4O50A

Crystal structure of trichomonas vaginalis triosephosphate isomerase ile45-ala mutant (tvag_497370)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
252
structure length
252
Chain Sequence
MRTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFAFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Engineering mutants with altered dimer-monomer equilibrium reveal the existence of stable monomeric Triosephosphate isomerases
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
total genus 85
structure length 252
sequence length 252
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o50A00
3U6WA 1R2TA 4N2YA 2ABAA 2QAFA 1UUOA 1GZGA 1OF6A 2NX9A 4LT9A 2ZRYA 3PG9A 3GZ3A 1JCLA 2NUYA 2ZCGA 4UCGA 2JKAA 3L2IA 2NZLA 3LXBA 3TDFA 4MFEA 3DFSA 4FIQA 4DQWA 3GKAA 4Z1BA 5CGQA 2RH9A 4IXXA 3TQKA 1KFCA 1QOQA 4N4PA 2V2HA 1SFLA 2A6LA 5D38A 1XBZA 3IIXA 3G0XA 1GVQA 1G69A 2WNNA 3QMSA 1BWKA 1VGAA 4GUFA 1C9DA 3S1XA 4ZQOA 1GVFA 3P8IA 1WOBA 1VCVA 3QJAA 4NNBA 5KZEA 2DZSA 4M6VA 3EWXA 1WQ5A 3DFNA 4I7WA 2YDAA 3EX4A 1S3HA 1W5QA 3TMLA 1YYAA 5AYXA 4IMGA 2YYTA 2YW3A 3M6YA 1VYPX 4NNAA 3G1HA 2QCMA 3G1YA 5BMXA 1MZHA 1RVGA 2NXGA 4AWSA 1IXQA 2H3DA 3M5YA 3QW4B 5K2ZA 3WJSA 3V1PA 2Y7EA 4LY8A 4GUGA 3A22A 1NF0A 1EP2A 2E5DA 2RDTA 1FCQA 1TTJA 2CLFA 4XWUA 3SJ3A 4H4IA 3STCA 2OX1A 1JCMP 2R94A 3MP3A 1WV2A 3PULA 5KTLA 3IEBA 3DXIA 4FX8A 1IIHA 4JGDA 2A1YA 4K37A 2B7QA 5ABTA 3LB0A 4UNKA 5EL1A 3F4WA 4MIMA 5CSSA 4NNCA 2CLEA 1EP1A 3JRKA 4CNOA 2ZZ4A 1XKYA 1JCJA 3IIZA 4YWIA 3GDMA 1QDSA 4TX9A 3GLCA 4LOCA 4XZ9A 4IUOA 4MZYA 2NLIA 1YPFA 2GUUA 3E49A 3PR2A 1RQBA 3QFEA 5FF0A 3EKLA 4X2RA 2ZRWA 3C61A 5G4WA 3LBCA 3O05A 3ZFHA 3W1XA 3FA5A 3G0SA 2ALDA 3M5VA 3IIVA 3R13A 4QQ3A 1TTPA 3TW6A 3STEA 2EAWA 2R8WA 1LRNA 5K4ZA 1DORA 4K36A 4N02A 5TBOA 1S5TA 3G1FA 1TPWA 3WFAA 1F6KA 2PRHA 3CEUA 4O28A 1Q3NA 1XBVA 2OT1A 3ELFA 2Z2UA 4MJMA 1X6UA 2EPHA 1OYAA 5HINA 5K4XA 3W7DA 1D3GA 3L5MA 4QITA 4NJJA 1VJIA 4DF2A 3GAYA 4NJGA 3RNDA 4EF9A 4O17A 3W74A 4O1DA 3CLMA 5CG7A 4AF0A 1S5WA 5HNRA 3TU9A 4WXYA 5IBXA 4WX2A 5D2TA 2BLEA 2ISVA 1FXQA 4IMEA 4RJEA 3W1RA 2NV1A 3VKJA 1LRTA 3NR0A 1OK6A 3P81A 3HGSA 1K8YA 3M41A 4MUZA 3SECA 3JS3A 4IQLA 2V8ZA 4LUIA 2GQ8A 1SFJA 4QNWA 2NX3A 4LC6A 3E96A 4PH6A 1QCWA 2NX1A 1TPUA 1KM3A 4GE8A 1EWDA 3CEPA 4JDYA 2E68A 3ANYA 4O53A 3SR7A 2ZZ7A 1R2RA 2VOMA 1P1XA 3TMQA 3W2UA 3NPVA 1LZOA 2YGYA 3W7KA 4UTTA 3TROA 5EBUA 5LHEA 4E38A 4J9JA 3CU2A 1H7WA 2O7SA 2YSWA 4UFMA 2G5WA 3W7RA 1QO5A 1LOLA 1L6SA 1MSSA 4O1AA 1DHPA 2D73A 3QQ1A 5HUOA 1OF8A 1VRDA 2DP3A 2PE4A 3M5ZA 3OA3A 4IPIA 5LKYA 5HULA 2ZTKA 2RFGA 4DEFA 1OFAA 3YPIA 1TRDA 3ATYA 2Z6IA 3MYOA 1JCXA 4BWLC 3LHZA 3THAA 1UASA 3WK0A 1MEHA 3EEGA 2ZYFA 2DZXA 5LNVA 5F1VA 1LOQA 2FPYA 1H62A 1TPC1 2ZA2A 2XN1A 3A9IA 2QCEA 4NZFA 4LS2A 1VLIA 4O14A 4Z1AA 5H91A 1XM3A 3L67A 4MOZA 4BI6A 1QPRA 3G3MA 5EPDA 1GVSA 2CZFA 3ABQA 3S5OA 1RQEA 1WX0A 1S5VA 3BLEA 1XI3A 4M19A 3M43A 1LYXA 3MI3A 4Z0JA 3TAKA 3BG3A 4CCDA 3H55A 4FF7A 3DI0A 3MI2A 3NYZA 1WXJA 4UXDA 3HGJA 4IX2A 4UMBA 1OFPA 1PV8A 3U8GA 3TA6A 1OYBA 3N19B 2YZRA 3IGXA 3TFXA 5AHMA 4UTLA 6TIMA 2ISWA 4ZL1A 5HQEA 1OFDA 4FIRA 3CT7A 4WOQA 1A5CA 2AAMA 1MEIA 1KM6A 2VXNA 2A7RA 3HF3A 1JULA 5DY3A 5F2IA 4BR1A 3ZWTA 1MEWA 3W1TA 1FWNA 1KV5A 1QOPA 1GPWA 4O54A 4CQ8A 2H8XA 2TSYA 1K3UA 4UFIA 2VEPA 4YXGA 4ZQMA 2CFFA 4MLRA 2BWGA 4MZ1A 4O12A 4NZJA 4JIPA 2BX7A 3GDRA 1W8SA 5KSWA 1OFQA 2GPTA 3Q94A 2CLLA 1W5OA 3PSVA 2Z6JA 3W7NA 1FUYA 4TMBA 3EWWA 1KV8A 1AK5A 4GRSA 5BMWA 5HR7A 3GXTA 1V7YA 4KFOA 3KRSA 2CZDA 1U83A 4FXSA 4Y96A 1TPDA 4MY8A 3GB6A 5D2XA 1Q6RA 4ML9A 4K39A 3BW2A 2A4AA 3HJZA 2QCHA 3GIYA 4RR4A 3DU0A 4K6AA 3RK8A 4UTKA 4B5NA 5LNSA 5I3JA 4ZMGA 3NA8A 1TPEA 3EWBX 4MYXA 1G6CA 3GAKA 3QSTA 5I3KA 2TPSA 4LS0A 4Q4KA 2FDSA 1Z44A 3E02A 3L0KA 4N6FA 1OFOA 2QF7A 3NQDA 1OX4B 3QEZA 2VEKA 3F1QA 1VQTA 3T7VA 5CKSA 5EMUA 2WNQA 4AHQA 3P74A 1KBIA 5D05A 2FB3A 3MBDA 3FKKA 2FIQA 4U28A 3MP4A 4RCXA 4WY0B 1C8VA 1QPOA 4IWWA 2QJIA 2NWSA 1H7RA 2X1RA 3NAVA 1AMKA 3C6CA 5CPNA 2Y63A 3N14A 3LCHA 3DKJA 2VC6A 3O63A 1ZNNA 1XXXA 1I2PA 3TSBA 1KLZA 3DHDA 3Q2DA 4DPPA 2QCDB 3O8AA 3G8EA 1KFEA 3E12A 3G0UA 4MY9A 2YYUA 2TMDA 3W22A 5AOUA 3W71A 1SQ7A 4IGHA 3DENA 5K3VA 4NXKA 4OV9A 1OFEA 5K9XA 1DBTA 5AHFA 4N9EA 2NWRA 4IMDA 1WDWA 3S5NA 4RKAA 1DV7A 2B7NA 2Y70A 2PURA 2GVJA 3ATZA 4BFAA 1KTNA 1ZCOA 2TYSA 3LHYA 3MWAA 3LX9A 5H2ZA 1TPFA 3NPXA 3OIXA 4RZ5A 5I3FA 3H53A 4HSNA 3BLFA 1TQJA 2P10A 4O15A 3C56A 2J9ZA 1PCWA 3L9CA 3O06A 1KM0A 4O52A 1FWWA 3W1LA 1OFRA 4IMFA 4DBEA 4KFNA 1E51A 1THFD 3LTSA 4M7TA 5FEWA 2ZRXA 3RFAA 5AB3A 1TQXA 4CNPA 1YXCA 1JRBA 1ICPA 1V5XA 3FEMA 3W7QA 1F5ZA 5FF4A 1GG0A 4BWLA 4O16A 5DCDA 3PM6A 3FLUA 2E77A 3UXDA 1DL3A 3HG4A 3RLUA 4HN4A 2G95A 3OVRA 2QCNA 1A5AA 4L4LA 3T44A 3W2LA 1OG0A 3NM1A 1W3TA 2BSLA 3LV5A 1LLZA 3TE9A 2RHGA 3MHGA 1XUZA 3LCWA 1SPQA 2A7NA 1K8XA 4WJEA 4BI5A 5HJLA 2AQWA 3UYCA 5DBUA 4Z1CA 5U7SA 5K9CA 1ICQA 3LCIA 3W7LA 4GJ1A 1H7PA 3F4NA 2F7FA 3T55A 1MXSA 4EF8A 1DJQA 4A21A 4RV8A 3KVKA 4JYEA 1YPIA 3GK0A 4I7UA 3BW3A 3S5YA 3M9YA 4R33A 2W0UA 5AHNA 1HL2A 1LOSA 1W54A 1D9EA 3BGGA 3FJLA 3R2GA 1P4CA 3W7HA 5HWNA 