1T40A

Crystal structure of human aldose reductase complexed with nadp and idd552 at ph 5
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
316
structure length
316
Chain Sequence
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title The crystallographic structure of the aldose reductase-IDD552 complex shows direct proton donation from tyrosine 48.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 104
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2004-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1t40A00
1QWKA 1YNQA 4Q7BA 4HBKA 1XJBA 2PDBA 1AFSA 1T40A 2C91A 2FZBA 2HVNA 4WDTA 2ACQA 5HNTA 3LQLA 1T41A 2PDUA 2PDKA 3UG8A 4XO7A 4NKCA 4IJCA 4QR6A 4XVDA 1Q5MA 3R8HA 3C3UA 1GVEA 5LIXX 3WBXA 4GA8A 4XZHA 3Q65A 1PYFA 2F38A 1ZGDA 1QRQA 2QXWA 2ACRA 3O0KA 3V36A 1US0A 3GUGA 3M4HA 4PRRA 4LBSA 5AZ0A 3UYIA 3UZYA 4JQAA 1JEZA 4JTDA 1A80A 3R6IA 3NTYA 2PD5A 4XK2A 2PDNA 2PEVA 4OTKA 2NVCA 4JQ2A 2IKIA 1C9WA 4WDXA 3LUTA 2ALRA 3UZZA 1K8CA 3FX4A 2F2KA 2PD9A 4L1XA 1YE4A 4JIIX 3U2CA 1J96A 4I5XA 3CMFA 4WEVX 4L1WA 1MI3A 2PDJA 4GABA 2BP1A 5LIKX 5LIWX 3GHRA 1S2CA 2IPWA 2PDGA 1AZ1A 3BURA 2R9RA 4EXBA 3CASA 2IS7A 2IPGA 2IPJA 4DBSA 4DBWA 1Q13A 3R43A 1OG6A 3EAUA 1XGDA 1X98A 3CAVA 1AH4A 3UFYA 3BV7A 1LWIA 3WBYA 4GIEA 3LD5A 3V0SA 1Z8AA 3LZ5A 4XAPA 3G1RA 4IJRA 4LB3A 5M2FX 3WBWA 3V0TA 2PDIA 3R58A 3LENA 4GCAA 3V0UA 2ACSA 3WG6A 1X97A 1Z89A 2J8TA 4QX4A 2PFHA 4GQGA 1RY0A 1EXBA 1R38A 4JIHA 3D3FA 2DUZA 4RPQA 4XZLX 3R8GA 1EKOA 3F7JA 5HA7A 3LBOA 3UZWA 2FZDA 3R94A 1S1RA 2FZ8A 3N2TA 2BGQA 2HE5A 3COTA 3VXGA 5DANA 3V35A 5JH2A 1HW6A 3MB9A 1ZSXA 4XO6A 5KETA 2A79A 3Q67A 4LB4A 4QXIA 4XVEA 2BGSA 4LAZA 2PDFA 1AH0A 2PDWA 2IQDA 4EXAA 2PZNA 3FJNA 3CV7A 4GQ0A 1S1PA 2HE8A 4IGSA 2P5NA 3ERPA 2I17A 4FZIA 4YU1A 3EB3A 1VP5A 4LAUA 3R7MA 1UR3M 5LIYX 3CV6A 2PF8A 2CLPA 4QBXA 4XZNX 1Z3NA 2PDXA 4XZIA 3QKZA 2WZTA 4PRTA 4MHBA 3LZ3A 3LN3A 2PDQA 2DV0A 3GHUA 2FZ9A 4H7CA 3ONBA 1SM9A 4ICCX 4AUBA 5AZ1A 1RY8A 2PDHA 4Q3MA 1PZ1A 1Z9AA 4JIRA 4JTRA 4WRHA 2HVOA 4HMNA 4FA3A 1X96A 1PZ0A 4PUUA 4YVPA 2INEA 4ASTA 1IEIA 4WGHA 3BCJA 1EL3A 4LBRA 3KRBA 2PDLA 4H8NA 3UWEA 4JQ1A 3RX3A 2PDYA 2ACUA 3LNMA 3DN5A 4PMJA 5HNUA 1LQAA 4GACA 2INZA 4ZFCA 1AZ2A 3O3RA 3P2VA 3EB4A 2DUXA 4G5DA 4YS1A 1MRQA 3H7UA 4JTCA 2HEJA 2IPFA 2I16A 1XF0A 4JQ3A 3BUVA 2IQ0A 3DOPA 3LQGA 1YNPA 2PDMA 3UGRA 3CAQA 3GHTA 1S2AA 1PWMA 1VBJA 3N6QA 4DZ5A 2R24A 3G5EA 3H4GA 1MZRA 1PWLA 2FVLA 4F40A 1HQTA 2WZMA 5C7HA 2ISFA 3S3GA 5LIUX 3H7RA 1AH3A 3T42A 4WDWA 3WCZA 3UP8A 1FRBA 3MC5A 3M0IA 4DBUA 3LEPA 1M9HA 1ZQ5A 1ZUAX 1YE6A 2PDCA 3UZXA 4YVVA 1EF3A 4JQ4A 4XZMX 5JH1A 1IHIA 4FAMA 4YVXA 4JTAA 3GHSA 2IKGA 2VDGA 4PUWA 3ONCA 4FALA 2PDPA 3RX2A 2AGTA 3M64A 2NVDA 2HDJA 4WDUA 2FGBA 1RALA 2IKJA 1ADSA 2HV5A 4R9OA 3RX4A 3B3DA 2IKHA 4PR4A 4JTQA
chains in the Genus database with same CATH superfamily
1G67A 4XUGA 4D1IA 2FB2A 1UR1A 3KBVA 3TKFA 1P0DA 4UZUA 5FA5A 3GX9A 1CYGA 2PLJA 4I7WA 3P61A 4ZO9A 4UR9A 2VX4A 2CLEA 5K7JA 1OD0A 1X6NA 4IJCA 3WL1A 4JTTA 1TMHA 1RBLA 1ZGDA 5EMUA 2VGBA 3O7UA 1I1WA 5H8PA 1Q3NA 3OQ8A 1S5WA 4QE1A 1XCWA 3P74A 3CHCA 3WFAA 3A4XA 3SY8A 1GOQA 3A6OA 2BLEA 3GNXA 3GRIA 1ZJAA 2ISSA 4WSJA 2VC7A 4F0HA 5E9XA 3C3NA 5EFFA 5IXEA 3ZT6A 1RJQA 3VYLA 4DZIA 1E51A 3HIJA 3DYMA 1UWUA 5T91A 3LNPA 3FVMA 4IF2A 1NQ6A 2G4JA 4ZL1A 1QPQA 2CLMA 2ZUWA 2ALRA 3RO6A 2WNQA 3K30A 4TQTA 3T2QA 4US5D 4JIIX 2VZTA 3TV8A 1BF2A 4DWDA 1AK5A 3GXMA 4L1WA 4GYJA 2YCKX 1I75A 3NZ1A 2V3DA 1UZHA 1YQ2A 2R91A 1J2WA 3WH8A 4HU4A 4GQRA 3KBWA 2FFCA 3WQCA 1GYMA 1V02E 1XP3A 1F74A 4GUJA 1G4TA 4IMCA 3DGBA 4HMDA 1F61A 4F8XA 2DFAA 2JIEA 4DRSA 2Z24A 5AC8A 4E2DA 3JZEA 2ATMA 1WUFA 3E12A 2DP3A 1PHQA 2XPKA 4H6EA 3UFYA 2W62A 3OYXA 3V0SA 1V77A 1Z8AA 3W38A 1XUUA 4RPPA 3TYZA 3QY8A 4QS5A 4L7ZA 5A8NA 4MMWA 1K6WA 2FJKA 2MNRA 3WQGA 3VM7A 4KIEA 4LV4A 4IGNA 4MF4A 1R9ZA 4KRUA 3IJ8A 4EPDC 3VIIA 4TVCA 1TTPA 2P0OA 1KLYA 3OG2A 1Q85A 2GGEA 5HUPA 4PBEA 2P3EA 4QX4A 1Q7QA 3EX6A 3BDKA 3CT7A 5AHFA 4BWLA 1K3UA 4DWSD 3QGAC 4DI8A 2E1WA 1PAMA 5DEZA 1HKKA 3ARVA 5HWNA 4JIQA 4C91A 1OFOA 4NAFB 3GR8A 3I65A 3H55A 4JN6A 2PTWA 3A4AA 4KH2A 5TD4A 5LNWA 1U5VA 4BZYA 3UQNA 3ZSSA 4AMCA 4UOQA 3N2TA 4FLQA 3KCJA 4EVZA 1KFEA 4OUEA 4GO8A 2GLKA 2A79A 1W9VA 5CCZA 4GG9A 1F8IA 3O8AA 3HPSA 1ML1A 1K9FA 1UUQA 6TAAA 5KTLA 4UBPC 2QUTA 1GVIA 3PN8A 2OPJA 1PTGA 3LCIA 1PHWA 4GQ0A 3PJXA 4CGTA 4P2VA 4KBXA 1GHSA 4Q6XA 2Z27A 2YXOA 2Z4GA 1Q8AA 4H83A 4CU8A 1I0DA 4KGJA 1VFTA 4D6DA 2CERA 2I17A 1NEYA 5BRPA 4KWOA 4LAUA 1FWDC 4WR3A 4O19A 2VT0A 1Z6KA 2ZC1A 4LGXA 4RE3A 4U3AA 4LXFA 3IVUA 4ZB2A 1Q8JA 3SIMA 1KO0A 4NUWA 1OFPA 4XZIA 5FSDC 1SJCA 3FDGA 3MHUA 4CVUA 3KUMA 3PNUA 3E96A 3APTA 4I7VA 1A50A 1PSCA 4X63A 4QCFA 3GHUA 3PPHA 3MBFA 4MPKA 2E9MA 3AIBA 3CUXA 2W5FA 2ZZ7A 2PBGA 4UNIA 5LA2A 3AS3A 1LT8A 3QQWA 4ASTA 4LALA 3W6LA 3G0SA 3NNTA 3ZR6A 4LCQA 3L5MA 1UKTA 4N9DA 2OSXA 3WLSA 2E1DA 1EOKA 1E4NA 4AZ6A 1LG1A 4PC8A 2CLLA 3EB4A 3EMQA 4JTCA 1Y5VA 1O94A 2VEIA 4L64A 4D6GA 2VRQA 5CPSA 1RA0A 2VFDA 1VLIA 3LI0A 1UPMB 3UJEA 3CBWA 1IXNA 3ZO9A 1J0HA 3VC6A 3GDBA 4PTXA 1G5AA 5I77A 3ARTA 1QI3A 1MFVA 3T09A 