3UGRA

Akr1c3 complex with indomethacin at ph 6.8
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
314
structure length
308
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal structures of three classes of non-steroidal anti-inflammatory drugs in complex with aldo-keto reductase 1C3.
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 308
sequence length 314
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3ugrA00
5LIYX 3CAVA 4GACA 4H8NA 1QRQA 2IS7A 4RPQA 2HV5A 3R8HA 3V36A 2IPJA 1ADSA 2PDGA 3H4GA 2ALRA 3T42A 4XZMX 3H7RA 3ERPA 4GQGA 4WDWA 2PZNA 2PDCA 1JEZA 2IQDA 3UGRA 3C3UA 4ASTA 3GHSA 2AGTA 4JTQA 1US0A 1GVEA 4IJRA 4LBSA 3S3GA 4Q3MA 2ACSA 4XO7A 3UZZA 3UZYA 4XO6A 2WZTA 3VXGA 1Z3NA 3CV6A 4JIRA 4LB4A 3G5EA 2PDWA 4GA8A 3UZWA 4JQAA 1HQTA 2PDQA 3LZ3A 3WBXA 2PDXA 2HE8A 1AH0A 3R94A 3N6QA 4WDUA 2DUZA 1XGDA 1PWMA 2C91A 2IPGA 4L1XA 1S2CA 4YVXA 4WRHA 1QWKA 1MZRA 1T40A 3LN3A 1LWIA 1EKOA 2HE5A 4HMNA 3COTA 5DANA 1MI3A 2HEJA 3R43A 1Z8AA 1XF0A 3KRBA 4LAUA 3UFYA 4AUBA 2HVNA 4F40A 3M64A 2IKJA 1AZ2A 4LB3A 3DOPA 3EB3A 1X96A 2PFHA 2F2KA 3P2VA 4PUUA 2INZA 4GCAA 1S1PA 2PDIA 4JIHA 4JQ1A 4XVEA 4DBWA 4EXAA 1R38A 2IKGA 3QKZA 2FZBA 2J8TA 1VP5A 3G1RA 4XZHA 2PDKA 4FA3A 3UWEA 3GHRA 4ZFCA 4FZIA 2IPWA 2FZ9A 2FGBA 2BGSA 2ACRA 3U2CA 3ONBA 2A79A 1SM9A 3D3FA 3BV7A 3O0KA 2QXWA 4HBKA 5LIXX 3RX2A 1T41A 4YVPA 2IKIA 1ZGDA 3LQGA 3EAUA 1Z9AA 3LNMA 4WDTA 5JH1A 4EXBA 3CMFA 4FAMA 2BGQA 4QXIA 1EXBA 1MRQA 3V0TA 3V35A 1EL3A 3GUGA 1AZ1A 2HDJA 2P5NA 4QBXA 3Q67A 3RX4A 4JQ2A 1YNPA 1ZSXA 5M2FX 3UP8A 2PDUA 2IQ0A 4IGSA 1Z89A 1M9HA 2F38A 4PUWA 1S2AA 1Q13A 4WEVX 2PDYA 2ISFA 2IPFA 3Q65A 4NKCA 5C7HA 2FVLA 4QR6A 5AZ1A 2FZDA 1LQAA 3R8GA 4XVDA 1RALA 1IEIA 3MB9A 3BURA 4GIEA 2INEA 1RY0A 3EB4A 3BCJA 4ICCX 4WGHA 1X98A 4XZLX 5AZ0A 4H7CA 3MC5A 4GQ0A 1X97A 4JIIX 5LIWX 3UZXA 4DZ5A 1XJBA 4PRRA 1AH3A 1FRBA 3CV7A 1AH4A 2ACUA 3M0IA 4XZNX 2PDBA 4JTDA 1UR3M 1PZ1A 4PRTA 2BP1A 1J96A 2PF8A 5LIUX 3WBYA 2PD5A 4FALA 1HW6A 2I17A 4WDXA 1K8CA 2PDFA 4JQ3A 4JQ4A 1ZUAX 2WZMA 3LENA 2NVDA 3GHTA 1YNQA 2HVOA 3R6IA 2IKHA 3DN5A 2PDLA 3M4HA 5LIKX 3V0SA 3N2TA 1EF3A 1PYFA 3LUTA 2PDMA 4YS1A 4PMJA 3BUVA 1AFSA 3B3DA 1ZQ5A 3F7JA 4LBRA 4DBUA 4L1WA 3O3RA 4I5XA 3FX4A 2I16A 1IHIA 3WBWA 1YE4A 3FJNA 3LQLA 4XZIA 4MHBA 4OTKA 1RY8A 3ONCA 2PEVA 1VBJA 3R58A 2PDJA 4YU1A 2PDNA 5HNTA 3UG8A 3LEPA 5HNUA 5KETA 4XK2A 3WG6A 3V0UA 2NVCA 4IJCA 3LD5A 5HA7A 3NTYA 2R24A 2PDPA 3LBOA 1PZ0A 3UYIA 2DUXA 4G5DA 4DBSA 4JTCA 3H7UA 5JH2A 4Q7BA 4JTAA 1S1RA 1OG6A 1Q5MA 1YE6A 2FZ8A 4JTRA 3GHUA 4LAZA 3CAQA 3R7MA 2CLPA 2PDHA 2R9RA 1A80A 1C9WA 3CASA 4QX4A 4PR4A 2ACQA 3LZ5A 2DV0A 4XAPA 3WCZA 1PWLA 4R9OA 4GABA 2PD9A 4YVVA 2VDGA 3RX3A
chains in the Genus database with same CATH superfamily
3EZ4A 3CL6A 1EOMA 4GACA 3MQTA 4RPQA 4DAFA 3S5ZA 2TMDA 1GOIA 3L5AA 1KW1A 1JVNA 1TMLA 3G0SA 3NEHA 2QHAA 2V0TA 3OPSA 4RJEA 2V5JA 1PL9A 3IV8A 4H6QA 1SPQA 3AUOA 2OOGA 1TUFA 5D9PA 3D46A 2YXOA 4V2XA 3ATZA 2CHNA 3LLFA 1PBGA 4F9DA 3UGRA 4U28A 5D02A 4UC5A 4A05A 4L56A 1QHPA 4Q6JA 2PUZA 4ATWA 2JQXA 3L2IA 4BA0A 4GY1A 2A7PA 4Q4OA 4URIA 3E02A 1TWSA 1S2WA 5I3JA 2REQB 3UZYA 1VBRA 2E9LA 4JBRA 3S5SA 5C71A 2WZTA 3TNOA 1GTEA 4W5ZA 3RO6A 4KFNA 3LU2A 3Q2DA 2ODOA 2J88A 3H55A 3WBXA 2PDXA 4C7GA 3PTQA 1BGGA 3W83A 1TYGA 4W8BA 5GJPA 3EWBX 1EGMA 5CG7A 2RUSA 3MV11 5CSRA 1NM9A 2Q3OA 1WDRA 2W27A 2FQIA 3WQDA 4JR5A 5E1QA 4HMNA 3H2NA 2OLSA 3G2GA 1BVZA 4UR7A 4A6GA 2G0WA 1BTMA 3QV7A 2NSOA 5D8ZA 1IT8A 2VX6A 4ZOAA 1X6LA 2V5DA 2V82A 2ZZ2A 1JCNA 1LROA 4TR9A 3SW6A 3IUIA 4Y96A 3S47A 5DCEA 3E0IA 4XZWA 3CEUA 3QKZA 2FZBA 1XPGA 3C8NA 1JPMA 2HK0A 2J9YA 1TE1A 4N2YA 3GTXA 1JPDX 1UPPA 1KM1A 3W00A 3AXHA 1G7UA 3MWAA 3QLLA 3O07A 3BSHA 3VFCA 1VLIA 3EX1A 4FA3A 4IHCA 1EDTA 3EDKA 1OIFA 1KFLA 4WK9A 3TYUA 2BGSA 4X2PA 5BNKA 2I5GA 2WWDA 1FWWA 1QNQA 3TAKA 4UQAA 4YMZA 2W92A 4AHPA 4V28A 3BDKA 4O8RA 1PEZA 1UYQA 4KFOA 5G4WA 4F0KA 1BQGA 4KF1A 2WCGA 4DAIA 1Q7QA 1A5UA 2POZA 1QI2A 3KVKA 3FJ4A 4AEOA 4LTSA 1TTPA 3VMNA 3CZJA 1CYGA 3LNMA 1U33A 3UQNA 4ALDA 1EP1A 3V35A 1AZ1A 1JGMA 1WUEA 1AL8A 2Z26A 3KE0A 5DXXA 4XIMA 4RV8A 4X61A 2YGYA 3CIXA 1TV7A 3ITGA 4JKMA 3NQBA 4AWEA 1T8QA 2CKSA 1CEOA 1DBTA 3WLIA 4M6VA 2DW7A 1FWBC 3BLPX 3NSXA 4LVBA 4AXNA 3MUAA 3VCRA 3TEVA 3I3BA 3WQWA 1K9DA 1DJZA 1KRBC 1KO0A 2ZOXA 1QNVA 4KCTA 5PTDA 4UTKA 1IEIA 1YNYA 1Q8JA 4GNVA 2D2JA 3PHAA 3NL3A 1CZ1A 2XN0A 4ICCX 3HPXA 4MY1A 1DOSA 2DZAA 3M5VA 2KAUC 1P6BA 2A6NA 1E15A 2QCCA 3EDEA 3I6RA 5EB8A 2Z1XA 4A2RA 2VT0A 4XZNX 3ARZA 2PDBA 4AB4A 1XC4A 2QPSA 4RUBA 1JYNA 3BQ5A 4O57A 1JD9A 1QW9A 1P1XA 5FEWA 1FBAA 5HQEA 1BWLA 4JQ3A 2QV4A 1I6NA 3GHTA 5F4XA 1F76A 1GNXA 3V1HA 2V9DA 3CM4A 4PYSA 4O18A 1WDPA 2QCMA 2YOCA 3WFLA 3A47A 4OGZA 3N19B 3SN1A 1K02A 3GZAA 1W32A 2V38A 3W2LA 4F2TA 4I7UA 3WD0A 2XFYA 3LLDA 5HUPA 2YXGA 2XH4A 3PJXA 1A50A 5IXEA 2ZX7A 3TA6A 4RX0A 2ZZ1A 1MZHA 1VRXA 3PB0A 4HPNA 1TA3B 1YIXA 3UETA 3NIYA 1I9CB 3FVMA 4D6HA 2E68A 5AHLA 4FIQA 4W93A 3AXMA 3G18A 1E9YB 1KBJA 1DWJM 3EOOA 3SUUA 3UVAA 1XQKA 3PPFA 3MP5A 1NELA 3RJYA 4GUHA 9XIMA 1JFXA 3WLSA 3PWGA 1WZAA 4AC1X 4AW7A 1I1WA 4KRUA 