1JRBA

The p56a mutant of lactococcus lactis dihydroorotate dehydrogenase a
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLARYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords dihydroorotate dehydrogenase A
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function
pubmed doi rcsb
source organism Lactococcus lactis
total genus 112
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2001-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1jrbA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jrbA01
5U4NA 5AYYA 2EHHA 1H63A 2C13A 3PG9A 3G1VA 2Y63A 3W7KA 3O05A 4WQ6A 3UWZA 2X1UA 1FY6A 2NUWA 1QFEA 4XKYB 1AW2A 1TPH1 3WK2A 1ME7A 2E77A 3IGSA 4IMFA 2GQ9A 3GK0A 4NJKA 1TPB1 3MP5A 4NXSA 3TJLA 4L4LA 3NQ8A 3TQ0A 3HJZA 3WJSA 2GVLA 3KRUA 1O95A 4NNCA 3O06A 4UTJA 1SQ7A 4O16A 1TPDA 2QAFA 3C6CA 4E2DA 4EF8A 4WY0F 4JNMA 5DXYA 3FS2A 3IVSA 3UXDA 4UTHA 4A21A 2B7QA 4K38A 4M19A 3QQ0A 1NF7A 1S5TA 2DZUA 5K3VA 1H7PA 4OU1A 4ZQPA 1H7XA 6ALDA 3TV8A 2E5BA 1EX5A 1XBZA 3L68A 5HWMA 3UXAA 3DHFA 3OVRA 4XUGA 4E38A 1G7VA 2W0UA 3WFAA 2NXGA 5BW6A 3C2OA 1LTDA 3QPZA 3P84A 3H53A 3W7MA 1TMHA 1P4CA 3W1AA 1ZAJA 1HFBA 5I3JA 3O15A 5CZ0A 1G69A 1G6CA 4DF1A 1WYIA 3IIOA 1TPUA 2E6DA 5IBXC 3TA6A 2E5CA 4FXRA 5G1TA 2B4GA 4ZMGA 1X8FA 1ZALA 2WPBA 4LWWA 2YGYA 3DGRA 5HQEA 3QW3A 4O52A 2Q3RA 2VELA 3SJ3A 1FCQA 3LBMA 5LNSA 4LUJA 5KSWA 4UTMA 1XDMA 5HR7A 4X2RA 2V8ZA 3NQ2A 3CIWA 3B0PA 4JD4A 4BR1A 2YZRA 3NVTA 3GXNA 4JX4A 4QITA 3N34A 1EUAA 5F4XA 4IMGA 3GR8A 2WOQA 4IUOA 4HNVA 4MFDA 5C54A 2YFNA 4GUFA 1OYBA 5DXXA 4IPIA 3M5ZA 3LHTA 3DH7A 3M6YA 3BO9A 4JTJA 1PCWA 5FESA 4K36A 4O1CA 1YXDA 4Z1AA 2CZ5A 1OFPA 2QCEA 3LCHA 2QCHA 1XKYA 2V82A 4N9EA 3SY5A 2X16A 3GNDA 5H2ZA 5LHFA 1HUVA 3W23A 3HMJG 4Z0SA 4AMAA 7TIMA 2NUXA 3E96A 4QISA 3BG3A 5DY2A 5BOOA 1Q6LA 1KM5A 2C16A 1EB3A 2DZVA 1WOAA 3LLFA 2LLEA 3TAKA 1IXPA 3W7GA 3USBA 1IGSA 1NSJA 3E12A 4TMBA 3W6YA 4O17A 3LHYA 3OA3A 1H1YA 2X1RA 1GOXA 3I7RA 3GYEA 5CSRA 5C2XA 1KM4A 2E68A 4AHPA 3O6YX 3VI2A 3W1RA 2E6YA 5G5IA 3W1XA 4IOTA 4X22A 1RPXA 1GZGA 5CZSA 4AH7A 1BKSA 3HGOA 3LCLA 1TRDA 3S42A 3PB2A 3PY2A 2WJZA 3S9YA 1KBJA 3A24A 2CLOA 4UC5A 4FX6M 4UFJA 2V30A 3O16A 2TRSA 3W7PA 1W8SA 3NR0A 1KFEA 3NNTA 1UCWA 3OVPA 4UFIA 3LLDA 3TC6A 3C61A 1M6JA 2ZZ2A 3RFAA 2PRLA 5H91A 4O53A 4WY0B 3WJZA 3W72A 1SW0A 4N9CA 1J5TA 3BPWA 3R13A 1Q6OA 2I14A 5LKYA 4M6QA 2YW3A 3LBCA 4FB7A 4ADUA 2A7RA 3EXTA 1UASA 3L5MA 3PSVA 3T44A 3SZ8A 5AHIA 1JQXA 5HULA 2A85A 4N6FA 5TBOA 5I3IA 1FWSA 2CZDA 1OFQA 1PE1A 4C1LA 1FQ0A 4ZQRA 4JX5A 1AG1O 1I4NA 1EP2A 3IEBA 2CFFA 2J88A 4IMDA 2RFGA 4Q32A 3N3MA 3NL6A 1EP1A 1YDNA 2Y7EA 3W7HA 1GVSA 3C3NA 1C29A 3HOJA 3GDMA 3M43A 4Z0JA 4MY8A 4ZQCA 1AL8A 4FHAA 1VYPX 3SSJA 2FPVA 1KFBA 3W1TA 3C2EA 2OCZA 2A2IA 5BNKA 5HUOA 1OFDA 3B4UA 3GR7A 5D32A 1MEHA 3THAA 1T0OA 3I65A 2Y62A 3G1SA 4P2VA 4LC8A 3DFQA 3NGJA 4MY9A 3LXAA 1M7OA 3N2XA 1KTCA 3PS7A 3C2VA 1LRQA 1I2NA 4LS1A 1SZEA 3EB2A 1RVGA 4QNWA 4I7WA 1XL9A 1ICSA 5AHFA 3R8RA 3W7CA 1F05A 1SPQA 3LRKA 5DCBA 4TIMA 5LNWA 1VPXA 3ZS4A 1QNVA 1TV5A 5F2MA 4JDYA 2BWGA 3G1FA 1HG3A 4OWGA 4M5PA 3STEA 2R94A 1O4UA 5FEWA 2QJIA 4MLJA 1OHLA 4JN6A 3ATZA 2XN1A 4UMCA 1K02A 1JCJA 4OV9A 3MUXA 3UYCA 3TE9A 4YMZA 4DEFA 5EY5A 2FIQA 1QPRA 4NJGA 3IIPA 4JTLA 5LNVA 2QF7A 2ABAA 3AO0A 4A29A 1LORA 3PG8A 5U7SA 3TXZA 3UY7A 1V5XA 3M5VA 4IMEA 5CSSA 2CLEA 2CLLA 3TC7A 1FCBA 2ZBTA 2A6NA 1GJPA 1WV2A 2NV1A 3A5VA 3B04A 3S5YA 2A4AA 1G4EA 4PA8A 1ZAHA 4CQAA 3QRHA 1TSIA 3M16A 3CWNA 3HO8A 3ZWSA 3MP4A 2Y7DA 1WOBA 1LLWA 3CLMA 4DPPA 2QCNA 2YYTA 4MJZA 1IXQA 2GJNA 3SW6A 3L0NA 3LCFA 4G1KA 4DF0A 1R2TA 2IQTA 1M5WA 3HPXA 3C52A 3STFA 2J9ZA 4N4PA 4POCA 3I6RA 1XXXA 2VOMA 3NQFA 5DN1A 3UPBA 3N9RA 3P61A 3GAKA 3NPWA 1LOLA 2OJPA 5I3HA 3DU0A 2ATSA 1H50A 4CNPA 1LROA 1H51A 2V5LA 4ICNA 1H7WA 1GVOA 4TMCA 4ADTA 2TSYA 1QO5A 5C55A 3W2UA 4FNSA 4UNLA 4HSOA 1TREA 1ZY9A 5AC7A 2EPHA 3DXIA 3R12A 2CLIA 3W71A 4A2SA 2NX3A 3DBPA 1T96A 3CC1A 4ZVJA 2BTMA 2CLFA 3ZWTA 4AEOA 3C2FA 3MI2A 4D2JA 3TNOA 4XWUA 5DCDA 4PC8A 3P81A 5AHEA 3TXVA 2R8WA 2G95A 1OX6A 2PC4A 2RHGA 1TTIA 4NU7A 2WSYA 4O13A 2V2DA 1RV8A 2WV8A 3OHIA 3L0GA 3PAJA 1AMKA 3CWOX 1I45A 3W70A 3HG3A 4O50A 1G67A 4K7VA 3SR7A 2CLMA 3MO7A 1SW7A 4IXHA 3P8IA 4ML9A 3G3MA 1JULA 2NV2A 3MP3A 4X3ZA 2Y89A 1QR7A 5KINA 3CTLA 5KZMA 3L67A 5I3FA 2B7PA 3QFEA 4DXVA 4JTFA 3W2LA 1TTPA 4IXXA 4UR8A 5D2YA 4RK8A 2VFIA 1VQTA 3ABRA 4K39A 4Y8FA 1WXJA 3WK0A 3GDTA 3PUDA 2WQPA 3W7OA 1YTKA 1HO4A 1PHWA 4RX0A 4CQ9A 5G4WA 2KZHA 1JJKA 2QJHA 4L4MA 1F73A 4NQ1A 4N6EA 1TPC1 4X9SA 4FX7A 4LVDA 1Z41A 2ZQ0A 2VFFA 5EA9A 1X7FA 3TW6A 3DENA 3TU9A 3RMJA 3HB9A 3I7SA 3PM6A 2A7NA 3GVGA 3EX6A 1J2WA 1YXCA 1ML1A 4NNBA 2QCDB 3OVQA 3OBKA 3FFSA 3KOFA 4GJ1A 5FEPA 1H7NA 2FTPA 1ZHAA 3I7QA 4O19A 3P5YA 2ZZ3A 1OFOA 3DHDA 3R89A 1L2UA 1LCOA 5J5RA 1FWTA 4LY8A 2Q8LA 1P0NA 1TRIA 2J9XA 3EX4A 4XBSA 1Q45A 3ELFA 5J5DA 1KM2A 5LHEA 3S0CA 1RQEA 3SIZA 2VEPA 4KWWA 1EA0A 2ZRUA 4ZZ9A 3HF3A 2V9DA 1DHPA 1OF6A 1W5MA 2ZA1A 4R34A 5G2WA 1OX5A 4OHQA 4Z08A 3A21A 5I3KA 3LB0A 3O1NA 4GUHA 1B57A 1GT8A 2EF9A 1EIXA 4GNJA 3S1XA 3IVUA 4LTSA 3DFOA 5HR6A 1T99A 