4DO5A

Pharmacological chaperones for human alpha-n-acetylgalactosaminidase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pharmacological chaperones for human alpha-N-acetylgalactosaminidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Alpha-N-acetylgalactosaminidase
total genus 131
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4do5A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4do5A01
4I7VA 2OYKA 2R8WA 3T44A 3NQMA 2WNZA 3L5AA 2YJQA 2TRSA 2ZBTA 1CXHA 3S2CA 1TV7A 1TO3A 2VENA 4CQ9A 3IGSA 3PB0A 1AL8A 1WOBA 1XCFA 3LTPA 1W56A 3BLFA 5DY2A 3NPWA 1TTPA 5LGXA 1I4NA 4JFVA 3W2UA 2YYTA 3TH6A 1VFMA 2G95A 2ZUUA 2YA2A 5HDRA 4C1KA 3ABSA 2CLIA 3ECQA 1H50A 2YA1A 1QOPA 5L6UA 3HBLA 1OFAA 2C1HA 2WKJA 3DBPA 2FIQA 3D50A 5E70A 1SO3A 1QMLA 1XSKA 3UYCA 1SZGA 2ISSA 2JK2A 5K3VA 4XZ9A 5D30A 2V30A 3RIKA 4AXKA 1H7RA 1KXHA 3JR2A 2WSQA 4EVZA 5LNUA 4M6PA 3UQNA 1G7UA 1TPUA 3QGVA 3BUPA 3GKAA 4PEEA 4KWVA 4N6FA 2VOMA 2NT1A 2CLEA 3EXRA 4AEOA 1MW3A 4UCFA 5I23A 3NL6A 1FXPA 3B0PA 3NA8A 3WENA 1LOQA 3DKLA 3R13A 2JKPA 2X1TA 1NVMA 5CXPA 2FH6A 4HNNA 4FX8A 1QW9A 4LC8A 2FYVA 1DL3A 3M5VA 4TX9A 5D03A 2HSAA 3W22A 3BLBA 1XD1A 4MFDA 5D2YA 3SIZA 3KRZA 2XN1A 3D0CA 1PZ2A 4QAWA 1F5ZA 1JUBA 1J0JA 2A0NA 4J7RA 1H7WA 3PSVA 1EWDA 3TROA 4LV4A 2VT0A 2BLEA 4I7UA 2QEZA 3D52A 2BHZA 2C3ZA 4B5NA 1EP1A 2Y89A 3SI9A 3L4UA 4LRTA 1OSEA 1YYAA 3FOKA 2FPTA 4Y8FA 2CLFA 5BMXA 1VB9A 3OIXA 1BVNP 3BUBA 3HOJA 4RZ5A 2DH2A 1JUKA 1BPLB 2BHUA 1P0NA 4DF2A 1UASA 3TX9A 1PEZA 4Y9AA 2DZPA 3QMRA 3BUIA 4A21A 3C3NA 1WXJA 3W7CA 1HT6A 1TPVA 3TSMA 4HKPA 4WJEA 1RQEA 3A22A 1UOKA 3NDOA 2ZTJA 1MW0A 1S5TA 2WCSA 1WBJA 2ZQ0A 3KRSA 3IEBA 4OU1A 3LHYA 3BSGA 3GX9A 1PL9A 1UKTA 4UMBA 3SGUA 1XBYA 1GCYA 2YCEA 5A6LA 3CZSA 1BWLA 5J5RA 2VRKA 3VNYA 5BOOA 5FF0A 2FPVA 3HPSA 4MIMA 3P82A 4NXKA 2W79A 3IIPA 3HGJA 4TVUA 5D37A 3INPA 4JTTA 3NPUA 1JDCA 3BAJA 3MUXA 1TPDA 1J2WA 3LCWA 2C6QA 3PUOA 4GUIA 3FAXA 1CXKA 2PURA 1V7YA 3CEPA 1TCMA 3A24A 3KLLA 4UNLA 1EEPA 2PC4A 1OFPA 1QCWA 2E6AA 4PA8A 4H8UA 1AW2A 1NAL1 4P61A 1DJNA 1B9BA 5G2WA 3AXIA 4XKYB 2YKKA 3LB0A 3TTSA 3N73A 4BI5A 1L0PA 3IJ9A 3UZJA 3LTSA 2Y7FA 2VRQA 4TO8A 2F2HA 2WKGA 4QNEA 5IBXC 1XH0A 4IX2A 3VGHA 1VZWA 2QCDA 2WQPA 1Z32X 4R53A 3W1QA 1HO4A 3W70A 5I5RA 4HNVA 4ALDA 4ORMA 1HTYA 4JX5A 4EF8A 4NUWA 3LHWA 2WPBA 4EF9A 4UFMA 2GQ8A 3O15A 3HJEA 3QPYA 5K2ZA 1JRBA 4K36A 4DBDA 2F61A 2X2JA 3GR8A 4HSNA 1MXGA 3BC9A 4PH6A 1RVGA 4J9JA 4Y90A 3RU6A 3A6OA 3GXIA 2WC7A 3U2OA 3WK1A 3UWQA 3S42A 4C1LA 1LLZA 3IIXA 3NG3A 4X22A 1LWHA 3M07A 3FKRA 1UKSA 1K7FA 5DY3A 2DIJA 4UIOA 4GI8A 4IMGA 4GO9A 4IUOA 5K4XA 3E12A 2GPTA 3NZRA 4A2RA 1YTDA 2NV1A 4XTDA 5EYWA 1ICSA 5EL1A 3LCFA 1TV8A 1QWGA 4JY9A 5E9AA 1XD0A 4FMVA 3C56A 3O1NA 1CGWA 3VSUA 1OFQA 1JCXA 4LTSA 4RXGA 3WJXA 2YFOA 4GQQA 3RF9A 3NAVA 3K8LA 5KMYA 1LOSA 1GVOA 2R94A 1PCWA 3P7YA 1ZFJA 3G1FA 4JNMA 4AVFA 1W3TA 1DHKA 4FNUA 2F84A 2CZFA 1QNVA 5I3HA 4QITA 2OJPA 4CN1A 1W5QA 1JI2A 1G4PA 1QPRA 2EEXA 3A4AA 1KFLA 4GQRA 1EP3A 3L0KA 2I9EA 1U2YA 4Z1BA 1SQ7A 2ZZ3A 4MY9A 4UTWC 1L2UA 1WP6A 2E8ZA 1L6SA 1WV2A 1B57A 5E6ZA 4NNCA 4J3XA 2IGTA 4RK8A 1MWOA 1OT2A 1L9WA 3BVTA 1BWKA 3O6CA 4O1CA 5BRQA 3OVRA 3QF0A 4GFSA 3LCLA 2QJGA 4FNQA 2E1DA 4UOZA 3TCEA 4S2CA 1L6WA 3S9YA 3O16A 2J27A 3G0XA 3HG4A 4XB3A 4ATWA 2ZDRA 3G3DA 1TYGA 4O0KA 4GKLA 1MFVA 5EBUA 3TE9A 3W7GA 1TPWA 2BX7A 3WJWA 3K1DA 1FWWA 1NM9A 4GIAA 3ZFHA 1FY6A 2LLEA 3PS7A 3LV6A 4FXSA 3FLUA 3W7HA 1TRIA 4ZQNA 3DX4A 5D09A 3M16A 1ZJBA 1GYLA 3P8JA 4XUGA 1KXQA 3WDIA 2Y70A 2BZNA 3W1RA 3P67A 2BY3A 4YWIA 2OZ0A 2Y24A 2X2GA 2EO7A 1G1YA 4LUIA 3BO9A 1KXTA 4QIUA 4U28A 3KL5A 1HL2A 2DU2A 1JCYA 4W93A 1H7NA 1WYIA 3FYOA 1I8JA 2YXGA 1GJPA 3AJXA 3BLIA 1TQWA 1J4EA 2JBMA 1EH9A 4IX0A 5E0FA 1U30A 1QOQA 1EX5A 2QCNA 1K8XA 3NO5A 3ZSSA 2FE0A 1QAPA 3NL2A 3ABQA 4MJMA 2YFNA 4OJYA 1JCLA 2YIHA 2V3EA 2GOUA 4LV9A 3QEZA 1K7XA 1RV8A 2ZUTA 1G67A 1I45A 1H1YA 3I7SA 1WO2A 4FX7A 2D3LA 3NVTA 3KAOA 2NX9A 4L4MA 1NFBA 3RK8A 3STGA 1EUAA 4HNUA 4MAZA 3BAIA 4O1BA 4UFLA 3OG3A 1A53A 3WNPA 1KM3A 4UC5A 1B4KA 4NNAA 2D2OA 1OFEA 1X8FA 5HQEA 3STEA 1PZ3A 3T7VA 1XM3A 4AW7A 2VEKA 2WSRA 3NYZA 3VKJA 4E2DA 2WNQA 5HUOA 4MYXA 4PC8A 4BF9A 4QNWA 1PHWA 3SFKA 2QCLA 3LDVA 3NL5A 2Q3RA 2CLMA 3O06A 3T78A 1ZNNA 3W7JA 1X7FA 4RR4A 1GOXA 3CQ0A 4JTFA 1LTDA 4PSRA 2D73A 2QJHA 2WO5A 3OHIA 4HA1A 4J27A 3P8IA 4U4MA 1OT1A 3A23A 5KTLA 1OF8A 3AMLA 2FH8A 1F6KA 3TUUA 4K7VA 4WOQA 2H6RA 1RD5A 1XH2A 3KL3A 3L68A 4GUJA 1JRCA 5DLCA 4GI6A 1FCVA 2HS6A 4X2RA 1MFUA 4DPQA 4WSKA 1KWKA 3LRLA 5E6YA 3NPVA 3BUQA 3LHVA 1ME7A 4NJKA 4MB1A 3MP3A 1KBIA 1XUUA 1JCNA 3W7NA 4JGDA 4MPQA 3M7WA 1JIBA 5FF4A 4ZZ9A 2ZX7A 3L21A 4AF0B 2OW6A 3MP5A 1WBHA 1KTBA 1M6JA 5LHFA 3UWUA 4MVAA 2BXZA 1N7KA 1HTIA 3W72A 4KKXA 2BTMA 3M47A 3C52A 1LWJA 4RJEA 2ZZ7A 1Q6QA 4OV9A 5AYZA 3C2OA 2TMDA 4K8HA 5D04C 3SSJA 4JFSA 1ZAIA 3BMWA 1NF7A 2NXGA 2G5WA 4O16A 1VFOA 5G5IA 3W7RA 3NEVA 2G96A 2FGZA 1E3ZA 2BY0A 4WXYA 5AC6A 2QCFA 1XDMA 2XIBA 3TV8A 2GJNA 1OFRA 1WZLA 3S1UA 1PCKA 1PIGA 4UTLA 2ZWZA 2J6XA 1OVDA 3OLDA 4FX6M 3WK2A 1NSJA 2ZWYA 3IK2A 1GVSA 3HB9A 1XV8A 3SR7A 