1AD1A 4DPQA 1DJGA 1IF2A 2Y5SA 1RQEA 1US3A 2VX7A 4XWUA 3OODA 3CV1A 3H7UA 3XISA 4CD5A 1ISYA 4HVXA 2CKRA 1OG6A 3ZLFA 1XISA 3TZFA 2J24A 3QRHA 1R0MA 4UTMA 5FJPA 4WJEA 4O13A 1PX3A 2QJIA 3CEPA 3G1HA 3SM0A 1Z48A 2CEQA 2DV0A 3VTRA 3NQ8A 4KT2A 1S39A 3B4UA 1ZFJA 4UQEA 5K9CA 3U48A 2XSBA 4HMCA 2P3EA 3AZSA 3C0JA 5HOSA 2XVNA 2NSXA 4M8UA 1H7XA 5EA9A 1RP9A 1IZJA 4LW7A 1KC7A 1H61A 3WK2A 5U4NA 2YDAA 3PVFA 3VC6A 1HJXA 2DZSA 1ADSA 1C92A 1UC4A 1B3YA 2PDGA 3XINA 7TIMA 5D9OA 2X7VA 1XRTA 4DYJA 3CYJA 4HNOA 1NY1A 4IPJA 4JKKA 4WXZA 3QQ1A 3W1UA 3OTRA 1RK6A 1CLXA 3C3UA 4HYRA 2ZWZA 3GNXA 2CZEA 1IE7C 3B06A 3S6OA 2W62A 4NYYA 1ZAIA 1XDMA 2GL5A 4MB1A 1E0XA 3OHIA 1ZP4A 1WXZA 3PTMA 3CV6A 3VDAA 4MKNA 2GVYA 2PRLA 3SI9A 1ZAHA 5G1MA 1XW8A 2R14A 3VKDA 3R12A 2OOFA 3SQMA 4KH2A 4KCUA 1EJ7L 1XIMA 1XL9A 4ADTA 3WIJA 3AOFA 5CH9A 4W7UA 4EF8A 4YTRA 1WAWA 2QDDA 4INFA 2WJDA 1B5TA 4RKAA 4PCFA 5I77A 4BI5A 3FEMA 1GVFA 2ISSA 4K36A 3L4WA 4OQVA 4GI4A 1EPXA 1XH2A 3QR1A 3EXRA 3KRUA 2FH8A 3IJ9A 4XKYA 3IARA 4L80A 1JXKA 3AALA 1R3QA 5G4HC 5F2GA 1G94A 1NH6A 1K4HA 4LB3A 3HQNA 2WSYA 1YADA 4MKVA 4FNSA 1E3XA 1KM6A 3DEQA 5HUOA 1CPUA 3DHFA 1FP8A 1MQPA 1PYMA 2F9RA 1A5SA 4JIEA 3UY8A 1TZ7A 3UJSA 1QFEA 5LA1A 5A2CA 3T09A 4XAGA 3NQEA 3KW3A 4LC8A 5XIMA 3NQCA 3FJ6A 4QLJA 1FWSA 4DELA 4Q8WA 2BNJA 2J6VA 4Q4PA 5CBBA 2RGMA 4N02A 1JF6A 5IDZA 3CUZA 3C56A 5AOUA 3WFZA 1TIWA 1NWRA 4MFEA 2BY3A 3QYQA 3VNMA 1D8CA 4G2DA 4EX4A 3A22A 2WHJA 5TF0A 1H41A 1LF1A 4S3AA 4JIPA 1QMLA 8CGTA 1R2RA 1BKHA 2XZ9A 2PPGA 4JTFA 2RDUA 4N7QA 4IPPA 2VHLA 1NOFA 1GQNA 1KRMA 4UTTA 1VFFA 3AIQA 4HSNA 2GJPA 4QCEA 2PA6A 3IJ6A 4I8DA 3EOEA 2J62A 1F6YA 1EO7A 1W31A 3L66A 3RIKA 2DZWA 2PWGA 3RX4A 2WMKA 2Y62A 1QUMA 1J6PA 4JTGA 3N6JA 2OELA 3M44A 3W0KA 1TQXA 4QNWA 3R25A 4N6FA 2EG8A 2SFPA 2QUVA 2X41A 4CNPA 3KVMA 1H5VA 1LG2A 1UUQA 4A3YA 4JTIA 3AXIA 2DDXA 4GIAA 1ECQA 4NQ1A 4RDWA 4PUKA 1A5OC 1ZJBA 4MB3A 1OM0A 2NUXA 4EANA 3A3HA 3W7HA 5ENLA 2QDGA 3O0FA 1UWIA 3O2LA 1JDDA 1X6UA 5IFPA 4XV0A 2Z0IA 1J93A 4QDPA 1T6MA 1U22A 2EG6A 1XJBA 4CN4A 2NWSA 4PCNA 4B9YA 2JEPA 3FW6A 2WSRA 1LL7A 4PRTA 2D2OA 5T8GA 3VKAA 2V63A 2ATSA 4K1GA 3IJIA 4KEZA 2O4MA 2YCKX 3HGOA 1F74A 4XKMA 5FF3A 1KXVA 4PGLA 4W7WA 5DY3A 4R5EA 4FX8A 2Y85A 5D2YA 3SRHA 2VENA 1W2PA 1F7BA 3Q94A 2C1GA 3UZ5A 1QPOA 3RMJA 3NXFA 2C1HA 3LRMA 3WEZA 1PUDA 4UR8A 5G4EA 4RZBA 2WMFA 1LQ2A 1FX6A 5CEWA 1GWJA 3AO0A 3RN6A 4DBUA 3VNZA 1FCBA 2ZBTA 4A22A 5D9NA 4AD5A 4FLRA 1FY6A 3E5PA 2YIHA 2FKPA 1U2YA 4MGGA 3QLDA 1C8YA 3WDJA 2GJNA 4DRSA 4WD0A 5HNUA 2WMIB 3KEHA 3GBDA 3KUMA 2NVCA 5A8OA 1TCMA 5DELA 3ID7A 4M56A 2J77A 2I9EA 4A8IA 3PNZA 1YPFA 2PDPA 3LBOA 3W76A 4E3VA 4DXXA 1K7XA 4M82A 1QWGA 3WQFA 4Q4QA 3SCOA 2W5FA 2NQJA 2GOUA 3W7GA 1RJQA 3S46A 4C6OA 4BK9A 3VDBA 4IF2A 5HJYA 3W1MA 1EIXA 5C0QA 1FCVA 1X1OA 2QUNA 1VBGA 1UQZA 2EF9A 3TSMA 4Y9NA 3A64A 3U8GA 2Y8VA 2FGZA 1Q6FA 4UNIA 1Q6DA 1A0CA 3GKFA 3TCSA 2OJPA 5AHNA 4L7ZA 4NZCA 3MSRA 3ME3A 3GO2A 3IS4A 3TMQA 1KFJA 2ZQ0A 3FGCB 2VDGA 2PBGA 3STPA 5AC7A 3O6DA 1BRLB 4H19A 4UFIA 5BCAA 2OPJA 1G6CA 2QUTA 1QT1A 3SN0A 2GUYA 4PUDA 1UMLA 5D04C 1E51A 4AMCA 4I5RA 5CCZA 3T42A 2G5WA 1MQRA 1XGZA 1VIWA 3K8LA 4TMBA 4LNCA 1F6KA 4H9VA 2IQDA 2OQLA 1M03A 4LUTA 3NPUA 3OA5A 3AWOA 1IZKA 3WQEA 4FNQA 3UGVA 2PTXA 1ODUA 4W4QA 3HJEA 4QROA 1I2RA 2BY1A 2I1OA 3A4JA 1LBLA 1I1XA 4AZ5A 4XZ9A 4XAYA 3Q37A 1KFWA 4GVGA 1EPVA 2Z1WA 3ZMRA 1W9VA 1GOWA 4FOKA 4AG0A 3CWOX 2PLMA 2HE8A 3L5LA 2PU0A 1ML1A 4QCFA 1HJVA 3KDOA 4QISA 4BR1A 3VNDA 1OZQA 1GJPA 3LXAA 3WK1A 3W1XA 2OKTA 2OO0A 2QNEA 1HG3A 2QF7A 4YHEA 3NQGA 1PKNA 2DP3A 3QYSA 3CV2A 4YNGA 1B3WA 1CCWB 3CQHA 3SAZA 4MUPA 4ERGA 4GO8A 1Y8BA 3JW7A 4G7FA 1XV8A 1B3VA 1L6SA 5C9UA 3BLIA 2PFHA 3FJLA 1E6XM 3W1TA 1DJQA 3G0UA 4J9JA 1UG6A 2KZHA 4QJ5B 4O28A 1MUWA 4MKSA 1C3FA 3KTSA 4HTYA 3U7VA 3UXAA 1EHAA 3AZRA 2Q8LA 2C18A 1OD0A 4AD0A 4JGDA 3VC5A 1GVRA 5A6SA 1OHLA 4ILSA 5DRCA 3VOIA 4Y9OA 2XIMA 3SY8A 4GZIA 4LYQA 7REQA 1KXTA 4Z2HA 4A8LA 1QAPA 4D6DA 2P8CA 1W3TA 4OV9A 3P8JA 3D3FA 1B2YA 4YTTA 1GHSA 2NX9A 2ZCGA 7A3HA 1UJPA 5D2VA 2HS8A 1EWEA 1OJXA 3WO8A 1UD8A 4CQ9A 4AH7A 4YVPA 2Z27A 1NDZA 1YLVA 5A6LA 2J7BA 2BHYA 2WO5A 3OG2A 2G3MA 3SEPA 5C55A 4HIBA 3K2GA 3G0XA 4XD3A 2J7EA 1C8XA 3FNDA 3KL0A 4M7TA 3I3EA 3FA3A 3UWUA 4GZEA 2Y88A 2ZUVA 1AMYA 1W1YA 1X38A 1XM3A 4RL3A 5AC5A 1SGJA 3ZSSA 1QBBA 1IGSA 4GQBA 4MWAD 2CLMA 3ITVA 3W74A 3PK7A 3OIXA 3MS8A 4LS1A 1I45A 3GW0A 1VFMA 1ONXA 3Q65A 5C7HA 4R9XA 1LQAA 4U2ZA 3NVDA 2QT3A 4HPHA 3LHTA 1H1YA 3NDYA 5CXPA 4C6BA 3RPDA 3R4IA 3VIPA 1UD6A 3BSMA 4LX4A 2J75A 1F4AA 1QI3A 3C2EA 4GG9A 3REQB 1Y5VA 3PZUA 1OK6A 1E0UA 4ZSTA 2ZVIA 2HXTA 1E55A 1AH3A 2VD8A 4HP5A 4LBUA 2CBVA 4B9ZA 3M0IA 2DZPA 1VJZA 2A4AA 4IFKA 4D72A 3DBPA 1TVLA 3RU8X 5E09A 2PD5A 1IEQA 2XH0A 4F0MA 1HW6A 3HURA 2I17A 1M3UA 1XYFA 1E1EA 1J5SA 3TXZA 3I7SA 2HSAA 2XTKA 4CNTA 5I5RA 3GZ3A 1FXPA 3CZGA 2ZRUA 2WWCA 2NLYA 7PTDA 3EX2A 4G6CA 4Q4MA 5GPRA 2ASHA 3DUGA 1GPFA 1JQVA 4ERIA 4AWSA 3W7JA 1TMQA 4PL2A 2QJNA 5FJRA 4IP5A 3LM7A 4CD6A 3RCMA 1E6ZA 2DZTA 2WMHA 5BWFA 2VFFA 4I6KA 3QOMA 2DIKA 1ME8A 1C7SA 1WA3A 1KCKA 1R9XA 4Q8PA 1LLWA 2WC7A 2BVWA 3VK5A 