1JRBA

The p56a mutant of lactococcus lactis dihydroorotate dehydrogenase a
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLARYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dihydroorotate dehydrogenase A
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
total genus 112
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2001-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1jrbA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jrbA01
1MSSA 2PC4A 2QJIA 3FS2A 1LBMA 3EXSA 4ADTA 5AHFA 4O14A 3F4NA 1GVOA 3TC6A 4Y96A 5D2XA 3G0UA 4N02A 2WKJA 4JR5A 3LCLA 4ZQOA 2NX1A 1OF6A 4MOZA 1KM2A 3IGUA 3WK3A 2EAWA 5DN1A 2H8XA 3OVRA 3O06A 1PE1A 2V30A 3PWAA 4LW7A 3GNDA 3IIXA 6TIMA 2VFFA 4WX2A 1OFBA 1R46A 1LBFA 1LP6A 3M5VA 3TW6A 5D32A 2Q8ZA 1K7XA 4LS2A 4N9BA 1VZWA 3DFOA 5D37A 3R89A 1DQWA 3PG9A 1QO5A 3M0ZA 4JTTA 5K9CA 1X7FA 3S8HA 3EKZA 3TX9A 2FPYA 4X22A 4MZ1A 1RV8A 1TPB1 3W73A 3QSRA 4UCGA 1OJXA 3L5LA 3P62A 4KFOA 3W7KA 4FNSA 4LOCA 3SW6A 3TU9A 3FEMA 4QQ3A 3QMRA 3T4CA 3NQ2A 2JKPA 5FF2A 3E12A 1U83A 4E2BA 1FCUA 1JR1A 2GPTA 2A85A 3S5ZA 3EWXA 4DBEA 4UMBA 4JN6A 4Y8FA 3C61A 3R5EA 2A2IA 4WD0A 3W7CA 2QJGA 5G5IA 2VOMA 4ZQNA 5LGXA 4O8RA 2WO5A 1JRCA 3OA3A 5TQLA 1LRNA 4PC8A 1TPEA 1AG1O 1TPVA 5DCDA 5J5DA 3PBYA 5LHEA 3UZ5A 5F4XA 2ZCGA 3EX4A 1ZCOA 1OYBA 4LRSA 2WJZA 1JQVA 3BGJA 3S5YA 1PIIA 3OIXA 1W5PA 4LVBA 2B0MA 2TSYA 2YCEA 1W8SA 4GUFA 1KFKA 3PR2A 1TQJA 4MJMA 4XQ6A 4JNMA 1LYXA 3NL3A 4A2SA 1F5ZA 1V7YA 3PBUA 1H7RA 4OQVA 3TV8A 4NJJA 5CPOA 1H5YA 3W87A 3PUOA 4MLJA 1O4UA 3RF9A 4O52A 1G6CA 1DOSA 3GAYA 1KM3A 4DPPA 4O54A 1RPXA 1JCXA 1OVDA 3M5ZA 5DCBA 4UFKA 2E5BA 4JTFA 4DPQA 2HSAA 3WK2A 3SFKA 2C0AA 1W5MA 3IEBA 1AW5A 5U7SA 1F76A 4A2RA 1XCFA 4GBUA 3DENA 3SSJA 3BGGA 4M6PA 3PULA 1GQNA 3LHVA 1IGSA 3NQ7A 3W1QA 3A5FA 1SUXA 5CZSA 1X8FA 3M6YA 2B7OA 4O12A 1O60A 1R2TA 4FNQA 3UY8A 2W6RA 2H90A 2YDAA 3NEVA 3W7NA 1FWTA 4ZVJA 3IIVA 5CZJA 4CQ8A 4JDBA 3NR0A 4JYFA 2QCNA 3QW4B 4MVAA 5D02A 1VLIA 1VPXA 1ML1A 3ZWSA 3ATZA 3PUDA 4GWEA 4O4VA 5I3HA 3T44A 3C2VA 4HNTA 2V5BA 1BKSA 4E2DA 3CU2A 3LXAA 4HNNA 4O13A 3P7YA 3W07A 1G4EA 2DZWA 3BARA 4FNTA 4X2RA 4JEQA 4NZJA 3TJXA 2XFWA 3A22A 1IXOA 3LOTA 1KA9F 2AAMA 3PBWA 3QEZA 2A5HA 4LC8A 1WV2A 1S3HA 4NVTA 3PF3A 3LERA 2CZ5A 1B4KA 5CSSA 3MHUA 3KHJA 4QNEA 4H6KA 1KFJA 1K8ZA 3QFEA 3EKLA 3WK1A 2ZZ3A 2Y88A 4ZQPA 3TFCA 1Q45A 4XWUA 2NXHA 1OYAA 2B7QA 4O18A 1OFDA 3GKFA 3OVQA 5H2ZA 3BV4A 3VE7A 5HUOA 1GVQA 4LC6A 1H51A 3CB8A 1VRDA 4RXFA 1O94A 1VR6A 3IVTA 4UTMA 3IRDA 1RVGA 3BW3A 4ALDA 1WBHA 5EYWA 3LB0A 1OX4A 3QC3A 3TKFA 3GXNA 2CLMA 3S1XA 4LNYA 1NVMA 3M16A 2BLEA 2V82A 4IX2A 2ZRWA 2FPVA 3MYOA 5FESA 1HUVA 4LS1A 1A53A 4FNRA 1LRQA 1NSJA 3VFLA 4PODA 2VC6A 5D09A 5D30A 3T40A 4GC4A 3LRLA 1M6JA 1DV7A 2Y70A 4O15A 5CPMA 5AFDA 4HPJA 1OF8A 4FIRA 1JULA 1F05A 3ELFA 5I3KA 3LRKA 2A1YA 3EWWA 3HIJA 2HTMA 7TIMA 1QOPA 4NXSA 4PH6A 3I6RA 2JK2A 1JCMP 4Z0SA 1OX6A 3QH2A 3BG9A 3W7GA 5L6UA 4LV9A 3C0JA 4DEFA 5KINA 5CZ0A 5G4WA 3AJXA 5EA9A 1NF0A 5DY2A 4K37A 3L65A 2GVLA 3MYPA 3LHYA 1VS1A 2GQAA 1KTBA 3L67A 2Q3OA 3G22A 3M7WA 1C29A 3W70A 1EIXA 3LHZA 4BWLA 3QYQA 2WNQA 3UY7A 5HINA 5HR6A 3QQ1A 3NPUA 3HF3A 2ZDRA 3N2XA 3KRUA 5HULA 3W22A 3M41A 1KLZA 5CPNA 1JUEA 5J5RA 3UWYA 1P0NA 3MI6A 4AHOA 5K7JA 2QUUA 3W7HA 1H62A 1UCWA 3W74A 1B9BA 3KVLA 4XBSA 4QITA 1G4PA 3DI0A 5C55A 3EWYA 3W1AA 4GUIA 1AW1A 3V75A 4AHQA 1TIMA 1EP1A 1TYGA 1DBTA 4K7YA 4OE7A 4LY8A 2YR1A 1LORA 5AN7A 1N7KA 2Y62A 3GB6A 5HMSA 3I7RA 2YZRA 1KM0A 6ALDA 1TV5A 1W5NA 2NWSA 4I7WA 2QDGA 3TW7A 4LUJA 4GUJA 4RCXA 4LV4A 4DF2A 2PURA 3FJLA 1HG3A 3UWVA 5E93A 2ZA2A 5HR7A 1FCBA 1SU5A 3CC1A 2CLIA 1W0MA 1GYNA 1K8XA 1TB3A 4S2CA 2G5WA 4LTSA 4ORIA 1SQ7A 3W1XA 4QM1A 4LT9A 4A22A 3L9CA 3CEUA 2Q8LA 4PL2A 3MBDA 2H8ZA 5KZMA 3PY2A 2BX7A 4D2JA 2BXVA 2E09A 4G1KA 4UFMA 2CW6A 4Y9AA 5D2YA 4NJIA 1ZNNA 5F4SA 3B4UA 3QPZA 4JY9A 3S5OA 1YXYA 2BZNA 5E0KA 3QZEA 3MHGA 5G2WA 2R14A 3Q58A 3R8RA 1KV8A 5SWUA 3C6CA 2E5DA 2VENA 5DXXA 4UTHA 2GQ8A 2PRMA 3HGRA 5D38A 3GXTA 4JDYA 5AYYA 3M5XA 2CLFA 5LKYA 4EF9A 4POCA 4XKYA 2OZ0A 1EPXA 4M6QA 1PL9A 1DJQA 2X2GA 3HGOA 3HGSA 1XBVA 5KZEA 3P61A 3DKLA 4OT7A 1QPQA 3GR8A 4HIBA 1W56A 2FFCA 4UUIA 4CCDA 4LVGA 4QAIA 1MXSA 3B04A 1WX0A 2WNZA 4JTKA 1Q6OA 3DAQA 2CU0A 3LCWA 4JX6A 1TTIA 4IMFA 4WJEA 3TMQA 2Z0IA 2AQWA 3C2EA 4UTLA 1QO2A 3LLFA 4S2BA 5D04C 3NYZA 4ADSA 1RQHA 4ICNA 1L2UA 3W23A 2Q3RA 1GWJA 3I7QA 1OX5A 1ZJIA 5AOUA 4JGDA 4CNNA 2CLLA 3LTSA 3C52A 3P5ZA 4OV4A 3LCHA 5K9XA 2HS8A 2ZZ4A 3P8JA 3STFA 3N19B 4LVDA 2FTPA 2BWGA 5AHMA 5AYXA 3B0UX 2GOUA 1OG0A 4JTLA 4CQ9A 4JD4A 2E5CA 2GQ9A 1ICQA 1ZENA 3VKJA 5C2XA 1R30A 1VYSX 2CWNA 3FYPA 4ZQRA 3LV5A 1YXCA 3EWBX 1K7EA 1VHNA 1X1ZA 1UUMA 3FKKA 1BWLA 4P61A 1LDCA 1R47A 5LNVA 1B4EA 5FEWA 1VHCA 4OU1A 3PBVA 4O50A 3S0CA 3R13A 3W3OA 1EEPA 3A24A 4XUGA 4K6AA 3NQMA 2VEMA 1QFEA 2CZFA 4CNOA 1SZFA 2FJKA 4BI5A 5TBOA 2YW3A 1ZAIA 4QISA 1GJPA 4FHAA 4DO5A 3RK8A 2QEZA 1H63A 2TMDA 3NVTA 2DJXA 2H3BA 4XTDA 2ZQ0A 1NEYA 3ABRA 3LTYA 1TO3A 5DELA 1H1ZA 3W7IA 4NJKA 2C19A 1MEWA 2DZSA 2EHHA 3FYOA 1TRDA 5AC6A 4K7VA 3SI9A 2NWRA 4FNUA 4UR7A 3NOEA 