3GTNA 4M56A 2DP3A 4O14A 3M9YA 1TSIA 4GO8A 5MHBA 1FWRA 1DKWA 2Y7EA 2WANA 1QHOA 1UB3A 3W38A 4O1DA 3H55A 3QM3A 4MZ1A 2DZVA 1OYCA 1CXFA 1B3OA 3N19B 3OBKA 1UH3A 1WE5A 4FIRA 1U33A 1CX9A 4MLRA 1R2RA 2B7QA 2Q8ZA 1KBKA 3WNOA 3PR2A 1JF6A 1SR9A 2Z2UA 3BUDA 5G4EA 3DAQA 2ATSA 4N2YA 3LXAA 1FQ0A 2YDAA 2FFCA 3JS3A 4AEEA 2RDWA 4ZQRA 5D38A 5A5WA 4UZSA 1FCBA 4QAIA 1RP8A 5F2IA 2VFIA 3W23A 4KFPA 1U83A 3TW6A 9CGTA 3G1SA 1MZHA 1UD8A 1VAHA 5EKYA 1TREA 4NXSA 3EWYA 3UCQA 1UD2A 1J0IA 3NQ7A 4YMZA 1TQXA 2H8XA 3EX4A 4UTJA 2CHNA 3UY8A 5I3JA 1N8FA 1MEWA 2ZRWA 4HPHA 4JTJA 3TAOA 1IZJA 4WXZA 1KTCA 1XFBA 5CPOA 1G6CA 5CZTA 2QV4A 1QI3A 5D2XA 5CKSA 5T26A 5BMWA 5IM51 2A6NA 3CWOX 3TKFA 3LRMA 3MI6A 1VJSA 5FEXA 1JQXA 4PL1A 3FW6A 3S8HA 2GJLA 5DBTA 2WJZA 2Q8LA 1CGTA 1IXOA 1CW2A 5AC7A 5HWJA 3GNNA 2FHCA 2B7NA 4ADUA 8CGTA 3W1UA 3C2RA 3B04A 3KFTA 3G0SA 1WDWA 4I9AA 1KM2A 1ZENA 2NV2A 1GJUA 2WSKA 1W9XA 5AN7A 4NZFA 4O15A 3HIJA 1GVIA 4BFAA 3WDJA 5AOUA 1AK5A 4LQ1A 1SZEA 3TTYA 4BA0A 3IV3A 3NQAA 2FHBA 3RMJA 1JJKA 5DCBA 2WSYA 3KXQA 3TAKA 3OVQA 3ZQ9A 1SFLA 3W7IA 1KA9F 1CPUA 3F4NA 1TPB1 3W7QA 3OVPA 3IRDA 1AMYA 1H7PA 1N55A 2X2IA 1OFDA 1C9DA 2AMGA 4N02A 2Y85A 1FCUA 4LVBA 3W75A 3F4WA 1JGIA 3L4XA 3DDFA 2FJKA 3G8EA 3TC6A 2EQDA 3FS2A 3EJPA 3HJZA 1LORA 2QAFA 5DN1A 2NSXA 4LU0A 4WUIA 1OABA 5CLTA 4IMDA 3FAWA 3MI2A 3DFQA 3QH2A 4B9ZA 4OGZA 2EADA 1I2OA 2J25A 3EDKA 4YLWA 3KVKA 4JCLA 3NM1A 3L5LA 2CW6A 3NZ1A 1KGWA 3VX1A 4JTUA 4W9TA 2PE4A 4FEZA 3WEOA 3ABRA 4J3SA 1F2JA 1NOFA 2QCEA 1SSDA 5HINA 2CXGA 5A2AA 3BV4A 2J88A 4CCCA 2BXVA 3W76A 2JGYA 1OG0A 1OX4B 5C5YA 2PRMA 4M6QA 1NEYA 1YXYA 4ADTA 3TU9A 3L9CA 2ABBA 3PUEA 3HPXA 2Y5EA 1CGYA 4CCEA 1E40A 3GBDA 5LNWA 4LVFA 4UTKA 2QMJA 3PC0A 3TQ0A 1VJIA 2YX0A 1FCQA 3I6RA 4PODA 3M41A 1XXXA 3O05A 1TPEA 4AH7A 4UFIA 2V2CA 1W5PA 1FX6A 3E9AA 4XTIA 3THQA 1P4CA 3KHJA 4Q4KA 4TMBA 1KLZA 4K38A 1LRQA 3B06A 2FPYA 3TIMA 3C2FA 4Z08A 1CLVA 1VYPX 1P1XA 1D3HA 2YW3A 5G4WA 4HPXA 4M7TA 4ML9A 3BVUA 1IZKA 2HS8A 3PWAA 3MHFA 3VX0A 1DBTA 1KBBA 1P6WA 1KCLA 1K03A 5AFDA 4JFUA 1Y0EA 5A8GA 4A3UA 2ZA1A 3CWNA 1UD6A 4AIOA 5C2XA 2NZLA 3S0CA 4FIQA 2JKAA 4BZYA 2W6RA 3NNTA 1OX4A 1FWNA 2Q3OA 3BW2A 3ZS4A 2WOQA 1PS9A 3UG5A 2EAEA 1BTMA 4B9YA 1H63A 3UXDA 4FB7A 5HWMA 1I2NA 5HWNA 2YOCA 3P74A 3CPRA 1SMAA 3KE0A 5EA9A 2AAMA 4JY8A 1D3GA 2QAPA 2EABA 4Y96A 2QPUA 3BK0A 1LDCA 3MO7A 4U2ZA 3B8DA 2R91A 5FF2A 2ZRYA 2NXHA 3B03A 1M7XA 5KZMA 3R89A 4Z0JA 4NVTA 3FKKA 4X3ZA 4UNKA 3F03K 2ZRXA 1XGZA 3VGDA 5D2WA 5E0KA 2QLYA 4RV8A 1EA9C 1LYXA 3DFSA 3B0VC 4OKDA 1QPKA 5K9XA 1JCJA 4E2OA 3M1ZA 4O57A 1UJPA 1SFJA 4JTSA 3MBFA 1HNYA 7TIMA 1LRTA 1E51A 5BRBA 4M19A 2FHFA 1IGSA 3CZKA 1M7PA 3CT7A 3QJAA 3N9SA 2IQTA 1XCXA 4UQCA 1G9HA 3UG3A 1W5NA 4AYGA 2CPUA 2XWDA 3W1MA 3BG9A 5AHIA 1JVNA 2QKFA 4RKAA 3MHGA 3TMQA 3MWAA 2GUYA 3K8MA 3TXVA 3FIGA 3C4UA 3H54A 4CNPA 3UERA 2GQ9A 3BVVA 2TAAA 3STFA 3SY5A 1MSSA 1UCWA 1XBVA 3LI0A 3VFLA 1XUZA 4K6AA 1YDOA 1PIFA 2BY1A 1LBMA 3K30A 4MKNA 1XL9A 3DC0A 1GTHA 3CC1A 1ZHAA 4AHPA 2PRLA 3N34A 4N9CA 2QF7A 1CGUA 3NQEA 1G4EA 5H91A 4UUIA 3G8RA 2BHYA 2CZ5A 1BVZA 3AMKA 1VHCA 3B05A 3NL3A 3VM7A 1R2SA 4D2JA 5LZLA 5DFAA 3CU2A 2WV8A 3L2MA 1BKSA 1G4SA 4K8EA 4UQAA 4AIEA 1H60A 3NR0A 4O8RA 2DJLA 3EDFA 2ZA2A 3DX0A 2QR6A 3IGUA 1T0OA 3S5YA 1D9EA 1EWEA 1KV5A 3H53A 3BG5A 3DI1A 1LCOA 1KM0A 1Z48A 1DJQA 3BGGA 3NQVA 4RLIA 4AMXA 3CM4A 3GXNA 3TSDA 5HULA 1HL9A 3U6WA 4DPPA 1SW3A 4N9BA 3BAWA 4HOWA 1JQVA 4EIVA 3E49A 6TAAA 3W7OA 2VFFA 3PVFA 4GINA 1ADOA 1JL8A 1KTNA 2E6YA 4PSPA 3HGSA 5F2LA 4UXDA 1GEQA 3W86A 6ALDA 2O7QA 2GQAA 1YPFA 3VU2A 2OSYA 2CWNA 1KGUA 2GVLA 2XVKA 4TMCA 4JIQA 1JCMP 1HX0A 3W1AA 3NQGA 1VCVA 3ZT7A 4U2YA 3THAA 3PBWA 4G1KA 5U4NA 1QX1A 3BVXA 1V3MA 3CZGA 2QCHA 4H6KA 5I3FA 2A85A 1C29A 1GT8A 1O5XA 1Q45A 4GRSA 4Q32A 2CU0A 1YLVA 3PAJA 4LVDA 1WZAA 3W7PA 2C8NA 1AG1O 2RFGA 3TFXA 2OX1A 4DQWA 4A2SA 2VELA 5EY5A 5AYXA 1RQHA 1YTEA 2B4GA 1PAMA 3EJTA 7CGTA 4K7YA 4UNIA 2G3NA 1B4EA 2C19A 5CPMA 1PE1A 3WFAA 3Q37A 1ICQA 3I7RA 1DTUA 1GTEA 3W7LA 1XBZA 4ZMGA 1OK6A 3P80A 2WVTA 3TA6A 1W5MA 3BARA 1T99A 2BXYA 1H51A 3LM7A 4FO4A 5HR6A 2A2IA 3CIXA 5C6MA 1K02A 4WD0A 3P62A 4NJJA 3R5EA 3HGRA 5TBOA 3EX3A 3QQ1A 2X30A 1I2PA 3ZR5A 5CLWA 3A5VA 1KV8A 1UH2A 1JD9A 2OT1A 3VGEA 5K9DA 3DHPA 3W9ZA 1ZJAA 3M43A 1F73A 4R7JA 2V3DA 2OT0A 3L0NA 4LS1A 5FF7A 3WELA 2R14A 3G1VA 4PTNA 4RCXA 4WSJA 1S3HA 4WY0A 1V3LA 1JD7A 3EWUA 4UR7A 4IJBA 4P2VA 2F7QA 2P0OA 1KFEA 2YSWA 1U5JA 4GNJA 1I75A 1DQXA 2Y7DA 4CQAA 2CLOA 3HZ3A 1ODUA 4JX4A 5D05A 1ZAHA 3IGXA 2ZUVA 3W88A 2AQWA 4HPJA 4A22A 1HXKA 4HP5A 5HR7A 1PHQA 5CZSA 1FBAA 4WY0B 4X9YA 3SECA 1WZMA 2PCQA 4GUGA 5A6MA 4JS3A 5E93A 1G5AA 2ZCGA 2ZZ1A 4HNTA 5FEWA 3CTLA 2YR1A 3N3MA 1RR2A 2CLHA 2DZSA 2WVUA 4OIFA 4MOZA 3QSRA 4JTLA 1VLWA 5F1VA 3TNOA 3LI1A 1GZGA 3DFNA 1XKYA 5I3GA 3YPIA 2NX3A 4JL1A 3BW3A 3CTTA 3LXBA 4H2CA 4S1FA 3W2KA 3EJRA 3NGJA 4LW7A 1DQWA 3EX6A 1SSGA 1BSIA 4PCSA 4UTTC 1M7OA 1EO5A 2C16A 3PBUA 4DO6A 2F1AA 4J3TA 4QQ3A 5KZEA 4JYDA 2C13A 3UNDA 3O07A 1E3XA 3M6YA 1WOAA 2ALDA 1IXQA 5K9CA 4UQBA 3DGRA 5BW6A 3W74A 1ME9A 4FXRA 5KEZA 4FLQA 3DKJA 3S1VA 3UY7A 