1JRBA

The p56a mutant of lactococcus lactis dihydroorotate dehydrogenase a
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
311
structure length
311
Chain Sequence
b'MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLARYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dihydroorotate dehydrogenase A
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
total genus 112
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2001-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1jrbA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jrbA01
3C56A 3W1UA 2I9EA 3GR8A 4X9SA 1H61A 3BG3A 1B4KA 4FXSA 2VKZG 3WJYA 3W2MA 2CZFA 1IF2A 4UFIA 5LNUA 2RDWA 3G1VA 4O16A 2E68A 4AF0B 3GVGA 1HO1A 1AK5A 1IIHA 6TIMA 4XQ6A 1EB3A 3QQ0A 1CW2A 3M16A 4NZJA 1DKWA 4LVDA 3LCGA 2J9ZA 1WA3A 4M6PA 3AO0A 3O8AA 2QUUA 5C54A 3G3DA 4HN4A 1WX0A 4MPQA 4CCDA 4K38A 2NX3A 4I7WA 2QAFA 1LRQA 3NDOA 3LBCA 4GUIA 3LHVA 3E96A 1I4NA 3P61A 3OVQA 3TIMA 2QUTA 3IVSA 4POCA 1CX9A 2ZYFA 3P80A 2HS8A 3CWNA 3WK0A 4R33A 1ZNNA 3C2OA 3G1DA 2A21A 3LCXA 1W5NA 2C14A 1LBMA 4NX0A 2ATSA 5L6UA 4E0CA 4NT0A 4MY1A 3DBPA 1ZAIA 3F1QA 4BI6A 1UASA 4UFKA 1YDOA 4MUZA 2EAWA 4S2CA 1IGSA 3W87A 3JS3A 2PRMA 3I7RA 5D03A 2QDHA 4U4MA 4N6EA 1S5TA 1XDLA 2J88A 3FKRA 1FY6A 5CZ0A 1ZJIA 2B7NA 4FXRA 4TO8A 3TW7A 3BW2A 1UJPA 5FEXA 4RZ5A 2ZRZA 3QQ1A 5DCDA 3KRZA 3CIXA 1B4EA 1F5ZA 4RV8A 4LRSA 4MFDA 3FIGA 1R2RA 1XC4A 3NL3A 2CW6A 3W73A 4ORMA 1RV8A 1JCLA 2EHHA 4JTKA 3LHZA 4FX6M 3GDRA 5BMWA 1H63A 5AHFA 5KSWA 5HULA 4LRTA 3G0SA 1H7PA 1QO2A 3INPA 3VI2A 1TB3A 1YTDA 2ZA3A 1XUUA 1O4UA 3CIWA 3BK0A 3W7NA 1LROA 5HWJA 3W1MA 3NNTA 4JX5A 1K7XA 4LC6A 2X1RA 2QAPA 3GNNA 1M7OA 3KHJA 1HG3A 2GPTA 2ZRWA 1E51A 4AHOA 4GNJA 2VFEA 4QISA 3A22A 3RK8A 1P0NA 2XN2A 3QC3A 3E9AA 1KLYA 2QCDB 1LRTA 2DZVA 2DZSA 5A8GA 4MVAA 3UY7A 3PVFA 1Q6LA 2ZDRA 5F4SA 3FOKA 3QH2A 4GFSA 3M7WA 3ATZA 5H91A 1EUAA 3PBYA 2NWSA 4JIPA 3OIXA 4XUGA 5HR7A 5FEPA 1S3HA 3LRLA 1W31A 3T55A 4O57A 3W3OA 2QDGA 4LVGA 3O6CA 3UZ5A 1YADA 5AHIA 2WSQA 2C16A 4GWEA 4JGDA 5LGZA 2QJIA 1SFJA 3TQKA 1OVDA 1KFLA 2V2CA 1GVSA 3EWXA 4N9BA 1TPUA 4LVAA 3W1TA 3TV8A 5FEWA 2E6AA 1AW1A 3SJ3A 3CLMA 1LYXA 1T96A 4A2RA 3VNDA 1GT8A 1DOSA 4BWLC 2DJXA 5AN7A 3VKJA 3CB8A 1J5TA 2P1FA 5TQLA 3A5FA 1KM0A 1UUOA 5I3IA 3FFSA 3I7SA 1SO3A 1H62A 5KMYA 2CU0A 5DY3A 1NSJA 1SO5A 2VFFA 3LM7A 3LRKA 3TFCA 1QNVA 3N3MA 5LKYA 3ABOA 4JR5A 2NX9A 5CPLA 3MHUA 3PG9A 4Z08A 2Y88A 3WJZA 3ABRA 4NJHA 5TIMA 2QCLA 2YSWA 4PFMA 2PRLA 2UV8G 3QPZA 1EEPA 4YWIA 3EWWA 4FIRA 1LLZA 3HJZA 3PF3A 1TV7A 1IIGA 3V1PA 4IWWA 3S1VA 4O18A 2ZZ3A 3A9IA 2O7SA 4CCCA 4AWSA 2G5WA 1F7BA 4O13A 2Z2UA 2DU2A 1XBVA 3S5NA 4ALDA 3O63A 3E12A 2RKXA 1W5OA 3DFNA 1FDYA 3W1NA 4AF0A 2J24A 2QKFA 4MLRA 1DHPA 4K36A 3C52A 3N14A 3NQ2A 4JXCA 4UFMA 5K3VA 2C15A 2WPBA 3E49A 3S9YA 2QCMA 4LVBA 3EX1A 4MIMA 1JRBA 2GOUA 2OZ0A 4IMCA 2YR1A 5D32A 2BTMA 2CLMA 3EEGA 5G4WA 3UXAA 3W7DA 2Z0IA 3CWOX 3O06A 3W1QA 3G1YA 4AH7A 3W7KA 5I3KA 3MWAA 2HSAA 1C8VA 2QJGA 1R47A 4UC5A 4IJBA 3F4WA 4O10A 4XTDA 2G96A 5EL1A 1F6PA 1XCFA 2VXNA 4WY0F 1AG1O 3L9CA 3R2GA 4AXKA 5I3GA 1U83A 4BI5A 2YFOA 4LS1A 2VFIA 3N73A 4IMGA 4EVZA 1LZOA 3M43A 3LHTA 2ZRVA 1UCWA 3B0PA 1MEHA 5DXYA 4QQ3A 1JUBA 3TMQA 1TCDA 5F4WA 2Q8LA 3EKLA 1ZFJA 3LTSA 3LXCA 2XFWA 1ML1A 4JY8A 5F1VA 2AGKA 4Z1DA 4NXKA 1OHLA 4UUIA 3HGOA 4JTJA 2E6DA 3W6YA 5FF2A 3SGZA 5D2YA 1VRDA 3STFA 4CLMA 1FXQA 1X8FA 1TTJA 2ZTJA 3NQAA 1R46A 3TR2A 1F76A 3W83A 4Y90A 4AHPA 2R8WA 4AWUA 1VS1A 4RXFA 3UPWA 1P1XA 4JDYA 3NR0A 1OYAA 2A7PA 3IGXA 3W70A 1M6JA 1Z41A 2RDUA 3I65A 2QCCA 1W54A 1MSSA 3LV5A 1R2TA 1RZMA 1TPFA 3QMTA 5LSMA 2FDSA 3R12A 4WOQA 5ABTA 2V2HA 1D3HA 3IRDA 3KVMA 1SZGA 1TYGA 4K39A 3STGA 4FNRA 1WOBA 1EWEA 2O7QA 2YCEA 4Y96A 5K2ZA 4EIVA 2J9YA 3M5XA 4L4MA 4AVFA 2E6FA 2H8XA 1OFPA 3W75A 5HINA 3W84A 3PBVA 3NL6A 4WD0A 2ZZ1A 5G4EA 3GYEA 1H5YA 2DJLA 4TR9A 5F2LA 4FHAA 2NV1A 2RFGA 1PL9A 2R91A 3Q37A 2JGQA 4TU1A 4GXMA 1XFBA 4JD4A 2BXVA 1H7WA 1SZNA 2Y6ZA 2D73A 4CNNA 3TQ0A 2PCQA 4A21A 3UXDA 3NOEA 1W8SA 1SPQA 1TV8A 4MLJA 4OGZA 3L21A 4XBKA 4DPPA 3HGRA 1I2PA 5CSRA 2ATMA 2QJHA 3NQGA 3NAVA 3H54A 1QO5A 1KV5A 5DCEA 4ZVJA 4UNLA 4KFNA 1TQJA 1YLVA 3B04A 3DAQA 2NWRA 4WXYA 3FEMA 4K7VA 1SZFA 3ZS4A 2JKEA 1PCKA 1JR1A 3CTLA 2GJLA 2WSRA 3E0IA 5D2XA 1DV7A 2WQPA 2A1YA 4BFAA 3T4CA 1IXQA 4MZ8A 3L5AA 4A3UA 2E5BA 5E0KA 8TIMA 2OX1A 5CZJA 2E09A 2TRSA 1LOQA 3LLDA 4AEOA 3CPRA 4ZQOA 3LCLA 4U28A 4GUGA 5AB3A 4CQ8A 5HJLA 1O95A 3FJLA 1P4CA 2VFHA 1KM2A 2ZCGA 2IQTA 4CNOA 2YGYA 4M7TA 4Q4KA 3LI1A 3NQ6A 4ADTA 5AC8A 5K4XA 4KKXA 3QSRA 4KWWA 4LY8A 2NUXA 3T7VA 4LVFA 5L9FA 1W3NA 4UIOA 4PL1A 3MJYA 3M44A 5K9XA 2ZZ6A 3YPIA 3UWWA 1QAPA 3IIPA 5E1QA 3DGRA 1PIIA 3R8RA 3RLVA 4BF9A 4IOTA 5DY2A 4ADUA 4DF2A 3KRUA 4TMCA 4JYEA 3BG9A 3HGSA 1UUMA 4MJZA 3LCFA 5KZMA 1GYLA 3EXTA 1GTHA 2ZRUA 1RD5A 1LBLA 4IQLA 4UTJA 5LNSA 3LXAA 3UPBA 3W7RA 1IXOA 3QMSA 5G2WA 4LUIA 1OF8A 3THAA 4P61A 4JTLA 3MI3A 4O8RA 4ZQNA 4QJ1A 3C3NA 3SY5A 3DH7A 4UMAA 3TROA 1F6KA 5CKSA 1GQNA 1P0KA 1VJIA 4MY8A 3GAKA 3W71A 4Z1AA 4LOCA 4UFHA 1TPEA 1VHCA 3HIJA 1OYBA 3IVUA 1N8FA 5KZEA 4M5PA 1VQTA 3HG3A 