A 1ZJHA 3RXZA 2NT1A 3CHVA 5EA9A 4K8EA 1WDDA 2V5CA 3SZ8A 4NJKA 3WNNA 5C9UA 2VFHA 3GTIA 3NO1A 2CERA 4KRUA 1VC4A 2FB2A 2XN0A 4F79A 5DELA 5C2XA 4GCAA 4BF7A 3W1RA 4PR4A 4NXKA 3B4UA 1KNWA 4FXFA 3E74A 3U2OA 4IGSA 3LV5A 5D9NA 4QGCA 3QOKA 1HL9A 3WNLA 1W8SA 2C19A 3BAYA 1PWMA 3SO7A 3HN3A 1Y7VA 3MUXA 1KD0A 3N3TA 4EPDC 3G1VA 5CG0A 4HNNA 2FDMA 5J5RA 3KX6A 1EXBA 2ZCGA 1CXLA 1RA0A 1OYAA 5AB3A 4YVXA 2VENA 3GRIA 3S3GA 5H1WA 3NR0A 1JRCA 1WAUA 1GVRA 3S2CA 1GOOA 3STFA 3B8UA 4DUOA 2HISA 5JH2A 5DO8A 3TONA 4Z1CA 3VD4A 3SW6A 1YDOA 1ONRA 1L2QA 4DWDA 3ZR6A 4MWAD 1ODZA 1JCNA 2F9RA 4TV5A 2XIJA 3O1NA 2FHFA 1P5BA 2BY1A 1KXHA 3LB0A 4PMDA 3EA2A 4UTJA 2ZE3A 3VZYA 3SRKA 3C56A 1DQXA 3I4EA 5PTDA 1GQLA 3DOPA 2VDHA 3N2TA 3PJUA 4JD4A 3GZ3A 1SFJA 4Q4RA 5E9AA 3Q4DA 2FH6A 2BOEX 4CQAA 4C7DA 3DU0A 4HOWA 4XSLA 3LHVA 4Q8UA 2EKGA 3OZPA 4Z2LA 3VD7A 4X0VA 3RAOA 4AMAA 1K7EA 3CWHA 5A94A 2PDLA 4JIHA 4Z2KA 2WMGA 3PTMA 4TMBA 2WPGA 3RHGA 3VGFA 2QPSA 2JF7A 3NL6A 5FA5A 4PEKA 4WJ8A 3VOHA 3SN0A 4B3LA 1Q7ZA 2E77A 3SBFA 2FTYA 3K4DA 2PEVA 4TR9A 3GIQA 3U6WA 4FR6A 4O16A 1FWIC 1M03A 4XUGA 4IFKA 3G24A 2QGYA 3K13A 4J4KA 1KFWA 3W27A 4B15A 1T96A 2VCAA 2QHAA 1XKYA 1QATA 4XKYA 1AJ0A 3OBKA 5DCDA 4WK9A 2FZNA 4S1FA 4S23A 1JCYA 1VLIA 3L4UA 3PZ9A 1IYXA 2OKTA 2QMJA 3T78A 2E5DA 4L4OA 4XD6A 4QM1A 1B3XA 1V03A 5BXTA 2OZ8A 4IMAA 4BA0A 4LNYA 1P7TA 1UA3A 3W23A 2VGGA 2PBOA 3RR4A 3BMXA 4JTTA 1XRTA 4HCLA 3B8VA 4Q6XA 3UJFA 3IAPA 1UPMB 3I6RA 4KEZA 1XG3A 1KA9F 4HPGA 3TZNA 3MHUA 4BI5A 4Q7BA 4UMAA 2VFGA 3PHAA 5FJUA 4BR1A 3V1PA 1GJPA 1DTUA 4HNLA 1XPYA 2X16A 4DLMA 3EWZA 3VIOA 3WNOA 3DFTA 4G56A 1G9HA 4LUIA 2QF7A 3VNKA 3IVTA 2XIIA 4CN6A 3CZJA 1YDVA 4HMEA 3KOFA 3R0DA 2VEFA 3THDA 