4DO5A

Pharmacological chaperones for human alpha-n-acetylgalactosaminidase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pharmacological chaperones for human alpha-N-acetylgalactosaminidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Alpha-N-acetylgalactosaminidase
total genus 131
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4do5A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4do5A01
2H6RA 2VT0A 7TAAA 4MUZA 2QPUA 3GXMA 3BG5A 5LSMA 5KMYA 3NPVA 3D0CA 4JD4A 2A6NA 4H7VA 2ZRZA 3B06A 2AMGA 3EKLA 4IMGA 4WJEA 4HNTA 2C13A 4O52A 4UMCA 2V2DA 1E43A 3C2FA 3W7GA 5BMWA 4S2BA 1W54A 3ABQA 3DENA 4AIEA 1MW0A 3G1XA 4FLOA 3O06A 4GUIA 5H2ZA 2XVKA 4JFSA 1JULA 5HUOA 3NXFA 3WK0A 4UTTC 1FDJA 2G3NA 3HZ3A 4YLWA 3GIYA 3C8FA 1F5ZA 4M6VA 1VCGA 1JD7A 2ABAA 4O1DA 3QW4B 1HL9A 3T40A 3BVJA 3OIXA 2PWGA 1SFJA 2ZRYA 3N3MA 3BUPA 2CW6A 1O95A 5U7SA 4B9YA 1C29A 5TD4A 3LV5A 1A5SA 2GOUA 1WOAA 2DZXA 3QZEA 4JR5A 1YLVA 1DJQA 3T4CA 3L5LA 3JRKA 3BLBA 2GQ9A 1VCVA 2VELA 3VNYA 2YR1A 4NU7A 3W2KA 4EOUA 1SR9A 1N55A 1S5VA 5BOOA 4HNVA 3NEVA 3CZLA 3OLEA 3RFAA 3M9YA 5KITA 3FKRA 4Q33A 3SSJA 3TXZA 3P74A 1OG0A 5K7JA 4M7SA 1AL8A 1W37A 5IM51 1FY6A 3S5ZA 4NJKA 3L0GA 2V5LA 3QPZA 4GKLA 3DDGA 3G0XA 1R33A 2ZZ4A 2X2GA 1EA9C 2ZX9A 2YA0A 1JG9A 3HJZA 1GVOA 4QQ3A 3S0CA 2TPSA 2JKEA 3BARA 3PULA 4IPJA 3A5FA 1XBYA 3CIXA 4L4LA 1U33A 2TAAA 4CQ8A 1KBBA 5L6UA 3TTYA 2CXGA 2QCCA 3M1ZA 2I14A 3FLUA 1GJUA 5HWMA 5LHEA 2NV2A 2Q3RA 2NXHA 6ALDA 1H63A 2V5BA 2WNWA 3WNKA 3P5ZA 3N9SA 3P8IA 1OFOA 2NT0A 3M7WA 2YIHA 1OVDA 2RFGA 4AWTA 3NG3A 2EO7A 2Y7FA 3UERA 4JFVA 4ZL1A 2WSRA 1X8FA 2WCGA 4XWUA 1ML1A 3W71A 3MO7A 1FWSA 3L4TA 3QGVA 2B4GA 3IVTA 1KWKA 2A5HA 3EWUA 4OBTA 5D2WA 1G7UA 2E0PA 3L4XA 2NXGA 3HPSA 4ONVA 3W7HA 4HPHA 1H7WA 2ZRUA 1TREA 2FHCA 3BCFA 4PCSA 3W6YA 2NUXA 1YDVA 2EGZA 3HIJA 4N6EA 2VXNA 5DXXA 4J3TA 3BUIA 1XL9A 1JXKA 3VSTA 1LRNA 1I2QA 1ME8A 3TQKA 2B7NA 4HKPA 4LWWA 3G24A 2WQPA 2E6AA 3A6OA 1Z44A 2CU0A 3EXSA 1EUNA 3UWWA 2V30A 4P61A 1Q4NX 1M7OA 5G4WA 1PS9A 1QW8A 1WYIA 4MPQA 3LCIA 4K38A 3ZWTA 5I3FA 4JX4A 3DHDA 3L67A 1PIGA 3EDKA 1SW3A 4FO4A 5DCDA 1FWWA 5AOUA 2V9DA 2RKXA 2RDWA 3L0NA 3L2MA 3W75A 1CGTA 1KGWA 3G1FA 3ZT5A 1L2UA 2E77A 2G5WA 3FYPA 4B9ZA 3VM5A 1G9HA 1EIXA 4RJEA 3AMLA 1CXHA 3M5YA 1EP2A 3CZEA 4MJZA 3LTSA 3EJRA 5CG7A 4QAIA 3LRKA 3ZT6A 2PC4A 5D09A 1PZ2A 1V3MA 5AC8A 1XXXA 1JAEA 2NWSA 4LS2A 2C18A 1RV8A 1TCMA 3PUDA 2OW6A 3LPOA 3W7IA 1SFLA 4XBSA 2OYLA 5C5YA 2WNQA 3HJEA 1CW2A 1U30A 4NJJA 1BSIA 2DZVA 3EWWA 4GUGA 4UOZA 4UTWA 3BAIA 3TSMA 4M6PA 1LOLA 3G8EA 4IUOA 1XBXA 3SIZA 3HGSA 4DEFA 2QCMA 3L4YA 3C0JA 3MJYA 1TQTA 3P82A 1RVGA 4PODA 3L4WA 3WEOA 4UFIA 3UWZA 2JGYA 2GJLA 1I2OA 2NZLA 3IK2A 1G4SA 4IX2A 1GT8A 1OFEA 2EABA 1FUYA 1PIFA 1ZAHA 2X2JA 3NQ6A 1HTYA 1Y7VA 4LY8A 1XI3A 2E68A 3DFOA 2Y7GA 3DI1A 3NPUA 2P10A 4O8RA 1KM1A 5FESA 4GINA 1OF8A 4OJYA 4W9TA 1AL7A 3RNDA 3UWYA 4JDYA 4C1LA 3KWXA 1F6KA 5DY3A 2QPSA 3UG3A 4Z1BA 1VAHA 5BMXA 2RHGA 1SZFA 5DELA 7CGTA 1MSSA 4DO5A 1JUBA 3LB0A 3LHTA 4KKXA 4QIUA 3RF9A 3B0PA 3L21A 3GBEA 3W23A 2E5BA 3LOTA 1ZJAA 3NQGA 4NVTA 1UUOA 3ANYA 1Q6RA 2DORA 5D33A 3EX3A 4MY8A 1UD5A 4UCFA 2Y62A 1KV5A 3A9IA 3DXIA 3W7LA 2A6LA 1EWDA 4UNKA 1VFUA 3S2CA 4I7UA 1MEWA 1J2WA 4LUIA 4AWSA 2ZA2A 2G95A 1MEHA 1SW0A 1QCWA 3KVJA 2EACA 3H53A 4O53A 3TJLA 4ADUA 5TIMA 2E6FA 2QJIA 3CB8A 4BK9A 2JKPA 1RQBA 1K7EA 2BX7A 4KMQA 5SWUA 4WQ6A 4K7YA 3N14A 4FXSA 4XKYB 3BV4A 3FW6A 1BWLA 4WOZA 3W1MA 2E8YA 5E9AA 1H62A 3ZFHA 1KM5A 1PE1A 1GVIA 4DF2A 4MY9A 5K9DA 1MXGA 1NF7A 2H3BA 4LOCA 2F7OA 4OE7A 5IBXA 1D9EA 2BY0A 3LDVA 2NX3A 3EJSA 4Z08A 2H3DA 3SZ8A 2OX1A 1CXKA 2RDUA 3IVSA 4UOQA 4GUHA 3WY2A 1XCFA 3GNNA 1IXPA 4HP5A 2X1UA 3W1QA 1GG1A 1M5WA 1UBSA 4JTLA 2OSYA 4RZ4A 4LPCA 4PL1A 1TPB1 1YXCA 3HGRA 1ZFJA 1G5AA 3IIPA 3PBWA 4AYSA 2CZFA 5CGTA 4LNYA 3G1HA 1DJNA 4NZJA 4DF0A 4K8EA 4UUIA 1VB9A 1JCNA 4RLIA 3KX6A 4O1CA 3BAJA 1JD9A 2YDAA 3Q58A 3T7VA 3KEHA 2Z6IA 3BUDA 1CPUA 1UASA 3TC6A 1VC4A 4HT3A 1WOBA 1ZAJA 3CQ0A 4D2JA 5AHIA 1PPIA 1OX6A 5LZLA 1TPFA 5I23A 5C6MA 1A50A 1KXHA 3TIMA 2WCSA 2CLMA 1VFMA 2DIJA 4MFEA 1KLYA 3YPIA 3NQEA 4JTIA 5G2IA 4EF8A 2YPIA 4W93A 3KVKA 4YMZA 4CN4A 4AAJA 1W5PA 1XC4A 1TMQA 3BMWA 3D4YA 1WX0A 1VZWA 4U33A 3HG2A 3OEXA 1DL3A 2CLKA 5AHEA 3QM3A 3TC7A 1X6UA 1J4EA 4RZ5A 1V5XA 1CGUA 2XIBA 5H91A 5HR7A 3DX4A 1KTNA 2VFIA 5CPOA 4AIOA 1PS3A 1CGXA 4LRTA 4HNUA 2XFWA 1JJKA 4Y9AA 3SY5A 1TIMA 1FCBA 3WDJA 2ZIDA 4DXVA 5E6ZA 5BRBA 2P0OA 2Z0IA 4RKAA 4FNTA 5DBTA 5CKSA 4ZQPA 3E02A 4H8UA 1EWEA 1G94A 5D30A 1ADOA 4O28A 1XSKA 5HXMA 4Y6GA 5EPDA 1P1XA 3NQAA 2X2HA 3TFXA 3F4NA 5FF2A 3ECQA 3P8JA 2PRLA 1EX5A 4BI7A 4MVAA 3FKKA 3VFLA 1OF6A 3VGBA 3O6CA 2ZZ2A 5I0DA 2Q3OA 2WV8A 4JTFA 4UTHA 1CGWA 2CFFA 2EAWA 2FHBA 1ICSA 3O6DA 1QWGA 4BA0A 3PC0A 4K7VA 4UTJA 2QV4A 1GG0A 5EYWA 4R53A 4GI9A 2Y2WA 2Y61A 2X1TA 4YCOA 1E3ZA 4FXRA 1JRBA 2V2HA 1EO5A 1G1YA 1FX6A 1UH2A 3WNMA 3DFSA 1GZGA 3WJSA 3BO9A 3IIXA 3R8RA 4JTJA 1L6SA 3S5NA 2EJ1A 3N34A 3U6WA 4E2OA 3PBUA 4JX6A 4I9AA 2YW4A 3GDLA 1UD3A 4NNCA 2NXIA 3NYZA 1YDOA 5G5IA 2VRKA 1S3HA 3AXHA 5G2HA 3EXRA 1XM3A 4JFTA 