4DO5A

Pharmacological chaperones for human alpha-n-acetylgalactosaminidase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
387
structure length
387
Chain Sequence
b'LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-N-acetylgalactosaminidase
publication title Pharmacological chaperones for human alpha-N-acetylgalactosaminidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 131
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4do5A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4do5A01
1QPRA 4IX2A 3G1FA 3H53A 4AF0A 1CYGA 2C15A 1CXHA 4MFEA 2RDUA 2QCGA 2ZDRA 1M5WA 2C6QA 4M6VA 2ISWA 2V2CA 4JIPA 2QCMA 1V3MA 3BLEA 4DO4A 3BLKA 1R33A 4N4QA 4UTJA 1MW1A 2QDHA 1Z41A 1B3OA 5F4XA 3BCFA 5J5RA 3GDKA 4U4MA 1GVFA 2QCEA 4D2JA 3CIXA 8TIMA 1CX9A 4W9TA 4JNMA 1J4EA 3LXAA 1EEPA 3UEQA 2A21A 4O1CA 2V3FA 5TD4A 3IVUA 2H6RA 4FLRA 2YYTA 4OU1A 1E3ZA 7CGTA 3NXFA 2GPTA 4H3DA 3B0PA 2ZWZA 3OVPA 4EWND 4ICNA 1OX5A 3CZKA 2YW3A 3WY1A 5U7SA 1WAUA 2ISSA 3W72A 3AJ7A 4JY9A 3KL3A 3HBLA 4XZ9A 4NNAA 5FEWA 5F4WA 4FLSA 1SO5A 3ABSA 2YXGA 3NPUA 1PIIA 3IIZA 5E6YA 1W5MA 3P5YA 3TAKA 5K7JA 3WELA 4BZYA 3B04A 2ZBTA 1JGIA 1XH0A 3TU9A 3HG2A 3CZLA 1QW8A 5EKYA 4AWSA 1AQHA 4J28A 1GTHA 1HFBA 2ZYFA 1CPUA 4CN6A 2WV8A 3OLEA 3NNTA 3TR2A 4HOZA 1JAEA 3GX9A 4K39A 3IJ9A 4WLCA 4H2CA 5KZEA 3O6DA 1F6KA 4L4MA 3WJXA 3QC3A 3BVJA 4ONVA 3HPZA 1YPFA 3P84A 3T40A 3W88A 3D4ZA 3WNKA 1H50A 3WY4A 1QWGA 3NQ7A 2E9BA 2JBMA 4JTTA 4UCGA 4MOZA 3LRMA 4AIEA 1UKTA 4UQDA 3GXNA 3RU6A 4EIVA 3TMQA 1YTKA 4HSOA 1QDSA 2F2HA 1CGTA 3DDGA 1TPVA 3PF3A 1YXCA 5HMSA 2EACA 2Y4SA 2J27A 3DHPA 3PAJA 3QM3A 1XBVA 3LPOA 4O8RA 1G4EA 4KFOA 5F7UA 1ZJAA 4IPJA 3BLPX 3T78A 5FEPA 1RPKA 2XVLA 3VX0A 4NVTA 4UNKA 3V75A 2E4TA 3LRKA 1SZGA 4CCDA 1YDVA 1GJPA 1XFBA 2C8NA 2Y7DA 1S5VA 4LS1A 1MW3A 4MY8A 4H6KA 1J0IA 4XKYB 2O7QA 3QF0A 1W3TA 4MLRA 2V8ZA 7TIMA 2FTPA 1SFJA 4O50A 1U2YA 3W83A 2CZEA 2OMAA 3QSTA 1KFBA 3C61A 5KZMA 2OSXA 1G69A 1UUMA 2PE4A 1RD5A 3NQ6A 3S1WA 2BHZA 1XXXA 6ALDA 3SFKA 4Z1DA 2WVVA 2E68A 4WY0B 1WXJA 1RP8A 2GUUA 3L65A 1LOQA 1SW3A 3L5LA 1B0IA 3R2GA 4X22A 3UCQA 1W5PA 4AHQA 4FNUA 4O15A 1OF8A 3FJLA 5FEXA 1R47A 5EMYA 5LNSA 3L0NA 4O28A 5HWJA 4CN4A 3T44A 1UH4A 2FHBA 3DKLA 4NQ1A 4O52A 4UQ9A 4P2VA 4U2YA 2ZX7A 1VFMA 3WDIA 2V0TA 4JL1A 1V7YA 4LVDA 2TRSA 1H7WA 1W0MA 2WPGA 3IVSA 4DXVA 1VLIA 4M6PA 3LCXA 3RLUA 2DJLA 1H7RA 3G22A 3UPWA 1HG3A 4O1AA 1TQWA 3Q37A 4UUIA 4WY0A 3S5ZA 4TIMA 5J5DA 1ZNNA 3CTLA 5I3KA 4JFTA 4AVFA 5K3VA 1X1OA 1MWOA 3FKRA 3O8AA 3IVTA 4PCTA 4O11A 3W7IA 4WSKA 2GVLA 5L9FA 3GYEA 1CGUA 1DL3A 1F73A 1WA3A 3CB8A 5CLWA 1M6JA 3PBYA 3E02A 1KGXA 3GKAA 4WQ6A 2ZXQA 1YDNA 4Q33A 4QITA 2BTMA 4LY8A 1DKWA 4E2OA 2X2JA 1HWWA 3MHUA 2BLEA 1VPXA 3PG9A 3EWXA 3W87A 1BEUA 1ZY9A 1UH3A 3SSJA 1UOKA 3M41A 2JKEA 1H1ZA 2D0HA 3AXIA 4TO8A 4IJBA 2V5LA 3VNZA 3WNPA 2F7PA 4LU0A 3BCDA 4JXCA 2H90A 4HN4A 1KCKA 1OFEA 3VGBA 5EA9A 2ZICA 5DFAA 1F7BA 2XN0A 5FF4A 1BKSA 4QM1A 1HNYA 3U8GA 1S3HA 3BG5A 4PCFA 1S5TA 3UNDA 4J3WA 4GE8A 1GG0A 2VKZG 1LROA 1VIWA 4JL2A 3E9AA 2ZRXA 4K6AA 3UWWA 1O94A 2RFGA 3DC0A 4JFSA 4K37A 3VE9A 2NX3A 2EABA 5TIMA 3M16A 2PC4A 1UCWA 3NM1A 2HTMA 4M56A 3U2OA 1GZGA 1JCNA 2P1FA 4IXXA 3MP4A 1EPXA 4EF9A 5ABTA 1E40A 3S8HA 3UXDA 2WOQA 3TK7A 2AAAA 4A29A 3QSRA 4TU1A 1W8SA 5E9AA 3GXFA 3KL0A 2ABAA 2DZTA 4IX0A 2BHYA 1DQXA 3TCEA 4QIUA 4QJ1A 3GR7A 3W1UA 2V9DA 1LM1A 2X1UA 3M44A 1ICSA 1KTCA 1FWWA 1KV8A 2VFIA 3N34A 2CWNA 1U30A 3B0VC 3O06A 3W86A 4M7SA 2WSYA 3CLWA 2X2GA 3HQ1A 3VMPA 2DP3A 4J3TA 4Y90A 1L6SA 2AMGA 3ZWSA 4K8HA 4ZQNA 1QMLA 3RLVA 1K7FA 4JTLA 3G1VA 3QJAA 4FXRA 2A4AA 5I3JA 1BTMA 1KM6A 2EAWA 4WD0A 5SWUA 1ICQA 3UD6A 2AQWA 1MO0A 1ZJBA 2P10A 2X1TA 4UR7A 2ZZ6A 4Z1BA 1LORA 4EVZA 5C5YA 2QCFA 1WZKA 2VOMA 1QI5A 4HHPA 1PCWA 2ZE0A 1SW7A 5BRBA 1P0KA 3HPXA 4LV9A 3QQ0A 1JVNA 2XN1A 5EPDA 4HNUA 1BWLA 3BAIA 4GQRA 3DXIA 4XWUA 8CGTA 2PRLA 5G2HA 3W85A 3TQKA 4Y96A 3L2LA 1IXOA 1C29A 1J0HA 4JCMA 1MEHA 2X16A 3W1QA 3S42A 1OFPA 3KVJA 2QUVA 1TQSA 1OK4A 4GO8A 1NEYA 4U2ZA 3N19B 1IGSA 3I6RA 3A47A 5D2TA 3E0IA 3MO7A 5DY3A 1I45A 3W1AA 2UV8G 3W37A 4I7WA 3S5NA 3W7CA 3BV4A 4JN6A 1G4PA 2BY3A 4QAIA 3UWZA 2DORA 3DFOA 4WSJA 2ALWA 1KWKA 1TTIA 2VXNA 3G0UA 1KGUA 5C55A 3W1RA 1XV8A 5AFDA 5HJLA 3CZEA 3PWAA 1NAL1 4FB7A 3FIGA 3BAJA 3M6YA 1TV7A 1R2TA 3TTSA 2YW4A 3EWWA 4PSPA 3EX2A 2OCZA 3KVMA 3EB2A 1R30A 5E1QA 2WVUA 3GDLA 3MJYA 2A6NA 3RMJA 4XB3A 1ZS2A 3L4VA 4GUGA 3W2MA 1SSGA 3P81A 1EA0A 5BRPA 2NV1A 4MZ1A 3WJZA 1WV2A 3PUEA 3NQDA 5AYYA 2DZXA 1L9WA 4U3CA 2E6DA 3PUOA 1ONRA 3ATYA 2EF9A 3LOTA 3A5FA 1YLVA 4N9BA 4MAZA 1OX4A 4JTGA 2V82A 3M43A 3TKFA 1G67A 1CGWA 4UTLA 4HPJA 5I3FA 1TJRA 3OLGA 1J0JA 3P80A 3GKFA 3VNDA 3WNLA 1OJXA 1TPFA 3LCIA 2Z1BA 2ZX5A 4GQQA 3KXQA 4AEOA 2J9XA 1PAMA 2QF7A 3G1SA 2BY1A 3L4XA 3DH7A 3IRDA 3C56A 1GJWA 4N9EA 5DO8A 2E8YA 3M5XA 4QNEA 4J7RA 1EO7A 1I2RA 1H60A 4L4LA 4N4PA 2GJNA 3VO0A 1OYBA 1L6WA 4GBUA 1KB3A 3QYQA 3EJPA 1UKSA 3NZRA 4O57A 1TRIA 3CQ0A 3STCA 5AHEA 3QMSA 4AHOA 3HGRA 3I7RA 1H3GA 4N6EA 1M7OA 1AVAA 2GOUA 1PPIA 2FHCA 4GRSA 3TQVA 2CHNA 4JX6A 1M53A 4X3ZA 3TXZA 2J25A 5C54A 1G9HA 1C8VA 