3G1SA 2AMXA 4RE3A 4NRRA 5F4WA 2XIQA 2BS9A 3L0NA 1XH2A 3RUBL 4V1YA 2KAUC 3RRXA 4Z2GA 3CPUA 2MNRA 4GBDA 1HO1A 1XICA 9XIAA 3NOEA 3H4XA 3AWNA 4V2XA 1XYMA 1RP8A 2HE8A 4HZMA 2VEKA 5CZKA 5AHIA 5C7VA 3AMCA 1EJXC 2FZ8A 4A3UA 4NI8A 3IVUA 3NG3A 2ZRWA 2JIEA 4J5NA 3DC8A 2HXTA 3WF3A 5CPQA 3APTA 3KVLA 1ZNNA 1R7OA 3TP4A 5HWNA 3ECQA 4F2UA 4C6CA 4DPPA 3NYDA 4I9AA 3NQCA 4LTSA 2VHLA 2IKGA 1TV3A 3NXLA 3EB3A 3MMWA 4YU1A 4DZIA 1OK6A 4LB3A 2V67A 2ZADA 2W6RA 1H5YA 2F6XA 2PWVA 4HYRA 3PAOA 2EPOA 4ZE4A 4ADSA 1MFUA 4K37A 4P5UA 1F05A 1YXCA 2XN2A 4BFAA 2D2OA 2VRQA 2WCSA 2WWDA 3W1AA 1K9DA 4A35A 5A8NA 1TZ9A 4HTBA 3RX2A 3TFCA 2Y7DA 1HJUA 4GRSA 4ZZ9A 2A1YA 4OECA 3QY8A 4BQ3A 1FBAA 4OHQA 1T5AA 1XR2A 4MPKA 3QM3A 1GPFA 3NAVA 2VQTA 1EIBA 4XD3A 1G94A 5DXYA 3TOYA 3PTKA 3VTRA 3OHIA 3I7RA 3H21A 4M6QA 5HUOA 3GDBA 1CLKA 3HFTA 5T9BG 2PTXA 3DX5A 1V08A 2PMQA 2ZUWA 4WGHA 1GKQA 3TW7A 1XIGA 3P62A 4OUIA 2VWSA 1ONWA 4FF5A 2MANA 3BLEA 1JNEA 1LORA 4TIMA 3LI0A 2FDSA 3NL5A 3V5CA 1RVGA 3LLDA 1B0IA 3H26A 1DJXA 1EHNA 1JFXA 3EDEA 4H9UA 4MWAA 4LH8A 4E2BA 3R8HA 3AJXA 1IGWA 4AD1A 1XV8A 4KFNA 3NM3A 2Q8XA 1E9ZB 1R5YA 4PZVA 2H9AB 1XYLA 1REQB 1HJQA 5I3FA 2QQ6A 4MLRA 2G37A 1ISYA 1XP3A 3UZXA 3E3HA 3HQPA 3NPWA 3IJQA 3LRLA 1E71M 3C0QA 3V35A 4WSJA 4JPGA 1NAL1 2XH4A 4GQBA 1Z44A 3N2MA 3DG7A 1UBPC 1EJ7L 1QWGA 3RFAA 1XDJA 3PZGA 4O15A 4LAZA 2O56A 1MZRA 3CHEA 2DW6A 2C91A 4NY2A 2BODX 3GXTA 2ZBTA 2J77A 5HBFA 3HV9A 1LBFA 3AU2A 3VOJA 4S2CA 1XBZA 1GVSA 5ENLA 4INFA 3AHXA 3GZAA 3M0KA 1US3A 1RD5A 4D9PA 2VUYA 3DYPA 2DP3A 4NL1A 4M7TA 3AS1A 3DI0A 1W2VA 3TCEA 5AC4A 1GZJA 1EHAA 4TTUA 1LT7A 3CUXA 3BJTA 5HXMA 1VPYA 1S2VA 3LCIA 1FFQA 1O6IA 2P8CA 1MUCA 3OHMB 1SZEA 3W9ZA 3N12A 3S8HA 