4O50A

Crystal structure of trichomonas vaginalis triosephosphate isomerase ile45-ala mutant (tvag_497370)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
252
structure length
252
Chain Sequence
MRTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFAFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering mutants with altered dimer-monomer equilibrium reveal the existence of stable monomeric Triosephosphate isomerases
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 85
structure length 252
sequence length 252
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o50A00
3SIZA 4ADUA 4Q33A 4O52A 3CQ0A 3G1FA 2C1HA 3DHFA 4MJMA 2WNNA 3HIJA 4RKAA 1YYAA 2B7OA 2P0OA 2Q3OA 2OX1A 4HIBA 3W7MA 2QUUA 4POCA 3LERA 1X8FA 1SW3A 3LXBA 4ZQCA 3N14A 3NOEA 4JTFA 5C2XA 5LNSA 2XN0A 3FYPA 1TQJA 3L0NA 3MHUA 2CZFA 5CSRA 3LCHA 3NPXA 1XBXA 1I45A 2I1OA 2DP3A 3QW3A 3BGGA 4N2YA 3MI6A 4IMGA 3DBPA 3UPWA 1L9WA 1H1YA 3DFPA 1TTIA 3UZ5A 2QJIA 4DO5A 1LM1A 1K7EA 1SO5A 2CLLA 1MXSA 1OFOA 3ELFA 4GUJA 1A5SA 5G4WA 2TSYA 3LRMA 1QCWA 3GYEA 2R14A 3LV6A 4AF0A 4R7JA 4LV4A 5ABTA 3W7RA 2CZEA 4GC4A 3M16A 3THAA 4AVFA 1PVNA 3TQ0A 3DI0A 2UV8G 4NZFA 3EX6A 3DHDA 3N73A 5AYZA 5D38A 1K8XA 4MLJA 4WD0A 4AAJA 3MW7A 1K7XA 5EYWA 1XCFA 3DFNA 3G1XA 2EPHA 2WOQA 2H3DA 4JTKA 2A5HA 1AW5A 2VFIA 3L65A 2J24A 3NPUA 3PB0A 2QEZA 4PODA 4CCEA 3GDLA 2JKPA 3FJLA 5CZTA 1RZMA 4O15A 3GAYA 3LXCA 5DELA 4N4PA 3QFEA 4WOZA 1K7FA 4K6AA 2C6QA 2QDHA 2V2CA 2VEMA 2BSLA 2CZ5A 4XQ6A 5CGQA 3HOJA 4AHQA 1EB3A 2ZRUA 1P0NA 1FXPA 1TJRA 2V82A 4AEOA 3RLVA 4NQ1A 1ML1A 1X1OA 1PHQA 4JY8A 1H7WA 4FXRA 2OCZA 2ATMA 1TRDA 4ZMGA 3HG5A 3M44A 4M6PA 1MZHA 1PE1A 4XKYA 3PY2A 3N19B 4MY1A 1ZALA 3ABRA 3MO7A 4O28A 2QUVA 2H8XA 2QCCA 4BWLC 4WOQA 4O50A 4AB4A 5FF7A 3CEPA 3GNNA 4N9EA 3BGJA 3UYCA 2OMAA 4R33A 3SSJA 3W9ZA 3CWNA 2JKEA 3QH2A 2DZWA 2PRLA 3LHWA 3PUDA 4IPJA 2B4GA 3W1TA 3WJYA 4BK9A 5L9FA 1GVQA 1FY6A 1JR1A 1VLIA 4AMAA 5D37A 2ZRVA 1A50A 1R30A 3A23A 3UQNA 5HWNA 2A0NA 4HSNA 4JIPA 2XFWA 3RMJA 1PV8A 4FNUA 5KINA 3C2VA 4M6VA 1WOAA 2FPYA 3G1SA 3TA6A 1X1ZA 3RF9A 4ALDA 1KTBA 4PL1A 1VR6A 3EXSA 2X30A 2J27A 4I7VA 2XN2A 5CKSA 1QDSA 5LHEA 2G95A 1PS9A 3LHTA 1LOSA 1WBHA 2ZRYA 4TX9A 3KRSA 4ZZ9A 4UR8A 4GXMA 1P5BA 3L9CA 3BW4A 5KMYA 3B0UX 5AC6A 4UFMA 3VKJA 4DO6A 4EIVA 2VENA 4DF1A 1JCJA 4RCXA 3E9AA 1KFKA 3HG2A 1DOSA 3PS7A 1XUZA 2J88A 1GVSA 1HG3A 3NQEA 3PG9A 3GKFA 2YX0A 1OX5A 3HF3A 4HNNA 1ME7A 4RXGA 4IXHA 3WJWA 1KLYA 4RX0A 1GG1A 2QCLA 1XM3A 1DORA 4QM1A 3NPWA 2YDAA 2HS6A 1KV5A 1QWGA 3MYOA 2H3BA 1JQXA 3EB2A 3TK7A 1F6PA 3V75A 3RFAA 2FLIA 2X1TA 4P61A 3IVTA 1TPWA 2G5WA 3BLEA 2VC6A 2FB2A 3F4NA 1FCQA 3IGXA 1VQTA 4E2BA 4UTTC 4K39A 1LCOA 1SSDA 2CFFA 5AN7A 3SW6A 3W2UA 3EXTA 3NL2A 3MYPA 4JYDA 3G3MA 3L5MA 1VCVA 5G2WA 5IM51 3LBCA 3HPSA 3THQA 1GVFA 1TPDA 1H7PA 1G4EA 3R13A 4FNTA 2CLMA 1H63A 3W83A 3O06A 2EAWA 2NLIA 3S1WA 4O17A 3NYZA 3WK3A 2QCGA 3O8AA 3S9YA 3NPVA 4ZQNA 4G1KA 4Y6GA 2Y7GA 4YLWA 3SGUA 3BG9A 4JTGA 4DBDA 1JJKA 5SWUA 4O1BA 4BI5A 4UFIA 3VE7A 2C14A 4MYXA 1YADA 3NGJA 2JK2A 1K02A 4DQWA 3UWQA 3R89A 3DXIA 3OVPA 3MHGA 3M5ZA 3WFAA 3W1QA 1K8YA 1R2TA 3LV5A 3W2NA 4K37A 2ZZ3A 1W5PA 1OFPA 1I2NA 3DGRA 3S1UA 2Y7EA 3L5AA 1H61A 1YTDA 1XFBA 2AGKA 4LC8A 1RPXA 3CIWA 1UUOA 3N3MA 5BNKA 1JCMP 2FTPA 1YPFA 2E5BA 1VYSX 3GDKA 2QR6A 2A6NA 2Y62A 4LUIA 3B0VC 4WJEA 4R34A 1GG0A 2WNQA 4MLRA 3EWYA 3A5FA 3A22A 4ADTA 3RU6A 4DBEA 4N6EA 3BK0A 4PC8A 2GVJA 5D2XA 2HMCA 2FDSA 1XC4A 5HMSA 1JCNA 5DY2A 3N9SA 1C9DA 3L67A 4OHQA 1ZHAA 3QSRA 4NX5A 3W22A 2FJKA 3LTSA 4NVTA 2GVGA 5GVJA 2C19A 4O14A 1T0OA 2TPSA 1EP3A 1G4PA 1H50A 5K9DA 2R91A 5C55A 3O6DA 2A7NA 4IMFA 2E6FA 1Q6QA 1OVDA 4M7TA 4NJKA 2CLOA 1FDJA 4NNBA 3WJSA 5LNUA 2VFHA 1SUXA 1QMLA 5T26A 3UY8A 2Y7DA 3EX1A 4XBKA 3EKZA 3TXVA 4O0ZA 4DPQA 2PRHA 2ABAA 4E2DA 1G67A 1J2WA 3C6CA 3V1PA 4QISA 4XWUA 4NJGA 1LOQA 4KWVA 2OT1A 1TQXA 5HR6A 2HS8A 3M1ZA 3HB9A 3DU0A 4BWLA 4FIQA 5AHNA 1A53A 3TSMA 3KHJA 2V5BA 4QITA 5H2ZA 4UR7A 1H60A 1W54A 1IXQA 3TXZA 2PURA 2V5LA 2HTMA 1TCDA 1JRBA 1NVMA 2A85A 1SU5A 4OV9A 1GYNA 3STEA 1YDNA 3KFTA 2C18A 4XTDA 3P82A 4JTJA 3D0CA 3TSDA 1F05A 3LCGA 3S5YA 4UXDA 1FDZA 4N4QA 3CLMA 2DZXA 4UFHA 5F4XA 2NX3A 3QMSA 3I68A 5CPOA 1H5YA 1ZFJA 1TJPA 2RH9A 2NZLA 1TPH1 1SFJA 4WY0F 3S5OA 1Z48A 5CG7A 2DU2A 5CSSA 4H3DA 3NA8A 2WQPA 1W3TA 1S5WA 1QNVA 3SJ3A 4LC6A 1IF2A 4LY8A 3W7JA 2W79A 5D05A 1OFDA 4LVFA 3DENA 4FB7A 1R2RA 3UWVA 2WSYA 1CI1A 4NU7A 2TYSA 2E6AA 1XKYA 2Z6IA 1M5WA 3I7RA 1UCWA 1FWTA 3LCFA 2RHGA 1NSJA 4O4VA 2W6RA 5D2VA 2A4AA 3IGSA 2V8ZA 1TV5A 1GVOA 4JGDA 1V5XA 4FNSA 1GOXA 4D2JA 1I2PA 3G3DA 4UC5A 2EGZA 3A24A 1OYAA 5F2GA 1W5MA 3GAKA 5AHIA 1QR7A 1W5NA 3TJXA 1P1XA 3VNDA 4JDYA 1C29A 1UB3A 4WX2A 4JX4A 1XXXA 3LB0A 1ADOA 3E02A 4FX8A 3FOKA 3M9YA 4QAIA 3HGJA 3M41A 1DQXA 4AWSA 1S5VA 1YLVA 3F1QA 1CX9A 4IMEA 1OF8A 5CZ0A 2CU0A 4ZQOA 1SO6A 2ZA2A 2GOUA 3LX9A 3MHFA 3WK0A 2NV1A 1H7NA 1PHWA 4O57A 2QJHA 3ZFHA 4EVZA 1O95A 3C56A 3KVJA 1MEIA 1ICQA 3W86A 4A22A 3JS3A 3TC6A 5LGXA 4KKXA 2BLEA 4WZHA 1M6JA 1TMHA 4J9JA 4LUJA 3EWWA 5HJLA 5LSMA 2F7FA 5D03A 3NL6A 3IIZA 3W23A 3DFQA 5I3JA 3N2MA 4O1CA 3HJZA 