3NM3A 7TAAA 1UB3A 1XC4A 3L2IA 1G6CA 1Q45A 4JEQA 5HNRA 2W0UA 1EH9A 4R7JA 4JCLA 1H7XA 1QPQA 3O16A 2F84A 1VGAA 3C3NA 3IJ7A 4OQVA 3KOFA 2GUYA 4O53A 3ZQ9A 1H7OA 3LCGA 4UTTC 4XBSA 3T4CA 4UFJA 4GFSA 2B0MA 1DBTA 5EL1A 1JCLA 4AMXA 2QAFA 5LNWA 4LOCA 5G1YA 4KWUA 1H5YA 1EP3A 1MXSA 2E5DA 4HNTA 3PBWA 3KLKA 1KXQA 1VRDA 4JD4A 3QFEA 3C2RA 1KXVA 1RP9A 3NQ2A 2VRKA 2G96A 2QDGA 4PTNA 2OZ0A 3P67A 2ALDA 2YCEA 3BAWA 3ZR6A 5IM51 4P61A 1R2RA 4ZQOA 1FCUA 9CGTA 4FX8A 1CGXA 2HS6A 3FYOA 4MLJA 3FFSA 4UFIA 5H91A 3C2FA 1HUVA 1XBXA 2ZA3A 1ADOA 2J24A 4CN1A 3IIVA 1H7PA 4MYXA 1XUZA 4PL1A 3MP3A 4QQ3A 4YCPA 3NPVA 1GQNA 3ABRA 4HKPA 2ZUTA 1UD6A 3KHJA 1XCXA 2E1DA 1I4NA 3LTPA 3Q94A 4S2BA 2CPUA 1PVNA 2V30A 4LW7A 1RR2A 4Y8FA 5I23A 5AHFA 4KKXA 4UMCA 1YDOA 4A3UA 3LTSA 3O6YX 1YXYA 4UTUA 2ATMA 3W7EA 1Z48A 3LTYA 2JKPA 4GO9A 4O13A 2YKKA 4O12A 3WK2A 1K8YA 4MZYA 4AF0B 2Y5EA 1A5SA 1HVXA 3GZ3A 2FJKA 3MW7A 3NA8A 2FGZA 1AK5A 2NX9A 2VFHA 3CLMA 3BW4A 3UY7A 3WFZA 2Q3RA 3TJXA 2XN2A 1TQXA 1IIGA 3W7HA 1UASA 1PS3A 1GT8A 2QJHA 4FX6M 4CNNA 2OW6A 2KZHA 4Y6GA 3TX9A 5LNVA 2YJQA 3EKLA 3N9SA 1LBMA 1PS9A 4K7YA 3NAVA 3YPIA 3PR2A 4R34A 4U31A 5A2BA 1AW5A 4O54A 3LXCA 2YZRA 4JFWA 1LOLA 2E6YA 4RV8A 3LBMA 4H4IA 3CT7A 4TR9A 3P8JA 3PM6A 5AN7A 1KM3A 5K9DA 2HSAA 3WN6A 3H55A 1CXIA 3LHZA 3LHWA 2WPBA 4AB4A 1WOBA 4JTFA 2WANA 1JRCA 2ZTJA 2R14A 3AMKA 1JR1A 1TQVA 5AHLA 1TPEA 3PB2A 5CPNA 1KTNA 1TPDA 4XBKA 2RDWA 3P60A 1LBFA 4RXGA 1BSIA 1YADA 1QNVA 1VC4A 3DX1A 5EY5A 5E70A 4HPHA 5HPOA 3W7PA 2Z0IA 1VCGA 4LNYA 3VM5A 1QX1A 3NZ1A 1PIGA 3TUUA 2Q8ZA 1AW2A 4GWEA 1W9XA 5D32A 1OB0A 4UTIA 2A2IA 4ZQMA 1TRDA 2E6FA 4GKLA 2OYLA 5CSSA 1G7UA 1IZJA 2WC7A 3VM7A 3UY8A 2VEPA 4MJZA 3GBEA 3G1YA 4DO6A 3LGEA 5LNUA 4NJIA 2FE0A 4JYDA 1KBKA 1Y0EA 3S5OA 3W38A 1HL9A 1G7VA 4OE7A 3L0KA 1FUYA 3OHIA 1MW0A 3EJQA 2ZIDA 3BW3A 4GUJA 1CGVA 1JDDA 4RR4A 1SQ7A 2NXIA 1FBAA 2WCSA 4UFMA 4JS3A 1W3IA 3U6WA 1JUBA 1QW9A 1ZCOA 4MIMA 3GDTA 3C2EA 2X2IA 5AYZA 2BXVA 2CZFA 4JTJA 4UC5A 5A6MA 3W6YA 3W2LA 5A2CA 3UPBA 3BLFA 2WJZA 4Q32A 5CXPA 4UQBA 5LHFA 1EIXA 1NM9A 3MI3A 3HIJA 2PWFA 3GBDA 4GI9A 1QHPA 2ZXBA 4FMVA 2VR5A 2Y7EA 3GXDA 2X1SA 1NSJA 3PULA 1FDJA 3NEVA 3MHGA 2A85A 1JFHA 5EYWA 2CLOA 4JTSA 2B7OA 1Q6OA 2B7NA 2NSXA 3FKKA 1UJPA 4YLWA 1JQXA 4Z08A 2WVVB 1K7XA 3L66A 3NQVA 2NWRA 3BVTA 1QPOA 2V5BA 2CW6A 2C0AA 1R34A 2OSYA 1DVJA 4OT7A 2D0GA 1YPIA 3E49A 1CDGA 4NZFA 1GPWA 1BVNP 4X9YA 3K8KA 5D2YA 4YL2A 2GQ9A 3DX4A 1OT2A 1VLWA 4BI6A 4CNOA 5FF0A 3VFLA 3BUIA 4ADUA 2A0NA 4CKQA 2CLHA 2DZUA 1K03A 3TAOA 3B05A 4J9JA 3SI9A 4LWWA 3TMLA 1H51A 3LRLA 4Q4KA 3GXMA 1ZENA 3KVLA 3TDFA 2EO7A 4IGHA 3W2NA 1JF6A 3K30A 3MP5A 4HIBA 1JI1A 4LC6A 3B8DA 1X8FA 3S6DA 4O10A 1JCJA 3OLIA 1ICPA 4WJEA 3LCWA 4PL2A 4LUIA 5F4SA 1GVRA 4MJMA 4FXSA 3AO0A 4UQCA 4UQEA 3KRUA 1MXGA 4JDYA 4LVGA 5K4XA 3WNOA 2QR6A 4N9CA 2XWDA 2CLMA 5MHBA 2XWEA 1SO3A 2VFEA 3CM4A 4GNJA 3BK0A 1TV5A 4IMFA 1RZMA 3BLIA 3NO5A 4J3UA 3STGA 1O60A 4QNWA 1Q4NX 3ZOAA 2GVGA 5H2ZA 4FNQA 2H8ZA 2GJLA 1KA9F 3FEMA 4WXYA 1GCYA 3LHUA 4WOZA 2ZCGA 4UTTA 2VELA 3CZSA 2GJPA 3G3MA 4O1BA 4WOQA 5F2GA 3W70A 3EXTA 1UA3A 3HJZA 3N2XA 5D37A 5LZLA 5KINA 3B03A 4QSHA 3ZSSA 3CIWA 4QISA 3GXIA 1VCFA 2ZZ5A 3V1PA 1QPNA 5I3IA 3EKZA 2ZA1A 3KRSA 5G2IA 1VR6A 3BVUA 2C1HA 2F7OA 4X0NA 1CGYA 1EA9C 1W37A 4LPCA 4AYSA 2ZRUA 1W3NA 3WEOA 4CCCA 4H8VA 3BC9A 1U5JA 2ZA2A 2E5BA 2NT0A 3DI0A 1JD9A 1OT1A 2E5CA 5EBUA 2J88A 2FLIA 3IEBA 4E0CA 1I2NA 1FXPA 4U28A 1EWDA 4NU7A 4ATWA 3K1DA 1J0KA 1O7DC 1OG0A 1BPLB 3VMOA 3ELFA 1T8XA 2Y88A 2G95A 3C6CA 1AG1O 3JS3A 4EOUA 2LLEA 3HPSA 3LPPA 4Z1CA 3DFQA 2ZTKA 3P62A 5DXXA 2TAAA 1MSSA 3P5ZA 4RZ5A 5BOOA 1MFUA 5CGTA 1CW2A 4FLQA 1HL8A 1JD7A 1W1ZA 1JXJA 2ZZ3A 1PV8A 2BZNA 1F76A 2BSLA 2I14A 4NJKA 1O5XA 1N8FA 4KFPA 3EDEA 3G0SA 1D3GA 1C9DA 2XVGA 1N7KA 3PVFA 3IGSA 3GLCA 4RK8A 1CXLA 3GXTA 1GVOA 5HDRA 2D73A 2FHFA 5HINA 1KM2A 1F2JA 3LI0A 3TA6A 1XUUA 4A21A 2EAEA 4ZQRA 1K8ZA 4GJ1A 3NL2A 1HXKA 4JR5A 5HQEA 4J3XA 2ZWYA 3N2MA 3BG3A 3LERA 1OK6A 2FQIA 1AL7A 3BAYA 2JK2A 2YA2A 3BVXA 2ZRVA 3EWZA 3R8RA 1LTDA 4DBEA 2C14A 1QHOA 1XL9A 1TPWA 1F6PA 4BWLC 1JCXA 3STFA 2FDSA 1H7NA 2CXGA 3CZGA 3C2VA 5U4NA 2YOCA 3GTNA 1T0OA 1RV8A 1QAPA 2B4GA 4BA0A 3MI6A 1QCWA 1R46A 1TTQA 1KXHA 4GIAA 3CHVA 1DORA 4UZSA 4PFMA 5DBUA 4JYEA 4RZ6A 1O4UA 3M1ZA 1E3XA 3CU2A 1ME8A 1IXQA 1XDMA 3GAYA 2YFNA 5HWNA 5I3GA 5D30A 1T99A 2QJGA 4JTKA 1UH2A 4DO5A 1E43A 1QI3A 4MVAA 2A7PA 1VH7A 4LXFA 3TTYA 1F5ZA 4DF2A 4YCOA 1FWTA 3KFTA 3MBDA 2Y24A 3HGOA 1QO5A 3HG3A 5LKYA 1FCQA 4UFHA 3VGGA 4C1LA 2DH3A 2VENA 3DKJA 4GI8A 1NF0A 2Y85A 4LTSA 5KTLA 3SY5A 5D2XA 4M6QA 1KWGA 3M7WA 3TFCA 3G8EA 5DBTA 1VFOA 1KM4A 3WEMA 4PCSA 3IIOA 3TH6A 1YYAA 3DDFA 3WY3A 1TMHA 1XBZA 1D3HA 1GVQA 5HUOA 1FY6A 4JGDA 4ZZ9A 1TQJA 4IQLA 1I2OA 1EWEA 5LGXA 3W3OA 3A21A 4BI7A 4AH7A 1Y7VA 1RQHA 3E96A 1HX0A 3RK8A 4CLMA 5I0DA 1I8JA 1P1XA 1IXNA 1O95A 3EDDA 3BVWA 1LLWA 3PBVA 1SSDA 1KFCA 1PZ3A 5BNKA 1KW1A 1W31A 1KFEA 3JR2A 3L68A 1QOQA 2OSWA 1OX4B 1KBJA 2DZPA 3NGJA 2DJXA 4RCXA 2O7SA 3ZT5A 1P0NA 3ABOA 4ZVJA 1NFBA 3W75A 2BHUA 2TSYA 2D2OA 1TTPA 3TW6A 2F7QA 1V3KA 2EGZA 1GVSA 4LVBA 5A8GA 3W7GA 