4O50A

Crystal structure of trichomonas vaginalis triosephosphate isomerase ile45-ala mutant (tvag_497370)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
252
structure length
252
Chain Sequence
MRTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFAFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title Engineering mutants with altered dimer-monomer equilibrium reveal the existence of stable monomeric Triosephosphate isomerases
rcsb
source organism Trichomonas vaginalis
total genus 85
structure length 252
sequence length 252
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o50A00
1WX0A 1K03A 3LOTA 5GVJA 1H61A 1LDCA 4UMBA 1SFJA 3PVFA 4R34A 5D32A 3W7QA 3Q58A 3CT7A 4X2RA 1XUZA 1R2TA 1JCYA 3G1DA 3GB6A 3LCXA 3TMLA 2CZFA 1MEIA 1VCVA 3EX1A 2CW6A 1VS1A 3LLDA 3NEVA 4A22A 2XN1A 3IIZA 2C6QA 2QCFA 1TPB1 3O63A 3ABRA 5AYZA 2VC6A 5HUOA 1AG1O 4J9JA 3MJYA 4MY8A 4XUGA 1O5XA 5HMSA 5F2IA 1R47A 1S5VA 4RKAA 2ZRXA 1FCBA 2DZVA 4O16A 4AHPA 5HWJA 3W74A 2G95A 3M41A 1KV8A 1XUUA 1LROA 4WY0B 1Z44A 4IOTA 3NQGA 4GNJA 3CIWA 5LNSA 1H63A 4EVZA 1OX6A 2C13A 5AHMA 2CZEA 5MHBA 3DZ1A 3EKLA 5D2VA 2R14A 1A5AA 3DH7A 3LDVA 1WOAA 1AW1A 3IRDA 2VFHA 3CPRA 4LU0A 3LX9A 4FB7A 2E77A 4OBTA 1GZGA 3W73A 2ABBA 1SSGA 1YLVA 5FEPA 3TV8A 2BZNA 2X16A 2Y61A 2YW4A 4MZ1A 3AJXA 2Q8LA 2C19A 1BTMA 1OYAA 2CLFA 2D73A 1FX6A 3F4WA 4JX6A 3E12A 4O12A 4N2YA 3S1UA 3TH6A 3W3OA 2PRMA 2ZRVA 1A50A 2VFEA 3NR0A 4O1BA 2JGYA 1GWJA 1TSIA 4JTTA 3N2MA 2JBMA 3M6YA 3STFA 5I3IA 3NQ2A 3I68A 1RV8A 2ZFAA 5LZLA 1FUYA 4WXZA 3DKJA 1VPXA 5TQLA 2E6FA 4M6VA 5D04C 1Q3NA 3MYOA 4BK9A 1OFAA 3TJXA 4LVFA 3HIJA 4Y96A 2FLIA 3IIXA 3PR2A 1KM4A 1CI1A 1DORA 3DFTA 2GJNA 4Y6GA 3HO8A 4LS2A 1K8YA 5D2WA 2Q3RA 2WJZA 2RDWA 3EXTA 4DPPA 2CLMA 3M7WA 1KTCA 3W2JA 3STGA 2YFNA 4OHQA 1XCFA 1ADOA 4RLIA 3ATZA 2Z6IA 5EY5A 3IIVA 4IQLA 2W79A 2C14A 1KTNA 1O95A 4DO4A 3FFSA 4TIMA 2GVLA 1AW5A 3C56A 4GUHA 1IGSA 4JY9A 2PC4A 4Y8FA 3G1VA 3KVMA 4LRSA 3B04A 2ISSA 2NXIA 4JEQA 5HR7A 1XXXA 4MVAA 1ZALA 3BK0A 4Q32A 1OFBA 2A2IA 3EXSA 1HO4A 3W22A 4HNVA 3S5YA 3QMSA 3QQ1A 2A21A 3GAYA 2QCGA 1I4NA 2Y89A 4LC6A 1KFJA 3G8EA 3O07A 4O28A 3NAVA 2CLIA 3NL6A 3N19B 1J5TA 4M7TA 5HULA 2Q8ZA 3P8JA 5AHLA 3GYEA 4OE7A 4HT3A 2Y70A 1NVMA 2XFWA 3PY2A 3N73A 2HS8A 1VRDA 4OV4A 4QNEA 4DF0A 1MEWA 4UTJA 4EF8A 2ZTJA 4MIMA 4QSHA 2YX0A 3IVUA 3I7QA 4DEFA 4I7WA 3BLIA 3O06A 1N55A 3FA5A 1IIGA 1TYGA 3SGZA 2TSYA 3CEUA 2TRSA 1YADA 3GKFA 2WO5A 1UCWA 4CCDA 5CPLA 1I2RA 4IXXA 2X1TA 1VC4A 1B4EA 1WA3A 3TW6A 5BW6A 1GEQA 3GKAA 5AYYA 3SR7A 3HG4A 2R91A 4UTMA 3KRSA 3NPUA 5G2IA 3QQ0A 3FKKA 4FNRA 3W1RA 1PS9A 3QJAA 3C61A 4O0KA 2RDUA 4PODA 3GNDA 4MJZA 3LERA 2BLEA 3SZ8A 3G1HA 3EWXA 2BSLA 5EPDA 3TQ0A 3CC1A 2VEIA 1KM2A 3TDFA 3IV3A 4TX9A 4Q33A 1L6YA 1JULA 4O54A 2F7FA 3R5EA 3GVGA 3M47A 4MLJA 1LBMA 2PCQA 3UD6A 5D30A 3S5ZA 3A21A 3S42A 1BKSA 3W7GA 3SY5A 1OJXA 1VCFA 4MUZA 1P0KA 3USBA 3ZWTA 2WQPA 4NJKA 3QH2A 3NNTA 3RK8A 1TMHA 2E5BA 3LTSA 2YW3A 3P67A 4BI7A 1VH7A 1B3OA 3LRLA 1QPOA 4UUIA 3O15A 3T44A 1I45A 2GVGA 4N4QA 2CLEA 5K3VA 4HSNA 4LOCA 1GVOA 4RXFA 6TIMA 3N9SA 4K8HA 2E5CA 1XC4A 2Y88A 2DJLA 2KZHA 3LHZA 1SO3A 2QCDB 2VFGA 3MMTA 2E09A 3MHGA 4CNPA 3F4NA 3A23A 2WNNA 1I2QA 1XKYA 4EIVA 3L65A 1XBVA 1VLWA 1W0MA 3G1SA 5F4SA 4XQ6A 2WOQA 1UUOA 4JTIA 3HF3A 1MEHA 3IGXA 2J88A 2X1UA 1TO3A 1WOBA 4AXKA 3W6YA 1S5WA 2NUXA 4IXHA 4P61A 4RZ5A 1GYLA 4TO8A 2GQ9A 5A8GA 3WJYA 3PG9A 4MPQA 1QNVA 2QKFA 5FF4A 2E6YA 2H3BA 5BNKA 5F4XA 3FLUA 4AEOA 5D02A 5HWMA 2Y7EA 1EIXA 1H62A 3MBDA 3G24A 4O50A 5CZSA 4XTDA 4DXVA 4GJ1A 1H7OA 3ATYA 3C2RA 5FF0A 3LB0A 4HPJA 3M5ZA 2NUWA 4YCOA 1W5MA 3IEBA 1YXDA 4A2SA 1V7YA 3B06A 5CKSA 3PBWA 1L6SA 1BEUA 4UMAA 5AN7A 3UZJA 2YDAA 3W2UA 2ZA1A 1CW2A 3NM1A 5BMWA 1GTHA 1TPH1 3BG5A 4HIBA 5HQEA 4NQ1A 1EA0A 1K7XA 4E38A 3TQKA 3QEZA 2A6NA 3NQ8A 2DJXA 1LYXA 4Z0JA 4JTHA 4IMGA 3PUOA 3CU2A 3UNDA 3MW7A 1ZY9A 3HGJA 3VKJA 3L68A 2V2CA 2VEMA 4IMDA 3C8FA 2FIQA 4YXGA 1B4KA 2E6DA 3NO5A 2ZZ2A 4UFLA 1QFEA 1TQJA 2YXGA 1KFCA 4O18A 5IBXC 1IXNA 3IVSA 4PTNA 3WK2A 3VNDA 5CZJA 3QW3A 1THFD 4XBKA 1LOLA 1KFKA 1YTDA 2H8ZA 3NXFA 4HSOA 3PSWA 5D37A 1GVRA 2B7NA 1K02A 2A5HA 3F1QA 4X22A 1DL3A 2YPIA 3G1AA 5CGQA 4IMCA 4JDBA 2V5BA 3H53A 5D38A 2YYUA 4R33A 4RJEA 3W86A 1WYIA 4AHQA 3T40A 1TV5A 2CWNA 2QJGA 4AHOA 4DO6A 2JK2A 3EXRA 2NX3A 1W5QA 4O0ZA 1G7VA 1OFPA 4BF9A 4ZZ9A 3W83A 1G67A 2E6AA 3PAJA 2ZZ7A 5K9XA 4PC8A 4LVAA 3QYQA 4MZYA 5DELA 2VOMA 2A0NA 1FY6A 1TQXA 5F2LA 1GOXA 4K7VA 4O1CA 1DQWA 3FKRA 3BPWA 2VXNA 4BWLA 4JTSA 2C15A 1QR7A 4MLRA 1O4UA 2DU2A 5U4NA 4M7SA 3BV4A 1P1XA 3W7DA 2QUUA 2QCLA 2RHGA 4I7UA 1MXSA 3GDKA 3O1NA 1LBFA 3R12A 4IJBA 3EWZA 3PM6A 5E0KA 4UFKA 4LY8A 2P1FA 3O8AA 3U2OA 2RDTA 1Q6RA 1F74A 2I1OA 5J5DA 5F1UA 4D2JA 3C6CA 1P0NA 4MZ8A 3QPZA 1K7EA 1PV8A 4NJHA 4UTIA 5FEWA 1YDOA 1W3NA 1FWTA 1NSJA 3C2VA 3N9RA 5KZMA 4GBUA 3M43A 3W1MA 2HTMA 1W1ZA 2Z1BA 4QIUA 4GE8A 2YYTA 2GQAA 4JTGA 3PF3A 2CLKA 2PE4A 1HFBA 2QF7A 4MFDA 4ONVA 3O6DA 4EF9A 2YSWA 1VR6A 3W1QA 4S2BA 3TFCA 4Z1DA 3U8GA 1KLYA 3B0VC 4AF0B 1QPNA 3TFXA 3UWVA 3TSMA 3M5XA 1U5JA 1KM0A 1WXJA 3LCHA 2Z2UA 1R30A 2V82A 1H7PA 3PBVA 3B0PA 