4DO5A

Pharmacological chaperones for human alpha-n-acetylgalactosaminidase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pharmacological chaperones for human alpha-N-acetylgalactosaminidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Alpha-N-acetylgalactosaminidase
total genus 131
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4do5A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4do5A01
3VGHA 1HO4A 3LB0A 3PWAA 1XM3A 1XH2A 1VCGA 1PE1A 4GBUA 3EWWA 4NJKA 5CGQA 3TONA 1A53A 1R33A 1KM1A 3W7CA 2BY0A 3GK0A 4J28A 3RNDA 1Z42A 4GI9A 4O54A 3NYZA 3TW6A 1WV2A 4UMAA 3BUQA 3ECQA 4J27A 3LCWA 3BVTA 2EJ1A 2WC7A 4G1KA 3W72A 3CB8A 3MI2A 3VFLA 4WSKA 5HWJA 2CWNA 3CWOX 3KLKA 4PSRA 2DZVA 3NNTA 4ZQOA 1PS3A 1XSIA 4LXFA 3CQ0A 3T44A 4MY8A 3TSBA 4LOCA 3DENA 4M7TA 4ADTA 1WO2A 2XVKA 4JTLA 4XWUA 1ZFJA 3TSDA 2GVJA 4BI6A 2FTPA 2B7NA 4J3TA 1TTJA 4ZQRA 2F7PA 3EDDA 1GVOA 3B04A 3KX6A 3GXTA 2YX0A 4GQRA 4M7SA 1NM9A 5KSWA 1GVFA 1VYPX 1W0MA 1SZEA 2XN1A 3W7QA 1OABA 3NDOA 4QSHA 3W7JA 1Z41A 5I3KA 4BK9A 3W1UA 3GDTA 2B7OA 1HWWA 1TMHA 2R14A 2EAEA 3HIJA 3EDKA 1ICQA 1YYAA 3F03K 3UQNA 3QH2A 2EF9A 5FF3A 6CGTA 4UQAA 1SW3A 1UCWA 2V30A 1G4EA 1T8XA 2A7RA 3IV3A 3INPA 3O07A 4KWUA 3W1TA 4XTIA 5BW6A 4HOXA 3WDJA 2NUXA 1D7FA 1YXDA 6ALDA 1QNVA 3BAIA 3ZWSA 3STCA 3BLIA 1F76A 1TYGA 2KZHA 1Q6LA 1F74A 3C3NA 1H7OA 3M1ZA 3W1QA 3ZFHA 2BLEA 5I3FA 2QDGA 1OJXA 4CKQA 2V3DA 3W6YA 4JL1A 2WJZA 2PC4A 3TW7A 1VFOA 4Z0JA 3STFA 1BWKA 1KFCA 1SSGA 4WXZA 4UUIA 3P8IA 3BG5A 5L9FA 1DQXA 3C61A 1WPCA 3IIVA 1K8ZA 4CN4A 5HUOA 3CIWA 3LM7A 3LERA 3WJSA 3PG9A 3VMPA 3L0GA 1ZY9A 3RIKA 2A4AA 5K9DA 3UD6A 5G2IA 2H6RA 2VR5A 3GR7A 2RDTA 1KBKA 3PY2A 1XD1A 3R5EA 1JGIA 1WYIA 4JCLA 1RP9A 1RQHA 3B4UA 2V5LA 3DI0A 5D37A 4YWIA 3UEQA 5C55A 1KBIA 1O60A 1K3UA 2EAWA 1QWUA 3WNNA 2BWGA 3MHGA 3KVJA 4OGZA 3TQVA 3W1LA 2WO5A 2J9ZA 1XSJA 2A6NA 4WY0A 1TRIA 5I3HA 1MXDA 4UFLA 3DX4A 1QMLA 1RV8A 1QHOA 4O4VA 5BNKA 1KFJA 1WBJA 1SMDA 2CHNA 1XDMA 1YXYA 2TPSA 1WP6A 4BZYA 5D2TA 2OX1A 4H7VA 2NZLA 3Q2DA 3WN6A 3NR0A 5GVJA 5H2ZA 2V2HA 2QJGA 3LXAA 4QNEA 4LRTA 4A22A 5DLCA 5EL1A 2QCDA 3HPSA 4LPCA 2BHZA 4LNYA 4O1CA 5AC6A 4YCPA 1EA0A 2DORA 3DBPA 2J9YA 1CDGA 3TKFA 1DHPA 4ORIA 2LLEA 3GX9A 3KE0A 2CFFA 1FDJA 1U33A 1MEWA 2PWGA 2TMDA 4BF9A 1AW1A 5D2WA 3FA5A 1IIGA 4FB7A 4MJMA 4GO9A 3S8HA 3OBKA 1TPUA 5F2IA 5MHBA 5CKSA 1VCVA 3N9RA 4AMWA 3P62A 3KXQA 5FF2A 3EX4A 1LRQA 1O94A 3NZ1A 3BCDA 4JDYA 4MYXA 1JQVA 3UYCA 3D52A 4O14A 5F4WA 1H7XA 2YZRA 2WCSA 3DDGA 2XWEA 3L4UA 5EYWA 4HIBA 1E40A 4NX5A 4OT7A 1IV8A 1KM6A 2YYUA 4UFKA 1OFEA 4GUIA 1V3LA 3C4UA 3EDEA 1ZAHA 2ZDRA 5D2VA 2CZDA 4BFAA 3N9SA 1WX0A 1H1ZA 3HG5A 1YTKA 3MBDA 1HTIA 4M56A 2RH9A 5FI8A 1G4TA 2NXHA 3M5YA 3D51A 2EQDA 1QPOA 1EWEA 3HPXA 2FDSA 2YFOA 3TE9A 3KLLA 3CHVA 3THAA 1QWGA 1DVJA 5CPNA 3B8DA 4AAJA 3L2MA 1EB3A 1JI1A 3L2IA 3MYOA 4OKDA 1W3TA 3DKLA 1HXKA 1NAL1 4LUJA 1IXPA 1QWNA 1JDAA 3P74A 4QJ1A 3N14A 3DHPA 3EEGA 2YJQA 5KZEA 3L2LA 3O6YX 3M5ZA 8TIMA 3A21A 3PUDA 1JF6A 3PUEA 3A5VA 3ABOA 5BMWA 1OT1A 5LHEA 1WZAA 3TQKA 3W1XA 3KRUA 4WF7A 4X9YA 3SECA 3H55A 4J3VA 1BPLB 5K7JA 1I8JA 1H7PA 1LYXA 1TV7A 1T0OA 1BVNP 4GRSA 4ZQMA 4PCSA 2CZ5A 3DX2A 3UWQA 2WSYA 1KM4A 3QFEA 3NQ6A 2BTMA 4Z1DA 1G94A 2PCQA 1LTDA 1GYNA 7TAAA 3GNNA 3LCXA 1ZHAA 3W84A 2NT1A 1EEPA 1OHLA 4DF1A 4O4WA 1THFD 2VEKA 3EX2A 3W85A 4FLRA 4M6PA 3IGSA 4ML9A 1FWNA 4JXCA 1AQMA 1JCJA 4WD0A 2ZX8A 3O6DA 4PEEA 5E1QA 4O0ZA 1UD8A 3W70A 3ZR5A 5CZ0A 4QITA 4M19A 4LRSA 1CXLA 3LLFA 2JKEA 3OA3A 4S2CA 4UTTC 4PTNA 1CXHA 1HO1A 3CZEA 3L66A 1AW2A 4BWLA 3P8JA 4UTKA 1XUZA 2Y5EA 4MAZA 4UTLA 3SZ8A 3N2MA 3VGDA 2ATMA 3E96A 2Y61A 3W7NA 2VEPA 1CI1A 3DFTA 3EX1A 3W23A 1TPB1 5BMXA 1ZAIA 2ZXAA 4POCA 2CLMA 3STEA 1P0NA 1BKSA 2XIBA 4DO5A 3P5ZA 4FHAA 3II1A 4MLRA 3UPBA 4O28A 5HJLA 5SWUA 4DPQA 3D4YA 5T26A 1E3XA 1KB3A 3UXDA 3DX3A 3GIYA 1Y7VA 2QCLA 3UY7A 4LVFA 2V3FA 4ATWA 2ZFAA 2X2HA 3UCQA 1JCYA 4X9SA 2YA1A 1KXTA 2E09A 3O8AA 3RK8A 3TTSA 3E49A 3NPXA 4M5PA 4H2CA 2A5HA 4R33A 2DH2A 1PCKA 2OYKA 1KXVA 3EJRA 3WNKA 2OYMA 3L9CA 2PURA 4Q4KA 4WOQA 1YTEA 2QCGA 2ZWYA 1AG1O 2ZZ7A 1HT6A 2EPHA 1LZOA 2OZ0A 3BUBA 3OVPA 4NUWA 1QAPA 3NPUA 1EP1A 1YDOA 1MXGA 4CGTA 2NXIA 3EJUA 3KL3A 3LRLA 5KEZA 2QJHA 3N2XA 5KITA 5CGTA 1S3HA 4Z1BA 1ONRA 1RPKA 4N4QA 1YTDA 4FLQA 1G1YA 4IMCA 3UG3A 1VPXA 4JTJA 4HA1A 3W7LA 3S6DA 5CSRA 1MVYA 5AHLA 2TRSA 1DQWA 3GXNA 1OG0A 2DIJA 1K8YA 3EB2A 3QPYA 4R34A 5DBUA 3EJTA 1XCXA 1QI3A 1DL3A 4XQ6A 4NQ1A 2ALDA 2ZQ0A 3TJLA 3GNDA 2F7QA 3MUXA 5G1TA 2F84A 2YW3A 3W83A 4W9TA 4ORMA 1B4KA 2Y7EA 3CU2A 3EWYA 5C6MA 4K7YA 2YFNA 4Z0SA 3KFTA 1E3ZA 4AEFA 4JYEA 5I3IA 3W86A 4PL1A 1GZGA 3P61A 3VX0A 2E6FA 3UWUA 3RLUA 1SPQA 4TO8A 4H8HA 2FH6A 3Q37A 3TJXA 3W2LA 4LWWA 2VC6A 4OU1A 3EJQA 4WZHA 1NF7A 2CW6A 1Z32X 2Y63A 3SFKA 1L6YA 3WK0A 3S9YA 1UBSA 4GXMA 1PV8A 1QOPA 3TFXA 3LDVA 4EWND 3B0VC 1H7WA 1VH7A 3W2KA 3AJXA 5HPOA 5KZDA 2HS6A 3IRDA 3FLUA 3BK0A 1I2OA 4L4MA 1GTEA 3VU2A 4HPXA 3DI1A 2WNZA 3L67A 1UD2A 2ATSA 3MP3A 2PWDA 3BSHA 1MXSA 1SFLA 3ANYA 5HINA 4AYSA 3NL3A 3C2OA 1JXJA 1T99A 5C2XA 2JKAA 1PJ9A 1UD6A 4E0CA 2FJKA 3LBCA 