5C55A 4WX2A 2ABAA 2CLLA 1LROA 1A5SA 1VHNA 1SO6A 2B7PA 3LV5A 5GVJA 4XWUA 4RX0A 1DV7A 4NT0A 4QJ1A 1JDAA 3P5YA 4H4IA 1WA3A 3G24A 2ZXBA 3HO8A 1Z41A 3ZOAA 4OT7A 3LOTA 4N9EA 4L4LA 4UQDA 4JYEA 3ZO9A 1CXLA 4QISA 3QW4B 1DHPA 3HQ1A 3S6DA 3QW3A 5LSMA 3VGGA 2RKXA 1GG1A 3DFPA 3LLFA 5BRPA 3WNNA 3TMLA 1W0MA 3AXHA 3GZ3A 2DZTA 3C0JA 1QO2A 3LLDA 1YDVA 8TIMA 2V2DA 1JUEA 2OYLA 3W3OA 2QCGA 3GXMA 2FB2A 5HUPA 2ZZ5A 3A5FA 1HL8A 4DBEA 3GXTA 1THFD 1VFUA 3GK0A 4XBSA 1UD3A 1LOLA 4HN4A 1OB0A 1S5WA 3QZEA 1P0KA 3VSTA 3WY2A 3V75A 1ONRA 3IVSA 2VUYA 1O95A 4RXFA 1PJ9A 4O28A 1JXKA 1G69A 3L4YA 4JTHA 2Z6JA 4FNPA 3W1TA 3TFCA 3DHUA 2FB3A 4IOTA 1PV8A 4M5PA 3LHZA 3TDFA 5DELA 1M53A 1QPOA 1VYSX 4JEQA 3NQCA 1G7VA 1ZJIA 1ZCOA 2Y7GA 2VFGA 2AAAA 4XQ6A 4PCTA 1EP2A 2QMKA 4BR1A 3O63A 4JYFA 3PBYA 4NJGA 4NX0A 2Y88A 5CSSA 3O8AA 4FNSA 3W85A 3L4TA 3LERA 1HG3A 3M5XA 2X1UA 4GWEA 3GDTA 1RP9A 1VLIA 3VI2A 2BWGA 1FUYA 1QR7A 3GVGA 3MHUA 4MUZA 4YL2A 1KXVA 1DVJA 3W07A 3ZWSA 2J9YA 1VR6A 1MW2A 3WJYA 4OV4A 5CGTA 1LLWA 3WNMA 4JTEA 3TXZA 3RILA 4UMAA 5BNKA 4QSHA 4ZQOA 4WLCA 3W2JA 2WVVA 1EPXA 3M0ZA 2PWDA 4IXHA 1ZY9A 1FDZA 3W2NA 3DENA 5C54A 3WY4A 3EWXA 3VE7A 1FDJA 3OEXA 1EA0A 3HG2A 3KL0A 3CEUA 4YCPA 2QPSA 3TQVA 1TIMA 1SMDA 4LS2A 3WN6A 4N9DA 4O19A 3HG3A 1F74A 1JF5A 3VMOA 2E8YA 3KVLA 4NJIA 2RH9A 1W54A 1OYAA 3EB2A 3PULA 2DH3A 3DX1A 4Y6GA 4AYSA 2Y62A 1WQ5A 2VC6A 1A5BA 4LT9A 1PPIA 4HSOA 3SJ3A 1W37A 4JICA 3TONA 4UMCA 4YCOA 4UQ9A 2NUWA 6CGTA 2ZX6A 2YA0A 3ZT5A 2ZX5A 3G18A 4M6VA 4CN6A 3E02A 3R2GA 2EACA 3W71A 2V8ZA 3LCHA 2E9BA 3GR7A 3VM5A 2ZXAA 1QHPA 1IIHA 5G2IA 2ZUWA 3ZR6A 5L9FA 3ZT6A 2HTMA 1UA7A 4GUFA 2B7OA 5LGZA 4N4QA 3N2MA 1RPKA 1OFOA 1A5AA 3P60A 1AMKA 1Q3NA 2JKEA 3EJUA 1VS1A 4Z1CA 3FJ6A 3KWXA 1BF2A 3IIOA 5SWUA 2WKLA 2V3FA 5H2ZA 4ORIA 4JD4A 5FEZA 1KW1A 1VCGA 3GIYA 1KGXA 2VKZG 4LRSA 5AHEA 5F2MA 4O1AA 3DX2A 3N14A 3S5ZA 1MXSA 1SZNA 4AF0A 3W7EA 4JFTA 3NQ2A 1UUMA 5E1QA 1UKQA 5K7JA 3UXAA 2D0FA 4BI7A 1V3JA 2O7SA 1CXEA 4MY8A 3WJSA 3EX2A 3CB8A 5HNRA 2F7RA 3CHVA 4JXCA 2OSWA 1W8SA 5KINA 3BH4A 3BW4A 1KM5A 3NQDA 1R33A 3GXPA 3BSHA 1IXNA 2QCCA 2RDUA 2WVVB 4ZQMA 3W83A 2PWFA 1KBJA 4O10A 5EPDA 2NXIA 2Z6IA 3GNDA 5DO8A 4O50A 4S2BA 1HFBA 3W7MA 5LKYA 3MI3A 2NT0A 3MP4A 2A7RA 2VNCA 1R34A 1S5VA 4DEFA 5F4SA 3SW6A 1JFHA 3SZ8A 1LM1A 5CG7A 3NOEA 1ALDA 1HUVA 2ZRVA 2ZRZA 3LCGA 3N9RA 4IPJA 2ISWA 3EJQA 2EF9A 3LRKA 4WY0F 4O53A 3KEHA 2FQIA 3W37A 2CZEA 3TJXA 3TR2A 3FYPA 2AGKA 3G1XA 3S1WA 2BSLA 1BEUA 1SU5A 2YW4A 2ZA3A 3VCRA 1JAEA 3NQ8A 1QI5A 3R12A 4FHAA 3L65A 2Z1BA 5AB3A 1VH7A 4K37A 3UWYA 1OF6A 4Z0SA 4OHQA 4HOXA 1OX5A 2TYSA 1GG0A 3EKLA 3QC3A 3VNDA 2CFFA 1XSJA 2GJPA 3MW7A 4IMFA 4POCA 1WX0A 1AQMA 3UWWA 3CGTA 1QI4A 5TD4A 1JI1A 1SO5A 4RZ4A 2NWSA 2EAWA 3QMSA 4NNBA 4U33A 4ONVA 5ABTA 2WNWA 1FWTA 4GE8A 3WFZA 3T40A 1CGVA 2FTPA 4J3WA 2Y2WA 1QO5A 4ZVJA 3SGZA 4AHOA 3CLWA 2JGQA 3BLPX 3UD6A 1GPWA 2G3MA 2WNNA 3ZR4A 1UA3A 1GVFA 4XBKA 2VR5A 1YDNA 1TTJA 1OGSA 2QJIA 1AL7A 3O6DA 1H61A 1UBSA 5G1YA 4O52A 1HVXA 2V0TA 1FDYA 4IGHA 6TIMA 2ZE0A 4H8VA 1OYBA 4TU1A 2XN2A 1J0KA 3W1LA 3DZ1A 3AJ7A 2ISVA 1T8XA 2H8ZA 1GVQA 4CLMA 4O11A 1IV8A 3QMTA 5FESA 3VGFA 3TK7A 3BCFA 1W3IA 4UTMA 2RDTA 1TPFA 5CPNA 3L67A 2NUYA 2E77A 4AWTA 2GVGA 1B0IA 1X6UA 3OLEA 4UTTA 4H8HA 3M5YA 1SW0A 1TQVA 3QQ0A 2F7PA 3BVJA 4TIMA 1O4UA 2QCMA 1GYNA 1JULA 1LRNA 5CZJA 3RLVA 3BAKA 1EHAA 3CPUA 2NX1A 3CV5A 3G0UA 1YXCA 5EMYA 1H5YA 5D02A 1OK4A 2OSXA 3CLMA 1QWNA 2A1YA 2E5DA 5DBUA 3D4ZA 3GYEA 3AO0A 4DO5A 1H7OA 3FA5A 1YADA 2OW7A 3I65A 1QWUA 4LXFA 5FEPA 1OJXA 1S46A 1X1ZA 2ZIDA 4FLOA 3R8RA 1P5BA 3M5ZA 2F18A 3GXDA 2P1FA 2H90A 2UV8G 1K3UA 4CNNA 5EMUA 4N6EA 1H62A 4A29A 1D7FA 4X0NA 2QUVA 3WDHA 4HOZA 4MLJA 3N2XA 3CZNA 2C7FA 3L2IA 4JDYA 4KFNA 1QPNA 1K8ZA 3BMVA 1X1OA 3V1PA 5FI8A 1V5XA 2DJXA 5A2CA 1SW7A 4FLRA 1SPQA 2OMAA 1KWGA 3L0GA 1CYGA 1ZALA 1JDDA 1TTQA 2A6LA 3GXFA 4M8UA 4GC4A 1AQHA 1OHLA 4M7SA 3BLEA 4J3VA 3MYOA 4R34A 2XWEA 1IF2A 3HGOA 3M44A 2FDSA 1TRDA 4JFWA 4MY1A 4GJ1A 1TJPA 2ZUSA 3BGJA 5FF3A 3VSVA 1WAUA 3PB2A 1UUOA 1JG9A 3TOPA 1TJRA 2EJ1A 4JTGA 4OWGA 4H3DA 2Y4SA 4BWLC 4NJHA 5AYYA 2QCDB 3K8KA 1C8QA 2D3NA 3G1AA 4HHPA 3ELFA 3QPZA 3U8GA 3W84A 1MO0A 3WNLA 4XKYA 4K39A 3A47A 2NWRA 1O5KA 3EXTA 3C61A 3W73A 4AHQA 1GVRA 3LCXA 3L4WA 3VGBA 1TQJA 3W87A 1M5WA 5KSWA 1QFEA 1QDSA 3KOFA 5CSRA 2A4AA 2YZRA 1RQBA 1Q6LA 2J24A 1QPQA 3LXCA 4O18A 4UR8A 3OLGA 3NM3A 1EO7A 3BVWA 3TQKA 4U31A 1OFBA 5G2HA 4CCDA 4O54A 1VQTA 1PVNA 2XN0A 4LUJA 1KLYA 3P5ZA 4AMAA 3RNDA 3WK0A 3L2LA 1KB3A 1TPH1 2HMCA 5KITA 1YPIA 4WQ6A 3EWBX 4KFOA 1XC4A 2C15A 3ABOA 4YXGA 1ML1A 1CXIA 2V82A 3GAKA 3HG5A 1LP6A 2V5LA 5I24A 3B0UX 5K4ZA 3G1HA 5AHLA 5AHMA 3STCA 3BPWA 3WK3A 2D0GA 4U3CA 2V81A 3EXSA 3Q2DA 4UCGA 2J9XA 4MYAA 3PF3A 2EGZA 5AHNA 3UZ5A 4JTKA 1O94A 4CQ8A 5F7UA 1LZOA 2E6DA 3W2LA 1F7BA 3DHFA 1IIGA 2Y63A 4I7WA 4BK9A 4CVWA 3FEMA 4E38A 1GQNA 2A5HA 4NZJA 5D33A 3S1XA 3DFOA 3IJ8A 4JX6A 5U7SA 1WZKA 3KVJA 5LHEA 1EB3A 3LCIA 1BLIA 2WPGA 3IVTA 1LBLA 3PG9A 1RZMA 3GKFA 1A47A 2YGYA 4Q33A 3QFEA 1SZFA 1CGXA 2ZXDA 2GVJA 1TQSA 1TPC1 4O0ZA 3LTYA 1FXQA 2Y61A 5IBXA 3EX1A 1UH4A 