3UGRA

Akr1c3 complex with indomethacin at ph 6.8
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
314
structure length
308
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal structures of three classes of non-steroidal anti-inflammatory drugs in complex with aldo-keto reductase 1C3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 116
structure length 308
sequence length 314
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3ugrA00
1X97A 1JEZA 3ERPA 4GIEA 3H7UA 4YVXA 1S2AA 3LENA 3LZ5A 1PYFA 3M64A 3M4HA 3RX2A 3CV7A 2PDGA 1IHIA 2P5NA 2ACRA 1R38A 4XZLX 4AUBA 2AGTA 2FZDA 4Q7BA 2INEA 3Q65A 1RY0A 4DBWA 3LEPA 1AZ2A 4ICCX 3LNMA 3R7MA 4JIIX 4MHBA 2ACUA 3T42A 4JQ3A 3WG6A 1UR3M 3CAQA 2I16A 5LIYX 3UP8A 5HA7A 3UWEA 1HQTA 2PDWA 1Z3NA 3F7JA 1Z89A 4LB3A 1EXBA 3GHRA 3LQGA 3V35A 5AZ0A 2DV0A 4WEVX 3U2CA 4JTAA 4IGSA 3H4GA 3M0IA 4XO6A 3RX4A 2QXWA 3WCZA 3EB4A 2FGBA 3KRBA 3UZZA 5HNTA 2FZ9A 2PFHA 1MRQA 4DZ5A 3CAVA 2VDGA 2C91A 2DUZA 4ZFCA 1X98A 2HE5A 1IEIA 3UYIA 3D3FA 2NVCA 1AH3A 1EF3A 2F38A 1GVEA 3FJNA 1PWMA 2I17A 3R8GA 2PDFA 2PDYA 4GQGA 1J96A 2IS7A 4WDWA 1S2CA 2PDXA 3R58A 2FZBA 3GHTA 2PDJA 4QBXA 2IPWA 1RALA 3G5EA 2PDQA 1FRBA 2F2KA 4ASTA 3UZYA 1YE6A 5LIWX 2ACSA 3R6IA 4QXIA 1PZ1A 4FALA 1XF0A 1Q5MA 3G1RA 4GACA 4FZIA 1XJBA 4GABA 4JQ4A 1AZ1A 4WRHA 4HMNA 2PDBA 1C9WA 4EXBA 3H7RA 1S1PA 1MZRA 2IPGA 5M2FX 4JTDA 4EXAA 3EAUA 3V0UA 4FAMA 5LIXX 4PUWA 4WDUA 3BUVA 4L1XA 4XK2A 1YE4A 3GHUA 5HNUA 2J8TA 2IPFA 4DBSA 4XAPA 3RX3A 4IJCA 3N6QA 2HV5A 3ONBA 4YS1A 3BURA 4GCAA 3R43A 3GUGA 2PDPA 4WGHA 4JQ1A 2PDUA 4PR4A 2PZNA 3V0SA 3C3UA 3S3GA 3NTYA 1ZUAX 1Z9AA 1A80A 4YU1A 1EKOA 2IKJA 2BP1A 4XZIA 2WZTA 1HW6A 3DN5A 2NVDA 2PDIA 1SM9A 4PUUA 3FX4A 5DANA 2IQ0A 2FVLA 1X96A 1AH0A 2A79A 4JTQA 1S1RA 1T41A 4GA8A 4F40A 5C7HA 2HDJA 2PDKA 3LD5A 2ACQA 1QWKA 5JH1A 3MB9A 2PD5A 2PDMA 3LUTA 1AH4A 1US0A 1ZSXA 5LIUX 3CASA 5AZ1A 3WBWA 1K8CA 3CMFA 3V0TA 2IKHA 1MI3A 4XZNX 3VXGA 2PDCA 2HE8A 1VP5A 4LBRA 3WBYA 1Z8AA 1T40A 4XZHA 2IPJA 4LB4A 3P2VA 1VBJA 2IQDA 4YVPA 1ZQ5A 3MC5A 2IKIA 4YVVA 4PMJA 3EB3A 1PZ0A 3UZWA 2ALRA 4JQAA 3BCJA 2R24A 3V36A 2IKGA 2HVOA 4LBSA 2ISFA 1RY8A 4PRTA 3DOPA 4I5XA 4XZMX 4R9OA 2DUXA 4NKCA 2CLPA 4QR6A 1Q13A 4L1WA 3B3DA 1EL3A 3N2TA 4DBUA 2BGQA 1YNQA 2R9RA 3UZXA 2PDNA 2WZMA 4WDXA 3UGRA 2PDHA 4RPQA 2PD9A 4JIHA 4LAZA 4XO7A 4H8NA 1OG6A 4H7CA 3LN3A 4XVDA 2INZA 4LAUA 3LQLA 3UFYA 3CV6A 1AFSA 2HEJA 1QRQA 2BGSA 3O0KA 4WDTA 3R8HA 2HVNA 1LWIA 5LIKX 2PDLA 3Q67A 4G5DA 4IJRA 1YNPA 4FA3A 3O3RA 3QKZA 4JTCA 3WBXA 4JQ2A 3LZ3A 1PWLA 1XGDA 4JTRA 1ZGDA 4JIRA 4QX4A 4HBKA 4OTKA 3LBOA 3R94A 4GQ0A 3ONCA 5KETA 2PF8A 3BV7A 1M9HA 5JH2A 2FZ8A 1LQAA 4Q3MA 4XVEA 3UG8A 1ADSA 3COTA 3GHSA 4PRRA 2PEVA
chains in the Genus database with same CATH superfamily
1UWQA 2GFTA 2QJJA 4LYQA 3II1A 3EXRA 4ACZA 4X9YA 3VNJA 5K9XA 3LZ5A 3GNNA 3NA8A 3WH5A 3VZXA 3LCLA 5FJUA 1KFKA 2WVUA 1U5JA 1EIXA 3TYDA 3IJQA 5LGXA 3CIWA 2OQYA 4XX6A 1ME8A 5T9BG 3FCPA 3KTXA 3ARVA 1RY0A 2ZZ7A 3UU0A 3LEPA 2I7GA 3JR2A 5HNRA 4DM1A 4WSJA 3UF9A 3EBVA 3KBVA 3WJSA 1JUBA 5JUVA 3QYQA 1OK6A 3UP8A 2ZWYA 5EPDA 4J27A 3CTTA 1JG9A 2LLEA 2YLLA 2XH4A 3BCFA 2XISA 4LB3A 3ZJ8A 4UZSA 3B06A 1E4NA 2AOSA 4BK9A 1CBGA 3G1YA 3U2CA 2WHMA 2C0AA 3T2PA 1NWTA 1A5UA 2GJXA 3O6CA 3ZLHA 3H4GA 3N9KA 3L2IA 4AD1A 3WQVA 2VUNA 4O12A 3KP0A 3LXBA 1O95A 5C9RA 3SDOA 5HK4A 4GNVA 3F4CA 3KRBA 1UKPA 3AMGA 1I2PA 2YDQA 2ATMA 3VNKA 1DJZA 1NEYA 3OOQA 2HE5A 2H3DA 5A2BA 2Y7GA 1RA0A 3RJXA 2WSPA 1G4TA 4XD4A 1WYIA 1MMFA 2J9ZA 4QLLA 1FKWA 1ZLPA 3A12A 2JEQA 1KA9F 1OINA 1CLKA 3K4DA 5D04C 3W1NA 5DBUA 2OODA 2GUUA 1J0KA 1R3SA 3A24A 5H8MA 3ZT7A 5KZ6A 3NQCA 3VCRA 3S5SA 3THQA 5EL1A 5BW6A 4NAEB 3VC6A 2Z0IA 4GCXA 3H2MA 2ZZ6A 1N8WA 4NYUA 5A8QA 4DUOA 3QPZA 1MNZA 4F0SA 1HJWA 5AC8A 4IPPA 1Z42A 1UP0A 2FHBA 4XUYA 2BWGA 4KEMA 4O4WA 3W84A 1HKMA 2OZ8A 3MUIA 4JDBA 4QJ4B 1EBHA 1TTJA 1X6NA 3IIXA 4NHVA 4C1KA 4JTSA 1GG1A 3HZ3A 3OBKA 5HMSA 3ARSA 2YBTA 3T4CA 4PODA 1AMKA 1FHLA 5AOUA 3QLLA 5CG0A 1TE6A 1XLMA 1ZJIA 4E6MA 1TR1A 1UD2A 3HPFA 3NVDA 3V0UA 2NWSA 5EY5A 3IUHA 1PDYA 3VDCA 1EJ7L 1US3A 1RA5A 1IEWA 4K6AA 5H6HA 1NELA 5I3DA 4JNZA 1J0IA 1QASA 4RX0A 2IPFA 3SCPA 1R5YA 3C86A 3WQPA 4XAPA 3LHVA 2YL8A 5KEZA 1RK5A 3VMOA 1BWKA 3DX5A 4W88A 1AD1A 4C6PA 2OGJA 3GNOA 2WQPA 3TZFA 4Y90A 3FAXA 3HTWA 4MM1A 1QW7A 2PZNA 1PUDA 2ZUMA 4NX5A 4IH3A 3RJYA 4XV0A 3SQLA 3WKZA 3F2CA 4GJ1A 4V1YA 4HQVA 3HGRA 1M7PA 1JYWA 5CBBA 2A0NA 1LYXA 4GI9A 4I9TA 3V4BA 2J9XA 3QMTA 1OEPA 3U2EA 1FY6A 1E6ZA 3W1UA 2V38A 1HIZA 5FJJA 5CBJA 1DQXA 4M7TA 4GA8A 2Y85A 4ZOCA 4K68A 2PTWA 3IV3A 4LUSA 5E9AA 1G5AA 3SADA 5REQA 2NQLA 3DG7A 3T2OA 1FWIC 3UG4A 3ZT6A 1MQQA 4H1ZA 3CASA 1OX4A 2VP8A 3NPXA 3V0TA 3ZVHA 4J2PA 1MI3A 3C2VA 3EKZA 4XD3A 4JHMA 4EKJA 1H7WA 3VILA 2J88A 1F4AA 2GVJA 1BVWA 2GGGA 4Q8VA 4LEQA 3S2LA 3VC5A 1CECA 3GIPA 3P2VA 2E5CA 3C2RA 3T81A 3JRKA 3AMKA 3O6YX 2NVAA 1N8IA 4QS6A 4ZOBA 3BZGA 1YDYA 1UMLA 4J4KA 3FA4A 4ZQRA 4GUHA 3MCNA 7TAAA 2NV2A 2HNEA 7CGTA 1EOMA 1LBMA 1TTQA 1PV8A 5ABGA 1WUEA 4GX8A 2PWVA 3FFSA 1ZBVA 2WLYA 3NQVA 4LNCA 4XZ9A 1FUYA 4RNHA 5FIPA 5C8BB 1A5KC 