2X1SA 1AW2A 2V81A 3E0IA 4HSNA 1LOSA 4KKXA 3B0VC 3O16A 3ZWTA 4HKPA 3JS3A 3PC0A 5MHBA 3HO8A 4BK9A 4IMEA 3DHDA 4AEOA 1HFBA 1QPOA 2X16A 4JICA 2ZRZA 3CEPA 3O63A 5K3VA 3IIOA 3G1VA 3BPWA 5EY5A 4O10A 2V8ZA 3UWZA 2YW4A 1VJIA 1EUAA 3NQEA 2DJLA 1OK6A 1XL9A 3W7RA 1VYRA 2VFIA 2VEPA 2NLIA 3T78A 3DI1A 3W84A 5HWJA 3W1MA 1H60A 4WOQA 1AK5A 4OBTA 4UTUA 3MHFA 5D2WA 3UD6A 3NZRA 1TTQA 3GX9A 2QCGA 3PUEA 1X6UA 1YADA 1H1YA 4BI6A 3NPWA 4TO8A 1IIGA 3S6DA 4MFEA 4IWWA 3ABQA 1ALDA 3NPVA 2OMAA 3NQFA 3VE9A 2V2DA 2ABAA 3C56A 1JVNA 5FF7A 4UMAA 4RJEA 1OFAA 3W1RA 2OT1A 5IBXC 5KZDA 2V0TA 4K8EA 3GK0A 2Y7GA 2ISVA 2R91A 5TIMA 3TQVA 2A7NA 5U4NA 4RZ6A 3NGJA 4AHPA 3ABOA 5AHLA 3NZ1A 3WK0A 4IMDA 1LTDA 2QKFA 4ZZ9A 3LHWA 1SPQA 4RXGA 2WNNA 3BLFA 3GDRA 4NJGA 3L0KA 1CX9A 1SZGA 4HPXA 4IQLA 3PSWA 3SIZA 3WJSA 1I2QA 4YCOA 2C1HA 5LNUA 3A9IA 3C3NA 3I65A 3NXFA 1PHWA 1OFEA 4Q4KA 4N9DA 4RK8A 8TIMA 2PCQA 3G1YA 2E68A 3GKAA 4E0CA 1P5BA 2XN0A 3O07A 2KZHA 1W31A 3IIZA 1XI3A 3C4UA 4AMAA 3PAJA 5KMYA 1EA0A 4OHQA 4AAJA 4NU7A 1J5TA 4NNCA 3EWZA 2PRLA 2O7QA 1MEIA 3GDTA 4W9TA 3KVJA 4WQ6A 2P10A 5IBXA 3TIMA 2IQTA 3G1FA 3P82A 1ICSA 2ZTJA 4NUWA 2QCMA 4CCCA 4TX9A 2OT0A 2WQPA 1BTMA 5D2TA 3CIXA 3G8RA 3EX6A 1XBZA 2YX0A 4FXRA 1PCWA 4XZ9A 1G7VA 1SW0A 2ALDA 5DY3A 4AWUA 1ONRA 4K8HA 5EMUA 4UTWC 3G24A 3MWAA 1Y0EA 3HQ1A 1L6WA 4ORMA 4FF7A 1ICPA 3G1DA 2Z2UA 3DZ1A 4GXMA 1TRIA 3ATYA 4JTHA 3TDFA 1M7OA 1OFRA 3T55A 3IV3A 3P80A 3BG5A 4WZHA 3BW2A 4QNWA 3UWWA 3PB0A 4HN4A 3N3MA 2X30A 4ZQMA 3TQ0A 4MZ8A 5DBTA 4IPJA 3LTPA 1RR2A 4I7UA 4CNPA 1VLWA 2J9YA 2X1RA 2Y6ZA 3KFTA 1ME7A 4HHPA 4LVAA 4K38A 3V1PA 4UFJA 4LRTA 1ZFJA 3THQA 2V2CA 1RQEA 4ML9A 3TXZA 4PCFA 1N8FA 1VCVA 2Y61A 3M47A 5AYZA 3A23A 3W1TA 3CTLA 4JIQA 4YWIA 1VQTA 1WBJA 2GUUA 4WXZA 3DFNA 4YXGA 3H54A 3NNTA 2JGQA 5BOOA 4YLWA 4MLRA 2E6YA 1FWNA 3UWUA 4Z1AA 1GPWA 2QCEA 2ATSA 2FQIA 3O8AA 3P5YA 1CI1A 3LRMA 3HG2A 5K4XA 4O57A 4FO4A 2YSWA 1FXQA 2NX9A 4UTWA 3HPSA 1VC4A 5AC8A 2YXGA 1QAPA 3G1AA 4HNUA 2CZDA 1P1XA 1YYAA 3LDVA 3GDLA 3TCEA 1QWGA 1IXPA 3W7PA 3LI0A 1H7WA 3HMJG 4YCPA 4EOUA 3MP3A 1THFD 5FEPA 3P67A 3CWNA 1C8VA 2R8WA 1DQXA 3EXTA 1DORA 2B4GA 1HL2A 1G4SA 2DORA 1GVFA 1P0KA 1EUNA 4BWLC 4UFHA 1K3UA 1QPRA 4MY8A 1R2RA 4MY1A 1VCFA 2PRHA 3FKRA 3EEGA 3GLCA 1WOBA 3SY5A 1ADOA 1OABA 2RDUA 2NV2A 2QJHA 1Q6RA 1ME8A 2QCDB 3W2NA 4NZFA 2I9EA 1F6PA 4DBDA 2CLOA 1XDLA 1RQBA 1IXQA 2NV1A 4AH7A 5HUPA 5F2GA 1Q3NA 3FJ6A 3GYEA 4MY9A 4AB4A 3W2MA 4TMBA 2CLEA 3W2KA 3WJYA 4Y90A 2JKAA 3PVFA 4PEKA 5LNRA 3TFXA 5E1QA 4MFDA 3QRHA 1UASA 1KFBA 4UFIA 3ABSA 4NJHA 5LNSA 4S1FA 1FWSA 4MYXA 3ANYA 3IIPA 2X1TA 5G4EA 1JUBA 1H7NA 1NAL1 2P1FA 5KTLA 2VFEA 3KVKA 4AVFA 3GAKA 1TPDA 1FY6A 3FOKA 4Z08A 3JRKA 1Z41A 2A6LA 4TMCA 2A7PA 1K8YA 2A6NA 4LUIA 3H53A 4JIPA 5ABTA 1XXXA 1GVSA 1YXDA 3Q94A 1M7PA 3LCXA 1SFLA 3W9ZA 4O1AA 1K7FA 5I3FA 3TNOA 1YPIA 2E1DA 5BW6A 3F1QA 3MMTA 1C9DA 2FDSA 4JTEA 3M5YA 3NO5A 1T0OA 2FB3A 4HT3A 4N6EA 4MPQA 3DFQA 1B57A 1JCNA 2TPSA 4O0ZA 4YMZA 1DHPA 3HPXA 5DLCA 1G7UA 1I2RA 4ZL1A 1FDZA 5DBUA 3SJ3A 2DP3A 4PA8A 1WQ5A 3LM7A 1A5BA 2VEKA 1S5TA 2QCFA 4UR8A 3TA6A 2CZEA 4RV8A 5LNWA 3DBPA 2AGKA 3W2UA 3LHTA 4DF0A 4GUGA 2ZA1A 4IPIA 1KBJA 1YTDA 1QDSA 1GZGA 3CM4A 3LXBA 2HMCA 2EKCA 5FEZA 1GEQA 5EKYA 4GE8A 3USBA 5D03A 1QR7A 3BG3A 3THAA 1SSGA 2XN2A 4EF8A 2E6DA 1TJRA 4A21A 1V5XA 1ZHAA 4N4QA 1LLZA 3W2JA 1G69A 5F2MA 3TAKA 1VCGA 2HS6A 4UXDA 1H61A 1AL8A 1VGAA 4X3ZA 4LVFA 2VELA 3NQ8A 2D73A 4JTIA 4FXSA 3TSDA 3W7LA 1YDOA 3E9AA 3L0GA 3QM3A 4JTJA 3S42A 4DQWA 2V5LA 1RD5A 5I3JA 3HBLA 2C13A 3CPRA 1Z42A 1TPWA 3SR7A 1Q6QA 4O1BA 3DGRA 2ATMA 1LZOA 2GJLA 1OFPA 1TMHA 5I3GA 1WA3A 3LLDA 5GVJA 3BLIA 3QMSA 3BO9A 3F4WA 3IGSA 2VKZG 3QPYA 1MEHA 1DL3A 2QAPA 3O1NA 2ISWA 3KRZA 3L2IA 3W1LA 3NQGA 3O05A 2YFOA 1GVRA 1QNVA 1SW7A 4N2YA 1H7XA 2DZTA 2ZRYA 3INPA 3LV6A 3RFAA 4R33A 1ZY9A 1OYCA 3N34A 1QPNA 1YLVA 3OG3A 4UNLA 3TROA 3R2GA 3T7VA 2H3DA 1SFJA 4O0KA 1KTCA 1GOXA 3W7MA 3SGUA 2YPIA 2Y7FA 2PE4A 3TSMA 3NDOA 4ZQCA 1J4EA 3BVJA 4BI7A 5AC7A 4M5PA 2RHGA 4UNKA 1A5AA 2X1UA 3MUXA 2BTMA 4JY8A 5F1VA 1XBXA 3OHIA 4EVZA 3Q37A 1H50A 3MI2A 4KFNA 3DKJA 1Z44A 4NX0A 3HJZA 2EPHA 4N9EA 3MO7A 4U28A 4TIMA 3G18A 1SR9A 1FCVA 1FBAA 3HG5A 3LHUA 2JGYA 1O5XA 5LGZA 4DXVA 5G2IA 1KLYA 3P74A 4M6VA 3P8IA 3TK7A 3CIWA 1KV5A 3LI1A 4I7VA 1KM1A 2YGYA 3K30A 3IVUA 5AHEA 5F1UA 1KM4A 3D0CA 2C3ZA 4O4WA 5T26A 4GJ1A 3QW3A 2NZLA 3VCRA 1TPC1 1JRBA 2WSRA 1SW3A 2QAFA 3EX1A 3G1SA 1FXPA 4GUHA 4H4IA 1TQXA 2DZVA 1XUUA 3DFTA 3ZR4A 1LOQA 1F7BA 4FIQA 2A21A 2ZZ5A 4OV9A 1FQ0A 4WY0B 2VEIA 1M5WA 1GTHA 5DXYA 2ZFAA 3STGA 3VNDA 3RMJA 3UQNA 2QCLA 4CLMA 2NXIA 1IIHA 1W3IA 4JX5A 1J2WA 1TPUA 4LU0A 5KITA 5CPLA 2CFFA 1CW2A 5LHFA 1A5SA 2NUXA 1TTPA 3P60A 3R12A 4M19A 3BW4A 3U2OA 3O6YX 2C6QA 1T99A 2YYUA 1TSIA 2CLHA 4TU1A 2VXNA 3FIGA 2ZTKA 3NA8A 3KXQA 1UBSA 4Q32A 1ME9A 2QCHA 1FX6A 4AF0B 2WSYA 1DKWA 1I2OA 1SO5A 2FB2A 3KOFA 1TCDA 4RR4A 1K03A 1H7OA 4Z0JA 3NQ6A 3W86A 2Y63A 1EWEA 4UTIA 4K36A 2VFGA 4NNAA 3W7QA 4JYDA 1GYLA 3B05A 3C2OA 3MP5A 3TH6A 2J24A 4IGHA 1IF2A 2H6RA 1EWDA 2TYSA 4ADUA 4C1LA 3GIYA 4FX6M 5F2LA 2DU2A 3LCGA 4KWWA 3B03A 4Z1CA 