1MZRA 3ZSTA 4MKVA 3WUEA 3H4XA 3MHGA 2QJJA 4DWSB 1DBTA 1R3VA 1TO3A 2P8CA 3IIPA 1WYIA 4KMQA 1GORA 1N8WA 3GDTA 2ZZ6A 1ZY9A 2Y5SA 4YXGA 1RVGA 3KLLA 3HPXA 3F2BA 3VILA 1H5YA 4MSSA 1ZUAX 3PAOA 3N4FA 5D9PA 2ZYFA 3UJSA 1U83A 1KFWA 2GK1B 3ITLA 3P0XA 2J25A 1ZP3A 2VC6A 1WA3A 1X7IA 2OB3A 4JTHA 2XN0A 3M47A 1UOZA 4YVXA 4JAWA 2VDGA 4PUWA 2WCAA 3EOEA 3VKJA 2QUNA 4NJGA 4JDBA 1V0LA 4HNUA 2PI6A 1EJSC 3FLUA 3GNDA 2WKLA 6ALDA 4G1NA 1LLWA 2JGYA 4F79A 5K4XA 1NDYA 2YYUA 4PMZA 4DELA 1GKQA 1J01A 4XB3A 2C3ZA 2NV1A 2YLLA 3WUBA 3TCEA 3VDCA 2BASA 4XBJA 2XSAA 4XVDA 4KFNA 3QEZA 4GA8A 2ZFAA 3VIFA 1XYBA 5JMUA 4AF0B 2C15A 1JPDX 1M7JA 4JFWA 3M5ZA 5G2HA 4C5YA 4LBSA 2WZEA 1GKRA 3F4DA 4ZFMA 2J4GA 1RJRA 4JQAA 4H8UA 4AU0A 4JHOA 3PS7A 5EMKA 4CCZA 2RDXA 2XVNA 3QSTA 4LC6A 3KP1A 5I3DA 2VHLA 3T44A 3UXLA 2RAGA 2R1NA 2FPVA 1NY1A 3OBKA 5F1UA 2ABAA 3ATYA 3NZRA 3PFRA 5LHFA 3NQVA 3CT2A 3SFKA 3MBDA 4DNHA 2GWGA 2YA2A 3H70A 1F07A 2E0PA 4RNJA 3N13A 3ZXWA 1RD5A 4ADSA 4Z2HA 4A8NA 3FCPA 1LZOA 1UH3A 2GVJA 1AW5A 4QGCA 4NRRA 2PLCA 4PCNA 2YCEA 4YTQA 3UWVA 3R2GA 3EWWA 2F84A 4AC7C 3ME3A 4OFCA 5CSYA 1WKFA 3MMWA 5KINA 1QNPA 3UA4A 5KZMA 2J62A 1OG6A 4PFHA 1KRCC 4AH7A 1S2WA 1KRAC 4O1DA 2QIWA 5I09A 4KGLA 1AH4A 4MUZA 3HF3A 1TELA 3U4AA 3VD4A 2CW6A 4OT7A 4CNPA 2XH0A 2PGFA 3NVDA 2DVTA 3IRDA 3W1TA 3BGAA 4I8YA 1TVNA 4XTIA 4C60A 2YZRA 3DFHA 3N29A 1YDNA 2Y1HA 2WSKA 1U1UA 4B5TA 1A53A 4UOJA 3V0UA 4DJFD 4PRWA 1Q6OA 2SFPA 3FA3A 3CU2A 1ISVA 3REQB 4DUWA 4Q8PA 2J8TA 2PWGA 4LY8A 1XSIA 3GXNA 1R38A 4N7QA 2GVYA 2PODA 3WIJA 2VURA 1I4NA 5K4ZA 3PG8A 1SW7A 1E0VA 2QCDA 4DXXA 5EYWA 3O05A 4I9MA 1DE5A 1TWDA 3BOXA 3PUDA 2FPTA 2GVGA 1SSDA 4GX8A 3PZVA 4S3FA 4Z2JA 3OP2A 1TCDA 1XD1A 1XLCA 1Y5XA 4JIEA 3PTMA 2XUCA 2VRKA 1TV7A 3GVWA 2WMHA 4XVEA 2RHGA 4LAZA 5PTDA 2PDFA 4QQUA 3MY9A 2RUSA 4ZOEA 1G94A 2DZAA 1UIOA 2IQDA 1ZL1A 1L8NA 1PJ9A 3K1DA 1RK6A 3RFAA 3ITGA 3VIMA 4LVAA 4ZQMA 2TAAA 3C2FA 3UXDA 3WK2A 1ZP4A 2A85A 2BDQA 5EGRA 1ZTVA 4IPIA 3NO3A 3CH9A 3TJIA 3HB9A 2G50A 4JX5A 3CHDA 4CNUA 2VTFA 3SEPA 1IT7A 5T9CE 4C7GA 3P82A 4O0KA 2CLFA 3E0VA 2P88A 3WD4A 3WEOA 1ISZA 4OZOA 1E70M 1ZCOA 4UTHA 4YJ5A 5AC6A 4H7CA 3ONBA 4AUBA 3UY8A 4PBFA 3STCA 1F3WA 1Z9AA 3P8IA 1AJ0A 4KCVA 3KX6A 3SRDA 4NNAA 4S3KA 4GRSA 3GXFA 2INEA 2VR4A 4FX8A 4QLLA 3FOKA 3DFNA 2A1YA 3NIYA 3L2LA 2EPLX 4WXZA 1MXDA 3WFLA 2PRHA 3QPZA 2UZ9A 5CC7A 2QAFA 5IBXC 5HQLA 2O4MA 3O6CA 3UWUA 2UWFA 4YS1A 4GYFA 1MNZA 2FPYA 3L2MA 3FW6A 3TC7A 3TYCA 5FD0A 1JD7A 1Z44A 4V1XA 3LQGA 3PR2A 4P7LA 1ZRQA 5I02A 4PULA 3LHTA 4AD3A 1SJDA 2WHMA 3UJ2A 4CN4A 1ZFJA 3GXDA 2JGQA 3HPAA 3IJLA 1QOXA 3NQBA 4S3CA 2FHFA 1EJUC 1F4AA 2Y4SA 2FVLA 1J5TA 3RG6A 1K9DA 4EX4A 5D32A 4LUJA 3GW3A 3RXZA 2HROA 2VELA 4JPGA 2J88A 3NQ6A 1W1B1 3GU2A 2WYSA 2CKSA 1G0CA 5LIUX 5HPCA 4FHAA 1EH9A 1FHUA 1GVSA 1E0TA 1M5WA 3G1DA 1P43A 5IDIA 3MCMA 4ML4A 4I8DA 3EDJA 1EZWA 4UZSA 1XCXA 4YLWA 3VZYA 4FS9A 4JYFA 3LCXA 1IHIA 4FAMA 2PP3A 5I7GA 1XKJA 4ZBCA 3NWRA 3ONCA 2W63A 1OIFA 3GIYA 3H2MA 4OBRA 3NR0A 3P84A 1UW9A 2GGGA 3P14A 2DUAA 4H2HA 4C1NA 2ZWYA 1EFZA 1GQKA 3LSCA 4DBDA 4Z42C 3NL3A 2QVHA 2I5QA 2ZICA 1BSLA 1FDYA 2CXEA 2RGMA 2YBUA 5LIXX 3TDFA 1S46A 3LRKA 1Q6QA 4MY1A 4E4PA 1QFEA 3W00A 4AD1A 3LTSA 1DEDA 4MKSA 4WXYA 1V6VA 5I3IA 1GG1A 3GUGA 3KVLA 5CC5A 2OYKA 1F4HA 2G4FA 3MP4A 5CPMA 2QCGA 4RKAA 3TTSA 1XCFA 1TWWA 4GXPA 3V16A 1H41A 2PS2A 2WNZA 4LAMA 2OZ0A 3MU7A 5FEZA 3FHAA 2PDNA 3OU8A 3VGDA 4ACZB 1L9WA 1SO4A 1HN1A 3W85A 1XIMA 3S5OA 4BQ2A 3W7IA 4IT1A 3B8IA 3VTRA 3U5YA 3A9IA 3DFSA 1MUMA 4B5UA 2OZ3A 1R2RA 3EGJA 1EUNA 1H1YA 4IISA 3AXHA 1J0IA 2BXZA 5HJXA 4L1XA 1UD2A 5IHSA 3FA5A 1JZ2A 3RMJA 2XIMA 1W17A 4GJIA 1ICQA 2V68A 4TOQA 2W4XA 1P0BA 1MXGA 1DIOA 2D0GA 4LBUA 2FYMA 4RE0A 4HHLA 4B9ZA 3CTLA 4H7VA 4EXBA 1FH7A 1W3JA 1Q7ZA 2EAWA 3A3XA 1TWZA 1K7EA 3NUKA 2DT3A 2ZVIA 2DSUA 1H11A 1JI1A 1LUCB 2NVAA 3WQ6A 5C71A 2H3BA 4AQLA 4XAPA 2VXNA 3OO2A 1F6PA 3KOZA 1GJPA 3UWYA 4AEFA 1C9DA 1OB0A 2GSEA 5M2FX 3W7JA 4CKQA 4OKDA 4PMYA 1HP4A 1TREA 3SRHA 3TONA 3OLIA 2YW3A 3V0TA 2D0FA 1XIIA 3E02A 4IHCA 2JF7A 4QFUA 1JXJA 3M5VA 2BX7A 3AIRA 3DI1A 3MO7A 4OV4A 3C61A 2VX5A 2PC4A 5I6SA 4YWIA 2OOFA 3TYUA 2JKEA 2G41A 1MEWA 1HO1A 2PFHA 3W29A 4GZIA 4BHYA 1SO3A 1JZ7A 2OEKA 3GNNA 4ZODA 1U2YA 2QJGA 2VZSA 4JY9A 1VKFA 2IMRA 3GY1A 3RLUA 1LCOA 2GJXB 2WVSA 2IXVA 2VDHA 3FIGA 5I78A 3FXGA 5J5DA 2XH4A 3TW7A 3SCOA 1KM5A 3E49A 5A6SA 3ANYA 1K1DA 1YBQA 4NHVA 1X6LA 3W53A 4PMRA 1QHOA 4IICA 3BLDA 3BQ5A 4P7RA 1XQLA 4L4MA 3M07A 5BRBA 1NWTA 1K02A 2CESA 2UBPC 2B7QA 2RDUA 3F4NA 3VZZA 3BG3A 3LRMA 4UC5A 5AHNA 3DGRA 1T7LA 3BLFA 3PANA 3FJNA 3S5NA 1D7KA 1BTMA 2Y24A 4XKYB 1MMFA 4UTIA 1W1ZA 2J7HA 2WC3A 4UIOA 1XYFA 1TV3A 2NLIA 1QK0A 3PVFA 1UD6A 3XINA 1KGXA 3AXIA 3TROA 4CQDA 1R30A 3BLOA 4WY0A 1Q2SA 3QTPA 1TE1A 2WNNA 1IEXA 1QWGA 5HAOA 3DH7A 3THDA 2HK1A 5CZSA 2DT1A 2QPSA 3O1NA 1GWJA 4NU7A 4GH3A 2Y8VA 3HGOA 5F2LA 3MWAA 1QAPA 1WAUA 1ZBVA 4MNMA 4WRHA 2NQJA 3NAVA 3OVPA 6TIMA 2J9XA 5I3JA 3EDKA 3S2JA 3SCNA 4D6EA 1H62A 1GW1A 3EA2A 2EJAA 2GVEA 2V6AA 4YL2A 3QV8A 3WLHA 1GVRA 4H8NA 2J24A 1VFOA 3LBMA 1B3VA 1AW1A 1CI1A 5F2GA 3OLGA 3RCNA 3MKVA 3MVTA 1JZ3A 1R3SA 