4DF1A 3I7QA 1AW1A 4LVGA 2YYUA 3GLCA 2VEIA 2NUXA 1H3GA 2E68A 1YXDA 3DFTA 4NQ1A 4E2BA 3QYQA 4MZ8A 2C0AA 1MEHA 3EEGA 1AVAA 3VNZA 4NX5A 1O7DC 3VMNA 3EJSA 2A7NA 3F1QA 3MMTA 1TQUA 3PSWA 4IQLA 3W1PA 3BLKA 1OX6A 1T96A 4WOZA 3W1NA 4UTHA 3UEQA 2VEPA 2DZXA 3WEMA 3W7DA 1NF0A 3TC7A 2ZZ4A 1VYRA 2KZHA 5F4WA 2DORA 3L5MA 3KX6A 4GXMA 2C14A 5F1UA 4AAJA 1PIIA 2Z0IA 3PM6A 5F2GA 1R47A 1YTKA 2GUUA 2P10A 3NXFA 4CKQA 2FLIA 1KFCA 2X1SA 4LVAA 5D2TA 5CZ0A 1V3KA 1DORA 2ZRUA 1R46A 3DH7A 3HF3A 3LHTA 4HIBA 4RZ6A 4UZUA 1Q6RA 5DXYA 1EUNA 1WPCA 3LPOA 1KFBA 3W6YA 1TMHA 2V9DA 4DXVA 3ZSTA 3JRKA 4UFKA 4KMQA 3RFAA 4ZQCA 2TSYA 3KVMA 1KM4A 3VO0A 3BCDA 2ATMA 5KZDA 1XSIA 2C18A 5I3IA 3ANYA 3W7KA 2DZWA 1TV5A 2X16A 3MYPA 4UTIA 4QM1A 4IXXA 4UQEA 4LC6A 1W3NA 4UFHA 3ATYA 3PBVA 4AWUA 3UWZA 2ZICA 5I3KA 4Z1DA 2PWHA 4PFMA 2A21A 2A7PA 5D2VA 1L6YA 1C8VA 4MJZA 3WY1A 4MZYA 1CIUA 5LNSA 3TW7A 2PWEA 2E6FA 1CDGA 3IIZA 5LNRA 3HMJG 1D3CA 2CZDA 4N4PA 3C6CA 2G97A 3BG3A 1SUXA 2ZX9A 3UPBA 4AWSA 1PS3A 1TMQA 4OQVA 4O12A 5HJLA 1TCDA 1W1ZA 5TQLA 4BWLA 4HT3A 4NU7A 1XBXA 2ALWA 5HXMA 5I0DA 4AEFA 1TB3A 1XCWA 4IPIA 2ZTKA 5G1TA 5AC8A 4DELA 1FWSA 3G1DA 3WNKA 4FNTA 4R33A 4BI6A 2PWGA 3EDJA 3KRUA 3HPZA 5CGQA 3P84A 1XH1A 3C2EA 1R30A 4LY8A 2GJRA 1J0HA 3VE9A 4PL2A 4CGTA 1HWWA 3LHUA 2Y6ZA 2DIEA 4AMWA 2QDHA 1R75A 4E0CA 4GBUA 2H3BA 2I14A 5A2BA 3B4UA 3II1A 2ZX8A 1QW8A 3E0IA 5TIMA 4DF0A 5F4XA 4GI9A 4CN4A 4KWWA 2F7FA 4LPCA 1A5CA 2PRHA 2VFDA 5HPOA 3CIWA 3D51A 4OE7A 4JDBA 2EPHA 4WZHA 3L4VA 1VPXA 3NQ6A 3WY3A 4EOUA 1AW5A 1Z42A 5HMSA 3W2MA 1K7EA 1CI1A 3GDKA 4FNRA 2VEMA 1TTIA 3LX9A 1KFKA 4WF7A 2TPSA 4PCFA 4EWND 1VCFA 1IXPA 2XFWA 1KFJA 3DU0A 1F76A 1ME8A 4JCMA 3MBDA 3GDRA 3VMPA 1H1ZA 2X1RA 3MJYA 3GAYA 3DHDA 3T55A 3Q94A 3BAYA 4CNOA 2H3DA 4UFJA 2E09A 4IMEA 2X2HA 1BAGA 3EWZA 1MEIA 1VC4A 3EWWA 1A50A 1J5TA 2XIIA 4JR5A 1DEDA 1E43A 3UPWA 3CZEA 4J3UA 3QRHA 1UD5A 5D32A 3UWVA 4LOCA 1B2YA 2NLIA 2ZZ2A 5J5DA 3NQFA 4OBTA 3DI0A 3UG4A 2V2HA 1MVYA 2GVYA 1VIWA 1I2RA 3S5NA 2QDGA 4O13A 3LBMA 4UTWA 4ADSA 2QUUA 3ATZA 4TR9A 7TAAA 4MFEA 1Q6OA 4O4VA 2W0UA 3EKZA 4AB4A 3C8FA 3DXIA 3G1YA 3TJLA 2E4TA 3A21A 1UD4A 3L4ZA 1SO4A 1KCKA 2ZZ6A 4ZQPA 2OCZA 4LS0A 1LBFA 2E5BA 2OYMA 2YPIA 3USBA 2Z1KA 3WJZA 1Y7VA 4NI3A 1ZAJA 5AHFA 1ICPA 1W31A 3GDMA 3RLUA 1MXDA 3TSBA 3DDGA 1F6PA 1Z44A 1BG9A 1XDLA 3W1XA 3IIVA 4UTUA 4FLSA 3P81A 1JXJA 3A9IA 2EHHA 1DOSA 4J28A 4JIPA 3OA3A 3ZWTA 3NPXA 4DO4A 2BY2A 1GJWA 5LNVA 1EIXA 1KM1A 5DCDA 3IJ7A 5CPLA 3S5OA 4X9SA 3D4YA 2E5CA 3C2VA 4IWWA 1R2TA 5CGMA 3GDLA 4JL2A 1RPXA 1G94A 3G22A 2VFEA 1F05A 4FF7A 2XVLA 3G3MA 4IMCA 2EKCA 2ZYFA 1KM6A 2VFHA 4Z1AA 2XVGA 4H7VA 2B0MA 4O4WA 2DZUA 4LNYA 1GWJA 2E0PA 1MW1A 3E96A 2D0HA 2J9ZA 1HO1A 3BAXA 3L66A 3FFSA 1O60A 4O17A 5DXXA 4ICNA 3OLIA 4JN6A 1G4TA 1I2QA 3PY2A 4KWUA 3T4CA 3PG8A 3FJLA 3LPPA 1TQTA 3EDEA 4LWWA 3IVUA 2WSPA 2WVSA 4PEKA 3PUDA 1VRDA 2F1BA 2CLKA 3EDDA 1VGAA 1ZS2A 1H7XA 2WCGA 3P61A 4GUHA 2ZFAA 1XI3A 2RHGA 3Q58A 3GB6A 3O6YX 3QSTA 2V5BA 4ZL1A 1W5OA 3WMSA 1Q4NX 2ZXQA 3LGEA 5DCEA 3DX3A 3CZLA 3KLKA 2VXNA 1JR1A 3I68A 2F7OA 2I1OA 3LBCA 4UOQA 2QUTA 1K8YA 3GBEA 4JTIA
chains in the Genus database with same CATH superfamily
3QC0A 2R0ZL 3QUMH 1R87A 1I1XA 4I7VA 2OYKA 3KYKL 4E9YA 5A3IC 4LCUA 1R3JA 3T44A 4DLFA 4JTRA 5KUKA 4P3WA 3QCUH 3TF4A 2YJQA 1DE6A 5JW4N 2FL5B 1CXHA 2VQUA 1Q13A 1TV7A 5DEFB 5D7LA 3VXQB 4A7UA 1AL8A 4JW3A 2NQCA 1W56A 5EBMA 4MDPA 1F3JB 4J1OA 4JFVA 3V4VA 2J7HA 5IKCB 4DM2A 2EIBA 1INQA 1VFMA 1IVLA 2BZDA 2UXVA 4FTVD 1KC5H 3CFDA 5HDRA 1FCCA 2OBGA 4OD3L 3UAJA 4ZNEE 5LG6A 3BZEB 1R5YA 3ECQA 5L4IA 4WK9A 5C7VA 1DVFC 1L7TL 3RWJB 1QLEL 1GGTA 4TQEL 1NARA 1OFAA 1XW8A 3HBLA 3NCJL 1E6SM 2LLGA 3GDBA 4OF7A 1MRAA 2FIQA 3NURA 1WKDA 3KYAA 3KPLA 3NGBB 1AGBB 2BOCA 3T0BA 1E15A 4IG2A 5JU6A 5T1KA 2Y3AA 3AISA 2XU9A 2YN3A 3GF8A 5BVPH 4W5UA 5KVFH 3QG6A 1JGLL 3OF6A 4BFBD 1S38A 4GCXA 3JR2A 2CBVA 2WSQA 5FO7A 4GYKA 3BKCL 4PVMA 4M6PA 4KJYB 1TPUA 1OIOA 2X53A 1LNUB 3QGVA 2ADGA 3L3DA 1HZHL 4NRXA 4XWGL 3RWEA 3WKQA 4EAEA 5CFHA 4BSWA 4GVHA 2NT1A 4QDMA 1C5CL 1MW3A 3R6IA 4H25A 2WLKA 5E6IC 4C5YA 1FXPA 4P2QD 3C2AL 3UYOD 2JKPA 5E09A 5F7AA 3RIAK 5CU5A 2A3TA 2VABB 5KYWB 4XBGA 2HN7B 3N55A 4DJFD 1VJZA 3QR0A 3H6JA 4EN2A 2NZ9D 3BLBA 1RUAH 3EJCA 4NENA 3WUWA 2YAFA 4A2LA 2BVPB 1R86A 4IK6A 4HS6A 1UM6L 1R5WB 3NH7L 4UTBL 3CH9A 2XQYG 3KRZA 3W4RA 3DOHA 4G6AD 4QAWA 3QIBA 4KFMA 3TLRA 3EBHA 1HQ4B 1JUBA 4QXTA 3KPQB 1NINA 3KP0A 5I1GH 4XGZA 3VXSD 3S1GA 5ITFB 1JTTA 3UIZA 1I85A 1H7WA 4JGUA 4IPLA 4LV4A 2VT0A 2BLEA 5CPTA 3VD1A 1GGIL 3H85A 5DT7A 1ECQA 1VA9A 2C3ZA 2GJ6D 3R06A 3AYTA 5AW2B 5IW6B 1A4JA 3L4UA 4ETQB 1OSEA 1P0DA 3P4LA 1WG3A 5IOPA 3W39B 2CLFA 2TSAA 2A0LC 3SGDI 1O7AA 4I2XE 5CJMA 4HGKC 4IRZA 1ZV9A 4BM7A 5IMMA 2XFWA 1SOKA 2WNGA 4INFA 2C1PA 2Y25A 3PWJB 1S2CA 2H7WA 3DETD 3JUZA 4IIQB 1BVNP 1SLUA 3BUBA 2VC2L 4PJEB 4I5BB 2CDFB 4A7GA 5JW4R 2X40A 1ONXA 3E0FA 3RE0A 5K9JL 3FJ4A 5BZDA 1BQSA 1F8TH 1VF5C 3EOAA 5C0BD 5JHMA 3P6LA 1Z9LA 5GJSH 5A7EA 1BM7A 1IJ9A 2X4PB 3II2A 1S2UA 4K5OA 2QVNA 1RUPH 2GJJA 5LA2A 3QMRA 3NGBC 2YMOA 3OGSA 1S5HA 2QPFA 3W7CA 4ZX6A 