2ZRUA 4TR9A 3RU6A 4MIMA 2YYTA 3LXCA 5K2ZA 2W79A 3U8GA 3W83A 4IXXA 2QUVA 2WPBA 1F6KA 1YDNA 1W3TA 3CWOX 3NG3A 4NX5A 3QSTA 3H55A 3LBCA 4JTUA 3PSVA 4HSOA 4O28A 1E51A 2Y7EA 4MKNA 2I1OA 1W1ZA 1H7PA 4NT0A 3QQ0A 3NPXA 4JYEA 4MUZA 2FLIA 1WXJA 3OBKA 4E38A 1PCKA 3GR7A 4EWND 1SO4A 1VYPX 3S1UA 3HG3A 4N4PA 4PFMA 1RZMA 1HTIA 2C18A 4M7TA 3C8FA 4O17A 1TPFA 1OFOA 4O19A 4AWSA 1KM5A 1XM3A 1DJNA 2EGZA 3NQVA 2Y7DA 4Q33A 2DZXA 4CCEA 3IGXA 1EB3A 4FX7A 4O1DA 4B5NA 3EWUA 5C54A 1OK4A 2VFDA 3WJXA 4Y6GA 4IJBA 3W1NA 1XC4A 3DFPA 4O1CA 4IOTA 5HNRA 1I2NA 1PV8A 4RX0A 5D33A 4XTIA 1U5JA 5C6MA 5KSWA 5A8GA 4OGZA 3B8DA 3GDMA 2A0NA 3DH7A 5A5WA 3U6WA 4JTSA 4JS3A 3F03K 3OVPA 1FWRA 2RDTA 4RLIA 3NM1A 4FEZA 3ZS4A 3G3DA 2QR6A 1BEUA 2JKEA 3LX9A 5CSRA 3G8EA 2R94A 2ZRXA 1HO1A 2GJNA 1GT8A 2ZZ7A 3AO0A 3UZJA 5FEXA 2GVJA 3SECA 4RZ5A 2ZA3A 5K9DA 1GTEA 2E77A 1P4CA 3KAOA 4PL1A 3KX6A 1SO6A 1O95A 1LM1A 3W71A 1T96A 4WOZA 5BNKA 1FUYA 5HJLA 3W7DA 3O15A 2G95A 3BK0A 1W5OA 3L5MA 4A29A 4IMGA 1YTEA 2OX1A 3CT7A 4XBKA 5G2HA 5G1YA 4PTNA 5CG7A 3W75A 3G0XA 2FIQA 1VH7A 3IVSA 3TR2A 3M1ZA 1KBIA 4IX0A 1JUKA 1JQXA 4QIUA 3HOJA 2RKXA 4NNBA 4N9CA 4M7SA 3E02A 2QCDA 3CHVA 2QDHA 3WJZA 2QF7A 5F2IA 1I45A 1XBYA 1ZALA 1KW1A 2A7RA 3I7SA 3TE9A 1KTNA 3KRSA 4JXCA 5HWNA 1A50A 1NFBA 3I68A 3NQDA 4LWWA 2NUWA 3C2FA 2TRSA 3MW7A 3SGZA 4GFSA 1PVNA 3W88A 3HB9A 3NQCA 3EX3A 3PM6A 1TV8A 3G1XA 1I4NA 2ABBA 1XDMA 4Z1DA 1XKYA 4L4LA 4U4MA 1LCOA 1TJPA 2F7FA 5EBUA 1R2SA 3L5AA 4BF9A 5LSMA 1B3OA 4P2VA 1D3GA 1JJKA 2O7SA 3LGEA 5EPDA 1ZAHA 2F84A 3BLEA 3NL2A 4H3DA 4J9JA 5D2VA 1QCWA 4KWVA 3MBFA 3S1VA 5BRBA 4NXKA 1TV7A 1FDYA 2DZUA 3NL6A 1W5QA 4MJZA 1DVJA 3TMLA 2V9DA 2QUTA 4ZMGA 4IUOA 2J27A 4A3UA 5BMWA 5I3IA 1O5KA 1EP3A 2JBMA 2ZZ6A 2J6XA 3GNNA 3EX2A 2J88A 3UNDA 3UPBA 1JCYA 1LRTA 2XN1A 1S5VA 2C15A 3UYCA 3CQ0A 2E6FA 1WDWA 1X1OA 3G0SA 5AB3A 3GVGA 4IXHA 1FCQA 3MI3A 2I14A 5D05A 1FWWA 1YPFA 3N73A 1OX4B 4NQ1A 5G1TA 2ZZ1A 5C5YA 3RLVA 1NF7A 3HG4A 1JCLA 1I8JA 1MZHA 2BSLA 3CLMA 3C2RA 5FF0A 3B06A 1OFQA 1D3HA 4OWGA 2QCCA 3SZ8A 3YPIA 3PG8A 1UB3A 1T8XA 5HQEA 4JX4A 2ZYFA 5FI8A 3S9YA 3W6YA 4L4MA 3TUUA 1YDVA 1QMLA 2ZRVA 4C1KA 1QOQA 4FNPA 4UIOA 1ZAJA 3EXRA 1EX5A 3GXPA 2ZBTA 5DCEA 3DU0A 1S5WA 5H91A 4RZ4A 3N14A 4K39A 3Q2DA 3NM3A 1HO4A 3P81A 1TPH1 3GDKA 1L6YA 2OCZA 3M44A 5CZTA 3M43A 4WUIA 3UWQA 1L9WA 2WSQA 3GZ3A 1FDJA 1KM6A 1YTKA 2B7NA 2ISSA 3G1HA 4IMCA 1AL7A 3W76A 5AHNA 3QF0A 2UV8G 4YL2A 1G4TA 4MZYA 3VI2A 1LLWA 5L9FA 2A4AA 3RLUA 2EF9A 2NXGA 3PB2A 4LS0A 4JTGA 4QJ1A 4HNVA 1SSDA 3N9SA 1K02A 3L21A 4UMCA 2C16A 2RH9A 5AHIA 5CGQA 2YFNA 4WXYA 3RNDA 2J9ZA 3G3MA 4QSHA 4O53A 1D9EA 4FX8A 1MO0A 3E96A 1AMKA 3FFSA 4ONVA 1LROA 3QMTA 3W7JA 4DO6A 3L68A 1F2JA 1LOLA 3JR2A 3NAVA 1TTJA 3UXDA 1PHQA 3UXAA 4GNJA 3TC7A 5CKSA 3L0NA 4R53A 1JCJA 2FPTA 3W1PA 3S5NA 4GRSA 2Z6JA 4O11A 4WY0F 1F73A 1SZNA 3MJYA 4BFAA 3DHFA 3ZFHA 1WOAA 4R7JA 1W54A 4EIVA 1SO3A 3M9YA 4RKAA 4UTKA 2J9XA 4UTJA 4N6FA 4BR1A 3TJLA 1XUZA 1PS9A 3N2MA 4UTTC 2DZPA 3W1UA 3L66A 1GG1A 1SZEA 4DELA 3MP4A 1EP2A 2E6AA 1TREA 5HWMA 3LCFA 2WV8A 4R34A 3DFSA 4DF1A 5F4WA 2NX3A 3HPZA 3W72A 4X9SA 1KFEA 2B7PA 1N55A 3N9RA 3WJWA 2G96A 3DXIA 3W2LA 3HGJA 1W37A 2Z1BA 1GG0A 5IM51 3E49A 1A5CA 3S1WA 4UC5A 1UUOA 1W3NA 2NUYA 4AXKA 2Y89A 3QJAA 3A21A 3NL5A 2GVGA 5FF3A 1KFCA 1Z48A 1I2PA 1Q6LA 3WFAA 4UFLA 2ZZ2A 5LZLA 3STEA 3PS7A 3LBMA 3STCA 3NQAA 4WY0A 2V2HA 3FLUA 4MYAA 1F74A 2WOQA 3W7OA 4UTTA 2C14A 5EL1A 5FF4A 1WYIA 4KFPA 4XKYB 2RFGA 1BWKA 3TSBA 2OJPA 2Z6IA 5K4ZA 3KVMA 3EB2A 4DO4A 3UPWA 4FB7A 1LBLA 4O16A 3TAOA 3O6CA 3P84A 4Z1BA 2Y85A 1G67A 4I9AA 4AF0A 2CLKA 2RDWA 3B0PA 2LLEA 3A5VA 2G97A 2P0OA 3O6DA 5BMXA 3W7EA 3W85A 3FA5A 1WAUA 2W0UA 2VFHA 1L6SA 1KFLA 3TQKA 4CQAA 3LCIA 1OHLA 3OEXA 1IXNA 3TXVA 1UJPA 4AWTA 1XFBA
chains in the Genus database with same CATH superfamily
1X39A 3FS2A 2PTXA 2WJEA 3RRAA 2D0FA 3F4NA 1GVOA 5D2XA 5BOEA 1X38A 2Z2BA 3N15A 1LG1A 4HHLA 4ZQOA 5HA7A 1XP3A 1VF8A 1TWIA 1YIXA 5DN1A 2EAWA 4BQ5A 3O06A 3URBA 3UA3A 1TV3A 2QPUA 3GNDA 4OUEA 1VB9A 3ARTA 4H2HA 5DMNA 4WX2A 1R46A 1RLDA 4Q8OA 5FJIA 1LBFA 1LP6A 3M5VA 3TJ4A 3O6AA 1K9TA 5D32A 2Q8ZA 1XH1A 4LS2A 2VZVA 4JHMA 1ISXA 2Y24A 4U31A 1LL7A 2WHKA 1X7FA 3CK5A 5K9CA 2NSXA 3S8HA 2FPYA 4MZ1A 3W73A 4UWMA 3QSRA 4H9MA 2CXEA 3OGRA 1Z8AA 3BMXA 4FNSA 3SW6A 1FHLA 4PTDA 1PZ3A 3QXBA 2NVCA 3H12A 2PDNA 4M3PA 4B9YA 1ZJAA 2OYKA 1JR1A 4ZB5A 3S5ZA 4LYPA 3URQA 4JFTA 3C61A 2A2IA 5AYIA 2VGBA 3V5CA 2DDXA 2WO5A 4ILSA 2GDQA 2PDHA 4G8TA 3AIUA 4PC8A 1TPEA 1AG1O 5LHEA 5DCDA 3PBYA 5D9NA 3SCPA 2WJZA 3OIXA 3BUVA 3PZGA 2EPLX 3CUHA 2B0MA 2YCEA 4LVBA 4ATWA 4Z1YA 1GJWA 4MJMA 5RUBA 4GKLA 3CJPA 4DUVA 1LYXA 5I78A 4A2SA 1F5ZA 3DDMA 4OQVA 3TV8A 1EDGA 1RBLA 4AZ5A 3PUOA 2G4FA 2GSEA 4LANA 1G6CA 3GAYA 3PZOA 3WH7A 3QC0A 1M01A 2PP3A 3TCSA 1JCXA 3GXDA 5DCBA 3CH9A 1UMYA 4UFKA 2GGEA 4JTFA 4J27A 2QF8A 4C5YA 5A6KA 1PEZA 1W5MA 7REQB 1AW5A 5U7SA 1DTUA 2ZUMA 1S46A 3DENA 3T09A 2E40A 3SSJA 4M6PA 3PZTA 1GQNA 3IJ7A 3W1QA 3A5FA 2AQVA 2ISFA 2VUNA 4NIRA 1KRAC 4W8LA 5CZSA 5AY7A 4GVGA 3ZJ8A 4LF2A 4BA0A 2H90A 2YDAA 2OWCA 1M03A 1A0DA 3IIVA 1VEOA 4ACZB 