4O50A

Crystal structure of trichomonas vaginalis triosephosphate isomerase ile45-ala mutant (tvag_497370)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
252
structure length
252
Chain Sequence
MRTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFAFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering mutants with altered dimer-monomer equilibrium reveal the existence of stable monomeric Triosephosphate isomerases
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 85
structure length 252
sequence length 252
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o50A00
3LI1A 5I3HA 1G4TA 1Q6LA 3BW4A 3TJLA 3BGGA 1K7FA 1A5SA 3W2MA 1DJNA 1FCUA 1OFPA 3H54A 2ZRUA 1H7NA 2A21A 1QOQA 4MZ8A 3UQNA 5G4EA 3CU2A 2NWRA 3GXNA 4UR7A 4O28A 3LCHA 4Q33A 3GXTA 4LVDA 5L9FA 1MZHA 1Z44A 3B4UA 4K7YA 2YPIA 4FXRA 3W2KA 1VRDA 3NXFA 5FF7A 2DJXA 1W5OA 1TQJA 5FEZA 2Q8ZA 4Z1DA 1K8XA 3S9YA 4POCA 4ADTA 4HT3A 3HGJA 5BMXA 2R91A 1YADA 2WOQA 5DXXA 3DBPA 3R5EA 3YPIA 3O06A 1F6PA 1KFCA 1EUAA 3VCRA 3UWQA 3TC6A 3EX2A 2WSRA 3G1AA 2QDGA 5EA9A 2P10A 3O63A 1SO3A 3PBWA 2OT0A 4CNOA 1VC4A 4AB4A 2GVJA 3L5MA 2C16A 3GK0A 1YXYA 5G1TA 3W7CA 3IEBA 4Y96A 4PEKA 5D04C 5CPMA 5KSWA 2QCMA 1TQXA 3IRDA 4WOQA 3QSTA 2G97A 5FF0A 1KV8A 4C1KA 3TJXA 3W7RA 3UWVA 2PRMA 1KM4A 1LOQA 1QMLA 1W1ZA 2W6RA 3UNDA 1TV7A 3DHDA 4RK8A 2A1YA 2TYSA 3E0IA 1VZWA 2W0UA 2OX1A 4X3ZA 1TTQA 4XQ6A 5D03A 2E68A 2EAWA 3TKFA 2B7QA 4Z0SA 5C5YA 4K39A 4AEOA 2RH9A 3TDFA 5AHIA 1I45A 1FDYA 4XBSA 3QMSA 2JBMA 3G8RA 3MJYA 1TIMA 2C18A 1W31A 1KV5A 3EXTA 2FB3A 3M16A 3P81A 5LNUA 1OF6A 1I2NA 2WJZA 4FNSA 1OFOA 4ZQRA 4LV4A 4LWWA 4Q32A 3W2UA 1EP1A 4JTSA 3TCEA 3ABRA 3GDMA 4U28A 2V81A 1FCBA 1AG1O 4ZMGA 3KVLA 5TBOA 5K4ZA 1KW1A 5KITA 1FXPA 1KM1A 4DF1A 3PC0A 3TSDA 5K3VA 1DQXA 3LB0A 2VKZG 3M43A 4BFAA 4H3DA 4N9DA 1XM3A 3LCWA 4HNVA 2Y61A 5AC6A 1YLVA 1GVOA 4L4MA 2VFFA 3GIYA 5FEXA 1AL7A 2VFDA 3T7VA 1GYLA 1YXCA 1TTIA 3QH2A 4DO4A 2JGYA 1KFEA 2RDWA 1IXPA 3QQ1A 4JYFA 4DO6A 1BKSA 1W8SA 3W85A 3THQA 4DF2A 3A22A 4BK9A 4O53A 3ZFHA 3LBCA 3SFKA 3T55A 2A7PA 4N6FA 1NSJA 4IOTA 2QJHA 3LTPA 1YTEA 4GWEA 4O0KA 5DCDA 4LVFA 2B4GA 3HB9A 3S5OA 2DZPA 3C2EA 4M19A 1QPRA 4DBEA 1H62A 3GDRA 1V5XA 2E5DA 2YR1A 3AJXA 1XDLA 1SZGA 2GVGA 1S5VA 3KOFA 2ZZ6A 2FQIA 3S1UA 2FFCA 3GAKA 4HPXA 5LGZA 2NV1A 1TV5A 3SW6A 3EWYA 5FF4A 3QW3A 3UZJA 2X1RA 3NOEA 3M41A 4AHOA 1H61A 5EYWA 2H6RA 3FOKA 2ZRZA 1SSDA 3HOJA 