5JMRA 3B8TA 1TPVA 3TSMA 4MS8C 2ZKYA 4MMZC 5E6ID 4LESA 4ACYA 1AQDB 3IAPA 3TBSA 1UOKA 5F3HB 5H94B 3V4VL 5C0CD 3TP4A 4F9PC 3GY1A 1EXUA 4OU1A 2ZQ0A 3ARGD 5I66A 2BBFA 3M0YA 4DLMA 5GS0D 2XQBH 2DQIL 3GX9A 4BKSC 1G9ML 1HQRB 5TE7L 1R3LB 5F9JB 1GCYA 1XBYA 5F96H 2WJFA 3F7JA 4DZHA 4KQ3L 4LSDA 3CZSA 5C70A 1BWLA 1EFZA 3DV4B 5CSZB 4CD8A 5BOOA 4NC1E 4XZLX 1FP8A 3P82A 2AJUH 4LMQE 5KYUB 3ZDYE 2W79A 4PJHF 1IBBA 2YAPA 1ITBB 4JRLA 5FHBL 2NY3C 4YBQC 1ZE3H 3PZ9A 2I56A 1W1PA 3HLKA 3FQXA 5AKVA 5CEZL 3UVAA 4K7PY 1JDCA 1NCAL 1A7RL 4CKVX 4AZ6A 3O3BB 5HI3D 4Z8FL 2V69A 2OXGA 4LSVL 4RISH 2X9WA 3FAXA 3RWGB 3QJZA 1A6ZB 2AF2A 2WN3A 1KCRL 1SFTA 3RVXD 3HV9A 5BOZG 3A24A 1HXMA 3CDCA 3UTQA 3EOBB 1EEPA 2L7QA 1OADA 3KTSA 4G56A 1QCWA 3KWUA 1J7VR 4G5ZL 2DT2A 2HNEA 2LFEA 3DGGA 3EOTH 4H8UA 3NO1A 2CO1A 1RA5A 4PA8A 1B9BA 3AXIA 2VDNH 2WHKA 3FCUB 2RA1A 4KY2A 1HAWA 3QXTA 4LU5H 3DVIA 2GK1A 4PJBB 2ZAHA 3QZWA 4QNEA 1N3NA 5DHYA 1U8MA 4K3JH 1ISWA 5DHMC 4MZRA 3PHQB 1ZSHA 2A73B 1RHCA 4GZJA 5GNZA 4ONGL 2XWBA 4QJ5B 4DI8A 5CEYB 2IPWA 3WFAA 4GJIA 2WQRA 4MCZB 4EF8A 1ZLWK 4FERA 5AVUB 4XCCL 1P5UA 1URZA 3DO7A 2WPBA 3LHWA 4MG4A 4ONGH 5KSAD 2MCPH 4ONOA 1A3RL 2G4EA 4TSBH 1F97A 2MWCA 4KY1L 3PIQA 4LLUB 2XZZA 1ZUAX 1JUFA 2GBAA 2P7TA 2IQ9H 1RVFH 4K36A 1ZHNB 2X2JA 3H2NA 1DVUA 3AZSA 1ZQ5A 2FWUA 4QRRB 2O26U 5A6TC 3CU1A 3RU6A 3GXIA 5EZOH 3VFWA 2HPTA 4LHQB 1FUNA 3N85H 4K9EL 2BNQD 5H37H 4Z7OE 1EX0A 4C1LA 4B4FA 4F9DA 4RFNC 1R3KA 1G84A 3VIHA 4UOW1 4R26L 1CNVA 1OWQA 2DQXA 1BAFL 5I2IA 4HPGA 3TWBA 4L0ZA 3FGCA 2DIJA 3NJXA 3M8OL 3E1ZA 5HVHC 4GI8A 4PM1A 3K13A 3LKOB 3QKEA 4YJ5A 4LLVB 1NCGA 1V7MH 1MRCH 3R10A 5JUEH 5ALCH 1YTDA 4GKSA 3MRNB 5BRZB 4XTDA 2PDXA 3S37H 1LP9E 3LD8C 2YBVA 4QE1A 2GTWB 5E9AA 2Y7QA 4FMVA 1I3GH 4Z7WB 2QXWA 3RPKA 3H7BA 3QIWB 1OFQA 3NQBA 3JV0A 1OGAA 4RXGA 1XEDA 2HUHA 1O6SA 5DI8B 3FRPA 5TE6H 3MMEB 4GQQA 1S6NA 5C3TA 1MMFA 1MIMH 1S7TB 3IMUA 5IB3A 2X8RA 2PMQA 3RF9A 4HCRA 5F3BA 1PCWA 3E3HA 5T1LB 1ZRQA 1AZ1A 1W3TA 3O3DA 3WBYA 4U7MA 2CZFA 3RVTD 3GT6A 3IUDA 3NG5A 1W5QA 3EYSH 2Z4QB 3AREB 4APXB 5JIQA 1HHIB 1UR4A 1KDJA 1HJVA 1KFLA 1TWZA 3UVIA 4YGAB 2OU4A 2NUTB 3QO0B 4HWEL 4A7GF 4ZMZA 3KXFE 3PQYA 1F4WH 1A64A 3JTSA 2HISA 3AU0A 4DKFH 4NHUA 1SQ7A 3L0KA 3VPLA 3CUHA 4UTWC 2J6WA 2WKOA 1L2UA 3X13A 5JORA 2IAAC 2IOIA 4IP4A 3FQUA 3DUSB 2Y22A 5E8OA 4QJ4B 3MRCA 1WV2A 4JZNB 4AVNA 2P5PA 1B1YA 3MZ2A 3PAZA 4AZBA 1TG8A 2K8QA 1IGYA 1IARB 3D3VA 1RZFL 1MCLA 4QRPE 5JPNB 1CB2A 4XB7A 5BRQA 1QAWA 3JV5A 3QF0A 4IBUA 2OZ4H 4GFSA 5CH9A 5CQ1A 1S7XB 4UTCA 3M0LA 3IDXH 4UOZA 1SOQA 3MRHB 1J1XL 1SM3L 3ARSA 4Q2ZB 3CZFA 4YDZA 2NOYA 3W56A 3L3OA 5IW1A 4CU6A 2X10A 1W1A1 3O16A 4LRIC 4PIBA 2B4CL 3GMQA 1JPKA 1TYGA 3P2VA 1UMLA 4XVTH 2IXQA 5E4EB 4OKVA 4O0KA 4LRIA 1UXSA 4WVXA 1XGTB 4WI3A 4QX4A 3UR5A 1SY6A 4ZMLA 2BX7A 2DQGL 4NYYA 3B1TA 2AFNA 4GIAA 2NTFA 3PPCA 3B34A 4PUMA 3GZAA 3V10A 3TURA 5IHUL 1UWAA 5E9XA 3IANA 3V0VA 4LOFA 3B7YA 4U10A 3F5WB 1E9PA 5EO0A 3BJTA 3FLUA 3A6BH 2X4OB 3RAOA 3EFFA 1KIRB 2WBJA 3DX4A 4JPVL 3AXLA 4TTDC 3WN5B 3HUJA 2CKBA 1IL1B 1ZJBA 1BTCA 1Q6CA 3EXLA 3ZE0E 3RR4A 3ASNB 4NHCL 2AQOA 3WIJA 3WL9A 1JRHI 2ZCHH 3NFSH 4G9FD 4C60A 1DDHB 1XX9C 2DD8H 3QPQC 4YR6B 5J11C 1JCLA 5GGRB 3L7RA 3SYCA 4PRAB 1YEEL 2XINA 2OZ0A 3GVQA 1SDDB 3Q7JA 5D1QC 4DQOL 2X2GA 1P1MA 4NM4L 2GFTA 2EO7A 1ZT7B 3DMMB 3DRTB 1Z9SB 4HEME 4PY7A 5DWUL 5C0ND 3RX5A 5G4NA 2X0HA 4QRBA 1DBJL 1GGBL 4U28A 1D8CA 4LO9A 1WUEA 1H7NA 2GI0A 2ESVB 2YXGA 2KH2B 4F0LA 1TQWA 4WNSA 3O11A 5KVFL 1C7TA 1J4EA 3AFBA 2YL6A 3TIEB 3RRXA 3APYA 3RTQB 5E0FA 1U30A 1U3HD 1WGVA 4Y9EA 2BDNH 4JDVA 3ZSSA 1DQLH 1MJ8H 2WQWA 3QZAA 3UXIA 1YEHL 1LEKB 4OU3A 3EYVB 4WWPA 1BXCA 2FZNA 3QXUA 1PDKA 3QS3A 1L7TH 2LT9A 2ZNWA 3WCZA 1TJMA 3I75A 4OCWL 4K3DH 1JCTA 2ZUTA 3JU2A 4MJIB 5JNYA 1I45A 1YC8A 5B1AB 1F1GA 3U9PH 3D46A 3NVTA 3DMMA 2ATPB 1O9VA 3DRTA 3OKNB 2NX9A 3EOUA 2JSFA 4ZDHB 2WXDM 3RK8A 3WLMA 4RDYA 2XQYA 3FHAA 1FHUA 5JBFA 1U2CA 1BX2A 4JO3L 5FKAA 5SWQB 4IOIB 3R25A 5HJDA 3Q6FB 5SX4H 3TEWA 4UFLA 1KT2B 1A53A 3UBHA 4UC5A 4QOKE 2DIKA 1E70M 2D2OA 2HJFA 1KUMA 2GJZB 3KNBB 4GZIA 2BC4B 2UXFA 2C71A 4D6GA 4MQSB 1HKIA 1OHQA 1TFHA 4KZEH 5IMLA 2P8BA 5DVLA 2VEKA 1ZK9A 2WSRA 1KTLA 2G0KA 3MRLB 3MMUA 4N7QA 4YHOL 4OECA 2YD7A 1ZV5A 3V9CA 3S83A 5E6UB 3CN2A 5A7BA 4QS6A 1NMCC 2PDYA 3ITGA 4MYXA 2PDMA 2GJ6B 1RKRA 1TT6A 1N67A 3SFKA 4FABL 2QCLA 3LDVA 3NL5A 3WMBA 2ATKA 4MMXA 1UXMA 3L5WB 4E41B 5HHXH 1UXWA 4F2FA 1QVOA 5JHDA 5CEZD 1SJVA 4HA1A 4J27A 5KSAA 1BREA 2YPKA 4MD4B 4AYMC 4DCQA 3S2LA 5KTLA 3T2NL 1GYAA 1OF8A 3ZTDC 1F6KA 2B16A 1JK9B 3KYNA 5IQ9B 2R2HB 2CGYA 4ERIA 1U8OB 2OQJA 5JR1L 2H6RA 3UZWA 3HBQA 3CAQA 3KL3A 3NGFA 3QHFH 3VD0A 3U5YA 4Q4SA 5EU5A 2YMXL 4F48A 2VR4A 2XHNA 3GHEL 4HG4J 4H44C 4XP4H 3QTGA 1NAML 3O3AA 2A38A 3EAKA 5EEZA 4DPQA 4EIUA 2NY6B 1KWKA 2HV5A 4LF3A 3NPVA 1KDIA 3BWUC 4GLRI 1LK2B 4YVXA 1RZ7L 2LOEA 3L7FA 4ZPVA 4ZAKA 1IKFH 3SPIA 1JCNA 3MRPB 1KBIA 1XUUA 2FK9A 5C09D 3TA4D 4MPQA 5FF4A 1YEJH 4I89A 5D8JH 4TUOB 1FL3A 2OMYA 4J2PA 5FA4B 2OW6A 2Z4QA 4XXWA 3FFDB 1D5XA 5GZOD 3R1GL 2QHRL 2VLLA 3FK3A 3NFSL 2DM2A 4GXFA 4TUJB 4UUJA 2Q6WB 