3TIMA 3R0UA 3VKCA 5J8LA 5CZ0A 4ZB2A 3UZWA 5JIPA 4PUUA 4KIRA 1P0BA 3MP4A 1CPUA 1TIMA 2QZRA 3IIOA 1JI2A 2VZUA 1T7LA 1Y8BA 3VOFA 2POZA 3VKJA 4Q4QA 1PZ0A 3QV6A 5LKYA 2O9RA 1T8QA 4G6CA 5LIKX 1TPEA 4GYFA 4H00A 3T40A 2DZSA 8XIMA 1DXIA 5EGRA 2V6AA 1SSGA 5DRIA 2G97A 2Y62A 4R27A 3WDIA 3TAOA 1MO0A 1ONEA 1LQAA 3E2VA 2V5LA 1QBBA 1WZLA 3TMQA 3WD3A 4GY0A 1TV4A 3TXZA 2BY0A 1K6AA 2YXXA 1EOKA 4IGMA 4QAIA 1P0EA 5K2ZA 1M7PA 4S3BA 1M1BA 2OR2A 1G6CA 1A0DA 2RHGA 1C8QA 3GBDA 4FNTA 4AEEA 1GOMA 2DVTA 2OQLA 4DXKA 1CWYA 2BXYA 2QUMA 2INZA 2OVLA 3MMTA 2X7VA 1D2KA 5L6UA 5A5WA 5G2WA 1H50A 3KCOA 4DHGA 4OU1A 5FF2A 4YYCA 4IQEA 1RQHA 1F3EA 2EKCA 1H62A 1L0PA 3H4WA 3BLDA 2ZXDA 1G4EA 2XFFA 4I6VA 4KBXA 2PODA 3PANA 1W1B1 1LLWA 3T2PA 2CXEA 2Z0IA 3MB9A 4HU4A 3M6YA 4D6HA 2BXVA 3PWAA 3F03K 3NL3A 5CC6A 5BNKA 1ITQA 4F0MA 2PP0A 1VHNA 2ABAA 1LT8A 1BEUA 3RILA 1W1YA 3KTCA 1UWAA 1H63A 4REQA 2ALRA 4I8YA 3G5EA 3A21A 1F2JA 3F5KA 3MUY1 1P0DA 4P61A 2B4GA 2OQHA 1HX0A 1HF6A 1W0MA 4H01A 3XINA 5M5DA 3F2CA 4S3GA 3QHOA 2O4MA 2VM8A 4F0LA 3G77A 1UKSA 1E1CA 1WYIA 1RCXB 2QCFA 1H60A 4M7SA 2W92A 3VU2A 4J3TA 3DC0A 4J9JA 2P53A 4FP1A 2CIPA 4G7EA 1MUWA 3ITXA 4R7OA 1PKNA 2G8ZA 1YIXA 1XIJA 4LYQA 3NQFA 3AYSA 1BD0A 4A22A 3M5YA 3BCFA 3GHRA 1ICPA 2J7FA 2R1NA 1U5VA 5IFPA 2VC9A 1OD0A 3HF3A 3RJYA 1EEXA 4QSFA 3OQEA 3DECA 2V38A 1ZCCA 5I3KA 3USZA 4HNTA 2MUCA 4ZSTA 4HYWA 2WJDA 2BOGX 1FH9A 1UP0A 1OF8A 3A3XA 2ZRYA 3H4GA 2GPTA 5BWAA 1J6PA 3BC9A 3QHNA 2Y85A 5CPNA 4UQBA 3PUGA 3QSRA 3SI9A 2QCHA 4ZSUA 3IGHX 5E0KA 1Z8AA 4OBTA 2DSWA 3PS7A 4PC8A 2HNHA 4Z1YA 1GYLA 3URQA 1V4YA 1DWIM 4JIRA 3WD2A 3ZWTA 4B5UA 3AYTA 3GUGA 4JIQA 1IHIA 3UY7A 1KM3A 2PDQA 4O1EA 4NJGA 1PEZA 2VD8A 3S1WA 3B97A 