1O5XA 5F4SA 1G4EA 3UY8A 2BXVA 5FF3A 1A53A 4O18A 4PC8A 3HO8A 1OJXA 3QF0A 5CPOA 1H7OA 2FB2A 4ONVA 4NQ1A 4JEQA 2I9EA 3RLVA 1FX6A 1OABA 4HPJA 4IX0A 1ALDA 2Q3RA 3C2OA 3SI9A 2EGZA 4M6QA 4UIOA 1TIMA 7TIMA 3G1XA 1SR9A 3NQMA 4UMCA 1ZAIA 5BW6A 4M7SA 2X1TA 4N9BA 3PB0A 5AYYA 1SSGA 5A8GA 2ZZ5A 3DFOA 3TAOA 3TQVA 4CLMA 4XTIA 3F03K 3KXQA 2WSQA 4FXRA 5HMSA 3FYOA 1TYGA 5A5WA 4K38A 3NQ7A 5FEZA 1RV8A 4FNPA 4JY9A 3JR2A 4PL2A 2CW6A 1XCFA 2VKZG 1ZFJA 5E0KA 1AG1O 2JK2A 4LVAA 3TH6A 4ZQPA 1L6YA 2ZDRA 3QZEA 5J5RA 4MFDA 4NXSA 3DH7A 3HGOA 3S1WA 2ZBTA 4AWTA 3LCXA 3LTYA 3BG9A 1B3OA 3TC6A 3W9ZA 2E1DA 3NQGA 4LV9A 3ZWSA 1YTKA 4HNVA 1HO1A 3LLDA 3TNOA 3NQAA 3P80A 3TX9A 1WOAA 2YR1A 1G67A 4FNTA 3ZS4A 4OU1A 1RZMA 1W0MA 1W3NA 2ZQ0A 5CPMA 5K7JA 3B06A 3EX3A 1TJRA 1H61A 1I4NA 4N9DA 3W85A 4O8RA 3W88A 2J9YA 2QCCA 4S1FA 3ABOA 5AC6A 3N9RA 1GTHA 3B05A 1L2UA 3LCLA 3TV8A 1H51A 3IIOA 1QPQA 1I2QA 3THQA 1YTDA 5F1UA 1WA3A 1FDYA 1XC4A 2E09A 1WYIA 5D04C 2YFOA 4W9TA 3TK7A 1IF2A 1JVNA 3R5EA 1CX9A 2A6NA 5DXYA 5HWJA 1VH7A 2WNZA 1SU5A 2YPIA 1KM5A 3MHUA 4I7VA 4X9SA 2UV8G 3I68A 2FQIA 4GUIA 3Q37A 4WUIA 5EA9A 2P0OA 1LTDA 4GBUA 4O19A 3P60A 1DKWA 3ABRA 4IJBA 2H6RA 1B9BA 2HS6A 1SSDA 3NM3A 2OT0A 2JGYA 5T26A 3P8JA 1P0KA 3MJYA 2E6FA 4C1LA 2OZ0A 1PCKA 5EY5A 1JUEA 4UUIA 5F2MA 3W1MA 2NV2A 1M5WA 3P5ZA 3BVJA 3G18A 4WZHA 2E6DA 3U2OA 3N2XA 3CTLA 2EHHA 2ZZ2A 3HOJA 2YW4A 3P84A 4UR7A 4G1KA 1NF7A 1YADA 1PVNA 3L68A 4JICA 1CI1A 4M5PA 4EVZA 4QM1A 3UNDA 3W6YA 5G1YA 1YTEA 3PY2A 3QSRA 5CZ0A 3IIPA 5DCBA 3NPUA 1O60A 4GXMA 1PL9A 4O57A 3M16A 3P82A 1KW1A 3M5XA 4Z1DA 3O6CA 3W1AA 1UUMA 4XBKA 2KZHA 1YDVA 4ZZ9A 3LHTA 2HSAA 3NL6A 4K7YA 3S42A 3EX6A 1KM2A 2A7PA 1R47A 3PBYA 3AO0A 3GDKA 4LWWA 1HFBA 3WK2A 2G96A 3W75A 4N4QA 4JIQA 4IPJA 4UFJA 1ZY9A 1NFBA 1PE1A 3EKZA 1GT8A 1X1ZA 1SZGA 4MPQA 1NVMA 1EUAA 1QWGA 4RLIA 1Z42A 4LW7A 1NEYA 2CLHA 1FY6A 1T0OA 1RPXA 5D2VA 4N6EA 2XN0A 4PTNA 2C13A 2CLOA 3BO9A 4ADUA 3NDOA 4O0ZA 1ML1A 3WJXA 3TIMA 3NO5A 3TJXA 1EIXA 2YCEA 3LXAA 1KFLA 4TIMA 1BTMA 3STFA 3FKRA 3G1AA 2ATMA 2Y6ZA 1GEQA 1UCWA 3MI6A 2Q8ZA 1MO0A 2QR6A 4RXFA 3TR2A 1KBJA 4UR8A 3LTPA 2QJGA 2NUXA 1X8FA 4QSHA 2GJLA 3L65A 1JR1A 3ZR4A 2HTMA 4K8HA 1FDZA 3IGUA 2A0NA 4UFKA 3W7EA 3L5LA 1K7FA 2H8ZA 3VFLA 1QO2A 1X1OA 1O4UA 1G7VA 3TCEA 2C1HA 1Q6LA 3BW4A 4AHPA 5G4EA 2FPVA 3LHUA 3OEXA 3T78A 3DI1A 3OVQA 1JRCA 3NL2A 3CM4A 3P7YA 3EWZA 4O4WA 3LI0A 2JGQA 4FNUA 4OE7A 2V81A 3QH2A 3WK3A 4DF1A 3P5YA 3PBUA 1DQWA 5LGXA 3GR7A 4JD4A 3W1PA 1PHQA 1ONRA 1RQHA 4ALDA 4HKPA 4HNTA 4JTFA 5BOOA 1N8FA 5DCEA 4BI7A 4A29A 2CLKA 3NG3A 2OCZA 1GWJA 2QDGA 3A5VA 1L9WA 4L4MA 3M1ZA 1O95A 1RD5A 3CB8A 4JYDA 2CLMA 3LM7A 4OGZA 2V2CA 1IXNA 2GJNA 4POCA 4BF9A 2E6YA 3NEVA 4RX0A 1VC4A 5LSMA 3EXTA 2CZEA 3W2KA 1EPXA 3PF3A 3HIJA 3G1SA 2AGKA 2GQ9A 2J6XA 1UBSA 1FCBA 1PIIA 4MJZA 4XUGA 1AL7A 3PBWA 5DBTA 2QUVA 1K7EA 1AW1A 3PG8A 5MHBA 5KINA 5CZJA 4HSOA 3CWNA 3LCFA 4S2CA 3HPSA 4QNEA 4K8EA 4UTJA 3B0UX 4XQ6A 4JX5A 4P61A 4Z0SA 1J2WA 1I45A 4UTUA 3B0PA 3FIGA 1N55A 3B4UA 4HIBA 4AB4A 5FEPA 4FNSA 3SGUA 1P0NA 3KAOA 2QUTA 4O1CA 3HMJG 1Q6QA 4U4MA 2Y88A 5DN1A 1AW2A 4WY0F 1W5MA 5AHEA 4TR9A 4HT3A 1F7BA 3IGSA 2JKPA 1XDLA 2Q8LA 4EIVA 1UB3A 2RKXA 4PL1A 4Y90A 2EF9A 5LNUA 3CQ0A 2VFHA 2C3ZA 4Q32A 2C14A 1TMHA 2Z1BA 3GVGA 2WPBA 1LBLA 2V2DA 3C2FA 1J5TA 3Q58A 2J24A 5DXXA 3G24A 5D2YA 3W23A 1H1YA 2PRMA 2VFEA 1JQVA 2FFCA 4NUWA 3KRZA 1ZALA 2ISSA 2Y89A 2I14A 3DHFA 1OX4A 5D37A 2QCGA 3WK1A 1ICSA 3T4CA 1SO3A 3NQCA 3A5FA 3MBFA 4A2RA 4Q33A 3LOTA 3NQ2A 4WXZA 3NGJA 3RMJA 1VCGA 1QAPA 3LRLA 3QPYA 1Z48A 3EWUA 3TFCA 4OQVA 1TRIA 4JTUA 2A2IA 1EP3A 2JKEA 3CC1A 1TSIA 2CLIA 3KRUA 1KFBA 4R34A 1M7PA 3NZ1A 3S8HA 5GVJA 3HB9A 3DBPA 3S5ZA 3LLFA 3C8FA 2WQPA 4FNQA 3A21A 2YXGA 5F2GA 4E2BA 4P2VA 3W7OA 4PEKA 2QCLA 2ZZ3A 1F2JA 2Y61A 4AH7A 1G4PA 2C19A 2H3BA 1I8JA 1IIGA 4FX6M 3W83A 3BG5A 2V30A 1GVRA 1F76A 3GDLA 3E0IA 3VE7A 1GG1A 4CQAA 3TJLA 3W86A 1HUVA 3KFTA 3QW3A 4PCFA 1W56A 2W79A 4LNYA 3I65A 1Q45A 1F74A 1Q6OA 2W6RA 1H60A 3O6DA 5TQLA 3W87A 4LTSA 2QKFA 3HBLA 1DQXA 1EEPA 3B03A 2Y7GA 4AAJA 5K9DA 4CCEA 3CWOX 1KM4A 1TREA 3W1UA 3N2MA 2C0AA 1EX5A 3W3OA 5L6UA 4NJKA 1VCFA 3HG3A 1KFJA 1LDCA 3LBMA 3LXCA 4C1KA 2CWNA 1A5BA 4NJHA 2ATSA 4O10A 4ZQCA 1DOSA 5J5DA 2J9XA 4A22A 3UQNA 3L21A 4IMCA 5I3IA 6ALDA 3QMTA 3W7JA 3FS2A 4JTJA 3RU6A 3D0CA 1JCYA 2ABBA 1Y0EA 5D33A 2GVLA 4XKYB 1FWRA 4NJIA 4HHPA 1GVOA 3C2EA 1W31A 4NU7A 5LNRA 2Y7FA 5G2WA 5G2HA 2BTMA 4MZ8A 5F4WA 4DBDA 3KHJA 4LV4A 4GFSA 5KMYA 3TW7A 1WAUA 2X1UA 2QUUA 1VLWA 3DAQA 2WOQA 1GJPA 2XFWA 5SWUA 5BRBA 3S9YA 3M47A 2CU0A 1F73A 2DZUA 4MVAA 1LBFA 4HNUA 4XTDA 3W07A 1OYCA 8TIMA 3GR8A 4KKXA 4JY8A 4LS1A 2B7OA 3R8RA 5AC8A 4RXGA 4LRSA 4YMZA 5C2XA 3INPA 2DJLA 2ZRUA 4JDBA 1LLWA 1EUNA 4YLWA 2Y7DA 1OK4A 2VEMA 5AN7A 3O07A 2O7QA 1W1ZA 4Z08A 1B4EA 1SO5A 4WD0A 4MYAA 4O1BA 1O94A 4JTSA 3LV6A 1LCOA 2V82A 3T40A 3NNTA 4DPQA 3WJWA 3TKFA 5AHLA 2LLEA 1I2OA 2WSYA 3MHFA 3UWYA 2X2GA 3KVLA 2X1SA 1IXOA 1KM1A 5D30A 4X22A 1ADOA 1I2RA 2E5CA 1ME8A 3G22A 4UTWC 1W37A 3EXRA 2PRLA 3C3NA 5HUPA 5E93A 4ZQNA 3HPZA 3CHVA 4N9CA 3LDVA 5HWMA 3TUUA 2HMCA 1H7NA 2B0MA 4S2BA 1YDNA 3HQ1A 1R46A 