4O50A

Crystal structure of trichomonas vaginalis triosephosphate isomerase ile45-ala mutant (tvag_497370)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
252
structure length
252
Chain Sequence
b'MRTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFAFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Engineering mutants with altered dimer-monomer equilibrium reveal the existence of stable monomeric Triosephosphate isomerases
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
total genus 85
structure length 252
sequence length 252
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o50A00
3L0NA 4FIRA 3VE7A 1VS1A 3G18A 2WNZA 2CLOA 4EF8A 3P61A 3NZ1A 2G96A 5D03A 1VJIA 3DXIA 2NX3A 1LOQA 1EP3A 1HFBA 1AL8A 4FIQA 4LY8A 3ZWTA 3KRUA 5CZTA 3W72A 1O4UA 4XQ6A 2GQ8A 2V2HA 5AHLA 1S3HA 1LLWA 3DZ1A 3W2MA 4ADTA 2FPVA 1LBFA 1QOPA 3P7YA 5L9FA 3C2OA 3UZ5A 4XWUA 4LT9A 2P0OA 6ALDA 4K6AA 3W7MA 4C1LA 4O11A 1EUNA 3UYCA 1OFPA 2QF7A 5D05A 1JCXA 4POCA 4RCXA 1Q6OA 3OVQA 3FOKA 4U28A 2V81A 5F4SA 4FHAA 4ZL1A 5D09A 4I9AA 1EEPA 5CZSA 4I7VA 1HTIA 3IGUA 4ZQRA 1YADA 4DPPA 1TPEA 3LCFA 4FO4A 3GYEA 1H51A 2CLLA 5CPNA 3DGRA 1ZALA 1H62A 1LTDA 2EF9A 2A5HA 4LRSA 5HNRA 5D33A 5DBUA 1OX4A 5HULA 4MVAA 3C61A 3QPYA 2OT1A 1SU5A 1ZJIA 1K7FA 4GC4A 3GNNA 1H7RA 2X16A 3AJXA 4MY1A 1G6CA 3E49A 3KVMA 1XUZA 2NV2A 3NQ2A 2JGQA 1K8ZA 5AHIA 4FNTA 1YTKA 1H7XA 4FNUA 4AXKA 3AO0A 4UMAA 1N8FA 2ZRWA 3BG3A 4PH6A 2H3DA 3RLVA 2FB2A 3PULA 4WXYA 3C2VA 3DENA 5EYWA 1DJNA 2JKPA 1ICQA 3L66A 2QJGA 3Q58A 2F7FA 3CTLA 2GUUA 2R94A 3L21A 4UFKA 4FXSA 1OVDA 2OX1A 3W22A 4FF7A 3G1XA 1ZNNA 2C15A 3PBVA 4JTSA 2VFEA 1G69A 5HUPA 2DZXA 3FYOA 3I6RA 1EUAA 5AC7A 5G4EA 3DBPA 3SJ3A 3NL5A 4DPQA 4YCPA 3SGUA 3GXPA 3HG2A 4JN6A 3IVTA 1SW3A 4ORMA 3C52A 1PIIA 3OHIA 1QPRA 3WJXA 5KINA 4N2YA 1JRBA 2ZYFA 1VGAA 2FPTA 2QCFA 1GG1A 2XN0A 5DCBA 4EWND 3LTPA 4NU7A 1P1XA 3W7PA 4E38A 4PA8A 5K3VA 2QDGA 2V82A 2VXNA 1B9BA 3PAJA 4O14A 1P5BA 3W07A 1R2SA 2B7NA 4E0CA 4Q4KA 3B0PA 3EB2A 4HIBA 2Q8LA 8TIMA 4TMBA 1TV8A 1KFKA 5LNWA 3MI3A 3NQDA 2A85A 3QPZA 1EWEA 4BWLC 2R8WA 1GVSA 1Z41A 4KWWA 3NQCA 3QQ1A 1IXPA 4BI5A 1OFEA 4IQLA 1VLIA 1DQXA 3LOTA 4CNOA 3HF3A 5K7JA 1DHPA 4M6QA 4ONVA 3SI9A 4OT7A 1LROA 3HO8A 3ZFHA 4XBSA 3K30A 1XCFA 3LHVA 1VYPX 4S2BA 5KZDA 4RJEA 1MXSA 5EL1A 5G1TA 4TIMA 4LV4A 1JCMP 3IIPA 5FF2A 3GR8A 1H61A 4LVDA 4YWIA 3P8IA 2QUTA 4X3ZA 3S1UA 4JDBA 5D32A 4UTJA 4UMCA 3TX9A 4CQAA 4Y90A 1H60A 3QEZA 2V2DA 1QPQA 1SW7A 3STFA 3Q94A 3HGSA 3GZ3A 5DELA 4FEZA 4NX0A 3OA3A 1SSDA 4IWWA 3NM1A 1FWRA 3F03K 2WSQA 3LHZA 2ZA3A 1X1ZA 3TQKA 2A0NA 3DFNA 4ZQOA 1A50A 2BWGA 3G3DA 1IF2A 3FFSA 5I3HA 2DZUA 5D2WA 4UFLA 4EF9A 5TBOA 2V5LA 4DO5A 3FYPA 2J24A 5CPLA 2FQIA 5E93A 4N6FA 2WPBA 3DKLA 4BWLA 3W7EA 4BF9A 3NEVA 4NJHA 1GG0A 1RV8A 2C14A 3THQA 2QCDA 4IMGA 2YW3A 1TRDA 5ABTA 1I8JA 2WQPA 3TMQA 1NSJA 1GQNA 3L5AA 1EB3A 3B0VC 1TPDA 1NF0A 3TDFA 4UNKA 4UCGA 2W0UA 3ABSA 3C2RA 2OCZA 3S1VA 3GK0A 2IQTA 2CWNA 3S5OA 1N7KA 5D02A 3GDLA 2DZVA 4ZQCA 2ALDA 3UWYA 1WAUA 4QNWA 3R8RA 1OX6A 2RHGA 3M6YA 3P80A 4RZ4A 1F74A 4Z1DA 2DZTA 1Q3NA 3G3MA 4OE7A 3W76A 1AW2A 1NFBA 3TMLA 4AB4A 1JULA 1YDOA 3CIXA 1AW5A 4HSNA 2ABAA 2WV8A 3GAYA 5DCDA 4IMDA 2A7NA 1PCKA 2VKZG 4GUIA 3LHUA 1FDYA 3G8EA 2R14A 3QH2A 2YYTA 4RR4A 4X9SA 4IMCA 3ATYA 1FXPA 3R5EA 4MZ8A 5I3FA 3PUDA 3VFLA 3W84A 1BWKA 2HS8A 5K2ZA 4LNYA 4IPJA 3NQ6A 3MUXA 2VFHA 5EBUA 1TRIA 1B4EA 4QITA 4RXFA 1U83A 3OBKA 4NVTA 4NNAA 5G2HA 1EX5A 1G4EA 3BLEA 5U7SA 2VEMA 2QCGA 1KTNA 1QR7A 4L4MA 4LS2A 4ORIA 4TO8A 4AHPA 3TAOA 4MUZA 4QSHA 2V9DA 2QCEA 1WA3A 4K36A 2I1OA 3TAKA 2C18A 1XL9A 1GYLA 2J9YA 4JX4A 4TX9A 4HPJA 1S5TA 4ZQPA 5BNKA 4OQVA 3PS7A 3UWUA 5G1YA 2TRSA 2C6QA 1KM1A 3GDMA 3W7QA 4OV4A 5LSMA 5FEPA 4LW7A 2E6YA 4ML9A 4O57A 3W1MA 1SO3A 3NQ8A 3LCIA 1H5YA 5DXXA 1VR6A 4YMZA 5F2MA 3UQNA 1LCOA 2Z1BA 1QDSA 2DZWA 5EKYA 2JBMA 1ZY9A 5AYYA 5G5IA 3KXQA 4E2DA 4DF0A 4IGHA 4UR7A 2PE4A 4NT0A 2ZA1A 1NAL1 2Y89A 1TTPA 1L9WA 3MBDA 4IMEA 2KZHA 1TPH1 4H3DA 1HL2A 4GXMA 4QISA 3FS2A 4K39A 1OJXA 4PL1A 1TSIA 2CLIA 5AC6A 3GR7A 2NX1A 3MJYA 3GXTA 3TQVA 3UXDA 3WJZA 3LBCA 1M7PA 4GUHA 2VOMA 3W2KA 2A2IA 3NR0A 2Y61A 2QUUA 2QAPA 3B0UX 4KFNA 1T99A 2CZFA 5LNSA 1VCGA 3BLIA 2NV1A 5AHNA 4BR1A 1FCUA 1SSGA 4FNQA 3N9SA 4R7JA 1N55A 4O1CA 1V5XA 3W85A 1WOAA 1W3IA 3PUEA 5F4XA 1PHQA 3BGGA 3P67A 3S0CA 2Q8ZA 4XTIA 5AC8A 4KFPA 4QM1A 1LOSA 3EEGA 1RVGA 2B7OA 2GJNA 1FCBA 1KFJA 3NNTA 1OK4A 1HUVA 4NJIA 2B7PA 3UXAA 1VPXA 3UWZA 3NO5A 1WQ5A 4DF1A 5LHFA 2ZRVA 1THFD 3LTSA 4RZ6A 3V1PA 2TMDA 2GVJA 1F6KA 2NWSA 4GJ1A 3USBA 3NQEA 4AF0B 1GTHA 4AHQA 3C8FA 3C2FA 4M6PA 3IGXA 1OX4B 1GJPA 1W8SA 4OHQA 3LHTA 1OX5A 1P0NA 4GE8A 3LX9A 3F4WA 3LV6A 2ZTJA 4JTLA 1ME7A 1SO4A 1PCWA 4O0ZA 4AWUA 1B3OA 3TFCA 2ZRXA 1OFOA 2NZLA 2W79A 3V75A 2C13A 4JR5A 1QFEA 3HOJA 2RDUA 4JIQA 1TPUA 5G4WA 3M5YA 4NNCA 4UTIA 4UUIA 5CGQA 3W1LA 3LRKA 4MJMA 2FPYA 1F73A 2ZZ2A 4XTDA 5F1VA 5HINA 2W6RA 3M44A 3TW6A 3CPRA 3GKFA 3B03A 1T8XA 3LHYA 3ZWSA 1FQ0A 3T4CA 5BMWA 5G2IA 5F2LA 5LHEA 4YL2A 1S5WA 2LLEA 3KOFA 4KFOA 4PCFA 2E5BA 1F6PA 1VHCA 2BXVA 2OJPA 1ML1A 1OF6A 4XUGA 3S42A 3M0ZA 2E5CA 3NGJA 