5JXQA 4LPCA 3NR0A 2PPGA 2QCNA 3ABZA 3QW4B 5D02A 1VLIA 1VPXA 1ML1A 1DIKA 3VDBA 3PUDA 3BJTA 2V5BA 2EBNA 5AVHA 4HYWA 4RPPA 1B9ZA 2YCLB 4JEQA 3TJXA 3A22A 1IXOA 9RUBA 1YNPA 4P8UA 4XV0A 4KH2A 2G8ZA 2X09A 3PBWA 3KE0A 2A5HA 4NVTA 4E2VA 5CSSA 4F48A 3KHJA 4QNEA 1KFJA 4X0NA 3WK1A 1UD8A 2F8QA 1PX8A 1Q45A 1WZKA 3JVAA 3LPFA 4Q4RA 3OVQA 4HJFA 2WZMA 1E6RA 4LC6A 1SJCA 2J13A 1CCWB 3WKZA 3BW3A 1WBHA 4GMEA 3TKFA 3BSHA 3S1XA 4QRNA 4AU0A 4IX2A 5I77A 1PYFA 5EMKA 3C86A 1HNYA 2X7VA 2XHYA 3MYOA 5FESA 1MFVA 4PB5A 1LRQA 3VFLA 3BICA 5D09A 5D30A 4ENLA 4RNFA 3LRLA 1XHGA 4P8VA 1OIMA 4RE0A 5AFDA 4HPJA 1OF8A 1B90A 4DJDD 3CMJA 3RX2A 1V79A 3VGEA 1H5VA 3U0HA 1J93A 5I06A 1QOPA 3B8WA 3SB0A 3I6RA 3HJEA 3BG9A 1TZ7A 3SRKA 5CZ0A 1OC6A 4K37A 4PB4A 2GVLA 2ZADA 3WLNA 1UR8A 4AEEA 1C29A 1EIXA 3A4AA 3QYQA 4FLRA 3POCA 3UY7A 3QQ1A 2CBJA 3WNNA 3W22A 3MUCA 5J5RA 1A5OC 1NWTA 2QUUA 9CGTA 1H62A 3W74A 3KVLA 1G4PA 5M03A 4BF7A 5CH9A 1P1MA 3FXYA 7ENLA 2HCVA 1TIMA 3S2NA 6REQB 3DC0A 5AN7A 1KO0A 2WQDA 4C90A 2NVDA 3GB6A 5HMSA 4JIHA 1KM0A 1XLMA 3TW7A 4C6MA 1DIDA 4HPGA 5FL0A 4DBWA 1KBLA 5FJOA 1W1B1 1A0EA 2QXWA 4LV4A 3QYSA 2PURA 4ZENA 3WN6A 2I57A 3R0DA 3WF2A 3CC1A 2WBKA 5A2AA 3W82A 2UBPC 4S2CA 5CG0A 3W1XA 2J7HA 4H7CA 4B92A 4PUUA 2PDGA 1YE4A 3PY2A 1Q66A 2BXVA 3TYUA 1XRTA 3BLLA 1ZNNA 3V5FA 5HPCA 3LMZA 1Q6CA 3RN6A 3B4UA 4JY9A 1JPDX 3OLIA 2OWXA 1XLCA 1YXYA 2BZNA 4C6DA 3PFMA 3L7RA 5GQBA 3MHGA 5IHSA 3NDZA 4QJ5B 3R8RA 4F2BA 6PTDA 4FZIA 5SWUA 3C6CA 3BANA 2EO7A 4UTHA 2PRMA 1HJVA 1RAKA 5D38A 5B80A 4XKYA 3LSCA 3NXLA 2V5DA 4NAEB 1RP8A 1OZQA 3HGSA 5KZEA 4HIBA 2VHLA 3B04A 1WX0A 2WNZA 3EOLA 1D7KA 3DAQA 2WZTA 2CU0A 2G3IA 3LY0A 3G2GA 1XRSA 3OU8A 3NO3A 4JX6A 1TTIA 5CGTA 5EMYA 3TMQA 2R1NA 1ZZMA 2XSAA 2VVSA 1OX5A 1ZJIA 3P5ZA 3CB3A 1M7XA 1W91A 3QZAA 2C8NA 5K9XA 2HS8A 3P8JA 3MT1A 5DRCA 4LVDA 1HKVA 5AYXA 3LNPA 4JTLA 5FACA 2PLKA 2I5QA 4G1NA 5C9ZA 1P7TB 3UXKA 1VYSX 3QOMA 3LQGA 3FYPA 1A4MA 3M0VA 2DT3A 2GJXA 4R9XA 3WD3A 1XINA 1BWLA 3AXMA 1EJUC 1A5LC 2QDEA 3S1GA 2DIKA 2FZ8A 1EEPA 4YTQA 4E8DA 3KL3A 4B5TA 1S2CA 2FJKA 5TBOA 5A2CA 4QISA 4AYSA 4FHAA 4DO5A 3W29A 3RK8A 2QEZA 2VC9A 4MJ2A 1FRBA 1TO3A 5DELA 3MVTA 2ZE3A 4JQ3A 2ZUNA 3BL3A 3AALA 1V6WA 2EHHA 1MW3A 4FNUA 3TTYA 3AZRA 4IFKA 4LAUA 1IEWA 1EO5A 3AIQA 2QVHA 1R9YA 2V81A 3UU0A 3LLXA 4ZE4A 3OJGA 3O16A 2PGWA 4GI6A 3BAYA 5A94A 3OHMB 4FI4A 4DN1A 1HFBA 1QPOA 3O63A 1X6NA 5K3VA 2CHNA 3G1VA 4HTYA 2FKPA 3AUJA 3GC2A 5A95A 1XL9A 3GU1A 3W1MA 5DANA 1AK5A 3MUY1 1QHZA 5CSYA 3IUHA 4E3TA 4HBKA 2NQ5A 2NQLA 2E1WA 3SM0A 1H1YA 1IIGA 3QHNA 1EYWA 2Z1VA 3ABQA 1ALDA 3NQFA 4HN8A 2W3ZA 3BOLA 3ORWA 5I2UA 3RUBL 1S38A 4NP7A 3N2TA 5IBXC 2V0TA 3W02A 1J01A 3KTXA 1E3ZA 1RY0A 3VIFA 2R91A 3GSMA 5U4NA 4RZ6A 3ABOA 5AHLA 4ZZ9A 5BWFA 2VM8A 3CUJA 4I8YA 3LHWA 3WQGA 1SPQA 4RXGA 4E4PA 5D8ZA 3GDRA 1WP6A 4NJGA 3N6QA 1A5KC 1SZGA 4IQLA 4GHRA 3ZMRA 3I65A 2FGLA 3G1YA 2E68A 3GKAA 3RITA 1DTNA 4E0CA 2DSVA 2BOFX 3R11A 4M51A 1TZZA 2AOSA 4AX7A 3IIZA 4A6GA 3WDRA 5DF0A 4AMAA 4CQDA 3MCNA 2BHUA 4XZNX 3U4FA 3ARYA 4AAJA 4NU7A 1YRRA 4W9TA 4WQ6A 3RM8A 4DXXA 5IBXA 1XD0A 4JFSA 4QG9A 3M0HA 3WQPA 4G6CA 1KWKA 2ZTJA 1JAEA 1HQTA 4NUWA 4B5UA 4I3GA 3W6MA 4TX9A 1JZ5A 3C2YA 1M68A 2XGZA 4XZ9A 1G7VA 1CGUA 8RUCA 4AWUA 5EMUA 5CEWA 2OYLA 3MKVA 3HQ1A 1UPPA 3G1DA 1K70A 4GXMA 1MMFA 3TDFA 4MDOA 1RXOB 4PMNA 4P7QA 4CD4A 3N3MA 2X30A 4IIBA 4S3AA 3WDHA 3CUXA 2FHFA 4IPJA 2AKMA 4XO7A 1E5NA 5FAGA 2E9BA 3NCOA 2J9YA 8A3HA 2Y6ZA 4LVAA 4AZBA 4UFJA 4IGNA 3K4DA 3VX0A 1V3MA 3ITOA 4ML9A 2JALA 4IP7A 3UR8A 1J0ZA 4J2PA 4ZA0A 1XQKA 2FZMA 3AZTA 4YLWA 4MLRA 2E6YA 1TVLA 4PULA 4O57A 2NX9A 3BTNA 4L61A 2YXGA 4R85A 1WAWA 3T42A 2CZDA 2DVUA 1YYAA 3LDVA 3GDLA 4QDPA 1XS2A 3AJ7A 4YPJA 3F5KA 4YCPA 4S39A 1Z89A 3CWNA 1C8VA 2R8WA 2XZ7A 2Q02A 1OZMA 3H4XA 2DORA 1Q2SA 3BAIA 3MSYA 4I5RA 1K3UA 3UJSA 4WKHA 3FY1A 3FKRA 1JPMA 1ADOA 2NV2A 5XIAA 1Q6RA 4HTBA 1UZDA 4NZFA 3VZZA 1NP0A 2YA0A 1RCQA 5C8BB 2ZXBA 4ZOBA 2CLOA 1XDLA 3CO4A 3GYEA 2BGQA 4AB4A 1GEHA 3QTGA 4ML4A 4AFYA 3W2KA 2JKAA 2J25A 1X96A 1NOFA 3TFXA 5E1QA 1UASA 1KFBA 2AAAA 4UFIA 3ABSA 4UOZA 5LNSA 2Z2AA 1FWSA 1K8CA 3ANYA 4MYXA 5BRQA 3IIPA 1JYNA 1O1HA 1JUBA 1R7AA 2X0YA 4JKKA 3DYOA 4ERGA 3KVKA 4WGHA 1TPDA 4AD0A 3FOKA 3PZQA 2DSKA 3JRKA 3ZT5A 3BXWA 4IZGA 3EDJA 3UR7A 3H53A 1GVSA 1YXDA 1XR2A 1MUMA 4DJED 1M7PA 3W9ZA 4O1AA 2E1DA 5BW6A 3H6OA 1X98A 2VGIA 3B9EA 4KWSA 2MUCA 4GI9A 4JTEA 3NO5A 4AQLA 4MPQA 3DFQA 4O0ZA 2TPSA 4IL0A 1DHPA 5DMMA 5DBUA 4PA8A 3TA6A 4UR8A 4QCFA 4RV8A 2J47A 3W2UA 3CWHA 3MANA 1GZGA 3GH5A 3QY7A 3PZNA 1NOUA 2PBGA 2A3LA 3BG3A 1SR0A 2E6DA 1ODUA 3G6LA 1TJRA 2WMIB 1ZHAA 4HCLA 3OBAA 1AH4A 3W2JA 3BH4A 1HT6A 3PWGA 4IGSA 1VCGA 2HS6A 3WLQA 1XYAA 3AOFA 1E71M 2FVMA 3DCPA 1JNDA 1VGAA 2VELA 1C91A 3TSDA 1DWIM 5CBIA 1ONEA 5DT5A 2HEJA 3GG7A 4CKQA 3ALFA 5E0FA 2PU0A 1QNSA 3HBLA 4GQQA 4M0XA 1EJWC 2XSXA 3SR7A 3Q67A 3TA9A 1Q6QA 2WMFA 3DGRA 4W7WA 1OFPA 5I3GA 3LLDA 3BLIA 3UCDA 3FA3A 1UPMB 3F4WA 3LZ3A 1TE6A 2NQHA 2QAPA 3AMLA 1TWZA 3BAKA 4N2YA 1H7XA 2DZTA 3RFAA 1I60A 3H7UA 4MTVA 1YLVA 3AS2A 3OG3A 4DWSC 1VFTA 3R2GA 5A6JA 3K2GA 3VIGA 2BV9A 4HK7A 4CN1A 1XFBA 