4DQWA 4NJJA 1GOXA 3OA3A 1PWLA 1U1UA 1WKFA 1Z41A 2ZTKA 3CZKA 4DWSD 3ONBA 3EOOA 1DE5A 2WNQA 4DO7A 1R7AA 2ZUTA 1G4SA 5LNUA 1UZHA 4PMRA 1W3TA 4XTIA 3S6OA 3WJZA 1W3NA 1QAPA 2FZDA 2NVDA 4JCLA 2HPMA 1O1HA 2TPSA 1H0IA 5T8GA 4OV9A 2XVNA 3G2GA 5FF7A 5G4HC 1UOKA 4PTVA 3MZ2A 1S1PA 1R3SA 2PDMA 3WDRA 1UD2A 5D37A 2YBTA 4O54A 1EQPA 3VOIA 3LY0A 1QI4A 5I3JA 4Q7IA 3O15A 3LQGA 3EWXA 1OG0A 3H55A 2A3BA 1W1IE 3GTFA 1DQWA 2V3EA 4EACA 4N9CA 2PWEA 3QN3A 2PBGA 2J79A 3A3HA 4FHAA 1IZJA 4C6FA 3LMZA 1WXYA 2J6VA 4IFRA 1YPXA 2DORA 3WUFA 1ICSA 4XAYA 4E8DA 1EOMA 3FJLA 1FWSA 1ZS2A 4X63A 4WSHA 2P10A 5L9FA 1XX1A 4LUSB 4UR9A 4UBPC 1GVEA 4QCFA 3KOZA 3QMRA 2RUSA 4PFMA 1ZJAA 1P6BA 4GBUA 1BHGA 3V0UA 2YZRA 4FNPA 4L1WA 3FY1A 2XWDA 1C9WA 4P2VA 1A4LA 1A80A 3LM3A 4GVGA 1Q85A 1AL8A 1OWQA 4E3TA 3IK4A 2BGNE 4C6NA 4DEFA 3CV1A 4Q3MA 4W4QA 4A3RA 2YW4A 2R1MA 1SGJA 1JR1A 4L9XA 4PSPA 5JMUA 3SFWA 3MO4A 1XLEA 4KFOA 1XJBA 1FUYA 3UZ5A 1AD1A 1PX8A 2A3EA 1UD6A 1DE6A 4KWUA 1NP2A 3P8IA 2OQYA 2FMNA 4ES4A 4L4LA 2FFCA 3RIKA 1FRBA 4B5XA 4RKAA 3IGUA 3UPWA 1G4PA 2Y7GA 2Y2WA 1EKOA 1PDZA 3W2JA 1MYRA 5I78A 1WBHA 4GJ1A 3VXGA 4WXZA 4DUVA 2NQJA 4PEEA 4LY4A 3TYUA 3UW6A 3DENA 3G0XA 3MSYA 4LYRA 1GTHA 1XSKA 4IIGA 4O11A 3LXAA 4HHPA 4Z1BA 1UKTA 3RNDA 3MVIA 3UXKA 5BROA 4IP7A 3DBPA 2CLKA 1UWUA 3AS3A 1UW9A 2A4AA 2PDGA 1F3XA 5HJLA 4FIQA 3PFRA 3FDGA 4PA8A 1ZBVA 5CSYA 1KCLA 3AMDA 6ALDA 2VR2A 4HYVA 2ZKMX 4FLQA 1VFOA 1XLCA 1W9VA 3NVDA 2HK0A 2DFAA 4XVEA 1A5LC 3S9IA 3W2LA 3URBA 1RSCA 4C65A 4KWSA 1ENUA 5EMMA 4AEFA 4MTVA 2E7FA 1UR4A 4ZOEA 3JU2A 1PTDA 4O4VA 4DBEA 1Q6DA 1P6WA 3S1VA 4PBGA 4U5IA 2JGYA 3H2NA 4AY1A 3HFYA 1CECA 2XIOA 1FWWA 3NDYA 1E70M 1OCNA 3WDHA 3MJYA 2PDNA 1LBLA 