5DELA

Crystal structure of plasmodium falciparum dihydroorotate dehydrogenase bound with inhibitor dsm59
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
374
structure length
374
Chain Sequence
NPEFFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEKNNIMNDEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title The X-ray structure of Plasmodium falciparum dihydroorotate dehydrogenase bound to a potent and selective N-phenylbenzamide inhibitor reveals novel binding-site interactions.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 142
structure length 374
sequence length 374
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5delA00
3DFOA 3W7LA 2CLHA 2ZRYA 3TQKA 1MEWA 3IEBA 3IIOA 4NZFA 4AMAA 5D32A 4XBKA 3LTPA 3STCA 4RCXA 1FWWA 1XBZA 5D2TA 1KTBA 2JK2A 2E5BA 1UCWA 4JEQA 2ZZ6A 4IJBA 2V5LA 1H7RA 2C13A 1J4EA 3TJXA 3ATZA 1VH7A 3KVLA 1G7UA 4POCA 4AWUA 3A9IA 3FYOA 4LTSA 5AOUA 3V75A 1S5TA 2YXGA 3M5ZA 1W3TA 4Q33A 4O18A 2W0UA 4QISA 3B0PA 5K9XA 3HMJG 2NX1A 1PS9A 2G95A 2DZTA 4JIQA 3C2VA 4QSHA 4A22A 4KFPA 5DN1A 3PSWA 4S1FA 2OX1A 1ML1A 3EX2A 4E2BA 5L9FA 4M5PA 4N9EA 3CT7A 3QH2A 5J5RA 1FBAA 1GVRA 4N6EA 3DXIA 2OJPA 3M44A 1FCQA 3TFXA 3LHYA 5U7SA 5DCDA 1SZEA 1LLWA 2VFIA 1G4PA 4GUFA 2FPYA 1TQJA 3NQEA 4RK8A 4GXMA 1B57A 2C6QA 3H53A 3NA8A 1KFBA 4NX5A 1W5OA 1GEQA 3NOEA 4NXKA 1KLZA 4C1LA 1Y0EA 2C0AA 1VLWA 1GTEA 5HUPA 4EVZA 2X16A 3NQFA 1ADOA 4UTTC 4NXSA 2H3BA 3EXSA 3EWBX 5F4XA 1KFJA 3LV5A 1Q3NA 4NJJA 2ZRWA 4CCDA 2DJXA 1ZHAA 1Z44A 4PEKA 1KLYA 1LCOA 3GKAA 4O4WA 4BI7A 1OF6A 1HO4A 5FF7A 4M7TA 1LRNA 1W56A 1IXNA 4UXDA 1TRIA 1SSDA 3HBLA 2WV8A 3PG8A 7TIMA 1DBTA 2X1SA 5EPDA 1FY6A 2CLOA 1QWGA 1J5TA 1EEPA 1IXQA 3LI0A 3C4UA 3NL6A 2P10A 3NXFA 3Q37A 4J9JA 4WY0B 4TMBA 1ZAHA 3DKLA 2VFHA 4UFLA 3BVJA 1F76A 4I7WA 3O07A 2PRMA 5FF0A 3DKJA 4WUIA 2E68A 2TRSA 2CZEA 1UJPA 3H54A 4LWWA 1SQ7A 2DZVA 3BLIA 4YCPA 4R34A 3UXDA 5KZEA 3KOFA 1H7OA 1FX6A 4OWGA 1U5JA 3W1RA 1EUAA 3W2UA 3M1ZA 3EWXA 3TJLA 1JQXA 3UZ5A 1YXDA 5KITA 3PUOA 4N4QA 1ZCOA 1TV5A 3G1XA 3NQMA 4PC8A 3RLUA 1EA0A 2YSWA 3DAQA 3M7WA 2QF7A 1JUBA 4QJ1A 3LXAA 4PODA 1K8ZA 2VFEA 1F2JA 1NVMA 1OX6A 2E6DA 4O15A 2Q8ZA 4PH6A 3HGJA 4ZMGA 4GC4A 1OFRA 3W2LA 4FB7A 3IVUA 3NG3A 2DU2A 5G4WA 1Q6OA 4H4IA 4AF0B 1O95A 2F84A 3HGRA 4ONVA 4MYAA 1D3HA 4EOUA 4M19A 2HSAA 4Z1AA 2FB2A 3O63A 4GNJA 4UR8A 5AC6A 3GK0A 3MJYA 2YYUA 1GYNA 1IIHA 2O7QA 4K7VA 5DELA 1WV2A 1TREA 3FA5A 2CLEA 1H1ZA 4K8HA 1TIMA 2QJIA 3JR2A 1IF2A 3NPVA 4O1CA 3ZS4A 3T7VA 3P5YA 4MY1A 2GVJA 4P61A 3VKJA 4LVDA 4DO5A 4BR1A 4AHOA 1L6SA 1E51A 3JS3A 3IIXA 4TR9A 4UC5A 5TBOA 2Q8LA 3NL5A 3NR0A 4LS1A 4BI6A 4NJHA 2ABAA 4RXFA 1VHNA 2J9XA 3UPBA 3TSBA 5FF4A 3KRUA 4JXCA 3TROA 4MKNA 1I2NA 2E1DA 2E09A 2R91A 3PB2A 5AHIA 1OYBA 3ABRA 3TX9A 2Z2UA 4A2SA 3W7DA 3BW4A 2QEZA 1V5XA 5KZDA 4JTKA 2J9ZA 4O28A 2E77A 3KAOA 4Y8FA 3HGOA 4IXHA 1R46A 3QRHA 2DORA 4U4MA 3HG2A 1ZY9A 1YPFA 2ZTJA 4E2DA 1O4UA 3NL3A 3TDFA 1OX5A 1DOSA 1ICQA 4HT3A 1JCYA 4WXYA 5HULA 2B7OA 1QPNA 5ABTA 3Q58A 3TMLA 1ZJIA 2FPVA 4NX0A 4LVFA 2VFGA 3OIXA 3I7SA 4WZHA 3YPIA 1QPQA 5FEXA 3W7HA 1IXOA 1NEYA 5G4EA 3TW6A 2BXVA 3DI0A 3LBCA 3LCGA 1NF7A 2H6RA 1XXXA 1NSJA 1OFAA 3SECA 3CIWA 5DY3A 2VXNA 2JBMA 3QZEA 3QW4B 2Q3RA 3G8RA 3S1XA 2V9DA 1P4CA 3W7KA 5I3IA 3UPWA 3W2MA 2EPHA 3INPA 3HG3A 5AB3A 3FOKA 3LB0A 1PL9A 1VHCA 2VEPA 4AVFA 3RK8A 3G24A 4RJEA 1JQVA 2QCHA 1PCKA 4XTIA 1XC4A 2EF9A 3L9CA 4DBEA 5DY2A 3MI6A 3G8EA 1KM2A 3HQ1A 1AMKA 2ZA1A 5BW6A 4RZ6A 4HKPA 3ZR4A 2CLIA 3EXRA 3PUEA 5D37A 3T40A 2VEMA 2PE4A 1VS1A 1VPXA 3HO8A 3IVTA 2B0MA 3PVFA 2G96A 3STGA 1JCXA 1P1XA 5D09A 1LOSA 4MFDA 1HTIA 3DENA 3MHUA 3F4WA 3R13A 4X2RA 2ABBA 3SFKA 3W1AA 1I2RA 4UFMA 1HFBA 3F1QA 4ALDA 1GZGA 4NNCA 4BF9A 1SZNA 1R2RA 3O6DA 4XUGA 1ICSA 3LOTA 4HPJA 2X1UA 1OX4A 1JUEA 4O54A 3IIPA 3W83A 4UCGA 3GKFA 5KSWA 3TAKA 1OG0A 4E38A 1W3IA 1EB3A 3CM4A 2EAWA 4IGHA 5DCEA 5K9CA 5T26A 3SW6A 5D30A 2BLEA 3GX9A 4UMAA 5BRBA 3W87A 2AGKA 4TO8A 2E5DA 3KX6A 3TIMA 3LCFA 4KFOA 1W0MA 3TCEA 1P0NA 3G3DA 3LRLA 3MMTA 3PUDA 2PURA 3PC0A 1XBVA 1PE1A 3L0KA 5CSRA 5CZSA 2GQAA 4D2JA 2NWSA 8TIMA 3O6CA 2VKZG 5IBXA 3WK1A 4XQ6A 1L6YA 3QJAA 1H7WA 1H7PA 1SO4A 4WJEA 4X3ZA 2X1TA 2FDSA 2ZZ7A 3NO5A 4EIVA 4FX8A 3B0VC 3CLMA 1R30A 2C3ZA 2A7PA 1DJNA 1LRTA 4GUHA 5DXXA 2J88A 1Q6QA 4Q4KA 1KM4A 4RZ4A 4B5NA 1S3HA 2H8ZA 3WJWA 5SWUA 1K7EA 2J24A 3E9AA 1H1YA 3P60A 4DEFA 4JYEA 4K38A 4AWSA 2CZDA 3CEPA 3S42A 3LM7A 3PG9A 3H55A 3NL2A 1JCMP 4AH7A 5F2GA 5FF2A 1VCVA 2WQPA 4OE7A 3G1AA 3STEA 1OK4A 3NQ7A 3TSDA 1RQBA 2HTMA 2Y7GA 4GE8A 5G5IA 1VCFA 3BLEA 4LOCA 2GPTA 2Y85A 2H90A 1IIGA 1YDNA 1VRDA 2QCFA 4O16A 1OYCA 4UR7A 4N9BA 1QAPA 2JKAA 5IM51 1KM3A 3MP5A 5HNRA 3QM3A 3W84A 4HPXA 4IOTA 5TIMA 1ZAJA 3O6YX 2YCEA 1QFEA 2J9YA 3TMQA 3SJ3A 1OF8A 3O1NA 2JGYA 3DHDA 5HWNA 1G4EA 4DBDA 3M5YA 1B4EA 2V2CA 1I8JA 3L21A 4M6PA 3SSJA 4MYXA 3UNDA 1LROA 1GTHA 4M6QA 2ZRVA 5FEZA 1THFD 1L2UA 2VENA 1TMHA 2H8XA 4HSNA 1KV5A 3I7QA 1MXSA 1T0OA 3G1DA 1YPIA 3A5VA 1AW1A 3RMJA 1DL3A 1XBXA 4LT9A 1JULA 3BARA 3P74A 4O19A 3W72A 4TX9A 4A2RA 4MZYA 5CZJA 1K7XA 2GQ8A 4K6AA 1JRBA 2JKPA 1I2OA 3W7GA 4LC6A 1EPXA 5I3JA 