4F9JA 4F40A 2J74A 1KTCA 4MNJA 1GOXA 1CEOA 4PMRA 4ZQCA 3BVJA 1EA9C 2RHGA 2XINA 3MUXA 4L64A 2GOKA 4EVZA 3ALGA 5CBJA 3RCMA 1Z44A 3B9AA 2FTWA 3VX1A 1QPKA 1RY8A 2OPJA 1MW2A 1FCVA 1FBAA 3LHUA 4H19A 2Q8XA 4M6VA 4GIRA 3P8IA 1I6NA 1KV5A 3TW9A 1XSKA 3D0CA 3ITLA 1DWGM 3MUIA 5T26A 2NZLA 1TPC1 3CZLA 2QAFA 4QCEA 3G1SA 1OEPA 2YKKA 5JVLA 3SQMA 1W9XA 1N8WA 3VUSA 3L2LA 2A21A 3EWCA 4ATDA 4AIEA 3VNDA 1TR1A 3B8TA 2EQDA 3UQNA 2QCLA 3TTSA 4CLMA 4JX5A 1TPUA 4YNGA 2HXUA 4JEJA 2CFFA 4H8HA 3E1F1 4GQRA 3R12A 2C0HA 3BW4A 3PBGA 3O6YX 2HPMA 3NQBA 1SGJA 1T99A 2CLHA 2IPWA 2OSXA 2VXNA 3NA8A 2ZTKA 3RGTA 2QS8A 4MKVA 4Q32A 1T8QA 4AF0B 1DKWA 4EPDC 7TAAA 1GVEA 2FB2A 3KOFA 4B2DA 1H7OA 2DVXA 1FFQA 2W66A 3PAOA 5C9XA 4C6JA 3LS9A 4HD5A 2V3DA 3UXIA 1EWEA 4UTIA 1VBRA 4Q7IA 4K36A 5A8MA 3WBXA 2OZTA 1GYLA 4JYDA 4ZXOA 3B05A 3KCJA 2ZXAA 3WYZA 3BLKA 4FX6M 5CJNA 4KWWA 5F2LA 3SCVA 2ZRUA 4BHYA 1BG9A 1Q8AA 4IFOA 3MDWA 1SJAA 4CNTA 4A05A 3EZ4A 3CWOX 2J75A 3MCMA 1PTAA 1EJTC 1V3HA 4EXAA 3LBCA 1IR2A 4HSOA 4KQNA 3L4TA 1E51A 3U5YA 4DLMA 2O92A 1RVKA 2I1OA 3I4EA 2Y5JA 1NM9A 4F2UA 1W1ZA 4NT0A 1C90A 3F2CA 3OGVA 4JYEA 3CUGA 3W24A 2L5HA 4P7LA 3S1UA 3HG3A 4PFMA 2PWFA 1RZMA 1HTIA 1UR2A 4XX6A 4DI9A 1E4IA 2FGZA 1DJXA 1OFOA 4O19A 4AWSA 4KERA 1VBJA 3NQVA 3BCJA 2BBFA 2DZXA 2G3MA 1JYWA 4FX7A 1EB3A 1UR3M 3R1ZA 2W67A 4B5NA 1EO7A 2ICSA 3DESA 5FOOA 1NWUA 4PUEA 3NSXA 1EGZA 2VFDA 1BXCA 3WJXA 3GXFA 3GW0A 4IJBA 1C9WA 4E6MA 2GSJA 4PUMA 4IOTA 5T9CE 1AD4A 3KBWA 4W88A 1U5JA 5C6MA 5KSWA 1J6PA 1NDWA 5I79A 1ZTVA 2W61A 3UFYA 1EC9A 4JS3A 3BC9A 3ID7A 2D3NA 2PC8A 2RDTA 1NP2A 4RLIA 2VRJA 3ITCA 4O8AA 1QWKA 3CV1A 4ZSTA 1BEUA 3CQJA 4M81A 1E0TA 3LX9A 2CYGA 3DYPA 1ITUA 3GRIA 2GJNA 2ZZ7A 4WCJA 4CD7A 2GVJA 3SECA 2E28A 2XH0A 4RZ5A 1KC7A 1GTEA 3KAOA 3H4GA 4PL1A 3SSZA 1SO6A 1V0LA 3W71A 5BNKA 1FOBA 3AXIA 3OZPA 3UPMA 1AQ0A 2VWTA 6XIAA 1XYFA 1IT7A 1OG6A 3L5MA 4QTGA 3ARRA 2OX1A 5G2HA 2V69A 5A8QA 1NQ6A 1F8IA 3IVSA 4RW3A 1BVNP 4IX0A 4C5ZA 1JQXA 1V0MA 4ZXLA 3HOJA 5JIWA 1QNPA 3RHGA 1A5UA 1JXKA 4L65A 1SVDA 2QF7A 1I45A 3TE9A 2A7RA 3WUFA 1KTNA 1W1IE 4GY1A 4JXCA 1GK8A 1S1PA 1NDZA 2V3GA 3C2FA 4DM2A 3EB4A 1RJQA 3UT0A 1GGOA 1ISVA 3EX3A 3G1XA 3TLLA 1G1YA 4Z1DA 3HN3A 4L4LA 4D6HA 1T40A 2YDQA 1R2SA 5LSMA 3WENA 1UP2A 2HXTA 3MB9A 1EBGA 1KQYA 3OB8A 1XLKA 5EPDA 2J7DA 1NY1A 1G5AA 3BLEA 3QV7A 4HZ7A 4KWVA 4HHHA 4NXKA 1W5QA 1ZJHA 2QULA 3N04A 3UVAA 2V9DA 3THUA 3IJ9A 2DUXA 3RO8A 4AY1A 5CGMA 3EX2A 4AMCA 5B7ZA 2QYGA 4RNJA 3E2RA 2Y2WA 3Q4DA 1XLHA 2XN1A 1MW0A 1KB3A 3UYCA 2VDIA 3CQ0A 3HTWA 2PDMA 2BB0A 1GCYA 1YPFA 1XH2A 4NQ1A 5HJXA 3WZ0E 5JU6A 4KIEA 1RA5A 3BWWA 1MZHA 2BSLA 4IIFA 1XLFA 4OOUA 4LYQA 1EOMA 3JU2A 4LUSA 5FF0A 5JBDA 1W9BM 3IRSA 4OWGA 2FFIA 2QCCA 2YB4A 4Z2KA 3CUFA 4DIAA 2RAGA 3TVAA 3W81A 1BYBA 2ZYFA 3NWRA 1BRLA 4L4MA 4C1KA 5FAJA 3H7RA 3LZ5A 3H7VA 3WLLA 4C7DA 4PMVA 4XO6A 2ZBTA 2PMQA 2OKTA 3GG8A 5DCEA 3DU0A 5H91A 5I23A 1JDFA 4MWAC 3NM3A 2D20A 4UQ9A 1TPH1 2OCZA 4WUIA 4C91A 1VFMA 3GZ3A 1FDJA 1YTKA 1FH8A 5CAKA 1JDCA 3WLHA 4K8GA 2INEA 5AHNA 4V1XA 1G4TA 3NUKA 4MZYA 4IJRA 1LLWA 1BWVA 5L9FA 3IAPA 2NXGA 4LS0A 1NIUA 4Z42C 3L21A 3AIBA 2VRKA 5I0DA 2JF6A 2C16A 1PWLA 3T0AA 3QVQA 3RNDA 5BRPA 2VUYA 2J9ZA 3G3MA 4CVWA 4J3VA 2DVTA 1SMAA 4FXFA 1NDYA 1MRAA 1AMKA 4I9JA 4DO6A 2WPGA 1F2JA 5ABGA 5JQ9A 1TTJA 3UXDA 3UXAA 1X97A 5CKSA 1ISYA 4MGGA 3W1PA 2INZA 4MWAA 2Z6JA 4WY0F 1F73A 3MJYA 1WZLA 4R7JA 1SO3A 4UTKA 1UOZA 3DC8A 4N6FA 1FH7A 4U5KA 3V3WA 1XUZA 3EA1A 2CBIA 4AY7A 1MNZA 3L66A 1GG1A 1SZEA 2F6XA 3MP4A 3WDQA 1IHIA 1DEDA 1VAHA 5A8PA 3LCFA 2OQLA 2WV8A 4FA3A 3HPZA 2IQ0A 1V6XA 3SCQA 2ACSA 4F0MA 1KFEA 4XZIA 2Z1KA 1O5RA 2G96A 3FA4A 3HGJA 2OO0A 4GINA 1NDVA 2WSPA 4C65A 3KLLA 1UJQA 2Q01A 4S3BA 1JI1A 2D2GA 4HNCA 4V2XA 1PB0A 1E4NA 1YMYA 1JZ6A 5A8OA 4PUJA 3EOOA 3GC5A 3WLRA 3KBMA 3R43A 1DXFA 2GVGA 4TV6A 2JF7A 1PXGA 2VI0A 2ZZ2A 1LLOA 3QY8A 4B16A 1CXLA 4J40A 2QVNA 1C8YA 4H00A 3UJEA 1JL8A 4AZCA 1CPUA 2ZVIA 6ENLA 3OYZA 3O9NA 3GVWA 1WYIA 4KFPA 3WUBA 4XKYB 1FTXA 2RFGA 2WZIA 2KX9A 2Y5EA 2WXDM 1MUWA 4Z2LA 3EDEA 3UPWA 1LBLA 1P0BA 1Q65A 4W89A 3GR4A 3P84A 1QI5A 3RM4A 4Z1BA 1CB7B 1HN1A 2Y85A 3GBEA 4I9AA 2CLKA 3R7MA 2FZNA 1U30A 2NQJA 2DSWA 1NWSA 3W7EA 1FWEC 1EBHA 2W0UA 3SN1A 5CC7A 1KFLA 3WEMA 5H8UA 1VEMA 3TXVA 3BAXA 2CBVA 1EDTA 4ADTA 2VZUA 5AHFA 3N6HA 4Y96A 2ZKMX 4OIFA 4N02A 3BSMA 4JR5A 1XRFA 3VDCA 1EQPA 3EWDA 1KM2A 3PZMA 2H8XA 1TWDA 1PE1A 3D5HA 1EF3A 2V30A 2OO6A 4IM4A 3IIXA 6TIMA 2BXYA 1OFBA 2QV4A 1C7TA 4N9BA 1VZWA 2J77A 4L4OA 1EKOA 3OLDA 4QXIA 3M0ZA 4JTTA 5IHRA 3WF4A 3VGHA 1AH0A 4X22A 1RV8A 1DIOA 3UZWA 3WDPP 4G7FA 3FCPA 1JG9A 3P62A 3D3AA 1H11A 3T05A 1UZ4A 3OIHA 1Q6FA 3H22A 3QMRA 1UOKA 1MFUA 1JDEA 4IFKB 1UD6A 1R9XA 3LBOA 2JKPA 5FF2A 4YYCA 2PDQA 4ACYA 4RDZA 3FGCB 4P8XA 3BE7A 4UOJA 1QI4A 1N8IA 5LIUX 1GKRA 3T6CA 5M17A 3R5EA 3K46A 3W7CA 3UP8A 1E9IA 4NZ1A 1QTWA 3WL1A 4ZQNA 4O8RA 5LYRA 1IV8A 5D9PA 5TQLA 1LRNA 1Y8BA 5HMFA 1CENA 3QR0A 2I9UA 1ELSA 4YWSA 2VCAA 3WUGA 4OKDA 3S5YA 2ZWYA 1W5PA 2VVNA 1XX1A 3ARSA 5C2GA 1EZ2A 2TSYA 1W8SA 3E6EA 2P3EA 3GG1A 1KFKA 2OYMA 4JNMA 2ZDSA 2SFPA 3GXMA 4QSFA 1H7RA 4GQ0A 