3KDNA 5BU9A 5HNTA 3CAVA 2J78A 5JBFA 1UHVA 4J3SA 1VFTA 2OWXA 3I3DA 4I9JA 3GK0A 4AZCA 5IDZA 4LU0A 3A4XA 4R53A 1I0BA 1TPVA 2PCEA 3VIGA 4ZL1A 3EMCA 2DZTA 1C7TA 1V6VA 1BPLB 7PTDA 1E1FA 1W9BM 3PJWA 5HINA 4AYSA 2Z24A 4JQ1A 1QUMA 5IRPA 1SPQA 1THFD 5DBUA 2VOMA 2OGJA 1R3YA 8A3HA 1L6SA 1UR1A 2PGFA 2AL1A 1B9ZA 2YCLA 2BMBA 1Q6OA 3FIGA 3GC4A 2IQ0A 3RITA 3WEOA 4ZTXA 5CZTA 3NGFA 4QQ3A 2YGYA 1AMKA 3A12A 3W2MA 4GFIA 2YYTA 5EMUA 3A4JA 4HU8A 1QMLA 1TJPA 2V2DA 3LRMA 3EDKA 1OK4A 5B80A 2P50A 1CB7B 4DWSA 4IMEA 4QS5A 2WSRA 4LAMA 1DOSA 1LRTA 3RLUA 4ZOCA 2DT1A 4GIYA 1VH7A 3ARTA 3PAJA 1KCZA 2PU0A 4ORIA 1TX2A 2D0FA 2AKZA 3WQEA 2GWNA 2YL5A 4UTWC 3WY1A 2BHZA 3PJTA 2BWGA 1S2AA 3GHUA 2ZIDA 4S3DA 3KRBA 4ZQPA 5FSDC 4MG4A 1I2NA 5TNVA 2YXOA 4PE8A 4YPJA 2OLHA 4NNCA 3W88A 3TW9A 1J8VA 3W24A 3M0XA 2OWWA 1DIDA 2DSUA 3LPOA 4W7WA 3CGTA 4AZHA 2BZNA 3UT0A 1POJA 3HURA 3TZFA 3PBYA 3M5XA 4GUJA 3PPFA 1B31A 4QEHA 5M2FX 3WL0A 4DI8A 1OSEA 1QT1A 4AHQA 1XGEA 4X0NA 2ZOXA 4HMNA 2WBGA 1OB0A 1VJSA 1XFCA 4UTTC 5AYBA 4FOJA 1CLVA 1J0KA 1BVNP 4FXRA 3UFYA 2D0GA 1KRAC 4I90A 2NQHA 5AC8A 2JQXA 3QC3A 2D22A 5GNYA 3C2FA 3S5NA 1ISWA 3UU0A 5E9XA 3LUTA 2QJNA 2BNJA 4NQ1A 3CC1A 2G50A 3EPNA 3Q65A 4ZB0A 3W53A 3TN4A 5A6JA 4GVIA 5JVLA 3GG0A 1NWSA 1SVDA 2W5FA 3MKCA 1OABA 1M68A 1HP4A 3G0UA 1GOWA 2XIMA 4RW5A 2DIJA 3H2CA 3TWAA 4ALDA 3T44A 2ODOA 3QHMA 4JTUA 1GYNA 3W87A 3KBNA 4QLJA 3G1AA 4JS3A 2J25A 5CGMA 4IX0A 3GXDA 3R1ZA 1ZHAA 3IPWA 1RBLA 2WMFA 3CHFA 1UIOA 4C1NA 4C5ZA 4QLLA 4XIMA 1BF6A 2OGYA 5HMEA 2V3GA 4IPPA 4XAZA 1TCMA 3GS6A 2O4QA 1Q6LA 1GORA 1JPIA 3M43A 2J88A 1IEQA 2WZTA 5E1QA 2J7GA 4WF7A 3RDKA 2FMOA 1AH4A 3OO2A 2HS6A 2WJFA 1M01A 5FEZA 3PVFA 1SJDA 3TA9A 4I5XA 3VOCA 