3T55A 3HG3A 4CCCA 3PWAA 4PCFA 2JBMA 1JUKA 3C8FA 4LTSA 1Z42A 1LRQA 3BVJA 3S1VA 3WK2A 4RZ5A 4PEKA 2O7QA 3E0IA 1XL9A 3IIPA 3VFLA 2WNZA 5HULA 4HSOA 5F4SA 2FB3A 4IOTA 1SW0A 1EA0A 4O4WA 4UTWC 3OVQA 1G4SA 1WAUA 4OBTA 4UMBA 3BG5A 3IVSA 3NQMA 4M6QA 1EUAA 3UWWA 1WX0A 3QMTA 1YPIA 3TE9A 1JRCA 1FQ0A 4ZVJA 5AYXA 2NXHA 3W1PA 5G1YA 4KFOA 4I7WA 4JR5A 2ZRZA 3I7SA 3FKRA 1FDYA 3NQ8A 4ML9A 1XUUA 4FNPA 5D2TA 2QCDB 2VEKA 3C52A 3HGOA 4JN6A 3G8EA 4O53A 3DFTA 2B7QA 4K8HA 1ZNNA 2ZZ6A 1Y0EA 1YXYA 3BW2A 2PC4A 4YWIA 1VS1A 4HNTA 5TQLA 2ZTKA 3W85A 3WJZA 3LHUA 3CM4A 4LRTA 3FA5A 3PULA 4UTUA 1PL9A 2I9EA 5KTLA 3S1XA 3P60A 2J6XA 3C61A 3NL5A 3ATYA 4S2CA 3S5ZA 3W7DA 4ADSA 5U4NA 2FPTA 4JTSA 3EX4A 1RQBA 3TMLA 1QO5A 4JTTA 1QPQA 2ZZ7A 2EKCA 3RK8A 5F1VA 4O0KA 1MEWA 3C2EA 4FHAA 2VKZG 2Y6ZA 2GQ8A 1S5TA 3QC3A 1RVGA 3P74A 3BARA 1SPQA 2X1RA 3HPXA 1B4KA 5D09A 2RFGA 3TIMA 1SSGA 3O63A 4Z0SA 3QW4B 4ORIA 5BW6A 4UMAA 2PE4A 1TV8A 2EHHA 4O11A 1QPOA 4E38A 4HN4A 2NV2A 1RV8A 4CNPA 2V2DA 1OYCA 4DF0A 5IBXC 5HR7A 1YTEA 2HSAA 4O8RA 1JQVA 3HMJG 2YSWA 2DZVA 4YCOA 5FESA 2Q3RA 5FEPA 4AWUA 1OFEA 1OG0A 1QOQA 4X22A 5K4ZA 2W0UA 5FF0A 2A7RA 3QRHA 1DKWA 1RD5A 3OVRA 2P1FA 2CLFA 4JYFA 3TW6A 5DLCA 3W7CA 4Z08A 3GB6A 1EP1A 3EKLA 4UFLA 1IGSA 3DAQA 5DBTA 2X16A 4IX2A 3B06A 5A8GA 3L66A 1SQ7A 3CT7A 1IIGA 4DELA 3QPZA 3NQ6A 1A5BA 3BG3A 3DKJA 4NXKA 2WPBA 5CZSA 1TTJA 2GQ9A 2YYTA 4LVDA 1C8VA 2VEIA 1F2JA 4AXKA 3CEUA 3NZRA 1ZENA 4YXGA 5HNRA 2I14A 3C2FA 4PL2A 1GWJA 2WO5A 2C0AA 2Q8LA 3SGZA 4CNOA 2ZZ1A 3G0XA 2Z6JA 2QCMA 2Z1BA 3MMTA 2ISVA 3BO9A 3E49A 3UNDA 5LNRA 2GJLA 2B7NA 2QCHA 3FFSA 3O16A 4LVGA 1I2QA 1IXOA 5F1UA 6TIMA 3LLFA 4OU1A 1B4EA 1D3HA 2YCEA 5HUOA 1TPVA 4GUGA 4M5PA 2IQTA 1BKSA 5EMUA 5BMXA 4S1FA 1K03A 3OBKA 1U5JA 3FYOA 4LNYA 3O6YX 3OIXA 3YPIA 1YTKA 3FKKA 2CLKA 2BX7A 3W74A 1NFBA 5BRBA 1H1ZA 2ZRXA 3B0PA 5EL1A 4CQAA 3BW3A 4NZJA 3UWYA 1THFD 1FCVA 5KZDA 2QAPA 3IIVA 1KM6A 4JTIA 3TAOA 5D02A 1SZEA 4LS2A 5F2MA 3VI2A 2A1YA 4X3ZA 2ZRWA 3P61A 5D30A 2DZTA 4XZ9A 3UXAA 4MY8A 3M7WA 3LHZA 1BEUA 4LT9A 1FBAA 2R94A 4CQ9A 4JICA 1VRDA 2ZA1A 3UWUA 3FS2A 5D2YA 5DCDA 3Q37A 4WXZA 1ICSA 1AG1O 3VCRA 1WDWA 4JTUA 4MIMA 5CPMA 3ZS4A 2NUWA 4OV4A 3LGEA 2OT0A 4UTTA 1WOBA 3STCA 3KVMA 4O18A 4AHOA 3EX3A 1UUMA 3TMQA 4DF2A 2Y7FA 4CQ8A 3SR7A 3BV4A 4WUIA 1EWEA 4EF8A 3K30A 1V7YA 1ME9A 3QF0A 3FIGA 2QUTA 3L5LA 1KBIA 3PSVA 3IVUA 3Q2DA 1KM0A 3QJAA 3NQ7A 1FCUA 4TR9A 3L68A 2ZDRA 3NM1A 3G18A 5J5DA 3W1NA 3W7EA 4Q4KA 3L0GA 1KFCA 2YW4A 4JX5A 3T7VA 2GJNA 4HNUA 4E0CA 3MBDA 3LCXA 3LTPA 5AHMA 4OWGA 1GZGA 2GVLA 1ZY9A 5TIMA 1YDVA 1M7OA 1A5CA 1T8XA 3LOTA 1RQHA 2Y63A 4JD4A 3P62A 3DFOA 1W5OA 3GK0A 1GYLA 1LROA 1AL8A 4AWTA 2VFFA 3ATZA 3MBFA 3HQ1A 3G1HA 2VEPA 1J5TA 1VYPX 1FWWA 1KFEA 1N7KA 2JGQA 1ZAHA 5BMWA 3IV3A 4IUOA 1LBMA 3NQ2A 3CB8A 4IPIA 4I7UA 4RXFA 2VFDA 3MI2A 2NX9A 1EPXA 3KXQA 5EBUA 1KM2A 4XTIA 1D3GA 3KX6A 4TU1A 5LHFA 4FF7A 4QQ3A 3U8GA 2CLHA 1KM5A 4K38A 1OF6A 2BTMA 4N6FA 3UWZA 3G1YA 3MP3A 4JIQA 2CW6A 3G24A 4TO8A 2PCQA 5FEXA 5LNVA 5G2HA 4A29A 3SFKA 5E0KA 5C54A 1O5KA 1D9EA 1KTCA 1LLZA 2WKJA 1MO0A 2ZZ5A 3IRDA 3NO5A 4H4IA 5DCBA 2QCDA 3QQ0A 3H54A 3BPWA 4KFNA 1LZOA 2PRMA 4GUFA 1T96A 3C2OA 1FCBA 1WXJA 2WSQA 3W2LA 5I3GA 1VH7A 5C5YA 4O1DA 3R8RA 1I2OA 2WSRA 4DPPA 3CTLA 7TIMA 1LTDA 1G6CA 5HWJA 1F76A 3GKAA 4XUGA 2J9YA 4FX6M 3T78A 3TX9A 3P80A 4O12A 1LYXA 4MYAA 1EEPA 1P4CA 3EWXA 5F2IA 5AB3A 4C1LA 5AOUA 3LI0A 1EX5A 3F4WA 3P8IA 3ZWSA 3HGRA 4GE8A 2G97A 4PH6A 3M43A 3PVFA 4RK8A 4N9DA 4U4MA 3W75A 3N9RA 2NUXA 2ZBTA 4UTJA 4JYEA 1IXNA 1TB3A 4Z1CA 1YXDA 3GXNA 5DXYA 3P5YA 4QIUA 4ZL1A 3UZJA 3W3OA 4LS0A 1WQ5A 2BXVA 1QAPA 2YFOA 1WYIA 3PBUA 4ZQMA 3M5XA 4B5NA 4HNVA 4C1KA 3PBWA 4K7YA 3O07A 3NXFA 2GQAA 5U7SA 1CW2A 3TH6A 4LOCA 1XDMA 4ONVA 1HO1A 1OX4A 1UASA 5I3KA 2P10A 1RR2A 4HHPA 4P2VA 4MKNA 1TIMA 4BF9A 4UTHA 2AQWA 3TROA 1EWDA 4BR1A 2E68A 2YW3A 3W70A 3RNDA 3NG3A 1KBJA 1Q45A 3W7HA 1ZAIA 3AO0A 4X2RA 5K4XA 4RR4A 4RZ4A 1KV8A 2DZUA 3W84A 2EF9A 1GQNA 1M7PA 1AW2A 3PC0A 3UD6A 1LP6A 3B04A 4XBSA 5AHEA 1H51A 3MWAA 3KAOA 3LCWA 5K7JA 2G96A 2H6RA 4GFSA 3GXTA 1ZCOA 5HQEA 2A2IA 2A6LA 5D32A 4LRSA 5AC7A 4N9BA 5FF3A 1NF7A 4H6KA 4LW7A 4CNNA 1LOLA 1XBZA 3DFSA 4LVBA 3P67A 2C15A 4XKYB 4WY0A 4X9SA 5LZLA 3DI1A 3KRZA 2RDWA 3TDFA 6ALDA 1SZNA 1KM3A 2AAMA 5I3HA 3PBVA 1UJPA 1H7OA 2ZCGA 4TIMA 2D73A 3MI3A 3U6WA 3P84A 3SY5A 3G1DA 2DJXA 1G7VA 4RZ6A 3W2JA 1NF0A 4MJZA 2CZDA 3W7IA 2E6YA 4LWWA 1W8SA 1J4EA 5HINA 1Q3NA 4HPJA 1EUNA 3W88A 4NX0A 3H55A 2Y61A 1F74A 5KSWA 1K3UA 3HGSA 3W73A 5KITA 4MUZA 3EWZA 5CZJA 2WJZA 5A5WA 3TUUA 2OZ0A 1KFBA 2Z0IA 1GT8A 1LBFA 3SECA 4UFJA 4I9AA 1OK4A 3HBLA 1Z41A 4Z0JA 2TMDA 3W71A 4NNAA 4CCDA 1W5QA 2V0TA 3ANYA 3PSWA 1TYGA 2CLIA 1LRTA 4O13A 2GPTA 3W7QA 1FXQA 4RV8A 5AFDA 1VLWA 3W7KA 5DN1A 1QFEA 4K36A 3T40A 1AK5A 4N9CA 4EWND 2E5DA 3LBMA 8TIMA 3SZ8A 3H53A 3LLDA 3EWBX 3BLIA 1VGAA 4HT3A 5I3FA 4NT0A 2YZRA 3A21A 3QZEA 4PTNA 1TO3A 4MZYA 3HO8A 3TV8A 5EPDA 1DQWA 1DL3A 4FEZA 1Z44A 3EXRA 2JKAA 2RDTA 4CLMA 4M19A 3NQFA 3W72A 1FX6A 3NQDA 2F84A 5H91A 2X2GA 1FWSA 5IBXA 4JNMA 1H62A 3QM3A 1LLWA 1WV2A 5MHBA 1T99A 5KZMA 2ISSA 4MPQA 2C3ZA 4ZQPA 