2QEZA 7XIMA 3VGDA 3ANVA 3GNOA 3PM6A 5LNSA 5HNRA 1K8YA 3VIOA 2WCSA 1Q63A 1GQKA 3ELFA 2R24A 4DJFD 3ABZA 3I65A 1XDLA 1OYBA 1TWDA 3S1UA 4CVUA 4PODA 3ZVIA 4I9TA 1US2A 3URNA 4ZMGA 2J4GA 1OABA 3MT1A 4UTTC 2PWHA 3VABA 2YCLB 5ABTA 1ZENA 3CK5A 4RNHA 3E2VA 2ZKMX 4LU0A 3QGAC 5D05A 5A95A 1OYCA 3WF2A 3HG5A 4GC4A 4TTUA 4AZBA 4EKJA 3ABSA 3E0LA 2UV8G 3USZA 3A4AA 1SVDA 1CTNA 3P3BA 1FDZA 3U57A 5B7YA 1OX4B 4US6A 1XIHA 2NUYA 3UPBA 4FIRA 2YCJA 2WW5A 1DEDA 3AXKA 3SGUA 1EJSC 2Z2BA 2Y2WA 3N18A 3U4AA 1PPIA 1TPC1 3V36A 4ZENA 2H90A 4OBTA 4PH6A 3TTQA 4F0LA 2VUNA 3G1FA 1M7PA 2IXVA 3FLUA 3LCLA 2QMJA 2J7HA 3W1NA 4B5WA 2HZGA 1TWIA 4POCA 1QVBA 4K8HA 2A0NA 4OBRA 1H62A 3CH9A 4HYVA 1SJAA 3S2JA 2V3EA 4UB9A 1Q6LA 1U1JA 4BI6A 1UZ4A 2AGTA 3RRAA 1MW1A 3DGBA 3L4XA 4IMFA 4LBSA 2OU4A 4H04A 4Q3MA 3IPWA 4QSFA 3LCWA 3UZZA 4GY7A 2FLIA 3QMSA 2Y4SA 4TOQA 3A12A 5KEZA 4PMXA 3VX0A 4LB4A 4NUWA 1PB0A 1UW9A 3UVIA 4H2HA 3F4WA 3OLGA 1I2NA 3LXCA 1AQHA 3W07A 1S5WA 2IPGA 2RDWA 1SR9A 3VNJA 3MA8A 3TKFA 1XRVA 4LAOA 3STEA 2FJUB 1B0IA 1UBPC 1AD4A 1TRIA 5D30A 1K6AA 3QQWA 4ROQA 3EWUA 2O0TA 1NDYA 5CSUA 4F66A 3VIIA 4FPSA 1BHGA 3UFYA 3UR2A 1KM5A 4BWLA 4AIOA 1Q6QA 4MJMA 1IXQA 1TJ2A 4PN2A 3P62A 5ECVA 3DOPA 4O50A 3KRSA 2UY4A 3PZVA 2INZA 2OGYA 3R2GA 4NJKA 4U2YA 2XN2A 3LCGA 3CUGA 1BYBA 2IKGA 5D09A 3VGFA 2WVVA 2ZE3A 3SY1A 3EMZA 1NWUA 1NIUA 3SIZA 1AQ0A 1EDGA 3CUHA 3GVVA 3GD6A 1HL2A 3EYPA 4ROPA 1H49A 4A8NA 1AVAA 2QCDB 4HJFA 1ONEA 2DQXA 2F7FA 1EOKA 2OB3A 3M07A 3VMPA 3WMBA 3NZRA 2CWXA 3T2OA 1VENA 1G67A 5D2TA 2OODA 2A2IA 3CPRA 2V5BA 3VAVA 1FWNA 4D6GA 5H8UA 1CECA 3HFYA 3BV7A 3LERA 1RPXA 1FHUA 3PZGA 1LL4A 1VPQA 3P5YA 2B4GA 3WSUA 3RHGA 2CLHA 3VOHA 4C6IA 3L2MA 2QKFA 3DECA 4XD6A 2DJXA 3ZJ8A 4G7EB 1ZS2A 1JAEA 3JR2A 1TWZA 1FXQA 4OUEA 4R88A 1KXQA 2XHYA 1GT8A 1TTIA 4JTUA 3W1AA 3VIJA 2ZRYA 1EL3A 4CQAA 3KZPA 1HVXA 4P7LA 3WLJA 4EP8C 2DORA 3VOGA 3VKJA 3HV8A 3O63A 1QK0A 1YNPA 5I07A 3N4AA 4JL2A 4KEUA 4BEUA 2DVTA 3C2YA 2RFGA 3GH4A 1TPH1 4F0SA 1A3XA 1W5OA 4DIAA 4NZ3A 3BW4A 1F3WA 1Q13A 1PKYA 3WKZA 1TV5A 2YL9A 1OX5A 4LUSB 1U83A 1JCXA 2E5DA 2X1RA 3KVJA 1SUXA 1JPIA 1TJRA 3M47A 2Z25A 3C5QA 2WVSA 1S2TA 2GSEA 5I3FA 3NCOA 4JFWA 5SWUA 1AJ2A 1XYMA 2CFFA 3TYCA 3S6TA 4NL1A 4UOZA 3AICA 3LSBA 4Z2KA 3UZXA 3QGKC 3UR8A 4CEXC 3CV7A 1A47A 1WKFA 4DN1A 2A7NA 1L6WA 1OT2A 3PN8A 4YCPA 2ZVRA 4Q4RA 4S3BA 4GLEA 1NDWA 1CBGA 3ABRA 3OZMA 4MZ8A 3TR2A 2Q09A 4NXKA 3GQYA 2NVDA 1BF6A 3G77A 4GX9A 4LEFA 2HJPA 4QQ3A 1N2VA 3TVAA 4W88A 4CD7A 3MYPA 5FACA 4Z1YA 2J9ZA 4J7RA 2DT0A 4GJIA 5JMUA 3WEMA 3CUFA 3W37A 3BXWA 4DO4A 3MANA 1BYCA 2WJFA 3MV01 3HMJG 4P61A 3QXBA 3ZZ1A 2WBGA 4W86A 1IR1A 1CI1A 3K8KA 4S2CA 2ZRZA 1HZYA 3W72A 3PPGA 1LG1A 2ONEA 3ARPA 3OHMB 3ITCA 4JHOA 3HZ3A 4IMCA 3T40A 3DAQA 4QGCA 2GGEA 1H11A 3MBFA 3EOLA 1DJHA 1GW1A 1OY0A 3WJYA 1J2BA 2PP1A 2BV9A 2QUUA 5DRIA 3W28A 1CGYA 3N4EA 1H51A 4DYEA 1WKEA 3W2KA 3W6LA 1QPQA 4BCEA 4DBSA 5C9ZA 1JYVA 1DIEA 3PF3A 5FJIA 1SSGA 4QJ1A 3B40A 1P0BA 1TPFA 1UD4A 2PWFA 3CAQA 3NNTA 1VH7A 2PTWA 2CLOA 5AYZA 3TU9A 4ZO9A 3E96A 4Z2LA 3EGJA 5KITA 2BG5A 2VGIA 4XAPA 3MU7A 3WJZA 4GABA 1E6RA 3GXFA 1R86A 4JKLA 4XSLA 2ZUNA 1JJKA 4X0NA 3SZ8A 4FMVA 3C6CA 3HM7A 3PZTA 3LRKA 2GGGA 4DF0A 5IHRA 1LBFA 4ZL1A 1PVNA 4HJWA 1EJVC 3LCHA 2IPJA 4JTHA 2A3LA 3QF0A 1AJ0A 5A5WA 4GRSA 1UQYA 3P80A 3ITTA 1IEVA 3BLLA 2CXGA 2BLEA 3S2NA 3QZAA 1GVYA 1QOPA 4H7ZA 1R7AA 4PUEA 3GX9A 2PI6A 3DFHA 4KRZA 1JULA 3OLIA 3GS6A 4JY8A 3U7BA 3DFSA 1CXKA 2WYSA 2WJZA 3GSMA 3GXMA 2PE4A 5TAOA 3VPLA 5F1VA 3MUIA 1E6PA 3ARSA 1K4GA 3GVRA 3OVRA 2WSQA 5FJUA 1W3JA 1V4YA 4CNUA 4DJDC 3C2OA 1CLVA 4O4WA 3WD3A 2BASA 3LPOA 4HHPA 3KLLA 4AQLA 5D37A 1HJWA 4LC6A 2PDQA 1N82A 2VCBA 3WNKA 1W5QA 4WSJA 2CZDA 2OQHA 3A6OA 5JIWA 3L0GA 1BD0A 1BPLB 4GOAA 4E8GA 3WNPA 2DUZA 4WOQA 4YVXA 1O7AA 1Y5WA 1XCFA 1J4EA 2B7PA 3TN5A 1D3GA 3N1AA 4J3WA 2ZUMA 5EBAA 2WVTA 4JPGA 4FXJA 4WHBA 4WQ6A 5EFFA 5CC7A 3NYZA 1LRTA 3UY7A 1RBLA 4EPBC 3BL3A 3OO2A 2WM0A 3KRBA 3T4WA 1MWOA 3QOKA 2BOGX 3MKCA 3B9OA 3WNLA 1AZ2A 1NOUA 2ISDA 2VDHA 1M53A 2EKCA 2OEJA 3HMCA 1R6WA 1RHCA 3GDLA 3DKJA 4JHMA 1CT5A 5J8LA 2E09A 3PR2A 1VP5A 1DWIM 4Q8TA 3GC5A 5AHIA 1ISXA 3KWSA 2XM1A 3BJFA 2VI0A 5AHEA 1VBUA 1X1NA 1LCOA 1HKKA 3CHVA 3WF0A 3L68A 2D2GA 1TV8A 1O66A 5C7VA 1YHTA 4OE7A 3G8EA 1VAHA 5CBJA 3T07A 3S2CA 1IIGA 5LIXX 2AQVA 3NSMA 3RPTA 4C5YA 2XIBA 1S2UA 1JRCA 4JYEA 1RD5A 1I8JA 2DZUA 2VC5A 4YN5A 3W2NA 1ENUA 4EXBA 3CMFA 2J8GA 3AFBA 5HJLA 2PU1A 2GJXB 1YDYA 2BZNA 2R1LA 1D9EA 4AC7C 4IMGA 2XWEA 4IFOA 1OFAA 1TFVA 1KBBA 1KA9F 5H2ZA 4HA4A 4JQ2A 1ZSXA 4ZR8A 5DN1A 1PIIA 1REQB 2A3HA 5I00A 1JRBA 1B3OA 4RE3A 1WKDA 3H7VA 3H2AA 3PZQA 4XD4A 4PUWA 1S2AA 4N9EA 1QI4A 1A5NC 4HHMA 3PFRA 5CPTA 1GZ1A 1GQJA 4KCWA 3CHDA 2VFIA 3HGJA 1Z42A 4XB3A 3SCSA 3GR4A 3PAJA 2ZZ3A 3AC0A 1OD8A 5FF4A 3TH6A 1AW2A 3VMOA 2P3ZA 4W85A 3WD1A 2R94A 4BFAA 4BQ3A 5AZ0A 1KGUA 1QATA 4R85A 2OGJA 4FNUA 1AH4A 2ACUA 5DF0A 4MM1A 3LV5A 3MHFA 4RK8A 4A4AA 3GG0A 3WLPA 3UXIA 1W8SA 3T6CA 3A5FA 4E4UA 2QJHA 2CYGA 1EYEA 4TO8A 4BWLC 1K70A 1CIUA 1EQCA 1OGGA 4ENLA 4Q4KA 3YPIA 4GMEA 5I2UA 2GPTA 2VEFA 2X1SA 1M7JA 4LBRA 1MSSA 