3K8MA 3MYOA 4O0KA 2WKLA 1Q3NA 1OABA 4ADSA 3IGXA 2V3EA 3SZ8A 4UNIA 1K7EA 4POCA 5C6MA 3HMJG 3A24A 1VYPX 1QPKA 2W79A 4N2YA 5L6UA 3OLDA 2ZRWA 2NUXA 2DZSA 4ORIA 3ZS4A 3S5YA 4N02A 2QPSA 3NR0A 3PB0A 4NX0A 3Q58A 3MUXA 3NOEA 4BF9A 2YA0A 4C1KA 3GB6A 4IMCA 5AHIA 4FIRA 3HF3A 1J5TA 3WFAA 2X1RA 4LQ1A 3W7OA 3VSTA 1SO4A 1XSJA 3IK2A 2XIIA 1EB3A 3M0ZA 5I3HA 1HL2A 4G1KA 1JULA 3W2KA 4MFDA 2A7NA 2YA1A 3N3MA 1TSIA 1TTJA 3W1NA 2FPTA 5KMYA 2OJPA 5HWMA 4TX9A 1LLZA 2FH8A 2ZZ2A 3TIMA 1XKYA 1W56A 3HOJA 1P4CA 3TV8A 2G3NA 1NF7A 3S1VA 2VFDA 3W1XA 3L4WA 1O5KA 2CZ5A 4TMBA 1J2WA 2FFCA 5AHMA 2Y63A 1XH2A 4PSRA 3BAXA 3H54A 3FA5A 2GJRA 1VAHA 3BMWA 2NXHA 4IOTA 1ZALA 3TSMA 5K4ZA 5BW6A 3F4WA 4JY8A 4XQ6A 4CGTA 1JJKA 2OT0A 4A2SA 3QW3A 5CG7A 2Z1KA 1TIMA 3QMRA 2Q3OA 5G2WA 2WVTA 2PURA 3SGUA 4DPPA 5TBOA 1S46A 3W1PA 1UD8A 2VEMA 1Q6LA 2Y70A 3NVTA 3VE7A 1SZFA 3PUDA 3D4YA 3M9YA 3Q2DA 4RXFA 1LRTA 1RQEA 3M5ZA 3DFTA 3CPRA 2WSKA 1EUNA 3F03K 4O18A 2PWHA 3NQAA 4GUIA 4MB1A 3NL6A 4IMEA 5KZDA 5E93A 4EF8A 3BUBA 1ME7A 1XCFA 4LS2A 4XTIA 1OFOA 1OSEA 3MI2A 1WBJA 1A5CA 3G8RA 1VFUA 1VJSA 5I24A 4UMBA 1BF2A 3OA3A 3UG5A 1OVDA 1RVGA 2ZRZA 1JL8A 1H1YA 4HT3A 4MY9A 1TREA 1F74A 2X30A 3THQA 1GYNA 1LZOA 1LP6A 5E6ZA 4LV4A 2F61A 3DENA 2ZUUA 1WDWA 2WNNA 5F2IA 4KWVA 3LCHA 5DY2A 3W7RA 1LOSA 1SZNA 3BGGA 3CC1A 5CPOA 2XIBA 1UD4A 4OBTA 4PODA 1FWRA 1R2SA 3LHYA 2QAPA 3CWNA 3EWYA 3KAOA 5LGZA 5DCEA 4Z1AA 2E09A 2DZWA 3DGRA 1TQUA 3LV5A 5A2AA 4A2RA 2VUYA 3PS7A 3WNMA 1MZHA 4LT9A 2WNZA 5FF7A 4OWGA 3G24A 3O6CA 3K8LA 3KLLA 3OIXA 4JTIA 4HNVA 5HUPA 3MBFA 4FHAA 4M5PA 3BAKA 2D3LA 4I9AA 4FNRA 2QCDB 2I9EA 3WK3A 3BW2A 3O63A 3C52A 1W54A 3VMNA 1EP2A 3E12A 1GYLA 1PEZA 1TMQA 4JYFA 3A23A 4HOWA 1OF6A 4UIOA 1XM3A 4KFNA 1ZAJA 3PBUA 1JQVA 2OYMA 4JDBA 3G1XA 4X9SA 1Q6RA 3WMSA 3DFSA 4FLOA 3G3DA 5TQLA 1JDAA 2R94A 1SUXA 5LNRA 3D52A 2QCNA 1PZ2A 1QO2A 4TMCA 1D3CA 1Q6QA 1TPH1 1KM5A 4DF0A 4IPIA 2Y6ZA 5C2XA 2CLIA 3UZJA 1MEIA 1ML1A 1EO5A 3CWOX 5HXMA 2QUUA 2QLYA 2NLIA 5FI8A 2J9YA 3AMLA 3S2CA 5LHEA 5LSMA 1FDZA 5CZSA 2QCDA 4NJGA 5D04C 3F4NA 5BMXA 1CLVA 1MVYA 3FJ6A 4BWLA 1PL9A 1KFKA 1ZAIA 3NQEA 2OW7A 2Y7GA 4I7VA 2DU2A 3VNYA 1JF5A 3TC6A 2YR1A 2RH9A 2Y61A 3HZ3A 1P6WA 4JTUA 4O19A 1WBHA 2W6RA 3W22A 4CCEA 3HJEA 2A1YA 3MYPA 2IQTA 4FNTA 5D33A 5T26A 3W7LA 3THAA 1K3UA 1DV7A 3OVRA 4DEFA 2WVSA 3NQGA 1GJUA 2DZVA 5K9XA 1CXKA 4K38A 1GG1A 2FB3A 1DHKA 2VEKA 3EDKA 4GUFA 1TJPA 3MHFA 4LUJA 2FIQA 1PIFA 4R33A 2EJ1A 3D0CA 1AL8A 2QMKA 4Z0SA 5HR7A 4JIQA 2QPUA 3D51A 2ABBA 2ZZ1A 4E2BA 3UWYA 1IV8A 3P7YA 2CLEA 2NUYA 4I7UA 4PEEA 2EPHA 3NL5A 1B9BA 3KX6A 1TCDA 1FX6A 2XFWA 3AJXA 5G5IA 4AWUA 3DHUA 5FESA 2BXZA 3DBPA 3LDVA 1TYGA 3BO9A 2QUTA 3C8FA 3CEPA 3DHDA 4UTKA 4M8UA 1CXFA 4NXKA 2EQDA 4UR8A 2OX1A 3OEXA 2ZFAA 3W7KA 2H3DA 3W1TA 4HNNA 2DIEA 1WZAA 3BH4A 4JFUA 5CKSA 3DAQA 2QV4A 1QOPA 1TO3A 4NNCA 1EUAA 2R8WA 3UYCA 1TPC1 2WNWA 2YSWA 2E8ZA 3O15A 3WENA 3VGFA 4U33A 3I7SA 3EX3A 5AHNA 3KWXA 2ZRYA 3BLBA 3ZSTA 4PH6A 1PHWA 2ZXDA 3TC7A 4B5NA 3W7MA 1L6YA 5CGQA 1FQ0A 3VX1A 1TCMA 2Y2WA 3G1DA 4JTHA 3NQCA 2WCGA 1KV5A 3TJLA 3N14A 2FB2A 1OFBA 3IIPA 4DBDA 5IBXC 3HG5A 2ZX9A 3GVGA 2CLKA 1MEWA 3GDRA 3CGTA 3ZWTA 2ZX6A 3HGSA 1UD3A 5BRQA 4LRSA 1G94A 3SW6A 3QRHA 1OFAA 1V5XA 1VYSX 4MKNA 4CVWA 3LM7A 1UD5A 1TPUA 1KFLA 1CXEA 1JXKA 1M7PA 4LVFA 3S9YA 3VKJA 1VHCA 3R5EA 3EDFA 1FWNA 2WO5A 2CU0A 3D50A 3WK0A 2HS8A 2TMDA 4GUHA 4YMZA 3ZR4A 1GWJA 4OKDA 4CQ8A 2NX1A 2BXYA 2EHHA 2QEZA 3BMVA 3QQ1A 4OHQA 4IXHA 4WY0F 5KEZA 5AOUA 3EXSA 1H61A 3O07A 2VNCA 2TPSA 1V3JA 3HGJA 1UA7A 3LB0A 3I68A 4IUOA 2OT1A 1XGZA 3GR8A 1SFLA 4Y9AA 3GNNA 2AAMA 4XUGA 5FF3A 3L5MA 1EHAA 4FX7A 3BSGA 2WKJA 3S0CA 4OV9A 2X2HA 3ECQA 1FCVA 1ZHAA 5CPMA 3UWQA 3VCRA 2Z6IA 2WSQA 3BSHA 3L0GA 5FEZA 2FYVA 2FH6A 2DIJA 3SR7A 1TQTA 1LWJA 2CFFA 4OV4A 4AAJA 1XDLA 4GI6A 3FOKA 1VHNA 3N73A 6TIMA 1TV8A 4UXDA 1NOFA 4UTWC 3DI1A 1ZAHA 4E2DA 3I65A 3SJ3A 2NXGA 3OBKA 1X6UA 3CPUA 1GEQA 3RIKA 5DXYA 3P74A 4R53A 4ADTA 5CGMA 4UMAA 4XTDA 3EX1A 4AYGA 2PWEA 4AWTA 3FLUA 2YYUA 1VB9A 4FNPA 4S1FA 3T55A 2PWDA 4O14A 4CQAA 3M07A 2C16A 3HB9A 1KXTA 3ATZA 2YIHA 4FIQA 5E0FA 1VJIA 1QFEA 3NPXA 1B4KA 2ZUWA 3DFNA 4FO4A 1WPCA 4XKYA 1A5BA 1MW2A 2B7QA 3W07A 1K8XA 1WE5A 3L4UA 2B7PA 5K2ZA 2A5HA 2VFFA 1VZWA 1LRNA 3W74A 5GVJA 4AEEA 2C3ZA 3W7QA 5AC7A 2YDAA 3EX4A 5F1UA 2BY2A 2C18A 1KCLA 4UNLA 1KLZA 3M5YA 1OFRA 4AMAA 3VGHA 1HO1A 4AW7A 1IXPA 4NI3A 2NT1A 1WZLA 1WZMA 3W76A 4W93A 3GDMA 3VGEA 4MPQA 4JX5A 1RPXA 3ZT7A 3L5AA 1KLYA 5G4WA 3C4UA 1YTEA 1DHPA 4ALDA 2GQAA 4IMDA 4NT0A 3W2JA 1SU5A 1FWSA 3JRKA 5EMUA 2JGQA 1KTBA 3G18A 4NJHA 2ZZ4A 3EJRA 2QKFA 3PSVA 1Z32X 3FAWA 2V2HA 3L4TA 1F05A 3HG4A 2EEXA 2GVJA 4PEKA 1QWNA 4B9ZA 3DHFA 2DH2A 4BK9A 4HP5A 2ATSA 4MY1A 3NG3A 4QAWA 1OX6A 1EX5A 3DZ1A 3AXHA 3KEHA 3EJSA 5AYXA 1K02A 6CGTA 4UZUA 5CZ0A 2NV2A 2C7FA 4YWIA 2HMCA 1MXDA 5AC8A 3TSDA 1CIUA 4A22A 3BVVA 2V3DA 5AB3A 3GXPA 2OYKA 4OJYA 1EP1A 2CLLA 5D03A 3KRZA 5KSWA 4AEFA 4J3SA 3EX6A 5F2MA 3S1UA 3LCLA 4O17A 5CLTA 3SECA 3LHTA 3CZNA 4WX2A 5A5WA 4DPQA 3A6OA 6TAAA 1A5AA 3LCFA 4ORMA 1JUEA 2CZDA 5CPLA 1B57A 2PRHA 2YPIA 1JI2A 5DN1A 2JKAA 1FDYA 