4N6FA 4LS1A 4GUJA 1R46A 4WX2A 4YCPA 1O60A 1VZWA 1OFRA 1G4EA 4ADTA 4UMCA 3TMQA 1LP6A 1R2RA 3LBMA 4JX5A 5T26A 2V81A 3P60A 3KVLA 3E9AA 4U28A 3QZEA 3S9YA 4HN4A 4HNNA 2XN0A 2OJPA 4LVGA 1ZCOA 5L9FA 3L5MA 2A7RA 4JTLA 3TC6A 5K9DA 1JCMP 2QJIA 2JGQA 2ABAA 3JRKA 1TCDA 3MI2A 1VYPX 1GQNA 1IXPA 2GOUA 2NWRA 4AAJA 2P0OA 3BG9A 3KFTA 1U83A 2ZZ6A 1TB3A 1WQ5A 2X30A 1X1OA 5F1VA 2NV2A 1NEYA 3C2OA 4UFJA 2OT1A 3UZ5A 5D03A 5AFDA 3HG3A 5FEZA 3LCWA 2PRHA 4LUIA 5EKYA 1ME9A 3W87A 4JTKA 4CQ9A 4MJMA 4NU7A 2QCCA 1DKWA 1RQEA 5DBUA 3TKFA 2VFIA 2WNZA 4RK8A 1XM3A 2DORA 3A24A 4BWLC 4HHPA 1SW3A 3G1YA 4JICA 3SW6A 1LLZA 3SJ3A 1H5YA 2QAPA 4O1AA 1LORA 3DXIA 3LXCA 3KVKA 4FNPA 5HUPA 5CPOA 4UXDA 3UYCA 4NXKA 2VELA 2TMDA 3W76A 3NA8A 1AL8A 1OABA 1MZHA 4UIOA 1JCLA 3V1PA 4Z08A 2NZLA 4K6AA 2JKEA 4OQVA 1TPDA 1XDLA 2EF9A 3OIXA 1GT8A 3MO7A 3PS7A 3UWQA 3B8DA 4GUIA 3NGJA 3IGUA 4A21A 1QPRA 3GLCA 3KRZA 4UTTC 3W2NA 1PHWA 2J9ZA 4O11A 5DCBA 3P81A 1KM5A 1R2SA 3L0GA 4WY0A 5E1QA 5LHEA 1UUMA 1SQ7A 3H55A 2CLHA 1PCWA 3TJLA 1LRTA 4TMCA 3QMRA 4ZL1A 1TPC1 3ABSA 3NDOA 5C5YA 4GWEA 5ABTA 3W7HA 2J27A 5AC6A 3M44A 3BO9A 3B03A 3W75A 1NF0A 5D33A 3M5VA 4IGHA 3STCA 4P2VA 4FIQA 3LI0A 3EEGA 4WD0A 4S1FA 3W2LA 3NZ1A 5AB3A 1KM1A 2WPBA 3RU6A 1OFQA 5E93A 1T8XA 3AO0A 3SI9A 3S1WA 1O94A 2B7OA 4AH7A 3QF0A 4I9AA 2WSQA 2OX1A 4CLMA 1QOQA 4LTSA 2X2GA 4QAIA 1J2WA 4Z1CA 2ZYFA 1M7OA 1LBLA 3MP3A 4LNYA 5C54A 5A5WA 3P5ZA 4GC4A 4IMFA 3PSVA 3QW4B 4XKYB 3CQ0A 3G0XA 1YXCA 4OGZA 3OA3A 3O16A 2FB2A 1OK6A 1UJPA 5K7JA 1MSSA 4AVFA 1FWRA 3TIMA 3NL3A 2OMAA 1HTIA 3EX3A 4Z1AA 7TIMA 3NYZA 4FF7A 3HGSA 1X8FA 1L6WA 4GUFA 1OYCA 4PFMA 1W37A 3NOEA 2WSYA 4RR4A 1TTPA 3W1TA 1NFBA 2B7QA 2NX1A 1LRQA 1OK4A 1D9EA 3VCRA 1VYSX 4NXSA 4FX6M 1KW1A 3HOJA 1LOQA 4JDYA 2E68A 2V0TA 1FDJA 4CQAA 5AHIA 4U4MA 4W9TA 3RFAA 1F7BA 2J9YA 3UPBA 5AC7A 4A2RA 4MOZA 3TR2A 1JCNA 1UASA 3CWOX 4JYEA 3OVRA 1LTDA 1JQXA 3VE9A 1TV7A 1JCJA 3UWZA 1ZFJA 5LKYA 1F5ZA 2AAMA 1HG3A 3D0CA 3W7NA 4PEKA 2CLLA 4FXSA 4BI5A 3C4UA 5LGZA 1RD5A 1KFLA 3LCFA 3KVJA 3EWBX 3T4CA 1FBAA 1H7NA 1MO0A 3C2FA 4QM1A 3CB8A 3G3MA 3EKZA 1ICPA 2LLEA 5FF3A 3U6WA 1PCKA 2IQTA 1I2OA 1LLWA 4CQ8A 2A7NA 3LHVA 3NQDA 3MP4A 1TTQA 4R7JA 2Y7DA 3DU0A 1S3HA 5DXYA 1ICSA 1FWNA 1SUXA 1TPEA 1C8VA 1A5SA 4WQ6A 4ADUA 4HKPA 4E0CA 5LNUA 3MBFA 2V2HA 3IIOA 1XFBA 2VEPA 1WAUA 1TPWA 1GJPA 3NG3A 1P5BA 1DVJA 4TR9A 4O8RA 5DLCA 4RZ6A 4CNOA 3QPYA 2QR6A 2ZZ5A 1A5BA 2ISVA 2Y62A 2ZA2A 2A7PA 5FESA 4K7YA 3THAA 2VEKA 3B0UX 1RQBA 3PG8A 3KAOA 3P80A 3E02A 3I6RA 2ALDA 3Q2DA 1KM3A 2Q3OA 5H91A 1H1ZA 3BGJA 3OG3A 1ML1A 3FS2A 1F05A 3WK1A 4K39A 5C6MA 5G1TA 4R53A 2YCEA 3HJZA 3OVQA 3C52A 3EWUA 5EYWA 1KBJA 8TIMA 2J9XA 4MY1A 4UNKA 4PH6A 3W07A 5K4ZA 3SSJA 1QAPA 2C16A 3L0NA 1YPFA 4BFAA 4UTKA 4JN6A 5AHFA 3LV6A 1HUVA 3EWWA 3B05A 5DY2A 2I9EA 4OV9A 2FTPA 4LVDA 1SW7A 3W2MA 2BXVA 2OCZA 1YYAA 4L4LA 4QQ3A 4DO5A 3EX2A 5DXXA 3SIZA 3PWAA 4A29A 5I3JA 3W23A 3GNNA 1XDMA 5F4WA 3FOKA 3N14A 2QCDA 1W54A 1T0OA 3CEPA 3QM3A 3TAKA 3HG2A 4E2DA 3UPWA 4ORMA 4FXRA 2ZRWA 1X7FA 2EKCA 2QUTA 1L9WA 3R13A 1ALDA 1Z42A 1ONRA 4JIPA 4Q4KA 2GPTA 6ALDA 2Y63A 1KV5A 3FJLA 5KZDA 4IX0A 4X3ZA 4XWUA 4ZQRA 4PL1A 1SPQA 4O19A 5D05A 2C0AA 1DBTA 1FXQA 2DP3A 4DELA 3DFSA 1SU5A 4DBEA 4UTWA 5G4WA 3MHFA 3ELFA 1EP1A 1ME7A 4FNQA 5HINA 1RVGA 1OF6A 3NQMA 2WSRA 4KWVA 3E49A 3Q37A 3MHUA 4YLWA 1T96A 1FXPA 4BR1A 1OX4B 2NXGA 3W85A 2VKZG 1WV2A 3W88A 2ZRUA 4KFPA 3GXTA 1XL9A 2FPYA 4AWSA 2WNQA 2YFOA 4X9SA 1HO1A 4IPJA 1TPFA 1QMLA 3T7VA 1D3GA 3S1XA 2ZBTA 3L66A 2CU0A 1G6CA 5KSWA 2QCEA 2FDSA 3BLEA 5CSRA 3PC0A 1K8XA 3TA6A 3I7RA 5AC8A 1Y0EA 4WOZA 5HR6A 1F73A 4XTIA 1AW2A 2DZXA 1A5CA 4O4VA 1OVDA 3BLFA 4NNAA 1PVNA 2RKXA 4O17A 1FWSA 2AQWA 3NQ6A 3GK0A 2ZDRA 3TW7A 1TJPA 4ZQMA 2Y7GA 3UY7A 3PUEA 2O7QA 3CTLA 3NQVA 3I65A 3DGRA 2V2DA 3G3DA 3GDLA 2QDGA 1IXOA 3NQ7A 4OT7A 2ZZ3A 1H50A 5DY3A 1H7RA 5LHFA 1ZENA 1IIHA 1G4SA 1EP2A 2NV1A 1CX9A 1VQTA 4G1KA 3ZWSA 4FNUA 5EL1A 3CLMA 4MYXA 5EBUA 3BG3A 4ZQPA 3KXQA 2XN2A 2H8XA 3R2GA 5KITA 2QAFA 1GTEA 3NL2A 2B4GA 4JYFA 4ZQCA 3P62A 3SECA 4LT9A 4IUOA 1GG0A 4IX2A 3Q94A 4NNCA 3W7LA 3SFKA 2BWGA 1W8SA 4O57A 2GQ8A 3HQ1A 3P8IA 2GJLA 3H54A 3LTPA 4C1LA 1XBYA 3A9IA 3EWYA 1SFLA 3M1ZA 3OVPA 1EP3A 3OEXA 3RF9A 1FWWA 4ORIA 3ABOA 1OG0A 1DV7A 5LNWA 4YWIA 1X1ZA 4JTJA 3CM4A 3RNDA 2QDHA 4AMAA 4KWWA 3W7IA 4DPQA 1EEPA 3VE7A 5CZTA 1K8ZA 4LW7A 5C55A 1SZNA 3QRHA 3L9CA 3WK3A 3V75A 4DQWA 3P7YA 4LRTA 1TTJA 3W1UA 5FEXA 4LV4A 1Q6OA 2A6LA 5U7SA 3WK0A 1OF8A 4M6QA 1ZAHA 3W2KA 5LNRA 2RFGA 2NX9A 3N3MA 2DZWA 5FF2A 1A53A 1OFDA 1TV8A 3STEA 3RLVA 1OYBA 3EB2A 1PIIA 3RLUA 4TMBA 2VFFA 1Z41A 3GXPA 5DN1A 5TBOA 4ADSA 5TIMA 3GDTA 1QO2A 1IXQA 1ZAJA 3I7SA 3PB0A 1PE1A 4NZFA 4K36A 4QISA 4N4PA 1KFBA 3GZ3A 2NWSA 1ZHAA 3TE9A 3QC3A 3CHVA 4DF2A 4WUIA 3P82A 5FF7A 3LHYA 1JR1A 3LV5A 1OHLA 4ALDA 1B57A 5G4EA 2Z6JA 2X1SA 2VFDA 3C0JA 1SO4A 1QWGA 3A22A 5G2WA 1F6PA 5AHNA 1TIMA 1AL7A 3S0CA 4AF0A 1GYNA 1YTEA 4JTEA 1LZOA 2CFFA 3NQAA 5BOOA 2CZ5A 4IPIA 4FO4A 4O10A 5KTLA 2GUUA 4LWWA 4O52A 2ATMA 3FYOA 3MYPA 3W7RA 3TXVA 2YGYA 2C18A 2QCHA 3G0UA 1H7WA 3IVTA 5CSSA 3L2IA 4RZ4A 3TSDA 3INPA 1YDNA 3NPXA 3W7PA 1EWDA 