3M9YA 3STFA 3EX4A 2FIQA 4JS3A 1Q45A 5F1VA 4BWLA 1FWTA 2G5WA 3QW3A 4Y9AA 1ZAIA 1WOAA 2V8ZA 2Y89A 2V2HA 3EEGA 4AXKA 4QNEA 1P0KA 2I14A 3CIXA 2V0TA 4OQVA 3ATYA 4WX2A 3LHUA 4ZQPA 2EKCA 4Y6GA 4XKYB 3QSTA 4O17A 3RU6A 1SSGA 3BG3A 3C3NA 5CGQA 1TTPA 1SFJA 3EKZA 1SZGA 2WNNA 3G0UA 1QPRA 1GPWA 3VNDA 1BWLA 5LHEA 2ISWA 5HWJA 2WSQA 3OA3A 5A8GA 2VEKA 3NZRA 3L65A 5I3GA 4JTEA 2YZRA 3P8IA 5DLCA 3NM1A 3IV3A 1FCUA 3EX3A 1OFPA 2TYSA 3CC1A 4U28A 4UFJA 1G67A 1LBMA 1OFOA 3M0ZA 4WY0A 3SZ8A 3IGSA 4XWUA 3PB0A 4ZQOA 2WPBA 2P0OA 1ME9A 3W7RA 1MZHA 4BI5A 1AW2A 4NUWA 1DVJA 1XUZA 3G0SA 4JYDA 5HINA 1H51A 1EP3A 3W7JA 3W1TA 4JNMA 2B7QA 3CPRA 2HS6A 4O13A 1SO5A 5FEPA 1WQ5A 3DI1A 1JCNA 2OZ0A 4GWEA 5LNSA 1PHWA 3RNDA 4MIMA 3THAA 2FPTA 5G1YA 1K03A 5EY5A 3UZJA 5CKSA 3W7IA 4AAJA 1PIIA 4QNWA 1YXCA 1TQXA 3LCLA 4ORIA 3QC3A 2X2GA 5DBUA 3TQVA 1IGSA 3R12A 3U8GA 3P7YA 4JTLA 5D03A 1LOLA 5LKYA 3I65A 3N9SA 3GYEA 5CG7A 3C2OA 3LHWA 1D9EA 4JX4A 3GIYA 5D02A 1ZNNA 3G18A 1L9WA 4OBTA 2C18A 1QMLA 4UNLA 3CWOX 5TQLA 3RLVA 1VYSX 1QO5A 3QSRA 3PF3A 3A5FA 3GXPA 3LXBA 3PBUA 4ZQCA 4ML9A 3V1PA 3DFSA 4JX6A 2FTPA 2ZRXA 1LM1A 1S5VA 4AF0A 2VC6A 1I2PA 5I3KA 4JYFA 3FFSA 1GQNA 3EB2A 2ZZ2A 4X9SA 1LP6A 1V7YA 4K37A 1CI1A 1DV7A 2J6XA 3MI2A 3NPWA 3QYQA 4QM1A 3NZ1A 5D2VA 4DF1A 3MBDA 3HOJA 3VFLA 4C1KA 2GUUA 1GVOA 2YPIA 1BWKA 4NNBA 1RVGA 2NZLA 5EMUA 1I4NA 4EWND 1ZALA 3B4UA 2CLFA 1WXJA 2QJGA 3SY5A 1YTEA 5FI8A 3TA6A 2RKXA 4NNAA 5KINA 1RZMA 4JIPA 3B05A 4IWWA 3N3MA 3UY7A 1ICPA 2ZTKA 5F1UA 1FCVA 3EX1A 5E0KA 1LRQA 4MLJA 2B7NA 3G1SA 1H7NA 2YYTA 4UTLA 4UTWC 4TIMA 2CLMA 4JDYA 2J27A 3ABOA 4FXSA 3FLUA 4OHQA 3W76A 3W7EA 3TKFA 2A1YA 3QQ0A 1MEIA 4WD0A 2DZSA 4UFIA 3DU0A 1GVQA 3QMRA 1B9BA 2Y6ZA 5K4ZA 1RPXA 3QF0A 1KFEA 3E96A 3TK7A 4DO4A 4EF9A 4LVAA 5GVJA 4IPIA 5C54A 1XKYA 2ZCGA 5EKYA 2Y61A 5BOOA 4S2CA 4NJIA 5C55A 4CCEA 3PBYA 4UTHA 3M5VA 4PTNA 2NUXA 4PL2A 1M6JA 4M7SA 3OEXA 3KFTA 1BEUA 1SFLA 5L6UA 3EWUA 2JKEA 4O1AA 1KV8A 4HSOA 3OVQA 3F4NA 5K7JA 3N2MA 3NEVA 5AHFA 1P5BA 4G1KA 1H63A 2ZRZA 4MFEA 2C15A 3FYPA 4LNYA 4O0KA 4RZ5A 1RQEA 3M6YA 5H2ZA 1G4TA 4IUOA 2AAMA 2QCDB 4LS2A 3RF9A 4JTJA 1X1OA 3R89A 4K7YA 3T78A 5LHFA 3IGUA 1W31A 2GJLA 3KHJA 5D38A 5CZTA 3Q94A 5EL1A 3EWYA 3NPXA 5J5DA 4KKXA 3W1NA 3TUUA 1JUKA 1L6WA 2DZUA 3A21A 5BMXA 3ANYA 3TW7A 1TPC1 5HWMA 1LZOA 4UNKA 4FHAA 3BW2A 3QPYA 2LLEA 4ZL1A 3G22A 1DKWA 5LNWA 3Q2DA 2Y88A 1TPWA 1SZFA 4O1BA 3UY8A 3ELFA 4CQ9A 1A5AA 3P80A 1EX5A 4R33A 2EGZA 2V81A 1XBYA 4HNNA 2DJLA 1M7PA 2Y63A 4GFSA 3W1MA 2P1FA 1TPDA 5F2IA 3M47A 2IQTA 3NGJA 3MI3A 2GVLA 1O5XA 1AK5A 3L66A 3DFPA 2ALDA 1NFBA 2E5CA 1XDMA 3LV6A 3NQAA 2QDGA 4Z1DA 5AHLA 2G97A 4DPQA 5AC8A 3WJZA 3NQ6A 1Z41A 4N6FA 5DCBA 4Z0SA 3KRZA 3GNNA 4GRSA 1RR2A 1ZENA 4ZQNA 2XN0A 4UUIA 3CEUA 4UTUA 3TAOA 1FDJA 2WNQA 4HHPA 3C52A 1UB3A 1F7BA 3UD6A 1M5WA 4FIRA 4OU1A 1T99A 2H3DA 1FUYA 1PV8A 2QCEA 1K8XA 2VFFA 4MPQA 2GVGA 1C8VA 2NXHA 2GOUA 2I1OA 1KFLA 3ZWSA 1ONRA 3G1FA 3O15A 3VI2A 1TSIA 2EHHA 5CPMA 3NQCA 1J2WA 2YW3A 4IX2A 1QOPA 5HR6A 1F05A 4FXRA 1UUMA 1TV7A 4LS0A 2A6LA 3NDOA 3B8DA 4FNPA 2XN2A 2DZPA 3K30A 2ZDRA 1HL2A 1I45A 2NWRA 1A5SA 3USBA 4WY0F 1OFQA 3UWYA 3TFCA 4XZ9A 3UWUA 4UIOA 3NPUA 4CQ8A 4DF0A 2CZFA 2QCMA 3HG5A 3P5ZA 3MBFA 2W6RA 1FDYA 2BZNA 1QOQA 1KM6A 4O50A 3NM3A 1GOXA 1OABA 2NUWA 3MHFA 2FQIA 3E0IA 3LGEA 5BMWA 2QAPA 5E1QA 1SW7A 3GDTA 2W79A 1KTCA 3WJSA 4A29A 1QDSA 1EIXA 2Q3OA 2C1HA 1GYLA 3MHGA 1F6PA 3PR2A 3S5ZA 2Z6IA 4RLIA 1NF0A 4UFKA 3DZ1A 4OGZA 4Z08A 3U2OA 3W73A 2RH9A 1XUUA 3I68A 2Z1BA 4GUGA 4JTIA 3BV4A 4OV9A 3W23A 2YR1A 2TPSA 2WOQA 3KVMA 2CZ5A 1VR6A 3S0CA 3LCXA 4MUZA 4HNVA 1LORA 1N8FA 1WAUA 1JR1A 5KTLA 2Y70A 5I3HA 3IRDA 3LLDA 3P61A 3GAKA 1W5PA 5G2IA 3SGZA 3W7MA 1VQTA 1GVFA 2OT0A 4UTTA 1TV8A 4O52A 3T55A 3MP3A 5G2WA 4UMCA 3TSMA 5D04C 3W9ZA 2FFCA 3LCIA 3P67A 2NV1A 2Z0IA 4K8EA 4S2BA 1UASA 4WOZA 3L67A 2E6AA 4K39A 3SR7A 3TR2A 3VE7A 4RKAA 3P8JA 2V5BA 1KA9F 1Q6LA 4JTHA 1XL9A 1QNVA 3QEZA 4OV4A 3N2XA 3WJXA 2ZFAA 3O06A 3S9YA 3SI9A 3N19B 4XKYA 3W22A 2ISSA 4AWTA 3JRKA 2PC4A 1KW1A 2OMAA 1XM3A 3TQ0A 4DF2A 2A0NA 4JX5A 3O05A 4UMBA 5LGZA 3P81A 3LLFA 4X22A 1VCGA 4YMZA 1TPH1 2OCZA 4A3UA 4CNOA 4H6KA 1GG1A 3GXNA 4UTIA 1Q6RA 4IXXA 1K7FA 2QKFA 2Z6JA 3HIJA 4LVBA 2E6FA 5FF3A 3C8FA 1RD5A 2ZA2A 2TMDA 1ME8A 3S1VA 1VYPX 1OFBA 2QR6A 3GR8A 1HG3A 3G0XA 1ME7A 4LV4A 1N55A 3IGXA 1VLIA 3NQVA 3NQDA 2QUVA 5D2YA 4NZJA 3S5NA 5LSMA 1QCWA 2YW4A 3ZFHA 5D2XA 2JGQA 1R2TA 2Y62A 4ZQRA 5HUOA 5HR7A 1DQXA 2ZRUA 4MJZA 2X1RA 5K4XA 5EBUA 1WA3A 1AG1O 3GVGA 4JTSA 1G4SA 4GJ1A 1EP1A 2R94A 5F4SA 2BX7A 4GUIA 3UWQA 3FKKA 4JN6A 5AN7A 3C6CA 3WK0A 1KFCA 2YFOA 3G1HA 6TIMA 2ATSA 2WNZA 1OFEA 3QFEA 2XFWA 3C2FA 1H5YA 2RDUA 1SW3A 1JRCA 3W88A 4LU0A 3M5XA 5LZLA 4JICA 1YLVA 4M6VA 1F5ZA 6ALDA 4AB4A 1K3UA 3W07A 4P2VA 4TMCA 1XDLA 2NX9A 1Z48A 4PFMA 4NQ1A 1ZFJA 1XFBA 2WO5A 3AJXA 5AHEA 3KVKA 1KTNA 3LCHA 2VELA 2V30A 5FESA 3EKLA 4RV8A 3TC6A 5IBXC 4O14A 1U83A 3S8HA 5AC7A 5E93A 1KBJA 3G1YA 4Q32A 2A85A 1LTDA 2YDAA 4GUJA 2V82A 5EA9A 4Y90A 1SR9A 1W54A 1TRDA 4CNNA 3GDKA 3EX6A 1KM1A 1OVDA 3TH6A 3W70A 2R14A 3BK0A 3P62A 3WJYA 2YX0A 2RFGA 3CHVA 3DFTA 2VEIA 3KVJA 3QMTA 1PHQA 