2C19A 3W23A 1IZKA 3IIXA 4BFAA 2V2DA 2CLFA 4FNSA 1XCWA 3WDJA 1A53A 3A4AA 2I1OA 4J27A 1Z42A 4UFLA 2A6LA 3EXRA 1U33A 1XH1A 1FCBA 2QCLA 4LVAA 5DLCA 1BAGA 2F7RA 2C13A 3TNOA 3UXAA 4NNBA 1DEDA 2RKXA 2ZX8A 3II1A 1XSIA 5DCDA 4HOXA 3ZR5A 3KVKA 3PY2A 2VEIA 3STEA 3UZ5A 2D0FA 1GTEA 3CV5A 4OGZA 4RJEA 3G1AA 3UQNA 3R13A 2F1BA 3SGZA 1SMAA 2QMJA 3QPZA 5AC6A 1AMYA 1C8QA 4UQAA 3P8IA 3R89A 1DJNA 1NVMA 1XSKA 3BARA 4PC8A 3W2UA 3W1MA 4K7VA 4NJJA 1BLIA 5D02A 4HPXA 3OVQA 2A7RA 4FEZA 3W1LA 5BMWA 3LX9A 5G1TA 3A22A 1BG9A 4M19A 4N6FA 3FAXA 2ZQ0A 1HO4A 1SZEA 3TW7A 1WYIA 3VGDA 1S5WA 3LHVA 1XBYA 4LRTA 1AMKA 1X1ZA 3G1HA 3WK1A 3L21A 3P61A 1I2QA 3BGJA 3BG9A 1JDCA 1WX0A 3CEUA 3WJSA 1PHQA 2ZUSA 4J3VA 3HO8A 3B0UX 1IIHA 3UG4A 3G0XA 1GOXA 3LBCA 4IWWA 2EKCA 4PA8A 1ODUA 2G3MA 3TROA 3ANYA 4ZMGA 1M7XA 1L0PA 3KE0A 3W7NA 5I5RA 3PG8A 2WSRA 5HR6A 1KM1A 1FXQA 1SMDA 3LXBA 3UWUA 1GVIA 3TOPA 1MFVA 3GK0A 3W84A 1DOSA 1KGWA 3W73A 1WQ5A 4BI5A 4RLIA 2YGYA 3NQ8A 1LYXA 4O4VA 1D9EA 1TPB1 4OIFA 1JG9A 3IJ8A 2E0PA 1B2YA 3NDOA 4K36A 3EDJA 4H8UA 1RQBA 1XD1A 3DX0A 3L4ZA 3B4UA 5K9CA 1WP6A 5IBXA 2BY0A 2PWGA 1CI1A 2J6XA 1YXDA 1LCOA 4Z0JA 3LLFA 1T96A 3INPA 5D38A 2Y7FA 3L4YA 1LRQA 4UTMA 4O4WA 1OGSA 4CQ9A 4AXKA 2WQPA 1G1YA 2JGYA 4UCFA 4WF7A 2EADA 3TONA 2RHGA 2Z6JA 1VS1A 3L2MA 3MMTA 2PCQA 2R91A 1HT6A 4ML9A 4DQWA 2GQ8A 3EWBX 4MZ8A 2TYSA 3BPWA 4LC8A 1PJ9A 4JFVA 1UKQA 1OYAA 3DX3A 3VU2A 1I2PA 2WNQA 3KL5A 1H62A 3VSUA 3DFPA 5D2WA 1DTUA 3BUPA 1OHLA 3IV3A 3A9IA 2QCHA 4LS0A 3RF9A 4RZ4A 4AIOA 4O0ZA 2D3NA 1PCKA 1R75A 3DX2A 4N9DA 4AHPA 1TB3A 3NPWA 1UBSA 3L9CA 1KBIA 2Z2UA 2H8XA 5CSRA 1OFDA 3TSBA 5F1VA 4JICA 3GNDA 1A47A 3QGVA 3LV6A 4DF1A 2E77A 3SIZA 4TVUA 3QW4B 3NQMA 3PSWA 3QMTA 3ABQA 4UTWA 1JIBA 1VYRA 3LLDA 4M7TA 2NWSA 4NUWA 2E6AA 2F7FA 3RNDA 2NUWA 2J9ZA 3TXVA 5G4EA 3A5VA 1DQWA 2WKGA 1HTIA 1A50A 3L67A 1D7FA 4WUIA 4MYAA 2VT0A 3EWUA 5CZTA 3BUDA 2ISVA 5HULA 1SPQA 1G4SA 3ZT6A 4WZHA 3VI2A 1THFD 4GXMA 1H63A 5DELA 4NX5A 2FPYA 1WO2A 4NZJA 3QEZA 2Q8LA 4ZQCA 1BWKA 2ZZ7A 1W5OA 3W7DA 1SR9A 1G5AA 2ZUVA 2Y89A 2XVKA 5D09A 4UTHA 4UFKA 1KBBA 3P82A 2WSPA 1OYCA 3WDHA 1Z44A 2RDTA 3EEGA 3QZEA 5E0KA 1SW0A 4H7VA 2ZXAA 3EJTA 1LWHA 1UUOA 1AQMA 5FF2A 3WJYA 1JCYA 3C0JA 4O16A 4NXSA 3LI1A 2NZLA 3DU0A 1X7FA 2P0OA 3WJWA 3T7VA 2YX0A 3B06A 5DCBA 4E38A 3W9ZA 2IGTA 1YTDA 1XD0A 1P5BA 1QI4A 2G97A 4K8EA 4B9YA 3CTTA 2PRMA 3FS2A 1W5NA 4MUZA 3MWAA 4HA1A 1PE1A 1N55A 1UD2A 1JCMP 1BVZA 1VCVA 2FPVA 3EJUA 3TQ0A 1L2UA 4GC4A 1G4TA 1OFQA 3O1NA 3OG3A 2YFOA 4BR1A 5D05A 1ZJIA 5F2LA 1KFJA 1JRBA 1W5QA 1WOAA 3RILA 2BWGA 2VC6A 3NYZA 2H3BA 3UWVA 4O1DA 1IF2A 4ZQPA 2V81A 2F1AA 1HTYA 1QR7A 2Y62A 4UOQA 4UOZA 2G5WA 4RX0A 4S2CA 2F18A 3NQFA 3WNNA 1ZFJA 4DELA 4ZL1A 4GINA 2QJIA 3GIYA 3FW6A 3GAKA 3USBA 4KMQA 4IMGA 4JX4A 3W7JA 3UG3A 2VFGA 5D2VA 1LBLA 1DJQA 3NL3A 3O05A 2BX7A 3ZO9A 5CZJA 3S1XA 1KM0A 3VSVA 3TE9A 4WXZA 1AW1A 1U83A 2VRQA 1B4EA 4X2RA 3WY2A 3IGUA 4HSNA 3M5VA 1ME9A 3TFXA 1VQTA 3FYPA 1XI3A 3I7QA 3RFAA 3F1QA 4H8HA 3ZFHA 3QH2A 3UERA 1V3LA 3BUQA 1ALDA 1E51A 4RKAA 4YXGA 1QWUA 2AGKA 4KWWA 5KITA 3M47A 4JTEA 3PC0A 3N9RA 4AMWA 1LDCA 1I75A 3QPYA 5A6LA 4CNPA 1JUKA 3C2OA 3W71A 4FF7A 2QCCA 2GVYA 1SO6A 3R12A
chains in the Genus database with same CATH superfamily
3GIZL 1CYGA 1CXHA 3SIMA 1YYLH 2QCGA 5J9PA 2V2CA 3Q8EA 1HP5A 1JFQH 2DWXA 1M6UA 3HPFA 3BKYL 5F4XA 4ZFQA 4DEPC 3ROOB 2X4TA 3RZCB 3G6JA 4PRNB 4J2PA 1RAKA 3EF7A 4EWND 1YEGH 4NY2A 1WAUA 1G7JB 3UO1H 4JY9A 4P5KA 2KS0A 4ENEC 2XWJB 1SO5A 1FYTA 1ZGLM 1JGIA 4DGIH 2XZQL 4G7EB 2NRDA 4OZGB 4WEBL 4HQVA 4K39A 2R29L 4JN7A 4U10A 4HUVB 4TULH 4FL4B 2IQAA 1AO7A 3PL6C 1DLFH 3PAVA 1QG3A 2HFFA 5FM8A 4GSUA 2N56A 1N26A 3LRMA 4HJ0C 2R24A 4FHJA 3D7PA 5HYJA 1ITBB 3UTSA 3FB5A 1KJ2H 1D9KD 4S3GA 2MJWA 2XVLA 3VX0A 3G5YA 3V7PA 4LH8A 4HJ1A 4X4XA 3MV9B 4H88H 4R7LA 2OMAA 4E5XA 3EYUH 1Q8MA 4DK6A 3MROB 4UOW1 1UQSA 2RBLA 3S1WA 5JPMA 1WAAE 1ZSHA 4G70B 2VKWA 3L65A 1SW3A 4AVKA 2B1AL 3JTTA 1CG9B 3SY6A 1UCBL 3ROLB 5EMYA 3EHBC 3L0NA 2G5BB 2XH7A 4G9PA 5HHPA 3VFNB 2E7FA 5A6BA 4WI2A 4NQ1A 4Q8OA 1D5MA 4G8GA 2QGDA 2HFEA 1V7YA 2OCFD 4DXVA 2ZUNA 3CPLA 2IANE 4WV1B 4O1AA 4HIEA 2VDHA 1XLFA 4RE2A 4AZHA 2FEDD 4NM8H 3FKRA 4WSKA 5CLZA 4NBYB 5HYQB 1S8DA 4B4HA 2FBJL 4QITA 1DKWA 2J1YA 2BLEA 4P8WA 3W87A 4F15B 4JK0D 3VNZA 1GMIA 1D5ZB 4QE4A 4KTEH 2FVNA 3ULUH 4R7XA 2J88H 1F7BA 3NSMA 1S3HA 3BG5A 2JB6A 4PCFA 3O0FA 4PREB 4UNTA 3P30L 5MHSD 5T5NG 5CJBA 4K37A 4XNQB 5K1NA 2FWSA 3QDJD 4ASTA 1YEHH 5C2CA 3U2OA 3S34L 3PGFL 3S8HA 1X5FA 3S7GA 4UBPC 2NXYC 4H20H 4XH2B 2VR3A 1HHHB 4JM4H 3W86A 3GJFB 2OPJA 3UA3A 3HQ1A 2XI9A 3VG9B 1X4YA 2CG9X 3ZWSA 3P40A 2H3NA 2FGWH 4ZQNA 1K7FA 4ENED 1J8HA 1O66A 3GIQA 3UD6A 5E8NB 5EIIA 2QUNA 4TX6A 2Z7YA 2VITA 4HNUA 1BM3L 4DUWA 1C3FA 4IYKA 3ZE1B 5MEPB 3PL6D 4D1IA 1I45A 1Z5HA 2UV8G 3RBSA 5AKSA 1SUJA 2EPOA 5ISZA 3DFOA 3TBTB 3IMRA 3B5GA 3MZNA 1EZ2A 3JZ7A 3QXTA 5EU6D 2RGSA 3PIQA 4EIUA 1Q0EA 4MJ5A 1ZS2A 3K7UA 1UVQA 5CSYA 2PDUA 3PQYD 3KJ6L 1U4EA 3P9LB 3PUEA 1J8VA 2WWNA 3E9UA 5JIQA 1ONRA 3RUGA 1OSPH 4PCNA 2M8XA 1LQAA 1CGWA 2PF8A 1GHRA 3KYNA 2RJMA 4F9PC 4WU7A 1GTNA 1VADB 2IOIA 