4QG9A 4XZMX 3UYCA 3C2EA 3MANA 3SCWA 1H63A 2BASA 3SY5A 4NAFB 3NM1A 2XZ9A 4HOXA 2YFNA 4S2BA 2VURA 4RZ5A 2VT0A 5G5IA 2GPTA 2GQAA 1OFPA 4C1LA 1W3LA 4N2YA 4YTSA 2X09A 4P8VA 3IVTA 2MUCA 1V3LA 1CENA 3RCMA 4UBPC 4JCMA 4E4PA 4XVDA 1PTGA 3M0YA 3K4WA 4JL1A 2W79A 1E9IA 4NZCA 3VNMA 1E0TA 3D0CA 2RDXA 3L0NA 1JUEA 1YNPA 5C5YA 1QDSA 4RZBA 4JTCA 2ZYFA 1ITQA 3LCGA 3DENA 3EDKA 4O15A 1Q85A 4C6KA 4NL1A 4L9ZA 3NQBA 4DBEA 4GQQA 1R9ZA 3DC0A 2Z24A 1WCGA 3S2CA 4Z42C 2VTFA 1JRCA 2ZX5A 1XBZA 2OT0A 3B0VC 1LF1A 1QPOA 1XLCA 3S0CA 1BF6A 1K4GA 2W61A 3T8QA 3GBEA 3B0XA 2W62A 2F84A 1S2AA 1XPYA 3ARQA 4DZIA 3TCEA 1IHIA 2ACRA 4Y7EA 3C8NA 2XWEA 3KW3A 5CH9A 1OCQA 3N6HA 3TJXA 1QMLA 2PTDA 1FDZA 1JGMA 4ICCX 3QGVA 2PTXA 1ITXA 2Q6ZA 3ABOA 3KUMA 3M7WA 3H8AA 1TIWA 1FWAC 1A5OC 3WLIA 3T42A 3CV1A 4HK6A 3WH9A 1S3HA 2ZADA 3I68A 3O8AA 2QVHA 3O2LA 1JZ3A 4C6MA 3WK1A 3ZWSA 2WNWA 3EEZA 1HQTA 2E5DA 4OHQA 3EKGA 1E9ZB 3LLXA 4YTUA 5F7UA 3WMLA 1J0YA 1UKTA 4HT3A 1TMQA 2OSXA 3FVDA 4EPDC 2EHHA 4U3CA 2A85A 1E40A 2WJZA 5JIWA 1QUMA 2Z00A 4MFEA 3PAOA 3NFUA 4S2CA 5DCBA 4F0MA 2IXVA 4TIMA 1M65A 3EB4A 1XWYA 5TF0A 2PFHA 5I3JA 3UJFA 3REQA 4K2SA 4LWWA 2WVSA 1ZALA 1IEIA 3LY0A 1G7VA 2VOMA 3VGGA 4FO4A 4ZB0A 4LRTA 3N3MA 3FJNA 4HZMA 4OFCA 2RGMA 1LOSA 3GNRA 4URIA 3R8GA 4GQGA 3HIJA 5KSWA 3VPLA 3AUJA 2F8QA 1BYDA 5H8PA 2BZNA 1X8CA 1W0MA 1SW7A 3N18A 7XIMA 2CHRA 2QDDA 1CGUA 4W7VA 3GTFA 1UZHA 2Z2AA 4C6CA 1EDQA 4ROPA 1C8YA 1YBQA 3LTSA 2WB5A 5J8LA 4NF7A 3WQDA 1LROA 3INPA 2ZOXA 3OVQA 3WF4A 4P8WA 3C61A 1TYGA 1Q6GA 3UXLA 2WCAA 1DXFA 2GJRA 3PVFA 2Y70A 3WF1A 3WQ6A 3MI6A 4FX7A 2P76A 5D32A 5LZLA 1JAEA 1X6UA 1TELA 2XIBA 1C9WA 1E5JA 1W5MA 1ZP3A 4FLRA 3WK3A 4NZ3A 1AQHA 3PUOA 4FAMA 1J5SA 3DU0A 3MJYA 2FKPA 1JIBA 2WM1A 3L23A 1WZLA 1NFGA 1FTXA 2NWRA 1KNWA 2VI0A 4XK2A 5AN7A 3ME3A 3BE7A 4P8UA 1PYMA 4UQEA 3W1AA 4QITA 2JBMA 3ZSSA 1VRDA 3NQ7A 4S3BA 1OB0A 1IZJA 1DBTA 4DWSB 2E4TA 5FJPA 4IFRA 2NX3A 1HX0A 4O1AA 3STFA 4XBSA 4V28A 4DYJA 3P7YA 5E0KA 4K37A 2WSYA 2Y1HA 1E6NA 5CSUA 2E8YA 2VJXA 2Z1BA 2J47A 4C6BA 2V9DA 4JFVA 4GMEA 3BAWA 4XISA 5D9NA 2VEIA 4W85A 5H8UA 4H9MA 3EWBX 4WF7A 1CLVA 4RUBA 1JUKA 3DAQA 4Z17A 2W67A 1A5CA 2J8FA 2Q71A 3B9OA 3C0JA 4QDMA 1OSEA 3LV6A 2GQ9A 2J27A 6PTDA 5HQLA 2DQXA 3RAOA 2QIWA 3MB9A 4UFLA 4UFHA 2D24A 3SM0A 4QG8A 4KF1A 3WBWA 1C8QA 4MNLA 4WR3A 2C13A 4US6A 3M46A 4I9JA 3VXGA 6ENLA 1J2WA 3HM7A 4WQ6A 2PC4A 2HE8A 2HTMA 3WBYA 1KGUA 3ALFA 4ACYA 3WFLA 1IT8A 3QJAA 1OC5A 3WLHA 1W3KA 2WAGA 4HZ7A 3TW6A 1H3GA 4GVHA 3VGDA 4A35A 4YJ5A 1ZAHA 4GGBA 4HNLA 4P7RA 3BGJA 3BOLA 2BVTA 1CGTA 4GO8A 3C5QA 1P48A 2PGRA 3UZWA 1CXKA 1TQXA 1EA9C 3PY2A 3CLWA 2R24A 3PFMA 5A6BD 1QK2A 3GNXA 2ZA1A 2ZDRA 1RK6A 2BBFA 4KWUA 3ZYZA 3DFHA 1FCBA 1WAWA 1UZDA 4DIAA 5JIPA 1EWEA 4NXSA 3RMEA 1V4YA 4NKCA 4ERAA 3MUY1 1QPNA 2O7QA 4H6EA 1QNPA 4GC4A 4RNJA 2CBUA 4MYXA 1T99A 1Z41A 1UUQA 4CCZA 1DXIA 2X1TA 5CPTA 2BSLA 1VBUA 2W9MA 3UVAA 4NI3A 4WY0A 3G3DA 4JD4A 2E40A 3T08A 1AFSA 3HV8A 3KBJA 1M7OA 1SUXA 1C29A 1VHNA 4BEUA 3O0KA 3WBAA 3T0AA 2E67A 2F9RA 5FF2A 4HN4A 1D7KA 1KTCA 3M5YA 2PZ0A 4HK5A 4LJ3A 1G01A 2WWDA 2CW6A 2GL5A 1K6WA 1KLYA 1GOOA 1VHCA 4QX4A 5EU9A 1DP0A 3AMDA 4IFKB 1K7EA 2V67A 3WH8A 2GLKA 3GTIA 2J24A 3FXGA 1B57A 2C1IA 5E6YA 1LWHA 3VIGA 1C8VA 2VNCA 4J5NA 4Q6XA 3T2QA 2O4QA 3COTA 1SFTA 4PRRA 3A3WA 2PEVA 2D23A 1IR1A 4NVTA 2WKLA 3M0LA 5F2IA 5A6LA 3ERPA 1V0KA 5F2GA 1QI0A 4R9XA 3PZUA 2B7NA 2BY1A 1EA0A 1PYFA 5EMUA 1FWEC 1NWUA 3W07A 1Q6CA 4JYDA 2PDGA 1K70A 3OVPA 3TR9A 3RPTA 3UETA 1UUMA 3WJWA 2ZRVA 3DFYA 2OMAA 1A0EA 4W8BA 3WLNA 1UYQA 4L9XA 4IF2A 4KQNA 5LNSA 4WOQA 1QI3A 4DNHA 5K9CA 3B9AA 4MMWA 3KHDA 4OQVA 4GYFA 3N19B 4WJXA 3W7RA 3STPA 1C7SA 4HPXA 3M0XA 3OODA 4X0NA 3G1AA 4OUIA 4PMDA 1Z89A 2FB3A 4A21A 2OWCA 3AMLA 3RPMA 1ENUA 1E51A 1MXDA 1V03A 4R5EA 3NQFA 4XD6A 2POZA 2PI6A 5F4XA 5FF4A 1UR4A 4N9CA 1E6SM 1LCOA 1J6OA 4XO6A 4D2JA 4HU3A 3THDA 3WCZA 3NZQA 3AXXA 1CXLA 5L9FA 1GZ1A 2YXXA 4JZ5A 3MY9A 4WY0F 3PTQA 3CIVA 4DZ5A 4WUIA 2OELA 1F6YA 2B0MA 2ZBTA 2GWGA 2OKTA 3W37A 1OJXA 2DZSA 1RPKA 3KE0A 3K2GA 1YW1A 5LXEA 5AVHA 1SSGA 1XC4A 2BDQA 2I17A 3P5YA 4RLIA 5MKGB 1LRTA 2QCDB 1J96A 4C1NA 4QROA 1A50A 3AMCA 4PBEA 2TMDA 2R1NA 1J0ZA 1H5VA 1FBAA 3H2NA 4G2DA 4A8NA 3PPCA 3KVJA 1X7IA 1R3QA 2F2KA 1AQ0A 4CN4A 3QBUA 4G7EA 1HJQA 2OPJA 5LIWX 4PE8A 1JDAA 3STEA 3NCOA 5AHFA 4J3ZA 3LPGA 2QDEA 3QOKA 1HZYA 4D1IA 4UTMA 2BVDA 4LALA 3A47A 2NXHA 1M01A 4Q4OA 2GUBA 2BOGX 4IT1A 1AZ1A 3TN5A 3SUTA 3N25A 1J0JA 4UQDA 2Y0FA 4Q6JA 5FAGA 3B97A 1FFQA 3KHJA 4WXYA 3GY1A 3QHOA 4PUWA 4JYEA 4QAIA 4V27A 5XIMA 4NAEA 4JTIA 3PG8A 1QTWA 3WMBA 3FYOA 1I2OA 5A8OA 5A6KA 3UPMA 4BR1A 3R5EA 2WC3A 3MSGA 4BJHA 3Q37A 3I65A 1XYMA 3WUBA 4NNCA 2OSYA 3DFNA 2VC9A 3P14A 1P7TB 3QV8A 1R8LA 1L8PA 3GVQA 1DWFM 2ZZ4A 1RVGA 3BOXA 1EGZA 3APGA 5F2LA 3DBNA 1Q6FA 2E25A 2HQAA 1T8QA 1U2YA 1L2UA 5CEWA 1U1UA 2QW5A 1WXJA 3C0LA 3NQGA 4MTVA 1ISYA 4IGNA 4E0CA 1VYPX 5ABFA 5H1WA 2YCJA 6TAAA 3R25A 1YDVA 5LHEA 3CL8A 3UPWA 5G1TA 4XAFA 5CPOA 3UT0A 1B3XA 4IQJA 1S39A 3ZSTA 4AQLA 2D1ZA 3JW7A 5FF3A 2D0GA 4EACA 1SZNA 3LG3A 1H7XA 3U48A 5I3FA 3VOCA 3EWWA 4NQ1A 1W2VA 2PDCA 3LHZA 