3NQVA 3BLFA 3M07A 2PWHA 1K8YA 4UQBA 3UWVA 2X1SA 3DGRA 1KCLA 2E6YA 1IXNA 1C9DA 4R7JA 3DKLA 3RLUA 2WANA 4U31A 4UMBA 2J25A 4R34A 3CWNA 3WY1A 5F4SA 3DZ1A 1ONRA 1XDMA 1IZKA 2FTPA 3ABRA 3HG5A 3QF0A 1ME9A 4IWWA 4PSPA 1LP6A 3NQCA 3TMLA 3UXDA 4HA1A 2FH6A 3L2IA 3MBFA 3NQ2A 2D0GA 4TX9A 5D04C 2E5CA 4JTGA 3LXBA 4QISA 1KXTA 3PB2A 3SW6A 4ZVJA 2FB3A 3CEPA 4WF7A 4M19A 3KRZA 4PTNA 3RMJA 3LTPA 5D03A 3KL5A 3GXIA 2GQAA 1UKSA 4UFJA 3QH2A 1UA7A 3W07A 3S9YA 1XCWA 4JICA 4XQ6A 1WO2A 3EWYA 2YGYA 1JGIA 3KXQA 4WLCA 1LBMA 4IMFA 1HG3A 1KM4A 2XVGA 3W7JA 4AEEA 4FF7A 4IGHA 4RX0A 4LC6A 3D4ZA 1A5CA 4LVGA 4DBEA 1H51A 4UR8A 1BAGA 1JQXA 4OQVA 1OT2A 5K3VA 3LLFA 1YTDA 2WVTA 1NEYA 3H54A 2WVSA 4MYAA 3BAYA 2GJNA 4TIMA 3LRMA 1W5NA 2ZBTA 4M6QA 5DBUA 5FF4A 4AEFA 1N7KA 1SU5A 1WPCA 4OGZA 4LVFA 1PJ9A 1TTJA 4PH6A 1XKYA 2OSXA 2ZX8A 1Z41A 3KVMA 3F1QA 2TYSA 3SGZA 2DJLA 3WNOA 2QDGA 1TPC1 4RV8A 3L65A 1O7DC 2H8XA 4I7WA 4BWLC 4E2DA 5EL1A 1JL8A 4QJ1A 1MFUA 3BCDA 2GVGA 2GJRA 3KVLA 3AJ7A 4OWGA 3W7DA 3GXPA 2C19A 1KFEA 2OZ0A 1O5KA 2NSXA 4LTSA 4PFMA 1MFVA 4M56A 5AB3A 2FJKA 1G69A 3VMPA 1GCYA 3UG4A 4JTEA 3M43A 2WC7A 3LGEA 1KWGA 2QUTA 3DI0A 1R2RA 2VEMA 5U4NA 4IXXA 3UPBA 4UTMA 2D3LA 3CEUA 1X1OA 1RQHA 1VLWA 3BAWA 2X2IA 3LCFA 4LU0A 2BY1A 3W22A 7TIMA 1HNYA 1N8FA 2E1DA 2X30A 1G4TA 4LUJA 3BSHA 2TRSA 4NXKA 1TTPA 2I1OA 3S5YA 4WOQA 1QI3A 3BVTA 3CZKA 3K8MA 1E51A 1G6CA 3P81A 4ICNA 5HUPA 4O11A 3CU2A 3P7YA 4FNSA 4XB3A 4LVDA 1DKWA 2VNCA 1AG1O 3DFNA 2QCDA 3EDEA 3GDTA 1KFBA 3PG9A 4NXSA 1Y0EA 3BPWA 3K1DA 2V2CA 3NQFA 5CXPA 1I8JA 1UH3A 3BC9A 1T99A 1WP6A 4PEEA 1M7XA 3O6YX 4MB1A 1IZJA 3C2EA 1CYGA 3EWBX 1QI4A 3B8DA 3FYOA 3A21A 2ZXBA 4UZSA 4G1KA 1HT6A 1DV7A 5K2ZA 4GXMA 4WY0F 4X22A 2QJHA 1B9BA 3NAVA 4XTIA 2Y7EA 5CSRA 4GI8A 1JDCA 4H8HA 1XUUA 4U28A 4IMDA 3NR0A 2YA2A 4A22A 1XGZA 4O12A 4O1BA 5AC7A 1WBHA 5LHFA 3KL0A 3G1SA 4JTKA 2QDHA 3B04A 2E4TA 3BW2A 1TV7A 3P80A 2G96A 2DJXA 4FEZA 5EKYA 5FF7A 3IGXA 1JI1A 3S8HA 3LXCA 3IJ9A 1EEPA 1OK4A 5HWNA 3FOKA 4U2YA 3DH7A 1R46A 5E0FA 3ZSTA 4JXCA 3VM7A 3HGJA 5EA9A 4HN4A 2OYMA 1CXLA 2QCFA 1XSIA 1BPLB 4AHOA 3SJ3A 4FNPA 3R89A 3CV5A 1L6YA 3ZT7A 1OFBA 2EADA 2Y89A 3PM6A 3ZR5A 4MFDA 4GNJA 3CPUA 2GPTA 4Z0JA 3T44A 2ZDRA 3O63A 3E0IA 2ZX6A 5KSWA 4JTUA 4MAZA 1O94A 1XFBA 3JR2A 1IF2A 2C16A 1B0IA 3L68A 3S1XA 1QPOA 3PG8A 5I3JA 2G97A 3W72A 4NZFA 1MW1A 3HQ1A 3W7KA 4HOXA 1TSIA 3EDFA 1THFD 2E6DA 5HJLA 1VRDA 3O07A 3WK3A 4CCCA 3ELFA 4DQWA 1SMAA 1U2YA 3TJXA 2VFFA 3SFKA 3AJXA 3Q94A 3GXNA 2ZRWA 4JTTA 3L2LA 5E0KA 1R75A 3MP3A 3VE7A 2WSQA 2F61A 3NQMA 3EX4A 3WENA 3EX1A 5D38A 5HNRA 4ZQCA 2ATSA 1W5MA 3TCEA 4EIVA 3H55A 4MIMA 3GDRA 2YXGA 2Z6JA 1HUVA 5CPMA 3C61A 2X1RA 4AW7A 2X16A 4N9DA 3TR2A 3R12A 3W2UA 1OFPA 1PAMA 4ZQNA 5AHNA 4BZYA 3NVTA 5BNKA 3AMKA 2ZTJA 1A5BA 2HSAA 4KWUA 3ZSSA 1K3UA 2QCDB 3IIVA 3DAQA 4TR9A 3D50A 1YADA 1UD6A 3IJ8A 3TU9A 4FX7A 4O50A 4CLMA 4JGDA 1O4UA 3I7RA 4ZMGA 4KWWA 3TNOA 6TIMA 1LRTA 3TFCA 1U5JA 3ZO9A 4N4QA 5DLCA 2W79A 3IIZA 2YSWA 3UXAA 2BHUA 4PSRA 1RP9A 2FQIA 2ISVA 1TPH1 3SGUA 4GO9A 1WXJA 3GVGA 2QKFA 4P2VA 3NA8A 3VX1A 3MW7A 3DX3A 4ZQRA 4Z0SA 4U3CA 4J3VA 3DHFA 3M5VA 5DO8A 1Z42A 2GUYA 1J5TA 1YPFA 2VKZG 4O19A 2OJPA 4GQQA 3UCQA 3QQ1A 3F03K 3B03A 2BXZA 2CLEA 2ZXAA 2QUVA 1DORA 3PAJA 4N9EA 4Z1CA 3WY3A 3T55A 5AHLA 2F7QA 2GVYA 1HO1A 1FQ0A 2IGTA 4DPQA 1TMHA 1HFBA 1JF5A 3ZWSA 4ADSA 1TPVA 3BSGA 3WJZA 2PRHA 1FWNA 4J3WA 1JUEA 4GQRA 3ATZA 3FEMA 3GLCA 5CGMA 4CN6A 2BWGA 3TQVA 4BWLA 1JIBA 4J3SA 1ZHAA 2F18A 2ZX5A 2A1YA 3ABOA 5F1UA 2YFOA 3UPWA 3QC3A 3OLDA 2YYUA 4GC4A 4N02A 2WVUA 1YTEA 3NL3A 4LVBA 4H8VA 1PCWA 3BLPX 3E12A 3IGSA 1WZMA 4UR7A 1OX4A 2ZUSA 3TSDA 4FHAA 3EJTA 2FFCA 1EUAA 4EVZA 4DO6A 3M0ZA 3PBVA 4I7VA 3MMTA 1D3HA 3TW7A 4HPXA 1F7BA 3DFQA 3FFSA 5KZMA 3OLGA 3WNPA 5CZSA 3MI3A 1XH0A 4QAWA 1NSJA 3RIKA 4JYDA 1VLIA 3USBA 1ODUA 9CGTA 3MYOA 5I3KA 1DHPA 3VGDA 2FPYA 3S6DA 1TYGA 3BGGA 1D7FA 3VSUA 2ZX7A 2NLIA 3TROA 1GJWA 2CZEA 3FAWA 1EPXA 3W7RA 1OHLA 3W1LA 3KHJA 1XCXA 5BW6A 4JTHA 4LV9A 3UY8A 4RR4A 1SSDA 3EX6A 1F6PA 1H1ZA 3VGFA 3W74A 2BXVA 3HG3A 1AMKA 3TXVA 4LVAA 5AYZA 3TONA 1TQUA 4LXFA 5K9CA 1CI1A 4UZUA 4TMCA 4E38A 2J9XA 1UKQA 2V0TA 1H50A 2WSKA 1FWRA 3LI1A 2XN2A 3M5ZA 5KINA 3VU2A 3DU0A 3TAOA 2VC6A 3W1AA 2DIEA 2C15A 4JL1A 4UQDA 5IBXC 1W5OA 3CLWA 3UZ5A 3LHWA 1B57A 2YJQA 1B2YA 4O54A 2YCEA 3W7QA 1EB3A 5CZJA 5FEWA 4GE8A 4UTTA 1CGYA 1AW2A 4QNWA 5DFAA 5EY5A 3G18A 3A24A 4H2CA 4LRSA 1LBLA 4N9BA 1J0IA 2E09A 2Z1KA 1M53A 4K39A 1XBZA 1Z32X 4GBUA 4XTDA 1GPWA 3ZR6A 1OYCA 5J5RA 1LLWA 1K8XA 1YXYA 5K4ZA 3CTTA 4WSJA 3W87A 1KFLA 4FX6M 3HMJG 2CLFA 2VR5A 3GDKA 1UKTA 3NOEA 1VPXA 3PUEA 2QEZA 3S1VA 3NM1A 1I45A 3THQA 2VEIA 2HS8A 2XIIA 1VH7A 2Y85A 1L9WA 1JUKA 5C2XA 1HO4A 3TOPA 3M41A 1KB3A 1CX9A 3W7MA 1UJPA 1S5WA 2EKCA 3E96A 1DEDA 1WZAA 2OT1A 4C1KA 2C3ZA 3CZNA 4HNNA 2B7QA 3WN6A 3P60A 5I5RA 4M8UA 1VHNA 1W8SA 3SR7A 4E2BA 4A2RA 1PCKA 1KM3A 2UV8G 3STFA 3UG5A 1VJSA 4KFOA 2J27A 1D3CA 3WNNA 1KFJA 2FIQA 3CIWA 5GVJA 3W73A 5EMYA 3AXIA 3W85A 3C2RA 3TH6A 2JKAA 4M5PA 2Z1BA 3O1NA 3NL2A 3A23A 3PY2A 1XH2A 3W38A 1EP3A 4H6KA 2YA1A 3CTLA 2D73A 3LCHA 3THAA 