5CSRA 1BKSA 2V5LA 2ZTJA 4H3DA 4NVTA 4DF0A 3GYEA 3EB2A 1I2NA 3C2RA 4JTGA 2J27A 4JN6A 5E1QA 3I7SA 1SO6A 5DLCA 4IOTA 3S1UA 4TO8A 1JJKA 3PUOA 2G97A 2VFDA 1AL8A 4FEZA 2OMAA 4O0KA 3NL3A 1Z41A 2WO5A 3W76A 3M44A 1VPXA 3GNDA 3W7MA 4GWEA 1BWLA 3DKLA 1K8ZA 1TCDA 3TXVA 3MUXA 1W5PA 4AF0B 2A21A 4UTMA 1XDMA 3G1DA 2JBMA 1GQNA 4YCOA 4LVGA 2V5BA 3LERA 4ADTA 1W3IA 3W7IA 4GUHA 3TSDA 3W1NA 3FYPA 1YLVA 5I3GA 1KLYA 2DJXA 3N3MA 3HGRA 4M6PA 3UWZA 3NQFA 4ZVJA 1SO4A 1FDJA 3TSMA 1SW3A 3UXAA 4KWWA 5G5IA 1XBXA 4DXVA 1PHWA 2VENA 3WJZA 1EB3A 5G2IA 1EA0A 4UNLA 3EXSA 4O11A 1VS1A 2GQAA 4JTHA 2ZRZA 3W70A 1JUBA 4UMAA 3C2VA 3O15A 3S1VA 3KOFA 3SZ8A 3P67A 2R14A 1K03A 4OHQA 5DY2A 2A85A 4BK9A 3W73A 3M0ZA 1M7OA 4FHAA 2NXHA 3PUDA 4MKNA 3LGEA 4JYFA 1QR7A 4UFLA 3P62A 1WBJA 3NQEA 3EX1A 2QJHA 3NL5A 2IQTA 3I6RA 3QM3A 3IVTA 4TMCA 5LZLA 1HO4A 3S6DA 3BGJA 3QPZA 3NVTA 3SSJA 1OX6A 3MP5A 3QYQA 3KX6A 3LRKA 3N34A 3MMTA 1KA9F 5U4NA 4E2DA 2ZFAA 4A2SA 1TV7A 2V0TA 3SW6A 1QNVA 1G7UA 1TO3A 4PA8A 4MLJA 3SIZA 2QCFA 1TV8A 4KFPA 1JQXA 3KVJA 1ME7A 1LP6A 3LRMA 1TPH1 1VZWA 4Y6GA 4R7JA 1HG3A 4ZQRA 5DELA 2R91A 1QPNA 3BARA 2C18A 3W84A 1A5SA 4JTLA 4ADSA 2J88A 4YCPA 3B0VC 2ZA1A 4RZ6A 4JR5A 1G4TA 2Y85A 5D02A 5D32A 3MW7A 4YL2A 1N7KA 2Y62A 3IVSA 4ICNA 1D3HA 3NPWA 1GYNA 1FXPA 3LHWA 3H54A 3S0CA 3PUEA 5IM51 1RR2A 4JTTA 1TPB1 5CPLA 2WKJA 1TPVA 5FF7A 3NQVA 3A24A 1XUUA 2XN2A 5TIMA 3USBA 4JXCA 3IRDA 2FTPA 3RF9A 1XFBA 3GDTA 1XBYA 3PB2A 3R12A 2BZNA 3CIWA 3UPWA 2FLIA 3W2MA 4FO4A 4OBTA 1VHCA 3HG2A 1R2SA 2WSRA 5EKYA 1JCNA 2X16A 4DO4A 1TTIA 4HPXA 4AHOA 2QEZA 1B57A 1KFKA 3K30A 2QAPA 4AVFA 1ZHAA 3QMRA 3I7QA 2NUWA 5FEXA 3I7RA 2PCQA 3IV3A 2VFIA 3BK0A 5LGZA 3DGRA 3LHVA 1TJPA 1K7XA 2GOUA 3IVUA 1FCUA 1FBAA 3QQ0A 2DZTA 4DO6A 4LC8A 3PC0A 3PSWA 5AHIA 4E0CA 4EWND 3QC3A 5C5YA 1BEUA 1VYSX 5AFDA 2ZRVA 2RDWA 4IXHA 1M6JA 1LORA 4FX7A 2FPTA 5L9FA 4NX0A 3NZRA 1TV5A 4LVFA 1H5YA 2P1FA 3UPBA 4UTWA 1A50A 3OBKA 1XL9A 5FESA 1WBHA 1QFEA 5CZSA 1DJNA 3UWWA 4FB7A 1GTEA 4Y8FA 2CZ5A 1OVDA 3OVPA 1KTBA 3PWAA 2WV8A 4AXKA 3P61A 1H1ZA 1J4EA 4QIUA 1OHLA 1K02A 4XBSA 1L6WA 3GXNA 4WQ6A 3STGA 2PC4A 3UZJA 3W7CA 3GXPA 3O16A 3OHIA 4O50A 2HS8A 3BV4A 3SFKA 1F05A 1X7FA 3EWYA 3G1VA 5LNWA 2Z0IA 3LI1A 2QDHA 3FJ6A 2VFGA 4O4VA 4JX4A 1PS9A 3O6YX 2YFNA 2DZWA 2I1OA 4LVBA 1HTIA 4MY1A 2ZA3A 3G8RA 4UC5A 4JNMA 4K7VA 4GNJA 1VYRA 4TU1A 3PVFA 5LHFA 3TC7A 2E6AA 5FF2A 3VCRA 1SZFA 4JTKA 1SZNA 3W72A 3LCGA 5I3HA 3L5AA 4PFMA 1GOXA 5AC7A 1SW7A 4PODA 3FOKA 3MYPA 4EOUA 1U5JA 3UY7A 1YDOA 3N9SA 3UD6A 3BPWA 3GX9A 2A5HA 1FWSA 2NXIA 4D2JA 1IGSA 3N73A 4GUJA 1T99A 4OWGA 4WY0A 1DVJA 1H50A 2B4GA 3GKFA 1NAL1 5C6MA 1O5KA 3NQ8A 3E9AA 3UWUA 2EKCA 3DZ1A 2VEIA 1TB3A 1T8XA 3FFSA 1EWEA 4R53A 1VR6A 5AYZA 3UWQA 3L66A 3DFQA 4RZ4A 4RK8A 3C4UA 2QCDA 1NSJA 2FJKA 4A3UA 4ORIA 3PAJA 3WJYA 2GVGA 3PBVA 3B8DA 5C54A 1C29A 4JTIA 4H6KA 4WOZA 1LROA 1ZENA 5KZMA 1ZJIA 1LM1A 1KTCA 2C16A 3B04A 1OFBA 3HPXA 1SUXA 5IBXC 4LVDA 2WJZA 4QAIA 2V9DA 1FWTA 1TTQA 5EYWA 5C55A 3VNDA 3CIXA 4LU0A 2RDUA 2TRSA 1T96A 2C15A 4NX5A 1JUKA 1FQ0A 5CZTA 3V75A 4NT0A 4AMAA 3VE9A 2OJPA 3DFPA 4X3ZA 1R30A 4JTEA 3L0GA 4UTIA 4OV4A 3W7PA 2VFFA 2B7PA 2VELA 5HR6A 5BNKA 4LRTA 2DORA 3NXFA 3SY5A 1FCVA 3MO7A 1H7XA 4UTTC 1P5BA 3W7GA 1LBMA 3TQ0A 2C6QA 4FNRA 4O13A 4CQ9A 3A23A 3DFTA 1W5NA 2F84A 3C52A 5F4XA 1B4KA 4LUJA 1CW2A 5G1TA 2X30A 3M7WA 4QJ1A 4CCCA 1IXPA 1H63A 1LRQA 4AEOA 3TXZA 3AJXA 3C0JA 3ABSA 1QMLA 3W2JA 1YXYA 3PS7A 2DZPA 4UFHA 3R89A 2DZVA 1YXDA 4DO5A 5D2WA 5F2LA 1ZAJA 2DU2A 3QRHA 3SGZA 4QISA 5FI8A 2H90A 1AW5A 1GYLA 1ZAHA 3BLIA 1F6PA 3NOEA 3EX2A 2E5BA 4ORMA 3UZ5A 4I9AA 3L0NA 5KZDA 1SW0A 1UJPA 5D09A 4Y9AA 1G4SA 3W2NA 3HG5A 3KVMA 3UWVA 4GC4A 4KWVA 1SZEA 4OT7A 2ZZ1A 3G3DA 4CNNA 3CPRA 3VI2A 3O1NA 4UTHA 1VHNA 1OX5A 4JX6A 3GNNA 3OG3A 3NQ6A 2ZZ6A 4JS3A 4AWUA 3W1QA 1ME9A 2YX0A 4XKYA 2Q3OA 4DELA 4HNNA 5D03A 5KITA
chains in the Genus database with same CATH superfamily
1R2TA 3F4VA 1Q6GA 2QAFA 1UUOA 2G4JA 1CZ1A 1OGSA 3WF1A 2NUYA 3IGHX 4UCGA 2A3LA 4BQ5A 4FIQA 3W0KA 2WVVB 2O4QA 2FZ9A 3UZYA 4IXXA 3Q45A 3VPLA 5HPOA 2A6LA 5D38A 3VKAA 1TUXA 2J25A 5AC4A 2GSHA 1YE6A 2WNNA 3QMSA 4XSMA 1BWKA 2WMGA 3FN9A 1C9DA 3IK4A 3WUFA 4ZQOA 1GVFA 4RE2A 2ZX9A 1BVNP 1EX1A 2E25A 3XINA 1GZJA 4I7WA 4OFCA 1S3HA 3WMBA 4P7LA 5AYXA 2YYTA 2INZA 1VYPX 3G1YA 5CPSA 3HPFA 3WQ4A 5K2ZA 3EPMA 3V1PA 1X38A 4D8ZA 1W9UA 3K5XA 1NF0A 4US6A 3TTQA 2RDTA 3WQEA 3SJ3A 1KR1A 1WV2A 3LSCA 3IEBA 3UZWA 4HD5A 1IIHA 2BDQA 4K37A 2YBVA 4C1NA 4UNKA 5EL1A 5CSSA 3JRKA 4CNOA 2ZZ4A 1R3QA 4YWIA 3GXFA 1PZ0A 5A94A 1F3TA 1YPFA 2GUUA 2EPMX 2XZ9A 1CLKA 1XRSA 2ZRWA 3GFYA 3AHYA 3FA5A 3G0SA 4OUIA 2YL9A 3TLQA 3BAJA 1UD8A 5K4ZA 4ZBCA 1S5TA 3LNPA 1V3HA 3MCOA 3H2CA 4O28A 1JAKA 2D0GA 1X6UA 4ES4A 2DSZA 4ML4A 4OJYA 5HINA 4BF5A 2RJHA 1LL6A 3MKCA 3CUGA 3RNDA 2PS2A 2ESCA 1S2AA 3DFYA 2PD9A 4WXYA 1C93A 2BLEA 1EQCA 4RJEA 3W1RA 3URAA 1LRTA 3P81A 1OK6A 3NR0A 3HGSA 4MUZA 4XISA 3SECA 4LUIA 5A8PA 2PLJA 4PE8A 3QVQA 3TA9A 2GQ8A 1SFJA 2QXWA 3JU2A 4LC6A 4PH6A 1TPUA 3H7RA 4J1OA 1KM3A 1QHPA 1GNXA 1P0EA 2DQXA 4JDYA 5E5CA 4CU6A 3GXIA 3SR7A 2VRKA 3TMQA 3CZKA 3NPVA 2D3NA 2PU0A 