4RKAA 3MP3A 3WK3A 5DY2A 2ZZ7A 3P5YA 2NWRA 2YCEA 1KLYA 2ZTKA 3TK7A 2P1FA 2GVGA 2ZBTA 4QIUA 1DJQA 5LZLA 2PRMA 1LDCA 2YX0A 3O1NA 1RR2A 3T55A 1R2TA 1D3HA 2JKAA 2XFWA 1VCFA 3B06A 3UZJA 3N14A 4A29A 2EKCA 3IIVA 4H6KA 4WY0B 3W7DA 1H50A 4S2CA 1PL9A 4Q32A 1QNVA 4JEQA 1TV5A 3G1FA 4HNNA 3P5ZA 2VFDA 4BI6A 2JKEA 1PS9A 3JR2A 1X6UA 1UUOA 3L68A 2ZFAA 4N9BA 5K4XA 2Z0IA 2A7RA 5J5DA 3IIOA 4CNNA 3DI0A 1KM6A 4DQWA 3W7GA 5H2ZA 3LGEA 4KWVA 4JY8A 3E9AA 2QCCA 3PSWA 1XUUA 1LYXA 3S5ZA 1O95A 4CCEA 3R89A 2A7PA 3HG5A 5TIMA 1EA0A 4QAIA 3EX4A 4JGDA 1WOBA 4MY8A 3MP4A 3SZ8A 4QNEA 3KAOA 3ABOA 3CM4A 2PC4A 4HNVA 1OF8A 4FX8A 1IXOA 4I7UA 1KV5A 2WNQA 3SSJA 3BW2A 4UXDA 2A6NA 1F7BA 5K9CA 2FFCA 3UY8A 5HQEA 1SFLA 4NZFA 3RK8A 3HBLA 3P60A 3N9RA 5FEXA 1FXQA 3EX2A 2QR6A 3PB2A 3W1XA 3W74A 2H8ZA 4R34A 4MFEA 4DO6A 4K7VA 4ADSA 3STGA 1S5VA 3P84A 2CFFA 3FA5A 2CLHA 1K8YA 4ADUA 3UD6A 3HG3A 2ZDRA 3TU9A 1OYBA 2JK2A 3A5VA 3GDTA 2WKJA 4LVGA 2QUVA 3M47A 3LCLA 3QMRA 3S5NA 3SIZA 3L0GA 4UTUA 3NXFA 1W5PA 3W7LA 4GUFA 1FDJA 3TSBA 2QKFA 4RX0A 4OBTA 1MEIA 3HIJA 3IIXA 2CLKA 3HMJG 4FB7A 3TC6A 4MY9A 3NL6A 3TXZA 2HTMA 1FWSA 1PE1A 1I2NA 1AG1O 2DZSA 2Y7DA 2ZRYA 2YXGA 2ZZ3A 3IRDA 3C0JA 1VH7A 1P4CA 3H54A 3TROA 3DH7A 5IBXA 2X1UA 3BK0A 1ZHAA 5AYXA 3MI2A 4DELA 1YPIA 3DFQA 3BV4A 4IX0A 1BKSA 4O12A 3LLDA 2QJHA 1A5AA 3W6YA 5H91A 1H63A 1WV2A 5AOUA 4N4QA 1YXYA 5LNRA 1VYSX 4UIOA 2NXGA 1TTJA 2QCHA 2GPTA 3W7RA 1L6SA 4IPIA 3HPXA 4JDYA 2O7SA 4BK9A 2FTPA 2GOUA 3PB0A 3WFAA 1BEUA 3ZS4A 3JRKA 4CNPA 1VZWA 4NXKA 1EIXA 1KFEA 3NQ7A 4AAJA 4RV8A 4IXXA 5KITA 5D04C 5D2XA 2CU0A 3EKZA 4MOZA 4WD0A 3STEA 3MO7A 4J9JA 2HSAA 1W31A 1XBZA 1SQ7A 1K7EA 4FNSA 5G2WA 1DOSA 3EX6A 5GVJA 2WO5A 4LVFA 4Q33A 3IVUA 1ZAHA 3IGSA 1AK5A 4Y9AA 4MZ1A 4M7TA 3QW4B 3WK0A 1ALDA 4UFHA 2O7QA 3E02A 2ZQ0A 3MBFA 1F05A 1GOXA 1JUBA 3EWXA 3ZR4A 4S1FA 4O1BA 4LC8A 4Z08A 4YCOA 3GNDA 2VFIA 4L4LA 1GVOA 1LOLA 3LM7A 4TU1A 1B57A 1R2RA 1I2PA 1XC4A 3G1DA 3M16A 2EHHA 3WJYA 5C2XA 3QFEA 4LOCA 4DEFA 1HO1A 5EPDA 1G67A 1NEYA 2EGZA 2H8XA 3G0SA 4WOZA 5J5RA 3UWWA 1H7WA 2QCLA 4JYFA 2YYUA 2B7QA 3TCEA 4AHOA 1LRNA 3W7OA 4JS3A 4O53A 2ZA2A 4N6EA 5CPMA 1SUXA 2P10A 1NVMA 4MIMA 2X1TA 4Z0JA 1RQBA 4WUIA 4JTKA 3M43A 1EPXA 2YSWA 4A21A 3HGJA 4DF2A 3TKFA 3OIXA 1CI1A 1CW2A 1VYRA 2V5BA 1KA9F 4A2RA 5DLCA 4FX7A 1Q6QA 3TSDA 2VFFA 4MFDA 3DI1A 3PUOA 4LUJA 3O06A 2D73A 3ABRA 5DXYA 3H55A 1LBLA 1DL3A 4NJGA 1LRTA 2ATMA 1YDNA 2VEIA 3KX6A 3W7KA 2VELA 4P61A 3O07A 3W88A 1M6JA 4NJJA 3A9IA 2A4AA 2Z6JA 3QM3A 3KVLA 3CLMA 1MEHA 1LP6A 2VEKA 1ME9A 3I68A 2H90A 1W3NA 2R91A 1UB3A 3QW3A 4MYXA 3PSVA 4NJKA 3QQ0A 1M7OA 3CU2A 5A8GA 2PRLA 5HR7A 3W2NA 3E96A 6TIMA 2EPHA 3W1RA 3SW6A 1TPVA 4LS0A 1UJPA 1UBSA 4UTMA 4LC6A 3NDOA 3L0KA 2DJLA 4PODA 3WJWA 2CLEA 3SECA 1GTEA 4XKYA 2BSLA 3O8AA 2WJZA 3CQ0A 4K37A 3FJ6A 2BX7A 1LRQA 1W1ZA 3OVPA 3LB0A 3DAQA 2YZRA 3SFKA 3LCWA 3QC3A 3L5LA 1F76A 1JCNA 3PBWA 1TPWA 3NYZA 2QEZA 4AWTA 3EWZA 3O15A 4G1KA 2OT0A 1TCDA 3QJAA 2CZDA 5HUOA 4M6VA 4DO4A 5BMXA 3N34A 3KVKA 3QYQA 3FLUA 1SPQA 4IXHA 1OG0A 3IVSA 4DXVA 2WOQA 4UTKA 4K8HA 3Q2DA 3HQ1A 1GWJA 2C19A 1DBTA 3IIZA 2HS6A 4K8EA 1XXXA 1X8FA 2VC6A 3M9YA 3HGOA 3M5ZA 3EKLA 2NX9A 3W9ZA 1SZNA 4LUIA 1JCJA 1TO3A 1YLVA 3GX9A 2RFGA 1YDVA 1UUMA 2UV8G 5HJLA 3TC7A 1IXNA 3G1SA 4O1DA 3LCGA 1Q6RA 4UFMA 1QO5A 3EXTA 3KRZA 2Z2UA 4UFIA 1RQEA 1FX6A 2CLMA 3QSTA 1TPC1 1VRDA 2B4GA 3FJLA 4UTTA 3L2IA 4FX6M 3FKKA 3EX3A 3NAVA 3T44A 5I3GA 1QMLA 3W87A 4ALDA 4YXGA 1B4KA 1FCVA 4OV9A 4O13A 1H1ZA 1IIGA 5FF3A 1PVNA 4HT3A 5F1UA 5IM51 2YDAA 3GB6A 3GXNA 3RMJA 5CKSA 1LORA 3FIGA 2A6LA 3S8HA 1F5ZA 1UCWA 3W23A 4MZYA 1X7FA 3C3NA 4JTTA 2WSYA 2E5DA 2X1SA 2GJLA 1MSSA 3W1AA 4GUJA 3OEXA 3LLFA 3BG5A 1ZAJA 5BW6A 1VC4A 1OFAA 2H6RA 1K03A 3RNDA 1O5KA 2RDWA 3W2UA 1GYNA 1KFCA 3FEMA 3TJXA 1SO5A 4AH7A 1OYAA 3KVJA 1ICPA 2V0TA 3R13A 1ZCOA 4A2SA 2EAWA 3W1TA 1YXDA 4UMBA 4N9CA 2YFNA 4JIPA 5CZ0A 2ISVA 3RU6A 3C4UA 4Y8FA 2DJXA 4WOQA 3W71A 4O1AA 2C0AA 5C5YA 1WXJA 1A5CA 3S5YA 2QAFA 3NPXA 1W5NA 3TR2A 4GBUA 3THAA 1A5SA 3YPIA 1HG3A 5HWNA 3B8DA 4CCDA 1AW1A 4NUWA 1EP2A 3W83A 1TMHA 5KSWA 1L6YA 1V7YA 4KKXA 4Z0SA 1O94A 3B04A 4O8RA 2ZZ5A 3NG3A 3M1ZA 4GNJA 3KRSA 3QZEA 3D0CA 2Z6IA 4O50A 1TYGA 5LGXA 2F84A 2FLIA 4O18A 2NXHA 3ABQA 3TW7A 3WK1A 4MLJA 4P2VA 1W37A 3CWNA 2FJKA 4NX5A 1Y0EA 1H7NA 3W7CA 1Z48A 5EMUA 3DHDA 3LRLA 1MEWA 3R2GA 4M7SA 4ZQNA 3TH6A 4BI7A 1KM3A 5AFDA 5CG7A 1VHNA 3UY7A 2ZZ6A 3HPZA 4CLMA 3UNDA 3S1XA 2NUXA 1G4PA 4NXSA 3G1AA 3VE9A 1XFBA 3O05A 4AVFA 1U5JA 3TQ0A 4LVAA 1C29A 1ZFJA 1OHLA 3VKJA 3BGJA 4N4PA 1DORA 5LNUA 1QOQA 2E09A 4JY9A 3M7WA 4O28A 1OFDA 4HNTA 3TV8A 3W7NA 1GVQA 5KTLA 3EWWA 1ME8A 3W2JA 1W5MA 3M5VA 5L6UA 4PTNA 5FI8A 4JD4A 2BTMA 5BRBA 3LTYA 4NZJA 3LI1A 3MHGA 2CZ5A 4JICA 1JUEA 4UTWA 2PURA 4W9TA 3W7JA 3MWAA 4RZ5A 1IIHA 4ZQMA 1ICSA 3HB9A 1O60A 1QPOA 5IBXC 3BO9A 5KZEA 1KFBA 1XBYA 1GT8A 1TTQA 7TIMA 3PG9A 3RF9A 4WY0F 4PFMA 3STCA 1T96A 2AAMA 3IV3A 1KLZA 4PL2A 3W86A 1L6WA 4O17A 5D37A 1FUYA 3RLUA 1KM4A 2JGYA 4UNLA 3DFPA 1VQTA 2Y85A 3N3MA 3UPBA 1H7OA 3NVTA 4BFAA 3QMSA 1RD5A 4AF0A 2H3BA 3OVRA 3HPSA 3BW4A 3LXAA 4K38A 2OMAA 5KMYA 5A5WA 4MLRA 1ONRA 4NQ1A 