5MHBA 1ZY9A 3PBUA 3LGEA 3TSMA 4WOZA 2ABBA 1G7VA 4GBUA 4O52A 3NQVA 1OX6A 1ICPA 3L5MA 1I2RA 2A4AA 1J2WA 1P5BA 3U6WA 4IMEA 1Q6RA 4BWLA 3GXNA 4A22A 3VCRA 1A5SA 4O12A 3P82A 3G1SA 1Z44A 1V7YA 4MZ1A 4UR8A 1ZCOA 2PURA 3QPYA 3NXFA 1YPIA 4IGHA 2JKAA 3FS2A 4N9CA 3M47A 4ZQRA 4O14A 1NFBA 1H50A 2F84A 4O54A 4JN6A 4N4PA 3UWUA 4JTUA 2Y7GA 3DI1A 5D2VA 5J5RA 2FPYA 3DHFA 3HF3A 3O1NA 3GXPA 3NPVA 2CLEA 5EKYA 1B9BA 5TBOA 3NGJA 1NF0A 2C1HA 2CLHA 4O4VA 2A7NA 3L67A 3N19B 5IBXC 1QOPA 1KM5A 4EF8A 4JYDA 3GZ3A 1T0OA 3ELFA 1BWKA 4K6AA 3TSBA 3LXBA 3IV3A 3O6DA 4CCEA 1VCGA 3LHUA 2RHGA 3BW4A 4QAIA 4DF0A 2V9DA 3QMRA 3NL2A 4UTLA 3B8DA 3S5ZA 2X1SA 2OJPA 1NAL1 1W5MA 3C2RA 3SZ8A 2FJKA 3ATYA 1OABA 3VE9A 3BGGA 1X6UA 1LOLA 5BNKA 1QPQA 4YCOA 1HUVA 1VPXA 5CG7A 3EKZA 4FNQA 4K8HA 4Z1BA 2EF9A 1TSIA 1JQXA 2ZA2A 3NA8A 4ZMGA 5C6MA 1KM1A 3W76A 3GX9A 5KITA 3JR2A 3NPXA 3C2FA 3S5OA 1Q6QA 3WJWA 1TPVA 2QEZA 5D2TA 4WZHA 2YYTA 1W1ZA 4RJEA 3QJAA 2JKPA 2ZZ7A 2V82A 1LLWA 4TMBA 2TMDA 3CT7A 2Q3OA 2Y7EA 5C2XA 1KBIA 3TU9A 4OT7A 1FWRA 3B0UX 1AL8A 4UTTA 2YPIA 1EWDA 4Z0JA 4DBEA 1H51A 3V75A 5HNRA 2J6XA 3KVLA 1SUXA 3NG3A 4ZZ9A 3NPWA 2C13A 3SR7A 6ALDA 4NXSA 1QPOA 1LTDA 1Z42A 3RU6A 3FKKA 4PODA 4MKNA 4LV4A 2CLLA 1XBYA 4HNUA 1KW1A 4L4LA 1VH7A 2CZEA 4LWWA 4S2BA 1KM3A 4MYAA 2EKCA 3HPSA 1HFBA 1I45A 3I6RA 5AHLA 4UXDA 1W5PA 3MMTA 1WBJA 1I2NA 1W5QA 4RZ4A 3BO9A 3LRMA 1YYAA 5KZDA 1EA0A 3MO7A 1DQWA 2JBMA 3QYQA 5K9CA 2YXGA 3S1XA 2B4GA 3U2OA 1I8JA 1A53A 3WK1A 3PS7A 3W7QA 3U8GA 5HQEA 1LM1A 1QMLA 5DBUA 4LV9A 3MYOA 3BGJA 2C0AA 3W1PA 4JIQA 1WOAA 3HBLA 5SWUA 3Q58A 1G4EA 4UNKA 2NXGA 2ZTKA 3CQ0A 4NJGA 3NQDA 2EGZA 1D9EA 2LLEA 4IMDA 3HG2A 3W22A 1LOSA 3CC1A 1YTEA 1QCWA 4O19A 2VENA 4C1LA 2CLKA 1Q6OA 1K7FA 3G3MA 2DP3A 1VCVA 4LU0A 3UY8A 1C9DA 2Y89A 2Q8ZA 2V5BA 1FWSA 2I14A 2ISSA 3M5YA 3EWYA 4PH6A 4DXVA 2GUUA 4IPJA 3G24A 3TJLA 3GKAA 1EP1A 1ZAHA 2V0TA 3R13A 4WQ6A 3ZWSA 2X30A 1LP6A 3KRSA 3F4NA 4K37A 2BSLA 2FTPA 3FLUA 4IXHA 1KM4A 1L6YA 1BKSA 3P60A 3TKFA 3PSWA 4O53A 4YL2A 2A6NA 1XI3A 4UMBA 1EP2A 1GVRA 3NZRA 3HPXA 2XN1A 3TK7A 1JUKA 1J4EA 2GVGA 4GRSA 4DELA 1X1OA 3RNDA 5E93A 4UTIA 3EWZA 3W7HA 5U4NA 1TPC1 1Y0EA 1JCXA 1H60A 5F2IA 3GDMA 4FX7A 1TPH1 2C6QA 4BK9A 2CFFA 4XTIA 3IIOA 2OT1A 3NQCA 3MP3A 1H1ZA 3P8IA 1GTEA 5H2ZA 1AMKA 3WJSA 3NZ1A 1UBSA 2KZHA 2NXIA 4OBTA 3PB2A 4WXZA 3UZJA 3W1XA 1KTCA 3P81A 3C0JA 4ICNA 2JGYA 1VC4A 1G6CA 1TPDA 2FPVA 4N02A 4UFLA 4HT3A 4OV4A 1VZWA 4NX5A 1VR6A 3W72A 3PUEA 1TO3A 4CQAA 2ISWA 3PG8A 3M0ZA 5DBTA 4HPXA 4Q32A 3IIXA 2ABAA 3DU0A 1G4PA 2OCZA 4P2VA 3TJXA 1YDNA 1FDZA 1M5WA 4KFOA 3TXVA 1L6SA 3W7CA 4YCPA 4XKYB 1H7NA 2QUVA 1TJPA 2J9XA 4H3DA 5DELA 3KAOA 4X2RA 4WY0B 2VEMA 1JCYA 1FCBA 1GG0A 1GVQA 4DBDA 1PVNA 2CZ5A 3HO8A 3W2NA 1DVJA 1MEIA 1KA9F 1TTPA 2NZLA 3G8RA 3LCHA 4FEZA 3T44A 4MZYA 3C2EA 4M6QA 3TC6A 3FJ6A 4MJMA 2GJNA 4OQVA 1FQ0A 3RLUA 3CHVA 1L2UA 4E2DA 4JS3A 1W3TA 1QFEA 3PM6A 2WJZA 1DL3A 2QCGA 3PBWA 3UD6A 2Y63A 3KOFA 3OEXA 3E02A 3S42A 3CEPA 5HWNA 3FA5A 4ONVA 5EA9A 1DJQA 4JTTA 4HHPA 3W2JA 4MY9A 3P84A 1BWLA 4O17A 1F2JA 4DQWA 3ZWTA 3TAKA 2H90A 4RZ6A 1DQXA 1VYSX 1VGAA 4JEQA 4OHQA 1OFBA 3MBFA 4A2SA 1GZGA 1XM3A 4ORIA 3SGUA 5D09A 2WSYA 5CGQA 5I3JA 4NUWA 2VELA 4UCGA 4JX6A 4PTNA 1GEQA 4RCXA 1FWTA 1RQEA 1A50A 3W7GA 3W86A 2ZZ2A 3GDKA 3NO5A 3EX4A 1GJPA 3N2XA 4M6VA 3B06A 3S5YA 3P7YA 4JDBA 4N9DA 1YTKA 3P8JA 4UTHA 1QPRA 3N2MA 1LBFA 2CLOA 4OU1A 4E38A 1GOXA 3P5YA 4LC8A 1RQHA 4UTUA 2Y70A 4O50A 1OFDA 1RQBA 1WV2A 3BVJA 3Q94A 4JTIA 4YLWA 1XBZA 3KVJA 3R5EA 3W1LA 4MYXA 3UWYA 2QR6A 4UTKA 4O1CA 1H7OA 3PC0A 3W23A 5AYZA 5IBXA 1QDSA 4JTHA 7TIMA 1SW3A 4I7VA 3CU2A 1ZENA 1X1ZA 3N9SA 4I7UA 3S6DA 1I2OA 1RPXA 1XUZA 2DZPA 3B03A 4NNAA 4FNUA 1U5JA 2W6RA 1EPXA 3TCEA 3IEBA 1IXNA 1THFD 2E77A 5G2HA 3OA3A 1KTBA 3LTPA 2BWGA 2R14A 3F03K 4J9JA 1SQ7A 3TUUA 4QNEA 3NEVA 3L0KA 4NVTA 2ZQ0A 2Y62A 3LHWA 4JNMA 1K3UA 4C1KA 4NNBA 3RMJA 2GVJA 4AB4A 3W9ZA 2OMAA 1N55A 1TPWA 4Y6GA 3G18A 2QF7A 1DORA 3DHDA 3LTYA 1ZHAA 3QSTA 4A29A 3HOJA 2YW4A 3JRKA 4WUIA 3TFXA 5CZTA 1PHQA 2X16A 3N9RA 2VOMA 3LX9A 1PHWA 1NEYA 3HMJG 3LOTA 3GAYA 3MI2A 5FF4A 1LCOA 3G1FA 4RR4A 3EWBX 3SECA 4O4WA 5D30A 4N2YA 3KFTA 4G1KA 1F05A 4O1DA 4PC8A 3BW3A 3BLEA 4FB7A 2Y85A 3NM1A 5CPOA 1K03A 4H6KA 4JTGA 5D02A 4YMZA 2Y7FA 1W3IA 3W1AA 2H8ZA 4IMFA 4HSOA 2B7PA 3OBKA 3LB0A 2E1DA 2Q3RA 3W2KA 3NQFA 4FNPA 4I9AA 1X7FA 4S1FA 3LDVA 1C29A 4PL2A 1XXXA 3ZFHA 3NVTA 2QCNA 4JY9A 1ME7A 4FNTA 1KLZA 4Q33A 5AHMA 1FBAA 1VCFA 2Y7DA 5CPMA 2H3DA 4AWTA 5G2IA 4O0ZA 1MXSA 3MW7A 5IM51 3W2UA 5AHNA 1OFQA 3ANYA 3SI9A 5FF7A 1LDCA 1OG0A 3HG4A 4Z0SA 3SW6A 1EX5A 2TPSA 4QITA 3UWQA 4EWND 1A5AA 2B7QA 2ZZ4A 4UMCA 1VYPX 3QFEA 1JRCA 3O6YX 1TTIA 2VEPA 4OWGA 5FF0A 4QM1A 5EY5A 1W0MA 2CLFA 4EF9A 5C55A 3UWZA 3LV6A 5AFDA 1G4TA 5D05A 3M9YA 4Z1CA 1ICQA 4M19A 3RFAA 4FX8A 2GVLA 4WX2A 1XDMA 4O15A 3W7PA 3NQ8A 4IPIA 4QNWA 4XKYA 5I3FA 4DO5A 1Z48A 3WK3A 1SO4A 2WOQA 4WY0A 2EPHA 2WO5A 4LUJA 3USBA 2Y61A 3HGJA 1S5VA 3A23A 3S0CA 1HTIA 3DXIA 2BLEA 1H7XA 5CPNA 1Q3NA 1XBXA 3NQEA 3MUXA 5LZLA 1T8XA 1A5CA 3IGUA 5KINA 2NUWA 1OX4B 3C8FA 1MZHA 1WDWA 2V2DA 1HO4A 2YFNA 2GQAA 1A5BA 2NXHA 