4ZQCA 2FB2A 4JTUA 3W7MA 4JY9A 4UTMA 5HQEA 3C0JA 3W88A 4OE7A 1JRCA 3C2FA 5F4SA 1O95A 3EX4A 3NQMA 3JR2A 3OHIA 4CCCA 4YLWA 3NL3A 2A7RA 3HQ1A 3NO5A 5FESA 3PWAA 4UTTC 2FJKA 4FNRA 3V1PA 5LZLA 3W74A 1SU5A 3P67A 4RJEA 3INPA 2DZVA 3TW6A 4TR9A 3G1FA 2V82A 1HG3A 2A7NA 2Y89A 3M7WA 5HUOA 4Q4KA 2GJNA 2VFIA 3BW2A 1ONRA 3C8FA 4ADSA 5BMWA 1WBHA 3W87A 1JQVA 4LS0A 3CC1A 3S1VA 1Q6OA 3NQFA 1UB3A 2QJIA 3O8AA 4IMEA 1XUZA 4IWWA 6ALDA 2EKCA 4UTKA 2H3DA 1WA3A 3M5XA 5AOUA 1W5MA 1F2JA 2KZHA 2RKXA 3WJXA 2CLOA 4AVFA 1OFDA 1DVJA 2GQAA 2V5LA 4GUJA 1DOSA 3A5VA 4X2RA 3GVGA 3S5YA 4Z0JA 3GDTA 4TMBA 1LRNA 1FX6A 3MW7A 4RXFA 5C6MA 1UBSA 2VELA 1U83A 5KZDA 4YCPA 4MY1A 2CZFA 4LY8A 1EB3A 1NF0A 4LV9A 1EIXA 4UFJA 4A22A 1UASA 4KWWA 4NZJA 4BI6A 3HGRA 4WY0F 4JX6A 5I3KA 3W7JA 1DQWA 4R53A 2ZRXA 2C13A 2OZ0A 3TIMA 3QPZA 3C52A 3MP3A 5F4WA 3W72A 3BARA 1H7WA 4UTIA 3W2NA 1KFJA 1IIHA 2WSQA 3HMJG 4BWLA 3VI2A 3NG3A 2ZFAA 4E0CA 2X16A 5E1QA 4DPQA 4Y9AA 4JTGA 2J24A 4WQ6A 1JUEA 2QCCA 1FXQA 5HNRA 1PV8A 2Y88A 4HPJA 2Y7GA 4JTHA 2YXGA 1DJQA 1PVNA 5FF2A 5D02A 4TX9A 3BV4A 2FPVA 1NF7A 1B4EA 3PB2A 1GTHA 3GDLA 1JVNA 2NXHA 3DFQA 2PE4A 1K02A 3L2IA 4JNMA 5K9CA 4Y90A 4JXCA 4I7VA 2DZTA 1MEIA 1TPEA 3G1YA 1QCWA 5F2GA 4HN4A 1P0NA 3LCXA 3HBLA 4NU7A 4P61A 4HSNA 4A2RA 4N4PA 1W3IA 3W71A 2QUUA 4DBDA 3R2GA 1JCMP 3NL5A 3JS3A 4N9CA 4PL2A 2VEKA 4AWSA 3IVSA 5AN7A 3W23A 3ABSA 4LT9A 4YL2A 2C14A 3STGA 4BI7A 5K2ZA 4M7SA 1JCYA 4OHQA 3GB6A 3W1UA 1O94A 4GUFA 4O1AA 1TJPA 1SFJA 1VCVA 3DFPA 2CLLA 3MI2A 4JTIA 1W5NA 2CLEA 3OBKA 4WOZA 2BWGA 3W73A 3S5NA 2NXIA 4JX5A 1GG0A 3SECA 1T99A 4HNTA 4CNNA 3G0XA 4JIQA 4JTTA 4LU0A 4CNPA 3EWZA 1DHPA 4DQWA 1X7FA 2QCNA 3P74A 4WD0A 2FTPA 2BX7A 4O54A 1GVRA 3FLUA 1G4EA 1FCVA 2YGYA 3KFTA 3EX3A 3W7PA 1W3NA 4GBUA 1HO4A 1QPNA 3DZ1A 2V5BA 1H7RA 3QC3A 5AC8A 2X2GA 1W37A 5G5IA 2NX1A 3A21A 1R30A 3P5YA 1VLIA 3ZR4A 2A6LA 2WQPA 2DZUA 5D38A 3TUUA 3KVMA 1EWEA 4JR5A 3G1SA 3THAA 1XC4A 4WX2A 4D2JA 3C6CA 3IGUA 4JDBA 3P80A 2FPTA 3BO9A 4RZ6A 1FWRA 4XTIA 1NEYA 2ALDA 1LTDA 4MZ1A 1RV8A 1VHCA 5I3FA 3T4CA 5K7JA 4ONVA 4I7WA 4G1KA 3OA3A 1LRTA 3OVPA 2YCEA 3M9YA 4DF0A 4NNAA 1QO2A 3C2RA 3K30A 3KXQA 3SI9A 4UFHA 4NXKA 1KBIA 3QEZA 4FIQA 3C4UA 4RZ4A 5KTLA 4MLJA 2VFHA 4NVTA 1OX5A 3N2MA 2JKPA 5AFDA 4O18A 5I3GA 3BLIA 4GNJA 3TMLA 2BZNA 5LNWA 4AF0A 2DJLA 1AL8A 1OVDA 3LLDA 4PA8A 4UTHA 2Y7FA 4K8HA 4ORIA 2C19A 2FDSA 1JCXA 1LOSA 4PL1A 2QAPA 2DZXA 1PL9A 1ME7A 1VYRA 2ABBA 