4O50A

Crystal structure of trichomonas vaginalis triosephosphate isomerase ile45-ala mutant (tvag_497370)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
252
structure length
252
Chain Sequence
MRTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFAFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Engineering mutants with altered dimer-monomer equilibrium reveal the existence of stable monomeric Triosephosphate isomerases
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
total genus 85
structure length 252
sequence length 252
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o50A00
1WOAA 1FWWA 1JUKA 3G1VA 1LOSA 4HSOA 3GVGA 1O4UA 3LCXA 5AHNA 2Z0IA 4RZ6A 2CLHA 2ZA1A 3UWQA 5EYWA 3FFSA 3SR7A 1KV8A 3NL3A 3B05A 4NU7A 4AF0B 1B4KA 4CQ9A 3CQ0A 3F4WA 5C6MA 4UTMA 3L68A 4LVFA 4KKXA 1G4SA 3C3NA 2E5BA 1XL9A 4ADSA 4NX5A 2EKCA 2Q8ZA 3S5ZA 3W72A 2QF7A 4JX5A 2NXHA 5LNUA 4IPJA 3O6DA 4DF0A 5AHFA 5I3IA 3M0ZA 2PRMA 4MJMA 4W9TA 5G4EA 3EXTA 3QQ1A 4J9JA 4HNUA 4WJEA 1K03A 2EPHA 3BV4A 2FPYA 4FNUA 3A9IA 3PAJA 2Y88A 3G1DA 3N19B 2X30A 2GQAA 2OT1A 4O12A 1LROA 3BVJA 3EX3A 3EKLA 4KFOA 2RH9A 3E9AA 2GVLA 1NFBA 3KX6A 3TUUA 3HF3A 2ZRZA 3M5ZA 1QNVA 1WAUA 3DFQA 1TMHA 4C1KA 2X1RA 1OFOA 3NL5A 4N9EA 3SIZA 3QW3A 3W3OA 1O60A 1FXPA 2QCDB 4ADUA 5U4NA 4ZMGA 2DZVA 2CLOA 3IVTA 3BW2A 3PB0A 1HFBA 4S2BA 3GDKA 3DFSA 2Z6JA 1VYSX 4A22A 1QO5A 2NV2A 3NZRA 3MP3A 4WOZA 1I2OA 1EWDA 3C56A 1KFBA 4M7TA 4K6AA 3M47A 4JX4A 1ALDA 3D0CA 4Z08A 5HWNA 4LU0A 1W5NA 3PBYA 4O1BA 3THAA 2FJKA 4X9SA 1JR1A 1SPQA 4UTTC 4E38A 1OK4A 2ATMA 2H90A 4FEZA 3LCWA 1U83A 2VENA 2ZFAA 3OHIA 2GJLA 4HNNA 1SSGA 2B0MA 1FDJA 3KRUA 1H7WA 4BF9A 3LV6A 2YW4A 3DBPA 3FLUA 3DH7A 4GBUA 4QJ1A 3RLUA 3W2LA 4JIQA 3PC0A 4TIMA 3U6WA 5K3VA 4FF7A 2Q3OA 5DCDA 2CW6A 1SSDA 1LDCA 4EVZA 5J5RA 1JCMP 1H50A 3QEZA 5HUOA 1ICQA 5F2IA 1KLZA 4ORIA 4ADTA 1IXOA 3ABOA 1IXNA 2YDAA 1RQEA 3H55A 1MXSA 4LV4A 2Y62A 1H7XA 1RQBA 3UY7A 3W7HA 1S3HA 5DLCA 3MHFA 1RR2A 5FI8A 3OIXA 1PV8A 2ZDRA 3W86A 4UFJA 3SZ8A 5IM51 5T26A 4O16A 1ML1A 4E2DA 4EIVA 3TSDA 1RVGA 4PH6A 2B7QA 3V75A 1H62A 4OV9A 2NUXA 3M43A 1ZCOA 3U2OA 2ZZ3A 1LTDA 1GPWA 1A5SA 3QC3A 3B0UX 4FX7A 4UTIA 1MSSA 2QAPA 4H4IA 1J2WA 4GXMA 4DF1A 3GDMA 1KV5A 1FDYA 2ISSA 1YTDA 2BX7A 2VFFA 4N4QA 2CZDA 5IBXA 3QJAA 2TYSA 4BI7A 1OX6A 3W1UA 1W31A 3A21A 5LKYA 3GK0A 3M5XA 3W7OA 3TKFA 3M5VA 1XBZA 5A8GA 3SGZA 4JNMA 4Z0SA 4I7WA 3NQVA 1JCLA 3GDTA 3I6RA 3JS3A 5FESA 2B7NA 1FCVA 2YZRA 2WSQA 1SO6A 2R91A 3S5OA 2CLKA 1TV8A 5DBTA 1GVFA 3K30A 4JTFA 1B57A 2C19A 3W87A 3LCFA 4DXVA 4DPQA 2QJGA 1JRCA 5E1QA 2O7SA 4O0ZA 1VZWA 1PVNA 3S8HA 4IMDA 3W1PA 5MHBA 5D38A 5TIMA 2QJIA 3W7IA 1TYGA 3HG5A 5CPNA 1GOXA 5CPMA 3PSVA 3BGGA 5HJLA 4R33A 1N7KA 2VFGA 3IIVA 2FLIA 4JXCA 2RHGA 4IXHA 5LNVA 2ZRVA 4BI6A 2OJPA 1WA3A 2X1TA 1EA0A 1ZHAA 2ISWA 1A5BA 3UQNA 3BG3A 1FUYA 1QPQA 3VFLA 1KFLA 2Q3RA 2H3DA 2NZLA 4GUIA 5D32A 3MBDA 1BKSA 3CHVA 1ONRA 1R30A 1DOSA 4H3DA 4JYEA 3ZWTA 3L0GA 1YLVA 3HBLA 4DBDA 2ZZ7A 4CNPA 5AHEA 5SWUA 1TQXA 5EA9A 4GUJA 3ZR4A 3W1LA 1V7YA 1G7UA 5G2HA 5AC7A 5F4WA 2C0AA 5LNSA 4IUOA 1LORA 2QDHA 3U8GA 2P10A 3S42A 5D37A 3OVPA 3TQ0A 1Z44A 1TSIA 2JBMA 1JUBA 3TK7A 2QCNA 4LT9A 3P67A 2J24A 2RDUA 1W56A 5H91A 1P0KA 4UNLA 1QPRA 1TPDA 1WYIA 4MKNA 1G69A 1HO4A 4IMGA 2PRLA 2VEIA 5HUPA 3HG4A 5HWMA 3C52A 4RX0A 4IQLA 4BK9A 3M5YA 4H6KA 4JYDA 4DO4A 4O53A 5CZJA 1WDWA 1QR7A 3L0NA 4WY0A 3E96A 2AAMA 3WJSA 5GVJA 3W07A 1Q3NA 5C5YA 5C55A 1F76A 3QSTA 4JTIA 1NEYA 2Y7DA 3CM4A 4N6EA 4NNBA 4PL2A 3ELFA 1OFEA 1C9DA 1F05A 3SI9A 4QM1A 1EP1A 5LSMA 3C2VA 2XN0A 1VH7A 1FCUA 3P60A 1CX9A 1JCNA 2ZRWA 4JTTA 1EIXA 4M5PA 2FPTA 1TTQA 3S1VA 3UWVA 1QWGA 4NVTA 3GXPA 1F6KA 4NJIA 4WOQA 2C1HA 4GNJA 4GUHA 2D73A 4FHAA 4ZZ9A 3NVTA 1YDOA 1OG0A 1TQJA 4FNSA 4RKAA 4LUJA 4ZQRA 3NQ8A 1NSJA 3UPWA 4BWLA 2QUUA 3QPYA 3VKJA 3G1HA 1PE1A 2QCHA 4LVBA 4MZ8A 4O11A 4QNWA 2DZUA 3W1XA 1JQVA 1K8ZA 3ATYA 3GXNA 3MMTA 5HWJA 3LHYA 1TTPA 3LBCA 5F1UA 1D3HA 4GJ1A 5G1TA 4MY9A 5KINA 4S1FA 2PRHA 2X1SA 4QSHA 4MIMA 4M6QA 4UNKA 1RPXA 3GNDA 1YADA 3MW7A 1H5YA 1QDSA 3W7GA 3W2MA 1M6JA 3DI1A 3CEPA 5G4WA 4I9AA 3DKJA 5D02A 3NOEA 2PC4A 2CU0A 3F03K 3NQFA 1PHQA 1MO0A 1ZJIA 3O07A 2YCEA 4JTUA 2CZ5A 3UWYA 1TJRA 3RU6A 5KITA 3W22A 1EUNA 1HTIA 1ME7A 4OHQA 3SECA 4PFMA 2Y70A 5H2ZA 3P5YA 3HJZA 1VPXA 3BG9A 2CLMA 1O5KA 1Z48A 1KFEA 1NAL1 1FBAA 3M7WA 3FYOA 2JKEA 3MI3A 2DORA 4LVAA 2ZTJA 1A53A 4I7VA 4ZQNA 4XTIA 3TAKA 4FO4A 1K7FA 2ZZ1A 5KZDA 1GVOA 3FS2A 1PIIA 3ATZA 3CTLA 4UC5A 1TTIA 4PL1A 4OV4A 1UUMA 2RKXA 3PVFA 1VQTA 4K7YA 2A21A 3EWBX 3B0VC 3C2FA 3N9SA 4MZ1A 2VOMA 2Q8LA 3CIWA 4QAIA 3BO9A 3TJXA 3O1NA 2ZZ6A 4LC6A 4MOZA 3W83A 2C18A 3NGJA 2A0NA 4CCCA 5EY5A 3HGRA 3IIZA 3P82A 1W1ZA 1EP3A 2EAWA 2GVGA 1HL2A 2DZTA 3KFTA 1IIHA 2CLEA 4AVFA 3NQMA 4FIQA 2QUVA 2RDTA 2P0OA 3GKFA 2A7PA 3Q58A 3IGXA 3W1QA 3BPWA 4O4WA 1TREA 2ZZ4A 2QCEA 4LRTA 5I3KA 2CZFA 2NX1A 3GR8A 4O1AA 5AN7A 3EX1A 1EP2A 3GKAA 4E2BA 3KRSA 2EF9A 1P0NA 1H7NA 2BZNA 3W2UA 1TPEA 1I2QA 2G5WA 3DHDA 4IGHA 3STFA 3LTYA 1TRIA 1TPWA 3G3DA 1KTCA 2A4AA 2HTMA 3PS7A 5CZ0A 1R46A 4MY1A 4EOUA 3W84A 5CG7A 4WQ6A 5D03A 2B7PA 2QCCA 