1XDLA 4RXGA 4O4WA 3BW3A 1TQXA 5HR6A 2E68A 4IX2A 2E6FA 1PV8A 2QCDB 2RKXA 4UR8A 1O5XA 4ZZ9A 3G1YA 3TIMA 2ISSA 2J27A 3NQVA 3HGRA 2TSYA 1NF7A 3EXRA 4O16A 3BLFA 3A5FA 1SZEA 3EWUA 3QMTA 3G0XA 1OFQA 2BZNA 4QJ1A 3B05A 3I7RA 3LBMA 4D2JA 3SGZA 1ADOA 1D3GA 3IEBA 2J9XA 1W0MA 1K8XA 1R46A 1ZENA 2WSRA 5FESA 2ZRUA 5C6MA 1KBIA 2Q3OA 4CCCA 1RQHA 1E51A 4LTSA 5CPOA 3PM6A 2ZCGA 5E0KA 2J9ZA 5FEWA 2FDSA 3EXSA 1KM5A 4N9EA 1Q45A 3E0IA 4HN4A 1FWNA 3PBUA 2AQWA 3EWBX 4DBEA 2CLFA 4Z1BA 4HHPA 3W2LA 3W7HA 4MJZA 4XZ9A 2OZ0A 3BVJA 3Q37A 1JQXA 3QRHA 5U4NA 5AHFA 2FB3A 1K7XA 4JTUA 3BPWA 4WX2A 4XKYB 3O16A 3DU0A 1JVNA 4WY0A 4GUGA 1TB3A 4H4IA 1SR9A 2NXIA 1YXCA 5HWJA 5TQLA 1K02A 2ZZ4A 1JRCA 1TREA 3C6CA 5E1QA 3HG4A 1KV8A 2NLIA 1I2RA 2G5WA 4ZVJA 4C1KA 3CEUA 2RDTA 2GQ9A 3TUUA 4UTHA 4O0KA 2X30A 1J5TA 1SO6A 3W1PA 3H53A 3EWYA 3VNDA 5SWUA 3GKAA 5HMSA 4WJEA 1JJKA 1TQJA 1OABA 3MW7A 3PY2A 4N9DA 1FWTA 5FF4A 3DFSA 1L2UA 1SZGA 5AYZA 3M5XA 3WK2A 5MHBA 5D38A 4EVZA 3B4UA 3TNOA 3PBYA 3UWQA 3JS3A 3NQFA 4Y6GA 3NPVA 4E2BA 3EX1A 3CT7A 1KTCA 5D2VA 3N2XA 2DZPA 3T40A 3L9CA 5AHEA 4CQ9A 3A22A 4UTLA 4IUOA 1KM2A 3R12A 2Y7GA 1XBXA 2QDHA 4FNPA 3I65A 5FEZA 1KTBA 2VEPA 4Z1CA 3G0UA 4X22A 5CZJA 3UPWA 4U4MA 1IXQA 4AEOA 5FF7A 4HNUA 2C1HA 1QCWA 3MYPA 3T78A 3U8GA 4JTEA 5KZMA 3PC0A 1VCVA 1W5OA 3HJZA 4PC8A 4JTJA 4EIVA 3LRMA 3CHVA 5F2GA 4A22A 2VENA 3ANYA 1X1OA 3O6DA 4IJBA 5EA9A 2TYSA 2BLEA 1TTIA 4O10A 2V30A 3W7IA 3PF3A 3NPWA 3VI2A 4A3UA 3CEPA 3INPA 4TMCA 4MKNA 2QCMA 1W5QA 4PEKA 3W1QA 3LXCA 1W3TA 1YPFA 2Y7EA 2NUYA 5D30A 3PWAA 3N73A 1RZMA 4Z1AA 1DQWA 2Q3RA 4WQ6A 3W70A 1J2WA 2YW4A 4MYAA 3NOEA 5FF0A 1WX0A 2B0MA 3G1HA 1WBHA 1KBJA 2ZZ1A 4R33A 4JX6A 1FDZA 5F2IA 3P62A 3TSMA 3I7SA 1P0KA 3BARA 2Y62A 5K9DA 3SR7A 1TPFA 1Q6LA 3S9YA 1QO2A 3MYOA 4OU1A 3U2OA 1WYIA 3MI6A 5F4WA 2G95A 3S6DA 1BTMA 2Y6ZA 3U6WA 1F2JA 4GRSA 4OWGA 3PG8A 1HO4A 5DY3A 1YTDA 3MMTA 4DBDA 3GLCA 4EOUA 2DU2A 2E77A 4M5PA 5AN7A 1GEQA 2A21A 2GVLA 3LXBA 3L5MA 4JTHA 3DFOA 1QWGA 3CIWA 1XKYA 4O19A 2C3ZA 4UTTC 4YLWA 5T26A 2X2GA 3LCXA 2NUWA 3QF0A 3KHJA 5I3KA 3N19B 4MPQA 5C55A 1EP1A 3VCRA 1JR1A 1W56A 1AMKA 1FWWA 3A21A 1LM1A 1C8VA 3TJLA 1G7VA 4JTGA 4CQ8A 4O52A 1XBVA 4JX5A 4RK8A 3MHUA 1BWLA 2DORA 5CSSA 3W3OA 5HWMA 3GDRA 3PR2A 4JXCA 1M5WA 2CZEA 1Z42A 2G97A 1R47A 1GZGA 5D2TA 2WNNA 3C2EA 4LVBA 2E1DA 3LCHA 3NQMA 4O54A 3TFXA 3CC1A 1A53A 1GVFA 4I7WA 2ISWA 2ZRZA 3CWOX 3NA8A 2RH9A 1MO0A 3O6YX 1XDMA 5C54A 3LERA 1YYAA 1G4TA 3PVFA 4JTIA 4XBKA 5DN1A 1OK6A 1LZOA 1MZHA 1TV7A 4OGZA 4O4VA 2CW6A 1T0OA 1QPNA 4LRTA 2HMCA 4FXRA 1I4NA 3FKRA 1OYCA 1JQVA 3GIYA 3TXVA 1LLZA 3C56A 3NM3A 3MHFA 1TJRA 1LBMA 1OFRA 2V2CA 5DCEA 3KFTA 4Y96A 3SY5A 3F1QA 1H1YA 2PRHA 5K9XA 3S1WA 1G4SA 1I2QA 5DBTA 3A24A 1OFBA 3NL3A 4LWWA 1I45A 2PCQA 1KM0A 3P82A 1Z44A 3DFTA 3P8JA 4N02A 3LHWA 3GAKA 3OG3A 4WXZA 1W54A 1FCQA 3G1VA 3F4NA 1G7UA 1R30A 4JYDA 1UASA 1PHWA 1SW0A 3W75A 4JTFA 4O15A 5CSRA 3T7VA 4UC5A 2I14A 2Y88A 3P74A 1D9EA 2YFOA 1FBAA 2Y63A 3MP5A 5AB3A 3NQGA 3TA6A 3G22A 4JNMA 4FNRA 4ICNA 3RFAA 1JUKA 5LGZA 1GVRA 4LS1A 1FY6A 5I3JA 2V8ZA 5LKYA 3N2MA 2C16A 4QQ3A 2GQAA 3G8RA 1KW1A 4X2RA 4HPXA 1RPXA 3W73A 3L67A 2X1RA 3ELFA 3LI0A 3NQAA 1DVJA 4GWEA 2DP3A 2YR1A 4LV9A 3TE9A 1YTEA 3NZRA 4K7YA 2ATSA 1AL7A 3O6CA 1EWDA 2VFGA 2E6DA 3ATZA 4UFJA 5D2YA 1I2OA 4LU0A 2Y7FA 2Y70A 2AGKA 3E12A 5I3IA 3W1NA 3P81A 1WDWA 3WJSA 3GVGA 3L65A 3LDVA 1VLWA 3LV5A 1XM3A 4JYEA 4IOTA 2FIQA 1CX9A 1TJPA 3G24A 3A23A 1WBJA 4UTWC 2XN2A 4AWSA 1A5BA 1DV7A 3UWVA 1IGSA 3CB8A 5K4ZA 1JCLA 2QJIA 3M41A 4TR9A 1DKWA 1TPB1 5AHMA 1JCYA 3DKJA 3NL2A 4ZMGA 4GFSA 1SZFA 2YPIA 4R53A 4M19A 1GPWA 1KFLA 3DHFA 3BG9A 2ABBA 1XI3A 4HSOA 2QCNA 4IMFA 1K3UA 4AMAA 2E6AA 5LNVA 2YGYA 3W1UA 5BOOA 2I9EA 1QAPA 3I7QA 1SFJA 3QSRA 2TPSA 2J6XA 3O63A 1J4EA 5EY5A 2XN1A 3GDKA 4WZHA 3NPUA 1C9DA 4B5NA 1TIMA 4RLIA 2J88A 1H7PA 2A1YA 4NNBA 1ZAIA 4HKPA
chains in the Genus database with same CATH superfamily
1UR8A 4FIRA 3POHA 2WVUA 1W3LA 2WNZA 3GY1A 2NX3A 1LOQA 1EP3A 2IQDA 3HPAA 4AEFA 3A64A 1TA3B 4FIQA 4LY8A 4XAPA 5AHLA 4OZOA 4QEEA 1S3HA 3DZ1A 2FPVA 1LBFA 3GG1A 3QR0A 3C2OA 3UZ5A 4H6RA 1OGSA 4XWUA 4IF2A 3U57A 3AHXA 4O11A 3TZNA 3WNMA 3D5HA 1OFPA 2EQDA 1JCXA 3WLLA 3OVQA 3FOKA 4U28A 3SN1A 2QPSA 5REQA 4ZL1A 1PZ1A 1FP9A 2BOGX 4ZQRA 1NH6A 1YADA 4DPPA 2P3ZA 2CLLA 2G41A 4QHRA 2IMRA 5CPNA 5AECA 4DZIA 4E8CA 1LTDA 1JXJA 5C9WA 4WKHA 1LWHA 2WMFA 4HK5A 4URIA 2GSHA 3QPYA 2OT1A 3D46A 1SU5A 1ZJIA 5ABGA 4Q8TA 1K7FA 4GC4A 3CV7A 3VIMA 1ONEA 3AJXA 2JGQA 1F61A 2PTYA 3AO0A 1YQ2A 2EBNA 3PULA 1JD9A 2XIOA 2OWXA 3L66A 2R94A 2OX1A 3L2MA 2QJJA 1A5UA 3G1XA 2R1MA 3LUTA 3AIEA 1E0WA 3WLRA 3RYSA 5BU6A 1R38A 4V27A 2DZXA 5A6BA 1EUAA 2E28A 4UBPC 2PDJA 5A8NA 1EQPA 4P7NA 3SEPA 4JN6A 3IVTA 1SW3A 4M6UA 3C52A 1PIIA 3OHIA 1E4LA 1JPKA 2QCFA 1GG1A 3AXMA 4GH1A 4IPNB 4MNKA 4EWND 3PZTA 1P1XA 3W7PA 3GU1A 4PA8A 3SJNA 5K3VA 2W5FA 1TMQA 3SCQA 3LMZA 4GBDA 1GHSA 4O14A 3UR2A 1Y65A 2B7NA 4I8YA 4Q4KA 3KRBA 3F5KA 2Q8LA 3SRDA 8TIMA 1S3TC 4TMBA 1TV8A 1KFKA 5LNWA 3AQUA 2I5IA 3OGVA 1EWEA 3MCMA 3WUFA 3GHTA 1VFUA 3NQCA 3ARZA 4ECLA 1VLIA 3BQ5A 3B8SA 4AY8A 4AWEA 1FRBA 1DHPA 3C0LA 