4DO5A

Pharmacological chaperones for human alpha-n-acetylgalactosaminidase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Alpha-N-acetylgalactosaminidase
publication title Pharmacological chaperones for human alpha-N-acetylgalactosaminidase
pubmed doi rcsb
source organism Homo sapiens
total genus 131
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4do5A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4do5A01
1CXHA 3UWYA 2DZWA 3DFQA 2VR5A 3TX9A 2VFGA 2XWEA 3MO7A 3VGGA 5D30A 3L4UA 1T8XA 2EEXA 1DKWA 3NOEA 3L5AA 4N9DA 4OE7A 4ORMA 4AMXA 2CZFA 1HL2A 1PVNA 4XTIA 1E3ZA 1M7XA 1I2OA 1O7DC 4Y9AA 3L5MA 1W5NA 4U28A 1WO2A 3NQGA 1H1YA 4DBEA 5FEPA 4PSPA 2LLEA 1ZAHA 1P5BA 1WOBA 3VNYA 2J27A 4PCFA 3CC1A 4JY9A 5EPDA 3TIMA 1BVNP 1DQXA 4J28A 4NJJA 2ZA3A 3G24A 4HHPA 4RV8A 3TC7A 3EDFA 2BTMA 3TFXA 1Z44A 2Y63A 1EH9A 3BV4A 1RQBA 1OJXA 3UQNA 1G5AA 4RK8A 4O1BA 1VCGA 5LNVA 2ABAA 4CVWA 4HPJA 1A5BA 3DX4A 3Q58A 4LTSA 1H50A 3SJ3A 3S5YA 1JXKA 1LRQA 3K30A 1AW1A 4HSNA 1QMLA 2FHCA 3OVPA 5T26A 2JGYA 3DI1A 3N19B 2EJ1A 4X22A 1EIXA 4IPIA 1XGZA 4UFMA 3NPVA 3KVMA 4IMGA 3HGRA 3QRHA 4FEZA 1GVFA 5LZLA 2XVLA 5HDRA 4FHAA 5HR7A 3GYEA 1MEWA 3CB8A 2DZXA 4TMBA 2PWFA 3BUBA 3ABOA 2TPSA 3R12A 2Q3OA 1FUYA 4KFNA 6ALDA 3FJ6A 2WVSA 5AHFA 3P74A 3BAKA 3NL2A 3LCLA 1ZJBA 4MY8A 1ZJIA 3LBMA 1MSSA 4RKAA 1BG9A 2OYMA 1QWUA 1SZNA 4WY0F 3MI3A 5DFAA 3BLIA 3G3DA 3C52A 3UG4A 4LS1A 3W7KA 3VM7A 4IMDA 4WOQA 3SGUA 3LDVA 2B7NA 3OLGA 4XUGA 5CZJA 5D32A 1LM1A 2P0OA 1PZ2A 2Z6JA 2WVVB 2VEKA 1OF6A 5CPMA 2WNWA 3N2MA 4O4VA 4GUJA 2FGZA 3WK0A 1VJSA 3CV5A 3EDDA 1ME7A 5AHLA 2OSXA 3G22A 1VLWA 5TD4A 3CIXA 3W2NA 3W70A 2Y7GA 5IM51 3WJYA 3KX6A 2YGYA 3HPXA 3SI9A 5AC8A 3GB6A 1G7VA 3B4UA 3W84A 3L68A 3CT7A 1M53A 2C6QA 3EJSA 2XIIA 2D2OA 2ZRWA 4O11A 3BGJA 4JTIA 3AJ7A 4KFPA 4JGDA 2H3DA 4K37A 3F03K 4HNTA 4TVUA 5TBOA 1DJNA 3UXDA 2Y2WA 2ZCGA 2D0GA 2BY3A 2H90A 3ABSA 4JTUA 4UR8A 1E3XA 4Y96A 3BW2A 9CGTA 2WOQA 1ZHAA 4O4WA 4N9EA 3GLCA 1QNVA 5F2IA 4FIRA 1ML1A 1CYGA 1X1ZA 4AB4A 3EWBX 4JX6A 1PIFA 4OWGA 1PPIA 1PCKA 4U2ZA 5FF4A 4N6FA 4ONVA 2PC4A 3WNOA 1Z41A 2ZUUA 4JCMA 5AYYA 3A4AA 3G1VA 3KLLA 3M5XA 1WZAA 5DCEA 3DGRA 3BUIA 2DZVA 1XXXA 3S9YA 4O50A 1K7FA 2WNQA 3QC3A 5D03A 1IXOA 1ZFJA 1TRDA 2H8XA 4M5PA 1CGYA 1XDLA 3EXSA 5EMYA 3EWWA 2IGTA 1WPCA 1UKQA 4W93A 4CKQA 5CPLA 3W7HA 2AAMA 4DXVA 3BVJA 3GBDA 1KCKA 2ZRZA 4UTTC 4Y8FA 1I45A 1WXJA 2BXZA 5HWNA 3G18A 3QW3A 3T78A 1Q4NX 3DHPA 1VFOA 3HQ1A 3YPIA 3BSHA 5DXXA 3NQ8A 3PBYA 1WBJA 3ZQ9A 3TV8A 3TKFA 3P67A 1EEPA 1BEUA 1GVQA 2A1YA 2YR1A 1VYPX 4E0CA 3VCRA 4JN6A 5DO8A 3MP5A 4ICNA 4CQ8A 5AB3A 1JCLA 2Y62A 5FEWA 1FY6A 3UWZA 4A29A 4NZFA 3LCWA 2E1DA 4JD4A 3TJLA 1UUMA 2V30A 1OGSA 5DY2A 4Q4KA 1H7OA 3LHZA 2GVLA 2ZA2A 3T4CA 1KV8A 1D3CA 2GJPA 4UTJA 2QV4A 3RILA 3W1RA 3HJEA 3IGSA 1OVDA 5KINA 4J3SA 4BFAA 3VM5A 2WCSA 1JCXA 4UZUA 1TIMA 2ZTJA 2ZUTA 1BF2A 2DZUA 3L5LA 2BY0A 5F2GA 1UKSA 2CLIA 2CWNA 1OF8A 3AXHA 2XN1A 1FQ0A 1QPKA 4JX4A 4DO4A 2QR6A 1XI3A 5LHFA 1JCNA 4PFMA 3DKLA 2NXHA 3EJRA 3W71A 2WSRA 4P61A 4A2SA 4ZL1A 4K8EA 1E43A 3LHUA 2QEZA 3P81A 1W3IA 1KM1A 1RPXA 4JTJA 1PHQA 4PSRA 1SUXA 3VI2A 5K4XA 3EJPA 3CPRA 2YA0A 3RLVA 2QLYA 4O18A 1V3MA 1CIUA 5I3GA 4BI7A 2WKJA 3LV6A 5CLWA 3LXAA 3DH7A 1QFEA 4NNBA 4PC8A 4GQRA 1FDYA 4FNPA 3ATZA 4H3DA 2X2JA 1PEZA 1R30A 3O6DA 4CLMA 3PAJA 3C0JA 3GXNA 5CZSA 4GO8A 1KBJA 3BARA 4NQ1A 4PL1A 3IIVA 1T99A 1RD5A 3S1VA 1X7FA 1BSIA 2VUYA 3KL3A 3IVUA 3U2OA 5K4ZA 2TAAA 1XFBA 2BLEA 2DU2A 1TPVA 3TQKA 1N55A 5AOUA 4ZQPA 1W5MA 3W75A 2BHYA 4MLRA 4O14A 3LI1A 1WA3A 1FDJA 1OFDA 4FMVA 3DHUA 4MY1A 2OCZA 1ADOA 1VZWA 1RVGA 1KFBA 1XSJA 1LP6A 3GVGA 3KE0A 5G2HA 3BCDA 5HMSA 4NJKA 4UQBA 1KM0A 1EUNA 1TB3A 2RDTA 3E02A 3ANYA 1GQNA 1JD7A 3BG9A 4FX8A 4KWVA 4WD0A 1G94A 5D33A 2WNZA 2XVKA 4MJMA 2GVJA 3TMLA 4C1LA 3G1HA 3NAVA 4TU1A 4IX2A 3Q94A 8CGTA 1IXQA 3W3OA 4JTSA 3IIPA 3IJ7A 4RXFA 3GK0A 1GTEA 1KTNA 3W76A 4B5NA 3STEA 1KM4A 1TQJA 3E96A 7CGTA 3LV5A 2E09A 2CZEA 3BUDA 3NNTA 2OYLA 3W83A 1GVOA 2I9EA 3S1UA 1XH1A 1LBLA 3EJQA 1GVIA 2VFDA 3PWAA 2WCGA 4LC8A 4X2RA 3VE9A 2OSWA 1WBHA 5K9DA 4HOWA 3NM3A 3WK1A 2ZIDA 1TO3A 3WNLA 4WF7A 2E8YA 2HS6A 1JXJA 2FPTA 3W73A 4O17A 1VLIA 4W9TA 4J3VA 1BWKA 2EAWA 3FIGA 1UASA 1JI2A 3W86A 1LOLA 1CGXA 3DBPA 3LHVA 2FLIA 3BVVA 1K7EA 3PULA 2CLKA 3GDTA 5DLCA 5LHEA 1EP3A 4JL2A 1C8VA 1L6YA 4OQVA 3PVFA 4UQEA 4Y6GA 4FNUA 4Z1BA 3GAKA 1U83A 3QMRA 1H7RA 1QPRA 3PSWA 1PJ9A 2J88A 1G1YA 5GVJA 4UTHA 3N9SA 2TYSA 5D02A 1WOAA 6TIMA 2ZX6A 2ZRVA 5FF2A 3FYPA 2OW7A 5FESA 4OKDA 4O1CA 1LYXA 3SGZA 2QMJA 2E5CA 1TCDA 1CPUA 3II1A 1MEIA 2V0TA 3VMNA 4MYAA 5FF7A 3WJZA 4RR4A 2NWSA 4O57A 4O0ZA 4HN4A 1OX6A 3NPWA 1YPIA 2FFCA 4OV4A 3PBVA 3NQ6A 4JR5A 1IIGA 1CGVA 1G4EA 2PRLA 3DX2A 5BOOA 2A0NA 4FLRA 4M19A 3M1ZA 3A6OA 3BAIA 1L6WA 5D09A 1J4EA 2E6YA 3BUQA 3TW7A 4EIVA 2CZDA 1BPLB 2EF9A 1KFLA 1UA3A 4ATWA 1JCYA 3GDRA 4ADSA 1HO1A 5A2AA 5EKYA 3KL0A 3BG3A 3TXVA 4O16A 1OX5A 1SSGA 3TTSA 1OHLA 1H61A 3K8KA 3W7LA 4DO6A 1OFBA 1HL9A 3DHDA 1ZS2A 2QAFA 3ZT6A 4IWWA 5HUPA 1TPC1 2C15A 1MW0A 1OSEA 2YKKA 3WNKA 2X1SA 1QOPA 3QSRA 1TTIA 5I3IA 1FWRA 