1JRBA

The p56a mutant of lactococcus lactis dihydroorotate dehydrogenase a
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLARYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dihydroorotate dehydrogenase A
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
total genus 112
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2001-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1jrbA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jrbA01
1G7UA 4O0KA 3W87A 1LRNA 3GAYA 2EPHA 3QFEA 2WOQA 2G5WA 4PTNA 3GR8A 1LZOA 2B7NA 2QEZA 4H6KA 1OFQA 4QM1A 3DENA 4NZJA 4BI7A 2XN0A 1OABA 1EUAA 2OZ0A 4M5PA 3M44A 2V9DA 1L6YA 4NVTA 5FEPA 2EKCA 3TQVA 5ABTA 1NAL1 2CFFA 3EWUA 3U8GA 1IXPA 1P4CA 4Q4KA 1TPDA 1I2PA 1FXQA 4JYFA 1W5OA 2E09A 3NXFA 3PSVA 3TW7A 4A29A 1C8VA 4GC4A 3M6YA 4R33A 4A2RA 3MMTA 1OVDA 1O5KA 5I3GA 5L6UA 4Z08A 3R89A 2HMCA 1KM3A 4K38A 1LOQA 1ADOA 3GDMA 3NGJA 4WD0A 3YPIA 2A1YA 4ZQPA 5AFDA 4I7UA 1L6SA 3QF0A 1ZHAA 1XCFA 3S5NA 1VZWA 4Z1DA 2QUVA 2Y7FA 2VFDA 2CZDA 3UZJA 3PC0A 3UD6A 4QITA 1W31A 3NPVA 3G0XA 4CLMA 5LSMA 5CPLA 1GT8A 4HSOA 5D04C 2Z2UA 3PBYA 1YPIA 4FNRA 2ZRUA 1IXOA 4JDYA 2OT0A 3L0GA 3D0CA 4NX5A 3DFTA 4ML9A 1ONRA 2GJLA 2GQAA 3LCFA 1TV5A 1FY6A 3LXAA 4O28A 1FDJA 4AWUA 4BR1A 5DELA 4DQWA 2YW3A 1LLWA 1UB3A 3IIXA 3RMJA 2F84A 3PULA 3PR2A 2JGQA 3AJXA 4QNWA 2O7SA 3W7OA 1LRQA 1H63A 1LBFA 2B4GA 1JULA 5BMXA 4UTMA 1MO0A 1SO6A 4MIMA 1BWLA 3O07A 3EWZA 3NA8A 4UIOA 3TQ0A 3LOTA 2V2HA 2C0AA 2DZUA 3W7DA 4JIPA 4A21A 3E49A 4LVFA 2DJLA 2CZ5A 3HGRA 4JGDA 4UTWA 2WSRA 1ME9A 2YX0A 5LNVA 3N9RA 1DV7A 1FWSA 3GDRA 4NNBA 3NQVA 1NVMA 1FX6A 4IMFA 5HINA 2QCDA 4UR8A 4U4MA 4FXSA 1O5XA 2OMAA 5CPOA 3P61A 3P82A 4PCFA 1GTHA 1VGAA 3WK2A 3QQ0A 3W7PA 4FEZA 2CLFA 4WY0A 3S0CA 1VS1A 3G0SA 2ZZ5A 4GXMA 1OX6A 5D05A 1OX5A 3W83A 2GJNA 4MYAA 3TFCA 2NV2A 1I45A 3RK8A 2HSAA 5AC6A 5D38A 2GOUA 4IMCA 4AAJA 2E5CA 5K3VA 2NV1A 1DJQA 1H7XA 4O1AA 1R30A 1TCDA 2P1FA 4XBKA 1JUEA 3A5FA 2QCLA 3KX6A 5A8GA 2YW4A 3NL5A 1PV8A 1TB3A 3KFTA 1GPWA 1HTIA 3MJYA 3UWYA 2GVLA 1EWEA 4RXFA 2YR1A 3FKRA 4AEOA 4FNTA 3W7NA 3C6CA 4NX0A 1ME8A 3W74A 3M0ZA 5HWMA 1RQBA 1YXYA 1HL2A 4QAIA 3G0UA 3LCHA 6ALDA 3WJSA 3DI0A 1KBIA 3W85A 2FIQA 2Z6IA 3HG4A 3EX1A 1YDNA 1N8FA 2NLIA 3QPZA 1DORA 3W1RA 4Z1BA 3PG8A 4RXGA 3ATYA 4IOTA 3WJWA 3A22A 3ZWSA 5AYXA 4NJJA 3W7JA 3M7WA 3RFAA 4WY0F 4J9JA 1THFD 4AF0B 2ABAA 3NR0A 3N2MA 4EWND 3IVTA 3TMQA 3V1PA 3TJLA 2C18A 4RJEA 3O63A 1FCUA 4RR4A 1TTJA 1LROA 1K3UA 5E1QA 3OEXA 3BO9A 1FUYA 1WDWA 3P8JA 2RDUA 1IIGA 4ZMGA 4O11A 3O16A 3I7RA 3QPYA 2XFWA 4MLJA 3IVUA 4CCDA 4GE8A 3TE9A 5C2XA 4ORMA 1WV2A 1UUOA 1VYRA 2VFHA 5D2TA 2DU2A 3NM3A 2VXNA 5DN1A 3DFSA 2BWGA 4QIUA 3MUXA 4XKYB 5FESA 1WQ5A 3P62A 1Q6OA 4CCCA 3SGUA 4JY8A 3N14A 2QJIA 4JS3A 3T4CA 4AB4A 4HNNA 3HIJA 1T8XA 2WQPA 4CQ9A 1TPH1 1XBYA 4IX2A 4IMDA 1KM1A 1XBVA 2QCFA 3P60A 1YLVA 1LOLA 4FNUA 1W3NA 1TPVA 4IJBA 1EX5A 3MW7A 3STEA 1SO5A 1T0OA 2RKXA 2A4AA 4C1KA 2CLHA 3G3DA 3NOEA 3TC6A 3ZS4A 5F1VA 3M5ZA 2A21A 2V2CA 4JDBA 1LLZA 1W54A 1H51A 1JRCA 2NWRA 1H7WA 3PBVA 5DCBA 1WXJA 1I2NA 1DQXA 3LXBA 5D02A 3LHUA 3QMRA 5K9CA 3ABSA 4FX8A 1X8FA 2YZRA 4WJEA 2NXIA 3QMTA 2IQTA 2ZQ0A 3MYOA 1H50A 3W75A 1TQJA 4PL2A 2WNQA 3ABOA 4O19A 3OIXA 2YXGA 3P5YA 2PE4A 2VKZG 4ZVJA 2DZSA 2A6LA 1FDYA 2B7QA 1CI1A 3LV5A 3MHGA 5CPMA 1Y0EA 3G1HA 1W5MA 2QJGA 2VEKA 5J5RA 4LVGA 3O15A 3SZ8A 2XN1A 1F6PA 1H7PA 4KKXA 1QOQA 3DKLA 2WO5A 2Z1BA 1YTDA 5C5YA 1A5SA 2A0NA 4K6AA 1H1YA 4FNPA 4LV9A 3C2VA 5D2YA 2FFCA 3W1TA 5U7SA 3TROA 1K8YA 5CGQA 4K7VA 3DU0A 3W2LA 1GYNA 4UR7A 4MZYA 4ALDA 4S1FA 2OX1A 3NL2A 2DZPA 5AC8A 1D9EA 1TRDA 1V7YA 4M7SA 3DBPA 4KWWA 5AHMA 1FCBA 1OX4B 3CC1A 4AF0A 2ZRZA 2B7PA 1X7FA 2WPBA 1BTMA 4IXXA 1ZAJA 4AMAA 4ZQMA 1RV8A 4B5NA 4RX0A 1TV8A 4JX6A 4NJGA 1U83A 3CHVA 2CU0A 3B04A 1F5ZA 3W7CA 2YCEA 1PHQA 3ANYA 2EHHA 1QAPA 1P5BA 3W2MA 3U2OA 3W1XA 3O6DA 2V0TA 1AL7A 2VFEA 1LP6A 1V5XA 3LDVA 4NUWA 5A5WA 5FI8A 1O60A 2H8XA 4OBTA 1RD5A 3M16A 4IXHA 3MBFA 4M19A 4PC8A 4Z0JA 3I68A 1W37A 1SW3A 4OU1A 3S5YA 3HPZA 4GFSA 4LS1A 3NL3A 4O53A 5J5DA 4JTGA 3P74A 2TRSA 3TJXA 1KFBA 2NX1A 4AHQA 3STGA 4O0ZA 3UQNA 1FWTA 3SY5A 4NT0A 1L2UA 3L66A 1VRDA 3IIZA 4XBSA 3TMLA 1KLYA 2Q8ZA 4HIBA 3EEGA 3TXZA 3I6RA 3EKZA 3LXCA 4LVAA 1RVGA 4NXKA 4JTSA 4TX9A 2R91A 4XTIA 5FEWA 1KFLA 2JKEA 3MI6A 1VYSX 3NYZA 1O4UA 4JTTA 2V5BA 1XC4A 5L9FA 1SSDA 2EAWA 1GEQA 2B0MA 4Q33A 3GB6A 3PAJA 4AWTA 1I4NA 4DBDA 1ML1A 3INPA 3W7QA 1C9DA 4N2YA 2QCMA 2ZA2A 4IPIA 4A22A 5KMYA 5HR7A 2V2DA 3TXVA 2ATMA 3Q58A 1H1ZA 5KSWA 4RZ4A 2AGKA 3RF9A 3S1WA 2ZRWA 4UFIA 1VHNA 4MFDA 1JQVA 2ISSA 3NVTA 5AC7A 4MOZA 4MY8A 3I7SA 4E0CA 2PRMA 3ATZA 3DZ1A 4Q32A 2ABBA 3QRHA 2WSQA 1OYAA 4JTIA 3W3OA 4K8HA 3O8AA 1G69A 1LCOA 2WV8A 4ICNA 3C52A 4TR9A 3QJAA 2C3ZA 5D2XA 2G95A 2YGYA 3M5XA 1W3IA 1QO5A 2Q3RA 4ORIA 2A6NA 1WOAA 3F1QA 1F05A 2FDSA 4H4IA 1EP2A 1I8JA 3GNNA 3IIPA 2FJKA 2KZHA 3F4NA 1FBAA 4EF9A 4UUIA 4DPPA 3LB0A 4UTKA 3L68A 2QAFA 2CLOA 3M5YA 5TQLA 1YTEA 2NWSA 5F4XA 1PCKA 3BW2A 4WY0B 1RQHA 4DF2A 1SZFA 5T26A 1J5TA 1QWGA 4IPJA 3H54A 1CW2A 1XBXA 3BW4A 3BPWA 3LBCA 1TPFA 4GUFA 1N7KA 