4AWTA 1RD5A 3A22A 3LV5A 1D3GA 2Z6JA 1Q6QA 2GJLA 1KLZA 3DI0A 4QM1A 3O6DA 1K7EA 3TR2A 1YDVA 2XN0A 2ZFAA 3LCGA 1FX6A 1FDJA 2YR1A 2XN2A 2A1YA 3G1XA 3GKAA 2H8ZA 4DO6A 3FYOA 3NM3A 1TCDA 5CZJA 5AHLA 3E9AA 1DOSA 2HS6A 3F1QA 3W75A 3CU2A 2BXVA 3TIMA 3NQ6A 4KFOA 1K7XA 3A5FA 1G4SA 1AK5A 2Y88A 4OV4A 1V7YA 5F1VA 4PH6A 1KFCA 1DQXA 2DZPA 3QPYA 1LBFA 1KTNA 1UUMA 3N9SA 3M41A 2ABBA 1GPWA 1F5ZA 4UUIA 5CPLA 3KX6A 2ZYFA 1QMLA 5IBXA 2JKEA 3BGJA 3W2NA 3UD6A 5FI8A 3PB0A 1I2QA 4LW7A 5FF2A 4MLRA 3N19B 4JTIA 1JCMP 3L0KA 5D37A 3RLVA 3IV3A 3Q58A 1XBYA 3U8GA 4DBEA 3B06A 1P1XA 4JS3A 4JTTA 4EWND 1PHQA 2F7FA 5D2VA 3LTYA 4XBKA 3UZJA 3JRKA 1OFRA 4UTLA 5AFDA 5K4ZA 1OYCA 2VXNA 4ZL1A 3CB8A 1PL9A 1W56A 5L9FA 4HNUA 2QCFA 1TO3A 4IGHA 4LV9A 4QIUA 3MYOA 2PCQA 4P61A 4HNTA 3MI3A 3P60A 3BW4A 4HNNA 5K9CA 1LOSA 2A6LA 1OX4A 4RV8A 1JCNA 1YPIA 4IX0A 3QZEA 2YPIA 2I9EA 3MBFA 1OJXA 1UUOA 4PODA 3QF0A 3U6WA 3QQ1A 5HNRA 3FLUA 1X1OA 3DI1A 3THQA 4O0KA 1GEQA 3GKFA 3T7VA 2NLIA 2FB2A 5AYZA 3F4NA 3NQEA 3EWYA 3G24A 4FNPA 3W84A 3PBUA 3NL3A 3PUEA 4XKYA 1R46A 2R14A 1ALDA 3IIXA 1Q3NA 1LRTA 1NFBA 2RH9A 3O8AA 1B9BA 1K03A 3S1UA 3UWQA 1KFLA 4UR7A 2CZEA 4Z1CA 1LOQA 2G96A 3EWXA 3Q2DA 1XBVA 1WDWA 5MHBA 4LC6A 3H55A 5AB3A 2X30A 1LLZA 2Y6ZA 1VCFA 5FF7A 1DV7A 1M7PA 3LDVA 3QEZA 4RXFA 3GXTA 1MO0A 3GAYA 5DBUA 1WBHA 3TSBA 5LNRA 2WSRA 1THFD 4IX2A 2BLEA 3LCWA 2ISWA 2TPSA 1MSSA 4NZFA 4Y6GA 3W1PA 4RZ4A 4WOQA 5F4WA 3BLFA 3W07A 3YPIA 3QMSA 4WOZA 4MYXA 5E0KA 3LXBA 2JK2A 2FQIA 2QR6A 3KVKA 1W1ZA 3DFSA 1Z42A 3HGJA 4TX9A 3G8RA 1F7BA 4E2BA 1YPFA 4RR4A 4JIQA 3WJWA 3NOEA 1ICQA 4RJEA 3SGZA 3UQNA 2ALDA 5D09A 4OBTA 3ABSA 5ABTA 4NT0A 2A0NA 4PL1A 3C56A 2Z1BA 3LGEA 3W1QA 5AC8A 1XI3A 5KITA 1WBJA 3G8EA 4U4MA 4PCFA 3W7QA 1GG1A 3BG5A 1VLIA 4CNNA 3LCXA 4RCXA 1QPOA 4IPJA 2J27A 3TQKA 3OG3A 3SI9A 1D3HA 3W3OA 4BFAA 2ZZ4A 3NPVA 2QUUA 1YADA 2CW6A 5EMUA 2NWRA 2WO5A 4AVFA 3FJ6A 4LRSA 3K30A 4E0CA 4GFSA 4RLIA 4R53A 3EWWA 2HTMA 2CZFA 1QAPA 1TPWA 1L6WA 2H6RA 3TMLA 3N14A 3TK7A 4WXYA 1QCWA 1VRDA 2C3ZA 3W7LA 3E02A 3W1LA 3EX3A 2TYSA 3EWZA 3B8DA 4DF2A 1FDYA 4NNAA 3PVFA 2VENA 2V2CA 1O94A 4YXGA 4O1BA 5EL1A 2ZTJA 4KFNA 2X2GA 3S5NA 3HG4A 3L9CA 4MUZA 1HTIA 1B3OA 4IWWA 1KM3A 1W3TA 1DVJA 3M5XA 1G4PA 1F76A 3A9IA 3VKJA 4LVGA 3BARA 4ZQMA 3G3DA 3ZFHA 3BVJA 2RDUA 4O57A 2C19A 4BK9A 2QUVA 3TUUA 1JR1A 4N9BA 1WX0A 1KA9F 5D30A 3C8FA 1JCXA 3P67A 2VFEA 5D03A 5L6UA 3EXSA 1N8FA 3EWUA 3U2OA 2E1DA 2QKFA 2UV8G 1EEPA 1LM1A 3UWVA 4O11A 1UBSA 2TMDA 3KVMA 4BWLC 3W83A 3IIVA 4NX5A 5EBUA 2BSLA 4I9AA 3PBVA 1R47A 5FF3A 3RK8A 4BF9A 1YYAA 1G7UA 4H4IA 3NQGA 2CWNA 4Q33A 2AGKA 2NX1A 3I68A 3BG9A 3R5EA 1A5AA 3GDRA 3M1ZA 1DJQA 2FPTA 1TPFA 3EKLA 3TSMA 4UNKA 2AQWA 4MKNA 1JRBA 5K2ZA 3MHFA 3FOKA 3G0XA 5DBTA 3KVJA 2A5HA 4U28A 4ONVA 4B5NA 3MHGA 4O0ZA 4OGZA 5CPOA 1BTMA 4A3UA 5FEZA 4WY0A 4EF9A 3EX2A 1OF8A 4EVZA 2NWSA 4ALDA 3NPXA 1TPVA 2NUYA 2O7QA 4OE7A 4JTKA 4FO4A 4TO8A 3GX9A 2V0TA 4ADSA 1OVDA 4Z1BA 4AWUA 2C6QA 4H6KA 3EEGA 3HQ1A 2X1TA 5F1UA 4HPXA 2Y61A 2GUUA 5LNUA 2B7OA 4RKAA 4AF0B 3NXFA 4MYAA 2QJGA 1VZWA 4O4WA 4AHOA 3LI0A 2H3DA 1ONRA 4O12A 5I3GA 4R7JA 1FUYA 5GVJA 3PULA 5K9XA 1FXPA 3UNDA 1FWWA 1DJNA 4NUWA 1W0MA 3DKLA 4JICA 2P10A 1K8XA 3CEUA 3V75A 1G4TA 3W73A 3KAOA 3C0JA 4YL2A 3M47A 2D73A 5CPMA 2DZWA 5E1QA 2OZ0A 3EWBX 4CLMA 1QOPA 3V1PA 1FCVA 3TDFA 4UIOA 2QDHA 4YCOA 4CNOA 5TQLA 1H62A 1SU5A 2GVJA 3FJLA 3GIYA 4DO5A 2OMAA 3RNDA 1TTQA 4CCCA 3PF3A 1XFBA 2GPTA 3P74A 3QYQA 3LXCA 3T40A 5F2GA 3STCA 5K7JA 3T4CA 1LRNA 1OK4A 4JTEA 1GYLA 3TX9A 1QPNA 4TU1A 3W1UA 3NL2A 5F2IA 1MXSA 4FF7A 1SZGA 5DY3A 3G0UA 3LERA 4JTHA 1C8VA 4Y96A 3N2MA 4JTSA 3MW7A 1TV7A 2VEMA 2OT0A 1TTJA 1B4EA 3QM3A 4HHPA 3DFNA 2Z2UA 3CM4A 3KXQA 3ABQA 3GNNA 4NJIA 5HWNA 3QSRA 1BWLA 1FXQA 3WK3A 2VKZG 1JRCA 3M7WA 3M9YA 4S2CA 1WQ5A 1XCFA 4EOUA 2WKJA 1FWRA 3UZ5A 1ZFJA 2YX0A 1LZOA 4UFHA 1Y0EA 2J6XA 4UTIA 3B05A 4UFKA 2Z6IA 3VFLA 1D9EA 1R2SA 3ABOA 3TJXA 4LVAA 3KRZA 3W87A 4UXDA 2YCEA 2QCMA 3LTSA 2JKAA 1VYSX 3NZRA 3LV6A 1VR6A 5KTLA 1SO5A 3BLEA 3BGGA 5AOUA 2YXGA 3HBLA 2ZDRA 4NVTA 2VEKA 3TSDA 3L65A 3DAQA 3LRLA 3LOTA 4BI6A 2PE4A 4N9DA 2GQAA 2DP3A 2NXHA 5CG7A 2BX7A 2FDSA 4ORIA 1SUXA 3W22A 2WSQA 5D2TA 3JR2A 4WD0A 3W7RA 3NAVA 5BRBA 3LM7A 3RLUA 2PURA 4HPJA 1W54A 2Y70A 1B4KA 3INPA 1OABA 3CIXA 3W1MA 1O60A 4M6PA 1XUZA 3W1NA 4BI7A 3O63A 3LRMA 2NX9A 3DKJA 2OX1A 3S5OA 1NF0A 3NG3A 2ZZ7A 1ZCOA 3PC0A 3VCRA 4DELA 4UMBA 2HS8A 1SO4A 1EWEA 1TIMA 4BI5A 4MZ1A 3T78A 1VS1A 3NQ7A 3DFTA 3NYZA 5AYXA 4O8RA 1JUKA 2EKCA 3TCEA 2JKPA 1H61A 6TIMA 1ZENA 1T8XA 2ZRZA 2ZCGA 2E09A 3H54A 1VHNA 1XUUA 2VFHA 1OFEA 3NPUA 1LDCA 2C1HA 5EYWA 5HUPA 4LVBA 4O14A 3W2KA 1L9WA 3SFKA 5HMSA 4XTIA 3CPRA 4I7UA 4O1AA 3G0SA 1ADOA 3NA8A 5IM51 1KTBA 1ME8A 1XDLA 1FCUA 2W6RA 3W7NA 4I7VA 4K8HA 3E0IA 5F2LA 3EX1A 3NL5A 3P62A 1MEIA 1S5WA 4UCGA 2ZZ1A 3OEXA 2ZZ6A 3FIGA 3R2GA 2DZSA 1YTEA 3BLIA 1DKWA 1NEYA 4Y90A 4A22A 3GXPA 4IJBA 1BEUA 3TFXA 2Z0IA 2E6FA 5CGQA 4AAJA 3QSTA 1CI1A 1JCLA 4JX6A 3NQCA 4JYDA 4JY9A 3G1DA 3F03K 3AJXA 4QAIA 4C1KA 4CCEA 4OQVA 4O15A 4DPQA 2OT1A 4NXKA 4R33A 2NXIA 3P5ZA 3MI6A 1O5KA 1VCVA 2HMCA 4HIBA 2G97A 