4DO5A

Pharmacological chaperones for human alpha-n-acetylgalactosaminidase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-N-acetylgalactosaminidase
publication title Pharmacological chaperones for human alpha-N-acetylgalactosaminidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 131
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4do5A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4do5A01
5LNWA 2GQ9A 1F5ZA 4AMAA 5AOUA 4J9JA 3HBLA 3WEOA 3EWUA 4AHPA 1XKYA 3T4CA 2FH8A 2BXZA 3GAKA 1SZNA 1KM0A 4A2RA 4KWVA 2ZXAA 2Q8LA 2VEPA 3ABSA 1LWHA 3W74A 3GLCA 3D50A 1XV8A 3ZSSA 2R91A 4ZZ9A 3NL5A 3BAKA 3CWNA 2J6XA 2WQPA 4O4WA 1OVDA 1MWOA 5EPDA 3PC0A 3W6YA 3JS3A 3W7HA 3LXBA 2WV8A 1H7PA 4JTHA 3MP4A 2A7NA 5D2XA 1IXOA 4IQLA 3WK2A 1IGSA 1VR6A 1OFOA 2ZRUA 1J0JA 1XL9A 3BAIA 3O07A 2WCGA 1KFJA 1LLWA 1CPUA 3HG2A 1W5QA 2W79A 3E9AA 1WP6A 3GK0A 4O15A 3L5AA 5E9AA 2H8XA 5K4XA 3S2CA 4WX2A 4TR9A 4FXSA 1K8XA 5EY5A 3BVTA 4JGDA 1OHLA 3KAOA 7CGTA 3K1DA 2DORA 2FDSA 4X9SA 1Q6LA 3MP5A 4CNOA 2Y62A 4XQ6A 3DBPA 2A6NA 5E1QA 2BTMA 3RF9A 3BUBA 4MVAA 5DLCA 2BY2A 4H3DA 3W1AA 3W7RA 5IM51 5E6YA 5CPOA 2YCEA 3G3DA 1ALDA 4LNYA 3S9YA 1CDGA 2D0HA 1TIMA 3SGZA 3I7SA 3PBVA 1ZHAA 3QM3A 3NQ6A 1QI3A 5AC8A 4CCDA 5C5YA 5F4WA 4FX8A 2ABAA 4O1DA 4M56A 3TMLA 5KMYA 1WQ5A 3GZ3A 3NZRA 2P1FA 1K03A 5AYXA 1GVFA 1KGUA 2V0TA 2RDUA 3E02A 5A2BA 3EX3A 3NDOA 5F1UA 2QPSA 1H7XA 1UA3A 3KXQA 3AXIA 1U5JA 4LVGA 3KRSA 4FXRA 3BG5A 3VCRA 3M07A 3EB2A 4OKDA 1GEQA 4FHAA 3TAKA 3UYCA 3A24A 1NOFA 1HG3A 5AFDA 4D2JA 1EHAA 3PBUA 1W1ZA 2ZZ2A 1JXJA 3T55A 4O17A 1HVXA 1XCFA 2EHHA 1A5BA 2NUWA 1SW3A 5D02A 3MUXA 3K30A 1WZMA 1VJIA 3DHDA 3PSWA 4N9BA 2VFGA 1SZFA 2H90A 1XC4A 2YYTA 1G9HA 3G1HA 1JVNA 4NJIA 2VRKA 3P8JA 1V7YA 1HL8A 3W23A 2V81A 1ML1A 2GPTA 1W5PA 3NQ7A 5AHLA 2XWEA 3VMNA 5F4XA 2BHUA 3F1QA 1H1YA 3M7WA 1NF0A 3NPVA 1S5WA 2Y7DA 2XN2A 1TV5A 1EA0A 1KV8A 3P80A 5L9FA 4B9YA 2F1AA 1MW2A 2E8YA 3I6RA 1ME7A 1SZGA 2NV2A 4JTEA 5AB3A 2WVUA 4GO9A 1WOBA 1QO5A 2Q3RA 1BG9A 2ZTKA 3OLGA 2ZRYA 2ZX7A 3BAJA 1KBBA 4FF7A 2NWSA 4FX6M 2CWNA 3S1UA 2WSKA 4Q4KA 1PEZA 5LHEA 3AMKA 4DF0A 2X1RA 1GVRA 3ATYA 3TAOA 1TPEA 1AL8A 1TV8A 3UXDA 1E43A 3KOFA 4TMBA 2EPHA 1CXEA 3EWBX 4MOZA 3TU9A 3LXAA 1KTBA 3RK8A 3HGOA 3NQCA 4GI8A 1ZJAA 3QSTA 4MYAA 1V3KA 5K3VA 2F1BA 2Y70A 1HNYA 4UZSA 1G4EA 4O53A 1BWLA 1XD1A 5FEWA 3THQA 5CXPA 1OGSA 2GQ8A 1AK5A 1CGWA 3GDTA 5A2AA 4GUHA 2O7QA 4OV9A 5EA9A 4UTHA 1AMYA 4NNBA 3GR8A 1TPUA 2C14A 3U2OA 4TIMA 5I3JA 2OZ0A 1X1OA 3MYOA 1FWTA 2QDGA 2C1HA 5HQEA 1VHNA 3LCGA 1XSJA 5A8GA 4NX5A 3ZT6A 1JJKA 2WSYA 1L9WA 5A6MA 4O16A 4NQ1A 3M5YA 3LLFA 3MHFA 4OE7A 3HGSA 5CLTA 1PPIA 4FNPA 4OJYA 4GWEA 1GJUA 4UR7A 3VM7A 3CIXA 1OF8A 3STCA 4JD4A 1OT2A 3MP3A 1OYBA 4AYGA 1LM1A 3DFQA 3QGVA 5DXXA 1CGVA 1NAL1 2QKFA 3H55A 4FNSA 1VLWA 1QO2A 3AJXA 3QQ0A 4MKNA 2GVGA 3EX1A 5IBXA 3GXNA 2J27A 1U30A 3G0UA 3P67A 1SQ7A 5LNVA 4JTGA 4JYFA 3GNNA 1J0HA 1NEYA 5F2GA 1UKQA 5HXMA 1LYXA 2F84A 4AEOA 2D0GA 1JCYA 4AH7A 1PV8A 1KM1A 3W1MA 1JF5A 1DQWA 1TB3A 1UKSA 4NJKA 3UNDA 4IX2A 4MYXA 3O6YX 3KFTA 3UWWA 1B3OA 1KTNA 3CPUA 3L0NA 1CLVA 1IXQA 1BVNP 4NJHA 2XN0A 4JL2A 3EX6A 4BZYA 3WY2A 1DOSA 1F76A 1LRQA 3UCQA 2CZFA 3M6YA 4K39A 1KCLA 2IGTA 4S1FA 1VYSX 1RP8A 3ZSTA 4OIFA 1KA9F 1H1ZA 4AF0B 1MW3A 4MY1A 3L4XA 3DHPA 1KFKA 1FCBA 3LX9A 3N34A 3OVPA 4IMCA 2TRSA 3QW3A 3C61A 3G1SA 3QW4B 2VXNA 4UTTA 5C55A 2ALWA 3S8HA 1LLZA 4LS0A 2RHGA 1V3LA 5FF7A 4U2YA 5AN7A 3GDLA 2Y24A 2X1UA 3LLDA 3Q94A 5FEZA 4GUGA 1W3TA 3EXSA 3CZKA 2YW4A 3NQMA 1IV8A 2ZZ1A 3O16A 3W76A 4IMEA 5HMSA 1TQXA 3LI1A 2VFDA 2ZZ7A 2ZA2A 3WNNA 4FLQA 3NYZA 3QEZA 3C2VA 4LV4A 4MZ1A 7TIMA 5G5IA 3U6WA 1TPVA 4E2OA 4UTLA 1BTMA 4CCEA 1J0IA 4UFJA 3HJEA 5I5RA 2BY0A 3IRDA 1RQEA 2WVVA 4TVUA 3GXDA 3I65A 3TFCA 2C18A 3A47A 2PWGA 2CLFA 3OHIA 2XIIA 3NZ1A 1FXQA 3VGEA 1CGTA 2WKJA 1Z44A 2WNQA 1Y7VA 1D9EA 1QMLA 5BRQA 1VLIA 5DFAA 1GG0A 2BLEA 2Y89A 5HNRA 2NUYA 2YW3A 2ZX8A 3UZ5A 1TRDA 2QCCA 2BY3A 4A3UA 1D3CA 1DBTA 2YIHA 3N2MA 1LP6A 2E6DA 4XBSA 2DU2A 1UH4A 2RH9A 3M5XA 1SO6A 5D38A 3VFLA 5KTLA 1O7DC 1TJRA 2RDTA 2DJXA 3BK0A 3O8AA 1HXKA 2PC4A 4AXKA 1RZMA 3L66A 1GG1A 3LBMA 4FNTA 1LOSA 4XKYB 3WJZA 3ANYA 2UV8G 2CZ5A 3EWZA 3QPZA 1XH1A 3MMTA 3GNDA 2CXGA 3CZLA 3VO0A 3Q2DA 2NX9A 1XCXA 3W85A 3BLIA 2VEIA 3R13A 3SZ8A 5KINA 3FAXA 1LORA 1YDNA 5FEXA 5C2XA 4RXGA 1H7OA 4XTIA 4BWLA 3PULA 3TKFA 3AMLA 4UTKA 1G6CA 3C6CA 1FCQA 2QV4A 2ZUWA 2ZUTA 4CN1A 4J3SA 2V30A 1L6YA 1LOLA 2NT0A 2VFEA 4HNNA 3W3OA 3CM4A 5A5WA 3UPBA 3ATZA 4NU7A 3TCEA 1FDYA 3THAA 4UOQA 3W1UA 3VGDA 4CNNA 1OT1A 2ZZ4A 1OFEA 2WPGA 3W7DA 1A53A 1NF7A 3PBYA 3L65A 3L5LA 4GQRA 3W7CA 2QR6A 5AC6A 3BARA 3EJUA 4WSJA 3SFKA 5HWMA 5D30A 1BF2A 3GXTA 2WPBA 3LRKA 3W1QA 3EJSA 5AHEA 3A23A 4J3WA 5BNKA 2F61A 3SGUA 4RX0A 3EJRA 4UIOA 1A47A 4GE8A 4WF7A 2A0NA 3UY7A 4JTKA 3W2MA 1JQXA 3M41A 4O1AA 1M5WA 2GJNA 3EKLA 2E9BA 1XBYA 3TC6A 2QDHA 1R33A 1PS3A 3KRUA 3QQ1A 2CLLA 3DX1A 1WX0A 1MEWA 4C1LA 3VM5A 3BAYA 1EP3A 2C16A 2QPUA 4MZ8A 2QCDA 1JUKA 3R5EA 1JRCA 1CW2A 1KM2A 4J7RA 4HOWA 5LGXA 4X3ZA 3FW6A 2Y4SA 3BVVA 5G2WA 1JCXA 2WO5A 2Y5EA 3H54A 