1SMDA 5A5WA 1WV2A 1YXYA 4BI5A 3BSGA 5KEZA 2PWHA 3P7YA 1KFEA 2WV8A 1H63A 2GJRA 5FEZA 2FQIA 1PS9A 1YADA 4HIBA 3AJXA 2HSAA 1NF7A 2H6RA 1D9EA 2C1HA 3RIKA 3HG2A 4MUZA 4I7WA 3L21A 4FNTA 3TSDA 1TQVA 1SZEA 4UQCA 1UH2A 4MZ8A 1JL8A 2GPTA 3A23A 3C2EA 2FIQA 4DPPA 2WC7A 1PIIA 5BMWA 3DFNA 3CZNA 5MHBA 4CNNA 1FDZA 4JFUA 4UMAA 5CG7A 4FNSA 3Q37A 5F1UA 1NF0A 1SO3A 3GBEA 3QJAA 1TRIA 4LW7A 4WJEA 1XKYA 3W88A 4S2CA 1SQ7A 3KRUA 4XKYB 5U7SA 3WJWA 5KSWA 2A21A 4AH7A 4EF9A 1E40A 1ALDA 3W7DA 1P0NA 1U2YA 4AVFA 2NX1A 2F1AA 4FX6M 4NT0A 3ZWTA 1X1OA 3FS2A 2QCCA 4OT7A 5KMYA 2YOCA 2J24A 4AXKA 1VGAA 3CIWA 4O28A 5D37A 5C55A 3EDJA 3D51A 4UQ9A 4HT3A 4CCEA 5LNRA 3M5VA 3E12A 4K36A 3USBA 3MHUA 3L2LA 2F7OA 1MWOA 4R53A 2ZTKA 5E6ZA 1E51A 1FCVA 3W85A 1HT6A 2E5BA 3B03A 3VKJA 1TPUA 2E6DA 1LZOA 2WPBA 4LVAA 1CXKA 3W7QA 1TYGA 3EWYA 2V9DA 4ADUA 4LV4A 3DDFA 3NQ7A 1CLVA 4ZMGA 4AHQA 1JCMP 1JJKA 3P62A 3EWXA 3SW6A 1DHPA 1ODUA 2ZWZA 2VFFA 3NM1A 3A24A 1KA9F 1D7FA 2ZZ6A 3AMLA 1SW7A 3N3MA 4GXMA 5J5RA 1XBYA 3RNDA 1UD3A 2D73A 4DF2A 3B06A 4CNOA 4NI3A 1P4CA 3NEVA 4DF1A 3DHFA 4S2BA 1I75A 2ZXDA 2GQ8A 3SR7A 3LOTA 4P2VA 2E4TA 2EQDA 1RV8A 2G3MA 3GZ3A 3KLKA 3L65A 3A21A 1R46A 2YA2A 1B57A 2JKEA 4Z0JA 1R47A 2ZUSA 2QCLA 1V3JA 3W1UA 3QEZA 3ABRA 2ABBA 2ISWA 3MYOA 1BAGA 1W5QA 1BTMA 3ABQA 4M56A 3NL6A 3W1TA 4NJHA 1KLZA 1AW2A 1JCJA 2PWEA 1B4KA 3DC0A 2NXGA 1Y7VA 3LPPA 3VE7A 3BW3A 3HZ3A 3K8LA 3O63A 4UUIA 3M0ZA 3O8AA 3CTLA 5DCBA 4QM1A 3L4WA 4AMWA 2ZUWA 3BAYA 3EKZA 4M6PA 4UFIA 4AW7A 5BW6A 1NOFA 2YIHA 3NG3A 4MZYA 4O54A 4O13A 4UTWC 5LKYA 3N9RA 4XBKA 4CCDA 3VX1A 2FPYA 3TA6A 4XB3A 1JUEA 3BAWA 3RFAA 2ZBTA 1QW9A 3IGUA 1WZLA 1T96A 3D52A 1LRNA 2VNCA 3C2RA 3T40A 2A7RA 3W1AA 3NR0A 3FKKA 3S6DA 3TFCA 3CZGA 4OIFA 2R14A 1W0MA 2Y6ZA 2C16A 2C8NA 3P60A 1XM3A 5G2IA 2G95A 2Y85A 2NLIA 4WXYA 1B3OA 4LT9A 2R8WA 7TAAA 1G4SA 3UEQA 1CXIA 1HX0A 5AYZA 5HJLA 4YWIA 5CLTA 4LRTA 3G1YA 3NA8A 1Z48A 1H62A 3W1NA 4GUIA 4IMEA 2JKAA 1KTBA 4R34A 4H7VA 4FNQA 4U2YA 1AQHA 3HIJA 2V82A 1KXHA 1VCFA 2DJXA 3GXFA 2Y89A 3E9AA 3CEPA 3WK3A 2QCEA 3L4ZA 5HR6A 2QJHA 4G1KA 1CGUA 4JTFA 3GAYA 1TV7A 3EWUA 4GUGA 2AQWA 3GXTA 3ZR4A 1JF5A 4CQ9A 2RFGA 4AHOA 2RH9A 3OIXA 2ZXQA 4S1FA 2DIEA 1XBXA 4RLIA 2YFOA 5DBTA 2D3NA 3F1QA 3TSMA 1LLZA 2F7RA 3PB2A 4IX0A 2CLMA 3S42A 1R2RA 3UWUA 2XVGA 1NEYA 3CU2A 1B2YA 2Z0IA 3M5ZA 1LROA 2X2GA 5I3KA 2YDAA 3V1PA 1SSDA 5D2VA 1WZMA 4NX5A 2QF7A 4Z1AA 1TQSA 1VFMA 2YX0A 4HPXA 1KW1A 4X9YA 3QZEA 2FH8A 3KXQA 3KRZA 3G8EA 4NXSA 3BG5A 2F2HA 3BGGA 4LXFA 3FOKA 1Q45A 1W54A 1EP2A 3W7IA 1QO2A 4CQAA 3TR2A 1ZJAA 4HNVA 2VC6A 1TMQA 1BVZA 1A50A 5CGTA 3KRSA 4TIMA 1LCOA 1VFUA 3AXIA 3B04A 4LWWA 5D05A 3T55A 1VHCA 3KFTA 5G2WA 4JTLA 1TJPA 3OHIA 3LI0A 3OLEA 1YXDA 2EABA 1K02A 5AFDA 3BUPA 4YMZA 2PWDA 2BY1A 2ALWA 1QR7A 2QDHA 3C2VA 1GVSA 3PUDA 4PA8A 2EADA 3UPWA 5I3FA 5EBUA 2QPUA 1OYAA 3KVLA 1Z32X 2NUWA 3G3MA 1JDAA 3HGOA 1VYSX 4IJBA 2WNNA 2KZHA 3LHWA 5D2XA 1G6CA 2EGZA 4GUHA 1NSJA 3R89A 2VEIA 1JUBA 3LB0A 1F2JA 4H4IA 4FLSA 4JL1A 2ISSA 1ZALA 2RDUA 5G1TA 3EX4A 1D3HA 2GVYA 3EJTA 4O52A 3M43A 1IZKA 3SZ8A 3AMKA 4GJ1A 4NVTA 3LCIA 5AN7A 2B4GA 1RQEA 3WN6A 4NJGA 5AHEA 1GJWA 2FDSA 4FLQA 2YCEA 1O94A 3W6YA 3P82A 2HS8A 4BF9A 3WY1A 3FYOA 2CHNA 4PCTA 3CTTA 1KTCA 3FKRA 5K3VA 1GYLA 2DZPA 4Q32A 1A5CA 2AAAA 8TIMA 1I2PA 3TDFA 1OYCA 2VXNA 2WJZA 2QCHA 4UQAA 1TV8A 1NVMA 4GE8A 4JY8A 4O0KA 1V3LA 2A6LA 1NAL1 3L4YA 1IXNA 4UOZA 3GR8A 1C29A 2VRKA 3I7QA 4WLCA 4N4QA 3INPA 1GVRA 1PCWA 2ZZ3A 4JXCA 1WDWA 4IMCA 1F6KA 2FTPA 2NXIA 4GBUA 2WQPA 3UERA 5DCDA 1XH2A 3STCA 4YCPA 4GFSA 2V3DA 3GX9A 3UWQA 1P0KA 2YW3A 4JICA 2ALDA 2AMGA 3G1XA 2QMKA 3MI6A 1IF2A 2V81A 3EDKA 1EUAA 3LHTA 5BRQA 1O4UA 2QKFA 1ICSA 3ZOAA 1ME9A 3W9ZA 1JUKA 4B9ZA 2NUYA 4KWWA 1JDCA 1OABA 4GWEA 5HQEA 2QCDA 3BVXA 1M5WA 1GEQA 5KITA 1XUUA 4ORIA 5FF3A 5DELA 3LXCA 4RX0A 4FF7A 4AYSA 1QPOA 2V2CA 3ATYA 4IXXA 3HG5A 4O1DA 2CU0A 1KGWA 2BHUA 3DI0A 3RK8A 1I8JA 3MHFA 5BMXA 1RQHA 1LOSA 1WE5A 4N02A 3TUUA 4R7JA 4X0NA 4J3WA 4M8UA 4FIQA 1QI5A 1TQXA 1EB3A 4XBSA 1VHNA 3BK0A 3WENA 1W3TA 1H60A 2VOMA 2FHFA 1KFJA 2JBMA 3PSVA 3NO5A 3BAXA 2V2HA 4ZQCA 3W74A 1GZGA 1GJPA 2EO7A 3WDIA 1DHKA 1XCWA 1ZNNA 4Q33A 2YYUA 1PE1A 1MFUA 3I6RA 2EPHA 3CWNA 1JQVA 1K8YA 2DZTA 2WO5A 1OK4A 2V3FA 2WVUA 4O19A 1H7XA 1OFPA 3P8JA 1VCVA 1LLWA 2NZLA 3BH4A 3KL5A 3LRMA 3B0UX 1FCBA 1VS1A 5DN1A 1AQMA 2C3ZA 4HOZA 2ZYFA 4MZ1A 3GKAA 2JKPA 1Q3NA 4NJIA 4DO5A 4LS0A 5AHMA 3DX1A 3LTSA 1OK6A 4WQ6A 4GQQA 1S3HA 3HF3A 4UXDA 1V5XA 3BC9A 3CEUA 5TQLA 4UTTA 1QHOA 1ZAJA 4WOZA 1JGIA 4KWUA 1H7WA 1YDOA 3DFPA 4BZYA 3M44A 2ATMA 3OBKA 1MO0A 4CN4A 3EX3A 2OX1A 5FEXA 3FAWA 3LPOA 3BLKA 3HMJG 1DOSA 1O60A 3ZT7A 3IIZA 4AIEA 4WXZA 2Z1KA 3WFZA 4AWTA 3ZFHA 3K1DA 3UY7A 2GJNA 2Y88A 3LXBA 3N73A 5HPOA 4TX9A 4XZ9A 2G96A 3G8RA 1U33A 3UCQA 3SY5A 4UC5A 3NQMA 5F2LA 5LGZA 2C7FA 1SU5A 3DFOA 2YYTA 2J9XA 5K9CA 1EHAA 4IQLA 4AF0A 4EVZA 4BWLC 4DF0A 1ICPA 3V75A 2B7QA 4D2JA 3FA5A 1QI4A 3CLWA 4OV9A 1TREA 3C8FA 5DXYA 1LOQA 1TMHA 3IGXA 2CZ5A 3UY8A 3OLIA 1PZ3A 5CGMA 1QPNA 2FB3A 3FJLA 2CXGA 4JIQA 1GJUA 3NPXA 4LS2A 3MP4A 1L2UA 3EX1A 3EX6A 4AIOA 5D04C 3ZSSA 