1I1AA 3SURA 3WDQA 2XTSA 5H37G 2ADYA 5AB2A 3TZVC 3VXSE 4P9HC 4LF3A 1FG2A 4Q8WA 3LHPL 4LNCA 2OKOA 1TRIA 1SJHB 2J20A 3LNMA 1H3GA 3ZPDA 1BBJB 3R4RA 1WFTA 4LBSA 1N0XH 2UY3A 3FUFA 4RDWA 3IU4L 1Q9OA 3MV01 4P59L 1WITA 1BRLA 3AT9A 3RCYA 4YUEH 1WISA 5EL1A 3JWDH 4DJMA 5IW6B 2EVIA 1MXSA 5DX7A 4P7LA 4ZODA 4GD0A 3MDUA 3VA6A 2OI9C 4ERIA 5C7HA 4FQCL 2ALDA 4LSUL 3P77A 3MDJA 3RWIB 1MCQA 5H91A 4HV8B 3F65A 1UJTA 1U8CB 2D7MA 4RGNE 2IQ9L 3RWDB 3MDWA 4NILA 5IVXF 3Q94A 4PH8A 4A3UA 3LTSA 2BNJA 4BGDA 4H26A 3W7EA 3PTDA 1ILUA 3GBMH 4Y88A 1IM3A 5KOVC 3WKQA 4H9MA 1NGWB 1OCRB 2O6DA 4W81A 3UY7A 2NMSA 2R1WB 3HU7A 4G7QB 3VXUD 4K7YA 2DBJA 4XVUC 5CEYB 4MA1B 3LBMA 4C56E 4A6YA 4NGHL 1T5WA 1KM3A 5ETUB 1NJ9A 4RFEB 1KIUB 4JTFA 2FYYA 2C3VB 2ZTJA 4F24A 3QJOA 4HWEH 3P60A 3VYPA 3LIZH 3ARVA 1BSIA 2WNXA 3OD3A 2IGFL 3U0PA 1Q72H 5J04A 1TRDA 2OYLA 3ZXWA 2HWZL 1ETZA 1NEPA 1G0XA 5I8OL 1Y0EA 1HL9A 2AV1B 4XMKL 4EOWL 2YL5A 2SEBA 4N0CC 4CDHA 3U4EB 2WB1A 1FV1A 3W29A 2CZFA 4WSHA 3JSSA 1B54A 3IDJB 4V28A 2R0LL 4X9HA 2AABL 4AJ0A 2PWFA 4OZFA 2UY6A 1QHPA 2VR5A 2HVBA 5BRZA 3RTQA 3NEVA 4ERAA 1SYVA 3TZVD 2WXHA 4JTSA 2B7OA 3N91A 5GNXA 3LNFA 4OQ1A 4BE5A 5JMUA 3KDMA 5LNEA 1B3IA 4O5LL 4OCRL 4A38A 3CX5J 4WNJA 8XIAA 2XQYK 2A7BA 3FN3A 3T5WA 5LG1A 4RNIA 1TZIB 4KKBC 1F4XH 4ZW8A 4V33A 1X8FA 1B0RB 3SJVD 5E94A 3HAEH 2J2ZA 4MQTB 4DVOA 2XWDA 1AD0A 5E6IA 4U1GC 1SO3A 1WD8A 1ENUA 1H3TA 4FFTA 2OLAA 4LO9A 3HS0B 1ZIBA 2IDUA 2VM9A 5LG6A 5IB2B 4FNQA 1XH3B 5I8CA 2A6KB 3U4FA 4DI8A 1K70A 2IG2L 4M02A 4B3EA 1VCFA 5FAJA 2QVIA 2FZ8A 4DJEA 4XN9A 3SDXA 2F7OA 1UENA 4MMYB 2W94A 4ADJA 4LPCA 2Y06L 3WEXA 4YHLL 5HY9A 1M7DA 1MCBA 1SJAA 5C0IB 1D5BA 5ABFB 4KJWD 3CQIA 2I60H 1MJJA 5AD0B 3CXHK 4BYHA 4XWGH 1ETA1 4K8GA 4EVNA 4RZ5A 3KHOA 4XVUD 5H8PA 3GZAA 4G6FB 4PFEA 1AMXA 1NQKA 4X6BA 2GTZA 5EU5A 3RGHA 1NC4A 4R90L 1GYWA 1BREA 1K8ZA 2VDNH 1DQJA 3H0TB 2K7PA 1PSKH 4Q9QL 1GW0A 4DBEA 4U0RB 4AT6A 2E1WA 3D48R 1T0OA 1TTQA 3CHVA 3FJTA 1R3IL 1O4UA 4IIQB 5BS0A 3HBPA 2CWXA 1G9ML 2V7HA 2A7PA 3USZA 1BQHA 2DQDH 2VRJA 4GSDL 1LP9A 2OMYA 3AG4B 1R86A 3G8EA 3V0IA 3AYTA 3OXRB 5ES4B 4GRMA 5I1CH 3MNZB 4I1NB 4DERA 1EWEA 5LGXA 3W3OA 1DBKH 2ZYHA 3ECBA 3AU1B 3BI9X 1DWJM 3BH8A 4F7TA 1P0NA 2VP8A 4MDJB 2IC2A 1DBBH 4R7OA 4HHMA 3DSNB 1KPVA 1J48A 1TG7A 1BQUA 4E0RA 4NHCL 1TZ9A 3C8KA 3TEVA 4KKBD 3BUYB 3U2CA 2J7HA 2O6FA 3OSVA 4O51A 4N3UA 4FQXC 1QHZA 1PDYA 1F4WH 2AGTA 4QOKA 1TSIA 4HZLA 2EDTA 1QI2A 2ZOWA 1XKYA 4JG1H 3S1VA 4OLUL 2VFDA 5IB3B 4GJIA 4M81A 5I66B 4XX1G 1XH2A 3O3EA 4PSRA 1OK8A 1AI1L 5JBEA 1IKFL 4XQ6A 3MRHB 2D7PA 3J7HA 5F1IA 1EBAA 3FMGH 1N64L 3A6CH 3UC0L 4PTWA 3W1PA 3KDNA 2X1PA 3NVTA 4LHJB 1FAIL 4AXWB 1M2VA 1FNHA 4I9JA 3DMMA 1GPOH 4D0BA 2A99A 3DERA 4XTIA 1AE6H 5LCVH 1NCDH 2V2WA 3CFEB 5T1DH 3G8RA 3O6FA 3N1PC 5EIVA 4HT3A 1CB2A 4ONGL 1E9PA 4EN3B 3OZMA 1BYBA 1RV6X 1LOSA 3AWNA 4NQSA 5IUSA 1A6TB 1FH2A 2RA1A 4L4VE 4Z1AA 4EIBA 5F9OL 5FCUL 3TIDA 4O9HL 4N42A 3PJUA 4FHAA 5DRNA 4Y2LA 5D9MA 1YSOA 3C52A 2XSKA 4U6HA 3TH4T 2BNRA 4HOWA 4CUCA 1NTDA 5F7EH 4JDBA 4X9SA 4DUXA 2X6MA 4TMCA 4HT1L 4X4YB 1TPH1 4LSQL 3T1GA 4N24A 5C2XA 4OFYA 1UXLA 1YNTF 5FI8A 2W63A 2V17H 4N6QA 5CZSA 3IVKB 4MSWA 5AZ2L 5BMXA 5T3XE 1MVYA 4G6MH 35C8H 4HK3J 1IT7A 4P5TA 1PKQE 4HSHA 2Y7NA 1J5HA 3VNLA 3TN6A 3W7LA 5IUCA 5GSRA 4D0CA 1YC7A 2HFGL 3GG7A 3ZKMD 1X4ZA 4W85A 2FIQA 4R33A 1JK8B 4S10A 1N5AA 1RUAL 4YTSA 1ZBWA 3KGTA 3R6IA 4NYUA 4I7UA 1HZHH 4PEEA 1MCWM 1SN5A 4GAGH 2E7LC 3NYDA 2X7LA 4BQCA 4WJ8A 5JH1A 1QP1A 4HNNA 1A7QL 1QOPA 3UTPD 2E8ZA 1ZSXA 4MWAB 1H8OA 4P05A 1EX0A 3KWXA 1XTMA 3G1DA 4XPGH 1W8GA 3RZCA 3O2DA 3OGRA 1QRNE 1AODA 2CLKA 4PTTB 3GLEA 1G7JA 4MKNA 1TZGL 1JN6B 1L6ZA 1FGVH 1BMGA 5CCJA 3ISIX 1NP0A 5AAPA 4OZGA 2H9GB 2J7EA 4JN8A 5KEZA 1T4WA 1D2OA 4NLAA 1XGRA 4M80A 5MKGB 2X2YA 2OS7A 2GSGB 2DIJA 3FHAA 4OIAA 3LEPA 1ONWA 5FUOH 3DJRA 3QEGL 4X80H 3FCSB 2W88A 3VXRE 4QCIB 2GCYA 4PBVC 1KJ3L 2PWEA 3T55A 2DQGH 4CQAA 4KCUA 2PFHA 4Z78B 2HPTA 1WPCA 1TVPA 9XIMA 1DFBH 1U8OB 5ELIA 4YFEA 3Q5TA 5AC7A 3MROA 5BZXA 5INDA 2IFFH 2H2PC 3SCOA 1NDMB 1VKFA 4PJ7B 2EIBA 1YNLH 4PMQA 1ZA3A 3ZT7A 1MQKH 1RIUL 2C9SA 2PYED 3S48A 4QCFA 1CG9A 3ROLA 3B8TA 4IMDA 1LTXA 3MRMB 2G5BA 1SMOA 1N18A 5TQ2H 2ZVIA 3LKQB 3SGJC 3VFNA 2X0HA 2LFEA 4L9ZA 3KPRE 2FEEL 2BWIA 2QNEA 3ARFC 4X7DC 3JZEA 4MY1A 1NMCC 3DZ1A 4WV1A 3SBWA 1QUMA 2DW6A 1MCRA 5KYNA 4A22A 3QDHA 5DMLA 2LAAA 5HYQA 5D8JL 2YPVH 3OJDA 5AZEH 4RRPG 5A5WA 4XNUH 4PJHB 3LCFA 3TJPA 2M26A 2C19A 1RULL 3UXLA 1D5ZA 3O0RL 4N26A 3QEUB 5EBLB 4RMWA 1L6XA 1XH1A 2QCLA 3UNTA 1NANH 4PREA 1TE1A 4AITA 1E5AA 3GHBH 4XNQA 1FNLA 3ZVHB 2YD8A 4K7VA 3QQDA 3LX9A 2Y5TB 4OT1L 4A2GA 1AIFB 3ZE2F 3VOHA 4GNKB 1I2QA 1E6QM 2FBRA 4XH2A 5JDJA 2RH0A 1HHHA 3RFZA 3GJFA 2OELA 3NIFE 4YK4C 2WZEA 5IB5B 3E9TA 3N18A 1LNUB 4EI0A 5DRZB 1J1PH 5E8NA 1YEDB 2B31A 2NYKA 4JUSA 5DK2B 1N8ZA 4XN8A 4MJ6B 1SJDA 2HPIA 1J9SA 1JTOA 4LRNL 3QULB 4UTMA 4NZUH 2YPLA 1S5IH 5IWLA 5IJKA 4LVHB 3GYCA 3TBTA 1EX1A 3HUJE 3TP4A 3RM8A 1W2PA 3EZ8A 1BVWA 5D2WA 1DTUA 1T83A 3L5WB 2Z0UA 1V27A 4FF9A 4DPRA 3WFEL 4OQTL 4JFHE 3MR9B 1UR0A 2PP8A 3TS8A 4DN1A 1A0QH 4TVUA 3P9LA 3UAAA 3CMOH 