3O3RA 1N82A 1HTIA 2XVLA 5J04A 1W1YA 3Q94A 2QV5A 4E8CA 3WLKX 1WBJA 4W5ZA 3TOYA 4AZCA 2ZX8A 4HU3A 4A21A 1QW9A 3RJYA 2QMJA 3IUHA 7ENLA 1ZENA 2NX1A 1TPEA 3R11A 3LRLA 4HOWA 1XX1A 1FWFC 1QW8A 1OF8A 1W5PA 2WZMA 2ZUVA 1IE7C 3FGCB 4HNOA 3OVRA 2XFFA 5HULA 2E28A 4Q8QA 4ZOAA 1P7TB 2Y8UA 3RLGA 1PIFA 3BC9A 4IZGA 4J2PA 2V8ZA 3KOYA 1AQFA 3LEPA 4TMCA 3FVDA 2Q8ZA 4IFKB 1EZ2A 3E0WA 4A05A 2Q3OA 1EF3A 2NT1A 3EBVA 1TPWA 3EPOA 4FPSA 2RKXA 1G9HA 1XYZA 4JQ4A 1QT1A 4KEZA 2PA6A 2QIIA 1EA0A 4CCEA 5LNVA 4PCFA 3IJDA 1A5NC 5REQA 3U3HA 2PP1A 1E40A 2NVDA 3G18A 5DF0A 3CIVA 2BMBA 3RU6A 8A3HA 3EOUA 2ATSA 3W7GA 3URNA 3SAZA 3LV6A 3KW3A 3WY1A 3NGJA 4JXCA 3TAOA 2OSYA 1OZMA 2V0TA 1G7UA 1QNOA 3VABA 3EOSA 2Q6ZA 4O4WA 3OB8A 1IXOA 4D6CA 3DYPA 3H4WA 2XSBA 3G1AA 1PYFA 2NUYA 3L0GA 3W01A 1XPYA 5G1MA 4Z2KA 4G6CA 1FHLA 2HNHA 3E2QA 1PDYA 4HP5A 2OODA 1W1IE 4O1BA 4TTUA 2O9OA 1Z41A 5H8UA 1JGMA 3LYEA 4E4FA 2C0HA 3VD5A 4XK2A 3V5CA 4Z08A 1NOFA 4K37A 3RHGA 5TQLA 3WLTA 1Q6LA 5D9MA 2AAAA 4A29A 4U10A 2ZADA 4W7VA 1V3HA 1JGIA 1DWGM 2QDDA 2GGJA 2FLIA 3W9ZA 5I23A 3A13A 3UWQA 4UQBA 5CSSA 5FF7A 4REQB 3SUSA 3WLIA 2PGEA 4AHOA 3N9RA 1KQYA 4P7OA 1E1CA 1YE4A 3GBDA 5KEZA 1OHLA 1J96A 1WBHA 1GOKA 3DFQA 4XKMA 4Y9PA 2Y0FA 1L6SA 2OJPA 2CITA 1LG2A 2A3HA 3PBVA 4KCTA 2BP1A 3WN6A 4Q4OA 3KTCA 4W93A 1MEHA 5FJUA 1KFCA 5BMWA 3AXKA 3P93A 4JYEA 2J7GA 3G8EA 1W9BM 4EPKA 1XYCA 2Y7FA 2X0SA 2FTWA 4S3EA 5C54A 1SZFA 1ZAIA 3VIOA 1DWFM 4PCSA 3VUPA 1VFMA 1AL7A 3VNYA 4L4LA 3A4JA 4IXHA 3C0LA 3MO4A 4O0QA 5E0KA 3QW4B 4IH3A 5C2XA 1F7BA 4GK8A 3LU2A 3W2KA 5GJNA 3VU2A 4E5TA 4W84A 2X05A 2ZXBA 4QJ4B 4HMCA 5A6KA 4GY0A 5CC3A 3DYOA 4M3PA 4KESA 2QCLA 1IV8A 4H9MA 3PZTA 4PTVA 1BHGA 2FKPA 2VX6A 4IM4A 3WQVA 4DYEA 2A7PA 1TYGA 2V81A 1EXBA 3UY7A 1W5QA 1E5NA 1UKSA 3QOKA 3VCRA 1K4GA 5HMSA 3P6LA 3VM5A 5ABGA 3OODA 2Y7EA 3OZMA 4AXNA 5B7ZA 3MHFA 3TYEA 4NZCA 5I24A 1FFQA 3DX5A 1R2TA 1JCMP 3DI0A 1S1RA 1CXIA 5LNUA 3VXGA 4U2ZA 3GAKA 4A3UA 4E3VA 1NARA 1HW6A 3MB9A 2A6NA 3C0QA 3C52A 2WZHA 5K2ZA 2OR2A 1PS9A 4QXIA 4O17A 4C65A 2WVUA 1ZJIA 4Y2WA 2O4QA 4Q8OA 4WKFA 1FXPA 3OHMB 2CWNA 1VEMA 1X8FA 4W7UA 1H7NA 4J3VA 5C0QA 1B3OA 3FAWA 1V0NA 5A94A 1VYPX 1YXDA 3ERPA 4MKNA 3K4WA 4U2YA 5M03A 4C6QA 2OQYA 3C2RA 2PF8A 1E5JA 4OIFA 3DKJA 2D2JA 1PVNA 1WE5A 3KLKA 3ZOAA 1IXPA 1YIXA 5FCZA 2HMCA 3WMLA 2WZTA 1V4YA 1J8VA 4CQBA 1IF2A 4ICCX 1H0IA 3VC5A 2REQB 4F3HA 2WAGA 3H54A 5MKGB 1OADA 3U7VA 1W9DM 4O52A 3STPA 1I6NA 4OUIA 2YX0A 1P5BA 3VX1A 5D05A 2DZUA 3P3BA 5AKQA 3SRKA 1YXCA 3W0KA 2XIIA 1P4CA 5H2ZA 1FP9A 3W82A 1OGSA 1UZ4A 1KGUA 3RLHA 2B7OA 4JEJA 1VFUA 4GACA 2Z28A 4EPBC 2YLAA 4BEQA 4Z1CA 3BO9A 4IMEA 2JKPA 3NM3A 3H26A 1OVDA 3QPEA 1U22A 2G0WA 4J28A 1W5MA 4MUPA 3IV8A 3GW0A 7CGTA 4C6MA 4A8LA 1H1NA 4IGHA 3UNDA 3TH6A 1W9XA 2PDMA 1EOMA 1ME7A 1ZJHA 2WO5A 3GUWA 1CB2A 4CNSA 2VWSA 1FA2A 1XLHA 1ONEA 2YA1A 5AHIA 3N2OA 3G5EA 1QPKA 5CBJA 1DJNA 1KM4A 4H7ZA 3PBYA 4F40A 3M5XA 2WWCA 1JCJA 2Q71A 3WLJA 4D9PA 5HNRA 4YTSA 4AD0A 4JTJA 5DY2A 2WLZA 4UUIA 2F61A 5HMDA 3W2NA 3VAVA 4B5SA 3WJSA 1C91A 4ERIA 4NAEB 3QR0A 1BFNA 2D2HA 1VRDA 3SB0A 2MANA 1BYDA 1XBXA 1EGVA 4QEHA 3I3BA 4Q7IA 1FWHC 1OFQA 1ZBWA 4NYUA 2YCIX 1FWBC 1RH9A 5E1QA 4Q4RA 3F2CA 4H01A 3VD7A 2FB3A 2C16A 3Q45A 1FXQA 1H7XA 3VA8A 4F0SA 1AQHA 1N8IA 2PDPA 4F9DA 3QY7A 5GPRA 1HGYA 2DZWA 3UZJA 3BANA 1DJZA 2WBKA 2FGBA 3ZT5A 1B4EA 3V7PA 1SGJA 1M6JA 4XAYA 2J75A 1CENA 3ZVHB 2DT2A 3VGBA 2BXVA 5J8LA 3ITYA 4FF7A 3WJXA 2Y5JA 1FDJA 5FI8A 3SIZA 1AFSA 1VQTA 4MB3A 5FKYA 3QMSA 1BVNP 1ZCCA 3QGVA 4Y96A 1RBAA 3GD6A 5M3WA 1DXIA 3TYDA 3JRKA 2OWWA 3FV9A 3ZQ9A 3E0FA 2VCBA 1Y5WA 1UUOA 4NJKA 3V36A 1XRTA 2OZTA 3H2NA 1UBPC 5AB3A 2ZDRA 5CBBA 3DBNA 3B9NA 1EIBA 2X0HA 2PUZA 3RR1A 1MWOA 1KM0A 2P0IA 4EKJA 2Z00A 1FQ0A 3VMPA 3TTOA 2ZWZA 3HMJG 3K2GA 2VD8A 2XHYA 3UCQA 4IFOA 3QPYA 4NY2A 2HTMA 3ZZ1A 4A3QA 1R3WA 1PCKA 1Y65A 1JZ6A 1RLCL 4KWUA 3KZPA 1O68A 3GTXA 4QHRA 1GTEA 2FIQA 3LUTA 4D8ZA 4MTVA 3GZAA 5E93A 2F2KA 1NFGA 1UP3A 3E0IA 5A6MA 3P8JA 4I5XA 1QO5A 2IQTA 3MDWA 3N04A 4J4KA 2HVMA 5BRQA 4HCDA 1MI3A 1EO5A 3EWUA 4O1FA 2PSNA 3L23A 1Z7AA 4P7NA 1ICSA 2VEPA 3AYTA 4UTFA 4ONVA 1UYQA 2CNCA 1YTKA 2DVUA 3GR4A 1EGMA 5JIWA 1PV8A 2R9RA 3BK0A 2QQ6A 4Q4MA 3W28A 1HJSA 4JS3A 5AC5A 1B3YA 2EKGA 1OJXA 1OBAA 1VBGA 1DV7A 1DJGA 3N9KA 4W87A 3W23A 2VKZG 3APGA 3R43A 3VGGA 5XIAA 4H2CA 1V8EA 1N55A 3AIWA 1ZS2A 1XS2A 2EBNA 5FJTA 2GJLA 1LWIA 4HD5A 5AVHA 3HJZA 8XIMA 2J6VA 4EANA 7REQA 3GTFA 3EXTA 2VGIA 1A3WA 4IQDA 3G1RA 4GUGA 3CZGA 4LUSA 2BOGX 3SZ8A 2WJZA 3ZLFA 1KXVA 3IJ6A 4H6RA 2VEGA 2B4GA 3TN3A 1N8FA 1WXYA 4FNSA 2J47A 2NWRA 1CXHA 4X9SA 5BXTA 3TUUA 1GCYA 1XIHA 1JPKA 1LL4A 3SURA 2J8FA 3W24A 3BQ6A 4JY8A 1TV2A 2AQWA 1EJVC 1EBHA 3MI2A 2QZRA 4RPQA 4NF7A 1BXCA 1K70A 1OSEA 1DJHA 3BLEA 1EKOA 3TC3A 4MNKA 4R33A 4LU0A 5CG0A 1W3KA 3W1PA 3L4UA 4ZO6A 3MKKA 5KZDA 4H00A 1G1YA 4KRTA 3NQEA 4RDWA 2XH2A 1LQ2A 1ZNNA 4JL1A 4AIBA 1OD8A 5EMMA 1H51A 1VYSX 1XDJA 3SUTA 1Q2RA 1F3EA 4E3TA 3PBMA 3LXAA 3TP4A 3RK8A 2P76A 2BGSA 4U4MA 1DWJM 1ZBKA 4HK5A 5D2YA 2PZNA 4B5XA 2AOSA 2A5HA 4FNQA 1A5LC 1GZJA 2ZX9A 3LGDA 4NXKA 1A0CA 3OOQA 1X8CA 4JYDA 3A3HA 2POZA 3CWNA 3WLPA 