4CNPA 1XSKA 5EA9A 2GUYA 3D50A 3C2OA 1CX9A 4JTKA 5DBUA 4O15A 2H3BA 4AEOA 3WDHA 4OHQA 4IGHA 3WY2A 2VKZG 4DPQA 4HNUA 1X6UA 1OX4A 4MOZA 4N9CA 2OZ0A 1WQ5A 2CLEA 4FX7A 1XH0A 3T44A 3SECA 3W7EA 4XWUA 3N14A 1TQTA 3MI2A 3O1NA 2F84A 2IQTA 3G1SA 2E77A 3D0CA 1HTIA 4AMAA 5IBXC 3QMSA 1ZCOA 5A8GA 1VH7A 5BRPA 4IOTA 1XBZA 3GXPA 3EWZA 4DELA 1LDCA 3TCEA 3TXZA 1Q6RA 3CZEA 3TAOA 3W7PA 4CN6A 4FO4A 2PE4A 3VGBA 1QWNA 4POCA 3L2MA 4M6VA 1MW3A 3F4WA 1JRCA 3MMTA 2G97A 3QF0A 4ZVJA 4FB7A 3MHGA 3LM7A 3QMTA 3LHYA 1UD8A 2WSKA 4K6AA 3DXIA 3P80A 4BA0A 3SFKA 2F1BA 2Y5EA 4UFKA 2PURA 1FBAA 1M7PA 3IVTA 3NGJA 4RZ6A 5F4WA 3IJ9A 4FXSA 1SPQA 2F61A 3IV3A 1TV5A 3G0XA 4JDBA 2NT1A 3WJSA 4MIMA 4ZZ9A 2BHZA 4QISA 1L9WA 1CXFA 3LCFA 5D2WA 3WMSA 3IIOA 2WSYA 3BAJA 1V3KA 3IK2A 4JTEA 1F73A 1LBFA 3QQ0A 1FWWA 5D2YA 4E2OA 4LV9A 1MW2A 1KXVA 1B4EA 4J9JA 2X30A 2A4AA 1UBSA 3IJ8A 2D0HA 2X2IA 3IVSA 4BI6A 4TMCA 1DORA 3QPZA 5E6YA 1TPDA 2H8ZA 4MVAA 1Q6QA 3W37A 2QUUA 1LBMA 4A21A 4NZJA 2X1RA 4HPHA 2J25A 3C3NA 3L0NA 3NL5A 3GTNA 3C2FA 2G3NA 2O7QA 3DKJA 4K8HA 3ZT5A 2DH3A 3PG9A 3VSVA 2TRSA 1EO5A 1KXTA 4B9YA 2W0UA 3IIXA 4JYDA 1KBKA 1TTPA 1G4TA 1N8FA 1VIWA 2GOUA 1KCLA 5ABTA 1OB0A 2NX9A 1KLYA 3STFA 3TONA 1RZMA 5CKSA 3U6WA 1QX1A 2X2HA 2V5LA 1TSIA 1A5SA 1H1ZA 3QYQA 2R94A 4YL2A 2WANA 2ZX5A 4LPCA 1XV8A 3ZO9A 4X9SA 3LCHA 3G0UA 2E68A 1IGSA 4KKXA 1F6PA 4JTGA 4QITA 3TC6A 2ZRXA 4LOCA 1MXSA 1A5AA 3LERA 1AK5A 5C2XA 5BNKA 3WELA 3CWOX 1QWGA 3UZ5A 1H3GA 2E6AA 4QJ1A 2YXGA 3TSBA 3GNNA 1N7KA 1UD5A 1UB3A 4LNYA 1YDNA 3BMVA 1QOQA 3M5YA 4RZ4A 2OW6A 2X1TA 3B0PA 1VR6A 3GDMA 1V7YA 3P5YA 4J3XA 3EB2A 4HKPA 2YFNA 1UOKA 3ZR5A 2QCNA 4NX0A 1DTUA 3TROA 5CXPA 3I7RA 1G69A 4RXGA 5U4NA 1DV7A 1MFVA 3L9CA 4K38A 4E2BA 5J5DA 2RHGA 3W2LA 4HSOA 3NQ2A 5IBXA 2YJQA 2ZRUA 3I65A 4FLOA 1OFAA 1W5PA 3O07A 4ZQMA 1L6SA 3VU2A 3GXIA 5CSSA 3QQ1A 4RCXA 1GTHA 1Q6LA 2EHHA 1TTQA 3A5VA 1ZENA 1ME8A 1HUVA 3M9YA 1UCWA 1FWNA 3C61A 2OT0A 3WNPA 3G1DA 2WKGA 2C14A 3VMPA 2NV1A 2W6RA 3WEOA 1LWJA 3VNZA 1QW8A 1K03A 3O15A 4NU7A 3KOFA 2XWDA 2UV8G 4UFHA 2WVVA 3S1XA 3W1XA 2W79A 1KM6A 1CW2A 1EA0A 4ZQOA 4ML9A 2E5DA 2WKLA 1XL9A 2F7FA 2RKXA 3BLEA 3NQDA 1TPH1 3UXAA 2B7OA 3D4YA 4O53A 1DL3A 3W2JA 3W7RA 1JF6A 2V2DA 4O8RA 5A6LA 1M7OA 2FPVA 2A85A 3R8RA 1MW1A 4L4LA 1OG0A 3M07A 3MUXA 3MW7A 3WK2A 3NPUA 1RR2A 2NV2A 3QH2A 2Z6IA 4QIUA 3VGHA 3H54A 5HWMA 1TQWA 3S1WA 3UYCA 3S5NA 3KHJA 3VO0A 3W7CA 3W2KA 1VYRA 2GQ9A 3G1FA 4JFSA 3M16A 1I2QA 5AYXA 1HG3A 2BY2A 1UUOA 1HFBA 2NT0A 4Z1CA 3OG3A 2DH2A 3TTYA 3GDKA 3VGEA 5D38A 1JVNA 1JI1A 3QFEA 2FHBA 3O6YX 1NM9A 4UMCA 3RMJA 2Q8ZA 3PBUA 4A22A 2VT0A 1H7NA 5KTLA 3M6YA 1W56A 2R91A 5HNRA 3HGSA 1QO5A 2I1OA 3VNDA 2CFFA 4YXGA 4U33A 1JG9A 3M7WA 4MLJA 2QJGA 1R75A 1GPWA 4UTLA 1YXCA 4CN1A 1PHWA 4JFVA 3NDOA 1R34A 2D0FA 4JS3A 3P61A 1K8ZA 1J0JA 4TR9A 3BVWA 1TPFA 2BWGA 3HG3A 2C0AA 3DU0A 2G5WA 5G4EA 2Z1BA 2ZX7A 3A5FA 1TPB1 4HNNA 2WSPA 3WY4A 3MWAA 3NQCA 3O05A 4JTHA 1HWWA 1O5KA 2O7SA 2A2IA 1OFOA 3PC0A 7TIMA 3NZ1A 1Q6OA 4HP5A 1ONRA 2ZICA 5KZDA 4U3CA 3S2CA 1MVYA 1GT8A 2ZX8A 3EDEA 3EXTA 5K7JA 2TMDA 3BLBA 3CGTA 4MKNA 4LUJA 1RPKA 1SZGA 5K2ZA 3HO8A 1J0KA 5F2MA 4N2YA 5HWJA 4UZSA 2A5HA 4MJZA 1TJRA 3HPSA 2VFIA 4UTIA 3LCGA 5F4XA 4E2DA 2WPGA 4JYFA 1SMAA 4H8HA 1KV5A 4LVFA 1ICQA 3LX9A 2VFHA 3TNOA 3L4VA 3ZSTA 3ELFA 4GI9A 4O1AA 3LTPA 1PS3A 1FCQA 4J3TA 1IV8A 4X3ZA 1KWGA 4OJYA 1XD0A 2C13A 4DEFA 3C6CA 4HOXA 2FE0A 2HTMA 4NNAA 2V3EA 5A6MA 2ISVA 1DBTA 1DVJA 2NSXA 3VMOA 4U4MA 5H91A 4DQWA 1KB3A 1KBBA 2CPUA 1FCUA 4J3UA 4IPJA 4GI6A 3EJUA 5F7UA 1TPEA 4GIAA 2YPIA 3DENA 2ZZ5A 4UR7A 3AO0A 1JIBA 4JEQA 1AG1O 1B0IA 3P8IA 4GC4A 3W7NA 2GUUA 3G1AA 2PRMA 1VPXA 3O06A 3W7JA 3G0SA 1VB9A 1YPFA 1KFCA 1EX5A 3HJZA 2A7NA 3CZLA 1CXEA 1HL8A 2NUXA 1S46A 2Y4SA 2Y61A 4Z08A 1JDDA 4K7VA 2Q3RA 3LGEA 3C4UA 3WNNA 3MBFA 5FF0A 4ZQRA 3RU6A 1ZY9A 4H8UA 1AMYA 3L4TA 4I9AA 3L0GA 4LVBA 4NNCA 4Z0SA 4FNRA 3OVRA 1UKTA 3P84A 2OYKA 4UTWA 3WNMA 1KM5A 1J2WA 1DQWA 1Z42A 1MEHA 4K7YA 3D4ZA 4OBTA 1JD9A 3HGJA 4LC6A 2AGKA 3W2MA 1EWEA 1BWLA 2YW4A 1KGXA 3W1PA 2QCGA 5HINA 2DZSA 3KVJA 2VEPA 5E0KA 5LNUA 2FH6A 5I23A 3TOPA 2OT1A 4K39A 5L9FA 1DEDA 4JFTA 1JQXA 4UCFA 4N4PA 2Y7FA 4M7SA 2GQAA 3NXFA 4JX5A 4LY8A 1AL8A 5AHNA 3LRLA 2V8ZA 4LVGA 4PEKA 3HOJA 3BO9A 4GO9A 1UJPA 1XSIA 1UD4A 3UWVA 2VEMA 2ZQ0A 6TAAA 3M41A 3TE9A 3ECQA 3BW4A 3PR2A 1F05A 3TJXA 1YTDA 3LLFA 3W1MA 3B0VC 2ZWYA 4KMQA 3W2UA 2Y24A 2ZDRA 4FXRA 3PF3A 3W23A 4J7RA 2NWRA 1VAHA 1GOXA 2EKCA 2BXYA 2B7PA 2QUVA 4UOQA 3E0IA 1VC4A 3HB9A 4KFOA 3O6CA 5F4SA 2EAEA 2Y7DA 4O10A 4R33A 4AAJA 4PL2A 1OFEA 1D3GA 2ZRYA 5E93A 3OA3A 5CSRA 3EX2A 3DZ1A 1W3NA 1P1XA 2ZX9A 1XDMA 1GCYA 2CLOA 2Z2UA 3S0CA 5E1QA 3B8DA 3QSTA 3JRKA 5CZTA 2BXVA 3QW4B 5G5IA 3H55A 4ZQNA 5C5YA 3ZR6A 3FLUA 2A6NA 1KFKA 4LU0A 1QCWA 2CLFA 3CLMA 3TK7A 4A2RA 4DBDA 2GVGA 1U30A 2J9ZA 2ZUVA 3NZRA 1CDGA 3BVUA 4EF8A 4WY0A 3W7GA 2P1FA 5K9XA 5A2CA 1SO5A 3STGA 3PB0A 1JULA 1CGTA 1UH3A 2VENA 3A9IA 3GR7A 5F1VA 5LNWA 4QAWA 2VELA 4J27A 3SSJA 3B05A 2PCQA 4YLWA 5HULA 1J0IA 5LSMA 3C56A 3GXMA 3UG3A 3R2GA 5DY3A 3W1LA 1HNYA 2Y7EA 3GKFA 1U5JA 3N34A 4MAZA 3FFSA 