4O54A 4UUIA 1K02A 3HPSA 3BG5A 3DGRA 4ZL1A 4RR4A 3UXDA 3VI2A 4Q4KA 1KFCA 3N3MA 3L66A 1UUOA 1TCDA 3QMRA 4XBSA 4AWSA 5U7SA 4NQ1A 1LZOA 4D2JA 1L6WA 2X1UA 5HNRA 3HB9A 3L9CA 3CT7A 1V5XA 1GT8A 3N34A 1FWTA 3NZ1A 5AC6A 3NM1A 3GIYA 3UNDA 1RQHA 1K8XA 1ZALA 3WFAA 3S9YA 4FNQA 4QQ3A 4UTUA 3WJXA 2ABAA 1FCBA 4N9CA 2C15A 4XUGA 4PTNA 1W8SA 3PUEA 4FX8A 3GNNA 3TV8A 4UTKA 3B04A 3NPVA 4UFLA 4LY8A 3RFAA 3R5EA 3W6YA 3LERA 4RLIA 2XN2A 1QFEA 2FB3A 4XKYA 3LXAA 1MEWA 1LBMA 3S1WA 3L0KA 3TFXA 2ZRYA 3M6YA 3HPXA 2ZTKA 3UWWA 4MLJA 2OT0A 5LHFA 1K3UA 1YXDA 5K9XA 2EHHA 3M41A 1XDMA 2VC6A 3NXFA 1THFD 4OU1A 2DZWA 5TQLA 3T40A 3PG8A 3DENA 4O57A 4FNTA 5FEXA 1SO5A 1UCWA 2GPTA 5DBUA 2Y63A 1XDLA 5AHLA 3R12A 3L65A 1OFDA 2C6QA 4HPXA 4JTJA 3PUDA 4JX6A 3NDOA 3IVSA 1W3NA 4G1KA 1WQ5A 1HO1A 3IIPA 4M19A 4A3UA 1KBJA 1OX4A 4JTSA 2WNZA 2FDSA 1BWLA 3TMQA 2H8XA 2GUUA 5E93A 3PBWA 1XKYA 4A2RA 1J5TA 3TJLA 2R14A 5FF7A 3NAVA 1ICSA 2Y89A 2H3BA 3WJZA 3EB2A 3DAQA 4FNPA 4MUZA 4NZJA 3C6CA 1SU5A 5D05A 2P1FA 3W1MA 2A6NA 1R2TA 2B7OA 5AFDA 1KFJA 3O8AA 1P5BA 3NQGA 4DO5A 2EGZA 1DBTA 3MWAA 5D2WA 3MP5A 1M5WA 2Y61A 3CU2A 3GXTA 4DBEA 4XTDA 5LNRA 4OBTA 3UY8A 4MFEA 3V1PA 1FWSA 3OA3A 3QM3A 2WJZA 3NQDA 4FX6M 1W54A 5CZSA 5I3GA 5L9FA 3L21A 2WKJA 2HS6A 3KOFA 2Y7FA 4GUFA 4UTWA 1B3OA 1A5CA 4CNNA 4GFSA 4JY8A 3M16A 3TIMA 4N02A 2DJXA 1UB3A 5EKYA 2WV8A 3UD6A 1VJIA 3DFNA 2ZZ5A 2NXIA 1HUVA 3W7MA 2Z1BA 1XBYA 4KWWA 3INPA 2E6DA 3S5NA 4OT7A 1W37A 1VHNA 1TPVA 1VC4A 3CWOX 1UASA 3S5YA 3KHJA 5FEPA 4JDYA 5CZTA 4R53A 3EWYA 2ALDA 3OBKA 1D3GA 2VFHA 4KWVA 3UWUA 2B4GA 2PE4A 4LS2A 1EWEA 4N9BA 4UCGA 1ZAJA 4JICA 1GTEA 2BSLA 2Y6ZA 3TQVA 3P61A 1JUEA 4NJJA 4NT0A 1G4TA 1LCOA 3LI1A 2HSAA 1GYNA 2C16A 3PBVA 1GQNA 1VR6A 1SR9A 5D33A 4UMCA 3EX6A 2GQ8A 2A2IA 1W3IA 1M7PA 5I3JA 3DHFA 5BRBA 4NZFA 1T96A 3KRZA 4X2RA 3T7VA 3O63A 1OFRA 1O94A 3LOTA 4ICNA 1QOPA 5BOOA 3W7NA 3H53A 3MYPA 3NPXA 4K36A 4HKPA 5BMWA 1W3TA 5HMSA 1WXJA 4LS0A 3W7CA 4A29A 4DQWA 4M6VA 3VNDA 3TX9A 1X7FA 2F7FA 2WO5A 1OABA 4O50A 1FY6A 3DKLA 3THQA 1LRNA 4RZ4A 2DJLA 4QITA 1XBVA 3RK8A 4JY9A 3W70A 4NJGA 2WNQA 3LLDA 4N2YA 1RZMA 4MPQA 4HSNA 3C2EA 1KTNA 3DZ1A 3E49A 4CLMA 3LTSA 3G0XA 4N9DA 2OX1A 4JDBA 3QF0A 1G4PA 3DXIA 3KVJA 2ABBA 3VCRA 3LI0A 3W1TA 3L5LA 2KZHA 3HO8A 3G3MA 5LHEA 4MVAA 4E0CA 2ZQ0A 2QEZA 2V9DA 4UFIA 4LVDA 3WJYA 4MYAA 3KVMA 3LXCA 2E6YA 1RD5A 5K9DA 4JTKA 2DP3A 2OZ0A 4XBKA 4QNEA 3CEUA 3DFPA 3WK1A 4X22A 2YR1A 3FKRA 1LRQA 3Q37A 3W7LA 1LBFA 5EL1A 5FF2A 2V2CA 2WNNA 2TPSA 3W2JA 2CLLA 4Z1BA 1YTKA 2CZEA 3P7YA 1YDNA 2YW3A 3PBUA 4KFPA 3UYCA 1R2RA 3N2MA 3S0CA 3WK0A 1XXXA 5FF3A 2W79A 4K7VA 4PC8A 5D2YA 3LHZA 4OE7A 4RV8A 4B5NA 2R94A 3TCEA 1EPXA 3W7PA 4NJKA 4UIOA 2A6LA 1Q45A 2RDWA 2NWSA 3NO5A 4LRSA 1VCFA 2VXNA 4Y96A 5DXYA 1X1ZA 4AF0A 2A7RA 2ZRXA 5CPOA 1K7EA 3MBFA 1M7OA 3PF3A 5G2WA 1BEUA 1KFKA 3MHUA 2W0UA 2Y85A 1J4EA 3LGEA 3BK0A 3MUXA 4HN4A 4O4VA 5FF4A 2CLIA 4XQ6A 4HHPA 5HQEA 1H61A 1JJKA 3W9ZA 1W5QA 3NQEA 3PUOA 3HPZA 1W5OA 4P2VA 1F5ZA 2X2GA 1QCWA 3CWNA 4JR5A 4AAJA 1EUAA 1SZEA 2DZSA 3NQAA 1H63A 4LUIA 4QISA 3W2KA 4AEOA 1Q6QA 2ZBTA 1AG1O 4O14A 4GE8A 2HS8A 1KW1A 3LCHA 1QO2A 3LCLA 1TO3A 4LC8A 4NX0A 4M6PA 1OVDA 4LOCA 6ALDA 1X8FA 1QPOA 3W7JA 3ANYA 1B4EA 1MEHA 4O1DA 1WX0A 2E77A 3NA8A 4CQAA 4WUIA 2FQIA 3EX2A 3G1FA 3WK3A 2YSWA 4Z1DA 3W88A 3G8RA 1L9WA 1GZGA 2QCDA 1HG3A 1LP6A 3EX4A 4ZQCA 5LZLA 1SW7A 3E02A 3QZEA 1P1XA 4O1CA 4KFNA 5AOUA 1BWKA 1EX5A 2C14A 2JGYA 4N4PA 1IXQA 4JIPA 3A22A 2E5DA 3W7RA 5BNKA 3B06A 3FIGA 3TH6A 4LS1A 1OYAA 1NF0A 5AHMA 3OVRA 3PR2A 1I2RA 2NUYA 5F4XA 2XN1A 4RCXA 3GB6A 4LW7A 2QUTA 3G24A 2VEMA 3L5MA 5FEZA 5CPLA 3NL6A 5L6UA 1GJPA 1WBJA 1XBXA 4JYFA 1LM1A 1AMKA 4L4LA 3QMSA 4TU1A 5EPDA 1JCYA 2WSYA 4WX2A 4MFDA 1TPFA 3FJLA 4DF2A 4S2CA 1IXPA 1F6PA 2VELA 3NQ2A 1FX6A 3LXBA 3MJYA 4UFHA 5HINA 3MHGA 2NX3A 3O6YX 2QAFA 4JTGA 1FWRA 4JN6A 1LOLA 1JRBA 1UBSA 2CLFA 4R34A 3G0UA 2ZA3A 4XZ9A 5DCEA 3LHWA 3AO0A 5F2MA 1LRTA 2E68A 4AHQA 4WXZA 4BR1A 1TPB1 4M7SA 3NQ6A 2W6RA 2TMDA 1UJPA 1QOQA 3O05A 1QMLA 1OFAA 1F2JA 3I68A 3TSMA 3IEBA 3ABSA 2ZCGA 5KSWA 2A5HA 3HGJA 3P8IA 5AHIA 3TROA 2AQWA 1Q6RA 3A23A 3NR0A 1SZGA 3T44A 3NG3A 3N73A 3VE9A 1GVRA 3LRLA 3PM6A 1SFLA 3P74A 2J6XA 4MY8A 3SY5A 2O7QA 4GC4A 3TU9A 5F1VA 4RK8A 2CFFA 3RF9A 1I8JA 3FEMA 1R2SA 3LRKA 3QYQA 4IMEA 4LV9A 4WY0B 1KM2A 5C54A 5K9CA 5KTLA 4JGDA 3EWZA 3C0JA 5FEWA 3HGSA 5LNWA 1TV5A 3R8RA 1YDVA 4JEQA 2G95A 1XCFA 5J5DA 4K38A 2E09A 3OEXA 2QJHA 3QH2A 2YFNA 3DI0A 3TXZA 3GR7A 3HIJA 1MEIA 2NUWA 1H7PA 3F4NA 3PG9A 3GLCA 4AB4A 2OMAA 3UWZA 3R13A 3HMJG 1EEPA 1GTHA 4GWEA 4NXKA 2Y7EA 3A5FA 4XWUA 3O6CA 4UMBA 3PB2A 1VHCA 3G0SA 1YXCA 1LYXA 4GRSA 2YXGA 1QAPA 4I7UA 3LCIA 4JS3A 3G22A 3TAOA 3B0PA 3RLVA 1JCJA 1ZAHA 5G2IA 3QSRA 1E51A 3M44A 3LV5A 4AWUA 4YCPA 1KM4A 2A7NA 4O52A 4YMZA 5K7JA 3CPRA 3QQ0A 1JULA 3WJWA 1SQ7A 4O19A 1C8VA 3QFEA 3TFCA 4A2SA 1JCXA 4ZQPA 4EF8A 1XC4A 4DEFA 2RFGA 1K7XA 4WD0A 1OJXA 3TW6A 3R89A 1N55A 2VFDA 1VLIA 3ABRA 3BLEA 1KTBA 3UPBA 2GVJA 2HMCA 5AYZA 4LTSA 3LHVA 4K8EA 4UMAA 5ABTA 1SFJA 1ME8A 3LHTA 3FJ6A 3NM3A 1P4CA 3JR2A 3B03A 2GQ9A 2J9XA 1XUUA 4GUGA 1I2PA 2WQPA 2BXVA 3G1SA 1I4NA 4TX9A 