1F76A 1Q6QA 1L2UA 1QPQA 4NJIA 1K7FA 2GVJA 3WFAA 1M5WA 2ISWA 4RXGA 5KINA 1GVSA 1EUNA 3TCEA 5CPNA 4WXYA 3HGRA 2A4AA 4H3DA 4C1KA 4N02A 1G69A 1LOSA 4ZQNA 2UV8G 4FEZA 5BMXA 3BW4A 3LCLA 3NM3A 4OU1A 4LUJA 3QMTA 1E51A 3DFNA 2C3ZA 5D2TA 1ICQA 3L5LA 5J5RA 5SWUA 3DI0A 3LLFA 1VHCA 1YPIA 3W1AA 1W5NA 4PL2A 4AWTA 4OWGA 4UTLA 3MUXA 1JRCA 2WKJA 3TU9A 2ZRZA 1PHQA 2ZQ0A 2J6XA 1EUAA 1W3TA 1H1YA 2ZTKA 3W7EA 4A3UA 3HB9A 1PL9A 2NXHA 3DENA 1SO5A 4XBSA 3OHIA 1BWKA 2W6RA 2YR1A 4UC5A 2ZCGA 3MWAA 3W7JA 1VJIA 3LXBA 3TX9A 3W72A 3B4UA 4UFMA 4HPXA 1W3IA 2V8ZA 3MI3A 2DZSA 4FIRA 4MKNA 3QSTA 3G1XA 3UWYA 5HNRA 4NT0A 5EMUA 1VHNA 1LM1A 3W7KA 3KHJA 2NLIA 2P10A 3M9YA 4NVTA 4QNWA 1C29A 1ZNNA 5CPMA 2QEZA 3BW2A 3GDRA 4NX5A 1YXYA 3EX6A 1OFOA 1W56A 2QCMA 3C2EA 3C3NA 3LCIA 1F2JA 4Z1BA 4YL2A 2OZ0A 3BVJA 1P4CA 1WBJA 4I7VA 4N6EA 4JYDA 3TQVA 3W1PA 2FJKA 3LGEA 1V5XA 3WJWA 1QOPA 1DOSA 1AK5A 3DFPA 2I14A 3W9ZA 4DBDA 3ZS4A 1XBXA 4RV8A 3QFEA 3W1NA 4M5PA 5KZEA 2WV8A 4EOUA 3GDMA 3L21A 2V5LA 3GAKA 3GIYA 2EGZA 3HBLA 4ZVJA 4NJGA 1Z48A 3WJZA 3BARA 4UTUA 2BX7A 5C2XA 5I3KA 3WJSA 4HNTA 3ZR4A 3GX9A 5AOUA 3O05A 3S5OA 3M5YA 2H3DA 4AB4A 2EHHA 3DBPA 5DCDA 1C9DA 2B7PA 1TRIA 1ZAIA 4O15A 1YDVA 4M6PA 4PA8A 5CZ0A 1EWEA 4XKYA 3UXDA 4WY0F 3IGSA 3LBCA 4EWND 1K3UA 1JVNA 1JCXA 5BRBA 1WDWA 1TTIA 2F84A 3P84A 3N34A 4IMEA 4LV9A 3FYPA 4RX0A 4KKXA 1VCGA 2G97A 1XI3A 1KM6A 4K37A 4CNNA 3LRKA 3S5NA 1SZGA 4M19A 3VFLA 4POCA 1FCVA 1VYRA 1Q45A 3NZRA 3GR7A 4JGDA 4UFIA 3LHUA 3UXAA 2PRLA 2QUVA 3L5AA 5HJLA 1IF2A 1H7XA 4N9BA 4UCGA 1JRBA 3W1LA 1M6JA 3LM7A 1ME8A 4JX4A 3TK7A 4K8EA 3O6CA 1LCOA 4O1DA 2EPHA 5LGXA 5LNVA 4MYAA 3DFOA 4JY8A 2JKAA 4O53A 4UR8A 5IBXA 2ZZ4A 1RPXA 3E0IA 3M16A 1UBSA 2E1DA 2DZTA 4B5NA 1I2PA 4N9CA 1G4TA 4JTUA 5G1YA 3W1XA 2Y7FA 2QJHA 3PBUA 3R8RA 2PURA 1W5OA 3KOFA 1OFEA 2FB3A 2Y85A 1FDYA 1SO6A 1DHPA 3K30A 4N9DA 4TU1A 4QITA 4NNBA 1N8FA 3G22A 3SGUA 3UQNA 3LXAA 2ZA3A 2EAWA 3LRMA 3O6YX 2ZZ1A 4PCFA 3RMJA 1QO5A 3LTYA 1JUEA 2VENA 4JTFA 3S8HA 5G5IA 1GG1A 4ZMGA 4XZ9A 5I3GA 1DJQA 4S2CA 5FI8A 3W7CA 2FPTA 4BI6A 3E96A 1TREA 4GUGA 2J24A 3HPXA 5I3FA 1KTBA 5AYXA 3YPIA 1DJNA 3F03K 3LI1A 5K4XA 4NX0A 1N7KA 1G4PA 3LHTA 1QDSA 1TPUA 3T78A 3G18A 1D3HA 2V9DA 3NVTA 1X6UA 3S1VA 3P5YA 2Z0IA 3NQEA 1SR9A 1XBZA 4O4WA 5K2ZA 3G0SA 2G5WA 1H60A 3W7OA 1FCUA 3PBYA 2QCNA 1WBHA 1JJKA 5HWNA 3DKLA 3IIPA 1S5TA 4JXCA 4L4MA 1SZFA 2HSAA 3A5VA 2B0MA 4HNUA 2NUYA 4CCCA 3TSBA 3LCGA 1YTKA 4Y90A 4JS3A 3BGGA 1JQVA 4JNMA 3JR2A 4DF1A 1TPVA 3THQA 1B9BA 3KX6A 3GXNA 5D2XA 4H6KA 3NL5A 1FQ0A 3HPZA 3TUUA 2HMCA 2ZRYA 3FJ6A 3TROA 4E2BA 2DZUA 4NUWA 2X1RA 1T99A 4MFEA 5D2YA 1SSDA 3P74A 2AGKA 3HPSA 1GVFA 4GRSA 2CLOA 5D09A 4MY9A 4N9EA 5K9CA 1TRDA 1KFEA 4YMZA 1AMKA 4Y9AA 5F2GA 3N2XA 4FHAA 4AWUA 3JS3A 1I2NA 3NPWA 4O14A 3W70A 3HMJG 5EA9A 3DHFA 1EX5A 2H6RA 3ANYA 2A1YA 3TNOA 3LHWA 3W84A 1KBIA 2V30A 4IWWA 1QCWA 1F6KA 1O5KA 3L67A 5H2ZA 4KFOA 3ZFHA 4ML9A 1VGAA 3P61A 3WJXA 3T55A 3GR8A 4JIQA 1G7UA 2R94A 5LSMA 2R8WA 3OBKA 3UWWA 4JD4A 4JR5A 3BW3A 4LS0A 3CIXA 5DCEA 3KRUA 3DAQA 2HS6A 4ZQOA 1DQXA 1I8JA 3HGOA 2TPSA 3DHDA 1KA9F 1M7PA 4QJ1A 4UNLA 2CZDA 5I3HA 1LRNA 3W7MA 4FNSA 1RQHA 4Z0SA 4FX7A 2G96A 1SW0A 1W31A 4UTHA 2DZPA 1GVQA 5IM51 5AHEA 2O7SA 1OX5A 4LC8A 1JUBA 5F2MA 1OX4A 3DFQA 3NQFA 3W71A 4RCXA 3S6DA 3NPVA 3UY8A 1KLZA 3CWNA 1NF7A 2OT0A 4CCEA 2RH9A 1UB3A 1RZMA 3PUDA 1H51A 1VLIA 4FNTA 1JUKA 4ICNA 3G8RA 4FX8A 1ZJIA 3HG5A 3NQCA 4WJEA 3PB2A 2YZRA 1NAL1 3ABQA 1GPWA 2TYSA 4WZHA 4KFNA 5G2HA 3M0ZA 3UWUA 2A85A 3TXZA 4NJJA 2E5DA 4UR7A 5L6UA 1TJRA 1HL2A 1BWLA 3DI1A 5KMYA 3MI6A 1J4EA 2W0UA 4K38A 3FIGA 3PULA 5CG7A 2FFCA 1W5PA 1SZEA 3QSRA 4O13A 4WOQA 4UTTA 4UTWC 3FEMA 4H4IA 4GFSA 2Y6ZA 1FCQA 5DBTA 3G1FA 1RR2A 3MP5A 3TAOA 2FQIA 4UFHA 2BTMA 4GXMA 2JKPA 1FDZA 4LVBA 2ATSA 1EB3A 2FPVA 2H90A 3EX4A 3R89A 1EPXA 3TC7A 3A5FA 2C1HA 3VI2A 1Q6LA 3L0KA 4NZJA
chains in the Genus database with same CATH superfamily
1WX0A 4W8LA 4UMBA 2XSXA 4S3KA 2QMJA 3W7QA 3PZQA 3Q58A 2ADAA 2VZSA 3CT7A 4UQEA 2W3ZA 2EQDA 3G1DA 3NEVA 3LLDA 4A22A 4ZBCA 1XCWA 2EPMX 3O63A 4L9YA 5FOOA 4D9PA 4GXPA 1AG1O 4J9JA 5A2BA 4MY8A 2F9RA 2ONEA 3LBOA 3RLHA 4OTKA 3VNMA 5A6MA 5HWJA 3AZTA 2G95A 2GVYA 1KV8A 5LIUX 4GI8A 1Z44A 2DIJA 1B3ZA 4GNJA 3CIWA 2VVSA 4EVZA 3EKLA 1PZ0A 5D2VA 3MCOA 1V7AA 1GUVA 1U1JA 2YIHA 3CPRA 4C1NA 2F61A 3LX9A 1JZ3A 2O4QA 3M0KA 5M03A 2E77A 4OBTA 3W73A 3UXIA 3TV8A 4UOQA 3UZYA 2X16A 4EK7A 3QGAC 1F07A 3N6JA 3F4WA 4JX6A 1P0EA 3GIQA 4US5A 4Q8UA 2GJXA 3S1UA 2PRMA 2OU4A 4U31A 1AA1B 4LGXA 2JBMA 4LYQA 5I79A 3STFA 4E4PA 4A35A 3VDBA 4M80A 2ISDA 1W3JA 2VZVA 1VPXA 5TQLA 1BQGA 3MYOA 4D8LA 2DSVA 4LVFA 1ZTVA 4Y96A 1P48A 3IGHX 5H8MA 1AH4A 4L4PA 2Q3RA 5C8BB 1NWTA 4J27A 4XAFA 2CLMA 4HHMA 4R7OA 3A4JA 4OHQA 4RLIA 4IQLA 2QVNA 2ZE3A 2KX9A 3T8LA 4DO4A 3FFSA 1Y5XA 2IKHA 3KVMA 4J5NA 3QOMA 3B3DA 4LRSA 3PAOA 4XK2A 2ISSA 3CUXA 3E1F1 5BCAA 1XXXA 1EJXC 1T40A 1AODA 3BK0A 1OFBA 3VZXA 1ZQ5A 4J1OA 4J3ZA 4DZHA 3QQ1A 4F2TA 1QHPA 3VDGA 1KFJA 2OWXA 4O28A 4WHBA 2Q8ZA 4GHRA 5AHLA 3EA2A 5HATA 1CTNA 3RN6A 4DZ5A 3R8GA 4AZ5A 1OG6A 2XFWA 1R3SA 4XG1A 3UWEA 3U7BA 1VRDA 4QNEA 4DF0A 3V16A 4EF8A 