1T40A

Crystal structure of human aldose reductase complexed with nadp and idd552 at ph 5
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
316
structure length
316
Chain Sequence
b'MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title The crystallographic structure of the aldose reductase-IDD552 complex shows direct proton donation from tyrosine 48.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 104
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2004-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1t40A00
4GCAA 3V0UA 1Z3NA 4ZFCA 3NTYA 3H7UA 4PUUA 2BGSA 3H4GA 2IKIA 3UZWA 4JQ3A 3M64A 2WZMA 4HBKA 3R8HA 4LBSA 4OTKA 2PF8A 1AH0A 4JIHA 4YVXA 3EAUA 3O3RA 4PR4A 2PDMA 3GUGA 3T42A 5LIYX 2HVNA 4DBSA 4JTCA 5LIXX 4Q3MA 4WDTA 1XF0A 4FZIA 3UYIA 1UR3M 3RX3A 2I16A 4XAPA 4MHBA 1X96A 3CAVA 4QX4A 4WDXA 3MB9A 1Z8AA 4JTAA 5JH1A 2PDQA 3LD5A 4NKCA 2FZ8A 2FZDA 3G5EA 4R9OA 4YVPA 1Q13A 2R9RA 3V0TA 3R43A 4GIEA 2HV5A 1ZSXA 4LB3A 2DUXA 4FA3A 3UG8A 1EKOA 4XZLX 3R6IA 3CASA 1FRBA 2PDFA 1QRQA 3UZXA 2ISFA 1RALA 2AGTA 1AH3A 3KRBA 1Z89A 3R7MA 4JQAA 5M2FX 1Q5MA 5AZ1A 3CAQA 2QXWA 3N6QA 3WBWA 5AZ0A 2IKJA 4EXBA 4GQ0A 3R8GA 1IEIA 1SM9A 3U2CA 2PDNA 2BGQA 1OG6A 1YNQA 1JEZA 2HE8A 1MI3A 4ASTA 2CLPA 3GHSA 3Q67A 4JIIX 1YNPA 4L1WA 1MZRA 4WDUA 4LB4A 4H8NA 3R94A 4F40A 2IPWA 2ACUA 4L1XA 2F2KA 1AFSA 4EXAA 3BV7A 3WCZA 3B3DA 3G1RA 1MRQA 3LZ3A 4FAMA 4XZIA 4PRTA 4JQ4A 4LBRA 1R38A 4FALA 4IJCA 1AZ1A 3RX2A 3EB4A 2IKHA 3QKZA 3WG6A 3EB3A 3D3FA 2PDUA 2NVDA 4LAZA 4WEVX 2PDIA 1ZUAX 4QR6A 1T41A 2HE5A 2PDWA 4RPQA 3ONCA 1VP5A 2FVLA 4DZ5A 2C91A 1S2AA 3LN3A 4GACA 1S1PA 1M9HA 3S3GA 4XZMX 4YVVA 2HVOA 4H7CA 1PWLA 2PDYA 1K8CA 1PWMA 4YU1A 3ONBA 4IJRA 4XK2A 5DANA 4ICCX 3C3UA 1A80A 2FGBA 1EL3A 3LQGA 3RX4A 4HMNA 1GVEA 2VDGA 3Q65A 4XZNX 1HW6A 3GHUA 1AH4A 3V35A 3M4HA 2P5NA 3O0KA 4XO7A 4XZHA 1VBJA 3FJNA 3UZZA 1US0A 5HNTA 3V36A 5JH2A 3BCJA 4XVEA 3LBOA 1RY8A 3LNMA 4JTQA 2IPGA 2ACQA 1Z9AA 4I5XA 4PUWA 2PZNA 3UFYA 2PFHA 2ACSA 1PZ1A 3V0SA 3BUVA 5LIWX 2I17A 4XVDA 2J8TA 2INZA 1AZ2A 4PRRA 2PDCA 4JTRA 3WBXA 1ZGDA 3GHTA 1IHIA 3MC5A 2PD9A 1S2CA 4DBUA 3LZ5A 4LAUA 3GHRA 2INEA 3WBYA 1J96A 5KETA 2PDPA 4QBXA 1XJBA 2IPFA 2PDJA 3R58A 3UZYA 3F7JA 3N2TA 4WGHA 3CV7A 2BP1A 2PDHA 4JQ2A 4G5DA 3UWEA 1EF3A 3BURA 3CMFA 2HDJA 1QWKA 4GA8A 1X98A 5HNUA 5LIKX 2IQ0A 2IPJA 4JTDA 1PZ0A 3DN5A 3UGRA 2F38A 2ALRA 4QXIA 3LENA 4PMJA 2ACRA 4Q7BA 1ADSA 1HQTA 4WRHA 4YS1A 1RY0A 3M0IA 2NVCA 2FZ9A 1EXBA 2R24A 4IGSA 5LIUX 3LQLA 3DOPA 2PDKA 3LUTA 2PDBA 4WDWA 1XGDA 2PDLA 2IS7A 2IQDA 2DUZA 1PYFA 4DBWA 3ERPA 1C9WA 1S1RA 2PD5A 3VXGA 1YE4A 4XO6A 1YE6A 4GQGA 4JQ1A 2HEJA 2DV0A 1ZQ5A 3H7RA 2PDXA 1LQAA 2WZTA 2FZBA 3CV6A 1T40A 5C7HA 3COTA 2PEVA 2PDGA 3FX4A 4AUBA 1X97A 2A79A 3LEPA 3UP8A 5HA7A 2IKGA 4JIRA 1LWIA 4GABA 3P2VA
chains in the Genus database with same CATH superfamily
4NZ3A 4JR5A 4GINA 5HMFA 1H50A 3HURA 3OHIA 2AL2A 3AALA 3MHUA 1BPLB 1X7IA 1QNOA 2IKIA 4AQLA 2WQDA 3M64A 4XUYA 2WV8A 2OLHA 2WJZA 3DFHA 2ZTKA 3O06A 4NSBA 1BYDA 3G1YA 3FGCB 3LXAA 1J8VA 2E3ZA 2GZXA 1SYTA 2DZUA 1LTDA 4A4AA 3T42A 4HPXA 1FP9A 4WK9A 5J04A 1XYZA 3IGSA 4UTTC 1O66A 3PZ9A 4QM1A 5ABHA 1RBAA 4EWJA 1H7XA 2YZ5A 3IJ6A 3TA9A 3TK7A 4XWUA 4EPBC 1JUEA 3MPGA 1KBJA 3OBAA 4JKKA 1Y5WA 1DTUA 2WC7A 1Y5VA 2X42A 3L2MA 4LAOA 4DWSA 5KZ6A 5LNUA 1RH9A 3T4WA 2ESCA 1KM4A 2AMGA 1GZGA 1S5VA 4HTYA 5G5IA 5XIMA 3U4FA 4QRNA 8RUCA 3SRKA 3FJLA 2ZRZA 4WX2A 1ESWA 4ROPA 3UU0A 2G95A 2E77A 1CW2A 3L4VA 2PF0A 3JZEA 3Q45A 2X7VA 3H2NA 3IANA 4AHQA 1QRQA 3NWRA 1XH0A 4BQ3A 3M5XA 3W1XA 3PVFA 4AY7A 3C0LA 2V2CA 5CEWA 1W1VA 3IVUA 3IVTA 3KRBA 4N9CA 4D6IA 2X1UA 3RR1A 4J35A 4ZQOA 3L4YA 5M2FX 4BFAA 2H9AA 1EO5A 5MHBA 2QXWA 2E7FA 4KCWA 3W1UA 2BLEA 1F05A 1K03A 2Y62A 3LI0A 1XQLA 4UTWA 4TIMA 2Q8LA 1ODZA 2OEMA 4CNOA 5C9XA 4RNHA 3CQHA 2WZHA 3FXGA 1NARA 2WBGA 4IWWA 3RPDA 1BWLA 2Y8VA 1DPMA 1XLKA 4A05A 5T9CE 4ZOCA 5HOSA 5F2LA 3ARZA 1C9DA 1XIDA 1QBBA 1H1ZA 2FYMA 1RBOB 4WDUA 1J0YA 3I10A 4EANA 3DEQA 1K6WA 3MI6A 2D2OA 3RPTA 4I5RA 3LZ3A 3USZA 3CGTA 4B9ZA 1BGGA 3V4BA 3TE9A 1NWRA 4W7VA 1F8MA 4AZIA 3NURA 4O1FA 4C1NB 2FB2A 1VENA 3UYCA 2V5JA 1KXHA 3BCFA 3CWHA 5IDZA 1M01A 5KTLA 1LZOA 3OGRA 4JTGA 4DXKA 1X1ZA 3I7SA 1SO4A 2AQOA 3VAVA 5I03A 1VEPA 1BG4A 2EG7A 1EJTC 1CECA 1CT5A 4MLRA 2QGYA 4JZ5A 3ZJ6A 1RPKA 2PTXA 4PB5A 5TD4A 4ZB2A 2VT0A 3P82A 2JKAA 1TO3A 3H2EA 2R1NA 1F73A 1X7FA 2VX5A 2B4GA 3VGBA 3Q65A 3EDDA 4Z1BA 1ITCA 1R87A 3GC5A 1E0XA 1SFJA 1FH7A 3NQ8A 5TQLA 2ASHA 4UQBA 3VIFA 4GBDA 5HNTA 5JH2A 5F1UA 4L9ZA 4D6DA 1BF6A 1OCQA 5D09A 3SI9A 2UY5A 2C14A 4X3ZA 1W8GA 3SADA 3UVAA 2C13A 4K38A 1LLOA 4BEUA 2ZZ2A 2H6RA 1LBFA 3HG3A 2OR2A 5E70A 4W86A 4UMAA 4M6QA 1EZ2A 3G3MA 3PFRA 2DH2A 1UP0A 1A4MA 4M1BA 4S38A 3GHRA 4GGBA 1LT8A 4HA1A 2GWNA 2QPUA 4N6FA 4JKLA 5DT7A 2E6YA 4J40A 1O7AA 4OGZA 1IEWA 4Z2HA 3VK5A 3UCCA 1AVAA 3N13A 1MQPA 3NCOA 1FHUA 4GYFA 4RPPA 5M03A 3W1PA 5KZMA 1TV4A 1SJBA 2X0SA 2OT1A 4QROA 4B5VA 4ZENA 4AEOA 1D3CA 4OUIA 1PV8A 2I56A 5MKGA 1EH9A 4MB5A 3BSGA 4IX0A 2QCLA 1AQ0A 1J5SA 1EXBA 5IBXC 3H12A 1B5TA 1TMHA 2CZ5A 3OIHA 2VEGA 1KRMA 5E1QA 1Y7VA 3L65A 