1H5YA 1O4UA 2OTDA 2PDXA 4O52A 1DOSA 1O12A 2FZBA 4W93A 4XAFA 4RDWA 4O54A 4DPPA 3S2CA 3NZPA 1OVDA 3M5ZA 4FF5A 4NL1A 3QBUA 4J3SA 2HSAA 3VC5A 2Y0FA 3WK2A 5FJRA 4AC7C 4HCDA 4B4HA 3WNMA 3PK7A 3A64A 3CV6A 4MMWA 1IGSA 1XPGA 3NQ7A 4OFCA 2Q09A 1A4LA 1XKJA 3OA5A 2FMNA 3FJ4A 4L6OA 1SUXA 4CNUA 4HU4A 3AYVA 3KBNA 2YLAA 4HOWA 1GQLA 4GJIA 1R2TA 4FNQA 1BYDA 1Y7VA 2PGEA 2JIEA 2WZHA 3NEVA 3W7NA 1RK5A 4LYRA 3WNKA 4RNHA 4WKAA 4GYPA 3A47A 3ZWSA 4JQ4A 3U7BA 4O4VA 3E5BA 4G56A 2ISDA 3W07A 4WIWA 2PF0A 3VNLA 3AHZA 3BARA 3FEQA 2ZX7A 2B81A 3HPAA 2UY3A 1VRXA 4LC8A 1S3HA 1B4KA 2OZ3A 2CKRA 4WGXA 4H6KA 4WJXA 3H21A 3RYSA 3QFEA 4YVXA 3TFCA 3GTHA 3L12A 4XWUA 2NXHA 1PJ9A 3QLLA 2GUBA 4O18A 1E6ZA 3GKFA 1H51A 1VRDA 4RXFA 3GTIA 1GKPA 1RVGA 1R6WA 1ONXA 4QLKA 3LUTA 1HIZA 2HE5A 1OX4A 3QC3A 2EXOA 5I02A 2CLMA 1FVPA 1NVMA 4GISA 2BLEA 1B3YA 4EP8C 5LA1A 2FPVA 1HUVA 1A53A 3RX4A 4L1GA 4GFIA 5I00A 1NSJA 4S3JA 4PODA 1R38A 2WC7A 4GZ7A 4YVVA 2J79A 4D6EA 4ZTYA 5ECVA 3UJFA 4IH3A 3BURA 1F05A 3ELFA 5I3KA 3KP0A 3LSBA 4UZUA 3LRKA 2A1YA 3B3DA 1GQKA 4PCPA 2HTMA 4DM1A 4NXSA 3VNYA 1JCMP 2F2HA 4Z0SA 2PF8A 4FMVA 4L5ZA 3RRXA 5CLTA 4DEFA 5KINA 1R7OA 2AMXA 2BG5A 4DJDC 5DY2A 4MNKA 4U3CA 1P6BA 3LHYA 1VS1A 5HK4A 2IXUA 3W70A 3LHZA 4KCTA 4BWLA 3N13A 3W00A 5HINA 5HR6A 3QY6A 3NPUA 9XIMA 2YXXA 3N2XA 4A8IA 4GZJA 1Q7QA 1JUEA 1QU4A 1XLDA 3UWYA 1P0NA 1OCNA 4FLOA 5M1TA 1UCWA 1ODZA 4XBSA 4QITA 1Q4NX 1D8WA 3W1AA 1FWDC 1VIZA 4JQ1A 5HAOA 1SFTA 1UR9A 3UERA 1EP1A 1TYGA 4NZ5A 1XFCA 5GJPA 4OE7A 4LY8A 5JBEA 2D0HA 2Y62A 1W9UA 2YZRA 1TV5A 1W5NA 2NWSA 2QDGA 4N7QA 4E4UA 1A3WA 2VGFA 3SDOA 2P0IA 4DF2A 3MV01 2ZWZA 4DJDA 2IS7A 4CCZA 1UD3A 2WMGA 3RLGA 3SQLA 1FCBA 1VJZA 2FYMA 5AC4A 3LN3A 1GYNA 1K8XA 4AD2A 4HK6A 1BSLA 1DP0A 2R82A 3W53A 4ORIA 1V77A 2PDPA 3CV7A 1SQ7A 4LT9A 4W85A 2CESA 3CL7A 1J18A 3L4WA 3GXIA 5KZMA 3T81A 3WX7A 4Z2GA 3TONA 2CW6A 5F4SA 2GVYA 3ARVA 4NYUA 1TWWA 4TX6A 4HSHA 5E0KA 3QZEA 2V63A 2EPOA 4OJYA 3WBWA 1EIBA 1KV8A 3VMPA 3VD5A 4GACA 2VR2A 2GQ8A 3V16A 3JW7A 4C6QA 1DJIA 4OBSA 5AYYA 3U2CA 3ARPA 2OZ0A 4M6QA 4FK9A 4QBXA 4N42A 1XBVA 3K4WA 3P61A 3DHPA 4OT7A 4XAGA 2XWDA 2FFCA 4CCDA 4F0SA 2D22A 4V27A 2YCIX 3KUMA 3FN9A 4H8UA 3SCUA 4WJEA 1E4MM 4S2BA 3T2OA 1LL4A 4ADSA 2BGSA 2GQ3A 4FP1A 4Y7EA 4JGDA 6A3HA 3C52A 3A12A 2NT1A 3LCHA 1CIUA 2OSYA 5MF5A 3STFA 3AHVA 3N19B 3LK6A 2FTPA 1KD0A 4J35A 2GOUA 1MDLA 3QV9A 4JD4A 3MC5A 3UJ2A 5C2XA 1GQJA 1R30A 2C91A 1S2WA 2CWNA 1DJHA 3LV5A 4AD5A 1JZ2A 3EWBX 1VHNA 1X1ZA 1UUMA 1VHCA 4OU1A 1WKYA 3PBVA 2YXOA 1IZKA 3FW6A 3W3OA 4E8CA 4QS6A 3NQMA 2CZFA 1SZFA 1FWCC 3OTRA 4BI5A 5GNYA 1U33A 3EPNA 3MV11 1VBUA 2WWDA 2PWGA 4HU0A 3O3RA 1F3WA 3GE7A 3REQA 3NVTA 2DJXA 2RGLA 4JHOA 3VD4A 2ZQ0A 4PMJA 3MZNA 4EWJA 4FOKA 4YTRA 3A3WA 3WH5A 2WLZA 3H2MA 4XD5A 3LQLA 1SZRA 3FYOA 1TRDA 3SI9A 1K1DA 4UR7A 4DB7A 2X1SA 1AW2A 3E0IA 1S1RA 3NZQA 1LOSA 5HNTA 4K2SA 4HK5A 3ZWTA 1E1FA 3PPHA 1MDRA 5MHBA 3NJ3A 2X16A 3V7PA 3V0TA 4LAMA 2ADAA 3V36A 3BLPX 5EY5A 5FSEC 3UWZA 2DW7A 2YW4A 1VJIA 1EUAA 2DJLA 5EBAA 4XZMX 3S9ZA 3W7RA 2VEPA 4H8NA 3DI1A 1U1UA 5HWJA 2I56A 3GTXA 1DHKA 4UTUA 5ABEA 1JZ7A 3ZZ1A 3PUEA 5FJUA 1OM0A 1X6UA 1YADA 3NPWA 3RPDA 3OBEA 3CHDA 4MFEA 2CNCA 3NYDA 4DZAA 1L8NA 2DZBA 3VE9A 4GVFA 1GJUA 5A6BD 6TAAA 4ERIA 4S3KA 2IXVA 4RJEA 1F6YA 1OFAA 3OZMA 1K6AA 4DZIA 3F2DA 3VMNA 5FSDC 2VC7A 2ISVA 1EXBA 4JN7A 5TIMA 3TQVA 4IF2A 3UYIA 2FGBA 3NGJA 4AHPA 2ZC8A 4PUDA 3W0KA 2OSWA 3WK0A 1PZ0A 2ACUA 4GA8A 3H8AA 4UR9A 4JIEA 1CX9A 3MMWA 3ZVIA 3HPFA 1I2QA 1RP9A 4YCOA 4L7ZA 2PB1A 3C3NA 2OQHA 4LXFA 1PHWA 4Q4KA 4N9DA 4KCVA 8TIMA 4UB9A 2GDVA 2ACQA 2XN0A 1S2VA 3O07A 2KZHA 1W31A 3C4UA 4FSAA 4WHBA 5KMYA 4KPLA 4J4KA 1RBOB 2XGBA 5AZ0A 1J5TA 2OB3A 3EWZA 4A4AA 2F6UA 2PRLA 2O7QA 3W6LA 2QV5A 1UIOA 2IQTA 1E55A 3G1FA 3F2BA 1QVBA 3MSRA 1KRBC 2VWSA 2QCMA 2O4QA 4L6HA 2WQPA 4PMUA 1UWAA 4JFUA 5D2TA 3AXXA 3LPPA 3ZIZA 1S2TA 1XBZA 1E0XA 3ZVHA 1M7JA 4ZO7A 3VIHA 3H2AA 1UR1A 3AS3A 3MWAA 1EHNA 4ORMA 5I5RA 4EPBC 4FF7A 3M7SA 2Z2UA 3DZ1A 3ATYA 2GYIA 4WRHA 3WFLA 5D8WA 3W25A 1EZWA 3P80A 3L4YA 4WZHA 3BW2A 1XDJA 3IJQA 3PB0A 4Q8TA 4ZQMA 4D6FA 4TVDA 4MZ8A 1VFUA 3ITXA 4I7UA 1VLWA 3U7VA 4HHPA 1ZP3A 2X1RA 1ME7A 5REQA 4DZ5A 3H23A 1B1YA 1ZFJA 4LRTA 1UH3A 1E5JA 4PMYA 2Y61A 3M47A 5AYZA 4HOZA 3CTLA 1HKIA 2WC3A 1WBJA 3CZ8A 2P8BA 3R4IA 3SIMA 4YXGA 5CJ5A 2GK1B 1EPVA 2JEPA 4Z1AA 1GPWA 4P5UA 3CV2A 1CI1A 2WCAA 1Q13A 3LRMA 3HG2A 4ZB0A 5K4XA 1LQ0A 1AODA 2D2JA 1SJBA 1JF6A 1D7FA 5AC8A 1BVZA 1A3HA 1EJXC 4AVNA 2Y8KA 4C7FA 1E6NA 1MUCA 2VGGA 1QWGA 3LI0A 1ESWA 2I7GA 4EPKA 4XAYA 3M0MA 1GVIA 1US2A 4GNVA 2XIIA 1ZB5A 4XISA 4Q8VA 4JBRA 2DH2A 3DYMA 1WDPA 1P0KA 3LG3A 1QPRA 5IFTA 4U5IA 4MY1A 1V3KA 3EEGA 4PTMA 2RDUA 2HISA 1ME8A 1F6PA 3ITVA 4LBRA 5JUVA 5I07A 2V6AA 3FJ6A 4KMQA 4B5SA 4B5WA 2R1PA 3WJYA 4XZLX 3IANA 4PEKA 4US5A 1E9YB 4IIHA 3DG6A 4MFDA 3QRHA 1X1NA 4NJHA 3WQ4A 3A6OA 4YHEA 3TWBA 2X1TA 2CERA 1FWIC 1KR1A 4G5DA 4WJ8A 1NAL1 1WKDA 2P1FA 4R88A 5KTLA 3VGDA 1UWIA 1FY6A 4V33A 4Z08A 4LFYA 1Z41A 1KGWA 1K8YA 3WNOA 3Q94A 1A3XA 1SFLA 1B3ZA 3TNOA 1P6WA 1YPIA 1NOWA 1BF2A 3GIPA 1J8VA 1F3XA 1R85A 4A3HA 3UESA 1Q6GA 2R1MA 