3BG9A 4IGHA 1V7YA 3WFAA 3M0ZA 3W1MA 3MUXA 4I9AA 3W7GA 2EPHA 2YW4A 3BVJA 4KWVA 3HG2A 3B0PA 3S5ZA 3T40A 4O14A 3DKLA 4ICNA 1XBXA 3FYOA 2G96A 1OX4B 1LP6A 1SQ7A 3MP4A 1FCQA 1H1ZA 3CWNA 3DKJA 1TPH1 1M5WA 2X1TA 3NYZA 3FYPA 4UTTA 5CSRA 3B8DA 5EL1A 1C29A 2QCDB 4MOZA 2Y63A 4NJGA 2G5WA 5U7SA 5LNRA 3W6YA 1OYAA 3L67A 1QPQA 1F05A 3Q37A 1OFEA 4UCGA 1VS1A 2R14A 3NQDA 1JQXA 3CQ0A 1SZEA 4M7TA 1F76A 5HMSA 1G7VA 1FWSA 2A4AA 5DCBA 3SR7A 3KHJA 2Y62A 5DLCA 1WQ5A 1RZMA 5IBXA 3FJLA 4WY0B 5I3JA 4HHPA 4X9SA 3MO7A 1B3OA 4JDYA 1XBYA 3MHGA 2WSYA 2GOUA 1KFKA 3CEUA 1WAUA 3QM3A 1I2QA 3UWUA 4O1DA 1RD5A 3F1QA 3NQ2A 1OFAA 1QPOA 1S5TA 3CB8A 2YW3A 3CEPA 3O07A 4S2BA 4RXGA 1B4KA 4TU1A 2ATMA 3PSWA 4RR4A 1P0KA 1UUOA 3P60A 2EGZA 1NAL1 2O7SA 3NZ1A 3FS2A 3G3DA 1TRDA 4HIBA 1FDJA 4X22A 3NZRA 4O15A 4O52A 3MYOA 2OJPA 2BLEA 3MI6A 4P2VA 2HMCA 3HG3A 4QITA 5D37A 1OX6A 4A2SA 1LLZA 5HR7A 4J9JA 4AF0B 4FEZA 3QYQA 4IXXA 1RQEA 3I7QA 5AC7A 4NXSA 2CZDA 2UV8G 3F03K 4LS2A 3ELFA 3E02A 2QCFA 3NL6A 5DXYA 3TA6A 1GVQA 4LOCA 3TFXA 4N9EA 1A53A 5LHFA 1D3GA 4PCFA 3B0VC 4FO4A 2ZZ7A 4XKYA 2O7QA 4GJ1A 1JRBA 4CQ8A 4C1LA 3LLFA 4O8RA 1TPC1 3KVJA 1HO1A 4IXHA 2H8XA 1MEHA 1H60A 3BGJA 4JICA 4ZVJA 5EMUA 2TMDA 1QWGA 4MVAA 3GAYA 1SPQA 3O6YX 5AYYA 1AW5A 2V30A 1XBZA 4N9BA 3ATYA 1O60A 1LCOA 3DXIA 4GXMA 5HWJA 1GOXA 1LDCA 2GJLA 2HS8A 1VHNA 3RNDA 5BOOA 5CSSA 2E1DA 3P8JA 4O4WA 1K8YA 1JUBA 4JTEA 5EBUA 5MHBA 4KFOA 4GUGA 3PAJA 3RLUA 4IPIA 5LGXA 3L5LA 1SW0A 4QM1A 3ZWSA 2TPSA 4WJEA 3UD6A 3R89A 1H7PA 4MKNA 1MSSA 3L68A 2JKAA 2ZZ1A 4UNLA 4XTDA 4MY8A 3TK7A 3VFLA 1M6JA 3TFCA 3H53A 2E77A 3NPWA 3STEA 3NQ7A 4XUGA 1DKWA 4JX4A 4LC6A 2CLFA 1Q45A 5HWMA 2V2DA 5LNVA 2NX9A 1M7PA 3O6DA 2E09A 1GJPA 2WNNA 3LI0A 2RDUA 3IIOA 4NZFA 3G0UA 3CHVA 1SSGA 4M6VA 4OV4A 1XUUA 3EKZA 3Q94A 4IPJA 3NQ8A 1JJKA 1QR7A 3W76A 3W1TA 3RU6A 3DENA 1ML1A 3VE9A 3OIXA 2ZTKA 4A3UA 3LBMA 1F5ZA 2LLEA 2CFFA 4FX8A 3TSMA 5U4NA 4RZ5A 4NUWA 3MI3A 3DFNA 4ADUA 3LHZA 1IGSA 3QMRA 4QNWA 5K9XA 2F7FA 3SGZA 5HJLA 3EEGA 1YYAA 3ABOA 5E93A 2G95A 1SW7A 3WJZA 1N8FA 3NQEA 3DFOA 5K4XA 3O1NA 3VKJA 4NJKA 2AQWA 3BPWA 3LV5A 2DZWA 2E6AA 3NPXA 1H7XA 2J9ZA 2BSLA 4YWIA 1YDOA 2ZRVA 5G4WA 3L0GA 3R13A 3I7SA 2QCEA 1MXSA 3LCGA 4R7JA 2H8ZA 2I9EA 3UZ5A 2NUYA 3TAKA 4K36A 1AMKA 4DXVA 1VJIA 5J5RA 3W1NA 1KM0A 2J88A 3WJWA 2ISVA 1TREA 3M5ZA 5CPOA 1Y0EA 1EUNA 5A5WA 4U4MA 5AYZA 1QO5A 1TPDA 5CZ0A 5E0KA 1ICSA 3N2XA 1G67A 4MFEA 4FX6M 3LTYA 