1EBGA 1XGDA 4QAWA 2IMRA 2VGGA 4R33A 1ZAIA 3IPWA 2G37A 1R3WA 2WSRA 1YE4A 5CGQA 1IXQA 3DFNA 4PODA 3PUDA 1CGWA 1G7UA 5CC3A 1IQ8A 2GUYA 3CL8A 2NXGA 2Y8UA 1ZQ5A 3VNDA 2PE4A 3B8DA 1LQAA 2WZTA 2P0OA 1M53A 1HZYA 4NZCA 3KOXA 2PEVA 1BFNA 4UNKA 3PAOA 1L2QA 3UF9A 2WJFA 3GU9A 2HXUA 1QNSA 3LHWA 2PBGA 2QYGA 4L1GA 4G1KA 5BU6A 1KR1A 3KBNA 5A94A 1OQFA 1A49A 1HJSA 3PZNA 4O1DA 5CKSA 3RRXA 2W92A 4QITA 4OZOA 1EJUC 4FS9A 4HBKA 1XLGA 4QEHA 5D03A 4CNSA 1GOMA 3GQYA 3LNPA 3SGGA 4YVXA 3TIMA 1H11A 3SSJA 5ECUA 4KGLA 4PR4A 3REQA 2GSEA 2XTKA 2V82A 5A2AA 1W32A 1K1DA 5D8ZA 2OXNA 4KFPA 3P62A 2J25A 3BPWA 3THQA 3L4WA 1W9PA 1DIDA 1R30A 4L61A 4JL2A 3PF3A 3S1VA 4Y6GA 4HHHA 1KM1A 2J74A 3UD6A 3RAOA 1J93A 4CNTA 2QULA 4NNCA 1QW8A 2Z2AA 3VZZA 4IPIA 4LNYA 3GVWA 2XVGA 4OBSA 3OZMA 4D6FA 2BXYA 4D9PA 4E2OA 2DT0A 4GG9A 4XZWA 5AHMA 2J9YA 5CXPA 2Y0FA 4OOZA 2QCCA 2EG8A 3HMJG 2W61A 3BJFA 1JXJA 1FRBA 3TQVA 4PMRA 5LYRA 3OZYA 3ATYA 4AISA 1BKHA 4GI9A 3GXIA 3MP4A 3PPFA 1RVKA 1EJSC 2E8YA 1JF6A 4UTMA 1VRDA 4LVGA 4XZBA 1TTJA 1F3XA 3V18A 2WPBA 1NF0A 1UOZA 3WQCA 3N73A 4ZODA 3TN3A 1TMLA 1G67A 4DM2A 3P80A 2ZICA 4ML9A 4FNTA 3R11A 1PZ2A 3LRMA 2WNQA 2BGQA 1RUSA 1WNOA 1J6OA 5FAGA 2NX1A 4LV4A 1XIMA 1NOWA 4LVFA 4IGHA 1VBHA 3NGJA 1Y5XA 1FWDC 3KL0A 4KFOA 3ARSA 3LYEA 3U0HA 4KKXA 2CERA 3EKZA 1ADOA 4BHYA 2XSBA 1M03A 2ZX9A 5AYIA 1UKOA 1NF7A 1PX8A 4S1FA 3CTLA 1MRQA 4BI7A 1UWTA 3ALFA 1MMFA 2QDGA 2D0GA 2QVNA 3MYPA 2VZUA 1JD9A 3EB4A 4GKLA 4E2DA 4X22A 3L5LA 1OYBA 3QSTA 4H9XA 3OQ8A 3W37A 2OKOA 4DO6A 3VM7A 4M51A 3BLKA 1RA0A 3OG2A 1OF8A 2Q8ZA 1R6WA 4ERGA 4MJMA 2WWDA 4BWLA 3C5QA 3QJAA 1J0JA 5DMNA 5LGZA 3FK4A 3DYPA 4JFVA 2C91A 3QGAC 3KCOA 3CT2A 4GACA 3MZ2A 1D8CA 2BHUA 3QC3A 1E1EA 1ZAHA 1CGXA 3DBNA 4OU1A 1BRLB 3CQKA 5G1TA 2WMJA 1H5YA 2WLYA 1E56A 2BY1A 4H9MA 3R25A 1A80A 3L23A 5HMDA 3KWXA 4XUGA 3UWVA 2VDGA 4NJIA 1JGMA 3ATZA 1ZY9A 3ZT5A 4S3CA 1MXGA 5LSMA 2YIHA 4S2BA 3VC6A 5GQBA 1EGMA 4PCNA 3DG6A 2WNZA 3WMCA 1H7OA 5C0QA 2HISA 3FJNA 3T4CA 1NAL1 1HL8A 2BDQA 3DH7A 4M6PA 2YFNA 2WPGA 1A5NC 2V5LA 2IPGA 1Z9AA 2I5IA 1CTNA 2TMDA 3CM4A 1JNDA 2O9PA 2PZNA 2AQVA 1C90A 5A6KA 3OLDA 4ZE5A 3MBFA 1SQ7A 1AW1A 2CKRA 3JS3A 2DP3A 2GK1B 1PKYA 3WDRA 3W9ZA 3GTIA 5CSYA 1QI4A 2EAWA 4DUWA 3PSVA 4LANA 3QXBA 4PUNA 2GJXB 1PDZA 1F7BA 3QFWA 3GHTA 3MC5A 2GSHA 4ZE4A 3TROA 1E6XM 1UCWA 2XPKA 3PHAA 5EMMA 1VPXA 3G1DA 3OBKA 3GW0A 3GDLA 1XYBA 4GQRA 1L6FA 2QCMA 3NDOA 1JYXA 3JRKA 2HDJA 4RW5A 4ZEPA 1PX3A 4FF5A 3M0XA 2WOQA 2ZQ0A 2CIPA 1OT2A 4GH3A 1MWOA 2XIQA 5I3FA 3WSUA 2YDQA 4CCEA 3KBMA 2AGKA 1C8YA 3LENA 1VC4A 5HNRA 3BLFA 4PMJA 4KWWA 3UXLA 2V38A 4QJ5B 2Y5JA 3VGHA 1ZBCA 5KEZA 4XIAA 3BW4A 4IMGA 3BJSA 2F7FA 3IGUA 1PIFA 1YDOA 3IK4A 1PE1A 3VKAA 4R7JA 3EWYA 2IQDA 4FLQA 3N4EA 4FNRA 2D2HA 1ONXA 3ERPA 3QHOA 1Q3NA 3UY7A 4E4FA 2JGYA 3QV7A 3T05A 4WZHA 5HQLA 2EO7A 3APYA 1HJVA 1I45A 4PL1A 2PWVA 4CN1A 1ISYA 3EWCA 4L80A 3MUZ1 1ME7A 4GIAA 3KRSA 1PIGA 3CL6A 1TPH1 4RZ4A 1KGUA 4GXMA 4AUBA 3VABA 1CGYA 5I3DA 4KEVA 1US2A 4GIRA 1PEZA 2DZWA 2GVYA 4HMDA 4JTHA 1DJWA 5FI8A 3U5UA 3GXPA 1UIPA 2QW5A 1X8CA 2TSYA 3CU2A 3PTQA 1NP2A 3RLUA 4HTBA 3E5PA 1JF5A 5C54A 1H2JA 3WF0A 3LHZA 1W1IE 4Y9PA 1E51A 2GJNA 1XFCA 4TR9A 3W7PA 4M1RA 3BOXA 2VFFA 1EGVA 1IR1A 3PZTA 4FR1A 4NX0A 3AC0A 1I1XA 1AW5A 5HNNA 4GY0A 1UMLA 1KCXA 3QR1A 1X1OA 3RX3A 1XIGA 2I16A 3R10A 3TC3A 3ARVA 1RAKA 1H7WA 1V93A 3ZVHB 1JIBA 1LL7A 2D23A 3WO8A 5F7UA 3UGVA 1Q6EA 3BTNA 1NWUA 1YPFA 1BTCA 2VO5A 4ACYA 5D2TA 3WQ4A 4XX6A 3P5ZA 3E1F1 3KLKA 3A3HA 4R7WA 3SSZA 3TDFA 4BA0A 1MYRA 2CHOA 1V3JA 4FOUA 4PL2A 3G1FA 3AHVA 3LBCA 3NOEA 3L12A 1FHVA 1W1YA 3QN3A 1UZDA 5D2YA 2NX9A 1Q6QA 4N4PA 4JIEA 3M43A 3HPFA 1NVMA 2TPSA 2E68A 3AS1A 4LNCA 4CD8A 5HWMA 2X0YA 2PCQA 1T7LA 1L6YA 3ITTA 1MFUA 2EKCA 2PA6A 3ABZA 1FH9A 1O12A 3RRAA 4JX6A 3C2EA 2XGIA 2FGLA 2PDNA 1CNVA 1HP4A 5FAJA 1QNPA 2YDRA 4LYRA 1LOLA 1C7SA 3RMEA 4MPKA 3A47A 2P0IA 1MI3A 1ZBVA 3UZ5A 8XIAA 3SIZA 1R9ZA 2WMIB 5HJXA 4X61A 4GUGA 3WLKX 3UPWA 3W6LA 4L9YA 3WQFA 1CENA 4NRRA 3VKDA 3PP7A 2ZA1A 3U6WA 1DORA 4PTWA 4AC7C 2VZTA 3K8MA 2PC4A 1W17A 3NQMA 3DHFA 4PCPA 2VR2A 4MNKA 3H4XA 3S4TA 2D3NA 3D3FA 3L4XA 2DU2A 2QCHA 4O18A 1E1CB 4UZSA 2OPJA 4P8VA 1GQNA 4FX7A 2HE5A 3EKGA 3MSYA 1H63A 3BC9A 1I60A 1ADDA 3DKJA 3LN3A 1UUQA 3PSWA 4MWAA 4RCXA 3KP1A 3GTXA 3TOYA 2KAUC 2F6UA 5E93A 4BJHA 1JPMA 4ERIA 3CJPA 5LHEA 3CO8A 5A5WA 2HTMA 3QGVA 2WKJA 4IISA 1WZAA 1Z42A 1GONA 2PBOA 4S3EA 5BWAA 4O28A 3C3UA 4LAKA 1TPEA 1YXCA 3BMWA 1T99A 2QUTA 1AUSL 5TNVA 3D46A 5I78A 1AW2A 4K1GA 1XHGA 4X63A 3CUZA 3MQTA 3N15A 1V6VA 4FNQA 3RJXA 1XXXA 3VOFA 5JIWA 1UWUA 2CWXA 3EDKA 4XVEA 3LBOA 4I9MA 4E2VA 4MNLA 1CGTA 5A3HA 4WSKA 1T8QA 3WLOA 3P8JA 4M80A 1A5AA 2DDXA 1DOSA 1BVWA 1YIXA 4HGXA 4DY1A 1UBSA 1A5CA 4J3ZA 4MAZA 2C7FA 2INFA 1B54A 2KZHA 4CKQA 3NPUA 2PWEA 3DHDA 4IPLA 4JIQA 2FHFA 4P7NA 1JZ4A 3W7HA 2XU2A 5ENLA 4DI9A 4PMUA 1IHIA 3RNDA 3UT0A 4DM1A 1N55A 3LZ5A 3E0VA 5AC6A 2INEA 3RCNA 1E9YB 3WL1A 3MKCA 1Z44A 4GO8A 3N2TA 1EWEA 2ZA3A 3VD7A 1UP2A 1JQXA 5CG7A 1VFLA 1EF3A 3P74A 3IRSA 4P7QA 1SU5A 1TCMA 2YCKX 4XSMA 3E02A 3B4YA 4AW7A 3GG7A 1TVLA 2JALA 5BCAA 3GBDA 1GVOA 1WDWA 3WBAA 