3NQDA 4FEZA 3W3OA 2DIEA 1GEQA 1O4UA 3HGSA 2H8XA 1LBMA 1XKYA 4JYFA 1A5CA 3VGFA 2WVSA 3AXIA 2BXZA 3W1MA 2H3DA 5CZJA 3EKZA 5DFAA 3OLDA 2P0OA 4X2RA 2JGYA 4NNBA 1TCMA 1QPRA 2V9DA 3LCIA 4UCGA 3GXPA 4N4PA 1UJPA 4FNSA 3A23A 3WNLA 1EH9A 3GDLA 3BVVA 2CLOA 4JY8A 5LGXA 3LRMA 1KCKA 2GOUA 1VJSA 2F7OA 1BVZA 3CIXA 3MW7A 4MLJA 4GQQA 5EMYA 3RFAA 1R2SA 3IVTA 3LGEA 5AFDA 4AMAA 4ZQNA 2FPTA 1QPKA 3I6RA 1AQHA 4AIEA 4B9YA 1MW0A 3QMSA 5AC8A 1G7UA 1UKSA 4JTTA 4MZ8A 5D2YA 5DO8A 4JX4A 2YGYA 1SFJA 4UC5A 3NQVA 4MY9A 5KMYA 4P2VA 4FMVA 3LHZA 3KL0A 1GVRA 4LY8A 3HBLA 1KGXA 1NFBA 3EWXA 3GBDA 1GWJA 3CT7A 1MW3A 2OW6A 3CTLA 1JDCA 3FYOA 3TUUA 2YDAA 1G7VA 1TPDA 4U2ZA 3SIZA 4OQVA 4UFIA 2NWRA 3MHUA 1FWTA 4FLSA 5IM51 1XBZA 1CGUA 4K7VA 1M7PA 1UA7A 2NUWA 4DBDA 3I68A 4UZUA 1UD3A 4ONVA 3WY2A 1V5XA 1A47A 2JGQA 5FF0A 3GDRA 1H50A 1DJQA 3DZ1A 4XKYB 1FCUA 4EF8A 4JX6A 3BW4A 3NAVA 2AGKA 3DDFA 3GYEA 3ZOAA 3GAYA 4OJYA 4JDBA 3L5MA 3NQ2A 5KZMA 2Z1BA 3DC0A 1ZJBA 3BVUA 4MJZA 3LCLA 2OT1A 1GTHA 3TTYA 1WXJA 1J0HA 1K8XA 1L6SA 4A29A 1FWSA 5BRQA 5D02A 1NOFA 2A1YA 4I9AA 2ZYFA 4O16A 3W76A 2J88A 2QAPA 4U33A 2GVYA 1KM2A 1W5QA 2YIHA 4XB3A 4LC8A 4O12A 2XWDA 4UTJA 5FEXA 3WJYA 3ZT7A 1VC4A 5D03A 3D50A 4MFEA 2ZRXA 2ZUSA 3EJSA 3BG3A 4UTWA 2X30A 3CV5A 1TTIA 4R7JA 4XUGA 5E6ZA 2VXNA 1VR6A 1XUUA 3SSJA 1F2JA 1G9HA 1KLZA 3NM3A 4HHPA 2ZRUA 5AB3A 3E0IA 1SR9A 1PL9A 3LTSA 3W9ZA 5LGZA 1JCMP 3ZSSA 5AYZA 2OSWA 4WJEA 1ME7A 4U2YA 4PC8A 4GC4A 3I7RA 2ZTJA 1H1YA 2F61A 3PAJA 1VGAA 1C9DA 1QOQA 2E0PA 1SO4A 1PIGA 3W22A 4LU0A 2WKLA 1OYCA 3V1PA 2B0MA 4WSJA 1YADA 2Z6IA 2VFIA 3LCHA 1Q4NX 2ZRWA 1I2QA 1CXIA 2WOQA 4IXHA 4ADSA 2F1AA 4O15A 1OK4A 2W6RA 4MZ1A 2H90A 2Y2WA 3UY8A 4ADUA 4MY1A 3O16A 1QHPA 3RLVA 1JR1A 4LVDA 2G5WA 4RJEA 3PBWA 3G1VA 3G1YA 3WNOA 2E9BA 3BSGA 2C0AA 1LP6A 3QGVA 2O7QA 4YCOA 3W1RA 3NOEA 3DFPA 3BPWA 1KFEA 4JFSA 2GUUA 1TPC1 3TQ0A 4FLOA 2C18A 2ZE0A 1LM1A 5BOOA 3M44A 3HF3A 1DV7A 3O15A 4IQLA 4K37A 4JYDA 1W5OA 4N9BA 3G1SA 4UFMA 4OIFA 4Z1AA 2J27A 1IZKA 2D2OA 2YYTA 3PS7A 2FPVA 1XC4A 3NL2A 3ABSA 3HQ1A 2A7PA 5TQLA 2C7FA 3MYPA 1B4EA 1GQNA 3QSTA 5AYXA 3S42A 3L4ZA 3DHUA 2BY2A 4KFOA 4PH6A 1GCYA 5LNVA 4PL2A 1P4CA 1VRDA 3F4NA 1XXXA 3KOFA 4JTEA 3C0JA 4PEKA 4JEQA 1BG9A 5DCBA 2X2JA 4A21A 4AB4A 1TSIA 4HNTA 3EXTA 3LHVA 3S5ZA 1LBFA 4HT3A 4S1FA 1MFUA 3GXMA 2X1RA 4RCXA 5HQEA 3VSVA 4IMFA 3W07A 5C5YA 3A9IA 2Z0IA 4DO6A 3T7VA 5D05A 1XGZA 3VGEA 5HNRA 2NX9A 3LX9A 3M07A 4HPJA 1W31A 1KTNA 3LCFA 4RZ5A 5F4SA 4QISA 1XL9A 3IGUA 1X7FA 3TH6A 1N8FA 2VT0A 2X16A 2E6YA 3VI2A 3UZ5A 3TCEA 5HMSA 1VIWA 4UTTA 1ODUA 1J0KA 2V2DA 1R2RA 3K8KA 3IVSA 3UERA 1Q6RA 3JRKA 1SW0A 3WNPA 2C14A 2GQ9A 5K9CA 1CLVA 4B9ZA 5AHIA 4MZYA 3HJEA 1YDVA 1JCLA 1TQXA 4QAIA 2GVGA 1K7XA 3A22A 1ZJAA 1MSSA 1UASA 3W7RA 1X1OA 2QPUA 3QMTA 4HKPA 5A2BA 2GPTA 3SI9A 2VFEA 1CGVA 3LPPA 4K6AA 4WY0B 1PS9A 1LRNA 2Q3OA 1CGYA 5G2HA 3ZR4A 3L4XA 4IXXA 3G22A 2Z2UA 3W7MA 4LVAA 5I3JA 4IMGA 3NPVA 2GJRA 1KBJA 1PAMA 3M9YA 5CGMA 4WLCA 3L4WA 2YPIA 2CZFA 3CC1A 1Z44A 3HGJA 4GJ1A 5HR6A 5AYYA 3G1FA 5D38A 3CLMA 4O13A 2GUYA 3EX6A 3PSVA 2GJLA 4UNIA 3I7QA 3ZT5A 2ZZ6A 1VYSX 3LI1A 3G24A 1JRBA 3VSUA 4NJIA 1A5BA 8CGTA 3WFAA 3KRSA 4BI7A 4O11A 2Y89A 1XBXA 3NEVA 4I7UA 3UG5A 4JTIA 1IIHA 3HO8A 1GVSA 4A3UA 5KTLA 3B05A 3OIXA 2RHGA 2VUYA 1SW7A 4NNAA 3A5FA 1W8SA 4OWGA 2A6LA 5J5DA 1O7DC 3HMJG 1F05A 1PEZA 3DH7A 1XSKA 1XBVA 1XI3A 3TX9A 2ZZ2A 1HVXA 3W2NA 2BSLA 2QCCA 3MHFA 2DZPA 1LWJA 3PF3A 2F1BA 2E8YA 5D2XA 2C15A 3V75A 3EDFA 2OSXA 1MEIA 1NVMA 3DXIA 1S46A 2QKFA 2VELA 4RK8A 3L5AA 3BUDA 4AMXA 3VO0A 3IIOA 1OF8A 2NV2A 2Y4SA 3LTYA 3FOKA 2C13A 1AK5A 1W1ZA 3BLFA 3IGXA 2QMJA 3BUPA 1LCOA 5K4ZA 3DX1A 1J0IA 2Z1KA 1FDYA 2WVVB 2FIQA 3DFSA 3TFCA 3WDHA 2E68A 2A0NA 7TIMA 2VEMA 3UNDA 3BLBA 3K8LA 5DELA 3UWZA 4YLWA 2EGZA 1PCWA 2YW4A 2WSQA 1FXPA 2XN2A 1U2YA 5F1UA 5TD4A 2W0UA 4YL2A 3LXBA 3VMNA 2ZZ3A 4UNKA 3CLWA 4RR4A 5IBXA 3QF0A 1IXNA 2B4GA 2QCHA 2G96A 3L21A 1WZKA 1WAUA 3EKLA 3W7OA 4JN6A 3DKJA 3TSMA 3L4TA 1FX6A 5EA9A 1TV8A 5AOUA 2QF7A 3CZGA 1VCFA 4UR7A 4U3CA 4W93A 3W73A 2OW7A 1KFBA 3HG2A 1KCLA 3UWWA 1BF2A 2NWSA 3G0SA 4PCFA 2NX3A 5U4NA 2G3NA 5CPOA 3RMJA 3VGBA 1ZJIA 5HDRA 3WY3A 4Z08A 5AHEA 4XBKA 3VNYA 3KHJA 3LV5A 1B3OA 1LRTA 3GTNA 3G0UA 3EWBX 4LVBA 2RKXA 2F7RA 3U8GA 5EY5A 1VB9A 5CLWA 1JUBA 1HL9A 1FY6A 3QJAA 2CXGA 4H8VA 1OX4B 3IIXA 5FEWA 2XIIA 4KWWA 3LBMA 4HSOA 3NQMA 4OV4A 1CGTA 2ZA2A 1HG3A 2O7SA 4HNUA 3FIGA 2VFDA 2CU0A 1J4EA 4UCFA 2IGTA 1HFBA 1E43A 5AHMA 2QPSA 1UUOA 4JTGA 4QIUA 4FNQA 1FBAA 3THQA 3GXFA 3SY5A 2EO7A 1SO5A 4O19A 4UFHA 1FWWA 3FAWA 2I14A 4FX8A 3WJZA 3QC3A 5CPLA 4LT9A 3QM3A 2ZZ1A 2FE0A 1VLWA 3DFNA 1H7RA 7CGTA 4K36A 4DF0A 3CGTA 3CEUA 2V5BA 1HUVA 4RZ4A 2PRLA 3BVJA 1PIFA 1TQVA 2XN0A 4MIMA 2OYLA 3ZR6A 3IJ7A 1D3HA 1VHNA 1ZS2A 3NGJA 3W75A 2X2IA 1H5YA 2QDHA 4DQWA 1M6JA 2EABA 1DKWA 1S5TA 3WMSA 3W7KA 2ALWA 3PULA 5A8GA 2F2HA 1JD9A 1F6KA 1W9XA 1XCWA 2EACA 3O1NA 2QJIA 3O05A 3BW2A 1OYAA 3BGGA 3DHDA 3PUOA 1TIMA 3DHFA 3KEHA 5LNWA 1P6WA 3W37A 4UOQA 1SZNA 3M5XA 4K8HA 2DP3A 1ICSA 2E5CA 4XTDA 5K2ZA 2Y70A 3LHTA 1IF2A 4DELA 2OSYA 3H54A 2WKJA 1HNYA 1RZMA 3ZS4A 