4YXGA 4NQ1A 3GNDA 4IX0A 3QW4B 4NU7A 5HUOA 4AAJA 3MHFA 1DBTA 1FCQA 5D2WA 2QCFA 1WAUA 5LNVA 2Z1BA 3GXTA 1ME9A 3QW3A 4FIQA 3TA6A 5CZSA 1M7PA 3D0CA 1RR2A 3WK2A 1KFKA 4XZ9A 2DZTA 4KFPA 3GIYA 2FPTA 4N4QA 4O0KA 2ZRYA 2VFDA 4ZQMA 3TXZA 4HPJA 4TX9A 1N7KA 3W85A 4RKAA 4X22A 4R7JA 3OVPA 2F7FA 2RH9A 2WNZA 3BLFA 3P62A 3WJXA 5AC7A 3NQ7A 3VE7A 5AC6A 1FCVA 4RXGA 3KXQA 4PCFA 4JTSA 3TX9A 1D3GA 1KBJA 2PC4A 4QSHA 4WJEA 1JCJA 1OK4A 3M41A 2DORA 1O60A 3KVKA 4R34A 3G1HA 4UTWC 2QCHA 1EIXA 2NV2A 4K8EA 2E5CA 1FX6A 3P74A 5LHEA 4HNNA 3I7QA 4HSNA 1SZEA 4DO4A 3MYPA 1VLWA 2H6RA 1JCMP 1I2QA 4XWUA 5A5WA 5I3HA 4CQ9A 3LHYA 3EXRA 3PSVA 1F73A 4LNYA 1EUNA 1TV5A 1YXYA 4IXXA 2B0MA 2G97A 3O07A 1OJXA 1IXPA 1G67A 2AAMA 2FQIA 3GB6A 2HMCA 4JX4A 5HUPA 2PE4A 4BR1A 3H55A 5EMUA 3TMLA 2ZZ5A 2CLIA 4D2JA 3QF0A 3W7EA 3MHGA 1H1YA 5BOOA 4JTFA 3TE9A 2VEKA 5D37A 1VYRA 3R89A 3W7LA 3LCWA 4LS2A 3B0VC 2J27A 5C5YA 4EOUA 5U7SA 2FIQA 3SSJA 2NUYA 3M6YA 4HNTA 3L66A 4FO4A 3GK0A 2C19A 1XKYA 3EWUA 3MI6A 3A24A 3I68A 3TC7A 1PE1A 3W74A 3EX3A 4LT9A 4HKPA 1TMHA 3P67A 2YYUA 2PRHA 2A0NA 1FCUA 3G1AA 2C18A 5FI8A 3IIVA 4OV9A 4O1AA 3QEZA 1TQXA 1FXPA 4K7YA 2NLIA 3W88A 3TH6A 3LLFA 3TNOA 1K8ZA 5DLCA 1L9WA 2X1TA 3L2IA 3NYZA 3GDLA 3HQ1A 2E6YA 3TQVA 2HS6A 1BEUA 4NJKA 1ME8A 3QRHA 3PB0A 4KWVA 3LBMA 1YXCA 4E2BA 1KFEA 1Q45A 3FYPA 3B4UA 3G0UA 1TPB1 1UB3A 5EBUA 3L68A 1K8YA 1SSDA 3M5ZA 1WXJA 3DI0A 3GDTA 2E5DA 3O05A 4GUHA 3LERA 3THQA 5K9DA 3DFSA 2B7OA 1TIMA 1O94A 4FF7A 4OE7A 3DFOA 1K8XA 4JTEA 4NNCA 4JICA 4HNVA 5G1TA 2X1UA 1ICSA 4UFJA 2YW3A 3DFTA 1V5XA 1KV8A 1K7EA 1PS9A 2OT0A 4GJ1A 2ZFAA 1OFAA 3W07A 2CZDA 4PA8A 5DN1A 2A2IA 1JUEA 5CSSA 2FB3A 1FUYA 3T40A 1W56A 3CEUA 2X2GA 3O16A 1FWWA 5G1YA 4ZL1A 4MOZA 3A21A 3P5ZA 5BW6A 2TYSA 3IVTA 1RVGA 1AW5A 3UQNA 3PWAA 3LI0A 5F2GA 5HR6A 4GE8A 1KFJA 4AHQA 1OFOA 1SFLA 2WNNA 5EPDA 3STCA 4W9TA 4UTTC 1QOQA 1BTMA 1CI1A 1AW2A 2W79A 1SW0A 1QPNA 4MFEA 2W0UA 4FNSA 2Z6IA 1KTNA 1OX4A 3DFQA 3N34A 4O11A 2ZRXA 3T78A 3W1RA 4NJJA 3M5VA 4M7SA 3BV4A 2GQ8A 4LS0A 1YXDA 3NPUA 3FYOA 5LHFA 4GUFA 4H4IA 5HWMA 2C3ZA 1OF6A 1QWGA 1YDVA 2AQWA 3EX6A 3TAOA 1OX5A 1WBHA 1NVMA 4TIMA 4LTSA 4BI7A 1G7UA 5D04C 1KFCA 2XN0A 4LW7A 3O15A 1ZALA 2NX1A 2A85A 1YPFA 3MP5A 5AHEA 1JJKA 3IGSA 2DZUA 5GVJA 4AMAA 3UYCA 4HIBA 3CM4A 3AJXA 3NM3A 3L65A 3L0GA 3PUOA 3UWVA 3C61A 3W7OA 4Y8FA 1VLIA 2CWNA 3SFKA 1TJRA 5G5IA 5D38A 4DPQA 3UNDA 2A7RA 3TSDA 3G22A 5KTLA 3K30A 3PR2A 3PULA 1JVNA 1FWNA 1OK6A 3PY2A 5K7JA 1T99A 1SW7A 4IX2A 3PAJA 2R94A 4RLIA 1DJNA 2YDAA 5F4XA 4UR7A 2V5LA 1PV8A 2YX0A 3G0XA 2HTMA 4O28A 1MO0A 1ZAJA 4N6FA 3NQMA 1QR7A 3Q2DA 2WNQA 1SR9A 3DENA 1EP3A 4DEFA 3BLIA 1G4SA 5BMXA 1HL2A 1F74A 2JK2A 3GLCA 3EX2A 2G95A 2QCEA 2V8ZA 3RF9A 2QCDA 2VC6A 3DKLA 2WKJA 4DO6A 4DF1A 3IIZA 1TREA 3GKFA 3S1WA 5DXXA 1OFRA 3W7MA 1FDJA 3G1XA 5LGXA 3QZEA 3SIZA 3A5VA 1B57A 4GUJA 3M1ZA 3L0NA 5FESA 3VFLA 3C2VA 3L5LA 5AYYA 4N9EA 5EYWA 1W37A 1JQVA 3H53A 4R53A 3ABQA 4ML9A 1R2SA 3B05A 3BARA 4Y9AA 3BPWA 1XL9A 3HB9A 4B5NA 5HMSA 3W2LA 3TW6A 2A6LA 2V30A 1G69A 1O5XA 2RDTA 3GR7A 5J5DA 3OVRA 4ZQCA 4PEKA 3HG5A 3DZ1A 5LNWA 2A5HA 2ZBTA 1ONRA 2VFGA 5T26A 3BG5A 3C4UA 1K02A 4NJIA 5BRBA 2ZA1A 2FB2A 2V81A 1SSGA 3TDFA 3KX6A 5FEZA 3G8EA 1JCNA 3OG3A 1TRIA 5AYXA 1L6WA 5D33A 1AL7A 5F1UA 3S1UA 3STEA 2H3BA 1SU5A 1JULA 3DFPA 3EXSA 2TSYA 1S5WA 3MBDA 1GPWA 4UTMA 4NZFA 1MEWA 4IUOA 2DZWA 2FLIA 4RX0A 5AOUA 1ALDA 2VEIA 4ADSA 1R30A 3LCIA 1OFEA 1TRDA 2Z6JA 1PCWA 1LRNA 4XBSA 2P10A 2P0OA 1KFBA 3W7JA 3C6CA 1WQ5A 1NF7A 2BZNA 5FF3A 3WFAA 1GVOA 5DCBA 3ZR4A 1GVFA 3DKJA 2WV8A 4UTWA 3ABSA 1ADOA 3MP4A 4ZQPA 1OYCA 1KM6A 2DZXA 4O1BA 1TTQA 2YZRA 5F2MA 2BX7A 3W7IA 2GQ9A 3EB2A 1O5KA 2ALDA 4X3ZA 3HPZA 1GYNA 1LORA 3S8HA 1GWJA 1VHNA 4RK8A 2I1OA 4CNPA 3OHIA 4GC4A 1H7RA 3NL5A 1WYIA 1GG1A 2FFCA 4QIUA 3QM3A 3PUDA 5K4ZA 1SO6A 4JYFA 1B3OA 5LNRA 2ISVA
chains in the Genus database with same CATH superfamily
3W1UA 2I9EA 4O1EA 1QWKA 5JH1A 1CGYA 4FXSA 2VKZG 1WXZA 1H0IA 3TCSA 1IF2A 2Z1VA 1K4HA 4B4HA 2RDWA 4ZO9A 5E5CA 3MA8A 2A3EA 4QE5A 3GVGA 1HO1A 3CYVA 3L4VA 2PWEA 2R6OA 1EB3A 1EZWA 3W24A 5C2CA 1DKWA 1TJ2A 1WA3A 1CGXA 3O8AA 5LIYX 4HN4A 5FAGA 2NX3A 2QAFA 4GKLA 2QJMA 3C0QA 4GUIA 5FKYA 3AMLA 3LHVA 1H4PA 4LXFA 1I4NA 3S1GA 3DHUA 3U0HA 3P61A 3OVQA 1B3ZA 4KGJA 1DWIM 3P80A 1W17A 3WLNA 3MPGA 3CWNA 3WK0A 1KCXA 1ENUA 1ZNNA 3WMCA 3ZT7A 3ID7A 3G1DA 2A21A 1RCOB 1S3TC 2PDQA 1HGWA 5BWAA 2XTKA 4W87A 4NX0A 4NT0A 5TF0A 3DBPA 4ROPA 3F1QA 1Q4WA 2QDDA 2PGRA 1YDOA 4MUZA 3TTOA 2EAWA 3BMXA 1A3HA 3QY6A 4TVCA 5AY7A 3TC3A 1HKWA 4IIFA 5D03A 5I00A 4N6EA 3P0XA 5HQMA 2J88A 1ZJIA 1J0JA 3KBNA 1EHNA 3OLGA 4KEVA 3EB4A 3CIXA 2Z29A 3LS9A 1JAEA 1XC4A 2CW6A 1TA3B 3I10A 1ADSA 3EYPA 4ORMA 2EHHA 4JTKA 2QPUA 1O66A 2PDXA 4FX6M 2VR2A 1PDZA 2PUZA 4BJHA 4NZ1A 4IQEA 5LA2A 4GO9A 4QDPA 3U4AA 4GZIA 3AU2A 4XAFA 1E6XM 4IIEA 4D6HA 4JX5A 2VVSA 3GNNA 2ZRWA 2XGIA 3DYPA 4QISA 3A22A 4ECLA 1OG6A 3RRAA 4B9YA 2QCDB 3PZIA 2DZVA 2DZSA 2PFHA 3PTMA 3UY7A 1CXFA 3P2VA 3RRXA 3TJIA 3N15A 3K4AA 3VGBA 1PX4A 3RO8A 4NZ4A 3QLLA 2XFYA 4AG0A 3ATZA 4ZB2A 1EUAA 3PBYA 2NWSA 4Q4MA 1NOFA 2BB0A 2GSHA 4HNLA 3FA4A 