4DO5A

Pharmacological chaperones for human alpha-n-acetylgalactosaminidase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-N-acetylgalactosaminidase
publication title Pharmacological chaperones for human alpha-N-acetylgalactosaminidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 131
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4do5A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4do5A01
2ZA3A 3WY2A 3LDVA 2XVLA 3EJPA 2WPGA 1OT1A 1KM4A 3LRLA 1JGIA 1SO5A 1EWEA 2NWSA 1W3TA 4N9BA 3E9AA 4IWWA 1RQEA 1PL9A 1EUNA 2QMKA 1WDWA 2EF9A 3LGEA 4O15A 4OE7A 5A5WA 3BSGA 1SQ7A 2V3EA 3NNTA 1G4PA 3QEZA 2WVSA 3O07A 1W5NA 4NX0A 2G3MA 1OYCA 3K30A 2WVVB 1I45A 3NL3A 4WQ6A 5HMSA 2FGZA 3RILA 3TXZA 3W1MA 4O13A 2BHYA 3WJYA 1S46A 3S0CA 3Q94A 4FLSA 2IGTA 3SIZA 1BPLB 1BF2A 3OLEA 2QF7A 3W1UA 4UZUA 5E0KA 2DU2A 3MYPA 1QPQA 4DO5A 3FA5A 4OV4A 4O12A 5DY2A 3NQDA 4BA0A 2ZUVA 3BVWA 4H4IA 5D2YA 1G5AA 2VEKA 6TAAA 4AHPA 1JXJA 1WP6A 4H6KA 2ABBA 1YDOA 1J0KA 2NT0A 5AOUA 3L4XA 4OT7A 1W5QA 1VB9A 3KFTA 5AYXA 3HPXA 1RPKA 1WPCA 3IK2A 4AEEA 1VYRA 4XBKA 4E0CA 1TQTA 3ABQA 1MO0A 5HWNA 2X2IA 1V7YA 4JEQA 4O4WA 2YFOA 3JS3A 4ZMGA 3NM1A 4JFSA 4OKDA 2WSYA 3JRKA 4XUGA 2WCGA 3HGRA 1CW2A 2QEZA 2YA2A 3OIXA 1LWHA 1DOSA 3V75A 1F5ZA 3RF9A 1JD7A 3A5FA 3TQVA 2Z2UA 4NZJA 1K02A 1WV2A 4HIBA 3UPBA 4NU7A 4AHQA 2DJXA 3EX3A 3NPUA 3P81A 1JUEA 1M7OA 4JIPA 3M0ZA 3KE0A 4FHAA 4QAIA 5LKYA 1SZNA 3WENA 3SSJA 3O06A 3W7DA 3PSWA 2WVUA 2XN2A 1UUMA 4R33A 1Q4NX 1WO2A 1FWSA 2G5WA 3BG5A 5E1QA 3TSBA 4KFPA 3M07A 2DZWA 4PCFA 3S1UA 3P80A 1KM3A 3NL5A 4X3ZA 4AIOA 5KITA 2C8NA 4DBDA 5D37A 2OW6A 2NLIA 2PWDA 1FXQA 1FCBA 1MZHA 3NL6A 1SO4A 3IVTA 1GVRA 3QRHA 4JX4A 1L9WA 3WMSA 4UR7A 1KFEA 3GXMA 2GQ9A 3UWVA 1JR1A 2CZFA 3B8DA 3DENA 3M41A 4JFVA 4B5NA 2ZTKA 2GVGA 1CX9A 2HMCA 4HOZA 4CNPA 4Z0JA 1I8JA 3P7YA 2GUUA 3NEVA 3I65A 3MHUA 3BVVA 1L6SA 3W3OA 1SO3A 4GE8A 4XTDA 3QFEA 1E3ZA 2QCDA 4X0NA 3WY3A 3RLUA 2YOCA 2J24A 1EA9C 1LROA 3NQMA 4Q4KA 1TPUA 5HR6A 1VCVA 3UPWA 3W73A 5G4EA 3DFNA 5CPLA 2ZA1A 2Z6JA 1S3HA 5IBXC 1GJUA 2XIIA 3DDFA 3O8AA 4GWEA 1QHOA 1IXQA 3GDLA 1UCWA 2GVLA 4UFMA 4K37A 2LLEA 5F7UA 3IGUA 2CLHA 3GTNA 1H51A 3S42A 2HTMA 2KZHA 3G3DA 1OFAA 2V2CA 1KXQA 3LHZA 2WKJA 1AL7A 4LPCA 2OJPA 2X1RA 3CEPA 1YTEA 3PS7A 3BCDA 3WK1A 1CXIA 3NG3A 1PIIA 2NWRA 1KBBA 2I14A 4AWTA 4WF7A 4GUIA 3WEOA 1DHPA 3UXDA 4AXKA 3KOFA 4TIMA 3RK8A 5MHBA 2F18A 3P8IA 4O4VA 3ZT7A 3PUOA 4WUIA 3TROA 2FB3A 5LNUA 1PPIA 4NQ1A 3IV3A 3ZSSA 6TIMA 3HIJA 1TJRA 1MW1A 4FNRA 1X1ZA 4P2VA 1QCWA 4RLIA 4N6FA 3NQVA 1WZLA 3P60A 1BAGA 2QCDB 4UZSA 1DV7A 2TSYA 2BXZA 1ZY9A 2E1DA 1K8YA 2BHUA 2R14A 5CPMA 3CZKA 3R89A 1XKYA 4UMBA 3GXNA 1GVSA 3PUEA 3H54A 4MUZA 2ZX5A 3FFSA 4DF1A 2BLEA 3PR2A 5EY5A 3SGZA 2RH9A 1XI3A 1LORA 3LOTA 1YXYA 3IIOA 5BW6A 1HXKA 1FBAA 2X16A 3ZR4A 2ZUWA 1EWDA 2JKAA 1DTUA 3L9CA 1IV8A 4MY8A 1TPC1 5L6UA 4Z1DA 4JGDA 5FEWA 2Y7FA 5CGTA 3EWYA 5I3GA 5FF7A 1JQXA 2PC4A 2Y7DA 4JTKA 3QYQA 1VCFA 2G96A 3TQKA 1JQVA 1TQSA 1JF6A 4YL2A 3TFCA 3LXBA 2O7QA 1U5JA 3ATZA 2ZX9A 1ZHAA 1I2NA 2C13A 1XH0A 4O16A 2YX0A 3BAWA 4GKLA 4KWWA 1CGYA 2YJQA 2E0PA 2I9EA 3O1NA 1MW2A 1TREA 4MY9A 1I75A 4UTTC 4WXYA 3EKLA 4MOZA 2V82A 3L4YA 3CZLA 4IUOA 1FY6A 1SPQA 1DKWA 1A5BA 4GRSA 4OWGA 4U28A 2OMAA 5C54A 2EAWA 3L68A 1JVNA 4M7TA 2ZXQA 1KW1A 1TMHA 4H8VA 5AHLA 3QSTA 3L4TA 3NXFA 3EX6A 1LYXA 2WKGA 1A53A 3G22A 1AMKA 4IMCA 1XBVA 3MO7A 4RZ4A 4UIOA 1EH9A 3GX9A 4QJ1A 3OBKA 2GJNA 4UTJA 1VFMA 4UMCA 2E6FA 3NPWA 4LVBA 5CPOA 5FEZA 1X6UA 4O18A 3D4ZA 3OEXA 4OQVA 3UWUA 3BVTA 3PB2A 2R8WA 4MFEA 1WZMA 4FNQA 4R34A 3W83A 2PWFA 2Y89A 2F7OA 4GFSA 1BWLA 3A4AA 4IGHA 3C2FA 5AB3A 1VR6A 1ML1A 3ZR6A 1V3JA 1HUVA 5IBXA 1I2QA 4M6QA 4NVTA 3CEUA 1U2YA 3HGSA 1OF6A 2A1YA 1TIMA 2DZPA 1R75A 1V3MA 1UASA 2ZXAA 3P5YA 1CIUA 4XBSA 3PG9A 3W2UA 3W75A 3W7JA 3C0JA 1KFJA 3CV5A 4J3WA 3L66A 3KVLA 3NQFA 3SW6A 1CI1A 4CLMA 4OHQA 1LCOA 2FIQA 3IVUA 1E43A 2VKZG 3ZQ9A 1ZCOA 1UKSA 3VNDA 2P10A 4TU1A 1G7VA 2XWDA 3AMKA 3VGHA 1VGAA 4HOWA 3LCIA 2W79A 3W38A 1QDSA 4ML9A 3L2MA 1GVFA 1PHWA 1TV7A 1W5PA 3GK0A 1O95A 4RXGA 4K7VA 2VFEA 3MI6A 1QMLA 2OSYA 1SW3A 1ZJIA 2X2GA 2RDUA 3M5VA 1PV8A 1OVDA 3EKZA 3S6DA 4AF0A 1Y0EA 4GBUA 2F61A 3BCFA 3LBMA 4FLRA 1G9HA 3WNLA 2F84A 4FXSA 4FLQA 3W74A 2ZCGA 1NVMA 3CWNA 1DHKA 3DX4A 1ZAJA 3G1XA 3PAJA 2BY3A 1GZGA 7CGTA 2QJHA 4QNEA 3SR7A 3BAIA 2ZTJA 3QPZA 1ZJBA 1XC4A 2VR5A 4O52A 3F03K 3UG4A 4TMBA 5K2ZA 1DQWA 1K03A 1AW2A 3ZT6A 3S1VA 4LS2A 5D02A 3G1DA 3HMJG 5HULA 3A5VA 4DQWA 2EJ1A 4WSKA 3R13A 1CGVA 3DXIA 2C3ZA 4J7RA 2YA0A 2DZXA 2EAEA 4N9CA 4CVWA 3EJUA 3VCRA 3QMTA 2WCSA 5DLCA 1HL9A 2VEPA 1FX6A 3BARA 3CTTA 2XVGA 3LCHA 3ABSA 3CTLA 3VMNA 4DBEA 4AF0B 1GTHA 4CQAA 3IJ7A 3WNKA 5I23A 1BG9A 5G2IA 2H3DA 1OFRA 2A0NA 2QJIA 1M7PA 4OV9A 1TQJA 3HJZA 1QOPA 1MW3A 2D2OA 5D05A 4FNUA 3P5ZA 1I2PA 3LV6A 2X2HA 1P1XA 1VPXA 4LS0A 4MLJA 1BWKA 1YLVA 1SMAA 4UQDA 5KZEA 2ZRYA 5HWMA 4BWLA 5C6MA 2AGKA 3STCA 1F74A 1OX4A 2OYLA 1GG1A 3LCGA 2ISWA 4UOQA 4LRTA 4OU1A 1ZJAA 1OABA 2E6AA 4CN6A 4JL2A 2VXNA 2ZZ2A 3PBUA 2ZUUA 3TSDA 5AC7A 1TTPA 3ZO9A 4LVDA 4IX0A 5FEXA 2ABAA 5HJLA 