2OFJA 3SN1A 5CLWA 2EKGA 2F2HA 2VQTA 4ACZA 3O15A 1UJQA 2MUCA 4Q7BA 2Q01A 3AIBA 3EMQA 4LUTA 3WK3A 2YJQA 1B4KA 2V5KA 2YB4A 3MHGA 1PX4A 3I68A 3I3BA 3SUSA 1DJQA 3GFYA 2CFFA 1P0EA 1E0VA 3UJ2A 2DJLA 3NPXA 4C6LA 4WSJA 2DUZA 5I06A 4DBWA 2QMKA 3LCGA 1JR1A 2WCAA 1CLVA 1XI3A 3EDEA 1G69A 3O7UA 1CB2A 1DQXA 4H4IA 2Y88A 3CZ8A 2G50A 1GVIA 3W7LA 4YHEA 3KEHA 3WH9A 5JBEA 2Z24A 4BKNA 1A50A 4H6KA 3MCNA 3KOYA 3LX9A 3VA8A 1OJXA 2HXTA 3HG4A 4K36A 1XDJA 5H6HA 5AYZA 1UQYA 1E9LA 2OOGA 4J5NA 2YCIX 4K37A 4Z1YA 1QJWA 3OVPA 5IOBA 1E4NA 1IEXA 1H4PA 5FJRA 2YXXA 1IT0A 3M0KA 1GG0A 1B3XA 1PVNA 4JIHA 2BVWA 4W87A 1V7AA 2ANUA 5F4WA 4H6RA 5HJLA 5DY2A 4CD6A 3MANA 2XWEA 1P1XA 4H9TA 3OLGA 1ZZMA 5BWFA 4FZIA 2QCGA 1EX1A 6TIMA 4WXYA 1X96A 4PB4A 3UXAA 5CH9A 3GDRA 3S47A 3NL6A 1YHTA 4TUFA 2FFIA 4NKCA 3AQUA 3P8IA 3TYUA 4GK8A 3TZNA 1HGWA 1UP3A 4YVPA 4CU7A 3PC0A 1DXEA 2WSYA 3J7HA 3GU2A 4OFCA 3FCPA 3SQMA 5D9OA 3KM8A 1YPXA 1JGIA 2AAAA 3HU7A 4I9TA 3ALGA 2B7NA 2VFDA 4NZ1A 3KCJA 1OC6A 5E9AA 5EMJA 1WZLA 4XKMA 3S1WA 4AH7A 3UZXA 2RHGA 4QNEA 4CNNA 1RALA 2ZE0A 4C6CA 4I5UA 3SRHA 1XBXA 1G5AA 3G0UA 1FHDA 4IGNA 3A4XA 3EBVA 4WY0B 5AYYA 3K8KA 1YNYA 1ZAJA 1B3WA 3PULA 5GNXA 2CLFA 1XYFA 4H8UA 1OG6A 3WFAA 1IF2A 1JEZA 1X6LA 3B8WA 3LPOA 1VFOA 3U7VA 3CHFA 2XH0A 1SUXA 2CZVA 3NJ3A 2ODOA 4QDPA 1WKDA 4D6JA 2D1ZA 3ZLFA 4HA0A 4B4HA 2VZSA 2PRLA 2VENA 3NPWA 1D8WA 5FJOA 1YNPA 1PKLA 1QDSA 5LXEA 4PEEA 4ZCWA 4LS1A 3SY5A 3NZPA 1G9HA 3EEZA 5F2IA 2ZXDA 3WF2A 3TYCA 3UWZA 2R91A 1X38A 2RDWA 4NHVA 4Q22A 3IRDA 4HNNA 3I7RA 5I7GA 4H01A 1AJ2A 1BSLA 4AZ5A 2QCDA 3T09A 3D3AA 3WY1A 3VCNA 3EMCA 4UOQA 1PTGA 4FXJA 4KEMA 4MNMA 2B0MA 4HN4A 1JCNA 2R14A 7REQA 4LGXA 3FYOA 2O9OA 4IFKA 2Z26A 1ZUAX 2QKFA 2DT3A 1ZJBA 5G2WA 2G96A 3TV8A 1XD0A 2FVLA 4ZSTA 1FXPA 1EEXA 3KBWA 1E1FA 2C6QA 4YYCA 4L4PA 3N14A 1M9HA 3GBEA 5AVHA 3T2OA 1YYAA 3QY7A 4XZMX 5G1YA 1YTEA 1TV5A 1TX0A 1KM2A 5AYBA 5I3JA 3K46A 3PPCA 5I23A 1J2WA 5DANA 3TU9A 4DWSB 4U31A 3B9AA 5JIPA 2ZZ5A 1UD3A 1LRTA 3CIVA 4HNLA 4NNAA 4P2VA 1QI0A 2WMFA 4XZNX 2X05A 3EXRA 4RXGA 3BJTA 1BQGA 4QG8A 1H09A 5FA5A 3GR4A 1FDYA 1ZB5A 3FHAA 2YXOA 2DZXA 4WKFA 2PMQA 3PS7A 3TWAA 4GHRA 2B7OA 1QASA 4JTQA 3AI0A 4PUWA 2E1DA 2NV1A 4Y96A 4MWAE 1W2PA 3AZSA 7ENLA 2WAGA 3OGVA 5LIWX 1TE1A 3N6JA 3NOYA 3ORWA 5CPLA 5LNWA 2ZUUA 1TE6A 1FBAA 1J18A 1EA0A 3MP3A 3QSRA 4B15A 3O6AA 1I8JA 4K3ZA 1BYAA 2I9UA 3SUUA 2BOFX 1XLIA 4QAIA 2E6FA 1XG3A 3WJZA 2WQPA 4H04A 4ATLA 4TOQA 3R58A 4I9AA 4WGHA 4GXPA 1U5JA 1J9YA 2PTZA 3GXFA 3IK2A 5LA0A 3AU6A 1FX6A 4O0ZA 4N9EA 1CB7B 4K39A 1D7FA 3I4EA 2FQIA 1IZCA 4GMEA 5CPSA 3C2VA 4ZA0A 4HYWA 1H61A 1QCWA 4LALA 3CWOX 4C6OA 1XGEA 3SGZA 4R7OA 3A4AA 3U2OA 3W2KA 1D2KA 4RZBA 1Q63A 3A5VA 1XW8A 1UD4A 4JKMA 4JD4A 2YA2A 5C9RA 2C8NA 2ZX8A 3EX1A 4DO7A 1TTQA 2FDSA 1R3YA 2OU4A 4LYKA 3WL0A 1QPNA 1EEPA 1WDDA 3VI2A 1BVNP 4HNCA 1SW7A 3IV8A 4XO6A 3H54A 4MIMA 3THAA 4JX4A 2YSWA 2H8ZA 1KBKA 2V2HA 4A3QA 3IACA 2OOFA 1I9CB 1ZJIA 2FZBA 1DE6A 1R85A 3ITGA 1VJIA 2ADAA 1ZJHA 4TV5A 4PTDA 3VX1A 1B2YA 4HU8A 3L0GA 3NSNA 5H8UA 3OW1A 2GJLA 3EDJA 3WQVA 2Z6IA 3WK1A 2E8ZA 1FVPA 1XLLA 4N4QA 4P7OA 2XZ9A 1KCLA 3GKFA 4PB3A 2H8XA 1SFTA 1M04A 2IXUA 5CQ1A 4MUPA 5HDRA 2Q3OA 2PODA 1R7OA 3WH6A 4MTVA 2W5FA 3VOCA 1BTMA 2X7WA 3W74A 1OFPA 4GZJA 2H3DA 4DZIA 1XR2A 3KVMA 3L5MA 3V1PA 1SFLA 3UA3A 3ZSSA 3H6OA 5G4EA 1KD0A 2DT2A 3MMTA 1WAUA 5LIXX 1NJJA 4WHBA 5LNRA 3M9YA 1NDWA 3S2LA 3NNTA 1Z8AA 3EZ4A 1WZMA 3O6DA 3GC2A 4ZZ9A 1OB0A 3EOUA 3TR2A 3PZIA 4O1EA 1NFBA 2BODX 1VFSA 4TX9A 1MW3A 1H1NA 3M0YA 2PGEA 4GD0A 5HANA 1DJZA 3FEQA 3R43A 4AB4A 5EMKA 4HK5A 1QW7A 2X0HA 3F4WA 3F2CA 3EDFA 3KTCA 6TAAA 1NIUA 3M1ZA 5MKGB 1TR1A 2GDUA 1Q8AA 4F9JA 1W3NA 4OQVA 3GZAA 5F4XA 3WLLA 9RUBA 2PLKA 4Q8UA 5KZEA 1Z6KA 3RXZA 2PGFA 3R4IA 4E8GA 3EGJA 3C56A 4N2YA 4JN6A 1HJXA 4YL2A 1LL6A 2QIIA 1DHKA 4LJ3A 4B2DA 3VKBA 4ALDA 3WBWA 1YBQA 5BU9A 5AZ0A 4HSNA 1AA1B 1JZ8A 1SGJA 3QQWA 4BQ2A 4RK8A 5LNVA 1G4PA 1XYLA 3LTSA 1WCGA 1BXBA 4DJDC 3H2AA 1PPIA 4O53A 1ZRQA 5K9DA 2ZUWA 4H00A 2HE8A 4AEEA 2PU1A 1LL4A 4LEFA 4PC8A 3VIKA 3NIYA 3K4DA 3QZEA 2G41A 5EMLA 4GVFA 1GW1A 1NFGA 1AL8A 3NZRA 4DJFA 4EXAA 1HKKA 3G1VA 5JBFA 1QPOA 5K2ZA 4LRSA 4MVAA 3E2VA 3MP5A 3GK0A 4AX6A 3HF3A 4IJCA 4PMZA 1FFRA 4F2TA 4H1ZA 2GL5A 3UWYA 4LUSB 3RG6A 3B4UA 1VFTA 1GOXA 5A2CA 4AEFA 2HPIA 3GSMA 1YX1A 1XRTA 3NQ6A 4O4VA 5D32A 4ZR8A 1BYBA 2J24A 4LAZA 4RL3A 2Z1BA 3REQB 4DRSA 3IS4A 3HN3A 4YN5A 2A3BA 3QV9A 4LUJA 4Q8OA 1TJRA 4RPQA 4QISA 3UJFA 1CXLA 4IP4A 1CZ1A 1XS2A 1HL9A 3PB2A 4ZTYA 1GHSA 2QCNA 3GNNA 1Z32X 1M1BA 1UC4A 2P3ZA 4DNMA 1BKSA 2WM1A 3GNPA 3HA1A 3MKKA 5D4YA 1KQZA 1E5NA 1K8CA 1FP8A 3CZGA 3AXXA 3CYVA 3E5BA 4HMNA 3W1TA 2HVMA 3S42A 2EPNA 3GXDA 4WJ8A 4KCUA 4GJ1A 4NP7A 1U83A 1OT1A 1IR2A 3KXQA 3GNRA 3BLOA 3M4HA 4DWSC 3FXYA 3NVTA 3GUWA 1EX5A 1RD5A 3UG3A 3CUXA 3W27A 1OK6A 3EOLA 2DZTA 4GIYA 4W9TA 5A6BA 3UWUA 3VOGA 4AX7A 3QZ6A 2A0NA 4DF1A 2WHLA 2QJMA 1XSJA 4M5PA 1JJKA 3UFYA 1WUFA 2ZC1A 3MDUA 4W8LA 1WA3A 4FP1A 2FJKA 3W0KA 1H1YA 1XFBA 3P14A 4DUXA 4JY9A 1TWDA 1Z48A 5A6JA 3AMCA 1TR9A 4JYFA 4ONVA 3GIPA 5DQPA 5AHFA 5CSUA 5LGXA 1C29A 4L65A 3GIYA 4UTWC 1SMDA 4C65A 