1FC1A 5AECA 5EU6E 1DQQB 3F12B 1HJWA 1UKOA 4KK9D 3CB3A 4P46C 4Z2GA 3A6BL 4GRLB 1S9XB 3O6FA 1N7KA 1MYRA 3BVNB 1N8IA 1NGZA 4YLCA 4KKXA 1X7SA 1SQ2N 3GFUA 4ERGA 4PB9H 1Q6QA 2A3CA 3C2OA 2C1OB 3RLGA 3GZPA 3PUUA 3C09C 4AKPA 5EZIH 2OELA 4JFSA 1L9SA 3VFMA 1ZAIA 3OQEA 1YY8B 3TIDB 3T2OA 5ACZB 4KJWC 3OXRB 5HYSB 5G5IA 5F9OL 1BZ9B 4KK6D 1V0LA 3NEVA 1EUUA 2OCFD 5DHVH 2G96A 1NBZA 2QCFA 1K6QH 1XDMA 4J8RA 2OMWB 1DEEB 5D7LD 1DXEA 7FABL 4MMYB 5LIXX 1UR9A 5EUOA 2R69L 3E2RA 3IPFA 4UTLA 2J6XA 1J9YA 3V52L 3MO1B 4EDXB 5JW4M 3PZMA 1I1AC 1QUNB 2P45B 2WWMD 5EU3B 2DDQL 1JZ8A 5KZCB 1O5RA 3CO8A 4K1GA 1DTNA 3LMJH 3KPMB 2KT6A 5LLIC 4ZFOB 4LIQL 3VXMB 1MQRA 2ZWYA 3D3FA 5BV7H 3HB9A 1OD9A 4NI6A 3BP5B 5I0WA 3BOLA 4PGEA 3SR7A 1UUNA 2EIDA 3L5XL 3VG9B 2E7LC 4J8QA 5KVDE 2XXCB 3HZKB 4RGNC 2J7BA 3EO0B 4GXPA 4HIXL 3V0WH 4JQ3A 1DEEA 1MJ7L 5M5DA 4FQ1H 4WV1A 2I07B 1TSIA 2Q9OA 1ET5A 4GO8A 4GCAA 5MHBA 4GO6B 4P99A 1DKWA 1OAQH 3L3KA 1MJJA 5T91A 1YJDL 1GHFL 3X3FL 4XBEH 2XSXA 5TQ0L 1KNOA 2F58L 3B9EA 3DEQA 3A6CL 3H55A 3MOBL 2P8MB 4R7DB 2J8TA 2P3YA 4X61A 1I1FB 1SLXA 4PJBF 3ROOB 2RFXB 1ZT4A 4Q9BA 4X80H 3VGAB 2DZVA 3FO0L 2XQYK 1KULA 3PP3K 1EXGA 3PJNA 4X60A 3QHMA 2R1YA 1RK6A 4I8DA 4CNTA 4ODSL 5BMFH 1I8KA 1S7RA 1UZ6E 4P59L 3SGJC 5KANG 5HGBA 4DP6X 1D6EA 2WXRA 4B2DA 3ES6A 3KJ6H 2XV0A 4B7LA 1MUCA 1OC6A 2IPKB 4KO6A 3K5RA 4N8PA 1H3PH 5JDJA 1KBKA 3RX8A 1Q9OA 1RZ8B 2BNRB 3R0UA 4ZR8A 1WXZA 3ROLA 4TX6A 2XN9E 3GSXA 4JFZH 3VNMA 2ZJSH 3MFFA 4N2YA 1T03L 3JYBA 1HH6A 3B9KB 1FHGA 4HD5A 3SE4C 1YG9A 3QFWA 3JS3A 5DS8A 5EOTB 4BINA 2YXXA 4AEEA 3ESMA 2P5WB 4Y1TA 1A80A 1CBJA 1MCPL 4FP1A 1NMAL 1LQAA 5D38A 1T5XB 4BZ1A 3EAUA 5A5WA 3QV7A 2ZCLL 5DK0A 4APQA 5D71H 1RP8A 3NIDE 3TBVB 1NGPL 3FONB 4YZFF 5ANMB 1M3JA 1ZXKA 3Q44A 5LIYX 1CENA 1MFEH 1UD8A 1QQDA 1VAHA 2HRLA 5DVMA 3RUGF 5BUAA 1MHEB 1RY7B 3O0RL 1AGEB 4Y1AE 2ZTBA 1W15A 4Z7NF 4NXSA 3GWJA 1LO2H 1P5VB 1YZZA 3DX7A 1AR1B 2NVAA 2B5IB 5LXXA 1IB5A 3JZYA 4ADJA 2OB3A 5KVGH 4G7SB 3VNJA 4XAPA 4UTJA 1M7IB 3HC4L 2XYLA 2IH3A 3UAJC 4OUEA 4NBZB 1TWIA 2APTA 2DQTL 1ONQB 3O0KA 3HB3B 3PGFH 3TAOA 4NAFA 4WXZA 4BZ2L 3VFRB 5CZTA 4M1BA 4X7TB 2Y23A 5FF6A 4F0KA 4X4ZA 3CWOX 3LRMA 2VAAA 3MI6A 4XCEA 5DJ8A 3DFYA 3PZOA 3BLOA 3FCSA 3SDYH 1M2VA 4DPRA 5FEXA 4DXKA 4F79A 3FW6A 4LU5L 5CBEA 2GJLA 5GZNC 2WJZA 4ENLA 2HWZH 5ETUA 5E2UL 4BFIB 4WFHD 3WSUA 2IWKA 4GBXB 4J4PC 4PJEA 5IG7A 1BZEA 1ZFJA 5HWJA 4HX1B 2IBZY 1EPFA 2C3VA 3JXAA 5T3XL 5C8JB 1KLUB 3MRDB 3ESOA 8CGTA 1IWBA 3PWPE 3B0YA 3B04A 1CR9H 4YYFA 3G0SA 2B77A 1NIAA 1V7NH 3WFHA 1NGQH 1XIIA 4MF4A 2W5PA 1WDWA 1KM2A 2CO7B 1XMEB 3CMGA 4PRBA 5ID0A 2X6AA 4IQDA 4IJCA 5C0FB 3HIJA 1GVIA 4QYOB 1TZ7A 4YHIB 1WVZA 4UU9A 3WLHA 2P5WD 5C2UB 4M1CD 3REVA 3TTYA 3KWTA 5D7JB 2FFIA 4X9IA 5JIMA 1GGCL 1GHRA 1P6BA 3OGCA 2I24N 1SYSB 2KS0A 2X6UA 3AY4A 2J44A 1FIEA 1CPUA 3F4NA 1Z3GH 2EICA 3BGMA 4OOUA 2JF1A 3EJYC 1WXYA 2RACA 4K3EL 5CJBA 1X6LA 3OVPA 5B38A 3WUWB 1MNUL 3EYOB 4KVCL 3VRIA 1B0WA 2X2IA 2ITDA 3N1QC 3GIVB 3QIUD 1F42A 5INDB 3C75A 3AAZA 3HG1B 1I85C 4CMMB 4CVXB 2LGNA 1C9DA 3GD1C 4X7DC 5DJ6A 1C8PA 3O3EB 1FCUA 3MJ7B 4K94C 5IHSA 4OJFL 3F4WA 1FWFC 2FJKA 4BS0A 1CO1A 2E56A 2QZQA 3B2PA 3FU0A 1Z9SA 3TNBA 3EJPA 2F8VA 3WQFA 2D2CC 4BQ9A 5E08L 4HIXH 4M6OH 3V0WL 4IFRA 1QUMA 4GGHA 4BSWB 2RUSA 4HJJH 4WUIA 3LM3A 4IMDA 1RZJC 5HHNB 3W0WD 3GUFA 2IDFA 3WF4A 3WUWG 1YMME 2XN9D 4K8RD 2PO6A 4BH8B 2R4SL 2OO6A 3EDKA 2XBDA 2JFCA 3QXWA 1Z3RA 2VL5B 3WD5L 5C0EB 3WN5A 1ROWA 2FO4B 1IEVA 2D23A 4W70A 1UOZA 4J4PA 2NY0C 3NM1A 2OK0L 4M6UA 2CW6A 3AZTA 5TE4L 3V0VB 2VCAA 4W9TA 4FEZA 3FFCD 4RE0A 1ZHBB 2X7LB 4J3SA 4X6CF 4JAWA 3PL6C 4DZ5A 5IM7A 1TQCC 2C3HA 2X4RA 4GYBA 4JQIH 1F2JA 2G60H 4S3FA 4CDGC 4PRBB 5JPMC 3VDAA 2AANA 5AVNA 1UT2A 1KGYE 4O02A 5EDSA 5FLVA 1ECYA 5LXGH 5DJ2A 4LBEB 4XMLH 3U0PB 1GKQA 3QHNA 4RUBA 2CBPA 4U6TA 5E6RB 4CCCA 1KB5L 1L9OA 3UTSA 1EX1A 2NR6D 3QR3A 4PB4A 3VNIA 4HEMA 3P3UA 2B15A 2ABBA 1ZOXA 5CJQL 1KEGH 4KEMA 3HPXA 2Y5EA 1KENH 3MNWB 5JW5A 2PC8A 4CCEA 1U3ZA 4DWSB 4MRBA 4NBXB 5I8KL 3GBDA 5CGBA 2HVNA 1YSOA 3D18B 4E4FA 4UTKA 2RGSA 3NACL 5H1WA 1DJHA 1C3FA 3FNDA 1YEJL 2F68X 4GUOA 3NSNA 1TPEA 4AH7A 4OFYD 4U7KA 5JORB 3A4FA 3FRUA 1N5AB 2DN7A 4R4ND 3SBFA 1VFLA 1OINA 3OVGA 5LNEA 2BP8B 2DV0A 1A3QA 1D5RA 2C9RA 2HXTA 1HZHH 1WBXA 2NLJA 4M7JL 1QU4A 4Q4KA 4NUMA 3LSOB 1EXPA 2R0KH 4K38A 1RJZA 2ZWKA 4RBPK 1LRQA 3TIMA 4NZ8A 4Z08A 3FF7A 4RMRA 1I4FB 1N2RA 1A4BA 3O3DB 1U8NA 4L37A 1JPGB 4M7TA 2Q86B 3BVUA 5F3BB 1OTTD 3FONA 1OGBA 2BASA 3PPHA 3WUBA 2XRAL 5B1CA 3MHFA 3VX0A 1DBTA 1E9ZB 1F6FB 5AFDA 3HKFA 1UJQA 2PBGA 4JFUA 4YUEL 1D5IL 2EO9A 1K8DA 4R2GB 1Y0EA 2ZA1A 5A8GA 5T9BG 5HHXL 5KS9B 2JKAA 4FIQA 4RZKA 2W6RA 3NNTA 4Q8WA 2ZP9A 1UJ3C 1MCWW 2AMUA 3CZUB 4DN4H 3U57A 3ZS4A 4QKXB 4YDJB 1WUZA 3UG5A 3E8VA 1T1XB 2IBZX 2ZXGA 4Z95L 4FB7A 3QQNA 5JPMA 3FVMA 4M0XA 5CC7A 2XA3A 3WKML 2OLHA 4HK3J 4OY9A 5FUOH 3DURA 1L0XA 1TYJA 5BV7B 3CPRA 1EL3A 1JGEA 1D3GA 3V7MA 4MDOA 1OZTG 3MBEA 5HAOA 4GAYB 4P9HL 2BJMH 2O0TA 1FWCC 1QVBA 3JZ7A 3BK0A 1GEHA 1WAAE 2JB6A 4JZOB 4P4KC 4QRRA 3B8DA 4ZSOA 1FBIL 3DTUB 5LBSH 4Q7NA 4HCDA 5J1AB 1DFXA 2K6WA 