4O16A 4UMCA 5T26A 5K9DA 3EX6A 3ZS4A 2X30A 1H50A 4M5PA 3LRMA 3UWYA 5GVJA 4E38A 2DP3A 2Z1BA 3W86A 4JTFA 2J27A 5D2TA 2VC6A 3BG3A 4DPPA 1R2RA 1T96A 3EWBX 3OVRA 1F74A 1LZOA 4Z1CA 4GUIA 4GE8A 1GT8A 3ATZA 3LHYA 1PS9A 2BTMA 1KTCA 3TXVA 5HR6A 3W7HA 1SZFA 2B7OA 3W1PA 5KINA 5FI8A 5J5DA 1OK6A 4O17A 3CM4A 1OK4A 1LBMA 5DCEA 2ZRYA 3FKRA 5AHEA 2WKJA 2NUWA 5FEPA 3U8GA 3N9RA 4N02A 5CKSA 1TO3A 1ZCOA 3AO0A 5DY3A 3QJAA 2VEPA 1XFBA 1N55A 3QMTA 4W9TA 1L6WA 1FUYA 3NPUA 3E96A 3STCA 2D73A 4JS3A 1MEWA 1UUMA 4UR8A 1KM6A 5CZTA 2A0NA 1YTKA 2V8ZA 3GNNA 2QCDA 1K7EA 3IGXA 5KZMA 2CW6A 5HWNA 1I2PA 2ISSA 2E5CA 4NNCA 3MBDA 2A85A 3FEMA 1D9EA 3GLCA 4JYEA 3LHUA 1LLWA 4CLMA 2C15A 6TIMA 3ZWTA 1YPIA 2H90A 2Y7DA 2ZA2A 3SY5A 1J4EA 2C1HA 4O4VA 4UTUA 1NFBA 3NR0A 2W79A 1TV8A 2VEIA 4QNEA 4QSHA 4ZQNA 3WJYA 3P84A 1G4SA 2XN1A 4FNPA 3MHFA 2QCGA 1P5BA 2B0MA 4LC8A 3FFSA 4OU1A 3SSJA 2XFWA 5LNSA 1AW1A 3Q58A 1XXXA 4PODA 2V9DA 4RV8A 1QNVA 3UWWA 1B9BA 3WK0A 3R8RA 3C2VA 3WK2A 2IQTA 2CZ5A 2ZZ2A 3Q2DA 4UTWC 2GQ8A 4O0ZA 1LBFA 2OT1A 4JTKA 3W1QA 3L5AA 3GKFA 3TQ0A 3GNDA 4K8EA 1WBJA 3L0KA 2Q8LA 4JD4A 5H2ZA 4WXZA 2PRHA 1CW2A 2P1FA 4O11A 4E2BA 2QKFA 1HTIA 4JTLA 4WUIA 1SZNA 3A23A 4FHAA 3G0SA 5I3IA 1KFLA 2VOMA 3I6RA 1TTJA 3CWOX 3STFA 4LTSA 4K37A 4AMAA 3PB0A 1EX5A 1VGAA 5D09A 2C0AA 3LERA 3I65A 2CLMA 4MUZA 4JGDA 1XCFA 3IIXA 3C61A 4OWGA 2HTMA 1I8JA 5D33A 4LUIA 3M5YA 2RHGA 4NJJA 4OV9A 4MIMA 3O16A 3W7QA 1OHLA 5ABTA 1H5YA 5SWUA 5TQLA 2YFNA 2GUUA 3B04A 2VEMA 1RR2A 5KMYA 1Z48A 4GFSA 2AGKA 4ZZ9A 3GX9A 3E12A 4QIUA 3LCIA 4R34A 5D2VA 1AK5A 1G4PA 2PURA 3QZEA 3HF3A 4FXSA 4OQVA 1OFBA 3LTSA 3S42A 2QR6A 1THFD 2VENA 3TV8A 2RFGA 1ICQA 2VFEA 1VCGA 4GRSA 1GEQA 1ADOA 3KAOA 1DBTA 4AH7A 3SZ8A 1TMHA 5AHNA 3M47A 2ZBTA 3O15A 4N6EA 7TIMA 1LYXA 1RQBA 3IV3A 1F7BA 3VNDA 4LW7A 3D0CA 2YX0A 2FLIA 2GQ9A 2YFOA 3UXDA 3LRKA 4M6QA 2E6YA 1KLZA 3QF0A 3W1LA 4LNYA 4RX0A 1LOLA 3PUOA 3DI0A 3CTLA 2RDTA 3W70A 3TE9A 2F84A 2R94A 3LOTA 4AXKA 5F2IA 5BW6A 3QQ0A 4HSOA 3UY8A 3GXPA 1O5KA 2OCZA 1R2TA 4EF8A 3TAOA 3KRZA 3DFSA 3E49A 4Y6GA 1OABA 4BF9A 5F2LA 3NAVA 5AHLA 1TTPA 1LM1A 5CGQA 3O6CA 3RF9A 4UMAA 3P7YA 1WV2A 2GVLA 3NQ6A 5BNKA 3PUEA 4RLIA 3PG8A 1NVMA 3PVFA 4MPQA 4QISA 1BEUA 1LORA 1B57A 2NX3A 3MMTA 2V2CA 3NNTA 1GQNA 1KM5A 5F1UA 1DORA 5KZEA 4ORMA 1SO4A 3QPYA 4XKYB 1XBVA 1TSIA 4FF7A 3CLMA 1RPXA 3V75A 4NJIA 1PHQA 4OBTA 4JY8A 3W7EA 1IXOA 1HL2A 1FY6A 1BWLA 1XDMA 3W2LA 3PUDA 3KVKA 3F4NA 