4LU0A 4FX8A 1L6SA 1CW2A 1N55A 2YYUA 3MWAA 3W86A 3M44A 3PUOA 3CHVA 2QCDA 3C4UA 4FNTA 2E5DA 1PCKA 3ANYA 4FNRA 1SSGA 1XBXA 1WA3A 3TFCA 1GTHA 4AXKA 5F4SA 4J9JA 1I2RA 3OIXA 4GXMA 4WXZA 5D04C 3SGUA 4HN4A 2ISVA 3S1VA 2ZRVA 3L66A 4YWIA 5KZEA 1SZFA 4MPQA 1I2OA 5DLCA 1GVRA 1KM6A 4FIRA 5T26A 2RDTA 4Q4KA 2Y7GA 4N4QA 2CLKA 4XZ9A 4JTGA 1A5CA 1Z44A 1PVNA 1SFJA 1E51A 2HSAA 3M0ZA 1UJPA 3BW2A 1SR9A 5TIMA 4Y9AA 4IMCA 4O1DA 3GLCA 4JEQA 2A21A 3DFPA 1W5NA 3CQ0A 4S1FA 1ICPA 3VNDA 1ZNNA 4NZJA 3B03A 3GB6A 4RZ6A 3WK1A 3NM1A 1F6PA 1VC4A 3GZ3A 2EAWA 1JQVA 1W3IA 3KFTA 4GUJA 3KRSA 1C9DA 1OG0A 3LCIA 1L6YA 2B0MA 4H3DA 1LYXA 4JIPA 1KM0A 4LT9A 2ZZ5A 3LI1A 3CEPA 5CPNA 1W5QA 5LSMA 1W5OA 3HGRA 1H1ZA 2VEIA 1TJPA 2DJXA 1KW1A 5HINA 2V5BA 3W2MA 4KFPA 3G1AA 3VE9A 1QWGA 2ZA2A 4GC4A 3P82A 4MY1A 3HGSA 3TROA 3IRDA 3W7JA 4GWEA 1TQJA 4A2RA 3B0UX 1W3NA 4HKPA 1AL7A 1P5BA 1KV5A 2QEZA 3WJYA 4K7YA 2YDAA 3CT7A 3W85A 2P0OA 4DBDA 1KFJA 4KKXA 3GDLA 3ZR4A 1JUBA 2A7PA 3MBDA 1JUEA 1IF2A 5A5WA 4HSNA 3W76A 4JR5A 2J9YA 5AHMA 5FF4A 3KHJA 5A8GA 1OYAA 4GUGA 3S1WA 3NQVA 8TIMA 3F4WA 2YSWA 1TYGA 3HPZA 3G22A 1F74A 1KFKA 2DZXA 3C2RA 4LNYA 4GRSA 1SSDA 2X1SA 1OK6A 3E49A 3IVTA 3EKZA 1HL2A 5SWUA 1AW5A 3HG2A 4AB4A 3S6DA 3RU6A 1HO1A 2YFOA 2ISSA 5HWJA 5G4EA 1RR2A 2FLIA 4YCPA 4NJJA 1GQNA 1DQWA 1VLWA 1GWJA 4NJHA 3W9ZA 3ATYA 2R91A 4WJEA 2VFDA 2FFCA 3G1HA 1KBIA 1ZAIA 3P7YA 4O54A 2C15A 2CLHA 3D0CA 4QNEA 5DCEA 3FEMA 2ZTKA 1LP6A 3PBYA 3W88A 5D2XA 1F2JA 1GTEA 2DORA 4MJMA 1I2PA 2CU0A 3EXRA 2J24A 5AHNA 1PIIA 5KZDA 4N02A 3Q37A 4EIVA 4UMAA 3Q94A 2V81A 5BMXA 4KWVA 4BWLA 1NVMA 5E93A 4LOCA 1QDSA 3NQDA 4JDBA 1XC4A 4XQ6A 3DZ1A 4QQ3A 2C18A 2P1FA 2JGYA 2RDWA 3FA5A 3S5ZA 5HJLA 4AWSA 4LUIA 3STGA 1TPEA 2H3BA 1GG0A 3NDOA 1X1ZA 4ZQOA 5EKYA 1ME9A 4K6AA 1SO6A 4PL2A 3UY8A 1OFAA 1GYNA 4QSHA 5D02A 5D33A 3FKKA 2DU2A 2XFWA 1EPXA 4FXSA 2DJLA 3LHUA 5KMYA 4LRTA 5CKSA 1JVNA 4UTWA 1FDZA 3WJXA 2E6AA 4MOZA 3LX9A 4MZ8A 3S8HA 3G1YA 3UWUA 3O07A 4IQLA 3JS3A 4JYEA 2RKXA 1QPQA 2VC6A 5D2WA 2I1OA 4S2BA 1EP3A 1FBAA 2QCLA 4UTWC 4W9TA 1I8JA 4QJ1A 1F6KA 4FEZA 5G2IA 1P0KA 4UTKA 1VYRA 1K3UA 2ZA3A 2WNNA 4RZ5A 1AW1A 3QMTA 2NZLA 4CQ8A 4MIMA 1R30A 5G1YA 4LS0A 4FNUA 4JYFA 1IIHA 3TQVA 2ATMA 3QC3A 4NX0A 4AHQA 2WNZA 2ZRYA 3QMRA 2W79A 1S3HA 1YDOA 1U5JA 1J4EA 3RF9A 5LGZA 3PWAA 2PRMA 5G2HA 2QUTA 2FJKA 1O5XA 4FIQA 4O10A 3N73A 2GVGA 1KM1A 2EGZA 5EPDA 1QOQA 3W2JA 3TMQA 1NAL1 1W31A 3NZ1A 1PS9A 1Q6RA 1H60A 1TJRA 1DL3A 2H90A 4O28A 4M7TA 1VHCA 3QJAA 1VGAA 1A50A 1TB3A 1MZHA 3PBWA 4UTUA 4K37A 1SFLA 1VJIA 3T55A 5FF0A 3LHVA 1PV8A 3W7DA 2VFGA 1H5YA 2BZNA 5K9DA 1EUNA 1TQXA 3LHWA 5D05A 3BW3A 3HG5A 1U83A 2QAPA 5LZLA 4MFEA 1YLVA 3QH2A 1GVFA 1S5VA 3A23A 1K8YA 1ZJIA 2Q8ZA 3LTPA 1XM3A 1BWKA 2WNQA 3MMTA 3FKRA 1SZNA 1H7RA 2DZTA 2GQ8A 1RZMA 2C14A 4WUIA 3IGUA 2ZRWA 2O7SA 1Z48A 2GOUA 4K8EA 4GUIA 3TW7A 3BK0A 4LV4A 4GBUA 3UWWA 2JGQA 1MEWA 4ORMA 4MVAA 1DBTA 4JTUA 3VE7A 5D38A 1WAUA 2C0AA 3NQMA 4UTTA 3HIJA 4PEKA 3L5AA 4DO4A 3P8JA 5LGXA 2H8XA 4HT3A 2Y85A 1DORA 3BV4A 1N7KA 1W37A 4JGDA 1YTDA 1KV8A 4UTTC 3L21A 1W5PA 1VCGA 3W7EA 4WX2A 3MJYA 4PFMA 4RXGA 1RQBA 2QCCA 1SW3A 4O4VA 4ZQNA 3G18A 2FPYA 4UFLA 2B7NA 3IGXA 4M6VA 3NEVA 4XTDA 3W7IA 3TAOA 2PRHA 3HPSA 3LHZA 1QO2A 4JXCA 2G5WA 3M5YA 4YLWA 2QDGA 1X6UA 1FWNA 2Q3OA 1K7FA 3O6CA 3FYPA 2F84A 3P80A 5CZTA 1SO3A 5BMWA 1A5BA 3QW4B 5C5YA 1A53A 5FEXA 3PR2A 4OT7A 2JBMA 4AF0A 1EWDA 5DELA 3B0VC 1K8ZA 4JY8A 1LBMA 3KVLA 1A5SA 5C6MA 1IIGA 4O18A 4WZHA 1JCYA 2ZRXA 1CX9A 1RQHA 4LS2A 4GE8A 5AN7A 1VH7A 4FNQA 1LBLA 2YW4A 4N2YA 3TH6A 4CCDA 2QCGA 4Z1DA 4M7SA 4TR9A 1OFBA 3UWYA 1KLYA 1H7OA 1R2RA 3L5LA 4UFMA 1GVQA 3UPWA 3PSWA 1YXYA 4LVFA 2V2HA 1UB3A 1OX4B 1IXNA 3NQAA 3MHUA 3L2IA 3W74A 3TKFA 2Y7FA 1TV8A 4PTNA 3SECA 3GDKA 5AC6A 4DQWA 4MZYA 1IXOA 2AAMA 3NO5A 5K4XA 3MYPA 2FB3A 3IIZA
chains in the Genus database with same CATH superfamily
3CZ8A 5AYYA 1E40A 2EHHA 1H63A 2UZ9A 2W3ZA 4MSSA 3G1VA 3W7KA 3UWZA 1EGMA 1XRFA 2NUWA 3MPGA 4XKYB 1O66A 1AW2A 3WK2A 1ME7A 4NAFA 3NDZA 5JBFA 4XD4A 1UQYA 3QC0A 4NJKA 2XSAA 1TPB1 1I1WA 3TJLA 1RHCA 4J1OA 3P2VA 3KCJA 2GVLA 3KRUA 5DMLA 3DN5A 1O95A 1DJHA 4H9MA 1SQ7A 4O16A 3KBJA 2OWCA 3K1DA 3GS6A 2QAFA 4WY0F 3CAWA 3FS2A 2P3ZA 3WFZA 1MW2A 2WAGA 4K38A 3S47A 4M19A 1H7PA 4ZQPA 1LUCB 4J3VA 6ALDA 1HL8A 3L68A 1XBZA 1XICA 2QXWA 4C60A 3VD7A 4YU1A 3OVRA 1EXPA 2NXGA 3JUGA 5BW6A 1TFVA 1HF6A 3QPZA 5EU9A 4UZUA 3W7MA 1P4CA 2BHZA 1HFBA 3E74A 2G3MA 5JH1A 1UH4A 1PZ2A 4DYKA 3N29A 2Q8XA 3APYA 3DG7A 2E6DA 5IBXC 4ZE5A 2YBUA 1X8FA 2WPBA 3LGGA 4LWWA 3VUPA 3DGRA 5HQEA 3QW3A 2Q3RA 3FSTA 2FHBA 4NY2A 1CLVA 1FCQA 5LNSA 5KSWA 4MNKA 2CITA 1XDMA 4ACZA 4X2RA 3DBNA 3CIWA 4KWUA 1V7AA 1VIWA 4BR1A 1AD1A 3MSDA 3GXNA 3PTKA 4JX4A 3SQLA 2CWXA 3CH9A 3HFYA 2XH0A 3GR8A 4BA0A 2E8YA 5MKGA 4IUOA 4MNJA 1FHLA 3RCNA 1X6NA 1M3UA 2XH2A 4J3TA 1Y5XA 1B3YA 2YFNA 1OYBA 4IPIA 5HAOA 3M5ZA 4JTJA 2WZEA 2BVWA 4K36A 3T4WA 3Q4DA 1EJTC 2WKLA 3A12A 3QGVA 1UKTA 3O7UA 2EPKX 4N9EA 2X2YA 2Z2AA 4ZGYA 3DYMA 1SFTA 3WO8A 4I8DA 4ATDA 1U1JA 4Z0SA 4AMAA 4W8AA 5DY2A 3RJYA 1ZCCA 2C16A 2PD5A 4QGCA 3T9PA 1QW7A 1XRSA 2QDDA 1WOAA 