1S3HA 1NFBA 3CLWA 2D0FA 2C6QA 3UWZA 1ZAHA 1TQSA 1LRNA 4WXZA 2YFNA 1KBIA 2Z1BA 3C2EA 1E3ZA 2YXGA 4MZYA 3VGFA 3W07A 2VFHA 1JD9A 1KB3A 2XFWA 4FIRA 2YPIA 4ADSA 4E38A 1JCJA 3W7LA 3MWAA 3WJSA 4WY0A 1KXQA 3UWYA 2BZNA 1WZKA 4BK9A 3WNKA 1YXCA 1B4EA 5D2YA 1ZNNA 3ZFHA 4L4MA 5AC7A 4CCCA 3VGHA 1O94A 2B0MA 4Q32A 5K2ZA 4YMZA 1JG9A 1VGAA 2J88A 4DBEA 1TV7A 1MZHA 5F2MA 1TQWA 4IWWA 2XN1A 2WANA 3P74A 1Q6RA 4A21A 1YXYA 4OBTA 3WENA 1VFOA 3NGJA 3PB2A 4WY0F 1UB3A 3UG3A 2R14A 3DI0A 3N3MA 4M6PA 3NG3A 2XWDA 3WJXA 2EABA 5K9DA 2Y88A 3E12A 1G67A 2EEXA 1FQ0A 4C1KA 1MXSA 3O05A 3TNOA 1DTUA 3BVJA 2DZTA 1UH3A 4K6AA 5HINA 3C3NA 4UTWC 1EPXA 3LGEA 2QAFA 4MY9A 4BA0A 1P0KA 2QLYA 1WAUA 1PE1A 1VFUA 2OMAA 3BAWA 4IMDA 3WFZA 4UNIA 1VPXA 1AG1O 1EX5A 1MW1A 4LC8A 3OA3A 2NXIA 3G1XA 3C4UA 1VRDA 3EJPA 4U28A 3VE9A 3BLBA 3GDMA 4CN4A 3TXVA 1XFBA 3CWOX 4GI6A 1VB9A 1I2OA 1I2QA 3KL3A 4KFPA 1LBLA 1WZAA 4YWIA 3NVTA 2TAAA 2J9XA 2YJQA 2WKLA 3EWYA 4Z1AA 4WQ6A 1PJ9A 5J5DA 4YCOA 1N7KA 2VEKA 4NNCA 5KZMA 4CN6A 4DQWA 3T40A 3VSUA 1A5SA 1V5XA 2ABBA 1SUXA 2DZPA 4N6EA 1Y0EA 3KX6A 2NZLA 1Z32X 3ABRA 1TTIA 4YL2A 4J3VA 3UY8A 3ZR6A 1RPKA 1FBAA 2QCHA 3INPA 4IJBA 1BWKA 4CQ9A 4K7YA 3TJXA 1KM4A 3NAVA 3GVGA 3G0XA 4MFEA 2LLEA 1QI4A 1TPH1 4E2DA 1R47A 3L2MA 2JKEA 3VNDA 1F6KA 1GJWA 1EO7A 4HKPA 1TPFA 4FO4A 3DZ1A 4X9YA 2Q8ZA 2ZUUA 3RIKA 3O63A 4CVWA 4UTUA 3TFXA 2CU0A 1GVSA 3LRLA 3TQKA 1ONRA 4UQAA 3VNYA 4DEFA 5EYWA 1OYCA 3P61A 5CLWA 4N2YA 5AHFA 2J9ZA 3PUOA 1R2RA 1U2YA 4NZFA 5DELA 5K7JA 4ATWA 2Y7EA 3LCLA 4HN4A 2ISSA 2TMDA 2DIJA 3WNLA 3ECQA 3C52A 4MPQA 4X22A 3BH4A 4CKQA 1ZJIA 2OYKA 3BVUA 4HPXA 3BLFA 3M5VA 4QNEA 2QF7A 1VYPX 4RZ4A 1M7PA 3TK7A 1G7VA 4O28A 3KVKA 4WSKA 4DO5A 1TTJA 1IZKA 4BI5A 1GTHA 3BSGA 3W7GA 2DZWA 3DENA 1XBZA 2WSQA 5C54A 3W2UA 3B4UA 3D52A 3L9CA 2WSPA 2NT1A 3BO9A 4QQ3A 8TIMA 1K8YA 1Q45A 4GRSA 2AGKA 2DIEA 3CU2A 3DKLA 1VFMA 4RK8A 2VT0A 1F7BA 5DY2A 1X6UA 4FX7A 1DVJA 3P84A 4JFUA 3UD6A 3NM3A 1WO2A 4ZQNA 4AIEA 2WNZA 4S2CA 4AYSA 2W6RA 1PIIA 3P81A 2GVYA 1P4CA 1E3XA 3M5ZA 5AHMA 4HPHA 1JGIA 2ZXBA 1CGUA 2B4GA 1TREA 3BG9A 1PAMA 3DGRA 3UWQA 1K7FA 3BVWA 3G1DA 4JFSA 1JDDA 4JCLA 4N4QA 1W54A 3B06A 1SW7A 1OFPA 3FAWA 1H60A 4IX0A 1XBVA 3W71A 3DFOA 3W1TA 5BRBA 1E51A 1OX4B 3RFAA 5ABTA 3KVJA 1RP9A 1F74A 4G1KA 5D05A 1QW8A 1SFJA 4NVTA 3TJLA 1L2UA 2HS6A 1XGZA 5LNSA 3BPWA 4K36A 1SMDA 1PIFA 2OT1A 1D3GA 1OF6A 3EJQA 1R2TA 1S5TA 1TMHA 2QJGA 2Z0IA 2FHFA 2ZRZA 3UXAA 4HOZA 3F03K 3PY2A 2Z2UA 3HF3A 4O19A 1SPQA 1W0MA 4UXDA 4O1CA 4JTLA 4A2SA 1JDCA 2WC7A 3ZOAA 3EXTA 3NQVA 4RCXA 3L21A 5E6ZA 1AW1A 1VQTA 1Z41A 1OYAA 1OFRA 1T99A 3IJ9A 3V1PA 1I4NA 4UFIA 2FHBA 1KFCA 2VEMA 2QCGA 1JRBA 4K7VA 1W31A 3PM6A 2ZX5A 4DELA 1AQMA 2C7FA 2V3EA 1ZJBA 1UD3A 4U3CA 3G8RA 3IIXA 1QPNA 4QSHA 3A6OA 3LTYA 5U7SA 3C0JA 2E1DA 3BW2A 3LHTA 3PF3A 4KKXA 1EP2A 3CB8A 1QX1A 3ABOA 3FJ6A 3W83A 1HO4A 2V8ZA 1ICQA 2FTPA 1XUUA 3K8MA 1H63A 5K9CA 3EJTA 4J3XA 3L0GA 2X16A 2WOQA 3FKRA 2PWFA 3VSTA 1WBHA 5F4SA 2QUVA 2EAWA 3S5ZA 2OSYA 1ODUA 3CZNA 1QCWA 2EQDA 1JULA 4GNJA 1OFQA 2CZDA 2QCNA 1W56A 3M1ZA 4N9CA 3PB0A 4BI7A 4KFNA 2X2IA 4GINA 4GC4A 3PG8A 1G4TA 4UNLA 1XH0A 5FF2A 1KFLA 3HPZA 4O11A 3S5YA 3TSBA 2WKGA 4W93A 4AWTA 4IMFA 1XDLA 4DXVA 5D03A 1Q4NX 4TO8A 1VIWA 3ZR5A 1RD5A 3GDKA 3L67A 2F2HA 1KCKA 3MBFA 2E5CA 1KV5A 4UTIA 5DBTA 1TTQA 2QUUA 4MUZA 1F73A 3M9YA 4BF9A 3GBEA 1MFVA 5G2HA 4KFOA 1F05A 1SFLA 2TYSA 3HJZA 5I3IA 2ZICA 3EDFA 1MFUA 3HO8A 3N73A 3D4YA 1KFEA 3USBA 2A21A 5CGQA 4ORMA 4MB1A 4AMWA 4AIOA 1XCWA 1KWKA 3TW6A 2AAMA 2Z6IA 5CSSA 2NLIA 2NXHA 3G0SA 4FMVA 4HSOA 4M8UA 1C8QA 5T26A 3W7JA 3R2GA 1MO0A 3IK2A 2VKZG 3TH6A 1EH9A 4O14A 2ZRWA 2A85A 3PVFA 3NO5A 2BY1A 3NQFA 3W7OA 4Y8FA 4XB3A 1JF6A 4IMGA 1T96A 3S42A 4HP5A 4NUWA 2D73A 1LROA 4JIQA 1CXIA 1HUVA 2TSYA 3TQ0A 5EMUA 3WN6A 1RR2A 1N8FA 3BV4A 3PWAA 1R30A 4B9ZA 3W72A 1C29A 2D3NA 1GVOA 5LZLA 3L4VA 1XDMA 3GDRA 4M7SA 4LUIA 1QHOA 3KLKA 3W1NA 5IBXC 3KLLA 5TD4A 3W88A 2PCQA 3LM7A 1N55A 4N9EA 3VKJA 2J25A 3FKKA 3I68A 1DL3A 4HHPA 3OVRA 2I9EA 2P10A 1QW9A 1GZGA 4NJJA 1THFD 3KVLA 1AQHA 3Q37A 5H91A 5FF0A 3DXIA 5I3KA 1JAEA 3GIYA 3UG4A 2E6YA 1ZCOA 4HIBA 3SW6A 3WELA 1SW0A 1UD8A 1PCKA 2J9YA 2E0PA 1FX6A 3BW3A 1C8VA 2OW7A 4CNPA 4H4IA 1TSIA 3AO0A 2QAPA 1SSGA 3NEVA 2EACA 3KRZA 1ZFJA 1HT6A 3OG3A 1EWEA 3E0IA 1G4PA 4PODA 1WA3A 5F1VA 2F7FA 1H62A 1HX0A 4N4PA 4XBKA 4XUGA 2WVTA 3QMRA 4H8HA 1JDAA 4Z1CA 1W9XA 5HPOA 4GIAA 1LBFA 4JNMA 4JY8A 1XI3A 5HR6A 4H2CA 1OX6A 4PEEA 3NXFA 1DHPA 3L4YA 4UTTC 4FLRA 2BX7A 1OABA 3IIPA 2ALDA 1QOQA 2JKAA 5E0KA 3WNMA 1TPB1 4ZMGA 3OLIA 3CIWA 7TAAA 1CXKA 2A7PA 1B4KA 3IJ7A 4X2RA 2ZZ5A 1FXPA 1KM3A 5BMWA 3STEA 3DFPA 3QMSA 4PCFA 5DBUA 4JY9A 4JYEA 5K9XA 1FCVA 3VU2A 3LOTA 1YYAA 4O13A 1QWUA 3D0CA 2A1YA 1SO5A 4NNAA 1O5XA 5TBOA 3VNZA 8CGTA 3KVMA 4UC5A 4LPCA 4O4VA 3DFNA 2R8WA 4RZ5A 4KMQA 1WDWA 3R8RA 2PWEA 3AXHA 1QOPA 1HWWA 1TYGA 4UFMA 1K8ZA 3K8LA 3R89A 3NQEA 2QJIA 4JS3A 5HJLA 2X1TA 5LNUA 3NOEA 4EOUA 4AEFA 3A5FA 2NV1A 3B04A 1HTIA 2CW6A 3VGBA 1M7OA 4ZQRA 3N2XA 1YTKA 3WY4A 3LB0A 4I9AA 3LHWA 3DFSA 3LPPA 3S6DA 3UG5A 4JFVA 4WLCA 3LPOA 2QEZA 4MJMA 1EWDA 