2ZA1A 4YMZA 2B7OA 3LHWA 4LS2A 2NX3A 4ZQRA 1SO4A 2VEMA 1OX4A 2YFNA 4UFHA 1EUNA 5D2WA 4C1LA 1TJRA 3UPWA 1A53A 5EYWA 1YXCA 1FWWA 1ZALA 3UWWA 3QSRA 4Z0SA 4CNNA 3R13A 1PIIA 2JKPA 2GQ8A 3LRKA 4JTLA 1G6CA 3WJXA 5AHFA 3HGSA 1DBTA 3RLUA 4MY1A 4O1DA 2CW6A 3KVLA 4MLRA 4O1CA 4RV8A 3LCIA 3UWZA 3LHVA 4CCEA 2H3BA 2QR6A 3IGSA 3C4UA 4P2VA 4S2BA 4FX6M 1KTBA 3SSJA 4OWGA 2ZZ2A 3C3NA 1OFBA 1QPOA 1FWNA 3UWVA 1JR1A 1HUVA 2YPIA 3IIOA 4G1KA 2RFGA 3LTPA 3T55A 4FNSA 1WYIA 1GVSA 3STFA 3BGGA 2D73A 3VCRA 2QUUA 5K9DA 1VLIA 1F74A 4M6PA 1LTDA 1G4PA 3EB2A 1XL9A 2GUUA 2BX7A 4N6FA 1SU5A 5KTLA 4LVDA 3MP5A 3S1VA 1KM4A 4KWVA 3MP3A 3E02A 3QSTA 2R14A 5CKSA 4JTEA 4EF8A 4O13A 2PC4A 3P80A 2VEIA 1TQXA 4UMAA 4JTJA 5DBUA 3N9SA 5G5IA 3UZ5A 1PHWA 3BGJA 1GYLA 5I3KA 2Q3OA 3C2EA 3O6YX 3MI2A 4PA8A 2Y62A 1TV7A 1ZY9A 1XXXA 5G2IA 1ICSA 5H91A 4UTWC 3VI2A 3FLUA 3LTSA 1KV5A 3NPUA 2YYTA 2JBMA 4E2BA 3M41A 4TO8A 5GVJA 1F6KA 4HNUA 1JQXA 1EA0A 3C2OA 3DH7A 2QAPA 1LRTA 5LNRA 4XQ6A 5G1YA 1SSGA 3BK0A 4MVAA 5E93A 1VYPX 2C13A 4LRTA 1DOSA 1JJKA 5CZ0A 4N4PA 1XI3A 3I7QA 3UXDA 1DJNA 1OJXA 1VH7A 1M7OA 1UUMA 3IIVA 5TBOA 2ZYFA 3G1XA 3USBA 1PCWA 2FB2A 3TA6A 3BG9A 4N9EA 4LW7A 3KVKA 2BTMA 3ELFA 4N9CA 5CSSA 3L5LA 4K39A 2ZZ6A 2Y88A 1JCLA 3W1AA 3CTLA 4DO6A 1H60A 5CG7A 2GQ9A 3PUDA 3FYOA 1A50A 4UFJA 2FQIA 3THQA 1B9BA 4Y96A 7TIMA 1NFBA 3BV4A 2TSYA 3NM1A 2E5BA 3W7RA 5EA9A 3L65A 2WKJA 2ZZ4A 4M7TA 2FPVA 4DPQA 4R53A 1RQEA 1G67A 2I1OA 1MEHA 3AO0A 3W2JA 5D30A 2ZZ7A 2V82A 1XBZA 2ZDRA 4WOZA 3GYEA 2Y7DA 3LERA 3W1QA 3PB0A 2X16A 3QEZA 1ALDA 2ISWA 1R2RA 5AB3A 3SJ3A 3TKFA 3HBLA 3SECA 5LKYA 1KTNA 1K02A 4RLIA 1QCWA 2H6RA 4UNKA 5KZDA 1TPC1 3LI0A 1A5BA 3C0JA 4WZHA 1QNVA 3PVFA 4KFOA 3TC7A 4MYXA 5EL1A 1EIXA 2J9XA 2YDAA 3H55A 5C55A 4ZZ9A 2FTPA 1SUXA 2Z0IA 1OFRA 2W0UA 3UYCA 1VR6A 2LLEA 3W9ZA 5BRBA 3LLDA 1KA9F 4R7JA 1NEYA 4PODA 4RZ6A 3LCGA 4MPQA 3W1NA 3DFNA 5DXYA 1A5CA 3QZEA 1QPQA 4GWEA 1TTPA 4OE7A 1KM6A 4WXYA 3B0PA 1GG0A 4MKNA 3BG3A 4JXCA 1ZFJA 3RNDA 4HN4A 4O50A 3QH2A 1SZNA 2E6DA 1IGSA 4O15A 3HPSA 3IEBA 4LWWA 4PFMA 3G1YA 1Z41A 1IXQA 4HNVA 3NQEA 5LGXA 3OG3A 3FIGA 4IGHA 1R2TA 3EXRA 1KM0A 2VEPA 1EP1A 4FX7A 3W1LA 3W2UA 2C14A 2P0OA 1DVJA 3O06A 1KFKA 1TMHA 3UWQA 5DCEA 1SFJA 3H53A 5EMUA 1AW1A 3W88A 5EY5A 3W7HA 1JRBA 2BSLA 3KOFA 5C54A 4FF7A 5D33A 1GZGA 3WK3A 5CZTA 5F2IA 3GLCA 1DQWA 1LBLA 3LBMA 5FEXA 3G1DA 3KVJA 4O4VA 3K30A 3W76A 3EWXA 1I2RA 1JCNA 4JTKA 1YDOA 4JTUA 5HNRA 6TIMA 3L21A 1RPXA 3PBUA 5DLCA 5BW6A 4MFEA 4LNYA 2X1RA 4UNLA 4Y90A 3GDKA 4Y6GA 1T96A 3LCWA 3N73A 1FDZA 3NQ2A 4X2RA 3P5ZA 5IBXA 1AMKA 1C29A 3M9YA 4RZ5A 3BLEA 4O4WA 3HG2A 2QDHA 4TMBA 3TR2A 3DXIA 4D2JA 3CIXA 1GVRA 2OJPA 3B4UA 5G4WA 2A2IA 4MZ1A 4X22A 4WQ6A 4ADUA 2R8WA 1G4TA 1OFDA 3TCEA 3NEVA 5G2WA 4JR5A 1TJPA 2ZBTA 3HJZA 5HUOA 1FWRA 1EWDA 1QO2A 4IQLA 3LV6A 4BI6A 4JTHA 1S5VA 1X1ZA 1AW2A 3KVMA 3G24A 4POCA 4MY9A 3OHIA 3HPXA 5LNUA 5G4EA 1EPXA 2ZCGA 5F2GA 1KFJA 1GQNA 3TW6A 1B57A 3KHJA 5G1TA 1UBSA 1K8XA 2TMDA 3DAQA 3PS7A 5LHEA 1DKWA 3FOKA 4NNCA 5D37A 4YCPA 5HWNA 1H61A 4JYDA 3CQ0A 3NQ7A 3S5ZA 1UJPA 4UCGA 1FQ0A 3Q2DA 5DCDA 4JN6A 1NF7A 2C1HA 3EWWA 2Y6ZA 3WK0A 1WA3A 1GWJA 3S5OA 4DELA 3BW3A 4FNQA 1JCYA 4GBUA 3P84A 2VFGA 3GXPA 2W79A 1GG1A 1G4EA 3WJZA 4HT3A 3MHUA 3CM4A 4WOQA 3NQAA 3E9AA 1TPB1 2ZTKA 2Q8LA 5LNWA 1XUUA 5AOUA 3TQKA 1KM2A 1Z42A 5DY3A 3HMJG 3QW4B 2R94A 4ONVA 3G3MA 4DF0A 1RR2A 3IGUA 4WXZA 3A21A 2J27A 1FCVA 1QR7A 2NUXA 2E5DA 3L0KA 3DFQA 2C19A 5HMSA 3CU2A 3TUUA 1OK4A 3IGXA 4O8RA 3P8IA 5E0KA 1JUBA 3N19B 2GPTA 3C56A 1MZHA 2QCNA 2QKFA 4IUOA 3TSMA 4QISA 2C6QA 5F1UA 1TO3A 1H7RA 1O94A 1W5NA 4OV4A 4O18A 3B05A 3IRDA 5AN7A 1QDSA 3A5VA 5D2VA 5SWUA 4UFMA 2CLMA 1F2JA 5D03A 3W2KA 3U6WA 4W9TA 1OFEA 4LOCA 2BXVA 3VE7A 3DGRA 1W5QA 1DL3A 1HFBA 4GUJA 5HJLA 1LM1A 2E6FA 4LC8A 3JR2A 5HQEA 3LRMA 5K7JA 4LVBA 3A24A 2A85A 3FFSA 3CT7A 2CLKA 4L4MA 1OFPA 3L67A 1KFEA 1YTKA 3NQCA 1YADA 3Q37A 3EWBX 2DP3A 3QM3A 5LNSA 1DHPA 4AXKA 4UFKA 3W73A 4PEKA 1W0MA 3TX9A 1QPRA 3JRKA 1F76A 3PBWA 3B06A 4LRSA 5HR6A 5EKYA 2H8ZA 3DI1A 4L4LA 5G2HA 4QQ3A 5FF0A 4BFAA 4TIMA 2H90A 1FXPA 1NSJA 4Y9AA 3CPRA 2C16A 1KLZA 1KTCA 4R34A 2ZTJA 3WK1A 3W2NA 2JK2A 5I3JA 3LX9A 1GVQA 3QMSA 3EXTA 3OA3A 4I9AA 3HGJA 3NQFA 1EEPA 1E51A 2Y70A 4E2DA 4DO5A 4MJZA 1ZENA 5D09A 3CIWA 3B0UX 4NNAA 4CQ8A 1K03A 3NQGA 4FB7A 1M5WA 4DBEA 2UV8G 2XN2A 1R46A 3LLFA 1I2QA 1S5TA 3S1UA 1ZJIA 3MI3A 2YYUA 3TH6A 3LTYA 2V81A 3NG3A 5I3HA 5EPDA 4HKPA 2V30A 1IF2A 1ICPA 2ISVA 3LRLA 2YSWA 3P7YA 3GIYA 3SW6A 4JX4A 1ZCOA 2DJXA 2A5HA 2X30A 4XZ9A 3S6DA 3DHFA 3LGEA 3O6CA 4OV9A 4PH6A 3CWOX 1LBMA 4I7WA 3TSDA 3DFPA 2WNNA 4LUIA 3PUEA 2WSYA 1OHLA 1WOBA 3STCA 1KV8A 3M5VA 3PY2A 3GZ3A 2ZFAA 1JVNA 1GVFA 4DO4A 3EX3A 3THAA 4TU1A 4GJ1A 4KFNA 4E38A 3E12A 4O52A 3G8RA 5AYYA 2HS6A 1XDLA 1KW1A 3TSBA 3KXQA 3R12A 3B0VC 4LS0A 1J2WA 4IMGA 2G97A 3W22A 3KAOA 2E68A 1D3GA 1T99A 2FPYA 3HB9A 4BK9A 3NO5A 4LV4A 1A5AA 4JICA 4WX2A 1JCMP 4GNJA 2OCZA 4UTIA 4ADTA 4HPXA 1GOXA 2PRLA 3FYPA 2C15A 5DY2A 2J9ZA 3TV8A 4S2CA 3OVQA 3MO7A 1OF8A 3TNOA 1W8SA 1AL8A 5C6MA 3NAVA 4YXGA 3GDTA 1L6WA 3UNDA 4EIVA 5HULA 3HO8A 1JCJA 1LYXA 