2ZE0A 5H2ZA 4YCOA 1WZKA 2DORA 1I2NA 1RP9A 2A7PA 3FAXA 1CI1A 2B0MA 2DP3A 4OU1A 1G9HA 1WX0A 4QQ3A 3T7VA 1VRDA 3WJXA 1LRTA 1H7PA 3QM3A 1R2SA 3PBWA 3S5OA 3KWXA 1PIGA 1I2RA 2WVTA 3DX0A 4O12A 5CGQA 2BSLA 3GIYA 1M6JA 1WYIA 4GUFA 1SR9A 1S5TA 1YTEA 4WX2A 2E0PA 1J0HA 4I7UA 1THFD 2C18A 3WFAA 2ZZ7A 4MPQA 5I5RA 1QI3A 2ZZ1A 2F18A 4AWUA 3NQVA 3OVQA 3Q2DA 1OT2A 1S5VA 3R13A 2GJLA 3LTYA 4TO8A 1EP1A 1YYAA 4JNMA 1UH4A 5AC7A 1FWTA 3BLPX 4U31A 1MZHA 5I24A 2YA1A 1FX6A 2XN2A 1FXPA 2TSYA 3I68A 4H2CA 1JRBA 1SFJA 1VQTA 1H5YA 2QDGA 4L4MA 5G4WA 1QPQA 3FEMA 3W1QA 3NQFA 2QJIA 4M7TA 1OT1A 1QHPA 3L66A 4MYXA 1JAEA 4C1KA 1IZJA 1K7XA 4PODA 5SWUA 1W9XA 2CLHA 1RP8A 1BKSA 1XC4A 2X1UA 2Q8LA 3TH6A 2C19A 2D3LA 3A22A 3GXDA 1DJQA 5EYWA 4WZHA 3UD6A 2QAPA 3F4NA 2ATSA 5KZMA 3U8GA 1W31A 3SIZA 1YDVA 2QCDB 3BLFA 4I7VA 3EXRA 3PS7A 1KM2A 1AVAA 2WSQA 3OLDA 4Z1DA 4PCSA 3BPWA 2ZXBA 4JCLA 1AW5A 2BZNA 5EL1A 5E70A 1FWSA 3MYPA 2PWGA 1EWDA 3PUOA 5E0FA 4UNIA 5C6MA 2BX7A 3L4XA 3NQEA 1ZAIA 3TU9A 1IXPA 4XKYA 4WY0B 2E6FA 1HO4A 3BVTA 3DDGA 4BK9A 3UWWA 1CXLA 4WUIA 4EWND 1JR1A 4HA1A 3UNDA 3NQAA 3THQA 5BRBA 4AHPA 3ZWSA 5EMUA 1C9DA 4UTKA 3IEBA 4UTUA 1MXDA 3VFLA 3O16A 4UFJA 1CGWA 2VRQA 5KZEA 2CW6A 3TMQA 4AYGA 1O5XA 4MY9A 4JYEA 3VSUA 3NYZA 5I3JA 3MJYA 4IXHA 4QNWA 2I14A 4UCGA 3PY2A 3KVKA 2E8ZA 1WAUA 1F7BA 2CLLA 2XN0A 2J9YA 5LGXA 1H51A 4NUWA 2VFEA 5HUOA 3W72A 1SZFA 1TQUA 1XCFA 2X16A 4PEEA 2QUTA 4AEEA 4BR1A 4RJEA 1Y0EA 1T0OA 4GKLA 1HVXA 1QAPA 3W22A 4MFDA 3N2XA 4E38A 4ADTA 4MFEA 3EKLA 4GI8A 1HXKA 1R33A 3W38A 2YZRA 1KWKA 4NXKA 2FYVA 3THAA 3PM6A 4OGZA 3OEXA 3L2IA 3R5EA 1SO4A 3BMWA 3TQVA 1AMKA 3JS3A 1XD1A 3DFTA 3PG8A 5CPOA 1B9BA 1YLVA 3CQ0A 4UIOA 5AHIA 2YSWA 3EEGA 2PRHA 3TAKA 3MBDA 3S5ZA 3W7MA 1A53A 1XUZA 3L0KA 3PUEA 4WSKA 4WSJA 4H6KA 4AWSA 1F76A 1SW0A 4M6QA 1OFRA 2JGQA 3CZSA 3H53A 4JIPA 2DIJA 2QCFA 3TW6A 2EACA 6CGTA 3DAQA 1F5ZA 4UMBA 3E49A 2F7QA 3LRKA 1I4NA 1OYBA 3KAOA 3WDJA 5D2TA 4AF0B 2ZXAA 2OMAA 1QDSA 3GNDA 1LTDA 2OSYA 2FB2A 4EOUA 1AL7A 5CZ0A 2QPSA 1G67A 1O95A 4UFLA 3CM4A 3QPYA 4ALDA 1GWJA 4LVDA 3HBLA 1GG0A 3LLDA 4BWLA 1WP6A 3FW6A 3VSTA 1SO6A 3I7SA 1IIHA 3VGDA 3MP3A 2V5BA 4LQ1A 1J5TA 4MB1A 1EPXA 1NFBA 4UNLA 2E9BA 1K8XA 1EO7A 5AC6A 1G4PA 1YTKA 3W87A 1KBIA 3K8MA 1OX4B 1HTYA 3P5ZA 4N6EA 4RZ5A 3A47A 1SFLA 1XCXA 5L6UA 2J6XA 3RLUA 2JK2A 3NL3A 4Y90A 3KEHA 3UZJA 4GRSA 1MXGA 3S8HA 2QCMA 5CPNA 1R2TA 1TPWA 3LCXA 4UTMA 3DX3A 3CHVA 3NVTA 4H8VA 5I3HA 4PTNA 2FJKA 3VX0A 4JFWA 1XBVA 1PAMA 2NX3A 2ZZ4A 2F7PA 1VJIA 2XFWA 3TQ0A 3HPZA 2XIBA 4N9BA 1KGUA 5LNSA 1A47A 1OFQA 1X8FA 1L0PA 4GINA 1SW3A 3UG5A 4UQDA 1K3UA 1LORA 4UNKA 1W37A 4AEFA 1UD2A 2RDWA 3HG4A 2ZA1A 1LWHA 4QAIA 4JDYA 3L67A 1TCMA 4PH6A 1FXQA 2OJPA 4IUOA 3ZS4A 2P10A 1F74A 1W5OA 1UA7A 4QNEA 1P6WA 5EY5A 3CPUA 1UD6A 1PV8A 3IRDA 3W7OA 5E9AA 1KXQA 1C8QA 2DJLA 3GDLA 4LRSA 5A2BA 1EA9C 3WEMA 1W8SA 3W07A 5I0DA 4CGTA 2Y70A 4XQ6A 4LUIA 1PL9A 4GNJA 2ZZ2A 1GG1A 3UPBA 5C54A 1G7UA 3QGVA 5HXMA 1W1ZA 3CZKA 5TIMA 3RF9A 2ZFAA 3LBCA 1KM3A 3JR2A 4A3UA 4CCCA 4QSHA 3WY3A 1TTJA 1BLIA 3BCFA 4XTDA 3M47A 4IMFA 3DFSA 1JFHA 1S5WA 5G1YA 4JTTA 5FI8A 1GYNA 3VGFA 2HMCA
chains in the Genus database with same CATH superfamily
3I9GL 5I1GH 5JZ7D 1QFPA 3SE9L 1BVOA 5K9JL 3L4UA 1QWKA 1XQKA 4FZ8H 1ZCCA 3L5AA 4HCRA 2VW4A 4HKBB 1M7XA 2FJSA 3AT0A 3PL6B 4LAQH 3TYFB 3F7LA 1W5NA 2IXQA 4DBEA 5H37G 1M2VB 1P5BA 4LSUH 4UWQB 5D7IE 3QTPA 1Z44A 1VCGA 1ONQA 3GSOB 2GEEA 2YAMA 3P11L 3ZE0B 1WKFA 3SJ3A 3PY9A 3K30A 4PMQA 1R5IB 3CX5J 3WO4C 4HZ6A 3RM9A 6XIMA 7ODCA 3HR5A 3BUBA 3TJHD 2TPSA 5KVEH 4KV5E 4E41E 1CQYA 2W61A 4WIQA 3HS0B 2B7NA 1FCGA 3P0WA 2EXYC 2VEKA 1E8XA 3MGAA 4HN8A 4PCYA 1QMUA 5AHLA 4Y89A 3UZEC 3CXOA 1F0LA 2YGYA 1RCOB 5FM5M 3UTPE 3PP3H 1E4MM 1R17A 3L1EA 1UIPA 3ETSA 3RR1A 4XPTL 2X7WA 1OM3H 4Q4RA 2O56A 4QE1A 3L9RA 1H8SA 1ITXA 1A3LH 3QHMA 5F2IA 3N2BA 1IGYB 4MHHI 1ML1A 2PDYA 4X6BA 4R2GB 4IHOA 3VIMA 2NR6C 4KZCA 2N7SA 1MFAH 5CEXB 4QRPE 3GSNL 3KLLA 1WZAA 4ZO8A 3NN8A 1H8LA 2W95A 4XNXH 1IC4L 3FKUS 5JUEL 1DQQA 1XXXA 5J6HB 1KQZA 3PBGA 3WS3A 1UKQA 3B7RL 3E3QE 1YNLL 4H19A 2IWEA 4A2DA 1OM0A 1Q4NX 3YPIA 3B5TA 4E0CA 1E9QA 2VAAB 4XNYL 2FUTA 1CD9B 2VEGA 3HPLB 3RTQD 1M01A 3VYPA 3HJEA 1A0QL 3IMSA 5FUCC 1ETZA 4PJEA 1OW0A 4OI7A 1BF2A 4PBXA 5DJXA 4NNYA 3U5UA 3TPUA 4D0CB 2CLVA 2GEQA 1PZBA 4P99A 5AYIA 1PKMA 3SBRA 4ZAKD 4L8SB 3EJPA 4LSVL 4H5SB 3MOBH 1O9WA 4WNQA 4NL1A 3EJCA 1R3IH 4F37K 3O6FC 3KVPA 1W0VA 2X2JA 5LN8A 3GXNA 5FO2A 1WFOA 3LQMA 4N42A 1QNQA 2TAAA 5KTEH 1XFBA 2X4QA 3KPMB 1N55A 8A3HA 1W5MA 1KENL 3UPRB 2IPJA 4XO8A 3N4AA 3TCXA 5J1AB 2ANUA 4Z7QE 1CLOL 2DT1A 1EJSC 4MY1A 1GQJA 4R0LB 5G2HA 2QKIC 5DRZA 2PA6A 5BW7A 2GITA 3L3HB 1EUNA 3MCLH 3B2PA 4A38A 5DQ9A 1Q9KB 2ZWKA 2UV3A 4N2MA 3T3MF 2ICWB 3L17A 1POKA 3WH6A 3D4GA 3E96A 3LV5A 4FQJL 3AIUA 1LBLA 3VE9A 4W5ZA 3GSNA 1FV1B 4GBDA 2BVUA 4O17A 5IRPA 2DVTA 1N5YL 1MCFA 4JQ3A 4ZENA 3GO2A 5CP7A 4OB5L 3SQSA 2VL5A 3RUGE 4IKIA 5LDSA 2YCIX 2QF8A 3QMRA 1EAQA 5CBAB 4W9JC 2R1LA 2A77L 4IU2B 4URKA 3QWNA 4H9YA 3TIDB 2HZGA 6ENLA 4LCWE 2P80D 4A3RA 3I6GA 3RG1C 3II1A 5FF7A 4GI4A 4JR5A 1P4BH 2EG7A 