3EWZA 5D05A 3BLFA 4O57A 3GB6A 3W71A 4O0ZA 1HUVA 3PBWA 2WSYA 3C61A 2ZA3A 2B4GA 2QJHA 3L5AA 1TTQA 3NAVA 4FNQA 2X30A 4KWVA 3W1UA 3QPZA 1TO3A 4O1DA 5BNKA 2RHGA 2A7NA 4N9CA 3ABSA 3CB8A 3PBVA 3LI1A 1KBIA 1TTJA 1FWSA 2A2IA 2BSLA 2ZYFA 4LV9A 3LTSA 1MEHA 1LYXA 4HNTA 5KZMA 1JJKA 2FB3A 3I6RA 4NVTA 3F03K 3S1WA 1EUNA 2A21A 4DQWA 5AFDA 1QO2A 3HG4A 2F7FA 5DXYA 2ATMA 2DZWA 2FLIA 3TC7A 4WQ6A 4MVAA 3S5YA 1XCFA 2NLIA 4AHPA 3NQ2A 3S5OA 3W7OA 1GJPA 3W2JA 2GJNA 4H3DA 4L4MA 3DGRA 3NQ8A 1W8SA 4ICNA 4JGDA 4MZ1A 3EWWA 4NJGA 3PAJA 3B03A 3N14A 3TE9A 4AEOA 2WKJA 4O8RA 4N2YA 2QDHA 2V2DA 1UUOA 4YL2A 1OK6A 1SU5A 1A53A 2CW6A 2XN1A 4FX7A 4DELA 1R47A 4KFNA 4QAIA 1SO6A 1FXPA 4Y96A 1C9DA 3PM6A 4BWLC 3PULA 1Z42A 2QCDA 1KM5A 4MLRA 4UTMA 3LBMA 1FXQA 5FEWA 1KFKA 2QAFA 1GT8A 4LRSA 3HPZA 1H7XA 1FWNA 1G6CA 3S1UA 3SIZA 3WFAA 3C2RA 1K8YA 1OFDA 4LY8A 3IIVA 1T8XA 4DPPA 3CU2A 1BKSA 2O7SA 1X1ZA 4IMFA 4O12A 3NVTA 3TXZA 4FX6M 4CCCA 3HGSA 3RFAA 4UFHA 4I9AA 1LBLA 1VZWA 2BTMA 3N73A 2WSRA 3WK2A 4PL1A 3VCRA 1VJIA 2A4AA 1OHLA 4YWIA 3LRKA 3A22A 4ZZ9A 1H50A 3MW7A 4UTJA 4RR4A 2DZXA 4N9DA 3BW3A 5LGXA 1PVNA 3N9RA 5EYWA 5CSSA 4JR5A 5C2XA 5DBTA 4FNUA 5CPLA 4ZVJA 4JTGA 4JY8A 1D3GA 1M7OA 1GWJA 5F2MA 3B04A 3FS2A 1PCWA 5K3VA 3E02A 3M16A 3S6DA 4FIQA 4YXGA 3PSVA 4LRTA 3GDRA 2QCCA 5K2ZA 4JY9A 3VE9A 3ABQA 4MOZA 5HMSA 2CFFA 5AHNA 5AHMA 3BPWA 3LHTA 2ZBTA 3UWWA 2CU0A 2R8WA 3C56A 1R2SA 4WXZA 3TV8A 3DFNA 1EWDA 2UV8G 1YTDA 1W1ZA 1LDCA 3LRMA 4IMCA 5G1TA 1G7VA 2ZZ5A 4JTFA 4O10A 1DORA 2ZZ3A 4FEZA 1F74A 3L0GA 4QIUA 4LW7A 4PCFA 4TU1A 1WDWA 3LHVA 5CPNA 1WOBA 4JTTA 5K9DA 4IPJA 2RDWA 3FEMA 3R2GA 1HO1A 1TPB1 1WX0A 2C19A 3IVSA 3ZWTA 4E0CA 3O16A 3PS7A 4I7VA 1W5NA 1A50A 1VGAA 1SUXA 1C29A 3UWVA 5LNVA 3P84A 1GVSA 2GQ9A 5AYXA 3NYZA 5F2LA 2BWGA 4YCOA 1BTMA 3GR7A 2NXGA 3AO0A 3DFQA 1JCLA 2PRHA 4ZQMA 1SW0A 1X6UA 1TYGA 3L5LA 4MY8A 3QQ1A 1A5CA 3C0JA 3L5MA 1AW5A 2C16A 3W7QA 3GDMA 3LERA 3W7PA 3L68A 2KZHA 3MYOA 1AL7A 1JCJA 3CQ0A 4HNUA 4O4VA 2I9EA 3BGJA 3GDLA 1WBHA 2A5HA 1N7KA 3IIZA 1ALDA 5HJLA 3TNOA 1O60A 2QCLA 4FNRA 4BFAA 1TJPA 1H62A 5D33A 5C5YA 2Y7EA 4ADTA 2YFNA 4DO6A 4Z1BA 2D73A 3BG5A 1EP2A 1B4KA 3MP4A 5C6MA 3FIGA 3G3MA 3O8AA 4QQ3A 2VOMA 4N4PA 3OHIA 3C2EA 2CLLA 2ZZ1A 3HPXA 3GXTA 4HIBA 3W1QA 4EF8A 1B3OA 3P82A 3A24A 4NJKA 3SGUA 1LBFA 1TPVA 3OBKA 3MWAA 4OT7A 4QITA 2ZZ4A 1W5QA 3TXVA 1SPQA 3W3OA 3PWAA 3W85A 4Z1CA 1MO0A 4Z0JA 3W74A 3UYCA 1DQWA 4IMGA 3PY2A 1LOQA 2QUUA 3OVPA 3BO9A 1GG0A 2WJZA 4DXVA 4ORMA 1DJQA 5H91A 3E12A 1RV8A 2NXIA 3FJLA 1O5KA 1VYRA 3LDVA 2NV2A 1OYAA 1A5BA 2CLKA 1TCDA 3LHZA 1OJXA 3L2IA 3OVRA 3DBPA 4CNPA 3W1XA 1YDOA 4IQLA 1EWEA 3LX9A 4FNTA 1YDVA 1FCBA 3DH7A 5MHBA 3B0UX 3W2KA 3W75A 3W7CA 3KXQA 3W2NA 4FF7A 1JVNA 3A23A 3T44A 1TPFA 4R53A 2NX3A 4PA8A 1W3NA 2Y7DA 3NQGA 3M41A 1FDZA 1KM0A 1W37A 3MYPA 4IMEA 3B06A 4IX0A 1TJRA 1XI3A 3W6YA 4JTUA 5I3FA 3GZ3A 1DHPA 2DP3A 3I7RA 4I7UA 1H61A 1X7FA 1O94A 1VC4A 4BK9A 2OT1A 5G2HA 4ADSA 1YYAA 1I2QA 1CX9A 4O53A 1TPUA 1AL8A 3M43A 3W1LA 5AYYA 2HMCA 4CLMA 2NUYA 2Y7FA 1WYIA 1TTIA 1TB3A 5CZ0A 5D2WA 4FNSA 1TPEA 2QCGA 2FJKA 1FQ0A 4R7JA 4GBUA 4LUJA 3DHFA 3MUXA 4AHQA 3D0CA 1SO3A 1OX4B 4WOQA 3CTLA 5LNUA 4LC8A 3UQNA 4NT0A 1FWRA 3T4CA 4RX0A 4MZ8A 3KRSA 3CWNA 3L0NA 4MY9A 5HQEA 1F6KA 1G69A 5A5WA 5F4WA 2VFDA 2TSYA 2A7RA 4RXGA 2PCQA 4MJMA 4UTKA 3NNTA 2YGYA 4JDBA 1CW2A 4KWWA 4FO4A 2PRLA 4N02A 3U6WA 4L4LA 3HJZA 3THQA 1RQHA 3MO7A 4W9TA 2AQWA 3BG9A 1S5WA 3E49A 3GNDA 1WBJA 3HB9A 4NU7A 1QR7A 1NAL1 2C14A 2QUTA 3R8RA 1H60A 4O11A 1F73A 4A21A 4CQAA 1YXYA 1QPOA 3R5EA 3W86A 3BGGA 3LCWA 3W7NA 2ISVA 4IMDA 3EXTA 2QCNA 1YTKA 4XBSA 3TU9A 3G1VA 3WK3A 3W1PA 2A6NA 3UWZA 3FKRA 2CWNA 4LUIA 1X8FA 2RDTA 4YLWA 5U4NA 2E6YA 4K36A 1IXPA 3FJ6A 3QMSA 1UBSA 1K02A 1T96A 1YADA 2ZQ0A 2HS8A 3OG3A 2B7PA 5AYZA 1LLZA 3LTYA 5KMYA 1MSSA 3LXCA 3HPSA 4XTDA 4JD4A 5CPOA 1W5MA 4ADUA 3GLCA 3HF3A 3UXAA 3GAYA 3N34A 4LVGA 4UTWA 4HN4A 5LNRA
chains in the Genus database with same CATH superfamily
2CLHA 1WZMA 3IEBA 2RUSA 3C8NA 4AQLA 4AMAA 1H49A 1FWAC 2POTA 5D32A 1CLKA 3LTPA 3AYVA 3STCA 1FWWA 1XBZA 2JK2A 3CYJA 1HVQA 3FDGA 4FLQA 1XQKA 4U5KA 3ATZA 3AC0A 2XVLA 4POCA 1L8NA 3CL8A 4AWUA 3A9IA 3FYOA 3B8UA 1R8LA 2VZSA 4GI4A 1IT7A 2PZ0A 3IJ6A 2NQ5A 3RGTA 1J0KA 3OLDA 2G95A 2OOGA 2PLJA 2Y1HA 4QSHA 4ZFCA 1ML1A 3TYBA 4U3CA 5L9FA 4N9EA 4GACA 4M80A 3AHYA 3B97A 2FGBA 3WUBA 2HWGA 3DXIA 1FCQA 4PBGA 5DCDA 1SZEA 1XQLA 4L9ZA 4GXMA 1RY0A 1N8IA 1U33A 4QEEA 1HL8A 3QC0A 3AYRA 3NA8A 1KFBA 2VEFA 2ZVRA 1W5OA 1GEQA 1KLZA 2X7WA 2C0AA 2CXGA 1Y5WA 4LYRA 3TN5A 3NQFA 4B2DA 4NXSA 3EXSA 2IPFA 1ITCA 1UA7A 1W3LA 1IWAA 2DSZA 2VR4A 4WR3A 1Z44A 3GTIA 4PEKA 1UR8A 3G77A 4DZHA 3U0HA 4M7TA 3AXHA 3F2BA 1TRIA 5CPTA 3EOLA 4D9PA 1FY6A 2NSXA 5FL1A 2YLLA 4GC3A 3CZGA 2P10A 1XX1A 5BXSA 4TMBA 3DKLA 2EPNA 4WEVX 4NY2A 4UOZA 5C2CA 1CGWA 3DKJA 1XIFA 3N6HA 2TRSA 1RBOB 1NQKA 2VR2A 2CZEA 1UJPA 2AAAA 2OVLA 1ZBWA 3TJIA 4S3CA 3L4YA 5KZEA 4GX8A 2PDUA 1H7OA 4KIRA 3M1ZA 4FMVA 4YU1A 2ZE3A 3EA2A 1JQXA 4GISA 4GPNA 2CHNA 2AQOA 3M0HA 3G1XA 3AIBA 2FVLA 4JTQA 3RLUA 1EA0A 3M7WA 2QF7A 1JUBA 2DVTA 3XISA 2Y5EA 1NVMA 4XAGA 2DH2A 2Q8ZA 4PH6A 