3NSXA 3AS1A 3THAA 3EXSA 1VP5A 3BVJA 2DW7A 4JNMA 5JQ9A 4XBKA 1Q6FA 3CV6A 1SU5A 3LCLA 2CLPA 2YW4A 2Z6JA 5CSRA 3TC6A 2CIPA 2V3EA 1LWJA 1F76A 2CC0A 1P0KA 2ZTKA 3NYZA 2VENA 4B5VA 3U48A 3H6OA 3M1ZA 4GO9A 4GISA 5C9XA 1C29A 1CT5A 4Z1DA 3GH4A 4QDPA 5HATA 2CWXA 4ZE4A 1JDEA 5K9DA 3CHVA 2DGAA 3S83A 4WGHA 3QR1A 1LBMA 2ZZ5A 2UY5A 2HWGA 1EWDA 4YHEA 3N3MA 1JZ4A 1ONWA 2VX7A 5D2TA 2O9RA 2VVNA 1GOXA 2H9AA 3XIMA 1MVYA 1R3TA 1HKMA 4YCPA 1AZ2A 4L5ZA 5AN7A 2OFJA 1PYMA 2WHLA 3QV7A 2VUYA 1VZWA 2Y7DA 5BMXA 4B2DD 3NQGA 4DAFA 3B05A 4CD8A 4N9CA 1S2AA 1DQXA 4JN8A 2EPKX 2QGHA 2R24A 3FEQA 1VFHA 1UD8A 3NCOA 1H0GA 5E6YA 1TA3A 1D3CA 4NSBA 4IQEA 4HK6A 4XAGA 4RR4A 4OV9A 2X09A 5C55A 1YPXA 3AIEA 1SZEA 4KRZA 4R53A 3N4AA 4ACYA 2ISVA 1BPLB 4DBUA 3QHOA 3KP0A 2JEQA 1E56A 5J5RA 5A6JA 4Y9AA 2Q8LA 3NXLA 2BV9A 4K39A 4AY8A 5L6UA 4K38A 5HWMA 4J3XA 3GHSA 4FALA 3W7NA 1I2NA 4WJXA 3RX2A 5H8MA 4ZXLA 3BAYA 3ALGA 4QE4A 1J11A 1J6PA 2PMQA 3KBSA 3LMYA 2ZUMA 4N4PA 1JCLA 3B3DA 2QJIA 3VNKA 1SW0A 3GIPA 1KBBA 1BG4A 5TNVA 3FN9A 1J12A 1H61A 1EB3A 1CZ1A 1GZGA 4BI7A 4K6AA 3EEZA 3IGHX 1XYAA 2Z1SA 4I3GA 4FXJA 2A7NA 1XXXA 4O0ZA 5FEXA 3MSDA 3W7QA 1Q4NX 3ZJ6A 3CMJA 1OC7A 3Q65A 2W0UA 4E2BA 4A22A 3WDHA 3NGFA 3W6YA 4FNRA 2JFEX 1VFLA 4MNLA 1O4UA 3MYPA 4O1AA 3GS6A 3DKLA 1O12A 3NVTA 3EZ4A 2YL6A 4H1ZA 2C19A 1EDQA 6XIAA 3AZSA 3UERA 2HBVA 1VJZA 3AIQA 3CUHA 4W85A 4KCUA 4PGLA 1P0NA 2NLYA 1E15A 4JZ5A 4BA0A 5A6LA 3K4AA 3L4TA 4DAIA 1V0MA 3MKCA 4Q4QA 1A5AA 1TQJA 5M1TA 2X2YA 3IJIA 4RL3A 2PLMA 4M1RA 4TVDA 4XWUA 4S1FA 1EQCA 2VJXA 4ZQPA 4C1NB 1F3XA 3HPZA 4J9JA 1HFBA 2AAMA 2E5DA 2QV4A 1J10A 1LP6A 2ZDSA 4AYSA 3TSBA 2OELA 3N34A 4ZMGA 5JUVA 1TPH1 1UA7A 1Y0EA 2WSPA 1XV8A 3R0KA 3A3WA 1JYVA 3ARYA 3L0NA 1CGYA 2Z2UA 4DO4A 1FH8A 1S3HA 1EJRC 3NQ7A 4ALDA 4XD4A 1CIUA 4I9TA 4MY8A 2ZX5A 2X16A 2VFGA 3KM8A 4JCLA 3LTPA 4HN4A 1RAKA 1OZQA 3N11A 1ZBCA 4TX8A 5I2UA 4I90A 1RA5A 1JNEA 2NZLA 1D2KA 3FJ4A 1H7WA 1VIWA 3IPWA 1M7XA 2AMXA 1QASA 4IG2A 3H2CA 1GONA 1JD9A 4S39A 1XH2A 4MWAE 3N3TA 1H09A 2EPNA 4HQVA 3DECA 3RPDA 3DHFA 2ZRXA 3C0JA 1HXJA 1V51A 3CXOA 3ITCA 2CHOA 2VRJA 2ZUSA 3WG6A 1XSKA 1BYAA 4FR1A 4NRSA 3QYSA 4O1CA 4X0NA 1RY0A 5K9XA 3SSZA 1QBAA 1OINA 4ZSTA 3K8LA 4LQ1A 3VD3A 4QAIA 3SGUA 9RUBA 3BICA 4C6KA 4UOZA 5E09A 3GFYA 2Z25A 3UF9A 1JCXA 3PULA 3S5ZA 1ITCA 4FLRA 4DO5A 4C6LA 3O2LA 1QPOA 4Y9MA 4UFJA 3GTIA 4JIPA 2WB5A 5JBEA 4DF1A 3OZPA 1LTDA 2I9UA 4GUHA 2QJMA 3VFCA 1R0MA 3COTA 2PRMA 4GKTA 4C6DA 5JVLA 1OF6A 2VQUA 1H7PA 3FHQA 3R12A 3PZOA 2ZZ1A 1UR4A 3MS8A 5HUOA 3GVVA 1A3HA 2GFTA 3PJUA 2DSVA 4GMEA 2AL2B 1CGTA 3C2YA 3VIKA 3LI1A 5CLTA 3QYQA 2QCCA 4ROPA 1SO6A 1BD0A 2VR5A 3BZJA 1TJRA 1GOMA 4FZIA 3EWYA 1W5NA 3W25A 3HFYA 1Q4WA 4DHGA 2HJPA 1ONRA 3M0KA 2DZSA 1KV8A 3GR7A 4QBXA 3CJPA 2VI0A 3JUGA 2UY3A 2NXHA 2OKTA 3RCMA 4DJDC 4U5IA 2C1IA 3AWNA 3QMRA 4XZ9A 4JTKA 1ZJBA 3PWIA 4UFKA 1KRMA 1C93A 1BG9A 4MWAD 3S1VA 1PZ0A 2QJNA 1HJWA 3KCOA 2JIWA 1H2JA 3MPGA 4LYPA 3II1A 5HQEA 5EKYA 4Q4SA 1JF6A 2MUCA 5G1YA 3WNMA 3RAOA 3QC3A 1IQ8A 3BOLA 1J5SA 3O6DA 4O8AA 3BAKA 4GE8A 4RZ4A 2CHRA 3BW4A 3LOTA 4IMGA 1QI2A 3DHDA 1HGWA 3CS2A 1E43A 3WQPA 1R46A 1R2SA 2HEJA 4L80A 2PTXA 3KZSA 1J2BA 2PBOA 1WV2A 3VKCA 3LDVA 3RMEA 1WUEA 4B15A 3A12A 2QGYA 2D24A 1VBJA 4JR5A 1YYAA 2XFWA 5C70A 2PTYA 4ZOCA 4WCJA 4HK7A 4NILA 4JKKA 1DIKA 1MW2A 1EC8A 4GGHA 3BSMA 3AUOA 3WLLA 2XJ7A 4UQDA 2TSYA 3HQ1A 3T40A 4BEUA 4IUGA 3QRHA 3NSMA 3C6CA 3CK5A 6ENLA 5RUBA 2F2HA 2ZE3A 4Z0SA 4PTDA 3OA5A 2XM1A 2GQ3A 4C5ZA 1IEQA 3IGUA 2G97A 4TXEA 3D0CA 3FKKA 3B0YA 7XIMA 5JU6A 3UXIA 4GPNA 2QR6A 1GQJA 2PDCA 3C8FA 1LLZA 1VCGA 4RXFA 2ICSA 1V93A 2QYGA 3F5LA 3VOHA 1HIZA 4J3WA 1CBGA 3VOJA 2GUBA 4WY0F 4S2CA 2XN2A 3CM4A 3A24A 4R3UA 1XLBA 1CB7B 3I4EA 4LSBA 3RILA 4EF9A 1PKNA 4QSHA 3W73A 1POJA 4FXSA 5CGQA 1A49A 1QOQA 2FFIA 3UPMA 3T08A 3FSUA 3NDZA 3SQLA 1UR0A 1L2UA 4EACA 4W7WA 1RP9A 3KHDA 1EEPA 4RZBA 4QAWA 4XX6A 4AAJA 1REQA 3ZWTA 4F2TA 4MB4A 4PCPA 3WBXA 4UWMA 5H1WA 4O11A 4JFSA 4MWAB 4QLKA 3MTWA 1OQFA 1SR0A 2F8QA 4RUBA 3MUAA 4FX7A 5EBAA 4GX9A 2OSWA 3EX2A 1TZZA 2WV8A 4L56A 1ESWA 2YZ5A 2QCEA 1FWAC 2D73A 4UNKA 1MDRA 3WQDA 3OQEA 1EHAA 2VEKA 2PTZA 2G3FA 3MUXA 4LH8A 4AHPA 2BHZA 5REQB 1V0KA 5E0FA 3FA4A 3CO4A 2F9RA 5FESA 4UQEA 4K36A 8RUCA 3TWAA 4WJ8A 4HZ8A 1RLDA 1G4EA 1K8CA 1QK2A 1U1HA 3LCFA 1R7AA 1BAGA 4ZQRA 4JEQA 4R34A 1NOWA 4UFLA 1Y8BA 3CMFA 3KOFA 4CCDA 1WOBA 3TR2A 3WLNA 1J0YA 1XRSA 1R9YA 2XYLA 3QY6A 1ENUA 4GOAA 5D37A 3TMQA 4GABA 9XIMA 1KD0A 1YNYA 3CYVA 4ZQCA 4AB4A 5DCEA 4O54A 2DZXA 2ZE0A 5JXQA 2V3FA 3BG9A 2QAPA 3PJTA 1VB9A 2OXNA 1I9CB 3PUEA 3VGFA 1TMQA 4PA8A 2Q01A 4AWEA 2NXIA 3SBFA 2QUMA 2R1KA 1MDLA 5ABEA 3HO8A 2BVTA 3UWWA 4GCXA 3PM6A 3DIPA 1RK5A 3EX4A 3GG1A 2QMKA 4LB3A 1R47A 3T0AA 1ADOA 3PJWA 2PDIA 1B31A 3S1WA 4Z17A 3BGJA 2ZRZA 5A8GA 1LOSA 4GCAA 5D03A 1KA9F 2D2OA 3NQ2A 5HNNA 3UZ5A 1W5OA 2D3NA 1FCUA 2FDMA 4JICA 3L7RA 4GQGA 3CUGA 4HTBA 3B8TA 3RJXA 1VBUA 1UROA 3WDJA 1MXSA 1JL8A 3SW6A 3G1SA 4GD0A 4C1KA 4DJEA 2RH9A 4OBTA 3E1F1 3BLIA 3WUGA 4JDYA 1TKKA 3CPUA 3A22A 5HA7A 3GYCA 3UR2A 3VDHA 2G3JA 1G01A 2WMKA 1EP3A 3N2BA 1XL9A 1JCYA 5CJNA 1UJPA 1E9LA 2Q02A 2PURA 