2LLEA 3TAKA 4AG0A 1RCOB 3SCVA 4GYJA 3E12A 3LHYA 3VO0A 1H1YA 2X1RA 3GYEA 4PEEA 4UQDA 4ACYA 3XIMA 2E68A 1WDRA 4YHEA 5I3DA 3JU2A 1K70A 1RPXA 1R6WA 1NARA 4XD6A 3PY2A 4DX3A 3O16A 3W27A 3OVPA 1UCWA 4UFIA 3TC6A 2ZZ2A 2PRLA 5H91A 1YIXA 3ZYZA 4Q4RA 4C6QA 2X0YA 3WJZA 4N9CA 4QG8A 3GHSA 1J9YA 3P3BA 1YPXA 2BGNE 4MKSA 3AHYA 2A7RA 3F4DA 1UASA 3WSUA 3CHCA 3T44A 3QLLA 2PLJA 4QTGA 4REQB 1WDSA 5TBOA 1FWSA 1DXFA 3SCTA 1D8WA 1OFQA 1XIDA 1AG1O 3SURA 2J62A 1KXQA 2CFFA 2J88A 2PWVA 4IMDA 4Q32A 2DIEA 3N3MA 3JW7A 2DIKA 1YDNA 1GVSA 4MAZA 1IWPA 2YJQA 3GDMA 1P7TA 3M43A 1OD0A 4Z0JA 1GQKA 1AL8A 3IGHX 4FHAA 1UJQA 2OWXA 1KFBA 1VFHA 3EDJA 2OCZA 2A2IA 5HMEA 3WCZA 2ZDSA 4DLMA 4ZB0A 3THAA 2P8BA 2Y62A 1WB0A 1QI4A 4HU4A 4B5SA 3NCOA 1CGVA 2XVKA 3AISA 1KTCA 2IPWA 1LRQA 1F3TA 3A47A 1MXDA 1AJZA 3LLXA 3KTCA 3N4AA 1NQ6A 5AHFA 5REQB 3R8RA 4AX6A 5CCZA 1SPQA 4XG1A 5LNWA 4XAZA 1OC6A 4B5TA 4Q8PA 4JDYA 1HG3A 1E4IA 4M5PA 2QJIA 4RW5A 1ZJHA 4UMCA 1JCJA 4OV9A 3MUXA 3TYCA 1PKLA 5C70A 3WLLA 4JTLA 3QHNA 2ABAA 4L56A 1X8CA 5A95A 4ES4A 5D9PA 3PG8A 4UOJA 3WD4A 2X05A 4XAYA 4F0MA 1YQ2A 4LAZA 1V03A 3K8MA 4H04A 3TC7A 1FCBA 2ACRA 1UIOA 2A6NA 3B04A 3ONBA 3F4CA 4PA8A 1TSIA 4Q4OA 2QHAA 3H2FA 4DRSA 3HO8A 3ZWSA 2QGYA 1XGEA 3UJSA 3CLMA 4A05A 4HU3A 3BMVA 2P3EA 4L80A 1M7JA 5HNNA 1A47A 2OFJA 5GNYA 5CH9A 3EPMA 1XJBA 3N2TA 1R2TA 3C5QA 3LU2A 1LQ0A 4POCA 5CAKA 3I6RA 3E5BA 3CHFA 1NOUA 4QS6A 4GGBA 3GAKA 3UA3A 3WDPP 4AX7A 4TMCA 1E15A 2Z1WA 4LUTB 4NZ3A 4L7ZA 4ADTA 4K1WA 4I9TA 3VDAA 1A0CA 2WVUA 1UD5A 4HSOA 2DQXA 5E09A 2OB3A 1F8MA 3W71A 4CQDA 3M7SA 3EWCA 4A2SA 3DBPA 5D9OA 1T96A 1V93A 3BLPX 4F9JA 2BTMA 1H0IA 1OCQA 3SCWA 4AXNA 2GJPA 2HZGA 4PC8A 3P81A 1H4PA 3LUTA 3PNZA 4F40A 3BZGA 3RR1A 2G95A 4IQJA 4O13A 4P8UA 2WV8A 3OHIA 4MDOA 1KRBC 5D8ZA 3BAYA 3QPEA 1JZ5A 3W70A 3UBPC 3H23A 1YE4A 1UWAA 2CLMA 2PBOA 1SW7A 3MO7A 4IXHA 2FZBA 3DFYA 1KKOA 1C9WA 1D3CA 4ML9A 3RM8A 4X3ZA 3H7RA 5D4YA 3E2SA 1QPKA 1O1HA 1QVBA 5KZMA 1MDRA 5ABFB 1UIPA 1A5NC 3LPOA 2B7PA 1XD1A 3V0SA 3LZ3A 4JTFA 3BAXA 2VFIA 2O9TA 4K39A 1UW9A 4IICA 1TKKA 4A35A 1Q8AA 1V79A 1FH7A 1AODA 3DG3A 4LBUA 4L4MA 3VVGA 1F73A 4HNCA 2OGYA 4LVDA 2ZQ0A 2VFFA 3FJ4A 3DENA 4H19A 3HB9A 3PM6A 1C7SA 3KBWA 2PTWA 2A7NA 1J2WA 1PIFA 2HPMA 4JTAA 1YXCA 4CU7A 1ML1A 4WVXA 1GKQA 2E9MA 1DIKA 3PBMA 3CV2A 3I7QA 4UNIA 1TX2A 2BY2A 1CLKA 3P5YA 1OFOA 4LY8A 4GI9A 4KF1A 4WLCA 1Q45A 1KM2A 5LHEA 3B9EA 1OCBA 3ARRA 4US5A 2BODX 5M3WA 4QJ3B 2W62A 1ELSA 4XAFA 2DDXA 2VGBA 1W5MA 2ZA1A 3N15A 3WKZA 3WQ8A 1MW3A 4DZHA 4U5KA 3M07A 4RUBA 3S2MA 4EWJA 5HPOA 1WXYA 1ZZMA 2G0WA 3S6TA 2EG8A 1Z9AA 3DFOA 2CIPA 2YLLA 1AZ1A 2GJLA 1KLZA 3DI0A 2VC7A 3E2VA 4IP4A 4QM1A 3WH6A 4ZODA 2XN2A 2H8ZA 3GFXA 4WDTA 5AHLA 3CMFA 3CK5A 3QV8A 3F1QA 1L2QA 5FJPA 2YDRA 4KFOA 2IQ0A 4L6OA 2Y88A 1E56A 5F1VA 1DQXA 1SMDA 1LBFA 1F5ZA 3BGJA 1EZ2A 2CC0A 2PP1A 4JN7A 3UD6A 2V38A 1M65A 5HMDA 1RJQA 5FF2A 3GBEA 2OOFA 3TW9A 2YOCA 5D37A 3UVIA 3U8GA 3VNZA 2PDNA 1P1XA 3MKCA 1D7KA 4JS3A 4EWND 1XGZA 3LTYA 3EB4A 3AS0A 1SGJA 1OGBA 2PDGA 4NASA 1YRRA 2VXNA 1W56A 1ZP4A 3NXLA 4HNUA 1M03A 2VM8A 3MTWA 4HNNA 3PWIA 2A6LA 4RV8A 4RNJA 1YPIA 3QZEA 2HK1A 3T81A 2D69A 3MBFA 1OJXA 3LZ5A 4IQEA 3V0TA 2DW7A 3NDYA 2Y5EA 1GEQA 3RPDA 3T7VA 3BXWA 5M03A 1FKXA 2FB2A 3F4NA 3IUDA 3EBVA 3EWYA 3G24A 2J79A 3PBUA 2IW0A 1E5JA 4XKYA 4AYGA 1XH2A 2EJ1A 1Q3NA 2WMJA 1V3MA 3BLDA 4HSHA 4CNUA 3F2BA 1NFBA 1FRBA 3S1UA 3WBEA 3BJFA 2VGFA 4UR7A 3SCOA 3ZVHB 3EWXA 3Q2DA 2DT1A 4A8NA 1R85A 1QI3A 3VD5A 1WDWA 4XISA 1J0IA 4S3EA 3W82A 5FF7A 5FL0A 1SZRA 3LDVA 1A5MC 3OW1A 4RE3A 3CUIA 1R8LA 1THFD 1RH9A 1B31A 1LUCA 3E38A 4KESA 2W5FA 4S3FA 1E0TA 4U3CA 3ERPA 3BLFA 4TQTA 3ZLGA 3QMSA 3VZZA 2JK2A 1XLHA 2FQIA 3KVKA 1PDYA 3ZXWA 2CBJA 3V4BA 4TX9A 3G8RA 1F7BA 3KS5A 1YPFA 4HK7A 3ZZ1A 1V08A 4PCNA 1GYMA 1JD9A 2B31A 2GJRA 3HV8A 2ISFA 2V3GA 1EHAA 4XIMA 3ITOA 3GUWA 1EGZA 3MCNA 2C91A 1WBJA 3G8EA 1MRAA 3V5OA 3W7QA 1BVZA 1VLIA 4OZOA 2WSPA 3VIGA 1IZCA 1D3HA 3W3OA 1MUWA 4GCXA 3FN9A 2PDWA 1YADA 1OQFA 5EMUA 1JYXA 4FPSA 4AVFA 1O7AA 4DIAA 4E0CA 2DFAA 3OBEA 3EWWA 1MNSA 1CIUA 2HTMA 4GY7A 1QNSA 1XH1A 5G4HC 1R3YA 4JQ1A 4CNSA 2WLZA 5JUVA 1VRDA 3W7LA 4DZAA 1E9YB 3B8DA 4DF2A 1JZ6A 2V2CA 1VFFA 1SM9A 4O1BA 2OODA 4CVUA 2ZTJA 2DPEA 1E9ZB 3S5NA 3NSXA 1DVJA 3NSMA 4ZQMA 3G3DA 3ZFHA 3WQGA 5CGTA 2QULA 4WIWA 3H2OA 2HE5A 4N9BA 4PCSA 5D30A 4FXFA 4L6DA 4E4PA 2QKFA 4OOUA 3MUY1 3SQSA 3UWVA 4AZGA 2TMDA 3VDBA 3IIVA 4NX5A 4X60A 5A8OA 3GVQA 1OIMA 3RK8A 4BF9A 1YYAA 1RCXB 3XISA 2ZXQA 2UY2A 3WQ4A 1UC4A 3ES8A 2D2HA 3I68A 1A5AA 1DJQA 2FPTA 3R58A 4WGXA 2TAAA 2AQWA 3PZUA 1BXBA 5K2ZA 3FXGA 3PN8A 4ONVA 1M68A 4B5NA 1IZJA 1XDJA 3EYPA 3LBOA 1BTMA 4A3UA 5FEZA 2R1LA 4EF9A 3CV7A 4QCEA 1OF8A 5AZ0A 2C71A 1TPVA 2O7QA 1CCWB 5A3HA 3AYVA 4FO4A 1DTNA 3VOGA 2FJUB 4ADSA 1OVDA 3CS2A 1ZGDA 4NKCA 4AWUA 1BF2A 3SSZA 3HQ1A 2X1TA 4REQA 3WZ0E 2Y61A 3H4GA 2B7OA 2QYGA 2QJGA 5FAGA 3SEPA 2F6UA 1RBLA 1UBPC 1ZTVA 1E6QM 2GSJA 3EOLA 4L4OA 1ONRA 1UC5A 5I3GA 5J8LA 5EB8A 3T8QA 3WLRA 4GH3A 4NUWA 4JICA 3CQJA 4ATWA 2RDXA 4O1FA 1KWKA 1G4TA 3C0JA 4LAMA 4KIEA 3NJ3A 1BPLB 1EHNA 2OZ0A 4PBFA 1FCVA 4ZCWA 3TDFA 5CQ1A 4JL2A 