4FB7A 2BTMA 1OF8A 3KAOA 1OHLA 5BMXA 3KXQA 1MZHA 1PS9A 1ZFJA 4HNVA 4YL2A 1TIMA 1GVSA 3L5AA 7TIMA 3EKZA 2V8ZA 2JK2A 3G8EA 3EXSA 3GDRA 1XM3A 3NL2A 5AYYA 3LBMA 2JGQA 1KM3A 3H54A 2GOUA 3W7QA 5DN1A 4Y90A 4UTTA 1BTMA 3L2IA 2E6FA 4Q32A 4EF9A 3EWXA 2NX9A 1DQWA 4U28A 3P80A 3TC7A 3I65A 3PSWA 4AWTA 3PWAA 4DPPA 3W2NA 4OGZA 4RJEA 4CCDA 3DFOA 2E6AA 1C29A 2QCFA 4FXRA 1LLZA 3N2XA 4O13A 4NNAA 3S1XA 3BW3A 4K39A 1RV8A 3IV3A 1A50A 3EWWA 1DKWA 3CLMA 3STGA 3W7EA 3WK2A 4CNOA 1DQXA 1IIGA 5G5IA 2J9ZA 3C61A 3T55A 1I2NA 3DU0A 4NNCA 2VFIA 4O17A 4IOTA 2VFEA 2FTPA 1KA9F 3N14A 3A24A 4N6FA 3USBA 1D9EA 1TRDA 3C2OA 3TA6A 2VEPA 2ZA2A 4JTEA 4UTWC 4TO8A 2DZPA 5C2XA 4LNYA 5HR7A 2GJNA 2JKAA 4IMCA 1OX5A 3OVQA 1F73A 1VS1A 4TMCA 3NEVA 3B4UA 1H1YA 1U5JA 3STCA 1YPIA 3GZ3A 3NQCA 4UR8A 5IBXC 2V81A 1G4EA 1N8FA 2V30A 4PCFA 1OYBA 2XFWA 3M9YA 1F7BA 2V82A 3TW7A 3VE7A 1S5VA 3M1ZA 5KZEA 5F2LA 2LLEA 3LB0A 5E0KA 4HPJA 2AGKA 3IIOA 5CSSA 1GG1A 4UTHA 4MJZA 4TR9A 5D2XA 4DO6A 1TB3A 1PCKA 5D04C 2BWGA 1G6CA 3BW4A 4NUWA 1L6YA 2FB2A 4OWGA 3TNOA 3I7SA 3MYOA 4LWWA 1Z41A 3TE9A 4O28A 3ZFHA 5CKSA 5KMYA 3O06A 3LHUA 2C13A 3W85A 4BFAA 3C2RA 5CSRA 1X1OA 3IVUA 1H60A 2F84A 3MO7A 1PL9A 3W23A 3W75A 2X16A 1Y0EA 4UTLA 5F4SA 2ISVA 5HR6A 3W1RA 4OQVA 2J27A 4CQ8A 2H6RA 3TC6A 5EMUA 2A85A 4LVGA 4UFKA 4O10A 2J88A 2PURA 3F1QA 2NV1A 4R7JA 1W0MA 1WBHA 2QDGA 3YPIA 1OFBA 4ORMA 3BGJA 4QIUA 1AW5A 4ALDA 2J9YA 1O5XA 5I3HA 4AHOA 4ZQMA 5A5WA 4FXSA 1H7OA 4K37A 1YTEA 4AXKA 5G1YA 4AMAA 3CIXA 4FIRA 1AK5A 4MZYA 1ME9A 3MP4A 5AB3A 5BW6A 3P84A 1EB3A 1R47A 1TPH1 1ADOA 1ZAIA 4YLWA 2Y7GA 3GX9A 1SO3A 1LOQA 2QCGA 1KLYA 4XKYB 1YPFA 2V2HA 1Z42A 3CB8A 5DCBA 1VGAA 4IMFA 3FKKA 3LLFA 5K2ZA 3TMLA 5DELA 3W71A 2I9EA 5F2GA 3HOJA 1XUZA 4POCA 3E0IA 3FOKA 2E1DA 1PHWA 3P81A 4MYXA 1TTJA 3NPWA 3W7KA 2ATSA 1DV7A 3HG3A 1TPC1 5I3FA 1VCGA 3QW4B 5D30A 2NLIA 1H7RA 1X6UA 2G97A 3I7RA 4WXYA 3TR2A 3W7DA 4YCOA 1GYLA 3R2GA 1SO4A 5DY2A 2G96A 4HT3A 3PY2A 4X3ZA 5AC8A 3ZWSA 2FFCA 1IF2A 4RXFA 4WZHA 3Q2DA 3LRMA 4ML9A 4K8HA 1VRDA 1WOBA 1GWJA 3T4CA 1OX4B 1Q6OA 2Z6IA 2WSRA 4IWWA 4RXGA 1OYCA 1VCVA 3PULA 3LM7A 4NJHA 1XFBA 1DJQA 3UZ5A 3B8DA 1H1ZA 4IX2A 3W73A 4JTLA 1NVMA 4PA8A 1SW0A 4UR7A 5LGZA 2YYUA 4O15A 4P61A 4ZQOA 1TPUA 3QRHA 3O16A 3BLIA 3I7QA 3BLFA 1KBIA 1GVQA 2VKZG 2DU2A 2TSYA 2WPBA 4A21A 4AH7A 2NXGA 5FF0A 8TIMA 3JRKA 1GG0A 4PEKA 3SW6A 3CC1A 4RZ5A 1AW2A 1KM1A 2DZXA 4O8RA 4U4MA 2PCQA 2UV8G 4CCEA 1VYRA 1L6SA 2WOQA 3W1AA 3KVLA 5LGXA 4IJBA 1AL7A 1SZNA 3SGUA 4BWLC 1G67A 1AW1A 1XI3A 4WY0F 3LDVA 3C8FA 1T99A 1GEQA 1OFQA 3G18A 5CGQA 5KZMA 4JTHA 4YXGA 1I45A 1OF6A 4EWND 1L2UA 1Q6LA 3LTPA 3EXRA 1AL8A 3TQKA 5AYXA 2QCMA 2CWNA 1B9BA 1S5WA 2YGYA 2A1YA 3FA5A 4IPIA 2IQTA 1YXYA 4MLRA 2ZYFA 1DHPA 3L67A 1G7VA 1T8XA 3GAYA 1ZENA 2R8WA 2ZZ2A 3IGUA 1VYPX 5K4ZA 2QCLA 3NNTA 2V2DA 1FDZA 3HGOA 4YWIA 3HG2A 2I14A 4HIBA 2YX0A 4Z1CA 3AJXA 4O18A 1WV2A 3MI2A 3G1XA 3N9RA 4BI5A 1W5PA 4Z0JA 1IGSA 1DVJA 2E5CA 3GAKA 1SW3A 3Q94A 1W5MA 3C4UA 5D2TA 2ZRUA 1CI1A 1LLWA 1PCWA 4IXXA 1DORA 3TSBA 5TBOA 1VLWA 1FQ0A 1CW2A 3O15A 3SSJA 1LBLA 2C3ZA 1SZFA 3QMTA 5HULA 2H8ZA 5EBUA 4TMBA 3UZJA 3P5ZA 3S1UA 3EEGA 3IRDA 1T0OA 3S6DA 4C1LA 3LX9A 1OFPA 5DXXA 4Y9AA 2YYTA 3QPZA 4UTJA 3TXVA 3BARA 2V0TA 3W76A 4L4MA 1KM0A 3STEA 4UFMA 4NXSA 2V5LA 3KVKA 2JKPA 3G1AA 2BLEA 1QPNA 2NWRA 2OCZA 1FXQA 2YFOA 1SUXA 1F74A 3NYZA 3ZS4A 5DY3A 3TDFA 1FCQA 2FPVA 1JQXA 1YYAA 1NF7A 3UXAA 3P8JA 2FIQA 3A5VA 3MI6A 1DJNA 3IGSA 3RMJA 4Y8FA 3NQ7A 2TRSA 3E12A 4DELA 3GYEA 4IX0A 2QKFA 1JVNA 3SFKA 1ZNNA 3LCGA 3G1YA 1DL3A 4Y6GA 4HNTA 3NPUA 3HQ1A 2I1OA 1OK6A 1KM6A 1FWNA 1H51A 5D09A 4Z1AA 3W74A 1ICPA 4FNRA 1S5TA 3ABQA 4ZVJA 3T78A 3RNDA 6TIMA 3DFTA 2QR6A 3IIXA 5K4XA 3P62A 2YPIA 2V5BA 4PODA 2Z2UA 1KM5A 3FYPA 4O0KA 4Q33A 4UXDA 3GDLA 5D2VA 3SJ3A 2VEKA 4JD4A 1TJPA 1TV7A 4AHPA 1K8YA 1O95A 3OG3A 1A5AA 3EWUA 1ZY9A 3W1NA 4ONVA
chains in the Genus database with same CATH superfamily
4J40A 3LQGA 3RCNA 3LCXA 2Z0IA 4W8AA 3ZYZA 3RLGA 3FFSA 3SR7A 1KV8A 5IOBA 4NI3A 2BY3A 3PJTA 1R0MA 4CQ9A 3CQ0A 3Q4DA 3LENA 4KKXA 2OYMA 5LIWX 2E5BA 2NVCA 4YS1A 4NX5A 2BS9A 3WLKX 3W72A 2QF7A 3VXGA 2NXHA 3LPGA 3VM7A 4LBRA 1DJZA 5C70A 1JYWA 4IPJA 4ACZA 5HAOA 3WUGA 2EBNA 3M0ZA 1PTAA 4W9TA 1VIWA 1EQPA 4ECLA 4WJEA 1E5JA 1DIKA 1K03A 3DC0A 2FPYA 4H1ZA 3G1DA 3N19B 4A8NA 3OQ8A 3BAYA 4JTDA 1JDDA 4TX8A 1NFBA 3KX6A 6XIMA 3HF3A 2FMOA 2ZRZA 5JU6A 3BAKA 1B30A 2X1RA 3VX0A 1KGWA 3SIZA 2EG6A 2QCDB 5U4NA 4ZMGA 2DZVA 1J6PA 3PB0A 3BW2A 1BF2A 1HFBA 5A8NA 3GDKA 3DFSA 3RPDA 4YHGA 3NZRA 3MANA 4L9XA 1EBGA 1KFBA 4AX6A 3MDWA 3M47A 4EPEC 4W86A 3TYBA 2X0HA 2WBGA 4HP5A 1PAMA 3THAA 4U3AA 4X9SA 3WQ5A 3BH4A 2H90A 4KF1A 4FEZA 4XVDA 3LCWA 2VX7A 4G5DA 1KR1A 3BMWA 4HNNA 2QLYA 3DYPA 1H7WA 3KRUA 4AMCA 1X6NA 3ZT7A 3LV6A 1SJCA 1QXLA 4FR1A 3ME3A 4OOUA 2WMIB 1W9VA 5I79A 1X1NA 3ISIX 5K3VA 3EA3A 3R8HA 4F0SA 2CPUA 3GH5A 5DCDA 4K1WA 5IHSA 4LUTA 2WANA 1ICQA 4U10A 3ABOA 1BXCA 2YDAA 5FJRA 1RQEA 3H55A 4GYPC 2DT3A 3RRAA 3WUEA 3BOXA 3T81A 2YZ5A 3UY7A 1RQBA 3W7HA 2QZRA 4QHRA 4K8GA 3ZLGA 1OD8A 2OEMA 2W62A 3SZ8A 3CQHA 5IM51 3TN5A 1ML1A 4MB1A 1U1JA 2B7QA 4HPGA 1MNSA 4RZBA 