3IVUA 4GC3A 1EX1A 4I7WA 3BLIA 3O06A 3FEQA 2VGIA 4A05A 2I16A 2OFJA 2VQUA 3U2ZA 2D24A 2C1IA 1YADA 1UCWA 1W1VA 4C7GA 1QRQA 2X1TA 2ZUVA 1VC4A 1XINA 5BW6A 3WD2A 2WB5A 2BFGA 3SR7A 2R91A 1BVZA 3WX7A 4GYFA 4XO6A 3VX0A 3QQ0A 3FKKA 1TA3B 3WH7A 3QJAA 1E1CA 2W62A 2GJRA 4MJZA 2INFA 4AYSA 3LERA 1XGEA 4Z2LA 3G1HA 3EWXA 5EPDA 1G94A 3CC1A 4Q33A 4HMDA 4JTAA 3NSMA 2R1MA 2FMOA 3BJTA 4TQTA 3UD6A 4CQDA 5D30A 1OJXA 4BCEA 1J0ZA 1P0KA 2WQPA 3WY1A 3RK8A 2E5BA 1HJWA 4RUBA 2Q71A 3NUKA 1QPOA 2ZVIA 1S2TA 2GVGA 4LOCA 1B90A 2UY3A 1GEHA 3T42A 1V4YA 1XIBA 2XWDA 5BYWA 4B5UA 3IJDA 3ITXA 1GONA 6XIMA 4LEFA 3MMTA 2EKGA 3ARUA 3MVIA 3F4NA 3WQ6A 2WNNA 4EIVA 1XBVA 3DGBA 5F4SA 5E0CA 3ARZA 2A3HA 3VU2A 1MEHA 4NASA 3IGXA 3HFYA 1TO3A 3N6QA 1E40A 1S5WA 4NZ5A 1E72M 4O8AA 2PDNA 2GQ9A 4Z17A 2FDMA 2IPGA 1RK6A 1VFOA 1QNVA 2QKFA 4FZIA 1MWOA 2W4XA 4KEZA 4AD3A 2BGSA 5HWMA 2WC3A 1H62A 5CZSA 4O50A 4GJ1A 1K9TA 1H7OA 1X6LA 4QCFA 3ATYA 3C2RA 3KOXA 5FF0A 1BHGA 4K68A 1BF6A 4YCOA 1XFCA 2Y8KA 3S4TA 3CL6A 4UMAA 1AH3A 1H49A 5A94A 3NQBA 3AUJA 1EZWA 1K70A 3C0SA 2JEQA 2QMKA 5LIWX 1TPH1 3BG5A 1WDSA 5HQEA 4AYGA 5HQMA 5XIMA 1K7XA 3TQKA 4S23A 1QNSA 1I75A 1Z9AA 4JTHA 1QATA 3VIMA 2XYLA 3IRSA 2L5HA 1WDDA 2FIQA 3C8FA 4YXGA 1GPFA 2YL9A 2YXGA 1KFCA 1KWGA 3WK2A 1U33A 3VNDA 1LOLA 3RRAA 5A2CA 2PLKA 3PNUA 2H8ZA 2RAGA 1XLMA 3WBEA 2XFYA 2XIIA 1ELSA 1RY0A 2JIEA 5D38A 4H8UA 1SJAA 4LY4A 4R33A 3LNMA 1PIFA 1PZ3A 3T40A 2QJGA 4DJDD 3EXRA 3VILA 1G7VA 2QXWA 1AD1A 1OFPA 4IIFA 1XX1A 4REQA 1F61A 4OVXA 1SYTA 5CGTA 5D9OA 1UD4A 1TQXA 3ZQ9A 5F2LA 1GOXA 4K7VA 5A8QA 2BS9A 3WLTA 4O1CA 3TA9A 1KRBC 3W0KA 2VXNA 1WDRA 3EPNA 3D6NA 4JTSA 1TR1A 5E6YA 1QR7A 1O4UA 3U7VA 4JEJA 3UR5A 1N82A 3G6LA 4B9YA 2QCLA 4AD0A 4I7UA 1MXSA 3GDKA 2J7BA 3CTTA 3R12A 4UZUA 3T0DA 1IZCA 1JD7A 3BTNA 1JAEA 1DJYA 2UBPC 3KL3A 4XD5A 4DHGA 2Z1VA 4MZ8A 3T0BA 3ZZ1A 3QPZA 4HYWA 3WLKX 1PV8A 3NYDA 3T2QA 3DG6A 3M43A 2YBUA 1W1ZA 3W00A 3VNJA 1MRAA 2YYTA 4ZOAA 2HXUA 2QF7A 1EJTC 2YSWA 3W1QA 2WQDA 3T2OA 2ACUA 4S2BA 4HU8A 1DXFA 1KLYA 3TFXA 4ENLA 3UWVA 1JZ2A 3FYYA 3M5XA 3WH8A 1KM0A 1WXJA 4MB3A 1EGVA 1CB2A 3B0PA 3LA4A 4WX2A 1Q6DA 4DIAA 1O60A 4D8AA 3VFCA 3RRXA 1LP6A 1AZ1A 1ADSA 3LBMA 4JX5A 4KCUA 5FAGA 3MSDA 3NURA 4HNNA 5MF5A 5EFDA 5DQPA 3FN9A 3GTFA 3R58A 3MV11 3M46A 2DIEA 2JGQA 2DUZA 1J5SA 2PI6A 1VYPX 1IXPA 3FVDA 2P0OA 1WAWA 1U83A 3ISIX 1TB3A 2IUZA 4IFOA 2VO5A 5D8WA 2J75A 5AFDA 2OTDA 3A4XA 5FEZA 3KEHA 2PRHA 7ODCA 2MNRA 5EKYA 3PNZA 4JTKA 4CQ9A 3R79A 2WNZA 2D0FA 4I5UA 1XM3A 2CBVA 2DORA 5CJ5A 3Q67A 4BWLC 4GIYA 4KERA 1YQ2A 1XLIA 3SW6A 4GY1A 4E3TA 2ZC1A 4HOZA 3PK7A 1A4MA 2JIWA 3N17A 2RDXA 3A3WA 3LXCA 4CN6A 1R3VA 3R4IA 2VELA 3WL0A 3QQWA 1MZHA 2VX7A 2JKEA 8A3HA 1A5MC 2J78A 3VD4A 1GT8A 1EZ2A 1JI2A 4FF5A 3MO7A 3LD5A 3PJTA 2OEMA 3EMQA 3VKCA 3IGUA 1H41A 3GLCA 1LL7A 1IT8A 5DMMA 3DYOA 3OGSA 1JDFA 1NM9A 2VX4A 1PCWA 1LRTA 4TMCA 3JW7A 3QMRA 4JCLA 4DN1A 4PB4A 4ZL1A 1VFFA 1QI4A 1I9CB 4GA8A 3B03A 3W75A 3BL3A 4QLKA 1WNOA 4FIQA 2QQ6A 4QEHA 3EEGA 4H7VA 3NZ1A 5AB3A 1X8CA 3LGGA 3GVQA 3N2BA 3RU6A 4AD1A 1OFQA 1Y8BA 4Y9PA 3QF0A 3LN3A 2OZ3A 2WSQA 4CLMA 4LTSA 4QAIA 1J2WA 1GHRA 3B0YA 4LNYA 1LBLA 3MP3A 5A5WA 3P5ZA 2OPJA 5HNNA 4DWSD 4IMFA 1YRRA 3SQLA 4XKYB 3G0XA 4I9JA 3OBAA 3GTNA 2YXOA 2VCAA 2AL1A 4D8ZA 3HQPA 2FB2A 4KPLA 1DIKA 4B15A 2GDQA 3AALA 1F4HA 1S46A 4JKMA 3EX3A 1GQLA 1X8FA 3SUVA 1R9YA 1RJQA 1W37A 4RR4A 4EPDC 3PJXA 2B7QA 4YN5A 5FSDC 1OK4A 4KIRA 3TWBA 1UP3A 3VCRA 4NXSA 1KW1A 1LOQA 2E68A 1OIFA 2QJMA 3AWOA 1BWVA 3IV8A 4FR6A 4W9TA 2J9YA 3RFAA 3TOPA 3UPBA 4ZB2A 3QGKC 3UCQA 4JTDA 2JQXA 4L56A 5FACA 3CWOX 1LTDA 3GE7A 3T07A 1ZFJA 5LKYA 3D0CA 5E6ZA 4N42A 1QHOA 2CLLA 3E38A 1KFLA 3KVJA 4LAOA 6ENLA 1YW1A 2F38A 3EWBX 3T4CA 1E9ZB 4OUEA 3DHUA 3C2FA 4KRZA 1KXHA 3WF0A 3V5OA 2DZAA 1M7JA 2C71A 2XVKA 4RV3A 1QK0A 2A7NA 3DYPA 3ARRA 3B8VA 3LHVA 3F4VA 3UVAA 3WMCA 1TTQA 3OHMB 1V3IA 1S3HA 4F66A 3CUIA 3VOIA 2HK1A 4WCJA 4GYJA 2V68A 4WQ6A 4ADUA 3R7MA 2I17A 4QDWA 1K1DA 1XFBA 2HQAA 2ON3A 3A12A 4R88A 4TR9A 4RZ6A 4H8NA 3QPYA 3PZVA 1D8CA 2QR6A 3AOFA 2ZZ5A 5HK4A 2ISVA 1V0NA 2A7PA 2R9RA 4IFRA 2BMBA 3LGDA 3N4FA 1TA3A 4IP7A 3PG8A 3P80A 5GJNA 3GD6A 4PSPA 3G2GA 3Q2DA 4NI3A 1JZ5A 3BGJA 1ML1A 1ZU8A 1JYVA 3ICJA 2ZC8A 4K39A 5C6MA 1XYFA 4Q7NA 2YCEA 3CO4A 3EWUA 2CCRA 5EYWA 4HVXA 4DYKA 2WWDA 2PD5A 8TIMA 1VEOA 2J9XA 4MY1A 4ACZB 2V3GA 5HNUA 3Q4DA 5H1WA 1JXJA 3CNYA 3R6IA 5LXEA 3OW1A 5AHFA 1CECA 5DY2A 3B05A 1TIWA 4OV9A 5A8MA 2FTPA 4L1WA 1EL3A 2RUSA 3VOFA 4FLSA 5HDRA 4AIUA 3ZT7A 4L4LA 5DXXA 2V5JA 3CV7A 4QXIA 5KEZA 4TX6A 4KEMA 3W26A 4A29A 6XIAA 1WDPA 1XDMA 3KLKA 1W91A 3N14A 1FRBA 1T0OA 3NSNA 4E2DA 2EKCA 2QUTA 1O7AA 2DQXA 4HZ8A 5CZKA 3HFTA 4GBDA 5TD4A 1EOKA 1ONRA 3MA8A 3PTQA 4Q4KA 1Q13A 2GPTA 4UOJA 4C6OA 2PDJA 4JIIX 4X3ZA 4XWUA 1VPYA 2D69A 1UR9A 3IWPA 1E6RA 1B3YA 2FYMA 1XWYA 4FNQA 1NTHA 1J93A 1Q8AA 5I02A 2EG6A 2V5CA 1FXPA 5CLTA 4JN7A 1D2KA 1ZL1A 2PDCA 3GRIA 4AWSA 1C93A 2YFOA 3K1DA 1QASA 1HO1A 3WUFA 1TPFA 4ZO7A 1D3GA 3L66A 5AECA 4IL2A 5CSRA 4JOMA 3UESA 1V79A 3WIJA 3GM8A 3TA6A 2GGGA 5CCZA 3WZ0E 3BCFA 5AC8A 4A4AA 1Y0EA 4HA1A 4Z2JA 2I9UA 2QPXA 4NNAA 2J8GA 4DJEA 2J4GA 4O17A 