4IIHA 4PCNA 3VINA 4LAKA 3OZOA 3B0UX 4B5SA 4JEQA 3GVWA 5AHMA 3QW4B 1SYTA 2HK1A 1ZAHA 4LX4A 1LUCB 2P3EA 1DEDA 4U2ZA 4RCXA 1W9DM 3U2ZA 4ZO8A 2ZXQA 3SQMA 4HCDA 4DBWA 2VQUA 1JZ7A 3RM4A 4CD4A 1J0HA 1I1XA 3VYLA 4NAFA 2DZXA 3JS3A 1M7JA 3TLLA 2EQDA 5F4SA 1BYDA 1W3IA 3S6DA 4QE5A 5BOEA 2DV0A 2AL2B 2PD9A 3M0ZA 1KB3A 3SAZA 5I5RA 2EO7A 2X0SA 4O8RA 2ZRUA 4PL2A 2GJXA 4PTXA 4WY0F 4FI4A 3MDWA 4HHLA 4F3HA 3T0BA 1EX5A 3OW1A 4JFTA 2J47A 4J1OA 2Y63A 1QI0A 3UQNA 3FK4A 3KW3A 2ZVRA 2E25A 4RUBA 1TVPA 2NLYA 4GABA 1R46A 4TVUA 3UWQA 1S38A 4D6DA 4H9YA 4MKSA 1EZ2A 1J5TA 3S5OA 3CMJA 5E0CA 4JTHA 5IDIA 2QS8A 3FXGA 1M04A 4BHYA 1VF8A 1GEHA 4H3DA 3GC5A 1YHTA 2WMJA 2D3NA 4I7WA 1HUVA 1QR7A 3AMLA 4FPSA 4HNVA 1WB0A 1H1ZA 1Q13A 3LG3A 1F73A 1H61A 2YXGA 3TJLA 1TTIA 2NSOA 4F9DA 3NZGA 1UH4A 3W85A 3MI2A 3BOFA 3UGRA 4WHBA 1L2UA 4NX0A 3S2JA 5I79A 1V3LA 1QPNA 4JTKA 4RE0A 1D8WA 2X1TA 5D38A 4US6A 4CQ9A 1JGIA 4MADA 2F84A 1VBJA 1VB9A 3V0TA 4H6RA 2GSEA 1K02A 3V0SA 3UESA 4DVOA 4L6DA 3OVPA 3BGJA 1A3HA 4WD0A 5FJJA 1W1VA 4K36A 4GQGA 1E3XA 2V5KA 3ARWA 2BOFX 4AVOA 1XDMA 1E5JA 5HJYA 4UTLA 4O50A 1T8XA 4IPJA 2I5QA 2XH0A 5DFAA 3WLNA 4ZGYA 2QCCA 3BOLA 7A3HA 4FOKA 2RDTA 2YCKX 4QROA 1I6NA 2XTKA 1EP1A 4ILSA 3VNIA 1O5XA 4HQVA 2PDJA 2R91A 4E0CA 1UWIA 1CW2A 4NZ3A 3QKZA 2O9PA 4OIFA 3BMVA 4YN5A 2Y70A 4H8HA 4O4WA 3TEVA 1VPQA 2I9EA 4EXQA 4NZCA 1DWHM 1V02E 4JTEA 4S3JA 3SR7A 1J2WA 4ENLA 4XTDA 4C1LA 3RLGA 3AU6A 4MB5A 6TIMA 4GZIA 2VZTA 2XSXA 3D3AA 4JHZA 1QW7A 1VFFA 4O19A 3KHDA 3DKJA 4Q4PA 3STGA 4TU1A 3I4KA 4F9JA 1LQ0A 5C54A 4ML4A 3MY9A 4ZQRA 4U3CA 3A23A 4NJHA 1VBGA 2AAAA 2HE5A 2FFIA 3MV01 4XBSA 5CLTA 3ENLA 1RVKA 2EPNA 3L66A 4LGXA 7CGTA 1V51A 3E96A 2WOQA 4UB9A 3E0VA 