5IM51 1TCDA 1YPFA 3H55A 4M56A 2YDAA 3HZ3A 1GOXA 1GPWA 5CGMA 1BLIA 1G6CA 1H7NA 1W1ZA 2QCNA 5F1VA 3IEBA 5LGXA 2NXIA 5KZDA 4WSJA 4ADSA 2YPIA 1UH3A 1EP1A 1JCMP 1DJNA 3TC6A 2ZWZA 2JK2A 3YPIA 3LCFA 4BI5A 1QW8A 1R33A 3EJQA 5EA9A 1Z32X 1PCKA 1GG0A 3M5ZA 2HS6A 3W7CA 1J2WA 1CXFA 3BO9A 1WA3A 2YIHA 4O11A 3BH4A 4UTLA 4AW7A 1KTNA 3OG3A 4HKPA 4Z1BA 3N73A 4NNBA 2CPUA 3I7RA 3I7QA 2CLLA 3NQAA 2YZRA 3NR0A 5EYWA 4LS1A 4AAJA 3FW6A 4Y6GA 4FX6M 3N14A 5LNVA 4K6AA 3A6OA 1OX4B 3P61A 4GJ1A 1G1YA 3TAOA 4WD0A 4NXSA 2A7PA 2IQTA 5AFDA 3WDIA 5BMXA 3EJRA 3D50A 1C29A 3KX6A 4CQ9A 3MUXA 4JTLA 3IVSA 4FNSA 2GJRA 5I3HA 3CM4A 2O7SA 2WVVA 2BZNA 2RFGA 5HXMA 5EBUA 3TTYA 4WY0A 3VNZA 4GI9A 3WDJA 5CZSA 3E12A 3BW4A 1WOAA 3NQ7A 4JTIA 3HJEA 3DHPA 3DKJA 5D03A 2YA1A 4HP5A 3T44A 3LPOA 1UB3A 4TX9A 3VM7A 4Y96A 3CGTA 3DFQA 5G2HA 1J4EA 3N9SA 1LWJA 3EEGA 1VFUA 4M8UA 1VHNA 1H7XA 1L2UA 3CC1A 4I7VA 3S5YA 4Z08A 1R2SA 2J9YA 3GZ3A 1SR9A 1SZEA 1LBMA 5CLWA 2FH6A 1PS3A 5LNWA 2WQPA 3CIWA 2F7FA 1DJQA 3HPZA 5D09A 3EX4A 1QPKA 1IGSA 1L0PA 1PIGA 3BVXA 3D51A 2C16A 2XFWA 4AWUA 2BY2A 4DELA 1QI5A 5E6YA 1BTMA 5I24A 2J27A 3EXSA 5DBTA 1EX5A 1JCLA 1A5CA 1T96A 2WSRA 1UJPA 5I5RA 4ZVJA 1TPB1 4WX2A 3UG3A 3W2MA 1M53A 4TMCA 3QMRA 3S2CA 3FEMA 3G1VA 4NXKA 3NQ6A 4JTUA 4HNNA 1ZFJA 2PRHA 3DAQA 4I7WA 1HL2A 4J3UA 3FS2A 3MBFA 3TK7A 3HPSA 3BMWA 2VFDA 3L4ZA 3O16A 4CCEA 2V9DA 3DHUA 2QKFA 3W7EA 1WBHA 1QO5A 5K9XA 4WY0B 1CYGA 1FDYA 4S2BA 2EACA 5HUOA 3T55A 1JDCA 1VIWA 1YPIA 2V30A 1OYAA 3C8FA 3E0IA 2FE0A 2YYTA 3P67A 4UTMA 3B04A 5HQEA 2F7QA 1KBKA 1S5TA 3W7KA 3DU0A 4UUIA 3LHVA 1L6YA 3GIYA 3N3MA 2TRSA 1W3NA 2C18A 4IPIA 3B0VC 3EWUA 3WY1A 1ONRA 3IGSA 2ZRXA 4YWIA 3P62A 1AVAA 2GJPA 3ECQA 4U33A 3W84A 1KGWA 2VEMA 1QWNA 4N6EA 2ZQ0A 4H8UA 3WJZA 3HBLA 3CZEA 4PSRA 1CXEA 3NGJA 2H6RA 3E49A 1DEDA 5DXXA 5G1YA 1AQHA 4LVFA 1MEWA 2FYVA 1M5WA 3KWXA 1K3UA 2ZWYA 2RKXA 2OZ0A 5H2ZA 3S1WA 3BLKA 3MJYA 3UY7A 4B9YA 2FHCA 1GWJA 1GEQA 3W86A 5E93A 2E5BA 3DHDA 2H3BA 3O6DA 3DZ1A 3DC0A 2R91A 2E6DA 3R8RA 2ZZ1A 1OX6A 3A9IA 1ICSA 2E68A 1XCFA 3T4CA 5LSMA 4UFKA 1R46A 1XSKA 2B7PA 4ALDA 1KTCA 1LRQA 3UXAA 4JTJA 5FF2A 5F2LA 3IJ8A 1XXXA 4ZQOA 4AH7A 3WFZA 2F7RA 2WJZA 4OBTA 3MMTA 1XSJA 2Z1KA 5TBOA 2GQ8A 4I7UA 4QIUA 2WSKA 4O1DA 5F4WA 4HNTA 5LNRA 2NUXA 2ZICA 1OFDA 1RPXA 3THQA 3QQ1A 3KHJA 5KTLA 1B9BA 2UV8G 1CGWA 3RNDA 3W1TA 2WSPA 4UFLA 4AWSA 3BAYA 4TVUA 2D3LA 1AK5A 2ZX8A 2X1SA 3FLUA 4BF9A 1VS1A 1FDZA 1S5VA 1X7FA 2H90A 3TR2A 4EVZA 2GVYA 3GKFA 2ALDA 1HTYA 1XBYA 2VFHA 4HNUA 1F73A 5I3KA 1L6WA 4MB1A 1KFCA 3GXFA 1Q6RA 3BLBA 2C15A 2C7FA 4O8RA 1HFBA 2Y61A 3UG5A 5EPDA 2B7QA 2C0AA 4AEFA 1RQHA 3GXIA 1E40A 3AMLA 3DBPA 3BW3A 1ALDA 1K7EA 3IIZA 1EO5A 4JFTA 3HG2A 1KFLA 3ABOA 4Q33A 3KAOA 2Q8LA 4AIEA 1OG0A 4GO9A 3FKKA 1JRBA 4J3VA 4LU0A 5AC8A 2QPSA 1KV8A 4JTGA 2RDWA 3UERA 3RU6A 1ZALA 3OLIA 4S2CA 3BLIA 3TIMA 1J0HA 1K7FA 1OFEA 5F4XA 1JIBA 1F05A 4E38A 4L4LA 1UD2A 1GVIA 1QHPA 1KB3A 3UWYA 3VE7A 4YCPA 1B2YA 2ZIDA 1TB3A 3NVTA 4YLWA 2PWEA 2ZDRA 1TJPA 3OVQA 2J88A 3LTSA 4MKNA 4PH6A 2V3DA 3WK3A 2E8YA 5J5RA 5E9AA 4U31A 4AHOA 4N2YA 1R34A 1KBIA 2VENA 3UY8A 1NSJA 1CGTA 4IMEA 2ZBTA 1TPWA 1KFKA 2ZXDA 2EADA 4J28A 3MP5A 2BXVA 3EDFA 2NXHA 2FH8A 1TPEA 2WPBA 3CIXA 4FIQA 1GQNA 4PEKA 3C2VA 3E96A 3EJSA 1LRTA 2B0MA 2VNCA 1YTKA 5CSRA 1W5MA 2FTPA 1H60A 1DL3A 1DVJA 8CGTA 1H7RA 3DI0A 4JS3A 3N34A 3W2KA 1D3HA 4MAZA 4W9TA 4E2DA 1LZOA 1Q45A 1LRNA 5DY3A 1YTDA 3SFKA 3S5ZA 5DCEA 3KL0A 2BXYA 2NX3A 3MHFA 3NZRA 4MVAA 4RR4A 3M1ZA 3AO0A 3FJ6A 4O0KA 2QUVA 1RQBA 4B9ZA 3EB2A 1I2OA 4Y8FA 5E6ZA 1XDLA 3RLVA 2PWHA 4MYXA 1TRIA 1MFUA 1W5OA 3KVJA 1UD8A 3L0KA 4DXVA 1KLZA 2CWNA 5EMYA 3M5YA 1PIFA 1D3GA 3PULA 4RK8A 4HA1A 4M6PA 4GI6A 5J5DA 4UTWC 1ZNNA 5LHFA 2V81A 4HT3A 4FNPA 4LV4A 4RJEA 1TTJA 2AAAA 2XIBA 2NX1A 2YKKA 5C5YA 2Q3OA 3VGEA 1UD6A 3EXTA 5HWJA 1TPDA 2TMDA 1VCGA 2Y2WA 5HR7A 1MW0A 4GQQA 4Q32A 3LXCA 3K8LA 4U3CA 1PZ2A 4A21A 2CLOA 1WYIA 4UNIA 1UOKA 3CB8A 2V8ZA 5U7SA 3W7PA 1I2RA 3EWBX 3B0UX 3DFPA 1AQMA 3MI3A 1H61A 1EHAA 4N4QA 2XN0A 3VGGA 1JUBA 1S5WA 2OSXA 2CLKA 2QPUA 1JXKA 2Y88A 3FJLA 4N02A 3NQEA 1JD9A 4J27A 2B4GA 1JDAA 4LQ1A 4BWLC 4R7JA 3BG3A 1SUXA 2GJLA 2J9ZA 4GQRA 2AAMA 4ORIA 4D2JA 3PB0A 3MP3A 1M7XA 1V3KA 2OCZA 4ZZ9A 3HG4A 3DFOA 5BRPA 1G4SA 1FWRA 4O28A 2ZZ4A 4NJHA 1KGXA 1MSSA 4UMAA 2YFNA 1XD1A 2Y70A 4J3XA 3VSTA 3V1PA 1OFQA 1P0KA 4RV8A 4XZ9A 1VH7A 3EDJA 3RIKA 3M16A 5D32A 2G95A 1N7KA 4PL1A 3WFAA 3UQNA 1TTIA 3N19B 3G18A 4FMVA 1HWWA 3T78A 4IX2A 4UFHA 3NO5A 1Z41A 2ZRUA 3UCQA 5K4XA 5SWUA 3VGBA 1ZAIA 3W07A 2WNWA 1VFOA 3LRMA 5CPNA 1JUKA 5F2GA 3R2GA 1QWGA 3VX1A 3KRSA 3VSUA 2ZZ7A 3OA3A 1N55A 3W7OA 1XH1A 3BUIA 1HG3A 1SU5A 4UXDA 1OX5A 1JDDA 1QAPA 3B4UA 2GUYA 4FNTA 1R2TA 3FKRA 1GJPA 3F4WA 3DX2A 3SY5A 2ZRVA 3W7GA 4MJZA 2QDGA 4OJYA 3O6CA 4RXFA 1ADOA 3B03A 5CXPA 5CZJA 3EDKA 3CWOX 4DO4A 1VHCA 3LPPA 1K8ZA 2QCEA 4CGTA 3GNNA 3WJWA 5KMYA 1R2RA 1U83A 1T0OA 3ZWSA 1PCWA 1TV8A 2CXGA 5D38A 4A22A 3UZ5A 2ZX6A 4O14A 5KEZA 1B57A 3G1AA 1KM6A 2YSWA 4BFAA 3L5LA 2ZRZA 4DPQA 3KVMA 4JL1A 3UNDA 1QI4A 1UH4A 1MFVA 2YCEA 1NF7A 1VLIA 2YW3A 3WY4A 1GVQA 3USBA 3M44A 