4G9PA 1H62A 1SU5A 2J77A 5CG0A 2Y5JA 3RIKA 3BURA 1TTQA 3M0VA 2X1IA 3S2NA 4AY8A 1XIGA 5REQA 3P74A 3T40A 3NUKA 1OGSA 1K1DA 2Y8KA 5BZAA 1U22A 4LQ1A 1LRNA 4ERGA 4YWSA 1QPNA 4AQLA 2Y8VA 3NL2A 5F2IA 5HK4A 4FF7A 2D0FA 4Y9PA 5E5CA 3VNJA 5A6JA 4JTHA 1IT7A 1TTJA 4I6KA 4Z2IA 1B4EA 4MG4A 3LY0A 1XLJA 1F8IA 3DHUA 3KXQA 4BEUA 2XFFA 3F5JA 1FXQA 3B9DA 4B4HA 3WK3A 2OTDA 4S3DA 1PBGA 1RVKA 1WQ5A 3BLLA 5HJYA 3ARVA 1F6YA 3RRAA 2Z1VA 3GQYA 1FWRA 2QPSA 3SN1A 1XSKA 3B05A 4UFKA 1E6ZA 2Z6IA 3VIFA 3VIMA 3IUIA 4X9YA 4UXDA 1XQLA 2YCEA 5CC6A 3V36A 4EX4A 3P0XA 3GNPA 3EMQA 2JFEX 4CGTA 5KTLA 3B8SA 1SR0A 3HBLA 3E0VA 3TSDA 3DAQA 3DESA 1AQMA 4ORIA 1V4YA 2WSQA 4PUMA 5C9UA 3JR2A 3ALGA 3W7RA 3NAVA 2VZUA 4NYYA 1IYXA 1W54A 3DYOA 3INPA 4RL3A 4EP8C 4B2DA 4M6PA 2WZHA 1DWAM 4KCWA 4KRTA 3O63A 1VAHA 4M81A 2NX9A 4HN8A 4QHRA 2ZZ7A 2WANA 4YTTA 2PS2A 4AIEA 2ZUNA 3VCCA 1EWEA 3FVDA 1TIMA 4L9YA 3Q67A 3WD3A 1ODZA 3T78A 1QBAA 3NQ7A 3DFTA 5AYXA 3VM7A 4O8RA 2EKCA 4XZWA 3TCEA 4HBKA 3N2OA 3H54A 3VPLA 1DQUA 2VR2A 2H9AA 3IV8A 4W84A 5HUPA 4D6GA 1F4AA 3W2KA 5FIPA 1M7XA 1QT1A 1TVLA 4XTIA 5ABFA 3CPRA 5BXTA 4GQGA 5E0FA 1KTBA 2GYIA 4F9DA 5CSUA 1GZ1A 3GXIA 1POJA 2W6RA 3VILA 1KO0A 3P62A 3AZRA 4JFUA 4LFYA 3L2LA 3H2CA 3GXPA 4IJBA 1XPGA 1D8CA 2E6FA 2PLMA 1RALA 5CAHA 1JCLA 2W63A 3TN5A 3NQCA 3FDGA 2YDQA 4QAIA 1NELA 2ZX7A 1BHGA 3VIIA 1LLOA 4R85A 3V7PA 3MI6A 1CXFA 1ZL1A 3VDCA 3TTEA 2O4QA 4FNTA 3MWAA 3PANA 4I5XA 4Y9OA 3MCMA 2E8ZA 1YEYA 4IPNB 1GTHA 4J9JA 4PUDA 5JIWA 1HKJA 4HN4A 1JEZA 3MUZ1 3S1VA 4FR1A 2ZRVA 4WDXA 3L66A 4YWIA 3CUFA 1JGIA 3VGDA 4HMCA 5T26A 2RDTA 4Q4KA 4N4QA 4TVDA 2JEQA 1E51A 3BW2A 1M53A 3H6OA 2HROA 1NWUA 4KGLA 4IMCA 2V6AA 3W4RA 1UH2A 1FOBA 3GLCA 4O1DA 1J6PA 1RA5A 4ZXOA 2GGEA 2J7DA 3CQ0A 3SAZA 5JBDA 1E0XA 1ZNNA 3B03A 4D8LA 3KL0A 2PUZA 3ITXA 1VD6A 3AYTA 4IMAA 1AA1B 3N11A 1J79A 1JQVA 1UZHA 3ZIZA 1UH3A 2XIOA 3KRSA 1C9DA 4DXKA 3ZOAA 1AJ2A 3ZSSA 1OBAA 8XIAA 1JPHA 3CB3A 1QBBA 3WL0A 4H9XA 2V5BA 1TCMA 4KFPA 1V02E 3VE9A 1QWGA 4EXBA 2J7FA 4HPGA 4A2RA 1TQJA 4IIFA 3B0UX 1P5BA 1TE6A 3WEOA 2VT0A 2QEZA 4ZO6A 1UR2A 3V5FA 4DBDA 1KFJA 3GDLA 3WH7A 2A7PA 1UR4A 2D2GA 5C9ZA 1IF2A 1SYTA 1XLAA 4H6EA 2O4MA 1XYLA 3VX1A 1TWZA 2BXZA 3WY1A 5A8GA 2WXDM 1VIZA 4Q7IA 3DDMA 3NQVA 3WUEA 3RJXA 1EJ7L 3F4WA 1EZWA 1F74A 1KFKA 1XWYA 2WC3A 3B4YA 4LNYA 3W38A 3EAUA 2X1SA 3WQWA 2XIIA 1R9YA 4JFSA 3T8LA 1JI2A 1VEOA 4MB3A 2YFOA 4Q3MA 2I5IA 4DUXA 4YCPA 1QHZA 4NJJA 1GQNA 3VIHA 1DQWA 5BCAA 3W9ZA 1JIBA 3ATYA 1XQKA 2R91A 2YDSA 3LM3A 4O54A 4IH3A 1CENA 3D0CA 3VTRA 2BV9A 3LK6A 2J8TA 1US3A 5LA2A 3AWNA 3FEMA 1XLIA 1K4GA 1FTXA 1GTEA 2Z26A 2DORA 2OSWA 3ZVHA 1I2PA 1Q6GA 3WDRA 2J24A 1CB7B 1PIIA 3IPWA 4C7FA 4EPEC 2I17A 2V5KA 4DJFD 1KFWA 2V81A 4KWVA 4Z2KA 4Z2JA 4LOCA 3RM9A 2BOFX 2XGIA 3U7BA 4MWAE 3I3BA 4A4AA 3DZ1A 2HXUA 2O0TA 4A8LA 3TYAA 4AD1A 1UD8A 1JXKA 2E0PA 3FA5A 3VOJA 3BSGA 4LUIA 1TPEA 1CWYA 1SFSA 4JPGA 4JFTA 1PTAA 4K6AA 1EJRC 3STPA 1L6FA 1XIBA 4QSHA 2ZVIA 5D33A 3PNUA 1E0VA 4C6CA 3LHUA 3WF0A 1F3EA 1TWWA 2X09A 3WJXA 2I9UA 4MOZA 3LX9A 4MZ8A 3UWUA 2SFPA 1ITUA 5H6HA 3VNMA 1S1PA 2RKXA 1QPQA 3VKBA 1PPIA 1EP3A 2QCLA 4W9TA 1I8JA 1MDLA 4QJ1A 4QFUA 3VNKA 3QOKA 1UR3M 4CQ8A 3SDOA 4E2OA 4MIMA 3RXZA 4BS0A 3SIMA 1V8EA 3QC3A 4AHQA 2WNZA 2FYMA 4H9TA 5CBBA 3PWAA 3WNLA 2AOSA 2QUTA 1MMFA 3EDEA 4JFWA 2J74A 3AQUA 4HZ7A 3WNNA 1KM1A 3BE7A 3W2JA 3TMQA 2GZXA 4AD0A 1VBRA 2MNRA 1PS9A 2BY0A 3SCPA 2J8FA 1OZMA 4QE5A 4O28A 2IMRA 5FAJA 1VGAA 4C7DA 1TB3A 4WGHA 1PKNA 3RUBL 2PWEA 3OP2A 3PBWA 1BYCA 5LXXA 3UZZA 3T55A 3AOFA 2VFGA 1UZDA 5K9DA 3MA8A 1EUNA 2O56A 1TQXA 2VZOA 5C71A 5D05A 1U83A 2GDQA 2AAAA 5LZLA 4GVHA 3QH2A 1F4HA 4WHBA 4KCUA 1LWJA 2P8CA 1O1ZA 4F79A 2GQ8A 1UPMB 1NU5A 2ZRWA 4XX6A 3OGRA 4CN1A 1Z48A 2FMOA 3MVTA 4ORMA 3I6EA 6XIMA 4NI8A 1OIFA 4AY1A 3NQMA 3LYEA 4W89A 4CD7A 3HA1A 4PEKA 4C5YA 3KLLA 4OIFA 4DO4A 3VCNA 1H49A 4HT3A 4JZ5A 3BV4A 4XVEA 1W37A 1KXHA 2E9LA 1CXLA 1KV8A 1T6MA 1FH8A 5IRPA 4AIUA 2QCCA 3G18A 2FPYA 4UFLA 4NI3A 1JFHA 3NEVA 5C2CA 3LHZA 4IIEA 2NVDA 3MV01 2AL2B 4YJ5A 5I5RA 2YA2A 1S46A 3WBAA 1K7FA 2QS8A 3OLIA 5BMWA 3GW0A 3KW3A 4OT7A 1EWDA 2XTKA 4JY8A 1LBMA 1V6UA 2PTXA 2R1KA 3U5YA 4WZHA 4GHRA 4PSPA 1H1NA 2WKGA 2O55A 3CZEA 1RQHA 3E2RA 2A3LA 4GE8A 2HK0A 2ZUVA 6PTDA 4TR9A 1OFBA 2RAGA 2VX7A 4UFMA 1CXIA 1QHPA 1OX4B 1IXNA 2CXEA 1F9CA 3MHUA 3L2IA 1KB3A 2XSXA 1TV8A 4PTNA 3TWAA 4XSMA 3BGAA 4MZYA 3UZYA 1WKYA 5BRPA 5K4XA 3MYPA 3IIZA 2NV2A 5U4NA 1ZBWA 1HJSA 1MNZA 4GBDA 4H7VA 5A8PA 4D1JA 1W2PA 5AECA 3GK0A 1BG9A 1MUCA 3RR4A 1JF5A 3TQ0A 3HJZA 2CLPA 4UQEA 2PP0A 1VEPA 3O06A 3KLKA 3IJ7A 1EEXA 2GUYA 4EF8A 5DXYA 3IVSA 2CBUA 4UTHA 3K4DA 2XVNA 3QQ0A 3GIQA 4LF2A 1GVEA 1S5TA 2DZUA 3AFBA 3AMLA 3G77A 1EX5A 3TYEA 3UXAA 3DHFA 4XUGA 2XHYA 1G7VA 4P7NA 3WFAA 1LTDA 4GKLA 3KBNA 3P84A 3H53A 2E25A 1F3WA 3H4WA 4UOZA 2E67A 1ZAJA 5A6BA 3CL7A 2HE8A 1G69A 1G6CA 1LQAA 4J3WA 4DF1A 4JAWA 1WYIA 2VI0A 2I5GA 3IIOA 3I3EA 3GFZA 2Z1XA 2B81A 2VTFA 3C86A 2B4GA 2W4XA 2DT0A 1PJ9A 4FLQA 2J7CA 2YGYA 2VJXA 3RMEA 1M9HA 2VELA 3SJ3A 3LBMA 4HMDA 4UTMA 4R9OA 3NQ2A 3B0PA 4NSBA 4TX6A 4NL1A 2UY5A 2KX9A 4RNFA 4XZIA 2YZRA 2MANA 3FCPA 