2QCDA 3QQ0A 1VAHA 1MI3A 1DORA 1J0IA 2VEIA 3CB8A 3HJEA 3V7PA 3UF9A 1IXPA 3GFYA 4IFKB 3T08A 4GO9A 4KRZA 2X1UA 3QOMA 4S3EA 4Z2JA 3CUGA 4XKYB 2Q01A 2AMGA 5LIXX 3PWGA 5C9XA 1GZ1A 3R25A 2OPJA 2P88A 4BQ5A 1QNSA 1RAKA 3FA4A 1NOFA 1F6PA 4MZ8A 3IACA 1KLYA 4LC6A 4H6QA 3NXFA 3DERA 1XRFA 3QFWA 1E73M 1H41A 2YDRA 1MNSA 2X09A 3R94A 4F0RA 3TQKA 5JH1A 2XFRA 1A5UA 2DJLA 3MHFA 1Q6EA 1ECQA 1P7TB 4H7CA 4XQ6A 4E2VA 4HA3A 3S1UA 3PG8A 3WJWA 3ZLGA 4NZ5A 4GH1A 4U3AA 1H5VA 1MXDA 3B0VC 1YDNA 2X05A 4UNKA 1UD5A 3KXQA 2DSVA 2VR5A 4HHHA 1C8XA 4NZJA 4HBKA 5CGQA 2XVKA 4FO4A 2YIHA 2Q3RA 1X39A 1JI1A 5G2HA 5DANA 1NWUA 3IIVA 3VCRA 3R4IA 3LGGA 1XFBA 2WVVA 2NWRA 1MEHA 3ZJ8A 2E1WA 4JTSA 4C6EA 4AC1X 2E9MA 3P67A 1FWFC 1JZ4A 3CQ0A 4GWEA 2PF8A 1PO9A 4KWWA 1AZ1A 5AYIA 4K1GA 4DYEA 3EWUA 4N6FA 2QEZA 2CLEA 3UR7A 1SM9A 2GVLA 3JW7A 4EXAA 5JUVA 3BAJA 4G8TA 1AL7A 3GIPA 2OZTA 3VDGA 3LU2A 4LF2A 5BXPA 4RPQA 2VDGA 4CNUA 3CV2A 4Z0JA 4NF7A 1XCWA 3QQ1A 3KE0A 2OLAA 4JNYA 4M29A 3CEPA 1G69A 5HR6A 3T09A 2CHRA 4W93A 1TWWA 4IT1A 2ZUUA 1BWLA 2WKGA 1MWOA 4NXSA 1Q6RA 1LDCA 3B8TA 3E12A 4HA0A 2PURA 4EKJA 3ME3A 3HV8A 2H9AA 4AIEA 3FKRA 3BICA 5M1TA 5ABFA 2F38A 4W8BA 1XHGA 1LLOA 2WPBA 3CO8A 1QU4A 3M07A 3EX1A 1GZGA 1VCFA 3W7HA 3GVQA 1V6XA 1XM3A 3A3WA 3OA5A 1UD8A 1D7KA 3CQJA 3BG9A 4IG2A 3OJGA 2J7EA 1AA1B 1E6XM 4FS9A 2CBVA 2QCGA 3CASA 1KGWA 4D8AA 1WUFA 3T4WA 1KFBA 1QOQA 3CYJA 1C7SA 1JGMA 2FPTA 4A8RA 3H6OA 3BUVA 4MIMA 1FCUA 5CQ1A 4QBXA 4UZUA 3GNOA 1ZY9A 3WLKX 1AH0A 1QTWA 3RM9A 3CNYA 3SIMA 4EWJA 3QLDA 3W3OA 2WJEA 1VFHA 1UC5A 4MWAB 2W3ZA 2WMKA 4LEFA 3VDAA 5A95A 1QPKA 4NAEA 2VVSA 5A3HA 1FH8A 5A2BA 2B31A 2VTFA 4FX8A 4G1NA 1S5NA 3MBDA 1J12A 1Q7MA 1YKWA 2WB5A 1DWGM 