4M7SA 2WMJA 4I6VA 3TAKA 1JUEA 4DM2A 3S9YA 1UOKA 3NSNA 2OT0A 4HA4A 6A3HA 4KFPA 5A8PA 4JTEA 4MPQA 4PL2A 5ECVA 3EX1A 1WB0A 2ASHA 5BCAA 1LROA 1Q63A 2PWFA 5BW6A 1QI0A 4J3ZA 1CLVA 2WPGA 2PWVA 3E5BA 3WBAA 5EA9A 1OWQA 5AFDA 2P5NA 4PTNA 5FAJA 3ZJKA 4JNZA 5ABFB 1G7VA 2AQVA 3DFTA 1XG3A 5HINA 4F2UA 3W2JA 4Y90A 3S5SA 4DJEC 3R79A 4XSLA 3WQEA 3M0HA 4X61A 5D9OA 2J13A 1YADA 3B8WA 2GDVA 3O63A 3N9SA 4PUEA 2B81A 1SFJA 3G8RA 5CH9A 2W92A 5DMNA 4RXGA 2YJQA 1RY8A 2YYTA 1M01A 3P60A 4FA3A 2O92A 4CD5A 3MA8A 1KTCA 4PUUA 2AL1A 3RM9A 3G3MA 4QJ3B 2YIHA 1UR2A 1XIDA 1ISWA 4FSAA 4US5A 4YYFA 3S47A 3JVAA 1HL8A 4GFSA 4KETA 4AX6A 3ARZA 2G96A 4AD2A 1DYSA 2J79A 4F9JA 4A3HA 2F6KA 2E9LA 1Z42A 3ES7A 5A2CA 4F66A 2IPFA 3R0DA 1GT8A 4IX2A 2V2DA 5I00A 3FJ6A 5IDZA 3ISIX 4GC3A 1XRVA 2OX1A 4GJJA 5I3FA 1HVXA 3Q37A 3UGRA 3AALA 4LNYA 3TR9A 1U5JA 1UQYA 5G4EA 3MSRA 1XFCA 4GFIA 4M24A 4R85A 5C7HA 4HOZA 3N1AA 3M7SA 3W7DA 4CD7A 1WXZA 3BMWA 2QT3A 4J40A 3HOJA 1GQLA 3H7RA 3T42A 4WDWA 3ZIZA 1WDRA 2XN1A 1P6BA 1MUWA 3SGGA 1GQIA 3CMGA 1E9IA 5EBUA 3K4DA 2WJDA 3UYCA 2ZKMX 3OGRA 4HJWA 3CHEA 1FP8A 2UY2A 4IIBA 1KBJA 2V5KA 3WMCA 4NZ5A 1OFDA 4XZMX 2O7SA 5JH1A 1DHKA 4QIUA 2Y61A 4NX0A 1UD5A 3HU7A 1XLKA 3IJ7A 1VGAA 3P0WA 4ZTYA 5DFAA 3IWPA 3W87A 3G0XA 3K8KA 3AISA 4DWSA 2J74A 4RV3A 1RHCA 4ML9A 2HV5A 4DF0A 5BXPA 3C2OA 2J66A 1ECQA 1V3KA 4MLJA 4ORMA 3V4BA 5HBFA 2E5CA 2XM2A 4GYPA 1T40A 1W91A 4LPCA 2J9YA 1P1MA 1R87A 1MQQA 3IAPA 3W7CA 1T41A 2GK1A 2PDUA 2WQDA 3A5VA 4HA0A 1Q5MA 2WJFA 5F7UA 4LEQA 1GVEA 1NSJA 3E2RA 1F2JA 2F38A 2WVTA 3BLPX 5DXYA 4HVXA 1E4MM 5CZJA 1S39A 2ACRA 5U7SA 4LCRA 3GKAA 2C8NA 3GDLA 1V02A 2BBFA 3AAMA 1UMYA 5D2VA 4MFDA 5DT5A 1NF0A 3EPMA 2YOCA 3BJTA 4M80A 2VGFA 4B91A 1BSIA 2V30A 2X42A 3TLLA 4QSFA 3GSMA 4OTKA 3ITVA 3BW2A 1PCWA 1MW0A 4WGXA 1GYNA 3TU9A 3B0XA 4B90A 3N17A 1B90A 1VAHA 3PBWA 2HXTA 3SCVA 4GYPC 1M7OA 1Z69A 1KKOA 4O8RA 4WDXA 4POCA 1E3ZA 2FTPA 3PB0A 4AF0A 2ALDA 3RCYA 1OFEA 1JPIA 1QNRA 5G5IA 2CZEA 4LVGA 5M5DA 3U2CA 1H5VA 1TIWA 1TPUA 4P8VA 7PTDA 3EA3A 1CPUA 4N0RA 2PDJA 3ANVA 2Z29A 1OG0A 3GNPA 4U31A 3W1NA 3RPTA 2YL8A 3O16A 3T9PA 1GQNA 2FGZA 4QJ1A 3S1XA 1XIEA 4D71A 1RVKA 2OO0A 1UJQA 2OYMA 1WDPA 5IOBA 2IS7A 5CKSA 1I1XA 2YA0A 2DQXA 4N42A 2NWSA 4BWLC 3LS9A 4TV6A 5CPQA 1TRIA 4M5PA 1EQPA 3W74A 3ABZA 3BH4A 3TE9A 4CD4A 4OWGA 4M29A 1B2YA 3PZUA 2EEXA 4FXRA 3GNRA 2BY0A 3W27A 1XLFA 1JPHA 2EGZA 4DYKA 1IWAA 3URAA 1V6XA 4B3ZA 3KL0A 2VCCA 7A3HA 4IPJA 3W7EA 1P48A 4O4VA 3RLVA 1QR7A 3WL0A 6REQB 1D8CA 3BAIA 2VM8A 3GLCA 1W3HA 1RZMA 4S3DA 1YW1A 3TXZA 4AY1A 3BAXA 4NJIA 4E0CA 5DT7A 1KXHA 2ZIDA 4H9XA 1UASA 1K7FA 3LHVA 4DQWA 3BMXA 4K7VA 4HCLA 4LYQA 4B9YA 3MI6A 4H9TA 3FNDA 4GINA 1EDGA 4GLEA 1LRQA 4HA1A 3TQ0A 3UZWA 3QH2A 5G4WA 1JVNA 5MF5A 2PTDA 1OC6A 3ALFA 4PMQA 4HPXA 3TLQA 3H2AA 4NT0A 1T8QA 3B0UX 1WDQA 1YDVA 5JH2A 5KETA 4M19A 5CZ0A 2I9EA 4ZB5A 4NZ4A 4S23A 1OY0A 1W9UA 1PKYA 3REQA 2ZRYA 1HNYA 1I2PA 4FR6A 4OOUA 1JG9A 4LUSB 4C6FA 3MMDA 1NVMA 5I07A 4IUOA 3BJFA 4H8VA 1K9EA 3LPPA 4E2VA 3C5QA 1L6GA 1XI3A 3K5XA 1HUVA 3BJSA 1E71M 1K9TA 3B8SA 5C9WA 3WKZA 3C0SA 4C6OA 4O10A 2ZA3A 2CBUA 3S2LA 2BHUA 2RFGA 4D8AA 4JTLA 1YMYA 3W1XA 4ATLA 4KCWA 1KM1A 2TPSA 3HTWA 2D3LA 3OA3A 3VPLA 1SM9A 4KEVA 4XD6A 3UJRA 4BI6A 4GZEA 2PDHA 3DU0A 2EO7A 1XPGA 4JIRA 1AQ0A 2DQWA 3VK5A 2YBVA 3L66A 1VD6A 3FJLA 3LPFA 4FK9A 3EKZA 2GQAA 2DU2A 5TF0A 2XZ9A 3P81A 4QLJA 4KFOA 1TTJA 4ADTA 1EJWC 1CECA 4QE5A 3POCA 2O9PA 1PTAA 4OOZA 2E3ZA 1EIXA 4MB1A 8CGTA 4PMJA 1LQAA 2W6RA 1AQMA 4O1EA 4N2YA 3T07A 1LT7A 4Z2GA 3NO5A 2I16A 3GYEA 4OQVA 4JQ3A 3S2CA 3U2OA 3TJLA 8TIMA 2ZVRA 3DOPA 1J93A 2WPBA 3W6MA 3WD2A 2WHKA 1SVDA 1VENA 3TW6A 3SCTA 1TJ2A 1XC6A 4L9ZA 2QPUA 1FBAA 1W1PA 4PH6A 1B3XA 1L6YA 3VKDA 3B8VA 4DZAA 3KTSA 2QEZA 3NPUA 2NQLA 3KVKA 1E3XA 4MJ2A 2GQ8A 2HS6A 5DMLA 3ABSA 3BAJA 4XAZA 3AHTA 4K8EA 1E4LA 1AH3A 3AJ7A 5F4SA 1FFRA 1SO5A 2XG9A 4GHRA 1TV5A 1CEOA 1JXKA 1M9HA 4FP1A 2BVWA 1ZQ5A 1YE6A 4EWJA 3AMLA 2UY4A 3VDGA 1XBVA 4YVVA 4Q32A 4DJFA 3B9OA 4PMOA 3P5YA 5AHMA 5D8WA 2E25A 4O16A 2XH7A 5I06A 5CPOA 3UBPC 4PMUA 2D23A 3GFXA 1XFBA 2DPEA 3EKGA 4TU1A 1MQPA 1ZHAA 3OYZA 1AMKA 1FH9A 2VYOA 2GDUA 3AWOA 4ZOBA 3GG8A 1WKYA 2PC8A 3ZR4A 4NZ1A 1GVOA 4UTJA 4V27A 1T8XA 3S42A 5LA0A 2EF9A 5KZ6A 4UTLA 2GJPA 4PEEA 4Q8NA 4ZR8A 1DJYA 2PDBA 2BVYA 3AU6A 4WDTA 2QUUA 3ANUA 1K03A 5CJ5A 3GC5A 2CEQA 3AXMA 2E6DA 1IEVA 4HT3A 4LRSA 3ZM8A 3A21A 3WMSA 1WDSA 3MZNA 4LVDA 4WLCA 3GO2A 1BF6A 2J27A 4Y6GA 3O0KA 3UD6A 3CZEA 4AFYA 2ZA2A 2OX4A 3M5YA 4JTIA 3H2EA 2GGHA 3WO8A 3FDKA 2V67A 2QF8A 3DHPA 4JTDA 3AQUA 3W7LA 1QO2A 5K9CA 2ZCGA 1LDCA 4XTDA 2GDQA 2J7FA 4G7FA 2GL5A 4W88A 1M68A 4FO4A 1KFLA 4JQ2A 5CC6A 4AHQA 3BLLA 1EBGA 3VD9A 2BOEX 3EWDA 4IIFA 3N15A 3URQA 4R9XA 1C9WA 3WH5A 3DG7A 4IIEA 1BRLB 4RDYA 2DSKA 2BY1A 3B9EA 4LUTB 3BOFA 1QW7A 3R5EA 4AXKA 2PD9A 1ALDA 3E6EA 4YPJA 3WJWA 4LRTA 2H3DA 4ZA0A 1O1HA 2WSRA 4B4FA 4WEVX 1XH1A 1YHTA 2OEMA 3GU1A 3OGSA 1K4HA 4O50A 3B40A 1S38A 2GUYA 3CZ8A 4UR7A 2B7PA 2IPWA 4ACZA 3N25A 3A5FA 4NJHA 2HQAA 5I79A 1XIFA 3LM3A 2YDSA 3U6WA 3I10A 2VOTA 5EY5A 3GG0A 4DJDD 1E6ZA 1Q13A 4ZGYA 5MHBA 2C13A 4HPNA 1X98A 