3SI9A 4OT7A 3HO8A 3ZFHA 4GJIA 3K30A 3LHVA 1ECQA 1ZBKA 3LPOA 1GONA 5EL1A 4TIMA 3FJNA 3H2AA 1H61A 1H0IA 1H11A 1E70M 1AQFA 3LYEA 1R86A 4X3ZA 1PX3A 3TWAA 4A6GA 4JDBA 5D32A 4J3SA 1VBGA 3TX9A 3TNBA 4Y90A 1H60A 3CS2A 2V2DA 1A5LC 4JQ4A 3STFA 2R9RA 4NG3A 4CVWA 1UOZA 3BSMA 4IWWA 3F03K 2WSQA 1UZDA 3DFNA 4B5SA 2DT1A 1UWUA 1GOOA 3IJ8A 1WDQA 4D6HA 4EF9A 2OX4A 1PKNA 2V5LA 3W81A 3H7VA 3PNZA 2J24A 4N6FA 3N1AA 4L6DA 3TP4A 4BF9A 2ZUVA 4A8LA 2CKRA 4XK2A 1GG0A 4US5D 2D3NA 1RV8A 3THQA 3MANA 4B3KA 2A3HA 5ABTA 3OGRA 1NSJA 5M5DA 3U2EA 3KZSA 4FOUA 4XIAA 1A80A 1XSIA 4IP7A 2W0UA 1XSJA 4ES4A 1FWGC 3A6OA 3ZVHB 4IG2B 2NQ5A 4AVOA 4ZQCA 4QNWA 1OX6A 4I90A 1Z69A 3ZT5A 1Q3NA 3G3MA 3KOZA 4OE7A 1JULA 1RJRA 2ABAA 3T09A 2A7NA 5CSUA 3AMGA 3BLOA 4H1ZA 3ES8A 3LHUA 4DM1A 5MKGB 2YYTA 4RR4A 1GORA 4UOJA 3ATYA 3CLWA 4MZ8A 3VU2A 1MW3A 3VFLA 3W84A 4PB4A 4LNYA 4Q7IA 4GK8A 4DAFA 4QITA 3AOFA 5G2HA 4F0HA 3ARTA 3DHUA 4HA0A 2GGGA 2QCGA 4AHPA 3BANA 3RX2A 3HFTA 3MB9A 4ATLA 2XSBA 1V0NA 4D72A 1OBAA 1OM0A 1WE5A 2V9DA 2GJXB 4K36A 3SO7A 1QW8A 3VC6A 4FXJA 2C18A 1GYLA 5A8QA 4NAEB 5ABEA 5CH9A 3RLHA 3ITVA 3UWUA 3W7QA 1KM1A 4OV4A 4WRHA 5J8LA 4LW7A 3TTSA 5CC7A 4DJEC 4F0KA 3M7SA 2VVSA 1H5YA 3UZZA 1OT1A 3N9KA 3ZT7A 3O0FA 3MA8A 4MJ2A 1ZY9A 5AYYA 5G5IA 2OR2A 4E2DA 3KDNA 4IGHA 4UR7A 3VIJA 5I77A 2ZA1A 1BVWA 3WLMA 7CGTA 4PBFA 3MBDA 4C5ZA 1TPH1 1UR4A 1T41A 3FS2A 4K39A 1DJHA 1D2KA 3ZSTA 2OYKA 5AC6A 3GR7A 2NX1A 1ZTVA 3UNTA 2G37A 1M7PA 2FVLA 4MWAA 3W2KA 4CCZA 3NR0A 2BY0A 5CGMA 2QAPA 4HCHA 4KFNA 1JZ7A 1T99A 2O4QA 1MQQA 1WB0A 1E72M 3BLIA 3A4WA 4JIIX 4EANA 3N9SA 1XP3A 3VM5A 4O1CA 1V5XA 3UXKA 1TJ1A 5F4XA 2C8NA 3P67A 4XTIA 1F4HA 4PUUA 3JVAA 4PN2A 2YXOA 1OIMA 3S2JA 1RVGA 2B7OA 3QYSA 4XAFA 1KFJA 1RCQA 1U1JA 1US3A 5CAKA 1XCXA 1NOFA 2YKKA 3UXAA 2O0TA 4RZ6A 1F6KA 4OECA 4LCRA 4GC3A 4A05A 4MSSA 3OBAA 3C2FA 4XUYA 5E0CA 3DERA 3FYYA 3WQCA 3WH7A 1Q6GA 3AWOA 1GJPA 3FNDA 4PTMA 5DO8A 1W8SA 3GVRA 3W25A 1P0NA 1GYMA 3EDJA 3V1HA 1RJPA 3LX9A 1ISWA 4O0ZA 4W8BA 1W1VA 1NFGA 1K70A 3LZ3A 2C13A 3SUVA 1QFEA 2RDUA 4NNCA 1N2VA 3W1LA 1E55A 3GHRA 4GYPC 3SY1A 4MJMA 3WF3A 1M9HA 2FPYA 2B31A 1F73A 2ZZ2A 4XTDA 2F8QA 1J11A 1XIBA 3IJLA 3M44A 3TW6A 3CPRA 1JPIA 1WP6A 1FQ0A 2IPWA 4I5UA 1CIUA 5LHEA 3GH5A 3MSDA 3URQA 4OFCA 3KOFA 4LQ1A 3CMGA 3OU8A 1XLKA 4L64A 5JIWA 3HM7A 2BXVA 2VRKA 3AS1A 1OF6A 3S42A 3S46A 5CG0A 3E5BA 3OA5A 4QDMA 3P5YA 4C6BA 2PSNA 2AL1A 4TV5A 3TK7A 1EJRC 1E6SM 2P1FA 4QROA 3F2CA 2X42A 3O1NA 4MM1A 5GPRA 1XLCA 3CJPA 1D3HA 1VCFA 2EKCA 3SRKA 3M0XA 3RG6A 1NWSA 2J47A 4W89A 5FJOA 1TX2A 4NZ5A 3AIBA 4R88A 4JEQA 4LYRA 2D23A 4PMVA 4EKJA 2E25A 1B3VA 3G1FA 1ZS2A 4HNNA 4BI6A 1P7TA 1PS9A 2FMOA 2JKEA 3TONA 3VX0A 4J3VA 1JDDA 1UUOA 2I5QA 1JCTA 2PDPA 3L68A 4N9BA 5K4XA 5J5DA 2QPXA 1EPVA 3DI0A 4H9XA 1M7XA 2EJ1A 4KWVA 1BF6A 3RX3A 5H8MA 2QCCA 3PSWA 1LYXA 1XYFA 3S5ZA 2HBVA 2V3DA 2VWTA 4NIRA 2A7PA 3EX4A 4KS0A 1VFOA 1VPYA 2WMGA 4MJ4A 5HMDA 2EG7A 1EF3A 1YNYA 3NSMA 2FZ9A 4QNEA 5H6HA 4HNVA 5HQLA 5CXPA 3UJ2A 1BAGA 3GXMA 2WJEA 1KV5A 3BZGA 4LXFA 3SSJA 2V68A 4DBWA 2FFCA 3UY8A 1H41A 1H09A 2KAUC 5HQEA 5CLTA 1SFLA 2D69A 4PUMA 1HL8A 4E5TA 3W1XA 2QGHA 2CEQA 4MGGA 4ADSA 3KE0A 2CFFA 1ZPTA 5DMYA 3UD6A 3HG3A 3UBPC 2ZDRA 4F66A 4HZ7A 3TU9A 4LF2A 3A5VA 5M2FX 4JIRA 4LVGA 1GOWA 1JGMA 3S5NA 1RVKA 3A3HA 3NXFA 5DEZA 3ARSA 3WMLA 2AL2A 2C0HA 4BY3A 2YDSA 3T05A 5EMMA 1MXDA 5AYBA 1RP8A 4FB7A 1O5QA 5BXPA 2VX6A 1EGVA 2HTMA 5LA1A 2A3CA 1FHUA 1UD6A 1I2NA 1R3TA 2Y7DA 2YXGA 1VH7A 2OQHA 3QOMA 5I2UA 2PWGA 2X1UA 1ZHAA 2H9AA 2ZUSA 3LY0A 1QASA 1AZ1A 2QMJA 1S39A 1H63A 4H7CA 2XVPA 4FR6A 5AOUA 4N4QA 2Z29A 6ENLA 3W7RA 1TMLA 2WHLA 3ANVA 1L6FA 4C6KA 3ES7A 1KXTA 3GIPA 2VEGA 1WDSA 2WLZA 4QCFA 1BEUA 1SJDA 1E40A 1KFEA 3BMWA 3ENLA 4IXXA 3O2LA 3IUIA 4MOZA 1PPIA 3VGEA 4J9JA 4GGHA 4LYPA 2HSAA 1W31A 1XH0A 1K7EA 2O9TA 2OTDA 4F40A 1DOSA 4AIEA 4J5NA 3U4AA 1S5NA 1XC6A 1DIDA 3IVUA 3GWQA 3IGSA 4UFHA 2O7QA 1WKEA 5DRCA 2QVHA 1CNVA 1JUBA 1TR1A 4US6A 4O1BA 1KWKA 4I3GA 1EL3A 2OLAA 1XC4A 3CHFA 3M16A 1FHVA 3QGVA 4CEXC 1UUQA 4AZ5A 2VZSA 3UJFA 2XH2A 1NDWA 4B5WA 4PGLA 4DUWA 2QPUA 3BDKA 4V28A 4F0MA 1G9HA 3AYRA 1JZ2A 4MWAB 3W7OA 2UY3A 4O53A 2ZA2A 1SUXA 2P10A 1GOIA 1PKMA 4Z0JA 4WGXA 3GNRA 1V6WA 3CV2A 4UQEA 4PMRA 4GJJA 1CI1A 3ZJ7A 1CW2A 1KRCC 3UCDA 1RBAA 4A2RA 4XX6A 1U2YA 1NDYA 2HCVA 3I10A 1Q6QA 4I8DA 1V7AA 3NWRA 5IXEA 3O06A 2D73A 4TVUA 2V69A 1YRRA 1LRTA 1YDNA 2VEIA 3W7KA 4LSBA 3CHCA 3O07A 3KLLA 4B91A 1M6JA 2Z6JA 3CLMA 1LP6A 2G0WA 2XFFA 3N4AA 2VEKA 5GNXA 1V6XA 5BCAA 1GOQA 1L8PA 3QW3A 4NJKA 4PZVA 4AD3A 2PRLA 3E96A 5EFDA 3HU7A 2D0GA 4MHBA 2GFTA 2Y8KA 4XBJA 5IDIA 4H83A 3ARVA 4UTMA 2DJLA 3WJWA 3DCPA 2XWEA 2GDUA 3CT2A 4L9YA 3A4AA 2PP1A 1KBKA 2J25A 1CXLA 2OXNA 2ZIDA 1LRQA 4RZBA 1W1ZA 4TX8A 3OVPA 2WSPA 4NAFA 3QC3A 4PSRA 1UR0A 2OZTA 5IFTA 1UR2A 3ZMRA 4K1WA 1F76A 3PBWA 2QDEA 2OO0A 1Q2RA 4U5IA 4G1KA 4RE2A 2DUXA 2OT0A 2E4TA 4M6VA 4DO4A 3LLXA 4BEQA 2DGAA 4JNZA 3N34A 2ACRA 1ZGDA 4S3AA 3IVSA 5F7UA 1DYSA 3GDBA 4HD5A 1PTDA 5JBFA 3HMCA 1R9XA 1J93A 2HS6A 4IFKB 2VC6A 3M9YA 4TTUA 2NX9A 3W9ZA 5IRPA 4XB3A 3GX9A 3R94A 1M41A 4X2PA 3M46A 3K46A 3TA9A 1VFFA 3GVQA 1PIFA 1QNPA 