1F2JA 1JCLA 1JXJA 3OHIA 2F7FA 3LCXA 2ZTKA 1TPDA 1BG9A 4HHPA 3BUBA 1NFBA 1SQ7A 1RP8A 2ZA1A 4QNEA 2PURA 3EJPA 1I75A 4PA8A 2OCZA 2XWEA 5F2GA 2ZZ3A 5TQLA 2Z2UA 1MEIA 3WEMA 3SI9A 4UC5A 1F05A 4Z1DA 3G3MA 4RXFA 4UFMA 2ALWA 4ZZ9A 4GIAA 3DDFA 1H61A 4Q4KA 4RK8A 1QWNA 3W86A 5AYXA 1LWJA 1KM2A 4J27A 5C55A 2DZTA 3NQDA 1VYSX 1SMDA 1B4KA 3G1VA 3STCA 2A21A 2C1HA 1O60A 2BY2A 3HB9A 4JY9A 1ZAIA 2EHHA 3PBYA 2F84A 3GNDA 3NPXA 5LNSA 3VX0A 3TAKA 2BTMA 2OT0A 1D3GA 4Q32A 1WBJA 3W7NA 4A21A 3IVUA 3UWUA 2J9YA 4O1AA 1K7FA 2TMDA 2FDSA 4GI6A 1K03A 5DCBA 3KOFA 3TW6A 1YPIA 2D2OA 3IJ7A 4AMWA 3QQ0A 4FLRA 3CZSA 1MVYA 1DBTA 4X2RA 1GVQA 2V3DA 3G22A 4O57A 4CNPA 1YYAA 1QX1A 1SZNA 1TCDA 3ZQ9A 1ZCOA 4UTLA 3L4VA 1KBKA 4O16A 4LS1A 2PCQA 2R14A 4JFUA 4XKYA 1BLIA 1OYAA 2NX1A 2VFEA 4ORIA 1RD5A 1S5TA 1RZMA 2XWDA 1UA3A 2VFHA 4MZYA 2EPHA 3MUXA 2V82A 5L9FA 4UTUA 5D02A 4CKQA 1HX0A 1VJIA 1F73A 2C0AA 3M16A 1SPQA 1Q45A 1DOSA 1UB3A 1QPNA 4JNMA 1XDLA 3NPWA 3MBDA 3OA3A 3OBKA 1KGUA 1OFRA 2P1FA 2QMJA 1LBFA 5LNUA 3E9AA 5G1TA 3BAXA 3W7EA 3NL6A 3LBMA 2ZA3A 5AFDA 1XD0A 3QMRA 1I2NA 1LOSA 1CDGA 3MP4A 3MWAA 3VKJA 1I2RA 1QR7A 1EH9A 2Y24A 3O15A 5D37A 3V75A 3VNZA 1NAL1 2RH9A 2ZE0A 2E5DA 3TV8A 3WNLA 3ZOAA 3EDDA 2TSYA 1CLVA 3M47A 3DX0A 5I3GA 1QMLA 2HMCA 4L4MA 3W2NA 2J9ZA 1CGVA 2XN0A 4UTIA 5K9XA 5D2TA 1H5YA 4NX0A 2GJPA 1ZY9A 4ADTA 1KFKA 5J5DA 4JCMA 2QF7A 5TBOA 5HPOA 2GVJA 3DFPA 1OABA 3UWQA 4JDBA 3W1XA 1OGSA 4OU1A 4ATWA 3PWAA 2QCEA 2Q8LA 2LLEA 2Y7DA 4O4VA 3P62A 3WFAA 2QAPA 2OMAA 3KAOA 5AC6A 2CZDA 3W1PA 1XSJA 4O13A 1G7VA 1QO5A 1IXQA 4N2YA 1IXOA 1WQ5A 4BFAA 5AN7A 4TU1A 5LGXA 3GXDA 1FDYA 1QPQA 1KGXA 3IRDA 1AW5A 3MI6A 2A7NA 3CHVA 5F7UA 2I9EA 4FMVA 6TAAA 3FJ6A 3W9ZA 2VEKA 5G1YA 4YCPA 1T8XA 1KFCA 4IJBA 1FWTA 5FEXA 3GBDA 1OT1A 4NUWA 1JCMP 1ZALA 2IQTA 2PRMA 2DZWA 3FJLA 4Y8FA 3GAYA 3TDFA 1NVMA 3EDJA 1ZNNA 3PUOA 2J6XA 1HL8A 3GDMA 1W0MA 2A0NA 3W1UA 2FGZA 5ABTA 4OKDA 3CGTA 2CLHA 2J88A 3TE9A 2Y6ZA 2ZRXA 2EAEA 2XVLA 5D32A 4NJHA 5DCEA 1K7XA 3OLIA 1TRDA 5F1VA 4UNIA 1A5AA 3P84A 1QI5A 1L0PA 1WE5A 3WELA 3W7OA 2FLIA 5AHMA 4NX5A 2WVVA 5I3HA 2ZYFA 4LC8A 2WVVB 1GVRA 3HPZA 1OX4B 3RILA 3GR8A 1X7FA 3N2MA 5T26A 5BRQA 1AK5A 3M44A 4J3XA 3NDOA 2QR6A 3DFTA 4PCFA 1OFAA 4GJ1A 2WOQA 4OT7A 1V7YA 2A4AA 2GQ8A 3K30A 2PWFA 5F2IA 3DHUA 4NI3A 2W0UA 3LTYA 1MZHA 5KEZA 1TB3A 2WKGA 2A2IA 3C56A 4A29A 4QM1A 2CWNA 1TPWA 3VGHA 3KL3A 3STGA 4AXKA 1LDCA 2D0HA 3LHVA 2VEPA 3GK0A 4N6FA 4RXGA 1QPRA 4MZ1A 1F76A 2BHYA 4GRSA 1TTQA 3UNDA 1RPKA 3ZS4A 4NQ1A 1W1ZA 3WMSA 1GWJA 1Q3NA 5FI8A 4JX5A 1BTMA 4IQLA 1TPEA 4FNUA 1PZ3A 4HSNA 2R91A 1XH1A 3W1TA 5F4XA 1IGSA 1C8QA 1J0KA 2DZUA 1KXQA 4JFWA 1JCYA 3WK1A 2ISSA 1BF2A 4FX8A 3CWOX 1LWHA 1F74A 3HBLA 3QMSA 3CT7A 3Q2DA 3BG3A 5FF3A 4JTSA 4WXZA 4RCXA 3W37A 2YKKA 4BI5A 1W3NA 2WKJA 4DF1A 1PHWA 4FIRA 1WA3A 3CLMA 3K8LA 2ZUWA 4CQ9A 2ZUUA 1JFHA 1KW1A 1W5QA 1LRQA 2DH3A 1BWKA 3IEBA 3I65A 2NUWA 1LCOA 3B0VC 3W1RA 3O05A 3P61A 4ORMA 1DHKA 3C4UA 5AHFA 1O5XA 1JCJA 2AAMA 1LZOA 3VSVA 2ABBA 1H7PA 3PVFA 1LTDA 2QAFA 5HDRA 3IGUA 3S1WA 3G0UA 1IIGA 1QNVA 3A47A 1QFEA 2D3NA 4ZQMA 3QYQA 3L0KA 4DPPA 1FDZA 1GVFA 5D2XA 2CLOA 3P67A 4KFPA 5CLWA 3G1AA 4AYGA 4AMAA 1TTIA 1OB0A 4PEKA 5CPLA 4RZ6A 2DU2A 3BUQA 2O7QA 1ZS2A 3NQ8A 3UYCA 1M6JA 1S46A 5HR6A 1QHPA 2WKLA 5DN1A 4MLJA 4H4IA 4NJGA 2Y70A 4O17A 3LRLA 1MWOA 4GUJA 5MHBA 8CGTA 1FXPA 3FS2A 1RQEA 3KLLA 1KLZA 3BH4A 4TVUA 1KM6A 2ISWA 2BHZA 3S1UA 3S5OA 3OVPA 3L4UA 5DXYA 1LYXA 2A7PA 1G4EA 4O14A 5KZEA 1SZEA 4HOWA 1CXFA 2V3FA 5K4XA 3UY7A 1VFOA 1SZGA 3PSWA 3BVWA 3LXAA 1KCKA 8TIMA 4YXGA 1LROA 2YZRA 1QO2A 1LM1A 3OVRA 4YL2A 3QSRA 2C8NA 4CVWA 1M7PA 3LERA 1JQVA 3BLEA 2OYKA 1HL2A 3MP5A 2QCNA 3D52A 1UOKA 4AB4A 4UFKA 4UFLA 3PF3A 1EHAA 3PB0A 1RPXA 2GUUA 2QLYA 3WDIA 3ATYA 4QITA 4X0NA 1A53A 1R2TA 2Q8ZA 3QFEA 4IXHA 3CM4A 3VGEA 3HPXA 2ZXDA 3VMOA 1SW7A 1YTKA 3P5YA 3NZRA 2QCHA 1YDNA 2WPGA 4CCEA 5EMUA 1B4EA 1MO0A 2RDTA 2PE4A 2WSYA 4OV9A 3LX9A 3C2VA 3EB2A 1QOQA 2Y5EA 3MHUA 4B5NA 5E1QA 2A85A 4S2CA 2PWDA 3IV3A 5EBUA 3VGGA 1GJPA 1MW2A 2G3MA 5HWJA 5D05A 1HWWA 4NNAA 3TK7A 1QDSA 4JIQA 4CN1A 2WNZA 2BLEA 5F4WA 4QSHA 3GB6A 2C7FA 2FHFA 3VI2A 3DKJA 4AWUA 4AHQA 5A2AA 2V8ZA 5A5WA 4WY0B 1EA0A 4UQ9A 3D51A 2ZZ7A 4E0CA 3GTNA 4MKNA 1GTHA 5AYYA 3GYEA 5G2WA 1KXVA 3WDHA 2FB2A 4J3UA 1MXSA 3RLVA 1H1YA 1PV8A 1JVNA 1EO7A 3GXFA 3C52A 3GKFA 1GYNA 1LLZA 3N19B 3GKAA 3L4ZA 3HF3A 1FCQA 1V3KA 2CPUA 2ZZ5A 4CNNA 1DQXA 3LV6A 2ZWZA 2OW7A 3DHPA 4Z1AA 3MI2A 3EJUA 4J7RA 1EP1A 3TKFA 1I4NA 3EWZA 5LNWA 5A2BA 1XUZA 1J0JA 3C6CA 4BF9A 3BVUA 2JK2A 3FAXA 4KFNA 3CC1A 5E93A 4HSOA 5A8GA 1FCUA 1KV8A 4UIOA 4JL2A 1G67A 1AW1A 4PC8A 3TSBA 4DBDA 5F2LA 1PHQA 1KTCA 3SECA 3BGJA 1OFDA 1QW9A 3TQ0A 3GAKA 1GEQA 4N9CA 1GQNA 5KTLA 5CSSA 4MLRA 4N4PA 2ZQ0A 1SO5A 4NT0A 2ZUVA 1YXDA 4UQAA 4XBKA 4HPJA 1QPKA 3KRSA 3BG9A 2NV1A 2DZPA 4ML9A 1AMYA 1OFQA 3QSTA 3B4UA 4LW7A 1TRIA 2E9BA 2FH8A 5CZTA 3FIGA 2J24A 3VE9A 3QRHA 3PR2A 4JS3A 1UUMA 4TO8A 2VRQA 2ATMA 2ZZ1A 4LT9A 2HTMA 4O4WA 2QCGA 1Q6OA 2WO5A 3LBCA 1JDAA 3PS7A 4K8HA 5HMSA 3II1A 2B0MA 1H7RA 3G3DA 3WJWA 1NOFA 5FEZA 4AF0B 3A22A 1XBVA 3UQNA 