1EPXA 1UJPA 1MO0A 1X8FA 1Z42A 2R8WA 3B0UX 4A21A 4K38A 4MFDA 3OEXA 2H3BA 2Q3RA 3F4WA 2FIQA 2YYUA 1Q6RA 2Z6IA 3N19B 3PR2A 1X1ZA 4DO5A 5LKYA 3I68A 1CI1A 2YZRA 3NM3A 3BLFA 1OG0A 1W54A 3LXCA 1T8XA 3NPVA 3W1RA 4M6PA 1TJRA 3SJ3A 1H1YA 1SFLA 4YCOA 2Y70A 3G1XA 1ZALA 3LM7A 4MYAA 1U5JA 1W56A 5G2WA 3LGEA 1JCJA 1OJXA 1VYPX 3B06A 4WZHA 4EIVA 1FWNA 4O57A 4CQAA 3EB2A 1K3UA 3PBYA 3LCLA 2A2IA 3C56A 3MBFA 4Y8FA 4IMDA 3PBUA 3LCFA 2I14A 1YPFA 3HO8A 4DEFA 3W84A 3G1VA 1KTBA 1GVFA 1ZAIA 3BK0A 3W7OA 4FNUA 3BLEA 1R46A 3LV6A 1Z41A 3W22A 1OYBA 1IXQA 3WJSA 3MHUA 3IGSA 2V0TA 1EP2A 1RVGA 4Z1BA 4EF9A 1L6SA 1PCKA 3R12A 1L2UA 1BTMA 2CZEA 4R33A 2GPTA 1YDVA 3G1HA 1C8VA 3P61A 2Z0IA 2ATSA 1HFBA 1F6KA 1EWDA 3EWWA 4EWND 4LVBA 4BWLC 2NXGA 2QJGA 4ZQPA 4FB7A 1IXNA 2Y7EA 1ZAHA 1TPWA 2QF7A 5CZSA 1TPB1 3W75A 1XI3A 1FQ0A 4EVZA 1WYIA 1WDWA 3L9CA 3HPZA 4LUJA 3U2OA 1ICPA 1RQHA 4S2CA 3LHTA 3HIJA 3LXAA 3HGOA 3GYEA 3O05A 1P4CA 3BG5A 2YYTA 4QAIA 1R2SA 1X6UA 3IIVA 1YTDA 3PG9A 4O1BA 1W5QA 1M7OA 1XL9A 3TMQA 2DORA 3M5VA 1WOAA 4QQ3A 4NX5A 3UY7A 1GZGA 1A5BA 3NQVA 5C2XA 1TCDA 3CPRA 5H91A 3W7NA 3TC7A 4K7VA 5F4XA 1ZENA 3L66A 3DFTA 5LSMA 2ZZ3A 1SUXA 1D3HA 3N73A 1GYNA 3VE7A 3P82A 3S1XA 4A29A 3TROA 3L21A 4LRSA 3GR8A 4MY9A 4PH6A 2B7PA 2WO5A 1JR1A 3QW4B 3S6DA 4FNQA 2QCLA 1YXDA 2CU0A 3N9SA 3IVUA 3TU9A 3TSBA 1KLYA 1N7KA 4EOUA 3T78A 5EKYA 5F2MA 5A8GA 4O13A 1WOBA 2DU2A 2CLHA 5D32A 1F73A 3TR2A 3TW7A 1GTEA 4GUHA 3NEVA 1I4NA 3GR7A 4UNKA 4UFMA 4I7UA 5CZJA 1LRQA 3USBA 1WX0A 3M44A 3JRKA 1QAPA 4UXDA 3NGJA 2HSAA 3L0NA 3L65A 3MYPA 3HPXA 3NDOA 4AWTA 1P1XA 4JN6A 3W3OA 4AWUA 2Z6JA 2J9YA 1HUVA 2JGQA 3HJZA 3W7IA 3SIZA 3MWAA 4MYXA 4ZL1A 2Q3OA 4OT7A 3A24A 1ZY9A 1TB3A 1VCFA 4KFPA 4GC4A 5TIMA 2QUVA 5FEWA 2NV2A 5DBUA 4QJ1A 1EA0A 3MP5A 1R47A 4XBKA 4H6KA 1SW3A 5HULA 4LRTA 2ZRWA 1GVSA 3NQGA 5L6UA 1VLWA 5AYXA 5DELA 1PHWA 3H55A 4HNUA 3DGRA 1S3HA 3UWZA 3W7LA 2ZDRA 2WPBA 2PC4A 2XN0A 4JYDA 2V2HA 3UXAA 3EWXA 4TIMA 3W7DA 1JCLA 4JEQA 5C54A 1T0OA 3HPSA 4CCEA 4AHQA 1S5WA 3KRSA 4O1CA 4O50A 3OVQA 1I2OA 4XZ9A 4Z08A 3DU0A 3DAQA 5G2IA 2NUXA 5DN1A 3NQAA 3KX6A 3ANYA 1OFRA 3NM1A 1GPWA 3TQVA 4S1FA 3NVTA 3GKAA 2J6XA 3B03A 2FPYA 1O4UA 1VR6A 1ZHAA 1TPUA 3FJ6A 2NWSA 4IMGA 5D2WA 1GG1A 3GZ3A 3RMJA 1BWKA 4O12A 4TMCA 2ZA1A 4FX7A 3QSRA 4UTLA 1ME9A 1AW2A 1A5CA 1VH7A 4IUOA 1QOPA 3C3NA 2B7NA 1VYSX 1W5PA 2PCQA 2ZQ0A 4MLRA 4HKPA 1K7XA 5AHFA 5IM51 2VXNA 2ZA3A 1CX9A 2ABAA 2NLIA 4TO8A 