3PZOA 3NFUA 3LD5A 3FJLA 4UTTA 1EOKA 1WKYA 4ZSTA 2YBVA 3EEZA 3LPFA 4HQVA 3VIFA 3ARRA 1IIGA 3CH9A 3L23A 3WD3A 3SAZA 2GUBA 2G3FA 3ONBA 5FJRA 3S8HA 1H5VA 5FOOA 3CV6A 1S46A 1JNEA 2AQOA 4AY7A 4HHLA 2X1SA 1MW2A 3FGCA 8RUCA 3FVMA 5C9ZA 3W28A 3LLFA 1OD8A 5A6MA 3VIPA 1CCWB 2RDWA 3VMNA 1KFCA 3EB3A 3FEMA 1QRQA 4C6DA 3MC5A 1I9CB 2V0TA 3R13A 4FS9A 3W1TA 4UMBA 2PB1A 4H8HA 3BURA 3C3UA 1J96A 1XW8A 1F3WA 4O1AA 3IUHA 4A3RA 3B0XA 4MDPA 3S5YA 4AC7C 4ERGA 1YKWA 4CU7A 5AYIA 3THAA 4NYUA 2P53A 3NIYA 3B8DA 1DXIA 5HWNA 4NUWA 4X0NA 2JFEX 4RDZA 5ECUA 4RW5A 4KKXA 4S3CA 3B04A 3NG3A 1NQ6A 3WQ5A 5FJTA 1E6NA 2PWEA 2G3MA 3WMBA 1PB0A 4W93A 3KBWA 2Z6IA 2VCAA 5BRQA 2DQWA 5LGXA 2ZWZA 2Y5JA 1IR1A 5E6ZA 3TW7A 4L5ZA 3LU2A 4QLKA 1GW9A 3EA2A 3ZZ1A 3VDBA 5CG7A 4L9XA 3WQWA 3UNDA 1Q6DA 1U5HA 3I4KA 4B9ZA 3BGJA 4N4PA 4QDPA 4S3GA 5LNUA 2E09A 2VHLA 3ITTA 3M7WA 1RA5A 4ROPA 2HNHA 1GVQA 5KTLA 2OQYA 4MB1A 4F2TA 2FHCA 3GC4A 3IK4A 3W0KA 4JD4A 3LTYA 3LI1A 4QQUA 3UU0A 4UTWA 3FDGA 2I16A 2YL6A 2CLPA 1LWIA 4E2VA 1ICSA 4A8RA 4GISA 3LGDA 1GT8A 3VUPA 1KQZA 1TTQA 3MUAA 4WY0F 4ZB0A 2BASA 4MAVA 4PFMA 2AAMA 4TQTA 4PL2A 1V02A 1V6TA 2ALRA 2BGQA 2PDWA 5D37A 3APYA 3HTWA 3RLUA 4UNLA 2Y85A 1H0GA 2ZUTA 2RUSA 3NVTA 4GIEA 4L1XA 1DIKA 1RD5A 3CQHA 3OVRA 2WWDA 2XYLA 2ZX9A 3LXAA 4K38A 2OMAA 4PFHA 5KMYA 4C1NB 3U9IA 4F0SA 4K8GA 2EPOA 1TELA 4HHHA 3BW3A 5M17A 4F2UA 3S3GA 3SUTA 1CPUA 2IQ0A 3MUZ1 1ADDA 2WMIB 3NQVA 4AZCB 3HGRA 1MI3A 2DVUA 2Q8XA 3EXRA 1L6GA 4O16A 2PZ0A 2GDQA 4QGCA 3EWUA 3QN3A 1VF8A 1OFQA 2BZNA 4S23A 4H9VA 1V3HA 3B05A 2HZGA 3LBMA 2QV4A 4D2JA 1ADOA 4AD4A 4Y9NA 5FACA 4GIAA 1E6PA 5FESA 4LB4A 1YPXA 4DWSD 2PDQA 3WG6A 1RQHA 3AMLA 2XFRA 1SFSA 5CPOA 2ZCGA 2CXGA 2J9ZA 5FEWA 3WF4A 4NHVA 3E0IA 1FWNA 3PBUA 3GUWA 2HK0A 4Q8PA 4GCXA 3C86A 1DWGM 4IM4A 4Z1BA 5TAOA 1E73M 1UJQA 3E6EA 1TV4A 3Q37A 2WM1A 3VNZA 3QRHA 1DXFA 4JTUA 3BPWA 2VGFA 1SR9A 1YXCA 5HWJA 4AMCA 1K02A 3C6CA 5E1QA 4W86A 3NCOA 2PGEA 3HG4A 5CC5A 4Y8EA 2Z24A 2G5WA 3PJTA 4C1KA 2VQTA 4F2BA 2GQ9A 4XAGA 4Q6JA 3KS6A 1TUXA 1J5TA 4PBEA 4PCPA 3VNDA 1OABA 3PZNA 3SUSA 5ECVA 1FWTA 5FF4A 5MHBA 5AYZA 3C5QA 4LBRA 4I9JA 3TNOA 1BYBA 4RE3A 3NPVA 3M0MA 4UR9A 4UQ9A 5D2VA 2DZPA 1AQMA 3L9CA 2I5GA 4GX9A 3A22A 4UTLA 3N13A 4IUOA 1KM2A 4O0QA 4M80A 4ACYA 3GXIA 4KGJA 4HVXA 5FEZA 1M1BA 2VEPA 1NELA 3PPGA 1RBOB 4LUTB 3QV9A 5CZJA 3IARA 2IXUA 1QCWA 5D8ZA 3W38A 5H8PA 5KZMA 1OEPA 3PC0A 1VCVA 2FDMA 4GYFA 3VDAA 4X63A 3CQIA 5CJMA 3CHVA 3MCOA 2VENA 5C7VA 1OIFA 1X1OA 4P7RA 5FSEC 2V5CA 1TTIA 3QOKA 4LJ3A 3W7IA 1XRFA 1QW9A 5G1MA 1UZ1A 2VCCA 3ZVIA 2PAJA 3PWIA 2W9MA 3V0TA 4KEMA 3ZT6A 3HJEA 3T0AA 1YPFA 2Y7EA 2FZMA 3SCPA 4J4KA 5D30A 3SCTA 4Z1AA 1O6IA 1NWTA 1Q8AA 2E40A 1JZ3A 2HJPA 2DV0A 3VO0A 5F2IA 3V18A 3BARA 5EB8A 3SR7A 1TPFA 3WDIA 1IE7C 1QO2A 2WQDA 4AVNA 3U0HA 4A8NA 1YNPA 3WLNA 4OU1A 5FL0A 3AIRA 2G95A 1QT1A 3U6WA 1DHKA 1MRAA 1YMYA 3PG8A 1HO4A 3V5CA 3VNMA 4R7WA 2QVNA 4LAZA 3MMTA 4DBDA 4AU0A 2E77A 4M5PA 3I4EA 3BLPX 3LXBA 3ZJ6A 4YTUA 3BSGA 3DFOA 1QWGA 3CIWA 5CJ5A 4YLWA 4DUOA 5B7YA 1CXHA 4XISA 2WMHA 4RDWA 2DIKA 4RPPA 3PZQA 3WD4A 5C55A 1EP1A 1AMKA 1FWWA 2V38A 1XYBA 2V5DA 1ZP4A 3IJIA 1ENUA 4CQ8A 4AX7A 3MHUA 5DRIA 1GCYA 1BWLA 5CSSA 3WNNA 3LNPA 4ZB2A 1N8WA 3E2SA 3GDRA 1Z42A 3LSCA 2G97A 3QHOA 2QZRA 4JHZA 2E1DA 4XSMA 2BG5A 2OGYA 4O54A 1J8VA 2DIJA 2ZUWA 3R10A 2ISWA 3EOSA 3THCA 3MDUA 4PUJA 1YYAA 1G4TA 1O7AA 3L4VA 3L2LA 5B7ZA 4HNOA 3ZLHA 3TEVA 4QX4A 4Q8UA 4KWSA 4WSHA 2HMCA 3EOUA 1E43A 1TJRA 2VR2A 2X7WA 1DEDA 4IIBA 1OCQA 4P7QA 2VR4A 1M53A 3F1QA 1BSLA 5K9XA 2XISA 2QULA 2XVNA 1I2QA 5DBTA 3FA4A 3A24A 2QJNA 3NL3A 2PCQA 2A3AA 2EKGA 2PC8A 3HA1A 1E9ZB 1V3MA 4N02A 3LHWA 3GAKA 1W54A 1R30A 2GGJA 1JZ6A 3AXKA 2D2GA 2OSXA 1PHWA 1BXCA 2BOEX 2Y2WA 4DJEA 1XDJA 5CSRA 1CTNA 2PDIA 3T7VA 1Q6FA 4JBRA 2Y88A 4RPQA 3TA6A 3G22A 4ICNA 3VA8A 1TE1A 1O5RA 4IISA 2OELA 1FY6A 3N2MA 2W61A 3GC5A 1KW1A 2G4FA 3W73A 4F0LA 1RK6A 3L67A 1SJBA 4UZUA 4GVIA 4DI8A 4BS0A 1DVJA 1BXBA 1ONXA 4PTDA 5BWAA 3NOYA 2YOCA 2OSWA 1QBAA 1UD2A 2ATSA 3NGFA 1EWDA 2VFGA 5D2YA 3K4WA 3E12A 4QXIA 3W1NA 3S9ZA 1IWPA 4JNYA 2PPGA 3LV5A 4IOTA 3CYVA 2HISA 1U30A 2YA0A 3A23A 3TN5A 1HVXA 4DRSA 3U7VA 4LBSA 3P93A 3MVTA 3UF9A 4PUDA 5K4ZA 4TR9A 2RJHA 5AHMA 2OZ3A 2YPIA 2XH7A 4M19A 4XZHA 2IKGA 1GHRA 2ABBA 4IJCA 3KL0A 5HOSA 1J0JA 1K3UA 1FVPA 4AMAA 2E6AA 4IICA 2OVLA 3T2QA 3FDKA 4DM2A 3NEHA 1SFJA 3O63A 3AJ7A 4CD8A 4GQQA 5EY5A 2JIEA 2WC7A 4AISA 3OGSA 4WZHA 1KCXA 1X38A 1C9DA 4UQBA 4UQAA 1KKRA 2FGBA 2ADAA 2J88A 4I5RA 5BU9A 4NNBA 2BBFA 1CGXA 3AWNA 3OZMA 3NZ1A 1VJIA 3M64A 1FA2A 1HFBA 2NW0A 1MYRA 4GYPA 3M0LA 1O4UA 4XQ6A 2ZUNA 2V2HA 1LLWA 4IIFA 2PTWA 1LQ2A 4ADTA 2VCBA 5L9FA 1IR2A 1DXEA 2D1ZA 1E56A 3RDKA 4K6AA 3W7MA 4C1LA 1A4MA 1U33A 1UD4A 3WKZA 3N2BA 3EA1A 4PMJA 1QK0A 1EUNA 3BUVA 5IHRA 2BVDA 1CGYA 4W85A 4HB7A 1NDVA 2V81A 4FHAA 3VIIA 4DWDA 1XPYA 4I7VA 2OODA 1ZJAA 3DC0A 4GI8A 5EMYA 3DGRA 2J7EA 3RR4A 2W92A 3PPCA 3BQ6A 5HULA 1RHCA 1HXJA 4U10A 1QATA 3DBNA 1EX1A 3H23A 4QSFA 5AHIA 4GZJA 3QTGA 1YTKA 1H7XA 4O8AA 4K1GA 1F8IA 2XVGA 3VD9A 1Q4NX 2POTA 3BG3A 3HN3A 1QUMA 4H9UA 3PZMA 4G1NA 4QG9A 1DJNA 2JKPA 1ICQA 5IDZA 2QJGA 4H8VA 