3NQAA 3QMRA 4F2TA 1JZ7A 4H9YA 4IX0A 6TIMA 3L4YA 2V3EA 3WUEA 1W9PA 2HWGA 1MZHA 4FP1A 3C2OA 3EWDA 5HR6A 4TX8A 3PFRA 1ONRA 1WB0A 4TQTA 3V36A 1HJUA 3GSMA 4GI8A 2D2GA 3KVMA 5CC6A 1KRBC 1R3RA 1JCJA 5CG7A 4H2HA 4OU1A 5C9UA 4AXNA 3MYPA 4CNSA 1XSJA 4DJFC 3LNPA 1B1YA 3NDZA 4FLOA 2RH9A 2ZQ0A 5K4ZA 4IPIA 1EL3A 3W2KA 1XIJA 4AC7C 1XGEA 3PUGA 4IZGA 1JDEA 4KT2A 3N4FA 2VX7A 1J9YA 3AIRA 5A2AA 5CLWA 2Y7EA 3PPFA 4AWUA 2FMOA 2FZMA 2BFGA 3O0FA 3IAQA 5G4WA 1E0XA 1WQ5A 1JPHA 5FACA 3NGFA 4LAUA 4K39A 4DQWA 1RBAA 5FJRA 3CV6A 3N11A 4YYFA 2VR4A 2ZE3A 3N2CA 3Q67A 4IJRA 1LM1A 1TE1A 3DHFA 2CKRA 1RCOB 4PTWA 1B90A 2E6DA 3NL6A 4W89A 2PWEA 3PWIA 3SURA 1J12A 3NWRA 3GTHA 4JFWA 1W1TA 1JL8A 2G37A 1VCGA 2FZ8A 2ZX8A 2WVTA 3V16A 2VCBA 1NDYA 3ABSA 1TV5A 3GR7A 4L5ZA 4EF8A 4NIRA 3W23A 2BVWA 5I07A 2XWDA 1JXJA 4UNKA 5D9MA 1O4UA 4XKYB 7ENLA 1OHLA 2VUYA 2Q09A 5C7VA 4GVFA 4FNPA 1KBLA 4LBUA 1V3IA 1LQ2A 1W3TA 2H3BA 4DYKA 3BGAA 2ZZ1A 4E2VA 3SSZA 4RZ6A 3AS2A 3BSHA 1QNOA 2HVMA 1PX4A 2OJPA 1LRNA 2Q3OA 3TJLA 2XINA 2D22A 3LM3A 5JMUA 2INEA 1VEMA 4X2RA 3CWHA 3UBPC 2JKPA 4RW5A 4D72A 3OLEA 3KLLA 1VR6A 2Y88A 3SCNA 3ITGA 3TJIA 1ZAIA 1A47A 1V51A 1L6FA 3VKKA 1GORA 2EG7A 4L4OA 4NXKA 4GY7A 3TFCA 1W5QA 2DJLA 3AYRA 2XGBA 1MW2A 1XLJA 4GUGA 3FGCA 4AD5A 2DV0A 2CPUA 3QM3A 3TTYA 4GYKA 4B5UA 1VPXA 1OCJA 4C6NA 1EX5A 4KRZA 2W5FA 3PB0A 1HVXA 4AMAA 3BW3A 3CUFA 2ICSA 2VRJA 2BXVA 3W26A 1ZRQA 2C19A 1U83A 1M04A 4FOJA 1EHAA 2CLLA 4GUJA 1JR1A 2JKEA 1PPIA 4RDWA 1XRTA 3UWVA 1EP3A 1VCVA 1CNVA 1GG0A 2CZFA 1B2YA 3UY8A 4PA8A 5FAJA 1PWMA 1UBPC 1VPQA 1UQZA 2J8GA 1CGVA 4G1NA 2OYKA 4AWEA 2FGZA 4QIUA 4WDWA 4BWLA 2E6AA 1K8ZA 2JGYA 1I2RA 3QF0A 2QUMA 1PZ3A 3EA3A 2ZUSA 3UZ5A 3C3NA 5AB3A 1GQLA 3UGVA 2WZHA 1GJWA 3E2SA 3G0SA 3R11A 3VX0A 1JF6A 1E72M 1B4EA 3N4AA 4ZMGA 3IARA 4Z1AA 4M3PA 3GU1A 3LPOA 2J13A 5IBXA 3H12A 4MWAD 1XBYA 3EOOA 3HQ1A 3P67A 3IUDA 3PM6A 1H1ZA 2D20A 4DVOA 1DQUA 4CQ8A 4UTTA 5I09A 4MUZA 2DH3A 2JKAA 3B8WA 5LXXA 1VENA 4AISA 5HANA 4O0KA 2I9EA 4FXSA 5IHSA 5C2CA 1HXJA 4LS1A 3H7RA 3I6RA 4Q33A 2ZXAA 2ZDSA 4IPJA 3QQ0A 2PA6A 5AYXA 3RO6A 4JY8A 3OEXA 2QEZA 4L1XA 4IICA 1XCXA 2YBVA 1EEXA 3PTDA 5D4YA 1R2RA 1N8FA 1P1XA 4DBSA 1HJXA 3H2EA 2JFEX 1H7OA 1OX5A 1CWYA 3HPZA 2FFIA 3W75A 3WLRA 5M1TA 5CGMA 3V0SA 2VD8A 5C55A 2GDUA 1Q8AA 3FIGA 5FEXA 4R33A 1MW1A 3UESA 3G0UA 5IHRA 1GOKA 4JY9A 3CL7A 4KCTA 5B80A 4PUUA 1KM3A 3WLLA 1LT7A 3VGFA 3OZMA 3MKVA 4HNOA 5BCAA 2CLKA 1O5RA 1T41A 1KGWA 2YYUA 1DHKA 2WCGA 3PANA 4RW3A 1VFTA 1I1WA 3B8DA 3MWCA 3IAPA 1IIHA 3H4WA 1CIUA 2CZDA 2VFGA 1EH9A 5K3VA 4C7FA 1Q7QA 3THUA 2BHUA 2TYSA 4WHBA 3GW3A 1ZS2A 3EMCA 3P80A 2O4MA 4DO7A 2Y5EA 2ZZ2A 1SU5A 2DZTA 1PXGA 1UH2A 2EPKX 3H2FA 2B7OA 3BLIA 1VPYA 3AHVA 4MIMA 3W28A 4DUXA 3W2JA 2OYMA 2FMNA 5HWMA 3L2LA 5IM51 4HNNA 2R1MA 4GJJA 1F8MA 5AC6A 2Y8UA 2EO7A 4LUYA 4XB3A 4O52A 2VFIA 3NPUA 3PAJA 2OZ3A 3T09A 4L6OA 1IEVA 2BY0A 4I5XA 2DSWA 1Q3NA 2H9AB 3N17A 3DG6A 3ZO9A 1H11A 3KOFA 1KRAC 1IV8A 5BRBA 4H19A 3WEMA 3EDEA 4FXRA 1JPKA 1V8EA 3N2TA 2XVNA 1XXXA 1GHSA 3RM8A 1Y0EA 3E2VA 2C7FA 7A3HA 2VOTA 4DAIA 3PG9A 5FJTA 2V68A 2HMCA 1OFBA 2NLIA 5A1AA 1A4MA 4LAZA 1R2SA 4IIDA 1N7KA 5BXRA 3HG2A 4AZ6A 3FJ6A 1LUCB 4HTBA 4RK8A 3AYSA 3AS3A 4FNSA 3PPHA 4OBSA 3NL2A 3VM7A 3V5FA 4O50A 4GKLA 4L7ZA 4UQAA 3QTPA 2E1WA 2OEMA 3EOUA 1XCFA 5DMMA 3MV11 1MW0A 3CH9A 4LY4A 1ZGDA 4H9TA 3URBA 1HKIA 4KW2A 4OTKA 3R94A 5A95A 3NSMA 3HQPA 4PSPA 5JH2A 3FYPA 1XYAA 4D6CA 3AXMA 3CHFA 4G6CA 1H1YA 2CKSA 2PRHA 4P7OA 4S3DA 3NQMA 4IXHA 1XH2A 3TNOA 4CU8A 1H7PA 5C0QA 3DYOA 1E1EA 1YQ2A 4JKMA 1QO5A 4PSRA 3M64A 3M4HA 3CQKA 3M0JA 3SEPA 1WXYA 3CV7A 1SPQA 2IXUA 1XKJA 3TC3A 4NNBA 1XBVA 4H3DA 2MANA 4UTWA 2ZA2A 4RE0A 2YPIA 3BANA 5K9DA 1AVAA 4EAMA 3OQ8A 5CPLA 3Q65A 4EF9A 3DESA 2A7NA 3L68A 4PYSA 1J18A 1P1MA 3AIEA 4GHRA 2UY3A 5AHIA 2E9MA 1RLDA 4KERA 3L4VA 5LKYA 4AZ5A 1DJGA 3F7JA 4AHQA 1LL4A 3SFKA 2X05A 4ZQCA 5LNVA 2YDSA 1EXBA 1QPRA 3MDWA 4ZB2A 4DLMA 5C9WA 1M7JA 1UJPA 2WSKA 4UZUA 3TX9A 3HGJA 4TTGA 5LNRA 3GZAA 1HG3A 3AXHA 1F61A 5K7JA 2WXDM 1LBLA 1TRDA 2VZSA 3PSWA 2JALA 2OZ0A 4P61A 4MJ4A 4QSHA 2HROA 5HULA 4LTSA 4PTXA 4I5RA 6REQB 1EUNA 3SN4A 2X0HA 1HL8A 5IDIA 2PDFA 4OUEA 4GIAA 5FL1A 4PGLA 3UY7A 3GO2A 3QRHA 1R3TA 3SUWA 3I4EA 2DFAA 3H23A 3TTEA 1NDWA 3U2OA 2ZZ3A 3PUDA 4LRSA 3VCCA 2CBIA 2PS2A 3W53A 1W1PA 4AW7A 1CB2A 1YXYA 3GH5A 1L0PA 1PCWA 2YIHA 2ISWA 3CMGA 4WIWA 5CCZA 2BLEA 4W7WA 3L4TA 1F07A 4HCDA 1M53A 4QXIA 3SN0A 2FTYA 1E70M 3MVIA 4H6QA 3BK0A 3G24A 3GU2A 1E55A 4UOQA 3LHWA 5GNXA 2ZRUA 2C16A 3OHMB 1E1CB 4GOAA 2BNJA 3HA1A 1H60A 4PUEA 4FZIA 1WE5A 4XZWA 3LOTA 4E5TA 5D9OA 4K36A 4JNMA 1RH9A 4PCPA 4EAYA 3AZSA 3H55A 4DJEA 5LNWA 3BICA 1PBGA 3TYEA 1UASA 5TNVA 1DPMA 1GVYA 3VA8A 1V93A 4CQ9A 4GJIA 1AJ2A 1UROA 3OB8A 4WXZA 1PHWA 3U0HA 3GHUA 5C70A 3VOGA 3HFTA 1JD9A 2GGJA 4PRWA 2E68A 2QGYA 5AFDA 8RUCA 1UKOA 1BSLA 1KM4A 4IJCA 1XD1A 2VZUA 1BPLB 3N6QA 4FXJA 1RXOB 4BZYA 1PS9A 4O13A 1ZPTA 3QPYA 3M07A 4O16A 1JZ4A 1S3TC 2I9UA 2R1LA 2WMJA 4Y2WA 2GVGA 1V6VA 2CYGA 3BLDA 1BTMA 3VNIA 4UTFA 2YB1A 2PLMA 2PGWA 2V30A 1XINA 4D6GA 3VTRA 1Z9AA 3RHGA 1FX6A 4NZJA 3WYZA 1ZBKA 1XLIA 