2HROA 5BROA 1YEYA 3A4JA 4HPGA 4GNJA 3PUEA 5EPDA 2Y8KA 3SUVA 4CCDA 4DJDD 3GYCA 1HXJA 4ZVJA 2BVYA 2IQ0A 3UW6A 1XLMA 5A1AA 3VTRA 5K9CA 3PN8A 1KBLA 4PTMA 1PUDA 3GZ3A 4HN8A 3W53A 5CZSA 2V9DA 3IIPA 3WK0A 5A8NA 4OWGA 3SJNA 3NSXA 2R24A 2XJ7A 2XM2A 4TX8A 2GPTA 2XH7A 2JFEX 1XG4A 2GQAA 3BLIA 4YYFA 3PR2A 5A95A 4W5UA 1OD0A 4LC6A 4F0RA 5BRPA 7XIMA 1CXKA 1I0DA 2OYKA 5HR6A 3TX9A 5CSSA 1W3JA 2I7GA 4DPPA 5HWNA 2VD9A 3AHTA 3NZ1A 3LTPA 1YMYA 3SGUA 2V5BA 5BXTA 4IZGA 2CLOA 3GS6A 2A21A 3N1AA 3LSCA 4XAZA 4RX0A 5EMYA 4CVUA 1YADA 2PTDA 3PPGA 1HT6A 4JYEA 1JZ5A 4FI4A 2PDGA 4LS2A 3ZFHA 3W7OA 2A85A 3NM1A 3TTYA 4LOCA 1N82A 5FF2A 5B7ZA 1CDGA 5HA7A 3SB0A 4X2PA 2D20A 1KV8A 4AY1A 3NTYA 3RM9A 1YTKA 4Q33A 1QK0A 5I07A 1TVPA 2JK2A 4JQ3A 3B8SA 4XD5A 3FVDA 4MY1A 1WKFA 1XYCA 4L6DA 3ZVIA 4LY8A 1KTCA 4DWSD 5A69A 1UZ4A 3MUIA 4UTIA 4MB3A 3O8AA 3EAUA 4Q8VA 3G1XA 4W8AA 2WXDM 1WPCA 3GUGA 1M68A 2Y70A 3M6DA 2XUCA 4AD3A 4DBSA 2QLYA 4MJZA 4XSLA 4MY9A 4HP5A 4RE4A 4QX4A 2OSYA 3SUTA 4YLWA 4A3RA 4R88A 1DE5A 2F8QA 2GDVA 4JTAA 1GQKA 3HQOA 1M7OA 3L7RA 3IJDA 5FD0A 1W5NA 1XUZA 3LPFA 8TIMA 3WQOA 1XPGA 3CV1A 3WDPP 4IG2A 3IGHX 3TFCA 1EYEA 2DVXA 4GIEA 1UOKA 5AVNA 1M5WA 1E4IA 1XCXA 4IGMA 3LA4A 4FA3A 3MU7A 1OBAA 4M29A 1HJQA 4TU1A 4R53A 2VNCA 4S3FA 2I14A 3CZKA 3H21A 4BF9A 3NR0A 3ZQ9A 4H6QA 4LVBA 4WY0F 2WYSA 4B5SA 1JAKA 3G22A 4WGXA 1B90A 4PUDA 2NQHA 2Z27A 5AZ1A 1IT7A 1EOKA 4CGTA 3EOSA 1SPQA 2OGYA 3KW3A 2WK2A 2ALDA 3LLDA 3XINA 3W71A 3FJ4A 2JQXA 4S3GA 1YDNA 1HX0A 2OWXA 4HZ7A 2VYOA 4PMQA 5LKYA 4I6VA 3LV6A 4PBGA 3ANVA 1TPC1 2O55A 3N17A 4JICA 2QF7A 3Q67A 3S5OA 4Z2IA 3AYTA 4W93A 4LVDA 4H8NA 1PSCA 4AXKA 1XD1A 2YDSA 3R79A 3KBSA 1QI5A 2V8ZA 1EGZA 1Q85A 1JDFA 1UWQA 4IHCA 5G4WA 3C52A 2DUAA 3S5YA 4FAMA 1LRNA 4OT7A 4XZIA 4H8VA 4IICA 5CJ5A 1R38A 4XAYA 5AKQA 3LGEA 1V02A 4F4RA 3PZOA 3AIRA 4JGDA 3RMJA 3TYBA 1K8ZA 1QR7A 1EP1A 4CN4A 1TMQA 4WEVX 1KM3A 1JULA 4KT2A 4ORMA 2GUUA 3GE7A 4LSBA 1IEQA 3N9RA 3PWIA 2C1GA 4Q4QA 3VMPA 2UWFA 5JQ9A 3V16A 1GT8A 1ML1A 4ADTA 4NXKA 3GKAA 3BV4A 1S2WA 1UZHA 2EPHA 4ECLA 3WDHA 2BOEX 5C5YA 1A5SA 4E38A 4J2MA 1Z41A 4F3HA 5FL0A 1WBHA 2J8GA 4NI8A 2YLLA 1HNYA 3LV5A 3LQGA 2V3DA 6REQB 3P60A 4Z2GA 1UA7A 3KOZA 1R2TA 1OFDA 4NZJA 1JFXA 2BTMA 1LT7A 3V35A 8CGTA 4HJFA 4KETA 3NYDA 5CC7A 4DBDA 4INFA 1ECQA 4I9JA 3NQ7A 1BSIA 1WDPA 5JU6A 3TMLA 5DBUA 2Q71A 1POJA 1THFD 4ZO6A 3SCPA 1IGWA 1F4AA 1FWJC 3IIOA 3SURA 3LNMA 2GFTA 2PLCA 4AHPA 2V63A 3AFBA 4JN8A 1A5MC 2ZZ7A 5CZ0A 4L6HA 2G5WA 2PGWA 4RUBA 1RR2A 3UY8A 1JYNA 4MJ2A 2PP3A 2YL6A 4O54A 4D8ZA 4JTRA 2X2GA 1L0PA 5FEPA 4H3DA 2ZXBA 4XTDA 4DBUA 1LBLA 2RDXA 2WC4A 3GU1A 4E4PA 1XLBA 1E55A 3LHYA 3ES7A 3CNYA 3IUHA 2GQ9A 3GXNA 1AG1O 4KBXA 3UWEA 4RJEA 1WBJA 5CPNA 4UIOA 1OABA 5LZLA 3KHJA 3UETA 4TVUA 5LIKX 1U33A 2XVLA 4CQ8A 1VS1A 4EX4A 1S2UA 4O10A 3LM3A 3EPOA 4GX8A 4AU0A 4BI5A 4IM4A 4RR4A 2EPLX 4R34A 2HSAA 1W9UA 1GYNA 2J7CA 3SRDA 2XIJA 3VCRA 2JEQA 3JW7A 3O9NA 4HIBA 2PTWA 2VDIA 3UNDA 1B30A 2VDHA 1ZBWA 1A5OC 5C71A 1OHLA 1QOXA 2VR5A 1UPPA 1FDZA 4C7GA 3E0LA 3T7VA 1CBGA 3CUIA 1KFCA 2EBNA 3V1HA 4BWLC 3B9DA 5C70A 2YW4A 4M7TA 3GNOA 4YTUA 4GQGA 5H8MA 2Z4GA 2XIIA 4N6EA 1VEOA 1YXDA 1UR4A 3HGOA 1XLEA 4GYJA 2OSWA 3STPA 3P84A 4UMBA 2VKZG 4PSPA 4RDZA 1V77A 3HG2A 4AMAA 3ME3A 4OECA 1GNXA 4QS6A 1OCNA 2GVLA 2YDAA 3WD0A 3LOTA 1BAGA 4Q6XA 3W83A 4Z17A 2EG6A 4M7SA 3NQBA 5FCZA 5CPQA 3U2ZA 4RV3A 5B80A 4QS5A 5REQA 3R8HA 3WYZA 1QU4A 3N18A 4AXNA 1KCZA 4HU0A 2J6VA 4U5IA 4E4UA 4LW7A 5BMXA 3W7NA 4XD3A 4OKDA 2YL5A 4PCFA 5AY7A 2QDEA 4A3YA 5ABTA 2QJNA 3AS2A 2XGBA 1K6AA 3MZNA 4Q3MA 3DGBA 1MW0A 3CIWA 3GDBA 4YTQA 1JNEA 1WDRA 4DUVA 2A3HA 4X60A 1IGSA 4J1OA 3QW3A 4RZ6A 1BD0A 2X1SA 2VCBA 3LI1A 1UKSA 1KRBC 1TUXA 2NV9A 1EXPA 2WW5A 1DWFM 2FZ8A 2FZDA 3G5EA 3RCMA 1XSKA 4NILA 1RQHA 3V0TA 3OEXA 5GJMA 3S1XA 4UFIA 3GM8A 4AY8A 2XVKA 1SW3A 5K3VA 2HV5A 3FSUA 1ICPA 1XDMA 1LWHA 5HMSA 5AC5A 4ACZB 2VI0A 4KMQA 3LB0A 4FO4A 4C6JA 3GH7A 2HRWA 1JDEA 2Q8XA 4HA3A 2PTYA 4QG9A 1J0KA 4LUTB 4KESA 2O92A 4JTJA 4M81A 4LYPA 2VEFA 3BXWA 4L4LA 4F0HA 4X2RA 1Z89A 1TJ2A 4Q7NA 3R7MA 4JQAA 2PPGA 2PSNA 3MT1A 3LSBA 1LOQA 4RE2A 2C79A 3UPMA 1RK6A 1UWRA 1DP0A 2ZUMA 4PZVA 4YIWA 1UR8A 1C91A 1TV2A 1J79A 1XRFA 3DHPA 1R9XA 3DECA 1WXZA 3AIWA 1O5KA 5DF0A 1I1WA 3FA3A 3S5SA 1YXYA 3HQNA 3K30A 3ARTA 3BLDA 3P93A 1I0BA 1AMKA 4U3CA 3QR0A 2BZNA 1ZCOA 3GHSA 1OGSA 1IIHA 4CNUA 3ITCA 4E3TA 4GE8A 4A8RA 5EFDA 1QI2A 2XIBA 2YL9A 1HN1A 4DJED 1HKIA 1AFSA 3ARRA 4E6MA 4H8HA 4N9BA 2QMJA 4IQLA 2ZZ4A 3B3DA 4V1YA 1EIXA 1VZWA 1GQIA 1DWIM 3PWGA 3URQA 3WLJA 2ZC8A 4GUJA 4J7RA 5IFPA 1UG6A 1W9XA 1H3GA 3CH0A 1N2VA 5TF0A 1A53A 3M0ZA 5HR7A 4WSHA 3SN4A 2O9RA 2XFYA 4U2ZA 1VYPX 1KO0A 3W1AA 3CV2A 3AYVA 3Q2DA 3FFSA 1S2AA 1V5XA 4O13A 3IJ7A 1MW1A 3UJRA 5CZJA 2Z00A 1KA9F 4S3JA 2NWSA 2VC6A 2Y7EA 1O60A 4LCQA 3ABRA 2QAPA 4GFIA 1GW9A 3BDKA 1L6GA 3CHCA 3WUGA 1UWIA 4DI8A 3H7VA 1PZ3A 5J5RA 4AAJA 3VC5A 1GVEA 6PTDA 3M0HA 4EACA 1UJPA 1TTIA 3QOKA 4OIFA 1V02E 5JVLA 2QV5A 3U9IA 1E4LA 5CPOA 2VHLA 2G3MA 4GFSA 2XH4A 4LH8A 1NQKA 3IEBA 2O7SA 1SSGA 4J3XA 2QGHA 2CBUA 3A3XA 3VNKA 2Z25A 1SJCA 2PRMA 5DCBA 3FAWA 1FCBA 1QXLA 4L5ZA 