5LKYA 1TV8A 1H7OA 4K6AA 2BXYA 1OJXA 1TQXA 3QEZA 1JF6A 2AQWA 5HINA 1UH4A 3OVQA 4R33A 2Y4SA 1QAPA 3BK0A 4FNQA 4FIQA 1VHCA 2WNNA 1P0KA 1KA9F 4DELA 1JR1A 3DC0A 1L6WA 3LHZA 4MJMA 6CGTA 5CZ0A 4MYXA 3Q37A 5FF0A 4IX0A 4OHQA 3G0SA 3QPYA 4X9SA 5DY2A 1SO6A 3G1DA 1BVNP 1GOXA 3EXTA 3GXTA 1TV5A 3KFTA 3EWXA 3GX9A 4IMEA 4Y96A 4O0KA 3PSVA 2E8ZA 1E3XA 1P5BA 2EF9A 4MY1A 3N9RA 2VFGA 1Q6QA 3I7SA 3L9CA 3RK8A 1H7NA 5E70A 2GVLA 1WZKA 4FLQA 1TO3A 2NWRA 2R94A 4JYEA 3LCGA 1JDDA 4XUGA 1OK6A 1P6WA 3QMTA 4IOTA 2ALDA 2ZXQA 3W7PA 4X3ZA 1TJPA 5CGQA 4IMCA 2F7RA 1R34A 2FPVA 2A7RA 5CLTA 3BVXA 4MZ8A 1BKSA 1BVZA 1HXKA 1AVAA 1TQVA 3NNTA 4M7TA 5LGZA 4JN6A 2FPTA 5G4EA 4CGTA 4NJIA 1C8VA 4CCDA 2V3EA 1LORA 4UQCA 1HVXA 3MHGA 3A5VA 4Y90A 1OX5A 1CXIA 1JI2A 2Y88A 4O10A 2FE0A 4J28A 3OG3A 4UCGA 1IV8A 4LV4A 1P0NA 1XD1A 3W84A 1UCWA 5LNRA 4XZ9A 2YOCA 3F4WA 4IPIA 5A6LA 5F2MA 4AVFA 4FNRA 3DBPA 4FLSA 3RU6A 2CLIA 1TJRA 3GR7A 3M5XA 1W3IA 2YW3A 5I3IA 3S42A 4WSKA 1J0HA 1SSGA 3LLDA 1MW3A 2V81A 4O18A 1V3LA 2WSPA 5KZDA 2H8ZA 1G4PA 1TQJA 1H3GA 4UNLA 2D0FA 4GO8A 5BRPA 1NM9A 3BLKA 4CNOA 3BMVA 2CZ5A 2JBMA 2ZCGA 3VO0A 3WK2A 4UMAA 2C14A 3V1PA 3W70A 2FYVA 3GZ3A 1GTEA 1XV8A 3EKZA 1MXDA 2H90A 2ZICA 2F1AA 3WFZA 5I24A 3BVVA 3BLIA 3U8GA 4GFSA 4GUFA 1TQSA 3VMNA 3TUUA 4UFHA 2QMKA 4NNBA 2EEXA 1VGAA 4WZHA 4JCLA 4WUIA 1KTBA 3W2MA 3R13A 1T96A 1GVSA 3W7CA 4U2ZA 3CZGA 3R5EA 1LOQA 4HIBA 4X9YA 1ZENA 3NGJA 1ME7A 3LHYA 2QUUA 3A4AA 1SO4A 1KM0A 1I2PA 3FA5A 2EQDA 2YYTA 4GWEA 4PL2A 3LHUA 5HULA 1TPUA 5FEPA 4ALDA 1W9XA 2ZFAA 4WY0A 2WJZA 3ABSA 3VNDA 3EJQA 3NL5A 1AQMA 2WPBA 1B3OA 1VIWA 2VOMA 3HO8A 2HS6A 3MHFA 1PL9A 4CQAA 3N73A 3E49A 1FCVA 3W3OA 3W2JA 5A6MA 4K36A 2JGQA 3W88A 2YFNA 4AH7A 4JEQA 3I68A 3TTSA 1QWUA 2ZWYA 1W31A 2BZNA 4BR1A 2BSLA 3HGOA 3TA6A 3N2XA 4AHPA 3QW3A 3ZR4A 1PEZA 4YWIA 2PWEA 3TX9A 2DZSA 3UZJA 1QHOA 1ICQA 2F7PA 1CXEA 5HQEA 1KBJA 5C54A 3WJXA 2W6RA 3L5AA 3M6YA 1VCFA 1H7XA 3L66A 5D2YA 3STEA 2ZRVA 4DO4A 4O0ZA 4UTWC 1ALDA 4AMXA 2VFDA 3UEQA 4JIPA 1TQWA 4TMBA 1ZJIA 3HOJA 3BW4A 4BI6A 1R47A 4H3DA 3I7QA 3NO5A 3C3NA 1BEUA 2F2HA 3HG4A 3EEGA 3G1YA 1DTUA 2B7PA 2OSWA 2R8WA 2ZUTA 2AAAA 2QJGA 1ZJBA 1VYPX 2QCLA 4U4MA 2NX9A 2Y63A 3L5MA 1WDWA 3WY4A 2XN1A 4JY8A 3LI0A 1FBAA 3DX2A 4POCA 1R2SA 3I6RA 3K8KA 1KBIA 1A47A 2CLLA 1UD4A 4ZQOA 3G8RA 4UXDA 1R30A 5LNVA 1CIUA 1H60A 4JYFA 3W1NA 2NT1A 1W3TA 1GYLA 1P4CA 1VYRA 3BAKA 2F1BA 3W2LA 1PVNA 4J9JA 3NZ1A 3KRUA 3T78A 2YX0A 3C2OA 1E40A 1DVJA 4OV4A 1AQHA 4A2SA 1QOPA 3DX1A 2VENA 2DP3A 3CPRA 4MOZA 2ZZ6A 3W83A 4HOZA 1ICPA 1UD2A 4LS0A 1T0OA 2BY3A 1OYBA 3B05A 2KZHA 5D2VA 4AEOA 1UD8A 4AF0A 1SUXA 1U83A 3AO0A 4PCTA 4OIFA 3LCWA 2DH2A 4UQEA 4A3UA 2VUYA 5CPNA 3O16A 4EF9A 4LQ1A 4O15A 1DQWA 1K02A 3U2OA 4S1FA 1FXQA 3KLKA 3WJYA 5E6YA 1X1ZA 1PIIA 3MYPA 2CHNA 1VQTA 3LCLA 1SO3A 3VCRA 1WAUA 2O7SA 3NQ7A 3JS3A 2AGKA 4UTKA 4FB7A 3UD6A 5A2CA 1NF0A 1VR6A 3QJAA 3TMQA 2C6QA 3BW3A 4WXYA 1V3JA 4WD0A 1OSEA 3LPPA 1RR2A 4EWND 1HTIA 3O8AA 1JCXA 3KE0A 3IIOA 1W56A 3LM7A 4KWVA 1VS1A 3EX2A 1WZLA 1IIHA 3B0UX 1K8ZA 3INPA 3R2GA 2NUYA 4WX2A 3W76A 1Z48A 4K37A 1JRCA 1Q6LA 1WV2A 2B7OA 3NM3A
chains in the Genus database with same CATH superfamily
5IB5B 4HUVB 5C0GA 7TAAA 4JFFD 4MUZA 1G9NH 2QPUA 1LL1A 5EDXA 4IS6B 3MANA 2WP3O 2V2XB 2P7TA 5LSMA 4KJYB 4M7JL 3ZLHA 5TH2B 2DVUA 3ATAA 3ITXA 5AKSA 1A2YB 3S36X 4JD4A 4A7SA 4WJEA 3MYJA 3FQXB 2EVFA 3ZKQD 1NM4A 4PVLA 2X0WA 3G5VA 3QXTA 1KCRH 4ZPVB 4AWJC 5GNXA 5ICZB 1OAYL 5ITBH 1UXWA 4F93B 2OMVA 3FT9A 3LS4H 4FLOA 2XVKA 4GJTB 4P59H 4WTXA 5D7KE 5INDA 5K1VA 3ZYIA 3IDMA 3HAEH 2VZ3A 4R4FH 4IRZL 3EMCA 4KI5C 4UTTC 4HZLA 1QK2A 2Y6SD 3NSCA 3HZ3A 4JJHA 3Q5TA 3C8FA 4C5ZA 4A37A 1OK8A 1VCGA 1XDJA 2BVUA 1R3KB 3D25B 3DX7B 1Q6DA 2DMKA 1ASPA 2WB1A 1A4LA 2UV3A 4HEMA 3U0WL 2FKPA 4PJEE 1DUYB 1KCSL 3OIXA 4GG6E 1MDRA 2GKIA 2AK4D 3N3MA 3BUPA 2A38A 1WGVA 3FONA 4JE4B 3D3AA 4KVCL 3CUIA 3VUAA 2X5PA 4P2QD 3OPZL 3PZ9A 5T1LB 1M3JA 3D4GA 2YL6A 2IOIA 4ZJ9A 1A5LC 2QZRA 3QZEA 4JR5A 4WNQB 3RKDD 4KQNA 2EDRA 4AEIL 2VELA 4Z7NB 5DMMA 5HPMB 4EOUA 5FL1A 3F5WB 5EZJB 4F9LA 4DGWC 2F68X 3U2ZA 1N55A 3TZFA 4Z7OE 4HZ1A 3V0EA 2R24A 4XBEH 3CUXA 4M61B 3QCUH 3X3GH 2BVDA 2NCMA 3JV4B 3GK8L 4J4PA 3MOBL 2A1WH 3LSOA 3O4LD 2OMTA 4RGMB 4YDJA 4FQXC 3UETA 4FQIH 3VVVA 1QWHA 1DLFH 1SQMA 1QPPA 2NPLX 1NCWH 4IIFA 3MRPA 7FABL 3J07A 2XJKA 3SQOL 1VF8A 4D2NA 4ICMA 3OB8A 2G60L 1GW6A 4JFHD 1AD4A 3K4WA 2VZ1A 2EEBA 4PR5A 4B4FA 1FY6A 3RJXA 4F79A 2B1HH 5LCVH 4F58H 4OU3A 3QV9A 4OFKA 5FAJA 5A8GA 1H9VA 1I1YA 2WJDA 3G0XA 4PRPE 4Z3EA 5MKGA 2X8RA 1EA9C 4QHNB 2O4QA 3W29A 5ID0A 5J9PB 1JG9A 3K6DA 5CSBA 1IQDA 3S0CA 3PULA 4FMFA 4LCCA 4MCYB 3KCOA 4ODVL 2Q71A 4S3DA 3CIXA 2P53A 1IAIL 4UNTA 3ARGC 3LZFL 2TAAA 4FJZA 4HK0A 1F4AA 3RL2A 4B27A 5AFAA 3AWOA 2JQZA 5L6UA 2CXGA 2BVEA 1ESWA 1HEZB 4AGMA 2HFEB 5SWSA 1CFMA 2VCOA 5ABAA 6ALDA 1XCQB 1VFFA 5ADPH 5GJPA 2C1GA 5DK0B 3ZUNC 3ZJ7A 4YUEH 1KD0A 3N9SA 3P8IA 1U3HD 3GZPA 3HS0B 4QLJA 2YIHA 1OVDA 2X1IA 3BQUD 1CWVA 2I7SA 1CFNB 1H8SA 2PKDA 4LDLB 3HUJF 4WUKL 5BVJB 2Y7FA 3R0KA 4DCQA 5FSDC 3NUKA 3WQEA 4KDVA 1S2AA 2WCGA 5D4JA 3U2JA 4DEWA 