3CMJA 3JZEA 4GC4A 3VD4A 2WCAA 5A6AA 4NZ1A 1C8YA 4A3RA 3DFHA 3B8VA 3NG3A 1GCYA 3WQ6A 3R94A 4AVNA 3H6OA 1Q6OA 2OWWA 1O95A 3HGRA 4ONVA 3OODA 4DM2A 4DZAA 4CCZA 4WSJA 3VKAA 3PFRA 2FB2A 2GGJA 2WZIA 4GNJA 2Q71A 2PF8A 1JYXA 3C3UA 2HXTA 2YYUA 3U9IA 3GC4A 3RPMA 3ZLFA 3FA5A 5FD0A 1X6NA 1H1ZA 3MUY1 4K8HA 1J93A 1Z8AA 1TIMA 1XLHA 4DBWA 1EOKA 4M8UA 3ZS4A 3P5YA 3R58A 2ZUNA 5BRQA 1PKMA 4LVDA 4DO5A 4AHOA 3TN6A 3WLRA 4RUBA 3I6TA 2G4JA 3R7MA 4PB4A 5CEWA 1L2QA 2D3NA 3NR0A 3BWWA 4RXFA 4DBUA 4P8WA 3BAIA 3TSBA 3WH6A 5BXTA 1YDYA 4FR6A 4QR6A 3TX9A 2Z2UA 4A2SA 2BGNE 4B5TA 2I9UA 1UD8A 1V0LA 4PUKA 5KZDA 2W67A 1FFQA 4JTKA 3VU2A 2BY3A 4Y8FA 3HGOA 1R46A 4P7QA 5CGTA 4U4MA 1C7SA 1CBGA 3R43A 1DOSA 1JCYA 2B7OA 2YL6A 4AD4A 3SCRA 1QUMA 4NX0A 1BXNA 1C91A 2D2JA 3UXKA 4JQ3A 4A05A 1TG7A 2BXVA 1NF7A 2H6RA 1NSJA 3CUFA 1UZDA 1OFAA 2QJJA 4L7ZA 3WD2A 5CBJA 3B3DA 3V4BA 2WMHA 3OLGA 3ZMRA 1BVWA 1NDYA 2PAJA 3CAKA 3W2MA 4W85A 2EPHA 4UQBA 2XFYA 3FOKA 4AW7A 3LB0A 1PL9A 4IPNB 3DOPA 5MKGA 5E9AA 3RK8A 3G24A 4RJEA 2QCHA 4XTIA 1VFOA 2EF9A 3CAQA 3OZYA 3MI6A 5HPOA 1KM2A 3HQ1A 1LQ0A 2G0WA 3GRIA 3QKZA 2ZA1A 1TVNA 2YOCA 2CLIA 1E1CA 4PUUA 4AZ7A 4JTRA 3CQIA 3HO8A 3IVTA 3GR4A 3PVFA 3STGA 5D09A 1S2WA 1ZTVA 4X2RA 4XIAA 3VABA 3W1AA 5DEZA 1I2RA 4UFMA 4X63A 4H8VA 2F6KA 1V6UA 3EOEA 2X1UA 2HNHA 1JUEA 5A6LA 3I10A 3IIPA 3W83A 3VGFA 3WH5A 3PJWA 3GKFA 3TAKA 2J7FA 5FAJA 4E38A 1ECEA 1EB3A 3CM4A 2EAWA 5DCEA 4D6GA 2WKGA 1P6CA 5D30A 2QLYA 2PWDA 3TCEA 1P0NA 4RNJA 4H00A 3MMTA 2PURA 1W9PA 2CZVA 3PC0A 2YBTA 4YYFA 3L0KA 1GHSA 4DI8A 1F4AA 1H3GA 4GIEA 4J4KA 1MQQA 5IBXA 2P88A 4IQEA 1VFFA 3T8QA 1Y65A 1L6YA 3EA3A 5CJNA 2G3JA 1J12A 3WLPA 4GYJA 1UBPC 3CLMA 4HJWA 1TCMA 3BJFA 2A7PA 1AQMA 5DXXA 2J88A 1ZCCA 1Q6QA 4Q4KA 4RZ4A 1SJAA 2G41A 1GKRA 2DT3A 3FGCA 3TW9A 1UQZA 1K7EA 3OQEA 3E9AA 3UETA 3P60A 4M56A 2E8YA 2CZDA 2FH8A 1DIDA 4LUSA 4ZCWA 4HNCA 3PG9A 4HNLA 4P8XA 5F2GA 1DJZA 3QYSA 2WQPA 4OE7A 1RPKA 3LSBA 4JQ2A 4GE8A 2V3GA 1A0EA 2Y85A 5HMDA 1K8CA 3ZVHB 1VRDA 1Q65A 4UR7A 4N9BA 4AZHA 1GKQA 5I06A 1Q13A 1KM3A 3MP5A 5HNRA 2FHCA 4AU0A 2J9YA 1E9ZB 2BS9A 1GKPA 2Q01A 2JGYA 2IW0A 1S2CA 3M5YA 4DUVA 3SSJA 3WDRA 2HE8A 1B90A 2DPEA 1L0PA 2ZC8A 2H8XA 1KV5A 1RP8A 3APYA 1JF5A 3I7QA 1F3XA 1KWKA 4F0HA 4REQA 3G1DA 4TX6A 5I07A 3RMJA 4CGTA 4DWSA 3UESA 3H4XA 3BARA 4O19A 4XD3A 3SUTA 5CZJA 1K7XA 1EYEA 4C91A 1TVLA 1X7IA 3W7GA 1EPXA 1V6XA 4TOQA 1E72M 1HGWA 2YLAA 1H5VA 2J74A 1QPKA 3GXMA 4BWLA 4Q8PA 3GM8A 1UR0A 1E1FA 4Y9AA 1ZAIA 2F2KA 3OIHA 2P50A 2V2HA 4AXKA 4B9YA 5CC3A 3CZ8A 1VB9A 1AUSL 3IV8A 4ZQPA 4O17A 1K6AA 3FDKA 1TTPA 1SFJA 2HZGA 4CNSA 9XIMA 4A3HA 3RJYA 3G0UA 1QPRA 1GPWA 1BWLA 4HHMA 2BMBA 3W4RA 5LHEA 2ISWA 2HEJA 5HWJA 4PB5A 2WSQA 2DIJA 3OA3A 3AWOA 3NM1A 3E5PA 1FCUA 5AYBA 4LX4A 3EX3A 1PX8A 4UFJA 3BOLA 1LBMA 3M0ZA 4WY0A 4XWUA 2R1NA 1XHGA 4ZE5A 4G2DA 1AW2A 3T0BA 1M01A 2EG8A 3W7JA 1VFMA 3W1TA 1W3HA 2B7QA 3TYCA 3MDUA 4GWEA 4E4UA 1PHWA 3S2NA 4MIMA 3FW6A 3OHMB 3R11A 1BVZA 3W7IA 4GIAA 1OC7A 3LCLA 4C65A 2YL8A 3UFYA 5D03A 5LKYA 3N9SA 3C0LA 3KS5A 3C2OA 1SGJA 2WHMA 3R25A 4AG0A 4JX4A 3SADA 1XIEA 4IZGA 1H0IA 4DIAA 4DRSA 3CWOX 2D0HA 3WD4A 4IP7A 3A5FA 3F5JA 3LXBA 3PBUA 4ZQCA 2GFTA 3MA8A 4GNVA 3V1PA 2QHAA 4GI9A 2CWXA 2OYKA 1S5VA 2VC6A 1UC5A 3EB2A 3ZSSA 1I75A 3TONA 1DE5A 3AJ7A 5CJ5A 1OC5A 3NZ1A 4DF1A 3KBJA 1GVOA 1TJ2A 4NNBA 4LPCA 3SUWA 3IRSA 4BEUA 5EMUA 1I4NA 4W8BA 1YTEA 5CAHA 3CMFA 4JIPA 3V0TA 1EXPA 1NM9A 4RZBA 2ZTKA 1FCVA 3B8SA 4MLJA 2B7NA 3QR0A 1JGMA 2YYTA 4UTLA 4GNKB 4UTWC 4E2OA 1JPIA 3ABOA 3FLUA 4OHQA 3W76A 2Z1KA 4L1XA 4WD0A 1MRAA 2QUNA 4UFIA 2Y8KA 1LUCA 4JN7A 2FZBA 3KBWA 3OO2A 1RPXA 3QF0A 1KFEA 4S3KA 4DO4A 3R6IA 4EF9A 5BOOA 3NWRA 3GHSA 4HBKA 2BVYA 5IOBA 3PBYA 4UQEA 4UTHA 3BUVA 3AYSA 4L65A 1J0IA 3N4AA 1P7TA 3KFTA 1UOKA 3SO7A 1BQGA 3EWUA 3PBGA 4FK9A 5ECVA 4HSOA 3WF0A 4BEQA 1Q6GA 3HFTA 3NEVA 5AHFA 4WF7A 1GZJA 4U10A 2NW0A 5I03A 3COTA 3SQSA 1XJBA 1IZCA 2BOGX 1ADSA 3AFBA 3FYPA 1KXQA 3OLEA 5HDRA 2I5IA 1DIKA 3M6YA 4IUOA 4K2SA 3WQFA 2DVXA 2EQDA 1HKWA 1WXZA 2PB1A 5DF0A 3T78A 5LHFA 3IGUA 3ZOAA 4M51A 2VCBA 1W31A 2G3NA 2GJLA 3L4VA 1SM9A 2GSHA 4ZB2A 3EWYA 3NPXA 3ITYA 4KKXA 1JI2A 3TN4A 2PBGA 4MPKA 1L6WA 2Q8XA 1TJ0A 4KEUA 2X0SA 5HWMA 1EL3A 4FHAA 5AY7A 2NQJA 2INZA 1EPVA 1XG4A 5ENLA 4HPHA 1C90A 1PYFA 2LLEA 3FK4A 4JIIX 4XAYA 3G22A 4ZL1A 1DKWA 5LNWA 3Q2DA 2Y88A 3Q67A 3UY8A 4CQ9A 1EX5A 4R33A 2Y5JA 4HMNA 2YL9A 2PU0A 3T2QA 4QFUA 5C7VA 2DJLA 1M7PA 1DXEA 4GZJA 1ESWA 1EDGA 2JF7A 1K9FA 1PO9A 4KGLA 3M47A 2IQTA 1XLCA 2ONEA 2BY2A 1O5XA 2GVLA 4XB3A 4J3ZA 2VYOA 1KO0A 3LS9A 3VINA 1T40A 4Z1DA 4DYEA 2G97A 2O4QA 4LH8A 3K46A 1T6MA 2VQUA 5CPSA 3WJZA 1KC7A 1JL8A 2H9AB 3GQYA 2EJ1A 1G1YA 4ZQNA 3FSTA 1JF6A 1EIBA 2XN0A 1YMYA 3K13A 3QKEA 4PTXA 3PWGA 3MANA 3MQTA 4HHPA 3C52A 3VOCA 1UR2A 3ORWA 2O92A 5TNVA 2AOSA 2H3DA 3VUSA 1PV8A 2VFFA 1SFSA 2NXHA 2I1OA 1KFLA 5B7YA 3ZWSA 5CSUA 1M9HA 2EHHA 4PUJA 1A3WA 1J2WA 3CTTA 4IX2A 5HR6A 4Q8UA 2QPSA 1M1BA 1UUMA 4LS0A 5TF0A 2A6LA 3RAOA 2CNCA 1R5YA 1DEDA 3CUJA 4IL2A 3AU6A 1EJVC 1C3FA 4KGJA 1HL2A 3MCMA 1A5SA 1OY0A 1CT5A 2QIWA 4URIA 3H2AA 1UOZA 3KL0A 3ZT5A 3CYVA 4CQ8A 4Y9OA 2IXUA 2W6RA 2NUWA 3E0IA 