3URNA 3UVIA 4C6PA 4GG9A 1A5SA 3CAVA 1VEPA 4HMCA 3UESA 3GHSA 2D69A 1J2WA 2AKMA 2ISSA 4U2YA 2BX7A 3U0HA 2OQYA 2TYSA 3GW0A 3A21A 4QAWA 3GK0A 3U7VA 3GO2A 5C9XA 4I7WA 3NQVA 1RA5A 5CSYA 2W63A 4GI6A 3GDTA 5T91A 5FESA 4NASA 2YZRA 2XH7A 3CAQA 1TV8A 3VOCA 3JUGA 4TV6A 2XINA 5DBTA 4I5RA 3W87A 4JTAA 2QJGA 2OEJA 1VFLA 2J7FA 1UQZA 1UWUA 2QJIA 3W7IA 1JDEA 1TYGA 2RGMA 2VD8A 5CPMA 3BGGA 1K9TA 1RCQA 2FLIA 1M53A 3KP1A 4HTBA 3WLMA 3VPLA 4BI6A 3WLQA 1ZHAA 1A5BA 3UQNA 1YMYA 1QPQA 4GUIA 2R9RA 3MBDA 3CHVA 5A95A 4H3DA 1VBGA 3L0GA 4ICCX 3EYPA 5SWUA 2PTWA 3W1LA 1W1YA 5HJYA 5G2HA 2C0AA 1B3WA 4PUEA 2QDHA 2WVVB 3U8GA 4M1RA 4FK9A 3S42A 5H1WA 2XYLA 3RN6A 1TSIA 1LG2A 4GNVA 3VIJA 3MC5A 4D1IA 3P67A 1HGYA 2RDUA 3WNNA 1LT8A 3T9PA 4L64A 1S2TA 1G69A 1Y8BA 2GFTA 2PRLA 3LPOA 3CIVA 1K4GA 3C52A 4PUWA 3F2CA 1C7SA 2GJRA 1MUMA 4DBUA 4WY0A 3RPMA 2AAMA 1E4IA 5C55A 5A6BA 1P0EA 4NNBA 4N6EA 4PL2A 4F0KA 4Y7EA 1C9DA 1F9CA 2C0HA 2ZVRA 1NQ6A 3M0MA 4KH2A 3SI9A 3VD7A 2CHRA 2XN0A 3O9NA 1UKTA 2OQHA 4FLRA 4L56A 4KESA 3LSBA 4JTTA 1Q85A 3VIFA 1OQFA 3FGCA 1DWFM 4QXIA 1PJ9A 1QWGA 2F6KA 4GZJA 4GJJA 4GH3A 2BXZA 3CQIA 5C9WA 5A8PA 2D73A 4DZAA 4FNSA 4RKAA 1RALA 4ZQRA 3NQ8A 3TCSA 5A1AA 1GVIA 3QPYA 1O5QA 1XICA 1ZP4A 3SAZA 3BAJA 1MQRA 2OO0A 3VKJA 3KWXA 3AZRA 1V77A 4LVBA 4QNWA 2DZUA 2A3EA 4CVUA 3UERA 3MMTA 5HWJA 1TTPA 2VRKA 2WYSA 5F1UA 1D3HA 5G1TA 1TJ2A 4S1FA 1B9ZA 4JTRA 1C8YA 1E4MM 2X1SA 1UH4A 2WC3A 1B3ZA 3A6OA 1WUFA 1H5YA 2WC4A 1H0IA 5XIAA 1N8WA 2Z1XA 1ESWA 3V5CA 1YNQA 4UZSA 4HA0A 5D02A 1A3WA 2BV9A 2CU0A 4JFTA 1MW0A 3UWYA 1WPCA 1TJRA 1Q7MA 3SN1A 2XFFA 4HOWA 4PFMA 2Y70A 2NLYA 1Q8JA 3VU2A 3RDKA 4DJFD 1V8EA 5DMLA 2G3FA 4ZE5A 1PKNA 1ISWA 2ZTJA 4ZBCA 4R3UA 3WD3A 1V3KA 4D6JA 5KZDA 1P0DA 2HCVA 4DJEA 3ATZA 3CTLA 5MF5A 1A5NC 5HNUA 1UUMA 3QZ6A 2F6XA 3B0VC 1AH0A 4V2XA 3LGGA 4QAIA 5CPTA 3BO9A 4GGHA 4GQQA 4E2VA 2ZZ6A 4IP4A 1BF6A 5J04A 5EY5A 4Q4SA 3RO8A 3HGRA 2OKOA 3P82A 1W1ZA 1XLEA 1ITUA 1W3HA 3SUUA 2CLEA 4AVFA 2RDTA 1LQ0A 3Q58A 3TTQA 3AHVA 3NO1A 2VD9A 2R6OA 4IL2A 2JF6A 3GKAA 3T8QA 5CGTA 4E2BA 1OC7A 2P5NA 2BZNA 1A4MA 4L6DA 3CMFA 1MQQA 1TPWA 2BOEX 1QHPA 4A3YA 2Y5SA 3PS7A 2PDHA 5TAOA 4RUBA 3RLHA 3KOZA 4WQ6A 2VX6A 4O54A 2B7PA 2BVDA 2HZGA 3DGRA 1Q6FA 2GGHA 3JU2A 1KFCA 4ZO7A 3GU2A 2V5KA 3I10A 4D6CA 5DQPA 2DDXA 3AYTA 2HJPA 1V6VA 4HU8A 1L6WA 1VFTA 4K1GA 4Q4MA 3DUGA 1XCWA 3TN4A 2X0SA 3L9CA 3GFZA 1GT8A 3GIYA 3VMPA 4PYSA 3UNDA 5I24A 2WVTA 2PDJA 3N17A 4F2TA 2D2HA 4XB3A 4N9CA 2C15A 4XUGA 3UXKA 4FX8A 3GNNA 4LY8A 3R5EA 1QFEA 3LXAA 3WUFA 4HD5A 1PWLA 1YEYA 1B3XA 1LJYA 5H8PA 2IXUA 1DWJM 1V79A 2YLLA 5LHFA 1K3UA 4MDPA 4RE0A 2EHHA 3V36A 2DUZA 1SJBA 4LYRA 3LUTA 3PG8A 3T40A 3V4BA 1P6CA 3C3UA 4O57A 2YBVA 3SUSA 3NFUA 5FEXA 4IPNB 2VYOA 1Z7AA 2BB0A 5D9MA 3L65A 2C6QA 3KUMA 3PUDA 3NDOA 4GQ0A 1UMYA 4G1KA 4IIHA 4AVNA 4JTSA 1TZ9A 3TMQA 2H8XA 3SUWA 1LT7A 3E74A 4A2RA 1J5TA 2R14A 5FF7A 2YLAA 4H01A 1Q5MA 1ITQA 2H3BA 4KRTA 3DAQA 3EPMA 1RJRA 2POTA 4NZJA 3C6CA 1TG7A 3N4FA 4GKTA 3VABA 1R2TA 1JD9A 5AFDA 2XIOA 1F4HA 1TMQA 3B9OA 2VC7A 3S83A 5FL1A 2E7FA 3MWAA 5AC4A 3IUDA 2YA0A 3MP5A 2BMBA 4RE3A 3B9AA 3E2RA 1EO7A 4XTDA 5LNRA 4OBTA 3UY8A 4L61A 1XLBA 2W9MA 3A4XA 2BG5A 4UOZA 4F48A 4N42A 1UR1A 3ZZ1A 3R11A 5L9FA 3M46A 2OGJA 3CUGA 2QMJA 4JY8A 2HXTA 3M16A 3TIMA 3RAOA 3VO0A 5H8MA 2ZZ5A 2NXIA 5EFFA 4DO7A 1XBYA 4Q22A 4GYKA 3INPA 2E6DA 4AIUA 2VDGA 4MUPA 3GQYA 1W37A 1PPIA 4XD4A 3S5YA 1UASA 3KHJA 5FEPA 3OGSA 4NAEB 4V33A 5HBFA 3TZNA 3GE7A 1EWEA 4N9BA 4UCGA 1UOZA 2BSLA 2Y6ZA 4LPCA 3TQVA 5ABFA 4NJJA 1G4TA 1LCOA 6CGTA 3LBOA 1EXPA 2HSAA 2QVNA 1BQCA 2BXYA 3VNKA 3PBVA 3B8WA 1VR6A 2Y1HA 1GKPA 3TTYA 1UPPA 1UH2A 1ENUA 4LB3A 4UMCA 1AA1B 4XD3A 2A2IA 1W3IA 5I3JA 2XISA 5BRBA 4NZFA 3T7VA 3MYPA 2A3LA 1K1DA 1OM0A 4K36A 1FWIC 4ZODA 3FXYA 1TX2A 5HDRA 3VKKA 4MADA 4A29A 4DQWA 3VNDA 3TX9A 3W6LA 1BGAA 1QHOA 2WO5A 4CQDA 3URQA 2PI6A 1FY6A 1LRNA 3F4VA 4QITA 3H70A 1T41A 4FR6A 3W70A 4S39A 2CBVA 3LLDA 2VQUA 1KTNA 9XIMA 3E49A 3AMCA 2RGLA 2O0TA 4JDBA 3DXIA 3W1TA 3L5LA 2P0IA 5E9AA 5LHEA 1XSIA 2ZQ0A 3W38A 4UFIA 4DJFA 2E3ZA 2E6YA 1IGWA 4E2OA 2BNJA 3A9BA 3K8LA 2DSUA 3OGVA 1JZ5A 4W8LA 3W7LA 1LBFA 1WDDA 1Y7VA 1BRLB 1ZB5A 2TPSA 1I60A 4UQCA 3UYCA 1YDNA 2YW3A 4CVWA 3VOGA 2EJ1A 2W79A 1AJ0A 2FHCA 4PC8A 3LHZA 2R94A 4H00A 3XISA 5CZKA 3W7PA 4UIOA 2XVLA 2WVSA 2ASHA 3IANA 4LRSA 3N1AA 1J11A 2VXNA 5I23A 5DXYA 1VFUA 1X1ZA 4CD4A 4GXWA 1C91A 3MBFA 1M7OA 4G1NA 5G2WA 4KEUA 1ZTVA 3MHUA 2W0UA 3MUXA 5B7YA 4HN4A 4EWJA 2CESA 5FF4A 3C5QA 4PUDA 4HHPA 3VGBA 1H61A 3N2TA 1W5QA 3KE0A 3GFXA 3TYAA 4P2VA 4CU8A 4WGHA 3WN6A 3CWNA 4HYRA 4KETA 3BOFA 4BA0A 1SZEA 3SRHA 1R5YA 3NQAA 1H63A 3W2KA 4LCSA 4HA4A 1F4AA 5LYRA 4OUEA 2HS8A 5CAHA 1TO3A 3HM7A 4X2PA 5A6JA 4LNCA 1W9XA 3ANYA 4O1DA 4GLEA 3NA8A 1EDGA 1U1UA 2WMHA 3PANA 2Y8KA 3WK3A 3WD4A 4Z1DA 2JFEX 3G8RA 1GZGA 4ZOEA 2QCDA 4UB9A 1JPDX 4ZSUA 5CC7A 3EX4A 4ZQCA 2DZBA 1EX5A 3IRSA 4PMQA 1XLGA 2JGYA 4DM2A 1IXQA 4MSSA 1JAEA 1CZ1A 5BNKA 3B06A 4UNIA 5BU6A 4IICA 5AHMA 3PR2A 3H22A 1TV4A 1SJDA 4J3ZA 3ZVHB 2X8RA 3EOOA 3FYYA 3NOYA 5FEZA 3S6TA 2P50A 4JYFA 1LM1A 1RBOB 3NYDA 1JCYA 2WSYA 3SM0A 2WMIA 2Z25A 1XLLA 1DTNA 1PKMA 