3EX2A 4AMXA 2EKCA 1Y7VA 1NOFA 1B3OA 3SECA 3LLFA 1GVOA 2BSLA 4O54A 2XVKA 1PAMA 3PSVA 1PZ3A 1IXPA 3TNOA 4DF2A 2BX7A 2ZE0A 5FI8A 2AQWA 3LCXA 1MXSA 3WNMA 3ZR5A 1AW1A 1EA0A 2QR6A 4A29A 2J25A 3C2OA 3W37A 1AW5A 4LWWA 3A22A 2DIJA 2QCFA 1EUAA 1RZMA 4ADUA 5TD4A 3WELA 5EKYA 2EABA 3ATYA 2YXGA 4MZ1A 4MZYA 1YXCA 4N9DA 2FDSA 3QSRA 3DKLA 3M47A 5C55A 5K4ZA 2DP3A 3B05A 4NJIA 3GVGA 5DFAA 1IIHA 2OT1A 2H8ZA 2PCQA 3BAKA 4UTWA 1XH2A 3CT7A 5G1TA 2ISSA 1LOQA 1F76A 1PHQA 3PY2A 4MFDA 3G1FA 3A23A 1KXTA 3AJ7A 1EEPA 1XCXA 2JGYA 3GDTA 5F1UA 1QFEA 3LERA 2D0HA 3MYOA 5AHFA 3L5MA 4JFWA 4HPHA 1O60A 4JDBA 2Q8ZA 1C8QA 1TPVA 2JKPA 5FESA 3C3NA 4O57A 1MXGA 1XDMA 2FB2A 2FPTA 5FF4A 2E5DA 3Q2DA 2A7NA 2BY1A 4UFIA 2Z6IA 1XSIA 4NJJA 1G7UA 3AXHA 3D4YA 1XL9A 2V2DA 2CLMA 1ICPA 3TW6A 2OSWA 5KINA 5D33A 1SO6A 5GVJA 4WY0F 1H7OA 1W31A 2EHHA 3BUDA 1YYAA 3PBWA 3G1SA 3TJLA 1VLWA 3IGXA 3NM3A 3O15A 4K36A 3QGVA 4LUJA 3HO8A 3QW3A 4AVFA 1T8XA 3Q58A 1SW7A 4UTUA 1DQXA 2CU0A 2C6QA 2NSXA 1HO1A 4CNNA 4CNOA 1K7XA 4CCDA 2CZEA 4M7SA 3W71A 3W23A 2DH3A 2NV2A 5F2MA 3EDDA 1KM5A 4KWUA 3KLLA 5KSWA 3EDEA 4JTFA 1G94A 1D9EA 1KBJA 3BPWA 4GINA 3AJXA 2GVJA 3W7IA 1LBFA 3TTSA 2E09A 3GR8A 5D04C 5G5IA 3TAKA 3Q37A 3F1QA 1JCYA 1QO2A 2ZRWA 4KWVA 3CPUA 5LZLA 1FCUA 4MYAA 3PVFA 3OLDA 4KMQA 1RR2A 3W87A 4H2CA 2BWGA 3MI2A 4M19A 3UWWA 2E77A 3LB0A 3TJXA 1SSGA 4IQLA 1Z42A 1RVGA 1WZAA 4Z1CA 1UKTA 2PWGA 3W70A 5DXYA 4Y90A 1TQUA 1WOBA 3W1LA 1VYSX 3OLGA 3L4WA 2BY0A 3BLFA 2X2JA 4FX7A 2ALWA 4L4MA 4GUFA 3KL5A 2R94A 2G3NA 3DFTA 1XGZA 4PEEA 5A6MA 1MEHA 2WO5A 3L21A 3ZOAA 3LM7A 5BOOA 2JKEA 5I0DA 1GTEA 1O7DC 5AHEA 1SZFA 3HB9A 3CLWA 2FPVA 4P61A 1PS9A 3EWZA 3K8KA 4JX5A 4MLRA 2Z0IA 3C2RA 2OW7A 1W37A 3WN6A 5G2WA 4NNCA 1ICQA 3QF0A 2ZYFA 3W2LA 3B0PA 1JCJA 3L0NA 3WDHA 3NYZA 1KA9F 1G4EA 1KWGA 2ZXBA 1E51A 2WNNA 3TH6A 3K8MA 2EGZA 1VJIA 3PC0A 1H62A 4ZQMA 3SGUA 2BHZA 1WZKA 2GQAA 3G0XA 3P8JA 1BVNP 4K7YA 5E70A 5K9DA 4GO8A 4HPXA 1KWKA 5A6LA 5TIMA 2PE4A 4BR1A 4PODA 1EP2A 1NFBA 1R47A 1G67A 4IOTA 3GBEA 2V2HA 3VMOA 4PCSA 1PVNA 5A8GA 2Z1BA 2QMJA 4IXHA 4UTKA 4FF7A 3IIXA 3QM3A 4Z0SA 1RP8A 3S1XA 5AYYA 1OB0A 2Y7EA 3UD6A 2Y24A 4JYEA 3PBVA 4PL2A 3W2NA 1DORA 1UD3A 4ORMA 1ME7A 2QV4A 1O94A 1QR7A 2A6NA 4GXMA 1P5BA 4FX8A 3SZ8A 3ANYA 3T40A 3W1AA 4UQEA 3A47A 4J3SA 3BGJA 4EWND 2W0UA 4QITA 4XKYA 3E02A 2NV1A 3GAYA 3C6CA 1YADA 1FWTA 4AEOA 3EJTA 3II1A 4O50A 3UZJA 1EIXA 3AXIA 5AC6A 3BAXA 4JCMA 1UA3A 3TONA 1XUUA 1TPH1 3WJXA 3QZEA 1FCQA 1KM1A 2WKLA 1VRDA 2CFFA 1NF0A 3KVKA 3SI9A 3KRUA 4O1CA 4X9YA 3QQ0A 4W93A 2CHNA 5I3JA 4WOZA 3M7WA 3RFAA 3VM5A 4MY1A 1C8VA 4AYSA 1WXJA 4NJKA 1FWNA 4GUHA 3GBDA 4LW7A 1ZS2A 3ABRA 3VI2A 4O19A 1FXPA 2Y4SA 3ZS4A 4U4MA 3KLKA 2ISVA 1XV8A 2OT0A 4S1FA 4CCCA 3BLPX 1SFLA 1HO4A 4A2RA 2DIEA 2GPTA 1OF8A 5HDRA 1AG1O 3LBCA 3INPA 4M5PA 3TU9A 4NZFA 4JY9A 4EIVA 1OK6A 1GYLA 5FF0A 4LNYA 2QCLA 2Q3RA 3STGA 2AMGA 1UD5A 1V3LA 1MEIA 1OYBA 3T7VA 4JNMA 1GT8A 4IXXA 4LXFA 1OFBA 3IIPA 4Y9AA 4MPQA 1CXKA 2A85A 1QW9A 4XKYB 4IJBA 3TQ0A 1P0NA 2I1OA 4ONVA 1VJSA 1Q6LA 1U30A 1CXHA 4H7VA 3TDFA 1VAHA 1F6PA 1H63A 2C14A 7TAAA 1KXVA 2YYUA 5DCBA 1P6WA 2C1HA 1F6KA 3RMJA 4I9AA 1BSIA 3U2OA 1IIGA 3U6WA 3K1DA 4ZQNA 5BMWA 4MZ8A 2DZTA 3DGRA 1CDGA 4JDYA 2NT1A 4CKQA 2C19A 4FB7A 1LM1A 4EOUA 3GXPA 4LOCA 1IF2A 1TTQA 5H91A 3G8RA 3L65A 1TMQA 3CLMA 2DH2A 2A2IA 1H1ZA 2HS8A 2VOMA 3GDRA 2CW6A 1WE5A 2GOUA 2WC7A 4WLCA 5AHIA 5CZ0A 5K3VA 4UQ9A 1T99A 3TMQA 1W9XA 2QDHA 1KTBA 1YDVA 1SZGA 3W7LA 1HVXA 1BVZA 3GKAA 2WSQA 2HSAA 4UFJA 4JTTA 4NJGA 2EPHA 3LHYA 2D3NA 3KEHA 2WNZA 3BUPA 4QISA 3DFSA 1KLYA 4FXRA 3W85A 3NPVA 1PJ9A 4LY8A 3VSVA 2QAFA 3BC9A 1OHLA 3FAXA 2CZ5A 4AMWA 1TRDA 5CSSA 3G3MA 3TX9A 2YR1A 1KV5A 3TKFA 2EO7A 1B4KA 2PURA 3S9YA 2EQDA 4JXCA 2VELA 1TQXA 3W76A 2OYMA 3N9RA 3EWXA 2PRLA 1P4CA 2QAPA 3CZGA 2QCMA 4NNAA 3TC7A 2CLFA 3NAVA 2QUUA 1H50A 1HX0A 3JR2A 4DEFA 4HSNA 2A7RA 4WOQA 4RX0A 4AMAA 2ZUSA 1JRCA 5D2VA 2A4AA 3EX1A 5LHEA 2B7NA 3BG9A 5ABTA 4YMZA 3MHGA 1TO3A 1QWUA 4PCTA 3O63A 4QAWA 3D0CA 4RCXA 5CG7A 5D2TA 1WQ5A 1TQWA 2WVTA 4IMGA 1W3IA 2ZZ5A 3KL3A 4IMFA 4JICA 4JTEA 3VGFA 4GI8A 3S5OA 4EF8A 5K9CA 1OSEA 1OFOA 4UQAA 3H53A 4H3DA 5DCDA 2X1TA 1MVYA 3W7QA 1XM3A 4LT9A 1KCLA 4JR5A 2Y6ZA 4O53A 1TQVA 2WNQA 4PSPA 1SMDA 5EL1A 3LHUA 5C2XA 4UNKA 2QLYA 4NT0A 3ZSTA 4GUJA 2VUYA 1W56A 3WEMA 3W1PA 3TUUA 3LCWA 3GAKA 3N2XA 3FAWA 3MP4A 4JCLA 3TOPA 2Y7GA 3LHWA 1QPNA 1BKSA 3MWAA 3BUQA 3TSMA 2FQIA 4J3TA 1XBZA 3A24A 2E9BA 4BK9A 4K39A 3ELFA 2F1AA 4X9SA 1LP6A 1SFJA 2ATSA 3MBDA 4DPPA 4QM1A 3STFA 4XTIA 3U8GA 1H3GA 4O1BA 4LTSA 5FEPA 1BEUA 1QOQA 2FJKA 1JULA 3OVRA 3LLDA 3N2MA 1UA7A 4UCFA 4DF0A 5EMUA 4RZ5A 4DO6A 5A2CA 2ATMA 4KFOA 4FLOA 3KXQA 4HHPA 1JL8A 2E5CA 4KFNA 2JBMA 4UTHA 1MXDA 1TCMA 1B4EA 4UNLA 3W6YA 4LV9A 1KM2A 1LLWA 3W1QA 2VFGA 3WNNA 3FOKA 1NAL1 3IRDA 2DZVA 4PC8A 3VFLA 1QPRA 4RZ6A 2XWEA 5BRBA 3PUDA 3LCLA 3LRKA 5CZTA 2D0FA 1VYPX 4QNWA 1EPXA 1LTDA 2B7OA 1HNYA 1VQTA 4N4PA 3W1RA 1LLZA 3WJSA 3DX0A 3NZ1A 2RDTA 1I4NA 3W22A 4UOZA 1B0IA 1PEZA 2DORA 3VGDA 4ZQCA 3TA6A 4LUIA 5BNKA 3C61A 2JGQA 1LOLA 4U2ZA 4IPJA 4YCOA 3BUBA 1WBJA 3TXVA 