4W84A 3GNRA 2PMQA 1I0BA 2W79A 2WQDA 3L2MA 4A29A 1EIXA 4GI8A 4E2VA 3MMDA 1HJXA 1HZYA 4UFKA 2VI0A 4AISA 2C8NA 1XD0A 4HTYA 5IFTA 3S9IA 3KDNA 1DJHA 2Z1BA 4JTIA 3BV4A 3W53A 5CAKA 3ITGA 4W4QA 2WOQA 3KVMA 1LQAA 5KTLA 4XK2A 5FJRA 2YDSA 1TR1A 3LLDA 3M46A 3GAKA 2DEPA 4F0RA 3SGZA 4IT1A 2PTYA 1WDQA 1KCKA 3T55A 5G2WA 5D04C 4H7CA 3PZQA 2NV1A 1JAEA 4WOZA 3L67A 4LAUA 4AMCA 2GWNA 1WDSA 3VE7A 4RKAA 3U5UA 4TX8A 3SBFA 2V5BA 1KA9F 2DT0A 1Q6LA 3TOYA 1E3ZA 4S3EA 4OV4A 3WJXA 1JZ8A 3P3BA 1WDRA 2QPUA 3W22A 4AWTA 2PC4A 1KW1A 3BDKA 3TQ0A 3TYAA 4DF2A 2WZHA 2WC3A 4FLRA 5LGZA 3B9NA 3LLFA 2DQXA 3RRXA 1UROA 4YMZA 1TPH1 4Z2JA 4P5UA 2OCZA 4CNOA 2C91A 1QNQA 5IDIA 4B9ZA 4IXXA 3HMCA 2QKFA 3HIJA 3K8LA 4LVBA 3U2ZA 4Q4PA 1E6NA 5FJIA 3SN1A 4XX6A 3MSYA 2ZX5A 1W1PA 1PUDA 4I9MA 2ZUWA 4GKTA 1W1B1 2FVMA 3RN6A 1A47A 5LSMA 4EE9A 2Y62A 1UKSA 3QY7A 5HR7A 1DQXA 4GIYA 3RMEA 1WA3A 3AZSA 3N6JA 3GVGA 4AZIA 3Q45A 3VIIA 1WKEA 1RD6A 2BX7A 4L9XA 4JN6A 5AN7A 1OT2A 3QZAA 3TEVA 3TA9A 1KFCA 3G1HA 4CVUA 4PR4A 2XFWA 3GVQA 2RDUA 2QYGA 1PZ2A 2QVNA 4LU0A 4C6DA 3PTKA 5LZLA 1Q8JA 1NARA 4M6VA 3BTNA 1F5ZA 4IIGA 3W07A 4H6EA 4PFMA 1ZFJA 2GUYA 1XFBA 2X42A 2V30A 1JPMA 4HU8A 3TC6A 3WLHA 3ZLGA 4ZB5A 2XIQA 4K1WA 4O14A 3TWBA 3ZLHA 5E93A 1KBJA 2A85A 2YDAA 1SR9A 1W54A 1TRDA 5LXXA 8XIMA 3SQLA 3POHA 3B4YA 4GABA 3P62A 4HSHA 3CO8A 4C7DA 3QMTA 4QS6A 2G3IA 4QG8A 1F4HA 1QI2A 3GB6A 4Q4OA 2FGZA 2A3HA 1O68A 2QMKA 2QJHA 1L6GA 2X30A 1XRFA 2RHGA 2F38A 4H6RA 4N9CA 1Z7AA 1KBIA 1TTJA 1DPMA 2BSLA 3WLKX 1QI0A 2VL4A 2VM8A 1LYXA 3MUAA 4PTVA 2WHKA 1JJKA 2DGAA 3KCOA 3K1DA 1V6WA 2VOTA 3S1WA 2A79A 3VMNA 4IMAA 3AIWA 3VD5A 2JEPA 3W00A 3APGA 4LANA 2F7FA 5DXYA 1KQZA 5HOSA 3TC7A 2BB0A 4MVAA 3GVWA 3S5YA 3GG8A 3VD9A 4DB7A 3W7OA 4F0KA 3I3BA 1YKWA 3KL3A 3MO4A 1R3TA 1Y5VA 3DGRA 2F6XA 3GY1A 3N2CA 1NOWA 2QIIA 4QSFA 2UY3A 4JGDA 4JHZA 3T0TA 1E0UA 3N14A 4O8RA 2ZUUA 3WLTA 1UUOA 3GIPA 1BAGA 4FX7A 4DELA 1W3KA 1KD0A 4ACYA 3QV7A 4EXAA 2QCDA 3DESA 4IPLA 2PDPA 5FEWA 4K1GA 4LRSA 1R3RA 1H7XA 1FOBA 2XH2A 4G56A 2OQHA 3N2OA 5EGRA 4I6KA 1CZ1A 3WFAA 3BAWA 3NDZA 1XLBA 2O7SA 4P7LA 4CQDA 3NVTA 4NF7A 3RILA 3CUZA 2PGWA 3R8GA 1LBLA 2XFRA 3LUTA 3DECA 1GK8A 3PUGA 2DT2A 4C6LA 1HT6A 4NAEA 4YWIA 4ROQA 4NI3A 1H50A 3HFYA 7PTDA 4N9DA 2GJPA 3BW3A 3JW7A 1W6TA 1PVNA 3LYEA 5A6TC 4US5D 3BQ5A 5C2XA 1UW9A 4RPQA 3WZ0E 4JTGA 2F61A 1EBGA 2BGSA 1BLIA 5F2MA 3VIHA 3B04A 3FS2A 1PCWA 5K3VA 3ES8A 4FIQA 4I9JA 4QDMA 4QGCA 3EWDA 1EX1A 1EGMA 3GDRA 2OR2A 3LMZA 3VE9A 5BZAA 3ABQA 2ALRA 5AC4A 2OZ8A 2CFFA 2CLPA 1XLAA 2ZBTA 2CU0A 1DIEA 3C56A 1R2SA 1BSIA 4YWSA 2UV8G 1YTDA 2V68A 4JTFA 2ZZ3A 1F74A 1MUMA 4PCFA 4TU1A 1WDWA 3LHVA 5KZ6A 1WOBA 3CUXA 4JTTA 4IPJA 2RDWA 3FEMA 3R2GA 2PGFA 2NSOA 1M7XA 3NIYA 3UVAA 3IVSA 1UPPA 2FJUB 4TXEA 4HU3A 1VBHA 2IKJA 1VGAA 4HPGA 2OLHA 4D6CA 5LNVA 2GQ9A 5ABFB 2ZXBA 4TV6A 4M6UA 3MCOA 1XSIA 2WMJA 4YCOA 1WZAA 4H9VA 3AO0A 2PLKA 2PRHA 1SW0A 4HA4A 3N4EA 3CH0A 2FHFA 4MY8A 2WWDA 4YS1A 4Z1YA 2D2OA 1HW6A 2KZHA 3LPFA 3DYMA 4CQBA 4KBXA 3QPEA 3ARQA 4O4VA 2I9EA 3CHCA 5CBBA 3M4HA 4GYKA 2D0FA 1TX2A 1O60A 2UY2A 7A3HA 1V0NA 3VC6A 3QV9A 3B9EA 2HPIA 1C8QA 3WN6A 1KKOA 4X2PA 4Z1BA 3TVAA 1GOWA 3UR8A 2J7EA 2R82A 1EP2A 1B4KA 5C6MA 3GC2A 3G3MA 4J3TA 1TUFA 4J2PA 2D23A 3C2EA 2JIEA 3DC0A 2GK1A 3HPXA 3GXTA 5FOOA 3W1QA 1EQCA 3IACA 4FPSA 2PDNA 4GZIA 3N25A 3UR2A 4PTWA 5KETA 3W85A 1TZ7A 1MO0A 2KX9A 4AX6A 4IMGA 1B3WA 2WJZA 4DXVA 1PTGA 4ORMA 5H91A 2NXIA 3KTXA 1O5KA 3LDVA 4KWOA 1A5BA 1QVBA 2WVVB 4IGSA 3QY6A 1ZP4A 1OJXA 3WNPA 5CZKA 3KM8A 3D47A 1YDOA 3BOXA 4PUDA 3WBYA 3W2NA 4MB5A 2O0TA 4A4AA 3BAJA 3NQGA 4MSSA 1X1NA 1FDZA 1KM0A 4Z2GA 1W37A 4IX0A 3WF2A 3RPDA 4JTUA 5I3FA 3GZ3A 1DHPA 2DP3A 3I7RA 3N18A 4DI9A 2WMIA 2Q6ZA 3EMQA 4B3ZA 1GQIA 3M43A 3W1LA 4JQAA 5AYYA 2HMCA 4CLMA 2X8RA 1UD3A 1FHLA 1E0VA 5CZ0A 5D2WA 1TPEA 2J79A 4IIHA 4GBUA 3AU2A 1RK6A 3WMCA 4EK7A 3NFUA 3E38A 3T4CA 4MZ8A 5E0FA 3L0NA 4PTDA 1DP0A 5F4WA 3AICA 3AZTA 2GJXB 3NNTA 4JDBA 3KL5A 2ZKMX 1CW2A 4J3XA 4DLFA 5IHSA 4AC7C 4GZEA 2Z29A 3HJZA 3WQ4A 1XSKA 3EEZA 4ASTA 1GW1A 3B8TA 3WBXA 2AQWA 2VNCA 3BG9A 1S5WA 3E49A 3GNDA 3BCDA 4LY4A 2CBUA 1NAL1 2VRKA 1YBQA 1H60A 4O11A 4X0VA 5JBDA 3VXGA 4V1XA 2VTFA 4ATDA 3W86A 1T7LA 2ISVA 3PZVA 4IMDA 2WVTA 6XIMA 1XYFA 2VDGA 4CU7A 2YA2A 1DE6A 4YLWA 5U4NA 1IXPA 3UGRA 3FJ6A 1V02A 4AD1A 5GJNA 3QMSA 2ADAA 2RJHA 4RNHA 3LPPA 1JXJA 4JKLA 3VKKA 2DW6A 3L2LA 1B3YA 2B7PA 1LLZA 1A5LC 3MC5A 1MSSA 4JIHA 1W5MA 3I3EA 3UXAA 1US0A 3GAYA 4LVGA 2QF8A 2J7BA 1GZ1A 2TODA 2ZRYA 5LIUX 3KOYA 3P0WA 1J5SA 2YCLA 2HBVA 2RGMA 3A6OA 3DDMA 4MKVA 2WC7A 4XBKA 4DUWA 4RCXA 5D2TA 1KTBA 2C1IA 1UCWA 2Q02A 2ZZ6A 4JEQA 4IJBA 2C13A 1J4EA 3E2RA 3WUGA 2VC5A 9CGTA 4LEQA 4W88A 4LBRA 2Z1SA 5AOUA 3V75A 3UG5A 4L1GA 5LA2A 3A12A 4Q33A 4ICCX 5K9XA 2NX1A 5HK4A 3QBUA 3V0SA 6CGTA 2PP3A 2X40A 2WHJA 1SZRA 5DN1A 3NZGA 4S1FA 2PODA 4E2BA 4CD8A 1OADA 4HHHA 4ATWA 2OJPA 4IFKA 3H2NA 3TFXA 1JPHA 3AUOA 5U7SA 4PCPA 1G4PA 4GUFA 2VGGA 1TQJA 1US3A 2BGQA 2WMGA 2VEGA 3H53A 2VX7A 1V7AA 1A5UA 3NJ3A 2CHOA 4NXKA 5CQ1A 1Y0EA 1VLWA 4XV0A 5DANA 4EVZA 3RR4A 2GGGA 4JFTA 4N0RA 4F2BA 4BHYA 1Q3NA 4NJJA 2P76A 5AYIA 1VD6A 2PP0A 3SRFA 