2VELA 3TFXA 3CHVA 1TRIA 4FX7A 4LS1A 1R2SA 3OG3A 3JRKA 4ORMA 3S6DA 1W3NA 3TNOA 2CLEA 5AHLA 3I6RA 3IGUA 5K3VA 3L21A 1XDLA 1E51A 4TMBA 1F6KA 1VYRA 2NXGA 3P5ZA 2ATSA 5FEWA 2ALDA 3LHVA 4DEFA 4IQLA 4O19A 1W31A 2ABBA 1UBSA 1AMKA 4UMCA 5G2IA 2QKFA 3KVKA 3GDMA 3C0JA 4UUIA 3F03K 4GUIA 1G7UA 3GDTA 1XBYA 1KLZA 4GUHA 5FF2A 1EP2A 1O5XA 2JGYA 2Y70A 4FNRA 1BWLA 2H90A 3OEXA 4N02A 2RDUA 3INPA 3GVGA 1SO3A 3FLUA 1TREA 1H7XA 5KZEA 4K7VA 3LTYA 4FNQA 1A5AA 4JX6A 3UXDA 4MVAA 5D04C 3A5VA 1WA3A 2J9ZA 1RQEA 4PFMA 2ZTJA 5EA9A 5K9XA 2O7SA 2TRSA 2V30A 2NWRA 3STFA 3G8RA 3TR2A 3NEVA 4GRSA 4L4MA 4Q32A 3STGA 3QYQA 2VOMA 3GNDA 4PA8A 1VCFA 1DV7A 3GXPA 2ZQ0A 4OGZA 5I3IA 3MJYA 1JUEA 3LRKA 5K2ZA 4MZ8A 1L6WA 4AHPA 5K9CA 2YR1A 3WK1A 3W1UA 4HKPA 1O4UA 4FO4A 1W0MA 3LDVA 3U2OA 1TPC1 1TPFA 1N8FA 1X7FA 1GTEA 1W1ZA 1R46A 4JTEA 3CPRA 5AHFA 3OA3A 4WXYA 3QMRA 3S8HA 3W87A 4A3UA 3W1RA 3W1LA 1ZAJA 3W7NA 1I8JA 4KWWA 1XBVA 4NJIA 4O16A 1VPXA 3RLUA 1JVNA 3NNTA 1B57A 4NXSA 3GIYA 3M47A 3VE9A 2C13A 2DORA 2ZZ2A 5G4EA 3PUEA 4RJEA 3QSTA 3B05A 3T44A 3S42A 1JUBA 1LDCA 4S2BA 1OX6A 2Y89A 4DO4A 4Y8FA 2LLEA 4BI7A 1OYBA 1XI3A 3LM7A 3B4UA 4IMDA 2CWNA 3O05A 4LV9A 4GBUA 1KTNA 4DXVA 1MSSA 1DBTA 3PAJA 3PB2A 3NQCA 3QQ1A 4MOZA 1DJQA 1O60A 2V9DA 5DBUA 1SO4A 1KM4A 3NZ1A 2V2HA 4KFPA 1QOPA 3N2XA 3CU2A 3M0ZA 1HUVA 4FXSA 3CWOX 4UCGA 3PF3A 3M5VA 2GUUA 4O10A 3TC7A 3TQKA 2RKXA 3NDOA 3IIXA 4UTMA 1GEQA 2E77A 3NR0A 4JS3A 3W7PA 2QAFA 2BZNA 1FWRA 4QNWA 4UFKA 3IIOA 2OJPA 1BWKA 1G4TA 5TBOA 3W07A 2VFEA 3TFCA 4OT7A 3TKFA 3C3NA 1G69A 4IJBA 5CPLA 3P7YA 3GR7A 1ALDA 2DZPA 3O6CA 5E93A 3BLFA 2C16A 4EF9A 2VXNA 2YFNA 4ICNA 3W2KA 4YMZA 1KFLA 3C4UA 3ABSA 3E96A 2H8ZA 1PCKA 3L0KA 1IIHA 1S3HA 3P8JA 4Y9AA 3R2GA 3DH7A 1OABA 3KVLA 4MFEA 1FWNA 2QDGA 3B03A 4JTLA 1GPWA 1W37A 2ISWA 3T4CA 1OJXA 4OQVA 1MEHA 1ME8A 2NUYA 1B9BA 1HL2A 4M7SA 1LORA 2V81A 3W7OA 2FQIA 1LRNA 3AJXA 1TTPA 3UY7A 1ICPA 2E6DA 4UTKA 3C2RA 3LCIA 5DXXA 1QPNA 3G1AA 1DVJA 2YGYA 1VCGA 2FFCA 3W1MA 2E09A 1KA9F 3A9IA 4BFAA 1SFLA 1QO2A 4IX0A 1ZJIA 3TQVA 1PIIA 2Y88A 1SR9A 1EIXA 3TCEA 2B7PA 3LHYA 5HWMA 1JCLA 4UNLA 4UIOA 2FIQA 1K8ZA 3O1NA 3NM3A 3O15A 2R8WA 4JTHA 1OFQA 4GWEA 1W3IA 1WBJA 4WY0B 3R5EA 1L6SA 2Z2UA 3M6YA 1VHNA 3GZ3A 1P0KA 4Z1AA 1AL7A 4O54A 3UPBA 4YL2A 3ABOA 3W7GA 5C6MA 3KOFA 4R53A 3E12A 4Y90A 3LCLA 5AYYA 3USBA 3G0UA 3NQVA 1OK6A 2BWGA 5EKYA 1OFBA 1LBLA 3EWUA 4HPXA 4TMCA 1X6UA 3PR2A 2QF7A 4QJ1A 3CC1A 2WV8A 1O94A 5FF4A 3R12A 1TV7A 4QSHA 3KRUA 1AW1A 3W1AA 4IMCA 3DZ1A 3G22A 1QPRA 4JXCA 4UTIA 1W56A 3TW7A 3TU9A 2DZSA 5F2LA 3DKLA 3TJLA 4BI6A 4Z1DA 3QEZA 1TTQA 4AH7A 4NUWA 3TSBA 4FIRA 4K8EA 2KZHA 4UNKA 4JEQA 3W1XA 1KW1A 3W7LA 2QCNA 1SW7A 1TSIA 2NXIA 3G0SA 3HG4A 1Q6OA 3MP4A 1ONRA 1TPEA 3PBYA 1YDOA 1F5ZA 5F4WA 2YPIA 2NWSA 1L2UA 1F7BA 2E1DA 4NJJA 1GVRA 1L6YA 4O1AA 4U28A 5BOOA 4IWWA 3N34A 3TAKA 1VC4A 4NJHA 1BTMA 1DJNA 3W76A 1GJPA 2A7PA 1TPUA 1HO4A 4A21A 3Q94A 3I65A 5J5RA 3NVTA 3NL3A 5AC8A 5HUPA 4Y96A 5LNWA 3FEMA 2FPVA 2X1SA 3EEGA 4YCPA 1TPB1 3QPYA 4AF0B 1YXCA 3PG8A 4MZ1A 3GX9A 3Q58A 4A2RA 2QCFA 5D2WA 4LU0A 3S5NA 1OX4B 4EOUA 1GTHA 1NEYA 5DCEA 3GR8A 3I7QA 3NQAA 5EY5A 1H7RA 2A21A 5D33A 2B0MA 4MFDA 2Q8ZA 3GLCA 1DHPA 2E5CA 3PM6A 1HFBA 1PCWA 3HPZA 3LI1A 3M5YA 3ZR4A 4LVAA 1JULA 4L4LA 1OHLA 1I2RA 4JY9A 4IGHA 1VZWA 2DJLA 2ZYFA 3PUOA 4NNCA 1F73A 2YXGA 3FJ6A 1OFAA 1N55A 5FI8A 1VJIA 1VHCA 3NQGA 3EX2A 3W6YA 4RLIA 4UTLA 5L6UA 1NAL1 4MY9A 5DY3A 2ZZ4A 1I4NA 3G1VA 1R47A 1HTIA 3LXAA 2XN1A 3P81A 3LRLA 2ZA3A 2ZFAA 3WJXA 2J9XA 1SZFA 2QJGA 4GNJA 2YYUA 5E1QA 2NX1A 4UTWA 3JR2A 5CPNA 1IXPA 1JCYA 5LKYA 1Q6RA 3ABQA 5FEZA 1JCXA 1OFRA 1B3OA 1U83A 3CIXA 5G5IA 1KFJA 5LGZA 3ZWTA 1SZGA 3S0CA 3L2IA 1FUYA 3B8DA 5G1TA 3SI9A 3OHIA 4A2SA 1KM1A 4JDBA 4ZQRA 4IXXA 3GDRA 3MUXA 4GJ1A 3MP5A 2Y85A 2VFGA 3W2MA 1Q6LA 4QNEA 4W9TA 3IEBA 2QCEA 3NAVA 4OE7A 2X1UA 4Z1BA 4WQ6A
chains in the Genus database with same CATH superfamily
2PU0A 3AJ7A 1RUSA 4MWAA 3TZNA 1MNZA 1LJYA 3SQLA 4MJMA 2WNNA 3QFWA 2B7OA 4WDUA 1I1WA 1UQYA 3PZTA 1LT8A 2OX1A 3GO2A 3SCUA 4U31A 1JDEA 1SW3A 3LXBA 2DGAA 1C92A 5C2XA 3DBNA 4JTFA 1GHSA 5A3HA 5A8NA 2IXUA 2J66A 3FYPA 1TQJA 2MANA 3MHUA 5CSRA 2QPXA 2PI6A 4N2YA 1HQTA 3UPWA 4B9ZA 1E6XM 4BF5A 1SO5A 3HN3A 3QY8A 3MCOA 3ELFA 1A5SA 5G4WA 2TSYA 2WHJA 3NURA 1QCWA 3GYEA 4Q3MA 4ZCWA 4LV4A 1NU5A 4YNGA 3THAA 3VOIA 3UPMA 7REQB 4NZFA 2VRKA 2QYGA 1E40A 3QGKC 3N73A 4GLEA 4DIAA 5AYZA 4WD0A 4DWSB 3KZSA 5FACA 3ZIZA 3MW7A 1XIFA 1EOMA 2EPHA 3L65A 5D8ZA 4B90A 2EPLX 3P93A 2QEZA 1Q8AA 4CCEA 4GC3A 3GDLA 3LM3A 3FJLA 3IJ7A 2FHCA 5FJPA 4IPPA 2QGYA 1TKKA 1KWGA 5LA0A 2AQOA 2CHNA 3QFEA 3B8VA 4HMDA 2WZMA 4K6AA 3AZSA 2QDHA 2PLMA 1OEPA 2CZ5A 2YB4A 3WLOA 1R86A 3E0LA 1VB9A 3B8TA 3HOJA 2ZRUA 1FXPA 4XISA 4BY3A 3GW0A 3RLVA 1NP0A 2A3LA 3CZKA 3M44A 2VR4A 4F66A 3ARZA 1Q13A 2E4TA 3PY2A 1VD6A 4IL2A 1FWBC 1AQMA 3WQFA 1FHDA 1JAKA 5BU6A 2VZVA 4UQBA 4R33A 3SSJA 2YCJA 3CL8A 4JTRA 3QH2A 5CLTA 3EDDA 3LQLA 3PUDA 2B4GA 4IPJA 4MNKA 4BK9A 3S9IA 1OCQA 4JIRA 1GVQA 4F2BA 1FY6A 1KCKA 5D37A 1A50A 3VU2A 3UQNA 5HWNA 4JIPA 3RMJA 4ATLA 2E40A 4B5TA 1TE6A 2FPYA 4KT2A 2JEPA 4HPHA 3RF9A 2DV0A 1KTBA 