4UBPC 3R94A 4DF2A 1IXPA 4Y8EA 4AFYA 2DH3A 3RUBL 3NQ2A 1MXGA 4DJEC 4UFHA 3MHGA 4HHHA 4AWEA 1BYBA 2WAGA 3D46A 3T08A 3UCQA 1JRBA 4FAMA 2PP3A 5DCEA 4I5XA 1R38A 1B0IA 5F2MA 2VQTA 2E68A 3BCDA 1FWAC 5GJNA 4R7WA 5BCAA 3LM3A 1M68A 3GH4A 5BOFA 2ZCGA 5KSWA 1NJJA 3BLLA 3S9IA 3VZXA 2AQWA 3A23A 3ARPA 2YCKX 3N73A 4W4QA 3NO3A 2Z1WA 1IE7C 3PK7A 1YE4A 4XZHA 4WKFA 4CEUC 3HQPA 2BASA 3RF9A 1I8JA 4YYFA 3WNOA 2VWTA 3LRKA 4TV5A 1IZJA 4H9UA 3HGSA 2WSPA 3V0SA 3W4RA 3R8RA 4JEQA 4R9XA 3HPFA 3VTRA 2UY4A 3OEXA 2QJHA 4C7DA 3QPEA 1HVXA 4CCZA 1JYNA 3BDKA 3GR7A 4JFSA 2EXOA 3F4NA 3GLCA 4QDMA 3WDIA 2VL4A 1EEPA 1GTHA 3BLOA 4JEJA 2Y7EA 1EC7A 3A5FA 3U2ZA 3CJPA 4XWUA 4UMBA 3CMJA 5J8LA 3VNLA 2F6UA 4GRSA 1IR2A 4I7UA 1QNRA 2IPFA 1ZAHA 4E3TA 4HPHA 4PBGA 1MNZA 2JALA 4O52A 4YMZA 5K7JA 4IPLA 3S47A 4J2MA 1E40A 3TFCA 4AZBA 4EF8A 1XC4A 4O1FA 1W1IE 2RFGA 1TWSA 2VRQA 1DWHM 4AXNA 5JXQA 2WJFA 1N55A 2VFDA 5FJJA 4Q8UA 4C91A 4I3GA 2HMCA 3UETA 4GI8A 4UMAA 4ML4A 3KBNA 3KL5A 4GKLA 3NM3A 1P4CA 3POHA 2GQ9A 2Q71A 4LAOA 1XUUA 1E0VA 1ZP3A 2VZUA 3ZLFA 3G1SA 3ZXWA 1US0A 1FWGC 2XGBA 3OO2A 4DN1A 1MZHA 2WVVA 4YL2A 4H6QA 4EXAA 1MUWA 4DI9A 1XYZA 7TIMA 3WBEA 3EKZA 2JK2A 3W81A 3GDRA 3NL2A 1VAHA 2AQOA 3LBMA 1FWFC 5ECVA 4KGLA 4GPNA 1C8XA 2ZUTA 3W7QA 4L4OA 3S5SA 4UTTA 2XIBA 4CQCA 4UQBA 4UWMA 3CHCA 2FGZA 2Q01A 4DIAA 3EWXA 2NX9A 3WDJA 1DQWA 2ACUA 3N6JA 2Y4SA 3AWOA 4CN6A 1VBUA 3I65A 3W0KA 3PWGA 3AXKA 4CCDA 3CUXA 4HVXA 3N2XA 4IPPA 1RA0A 1Q7ZA 3QKEA 4ZSTA 2PU0A 1C7TA 1RV8A 1DKWA 3L4ZA 3W7EA 5LA2A 3GXFA 1HKIA 1YX1A 3EEZA 3WK2A 2OOFA 3GIQA 3T55A 1I2NA 3GVVA 3CQJA 2HRWA 2VFIA 2W67A 4F0LA 3VZYA 3TYUA 1KA9F 4N6FA 4BKNA 3USBA 1D9EA 4JHMA 1CECA 3TN6A 4FOJA 5C2XA 1QASA 4C6JA 2JKAA 4EANA 2XWEA 1KRBC 4PULA 1F73A 1YPIA 1QI5A 3NQCA 5IBXC 1S39A 3H7RA 1V0NA 2V30A 2XFWA 3UVAA 1F7BA 2Z24A 3UCDA 3VDCA 3M1ZA 1SGJA 4W87A 4S3GA 2YL9A 2LLEA 3VILA 3R0KA 5E0KA 4UTHA 3H4XA 4TR9A 5D2XA 3L12A 4PB4A 2BWGA 1L6YA 2FB2A 4FOKA 4ZO9A 2YOCA 4LWWA 5KMYA 2C13A 3HQNA 1T7LA 1FKWA 4BFAA 1X39A 3IVUA 3RHGA 3MO7A 1PL9A 3W23A 3W75A 1ODZA 4A4AA 1J96A 4U5IA 4OBRA 4F8XA 3TLQA 3WLPA 1XYBA 5HR6A 4BQ2A 1CXKA 4CQ8A 3AU2A 2H6RA 4XIAA 1W1A1 1RP9A 2G0WA 2PSNA 2VI0A 4HNLA 3TJIA 2I17A 3H4GA 3O0KA 3KHDA 2CITA 4B3LA 2BODX 4ZGYA 2YCIX 1AW5A 5C9UA 1O5XA 3I3BA 2R1MA 3TOYA 3CL6A 1UROA 1H7OA 4IQDA 4H41A 4Z2HA 3CL7A 4FIRA 3VDGA 4ERAA 1Y5XA 5BW6A 4J3XA 1VFSA 4ZB5A 1ADOA 2Y7GA 3GX9A 3M7SA 4AD5A 1LOQA 2QCGA 4WHBA 1VPQA 3EOEA 1XC6A 1TE6A 2YJQA 5DCBA 1EOKA 4IMFA 3LLFA 4HHLA 4R27A 1RJQA 4DJFC 4FLOA 3SRDA 4Q6JA 3M0YA 5F2GA 1XUZA 1A49A 4POCA 2HVMA 2MUCA 4MYXA 1Y5VA 3VZZA 4PUJA 4PUNA 3HG3A 4DZ5A 3JW7A 2NLIA 1H7RA 1DTUA 4QSFA 3WQWA 4GIYA 5DY2A 2G96A 1ISVA 4LSBA 1M9HA 4KIEA 3UG4A 3WBWA 3E0LA 1JF6A 2VCBA 3CGTA 3QV6A 4UZUA 3ARTA 3IJQA 1Q65A 1VCVA 3PULA 3UG8A 4ZO8A 3UT0A 4PSRA 2WXDM 1H1ZA 4WJXA 3B8SA 3W73A 1NVMA 4PA8A 1TV3A 4XK2A 3SCOA 4L80A 2YYUA 4P61A 1TPUA 3GU9A 1HJXA 1A0DA 2VKZG 3TC3A 2DU2A 3AROA 1IT7A 2OSYA 1J18A 4WCJA 4DZIA 1KBKA 5CJNA 1XYAA 1PWMA 2Z7GA 3SW6A 1J2BA 4RZ5A 3IK2A 1AW2A 1KM1A 3OVGA 1V93A 4R7OA 2PUZA 1JNDA 5LGXA 3GW3A 3KCLA 5I77A 3SGUA 2YXXA 1AW1A 1XI3A 4C7FA 3G5EA 1GEQA 4YXGA 1PDYA 5HATA 1NDWA 4US6A 1IEIA 2WKGA 5CH9A 3EXRA 1SVDA 4QJ3B 5GPRA 3KOXA 1B9BA 1HKVA 2W4XA 3FA5A 2G3MA 1W9BM 3U4FA 3RX4A 1TWWA 1T8XA 4GI9A 4KWUA 3WLJA 2WMFA 3GXMA 4YWIA 3WD0A 1EJUC 1US3A 2VMFA 4Q4QA 4M6UA 3A4JA 5XIMA 4B90A 4PMDA 3GC4A 1M7JA 2ALRA 1IGSA 5EMKA 3WQPA 4JAWA 4B9ZA 3CUHA 1EJRC 3W27A 2XFYA 5C7HA 3WBYA 5CEWA 3VKBA 1LBLA 1SZFA 3QMTA 2H8ZA 2EKGA 2NQ5A 3P5ZA 3UZJA 3WNLA 3EDKA 4BY3A 2VDHA 3CAWA 4C1LA 3OJGA 3LN3A 5DXXA 4H19A 3LPFA 3QPZA 3EAUA 3TXVA 3BARA 2V0TA 3OOQA 2QYGA 5FD0A 1KM0A 4DXXA 1M03A 4UFMA 4CKQA 1E5NA 2BLEA 3NZQA 1U22A 4ATWA 2ZE3A 3WH7A 3WH5A 5DY3A 3TDFA 2BBFA 4AD0A 2ZX5A 2FIQA 3IGHX 3IGSA 3RMJA 5I78A 2D0FA 3NQ7A 3E12A 4IX0A 2DFAA 2QKFA 5TD4A 1JVNA 3SFKA 1XLKA 5AZ1A 4Q4OA 4D6GA 4Q4RA 1QT1A 3NPUA 3HQ1A 4PMJA 4Z1AA 1ICPA 1S5TA 3ABQA 3T78A 1A5OC 4HK7A 6TIMA 3IIXA 3WH8A 5K4XA 1U30A 3CV1A 1XRVA 2Z00A 4K2SA 3MUZ1 4UXDA 3GDLA 5LA1A 5D2VA 4JD4A 1TJPA 5I5RA 1A5AA 1WDPA 6REQB 3M07A 2QPUA 1K6AA 3IUIA 1LOSA 3AQUA 3AS2A 2I57A 2GWGA 2CIPA 3N18A 1BG4A 4NAEA 4WR3A 4OJYA 3WLSA 1J0IA 2YA2A 3F4WA 5C6MA 4LVFA 3AS1A 1G4SA 1B1YA 2QGYA 5CC3A 3ARXA 4LAMA 1UR2A 5LNUA 2RAGA 2XVNA 1LQ2A 3R10A 1OC6A 2E8ZA 3O6DA 2UY2A 4JIHA 3D5HA 5FIPA 4F0RA 2PRMA 4MJMA 3LEPA 3ITTA 3RX2A 2EPHA 1JZ2A 2A3HA 2PGRA 3BV4A 3A9IA 2Y5EA 3PAJA 3VNIA 4OZOA 1A47A 4GCAA 2X30A 2HPIA 4M8UA 1FFRA 3MCMA 2RH9A 3E9AA 2GVLA 3GRIA 3XIMA 1G0CA 5E70A 3ZM8A 3OTRA 2GQ3A 1POJA 2VT0A 3WX7A 1QNVA 1REQB 4B2DA 4IGNA 3ID7A 1TMHA 1OFOA 2WVUA 3NL5A 2PP0A 3HQOA 1CENA 2HBVA 4ZFMA 1NWRA 2ODOA 5A6TC 2Z6JA 1E0XA 4M80A 2NV2A 1US2A 1RBAA 3JZUA 1S46A 2JEQA 4LYKA 3IK4A 4K6AA 4FLQA 4BCEA 2AAAA 3A47A 4JX4A 4NZ5A 1U1HA 1ALDA 5C2GA 2PDPA 1JYXA 4LU0A 1W5NA 1UIPA 4O1BA 2FJKA 1JR1A 4QROA 4UTTC 1EOMA 4JQ1A 2J62A 2FHFA 3WLIA 1PZ3A 2ATMA 1JZ8A 1BRLA 3M0JA 4GXPA 1SSGA 2B0MA 2BOFX 3PHAA 4HZ7A 4BQ5A 4TVDA 1ELSA 4D6FA 4GBUA 4QJ1A 1Z69A 3MV11 4DYJA 4E8DA 3WFLA 3KLKA 3RXZA 1L6FA 2CW6A 3PTMA 