3L2MA 3TW7A 2VGGA 4GYPA 3CTLA 3NQVA 2QDGA 2NVDA 1AQHA 1YE6A 1MXDA 1WKFA 5HNTA 1PTAA 4C6IA 2PPGA 4CEXC 3KDOA 2VX6A 1G4SA 1EP2A 3F4CA 4LUSB 1Q2RA 1WKEA 3OIHA 4QLJA 3VPLA 1RJRA 1UG6A 5EL1A 4TTUA 2VDGA 4JAWA 4MYXA 2PLCA 4PE8A 1A3WA 4EACA 3BAXA 2WMIB 1GTEA 1L8PA 3NL2A 3IK2A 3P62A 4IUOA 4NNCA 5JXQA 2BWGA 2ZUUA 1W8SA 4O57A 3HQ1A 3P8IA 4ML4A 3ZLHA 3LTPA 4MWAE 1EP3A 1DJZA 3OYZA 4D6DA 1X1ZA 2FZMA 2YDSA 3CM4A 3OLGA 4O1FA 2NSOA 4KWWA 4Q4PA 4WSJA 3UVIA 4DPQA 4WDTA 3V4BA 3VE7A 4JFSA 5CZTA 1K8ZA 3AS3A 2UY5A 1SZNA 5CAHA 3WK3A 1VBRA 3KCOA 1E70M 2A6LA 5U7SA 5G4HC 4M6QA 2Z1WA 3D46A 3M4HA 4NIRA 3GZAA 2RFGA 4G5DA 1V08A 3NDZA 4QSFA 3STEA 1W9XA 4NL1A 2Z1XA 1PIIA 3LM3A 4TMBA 4RE0A 3GXPA 3VK5A 1OCBA 3CHDA 3T0AA 4YTUA 4ADSA 3LK6A 3GDTA 3MU7A 4PUUA 1IXQA 1PE1A 2GUYA 4HPNA 4QDPA 1YNYA 4IH3A 2NWSA 2FGBA 2ALRA 4DF2A 3J7HA 3NXLA 1JR1A 1CWYA 4ALDA 1B57A 4KGLA 3HTWA 3C0JA 1Q8JA 4HYRA 4IICA 5G2WA 2X7WA 2QW5A 4PBFA 1UD5A 1ZP4A 1GYNA 1YTEA 1LZOA 2VGFA 1XPYA 3RX2A 2PDGA 2FZDA 4LWWA 4O52A 1RBOB 4Q7IA 2D20A 3TR9A 3URQA 1F6YA 2YGYA 3FA3A 3UG3A 2QCHA 3D3AA 1WCGA 4RZ4A 4ZOCA 3TSDA 2CXGA 4F9DA 4GQQA 4PR4A 3AFBA 1GVSA 4K8GA 3TCEA 3HGRA 2A4AA 4MSSA 3THCA 9XIAA 1D7KA 3GBDA 2UV8G 5C71A 3V5CA 3QMTA 2BODX 1NDWA 1ICQA 4P7QA 3PPGA 5DF0A 3RU8X 3PPHA 3U4FA 3G6MA 4KT2A 4S3CA 1R87A 3DIPA 4OWGA 1XLAA 3N11A 1JAKA 2HDJA 4AQLA 2O9OA 3QV9A 3LQLA 4ATDA 4JFUA 3NJ3A 3UJFA 1EUAA 1S1RA 4M24A 2ZTKA 4QJ5B 1R9ZA 3DENA 1NOFA 3OHIA 1UKPA 3GFYA 4UC5A 3VNKA 4J3UA 3MWCA 4NP7A 3KZSA 4H41A 3WMBA 3W7JA 3B4UA 4HPXA 3VGGA 2DZSA 1AQ0A 3TYZA 3OGRA 4XAYA 5EMUA 1UZ4A 1LM1A 5BZAA 1DJGA 3M9YA 4NVTA 3ZXWA 4EPEC 4AMCA 1ZNNA 4ZTYA 4G9PA 3KBMA 3EX6A 1OFOA 1VEMA 1W3KA 2QCMA 1EDTA 2PWGA 4Z1BA 3THDA 1P4CA 5C0QA 2NQZA 3WJWA 1QOPA 4GQBA 1JPMA 3DFPA 2WZIA 4AY8A 1SM9A 3H4WA 1DWAM 3BLPX 4DBDA 1U30A 1BKHA 4RV8A 5HMEA 1P43A 4GOAA 1DP0A 2WV8A 3BMVA 1OCNA 4LYKA 2GLKA 3GAKA 3GIYA 4ZVJA 1Z48A 4UTUA 1KCLA 1H11A 3WNNA 2IQDA 3URNA 5DO8A 4CD8A 3O05A 3M5YA 1JL8A 5DCDA 1C9DA 1ODUA 4G56A 1TRIA 2BDQA 5LA2A 4O15A 3GDBA 4M6PA 3E2VA 1W2VA 1EWEA 4XKYA 2IPWA 4AZ6A 1K3UA 1JVNA 1BGAA 1WDWA 1LT7A 2OGJA 3N34A 2Z25A 3WQ4A 4IMEA 1Q5MA 2XM1A 1C9WA 3FNDA 4KKXA 5ENLA 1RCOB 2PLJA 1KM6A 1J0KA 4BQ4A 6CGTA 5CGMA 8RUCA 1US0A 5AVHA 3AHZA 3QZ6A 4GI4A 3VFLA 2O55A 4POCA 1VYRA 2WLZA 1XLLA 2J79A 2OXNA 3LHUA 4X60A 4QJ4B 4GFIA 4B5SA 4N9BA 4PMUA 4UCGA 3R11A 1M6JA 3LYEA 1KRCC 3M64A 4AEFA 4K8EA 1W17A 1U22A 1IQ8A 1PO9A 4RNIA 3U3HA 2DW7A 2EPHA 1VJZA 1VBHA 2PTYA 4FSAA 4MYAA 5LGXA 4K1WA 4GIRA 4IGSA 5IBXA 1M7XA 1RPXA 2DZTA 4BJHA 4EKJA 1I2PA 1G4TA 1UJQA 1ZSXA 1UW9A 3TJ4A 3BAKA 1LQAA 1W5OA 3KOFA 4DO7A 3HU7A 2Y85A 1SO6A 4N9DA 1EC8A 1KCKA 3BDKA 4HCHA 4NNBA 3TLLA 4BEUA 3S9ZA 3LXAA 4HK5A 1O1HA 3LRMA 2ZZ1A 1M68A 4QG8A 3LTYA 2OLSA 3RMEA 3MVTA 4CD7A 1PTGA 4GABA 2ZUWA 4XZ9A 5I3GA 3W7CA 1FH7A 4BI6A 3VIJA 1XYLA 4GUGA 1K8CA 3CUHA 2X2YA 1DJNA 3LI1A 1VAHA 4M29A 4WK9A 1G4PA 4ZOBA 4LB4A 1Z8AA 2V5DA 3BOLA 1QDSA 3GUGA 5A6BA 1DE5A 1TPUA 1L2QA 2V9DA 3IACA 5C9XA 1QTWA 3UZWA 4K3ZA 4MPKA 1SR9A 2MUCA 3PBYA 2QCNA 4Y2WA 2D22A 3MC5A 3QV7A 4N0RA 3R10A 3CGTA 2NUYA 3LCGA 4Q8NA 4KMQA 1JQVA 3MS8A 4HNLA 3B4YA 3TN6A 1B9BA 5D9PA 4OZOA 4ACZA 3HPZA 3TUUA 3WNKA 2G37A 4AX6A 4MG4A 1QHZA 3VNYA 2PU1A 5D09A 3RG6A 3L4UA 4N9EA 4JFTA 5K9CA 2O4MA 2E4TA 1KFEA 2VWSA 3BAIA 5F2GA 3ZSTA 1I2NA 3B9OA 4C90A 3CAVA 1W1TA 4XVEA 1MVYA 4AD4A 5EA9A 2Y5EA 3ANYA 2VGBA 3IUHA 1KNWA 2DVTA 3ANUA 2ZWZA 3P6LA 1O5KA 3L67A 5H2ZA 3FA4A 1VGAA 4PMNA 1T41A 1G7UA 3CQJA 4PMYA 3H12A 3HA1A 4B5TA 3AS1A 5DCEA 3QY8A 2FH8A 4Q8PA 4DB7A 2HS6A 1I8JA 3BMWA 1IR2A 4PMJA 1M7PA 3SRHA 1MFVA 3T0TA 5I3HA 1LRNA 5I3DA 1TWIA 5BROA 4LH8A 4B4FA 4KW2A 1AUSL 1UD3A 3APYA 1SW0A 1W31A 3OTRA 2VMFA 1JUBA 2OSXA 4Q8WA 3KBJA 3M0MA 1IWPA 2F2HA 5BWFA 3CWNA 1US2A 2OT0A 4PULA 4CCEA 3GHUA 4ZO9A 3VZZA 4FNTA 1TV2A 1ZJIA 3HG5A 1A5OC 3VKBA 3NQCA 2C8NA 4JN8A 4QE4A 3ITGA 5FD0A 1T6MA 5FSEC 4K1GA 2GQ3A 3LEPA 3TEVA 4UR7A 1TJRA 4JIHA 5KMYA 3RCMA 2W0UA 4L64A 1KKOA 2Y5SA 5CG7A 3QSRA 4O13A 4UTTA 4H4IA 2Y6ZA 1FCQA 1RR2A 1IEIA 1FKWA 1VKFA 4HHHA 4ES4A 2FMNA 4PMQA 3TAOA 4LUSA 2BTMA 3H2EA 4OECA 4LVBA 5REQB 1EB3A 2H90A 1V3HA 3A5FA 3Q65A 3F7JA 2WSKA 1A49A 2WMIA 1Q6LA 4TOQA 2VOMA 2OYLA 4NZJA 1LDCA 2QJNA 3MUCA 1VBGA 1SFJA 1W2PA 2WNWA 4JL2A 5D32A 4B3KA 1XUZA 1E71M 2XWEA 3GB6A 2CZFA 1PSCA 2XN1A 4Q8MA 5HQLA 2VDIA 2PP1A 4DM1A 2Z29A 2QS8A 1UKQA 1XIHA 3MJYA 3CQKA 1JYXA 2FVLA 4RKAA 1I6NA 2ZRXA 2DZVA 1E43A 4O16A 4GJJA 3B9NA 3M41A 2ZXAA 1LROA 1FH9A 1EQCA 5DMLA 5LNSA 4CU8A 2C13A 3ZSSA 2R14A 5HJYA 1JFXA 3LDVA 2BHZA 5RUBA 1V3JA 2Y8UA 1R3WA 3N2OA 2VFHA 2VDHA 4LU0A 5A6JA 1XC6A 2HVMA 1ITCA 3ZJ6A 4DBUA 2PDBA 5T9CE 2VC5A 3MSYA 4FB7A 1A0EA 5BWAA 1XQLA 5DRCA 4H9TA 5FEPA 2IPJA 1I60A 3VD9A 4MZ1A 3AJXA 1BTMA 4F0SA 4PMXA 5A8OA 2D73A 4YHEA 1DQUA 3EOEA 3E12A 2G50A 1UD8A 1W9PA 3TH6A 3W3OA 5I78A 5JQ9A 1E6NA 4NILA 2VFEA 4H9UA 3FDKA 4O1BA 1W1A1 3NEHA 4JTTA 3OO2A 3IJ7A 2B81A 5I3IA 2ZE0A 3B9EA 5I03A 2YL5A 1CLVA 4PUWA 5ABFB 3SAZA 5D04C 1ESWA 4ATLA 3SEPA 4RW5A 3TJXA 3L4VA 1UBPC 3GXDA 1KM4A 3A47A 1DORA 1G1YA 2V67A 3FJ4A 1PDYA 4KBXA 4L4OA 4TUFA 1W9UA 