4NUWA 2FAUA 5I6NA 2NUWA 4PRBB 2J5LB 3L67A 3AXKA 2EXSA 1OTUC 2NY6B 3TBBA 3VI2A 1VADA 4ZCWA 5EBMA 4BKNA 2ZZ7A 1PEWA 5D09A 4ZOEA 4S1DD 4E8CA 4Z7VF 3ARFD 1LWHA 3NN8B 5D7HA 3VAVA 1GKPA 1SJHA 4NWUH 1BBJA 4KHXL 1YTDA 2G97A 4CU8A 2DYPB 3EFDL 1WT5A 3KYKL 3IXTB 4ZK8A 3LNDA 4UAHA 1JCMP 2WUBL 2R7EB 4FI7A 2WZ5A 3L6FB 1RURL 5D72L 4GZEA 3SDAB 4UDTB 3BGMB 5JW3L 3MODH 1WRFA 2F18A 4DWSD 4PWHA 1K77A 4IQJA 3RWIA 3S1XA 3TE9A 4HV8A 2NSQA 5I6XB 1U8CA 3QWRD 2DSWA 3A3XA 3I7QA 3T8QA 3RWDA 3F1QA 5C09E 5CILL 4KU1A 1Q1PA 1EFZA 3M0YA 4YXGA 1YPZB 1MQ8A 4EJ1C 1XC6A 4P2CG 1DL7H 1JUKA 1OQOA 4N8PA 2QIIA 2GVYA 1Q9KB 4M7JH 4YXHH 1JPGB 2C5DC 4IMAA 1NGWA 3H1ZA 5CQ1A 4P5KB 4ISVA 2QV2A 1V3MA 3GMOB 1RLBA 3MHZA 2R1WA 5J5RA 2V9RA 5CEYA 3V9CA 4I0PD 4S1RH 3UO8B 4BFOA 3MPGA 5B3JF 2AQ2A 4RFEA 1KIUA 3LB6D 1KN2L 5DMNA 4FP8H 2IQAB 3KOZA 3KL3A 2C3VA 1XVSA 2HFFB 4PVLA 3RLGA 1W5MA 2J21A 1XHGA 3FB5B 3FN0H 2ZYFA 3QUZC 3SGEI 2GJXA 5KS9F 2NQHA 3WJXA 2QDDA 5FGSA 2WBJA 3HPZA 4R2GC 4X4XB 3WNKA 4XO8A 1SBBA 2AV1A 2N3JA 2B7DT 5TPWL 3AC0A 5I71B 3PF3A 3FT0A 3U4EA 3DHPA 4X4ZA 3B2DC 1QQDB 3WLKX 5KVDH 4KFOA 3IDJA 4AGLA 4JM2D 4JO1H 3QYMA 5M94B 4Z2LA 2P5EA 5HHMB 4ACTA 5I07A 3UJRA 2J66A 3G5EA 2DKUA 4FERA 3BTNA 3U4AA 1HFUA 1D5MB 3GHTA 2HFEB 1CLYL 4E9WA 5F9DC 3NQ6A 3SFKA 4HIEB 3E2SA 2P43B 3L5LA 1UW9A 1FZJA 4B3VA 1W5PA 1AY1L 4QROA 1JWUB 4KJPC 2WYZA 3VK5A 1S8DB 3HFMH 4WWKC 4M8VA 3RJQB 4TTDC 4M0XA 4MNQE 5TFSL 1TZIA 4JIRA 3WFCH 4LVDA 4DJFA 1B0RA 4YTTA 1YUHB 1F90H 4FOKA 3F4DA 1LG1A 4LEXL 3VTMA 3HS0A 3BW9B 1NAMH 3NZGA 3GKAA 1CQKA 1H8NA 1RZIA 5IB2A 2BVOB 2F6KA 1VPXA 1XH3A 3EWXA 1HS6A 2A6KA 3SSJA 2HPOA 3VFPB 3V6BR 4M29A 1OFEA 4D8PB 1FF5A 3BRGC 1HNYA 4Y9PA 5D7SH 4J3WA 4HUNB 5AVZB 3D87B 4A8IA 4MB5A 2YBGA 4LKCA 1DWAM 5C0IA 1MDTA 5ABFA 4OI9A 4LUSA 2HTMA 2H3NB 4KXAA 1MCWW 5C8BB 3U30B 3GXFA 4I3RL 4GI4A 1MHCB 4M5TA 4WW2F 4PE8A 1N4XL 4OD1H 2IV9A 4YHGA 1OCWH 2CKSA 1G7QA 3MRJA 5J6SA 1EGJH 2XSAA 3B9OA 1NOAA 3WO3B 3VTTA 2WJ7A 5C5YA 4AZUA 2VOMA 3GFXA 1X38A 5CFHA 1AH1A 1UM4H 3OF6D 1QVBA 1P0KA 3QUZD 5LNDA 3VILA 2PSNA 4KESA 3GRWA 1UT9A 4R2GD 3I6RA 3MKVA 4DZIA 1B9ZA 3S5NA 1KGCE 4RISH 1TTIA 4LCIL 4HCHA 4KVNH 4S3JA 1TV7A 1L9TA 2CR3A 4D7PA 4ZDHA 3AIEA 1OWQA 3RMJA 5DRCA 3OXRA 1DJHA 1R8LA 1I1AB 1TV4A 1MOEA 1V8EA 3W26A 3ZTNH 2NVDA 3WJZA 1U36A 2WM0A 3NQDA 3SYPA 2DZXA 1J9CT 2GSEA 2OGJA 1U1HA 3HZKB 4KGJA 4MAZA 4XD3A 1E8WA 3LXUX 4ZMYA 4Y5XB 2YDSA 3HMXL 2HKFL 4HPJA 4MDJA 4NJ9H 2GITB 3DSNA 1FTXA 5DD6B 5DO8A 3SCMC 1KTLB 5MF5A 3GNXA 4PS4L 3P0YL 4L37B 5FFLA 4TUKH 2A3LA 1AVAA 1CT8B 2FHCA 4XPTH 4H4NA 1E9IA 3P77B 1G9HA 1XC4A 4W9DC 1Q45A 2UXVA 2X88A 4OQVA 1HJXA 3ZQ9A 2Z0BA 5I66A 1DBTA 2FGLA 5CJXA 1ZQ5A 1XGUA 1PL3A 3MRHA 4I5RA 1D7DA 3RX5A 1VRDA 2HCZX 2GDUA 4Z1YA 4ZQOA 4IRSA 4ZMXA 3FQUB 1IM3B 4AXWA 2YL8A 3O7UA 1BQSA 5E6UB 2B0SH 2ARJQ 3CFEA 1BBDH 3QLDA 2FMOA 1W72H 4P8XA 1FBIH 4UMCA 2FK9A 4PYSA 4EN3A 1P9MC 2KLSA 2ESVB 1NBQA 2Z1VA 1T5WB 5A8PA 3PZQA 1A6TA 3MW7A 2QHRL 1DVYA 1HOCB 3CLMA 4Q2ZB 4NUPA 3UZZA 1GT8A 2H1PH 4FG2A 3W57A 3U0PB 5FYJU 3GSNB 4K3JL 3PUUA 4I90A 1K8DB 2Z1XA 1N9PA 1TPEA 4AV4A 4X4YA 4JQXA 5HVHC 4B15A 4XNYL 4LNYA 4W5UA 5CEZH 3IVKA 2D23A 2BZDA 1W9XA 3ZKXB 2HPMA 1QFWH 1LO5B 3RVWD 3ISWA 1GGIL 1E0XA 4OZFB 3QS3A 5D2NE 2P4AB 4K15A 3WGVB 3RTQB 3W38A 5EZIL 1MDLA 4OE7A 5I0VA 2DM3A 2P5WA 5MHSE 3FKUS 3WIHL 4JIIX 5EB9A 4E3TA 2EJAA 4ODXA 4GBDA 1NGQH 5KVFH 3QDJE 4XZ4A 5EU3B 3RHGA 3DGDA 4HISA 1JK8A 4Q32A 1I9IH 3RRXA 4QRRD 2TRHA 4WUKH 3GBDA 1OY0A 1IIIA 4C6NA 1B3ZA 4X61A 3MOAL 4UYQA 5E09A 4KFMA 3SCMD 3R7MA 1W1B1 4GS7B 4KUZH 5MENB 1EGVA 5CAYB 5IKCB 2YKLH 1RZQA 5E94B 3N44B 5L88L 4HC1H 5HDWA 2CW6A 4UTBL 3QG7L 2D0GA 3G04B 3E49A 1IFHL 4MWAA 3AG3B 2ZPKH 2LABA 4B92A 3KH3A 4H13C 4ADUA 5EEYA 4C1NB 1WKDA 1H51A 2E7MA 2FJUB 4G80B 2GPZA 3K30A 4PTTA 4LC6A 3SADA 4RA3A 3OLIA 4OF3A 2IPGA 4P5UA 3AO0A 1JN6A 4C5YA 1RCYA 1QASA 5FJRA 1IC5H 3LPWA 2H9GA 5DC4B 1M57B 4J3UA 3GHEL 3ZOAA 5EU6E 2VR2A 5MKGA 3UGUA 4A8RA 1V05A 3GFYA 3LPGA 1TETL 2GSGA 3GXIA 4NL1A 4FFZH 4PUDA 3EKZA 3CWGA 5CJNA 1DO5A 3C5QA 4OGYL 1X5ZA 2AEQL 2E59A 3FCSA 1WCGA 2GTZB 3MLWL 1H49A 2YOAA 5AW6B 4PJAE 4OCWH 3WF4A 4NU7A 1R3KB 4AZIA 4N9GA 1HH6B 1BPLB 4JZ5A 3VMOA 3M45A 4Z78A 2KYIA 3DIDA 3JV6B 4EZJA 4DYEA 1MSSA 2PR9A 1W9DM 5IK3B 1N2VA 1U8OA 4BWTA 2V8LA 4P46D 5C97A 4AT6B 1NDMA 4PJ7A 5FSEC 4L8SA 1KEGL 5FV1L 3G0SA 1GYVA 4HEPA 1N7KA 3ZL4H 5LQBL 4H0HB 2PDNA 3LDBC 5BS0B 3TA6A 3TEWA 4PJXE 3LKQA 3T9WA 2V7HB 2ZWYA 4WWNA 3QCUL 2OMYB 3EWZA 2AJVH 1XL9A 2BOFX 5T1LB 2FDSA 3CZGA 1RV8A 1G6RH 3P3TA 5DBUA 1YHPA 2BIQA 3A3HA 3OQRA 2DOCA 4RGMB 2BBFA 4PJHA 5EA0H 3HW7A 1H19A 5L2KB 3MUAA 1FCQA 2C3HA 1H6UA 4TQHA 3QEUA 5EBLA 3WKNA 2DLFL 1TMHA 1MCKA 2X9ZA 1N8IA 3ZJAA 5GZNA 4BI7A 4YHNA 4CLMA 3ZVHA 3MLRL 2DZEA 1FFTB 3AROA 2OSWA 3GE7A 2Y5TA 2QSCH 5HOSA 1AIFA 4L3EE 1V3KA 3VXUE 3VD2A 1I8IB 4OZIF 4CC4C 1JNEA 2W0FB 5DVMA 3HMJG 3A24A 2FDMA 3T0EB 3S5LB 5IB5A 5IJCC 1ZD6A 1T7XA 2OZ4A 2HISA 2P3EA 1LNUA 5DRZA 1ZTVA 1JULA 3FVDA 2Z3FA 1YEDA 2A79A 5DK2A 1U3JA 1UOVA 2ZZ2A 2NY0B 3UJSA 2G3NA 1KRCC 1BFSA 3OZ9L 4MJ6A 2BV9A 5AHMA 4D0BB 3QULA 2LGNA 3MFGB 