3NXFA 1SW0A 3O2LA 1GOIA 2PC8A 4AVNA 1GVRA 4DAFA 1KTBA 4REQA 1DBTA 5F1VA 3SRFA 2ZUTA 3AXIA 3FAXA 1VPQA 5HPOA 3QW4B 1TREA 2VZOA 4JBRA 1K70A 1EHNA 3NQDA 2XVNA 1VBUA 5C9ZA 2NQ5A 2TYSA 3SCQA 2HS8A 3VIJA 2VX4A 3FKRA 2EXOA 1VFHA 3B9EA 4NJKA 3KBJA 3NQCA 3QBUA 1U22A 3FEMA 1LCOA 3ABSA 1W2VA 4H7ZA 3LTYA 3NQAA 4WOQA 1E6QM 5H91A 1PBGA 4IMDA 3B40A 3QM3A 2QQ6A 5FIPA 3GRIA 1G4TA 4QTGA 3PZQA 4WXZA 2GJRA 3UGRA 2F38A 5E09A 3ZIZA 1AK5A 2QCDB 4TMBA 3GX9A 2QUMA 3G77A 4KH2A 1XIFA 4WJXA 2X41A 2J7GA 7REQB 5IFTA 4IGSA 4IFKB 4M82A 4ROQA 5T9BG 4X0VA 2E5DA 4A8LA 3RITA 1JD7A 4P7RA 2FMOA 4V1XA 3U7BA 2QDDA 3B97A 4MKNA 2Y61A 5I77A 4ZXLA 1XM3A 1V51A 4XB3A 2G3JA 1KWGA 3CB8A 1LF1A 4Q4KA 1IIGA 3TVAA 3SW6A 2CZDA 1F07A 2PDXA 4MWAC 1QO5A 3G8RA 3ZWSA 3WQGA 5FJIA 5G4HC 3JU2A 3HOJA 1OC7A 3USBA 3CAKA 1R5YA 5CJNA 4AZ6A 4B3ZA 1XC4A 1TTPA 4ZQPA 3VGGA 3LEPA 4DEFA 3VUPA 2V3EA 4IL0A 3U57A 1J6PA 1GJUA 4OV4A 4PBFA 1HJUA 4FOJA 4A29A 1WP6A 2YKKA 4MSSA 4AIEA 5FKYA 6XIMA 2OMAA 4IX2A 2WZMA 3BSMA 4FX8A 3P81A 3LY0A 1GG1A 2HMCA 4LCSA 2PF8A 3TJIA 3TZFA 1MRAA 1MXSA 3PAJA 3R0KA 4HA4A 6XIAA 3CXOA 2XZ7A 1QUMA 5MF5A 2DY3A 1E9ZB 2FFCA 3VOHA 4QGCA 1A0DA 1XLHA 1GZ1A 4JTSA 1CLXA 3H2FA 1QNQA 5CAKA 1XWYA 5CBBA 2ZE3A 4NYYA 4OBRA 4W84A 3SDOA 3AMDA 4XAPA 4Z2JA 2QZRA 1B57A 1PJ9A 4G8TA 4QIUA 5KMYA 2C18A 1ELSA 2GSJA 3A4WA 3CC1A 1GKRA 2HBXA 2PDQA 3LPPA 1UD8A 3LD5A 2Q3RA 1MDLA 1GVFA 3L4UA 3WLRA 4Y7EA 3WNOA 1S5TA 3KWSA 4UR9A 4IXHA 1OFRA 2OQLA 2B7QA 4C6NA 3I65A 2C1IA 4GRSA 4AZCA 3I6EA 4PUMA 2PURA 3EX4A 3CASA 1JZ6A 1KFWA 3EWBX 1PTAA 3WQ5A 4C6MA 1JCLA 1NP0A 1NOFA 2Y5SA 1AH3A 1GVQA 4HU3A 3E2QA 2UY2A 4DLMA 4Z1AA 5GJPA 3VNJA 1V0LA 2A3EA 4OVXA 1EJXC 1TJPA 1XYAA 4HCDA 1D9EA 2OGJA 2V3FA 4ZSUA 1MEWA 1OADA 3QYQA 3P0XA 1A0CA 1IZJA 1Z69A 2XG9A 1J2BA 2E5BA 4F0MA 3M16A 4PUKA 2A3CA 5BMWA 1DJNA 3THDA 5FJJA 4LBUA 4RNIA 1MZRA 3W7RA 2IPWA 3UR8A 3HPAA 3P3BA 1DYSA 3VZXA 3TQPA 3ZM8A 4MWAD 1VLIA 1ISVA 3L68A 1JDAA 3R1ZA 3NYZA 3QFEA 1UUMA 1V08A 1I2QA 5LNSA 3URBA 1DJYA 2F84A 3WG6A 4OJYA 1KWKA 1LRQA 2EGZA 2OX1A 1XBZA 1RCXB 4W7WA 2BV9A 3KX6A 2Y7FA 2CLEA 4Z2LA 1FWRA 5A6AA 4K8GA 3NVDA 5KZDA 1XCFA 2VC9A 1VYSX 2BMBA 5L6UA 4CD7A 3T08A 3S6TA 4KGJA 8A3HA 4GQBA 4DLFA 1E5JA 3UERA 2DT1A 2UY3A 4MFEA 1AD1A 3CPGA 2VX6A 4O4WA 3AU2A 3ECQA 1EB3A 3MCMA 3PJTA 3G8EA 1A4LA 2VCAA 1MEIA 1MVYA 2BY2A 3I3EA 3TSBA 4B3KA 3H4WA 2GWGA 3RFAA 4ICMA 2PWHA 3LHVA 5XIAA 1TWZA 3QC0A 5FJPA 2Y24A 3WUFA 2QF8A 1LLZA 1HG3A 3CS2A 1US0A 1V7YA 2GJXA 2XM1A 2D0FA 2YXGA 1P0NA 4H6EA 3VNLA 4RLIA 1ME9A 4Q8WA 1CCWB 3W70A 2B31A 3HGJA 1OINA 3N9SA 1HO1A 3NO3A 4CQ9A 1YBQB 3CHDA 5HINA 4LX4A 3VKJA 4FEZA 5FF3A 1H49A 3BAJA 2FVKA 3U4AA 3U3HA 3KZPA 4RE0A 1L8PA 2ZUNA 2X16A 2VFHA 3S2CA 1Q6DA 4GCXA 1RJQA 2CWNA 4AWTA 3A13A 4A2SA 5IM51 4IQDA 4B5XA 5HUPA 3KVKA 1EC8A 2BHYA 2ZZ3A 4DX3A 1TCDA 5AHLA 2PLJA 3BLEA 3CV7A 1H5VA 4L7ZA 3BWWA 3N12A 4JL1A 3CYJA 3HV9A 4O16A 4W8BA 2HCVA 2XFRA 3P7YA 3QQ0A 1OEPA 3WF3A 5A2BA 4FXRA 3SQLA 1UKQA 1DEDA 3TTOA 6ENLA 4BZYA 4MUZA 5CSRA 1DIKA 1P6CA 2X09A 4QG6A 2VFGA 1FWIC 4BS0A 3OTRA 3IV3A 1OD8A 1O1HA 1XISA 3GB6A 4LPCA 3KS6A 4H9ZA 3RPMA 4M8UA 4UXDA 1JYWA 1MZHA 2V2DA 3GG8A 3W38A 3RF9A 1V6WA 4J28A 2O7QA 3C4UA 3VGEA 2D73A 3DFQA 5EBUA 1V0NA 3ITXA 1PYFA 4QQ3A 1PCWA 1FCUA 1C9WA 2PD5A 3G0XA 2EEXA 3TXZA 5A8QA 2WZEA 3PBGA 3G6MA 3EWZA 4PA8A 1W0MA 4GZ7A 1N8WA 4LEQA 7TAAA 3AJ7A 4XZ9A 1KFJA 2C0AA 5A6TC 1L6SA 1FWNA 3H7RA 2JE8A 3CB3A 1KFEA 2GLKA 3BAIA 3RR4A 1XINA 1QT1A 3VNMA 4UUIA 3B8IA 3BVJA 1GWJA 2NQ9A 3GXMA 1JUBA 3SCNA 1X97A 2A79A 6ALDA 2FHBA 1FWFC 3S46A 1RD6A 2E6AA 4FNUA 4Q8NA 1SMAA 4JIRA 2HK0A 2Z1WA 4R27A 1P0BA 4ZO8A 3V0UA 3MS8A 4YTRA 2QS8A 3TLQA 1EF2A 5BZAA 1GGOA 2OWWA 3KP0A 1OG0A 1S5WA 3DDMA 1P7TA 1VR6A 3B0VC 2A6NA 1DV7A 1EO7A 1CXEA 3PJUA 1V6TA 2PDMA 1YLVA 2RH9A 5CLTA 4V33A 4DYJA 3KVLA 3S9ZA 2CW6A 3FS2A 3B0XA 1PS9A 2EPOA 1UD5A 4K8HA 2DZPA 1XSIA 2ZYFA 3JUGA 1UW9A 3WD4A 1QK2A 4TX6A 3THCA 3IJQA 1C8QA 4WDXA 5HATA 1R3SA 2J4GA 4ZFMA 2F6KA 4TXEA 5DMLA 2G97A 3NEHA 1YDVA 5DY3A 3BAYA 1OWQA 1KV5A 4AYGA 3UR7A 2OO6A 4AF0A 3EOOA 2QHAA 2E67A 2FTYA 2DH3A 3V75A 4XKYA 1ZSXA 2DGAA 2OEJA 1E3ZA 3MV11 4LB3A 4BEQA 3NSMA 3LMZA 1J4EA 2P50A 1H51A 2CBIA 3TQ0A 4YWIA 1O6IA 1W1TA 4JCMA 5AC4A 4EIVA 5EB8A 3DX5A 4F0LA 4PMYA 4IQJA 2ISFA 3CH9A 1IXOA 3G6LA 5BRQA 4CU8A 3QY8A 1MQRA 3DG7A 5D30A 1D3GA 3TW6A 2XVPA 3EWDA 3LRKA 1SFSA 3F2DA 1FH8A 2PWGA 3FIGA 1UBPC 4HHLA 4KPLA 3FDKA 3B05A 3U2CA 3M6YA 1V79A 4DBEA 2WSKA 5FSEC 1I2RA 2VOTA 3BICA 1DTNA 3V5FA 1M6JA 1O5QA 4U4MA 1SVDA 2TODA 2J9ZA 5HMEA 3MSGA 5JMUA 2F61A 3W4RA 4H9UA 4NZ5A 2DZAA 4KWSA 4L1WA 4GY7A 4DYKA 2J27A 3NXLA 2QAFA 2VRQA 2R94A 5D04C 2PWFA 3W87A 3OOQA 1F6KA 1XPYA 5H1WA 3LGGA 1M41A 4W85A 3STEA 1E1CA 2V6AA 3P61A 1JZ7A 1W5PA 4PRTA 1K9DA 2J7BA 1AZ1A 5E0CA 4IPJA 1Q65A 5T91A 5M5DA 3EB3A 2ZZ1A 3BAKA 2D0HA 1OFAA 1TQJA 1VF8A 4NT0A 2VELA 5FF0A 1HIZA 2PWDA 5IDIA 2IW0A 4Y9MA 1MUCA 4BCEA 3MSDA 4Q7IA 4C7FA 5F2MA 1TV3A 4A6GA 3L2LA 3TQKA 1FWWA 3HQPA 3W1RA 3H70A 1T0OA 1V6YA 1NEYA 3PUOA 4QEEA 3URAA 3OIXA 3WLPA 1OCJA 2YGYA 2HVOA 2AKMA 3HFYA 4G7EB 2DIEA 1H60A 3NQEA 3M7SA 1AQFA 5GJNA 4A35A 