2VOMA 2BLEA 2NXHA 2X1TA 3TAKA 3G8EA 3RU6A 4NXSA 4P61A 5LGZA 3LHYA 3O1NA 3G18A 3SGZA 2E6YA 4JX5A 4CQAA 1XFBA 1VCFA 3ABRA 4HNTA 3CB8A 4HHPA 2CLIA 4O10A 4QNEA 4TMCA 1Q6RA 4H3DA 1QFEA 2DZTA 1AK5A 1ZAHA 3GVGA 3MP4A 2E6AA 3TU9A 3OVPA 3IV3A 4GRSA 4HPJA 2X1UA 1JUKA 1JCXA 3ABQA 1SPQA 3F03K 1R47A 2QCGA 1HG3A 4N6EA 3WFAA 2JKAA 1VCVA 2CWNA 3G1SA 4JTFA 3PG9A 1TSIA 4LT9A 4LTSA 1SO3A 2PURA 3G1VA 3EXSA 1MEIA 1ZAIA 2X2GA 1WBHA 4Y8FA 5CZSA 4MZ8A 3L0NA 3L5AA 4UTJA 1VPXA 2V8ZA 4DXVA 3LI1A 1K7EA 4MJMA 3M43A 4O57A 1TYGA 3M1ZA 5HWJA 2FPTA 4GUGA 4XWUA 3OVRA 1SQ7A 2Y7EA 5CZJA 2QCCA 1TIMA 1OFOA 1QMLA 3W1UA 2VFIA 1TTIA 5KZMA 3EX6A 3L5MA 4GUHA 1J4EA 4K36A 4FIRA 5TIMA 3W7EA 4GUIA 4JEQA 3GNDA 3FJLA 4Z1AA 2BZNA 2CZEA 1XM3A 2FLIA 5K4XA 1G4SA 1M7PA 1W3TA 3NQ6A 1M6JA 1YDVA 4KFPA 1OK6A 4AHPA 3BG5A 3E0IA 1SW0A 3KRSA 4O54A 4RK8A 1TREA 5FF3A 2J6XA 4DEFA 1H7NA 3G1AA 4LY8A 1Q6LA 1QOPA 1ME7A 4OHQA 1LDCA 4RKAA 4NJHA 2I9EA 2Y7GA 4X3ZA 1W5PA 1KBJA 3NQMA 3S1XA 1ZNNA 3BLIA 5AHNA 3FKKA 2X1SA 3F4WA 3IVSA 4ZQCA 3W70A 3C2RA 3N2XA 1K8ZA 1EP3A 2RH9A 5BMWA 5EBUA 5F4SA 1WAUA 2I14A 1CX9A 4NJIA 1HO1A 3JS3A 5H2ZA 1IXNA 1PE1A 3EX2A 2FB3A 5FEZA 3VE9A 2VC6A 2W6RA 3HG5A 3S8HA 1H62A 3S9YA 4K8EA 2NZLA 2ZRXA 1OFAA 3SR7A 4OGZA 3GR7A 4YLWA 1L9WA 3OBKA 3EX4A 1SFLA 1VC4A 5LHFA 4PL1A 3UY7A 3CLMA 1OYBA 3SFKA 3A9IA 3LCLA 5AYZA 3C61A 1F73A 4AHOA 3R8RA 2Y63A 2QCEA 2NUYA 2J9YA 3T78A 3L9CA 3R5EA 1P0KA 3W7MA 2ATSA 4NU7A 1Z48A 4O14A 4XTDA 3LHZA 3GXTA 5I3IA 3WJYA 3LCXA 3M47A 5KITA 2NUWA 3UXAA 4YCOA 3W84A 2QJHA 4UMBA 3ZFHA 3ZWTA 1WBJA 3TIMA 3BARA 3PF3A 1TPEA 3EKLA 2VELA 1UASA 3G1FA 5FF2A 3DFOA 3PUOA 2P10A 1P1XA 3TK7A 1NF0A 5DXXA 1UCWA 2DZVA 3B8DA 5IBXC 2E1DA 4IMEA 3E96A 1OF6A 1GJPA 4O16A 2A7NA 4Z1CA 4LU0A 3W7LA 3L2IA 5HUPA 3LHTA 4BF9A 1SR9A 4CNPA 2F7FA 4ZQNA 4N4QA 4IWWA 4UFLA 4LUJA 2J88A 4U28A 4AVFA 5F2MA 3W7KA 2GVJA 1VJIA 4YWIA 3W7GA 2TYSA 3DHDA 4JYEA 4BWLC 1BWKA 2NX9A 3KRUA 3FA5A 3HQ1A 3I65A 1SW7A 3NQDA 3BVJA 3NDOA 5D32A 1EB3A 1MXSA 3W07A 5F2LA 3BLFA 1BKSA 5KINA 5FF4A 3PSWA 1TPUA 1LORA 5LZLA 2H3DA 3HGOA 1RZMA 1BEUA 1O95A 4NQ1A 5BNKA 1XDMA 3GAKA 4FO4A 1VCGA 2EF9A 2O7QA 1TPWA 1GTEA 3MWAA 1H5YA 3W7IA 3FS2A 1PL9A 2QDGA 2RHGA 4BWLA 2Y85A 3GX9A 1XKYA 4M6QA 5CSRA 1QPNA 4FHAA 1S5WA 3W23A 3TFXA 4K37A 3W1PA 4UXDA 5BOOA 3W72A 3NL6A 3NNTA 4O17A 2A7PA 3W86A 3QYQA 4YL2A 4IX0A 3W6YA 1PVNA 4DF1A 4UTLA 3NPXA 1S3HA 2J24A 4UTTC 4HSNA 2ZZ3A 5CPNA 1Q45A 4NJKA 1WX0A 2VENA 4O1BA 3HOJA 3N34A 5K9XA 1PS9A 1K7FA 3Q94A 3P67A 1U5JA 4N9BA 3UPBA 1SZGA 1Z44A 4BI5A 3CEUA 3VFLA 3PB2A 3GK0A 3UWUA 2CLEA 1AW5A 4X9SA 3HF3A 5F4WA 1Q6QA 3W1MA 4OQVA 4N9DA 1HO4A 3QC3A 3ZR4A 2CLLA 4UTTA 5K2ZA 3B03A 2GVGA 2NXGA 1TTQA 1VLWA 3UY8A 4ZQOA 1VQTA 3GKAA 3N3MA 3GDLA 3S42A 1KFCA 1FCQA 2TPSA 5KZEA 1VHCA 2DORA 2PRHA 2WNZA 1Q3NA 4UC5A 4XUGA 4AWSA 1IIHA 2V5LA 3R2GA 4RCXA 4UMCA 5IM51 2Z6JA 2RDTA 5FF7A 3KRZA 3NZRA 3PWAA 3NZ1A 3FEMA 3EWYA 1OG0A 1F7BA 3CEPA 4XKYA 3MYPA 2OT1A 5AHIA 2RDWA 3GXNA 4N02A 4EVZA 4AH7A 5U4NA 1X6UA 2QF7A 3NPWA 1K7XA 2A7RA 4NZFA 3SIZA 5DBTA 3W71A 2HTMA 5MHBA 2G96A 1B4EA 4K7YA 4O12A 4EOUA 4WUIA 2ZA3A 2PCQA 1W56A 3C8FA 2ZRVA 4FIQA 1MSSA 2ALDA 1KM5A 3T7VA 3MBDA 1TRIA 2CZFA 4A3UA 1YYAA 2DZXA 3P81A 1D3HA 3DKJA 3GKFA 1GVOA 5AHEA 3QW3A 1AG1O 3T44A 2E77A 4QSHA 1X1OA 2AAMA 1OYCA 3O05A 4LC6A 1YXDA 2Y61A 4JNMA 3LM7A 4ZL1A 1R2SA 4QJ1A 1H7OA 4UTUA 4JIQA 3SI9A 1N55A 3HG3A 2QUTA 3TDFA 1LOSA 4JD4A 8TIMA 1XUZA 3CWNA 3G22A 3RLVA 2JGYA 3T40A 2WJZA 3C2FA 1P0NA 2QCHA 1MEWA 2DZWA 3QQ1A 4MUZA 1B3OA 4I7VA 1W1ZA 4OT7A 4UTHA 1I2OA 2EGZA 3PM6A 2Y89A 3VNDA 4A2SA 4ADSA 2YFOA 4FXRA 4JY9A 5K4ZA 1YPFA 1ICQA 2QCDB 3A23A 3FJ6A 2AQWA 2HS8A 4M6VA 1G7VA 3V75A 3VKJA 4CNOA 2ZRYA 1SZEA 5AHLA 3TAOA 3MHFA 5I3FA 3NQ8A 2ZZ1A 2VFFA 1B4KA
chains in the Genus database with same CATH superfamily
3SAZA 2VCAA 4O0KA 3T42A 1LRNA 3POHA 1G94A 3QFEA 2WOQA 5I79A 4BS0A 3AIQA 1F3TA 2OKTA 4KWUA 1XIFA 4QLJA 1J01A 3DENA 4NZJA 2HWGA 4BI7A 5C71A 2VGIA 1E9ZB 1US3A 5LIWX 2OZ0A 5C9ZA 2V9DA 4XK2A 1QXLA 4DIAA 2CCRA 1L6YA 5FEPA 1JD7A 3TQVA 4GQBA 4ECLA 4QTGA 4XISA 3KHDA 1RPKA 3EWUA 1XGDA 4W8LA 1P4CA 1Y5VA 1TPDA 4XD3A 1FXQA 1RA5A 1QW9A 1W5OA 3PFMA 3PSVA 3U2EA 1C8VA 1GEHA 2BVYA 4R33A 1XDJA 3MMTA 1IR1A 3V16A 1FH9A 1T40A 2VEFA 5JXQA 1KM3A 3PZMA 3MKKA 1XG4A 4HNOA 1L6SA 4PTMA 5MF5A 3R10A 5A2CA 2IXUA 4M82A 1YNQA 1WCGA 2Y7FA 1KKOA 4QITA 1W31A 4EKJA 4EP8C 3UNTA 4HSOA 1BVZA 3VILA 2ZUNA 1UKPA 1VFHA 4B5WA 4ZA0A 2PEVA 4F2BA 1NELA 3G2GA 5I78A 2GUYA 3CZEA 3GU2A 2ZRUA 1KKRA 2VDGA 2OT0A 3TTOA 4ERGA 1YNPA 4URIA 4GYFA 2GJLA 5LIYX 2GQAA 4I5XA 1DTUA 3GU9A 1TJ0A 4AWUA 4BR1A 2YW3A 1LLWA 3RMJA 2F84A 5JH1A 2HDJA 2J8GA 1LRQA 5A2BA 1H41A 1XPYA 1LBFA 1MO0A 3WBEA 1BWLA 4I9MA 3EWZA 3NA8A 4UIOA 1XLKA 1FHDA 3ITVA 2V2HA 2DZUA 3W7DA 2BGNE 4LVFA 3HQPA 5GNYA 1E5JA 4W7WA 4IG2B 4UTWA 1XIDA 3ISIX 1Q6DA 4WSJA 3GXIA 2AKZA 1DV7A 3QR3A 4NNBA 1DJIA 1R3YA 3FGCA 5DX7A 4C7GA 4J4KA 3RMEA 2QCDA 3SRHA 3DERA 1A3WA 2G8ZA 1T7LA 3BSGA 1UJQA 3KCOA 1IZCA 5CPOA 3P82A 3P93A 4PMZA 1AJ2A 1PEZA 2CLFA 3ORWA 7CGTA 1DEDA 1V02A 2ANUA 5LA0A 4Q8NA 2NV2A 2J7BA 