4PL1A 4NP7A 2PWGA 4LH8A 3PANA 1O6IA 2OO0A 4I7VA 2VCBA 1DXEA 4HYWA 4KPLA 2NQ9A 3LHTA 3THDA 3BL3A 4LCRA 1MFUA 2OYMA 4P7QA 3F4DA 2C8NA 3KRSA 1Y5VA 4ZZ9A 4QGCA 4UR8A 1P5BA 2P0IA 3BW4A 3MSRA 5AC6A 4UZUA 1C7TA 3GZAA 4ZFCA 2GVYA 4DRSA 4D6CA 2J88A 5A94A 4WGHA 5FAGA 3PG9A 2A3CA 4MG4A 1OX5A 3HF3A 3ANVA 3WJWA 1XS2A 1I0DA 1D2KA 4R7WA 3ECQA 2NSOA 1UH2A 1VENA 4XB3A 3RCYA 2J77A 2ZX9A 4E2BA 2QUNA 5BOFA 1E55A 2CFFA 1W91A 3EXTA 2VC9A 5IM51 3LBCA 3THQA 1GVFA 3WLSA 1GOMA 1G4EA 3EA3A 2EAWA 3TA9A 3WK3A 3DERA 3UETA 3R7MA 3N6QA 1IV8A 3R0UA 1FWEC 2Y7GA 3BAYA 4PR4A 3IGHX 4YLWA 1BG4A 1RCOB 5I7GA 4GZJA 4V1YA 1JJKA 4DYKA 1TV3A 1I1XA 2WSKA 4G5DA 3N6HA 2FYMA 2C14A 1DE6A 2JK2A 3WF4A 3CASA 1JPIA 4DQWA 3DXIA 3OOQA 3CV6A 3MHGA 3WFAA 3E5BA 4ZR8A 2VR2A 4LEQA 3LV5A 4K3ZA 3W2NA 1OC5A 2PGEA 1WZLA 3IUDA 1OFPA 1PTGA 2HEJA 1JF5A 4QG8A 4AZCB 3GNPA 2Y7EA 4IFOA 2BASA 2D0GA 1UKQA 2CBJA 2AGKA 1VFFA 3E1F1 2QT3A 3CIWA 3AZTA 4WSHA 1A80A 2DQWA 3N3MA 4MDOA 1JCMP 2QDDA 2A6NA 4WJEA 4MLRA 3EWYA 2REQB 2CESA 1G5AA 2OQLA 1PZ2A 3T4WA 2GVJA 4AEFA 1VFUA 5HMSA 4PUKA 2I7GA 3N17A 1C9DA 3CMGA 4JL1A 4QEHA 3QSRA 3W22A 4NVTA 3VXGA 2I5QA 5HQLA 3WMBA 1JYVA 2R91A 1DIEA 2A7NA 3N4EA 3MUCA 4IMFA 4R9OA 4MAZA 1OVDA 4JZ5A 2IQ0A 4INFA 4NNBA 5LNUA 1NQ6A 3TP4A 5T26A 1XSJA 3IAPA 3ME3A 1Q7QA 1UG6A 1J2WA 4HK6A 3CAWA 3C6CA 4MWAE 4XWUA 1JL8A 3IJ8A 3HB9A 1TUXA 3BURA 4RUBA 5A6JA 2P8CA 5J04A 2PDJA 4XG1A 5C9RA 2HTMA 1JRBA 2A85A 4YHEA 4OV9A 1POKA 2PU1A 1E71M 5G4HC 3G77A 5I23A 4W84A 2HRWA 4XTDA 4WHBA 1UR0A 3S5YA 4N4QA 4E6MA 1CPUA 2BDQA 3C0LA 1ISYA 3IJ6A 1WDQA 2NX3A 4FI4A 3I68A 1DIKA 1TJPA 2XPKA 3MY9A 1OCBA 5I09A 1V02A 2EPOA 5CPTA 4JN8A 1Q6EA 1Z48A 2R9RA 1H3GA 4LQ1A 3OW1A 2OQHA 4QHRA 3SJ3A 2FVLA 4NZ4A 4LY8A 3VMPA 5A6BD 5EBAA 2EG8A 1KXHA 4NU7A 4WDWA 2E6AA 5AYBA 1M5WA 3I7RA 2EG7A 1UCWA 3H8AA 1BXBA 3PNUA 2DIKA 2ESCA 1TV5A 5GNXA 3UA3A 1F3WA 1XV8A 1LQ2A 2OEKA 2EBNA 1W5MA 3SCWA 1QNOA 1W5NA 1V6WA 4FK9A 4Z2JA 3VNDA 1UB3A 4JX4A 3H2OA 4FX8A 2PWHA 3UJ2A 1DQXA 1M1BA 4HCLA 3QGAC 1ZPTA 3F1QA 1DP0A 1X8CA 2JFEX 5I07A 4L56A 1TR9A 3MHFA 5IFPA 3P6LA 3WK0A 2OR2A 2EPNA 3T05A 4EVZA 3GUWA 3KVJA 2FKPA 2A3BA 4A22A 3JS3A 5LGXA 5H6HA 4P8XA 4WZHA 1M6JA 3EWWA 1LQ0A 1CIUA 1E6SM 2YB1A 2HJPA 4MWAD 3RGTA 4OUIA 1YIXA 4J1OA 3SFWA 1HKKA 5I3JA 4HMCA 3RPDA 3HG3A 2JBMA 4W86A 4LTSA 3QR1A 4PUWA 3BVJA 1MRQA 3S1VA 3WK2A 3A3HA 4PEKA 2VVSA 2ZDSA 4IQEA 2XIOA 1XL9A 3U57A 2WNZA 3TTYA 2GWGA 1V3LA 4UMBA 1WAUA 8RUCA 2INZA 3NJ3A 3IVSA 2ZC8A 4M6QA 3UWWA 1E4NA 4GI9A 2PODA 1WX0A 3TE9A 4LUTB 3I4KA 1K1DA 4CD8A 3HU7A 5EFFA 1EDQA 1W9VA 3W1PA 3AMKA 5G1YA 3CZGA 4XO6A 3VKAA 3WQEA 3GNOA 1GOQA 2ZRZA 3T42A 1K9FA 4TX6A 3JZEA 2VEKA 1SYTA 3EZ4A 3ERPA 4YTUA 4K8HA 1M7XA 3RRAA 1YXYA 5CGMA 4YWIA 1VS1A 2PDGA 1UA7A 5TQLA 3TN5A 3LHUA 3CM4A 4FR1A 4GXWA 5KTLA 1U1HA 3P60A 4H7ZA 3S5ZA 1GONA 3W7DA 2FH8A 4ADSA 4DNMA 3EX4A 4YTSA 3TNBA 4NG3A 2D24A 4O8AA 2Y5JA 2EKCA 3MV01 4BEUA 3RK8A 1BYCA 3ZO9A 3AWOA 3URNA 1LL7A 3TEVA 1MEWA 1CBGA 3GWQA 2PLJA 1O5QA 3BH4A 5BRQA 3P74A 3BARA 4X0NA 2RGMA 2FMOA 2I5GA 4J7RA 3V5OA 2G37A 4J4KA 4ZXOA 1SSGA 4YTRA 5AKQA 1TWSA 4D6IA 3A13A 3IJDA 4IP7A 1MUCA 3EWDA 4E38A 1XPGA 2Q01A 3AIVA 2Q09A 3UERA 2XH7A 4HA4A 5D9MA 1UWAA 3VDHA 1YTEA 2HSAA 5HQMA 1GKPA 4O8RA 1JQVA 3FA3A 5FESA 4XZLX 2PTWA 2FHFA 3EPNA 4MKSA 1QOQA 5BXSA 4X22A 4HU0A 2A7RA 4JFTA 1K9TA 1IR1A 2CLFA 3CUGA 3MKVA 3DYPA 4Z08A 1UR3M 3ONCA 4P7NA 4UFLA 4HZ6A 1XIIA 4M51A 1K6AA 2ISFA 5CPQA 3WUBA 4DELA 4S39A 2WPBA 3WLPA 2PDPA 4HD5A 3WQOA 4XSLA 4JQ3A 2W61A 4AXKA 3E2SA 3LEPA 3CUFA 1KBLA 1F8IA 5HNRA 3S46A 2CKSA 5JIWA 4PL2A 1GWJA 5DO8A 4ZSUA 4A3HA 4LAOA 1XRVA 3N18A 2WVSA 3PK7A 3CJPA 3MMTA 3RJYA 3QQWA 4LB3A 3OBAA 3E49A 3Q4DA 4QP0A 3WH5A 1I2QA 3FW6A 6TIMA 5F1UA 2BB0A 1N8WA 2XUCA 1VBUA 1L8PA 1D3HA 1CXHA 2VNCA 1X96A 4GUGA 4RNFA 3RM4A 2IQTA 1D8WA 5H1WA 1KXTA 4GYPC 4DJFC 3AHYA 1K03A 4HYRA 3MZ2A 1U5JA 4LNYA 3BXWA 1IEVA 3OIXA 3YPIA 2OWXA 2CLKA 2NVAA 4QFUA 3KOYA 2PBGA 2YLAA 2F9RA 3EB4A 2ZRXA 3AMCA 4NZJA 1WE5A 1FCVA 2ZUUA 5KZDA 2QAPA 3IIVA 3TAOA 1SZEA 3UF9A 3AZRA 4Y9MA 3SB0A 4KGJA 3AYSA 3HFTA 4TOQA 1W9DM 4IPLA 4XZ9A 1Y5XA 2WAGA 4IIBA 1EGZA 3TTSA 3SY1A 2QF8A 3OG2A 1MQQA 5D9PA 3WL0A 2IPFA 1VRDA 2ZA1A 3WBAA 1PO9A 1RK6A 2NSXA 1KO0A 4DAIA 4AIUA 1CGTA 2OEMA 4DBSA 2O55A 3JUGA 1ICSA 9RUBA 1FOBA 1EKOA 2QS8A 3ZS4A 2E28A 1WOBA 3DG6A 4Z2KA 3KVMA 2Y7FA 1RBAA 4EF8A 1V7YA 4RNHA 1TZZA 2CBIA 3NQ7A 1WXZA 1E6QM 4TR9A 1DJYA 3GU2A 3NM1A 3G18A 3EMZA 9XIAA 2HQAA 2F6XA 3L0GA 1KFCA 3MBDA 1XLEA 4L65A 1M01A 2GVLA 2FZMA 1J6PA 3LOTA 4RDWA 1RQHA 1U30A 1QW8A 2E7FA 3P62A 3RHGA 1GYLA 4X60A 4AWTA 2GK1A 1ZBVA 3VD3A 1WKEA 1Z3NA 4IUOA 4IPIA 3D46A 3ARVA 2G4JA 2IUZA 3KXQA 1OF6A 4FR6A 3MVIA 3MP3A 4JIQA 3G24A 1P0DA 3QY6A 4GVHA 4I3GA 1KTCA 3IRDA 3NO5A 1TV4A 4H4IA 5DCBA 5MKGB 3BPWA 1LZOA 2ADAA 4GUFA 1DE5A 2VX4A 3C2OA 1FCBA 4JQAA 4DPPA 4IJRA 4W5UA 2ZXDA 5HWJA 4L5ZA 4URIA 1CXKA 4FX6M 4MYAA 4XIMA 2VDIA 3EWXA 5F2IA 4C1LA 1KCXA 5AOUA 3F4WA 4GI6A 3VIPA 3HGRA 1QW9A 3TWBA 2G97A 1RPKA 3SAZA 3VO0A 1P7TA 5H8MA 2XM2A 2DW7A 2HXTA 1JGIA 4GPNA 3ZR6A 4BQ4A 1XISA 2PTDA 2ZUNA 2OSWA 4JKLA 1CGXA 4GKLA 5A8MA 4QS5A 