3NDYA 4KEZA 1AD4A 4AZGA 4PMOA 4AC1X 2WBKA 3DC0A 1W56A 2QDHA 3O05A 4HSOA 5LHFA 3TJLA 2B81A 3KHDA 4ZB5A 1F76A 2JKPA 1B9BA 3UEQA 3I7QA 5C2XA 2C71A 3EKLA 1E0UA 4PTNA 2PLMA 4S39A 2EPMX 4AMCA 3AHZA 3EB2A 2VGFA 5HQMA 3CPUA 1VFUA 1ONRA 2CLKA 2R1MA 3AMLA 5EMUA 8XIMA 3MWAA 1NDZA 2ZDSA 3LG3A 3VD9A 4F79A 5CPTA 1C93A 4HU4A 1V0MA 3WH5A 4AIUA 2FMNA 3AIEA 3VGDA 4GY1A 3T0DA 2BBFA 6CGTA 2PDCA 1JZ2A 1BXNA 3WBXA 4C60A 3WBEA 4C6KA 4YTSA 3SFWA 1IWAA 4YCOA 1XLJA 4AWSA 3KUMA 1VYRA 1VJZA 3H24A 3KAOA 1QBAA 3W1NA 1QNVA 2PDJA 2X40A 3HJEA 2BP1A 3XISA 4Q32A 3MUY1 3RU6A 2J8FA 3N4AA 1QWKA 2W79A 4LAMA 1KFKA 2W67A 1L9WA 2V0TA 4JNZA 1JCYA 2CLHA 1UR1A 1MSSA 2D24A 2GGIA 2PZ0A 3S6DA 3OHMB 4H7VA 2ALRA 4QXIA 3V3WA 3ZLGA 1GK8A 5J5DA 4DJFC 3R2GA 1RVGA 1XIJA 1HFBA 4LT9A 3VE7A 2ISSA 1H41A 4ZB0A 1HQTA 1I2OA 2AKZA 4MM1A 1UZ1A 2AMXA 2ONEA 2ZRVA 3LQLA 2Y4SA 1J01A 3C0QA 3FN9A 1R3RA 4U10A 2PDKA 1JAEA 4C7DA 4HOWA 2PDLA 2CU0A 3NQ2A 3LXCA 3B0YA 2AL1A 3BW2A 3IJIA 3BGAA 3WMBA 1LUCA 3L4TA 3ZLHA 1YE6A 3PNUA 1A5LC 4U5KA 4GI4A 3VCCA 3QGKC 2E40A 4JQ1A 2ZX5A 4ZOBA 2ISDA 1KLZA 4O19A 2A2IA 1KFLA 3DGRA 4R9XA 1FCQA 1PKMA 3L2IA 2O9TA 1RPXA 4FXSA 1F61A 1MUMA 4LTSA 2X1RA 3DIPA 3VIHA 2XN0A 1PXGA 1NELA 2BFGA 2CNCA 3UR2A 3Q37A 4UBPC 1NH6A 3M5ZA 2DW6A 1V3KA 3W81A 5I09A 3A22A 2QCFA 4MY8A 2EQDA 1NOUA 2FH6A 4LBSA 4EKJA 4OTKA 1Z7AA 4PYSA 5DRIA 3KOWA 2PGRA 4O0KA 4YHGA 3ZMRA 2FLIA 3MI2A 5AN7A 1EQCA 5LIYX 4JTLA 4IQEA 1PHWA 1TPVA 3BZJA 4WUIA 1UC5A 2FKPA 3QPZA 3VPLA 1ZBKA 2ZFAA 1JCMP 2BB0A 2J7FA 1JCXA 1XX1A 1TG7A 3W28A 4E3VA 3SBFA 4D71A 1VH7A 4UFJA 5BOFA 2CEQA 2D22A 5D05A 5JH1A 3ZSTA 2OJPA 4MOZA 2XIOA 2NXIA 4KCVA 4B2DD 3VKKA 3TEVA 3SFKA 5HXMA 3C8NA 3TW7A 7ODCA 3HG5A 3SCWA 3WQEA 1O95A 3L67A 4YJ5A 1QW9A 3UG8A 3TN5A 1VHNA 4AIBA 3KLLA 3EMZA 4M24A 2PDFA 2BASA 4D6CA 4GYPA 1UKPA 1OIMA 2NXHA 1E0WA 1TYGA 4AVFA 1EP3A 1HTIA 1UUOA 1RCQA 3RJYA 2Z7GA 1XICA 3WD1A 3M0MA 1IE7C 4DJFD 5K4ZA 1CLKA 5A6SA 2IKJA 5ABFA 4EXBA 1OSEA 3DFYA 4DIAA 1EPXA 1CGVA 1WKYA 4GQ0A 5DT5A 3QHNA 5DLCA 3RU8X 2YYUA 2QJHA 1HUVA 5I5RA 1EBHA 3BG9A 1OK4A 4L4MA 1LQ0A 3G1SA 3RK8A 3ZR6A 3GXTA 3B8UA 4NASA 1GEQA 4FF7A 1LBMA 4LB4A 4EE9A 2Y85A 1DIEA 1FXQA 4JNMA 5DRCA 1N8IA 3D5HA 1M65A 3WNNA 1BG9A 5REQB 4WLCA 1GYMA 4Y9NA 3TCSA 2WSQA 1C3FA 1ZJAA 2WC3A 1TRDA 4IPNB 3QRHA 5C9WA 4ZQCA 2PDUA 5EYWA 4WCJA 3E96A 3I6RA 4KCTA 5I3KA 1TIWA 3QV8A 1RZMA 4DAIA 3VGFA 1UB3A 3T0CA 1FWHC 3W26A 2PDWA 4DB7A 4WIWA 4B5NA 3TYEA 1RP9A 2O0TA 4KWVA 1W9BM 4GYKA 3HGSA 2ZCGA 1A5UA 2ZRWA 4PRWA 3OGSA 5H2ZA 3HFTA 5A6BD 4KRZA 1PWLA 3DUGA 4DPQA 1PWMA 5GVJA 1FWSA 1I6NA 3CEPA 1RK5A 3WMLA 5EY5A 2J79A 3RUBL 4HOZA 2I57A 2FPTA 1T8XA 2YOCA 3FYPA 4O12A 2NT1A 4QSHA 4HB7A 4IP5A 3K4AA 1F2JA 1H62A 1XYMA 3SY8A 4UR8A 2F9RA 1DHPA 4IIBA 4XZHA 3BO9A 4LY4A 1VIWA 1V3LA 1FWAC 3HBLA 2CETA 2V5CA 2YYTA 3THUA 3CT7A 3AS0A 4O52A 2BG5A 1TA3A 2XN2A 3HGRA 3TOPA 1TZ9A 3UQNA 2VMFA 1TELA 4LCRA 3QLDA 2ACSA 1X8FA 2WVUA 1NDYA 3E2SA 3QTGA 1VBRA 3DENA 4C91A 4LQ1A 3OA5A 3FVMA 1GEHA 4IMFA 1QWGA 2J77A 4P8XA 3IIVA 4I90A 5HBFA 1ZGDA 4HJWA 2PD9A 1S2CA 3LHTA 3MKVA 2PWUA 3WEZA 4LYQA 2X1TA 4AZ7A 3W6MA 2VUNA 5B7YA 4HNTA 2NQLA 3PZVA 5KETA 1REQB 2PDPA 1RLCL 3Q4DA 3SCOA 2VQUA 2DVTA 2PDHA 3GD6A 4JQ2A 4W88A 4O11A 2JKEA 3GLCA 3I6TA 3CMFA 4KS0A 3P5YA 3IJ9A 4GC3A 1LG2A 1R3VA 3W3OA 5AOUA 4BF5A 2YCLB 4ATDA 1UR9A 4DZHA 3CLWA 3SQSA 4DO5A 5DN1A 1OGBA 1PHQA 3BQ5A 1FWEC 3G3DA 4TV6A 4QCFA 1ADSA 1JRCA 5K4XA 3HIJA 1XRVA 5K9XA 3NUKA 1F3WA 4PUJA 4ZOAA 1H7PA 4HK6A 4AZHA 4HYRA 1AL7A 4OBTA 4LRTA 2DSKA 1K02A 3PZMA 3ABXA 4S3DA 4HPHA 1XDLA 3S83A 2XISA 3LPGA 2WSPA 1KBIA 1BVZA 4J9JA 5CGTA 2FZMA 4IP7A 3UNTA 2YA1A 1BLIA 4K6AA 2GQ8A 3B9NA 5ABGA 3AUOA 3T2PA 3DKLA 4B9YA 2JGQA 4E2BA 2WCSA 4YPJA 1RJPA 3UXIA 4QQUA 4C6EA 4G6CA 4C90A 2XGZA 2CZEA 1B0IA 3LLFA 1T40A 3VM5A 3K13A 4F8XA 2FIQA 4LUYA 2A4AA 1EQPA 2RDUA 2P53A 3R0DA 4ADUA 3FV9A 2VC7A 3F5LA 4MF4A 4E0CA 2J13A 4ERAA 3D0CA 2R1LA 1JYVA 1R7AA 5CG0A 4NAEA 3HB9A 3T78A 3GTNA 3MUAA 4KWOA 1OCBA 5EL1A 1UA3A 3W7EA 2DSZA 4E5TA 2OYLA 3GDKA 4REQB 4GI8A 1VIZA 2BHZA 2OVLA 3VD5A 4GGHA 4Q4PA 2CITA 3O3RA 3IIZA 3AXHA 3WLMA 4BQ5A 1E70M 3DAQA 2XSAA 1N7KA 1AJZA 2AL2B 4JTIA 3CUJA 3WD3A 1TPDA 3ISIX 3MWCA 3T0BA 4JTUA 4PGLA 3WEMA 1XF0A 1EWDA 2VTFA 4PFHA 3LS9A 1MNSA 4CU6A 2Z1SA 3BGJA 4FMVA 4TMCA 1QOQA 1V3IA 1ZPTA 2VRKA 3FJ6A 1MDRA 2OKTA 3I4KA 1E43A 1TVNA 1W5MA 1CPUA 2WB5A 4WD0A 1WQ5A 1WOAA 5HUOA 3AXKA 2OYMA 3TJ4A 1LG1A 4LWWA 3HV8A 4UQ9A 4JY8A 3E74A 2GVEA 1QPKA 4NVTA 4CLMA 3E49A 5L9FA 1EC9A 4YWSA 2RJHA 2WKGA 1FTXA 3QYSA 4Q4OA 2RJGA 3PJXA 1JDDA 2BVDA 4ES4A 1EOMA 1E3XA 4FPSA 1WZKA 4H2HA 1OX4A 2VM8A 3HM7A 2MNRA 2GDQA 2ZZ6A 3BAWA 3W1MA 2NQJA 3TFXA 3PWAA 4HOXA 3AYRA 2VURA 5DCDA 3TC6A 1D7KA 2G0WA 4JHOA 1GORA 3VDHA 3GDTA 2CBJA 1MO0A 1FA2A 1U30A 3ITLA 3EA1A 4DXXA 3OG3A 1JVNA 4AD5A 1HF6A 3ITVA 2RDTA 4XBSA 3UPBA 1JCJA 2J75A 2VZVA 1TPWA 2NX3A 1S2VA 4HZ8A 2V3GA 5E6ZA 3VZYA 3ES8A 1JUKA 3RHGA 3W2LA 3LLXA 4C6BA 2H9AB 1Q6LA 2CLLA 2FDMA 4W89A 3O07A 3KVJA 4LUSA 1I2NA 1FY6A 4UTJA 3R0UA 3M44A 4N7QA 2W9MA 2WNNA 3A5FA 3R94A 1K8YA 1KCKA 2W66A 1C8VA 3BK0A 2PP0A 4MPQA 4H83A 3A64A 