1J8HB 3U7AA 3DIFB 1C8PA 3NSJA 3EYUH 5D09A 1J4EA 4HLJA 5IB1A 4PUMA 1ITBB 1N6VA 5IVOA 3AZRA 3VRIB 1H61A 4YJ5A 4HALA 2IXUA 3HBGA 1NGYB 3FT9A 1A5NC 2YKKA 3BZEB 2X1SA 4PGBA 1B3JA 5K69A 4BI5A 1DSFH 2CKBB 3QK0A 2BP0B 5C0DA 4B15A 1UOWA 3C09B 1TZ9A 4PJBB 2Y3NA 3O4LB 3PREA 1JVOA 3MACH 2MNJB 4F3FB 1V7ML 3GF8A 5F1UA 5IHLB 2ZXGA 1G7QA 3IKKA 1A9EA 5U7SA 4KJQD 2A21A 2Y6TE 3ROLA 1FZMB 5ESVB 1VBGA 4MA1B 1FVCB 3KZ8A 2R7EA 4J12A 3CDGA 4XBEL 1UR1A 1RURH 1NBZB 2GOKA 4K36A 4R53A 3QAZB 1E51A 4LLVB 4JR9H 3L7FA 5CJQH 5HDQH 4YIQA 4NQDE 2XWTB 2Y69B 2D7TH 4GPVA 3D39B 5JPMC 1FKWA 2P52A 4KGJA 3NQ7A 3OXSA 3AADB 3V0WH 5EF2A 4HIQA 4AYFB 2IKGA 1T1ZA 3AMLA 4QTFA 4P5RA 4TVDA 1I75A 2VWEC 1E0VA 4PLNC 5FF6A 5CG0A 1GZHC 1XF2B 5IQ9A 1E6QM 2BIQA 3M0MA 4L9LA 1V3JA 2ABBA 4TTDC 1HHJA 3LHPH 2IW0A 2Q9OA 1XG3A 1AW2A 1FWHC 4HKXA 3BW9A 9RUBA 4MDJA 3WBEA 5C0BD 3TJPA 1T2QL 4F2UA 3I3BA 5AW7B 1YYLH 3RFAA 3D52A 1LRNA 2VNCA 4LSPH 1DLFL 3S6DA 5JPNA 4ZMYA 4PJ7A 1XM3A 4BZ1L 4RAVA 2VJXA 4LLUA 1AZ2A 1FFRA 4ZSTA 5KS9E 1KY7A 3W1NA 1CU4H 2YJLA 2OX5A 3H2MA 3GAYA 1BZDA 4G8EA 3MROA 1XC6A 3GO1H 3MO1A 4MFHA 2XIDA 2V5MA 4L4PA 3FN3A 2Y22A 3FN9A 3UJ2A 5B1JA 2VXUH 1R2RA 1TITA 3SUTA 1RJLB 5I3KA 1BJ8A 1PCSA 4GRLA 4UIKL 1I1WA 3KXQA 3CUJA 2AK4D 4XVJH 1EDHA 3DO4A 5HHMD 5FYJL 5HYJD 3FH7A 4LWWA 5D05A 4PJDF 1GTFA 3OR6A 3QJOA 3W5NA 4JQXC 3W57A 2GVEA 2QVFB 1JJUA 2OJ1A 4EI5B 4NFBA 2EADA 4XNBA 5GGRB 5FV2A 3RJQB 2WW8A 1G6CA 1E2ZA 2VDPH 1UYWH 1F2JA 1BLNB 2BSTB 3QQDB 2XKSA 2Y1VA 4NRXB 4NC2B 3P4OB 4LSTH 1IGJB 3IN2A 2FDSA 3P82A 4FAMA 3BSZH 2GJ6B 5B8CA 4ZMNA 3UJRA 1X6LA 3C8NA 4QR7A 2R6OA 3D0VA 3QZPA 4NAEA 1F3DJ 4IT1A 3S98A 3WGVB 3DTXA 3PPHA 4DJDC 5D6DC 4B5TA 1NFIB 4H6QA 4GBUA 4P2OA 1JZJA 5SWQB 1HZYA 4BK5A 3PDOA 3WHXB 3A6CL 2CK2A 1Z2KA 2F54D 3RYMA 1ICSA 3W9ZA 4BZ1A 1AHWC 3BTNA 1MMFA 3BVXA 5GS0D 4ORIA 4YHGA 1F61A 5DHEA 2WXQA 1IGTB 3HG5A 4P8WA 4Y9FA 1V93A 1ASQA 3SCMC 3VCCA 3S37L 4JDVB 5T1DH 1QI5A 1P0SE 4OCMC 4ZT1A 3B3IB 2UVEA 3ULUH 1XISA 4QOKA 2XZQH 4ZQCA 2VXSL 1GZGA 4M8RA 5BRZB 3DTDA 1C92A 2QR0B 3CVHH 3QIUA 1I3RA 3EXJA 2NQ3A 1ZEAH 1VFAB 2EDOA 3LRMA 2QADC 4JMXA 5H2BA 5L4MA 4KEUA 4DO5A 2H6OA 2EC8A 1V5XA 4RGNE 2QSVA 1MJJB 1H7WA 1YDOA 2NUTB 2OZNA 4PBDA 3VFCA 3N6YA 4AWTA 2IDCA 4PB0H 3TESA 2GSGA 5F2LA 5DJYA 2B39A 1EHAA 4A6YA 4G8GB 4LAOA 3OHMB 3N1AA 4GG9A 1JRHI 4IFRA 5DXYA 3IGXA 2YUXA 2VDOH 5IR1A 4G2AA 4LY4A 4JIQA 3KR3L 3EX6A 2JJTA 5FFLA 1RAMA 5EH1A 3QUXB 1LO3L 5DBUA 3ZDYE 3VFSB 1UP2A 5AZ1A 3P0GB 5EIQA 2FWLB 4HCHA 3VXME 3W7EA 2OI9C 2IQTA 3G1SA 12E8L 5J13B 2BHFA 3WJLC 1ZCOA 3KZPA 3L45A 3EWZA 1XR9A 3CZEA 1COBA 1EJFA 1QWNA 4LVNC 2O9OA 2BVYA 1UZ8B 5HNTA 4PWKA 3W0WE 2Z7GA 4PJ6A 4V11A 4WDIB 5EU6B 5TH2B 3NGJA 3LVTA 4M7KH 3T2NL 3W28A 4DF9A 4J5NA 4F15B 1BQSA 4EDXA 2WCAA 4X60A 1Q6EA 5I6KA 4GC3A 4LT7A 3TN6A 5EUOB 3ZJAA 5FFOA 4XZHA 3ZXWA 1OO2A 1JCVA 1V3KA 4WW2F 4PJFB 4JO3L 3QDMD 4ZYKA 1PFOA 3GBML 1MFCH 4XD3A 4F58L 5DYOA 1XGRB 2H8ZA 3KS5A 3PZNA 2X1RA 1QU4A 3IN0A 3DXAE 2G3FA 4ILSA 3LSBA 4HKBA 1S9XB 3IIXA 3FL7A 2EKJA 3PL6A 3B5HA 3TYFA 1KCLA 1XZWA 3KTSA 4HJTA 3VB9A 4OLEA 1M2VA 1WA1X 2V5LA 2BP1A 1XV8A 3ZO9A 5I6PA 4KHTL 4PP1C 5SWSE 5I19L 1R5WA 5BNKA 3CWOX 1FKXA 3GSOA 2X70B 1UD5A 2G0LA 1R5IA 3EOYG 4J3XA 2BNRE 1GXEA 5GS2H 5T5FH 4FEMA 4JM2F 1G7JB 4HSOA 3WIJA 3NQ2A 1T8QA 3N3TA 3QQ1A 5E0QA 3BRDA 2AJYH 1J10A 1MIEL 3HUJF 4FA7B 4BFRA 3BZJA 3UP6A 2QVTA 4UFHA 4GYPC 2G8ZA 2VLJB 3ZJ7A 4DRSA 5HD8D 3BAEH 4OUIA 3W2JA 3S88H 3AYRA 1XGUB 2MRYA 4LK4A 2A85A 4GAJH 1F4HA 1WA0X 2V5JA 3VZZA 2NCEA 3AUVA 1W91A 4IIHA 4PY8I 3VGHA 5CZVL 3TNBA 2GTZB 3HRZC 4X4KA 3B1TA 3IRPX 2GQ9A 2WTRB 2GJXB 1HZHL 3QI9C 1UUOA 1HH6B 4OUUB 3LEPA 2A9ML 1XF1A 1IGYA 1KCZA 4IICA 2Q8ZA 3RM8A 3M6YA 2R91A 2PI6A 3VE0A 4DWSC 4GIEA 4UTLA 4NJ9H 4P8XA 4TR9A 5J6HA 3TZVC 1TPB1 5CGBA 3F2CA 4PJ9B 4IGNA 4M00A 1TZGL 4HP5A 3MUAA 4GCXA 2ZP0T 3PWPB 1VGEH 2QFRA 3EDEA 2YL8A 4F0KA 2E6JA 3ARBD 2Y9RT 1Y5WA 5F2MA 3KDOA 1F3TA 3MZTA 2A5HA 2VAAA 4WSHA 2CJTA 4HWBH 2VAJA 4JPVL 2PU0A 3OOQA 3GKWL 1UWSA 2OLHA 4EZMA 3APMA 3ARYA 2ZPKH 1KRCC 3VMOA 5E9NA 2OU4A 3SDCD 2ZCHH 4J3UA 5EUKB 4AQEA 1YG9A 4D0CA 1OEPA 2XN9B 2ZZ5A 4NASA 4L23A 4ZOBA 4GC4A 4XVEA 4XOAA 1W1B1 4L8SA 5CD5D 4WRHA 3E2SA 5ID0B 2Y4SA 3TO2B 1IAKB 4WKHA 1E6OH 3DRTB 1E90A 2CKBL 1BQHB 4Z0SA 4TRPH 1DQWA 1MFNA 5D96B 3B43A 1YDYA 2ZCLL 3KPMA 3CUPA 3UPRA 2DLIA 2GCYB 4X0VA 2WSDA 2BNQE 1NELA 3NXFA 1DPMA 4R0LA 4TVPE 3L3HA 5AKVA 3MOAL 4R6UA 4GG8B 4GGBA 3W1MA 1HHKB 2IC2A 4MXVF 1XEUA 1Q9KA 2ZDRA 3PF3A 3W23A 4A2GA 1IFGA 2EKCA 4MD5B 1F4XH 3CVDA 3COOA 3T0VA 1FV1A 2Z1WA 4FQHB 2QPDB 2UXVA 1RQ5A 1ISZA 3APCA 2UYLB 3BQVA 3BZDA 3UGVA 3FO0H 1VBUA 1U3HB 4P5TC 1CURA 5A2CA 1XIDA 3K71B 3OB0K 5ABFB 5CBAA 3LH8A 5LSMA 4PUUA 4IU2A 2IVFC 3UZQB 1YPZB 3K74B 3TIDA 15C8L 4MAZA 4PUEA 5H2ZA 4YCOA 1ZLSL 3O0FA 3CU1A 3G77A 3CN2A 3EFFB 4QQ3A 1S38A 1J8HA 3DIFA 4M7LT 4X50A 4K9EH 1MSPA 1OE1A 3TPKA 4GUFA 1YTEA 2VLKB 4MPQA 2Q01A 3D3VE 2ZZ1A 1OT2A 2IOIA 3DX8B 3VRIA 1AS6A 2OBGA 4L0YA 4NPKA 3IWPA 1NGYA 3BZEA 4Z77A 2VR6A 1VQTA 1CUOA 1B0GB 3EA3A 4K55A 2CKBA 2BP0A 3QDGD 4OH2A 4ODSL 4B5UA 4GACA 3CFMA 5INDB 