3R12A 1ALDA 4XBSA 4AHQA 3RILA 3NM1A 1DHKA 4UNLA 1GJWA 1DOSA 1KW1A 1UA3A 1FCBA 1H63A 3FFSA 1BSIA 3MP5A 4CCCA 2VENA 4TIMA 2QEZA 3BH4A 4RXFA 2YCEA 4ZVJA 2ISVA 3P84A 2YOCA 5K4XA 3OLGA 5HULA 2ZUTA 4AYGA 2DH3A 4MFDA 3EX3A 3LOTA 3U6WA 3GZ3A 1YPFA 2YA0A 4S2BA 1AW5A 1MEHA 1SO3A 3TIMA 4NXSA 2RDUA 1M53A 5DCEA 4GUFA 3BAYA 1I4NA 4AH7A 4EOUA 5CZSA 2GQ8A 5CXPA 3CTTA 1TRDA 5D04C 3EXSA 9CGTA 5G5IA 3L4YA 4AF0B 4CQ8A 3OEXA 3MP4A 3O06A 5G4EA 1DJNA 4H3DA 5A2AA 3UXAA 4GUHA 4ZL1A 4LQ1A 4FNRA 2WKGA 1BTMA 5BRBA 4UQBA 1LDCA 2FYVA 1MFVA 4AWSA 4NXKA 1RPXA 3LLDA 3IJ9A 4A2RA 1B57A 1UH2A 1CXEA 3LPOA 3MO7A 2E5BA 1VZWA 3OHIA 1IXOA 3FW6A 3G1HA 1LLZA 1H3GA 2D3LA 1VJIA 1XH1A 4CN1A 1GJPA 4IUOA 1GOXA 4FNUA 1RR2A 3MI6A 1J2WA 2VOMA 2XFWA 3S1XA 4J3UA 4Y8FA 2BHUA 1JD7A 4H4IA 2B7QA 3ATZA 3S1WA 3DU0A 3RF9A 3LRKA 3CM4A 1VFMA 3FKRA 2B7PA 4KFPA 3QPZA 4TVUA 3P67A 3PM6A 3JS3A 2CLIA 3EXRA 2VFGA 2A85A 3W7HA 1GVQA 2V82A 5HUPA 1ME8A 3P5YA 5CG7A 4NZFA 2ZBTA 1OFPA 3NQ8A 1YLVA 2RFGA 4OV9A 5D32A 5LNUA 3QZEA 1ML1A 4E38A 3M5VA 2WVTA 1JFHA 1JI2A 3LXCA 3WELA 2E8ZA 1KWKA 2XVGA 4IGHA 1JVNA 4DF2A 4JNMA 4U28A 3CZKA 5IBXC 4FO4A 3M47A 2GJNA 2DZWA 3G1AA 5A6MA 3IK2A 1IXQA 4IPIA 2PWEA 1LOSA 1WE5A 1RP8A 1QX1A 2VRKA 1EIXA 2CZEA 1TQSA 1VAHA 2HS8A 3ZSTA 2A7NA 1ME9A 4O57A 4BR1A 1KTBA 4QM1A 3B0PA 5DN1A 1SU5A 2ZIDA 4JFUA 2QCEA 4N6EA 3WNMA 1Z48A 4FNTA 1W3NA 1O95A 4P61A 3QEZA 2ZA3A 3LHWA 4JS3A 4ZMGA 1FWRA 6TIMA 1FQ0A 1CXFA 1QI4A 2Y85A 4JICA 5E70A 1OX6A 1K03A 3SW6A 2HMCA 3NQFA 1S5WA 2E77A 2ZCGA 5FF4A 4O0KA 2Y7FA 3DX0A 3GKAA 2FLIA 1TCDA 2A21A 2YA2A 1GT8A 3E02A 1PHQA 4FXSA 3W71A 3PBUA 5K9XA 1ZCOA 3IEBA 4KMQA 3PC0A 3C8FA 2Y88A 1EUAA 2ZICA 5E6YA 3NL6A 3EWZA 3LHUA 3QQ1A 1B0IA 2PRMA 1EO7A 4K8EA 5TIMA 1QPQA 2VFFA 1SSDA 4X3ZA 1GYLA 3M0ZA 4ZQPA 1KXHA 1T96A 1RQBA 4EF9A 4CNOA 2CLLA 2Y24A 3IIPA 4KWVA 1YPIA 3S5YA 1OSEA 3CEPA 3R8RA 2VFHA 2ZZ5A 3BARA 5F2GA 1VS1A 4O8RA 3AMKA 4BI5A 3L0NA 1JDDA 5D33A 4JIQA 2ABAA 3PB0A 4MUZA 2BY1A 3E9AA 2Y7DA 2WPGA 5A2CA 4JTFA 2DZSA 4MKNA 4XKYA 3M43A 4IX2A 4AEOA 2ZA1A 3CZSA 1P0KA 4J3SA 2FGZA 4U4MA 1M5WA 4FX6M 1MZHA 1BWLA 1RQEA 3GXDA 3G3MA 1I2RA 4D2JA 1C29A 2EHHA 1ZALA 3TAKA 1GG0A 5DBTA 1R75A 1EHAA 4M6QA 1TJPA 2BX7A 1GG1A 3FS2A 1V3MA 1LLWA 2Q3RA 2XVLA 1IZJA 1EPXA 2I1OA 4DPPA 1KM5A 1JCXA 1OFDA 2DJLA 3HJZA 3PG8A 2V3EA 1SZGA 4HSNA 5C54A 1KA9F 2DZXA 4JTKA 3W74A 2D3NA 2V8ZA 2WSPA 2VKZG 3NQAA 2H8ZA 2R94A 3O6CA 1CGWA 1CIUA 6TAAA 3T4CA 2TYSA 3FYPA 3O63A 3YPIA 2Q8ZA 4LC6A 1D3GA 3GB6A 4UQCA 4IPJA 1S5VA 3M6YA 1L0PA 3KRZA 4MVAA 4HNNA 2J24A 4J3WA 3WK3A 2FH8A 4GFSA 4K38A 3AO0A 4NU7A 3Q94A 3UZJA 4UIOA 3W7EA 2R8WA 1G69A 3GBEA 1W5NA 4ZQCA 3WFZA 5G4WA 3D4ZA 4JTSA 1IGSA 1OFRA 5G1YA 4TU1A 4O1DA 1QI5A 3L5LA 2ISWA 5I3GA 3UWYA 4GUJA 5CLTA 3CZLA 1DBTA 1LROA 3DGRA 3ELFA 4GWEA 1DORA 2VEIA 4J9JA 5E9AA 1QDSA 1KV8A 3AXHA 1WOBA 2TAAA 2BXYA 2E6AA 4DEFA 4TMBA 2ZRYA 3VM5A 4MOZA 3WY4A 5F4XA 1OFOA 1RVGA 4FNPA 3KVLA 1ADOA 1A5SA 1UKTA 3BAWA 4X22A 3PBYA 4JY9A 4NJJA 3C52A 1SUXA 1M7OA 1TQJA 4CN6A 4C1KA 3WJXA 2Z6JA 3GDMA 3BVXA 2C6QA 2JBMA 4DO4A 2FHFA 1EUNA 1JUEA 1DTUA 3BLPX 4LTSA 4AWUA 1KWGA 3C2RA 2QR6A 3TAOA 2QV4A 2TSYA 3NA8A 1F73A 3BAXA 3GR8A 3BMVA 4MYAA 1HX0A 3CPUA 1W37A 3QW4B 4AVFA 5K3VA 1PIIA 3W2UA 1XH0A 4N2YA 4MPQA 3E12A 1N7KA 2FB2A 4WXYA 1TQTA 1PHWA 3MBFA 1LWHA 1XCFA 4GUGA 1J0JA 2YKKA 3NG3A 3IIZA 5FESA 1UD5A 4YXGA 3OLEA 5CSSA 4LUIA 3OLIA 1UH4A 1UOKA 2CLFA 2HSAA 5LSMA 3GKFA 4TMCA 4NZJA 3BAJA 1F6PA 3K30A 1SZFA 2A2IA 3G1XA 3OVRA 1QW9A 3S2CA 4WQ6A 4GI6A 3W38A 3W1NA 3BCFA 1QPNA 4WOZA 4J3XA 4O10A 2P1FA 1KFLA 1O5KA 2G97A 4PODA 3NQGA 4TR9A 4DBEA 4LS0A 4NX0A 2NUYA 1VHCA 5HXMA 4HOWA 1KGUA 2AAAA 4PCTA 2V0TA 3FEMA 2D73A 3G0XA 4JCMA 2ZRVA 1A5AA 2BXVA 3STGA 5LNRA 1AMYA 3HGOA 3LCGA 2NX1A 3EWUA 2WPBA 4Y6GA 4UTWC 3ZWTA 4UTIA 5EBUA 1XD0A 2ZXBA 1FDZA 4H6KA 2JK2A 5U7SA 3N3MA 1EX5A 2NV1A 1UD4A 4AW7A 2G3MA 5E93A 3QMRA 5CZTA 5DXXA 2QCDB 4PSPA 1EWDA 1KV5A 2J6XA 1H61A 3G8EA 3GDKA 2ZX7A 4QQ3A 1I2NA 4H8UA 3W7DA 3NL5A 5DY2A 1EO5A 3WY1A 3KVMA 3HG3A 4HOZA 1R2TA 3QW3A 4JTHA 2OT0A 1TMQA 1P5BA 1I45A 2C1HA 4WX2A 3UPWA 3VNZA 3TV8A 1TPFA 4YMZA 4UQDA 1TJRA 2BY3A 3FAXA 4RLIA 3P81A 1L6WA 3VCRA 3ZQ9A 4BA0A 4JD4A 1VYRA 1XFBA 3VE9A 4O18A 5ABTA 4U31A 2QCNA 4B5NA 3B0UX 2GQAA 4N9EA 2ZX9A 4WUIA 3AJ7A 2WSKA 1H51A 1X8FA 2FB3A 3SGUA 3T78A 3WK2A 3IVUA 2J9XA 3W2MA 1UB3A 3P7YA 4M6VA 5HWMA 2WV8A 3BGJA 4J7RA 4UTMA 4UOZA 1OB0A 4LV9A 3L4VA 2ZRZA 4Q32A 4GINA 4RKAA 1TPH1 1OYBA 3DFQA 3R89A 3NQEA 3LTPA 1G4SA 2ZUVA 2PRHA 4JTUA 3BAKA 3LV6A 1UH3A 3T55A 4AEEA 5I24A 4GE8A 1G4PA 5LNSA 5H91A 4I7VA 1OT2A 4CVWA 1HL2A 2WANA 4N9CA 1OX5A 1VQTA 3RU6A 1TQWA 1W5MA 2CLEA 1WOAA 4NJHA 1NEYA 3B03A 3OVQA 1OX4A 2C8NA 1G6CA 4JGDA 1P1XA 3FJLA 1W54A 2PE4A 1ZENA 4ICNA 3SJ3A 1GPWA 2ISSA 4AF0A 1PZ3A 3QSRA 4QNWA 3TU9A 2YXGA 4LS2A 3GXIA 3MI3A 4O1BA 1CXKA 2WSRA 5E0KA 1HTYA 4LW7A 1TQUA 1WA3A 4UQEA 1NF0A 1GJUA 1K7FA 3TXZA 3WEOA 1J5TA 2VNCA 4KKXA 1GVIA 3B06A 4CNPA 4OE7A 1PZ2A 1U30A 2CPUA 2D0FA 1Q45A 1R30A 3TDFA 3BVWA 1UKQA 3L68A 3W7GA 4UMBA 1Q3NA 4HNVA 2ZZ4A 1DEDA 3TC6A 5KINA 1F7BA 3WEMA 1W5PA 