2VNCA 4LPCA 5LHEA 3ANVA 3LG3A 3BWWA 1UR2A 5FAJA 3W7RA 2O9PA 4G5DA 4O1AA 1BYDA 3V16A 5HUOA 3OA3A 1I0DA 4IPIA 5H8UA 3RRXA 4URIA 3SCUA 4HYWA 1TJ0A 3GH4A 3N15A 3MYOA 1JCXA 1NOUA 3CUJA 3EEGA 2EBNA 2BVWA 2BY1A 5LNVA 4F66A 1LOQA 3VDCA 1TPC1 4PMUA 4JNYA 1I6NA 2YCJA 4IMAA 4CNSA 3KOXA 2BHZA 1XM3A 4Q7BA 1Z7AA 1QPRA 4WSJA 1HN1A 1GVSA 3VZXA 5DT7A 3N2BA 3OYXA 3P6LA 4HOWA 1LQAA 1S5VA 2VDHA 3EZ4A 1ITCA 1CGUA 3E1F1 4ROPA 5CLTA 2HRWA 3TAKA 1R86A 2PP1A 3DI0A 1IZCA 3W29A 4MDOA 1OFPA 3G77A 3WQWA 3OBAA 4C6BA 3E2SA 4S3GA 2YZRA 3D3AA 6TIMA 5HQEA 3EKGA 4FIRA 3OO2A 4HU0A 4V15A 1ISVA 4JEJA 4M81A 1MEIA 5D9MA 5DY3A 3VOFA 2CCRA 3HQOA 3K1GA 4CQ8A 2H8XA 1K3UA 3WYZA 4JKLA 4UFIA 1UKOA 2ZX5A 3PN8A 4MLRA 2BWGA 3PPHA 4EANA 4NZJA 4JIPA 2BX7A 3W4RA 1Y7VA 4GVFA 3LBOA 4L5ZA 2CLLA 5CSUA 3GO2A 3EWWA 4AC1X 1KV8A 1AK5A 4GRSA 1AVAA 3FA3A 3GXTA 1N2VA 3WH7A 2EPOA 4KFOA 4QXIA 1XLEA 1JI1A 5I06A 4FXSA 3GB6A 5D2XA 1Q6RA 4HN8A 2HDJA 1GOMA 5CJ5A 3BW2A 2QCHA 3NURA 4CD6A 3THDA 4UTKA 5A6TC 3CH9A 1BFNA 1E0XA 3VM7A 1K9DA 4AEFA 4C60A 3BDKA 1J12A 4QP0A 1PTAA 5KEZA 3NQDA 5DRCA 3QEZA 1ZJAA 3VGFA 1CLXA 3O0FA 3T7VA 4B3KA 1ITXA 1LT7A 1A5NC 5CKSA 5EMUA 4AHQA 4MB3A 2W27A 3EA1A 1AD1A 2VX6A 1QNPA 4MWAA 1E1FA 1FKXA 1QPOA 3GHUA 1EPVA 1H7RA 2G4FA 3VX0A 3FHAA 4AD2A 2DSWA 1HJUA 4DY1A 5CPNA 2HXUA 3GVWA 3A4WA 4NZ4A 2VC6A 4EXAA 3O63A 1ZNNA 3SN1A 1I2PA 1E1CB 3TW9A 1XQKA 4ZOAA 3WQGA 2DSVA 3AS2A 3E12A 4AZBA 1WUFA 1H1NA 2YYUA 4B5VA 3AIQA 2TMDA 4M24A 3T07A 5K3VA 1O12A 5EMJA 2ON3A 5K9XA 1E15A 5AHFA 2REQA 4N9EA 4EAMA 1R3YA 2HE5A 4D9PA 2NWRA 4HHLA 4C6CA 2WM1A 4IQDA 3WLSA 2GVJA 3ATZA 4BFAA 4TV5A 1KTNA 5LXXA 1ZCOA 3LX9A 3OIXA 3VILA 3EDKA 1JZ4A 3A13A 4M1BA 4HSNA 2NT1A 5A6BD 2FZDA 1T41A 3EA3A 4Y7EA 2J9ZA 3UR2A 1PCWA 1S46A 3NXLA 1OFRA 1JZ2A 4XD4A 1TWDA 3WQ8A 4DBEA 3AROA 4KFNA 1THFD 3H23A 5FEWA 2ZRXA 2I16A 1UWAA 4L4OA 3RFAA 1ZBCA 4AYGA 5AB3A 2VHLA 3N2OA 4D6IA 3AWOA 3VOJA 3JZEA 2J62A 3WSUA 4O16A 3FLUA 3U57A 1DL3A 1TZZA 2OWWA 1LT8A 2WZIA 3RLUA 4RE0A 5BXRA 3OLEA 2QCNA 1K4HA 3OBEA 3NM1A 1XIHA 2VCBA 2BSLA 3MHGA 3ISIX 1BHGA 1FH9A 4GX8A 1XUZA 1B5TA 3GTIA 2AQWA 2V67A 4RDZA 4DWSB 2D0HA 1ICQA 1IT8A 1FA2A 4PB4A 1Z9AA 3REQA 4GJ1A 1H7PA 2GJRA 3N29A 4RV8A 2UY2A 2V5KA 2EJ1A 4JYEA 4W88A 5LA2A 3UJRA 3G1RA 2XGZA 4Q8OA 1RJRA 3BW3A 1CIUA 2YZ5A 4IPPA 2W0UA 3SM0A 3BGGA 1D9EA 2X7VA 4GACA 2OSYA 3ZOAA 2PPGA 3PNUA 4JQ4A 5HWNA 1TWWA 1Z69A 3G5EA 3JVAA 3UY8A 3DOPA 2BXVA 3GYCA 1A53A 2A3AA 1CGTA 4PC8A 1A49A 4A4AA 2DGAA 2GVYA 6A3HA 2FH6A 2P3EA 4W7WA 4ONVA 4NQ1A 3AMDA 2I9EA 1FX6A 2VUYA 4IX0A 3C2OA 1P7TB 1GOIA 1W6TA 4WKAA 3PB0A 3DFOA 3QV9A 4WR3A 3WQ5A 4CLMA 3KBNA 3F03K 3KXQA 3T2QA 3S6OA 4FXRA 5HMSA 1K70A 3UXKA 2Z24A 3CIVA 3NQ7A 2EPNA 1L0PA 1KXHA 5F7UA 2VKZG 3URQA 2JK2A 2CC0A 5CBJA 3QZEA 5J5RA 3ERPA 3DH7A 1PBGA 2X7WA 3UR8A 1A47A 3OTRA 4LCSA 4QE5A 4OVXA 2BVDA 4CD8A 1WE5A 4GYKA 4LV9A 3ZWSA 1VFOA 3V0UA 1RXOB 6ENLA 3M6DA 3ALFA 1SJBA 3SB0A 4H9TA 1Y5VA 2YDSA 4BKNA 1Y5XA 4FNTA 1ZUAX 4L61A 3ZS4A 4OU1A 2OOFA 1SMDA 1RZMA 3R58A 2HE8A 3I3BA 5CPMA 4HMCA 4D6CA 4N9DA 4C5YA 4O8RA 2D2HA 4IFKA 4DJFC 5ABHA 3LPFA 3QY6A 5AC6A 3UG8A 5A69A 3B05A 1L2UA 3MA8A 4JQ2A 4AQLA 2WANA 4DIAA 5ECUA 2E09A 5ABFB 5D04C 1V03A 2VEGA 4PULA 5HWJA 1J0KA 2XFRA 2P88A 2C1IA 3MHUA 3V35A 3F2CA 3SY8A 3I68A 3VD7A 1JI2A 1RHCA 3Q37A 1TE1A 2CBVA 5BRQA 2P0OA 3ZM8A 4O19A 1DKWA 3ABRA 3BTNA 5C9XA 4FA3A 5CC6A 4KF1A 1Z32X 1SSDA 4CCZA 3NM3A 2OT0A 5T26A 4TVUA 3P8JA 3SQMA 5RUBA 2OZ0A 4F8XA 5F2MA 4UUIA 2VOTA 1M5WA 3ARTA 3MSRA 2PZNA 1X97A 4P8VA 5HDRA 4ERGA 1AQ0A 4UR7A 2YW4A 4UCFA 2G3JA 2O55A 3L68A 4QJ3B 3U7VA 3UF9A 1RALA 4YTRA 4M5PA 1PTGA 4QM1A 5JXQA 1ISYA 3QSRA 5CZ0A 3AISA 3USZA 3OP2A 3NPUA 4Q8NA 1ZJBA 4O57A 3M16A 1FH7A 1UUMA 4XBKA 3CK5A 1YDVA 4M80A 3LHTA 1XH0A 4K7YA 1R3SA 3EX6A 1KM2A 3PBYA 2D0FA 3WELA 1PKLA 4LWWA 2Z1WA 3LGDA 2G96A 3ZT6A 3W75A 4N4QA 4JIQA 4UFJA 3B9AA 3RLHA 1NFBA 3RCYA 4RLIA 1Z42A 1FY6A 1T0OA 1RPXA 4P7NA 4QROA 5D2VA 4N6EA 4HYRA 2OZ8A 2FGBA 4F9JA 3NDOA 1ML1A 1GHSA 3TJXA 2YCEA 1JFXA 2QVNA 1KFLA 2GUBA 1BTMA 2VGIA 4D6JA 3STFA 1Q13A 4H8HA 2Y6ZA 2Q8ZA 1BSIA 4LYKA 4RXFA 3TR2A 2NQZA 5IFTA 3S2NA 1X8FA 4BEQA 3CL7A 2HTMA 4K8HA 1EGMA 3ARPA 4E3TA 4FOJA 3VFLA 1JF6A 1KGUA 5HMDA 2G50A 2ZC1A 2FDMA 1J0YA 3N12A 3T78A 3DI1A 3CM4A 3AIBA 5T9CE 4RE4A 3SCQA 2JGQA 4FNUA 3GC4A 3QH2A 3WK3A 1JZ6A 2XFYA 3CPUA 4FXJA 3SUWA 4JD4A 4LBUA 1XSJA 1ONRA 1UKPA 4ALDA 2VC9A 2PTZA 5A1AA 1WCGA 1BG9A 4A29A 2HNHA 1GWJA 1KCXA 1L9WA 4L4MA 3KCLA 4GIAA 1RD5A 1REQB 1UWIA 1MFUA 4OGZA 4GQGA 3TTEA 1B0IA 2E6YA 2VRQA 2HJPA 3UBPC 1JGMA 4M29A 4MHBA 2X0YA 3PF3A 3G1SA 4RZBA 4XUGA 1UBSA 1PIIA 1AL7A 4XV0A 4TVCA 4JCMA 1CENA 3QOMA 4U5IA 5CZJA 1RY0A 2F2KA 3RM8A 1B54A 1WAWA 4IISA 4MJ4A 1XLGA 2WNWA 4UTJA 3WFZA 2FZNA 4UTUA 3RHGA 3B0PA 4DZIA 2D20A 2EKGA 4KW2A 1P0NA 3OA5A 1PZ3A 1U1JA 3QZ6A 1AW2A 1TELA 3VK5A 3FEQA 4XAYA 2YJQA 2Y8VA 1E0VA 3LENA 2BXYA 1C3FA 1W9BM 4V27A 1JDCA 1GJUA 5LNUA 2OSWA 2WAGA 1UR8A 3EMQA 1TMHA 1POJA 4MUPA 1TX0A 3MB9A 3B8VA 3GNOA 4OBRA 4F2UA 1W1VA 1YBQA 3C2FA 3N6QA 1AQFA 3W23A 4F2TA 2VFEA 1JQVA 3ARZA 2FFCA 4X2PA 1H11A 7REQA 3BJFA 2NW0A 3WK1A 1T8QA 1SO3A 2QPUA 