3V4BA 5HPCA 1OADA 3PP7A 1DPMA 2CBIA 3VU2A 3L21A 4YYFA 1IHIA 1BEUA 1O5QA 4KPLA 1OFQA 2NQLA 3E49A 1A0DA 3TFCA 1BQCA 3MUXA 2C8NA 5K2ZA 3UA3A 2PBOA 2PEVA 4ADSA 1VBJA 4HK6A 3W1QA 4PCPA 4WY0F 1W1VA 2WQDA 3S9ZA 1XH1A 1GYMA 1YPXA 1YRRA 2AL2B 4HZ6A 7TAAA 1ISWA 3MMUA 4CKQA 1JAKA 4ZCWA 1RLCL 5AC8A 4HNNA 5HA7A 1HNYA 3NTYA 4GBDA 3IIPA 3AHXA 1Z7AA 1P0NA 3OBAA 4LYKA 1UKOA 4XTIA 1FWTA 3LK6A 3TC7A 1HKWA 1BVNP 3L7RA 4ML9A 3TJ4A 1XG3A 1NVMA 1YW1A 1V3LA 4AAJA 4E8CA 2UY2A 2HMCA 4J3TA 3WUFA 4EF9A 1IGWA 2E5BA 1FDYA 1I0BA 3RM4A 4PMYA 5M03A 4PULA 1A80A 2WNZA 2J8FA 3GDMA 3IJ7A 3QW3A 3BAXA 1BFNA 2EG7A 3IIVA 4J27A 4IGNA 3B04A 1HL8A 1G7VA 1E40A 8A3HA 3RILA 4UTWA 2DUAA 5HR7A 3VZXA 2BY2A 1FHDA 1VGAA 5HATA 4RNJA 1WV2A 1EC8A 5EU9A 2Z29A 4H8NA 1XLDA 4F0RA 5AECA 3FV9A 3UWWA 2Q8XA 3T2PA 4H01A 2AMGA 5KINA 3VD7A 2EJ1A 4HPGA 4IL2A 3BVJA 4AEEA 1NWSA 3PC0A 3W24A 1PE1A 1L8NA 4IQLA 1UR9A 3SUVA 2DSVA 4GNKB 3EA3A 4Y9MA 4WDWA 2PZNA 4C7FA 5AN7A 3H24A 4AZIA 2WMGA 4MJ4A 3URAA 1JEZA 1EP3A 3BOFA 2XISA 2WKGA 1EXPA 3UA4A 1E5JA 4KIEA 4RR4A 5AKQA 3SCTA 4NNAA 4QS5A 1W1B1 1CDGA 2BODX 1YDVA 2I5IA 2D0HA 3D5HA 3V1PA 2OG9A 3A13A 3OGVA 3BLFA 5I3DA 1CXHA 1QHOA 1WXJA 2GYIA 4K2SA 3VKCA 3AS2A 5A6MA 1ME7A 1VFHA 2Y5JA 4NSBA 1TO3A 2Z7KA 4R34A 5IRPA 4MJZA 4GJ1A 2INFA 4LT9A 4AZHA 3LZ3A 1GORA 4DXKA 1KFKA 1VFLA 4O16A 2EAWA 1V8EA 4A29A 3UCCA 3BZJA 3MP4A 1ICQA 4MG4A 4FXSA 2YKKA 3E0VA 3SUTA 3DCPA 4U33A 4ZQNA 4GCXA 5AVHA 5G2WA 3MKVA 3BZGA 5D4YA 5I03A 1VEMA 2PC8A 1OC7A 4E2BA 3VO0A 4J2MA 1H7RA 2RH9A 1V93A 1XRFA 3WLQA 3GW3A 3HGSA 4ATDA 1CGTA 4MNMA 3V5OA 3QZ6A 1XQLA 4ACYA 4JIHA 1UBSA 1ME9A 2EXOA 1TPEA 3BOXA 1ZY9A 1CENA 3N9RA 3F2BA 4RXGA 5DMMA 3L23A 4M29A 5DX7A 3IGSA 1B3XA 4H1ZA 1ODZA 4JIQA 2HS6A 4P7OA 3DH7A 1LT8A 2Q02A 3VCNA 4DWSA 2W3ZA 3U5UA 3HG2A 3KTXA 4GUGA 3NZQA 3G1AA 4JY9A 4WKHA 3UPWA 4PC8A 4GUJA 4X60A 1TTQA 1O94A 1LOLA 2E40A 1S5TA 2PLKA 2V3FA 2VGBA 7ENLA 4AXKA 4ADUA 1W5MA 3UXDA 3O0KA 1FWGC 3THUA 4M80A 4HBKA 2D1ZA 4FP1A 1H0GA 2BBFA 1H50A 4AVFA 3F5JA 3D0CA 4L9YA 5JH1A 3ARXA 4IQEA 4BHYA 4Y6GA 4YCOA 2VEMA 4DX3A 5HAOA 1MRQA 5HQLA 2XYLA 1Q6CA 4QNEA 5B80A 4GZ7A 4IIBA 2VFDA 4ZB0A 4AY1A 5M2FX 4AHOA 4WF7A 3FXGA 2PDUA 4O15A 4CNSA 5I24A 3U5YA 3WMCA 4G1NA 4AMAA 3W7IA 2REQA 2PF0A 3PSVA 3DYPA 1IWAA 2V2CA 1K7FA 3DG6A 3QV6A 2WV8A 4HHLA 2E6DA 4JX6A 4MFDA 4ZZ9A 4I7VA 4GYKA 3I7RA 3BMVA 5CPLA 3KBJA 1D7KA 2WB5A 2YFNA 1B54A 1ZBKA 3ORWA 3QH2A 3AMGA 3M1ZA 5C9WA 4QTGA 5JBFA 4NJGA 3W88A 2GUUA 5DBUA 3QC0A 2CLFA 2VFEA 3B8IA 3O6CA 4J3ZA 2J7GA 3TONA 1SO5A 4EWJA 4IPLA 5H1WA 3LMYA 1OCJA 3OG3A 1PJ9A 4DY1A 3HGRA 3EDFA 1E6NA 2XVKA 2VCCA 2YZ5A 1EJTC 4S1FA 3WQVA 4DF1A 3IUHA 3UJFA 3T05A 2GUBA 5CGQA 1TSIA 1NOWA 4AY8A 3N9KA 2EO7A 1GOKA 3MCOA 1E5NA 2W0UA 1UASA 4IQDA 2EPNA 3GFZA 3WQ5A 4NIRA 2PGWA 1KCXA 4P8XA 4PRWA 4UNKA 5D32A 3EX6A 2VYOA 3II1A 3LPFA 3GTNA 3LI0A 3DG7A 4DYKA 3QPEA 3KP1A 3BK0A 2YW4A 3R13A 2NQZA 2A3EA 4Y8EA 4MY9A 2P76A 2E1WA 2FTWA 4NZJA 4YS1A 1TTJA 1QI0A 4H6RA 4YTUA 3VDGA 2VVNA 1BYDA 4GI6A 3VKBA 1OF8A 3M0MA 4AVOA 3FX4A 4QG8A 4LCRA 4DBEA 3GAYA 2PC4A 1J6OA 3BO9A 3MI3A 4PA8A 4QLKA 3F4VA 3MY9A 1RY8A 1QHZA 3GDBA 1TKKA 4C1LA 3BC9A 4YU1A 5GVJA 4Q8UA 2V6AA 2C79A 1WZMA 3H2FA 1OB0A 2PB1A 3FFSA 4D6JA 2G96A 2ZUWA 1IZCA 1T7LA 4ZB5A 1KM4A 3LM3A 3OZPA 4HU4A 3GIYA 5ABFB 3TWBA 1V3JA 1J9YA 3TTYA 4DZIA 1CGVA 4GQRA 4HYWA 4UFMA 1S1RA 4IXXA 5E70A 1ZJHA 1KKOA 4LAZA 5KZ6A 1EJXC 1XUUA 3N9SA 3N2OA 4LCSA 2OX4A 5C54A 3WH9A 4M51A 3QW4B 1R87A 1QW7A 4GINA 3QV9A 1YDNA 1E4IA 1QI5A 1OCNA 3ZR5A 4NP7A 1T96A 4QE5A 2PD9A 1P6WA 3MCNA 5D2XA 3LDVA 2F6UA 4L64A 1PHWA 3BAIA 1EBHA 3TTOA 2VR2A 1VQTA 3CAVA 3WLMA 1U30A 1PIGA 5BROA 3NVTA 1CGWA 2B81A 4DUXA 5H6HA 3TTEA 2DJLA 4PCSA 3K46A 3NOYA 3P61A 1DE5A 2WQPA 3UWZA 1MXGA 1WZLA 4A3UA 1W0MA 2DSZA 3GFYA 3W7NA 1GKQA 1KCLA 3ICJA 3LCXA 4ZQPA 2Y6ZA 1FCQA 1LWHA 3GLCA 3KL5A 4NAEB 1JYWA 4QM1A 3E2QA 4AZCB 3P84A 3PJUA 1U5HA 2VMFA 3AI0A 5KTLA 3MSDA 4K38A 2KX9A 4JZ5A 4GIRA 4KWUA 3E38A 1F3XA 1ZBWA 2VNCA 5CC3A 4QJ3B 4JTQA 1GVEA 3WY1A 4PE8A 1C29A 3P7YA 1JZ2A 1OG0A 1NTHA 3AMLA 5GJMA 4WX2A 1BYAA 2YB1A 3H54A 2YA0A 2QVNA 3NOEA 4I9MA 1OC5A 1TA3A 1IR2A 5A3HA 1P0EA 1MDRA 4NX5A 4RV3A 1VJIA 4U3CA 2Z1BA 3GNNA 2I56A 3R94A 3IJQA 1AK5A 3KOZA 1W56A 2WBKA 1AL7A 1LUCB 2P0IA 3GU1A 4G9PA 3BOLA 3P93A 1W17A 5HWJA 4BEQA 1LLOA 2OFJA 4IIDA 4IWWA 3AISA 2C3ZA 3GNDA 4N4PA 1SZFA 4EWND 1XCXA 3BARA 1WOBA 3SRFA 2R1KA 5EGRA 5FSDC 1QPRA 4C5ZA 4C91A 2IW0A 4NT0A 1W1TA 4FOUA 1HUVA 4D8ZA 3L4VA 3LBMA 2GZXA 3W7PA 2BX7A 2FGLA 1F5ZA 1MNZA 3WDPP 2FHBA 1PAMA 1O4UA 1XIGA 3BGAA 1H7PA 4JTSA 3E74A 1F3EA 2C1IA 2PDKA 2CESA 4GUIA 2HROA 4L6HA 4C6PA 1V3KA 1W91A 3QY8A 5LGXA 1DJXA 3RXZA 4NHVA 3ZT5A 6TIMA 2RJGA 4LQ1A 5FD0A 3U0HA 1PZ3A 4DO5A 3U4FA 3WYZA 5BOEA 4C7DA 4UTWC 4UUIA 2OYLA 1KWGA 5I02A 1Q6EA 3TYEA 4YWSA 4NZ4A 5EMMA 2WSKA 2UWFA 3VD9A 4K3ZA 1ZGDA 2GQ9A 3P82A 8XIAA 1DV7A 3N34A 3N17A 3W70A 3LPPA 5GNYA 4QAWA 4IICA 3WDQA 3Q67A 4KESA 5MKGB 4XAZA 4ZGYA 1ZALA 4DUOA 5K4XA 2NXIA 3U3HA 2VOTA 2EPKX 1OGSA 3P14A 4O19A 2PZ0A 3ZVHB 5BXTA 1P0KA 2OLAA 3K1GA 4RDZA 1W3HA 1PKMA 4FR1A 4C6EA 1U1HA 2D2HA 