4IJBA 4PA8A 2EADA 4IWWA 2F18A 1I2PA 2AAMA 5F2MA 3BMWA 3KVKA 1AL8A 4N9DA 4O52A 4UQ9A 5A5WA 3HB9A 2F7FA 3D0CA 2Y6ZA 5E0FA 3W87A 2QCMA 4RZ6A 4UTUA 4JR5A 3TMQA 3W88A 1LOQA 2DZTA 1L2UA 3NQCA 4HN4A 5I0DA 3HOJA 1AMKA 2FQIA 4CCDA 1SQ7A 3SR7A 2EEXA 3MJYA 2P10A 2QUTA 4IOTA 3BO9A 1QFEA 1V3JA 3QRHA 1OGSA 4IMDA 4AHOA 4N02A 2AQWA 2WQPA 1KGWA 1ZAJA 3WENA 3N73A 4FIQA 3KWXA 3HPZA 4JIPA 1A50A 1O5XA 3NQ7A 3W7IA 2X1TA 2YR1A 3PR2A 1W56A 1BAGA 3VSTA 1CW2A 3WDIA 3G8RA 4GIAA 3TXVA 2GJPA 1YDNA 1TPWA 2CLKA 3UG4A 1FXQA 2RDWA 4FF7A 1KBBA 5EKYA 4CLMA 3M41A 1TV5A 2BHYA 2FHBA 3VGGA 1TB3A 2PWFA 5AHNA 1R34A 3WK1A 2NLIA 4NJGA 5FEZA 1N55A 3PSWA 2V81A 3TR2A 4IX0A 3USBA 4EIVA 2YSWA 3IJ8A 1CX9A 1LORA 1G67A 1X1ZA 3VKJA 4UR8A 2E5DA 3CPRA 1FCQA 1MW2A 5BRPA 1X6UA 1OFQA 3A4AA 3GAKA 4Y9AA 1B2YA 2BZNA 2W79A 4MB1A 2ZX5A 3M16A 3S1UA 1H60A 3I65A 3TROA 2R91A 3C2EA 3MMTA 1WZMA 2EKCA 3N19B 5I5RA 1MWOA 1F5ZA 3KL5A 2ZXQA 4RX0A 4JFWA 3W2JA 4HPHA 4WY0F 1K7EA 3L65A 3DFOA 1LBLA 3K8MA 4RV8A 3DAQA 3NPWA 1L9WA 4DXVA 2NXGA 5L6UA 4CQAA 1CPUA 1QCWA 2Y62A 1XDLA 2UV8G 3GVGA 3FKKA 3BW3A 1B9BA 3VNDA 3TA6A 3U2OA 4R53A 5CPMA 3AMLA 5DCDA 4BWLC 3S0CA 4QAWA 3VM7A 3MWAA 3A24A 1EA9C 4XZ9A 5AC7A 4NT0A 3WJWA 3QYQA 4JFVA 3HGRA 1WDWA 1SMAA 2ZWZA 1EP3A 1C8QA 2QLYA 2WCGA 3ABRA 4L4LA 2E4TA 1E51A 1BEUA 1TREA 3S5OA 5AHFA 2ZUWA 1R46A 5D09A 5LZLA 3VMOA 4UFJA 4IMEA 1ICPA 5F1VA 4PFMA 2WNQA 3F4WA 1QO5A 2ZUUA 1KM3A 3I7SA 3C56A 1QO2A 1JF5A 3PVFA 4JFTA 3HG4A 3EJPA 3JR2A 3CWNA 1D3CA 1FCVA 3L0KA 2X1UA 3TNOA 1XBYA 4M8UA 1V7YA 4AIOA 1W3IA 5D30A 2DU2A 3R2GA 4Y96A 1SO6A 1RD5A 1TTPA 2E6DA 2ZX6A 3W1AA 3T40A 1D9EA 3CZNA 3N34A 1HL8A 3P82A 2NT0A 3S1VA 4K39A 3P60A 2C16A 3NXFA 3BG9A 4TX9A 1Q6QA 2CLHA 4FXRA 3LI0A 4JL2A 1OVDA 1K02A 4RXGA 5EMUA 1WQ5A 2C3ZA 1VFUA 1OFAA 2Y7GA 1AVAA 3BUIA 2FFCA 1JAEA 3SGZA 4JX5A 2ABBA 2ZXDA 2QCFA 3BC9A 3TOPA 1U83A 1KM0A 2DZUA 2D0GA 2D0HA 4CQ9A 2HTMA 1WZLA 3C6CA 1V3KA 1LOLA 3R13A 1EP2A 4Z1CA 4OHQA 4A2SA 5HR7A 3BLKA 3UWVA 1JCNA 3ATYA 1Q6OA 5DY3A 3BLEA 2WVVA 2Q8LA 4O1AA 4E2DA 2AMGA 4X0NA 3F1QA 3G18A 3LHYA 1WBHA 5EPDA 1JXKA 3GLCA 1TTQA 1TPEA 1R47A 2JKPA 4FIRA 2IQTA 3EDJA 2C19A 4UTHA 1Y0EA 1JUKA 5A6LA 2OMAA 5AN7A 1OK6A 2WNNA 4Y90A 1JRCA 1QW8A 3OG3A 2H3BA 1C8VA 3TK7A 3ZO9A 4NI3A 2I9EA 2VRQA 3ABQA 3K1DA 4N6FA 1TPVA 2PWHA 1H7NA 2OCZA 1I75A 2NSXA 4O53A 2X1SA 1VLIA 3G3DA 1FUYA 4LVGA 4C1LA 4AHPA 1OF6A 3BV4A 3P80A 3W7PA 1H62A 3HZ3A 1UUMA 2DJXA 3PBVA 1XV8A 1KLYA 3C2FA 5G2WA 4CCEA 3VE7A 4ALDA 2G95A 2GVLA 4CNNA 2QAFA 4HP5A 2FHCA 1NSJA 2E1DA 5TBOA 4ZZ9A 3H53A 4UXDA 1MO0A 2FPYA 1JIBA 1MW1A 4O17A 4UMCA 1BLIA 3C2VA 1AL7A 1ZNNA 4LS1A 3FJ6A 5LHFA 4GO8A 5F7UA 5J5RA 5LKYA 3KAOA 4NVTA 4O50A 1PVNA 3NVTA 1PPIA 1CGXA 1YXCA 3NO5A 3Q58A 5F2LA 1TO3A 4LV4A 3G1DA 1KXQA 5FF7A 1KTCA 1JQXA 1JULA 2WNWA 2V2CA 1OFBA 4OBTA 1M7XA 4GNJA 2QUUA 4Q33A 3W1PA 3A6OA 5HWNA 1QR7A 4I7WA 4NNCA 3A47A 2OJPA 2QMKA 1JJKA 1JL8A 3PB2A 3TC7A 1G5AA 4FX7A 4AWTA 4GKLA 2J25A 1JG9A 3ZT6A 1KFKA 4UZSA 4AXKA 5I23A 4E2BA 2QUVA 5FEPA 3NZRA 2ZTKA 3S5NA 3M7WA 1U5JA 3VX1A 2X2GA 4EVZA 3TMLA 1CYGA 4GI8A 4E2OA 5DXYA 3QQ0A 2WVUA 4KFNA
chains in the Genus database with same CATH superfamily
4P9HC 3ZHFA 2QTVA 2G75B 1XH2A 4ZR8A 3K4DA 3SCSA 4GBUA 5SWZE 3FB8A 4WKAA 2PMZA 2WSDA 3WIHH 2DV0A 2RDXA 1QBML 3O3BB 3TONA 1A53A 4X6FA 2H9GB 3LEPA 4OZFB 4PV9B 4PMFA 1QMUA 4NQCE 4GISA 1Y6MR 1Z42A 3RNDA 4YHYC 1QBBA 3GMNA 4GI9A 4KC3B 1JGDB 4DAGL 4ELME 4Q6XA 1KB9K 2NYZA 3C12A 3UTTB 5CFHA 2E9MA 4UMAA 2AL2A 1ZLVK 3M46A 1I8MB 4EI0A 3LCWA 4YVPA 4HF5L 2ACQA 3QULB 2EJ1A 4L23A 5EFIB 5DGQA 3ZDXF 1W8OA 3WD2A 4WSKA 5GSVB 3VDCA 2JALA 3F83A 3ABMB 2CWNA 4JG9A 4ONFH 3MNDA 5KS9F 5KUMA 4GKSB 4QRRA 5C09E 1VBRA 3CWOX 2AEQL 4G7EB 5L8JB 4Y5YA 3AZTA 1M56B 2DQ6A 4I0PB 5FYJL 4XCEB 1REQB 3DENA 1FZMB 3K2KA 4OAWB 4K9EH 1QKZH 4LGPB 2XVKA 1SQMA 4ZTYA 1Y18A 3VOFA 1B3JA 1BAWA 2PDMA 3LDBB 2FTPA 5LGKA 2MRYA 3LNFA 3PJWA 2HFGL 5DK3A 1TTJA 3UA3A 1JOIA 3NEHA 4PGEA 1GZ1A 4YVXA 1U8IB 1FAIL 3MU3A 5I16B 4YFEA 4K7PX 4GQRA 1OZQA 3KM1A 1I8LA 2IAAC 1M71A 1NAMA 1X3DA 3HR6A 3LNPA 1FORH 4BSWB 5AW3B 4YEFA 1P4LA 1V3IA 5E8NA 2BZ7A 5XIAA 3W7QA 4JFFA 1OABA 4WW2B 1QWHA 3MMWA 4QSHA 2WZPA 4IPPA 5IQ9B 4V27A 1SJDA 4U6VL 3W7JA 4D6GA 1Q9KB 3N41F 4R9XA 1Z41A 5I3KA 4ACZA 3VW3H 2B1HH 2XN9E 5AVTB 4X99A 3ONBA 1E2VA 1WGVA 2LFGA 4PP2B 5FACA 3W1UA 3IACA 3TBTA 5T9CE 1U3HA 3B6SA 1CLOH 3ISWA 4XHJC 4ZUUB 3X11B 3LU2A 3AROA 2EAEA 1SDYA 2DM3A 1AQKH 1H3PH 2IAMD 4C56E 2X6AA 5DD3H 2EF9A 4K5PA 4UQAA 3ZRFC 3KPRD 1WAEA 1G4EA 4G83A 1T8XA 1XX1A 2HKHL 3MO1A 4NQDA 1GGBH 4KWUA 4JDEA 4WDWA 1PLGH 2R1LA 1V27A 2NUXA 4HHHA 4E3VA 1FNGB 1YXDA 6ALDA 5M5DA 3GHEH 1U9KA 3QZBA 4NSKA 4B9PA 2JKRM 3BEVB 2JIXA 4NZUH 4R7XA 2KZHA 2RJHA 4WV1A 3DKHA 3OF6A 4QHKJ 1BEYH 2EKJA 1I8MA 5FWRA 4A38A 2VW4A 1H7OA 5AW6B 1U8LA 3PCYA 4Z3IA 4CKQA 1RZKL 2V3DA 2VKWA 1OJXA 2J47A 4Z7QE 5DQDH 2EDFA 2CO2A 4JL1A 2HLAB 1DXIA 3HI6H 5J1SC 5GSRA 4B9JA 1UKPA 4JIHA 3TW7A 4PS7A 3VD9A 4Z0JA 4AIBA 4RV3A 1NBZB 1BWKA 3E6HA 3DOIA 5J56B 4EDXB 5JMOC 1WUZA 3N06B 4LU5L 1T22A 2QDWA 3IIVA 1Z2KA 5DC2A 2Y07L 1CE6B 3ARDA 