3IVTA 2ZZ4A 1J5TA 3HG4A 3HGSA 1A5AA 2QCHA 5G2HA 3EWUA 4BR1A 3N34A 2EF9A 3HG5A 5CG7A 1G7UA 2CLKA 4AAJA 5AB3A 1A50A 1OFQA 2ZCGA 1KTNA 2QDHA 3QRHA 3U6WA 2E6DA 4PTNA 3WK3A 2TRSA 3EX1A 4RKAA 3G24A 1LBLA 1EP3A 3W83A 4IX2A 3E9AA 3W2JA 4LVAA 4Z1AA 1W0MA 2QUTA 2X1UA 4UMBA 1EEPA 3CIXA 5DBTA 4N4QA 1TYGA 1KFBA 3PBVA 1O5XA 1KA9F 1ALDA 3PM6A 2YDAA 5HUPA 1LROA 4UTWA 4BI5A 2HS6A 5DY2A 1YDNA 4MJZA 4YMZA 1VPXA 5C55A 1PE1A 1SO5A 1FDZA 3ABQA 4UFIA 3TXZA 1L6YA 3CIWA 3W1XA 1Q3NA 2TSYA 3OG3A 8TIMA 3G3MA 2AAMA 3LX9A 1KM2A 1WXJA 4NT0A 3PY2A 3G18A 4IX0A 3S8HA 4IMFA 1TRIA 2ZTJA 4NNBA 1H51A 4KKXA 3SGUA 3FIGA 5LHEA 1GWJA 3A9IA 2A6NA 2ISWA 2PRLA 3W1AA 5D2YA 3TQKA 3NL2A 5AHMA 3LRLA 5D30A 1QDSA 4UIOA 3BW3A 1QFEA 1PCWA 3G22A 3UPWA 1DV7A 4HNNA 4FNTA 1ME8A 1KBJA 3P5ZA 5EY5A 1G69A 3FA5A 1K8ZA 1W3TA 4JIPA 4ZQOA 2NZLA 3TX9A 5F1VA 3LHWA 4ZQMA 3GDKA 2XN2A 4RCXA 2I1OA 3RFAA 3G1DA 2A5HA 1I2RA 4NJHA 2CLIA 5IBXC 3EXRA 4WXYA 3N14A 4UFKA 4AHPA 4K6AA 5CPLA 1FBAA 2C6QA 3UYCA 3NQCA 4WY0A 1OF8A 4L4LA 4NQ1A 4KFNA 1H63A 4CQ9A 3RLVA 5CPNA 3B05A 5D05A 1FWWA 2DZSA 2VFGA 4IJBA 2YSWA 1TPVA 3W9ZA 1ZFJA 4UC5A 1PIIA 2E5BA 1FWTA 3EXSA 3PSVA 5HINA 1ZAJA 1E51A 4O10A 3P8IA 4DELA 4JTJA 1L9WA 3TNOA 3M6YA 4H4IA 1ZJIA 2JKEA 2JK2A 3DH7A 3G8EA 1UCWA 4MZYA 1JUKA 3P62A 2C3ZA 4FIRA 3DI1A 1J2WA 1JULA 2E6FA 4ML9A 1Q6QA 2P0OA 3PULA 5EPDA 1G6CA 4LS1A 1C9DA 3I7RA 3DHFA 3S0CA 2QAFA 3UPBA 1H7OA 3FKKA 3M1ZA 3TH6A 1DL3A 1KM3A 3NA8A 4NX0A 2QEZA 1ZNNA 1IF2A 2J9XA 4OGZA 5BRBA 1TPFA 3T44A 3CT7A 5FF3A 3IIPA 2ZYFA 1OX4A 5D2XA 3RK8A 1VQTA 3S1WA 4O19A 5G1YA 3W7KA 3C2OA 1SO6A 1XKYA 3WK1A 3A5FA 4ALDA 4YXGA 2WNQA 3PF3A 4CCDA 2WNZA 3LHVA 4PFMA 3EKLA 1JCNA 1X1OA 4IQLA 2BXVA 2X1SA 4N2YA 4UTJA 2Z2UA 3LDVA 2CWNA 3N3MA 4IMCA 4PC8A 1SR9A 2OMAA 4UUIA 2ZZ5A 3QFEA 2EHHA 1OYCA 3IIZA 2Y6ZA 4MJMA 3KRUA 3LXBA 1K03A 4E2DA 2Y85A 4LVGA 4UFLA 1IIGA 3W07A 2WV8A 4B5NA 4XWUA 3PS7A
chains in the Genus database with same CATH superfamily
4ML4A 3W4RA 1Q6LA 3BGGA 1YE4A 3NSNA 2I5QA 1K7FA 3W2MA 1DJNA 3H54A 3EPOA 3O9NA 3CU2A 4UR7A 3LCHA 3GXTA 5L9FA 2XISA 1MZHA 3B4UA 4AZHA 1EGMA 3MV01 3U2EA 3AWNA 1VRDA 3NXFA 2NV9A 5FF7A 4YWSA 1CXLA 1GGOA 2VGBA 4Z1DA 4GI6A 1K8XA 3FXGA 1P0DA 8A3HA 3QXBA 1HJWA 4IIGA 3SQLA 3YPIA 1GVYA 3P0WA 1F6PA 1KFCA 3D3FA 1AMYA 3H8AA 2XTKA 3U4AA 4A6GA 3VCRA 1B90A 3IJ9A 1W9PA 1KRAC 3G1AA 4B3LA 2E9MA 3WD2A 3PBWA 2ZX9A 1QBAA 1VC4A 3IACA 3L5MA 4GA8A 5G1TA 2WVUA 