3C60A 1MUCA 4MZ2A 1O9VA 1RUPL 3QIBC 5TDPA 2GSIB 1ML1A 2BBFA 3D3FA 4I8DA 4GRWB 4PUEA 3IVTA 3L4TA 3QGVA 5KW9H 3L08A 4I9WE 1FRGH 2VDQL 1ID5I 3PWUB 3RUGF 2C3XA 4GABA 5BV7C 2QEJA 2Q6WB 1MJJB 4D0BB 3R0NA 4KMTL 4AOFA 5PCYA 3F12A 4EDXB 3U7VA 3VFGL 3SPGA 4HPHA 2OXGA 1DIDA 3W7HA 4E4PA 2ZCKL 4ENLA 1FZOB 2GITA 2FHCA 2XY1A 3EHBB 1RZQA 3B1UA 4PW4A 5IR1A 4J3OH 3UU0A 2NUXA 3PG2A 3VNKA 3HIJA 2BNJA 2R0KH 4A6YA 4I48A 1ZBCA 2KI6A 4N6EA 2VXNA 1MRCH 1LL6A 4Y8AA 3TURA 1IBDA 3EOEA 4PV1C 4U10A 1DL7L 1NMBH 3E6FA 2EXYD 3IPBA 4IKJA 4OUUB 2ZC8A 3XINA 3GUFA 4NO3B 2PBGA 2E76C 3RJYA 3K3QA 3SCTA 1ME8A 3SHSA 5I1JH 1YE4A 1V7ML 4DUVA 3HV8A 3LMJL 1U21A 5BRZA 3HZYB 2P50A 2XIDA 5EUKA 3E6HA 2WQPA 2EXSA 1G7PA 1ZCRA 3A6OA 1HKFA 2F53D 5E99L 5AZ2H 5I76B 1HZYA 2MNUA 5AALA 4YFLF 1EUNA 3EXSA 4M93B 2FUQA 3QQ3B 1U8LA 3T8VA 3WTTA 4P61A 3MA7A 1HP4A 4JMXA 1ECYA 4XE5B 1PS9A 3SYCA 1MCJA 2GSGA 1N6UA 3D12B 4M7LL 3UAJC 4NZDA 3H42H 4PP1C 5GGRA 1WYIA 3LCIA 4MPQA 5T3XD 1P43A 3QG7H 3GVQA 1AZRA 3QOMA 1F5WA 4R5XA 4K38A 4Z7WA 3DHDA 4GFTB 3L67A 1QBML 2CGRH 4NQUA 3IRCA 4YLBA 4AMKH 2OXHA 5DJYB 1LDPL 2D2HA 1CT8B 1ZLDA 3ALGA 4YSTA 3I6EA 4PY7A 4AT6A 3PQYE 2H4EA 4PJIF 5EBWA 3UH8A 1FNSH 2D9CA 5CBAA 2GGJA 1C5BH 3T3PB 3FO0L 1G7QA 2Q8BH 1EXUA 3L2MA 3N18A 3WKMH 1S9YB 3VWKD 1DR9A 5JZ7C 2E77A 4HJEA 3RWJB 1EC9A 1NGXA 2F54D 2NY4B 1M05B 4KRPB 5FLUA 3S4SG 4KJQC 4KRMB 4BFEA 1WBYB 4EDWH 2ETWA 1SNRA 4WHDA 3M5YA 3TW9A 2X2YA 2BWDA 3CC5B 3U30C 5J57B 3OKYA 1HJSA 1RCOB 4MMWA 2Z0BA 4HUUA 1OP3K 4IKKA 4GG6B 1O5DT 1PNCA 1LEKB 2DDQL 3RMEA 1WEJH 2AEIT 3QUZA 5EZIL 3C2AL 3EJRA 1X4ZA 3AHTA 3V5DA 2PC4A 1NCCH 1EGMA 4XGZB 1CTOA 4P04A 1PZ2A 4TL4A 4UMSA 5AC8A 4ELMF 3CHRA 3LEVL 3WQ5A 4B2DA 1G6RA 4X8JB 1TCMA 5IHZB 3SOBL 3Q5OA 5J3HD 3V7AE 3W7IA 3O0KA 1XYLA 2JV6A 1D9KD 1OE2A 5C5YA 3LKPB 2EKSB 1BXUA 3GSRA 3LGGA 1OP4A 3WG6A 4L4TD 1SVCP 4LSTH 4XNZC 4X6BB 5CHNA 3R43A 2DZVA 4GUGA 1NBZB 5B80A 1PD1A 5IJVB 2XV2A 3VFTA 1TYEB 5KBLA 1L9RA 1Z9OA 4RFEB 2PLJA 4JB9H 5CS7A 4Y16A 5INCA 4A38A 2IMNA 3CZJA 3RPTA 4DEFA 5CBEA 5A69A 1MFBL 3GSRB 1UW9A 1TQTA 4O5LL 5KBPA 5LXEA 3MU7A 1KYOK 4MXQC 3WEOA 1FI8C 3UWZA 1D5ZA 3CFEB 2L04A 4C56B 2JGYA 3UAJA 5BWAA 4E3VA 1ZANH 3X1BA 2NZLA 3SYAA 5L2JA 4X8JA 5IHZA 1MKFA 1BKHA 3FTWA 1ZAHA 4G8EB 3NFUA 2X2JA 5ABHA 2OJEB 1PX8A 2UY3A 4EANA 2TRYA 1Y7VA 1YJDL 4LCYA 2HNHA 2E68A 1WTGT 1FGNH 3ES7A 2Q2EB 2ICWJ 2CJ3A 3OTTA 4JOMA 4YDIL 3B2PA 4DZAA 3S4SA 3E8VA 3RNDA 5DSCB 3SE3C 4RDVA 2DLGA 1AP2A 4KJPC 4WY7L 3RDJA 5CINH 1M71B 3MRBA 4NJ9H 2Z7GA 4J35A 2QPSA 3UG3A 3UX9B 2ATAA 4QHRA 2ADFL 3AIRA 5DY3A 4JFYA 1RA0A 4O2EB 4H6RA 1ITXA 1EQWA 4HLZG 3QA3A 3FB8A 4BFJA 1SZFA 7CGTA 4DO5A 4YBHA 3LB0A 3LHTA 3HRPA 4ZUVB 1ROWA 4HT1L 4BKTC 1GONA 2O5NA 4IKNA 2Z31B 1N68A 5DZJA 4F9JA 3QCUL 4QF1A 2FDSA 2APTA 1UUOA 3W7QA 2A1WL 2CUIA 2PDWA 1K4GA 1Q9OB 4AQZA 4ZODA 4PB5A 4KKPA 2MJWA 4HSQA 2Y62A 1POKA 5GIRA 2V9UA 5GGRB 3A9IA 3MA9H 2A6LA 2G60H 2PZ0A 1EWDA 4HU3A 3WH6A 4MADA 1KN2L 5F1NB 4G42B 5C7XH 2QKIC 1I7UA 4LCYB 1FHVA 1MEWA 5I77A 5BQ7B 4GRLB 3U79A 1PNDA 2ZA2A 2G95A 4V28A 3E6HB 3PHOA 1AOHA 4UT7L 4WEBL 2IPUG 1QCWA 2QVHA 3T40A 5L8KB 3TJLA 3WBWA 3HMWL 1FOBA 4FFWC 3N91A 3FUMA 1CICA 2E6FA 4BQBA 1KJ2B 1JK9B 3MSPA 3CB8A 5JORB 4IM8A 1AGFA 1RAMA 2JKPA 3HM7A 1IBHA 4MWAE 4KMQA 4GG8B 2QVFB 4G8GD 1YEWA 1UUNA 3WQOA 4LOFA 4FXSA 3FW6A 3NCMA 4C6EA 1S3KH 4L8BA 4N2FA 2G5BB 5E9AA 3D0LA 1HH9A 4F7CB 3ZFHA 8XIAA 1KM5A 2Z24A 3MR9A 1U8JA 1PE1A 3UAFA 4MY9A 5HGHA 1NF7A 2FGLA 1CTNA 1OCCB 4NKMB 1Q6CA 4XNZB 3BPLC 3UZZA 5FCUH 3OJVC 3ILQC 3QC5X 3UVIA 3K81A 4EVNA 1WD9A 3EJSA 3DV6B 1LE5A 3IDNA 4C4KO 4HK6A 3SZ8A 1OCWH 4OR1A 4AGQA 2WQAA 4NBZB 5JYMA 3BZFA 5KSAD 5T3XH 1N8OE 3OZKA 5F7HA 4CSTA 4R88A 2WWDA 5I16A 3BEVA 4XZUB 3UC0L 3VIJA 3AHVA 4OF0A 2YCIX 4ZTPL 2ZNXA 2V67A 2Y0FA 3AUJA 3W1QA 1M5WA 1Q2RA 2PPFA 3TN0B 3KLSA 5EU6E 5JR1H 1FFNA 3LCYA 4PGZA 1A8ZA 1R3WA 1BECA 3TBVA 1ETB1 3IIPA 3O6FA 4AYSA 3S9ZA 1WBYA 1Z9MA 2W92A 3LNPA 3CU7A 4LNYA 4ACZB 3MWCA 4NZJA 5EUOA 4K8EA 4Z0BL 5E2VH 1A6VL 3EYSH 3EZ8A 1GL4B 1NBVL 4BRJA 4ANUA 2EZ0C 2FEDD 4BQ9A 5EEWA 3ARFD 3NJ3A 5D1XC 2I7OA 5JPMC 3D39B 2FJGA 1IBGH 2CCVA 2LAAA 1XXDC 3BAJA 3N1PC 4NJAH 5C0FB 2YDAA 3CL7A 3Q58A 4YHLH 2C1PB 3TFBA 1NH6A 1J48A 5ETUB 4B97A 3TC6A 5I18L 3URQA 3W01A 1SXAA 4ZRGA 4DAGH 1FIGH 3L7FB 5FFOA 2CERA 3U83A 3NSXA 2VXQH 2H32H 5AHIA 1KF9B 1PPIA 4TLTA 4JQAA 2DQDL 3SQRA 3B6SB 2WXJA 4C6QA 1SEBA 3NURA 2B59A 1YQ2A 1WAWA 1U8PB 5CCKL 3MA7B 1QU4A 1VFMA 4NFDA 4M1CC 1E0VA 4ROPA 4M24A 1HKIA 2Y5JA 3F7KA 4EF8A 1T04B 4GKSA 1AMXA 1YYLH 2DPKA 5IVZB 4BCZA 4CN4A 5AENA 5EFIB 3ALWA 3N04A 5EZJA 1W5PA 2FZNA 1J79A 3HUJB 4OFQA 1G7LB 3TH2T 3BMWA 3D4YA 2QDGA 2KC0A 1XLMA 3MV8E 4ZFOL 2BMKB 2ENYA 4GP5B 3AG3B 5CSRA 3OEXA 4BQCA 4FXKC 2Z92A 1CG9A 2CJUH 2VDOL 3LPGA 3QM3A 3TC7A 4RMUA 1J4EA 4MNQD 4DJFA 1FNEA 4RZ5A 2XPYA 1R1CA 3AT8A 3C86A 5SWZE 2F0CA 4OZIF 1X6LA 3B9KC 2XIBA 1F8IA 5L4IA 4GA8A 4EDXA 4AIOA 1M7JA 3SBWA 2Z9TA 1AHWA 4JPKH 1XHGA 2AK4A 2YJLA 3Q2CA 1MCHA 1ZKAA 2EH8L 4ATLA 1WIOA 2XV0A 3ZDYE 4NZ1A 3QJZA 4OM1L 5I5IA 1FCBA 4ELMB 1KSRA 2OMVB 1BLNA 2QSCH 4HF5H 4WFFD 