1S1PA 3RMJA 5H8PA 1VCGA 1K6AA 1GQKA 4QX4A 1UD4A 3QPYA 3EWUA 1QK0A 3TCSA 5LXEA 5FJOA 5BU9A 1TIWA 4XAZA 4XZWA 4ZODA 1EP3A 1RLCL 2O56A 3CC1A 4FMVA 2XIJA 3CUZA 1TSIA 4HZ6A 5DEZA 2CLIA 4AZ6A 3QHMA 1KFBA 3S8HA 2J7BA 3DBPA 3KW3A 3TTYA 1WKEA 3C8FA 3A21A 2YXGA 2FTWA 4E2BA 4P2VA 3W7OA 2QCLA 4RV3A 1JDAA 3VIFA 5HANA 1G4PA 5HNUA 1IIGA 3BG5A 2ZVRA 1GVRA 4PCTA 1NH6A 4CQAA 3TJLA 2Q71A 4PYSA 4WDXA 4H9UA 1HUVA 4LNYA 3I65A 1Q45A 4JFWA 1VEMA 4DJDD 2V68A 3N6HA 3CB3A 4LTSA 1EEPA 1U33A 1G1YA 2IS7A 4Q4OA 4CCEA 3CWOX 2DV0A 2PDUA 3W1UA 3W3OA 5L6UA 3MMWA 3VC5A 1LDCA 1EJUC 3BLDA 6CGTA 3TYBA 3LXCA 4R7OA 3WLIA 4C1KA 1BXNA 1A5BA 3RU8X 1R6WA 4GQRA 2IXVA 1MMFA 3AMGA 2J9XA 5I3IA 4S38A 3G6MA 3SRKA 4JIHA 4Z2JA 3ABZA 4C91A 2Z25A 1OB0A 1Z89A 2ABBA 1UD5A 2DVXA 2BOFX 1FWRA 4Q4MA 1E0UA 3CUFA 3IJIA 4D71A 4Q8VA 4B4FA 5G2WA 1R8LA 3APTA 5G2HA 4L9ZA 1XIBA 4TUFA 4Q7IA 3NSXA 3EDFA 3UESA 5KMYA 4S3KA 3TW7A 1WAUA 1EFZA 1VLWA 2XG9A 1WZAA 3CS2A 5BOEA 4Z2GA 3LPPA 4XB3A 4IICA 2WW5A 1OYCA 2F6KA 1NDVA 2WC7A 5AZ1A 3GR8A 4KKXA 4RXGA 4YMZA 2V38A 4OKDA 3GTFA 4YLWA 1OK4A 4W7VA 4ACZB 1EO7A 3HPAA 1GUVA 1L8NA 2WJDA 5T91A 1W1ZA 1B4EA 3VZYA 3CV7A 1J0ZA 2BMBA 4M0XA 3VKBA 3SUVA 3NNTA 4DPQA 1OBAA 3RM9A 3TYZA 2WSYA 5GJPA 1AD4A 3GVVA 4XVDA 1KM1A 4X22A 4A8NA 1VEPA 2ANUA 1IWBA 2E5CA 3E0VA 3AZRA 3ES8A 3WQPA 2OPJA 3WX7A 2DT3A 4HK5A 1TKKA 3HJEA 5E93A 4B90A 3CHVA 3C2YA 4N9CA 3ZJ7A 3UZZA 3GXDA 1H7NA 3O3RA 4S2BA 3DG7A 4KRZA 5CSRA 2ZTJA 4GH1A 4NVTA 3EWDA 3GYEA 3SCSA 1I2NA 1XICA 3MZNA 4Q8PA 4JN6A 3WBXA 4XK2A 4NZCA 4IOTA 4QLLA 1E9ZB 3PUOA 4L6HA 4O0KA 1JZ7A 3H6OA 3NL3A 1TA3B 4E5TA 3O7UA 1O68A 3BOLA 3QLDA 1VPXA 4YWSA 4AC7C 3W7MA 3MKVA 4GWEA 1BWLA 3DKLA 3U5UA 5LIWX 2CZVA 3QN3A 4F9DA 1X6NA 3L7RA 3MUXA 1AODA 4AF0B 4UTMA 1XDMA 3TC3A 2JBMA 4DNMA 1ZLPA 2JALA 4HSHA 5CBBA 4YCOA 3DN5A 3W1NA 2VWTA 2R82A 3CZJA 5KETA 3HURA 3BLOA 1V02A 2ZUMA 1O6IA 1V3KA 2R1NA 4IG2B 4K8GA 4TVDA 3S9IA 2NVDA 1ZRQA 4QS6A 1PHWA 1CTNA 4PTDA 2OYLA 1LQ0A 2FH8A 3HZ3A 3EXSA 3ITXA 3M0IA 1VS1A 3VNYA 5CQ1A 4UMAA 1Q6EA 1XPYA 3O15A 1XIEA 3S1VA 2R9RA 4L6OA 4ZENA 3M0ZA 5A6SA 2NXHA 3PUDA 2WWDA 3ARQA 4AIUA 3NSNA 3NZGA 2PU1A 2IQTA 4K68A 3AJ7A 4TMCA 3K13A 1UQZA 1W8GA 3S6DA 3BGJA 3QPZA 4F3HA 3NVTA 3HQPA 4GYPA 3UJFA 3GU9A 2WZEA 4C6EA 4GXWA 3HFTA 3AIUA 2J77A 1QNVA 5FL1A 2GDVA 1TV8A 4KFPA 1DIKA 1Q7QA 1LP6A 3LRMA 2RUSA 1HG3A 2HEJA 2R91A 1QPNA 3BARA 4ADSA 2J88A 4YCPA 4WRHA 1G4TA 2Y85A 1EF3A 4D8LA 2Y62A 3IVSA 3BJTA 1F9CA 1FXPA 5AVNA 2VM8A 1OEPA 2WZMA 3WKZA 5IM51 5CPLA 3A24A 3SQLA 3CV2A 5FSEC 4R3UA 3WD2A 3RF9A 4Z1YA 3UYIA 1XBYA 5B7ZA 1BGAA 3R12A 4QTGA 4ERAA 1V6TA 3VIHA 5EKYA 2CERA 1TTIA 1MWOA 2XU2A 1E6PA 4EE9A 1FP9A 1KFKA 2GVEA 3WLLA 4MJ2A 3BMXA 1HJVA 4A05A 1DJHA 3I7RA 2BVTA 4KBXA 2PCQA 4AFYA 2WHJA 4M56A 4QDPA 1TJPA 4FLSA 3NYDA 1QXLA 2E9LA 1FBAA 4A3YA 2DZTA 3CZ8A 4DO6A 3PC0A 3CHDA 1EHAA 2GUYA 3V5CA 4EWND 4L6DA 1BEUA 2RDWA 1QOXA 4UTFA 1NFPA 3QHOA 1TV5A 4O1EA 1A50A 2ACQA 1IWAA 1E4LA 3LD5A 2BV9A 1QFEA 1YMYA 5XINA 1XH2A 2XPKA 1RD6A 1JYXA 3BURA 1JPHA 3T4WA 1OHLA 1R7AA 1L6WA 4B92A 3UZJA 2PC4A 4HNLA 2YL5A 2WHMA 2V3FA 3OHIA 1XYLA 3P0WA 3V1HA 3H2AA 1DXEA 4PUWA 4Q8UA 1F05A 3EWYA 4IQEA 2YXOA 1JPMA 1WPCA 4I6VA 4MWAD 4PMRA 4E8CA 1E0WA 1PX4A 2DZWA 1FWBC 2XM1A 3G8RA 3FYYA 3COTA 1P1MA 5C0QA 1J79A 4MDPA 4TU1A 2ZXBA 3S2CA 5LHFA 5FF2A 4L80A 3VCRA 4ASTA 1SZFA 2XWDA 4GABA 4YVVA 5E09A 2J8GA 3AHXA 1TVNA 5AC7A 3MQTA 1SW7A 4PODA 4S3FA 3UY7A 3DX5A 4LGXA 3UERA 5EU9A 3UD6A 1RCXB 3BPWA 3GX9A 3WBAA 4D2JA 4GUJA 1EEXA 2NV9A 3SN0A 3GKFA 1NAL1 1A5KC 3F4CA 5C70A 1JGIA 3RR4A 1V6UA 2QVHA 1T8XA 1RSCA 1GOOA 4RK8A 1V0NA 3GG0A 1UH3A 4A3UA 5A8OA 3WJYA 3PJUA 1C8QA 3PBVA 3B8DA 1C29A 3W02A 4JTIA 4D6EA 4Q4RA 1HT6A 3MMDA 3WNNA 1R3TA 1OFBA 1WZLA 1HKJA 3GY1A 4GC3A 4MNMA 5C55A 3VNDA 4H8VA 1BVWA 4INFA 4ATDA 2OJPA 4X3ZA 3MUIA 2BY3A 4PMQA 1GGOA 4NILA 1JAEA 2B7PA 2VELA 3M0VA 5BNKA 3UPMA 3VTRA 3IPWA 2HZGA 4O13A 4CQ9A 2OLHA 1W3JA 1A5MC 3A23A 5IHSA 3DFTA 4W89A 2F84A 1B4KA 3LZ5A 4CD5A 2A3EA 3UT0A 3AYSA 5G1TA 3A9BA 1A3HA 3W25A 3GNXA 4QJ1A 3RIKA 4GYFA 4C7DA 3C0JA 2GGGA 5FL0A 2RGMA 4P8WA 1PIFA 1YXYA 3H12A 2QLYA 1LWIA 1WZKA 1SR0A 1ZAJA 3QRHA 2DU2A 1V3IA 2FMOA 5FI8A 1AW5A 1GYLA 1ZAHA 5IXEA 1F6PA 3NOEA 3WF3A 2QNEA 3GVRA 4P8XA 2E8ZA 3UWVA 3RX2A 1SZEA 4AD4A 1QRQA 2ZZ1A 1H3GA 1EYEA 3GIPA 3CPRA 5HJYA 1DXFA 2D2JA 1XIJA 3VD4A 1VHNA 4JX6A 3GNNA 3ZJKA 1BVZA 3AXHA 4XKYA 3OU8A 7ENLA 4MNLA 4HNNA 5GJMA 1MNZA 3U6WA 4N2YA 3W27A 2ABAA 4YHEA 2NX9A 1E0TA 1V93A 4LT9A 3PG9A 3GZ3A 4HCHA 1HVXA 4XZLX 2YCKX 3L2IA 3LXBA 5I02A 4GQQA 4MWAE 4R27A 3VMOA 4MFEA 2DQWA 4DQWA 1D7KA 1M03A 2ASHA 2OZTA 4H9ZA 2RH9A 4REQB 3APGA 3ZSTA 1XYZA 1XC6A 1XR2A 3G0XA 4H04A 1UMYA 1JYNA 1RK5A 1P7TA 4J35A 4CEUC 5CLWA 1U5VA 1WOBA 3QJAA 4H8NA 4S3EA 1VFLA 3DFNA 2ZICA 2DFAA 2ZOXA 4IMGA 3EBVA 3KTSA 5FACA 3G1HA 4YN5A 3DEQA 2W3ZA 3NTYA 1RVGA 4AWSA 3NQBA 4CD7A 2PDQA 3QW4B 1V08A 3LPGA 1C92A 4Q8MA 2A79A 5M2FX 2CLFA 3STCA 3ARRA 1UZ4A 3SCPA 3VKCA 4JGDA 2X2YA 2A1YA 5ABTA 3LB0A 3F4WA 4MIMA 2F8QA 4W5UA 2CLEA 1EP1A 3VFCA 3QKZA 3B0XA 3IIZA 1QDSA 4XZ9A 2PGFA 3E49A 2R1MA 3GW0A 1RQBA 4X2RA 3WL1A 3C61A 3VM5A 3FY1A 