2P1FA 1KFBA 1VZWA 4UR8A 4UCGA 3QMSA 5F2IA 2Y63A 3L0GA 4WJEA 1JJKA 2P0OA 4R53A 5LGZA 3W7HA 4H8HA 2YW4A 1QNVA 1A5SA 4N9EA 9CGTA 4XB3A 2DZUA 4GC4A 1WAUA 3QPYA 4ADTA 3LX9A 3W7NA 3LHTA 3O6YX 3BSHA 4G1KA 5D30A 2Y5EA 1H7WA 2VRKA 1KXHA 5LNSA 3UWZA 1G69A 5AHMA 3THAA 1RD5A 2V3FA 3PBYA 1HT6A 1K8XA 2CLEA 3HOJA 3BAJA 3M9YA 4LC8A 4O1AA 1JFHA 1IZKA 4OIFA 5HPOA 1THFD 3W1XA 3P82A 4J9JA 2VFIA 1XFBA 3M43A 4K38A 3D52A 3L5AA 3BV4A 7TIMA 5AHNA 3UEQA 4HPJA 5DO8A 3BGGA 3BVJA 1FWWA 3GXDA 4UQBA 3A21A 2ZZ3A 3DX3A 3W1NA 2NZLA 5DN1A 3L2LA 3NQCA 4JYFA 3GDMA 3ZT5A 2CLIA 3BMVA 4O10A 1X8FA 2D0GA 1IXOA 3EWWA 1ODUA 2OYKA 5HINA 3NL2A 3I68A 4C1LA 1AMYA 3CQ0A 4UQCA 4K8HA 5CGQA 1JG9A 2G97A 1HTIA 3QJAA 1SSDA 3W2JA 4GNJA 3G8EA 2VC6A 3GLCA 4HN4A 5DELA 1V5XA 4JTHA 2V5LA 4QSHA 2A5HA 1UBSA 1J5TA 3TMLA 1R30A 1CLVA 3HQ1A 3NA8A 2Y62A 1O4UA 4BI6A 1NEYA 3S8HA 2ZX7A 1XCWA 1A50A 1YDNA 3GDKA 2Y85A 1EP3A 3PF3A 2VEIA 1VC4A 2F7PA 3CZNA 4X22A 4GUGA 4TO8A 4JN6A 1TPFA 3PG8A 1FCVA 3NDOA 2E6YA 3OHIA 4K8EA 2DZSA 4M6VA 1OK4A 5DBUA 3TE9A 1UUOA 4JFUA 5CKSA 4LRSA 3ZWTA 1Q6QA 1J0JA 5A2BA 2QUTA 3PM6A 1RV8A 2WV8A 3UWQA 3BW2A 3CHVA 2E4TA 2QCHA 3CU2A 2D73A 3R5EA 3L4UA 3L2IA 3NOEA 2WANA 5CLTA 4UTIA 4E2BA 3F4NA 1TV5A 1D3CA 3W88A 3DX1A 4AB4A 4EF9A 1EO7A 2CZDA 2ZA2A 1XD0A 1ZENA 6CGTA 1JI2A 1TSIA 3QW4B 3GNDA 1FQ0A 4CQ8A 3HGOA 2X1UA 5I3FA 4X2RA 2V0TA 4PA8A 5U4NA 5D2XA 1O5KA 1OFPA 3P84A 3QC3A 1E3XA 1F2JA 3NPXA 1YXDA 1EB3A 1CPUA 1JF5A 1IZJA 1ZAHA 4A3UA 3VNYA 1UD4A 3IJ9A 4CN4A 4PFMA 1FUYA 1PE1A 3GYEA 3W7MA 4HOXA 3C52A 1IXNA 3HG3A 1UKQA 3BK0A 2YGYA 1A47A 3C4UA 1W8SA 1NM9A 2WOQA 4UTTA 1QI3A 3HG5A 3L4VA 1ME8A 2PRMA 5F4SA 1LOSA 3P74A 1RP9A 5TQLA 3S5NA 1W54A 3G0SA 4JIQA 2EEXA 1KM0A 3G1HA 3O05A 5K7JA 1QX1A 2NUWA 2X30A 2FHFA 2XN1A 4WXZA 2VRQA 1H1YA 3LTPA 3OVPA 3VO0A 5E0FA 3IIVA 1KCKA 2W6RA 3I6RA 4HSOA 4JD4A 2NX9A 4LC6A 1Q6OA 3FIGA 2QJGA 3W9ZA 1QPOA 1G4TA 1X1OA 1LDCA 4LVGA 2A6LA 3WK0A 3L67A 3LXAA 4POCA 4JYDA 3ZFHA 4HNVA 4UC5A 1TYGA 1JI1A 2VFFA 5FF3A 2BTMA 3EXRA 4BZYA 1C9DA 3LTYA 3NQ8A 1OGSA 2NUYA 4ICNA 1Q3NA 3C2EA 2E8ZA 5BRQA 3HF3A 2FHBA 4NUWA 1H5YA 3GB6A 3WNOA 3VKJA 3DI1A 4O17A 4ZQPA 2ZUTA 3VMPA 1F7BA 3C56A 4Z1AA 5G4WA 1MWOA 3VE9A 4OGZA 6ALDA 3I7SA 4CN1A 1DBTA 4ATWA 1OT2A 3KRZA 4FIRA 4MJMA 1GCYA 1FDJA 4QQ3A 1KGUA 2NXGA 4AYGA 2FLIA 2F1BA 2FPYA 3WNPA 4NX5A 3TFXA 3WK2A 5HNRA 3G24A 3HGJA 1CGUA 3MW7A 2A21A 3TV8A 4XQ6A 2J6XA 3DHFA 3CZSA 5AYZA 5A2AA 1J0IA 2V5BA 4YXGA 5HUPA 3SJ3A 3FYPA 1UH2A 1W0MA 2H8XA 3M5XA 3G0UA 4U2YA 2QCGA 4BI7A 3W7RA 2TAAA 3DDGA 1CXLA 5L9FA 4IMDA 3CPRA 3NQGA 4RKAA 4WZHA 1OJXA 2TPSA 4O0ZA 2TYSA 4NI3A 1JAEA 3VU2A 2ZZ6A 3LI0A 1A5AA 3UYCA 1U33A 4PTNA 4JY8A 2J9XA 4MIMA 1H7PA 3DH7A 4TR9A 1JCXA 4XWUA 3W72A 3STEA 2RHGA 1N8FA 4KKXA 3VX0A 3FYOA 3LI1A 4A2SA 4E2OA 1Z48A 1O5XA 5D2WA 4GIAA 1XBXA 4LVAA 3BLEA 4JTSA 5AN7A 3G1YA 3PWAA 1ME9A 3BVUA 1M6JA 1LBLA 4FO4A 2DJLA 1D7FA 1CGXA 5I3IA 3R12A 1HL8A 2OX1A 1WX0A 2FFCA 4FEZA 1Z44A 3GR7A 4C1KA 2VT0A 1SW0A 5KZMA 3GXTA 2F2HA 1GJWA 3B06A 1GYNA 2QCCA 3QH2A 3TW7A 3LV5A 1AL8A 8TIMA 3NQ2A 3TCEA 2ZFAA 1XUZA 5T26A 1JCNA 4JX6A 4ZL1A 4ZQRA 3M6YA
chains in the Genus database with same CATH superfamily
4WJ5A 2HKAA 1E65A 1XDTT 2IPKA 3FQWA 1H41A 2NWSA 4MSWA 2D31B 4O2EA 1EYWA 1JXGA 4QOKE 3ZE0F 3HCVA 4AQ8C 1JEZA 4P59L 5BO0D 1CLYH 4IKLA 1MQQA 4PMYA 2PW1B 4PLJC 1JNDA 4ODTL 3BKCH 2IPWA 4QJ4B 3F7YB 1GGUA 3MYPA 3FB6B 1JNNH 5DY2A 3MR9B 3GC4A 4JFOA 4I2XE 1WP6A 1EJOH 1YDOA 4PJAE 2IH1B 1XEDA 4ZFFB 3MRLA 3ARWA 3N3TA 4H41A 4OKDA 3SQBA 4JHWL 3B2UD 1CW2A 2VR4A 4TULH 1T83C 5JPNA 3KPPB 4RGOL 3EX3A 1AG6A 3GIVB 3SSJA 2NQ9A 1WO2A 4P57A 2G5WA 1GYMA 3TSBA 2GHWB 4GG9A 1IGMH 4F57L 4K7FA 3VFOA 1LLOA 3DECA 3TBSB 3BGMA 1CGSL 5IREA 1GVRA 2NZ9C 3HPLA 5T5NG 3M41A 4XPAL 1E90A 2GVGA 4Z0JA 3U1QA 2HVJA 2XWJB 4EIZC 4ADJA 4EI6A 2H2PD 1CBVH 4BFEA 1NOAA 1DQLH 4N8UA 4N8CL 4ZMZA 1S7TA 4EN3B 3OO2A 3RJQB 1YMMD 3D87B 2XV3A 2DV6A 2F5AL 5FK9A 2IEPA 4KW2A 4M29A 3HB3C 2GQ3A 4XNMB 7REQA 1P4LA 2X0SA 2E74C 3OXSA 2VMFA 5T1LA 2HH0L 3BCDA 1AHWC 4WF7A 3MA9L 1GOMA 3ZT7A 1PPIA 5E09A 3S9DB 3MN8A 4G9FE 4RLIA 1MF2L 3MO1B 5KVEL 3NA9L 1BECA 3F65A 5CWSB 2N7AA 4NT6A 3KDNA 3GEWB 5I0XA 3R89A 1OZQA 1YEEL 2R1PA 4DF1A 3C08L 1MNSA 3IIOA 1GQJA 3O45A 4NIKB 4V1DE 4K2UH 4PRHA 1HKMA 4FNLH 1T83A 5GJTL 3B9AA 4DWHA 2J13A 5BV7B 2C3VB 5E9DD 4XCCH 4X6DA 3ATZA 1LK3L 2EDLA 4KJYB 2YEZA 2C13A 2WHLA 1IGFH 4QRFA 3QCVL 1CK0L 1W17A 4AZCB 1UQSA 3J27A 4E41E 5C09D 3L3DB 1E72M 4EDXA 1TMHA 1OE3A 3NSNA 4HZ1A 4GBXC 4NQEA 4N0UB 4NS0A 4XE5B 3TX4A 1ZKAA 3HTLX 3ZBMA 4AWJC 4QNPE 4LSQH 5KW9H 4IGHA 1V3JA 5LGHH 3EA3A 4M6QA 3V6FA 3P5YA 3C0JA 3CV5A 3BJLA 1LCOA 2AJXL 3N1AA 2VKZG 1WNOA 3B8TA 2HTLC 3TH3T 1OGTA 1SEBA 5KBKA 1G7VA 1AHWA 3UJTH 1NICA 5D1XD 3L2MA 4JCWA 3ES6B 3QUYB 1R87A 4QYOA 2EPMX 5FYKL 2WQXA 4DWSC 1AO7B 3S6DA 2J2ZB 1Y0EA 1BFVL 4JKPH 1FG9C 1G9HA 5FW7A 3AXLB 5DTFB 4EAYA 5LIKX 3PDOA 1GZGA 2PP1A 2YD5A 2FZ3A 2HRLA 1X7QB 1K03A 5DD5H 1OANA 2LU4A 1T7ZA 2Q0ZX 1KT2A 3I2CL 4LLMB 4QHNB 1DQDL 3ARGD 4ZAKB 2PR4H 3BRDA 4L8SC 4U1IB 2R9HC 3H2PA 5MKGB 4WTQA 4DAFA 3EOYG 3GSWB 