3QV6A 3TAOA 4XZIA 4FS9A 3MP3A 2AAMA 4J7RA 4NZFA 3W74A 1J8VA 3NYDA 3A4WA 2IQ0A 2WLZA 2FVLA 2XN2A 1E43A 3CNYA 4ICMA 3M6YA 2VKZG 3USBA 2PLJA 1LWJA 4NG3A 1E4LA 1QWKA 3BMVA 3SBFA 4AU0A 1UWIA 1P43A 1ELSA 1DWGM 4MG4A 5LIUX 3WH7A 1OFQA 4H8VA 1B9BA 1XLDA 1ECEA 1P7TA 4GFIA 3CC1A 5CSRA 2VZVA 1KBBA 1XLEA 3KRSA 4DJED 3V1HA 3NZGA 3O05A 3AIWA 4JTFA 4H83A 5CZKA 2YZRA 3KS6A 3RCNA 3NURA 3FEMA 2YDAA 3NEHA 3WUFA 3SY8A 4RE4A 3KL5A 3GU9A 3ARUA 3NPWA 4IHCA 4UFIA 5AYBA 3L66A 4AMCA 5D02A 3LERA 3AICA 3IK2A 4NY2A 1QPQA 5CLTA 3D47A 1ZFJA 5HJXA 2ABAA 3PS7A 2OKOA 5I02A 4S3AA 4ZBCA 3DOPA 2P0OA 4FSAA 1XRSA 3PJXA 4N6FA 4J3VA 4AIEA 3O07A 3IIVA 4ZE5A 3EDJA 2ZRZA 4AYGA 2JIWA 3DC8A 1P0EA 3HV9A 3WJYA 1C3FA 1Q66A 1H0IA 1VYRA 5AC4A 4F48A 4FR6A 1TUFA 2VFFA 4GPNA 1KTBA 4XO7A 3SCQA 3OLIA 1SR9A 2V5CA 2V5JA 3PZQA 3W1QA 4WDTA 4X61A 1EO7A 3AIVA 2FYMA 1TIMA 3VZYA 7REQB 1HNYA 1F2JA 4ZSUA 1DJYA 4C5YA 3MSDA 2OEKA 3EKLA 1HKJA 3LBCA 3AHXA 4EP8C 3BMWA 2Z1XA 1J79A 3W7MA 3GXPA 3CZJA 1R3VA 2J7GA 3BV7A 4GZJA 3GQYA 4CLMA 3Q45A 3PZMA 3EDFA 4CCEA 3TH6A 3GUWA 4R7JA 4X60A 4AHOA 1K7XA 2VMFA 3CMJA 4IMAA 1ZY9A 5I6SA 4ZTYA 2W27A 3PWGA 2GQ3A 4TUFA 4H2CA 3W1RA 3H6OA 1FH9A 4XQ6A 1HTIA 1Q45A 1SO4A 3PR2A 4GUIA 4HHLA 3W7KA 2VL4A 4MAVA 4MZYA 3F5KA 3TMQA 1GW9A 5T26A 4UNIA 3PZGA 3PWAA 1ISZA 1EPXA 4JN6A 4ES4A 1FCQA 5ENLA 3AXKA 4XZLX 5GJMA 2FZDA 4W86A 4IMGA 3FS2A 4L61A 3RCYA 1I60A 5CBIA 1TV4A 1S2UA 3GDLA 5HATA 4EE9A 4X9SA 2QIIA 3GVWA 2GVYA 1PO9A 1JCLA 3ITXA 4Q8OA 3KS5A 2E6YA 2VCAA 1KM5A 2ZXBA 5BU6A 4XKYA 1OFAA 3W70A 4IG2A 1GVIA 1W91A 9XIAA 3EDDA 4I6KA 4JNYA 2QNEA 1MXGA 4QEHA 2GJPA 5D2TA 3BAXA 5BZAA 3BTNA 3N29A 4UNLA 3GIQA 1RBOB 3N1AA 4IGMA 2FGBA 1KM2A 3UJSA 3AHZA 3B4YA 4ZQOA 3KFTA 3ICJA 4H7ZA 3QGKC 3OBAA 3UWUA 3E0WA 4WX2A 5E93A 3EYPA 1DWHM 1V3HA 2OO6A 1PAMA 4KIEA 5JXQA 3T8LA 3GHTA 1RALA 4I9MA 3G5EA 2PDQA 5LGZA 1FRBA 2DVXA 3T1GA 3U4FA 2PUZA 1TPEA 4TVUA 1MDRA 3R6IA 1VBHA 3IGSA 3OGVA 4R3UA 3KCOA 1E71M 1J01A 4Q4KA 3W83A 4D6JA 4NJJA 1GK8A 1H61A 4CU7A 3VNLA 4I8DA 3VFCA 2OX4A 8A3HA 4QSFA 3W1TA 1JDCA 3R0DA 4GH3A 4H6KA 1ALDA 1IR2A 1ODZA 1R47A 1VFMA 1W37A 3NZ1A 1KWKA 1KM6A 3TONA 3LYEA 3WLPA 3T44A 2QGHA 2OOFA 1U1HA 3R2GA 3NVTA 6ALDA 1QNVA 3R4IA 2WM0A 2DZXA 1TVLA 2JF7A 4ZEPA 3L65A 3I10A 2NT1A 3CS2A 2HV5A 3KZSA 3UCDA 3UWWA 1UH3A 3AQUA 4GCAA 5BMWA 1DJXA 3OIXA 4M1BA 2W6RA 4JQ1A 5F1VA 4TMCA 1DTUA 3AOFA 1K77A 4X0VA 1DJNA 2XPKA 2PU0A 4HA1A 3GAYA 3T0TA 4YLWA 1N55A 4MDOA 1CPUA 3I6TA 2VRKA 3O06A 1WDPA 2EQDA 4JTQA 4L1GA 3VM5A 3BQ6A 4Y8EA 1EP2A 5G4EA 5FESA 1O60A 3QSTA 3MMUA 1O66A 4S3FA 4ROQA 2RGLA 3EXTA 3WEZA 2QULA 3MCMA 3ZLFA 1JJKA 5I3KA 1SFSA 2QUNA 3VK5A 5C2XA 2WNQA 1DE5A 9CGTA 3GC2A 1NIUA 3IJ7A 4IXXA 1Z8AA 4R34A 4LB4A 5HPCA 1MVYA 2BY2A 4IQLA 1VAHA 1VBJA 2IQDA 1B30A 3N4EA 1J4EA 4BFAA 5IFPA 4PMRA 1FWWA 2OVLA 4JTGA 4W7UA 1XIDA 3CUJA 2UY5A 2XTKA 3F03K 2QPSA 1MDLA 4DF2A 1V3JA 5DN1A 4AD0A 4JAWA 4C6JA 1DYSA 3SIZA 3BLFA 2J66A 4UCFA 4IL0A 3V5CA 3P74A 3UWZA 4PRTA 1XLLA 2WBGA 2ANUA 3WQ8A 5CC3A 4S3GA 1TVPA 2XH0A 4JX6A 2EJAA 1WKFA 4US5A 1OT1A 4LX4A 1RLCL 5FCZA 5D2YA 2PF0A 3RFAA 3K8MA 1P0DA 1VBRA 2Z4GA 2D3NA 4PB4A 4JR5A 4WDXA 3UCQA 3CEUA 5LA1A 2X1RA 4UUIA 3GE7A 5CAKA 1P0NA 4YPJA 4PTVA 4FR1A 3W25A 1G7UA 2WYSA 2GDQA 4H8NA 4ZXOA 1WV2A 4W4QA 3IIPA 3EOSA 4XWUA 3S5ZA 2A4AA 5B7YA 5HPOA 2OLHA 4NJGA 3D3AA 2CWNA 3ZJ7A 4UB9A 2HBVA 1UIPA 1EYWA 1SJCA 3M16A 4UTLA 3S2NA 1MEWA 1OFOA 1PTAA 4TU1A 3I7SA 2H9AA 1TG7A 1ICQA 2FVKA 1WPCA 4D1JA 1Q65A 3C52A 4GQRA 1EPVA 1GGOA 1R9XA 4ZENA 5D03A 4UTJA 1KR1A 2O9TA 4D6DA 2YCLB 4WSKA 3W4RA 1BXCA 2DT3A 1CYGA 2BY3A 4HD5A 5FEPA 3QH2A 3SQMA 4FNQA 4M8UA 3M9YA 4GYPA 1Q6DA 4GIEA 1DIOA 1F6PA 3U7BA 1OZMA 1DJWA 3S1WA 8XIAA 1WAUA 1H51A 1X7FA 1PHQA 5IRPA 3OQEA 2FVMA 1YIXA 2ATSA 4JTLA 4IQDA 4F9DA 1Q6LA 3IK4A 5EBUA 1RJRA 1R38A 3LMYA 4HA0A 3KTSA 1FDYA 1X1OA 2EKCA 1G1YA 2V2CA 1BYCA 2Y7FA 1RD5A 5EB8A 4LVGA 4B92A 3VNYA 1QAPA 1TMLA 5CXPA 1HL9A 4BKNA 1QVBA 1OGSA 1EWDA 5I79A 4YNGA 2FPTA 2EBNA 1U5VA 1TKKA 3RU8X 4GWEA 1GEQA 3A13A 2GZXA 4OV9A 3LQGA 4HJWA 5H2ZA 1UR1A 3M5XA 1W9VA 3RU6A 4HA4A 3C0QA 2V2HA 3NQ6A 3UVIA 3W7IA 4AWSA 2VCCA 3SY1A 1FWHC 4LUTB 4F79A 4Q8QA 1Q6RA 3W82A 2KX9A 2DY3A 2HXTA 2O9PA 3BQ5A 4G7FA 3WBEA 4IFOA 3BGGA 1LLWA 4YIWA 1XDMA 2O92A 1XQLA 1GOMA 1YTKA 1GVEA 3UA3A 4TVCA 3VOHA 5A6MA 3N14A 4TO8A 1KRMA 2OTDA 4H41A 3URQA 4GI6A 2PDXA 3GDTA 4FNTA 3I7QA 5C71A 2UY2A 4FMVA 4ALDA 4LV4A 5BYWA 5HQMA 4MB3A 3I4KA 6XIMA 1GJPA 1CXFA 3HQOA 1XSKA 4HU4A 4M5PA 4ZQNA 4DUVA 3U2ZA 3USZA 4U10A 3LTPA 1P6CA 3LXCA 2NUYA 2Q8ZA 2WZEA 2QDGA 1V0NA 4E4UA 1XISA 3LCXA 3R79A 1J5TA 2NQ5A 5BNKA 3NZRA 1E6PA 3W7CA 3F4NA 3G2GA 3ANYA 4IUGA 5DFAA 4HOZA 2POTA 6REQA 3SI9A 1VLIA 3F1QA 2IMRA 4HMNA 4HJFA 3TVAA 4IPNB 1F3XA 1CDGA 4M6PA 5EMMA 3A5VA 4WSHA 1S1PA 1M03A 1TPVA 3O7UA 4K8EA 2Z28A 4QDWA 4CQCA 4AF0B 4ATLA 1YXDA 1G94A 4A8LA 1GJUA 1RZMA 3KL3A 3M0HA 5KITA 2BOFX 3IWPA 4I90A 3PTMA 3CIXA 2A2IA 1RQHA 4S3EA 5HNUA 4HNVA 4HHHA 2QJHA 1GHRA 2DIKA 1WDDA 2EPOA 4XTIA 4O11A 1JD7A 3GDKA 3M0VA 4GK8A 2D73A 4KETA 4REQA 1FWTA 3TK7A 1QW8A 1S2WA 1FXPA 3QFEA 1W32A 4W8AA 4F2UA 2PURA 