3M5YA 2XISA 3CAKA 3ZJ7A 3BDKA 4N6EA 3B40A 1LQ2A 3HPXA 4DJEC 3SJ3A 3MTWA 1OWQA 2R6OA 4YVPA 4M1BA 3CZJA 3TC3A 4ZODA 2AGKA 1S2UA 5G1MA 3LXBA 1V3LA 2J7GA 1AH3A 3TTQA 2QDDA 5EKYA 4GE8A 4LUSB 1QR7A 4IP5A 4D1IA 4EF8A 2Z24A 1I1XA 1G69A 2GLKA 1FP9A 1FWHC 2XFRA 2BVYA 1PKMA 2XG9A 5ABHA 3VK5A 2GJPA 1K77A 4X3ZA 3BAWA 4LVFA 3T0DA 4FXSA 4JNZA 2OLAA 2PWVA 3W7LA 3RILA 1YDOA 3E9AA 1DJGA 3MA8A 3UG5A 3QM3A 4JTJA 3AAMA 3SN0A 4DJEA 3WO8A 2C13A 1F4HA 1Z42A 1TPWA 1JZ8A 4UTFA 4RE2A 1F07A 3BZJA 3S5SA 2ATMA 2I5IA 1TMHA 4CQCA 3FV9A 5GVJA 3IGSA 4I6VA 1MEHA 2BVTA 5CPSA 3T8LA 3M07A 4Q8UA 1DL3A 1JGIA 2ISWA 3NEHA 3CZEA 3W1LA 2WVUA 4LX4A 3NQGA 1SW7A 3LV6A 1ZY9A 3GHUA 2CKSA 4UNLA 3TROA 4Q6XA 8XIAA 2VX5A 2G0WA 4E5TA 2DEPA 1I75A 1OT2A 2H3DA 4RV3A 2EPKX 4O0KA 3C0LA 2XIJA 3SGUA 2YPIA 4DUXA 4MWAB 3KLKA 1ADSA 3IJ8A 4QFUA 2XVNA 2VCCA 1S39A 2XGIA 3NDOA 3PANA 3VIMA 1BYCA 2CPUA 8XIMA 4UNKA 1HJUA 1CLVA 4OBRA 4AXNA 4KFNA 1K4GA 4IHCA 2EPHA 5C2CA 4TIMA 3SY8A 2YLLA 2JGYA 3KCLA 1O5XA 2UZ9A 1UP3A 3AHXA 3TK7A 4AX6A 3CIWA 4I7VA 5AHEA 1KM4A 3VNMA 1BGGA 5LXEA 4O4WA 4KF1A 3L2MA 3RAOA 3VCRA 4Y9OA 2WSRA 3OO2A 4M6UA 2WLYA 1SW3A 1P0DA 1FXPA 3B8IA 2DZVA 1RSCA 5CZKA 2GSHA 3Q65A 1DYSA 3KDOA 2G37A 2EG7A 4XIAA 1ZU8A 4OV9A 4GC3A 1UWRA 4TVUA 5DXYA 3STGA 1WXZA 1JZ3A 3VNJA 4AZCB 2NXIA 3WH6A 4C6FA 4Z2JA 1CW2A 3HURA 3RJXA 1YW1A 2GGHA 2Z28A 4TU1A 2QJJA 3TTOA 3VPLA 3KXQA 1QW9A 1UBSA 1HKWA 1ME9A 2WSYA 4RR4A 1K03A 4LF1A 4ZEPA 1BHGA 5H6HA 4DZHA 3W86A 2Y63A 1RBAA 1O68A 1S5MA 1UHVA 4NNAA 4PSPA 3EDFA 3GW3A 4C60A 1JPIA 3C2OA 3B4YA 3TH6A 2J24A 1IF2A 1XCXA 4C6LA 2VDGA 4JCLA 3PNUA 3LCGA 4CN6A 4TR9A 4MIMA 2YYTA 1XICA 5K2ZA 3U8GA 1G94A 5FJTA 5MKGA 3PSVA 4O28A 2BMBA 2WB5A 1A49A 5E09A 3CYVA 1H7PA 7REQA 3QQ0A 2REQA 3D47A 4M56A 3ZT6A 4MUZA 1WXJA 3FHAA 4PE8A 4E38A 1PCKA 3CASA 4M7TA 1YBQA 2C18A 1KXTA 4GQBA 5CQ1A 3L4VA 4O17A 1AJZA 3SGGA 1KM5A 1XM3A 1DJNA 4QR6A 2Y7DA 4AZHA 1PIGA 3TN4A 4CCEA 4DJFC 3R58A 4HYRA 1JFXA 3UF9A 1LL6A 1M04A 2OR2A 2AKZA 4R27A 3E0WA 2FH6A 4TXEA 3WBEA 4D1JA 3DBNA 3GD6A 4Y6GA 1V3JA 3DFPA 1E1CA 2E7FA 1XYBA 5D33A 2Z00A 1P0EA 3WQ6A 2G4JA 5A8GA 4OGZA 2C1GA 3QV6A 3M0IA 3ICJA 3HQOA 3NM1A 4FEZA 1JYVA 2A3BA 4KRUA 1WPCA 4G9PA 3P6LA 3G3DA 1DWJM 1EC8A 2JKEA 1F3TA 3PTQA 2R94A 2ZRXA 1GT8A 3UZJA 5FEXA 1PBGA 2QPXA 2EEXA 4PMOA 3KX6A 3KOXA 2XVKA 7ODCA 4Q7BA 1UD2A 1LM1A 1T96A 4WOZA 4QAWA 3UG3A 2E9MA 3GWQA 4NY2A 3W7DA 2XM1A 3V0UA 2DIEA 1E15A 3RDKA 3CL6A 2XFYA 2YJQA 2PZNA 4WDUA 5A8NA 1B3VA 3CMGA 3M0JA 1E9ZB 1BYAA 2PGRA 1T7LA 3G0XA 3TR2A 1WDRA 3I6EA 4Q22A 2D3LA 1KBIA 1H1NA 2RKXA 2I16A 3E0LA 4U2YA 2QCDA 5FL1A 1EJ7L 2QDHA 3STPA 2D2OA 2V5CA 5A6LA 4RE3A 3VDGA 1ZALA 1PWMA 5HWNA 5IFPA 1OC5A 1H0GA 4WSJA 3SGZA 4MAZA 1TV8A 3GFZA 2ABBA 3AS1A 3PJWA 4Q4QA 2P53A 3PTDA 3P3BA 4B4FA 1QK2A 4D8LA 3VZXA 3VOHA 4BF9A 4TUFA 3WQDA 4IGMA 1D3GA 1JJKA 4QLJA 3LGEA 2YCJA 3S9IA 1DWHM 1UW9A 3NL2A 4X0VA 2XH4A 2X1IA 4J9JA 3MBFA 3N3TA 1UWSA 4GX9A 3GDBA 5BRBA 3VOCA 3HV8A 1DVJA 4GCAA 2ZE0A 3CNYA 3R10A 1EQCA 3SEPA 1WKFA 3CQKA 3GTNA 1O5KA 1EP3A 1JI2A 3GNNA 2J88A 4ROQA 2KAUC 4YTUA 3APTA 1EGMA 1TJ1A 2E6FA 1X1OA 5AB3A 3GVGA 3QOKA 4IXHA 2PDIA 5D9OA 1FWWA 3N73A 1IEXA 1OX4B 5G1TA 4NYYA 3TOPA 5C5YA 4BEQA 3RLVA 1JCLA 2DGAA 3CO8A 3WMSA 3B06A 4ERAA 4Y9MA 3UBPC 1OFQA 2DZAA 3SURA 4LUYA 2BHYA 4IFRA 1UB3A 4CD8A 1V02A 5FI8A 3W6YA 4X2PA 3TUUA 1YDVA 1QMLA 2ZRVA 3U2ZA 2PODA 2J7FA 3GXPA 1Y5XA 3AHTA 1OINA 1XIMA 3DN5A 3N18A 3C5QA 3OGSA 3SUVA 1E1EA 3M44A 4PCSA 4B15A 1HKJA 2PD9A 3M43A 4FAMA 3UWQA 1IT0A 3G1HA 5IOBA 1GQIA 4H9VA 3DECA 4F8XA 2FZDA 3I4KA 1U1JA 3RLUA 1YHTA 4K1GA 4QJ1A 1UBPC 4NAEA 5AHIA 3WLTA 2PI6A 1FA2A 2G3FA 2WAGA 3V35A 1VFHA 3ARZA 4QSHA 1IEQA 4O53A 4GXPA 1E6PA 1MO0A 1NH6A 4QP0A 4GABA 4Y2WA 3W7JA 1RALA 4B9ZA 3L68A 1LOLA 3JR2A 2ZUVA 3L0NA 5AZ1A 1V93A 1XIGA 1JCJA 4H9UA 4W8BA 3AWNA 1DE6A 4BFAA 3ZFHA 1W54A 3UWEA 1RHCA 4RKAA 3M9YA 1QHOA 3AYTA 3TJLA 3WLIA 5J04A 4YTSA 2DZPA 1GW1A 1FKWA 4C6EA 3VUPA 3IJDA 1P7TA 4C1NA 3W72A 4X9SA 3PZ9A 4KWOA 2VQUA 5BROA 3WH9A 3W2LA 3VC6A 4V28A 2NVAA 2QJMA 3NZGA 3H4WA 4XK2A 1CXHA 5IM51 3E49A 3S1WA 1TG7A 1T5AA 1W2PA 2F6KA 3OODA 2XUCA 3QJAA 2IQDA 3NL5A 1FHUA 5M3WA 4PTVA 2C7FA 4UFLA 4KRZA 3NSMA 1CGYA 2FDMA 2FHCA 3ZJKA 2HJPA 3PS7A 3STCA 2PD5A 1XLJA 4LNCA 3AYRA 1VBGA 3SCNA 4MYAA 1F74A 3O0FA 3TTEA 2WOQA 4OTKA 2HNHA 3WF0A 3W7OA 1QNOA 2C14A 5EL1A 1CTNA 5IDIA 3MY9A 1OCJA 3C0QA 1WKEA 4HZ8A 4IISA 3TSBA 3GU9A 1OY0A 5K4ZA 4ZO6A 2Y5SA 3VCCA 4H01A 1PDZA 4I9MA 1K9FA 2JE8A 2RDWA 5EFFA 4NRSA 5BMXA 3APYA 3W27A 3SUSA 4HOXA 1MQRA 4KBXA 3CGTA 3CAVA 1EX1A 5LIXX 4AWTA 4Q8WA 2PC4A 1E6SM 1LBMA 1V6UA 4KGLA 1UC4A 3TC6A 1JF5A 3WQ5A 3G0UA 3BCDA 1DXEA 2WKJA 1V6YA 5I24A 1PPIA 1WCGA 1DJYA 1GHRA 3UZXA 3LCLA 5FJJA 4CU6A 1UQYA 4MOZA 4M80A 5HBFA 1PZ1A 3T2PA 2VFFA 3WDJA 3C0SA 3NFUA 4LEFA 3TW6A 2DT0A 3BV7A 1K7XA 2CC0A 3LENA 4QEEA 3R89A 1EYEA 1QO5A 4FOJA 3HQPA 2QUNA 2XSBA 1DJZA 3WMLA 4YTTA 1M65A 3EKZA 2PTWA 2WW5A 1FFRA 3U9IA 1OJXA 4H9TA 1GHSA 4KFOA 4HZ6A 4LOCA 3GZAA 2XH7A 4ATLA 5I6SA 5FCZA 3TU9A 3VAVA 3H26A 1TV4A 3WSUA 4JTRA 3ONBA 4MB4A 4AC1X 2VEGA 3KDNA 5HPOA 1U83A 2CXGA 