5FOOA 1YIXA 4JFTA 1DJQA 1H7XA 3OZPA 3EOOA 2OXNA 2YW4A 3QKEA 1NFGA 3MUAA 4HU4A 3MJYA 4IFOA 2GVLA 1L2QA 3UWYA 1JDAA 3FKRA 4AEOA 1RK6A 3C6CA 4HN8A 1SVDA 2DIEA 3WFZA 4NX0A 4S3DA 1ME8A 3GYCA 4E8GA 3FHAA 4P5UA 1RQBA 1YXYA 4QAIA 3G0UA 3LCHA 4GQRA 2V5JA 3WJSA 1VJSA 2XVGA 1NY1A 3DI0A 3OO2A 3G5EA 4J35A 2VX4A 3HG4A 4Z2KA 3QPZA 1DORA 3WJWA 3A22A 2XVNA 4KCTA 4NJJA 3RFAA 3W0KA 4V2XA 2WKGA 2VTFA 1ELSA 3I3BA 2ABAA 4A05A 4AZCA 2DW6A 4EWND 3IVTA 3TMQA 3ZOAA 4B5UA 2WZMA 2VO5A 1FCUA 3PJXA 3BO9A 1RD6A 4J40A 3P8JA 1J0ZA 4WLCA 1IIGA 5C2CA 1L6GA 4JL1A 1QHZA 4O11A 3T81A 1E3XA 5FSDC 2R1NA 4UOQA 3IVUA 3RCNA 4GE8A 2W91A 1VYRA 3VOJA 3GXMA 3T1GA 3N12A 2JEPA 1R9ZA 4QIUA 4JN8A 4XUYA 5I00A 4IT1A 4CCCA 1FTXA 4CQ9A 1T8XA 4EX4A 3C0QA 3ZQ9A 3U3HA 1W9XA 1JZ2A 3HPAA 4OUIA 3DGBA 3H2FA 1B31A 3QV6A 2F2KA 4ILSA 4KEVA 3CT2A 3AYRA 2BHUA 3TC6A 3ZS4A 4CD7A 4D71A 2A21A 1MW1A 1MQRA 1A3HA 1QW7A 4ATLA 1KCZA 3WH9A 5JH2A 4NASA 2WQDA 2VP8A 3P2VA 3LHUA 4MB4A 4TUFA 4FX8A 4JOMA 2J25A 6CGTA 3BLDA 3QXBA 2IQTA 2ZQ0A 3MYOA 1H50A 3V36A 3W75A 3ABOA 1D8CA 3EKGA 2YXGA 4PMOA 3P5YA 1AD4A 4GYKA 2DZSA 2NQHA 1FDYA 4AZ6A 4DN1A 4ZBCA 1MUCA 1WKEA 4JQ3A 1W5MA 4P7LA 3STPA 2HXUA 4FOKA 2Q09A 4XVEA 5J5RA 4LVGA 2XN1A 1E1CA 1A0CA 4KKXA 1QOQA 3KWXA 3IRSA 4PRWA 3ARXA 2FFCA 4K7VA 3DU0A 2Y5SA 4HHLA 3W2LA 3BOXA 2PF0A 4MZYA 3KOYA 1XSKA 3NO3A 5C9UA 4B3KA 2I5GA 3S2CA 3GXFA 1V7YA 4M7SA 4KWWA 1FKXA 4HU8A 2ZRZA 4JTAA 4DNHA 1ODZA 2W62A 2ISFA 3UERA 1GNXA 2RDXA 4NSBA 4NG3A 3B04A 3R0UA 3W7CA 2BS9A 2D2JA 1PHQA 2E0PA 1P5BA 3W2MA 3W1XA 3O6DA 2V0TA 4GX8A 1E6SM 1JPKA 4DI9A 5FI8A 1O60A 1JIBA 2O9OA 3LSCA 2UBPC 4IXHA 3MBFA 4M19A 1HQTA 1OGBA 2QMKA 4LS1A 4GFSA 4MB1A 4E4PA 3VD9A 2TRSA 3M6DA 3WLLA 1QNPA 4AHQA 3STGA 1L2UA 3L66A 1VRDA 1V03A 3L23A 1HJUA 4HIBA 1G9HA 2VYOA 2PB1A 3I6RA 3VIKA 1EKOA 2PDWA 2C71A 1V7AA 3WLJA 3B8TA 1O4UA 4LALA 3N29A 1UZHA 3PPGA 3QZ6A 1SSDA 4LCSA 5A8OA 1GEQA 1RCQA 2B0MA 3MTWA 3GB6A 4AWTA 2J66A 1TE6A 1EQCA 3VU2A 3W7QA 4N2YA 4P7QA 4A22A 2XWDA 4TTUA 5HR7A 1E56A 4MWAD 1RJPA 2ATMA 2C79A 4RZ4A 4QG6A 3RF9A 3S1WA 1XH2A 2XM1A 2QDEA 2WAGA 3UU0A 1TG7A 5BYWA 2ISSA 5CZKA 2V5DA 1OYAA 3W3OA 1WZMA 1BSLA 1G69A 4ICNA 3C52A 4DI8A 2PTXA 3B0YA 1U5HA 3ITXA 3AS0A 1W3IA 1R3SA 4HQVA 1LWIA 2DSKA 2Q3RA 2A6NA 4F66A 5BWAA 2D22A 2PDBA 3NDZA 1F05A 1AODA 1GZ1A 3IIPA 3QGKC 2V5KA 4UTKA 5AECA 3VAVA 1KCKA 3RN6A 5F4XA 4AIOA 4DF2A 4WDWA 4Z2LA 1CW2A 1XBXA 4CD4A 2EPKX 3H22A 3NZGA 2ZA1A 5AZ0A 3VGDA 4YMZA 1DWAM 4WJ8A 4ZQRA 4AX6A 3GHTA 1E9YB 3DHUA 1YXCA 1FWWA 1ZB5A 1IWBA 3TYZA 4KH2A 2FGLA 2VWTA 3UWWA 2YBVA 2ZX7A 2GQ8A 1WZLA 1HKWA 3IK2A 4JTLA 3E0LA 1CBGA 3N2BA 4MY1A 2G3JA 3K8LA 4INFA 4AZBA 4O1DA 1V3KA 1R3TA 2CW6A 3KS5A 1FWGC 3KVLA 4MLRA 3RM4A 4IJCA 2KX9A 4PUNA 4P2VA 5A6MA 4FX6M 1XPGA 2ZZ2A 3C3NA 5ABGA 1OFBA 4KCUA 4ZTYA 9RUBA 4LB4A 3EEZA 3LQLA 1FWIC 4DYKA 2X40A 2QJMA 1GVSA 2E8YA 2GSHA 5K9DA 3TJ4A 3WEMA 1XL9A 4C1NA 3RX4A 2BX7A 1SU5A 4LVDA 3WLSA 3MP5A 3S1VA 3E02A 3OU8A 2VDIA 2PC4A 3B9AA 3P80A 2VEIA 1TQXA 2BXZA 4UMAA 3S5SA 1RALA 5DBUA 1JG9A 3D6NA 5DEZA 3UZ5A 1QHOA 3UF9A 1DWFM 4ZENA 4J5NA 1ZY9A 4KRUA 2G41A 3HFTA 1SMDA 4D8LA 4JHZA 4E2BA 4Q4RA 2BBFA 2YOCA 3ES7A 3DH7A 4F9JA 3ALFA 1LRTA 3ERPA 1BQCA 5G1YA 1SSGA 4MVAA 4DWSC 2AL1A 5E93A 2C13A 4X0VA 4W89A 1S2AA 5CZ0A 1H11A 4N4PA 3I7QA 1VP5A 4GY0A 3ZXWA 1EGMA 1M7OA 1UUMA 2YCIX 1VEPA 4GIEA 3USBA 4WGHA 1PCWA 5C7VA 2JFEX 2BTMA 4DY1A 1W1VA 2ZICA 3TCSA 4K39A 2ZZ6A 5CJ5A 3GUWA 2WJFA 3ARPA 5CG7A 2WHJA 5EMKA 3THQA 5JU6A 1W1IE 4Y96A 1NFBA 2D0FA 2TSYA 3E5BA 1TFVA 5EA9A 1TV4A 2WKJA 3HU7A 2PLJA 3MCNA 5EGRA 2FPVA 4R53A 3AO0A 2OZTA 3GYEA 2Y7DA 3LERA 3M07A 3PB0A 3HM7A 1ALDA 2EPLX 2OX4A 4YJ5A 3SECA 4C6LA 1UQZA 3W25A 3CUXA 1BAGA 2H6RA 2P3EA 1A5BA 3CGTA 2DSWA 4MWAE 2FZDA 4ICCX 3BUVA 4AUBA 3N6QA 1QNVA 1XRSA 3IJQA 3AWNA 3TC7A 3GC2A 4UR9A 5CAKA 1EIXA 2J9XA 3H55A 2X2YA 5C55A 1EF2A 2FTPA 3C3UA 1MVYA 4HHMA 2ONEA 3D3FA 3LLDA 3WCZA 3BAKA 3LCGA 3MMWA 3UGRA 4Z2HA 2PD9A 5DXYA 1A5CA 1UQYA 2J47A 1TCMA 3QR0A 1GG0A 1HT6A 4F0KA 2GK1B 4O50A 2A3BA 2XIBA 2QPXA 1SZNA 1UROA 3HV9A 4HA1A 3QKZA 4LWWA 2OEJA 3G1YA 1IXQA 3OB8A 4DJEA 1PKYA 4MPKA 3VA8A 5B80A 5CBBA 1R2TA 3EXRA 3TR9A 1H49A 1EP1A 3W1LA 3PZVA 3WENA 3W2UA 1P0BA 1ZBWA 2I17A 4XZNX 4M6UA 4AISA 1JRBA 2F38A 1VD6A 2EG7A 3AMLA 5C54A 1E6RA 3FDKA 1UR4A 5FJUA 5D33A 4JPGA 3UG4A 2GVYA 5F2IA 7REQA 1JZ4A 3GVWA 2PDNA 2Z1XA 2ZOXA 2J8FA 1K1DA 3W76A 3K30A 4TX8A 2ZXBA 1YDOA 1RP8A 4MB5A 5HNRA 4ZO8A 1RPXA 1YE4A 3PBUA 4JHOA 2GFTA 2X1RA 4Y90A 1T96A 3LCWA 3N73A 1XP3A 3P5ZA 1KWKA 3M9YA 3BLEA 4O4WA 1FWDC 4QRNA 1W1TA 3WSUA 3WF1A 4LFYA 4LAUA 1EJSC 4IIFA 3CIXA 1SJCA 4MZ1A 1AH4A 4ADUA 1OFDA 4GMEA 1TJPA 2QPUA 2ZBTA 3HJZA 3N2OA 2Q71A 3H2AA 3VIOA 5H6HA 3LV6A 3WQ6A 4JTHA 1S5VA 7PTDA 1X1ZA 5HMFA 4K8GA 4MY9A 1XIMA 3OHIA 4XSMA 5J8LA 3VCNA 3WDIA 1UWQA 4TVUA 1KFJA 1JZ6A 3KHJA 2GGGA 2PBGA 4B3LA 1XLFA 3PS7A 4ACYA 2YCJA 3SUSA 3FHQA 1WB0A 4AY1A 5D37A 1J6PA 1E0VA 1ZP4A 1UJPA 1A5LC 4UCGA 3CQHA 4LQ1A 4WIWA 2E7FA 2EPMX 3WK0A 4D9PA 3DG7A 2FDMA 2XSXA 5I5RA 3BW3A 3M0YA 1TZ7A 4LH8A 4D6FA 2IKGA 3QY6A 4HT3A 3FAXA 1G01A 1TPB1 2Q8LA 4GYPC 2HXTA 