2F7FA 3CTLA 4JTDA 3SRFA 4UFKA 4FXSA 1OVDA 3U4FA 1H3GA 3OLEA 4FF7A 1EDQA 4IFRA 1ZNNA 4IJRA 4UTFA 1J0HA 4JTSA 3VZXA 1G69A 5I24A 3FYOA 3I6RA 5AC7A 5G4EA 4G9PA 4HHMA 1UOKA 4WEVX 4GI4A 7TAAA 3OP2A 1FTXA 2HPIA 3N6HA 2DSWA 3GXPA 4HPNA 3HG2A 3AMCA 3EWCA 3B9DA 2I17A 5KINA 4N2YA 1VGAA 2FPTA 2XN0A 3MSGA 3QV7A 3H26A 3D47A 4S3KA 2QDGA 4TVCA 1HKJA 1B9BA 3R8GA 4QJ5B 4Q3MA 1XIIA 4GKLA 3VAVA 3EB2A 1HGWA 2MANA 4JFWA 3OO2A 3QPZA 1ECEA 1GZ1A 4KWWA 4F4RA 4PE8A 1TWDA 4WCJA 1OFEA 4IQLA 3HURA 1DTUA 3HF3A 3NO3A 2E9LA 2HXTA 1LROA 1XCFA 4KWOA 2NQHA 1MFVA 2IS7A 1VYPX 1MXSA 1JCMP 4HCDA 2AGTA 5FF2A 3WF0A 1ZBWA 5C70A 3P8IA 1BQCA 3RM4A 4DLMA 3E0VA 4DZAA 3BAWA 3OB8A 1QPQA 1XD0A 1E1FA 4CQDA 1JDAA 2YA1A 1XF0A 5DELA 4FEZA 3KCOA 4NX0A 3OA3A 3LHZA 1F4AA 2ZA3A 3W24A 2E8YA 3TQKA 5C9RA 4ZTYA 1GPFA 1R85A 1ZQ5A 5TBOA 2FQIA 1AQ0A 2PLKA 1YEYA 4M8UA 2WPBA 3GNOA 1Y8BA 3DKLA 1WDPA 4BWLA 5BROA 3UETA 5CBJA 1PIGA 3NTYA 1RBLA 1B0IA 3HV8A 2WKLA 1GZJA 1QNSA 2C14A 2FTYA 2PTXA 3RCNA 3TMQA 2YBUA 1GQNA 3L5AA 3B0VC 1TPDA 4JHMA 1QI5A 2VZTA 3OPSA 4UNKA 4EAMA 2PD5A 3REQA 3ABSA 3C2RA 2OCZA 3S1VA 3GK0A 3FY1A 5D02A 2XIQA 4BQ5A 3GDLA 3RM8A 1GK8A 1WAUA 1QPKA 3ID7A 3P80A 1L0PA 2DZTA 4AD5A 4HGXA 4MPKA 5JUVA 1AW2A 1NFBA 3NQBA 2ZC1A 4HSNA 3KLKA 3B8TA 4JHOA 4CKQA 2WV8A 4GNVA 2XG9A 1LJYA 5DCDA 4IMDA 3STPA 4BF5A 3WH5A 3A4XA 2VKZG 3UA4A 1RCOB 5A6KA 4L65A 2R14A 1DJGA 4X9SA 2OSYA 3AHZA 1JIBA 3WDQA 5K2ZA 3NQ6A 1TRIA 4KPLA 5BOFA 4P8WA 4NNAA 1EX5A 3WLPA 5U7SA 4MWAC 3RR1A 4ZO8A 1QR7A 1VD6A 4MUZA 4OBSA 2REQA 3VNLA 4UQDA 3LNMA 4M81A 3VTRA 3UG4A 3EOEA 4LX4A 4KIEA 3WQEA 1XYCA 1XL9A 2J9YA 4TX9A 1PTAA 1S5TA 4HPJA 4ZQPA 3VOGA 4OQVA 3PS7A 2C6QA 2PP3A 5LSMA 3F2DA 2CESA 2GVEA 3KBSA 2PGRA 3NQ8A 3QXBA 3LBOA 2Z1BA 1SYTA 3E2QA 3VIGA 3EMCA 1DWFM 2JBMA 1MW1A 1VFTA 3KXQA 1BRLB 3UJSA 1NAL1 3DECA 1XHGA 4J2PA 4C6IA 3BL3A 4HOWA 2GGIA 4K68A 3BCFA 4H3DA 1BHGA 4GXMA 2INZA 3U2CA 1TSIA 2CLIA 3RO6A 4XSLA 3GXTA 4NZCA 2YCIX 2A2IA 1K77A 1AQHA 4LNCA 4D6CA 1C8XA 2CZFA 5LNSA 4J3XA 4BR1A 1FCUA 4ENLA 4PEEA 1E5NA 3S83A 5DF0A 3W85A 1A0CA 1WOAA 3GBDA 3E74A 1W3IA 2DSVA 1PHQA 3BGGA 4YJ5A 3S0CA 1CECA 1CENA 1MUCA 2GJNA 3D3FA 2P8CA 3GU2A 1OK4A 3MCNA 1NP2A 3K8LA 4A8IA 1HUVA 2OEMA 4QEHA 1RH9A 3T4WA 3W26A 3NO5A 4US5A 4PCNA 1WUFA 3APTA 5LHFA 3V1PA 4KRZA 2CBJA 4GJ1A 1UWSA 2Z7GA 3NQEA 4AF0B 1GTHA 2CHOA 1J9YA 3C8FA 2E8ZA 4M6PA 3IGXA 2VYOA 2OEJA 3H4WA 1T7LA 4OHQA 4REQA 3TZFA 1OX5A 1NTHA 3LV6A 1ME7A 1SO4A 4C6PA 1XIFA 3O9NA 1HQTA 5A6BD 1YBQB 4WSKA 3HOJA 1TPUA 1YE4A 1X39A 4UUIA 1I6NA 1PX4A 4C6CA 1F3EA 5F1VA 2W6RA 3GKFA 2Y0FA 1ZRQA 1UQYA 5G2IA 5HJYA 2QT3A 3IJDA 2PLMA 5C2CA 1F6PA 1VHCA 1P48A 4E6MA 2OJPA 1AODA 3WDJA 3NGJA 3LQLA 4RKAA 2NSXA 4C6MA 4R85A 5DY2A 2OU4A 2ZZ7A 4KIRA 1SJAA 2NWRA 5D8WA 3WQPA 2ZTKA 4CU6A 1VIZA 2ZBTA 5LZLA 5FJPA 4Z2KA 1LDCA 4BEUA 2YX0A 4DXKA 3A3XA 4YVVA 1R2TA 3A12A 5FAJA 4HA4A 1XIDA 2AQVA 2XFWA 1ITUA 1W2PA 2P88A 4H19A 3W7DA 2PUZA 4HPGA 1H50A 1WUEA 1PL9A 2WW5A 4QLLA 4ERAA 3M4HA 1OC5A 3P5ZA 2VFDA 3SADA 2GSEA 1X6UA 2ZFAA 5JXQA 2QXWA 4DQWA 3W7GA 4AIOA 3LGEA 3CL7A 4JY8A 3Q45A 1XUUA 3VNIA 3FJ4A 4ZOBA 4QAIA 3H70A 2AOSA 3SRHA 2WNWA 3H2CA 3KAOA 4KRTA 2PC4A 1UQZA 2YBTA 1IXOA 3BW2A 4UXDA 1EZ2A 4UQCA 4HA3A 3T6CA 1JZ4A 1SJCA 5XIAA 4ZSUA 2XWDA 3RK8A 3N9RA 5FEXA 4AXNA 2OWCA 2HVNA 3PB2A 4UOQA 2H8ZA 2FTWA 4K7VA 2HE5A 3STGA 3CHEA 1A4LA 1W1PA 1XQLA 1UP2A 2JK2A 4HTBA 3H21A 3TLQA 2WKJA 4RNFA 3TW9A 1TVPA 4DY1A 1Y5VA 4ZOAA 3LCLA 4DYKA 1EO7A 1O12A 1J0KA 1XIEA 4U33A 1UWQA 4UTUA 5CC6A 1A3XA 3OLIA 4OBTA 1TV2A 1MEIA 1U22A 1OC6A 3HIJA 4HCLA 1PJ9A 3RPTA 1UA7A 5A6JA 2TODA 4P5UA 2ZX5A 2J8GA 2CETA 3IRDA 2DZSA 2ZRYA 3LPGA 1MUMA 5DX7A 4D6IA 3DH7A 4AYGA 3N2TA 1UKQA 4MNMA 4ACZB 3DFQA 2F38A 3BV4A 1BKSA 2QF8A 3LLDA 2OYMA 1OADA 4CNTA 1V0LA 1XGZA 5H91A 1E3ZA 1WV2A 2E3ZA 3WQ8A 4P7LA 1YXYA 5LNRA 3VK5A 3V4BA 3PAOA 2NXGA 3FSUA 2QCHA 2GPTA 5ABHA 2IKJA 3HPXA 4KERA 2YDRA 1PSCA 4TXEA 3VABA 1FFRA 3IJ7A 3V35A 2J7CA 2VT0A 3EPMA 3NQ7A 3ZR5A 3WQOA 5KITA 2G3JA 3MO7A 2GWNA 4D6EA 1RLCL 2BGNE 4YYFA 4FF5A 4JKKA 3DYOA 4Q33A 4U3AA 4XVDA 2XPKA 1ZAHA 1AK5A 1SZRA 3MSYA 4M7TA 4H04A 3QW4B 2OKTA 3WK0A 1RK5A 1J0ZA 1ALDA 2Q71A 4Q8WA 3E02A 3QQWA 4NY2A 3GG0A 3MBFA 3GUGA 1GOXA 3NSNA 3EWXA 3ZR4A 1PZ2A 1VJZA 4S1FA 3NUKA 4LC8A 4YCOA 1W1B1 1B1YA 2NLYA 4FXFA 3ARWA 4QR6A 1R2RA 3G1DA 3MSRA 3IJQA 3OW1A 2Z25A 4IL2A 2EHHA 4LOCA 1JDCA 1HO1A 4YYCA 2VC5A 2EEXA 4N7QA 4HZ6A 1QXLA 1NEYA 2VEFA 3G0SA 1VAHA 1QI2A 4JIEA 1RJQA 1XRSA 4X9YA 3TCEA 2B7QA 4JS3A 1F3TA 1TKKA 3C0SA 1K1DA 4MIMA 1QBBA 3MTWA 4HPHA 3CGTA 1KXHA 3KL5A 1JGIA 4JTKA 2XU2A 1EPXA 2YSWA 4GI6A 3HGJA 4FP1A 2BDQA 2O9PA 4GY0A 4DJFD 3OIXA 4YWSA 2XJ7A 1KA9F 2FZBA 2ZX7A 5DLCA 4FX7A 1EFZA 3TSDA 3DI1A 1KGWA 4LUJA 3V5FA 4PTVA 4IHCA 5A69A 3DG3A 1KO0A 2JF6A 1P0EA 3WQGA 3N17A 3WH8A 4JTCA 1XG3A 3ITLA 1DWHM 4UNIA 1HL9A 3W88A 4H9MA 4NJJA 3A9IA 3QM3A 3KVLA 4LAOA 1MEHA 5AZ1A 2A3BA 2GZXA 3FXYA 1A5NC 4PB3A 3CU2A 6TIMA 3W1RA 3T0BA 3SW6A 1JDEA 1POJA 3L0KA 3CQJA 4PODA 2WVSA 4XKYA 5A8MA 4H7ZA 2GUYA 3GTXA 3CQ0A 3GM8A 3BAYA 3FJ6A 1W8GA 2BX7A 2YZRA 4A4AA 3T9PA 1TPWA 1ZL1A 3B8WA 1QNRA 3GQYA 3HV9A 2YDQA 4AWTA 