2X2HA 1P0NA 2CFFA 2J24A 2VELA 2VRQA 3IIOA 3UERA 1M6JA 1LZOA 3FYPA 3MHUA 3EXRA 4OU1A 4R7JA 1ZENA 5BRPA 3BAXA 3L68A 5L6UA 1VHCA 2AQWA 4IOTA 1FCUA 2G96A 3NL3A 4I7UA 3W2JA 1PS9A 5HULA 1O95A 2Y6ZA 1W8SA 3TOPA 3NL2A 4HOXA 1I8JA 3B03A 3S1VA 4LRSA 3ZR4A 1KTCA 4U4MA 3NR0A 2A2IA 3JRKA 5HUOA 4QAWA 3TR2A 3C2OA 4BWLC 3DU0A 3DHUA 3N14A 3RLVA 4CQ8A 1JFHA 3F4NA 2DZUA 2FGZA 1LOQA 1LWJA 1KLYA 3LCFA 3T7VA 3UEQA 1VZWA 3LDVA 2GUUA 2ZRVA 4U2ZA 2X30A 3CEUA 3O6CA 1KXHA 4QITA 3EKZA 1KM6A 1SO3A 1VAHA 3G18A 2QCMA 5EL1A 1G1YA 1F6PA 3CZEA 2F7QA 4RXFA 1WYIA 3OVQA 5KZEA 2EAEA 4OQVA 3NQ8A 4JTFA 1DHKA 4UQEA 1EP1A 4A29A 1W37A 5BMXA 5KITA 3HOJA 5BW6A 3SIZA 4O57A 4O1BA 3IV3A 4WJEA 5DXYA 3W7KA 2FE0A 1TPDA 2CLIA 4O8RA 4NX0A 3TQVA 4DPPA 2VR5A 2ZFAA 3O6DA 2BSLA 4U31A 5CG7A 3P5ZA 3GTNA 4PCTA 4NXSA 1SO4A 1QPRA 1JI1A 3M0ZA 3CHVA 2OSWA 1EUAA 1PVNA 4O12A 3M47A 2JGYA 4GJ1A 3BCDA 1TPWA 4UFHA 1I2PA 3SSJA 1PZ3A 2ISWA 3NPUA 2E8ZA 3S5OA 1PHWA 1EB3A 3G1AA 1UD2A 1DEDA 3MO7A 3W1RA 1J2WA 2JBMA 3IVTA 3FOKA 4DF1A 2ZXQA 3FS2A 2X2GA 2V3FA 3UQNA 2H3DA 4QNWA 3KL5A 1WXJA 2F18A 1GYLA 1HTYA 2YGYA 2ZZ6A 3KHJA 4PL2A 3GYEA 4ML9A 4AHQA 1AMKA 1TO3A 3STFA 3B0PA 3CGTA 3O06A 2GQAA 4J27A 2H8ZA 4GUFA 3LV5A 3DHFA 1BAGA 2ZUVA 4P61A 4EF8A 4N6FA 4EIVA 1FWRA 5G1TA 1YPIA 2C0AA 4FNUA 2YX0A 4EWND 2X2JA 2EGZA 2V5BA 4M6QA 1VH7A 1LDCA 1H61A 1FWSA 3OBKA 5E70A 3C2FA 3V75A 5CSRA 5SWUA 3W37A 2Y7FA 2PWDA 5FEPA 4Z1BA 3U8GA 4UOZA 3SJ3A 3A5VA 1OG0A 4QJ1A 5I3GA 4UCFA 4AWUA 2YR1A 4JTSA 3KL0A 3QJAA 2D2OA 3ZQ9A 2FJKA 2V2DA 4LW7A 3PUEA 5H2ZA 1ZS2A 3SI9A 4Y9AA 4NI3A 4IGHA 3G22A 4P2VA 4RLIA 5CGTA 2ZX6A 3WJYA 2I1OA 3DFTA 2FIQA 4Y6GA 1UJPA 4DF2A 3LHVA 2OT0A 3WMSA 2WCSA 2OYMA 1YDOA 3IVUA 4PA8A 4O50A 3S1WA 3WDHA 2DZVA 4LVDA 4H8VA 1Q6OA 2NX1A 2OCZA 4J3TA 3P82A 1FDJA 5FF4A 4HSNA 3HG3A 1L6SA 1IZJA 4FNRA 4LOCA 4UTJA 5D04C 3BCFA 4JN6A 3B0VC 3P5YA 1G69A 1U33A 2VENA 1GVQA 3P60A 4WOQA 2E09A 2Y85A 1U83A 4H6KA 1BPLB 2ZXDA 4TX9A 4ZQPA 2WVVB 3TSMA 4PTNA 2ZBTA 5G2IA 1X1ZA 4AEEA 3HIJA 4H8UA 1YADA 4MLJA 4XWUA 2CLKA 3HMJG 4NXKA 3DX3A 3LERA 5MHBA 1VJSA 1OX5A 2B7NA 4Q33A 4EVZA 4QISA 2JKPA 4IXXA 2VUYA 1LRTA 3QFEA 2GVJA 3WDJA 1X7FA 5FESA 1KBKA 3BLKA 3UWVA 2C15A 4ZQMA 3W7IA 3ZWTA 4YXGA 1KLZA 4PEKA 2NUXA 3IEBA 3L0KA 2CHNA 3NM1A 3EEGA 2G3MA 2GVLA 2HSAA 4PC8A 3LCHA 2GUYA 1KM5A 1NSJA 1OSEA 3TTSA 3WY1A 1QHPA 3MI2A 5D2TA 1YTEA 1ME9A 2A4AA 3GAYA 2JGQA 3LI0A 2W0UA 3B8DA 3JR2A 1RV8A 2V82A 1G94A 1BEUA 4ONVA 1YLVA 1LTDA 1YPFA 4JR5A 4L4LA 4DPQA 2YZRA 3IVSA 1HL2A 1EIXA 1V3JA 3NQDA 2OSXA 2ZA3A 3NL6A 2PWHA 4R33A 4MIMA 2YA0A 4WXYA 3IIVA 4AF0A 1O60A 2FPVA 1PIGA 3W2KA 1L0PA 4Z08A 1HL9A 2VFIA 4ALDA 3IGXA 5I0DA 1OFBA 1T8XA 2FFCA 1R75A 3BUPA 1UOKA 1SSDA 4O0ZA 3WFAA 2XVLA 1DKWA 1R34A 2RKXA 1A5CA 3EDDA 1DV7A 2A5HA 2ZQ0A 3LCIA 3CZSA 1TRIA 3PG9A 4BI6A 3HGJA 2ZRXA 2VNCA 3QSRA 2V5LA 3LCXA 2PRHA 1DJNA 3W7NA 2DH2A 2E5DA 1EO5A 3DH7A 1ZY9A 4I7WA 1CYGA 2D3LA 3IGUA 2I14A 3CTLA 3EX2A 1D3HA 1GTEA 4MAZA 1G4SA 6ALDA 3VX0A 1GQNA 2IQTA 4IPIA 1ZAIA 4LS2A 1XUZA 1WOAA 3DDFA 3PUDA 4KWUA 4UTMA 3AJ7A 1JCNA 3WJWA 3W70A 3CQ0A 3CT7A 3C8FA 2BXVA 2KZHA 3L4ZA 3DX0A 3IGSA 2BHZA 2GJLA 3M16A 2V3DA 1AW2A 4M7TA 2ZIDA 4NT0A 4GFSA 4M6VA 2YSWA 3CTTA 1TQUA 3W7MA 2QCDB 4O52A 5G4EA 5CKSA 1OK6A 3NNTA 1TCMA 4JCMA 1GOXA 3WK0A 3ELFA 3MJYA 1OJXA 2WVSA 1QDSA 4S2BA 1KGXA 1EUNA 1MXGA 2C13A 2YKKA 1RQHA 3OEXA 3GR7A 3BGGA 2A7RA 5D09A 2YFOA 4GO8A 1QI5A 2FYVA 3DX4A 5CZSA 1TPC1 2OX1A 2GJPA 1W3IA 2ZYFA 4GBUA 1CGYA 1RQBA 1I2NA 3WY3A 2ZX9A 1TQTA 3H53A 3P62A 5F7UA 4XKYA 4HNTA 2CPUA 3MHGA 1BLIA 3GBDA 3EDKA 4WY0B 3QZEA 5G1YA 5E0FA 1L6WA 1BKSA 2HS8A 1UUMA 4LTSA 1X8FA 3W7QA 1PHQA 2DZXA 2PURA 2ZDRA 3STGA 1UUOA 4UMCA 6CGTA 2B7QA 2F7RA 4UFKA 4GKLA 4E0CA 4HPJA 2X1SA 3UPWA 3QYQA 3GX9A 2DH3A 1S46A 2PRMA 1VC4A 1XXXA 3W87A 3TA6A 1AW5A 3RLUA 4J3UA 2RDWA 3E49A 4HT3A 1CXLA 5HDRA 4LVAA 3SR7A 4UFLA 4UUIA 3TONA 3CPRA 3CLMA 4ADUA 1TQJA 4JDBA 4ICNA 2C8NA 1TTPA 4WD0A 3W86A 1KFBA 3W9ZA 4Z0SA 2Z6JA 3VX1A 5I24A 4Z0JA 1G5AA 1OFDA 2FPTA 3LBCA 4LU0A 1AVAA 2OW6A 1MEHA 3LHUA 4LC6A 3QF0A 1DJQA 6TAAA 4GQQA 1UKTA 1QPQA 4RJEA 4A22A 5J5RA 1WE5A 1KW1A 3LTPA 5EKYA 2DZSA 1Q6QA 5AYYA 2Y2WA 1K7EA 3L4WA 3EWXA 1P5BA 1P1XA 4LVBA 3TXZA 3LTSA 2TPSA 3QMTA 4FB7A 4XZ9A 1XM3A 4JDYA 1CI1A 1RVGA 2NX3A 3PR2A 4ORIA 4CLMA 4AVFA 4JFWA 1ADOA 1QNVA 4RKAA 4JYDA 1B57A 2Y7GA 1AL7A 1QPOA 5I23A 2ATSA 3P7YA 1H5YA 1MW0A 4BR1A 1OB0A 5F2IA 2YYUA 1IIHA 2RFGA 5LSMA 4UQBA 1NM9A 5AHNA 4PCSA 1I2RA 3TROA 1I45A 1KWGA 1GVIA 1JR1A 4EF9A 3W22A 5E93A 5BOOA 2ZE0A 4POCA 5CZTA 1XSIA 3ABQA 5LHFA 1K3UA 3A4AA 3GKAA 1A50A 4LS1A 3WNPA 2BXYA 1KXVA 3E96A 2NSXA 4FEZA 4TU1A 4WOZA 3PS7A 2Y63A 3S1XA 1MVYA 3G8EA 4FIQA 4YCPA 2FQIA 2C19A 4LXFA 3TV8A 4RZ6A 1JUBA 3UZJA 3G1FA 4QIUA 3DDGA 3TDFA 1K7XA 1J0KA 1PCWA 3FA5A 2CLMA 3W7EA 1YDVA 3F4WA 1CXHA 2EO7A 3N9SA 4LWWA 3NQ2A 4H7VA 1V3MA 1OFAA 3CEPA 5D2WA 3G1VA 4O54A 3WK1A 4LUJA 3II1A 4X0NA 4UR8A 3WEMA 3NQAA 3L5MA 1W5MA 3W7PA 4IUOA 5D32A 1B0IA 3BUIA 1ICSA 3KEHA 3DI1A 1JIBA 4UQDA 1FWWA 1TMQA 1UCWA 1S5VA 2XIBA 1ICPA 3HPXA 3NQGA 3WNOA 2DP3A 2QCLA 4KWWA 2PE4A 