4NI3A 3IIVA 3H4GA 1RP9A 3W38A 1TTPA 3TW6A 3I6EA 4N02A 5TBOA 3T08A 3G1FA 3TWAA 1QJWA 1XBVA 2Z2UA 2BBFA 1PZ1A 4HU4A 4NJJA 1VJIA 4W7UA 3QC0A 1QW7A 1OG6A 1X96A 4IGMA 4NJGA 3CLMA 1HKMA 1S5WA 1JXJA 2Z2AA 3A3HA 4IFRA 4WX2A 2ISVA 4IMEA 4OUEA 3TN6A 2NV1A 4RNHA 1WKFA 4IQLA 4ZTYA 4QNWA 4KRTA 3E96A 5CGTA 3WZ0E 1QCWA 4BQ2A 1KRAC 2UZ9A 2ZKMX 3LZ3A 4JQAA 3R8GA 2XDFA 3W7KA 2QMJA 3W24A 3TROA 1VP5A 1NWRA 5E0CA 4J9JA 3CU2A 4V33A 4KWSA 2WCAA 4DO7A 1L6SA 1T40A 2HROA 4LBSA 3QQ1A 1EA9C 4KCVA 4AZIA 4ZEPA 1OINA 4G6CA 3U2CA 4X61A 4BWLC 3LHZA 2X09A 3BANA 3EAUA 3THAA 3EOUA 2Y8UA 2ZYFA 2DZXA 4B5TA 3CAKA 2FPYA 1H62A 2XN1A 1L6GA 1EJ7L 1R38A 4DZAA 1W9XA 4Z1AA 4PB3A 4FOUA 5EPDA 2IXUA 1GYMA 4DZ5A 1I60A 3RX4A 1RQEA 4W87A 3GS6A 2I7GA 2ZE3A 1XI3A 3M43A 1LYXA 3MI3A 4XKMA 1O1ZA 2WXDM 4EXBA 4JTQA 4LAZA 4UMBA 3FDGA 4GNKB 4GZ7A 1A0CA 1OYBA 3R10A 4QE4A 3N19B 2MNRA 3VNZA 1OFDA 2DSUA 1A5CA 1Z8AA 2VXNA 3HF3A 1DE6A 3CQIA 4CQDA 3CAQA 4BR1A 2FHFA 1W1YA 1QOPA 4RPQA 3II1A 2NQ9A 1KXVA 2TSYA 2VEPA 4KCWA 4YXGA 2V6AA 3VA8A 1GJWA 4O12A 4GIRA 4FF5A 4CNTA 1W8SA 1JD7A 2INEA 1IEXA 1OFQA 1RH9A 3Q94A 4Q8QA 3PSVA 4XAGA 1ELSA 1W3HA 2Z6JA 3V0TA 1FUYA 1RBAA 6XIAA 3W82A 5I3DA 1KB3A 1JDDA 4LH8A 1V7YA 4NHVA 3L4XA 1PJ9A 3SAZA 1U83A 3VNIA 3UETA 4OOZA 4Y96A 4GA8A 4JHOA 2DW6A 3AXKA 2A4AA 1KBBA 4RR4A 3GIYA 4RDYA 1W32A 3OB8A 2FVLA 4B5NA 1WKYA 2D3LA 3ZXWA 1TPEA 4V1XA 4PCSA 1R85A 3QSTA 1BQGA 4G56A 4ZE4A 4Q4KA 1VFTA 2UY4A 3BOXA 2VEKA 1VQTA 2J8FA 4FS9A 5E70A 1AJZA 1KBIA 3P74A 5D05A 2KX9A 4RCXA 1ADSA 4WDTA 4WY0B 1C8VA 2OOGA 4IWWA 4LFYA 4U3CA 2X1RA 3NAVA 1FWEC 1AMKA 1B31A 4GCAA 4YPJA 1Q7ZA 2V69A 1MFVA 4S23A 3LCHA 4YTSA 4PCNA 4I3GA 2FHCA 3FX4A 3ARSA 2OX4A 5A2BA 1LQ2A 1E56A 3DHDA 1I1XA 3BC9A 3B8UA 1KFEA 2NVCA 3RJXA 4PSPA 1V8EA 3CYJA 3RPTA 1W17A 4IMDA 3N25A 1WDWA 4WF7A 4RKAA 1DV7A 1EBGA 1XCWA 2B7NA 2GDUA 2JF7A 2Y70A 4U33A 2PURA 1VEOA 3T0CA 2TYSA 3GD6A 3NPXA 4QJ5B 3SRDA 4EXQA 4RZ5A 5I3FA 1EYWA 2PUZA 8XIAA 5CBIA 1TQJA 5GNXA 2OXNA 5AZ0A 2CBIA 3AHVA 1HJQA 3F4DA 1PUDA 1A5UA 1E51A 4M7TA 4NAEB 3HN3A 4HB7A 3PZIA 4JL2A 1TQXA 5I6SA 4I9TA 1YXCA 1F5ZA 4L64A 1GG0A 3S3GA 4Y9OA 5DCDA 3PM6A 1WDQA 2FZMA 4HN4A 2G95A 5CAHA 4L4LA 1JG9A 1FHLA 5G4HC 1U30A 4D8AA 3LV5A 7ODCA 3TE9A 1JDEA 4XD6A 3LCWA 3MSDA 4P8UA 1CGYA 1XH1A 1UWSA 4BI5A 1W2PA 5DBUA 1E55A 1TR1A 4JQ1A 4GYPC 1E9YB 2AAAA 4IM4A 2GWGA 3LCIA 3LY0A 4LUTA 1XIMA 2ZWYA 4JTCA 4EF8A 1H49A 1DJQA 1VRXA 2CHRA 1S5MA 2F6UA 4HVXA 3IRSA 5HNTA 4UQAA 5AHNA 1C8XA 3TJ4A 1LOSA 1W54A 3WMLA 3N2CA 1P4CA 6REQB 3W7HA 1O1HA 3R4IA 1JDFA 1IT7A 4TOQA 5FF3A 4DYEA 1W9VA 4AG0A 3N11A 2VI0A 1OJXA 3ID7A 4H01A 3SCRA 3GG8A 4A8LA 1OABA 3PZVA 1ALDA 3SI9A 3R94A 2EGZA 4HBKA 4M6QA 3QGVA 3WQCA 2YOCA 3NQMA 5C8BB 4WCJA 4H41A 4M7SA 5AYYA 5A8GA 1SSGA 2E40A 4UNIA 3TAOA 3AFBA 4N42A 2P50A 1V79A 1DJIA 5A5WA 2I56A 1CGXA 1RV8A 4IZGA 4NSBA 4FNPA 3TWBA 1ONXA 4JY9A 1OCBA 1XCFA 1ZFJA 2EEXA 3TH6A 4ZQPA 3HGOA 3LCXA 3LTYA 3BG9A 3H7UA 2F9RA 2YB4A 1B3OA 4AD3A 1VFMA 1S2UA 5CC3A 3W9ZA 3PJWA 2E1DA 3PZOA 4HA4A 1TVLA 2R6OA 1R9XA 1OZMA 4HNVA 1H2JA 1YNQA 4H1ZA 3A4JA 2HVNA 4PGLA 3TNOA 5A2CA 1C7SA 4GI8A 1G67A 3L4VA 3N4EA 1VFHA 1W3NA 2KAUC 3FK4A 2DIJA 3QY7A 4NZ3A 3VGHA 1E4NA 1H61A 3H2NA 3W85A 3VNMA 3QBUA 4B16A 1MDLA 2CBJA 3RR1A 3CBWA 4H7ZA 3XISA 3TV8A 1H51A 3IIOA 4UOQA 2VYOA 3EPNA 4LEQA 2VX4A 3THQA 3KWSA 1BRLA 1YX1A 1YTDA 3PZUA 1FDYA 1IZKA 3H24A 2OR2A 2YFOA 3R5EA 2A6NA 4MSSA 5DXYA 1KBKA 2WNZA 2YPIA 1NP2A 3B40A 5BCAA 2UV8G 4PB5A 3VOHA 4JFTA 4GUIA 1CXHA 1GEHA 4A3QA 2R1KA 1LTDA 3PWIA 4IJBA 3SURA 2H6RA 5I0DA 1VBGA 2JGYA 1XSKA 1P0KA 4C1LA 2NLYA 1PCKA 5EY5A 3W1MA 2NV2A 1DJYA 1DP0A 1EO5A 2I5QA 1ZSXA 4XAFA 3BVJA 4ZFMA 2E6DA 2EHHA 2ZZ2A 3P84A 4PTXA 1NF7A 3LPOA 1PVNA 4C90A 2GZXA 3R1ZA 3RDKA 2EO7A 3WLMA 4IG2A 3EPOA 4EVZA 2XFFA 2HK0A 3TOPA 3UNDA 3W6YA 5G1YA 3HV9A 1YTEA 3PY2A 2BP1A 1XWYA 4PN2A 4QAWA 1XISA 1D2KA 2BY0A 3P82A 3O6CA 3BQ5A 2Y4SA 3ZLGA 2KZHA 3NZQA 2HSAA 1OCQA 1ONWA 1US2A 3EB3A 1Y5WA 1EOKA 4DM2A 5A6AA 1TJ1A 1GT8A 1X1ZA 4KCTA 4MPQA 1NVMA 1QWGA 1NEYA 2CLHA 4NRSA 2C13A 2WHLA 1GKRA 3AI0A 3BO9A 4Q8TA 3TIMA 3NO5A 2GLKA 1EIXA 3CLWA 3OLGA 4AZGA 4W4QA 1NY1A 4H2CA 2ODOA 2XH7A 1Q4NX 3PZTA 3FKRA 5REQB 1M9HA 3THUA 1SGJA 1PKNA 1KBJA 1B3XA 3LTPA 2NUXA 2GJLA 2DH2A 3L65A 1GZ1A 1KXQA 3MY9A 2EG7A 3ZR4A 4AZCB 3QR1A 4JTDA 1XYBA 4UFKA 2OGJA 1MW1A 1X1OA 3BXWA 2BFGA 1Q6LA 4LANA 3NVDA 2B31A 3OEXA 1HIZA 2XVPA 3OVQA 1XFCA 4W86A 1JRCA 3NL2A 3U2EA 3LI0A 4B3ZA 4W5ZA 4DWSC 4DF1A 5T9BG 3PBUA 3GR7A 1P48A 3W1PA 3CT2A 1PHQA 5DMMA 3RYSA 2OG9A 2QGYA 3WD3A 3EDEA 2CLKA 2QDGA 3M1ZA 1O95A 3PTKA 2FHBA 1EJTC 1KCLA 1NDWA 3AXMA 3PTQA 4JFVA 2CLMA 1IXNA 2GJNA 1E6RA 1GOQA 1XLBA 3UVIA 4QJ4B 2J66A 2Q02A 1CYGA 4ZE5A 2XSAA 2DEPA 1FHUA 1V02E 2R24A 1EPXA 2ZUWA 1EXBA 3TZFA 5JBEA 1MXDA 1XLLA 3PBWA 1NDYA 1WZMA 4ATLA 4GVIA 3MCMA 2Y24A 5MHBA 5KINA 4KIRA 3CWNA 4HTBA 1TX2A 4LF2A 4K8EA 3B0UX 4XQ6A 4JX5A 1EDTA 2PDBA 1U2YA 1I45A 3WNKA 3SN4A 3GU1A 2Z26A 1PZ2A 3V36A 4AB4A 3UU0A 4GGHA 3SGUA 4DJFA 2HPMA 4I9JA 4O1CA 3HMJG 4NAFB 5DN1A 4OBSA 1UZHA 1DHKA 1UC4A 3IGSA 4PUJA 3QPEA 3CWHA 1U1UA 2Q8LA 2RKXA 4Z17A 3WLKX 4PL1A 4R85A 