4G9PA 1VC4A 3EPOA 4N4QA 3N04A 3G1VA 1FWJC 2BP1A 2WZTA 3W2UA 3PF3A 1EZWA 4E8DA 1NARA 4OZOA 5DANA 1FWBC 3M0MA 1AH0A 4LGXA 2A79A 4B90A 4FK9A 3SCTA 5GQBA 3ZS4A 3JZUA 5BXSA 1QNQA 2HDJA 3CWOX 2PDKA 4JGDA 4DJDD 1KW1A 2WHJA 1QPKA 1XG4A 1PVNA 1LL6A 2VEFA 1DWIM 1GVOA 4HZ6A 1V6YA 4MPQA 3MP4A 3W88A 3W1LA 5EMJA 1KO0A 2E8ZA 1RD6A 1J10A 2Y5JA 4O1CA 1RAKA 1H50A 1Z6KA 5D37A 1RVKA 3QQWA 5A5WA 3QY8A 1QOPA 3TWBA 2OU4A 1YEYA 3DCPA 4YVPA 3P93A 1FWDC 4GD0A 3HB9A 1RBLA 2YOCA 2WOQA 3MMDA 3ZLGA 1JCMP 3MPGA 5BWAA 3FEQA 3KBNA 4IL2A 2WMIB 3E6EA 3E3HA 4DUWA 3H54A 1OABA 4OECA 5DO8A 2HVOA 3G1HA 4OOZA 1BRLB 2VR2A 2XN1A 4HVXA 3DG3A 1XGZA 1P0BA 1KM1A 4KEUA 4AZIA 2XIMA 2PB1A 4XG1A 4Z1DA 2WZMA 2FDMA 1A3XA 1TPB1 3ENLA 2PDHA 4WZHA 1MUWA 4LUJA 4MWAE 1MSSA 3A64A 4IQEA 3KM8A 3XINA 4Y8FA 3CV2A 2X0SA 2YKKA 4ZCWA 1QRQA 3GX9A 2GOKA 4MLJA 2PDLA 3OPSA 4AXKA 2C79A 2DZBA 2O55A 1VKFA 4P8XA 4FA3A 3WD3A 2DZWA 1ZZMA 3BC9A 4LVAA 1R30A 4Z1CA 4GVGA 1IWBA 2FFCA 4JTRA 4MWAC 2GK1A 4O17A 2VXNA 4I8YA 1GPWA 4EPKA 3DEQA 1BLIA 4N9DA 4HPNA 4D8ZA 3I6EA 4DF0A 1TPUA 3ZIZA 1GVFA 4IIBA 2TSYA 5F4WA 4KWSA 5I23A 3V7PA 3OP2A 4ZL1A 5F1UA 5A3HA 5A8NA 1QATA 1GQKA 3SGZA 1WOBA 1REQA 4JIPA 3O1NA 1SJBA 2EF9A 3NNTA 1YYAA 2PWHA 4KFPA 2DORA 1KXQA 1Z44A 3POHA 5EFDA 1MXSA 3IIOA 4B5SA 1WO2A 3P84A 2AGTA 3YPIA 3W1XA 3I3BA 1X8FA 4ERIA 4JIIX 1QOXA 2E1DA 2P3EA 2RHGA 4I7WA 1JDDA 3RPDA 3CO4A 3SCRA 3NAVA 3WQFA 3CAQA 1XRVA 3W7LA 3CAWA 1IXOA 5CC7A 1LP6A 1E56A 5JBFA 4IJBA 4CNTA 3E1F1 5EA9A 3H2CA 3BAIA 5U4NA 3OA5A 5T91A 5ECUA 3L0GA 4MF4A 4FB7A 4KWOA 4W9TA 3M44A 2X7VA 4C90A 1S5TA 3IRSA 1Y5WA 2PCEA 4A3YA 3ZJ6A 4C6DA 1LG2A 4HGXA 5HQEA 2AGKA 3UR8A 3QY6A 3WDIA 4A6GA 1D3HA 2O56A 3T07A 2QQ6A 3CGTA 3VDGA 4C6OA 4E4FA 5HNTA 3EOEA 1EP1A 3ITLA 3CAVA 4QEEA 3PZOA 1ONEA 2NVCA 1AH3A 1EJSC 2EAWA 3S46A 4GYJA 4O19A 3TROA 1XI3A 4S1FA 2OQHA 2EJ1A 3PBYA 3S83A 3E2RA 5BOOA 3TKFA 4U3AA 3QSRA 3WD4A 1LG1A 4QBXA 4C6IA 3VI2A 1T0OA 2B4GA 2YW4A 5CJ5A 3O16A 3IEBA 1PIGA 4JN7A 3LI1A 1M6JA 1L6WA 2P0IA 3K8LA 3WQ4A 2B31A 5G2HA 1ZCCA 1MFVA 4QP0A 3SGGA 3IGHX 4O28A 2WBKA 1Y7VA 5GPRA 1YNYA 4MZ1A 2JE8A 2DT1A 4FALA 2VFHA 3WF2A 1GZJA 4NILA 2QR6A 4GACA 2CITA 4X22A 1VJSA 1XG3A 4GGHA 1JI2A 2PBGA 1R2TA 5FEWA 1I8JA 1OGBA 1UWRA 2PU1A 2YBUA 2PDBA 1EGVA 1R6WA 3BH4A 4IMEA 3TSMA 5A8MA 4EXBA 3WX7A 1JNEA 1PCKA 3UG3A 5LIXX 1EJRC 1G67A 1Q7ZA 2FIQA 1UA7A 4CN1A 4JTTA 3R0UA 3VIFA 4RNFA 4U2YA 3BLOA 3TN4A 2DW7A 3BW4A 5FSEC 5A6TC 3QQ1A 3TN6A 1US2A 2OOGA 3O6DA 3ES8A 3AZTA 3NSXA 1HN1A 1E5NA 3MA8A 3UWQA 2DT2A 4J3UA 1GPFA 4GQBA 1HF6A 2HS8A 4YCOA 4BS0A 2ODOA 3O63A 3WK0A 1G4EA 1IWPA 3BZJA 3LHUA 3C3UA 3KBSA 3E0VA 4B3KA 1THFD 4O0QA 1BG4A 1ZUAX 3W7DA 2G4JA 3SO7A 2E9BA 3JZEA 4J2MA 3CXOA 2OO0A 3LV5A 1TSIA 1L6SA 1KXVA 3CLMA 1GYLA 2C1HA 4D6IA 6A3HA 1TJ1A 4MFDA 1MNSA 3ITTA 4DO4A 3VYLA 2ZE0A 2XGZA 3CUXA 1RQEA 4J3WA 4F2BA 3B8UA 4NRRA 2G3IA 4HB7A 1XIHA 4AWTA 4Y9PA 2H8ZA 4XIAA 3GS6A 2Y8KA 4ZA0A 3LD5A 3Q4DA 1R7OA 3NO5A 3BPWA 3NM3A 2QKFA 1KM0A 2YDRA 4H8HA 4PCNA 3OVRA 4V33A 4AZBA 1TJPA 4YHGA 4EK7A 1Y5XA 4GZ7A 1TPWA 3LA4A 2W66A 2VWSA 1JZ2A 3MSYA 4EPEC 4A2SA 2EPNA 1W3NA 3VKDA 1EJXC 2A3LA 4K8HA 4QDPA 3K13A 3RLGA 3DXIA 1TJ0A 3T6CA 1P0KA 2D2OA 3PP7A 4Q7IA 1H49A 4F3HA 2DJXA 1OGGA 1G9HA 4M29A 3LPFA 2QCLA 3U5YA 4C7DA 1XIEA 5HJYA 3PULA 4PMJA 1P6BA 4MB5A 5D2WA 1TV7A 5I7GA 4YTQA 2C14A 5E9XA 1NQKA 3B9DA 3LS9A 1LTDA 1IQ8A 4BI7A 1KKOA 2J7HA 2F6XA 2XVGA 3LCHA 3V18A 1QI4A 4MKVA 3UJ2A 4XSMA 4KFOA 2DZVA 2A3EA 4QNWA 3OZYA 4BQ2A 2E3ZA 2REQB 4W5ZA 2O9RA 2L5HA 2X0YA 1JYXA 1EJWC 2Z25A 1SO3A 5REQB 1PEZA 3IJDA 1TX0A 1TA3B 2EG8A 4CD4A 4E2BA 4IIFA 1QI2A 1ECQA 2C71A 1OX4B 3PK7A 3GKFA 4JOMA 3ZVHB 4UMBA 3W38A 3WLTA 4QRNA 2X1UA 3NL3A 2V3DA 1IGSA 1NOFA 4YXGA 1V77A 1E3XA 3WQEA 4HYWA 4JN8A 3ZXWA 3CM4A 2HVNA 1XHGA 2DIJA 4NI8A 2YCIX 4ATDA 2PWFA 1GQJA 4NUWA 2EPLX 2J25A 5TD4A 1TPH1 1AQMA 3LZ3A 3DUGA 5AYZA 1W9UA 4ORIA 1TWDA 3TOYA 1Q4WA 2VX4A 1M9HA 1K9FA 3L4UA 2HPMA 2OT1A 2WJFA 3K1DA 4U28A 3T4WA 4WKAA 3I7RA 3UG8A 4UR8A 3M47A 4KIRA 3TQKA 4DF1A 1Z32X 1ZNNA 2Y4SA 3B9EA 3K30A 3KDNA 3O9NA 2ZUWA 3E5PA 3GFYA 1JXKA 4CNNA 3BAKA 3QLDA 3PBWA 1QFEA 3T0BA 1RJQA 4YL2A 4Z08A 4LVBA 4YWIA 5TAOA 2OYLA 3PZIA 2XFRA 4JFSA 1Z69A 3HPSA 1DVJA 2JK2A 3VE7A 5CSYA 4JEJA 3BV4A 3ID7A 1BWVA 1KFJA 2DEPA 4JFTA 1E9LA 5G1MA 3OHIA 1XL9A 4CCDA 1A0CA 2BMBA 2ISSA 2WHKA 3TNBA 1WDQA 4GBDA 4IGHA 4Q8NA 1UP2A 1IT7A 5EMLA 5DT5A 4JXCA 4AZCA 5HUOA 4O54A 1V7YA 3B4UA 1UQYA 3A4AA 4AYSA 4CQBA 3WZ0E 3C4UA 1KCLA 2ZXQA 2J4GA 1Q2RA 3H21A 1ISXA 4IGSA 5D2XA 5D2VA 5A69A 2GSJA 5J5RA 5FD0A 3ANVA 1WA3A 1E0VA 2OWWA 4BY3A 3E38A 4YN5A 3L5AA 4MGGA 3G6MA 2OR2A 4PL2A 4BQ4A 4J35A 4Z2IA 3W6YA 4BEQA 3W7NA 3WFZA 1X98A 2P53A 4LF1A 1EJUC 3NUKA 4MOZA 4RZ4A 4DJEC 1ITCA 3ITOA 4GVIA 3W27A 2PDYA 4L4LA 4DJFA 3FKRA 3CHCA 5FI8A 4QLKA 2BOEX 2A1YA 2Q02A 5KZMA 4HPJA 2WKJA 3E02A 4JTHA 1BWLA 5HINA 3FSTA 4UR7A 2VGFA 3ABRA 1CI1A 4ZGYA 4FPSA 1XR2A 4A4AA 1EBGA 2WMKA 3KWSA 2VO5A 4Z1BA 1J0HA 4ZZ9A 2UY4A 4S3CA 4O53A 4HU0A 1E4IA 3SN1A 1RSCA 1KLZA 4B5NA 5TIMA 1W8GA 1XRFA 3AZRA 1NWSA 5HWNA 1XF0A 1TJ2A 3PJTA 3DHDA 4J28A 1PE1A 3NOYA 3OJGA 