2IKJA 3UZ5A 3M0LA 4GWEA 1DJYA 1JXKA 3AMKA 4XZNX 5LGZA 2EJ1A 1KFLA 2XVKA 4N9BA 3RR4A 1QATA 5M5DA 5FEWA 4BWLC 4DXKA 2Y8VA 3VKJA 3CB8A 1J5TA 4IFRA 1PPIA 4RZBA 4ES4A 3I7SA 1GVIA 5DY3A 3ES7A 4I9TA 4BHYA 4RE2A 2WPGA 3AMGA 4PUMA 1W1TA 4PEEA 1MW3A 1M01A 5GJPA 3M0KA 2PGFA 3EWCA 1S1RA 2Y88A 4NJHA 3W53A 4GYPC 3F7JA 1L2QA 1ODZA 2YSWA 2UV8G 1E4NA 4YWIA 1CBGA 4FIRA 3OHMB 1IWAA 5GJNA 1OGBA 1OCQA 3KL5A 1UC4A 2ZZ3A 2NT1A 2PDIA 1TUFA 4AWSA 1F7BA 4FP1A 2DU2A 4D6JA 3S5NA 1JZ6A 3O63A 1R86A 4B5VA 2PDYA 3DFNA 1TR1A 4J3XA 1V0MA 1ONXA 4MLRA 3W29A 1D7FA 2WSPA 4F0RA 2YA2A 3EX1A 1JRBA 4IMCA 1UOKA 2BTMA 2CLMA 3EEGA 2PDUA 4XKMA 5G4WA 3UXAA 5G4HC 1I60A 2Z0IA 4XAZA 1A80A 1C93A 3G1YA 3W7KA 2HSAA 1C8VA 2PZ0A 4UC5A 1JPHA 1BG4A 4O10A 4XTDA 4LX4A 5EL1A 3QQWA 1F6PA 3ITOA 3B8UA 3R2GA 3TOYA 3KWXA 4XD4A 1XIDA 1AMYA 1BGGA 3U3HA 4J35A 3WQGA 3CBWA 1O1HA 4JIHA 3CMJA 3TMQA 1K9FA 4XIAA 2Q8LA 3MT1A 4JY8A 3KOXA 4AQLA 3EPOA 5I02A 3ZJ6A 3R25A 4UUIA 3ICJA 3Q4DA 2E6DA 4JTJA 3WDQA 3W6YA 4NRRA 4CLMA 1X8FA 4JBRA 1BRLB 2VGBA 2PDGA 3B9EA 3CASA 3A64A 4I8DA 3P6LA 4AWUA 1VS1A 2X41A 2CXEA 1V6VA 2DT0A 3B8VA 2W67A 2Q71A 2PU0A 3HA1A 3V35A 1RZMA 3FGCB 3QMTA 4CNSA 3FVMA 2V2HA 3S47A 4KRUA 1V02E 4MG4A 4L80A 4AIBA 3IRDA 3VOCA 2OZTA 4MADA 4NSBA 1WOBA 1QW7A 4Y96A 4FOJA 4MTVA 3L4TA 4AVFA 3MDUA 2WZMA 3T05A 3WNKA 3VIJA 2PPGA 6CGTA 3GYEA 2DJLA 2IPJA 4EE9A 1PL9A 3R58A 3Q37A 4US5D 4ATLA 4LGXA 4TU1A 3ITTA 5H8PA 2V5CA 2WHJA 1E73M 3HURA 2WZTA 1QBAA 1S2UA 3OJGA 2VQUA 1YQ2A 1SPQA 3PPFA 1IZKA 3EWDA 4MLJA 4OGZA 4RPPA 5GJMA 3REQA 3HGRA 2INFA 4BQ2A 1B9ZA 4ZVJA 3V1HA 1YLVA 3B04A 3WMBA 2NWRA 3FEMA 3SCUA 4AZHA 1SZFA 3WKZA 1JFXA 1XIMA 2X2YA 2WSRA 3AHVA 4E6MA 4XV0A 3WQCA 3OO2A 5E0CA 2TRSA 3CQJA 4H9ZA 2CYGA 4ZQOA 2OG9A 3QGKC 1Q2SA 1FWCC 3FJLA 2Y5SA 2POTA 4CNOA 4F0HA 4ADTA 1A5NC 3UPMA 4KWWA 4OJYA 2NUXA 4JIEA 4ZB0A 1JPKA 4FS9A 4R27A 1R3YA 3MKVA 4UIOA 4PL1A 2GYIA 1EGVA 1DJGA 1R3SA 5K9XA 2ZZ6A 1BSLA 2VR4A 3YPIA 4BQ5A 1XP3A 3UWWA 2W63A 4WGXA 1NJJA 1E1CB 2BY3A 1HJXA 1PB0A 4ADUA 3IJIA 3H24A 3K8MA 2VC9A 3WLRA 1XRSA 3ZO9A 4G2DA 1RD5A 3L4ZA 3LU2A 4B9ZA 3BXWA 2DSKA 3DFYA 2JF6A 3WBEA 4ZQNA 3SY5A 5A6MA 1F6KA 2HPIA 1J01A 2VL4A 2Z1XA 1OADA 4UFHA 1N8IA 1UR2A 5BXSA 1EFZA 5XINA 3PK7A 3WSUA 2F6UA 3IVUA 2VMFA 4M5PA 5CC7A 3SUUA 1XSIA 1IHIA 3TZNA 2PBGA 4HQVA 2ZUSA 1EL3A 4DJDC 1G7VA 4GBUA 1OX6A 3L5MA 4OOZA 1I2RA 3QGVA 4AC1X 5EMLA 4IMEA 2NVDA 1A5SA 4AMCA 1ZCOA 4BKNA 2PURA 2VC7A 4EPKA 2JKAA 3IS4A 3M47A 4ZQRA 4O54A 4JTUA 5I03A 2ZE3A 1EPVA 3SFWA 5CG0A 4Z2LA 3DHFA 3FA3A 3MB9A 3GXPA 2A3HA 5TBOA 1UR8A 4P7NA 4U5IA 3W00A 1US3A 2C1HA 3DBNA 2CLHA 2PS2A 2DZAA 4JYDA 3ELFA 1TVNA 3O6DA 1NM9A 4DF0A 2VTFA 3QMRA 3B8DA 2OJPA 7REQB 2FJKA 3T07A 8A3HA 1S38A 1OABA 2A3BA 1EJTC 1HUVA 3EKZA 3PBMA 1RCXB 1IEIA 2ZA2A 2DT2A 1EJSC 3NA8A 1IR1A 3V7PA 3GX9A 3JR2A 1AVAA 1XIIA 2QGYA 4DAFA 4DO7A 2QEZA 2WM1A 3AALA 5D2TA 1O68A 3PAOA 3QJAA 1QTWA 1BXBA 2ZZ7A 1PZ1A 2AL2B 2J8GA 5M3WA 1J2BA 2Q3OA 2O9OA 4OT7A 4UTTA 5CBIA 5D9NA 2BVDA 3SN4A 3KVLA 4HK5A 3R43A 5EGRA 1BVZA 4F8XA 1CPUA 1CIUA 4HU4A 4NXSA 3B3DA 3B40A 3K4DA 3K5XA 2DIEA 4CNUA 2WVVA 5JBFA 1KW1A 4B5SA 4PUDA 2FMOA 1TX2A 3Q65A 3WH7A 1UKQA 2HNEA 1I45A 5AHLA 3UCQA 4UXDA 3MMTA 4QGCA 3JUGA 4RZ4A 4LSBA 5KZDA 2UY2A 2P8BA 1EA0A 3MO7A 3T0DA 3CHCA 3TEVA 2JBMA 2YXGA 3AYVA 3TN6A 4OOUA 1FTXA 4QS5A 5DBUA 2QJNA 1XLMA 3VZXA 1QNQA 2WCAA 3VMPA 1G4EA 1DIOA 2NXGA 4DN1A 3NFUA 2GGJA 1D9EA 2LLEA 4F79A 4XAPA 3HG2A 1UD2A 4IH3A 2PTDA 4LU0A 2NQ5A 3UY8A 2ZKMX 1XD0A 1C9DA 2Y89A 2XIQA 2Q8ZA 2ISSA 3M5YA 4GCAA 1RLCL 1CXLA 2GUUA 4W8LA 1YMYA 2D1ZA 1EP1A 2MANA 2V0TA 2X30A 1LP6A 3KRSA 4JCMA 5HK4A 1R3VA 3W28A 1ISVA 2VWTA 1KBLA 3FLUA 4IXHA 1KM4A 2WMGA 4YHGA 3PFRA 3PSWA 4O53A 4LYQA 1XI3A 1UD6A 3NJ3A 4YTQA 3MVIA 3APYA 1HKVA 2GVGA 4GRSA 3RM8A 4IT1A 1F3WA 4KBXA 4S39A 2ODOA 5F2IA 6XIAA 3GDMA 4TX6A 1TPH1 3S9ZA 2CFFA 3B8TA 3LG3A 4PMZA 2CZVA 3WH8A 3MP3A 3G77A 3SCWA 1L8PA 2GJXB 2KZHA 4OBTA 1QNSA 1XIFA 4QCEA 5I0DA 3CL8A 3P81A 1IEVA 5HMEA 4UFLA 4I90A 2PDFA 3L7RA 1GJWA 3E74A 4JQ3A 3QKZA 3AI0A 4CQAA 2ISWA 3NWRA 3N4AA 4F0KA 4HCLA 3B97A 3HFYA 3IIXA 4BA0A 2QIIA 1G4PA 2OCZA 2OSXA 2OEMA 2XVLA 1M5WA 3BE7A 4KFOA 3W7CA 3VGDA 3VNZA 4YCPA 4H7ZA 2YL8A 3WD4A 4ZOCA 3LN3A 1TJPA 1RY0A 4HD5A 4H3DA 1HJUA 4X2RA 3GS6A 4PMYA 3RG6A 5HA7A 3N18A 5H8UA 1JCYA 1GOQA 3N11A 3DECA 4GNVA 3BQ6A 4IICA 4Y8EA 1DVJA 1A4MA 2NZLA 1JI2A 1E3XA 2WXDM 3G8RA 2PMQA 2DT3A 3T44A 4MZYA 3QV7A 1H5VA 3FJ6A 2GJNA 3K4WA 3U7BA 1KRMA 1RA0A 4JNYA 2NV9A 3CHEA 4G1NA 4W7VA 2WJZA 1DL3A 4ZOBA 4YHEA 1E0VA 5HWNA 4ONVA 1XSJA 1G94A 1VENA 3P84A 2AQOA 2BHUA 1E4MM 1AQMA 3MUCA 3IAQA 4OHQA 1X38A 3MBFA 3WF4A 1XM3A 1Q2RA 1ZB5A 3UWEA 3N9KA 4UCGA 3GW3A 4Q8OA 2YBTA 2XIBA 2Q8XA 4HU8A 3W86A 2GDVA 3EX4A 1GJPA 4PMJA 3B06A 3P7YA 1XH1A 4HMDA 2R82A 3LMZA 1QPRA 3N2MA 4KRZA 4K8GA 3F2BA 4E38A 1CECA 3WELA 3EMZA 3VCNA 1Q8JA 4O50A 4XSLA 2HZGA 3JU2A 2XUCA 1K77A 3BVJA 4QDMA 1A5UA 1XH0A 5CPSA 1ONEA 3H2MA 3R5EA 3W1LA 3AIBA 4MYXA 3UWYA 4O1CA 1H7OA 3PC0A 3W23A 1OD8A 4CVWA 7TIMA 3UETA 3PPGA 4I7VA 4U2YA 4EPBC 1ZENA 2FDMA 3N9SA 3S6DA 1RK5A 1UKOA 1IEWA 1UWIA 1E56A 1VB9A 3C86A 