3WQ6A 3W7CA 5IXEA 5D04C 5CPMA 5KSWA 3S6TA 5M03A 4DLMA 4WOQA 2FTYA 1UA7A 1KV8A 1UR4A 2YXXA 3TJXA 3IV8A 2V6AA 2PRMA 4AZBA 3UNDA 1W1ZA 2PBOA 2GL5A 1MQRA 4RK8A 2GDUA 1LJYA 2W0UA 2W27A 3FA3A 1Z89A 2CBVA 3AMGA 3CUGA 1IWAA 4Z0SA 3OU8A 5AHIA 4BCEA 1XQKA 1RBOB 1W8GA 2D2OA 2DSZA 1U5HA 3MJYA 1TIMA 1ISZA 1W31A 2CKRA 3M16A 1V6WA 5LNUA 3GUGA 2WJZA 1PPIA 4FNSA 1OFOA 4ZQRA 2F38A 1F8IA 3BAIA 4Q32A 3T6CA 1Z69A 3W2UA 1DJZA 3FNDA 3OODA 1XCWA 1UR3M 1HKKA 3KVLA 5E0FA 1RY8A 5KITA 1FXPA 3WLKX 3LB0A 1T7LA 3TC3A 3M43A 3UPMA 3DCPA 1UZDA 5AC6A 4Q22A 4Y9NA 2VZOA 1R8LA 1ZU8A 2GGEA 5REQA 3T7VA 2FZMA 3LLXA 1GYLA 4DAFA 3DHPA 3LNPA 4YNGA 2JGYA 2RDWA 1F8MA 1IXPA 5B80A 3THQA 3A22A 4LYKA 2HVNA 3ZFHA 3U9IA 1UH2A 3LBCA 2A7PA 1DE5A 3PZVA 1J0KA 2B4GA 3KCJA 3M0YA 3S5OA 4M19A 1BVWA 1QPRA 4W8AA 5DX7A 3BJTA 1RA0A 4FOJA 2E5DA 1XDLA 2GVGA 3H2MA 2NV1A 1PJ9A 1M3UA 2JFEX 4ZE4A 1E72M 3UZJA 3M41A 4JFVA 4Y9MA 2ZRZA 4GKTA 3ZSTA 2YB1A 2PDFA 5F4SA 1O95A 1E1EA 1F4AA 4E3VA 5CPQA 1D8CA 2J6VA 4AG0A 4C6DA 2YA2A 3JR2A 4GI8A 3OHIA 2QUNA 3HQ1A 1Y7VA 3UR8A 5C8BB 3T1GA 1S5MA 2FJKA 4FNRA 5JVLA 3NOYA 3P93A 3RPDA 3P67A 3IJDA 4RJEA 3INPA 3TW6A 4ATLA 2V82A 4C60A 3T09A 1KQZA 1QHOA 2A7NA 1WPCA 2OVLA 1W9UA 2GJNA 4ADSA 1WBHA 3W87A 4P8XA 4FI4A 4AZ7A 3A4XA 3AS3A 3BH4A 3NQFA 3WDHA 1XF0A 3O8AA 4ERGA 2PU1A 4IMEA 1RLDA 1XUZA 2EKCA 2H3DA 1OIMA 2ACSA 2DQXA 3P0XA 2BOGX 1V4YA 2JALA 3NO1A 4HPGA 1UWRA 3NO3A 2JEQA 2GQAA 2V5LA 4GUJA 2BXYA 1AQHA 4Z0JA 4WSJA 3G1RA 4RE2A 1UR2A 1U83A 4YCPA 3MKVA 4LY8A 1EB3A 5GNYA 1GOKA 2NQLA 4L9ZA 3B0YA 1UASA 4H9VA 4NZJA 1IE7C 4ZOCA 3QQWA 2ZRXA 3A3XA 3T4WA 1EXBA 3ZR5A 3W2NA 1HVXA 2WSQA 1PWLA 5GJPA 2QJNA 4ECLA 1VFTA 2EJ1A 5E1QA 4M81A 3RX4A 4WQ6A 3MY9A 3AMLA 3VM7A 3F5LA 2WJEA 1PV8A 4HPJA 2DGAA 4Z2KA 2XU2A 2YXGA 3BV4A 1FRBA 1ISVA 7A3HA 3KHDA 1V6XA 2IS7A 2ANUA 2DT1A 5AECA 3PB2A 1XGDA 3WN6A 4CD5A 3VDAA 3LMYA 3NJ3A 2G41A 3DFQA 2WKGA 3L2IA 3V5FA 1V0MA 3E0LA 4JXCA 4I7VA 2DZTA 3TR9A 3G1YA 1VIWA 3LCXA 3HBLA 3VGBA 1UD2A 5JQ9A 1TMQA 3H26A 4GIRA 3ISIX 1ZBCA 3R2GA 3LSBA 1JCMP 3NSMA 1RVKA 5CCZA 4N9CA 4CD6A 2OTDA 2PDMA 3UG8A 4HMNA 1X7IA 4MPKA 4AC7C 1TZ7A 3STGA 4PRWA 1OY0A 1KKOA 5DF0A 4JN7A 1EJTC 3OW1A 4JTIA 1W5NA 3GU1A 2XZ7A 4INFA 1A3WA 3ZJ6A 4AZCA 2J47A 3M0XA 1GG0A 1BLIA 2Z2BA 4JIQA 4EE9A 2PODA 2X2YA 4LU0A 3M07A 4CNPA 3URQA 2YL6A 5AKQA 2FTPA 4NZ3A 4IQEA 4DM2A 1RSCA 3IARA 4LB3A 1KXHA 2HBVA 4FLOA 1HO4A 3DZ1A 2V5BA 4HA4A 2X2GA 2VC9A 