1NFGA 3HO8A 5GNXA 3AYSA 3W53A 3V3WA 5LNWA 3PAOA 4D6FA 4RLIA 2OZ3A 1HVQA 3LPGA 3TYAA 3KBMA 2QW5A 3E9AA 4PMVA 3F5LA 1XGEA 1A5MC 4GY0A 1JXJA 1X98A 4NAFB 2A6LA 2YYUA 4GQ0A 4JIIX 2P0OA 3A23A 4Q8NA 1HGYA 2OZ8A 2CBUA 1J01A 2G8ZA 2CZFA 3VGHA 2PS2A 5I3GA 2G37A 1F8MA 2PF8A 2OYMA 3PS7A 4EPDC 3EB2A 4WDXA 3OGRA 3N4FA 1JR1A 2R1MA 5ABGA 1K8CA 1TPDA 4CUCA 4GFIA 4UOJA 4YYCA 4L9XA 4PUMA 4RZ5A 3DN5A 2C6QA 3S1GA 1EF2A 1UUOA 3QBUA 1PYFA 3UYCA 3PANA 3N2CA 3KBSA 3W7RA 3F7JA 4Z0SA 4CQDA 2QS8A 4XBSA 4L1WA 3VZZA 3DERA 1R3VA 2XVGA 3QHNA 1KRAC 3M0VA 1N7KA 3WBWA 1AJZA 1KXHA 3GXDA 2XIIA 3BICA 4XZIA 3PNUA 4CU8A 4CN6A 1L2UA 3W7KA 3VIFA 2GDVA 3MVTA 3T0AA 1V6UA 4LAMA 5I06A 1GHRA 4D2JA 4DWSC 2Q8ZA 1GG0A 5CJ5A 3VGEA 5KETA 4MPQA 3W23A 3LSCA 1NU5A 3WQ4A 1UA3A 1GKRA 3QQ0A 4LS0A 3SJ3A 1EA0A 2ZC8A 3AU2A 3AWNA 2WJEA 5CKSA 3W86A 2GVGA 3WX7A 4W8AA 2D23A 4PMNA 5C5YA 2W9MA 3GXIA 3BTNA 2W91A 4MNKA 4F4RA 2WANA 3EXTA 2D0GA 4QHRA 3B0XA 3ISIX 3NJ3A 3LRLA 5HANA 3LHZA 2GQAA 3NR0A 4AIBA 3R7MA 1TVNA 4EACA 3HQ1A 1HJSA 2VKZG 1V6TA 2O7QA 1UWTA 3ZXWA 3UEQA 2ZRWA 3I68A 3NDZA 2X05A 1W5NA 3C8FA 4Z42C 1K8ZA 2BSLA 5AC6A 3UBPC 4S3EA 3DHUA 4TX6A 4WCJA 2PTZA 2VRJA 5DY2A 1EIBA 5LIYX 2H3DA 4F48A 3EPOA 1BXCA 3GXPA 2GK1B 3W2JA 5LGZA 2XG9A 1F6PA 4P7NA 1A5CA 4UFHA 5TQLA 1E73M 5D33A 4ZXOA 1SR0A 3H7RA 3G22A 3ITXA 2WNNA 1XYAA 4GXWA 4HA3A 3E0WA 4MY8A 1PIFA 1HO1A 4MB4A 3GRIA 1UH3A 2VZVA 4LVGA 1XI3A 2VFHA 4PTXA 1OVDA 1VCFA 3MSYA 5T9BG 3B05A 4IIHA 1YPIA 3CHCA 3NPWA 2CLEA 1UP3A 3VZYA 2EPMX 5EBUA 2VELA 4H8UA 4ECLA 3FA4A 1Z41A 2PMQA 4NI3A 2PP3A 4XBJA 1SFJA 1XHGA 1UPMB 1LOSA 3VXGA 4HGXA 4Z1BA 3S42A 3UZWA 5E5CA 2MNRA 2PWVA 2D0FA 3QSRA 3L12A 5MF5A 1MUMA 1X8FA 1AH0A 4K6AA 2I57A 2WMIA 3QMTA 3W2MA 2VGGA 3LHVA 4LV9A 2G3NA 1XLKA 5FL0A 1UR2A 3DGRA 3LTSA 4AYGA 1RUSA 2A5HA 3QMRA 2YL5A 5A6JA 1I0DA 3G24A 3AIUA 2E1DA 3ZR4A 3B9AA 3KBWA 4YIWA 5DANA 2DIEA 1WKYA 4Y9AA 1OF6A 1XF0A 4LCQA 4WY0B 5LSMA 4HNCA 3VNYA 2IKJA 4AX7A 2DSWA 4RDYA 5J5RA 2BHUA 3GIPA 4Q7NA 5AVNA 1W2VA 3OBKA 1KTCA 1HN1A 3DFPA 3WH6A 1XIJA 4LY4A 4JFVA 2PSNA 2HBXA 2BDQA 1JZ7A 1LRNA 4WKAA 2PODA 1G4PA 4Q32A 1J79A 4ACZB 2E9MA 3K5XA 4O1FA 1B57A 1X7IA 3ABOA 1M41A 4TIMA 5K7JA 3FGCA 4I3GA 4JTLA 5HMDA 4X0VA 2YLAA 4ZSUA 1BRLA 1PTAA 3LOTA 1QJWA 3M7WA 4GNJA 4YJ5A 3U2EA 3E2RA 1TR1A 1XCWA 5EY5A 3KP0A 4IIGA 1PX8A 4S3FA 3EBVA 3C86A 1XX1A 1KM2A 3GTIA 3STFA 3FA5A 2IKIA 5T26A 3W2UA 3N12A 4ZXLA 3LQGA 1Z9AA 3O6AA 4H9UA 4HCHA 5CPMA 4Q33A 4QXIA 4LWWA 3PBGA 3FY1A 2E6AA 1C7TA 2H9AB 1K8XA 3QFWA 2ZXQA 1F9CA 1RK5A 2VR5A 1ONRA 5JBDA 1OINA 4Z08A 4OECA 4MWAB 3AAMA 4G8TA 3UWQA 4FLSA 4KWVA 3R11A 5E9XA 1OK4A 4AYSA 3VNIA 1WX0A 5DBTA 4CU7A 2DW6A 1FHLA 1EUAA 2V68A 5HULA 3T2QA 2YBTA 4AD2A 2INEA 4LVFA 1X7FA 1BLIA 4O52A 1LL6A 3BCJA 4LYRA 1UIOA 1XYZA 4BQ4A 4K39A 4A35A 1XINA 2CZVA 9XIAA 4RE4A 4E6MA 4LOCA 4OV4A 4EXQA 2YL8A 4WSKA 1Y0EA 3N25A 2E6YA 3WELA 3KOFA 1DWGM 3CT2A 4AD3A 4JFTA 4H9XA 4GZJA 4GX8A 1SW7A 1J12A 1V6VA 3G6MA 3DI0A 4DF2A 3H26A 1ZUAX 4LUIA 4LALA 2HVOA 3MJYA 2XINA 4L1GA 3RFAA 2BVDA 2PDLA 2C16A 5FEZA 2DU2A 4H9ZA 4E4PA 2GWGA 4OT7A 1ISVA 1JD7A 4O53A 4PMJA 2EQDA 1RD6A 3IGHX 1AFSA 1B9ZA 3MHUA 2GJLA 2OKOA 4US5A 2J13A 2F8QA 4JS3A 3PULA 3O3RA 2X1TA 4C65A 3LI1A 4MOZA 3LQLA 5E6YA 3QV8A 3TSDA 3ARRA 3PUGA 3KHJA 1MMFA 1BWKA 2ZC1A 1DJYA 2EPHA 1J8VA 3EWXA 3B8WA 3P0XA 5DLCA 1T0OA 1JCYA 3BLDA 4FNTA 4IJCA 1JCTA 3MMDA 1QPNA 2QDHA 2O55A 1N55A 3CUIA 1VFTA 3H2OA 1PTGA 2JEQA 2WC3A 2DZXA 3EMQA 3TE9A 1ZCCA 4IFRA 4TMCA 1MRAA 4PFHA 3MSGA 1XBYA 3GHUA 1UUMA 5CQ1A 1G0CA 1XYLA 1SFTA 1MQQA 2WHMA 2POTA 5CZJA 2FYMA 4REQB 1JF5A 3RR1A 1XYBA 5A8MA 1UH4A 3QY6A 3NL5A 4H7VA 3GYCA 1VIZA 3WENA 1FKWA 4DJFC 1GJUA 2GVJA 3C0SA 3F4CA 4YVVA 4DJEA 1WDWA 2QYGA 3REQA 1VKFA 4DI8A 4WXYA 2AL1A 1T8XA 1OC6A 4YTQA 2HQAA 2WKJA 2X1UA 3ZO9A 3F2CA 2CCRA 1XR2A 2BVYA 1J18A 4WVXA 3UG4A 5LYRA 3S5NA 2UZ9A 2ALRA 2R6OA 2VZTA 1LOQA 3P6LA 1HJUA 3HPAA 1P48A 4PMRA 1DP0A 4U4MA 3IANA 3EDDA 3TYBA 3EWYA 3S2MA 1VB9A 2OWCA 3PBVA 3MBDA 1OFOA 3O05A 3QPZA 3MDWA 4AZGA 3GHSA 1GOOA 2OYKA 1JDFA 3EX3A 3KFTA 3CHFA 4PTWA 1XLHA 1XKYA 3WNMA 2X2GA 1V02E 3S3GA 3TC6A 3NXLA 3NPVA 4RXFA 3O16A 4IPIA 2BY0A 4ZFMA 4PMOA 3S1WA 4UWMA 1IEWA 3VD5A 1DVJA 1RAKA 4L6OA 1HL9A 2CERA 3N29A 1TELA 3M5ZA 3VKKA 3T7VA 3KRZA 1OSEA 3C61A 3R89A 3J7HA 1E0WA 2FB3A 1UR8A 2VCAA 4XIAA 3EEZA 5MHBA 4AD4A 3RR4A 3FXYA 4Q7IA 4W5UA 1GW9A 4JFUA 2YDQA 4DUWA 3HF3A 3PSWA 3NL2A 4FNRA 1NQKA 1E3ZA 2CZ5A 4QSHA 3IAQA 1FCUA 1GOQA 2AAMA 2HE5A 1VBHA 1UR4A 3FDKA 5KMYA 2HEJA 3CS2A 4ZO6A 4A3QA 1Z8AA 5LA2A 4PMZA 1HKMA 4J3XA 2F2HA 3W25A 4AUBA 3M64A 2PLCA 3ZJ6A 1H60A 2D20A 3HV9A 3ITYA 3LG3A 3UJ2A 2YCLA 1LLZA 1DE6A 4A21A 1BXBA 1ALDA 3CQKA 4PUUA 4LF2A 2NV2A 4PTDA 2TODA 3HPSA 3LLXA 3OEXA 5JIPA 5IFTA 1FOBA 3NQFA 4F0HA 2NX1A 3WJWA 3AUJA 1AW5A 3GY1A 4IUGA 4BQ2A 1OX4A 4S3DA 3RNDA 4Z2JA 1E70M 4S38A 3LXBA 4M7SA 2J7FA 2WVUA 4MJ2A 1RJPA 2PTDA 3DXIA 4JEQA 2AQWA 2JKAA 3ZT7A 1SSDA 3GUWA 1B90A 5I3KA 1E1CB 4JEJA 2FIQA 2VD9A 3CH0A 5A6BA 3IACA 1SM9A 2ABBA 3O7UA 4KFPA 2VC7A 3ARUA 1E4NA 3WLTA 4F9JA 2Y70A 1GZJA 1XLAA 3NA8A 2GQ8A 3KCJA 3O8AA 1UZDA 