4LYKA 5EFDA 3SY1A 1TA3A 2PLCA 1RCOB 2OELA 3WQWA 1CXEA 1FRBA 3A21A 1FCVA 1UIOA 2NUXA 2G0WA 1VPYA 1VJZA 2C19A 1OGGA 2Z7KA 3CU2A 1OK4A 1XX1A 5E0KA 1JUBA 4XO6A 1NWRA 3RG6A 4X9YA 2QCNA 3PTMA 4J3SA 4DJFA 5ABHA 3AOFA 4H6RA 3K4DA 3A5VA 4M56A 1B5TA 5D03A 4CN4A 1KBBA 3U6WA 4KETA 1OFEA 3M0HA 4LOCA 1UPPA 1KXQA 3DGRA 1TZZA 3W02A 1HFBA 2OSYA 3VINA 2E6FA 2Y24A 1QI2A 2ASHA 3UJSA 5HQEA 4W85A 2DIJA 2A85A 3FFSA 1PZ3A 7TAAA 2WANA 1YTKA 3Q37A 1YBQA 3CUFA 1GQLA 1KFWA 4AXKA 2OGYA 4E3TA 3TX9A 4Q3MA 1QPRA 2WHKA 3UETA 3R4IA 5A6LA 3B06A 3R0KA 4LRSA 5HR6A 3DI1A 3KTSA 4HCLA 3FCPA 3IANA 1Y5XA 4QQ3A 4JNYA 4TIMA 2H90A 4S3AA 1EDTA 4Y9AA 1V6XA 2C16A 3WK1A 5A1AA 2ZX9A 1HP4A 2JK2A 3K2GA 2PWUA 3OTRA 4GG9A 1QI3A 2CXGA 4DUXA 3NSNA 4MB3A 1J5SA 1HL8A 1UH3A 1TZ9A 3QV7A 2Y70A 4J2MA 4E2DA 5A6AA 4ACZB 3PANA 3MANA 2HJPA 1VENA 1K03A 2VQTA 3NQGA 4DBEA 3KCJA 5TAOA 2XN2A 3V5CA 3LLFA 1I2QA 3DFYA 1ZJIA 3V18A 1JPHA 4MM1A 2EG6A 5FJPA 3UR7A 5C0QA 2XG9A 1DIDA 3N2TA 1PYMA 4DX3A 3LRLA 1E43A 4XAYA 2GWNA 3GIYA 1UWTA 2PTWA 1JNEA 4JX4A 3KP1A 1TMLA 3H24A 1XLJA 1V6YA 4OV9A 4QP0A 3A4JA 1H4PA 2CBIA 1LBMA 1XLMA 3DFPA 3TSDA 2WVVA 3H6OA 1WOBA 1KV8A 1U22A 4Q22A 3PY2A 3GZ3A 2P53A 3OLEA 1R3WA 2ZFAA 4DO4A 3EX3A 3THAA 4J3ZA 4E38A 4HBKA 1WZAA 1XIJA 1UMYA 3R12A 1B3WA 3K13A 1YQ2A 2VZUA 2WVSA 1Q6FA 2E68A 4BK9A 2QV5A 4GNJA 4UTIA 3LA4A 4HPXA 2C15A 3AYTA 3OVQA 1WE5A 3WF4A 2JIEA 2E1WA 1JAKA 4G7EB 4S39A 1L6WA 2POTA 2VOMA 3GNOA 1ZRQA 2X1TA 3WEOA 3G8EA 3MUZ1 4NXSA 4HPHA 3GWQA 1CYGA 3LHYA 3G18A 2E6YA 3BGAA 1OG6A 4JX5A 4CQAA 4RNHA 1ADSA 4AY8A 3F2DA 5AC5A 3CB8A 3UA3A 3CL6A 2CLIA 2IKIA 4PBEA 1KD0A 3NVDA 4H3DA 1QFEA 1ZAHA 4S3CA 2XU2A 3TU9A 2V3GA 3MKVA 3URNA 1F4HA 3IV3A 4Y9PA 2DSZA 4GRSA 3R7MA 1OSEA 1VCVA 4WKHA 2E9LA 4LTSA 2IPJA 3UJ2A 3EXSA 1MEIA 1AJZA 2PDQA 2PWHA 3GVRA 4Y8FA 2YCLA 3VDBA 1DXEA 1Y5WA 3L5AA 4UTJA 3MC5A 1AUSL 2O4QA 3LYEA 1O5RA 3ABZA 5ABFB 3VDHA 4L1GA 3W1UA 3ZR6A 1TTIA 2Z1KA 5KZMA 5TIMA 2XPKA 3W7EA 3SO7A 2BZNA 2CZEA 2XM2A 4E4UA 5K4XA 1UR3M 4L80A 4FAMA 1M6JA 3H4GA 1YDVA 5REQB 3E0IA 1SW0A 1E1FA 3NWRA 2XFYA 4O54A 3GC5A 1H7NA 3G1AA 2PDLA 5D9OA 1ME7A 1NU5A 4CNUA 1VFOA 4NJHA 2INZA 1KBJA 3S1XA 5AHNA 3UYIA 1UOZA 4OUEA 1PZ1A 2X1SA 3ZLFA 2G4FA 1XJBA 1YHTA 3IVSA 3W70A 4TQTA 1UWIA 4EPDC 1CT5A 5EBUA 3TLQA 2E40A 1LL6A 2B31A 3JS3A 1BYBA 4DBUA 4LUTA 1IXNA 3EX2A 1Z3NA 2FB3A 4GY1A 1JF5A 3VGEA 5LIXX 3S8HA 4G2DA 1S46A 1UKOA 4Y9MA 2NZLA 4MMWA 3BTNA 3KL0A 1L9WA 3OBKA 4RL3A 1VC4A 5E09A 2D20A 3BLKA 2CZVA 3UY7A 2FGBA 3KBNA 4H19A 3KOWA 3LCLA 1NDZA 4AHOA 3A4WA 3BL3A 4PYSA 1E6PA 1EA9C 4EE9A 3L9CA 4FZIA 2WBKA 4F0MA 4U2ZA 3BJTA 3SCWA 3GTXA 4ERAA 4HB7A 2CHRA 3MSGA 5BWFA 4RE2A 2QQ6A 5KITA 2NUWA 4YCOA 4P7OA 2QJHA 3PZUA 4UMBA 3TN4A 3P14A 3ZFHA 4FLRA 1SJAA 5I0DA 2J74A 1UASA 4EXQA 3B8VA 2P10A 1P1XA 1Q7MA 3TK7A 4XG1A 1UCWA 5IBXC 2E1DA 3NIYA 1AA1B 3GVQA 4O16A 1ESWA 1GQJA 1VPQA 4NI8A 3WD0A 2BNJA 1QWKA 1EOMA 2I16A 4XKMA 3L2IA 1Z7AA 4OZOA 1FHUA 3WQGA 3SCTA 1RCXB 1TV3A 1A4LA 1HJWA 4N4QA 1R6WA 3CK5A 1DJXA 4FPSA 1EJRC 3KS6A 2Z4GA 2G37A 2DW7A 2TYSA 4BWLC 4WF7A 3BVJA 2VUNA 1U1UA 3FV9A 2QZRA 2ZXAA 1PPIA 4IIEA 3HGOA 1TWDA 1O95A 3URAA 3ARRA 1E3ZA 3GAKA 4FO4A 4GVGA 2EF9A 3UVAA 3TYUA 1XLEA 1GTEA 3U2CA 2FH8A 2QDGA 2RHGA 3ARTA 2Y85A 4GO9A 4D1IA 2PWFA 4M6QA 2CPUA 4KWOA 3WG6A 1QPNA 1PTGA 4BJHA 2Q01A 4RE0A 3TZNA 4XAFA 2R24A 4JN7A 5BOOA 3W72A 2DV0A 3QYQA 2XDFA 4IX0A 2ACSA 4HSHA 4C6FA 1D3CA 3E0FA 3WD1A 2PP1A 3HMCA 4EXAA 5GPRA 3VOCA 4KW2A 5HANA 2VENA 2O9RA 4N9BA 1O68A 3UPBA 4BI5A 3GS6A 1QBAA 3CEUA 1UMLA 3WDPP 3PB2A 3UWUA 2IQDA 2CLEA 4MWAB 1CXLA 1Q6QA 4DZIA 3ZVHB 3DC0A 4D8ZA 4I9JA 1OC7A 1VBUA 1TTQA 3AHTA 1A5NC 1VQTA 3TTYA 4Y9OA 3GDLA 3I4EA 2TPSA 1VHCA 3SRDA 4L7ZA 3KBSA 3QHMA 4QLLA 1J18A 4XUGA 2R1LA 5XIAA 2Z6JA 2W9MA 4QR6A 2VRJA 3W82A 3VX0A 3KRZA 3NZRA 3NZ1A 3FEMA 1OG0A 3N4FA 2P3ZA 4XKYA 3MYPA 2OT1A 5AHIA 3LGGA 3HZ3A 4FA3A 3GXNA 4RV3A 1M7XA 4QSFA 2VT0A 5E0CA 1X6UA 5EB8A 3UCQA 3NPWA 2A7RA 4NZFA 2J79A 1B4EA 5C2GA 4H6EA 1EJ7L 4PFHA 3T7VA 4HMEA 3MBDA 3WH5A 4A3UA 4JTDA 3P81A 1RAKA 1GVOA 2D0GA 4ZXOA 4QEHA 3O0FA 3BXWA 4QSHA 1X1OA 1CLKA 1G0CA 2ADAA 3O05A 2G50A 2Y61A 3WQCA 1ITXA 3LM7A 1PWLA 3VGBA 1R2SA 4UTUA 3SI9A 3TDFA 4I5UA 3T9PA 3HJEA 2RJHA 1LL4A 1TVPA 3IUIA 4QFUA 1XUZA 2BHZA 4NAFB 3Q67A 3CWNA 2OOGA 4LYRA 3ARSA 3RLVA 1C90A 2J7DA 4H04A 4CVWA 2QCHA 1MEWA 2DZWA 3WLTA 1JEZA 1B3OA 3AIVA 4P8XA 6ENLA 4I7VA 1ZJHA 1ONWA 3MCMA 4OT7A 1I2OA 3VNDA 1YPFA 3VNJA 4RW3A 3UA4A 2DSVA 5LXXA 1H3GA 1G7VA 1ENUA 1XLGA 4S3KA 4D1JA 2BY0A 3E0WA 3V75A 3VKJA 2ZRYA 5AHLA 3R43A 1HJSA 3GRIA 3CV1A 2CNCA 2ZZ1A 3KEHA 3RAOA 1B4KA 3PTQA 2XH7A 4BEUA 3W87A 2VCCA 1BRLB 3OLDA 3MUY1 2G5WA 3QBUA 4M80A 4U5KA 4C6NA 3GR8A 2NW0A 1LZOA 1KRMA 2QEZA 1GYMA 3WQDA 1OABA 1P0EA 3GTHA 3CUIA 1ZGDA 5AY7A 2WMFA 4NVTA 6REQA 1AQHA 3TC3A 1XWYA 3E2VA 2JE8A 1NP2A 3TW7A 1UD8A 3EA1A 2OYMA 4PMYA 2PS2A 3M6YA 4A2RA 5FD0A 1LWJA 2XGBA 3CUZA 1BXBA 1BSIA 2E4TA 5HAOA 1F07A 1EPVA 3GSMA 4BHYA 3NGJA 2ZWZA 4X60A 2ZUSA 3CPGA 5AFDA 3R0DA 2ACQA 1IE7C 2REQB 2C7FA 1XCFA 1R3RA 5HJYA 1SR0A 3S5NA 2BODX 1VZWA 5CSUA 2QUVA 1S1RA 2OLAA 3N6JA 