1BQLL 3PS6A 3V6ZB 4LBSA 3BI9X 5C09B 4HJGB 3X3GL 4G1EB 3IVKA 4XNXL 5CKSA 5HD8C 4D8PA 4GG6F 3FB7A 5AZEL 1EZLA 1DQKA 2EXWD 2VAAA 2ZF9A 1G94A 4NP9A 5CJXA 4GSRA 4L61A 1ADOA 1ZEAH 3BJSA 3IEAA 4KJYA 1UXLA 7FABH 5HXMA 2OZ4L 3QEQE 4MD4B 1E4LA 4LQFH 2O9OA 2HV5A 2APWA 2PPCA 3RBGA 4C1NB 4HGWA 4L3AA 5FAAA 3T6WA 3TCLA 2Z35B 4ZFGH 1IEQA 5AYQA 1P1XA 3RL2B 3TFXA 3W2NA 2IDFA 3HNVH 1N5YL 3P8JA 3GSXA 2PRLA 2AQTA 1NEZB 4DOHE 1EX5A 3TZVC 2EIDA 3IWVA 1M7DA 1FBIL 4JREB 2VKXA 2WINB 3FKKA 3HG1D 2F54B 4N0CC 3VYPA 1JZEA 1IBYA 2ZZ2A 4GP8B 4H0HB 4JHVA 1XF5A 4NT6B 1XC6A 2WV8A 5E0CA 3B9VA 4R2GB 3SIMA 3L3IB 2YD8A 3PFQA 3UJSA 1ICSA 2AC0A 1UA6L 2C3VA 2ZF8A 3LQAC 4PR5B 5HI3C 5T5FL 4YBLC 4IU2A 4P46B 3SGJA 2FX7H 3GZOA 1K9DA 4GT0A 4UTJA 1XYBA 4FFVD 3IE4A 5IBUB 1WICA 3NACL 5B21A 3C3UA 4R53A 1BZQK 4NO2B 2Y2WA 3QHZH 3LSOB 4P2YA 1R3HB 4N0UA 3DCPA 4YCOA 1E3ZA 3NTCL 4FXRA 4LSVH 4APQD 3BT2H 3PDOB 4M61A 2ACSA 2FR4A 2JIXD 3FFCA 4F2TA 2DLIA 1FPTH 3IFNL 4NQEB 1H0IA 5E24E 1FNAA 3WNMA 4PMRA 5J4MA 1NAMH 5HPMA 3DFSA 1GZGA 3RNKB 2FZ3A 3R8RA 3IIXA 4NUQA 4UT6A 3B9EA 4JTJA 4H9VA 1L6SA 2CETA 3CQPA 3V0AC 3N34A 2DQGH 1TJHL 2G2RA 3VI4E 3KLQA 1AHWC 4I9AA 4NNCA 1JV2B 4ODVH 2WO4A 2MMXA 4Y4FA 2QZQA 2NXIA 1NDWA 4ZSUA 1Z6JT 5HVHC 1YDOA 1OQXA 5BNXD 1NFDE 1CZ8L 1R3KA 4EI5C 4R97B 4LAMA 2D4FA 3AXHA 5BJTB 4YTTA 3S2NA 1MRCL 3OGVA 1R17A 4BDVB 4HZLB 5LXGH 1Q5MA 2AGTA 5IBTH 1DL7H 1NMBL 3GMQA 2P88A 2XFGB 1TELA 4BQ2A 4PFEA 2PWHA 1J10A 1YBQA 1CF8L 2Y7SA 1K8YA 2DSVA 2C9UA 2J79A 4HNOA 2AJXL 4S3KA 2X1SA 1DBAH 2A3TA 1W72B 4POZC 5HGAA 2GSHA 2BPBA 3CSYB 3G6LA 1V10A 5C08B 1REQB 3NYDA 2WWOA 3R58A 3RLUA 4PRHE 4PRHA 4U31A 5D71H 1HJWA 5CJ5A 5C0BD 3GTFA 2H8PA 4A2LA 3TCXA 4RW3A 3RY6A 3GO2A 3WY1A 4TX6A 4AI7A 4G9PA 4ECLA 4XCEB 4JFZH 1IZKA 4W9EC 4E42A 3NIFF 1FA2A 3MNVA 1JZIA 4F0RA 1S8DB 1JGUH 1EXHA 2VDNB 4BBWA 4HUVA 2X0VA 1ME9A 2YPVL 4LANA 5HHPA 4PSPA 43C9B 2JKNA 4AL8L 1D6EB 1PZ0A 3TMLA 4G9FE 4YDZA 2JELL 2FH6A 3ESUF 4PJDF 4YX2L 2D0GA 3L2IA 4TX9A 1ENUA 4HPYL 2X9ZA 3LXBA 2Q20A 4KV5E 4ODUA 1T1XA 4ES9A 4JTGA 2BJMH 4HGKC 4KZDH 4KZ0A 3NJIA 4YIQB 1UZ8A 3VH8B 4ZVJA 4UIKH 1M1XB 5E08H 1NLBH 4JY5L 1VADB 3CHPA 2V3GA 4P46C 4U3SA 1LF1A 1S7XB 3KRZA 2O5ZH 5E9NA 2PDHA 1KB5B 3ERXA 3O3RA 2R27A 4AC2A 1UKSA 3GJFK 1UA7A 4MZIA 1COBA 4OOZA 1PW3A 4PJDA 2CRZA 4CU6A 2YGYA 4GUPA 5IB1A 3WUEA 4WLCA 3S83A 3B2DC 4IMFA 3AQUA 2IPWA 1G6RL 1URIA 3ITCA 3R8GA 2VW6A 2CIKB 3QQ4A 1E0UA 4Z7NF 1C3FA 5BU9A 1IBGL 5D7JD 1E4XL 4YEEA 1E5JA 2FO8A 3RX8A 4F27A 1H51A 1P7TA 4UR8A 2C9RA 1JQXA 1WFNA 5B39A 1IM3A 2K7QA 4NO5A 3MSGA 4XVDA 3LLFA 4PGJA 2XV3A 5DMIH 4AJVA 1DVFB 3NCWA 1RHHB 2WVSA 1FHLA 2Q6ZA 3BIAX 3QV7A 1B0RA 4XRCA 4J2MA 6REQA 4DZ8A 2QPDB 1AC6A 3S88L 4ZGYA 5KYUA 1WUEA 4EO5A 4LKCA 1EGJL 1RUSA 4UAHA 4MA1B 1Q94B 5C07E 4BK4A 4XX1E 4M6QA 5DBUA 1N7KA 4Y5YC 3O2DH 1V3HA 4JW3A 3W82A 4YDLC 4LLQA 1PYWB 4NRXA 4PJCE 3V0UA 1OAKH 3UJIH 2FMOA 2WAHA 4EIBA 1RSFA 5IIEA 1XKYA 3SBRA 3D0VA 4AGNA 2OSXA 5AYIA 1Z41A 4XHJC 3NJLA 2ON3A 1SMOA 1GIGL 4BYHA 4AZHA 3KLAB 2V8LA 3L3HB 2LABA 5KS9B 2DJLA 2PGFA 4WVXA 3H6AA 1P7TB 1ZVYA 1JPSH 3MMUA 5IB4B 1KCWA 4BWLC 2Z4TA 2H8XA 1KJ2L 3PBGA 2Q8BL 2FRGP 3RZCB 3WO4C 3ZKMD 2WZIA 2EUZA 3LNMA 3QZAA 3SKJH 5EL1A 3BCDA 2FWOA 4G80A 3QQ4B 4PHZA 4YHIA 3EOUA 3KVLA 1JNNH 4IUGA 1BVWA 5JNYA 2OV0A 4H2AA 1LO5B 4XTRC 3T05A 2DD8H 4YQXL 3I6GB 3HKZA 3W7DA 1GYVA 1B3VA 3TTQA 4DI9A 1DN0B 2OZ0A 2NSXA 4LTSA 25C8H 4UINL 4M56A 2F38A 3UDWA 4XZWA 4PJDB 4MJIB 4RMSA 1MLBA 2Z64C 1AGEB 4L9LA 3O9NA 1BD2A 1DN2A 3P2VA 3RO8A 2UUDK 2WC7A 3HZKB 4GBXA 4IU3B 1R2RA 4NNYB 1MCCA 2DQXA 3EGSB 2VEMA 3AWNA 2DV6A 3NSMA 2VX4A 3WLJA 3PDDA 1MQRA 2E59A 2YAQA 1UYQA 3FH8A 2UYLB 4RWYH 3MX0A 4YIQA 4RBPH 3RITA 1UWFA 2GYSA 4OBSA 2BY1A 3GYRA 5AZEH 3GW3A 2EXTA 3AS1A 3FTYA 4LFYA 4UTAA 2E1DA 7TIMA 3S6CA 1G4TA 3OM3B 3MAWA 3BSHA 4LHUA 1KCVL 3VXRA 2ORBH 1UMLA 5D1XB 1RJLA 4WFHE 2NY0B 2KPWA 3WLBB 4AY1A 3BVTA 1W32A 1XIWD 3K8MA 4LLDA 3P81A 5KSVB 3MUCA 1B3IA 2ZJSH 1BBDH 1RU9L 4PWKA 3SD2A 4E42B 5CD3A 1NCTA 3CU2A 3P7YA 4GYKA 5L8LB 5A6SA 5JW3L 4J3ZA 2HT2C 3BEWB 4J39A 2VNCA 3UABA 2IFFL 1JTOA 1BWMA 1T66C 2ZOTA 2VDPH 5T5NG 2J8FA 1KFBA 3TR9A 2NQCA 3ISWA 2AEPL 3KS6A 3PG9A 1M01A 3BPWA 5SX5H 3K1DA 1ERNA 2V2CA 2VQ1B 5CXPA 1OARH 2EUWA 3I9GH 4FTVB 3C60C 3EBAA 2BVQA 1DFBH 3OG4B 4UAOB 2EUVA 1RY8A 1T99A 1WP6A 1HJQA 1M7XA 3FK4A 1IZJA 3C2EA 3WL9B 4NM4H 3FB5B 1N12A 2XG5B 3B8DA 3FYOA 2ZXBA 4UZSA 2ZSWB 1ZLVH 1HT6A 2XTJD 1HSAB 2MOVA 5IB3B 4LESA 4ZAKA 5F6HI 1DV7A 1FZKB 4FYSA 1MRAA 2QJHA 4AXWA 2WMGA 2JCCB 4B0MB 2FQDA 3BMXA 4GI8A 1JDCA 4H8HA 1XUUA 3A3XA 3W0WA 2PCPA 3F4DA 2E40A 2ZUMA 2E46A 2BM3A 2BS8A 1FRBA 5HNNA 5AC7A 4UBDC 4WI4A 3EGDA 3F64A 1D8WA 2YZ5A 4X4YA 4F3HA 2UY4A 1BGXL 3FUDA 4XCNB 2HYMA 4EOWL 1AXTH 1N5AB 1QVOA 3O45A 4KVPA 1Q9KB 4E0RA 1FFOB 2NY6C 2PTZA 4N5EC 5HHOD 1ESOA 1PMYA 3OKLB 1IM9A 1JI1A 1UM4L 3QEUA 5CNHA 2HJPA 2X7VA 5LO7A 3LXCA 4CGUB 1R3HA 1HEHC 5TJWK 1OK4A 1RBLA 4KETA 4U2YA 3DH7A 1R46A 4YHEA 3C6SA 3R10A 3ARDB 3MLUH 4QWWC 1Z3NA 3WFLA 3FCGA 3LD8B 2IKIA 5EA9A 2EDMA 1BEYL 3IDJA 1GGBH 4NY2A 1IKNC 3WFCH 3R8BB 5K9KA 1J9CT 