3VVGA 4Y90A 2EF9A 2YDRA 4PUDA 3NO3A 4OIFA 2Z1BA 3WQFA 4KGLA 3AICA 4Z2KA 2WPBA 3SCWA 2OELA 2POTA 5CC5A 2V2DA 1J5TA 1DIOA 2HBVA 1AH3A 4XO6A 5DXXA 3G24A 1VAHA 1TMQA 2PWDA 4GJIA 4NUWA 3KRZA 3A3XA 1OX4A 2BS9A 2QCGA 4LBRA 3C0SA 1ISXA 1ODUA 3A5FA 3LQGA 3MDWA 4Q33A 4A2RA 4WXZA 3OODA 1IT0A 1QAPA 4EPDC 4W8AA 3S9ZA 1Z48A 1EXPA 1KR0A 1TRIA 2JKEA 3ZVHB 4J40A 4QG6A 3U0HA 3KRUA 2AQVA 3S5ZA 2YLLA 1M7XA 2WCSA 2WQPA 2XVKA 3M7SA 4AVOA 3QGKC 5C9RA 1XGZA 1G01A 2D22A 3VIJA 1UMLA 2OQLA 1F76A 3VE7A 1F3WA 1GG1A 4I5RA 4PCFA 2WMJA 2DIKA 1F74A 1QW8A 3O6DA 1R3VA 4H6RA 3W87A 1DQXA 4LAMA 1LF1A 1CWYA 5K9DA 1VKFA 1KM4A 3OJGA 1TREA 4JHMA 4U10A 1E3ZA 1CBGA 2PP3A 4XAPA 2QIWA 4NJKA 3HG3A 4UB9A 1GW9A 3I6TA 4W85A 2X42A 2CWNA 3GSMA 5EB8A 4H9YA 1QNRA 1DOSA 3UQNA 1IEIA 3NDYA 1VBRA 4W8LA 3QMTA 3W7JA 3FS2A 4JTJA 3RU6A 4CN1A 4GCXA 1K4GA 4GYJA 1Y0EA 2GVLA 3WQDA 5CC7A 2GQ3A 3AC0A 1MW3A 1TR9A 1XD0A 4TQTA 4NU7A 5LNRA 4PZVA 1G94A 1NOFA 4EACA 4DJEC 2BTMA 2ACUA 4QDWA 2GJXB 4LYQA 4AU0A 1XGDA 4PRRA 2IPJA 4F0HA 1QPKA 1BAGA 1QI4A 2YCIX 2XFWA 3VGEA 4RL3A 1XLFA 3S9YA 4AD0A 1KCKA 4D72A 1EC8A 2UY5A 3M47A 3KL0A 3UG3A 2PLCA 4MVAA 1LBFA 4HNUA 1XINA 4XTDA 3KRBA 2IKJA 2YA2A 4LS1A 2B7OA 3R8RA 1V3LA 4A3HA 5BYWA 4C6FA 3AS3A 2ZRUA 1EUNA 2Y7DA 5AN7A 1Q66A 4GI4A 1KQYA 1BD0A 2G37A 3CMFA 5AKQA 4Z08A 2GGEA 1SO5A 2QDDA 1VENA 1XW8A 4MYAA 3W53A 1O94A 4Y8EA 4JTSA 2X05A 3LV6A 1J01A 2V82A 2WSPA 1RLDA 4IT1A 3WJWA 3TKFA 4XZHA 1I2OA 3DBNA 3MHFA 1LG2A 3OGSA 4M51A 2X1SA 1IXOA 5D30A 1X98A 1ADOA 3SFWA 1IGWA 1XLIA 3QY8A 3G22A 2QZRA 2G8ZA 5FCZA 3K2GA 3WY1A 5EMMA 3ZSSA 4AZ7A 2D2GA 3LDVA 5BRPA 1V0MA 1BTCA 4PTMA 4M3PA 1R46A 1V77A 1BKSA 2J8TA 3M0YA 4B91A 2X41A 1ITQA 4JTGA 2J27A 4FP1A 3DESA 3EDDA 3CTTA 5E1QA 3TYUA 1E40A 3DYOA 1JJKA 5H6HA 4I9MA 4FEZA 1TE6A 4QRNA 3VIKA 1Z41A 3CXOA 2NVAA 4RNJA 5C7HA 3W76A 5A2AA 3M44A 3OQEA 1TCDA 1A0DA 3UFYA 3UR7A 4E8GA 3P0XA 3LUTA 4LVGA 2V5BA 3LERA 2Y2WA 2VJXA 4GUHA 3TSDA 5JVLA 1UJQA 2UWFA 2VWSA 3SO7A 5I3GA 1B9ZA 1QI5A 5IRPA 3B8IA 2DJXA 3N3MA 4M6PA 1R87A 1SO4A 1FDJA 1JNDA 3ITLA 2E3ZA 3UXAA 4KWWA 1JPIA 3ZZ1A 1KXTA 1IZJA 4DXVA 2NQHA 4AZHA 1EA0A 2CHOA 4IPNB 2J79A 1IEWA 4O11A 4N7QA 5EMKA 2GQAA 4JTHA 2ZRZA 1JUBA 3DFHA 3KOFA 4GKTA 4OHQA 5DY2A 3GVQA 4BK9A 3CMGA 1EJVC 4WGHA 1TV3A 4UFLA 3P62A 1SZRA 4PCPA 1WBJA 4CNUA 1JXKA 2HVOA 4X0NA 3NQEA 1K9FA 2HBXA 4GQBA 3I6RA 2PWHA 3KDOA 3LNMA 4RE3A 1CXEA 3GWQA 2FVMA 5LZLA 4AIOA 3PZQA 5MF5A 2O0TA 1OX6A 2J78A 3MP5A 3UNTA 1KA9F 2HVMA 3VGDA 4E2DA 2ZFAA 4IHCA 3S6TA 1E6XM 1PWLA 4EKJA 2QCFA 2BASA 1JQXA 3T9PA 2V5JA 4I5UA 5DELA 2CESA 3O2LA 2C18A 5CJMA 3W84A 1A5SA 1MNSA 4RPPA 5FJUA 1BYBA 3RAOA 3WQVA 4DUVA 4C6PA 5D32A 3AIVA 1GYNA 3AXXA 5HMFA 4UZUA 1UR1A 3QR3A 3S0CA 1UR9A 1UA7A 3FJNA 1TPB1 1TPVA 1PSCA 3NQVA 6PTDA 3WL0A 2FZ8A 3LYEA 3ZVIA 4GQ0A 3S5SA 3UPWA 3W2MA 3EB4A 2PLKA 1VHCA 2WSRA 4Q3MA 1JCNA 4G2DA 3MU7A 4HPXA 2J7DA 5HQLA 4AHOA 2QEZA 4AZ5A 1MZRA 3H2OA 3K30A 4HZ8A 1ZHAA 1M41A 2ZVIA 3AS1A 3I7QA 2NUWA 5FEXA 4NF7A 1HZYA 3IV3A 2VFIA 3BK0A 5LGZA 1V51A 1XLJA 3LHVA 2GOUA 1FCUA 2FGZA 4LC8A 1ZCCA 4AVNA 1H41A 1RA5A 1IQ8A 4DHGA 1M6JA 3L4TA 1CPUA 4ZO7A 2FPTA 4OOUA 3NZRA 2NQJA 4LVFA 1H5YA 2P1FA 3EMCA 1KCZA 3OBKA 4J3SA 1WBHA 2EG8A 4HA1A 3E3HA 1DJNA 3UWWA 5I5RA 4A6GA 2XH4A 1S2CA 1NFGA 2W9MA 3H7VA 5DF0A 1QT1A 3EGJA 4QIUA 3P61A 1J18A 2QHAA 3T2PA 2PDLA 3O0KA 2CITA 3HV8A 2CLPA 2PDJA 4PUNA 3W7CA 3NCOA 3M64A 1X7IA 2PTWA 4JFSA 4JPGA 2BVYA 3B97A 4HGXA 1PX8A 2WKLA 3BV4A 2XVGA 1UKQA 3IJ7A 3SFKA 5LNWA 1IEVA 4NYYA 2VZVA 2C79A 3LSBA 3RILA 2PTYA 4JN7A 2Z7GA 2VFGA 1ODZA 3AHZA 2XIOA 3SUTA 4CEXC 1AZ1A 1PS9A 4F48A 1BQCA 4S3CA 4NZ5A 2YFNA 1C8YA 1EIBA 3C0LA 2I1OA 4GK8A 2ZA3A 4NIRA 4HJWA 3QV6A 4HCDA 5HBFA 2JF6A 3PVFA 3WD4A 5HATA 2CXEA 4FOKA 3FGCA 4ZXLA 3TC7A 3BJSA 1SZNA 1VFUA 3W72A 3LCGA 3DC0A 4PFMA 1NIUA 1ZP4A 1TWSA 3E2QA 4FXFA 3VNLA 3K1DA 2C0HA 3FOKA 3MYPA 4EOUA 4BS0A 1YDOA 1PYFA 2QW5A 3CH0A 3N9SA 2R1PA 1IGSA 4OWGA 4WY0A 1HQTA 1Q8AA 2BOGX 2Z1XA 4GJJA 3GR4A 3ZJ8A 3QQWA 3NQ8A 1MQQA 4IIFA 2PI6A 1XPGA 2VEIA 2X8RA 1EWEA 2CETA 5B80A 4MPKA 3WDHA 4YU1A 3PAJA 5CPTA 1H0IA 3ZT5A 1SFSA 4KPLA 3KOYA 4WOZA 1LROA 3CHEA 1K77A 2C16A 3B04A 1BSLA 1CECA 3HPXA 2J47A 5IBXC 2ZADA 4LVDA 1XDJA 3MMUA 5EYWA 3GRIA 3ARXA 5A6BA 2EG6A 3CIXA 1BLIA 2RDUA 2TRSA 1T96A 2C15A 1EGVA 5CZTA 2RDXA 3VE9A 4B2DA 1R30A 5HJXA 2PDXA 3F5KA 2VFFA 1PB0A 5LIKX 2QV4A 5CXPA 2DORA 1H7XA 4UTTC 1LBMA 2X40A 3QFWA 4FNRA 5D9NA 3CUIA 1W5NA 3E2VA 4NAEA 3RRAA 5F4XA 1KO0A 4LUJA 1CW2A 3RPMA 1ONEA 3QR0A 3AXIA 4D6FA 1H63A 1NWUA 3K8MA 1GK8A 5I79A 4Q4SA 2PDYA 3ZQ9A 4GVGA 1E6SM 1QMLA 4PMDA 4F0LA 2UY3A 4UFHA 3R89A 3KBMA 3VX1A 1WB0A 3MUZ1 4J3ZA 3SCOA 4BF7A 4QISA 2VR2A 3NEHA 2E67A 1OCNA 3UZ5A 4I9AA 5D09A 4Y9AA 2PGEA 2DH3A 3W2NA 3BZGA 3HG5A 4GC4A 1H4PA 4OT7A 3VGGA 4GZJA 4LXFA 2XTKA 3WNMA 1OX5A 4PMOA 1CGVA 4GZEA 5XIMA 3KBVA 2Q3OA 1XGEA 1KRCC 5D03A 2NSXA 1BG4A 1UP0A 1GZGA 1OF6A 4M8UA 2ZX6A 2ZRYA 6REQA 3K8LA 5A3HA 4NASA 3BAKA 3POCA 5TAOA 1YNYA 4KQNA 4QCFA 5C71A 3MDUA 3GKAA 4ICCX 1XV8A 2Z1KA 3TQKA 1KFCA 4N4PA 1SYTA 1SFLA 4XD5A 2FGLA 3IIXA 2DUXA 1GVQA 1G69A 1SJDA 4D6GA 2DT1A 1FHDA 1VGAA 4MAVA 