3VXPB 2AK1L 4LEOB 5GJMA 2UXFA 3LERA 3LRSB 3WJSA 4Y5VC 1LEGA 4NO0A 1A9BB 1K4CB 3BWUC 3WXVH 3RIKA 2HKFH 2A4AA 4JAWA 5ITBL 4Z5RA 3UD6A 1TXKA 5E2VL 1VFFA 2H6RA 4RA0C 2Z4QB 1B6DA 2J6EA 1JGIA 3LZRA 3MRPB 1X98A 2V6AA 3V0GA 4J1UA 1WYIA 5KBMA 4I9JA 2EECA 1QTYT 2A77L 4PBFA 4DM1A 2AGJH 3P73B 3FB5B 3ZE2B 1L0QA 3MRIA 3PGCB 1CZ1A 1TFVA 1D5ZA 4HFUH 3SCMA 4DK5A 3P69A 3HE7C 3CFBB 3GRBA 4JKMA 5C55A 1SXZA 3HG1E 4HJJL 3QFJE 5GS0D 1SVCP 4TUJB 2EAWA 3HFYA 4CNSA 1J8VA 2IPKA 3G6JF 1JCVA 5EZJB 2J3SA 3C6LC 3F58L 1FWDC 2NVAA 5LAXA 3LYEA 3ZKMD 1RUQL 1TRIA 3DX4A 1BEYL 1QMLA 1QHOA 1MUWA 3IGAB 3HUJE 1CI5A 1RXOB 2QUNA 1SMDA 4RW3A 2X12A 3EYFA 3P3BA 4P8WA 1BQHA 1HKWA 5I82A 3VXUA 3CAQA 4PRWA 2ADAA 4H7VA 2NZLA 2BSEA 1AFSA 1YY9D 4F7PB 2GQHA 1A6UL 1ITCA 5HJXA 1XH3A 3WN6A 2R1MA 3NR0A 2QJGA 4PFHA 3FO2A 3GSUB 2O6DA 4ZCWA 3TVMD 2YAEA 5DLCA 4RGMC 4PJCF 3VA8A 4JG1H 5DQJB 3ZHNA 4H88H 3DC8A 3RCNA 3RPBA 1H6TA 3TLQA 4CEUC 1OF2B 1ADSA 2XNAB 4PJGE 3VXSA 5DJYB 4JRWA 1JZ2A 1YEFL 4PV8B 4JFEB 1Q4WA 2Q09A 1H3WM 1AZNA 1QFOA 4K9EC 5LHDA 3K6SA 1DHPA 2H2PD 2Q9OA 4ORIA 4ZBCA 4U1KB 4WTZG 5ENWB 2OULB 4PG9A 5F7DB 2OWWA 1FDJA 1MHHA 4R6UA 3DVIA 1GZJA 4L29B 5DI8B 1XRTA 3FYEB 2IG2L 3VWKA 3HE6B 4F7EB 2L7UA 3QJSB 3S34L 4GJTB 3K2IA 5FSDC 4HZ7A 4KTYA 1JNNL 1NELA 3FA5A 4ICWA 3MNWA 1KTKE 1AKJD 2WBJC 3CVIL 4C6IA 3EO9L 7ENLA 1QFUH 2C9XA 1B5TA 4ERGA 3MBWA 4X4KA 1DSYA 2ZG2A 5DJZA 3G1RA 2YD2A 4XUYA 1AIFB 2AJUL 2D7PA 4EJ1C 2JJWA 2OL3L 1UROA 5FYJH 1TPUA 5C2GA 2UXTA 3IB4A 5MHBA 3MOQA 4TUKL 3SQMA 3N9RA 1NFDF 3P62A 1ID5I 3GNXA 5M94B 1EXHA 1EPVA 4Y5VA 3ARGC 1C08B 3N17A 3BCDA 1B31A 3UYCA 3D52A 3VTRA 4X6CA 1HEZA 4ZMLA 3KPMA 1H7XA 2VSDA 5IKCA 3TIEB 3N1AA 4PMRA 2YAQA 2XWEA 3DDGA 3L4UA 4IIHA 2Z31C 4ORGB 4Q4PA 3VE0A 2VR2A 1OTUD 5DQDL 2Q7YB 1V51A 1KM6A 4XMUA 3CT2A 1SVBA 4JRLA 4K8RL 4WEVX 4DZ8A 4KHXL 4C83B 1JYNA 4JPKL 2VCCA 1YNTF 1GS6X 3L1EA 1H11A 2QR0A 2EIMB 1WX0A 3V95A 1ZA6A 1H1ZA 1EUTA 3K6IA 4E3TA 5T5NF 3KPSA 1BFTA 4OOUA 1U8NB 2P7TB 3MJ9H 4MKMA 4OCYL 3SQBB 4PB9L 1HYSC 4YXKH 5HYSG 3GSRB 5I18H 2Z27A 1JGDA 1IQDB 3TA4D 3GS0A 1NU5A 3C2AH 4G8GB 4NZ5A 5L7XH 1HCVA 2NXHA 5KVFE 1GGYA 3WIHL 5HDQL 3D51A 3UOAB 2EQDA 1QPOA 4KBXA 2VDPH 1EWEA 1G6RB 2JQXA 2ZF9A 5HHOD 3RPIA 1IFGA 4JN2B 2W0FB 3DUUA 4KZDL 4EUPG 4LEEA 2OPJA 3THAA 1QWGA 3GMQB 3MA9L 4YHMH 5EN2A 5RUBA 4HJGA 3B8DA 3VXNA 1KNWA 3OKNA 4AAJA 3L2MA 3EOAA 2OR7A 1L5GA 1JI1A 3KDPB 1UXMA 2CHWA 3Q6GH 4KNQA 3VILA 4RGOL 2DWXA 3BZFB 3DKLA 1NAL1 3GMMA 4IOIA 4LUJA 4HS3A 1TWZA 4DJFA 4QJ1A 4HJ0C 1BGGA 3EEGA 2YDQA 3BKJL 3L2LA 3K0WA 3R0NA 3O6YX 3DGDA 4FQCH 3OOQA 2Z7YA 5JIPA 2ZKHL 1PDKA 3FHEA 3DARA 1JF6A 1VERA 3HVNA 3PWNB 3PUDA 3PUEA 2EPOA 1OT1A 2HVJB 1LEIB 4POUB 5A7EA 3OG2A 1B3IA 4FXGA 3EJZD 1IEBB 2GIXA 4JO3H 4X9YA 3SDXE 3WXWL 4OM1H 5J1TC 1RK5A 4ZQMA 5B1JA 4U1SA 2ZCKL 4ZOEA 5BOPA 2ADIA 1U1UA 2O5YL 1KJVA 3QJFB 3BKCL 3ARSA 4DJDC 4M93C 2BTMA 3FTWA 2VDLL 4TVCA 4X8JA 4M62H 1S7XB 4N2MA 5ETUA 3SDDD 1NANI 1GYNA 3LCXA 1QOXA 2A9DA 3GNNA 1C08A 1BW8A 3P9LB 3PBGA 3RJOA 5IB4A 4TSAL 4DF1A 4S3DA 4PWKA 1A1NB 4U6VH 4CLMA 1FZKB 2J7LA 2JKSA 4N8CL 4ZMXA 1Q0YH 1GS8A 1A3LH 3QG6B 4NO2B 4KX9A 5CIPA 1V7NH 4PJ7A 5EO9A 5DFVC 4ERSH 2DLFL 5EZIH 2NQLA 5IW6A 1ZA6B 4LCIL 4HUUA 4DP9X 4JXCA 5F71A 4GK8A 2IXUA 4HZ8A 4LASH 1UD8A 2ORBL 3W70A 4XKMA 4CCZA 3GSNH 3CVDA 4LRSA 1L6ZA 4FE9A 3MTWA 3UTSE 2X4PA 2FK9A 3MN8A 4FNLL 3OA3A 4S2CA 1CXHA 3V5FA 1HO1A 1LYXA 2JH2A 5B39G 5ABFB 2BRQA 3U82B 1AW2A 3T9PA 4J6RH 1GS7A 3P8JA 1N6QH 2P0IA 4F8XA 4AT6B 1NCOA 2ZKHH 5A3HA 1JVKA 4GEJA 3ZVVA 2HXUA 1FFOB 1XC6A 3RUBL 3WN5A 3DGGA 4F92B 4K1GA 3E96A 4WY7L 3R8BB 2Y61A 3W7NA 3GMPB 2O5YH 3X1BA 2SEBB 1JPST 1O5PA 4YDZA 4TS6A 3D12B 1TPB1 1ZP3A 4V2CB 3KYAA 5LXGH 1ZSDA 4JFHD 2WLLB 4POCA 4LU5H 4H0IA 2EC9U 3MSPA 4N9GA 5EZPA 3KOXA 4DO5A 3T3MB 4BH7B 3MY9A 3LKSA 5AZEH 4ZMZA 4XNXH 1K9TA 1KB3A 2O9TA 3QZPA 5C0CD 3DX3A 4G8GE 3PZIA 3B9KD 3MCKB 3VA6A 4ATWA 5IB3A 4JRYE 1KR0A 3GFXA 2NZIA 1JCYA 4X9SA 2YA1A 1GY1A 3AITA 1MCBA 1C12B 3RL1A 2E09A 3TTSA 5C07D 4GMSH 1CDYA 5DVKA 5JOPE 4B5VA 1PCKA 2X4TB 4HZLA 2XA8L 3IUHA 2ROXA 15C8L 3UAAA 4HEPA 3L9CA 3T2LA 3OHXB 4X5WB 1AA1B 4PB3A 4C6DA 4GG9A 2PURA 1X5MA 4NKOA 3WBEA 4V2BA 2J66A 2QCGA 1CR9L 4HZ1A 2CDGA 3G5VA 3PNWB 3QHFH 1Q9OA 3SN6N 1G4MA 4BUHA 1LJYA 2OZ0A 3DXAD 3RJDA 4N8VA 5D72L 1KTJA 3NPUA 3GHBL 5FF6B 2WUBL 3S4SB 1EP1A 5JIQA 3JQOB 4N28A 4WI8A 4PJAB 4F1SA 4APQA 4PCNA 1A9BA 4GW5A 3EJUA 3V9CA 4ZX6A 2ZADA 3PUOA 4QG9A 1NFAA 2B0SH 2OA9A 4WHCA 4L0ZA 3LRLA 5KITA 2VXQA 4B92A 5CGTA 3U7AA 2RCSL 5KOMC 3SN4A 4OZHF 3KNBA 1S3HA 3IMVA 3VI3B 5T5FA 4Z9KB 1J1PH 1JRHH 4M61B 2J7BA 2IWKA 3U4FA 1WAAA 4V1DE 4FLQA 1Y6KR 4NQSB 4P4RB 4AC1X 4GUPA 2CO3A 1SGKA 3STBA 1INQA 3QWRD 1VPXA 4YNGA 4JTJA 1FFOA 3W7LA 2JIXD 3V4PA 3VI4F 5ENWA 3P73A 3CWGA 4IKNA 3G9AB 3L1FA 2ROYA 3ROLB 1GQJA 2VXSL 2HXTA 4G6CA 1L6PA 2AKRB 4ZW3A 3AS2A 3GXNA 3ARFC 4R7DA 1NUFA 1HZYA 1K8YA 3EB2A 4Y9OA 2FBJH 3B3IA 1DANT 4QHLB 5B38B 1PKQB 2VXTH 1I8UA 1E4KA 1XVSA 4CNIB 1FO0B 1QI3A 3ZE2F 1JYXA 1OZMA 1BM3H 1YPXA 4NQ1A 5DSCB 5GS1B 1C8XA 5CCHE 1ZHBB 2ZQ0A 3JW7A 2F7QA 4NO0D 1MPAH 5G1TA 