1YXDA 3GG1A 4J3SA 4QS6A 1W3JA 2FZDA 2R82A 3EOUA 1B5TA 1ZBWA 2XGZA 4ZL1A 2WZEA 3GXMA 2R1KA 1S2CA 4LS0A 1XYMA 3UJEA 1RALA 3QR0A 3MMDA 3MCNA 1UWQA 3E5PA 1QI0A 2WYSA 1O7AA 4ZQMA 4K7YA 1V3JA 3O07A 4AYSA 3VOFA 1PX4A 4LXFA 4ONVA 3WEMA 1TJ2A 3L4UA 2OZ3A 4FS9A 4WF7A 3VD7A 2O9PA 3TROA 4NZ5A 1EWDA 1OQFA 2YW3A 3WQDA 3RNDA 1KBJA 4BZYA 3W7HA 1ZAIA 2FGLA 3K4WA 4GYFA 1HJSA 4RR4A 2DZUA 1S38A 2YL5A 3CZLA 4PRWA 3FY1A 1M7PA 4FOJA 3GY1A 4HTYA 4I9MA 3UD6A 4F3HA 1W1B1 1LP6A 4XBSA 1H51A 2E25A 1EEXA 5K7JA 3K5XA 3ABXA 4J27A 2H6RA 1QATA 4LRSA 5AC7A 3KBWA 3VIFA 4H6KA 1UP2A 3VGGA 1LOLA 4E4UA 3UGRA 2YL9A 3GVQA 5DT7A 2PBOA 3TQPA 5MF5A 3MSGA 4WY0A 5LZLA 3DI1A 2GGJA 2WWCA 4DLFA 4YHGA 1FWJC 2EXOA 3VX1A 3U9IA 4HA1A 1VJZA 2D73A 1AH0A 2J7HA 2W66A 5EGRA 3B9NA 1NF0A 2OQYA 2CZDA 2FGZA 4Q4MA 1WKDA 4AX6A 1J4EA 1A0EA 5A6BA 4HPJA 3PZMA 3W88A 5KSWA 1K3UA 3HGSA 3W73A 5KITA 2CHRA 1HVQA 2OZ0A 1XIBA 4XX6A 2H9AB 2WHKA 5HANA 2XGBA 3CHEA 4NI8A 3ITYA 3LA4A 1POJA 4GK8A 3MS8A 1JXJA 2VTFA 2X1IA 3ANYA 4GGHA 1YQ2A 1NOFA 3L7RA 4TUFA 5AECA 1FXQA 4DZAA 1UZ1A 1VLWA 4ACZB 3RO6A 5DMYA 3B9DA 1QFEA 4E4PA 3T40A 2FMNA 1AK5A 4EWND 4DBWA 4GQBA 5HAOA 4ZE5A 3RN6A 1JGMA 3FVDA 3VDGA 2QGHA 3GR4A 3SBFA 1MW1A 3MMWA 3HO8A 3TV8A 1DL3A 2NQZA 5FOOA 3KDNA 2GYIA 3EPOA 4PUMA 5IBXA 3AAMA 1H62A 4K1WA 4RPPA 1QHPA 2ISSA 3WDHA 4C1NB 3TVAA 3UR5A 4S3BA 4DWSA 1TRIA 4ZOBA 3IJQA 3OG3A 4CN4A 2RJHA 1H49A 1PZ3A 4H7CA 4ERIA 3S6DA 4FF5A 3B40A 3Q45A 1UMLA 2CLEA 4QR6A 4DAFA 1TWZA 3ITCA 4BQ5A 1E51A 2XH2A 1VYRA 2V5KA 4GVIA 2ATSA 2OKOA 4S3CA 4O19A 4HMEA 1W31A 4LSBA 4H6RA 2YDRA 3S2JA 3PP7A 1KC7A 5G2IA 2QKFA 3DIPA 3WNLA 4GVFA 1YE4A 4XZWA 1CT5A 2FHBA 3RX2A 4HNOA 2JGYA 2Y70A 4FLRA 4FNRA 3RR1A 1TV2A 4WDTA 3WQPA 4A8RA 3WO8A 1TREA 3DHPA 3WNMA 4ZO9A 5DEZA 3LTYA 1A5AA 1ECQA 4JX6A 3UXDA 4EPBC 1A5LC 2TRSA 2NWRA 3STFA 4DJFD 3G8RA 3OLDA 4GRSA 3DESA 3STGA 1VCFA 2YBVA 2QVNA 2ZQ0A 1SFSA 2R6OA 4OGZA 3HPFA 4B3ZA 3DX5A 4NRRA 4G7EB 2WLZA 4GIAA 1UBPC 1EDTA 4AY1A 1GEHA 1BWVA 1KCZA 1L6WA 3LMYA 3LGGA 4JFWA 2GJXB 2OO6A 1W0MA 3U2OA 1XIEA 3HJEA 1N8FA 1X7FA 3OA3A 3S8HA 2AL1A 1MUWA 3BSGA 4GI8A 4WDXA 1XBVA 2GGHA 4NJIA 3RLUA 4EPKA 1ZJHA 1MRAA 3GIYA 3UJFA 2VGBA 2ZZ2A 5G4EA 3PUEA 1B30A 4XV0A 3QSTA 2OYKA 3F2CA 2WVVB 1JUBA 4S2BA 3ICJA 2EEXA 3QTPA 2BGSA 2DSVA 1TUFA 4L9ZA 3LM7A 1XG4A 4ZEPA 1J93A 2WJDA 4Q6XA 1V3KA 1P7TB 1BF6A 4UTFA 3PAJA 1XICA 4MOZA 1MI3A 4EP8C 4E8GA 4CKQA 5FSDC 2NQHA 3NZ1A 4KFPA 1QOPA 3N2XA 1EJRC 1FWIC 4LEFA 3M0ZA 2XSBA 2CWXA 1JPHA 2HZGA 4UCGA 1UJQA 1TWWA 5AVNA 4S38A 3PTDA 3IIXA 3ZVHA 2E77A 4XZNX 4TTUA 1PYFA 3A9BA 3OQ8A 2I16A 5TBOA 3W6LA 2Z27A 4I6VA 4OKDA 2GUYA 3UCQA 5M3WA 1BLIA 4L1GA 2HBXA 3V5CA 1GKRA 1XYZA 2XIIA 8XIMA 4FLSA 2B81A 4NKCA 3SRKA 4PB3A 1KFLA 1FA2A 2H8ZA 1IIHA 3K8KA 3O3RA 4Y9AA 2HK0A 3VAVA 2QXWA 3DH7A 3KVLA 4CQCA 4Z2IA 4GYPA 1GPWA 1J11A 2ISWA 3T4CA 1OT1A 4WR3A 1QRQA 2O4MA 3CYVA 1XSIA 2A79A 2OGJA 4L6OA 2FQIA 2BHYA 5FJRA 1MQPA 1GJWA 1VCGA 1D7FA 2E67A 3M0KA 1R8LA 5BWFA 4BFAA 3UG8A 1JCTA 3F5JA 3W53A 3AS1A 4IX0A 4J5NA 8CGTA 4DJDD 1ZJIA 1PIIA 4PCNA 3V36A 1AJZA 2B7PA 3LHYA 5HWMA 3GH4A 1G1YA 2FIQA 4X2PA 5DMNA 3NM3A 4PBEA 4JTHA 1MW3A 1LUCB 1DQUA 4XAZA 1UWIA 5A8QA 3GZ3A 3QHOA 4O54A 4DHGA 2XZ9A 5LIYX 4NASA 2I5IA 3E12A 4Z1YA 3WQ8A 3USBA 3BICA 1V0MA 2TAAA 4RDVA 4HPXA 4ZB5A 1X6UA 1JF6A 3GH7A 4QQUA 3T0BA 2WKLA 3MSDA 1ITCA 4IMCA 3SCTA 3MUY1 3WD3A 2G3NA 2CNCA 5F2LA 4BI6A 4NZCA 4GCAA 3TSBA 4FIRA 4UNKA 4XAPA 1EIBA 3MCMA 1SW7A 1HKJA 3MP4A 5REQA 1UKOA 3KHDA 4C7DA 2O92A 3QN3A 4S3FA 2HPMA 3W02A 1L2UA 1F7BA 4NJJA 3M0IA 3N34A 4IWWA 1VC4A 1J0ZA 1DJNA 4FOKA 1GJPA 3Q94A 4QEEA 3SRFA 2AMXA 5LNWA 1TELA 4B5VA 2PDCA 3QPYA 1YXCA 1KCLA 2WANA 3QKEA 1GZJA 3CV2A 3Q58A 2J79A 1DIDA 5D2WA 4AISA 4OOZA 1W2PA 4WSJA 1GTHA 5JU6A 2I17A 1XC6A 2Q8ZA 4ICCX 3WQVA 2E5CA 1HFBA 3HPZA 1NP2A 3LI1A 3M5YA 3ZR4A 1AODA 2W91A 4F8XA 4IGHA 4JIEA 1CXIA 1RD6A 1VZWA 4NNCA 1F73A 3WSUA 2YXGA 1DEDA 2P76A 2V5CA 1K4HA 3MO4A 1VHCA 3W6YA 4UTLA 4GD0A 4B5XA 3G1VA 3ZLFA 3QV6A 3TW9A 1HJXA 1GOOA 3VC6A 1EC8A 5I78A 1V02E 4GX8A 5E1QA 3W28A 2NX1A 4UTWA 5CC6A 1BAGA 3PN8A 3ABQA 5FEZA 1OFRA 1GOWA 4NRSA 2R1PA 5G5IA 1SZGA 1UD2A 3S0CA 3L2IA 4H9UA 4GINA 5KEZA 4EK7A 2VI0A 3GDRA 4GJ1A 2BP1A 4Q8NA 3ZLHA 4C6BA 1HJUA 2HWGA 2X09A 1DJGA 3IEBA 4KERA 3V35A 3VNZA 4WQ6A 1B54A 4H2CA 4Q33A 4O52A 3CQ0A 1CEOA 1BVZA 3NDZA 3GBEA 3VIGA 2VL4A 1JYNA 3ALGA 2Q3OA 4JOMA 3U4AA 2QUUA 1X8FA 2XH0A 3GS6A 3N14A 4MADA 5LNSA 1AD4A 2XN0A 5B7ZA 3VGHA 5GPRA 3RDKA 4Q4QA 2Z2BA 4N0RA 3NPXA 1I45A 1CXLA 3QW3A 1UIPA 2PDYA 2OYLA 3MI6A 1L9WA 1H1YA 3UZ5A 1PZ1A 4DO5A 4LX4A 3ORWA 1K7EA 3LY0A 3A3XA 3H2CA 2ZE0A 3LRMA 4YTTA 1J18A 4PMRA 4AF0A 3SUSA 3CZ8A 2VCCA 2WMJA 4AVFA 1K8CA 4DUOA 3NZGA 4Z42C 4AAJA 1K7XA 5C71A 4AD2A 5EYWA 3VIOA 4PMQA 2WOQA 3OQEA 1AW5A 2VFIA 3COTA 5XINA 3NPUA 1VEMA 2QJMA 4PODA 4QE5A 1R0MA 4EPEC 1RZMA 2PGWA 4D6JA 4JN7A 2XISA 4WOZA 4IMAA 5EMLA 2C6QA 2V2CA 4MWAB 3WD4A 3VX0A 3NCOA 2J78A 4PTMA 4EX4A 1F3EA 4RDYA 1EB3A 1PSCA 1J0KA 1TJRA 2J62A 4AEOA 3VM5A 4Z2GA 4FXRA 5XIMA 2PZ0A 4Q8WA 5ECUA 3LQGA 1OADA 1VFOA 2DIEA 3CBWA 4M6PA 1MZHA 4XKYA 2AKMA 4J3UA 1FH8A 1ZALA 3ABRA 3DCPA 