1JJKA 3SYCA 3GZOA 1B3WA 1EJ7L 2E25A 5G2WA 4DPPA 3T71A 1XIGA 1UD8A 2Y70A 4GKTA 2MFNA 3PUDA 3M9YA 1D9KC 4RFNC 3BIKA 2NQCA 4O18A 3L5WA 1V6XA 3WFDL 2GUOA 3DV6B 4M7LL 4K9EH 4ZSTA 3TIDB 3SPGA 5I24A 1Y6NR 4YDNA 1RZKH 3MR9A 1RVGA 4A6GA 4YZFE 1MCPL 5FSDC 1BVNT 2IPTH 4U6HB 4PRBA 1F4AA 5AOJA 4WIQA 4XD6A 2I16A 3QYCA 8FABB 3QH3B 5CAKA 3OTRA 1NAKL 1TQUA 1P4IL 3G24A 3K8LA 3KLLA 3OIXA 1XCTB 3FS9A 3IXAB 1BQKA 2W81C 2D3LA 1VFAB 3LH2H 1FP9A 3NN8A 1BJ1H 4NQDD 2XA8L 1OF6A 4UIOA 5D7IF 5L0QB 2FEDC 2OYMA 4R7VA 1CC3A 2R94A 3AZTA 4BEUA 2DYPA 2QEJA 5IV2B 4GUPA 2AV7B 3IXTA 4N8VB 2R7EA 2UZ9A 3LG3A 3GTTA 3L6FA 2QUUA 4TOQA 3SDAA 4UDTA 2UZPA 3BGMA 4LSSL 1V93A 1DZBA 1H5VA 2Z1WA 4X5PA 5D2NC 2Y61A 4RH4A 1CD9B 3HC3L 5I06A 7FABH 4KKZA 3N50A 2X7LB 2JEPA 1MZZA 4X9GA 4GSXA 1NDZA 5K9XA 3FTSA 3TNBA 3TURA 2OO6A 5FIEA 4JIQA 3TO4B 2ABBA 5EH1A 3VQLA 1YPZA 2VLMD 3DI3B 4XAGA 4F8LA 3BWWA 3KX6A 4HGWB 3VD5A 3AY4A 1Q9KA 1JPGA 4HS3B 1Z3GH 3S35H 2DGAA 5C2BH 1A6UL 1ZJHA 3GMOA 3F58L 3DJZA 4ZOCA 3G5WA 3WUWB 1JEZA 4B16A 2APWA 1WF5A 1XGRB 3V35A 4A7GF 1F2XK 2C26A 4XCCH 2ZX9A 4LRIA 1MEWA 4QRBA 2O61B 3S3DB 3BPLB 1V5XA 3BRFA 1TNNA 5EZJB 1OXYA 4YJZL 4NI8A 2QEZA 3S4TA 4WVRA 2GCYB 4ALAL 3SSZA 3ITOA 1AP2B 2HBXA 4X6CB 1OZTG 1HQ4A 1EHAA 4HMEA 3CFMA 5CPMA 4X9BA 1AQDB 4AUYA 3D1MC 2A3HA 4QHPA 2QXWA 3ZTCC 5AYBA 2IDSA 5TE6H 4ICMA 3MBED 4JRLA 3C0QA 1M4KA 1QQDA 5INDB 4A8NA 3U7WH 1N5YH 2WOYA 3QEQB 3D34A 1ZA3B 1A6AB 5FOJA 3MV7D 5EMMA 4LJ3A 2HH0H 4ZAKA 3WIFB 2LQRA 4KETA 4YSOA 4PJBF 4N8CH 2BSDA 1Z66A 4OB5L 4LSPH 3SE9H 1YEEH 2C18A 4M6UA 4YGVB 1KYFA 4IM4A 3WBWA 3U5UA 1RZFL 4LYQA 2IPKB 1JWUA 1QRKA 1UR3M 3OJDB 4BQ5A 2ZUQC 2XGBA 3JV4B 2CHDA 1Q7QA 3NDZE 6REQA 4PUJA 1QA9B 4HSCX 1SOXA 1YUHA 3D2UD 3S37H 4XZMX 3LCLA 3BW9A 2J8GA 3A6OA 2BVOA 3HVDA 4HQQH 2QGCA 4WJ5A 2JKAA 3QARA 1Q0YH 3QQDB 4NO0D 2FIRT 4KVCH 4D6HA 3U82B 3VFPA 1WJ3A 2R1LA 1ZAGA 4D8PA 2APVA 2Y7MA 3EXRA 4YVNA 3UXAA 4DK5A 2N0KA 5G2NA 5DCDA 4FA6A 3ZUNC 1CDIA 4XMLH 3EB3A 1RI8A 4DVBB 4H19A 3RFZB 3G1AA 1HIMH 5D7KD 3ZRFC 1NPNA 1DE4B 3FAXA 5AAWA 4V1DB 3WK1A 5JQIB 4L23A 2VH5H 1N8ZB 1MHCA 4A63A 4MXQD 5AW0B 1MJ8L 5JIIA 3W56A 2V4LA 2YPLB 4KX8A 1QFPA 1INEL 5I5MA 3ETBF 1TIUA 3NQ8A 2Q87A 2MWCA 5I18L 4OJEH 3QIBD 3ZJKA 2VLKB 4NBXB 3FHEA 4BCZA 1MPAH 4Z0JA 5ENWB 2Q10A 3R0NA 1OGSA 4OI7A 4JBSA 3LS4H 2H26A 1ZLPA 2OFQA 1HKVA 1EERB 4R83A 4WFFD 2DW5A 4R5VA 1NCCL 3GMNB 2JV6A 1H62A 2EC9T 3EZ4A 2L8AA 3T8VA 3QBUA 2R1YB 2L7QA 4N9DA 3WF0A 5EBMB 4H7ZA 1KBIA 5EOCJ 3GNDA 2NQ5A 3LV6A 2X4NB 4MMZC 3R8GA 3MJ9H 1LJYA 2J9ZA 2YBUA 3HZKA 2Y0FA 4Y5XA 2VLRB 4ODBD 3UTPE 4OIIH 2ITDB 2GITA 3ZT6A 2HE8A 4RDVA 2Q8LA 2PDHA 4DXKA 3K74B 4AD3A 5DD6A 3I2CL 4OZ4B 1HZYA 4UFKA 3MLTB 1KTLA 4NQED 3TN4A 2F5AL 5IQLA 4L37A 4PWJA 3VB9A 2UUDH 1UURA 2HJLB 1CT8A 3ECWA 3G5VB 4LSTH 4J4PA 5ADPL 3NIGB 3EJUA 5LIUX 3MGAA 4BFEA 4YHKL 2B15A 3WAJA 2DDQL 4WI5A 4PMRA 3G6JF 1L3WA 2PTWA 3GAKA 5FWQA 5D2VA 3FQUA 2W38A 3TC9A 1WKYA 2FIKB 4KJWC 2MCG1 3IDXH 4ZNEE 2WZIA 3RFAA 4ISVB 4Y5VC 3ZXAC 1V3LA 2GHWB 2DN7A 4ZS7L 4AMWA 2K8QA 5JQHC 4Y9MA 4K3EH 2ESVA 1KBWA 4B90A 1AHWC 2C4FT 4UWMA 4YBQC 5DHVB 3H22A 3UPAA 1NKRA 2PYEE 1HOCA 4ROQA 4Q2ZA 4DO4A 1ZDSA 4S3FA 1B3OA 1CGSH 1UOZA 4W9TA 2NCMA 2GJXB 3RRAA 3GSNA 5I5IA 3D3VE 3NXFA 2GPTA 1OX5A 3CZKA 2WBJB 1K8DA 4CVUA 3RFRA 4NNAA 3NPUA 1MIEH 4D9RD 3IIZA 1TFPA 4Z7QE 3H4GA 5HSFA 1MRDL 3CZLA 3MTWA 3FNDA 1A80A 1YQ2A 1S7SB 1N2RB 2X53A 3H70A 2I56A 1LO5A 4WLCA 2BZCA 2J7GA 5B7YA 2FATH 1RHCA 1LGVA 2D7OA 4N0YH 1UADC 2P5EB 1VBJA 1VZIA 2IWGA 1IVTA 4JTTA 1UMYA 3BD5A 1IWAA 2PC8A 4KKRA 5BVPH 2ALRA 1H6TA 3TEUA 3DDGA 3C87A 3EA2A 2ZCZA 4XO7A 3ZZ1A 2VAJA 5KW9L 2PTTB 5EU3A 3BLPX 1RPKA 3CS2A 3GKWH 4XOEA 1FZJB 3V75A 5IFHL 1JGVH 1XFBA 2C8NA 1LO2L 1SXCA 1EBHA 3WI9A 1BYCA 5I0ZA 2GTWB 1RD5A 5MENA 4KXBA 1LVEA 5IKCA 1UR4A 4Z1DA 3P3UA 2XTJB 1RP8A 5FYLL 4DGWC 1JYNA 4RMBA 3G04A 3GI8H 3QK0A 1B88A 4YLBA 4XBMA 1ZHLB 5KBPA 4L29A 4CN4A 3AIRA 4U1HA 3WUZA 1RZIB 2FHBA 4C1NA 1HINL 4HYRA 2V0TA 4G80A 2H2SC 4ZENA 5GJTL 3UTTD 4WDWA 4CEXC 5C0QA 1KXVC 3UP1A 2G5RA 1X1OA 4Y9BA 2HKAA 1GAFH 1FC1A 5K69A 4OUUA 2R29A 3O6LH 2XXGA 2ZXQA 5FF6B 4LKCB 3L45A 1LO4L 2HDJA 2QUMA 4LUSB 2EDKA 3NA4A 3DJSA 5IHUL 4PUBL 4N6RB 3NGBB 3FONB 3ASNB 5DFAA 4EXPX 2CMRL 3VINA 2JQXA 3B7TA 1CB4A 5LBSL 5XIMA 3N6QA 2O30A 2BM3A 4QY8A 5FA5A 4X5WA 5F9WB 5LGJB 2DQEH 3I10A 4YBQD 1R3KA 3F83A 4BXSV 1HH6A 1NOWA 1G7QB 3MRJB 3UXDA 5HMEA 3QSRA 3JV6A 2DZTA 2DBLL 1ZSDA 2BHYA 4OFCA 3GR7A 5IK3A 2V9DA 2X1UA 5J11B 4DETA 1EJWC 1OVZA 4TUUA 4B3KA 1OIOA 1MKFA 4XN5A 3HRZC 4K8HA 2E75C 2PGRA 4BEQA 3PRZA 2A4AA 1LWIA 4FS9A 4Q7DA 1QNZH 3RUGF 4LESA 1F3DJ 1LORA 2ZYIA 4AMKH 3X1FA 4HJJH 5BV7L 3LQGA 4ZDHB 4YDVB 2KDYA 3O0LA 5T1LA 1E6OL 5F70A 4Y9FA 4DB7A 3KVJA 1NEYA 3NH7L 3CZFA 4EQ2A 3WJLC 3UGVA 3W1AA 1J5CA 3A4JA 1JZ6A 2HP4A 1KB5L 2D03H 3G0UA 3WLPA 3N85H 1WKFA 3ZKMC 3ZDYF 5L2KA 1R2TA 3TTSA 3EWWA 4MNGE 2XKNB 2GGIA 4EN2A 1SSGA 2YSTA 3P81A 1M1BA 2GABA 3NJIA 1BCIA 4FZ8L 1L9WA 4Y5YA 5EOCL 3E7JA 5AC5A 1YLVA 2NUTA 4N9BA 3IDMB 4N5UA 1CZ1A 3WTTA 2G0WA 4KY1H 4I9XA 3TYGH 2XRAH 1UZHA 2OZ8A 1V7NL 1I8IA 4AEOA 3UU0A 3DO7B 2W0FA 