3N34A 1GZJA 4IMGA 2OGJA 1ZBVA 4A6GA 4HNVA 3DUGA 3TJIA 3MS8A 5C9XA 1C8XA 3WEZA 3SADA 1M04A 5CLWA 3CAQA 3M6YA 3BO9A 5TAOA 3VD3A 4O1CA 2CESA 2W27A 3CUZA 1YXDA 2EG6A 4Z1AA 1G9HA 1OFPA 3IJIA 2V82A 1YNYA 3SY5A 1T40A 5FKYA 4J3ZA 3DC8A 2IPGA 1JZ4A 2X8RA 4QISA 3BG3A 5BOOA 3UESA 1KGXA 1KM5A 4EK7A 1EB3A 3KTSA 2DZVA 2PF8A 4XB3A 3QTPA 3USBA 4Q8TA 1VBJA 2QIIA 1NSJA 4TMBA 5CSRA 1FWAC 4AHPA 3O6YX 2E6YA 2GK1A 4YPJA 5ECVA 4IOTA 3HGOA 3S42A 1GOIA 2Y8UA 1DJZA 4ATLA 1KNWA 4V1YA 1R9ZA 3A24A 3EA2A 1CNVA 3T2OA 2PA6A 2DUXA 1M6JA 1VJSA 1RK6A 4O53A 1ECQA 3ITVA 3W72A 1ZSXA 2WMKA 1S39A 5DMMA 2PDPA 1Q6OA 2I14A 2PDQA 3LBCA 4F8XA 2D2JA 3L5MA 3SZ8A 7PTDA 1US0A 5AHIA 4WF7A 1JQXA 2A85A 4DY1A 1YW1A 2D2OA 2VWSA 3E6EA 5DT7A 2CZDA 3GNXA 4ZQRA 1EP2A 1XLKA 3C0LA 3PZMA 3O9NA 4MWAD 3U0HA 4TUFA 5E6ZA 1VP5A 1EBHA 3OPSA 3NL6A 2Y7EA 3C3NA 1HQTA 3A3WA 2GL5A 4TTUA 1UYQA 3F4VA 4LNCA 1IHIA 3SSJA 2FPVA 1WZLA 3WH8A 7CGTA 3B4UA 5D32A 4YN5A 1T0OA 2I7GA 3UT0A 4J2MA 2Q01A 4PTVA 3LXAA 1NDYA 3C2VA 4P8WA 4LS1A 1SZEA 5EBAA 1RVGA 4J35A 4W8LA 3W7CA 1JDCA 5DCBA 1Q6CA 1ZQ5A 2OLHA 5B7ZA 1BWVA 3ZS4A 4Q6XA 5E6YA 1QNVA 1TUFA 3WF3A 3OTRA 4AEEA 3MMUA 5F2MA 5PTDA 4OWGA 1ONWA 3ZMRA 1NFGA 3T09A 1DE6A 4GO8A 2XN1A 4RNHA 1K02A 4W5UA 3TE9A 2VVNA 4DEFA 5JBEA 2FIQA 3IUHA 4NJGA 1XYBA 4H8NA 4MB1A 5U7SA 2FDMA 2V67A 3TXZA 2PFHA 2R9RA 2CERA 2PGRA 5CSSA 2CLLA 4E8GA 2ZBTA 1BGGA 2WHKA 1WV2A 2GOKA 3A5VA 4E8CA 2A4AA 1UOZA 3NVDA 1ZAHA 3M0LA 3C0QA 4MAVA 2GUBA 3PJWA 1YBQB 1A0EA 4NAEB 4YTQA 3CH0A 1JDEA 3CTTA 3MP4A 2Y7DA 3F2CA 3GHTA 1IXQA 4GI6A 4K8GA 3L0NA 1UWUA 2IQTA 5BXSA 2EG7A 3C52A 5EMLA 3STFA 3BOFA 4JFVA 2VOMA 3SUUA 1GORA 3P61A 4L5ZA 1TE1A 2FFIA 2OJPA 2ATSA 4AZ7A 1H50A 1LROA 4M8UA 3MCOA 2WYSA 2VQTA 2PODA 4Z1YA 4DNHA 1Q65A 3AZTA 4LAKA 4E3VA 9XIMA 3PTDA 1U5VA 3KOWA 4DBSA 3R12A 2INZA 2V5DA 3FNDA 2CLIA 1TV2A 4W5ZA 1DIOA 1PTGA 1IR2A 3TQPA 3MZ2A 2BGQA 2CLFA 4A8IA 1H5VA 3MI2A 4D2JA 3TNOA 1GUVA 4WDUA 3L12A 1SJCA 1H2JA 1UR8A 4P7RA 1FWEC 3QYSA 2RHGA 2PC4A 1EYEA 1TTIA 3N3TA 1LT8A 3ZT7A 1RV8A 1LG1A 3MDWA 2BOEX 3OHMB 4NILA 6A3HA 3PAJA 1Z3NA 5A6SA 2E7FA 1I45A 3MT1A 4O50A 1LL7A 7XIMA 3SR7A 2XWEA 1EJSC 4EANA 3MP3A 2Y89A 1QR7A 3LSCA 3CTLA 3EMCA 2HWGA 2FZ9A 2IXUA 3DEQA 4ZR8A 1E6NA 3RLGA 1CDGA 1HIZA 4UR8A 1GPFA 4R7WA 3AXMA 4GI4A 4L9ZA 1B2YA 1VQTA 3ABRA 4CN4A 2VOTA 3WK0A 1Y7VA 4IHCA 3W7OA 1YTKA 2ONEA 4DJFC 1EGVA 2QJHA 4AD5A 4NQ1A 5C9RA 3S1GA 4IGMA 4IGNA 1YDYA 3TTOA 3R8GA 5HPCA 4L4PA 3TU9A 2OVLA 4HB7A 3RMJA 3WLTA 3TN6A 4DNMA 2GLKA 1ZLPA 3NZPA 4C6DA 3EX6A 3GVVA 1KQYA 3AXHA 4GZJA 2QCDB 3OVQA 2XWDA 3FFSA 1VKFA 1ZHAA 5ENLA 4QSFA 3R89A 4C65A 3H2EA 2Q8LA 3HV9A 4HOXA 3WUFA 1Q13A 1AH4A 4AD2A 2WM0A 3SIZA 3WQ6A 4H83A 2QW5A 4DJDA 3HF3A 2V9DA 1DHPA 1OF6A 1CYGA 3B8WA 2BBFA 4OHQA 4AZCB 2HBXA 2DQWA 3LENA 4O1EA 3O1NA 4GUHA 1B57A 1GT8A 4DJDC 1C7TA 3IVUA 4LTSA 3UG4A 4AWTA 3ZJ8A 3ZR5A 1RD6A 3LV5A 3T07A 1CGWA 1K7EA 5D9MA 1XR2A 3M46A 1IEWA 1YDVA 2XN0A 3AICA 4MJ2A 4ZO7A 2ZFAA 2ASHA 3LCGA 1FX6A 2A1YA 4DO6A 3GKAA 4NHVA 4YIWA 3MSRA 3S2LA 4XVDA 5IDZA 3TIMA 4FZIA 3FAXA 3PTMA 4OV4A 1V7YA 4PH6A 4GMEA 3VMNA 1KR1A 2FGBA 5D9NA 3IAPA 1GOMA 1BFNA 1KTNA 5KETA 3FXYA 1ECEA 2JIWA 4RW3A 4CNTA 2GDUA 4ZE4A 1EPVA 3KP1A 1I2QA 5HOSA 2W66A 2NQ9A 3L0KA 3ONCA 3Q58A 1XBYA 4DBEA 4F2BA 1KRAC 4JTTA 3AALA 2F7FA 5D2VA 3UZJA 1UMYA 3MSYA 3PFRA 3UEQA 4UTLA 3BCDA 4KPLA 1OYCA 1S38A 1E6XM 5L9FA 1PL9A 2BFGA 2ZE3A 2ALRA 2WJFA 2PCQA 5A6TC 4WCJA 3P60A 2OKTA 4QG6A 2G4FA 2YLAA 2YB4A 1OX4A 1FWIC 2I9EA 1UUOA 2OR2A 2PP3A 5HNRA 1UROA 3DGBA 1QK2A 4DUWA 1N8WA 1KCZA 3RILA 2NLIA 5AYZA 2W91A 3IJ6A 3NQEA 1R3WA 3EOOA 4FNPA 3BCFA 1ALDA 3IIXA 5AVNA 1BXNA 2D24A 2HPIA 1LRTA 4ZBCA 2NVCA 3WLPA 3UWQA 1KFLA 2G50A 2OG9A 3TC3A 1MYRA 2CZEA 5BOEA 3K46A 4Z1CA 4IFRA 5HDRA 3CWHA 2UBPC 3H55A 5I24A 1HZYA 1PAMA 1DV7A 3NWRA 1BYDA 3QEZA 3GXTA 3SCNA 3GAYA 1IGWA 1XLCA 2GDVA 5C8BB 3WNPA 3LMYA 2WMFA 2RGMA 2BVTA 3W07A 3YPIA 1PSCA 1ADSA 4WOZA 3K13A 1W1PA 3EOEA 3LXBA 2DUZA 1UP3A 3CQKA 3NIYA 1W1ZA 3DFSA 1ITQA 4AD4A 1Z42A 3HGJA 3J7HA 3BOLA 4AC7C 3WJWA 3U2EA 2OELA 1YE6A 3VMOA 1ICQA 3SGZA 4E2VA 4OBTA 3ABSA 3M0XA 5ABTA 2A0NA 2CHRA 3MJMA 3L4YA 4ZXLA 3S9ZA 2BOGX 1OEPA 2Z1BA 1SMAA 4U4MA 3AS3A 4ENLA 3LNPA 4CNNA 4WSJA 1QPOA 2J27A 5LYRA 3TQKA 3ICJA 2CKRA 3SI9A 2ZXAA 3DX5A 1CLXA 4BFAA 5FJJA 1J93A 1J10A 2FZNA 2QUUA 2WO5A 3UR2A 3PTQA 2NQZA 4R53A 4GXPA 4AZ6A 3IJ8A 3UNTA 1QAPA 1TPWA 1L6WA 1ZJAA 2RJHA 4DXXA 1WDQA 3UR5A 1V0NA 2FZDA 3W1LA 3U9IA 3BH4A 3EWZA 1FDYA 3PVFA 1NP2A 4GA8A 5C7HA 4OECA 4YXGA 4CD8A 4KFNA 5I23A 3GIPA 4QLKA 4XBJA 4TXEA 1DJXA 1E0WA 1W3TA 4IUGA 5HQMA 4KGJA 1FHUA 3M5XA 3VKAA 1F76A 3VKJA 3BVJA 3GVWA 3IJ9A 3IWPA 5I7GA 1S5MA 1SJBA 3K5XA 1WX0A 2ZVRA 3S6OA 3BMXA 4QE4A 1JCXA 1UPPA 2VFEA 1FWCC 2PWFA 3EXSA 1FHVA 2C1IA 1N8FA 3EWUA 3U2OA 1C91A 1P6WA 4HGXA 1K9FA 1UBSA 4WDWA 4KIRA 2VD9A 1VB9A 3ENLA 4BWLC 3GDBA 2XVPA 4I9AA 5DF0A 3PBVA 3BSHA 5FF3A 4FXJA 4LB4A 3BL3A 4DB7A 3TSMA 4MKNA 1EIBA 3FOKA 3KVJA 3MHGA 2IPFA 5CPOA 1Q8JA 1W9DM 5I78A 4U2YA 2WCGA 2Y24A 1QHOA 1G5AA 3EX2A 1UA3A 2MUCA 4EVZA 3NPXA 4J3UA 4OE7A 1PKMA 1PDZA 2V0TA 4US5D 4PR4A 3GG8A 4H6KA 