4DJDC 1KLYA 3H70A 2XSXA 1XIMA 5FF7A 2I5GA 2VHLA 1SSDA 2WV8A 2DY3A 1MZRA 5AC5A 3VUPA 1EEPA 1IXQA 3C4UA 1XR2A 1EH9A 1KXHA 1QXLA 3GO2A 1N82A 4J9JA 1V0KA 2VT0A 4DWDA 4UFLA 4B91A 1LWHA 1FHVA 1J11A 2D24A 1XIHA 3VVGA 3LU2A 3SEPA 1REQB 2E40A 4KW2A 3V36A 1AJZA 1W1IE 4YCPA 1UD6A 3KOFA 1P0DA 1FX6A 1EUAA 3W2UA 4PTMA 3N3TA 2HCVA 1ZCOA 3PTDA 5JH1A 5JIWA 4PC8A 1UZHA 2YSWA 3DAQA 1A4LA 3AHXA 3UP8A 1K8ZA 1F2JA 4JKKA 2OU4A 4O15A 3HGJA 4ZMGA 2R9RA 3EDJA 4BZYA 3W2LA 4HYVA 4NG3A 5JBFA 3GXDA 1IWPA 3N9KA 3FXGA 2DU2A 3T07A 4V15A 1S46A 3W24A 2B31A 3OGSA 4AF0B 3WNLA 2F84A 1J01A 1E70M 2REQA 3AMGA 1D3HA 3CLWA 4Z1AA 4Q8VA 1JFHA 2O7QA 5DELA 3EAUA 1IT8A 1FRBA 1U2YA 3GIQA 4O1CA 3PHAA 4MY1A 3WNNA 2WMKA 2GVJA 1E51A 1Z9AA 3JS3A 4JFVA 2XHYA 1PKYA 3WMSA 4IH3A 1XLGA 4BI6A 1VHNA 2J7HA 2QGHA 4UNIA 2WYSA 2J9XA 2ODOA 3VIGA 3UPBA 1LWIA 2AKMA 4MKNA 3QLLA 1BF6A 5DMMA 2E1DA 2R91A 1UWTA 3ABRA 3W7DA 2OWXA 3BW4A 3A4JA 3KBNA 4GO9A 4FXFA 2E77A 4X60A 3DFYA 3EOSA 3NSXA 2VZVA 2DORA 4I5RA 2GDQA 1YPFA 4B3KA 1WDDA 4V2XA 1AVAA 3GSMA 4OOZA 1ICQA 4WXYA 3BSGA 1Z6KA 2BOFX 2PUZA 3Q58A 5BWFA 1ZJIA 2VZTA 1VFUA 2P8CA 3OIXA 1CB7B 1HKMA 2Z1WA 2ZVIA 1QPQA 3AHVA 3W7HA 1NEYA 5G4EA 4WKAA 1UMLA 4AZCA 2ESCA 3RHGA 3HJEA 4B15A 3CIWA 5DY3A 3QZEA 1EC7A 3QW4B 2P0IA 3ARWA 2Q3RA 1IV8A 4IG2A 3WLSA 1JAKA 7TAAA 1T8QA 2WXDM 3NEHA 3UR7A 3W7KA 5I3IA 3HU7A 2Y8VA 4KRZA 4E8GA 5AB3A 5HAOA 3TC3A 4DJFA 3ISIX 3H12A 1LL7A 1DWAM 4AVFA 6REQB 1JQVA 3BL3A 1O6IA 3L9CA 1QK2A 4DBSA 1PZ3A 1E9LA 4PGLA 3LLXA 4W93A 3A3WA 3M0JA 4NYUA 1YIXA 1J96A 3OJGA 5BW6A 4RZ6A 1E9YB 3ZR4A 3EXRA 1W1YA 5D37A 2CC0A 1VPXA 3RO8A 4NI8A 2B0MA 4AD3A 4KWUA 3HQOA 1LOSA 2PDFA 4R7WA 1J9YA 1HTIA 3A13A 3DENA 2WZMA 3MHUA 4ZXOA 4IFOA 1XIJA 1ONEA 4BF9A 2IQ0A 1SZNA 1RJRA 3KTCA 3LOTA 4HPJA 1E0TA 4HA3A 1B3ZA 7CGTA 3RX2A 5KSWA 1OG0A 4DNMA 2WNWA 1IR1A 1PKLA 4Z2HA 3SW6A 2BLEA 5BRBA 3TIMA 1NDZA 4KFOA 1TA3B 5BCAA 1UA3A 3LRLA 3GDBA 5LYRA 3VC5A 5LIWX 5CZSA 2HVOA 1OB0A 1Q8AA 4QE1A 4D2JA 4GY0A 1HP4A 2ACQA 2NWSA 1EFZA 4ZO6A 2O55A 3WK1A 4XQ6A 2HE5A 1R87A 5BROA 3QJAA 1H7WA 1SO4A 4NILA 4WJEA 2FDSA 5A6JA 3NO5A 1SVDA 4LBUA 1R30A 4JL2A 4ZODA 3VKBA 3SY1A 3SCQA 8CGTA 3T2OA 2ZX6A 5HJYA 1KM4A 4B5NA 2C0HA 1IEVA 1S3HA 2PDJA 5SWUA 3WQGA 2J24A 1H1YA 4DEFA 1MXDA 3WDPP 2DUZA 1H0GA 4NL1A 4FLOA 2Y5SA 1CGTA 4AH7A 2D0GA 1XYCA 4C6CA 3G1AA 3STEA 3NQ7A 3TSDA 4H6QA 1S1RA 2HTMA 4LUTB 2Y7GA 5G5IA 1C9WA 4LOCA 2GPTA 1G0CA 3I6EA 1YDNA 1M53A 3CUIA 4O16A 4HMDA 3AHTA 3IJIA 3CH9A 3QM3A 3W84A 1HJQA 3EDDA 4GH3A 1Z32X 5FSDC 3OGVA 3O1NA 3UJRA 3DHDA 1Q63A 4GO8A 1I8JA 4M6PA 3TLLA 4MYXA 3UNDA 2ZWZA 1GTHA 1R3VA 3U5YA 4HMCA 3FJNA 4Q8NA 5FEZA 1EGVA 1THFD 2VENA 3BAKA 1TMHA 3CUGA 3GVVA 4KPLA 2BHYA 1ODUA 4C6BA 4EPDC 5D8ZA 2W91A 4DJDD 2B81A 4LT9A 4QRNA 4P8VA 4A2RA 4FI4A 4MZYA 3AALA 4K6AA 1G5AA 1JRBA 1I2OA 2GL5A 3M9YA 2E0PA 4U2ZA 4A6GA 4NZ5A 4G5DA 1EOMA 4JS3A 4IPPA 2Y24A 4B4FA 3QW3A 4J40A 1XLMA 2V8ZA 2Y89A 4ILSA 3BOFA 4ZA0A 4QNEA 2X2YA 1QI3A 2XU2A 2I14A 2V0TA 1K4GA 1PTDA 4Y6GA 4L6HA 4LCQA 4Y8EA 2PDIA 3BG3A 3C3NA 4ZFMA 5CGQA 3NGFA 3EKZA 1NP2A 1SZGA 2WNNA 1HKKA 3BGAA 4EAYA 1PB0A 4V28A 1XYMA 1QRQA 1EHAA 3N6QA 4HU4A 5I3GA 4JTEA 1UH3A 5D9NA 4GGHA 4HA1A 4PE8A 3CC1A 4U28A 5REQA 3ZT6A 2AQVA 3VOHA 4WDXA 3IGSA 1JZ5A 4W7UA 4PFHA 3RCMA 2WPBA 2IKHA 3GS6A 4GYPC 2P0OA 1ME9A 2DT1A 3TZNA 4NUWA 3WH8A 1WKYA 1KRAC 2BY1A 3AIVA 4J1OA 4KEZA 3HTWA 1JEZA 3AWNA 5HINA 3UZXA 4ICMA 1CXFA 1QK0A 4J3VA 4Y7EA 3MUIA 2HS6A 4O13A 1SO5A 3DI1A 2WJDA 1JCNA 2OZ0A 3TR9A 4CD7A 3GBDA 3RNDA 3K4DA 3THAA 1EC8A 1AD4A 3BLOA 5G1YA 4UZSA 3SCVA 2EKGA 4QNWA 9XIAA 1M68A 2WM1A 2FGLA 3QC3A 2PDHA 2X2GA 5XIAA 3R12A 1R38A 3P7YA 4L5ZA 1SMAA 4PBEA 1LOLA 2ICSA 2RAGA 3GYEA 3N15A 3GIYA 3EA1A 3GBEA 3G18A 1L9WA 4UNLA 3WMBA 1TE1A 5TQLA 2YJQA 1QO5A 2IMRA 4RV3A 3ZM8A 4KETA 4QEHA 4L61A 1ITQA 1QNOA 1EJXC 3PP7A 4X9SA 1V7YA 1R7AA 4K37A 4RE3A 1I1WA 4LUYA 4GA8A 4ZTXA 3SCOA 4QM1A 1W1A1 4KCWA 4EP8C 4BQ4A 3G1RA 3T4WA 1RVGA 3CQKA 3AMDA 4EWND 1VJZA 1B1YA 1WXJA 3SY5A 3M0LA 4WDWA 1RZMA 4GJJA 4NSBA 1UD4A 3II1A 4GIRA 4OFCA 4J35A 1H7NA 4PSPA 1E4NA 5E9XA 3LENA 2CLMA 2J27A 4FXSA 1RA0A 3W7EA 2J66A 1FP8A 3QQ0A 1NWRA 5FCZA 2DZSA 3U7VA 3W81A 1GVQA 3GNOA 3P93A 3R79A 4L56A 2XH7A 3PPFA 3E96A 1ISYA 3TK7A 2ZX7A 3B8IA 4LVAA 4QLKA 5EKYA 2Y61A 1RJQA 2XINA 3M5VA 1NFPA 2OG9A 1LWJA 3BLLA 5H8UA 3OEXA 5L6UA 2JKEA 5A6MA 3L12A 3LZ5A 1MW2A 3SRHA 1DJXA 2XH0A 3BCFA 1W1TA 1KB3A 5HBFA 4ERAA 2AMGA 1G4TA 3ARYA 1F3WA 4WK9A 1B31A 4JTJA 2NT0A 3ITOA 3O9NA 4A8NA 1CENA 2WLYA 3G6LA 1YX1A 4F2UA 4JNZA 5JIPA 4AIUA 3M6DA 4S3AA 3FVDA 3KHJA 4AC1X 3UW6A 4L6OA 1JIBA 1G01A 5BMXA 2PDWA 3PN8A 1UKQA 1LZOA 4UNKA 4WKHA 3BW2A 2G37A 1RLDA 2Y2WA 4ERIA 3DUGA 4WLCA 2D2HA 4XISA 3P80A 1JGIA 1XBYA 3RYSA 3REQB 2Y63A 1UMYA 4O1FA 3W1MA 1V3KA 2P1FA 4CD6A 2ACRA 3H7VA 3K8KA 4LAZA 4M29A 1PJ9A 2XZ9A 3BV7A 4EKJA 2IQDA 4QJ3B 3LN3A 1AK5A 3DFPA 1MFVA 2E5CA 1XDMA 3IUDA 2YL5A 3NQAA 4PMNA 3MZ2A 2AGTA 5AC8A 4F40A 4GX9A 1Z41A 4N6FA 3KRZA 3GNNA 3QGKC 2XGIA 4G9PA 2YBVA 4N42A 1QI4A 3WY1A 4UUIA 3CEUA 4UTUA 3E3HA 1FDJA 5H8MA 4PSRA 4M82A 2OO6A 3AHZA 3RIKA 4FIRA 3WFLA 2HROA 2XIJA 4HMEA 3MU7A 2YKKA 