3WG6A 1GVEA 5D9MA 5I09A 4HMCA 2RDWA 5JVLA 1KTCA 1MW2A 3STGA 4EE9A 2YFNA 4C6PA 3VKAA 2ISFA 2Z6IA 3K1GA 1UR4A 4FI4A 4L65A 2GVLA 4GUHA 1IGSA 2AOSA 4FXJA 1NQKA 3WN6A 1QU4A 3AQUA 3B04A 4Q8VA 2NXIA 4E4FA 4F8XA 4CKQA 5CC3A 4MVAA 1JI1A 3MCMA 3CV1A 2J13A 1ZALA 2WWCA 4QS6A 1HO4A 3CHEA 3S5YA 2IQ0A 2Y89A 3E0FA 4GI6A 3G8EA 3WKZA 3NAVA 4H83A 2G3IA 5HULA 4M7TA 3GYEA 1R3TA 1HJUA 1E3ZA 4HT3A 1QBAA 1EJRC 2HZGA 1ZBWA 3WQWA 1Y65A 3H4XA 2HS8A 1PUDA 5FA5A 1B9ZA 4LUYA 4UTJA 3GSMA 2ZTJA 4MIMA 1GOKA 3UJ2A 4DEFA 1G0CA 2JF6A 5E09A 3CUFA 3FY1A 1NARA 3GKFA 2W61A 4CCDA 3N9KA 1UZ1A 5CPLA 1I2RA 3CT2A 2FHCA 1GOQA 3VDCA 1B4EA 1WA3A 3N2TA 1S1PA 1R9XA 5DFAA 4DY1A 4UTMA 4ZTXA 3KRSA 3BSHA 3WSUA 1AJZA 4FLOA 5G2IA 4IFKB 2X7VA 3FSUA 1GZ1A 3S9IA 2W27A 2BLEA 3SZ8A 3M07A 4I5XA 2QHAA 2BSLA 2VEIA 4QLLA 1EHAA 1RSCA 2DT0A 3PPFA 2F7FA 3QN3A 2RJGA 3R5EA 3GVGA 4UTFA 2I5GA 1POKA 4E8CA 3APTA 1TWWA 3DYMA 4JHOA 3SY5A 4MUZA 3USBA 4EPBC 5CC7A 4WR3A 4NJKA 2GJPA 2YW3A 4F0HA 3SCUA 1LG2A 3LRLA 4UUIA 4UCFA 2BP1A 3TN5A 9RUBA 4HSNA 2QPUA 3CH0A 1GVOA 4RXFA 1F8IA 3VTRA 5IHRA 4DWSB 1FOBA 2OOGA 6TIMA 4K8HA 2E5CA 1XLDA 2OELA 2QCDB 2VFGA 3MDWA 4CNPA 1Q6GA 4GVIA 1I2QA 4H1ZA 3L65A 3UCCA 2WM1A 1A5KC 3W28A 2AMGA 3WELA 4LBRA 2X1UA 1PYMA 4P8VA 3M7SA 1XH1A 4P61A 4B3LA 1GYLA 4TO8A 5A8GA 4WSHA 3WJYA 5FF4A 2H3BA 1U1UA 3CZJA 4LQ1A 5T8GA 5D02A 1UWTA 3C86A 2Y7EA 2Q6ZA 4DXVA 2GSJA 3L4WA 1E6XM 4MTVA 2JF7A 2NUWA 4IP4A 4A2SA 3O0KA 2JALA 1LF1A 3EWCA 1L6SA 3QR1A 4HGXA 1IEXA 1WZKA 3NM1A 3AHYA 3T1GA 1IR1A 4HIBA 2G3MA 4E38A 4W4QA 3QEZA 3NQ8A 3CHCA 1FFRA 3UNDA 2DSZA 3R94A 3RO8A 2WHLA 3CBWA 4Q3MA 1LLOA 1AFSA 3JU2A 4EP8C 3NO5A 1UWQA 1YIXA 1QFEA 1JPKA 1UWRA 5CPQA 3H6OA 5IBXC 4M51A 1IXNA 3IVSA 3EPMA 4PTNA 4WEVX 4W7VA 2VC9A 5CZJA 1THFD 2W92A 1YTDA 4ZODA 1VFMA 3PSWA 4Y9MA 3SY1A 3OVGA 1GVRA 1M41A 2B7NA 2A5HA 3F1QA 4IG2B 4OJYA 4X22A 1PKYA 1DL3A 4HHLA 2A79A 3N12A 4IMCA 3TW9A 1E4LA 4Q4RA 3H53A 3HQOA 2HISA 3W86A 4AHQA 4W87A 1TV5A 1AD4A 4DO6A 2JK2A 4O0ZA 1PTDA 3EB4A 3RPMA 4HYVA 3EKGA 3W83A 2F6UA 1G67A 3GW3A 2NVCA 2Q02A 3ARTA 5K9XA 4HA3A 4TVCA 4H8VA 3DC8A 3QYQA 4LVAA 4MZYA 3ZR6A 2A0NA 2PZNA 4GGHA 1QW7A 4GJIA 3TZFA 3CZEA 3IJLA 9XIMA 3ARXA 3CS2A 1OCQA 1CGXA 2PBOA 2C15A 3N29A 3BH4A 1UUQA 1XLCA 3BV4A 2SFPA 2RHGA 3BURA 2DFAA 1PZ1A 1NWSA 4J7RA 1T5AA 2VNCA 3VMOA 3O8AA 3WEZA 3OPSA 1NDVA 1Q6RA 2WHJA 2I1OA 1CZ1A 2OQYA 5F1UA 4D2JA 1ITXA 3CAWA 4UTIA 1YDOA 2WAGA 1W3NA 1FWTA 3N9RA 1U5VA 1EKOA 1HQTA 3V36A 2Z1BA 1W32A 4QFUA 4GE8A 4URIA 4LBUA 4JTGA 2CLKA 1HFBA 4MFDA 3VNIA 3VNLA 1FVPA 4HCLA 3E0LA 3MY9A 1M65A 3TFCA 2WCSA 4GX8A 3B0VC 4E5TA 2HXTA 4H7ZA 3WF3A 5ECVA 2ZICA 2Z2UA 4CNUA 5KETA 4M82A 4Q22A 1H7PA 4LS1A 5J8LA 4GUJA 1A3HA 2BGQA 1VZWA 1OFRA 1G4EA 3NOYA 4R5EA 4ZFMA 4UMCA 1TV4A 1HT6A 4EAMA 2VCCA 3P60A 3KVLA 1DJIA 1XV8A 2XN0A 2OZ8A 6PTDA 3AXXA 4LVGA 3W81A 1OBAA 4CD4A 1Z89A 2A7RA 3LPOA 2ABAA 3MI2A 4AAJA 3BG9A 5I2UA 2ZZ6A 1E6QM 1WZMA 4IIGA 4XSMA 4GD0A 3COTA 2X41A 1NEYA 3UW6A 4UFJA 3UZ5A 7A3HA 3HG3A 3LCWA 4JQ3A 2E9MA 3VCCA 2EBNA 1C7TA 1OCJA 3LG3A 4MJMA 3GTXA 1GJUA 3JVAA 2VFIA 3ERPA 4HHPA 2Y4SA 1PJ9A 5A1AA 3T8QA 1SW3A 3G1YA 3SCTA 4GGBA 1EBGA 3SJ3A 1LLZA 4O1AA 4QE5A 5CLWA 3DXIA 1R3QA 5B7YA 1UD2A 4NXKA 3DEQA 4F48A 1Q7ZA 1OABA 2J62A 4UIOA 3VKKA 2NZLA 4BQ5A 4OQVA 1XDLA 2EF9A 3GC4A 4V15A 4DJDA 1CGUA 4GUIA 3KLLA 3C8NA 3ITYA 4UTTC 4XV0A 1PHWA 1EDGA 3UP8A 2CITA 5LHEA 1UUMA 1SQ7A 4ZXLA 3EGJA 1QW9A 2AKZA 1P6WA 3ES7A 3ABSA 3NDOA 3WCZA 4IIDA 3W7HA 2J27A 4UR9A 3IUIA 3BSMA 1TX0A 1BYAA 2R1NA 3CXOA 3OLEA 3W2LA 3NFUA 3S83A 2PDIA 4PUEA 2WPBA 3ALFA 4M0XA 2EJAA 3S1WA 5E93A 3AO0A 3SI9A 1O94A 3AYSA 4HNOA 1GZJA 4DX3A 1IEWA 4I9AA 2PUZA 1QOQA 4K2SA 4D6CA 3RCYA 4Z1CA 2ZYFA 4U2ZA 3K2GA 1HKKA 1A80A 4OGZA 4QS5A 3CHFA 2VEFA 1OK6A 3PP7A 1DIEA 1MSSA 3RAOA 1UIOA 1FWRA 2J7DA 3H2MA 3H23A 2OMAA 1HTIA 4LAMA 1D3CA 2GOKA 4QCEA 4Z1AA 3K8LA 3VO0A 4GUFA 5ABFA 1OYCA 4PFMA 5JIPA 2WSYA 2D3LA 1NFBA 2XIOA 1GOOA 4RNFA 1HVXA 3QR0A 4M3PA 4LF1A 2OSYA 4UWMA 4JDYA 1H5VA 1FDJA 4U4MA 4F0MA 3BOFA 1D7FA 4MOZA 3TR2A 1HKJA 2WCAA 2A3BA 2BOEX 4JTCA 3VE9A 2XFRA 1DIDA 1TV7A 1JCJA 3UWZA 4RNJA 4L7ZA 2C7FA 2Z28A 4LAZA 4JHZA 4DI9A 2DT1A 3UGRA 3LCFA 2FZ9A 1E56A 2PDQA 3OGVA 3PUGA 1OY0A 5A8PA 2J6VA 5HBFA 2Z00A 1OC7A 3AXKA 3AMGA 5HMDA 3EAUA 3G3MA 3RPTA 3PFRA 5FF3A 3SCVA 2CBIA 4QX4A 1TVPA 2P53A 3MP4A 4R7JA 2Y7DA 3DU0A 3QKEA 4YHGA 4HD5A 3PZMA 5DXYA 1CXKA 1IWAA 3EOOA 3M0LA 4NZ3A 1TPEA 3LNPA 4HKPA 1SFSA 5LNUA 3MBFA 2V2HA 2VEPA 4OOZA 1WAUA 2RGLA 2GYIA 1TPWA 3K4DA 1QVBA 1DVJA 5DLCA 5FJJA 3IAQA 4LB3A 3GC5A 4XZIA 1M01A 2J66A 1A5BA 4UBPC 2VJXA 3SFWA 1E55A 3VX1A 4C6EA 1GJWA 1ZP3A 4IFKA 3B0UX 4MNLA 5CJMA 2YCKX 3KAOA 3E02A 3M0YA 1KM3A 5FL1A 2E8ZA 1H1ZA 3FS2A 1F05A 4PTVA 1TMQA 4DBSA 3UNTA 3WNMA 5EMKA 1GW1A 4UNKA 5CC5A 3QYSA 4W8AA 1MYRA 2VR4A 4UTKA 2HNHA 3SY8A 1X97A 3I3BA 3EWWA 3RITA 4LVDA 4DNMA 1R7AA 2BXVA 3UT0A 3W6MA 1BAGA 1YYAA 4QQ3A 3SIZA 2VR2A 4DWSA 3PWAA 5I3JA 4ASTA 3GNNA 1UP0A 3EPOA 4GISA 3VIGA 5F4WA 2BXZA 1GKPA 1DTNA 1S2UA 2QCDA 4S3EA 3ZMRA 4QHRA 1ZZMA 4GG9A 2E0PA 3POCA 3K13A 4FXRA 2ZRWA 1QNOA 1X7FA 1GVYA 3R13A 1Q2SA 1Z42A 3TYDA 1OM0A 2Y63A 