3GXDA 3M4HA 4MTVA 2YPVL 2D7NA 4EDWL 1J8KA 4F3FA 2BVTA 4JUTA 2BZNA 5E0FA 5C6MA 4N7QA 5E1IA 1U9KA 4PW9A 1PBYA 1FZMA 5ESVA 4G71B 1FVCA 3KEDA 2XFGB 1KCRL 4YMPA 3SAZA 4S3GA 1RVFL 2N0KA 4LOUD 3KLDA 3B2UD 1CDIA 4LLVA 3VSUA 4JJHA 2XWTA 5LGXA 3C8KB 1SFTA 4DJFC 3D39A 4RNIA 2GIMA 2XNAB 4U1KB 4KXZH 4K8RH 3CK5A 4AYFA 3WS6C 1B31A 3DFTA 5E8EB 3VXSB 4NIYE 1XF2A 4Y1AE 2RGMA 4NQCE 3IAGC 3UESA 1KY6A 1US0A 3G5ZB 4RFOH 1R19A 1MFDH 4IKLA 1OYBA 3GSQB 1HKLH 2Y36L 1O95A 4KQ3L 1YEGL 3MTXA 4WW2C 1WP6A 4YTUA 1IO4C 1TENA 2Z31D 5CPSA 5T3XL 3MV01 4JFDA 1N6QL 1P7QD 2AJSL 5E2WL 3A47A 3MLTB 5C7XL 4Z7WE 1V27A 3CAVA 4UDUB 2ZF8A 1KBGH 4HNOA 3SUSA 2ZCKH 1AP2A 3BOVA 4NN7B 4UNKA 2YPVA 1XFPA 3K7UA 5CJOL 3P77B 1G0YR 3PE9A 4M5TA 1P6WA 5DFVD 1UD6A 2CO2A 2Q8AH 2Y70A 1RJLA 1E4WL 4LVOB 4CC0A 5DZ9A 1ZP4A 4JM2C 4CCCA 2FBOJ 2P3ZA 4KK8C 3DNKA 3SQMA 3MLVH 4LE8A 4KS0A 4JTTA 3UTTE 3N25A 1N2VA 2INZA 1R4XA 4ONHB 1N68A 5LQBL 3T08A 3T77B 4FXTA 4NQVB 3NIDB 2PDQA 1WO2A 2J5LB 4IMKA 5EOCJ 5FEPA 4EI5A 2DQEH 4RBPH 4PCFA 4JFXB 3U9WA 4KVCH 25C8H 5GGRA 3JTSB 3GM0A 1SGJA 4HHPA 3CZFB 1TF4A 1E0TA 3FA3A 4NRXA 5TGBB 4CVWA 3P4OA 5B7YA 3O3RA 3QPQC 4K3EH 1E5AA 2O30A 3JTTB 3MA9L 2PGFA 3N19B 4X22A 3OSKA 2YGQA 2GJ6A 1II4E 2WQXA 2HLFD 1KGIA 5FW7A 2R9HD 5DQDH 2X3BA 1TZOA 2XRAL 2TSAA 2SEBB 3HV8A 4WY0F 1EBPA 4K15A 3BLIA 3RTLA 3Q05A 1NFIA 2Z6FA 3U0PB 2P0OA 4C6CA 5LNEA 2LU4A 5SWQA 3N1MC 4BH8B 3EDDA 1U8LB 3WHXA 1VFSA 1C1EH 2W67A 2HJPA 2IWFA 3GMMB 3EZJB 4FP8H 2C6QA 2YEZB 2QZ5A 5BU6A 4K37A 4DN3H 1IGTA 2VR8A 2XV3A 3FCSB 1OTSD 2D0GA 4UR8A 1D7BA 2X10A 1J5CA 1JEZA 4N9EA 4JDVA 4P2RB 4OGQC 2O61B 4NZ3A 4AB4A 4K94L 1WITA 3B3IA 4GSDL 5AOMA 3NJGA 5AENA 5FEBA 4O50A 2J88H 5BRZA 2QR0A 1KCWA 4JHZA 3QLLA 3ES8A 1Z3NA 1EMTL 5E9DD 2HB0A 1VFAA 3T0BA 3C5ZB 4CEXC 4NDMB 3KVDD 3V6ZB 4ZQTA 3QW3A 1ADWA 1BEUA 3AWEA 3RDTC 3LN3A 4L4OA 4A29A 1WAWA 2IGLA 2NUTA 2B14A 3W1RA 5IHZA 4MNQE 1WIOA 1IAIL 1I8IB 4GBXC 1XB8A 3EYOB 3P30H 2ZC1A 4G8GA 3APTA 5E2UH 5FWRA 2YD8A 2IBZY 1WYJA 4YXKL 4FI7A 4I3SH 4NWUL 4M5ZH 2YA0A 3QUXA 2NNAB 4IIQC 4P9ML 1BECA 4GP8B 4BCEA 4CLMA 4CDHA 2BIPA 5I6LA 1TO5A 2DIAA 4R9OA 3IIVA 1UBPC 5F0LB 3UJIH 4QNPE 3IVUA 2GY5A 4ZX5A 3WG7B 5IFPA 4BHUI 4M29A 1LVEA 1DE6A 4P9HH 1WA3A 1I8LA 2W81C 1UZ8A 1HKIA 1WUEA 2WUCL 4L1BA 1OV8A 2B9BA 4GD0A 3BDYH 4UQ2A 5HMSA 3AG3B 1NPNA 4WDIA 5EU6A 5TH2A 4J2MA 1G94A 3CFUA 5A6JA 1OF0A 4MQ7B 2Y06L 1KXQE 4TU1A 4V15A 5EUOA 1Z9NA 1BVWA 4L18A 4ACTA 1GTEA 1KTNA 4POZD 2HVBA 4LUYA 2PDWA 2EDMA 1U42A 1L7IH 2CZEA 5HI3C 3GZAA 2HS6A 1JXJA 2W0KA 2FPTA 1WAAE 4KKCC 5CCZA 4J3VA 5DJXB 1A80A 3RR4A 3MDJA 1S9XA 3DHMA 1ETJA 1JHLL 2CLKA 2X28A 5B22A 2J8UF 1CF8H 4M43L 2FX8H 3IRCA 3SKOB 3ZRSA 1N9PA 1BZOA 3SZ6A 4DVRH 2X70A 3WJZA 4KRPD 1Q6FA 4WHCA 5RUBA 1CGVA 3C0LA 4BQ4A 4MA7L 2VRAA 3DOIA 1G7JA 3NYKA 4C6PA 3BUTA 5IWLC 3RL2B 3CHQA 4MWAC 4FG4A 4US5A 1SSGA 2A9CA 5HUPA 4LEXL 5I3IA 1SMDA 4URTB 1H63A 5KETA 3SKUD 1UC6A 1XGUA 4YQXH 4RMUA 3LY6A 4LYQA 1BFVH 1ZVSB 5FWQA 2GPTA 5KSVB 4OV5B 1A7QH 5K9QG 2VXTL 1OPGH 1JZFA 4MS8D 4OFDA 1MI5D 1V8EA 2GTZA 4NKQB 1K3IA 4JFUA 2F74B 2WTRA 3TWAA 2GJXA 3KH3A 3QJAA 1HH6A 4OUUA 3N40P 4OY9A 1ALDA 4NPYA 4PMRA 4WJ8A 2AVFA 4Z7AA 5J11C 3N41B 3S1GA 4W9GC 1UA6L 4KO7A 3I6GB 5I0XA 1UWEL 1TWIA 4PJ9A 3VACA 3R6IA 1JPIA 5IHBA 4ZMVA 2IH3A 1TYGA 4PAZA 4F57L 4AZUA 2CPCA 5BMFL 4Y7MA 1ZGLB 1I3VA 1L8PA 4MVBD 3QZOA 1J01A 2O6FA 5FO7B 3QIWD 3POHA 3KLKA 4YSEA 5JIPA 1B57A 4Z0JA 1DQKA 1ORQB 1DJHA 4ZBCA 1W5QA 3DG6A 4DJEC 1IAIM 3F6JA 2XN9A 1CR9L 2HJFB 1QNZL 5HI5D 4KRTA 1FAIL 1N10A 2XG5A 4UFIA 5ID0A 4LNRB 3TO2A 1IAKA 1C08B 2FPYA 3DRTA 1F58H 4M61B 4KHXL 1TMCB 2DM3A 1BQHA 1B6UA 4FA3A 3V55A 5I30H 1A9EB 4UT9L 1JZHA 3VTAA 2NLIA 3ZE2B 3NFSL 4LT9A 2R8WA 1HX0A 1SEQL 1IKNA 4G7SB 2ZJSL 1F8IA 1KCSL 3WLTA 3H0TB 3GXFA 1YQVH 5GSVB 2K1MA 1MPAH 3LMJL 1MFEH 4GG8A 2AXJA 2YFOA 5L88L 2CKSA 4MD5A 1NAMB 2NNRA 2XVGA 3A67H 2WHVA 1CBVH 4Z1AA 4HPXA 2OQLA 1BQHG 1INDL 1ZK9A 3RJDA 3FOKA 4YYFA 2WO2B 2UYLA 1A50A 4TIMA 3RX3A 1AR1D 5KW9H 5IROA 4ZNCD 5BO0D 1U3HA 3O0KA 4B96A 3K71A 3CV7A 3H3PH 4XTRD 5AFDA 1YEEL 1QKZH 5ABFA 2ALWA 5I3FA 1Z32X 2H2SC 3CD4A 5D2XA 3UZQA 1O7AA 1NSJA 1YPZA 4KNUA 2FQDA 1FP8A 4FLSA 2IADB 2O5NA 4PJ7B 4AC7C 4MNKA 4U6VL 3R0MA 4KI1A 4YSAA 3HPFA 1OYCA 4R26L 4JY8A 3DX8A 3D8MA 4ACZA 2XWXA 1ZBVA 1GVRA 2I16A 2FNWA 2FTPA 3EOTL 2QGYA 1B0GA 1Q0EA 4YCPA 3SCTA 3ATBA 2YW3A 5A6KA 2QQ6A 2Z8VC 1I1AB 3LHTA 3VIFA 4ERIA 5INDA 4WJXA 3RWGA 2YQ2A 5I6OA 5T8IA 1EFXD 1Y1DA 4YR6B 3LXCA 4N24A 1MRDL 2BK8A 4A68A 4QJ5B 2IPKB 5FGBC 1GW1A 2DQWA 1BJ1H 3BPOB 4Y4KD 1EB3A 1VHNA 4TSCH 1NDYA 2FHFA 2H0JA 3NTCH 2V2HA 5AVRB 1RLWA 1FZKA 5BXRA 1XR8B 1GH7A 2VTFA 2Z91B 3UAJC 3C8KA 1M65A 3MWCA 5DD0L 1NZRA 4LEBA 2XNAA 4UBDD 1NMAH 3UBXB 2OEMA 2PD9A 2OZ3A 3U5YA 2E9IA 5E8EA 3VXSA 1X5JA 3F4VA 4CN4A 4FOUA 1OAZL 3CUXA 2IH8A 1IEIA 2FAUA 1X5IA 1H8NA 4P2OB 3G5ZA 6PTDA 1CLKA 4LH8A 4DF0A 3D3FA 3C8FA 1G43A 4AIOA 5D04C 1WGOA 5D2LF 3C2OA 3RG6A 3OPZL 5GJSL 1JERA 4IGHA 3B2VL 5F3BB 4DPQA 1XLJA 3MLTA 4W86A 4UDUA 1A5LC 3HMXL 2VM3A 2BSBA 3CU7A 1A5FH 3V4VH 1QI2A 4TLSA 2O5XH 5AKQA 1JTPA 2VDRL 4PS8A 