1FUYA 1K8XA 2BFGA 5I5RA 1D3CA 1C8VA 2DV0A 3WBEA 5AKQA 1R3WA 3WX7A 5ABHA 1ONRA 3G1FA 3O15A 3GG7A 3GC5A 2JE8A 3M0YA 4MJ2A 3NQCA 2YW3A 3KBSA 2C1GA 1F05A 3W02A 3VA8A 1SJCA 3B8DA 4FLSA 2XN2A 1EJRC 3GTNA 1JD9A 2CERA 2ZDRA 1I45A 1ISXA 4LYPA 2NWRA 2PTDA 2A3LA 1N2VA 3UWYA 3HURA 4XZ9A 4A8LA 1Q4WA 2VZUA 3NPUA 4U5IA 3GG0A 4C6KA 3JUGA 5CLWA 2CZFA 2QCMA 1OBAA 1FP9A 1XD1A 4QAWA 4ES4A 1FDYA 1GOQA 1QOQA 3NM3A 1GOXA 3MHFA 1ODZA 2E25A 1AH0A 1SW7A 3GDTA 3GTXA 3KOZA 3RPTA 3WL0A 5JVLA 3WENA 3CV7A 3MHGA 1I6NA 1ZUAX 5GNXA 2Z6IA 1Q6FA 4RLIA 5IFPA 4IGMA 4WJ8A 4Z08A 1PSCA 3VGEA 3WBAA 4NKCA 3W73A 1A4MA 2RH9A 1XUUA 3I68A 4RNIA 4GUGA 4I90A 3E0WA 3W23A 2YR1A 3F4VA 1XRTA 2TPSA 1VR6A 1O66A 3LCXA 2X05A 4HNVA 1LORA 1N8FA 1UWSA 1BYBA 3UGVA 5I3HA 3IRDA 3U4AA 1J0JA 3TYUA 4JNYA 3GD6A 1W5PA 3W7MA 1GVFA 2OT0A 3IARA 4H7ZA 4UTTA 4XO6A 1FH7A 4UMCA 1JYWA 1BQCA 2FFCA 3BXWA 1CPUA 1GVYA 1MW3A 3LGGA 1J6OA 3HPAA 4IQJA 2WVUA 1QNPA 1QNVA 3N2XA 5DMNA 4GK8A 3SI9A 4XKYA 1EQPA 3O2LA 3JRKA 4I5UA 3GW0A 2AL2B 3O05A 3SUUA 5FA5A 1VCGA 3KHDA 3DN5A 4FA3A 3T81A 5A6BA 3UCCA 4H6KA 3ANUA 2HQAA 3GXNA 4UTIA 2X0YA 2WCSA 1Q6RA 2J78A 1ISVA 2Z6JA 1V03A 3UJSA 5FJPA 3RITA 2I16A 5FF3A 3C8FA 4AD5A 2INEA 2ZA2A 4GY7A 3S1VA 3F4CA 1OFBA 1Y5XA 4YVXA 4HCDA 1N55A 3W26A 1NWSA 3H7UA 4LCSA 3NQVA 4AVOA 1XYAA 5D2YA 4OUIA 3S5NA 2PFHA 4GHRA 3V5FA 1OT1A 3ZFHA 1UUQA 4S3FA 8RUCA 2JGQA 1R2TA 4PUNA 3EB3A 3QV6A 4JTSA 3AIQA 2V3FA 1G4SA 4GUIA 3ZSTA 1H4PA 3FKKA 2CBJA 1HN1A 4TTGA 5DT5A 3LG3A 1PWMA 3R4IA 1OFEA 1XLEA 1LG1A 2G50A 3GZAA 1SW3A 3IJQA 1WUFA 1OGGA 1YLVA 4OZOA 4O0QA 2BVTA 1VENA 2HVMA 4P2VA 1XDLA 1A5MC 4NAFA 2J8GA 1PKNA 4HK5A 4NQ1A 3AJXA 5AHEA 1KTNA 2VELA 4ENLA 4KEMA 2OKOA 5IBXC 1KBBA 1W9BM 1DWIM 5LA1A 1CXHA 1IYXA 4GUJA 1YW1A 4JBRA 5EA9A 4CNNA 4B90A 3B9AA 2X0HA 3KWSA 1J10A 4UCFA 3VGGA 3VNKA 3DFTA 5AZ1A 3KVJA 4TV5A 2PDGA 1HUVA 3PBWA 2X09A 3G6MA 2PWVA 4G7EB 2ZA3A 2FZNA 4KWVA 3QPZA 5CH9A 4O1DA 3K8MA 3UBPC 1IZJA 3VM5A 3FA4A 3MKKA 4MF4A 3CV6A 4PMRA 3PBVA 3LI1A 1FWSA 2PTWA 4Q8TA 1DQUA 3K1GA 1Z3NA 1MEHA 3BJTA 3AXKA 1J0HA 3I6RA 3TOPA 3F03K 3Q65A 3R0DA 3NO3A 1S39A 1EUNA 5AFDA 3TTYA 3GU2A 3DGBA 5DMYA 2QS8A 4GQRA 2DZWA 4WQ6A 3A9BA 3LK6A 5BYWA 4JQ1A 2NLIA 4IIEA 1PDZA 3UVIA 4B2DD 3SIMA 1W9XA 1HVXA 4L4MA 2VRQA 5EMLA 4AY1A 1W8SA 2PWGA 3EWWA 4Z17A 2XSBA 4DWSC 1QU4A 4AEOA 2WKJA 4CKQA 4N2YA 7REQA 1B0IA 4C5YA 2V2DA 1OK6A 4KH2A 4NHVA 1A53A 4WCJA 1XRVA 2XN1A 4H9YA 4OECA 1UC4A 4KFNA 1FXPA 4Y96A 1C9DA 2I57A 4BWLC 3NYDA 4MLRA 4UTMA 3LBMA 1E6XM 1FXQA 4HYWA 1C7TA 1KFKA 2QAFA 5M3WA 3S1UA 1DJGA 3UF9A 1K8YA 3W6MA 4LY8A 4DPPA 1BKSA 4KERA 5FIPA 3LA4A 1CGXA 4ERGA 2YDRA 4F2TA 3TXZA 4CCCA 1M3UA 1W1VA 2E67A 3RFAA 4Y9NA 4PRTA 4XIMA 2WSRA 4YJ5A 4QCFA 4LAMA 2FZDA 3C2YA 4PL1A 5C7HA 2OEMA 3VCRA 2A4AA 1HIZA 3IJLA 4OVXA 3A22A 5C9XA 4QX4A 5A8MA 5LGXA 2VO5A 3ITLA 5EYWA 2DZBA 1SYTA 4JHMA 3RUBL 1PYMA 4ZVJA 2ZX8A 1NOUA 4HA0A 3QGVA 3AXIA 3LY0A 2QVHA 1POKA 2GVEA 3DHUA 1TE6A 5CJMA 3GXIA 3M16A 4HGXA 1U5VA 3S6DA 4YXGA 5I3DA 3AIEA 4B5VA 1WAWA 4MHBA 4AYSA 1E15A 3GNPA 3EPMA 4MOZA 5HMSA 4HQVA 5AHMA 1V3LA 3UWWA 5FL0A 1VFHA 2R8WA 3ITCA 2PPGA 4H9ZA 1W1ZA 3LRMA 2DQWA 3T2PA 4O10A 3GHUA 1H41A 3J7HA 2RGLA 1YNYA 3E0VA 3WLNA 4EWJA 1FKWA 1GQLA 4XZLX 1KR0A 3EYPA 2BHZA 3VZXA 4B5UA 5JH2A 1HO1A 2CHRA 1XKJA 3AAMA 4GY1A 2Z00A 3DHPA 3UNTA 1P1MA 1UKTA 1SUXA 5JBEA 1C29A 3UWVA 3NYZA 3M0VA 3WH7A 4LALA 2E9BA 1BTMA 1ZZMA 2NXGA 4E3VA 2J7GA 2J75A 1GOIA 1X6UA 1CIUA 3L4UA 1DHKA 3H22A 1A5CA 4KRTA 2CYGA 3IK4A 3WD0A 2C16A 2PGEA 3W7QA 2DIEA 1FH8A 1OGSA 3LEPA 1CLXA 3LERA 1HKIA 5BRPA 3MYOA 1V93A 1JFXA 4MWAA 3LPGA 2A5HA 1N7KA 1ALDA 4BFAA 1TJPA 1ZP3A 1O1HA 5J8LA 2JQXA 1E3XA 2YFNA 3WDQA 1XIGA 2AKZA 1SMDA 4HJFA 1ZL1A 1NWUA 3CO4A 3VMOA 2CLLA 3HPFA 2ZZ1A 1UR9A 4EF8A 1B3OA 1IWBA 3A24A 3LQGA 1LBFA 2VUYA 1TPVA 3MWAA 4OT7A 4XZHA 1W5QA 1P0BA 1CGUA 3BSMA 3PANA 1UR3M 3WQDA 4MNKA 2EEXA 2YDQA 3WQWA 3BO9A 1GG0A 3IJ9A 3E12A 2XGBA 1RV8A 1XPGA 1B2YA 2VGFA 3CGTA 3LHZA 1KBKA 3L2IA 3DBPA 4CNPA 3UWEA 4EPEC 4GMEA 4C60A 2R1PA 5KEZA 4CNUA 3LX9A 2P3EA 4FNTA 1FCBA 1JZ6A 3W75A 4HPNA 5MKGB 4FF7A 1JVNA 3A23A 1TPFA 3RXZA 2NX3A 1XYBA 4OIFA 3P2VA 4WVXA 3MYPA 2OQYA 3B06A 1WKFA 5E5CA 2MNRA 1HL9A 4XSLA 1XIBA 1Z69A 2J6VA 4MNMA 1PXGA 3MSGA 1H61A 1E1CB 3VKCA 4F79A 1PTAA 2VURA 1O94A 3VILA 4U33A 4ADSA 1F8MA 1I2QA 1RCXB 2FHBA 4ZB0A 2PZNA 1HP5A 3FJ4A 1TB3A 3GVRA 1FQ0A 4C6FA 4R7JA 5HA7A 1O7AA 4D8LA 4LUJA 3DHFA 1GOOA 1NP0A 5T9CE 4AHQA 3K5XA 4WOQA 4U3AA 3FAXA 4LC8A 3IK2A 4ACZA 4ZEPA 3CWNA 2Z1VA 5HQEA 1F6KA 3MPGA 1G69A 3URQA 2RDXA 2A7RA 2J13A 5TD4A 4RXGA 1BRLA 1E4MM 4I8DA 2XIMA 4LBSA 1LL6A 3BE7A 1WNOA 4N02A 3U6WA 3W27A 3ZJ6A 3E6EA 3MO7A 4W9TA 4O1EA 3WQCA 2CPUA 3N29A 1TV2A 3S46A 3QHMA 2ISFA 2XUCA 3UA4A 3SCSA 4H1ZA 2QUTA 3R8RA 2CBIA 2BOEX 4B5SA 1B54A 4DY1A 4PMZA 4CEXC 1E1EA 3TP4A 4G1NA 3AS2A 3BGGA 3LCWA 3W7NA 3NUKA 2ZUMA 3VDAA 1I9CB 2NVAA 5HANA 3TU9A 3FKRA 3FGCB 3V7PA 1RP9A 2RDTA 1JZ7A 3WEZA 2E6YA 1VFTA 1RK5A 1EJUC 2EPMX 5E09A 1JDFA 4XZBA 2CETA 4LUSB 1YADA 4X61A 2ZQ0A 3WQPA 1JZ4A 4B16A 5AYZA 4XD4A 3DYOA 3LXCA 4JD4A 3RX3A 1KRMA 3GLCA 3FV9A 3DFOA 3W7LA 1CGYA 2V6AA 3TQKA 1MEWA 