2FMNA 3PJTA 2E77A 1A5LC 1FOBA 3OA3A 1V03A 3K8KA 4XAGA 4IP4A 3QFWA 4QNEA 2A3AA 3IV8A 2IW0A 1NP0A 3ARUA 2EBNA 4QR6A 4J3SA 4FOUA 4O1FA 2G0WA 4AB4A 1R9ZA 1WKYA 3WLKX 1R8LA 2AOSA 1GZJA 1CGWA 2VX4A 1V6YA 3JRKA 1IV8A 2VOMA 3LX9A 4ZBCA 1NEYA 3UR8A 3LOTA 3GAYA 5FF4A 4RR4A 3SECA 2IPGA 3UJFA 4O4WA 3H7UA 1FWIC 1F05A 5FAJA 1MXGA 1VBRA 2VGGA 5D02A 4IMFA 2E1DA 1FH9A 4U2ZA 4FNPA 3SCVA 1X7FA 3RCYA 1PIGA 4S1FA 4JPGA 1XXXA 4KWUA 2P5NA 5CXPA 4GI6A 4KIRA 1FWJC 3BL3A 3FNDA 4ROQA 3VOGA 1MW1A 4XO7A 2X05A 3BAYA 1GW1A 5CPMA 4AWTA 3MW7A 5IM51 3T2QA 1OFQA 3ANYA 3SI9A 2G41A 3N6JA 2J47A 4Z0SA 1XIBA 4YVPA 1A5AA 4WDXA 1W9VA 1GZ1A 2REQB 1JPMA 3RX4A 5EY5A 3PJXA 1W3HA 3HQPA 3CS2A 2D20A 3TZFA 4Z1CA 1JDAA 3FXYA 4FX8A 4C6QA 4EXQA 2XISA 1WZLA 2D0GA 3NQ8A 4XKYA 2W92A 3S2MA 4P8XA 3WK3A 2X0SA 5AYIA 5LXXA 2BVYA 4J2PA 3PZGA 2Y61A 5T9CE 3ITLA 3DXIA 3TQPA 4JTRA 2O55A 4E3VA 1J18A 4RDVA 1UKTA 3M0YA 4GY7A 6REQB 3MUXA 1L0PA 2NLYA 5LZLA 3GH5A 5LA0A 2HE5A 4Q4QA 4MB1A 1XWYA 3BCJA 3L4XA 4CD6A 4CEXC 2FZDA 3GNDA 4AISA 1FP9A 1XDJA 3W38A 4QLLA 5BXRA 5D2WA 1FHDA 4XD3A 4MHBA 1B30A 4HCDA 1M04A 3TA6A 3D0CA 4NHVA 1QNPA 3SQLA 4GBDA 1IT8A 4LALA 7TAAA 1BFNA 1V3LA 2VHLA 3GIYA 3WY1A 2CHOA 2J77A 1K8CA 3FY1A 4TX9A 4RKAA 4IL2A 2XPKA 1X98A 3OVPA 1SFTA 4DWSC 1DWAM 5LIWX 3VE7A 4HK6A 3OODA 1OK4A 4UTWC 4Q8WA 1LUCA 3LENA 4GQBA 4R7OA 1ZSXA 1FX6A 3P74A 3WF3A 4HNNA 4DO4A 1Q7ZA 5CGTA 1I2QA 3UGVA 3NUKA 2GJRA 2Y8KA 3CHDA 2G50A 4GABA 1YXYA 5DX7A 2D3LA 1QNRA 2WQDA 3M0IA 1LG1A 2W9MA 3O07A 2Z2AA 5A6AA 4JX4A 4M81A 1PEZA 1W8GA 1QHPA 3TMLA 4ERAA 3HZ3A 4MNJA 2J7DA 3W7EA 4NI8A 4ZA0A 3MHGA 3AIUA 1LWJA 4Q8VA 3A4WA 5D37A 4LAOA 1PTAA 3G6LA 1RALA 4DLMA 2GVEA 4INFA 1UA3A 4M8UA 5J8LA 2WB5A 2AL1A 2NUYA 2JEPA 4JHZA 3APGA 3BAJA 2PF0A 4PB3A 1MW0A 3LYEA 1XKYA 1CB7B 2D0FA 3KP1A 2YLLA 4PRRA 2D2OA 1I1WA 3GXFA 2YYUA 1XH2A 3GTHA 5FJPA 4QG8A 1ZJHA 3E2VA 4JZ5A 1TJ0A 1NOWA 5A2AA 3AMDA 3LLFA 2Y2WA 1K8ZA 1ZLPA 4R85A 3U7VA 3NYZA 1XRTA 4S3GA 3GDLA 2E6YA 1CLVA 2WBKA 1B3XA 4NJKA 1ME8A 4RNJA 1MUCA 3QRHA 4NAFA 5FJUA 3LBMA 1D3CA 1JD7A 1O6IA 3MC5A 3PUGA 4E2BA 4L9YA 4C6PA 4JTAA 1DJHA 1TJ1A 1UB3A 1KD0A 1D8CA 1JDCA 1KNWA 4R9OA 3C0LA 3DI0A 3GDTA 3THQA 2GJPA 1DJWA 2PBOA 4XX6A 1RAKA 3AYSA 3M64A 4OE7A 3BSHA 5EBAA 4CN6A 3HQOA 1HVXA 4H9XA 4JICA 4DUVA 1AJZA 3N2CA 4US5A 3TYDA 1ICSA 5BU9A 2QXWA 3VGGA 3OZYA 1V5XA 1KV8A 1CXKA 2BGNE 2XH0A 1PS9A 2PDWA 3WEZA 3QN3A 5FJOA 1OFAA 3WNLA 4PA8A 2X2GA 4P8WA 3WD3A 4CN1A 4MOZA 1E6RA 5BW6A 1YNPA 1RVGA 3RX2A 4AHQA 3NOYA 3WQ4A 4H9YA 4W9TA 1AW2A 1QPNA 4FXFA 1WNOA 2W0UA 1J0HA 2ZWYA 5I2UA 4ZSTA 4L1WA 3CL7A 3T78A 4W93A 1FWEC 3NVDA 4NJJA 2H9AB 3WDPP 2YXXA 1KXHA 4DX3A 4XK2A 4HGXA 4UB9A 1KO0A 1JG9A 1QWGA 1AH3A 1WP6A 4M29A 1OX5A 4C6IA 1NVMA 3VAVA 4FA3A 2G3JA 4TV5A 1G7UA 4LF2A 1Q85A 3UR5A 3O15A 1ZALA 4S38A 2A85A 2W61A 5AHEA 4IP5A 2FTWA 1UZ4A 2VX7A 1HW6A 1MQRA 3V18A 3NM3A 3L65A 4Q8NA 1Z3NA 2R1MA 3TOPA 3IJ7A 1FWFC 4GMEA 4P7RA 2CWNA 4PUJA 1TJRA 1ZBKA 3KL0A 3LGDA 3M0JA 4GQQA 2OXNA 1JVNA 3AU6A 5K7JA 1GOIA 1SW7A 1ZBCA 4IX2A 4WCJA 1W1B1 4RLIA 1DJNA 2WNWA 1U1HA 5F4XA 3SIMA 2HTMA 4O28A 1ZAJA 4S3DA 4TUFA 2WNQA 3BWWA 3N2OA 1R38A 4WKHA 4F4RA 4GHRA 1R9YA 3K46A 1G4SA 3SCQA 3N12A 2JK2A 4L61A 4QG6A 5A6BD 2QCEA 4WSJA 1V0LA 1XIGA 4DO6A 3IIZA 4HNCA 3GKFA 3S1WA 1FDJA 3SIZA 1B57A 3L0NA 2ICSA 5AYYA 3KBMA 1EGMA 4EPDC 5EYWA 1W37A 3H53A 3LGGA 3NZGA 1PKYA 4D9PA 5A6TC 3BARA 4Y9AA 4LBRA 3HB9A 4B5NA 4UQCA 2I16A 3TW6A 2A6LA 4KRTA 5C70A 1DJIA 1O5XA 1UOZA 1ZBWA 2RDTA 2VCBA 3GR7A 3OZMA 4Z42C 1V3JA 3C4UA 5BRBA 5CJMA 1KR0A 2ZA1A 4IG2B 2FB2A 2V81A 3TDFA 3KX6A 5FEZA 3G8EA 4E4FA 1W2VA 1SMDA 1E0WA 3FAXA 3SBFA 1L6WA 3HFTA 4NAEB 1MFUA 1AL7A 1IR2A 3STEA 2H3BA 3RU8X 3BJTA 3RIKA 3MBDA 3GXMA 2FVKA 3VUPA 4UCFA 5BWFA 4IUOA 2IQDA 4RX0A 1A49A 1IWPA 1ALDA 3GC5A 3FHQA 1V93A 1OFEA 3GG8A 5H8MA 3UU0A 1QASA 1XLAA 1KFBA 2DW6A 3C6CA 1WQ5A 2D0HA 2BZNA 2VM8A 4H9VA 3LQLA 4H9UA 4IF2A 3ANUA 5DCBA 1FHLA 2MUCA 4FLQA 4ZQPA 3H4XA 1TTQA 4YWSA 3LZ3A 4AU0A 4DZHA 3T9PA 4L6HA 2ALDA 2Q02A 3HPZA 3PWIA 1LORA 1VHNA 2IS7A 2C1GA 4HZ6A 2YCLB 3UGRA 1V0KA 4MSSA 3NL5A 1GG1A 2ZXQA 2FFCA 5HPOA 1QJWA 3FV9A 4ILSA 1VEMA 1VFMA 2XWDA 3GR8A 3NEHA 1T8QA 3GG1A 3BG3A 4JN7A 1FHUA 3FX4A 4CKQA 1G1YA 2GK1B 4PB5A 4URIA 3SUSA 5MKGA 1WDPA 3WJYA 3W2MA 2FJUB 4OZOA 4QX4A 4ACZB 3BLPX 2E68A 3BOXA 3WCZA 1UIOA 1R0MA 5XIMA 4RDWA 3OB8A 2VGFA 5T91A 3IWPA 8RUCA 4EPEC 6TIMA 4WKAA 3ITXA 4Q7NA 4J2MA 2UBPC 1CW2A 4Q6JA 1VBGA 4QE1A 3S2CA 1XLLA 2ZUVA 3LCGA 2J9ZA 4M6PA 3AO0A 2QUUA 5C54A 1WX0A 4MPQA 4CCDA 4K38A 4WDUA 3LBCA 4AD4A 2I57A 3D46A 3TIMA 2QUTA 4POCA 3CZEA 1I6NA 3KBWA 3MSDA 1ZGDA 1AUSL 3AISA 1W5NA 4MF4A 1R85A 4LFYA 4MY1A 1W1PA 4BI6A 1E9ZB 5C9WA 3EBVA 2OPJA 4F48A 3STPA 1X8CA 3W87A 2PRMA 3I7RA 4U4MA 2YZ5A 5HAOA 3LM3A 3HMCA 1XDLA 2G3IA 3LSCA 1R3TA 5ENLA 1RVKA 3TW7A 3VU2A 4RZ5A 3DEQA 3WD2A 1QPKA 3URAA 1V02A 3AHXA 3KRZA 1B4EA 3RUBL 1IE7C 2G3FA 1F5ZA 4LRSA 3NDYA 4MFDA 3RPDA 4UQBA 3VVGA 3VM7A 4G56A 3UNTA 4UQEA 5AKQA 2PI6A 1W1YA 3FN9A 1HIZA 2I56A 3IACA 5AHFA 3ZR6A 4LRTA 2XZ9A 1JZ4A 1QO2A 1BF2A 3VI2A 4U3AA 3GHRA 4QHRA 1DXIA 3CIWA 1EQPA 3W7NA 1U5VA 