4PU2A 4U0QB 2YW3A 4ORMA 2XETA 2FGBA 3OPZL 4FEIA 4F7PA 4L3CB 4M29A 4JHBA 3CU2A 4K7YA 4AGLA 1MRDH 2YEQA 3MJ8A 2YFNA 4X8XA 2PPGA 2J13A 2ZXEB 5LKNA 1E8ZA 4AEFA 3ALFA 3KFTA 1PZCA 4WTZA 3B2PA 4HGXA 5GNYA 4DYEA 5FWQA 2X2YA 4DGVH 2DGAA 1J8HB 5D5ME 4PMVA 3T9WA 4TO8A 4GRWF 1WVZA 4Z77A 3ZE0B 1Z3GH 5KSBB 2CK0L 1MNUL 4NAQA 4F0SA 2FH6A 2C3WA 4P59L 5C0DB 4YHEA 1LF1A 3TJXA 5EOQL 3MJ6A 3Q1EA 3F58H 3N2JA 3WTUA 2ARWA 4L5ZA 4OU1A 3WOVA 4ZAKC 3L4CA 3H7VA 2WAGA 3EJQA 4P8XA 1NDYA 4C90A 2ZYIA 2IDTA 3OXSB 2CW6A 2YAOA 2Y63A 3WFDL 1WWAX 3SDCC 1ISXA 3TFXA 4ETYA 2MTPA 3B0VC 4V1YA 2HJFA 1H7WA 4KESA 1G6RL 4YLQT 3K5SA 2CGYA 4GXUN 4NLHA 4JFFD 2I5YH 4P2CG 3G7TA 2CLRB 5HPOA 4GO6B 2YPVH 1WCBA 2YZ8A 4NYLA 4ZUSB 2NX5D 4XNYH 3ES8A 1EYEA 2WXDM 4QG8A 1R5WB 5EIQA 4TTGA 3LQAH 2WNZA 2ATSA 2VL4A 3O0RH 3L67A 5E0CA 3DIVA 3PTMA 4O19A 3E9TA 3KS6A 5I03A 1MHPL 3TA9A 1AS7A 4JY5H 2NCMA 5F3HA 3VI3A 1QI0A 3U9WA 3VKAA 2W5FA 4Z78B 1GK8A 3OHXC 3S96A 4OCWL 4NJ9H 4KXZH 4R5XA 3I3BA 4YNYB 3HPFA 3QORD 5JIWA 3GEWB 4JBSA 4UDTA 2G60L 4OZHB 2XCMC 2MNJB 4YSUA 5I1LA 3AXIA 4NRXB 2H3DA 3SE4C 1P1ZB 2PTZA 3PDOA 1DWJM 3EHBC 3GLEA 1UZ8A 3ILQC 5JMRA 3PTDA 5FAGA 5EO1A 3ZMNA 1X39A 2WXPA 1JMZA 1DVFC 3RP1A 2AGTA 1QPRA 4V11A 5I0XA 3LCIA 1EEYB 1RHCA 4P59H 4UCGA 2Q8BL 4AU0A 1BXNA 2WBGA 1FE8H 1TPXB 4FNSA 5D8JL 1UJPA 4MVBD 2RGSA 4KX8A 1EH9A 2OOFA 3NCYP 5CEXA 2CLOA 1ONQA 4JY8A 4AQ8A 1DLHA 3REWA 2KYIA 3SDXB 5HDBB 3ZMEA 1BVZA 1EGJH 3LQAL 4NRSA 1YBQB 4MLJA 1NCAH 5KWYC 3KLHD 1R2SA 2I60H 5JW4Q 4PUDA 2YLAA 1KENH 3REQA 1AQHA 1AXTH 5E08L 2PTVA 3CFDA 2XFRA 2ZYHA 4XPGL 3QMSA 3HZVB 5AC8A 2G5BB 2QVFB 3D8MA 2R2HA 2VB5A 3T3PB 4TUUA 4FYRA 4ODUB 1TUPA 4YHNB 2YGYA 4UC5A 1BHGA 3MRHA 1I1RA 2PPFA 2WQWA 1H6FA 4P2VA 4MQ7A 2PI6A 4JQ1A 4LY8A 1WG3A 3D0LA 4N2LA 3OVGA 2XXGA 1AUSL 3DSNA 2JI3A 4XNZC 1QFWM 3WX7A 1MW3A 4WHYG 1D5XB 1EDQA 2W5PA 2OW6A 2PXYC 4IBQA 1CEOA 3BLOA 1OGTA 3S3PA 4NC1C 1TQCB 1GW0A 3UABA 3FYOA 1GYAA 4CVXB 1PTZA 4HK0A 1FAIH 2R2BB 5H94B 2YDAA 3MV7A 3R4IA 4RIRA 5CLZA 1WBYA 1G7VA 4RNHA 3ESVF 4FA3A 1Z0NA 3SIZA 3GFZA 4UFIA 2F53B 2NWRA 1FWTA 1GJIA 5IM51 1BD2D 4MXVE 4OFYA 5KSUA 3V0DA 2Q7AA 3TEVA 4Z2GA 1QYGL 4K7VA 1G7MA 3SGKA 4D8PA 3I68A 3ENEA 1UD3A 4UQIM 5IXEA 4XP6H 3WY2A 2A6JB 1V5XA 1KRCC 2NOYA 1A47A 3EFFB 1K2DB 1HNFA 5FGSA 4B5EA 2JGQA 4H9YA 4Q22A 2Y69B 2E76C 4AM0Q 1DJQA 3WJMA 3V18A 5E6IC 1LP9E 4XKYB 2V8LA 3VXRA 5KYWA 3KZ8A 1AC0A 4EF8A 3BW4A 1C8YA 2X1QA 1VKFA 3GYEA 1XLBA 4OJYA 4NN6B 3VRLF 1EHLL 1ZQ5A 4KS0A 4RZBA 4Z18A 1VBGA 1A64A 2O6FA 1MCLA 3G08B 4NM8L 4NZTH 4PREA 4ETQB 1VFTA 3TTEA 3D6GA 3EOBA 4TVPD 3ZE2E 3K4ZA 4H5SB 2F54B 5C0GA 2F6KA 1R3HB 3LCLA 1ZTVA 1S7VA 3VQ1C 3HG1B 1L6SA 1CS6A 4ZODA 4CC4A 5GRJL 5D2NA 5CPQA 1V6VA 2HCVA 5KSAD 4I9AA 3NSMA 2K6WA 5AAWA 3D05A 5FLUA 4X6FB 4M6ML 2J73A 4TULH 5I73C 1HIZA 5H2BB 2QAPA 3NJXA 2JEPA 1S5NA 3TBSB 2ICEA 1JUFB 1YLBB 2YIHA 5AVXB 4LNCA 2XWDA 1O7VA 2PCPB 4XNXL 2PDIA 4CSZA 5C0CA 5D03A 3V10A 1I1WA 3SYPA 3W0WA 3MJ9A 4MFEA 2ZRXA 2ZUSA 4QCFA 3BG3A 1PDZA 2WN3A 1WIPA 3CV5A 4U6XA 4O8AA 5HVHC 4D1IA 4WI5A 4WI4A 1HDMB 1MFEH 1YNTA 5AQ0A 4G6FB 5E6ZA 3L3DB 4PVBA 3RE0A 4NL1A 1VR6A 4AX6A 4K8RD 2IH8A 4N6RA 4DZHA 1ZT7B 5F3FA 1X5HA 3TYBA 3NM3A 4XZBA 5FYKD 4PRHD 5IW1B 2CHXA 5AB3A 4LSBA 4HQQL 1MKFA 4Y4FA 4ES8A 5LGZA 1RPQA 1AODA 4ONHB 1JCMP 3ZSSA 2I16A 1AE6L 3L5XH 5F7DA 2OSWA 2OR2A 4WJEA 3I9AA 4PYSA 4OLVL 3CMGA 4YDIH 5LXEA 1OAXL 4UF7C 4PC8A 1ZGLM 1EJTC 3SDDB 3U1QA 3BYTA 4HK0B 3HQNA 4WKZB 1FJ1A 4QPEA 2D4DA 1WGOA 3RHWF 1E9OA 2XZCL 4W86A 4YBLC 3P40A 1PIGA 4J6RL 3R0KA 4LU0A 4X6BA 2WKLA 3V5DB 1OYCA 3ECBB 2ZWNA 3V1PA 1S38A 4G6FD 2VFIA 1ZHKA 2EDJA 3AREC 2R4RH 2I27N 1KN2L 1TU2A 1TZ7A 4Q8QA 2F6AA 4YAQB 4Z76B 3AQZA 1I2QA 4PRIE 2DSWA 3GRWL 5EB9A 2F1AA 2WOQA 3VAEA 3VXRB 1YEEL 3AREA 4O15A 4ADSA 4XHQA 3TPUA 2H90A 2Y2WA 4ATTA 5C9ZA 4MKTA 2VC5A 3UY8A 4YDVA 1YDYA 4ADUA 1E72M 4WY7H 1AP2A 3G6JE 3ZLHA 1FRGH 5B7ZA 3O16A 1I9JL 1L0YA 1LO5B 4UTAL 3CYJA 1C5CH 2PO6C 4ALAC 2PLJA 4NP7A 2B4CL 3UU0A 4RJEA 4K68A 3H9ZA 3OODA 1N2VA 4JZJA 2E9BA 4HALA 4WO4B 2H6PB 4PCKA 1N0XH 2O7QA 3BOFA 4XCFH 4KI5C 4YIQA 5FJPA 4JIRA 1C93A 2CK2A 2B1OA 2BWDA 2XVNA 3TA3D 3TQ0A 4FLOA 1D5ZB 2C18A 1AZVA 3MZGB 5KSVB 1PKOA 5JPMA 2Q76A 3FQUB 4W9IC 3O15A 3O7UA 4YIWA 3A13A 4JYDA 2OMNA 1SHSA 3G1SA 4HTBA 3SDYL 3EYSL 4KRTA 4UFMA 2CIPA 1AKPA 3WQPA 4OIFA 4GGBA 2JELL 3MUCA 4L6HA 1YUHB 3H8NA 1KYUA 2D2OA 4ANXA 2W61A 2YYTA 4PJIF 2NY3B 1IM9B 4F7CA 1G7QB 4N2BA 4OF3A 4JFDE 2VGIA 1T21B 3UP1A 5CSGA 3ULUF 1QNZH 1SVZA 3MB9A 1XF5B 2APXA 4PV1C 2A7PA 1GSMA 3AIBA 1SY6A 3QBUA 1NMAH 4NJAH 5A6TC 3FO1A 6FABL 1QPPA 4Z7NE 4HCFA 3MYPA 1L5GB 4Z23A 5CJNA 2JF6A 3NQKA 2DW6A 1GQNA 2WYSA 3N2CA 1G7PA 2EXWC 2OSLB 1ZE3H 3L4ZA 4P06A 3GG8A 2OMTB 3R4DA 1P5UB 1GCFA 1E0TA 2UY5A 2CHDA 1GCYA 3MV8E 1U3HB 3B6SB 3DOSA 3GNPA 2APSA 3K7UA 3NJGA 1BPVA 1VRDA 1TO4A 1XXXA 1URZA 2FL5B 5CEZD 1QRKA 4YGVA 5FL1A 4JEQA 1YEDB 1CFQA 2VP8A 4MWAA 4AB4A 1J5HA 3W11D 1YIXA 2NQHA 3V5DA 1YNYA 5HYJA 3S5ZA 3WYRA 1YNLH 2DIKA 4KIEA 4A6GA 2ZOOA 1CLYH 1LBFA 5ADOH 4S1FA 1MFUA 1UOWA 4Y1TA 4BQCA 3RWCA 3VSVA 5I1LB 4PD4J 3WFHA 3W07A 