5HPOA 5KZ6A 2QUVA 2XVGA 4IIFA 5IHRA 3IUIA 1VAHA 2QCCA 4BWLC 4WOQA 1HKIA 1XGDA 4N9EA 3UYCA 1WKFA 4TV5A 4KETA 3PZNA 2MUCA 3W1TA 3OJGA 3WJYA 1A5KC 5L9FA 2W27A 1UD5A 5LYRA 1EH9A 4E3VA 2A0NA 3DG3A 4HSNA 4HCHA 1WO2A 2XFWA 1PV8A 3C2VA 1G01A 4NILA 1EYWA 3UU0A 2F6KA 3BJFA 3UESA 4CVWA 3EXSA 2J27A 1V8EA 5CKSA 2G95A 2G0WA 3POCA 1I0BA 3VUSA 3IUHA 1IWAA 4B5UA 3GXIA 4DJEA 4GXMA 4L6HA 4UFMA 3VKJA 4DO6A 3EOOA 2VENA 1IEQA 4DF1A 4RCXA 9XIMA 3WQ6A 3CUJA 1KFKA 3HG2A 7XIMA 1J96A 1DOSA 3PS7A 1XLJA 4LAUA 3MTWA 4ENLA 2JALA 1ME7A 4RXGA 1RA0A 2TODA 4RX0A 1GG1A 2QCLA 1PDYA 1DORA 3RO8A 3MYOA 1EJ7L 3H2FA 1GYMA 3EB2A 1E1EA 2FLIA 2X1TA 4P61A 3BLEA 3F4NA 5M17A 1SMAA 1FCQA 1XKJA 4D6GA 3IGXA 1CGYA 1KR0A 4K39A 5AN7A 3W2UA 4GYKA 3LPPA 3G6LA 3KBNA 1QBAA 3NFUA 4F0SA 3RILA 2BBFA 1TPDA 4YVXA 2G50A 3R13A 4FNTA 4C6PA 3ISIX 1UW9A 3W83A 4QCEA 2WZHA 7REQA 2OSXA 3NYZA 1ZQ5A 1KBBA 3REQA 4G1KA 4Y6GA 4Z2LA 3A47A 1XIJA 3K8MA 4O1FA 4H1ZA 2WC3A 4TX8A 1RXOB 3UG4A 2O9RA 3KS6A 3UWQA 1XX1A 2I9UA 3GG7A 3GTXA 1TVLA 2ALRA 3W1QA 1R3VA 3TYBA 3CGTA 4K37A 3ALFA 1W5PA 4PB5A 4A8LA 3S1UA 3L5AA 1Y7VA 2FFIA 3RUBL 1YTDA 1EF3A 3ZJ8A 4YIWA 1UUOA 3GDKA 2XTKA 1I60A 4W5ZA 4LUIA 4R34A 1EC9A 2PEVA 3A5FA 3U7BA 3RU6A 2PDKA 4DBEA 1FWDC 3S5SA 5I6SA 4XVEA 1V6YA 1TX2A 1RBOB 3WUGA 4ZTXA 2PAJA 1I6NA 5KETA 1LL4A 3LLXA 1S1PA 1ZHAA 4NX5A 1KB3A 3LTSA 2GVGA 4E8CA 4RW3A 5K9DA 3WUEA 5C55A 3M6DA 3I6TA 3MKKA 4J28A 1FDJA 5GJNA 1VEOA 3AI0A 5JIPA 3R11A 2BVDA 1HJVA 2Q6ZA 2Y7DA 3TYAA 1OCNA 4DPQA 1P6BA 2PDQA 2PRHA 2J7FA 1Q4NX 3V1PA 4QISA 4AW7A 2GDUA 2XSXA 8XIAA 2HS8A 3DU0A 4BWLA 3VGBA 1A53A 1HKMA 2YA2A 4RE4A 1QVBA 3KHJA 2C7FA 2V5BA 5H2ZA 1UH3A 1H60A 4PBGA 4P7RA 4UR7A 1W54A 3R43A 4RL3A 1GJUA 3TXZA 2D0HA 2J7EA 1SU5A 1U2YA 2XHYA 4AZIA 3KP0A 3WMCA 3GTNA 2Y5EA 3S4TA 5DANA 5IDIA 3KFTA 2C18A 1O1ZA 4FSAA 3PTQA 3LCGA 2RAGA 4UXDA 1FDZA 4D71A 3UYIA 5CPOA 3S6TA 2FVKA 3QY7A 3L4YA 3IAQA 4WY0F 1XPYA 1YNYA 3CH0A 2X0YA 2F61A 4GJJA 2OTDA 1S5WA 4P8WA 1ELSA 2HK1A 3CV1A 2UY3A 4WRHA 2V69A 3L12A 4V27A 5TD4A 2CKRA 4CGTA 3PPFA 2PLKA 1R3QA 1CI1A 3N4FA 2TYSA 1EYEA 1PUDA 1XKYA 4H00A 2Z6IA 4QDPA 3LCFA 1TCMA 4O4VA 4DN1A 4HU8A 5D2VA 2W62A 1XW8A 1GVOA 1GOXA 1TVPA 3EBVA 5XIAA 4J35A 2BOFX 3IARA 1OIMA 4E4FA 5I03A 1QR7A 4I9TA 1UOZA 1P1XA 4XD3A 3R94A 1XIGA 3SEPA 7CGTA 2P8BA 3LB0A 4ATWA 3FOKA 2O9OA 3HGJA 3M41A 4B91A 3VGFA 1E1CB 2ACUA 3V1HA 4IIGA 1YLVA 4IMEA 1Q63A 1OF8A 3F2DA 2CU0A 3SO7A 1SO6A 3LX9A 1AVAA 1EOKA 4KESA 1B3XA 1PHWA 1NWRA 4B5WA 1MEIA 1ICQA 3ZMRA 5LSMA 2EJAA 1M68A 2BHUA 4NYYA 5D03A 5FKYA 1W6TA 3W23A 2Q02A 2HE5A 4DJEC 5DRIA 4GG9A 5HMEA 4HGXA 2VCAA 3PWAA 3C8FA 5DF0A 2REQA 1IWPA 1E6PA 3EMCA 3VOCA 4RZ5A 2WCAA 2CEQA 3EWCA 2O7QA 1GGOA 3V0UA 3E0IA 4KCVA 5F4SA 4IOTA 3BCJA 3HQPA 2BY3A 2QZRA 4O4WA 1SJCA 3OVQA 3U0HA 3NQMA 3BQ5A 1EUAA 2VMFA 1JRCA 4ZVJA 2WMHA 3GUGA 4WCJA 4MJ4A 3AOFA 4L4PA 2BMBA 1A3XA 3BLLA 3I7SA 3HZ3A 4L9XA 3FKRA 4HJWA 4FNPA 1JI2A 1V6XA 1NDVA 1XDJA 2VHLA 4JN6A 4QCFA 3DFTA 2B7QA 1ZNNA 4F9DA 1Y0EA 2VC7A 4MB1A 1RJPA 1J9YA 3VINA 4E8DA 1CDGA 1AJ2A 3WJZA 4IH3A 4GZEA 3VYLA 2W4XA 3PULA 3URAA 3R4IA 1PL9A 3S1XA 1F4AA 2J6XA 4UOQA 1Q5MA 3VNIA 4Y8EA 1BGGA 1GOKA 5U4NA 2FPTA 2OEJA 2YIHA 4JTSA 4DYJA 3TMLA 3M0JA 4KGLA 4F0KA 3KBVA 3WF0A 4B3LA 1QO5A 1QPQA 2ZZ7A 4NL1A 3CNYA 4O0KA 4AX7A 4IFRA 3L2LA 3OA5A 1JDCA 1RCQA 3FVMA 4LYRA 1DYSA 1S5TA 4M29A 1XIMA 3KOXA 2YA1A 1W9XA 1RVGA 2D22A 4HSHA 1Z89A 1J0HA 4N7QA 2PDWA 1JAEA 2X1RA 3VABA 3B9AA 1J2BA 3HPXA 2VQTA 2CXEA 1NM9A 1PIFA 5D09A 3U5UA 2ON3A 2BXYA 4EACA 4GZ7A 4HBKA 4A05A 4C5YA 2E1WA 4UMAA 2PE4A 1TV8A 1OZQA 2EHHA 3CO4A 4FA3A 2NV2A 3NXLA 4XD5A 2XVNA 5GNYA 2V2DA 3M0YA 4DF0A 5HR7A 1TE1A 3EEZA 1UMYA 3M64A 3HMJG 2YSWA 3BAJA 4CVUA 4HOWA 2Q3RA 4IIEA 5FEPA 4AWUA 1MQRA 1SJDA 4HHLA 1OG0A 2ZX8A 4DZ5A 1CYGA 2ZUSA 1MDRA 3OVRA 3ARWA 2P1FA 3H7RA 5DLCA 3REQB 3W7CA 1YDYA 3GU1A 2ZUTA 1EP1A 1QHZA 4FAMA 3RRXA 5DBTA 4X9YA 1ODZA 1KWKA 3H4XA 4C1NA 1A5BA 4HQVA 3BG3A 4Z2HA 3DKJA 5CZSA 2GJPA 1TTJA 2YYTA 3OLIA 3RXZA 1AA1B 1MMFA 4US5A 2I14A 4Q8MA 1Z7AA 3C2FA 2WO5A 2Q8LA 4EPDC 4CNOA 2F2KA 3VDBA 2WC7A 3G0XA 4M81A 4UR9A 4DI9A 5ABGA 3BO9A 4KW2A 4X61A 5LNRA 2XWEA 3FAWA 2B7NA 3O16A 4D8LA 3LLFA 1B4EA 2YCEA 5HUOA 1TPVA 3RYSA 4M5PA 1AUSL 1C90A 2P53A 2PDMA 3V0TA 1BKSA 1B9ZA 3VNJA 3E3HA 4S1FA 3UCCA 3MV11 2G4FA 4HHMA 4GO9A 1PTDA 4JTQA 4ZO6A 1YE6A 3TTOA 2BX7A 4Q6JA 4UWMA 3V7PA 5CJ5A 1WZMA 4XAYA 1NFBA 2CBUA 2ISDA 1H1ZA 1RHCA 4AZCA 3BCFA 1THFD 1DWFM 5F2MA 4GIRA 1V77A 2ZRWA 4IT1A 3WBWA 3D5HA 3UXAA 1YX1A 4B16A 3UBPC 3O0FA 3LHZA 2P3EA 4LT9A 5A8OA 1VJSA 1FBAA 4LYKA 4TVDA 3UWUA 3W4RA 3PUGA 3FS2A 5DCDA 4WXZA 2FZNA 4DVOA 1EO7A 1WDWA 1OB0A 2XFRA 3VNMA 2WC4A 4F0HA 3PJXA 3KL0A 2ACQA 3FYYA 4ERAA 4DZIA 1ADDA 3STCA 4EKJA 4GX9A 4HJFA 4LANA 4QAWA 3EX3A 1UUMA 3TMQA 4EAMA 1BQCA 4A8IA 1EWEA 3OTRA 3K30A 1I75A 1I9CB 2QUTA 4AMCA 2DVUA 3L5LA 4WKFA 3OYZA 1KBIA 2VGFA 3BUVA 3IVUA 3VKKA 1BYAA 1FCUA 4F0RA 5CSUA 4GOAA 4Q4KA 2GJNA 5JBFA 3VZYA 1M3UA 1UR1A 1XLKA 3LCXA 1GZGA 1ENUA 4CQDA 1YDVA 1M7OA 1T8XA 2CBVA 4JD4A 3M0MA 3DFOA 3PZ9A 2DPEA 1LROA 3BANA 4HVXA 4K1GA 2VEPA 1J5TA 1VYPX 3QOKA 1FP9A 1GZ1A 1N7KA 