2ADAA 1BGAA 1OX4B 3JR2A 1VF8A 4URIA 3AMGA 4GBDA 1BWKA 4V1YA 4NI3A 2VOMA 4HZ7A 5LYRA 4KS0A 1KM6A 3S5YA 1OT1A 3FAXA 1R8LA 1M3UA 5I5RA 1FX6A 3AZRA 2HBXA 3EWZA 4X2PA 2WVVB 2WSQA 3LENA 1J79A 3VX0A 3WLRA 3F4CA 2Z1KA 3KBJA 4XQ6A 3GVGA 3GXPA 1H63A 3AMCA 2KX9A 2PP0A 4FI4A 4C6CA 4A2SA 3U57A 2WKGA 2CBVA 2AMGA 2YCLB 4LWWA 4RW5A 4RNIA 4S3BA 4D2JA 5H6HA 4AD4A 4B3LA 3R8GA 1VH7A 4IL0A 4S2BA 4Z2LA 2CZVA 4PMVA 4O18A 4UTMA 1GKPA 2R82A 4DUXA 1C90A 2QCNA 1L6FA 1XLLA 3S9ZA 5DANA 1YXYA 2CBJA 4UB9A 4TTGA 1XGZA 1F8MA 1DTUA 4BR1A 5EFDA 1LBFA 3OPSA 2CBIA 2PF0A 1E55A 1NWRA 3O07A 1B1YA 4UQCA 4MNJA 2TMDA 1PB0A 5FF3A 3QLDA 1S2TA 4LF1A 4WSHA 1QMLA 3SCPA 4GXWA 1UWSA 4FXFA 3R25A 3VKBA 2GJXA 2WWDA 3M46A 3B03A 3NO1A 4YU1A 1TZ7A 3QOMA 3GU9A 5LIYX 4K3ZA 2A4AA 2YDRA 5D04C 1L2QA 5I3GA 1KNWA 1E6PA 4NP7A 3A23A 1Z3NA 1TMLA 2VWTA 4F0KA 2WZIA 4N6FA 4LNCA 2A21A 3LN3A 5TAOA 3FYYA 2PDQA 4LFYA 4NASA 4Z2IA 3CNYA 2EG8A 3KCLA 3R4IA 5AZ1A 3CIXA 3OZYA 4Q7NA 3TTYA 4PL1A 4KERA 1WDWA 1WPCA 2HVOA 5I0DA 3EWXA 2E67A 3ITOA 4DN1A 1XINA 4BI5A 1NIUA 4XKYA 1P1XA 4YYCA 2Y63A 3GZ3A 4NZ3A 3KRBA 5AHLA 3AROA 3RX3A 3OHIA 2D20A 3LNMA 4AEEA 1VYRA 3E74A 1BVWA 2VZOA 4LAOA 4GI9A 5BZAA 3LMZA 1BYBA 1UH4A 2QULA 4UFIA 1SZNA 4BQ3A 1FWWA 2BZNA 3A4WA 3HV8A 2YXGA 3CAQA 4DB7A 3PY2A 1B4KA 2XZ7A 3BSGA 2CZDA 4DZ5A 3N6JA 4JOMA 1M1BA 1EYEA 1UB3A 1EJ7L 3OBAA 5F4XA 4IXXA 1KBIA 1K8XA 1HQTA 2V5LA 3NDOA 1I2OA 3SI9A 2ISFA 1FWGC 3ZJ7A 1V79A 3ZYZA 3OVQA 4BFAA 1JULA 2DVXA 2ABBA 2O7QA 4MDPA 4IPNB 3H2FA 4JCMA 1TPVA 5GNZA 3QQ0A 3T4CA 1X1OA 2CZ5A 2F7FA 1IXQA 3SUWA 2GJNA 4UTWA 4WOQA 3TCSA 3NQFA 4XD5A 1JIBA 3DAQA 4AVOA 2OGJA 1H1ZA 2FMOA 2W61A 5GJMA 3WF4A 2A3LA 4HHMA 3KDNA 3G1HA 1NDWA 5AYIA 4H6KA 3KOXA 4WDUA 3FGCA 4B92A 2IKJA 2W9MA 4A3YA 5LKYA 3SGZA 1PUDA 1TE6A 1P7TA 2IKHA 4CQ9A 3W07A 5CAKA 2VFEA 4KWWA 4AVFA 4Q7BA 1R3QA 1LWHA 2V63A 3LX9A 4HBKA 2OCZA 4HHHA 4LX4A 2FZBA 5TIMA 1C8XA 2YDAA 3UR7A 4HNTA 4IFKA 4C1LA 2F6XA 4NX5A 3E5PA 4XISA 1VC4A 2E40A 3SR7A 1YRRA 3MUCA 4S3GA 1A5SA 1OFAA 4K7YA 1M7PA 3C3UA 4C6EA 4XZHA 3VNZA 1DQUA 3S2MA 3C8NA 1FHDA 3RGTA 2Z0IA 5A6BD 1DL3A 3GKFA 3M41A 5GNYA 2NW0A 3M4HA 4UTUA 4CVWA 4GWEA 3S46A 4DM1A 3WK1A 1TR9A 5SWUA 3OLDA 3IACA 2ZXDA 1C8YA 5HDRA 1A80A 3UPWA 4YTTA 3V5OA 2OOGA 1EO7A 1SJBA 2PAJA 3AMKA 5FSEC 4P8UA 1CLXA 5HWJA 4AC1X 1I2RA 4PSRA 5A2BA 1TTQA 3NOEA 4R5EA 4PB3A 2C79A 3ELFA 2O9TA 4HU0A 3NL6A 3R8RA 4HZ6A 4Z0JA 3VIJA 4DF2A 5C9RA 2PZ0A 4A6GA 3SQSA 3G3DA 1U30A 1GEQA 1XLMA 3RRAA 4W8LA 1XDLA 1FVPA 1CX9A 1KLZA 1EXPA 4B4HA 2DJLA 3LCWA 2CYGA 4RZ5A 3IV3A 3NEVA 3S6TA 1B5TA 5EL1A 4L6DA 2VDIA 3W1UA 2V2HA 3IRSA 5DCDA 3V75A 3T4WA 1WKEA 3WSUA 3PBUA 1A5KC 1FWSA 2IPGA 3KAOA 5DXXA 5CG7A 2PE4A 4N02A 5FEPA 2XVKA 3CUIA 3P7YA 4REQA 3UA3A 1W54A 1XICA 1JF5A 3CAVA 1FWCC 2P50A 1DHPA 2P1FA 2G8ZA 4O13A 2GSJA 1BVZA 5A2AA 3AYSA 1U5HA 4LT9A 5BWAA 1EEXA 1RP8A 4LS1A 1UC4A 3S0CA 3I7SA 5FF0A 3H53A 3AUJA 3CO8A 3PBGA 4GIRA 4GUFA 4PSPA 2NSXA 1X6UA 1KCLA 4DEFA 4MZ1A 1IR2A 3H12A 1HJQA 3N2MA 4QG9A 4UMCA 1PPIA 1F6YA 3H2OA 5GVJA 4K1GA 3HBLA 3UG3A 1RQHA 2WXDM 2PGWA 4QITA 1DE6A 2IW0A 4MJ4A 3BCFA 3GDMA 1LJYA 1X1ZA 4BJHA 5T8GA 2XWEA 2WC4A 1F6KA 4KEUA 1UMLA 3CH0A 2X0YA 3AMDA 2VC9A 4UNLA 2G37A 2PCQA 4R7JA 4LUIA 4JX4A 2J77A 1GPWA 2G3IA 4LCSA 3PB2A 1VRXA 4E8DA 2RJGA 3RIKA 2FDSA 3UR8A 4W4QA 3CPGA 1S5NA 1S5MA 1TTIA 2QDHA 3LLXA 4HN8A 4LB4A 2WW5A 2YFOA 1F05A 3BMVA 5DELA 2VVSA 4YHGA 2NV2A 4DPPA 3NPVA 5AVNA 5AC7A 1MEIA 3M0JA 2X8RA 4EXQA 2Z1XA 5A6AA 3S9IA 4TMBA 5CXPA 3WF2A 1E6RA 1ECEA 4KEMA 4O15A 3E38A 2ISDA 2ZZ3A 3SSJA 4IX0A 4QP0A 4YTUA 2OGYA 3ABOA 1FOBA 4PMDA 1IIHA 4ADUA 2DV0A 2W67A 1XSJA 2FZ9A 1NWSA 3BWWA 3LG3A 2E6AA 4HYWA 4IMAA 1NJJA 1UWAA 2CKRA 4DLFA 2HSAA 4JTRA 3W26A 3QF0A 4EIVA 1XC4A 4F2BA 1WNOA 3GIQA 3BCJA 1P6WA 5BXSA 1NU5A 2ISWA 3UWEA 2I5GA 2PWHA 4I7UA 5CZKA 4GI6A 3S6DA 3W4RA 3C2VA 5HNUA 4ZFCA 3P2VA 3W2LA 3PZQA 4QS6A 1GJWA 3T2OA 3NJ3A 1C7TA 2INFA 1KFBA 4D72A 3T81A 3CAWA 3BUVA 2OWCA 2D2GA 2REQA 4M6UA 1DJXA 5MKGA 1OYCA 1DWAM 3GHTA 4G7EB 1LBLA 4GC4A 1UUMA 4ROQA 2R1PA 2A0NA 3TYAA 1BLIA 2OVLA 3W1LA 2A3EA 3LGEA 1AW2A 2PU0A 4TIMA 2CPUA 3TQVA 4HGXA 2P8BA 3PZGA 3VINA 4ZZ9A 2EJ1A 1HT6A 3UP8A 1AMYA 1FRBA 3ID7A 4J3TA 3P62A 3CWOX 2YXXA 3DUGA 4XZWA 3TTEA 3WQOA 3ZJ8A 3CQHA 1ADDA 4HSHA 2ZUTA 1TVPA 2ZC8A 1XISA 3V1HA 1K8ZA 2IKGA 4CEXC 1YDYA 1AJ2A 4ZO8A 3TTQA 4UQAA 4RE4A 3XISA 3QBUA 3GNOA 5DLCA 3G1VA 3W86A 1RALA 3HMCA 3NL2A 4AIOA 3ABRA 5HMEA 3GG7A 4R9OA 3LSBA 4XBSA 3TSMA 1SZGA 1RQBA 1QWKA 1LL6A 2C18A 3B06A 4Z1BA 3DFOA 4NAEA 3VZXA 1AVAA 4DPQA 3VVGA 3VKKA 2HK0A 2YDQA 1JDDA 1T5AA 3UG8A 3ZVIA 3CLMA 3H21A 1FWJC 1U1JA 3WYZA 2CETA 3B0PA 1QRQA 3AICA 3TSDA 1SMAA 4LAKA 3LXBA 3SCQA 4ICNA 3STGA 3M16A 7TAAA 5BOEA 2XSXA 1TJ1A 1IEWA 3IAQA 3ZVHA 4Q8TA 1JEZA 4NXSA 2XGBA 4MJZA 3SFWA 3L5AA 3SM0A 4C7FA 1BKSA 3Q4DA 4H8HA 4K68A 4YNGA 4MJMA 2A6LA 3EWBX 1SQ7A 4BQ5A 2ESCA 1SSGA 3G1XA 4V33A 2IKIA 1W2VA 3VIHA 3BL3A 4MZYA 2BB0A 3W02A 2Y88A 3KFTA 4F48A 3UZZA 2JALA 3FX4A 1V08A 2FVKA 4J7RA 3I7QA 4OGZA 4TUFA 1TWSA 4HSNA 3SECA 3B0VC 4QJ5B 1VEOA 3KTXA 1FWEC 1JUKA 4DI9A 4V28A 4Q8WA 1S2CA 4ZSUA 4FOUA 2Z7KA 