1KXVA 3L2MA 4LAKA 4EVZA 3ARUA 4HBKA 1JCMP 1SZRA 4ERIA 1H50A 4S23A 1IT8A 1X97A 4MNJA 4ORIA 1IXOA 4LQ1A 1HNYA 4PN2A 3DFYA 2OXNA 4Q8NA 4G2DA 4LV4A 2GYIA 1D3CA 2V69A 3PBGA 3PPFA 2Y62A 5D8WA 4QS6A 3HFYA 1LF1A 4L5ZA 1G94A 4RDYA 2CYGA 1LWJA 4GO8A 5T26A 4O16A 1I6NA 3TSDA 3BV7A 4PH6A 3OPSA 2D23A 4AZ6A 1VBHA 4OV9A 4PCNA 1QI0A 2ZZ3A 4AD4A 3QC3A 5M3WA 2YKKA 4US5D 3B0UX 3AYVA 4FX7A 4UTIA 2QXWA 2QAPA 5I09A 3KOYA 5JQ9A 3ITCA 1EBHA 1YNYA 3DBNA 5E5CA 1YTDA 3ZSSA 4BHYA 4ERGA 4I90A 3UJSA 4BI7A 4Y9MA 3W1UA 3ZJKA 1W31A 5LKYA 3M5XA 3M5VA 2AGTA 3VGDA 1XBZA 2HNEA 2J75A 1BSIA 3B40A 3GTXA 1JF5A 4PBFA 2PDQA 1CLXA 3CL8A 1FCVA 4UTFA 2E4TA 1SO6A 2Z1VA 3S5OA 2CLKA 4MHBA 2PTZA 4INFA 2REQB 4JTFA 2C19A 1JRCA 2O9TA 5CPQA 1KO0A 2O7SA 3CYJA 2J74A 1VZWA 3GWQA 3W1PA 2I5IA 2IS7A 2ICSA 5D38A 1WKFA 3ZVHA 2E25A 2XZ9A 1A5MC 3FSTA 1JIBA 2RHGA 4B4FA 5LNVA 5I07A 1XX1A 2X1TA 3QBUA 3H12A 2ISWA 3BG3A 1FUYA 3TYDA 3AS0A 1Z3NA 3VFLA 1NWTA 2Q3RA 5D32A 2OOGA 1ONRA 1R30A 1DOSA 3ZWTA 3HBLA 4C6QA 2ZZ7A 4CNPA 3T0AA 3U4AA 1AD4A 1G9HA 5EA9A 2JIWA 4GUJA 3ZR4A 3HURA 2IPJA 1G7UA 1EJ7L 3IARA 4XKMA 3IJ8A 1BLIA 1KWKA 2VCAA 5LNSA 1LORA 3PZOA 3MT1A 2NT0A 1C9WA 2NQLA 5LXEA 1UW9A 3G77A 1VFFA 2J7BA 2L5HA 3TYZA 2QCNA 2DVUA 4H8HA 3VIGA 3HPAA 3MO4A 5H91A 3V3WA 5IHRA 1QPRA 1BYCA 1TPDA 4E8CA 4MKNA 4IMGA 1L0PA 2Y8UA 1IR1A 2VEIA 5HUPA 1TVNA 4IQLA 3KP0A 3WQOA 3M5YA 4H6KA 4JYDA 2ACRA 4HU3A 4DO4A 5CZJA 3L4UA 4X60A 3SSZA 1EIBA 3CNYA 1Q3NA 1UZ4A 3ELFA 3M4HA 1QU4A 1Q2SA 2BOGX 2IKJA 1RXOB 2Z2BA 5M03A 4MWAD 4EACA 1Z9AA 4YTRA 2Z2AA 4D71A 5LSMA 1WZLA 4DJDD 5GJMA 3PUGA 1FCUA 3SQMA 1CX9A 4LXFA 2ZRWA 1ZZMA 3TW9A 1RY0A 1EIXA 4YPJA 3VD9A 2FPTA 3WLHA 2WHLA 3RGTA 1TX0A 3UWVA 4P8XA 2DVXA 3KBVA 5CPSA 1KRAC 4GO9A 1YW1A 2C79A 5C9RA 2BHYA 4GNJA 4GUHA 2IMRA 4HA3A 4W89A 1GOIA 3WDQA 2P8CA 1C8QA 4LUJA 1NU5A 4HA1A 1NSJA 1BYAA 4PMOA 2QUUA 3VCNA 4OKDA 4XZLX 1PE1A 5JH1A 3UG5A 4MZ8A 1TUXA 3H2EA 1JQVA 1K8ZA 3GXNA 4RV3A 1HVQA 2TAAA 4XSLA 2I16A 4GJ1A 2PRHA 4QSHA 4MKVA 5I2UA 4M6QA 1RPXA 5AKQA 4G7EB 1GORA 3MW7A 1QDSA 3EDJA 3W2MA 1QW7A 3ORWA 1OGGA 1DIEA 1E43A 3CEPA 3OA5A 3F03K 4JTCA 3NQFA 1PHQA 4IF2A 1ZJIA 3O07A 2YCEA 1R9XA 4JTUA 3D3AA 3N15A 5DMNA 2DT0A 1EUNA 4W7WA 3TWBA 4XZNX 6XIAA 1NDZA 4ZFCA 3SRFA 1GOMA 2FTWA 1YRRA 3CUIA 1HKKA 2CLMA 2XIMA 1O5KA 1V6UA 1Z48A 1NAL1 2DT2A 1FBAA 4GACA 1DE5A 1GZJA 2JKEA 1R3TA 4QG9A 1A53A 4I7VA 4XTIA 4S3AA 3NIYA 3TAKA 3OGRA 2ZZ1A 1K9FA 1PIIA 1S1PA 4UC5A 4JN7A 4OV4A 2OELA 2PLMA 4JHOA 2DSWA 4L6OA 4K7YA 2BHZA 2A21A 1V6TA 2V63A 3DEQA 3EWBX 3IJIA 1V4YA 4MZ1A 2F61A 3APYA 4HGXA 3TJXA 3O1NA 2FZ8A 4D8AA 4LC6A 3W83A 4XUYA 4IFKB 4QX4A 3IIZA 3WO8A 5HXMA 1EP3A 3A12A 3E2QA 2DZTA 3KFTA 4NYYA 2ZXQA 4FIQA 4IH3A 4B92A 2I56A 1I1XA 2ISFA 2NX1A 3GR8A 3H2OA 5A8OA 1IZCA 2PZ0A 2PF0A 1XIDA 2YL5A 1XYCA 1P0NA 4P8UA 1H7NA 3W2UA 2D0HA 1I2QA 4QRNA 3W00A 3AMKA 3STFA 1B54A 4JN8A 1D7KA 3LTYA 3DG3A 5A8QA 1FTXA 1KTCA 1M01A 1XLAA 1GOKA 1R46A 4EOUA 3HMCA 3V1HA 3LNMA 3OZPA 4JNYA 2QGHA 3HPSA 4IISA 1DXFA 3BG5A 5DMMA 1NDVA 4B5VA 4E6MA 2QJNA 3UXDA 3N3MA 1UUOA 5U7SA 1E6PA 4LB4A 4WSKA 2X1UA 5HNRA 5PTDA 3VNZA 1FWTA 3NM1A 3R7MA 4GIRA 2VX5A 3S9YA 4FNQA 4QQ3A 2XPKA 3WJXA 2ABAA 1SFTA 1W8SA 2P3ZA 4QCEA 3FEQA 3TV8A 3OODA 4UTKA 4GQRA 4IIGA 3LERA 1O66A 3FJ4A 1MEWA 1LBMA 4QG8A 4MNMA 4I9JA 3L4YA 3KS6A 1BTCA 1W9DM 4PMRA 3NURA 6PTDA 4MLJA 5K9XA 3M41A 1XDMA 1EKOA 2VC6A 4OOZA 1THFD 3TWAA 3PZUA 3DX5A 5I7GA 3SCTA 2X05A 1A0CA 4FNTA 2WZHA 1HL8A 1SO5A 2GPTA 4DBWA 3QXBA 5DBUA 2PCEA 3KLLA 1GKRA 3R12A 4MF4A 3WD1A 4NAFB 4J2PA 4Z2GA 2DW7A 3BAXA 4TTUA 4JTJA 3GVQA 5D9OA 1ECEA 4H2CA 3IIPA 1KBJA 3ZJ8A 1TCMA 3PJWA 2WKLA 2RUSA 2HQAA 1BHGA 3DN5A 3AJ7A 1PB0A 1QBBA 3CHFA 4REQB 3DC8A 4OBSA 4HB7A 1R3SA 1TE1A 3WJZA 3QV9A 2J78A 4ZTXA 1L8NA 2G3IA 5D05A 2A6NA 3GTIA 1ZPTA 2B7OA 1CB2A 2Z28A 1EHNA 1V03A 2QJMA 3NQGA 4DO5A 2EGZA 3MWCA 3NTYA 4AY8A 1WE5A 3CU2A 4MNLA 4DBEA 1OBAA 3QVQA 2ZWYA 5D9PA 3E2VA 4FX6M 1CGWA 2QNEA 4MB5A 4GYPA 5CZSA 3ZJ6A 1RK6A 3L21A 2WKJA 4C6LA 5I3DA 1KXTA 3H2MA 4GY0A 5KETA 1KRMA 4J4KA 3CO4A 1IWBA 3NWRA 3ZMRA 1VJIA 4IG2B 3DFNA 1HUVA 4V28A 2Z1BA 3GTFA 3LQLA 1JAKA 3B8TA 2WHJA 1VFHA 1VC4A 3BLKA 3CWOX 2OYLA 4JDYA 2FVLA 4R53A 3OBKA 4M56A 4B4HA 2PE4A 4U31A 4HCHA 4ZB0A 3EDFA 3MPGA 1JUEA 4Y9OA 2QIWA 5EMJA 2C16A 4U33A 1SR9A 1E1FA 1PKYA 5D33A 1XLMA 1J0JA 3DHFA 1PX4A 1K70A 3BJSA 5T9CE 1ZUAX 3O63A 3E6EA 1OFRA 1O94A 1QOPA 3H53A 3WCZA 1JDFA 1W3TA 2YL8A 5ABHA 4ATDA 1GQJA 4IP5A 3PPHA 4LF2A 3N13A 4IL0A 4XZWA 4M6VA 5CSUA 2DW6A 1GYMA 2F7FA 4UR9A 1OABA 1YE6A 1BWVA 3VOJA 2DJLA 3ARVA 1S38A 3TR9A 2GK1B 4N2YA 4F79A 1MRQA 3LTSA 2OX4A 3G0XA 5A2CA 2ABBA 2KZHA 3HO8A 1E4NA 3STPA 4MVAA 3ABXA 4E0CA 1UWTA 4B5XA 1KCXA 4LVDA 3OLEA 3KVMA 1EDQA 5AYIA 3UP8A 1UC5A 5K9DA 2WCAA 4JTKA 4F40A 1DWGM 3ONBA 3Q67A 1UUQA 4QNEA 3CEUA 2BY0A 1JL8A 3WK1A 4X22A 3FKRA 5EL1A 4Q6XA 1U5HA 3A3WA 2WWDA 2ZXDA 5FF2A 4PCSA 1GKQA 2WLZA 2WNNA 2CLLA 2CZEA 4LUSB 4KFPA 1XLHA 1R2RA 5FF3A 3UYIA 4K7VA 3WF3A 4PMYA 4RV8A 4XSMA 4B5NA 6REQA 1XISA 1W32A 4CN1A 4DRSA 1EPXA 4DWSB 2VR2A 4NJKA 2A6LA 1FHDA 2NWSA 2E8YA 1XPGA 3NO5A 4KBXA 3W28A 2A7RA 2ZRXA 1XW8A 4BF7A 