1E9YB 1KV5A 4Z2IA 4AC1X 4IX0A 2W66A 2VOTA 1MQPA 3AISA 1OD8A 2C0AA 1VPQA 3DFSA 3AMLA 1SU5A 5A69A 1AJ2A 1UH2A 3MPGA 2HRWA 4WGXA 2PDMA 4KWVA 3E49A 4V28A 4MWAC 4G6CA 3Q37A 2PWUA 5LA0A 5KZ6A 1T96A 4B9ZA 4BR1A 5C7HA 1UR8A 3W88A 2ZRUA 3KL0A 1XL9A 4I6VA 2FPYA 3HURA 3KBSA 1HJXA 4ICMA 4F79A 2ZBTA 2JFEX 2CU0A 1G6CA 5KSWA 1V02E 2FDSA 4CVWA 3C2YA 3LLXA 4HJFA 1P1MA 5LXXA 1CXHA 1IV8A 2PS2A 2YJQA 5HR6A 4W86A 4XTIA 1OVDA 4LCQA 1RY8A 4HQVA 5JU6A 4XD3A 4JKLA 1XYCA 3DN5A 1PVNA 2RKXA 4QTGA 3GK0A 4YVXA 1TJPA 3PUEA 2O7QA 4DJFC 3AHTA 4MHBA 3GDLA 4QJ3B 1S2VA 4BF5A 3ITVA 3NQ7A 4OT7A 3GH7A 2ZADA 2ZZ3A 2VVNA 4J4KA 1H7RA 3ZVIA 2EO7A 5C9WA 2XFFA 1VQTA 1CGTA 4AVNA 1QJWA 3C0QA 4NG3A 3WEMA 4FALA 4AFYA 3CLMA 4F0RA 3WDQA 4ZQPA 3B9DA 1BD0A 4IG2A 1SMAA 1E5JA 4X0NA 4L6DA 3KS5A 4JYFA 5EMMA 1XYAA 3SECA 1GG0A 4C6KA 5AC4A 4L6HA 2VWTA 4GO8A 3TYCA 1QNRA 3SFKA 3KTCA 1O66A 1RALA 4JL1A 3F4DA 3W29A 2GJLA 3H54A 4C1LA 3EWYA 3M1ZA 3OVPA 4B5XA 1GW9A 3RF9A 5JBDA 1DV7A 4IJCA 3WFLA 3V7PA 4AZCB 1PIGA 1VP5A 4YYFA 3BSGA 2QDHA 1KWKA 3W7IA 3T0CA 1EEPA 3KHDA 1Q6CA 3QRHA 3L9CA 1GKRA 4C6BA 2E8YA 1C8YA 4DQWA 3IJ8A 2WM0A 1HGWA 1B5TA 2DGAA 5FEXA 3WK0A 1ZAHA 3W2KA 5LNRA 2INZA 3A6OA 2J7CA 1TV8A 4L61A 1RHCA 2WKLA 1OYBA 3VGEA 4RDWA 2QPSA 5A6SA 4IIHA 1TV3A 3B40A 3CK5A 4RPQA 4C60A 1ZAJA 2PMQA 4S39A 4Q7BA 1LWIA 2HVOA 3KCLA 2PDWA 1V93A 3GZ3A 3TE9A 3CHVA 3V18A 4WUIA 5FF7A 3LV5A 1OHLA 5G4EA 3A22A 5AHNA 4JIEA 3TYBA 2C1GA 4LAUA 1EJWC 3DESA 3WBAA 2QDEA 5F7UA 4O10A 2E1WA 4GX9A 3BANA 3MYPA 3TXVA 1DXIA 3FSTA 3T4WA 4B92A 1LUCA 4HJWA 3H2FA 3L2IA 3NPXA 2VZOA 1EWDA 1Q6QA 1QPQA 1JYWA 2GVJA 3WFAA 4C5YA 1IWBA 4D6GA 1GOIA 4RXGA 3ZIZA 4H8HA 5KINA 2D2GA 3HM7A 4H3DA 1KBBA 4N02A 4ZQNA 4FEZA 3BW4A 3QC0A 5M1TA 3MKKA 1E51A 3DFNA 2YA0A 5D2TA 1W1YA 5XINA 1XH2A 1RJPA 3MO4A 1W9DM 4UTLA 1L6FA 2ZRZA 1PHQA 2J6XA 3P14A 1UPPA 3W7EA 3HB9A 2NXHA 5FIPA 4WKHA 4A3HA 4AY1A 1BWKA 2W6RA 2YR1A 4OIFA 1V0MA 3CZGA 3U0HA 2WSPA 3LXBA 3W72A 1W3IA 4CN1A 2V8ZA 3MI3A 4FIRA 1G01A 4MKNA 3GHTA 3UWYA 2V6AA 4NT0A 1MNZA 1VHNA 3EDFA 3TVAA 3W7KA 2GK1B 3KHJA 4QNWA 4GIEA 2VT0A 2Z7KA 2QEZA 3BW2A 4S3DA 4U2YA 3VGHA 3D3FA 4X2PA 1FWCC 4YL2A 4GZIA 4I7VA 3W1PA 4H9XA 1V5XA 3QHOA 1DOSA 1AK5A 2I14A 4Z2KA 1HKVA 2Z2BA 4W8BA 1O68A 2DT3A 3BICA 1GVIA 3WLOA 1GORA 3W1NA 1V77A 4YIWA 3GDMA 1X38A 2EXOA 2V5LA 4MB1A 4V1XA 4NJGA 2AQVA 3BARA 5C2XA 4Q4SA 3AXMA 3URBA 1CXFA 5AOUA 4I9MA 1XICA 3S5OA 1KXVA 3WUGA 2H3DA 2B7PA 2HVNA 4IHCA 3WUEA 1YDVA 4PA8A 2CZVA 2EEXA 3LPPA 3UXDA 4WY0F 4EWND 1CBGA 5BRBA 3SCSA 1TTIA 5E0FA 4HZ6A 3VD5A 3P84A 2XUCA 1UR0A 3EYPA 4QE1A 2A3CA 3BAYA 1VCGA 2C91A 1XI3A 4S3BA 4IP5A 1S2CA 2BHUA 4MNKA 1K9DA 1SZGA 1F3EA 2OB3A 1Q45A 3NZRA 4JGDA 3SGGA 1Q6FA 1P0BA 1H7XA 3L4YA 4UQAA 1TVLA 3LM7A 4H7CA 8XIMA 1BFNA 4KEVA 3O6CA 3PBGA 4O1DA 3SO7A 5T9BG 3VDAA 3B8IA 2ZUTA 3DFOA 4JY8A 2JKAA 3E0IA 3M16A 2E1DA 4IMAA 3TTSA 1E0UA 3RLGA 3USZA 4N9CA 3WLIA 4JTUA 5G1YA 5I24A 2QJHA 3PBUA 2D1ZA 2P5NA 4ZB5A 2FFIA 4RDZA 2NVAA 2FB3A 3SBFA 3WBXA 1FDYA 1DJXA 4TU1A 4QITA 2HPIA 1N8FA 3G22A 3SGUA 3UQNA 1E0TA 1FWAC 4HMNA 5FJIA 1IT7A 2ZA3A 1HL8A 3MUAA 3O6YX 2PF8A 3RMJA 4HU0A 2BNJA 5GPRA 4TV5A 1KO0A 1DJQA 2WVVB 4WJ8A 2FPTA 3F2DA 1SJBA 2J24A 3WQDA 2G0WA 5AYXA 3GNRA 3F03K 4GKLA 2BGNE 2E9BA 4PCSA 4ZCWA 3TWAA 2POZA 3T78A 1D3HA 3NVTA 2OKTA 3THUA 2DW6A 2QT3A 3CAQA 1E4NA 3NQEA 4YTSA 3I10A 4O4WA 5DEZA 5K2ZA 3G0SA 5GQBA 4WKFA 4TXEA 1H60A 1UKOA 4H01A 3ECQA 1JJKA 3IIPA 4S38A 1SZFA 3A5VA 1B2YA 4A8RA 2WJEA 4CCCA 1YTKA 3GY1A 2CYGA 3MV01 3JR2A 5BXTA 3VKDA 4DF1A 1NP0A 1TZ9A 3THQA 3RR4A 4FP1A 3KX6A 1Y5VA 1ISWA 3WO8A 3UA3A 2ZRYA 3SRFA 4A3YA 3OODA 3RM8A 3O0FA 5JH2A 1H1NA 1FWEC 3WQ5A 1CLKA 3RUBL 3SCOA 4MY9A 2ZUNA 2V5KA 1K9EA 3JS3A 4P8UA 4O14A 3W70A 3NSXA 3VIOA 1X96A 3IARA 3LU2A 3LHWA 3W84A 1KBIA 3AIVA 4IWWA 3ITTA 2QUNA 4ML9A 1R85A 3ZJ8A 3P61A 5DANA 3AU6A 3PANA 3T55A 2PLMA 2OLHA 5DT5A 5LSMA 2R8WA 2CLPA 3FXYA 3UWWA 4LS0A 2VQTA 1CIUA 3KRUA 3TOYA 3E5BA 4MGGA 4B5VA 2WHMA 1DWFM 3HGOA 3LZ3A 4W89A 2KAUC 3W7MA 4FNSA 5E5CA 4PEEA 4Z0SA 2P3EA 2G96A 2ACRA 4GNKB 3A9BA 4UTHA 5IM51 5AHEA 2O7SA 3PHAA 4J2MA 2WCGA 4FPSA 5AY7A 2NQHA 2YL8A 5F2MA 1JPIA 3R0UA 4JIRA 3O3RA 3W71A 2BVWA 4PUNA 4MKSA 3S6DA 3NPVA 3WQFA 4H9MA 1NF7A 1QI3A 1XIEA 1UB3A 4YNGA 3KTSA 1H51A 1VLIA 1JUKA 1J0IA 2PDFA 3NTYA 3PB2A 1XDJA 5JH1A 3ABQA 3KOYA 5GNYA 1HKMA 1NFGA 1E6SM 2EPOA 4WZHA 4QP0A 2ANUA 1OT1A 3UWUA 4NJJA 2IKGA 5GJPA 3WLRA 1HL2A 1BWLA 3FV9A 3WF4A 2X42A 4CU6A 3NZPA 3MI6A 1XSKA 1HIZA 2Y5JA 3PULA 4AZGA 1MW0A 1MQQA 3FEMA 4GZ7A 6TAAA 3VM7A 5AC5A 4JKKA 4KIEA 4H6RA 5DRIA 1BPLB 2PZ0A 1BYDA 1ISXA 1XP3A 3AZRA 2FQIA 4GXMA 2JKPA 4TVDA 1FDZA 4DWDA 4XIMA 2ATSA 1G5AA 4ZOEA 3EX4A 3R89A 1EPXA 4J40A 4GVFA 1ZPTA 3PZ9A 3VI2A 3L0KA 2EG8A 3BCJA 1XLJA 3KP0A 1K03A 3LOTA 3QOKA 5GVJA 1H61A 4DLMA 4R34A 4QROA 3PPCA 4WIWA 1UIPA 3UFYA 1W8GA 1R38A 1XIJA 1R2TA 1Q7MA 3TMLA 4NAFB 1MEIA 1VCVA 3MTWA 1TPB1 5AYZA 2VC6A 4J28A 9CGTA 1ZJAA 2XH7A 3EEZA 4WJXA 2WKGA 4AZCA 4XUGA 3M0HA 5HMSA 5F2IA 3BCDA 4ZA0A 1JYNA 1R47A 4UQCA 1B0IA 1S5VA 1UR3M 4AHPA 2OGYA 3GU2A 2XH2A 1XUUA 4OUIA 2DVXA 1XHGA 3B9AA 3ZJ7A 2BVYA 1H63A 3NZGA 