2V69A 3NNTA 4PMVA 2QAPA 4GOAA 4LB4A 4PUEA 3E0VA 1E51A 4HBKA 1HGYA 4IPPA 5T9BG 3BTNA 4IISA 3GXIA 3QC3A 1VP5A 1E9YB 1LRTA 4B3ZA 4AD0A 4ZXLA 4UZUA 1QVBA 1GUVA 3FOKA 3M7WA 3F2DA 4S3FA 2QYGA 4JIPA 3OIXA 5IFTA 2GSEA 3WX7A 2HPMA 3T55A 4O57A 4BZYA 2QDGA 4IIDA 2VX5A 3TYBA 3CAKA 2WSQA 4OVXA 4JGDA 5A8NA 3H21A 3TQKA 4GVGA 2V2CA 2PWDA 2CBVA 3FCPA 3TYZA 1XD1A 1W3KA 4CEUC 4HPHA 3CLMA 1LYXA 2CESA 1GT8A 1Y65A 5HDRA 1DOSA 4QCFA 3G2GA 2DJXA 5AZ1A 1HNYA 5ABFB 5TQLA 3A5FA 1UUOA 1SO3A 1H62A 4RNHA 3WQ5A 1SO5A 3CGTA 4FSAA 2OB3A 1YKWA 3LRKA 2PGEA 3TFCA 1EYEA 3N3MA 2J75A 3ABOA 4N0RA 3E0FA 2NX9A 4ZSUA 4Z08A 3WJZA 5H6HA 4YTTA 4C6JA 1RBOB 3I6EA 5TIMA 2BVTA 1J10A 4PFMA 5BOFA 3UG8A 2E8ZA 3RPMA 1Y5XA 2OODA 3UXKA 4GZJA 1LLZA 3HJZA 1EO7A 3PF3A 1TV7A 5A6JA 3SCOA 1IIGA 3S1VA 3S46A 1BG9A 1SVDA 3VMOA 4DVOA 4L7ZA 4O13A 1GQLA 2Z2UA 1XBVA 4Q8TA 3TYEA 4ZO6A 4ALDA 8XIMA 2RKXA 1FDYA 3MUY1 3OGVA 2XDFA 1XRVA 3QR1A 4K36A 4Q7BA 1HL9A 3C52A 3N14A 1QU4A 4LCQA 2WPBA 7CGTA 3S9YA 4I8YA 2R24A 4QFUA 2QCMA 2G8ZA 4F0LA 2WZIA 4JL1A 1W9XA 3W7DA 4DUOA 3HM7A 3O06A 3W1QA 3APTA 3T08A 5I3KA 2GUBA 2D23A 3MKCA 1QXLA 4IJBA 3UG5A 2XINA 2EG6A 2XIIA 1XCFA 5REQB 1AG1O 1MRQA 4AD2A 1W3JA 4BI5A 1TMQA 2YFOA 1U30A 3UXLA 2D2GA 3M43A 5CAHA 1UCWA 4PFHA 1VEOA 1TCDA 2VCAA 1YIXA 4CD8A 3EKLA 2HVMA 1JNDA 3EDDA 1ML1A 4Z1DA 4NXKA 4CU8A 3CUXA 1IZCA 3HGOA 5FSEC 4XZWA 4PMRA 3SGZA 3MUZ1 3MSRA 4GX8A 3STFA 5HBFA 2ACUA 3WEOA 4LB3A 1FXQA 2PWFA 1X7IA 4QS6A 4Y90A 2R8WA 3F4CA 3H2OA 5HMDA 1EYWA 1TA3A 2QGHA 1P1XA 4IFKA 4JDYA 3I65A 2PD9A 4UOQA 1MSSA 3GSMA 4MJ2A 1N2VA 3R12A 2CNCA 3AXMA 5JUVA 3UA3A 4M51A 3NIYA 2WKLA 1XX1A 2OYKA 3KVMA 3A12A 2OFJA 1TYGA 3STGA 3WG6A 4FNRA 4XVEA 4ACYA 4ZR8A 4GJIA 2O7QA 2E40A 2GDQA 1HP4A 1HXJA 4L56A 2OEKA 5K2ZA 3SDOA 4C6CA 1PBGA 3QY7A 3D47A 4Q7IA 2E9LA 2WMIB 5BZAA 3NL6A 4LYRA 4ZO7A 4YVVA 1GEHA 2WC7A 4WLCA 2NV1A 2RFGA 4H9MA 1GGOA 4B91A 2R91A 2DFAA 4GXMA 4JD4A 2BXVA 1H7WA 1SZNA 1I1XA 1OC5A 2Y6ZA 4CNNA 2NQLA 2PCQA 3TLLA 1XLJA 3F2CA 4LUSA 4G9PA 4A8RA 3L21A 4XBKA 1E43A 4YJ5A 1TE6A 1KXTA 2V3GA 3NAVA 3MS8A 1QO5A 4UNLA 4KFNA 1TQJA 4WXYA 4EWJA 2PLMA 3VILA 2DSZA 4WR3A 3MUAA 1JR1A 1UH3A 3CTLA 2GJLA 3E0IA 1UIPA 3WQFA 4BFAA 3T4CA 4GLEA 4A3UA 5ECVA 4OUIA 2GWGA 2OX1A 5CZJA 3SCPA 4RDYA 4AEOA 4JIIX 4U28A 4X63A 3M46A 3IUHA 1J6OA 2WLYA 3E5PA 5FJTA 2VJXA 4JKKA 1C90A 2YGYA 4M7TA 3NQ6A 4R9XA 5AC8A 3QXBA 1E1FA 3KZSA 2OQYA 4KKXA 3QSRA 3T7VA 1UWRA 1UWTA 3ZT5A 3MJYA 3M44A 2ZX5A 3THDA 3OG2A 4L65A 1QAPA 3A3WA 4AYSA 5E1QA 6ENLA 1J93A 3F5KA 3LK6A 3R8RA 4U31A 3RLVA 4IOTA 3D3AA 1S2AA 2ALRA 1ISXA 3KRUA 3QOMA 4NL1A 1P7TB 3VIOA 3WLIA 3R8HA 3CUJA 4W84A 1SGJA 4F2BA 2VDGA 3L12A 5CC5A 4IQLA 4GXWA 1EJUC 3LXAA 2QMKA 1HP5A 2UY3A 3CAWA 4AZIA 1IXOA 2V3FA 2J6VA 2HCVA 1PKLA 1UQZA 3GG7A 4FMVA 1OF8A 1LL6A 3SCSA 2P88A 1W1IE 2ON3A 4O8RA 1VFHA 5J04A 4QJ1A 3C3NA 5CBJA 4UMAA 2R1LA 5CKSA 1P0KA 1DE5A 3GAKA 2J8FA 2Q01A 4RE0A 2BFGA 3VD7A 3GVRA 1ZPTA 1OYBA 4PTVA 3SGGA 1Z8AA 5KZEA 1X6NA 4ZENA 5MHBA 2X40A 5C7VA 3FAWA 2I5QA 3TSMA 1DJZA 1RJQA 2PDBA 3NQVA 5DF0A 3GNXA 2A4AA 3U6WA 1P5BA 3AZRA 2NVAA 3W82A 1SYTA 1NDWA 1CEOA 4MZ1A 3H12A 3DUGA 2PDPA 3TNBA 1EH9A 3ME3A 3WUEA 1TG7A 3NXFA 1YPIA 4IGHA 1ESWA 2JALA 4DIAA 3W27A 4O14A 1NFBA 3E0LA 2FVLA 4IQDA 4B15A 5BU6A 2Y7GA 4BEUA 5A95A 5J5RA 3ZXWA 4J3VA 4PUNA 3VGFA 2E3ZA 1QI0A 9XIMA 1YEYA 1BRLA 1XG3A 3N6QA 4KCUA 1TMLA 1FP8A 1JZ5A 3N19B 4HP5A 1KM5A 3KS6A 3O9NA 1AQFA 3GZ3A 1T0OA 2QLYA 3GC4A 1F3EA 1BWKA 4K6AA 4S3KA 3VNKA 3LXBA 5A8QA 3FGCA 1VCGA 1JNEA 3KOWA 1EJXC 2V9DA 7ODCA 4Z2JA 4UTLA 3VGEA 1NAL1 2E67A 1W5MA 1QHZA 3H4GA 1Z7AA 3ATYA 4DNMA 3VE9A 4MWAE 1QPQA 1VPXA 2XSBA 2WSKA 5B7ZA 4E3TA 1JF5A 1TSIA 1JQXA 4C6EA 5C6MA 3AS1A 3NPXA 3C2FA 3S5OA 1CENA 1J0YA 1GJUA 4C6BA 4CNTA 2YYTA 3T09A 1XICA 4E2OA 1DHKA 2FHBA 1XF0A 4PUUA 4TTUA 2V82A 5A69A 1VJZA 4TMBA 2HBVA 2TMDA 4C6KA 2Y7EA 5C2XA 2E25A 4Y9MA 3B0UX 1AL8A 3VIGA 2TODA 5HNRA 3V0UA 2QF8A 3NPWA 3SR7A 1UWQA 2PCEA 1QPOA 1AFSA 4PODA 4KWOA 2CLLA 3BCDA 2YCJA 4L4LA 2CZEA 4GH1A 2EPMX 2ISFA 4KWSA 4MYAA 3HPSA 5EMJA 1HFBA 3AOFA 5LXEA 3RJYA 1MDRA 4Q8UA 1NWTA 1S1PA 2F2KA 2YIHA 1DQWA 4D8LA 1G9HA 3QYQA 3V0TA 1Q6GA 2UY5A 1I8JA 4KCVA 1QI2A 3WK1A 3WMLA 3BLOA 1RPKA 2QW5A 3WBYA 3RXZA 1LM1A 3TYUA 3SCNA 4UOJA 1WOAA 2ONEA 5SWUA 3BMWA 2ZTKA 4NJGA 3NQDA 1V6TA 1FFQA 5ECUA 2VQTA 4J40A 2ACSA 3W22A 2ZE0A 1YTEA 4HMEA 4LBUA 3DGBA 1Q6OA 1K7FA 1E1CA 1WDRA 2DP3A 1US2A 1W9PA 1PZ2A 4LQ1A 1PUDA 1WDSA 4QAWA 3EWYA 4GC3A 1HN1A 1M7XA 4FZIA 5BROA 3TJLA 2WJFA 1ZAHA 4PRTA 3R13A 4WQ6A 2V3DA 4AIEA 4K37A 2BSLA 2FTPA 3CAVA 1V3HA 1L6YA 3R10A 1LL4A 3ORWA 4YL2A 4YTSA 4UMBA 1M68A 1G0CA 1GVRA 3NZRA 2HQAA 1E6NA 1JUKA 1A0EA 1MQQA 1LT7A 2VURA 2ZX9A 4DELA 1DTNA 4M80A 2VCCA 2XIOA 4AXNA 4NI3A 5U4NA 1Y0EA 1Z89A 1JCXA 1H60A 4MB4A 2PSNA 1GKRA 4FX7A 4DM2A 3QGAC 4JTQA 3NQCA 1C8QA 1VAHA 3WJSA 1FWDC 5A6BA 5AYBA 1UBSA 3UZJA 4A3QA 2VUNA 4PZVA 3AXHA 1CLKA 3C0JA 3BQ5A 1QRQA 2V67A 1TPDA 3G5EA 2Z7KA 2IMRA 3WLHA 1OM0A 4V27A 4UR9A 3W72A 4PCTA 3EA2A 4HPXA 4Q32A 4UQDA 2ABAA 4H9TA 4P2VA 3KUMA 1YDNA 2ZX7A 3TTYA 1L6SA 3WQWA 4J3UA 3G1RA 1H11A 5G1MA 2XVGA 1E0XA 1GVQA 