3CHEA 1WAWA 2BGSA 1Q4WA 2FKPA 3PWIA 4CEXC 1DJHA 1DJIA 3PTDA 3UZWA 1WKYA 2OZTA 3PUOA 1F5ZA 1U5VA 1QCWA 4Z2LA 1Q4NX 4JR5A 1EUAA 2DZSA 4J1OA 4Q7NA 2XU2A 4AEOA 2ZBTA 1P43A 1OGBA 1KW1A 1QI3A 3LCHA 3T09A 4NX0A 4M6PA 1OVDA 4LOCA 3PNUA 6ALDA 5T8GA 3W7JA 3MJMA 4ZXLA 2PBGA 1B4EA 2C8NA 1MEHA 4GD0A 4Q8WA 3VC6A 1REQA 3T6CA 3G1FA 3SCSA 3K5XA 2YSWA 3OLIA 1S2CA 3PTQA 1A5UA 2PLJA 2X40A 1HG3A 1CEOA 3IJ9A 5LZLA 1SW7A 3E02A 5E09A 1R87A 3AIRA 4O1CA 4HHMA 4KFNA 5FJPA 1BWKA 2ZWZA 4PGLA 1MRAA 3QZAA 3EPNA 2RDXA 3A22A 1JZ4A 2J6VA 2E5DA 3W7RA 3CS2A 3FIGA 3URAA 1EYEA 1OYAA 4LS1A 2HVOA 5BWAA 3ERPA 3LMYA 5HA7A 4DBSA 2VEMA 3L5MA 4PMZA 4GVFA 2YBUA 3NL6A 1XBXA 4TU1A 1RHCA 3T05A 4IJCA 1W3LA 2VJXA 1TPFA 3FJLA 3W82A 1BYDA 3QHMA 4EXBA 3GD6A 4QLJA 2VELA 1J79A 1FX6A 5HINA 4M51A 4C7GA 5FAJA 1FWRA 3SJNA 1LOLA 4J27A 3SCWA 3A4AA 1UZHA 3AO0A 3SCPA 1LRTA 3BCJA 5CXPA 3FX4A 1TPB1 3BLPX 3TA9A 3GR4A 1E3ZA 4J3SA 4S38A 3O05A 1QMLA 3TQPA 3TSMA 3IEBA 3LYEA 1ZJHA 1KD0A 3DGBA 4AZIA 3P8IA 1DJWA 4LH8A 1PZ1A 3NR0A 1FP8A 3NG3A 4S3JA 3VNYA 3PM6A 4HZMA 2G41A 2PDYA 1JPMA 2J6XA 3VDBA 3BURA 2O7QA 4TUFA 1R7AA 4ZOBA 2JQXA 2CFFA 3GXIA 4HYVA 3T2QA 3GC5A 4LYPA 3H7UA 1X96A 2PTDA 1E9YB 3W02A 5KTLA 2ZIDA 1FOBA 4JGDA 3WLOA 3C0JA 3F4DA 1TV5A 2W61A 1YDVA 2G95A 2YCLB 5C9ZA 5A6AA 2AKZA 5T9BG 3FW6A 1TR9A 3EWCA 3TXZA 2OLSA 4M3PA 3HIJA 3AUJA 1K77A 3PG9A 4AB4A 3UWZA 2J4GA 5B80A 3PB2A 5DRCA 1VHCA 3PP7A 1YXCA 3MZNA 3QOKA 2REQA 2YXGA 4DUWA 2NVAA 2ZADA 4JBRA 3CZ8A 1JCJA 1VJSA 3FNDA 5BRQA 3QSRA 1E51A 3M44A 5IDIA 4AWUA 1Y5WA 3SN4A 3PN8A 5MKGB 3C0LA 2CCRA 3CPRA 1UWAA 1SQ7A 4O19A 3SQSA 1JCXA 3DDMA 3U7BA 3S46A 2PDBA 3GG1A 2VHLA 5ECUA 1VLIA 4PTMA 1KTBA 1H11A 3UPBA 2ZC8A 2EJAA 3TJ4A 5A2BA 4K8EA 1D8CA 4QJ5B 3JR2A 4D8ZA 1H49A 5GNXA 1XV8A 1I2PA 3EGJA 1HP4A 4NZCA 5BXPA 1QI2A 2BTMA 3B9NA 1OF8A 4PE8A 3LMZA 5BMXA 2ZUSA 1A80A 3GNPA 1ZFJA 4HNVA 1RD6A 1F6YA 3I6TA 1KWGA 2WWCA 1DJXA 3M6DA 5E6YA 3L2LA 2VZTA 1EZWA 4RW3A 2G8ZA 1AJZA 2GOUA 2WMJA 4WEVX 4H8NA 3AXHA 1OGSA 1RSCA 4CN4A 1PBGA 2PWHA 4CNSA 3PZNA 1NOUA 5HK4A 4MAZA 2XZ7A 4U28A 4HJFA 2ZUNA 3WENA 3P80A 3TC7A 5EMMA 4GHRA 1W3KA 4DPPA 3W2NA 2E6AA 1C29A 3B4YA 3VD4A 2DSVA 5CJ5A 4O13A 5DT7A 1V6WA 2E40A 4Q4PA 4LBUA 1JFXA 1UR4A 3STGA 3TYEA 4M82A 4DUXA 1VP5A 3GM8A 4CNOA 2WJEA 4FXJA 4ROQA 2J9ZA 3C61A 3FXGA 3RILA 4NNCA 4YTSA 1ZCCA 4O17A 2PWVA 1JGIA 2PDNA 3C2OA 1DJYA 3TA6A 5JH2A 5EBAA 3QY7A 1OY0A 3ARYA 5BOEA 2W66A 4LNYA 5HR7A 4MWAC 1EQCA 2HNHA 2XGZA 1NIUA 4DJDC 3L4VA 3B4UA 1U5JA 3S2JA 1PIGA 2YBTA 3STCA 4AG0A 1YQ2A 1HKWA 1OYBA 3M9YA 1QK0A 1ECQA 4LY4A 5F2LA 7ODCA 3VA8A 1GEHA 6ENLA 2GVEA 1AQHA 3PZMA 3IIOA 1TZZA 3RIKA 4DO6A 1PCKA 5D04C 3KW3A 4KEMA 3PZGA 4EPBC 3M0XA 2PGWA 3EB4A 4NP7A 3MYOA 4XD5A 3ZFHA 4YIWA 3SY8A 3T0TA 3O06A 4ZOAA 4GVGA 3W85A 2PWFA 3WNKA 1F3EA 4G7EA 1H60A 3VFCA 5RUBA 2HEJA 1FWHC 4OQVA 3FN9A 1OCQA 3TC6A 2VC9A 2A85A 3USZA 5EMUA 5JIPA 3QC0A 3F1QA 1JYVA 3QFWA 4DHGA 1OFBA 1E6RA 4QIUA 4PZVA 4AHOA 1TWZA 4ZQMA 3N2BA 5A5WA 1XLFA 1YTEA 4GINA 4XAFA 1Q2RA 2VCCA 4S3BA 4AMAA 4CD6A 3MP4A 3WELA 5AB3A 3LGDA 1PXGA 2DUXA 1TPH1 1ZBCA 2BHUA 3AICA 4YLWA 2PTYA 4O0QA 3DG7A 1I0DA 1SO3A 5LXXA 1TWDA 2BGQA 2V2HA 1Z42A 4W5ZA 5I6SA 3CB8A 2VEFA 1UBPC 1EGVA 1VGAA 3FKKA 4L6HA 3DCPA 5DELA 4Z1YA 2I9EA 5CG0A 3PFRA 1KQZA 4FXFA 1H5VA 3NJ3A 3FOKA 3P81A 1CDGA 1WXZA 3W7KA 4XG1A 4DWSD 3UXLA 5D30A 4GYJA 3W7DA 2G97A 4FA3A 4IFKA 3HU7A 2V5CA 4Z42C 3K4WA 3WQDA 1OB0A 5JUVA 4WZHA 3LRMA 1T6MA 1HZYA 4K8HA 4GQGA 1Q6OA 2WSRA 3BSHA 4IWWA 5LIKX 2ISDA 4RXGA 1OYCA 4RPQA 1DWIM 3ALFA 3LM7A 1XD0A 3UZ5A 1NH6A 4H9XA 3IS4A 4NRSA 1EGZA 1M3UA 4IX2A 4JTLA 1HJWA 4IIDA 1SW0A 4ACYA 1NOWA 2V3EA 5CAKA 1IQ8A 3KCJA 4Q8MA 4FSAA 3RR4A 2TSYA 9RUBA 5C8BB 2NXGA 1FHLA 5FF0A 4H9MA 1UQYA 2DIJA 3AHYA 4PEKA 2SFPA 3I6EA 3WUBA 3ALGA 4O8RA 4U4MA 3W53A 1EPVA 2ZX8A 5AC5A 1SZNA 4BWLC 2J8FA 4PUUA 3LDVA 2CEQA 3C8FA 1LUCB 3MSRA 4GNKB 3ITXA 3HN3A 1VFMA 4JNZA 5BWFA 3TN3A 1UPMB 2WCSA 1L2UA 3NDZA 3BSGA 4JQ4A 1AL8A 3TQKA 2QCMA 4O8AA 1NOFA 1E70M 1QOXA 1ZJAA 1S5WA 4IPIA 2IQTA 1RPKA 2R8WA 2ZZ2A 3IGUA 4MM1A 1VYPX 2QCLA 3NNTA 1DQUA 2QUMA 1J01A 1IEVA 1FDZA 3Q45A 2XSXA 2O55A 4HIBA 3AJXA 4GY7A 3MI2A 1J93A 3N6HA 1FRBA 3IV8A 2CBJA 2IXVA 4EAYA 4BI5A 2W27A 1DVJA 2E5CA 4B3ZA 3GAKA 1SW3A 1E6XM 2O9OA 1NFGA 4Q8QA 1R3VA 1CI1A 1S5MA 1TFVA 2EG7A 3TSBA 2OPJA 1FQ0A 3J7HA 4NAFA 5BXSA 3SSJA 1E3XA 4IJRA 2YB1A 3F5KA 2OU4A 2PDLA 4Z2KA 3S6DA 3MUCA 1OFPA 1GOQA 3S9ZA 2YYTA 2PDMA 4L4MA 1F3TA 1XJBA 2G3NA 4NHVA 3STEA 4KWSA 4REQA 2V5LA 2INZA 2PC8A 1UZDA 1QPNA 2NWRA 2CNCA 1ONXA 2OCZA 1QI4A 2FZNA 1QATA 4XZIA 3NYZA 1FCQA 2FPVA 1JQXA 4M0XA 1NF7A 3UXAA 2PB1A 5LIUX 4XD6A 2G50A 3WEOA 3L23A 4AD1A 1BPLB 1XGEA 4OFCA 1ZNNA 1J0YA 4Y6GA 3MMWA 1EJTC 1DPMA 1H51A 5D09A 1CT5A 3U2EA 4JQAA 3ZIZA 4P7RA 3W74A 1E73M 3OU8A 3WMSA 1XDJA 3WBAA 4L1WA 2QR6A 3V0TA 3U9IA 1BFNA 4Q33A 4B5TA 3UW6A 2QF8A 3AOFA 4AHPA 1K8YA 1KFWA 4IG2A 3OG3A 3TTEA 3W1NA 3AIQA 4ONVA 1O1HA 1WOAA 4I6KA 1JUKA 3G1VA 1S2UA 1P7TB 4PFHA 4MPKA 5AHNA 3KEHA 4RZ6A 3GHRA 3UA3A 4D1JA 2ZA1A 5HOSA 1BXNA 3UWQA 8RUCA 2RJHA 3NL3A 1KGUA 7A3HA 2V38A 1OIMA 3ARQA 2VGFA 1B4KA 3NSNA 1RK5A 4Q8OA 