2P7TB 3U25A 1HOCB 2XG4B 4JG0H 3DHJA 4F80A 2FSEA 5C09A 4N0UA 2E7FA 2SEBA 3BT2L 4EPDC 1WA2X 2FJSA 5DHVA 3U9PL 1T0NA 5ALBH 4I3RH 3F03K 1XGZA 1H3WM 3MRBA 5HDOA 2QLYA 4RV8A 1LYXA 1BZ8A 2XWBB 3FN9A 4KROB 3HNTH 5AW6B 4TVSa 3UROR 5I1JH 3B6SB 4A67A 5I18L 4G7VL 1TUPA 2FDBP 4JPIB 4KKCC 5ALBL 1YEHH 3GSUB 2CIPA 1IBGH 1N3NB 2PD5A 5REQA 5JXEC 2DYPD 5EU7E 4OLEA 4E2OA 2YARA 4F58H 4JTSA 5D1XB 1HNYA 3GMPB 5FLUA 5D6CA 1GS7A 5B7FA 3SN1A 5A6KA 1B3JA 3MN8A 4QO1B 3MV9E 1FBIH 5LBSL 5T8IA 3CZKA 2Z2BA 2BVTA 1Z7AA 4PRDA 4Q97A 2JJWA 5BRZD 4H20H 3N9SA 1E56A 4OLZH 4XMPL 3A4XA 1GOQA 4CNUA 4IHOB 3AXKA 1YCSA 1UZ4A 2EDFA 4FQJL 2XWDA 2NYKA 3BG9A 5AHIA 2AQNA 1JVNA 1UCBH 3APFA 3VQ1C 2QKFA 3K3QA 3TMQA 1GZ1A 1L6ZA 4Z95H 1JCKA 3FIGA 3KHDA 1AXIB 2ROXA 3UERA 2DOCA 4V1DD 1V03A 4Y2DD 1UCWA 1KLGB 4Q58C 4A2FA 2V6HA 3VFLA 3NZQA 4QOKB 4X98B 4FA8A 1G0CA 1PZSA 2HJLA 1JDFA 4HUKB 4PRIA 2X44D 4Q8PA 1G43A 1IAKA 3DC0A 1CD8A 1M71B 3NJHA 1Y07A 1YYCA 1ZHAA 4AHPA 2OR9H 3N34A 2UUDH 3QULB 3WLSA 2EDYA 4LP4A 1RBOB 3NZ8A 3G8RA 3V0EA 3AMKA 3QEQA 5I66B 4Q22A 1Q2RA 4LKXB 5ITBH 1TSRA 5DFAA 2OMZA 1GTFA 4C83B 1AQDA 1N0LB 3CU2A 5CSUA 4E41E 5K59E 1OD7A 4LBRA 4RIRB 3R7QA 3A0OA 1JDEA 4XAKE 4G3YH 2HVMA 1G4SA 4J35A 1CDCA 4DAGH 3NCCB 4IL2A 1K6AA 3TS8A 2FVKA 3OYZA 5GHWL 1A9EA 5JQ6H 3DG7A 2YUVA 4GG6A 4X6CA 1AE6L 4Y5YC 5T33H 3U79A 4X8CA 1E9YB 4EIGB 3NACH 4WFFE 1KV5A 5IK3A 3X11A 5I1DA 4OLYH 3FSTA 4PMDA 4QYOA 1TQBB 3RX4A 5D96C 4FXJA 1J12A 1MKFA 5DFTA 4NRYB 1NWPA 3CFBB 2D69A 3Q0HA 2CNYA 3CCHA 1FTXA 3BGGA 2X4UB 5B4MD 1B3WA 2ESCA 4P8QA 1DJIA 5I74C 2GJ6A 1S2WA 1W6TA 4OLXH 1AKJB 1DSFL 3VWKB 4O2CA 1FL6B 2WBKA 4MJ6A 3C6SA 3CFIC 3GVRA 4L9YA 4NZRH 4KRPD 1OK8A 1EGJA 1HL9A 2OTWB 4R7NA 5ESVA 4M7KH 4NYLA 1SW3A 5HULA 3BKML 4WNJA 4QE5A 1KYOJ 3U7WH 4JX0A 3C6LA 1E0VA 2CO2A 4G43A 4QF1B 4WTXA 4EEEA 3FA3A 4I0PB 4HSCX 3E49A 4EIVA 4ANUA 4TVPE 3VW3L 2WB5A 2O30A 1QBML 2X4SA 1SVBA 4KUCD 1XCTB 1JL8A 4HS6B 1ADOA 2FWSA 3BD3A 4R97C 4XP9H 1KTNA 3GQYA 5J57B 5DD6B 4KI1A 2GHZA 1XLKA 4TUFA 1OCWL 3UTTB 1KJMB 1P1ZA 2FLMA 2VABA 5IR1A 5KYWA 2PF8A 3D2UA 2OMVB 2DJMA 5KAQG 3U6WA 4FLHA 1YNTF 2XGBA 3U1QA 4KW2A 4LEXH 4QRSA 4TMCA 4XNQA 1A5MC 3BMXA 2X0VA 2WHVA 1JCMP 1HX0A 1MEXH 2BNUA 2OJZH 1T1YA 3KLAA 3WTYA 3S35L 1VCVA 1N19A 3NK4A 1Z9NA 5E2VL 1KQYA 4KI5F 3PBWA 4JFQB 2AAVA 4NYUA 5HYJE 1H0IA 3WLRA 4F0SA 1QX1A 1KY7A 3CZGA 3U0TA 4GNVA 5I3FA 4Y5XA 5JLZA 4CGUB 4JO5A 3N25A 1Q45A 3MYJB 4LVDA 3NIGE 1XIBA 3QBTB 2VLKB 1D6VH 1FLTX 4K3EH 3RGHA 4DFHA 4TULH 1ORQB 2XG9A 1UR1A 3LSCA 4UU9B 1Z0NA 3ZDXB 1E6XM 2YKLL 4XC1H 2E3VA 5C9XA 2BMKA 1P9MA 2XXGA 1LM8V 1Y1UA 4HQQL 5D1QB 1RK5A 1U0QA 5E1AB 5EY5A 3WQ6A 4A2SA 1YX1A 7CGTA 4WEMB 2NSQA 1CYXA 3ES6B 3VINA 4U6YB 3CAVA 1PE1A 3FU8A 3IU3B 3M6DA 3Q37A 1HH9A 1I8KB 1S7RB 4RZBA 1OK6A 2FL5A 3B3IB 1X5KA 4HJFA 3TA6A 3DIFA 3QAZB 5L2KE 4XZWA 4KPHL 2BXYA 3AXLB 2Z24A 3LM7A 3P0WA 1A4AA 2Y1AA 4L3AA 3TBTB 2A2IA 3NTCH 2WINB 3C09B 3FUFA 3MANA 4PS4L 4WD0A 5IZ7A 5GRVL 3EX3A 2XLLA 5HI4D 4Z17A 4GIOA 3ZR5A 1FVCA 2WTRB 3A5VA 1KV8A 4LGPB 3TR9A 3GHTA 1IGCL 2ZONA 4U6YA 4MWAB 2EG6A 3W9ZA 3W27A 1AZZC 1N59B 3EH3B 4PP2B 4AEIH 2GIYA 4F57L 1JXFA 1F73A 4LSVH 3RUBL 1IQWL 3KCPB 4MXWH 4NT6A 5KBPA 2KZ1B 1EGVA 1V02E 3L0NA 3FQRB 3MLYH 3JWNH 4LSPH 3K4WA 2VXQL 2VURA 4LVNC 1RXLA 1DIKA 2VCCA 3MLPA 4O0QA 4KXZI 4B0MM 4BIKA 1UWYA 1XF3B 2YK1H 2YLLA 2KLSA 4WSJA 1R3YA 2R1PA 1JD7A 2DLIA 4BZ2H 4RKAA 2DKUA 4D1IA 3EA1A 4OJDH 4OCXL 4WI2A 4UR7A 2N7AA 1WAAA 1M7UA 1V5JA 2MOQA 1TVBA 2XWCA 4PS3A 4XC1L 4DOHB 1I9EA 3ILPA 2P0OA 2YSWA 4GNJA 1I75A 3HN3A 4P23B 3KS0H 3MPGA 3HR6A 1T41A 2DBJA 3EYQD 4KQ3H 1XFPA 4XPFL 4R96B 2WZMA 5HDQL 2R0WL 2PKDA 1PZ1A 2LVCA 3EOLA 4JX4A 1O6TA 4JTIA 5CD3B 3N2BA 1HHKB 2ZUVA 4F8NA 3W88A 2VM8A 2AQWA 4WGXA 4LCCB 4H5SB 1HXKA 3GLZA 5HR7A 4MA8H 3DNKA 1ADQL 1CGSH 4IS6A 1HH6B 4KF1A 3D33A 4AIBA 3ABMB 4M43L 4DKAA 3GS0A 4AGNA 4ZCWA 2O93L 4WKFA 4JY5H 2CG9X 4GUGA 5A6MA 5LDUA 4JS3A 1RUPL 1PW3A 4CVZA 2B08A 1CECA 2VC9A 3Q6GL 3G6JE 1JNEA 1XIMA 4UF7C 2ADJA 3HI5L 4B9IA 3CQQA 1HKLH 4P5SA 4M6MH 3CTLA 1RCYA 4ZQKB 2XFXA 3BP6B 3N3MA 2BSCA 2IPTH 3QW9A 3W11C 4OIFA 3B2UD 4BH7B 4L1BA 3QSRA 1ZEAL 4O1FA 43C9A 3GSRA 1KF9B 2GBTA 5I3GA 4M00A 4QXIA 1N6UA 4XN2A 3LQLA 5JIWA 3LXBA 4NQED 3DBXB 4DHLA 3LSBA 4HA4A 1TZAA 4ES9A 2X9XA 1QBMH 3B5GA 5BMFL 2VR6A 3EX6A 3PWPA 3ARDD 4NQCD 3VI4A 4UTTC 5EUOF 1VRSA 4JFXA 2C16A 4DO6A 2F1AA 1R24A 4E9SA 4J3TA 3NK3A 1NGWB 5HPMB 2J47A 4QQ3A 3EO0A 4JM4H 3D3VE 5TQ0H 3RBSA 3URNA 2E86A 1HGYA 3DMMC 4NRYA 2EUXA 3M6YA 2DTMH 2D3JA 1GVYA 1DSFH 2G2RB 1CDJA 1NGXA 2K3HA 2PPEA 4XN7A 4TQ8A 5JYMA 2TRYA 5G4OA 5IK3B 3UY7A 1AYOA 5FO9B 5I8CA 4G1EA 4WX2A 4ZSOE 4AUUA 2NTSP 1OP5H 4AG4H 3FTZA 1TWSA 1QNIA 1LROA 2CLLA 3GTIA 4N1EA 3PWLA 4HSQA 5CEZE 2VGIA 3ZKMD 1YEKH 1GSMA 3P3YA 3PFQA 4QTIH 1N59A 5EOCJ 5J89A 4X99A 4LRNL 2OL3B 1DV7A 1VBHA 1KV7A 4RX0A 2OMWA 4TNGA 1IGMH 3KLSA 2XWRA 3F58L 4NQSA 1GOIA 1WA3A 3P5YA 3TBYA 4HNCA 1SYTA 4RCAA 3BW9A 4K23H 4AD5A 4N9EA 3CN3A 1E65A 1OQOA 1HP5A 4WI0A 1HSBA 1TIWA 4IFOA 3TO4A 4OCNC 5CZRA 2PW2B 1CN4A 1E6OL 3HVDA 4QISA 3W02A 2N4IA 5I73C 2FSDA 1J5DA 