3CTTA 3LCHA 2YCJA 2WINA 4V1XA 4CQAA 4N42A 1GC1C 1D9KB 4IBSA 3X14B 4XMWA 3HIZA 5I5MA 2IALB 4HT1H 1I2PA 1FYTD 4FX5A 2FWOB 3BH8A 2BZ7A 2X2HA 1VGEL 2AKRB 1CFBA 3V5DA 5B4MD 1R6WA 4MLJA 4UQDA 5KZEA 3EOEA 1N26A 1RUSA 2QQLL 4IP4A 1A6VH 4GBXA 1A5MC 5F0JB 4X8CA 5I16B 4YXLL 1OABA 4PGBB 2NXZC 3QISA 3WQ5A 1WUZA 5FEXA 3B34A 3UNTA 3HZ3A 1G6CA 2QCNA 3NIYA 3M0XA 5CAKA 5KZDA 2WC4A 2V4LA 4Y4KB 3TEWA 4NYLA 3TC6A 4F1SA 3LQAH 5CD3A 2EE0A 5CZVH 4M5SA 4X5QA 4AYMC 1R9ZA 4KDTA 1KULA 3MRIB 1PD1A 4CMHC 1OADA 3RWJB 4D0CB 3CFBA 2CDGB 5CM1A 1IT8A 3P02A 1EAPB 4MGXA 4DKTA 1RPQA 3A6OA 2WCPA 1IT0A 1U8JB 3MUXA 3Q45A 2GJRA 1QSFD 5GS3A 4CJ1A 2O7SA 4CC1A 3PZOA 4F3HA 1CFVL 4DY1A 2CR6A 5C6TH 3I6EA 2HFFA 4QG9A 4GW5A 5EU6A 4URKA 4PUKA 1XLCA 4H7CA 3K5RA 3CC1A 4XD3A 3WH6A 5DD0L 4L8SA 3VXPA 3PAVA 4DAIA 5D09A 1G9EA 1IGSA 1AD0A 5D5MB 2EE6A 2Q2LA 5HGDB 4Z7QB 3ZDZF 3ARDC 5IFJB 3NQ6A 4JTUA 2IV8A 1ZFJA 2Z25A 3T0ED 2UVEA 5ICYB 1NDTA 1WZ1H 3LOWA 5F9WC 1NUGA 4AX7A 1II4E 5IRPA 1WBHA 5B8CB 4IOIA 3HI1A 1G7MB 3IDJB 2ISFA 1KGWA 1ETJA 4HW6A 4RDQF 1MQKL 1EBPA 5E8NA 4P46D 2DLGA 1DEDA 3S97C 2ZWYA 2XIQA 3KDPB 3HMXH 3UY7A 4A7TA 1GQKA 1DUZB 4N68A 3OZOA 1E2WA 2ZZ1A 1OX6A 1AYOA 5LSMA 4I4WB 2HXTA 2B7PA 4ALDA 2J4WH 3OAUL 3LNGA 1IQWH 4HK6A 1XXXA 3KBPA 4P2AA 3SOBL 1RY0A 5JXQA 2F7RA 2LABA 4QTGA 5TH2B 4CD4A 4UILH 3S36L 4GNVA 3RVWD 4NUMA 1FC2D 4KXBA 3IDGB 2WSPA 3DG6A 2X4QB 4JRXA 4AWSA 3BAYA 4IIFA 4M82A 2KPWA 3O8XD 4IG2A 1GL4B 5IDIA 1TYJA 3UJEA 1Q6RA 4NSKB 1EFXA 2Y6SC 3G5XA 3EPOA 3I9PA 4NO3A 4Q22A 5DMMA 2DVTA 1X5KA 3KOXA 3H4FA 4XPHH 3D05A 1JRBA 3WMLA 2NW0A 3ANVA 3ESOA 2W94A 3NQKA 2MTAA 4FXKB 4PMJA 2QSVA 4S2CA 4O2CB 4X6DF 1HH6A 4RFNC 3T0TA 3OVQA 4A7GA 1IKFH 4FMKA 4PGCB 4JN1H 1T3FB 2E28A 2PWVA 3UY8A 2RIKA 4HVBA 4X4XA 1Z9OA 1AQKL 1IVTA 5BWAA 1U93A 3WF4A 5C07A 2Y36H 2FO1A 5DVPA 4W9TA 3MLXL 5D1XE 5HNUA 3KL0A 3NZRA 3WBAA 4M4RB 4XHJC 3ECBA 2PDHA 3B37A 3E3QC 2CWNA 4ZBJA 5EMYA 3STZB 3T8XA 3WD2A 1ZHLA 4JQIH 1DR9A 1O1HA 2FGLA 5XINA 2TMDA 4S2SB 2A6IB 3S5SA 3K71B 1PSCA 3BT0A 2CLOA 1GZ1A 5JZ7D 1V77A 3MI3A 3RWFA 4K8RL 1TE1A 1JUBA 1H0GA 1P0SE 4IJCA 4F8TA 1EX1A 1M7XA 3NSCA 1TJHL 4IM4A 1KBGH 4EQ2A 2EH7L 2YFNA 3UC0H 1OFQA 4PMQA 4R96B 5LXEA 4XO5A 4FMVA 2COVD 3MO4A 2HT2D 5SWUA 2H1PL 3BUIA 3IWVA 1NPNA 4CC4C 5B7YA 5IJBC 2WLNA 3W7GA 4Z7WB 2O72A 1VHCA 3LPPA 5GRZA 4CGTA 1T0OA 1W0WB 3GR4A 4F0KA 2ITCB 3OXRB 5K59E 2F54D 1QLRB 1EXPA 3MVIA 3B3BA 1LQAA 1ORSB 4RL3A 1JZ6A 4ZOAA 2BSLA 1REQA 3PSVA 4NWTL 3OHMB 1J10A 1EA0A 3X1FA 2XCMC 1OLZA 5EZPA 3KYMA 3N2CA 5HHMB 5F7WC 1M7IA 3OKMA 4PJXB 4I1PA 5C55A 3M17B 3T3PB 4P04A 2I5GA 4UT9H 4LJ3A 4Q6XA 4AIZA 2R1YB 2WO4A 3PY2A 3AM8C 5TFSL 1FH9A 5C0JA 3LPWA 1S9XB 3CC5B 1ZE3H 3WUZA 2PD5A 4LRNH 4C65A 3CAQA 4IKKA 5F7AA 3IGAB 4LLVB 3VXUA 4KKLD 4NRXB 3CO4A 1IGWA 5FYKD 1AGEB 3LNIA 4K3GA 4XWGL 3SPGA 4M7SA 5LXGH 1TTCA 4MXQD 2YUWA 4Q7DA 2ESVE 2Q3AA 4GINA 1CYXA 1JGUH 3F7QA 2EUVA 3FB5B 3TVMD 1UXWB 5D04C 3FJNA 5AW6B 3CK0H 7FABL 4DGYL 2I69A 4CC4A 1LXMA 4MB3A 3X3GL 2H32A 4Y1SA 3UTPD 2BWGA 5M03A 1NPJA 1YY9C 2Y3AA 3EWDA 1BYNA 5LGJB 5HHVH 1JGDA 3QQ9D 5BOOA 1BWWA 3R0MA 4FAMA 1B9ZA 2KZWA 2IADA 2E9MA 2F74B 3QF0A 3OR7B 4NHCH 3L0NA 1KA9F 1G4EA 4G8AC 5AG9A 1J05A 1R1CA 1D8CA 4B7IA 3LAFA 3UZVB 1TZZA 1PKQE 2EDYA 2V2HA 2YSTA 5I02A 4UTKA 3ILDA 3QM3A 1OCWH 4JYEA 3AM8A 1U3HB 4KV5E 2YPVA 1NEZA 2CGRL 5DJAA 3QHZH 2DL2A 3MTWA 3C6CA 4K71C 2VCCA 5F0PB 4Q4MA 1AQFA 5AC6A 3WLWD 3TONA 3UYPB 4QXUH 4D9QD 4HA0A 4WU5A 5I73B 3B2DC 5I2IB 3ZQXA 3QQ0A 2OTUA 3CDCA 5MERB 3PWNB 3D2UD 5GGVL 5AW1B 1JN6A 2AQRA 1BGAA 2PF0A 2ISVA 3CFDA 2YKLL 5D9SA 3RPBA 2CALA 1OF8A 1NTHA 5IB2A 3IKKA 2PGRA 2AMGA 3T7VA 2GDUA 1FO0L 1QR4A 1GZQB 4I5UA 5EZIL 1B2WH 4EXAA 5DCBA 1U95A 4BFIB 4IU2A 2J43A 3WIIL 3I4KA 1QFPA 4A7GF 4KKAC 1INEL 1ED3A 2VD9A 1UB5A 2MCPL 1R3JA 4M93B 1LM1A 1LO4L 3FU0A 3QUZC 5E6RB 3CLMA 4P2RA 4ODHH 3TCLB 1XVSA 4NUQA 1G9MC 4OD3H 5C7XH 1LNUB 3QHFH 2R56H 4HKJA 4Y5YC 2A83B 4LCCB 4FEIA 1F2XK 5KYNA 3OKNB 2VDQL 3DFSA 4LY8A 1PLCA 4PJCB 3MMWA 1WBZB 3EF4A 1NGYB 3T6WA 4IYKA 5D7IE 3W9DB 2PURA 4B95C 3SJVD 4PUUA 2W3ZA 5FA3B 1AZBA 1T21B 2CHRA 1IEBB 1MREH 3OF6A 4FG0A 3TYDA 1IAOA 1BYPA 2NLJB 3ABZA 3FGCA 1P4BL 4BFBD 4HSNA 3SE3A 1SJMA 3O0RL 4RX0A 4AMAA 5TK4A 4DN3L 3TFBA 3WI9A 1I8AA 2CBJA 1WQ5A 1YDYA 3KEDA 4KAQH 3S3CB 2KERA 5I66B 3VD2A 1HXMA 1T2JA 1NFIB 2WZHA 4ONHA 4XZIA 1WSST 5C2XA 1ACZA 1W56A 4J35A 1MRCL 3DUSA 2HN7A 3GTFA 4XBGB 3THDA 3AGVA 4QOKB 4BK9A 5HVFB 1JHKL 4CEXC 2GJJA 4X9SA 4QT5B 4S0TD 3H3KA 4M8QB 1DFBH 1KN4L 2WQWA 2AKMA 3T2LA 1Y6KR 3FY1A 3E6FA 5CEXB 4OZIA 1GW9A 1JK9B 4PJ5A 4QO1A 2J7BA 4ZSTA 4I2XB 5DJ0A 1VYPX 3PZIA 4PJAB 1JPGA 3HZVB 3OB0H 2RDTA 3SADA 3VFTA 4TNWF 4LUIA 2O5YL 4YCOA 1BA9A 4Y5YA 4XNUL 1VZWA 4G8GA 4H1LA 4NAEA 1GA2A 4AVHA 4YXHH 3D12B 3W7HA 5E5MA 1AQ8A 3QPYA 3ATEA 3KBSA 4CKVX 5KVMC 4PCYA 2VC5A 1HHHB 1QQDB 1G69A 3OKLA 5DSCA 5B7EA 3U5YA 2G4GA 4C56A 3H2CA 2DQFA 1JFHA 3FO9B 3IDIB 3W1XA 4OLVL 1F00I 4UTFA 4OZHE 2Z64C 4G1MB 4KO7A 3I02B 1XGTA 3B83A 4OLZH 2G3XA 4G8EA 1VBRA 3A21A 3WTSA 1ZTXH 4OVVA 1Q6DA 5D55A 3P0WA 2XNAB 3RL1B 8PAZA 3HI6H 2XXCB 5CEZE 