4E2BA 4IQJA 2GPTA 2A85A 3EWXA 4DBEA 1QOXA 4JN6A 4Y8FA 1MQPA 4WD0A 2WCSA 2W91A 3IUDA 2VOMA 3WQCA 1JRCA 3OA3A 5BU9A 2H9AB 2PLCA 5J5DA 1QI2A 3N11A 3UZ5A 4UOQA 3SCWA 5F4XA 2YB1A 3ZSTA 2D1ZA 2ZCGA 4S3DA 3UETA 3EX4A 1J5SA 1ZCOA 1OYBA 2GGIA 2HNEA 3K8LA 3KS5A 2XJ7A 3PR2A 2D23A 3IAQA 3NL3A 4PTXA 1V7YA 3PBUA 4AISA 5CPOA 3FXGA 2NV9A 4JQ2A 4MLJA 3RF9A 2HQAA 2EG6A 2PZ0A 3GH7A 1KM3A 3WNPA 5C7VA 2PA6A 4GIEA 3EMZA 1ZRQA 3U57A 2Z1SA 4H8VA 2IMRA 4B5VA 2UY2A 2ZUTA 4J7RA 4DPQA 3AMGA 5LIYX 2PDUA 3VOIA 3SFKA 4FLQA 4XAPA 1F76A 4A2RA 1XCFA 4GBUA 3VOFA 3FHQA 3PULA 3Q45A 3LHVA 2BNJA 2PP1A 2CHOA 3S46A 2XWEA 1UG6A 5E5CA 1X8FA 4ASTA 4O12A 1CGWA 2HDJA 4ZVJA 4KRTA 4LCQA 3IUIA 1E0VA 1WO2A 5CZJA 4CQ8A 4JYFA 2Z25A 4XVEA 3THCA 4AIOA 5H8MA 1GVYA 3ATZA 4DUOA 3UGVA 3T44A 4JIRA 4HNTA 1BKSA 3LXAA 4EAYA 4HNNA 4O13A 2WWCA 3GM8A 1J0YA 1G4EA 3CXOA 2DZWA 2VJXA 1ZJBA 1QI3A 4NZJA 2QUMA 4L9ZA 4LB4A 3LOTA 4NI3A 4JIIX 5GPRA 3ZVHB 3MUAA 2AAMA 4NAFA 3PF3A 4LYKA 3LERA 4GH1A 1IE7C 2MNRA 1HP5A 1HF6A 3EKLA 2P8CA 3WD2A 1MXGA 1POKA 4K3ZA 2ZZ3A 4ZQPA 2B7QA 4DHGA 1OFDA 1B5TA 2PLJA 3BV4A 4HA0A 1NELA 1XJBA 4CU8A 3CB8A 1O94A 3B9OA 5IDZA 4QG8A 3UR2A 1TMQA 4UTMA 4MNLA 3DUGA 5A69A 5REQB 4G7EA 4L9XA 3W26A 1XPYA 3KZPA 3LB0A 1R86A 2J78A 4LNYA 3WCZA 3M16A 2V82A 2X7WA 4JPGA 2WMHA 2X0SA 2VX6A 2VURA 4XZWA 4PRRA 3AROA 1TA3A 4FNRA 1UZHA 1U22A 2OELA 4L80A 1C92A 3ZO9A 1UKSA 3PTMA 3GHTA 1M6JA 2ALRA 1DV7A 4O15A 5CPMA 2G50A 4FIRA 1JULA 1BAGA 2B31A 1W9VA 1W17A 4GZEA 3UGRA 3CZKA 1LWHA 3HIJA 7TIMA 4ZE5A 3TJIA 2JK2A 2O9PA 4LJ3A 4XD6A 4R7OA 2A3AA 3QH2A 1ECQA 4F0RA 3W7GA 1EXPA 5L6UA 3C0JA 1UKOA 4W7VA 1E0WA 1EDQA 1WZMA 1NF0A 3L65A 4Y8EA 4GYFA 1FHVA 2Q3OA 3G22A 2WMIA 4GI8A 3U48A 3N12A 2Z27A 3KRUA 5HULA 2ZUSA 3M41A 4HNOA 3MI6A 5K7JA 3VU2A 1ZL1A 4AG0A 1O5QA 4JL2A 3TYBA 2FTYA 3DI0A 5C55A 2D0GA 3EWYA 4GUIA 1AW1A 4AHQA 3ZYZA 2NSOA 1TX0A 3FYYA 1SYTA 2PDFA 1DBTA 4H2CA 1LORA 5BOFA 1V7AA 4CU7A 2ZX9A 2GGGA 6ALDA 4I7WA 1MRQA 4LUJA 4Q3MA 4RCXA 4B90A 7PTDA 3KS6A 2P3ZA 1HXJA 4C6KA 3FJLA 1CB2A 1HG3A 5E93A 1PKYA 4NZ4A 4HU3A 4S3FA 1CWYA 1OCBA 1GOKA 1TE1A 2WVVA 4QM1A 4A22A 2G3JA 3JZUA 2Q8LA 2QJNA 4V15A 3UZYA 4RDVA 2QGHA 3HU7A 3MBDA 2CWXA 4Y9AA 2WMKA 4NJIA 1W9PA 2DY3A 2YL9A 3WDIA 5G2WA 1TVPA 2F61A 2R14A 1SFSA 5AVNA 2E5DA 4A3QA 5DQPA 4ZCWA 5G4HC 3HGRA 2YCKX 4V1YA 3G77A 3QLDA 3POHA 2VD8A 1ZBCA 3R0UA 3M5XA 3AISA 1QT1A 4EF9A 2WNWA 4POCA 3GIQA 1DJQA 2X2GA 3CBWA 4EKJA 1BQCA 1XLEA 3GR8A 4UUIA 3FVMA 1MXSA 3WQEA 2Z29A 4FLSA 2XVGA 4JTKA 1Q6OA 2VZOA 3LNMA 2CZVA 2X2YA 4IMFA 2GWGA 1KGXA 1UMLA 4UTLA 1QO2A 1HJSA 1I9CB 5D04C 2GVEA 2VMFA 1RQHA 4ICNA 3W23A 4EACA 1GWJA 3I7QA 1J79A 3MSGA 1HJXA 5AOUA 4CNNA 2CLLA 3LTSA 1W8GA 1S5NA 1D2KA 2ZZ4A 4BF5A 3N1AA 5AHMA 1W1VA 3EEZA 4J3UA 2E5CA 1ICQA 3AQUA 3KWSA 1UH2A 1OGSA 1W1A1 2BY1A 4ZQRA 1YXCA 1K7EA 3HM7A 4D8ZA 3UCCA 4P61A 3UVIA 1TUFA 3RJYA 4R7WA 1B4EA 4H9ZA 5FEWA 1K6WA 4O50A 2PGFA 4DWSA 1XSJA 3GU2A 3R13A 1NARA 3A24A 1CGVA 3AMKA 1ZCCA 3EYPA 2VEMA 1QFEA 4CNOA 4QX4A 2EPNA 3O0KA 1ZAIA 4Y9NA 4GK8A 1GJPA 2TMDA 2H3BA 2GL5A 3ABRA 3LTYA 1KR0A 4NJKA 2W5FA 1RD6A 3KOWA 4TX8A 2BS9A 3FAXA 4GI4A 5GJMA 3CZGA 4Q4PA 3R0KA 3NOEA 5BXSA 1UWTA 4HSNA 4KEVA 4KKXA 3RPTA 3PC0A 1E0UA 1U1HA 4AEOA 4JICA 4D71A 3CEPA 3QHMA 1BD0A 3BPWA 4ZOAA 4O10A 2DQWA 2V8ZA 3ABXA 4UQDA 1NU5A 1OK6A 2VFIA 3J7HA 1YNYA 2NLIA 5DMYA 3W84A 3CHEA 4FOUA 4OBTA 3HFYA 2IUZA 3MHFA 1FWAC 2VOTA 2YDRA 3M46A 5D2WA 3UD6A 3OLGA 3PBMA 5DEZA 3S6DA 4D6DA 1X6LA 5FD0A 1L2QA 3NTYA 3EPOA 2V2DA 3OQEA 3F5JA 3C56A 5I09A 4UMAA 3W1RA 4BS0A 2OT1A 3VD7A 1XIBA 5DX7A 2PSNA 2OWWA 2I5GA 5FJPA 2BY3A 2Y7GA 4BQ4A 4Y9PA 1TX2A 2VZTA 5CC6A 2A7NA 1LTDA 4PFHA 3AXHA 3AI0A 1O1ZA 2WNNA 3S6OA 3TYEA 3BCFA 5GJNA 4BQ3A 2P88A 4DJFD 4HPXA 3SIZA 2C1HA 3A9IA 2DT2A 2HVOA 3VTRA 1VFSA 1OFEA 3CT2A 2V67A 2PCQA 3AMDA 4F9DA 1Q5MA 3TZNA 1ISWA 1PTDA 4KW2A 1J10A 5C70A 5MKGB 1EA0A 4OHQA 4FR1A 4NNCA 4Q8PA 3WMCA 3GDTA 3KVJA 2P10A 4QLLA 3RLHA 3RR1A 4X60A 2ZUUA 2ASHA 2GWNA 3COTA 1C8QA 3P82A 1Q7MA 1ICSA 2WJDA 4URIA 2J7CA 5TAOA 2REQB 3S3GA 2QPSA 1MVYA 5A6BA 3G8RA 4QEHA 2YIHA 2CEQA 1AUSL 4B5XA 2YX0A 3CYJA 4FXRA 3R94A 1YBQB 5DY3A 1ONRA 1FH9A 1TMLA 2DV0A 1ZS2A 2PDJA 3GFYA 4K8HA 4RZBA 4EX4A 1EHAA 3KEHA 5ENLA 4D6IA 1L6WA 2X41A 1I0DA 1ICPA 3F4CA 1H3GA 4JTHA 2PTZA 5DFAA 5E9XA 1OFRA 3T55A 4QNWA 3ZM8A 3UWWA 4HN4A 3CAQA 3TQ0A 2IW0A 3LTPA 1RR2A 4CNPA 2PU1A 1E1CB 1HW6A 1XW8A 4EE9A 1B31A 4AWEA 1XISA 4HPNA 3V1PA 5BYWA 2V3EA 3VMOA 4GZIA 3THQA 2V2CA 3DHUA 3C3UA 1RQEA 1N8FA 1VCVA 1KNWA 3L4UA 3A23A 3W1TA 4JIQA 4YWIA 4Z2IA 2GUUA 2BASA 1GKQA 4EPEC 1CECA 3H54A 3NNTA 1OGBA 2AL1A 3ONCA 1FWNA 3UWUA 4IG2A 4JTCA 2FQIA 1HJQA 3O8AA 3P5YA 1V6TA 4FO4A 2YSWA 1FXQA 3HPSA 1VC4A 5T9BG 1UA7A 1QAPA 3G1AA 1IGWA 2MANA 3SFWA 1KCKA 3VKBA 3TCEA 4GH3A 1IXPA 3W7PA 1H7WA 4EOUA 1UC5A 4MG4A 5C9WA 1THFD 5FEPA 1DQXA 3CMFA 1G4SA 1LF1A 4REQA 5F7UA 3UW6A 4J2MA 2DQXA 3D3FA 4PUKA 1V08A 3FVDA 1JCTA 4MY8A 1R2RA 4QGCA 1VCFA 2PRHA 1ENUA 3GLCA 5HMEA 3MS8A 1KCXA 3OP2A 2QJHA 2QCDB 2I9EA 1NQKA 3PPGA 3I3DA 4UQBA 1RQBA 1IXQA 2NV1A 4AH7A 1XGDA 5DRIA 3EBVA 2O55A 4ZBCA 1WDSA <