1IXNA 2XFYA 2YGYA 1CXHA 1M1BA 4DXVA 2OG9A 2NV1A 2IPGA 3P5ZA 2QYGA 3VIIA 2H8XA 4WDUA 1V79A 3T0DA 1NM9A 2CZ5A 1KCXA 3LXAA 3VDAA 5ABTA 4UMCA 3CBWA 3WD2A 1EGMA 5DEZA 3P3BA 1J6PA 1OC6A 3EMZA 1H7RA 2Y63A 1Z48A 3OLGA 4I7UA 1SZFA 4HPGA 1J93A 4C65A 3DGRA 3R43A 4IWWA 1ICSA 4D6HA 5I0DA 4HSNA 1YBQB 2PDUA 3D46A 2PRMA 4PTNA 4OVXA 1E6QM 1V6TA 2CNCA 4KPLA 2J6XA 1NP0A 5LHFA 1FWSA 5CZJA 5EFFA 3TCSA 5CKSA 4JTEA 1GNXA 5XINA 1SZRA 3TW7A 1JYNA 2PDIA 2YA2A 4PUJA 1SJAA 4CU6A 4FIRA 3HGOA 4DI9A 2AQWA 1S1RA 1MEHA 3M6DA 3VUPA 3AU2A 2GYIA 3ITCA 3K46A 1KV8A 3NZPA 4HSOA 3VDHA 3GK0A 2IQTA 3W81A 1IZCA 4BHYA 1XCWA 2CIPA 3VVGA 3EPMA 4JYFA 3RLHA 3VUSA 1JGIA 4AH7A 4E8CA 2DZAA 4Y9MA 1TWWA 1M41A 5CGTA 4C60A 5HMDA 3MHGA 2P3ZA 2VGGA 3W85A 1T40A 2HRWA 4AEEA 4ZOAA 2OX1A 3L67A 4AIOA 1VBGA 3GWQA 1XIBA 3JVAA 4K8GA 3AJXA 2V5LA 1DHPA 4GNJA 5K2ZA 1O68A 2HK0A 3IVSA 2I5GA 3T55A 2QCMA 3MZ2A 3L12A 3QW4B 3E96A 3RRAA 2XVLA 1ZU8A 5FL0A 4L4MA 4S38A 4AD3A 1IGWA 2VDHA 4TV6A 1SJDA 3BLPX 3XISA 4QR6A 3OBEA 3W86A 2X2YA 3B3DA 3S42A 1BGAA 2VC6A 1D3GA 4JIQA 1EDTA 1SVDA 4LW7A 2OB3A 2D69A 2OLAA 3LGDA 4F0RA 4RPQA 3ALGA 4O10A 2GDVA 5C9XA 1PL9A 4H7CA 4KCVA 1L9WA 5E1QA 4HMEA 2FJUB 2EXOA 1TZ9A 4KCWA 1AW1A 3GXNA 3R8HA 1XQKA 1V08A 1PX3A 2EKGA 1Q7MA 3HG5A 3NSNA 3UEQA 4CKQA 1BRLA 4GNKB 3VGEA 1V6UA 3LK6A 3HF3A 5M5DA 3WUGA 1QJWA 1JAKA 4TV5A 5KETA 3GZ3A 3IGXA 1T8XA 2PF8A 4TTUA 3RILA 4I3GA 4XIMA 3N9SA 1ME7A 3Q94A 1J2BA 3VD4A 4LC8A 2SFPA 3TMLA 1HGYA 1YDNA 5C2GA 5I2UA 2P8CA 2Z27A 1X97A 4HK7A 3LB0A 3H7UA 4E3TA 4PZVA 1A5NC 4N02A 1SW3A 3HPAA 3RX2A 4MUPA 3AIQA 4GINA 2YB4A 4WY0B 1F7BA 1KD0A 3WL0A 1PIIA 1GKRA 4NX0A 3S9YA 4UTKA 2HS6A 4DBWA 4H4IA 4HIBA 1KCKA 3R7MA 2J77A 3H22A 1E9YB 2WNNA 2BHZA 3RGTA 1QW9A 3VIMA 5HJLA 1EHNA 2QCCA 1F05A 2I16A 1HP5A 4QJ3B 2NQJA 4MVAA 1DV7A 3NDOA 5BOFA 4IP4A 1D2KA 3STGA 4H01A 4DEFA 4HPHA 1WXZA 1S2VA 4LU0A 1TV8A 3MQTA 3VE9A 3RX4A 2PGEA 4G56A 1M7XA 3RMJA 3UPBA 3AIUA 3N6JA 3JU2A 1BXNA 3M43A 2BS9A 1FWCC 5KTLA 2VEKA 1Y65A 1QNRA 2VDGA 3GTXA 3KRZA 5CPQA 2NSOA 4B5VA 2DU2A 4DBDA 3MHFA 3W87A 1ME9A 2F38A 1N82A 3T0CA 3NO1A 3PC0A 1KFLA 4U5IA 4ZO8A 2X2GA 4JBRA 3D5HA 1OQFA 4DELA 5J5DA 4N42A 3ATZA 2QMKA 1ZBCA 3WLOA 1I0DA 1UR8A 2C15A 3H26A 2CBVA 1ADDA 1SO6A 1W1ZA 3S9IA 3A9BA 1ONXA 3MKCA 2ESCA 3ES7A 3GG8A 4B16A 4C5ZA 4Q8UA 3G22A 2WSQA 3TJ4A 2UBPC 2YLAA 2Y89A 4RDYA 4KWWA 5JBEA 5TQLA 4WKFA 1AL8A 4O8AA 2H90A 3N12A 1AG1O 3SW6A 3PBVA 4HMCA 3MJMA 4QCFA 5HBFA 3P6LA 4Q4PA 3TSBA 2R82A 4DRSA 4GABA 3HFYA 2XSBA 5CZ0A 4JTUA 1IXQA 5A2CA 1VFLA 4MSSA 1CGYA 1EC9A 1RR2A 1KC7A 1UG6A 3TAKA 3DFQA 1IYXA 3SIMA 3BUVA 3RF9A 1YE4A 4C1NB 2X1IA 4DX3A 3IS4A 3E74A 4S3KA 1D7FA 5BXTA 5I03A 4DM2A 2FPVA 1MFUA 2P50A 4FF5A 1F73A 3L2MA 1U5HA 4R7OA 2X40A 4M6UA 3TC7A 2WPGA 4G7EB 3IJLA 3GUGA 3GDMA 3VOIA 1G0CA 3R12A 3QV9A 3KVLA 3E5BA 1WNOA 1V3MA 1OFRA 4RKAA 2G5WA 2CLEA 3QR0A 4MYAA 4I9AA 4HNTA 1RV8A 1VEPA 2QCEA 1TQJA 4CVUA 4Q8PA 3EX4A 3JS3A 3WFAA 4WGXA 3W72A 1JCNA 2Z6JA 3MV01 1TR9A 1XKYA 3KCJA 1EZ2A 2CU0A 3A22A 1A3HA 1EQCA 3EWXA 2R8WA 4ZXLA 5JH1A 2PD5A 2PDMA 3WN6A 3E9AA 4NAFA 4ZFMA 1VFUA 4UXDA 1TO3A 1DORA 2Z7GA 2PWDA 3NQDA 5LSMA 5DMNA 1U30A 4LCQA 3SRFA 3AIBA 2OLSA 4GXMA 3N2BA 3NOEA 4OKDA 2ZVIA 3A23A 3SSJA 4D8LA 3F5LA 1KBIA 1EXPA 2YXOA 4QE1A 1HT6A 1VJZA 3CL6A 5AYIA 3K4AA 3B8SA 1IXPA 1LOQA 3ELFA 3SGUA 3OG2A 3GC5A 3DYMA 3HURA 3TFXA 1PZ0A 3EX1A 4L6DA 3IJ8A 5CPSA 3H2AA 1SZGA 3AS1A 3GDRA 3T05A 3ZQ9A 2IKGA 4B5XA 3MUAA 4LBSA 4OGZA 5ABFB 1BVZA 1SQ7A 1RY8A 1M68A 1UOKA 1VB9A 4AZ7A 3GDBA 4PCFA 5G4HC 3WDRA 2DUXA 4RPPA 1UR2A 1HVQA 3LI0A 1UBSA 2BGQA 2F7FA 4R27A 3PNUA 3FJ4A 4GYPC 3B8IA 2PDNA 4B5TA 3S1XA 3THCA 2GGIA 1NDZA 2NXGA 4JIHA 4M56A 4EWJA 1OG6A 1OC7A 4ADUA 2Z26A 4LAKA 5AY7A 3TQVA 1HUVA 1TX2A 2BHYA 3RITA 3WNMA 1VQTA 3P61A 2ISDA 5BOEA 3CK5A 3DH7A 2HCVA 3L7RA 2YJQA 4JIEA 1NJJA 3WBXA 2Q3RA 2BB0A 1BYAA 4RDVA 5BU9A 1K9TA 3EGJA 4OBRA 1BGGA 2VQTA 4N7QA 4NZ1A 4RXGA 2REQA 4GQ0A 3VIHA 1O12A 1P4CA 1OZQA 3VMPA 4UCGA 6XIAA 1TA3A 2CLMA 1M3UA 1WKEA 3WDQA 5BXPA 3AJ7A 4A22A 3ZR5A 4WCJA 1D8WA 1LORA 2XDFA 5DQPA 1ML1A 2J79A 4AEOA 1OT2A 4ZOEA 2F6KA 3KOYA 4YVXA 4BF7A 3QZ6A 2J7BA 2ASHA 5A6SA 1A5BA 1XLBA 4DZAA 1XYBA 2V63A 3A9IA 2WZIA 3RG6A 4OJYA 3LRLA 1HO4A 1AJZA 3R0KA 2VC5A 1ZTVA 4XAZA 2XH7A 4JICA 1H0GA 4I6VA 3KRUA 3ITVA 3U3HA 2V5KA 3QYSA 3SRKA 4ZTXA 1S5MA 2JQXA 1GVSA 1ODUA 1W54A 5U7SA 4Z2JA 1UZ4A 7ODCA 3MMWA 2VC7A 2TAAA 2PWGA 1KTNA 4FOKA 1PZ2A 2PDWA 3FA3A 1KV5A 3MUXA 4JKLA 4QE5A 1F8IA 1QHZA 4Z2HA 2FHFA 5CAHA 1OCNA 3PBMA 3M5VA 4PUNA 3WJXA 1DXEA 4WEVX 1E3ZA 3T40A 1OYBA 4BF9A 4PFHA 2CLFA 3R1ZA 4GG9A 5F4SA 1XV8A 4AC1X 1W3HA 1XD0A 3DFTA 4DY1A 4DJDC 3P62A 3PB2A 1FHDA 1W1YA 3ZT5A 1OY0A 3KVKA 5B7ZA 3NQ8A 2D2JA 1TFVA 4YHEA 4LT9A 4BQ5A 1BEUA 1W9DM 3QV7A 3UYIA 2A3HA 4YWSA 1WDSA 3KZPA 3LRMA 3TYCA 1UA3A 4XTDA 3T9PA 4C6EA 4U4MA 2V6AA 2VVSA 1HP4A 1NF7A 4H7VA 3MBDA 1RHCA 4MWAB 3TYUA 1QBAA 3KEHA 1WKDA 3PUEA 4N4PA 1FKXA 3MO4A 2XU2A 4Q4QA 4ML4A 1VIZA 3EWZA 3I3EA 1BYBA 2XM1A 3ZWTA 3E2QA 3G1FA 3U9IA 4L64A 4DWSA 3FGCB 3PJWA 4M82A 2ACSA 4I5UA 1BHGA 3M0KA 4UOJA 1TUXA 1K8XA 1HO1A 5I78A 3H7VA 