7ENLA 1LT7A 2OOFA 5TNVA 5EFDA 1ZUAX 3CB8A 3AUOA 5EBUA 1KM2A 1S2TA 5DFAA 3B0YA 1IT0A 3BCDA 3VKDA 3BC9A 3KX6A 2ZUWA 4R27A 4QQ3A 1KM5A 2BTMA 4I90A 2J7DA 3U48A 4HPGA 2PCQA 5G2HA 4PZVA 4U5KA 1NDZA 5C54A 1O5KA 3KWXA 2AOSA 1XFCA 2ZZ5A 3MKCA 1UOKA 2ZUVA 3N2CA 3QQ0A 3H54A 1RBLA 1XLFA 1VIWA 2OZTA 1WXJA 2P50A 1VH7A 2DY3A 4JBRA 5HJYA 3CTLA 7TIMA 1LTDA 1G6CA 2WCSA 3SCQA 1F76A 4PUDA 3SGGA 3GKAA 3MU7A 3QV8A 1EQCA 3BZJA 3T78A 3H2AA 3TX9A 1EEPA 1XR2A 1ONWA 3TN4A 3LI0A 4MF4A 3ZWSA 3WZ0E 3M43A 3LD5A 3PVFA 1ODUA 1G9HA 1JYWA 3SY8A 3F2BA 4N9DA 4U4MA 4H9MA 2POZA 4BA0A 4QJ3B 4GBDA 1KQYA 3N9RA 2NUXA 2ZBTA 3RCNA 4JYEA 4AXNA 3GXNA 2Q8XA 3P5YA 4QIUA 3VNKA 1D7KA 3ARXA 1Q4WA 4F2TA 2YFOA 3H22A 2DT2A 2XYLA 1W2VA 2D3LA 2HPIA 4B5NA 4HNVA 3PBWA 1KXQA 1NFPA 1UA3A 4S3AA 4IGSA 3U3HA 3PBMA 3WKZA 2J75A 2J8GA 4LOCA 1XDMA 1HO1A 3RX4A 3PBGA 3A4WA 1TJ1A 2QJJA 1TIMA 2F38A 3K8LA 2HBVA 5E6ZA 4NYUA 2X2YA 2PTYA 3W70A 3V4BA 3NG3A 4W8BA 1Q45A 1P0EA 3TYDA 4X2RA 5K4XA 4RZ4A 1KV8A 3MUZ1 1AJ0A 3EKGA 1AW2A 4GCXA 2G8ZA 3W24A 1HXJA 3D3AA 5HQEA 1IE7C 2OVLA 4N9BA 5FF3A 1NF7A 2VX7A 1R7OA 4CNNA 1XBZA 3DFSA 4U3CA 4GKTA 4OOUA 3WQWA 2C15A 4XKYB 3PJTA 4X9SA 3KRZA 1XLIA 1REQA 3TDFA 1SZNA 4KRTA 2VDGA 5I3HA 1JXKA 4ATDA 3ENLA 2QPUA 5CC7A 3P84A 3SY5A 3G1DA 1G7VA 2J7GA 4MJZA 2E6YA 3R58A 4LWWA 3MDWA 2PSNA 1DJIA 1C9WA 3TYUA 4NX0A 3H55A 2OWWA 4W7WA 4GYJA 3EWZA 5CZJA 1KRAC 3SCSA 3I3EA 4RE2A 4HZMA 1MXGA 5FCZA 2BFGA 5CLWA 1OK4A 2IKIA 3CS2A 4Z0JA 2TMDA 5I24A 4L64A 3W71A 3ZJ7A 4PMJA 1MZRA 1CCWB 1FWGC 2OLHA 3GFYA 5DN1A 3UG3A 1WUEA 4GVGA 3K13A 1H0IA 1UD6A 2VZOA 3LBMA 4QBXA 1E9ZB 3SZ8A 3LLDA 1UYQA 2Z28A 1VGAA 4HT3A 3A21A 3M0LA 4PTNA 4C65A 4MZYA 3LU2A 3BMVA 4KCTA 2OX4A 4H7VA 5C7VA 4NY2A 1GORA 3KTCA 1UD8A 2X2GA 1FWSA 1U1UA 2PB1A 2QV4A 3EOLA 3PNZA 1FHLA 1LLWA 1WV2A 5A95A 5MHBA 3OO2A 1T99A 5KZMA 3ZSTA 4QRNA 1E70M 4PUEA 2JF7A 4GIYA 2C3ZA 2PDHA 3TFXA 3T0DA 3LBOA 4UQCA 1GUVA 4ORMA 1IYXA 1W3NA 4I5XA 1W1YA 3FHQA 3I6RA 3IGUA 1ISWA 1ZRQA 3L21A 2NV9A 1XDLA 2VQUA 2NXGA 3UJRA 5FEWA 1E43A 1JNDA 4IGNA 3N2BA 1HT6A 1IWBA 5AYIA 2X0SA 4UMCA 3NZQA 4JKKA 4GUIA 1TA3A 4GQGA 4H8HA 4DUVA 1XBYA 5FF2A 1EP2A 4HOXA 4BF7A 4JFVA 3AS3A 2RDUA 3INPA 3CMJA 2Y0FA 3FLUA 1H7XA 1J12A 4FNQA 4C6LA 4L7ZA 3M0HA 1RQEA 2J9ZA 5EA9A 2V30A 4JQ2A 3TR2A 4UBPC 4ZENA 4L4MA 5A2CA 5HA7A 3GXPA 1TG7A 3C0SA 2JE8A 3RPTA 5I3IA 3MJYA 4IZGA 4MWAC 4ASTA 1JUEA 3CL7A 5K2ZA 4MZ8A 4AHPA 1E1CA 5K9CA 3WK1A 3ES7A 5C9ZA 4HKPA 1WXYA 2VX5A 3CAKA 4FO4A 1B2YA 3LDVA 3UXKA 5CBBA 3AS2A 3CH9A 1GTEA 1W1ZA 3ARUA 1R46A 3N2TA 3C86A 5AHFA 3QMRA 1E9LA 5A6KA 4A3UA 1ZAJA 4KWWA 3KTXA 3PAOA 3NNTA 1JZ6A 3UG5A 4NXSA 1VFLA 4PMOA 3VK5A 2OLAA 4OFCA 4W4QA 3H2EA 3B05A 4H9VA 3TTQA 1HL9A 3QGVA 2GQ3A 1UHVA 5D8WA 2QUMA 1GQLA 3IANA 1EJVC 2Y89A 3L4WA 4Y8FA 3H12A 4IIDA 2LLEA 4BI7A 1XI3A 3B4UA 3CZJA 4GBUA 2XIMA 1MSSA 1DBTA 2FH6A 3NQCA 3QQ1A 1O60A 3TLQA 2QMKA 1WDPA 3FCPA 2VRJA 3PF3A 5JH1A 4MNJA 3M07A 3NDOA 4UTMA 4G9PA 4JS3A 3PJUA 1W17A 1ONEA 1BRLA 4JHZA 1UKSA 1FWRA 4UFKA 4R85A 2OJPA 1BWKA 2QIIA 4H8VA 2DSKA 3NTYA 3R8GA 3GR7A 1ALDA 3EDJA 1CLVA 5E93A 3BLFA 4EANA 4IL0A 2ACSA 3F4CA 2YFNA 1CLKA 4RW5A 1NWTA 4WKAA 3WN6A 3NSMA 1DIOA 2F2HA 4Q8OA 3LNMA 3P8JA 1IEIA 3R2GA 3ARPA 2W63A 2QIWA 2QDGA 1WB0A 4HYVA 4DJFA 2CPUA 3OLEA 1OJXA 1MEHA 1B9BA 1HL2A 2PMQA 1BPLB 1XYFA 1GW1A 1ICPA 3C2RA 3LCIA 5DXXA 1FFQA 1DVJA 2HISA 3EMQA 1S3TC 3N04A 3PTKA 3F5LA 2XFYA 3W1MA 3NYDA 3C5QA 4WIWA 1Q7MA 3ITVA 3PHAA 1RP8A 3KCOA 1ZP4A 3PZIA 3TCEA 4O0QA 6REQB 4UNLA 3FXGA 4AZBA 1QWKA 2XWDA 3O1NA 5ECVA 3B9EA 4RPQA 1OFQA 2ODOA 1UZHA 1L6SA 3M6YA 2CERA 1P0KA 3NZPA 3VMOA 1AL7A 3GTFA 3UPBA 3W7GA 4V2XA 1LWIA 4R53A 1BFNA 3MWCA 1YPXA 1LUCA 5LIXX 3WQ4A 4BS0A 4YU1A 1LBLA 1NDWA 1V4YA 1JI1A 2QF7A 2DT3A 3SADA 4G1NA 2BOEX 3A3WA 1O94A 3WH9A 1FWHC 4QSHA 3KRUA 3VM7A 1H11A 3KL3A 1QPRA 3DC8A 2WHLA 1BXNA 3PPCA 4GH1A 3OP2A 1E6NA 3GHRA 5CC5A 2GLKA 3LYEA 3W1XA 4Q4OA 2KX9A 3VTRA 4GACA 1Y5WA 3MANA 1Q6OA 1UC5A 3MSYA 1IZCA 1US0A 1ONRA 2D3NA 1TPEA 3AXXA 1W3KA 5JUVA 2WVUA 2HDJA 4PYSA 3AMDA 2E1DA 2GOKA 1LWHA 3RAOA 3VFCA 1L6YA 1JYXA 1IGWA 3N12A 3W76A 2A7PA 4A21A 5BZAA 5J5RA 1Q6CA 2W3ZA 3HM7A 5AC8A 2EO7A 3GRIA 4Y96A 3TYCA 3FEMA 2FPVA 2ZOXA 2X1SA 4RNJA 3LPFA 1TPB1 3U2ZA 4YCPA 4CCZA 4B3KA 3GX9A 4A2RA 3APTA 3SN0A 1ZCCA 2QCFA 4LU0A 3HPAA 3SDOA 1K9DA 2GSJA 1NEYA 5DCEA 3KLLA 3I7QA 2FDMA 5EY5A 1XYAA 3D3FA 5D33A 4NZ1A 2YBUA 3WNKA 1Z32X 1DHPA 4AZ6A 4J2PA 2WNWA 3AMLA 2C79A 4S3JA 3H7VA 1L2QA 4LVAA 4JKMA 1SFTA 4L4LA 4PE8A 1I2RA 3N3TA 3FSTA 3PUOA 1B90A 1SZRA 1N55A 3NQGA 3AIRA 3T1GA 1NAL1 4KCWA 4MY9A 5DY3A 1W1PA 3GXDA 3GD6A 4DNHA 4EXAA 3AICA 3LRLA 2WLYA 3T6CA 2ZA3A 2ZFAA 3T2PA 1LL6A 2QJGA 4ZFMA 2QPSA 1JCYA 1QTWA 4DM1A 2GJXA 1DXFA 3HMCA 5REQB 2XINA 1A3WA 3ZWTA 4I8YA 3B8DA 5LIKX 3SI9A 4JDBA 3TYZA 4ZQRA 2V5DA 3MUXA 3V16A 1PAMA 4UQ9A 2VWSA 3U2EA 4H6EA 4WJ8A 2X41A 2Y85A 4Q8QA 1W3LA 4QNEA 3E38A 4GO8A 2J6VA 2X1UA 5EMMA 4ADUA 4AG0A 1RJRA 2NQ5A 2C1HA 4ROQA 3HIJA 4CU6A 1YYAA 1FWCC 4QE1A 4CUCA 5HXMA 1REQB 4HIBA 3W7MA 7ODCA 3E0VA 4POCA 2CZVA 3LERA 1SMDA 2VEFA 3WLTA 4ZXLA 3WQ5A 1V0LA 1K70A 2DP3A 1MW2A 4IMGA 3IACA 1KNWA 