1OX6A 5AHMA 2CZEA 3V5FA 5MHBA 4XZBA 1QI0A 2Z24A 3DH7A 1AW1A 2WXDM 4X0VA 3S6OA 2GFTA 3TN3A 2DH2A 3KUMA 4IT1A 4MKVA 2ZUSA 1WB0A 4D6HA 1GZGA 2ABBA 1B3XA 1SSGA 4IL0A 4J3VA 1FX6A 1EBHA 1NQ6A 4KWSA 4OFCA 2YKKA 2ZRVA 5DMNA 4YS1A 1KXTA 2PTWA 1XRFA 4A8NA 3VOCA 1A50A 3ARVA 3GU9A 3KP1A 1MMFA 2JGYA 2XIJA 1TSIA 3M6YA 3I68A 1F3WA 1NOUA 4MF4A 1RV8A 2A3AA 5LZLA 4W7WA 4EAYA 3G1RA 3CAKA 2BOFX 2PDXA 3HIJA 2FLIA 2FZBA 3PR2A 3DFTA 1UYQA 4Y6GA 1VF8A 3ZYZA 4C7FA 4IPPA 2DSUA 3HO8A 4LS2A 2J8FA 3R25A 3M7WA 3BLDA 1WZAA 3GS6A 3A4AA 2OYMA 5A6BD 1ADOA 2MANA 5EY5A 3IIVA 2FKPA 3TTQA 2WBGA 5AZ1A 1KTNA 2QIIA 4TIMA 3WDIA 1AW5A 3C56A 3KL5A 3EZ4A 4PUMA 2W5FA 3G1VA 2IXUA 3L7RA 3SRKA 1J0HA 3LPGA 1XG3A 2OKOA 3PTKA 4BF7A 4Q8OA 3BAWA 4PMZA 2P8BA 2E7FA 1QBBA 1ISYA 3WQOA 2D3NA 4Z2HA 2CBUA 5I07A 1MI3A 2A21A 3GAYA 1I4NA 2XISA 4I5RA 1SVDA 4J2PA 3VDHA 3ZJKA 3NL6A 1BSLA 4FLQA 2OWCA 3P8JA 4OE7A 2PTDA 3S2LA 2Y70A 2VD9A 5BXSA 1V02A 3N73A 1V0LA 1E9IA 2X09A 3K8MA 1KRMA 3O9NA 2YX0A 2WVSA 3I7QA 3OLIA 3HZ3A 3FA5A 2GK1A 1TJ0A 1OIMA 1TYGA 3SGZA 3CEUA 2TRSA 2RJHA 2WO5A 2Z2AA 3CASA 2POTA 5AVNA 1KR0A 1TE1A 4IXXA 4XAZA 2H9AB 4J35A 3FAXA 1I1XA 5AYYA 3HG4A 2WW5A 5CAKA 1PS9A 1KRAC 3C61A 2RDUA 4PODA 4LBSA 1F4AA 3SN0A 3TQ0A 4M6UA 2OEKA 2JE8A 1KM2A 3IV3A 3DC0A 4TX9A 4YJ5A 2AMXA 1L6YA 1JULA 1FTXA 1EJSC 4ICCX 3M47A 1LBMA 2PCQA 1ZJHA 3S5ZA 2D2OA 4C6MA 4EXQA 3A21A 4PMVA 2YOCA 1BKSA 3W7GA 4DBWA 1VCFA 1S2WA 3SCPA 3QH2A 1RD6A 3NNTA 1TWSA 1TMHA 3LTSA 1L6GA 4UQBA 5IHSA 3OZOA 3O15A 3T44A 1XW8A 1I45A 4N4QA 4R27A 2XVNA 2Z1KA 2XGZA 3U48A 5LA1A 2Y88A 3KOWA 1RUSA 2KZHA 3LHZA 3S5SA 2PEVA 4LUTB 3A23A 1P7TB 5I00A 1US3A 1HXJA 2GDUA 1HL9A 1VLWA 3G1SA 3EDKA 1QT1A 2HK0A 1Z69A 4GNVA 4XQ6A 2WOQA 1MNSA 1UUOA 3GVVA 4AUBA 4F40A 5A8NA 2J88A 4NY2A 2Y8VA 1WKYA 3WUBA 1WOBA 4AXKA 1BQCA 4AX7A 3W6YA 3LY0A 2NUXA 4IXHA 1RA5A 3G5EA 2PDPA 5GNXA 4S3GA 3KDNA 1QK2A 2QJJA 4MPQA 4LEQA 3QHMA 2E6YA 5BNKA 3FLUA 3E3HA 3WD0A 1YEYA 1EIXA 2PFHA 3MBDA 3G24A 7CGTA 2DT2A 2CBJA 3SQMA 4H04A 2VD8A 3BC9A 3M5ZA 1W5MA 3IEBA 3U4AA 2DH3A 1V7YA 1EHNA 5E70A 2YB4A 3PBWA 4I8DA 1MXGA 5AN7A 1PB0A 4MADA 4C6DA 3FHQA 2ZA1A 5BMWA 1PKLA 4L1GA 1DTUA 1GTHA 1Z7AA 1EA0A 2ZVRA 3GVRA 2A6NA 4RNHA 2DJXA 3ZLFA 1LYXA 4Z0JA 1DXEA 4IMGA 2CNCA 3UZXA 2WVVA 4W93A 1HZYA 1DWHM 3MW7A 2V3EA 3HGJA 3BJSA 2V2CA 4IMDA 1IGWA 1B4KA 2E6DA 1KBKA 4H19A 4UFLA 1IT0A 1TQJA 1U5HA 1V6UA 4O18A 3TCSA 4HU4A 4XBKA 3VCNA 2QNEA 2A3LA 3WMLA 1XIGA 1K02A 5CQ1A 4YPJA 4CN4A 5CGQA 4JDBA 3SIMA 2V5BA 3REQB 2XG9A 2PD9A 3PTDA 4G8TA 1C92A 1W5QA 2QGYA 4BF9A 4Q6XA 4ZSUA 1VFLA 2ZZ7A 1KXQA 1L8NA 3GW0A 4PC8A 4ZO8A 1YBQB 4MM1A 3ARSA 3ZOAA 3PZTA 2OO6A 1XYBA 2W9MA 3FKRA 2DY3A 2XGIA 3BPWA 4DVOA 4BWLA 1JNEA 1RK5A 2WVTA 4MLRA 2DU2A 3KWSA 5LIXX 3IUDA 1P1XA 2QUUA 3DECA 1E0XA 4CVUA 3O1NA 4UZSA 3P0XA 4UQDA 3PM6A 1QWKA 1BTCA 1FWJC 4LY8A 1FA2A 2J7FA 2RDTA 3UXKA 4E8DA 2PWVA 5J5DA 4U5KA 3KBWA 3RXZA 4ZR8A 1KBLA 3V1HA 3F5LA 1V6VA 3C6CA 5T91A 3WMSA 3LS9A 4F0KA 1K7EA 4NJHA 5GJMA 3DHPA 1XLKA 5FJUA 3TYEA 2CETA 1NSJA 2Q09A 5KZMA 1POJA 3GC2A 1F8MA 1HJVA 2HTMA 2GQAA 3PF3A 3TTYA 4XAPA 1WZLA 2BASA 3PJWA 5FJRA 3O6DA 1VR6A 1GKQA 2BHYA 1PKMA 1S3TC 4CD6A 2ZXBA 2YDQA 1R30A 3B8WA 1M1BA 2V82A 4JQ2A 3UA4A 3SN1A 5C9UA 4EX4A 4XIAA 3WQGA 1V6TA 4YCPA 1JDEA 3PWIA 4MAZA 4AC7C 1R2RA 4GQGA 5CSYA 5LIYX 3STPA 3E9AA 3H4GA 1JF6A 3QZEA 3S9YA 2OJPA 2ZDSA 1WP6A 1CGVA 1YHTA 1FWFC 3BZGA 1ZCOA 4F0LA 5L9FA 3L5MA 3WF2A 4JTLA 3TC6A 5K9DA 4HN8A 1JCMP 4QG9A 4XVDA 3JRKA 1TCDA 1R0MA 1J10A 3KFTA 5A3HA 3T05A 1WQ5A 4MJ2A 1O6IA 2NV2A 2OT1A 2ESCA 4PUKA 5D03A 5M3WA 2DZBA 1YNPA 4PB5A 4B2DD 1ME9A 4UB9A 4NU7A 4R9OA 1VFTA 2QCCA 1DKWA 3GG1A 1RQEA 3TKFA 1GCYA 3T9PA 4RK8A 4ROQA 3A24A 1XLBA 1W6TA 2G3FA 3NGFA 2XH0A 4L6OA 3XISA 1LORA 1UR2A 4MWAD 3KVKA 3HPAA 3CMJA 3LPFA 4LCSA 5HUPA 4UXDA 3UYCA 3LMZA 1TKKA 3W76A 3E2QA 2ZKMX 1SJCA 3RDKA 1AL8A 2O0TA 5CBJA 4NAFA 1JCLA 4Z08A 4K6AA 1TPDA 4EWJA 6REQB 3VC5A 4O1EA 3UWQA 3B8DA 2VYOA 2YBVA 4OBRA 4U5IA 3QFWA 1VFSA 4A21A 1QPRA 1UP2A 3KRZA 4AIBA 3W2NA 1NIUA 4HA4A 4O11A 5DCBA 1ZS2A 1R2SA 2WC7A 1FWDC 1JZ4A 3TJLA 2YBTA 3HMCA 3GTIA 1HNYA 4A6GA 4XUYA 3AIQA 5C5YA 4GWEA 5ABTA 2IW0A 3M44A 3BO9A 3LQGA 4DJFD 4MAVA 3U2CA 1NF0A 3M5VA 2DDXA 4IGHA 3STCA 4KWUA 1O5RA 1KM1A 1T7LA 3N25A 4P7NA 2E25A 4RPPA 3RX3A 4XD6A 1J12A 1T8XA 4AISA 4NI8A 4MDPA 2OX1A 4W88A 1KCZA 4RDVA 2X2GA 4HSHA 2WZTA 3OLDA 4YTTA 4NF7A 3AYVA 3SUUA 4XAGA 1S5NA 1Y7VA 2OQLA 3PSVA 3QW4B 5HOSA 2FTWA 1ZB5A 3VOHA 3N3TA 3R0KA 1E1EA 3TIMA 3NL3A 2OR2A 7TIMA 3NYZA 2NLYA 2AGTA 4M8UA 1BVNP 3NOEA 1ZLPA 1XH0A 1TTPA 3W1TA 4L9ZA 1D9EA 2V38A 2XPKA 1VYSX 4FX6M 3HOJA 2CHOA 1HP4A 3GHSA 4KRUA 1AVAA 4CQAA 5AHIA 4JBRA 1EIBA 2Z26A 1F7BA 3TONA 4BY3A 5AC7A 1FHDA 3UZZA 2ZX9A 1JCNA 1UASA 2X40A 4KGJA 4HOXA 4JYEA 1JQXA 2E40A 2AAMA 2PWEA 3VYLA 7REQB 4PEKA 4FXSA 1RD5A 3E6EA 3QVQA 1Z32X 2DQWA 1B3WA 2G3JA 1H7NA 3SRDA 4AWEA 4DRSA 3B8SA 5EMJA 3P0WA 4QM1A 1RAKA 3KW3A 3IJ9A 3U6WA 1LLWA 4DLFA 1UHVA 3CMFA 3F2CA 3NQDA 3AROA 3FHAA 3QHNA 3RILA 5I77A 3GG7A 4B4HA 3TYAA 1I0DA 1A5SA 1M3UA 3H2CA 4B90A 5HPCA 1Q7QA 5GNZA 3AHXA 4GH1A 4IPLA 3IIOA 3GXIA 3GO2A 2GVEA 1GJPA