5BWAA 3FQ2A 3MLZL 3VXGA 3A9IA 2W62A 1TYJA 4BE6A 2XWJB 2Z0IA 4TXEA 2CO4A 5CZVH 3RJXA 5C0DA 5D05A 4FZEL 4BZ2A 4CBZA 4IMKC 3VGEA 5HNRA 4G8FB 5TAOA 1YEKH 3LX9A 1IGYB 4WGVB 5EZOL 4GXWA 1BZ8A 4KHXH 3BPNB 4R26H 2A2QT 3LCFA 3IJDA 5M1TA 4RZ5A 3DO3A 3FZUD 3W0KA 1HQTA 3FH5A 5EEUA 1OAKL 3QEQD 2HBXA 2NTFA 3D46A 3GBMH 4UUJB 3TH6A 1LNUA 1PSKL 3G6AA 3MZTA 3NZSA 5JHDD 2EEAA 3VI2A 2KBGA 5J12C 3UZ5A 1NFIB 3HFFA 3BVNB 5E8PB 5HMSA 5EDSA 3OMZA 1NCDH 2WLIA 2B3IA 3MUGB 1J5SA 2V2DA 1F86A 3FCTA 3BE7A 3LQGA 4AQEB 3K8KA 3OKYA 3IVSA 2NY2B 4EVNA 5E8EA 3O3DA 3JRKA 3QPXL 4U1HA 3D30A 5K9CA 1IX2A 2OMUB 4PJBE 5I71B 2VM4A 5HI5C 1U5HA 4BF5A 1PNCA 2LW3A 1JCLA 4QAIA 1J9YA 1PNDA 1U8CA 3MRDB 3SE8H 1K7XA 4LUTA 3HE7B 1KXTB 3CFIC 3T05A 1ONWA 2ZXCA 3F7YB 4UWQB 3WH6A 4N3TA 2OMWB 4FQCL 3PFRA 4QTHB 3NZHH 3MLZH 5A2BA 2D31A 2BO0A 1WDRA 3NJMA 4ELDA 4LVNC 3SI9A 1CGVA 4P2RA 1PZAA 1CLYL 3UADA 1TZGL 3VCLB 4D0CA 4QLRA 5LJYH 1LRNA 3O6ML 5KVMC 3O0FA 1S9XA 3VCNA 3V8OA 2Z2UA 5GIRB 3U1PA 3W7MA 3I6KA 5CH9A 2IAND 1J8RA 1JCTA 1FWAC 5DRNB 1I8IB 2OZ4H 4PGDB 5DVPA 1N0LA 5DA0B 4R3UA 3KHDA 4G7QB 4N2CA 3TO2B 1CFQB 1RSFA 5DMGD 1FNSH 2H32A 1CFVL 4U1LB 3CH9A 2FL5A 3L4WA 1H0DB 3RDTB 3EPOA 3WLMA 3WLWD 4RE4A 5MENE 2VXSH 2BBFA 4JOMA 4L8BA 3T8XA 4B53A 2K0RA 4O13A 4QROA 4S0HA 2GUYA 3TNNB 2P5ED 3WUWA 2IALA 1AY1L 4OD1L 3WEAA 3ZJKA 4LYKA 5D9SB 2V2TB 2ZZ6A 4NF7A 4ATLA 1YHPA 4JM4H 2XNAA 3VSUA 3R06A 2DBLL 1JRBA 1IBGH 3BD3A 3U7BA 1FE8L 2B7DT 4FCAA 5D8JH 3LGDA 2Y89A 4YBQC 4I7UA 4W9CC 1X5GA 1UENA 4IRJC 4ZMYA 3AB0C 1HHIA 1GVSA 1AKJB 2LLNA 5LWYH 3B05A 3OIXA 4H13C 1SW7A 1PG7H 4XP5L 4NP4L 2RHGA 3MRMA 1EK3A 3URQA 3S4SA 1DTNA 1XGQA 2MQ0A 1IQDA 5FYKH 5G5DB 4B3LA 2TSAA 1KCSL 3HG0A 4D2NA 3UNTA 3QZWG 3D69B 1DQVA 1F05A 1PEZA 3DIFB 2FO4A 4WW2F 1QASA 4DN4H 2YD4A 2XUCA 3A67L 4QUOA 2AQSA 3APTA 1A49A 2XYCA 4TR9A 3N4FA 5BQDA 2VABB 4NN6C 3EYOB 1HVXA 2ZZ2A 4GAYA 2BSLA 2VMJA 2G3ZA 4HPOH 1LWJA 4NQUA 5CZXC 5I02A 4ELMA 3PF3A 1K2DA 4BQ4A 3FQWB 2E8YA 1UZHA 2C15A 2YUVA 3U7WH 3EDFA 5D2XA 3T71A 1MAKA 3V75A 1TZIA 3ZTNH 1BQ5A 4X80H 4U4IA 3V4VL 4Q4EA 1M7DA 5DRZB 5IKCB 2HT3C 3L5AA 3BD5A 4MD4A 4O02L 3VO0A 3IIOA 1FKXA 1P6BA 3LTYA 4LNRB 3V6ZB 2WMIA 4FI7A 5CJOH 5A69A 1BIIB 3PL6C 2C13A 4WSHA 4TQIA 4AQZA 4URIA 2BK8A 2Z1KA 4FQIL 5GIRA 3ZMRA 1AFVH 4DEWA 2I9LA 4MWAD 1HP5A 3BKMH 4R7VA 5IW3A 1XRSA 4JAMA 1UWXH 3ARFA 4OLWH 3GMPA 3N40P 2NNFA 1S7TA 2L3BA 5DELA 2PP9A 4WNQA 4LCIH 3A9BA 1GGBL 3LNHA 3I9GL 5L4IA 4XP5H 2AEIT 4GRLC 3GLDA 1EF2A 3SE9H 5FD0A 4KTEH 4AG0A 2XN2A 1B9KA 3KDMB 4BFEA 1EAQA 2UUDH 3G5YB 5TD4A 1IFHH 1S2VA 3EA1A 3QFWA 5F1UA 2ZZ3A 1Q6EA 5IB1B 5CD5D 2ICES 3CLWA 1MUCA 5D9SA 1LL7A 2B8OT 3MCOA 4YL9A 1OD9A 4WV1B 2B4GA 1QW7A 3QF0A 2QCHA 2ZE3A 1DO6A 2OJZL 3WIFA 1RUMH 1Z66A 1ZT7A 4HIHB 5JXAL 2FSDA 3S5LA 3FT0A 5D93C 1WIOA 5BO0D 3CYVA 4L1HA 3X1NA 1W1IE 1CD0A 4Z7UE 4FD0A 5F2FA 4HDIA 2AXGB 1FX6A 1WKDA 5AOUA 3LKRB 3BJFA 2H6OA 1WHPA 2JKIS 4FXKB 3VG9B 5JIMA 1F4YH 1BYAA 3CZ8A 32C2A 4CC1A 4ZSUA 3DA0A 3IJEB 3TZVA 3PU7A 4XPBL 1NQKA 3FTSA 3VZZA 5AB2A 5TE6H 4KU1A 1N2RB 4MRBA 1KFBA 2CBMA 1KCLA 2BC4B 2X4NA 3ZL2A 3ME0B 4XG1A 3QE5A 2K7QA 4RFEB 2P46B 1BQSA 1NGPH 3FT1A 4PCFA 2Z3FA 2NX3A 5U4NA 5LYRA 1ZHNB 3PJSB 4XVSL 3OYXA 2C26A 3RMJA 2G4EA 2VZUA 3H8AA 2C3XA 3VNYA 3KHJA 3RWIB 1CNVA 4U1SB 5I1JH 3Q5OA 5IWLA 4NHUB 4LVBA 3NFNB 4KRNA 4OZIB 3AIVA 2RKXA 5C09A 4DNHA 1G7LB 2GJJA 1S9YA 3V4BA 3IJHB 5CJ8A 3SCMB 3WO4C 3HV8A 1A1OB 3PZUA 3MJGX 1OKEA 4RDQF 2A74C 4X7EC 2IH1B 4NQXA 4KZEH 1FY6A 2V5JA 4WIWA 3M1BA 4S10A 1TKWA 1LDSA 2VLRE 2NW2A 4L3AA 4DTGL 5I66A 1BGXL 1JZHA 4JKKA 5EUOE 3LBMA 5FEWA 3QV9A 4EBQL 3HB3B 3NYDA 4OTXL 5IFPA 3BIKA 3OKLA 4QO1A 4U1GC 4KVNL 4DT2A 3QARA 1PKLA 4OV4A 1OQXA 5D7LA 1GOIA 2O7SA 3O3BA 3KGUA 2CU0A 4UCFA 3VB8A 1E43A 3WTSA 2JMRA 2QPSA 3OJVC 1BV8A 2OVLA 4WAFA 3FDKA 2OU4A 1AO7D 3THQA 3Q06A 3SBQA 4OJDH 3UACA 4H1LG 4U05A 2DYPA 2OX5B 1FWWA 2I14A 4UFHA 1W17A 4WKHA 1EZSA 1W16A 3QC3A 4GS7C 4MM1A 1Q7ZA 2FE0A 3DFNA 1KELL 1H7RA 4W9JC 2PFHA 1D5MA 3ARBC 5FECA 4P3DB 4DXKA 1D6EB 4TTUA 2CBQA 2F9BT 2WZHA 2F6XA 4BZ2H 4RZ4A 2FRGP 5L0QC 1HGYA 1YE6A 3VFGL 4LPYA 4OQ1A 4R97B 3WLJA 2OYLA 1U8MB 1RAMA 4Q9RH 4KI5F 4ODVL 5FFOA 3ZR6A 4IFOA 3IJ7A 3DJ9A 3DI2B 3F7QA 5IROA 1SRDA 5CEZH 1VHNA 2BG5A 2CBUA 3SBWC 3CZFB 1UQZA 2YDSA 4MKVA 1YYMH 4PMNA 2X2IA 3IWVA 2V68A 1Q9LB 3EEZA 4PS4H 2VUKA 3UF9A 5A6BD 1YRKA 1UCTA 2YSSA 1L7IH 1RKRA 4XZ4A 4OTXH 1AFVL 4YFDB 5C0JB 1DKWA 3WMSA 4HKZA 1R9ZA 4MD0A 1WWCA 1NBVL 3V5KA 2QFRA 4P2OD 2Q8XA 5D9PA 2LU5A 3VFNB 3QIBB 1F6KA 1IL1B 1DFBL 4R5TA 3ULVC 3MS8A 4JS7A 2CAKA 2QJIA 1MFCH 2WXNA 2WZIA 3BGGA 4J4PA 5D1ZA 3WQ4A 4BE5A 3CUXA 3GGWA 3DHFA 4GY1A 4JFXB 4PMDA 3KEHA 1FF5A 1NUNB 3TH2T 4FXGC 1OADA 1AYOA 3Q2CA 5LO7A 4UOQA 1AQ0A 2PLMA 1CFSA 2XV3A 4JZOA 4P8VA 4JHWL 1A6ZA 2PGEA 2PR4H 2BP8B 2WO4A 3UETA 1HHHB 2F08A 5CBJA 2K8QA 5E4EB 3CUHA 4DELA 5CHNB 4QT5A 4JPIB 3O0LA 3DV6A 1TX2A 3QDMB 4N8VB 5IFTA 4NUQA 3QZAA 4MAYA 3LB6D 1BBJA 3QBTB 4O2CB 1VDGA 3RILA 2C91A 3NM1A 3NIFB 1GJWA 4YO0B 4PW9A 5FM8A 2HFFB 4OD2B 1UA3A 2OXHB 1KW1A 1V79A 3S3SA 4UOW0 1ZB5A 4CCCA 4TIMA 2QEZA 2IPKB 