4C1LA 1AJ2A 3QUKB 1SSDA 2XU2A 3CMJA 1AGCA 3F58H 4YHPA 3VCCA 5DELA 1AI1L 4JEJA 5LIXX 3TMLA 3BD3A 4H7ZA 3IDUA 3TPKA 5BV7H 2VX4A 3NA8A 2X1QA 3ZL4L 2OEJA 5CGBA 4K8RD 1LO3L 1JZJA 2E6YA 4Q56A 1H9DA 4JFUA 2YHGA 4P5SA 3PM6A 3ULVC 3BP7B 3OPZL 1KLUB 1Q2RA 5EBMB 3QEHA 4G9FB 1L3WA 1K5WA 4PFHA 2ATKA 1I1YB 3MFGB 4M43L 3ECVA 1PBYA 3GEFA 3GB7B 4NIRA 1F3DJ 4DOHB 4MJIB 1GZPB 3BKML 1CDJA 3BGFB 3VU1A 3K4WA 4ZW5A 1JF5A 4HS3A 1UD4A 3GYEA 3MNWB 3ESVF 3THMH 2DIKA 2DLFL 4V1DB 4TNFA 4M7LH 1BKHA 2NW2A 4JFDD 3V6ZB 2BRRL 3RFZC 5AWNH 4HSOA 4LC6A 3IXTA 2CCRA 4ZFZB 5TF1L 2FLRT 3FZUD 3EG9B 3SCOA 1XQKA 2DQGL 4GP5B 4L3EA 2XTKA 3C2EA 1NCBH 3IRZA 3WNOA 4O17A 3LHPH 4HUVB 4IIBA 4KMLB 4NKOB 4FIRA 1NWRA 4LSDA 4J2XA 1XMEB 3KP0A 3C5ZC 4MD5B 5AALA 1UOVA 3TFXA 5F6IB 1CGUA 2C1GA 5FC9A 1QFWH 4TQTA 4PBDA 2FEEL 5EH1A 3JSSA 4IMDA 1UXMA 3KZPA 1D6EB 5SWSE 3HR5A 3GO1H 4GZ7A 4PTNA 2WIIA 5SV3A 4X9GA 2LAGB 4H5SB 3ATAA 5DUPL 3LI1A 3VFWB 2QJMA 2AJUH 2GB2A 2GSIA 1OAKH 5F0LB 3PWAA 3RWHB 4M7KH 3CFTA 1BXBA 2WBXA 3QIUB 1HL8A 3OZLA 3VXTB 4GS7B 5KZMA 2IPUK 4D6CA 4LZKA 3TV3L 5CJ5A 1A1NA 1R3HA 4ZL1A 3M88A 1TT6A 3WN5B 1E6RA 2ZA3A 5IW1B 3LDVA 3QHNA 43C9A 4GUCA 4JREC 1KM4A 4RDQG 5AVSB 4UV4L 3HC4L 4LYKA 4EXQA 1UCBH 4NFBA 1GGIH 4WQ6A 3FSWA 1VLXA 1K6QL 2VMJA 1XGEA 2E59A 3FYYA 2O30A 4HTYA 1R38A 1TWIA 1V7ML 1UQYA 3VXSD 4XN2A 3OLEA 3WCYA 3OOQA 2DU2A 3N2TA 3SAZA 3ETBF 4JG0H 3DHJA 1JXJA 3QWQB 4N2MA 3CNKA 3DFYA 4W7WA 3ZRSA 3L1OL 2VDNH 3KPLA 4JO8A 5DDHA 3CAKA 2VITA 2JB5L 1Z7JA 3U0PA 4JR9L 3JS3A 3ZGIA 4N26A 3QDMD 2G37A 3MCKA 4UIMB 3C5ZA 4TQEL 5IG7B 4LSPH 1W0YT 5LWYH 1FV1A 4EI5A 4Z3HA 2A74C 4NU7A 3P9MA 4D0BA 2VIRA 2CHWA 4Q8TA 3NZ8A 5LKYA 1HJSA 5G4HC 3AMGA 5G55A 2D03H 3R8HA 3I9IA 4N0UE 1ZBWA 4M7LT 4FALA 3CH8A 3DO4A 3CFUA 3BGAA 4YHMH 3KPSD 1D5MA 1UWIA 4UR7A 3UWVA 3KDMA 4LSTH 1N70A 1IAIL 1SBBA 4LKCA 3RLUA 3KTSA 1QO3B 4OZIF 4OT1L 1VCVA 3DFNA 3IPFA 4P5UA 1AO7E 1YN6A 3B1UA 2CLHA 2Y7OA 1NAKL 3MPCA 4WI5A 12E8H 1RUQH 4JB9H 3AZSA 2DQDH 3GBMH 4YDIH 1UOWA 5AC4A 2XIJA 1QCWA 1RVKA 1OCRB 3CLEL 1NOUA 2TSYA 2BXZA 4JHBA 4UNTA 1E9IA 1SVZA 2OR9H 1A7NL 1YMMB 3TA3C 4MUZA 4IHOA 3SN6N 4GG6B 1NDZA 4WHCA 3W6LA 3WQ8A 3L3JA 3GMPB 4KTEH 1C5DB 4DFHA 2Y7FA 3P30L 4K0OA 1ND0B 1SN5A 4PJEE 2A74A 3MA8A 3M1CA 3VIFA 3M7SA 4KCUA 5FUZL 2XGIA 1NKOA 3BP5A 4KWWA 2YD8A 2GIYA 2X70A 1X8CA 3S2MA 4X7TA 1JDFA 4TNWK 3HFTA 2IFGA 5BXTA 1XYFA 4JBSA 3HKZA 4I9MA 2VX7A 2VDOB 2P5WE 2VZUA 4O18A 5AVZB 1TTFA 3BVTA 5JH2A 4GB9A 1TE6A 1CEOA 2V5MA 3MRBA 5AB3A 1PW3A 1WUEA 3GSNB 1TJ1A 2A9AA 1UASA 1DVFD 3W75A 4MBOA 1TIUA 4OZOA 4L3FA 3B2PA 1PZDA 3FT3A 4WHYH 1DANU 5CILH 2XWDA 4Z7AA 4GYJA 4JIHA 3C0SA 4XOAA 5C09B 4NNXA 4XAKD 4OQTA 2MOQA 5ALBH 5HGGS 1OLLA 3TWYA 5HPMB 3HN5A 1L6FA 3BPLC 4GJTB 3AZTA 5I3DA 3QPZA 3P11L 5D5ME 3TA3A 1SYVA 2QGHA 3GI8H 1DJWA 2G50A 2ZNXA 4ORGB 2H5UA 4QRRD 2DY3A 2BNUA 2J44A 3SO5A 1OO2A 2EAEA 1PZ5B 2XVGA 2VLJA 3CHCA 5D1XB 1ONWA 3WFHB 2A1WL 1KRAC 3OAYH 3VVGA 1F8IA 2WBGA 3PNZA 1M7PA 2O55A 2GTWA 3HJZA 4RMQA 4CSTA 3WGUB 5D05A 4ES9A 2IWFA 5C0ND 1NMBH 3CFIC 4FI7A 4F9PC 3BH9A 4O00A 3ULVF 5HWMA 3CZ8A 2WW8A 4RZBA 2DKUA 4OU1A 2WP3O 3BSZL 5HJLA 3ARGB 1BXXA 4ODXA 3SB0A 1H7NA 1S2AA 4IUGA 2HX7A 4J4KA 3SBWC 3LXUX 4P2OC 5B1JC 1FVCA 1UWEL 2H3NB 3TBCA 1GCFA 3EJQA 5HYFA 1PCKA 3MRGA 1J2WA 4LGRB 4O11A 2CU9A 4ES4A 2EDOA 4REQB 1FYTB 3C87A 2YZRA 1M1SA 1SBSH 4XPTH 4NLHA 2R39A 3I3BA 3MOQA 2B81A 1QTPA 1HOCA 4FOMA 4OFKA 3S88L 3EOTL 2YQBA 4D1JA 2WVVA 1FGVH 4PCNA 1KRCC 1RSCA 5D72L 3VKBA 1GKOA 3DHPA 1GGOA 1X7IA 5HI3C 1MVUB 1DSFH 4M8UA 3UDWC 3C5SA 1L2UA 1QEWA 1RJRA 3PIQA 3HE7C 1LBMA 3UTQB 5T33L 2DYPA 3HPZA 2C16A 2XFWA 1NANI 1EX5A 3NCCB 2J72A 3ALWA 4ZTOL 4GVFA 4C6JA 1MRQA 1PTGA 2Z27A 3WIHL 2VFDA 3QQXA 3W7EA 1P4IH 2CRZA 4JFYA 3EB3A 3UTZB 1D6VL 1M7JA 3BDKA 3OGRA 3E0IA 2FE0A 3P67A 4Q9BA 3B04A 2Z4QA 2WZMA 2DBLH 3MTXA 3GHEL 5DMYA 3ECQA 4N6EA 4P2QD 4GX9A 1JZHA 2FYVA 5C3TA 3SBWA 1JZFA 4P2OA 5B1JA 3PTKA 4Z78B 1D7KA 1R3IH 4YHEA 4UT6A 1BLNB 3ZHFA 1ICSA 2AI0H 5HHQA 3GS0A 1FZOA 4Y16D 4K9EL 3T0EB 2K7PA 3DUUA 2HLFC 4KZCA 5CU9A 1VFAB 4MRBA 2W5FA 2AXFB 2ESVB 5AD0B 3STLB 3V7PA 4XVUC 4TPRL 1BQHG 3HFFA 4IRJD 1XGDA 4OF6A 4Z8FL 3CB3A 1BVWA 4OCLC 1E9PB 4HS8H 1E27A 2CK0H 2LV4A 4HH9B 8XIMA 4DVBB 3WMPA 1RK1A 3UDWA 2ZOKA 1E40A 2XFRA 3HE7A 3LQLA 4M24A 1GYVA 2RJMA 4Z7WE 4QTHA 5ITFA 1GYWA 1BFOB 1SFDA 5GRWA 3FCUB 3G9AB 4K3DH 3DA0A 35C8L 5B21A 4PZVA 1MAMH 1O9VA 3VE7A 4IOSD 1MNUH 3H3PL 4BWWA 1PKQB 2EDXA 1EZSA 2V3DA 5E2JA 5JIPA 2G3ZA 1TNMA 1RK0A 4OLUL 3PZQA 1W6LA 2XA3A 1TPWA 3O8XB 4NYUA 2WPBA 3II3A 3MROA 4PJXE 4KI5E 4CBZA 4HQQL 3QT2A 3T3PE 3CUJA 2H9GB 4HUNB 4P9MH 3HS0C 5I75B 3D0VA 4OTKA 4DQOH 2NY0C 4N8VB 5DFVC 1ISZA 3QZPA 4HXAL 4JO5A 4NM4H 1Q9OA 3JWNE 3GMQA 4M6PA 5E5LA 4LCWD 2VUNA 3BXWA 1J1XL 1VCBC 1TPDA 2QSTA 3CYJA 5IFAH 3IMBA 1DIOA 5U7SA 3LN4A 4HUUB 4W8AA 3FOMB 5GHWL 1UWFA 5JBDA 3FJLA 4K3ZA 2DIBA 2QIWA 2GJLA 3K2UL 3MP3A 4M1CD 1MG2C 4WTZA 3D18A 4M1RA 5EZJA 4QGCA 1R0AL 2ZZ4A 1KGXA 3FH8A 1DYSA 1HQRA 3GG0A 2Q7NA 5MHSD 3V1PA 1U8HA 1P0KA 5FYJL 1ADQA 4JUTA 2AGJH 1FAIL 4U6YB 1DEEB 1ZAIA 3CAFA 3TEYA 1DBBH 