3PFMA 2CBPA 4BFKA 2Y0SA 3LZ5A 3P77A 5H2BB 3KPPB 4F5CA 4DGYL 1RK7A 1YUKB 3OAUH 2F61A 1P4UA 3TASA 2B1HL 3CK0L 3LCFA 3OMAB 1RHFA 4AIUA 3NABH 1UZ4A 1OSZA 2DDXA 3V0VA 1KXVA 4BE5A 4BI6A 4WFGD 4PB3A 5GZNC 4ONHA 2X05A 1M3JA 2XG9A 1YEIL 1FHNA 3DKJA 1KYFA 1CT5A 2FSDA 1GGBH 2W0UA 3T77A 4NQVA 3GW3A 1G4TA 1VIWA 3MLRH 4FFWC 1MKFA 3PWNB 3F58H 5IR1B 4JFXA 1A5SA 3U30C 3H70A 3JTSA 4EN3C 5D9OA 5I75B 2OTPA 2WYZA 3T71A 4R5EA 1H3GA 3GH7A 3TSBA 2R1KA 2G5BB 1N7KA 2CNZA 1YDNA 3T2QA 1QP1A 1HE8A 1VR6A 4K1WA 2BP5M 1DTUA 3EHBD 3TROA 4WEBH 3PXHA 1E1FA 4YHZL 5H4YA 3S34L 1KCVL 1AJ0A 1FL6B 4FLOA 1OGAD 5A6IA 1QNPA 5B4MC 3HG1D 1UCTA 3QYNA 5K5YA 3U0PA 2YQGA 2W6RA 4MTMA 3W1XA 2VQ4A 2HTLD 4BH8A 2E5DA 1U8LA 2WYTA 3WFBL 5D1XC 3D4YA 1QG3A 2A5UA 1DL3A 5F7HA 1P4IH 1MDAA 4O9HL 3PQYD 1M7OA 1E4LA 1Z0MA 3GMMA 1Q65A 2YEZA 3QUMB 4HX1B 2Z6IA 1RULL 2IAAC 2IBBA 3DHJA 4PTXA 2VSCA 3FCSA 4IP4A 1EBHA 2I5YH 1NTDA 4HNCA 4U1IB 1S3KH 2NT0A 4P2RA 2O61A 3AS1A 1JV5B 1PYFA 2GGJA 4H8NA 4U33A 3M7WA 2V6HA 4F93B 1R5WB 3ZYOA 5GZOD 3TBTB 3ZTNH 3ZJ6A 3C5ZA 1U8MB 1RY0A 4NDMA 4PJHB 1WWWX 2OXNA 3V6ZA 4QYOB 4N8CH 1NUNB 2ICCA 1LO2H 3JTBA 3GI9L 1IARB 2A74C 5C0BA 2QTVA 5IT2H 2MOQA 4OI9A 4ABWA 4ROPA 3HV9A 3OWEA 1E8ZA 4TSAH 2RACA 3O8XC 4HOXA 1I8IA 3EYOA 5H91A 1R3KA 4DW2H 4GI6A 5GS0L 5I74C 1RD6A 2NUXA 3IWVA 2CIIA 4AJYV 2NNAA 1RERA 4Q4PA 4GQ9H 3CXDH 4X5XB 4KESA 1AMYA 5D7JD 3S9IA 3OVRA 2F9RA 5DI8B 3R8HA 2O4EA 1XLGA 3S3GA 2VCCA 1UM6L 3TCLB 2RCSH 2V9UA 5IEHA 4KCUA 5GS1C 3VE0B 1O6SB 1N0XH 3I74A 3T0EC 4HS8L 2AHIA 3EUUA 3A9BA 1E70M 5KYYB 4PMEA 4FQXD 4AC4A 4WTZA 6TAAA 4AIXA 4NM4H 2UX7A 1WDQA 5D1ZI 4MQ7A 2A3EA 5LIUX 4QHUB 4KFOA 1DBJL 1FL5B 4TULL 2WXJA 4UB9A 3OA3A 1XDMA 1T66C 3B8DA 1RXLA 4AQEB 1U30A 1EJXC 4C5ZA 2IAMB 3F5WB 5LIYX 3P54A 2V3GA 3SKOA 3FRUB 2AJVH 4QAWA 3SSJA 4LRNH 3AYTA 1SLUA 3UG3A 4GKZB 2E7LA 1I4FB 3GNOA 1AI1L 1WZKA 4N4YB 4WTZG 1CS6A 2DORA 1W2PA 2JI2A 2NY7H 3MV8B 2UY4A 4HG4K 2AL2B 2F54A 3DYOA 3GZQA 2N56A 3CUPB 4NCC2 3T8XB 4Y2WA 2A0LC 4AWUA 3Q2DA 1S5VA 3RL2A 4TO8A 3BKYL 2XIQA 4FJZA 3QHZL 4M1CC 1JYXA 4HA0A 2D7OA 1NCTA 1GL4B 3IFOA 1NOAA 1RY7B 1NU5A 1KBWA 5DS1A 2CLHA 1CQKA 2UZXB 2K6ZA 1ZVSA 4S38A 2YDSA 2BSEA 5KSVA 4OV5A 2E4FA 3W00A 5ISZD 1UP3A 3G1RA 3GMQB 4C6MA 2F74A 2IANE 4S3KA 5E8DH 1NAML 3L4XA 4M7JL 5AZUA 2GL5A 2NRDA 4HDIB 2VXVH 4TUKL 2VLLB 3NQAA 5D72H 2PF8A 3VFLA 2XETA 1G7LB 2AK1H 3Q67A 5KZEA 2CW6A 2VW6A 2GI7A 1LILA 3BGFB 1EBAA 4UCGA 2J6EL 1JFQL 3QUYD 2J9YA 4JG5A 2PZNA 43C9B 4GKLA 5I5IA 4C4UA 1ZBCA 4DI9A 3EKLA 2YCLA 3W38A 5JQ6H 4DFIA 1KWKA 3GQFA 1K5NB 1PTDA 4F24A 5A6SA 1ZGLA 1P1ZB 5KJRH 4YSUA 5A94A 4HEMA 1OD9A 1WFNA 2ZUQB 3C60D 1QPPA 2VLRE 1A7PH 5FO7A 4EKXA 1IR1A 3NCWA 4Z77B 3TAKA 5GRJL 2XJLA 3CHOA 3C0QA 1ORQA 4PMOA 4D6GA 2V2XB 5FXCH 3H53A 4JIPA 6CGTA 1U1JA 4F8LA 2P49B 1P9MA 4DP4X 4FZEH 2HJFA 1VESA 4EOUA 4H2HA 3N2JA 4ZUUB 4D6JA 2WLYA 1L7TH 4LNRA 1C08A 1FSKC 3MP3A 4M61A 4LSQL 1OLZA 3OZYA 2CHOA 2YXXA 4N6EA 2YLLA 3TM6A 4Y90A 3SE8L 3CHVA 3ARFC 1HCZA 2REQB 1CYXA 5CPTA 2B4CL 3H0TA 4GIRA 1A47A 1KGCD 2XSAA 3II3A 5GSVA 1Q63A 4ZB0A 4X7FC 4K5NA 4CD6A 5C9XA 1KKRA 2B2XL 3ZHKA 1TCMA 2Q3XA 4IUOA 4EOWL 4UBPC 4N90E 1UA7A 4QNEA 4MUPA 3OSVA 2PCYA 1NAMA 3BGAA 4Z2IA 5G55A 2DFAA 2B5IC 4NJAL 1X7IA 3JU2A 3WY3A 4Y4FD 4O2EB 3GTTA 1TJ0A 2BZCA 1JFHA 1BQLL 3OVUB 2JTYA 2DWTA 1IQDB 1ONWA 2VFGA 5DQPA 5IVXE 5E09A 4AYEC 5CJ8A 1A0EA 1KUMA 4N8VB 1MJ7L 4V1DE 3R11A 4ACPA 4EIUA 1PXGA 1ZGLM 3CC1A 4JY9A 1G6RH 4O5LH 1G9ML 3QUZD 4J28A 2FTAA 4NJJA 4FABH 5FA4A 2ICWJ 4FKHA 4JFDB 3L5XL 1KBVA 1K9TA 5GGTL 1G5AA 2IADA 4O1BA 4JY5L 2OTUB 3XISA 4JS7A 1FFOB 1A5BA 1AW1A 3MJ9H 2PBOA 4B4FA 4M93B 2GT9B 3RKDC 3RGVC 4QCEA 1UROA 2WZ6A 1AP2B 2O0TA 1TJGH 3RWCB 2WBKA 4S1SL 5AL8A 3OF6D 4WO4C 2XBDA 1QLEH 4IMDA 1PZSA 1NGPL 4XUGA 1ANUA 4NY2A 1TZHB 3K4WA 2BVEA 3OJ2C 1NC2B 3ZMRA 3NYDA 4WCJA 2HA1A 3OMNB 1I1AA 1MYRA 4KF1A 3K6SB 2H26B 2YC1B 3CPLB 4YR6A 2QQQA 4IPNB 4NQQA 1IT9L 1JPSH 1EO8H 2IPKA 1CWVA 4PUKA 3LIZH 4ZD3H 4OWGA 1E15A 2L7EA 1KRBC 3FQYA 4F7EA 1FLTX 3CE1A 3SBQA 2CR3A 4FA8A 3BKJL 1ZOXA 5DCEA 3BUIA 3PTMA 1FA2A 1ZFJA 2H8XA 1XR8A 2ZYIA 2X42A 1WPCA 2Z91A 3TP4A 1ZK5A 3G3LA 3US0A 5JXQA 3K0YA 4YHYC 2ZRZA 1DSWA 5HWNA 2R4SH 3QZLA 4JHBA 3LEVL 3UBXA 3C2AH 1T40A 3G6JF 4GHRA 5F3HB 3H56A 3MRJB 1P6CA 5F71A 5IQ7L 1GGUA 5J56B 3WQEA 3WO8A 4FCAA 2IFFL 2IOOA 3RHWF 2UY2A 3EYSH 3AICA 4BFJA 5GGTA 2Y7MA 3KTXA 4IOFC 5EZIH 1XI3A 4PFMA 2OO0A 3BQUB 4AZCB 1B1YA 3QGAC 3CIAA 4K3GA 3E6HB 5FR3A 3V8OA 2PDKA 5H8MA 2Q8BH 1GS7A 2MTAA 3ITVA 1RJZB 3RLVA 4B7IA 1AA1B 3NEXA 4E9WA 5F3BA 4KRZA 3V35A 1LL4A 2ZOKB 1UKPA 5D7HA 1DQUA 3UBXG 2ASHA 4H9TA 3QUML 1U8NB 2VW7A 4GYFA 2WXNA 3Q6FB 2DJSA 5AOUA 1M4KA 4IP5A 4JKPH 4O14A 5FYKH 3LI1A 1ADOA 3KTCA 3MY9A 1DANT 1I9IL 5HYQB 2BINA 2J8OA 3KE0A 3KPPA 4UQBA 3ZYZA 4L9ZA 2RDTA 2WB1A 1GQNA 5T9CE 4EVNB 4EKJA 3AXKA 3N06B 2JLLA 3UG8A 3I2CH 2N7AA 4XX5A 3W76A 3MSYA 4Z2JA 1XIJA 2VISB 5IHZB 4EI0A 3KD4A 5JR1L 5DMJB 1QRNB 3W73A 4C6LA 1KBPA 2JTDA 3DBPA 1ULVA 3CBJB 3PULA 3I6TA 3PWNA 1EBGA 4Y6GA 1DYSA 3NDZE 3N9SA 3B3BA 1NDTA 2G5BA 3GHEH 4O57A 4O0ZA 4XMKL 3OAYK 4NQTA 