4PH6A 3VI2A 1FDZA 4JIPA 2F7PA 4K8EA 1CIUA 3KWXA 3TTYA 2QJHA 2Q3OA 1H7NA 2DJLA 4I7VA 5K4ZA 2E68A 2FB2A 5G4WA 2G95A 1WBJA 1J4EA 1D7FA 3ZO9A 3TSDA 3DX2A 1IXPA 2YA2A 1FUYA 1UD6A 5KZDA 4NZJA 1NVMA 3A22A 2E5BA 3ZS4A 4ZQOA 3M44A 2QCFA 3W2NA 1H3GA 3GKFA 1IIGA 4NJGA 1IF2A 3EDJA 1OK4A 1LCOA 3MI6A 5CPMA 2YOCA 2QUTA 3VE7A 1GYNA 2ZUSA 3HZ3A 1H51A 1EA9C 4O18A 4GUIA 5U4NA 1SU5A 2FPYA 5GVJA 3GXPA 5I3HA 1JD7A 3OIXA 4JXCA 2VC6A 3RU6A 1JXKA 5TQLA 5CZJA 3TE9A 3W75A 4UQCA 1Z42A 4LT9A 2PRLA 4M5PA 1SZEA 5DN1A 2FHCA 4JL1A 2OYLA 3SY5A 3C56A 3W38A 3GB6A 4MLRA 2NWRA 1E40A 2ZTJA 4DO6A 4FNQA 1HFBA 4JICA 3TC7A 4O10A 1UA7A 3EWWA 1JL8A 4J28A 3D51A 5DCDA 4ZL1A 1FY6A 1DORA 3BUQA 3RMJA 2V9DA 2VOMA 1KBJA 3CV5A 3HPSA 4JFTA 4OGZA 3HGRA 3GXMA 3EX4A 2V2HA 4DO4A 3BSHA 1W5NA 3Q58A 3W1XA 5KSWA 3NA8A 2HTMA 2JK2A 3BGJA 1PL9A 2QMJA 4IPJA 3ZT5A 1ME8A 1UH2A 1XD0A 1TQVA 4JX5A 3G1YA 1WZLA 3S5NA 2QMKA 1B9BA 1H7WA 2E6FA 3PSVA 5F2LA 1M7XA 4Y90A 2P0OA 2G3NA 1KGWA 2WNNA 4JX6A 1TJPA 1G7UA 3O15A 5EBUA 4JEQA 2A6LA 1DQXA 3FYOA 3HQ1A 1CXFA 3QPYA 5HWJA 4PL1A 4AHOA 2E6AA 3TW7A 1QWGA 4W9TA 3W1PA 1SMAA 2ZCGA 3S0CA 4MFDA 3LCWA 4RV8A 3TIMA 3BMVA 3GXIA 3O1NA 3DC0A 1ZAJA 2V2CA 4CQAA 4N02A 1W3NA 4GUJA 3OLEA 1KXTA 1IXNA 4GXMA 2FLIA 1FWNA 1JQVA 4WZHA 3L4UA 5D37A 1WPCA 3LRMA 4UCGA 4BFAA 1JUEA 4JTIA 2WNWA 4E2BA 3L2IA 5HR7A 1R2SA 4K38A 3FFSA 2R94A 2Y61A 5A2CA 4MY8A 1GT8A 5CGMA 2WJZA 3VSVA 4LY8A 3FJLA 2EJ1A 4LV9A 4AWSA 1UASA 2WSRA 2F7OA 3BVXA 3C2RA 2G5WA 2G97A 2ZZ3A 1H50A 1B2YA 3W73A 4O0KA 1BSIA 3K8KA 3FIGA 4N9DA 1RPXA 5HWNA 5EMYA 3L2LA 1QR7A 2BHYA 4PSRA 3WDIA 2AMGA 5D2VA 4ZQCA 2EF9A 3BW4A 1R46A 1WV2A 4JTTA 5TIMA 5DCEA 1UD4A 3GXFA 3VGGA 4HA1A 4PFMA 2C3ZA 3N9RA 1MSSA 4OT7A 2AAAA 2H6RA 5HUPA 1EEPA 4PSPA 1SR9A 1CGXA 1QFEA 3RILA 1W5OA 1P6WA 3KE0A 1LBMA 3IIZA 1VCGA 4UMAA 4R34A 4Y96A 2CLHA 1ZALA 2E77A 2FB3A 2BWGA 3VMPA 2XVGA 2QCEA 3SECA 1OX4A 2ZA1A 2EKCA 3LV6A 4UZUA 5A6LA 1CX9A 3ZWSA 1XH2A 2E4TA 4AMXA 3CC1A 3MBDA 1QAPA 4WUIA 3W2LA 3BMWA 3QC3A 3HG5A 2YDAA 4UTWA 2OJPA 1VCVA 2YA1A 4QAIA 4FLOA 1C9DA 3BLPX 4M19A 2O7SA 3DKJA 4OHQA 5DY3A 4LQ1A 4TMCA 1YXDA 4LRTA 4IXHA 1HO1A 4UMBA 3BC9A 1A5AA 4AW7A 3QRHA 1VCFA 3L4TA 2HMCA 3LHZA 4QM1A 1K02A 5LKYA 2CZEA 2XVKA 5AYZA 3RNDA 1JCLA 2EADA 3B05A 3N19B 1T0OA 3HG4A 1J5TA 3G24A 3MW7A 3YPIA 3LXCA 3IJ8A 1GCYA 4R53A 4FLSA 4UQ9A 1Z48A 1PZ2A 4ZVJA 1GPWA 1GJPA 1Q3NA 2VFFA 3W1LA 5C6MA 1MXDA 3I7QA 1UBSA 4JTJA 1O5KA 5FF3A 3TUUA 4K37A 3LHYA 2B7PA 4XTDA 1I75A 3W84A 3B0UX 3MYPA 1TCDA 1VYRA 1XBXA 5D33A 3BUDA 1GWJA 4OV4A 3OLDA 4JTUA 5LGZA 3BLEA 3HB9A 2NXGA 2Z1KA 3DAQA 1QPKA 3A9IA 1QWNA 1XSKA 4GI9A 4YLWA 3PBWA 2CLEA 3NPWA 3G3MA 3EDEA 3UWUA 2ATMA 2ISVA 3R12A 1MEIA 5LNRA 5CZ0A 3QH2A 4DBDA 5CPNA 5FI8A 2CLOA 4HNUA 1JI2A 3VMOA 4OWGA 2GJRA 5AHIA 4HNVA 3M43A 1BVZA 5DO8A 3D4ZA 3T44A 3MI3A 1JCMP 3P8IA 5DCBA 5KEZA 3CZGA 1O4UA 3FEMA 3TX9A 4B5NA 4JX4A 3I7RA 4Z1DA 1VS1A 4AAJA 4RR4A 1UD5A 2FH6A 3A21A 1H7RA 3BG3A 3PAJA 3TMQA 2ZWZA 4MJZA 6TIMA 2GOUA 4CGTA 3NPXA 1M53A 2H3BA 9CGTA 2ZWYA 4ADTA 3ZT7A 3FLUA 2B7OA 3T78A 4K8HA 4U33A 1F2JA 5CPLA 4UNKA 3WK3A 1YTDA 5I3FA 4AB4A 4LVFA
chains in the Genus database with same CATH superfamily
1PFOA 5A94A 2R15A 1UQSB 2XZAH 1THCA 4NKIL 1PZUB 2K9FB 3EBGA 3WJJC 1LLOA 3CO8A 3MS8A 3CWNA 5D6CA 1NWPA 2HPIA 3LXBA 1ASQA 4JTHA 4XCFH 3OP2A 4PHZA 4EPKA 3BAIA 2E9LA 4NKOB 1R6WA 5E95B 4ECNA 2H1LM 1YEFH 4FXSA 3IPWA 7CGTA 1CFVH 4C6MA 4KJWD 3FK3A 1FFRA 3WUZA 5E1QA 3TN0C 3W1AA 1IHIA 2GYSA 4BQ6A 4R83A 4NZ5A 2H5UA 2VQ4A 5LGHH 3B9DA 1LL4A 2UZXB 1BZ7A 1FHNA 3GZ3A 2HB0A 2DQFA 4WKFA 1IGML 3NZ8A 4BQCA 4LVGA 4NLHA 3C5SB 3RUGE 3N40P 4PG9A 2NX5D 5H1WA 3TAKA 1MG3C 5KVFL 4PJCE 1A5BA 3NJGA 1SW3A 5K39A 3GNMH 4CJ1A 4TUKL 3LXUX 1K5NA 1JNHA 1JRHL 5BOZG 5E1GA 5LUMA 1GNXA 1D5BB 2FGLA 3S6OA 4B27A 5JBEA 1I1XA 1F42A 1M3JA 1KRCC 1J05A 4Z7IA 5IWLC 1BG9A 3BAJA 2AMUA 2FYYB 4NKDB 3DC8A 5ALBL 4LHUB 4LHJB 6ENLA 5HGDB 4CNIB 3QXDB 1D6VH 3HGOA 1O7SA 4TQIA 1ILUA 5J3HC 4PUDA 2NNFA 1T1WB 3TGXA 4JO2H 1DVZA 3LKPB 4WK4B 5D7HA 1F0LA 1QNIA 3JT0A 4CVUA 1LT8A 4O16A 5E9NA 2ZCKL 2HP4A 4UR7A 4BFRA 3CIXA 1OF8A 4J1UB 5CC5A 3LGGA 1DSYA 4C56D 3GS4A 1ZK9A 3SGKC 4QHNB 2X0HA 2QT6A 4NI6A 4JYFA 3VD3A 4BF7A 5JA8B 2COQA 1TKKA 3AS0A 4YSOA 4XVJL 3KFTA 1XR9B 3EYQC 2NNAB 1IXQA 2HRWA 2YGQA 5DA0B 4NJHA 3VA8A 4OT1L 4CVXA 2HKFH 3K4ZA 1P4LA 5ALCL 5E5MA 1WS8A 5C0QA 4R90L 2IGTA 4MNQE 3IJSA 3PHOB 3T71A 3H0TA 4WTZG 2YBTA 1CB7B 1X6NA 4BFKA 4JFFB 3CX2A 1UIOA 4NQCB 1J96A 1G87A 4G6KL 3WD4A 1DQVA 4YIQB 3NQMA 5HMSA 4E8CA 1QUPA 5G5IA 3U6WA 1TPVA 3KBWA 5I74C 3ENLA 2REQA 2CLRB 3IRDA 4LDOB 3V6FB 3A47A 2DEPA 9PCYA 1Z44A 1MCQA 2ENSA 1C7SA 1FLRL 1VLIA 2C5DC 3MTXA 4NDMA 5TPWL 4FQ2L 2Y89A 4BUHA 5HNRA 4Z7QB 1BJ1J 1TYEB 4D0CB 3QRGH 2J6WA 1R5IA 4G9DA 1QMUA 1U42A 1H0IA 1U8IB 3L66A 1GG1A 3WMLA 3GO2A 4WI6A 1HU8A 3GNDA 3ES7A 2ACSA 3MDJA 5LCVA 3FS9A 2RTTA 3R79A 3VCCA 5HHQB 1E71M 1L6YA 5DU7A 1NFAA 2B3RA 3VINA 1J9SA 1PDYA 3UJ2A 3PBYA 1KCWA 1K4GA 5AC6A 5D1ZI 3MUCA 1LUCB 4BWUA 4B9CA 4V1XA 3C60A 4QTFA 2WPBA 3GW3A 3IDXH 1UWSA 4ZXLA 3CX5K 3RPMA 3ZUNC 3N15A 1IC7L 4RX0A 