4TX8A 4FHAA 2XPKA 2E3ZA 4I6VA 1YYAA 1IXNA 4WDTA 3WLNA 4JN6A 1F3TA 4F3HA 2O9OA 2Y8UA 4ZODA 4AWTA 1AQMA 2ZZ5A 4QBXA 4GQQA 1Q2RA 4GVFA 1HP5A 2X0YA 2ZIDA 1XWYA 2GDUA 1SFLA 5TBOA 4U31A 3UNDA 4FLQA 2GOKA 5K4ZA 3VCCA 5C9RA 2ZZ7A 3A21A 1SFSA 1P43A 1R5YA 3R1ZA 1JPKA 1TVPA 4QR6A 4D1IA 5FCZA 1XP3A 1E4MM 1UHVA 1CXLA 1UB3A 1SJBA 3UESA 3RM8A 3BURA 3DESA 4GIEA 1H63A 3QC3A 2Y24A 5FF7A 4BI7A 6CGTA 1FH7A 1QO2A 1VS1A 3QR3A 3T08A 3SIMA 1FFRA 4WR3A 1JUKA 3CU2A 3CZKA 3G1VA 4GKTA 4GJJA 4JICA 1I60A 4JCMA 2CU0A 2PWDA 2ISVA 3L2LA 4Z1CA 2CC0A 1JFHA 2ZDSA 4JTDA 4PMDA 1PZ1A 3SFWA 4B3KA 4ML4A 4F2BA 4WIWA 3TK7A 3ZIZA 3TX9A 3FKRA 3UF9A 3JU2A 3LS9A 1UOKA 5DQPA 2YBUA 2WZMA 2FFCA 2PGEA 3LENA 1TV2A 1YNQA 1H4PA 2D69A 2VJXA 4Q8OA 3AHVA 1WNOA 3WEOA 3DI1A 1PO9A 2OEMA 3M4HA 3TUUA 3C3NA 3DZ1A 2B7OA 3KCOA 3W73A 5A2BA 1C93A 1ZPTA 2QCDA 1ZCOA 1MDLA 1YTKA 3WD2A 2YL6A 1IIHA 1V5XA 4TUFA 4TVUA 1CB2A 3KZSA 3TN6A 1XKJA 1GG1A 2I16A 3VFLA 4PTMA 4ZB2A 2FHCA 1YE4A 3FJNA 5J5DA 4YWIA 1FKXA 3PB2A 4P8WA 3T78A 3P8IA 3SGZA 3BAYA 2WKLA 2X16A 9CGTA 3ANUA 2OSYA 1H0IA 3GKAA 3V0UA 3CIWA 4ZVJA 2OO6A 1D7FA 3HQOA 4G7EA 2YZRA 4O1CA 4P8UA 2TPSA 5I7GA 4F8XA 3H2MA 4LFYA 4E8DA 1OX6A 1GONA 2D22A 4CEUC 1TV4A 3IRSA 2QVHA 5FKYA 3NO3A 4ZTYA 1QBAA 3CWNA 3FYOA 2VOMA 5K3VA 3IGUA 3AYTA 5HQMA 1ADDA 2WXDM 1KRCC 3TFXA 3L0NA 4MMWA 4LUSA 2QJGA 2OMAA 1EEXA 4OOZA 3N2BA 2P53A 1V6XA 1MEWA 1PWLA 3WK3A 3POCA 1SO3A 5EMLA 3WLKX 5C2CA 3V18A 2DZVA 3RX3A 1V51A 1KQYA 3BMWA 3T4CA 2C0AA 1QRQA 2IS7A 1DTNA 4O12A 4N4QA 3N3MA 5U7SA 4IUOA 1M7XA 4UFLA 3NGFA 8TIMA 1KV5A 1Q7MA 5HINA 4K7VA 3H4GA 2JE8A 2QCFA 1W8GA 3SJNA 3D47A 2R1PA 1RXOB 3HJZA 5C2XA 4QRNA 1W3NA 1GVSA 3DHDA 3LYEA 1OT1A 3CMJA 3N04A 3FAWA 2HBVA 1LWJA 2EKGA 1W1ZA 5FJJA 2Y7EA 1MW3A 2X2YA 1L6YA 4QDMA 1C8QA 7ODCA 1E9IA 1TREA 3K4WA 3T81A 3IK4A 1US0A 4IJRA 1Y7VA 5M17A 3CZLA 2ACSA 4XO7A 2E7FA 4HK7A 5EKYA 3WUGA 2OEKA 2B0MA 1EYWA 3T9PA 4HNTA 4HU3A 2WOQA 4MTVA 4V27A 3BH4A 5AYXA 5G2HA 5CPSA 1JL8A 1H3GA 3S5YA 2QR6A 2C91A 3JS3A 4Q6XA 1NFPA 1V08A 3W4RA 4HMDA 3BAJA 5CPQA 1MZRA 4Z17A 3ZLHA 3LN3A 1LWIA 4BF5A 1Q3NA 2JGQA 3T8LA 2Q01A 3VUPA 3COTA 2I14A 1AQFA 1XLJA 3PBUA 5LHFA 4B5UA 4DVOA 3R79A 3TJXA 5KSWA 1K9FA 2Z2UA 1JDCA 1YBQB 4N42A 3BW3A 3K13A 4V1YA 2J47A 4JX5A 4CQ8A 1AMKA 3SSJA 2WHLA 1EX5A 3D3AA 2ESCA 3KS5A 4K8EA 4IIEA 2O7SA 1W6TA 1JUEA 1R38A 1GOXA 2VDIA 4EAMA 1RQBA 2ZRXA 3QTPA 1U5VA 4J3SA 4NJJA 4XQ6A 3G8RA 1ZNNA 3EMCA 3PPCA 1HJQA 5CJNA 1TMHA 4LVAA 3GVWA 5ABEA 3VIGA 3OVPA 3L0KA 4ZOCA 1GJWA 5CBIA 3WBAA 3CL7A 3V5CA 3ABXA 1OWQA 4GD0A 1XLLA 3S6DA 3RO8A 4B5NA 4DJDA 4P7QA 3BJSA 3EDJA 2O56A 1FWDC 3TQ0A 4HN4A 1DWFM 5REQB 5RUBA 2I9UA 5TIMA 2TAAA 3GTFA 5LNVA 1BSLA 2OVLA 3DC8A 1SU5A 4DJEC 3CPUA 3WLLA 3WN6A 2WC4A 3GE7A 3W85A 1KTNA 1JUBA 4GWEA 4OFCA 3EAUA 5E0KA 4D9PA 4IXHA 4HOXA 1BTCA 1V7AA 4HNLA 3OIHA 4B2DA 4B4HA 3O06A 4U5KA 4QDWA 2ZUTA 3ZOAA 3GUGA 1WB0A 4BKNA 3G3DA 1H09A 1RCXB 2AKZA 2ZUUA 4LUJA 2FDMA 3WUEA 1A3WA 5M3WA 4AIEA 4UOQA 1KCZA 3QEZA 3UP8A 4NF7A 4GYPA 1M9HA 4B91A 3KX6A 3TZNA 2F38A 4AF0B 2YBVA 1Z44A 4OUIA 4DO7A 4CD4A 5CZ0A 1OEPA 2RDTA 4AD1A 3U6WA 2IPFA 1B4EA 3E0FA 4X63A 2YFOA 1ICSA 2W67A 1FP9A 3DC0A 1WCGA 2Y7GA 1M6JA 3EA1A 4LVDA 1JG9A 3GNPA 5DMNA 3OQEA 4C1NB 3I10A 5F1UA 1G69A 3GDRA 1FRBA 4KBXA 1SZNA 1NDVA 1K6WA 1DJNA 2P8BA 3MYOA 1Q66A 4IJBA 4PMUA 4UTIA 4MUZA 2JF7A 3WF3A 1EJWC 4NG3A 3CMGA 3FIGA 3WMLA 4E3TA 1O95A 2IKHA 1S5NA 1YKWA 1T5AA 1GYNA 5T91A 2HRWA 2O4QA 4JAWA 4IG2B 1EA9C 4JDBA 3M0HA 4LF1A 1F2JA 3MHGA 2OR2A 1PHQA 3HU7A 4IMAA 5I3HA 3APGA 4QAIA 1TPUA 2VM8A 4GK8A 2XSAA 5C8BB 3N2XA 2X8RA 2Z00A 2UBPC 2XFRA 3STGA 3GM8A 3BMXA 2E8YA 3TOPA 3BLKA 1I4NA 5F2MA 3NUKA 4CVWA 2PDJA 6REQB 2CETA 5EMKA 3KOWA 4NY2A 3FVDA 2AAAA 2PDNA 3CC1A 2EJAA 1M7OA 4RE2A 3WG6A 1TRDA 3H70A 3QFEA 4Z1AA 3IGXA 3MZ2A 1UROA 2FPVA 5C2GA 3VUSA 4S3JA 3ZJKA 3TIMA 4D6EA 2GJXA 3SGGA 3B9DA 4X22A 4DXVA 1SJCA 3UXKA 4MLJA 3AU6A 1REQA 1GVQA 1P7TB 2WMJA 4UMBA 3AZTA 2V5LA 1Q5MA 1YE6A 2UY5A 3W7DA 3WF4A 3S0CA 4WJXA 1G4SA 2OWWA 4N9CA 2TYSA 1SJDA 2VURA 4CQBA 1C9WA 3WF1A 3LNPA 2GDQA 4DO6A 1S5MA 1XS2A 1Q2SA 4AIUA 4ZOEA 2YA1A 4S3GA 1F05A 3C4UA 4B3LA 2O9TA 3WCZA 2IXUA 4PSRA 3TW9A 3GK0A 5AY7A 2OT0A 5I6SA 3VYLA 4MSSA 1HKJA 3R10A 4NVTA 1GGOA 2FJKA 3AS1A 2TSYA 1QXLA 3FOKA 2OQYA 1XIEA 3M41A 1UD3A 2E0PA 2QDEA 4C6QA 1S46A 3OYZA 4FNPA 4KW2A 3UERA 1YXCA 4WJ8A 4CCZA 2WPBA 3T0CA 3RM9A 3S1XA 3OU8A 2PRMA 4MDPA 3GU2A 1ITXA 1CGXA 2CHRA 4H6KA 3W7QA 2FZMA 4JNYA 4CNOA 3UCDA 3TQKA 1CLKA 1EEPA 1B30A 4DNHA 3M46A 3B8TA 2FB2A 4H2CA 5BOOA 4UQ9A 2NQHA 1EB3A 3C2RA 4KERA 3EPNA 3RITA 3ALFA 3VI2A 1KM3A 3CTTA 3I3DA 2HTMA 1EHNA 1RPKA 4M81A 3WH7A 5F7UA 2C14A 1BG9A 1KKRA 4MPKA 4XO6A 1B9BA 4IH3A 2QAPA 3PG9A 4X9YA 3UXLA 3APYA 4B5XA 4M6QA 3ZT6A 3G5EA 3ZLGA 4LYPA 5BRBA 4GO9A 3A3XA 2QLYA 4M1RA 3B0PA 4ICNA 5DCDA 1R30A 4M5PA 3QVQA 5I79A 2AL2A 3PY2A 3HA1A 3KTCA 1OZMA 2DY3A 4N9DA 3THCA 1TQJA 3V16A 4F2UA 2VVSA 2PWEA 1T40A 2V3GA 3MUY1 1EP2A 4CNNA 1XLIA 3TYDA 2Z6JA 3CO4A 2ANUA 1W9PA 3MO7A 4H4IA 2VFGA 3U2OA 4Y8FA 2NX3A 1ITQA 1FWRA 1V3HA 2FMOA 5DO8A 4F40A 1SYTA 3W1LA 1GCYA 3C0QA 