4DBDA 4FALA 1PVNA 4PTMA 4PSRA 1KA9F 1GOMA 3UERA 1B31A 2J74A 1GW9A 1Q63A 4M6QA 3OTRA 4UQAA 1JGIA 1FQ0A 3CHVA 4ZTYA 3P14A 4JS3A 1MRAA 1QFEA 3LBOA 3E02A 5A8MA 5EA9A 5FL1A 4DZAA 1K9TA 1XSKA 4WSHA 3WQEA 1F2JA 1HJVA 4LUYA 3ZWTA 3TAKA 1XLHA 4RZ6A 1DQXA 3C0SA 4JEQA 4QTGA 1OFBA 4A2SA 1GZGA 4ORIA 4W8BA 5D09A 1VRXA 2WSYA 5I3JA 2C7FA 2QV4A 1FWTA 4LBSA 3W7GA 1XHGA 3GDKA 4M6VA 1HVQA 3S5YA 4N42A 4GIRA 1RSCA 1KGWA 4ZOEA 4NZCA 4JQ2A 1LBFA 3ERPA 1KXQA 1GOXA 4LC8A 3VNLA 2FH8A 2Y24A 2CIPA 1OFDA 1NDYA 1WV2A 1E6SM 1EF2A 1XBZA 3KVJA 3O7UA 1DEDA 4JN8A 1J0ZA 3MZ2A 3XIMA 3S4TA 3PTQA 5IBXA 1R3WA 1WO2A 4JTHA 3WDHA 4C6OA 4Q3MA 4L6DA 4UQ9A 3CU2A 3R1ZA 3BLKA 4I7UA 1DWFM 3M6DA 1XUZA 2DZPA 4NNAA 5JBEA 4WEVX 1Q4NX 1KBBA 2PDJA 4GY0A 1THFD 5DRIA 2HRWA 4Y9PA 3AS0A 4M56A 3LTPA 1ZL1A 2BWGA 2R14A 2IPFA 3F03K 1SQ7A 2ZQ0A 3VIPA 1RUSA 1R6WA 2EPNA 4NNBA 5FJRA 8XIAA 1BVWA 3W9ZA 2OMAA 4PR4A 4Y6GA 2QF7A 5RUBA 1DORA 3LTYA 2OOGA 4LJ3A 2OO6A 4A29A 3HOJA 2AGTA 3ZJ7A 4WUIA 2XG9A 3AZSA 1PHQA 3AXIA 2AKZA 3N9RA 3RHGA 1EDTA 1LCOA 3G1FA 3BUVA 3SSZA 3CIVA 3IJQA 3QPEA 5D30A 1SJDA 3KFTA 4G1KA 4PBEA 1M1BA 1EJWC 2YCIX 3KBSA 1GQJA 4FB7A 5CPOA 4AX6A 1LWHA 4YMZA 4X60A 3UP8A 2Y7FA 4HSOA 2B7PA 2POZA 3EOOA 5JU6A 4F9JA 2DSVA 1E5NA 3LDVA 4XZLX 3RDKA 2XWEA 1C29A 3T0BA 3KHDA 4W5ZA 2YL9A 3RLGA 1FBAA 1VCFA 3WLTA 1DWJM 4RNFA 4O0ZA 3VKBA 3W2UA 1M7JA 5A8OA 1VPQA 1AJ2A 2J79A 1EX5A 1B3VA 2OOFA 2TPSA 2X7VA 3GFYA 4RUBA 4HZ8A 3UWQA 1W1VA 3QFEA 2NVCA 2QUMA 1JRCA 3O6YX 4IJRA 5JQ9A 5JIPA 2ZXBA 3CQKA 1UZDA 2E9MA 3AFBA 2CLFA 2DT1A 2OSWA 3LV6A 5AFDA 3M9YA 3MY9A 3RFAA 4WX2A 4O15A 4IPIA 3UFYA 1Z48A 4DNHA 3ZJ8A 4A05A 4L64A 4BS0A 4B5UA 4GO8A 1RLDA 4C6MA 5AVNA 3SURA 1TWDA 2V38A 4JQ1A 2JIEA 1H7XA 2HWGA 1XBXA 3NQEA 1H0GA 2PWHA 1Y7VA 4PMDA 2GSJA 1OX4B 1MZHA 5CH9A 1RJPA 1TUXA 1HO4A 3CB3A 2GQAA 1A5BA 1IYXA 2NQZA 4CN4A 4JAWA 1NQ6A 4NU7A 1YRRA 5HUOA 5BOEA 1DBTA 3WD0A 1TX0A 1KQYA 5LNVA 2QCFA 1WAUA 2VZSA 1BYDA 4QQUA 4FIQA 3ABXA 3KOYA 5CZSA 1M7PA 1RR2A 5XIAA 4GI4A 1CB2A 4J3WA 1RK6A 1DTUA 2Z25A 3DESA 3NTYA 3VD3A 2FPTA 4L4OA 4KPLA 3WQ6A 4N4QA 5DEZA 2OZ3A 2ZRYA 1N7KA 1V3IA 4KS0A 4R7JA 2XU2A 4GVFA 1X6LA 1ZU8A 2F7FA 3P62A 3PZTA 3BLFA 3WJXA 1FCVA 4P7QA 4J7RA 4JTSA 5E70A 2PC4A 4QSHA 5M03A 1XLIA 1UD3A 2XIMA 2AAAA 2R1KA 2PDKA 2TAAA 2DORA 2QCHA 1EIXA 2E5CA 5LHEA 4HYVA 1OBAA 1EXPA 5CCZA 4EXAA 3IJ6A 4XWUA 4IJCA 5A5WA 2PZNA 1PAMA 3ARYA 2QIWA 4JEJA 4P8UA 3OYXA 3D3FA 3LHYA 4L1XA 2C1IA 4JQ4A 1EUNA 2FGLA 5C7HA 4IXXA 4K68A 2G97A 1K9DA 2F61A 3O3RA 5HOSA 5JH2A 4GZ7A 1G67A 1MNSA 2HMCA 1OT2A 4PMNA 5FACA 4D2JA 2J7FA 4C60A 1QK0A 5D8WA 1K9EA 3AMCA 3GRIA 3UZYA 4JTFA 1RBAA 1DIDA 2VEKA 5C8BB 2W91A 4M24A 2WVUA 5C5YA 1UUQA 2W27A 1T41A 3IAPA 3SSJA 1UWSA 4HNTA 2I5GA 2GUYA 5JXQA 3L66A 2C19A 2DVXA 3EWUA 3T2OA 2I7GA 3KCOA 4DYKA 3A24A 1W91A 4YNGA 1NFGA 3CZJA 3SM0A 4HKPA 1TMHA 3DX5A 3DFHA 4WGHA 2PRHA 1FCUA 4RW3A 1OC6A 1SR0A 4DWSB 2MNRA 3PNZA 4K7YA 4AW7A 3PZMA 2CHNA 1V3KA 5I7GA 3TH6A 5DLCA 2WW5A 3B9OA 2OQHA 5M17A 3E2RA 2HS6A 1BEUA 3RO6A 3UZWA 3OQ8A 2OLHA 5HNTA 2G3MA 3WLLA 3MSGA 1UH2A 4K3ZA 3B4UA 2RJHA 3L4UA 3G0UA 2J4GA 5HJXA 4XBJA 2EPKX 5EBUA 4IFOA 2VZTA 1JDDA 2OWXA 1XYZA 5K9DA 2BHZA 4Q4SA 1GKQA 1YBQB 1KGXA 1XCWA 2REQA 3GYCA 2G4FA 4Y9OA 3IJ8A 2PD5A 1UKPA 4H6QA 4HNVA 2WANA 2X1UA 3N2TA 1TE1A 4KCTA 4S3EA 3GDBA 4GJ1A 2CZDA 2A2IA 1JUEA 5CSSA 2FB3A 3T40A 3CEUA 3UYIA 4ZL1A 3P5ZA 3IVTA 5AC4A 5FL0A 1AW5A 3AHYA 3UQNA 5EPDA 6REQA 1IEXA 1BTMA 1XRFA 1VFUA 7A3HA 1SW0A 4OKDA 2AKMA 4LYPA 1B3OA 3BLDA 3E3HA 3W1RA 4U3CA 1EO5A 4M7SA 1F8MA 4FI4A 2ASHA 3KL3A 2GQ8A 3H2CA 3FYOA 1XW8A 4B16A 1PZ3A 3U48A 3CUIA 1YDVA 3TAOA 4B2DD 4BI7A 1E5JA 3I3BA 1KFCA 4AYGA 2XN0A 4LW7A 5CPQA 4XZBA 1UMLA 1AZ2A 2NX1A 2EEXA 1YPFA 2DZUA 5GVJA 2BDQA 4RPQA 5FCZA 3HJEA 1FFRA 3L0GA 3PUOA 2CBUA 4NZ3A 4Y8FA 3ITVA 3ZQ9A 3SFKA 4GG9A 2EJAA 3BMVA 1ONWA 1KKOA 3ALFA 3QHOA 1FWNA 1OK6A 3UBPC 3VK5A 2YDAA 4GYFA 3ZZ1A 2YX0A 3G0XA 5GNYA 5JBDA 1Z9AA 1MO0A 1XYMA 4N6FA 1SR9A 4AZ7A 2CERA 2O4MA 3ES8A 3DENA 3PANA 1F4HA 3UA4A 4Y2WA 4J4KA 3GLCA 1OCNA 1LUCB 1LF1A 2G95A 3EX2A 4ZODA 2VWSA 3RAOA 4DF1A 1TREA 2PGWA 1XYBA 5DXXA 1OFRA 3W7MA 3G1XA 1O12A 3WEMA 1P43A 3M1ZA 3KCJA 3V36A 1ITQA 2WC3A 4D6EA 4A6GA 3O2LA 3ZLHA 1XL9A 4D6DA 2CXGA 4WSKA 3W2LA 2FH6A 1G69A 5A2CA 3HN3A 1REQA 4IL0A 4IIHA 4H6EA 3T0TA 1PTGA 4PEKA 3LSBA 3HG5A 4QJ4B 3DZ1A 2A5HA 2ZBTA 2ZUMA 1ONRA 2VDHA 3FW6A 2CPUA 3UJEA 3SN0A 2BY2A 1SSGA 3R4IA 3GNRA 4EACA 1B2YA 1YX1A 4DLFA 3S1UA 2OKOA 3DFPA 4KW2A 2TSYA 1S5WA 2X0HA 1GPWA 4UTMA 4NZFA 3AWNA 3IGHX 3WUBA 5D9PA 2DZWA 2WZEA 1EDGA 3DCPA 3CQHA 1R30A 3DC8A 3LCIA 1JYNA 3BSMA 2Z6JA 3S3GA 2IKGA 2P10A 2P0OA 2WBGA 4MB5A 4YPJA 3ENLA 3BSGA 5HATA 5FF3A 3WFAA 4PCNA 3DKJA 1NQKA 1ADOA 1KCKA 3MP4A 1KM6A 4O1BA 1TCMA 1XLFA 2YA1A 3P3BA 1UWAA 3SY8A 3VC6A 3L4YA 3OZPA 3PPCA 2GQ9A 1O5KA 1S2TA 2X0YA 5KETA 3S8HA 1GWJA 4RK8A 2I1OA 2DVTA 3BZJA 4M1RA 1AH0A 3B8SA 1D2KA 3A4XA 4DJDD 3VYLA 3MO4A 2VRJA 1QI3A 4A8LA 4RE3A 3PUDA 4HU3A 2ISVA 3BDKA 3C56A 3GY1A 1ITCA 1B4KA 5TNVA 1IGWA 5DMLA 3T4WA 1UD5A 1UG6A 5EMKA 4NRSA 5LNUA 4HPGA 3G1VA 1LT8A 4L9ZA 4AF0B 4D71A 5CGMA 1AK5A 1IIHA 