5A8QA 1F07A 4TXEA 4GUFA 1FP8A 3ICJA 3P8IA 4C7GA 1VCVA 4DBWA 4IIHA 3KOZA 4M6VA 3EWXA 3AAMA 2YDAA 3EX4A 2XH0A 5CSYA 1EHNA 2QCMA 5BMXA 3CAVA 4WSHA 4FLOA 3PZNA 2NXGA 2H3DA 4DX3A 4H2HA 3I4KA 1WKDA 3MS8A 1YNPA 2Y7EA 4LY8A 4GUGA 3A22A 3QV8A 2PBGA 2E5DA 4J28A 1FCQA 2AKMA 5DMNA 4MGGA 4I8DA 2OX1A 3MP3A 1A80A 5DMLA 4FX8A 3V4BA 3E2RA 2VD9A 2B7QA 2J74A 1MRQA 4G7FA 4NNCA 1HL9A 2VCAA 3GDMA 3TLLA 3GLCA 4LOCA 4IUOA 1J0IA 4MZYA 1TZ7A 2NLIA 1CXFA 1YPXA 3VNKA 4UQBA 3PR2A 4GY7A 5FF0A 2PCEA 3EKLA 3RX3A 1AZ2A 3AS0A 4MNKA 1HX0A 5G4WA 3LBCA 3CHCA 3W1XA 3GC2A 1U22A 2ALDA 3LMYA 4TTGA 3R13A 3STEA 1B2YA 3CQKA 2EAWA 2P3ZA 2R8WA 2CPUA 4RDWA 1TPWA 8A3HA 5IHRA 4B5SA 2XIQA 3CEUA 3K4DA 4KH2A 1PXGA 2OT1A 3ELFA 4MJMA 1ZJHA 5TD4A 2PSNA 5JBDA 5K4XA 3EYPA 3L5MA 2F2HA 1CGWA 4GMEA 2VZOA 2OEJA 3JZUA 4EF9A 4O1DA 1KGWA 4C6KA 4B15A 4JAWA 3CQHA 3UEQA 5HNRA 3TU9A 5CH9A 2C7FA 1S5NA 5JQ9A 1SM9A 1FXQA 3VKJA 1QNQA 3R8HA 2FTYA 1K8YA 1CB2A 1NM9A 4US5D 4L65A 1UYQA 2W5FA 3NO1A 4IPLA 1EWDA 4E3VA 2E68A 2VC5A 3ANYA 4XD3A 1R2RA 1P1XA 1HJWA 3H4WA 4WDWA 1LZOA 4FR1A 3E0FA 5JIWA 4GIYA 5EBUA 2HISA 1UPMB 3MTWA 4PMJA 1AFSA 2YSWA 4UFMA 1QI3A 5J04A 1RPKA 2G5WA 1QO5A 1LOLA 4PEEA 4W84A 1MSSA 2ONEA 4XIAA 3VGBA 2D73A 3EOEA 3PZMA 1VRDA 2PE4A 4DEFA 1OFAA 3YPIA 1TRDA 3M0JA 2Z6IA 4G9PA 3ZIZA 4CKQA 4AYSA 1HJXA 3WK0A 1MEHA 4QS5A 3IK2A 3NGFA 3KLKA 1HGYA 2XINA 2QV5A 2WLZA 3A9IA 1A4LA 2QCEA 3IUHA 1KRMA 1VLIA 3T1GA 3B0YA 4O14A 3L67A 4MOZA 3PP7A 3G3MA 1ZB5A 2DT2A 4DXXA 1AQHA 1WX0A 4AY7A 4NRRA 3BLEA 5REQA 2XIIA 1Q6FA 2ZUVA 4CCDA 4AISA 3H55A 3UXIA 4FF7A 3NYZA 2WM0A 1WXJA 4UXDA 2BNJA 1DIDA 1PV8A 3LN3A 2IQDA 5EFDA 4S3BA 3U8GA 3TA6A 2ZE0A 3S2JA 4WVXA 4AZCA 5AHMA 3FAXA 2PLMA 4UTLA 1CEOA 4BEUA 3NIYA 3KBWA 4WOQA 3CT7A 1ISWA 1Q5MA 1KM6A 2A7RA 1JULA 4O1FA 3N17A 4G1NA 3SJNA 1MEWA 4H7VA 1PDZA 1KV5A 3W1TA 1GPWA 3OIHA 4O54A 3U9IA 4U2ZA 4ZQMA 2CFFA 3CPGA 1HXJA 4MZ1A 4QG8A 1UP3A 3GDRA 4B9ZA 1I1WA 3GHTA 1A3XA 3WF2A 4DYJA 1ECEA 4TMBA 3KEHA 2Y5SA 1XRVA 3VIMA 3PZGA 3ZLHA 5HR7A 4KWUA 3BCDA 3MVIA 4WJXA 3KRSA 1Q8JA 3UGRA 2CZDA 3URNA 1ISZA 1VBUA 2WZHA 4E2OA 1GQLA 4KRUA 4IP5A 5G1MA 3FV9A 4DJFD 1IYXA 4MY8A 4K39A 3K8KA 3HJZA 4WJ8A 1RJQA 3DU0A 3OZYA 3RK8A 3LS9A 4ZMGA 3NA8A 2ALRA 2GK1B 1JF5A 5I3KA 3L0KA 1Z44A 4N6FA 5JU6A 5AYBA 1R9ZA 1OFOA 2QF7A 7REQB 1HW6A 3IUIA 2W4XA 2FZBA 1BXCA 2G41A 2WNQA 3RXZA 1UQYA 3A47A 2FB3A 3FKKA 1M53A 2Q01A 4U28A 3S4TA 4NP7A 2HWGA 2P8BA 4V2XA 4NAFA 2QJIA 3WFLA 3LQLA 2J75A 3E5PA 1KD0A 4FPSA 4ZSUA 3N14A 2GGJA 4TX6A 3DKJA 4HA0A 1Y8BA 2O9TA 1ZP3A 3MANA 3KCOA 1KLZA 2VGGA 3Q2DA 1TWZA 4DPPA 3O8AA 3S1GA 4MY9A 1DWFM 3H2EA 1H09A 1S2WA 3WNOA 3W22A 5AOUA 5AC5A 4W8BA 4ZA0A 3W71A 2TODA 1CDGA 1M65A 1SQ7A 3D3FA 3DENA 4OV9A 1OFEA 1DBTA 2ZWZA 2V3GA 1IV8A 2OGYA 3N2TA 1E5JA 3WN6A 1V4YA 1DIEA 4G7EA 5BWFA 3H53A 3U48A 3BLFA 3ZVHA 3RJYA 3C56A 2Y8KA 1KM0A 1FWWA 4HMDA 3PBMA 4C6NA 2DVTA 2SFPA 4GI6A 3ZR6A 1MW2A 3V18A 1KBLA 3CV6A 3EOLA 4CNPA 1JRBA 1E9IA 3BV7A 5FF4A 3AHTA 4BWLA 1FWCC 3W81A 4W93A 4LYPA 4MB4A 2E77A 3UXDA 1A4MA 4UOJA 3HG4A 1PWMA 2OWCA 1UD6A 1UHVA 3ANUA 3PJXA 1A5AA 3GQYA 3W2LA 1NELA 3DYPA 1UKTA 2RHGA 1DEDA 1R0MA 2VX7A 1EZ2A 1SPQA 1EOMA 3FVMA 4WJEA 3WF0A 3SCTA 1F61A 1KNWA 2XZ7A 4DB7A 3SQSA 3UYCA 1OD8A 3QXBA 3D46A 1MQPA 3W7LA 4LAUA 3T55A 4JTAA 1MXSA 5J8LA 5A6KA 4A21A 4Y9PA 1E3XA 3QTGA 3T0TA 1N82A 1XIFA 3D5HA 3GK0A 4I7UA 2QDEA 2QJJA 3S5YA 3IAQA 4R33A 1LJYA 2PODA 3T6CA 2PDGA 1O5XA 1XLCA 1G4EA 3TNBA 4O18A 2E9BA 1OGGA 1E4MM 4D6DA 1KWGA 1NTHA 2DPEA 2WMIA 4TV6A 3H2FA 5EGRA 1P0BA 2GJXA 5CPOA 3DIPA 2FB2A 4HPJA 1R3WA 3UZXA 2Q3RA 4ZOCA 3R43A 5HOSA 4UIOA 1TIMA 5H1WA 7TIMA 1SR9A 1ZBKA 5DT5A 5BW6A 2X1TA 4N9BA 3SADA 4A3RA 3OHMB 4PTVA 3WNLA 4XTIA 1BPLB 3GTNA 4KEVA 2PWGA 2WSQA 2QQ6A 2F38A 3EDJA 3FYOA 3WDPP 1TYGA 4K38A 4IGNA 4GZIA 3GFZA 2CW6A 3GZAA 5E0KA 2P8CA 1W1A1 3BSGA 4LVAA 1XP3A 2GSEA 3TZNA 1J8VA 2WVVA 2ISFA 1BF6A 3GXMA 4MFDA 2ZBTA 4AWTA 7TAAA 3H26A 4FZIA 3RUBL 2YXXA 3TC6A 1PO9A 4KCUA 4PUEA 3NQGA 1YTKA 4PUMA 2JEQA 7PTDA 1MQRA 3NQAA 1R7OA 3P80A 1WOAA 2YR1A 2G3NA 1RP8A 1W0MA 4WLCA 2ZQ0A 3ARYA 4XZIA 2NQ5A 5K7JA 2CWXA 1KQZA 2I5IA 2IKHA 3SY1A 3EWCA 4YTQA 1QW9A 1NQ6A 1OQFA 3LCLA 1QPQA 1EKOA 1US0A 1TG7A 3T0AA 1DWJM 3PPFA 4GO9A 5F1UA 1WA3A 3VABA 1XC4A 3VD9A 4EPKA 1WYIA 3IUDA 3TK7A 2F6XA 4AEEA 1FTXA 4UZSA 4PRTA 1FWGC 1S2VA 1VH7A 4AWEA 1SU5A 1KM5A 2BODX 1F3EA 5HPCA 4I7VA 2Z4GA 3AIRA 2GGIA 1K6WA 4WUIA 1PKMA 3LEPA 5EA9A 2VR4A 4GBUA 3TR9A 1Q7MA 1DYSA 3CJPA 1B9BA 4LB3A 4PBFA 3MJYA 2E6FA 2JQXA 1JUEA 3P5ZA 4PUUA 4ZXOA 4WZHA 1QK2A 3CTLA 1GORA 3HA1A 3WEMA 4G1KA 1YADA 1F4HA 1O5RA 3JUGA 2VL4A 1CI1A 2XYLA 1XYFA 3LM3A 3TYEA 4DAIA 4F40A 2VEFA 2QPSA 3AMCA 3SBFA 3RG6A 5DCBA 4QE1A 4DBSA 1O60A 4GXMA 1PL9A 4RW5A 3M5XA 4Z1DA 5A8NA 2PDKA 4GISA 2AL1A 3VIIA 4PTWA 4ZZ9A 5JIPA 4GPNA 4L1WA 4FSAA 2DUZA 3S42A 2A7PA 3AO0A 2J6VA 4HP5A 3WQOA 1QASA 1E71M 3GDKA 3RITA 4IPJA 1M3UA 2JIWA 4ZFCA 4QGCA 4TTUA 1PE1A 2YIHA 3EKZA 3ITVA 3WLOA 2WSKA 1EUAA 3IJQA 4LW7A 1DE5A 3ZT7A 4XBJA 4PTNA 3T0DA 4ADUA 4I6KA 1UW9A 1T5AA 3MZ2A 2Q09A 3LXAA 1HF6A 5CAKA 3G1AA 1GEQA 1UCWA 3NUKA 3APYA 2QR6A 4UR8A 3UA4A 1ADDA 3U3HA