3Q3GB 5JLZB 2ED9A 3O6FD 4MWAA 3TYUA 1YECH 2VDNL 5DJ6B 4CMHC 4Y19D 5AKTA 2AOSA 3L3IA 1BQRA 2HT3D 3DXAD 4WGKA 5D8JH 5IWLA 1TETH 3CV5A 4APQB 2EO9A 4OIIH 1TIUA 5GGRY 5HY9A 4YC2C 1OFBA 4U6HB 1YE6A 3IETB 3PM6A 4DHGA 4DQWA 1BG4A 4AVIA 1T41A 5DMYA 5KVFE 3UC0H 3VI4F 2WKOA 4J6IA 3KGTA 2ZX6A 4WR3A 3FXGA 2EC9T 1O94A 1O7DE 3F7LA 4N9GA 4QHKJ 4A68A 2PF6A 3S1XA 4R7NA 2DQJH 1NMAH 3FSZA 3I10A 2PETA 1R6WA 2XVPA 5ESVB 3DVFA 3CPGA 5I3JA 4AFYA 3W7KA 3HQ1A 5BO1H 3OAYH 5BZAA 3EDFA 3FT1A 1VRDA 1A49A 2ENJA 3O07A 2A5UA 4G1EA 2J6VA 1IEBB 1GHSA 2CJSA 3MLWH 4X6FB 3W9DA 2R1PA 1P7KB 3MACL 4UIMA 5AL0A 1U2YA 3B7UX 5HVFB 4KKLD 2VFFA 3SFKA 3TJXA 3R7MA 1FO0B 3L2LA 5EBLA 1R75A 4PS7A 4NNXB 5EOQH 5T3XL 1HKLH 4LBAA 1MCSA 3VE7A 2VDQB 2WSQA 3RNQB 3LN5B 4ZTPH 3EX4A 2BOCA 3JZEA 5D38A 4AK1A 4LBEA 4WJXA 3WLSA 4A8NA 3ITOA 2ATSA 3V0DA 1ZHBA 3HVDA 1IEVA 5DJCA 2FTWA 2FZBA 4QG8A 2XKNA 5I6NA 2GBVA 2Z6JA 1Q1JH 1E4XH 3SCMA 2P9RA 2X1RA 4AW7A 3B3DA 3V6FA 5M95B 4N9DA 3R12A 3W57A 4NRZA 4XX1G 1WRFA 2VXSL 3QULB 1A5BA 1E6ZA 3MBWB 2HSAA 4NIKB 3PP3K 3LQGA 3M0HA 5IVZA 2CIPA 2QCDB 3GU9A 3IIVA 3QZWG 3TJ4A 1R3QA 4PGLA 1ZLSH 4M9PA 1QSEB 1UD6A 5H37H 3WE1A 5AWNL 5I66A 4W8BA 5IWLC 3DROA 1MFAL 4FQ2L 2XETA 3QFGA 4JGDA 4I5XA 1EBAA 5HHVH 5T1KD 4DUXA 4BXSV 3INUL 3HR5B 3TNOA 1QFHA 4FZ8H 2E9GA 4A67A 2J6EL 5KG9B 1NQBA 4PPTA 1IC7L 1W3KA 1ED3A 1KCUL 4KNSA 2W79A 4RVBA 2L7EA 5AKRA 4NG3A 3SKUD 2PDIA 5DD6B 5IUCA 4PSRA 3ARVA 4OZGE 1M56B 2PYEE 1UA6H 2QFPA 4HXBL 4PP2B 2Q87A 4GO9A 3AISA 2V9RA 4QTIL 1SVBA 2XBZA 3D39A 4JPWL 3KWSA 2WY3B 2LR4A 5FYJL 2G9KA 4PMXA 3VFWA 2V7NA 1EPVA 3VDBA 3TN4A 3C08H 5FWQA 4N9GB 2WXQA 1EZ2A 3ARQA 4LLVA 1EEZB 1Q9LA 1SJMA 3EAKA 5DO8A 1J5TA 1YPFA 2WWCA 2QQQA 2P76A 5BZXA 1DLFL 4TMPA 3SDDC 1PDYA 4GQQA 4NP4L 4QCFA 1VGEH 3LKNA 4S0SD 3F03K 1T6MA 4MNGB 2AQNA 2BXZA 3GBLA 5HY9B 2ZXAA 3MUGA 4XZUA 3T2LA 4ETQB 1CTMA 2QUVA 4I2XE 4KCTA 4Z1CA 2PCFA 4H8PA 4H9UA 2VLKA 5BU6A 1S6NA 4LZKA 3T55A 2QKIA 5AOJA 3JWDL 5F7DA 3ROLA 4DPQA 5I15L 1T1ZB 3V4VL 1TMHA 1XTLA 5F3HA 2HCVA 3H8AA 5CH9A 5MF5A 4MTVA 1FIEA 3AG1B 9XIAA 3BSGA 2ITCA 1I8KA 2IPKB 4L4VE 4Z77A 3NJHA 1QRNE 4J3WA 3GIQA 1F13A 1QFOA 2VISA 5GNYA 3VFUA 5IB2A 3MOBH 2EIJB 3PWPD 2YSTA 1OAJA 1AACA 4KXDA 3LM3A 4RGOL 1K8IA 1EJTC 3URAA 1H2JA 1JIBA 2IBGA 4J3SA 2F18A 2KMWA 5GSVB 4X4YB 1YHTA 2A1YA 2X2UA 5IUSA 2E7HA 4E5XB 1NKGA 2VN5A 3TX4A 2E1WA 2VDPL 5FKYA 3OLDA 4TULL 5G2NA 2OLDA 2VOTA 3RLSA 5G4OA 4DWSC 1RJCA 2AEPH 1QABA 3RDTC 5FYKL 4GW4B 1T7YA 1AG6A 4RMWA 5FR3A 1OE1A 4XVSH 4WDXA 1UCBL 3P9WB 2AJVH 4R9HA 3VABA 1I7UB 1MHHA 4G6FD 4AGOA 1NFKA 2AANA 3FB5A 4WEEA 1PCWA 4M8QA 3WDQA 1JCKA 4C6CA 1RCYA 3IGSA 3BFQG 4NM4L 2P49B 1WZMA 2HFGL 2JIXB 2F58H 4RAVB 4HH9A 1AH4A 1OX4A 4UR7A 2ZUSA 3ZVIA 4OJAA 1OF2A 4MQ7A 3EJTA 2R2BA 2FFCA 4FHAA 3ZDZB 1BJMA 4APXA 3ARBB 1Q9OA 4QNPE 3AZRA 2AXFB 4PJXF 3E0FA 5MI0B 4HNLA 4I7VA 4RNIA 1QOXA 3X13B 4V15A 3TW7A 4HGMA 2EIEA 3AALA 5DQPA 2HKAA 3VXTA 1MFNA 1RZGB 4HQQH 2JJSA 5KSBB 3RR1A 4RGND 4RRPM 3WNPA 4TTUA 1JPFB 3WEZA 4UTFA 1XH0A 4QY8A 2FZ8A 2GVEA 3PUCA 4UDUA 1VLIA 3LK6A 3HEIB 1KGCE 3WI9A 4LEXL 1ODUA 4IHOA 4KO7A 3KBSA 1A4JA 1UWXH 1FNGB 4U1NB 1TYGA 1D7FA 2AP2A 4X98A 3VSUA 3WLBA 3A6CL 4BV1A 4PJXA 1GJWA 4RFNC 8FABB 2WNXA 3CCHB 4OZFG 2HJKB 3RTQC 2CZEA 4REQB 5EULV 3T4AA 5BW6A 2RFXB 4RR4A 4ZW5A 4TQEL 1U3NA 2BSED 3JT0A 1WBXA 3GSOB 2OI9C 1V6TA 4M00A 5I1KH 4US5D 2A6DA 5AZ0A 2IPTL 3BXWA 4TV5A 3H8NA 3HG3A 1LNUB 3MX0B 4FHJA 5C0CA 2UYLA 3PTMA 1T2JA 4GLRH 4LPVA 1JFQL 1HWHB 3TXVA 4LVAA 1U91B 2FYMA 3OAUH 5KOMC 4B5WA 4NNYA 1S5NA 2B4CL 2HTKD 4LXFA 4OV6F 4WW2C 3NZGA 4Z2JA 4TMCA 2VDMH 4IKIA 2O5ZL 3ZIYA 5BW7A 5F9DC 3LMJH 5KANG 1KDIA 1QBLL 1R3JB 3HC3H 1UKQA 5LBGA 2QADD 2WSKA 1H50A 3BIKA 1YNYA 5E99H 3BZ4B 3MCG1 5AVRB 1ISVA 4B3LA 3Q13A 1HYSD 4F37F 3CSPA 1NC4A 2DIEA 4DJFC 3QRGH 4G80B 3A64A 1WISA 2EDWA 4UV4L 1Z0NA 4P4KA 4AB4A 4TUOB 4EX4A 2JJTC 4PJEB 2YPLB 3SKMB 3LHWA 1B57A 4PM1A 3FQWA 4LRIC 3QBUA 2XZCL 4MKTA 4JQ4A 2W91A 2VH5H 4MDJB 3VDAA 4FQXD 1REIA 4XD6A 5GRUL 2VDRL 1GQIA 1TYRA 2GTZB 3DECA 3SN0A 2HRLA 5GRZA 3WU1A 4DI8A 5EY5A 2P8PA 4H2CA 3LDBB 1VSCA 1ILUA 1FKWA 4N9BA 3CH1B 4MX7A 4GBUA 2F5BL 3BYTA 3SDXF 3GLAA 3RWCA 1RLDA 4GG6A 3UTQA 1TJIH 5D1QB 1GPWA 5IROC 2DM3A 3ZR6A 1OYCA 2WZTA 3T0TA 5J5RA 2WBGA 1NFIA 5DX7A 1NFDB 1ZV5A 4U1LA 4WFFE 3DGCR 5K4ZA 2ERJC 3CTTA 3QORD 4GH7B 4UZGA 1M05A 5CLXA 5KANI 1EKOA 4N7QA 1RJZA 3G5ZB 3W87A 4BWTA 4JKLA 5MENB 4OFVA 4P57B 3F7JA 5B4MD 2CRYA 1X7SA 3GKWH 1B3WA 5JPNC 1OSPL 3MCYA 1DXIA 2FECI 5HDWA 2BZDA 2A9BA 5FHBH 1ZANL 3W5MA 2DQEH 5E23A 3L45A 4JO4L 4KRNA 3TZVA 3NOEA 4UT9A 3I6TA 1LL4A 3RHWK 1M03A 4PY7B 4AT6B 3QS3A 5C1MB 2VEIA 3BURA 1XLIA 3S1VA 1FA4A 1EIBA 3BQUC 2XIIA 2HS8A 5IOBA 1T21A 4ISVB 1L9WA 4A2HA 2LLGA 4Z7QB 1HO4A 4PJHB 3KJ6H 1DBBL 5TE7H 3GEFA 3LZOA 4XO6A 4KKBD 3W7MA 5GRVK 3XISA 4MS6A 3QIBD 3OA5A 3D3VA 3GM0A 4ANKA 1T2QH 4JFQA 4HIXL 2XN9A 5BW7C 1OGTA 3GGWB 3WN6A 1NGZA 1P7HL 4M8UA 5HSFA 3GHUA 2Z7ZA 4HCRA 3IMVA 1PD6A 5E1AB 2FB4H 4JFFE 5DLMH 5GS1C 3HFYA 1AIFA 3GNML 5DMLA 3VKDA 2QL1A 3RJOA 4KY1L 1IKFL 4FKEA 4KNUA 4QXTA 2UV8G 1TO5A 5SWQB 