4ORMA 5L6UA 3LGDA 1X96A 4V1XA 2CXEA 4GCAA 4PEKA 5HMSA 4I90A 1Q45A 2YLLA 5CLTA 5IBXA 1O5KA 3SCUA 3MUCA 3H4WA 3G1RA 4XZHA 3UWYA 3VOFA 1FFQA 3UWEA 2BOFX 1RVKA 5AHFA 1XBXA 2FGBA 1JZ4A 1FTXA 3IVSA 5D2WA 2FDSA 1UWAA 4AY7A 3W7MA 2A21A 1QK2A 4KETA 4FEZA 3EKLA 1XH0A 2A79A 2ABAA 1VPYA 3GYEA 4UFJA 3NWRA 3FSUA 3SSZA 1G9HA 3WL1A 4W84A 2QXWA 3KL3A 2GGIA 2XFFA 4XISA 1C9DA 3F5KA 2OTDA 4PBGA 2FFIA 1NARA 5FEPA 3WMSA 4KWOA 1HXJA 2BWGA 3DKLA 1JCJA 1OFBA 2B7QA 1DQWA 3AQUA 4UFKA 2OSXA 1EC9A 4C1KA 1I2PA 3WQ6A 3T0BA 2XIOA 3DFTA 3P60A 4N6EA 2VZSA 2GJRA 3WNNA 5ABHA 3FYPA 3P67A 1A5BA 3MMTA 1TUXA 3AMCA 5A6TC 4JYFA 1ITUA 1Z69A 1XLCA 3EWCA 1TX2A 2ON3A 4S3CA 1WUFA 2ZX8A 4GKLA 3Q4DA 4RZ6A 4NKCA 2FVLA 3BV4A 1CB7B 3VA8A 1ITCA 4HNVA 4JD4A 1YTEA 1R3WA 3N6HA 1G5AA 1H7OA 4TX9A 1IXPA 3DFNA 4RNFA 3AIWA 4HZMA 4QITA 4N9BA 3W01A 4L65A 3UNTA 4XZLX 3OLEA 3VGGA 1IXOA 3AMKA 2Z1KA 3NSNA 1RP8A 4KEMA 4UTFA 5BXSA 3RLVA 2VWSA 5LNUA 1EO5A 3RLGA 3PZIA 1W3KA 1EWDA 4I9AA 4FSAA 1J96A 3N11A 3WBYA 1R46A 1MW0A 2GVEA 1W9UA 4ES4A 4B3ZA 2A85A 4DB7A 1WDSA 1RH9A 4Y9PA 2IUZA 3AS3A 3CO8A 1K77A 3EA2A 4HHHA 3MZNA 1V6WA 2QULA 2QMKA 1L6FA 4QEHA 2YDRA 1KLYA 3NO5A 5HPOA 2PDMA 1TPB1 2J78A 1PCWA 4MLRA 1KGXA 1UD5A 3U9IA 5A8NA 1SQ7A 3B3DA 1JDAA 2VTFA 3NM1A 3K4DA 5JVLA 2JIWA 1EGVA 2GLKA 4YXGA 1F73A 4NJIA 1Q6OA 2W61A 1BF2A 2ZXAA 1CWYA 4PMQA 2NT0A 5A94A 3ONCA 3G1SA 3RGTA 2C19A 2Y63A 4GGHA 3GDKA 4PBEA 3UG8A 4W9TA 1ZHAA 4MYXA 2BB0A 3N73A 2Q6ZA 1D3HA 2O92A 1DL3A 4H3DA 1V0KA 5JQ9A 2NLIA 3AJ7A 1XYCA 5BWAA 2VEIA 2CLKA 2OSWA 6TAAA 4K7YA 3RDKA 1O1HA 3S83A 2Z6IA 1LYXA 2FTPA 3LGGA 1YQ2A 3H4XA 3GB6A 2W66A 3S2LA 4E0CA 3MMWA 2QJMA 4MADA 3WJXA 2VXNA 4EK7A 3CASA 3KHDA 1KBKA 2X1IA 3B8VA 4QP0A 3JZEA 2XIQA 1JNDA 2QV5A 2NZLA 4GXMA 2BFGA 4PR4A 1XLBA 3NZPA 3M7SA 4O54A 2OXNA 3AROA 4GYPC 3W26A 1A5AA 3NQMA 2B31A 5BRQA 1LP6A 1NWTA 1PKLA 3IEBA 3WD4A 4IZGA 3P5ZA 3ARYA 4DWSD 4HT3A 1EQPA 1THFD 4OBSA 1PXGA 3RG6A 2IQTA 3TDFA 5HR6A 5D38A 3WH5A 2VC9A 2XN1A 3TP4A 1W9XA 4B5SA 3B9NA 3LTPA 4R53A 3PUDA 3B0YA 4RE0A 5EL1A 4YTSA 4CGTA 2ZADA 3ERPA 4H83A 3BWWA 5B7ZA 1DWHM 3HFTA 3EKGA 2RHGA 4UZSA 1KB3A 2QUMA 1H2JA 3SO7A 3NPXA 2FH6A 2WAGA 3NAVA 2UY3A 1XLFA 3VDCA 3A4WA 2FPYA 2VRKA 4PL1A 4E5TA 4YLWA 4RW3A 3I4KA 3SBFA 4ZQOA 3ARWA 3EKZA 2XGBA 2XM2A 1RCOB 1UR0A 3IJ8A 1O68A 2JBMA 3K8MA 1HQTA 3IUDA 4C6CA 1J0HA 3FHQA 1W5PA 3ANYA 3R8RA 1IYXA 1YXDA 3HOJA 3T1GA 2YA2A 2C0HA 3W7EA 3FN9A 2AMXA 3O9NA 1JYXA 1PWMA 3HIJA 1CNVA 1W9DM 5KZDA 1VR6A 2J6XA 3SQSA 2RKXA 2VRQA 1WPCA 3MTWA 1NFBA 4UTJA 4ZE5A 1K3UA 1UKSA 3W27A 2JIEA 1H1ZA 4QS6A 4GE8A 5ABFA 3W7LA 2VGFA 4LEQA 2Z2AA 4FO4A 1XIFA 5DMLA 4LV4A 2VEGA 3WJSA 8XIMA 3CQ0A 5A6AA 4EXAA 1ZBCA 1TJ0A 5DEZA 1D8WA 1E43A 4DWDA 3ARQA 3DU0A 2OLHA 3AYVA 1O5XA 2JKEA 3ZYZA 3I7QA 1IWBA 1UP2A 2VUYA 3CJPA 4JL1A 3ITOA 3NO1A 3NQDA 3W9ZA 3OOQA 4HTBA 4F79A 1ADOA 4A8RA 4DZAA 4IGMA 1F4HA 3A24A 1E71M 1WQ5A 1QASA 2DVUA 2VO5A 4E2VA 4IT1A 1FQ0A 3W7CA 1MFUA 4O11A 4RW5A 2A3AA 1EZWA 3RX2A 3RMEA 2Q3RA 1P1MA 3USBA 1TZZA 4NAEA 4H00A 3GR8A 4AZCA 1S3HA 4IGHA 4L6DA 3FAXA 3V5FA 4PZVA 5KZMA 1ZTVA 2BGQA 3U2ZA 1FDJA 2J79A 3V0TA 5G1TA 3MI2A 3TOYA 1RV8A 3VE7A 2P5NA 3L4ZA 5XIAA 5JXQA 5JUVA 1B1YA 2W79A 4X2RA 3L9CA 2J7DA 5HNNA 4H8VA 3STCA 4R7WA 1E9LA 2BMBA 4AZ6A 4Q8VA 2Z1VA 3RCNA 3BLOA 3G3MA 3OVGA 5HXMA 3G1XA 1KFEA 1VEOA 5BOFA 3CTLA 3KWXA 2NQ5A 4O1BA 1B3ZA 3NQ7A 4R27A 4IL0A 4C6NA 2VZUA 4K68A 5AZ1A 3ATYA 1OFPA 1RALA 1DQXA 3WQ8A 3KBVA 1UIPA 4C6DA 3F2DA 3QY7A 1SO4A 3EB4A 4L9ZA 2R91A 1FHVA 1LUCA 4TQTA 3CL8A 1L0PA 2ZWYA 4HZ7A 1R85A 1X1ZA 1O1ZA 3ZWSA 4DZ5A 3BSGA 3THDA 2DH2A 1KV8A 4QJ4B 5FF0A 3BG9A 4D6CA 4HCDA 4GI9A 4V15A 3PWAA 3WNOA 2ZZ6A 1RJRA 5LIUX 2FVKA 4FALA 3IWPA 1RQHA 4ICMA 2R1NA 4B16A 3RJXA 2BS9A 1W1IE 4HMEA 1K7EA 3URQA 3MPGA 2J66A 3SDOA 3V7PA 5FL1A 3WQCA 1DYSA 2Y0FA 3WL0A 3UD6A 4KKXA 3TW7A 2ZX5A 1X39A 2FZNA 1EC7A 4LJ3A 4DUVA 1N8IA 3CWHA 3V0SA 2F6KA 4QE1A 2V8ZA 1PDYA 4UNLA 2PTYA 4JOMA 1ZQ5A 3TA9A 2YX0A 2GVLA 3HQPA 1PTDA 2NVAA 4UR9A 4DNMA 5IBXC 1TPWA 4TU1A 5BMXA 1S2VA 3S5OA 3I6EA 4P7RA 4GYJA 1E6SM 2ZTJA 1F8IA 1XC6A 2HPMA 2OZTA 5FAJA 1LDCA 4WZHA 4L4MA 4XK2A 4X3ZA 5CC5A 1Q8AA 2E28A 5BXPA 3LD5A 8RUCA 1SW3A 4Z0JA 3SCRA 2J7CA 1V0NA 4JX4A 3PFMA 1FWIC 3B8DA 5MKGA 4XKYB 3EPMA 1JZ8A 1E56A 4ZE4A 2Y8KA 1FH9A 5CSSA 4MYAA 3NM3A 3F4NA 3ZVHA 3WDIA 2WNQA 4HQVA 4AHQA 3E6EA 3GVQA 1EH9A 3UPMA 2J9XA 4HB7A 3VM7A 4B5TA 3LCIA 5I0DA 4U10A 1TCDA 1EGZA 5HDRA 2BTMA 5I09A 5BW6A 1Q7ZA 1DIKA 4ATLA 1J11A 1DXEA 4DLMA 1N8WA 5IM51 3OLDA 3RAOA 2W6RA 3QZEA 3NEVA 4NAFA 5FJOA 4IQJA 2ZTKA 3RLUA 4UBPC 2GQ3A 3TR9A 4WUIA 2JF6A 3DENA 2EBNA 1UKTA 3HB9A 5FIPA 1VCGA 1OFEA 4NASA 4CCEA 1KTBA 1XFCA 5M1TA 1WOAA 1WAUA 4XUYA 5M5DA 1P0DA 3M43A 3JZUA 1UP0A 1U1UA 5LNRA 4MB5A 1XFBA 5GQBA 1ECEA 2D73A 4RZ4A 1MEIA 3TJLA 2V67A 4MAZA 3SECA 3O15A 2E77A 4ASTA 4C6KA 3ZJ7A 1ELSA 4B4FA 4CU6A 3PJWA 5CAHA 1E1FA 1FWAC 3VGBA 2BGNE 4MDOA 3LMZA 1X6NA 3W6YA 3QPYA 3ZSTA 1MXSA 2BXZA 4JN7A 4W89A 2R8WA 2YPIA 3M0YA 1GPWA 4JTJA 4LRSA 2XFWA 5LXXA 2VC6A 5BU9A 2Q71A 1Z3NA 4JIRA 3S4TA 2O9RA 1BAGA 2DT3A 3GBEA 2GSJA 4MZ1A 1VJSA 3BW2A 2I7GA 