3WNKA 4HPXA 4ZB2A 4AF0B 5E9XA 3S4TA 4PUUA 1VZWA 4O4WA 3LI0A 1HP4A 4JHOA 2XM1A 4MMWA 4R7JA 4GVIA 4LAUA 3UNDA 3W26A 4H2HA 1FWWA 4AEFA 3DKLA 4HA4A 4TV5A 3CEUA 3L4UA 4TTGA 4Q4MA 1C8YA 1TR1A 3GW3A 2D73A 5CPMA 2DZWA 3URAA 1ZP3A 3EWBX 2Y4SA 1HKIA 1PWLA 5BU6A 4YCOA 2PEVA 1EC7A 4AVNA 3FJLA 3G5EA 1DJWA 1NIUA 4CCCA 2BMBA 2XSBA 1XS2A 1IEVA 3WF1A 4Z2HA 1KCLA 3BQ5A 3LXCA 5DO8A 5F2GA 1ENUA 5K7JA 3O0KA 4R88A 3UU0A 1OK4A 4NP7A 1XCWA 2GVEA 2PBGA 3K8KA 4HTBA 1SZGA 3QR0A 4AZIA 1C8VA 3H21A 3N2MA 4JTSA 2VEMA 3BQ6A 1X1NA 5ECUA 5JMUA 3WBXA 4D72A 5FSDC 1L0PA 2PTDA 1B3VA 4P8XA 2ZICA 1U33A 4HA3A 1AQ0A 3ABQA 3GNNA 3AYRA 4RDWA 4DM2A 3GTIA 2VKZG 3UJEA 1JRCA 2QGHA 1YNPA 2YCJA 4QS5A 1C3FA 5DQPA 4B9YA 3KDOA 4EOUA 2YX0A 4Z2GA 3OGSA 4NAEA 4UFHA 1JNEA 4UTIA 4G7EB 5GPRA 4H8UA 1D9EA 3GXMA 1R2SA 4LX4A 4LVAA 2GSEA 2WM1A 5FCZA 1EO5A 3VC5A 4ZOCA 4RE4A 4H7ZA 4NZCA 3NZRA 3UA4A 2PWUA 3LV6A 2OLSA 1VR6A 3CXOA 2WVSA 3BGGA 3NURA 2YXGA 3T42A 3TWBA 2ZDRA 3WLHA 4PUWA 4IJCA 3LOTA 3WDQA 3NQBA 3I4EA 2WHMA 4U31A 3FK4A 1SUXA 4H41A 3TOYA 4ZA0A 4ZOAA 3N12A 3RLUA 1VFTA 4HPNA 2PURA 2J7EA 4HPJA 2Y70A 1OABA 3PBGA 4AYSA 4HVXA 1W1VA 1PYMA 3LRMA 3C3UA 1NF0A 5DFAA 4B4FA 1ZCOA 3PC0A 4GQ0A 4GJJA 2HS8A 3MC5A 3WIJA 1V6XA 1SVDA 4BI5A 3B8TA 2VHLA 3R11A 5A94A 1A4LA 2X7VA 1XIEA 3CZLA 3DIPA 3W24A 3G1RA 3UCDA 4XV0A 4DZ5A 4PB3A 1ZENA 2ZRZA 1J96A 1A49A 2ZCGA 4CD5A 3PZOA 2L5HA 3NPUA 1W2VA 4GINA 4I9MA 4O14A 4F48A 3SFKA 1J5SA 4I7UA 3BWWA 4DVOA 4YVVA 2BY3A 3VKCA 1ADOA 3NA8A 3N9KA 1GJUA 1XDLA 6ENLA 3GHRA 1BG4A 4PMDA 2X0HA 4K8HA 4WJ8A 1B3WA 4H2CA 3NL5A 1MEIA 1NTHA 2ZZ1A 4DWDA 4Q8QA 1XLLA 2QUNA 1JCTA 2ZZ6A 3FIGA 3R2GA 1YTEA 3UF9A 1T41A 1YKWA 1BEUA 4GX8A 2Z0IA 3EDFA 2G3IA 2R6OA 3COTA 1Q85A 1CBGA 4JY9A 4J4KA 4C1KA 4J2PA 2VYOA 1KGWA 1DEDA 4OQVA 3UXKA 3PZGA 1UKPA 4DM1A 1VCVA 1XPYA 4Z2LA 4PMXA 1L6SA 3CV1A 1N55A 3W86A 2QCDA 3H7UA 1PCKA 1S2VA 3WQPA 3P14A 4MDPA 4DWSB 4WSHA 5F4SA 2R1MA 2HNHA 3OIXA 4C6JA 2OSXA 3TLQA 3SGUA 3VINA 4W4QA 3ZT5A 1K6WA 3QVQA 3ARPA 5KZEA 4V33A 3PZ9A 5DLCA 4FIRA 5AC5A 1IT0A 2Y7GA 1I0BA 5C0QA 4JTGA 1A5CA 1Z44A 1PVNA 1SFJA 1XHGA 3M0ZA 1UJPA 2DSUA 1CGXA 1JYNA 4AZCA 3GH4A 4JTQA 3SY1A 3GC5A 4QX4A 4QAWA 3OIHA 1VRXA 3DFPA 4K2SA 4JOMA 4U3AA 1LF1A 3LA4A 1HJUA 4RZ6A 1HJXA 3RU8X 2A3BA 1F6PA 3M0MA 3WMCA 1UKQA 2EAWA 3E2QA 3NGFA 4GUJA 4G56A 1FWDC 1L6YA 2C8NA 2QJJA 2ZKMX 4D71A 1KM0A 1IWBA 4LT9A 3ARXA 5JU6A 3LI1A 4PE8A 3CEPA 3ANVA 5CPNA 1W5QA 1UR9A 3B9AA 5LSMA 5LXEA 3MKVA 1HW6A 3EKGA 1TJPA 4XO6A 1JF6A 2HVNA 2ZUTA 2WBGA 2XH4A 1WCGA 3G1AA 1XIIA 1OG6A 3P82A 2WZTA 3HGSA 3NEHA 3IRDA 3W7JA 1E0UA 4GWEA 2C7FA 3OLDA 4ZOEA 4BHYA 4HKPA 4AIOA 3VGEA 2OZTA 3UVAA 4K7YA 4HYVA 1XRTA 3W85A 2P0OA 5DX7A 3ZR4A 1JUEA 1RXOB 2C1GA 5EMYA 4HSNA 4V27A 1QNOA 5H8PA 5G1MA 2J9YA 5FF4A 5XINA 1OYAA 4GUGA 1GKRA 4PSRA 4MB4A 3DERA 1TYGA 3WLQA 1EJUC 5FJTA 1OT2A 5DMNA 3W29A 4BJHA 4MF4A 1XLBA 2DZXA 4PMOA 4YVPA 1SSDA 1BTCA 1OK6A 3GXFA 3EKZA 1HL2A 2PLKA 5SWUA 1AW5A 7REQB 5EMMA 3AMGA 2ISSA 1CT5A 1PWMA 1RR2A 3U3HA 1A5KC 1X97A 1HXJA 1Q7ZA 4OUIA 1VLWA 3VOCA 3GR4A 5HNUA 2QLYA 1FFRA 2BHYA 4WR3A 2V69A 4QLLA 1Q6DA 2V3EA 3G1HA 1KBIA 1ZAIA 2DVTA 2HV5A 2WHJA 3N4FA 3TYUA 3KOZA 3VYLA 3PBYA 3W88A 4ZO8A 4LUSB 3KM8A 3FY1A 1PX3A 4PBGA 4MJMA 3KOXA 2CU0A 2XIJA 1HVQA 1LT7A 4N02A 4EIVA 1W9BM 1O5QA 2AKMA 5BMXA 1NVMA 5E93A 3AZSA 1QDSA 4ROPA 3NQDA 3D47A 3I4KA 1J12A 2P1FA 1H0GA 4MWAB 1W1A1 2CBIA 5HJLA 3STGA 3LPGA 2Z4GA 3UJ2A 4C6OA 4ZQOA 5EKYA 1UOKA 4LEQA 2G41A 1EF2A 4UZSA 3V35A 1J8VA 4HU8A 9CGTA 1GYNA 3A4JA 3WFLA 1R9XA 3ARYA 1JG9A 2XFWA 1EPXA 4TV6A 5DRCA 2DJLA 5KMYA 3QKEA 3CMGA 3REQB 2WZIA 4DAFA 2V3FA 3S8HA 4LEFA 3URNA 3O07A 4QE1A 4IQLA 2VC6A 1XISA 2I1OA 1OSEA 1FBAA 4XZLX 1IV8A 1P0KA 1QTWA 3IARA 1VYRA 4B2DD 2P88A 3QN3A 4C6FA 4WK9A 1UUQA 1AW1A 1N82A 2VDIA 1AMYA 1R30A 3CQIA 1S3TC 3L4ZA 3VIKA 3VXGA 2CPUA 3WQDA 1U5JA 3CL6A 4NRSA 5LGZA 3W0KA 5A1AA 2PRMA 5G2HA 4YYCA 1WDPA 2O9RA 3N73A 2EGZA 2CEQA 1W31A 4JQ4A 1Q6RA 3EWDA 3UP8A 1VFUA 1DL3A 2H90A 5JH2A 3KTXA 1VHCA 4E3TA 3KWXA 3QJAA 2FTYA 1MZHA 5I0DA 1Q4NX 3LHVA 1PV8A 4CQCA 4D6JA 3W7DA 1GK8A 1H5YA 3LPFA 1RY0A 2G37A 3GSMA 3BW3A 2QAPA 4A3YA 4MFEA 2VX6A 2NQ5A 7A3HA 2Z29A 3LTPA 2FZ8A 1XM3A 3FKRA 1SZNA 2DZTA 4UBPC 4RE2A 3SQMA 3EEZA 2C14A 4R5EA 3QFWA 3U2ZA 3D3AA 2O7SA 2GOUA 4K8EA 4GUIA 3BK0A 4QXIA 1GHSA 4X0NA 3UWWA 2JGQA 1MEWA 3UZWA 4WKAA 1GW9A 4JTUA 1M01A 3L4WA 3T05A 1LQ2A 4GISA 1ODUA 3TYBA 1PIGA 1RK5A 3SCRA 4G5DA 1JPMA 2DZAA 3L5AA 1UP0A 1QK0A 3OOQA 3P8JA 2Y85A 1DORA 1H41A 2HVOA 1OZQA 1KBBA 5CC5A 4PFMA 1RSCA 1BSLA 8XIMA 4IQDA 4QG9A 4ZQNA 3IGXA 3GG7A 3TAOA 3PPGA 2PRHA 1QO2A 4JXCA 3MKKA 3LSBA 3HJEA 3LQLA 3B9NA 1X6UA 4HJFA 1OB0A 1BSIA 3P80A 2DGAA 2GFTA 3UJRA 3PR2A 3QV6A 4M3PA 2JBMA 3MU7A 4YS1A 4AF0A 3SRHA 1K8ZA 4S3GA 3UWEA 3KVLA 4MKVA 4M0XA 4Q6JA 1E43A 2G8ZA 1VH7A 3TH6A 2YW4A 2QCGA 4Z1DA 4NF7A 3HZ3A 1GVQA 1UWSA 4PBEA 5M1TA 4HNLA 3OQEA 1QRQA 4CD4A 3NQAA 3TKFA 4CD6A 4QDMA 1H11A 2Y7FA 5AC6A 2PDLA 4LH8A 2DV0A 1IXOA 1XP3A 3W53A 2C13A 3ARSA 3PG9A 1N8IA 4AWEA 5JQ9A 3EA1A 3O05A 3EZ4A 4WQ6A 3GFYA 1FY6A 1TPH1 1I6NA 4IMFA 3R1ZA 2DT3A 4KEZA 3WMLA 4L4LA 