2Z8SA 2E8YA 5DGRA 1ZLEA 1DBML 2R0ZL 3T0EA 2GJNA 1NQBA 3S5LA 2H2SD 4MB4A 2VXVL 4IFKB 1XGUB 1NFDB 1ML0A 5KVGE 4NZ1A 4N0UE 1V77A 4JNXA 4GRLB 4OJCA 4IRSB 1G5GA 2NCEA 3PZNA 3ZN6A 1IO4C 1OM0A 3NVDA 4UTTC 3QAZC 4J6RH 4LOCA 3VNIA 5CC7A 3KUMA 4HNTA 2B2XL 3KLKA 4NCC2 3NBNA 1DVQA 4PTNA 3KJ4C 4XVJH 3PE9A 2CJTA 1MLCA 2VSMB 3B9AA 1NJJA 1ADOA 2ZADA 3R0MA 2AXGB 1CIDA 2I32A 3DV6A 3GC3A 2H8PB 1BIIA 4LFYA 4H01A 1ACCA 3G08A 5EF0A 3GNRA 1W6WA 1JZ4A 1UP3A 1DQKA 2JKPA 4JZOB 5I78A 3DX5A 5HNUA 1HVXA 8FABA 3N42B 3QH3A 3TYFB 4X6DB 1JCKA 1U0QA 4W87A 2UXGA 1IBHA 2NQJA 4ES9A 5ECGA 1MY7A 4QXUH 3W7HA 1PS3A 5CJOH 2AOSA 3B3BA 1AR1D 1MEXL 3EOUA 1XCTA 3IXAA 5ECVA 2NY1B 1S6NA 4MXVE 2FX9L 1VFAA 1I8UA 3LHZA 2HXTA 3KM2A 3WIJA 3QV9A 5EOTB 4BQ6A 4LL1A 1X7TA 4I2XE 5CPNA 5IV2A 1KTNA 2AV7A 1TPDA 2P5WB 4W4NA 4N8VA 3Q9QA 1EHLH 3DBSA 2CBOA 4ODXB 5E70A 7XIMA 5KVEL 1VCGA 3VM5A 4IRJA 3TUUA 2HVMA 5T9BG 5I30L 3I9IA 2P80A 1FWJC 4HIXL 1K85A 3WNIA 3RO6A 2GTQA 5AVXB 1KCSL 4DTGH 3PZVA 1C1EL 1PWMA 1YJDL 4AGQA 2Z4GA 2OZTA 4L0YA 1ZZMA 1LHZA 4GPNA 1ZCOA 4LSBA 5EC1B 1JPFB 1HJSA 2J78A 4UQBA 3TO4A 3MI3A 3FFOA 2QV5A 3QPEA 4FGMA 3U9PH 3WMCA 5IGXL 4Q7IA 3NACL 3UOAB 4HGWA 1IZCA 2D1ZA 3GTFA 2CLOA 3TU6A 5T3ZL 4Y1AA 3EADA 3IEAA 4HS3A 2BH0A 1FWHC 5E99L 1OW0A 1JQXA 3SDXF 3NQVA 4MDPA 1VFBB 3ZO0A 3MQTA 4X9YA 4YL2A 1UFGA 3VVWA 2QDEA 3WUWA 2DICA 3FSAA 2J1WA 1E6ZA 3QB7C 3VXGA 1FO0H 1S9KC 1RCQA 1OL0A 3ZDZF 4G7VL 4U7MA 5EFIB 2O61A 3S6DA 3NZHH 1UZ6F 5EZJA 1GVRA 3HZVB 3KRUA 1MXGA 2CHWA 3BT0A 2J7DA 5MHBA 3PV6A 4GNJA 3STBA 3BK0A 1GGBH 2ZKYA 4KNTA 1T40A 1AP2A 1Q4NX 3ULUD 4X6CA 1GCYA 2QF8A 4HPYL 4N9GB 4QRSB 2YAFA 3QXVA 2EDOA 1AQDA 1L2QA 4HSAC 3V1PA 3D30A 1QPNA 4WI3A 1YECL 4ODTH 5J13C 4JZJB 1H3XA 3Q01A 3HTWA 1V6YA 4L8SB 4U28A 3QEQA 3K46A 5GGTL 2GYIA 1A6AA 4EOUA 3K91A 1LP9F 1DIOA 3WIFA 3CG8A 1E6JL 4S1DC 2GC7C 3TF4A 4XX6A 3JUZA 5EFDA 1MG3C 4YGVA 1V7AA 1OIMA 3WQDA 3BQUA 2D3JA 1EJXC 2FHFA 2IPKA 4JO3H 4L1XA 2WD0A 5EF1A 3APYA 2JNZA 2IXQB 4NWTH 2VEGA 4TQ8A 5HQEA 4OLWH 3JV4A 4LZKA 5JA8B 3BVXA 3LD5A 2A3BA 4LU5H 1QA9A 5LHDA 5CWSB 2MNRA 3X3GL 3BOLA 3HNTH 2Z31D 2YOCA 2ISDA 4DWSC 4HALA 1QCWA 2W0KA 2WXIA 3L3DA 4JEGB 4A8LA 4RZ6A 4BSVB 3UYPA 4PG2A 1FWDC 4JTKA 4DO5A 4YHNB 3LSCA 1F5ZA 1QO5A 4FMFA 4DP8X 5AB9A 2VENA 2ERJB 1A25A 5KSBF 4P07A 3EFFA 3WY3A 1EHNA 5HUOA 2INEA 1TJIL 4DBWA 3T3PF 4AVJA 1Y7VA 4DVBA 3QO1B 2NY2D 3WMPA 1FA2A 3MNDA 3QV6A 5BNKA 2CR6A 3NGJA 3IUHA 4LYRA 5JDSB 4KQ3L 1Z9LA 3SDCA 1X96A 1DE4A 1LMKA 3TW6A 3GM0A 2BDNL 4V1DA 1J0ZA 1KBLA 1U3HA 3NFSL 4I0PC 1P84K 3P4LA 3OLDA 3LB6C 4TRPL 4OLVH 3WIAA 3NOEA 4C1KA 3GB6A 5AHIA 2D9QB 4U5IA 2PDLA 3VCNA 3PDDA 2XIIA 3INUH 1FLRL 3QFJD 4FQ1H 4K8RL 2IMNA 4KKAC 5GSVB 3BIKB 3ILQD 1QWKA 2VLKA 4EXQA 3H3KA 2D3VA 1J2WA 4AVHA 3FA5A 3BMWA 5ENWA 3QG6B 1COBA 4TL4A 2GUOB 2PDGA 3CSFA 3HI5H 5E95B 2HROA 3QISA 2IPUK 1Q6LA 1LK2A 2VDLL 3GMNA 4J3OF 2CK0H 4GJJA 4JM2C 4EPSA 1I8LA 5AVHA 5EUOB 2R1YA 5AFAA 1FSKC 1OFOA 3MI2A 2VX4A 1VFUA 4YEEA 3N15A 1XZ0B 2X4NA 3ZHKA 1GC1C 3H42L 5AW3B 5F7MC 2WNNA 4B60A 3VB8A 1K4CA 3CLEH 2P47B 3ESPA 4Q4SA 2VLRA 2OR9H 3EWYA 2UVFA 4NHVA 2ITDA 3LAFA 1DSFH 2K3TA 2UY5A 4GUPB 3PPHA 4OWGA 1UR9A 3AHXA 4HNVA 5HUPA 4OZ4A 3MLTA 2X12A 1EIBA 4G8EB 2H6UA 1KMGA 2G2PA 2WMPB 2E9MA 1UZDA 1J9QA 2HJLA 5C0CA 4KFNA 3ILDA 3G5VA 1SUXA 3TEXA 1KCUH 1I1YB 4IPIA 3N3TA 2MPAL 1OAJA 3QFWA 4BH7B 1TPXC 5LSMA 1FDZA 2QCDA 1CLVA 1PL9A 4DP7X 3P2VA 4ODSH 1US0A 4XVSH 5T5FA 3AS3A 3TC6A 4P9HL 3GRIA 3VKCA 4K23L 2CO1A 1OD7A 1BJ8A 1YPXA 4F2ME 1OK0A 3BE7A 2FIKA 3OVRA 4PJFA 2VEKA 2EC8A 1EMTL 2QPUA 4HWBL 4OZGF 3PZOA 4JQIH 4J12A 3B83A 1RK5A 2D9CA 3MRCA 3HA0A 3WS6C 4AWUA 1HHIB 2YRPA 4TKWA 3W7KA 3H56A 5DHVA 1I6NA 1DWIM 2O1AA 2N01B 3S2AA 1TO3A 4OGAD 2XPZA 1UYWL 5AHNA 1TA3B 3FK3A 3VX1A 4KKAD 1QTSA 1J8KA 3GU9A 4CILA 1HQ4B 2VQUA 4M6MH 1G94A 1HHJB 5DQJA 1UD5A 4ATDA 5J57B 3KPPB 1FWNA 4NO2B 1T5KA 1M05B 1A4MA 4CQ8A 1JS4A 1S7SA 1N2RA 2HB0A 4HKXB 2VQTA 2OT1A 2JKIS 2PUQT 5IBLD 2X2HA 1FCVA 2WSQA 3NK3A 1LWJA 4ZAKB 2CETA 1O9WA 4G5ZL 2DW7A 1ZAHA 3P69A 1SBSH 5B39G 4ZA0A 2R15A 2CRZA 1A7BA 3WUGA 2PTTA 5F96L 4ZXBC 4KOBA 3CVHH 3DFNA 1U4FA 1YDPB 1UJQA 5IQ7H 2GTWA 1AKJB 6REQB 4PRRA 1MMFA 1KCLA 5D1XD 3VGHA 1WZLA 1WZMA 2E6QA 5CJQL 4QXGH 2ODHA 5DLLA 4UNUA 2X4SB 2EH8H 2YUXA 4MZ3A 4QTFA 2F38A 1ZHLA 3A4DA 2A9ML 1OAXH 2B4CL 3DIVA 4JHBA 1SHMA 1CUOA 4NKCA 2XU9A 3P0VL 1O7AA 4WJ5B 3FXGA 3AXHA 5I1HL 5EULV 1KO0A 5I1KL 3GMMB 3NPZB 1FPTH 4M6AA 5AB3A 4ZI8A 2AQVA 4DJDC 4TLTA 1LF1A 3KBEA 4WX2A 5FF6A 5KANI 1ZBVA 3HQPA 3NOIA 3K5XA 2WK2A 1I1XA 3LN9A 4N6RA 3DETD 3CN1A 3FONA 2V2DA 4PULA 1T7VA 3V4UL 3X1GA 3OAUL 4HJEA 1Q2SA 3P6LA 3WL1A 1SOKA 3EYSH 3ZE1F 1UCTA 3QHFH 5LGJA 4RETB 2F1BA 5TE7L 4ZFMA 4MAVA 1HCZA 3MACL 4F8PA 3CDFA 4ZG1A 5BMWA 4GG6B 1S5WA 2VO8A 5E4EC 1W16A 5AVYB 3G2GA 5BUPA 4NQDE 3UG4A 4XN2A 4IWWA 3KVPA 3M0XA 3MRNB 1HEJC 1NFKA 3PWPD 4S0TD 3PG8A 4Q9BA 3E0WA 4PWFA 3QYSA 1L0XA 3ABGA 5AVQB 3SE4C 2H26B 3W84A 3PXJA 1HEHC 4BI5A 4JFED 3FU3A 3BRDA 4AZ8B 3IJ8A 2HNEA 1C91A 3RVWC 4ZXOA 4YDVA 4H8UA 1S38A 1WP6A 3UZYA 3PU7A 4I3SL 3C6EA 4X99A 4JFQA 1J1XL 2WUCH 5DWUL 2ZUMA