4GYPC 3A9BA 5CPSA 1DHKA 1F4HA 4YTRA 4NUWA 2ZDRA 4MM1A 2XFYA 3RYSA 4WKFA 1PPIA 3TTSA 1X97A 4PRWA 3REQA 1ZL1A 2PRMA 2C8NA 3GXPA 1FFRA 1PS9A 2Z1BA 4MB3A 4QX4A 1KKRA 3LHTA 3LEPA 4GKLA 2J24A 3TWBA 2F2HA 1YNQA 3USBA 5AVHA 4C7GA 2ON3A 3CMGA 3WK2A 3IK2A 2DT0A 4YXGA 4O17A 1RH9A 3OU8A 3BW3A 3KBSA 3IJ7A 3G6MA 2QGHA 2XZ9A 3P81A 4LCRA 4P7NA 3N6JA 1SFTA 2O55A 2X1SA 3AIRA 1K1DA 3SQLA 3H2FA 1TTJA 3WJYA 3EWYA 3RJXA 3S2NA 1PKLA 1G7VA 4HOXA 1OYCA 2VRJA 1NIUA 3P2VA 4DUXA 3WH6A 2ZC8A 2Y8KA 2OOGA 3VK5A 1M65A 1S2CA 2VMFA 4E8CA 4JTDA 4HSOA 5C9RA 4GD0A 3GU2A 2A85A 2EBNA 2Q8LA 3TOPA 1TELA 4BF9A 4GKTA 2V2CA 4KRTA 3MKVA 3VX0A 1K3UA 4GI4A 3M64A 2BG5A 3HGRA 2VGFA 1FWRA 2ATMA 2PGRA 5LGZA 2HSAA 3SEPA 3LLFA 1EBGA 2VCBA 3MBFA 1V3MA 3ARYA 4FX7A 5AY7A 5CC3A 3SECA 3RF9A 5LGXA 2QCEA 1RA5A 3L2LA 1F4AA 4K6AA 3WDQA 4R34A 4AZIA 1CYGA 4XB3A 2XVPA 1YBQB 4LSBA 3W7EA 2VRKA 2FZ9A 4Q4MA 3G1YA 4R9OA 3U9IA 4CNTA 4DAFA 1VCVA 2AKMA 3BK0A 4PMJA 2CITA 2I9UA 2D69A 3RCMA 4O0QA 5HOSA 1KBJA 1LTDA 1EF3A 2W91A 2D3LA 1KRCC 3BDKA 3BARA 3LNPA 2Q02A 3MQTA 2BP1A 1YE6A 4AIUA 4ICMA 3EXTA 1UD3A 4WSKA 5C0QA 3BWWA 3MMUA 1ZQ5A 5GVJA 4GQRA 4WR3A 4CNNA 4IQJA 1H7OA 5AC5A 4UQEA 1YE4A 1Q66A 1WV2A 4REQB 2VL4A 3VGGA 3I7SA 3KBVA 1WOBA 4BQ4A 3T0CA 4CU8A 1XLHA 2FTPA 4YIWA 4WLCA 2POTA 1NFGA 3UVAA 4JKMA 3FHQA 3G8EA 4LYPA 1W1PA 4AX7A 3GM8A 3KM8A 5G4EA 1E1CB 4TO8A 2YL9A 1I75A 1V3HA 1XWYA 3B9OA 3N17A 1EPXA 3AZTA 4AC7C 5I3GA 5F2IA 4FAMA 2CLMA 4ZA0A 1K8YA 1QO5A 1V3KA 1XL9A 1I4NA 3SGUA 4G7EB 4A4AA 2A2IA 3WUBA 3WBYA 4QISA 1KBIA 1I2PA 3CZGA 3OLIA 2OFJA 3QZEA 5AHFA 4AG0A 1POKA 4Y90A 3QJAA 1SQ7A 1KQYA 2PS2A 4J28A 1TMHA 5DXXA 4RDYA 3FKKA 3B8DA 1WA3A 2C0AA 3LXCA 3PN8A 3U0HA 1V77A