3WJSA 3WN6A 3E5PA 3D46A 2PDFA 3GXDA 4GFIA 4PMVA 2YL8A 4FR6A 1TUXA 4NNCA 4P5UA 4UTJA 4KEVA 4ICMA 3NSNA 1W9VA 1TPDA 3C6CA 4E2DA 4M6UA 2OO0A 3LN3A 3USZA 2VZTA 1MFUA 4A21A 2FZMA 3BAKA 4D6FA 4LCRA 2B7QA 3II1A 2X0SA 4NZ4A 1W1YA 4DUVA 1GOKA 3GG1A 1NF7A 1JGMA 5K3VA 4OU1A 3CUXA 1XV8A 1H7XA 3WD2A 4OVXA 1GQJA 4AMCA 3TV8A 3L23A 2E5BA 3TNBA 2V5JA 5HWMA 3TP4A 2QMKA 2W0UA 3T0DA 1JFXA 3C2OA 4G7EA 2BXYA 1EX1A 1WDDA 4GPNA 4IP5A 3W1AA 1P0EA 4L1XA 3O15A 1VFOA 3PZIA 4C6EA 3KBVA 3AMKA 1DWIM 1TPUA 4QROA 4U2ZA 4FXRA 5G1TA 1ZALA 5BROA 5BRQA 4F3HA 4PRTA 4O52A 4B3KA 1EJVC 3MVIA 2CXGA 2QVHA 4GQBA 4Q7BA 3WMBA 2C79A 4HCHA 4HQVA 3VZYA 2V8ZA 1TWIA 4C6IA 2F61A 2DT2A 3NVTA 1KXTA 3R4IA 4E4UA 3OU8A 3R7MA 2WOQA 3AS2A 1VPQA 4Y2WA 3CO4A 3KS6A 5T91A 3UR7A 3MSGA 3TOPA 1ITXA 1S5NA 1CXEA 4GUFA 1XLGA 5DXXA 3LHTA 3P0WA 3I10A 5AKQA 5FESA 4MNMA 2ESCA 4IFKB 3RPTA 2CZ5A 4JEJA 3LCHA 3RYSA 2X16A 2OZ8A 3W25A 2OYLA 5H2ZA 2PLCA 1XC6A 4KS0A 1HUVA 1DTUA 2FGZA 1GHRA 3HMJG 1J01A 2NUXA 3E96A 3GG0A 2OEMA 4XAGA 1VBGA 3QQWA 1TZ7A 3LLFA 4IM4A 3L4XA 2BP1A 1JXJA 1J0HA 4OOZA 3VMPA 1G01A 4GY0A 4G6CA 1IGSA 1EOMA 4O17A 3PZVA 2J75A 1BAGA 3QZAA 5C2XA 1KM4A 3VI2A 2VRQA 4X22A 4AH7A 5CZSA 1BKSA 3PB2A 3POCA 2WJZA 1KBJA 2CLOA 4FX6M 4JQ3A 2V30A 5CJNA 2TRSA 1W8SA 3NR0A 1KFEA 3NNTA 3GBDA 3RFAA 5BU9A 1H3GA 1FKWA 3SRKA 4JIEA 4WY0B 1SW0A 5GNZA 4XZBA 1J5TA 3BTNA 1XSJA 3R13A 4DWSA 2YW3A 4ADUA 2YBTA 4JIRA 3EXTA 3PSVA 4QDWA 3AROA 4LY4A 2YBVA 1CGYA 5I3IA 2G3JA 3VOHA 1AH0A 4DWSC 4YTUA 2Z25A 3CAVA 1OWQA 3DC0A 3QBUA 2YCIX 4CEXC 4JNYA 7ENLA 3EPOA 6XIAA 1ADDA 3AHZA 3W7HA 1K4HA 1C29A 1WZAA 4GNVA 3FHAA 4ZQCA 4N7QA 1MZRA 1VYPX 2QT3A 3W1TA 2GWGA 2CNCA 5BNKA 5HUOA 1ESWA 3GR7A 4L1WA 3KBSA 3G1SA 4P2VA 4F0LA 4LC8A 3CYVA 1VBUA 3BANA 2ZADA 1V6TA 3NGJA 3WENA 4LYKA 3F7JA 1M7OA 3N2XA 1JI1A 3WBWA 3EB2A 2PTYA 1RLDA 3VIPA 5TF0A 4TIMA 3ITTA 4OJYA 1TV5A 3MUAA 3URQA 2VC9A 1MW1A 3VGFA 4CUCA 4FK9A 1JDFA 3VFCA 4CN6A 2BNJA 2F2HA 3OA5A 2R94A 1O4UA 5FEWA 1OHLA 4JN6A 1HGYA 3ATZA 2OEKA 2OQHA 5C9WA 3T6CA 3BLKA 4IIHA 1QPRA 3IIPA 3TCSA 3SCQA 3AXIA 3R94A 3UY7A 2EO7A 3AHVA 4IMEA 1J18A 4MPKA 4DN1A 4DJEA 3A3XA 5EFFA 1GJPA 4ML4A 4R3UA 4JNZA 3TONA 4QEHA 1ZRQA 1ISZA 2IPJA 3F5LA 3LD5A 3M16A 3CWNA 3FVMA 1JZ3A 4W88A 4DJEC 2WVTA 4EE9A 7REQA 4L64A 1W1B1 2POZA 1WOBA 1LLWA 4DPPA 2AQOA 1TZZA 2YYTA 3APTA 3SN0A 3UCCA 1TV3A 4MJZA 3ZJ7A 3SW6A 3LCFA 1M5WA 4FMVA 4EAYA 5IDIA 2J9ZA 4N4PA 5GQBA 2Z24A 1J0ZA 1XXXA 3NOYA 4IJRA 5DN1A 3UPBA 2PDYA 3N9RA 2XYLA 3NPWA 1LL6A 3DU0A 2V5LA 4ICNA 1GVOA 5D8WA 4LUSA 4W85A 5FL1A 3LMZA 2WWCA 1WZMA 3T08A 1FWJC 4FNSA 4UNLA 2YB1A 1TREA 4W7WA 1XFCA 5AC7A 4H9YA 3UERA 2EPHA 3DXIA 1A3WA 5ABHA 1DJYA 1GOQA 2NX3A 1FP8A 3CC1A 4ZVJA 2GGJA 4AEOA 1VFLA 3C2FA 3B8IA 3QY8A 4MWAA 3N17A 3QHMA 4NU7A 1MQRA 2V2DA 3S2CA 2XISA 1NDZA 5A6BD 1QNRA 3EDDA 5F7UA 1W3KA 4H9ZA 1BD0A 5FJIA 1G67A 2REQB 4K7VA 1E6SM 1M41A 1XIJA 1UR1A 2FVMA 3REQA 5KINA 3TA9A 3GNOA 3L67A 3T2QA 1TWDA 5I3FA 4LYQA 4AZ5A 3QFEA 2YKKA 4DXVA 3H7VA 3W2LA 1Q2SA 3R25A 4H01A 5D2YA 1GJWA 1XYZA 1UD4A 4Y8FA 1WXJA 4DAIA 3SB0A 4CKQA 3GDTA 2WQPA 1PHWA 4CQ9A 2F9RA 5G4WA 2DY3A 1JJKA 1DJGA 1V3JA 4Q4PA 4N6EA 4X9SA 4JKMA 1D2KA 1DXEA 3RAOA 5EA9A 4CU6A 3B40A 3TW6A 5I09A 2AMGA 1Q4WA 4HOZA 2Z1KA 2VMFA 2PDCA 3I7SA 3SCSA 4JIHA 2F6KA 5FOOA 1S2WA 3GVGA 3D3FA 1Z7AA 4H7CA 3OODA 2OX4A 3OBKA 1ZU8A 3KOFA 3ZQ9A 1H7NA 3OZOA 3WDIA 4M51A 3JZUA 1E3ZA 3DHDA 1GEHA 1L2UA 1LCOA 4LUTA 3U5UA 1JYVA 1PB0A 2C0HA 4HOWA 3F5KA 3QGKC 1BQGA 2J9XA 3EX4A 2PAJA 4R27A 4EXQA 3AJ7A 3ELFA 5J5DA 1UD6A 1V6YA 3R0DA 1RQEA 3IJLA 2VWTA 3UXIA 4KWWA 1EA0A 5FA5A 5M5DA 4ZZ9A 4FALA 2J13A 4FI4A 1W8GA 5G2WA 3M0YA 1OX5A 3UR8A 4U5IA 1TIWA 3VGBA 1D7FA 3LB0A 2EF9A 1FWBC 3WDHA 4GNJA 1B54A 4M1BA 2ZIDA 3MANA 5HR6A 1T99A 1RD5A 3A22A 1OCJA 1S2CA 4GZ7A 4YTSA 3GO2A 4A3HA 1DJIA 3O6DA 1EL3A 2E40A 4HHMA 3QTGA 4RZBA 3R43A 3IJQA 3WL1A 4HP5A 1FDJA 3NM3A 5BWFA 1DOSA 3W75A 2ZUWA 3SRDA 1TJ0A 1K7XA 3A5FA 1QUMA 1G4SA 1AK5A 3ZVIA 4ZENA 3N25A 1QW8A 1CGUA 3QPYA 4EPBC 2PDXA 1UUMA 3N9SA 2I5QA 2ABBA 4UUIA 5CPLA 5IBXA 1XG3A 4GQQA 2J7BA 2VR4A 4GYPA 4KWOA 4XKMA 5FI8A 3PB0A 4MLRA 3N19B 4D6DA 1R38A 4D1IA 5BXRA 1CXHA 3V1HA 4LF1A 2WMIB 1QI5A 4XBKA 2Z7KA 4GYPC 3JRKA 5TNVA 1OFRA 5AFDA 5K4ZA 3CB8A 3CPGA 2QCFA 3VOIA 1TO3A 4IGHA 4LV9A 4ZEPA 4QIUA 3MYOA 3S3GA 4V1XA 2JALA 1WNOA 4P61A 5HXMA 4PMYA 3BW4A 5K9CA 1LOSA 1R3QA 4GYKA 4Y9NA 1EO7A 4DO7A 4TVUA 1XKJA 3HN3A 2E3ZA 3QV9A 2HJPA 4PODA 3QF0A 3QQ1A 2FVKA 3FLUA 1X1OA 2AMXA 2PD9A 3CUJA 2EQDA 1JZ8A 3A3HA 4FF5A 2PDMA 5CJMA 5A8MA 3ES7A 3NL3A 4ZFMA 4FSAA 3FX4A 1R46A 2R14A 5C2GA 4NZ1A 5I79A 1OY0A 3LQGA 2VDGA 3O8AA 3OZMA 3AU2A 2UY3A 4FA3A 1LOQA 4J27A 3KE0A 1XBVA 4LC6A 1BVNP 4EXAA 1KCKA 4B91A 5AB3A 3O6AA 4PMJA 2Y6ZA 3UG3A 1VCFA 4F0HA 2Z7GA 4I6VA 1M7PA 3L2MA 2ACUA 3K1GA 1HKVA 1E4NA 4ERIA 4GOAA 1WBHA 3TSBA 3WLOA 4S3KA 2WSRA 2WB5A 5GNXA 3VDGA 2ISWA 4MGGA 4Y6GA 1EJWC 1TZ9A 3W1PA 4RZ4A 4WOQA 4NG3A 2VZSA 1FFQA 4UWMA 3V5CA 5H8MA 3HFTA 4HZ8A 3AUOA 5DANA 1V6VA 2YL9A 5E0KA 2GGGA 1B30A 2QR6A 2A3HA 1R7AA 4PTMA 1XYAA 4AISA 4E2BA 3E1F1 1E9IA 4RR4A 4JIQA 4MTVA 2EPMX 3IANA 5DRIA