3UD6A 2PWGA 5LSMA 3W6MA 1SGJA 2AMGA 3CBWA 4HZMA 4FNRA 4LY4A 2X05A 1XIEA 2OZ3A 5M03A 1XV8A 3DFTA 4FR1A 4ML9A 3HA1A 1EO7A 4JTQA 2YDSA 1FY6A 3KBWA 3LXAA 1FDJA 2XZ9A 3IIXA 3A9BA 3PULA 3PR2A 3AJXA 1OB0A 4QNWA 4A4AA 3RU8X 1H09A 3ONCA 2BVTA 4HA0A 5DMLA 3TQ0A 5AC4A 4JIPA 3OZMA 3E49A 1HF6A 3HGRA 4JGDA 2OU4A 4W7UA 2YX0A 1NM9A 1P0DA 5HQMA 3GDRA 1W9BM 3NQVA 1M01A 2PZ0A 3VOIA 4IMFA 3ITTA 4O1EA 3DN5A 1O5XA 4I8YA 1EXPA 3P61A 1QTWA 5GJNA 3PFRA 1VGAA 4B9ZA 3SBFA 3QQ0A 3AHYA 4FEZA 4DWSA 2ZZ5A 1OINA 5D05A 1OX5A 3W83A 3EMQA 4BY3A 3EYPA 4M1RA 3NJ3A 3RLHA 1FWHC 3SY8A 2GOUA 1U33A 4AAJA 2NV1A 1A5KC 1LT7A 4DUVA 4DUWA 2GDVA 1WP6A 1UR2A 3KX6A 1CNVA 3SCSA 1O5QA 3KFTA 1HTIA 3ONBA 3MUIA 4IP5A 4GIYA 3CWHA 4FNTA 3RCMA 2J7CA 5M2FX 3LEPA 1TMQA 4Y2WA 3W85A 1UIPA 2ZVRA 3CS2A 3EX1A 1A4MA 4IISA 1N8FA 3FDGA 3W1RA 4RXGA 4IOTA 5AYXA 3W7JA 3M7WA 3T07A 4WY0F 4QXIA 4AF0B 2DSUA 2PC8A 1PTAA 2XFFA 3APGA 4DO7A 3ITGA 3QPEA 4Q8TA 3I6EA 5T9CE 4ZFCA 1WPCA 2C18A 3KM8A 2CYGA 1XIHA 3AMCA 3OEXA 1FUYA 2RDUA 4ZMGA 4W87A 4UCFA 3WMBA 2XFWA 4AWEA 1ITCA 1BYDA 2VZOA 5D2TA 2DU2A 1W3HA 4LGXA 1IYXA 3NM3A 2BWGA 3RLGA 1WQ5A 3OG2A 2VOTA 1R38A 3SGUA 3N14A 4PMQA 3EMZA 4AB4A 4HNNA 1PXGA 3HIJA 1ZPTA 4IX2A 1KXTA 3T0CA 3AU6A 4L1XA 2WZTA 4IZGA 2PU1A 1YLVA 1LOLA 1W3NA 3SM0A 1TPVA 1Q6CA 3MW7A 2RAGA 3N4AA 1SO5A 2CLHA 2X0SA 5LIKX 4IG2A 1W54A 1UHVA 1H51A 1TKKA 1JRCA 5JUVA 3B9EA 2VEGA 5I2UA 1I2NA 3T2OA 5K9CA 1CIUA 4J28A 2BASA 1OBAA 2DT1A 2IPWA 2DVUA 3LY0A 3AMGA 1GONA 3GW3A 2Y0FA 2VKZG 1DWIM 3T8LA 3M0KA 2B7QA 1CI1A 1QVBA 1Y0EA 4EAMA 1ODUA 1TUXA 4QE1A 3QOKA 2OEMA 3KTXA 3T4WA 5C5YA 1A5SA 5CCZA 4E2OA 4DJDD 2A0NA 2GJPA 4J2PA 1MFVA 4DBSA 1K8YA 5CGQA 1C7TA 1ZQ5A 2EQDA 5D8WA 3IJ7A 3AMKA 4IIBA 2DH2A 2DZPA 5AC8A 3HQOA 4C6MA 1MNZA 3AAMA 3VIMA 4PE8A 1ITUA 1QNQA 2YA0A 3Q45A 4NYYA 1Z6KA 4IXXA 5FJRA 4GZJA 2BDQA 1PO9A 1TV8A 4NJGA 3CHVA 1P7TB 3GG1A 2PDYA 5JQ9A 1RBAA 2DH3A 4B5XA 2YCEA 4H1ZA 3N17A 1R3QA 2EHHA 1U1HA 1QAPA 3U48A 4Q8PA 3U2OA 4V28A 2R6OA 2VFEA 1HX0A 4KCWA 3LU2A 2A3CA 1V5XA 2F6UA 4BKNA 1GQIA 4GNVA 1UR0A 2WC3A 1GK8A 1RD5A 4IUGA 1GOWA 1W37A 2WCGA 1MMFA 3UG5A 1SFTA 3NL3A 1XLAA 3TJXA 2CHNA 2NX1A 4ZOBA 3AZRA 3E6EA 3UQNA 2FVLA 5CH9A 3VIFA 2VVNA 3TMLA 2Q8ZA 5JBFA 2GGIA 3VC6A 4QGCA 1J0IA 3LXCA 3EOUA 1RVGA 1DIEA 4UNIA 4TX9A 4XTIA 5FEWA 4I9TA 3W24A 1KFLA 3MI6A 2UY2A 1OD8A 3KWSA 4A3YA 2TODA 4YPJA 3GQYA 4XVDA 4JTTA 4F0HA 3SGGA 1KRCC 1UZ4A 2FHCA 5GJPA 3TYCA 1NARA 3ZJ8A 4A35A 2EAWA 4QROA 1Q2SA 3PAJA 1FVPA 1I4NA 3VXGA 4RNJA 1ML1A 2GJXB 3IJDA 1UA7A 2GGHA 1WUFA 4IPIA 5KMYA 3K8KA 3SIMA 2HNHA 4PULA 3N3TA 4JIRA 2ZRWA 4N42A 1VHNA 3EA2A 2A3LA 2ZC8A 3WH6A 2WM0A 3NVTA 1X1NA 4MY8A 3I7SA 2ABBA 1M53A 4MJ4A 4K8HA 3O8AA 1PDYA 4FOUA 2OFJA 3B8UA 4TR9A 2WLYA 3GXDA 2C3ZA 3QJAA 5D2XA 3SCRA 4IL2A 2G95A 3M5XA 2YGYA 1FWJC 2BVDA 3KE0A 3UFYA 1CXIA 4ORIA 1DPMA 4Q8QA 2ZX8A 3M0XA 1W3KA 4KF1A 4CD5A 1EBHA 1K4HA 2FDSA 2PDHA 1IT7A 2FJKA 3BMVA 4UUIA 8A3HA 1HKMA 3AQUA 3LB0A 4C6CA 3JZUA 3L68A 3AXMA 2CLOA 2ACUA 4A8LA 4LXFA 3WF2A 2D0HA 3BW2A 1MW0A 1EHAA 1RQHA 5T26A 3CAWA 1W1YA 3H54A 3BW4A 3BPWA 3OVGA 1R9XA 3R11A 3SDOA 2B7OA 4L56A 2YFNA 1TJRA 3UPWA 3MPGA 1A53A 1ZALA 2JQXA 4Z0SA 3R13A 1WDDA 1PIIA 2JKPA 3N25A 4EANA 3HGSA 1CZ1A 2QNEA 4UQBA 4GH1A 3I3EA 1EGVA 1G5AA 5CGTA 3S4TA 3LG3A 3AS3A 3LHVA 4CCEA 2H3BA 2VWSA 3C4UA 5EU9A 3QC0A 1KTBA 4NL1A 3SSJA 2DUXA 5I77A 1LG1A 1C8QA 5C9WA 4G1KA 3TOPA 2ISDA 9XIMA 2RFGA 3VX1A 1F9CA 2GLKA 1WYIA 5JBEA 3NEHA 4H9VA 2PWEA 1CECA 1F74A 1HKIA 1K6WA 1Z32X 2PDKA 2ZUUA 1KO0A 3TTEA 1KM4A 4KWVA 4NY2A 4JTEA 6XIMA 1RUSA 3H21A 4EF8A 2BGSA 4O13A 5BXTA 4PB3A 4JTJA 2YCKX 1Q4NX 1PHWA 1IGWA 1K9DA 5I3KA 2Q3OA 3C2EA 1YE6A 2Z7GA 2Y62A 1ICSA 4LBUA 3FLUA 3CNYA 5FACA 5C8BB 2J8TA 1S2TA 2V38A 1F6KA 3C0LA 4WKFA 4U3CA 4FLQA 1EA0A 2R82A 4A3RA 2QAPA 4DM2A 5I09A 2I7GA 1WKFA 4YHEA 5A6BD 2PLMA 5EBAA 3VDGA 4GKLA 4GJJA 1JJKA 2Y4SA 2X0HA 1VH7A 1E55A 3O6AA 1E0UA 2XIMA 3FSUA 3IIVA 2G4JA 2FB2A 4N9CA 2OO0A 3L5LA 4GO8A 1EZ2A 1V6VA 1S2VA 1H60A 3U7BA 4S3JA 3W29A 5DFAA 4E8CA 2NT0A 4UFJA 2O92A 3T2QA 2FQIA 3L7RA 1B9BA 2BHYA 2DT2A 3C8NA 2E5BA 2VX6A 2FZ8A 1WDQA 3THCA 2ZZ4A 1UP2A 1FOBA 5E9XA 1FHLA 4B5SA 2VGBA 1MEHA 3W2JA 1JF6A 2V5CA 2ZDRA 2ZUVA 3W1QA 3C86A 2X16A 4JTRA 4WEVX 1R2RA 3SJ3A 3L4VA 1S39A 3SJNA 2YB4A 4H9UA 5LKYA 4F4RA 4RLIA 5KZDA 4UNKA 1CXHA 1TPC1 3LI0A 1UD6A 1ZU8A 4P8WA 4R7OA 4WZHA 3PVFA 1HKJA 5E6ZA 1IT8A 4KFOA 4NP7A 4CCZA 1OY0A 1SUXA 1VR6A 5IXEA 3W9ZA 4D6DA 3VIPA 4Q6JA 1KA9F 3ZJKA 5E70A 4DJEC 1RLDA 1JGIA 3W1NA 3OODA 1QPQA 4L9YA 1A5OC 3GTIA 1KM6A 5D9MA 3RNDA 3QH2A 2GJRA 4UOZA 4GABA 4O15A 3HPSA 3AC0A 4U33A 3NQEA 3TYBA 3CHCA 4K1GA 4LAKA 1MRAA 3T0AA 2X7VA 1KM0A 5C9RA 2MNRA 3PNZA 2IS7A 2P0OA 1GHSA 1TMHA 4XSLA 3S2LA 1SFJA 1AW1A 3GU1A 3MV01 1AQ0A 1E5NA 5EY5A 4PMJA 3W7HA 4WVXA 1Q85A 2VJXA 4AXNA 3CPUA 2EG8A 1GZGA 3WK3A 5CZTA 3GLCA 1GOOA 3LBMA 3EWXA 1I2RA 1X7IA 3L21A 2FVKA 3OQ8A 2OLHA 5BW6A 2YA1A 4PRTA 3KUMA 2V3FA 7A3HA 2XHYA 3B9OA 3AXKA 3ITLA 3M0IA 1HXJA 4HU0A 4GGBA 1Q7QA 5IBXA 2D2GA 1AMKA 4GY7A 1C29A 3T0DA 1N2VA 1QASA 1C8XA 4MADA 4US5A 3I4KA 2PAJA 3A3XA 3K4AA 3TR2A 3DXIA 