1RSCA 5FF7A 1ITXA 1PCKA 3VIGA 5M17A 1BF2A 4LBRA 4FALA 1WO2A 1W1PA 4BI6A 3VYLA 2X2YA 5IHSA 3UG5A 1OYCA 2EPKX 5KINA 3AS3A 2V30A 2HPMA 4FIQA 3VILA 5E0KA 4XISA 3AOFA 1E73M 1VP5A 4G7FA 1DKWA 2OZTA 4OV9A 4Z0SA 3CUHA 4M19A 2GQ3A 1UASA 2J7DA 4US5A 1JXKA 4JTKA 2VUYA 2PRHA 2QUVA 2PU0A 4ZQRA 1SJAA 1IYXA 2PDYA 4D8LA 2D3LA 5AYXA 4YU1A 2G3NA 1SO5A 4GNKB 3L5AA 2X8RA 3TYZA 4JX5A 3WFLA 3SZ8A 3RX4A 3IJ8A 3QVQA 3WK2A 1Q4WA 3FNDA 2ZKMX 2G3FA 4PSRA 2C16A 1C7TA 2P76A 1WXYA 3KS5A 4AZCB 1TJ0A 4ORIA 3WLSA 2GGJA 3S0CA 1EHAA 3ZS4A 3WMSA 1VBJA 1U2YA 4MYAA 3CTTA 1CXIA 2GGEA 3V36A 3EX6A 2NUXA 4X9SA 3W7DA 2HS6A 3BW3A 1KXVA 2OT0A 3S2NA 2XN1A 1MXDA 2DW7A 3KDOA 3GNXA 4DZAA 2SFPA 2E4TA 4XD4A 4H41A 4H2CA 1EPVA 2XH2A 3RO6A 2DQXA 2OELA 4UOJA 2BY0A 2AQWA 1H0GA 1K8XA 2INZA 1WDSA 4KRTA 4PBEA 3TLLA 1GUVA 1U1JA 1OFQA 3MO7A 5CC5A 3MJMA 2I5QA 3GIQA 2QUUA 4LAUA 2C1HA 3K1GA 2VXNA 3DU0A 1J96A 2J78A 3WN6A 2WVVA 2ZDRA 4C6QA 3TR9A 4IFRA 4NAFA 3F7JA 2C15A 4UMCA 4B4FA 1XL9A 4U2YA 3NO1A 3BURA 2WMGA 4V28A 3GTHA 1A3WA 3GWQA 2YBUA 4DJEA 3STFA 2ACRA 4PFMA 3TONA 4FLOA 2WNWA 4FHAA 1V3HA 2FH8A 3M0IA 4MJ4A 4S3AA 1W3IA 3ZJ7A 1U5VA 3B0UX 1Q6CA 3R12A 1WB0A 1E4MM 1GHRA 3QTPA 1ZNNA 1CX9A 4WDWA 1R47A 3M46A 2CC0A 1TIMA 3EX2A 1G94A 4XV0A 1S46A 2OB3A 1HJWA 3BCDA 4UTUA 1QHPA 4V2XA 3QPYA 1V0KA 4QE5A 3UG4A 3M5YA 3DBPA 3A24A 3HQ1A 1Q8JA 3RM8A 3QF0A 3UVIA 3PFMA 3KRZA 2QUNA 1S3TC 3T6CA 1A47A 5I24A 4EF9A 4CCZA 3K8LA 1FFQA 1Q2RA 5HQEA 3EPNA 4CQCA 1SZEA 4FOKA 2YW3A 3UP8A 5K7JA 3PBVA 3RCYA 2IKGA 1EA9C 1CI1A 2ZXAA 4NIRA 1VRXA 2X1IA 2YX0A 1ZLPA 2JBMA 3PTMA 1JPKA 3W88A 4XD6A 5EA9A 3PK7A 4C1KA 1JI2A 2HZGA 2W91A 3W6YA 1L6WA 4ENLA 3C0JA 1K9EA 2IUZA 5HJYA 3G0SA 3CZJA 1UIOA 2E09A 3LCIA 4AHOA 1E9IA 3TAOA 1WOBA 1K7FA 3B0PA 3W73A 2C0HA 1ISWA 4J2PA 4V27A 3UYIA 4GVIA 2ZRXA 2YCEA 1HKJA 3WJYA 4JXCA 3S1GA 3S8HA 1E40A 1LQ2A 3R13A 4E8DA 3IUIA 3A21A 1VJSA 4ZMGA 2OQYA 1FDJA 1Q6GA 4R9OA 2A5HA 3IVSA 3FSTA 2VR4A 4JFTA 3W76A 2PI6A 3BMVA 3RLGA 4Z08A 3M47A 1J12A 4B3LA 1XIIA 2Z1KA 3E9AA 2QNEA 5HK4A 1GOOA 4GUIA 1PIIA 1OVDA 4YXGA 2GVJA 1G0CA 3C2RA 5DMYA 4L64A 2AGTA 5DCEA 3W7JA 3IGXA 1KNWA 2WLZA 1BHGA 4ICNA 2VWSA 1JL8A 4UOZA 1P4CA 3T07A 3CUFA 5AHIA 2EJAA 4L6OA 2REQA 5XINA 3ZT6A 3GVQA 3S1UA 2BSLA 4GI6A 4CEXC 4I7UA 1YNQA 1NY1A 2EJ1A 4PULA 4UFLA 1POKA 4ZBCA 1XRSA 4YNGA 1I75A 1RHCA 2NLIA 3VO0A 1FHLA 3EPMA 2DSVA 3W86A 3JR2A 1GYLA 1RP8A 4PEKA 4JIIX 1S3HA 2A3AA 4J3TA 1L8NA 3VOJA 1DQWA 3BMXA 3VNYA 5U7SA 1X1NA 3BV7A 3ANYA 3KZSA 2QCEA 2V5DA 4J3SA 3WQ8A 1VEMA 3G1RA 2VEIA 3NQVA 3BLPX 3UR5A 3UJEA 3OYXA 3IAPA 3DYOA 3RX2A 3BOLA 4QP0A 1K9TA 3O1NA 4ILSA 1SZNA 1G4EA 1KRCC 1P7TB 2HNHA 4Q8QA 3P6LA 3TN4A 1XKJA 4LU0A 2ZVRA 1JPHA 1ZP4A 1PB0A 2P88A 4W5ZA 2D2JA 4QLKA 1OC5A 4HT3A 3BOFA 4FLSA 4M6UA 3T0TA 3VDGA 3MSRA 2QT3A 1JRBA 4WKAA 4HD5A 1J0IA 4DZ5A 3D6NA 1E0TA 6REQA 4JNYA 2NZLA 2NSXA 4GO9A 3CZLA 3SCSA 2A7RA 5AHNA 5FOOA 2DFAA 5AB3A 5FEWA 2GGHA 2BWGA 4IJRA 1IWBA 4AF0B 4H19A 1W91A 2FGBA 3LERA 3WF1A 4K7YA 2CHRA 3W85A 3E2RA 3QHMA 4MGGA 5GNZA 3VDAA 2CPUA 4LV9A 4XKYB 1KKOA 1HL2A 3R8RA 1JFHA 1V4YA 3GR7A 1UQZA 1AH4A 4NU7A 1LP6A 3Q94A 4DYEA 4EPEC 3AJXA 4OUEA 4XO7A 4TVDA 4YMZA 2RAGA 3UZZA 2FTPA 1MEHA 1XH1A 1YQ2A 4GUHA 1O5RA 2YR1A 4I5XA 3UCQA 3WLQA 3NQGA 2A3LA 1ZS2A 1XC6A 3TJXA 1ONEA 4UTTA 4LVAA 2GVGA 1PZ1A 4O15A 2EF9A 2Z2BA 2GOUA 1GTEA 1KRAC 4XVDA 4PMDA 4GJJA 1VQTA 1YPIA 1QO2A 4QHRA 4JIPA 1W3LA 1FUYA 1DIOA 2R1PA 4N42A 4UZUA 2ISWA 5I02A 4O1CA 1L2UA 3LHUA 3F4NA 3S5NA 3WELA 4TO8A 5BW6A 3W23A 4JTTA 4P7LA 3O16A 2E28A 4QBXA 1E6PA 3WNPA 3WLNA 1XJBA 1JCTA 3E0FA 3UWWA 3UZYA 4G5DA 4XBJA 4R85A 3T40A 1KR0A 2P1FA 2DJXA 1LM1A 1E71M 3V5CA 1MQQA 1EJRC 1R3TA 4D6EA 3ZR5A 3UBPC 2JIWA 1DWAM 1PZ0A 4NJHA 2P8CA 1ODUA 1VFMA 4KERA 1W1A1 3W7IA 4H9VA 5D38A 2R6OA 4YS1A 4XIMA 1QHZA 3BL3A 1B4EA 4EF8A 3UJSA 1G4SA 4YCPA 3TTSA 4A2RA 1VHCA 1LDCA 1NQ6A 2XDFA 2LLEA 5CAHA 1P6WA 3MMDA 3VD3A 4ZGYA 2CXGA 2ZTJA 3T8QA 3TW9A 4MFDA 2O4MA 2WHMA 3DXIA 3LCHA 2Y5EA 2BVTA 1HP5A 1XH2A 2HEJA 2DV0A 4RNJA 4CQDA 3TNBA 2WMHA 3H53A 4X9YA 2ON3A 3W1QA 2ABAA 4B92A 4I8DA 3K2GA 3N25A 3MJYA 5IHRA 5I6SA 2L5HA 3A9IA 5I3HA 3CAWA 4UQDA 2V67A 4DF2A 3H2MA 4HPJA 2E9BA 3IJLA 1Z3NA 4WOZA 3OPSA 3WDJA 3NZQA 4PUUA 4W7UA 1R3QA 3H4GA 4F9DA 3BGGA 2J9XA 3ZJKA 1XP3A 3KCLA 2UBPC 3CLMA 3TA6A 3FYYA 1O94A 4UFMA 1QVBA 1W9DM 2QJIA 4JS3A 2O56A 4EXQA 1RJRA 3INPA 4B5UA 2WHKA 3DFSA 5A8MA 3ARXA 4GXWA 4HNUA 3O6YX 2Q09A 1TPFA 4IUGA 4JTCA 4ZXOA 2J7HA 1IEVA 3GAKA 1O5XA 3F5KA 4IIDA 4JCLA 4NZFA 1BWKA 4PMNA 4LUIA 2W3ZA 5M3WA 5CJMA 4J27A 4NL1A 3VIIA 2IQTA 2E25A 4XAGA 3RGTA 4CN6A 4FLRA 3WNLA 3DYMA 3N19B 2WVSA 1TKKA 2HBVA 3TXVA 5ECVA 5D9MA 3FHQA 3OBEA 4ZO7A 3WZ0E 3PTKA 1Q13A 1B1YA 2QJGA 4QLLA 3VFLA 4EK7A 4PTXA 1OZMA 4I7VA 2DUXA 3EXSA 4HCLA 4JN7A 3N2MA 4IL2A 1ENUA 3OJGA 2O4QA 1TZ7A 1WXJA 2NLYA 3B03A 2YBVA 3OZPA 1F9CA 1TPUA 3G2GA 4UNIA 5A8OA 2CZFA 2RGLA 4UTFA 3CUGA 2OODA 1NDVA 1SZGA 5D2XA 1J5TA 3C3NA 2J47A 2VCCA 4P61A 3VDCA 4Z42C 5H8PA 1BEUA 1W3TA 4EAYA 3N04A 2NQZA 3M41A 1UWSA 2H3BA 4BF7A 1I4NA 3IWPA 4GBUA 4HSHA 1XV8A 2ZRUA 1OIFA 3SCRA 3F2BA 5DO8A 3HMCA 5FESA 1I2PA 3ITOA 