1A5AA 4NJHA 1W1B1 2NV9A 1OD0A 2WW5A 3L5MA 5DELA 2VFDA 5E70A 4HSHA 4MNJA 4FXFA 1B3WA 4OOUA 1JPDX 3ATYA 1V02A 3T7VA 5ABHA 3DERA 4JQ4A 4UQCA 1W1A1 3AC0A 3IACA 1WDWA 2TODA 3CPUA 2Z1SA 1ITUA 1FVPA 3K5XA 3TR2A 4LCSA 4J1OA 1XS2A 4AHPA 1JCYA 4PULA 4O14A 3N34A 3WQGA 4ML9A 4JTDA 4ZSTA 5GJPA 3VAVA 5DMYA 2V81A 4DNMA 4RV8A 3NXLA 3CUIA 3UJRA 2GWNA 4A05A 4PN2A 2V3GA 4LXFA 4INFA 1A5LC 3KOWA 3PZVA 3I3DA 3WD0A 1SYTA 4M81A 4TR9A 1TCDA 3VKBA 3N13A 1I45A 1OM0A 4M51A 3WDPP 3TUUA 3KXQA 1IWAA 3LMZA 1RPXA 2QJNA 4IMFA 1XYFA 4QGCA 1P5BA 1CEOA 4XD5A 4YU1A 3KX6A 3DHUA 5I3IA 1EIBA 1PB0A 4F0KA 2OGYA 1DJHA 1FFRA 2NVDA 2RDWA 2DSUA 3S1UA 4DWSD 1X96A 1JPMA 1VFFA 2DQWA 4QM1A 1EFZA 4PH6A 4V2XA 4XBKA 1DEDA 3CPRA 3GRIA 4MY1A 4AIBA 1UWUA 5AC5A 2ACQA 3GH4A 3FKKA 2ZX7A 3G18A 4GH1A 4O57A 3BOFA 1GT8A 2P1FA 4PMUA 4AD2A 4B15A 5I00A 1JZ5A 4AD4A 2WQDA 3BAJA 3QZEA 1E0UA 3MS8A 3CMFA 1FH7A 2QV5A 2Z7KA 4RDZA 1GWJA 3NL5A 4B3LA 4LS2A 2W3ZA 1X38A 3IRDA 4IPLA 2VGIA 3UXDA 4LBRA 1MYRA 2A3BA 4TVDA 4UMAA 2TPSA 3WH6A 1JQVA 3V5OA 2IPJA 1EOKA 3C8FA 2WANA 1X39A 1BAGA 3IUIA 4FX6M 1NFBA 3MC5A 4L56A 4ILSA 4PMNA 3B40A 3J7HA 3S1GA 2PLKA 1HKWA 1I2QA 2QUTA 3EB3A 4AX6A 4UTHA 1I0BA 2XG9A 1VGAA 1BF2A 4MAZA 4IFKA 4NSBA 3OGSA 2Y61A 1QI5A 3KCLA 1SO5A 1TZZA 2DZUA 3ZMRA 1WUFA 3RRXA 4M6QA 4PL1A 1EF2A 4B2DA 4R9OA 4EWND 3H24A 2YA0A 2I5QA 2ZX9A 1XYLA 3EA2A 2ABBA 4WJ8A 5A6BA 4DBUA 4MADA 4D6EA 4FF7A 3MHUA 2E9LA 2R9RA 4FIQA 1VCFA 2JF6A 2V3FA 1I75A 1D3CA 1Q6OA 3CZLA 4YTRA 3GXFA 3URAA 4LVFA 2OQLA 4HTYA 1QXLA 4DYEA 1RJPA 1LWIA 5LIKX 1S5NA 1B31A 4G5DA 3GYEA 1UD3A 1BQGA 3DFOA 1K1DA 4HNUA 2V82A 1CTNA 4JQ2A 3C56A 3WQCA 2I14A 1TVNA 3N9RA 3PN8A 4DXXA 2ZZ5A 3LBOA 4CNPA 1Y5VA 2F2HA 4DO6A 3B0UX 1X6LA 3L9CA 5CJNA 4LYKA 2DW6A 2XIJA 1O94A 1XBXA 3B04A 3W01A 3C0SA 2OWXA 1VZWA 3W71A 3MW7A 3FDKA 3LCIA 3BMXA 2BVYA 2C18A 4A8RA 1GZGA 1V7AA 2J7FA 1ZL1A 2VRQA 4K1GA 2ZTJA 1WZKA 1R46A 1R87A 1K03A 1CW2A 2E09A 3QHNA 1XLFA 5CPMA 2R91A 4AVNA 4B2DD 1IEXA 4LAMA 1JQXA 3S9ZA 3CEPA 4UFJA 3W6MA 1T5AA 1V3KA 2JGQA 1GONA 3LNMA 2ZC8A 4Z2LA 1UWSA 3TWAA 5MKGA 4MHBA 3WSUA 2QCDA 2PE4A 2X41A 4GIYA 2NQ9A 2VFEA 4PC8A 3E0IA 1CXIA 1BVNP 1B9ZA 3VDBA 3N15A 5HA7A 2ISVA 3ARRA 4PEEA 4HYVA 4AG0A 1BG9A 4L4PA 4AIUA 3QN3A 1IEQA 3U6WA 3LCFA 3ZJKA 3E0FA 5A8GA 5E0CA 1PTDA 1ESWA 2GGEA 4LY8A 3RR1A 4M24A 2PP1A 1PIFA 1Q2SA 3LGEA 4O0ZA 3NIYA 3RK8A 2G41A 1G69A 4N9EA 3ISIX 1KB3A 2HJPA 1O7AA 3WQOA 1BKHA 1TWIA 1ADOA 2E0PA 2C91A 4K3ZA 3CTLA 4MKNA 2VGBA 4ZFCA 1POJA 1ZJBA 4NJKA 3MP5A 4HCHA 2VX6A 1BXBA 1TWSA 4YMZA 3VZZA 1UD6A 2VZTA 4B9YA 3VNZA 5EKYA 3AROA 3CUZA 3R58A 4Y96A 1S5WA 5BWFA 4GLEA 1HGWA 1JI1A 3CHVA 2ZKMX 1SFJA 1K8YA 1K6AA 1NFPA 4IUOA 3FOKA 3SUSA 3BSGA 1NP2A 2CWXA 1PX8A 1E6XM 5JBDA 2A5HA 2I57A 3UNDA 3VO0A 1R0MA 3G1XA 2PWUA 3DZ1A 1WBHA 3WDJA 3OG3A 4CNOA 3OLDA 2OXNA 1EDGA 1KBJA 1QOQA 5K4XA 3N73A 2QCGA 4PMYA 4PUMA 5M3WA 4DLFA 1PDZA 3EWCA 3QVQA 1B3ZA 1FCUA 4RE3A 3FN9A 3QR3A 3LPPA 1EYEA 3GC4A 2VENA 2CESA 2HISA 1TJRA 1AK5A 3TW9A 5CGQA 5BRPA 1XM3A 1F76A 4IMDA 4CEUC 4BI6A 4KMQA 2I1OA 5DCDA 2P88A 1B3VA 2B7PA 4OE7A 3POCA 2J8TA 1ONWA 3QTGA 2O7SA 4GC3A 4AY8A 3EPNA 3GH7A 3BURA 3GFXA 1A53A 4LF2A 3BL3A 1Q8JA 3IJ6A 3IVUA 5C54A 1U33A 3C6CA 1I9CB 4K7VA 4XKMA 1CZ1A 4U33A 1JVNA 1XH0A 5LNUA 3PJUA 3EEGA 4PB3A 1WZMA 3FY1A 5IDZA 4MJ2A 1NOUA 3R13A 2J75A 4KBXA 1SM9A 4IIHA 3WD1A 4QJ1A 1CB7B 4A3RA 1VS1A 3EX3A 3B8VA 3L4ZA 4V1XA 4EANA 3H53A 4ZO7A 2J7CA 3NQ2A 3OYZA 1XLGA 1R85A 3E12A 3CB8A 2Y7DA 2VDIA 1AUSL 1VFHA 3VD3A 3G3MA 3AALA 4BA0A 1XFCA 4LPCA 3B9NA 4IIEA 4W93A 1W56A 2XIOA 3A6OA 5BROA 4RV3A 4A3HA 1E4MM 3M0ZA 4IM4A 2OZTA 3AO0A 1ZP4A 2WSRA 3DYPA 3G8RA 3UCCA 4PCSA 1TV3A 4JS3A 2R14A 1VP5A 4QTGA 3FXYA 1T6MA 3RLVA 1ZAJA 4KEZA 5I5RA 1SMAA 1GW1A 2CBJA 4M80A 4FLSA 1RUSA 4B4HA 1IIGA 4QJ5B 5CSSA 1KFEA 3GD6A 1TV2A 2G96A 1GVRA 1AQFA 1GKPA 1VJIA 3ABQA 4Q8MA 4B4FA 2XSXA 3KP1A 2O0TA 5IFTA 1LOLA 1F3TA 3G1DA 3MKKA 1XIGA 1K02A 5JVLA 2R1KA 3BCDA 4QG6A 2CHOA 1TMHA 4N9BA 1JRBA 1K3UA 4EX4A 1QCWA 3OIHA 4CCCA 4R7WA 1GTHA 4Q4RA 2Z1VA 2R6OA 1S5VA 1VFOA 4O1BA 1FWGC 3BJFA 5D33A 1KWGA 1AJ0A 2G3JA 1CCWB 4C6QA 2XIQA 3TP4A 4PUDA 3CYJA 3QHMA 4KCUA 4B91A 4TMBA 3NDYA 4NT0A 3CQ0A 3APTA 1UCWA 4E38A 3SUUA 2BGSA 2PC8A 2G0WA 1E0WA 3THAA 2P10A 3A4JA 1CT5A 4UTUA 2VM8A 4DPQA 3UQNA 2G95A 3DHPA 1MEIA 5IXEA 4L6HA 1I4NA 3W7HA 1BQCA 3QOMA 1XGDA 5J04A 1KFWA 1I6NA 2YL5A 3LBMA 1XDJA 4NYYA 2J6VA 1XC6A 4DAFA 2CZEA 4GE8A 4W84A 1JFHA 3TA9A 3BG3A 2DSKA 1GYNA 1RQBA 1GYMA 5XIAA 1BKSA 2EPMX 4XVEA 5AVNA 4JCLA 3A3HA 2GSEA 1ADSA 4PUKA 3GAKA 1LRQA 3MWAA 1SZEA 2CETA 3MCOA 3UERA 6CGTA 2C0HA 4YTTA 1OIMA 1RCXB 4H00A 3W9ZA 3F5JA 1C91A 2WC4A 1NU5A 3F4VA 1L2QA 2V5DA 2HZGA 5HNNA 2ZRYA 1KFBA 3S47A 2XM2A 2WC7A 3VU2A 3BJSA 2ZC1A 2B81A 3UR5A 2NXIA 1MW3A 3B0YA 4H04A 4QAWA 5EMKA 3H4XA 3GVRA 1HJVA 3HO8A 4ZB5A 1KXTA 1W2PA 1W8SA 2KAUC 1OK4A 2VX5A 1FWNA 4HP5A 1WBJA 4M19A 2CXEA 2IW0A 3ARWA 2YYTA 1YPXA 5LIYX 3KDOA 3SQSA 3V1PA 3CT2A 3U5UA 2VELA 2GVLA 1PJ9A 1OX6A 1EJVC 3DI0A 5D05A 4UQBA 2AL2B 1MWOA 1FHVA 3GHRA 5EYWA 2FHCA 1R7AA 1EJTC 3VOFA 3ITYA 4MLRA 4RR4A 1SSDA 4Y9NA 4WLCA 