2NW0A 1EC8A 4XQ6A 2I9UA 3LA4A 3M16A 4NZJA 4N7QA 4LVDA 3WF0A 2ZX6A 2GQ3A 3G3DA 4MDPA 2PP1A 5I6SA 3ITCA 2H9AA 4H2HA 4PBGA 3IVSA 2X42A 1C8YA 2ZYFA 1GNXA 4P8VA 2PLJA 4H8NA 3EMQA 1EC9A 3LCXA 3H22A 2V5DA 1ZJBA 1LBMA 3GO2A 4F2UA 1M53A 1ZAIA 1P6CA 2XFRA 1UASA 3KBVA 2BNJA 1R3QA 4V1XA 1Q65A 1JL8A 1MW2A 3WLPA 4TX8A 3JZEA 2Z00A 1T6MA 1IT7A 1B5TA 3FKRA 5BYWA 5I79A 3E5BA 4ZFMA 1QUMA 4TO8A 4HHHA 4I9MA 2CBIA 3QQ1A 3FIGA 3EOEA 1R2RA 3W73A 4L6OA 1RV8A 3HPAA 2OU4A 3GDRA 4X0VA 2J62A 2J25A 2FZ8A 2PLCA 4WKFA 5KSWA 3PTDA 1XIHA 5IFPA 3G0SA 1H7PA 3INPA 1B3YA 1TB3A 1YTDA 2ZA3A 1XUUA 1QHOA 5CPTA 3GWQA 1LROA 4V28A 3W1MA 2BOEX 1K7XA 4PBFA 3JZUA 3GNOA 4PTXA 1ISWA 2WWDA 2PDMA 3UZZA 3KHJA 1HG3A 1X39A 4KETA 2W5FA 4AHOA 2VFEA 1SZRA 4GJJA 1W1A1 2XN2A 3E9AA 2DVUA 4O0QA 4KH2A 4A35A 5A8GA 4MVAA 1Q6LA 2ZDRA 3MWCA 1PYFA 3WBXA 1S2CA 2GFTA 4HOXA 4PTWA 1P48A 3LEPA 3T2PA 4L4PA 1B0IA 3KS5A 5H91A 4AC7C 1I9CB 1BHGA 2Y5JA 4IG2A 3F4VA 5HR7A 1S3HA 5BCAA 2CBJA 4MB3A 3WZ0E 3MV01 3VIFA 3O6CA 4TOQA 1YADA 4NAEA 3K8LA 2QJIA 4MM1A 1V6XA 3EWXA 1TPUA 4LVAA 4OUEA 3UCCA 4MUPA 5EFFA 1XIEA 3OZOA 3SJ3A 3ZIZA 1OZQA 3A6OA 3VNDA 2ZIDA 1J79A 2DUZA 3A3HA 1V77A 2P1FA 1KM0A 5I3IA 1E55A 2CU0A 1NSJA 4NKCA 3EOLA 4GXPA 3WLQA 2JIWA 1QNVA 3EEZA 3VOJA 4GH3A 4JR5A 5CEWA 3MHUA 3UZXA 5LIUX 3OPSA 3ABRA 1PDYA 3W0KA 2NSXA 3MMWA 4OFCA 1RXOB 1S46A 1L6GA 3CPUA 2PRLA 5D9MA 3P93A 6TAAA 4LNCA 3PZNA 2ZXDA 3E38A 1PZ0A 1EEPA 1UP3A 1ZRQA 2BP1A 2CITA 2ZC8A 4AWEA 4MPKA 1E0TA 4PMXA 1K1DA 4HU0A 4IWWA 3F5LA 3A9IA 3SQSA 2O7SA 4BQ3A 4MJ4A 2GK1A 2G5WA 1ISYA 3EA1A 3KEHA 5E9XA 3E12A 3AIRA 1V4YA 2J24A 5IXEA 2WJDA 2QKFA 3EOUA 4CU6A 1PWLA 1DHPA 3BAIA 3CHFA 4H83A 3NQ2A 4R3UA 1IQ8A 3VDBA 3DDMA 1HT6A 1Q6FA 4QDWA 4MIMA 2GOUA 2OZ0A 5D32A 3CUZA 1CWYA 4WVXA 4B5WA 3C2YA 1NARA 4AH7A 3MWAA 5FJJA 4TVUA 2QJGA 2WJEA 3VFCA 1R47A 1T40A 1VKFA 3F4WA 1POJA 3GW0A 5GQBA 1B1YA 3L9CA 1G5AA 4AXKA 1U83A 3WQVA 4LS1A 2ZUUA 1J12A 3PZVA 4PMOA 2PWUA 3AC0A 3WLJA 4EVZA 1LZOA 3WQOA 2ZRVA 1TWZA 1OSEA 3ARSA 3OGSA 1U1JA 3B0PA 1O5RA 1MEHA 4FLSA 1MNZA 4QQ3A 1JUBA 1R7AA 5F4WA 3PNUA 3VCCA 2XFWA 2AGKA 1XINA 5HNNA 3OVGA 3QHNA 5FF2A 2BY1A 1VRDA 3WQPA 3UESA 4B3LA 3VKCA 1F76A 2V5JA 1WZKA 1FWGC 1PJ9A 1EX1A 8CGTA 3AQUA 4H8HA 4RXFA 3UPWA 3ITGA 4MWAA 1T5AA 2A7PA 1TR9A 3IGXA 1M6JA 1XG4A 1Z41A 2QCCA 3WH6A 4D6FA 3LV5A 5C2GA 1R2TA 2BASA 2YDQA 3GZAA 1TV2A 5LSMA 2FDSA 2O56A 1YE4A 3T42A 5ABTA 1NDVA 3VIMA 2DIKA 1SZGA 4K39A 1EWEA 2WAGA 2YCEA 3DIPA 3CZGA 3WMSA 4EP8C 3GVWA 4L5ZA 3LY0A 3M0XA 3AHZA 3LPOA 1OFPA 3W75A 5HINA 3V5OA 3W84A 3PBVA 1Q7MA 4LEFA 4WD0A 4B5TA 3BLLA 2ZZ1A 4TR9A 1WCGA 4FHAA 3AIWA 2PWGA 2JGQA 3SRHA 4HMCA 3SN1A 3W37A 2PTYA 3TQ0A 1YHTA 1W8SA 3PPHA 4C6DA 1TV8A 5IHRA 3CV2A 1UR3M 1I2PA 5CSRA 1KWGA 3NQGA 4W85A 3A4JA 5DCEA 2PA6A 1EJVC 3ZS4A 3F5JA 2JKEA 1PCKA 2DSUA 1DV7A 2WQPA 4E5TA 3FDKA 1JF6A 4MZ8A 2E5BA 8TIMA 2E09A 2G3NA 3NYDA 4A3YA 2C91A 4F0MA 1EIBA 2XYLA 4AEEA 3LCLA 1S5MA 4CQ8A 2XSXA 3H26A 4UWMA 2QQ6A 3NSMA 3VX1A 2OWWA 2IQTA 4UBPC 2F9RA 2I17A 3LI1A 5K4XA 4ZOAA 4LY8A 1GCYA 1WUFA 4IGSA 5L9FA 2D2JA 1VBJA 1W3NA 1H2JA 4GZEA 1FWHC 1WAWA 1TV4A 1ZTVA 1RP9A 4XZHA 2ZICA 1BAGA 1V6WA 1PIIA 2OGYA 3DERA 3WDIA 1IZJA 3BG9A 1UWUA 4GD0A 3HGSA 1JCTA 3SQMA 3LCFA 1S5NA 4JOMA 1VFFA 1JAKA 2G4JA 2G37A 5LNSA 1HJQA 3W7RA 4Q4RA 5G2WA 1XPGA 3EGJA 1DWHM 3THAA 4P61A 3A9BA 1BXNA 4JTLA 3MI3A 3BC9A 2XJ7A 3TROA 2XH4A 1VJIA 4H6RA 4JQAA 4MY8A 2P0IA 1DJXA 1UJQA 4LOCA 2V68A 2OYMA 4UOZA 1EBGA 3HIJA 4IP7A 1Y5WA 1VPYA 1N8FA 4QXIA 4AD1A 2PB1A 2J7BA 3PBUA 5I24A 3E2SA 4MAVA 5REQA 4ERIA 5HMFA 2VVNA 2ABBA 1NIUA 1M9HA 1ICPA 1J0KA 1J2WA 4BWLA 1BWVA 3GXNA 3EOSA 1LQ2A 4A22A 1BTCA 3WH9A 2Z24A 1E6QM 1Z44A 3OW1A 3QPYA 4B5XA 3SCRA 3FS2A 4N9CA 7PTDA 3BANA 4GX9A 2F84A 4YN5A 3UWUA 4XO6A 3DI1A 3JW7A 5I07A 3GR4A 4DM1A 5C9UA 3MSYA 2FPYA 2J7EA 4GYPA 3O1NA 1MDLA 3NPVA 4J5NA 1JYVA 4GFIA 1B9BA 5FD0A 1NF0A 5CSUA 1R87A 4DWSD 3QLDA 3RJXA 1MVYA 4Z1YA 1QOPA 3WLSA 4EF8A 3KTSA 3AYTA 4DI8A 3TSBA 3CYJA 2W62A 4QAIA 4GQRA 5EFDA 4PSPA 3ARQA 3MZNA 1ZP4A 3SZ8A 4IFKB 3S2LA 4EAMA 4S3JA 3LNMA 5BNKA 1PKMA 4YCOA 3CWHA 3WF1A 4FNQA 2PF8A 2EF9A 2YXOA 3I6TA 4M1BA 3A13A 4ZMGA 3OIHA 1KM1A 1C9WA 1V6UA 2WMIA 5KITA 3ZLGA 2BGSA 3EDJA 1Q6QA 5A6LA 3WJWA 1TPVA 1J9YA 3ARPA 1UZ1A 4WZHA 2OKTA 1EOMA 1W1ZA 5HNUA 1ZBVA 4DWDA 1LLWA 2WC4A 3MUIA 5HJYA 4DBWA 4GNKB 3TTQA 1KBIA 4B90A 1FWRA 3CT2A 1H09A 1SUXA 1VFTA 4ZZ9A 3TR9A 2GLKA 5CC3A 2KX9A 1LTDA 9CGTA 5IOBA 3GTIA 5CJNA 1CGVA 1F8IA 1KM3A 4LUSB 3OLEA 2EKCA 4C1NB 1ZCCA 2B31A 3I6RA 3IJDA 1WBJA 3L2LA 1OEPA 3URBA 3SJNA 4US6A 3VNMA 2PU1A 2FZMA 1UC5A 4C7GA 1FKWA 3S1XA 5EU9A 2VR5A 1A53A 3W7QA 2EKGA 3U8GA 2VNCA 3BH4A 4A8NA 1E9LA 2WHLA 2C0AA 2WHKA 4JIQA 4OIFA 4HOWA 2ACRA 1LOSA 4IQJA 2VYOA 4B2DA 1V3MA 2CLKA 3N29A 4IUGA 4Z2GA 1VCVA 3P0WA 1AA1B 2V5BA 2I14A 1P7TA 3G24A 1Q6CA 4LUTB 2J13A 4JIRA 3VZYA 4WF7A 1XS2A 1UMYA 4YTRA 2NQHA 4FF5A 3OQEA 1BKSA 3TKFA 1F9CA 2A6NA 3UVAA 3VM5A 1EP2A 1WKFA 1F07A 1XFCA 2VEFA 4GISA 3AUOA 1X1OA 3RNDA 5E93A 2FHFA 2OQLA 4HA1A 3EPNA 1JPIA 3BAXA 5LIXX 3CZKA 2C6QA 4BK9A 3IIOA 2ZVIA 3ARVA 2XM1A 1H1ZA 4C6FA 4A8IA 5H2ZA</