1KYOK 1V5JA 3AZRA 3J7HA 1UWSA 5BYWA 1SJXA 3SKOA 5D7IB 1M7DB 1R2TA 4H00A 2ZRVA 1MCNA 5KYWB 2VCOA 1R5WB 3JT2A 5MI0C 3WE1A 2XPYA 1RCQA 4XAPA 2FT6A 3I9AA 1A9EA 4O14A 1KENH 3J8F7 1RQ5A 3WD0A 2ZCHH 4N0FA 2CO2A 2OYPA 3O41A 3HS0A 5D1ZB 2UZ9A 1KF9B 4GGHA 3O2WL 2X09A 2INEA 3HHSB 2E47A 2QDDA 3TZVD 3ALPA 4N9DA 1VBJA 3EBIA 4G6KL 3EGDB 4WW1B 1LT8A 3FN0L 1QAWA 3RZCC 1UZ8A 1LL1A 3D33A 1IFHH 1XIDA 2EZ0C 2V8MA 1QFEA 1MCPL 4XCEB 4JFED 1Q94B 2F54B 4KZ0A 2WM1A 4WRLA 1NEZG 3GPSA 1JWUB 5IK3A 3UBHA 2BSTA 3QOMA 3IGXA 1JZ8A 3QGVA 3CN0A 2BFVL 1BZ7B 1JPSL 4JZOB 3EDEA 3JVGC 1G94A 3UPCA 1PSKL 1WKYA 2GVJA 3W7IA 2ZAHA 2E56A 1HYSC 5JW5B 3OLDA 1H5BB 1ZQ5A 1KCRL 3PPHA 4XODA 4ROQA 1U58B 4LHJB 4M3KB 1LP9B 2J8FA 1IIKA 4PJCE 4J2QA 2QVFB 2HV5A 1LUCB 1XH3A 1KG0B 5C0BD 2IPGA 2NV9A 5KSAD 1JCJA 2YK1L 4HNOA 3RI5K 1FH8A 5CH9A 1FLRH 3TH6A 3VC5A 3B2VH 3PC0A 4ZEPA 3TVMB 5HGBB 2XKNB 2AQPA 4GO8A 4YO0B 2PE4A 1R5VB 2VXTL 3RZCA 3S1XA 5DD3H 5JIHA 2C1PA 3UD6A 2Y24A 4CADB 1KIPA 1RJQA 4PL2A 2DWEB 3FRPB 3GJFA 3A3YB 5KBPA 1MHCA 3T40A 3IRSA 4Z95H 3HC0B 1WAAA 1TWZA 4WDUA 1BAFH 5D7JB 2D8KA 2YGPA 1FWTA 3UZJA 1LT7A 3QZEA 1VRDA 3DGDA 3CUPA 3MT1A 2CO7B 1CFSA 4F8QA 2YXXA 1A3ZA 4YVUA 2E9JA 3MKGA 3PL6D 4O19A 2E46A 4KCTA 2APVA 1UT1A 4KRPC 4PUEA 3C8KB 1TU2B 4KKRA 2TSAA 5DWUH 3ZPDA 2BVDA 2ADIA 3STGA 1XDJA 1P5UB 3QTPA 5ADOH 1N0LB 1KPRB 3UZYA 2A85A 1U30A 4MGGA 1W72A 3MNMA 1FORL 2APWA 4PMRA 4FA6A 1CG9A 4B5SA 3E80A 4TQIA 2YQGA 3LDBB 2NT1A 2W1NA 4KBPA 1T4WA 3DUHA 2ZOLA 4HAKA 4UOW0 4Q4EA 5AVYB 3D2UB 3RY4A 2HS8A 1G9NC 1YE4A 4I9XA 4G8IA 1J0ZA 3W57A 1L8NA 1FIGH 4WLCA 5D4QA 4RRPA 2XG5B 2FVLA 2P50A 5E0QA 4YHZH 2WJ7A 2NW3B 4GABA 1CECA 3FA3A 1CE6A 3RKDD 3ROOB 2FYMA 4A7SA 1MUCA 1FTXA 3DMMD 4E9VA 1LE9B 2QAFA 3NIGF 5BZWA 4M1BA 1ECQA 4I6KA 4H1LG 1AJ7H 1GZJA 2XZ7A 1KCUL 1RZKH 1BAWA 4HIHB 5SWSB 3NFNA 4WV1C 1SLWA 3ZYOA 2YD6A 1P5VA 4M9PA 1E9OA 1L9TA 4YMZA 4I8DA 4GKZB 1QWUA 2G9HA 1IE7C 1NFDA 1ZSHA 2XI9A 4PV9A 4IMGA 4LPUA 4AQ8A 2A6KB 3PAOA 4PH8A 3IU4H 4PG9B 1X3DA 2VXQA 3SUTA 4UNKA 5BZXA 3CUFA 3TCSA 5CC5A 1Q1JH 1I0DA 4HEME 5LBSA 2VR8A 4ZX4A 2I60H 4ZS7L 4J3TA 5CCGE 3LNMA 4F2EA 2YB4A 5DZNA 2PUZA 1PTAA 3PFMA 1A7OH 1U8MA 4DOHE 4MJIE 3LLDA 3N2MA 4I1NB 4OSUL 2EVHA 4DF0A 1ZTVA 4HIJB 4NHUA 3I75B 1CF8H 1P7QD 3GINA 1C8PA 3VUSA 1FRBA 4Q89A 5FGBC 1LO0L 1TQBC 3BEVB 5EIIA 1TZGL 4FQHB 2YN3A 5DJYB 3EFOB 1SLUA 3HA1A 4ZQCA 3KYAA 2ZT9C 4AG0A 2XZQL 2VURA 5C0CD 3R1ZA 2Q86B 4PRPD 4I9WD 1S7WB 4CJ0A 5DUBB 1S7UB 3KOYA 3MRNA 4LC8A 3JV4A 5I1HL 4J9JA 3A0OA 3M43A 4N9GB 2GY7B 4AT6A 1HHGB 3TN3A 4KO9A 2X0VA 4L0YA 3BGGA 3P77B 1FWWA 1RJCA 4ZENA 2AZAA 2YZ5A 3PWVB 3WXVH 3L2LA 3RVVD 2DZEA 5AVQB 1NAMB 4OFQA 1IXOA 1YPXA 5JQIB 3WSUA 4JMNA 3ELAT 2QSCH 2YPLA 1ROCA 2K3HA 3VNIA 1E4HA 3NABH 3VFGH 4TVPD 2YMXL 5E08L 4BCXA 1YDNA 2Y85A 1U6AL 3ZKNC 3CZNA 4X9FA 4GUGA 1FFPB 3ZWTA 4G6FD 1WAWA 2QUTA 1EF3A 3UWQA 4KIRA 4WJG3 2WWMD 5F3BB 2PTXA 4U3SA 3L2IA 4YEEA 1BF6A 3RG1C 3MHZA 2HBXA 5ETUA 6CGTA 5FGBA 3NFSL 5FYJD 1ETB1 3EGSB 2CJUL 3QHOA 4PE8A 3H9ZA 1DVXA 4AH2B 3KLHD 4FFYL 4L8DB 4KVNL 1K8IA 3EXJA 1NGPH 4A3UA 4AUYA 4HCRL 3E0GA 5B7MA 1F3WA 3WNIA 2H2SC 1FUYA 3C6SB 4HJJH 4Z0XB 2G75A 4HHMA 4AIBA 2ALRA 3FCTB 4ZS6C 3QR1A 1KC5L 4PJEB 1QYGH 3O05A 4FHKA 1IL1A 2Y07H 1F86A 4JD4A 4CVZA 4GKSA 3FJTA 4L18A 2NY5C 2DN7A 5T91A 1M03A 1C9DA 1MFBL 3SDAC 1BQGA 3OJGA 1MJ7H 1WAAF 5DXWA 3KLAB 4TUJA 2XZAL 4AD4A 2P5WB 4Y1AD 2F1BA 2N1KA 1K9FA 4R83A 3KWWB 3G08B 1ZGLM 1DANT 3TV8A 2BOCA 4IIQB 4ICMA 4TTDC 1NWOA 1UXSB 3ESNA 5E0CA 1ZV9A 4DWSA 2YWYA 2ARJA 1NDMB 1A6UH 4LMQI 4WZHA 3KJ4C 5SX5K 2TPSA 4WGXA 3HBGA 4KPHH 1BXCA 1X5AA 5J12B 3W2DH 4A2SA 1T6VN 3BVUA 2ODOA 2FO8A 2WTRA 3BHBB 2AV7A 2VT0A 2K6WA 1N8WA 3OKEA 1GIGH 3V18A 4BKNA 2FSEB 3TTOA 4HDIB 4DP7X 2ZXWB 1C16B 3CCHA 4O15A 3MRKA 2HUEA 2AK1H 2Y06H 3NNTA 1WG3A 3QUXC 1RKRA 2AQQA 3BE1H 1L9MA 5FDWB 1YMME 2HJKA 4OCSH 5IVZA 5EF2A 3W1MA 4PM1A 1WWWX 5F7BA 4GG6E 3WTWA 2DDXA 1NL0H 1V51A 4G6JL 4UZUA 3QC5X 3S96A 3MZGB 2F8VA 2V9UA 5J6SA 3S37H 6TAAA 3F7JA 2PTYA 1NSNH 2WMIB 4GCXA 3EBHA 5AW4B 1KRMA 5AOUA 1NEPA 4KX9A 3SDAA 2IDCA 4LCUB 1VB9A 5AYXA 5AZ1A 1RPKA 2VL5B 4X4MA 4LYPA 4ERIA 1TQTA 3WH5A 2WLIB 1PKYA 2YFOA 4GPVA 1QR1A 1NFDF 2BW5A 2WJEA 3GRBA 4A39A 1WV2A 1HJCA 4URIA 2RACA 2DJXA 3V16A 2XPGA 4JIPA 2WXLA 4QAIA 2RAGA 4R33A 3L3HB 3IDYC 3L08A 4YBLC 4ZODA 3VXSB 4ZDHA 2HLAA 4D6IA 2AEQH 1MUJA 3Q65A 1EFZA 1FCBA 1X9QA 2DWDA 3EGJA 1E3FA 5HJDA 3VUAA 4TTUA 5CZRA 4UTAL 1BZDA 4H0GA 4D6FA 3QG6A 2Y5JA 1YNLL 2ZUQB 4L3CA 1LLAA 2LVCA 3GDBA 4RGMC 3I65A 1OTSD 4DXXA 1U8IB 3RUBL 5E9DE 1NGWA 1MRFH 5FXCH 2R7EA 4XO8A 3N44B 4MA1C 1HKFA 2DTML 5G4EA 1KEGH 2P3ZA 5DRNB 2Z6JA 1C1EL 3GDCA 5C09E 1SRDA 2GVLA 1UFGA 5GIRB 4HLEA 3ARDA 5I6XB 2YD4A 3EFFB 3GYRA 3G04B 4RMTA 3CQFA 3NT0A 2I14A 1FQ9C 3K6IA 4XPBL 1XR8B 4GUIA 3ARTA 2Q10A 3KPSB 4W6XB 3EH5B 4MASA 6TIMA 2CLRA 1A7PL 2ZC1A 4ODVL 3PHQA 1LWIA 4A3RA 5J8LA 3UBXB 4IBLT 3QXDB 4LDCA 4PBFA 4N1CA 4DI9A 5K33A 5DC2A 2V17H 4XOCA 1EEUA 4OZFB 1PKMA 3PN8A 3FFSA 5EY5A 5HDQL 2CHXA 2ZYSA 3EH2A 2INZA 5K39B 3SKNA 1EV2E 1SOSA 1QI2A 4X63A 1X5FA 4PJ7B 3AU1B 4G3YH 3QYQA 