4D2JA 1P43A 4ATDA 1EFZA 2QUMA 2A2IA 3RHGA 1GVYA 2D24A 3NEVA 2NQ9A 1F61A 2VRQA 4JR5A 4H00A 1FWRA 1EWDA 3Q4DA 4BI6A 4ICMA 2DVTA 1E72M 2F6KA 4S3BA 2W3ZA 1VFLA 4POCA 4AMCA 5LNUA 4AIEA 1BYCA 8RUCA 1UKTA 3QHNA 2TMDA 1NJJA 1WXZA 4BQ4A 3DAQA 1DKWA 3FOKA 1AQMA 4YCPA 5GQBA 1Q8JA 1H61A 3NQ7A 4AVOA 2VZTA 3BMXA 5IHRA 3EWWA 4EAYA 1GWJA 1WAWA 3S5OA 4DELA 1JCYA 4GBUA 3P84A 1PKNA 2W79A 2GUBA 4WOQA 4DHGA 3OOQA 4J3XA 3E9AA 2WMIB 5LNWA 2ZTKA 1XUUA 3UW6A 5AOUA 4DJFC 1FKWA 4FS9A 5DY3A 2GK1A 4LEQA 3ITYA 4C60A 4HD5A 4ONVA 1EL3A 3IGUA 1QATA 2J27A 1V79A 4CQBA 1C91A 3TUUA 2J7EA 3NO1A 1WXYA 3P8IA 3APTA 3C56A 3ANUA 1V0LA 2QKFA 4IUOA 3TSMA 5ENLA 2C6QA 1HIZA 3GIQA 3WN6A 3KW3A 1O94A 1W5NA 4O18A 4Y7EA 3IRDA 5AN7A 1QDSA 4C1NB 5D2VA 2CLMA 1F2JA 2I57A 4HTYA 3W2KA 1DP0A 2NQJA 2DUZA 2WNWA 1W5QA 1DL3A 4GUJA 1UWAA 2VDHA 1JI1A 4CNTA 1WKYA 3N13A 1VF8A 4LC8A 3ABXA 2YXOA 5K7JA 3ARYA 1UD2A 2INEA 3M0LA 1PWMA 3S3GA 5HPCA 4L4MA 4F79A 1YADA 2VURA 5LNSA 4GLEA 1HVXA 4GI9A 3WNNA 1VBGA 5A8PA 1IEXA 1F76A 3PBWA 4W4QA 4HCDA 1AH0A 4O1FA 5FF0A 4Q8WA 1XSJA 5I6SA 3BV7A 1NSJA 3CPRA 1Z8AA 2ZTJA 2VC5A 5T91A 3A12A 3W2NA 2WMKA 3LX9A 4I9AA 1X6LA 3HGJA 1KNWA 3RGTA 3NQFA 1E51A 3BWWA 1ZENA 2Y8UA 3L4XA 1BXNA 2D2HA 3JVAA 1PKLA 4NNAA 4FB7A 1M5WA 1R46A 1SJBA 4QJ3B 1S5TA 3S1UA 2E9MA 2YYUA 2ZIDA 2YBTA 4RUBA 3N18A 3TH6A 5JIWA 5HNUA 3NG3A 5I3HA 5EPDA 2UY4A 4HKPA 4YIWA 4ZOCA 1N8WA 2ISVA 1B0IA 3OYZA 2ZX5A 2R1PA 1TR1A 2X30A 4XZ9A 1J6OA 3S6DA 3DHFA 4PH6A 2D69A 4E6MA 3CWOX 4Y9NA 4I7WA 1C93A 4LUIA 1OQFA 3NUKA 2BY1A 3M5VA 3OGSA 3A4AA 4LNCA 1JVNA 1GVFA 1EYWA 4TU1A 4WDTA 3R94A 2PDJA 5AYYA 2HS6A 4DZHA 4C6OA 1YDYA 4ROQA 1J2WA 3QY8A 4OJYA 1D3GA 1ECEA 1T99A 2FPYA 5CLWA 2VR2A 2FMNA 4JICA 3II1A 1JCMP 4H8VA 4ERIA 2OCZA 4FXJA 3FYPA 4NZ1A 2J9ZA 1QK2A 1OF8A 3UBPC 4IL0A 3TA9A 2PFHA 1JPMA 1KB3A 3B8IA 5CC7A 3HO8A 1LYXA 2BLEA 1ZBCA 3B8WA 3VUPA 1JPDX 4DNMA 4XAZA 4P61A 3BAXA 4LPCA 3TN3A 2NVDA 4DWSD 4QNEA 3TWAA 3EDJA 1Q6RA 4GQ0A 1IT0A 3MP4A 4HPJA 2WWCA 2X1UA 3BC9A 3ABQA 3LPFA 1HG3A 2GDUA 3MMDA 4N6EA 3CZ8A 1UWRA 4ZR8A 4JTFA 3PG9A 3G1VA 3EDKA 4CU7A 1WBHA 4YTUA 4XIAA 2CKRA 3CO8A 4JKLA 2V8ZA 4MJMA 2W67A 3M43A 3UJFA 3M1ZA 4GVHA 4ACZA 1J0YA 3CTTA 4XWUA 3OVRA 1SQ7A 3AALA 5G4HC 3TWBA 3ZLHA 5CZJA 4LEFA 1Q2RA 1OFOA 4YU1A 3CH9A 4FIRA 1ZJBA 1Y7VA 4GUIA 2DFAA 2E9BA 1EBGA 4Z1AA 3AMDA 4H8UA 4GD0A 1VBRA 3SFWA 1CENA 1KRBC 3CHDA 1W3TA 4L6HA 1OK6A 5H8PA 4RK8A 5FF3A 3PTKA 3MV11 1SMAA 2OSXA 2C0HA 2AOSA 1X39A 2I9EA 4X3ZA 1MW3A 3BLIA 2R1MA 4A3HA 1XGZA 2WMHA 4FF5A 3RILA 2ZWYA 4ZQCA 1D8WA 3N2XA 5BMWA 3BICA 4AYSA 2UZ9A 4PCSA 5F4SA 4NJIA 2Y8VA 1RVKA 2X42A 1D7KA 4L9XA 5H2ZA 1ISYA 2BY2A 2TAAA 1PE1A 2J4GA 5RUBA 4HU3A 2WHMA 4CN1A 4JQ2A 4BZYA 3GH7A 1H62A 9CGTA 2PDXA 3SR7A 4OGZA 3GR7A 2E8ZA 1EJUC 1OZQA 4AZ5A 4DLMA 3RRXA 1MNSA 3VD7A 4PL1A 4DAIA 2V6AA 4G7EA 1CB7B 3SFKA 3A9IA 4C6PA 3U9IA 2QCEA 3T78A 4IP7A 1HJQA 3AIBA 3CV7A 4CEUC 4R88A 1P0KA 3W7MA 4LCRA 1PX8A 1XYBA 4XBJA 3VD5A 3WDRA 1FA2A 3TYAA 3VIJA 3DDMA 3W84A 3JZEA 3WF3A 2P8CA 3TEVA 1WBJA 2VHLA 3BARA 1A5UA 1W1A1 3AIRA 3DFOA 3PUOA 4B2DA 3H4WA 1MUMA 1NF0A 3IJIA 3PZ9A 4HCHA 2DZVA 2BB0A 2YKKA 4W5ZA 2OKOA 4IMEA 3E96A 1OF6A 4MKSA 1DTNA 2A7NA 1K8CA 1I75A 4GACA 1K9EA 1SR9A 1NOUA 2ZKMX 1BXCA 4UFLA 5T8GA 2J88A 4U28A 4NRRA 4AVFA 5F2MA 4YWIA 2ZUWA 3DHDA 1BYAA 5ABFA 1BWKA 4F48A 3FA5A 3HQ1A 3I65A 1SW7A 1JZ7A 3NDOA 1UZDA 1E6QM 4W7VA 2DT0A 3BLFA 3SQLA 3EB3A 3CAQA 2XUCA 3REQB 2DIKA 1A80A 3B40A 3M64A 3VZXA 1BEUA 3DG6A 3MZNA 4Q4MA 1VCGA 5CAHA 4PUKA 1TVLA 5REQA 2QYGA 1PL9A 4FXFA 1XCXA 3F4DA 1KBKA 2DUAA 5CSRA 4ZB5A 2IMRA 4FHAA 3VO0A 1S5WA 3GD6A 3TFXA 2YZ5A 4K37A 3U4AA 1J8VA 1TJ1A 3TN5A 4ZCWA 4O17A 5EFFA 3O9NA 3W6YA 3WUBA 3R8GA 3FVDA 4UTLA 4AC7C 3NPXA 1S3HA 1F3EA 2Q02A 3MQTA 3W6LA 4HSNA 4V27A 3VIGA 4O1BA 3HOJA 1E70M 5ECVA 5HJXA 4WSHA 2SFPA 3VFLA 4FALA 4W88A 4JCMA 3EOLA 3HF3A 5F4WA 3L2LA 4IFRA 1M3UA 1HO4A 3QC3A 3ZR4A 1NDVA 2CLLA 2F2HA 2FZBA 3B03A 2DEPA 4KESA 3GHUA 4Z2JA 3GKAA 1F6YA 3N3MA 4JAWA 2P50A 4I3GA 5CLTA 4DXKA 1BLIA 1X38A 2PU0A 4ZSUA 1Q3NA 3R8HA 2ESCA 1FP8A 3MO4A 3CXOA 4L4PA 3VK5A 5IM51 1B1YA 3G6MA 2B81A 1DIKA 4QEEA 2WPGA 3CEPA 2ZVIA 3PTDA 4UQEA 3QGAC 4LANA 1CTNA 4EVZA 4AH7A 5U4NA 3EZ4A 3PPFA 5MHBA 1O12A 2G96A 4RPPA 4AD3A 4EOUA 1E4NA 2H9AB 1GPFA 1R9YA 1W56A 1XH1A 2E67A 2ZRVA 4O0QA 1MSSA 2ALDA 1KM5A 4AIUA 3BURA 4NAEB 4JEJA 1YYAA 4AQLA 1TJ2A 1FWEC 2RGMA 1AG1O 3T44A 4S3GA 3WLKX 1AD1A 4LJ3A 4LC6A 4C7FA 2XH0A 4JNMA 2W92A 2CBVA 3OQEA 5FJTA 3ZYZA 1POKA 2HEJA 4QJ1A 1OEPA 4A8RA 1K4GA 1OGSA 1E6ZA 4A6GA 3WH8A 1LUCB 1OZMA 4Q8MA 2VX7A 4KERA 3RPTA 1LOSA 4JD4A 3WIJA 8TIMA 3PZNA 3G22A 2WJZA 3B9NA 1P0NA 2PZNA 1X8CA 1ZBVA 3WQPA 5C7HA 3QQ1A 3AISA 4F3HA 2EJ1A 3D3AA 4K2SA 4PSPA 1W1ZA 2EGZA 2OGJA 2Y89A 3BQ6A 4A2SA 1F8IA 4FXRA 5BZAA 1XD0A 2DQXA 3FJ6A 4Q4SA 3ARUA 3OZOA 1EC7A 3WLRA 4HZ8A 1SZEA 2EPNA 1XQKA 3BAIA 2HCVA 4I6KA 1UD4A 1EC8A 2GGEA 1I6NA 4C6KA 1J93A 1U30A 3GAYA 3SCPA 4MWAA 4PTNA 3Q65A 3VABA 2B7NA 3BMWA 3ZVHA 4H6KA 1OFQA 3JW7A 2HK0A 5E9AA 2ZDSA 2XN0A 3U0HA 4LCQA 4ROPA 2Y5JA 4B4FA 5A6SA 1Q4WA 3OLGA 4UQDA 2F8QA 1E71M 4RPQA 5FIPA 2EKCA 