3T8QA 4J3WA 3A47A 1X98A 3QJAA 4W8AA 1E6XM 4IQJA 4B5UA 3KVKA 4F9DA 4IXHA 4AFYA 4BCEA 4UTKA 3Q2DA 1LT8A 4GA8A 2W67A 1GWJA 2E67A 1DBTA 3ZIZA 5ABFB 3BMVA 3UCCA 1O68A 4UB9A 3HGOA 4J3TA 1R9YA 3M5ZA 3EKLA 4LUIA 3DG6A 1MDRA 3RXZA 1UUMA 2ZE3A 3P2VA 3TC7A 3ZOAA 3G1SA 1Q6RA 2DUAA 1QO5A 3KRZA 2Z2UA 1FWEC 1RQEA 1FX6A 1X1NA 2CLMA 2ZX8A 5D9MA 1TPC1 2B4GA 2OOGA 1R0MA 4LYQA 2IPJA 3VC5A 1QMLA 3WEOA 3JZUA 4YXGA 1B4KA 1FCVA 5KETA 1PVNA 4HT3A 5IM51 5LIWX 4ATWA 3RMJA 5CKSA 3BXWA 1LORA 2A6LA 2PS2A 3TTYA 1VEPA 2IKHA 1MQPA 3H2OA 1X7FA 3UJEA 4GACA 4JTTA 1YNQA 3ZVHA 2WSYA 4RDYA 2GJLA 1MSSA 4GUJA 5A6LA 2QMKA 3BG5A 5BW6A 3II1A 1YHTA 3W2UA 1WDRA 6TAAA 1GYNA 3TJXA 1SO5A 3WQDA 2WZMA 4Y9OA 4A2SA 3IJ9A 2EAWA 2Z28A 1YXDA 3BJSA 1D7KA 4Q4SA 1WO2A 3GG8A 5CZ0A 2ISVA 3C4UA 7REQA 4AX6A 3DEQA 5CZKA 5MKGA 2DJXA 3W71A 3K1GA 5IOBA 1A5CA 2ASHA 1S1PA 2G3IA 3NPXA 3N18A 3IJ6A 1J01A 1HG3A 4CCDA 2Y1HA 1RSCA 1QJWA 3KTSA 4NI8A 3W83A 3H4XA 5KSWA 1L6YA 3R1ZA 4GY1A 3SDOA 1V7YA 4ZR8A 1O94A 1WPCA 3BV7A 4O8RA 2ZZ5A 2WM0A 1GOMA 4O50A 1W9XA 1V3JA 2F84A 4AW7A 1XPGA 2FLIA 4ZXLA 3ONCA 3CAQA 4NAEA 3VGHA 3KW3A 4MLJA 4AEEA 1W37A 3CWNA 5A1AA 3RPMA 2WBKA 2HROA 2FVMA 1RY8A 1CLKA 1S2AA 1HW6A 3AHYA 3R2GA 1MEWA 3ORWA 4ZQNA 2ZXBA 2VI0A 2PTZA 1CDGA 1VHNA 3TCSA 2ZZ6A 3CUIA 3HPZA 2VNCA 3S1XA 2NUXA 2C91A 4GD0A 1G4PA 3G1AA 1XFBA 4AVFA 3TQ0A 3RN6A 3TC3A 3VKJA 1VFMA 3K8KA 1PBGA 3ITGA 3TV8A 3W7NA 1E71M 1ME8A 1W5MA 1UH3A 3M5VA 3QY7A 5L6UA 4A3QA 3VDGA 2BTMA 5TD4A 3SQSA 4D6JA 4G56A 4NZJA 3CASA 3UP8A 2PURA 3W7JA 2E0PA 4RZ5A 1IIHA 4ZQMA 3KL3A 4XZBA 5T8GA 3G1RA 3HB9A 1QPOA 3BO9A 4WKFA 3VNJA 3PG9A 3RF9A 5H1WA 1PX8A 1HX0A 4C91A 3STCA 2VX4A 4W5UA 3TN4A 4O17A 3WNPA 4KBXA 1QHZA 3DFPA 1VQTA 2GK1B 3N3MA 5DT7A 1W9VA 4G7EB 1DIEA 3CIVA 4XZMX 3WENA 2H3BA 3EOLA 4JFTA 2X0SA 1FWIC 5EMJA 1JZ8A 3OQEA 3AIQA 5A5WA 1EA9C 4MLRA 1NP0A 1HKVA 4U31A 4O4WA 3VILA 3MUCA 5HR6A 3S2CA 2QCDB 2PDGA 3E2VA 4W84A 5E6YA 1PYFA 4H6EA 2Z1KA 3G1YA 3TIMA 1HJXA 4B4HA 4GXPA 1ZLPA 3JUGA 2TSYA 1NF7A 2ONEA 1GVEA 3A5FA 1FH8A 1SZEA 4HSHA 3HZ3A 2ACSA 2VMFA 2X1IA 3I7RA 2IXVA 4PRTA 3SGZA 2Y8VA 2BY3A 3IEBA 2CITA 1K8XA 4ZB5A 2CHRA 5AKQA 5C6MA 2E9BA 4RNIA 4P8XA 1ISVA 3CUGA 2VDIA 3PM6A 3G6LA 2FDSA 4N9EA 1Q45A 1Z7AA 2AQWA 3HFYA 4DBEA 1JNDA 1UR1A 4HHPA 1AH3A 2OZ0A 2ZE0A 4MNLA 4NL1A 1OB0A 4RL3A 1K7XA 1F07A 4XKYB 3PTKA 2FZNA 4H4IA 3VD5A 2ZUMA 1R7AA 1JYWA 3MMDA 2QIIA 1JRCA 3WDRA 1KV8A 4HU3A 2RAGA 2O56A 2RDTA 3TUUA 4UTHA 4Y9PA 2BNJA 1GW1A 4P7OA 1V51A 3H8AA 2PFHA 1I0BA 5SWUA 1W1YA 3GKAA 4XAYA 3ARUA 2WHJA 3CO4A 5JVLA 3PY2A 1R3WA 1L2UA 3M5XA 3AS0A 4BHYA 3B4UA 2PWHA 1FWAC 4E2BA 3CT7A 5JBEA 3W29A 3N2XA 3MU7A 3T40A 5AHEA 2HK1A 1TFVA 4KCWA 2UBPC 2OKOA 4FNPA 3QZ6A 2Z2AA 1TWIA 4W7UA 4Z1CA 3UR7A 1IXQA 4AEOA 5FF7A 4XD5A 4RNJA 3HJZA 4JTJA 1XR2A 1XYLA 2RGMA 4DJDD 3RJXA 3QHMA 3O6DA 1FWDC 3XISA 5EA9A 2TYSA 4INFA 2BLEA 3PF3A 3NPWA 4A3UA 3INPA 4TMCA 3AS3A 2WVVB 4IIEA 2QCMA 3W1QA 1W3TA 3PWAA 1W6TA 4DUVA 1DQWA 2Q3RA 1XX1A 1J2WA 1EJXC 3CUZA 3CO8A 3NOEA 3RO8A 1WX0A 4GMEA 2VVNA 2DT0A 2B0MA 3TOPA 5B80A 2R1LA 3BOLA 3I7SA 4UWMA 5K9DA 1BYAA 5AC4A 3H7RA 6XIAA 3AMKA 3S9YA 3MYOA 4PBGA 2WCGA 3H7UA 1F2JA 3DOPA 3OLGA 1US0A 4HU8A 7REQB 3AIWA 5DY3A 4RDVA 4J3UA 3GLCA 4EOUA 1F6YA 1PKLA 1UC4A 3H2FA 3L5MA 3B40A 4DWSA 3VKAA 2GDVA 3WLTA 2Y5EA 3LM3A 3M0JA 3H6OA 3KHJA 3RAOA 3WBXA 1KRAC 1NOUA 3GHSA 4PMYA 3IV8A 3R11A 4WR3A 4OVXA 4ATDA 4PMZA 2DORA 3W3OA 1P1MA 3PR2A 2CZEA 4H2CA 1KFWA 1R47A 3VZZA 4DZHA 1HZYA 5TF0A 1QI0A 3E2RA 3KWSA 2OZ8A 3LCHA 3IK2A 3CC1A 1UR9A 1E15A 2ZRZA 1EJWC 5M03A 3KCJA 3B9AA 3BTNA 2XDFA 5FAGA 5C54A 3LERA 2D2JA 1UIOA 2G3NA 4GG9A 1OK6A 1LZOA 5FD0A 4O4VA 2CW6A 3KBJA 1A0DA 1KD0A 1XSKA 4K3ZA 4FXRA 3LSBA 3QGKC 1JQVA 2D2HA 1LLZA 3KTXA 1OFRA 5DCEA 1SFTA 5XIMA 4Y96A 3SY5A 1H1YA 1RALA 3C0QA 4S3DA 5I5RA 2YB4A 3GFYA 3WH6A 3CUFA 1OFBA 4HNCA 3QLDA 5FKYA 1QI4A 4GVGA 4C90A 3FHQA 3OG3A 3UXIA 3VKBA 1NFPA 1TZ7A 3G1VA 1GVYA 3BH4A 1VFSA 2ON3A 1IWBA 2JEQA 2GQ3A 4I9MA 3W75A 4JTFA 3AC0A 4UC5A 1C8QA 2I56A 1D9EA 5G4HC 1LUCB 1W32A 4ASTA 3MV11 5CEWA 3CB3A 5AB3A 3NQGA 5EU9A 4EE9A 4F3HA 1J12A 4FNRA 2RGLA 4W7WA 4E4FA 1GVRA 4LUSB 5LKYA 1C93A 2C16A 3G8RA 2J8TA 3SB0A 2BODX 4XKMA 4X2RA 5HNUA 1RPXA 3B9OA 5JH1A 2VOTA 1EYWA 1I60A 3ABXA 1KXVA 3AYVA 3FCPA 1LLOA 3LI0A 3LQGA 3T0CA 2DP3A 4KGLA 4LV9A 2ZUUA 4K7YA 3O6CA 3VZYA 4WVXA 3V0UA 4LU0A 1WKDA 1WDWA 3QR3A 4JYEA 1TJPA 1WBJA 4AWSA 1A5BA 3UWVA 3R79A 1WZKA 1IGSA 1I1WA 1BG9A 1JCLA 1P43A 3M41A 1DKWA 4ZMGA 4GFSA 4R53A 3DHFA 4L56A 1XI3A 1D8WA 4HYRA 2PDHA 4IMFA 2YGYA 1V3LA 3MVIA 1QAPA 4QCEA 1REQB 1G94A 2J6XA 3RITA 5CPTA 2DVXA 3GDKA 1XICA 3PHAA 4IFKA 4EXQA 3VKDA 4ZEPA 1MZRA 3L0NA 2VGIA 2F6KA 2NV9A 2VZOA 3BZJA 4I5XA 4YIWA 2G96A 5D03A 4JIHA 4QG6A 2Q6ZA 1AL8A 5BOEA 3ZWTA 3W72A 4E2OA 1W9PA 1DJYA 4FMVA 2G8ZA 4WF7A 3W2MA 3DN5A 2O92A 1QOPA 4XD3A 1EJ7L 4LT9A 4C5YA 2XHYA 1B3XA 3U3HA 1VKFA 6A3HA 1HF6A 3ARXA 4QTGA 2Z1SA 4AIBA 3UYCA 1E1CB 3WEZA 4POCA 5ENLA 1Q6OA 1B3YA 1ZCCA 3T1GA 3PJUA 1MVYA 1QNOA 3WF1A 1EEPA 4XIMA 1V03A 1HTIA 3IGUA 3BC9A 4HOXA 3CUHA 1TPEA 3LCFA 2CERA 3UT0A 3AYSA 3K2GA 1H62A 4LRSA 3GNXA 4B5XA 3DX5A 