3QDJB 4E8CA 3DROA 4O9HL 3P14A 2IALB 4ODTH 2ISVA 4DWSB 1DQJB 4AZHA 2OXGA 4ZENA 1J9RA 2VQ4A 5EU6B 3E74A 3IS4A 3WLRA 5JBEA 3CH8A 5ESQA 3FSWA 4JPVH 3SPCA 2GSIA 2YCJA 4MFDA 1M2VB 3MLYL 1WC7A 4GXFA 3DIPA 3U6WA 1D6EA 3GZ3A 3H3PH 4OQTH 3ATBA 1NKGA 4TLUA 4W9KC 4BFGA 1TA3A 1W9DM 4S2BA 2V3GA 3WLBA 3I9GH 4K3ZA 3IBEA 4EP8C 5I74C 4X8CA 4EOUA 5C0BE 1DUYB 1NY1A 4PGLA 4MJJA 5KOVC 3KD4A 3JV6A 4DVBB 3NTCH 2A7BA 1ID2A 4JQVA 4HSQA 4UT6A 1MFBH 3ARGB 2N3JA 1IE4A 3EXSA 3ULAB 1ZANL 2CQVA 3B9DA 3HI1B 4MCNA 3L4YA 4AF0B 2J55A 2E46A 2DQUL 5T3XE 3OEXA 5DTFB 3T0ED 3LQZA 3GSQA 2FTAA 3TX4A 4H3DA 4O1FA 2PYED 3X17A 5A2AA 5ICZA 3UXAA 3W9DB 3V0JA 4LQ1A 4HJJH 4YSEA 4I9XA 4KVCH 5JUVA 3BH9B 2W4XA 3NCJL 2ED7A 2DEPA 4H04A 4MYPA 5IQLA 3KZPA 4NXKA 1UR9A 2BVTA 3IJ9A 2DQHH 1B57A 5DT1H 4A2RA 3GKZA 2B15A 3ATDA 1M2OA 4AIUA 1URLA 4NDMB 5D6CA 2OLSA 3FW6A 3O45A 5JOEA 1A8JH 1T66D 2X9WA 5D7IE 2GYIA 1EJOL 2GITA 3QLLA 2PF0A 1A6AA 4HUUB 1XH1A 1LQSR 1QUNB 1SLUA 5EUOF 2X28A 5GRZA 4BK5A 1L4IA 1AH1A 1J2WA 1GOXA 2VOMA 3M4HA 4Y8FA 4NWTL 2BHUA 2QSCL 3ATZA 3S1WA 3M6DA 3GI8H 1ZLSL 3CM4A 2FYYB 2B7PA 4P2AA 5HDQH 1J05B 1QTSA 3P67A 4ODVH 5DUBA 4LSUH 1SYSA 2DZAA 2EKSB 2ISFA 3SCWA 4F80A 2IGFL 4OD2A 1OW0A 2Y7LA 4NQVB 3OC5A 4GMTH 4HGMA 4APXB 1V6UA 2F74B 2JCCB 3T4AA 1QOKA 2ID5A 4M1DH 1GW9A 2A85A 4PUUA 3W7HA 4D8LA 1CFTA 5AVUB 3A4JA 4O0QA 3QA3B 4DVOA 1OAZH 3ABXA 1QP1A 3HR5A 3ZW3A 5MEOB 1CN4A 5F8RC 2ZBTA 2DBLH 2A3AA 2Z29A 4ODSL 3NQ8A 4G6ML 1K5NB 2P8LB 4D72A 2YMOA 4RISL 4BY3A 3UMNA 1JNHB 3DX5A 4L5FL 2WB1A 1URIA 1W6TA 5EIIG 1NIAA 1EJXC 1CC3A 2XVGA 4M51A 5F70A 2PDNA 1IBGL 4JNMA 1F97A 1MVUA 1I7RA 5DS8A 1JWUA 3VNJA 2P5EB 3D9AL 1OALA 3V4LA 5HNTA 2VMEA 2IWFA 3V6BR 2N4IA 1XIJA 4OKVB 3RZWA 4JQVC 4MNGB 5G4NA 3RFZA 3QV8A 5A8OA 2P8MB 1S7TB 2PDXA 3BWAA 1LOSA 4NQCD 1NEZG 1EIXA 2WZ6A 2HTKD 5FFLA 3CL6A 4BFIA 1ME9A 4BR1A 1KTBA 4QM1A 2GHZA 2VDQH 5DN1A 2ZCLL 3QR0A 1SU5A 4EAEA 3QULA 4BZ1L 4EUPB 3SSGA 2PTWA 3FTXA 1E8WA 4HYRA 3CUJA 1TV2A 4BCYA 3TEWA 1NDGA 4XVJH 1OOWA 3RBSA 3LHWA 3UCCA 4ZMGA 2VMFA 3MBEB 4S3CA 1X7QA 5HJDA 3R7RA 1NH6A 1CXFA 3O6AA 5HGAA 1S9VA 1XKJA 1XF2B 5AECA 1TZOA 3NQFA 4O58H 5FDWB 2HZHA 1GY2A 2CKBL 1QSEE 1XIHA 2CHOA 1XIWA 4G9DB 4LASL 4LPUA 3O9WC 2Y5TA 1ZGLP 1IEXA 1ZLDA 2YBRB 1PBGA 2BGSA 1VGKB 2Q5BA 4L1BA 4I0PA 1W1B1 2A21A 3FO9B 1GT8A 3DSFH 2NY1D 5IQNA 3T09A 1XAKA 5EF1A 1PU0A 1ZCOA 3MSDA 2GUOA 4PJ8B 3V6OE 3X12A 1WDDA 4B5ZA 2WZ5A 2JKTM 4I2XB 2PRMA 4HIXL 4JKPH 1KZYA 4HPYL 3DNKA 1QPQA 3NQBA 1SSDA 1YQVH 4NO2A 1UFGA 4Y9BA 5EO9B 5IQ7H 3T0XA 3VNKA 1RZIA 1RQBA 2J7DA 1JS4A 3QUZA 4HH9B 4NPJA 5E4OA 2Y24A 3TBWA 3UO8B 5IT2L 4EI6B 3S5YA 1JZ6A 2V4LA 1OSEA 1A14H 1IM3D 3VXME 4PCYA 2WB5A 4DI9A 1KB5A 3ZX1A 1VZGA 2FEDD 5CC3A 4ZUVA 3DLQR 3KPQB 4KF1A 4HCGA 1HYRC 1YNLL 4ADGA 1RHHA 1IWBA 1VS1A 3PNUA 4O8RA 4WKZA 4BI5A 1DVSA 1JDDA 3MV01 5I1GH 2YBVA 4RNJA 4GJJA 4JIQA 4HX1B 3MRIB 3PGCA 3UYRL 1ZSHA 4PJ8D 4GH7B 3OD3A 3JVFC 3PB0A 2BY1A 4QKXB 5LDSA 4JZ5A 4HIIB 2OL3B 2JCCF 4N0UE 4P9HH 2NYKA 4HSHA 5EIIB 1F56A 1CZ8H 1T4KB 2VDPB 1N0LB 2WLJA 3CXDH 4PS4L 4R97C 5GPRA 3TYCA 4D8OA 4RNRA 3SDAB 5BS0A 1EQCA 2PS2A 4RDYA 2AJYH 4AEOA 2WINB 4LAQH 1P0KA 2Z7KA 3UC0L 3V4VH 1UJQA 1RULH 1XMWA 5CC7A 3OYZA 1MZHA 1I8LC 1HDMA 5L8LB 1IM3B 2VC9A 5BYWA 1RCYA 4R4FL 1US3A 2QHRH 4HBQA 5ADPL 2ZUMA 1RUPL 1VZIA 3VFWB 1R75A 4EDXA 4M6QA 2CCRA 3V6FA 3LRHA 1UB6B 1LQ2A 4GY7A 1RK0B 2QNEA 1O9VA 2YS4A 3ZL4L 4F2FA 4HPYH 1V3MA 2R0KH 3ZDYF 4AV4A 2O93L 4EACA 1T1YB 5LXXA 5LGJA 3ZJAA 1KCZA 4PJFA 5IBLC 4DJED 1BXVA 1IZJA 4LESA 4Z7VB 1SXSA 3NN8A 3QXWA 5TH2B 3HMWH 4X7TA 4GX9A 4A2MA 1BMGA 2V3EA 2WP3O 5D7KE 4L9DA 4GABA 3UH8A 4EZJA 1TTAA 1KA9F 1D7BA 2HT3D 3SRFA 2RFXB 4QHUB 4TNVK 3V4UL 1OAYH 1GGIH 2FWSA 4NC0B 4IM4A 3U6RA 3BP7A 2WSPA 1VEMA 4XCFL 1ZP4A 2VEGA 3ZM8A 1G7JB 4U7KA 5HHMB 1M6OB 1MCOL 3FO9A 2CMRL 1CGWA 4EX4A 3AY4A 3N0AA 4NZ4A 4JG5A 4L4VB 5DEFB 3YPIA 1MEXL 3CV2A 1H8LA 4IPJA 4UQCA 4KTDL 3NJKA 1E3FA 2BP0A 2J1ZA 1G1CA 2R29A 4G3YH 3ES7A 3ZZQA 3KRZA 3H9SD 4R4FH 43CAA 5HGDB 2ERJC 2FGLA 3UZJA 2XISA 1HSBB 4GP4B 1CU4L 2OZNA 1E71M 5ECJE 1V77A 5DDHA 4ZQCA 2VDGA 4JJHA 3ILEA 1U1HA 3U0WL 1SOQA 1IGSA 2ZWKA 2VZTA 1OFRA 5G1YA 5CO1A 3K2GA 2VERA 1QI5A 3MREA 2VDPL 1B3YA 3L5LA 5HTSA 5ELIA 4EPKA 1JNLL 1TE6A 4UAHA 3UWYA 4HK7A 4HK3J 2X70B 2WWMD 3CZLA 1LE9A 2GABA 1EFXA 3ELFA 4OF5A 4O4YH 1DORA 4J9JA 2XZCH 1EQPA 2AKZA 4OZGF 3FQUA 4K71B 3AXHA 3TGXA 2R2CA 4KZEL 2GK2A 1S5HB 3ZQXA 1I1YA 1PXGA 4ESKA 4AUBA 4DETA 3FK4A 3BKJH 4L0YA 5LXVA 4AT6A 3BGAA 1RVGA 2WQSA 3CFDB 4D9LL 2KQMA 4G1MA 4ANKA 3JWDH 1ADOA 4E4UA 1YC7A 3N2OA 1GGUA 3EH3B 2FKPA 4P7OA 3TYAA 3BAWA 3HW7A 2A4EA 4XMPL 1VZHA 1OOAA 1P5UC 1BX2B 2Y5JA 3KDOA 1Q9WA 5C08E 5HSFA 4ASTA 2HX8A 4L8BB 3MRJA 4EIGB 1TQJA 3FCTB 1W1A1 4DN4L 5LIYX 2RALA 3R0DA 1FH8A 3GDMA 3P9MB 1DQMH 2QW5A 3BVXA 1FRBA 1FHUA 4PS8A 1PKYA 1R9FA 4NAEA 1IAKB 4XP6L 4LSUL 5JORB 4G8GD 3PWVB 4P23A 5D2LB 1FP9A 4G72B 4UTAA 4AUYA 3WH8A 2YAMA 3SCUA 3WKYA 4OLUL 5KSUB 4L1XA 3C2RA 1KPRA 4XPHH 3NA8A 2KZKA 2NY7L 3K71A 3B34A 5EOCJ 3OR7A 1KIUB 4H41A 3BAXA 3BMVA 2GIYA 4MSWA 3CPUA 1S3TC 4AVFA 5KANI 2GB2A </