3AU1A 2GL5A 4JTKA 4X6BA 3ECWA 3IFPA 1HOEA 3P4NB 2FRGP 2PTVA 3WHE0 1QOXA 3CFBA 1YEWA 1A3QA 1R3VA 3BVVA 5G2WA 4LX4A 3FK4A 4ZTYA 3DRTB 1EJOL 4HJUA 1RZ7L 1AP2A 3H2MA 2BVEA 1P5UB 5KS9E 2CRZA 3CVCA 1MRCL 2DLHA 3LU2A 1B4EA 2KPNA 5IOKA 2FD6L 1U8KA 1DVFD 3Q2WA 4PIBA 1MFCL 5DMGC 1W0WA 4E5XB 2WAHA 5J56B 4DGYH 1P7QD 1BYAA 4UM9A 1AHWA 3F62A 1KG0B 5HINA 3F12A 2G9HB 1FDLL 4DLMA 32C2A 4JGUA 2EUVA 3MVTA 4HB7A 2ADFL 3C8NA 1XGPA 4LC8A 3EJPA 2QVMA 1L9PA 3BD5A 2I24N 2K45A 4DJEC 3CWOX 3S4SA 3OKYA 2J9XA 3BZ4B 5I6NA 4JK0D 2VIRA 4PULA 2UZPA 4EI6B 3UW6A 3LN5A 6A3HA 1BREA 3AUVA 3OR6A 2PTUA 5GZOA 1GC1H 5I9QC 5DUBA 2RJGA 4NRRA 4P4KB 2RGSA 3G0XA 3LKSA 2ZOUA 2VABB 4KPLA 3L2MA 4OCYH 1KV7A 1ONQB 4MNLA 3MROA 3RIKA 3M0LA 3CQHA 4XXCA 1GGTA 5JBFA 3VKAA 3BCJA 2UY6A 5IOPA 3P3UA 4JHOA 3IDYB 5CLWA 5AHFA 3ISYA 4HTYA 3NPZB 4CL7A 3DX7B 4Z3JA 4TKWA 2PTXA 3ECQA 3V7MA 4ES9A 2OLSA 1WWAX 3MV9B 2IDCA 3D7PA 1QLRB 3MO1A 4BK8A 4JN7A 3WEAA 4MA7H 1HKLL 3VFCA 4PTUA 3PL6B 2DZWA 4LVOC 2WBKA 3WEXA 3EBIA 2A1WH 3W2UA 4V1DB 2XFFA 3T9PA 3QDMB 1VZIA 5I1GH 5IVXB 3CU2A 5E03A 1X5ZA 1WO2A 4RQQA 5BPPA 4Q9CA 2WZEA 3QR2A 1PAMA 1JDDA 2W92A 3WJMB 5K9JH 2BM3A 3PWGA 2C9PA 3B06A 1I9JL 3AFLA 1SW7A 2G2RA 1CK0H 4EAYA 4N2KA 2LTQC 5AVYB 2NLYA 1QW8A 3K6SA 2ORBH 1SMDA 5FB8B 1OF6A 1J5SA 3HMXA 1EJWC 4J2PA 5DQJA 2GAZA 1SPQA 3COTA 4DP8X 1F3DJ 4ZMXA 1OD7A 3IJYB 4XO7A 2GY7B 3CHOA 4OCLC 2B2XL 2GT9B 2QCGA 1MHPL 3PDOB 3BEVA 2C7FA 2V3EA 1BBJA 5T1KB 4QSHA 4MA3B 4NQDD 1LILA 1D9KA 5AW8B 4S1QL 4JN2A 4C6CA 3QBTB 1ICQA 4Q8UA 4PB4A 5MKGB 5D96B 1H63A 3AU6A 8RUCA 3RX4A 4C6EA 3OOQA 2C7UA 3VI3A 5IHZB 3MJ9A 4K68A 3UO1H 4GC4A 1TQBC 3OKOA 4K7FA 1G4TA 3VD9A 2ZKXA 5FF2A 3LIUA 3TSBA 5K9KA 2NNCA 1VIWA 3S36H 3VXME 3IGLA 4OCSL 2C3GA 4HOMA 3VI3F 1WICA 3M9YA 2NUPB 3D0LA 4QDPA 1GONA 1F05A 3HJZA 4Q8MA 1JWMB 1V79A 3VC5A 3UBXB 4MXWL 4HQQL 5IV2B 2EDDA 2AAMA 2Z6IA 2DEYX 1W3HA 4QXTB 4UQ2B 1KUMA 2AQ1A 2YAPA 2CG9X 4KX7A 5ENWA 1RIVH 3GMOB 1ACXA 3C8KA 2OYPA 3NSYA 2HXTA 4O14A 2A85A 3T8MA 3DOSB 2MQ3A 5HYIA 1MDTA 1EGZA 5JDJA 3FU9A 2EH7L 5E9DD 1N8FA 3OPZL 4RGND 4FALA 3LQLA 3PE9A 5AB2A 4M7SA 5GISL 1FWXA 3N43B 5TD4A 4N2LA 1E5UI 2CC0A 3OVRA 4GSUA 1XBRA 1XIEA 5FF0A 3MLVL 1N19A 5ABFB 1KTLB 2N3JA 5C0JA 4B6ZA 4FABL 5JUEL 5BWAA 2QQKH 1E5AA 4NUMA 4FA8A 4XX6A 1AQ8A 4D6IA 3VXPB 4H00A 4OZGA 3OYXA 3U6RA 4JO5A 3MZ2A 2DGAA 1LEGA 1JP5A 3GRWH 4PMFA 1M3UA 4RFOL 2PODA 2GJ6D 1CVSC 4X2RA 5DSCA 1E6JL 4OZGF 1BZEA 5DBUA 4KCWA 5C0DB 3D0CA 1JPFA 4KKCC 3HB3C 1SO5A 4Z7OE 4ODSL 4BCEA 1YN7A 3LK6A 4ZMTA 1VSCA 4UIKH 4OQTL 2R8WA 5BZAA 2DZBA 1EGJH 1TYGA 3K8LA 2D7PA 2WWKT 1ACYH 5BO1H 5CPQA 2FLBT 2YD5A 5ADPH 5HGHB 4ZQRA 4GYKA 1KIRA 3VYNA 2YD6A 3LPPA 1IM9B 4KK9C 3LPOA 2VRQA 3QR0A 1UXSB 1QU4A 3RZWA 3O8XB 2XH2A 3NFPA 2WQSA 4UILL 1XIIA 2L7UA 2HK0A 2EIZB 5IFHL 4NN5C 3O3DA 3BPCB 3F4NA 5IESL 3WNIA 2IFFL 3K4DA 2G0KA 4AZ8B 3M0MA 5H8DA 2FGWL 4G42B 4F3HA 4X6DB 2Y1ZA 2BWDA 2HFGH 4N85A 4ZD3L 2DDXA 2DB8A 3HOJA 1QNZL 1OLZA 3PJSB 4WJEA 4ODUB 5F0JB 1GAFH 3LSOA 4UQIM 4F4RA 1U4EA 1T04B 4NXSA 2GGHA 4O12A 1QNSA 1E30A 4Y2DC 4YDVA 5DZVA 5AOLA 5I15L 3N85L 4TUUA 4TMPA 4PGBB 5AOKA 2NLJA 2X2GA 3BZJA 4XP1L 1T1ZB 4HT1L 2Y8UA 1AMKA 3CGTA 3BRFA 2VDOL 3BVNB 4DGVL 5KSUA 5GGTA 1SFSA 2R7EB 3DHFA 4P61A 4YEEA 3V0GA 4POZC 1HXMA 1JERA 5L8LB 1BXNA 2IH1A 3C2FA 5SWSB 5SWUA 1UCTA 1K6QL 3JVGA 3M1CA 3A5VA 1JWSA 5D2LB 2NY1D 2V2DA 3OR7B 4H44C 2R2EB 3DGGA 4LKXA 3T0TA 4PG2C 4NFCA 1MF2H 4JZJB 2OI9C 4I9TA 7PAZA 4EWJA 4TQPA 1U33A 5JDSB 1X1ZA 5FYLD 3U0TB 1N26A 3BGAA 3RJOA 4NAJA 1ZSDB 1GZHC 4PJXB 3ZRCC 3VYLA 5HI4D 3GSWA 3KBNA 3ZVVA 2JCWA 2BSRA 3VB9A 3VFUB 4IG2A 3B8IA 5KYNA 4KO5A 3S2LA 4FFWD 5IMMA 4OB5L 3VDAA 2OSXA 3TZVD 4KTEH 2CCWA 4PJFA 4AF0A 4F8XA 4A1RA 1M56B 1I1YA 1UOKA 3PJNA 3WBXA 4PCNA 4I8YA 3BDBA 1MJ7H 2ADGA 3MOAL 1MEXH 2F58L 3UCRA 5K59F 4YVVA 4S1SH 1ZGLM 3WIAA 5BNXD 3ZYJA 4XPAH 3ASWA 4LS2A 1WOAA 1MH5A 3K80A 3CQ0A 2FTYA 3CT7A 3BUTA 3T2OA 2BXVA 3L4ZA 3DX0A 2FO4B 3F58H 4ICXA 2GJLA 2VLJD 2OJEB 3RTQC 2Z29A 5DZLA 1Z5LA 5HI3D 4AY7A 1IAIL 3IJDA 1R3YA 5IW3A 5DVMA 3SRKA 3WIFA 4JRYB 4IMLB 1MQQA 4NN7B 2VXQA 3MHGA 4BGDA 2WCPA 2Z25A 3W7QA 5DX7A 1GZ1A 2F7RA 1G9MH 2ZONA 4Y4KC 2B08A 4PJBA 1R5VB 4PW3A 1KB5A 3QJUB 3GJFB 3RO8A 4KEMA 3X14A 4UUIA 5IB4B 4IOFD 4JFYA 2GUOB 4Q4OA 3TNNA 3QUMH 2Z6JA 3JSSA 3O3UN 3EJYC 5ABEA 4H6EA 2H3NA 5DVOA 3ZDXE 6TAAA 3MBEC 2Q7YB 5ICZB 5CSZB 3PRZA 4PJBF 1KW1A 1ES0B 2AK1L 4KU1A 1P5BA 3TXZA 2FBJL 3PV7A 4JPWL 3KPRE 4CLMA 1QNVA 4QO1A 4NQDB 3FT1A 3CPLB 1OSYA 2CAKA 1F8MA 2Y7OA 1RZKH 4ZFQA 5CR8A 2HLAB 2KT6A 1Z89A 5CHNB 3WFCH 3VWKB 4E9YA 1KDIA 1YEEH 1DBJH 2OR9L 5IKCB 2J5LB 2C79A 2Y72A 4YSTA 1R9XA 4S3BA 1REQA 3CYJA 4FIQA 1ZS8B 1WCBA 4L4TB 1WIUA 2PDYA 2AJXL 2BWIA 1F90H 1LMIA 3VFPB 3F4WA 3PU7A 3NQ2A 1UZ6F 3TYUA 1IEIA 3N1AA 3PZGA 4IKNA 4PGEA 1EYEA 4GEJA 5J1AB 3IJIA 3LYEA 4X0NA 4UR8A 4LPUA 1ESWA 4LARH 1TZIB 2JI3A 5D7JA 3VFSB 3F64A 3MRMA 3GJEB 4HCHA 5KTEL 4P9MH 2Z91A 5D1QB 4F2BA 1CICB 2ICEA 2COVD 3QEHB 4JY4B 2RFXB 5GRXG 2BVQB 1FWDC 5D8ZA 2VLRD 3WBAA 3UTPE 3TJ4A 2I26N 4MD5A 3AS1A 3QG6A 2JI1A 4ATLA 1FUYA 2MHAB 4IIQB 1UD6A 