4CNTA 3UG5A 4D1JA 2DEPA 3P5ZA 9CGTA 1VPYA 4RCXA 3I3EA 5G1TA 2B7NA 5CEWA 5E5CA 3PWAA 3JW7A 3OBEA 3M0LA 3I68A 1TSIA 4HSOA 4DBWA 1VPQA 3NQCA 3VKAA 3VE9A 4XZBA 1RCQA 2OQLA 3KWXA 2VFHA 3W75A 1JYWA 1RR2A 1E0WA 1HVQA 2AQOA 2X30A 2PRLA 3PPCA 3W70A 4AVNA 1GYLA 1DXEA 1HJXA 5AY7A 1SYTA 4GIAA 1R85A 2FMNA 4UXDA 3WNNA 3EB2A 1EJXC 2VZVA 4NYYA 3MUIA 2QDGA 4M81A 1B3WA 3WQ5A 3NM1A 3TEVA 3R13A 4R27A 3SCWA 3I6EA 4BF5A 3ZR5A 1YPIA 4Y8EA 4MDOA 2X40A 3NDYA 4AIEA 1RPXA 3EMCA 2DSWA 3RYSA 4NJJA 1QCWA 3UEQA 3T8QA 3D3FA 3KBNA 3U5UA 3HQOA 2J8GA 3QV9A 2YPIA 3SUVA 1M65A 1T0OA 4JTGA 2OT1A 1ODUA 2CHNA 4KWSA 4LANA 2FZDA 3W7RA 1TB3A 3SN0A 1KFJA 4AZ5A 3W83A 3B4YA 1C8QA 2BY3A 2FGLA 3TZFA 4Q8VA 1SMDA 1UBSA 1ZSXA 3EDEA 2E4TA 3Q67A 1V7AA 3QJAA 1RXOB 1CLKA 3AC0A 4WD0A 3N73A 3AHZA 1LL7A 4UQ9A 1GW9A 1LYXA 4DNMA 1UD4A 3BG5A 4HIBA 3WDIA 3MJYA 2D0HA 3VE7A 1YPFA 3WQWA 4Y8FA 3H8AA 4ENLA 3EB3A 3W7MA 3W22A 3AJXA 2A3AA 3BCDA 3RF9A 2CLOA 3OIHA 1UR3M 4ZE5A 3UPBA 2ZX6A 3D5HA 4ES4A 4JFVA 3AHVA 3LCGA 4L6HA 2PDXA 5JBFA 1EUAA 4PRTA 4MG4A 3RRXA 3S6OA 1VFFA 3VNLA 3MUZ1 1WKDA 3M0YA 5LSMA 1UKOA 5C8BB 3LPOA 5CGMA 4ERGA 1SZRA 5D2XA 3T0TA 1EF2A 1V6TA 1W3NA 2J7CA 3GH5A 2V38A 1OCBA 2X1RA 5C9UA 4R7WA 1O5RA 2LLEA 4AWSA 4LYRA 5GNXA 1KBLA 2GYIA 4J1OA 1GNXA 1VS1A 1KM3A 1HZYA 1QXLA 1OK4A 1GOWA 5FJPA 2VQTA 4AX7A 4G9PA 1LM1A 4K1WA 4J3UA 3HQPA 3QHMA 1ZAHA 2CU0A 3T0CA 1JFHA 1NH6A 2NUXA 1PWMA 3BLKA 3NOYA 3WLMA 4BY3A 3ITTA 3WF3A 4JKLA 3H4GA 4S38A 4UFHA 5A3HA 1PWLA 3WNLA 2DIJA 3SCSA 1B3ZA 4XIAA 2WC7A 3UETA 2R8WA 3QHNA 1QVBA 2VFIA 2V2CA 3T1GA 2ZUUA 3QQ1A 3SJ3A 3G24A 3M0IA 2O55A 1E6QM 3ARWA 4C90A 4F4RA 2C0AA 4UCGA 1Y7VA 4X9YA 5IBXA 4H04A 3O9NA 4D6HA 1TQXA 4AEOA 3C2EA 1O5XA 2VUNA 2VGGA 2XIQA 1UR9A 1UZ1A 2VC5A 3UNTA 2H6RA 3LHZA 4MIMA 4ZQNA 5CBIA 3M64A 5IRPA 2HDJA 2NXGA 4NI8A 3P80A 3UR5A 4O53A 1M03A 3QVQA 3VIPA 4KQNA 1H60A 2Y70A 3MV11 2GWNA 1YNQA 3VMOA 2C1HA 1QPRA 2HPMA 1I60A 3DZ1A 2C91A 2V69A 3UXAA 1E1EA 4CQ8A 4PMNA 4M7TA 1XM3A 1EWEA 5C5YA 4NKCA 1R86A 2OZ8A 1DWHM 2DDXA 3PC0A 4FNTA 1BEUA 1X38A 4TO8A 4XG1A 4A8IA 4GNKB 3L21A 1WX0A 1TJPA 1FCVA 4KF1A 3VFLA 3D6NA 1ZB5A 4P5UA 4PE8A 4UMAA 3W7PA 3UYIA 3A47A 5FL1A 2GVLA 1K7XA 4C6PA 4HMEA 1MO0A 4ZB0A 4A2RA 1OC5A 1EP2A 3DC8A 3L65A 3L12A 3WDRA 3ARXA 4QG8A 1KTNA 3OG3A 1G69A 2OWXA 4DXVA 4R88A 4LUYA 1J0JA 1R7OA 3F5KA 1CGXA 4HPGA 3WH9A 4JFUA 5I3HA 4DO6A 1QTWA 1CXFA 3PTQA 1WOAA 4ORIA 3BGGA 1JDCA 4HYVA 4UR8A 3THCA 3ARQA 1XLIA 5BOOA 1O5QA 4FLOA 1WZAA 1JDFA 3RITA 2UV8G 5FOOA 5LHEA 3O06A 4EK7A 3S2NA 4DO7A 1J0KA 2X7WA 4HYRA 1KWGA 4HHPA 1YX1A 2I14A 2A3CA 3S1GA 4Y7EA 5LIKX 4BKNA 1NFPA 1IWPA 4M6PA 3MWCA 2R94A 1Q66A 3DCPA 1HKJA 3BURA 4NVTA 2Y5EA 5FJIA 2OEJA 1AL8A 2WMFA 2VEMA 3TQPA 4FNPA 4B2DA 4DBSA 3MDUA 5HK4A 3QTGA 5CLWA 1ZPTA 3QFEA 2G5WA 3AZTA 4NNCA 3L4WA 4Q4PA 3WLQA 1MFUA 3KE0A 3E3HA 3IIVA 5T26A 3S8HA 4RJEA 3UG4A 1V6WA 2QCDB 4EOUA 3HM7A 1OT2A 1CNVA 3FXYA 3MP3A 2QHAA 3CQIA 4IJRA 4P8XA 4MAZA 1GOIA 2Z1BA 5CGTA 4PN2A 4JD4A 1Q7MA 1XIJA 1UKQA 2HS8A 2YCJA 3F5JA 2WLYA 1MW1A 4PZVA 2VEFA 3JS3A 5F2MA 3ITXA 3M9YA 3T05A 4I9AA 3VI2A 1RD6A 2E09A 4ECLA 1E0XA 3N2CA 4IP7A 3MW7A 3O15A 1J6OA 1X97A 1AUSL 4H4IA 1JRCA 3TMLA 3HN3A 3U8GA 4IFRA 1ITXA 2J7DA 4O57A 4PUKA 1LRTA 1W3IA 4ILSA 4WOZA 3F1QA 1PZ2A 1S2UA 2FVMA 2NV9A 3R10A 3AS2A 3KHJA 4PBGA 3KWSA 3EOOA 3AIUA 1LRNA 2Z1VA 2HISA 3LBOA 3DENA 1GHRA 1WAWA 3MT1A 1JCTA 3SN1A 1HL2A 2OMAA 1HJUA 3GXIA 5AECA 3EDDA 3G1FA 1S3TC 1C8VA 3CB3A 5BROA 4H3DA 2FQIA 3WEMA 3IIXA 4OHQA 2H8XA 3NQ8A 3GFZA 4CUCA 5IHRA 4JN7A 4HNCA 2OYLA 1OGBA 4J35A 2XFRA 3G2GA 2WM1A 3KXQA 1PXGA 3TZNA 4J27A 4LOCA 4YCOA 5FACA 2FZNA 2DORA 4HA3A 2CCRA 3DG3A 2WKJA 2DZTA 1GVYA 1A0EA 1YTEA 3N4EA 3GXTA 1TR1A 2Q09A 1XGEA 3N6HA 1C92A 3N14A 4XSMA 3PHAA 3TJXA 4ZO7A 1HL9A 4Q22A 3ZLGA 4N4QA 1OFRA 2NQHA 3CZJA 3PF3A 1KR0A 4WHBA 2AL2A 4LS0A 2HZGA 3IK4A 4LC8A 4X60A 5D8ZA 2Z2AA 1TV4A 1BWVA 1IEIA 1V03A 1J4EA 4PTMA 3PPFA 2PDLA 1K8YA 2DW6A 3QKEA 1KWKA 1Z32X 3EYPA 2D22A 2DZPA 3AYRA 1G6CA 2PDYA 3L4YA 2YGYA 3C56A 3DN5A 3UXKA 4CEUC 4QRNA 2NQ9A 1THFD 2QCFA 5EMYA 3L67A 4JTSA 4GGBA 3BW3A 1BXBA 3H22A 3MZ2A 3H7UA 1O6IA 2E68A 3GC4A 1XWYA 1EPXA 3FFSA 4GVFA 4WSKA 4M8UA 2VNCA 2VFFA 3M0ZA 5ABHA 4LYKA 3UESA 1TCMA 2EXOA 3A9BA 3RUBL 1UQZA 4AISA 2XGIA 2RJHA 2WCGA 2POTA 2WM0A 4C6JA 1CGWA 1NOUA 2HCVA 4L4OA 4ZTXA 1QNQA 3LHYA 3B9DA 3D47A 6PTDA 4MFEA 5D33A 4W89A 1GVFA 1H49A 5A8OA 3H24A 3S3GA 1US2A 4MY9A 4QNWA 2P3ZA 1UR8A 1MSSA 3STEA 1HKVA 1H3GA 3MC5A 1EJTC 1K6AA 1OGGA 2XTKA 3NEHA 3FS2A 3HV9A 1HKIA 4M56A 5BU9A 5IFTA 3RPMA 4WZHA 2E9BA 3IS4A 1OEPA 1TVLA 3FYOA 4H19A 3WD1A 2XDFA 1E6XM 4WF7A 1CXLA 1IWBA 2DY3A 3TN6A 3CTTA 1ODZA 3ZT7A 3SO7A 2DH2A 3HG5A 3PPGA 1WXJA 1QNVA 1QPNA 1XJBA 5A6TC 3BZGA 5JBDA 3KVMA 4C6NA 1UD3A 4QDWA 5F2IA 1F5ZA 1SPQA 3V18A 3CUZA 1FDZA 5C9ZA 5FF4A 3CB8A 2CLIA 2E6YA 2ZA1A 4F0LA 1KBKA 2XFYA 1JFXA 4NIRA 4WUIA 3QGKC 3W1MA 3L0KA 4PYSA 4N9BA 4I6KA 4XAFA 1WCGA 1WO2A 2FHBA 1R9XA 6CGTA 3B8DA 1XLDA 3UZYA 1R3RA 2YKKA 1UH2A 1MZHA 1EX1A 2ZOXA 4GVGA 3ORWA 1KM2A 1BWLA 3RN6A 3LM7A 3TXVA 3WMBA 2NVCA 2CLKA 2BNJA 2D69A 3NQDA 5FIPA 2JBMA 3MMUA 4DIAA 