4IP4A 3GTFA 5FSEC 3IIOA 2C7FA 5D9MA 4DWSD 5BOEA 1BVNP 3BURA 3S2MA 2HK1A 2E5BA 2V5LA 3TJXA 4DJEA 4D6HA 1VH7A 4C6IA 3KVLA 4KQNA 4LTSA 4WJXA 4QP0A 5IHRA 4YIWA 3WF4A 1S5TA 3M5ZA 1D8CA 2GSJA 2W0UA 3B0PA 1J18A 3UPMA 4REQB 2PD5A 5I02A 2EG7A 2WSKA 1DTNA 1F9CA 2DZTA 3PNZA 4JIQA 1XIDA 4DWSB 3C2VA 4A22A 3PSWA 3EX2A 2I5QA 3CT7A 1OQFA 1S2UA 1GVRA 4N6EA 4Z2KA 3M44A 4FP1A 3LHYA 3VNMA 1LLWA 3FSUA 1MWOA 2P5NA 3NQEA 4RK8A 5A8PA 1AH3A 2V38A 1XH0A 7XIMA 2C6QA 4OBSA 1O1ZA 4NX5A 3MCNA 1GTEA 2VP8A 2QDEA 2X16A 3O6AA 1ADOA 8A3HA 2H3BA 4R9XA 3LV5A 4BS0A 5T8GA 2L5HA 3VCNA 2J7CA 1E0XA 1P43A 5RUBA 4CCDA 2DJXA 6ENLA 4ZOEA 3M0XA 3Q4DA 4BI7A 1OF6A 1HO4A 2XVKA 4XKMA 2WSPA 1IXNA 3WQEA 1R6WA 1TWIA 3KE0A 3PG8A 1DBTA 1JZ2A 2CLOA 1QWGA 1E6SM 2YA0A 3E0FA 2FZ8A 1RAKA 3NL6A 3NXFA 3Q37A 4WY0B 1KBLA 4QJ4B 2JFEX 2VFHA 4DXXA 4DXKA 1F76A 1F6YA 3EDEA 4WUIA 1DJYA 2W66A 4PMDA 3PJUA 3VO0A 3TTSA 4HOZA 4M1BA 3H4WA 1A5OC 4P7OA 3AI0A 4LWWA 2XIBA 5FJOA 1GW9A 4AIBA 3BLIA 3RCNA 4E3TA 3ZR5A 4R34A 3UXDA 4IJRA 1U5JA 1W9UA 3EWXA 3TJLA 3UZ5A 4BCEA 5A6KA 3ITVA 2OKTA 1YXDA 4N4QA 1EKOA 1TV5A 4C1NA 5I2UA 3NQMA 4Q4QA 1KRBC 3LXAA 1X8CA 3IUIA 4GOAA 2VFEA 3ALGA 1GQKA 3ZO9A 4XZMX 2E6DA 1FWDC 4UOQA 1OFRA 4H9XA 3TTEA 1V6VA 3RG6A 2VJXA 4IIFA 3IVUA 3MB9A 3WF3A 5DQPA 1O12A 4D8ZA 1HKJA 3E5BA 5AVHA 5JUVA 4M19A 2MANA 1VIZA 4G7FA 5AC6A 3GK0A 4AYGA 3BLPX 3MJYA 5I7GA 3OTRA 1GYNA 1IIHA 1TWZA 2E8ZA 1PBGA 1RJPA 2CLEA 3A3HA 3AUJA 2VUNA 1GOKA 2X1IA 2QJIA 3JR2A 3SY8A 1LT7A 3NPVA 4AEFA 4HNOA 4Q3MA 3T7VA 1AD1A 4P61A 3VKJA 1FWHC 4QHRA 1K9EA 1L6SA 1QHZA 3IIXA 3CJPA 4UC5A 5TBOA 3OYZA 2HNEA 4LS1A 4NJHA 2ABAA 1IGWA 3JVAA 2QV4A 5FF4A 5C70A 3KRUA 4JXCA 2CXEA 2E09A 3PB2A 1OYBA 3V0UA 1EF3A 1JYVA 3MKVA 4DZ5A 1LUCB 3CHFA 3QRHA 4LB4A 3HG2A 3C5QA 1O4UA 2PSNA 2J4GA 2NVDA 4XO7A 1OX5A 3R1ZA 1LLOA 5HULA 1QPNA 1P7TB 3TMLA 2FPVA 1WE5A 1S2AA 3GXFA 4LVFA 5H6HA 4D6DA 4S3DA 1AFSA 1BGGA 3I7SA 3UJFA 3UG3A 4QG6A 2PTZA 3YPIA 1IXOA 3UJEA 3TW6A 3DI0A 3LBCA 1XXXA 4IGNA 2BY0A 1IZKA 4PMQA 3SECA 4C7GA 3U7BA 2VXNA 2JBMA 1JNDA 3UCQA 3G8RA 1MDLA 3DEQA 4HZMA 1J0YA 2PLCA 3FHQA 1P4CA 1W17A 1YNQA 4WSHA 3UPWA 1GHRA 1UP3A 1OIMA 2W5FA 2VEPA 3TTOA 2FKPA 1PCKA 6PTDA 1XC4A 1V4YA 1KR1A 2OYMA 4DBEA 2EG6A 5FJTA 2INFA 2EPKX 3TQPA 3BAXA 4HKPA 2WZTA 3PUEA 3T40A 1Z89A 2PE4A 4L4PA 4OKDA 2Y4SA 4DX3A 4JL1A 3HA1A 1JCXA 1P1XA 3T08A 1R9XA 2FZMA 3F4WA 3R13A 1GOMA 2ABBA 3SFKA 1UKOA 1T41A 3F1QA 4ALDA 1GZGA 3FHAA 4NNCA 1VRXA 1R2RA 1QJWA 3O6DA 4AD0A 1OX4A 1HX0A 3SFWA 1Q6EA 4OBRA 3GHTA 4V1YA 1ZJBA 1ADDA 2PBOA 1CCWB 4UCGA 4S3JA 1NIUA 1ONWA 1CNVA 3PZIA 3AIUA 5EMYA 1EZ2A 5MF5A 1W3IA 3XIMA 1XLJA 4IGHA 3HM7A 1P48A 3HV8A 3OBAA 3GX9A 2WAGA 1CYGA 1S3TC 4US6A 3W87A 3KX6A 1W0MA 3KLLA 1EGZA 1C8XA 4TVCA 2OFJA 3CZJA 4JAWA 4KESA 1XBVA 2HXUA 5CSRA 1EBHA 1YHTA 4L6DA 2GQAA 1XISA 1JDEA 2ZE0A 4XBJA 5JXQA 3BZJA 3O6CA 1GQJA 4WDTA 1CTNA 5GNYA 4ZXLA 2EPOA 1NELA 2PDQA 3BMVA 2XGZA 2ZZ7A 1QHPA 4H2CA 4FX8A 2GWGA 4C6PA 1IHIA 1A80A 5C8BB 2BHUA 4JN8A 1DJNA 1LRTA 4GUHA 1S2VA 1CECA 3MV01 4C7FA 1Q85A 1X6LA 1ZBVA 2H8ZA 3WJWA 1J0ZA 2QULA 3WDJA 5B80A 4K38A 3WEOA 1HJWA 2QW5A 4H2HA 4AWSA 3CEPA 4PRRA 4IFRA 3ZJKA 3SUVA 1XDJA 2PC8A 3MTWA 3T0AA 1O5QA 4CNTA 2VDIA 1RQBA 4EXBA 1POJA 2GDVA 3GU1A 2DSVA 3LM3A 1PEZA 2Y0FA 2H90A 3VNZA 1IIGA 1R85A 2QCFA 1QAPA 2JKAA 4C5ZA 3O6YX 3QTGA 1X97A 2OWCA 2YCEA 1QFEA 4EANA 3MUCA 3SJ3A 3DX5A 1CB2A 5HWNA 4JZ5A 5TAOA 4DBDA 1B4EA 3DERA 2NQZA 3UU0A 3W28A 1LROA 3HQNA 4MAVA 2V63A 4M6QA 2ZRVA 4LEFA 3S2JA 2GLKA 4IICA 3LNMA 1L2UA 3SCWA 3ANVA 3AXMA 4F8XA 4DAFA 1V08A 1QWKA 3EB4A 4F48A 3CAVA 3O3RA 5CSYA 4NP7A 1UWAA 1G94A 4PN2A 3P74A 3OYXA 2VD8A 3IUHA 2JKPA 4LC6A 3IJ8A 3STFA 3EX4A 4GXPA 1VBJA 1HGYA 4D6IA 2FIQA 5F1VA 1FWTA 2PLMA 1WOAA 2Z7KA 1W3JA 1L6FA 2V5DA 1P0EA 2BASA 3WQ8A 4JKMA 1P0KA 3CIXA 4OQVA 1NOFA 2GSEA 4CD4A 3RU6A 5A8QA 1W91A 5GJMA 5M5DA 3V5CA 2ACUA 4DAIA 2WVSA 4Q8MA 3QR1A 3L4XA 1OWQA 3BH4A 2YZRA 3PPGA 3IV3A 3KBMA 1WPCA 3CV2A 3NVDA 1OFOA 1XYZA 4LXFA 1XCXA 3QHOA 1ZU8A 4YVPA 3ES7A 4NZ3A 1RHCA 1BYAA 1DTUA 3MJMA 1R3QA 1MZHA 3KEHA 4ZGYA 1UD5A 1DVJA 4JYDA 3IANA 1EP3A 4K3ZA 1ZS2A 4JNMA 2YXXA 5FEPA 1XS2A 5CLTA 1EEXA 4KRUA 3PNUA 3RDKA 3GH4A 2XIIA 2FPTA 1K03A 5FJJA 3UZJA 2GJRA 4NZ4A 3S1GA 4XAPA 3PPCA 1YXCA 1TQXA 4QG9A 1HXJA 2I56A 5DBUA 5D8WA 3SN0A 3TQVA 4HYRA 3U8GA 1QTWA 3I65A 3ZYZA 4WHBA 3CZLA 4C6NA 4YN5A 5D02A 3MZNA 4OBTA 1OCNA 2C18A 4FOKA 1MMFA 4J5NA 3RLVA 3WKZA 4ML9A 2ZX9A 4HN8A 1UPMB 3DFSA 4JX6A 3ME3A 2FTPA 2ZRXA 4WSKA 3SQMA 3R0KA 3K4AA 2J8FA 4A3QA 5I3KA 4JYFA 4ZSUA 3FFSA 2FZ9A 3TTQA 2ZZ2A 1CI1A 1DV7A 3N1AA 1TV3A 3MI2A 4H8HA 4F9JA 3QYQA 5D2VA 3CUHA 3EPNA 3MBDA 3IPWA 3VFLA 4C1KA 2GUUA 2YPIA 1BWKA 2E7FA 2NZLA 2UBPC 3WELA 4B5WA 3CHEA 3MKCA 2CLFA 3NXLA 5FI8A 3TA6A 2RKXA 5A69A 4NNAA 4FOJA 4GQGA 1LQ2A 2BODX 4IWWA 3N3MA 4AZBA 3EX1A 1FKXA 3JZUA 2Z28A 4GFIA 1WCGA 5LIXX 1VFLA 4TIMA 5G4HC 1W9DM 4JDYA 3UT0A 2DUXA 3TKFA 1XV8A 3TYEA 3RM9A 4OOUA 1MEIA 4ZOCA 3B0XA 3VD3A 1VEPA 3LPOA 4F0LA 3QMRA 1B9BA 3GUGA 3VCCA 2Y6ZA 2IXVA 3ARTA 5GPRA 1CXKA 3VGDA 4MDOA 5GVJA 4IPIA 1XKYA 2FVKA 5C55A 4CCEA 4PTNA 3EDKA 1UWRA 2NUXA 1BG9A 4KMQA 4HOWA