5HNRA 5DBUA 4KT2A 1UD8A 1LL4A 3FAWA 3C61A 3QBUA 2XVKA 1E6QM 3GNNA 2X16A 1JDFA 3WMCA 3E49A 3HPFA 1VFHA 1XUZA 2NV2A 3W82A 3CMFA 4HA1A 4FNTA 4FNUA 1EBHA 4RW3A 3CZJA 1N8FA 2ZRWA 1HJWA 4PH6A 2H3DA 2FB2A 1CLVA 1M3UA 4WXYA 1S2CA 4RUBA 4D1IA 4AUBA 2OG9A 1K9EA 2GUUA 3ME3A 3L21A 1UP3A 4L6HA 4HU0A 1MNSA 2UY4A 4YTQA 3THDA 4KQNA 4W88A 4ROQA 3LPPA 3RHGA 2VUNA 3KBVA 5HUPA 1IWAA 3SCUA 1GQKA 3UG3A 3KCLA 4NASA 1IGWA 1CXIA 4DPQA 3DDMA 3P14A 3PTQA 3WL0A 1FHDA 4ERIA 4JPGA 4FOJA 1XLMA 1B3ZA 4JCLA 5AVHA 1JRBA 1J2BA 2ZYFA 2BVYA 5I78A 5DCBA 2OLSA 3CHDA 4NU7A 3DYPA 4ZXOA 1Z3NA 2VXNA 5BZAA 4C6LA 3ZQ9A 1V0KA 3PAJA 3W07A 4GI9A 1UPMB 1R2SA 4CD7A 4DWSB 4MAZA 4HIBA 2YA2A 3VDHA 3AROA 2W91A 2CBUA 2PDFA 3N12A 1UKTA 4BWLC 1XLLA 2R8WA 1GVSA 2EPMX 1IXPA 2CZVA 4BI5A 4C6OA 1DQXA 8CGTA 1N82A 1FWCC 1UMYA 5K7JA 1ONWA 3RJYA 4M6QA 4G8TA 3OZYA 4S2BA 5KZDA 3VINA 3PZGA 1C7SA 4LV4A 4M1RA 4ZCWA 1QHOA 2JALA 4LVDA 4ZOEA 4YWIA 2QUTA 2IKIA 5HQMA 3WN6A 3KEHA 4CQAA 2XGIA 1KGUA 2AMGA 2C1IA 3LG3A 1HJSA 4GXWA 1SW7A 3Q94A 2V5JA 1U1UA 4LAKA 3GZ3A 3WLOA 1Q6CA 4XZIA 9RUBA 1SSDA 5H8UA 4IZGA 1FWRA 2F6XA 4MNJA 4E3TA 1A50A 2BWGA 1IF2A 3WBWA 3FFSA 4C7FA 4UFLA 1KKOA 4FZIA 4DO5A 4L6OA 1NU5A 3DG7A 2PDYA 5E93A 1YE6A 1VB9A 4H01A 3MUIA 3W7EA 4FLSA 5MF5A 4DJED 2W66A 3NEVA 4C1NA 1BG4A 5KZ6A 1BYDA 2J13A 4ZE5A 1GQIA 1DWIM 2YW3A 4V15A 1X7IA 1OC7A 1FWFC 3BOXA 2J62A 1EB3A 2ANUA 2WMIA 4AZCA 4UCGA 2IQTA 3S5OA 2QJMA 1FFQA 1IEIA 1N7KA 1IEWA 3UWYA 3R8RA 3M6YA 1H49A 3USZA 3AHTA 4S3JA 1UH4A 2FKPA 2FGLA 2WZHA 5HMEA 4Q4MA 2BY1A 4QP0A 2D0HA 4AB4A 1GGOA 3CIXA 1AW5A 4D6DA 4ZGYA 5EMLA 3E0WA 4GUIA 1DWAM 3ARPA 3G8EA 4H7VA 3URNA 3QH2A 4DNHA 5LIKX 5I3FA 4WLCA 1XINA 3PUDA 3TYUA 1BWKA 2HS8A 2PTDA 2J4GA 4CNSA 4IPJA 4BJHA 3MUXA 2VFHA 5EBUA 1J0YA 1B4EA 3O6AA 4RXFA 1DIOA 3VDCA 3OBKA 4NVTA 3BLEA 2VEMA 1KTNA 4WDWA 4L4MA 1XLJA 4TO8A 3LS9A 3TAOA 2X0YA 4QSHA 4C6QA 1YDYA 3PZ9A 4OUEA 3TAKA 4TTGA 4JX4A 4B3LA 5CPSA 1OY0A 5BNKA 3PFMA 5G1YA 3GDMA 1XYAA 2VDHA 4PUNA 3QGAC 4O57A 1SO3A 3M0YA 3K13A 3LCIA 5DXXA 3R0UA 1FHLA 4YMZA 5F2MA 4JQ1A 1E9YB 1OINA 1X6NA 2R1NA 2GOKA 2D24A 4DF0A 1TG7A 2PE4A 2VC7A 4NT0A 2DT3A 2FMNA 2Y89A 2O9RA 1G01A 4LB3A 4MKVA 1E4NA 4IMEA 2ZOXA 1VFLA 4DYEA 4QISA 1V8EA 1A0EA 1R5YA 4GQBA 4V33A 4Z42C 2OOFA 3MJYA 3TQVA 3WJZA 1IT7A 1EC7A 3LN3A 2DH3A 1CXEA 2Y61A 3IAQA 3B0UX 1TJ2A 4LUTA 2GGEA 3BOFA 5AHNA 5E0FA 4EPBC 1SSGA 3OTRA 4FNQA 1N55A 5CQ1A 3PUEA 4J28A 4J1OA 3UWEA 3PZVA 4YVPA 4KFPA 1BTCA 3EEGA 3AFBA 1FCBA 3NNTA 4U3CA 4NJIA 1VPXA 3UWZA 1OQFA 1WQ5A 4DF1A 3SCNA 2ZRVA 3LTSA 2TMDA 2GVJA 3N29A 3L4XA 2VC9A 4AHQA 3SFWA 4EK7A 3VIOA 2FHBA 2F61A 3VD4A 4PMXA 3F4WA 2ZTJA 3VIKA 4H8UA 1B3OA 1N8IA 3ECQA 1PWMA 1YX1A 2W79A 3V75A 3PBMA 4JIQA 3FVDA 3M5YA 4KMQA 4UTIA 3B9EA 1LG2A 3LRKA 4L61A 1ZJHA 3EA3A 1FKWA 1PTGA 3NXLA 1Q7ZA 4LGXA 2FZ8A 5CLWA 4G5DA 1T8XA 3LHYA 3F4VA 3ZWSA 1J6PA 3T4CA 5BMWA 2DH2A 4R3UA 4ZE4A 2L5HA 1E6ZA 3E0FA 5F2LA 4YL2A 1S5WA 4WSJA 3GTIA 4Q4RA 4JFVA 2ZC8A 5FJIA 2E5BA 4DAIA 4W8LA 4JN7A 1E3XA 3WO8A 2J77A 1VJSA 4XUGA 1S1RA 2QYGA 1C3FA 1XIHA 3M0ZA 2E5CA 4FSAA 2XINA 3FXGA 8XIAA 3WK3A 2NQLA 4PMNA 5I03A 1OCJA 1MUWA 2YCEA 4KRUA 1G1YA 4J7RA 3MQTA 2YCKX 4QIUA 3I6TA 2PRMA 2DDXA 1GVIA 1K9FA 1RR2A 2ISFA 3FV9A 3T55A 1EJTC 5E5CA 3N14A 4GPNA 4A29A 4WY0B 1XH2A 3GC2A 4S2CA 3GNPA 4Q32A 1QNVA 2O9OA 3CAWA 4LALA 4OOUA 3TR9A 2VD8A 2A7RA 2Z0IA 3IIOA 4NP7A 3IACA 1KM6A 1W2VA 5H2ZA 4I9TA 1K9DA 3N15A 1K6WA 3E9AA 4L80A 3EDDA 5A6AA 4ICMA 2X09A 4CCEA 4I6VA 3M0IA 1EA0A 2WPGA 3HG5A 4JGDA 2OLHA 1CWYA 1WOBA 1HP4A 3B8UA 4MY8A 1ZJBA 3MZ2A 3MP4A 1BYCA 1DJXA 2VUYA 4ZFCA 1BGGA 3GXFA 3ABOA 1J10A 2PWUA 1UYQA 3TTOA 1XQKA 2FYMA 2NVDA 4I7UA 2J7DA 2WNQA 4C60A 3T42A 2A6NA 1HP5A 1XYMA 4BQ4A 1CEOA 3HBLA 3P60A 1L2QA 1FXQA 1VPQA 3EX2A 2QR6A 3W74A 4R34A 2V3FA 4DO6A 4M1BA 1S5VA 3P84A 2VX7A 2D2OA 2CLHA 1K8YA 1IYXA 1LG1A 3TQPA 4DB7A 4GHRA 1Q6EA 3CL6A 3TYDA 1OYBA 2IPFA 1D7FA 3E38A 3GDTA 5EFFA 4GVHA 4V1YA 3M47A 1E0XA 3L0GA 1W5PA 1FDJA 1R3RA 3K5XA 5D9OA 1TUFA 1VBRA 1Q8JA 3IIXA 2E9MA 4GVFA 1E0VA 3AHVA 3OYZA 3BMXA 3TC6A 3NL6A 4W87A 1FWSA 2DZBA 4FI4A 1AG1O 2PU1A 1P4CA 2X7VA 4IIDA 1Q5MA 3TROA 5FIPA 5FL1A 3BK0A 5AYXA 2D3LA 4DELA 1YPIA 3WF2A 4O12A 1A5AA 1QI3A 4GZIA 2C71A 3W6YA 2XM1A 2VZVA 3SUWA 4AY1A 4NZ1A 1R7OA 3EYPA 1VYSX 3SUUA 3ITXA 3KM8A 1TTJA 3LEPA 4JL2A 2EG6A 1L6SA 2UZ9A 2YLLA 4JDYA 3DHPA 2BMBA 4BK9A 5HATA 2PF8A 2FVKA 2PDKA 3WLKX 3A4JA 1R3SA 4KCTA 2FTPA 4OOZA 4WGHA 3WFAA 3PB0A 3WQ6A 7ODCA 3BAJA 3JRKA 1VZWA 4NXKA 4ZA0A 1EIXA 4JAWA 4AAJA 3GYCA 2ISDA 5D04C 3EKZA 4DXXA 1CT5A 1PZ3A 1OD0A 3EKGA 4PMQA 1SQ7A 1ITXA 1VIWA 3V16A 5G2WA 1PZ0A 3N25A 1Z8AA 1IZJA 1ODZA 4PUEA 1IEQA 5GVJA 3ALFA 2Y24A 2D20A 5CAHA 4CD5A 3K4DA 4Y2WA 3UXLA 4Y9AA 4MZ1A 3VCNA 4XV0A 2PWVA 7A3HA 3F7JA 2DSZA 2ZQ0A 3WLHA 1SR0A 2WCSA 4EAYA 1F05A 3WUGA 4QRNA 5LYRA 1A3WA 3SCWA 6REQB 1HJVA 5HJXA 4J2MA 4FALA 2IUZA 3GNDA 2VFIA 4L4LA 1GVOA 4QJ4B 1LOLA 1UR3M 1XFCA 1B57A 2XM2A 3UVIA 1I2PA 4HZMA 3VFCA 1UIPA 5E9AA 4XO7A 2XVLA 3SBFA 3WJYA 3QFEA 1Q85A 4DEFA 8A3HA 4UZSA 2X0HA 3IAPA 3RIKA 2PODA 5EPDA 4Q8MA 2EGZA 4B5VA 1MWOA 5AY7A 1E9LA 1SGJA 1H7WA 3UWWA 3ALGA <