1IIGA 2PRLA 1IIKA 3NZSA 2J21A 2NW2B 4YNYB 1J9RA 4JRXB 2LFEA 1TVLA 2P5WE 2A4CA 4J3BA 5LXXA 1FL6A 2CHWA 3ARVA 2E6YA 1P2CB 2J4GA 3QFJB 3L3GB 4WKFA 4UQ2B 1N82A 2HRLA 1VPYA 4FTDA 5A16B 1ZHBB 4F3HA 3ZHNA 1G4RA 4F0HA 4ZFFB 3BSMA 5H1WA 3NBNA 1AH0A 4NHCL 1M1XB 2GIYA 3MT1A 1ZRQA 1LO0H 1TQVA 5SWZB 3QUMA 2V5TA 2FIQA 4HX1A 2OGYA 3CLEH 2VDHA 3VZYA 4WHDA 4FRWA 2XH7A 2AEPH 2UZIH 4GFIA 4UMAA 1XYZA 4U1IA 1OAQL 1CTOA 1EF2A 4YDZA 4S2CA 1JV5A 3ABZA 2F1AA 1X1OA 5AVQB 2WP3O 4OT7A 5KMYA 1WUZA 3T65B 1KFWA 3D51A 4HT3A 2EIDA 4FKKA 1U0QA 1JNNH 3ZKXB 3TBTA 4OZGE 3W85A 4KBPA 1U8MA 4A2EA 1TPUA 1S2EA 4PJHA 3ISYA 1H5BB 2HN7B 1E8YA 4QYOA 4MXQD 5D1ZD 3VWKC 3EYQD 4N0CD 3ZO0A 5D93B 1EHLH 3R1GL 1JXFA 4FQCH 4R84A 4HUUB 2WINB 2ZZ6A 3RNDA 2CJUL 1SJBA 2H8PB 1WUNT 3SR7A 2EQDA 4I0PD 3PZOA 1JRHL 1R47A 1A1OB 2CHDA 2ISWA 3TF4A 1BAGA 4UQ3B 5DD3H 1V0NA 2FEEL 1OANA 5J12B 1Y7VA 3VE7A 2IPTL 4MJ5A 3FZUC 1JTTA 3VD3A 4JQIH 4BQCA 5GJTL 5C0EA 4X5XA 4RGOH 4DP6X 2A3AA 5DI8A 3T40A 1ZXQA 3THML 3TFCA 4NPYB 2KBGA 1TLKA 2Y85A 3PRZA 3TCLA 5BS0D 3TZFA 3H9SB 5MHSD 1O6SA 4U2YA 4XGZA 3UF9A 1BXCA 3RO8A 2VEFA 1BXAA 2DL9A 5KYYA 1JPTL 5HR6A 1EOMA 3VDGA 2V7HA 1SXNA 1UACH 2PCEA 2IH3B 3LS5L 4Z3FA 3X12B 4EPEC 4WWKC 3F1QA 1JPHA 4QHUA 1LROA 2HUEA 3OP2A 1FL5A 5D2VA 3MV7D 4NX5A 3M88A 2BFVH 2DWEB 1CZ8H 4C6BA 2F2HA 3NJXA 3IS0X 3RB5A 1D2OA 3LNFA 3S37X 1EP2A 4UMSA 4HNVA 4PI0A 1UMYA 5E2TH 3FVDA 1BVZA 3KS0J 4HFUL 1VFUA 3TBBA 5G2WA 2GKIA 2IAMA 3F5WA 4N1EA 5CEYB 4L4VB 2EDWA 1CZ1A 3FRUA 2XG5B 5K39A 2O6CA 4GKZA 2WNNA 1I4FA 3SN0A 5FHAH 4NC1E 3MV8A 4NVTA 1CJYA 2AL2A 1GJWA 5DEJA 3NURA 3B5GA 4PB9L 3K5SA 3SOBL 2HS8A 1CK0L 2EH7L 4KROC 4GT0A 3T8XA 2VXNA 5AVHA 4ZNEA 3OGOE 1DQTA 4GUCA 3UC2A 2WQPA 3UERA 4LUTB 3STCA 1BQCA 2QV2A 3N4FA 5I0YA 1AZRA 1KGYE 4QG6A 3LN9A 3ZJKA 2UZXA 3PWJA 5BRQA 1H09A 4XNZC 5ANHA 2LU7A 3AIRA 5BYWA 3GMQA 4ZX3A 5ERWB 1TZ8A 4L4TE 4RX0A 2X1XR 1Z9AA 2VX5A 4AYDC 1EGVA 1BWMA 1NP0A 3ZKMD 3KCOA 1KLUB 3PLYA 5KANG 3M7OA 4N02A 3TUUA 4PMDA 4J3WA 4HDIA 3FQWB 3FSAA 2VLLA 4O51B 4TUUA 1BAFL 2PDBA 2Y1ZA 2HT2C 2FX7H 1KFJA 3IGLA 1G7LA 3W74A 1X5MA 1TVDA 3E8UH 4KXAA 3I6RA 3P3YA 1TPXC 2EPHA 2FK9A 2WO5A 4O19A 4WHBA 1A6UH 43C9A 2G41A 4OECA 3VC6A 2Y6SC 5IFHH 5DDHB 3R58A 5FJUA 4UXDA 1K5NA 1Q4WA 4UUJB 1P1ZA 3U4FA 1QR4A 1JGIA 2VDLL 4JJOA 3TR9A 5E2VH 2X89D 4ACZB 1RFDL 1OD8A 2P8PB 3T6WA 4NUQA 3MRMB 2G96A 2V2XA 1U33A 4Z0BH 2ROYA 5HGDB 5DUPL 1OQFA 3XINA 1VJZA 1IU1A 3UCDA 3TZNA 1ICPA 3P9LB 3LB6D 3RWGB 2V5KA 2BCKA 3IMTA 1TREA 4ZUUA 5D8ZA 1XXDC 5IXEA 3C8HA 1XSOA 3EBAA 2CXGA 4DM2A 5F1SA 3AQZA 3KOYA 1T5XB 1ZRUA 3MCMA 4JTKA 3O3DB 3STPA 4Z95L 4HISA 4HNUA 2WZAA 5J04A 3LZLA 3GDCA 4UB0H 3E2HB 2Z1PA 5ILTH 2OXGB 3B8SA 5BRPA 5CGYD 3RTQB 4YFEA 2REQA 4QS5A 4RZCA 4LUSB 1FZKB 1SN0A 4OW6A 5LXGL 4LAKA 1BRLA 3SFKA 5BUGA 3V52L 4DYKA 1OE2A 3FTSA 4ZAKB 4J4PD 5CZRA 1S4IA 4QXVA 4JTEA 1F73A 4O2EA 1UBSA 3IJ8A 4M3HA 3ONBA 1IJ9A 3W37A 1IQDA 3GTNA 3JVGC 4BJHA 3U0TA 4K8HA 2G5UA 2DH3A 1T89C 4GXVH 2TRSA 1EO5A 3FQTB 4N8VA 5D9NA 1FNSH 5AW6B 4YTSA 1LO5B 3D48R 3QYQA 3ULVE 5C2XA 1KC5H 3WLBB 1U8KB 4YDIH 3UZ5A 3QXUA 2OG9A 2OTUA 1FFOA 4GLRH 1W8GA 4LNYA 3M5YA 4NBXB 3TU6A 1FWAC 2GK0B 1TVPA 1V7YA 4ZK8A 3VQMA 4JPKL 1RAKA 2GT9A 1W16A 1DV7A 4AITA 3W3BA 3W2LA 3SDYH 1PNDA 2ZRUA 1MI5A 3NZGA 1SJXA 4YPGB 3RWCA 4FXKC 3VNZA 1TZHA 1T22B 4N8VG 3VFUB 2MANA 2Z00A 4L29B 1XL9A 1NC2A 4XP4L 2ZUNA 4HMNA 1OSZB 4V2CB 2UWEE 1VPOL 1VZHA 3V0VB 2QQLL 3K6SA 2H26A 3M07A 2YC1A 4C59B 4PGJA 3CPLA 5AB9A 2PDNA 4JTRA 4GUOA 4QDPA 2MMXA 3M16A 5T3ZD 4JQ4A 3LTVA 3GU1A 4GAFB 1GPWA 2BSRA 4CN1A 1WT5A 4ZA0A 4E6MA 2HEJA 4PJEF 4WNJA 2QYGA 4XAFA 5IHRA 3HG3A 4GY0A 5EMKA 5A1AA 3EJZD 1HIZA 4HNNA 3BHBB 3CASA 4EP8C 4ZI8A 3NZ1A 2X0SA 5JDSB 1MI3A 3GJFB 1RPKA 1UYQA 3VD9A 4JG0H 3RO6A 2ILLA 5F3HA 2ZVIA 2BSSB 4M5SA 5D7LE 3T2LA 3MRJA 4YDKL 3L4VA 2OQHA 4GI9A 2WO4A 3VTTA 5I66B 2EICA 3MPGA 4XCFL 2DD8H 3RVWD 4PRWA 3ARSA 2FE0A 4U7KA 5FDWB 3UTQB 2WLMA 5AW3B 3M0KA 1FFTB 4MQTB 4R7LA 1TV4A 3BQUA 4HW6A 2CITA 4AZCA 1SYVB 4YUEL 3P8IA 2YN5A 4UV4L 2GUUA 4C56D 3O06A 1TR7A 3E6HA 1YIXA 4EO5A 3R43A 4UNUA 1RJZA 1A7RH 2Y61A 3B8UA 4K7VA 4EZKA 1BAWA 4FFZL 1GOMA 2VDRB 5FF0A 4HBKA 4W81A 3Q0HA 3RJYA 2ZOKA 2CA4A 3K2IA 5C0AD 1JD9A 3SJNA 2PTWA 4LQFL 3D85D 1U8NA 3Q6FA 2VI0A 1NQ6A 3F2BA 5I23A 2EDRA 3GW0A 4FL4B 1RJQA 4CRPA 4N4PA 4D9RD 4Y4HC 2B3IA 3FC8A 5HYQA 3HOJA 2FCBA 4X98A 1XSIA 3F01A 4NN6C 3M41A 4KO9A 4ELMB 1E4NA 4EVNA 4JFYA 2ZWYA 4EQ2A 1Z9LA 2DQCL 3FFDB 5C0BB 1ODAA 5FACA 2GHZA 1R9FA 5F4SA 2H1PL 2VISA 3T42A 1HHIB 5D5ME 2Z2UA 4AC2A 1QRNA 1NICA 1KN2H 1R3KB 2WQRA 2E46A 4AKPA 2FYYA 1DBKH 4FE9A 1IC5L 5TPWL 3P73B 4KTEH 3NZQA 3AHTA 2CIIB 1JMZA 1HQ4B 1NGQL 1AQFA 4DKFL 2C34A 3FAXA 3LJ3A 5IEHB 1I8UA 2NW2A 4YNYA 1S7UB 2J1ZA 3WLWD 4PB4A 4JRXA 1WYIA 1YNKH 4LLQB 5DMGD 2AK4B 4WX2A 4Y2NA 3WBAA 3S36L 3IARA 3GHUA 1P2CA 5F97E 3REVA 3VKKA 3OVQA 3QFJA 5CBJA 2RTTA 1YNQA 5HHMB 4XX6A 3L3GA 5HYJB 2XG4B 1FH9A 6REQB 3SYCA 3HNSH 3H23A 1WBYB 3HIZA 3C0SA 3EO9H 5A16A 1ZHBA 2W38A 2TSYA 2H6UA 4PJ8D 2H3XC 4PGEA 4M7TA 4ZFFA 4RNFA 1IZJA 4DGVH 5IB3B 1M1XA 2W9DH 3LZOA 5SWZA 5H8PA