4LSQL 1B3XA 4YVNA 4OVXA 5FECB 4AISA 3QW3A 3EBIA 4V2CB 2DZBA 3VGGA 4IMAA 3VFOB 2GUOB 2PTZA 4L29B 3H3PL 3M1CA 3Q6FA 1U91B 3THMH 1GG1A 3PNUA 3SBRA 1S2TA 4YIWA 3WNNA 5I1AA 3IXTA 5EZIL 1BF5A 1PKNA 4HALA 1PFOA 4Z2JA 3SN6N 2VYRE 4K94H 2GAZA 1UZDA 2D20A 5LBVA 4PJXA 4V1XA 4KOBA 3LKNB 3E2VA 1LEIA 5E2TL 3UTQB 2FX9L 5HHQA 4Y4HB 5D4YA 5E9DB 3O0LA 2VQ4A 1YMHB 3QZNA 1M3UA 4M03A 3QR1A 4NN5B 1NFIA 4O2EB 2G9HA 1N9PA 4Y5XB 5JLZB 3O2VH 4DJDD 3T6WA 3FQXB 2NY6D 3I6GA 5D8JL 4XNZC 1RSCA 3HN5A 2OYPA 5F71A 1S5WA 1DANT 1UCBL 3VSTA 1JPEA 4XAWL 4S3KA 3V75A 3QZBA 4MJMA 4A68A 1R3HB 2PW1B 5A8QA 4OZHF 1KJ2A 1WTLA 2R0ZH 3P77B 4O28A 5KANI 1OE1A 4ALAH 4HAKA 3PWGA 1CFMA 4JTHA 1YQ2A 4H20L 3TFCA 3IVKB 1YNLH 5FO8A 1MAJA 1IE5A 1GZPB 1RQ5A 3DHUA 1LL7A 1O5QA 2FB3A 4IOTA 4XNAA 1SDDA 1CLXA 1G6RB 1FGVL 4M5PA 4PGCB 2V2XA 3LNHA 2OX4A 3A4EA 3TNNA 2M8XA 3BD4A 5GGRA 1VYSX 4WUUE 3B43A 3EYPA 3RNKB 3R94A 2NW2A 1H8NA 1WH0A 1PLGH 5AAMA 3F4CA 4GQBA 4G7VH 4B6ZA 3QT2A 1AHWC 1ZCOA 2OKTA 2VFGA 2PODA 3L95B 2Y7GA 1K4DB 1KOAA 2EIZA 3E6HB 1A0EA 1EP2A 3EFFB 2POZA 3RU8L 4EQ2A 4BWUA 5EO0B 3AY4C 2OQHA 4OZ4A 4NFBA 4NJGA 3OTTA 5IRPA 3ERPA 2YUXA 1KEMH 4LB3A 1ZGLA 3UGUA 4AE1A 1EEXA 2IPGA 4YHOH 1WS7A 4Y9BA 5B39A 5KVDL 3DDMA 2E7BA 3PY9A 1SNRA 2X1UA 4CW1B 1R9YA 3JT0A 4J4PD 3BWAB 3KWVA 2MIZA 5IVNA 4Q9CA 5IT2H 3SN0A 3T0EB 5JPMB 5EN2B 5J7CC 1C92A 1DVJA 3WUEA 5FW8A 2VITA 4G7EA 3AVEA 3CK0H 3NSCA 4M8VA 3KPSE 4YDJA 4NG3A 1J0ZA 5CGTA 2NDFA 4E8GA 4U6HB 3SPGA 3X1EA 5KYYB 2X38A 2QQQA 2CUHA 1F58L 3PCYA 4HJ1A 3RRQA 1AR2A 5G55A 5BNKA 2ZADA 4WLCA 4FP8L 3M0ZA 3P4MA 4IXHA 2YO3A 5ITFA 4HN8A 1KPUA 2PP9A 4KX7A 2J62A 1SGKA 5ES4B 1PDKB 3VE7A 5C54A 3K0WA 3S98A 4DH2A 5AG9A 3EKGA 3HG2A 3LQMA 4JDVB 3L9YA 4M8QA 4XHQA 4C56B 5AB0A 3CEUA 4HCIA 3ARGC 2IAMD 1TIMA 5GGVY 2FX9H 3BESR 3MRCB 3QZPA 4WGKA 1YE4A 1I3UA 1LG2A 1JHLL 3BN9D 2P8LB 3FA4A 2BDNL 5EBAA 5A16A 4NLHA 3RGVC 3IDNA 5I76B 3RLSA 2FGLA 1GQJA 3UADA 4O19A 3UZEC 4HUUA 3SDXB 3P69A 1E5BA 4GX9A 1DVYA 4W9LC 5CFAA 2E8YA 4HEPG 2Z35A 4MNHB 2NY3D 2Y36H 4QXUL 3VXSB 1BF8A 1MQPA 1UYQA 4FRWA 2PPAA 1I7UA 3LTVA 3W0WA 1S5MA 3EB2A 3MO4A 4RSYA 3PULA 3WFLA 3P93A 2DH3A 4XVEA 4P7LA 1IAIH 2YZ1A 3EFDH 4PVLA 4BZ1L 1A5BA 1GCFA 5KETA 1WCQA 1TJHL 1EZLA 3ZLGA 3ZL1A 4EIBA 4K68A 3D69B 3IFNH 2NY2D 1C08B 3KW8A 3TONA 1W37A 2P24B 2X0WA 4LK4A 4AK2A 2E9WA 1ESWA 3L16A 1OCNA 2NUWA 3VK5A 1X8CA 3IJYA 2BZCA 4XMWA 5H4ZA 4NQDB 15C8H 2ITEA 3G18A 1J9CT 1JMXA 1HKWA 3MRNA 4E9TA 3R2GA 1U41A 2VXTH 2ZVIA 1AJ2A 2V8ZA 1FORH 2QTVA 4OZHE 3VM5A 3VXRA 3GR7A 3T2LA 1IIHA 4IGSA 1EIBA 4F7PB 25C8H 3GSVA 3S4SB 4Z77A 2K9FB 3DPBB 4FEMA 4MNQE 1ISZA 4CCZA 4F7MA 1S7VB 2CO4A 1E9LA 3WFEL 4ZUVB 3HC0A 5LGZA 2B7OA 4GABA 2VZTA 3N2MA 4N4QA 3JBG7 5IW1B 3VNKA 3F83A 5G5DB 1Q3NA 2JKEA 4XAGA 3CAFA 3TZFA 4JPIA 1YLBB 3UZVB 5IOBA 5EZLB 4OGAC 4XD5A 4UIKL 4JGMA 3PP3H 4L3CB 4E41D 5KVMC 4R4FL 5FAJA 3RL2B 3U0TB 4WFFD 3UPRB 1NQBA 3IKCB 3W5MA 3AYVA 5HQMA 1RJCA 3CPLA 3Q05A 1RV6X 3OZ9L 2IFGA 1MAML 3LJ3A 3WEAA 1TMLA 1WKYA 1T4KB 3NESA 2JKSA 5L4MA 5EIVA 4U3SB 2HMIC 1RJYB 5KVEH 1C8YA 3CQIA 4W85A 1VCGA 5FEZA 3O2DH 4Z3JA 3FQUB 3UZYA 4AZHA 3FO2B 2IPTL 5F2MA 1CLOH 4QHPA 3N14A 2XWJA 2V33A 4HXBH 4ICMA 4NNXB 4XAKD 2VDQB 4QHRA 3TN4A 3S5ZA 5HYQB 3H6AA 1MXSA 5FYLD 3I3EA 3W7EA 4J1UA 3E8UL 1XQ4A 3NJKA 1ZPLA 1VGEH 4MSSA 3WMCA 3KYMA 3L45A 4P0DA 1ICTA 3NVDA 3S7GA 5E1QA 3G5VA 2IKIA 4M43H 5FJPA 1UKQA 1CGSL 4LKCB 1TPXB 2HYMA 4FEIA 5DD6A 5F7DA 1EEZA 3QQ3A 4BI7A 2ON3A 2PXYD 1SJEA 4MDRA 3WJSA 1GW9A 3EX2A 4P23D 5HNRA 1MCBA 1TTAA 3HPLB 2F7RA 4LGRB 2DZXA 1KELL 4JXCA 5F93C 1IX2A 2HA1A 3Q1SH 1BZOA 5DO2C 4Y9PA 1YN7B 4PMVA 4NC2B 4P5KA 4U1SB 3ZDZE 3GXPA 2QCCA 4DF9A 4IIDA 2B1HH 1CFSA 2MQ0A 3I9GL 2OTWA 2BODX 2CZNA 3KCOA 1AD1A 4JTCA 1SHSA 3T08A 3G7TA 4ZQMA 3JWOL 2K9UA 3MRKB 4O10A 3FH7A 1PUDA 3AHVA 2YK1L 5G1MA 3P73A 2ZCKL 1I3GL 4XCFH 3MI3A 3W7MA 3MV8D 3JZEA 1W8EA 3B2XA 3GIZH 4HZLB 5GZND 5LQBH 3WEBA 1N8ZA 4Z1PA 3WLPA 3SW6A 4F7KA 5HVWA 2A9BA 2H47C 3KWWB 2NQDA 4ZSTA 4Y16B 2W60A 4MJJA 3TH2T 3UYRH 3VI3A 1T7XA 5I1DB 1ALDA 1LM1A 3BP4A 4Q7IA 2ZRZA 4F24A 3LCGA 4UDTA 4MNGA 2QV5A 2VVNA 3EJQA 4X6CB 4OZ4B 4BFIA 3G04A 3CXFA 4D9RD 3DJSA 3KEHA 4QRRD 5AW4B 3I9AA 3J07A 4A7TA 3VXPB 3TJXA 3FYPA 2GK0B 3P4NB 4KTEH 1E42A 1EJSC 3V0DA 1S8DB 1P4BH 2JKNA 3P2TA 2E67A 1NCOA 1HDMB 2NCMA 2YW4A 3S1WA 2LW3A 2ZA3A 1Z3NA 2XKUA 4KFZC 3QCVH 1QI5A 3PJTA 4FHAA 5C08A 1ISVA 1RALA 3ISRA 2I69A 4YXLH 3SDYL 4OHQA 1F4AA 4FFZA 5CIPA 2TYSA 3QC3A 4AITA 4QI3A 5EEYA 5E4OA 1WFUA 1ASPA 4KQ0A 1WDSA 3D08A 2PAJA 4Y9OA 3AYSA 4POCA 1OCRB 4NZ1A 3HMXH 3TZVA 1KV3A 3CGTA 3UGVA 3WSQH 4L6DA 5TJWK 1T5WA 3VXRD 1O7VA 4S1RL 3EOOA 2O5YH 1SO5A 3ZO0A 3EIFA 4P57B 4QOKA 2XVBA 4U33A 4LCWD 1CT8B 4PH8A 2PDKA 3WG7B 3GW0A 4ACTA 2WNWA 1FWTA 2HUEA 2X5PA 3EOBA 4DJMA 5IVXF 1CL7I 1JTOA 2Y0SA 4OCSH 1RA0A 2EDKA 1QTYT 1NEUA 1UWUA 1CFNA 2Y2WA 3E80A 3RWGA 3LS5L 3SGZA 4D0DB 1NGPH 4AHOA 3T4YA 3CSYB 1P0BA 3GPEA 3KPQA 3ANVA 5CC6A 5K69A 2G3MA 3II3A 1NP0A 3S35H 3QPQD 1IT8A 4Z5RB 3ZR4A 2VAJA 1LL6A 1MCPH 2ZKWA 4LBAA 1VGEL 5IHWA 4XBKA 3H9YA 1YDNA 3LMZA 2G3FA 4YIQB 2X41A 2V5YA </