4TTGA 1AFSA 2VZSA 4AD3A 4GUJA 3ID7A 3WLIA 4BCEA 2R14A 4R7JA 4W88A 4O1EA 4BQ2A 2CZEA 1HGWA 5HK4A 3M16A 4ZSTA 5EMYA 1E5NA 3FGCB 3TQ0A 4HU3A 2Z29A 3ZT5A 3DHDA 5D38A 4MLJA 1U5VA 2B31A 1IEWA 4MKVA 3T0CA 3BZGA 1H4PA 1YNQA 3H4WA 1AZ1A 3CB3A 5EMKA 2GGGA 4O15A 3KCLA 3LXCA 5DELA 4N4PA 3MMUA 4HTBA 2VEMA 3FA4A 5CEWA 4XQ6A 5CGQA 1E6ZA 3BOLA 2X42A 4AHQA 1P0NA 4IISA 2ZWYA 2V82A 3A4AA 3UVAA 3FJNA 4AY8A 1X1OA 1T6MA 3EB3A 4JY8A 4LFYA 3IK4A 2OCZA 1TRDA 3GIPA 4EXBA 4REQA 4WLCA 3HG5A 5C9WA 1F8MA 1PE1A 1B3WA 3N19B 4D6FA 3DUGA 2H8XA 7TAAA 4O50A 5FF7A 3CEPA 3GNNA 3BGJA 4DWDA 3W9ZA 3CWNA 1EBGA 1W1IE 4IM4A 2JKEA 4L1WA 2DZWA 2PRLA 4GY0A 3LHWA 1UZ4A 3WF1A 4AMAA 2ZRVA 1R30A 3AIWA 3BAIA 3A23A 4G8TA 2PA6A 1DXIA 4GJIA 4FNUA 1Z9AA 5KINA 4M6VA 1UWRA 1WOAA 3G1SA 3TA6A 1X1ZA 1VR6A 4QTGA 4YYCA 2X30A 3S2MA 3VIKA 2XN2A 1QDSA 4KWUA 1PS9A 4KS0A 1IT8A 4C6QA 1EZWA 4TX9A 2XIQA 5BOEA 2GUBA 3URBA 1XJBA 1A49A 3DHUA 1AD1A 2OB3A 5KMYA 2PP3A 1MW0A 4HPNA 3B0UX 3ZVIA 1P48A 1B3VA 1J79A 4OUEA 4AD1A 1V79A 2NLYA 3CK5A 6REQA 1XUZA 3NQEA 1BVNP 1R3TA 4TVUA 3H2NA 2PD9A 2YX0A 4HNNA 3WBEA 3Q65A 2WB5A 1KLYA 2ZADA 2QDEA 2HS6A 3AXHA 1QWGA 1WP6A 1LQAA 2EQDA 3CQJA 4EXQA 2H3BA 2DUZA 3T09A 3LSCA 3TK7A 1F6PA 3IVTA 1TPWA 2G5WA 2GSHA 3BGAA 5CXPA 1VQTA 2CETA 4UTTC 1SSDA 3SW6A 3AHVA 5H8PA 3PZVA 3G3MA 3L5MA 1Q6DA 1VCVA 1XLGA 1KGUA 3ZXWA 1H7PA 2PGRA 4F79A 4UQAA 2CLMA 3VD5A 2VM8A 4O17A 3O8AA 3S9YA 4ZA0A 2YJQA 3GHUA 4ZQNA 2HV5A 2WW5A 2HVMA 2V3FA 5FL1A 1A47A 4W93A 4Q8VA 2QW5A 1HX0A 2VGGA 2PF0A 4JTGA 4DBDA 4AD4A 4R9XA 5SWUA 4O1BA 3W25A 3VE7A 4K8GA 3RLGA 3WG6A 4MYXA 3NGJA 4AIEA 3F7JA 1R6WA 3OIHA 4X63A 3GNXA 5HJXA 1BVWA 2VURA 4AZ7A 3M5ZA 1K8YA 3ARTA 1R2TA 5AVHA 1RY8A 1AQHA 1LG2A 4MDPA 5LIWX 2ZZ3A 4DUWA 1VPQA 1OD8A 4QLKA 2IPGA 3QHMA 4A3RA 3WL1A 4B15A 1H61A 5CAHA 2V5JA 4LC8A 1RPXA 3CO8A 3WEZA 4Y7EA 3QYSA 3SURA 2OG9A 5A6LA 3N25A 5A1AA 1JPDX 5BNKA 1B3YA 1YPFA 2QR6A 3N9KA 4QROA 5DX7A 2WQDA 1PXGA 4G7FA 2QULA 1MDLA 5HMFA 1KXVA 4R5EA 2BGQA 4DUXA 3VDAA 3MVTA 3G5EA 2PP0A 2HMCA 2YCLA 3C3UA 1JCNA 1L0PA 3APGA 3HQOA 5DY2A 5HBFA 3MB9A 4OHQA 2YKKA 5A2BA 4CN1A 5GVJA 4H9ZA 2C19A 1T0OA 2TPSA 1XD0A 1G4PA 4PB4A 1DJWA 1H50A 3UXIA 3O6DA 4LYPA 1JPKA 2E6FA 1AH4A 1Q6QA 3A64A 4M7TA 3EOEA 2FZBA 3PPGA 2CLOA 1R3SA 1ESWA 4LPCA 4WK9A 1SUXA 5CAKA 4D6HA 4XBKA 1MFVA 3TXVA 4O0ZA 2DSZA 4E2DA 2ZX6A 2WXDM 6CGTA 4MPKA 4JNYA 4KWVA 3LNPA 1BGAA 2OT1A 5HR6A 2R24A 4QDMA 1T41A 4FIQA 3FNDA 3RLHA 4QITA 1S5NA 3UEQA 4LB4A 2JEQA 2PWVA 1TCDA 1NVMA 4ZODA 5TF0A 1GYNA 5IHSA 1H0GA 3STEA 1YDNA 5JH2A 3P82A 2Y4SA 3NSXA 3KEHA 5BCAA 4LBSA 4MMWA 2DZXA 5C0QA 4PFHA 1XG3A 3CHFA 1MWOA 1V6UA 1H5YA 1ZFJA 2IXVA 2RH9A 1BG9A 2NZLA 3R10A 5EB8A 1TPH1 5M1TA 1SFJA 1XH2A 2GDQA 3FGCA 5CG7A 1M04A 2F6UA 2DU2A 4IF2A 2IKGA 2WQPA 1W3TA 3MA8A 3R79A 1IF2A 4MB5A 3W7JA 2P3ZA 2PTZA 2W79A 5D05A 1AQFA 3WIJA 1OFDA 4LVFA 5DT5A 5JXQA 2EPKX 1R2RA 3PWIA 1A5NC 1VBJA 4QJ5B 3APYA 1E0TA 1FWTA 1OSEA 3DDMA 4AC7C 3VKBA 3CMFA 2A4AA 1UWUA 4AZHA 3CYJA 1V5XA 4D2JA 1I2PA 1XGZA 2X7WA 3G3DA 4UC5A 5F2GA 2DT0A 4RV3A 3TJXA 4DJDA 1C29A 3I3BA 5M5DA 4HP5A 4WX2A 4HB7A 1ADOA 1V3HA 2Z4GA 3M9YA 4QAIA 4AWSA 2DVXA 2IMRA 2QV5A 3WY1A 1S5VA 4CNTA 3A4JA 1Z69A 4RE0A 4ZQOA 5E9AA 1JZ5A 2NV1A 5CBJA 4O57A 1P43A 3ZFHA 4LAZA 4LBRA 3TC6A 4XIAA 4KKXA 1S5MA 4J9JA 1M65A 2F7FA 3NEHA 3WDRA 3PZQA 2DFAA 3IIZA 3DFQA 3U5YA 4O1CA 3T55A 3K2GA 2E0PA 1JUKA 3EA2A 1Z42A 1LRQA 3SN1A 5FJTA 4W8LA 4XUYA 3URQA 3VFLA 2V3DA 3UZZA 2GDVA 2O4QA 4UTWC 4G2DA 3BG5A 4CEUC 2D2OA 1CB2A 4L9YA 3DEQA 1FQ0A 4IJCA 5AYXA 2NXHA 4TQTA 2VUNA 3I4EA 4I7WA 1EBHA 3SCRA 4X0VA 1FDYA 4ML9A 4UOZA 3WD0A 5CC3A 5GNZA 3BAWA 3G8EA 3GHSA 3B8IA 3TJIA 3BW2A 3TWAA 2PC4A 3WLLA 5E0CA 4HNTA 2ZTKA 3W85A 3R8HA 1DWIM 3KM8A 3O9NA 3MT1A 4A6GA 2I9EA 3AYVA 1QOXA 3ZT6A 1UD4A 4S2CA 2J7CA 3VPLA 5E6YA 1XYCA 5C9XA 3B8WA 3C2EA 3CUXA 3UP8A 2VKZG 3VIIA 4IUGA 5GJMA 2GQ8A 2O9TA 1A4MA 4E2OA 1C3FA 5IXEA 3XISA 1ISZA 4D1IA 1LLOA 1QK0A 3UNTA 1SPQA 3AIBA 3AYTA 2GJRA 8A3HA 3VKCA 1KR1A 3ITLA 3TIMA 2HNEA 3QW4B 4QLLA 4L1XA 3ANUA 4O11A 5T8GA 3VGDA 1QPOA 1XP3A 5JMUA 3ARQA 3KW3A 3SUWA 1TWIA 4ILSA 3VOJA 1RV8A 1OYCA 5IBXC 4US5D 3SJNA 4AVNA 2GWNA 3WD1A 4MB3A 3WQCA 2DZVA 3P0WA 1BXCA 1ZBKA 2YXOA 4EAYA 1NELA 3CL6A 3E0FA 2D23A 4P5UA 4UZSA 1MNSA 2W0UA 3VOHA 2YDQA 1DKWA 1RD5A 1ZTVA 4JYFA 3FDKA 4KEMA 3TW6A 3S1GA 1E0UA 1NY1A 2AMGA 2X16A 4IX2A 4NAEA 3B06A 1SQ7A 1IIGA 3EDKA 4GY7A 1HJQA 3GNRA 4XBJA 2GQ9A 2PWUA 4LY4A 4KMQA 5HNNA 2VEIA 3DYOA 1F2JA 3SUTA 1ZENA 4OVXA 2VO5A 1FFRA 4YXGA 4B9YA 1R9XA 2C0AA 2ICSA 4AWEA 1NOWA 1QHOA 4MTVA 1XIDA 3O2LA 2Z6JA 2QCMA 2Z7KA 1E4IA 1CGVA 3T9PA 1ZGDA 2GJLA 3FFSA 4OZOA 1IXOA 4WKHA 1JD9A 4OU1A 2DT1A 5BMXA 3U7VA 3FYOA 3QV9A 2BY2A 1O68A 2VUYA 3O6YX 4J3VA 4AC1X 3AMGA 4NIRA 3W74A 3B0PA 3USZA 1ITQA 4KEVA 2V3EA 3SRHA 4M1BA 2Z26A 1FP8A 2D2JA 2A3EA 4X3ZA 4HOZA 4JNZA 3N1AA 3M7WA 4HNLA 3SUVA 3OZOA 1BEUA 2IPWA 6PTDA 1UR4A 4CQ9A 1X6LA 1KKOA 2E9MA 4HN8A 4N42A 5BXRA 1DWAM 3NWRA 3BSHA 5A2AA 4H19A 3GE7A 5BWAA 4MIMA 5CPMA 2ZVIA 2OT0A 3AQUA 2X8RA 4O18A 4AHOA 3V3WA 1XLMA 3CPGA 4DF2A 4CQ8A 4R88A 3SR7A 5JQ9A 3F4VA 4WUIA 3AU6A 1QNQA 2PLCA 3S2LA