2XSXA 2AJUH 1G7JB 3F3HA 3J07A 1IIGA 1G9NH 4GG6B 1U8LB 5E9DB 4GUIA 1U8QB 2EXOA 2FPYA 5HHPB 2HLEB 1A5KC 2OYLA 4P5MA 5C08B 1HFBA 3RX7A 1MG2C 1OEZW 2VISB 4PJ7B 3G5XB 3TWBA 1M6OB 3MCYA 3HPSA 3UGVA 3BSHA 1W5NA 1RFDH 4YX2L 5C0FB 2N4IA 4QHMA 3BQVA 2RHEA 3G6JE 1UH2A 4W9EC 2NYYC 2OLAA 2P0OA 1FO0L 3K5RA 2YGVA 1FI8C 5JHLL 4E42A 1DQXA 1CXFA 2C3HA 5MF5A 4YN3A 4AHOA 3QUZD 4OD2A 4TVPL 4ONHB 5EBAA 4UTAL 2JIEA 4YR6A 3SGJA 1XISA 3WXWL 3MCLH 2YC1B 4K5LA 4TVSa 5SWQB 2X4RA 2OLDA 2R94A 1B4TA 1CT8B 3HZYB 1CZ1A 5AW0B 3R7QA 2PYFA 3L6FB 5DFTA 2G5WA 1OD8A 2Q5BA 5EEYA 4NNXB 1E6OH 3COOA 4WKAA 2CU9A 3FONA 1OAQH 1X5JA 3GXFA 2B5IB 1P6FA 3VGGA 3QI9C 4GAAA 3MYZA 1S3RA 2Z0UA 1XHHA 3IARA 5A2LH 2DN7A 1NPUA 1LBMA 2M2DA 2CLHA 3RX3A 3QRFM 3M0XA 3ZWSA 2E4TA 2X4TB 2ZYHA 4WUIA 4NO3A 43C9B 4M19A 4TMCA 4GXVH 3GI8H 4C83A 3MGAA 4UMBA 4Q2ZB 4AW7A 2WBWB 4HKJA 1VCFA 1K02A 4PH8A 1HILA 3MACL 4HBCL 5K93A 2CJSA 2ED7A 2KUTA 3BN9C 4IK6A 2Z0BA 4PJFE 1T20B 4FLSA 3IKKA 4XAKD 2G60L 3RZCA 3V4VL 1VFAB 3I50L 5CD5C 3ES6A 2XIDA 3FO0H 3N6JA 4MKMA 5KN5B 3L1OL 1JVLA 2DJUA 4JPGA 2YL8A 3CB3A 2Y25A 3F83A 5IB1A 4GI9A 1BQLH 2XWTB 2CLEA 3EDEA 1JI2A 3VVGA 3Q6FA 3D4ZA 4OJFH 3H70A 2VX4A 4QDMA 5I5JA 1KNOA 2PTTB 2PU1A 4ATDA 4E3TA 3BPLB 3ZE0E 1VS1A 2CUIA 3KNBB 5GS3A 4MNMA 4RVBA 3ZT7A 5DEFA 4AV0A 3T0CA 1AXTH 1PLBA 2WQRA 2AL2A 2CGZA 4YQXH 2PR9A 3WKYA 4EVNA 3V6ZA 1XV8A 3ZSSA 4G8TA 2IVFC 4L23A 4QXGH 4WDUA 2X1IA 3E1F1 1SM9A 2J77A 4F9JA 2G50A 4NFDA 5FK9A 5D2XA 1NEUA 1EDGA 4A7GA 1XRVA 1P0DA 3JWNC 5F3FA 5KOVC 3L5AA 1A7OH 1IGIL 5ESQA 4TR9A 2FJFA 4UTBH 3K1DA 3LEYL 1J11A 1BIHA 1N82A 2P8LA 3OIHA 3LHAA 2D22A 3PWJA 4N9GA 3NCOA 2G5BB 3HRZB 2FO8A 1C5BL 1JEZA 5I1HL 5EUOB 4RPPA 3MCKB 2C26A 1YNKH 1KYDA 3ISIX 4NUGL 3E02A 1V3IA 2A5UA 1I8KB 1IT9L 4I48B 4ZBJA 2CLVB 3C0LA 5CILL 5D6DA 3KPSA 5H4ZA 4M7JH 1N5AA 1I3UA 2Q3AA 2FWSA 3GT6A 4G8AC 4KJPD 4AGQA 2PO6D 1HQTA 5LKNA 1XC4A 4R3UA 3RURA 2G3IA 1M1BA 4XH2A 3K6NA 4JFDD 3ZLQC 7REQB 1R24B 1V6XA 3S8GB 3BH8A 1I1FB 4PS4L 1HVQA 2DQMA 3C8HA 3LS5H 1XF4A 5L2KE 2GI7A 5I2IA 4D1IA 3NEEA 1N4XH 1DE5A 4TMBA 1CFBA 4MOZA 3RK8A 1NTDA 3QSTA 5FOOA 2EDJA 2UY4A 3RBGA 1MQKL 2V5YA 4UTHA 1XIBA 3Q6GH 4NNBA 1KZYA 5DMJB 2C14A 4Y16D 5I3JA 4B53A 3EYOA 3A6CH 2C1HA 1VHNA 2EVHA 3E0FA 1NCDL 2VDLH 1MFAH 3VQLA 2A9NH 1G5GA 5HD8D 5T1DL 1GJUA 1NMAH 4ZMZA 3FYYA 1FL5A 4K7PL 5DXXA 1VZGA 5M17A 4FNSA 5B1CA 2O26U 4MWFA 3V2AR 4MVBC 1RKRA 2HUHA 4LE8A 1SLVA 1JCYA 4YFDB 1KM1A 4NJKA 1FWEC 4EK7A 1E2ZA 3HG1D 2JQMA 4X0KA 2WXGA 3OSVA 2D2JA 2R1LA 4BZYA 2B0SH 3BH9A 2OXHA 3QN3A 2Y9RT 2EE2A 3MQIA 3WH6A 4EUPH 1K9FA 3L3HA 4CU6A 2Q7AA 5HY9A 1FVCA 3DHPA 3LX9A 2XBZA 3N34A 3C61A 3QW4B 3ISRA 1LD9A 3ZDYF 4HH8A 4UTTA 3HI6L 5FF7A 5I75B 3Q2CA 1H49A 2C3VB 3OWEA 4LEXL 4OFKA 3LLDA 4NWTL 4MJ6A 4GAYA 2HAZA 1TVHB 2VLRB 1JZ2A 4AL8L 1FN4B 2PXYC 4XMVA 5E24E 1FXQA 5KVMC 5IB3A 1GG0A 1AO7E 3N3EA 3HZMA 4YC2B 4JDVA 4I5XA 2OO0A 4GKSA 1TRDA 2CDEA 1A0EA 2RH9A 2VCOA 3FOMA 8XIAA 3HHRB 5BRZD 3LBMA 5DD6B 3WJZA 2JFEX 3GUWA 1DQDL 2NX9A 5F7WC 3GD1C 3V4UL 5C2BL 3BIKB 5FCUL 3QDGB 3TYFA 3T2LA 3DMMD 4FQ1H 2GY5A 4ZW5A 1R3IH 4QEHA 3UTTE 4TQTA 3UGUA 5LNDA 4UOQA 4IHOB 5ICYA 2IAMA 2AQPA 2H47C 4TX6A 2P42B 2F53A 3FO2B 1R33A 3KRUA 5IBUB 3K5SA 1AR1C 1NMCB 2O5ZL 2ZPKH 1QFUL 1KM2A 2OCFD 3H4WA 4FQHB 5M2FX 5BUPA 4P5TA 3RNQA 4YFEA 1DN0A 1HW6A 1DLHA 5E6IB 4NQXA 3BFQG 5LAPA 5EMJA 4ANWA 1WZKA 1DSWA 1F2QA 4K07A 1JG9A 3NQBA 3OYZA 3SPHA 2KQMA 4M6PA 1HXYA 2OEMA 5K9DA 1NPNA 4WI5A 3ZKQD 4A7QA 4JCWA 2FIKA 1FQ0A 3CHEA 4R3SA 3AZRA 1FNSH 4YDZA 3V52H 4WENB 2ZYSA 4CCZA 5LIWX 3LGEA 3EFFA 1XGTA 4Z9KB 4MRBA 1VFUA 3MQTA 4MZ2A 2VH5L 3MLWH 1P53A 3G1XA 3LB6C 2W61A 1L5GA 2TRHA 4KROC 5I1IH 2ZUXA 3N5AA 3KL3A 4BZ1L 5GNYA 4I6VA 3WS6C 4MTVA 3CAWA 1Q8JA 3U9UA 4D0DB 1NEPA 2WLMA 4NZUH 4P2OB 1KYFA 4B5SA 2LAAA 4YL2A 1TZ8A 5FA4B 4XN7A 2EDBA 5DT1L 3TO2A 5FWRA 1SN2A 1OP4A 3BJTA 4R0LA 1SMOA 3OX8B 3U79A 3BE1L 1KJVA 4GCAA 3B0YA 3KYOB 4PR4A 1YRRA 1INEH 4H8QA 1S3KH 3QIBD 4FSAA 4OY9A 5EDXA 4PHXA 4DEFA 4ABUA 3OPUA 1U2YA 2WMPA 1CNVA 5CEYA 3OGRA 4PRBB 4ILDA 4WWKA 2J3SA 1CO1A 2YD8A 2ZXGA 3BH4A 4CKQA 4G7YH 1YRKA 4K0OA 5HHXL 1OWQA 1YEYA 4G82A 3TK7A 3C2AH 3GRWA 2GUBA 4WSKA 3NJJA 1XR2A 3CDZB 1AMXA 3VIPA 3DX6B 4KDTA 2UWEE 4WU5A 1D5IH 4I3GA 5HDBB 1KJ3H 4JFUA 3RDKA 4EEEA 4PR5A 5FF6A 3MXWL 2GVYA 2EEFA 4HPHA 1EGJA 2G3XA 3HU7A 3D0AA 1UEYA 4IKIA 2F8IA 3DGRA 3FTVA 1K7FA 1XF1A 3G1DA 1NSNL 5HYEA 4C5YA 4K3GA 5BRBA 5D05A 1KC5H 2FT8A 1R1CA 4Q4IA 2NNXA 1PIFA 4N8CL 3KDOA 4DSYA 2CDGB 3ZRFC 4RCXA 3A67H 4LHUD 3QC6X 3RYMA 4FGMA 1W31A 3BANA 3MJMA 4DP1X 4G8GE 4U3CA 3M1BA 1NC2A 4BFBD 5J6GA 3VCLB 4R7NB 3DSFL 5K33A 4Z2HA 4TTDC 1MVUA 4JFDB 1RHCA 3GHBL 3UZXA 1NBVL 4G3YH 2QUVA 3JUZA 1FAIL 1UM4H 3F7RA 1G4MA 3HPZA 5A6JA 3TYGH 1GZPB 3L67A 3P3RA 3O2LA 3ZLGA 4F8PA 1F9CA 2XU2A 1XLEA 4QUOA 3S3CB 3GUGA 2A6JA 3HAEG 3VNLA 4LNRA 2QJDA 3B7TA 4QS6A 4LK4A 3QZBA 5IROD 3G0SA 1RJLA 1T0MB 4FP8H 5IJCC 2VKZG 1EXBA 4GI4A 2UUDK 4BEIA 3W7OA 3CH0A 4JFHE 4NQCD 1T96A 5T1LD 3GG7A 3VZZA 4FAMA 1MOEA 4OLZH 2APBA 3EKCA 3QVAA 1QHOA 5HJ3B 2BVOA 3EO0B 4W4OA 1WT5C 3HG1B 3KG5A 1THFD 