4RNFA 1MUCA 4W8BA 2GQ9A 4D6IA 1XYMA 3NXFA 4MWAA 4ZEPA 4DYJA 1O95A 4L4PA 3GB6A 2PWDA 3GWQA 3NZQA 1OM0A 4EWND 1XLGA 3QV6A 2V5BA 2NT0A 4GY7A 1AJZA 4GH1A 2I5IA 2WMIA 4X22A 4JTFA 1CXEA 4FIQA 3GK0A 1BQCA 3NURA 4E4UA 2XGZA 2HPIA 3PFMA 1KB3A 5A95A 1JZ8A 1TPFA 3POHA 3G6LA 4IOTA 1V3JA 1OK6A 3TK7A 2BOFX 3U2ZA 4DXKA 1H7OA 1QU4A 1VLWA 3EAUA 4AWUA 1A3XA 1GOOA 3R89A 3IANA 4QEEA 3CLWA 3WBYA 4KKXA 3LD5A 4MWAC 3M0MA 3F2DA 1VIZA 2BHYA 4HTYA 1HO4A 3EXRA 2PWEA 4FF5A 1ZAJA 3CEPA 4IIGA 3FK4A 4MOZA 5CJMA 4CN6A 4YWSA 3BSHA 1YBQB 2C71A 4M0XA 1W3TA 3ZWSA 3K1GA 1E6SM 1W8SA 2FTYA 4PUMA 3CC1A 3QW3A 4UMBA 3M7WA 3B04A 1M53A 4RE2A 2ACSA 4HJFA 4QTGA 3C4UA 1DIEA 1Z89A 1WZKA 4OVXA 2WOQA 4OU1A 1HF6A 3KEHA 4EE9A 4YIWA 3W3OA 1TJ0A 3ARPA 4PUDA 1AA1B 4J2MA 4RLIA 2QUVA 4L1GA 1IYXA 2BFGA 3FKRA 3W72A 1E1FA 1JQVA 4WY0B 1HP5A 3LBCA 2BS9A 3W2UA 3HGJA 1BQGA 3URBA 1B30A 2YR1A 4CCCA 3VCNA 3AO0A 4XO6A 5I3KA 3LERA 1A4MA 2GSHA 3H23A 4X0VA 3CUFA 3VOFA 2EKCA 2WMGA 1W8GA 1EPVA 5BNKA 3MI3A 3STFA 2WSYA 4WIWA 1NELA 3TFCA 5XINA 2OQHA 5HR6A 1FCQA 3VOIA 4OBSA 2EG7A 1KXTA 1SUXA 3JU2A 4US6A 4DVOA 4IGSA 1NQKA 2F6UA 4S3AA 1JYXA 5BXRA 3THUA 4XD3A 3MP5A 5LNSA 1NFBA 5BOFA 3B4UA 1RCOB 2PCEA 3U4FA 1IIGA 1AD1A 3PP7A 5FL0A 2YFNA 2I1OA 3LZ3A 1NF7A 3LHUA 3VCCA 3OJGA 3UWZA 3D46A 4P61A 4AZCB 1WQ5A 2BY2A 3LA4A 4Q3MA 1ZZMA 4FIRA 1IGSA 1DP0A 2XVGA 2RGLA 1X1NA 4YVPA 2QJHA 3SDOA 1EL3A 5A8QA 4PFMA 1W3LA 1HG3A 3I6TA 2WJEA 4LBRA 1FWIC 3SY5A 1OFBA 3K46A 5DX7A 3T78A 5ABFA 2P53A 4IIHA 3KRUA 2BWGA 1RBOB 5AYBA 1S5VA 4NL1A 1V5XA 3E2VA 4UTTA 2DUXA 2YBTA 1D3GA 4LW7A 3WZ0E 3GTHA 3WEZA 5D2WA 4DLMA 4Q33A 1KC7A 4LY4A 4WJEA 1TX0A 2GJRA 2OKOA 1FWTA 1UPPA 3UCDA 4V2XA 2R6OA 4JFTA 3PUGA 2VZUA 2Q8XA 3S1UA 2HXUA 3TVAA 3PNZA 3PTDA 3TNOA 1IZJA 4AWTA 4O14A 3G0UA 1NDZA 3FY1A 1H7RA 1B0IA 1FTXA 3LV5A 2R1MA 2Y8KA 1E6NA 3WCZA 2XU2A 4NG3A 1B9BA 2JK2A 4YN5A 4ATDA 4UTTC 5IFPA 2NQZA 4B5NA 1E9YB 4Q8UA 4MYXA 3FSTA 3CQ0A 1IZCA 3TA9A 1NP2A 3VNJA 4TV5A 1DJQA 1XRFA 2VMFA 3AIVA 3NQAA 2QS8A 3DERA 4EF8A 5A1AA 3M6DA 3L9CA 1TIMA 1QJWA 1FKXA 1NP0A 5E70A 4RZ6A 4MGGA 3WBEA 3W37A 3R1ZA 3Q2DA 3TX9A 3KS5A 3T8LA 4JHMA 5CQ1A 2DH3A 2HVNA 1Q65A 4GYKA 4CD6A 1NAL1 3BXWA 3KRZA 3LQLA 1W32A 2PU1A 1QBBA 2BSLA 4MYAA 4HU8A 4B16A 5KITA 2V82A 1PDZA 3WQFA 3MCOA 1MNSA 3LK6A 4QR6A 2WBGA 3WF0A 3VO0A 3L4VA 3EEGA 4QQ3A 1UC5A 3E9AA 1RV8A 2QXWA 3APYA 3CUJA 1QI5A 4GBUA 1US0A 1E1CB 1KW1A 4PRRA 1PO9A 2XWDA 1FCBA 3Q58A 3HPFA 1V7YA 3UJFA 3CZLA 3G1YA 2ON3A 3ZFHA 3CYJA 3MQTA 1XBZA 4LVFA 3IUDA 3DFYA 4RX0A 2TODA 3HGRA 8XIAA 5G2IA 1L6WA 1XIBA 3TFXA 5IM51 2PEVA 2XINA 3W1AA 4LV9A 5B80A 1DKWA 1EGZA 4EAYA 4BQ4A 3QM3A 2PWUA 2EG6A 5HJYA 2ZUNA 4E38A 3IGSA 3T55A 4ERAA 4Y9NA 1TX2A 1QDSA 5I03A 4WKHA 2ODOA 4FLSA 3SCRA 3ABXA 4AIUA 4AW7A 4KIRA 3AS0A 3R0UA 3ENLA 1UZDA 4O12A 1WDDA 3S4TA 5LGZA 1OYBA 4Q8MA 3WX7A 1BGGA 2OLHA 3AFBA 4P7QA 2X1UA 2QNEA 4GY1A 1FHVA 3GHRA 4QCEA 2PDGA 1AZ1A 3CZKA 1PEZA 1E72M 1UIPA 3JZUA 3CASA 3TNBA 4NAFA 3L4ZA 1R6WA 2IPJA 4KPLA 1IZKA 3FYPA 2L5HA 1DORA 4ZQOA 5D9NA 2NSOA 1NWUA 1XG4A 2X1TA 2RDWA 5DRIA 4YTRA 1D7FA 4EPEC 3BV7A 3KS6A 4CNOA 3T0BA 4GIEA 1FWNA 1KGWA 3THQA 1ISXA 4PODA 2EPMX 1OCQA 2TYSA 3QZAA 4NNBA 4RDZA 3LY0A 1UP2A 1O7AA 1W1VA 3QLLA 3EKLA 2V9DA 4GI8A 4MZ8A 2WCSA 2GGIA 5HMFA 2EHHA 1OCJA 4GZJA 3QSRA 4JHZA 2NQ5A 4IL2A 3GH7A 1MRAA 1ITUA 1W6TA 2AKZA 1EC7A 3RDKA 4LS2A 1IT8A 4Q4KA 3N2XA 3WELA 1GEHA 1JCNA 1POKA 5HOSA 2WNWA 2ZBTA 4XZLX 5G2WA 3U2EA 3VGHA 1DQWA 4M6VA 1Z48A 3F7JA 1NDVA 3LCHA 4R7OA 2J7EA 2Z7GA 3IARA 3NFUA 2BGNE 3N12A 4L65A 4QDMA 6REQA 2HE5A 2X1IA 3AHYA 3QMTA 3V35A 4UTKA 1GG0A 3ATZA 1A5OC 1N2VA 4F0MA 3WNPA 3W1RA 2NX3A 1O60A 4G8TA 1X7FA 5AYYA 3LB0A 2PDWA 2OG9A 3I3DA 4C6BA 2E8ZA 2FH6A 2G95A 1FUYA 3EPNA 1T6MA 4ATWA 2GPTA 1JPMA 1RJPA 3SJNA 3MUY1 3VOGA 4GQQA 1QI4A 1V6UA 2QPXA 3M0XA 1JDAA 3D3AA 1TUFA 4UFMA 2QCHA 3CV2A 2E8YA 3RM8A 1YLVA 4IPLA 4A4AA 5E6ZA 3TQKA 1EX5A 4MLRA 2GUUA 3LHWA 1ICPA 3W7OA 2C6QA 3BTNA 2PB1A 1PIIA 1A5CA 4CLMA 3SQMA 1TPDA 2XIJA 4LTSA 5LZLA 1DPMA 4P8WA 1PZ1A 1S2VA 2ZRWA 3T6CA 3T7VA 3G77A 4EP8C 5D09A 2CZFA 4W86A 4PMXA 5ENLA 2WQPA 2QLYA 4FB7A 3WK0A 3SADA 3CPRA 4IP4A 4HPHA 1TWIA 4JQ1A 3GVRA 2V5JA 2FHCA 4BF7A 3PG9A 1Q6DA 4L9XA 1Q45A 3T2PA 2INZA 2CXGA 3HJEA 3IGXA 2QCMA 4G5DA 1PBGA 3IK2A 1VR6A 5HR7A 3WJYA 3KRSA 2JKAA 1Q6RA 2IQ0A 1EHNA 1W1TA 5FAGA 5M17A 3OEXA 1YNPA 3PAJA 1CGUA 3U0HA 2ZRUA 4FMVA 4DWSC 3GBEA 3CEUA 4WKAA 4OECA 4WX2A 1M41A 3WDQA 4RW3A 4MVAA 4L6OA 1J9YA 3TWBA 4IQLA 2G3NA 1Q6GA 2AKMA 4GXMA 4XV0A 4V15A 3WD0A 3BARA 3ZLHA 5EU9A 2R14A 3V5FA 1P0EA 1UG6A 3OW1A 1DWIM 2HNEA 4HZMA 3TOPA 1E4IA 2Y85A 1XIGA 4DX3A 1JAKA 1A5UA 1OCNA 4IMDA 3GQYA 1TZ9A 3CGTA 4PUNA 5E9AA 3W7KA 4BCEA 1A0DA 3WK3A 1UWTA 1V3LA 1QHPA 1VCFA 2ZXQA 3MSGA 5DMYA 3VGEA 5LGXA 5AOUA 3W2MA 3UVAA 1V3MA 4H9UA 2J9ZA 3I7RA 3VUSA 3WQ4A 4G56A 3VDBA 1X39A 1PL9A 2YB4A 1ADSA 1ISYA 3NZPA 5XIMA 3RX4A 5U4NA 4PR4A 1SW3A 3UZXA 4JX6A 4CU7A 2DSZA 4U5KA 2GZXA 3LPGA 2FH8A 3MCNA 4TX9A 2JQXA 1F73A 1G4PA 3ES8A 1GVQA 3TN4A 2BXYA 1HX0A 2PDKA 4XO7A 3QC0A 1VJIA 3OTRA 3R8HA 3W7HA 1LLOA 3GDRA 2IUZA 2YSWA 3MJMA 2Z26A 5CSUA 1NM9A