3GU1A 4PRDB 3PCYA 4BXVA 3X1EA 3WH7A 2H26B 4OAWA 3TYAA 2KPNA 1I2NA 2WUBL 4M3JA 1IEXA 4AGQA 1H11A 3UCRA 1ESWA 2IUZA 1XL6A 4J3OC 4GRSA 3ZTJH 4X0KA 2XH2A 4X6CE 3ULUC 4KRMB 5E8PA 2GIXA 3IFOB 1EF2A 1AMKA 1A7BA 3LRHA 3MNVA 3MDWA 2G2RB 3FT4A 1EXHA 5AKSA 4WWOA 3GFYA 4KRZA 5J8OA 4MFEA 3CQHA 1MDTA 4R34A 5EOCL 2QT6A 4S1DD 5KETA 1FYTE 1Q6CA 3NA4A 2A1YA 2QGDA 4UBDD 2W80C 1DBKH 3FU9A 2CIPA 1IC4L 3H70A 1UKSA 4DH2A 4L9LB 1J79A 3PHSA 4S1SH 3VKDA 1TV7A 5FUCE 3DN5A 3G6AB 3PUUA 4I5BA 4G1EB 2OKOA 2XX1A 2XVNA 3DBNA 2FVMA 3T5WA 4OLWH 4BFFA 1TZ9A 2ACSA 4LFHD 4WEEA 4O52A 4V27A 1FI8C 1W3JA 2F38A 2DUXA 3MLSH 2P3EA 5CJMA 3T6XA 4L8CB 1DVFB 2DYRB 4US5A 5HDBE 5F6HJ 3BDXA 3RGBA 2QUMA 2DZXA 1L7IH 3LKPB 1B4LA 1TOXA 3QRGL 1N6UA 3QYMA 1QSFE 3BARA 1I1FB 1JAKA 3ABSA 4B3ZA 3FTZA 1BJ1J 2ZCLH 3KR3L 2IQAB 1YHPA 1BIIB 3B9VA 5ABFB 4NENB 2ED9A 3T2PA 5DEGA 3SYCA 5I1LB 4YDJB 3K80A 3TJEL 3HU7A 1SMAA 5C7ZA 1GG1A 1F8MA 4KEMA 1EPVA 4K94H 4QXTB 1F11B 3FVDA 3KAAA 1S38A 1IEHA 5IB1A 3T0EE 4UQ2A 1NWSA 3TZNA 3RJYA 1UZ6E 2OU4A 2NXIA 1ZVYA 5FKPB 3TURA 4PVLA 1J01A 3SDYH 4P3DA 2AV1B 4TSAL 3P4OB 5EA9A 5REQA 1W1B1 1TVPA 1X4ZA 4H25A 4YFLI 4NNBA 1IM3A 1ENUA 3I7QA 3E9TA 4N28A 3J07A 3JTSA 4MTMA 4LS1A 2BSEA 1A9BA 4Y6GA 1BD2A 5DQJA 1OX4B 1FF5A 4NXSA 2IQTA 4X50A 3OG4B 4MB4A 2GL5A 2Y5TB 2XV2A 1TWDA 1S9WA 5I3HA 2J7DA 4Y9EA 1MMFA 4KH9A 4NP9A 2HK0A 2COQA 5INDA 3IGFA 5D7EA 4UBPC 4R26H 3VFNB 3TNNA 2VHLA 2E7DA 2YQ2A 1I4FA 4OD1H 2Z28A 4AQZA 5LNWA 1DJQA 4XP9H 2CKBL 4L29B 2PO6D 1FE8L 1UENA 1UJPA 1UWGH 4ZVJA 3UG3A 4TMCA 4NXKA 3UA4A 2O6PA 2V7NB 3MBFA 1E0TA 2JFEX 1FSKB 4IBWA 5HNTA 4MZ3A 1HFUA 1WLHA 2V9TA 2C7UB 3PJTA 4PAZA 1ONRA 1NUFA 4U33A 3NZQA 3WBWA 2DMHA 4KRTA 2VN3A 1I9CB 1WH0A 1L9SA 2A6DA 1HILA 5A40E 1VEPA 5H2ZA 1TF4A 3VXQB 2J88L 5CEZH 1YDPA 4Q0XL 2E5BA 1RJYA 3OQ3B 1UZ1A 3T4CA 4YHGA 4QRPD 4U6TA 4JTJA 3U9UB 4AH7A 4P23D 5FFOA 4K3EH 3MJ7B 1RU9H 2R15A 3FQXA 5HOSA 4WUUD 4PS4L 1NU5A 4YWGH 4Y4HB 1LD9A 4UNVA 5HJ3A 1YUHB 1HHJA 4P2QB 3RNQB 3FLUA 3WFEL 1S2VA 3DOSA 4POZC 3KLDA 1WB0A 3IT8D 2Y61A 3GXIA 4KWOA 5JIWA 4IMLB 1ALDA 1CUOA 3C6LB 1E2VA 3KPQB 4NI6A 4Y16B 4WKHA 2GJ6D 4NKDB 3FKKA 4BFKA 2YUVA 3RITA 4J3VA 2FL5B 4WTZG 5HTSA 3MNZB 4UDTA 5F4XA 4AVOA 3HV8A 1EXUA 1QSEA 3WQ4A 3N9GL 3W6MA 3STBA 4IRJB 4FA3A 1VACB 3O9WD 1ZT1A 1R34A 1I8IB 3LKRB 5EUOB 4D6GA 3QR0A 4OFPA 5A6JA 3SDOA 3CIXA 1YNPA 2AEIT 4LVHB 3QVAA 3L1GA 1H7RA 3N34A 5J6GB 3I84A 1BRLA 5EC1B 2OTDA 3MHFA 4O0KA 3B56A 1EAJA 2F54E 3VIMA 4G80B 4PI2A 4Z7VE 3GTXA 1DLHA 1UQZA 3AVEA 1F3DH 3T1WA 3QUZA 4X7SH 3CB8A 3P54A 1TSHA 3DFPA 4HHAB 5KBNC 3ZVIA 5JORA 1EAOA 2J79A 4M6OL 1EBGA 3H0TB 1OCCB 5AY7A 4J5NA 1L9PA 4XVOA 1JV2A 5GNZA 1ADSA 2EKSB 2NDFA 3PWUA 4OUUB 2JJSC 4GRMB 3NCEB 3V5HB 3VSTA 1HI6B 4K5MA 3N19B 1LP9E 3LRMA 3IJYB 4KZEL 5I00A 5FYKE 3DO7B 4IIEA 3CUIA 2WZAA 4XX1G 5I19L 1OX5A 4HFWA 1QAPA 3SODB 3IXAB 4MS8C 4IGSA 5IBLD 2J7EA 2Y7NA 1WD9A 4EPSA 4J3OF 4W89A 2UYLA 3ULUF 2CBVA 2XV0A 1O5DT 5SV4A 2GPZA 3C09B 1HKWA 4L23A 4JHVA 2XJ7A 4G82A 1MLBB 3GM8A 4ELKA 4H20L 4GSRA 3UTPE 3RRAA 1DQKA 3N4FA 3NOYA 5KVGE 4O9HL 4I3RH 4WI6A 5ECJE 2QV2A 1R7AA 4JPSA 3P4NA 2B8OT 4KDWA 2YXGA 2GSEA 3ZZQA 3TBVB 4A67A 5K9OA 1G7LB 2X7VA 2NY3D 3E2HB 3GVGA 2PCQA 1TVBB 4DGIH 2MKWA 3KS5A 1IAMA 4DKFH 3CU1A 1HWHB 3NFUA 5F1UA 3LERA 2DB8A 3TVAA 3LEXA 3CDGB 1T04B 1U1HA 1C8QA 4WKZA 4AE1A 1LEKB 2QZQA 2FPTA 5FF4A 2E5DA 4XZHA 3W53A 4DZ8B 1G7UA 4BFNA 1ZGLB 1HU8A 4IP7A 1G1KA 4IU3A 3BUDA 4NZRH 1KBWA 3GSVB 1ZBVA 5LQBL 2QQQA 4LUJA 3Q58A 3BJSA 1M71B 4CNNA 3V4VL 3CMGA 1SQMA 3ECWA 2JJSA 2DH3A 1D9EA 3BPWA 4FULA 3T2NL 4D9QE 1VESA 4MJ2A 1LBFA 3P2BA 3CX5K 4FTVD 3C9NA 1B3VA 4JFEB 5LYRA 2GT9A 3TJXA 4YHYB 2O5XH 4PRNB 4Y90A 3W1LA 3NK4A 1VPQA 2OMWB 4G42B 1J6OA 1CLOH 2HWZL 3TWAA 1F58L 5JW3L 4TN9A 4F9JA 2KZBA 3P3UA 2Z0IA 43CAB 3DXAD 4OM0L 3RDTD 1J8HA 3B0PA 3V0VB 3WDHA 1HEZA 4J1UA 3CD4A 2BOEX 4R7DA 3D85B 4S1QL 4RRPG 1ML0A 4CW1A 3SDCC 3QJHA 2OL3L 2WAGA 3BV7A 4AENA 4Z0SA 4AC7C 3PBVA 4KUCF 2EEAA 1IEAB 2VE6B 2A6NA 1DJIA 1HP5A 3N42F 5D6CA 3KXFA 3F5KA 4UAOC 1FWJC 2IANA 1KDIA 1MHPH 3AS2A 3KBMA 4IIDA 3BUVA 3ZM8A 4WI7A 1XUUA 1DVTA 1EHLL 4ZA0A 1KM1A 3FBKA 3TNMB 4P8QA 4JTCA 5C0BB 3SJVE 4W93A 5KSAB 3LH8A 5ESVB 2PDBA 4F8LA 3KNBA 4K7PX 3MV9A 1WXJA 3QYNA 3RFZA 3QV7A 1A0QH 3ERXA 2R69L 2CHZA 5DYOA 3VXRA 2OT0A 4A2RA 2HNHA 1MQ8A 2HKHH 3E9UA 4EIVA 5FF0A 5MEPA 3G6DH 4XK2A 3NGFA 4MMXC 1VJSA 4FP1A 1ZVSA 3VFMA 3OHXB 3PFQA 1PB0A 2V33A 4NCC1 4LOCA 3HG1A 3HUJE 4ZZKA 1WE5A 3RCMA 3VILA 3T9PA 1F97A 1TUXA 4HGMA 1LE5B 2DVXA 5EIIG 4W1TA 1HWGB 2N0KA 3WQVA 4IJRA 3T4YA 2NY1C 3R8QA 5I6LA 2O5ZL 4F3FA 1IFRA 3SDCA 5CSSA 3ZL1A 3TX9A 3EKGA 1DE5A 4ZPVA 3EBVA 3DTDA 4P5TD 3USZA 2ZKMX 3OKDA 2OQHA 8A3HA 1AY1L 1OZMA 1RVFH 4E4FA 4Q6KA 1ITUA 4WOQA 2VW7A 5CBEB 4PGDA 3QUML 2EDQA 2PLJA 3TEUA 3NTCL 3O63A 3LSOA 1MNNA 2CA4A 2WVTA 4MDIB 1GW1A 5DMLA 1LJMA 1OSEA 2YZ8A 1YPZE 3K6FA 5EL1A 1U0QA 4AZHA 3GZKA 4PJIA 3DMMB 2XYLA 1O0VA 3WEMA 4NYYA 1QBMH 2YCLB 4APXA 4DI8A 3GKWH 4QM1A 3STFA 3U8GA 4O1BA 1FCCA 2EXWD 4MMXA 1UA7A 4UCFA 2F8XC 5XIMA 5DD6B 4JO1L 4JHMA 4KFOA 3L95A 4LV9A 1NGXA 3WNNA