1FRBA 2RJHA 2F38A 4G7VH 3WELA 2NQ3A 2CO7B 4EZKA 1INDH 3V5KB 2EDTA 2Z1WA 2HX7A 4FNLH 4IEFA 3AISA 3BKYH 1ZHBA 1K1DA 2NXYB 2XY2A 3SE4A 1SSGA 4Z23A 4H9ZA 2N1TE 1YNQA 3AZUA 4H8HA 3QMRA 4G80B 1E4XL 3IBEA 2BX7A 3RWJA 2ALDA 1RULH 4DKEL 3V3WA 3OLIA 3L1FA 7TAAA 1ZLWH 1JSYA 5IK3B 3T1FB 2MWCA 1U93B 1KZQA 4NUJB 4PTTB 5EUKB 2OOGA 3VIMA 3D0VA 1OPOA 4JPVL 4BQ8A 1FRGH 3SCUA 5LHDA 1MCWM 3SDAA 1M7DB 3V4LA 4Z3TA 1VFFA 1TZ9A 3BWAB 2OK0H 5BRZB 5J13B 4MJMA 4B5WA 2J24A 1RK0B 4PWGA 3IIOA 1NICA 1FCUA 3OKLA 2IEPA 1PS9A 3L5WB 5JPMB 3DMMB 1OAZH 3JRKA 4JE4B 4BWLC 2VSDA 2ZTBA 2DZUA 2FGZA 4RDYA 4U2ZA 1KXHA 1EC8A 4NRYA 5F7EH 3MV11 1TKWB 1G1YA 2B8OT 4PGLA 1ZXKA 2IALB 4UQEA 3GMLA 4L6HA 1MMFA 4WCJA 2VR5A 3O6DA 2BSLA 1R4XA 1QPRA 4ONOA 3IGKA 1XLKA 2BNRA 2XV0A 4GQ9L 4U6XA 1WXYA 2OMZB 1NGWB 1PZ3A 3NPUA 4AEIL 1D5XB 2NOYA 3UTSD 4U1NA 1FFTB 2ZZ6A 5D70L 4AHQA 4J27A 4W85A 3B9NA 3F7QA 3QBUA 1C12A 4ZMAT 3IGAA 3BUYB 4NCC1 2Q20A 1Q66A 4Q8PA 1A7NL 3HA1A 4AZ7A 4HULB 4YU1A 3EO1B 5HYQB 3OZOA 3GRBA 3WKML 4KJQC 5HPMB 2XZZA 1RZIB 4MCZB 4W4NA 4IU3B 1SFDA 2KLSA 4Y7EA 3RX2A 5EZLA 3QARA 2HJPA 4K5PA 3CFMA 4BA8A 4JW3A 3D85B 3TPUA 4K94H 3HG3A 4P4KD 4KNQA 5D04C 4KTDH 4EXPX 1G69A 1WD8A 1M41A 4FXKA 5EU5A 2Q6WA 3B7YA 4ZPTA 3FQTB 3HIJA 1O9VA 3S5SA 1NOUA 4GUPA 3LN3A 4L3ED 5KVDE 1E5NA 2W66A 4B90A 3OXSB 3NCYP 5E99H 1KBKA 4ZQMA 3VFTB 1SYTA 5DJDA 4NHCH 4DWHA 4OV5B 5TE4H 3TTSA 3MV9D 1JNNH 5JMOC 1HHIA 3ZIZA 4GXFA 5ELIA 1BEUA 5HHOA 3PL6D 2IMNA 1QW7A 3NQDA 4WSHA 3GH5A 4R33A 4MIMA 2DQEH 4V1DD 4IBVA 2V9TA 2Y5TA 3IU4L 3QDMD 1J9CT 2X1QA 1OFBA 3BUPA 4NT6B 43CAB 3EOAB 1JPHA 2VN5A 3QIBB 2RKXA 3PWUB 1I8UA 1T03H 2NY6D 3PXJA 5C07E 1E4HA 4X6FB 4DJFA 2Z1PA 2PD9A 3V9EA 3VDBA 4O02H 4PJ9A 3IJLA 5DHVH 2BHZA 1MRQA 4US6A 3R0DA 3O45B 1BEYL 2WHMA 3PWPB 3CN1A 4NN6B 1SDYA 5B1JC 4MD4A 2FEJA 4HH9A 3RO6A 5T1KD 1L7IH 2PLCA 3AY4C 2P44B 4LTSA 1X8FA 4UMCA 1ZVSA 3OVUB 3DFYA 5KZ6A 3DTXA 4UFKA 4D6GA 3UPWA 3TIEA 3GX9A 3KPTA 3U7VA 1H0GA 1CWVA 3PDGA 4X5RA 3OJ2C 1PO9A 1CXLA 1SLXA 3VG0L 5I1DB 4H0HB 4XZIA 2KYIA 5FDYA 1KFAL 1HIMH 2DUAA 4M1DH 5EORH 1ZUAX 1T4KB 4LVNC 3QCUL 4HHGA 4A22A 4HU8A 2VDOB 3MRRB 3GMPB 4LCIL 1NFDE 3IEAA 3SE9L 1XM3A 2FZNA 3ES8A 4AUBA 1S4IA 4ZRGA 1OY0A 3QZWG 3ULUC 2IIJA 4U05A 5BOOA 5DJCB 2XWRA 1RZGB 4JE0A 1BCIA 3SE3C 5LGYA 3EG9A 4TU1A 5EEWA 1MHCA 5FIEA 3RAJL 3C6EA 2YMOA 1I53A 3FA5A 1MRDH 3H9SA 2WOBA 4TVCA 4IT1A 5EA0L 3EZ8A 3AZTA 2FWUA 2ZT9C 2APWA 3NCJH 5D7LE 3CFJA 3WEMA 1AKJA 4GRWB 1KENL 3BUIA 4ZFZA 2QHRH 5C9ZA 5FECB 4BCZA 4K8EA 2XPZA 3RGHA 3L3DB 3AMGA 4L37A 2G37A 3BYTA 3QQ3B 2EG6A 5GS2H 3TBWA 4ZOBA 3VA6A 1FBIL 1UWEH 4WW1A 4ZFCA 5T1LB 4KK5D 4RA0C 1BF8A 4N0FA 3QR3A 1EPVA 5I3HA 2UBPC 2VXTL 3RU6A 3O4LA 1DVFC 2J4WH 1NC4D 1Y6KR 3WCZA 3S37X 5H6HA 3W38A 3WSUA 2IDFA 3CFCL 2J7BA 5E2TL 5HDLA 2EIJB 2BCMA 4GG8A 3BUQA 4OD1L 2Q8AH 1KBJA 3CV5A 2NW2B 3KLDA 1NAKL 1BD2B 4Y19A 5T3ZE 4P3CL 4UTBA 1URIA 5SWZD 4NM8H 2VJ0A 1HJSA 4UT7H 1IM9D 3B2DC 4MX7A 1F1GA 4FA7B 3SDCC 1SEBB 3N44F 3QPYA 1D5MA 1A5OC 3O8XD 2PBGA 2HRLA 2DKMA 4PI2A 4POYA 3O1NA 4MZRA 1GW9A 4N02A 3WQGA 4L9LB 3D4CA 2D7OA 4BFAA 5B7MA 4P7NA 5AVSB 1N70A 3BOVA 4KZEL 1OW0A 2W27A 2APSA 2MOVA 1J7VR 4N9DA 4PMVA 2HT4C 1QR7A 4M6OH 1QZNA 3Q1SH 1BGXL 4LOVA 1WB0A 3QDHA 5IGXH 4B91A 4HA1A 4ZK8A 5DJ8A 3UGEA 1HZKA 3NO3A 4ZUWB 3WQVA 3A4JA 3MRGA 3D39A 4MWAA 1BRLA 3QEUB 3O2DH 4JVUA 4GMSH 5IQ9B 1IX2A 5A95A 5J6HA 2W60A 1W9DM 5DFWH 2RA1A 5ICXB 3S35L 3IPBA 2YA1A 3BLPX 1V0KA 1SBBA 3CDFA 1J5IA 3QRHA 4TSCH 3CSPA 5SWSD 4UB0L 5LKYA 3RGVB 3NESA 4M9OA 5DVLA 3TBCA 1IR1A 3WNJA 3HG4A 1J10A 4IHBA 1KOAA 5F9DC 4NWUL 1BQ5A 1T2QH 4PBXA 5I2UA 3FN3A 1PXGA 1PZ5A 25C8H 3UTSB 1TR1A 3UC0L 5C9UA 3TR9A 3PBWA 3QJXA 1CLOH 2V2TB 1A7QH 3FN9A 5JOFA 1A7PL 3U2SB 4DBDA 3JTSA 1E6SM 3QCTL 2YBRB 4OWGA 4ELMB 1YY8A 4QEEA 3GRIA 1JYXA 3CBWA 2Q0ZX 5CJXA 2NMSA 3RX8A 5CNHA 5D4YA 1UD5A 4XCCL 2VSKB 2VQ1B 5DJXB 4LYQA 4OF7A 4EUPA 4DZ8B 2ZWZA 1IAKA 5FYKU 5DI8A 3KPPA 1B0GB 3KGSA 4EI5C 2NY3B 2V2XA 2XY1A 4W8AA 4I85A 4MDIB 4GHRA 2R4RH 4Z7AA 2XFGB 4NJ9L 2FWOA 1WA2X 4A2RA 1UJ3A 3SJVA 2R2HA 3BKJH 1MWOA 3WF3A 3CSYA 4R97B 4L3EB 2ICWB 3MRCA 4S1RL 1CCWB 1LLWA 5BXPA 2J7DA 3WLHA 1PBYA 4N2MA 1FO0B 2EDMA 1S2CA 2ALRA 5BUAA 3AAZA 4JANB 4RNFA 4OD3H 1YYCA 5HYJD 3DO7B 2PB1A 5EN3A 4FFTA 3SCMD 2BTMA 4HBQA 4L64A 2N7BA 1V8HA 3H8AA 1OP9A 4JRYD 3E3QE 5IUCA 5AYXA 4W9CC 2Z1VA 2NY6B 3NDOA 3KHOA 1IAMA 5BVPL 5KSAA 3AXIA 1KN2L 1OF2B 3UYPA 3CUIA 3EB2A 2VCBA 4TNVK 4W6WB 4RGNC 1W1ZA 4IIHA 1HVXA 2MFNA 2V7HB 1T2JA 3AXKA 3UJTL 1I3GH 1AZBA 2YJLA 4XAGA 1M2VB 1ECQA 5IQMA 2YYTA 2PTZA 5PTDA 4X7TA 5AHLA 1RHHA 1ZCCA 4M6MH 1CF8H 1X97A 4OI7A 1VRSA 1V54B 1ME7A 2H8PA 4N0YL 5D9MA 4K73A 4Y4HB 2ZX7A 2KX9A 4PLJD 3PZVA 4FX6M 3GBMH 4K2UL 4ZCWA 2TRYA 5C8JB 4U6VL 2FO1A 3KR3H 3OMZA 1QO3A 2H3XC 3ATYA 1IGFL 4Z3IA 3MUAA 4QTHB 2FZ8A 2E27L 1UM6L 3SDYL 3CQJA 3VWKD 4GI8A 3V4VB 1ID2A 5FOBB 2OQYA 5B38B 5B21A 4Z3EA 4N42A 4MAYB 4GUHA 2O7QA 5ID1B 5EA9A 4NYYA 4FFYL 1TPUA 4L4TD 3QV6A 3M0HA 3GO1H 4F15B 4OCWH 5E08L 4NX5A 1T7WA 1XMEB 4YGVA 3BAEL 3DYOA 3QHOA 5CEWA 1PPIA 3U30C 3GFXA 3MP3A 3UFYA 4NOFA 3QGVA 1IWPA 