1U5HA 3LCFA 3SIMA 1LUCB 3R8GA 4IF2A 1OY0A 3W29A 1FQ0A 4A22A 4GKTA 3T0AA 3HPSA 1MNZA 4U3AA 1R86A 4IFOA 3OVRA 4QNWA 3MYOA 4MKVA 3G18A 4ATWA 1CXFA 1KXQA 2ZWYA 3WUBA 1XBYA 2PP1A 3CL7A 1Q2SA 5EU9A 3N11A 1OGGA 2G4JA 3WIJA 3WCZA 3A12A 3AHXA 3B04A 3OA3A 3AXMA 3NGFA 4O8RA 3NEVA 5IBXA 3GG0A 2PS2A 1XIEA 3M0JA 3QKZA 5C9UA 3HO8A 4LFYA 1W1B1 4DNHA 3P0WA 2PDIA 4PCSA 4KWUA 3ZXWA 4BR1A 1EP2A 3GO2A 3ONCA 3DERA 5PTDA 2D2GA 3PUGA 4GZIA 2PCEA 5DELA 4C6FA 3IAQA 3NAVA 1SO6A 1CIUA 3S3GA 3S9YA 4HZ6A 2WM0A 1P0DA 3CMGA 1TX2A 4FNSA 1ZL1A 4ZOEA 5FJTA 4XK2A 3EYPA 1C8XA 4I7WA 4MLJA 1F8IA 4NF7A 2OQHA 2TRSA 4JYDA 1BQCA 4PN2A 1V6UA 3MV01 2GYIA 1EJWC 4MWAB 4GVGA 2ZOXA 2XIMA 3DFOA 2YB1A 3ABOA 3RN6A 1ZU8A 5A8GA 3NL3A 1SR9A 2IXVA 1PDYA 4HNVA 3PNZA 3QKEA 3DFTA 3AIUA 4HNOA 4Q8PA 3BCJA 1RY8A 3ANUA 5TAOA 3GG1A 2YZRA 4Q8MA 1YDYA 3K4WA 3OQEA 3M0LA 3ID7A 1E15A 2Z6JA 4URIA 2PAJA 3N2OA 4US6A 3BUVA 3FGCA 2ZWZA 4MKSA 5ABFB 1KB3A 3CO4A 1VD6A 1OYAA 1FWTA 3CBWA 1GJPA 1PKNA 2W6RA 5DMMA 3GAYA 3H55A 3S2JA 3OVQA 3SCTA 4GVHA 1VPYA 3H26A 4K68A 2OZ3A 1UH3A 4C5ZA 1VGAA 3RLHA 2PB1A 1EDTA 1TFVA 4AD1A 1B3ZA 2YFOA 2DORA 1ISZA 3MVIA 5CBJA 4U28A 2OTDA 1KTNA 1UMYA 4W4QA 3QH2A 1EZWA 1R2SA 2WKLA 5G2HA 2VL4A 4GA8A 1Q6OA 2FGZA 4UTHA 4GQQA 3BLLA 4JFSA 5AC7A 3FDGA 3MW7A 4HKPA 2ZIDA 2J62A 3LCWA 1UKTA 4LS0A 1DXFA 1EUNA 2MANA 3W7CA 4B16A 3KFTA 3AISA 2F6XA 3ZZ1A 4WRHA 2JEPA 1JZ3A 3APGA 2YBTA 1N8FA 4KIRA 5LIUX 1LORA 3IIXA 3W2NA 3WJWA 1H7NA 1TV7A 4O14A 1DJIA 1ICQA 3DOPA 1F6YA 3EA2A 5AECA 1TUFA 2QV4A 1G01A 2PDBA 4HCHA 3TWBA 3KRUA 3A23A 3NL2A 3W7KA 3SECA 5EFFA 3ZWTA 1B3VA 1RLDA 2BXZA 1KW1A 1BWVA 4GJIA 3LCXA 3QQ1A 2XWDA 1AQMA 4GPNA 3ARPA 5I2UA 4AFYA 1B3YA 5D9PA 4RDVA 5ABEA 3POCA 3PTDA 2WJDA 1LOSA 3CV6A 3MI3A 2VVNA 3TNOA 1XLCA 3URNA 4RKAA 3WQWA 1VCVA 2DPEA 3PG9A 3MCOA 1QMLA 2Z1XA 3FX4A 4A8IA 2VEMA 4GOAA 2JF7A 1ME8A 1LYXA 5I0DA 3CIXA 1KGWA 2DQWA 3S9IA 1Q7ZA 3W25A 2FVMA 4JDYA 4CCCA 1RQEA 4HPNA 2BGSA 4AIOA 3OB8A 4UFHA 3WFZA 1TA3B 2WJEA 2FTWA 1E6ZA 3GDMA 1WYIA 2XFFA 3QZAA 4UQAA 4OHQA 4C1NA 2XHYA 2BNJA 1FOBA 4UB9A 3DFPA 4UR7A 4XBKA 3TTQA 4AZBA 2POZA 5KSWA 3O0FA 4QJ3B 1TWSA 4H9YA 3WQDA 3GVGA 1WX0A 3AWOA 2A6LA 3DC8A 1J11A 5C8BB 3WNKA 4UTLA 1FWCC 3ZYZA 1P5BA 4GWEA 1HVQA 2E1WA 4HK7A 1F3TA 3C2YA 3U2EA 3VIOA 5D2WA 3MB9A 3VMNA 4WF7A 4IMAA 3OZOA 3BARA 3W7MA 3M7WA 3WQ6A 5T26A 2FPYA 5CCZA 3AMKA 1DJXA 3F03K 1Q7QA 3E12A 2DZBA 3W07A 2H90A 4NG3A 2R9RA 1KM0A 1O68A 3QV6A 1CEOA 1WKEA 2VC5A 4P8UA 3CQIA 2B7PA 4DHGA 3C6CA 4J3VA 2BY3A 4B91A 4AD0A 1X6NA 4XZLX 4UWMA 1D3HA 3ARQA 3O63A 3GTFA 1SR0A 4UTKA 3AHYA 3L66A 2CBVA 4ZO9A 3GVVA 3JVAA 3L21A 2GUBA 4FXFA 3SR7A 4F0SA 3ZJ8A 1GOWA 1QI3A 3C2FA 5E5CA 1SZFA 1G7VA 2W27A 3N6QA 1K7XA 3C61A 5J8LA 5BRBA 3QR3A 2OZ0A 4IMEA 5CC6A 4LF2A 1KQYA 1IEIA 1KKRA 4NUWA 3CEUA 2HK1A 4B90A 1R8LA 2Q02A 4YTTA 2VD8A 4NYUA 3T8LA 3PZGA 2ZX7A 1YRRA 3BG3A 4ASTA 2CLPA 4ZL1A 1B9ZA 3M5VA 4A8NA 1OM0A 5FEXA 3E6EA 3FA5A 3VFCA 4F40A 4L1XA 1NM9A 3F4CA 2WANA 1K3UA 4NAEB 4Q4MA 4MDOA 4NJJA 3VD4A 2XYLA 4JQ4A 5F4SA 1A5BA 2HQAA 1MW2A 3LRLA 4UCGA 1OZQA 2DIJA 5G2IA 3AMGA 1W37A 3Q58A 1VFFA 1JPIA 3WDQA 2OO0A 2NVDA 4O50A 3RILA 3NL5A 2VGBA 1V6XA 3FLUA 3OLEA 1KXTA 5BNKA 3KTSA 4CVWA 1GKQA 1HGYA 3KBVA 2RFGA 1TV8A 1S1PA 2OZ8A 2VFIA 3B8TA 2QPSA 4LXFA 4HYVA 2ZRYA 2CKSA 4KF1A 2E6DA 4D6GA 1V3MA 4H7CA 1X39A 4PMXA 4GH1A 4RDYA 2R82A 3ELFA 1CXHA 1OX5A 3EOEA 1EL3A 1UH4A 2CHNA 1W3KA 5D02A 1SSDA 3ARUA 1TWIA 5RUBA 3GHUA 3L4ZA 4XTIA 1V03A 3EWXA 3N6HA 2Z28A 4O8AA 1AMYA 4O17A 2XFWA 2WCGA 1JQVA 3OP2A 3SY1A 2Y7GA 1DJGA 4DVOA 1OX4B 1ITUA 5FF4A 9XIMA 3LBMA 3WJXA 2ACQA 3LXBA 4DF0A 4MG4A 3OYZA 1VCFA 3WKZA 4MB4A 3V0SA 4GYPC 3TC7A 2Z29A 2I17A 4E8CA 2OLSA 4EPKA 1W5QA 4UNLA 1XIBA 2W4XA 7PTDA 1AZ2A 4PRRA 3B9OA 3H2OA 1NWSA 1KC7A 3AO0A 4N02A 3PBWA 3KTXA 3PJWA 1ZTVA 4M56A 1KM5A 5DXXA 4NQ1A 3VE9A 1RA5A 4MNJA 1P0KA 3TH6A 1XGZA 3W2MA 3SUWA 1R2RA 5C55A 3T2QA 4QDMA 1XLDA 1H0IA 4Y8EA 3PANA 3VIMA 1DWHM 2NSOA 1A5KC 2VX7A 1QTWA 2Z0IA 2HWGA 3N9KA 5GPRA 3STCA 2CYGA 3DZ1A 3MA8A 4I6KA 2FZNA 3ZOAA 5HNUA 1IXPA 1GQJA 4D8AA 2IPJA 2NUWA 5CGMA 1B31A 3SO7A 3MMUA 3W22A 5DX7A 2VGIA 3OO2A 3LGDA 4BY3A 3W72A 1GVSA 3ARYA 4I8YA 5LA1A 3LM7A 2UY4A 1F6PA 3H8AA 3N29A 1SZRA 2ISVA 2DEPA 1CWYA 1EDQA 1ZP3A 2HJPA 4JHZA 2UV8G 2HNEA 5A6MA 1XQKA 3HPXA 4R5EA 1XUUA 3B8VA 2EHHA 4MYXA 3TYAA 1KFBA 3N4FA 4S23A 4KW2A 1PL9A 3EWUA 2ICSA 4JFWA 4NJGA 1S1RA 4UQEA 4ZQMA 3MBDA 3NQFA 1QAPA 3DI0A 1O1ZA 1JG9A 1Y0EA 3GR8A 3WEOA 3BSHA 4PTVA 3BAXA 3CMJA 3COTA 4DN1A 1DVJA 4G56A 1ZENA 2Y2WA 1R46A 5C2GA 4RXFA 1JDCA 3OVGA 1A3HA 4N9DA 1EIBA 1LWIA 4GABA 3ZR4A 3TMQA 4CD4A 5C6MA 3VVGA 2OLAA 4KIEA 3VINA 2ZUSA 3W2UA 2BS9A 4ZFCA 4JAWA 4ML4A 4JHMA 3XIMA 2E0PA 3UZWA 3VOIA 3AAMA 3FKKA 4UQCA 4N0RA 3GY1A 4IMCA 2GJPA 1GKPA 4XQ6A 1AH0A 3HPZA 1V8EA 1A3XA 3SJ3A 4ZTXA 1UPMB 3OODA 4HMEA 4Z0JA 5HULA 4IT1A 2HVNA 1IXNA 2Y7DA 3UESA 1E72M 5TBOA 3TKFA 4Y90A 3MUXA 4WDTA 4FX6M 2V68A 1E6RA 1DQUA 3CAVA 1MFVA 3QMTA 1KLYA 1GQLA 5KITA 2WVVB 3DESA 4P8WA 2NVAA 4NAFB 5LA2A 4QCEA 1BRLA 3WUEA 4UC5A 4D72A 1OFOA 1VCGA 3T1GA 2Y89A 2QIWA 2OSXA 4QDWA 5DEZA 3LK6A 2J66A 4CQBA