1NEYA 1GTHA 4GH3A 1OCQA 5EMYA 3MI6A 4CN1A 4FS9A 1S2CA 1Q65A 2AQOA 5EMJA 1YTDA 2C15A 3M5XA 3W22A 3N15A 4HK5A 1XIIA 4M24A 4OIFA 3OVQA 3BGGA 3TROA 3C2VA 3NZGA 1UCWA 5HMEA 3T8QA 3RRXA 3R0KA 5HBFA 1ICPA 4FF7A 3EXSA 5E9AA 5CZTA 3EB3A 4HA1A 4FOJA 4V33A 3V75A 2F2KA 4LXFA 4M1BA 1R3YA 1KBLA 4O0KA 1GZGA 4GYFA 3EOSA 3PTDA 3PZNA 4MF4A 5CAKA 4Q22A 1D2KA 1KFBA 4H9TA 1XBZA 3IIXA 2ZX9A 4IPNB 1R47A 4ZFCA 4BJHA 2IPWA 2FZ9A 1JDEA 3DFQA 4KGJA 1QW8A 4TV5A 4LRTA 3T44A 3TJIA 4UMCA 2DEPA 3C52A 2RAGA 3GFXA 1CW2A 2GK1A 4CCCA 3UWVA 1XSJA 3WK0A 2WNWA 1PX4A 1QO5A 2YSWA 4O1DA 1I2OA 5LZLA 5LXEA 2ZDRA 3N2MA 1RA0A 1VC4A 1WZKA 4HPJA 3N13A 1DJWA 4FAMA 5FESA 1T99A 3ES8A 3GXTA 2HDJA 2QPUA 5AYBA 2PP0A 3DG3A 3OZYA 1EJUC 1A49A 2DQWA 2C13A 1XSKA 1BXNA 1XBVA 3BAKA 3GG7A 2F84A 2GGHA 3TV8A 3W6MA 5E6ZA 2PDYA 4O10A 3URBA 2FZDA 2EHHA 4MVAA 2FMNA 4GUFA 2GSHA 1NP0A 3WDHA 2HK1A 1WXYA 3KVLA 4J3VA 5D03A 3GTHA 3VM5A 3WQOA 1M5WA 1M65A 1UWRA 3FS2A 3B9EA 3SY5A 2I5QA 2DFAA 2G4JA 3M0XA 3R5EA 1DHKA 3QTGA 2NWRA 1KFCA 5LIWX 4J40A 3I4EA 1HIZA 4J4KA 5BYWA 4PRRA 2CPUA 3HG3A 1ONWA 4WY0A 5LA0A 2BP1A 3KCLA 1H7NA 3QR0A 2A7RA 4HZ8A 1XIDA 3S8HA 3A9IA 3IJDA 4OHQA 3ABQA 5TNVA 4HOWA 2ZA2A 5HWNA 1PV8A 5K9DA 3M16A 1HTIA 3L67A 5DXYA 1DQUA 3QSTA 5ECUA 3LTYA 4PUJA 4LUTB 2X0HA 2HVMA 4W7VA 1GQLA 3AXXA 1OFDA 1A4LA 3RCYA 4ACZA 1J0IA 3L5MA 3TWAA 1V02A 4P8VA 4IISA 3W02A 3H53A 3T0DA 5BXRA 1ZU8A 3ZQ9A 1QTWA 1VHNA 1BG4A 1VFUA 1V0MA 1F61A 1OYAA 3MO4A 3GAKA 5GJNA 5BZAA 2D3LA 4JDYA 2B7NA 3TQPA 6XIAA 3R58A 3QHMA 2E8ZA 4HSOA 2MANA 3TQVA 2DT1A 4LH8A 1DKWA 3RYSA 4LPCA 3BANA 3EEGA 3E5BA 3MVIA 4KCVA 5CPNA 1NSJA 2F61A 1JQXA 1G4EA 3GC4A 1POJA 1HKIA 4NU7A 2ZXBA 3BG5A 1FWCC 3VVGA 1PZ0A 2H9AA 2DUXA 4G5DA 2PAJA 3B4YA 3SB0A 3RPMA 1WDDA 1FWHC 4JTCA 4S39A 4AFYA 1PSCA 3KOXA 2IMRA 3LHWA 1LTDA 1QDSA 5T9CE 4MWAA 1VHCA 1O12A 4UQDA 1P6CA 5H91A 3GNRA 2FZ8A 2X30A 3DFYA 1PS9A 3SUSA 2PDHA 2YXXA 1E4LA 1QOXA 1V0LA 4BZYA 3MKKA 3KXQA 1BSIA 1YXYA 3K4AA 3EWZA 4J1OA 1W1PA 3VNLA 1MUCA 3CNYA 4R9OA 1QU4A 4WSHA 4NRSA 1SZGA 3CHEA 1SMDA 1QR7A 1POKA 1TR9A 4G1KA 3IJLA 1MXDA 1ZP3A 4GVIA 3NG3A 4WKFA 1SMAA 2HV5A 3SCPA 1H5YA 3RK8A 4HN8A 4NI8A 7REQB 2A3BA 1J5TA 9RUBA 3Q58A 1FWFC 4M6PA 2CWNA 3VX1A 3OW1A 3TW6A 3M0JA 2DH3A 3KS6A 3L4TA 2EEXA 4DI9A 1MFVA 1BVWA 1H1NA 4I7WA 3GWQA 2XU2A 4U3AA 3A9BA 1UJQA 3HG4A 2RJHA 3BE7A 2G3IA 2QQ6A 3MW7A 1EJRC 3BCDA 1MO0A 4HNUA 4UCGA 2LLEA 4NXSA 1Y65A 4TTGA 1JIBA 2V81A 3AHYA 2ZZ4A 4TVDA 4XBKA 1DHPA 2VQUA 3S9IA 4QIUA 1AUSL 3WH8A 1KGWA 4FF5A 1S5VA 3FK4A 2VX4A 3VINA 4LSBA 4DHGA 3LV6A 4B15A 2NUWA 1OGBA 1G4TA 3KOYA 2CLLA 2WCAA 4QFUA 1R3TA 3N6QA 4WDUA 4CD8A 4NZ1A 3WLOA 5E93A 5FJTA 4L1XA 2EPOA 3KDNA 1VEPA 2E4TA 4K8GA 4DJFA 4D8LA 3WBEA 3E12A 5A6KA 1QNRA 1MYRA 5AYYA 4WRHA 3MWCA 4BQ5A 3AYRA 4IX0A 4ZTXA 1Q6GA 1OIMA 1UA7A 1OCBA 3ZR6A 2ZE0A 3TYZA 5DT7A 3DYMA 1XUZA 3TLQA 4UMAA 3CZEA 4IFKB 4LAUA 2H8XA 2CNCA 1XD0A 3VOJA 3AIEA 3CPGA 4P5UA 3UU0A 1S38A 2C71A 2NW0A 2QZRA 5A2AA 4D6IA 1VPXA 4DBDA 3BGJA 4Z2IA 3SCQA 2Y1HA 4JN8A 1GOMA 3NFUA 2Y61A 4GC3A 3QJAA 3H12A 4REQA 4XZBA 1C8VA 2W63A 4OZOA 5CG0A 2CW6A 1XRSA 3SFKA 3FYYA 3GHRA 3H23A 4RDVA 5LKYA 2VQTA 3CXOA 2HNHA 4L4LA 1OQFA 4PCTA 1K9TA 4US5D 1QNOA 4IMDA 3OJGA 2G95A 1Q4NX 1K03A 3TN3A 2XZ7A 4IM4A 3OGSA 5CZKA 4IX2A 5AHMA 4OKDA 2V5CA 1JI1A 4HKPA 1YEYA 3ZWTA 4R7OA 3VNKA 1TB3A 3IVUA 4YL2A 1EXBA 1VF8A 1EDQA 4J28A 1E6QM 2FHFA 4LAKA 4B5VA 6PTDA 1TPVA 2DZBA 3THQA 1LORA 2X09A 1AODA 2J25A 3AS0A 3BCFA 1YDOA 4XX6A 5A8QA 2IQ0A 4J5NA 2AOSA 2OCZA 5HJXA 1Z89A 3SRDA 4JTTA 2C7FA 1XDJA 3NZ1A 1Z6KA 3WLHA 2J74A 3CBWA 2JK2A 3LHYA 3IVTA 1UZHA 3CAKA 2QCNA 2XH7A 3WUBA 2G3FA 1ZJIA 3MUZ1 3R8GA 1RSCA 3B03A 3H22A 2OZ0A 4XVDA 3UJEA 1W3IA 1RCQA 4NJHA 1MEHA 4EVZA 3SUWA 1WBJA 1WO2A 3AMDA 2Y5EA 3CIVA 3CUXA 3MC5A 4O14A 1X8CA 4DJED 4ZO7A 1WP6A 4E4FA 3WFAA 3G1YA 2WPGA 1JGIA 4JYDA 4BS0A 1NP2A 2ICSA 1IQ8A 1TWWA 3FHAA 1FA2A 1VYRA 3E3HA 2PDFA 3AHZA 4LANA 3UCQA 3IAPA 2ZXDA 5CSYA 4UQBA 3NDOA 2E9BA 3N3TA 4XSMA 4E38A 4RCXA 1L2QA 2TRSA 3UZJA 1UZ1A 1A5LC 1EF3A 1PZ2A 4KIRA 3VD3A 1ZZMA 4LY8A 1TV3A 3W71A 4IMEA 3SCWA 2G50A 6A3HA 1R9YA 3M9YA 4GI8A 3M6DA 4I5XA 4GFSA 2NV9A 1E1CA 3W87A 5A8GA 3ARVA 1LM1A 1F07A 1A3HA 1KLZA 5AYIA 2Z28A 1K9EA 4C90A 4OTKA 4UXDA 1Z32X 1KM0A 3JRKA 5XINA 4EOUA 3FSTA 3LEPA 2CHOA 4W87A 3MDUA 1CXFA 4XTDA 4PB4A 1DXIA 3EWWA 3NL6A 4HSHA 2PCEA 2YCEA 4PFMA 4UZUA 3C2FA 4GBUA 2V2DA 5K9XA 3NGJA 1FWEC 1DIDA 4FX6M 1JZ3A 3I6TA 3PJTA 4CQCA 2DT2A 4LNYA 4JTKA 1Q85A 3CQIA 4FX7A 3ZFHA 1LT7A 4RPPA 1XIBA 4ZBCA 4NNBA 5CZSA 5IHSA 1RZMA 2XGZA 1E72M 4I5UA 4JTRA 3PWIA 2NT1A 3PTKA 4UQCA 5GNZA 3W1RA 4HD5A 4JXCA 3AJXA 2VZOA 1BWVA 1XXXA 3TNBA 4D71A 2WVVB 2ACQA 3M0KA 1IT0A 5CLWA 2A3CA 3CUJA 3DX5A 4HOZA 5TD4A 1VRDA 3NYDA 3MCMA 1UWQA 1GEHA 3B97A 2NXHA 3A3WA 3BG3A 4IP7A 4QG6A 1XPYA 2G4FA 1SZEA 3TLLA 1V03A 5F2LA 1FWJC 3M5YA 4AWUA 5HK4A 2DSUA 1LQ0A 1KWKA 2CBJA 3PG8A 2BVTA 2Y7FA 4J35A 1JZ5A 3PPHA 1DTUA 3W1PA 4H9YA 1V6YA 1S3TC 5HWMA 1JPHA 3F1QA 4H9MA 2O9PA 5A6BD 3H2CA 3W81A 4YHGA 5EPDA 4R7JA 4ERAA 1J0ZA 2V30A 1BKSA 4KWWA 4PUNA 1TZ9A 1IV8A 1EX1A 2X42A 3W84A 1A5KC