4QS5A 3WLQA 2ZUUA 1F3EA 4MY9A 3CJPA 4HMDA 2QPUA 3RLUA 3U8GA 1GCYA 4WJEA 4HN8A 1H62A 1GTEA 1OVDA 5D09A 1TPC1 1H5YA 5DT7A 4LH8A 1VFSA 2OEJA 5AYYA 3D3FA 1YXCA 2ADAA 2WMFA 3UR7A 4HNCA 3BO9A 2C3ZA 2QVNA 3BLKA 3DBPA 4JHZA 1X1ZA 2ZUTA 1EC7A 1F6KA 2AKMA 2PDJA 1UWAA 4CD6A 3UD6A 2R1PA 4Z0JA 4C91A 4LAOA 1MUCA 4IG2B 3AYVA 1W5OA 3F4DA 3QY7A 2VHLA 3ABZA 2XHYA 1TB3A 2VEPA 1YE6A 2WMHA 5PTDA 2CFFA 2YX0A 1KQZA 1KBKA 4ONVA 3KBMA 3GM8A 3W02A 3W7OA 3U57A 4H8UA 2WHLA 2VZOA 5GJNA 4J3TA 1O5QA 1EUAA 2X30A 4HU8A 1D9EA 2WVVB 4LC6A 4E8GA 4RCXA 1WKYA 4UIOA 4TOQA 4MWAA 5M17A 4RXFA 3GNPA 5MF5A 2QMJA 5KZEA 4EXAA 2DSVA 5DF0A 4ATWA 1OFDA 1A3WA 3FSUA 3W29A 4ZQPA 3OU8A 2FJKA 5A6AA 4MNKA 4L65A 3OZPA 4GI4A 3QC3A 2XH2A 3TEVA 2CLOA 3AHYA 5HMEA 1QNSA 5AC7A 4C7GA 4DO5A 1NAL1 2YL6A 1JZ8A 3QKEA 1QU4A 3F2DA 1L8NA 5ECVA 2V2DA 4U2ZA 5I3GA 3S3GA 3NTYA 3BG9A 3ZZ1A 5CC5A 3SRDA 1A5MC 3TV8A 4BI5A 1R86A 1H4PA 3ZOAA 4X63A 2YFOA 3KOZA 1XH1A 3ORWA 2Z29A 3ARPA 3BDKA 2C1GA 4ZR8A 1J11A 4QHRA 3DN5A 4ZVJA 2XJ7A 4L80A 4P7LA 4J3SA 3LDVA 2A3AA 2HSAA 3FV9A 5BMXA 3FNDA 4FHAA 3WMCA 3TDFA 3FYYA 4MB1A 2X1SA 2J7DA 3VOJA 2UZ9A 5G1YA 1US0A 3FJLA 5AZ1A 2PTZA 3VIPA 9XIMA 3KL0A 1CX9A 3A5FA 3A4XA 1LL7A 1QWGA 2GOUA 2AMGA 3KOXA 5TBOA 4WD0A 5HWJA 1E6RA 2Z1WA 3WNNA 3WEOA 4GBUA 3HQNA 2QHAA 3GR4A 1VH7A 3TZNA 1LUCA 3CUHA 4GO9A 1A5SA 2G4FA 4GIRA 1UMYA 1XUZA 3VKAA 1GOIA 4MZ8A 4E2DA 2E5BA 4US5D 3DIPA 3B03A 4PMQA 1XLHA 4GXPA 3W22A 1POKA 4H9VA 5DY2A 2XFFA 2YXGA 3CPGA 3KWXA 2PPGA 2DUAA 5SWUA 1KRCC 2QF8A 3OGRA 4QNEA 1OBAA 1YDOA 5JQ9A 1UOZA 1O5KA 2RDUA 3HMJG 2CLPA 1C90A 4LSBA 3BVJA 1JULA 4HZ8A 4YCPA 1NWRA 3QXBA 3SECA 2NW0A 3MSRA 3ZVIA 2Z2UA 5D9PA 2WNZA 2ZUVA 4MJZA 3FK4A 1FDJA 4AX7A 3MDUA 5GNYA 3KAOA 2YW3A 4A29A 2INZA 4QE4A 2XSAA 4JX4A 4QLJA 4UQ9A 4M6VA 3NO3A 1O1ZA 3AFBA 2D3LA 4WK9A 3BARA 3UR2A 3GBDA 1BSIA 1PKMA 4P2VA 4BQ3A 1S46A 3DFPA 3LTYA 3QC0A 3CUGA 1PWLA 1CGXA 4M0XA 2RJGA 4JIRA 1AODA 4HBKA 2NUXA 4AVOA 3BWWA 5RUBA 3SJNA 3M5ZA 1Q4NX 3C2YA 2QZRA 1TPFA 1GOWA 1V6XA 1JF5A 8TIMA 4Q3MA 3L21A 2ZVRA 1XYCA 4RL3A 3TLQA 1PKNA 1F3WA 3PBGA 4RNIA 1B3OA 1HKKA 2QCHA 2VVNA 2B7QA 1UWTA 3CT7A 3GYCA 3WLMA 1B4KA 3WF0A 3S6TA 5H91A 1AD4A 5I77A 4DZHA 4K38A 4ECLA 1LZOA 3AS0A 1XP3A 2YSWA 1TCMA 2Y8VA 1VLWA 3VIJA 3U4AA 1R9YA 1DJQA 2Y62A 1IE7C 5FJIA 1W5NA 3W6LA 1VD6A 2G3FA 2WWCA 3EWUA 3ANUA 3B8TA 2BODX 4FNRA 3CZGA 2J9YA 1YPFA 2HXUA 2NT0A 3UWEA 4A2RA 1H09A 3NYZA 4Z0SA 3MI3A 1HFBA 4EVZA 3V35A 1GEHA 9RUBA 5AZ0A 3RO8A 3E0LA 2FTPA 4NJIA 5FJOA 4FX8A 2CC0A 1K9EA 2UV8G 4JTJA 1E1CA 1WOAA 3ARTA 3QEZA 3U7VA 1V0LA 1R3WA 4AZGA 3VGBA 1JDFA 3S6OA 1DIDA 3NJ3A 2BV9A 1FCVA 3P60A 3JUGA 3UZZA 4UWMA 3CO8A 2DUZA 4UC5A 5A94A 4PB5A 5D8WA 1P6WA 5LA2A 3AXIA 3HJEA 3W24A 4DB7A 4AZHA 4JKKA 3QR1A 2E77A 5DMLA 1NY1A 1FOBA 2IPWA 1SR0A 2RJHA 3GXMA 3HBLA 4KWVA 2C6QA 3M41A 2RFGA 1FWRA 1W6TA 3UZYA 3RUBL 3CHEA 1UJQA 1WZAA 4JX5A 1ZBWA 5CJMA 3V75A 5HR7A 2EGZA 2CXGA 4S3JA 4OIFA 1KCZA 3GG7A 2NX1A 3SCVA 1WX0A 5I06A 1AL7A 1YHTA 1UD8A 1Q5MA 3G1RA 3SZ8A 1EX1A 3APYA 2NZLA 4YYCA 5FKYA 2DVTA 2PP0A 3IANA 1D8CA 4XAYA 2V5BA 1ISVA 5LA0A 3BXWA 3EWYA 3N3TA 1IZKA 1MZRA 1OF6A 1NQ6A 3NG3A 1UR0A 5M2FX 4L9YA 1AMYA 3EAUA 3W1MA 5FSDC 3GR8A 1Q6QA 1QR7A 1ZB5A 1LT8A 1HL2A 4J3XA 4O18A 2I5IA 3R89A 3G6LA 1K9DA 4FNUA 3RX3A 3AUOA 3P0WA 2QJMA 3LGGA 3ONBA 4MPKA 1HKVA 2V8ZA 3IPWA 2X16A 1OCBA 5EMYA 3NEVA 1VF8A 3S5YA 3RDKA 1GOQA 3F2BA 3SUVA 1ZHAA 4GUFA 4P5UA 4CQDA 1YPIA 2Q8LA 3TYBA 3HMCA 3S5NA 1FXQA 3CH0A 4KRTA 1GQIA 1DKWA 4POCA 4S23A 2QDHA 2QLYA 4WOZA 1OIFA 5HUPA 3P8JA 4ADSA 2DIEA 2YCKX 2CHNA 5L6UA 4KFNA 2ZRXA 2ZX6A 3LM7A 5I3HA 3TIMA 2AQOA 1NSJA 1JCXA 3GNDA 3BLEA 1TPDA 3DGBA 4P7QA 3LUTA 1AH4A 4ZE4A 4CD5A 1F74A 3HN3A 3WENA 1ZSXA 4DWDA 1XIMA 4R88A 1UKQA 4HKPA 4F9JA 1KKRA 4CUCA 3LSCA 4DI8A 1YTEA 3CZ8A 3P8IA 4PMOA 2J7EA 8CGTA 4G1KA 2Q01A 4REQB 2JEPA 2IUZA 4F8XA 3TTOA 4ZO9A 3UWYA 3URNA 4XZHA 1V5XA 1NH6A 2O9OA 3SCSA 3CQJA 1UPMB 4LNYA 4Y6GA 3TTQA 7REQA 3FLUA 2Y2WA 3VD7A 3SJ3A 5AHMA 3VINA 1UKSA 1GKQA 3N2OA 3UA4A 1UUOA 4R53A 4H9ZA 4LANA 1QK0A 2NSXA 4AB4A 1FP9A 5A6JA 3CWNA 4LOCA 2XGIA 4Y9OA 4K1WA 2DZPA 2ISFA 2G3NA 1S38A 4MNMA 4ORMA 3TQPA 4FI4A 4J9JA 4BWLC 4LV9A 3QZAA 2NQHA 2J74A 4AEFA 4L1WA 3CHDA 3GFZA 4JTKA 1C8XA 3BSMA 3KTCA 1OG0A 2J62A 1I2NA 2WO5A 3VMNA 3OVGA 3UZXA 3EX2A 2QF7A 2D0HA 4A3UA 2FQIA 4F0HA 2RAGA 1SFLA 3GXIA 2ON3A 2ZFAA 3LN3A 4D6FA 5IBXC 1C92A 4UFMA 4ACZB 3CZEA 3LQLA 1TRIA 1L6YA 5JU6A 2BG5A 1PSCA 2HEJA 4GRSA 1A0DA 1SGJA 2F61A 3NXFA 3AHTA 2BXZA 4UTTC 1E15A 3WNOA 1A4LA 4PTDA 2AQVA 3LLDA 4CNUA 1Q6EA 2P8BA 3W73A 2WV8A 4Q22A 2Z2BA 3M1ZA 3P81A 1UPPA 4U31A 2DP3A 4NP7A 1ICPA 2CEQA 3SB0A 1LQAA 4B9ZA 1JNDA 1DIEA 3G1SA 1IT0A 3G77A 4EPBC 1XSIA 5BRQA 3UNTA 2PODA 1OFEA 3GG1A 3LHYA 4GY1A 1KXHA 3AISA 2XFWA 4XZBA 3WELA 4A3QA 3S5OA 1LDCA 4F0LA 4AAJA 5IOBA 3M7SA 3UXIA 1KFCA 1LBFA 2FDSA 2GJXB 3KBWA 1DIKA 2P5NA 3EMQA 2Z6IA 3HG3A 1O5XA 1VYSX 1XIIA 4Q7BA 5KZDA 3W3OA 1SW0A 2GJNA 1KQYA 1H41A 1M5WA 1AZ2A 1XFBA 1V6WA 3IIZA 1L6GA 3LLFA 1XICA 1ZJHA 3P0XA 3LU2A 2DVUA 2FZNA 3W2LA 3WG6A 2GK1B 3MUCA 2EEXA 2DSZA 4Y9AA 1X1NA 2NX9A 3OZOA