4KGLA 1CU4H 5D1QD 3QQ0A 2ICCA 1CICD 5F2GA 4JHVA 2F84A 4IMKC 3SPVB 2CK0H 1LQ0A 3GJFK 4YZFF 3UDWA 1A14H 1LK3L 1AGDA 4ZW3A 3CL8A 4D72A 4N0CD 5E8OA 1RBLA 3UCQA 2CZFA 5EFIB 1RP8A 1AE6L 1UJQA 4YWGH 2QPDB 1E27B 4NZTL 4RRPG 1HKMA 4JM4L 1FCBA 3VKCA 1FVEB 4JQIL 2EE6A 4HU2A 3MOBL 2RHGA 5CCJA 5AN7A 3CQIA 3CLFH 3WIHH 3W76A 1YEDA 3DV6B 5C08D 1AD1A 4Z2IA 1AYRA 5BQDA 2ZZ7A 1JPTH 5D9SA 1UXLA 3SE6A 4LPTA 3R1ZA 3GU2A 3AWFA 4C57C 3I75B 3VGEA 1U6AL 2VDRL 3DI2B 5DFAA 1KTDA 3R0NA 2NUYA 1H15B 5CU9A 3FUDA 2XWZA 1YYMH 5K1NA 3L3OA 4XBSA 1LQSR 3M5XA 1SO6A 3VFLA 2GK0B 5KTLA 2FZ3A 3QA3B 3L7EA 5JR1L 2WW8A 2GSHA 2NY1C 1NC4B 4BHUA 1AY1L 3ANYA 3QPZA 1ELSA 3VO0A 2WZPA 1N67A 4LOEA 2QV5A 1KIUB 2ZP0T 4XTIA 4K3HA 2VMEA 4OZIA 3IE4A 3RWHA 1O68A 2K6ZA 1KV3A 2NT0A 4KHTH 2HNHA 5SWZB 4NU7A 3SBPA 3HI1B 4CNNA 3D69A 3E5BA 2LU7A 4OZIF 4YNYA 1DBKL 2ZADA 4J3WA 1HCFX 5HI4C 2Z8SA 4UOJA 1QI2A 1RUAH 1K77A 4C1LA 4YPGA 4XX5A 3UAFA 5AZEL 2AJVH 3SPCA 3SB0A 4FFWC 5LGXA 3VXQB 1B3IA 4Z1PA 1A9EB 3TZVC 1QJWA 1S3HA 1NFBA 3M6DA 3F05A 4ODVH 1E3ZA 1AD9B 2NVAA 3VGFA 2QKIB 4E38A 3QEGL 4WY0A 1DQKA 4U1MA 4C6KA 5HHVH 2VXSL 2HT3D 1AFSA 1IEAA 3LS4L 3WIIH 1KIQA 1UR3M 4R4FH 1DO5A 4WY0F 1E15A 2XWDA 1TJHH 2Y7NA 1WA0X 1BVKB 4XPFH 3SCWA 3JWOC 3BVJA 3NAAH 2WO4A 4FFZA 4X5WB 5HI3C 2OMUA 2BSTB 2W59A 4KMLB 2VMCA 2OX5B 3UYOD 3SQOH 2Z35A 1U8OA 5IQ7H 5DMMA 1YAIA 3R1GH 4KQNA 3FHQA 1J1OL 3VSUA 2ABBA 1V5XA 1Q1JL 4FXTA 2DZPA 2QGEA 3B7UX 3ABRA 4NS0A 3FO9B 1JGLL 2JJUA 4IOFC 4QCEA 4XNBA 1UB6B 5ITFB 1S9XA 1RZJL 4WW2C 4E2DA 2JKRM 1NWOA 4DP0X 2HX9A 1XIJA 2QTVA 1EO7A 4LP5A 1DLFL 5JPNA 1MWAH 3GSNL 1GVSA 2J9ZA 4EIZC 1CB2A 4IUGA 1PLGH 1JYWA 4X8XA 2R69L 3I10A 2QF7A 3IDJA 2JMRA 5J11B 1KXTB 1CG9A 4MNGB 3K0WA 3W7GA 2Y3AA 3H2EA 3NCBB 2LFEA 2VDQL 3KYAA 1ODZA 4OCXH 7FABL 4XC1H 5EZOH 3GVRA 2OVLA 1F7BA 1IEXA 2A9CA 2C1IA 3VI3E 2VXVL 4WO4A 3NACH 4XB7A 5EULV 5AHMA 4V1YA 5HYJB 3H3PH 1L4IA 4NP4L 2GJXA 3TWCL 1P1MA 3SCMB 1NINA 1XQ4A 4O58H 4QRTA 4ZAKA 4QTIH 4AVOA 4IX0A 3W1TA 1RIHL 2NQLA 4KNSA 5AVZB 3U4BL 2VGGA 4NP7A 4N9OB 4DQOL 4AOFA 3QH3A 4Q9QL 1JHLH 4J6RL 1DVXA 3UPRA 1JZHA 2VZ1A 4HOZA 2Z2UA 4O19A 3NZHH 3IYLW 4A2SA 2FB4L 4O2CA 4RWYH 4HS8L 3T8VA 4P8QA 1YMMB 5FS5A 4UFIA 4OLWH 3M1OA 4HJWA 3N2CA 5GZNC 3CHCA 1KCUH 1IAIM 1I9IL 5I6KA 4X2PA 2PAJA 4KERA 4AIUA 2DJMA 2AEPL 1M68A 3MLYH 1M7UA 2UY2A 3U5UA 4OTXH 3FN0H 1SZRA 4L5FH 2X2IA 4H0GA 3DLQR 3W1ZA 3SRDA 1XLFA 1HYRC 4AWTA 1BFVL 4OZGE 1Q4NX 3BISA 3QUZC 1ZLUH 3QXUA 1F73A 3NVQA 2DEWX 5FO8A 1XX9C 2YPVH 3MV7A 4HMCA 3RFZA 5AECA 4YBLC 1U36A 1ECEA 4UOW1 5CUSL 4FR6A 4PP1D 2WZAA 1EH9A 4FS0A 4KXZH 3NO5A 2PCFB 4X7EC 2APVA 4XBGA 2DKUA 3L3KA 3SE8H 4MAUL 1BMGA 1JF6A 2XFXA 2EYSB 2EDYA 1XICA 2NZ9C 4BFEA 1V6YA 1U8HB 3MODL 1ITXA 5AZ2H 4KAQL 3PBGA 4PGCB 4QAMB 4Y9PA 4LU5H 4PMJA 4P9HH 4WU7A 3VJ6B 4KO7A 5FYKH 5TDOB 5KSBB 2PW1A 4N2OA 4YBHA 5CZVH 3EH5B 4MQ7A 4PBFA 1S5IL 3KXFA 1KNWA 1W6WA 2F7FA 1JDAA 1LBFA 1GKQA 2ATPB 1BG1A 3ZMNA 1V10A 3GPSA 5EIVA 4PV9A 2JKAA 2Z92B 5EU6A 4Z1YA 3QDGD 5BMWA 5I5IA 1NIUA 2CKNA 1ZMYA 4I18B 1UACH 3IJEB 3HC3H 4ZI8A 4XBPA 2ITDA 4KH2A 4XXWC 4QE4A 4EP8C 2XSBA 4ETQA 3R8RA 2BIQA 4K9EL 4WIWA 1CLZH 1K8DA 3P30L 4O02A 4UFMA 2EDHA 2Z34A 3TM6A 1EL3A 5DHVA 4Q52A 3AI0A 3QQDA 1KULA 4GIPD 4D9LH 4F0HA 1B5TA 4TQHA 3CFEB 2PLKA 3VKDA 4ANKA 2I69A 4NHUA 4IOTA 3HNSH 2WKOA 2JQZA 4YDKH 4IOSD 3UX9B 1NCWL 4E8GA 5C9JB 3TR2A 2J2ZB 5AVXB 2A2QT 3N14A 5I6SA 5E6ID 1LOQA 4M7ZC 3LDVA 2VR3A 2QR0A 2WKOF 3ITGA 2ZF9A 1KM6A 4KRZA 2ROXA 2AZAA 1A2YB 1A6PA 3RL2A 1WDAA 4BZ2H 1ITQA 1HP4A 1R87A 3RUGB 4MMXC 3LN9A 5I1EH 3P5ZA 3ESUF 4RFEB 4PJCB 2OSWA 4Z18A 5DZAA 3DPBA 3SSJA 2D7MA 3FFDA 4QYAA 4JUSA 2YMXH 4YYFA 3TU6A 1BF5A 5HDWA 3R94A 4Z2LA 1UGKA 3UO8B 3OM3B 3AWOA 4W9ZA 2YGYA 4ML9A 1TO3A 2X0SA 3EAKA 1BAGA 3AFBA 2P28B 4C5ZA 4X7FC 5K59E 2YX0A 3IU3B 1FWSA 5E70A 1CDHA 2VLKA 3GDCA 4ONGL 1OG0A 4GNKB 3O6KL 4KMTH 1R3KA 2GK1B 1ZS2A 4F37K 5BOJA 5E00B 4P2VA 4RLIA 1HEJC 3VXMD 2LABA 2WXQA 1UJPA 2D69A 4N2GA 4P2OD 5HYSB 1S8DB 3U2EA 2HXAA 4KJPC 3E6FA 2PO6C 2VDPL 4PM1A 1XQLA 2DT0A 1YZZA 2A3BA 1PD6A 3V0VA 3QJSB 1QSFA 4PP2B 3K1KC 3ZJKA 4MQXD 2R9RA 1TDQA 5I77A 5KZCB 2E7FA 4Q33A 2OOFA 3UL4A 5FESA 2P49B 2WN3A 1J5CA 3W7IA 2DD8H 1EDYA 2ZJSH 4E41A 2ZOTA 3TC9A 4XNXL 2YZ5A 1YYLH 3L9RB 3PPGA 4JR5A 1IC4H 4PJBE 2DWXA 5ICUA 3EBVA 1LO5B 4Y16C 1I1RA 4ETYA 4LLWA 3NTYA 3M7OA 4MNQB 3W9DB 3F2BA 2HFTA 4WEEA 3HPJB 3TF4A 1QYGH 1BXBA 4LRIA 3MRJB 5HD8C 3SQBB 1U58B 4OLXL 3CZSA 3B8VA 4BI6A 3QSRA 2D3LA 3IDMB 1G4SA 3FJTA 4E9XA 3C8FA 1NJJA 3ARYA 3CFNA 4Z76B 3EFDH 4WNJA 5F89B 1PB0A 5DRXB 4OAWB 5I66A 3NNTA 2ODOA 1GOXA 3WK0A 4RDQG 1VD6A 1UZ6E 2C13A 1MXGA 4D7PA 3RWIB 5JIHA 3IDIA 2OXNA 4YSSA 3DX4A 4L3AA 3WDPP 1OCQA 3H53A 1LM8V 2H6UA 4LEBA 3KM2A 3TJEL 3FPXA 2VE6B 4AEHH 1FWFC 2HS8A 1PHQA 2DZXA 5AYTA 1DBBH 3V6BR 4E0CA 1F4AA 4XWGH 4G43B 3C5JB 4WFHE 1ZDQA 2A7BA 4J3UA 1HCVA 4U3SB 4WI7A 4FHBD 4GFTB 4JDBA 3MN8A 3GE7A 4WD0A 1H3XA 1FYTA 2C4FU 2IAAC 5I00A 2HJKB 2G75A 5DR5H 4RJEA 3DV4B 3LTPA 3O2DA 4AV5A 4GRMB 1P1XA 2J8TA 3QMTA 1NBZA 3ZHFA 4RKAA 4DGIL 3NZUA 5I23A 1HKFA 2ATSA 2D4FA 3VRJA 1IC5H