3VH8G 2NZ9D 4MRBA 5I19H 3U5YA 5T5FH 2J7BA 1VJSA 4P5TA 2H2PC 4PRBB 1D5IL 4Q7IA 2WHJA 1H5BC 1KBVA 1QSFE 1KB9K 3EJJX 5GVJA 3UZWA 3MV7A 1D6EA 5EMYA 1DWIM 1RH9A 3OZMA 2EEDA 3KVQA 5H37G 4LBRA 3KW7A 2JKAA 4C6PA 4JFPB 1RUAH 2A3HA 3V5FA 3PY2A 3WS3B 1RZIB 4HJUA 3W38A 4YN5A 4LEEA 3GSNA 4CA4A 4ZNEA 4XAFA 2CBTA 3CTLA 1JDFA 3BESR 4WDIB 1A3XA 4Y8EA 3THAA 3UAJD 2PGWA 4L5ZA 3VXQA 3A6BH 4ZMNA 3P69A 1GMEA 3C60B 3LCXA 1EBGA 1TPDA 1E2VA 3T0EC 3URBA 2HLFC 2YD0A 4AM0Q 3OODA 2L7QA 1V0MA 4PA8A 5LXVA 3D69A 5FV1L 2ZZ3A 5DHMC 5F2GA 2ZT9C 5G4NA 4WU7B 4HX1A 4WSGA 3NN8B 1LK3L 5BJTA 1OLZA 4G43A 2F5AH 1F05A 4IRSB 4Z1DA 3ZL2A 3CAKA 3D39D 3GMPB 1M1SA 4ZZ9A 3QHTC 1EHLH 3TYZA 4JFOA 1IFRA 1WUFA 1UWQA 4MCYA 1NEPA 4N8VA 3FTGB 2VHLA 3GW0A 1SMDA 3IRSA 2XINA 3RE0A 4JGNA 5C08E 2A21A 2Y25A 4G8GE 1W91A 2M26A 3OHXB 1XF2B 1CZ1A 1J1XH 4XXDB 4JY9A 5EEYA 3N41B 4LNCA 4QG9A 3V8OA 2IV9A 2XWBA 2I25N 4K0OA 2WQDA 3DTDA 3NPXA 2COVD 5I82A 2EDJA 4N3UA 4HJJL 3EB4A 1QACA 2EIZB 4NAQA 1E6PA 4XISA 1T0PB 4NO2A 4JO8A 2OT0A 1D3GA 1UP3A 1WBJA 4HHHA 4NRSA 1CDIA 2XHYA 5IFTA 3KJ4C 3IFOA 4PJ9C 3IVUA 3EJZD 3KBVA 3H21A 2FNBA 2J9YA 3AGWA 4XWOD 1JOIA 1K7FA 4NZCA 2TMDA 3H4XA 5AY7A 1WXZA 2IMRA 1K03A 4OY9A 4GJJA 2IDCA 3VD3A 1BVOA 5G1MA 2KLRA 3IU3B 1UQSB 1BGGA 3HA1A 5HOSA 4J8RB 4NQQA 2J2ZA 3FQTA 5FDWA 4FLRA 2F54A 2VJ8A 5KUMA 3IJIA 3QQ0A 4NI6A 1GVQA 2V3DA 2VUOA 4K8RL 3MUZ1 2PP7A 4URIA 1L6FA 1YYAA 5JW4M 4CNPA 4KK9C 4EXPX 2QULA 4LSRL 1KJVA 4DLFA 4HKXA 3RLHA 3GB7B 1H6EA 3ZL1A 2Z35A 3WSUA 2AZAA 3HC0B 3ZQ9A 3JBG7 3CSTA 5CC7A 2XUCA 1ZHNA 4UM8B 5E8EA 1I8LC 3D25A 4O16A 5JHMA 2H9GA 4LS1A 1PG7W 1DANT 1FNHA 2AXGB 2YEVB 2OEMA 2R14A 4B16A 3VDCA 1BXCA 1D5MB 1S78C 4JFUA 3T6CA 5FGBA 2A3CA 4HBCH 3MLUL 2NX1A 3BZDA 3B5TA 5FO8B 1VFAB 5JXEC 2WQWA 1YY8A 1YYMH 2H2SC 5IMOB 3OF6D 1YCSA 2VQTA 1A6PA 3PNWB 4K3JH 1BLNB 1EDQA 2QBWA 4XP5H 1EJFA 2XACC 5CILL 3LDBC 4JZOA 5AYTA 1HX0A 1YEHH 3SO3C 3WHXA 1Q45A 5DK2B 1R3LB 3T0WA 1DSWA 4L9YA 2A73A 4AEHH 1XDLA 1OY3B 2VDIA 4Z7QE 4NRRA 1QNZL 2XI9A 3OHMB 3HU7A 3HI6H 3FO9B 1CK0L 4LLAA 1OFRA 2QNEA 3DPBA 3BCJA 3DA0A 5HHVL 1S5IL 1FWIC 1YNKH 3EF7A 3E9AA 2BC4A 3OJDA 3QN3A 2DQDH 3N3EA 2KZWA 2WBJB 1Q72L 2LW3A 2L7JA 4HC1A 1MCLA 4W4OA 3WCZA 2ZA3A 5FW7A 4LIQL 3TH3T 4KJWD 4D0DB 5E7BA 2IADA 1FYTA 3IV8A 5FEBA 1E9PA 4IPLA 1I2NA 4UDTB 1LOSA 2QGYA 2QVKA 5FJIA 4AVOA 1FG9C 1I2RA 3O15A 4WTQA 1KQZA 4LAZA 3O0RH 2R2HB 2CALA 2MTPA 4KTGA 1F6FB 3MJ9L 3OGRA 4G8TA 4KUZH 3QQDA 2Q8AH 1TJ1A 2OLSA 2VM8A 1AQFA 2DLEA 4N3TA 1NIFA 1I8MA 2A74C 2TSYA 1H0DA 1CLVA 3M47A 5D7EA 3FFDA 4KVNL 4L4MA 2H0FA 1CB2A 2E7FA 4C6MA 2ISSA 2J9ZA 4BGLA 4JIIX 2OI9B 4MNQE 1CGSH 5HGDA 3UTTB 4ABQA 3KCJA 4L1BA 1NCCL 4U1GC 2XWBB 4ZS6D 1GCFA 4ZENA 4Z78B 5TBOA 3MFGB 3ITYA 4NKOA 4IDJL 2GVJA 4BUHA 1DO6A 4MKMA 4XR8C 2MNWA 3FDKA 3ATEA 1PL3A 4UI2A 5IHWA 2CKBA 2YD5A 4G6ML 1N2RA 1M2VA 3EYOA 4ZTOH 3PP3H 3VRLF 4A7GA 2ACUA 3UWQA 4JFOB 4ADGA 4DJDA 1NOWA 1DTNA 4OU1A 4ATWA 5E4EC 3UZQA 5MEND 1NGPH 2IO5A 3B8WA 2Q8LA 4KHTH 2YRPA 3ARPA 5IFPA 3VNLA 2A6JB 2OMAA 4B5XA 4N2HA 3UBXB 4JO2H 2CZDA 2JFEX 3W1PA 3Q65A 1DSFH 3O9WD 2O0TA 1G7VA 1QO5A 4BFAA 4TU1A 3C0QA 5DA0B 2J20A 4G7SB 3BZFB 4KY1H 4ONFL 4P3DB 3P77B 3AACA 1ZRQA 3HAEA 3CHVA 2GLKA 4FMVA 3UR8A 2ZP0T 3KPNB 2VEKA 1QLEL 1FBIH 4OFDA 3RG6A 3UXDA 4IJBA 1A3HA 5D7LD 4PR4A 1EVTC 1MZYA 3MTWA 4BF7A 2Q5BA 1OCZB 3GBDA 1OT1A 1Q0XH 2FEDC 2YN3A 3WS3A 2W3ZA 4L65A 4FDWA 1JCMP 2IQTA 2PRMA 3RM4A 3OSVA 3V4VA 3KPQB 5ACZA 4OCNC 1NDGB 4Y8FA 2YN5A 3TLQA 3VFPB 3CV7A 3TDFA 3D0LB 4U4BA 3SDCA 2JKRM 2LTQB 2YC1B 4AVNA 3GO1L 5AVYB 4OV5B 4B5UA 4C7GA 5JUVA 4NQXB 1W0MA 1B3XA 3BT0A 4L9LC 2YZ1A 3LNIA 2BVOB 2FGZA 4ICXA 5ICXA 5CMAA 2VZUA 1IL1B 2BNQA 4Y7OC 2Y6ZA 2EKJA 3VG9B 4ECNA 3KBJA 2ZQKA 5IW1B 5I1EH 1F2XK 1BCIA 5D32A 4NJHA 5DCEA 1NAML 3VFCA 1YMMB 3GIZL 3IE9A 3KVPA 4L9DA 1A6TA 3MRQB 5D4QA 3T8XA 4ZX4A 4Q8OA 4UNIA 1RZJC 1HZKA 1OTSD 1GGUA 4JFQB 4N0FB 3ULUC 3VA6A 2AGJH 3I74A 1M6UA 4L23A 1FL5B 2FNWA 3HBZA 4XN1A 3S97C 1W9VA 3MBEC 1OP9A 5HHNA 1HCYA 3RIFF 4JREC 4DLMA 4ZBJA 4HFUH 2WVVB 5A43C 2X4QA 1IGCH 5D8ZA 3JTTB 2WXMA 3RILA 3ZHNA 5LA0A 1LUCB 4PG9A 4YR6A 5BRQA 5KYWB 6REQB 2QQLL 4HFWA 3ZBMA 2QR6A 4Q52A 1P4UA 4BFIB 4FS9A 1V7YA 3O11A 3IKKA 4FNLL 4I5UA 1B90A 4M3KB 5F2IA 7ODCA 3LRGA 1JHKL 1IC5H 4S1SL 2PDYA 4CDGC 1RVKA 4JRLA 2PYEB 1JVKA 2NY4C 4PJFB 5J13C 5KEZA 1RJZB 1TJXA 3G5ZA 4FABH 5A16B 3M4HA 4KQ4H 2CWNA 2K78A 5TGBB 2R0LL 3SRDA 1NFIB 1B1YA 4AXKA 4UWMA 4JNXA 1LDCA 5DSCA 4XPFL 3SN4A 2WWKO 1OPOA 1SJEB 1G0YR 1ZSDA 3MNZA 4HHWA 4RAHA 5EC1B 4N6FA 1DVFD 1MNUH 1UM5L 3QJFB 4K71C 4RXGA 1F76A 4G7YH 2YGOA 1TTQA 3P73B 4DIXA 4B7IA 4DBSA 1RPKA 4Q9BA 4IIDA 1W1ZA 3WMSA 2V0AA 1Q3NA 3PWIA 4NQ1A 1W8EA 3N55A 4IQLA 4FEMA 5HYJA 2Y22A 1PZCA 1QQDB 3SDCC 4AD3A 5F7KC 4JUSA 4P4KD 1AD0B 3DTXB 1Q66A 4KI5E 3RWIA 5F4XA 3FQWB 2FJHA 3KDMB 4M6OH 1MIML 3GUGA 4AY7A 2RACA 3ELQA 2JK5A 1VZHA 3VIGA 1AR1D 5JHLH 5FJUA 3IJYB 2VE6B 3DOSA 4FX8A 2E7DA 2VSDA 1NBZA 1KTDA 3FK3A 3BZ4A 4U0RB 1BD0A 1DXFA 1F74A 4QYOA 5CHNB 2W27A 3Q2DA 3P3RA 5GRVL 3GUTB 3QNYB 1JZ4A 1VEOA 5J6GA 1K9EA 1KLGB 3W37A 4PVBA 5I1HL 5ELIA </