1XLHA 3WBYA 3ZR5A 5ABTA 3V35A 3GHRA 1IXPA 3PN8A 3FW6A 7ENLA 3ECQA 1I2PA 4OECA 4JYFA 2E09A 3ENLA 3RJYA 2DY3A 4CD6A 4GC4A 1O5KA 5I3GA 4Z08A 3R89A 2C91A 2IW0A 1MUWA 2HMCA 2PDMA 4XD4A 2HQAA 4K38A 3GDMA 4WD0A 4G6CA 2FZNA 5CBIA 4I7UA 1ZHAA 1NH6A 4WSKA 2QIIA 3AU2A 3UT0A 2CZDA 3PC0A 3NPVA 1GVEA 3KCLA 4GX9A 1GT8A 4ZO7A 4K68A 1TWSA 3TW9A 2AAAA 5D04C 2CKSA 4IIGA 4QDWA 4JDYA 1W17A 1ONRA 2BXYA 3GBEA 4GI6A 3LCFA 1TV5A 3U57A 4ZXLA 1CCWB 3HTWA 3JUGA 4O28A 1O6IA 4EPKA 2O7SA 3MDWA 1H63A 1PZ2A 5CJMA 3WDJA 5BMXA 4UTMA 3LUTA 4MIMA 3U5YA 3PJTA 1ZP3A 2C0AA 3CZGA 4HHHA 1XFCA 3GG7A 4A21A 1P6CA 4HMCA 5IFPA 2CZ5A 3NURA 1ME9A 3FY1A 4JTCA 1ONEA 2XISA 3P6LA 4GCAA 1FWSA 3RDKA 3CO4A 4H6QA 4JHMA 1FX6A 3RPDA 4UR8A 1XRVA 4FXSA 3S2NA 3A6OA 3WK2A 1GHRA 3PWGA 4PCPA 4IJRA 3W7PA 3AICA 4C6QA 3B8SA 3IJ6A 3E2SA 3G0SA 3PP7A 4WY0A 3S0CA 4GXMA 2GJNA 4PB4A 1IR2A 4MYAA 2BMBA 1BRLA 3TONA 1I45A 1KR1A 5TNVA 4NYUA 5AC6A 3LGDA 1UG6A 3UJEA 4IMCA 2E5CA 1R30A 4HK7A 2P1FA 4XBKA 1JUEA 2QCLA 3CQKA 3KL5A 2VNCA 3IV8A 1PV8A 1VEOA 1TB3A 1GPWA 5G1MA 4HJFA 1EWEA 3WLHA 4RXFA 2OOFA 2YR1A 1OC5A 3L4WA 3W7NA 1R7OA 3WQFA 1ZJAA 2XVKA 2PUZA 3W74A 3M0ZA 3C5QA 4JQAA 1HL2A 1XW8A 1XYLA 2P8BA 1ZTVA 4ML4A 1KBIA 2FHBA 2FIQA 2Z6IA 3GIPA 1IEWA 5LA2A 4HGXA 1YDNA 3VUSA 3PG8A 4OIFA 4CQDA 3ZWSA 4XD5A 1W1B1 1B54A 1X97A 4J9JA 1THFD 2OYKA 1NTHA 2Y5EA 3CHFA 3N2MA 3NR0A 4EACA 3ZIZA 3BOLA 1PUDA 3O0KA 2REQA 1PIGA 4RJEA 3O63A 2VM8A 3ARQA 4HOXA 1LROA 5E1QA 1V3JA 1WDWA 3QV8A 2GYIA 4UOJA 3O16A 3I7RA 4KQNA 5EMJA 5H8UA 2W66A 4CCDA 3TE9A 2ON3A 5C2XA 1UUOA 2VFHA 1SJDA 2VXNA 5DN1A 3PZQA 4US6A 4REQA 2HBXA 4XKYB 5FESA 3P62A 1Q6OA 4QCEA 2E3ZA 2WM1A 1UPMB 2D2OA 2YL5A 1EYEA 2QJIA 3T4CA 2WQPA 3N2CA 2PTYA 1XBYA 3QTGA 5D9PA 5HXMA 2YIHA 2IUZA 3J7HA 1KM1A 2QCFA 5FAGA 3P60A 3O3RA 1EX5A 5I3DA 3QQWA 2D1ZA 3G3DA 3NOEA 2PTDA 3QR1A 1RLCL 3M5ZA 2Z1VA 2V2CA 2AL2A 4QE4A 4JL2A 1LLZA 1V3IA 2RGLA 4I6VA 1H7WA 4KWSA 3ZJ7A 5DCBA 1WXJA 4B90A 3N04A 1DQXA 3LXBA 1M9HA 3QMRA 3K4WA 5E6YA 1X8FA 3RPMA 5H1WA 2YZRA 1XIBA 3GTFA 2NXIA 1XIGA 2YXXA 4PR4A 3WLMA 1MYRA 1TQJA 4OOZA 1Y65A 4O19A 3OIXA 4LUSB 2Z27A 4PTVA 1P6WA 4M0XA 4NIRA 2PE4A 5HMDA 4W8AA 1QNOA 2A6LA 3LV5A 3MHGA 5CPMA 4HA3A 3G1HA 2Z00A 3W26A 3AYVA 3ES8A 3O15A 1F6PA 3MA8A 1H7PA 1BWVA 2WZHA 2WO5A 4B91A 3W01A 4IIHA 4K6AA 5HBFA 1H1YA 4AD0A 4QX4A 6PTDA 1EXBA 1NWSA 5D2YA 1BKHA 3BDKA 1JFXA 1OIMA 1GYNA 4MHBA 1H0IA 3WZ0E 4GI8A 6XIAA 1JL8A 1EQPA 5DANA 3VCCA 4C7DA 2O9TA 1TRDA 3V4BA 4AU0A 2GZXA 5AHMA 4H41A 8XIMA 1OX4B 4MDOA 4AF0A 1FWCC 5A8MA 5FJOA 2WPBA 4ZB0A 1ZAJA 4AMAA 4ZQMA 4L1WA 4DUOA 2R1KA 2CU0A 1L0PA 4GQQA 4L6DA 4ATWA 3TVAA 3A3HA 4NZ3A 4UWMA 1AL7A 3OLIA 1LP6A 3EMCA 3LDVA 1AFSA 1LQ0A 1EHNA 4CUCA 4OBTA 5C70A 3S5YA 3HPZA 4O53A 5J5DA 3P74A 4XZMX 4MG4A 1KFBA 4PRRA 3OJGA 2Z26A 4YTRA 4O0ZA 1L6FA 1FWTA 3SY5A 4NT0A 3OZYA 1Z9AA 3IIZA 3TNBA 1KLYA 3MSDA 3DECA 3FN9A 3TXZA 3AS2A 3WYZA 3IAQA 4LVAA 1US0A 4NXKA 1XKJA 1QU4A 3NZPA 2R91A 2JKEA 1ZS2A 1JD9A 4R5EA 4AG0A 2CITA 2IQ0A 1VIWA 5CGMA 4PMVA 2O56A 1E15A 1AH3A 5L9FA 4D6IA 1QI0A 4Q33A 3VNZA 1W32A 2BG5A 4DBDA 3INPA 4G8TA 1FWFC 1H1NA 4W86A 1GGOA 1GQKA 3Q58A 1H1ZA 4M81A 4AIBA 3UZXA 4PEEA 1G1YA 4UFIA 2Z2BA 3CAKA 4MOZA 5AC7A 2PRMA 4Q32A 2PDIA 1KRAC 4NHVA 4YVPA 3OPSA 4JTIA 1IEIA 4ZE4A 1UBPC 4PMNA 2WV8A 3SN4A 4H01A 1XLBA 3ARVA 2XIQA 1WOAA 1JYNA 3M0VA 3F1QA 4H4IA 3GNNA 3DX5A 3F4NA 1FBAA 4DPPA 4JFSA 2J7FA 2V67A 5BU6A 1FFRA 3M5YA 5TQLA 3DEQA 1PCKA 3D47A 2QIWA 1J5TA 2Z2AA 3LBCA 1TPFA 3EPNA 1N7KA 1KCLA 5A2AA 2XVPA 4H9ZA 4UFHA 4V1XA 1EUNA 4C1LA 2FYMA 4JCLA 5EYWA 1P7TA 3VMOA 3WO8A 3W38A 5D8ZA 2QHAA 3VNIA 4H7ZA 3B9DA 1G6CA 3WJXA 2OPJA 3THDA 3RLUA 3GFZA 2Z29A 2NVCA 3RYSA 5LXEA 3AI0A 4QJ4B 2PMQA 3LCIA 3XISA 2QR6A 4NILA 1A0DA 4Q8UA 4S2BA 1R8LA 1GKPA 5A6KA 4WGXA 2AGTA 4H9TA 1QPOA 1KXVA 1FWNA 2IPGA 1JR1A 1HUVA 2YPIA 4WDXA 2XH4A 1BD0A 3LTPA 1P1MA 3T55A 3OW1A 4YHGA 4FNSA 3STFA 4OTKA 3LBOA 2QUUA 2WW5A 1ZLPA 4M6PA 1LTDA 1G4PA 4QDPA 5A8NA 1A49A 4N6FA 2Z25A 5KTLA 3ZVIA 3H26A 3GE7A 3EPMA 3MP3A 2VL4A 1MQPA 2VI0A 1GW1A 1UWUA 1VFFA 4CU8A 1CGXA 3QFWA 3MI2A 4PA8A 1TV7A 1XXXA 3AHVA 1DIOA 4U2YA 3VI2A 1MRQA 4F8XA 3LTSA 1XRTA 1B3VA 2GJXA 4YTTA 1KV5A 1XLCA 2YYTA 2JBMA 4DAFA 4DZ5A 3M41A 4TO8A 4XZLX 4ENLA 1MQQA 4HNUA 3U7VA 3GH4A 2HPIA 4G1NA 1LLOA 4LRTA 3RRAA 1JZ8A 1DOSA 4JFVA 4XAGA 4AD1A 1DJNA 3KBJA 1OJXA 4UB9A 4F2TA 4HMNA 1XYMA 4A8NA 1NOFA 2G3MA 4JQ4A 4LW7A 5CSSA 4B5VA 3S1GA 1JCLA 1Q66A 3W1AA 3CASA 4DO6A 2XWEA 4BQ5A 3L4UA 3GDBA 3PZOA 4KMQA 2GQ9A 3SUTA 2ACRA 1V0KA 3CQIA 2QF8A 4MNMA 2FGZA 4QJ5B 7TIMA 1F3WA 3NQBA 5ABEA 3L65A 4KPLA 3LLXA 4M7TA 4DPQA 1RQEA 4QAWA 3ZM8A 1G67A 3MVTA 3KOZA 2ZZ7A 5DT5A 1XBZA 4S23A 4WOZA 1R7AA 3VVGA 2DZAA 2ZX6A 4UTFA 2ISWA 5AB3A 3TKFA 1XC6A 3HBLA 4H7CA 3S6OA 2V68A 1QCWA 2PBOA 2PDCA 1E73M 4B2DD 2O55A 1ITQA 1MW2A 3I10A 2OWCA 2NSXA 2QVHA 4BQ2A 3H4XA 2YDAA 1R0MA 1I1WA 4GK8A 2Z0IA 1OFRA 1E9IA 1M1BA 2LLEA 5BRBA 2P5NA 4WR3A 1YEYA 4C90A 2CETA 3D5HA 4HK5A 1BQGA 3WDQA 3E38A 5TF0A 2BOFX 4AD4A 1TTPA 4OE7A 4RE3A 5FKYA 1H0GA 2OWWA 4MKNA 3BG3A 4JXCA 1ZFJA 2FFIA 2IXVA 4HN4A 4NKCA 3FA4A 2E6DA <