1XL9A 3S2NA 1UD6A 4ADSA 2Q8ZA 4WLCA 1PTGA 3WF2A 4JX5A 4M81A 1M04A 5BU9A 2WSKA 1W1TA 1V02E 5AHFA 5I3IA 5TF0A 3KWSA 2J7CA 5G4EA 3VGFA 3EXTA 3QQ1A 1ZQ5A 3MDUA 4HNUA 4X9YA 4OECA 1OG6A 4P7QA 3PPCA 3L4WA 3PZVA 4O1EA 1VBRA 4LBSA 2OT1A 3NDYA 1LROA 1D2KA 1Y65A 4IM4A 3KL3A 3ARRA 3BVJA 3N3TA 3EKLA 1XG4A 1C90A 1XYLA 3AIUA 1T8QA 1ZLPA 2KX9A 1MFVA 4A8RA 3UR5A 3SBFA 4X61A 4C1KA 2GK1A 1UP3A 3QW3A 3W3OA 2EPLX 4ADUA 1P6BA 4AYSA 2CLOA 3IVTA 3LS9A 4YHEA 4CGTA 1VYSX 2B81A 4A22A 2ZUUA 4WOZA 1WP6A 1I2OA 4UCFA 3UWEA 3HZ3A 3C56A 3KDNA 3CUJA 2ZXBA 1WZKA 1S5NA 3D0CA 4Z08A 5HWNA 1BKHA 3O0FA 1UD5A 4FS9A 2VURA 3PBYA 1PKLA 1SPQA 3LG3A 3K2GA 1OK4A 2RJGA 4ZXOA 4H83A 1E6SM 1U83A 3OHIA 2UBPC 1FDJA 4LUSA 4GBDA 2YW4A 3DBPA 3FLUA 3K4AA 2QJJA 3RLUA 4JIQA 1GNXA 1W91A 1J0ZA 1AQMA 1VD6A 4TIMA 4AU0A 3LA4A 3FHQA 4FALA 2XIJA 1LDCA 3V18A 3CLWA 1KLZA 2QHAA 4J28A 2O4MA 1E71M 4J3TA 1RCOB 4W93A 3ES8A 2AMGA 3UGRA 1NELA 1C92A 1MXSA 4E4PA 2BVTA 1VRXA 1GOWA 2J8TA 4HTYA 4GZIA 1H7XA 2H9AB 3UXIA 1PTDA 2ZE0A 5DLCA 5FI8A 4RNHA 1PV8A 3UU0A 1XYMA 3W86A 1GQKA 4UFJA 5H6HA 3KL0A 4E2DA 4EIVA 3V0UA 5I03A 3VMOA 1G01A 2NUXA 2OVLA 1LTDA 4G9PA 3BC9A 3QN3A 4ZE4A 3LD5A 4Q8PA 4GXMA 4WVXA 3GG7A 3GDMA 1KV5A 3ZLHA 4N4QA 1AODA 2CZDA 5IBXA 3QJAA 1HIZA 2G4JA 1UIOA 1PIFA 4XAYA 1D7FA 2WMKA 5A8GA 1Z32X 3SGZA 4JNMA 4Z0SA 2CKSA 2V67A 1F07A 3CZGA 3G2GA 3I6RA 2OSWA 1JPIA 5EU9A 1UOKA 3LY0A 5E6ZA 2IQ0A 4PUMA 2W91A 1K9EA 2YDRA 5FL0A 3QQWA 2PLKA 2YCJA 3GTHA 5E1QA 1NWUA 1PVNA 1JPKA 3S8HA 3IPWA 1Q66A 5TIMA 3UJEA 3ZJ7A 3BOLA 3RG6A 1GOXA 2BP1A 3NUKA 3SURA 3PSVA 4R33A 3OP2A 1N7KA 4FZIA 3IIVA 2CLPA 2FDMA 2WZTA 5M17A 3I4KA 4IXHA 4DZHA 2ZRVA 1QPKA 3R43A 1QNOA 1EA0A 1BG9A 1N2VA 3VX1A 2H3DA 2NZLA 1OZQA 4A3HA 3QGAC 1QNSA 1TR1A 3H24A 4GX9A 1XHGA 2CBUA 4BEQA 4JYEA 4BJHA 1TQXA 2XUCA 1TWIA 1V7YA 2HV5A 4EPKA 5AC7A 4JKMA 4IUOA 4HMEA 5D37A 3GUWA 2DIEA 3TQ0A 5EMYA 4PMUA 1QBAA 2JBMA 3WF0A 3VD3A 1ITCA 3O3RA 1GZ1A 4YNGA 1W56A 1P0KA 4UNLA 4F4RA 1WYIA 4W5UA 3VC5A 1XIMA 2CETA 3PTKA 1R3WA 4EK7A 1UD8A 2PWGA 4JIIX 3KM8A 4O53A 3WEZA 3BAWA 3VOHA 3E96A 1KRCC 3WJSA 3HV8A 3F2BA 5IFPA 1F76A 4E4FA 2OTDA 2PP1A 2YCLA 3THCA 1NEYA 2Y7DA 3B0XA 5I06A 1OFEA 3H23A 4L1GA 3N4AA 4S3CA 1B3YA 2A79A 2GJXB 1F05A 4CNUA 2I5QA 4QM1A 4YN5A 5CCZA 3C2VA 7PTDA 4AZCB 4YWSA 1VH7A 1BQGA 1E6NA 2WHMA 2HVNA 2BY1A 1TTQA 3R8GA 5E9XA 2NQHA 3TEVA 1WZMA 1EF2A 2OO6A 1F6KA 4NJIA 4WOQA 2PFHA 3BQ5A 5MKGA 1QWKA 4N0RA 4H8UA 1OG0A 1TQJA 4DLMA 4JCMA 2E0PA 3UPWA 1UHVA 2YDSA 1V3JA 2O56A 1WO2A 1XH1A 2NSOA 1XIJA 4DNHA 3WIJA 4X0NA 4W7UA 4MY9A 3BAIA 4MIMA 4UNKA 1OC5A 1YADA 1EJWC 1CNVA 2ZVIA 5AVNA 4AD2A 2PDFA 5G4WA 4EPDC 2QMKA 2Y0FA 3NOEA 2PC4A 1XLIA 4PSPA 2CZ5A 5DO8A 3O2LA 4UOQA 3M0LA 5KITA 1HTIA 2MANA 4OHQA 3SECA 5H2ZA 3P5YA 4NYUA 1VPXA 1ZS2A 3E1F1 2Z26A 4HNCA 1ONWA 1AH4A 1KFEA 3SB0A 3VGHA 3FYOA 3U48A 2DORA 4U5KA 4LVAA 1SMAA 1V3HA 1FHVA 1K7FA 4PMNA 4C6BA 4YTTA 3WMCA 1TTIA 4PL1A 4WDUA 1VQTA 2FHBA 5AYBA 5A6BD 3C2FA 2WK2A 3N9SA 5JBDA 2VOMA 2Q8LA 3QV8A 4JL1A 4GY1A 3AYSA 4CCCA 1XS2A 2C1GA 3H2NA 2DVTA 3QY8A 1ZL1A 1HL2A 4B91A 1HP5A 3FJNA 4B15A 3NQMA 2QUVA 3CH9A 3GKFA 3FY1A 4D6HA 1UH3A 3BPWA 4IIBA 1TREA 2ZZ4A 2R1PA 2PODA 5BROA 5I3KA 2CZFA 4O1AA 3W01A 5AN7A 2BFGA 3H7VA 1H41A 1MQPA 2EF9A 1VEMA 2JIEA 1BVZA 3QR3A 3ZR6A 4AZHA 1GW1A 1TRIA 1F3XA 3VVGA 1LL6A 3G3DA 4B9YA 3QHOA 2A4AA 4HQVA 3N29A 4MY1A 1QNQA 1B3VA 5CG7A 2W92A 1J0KA 3BCFA 5D03A 5IRPA 5GQBA 2QCCA 1JI2A 4UUIA 1K02A 3FVDA 3EA2A 2G3JA 3VI2A 7REQB 5JIWA 3L66A 3QMRA 1WZAA 4LYQA 3RCMA 1XINA 4NQ1A 4D2JA 2OYKA 3KDOA 3SADA 2GVYA 3ABZA 1XKJA 3EZ4A 3N34A 3V35A 1BD0A 5AC6A 5DEZA 2ESCA 2DQXA 1RQHA 1K8XA 1ZALA 4QGCA 2QW5A 4UTUA 1FCBA 4D9PA 4PTNA 1XRTA 3PUEA 1JFHA 4J3UA 3KS5A 4Q7BA 3B04A 3EBVA 2BVWA 1IWPA 3W6YA 3VMNA 2XN2A 3UJRA 3S2CA 2NSXA 2FB3A 5JBEA 5D9NA 4W7VA 1ZRQA 3L0KA 3TFXA 2D1ZA 2R24A 2OT0A 1LL4A 3DHUA 4XAZA 3NXFA 3CV6A 4OU1A 2DZWA 4Y9PA 4DJED 1XDLA 4QDPA 4L4PA 3RJXA 1F8MA 3ANUA 1VBJA 1HJQA 3V5FA 4QBXA 4HPXA 3REQB 3CZJA 1MDLA 3VK5A 1WQ5A 1IWAA 4H7CA 4M19A 1C3FA 4DWSC 2WNZA 3WQ6A 1BWLA 1R9YA 2GUUA 2F2HA 5E93A 3PBWA 1E0TA 1XKYA 2E1WA 3NAVA 2Y89A 3AU6A 4FI4A 4H9ZA 4FNPA 2VVSA 2P1FA 3SCNA 1XSKA 1R3QA 3MU7A 1TV2A 2OWXA 1KFJA 3KBJA 3O8AA 3H6OA 4F9JA 1P5BA 3VKAA 3WSUA 1E9LA 2XG9A 1DBTA 5D2WA 2DQWA 1M5WA 1GUVA 3MB9A 4DUVA 3RU8X 3GXTA 3DYOA 4HCDA 3QM3A 3NQDA 2IKIA 4OVXA 4ZOCA 1W54A 1WKDA 3K1DA 5I3GA 2X7WA 1A5KC 3FV9A 4ASTA 2HS6A 3KOFA 4GUFA 3A4WA 1LUCA 1B3OA 4CNNA 3XINA 4GFSA 2D0GA 2DJXA 1UB3A 5EKYA 4P8WA 2WV8A 3UD6A 5HJXA 4I9TA 2R1LA 1CLKA 1KKRA 3QTPA 1ZJBA 3EA1A 4YVPA 2VWSA 2DGAA 1IEWA 3S5NA 4ZA0A 3C2YA 1TPVA 1CGVA 3W26A 5HNNA 5CZTA 3EWYA 2ALDA 4ENLA 1LL7A 1D3GA 2VFHA 3LZ5A 4KWVA 2B4GA 3UWUA 4LS2A 3HV9A 1ZAJA 4C6CA 2AL1A 3BLDA 4M29A 1FFQA 3LI1A 1HN1A 2PPGA 2HK1A 2R1KA 4ZTYA 3WNPA 3EX6A 2GL5A 4ZENA 1M7PA 3GBDA 4JHZA 4X2RA 1E72M 3KRZA 4YU1A 3ANVA 1KC7A 5BOOA 3W7NA 1BSLA 4MJ2A 3RM8A 1V02A 1UWQA 3CTTA 1X7IA 2IKGA 4TTGA 5BMWA 5FCZA 9CGTA 1J10A 1O1ZA 4LS0A 3W7CA 3W24A 1W9UA 3CBWA 1X7FA 3K8KA 3RO6A 3R0UA 2A3BA 4PTDA 3THQA 4RZ4A 1EHAA 4CU7A 3RK8A 4BF5A 1DWAM 1K8CA 4MPQA 1QVBA 4HSNA