1R30A 3OZPA 5D38A 4AFYA 3B97A 5TF0A 1EWEA 4JR5A 2W3ZA 4WX2A 2AGTA 3C6CA 3IGUA 3KS6A 3BO9A 1TJ0A 1B31A 3VA8A 4RW3A 1E0UA 3EBVA 1QHZA 4W7UA 4G1KA 4L64A 5I5RA 1OADA 2D2GA 3OVPA 3M9YA 5FJOA 3SURA 5I3DA 5CC6A 3WLOA 1IYXA 1AZ2A 1C91A 1AODA 3WUFA 3ITTA 1KBIA 4GO8A 3NQBA 2VFHA 3W53A 1GJWA 3WFZA 1Q7QA 4KCWA 5AFDA 3WLIA 5I3GA 4LH8A 3TMLA 4PCSA 3LYEA 2PDCA 3VIPA 4ICCX 4TQTA 2GK1B 3W01A 2Y8VA 3OYXA 4C7GA 4GI4A 1BYBA 4ORIA 3WMBA 3APTA 3SIMA 3RO8A 3A6OA 3KL3A 1VYRA 1EHNA 2ABBA 3ITGA 3PNZA 3F4CA 4DI8A 5DMMA 3WEZA 2DW6A 1IGWA 1UOZA 1VPYA 4AYSA 1OT1A 2PWHA 3HG2A 1ZS2A 3WCZA 1S39A 3S5ZA 3T40A 2PA6A 8CGTA 4US5A 4X61A 2AQVA 1E6PA 4FXFA 4CD7A 1ESWA 3VNMA 2X1TA 3NYZA 1JDDA 1QTWA 3B8DA 4JIHA 2QCDB 5DMLA 2VX6A 3VO0A 3TVAA 1MWOA 4NJGA 1JZ7A 4AVNA 3AYTA 3O0FA 1OYAA 3K4AA 3L67A 1QPQA 3GIQA 3URBA 1B3XA 4RV3A 1VS1A 2QNEA 2R14A 3GBDA 4QDPA 1F76A 3AQUA 5HMSA 1A5MC 5DCBA 3KHJA 3CS2A 4WKHA 5IBXA 4WY0B 2A3AA 4X9SA 3MO7A 1BTCA 2WSYA 5C9WA 2EQDA 2MUCA 4P8VA 3QM3A 4O1DA 2OPJA 3GTXA 4Q4SA 4QX4A 2PF0A 3MCMA 3IGHX 1SR0A 2WHMA 2Y4SA 3O07A 4C7DA 5CAKA 2ZWZA 1MXDA 1JPIA 4WJXA 3THCA 4TU1A 1HIZA 2QDEA 2BNJA 2DV0A 3M64A 1EBGA 5LYRA 3LBOA 4HIBA 3NZRA 1EJVC 4RZBA 3MYOA 4WJ8A 1F9CA 4M82A 2F61A 4J9JA 1S2AA 4A3RA 5A8OA 1GVEA 4J3VA 3E02A 2QV5A 4QEHA 4HOZA 2HVOA 2BGNE 4YTQA 3TA6A 1GVQA 4MWAD 2IXUA 3TFXA 2KX9A 5LHFA 1D3GA 1B3ZA 3QLLA 3WQ8A 4XAPA 2GWGA 3IK4A 4GJ1A 1E4NA 3LLFA 1Q66A 3KVJA 3VGGA 2H8XA 2A3LA 1IZCA 1GORA 4AZ6A 1H60A 2XFYA 4Y8EA 4GABA 4XAZA 4IIFA 4MVAA 3GAYA 2WNWA 1XBZA 2WB5A 4E8DA 5CSYA 2JIWA 1XKJA 2MNRA 3K46A 1C9WA 1NDWA 1M7JA 1W9VA 5BZAA 1XRTA 1QXLA 5BOOA 2E1DA 1K8YA 1XRSA 4JTEA 4C6LA 4JFUA 3PAJA 3TP4A 3ZQ9A 4LUSB 4C5ZA 1H5VA 5LGXA 3T8QA 3HURA 2TPSA 2X0YA 5G4HC 2JKAA 2ZZ1A 4XTDA 1V6UA 3R25A 4LYPA 4MY8A 2B81A 4ZTYA 4JX4A 4GIYA 2CLFA 5HWMA 2V2DA 5LNVA 2NX9A 4HQVA 2DUZA 1US2A 3O6DA 3GYCA 1F4HA 4H9ZA 2WNNA 3SY1A 1ENUA 4NZFA 1SSGA 3FW6A 1DWJM 3EKZA 3Q94A 5IFTA 2YLLA 3M0LA 1QR7A 3W76A 3POCA 3W1TA 1XV8A 3LBMA 1J12A 3LY0A 2RUSA 4RZ5A 1J11A 4XK2A 2WVTA 2VD8A 3DFNA 4Q8WA 4ADUA 1R9YA 2PGFA 4XZNX 4UZUA 1MW3A 3CYVA 4DJEC 3QMRA 2DH3A 3FHQA 5DEZA 3IJ7A 3EEGA 1JZ6A 4DJDD 3WJZA 1QVBA 3GRIA 3DFOA 4S3DA 4BA0A 2AQWA 3LV5A 3FJ4A 1GK8A 2E6AA 3QTPA 1J9YA 2J9ZA 5FOOA 3BC9A 3CHCA 3UA3A 3RU8X 3VDCA 1MXSA 2INEA 2GFTA 2I9EA 2A79A 3COTA 4NI3A 2NUYA 2GSHA 1AMKA 1TVPA 4GZJA 3WJWA 1UOKA 2CC0A 4PEEA 4AIOA 3W00A 1Y0EA 2GWNA 4KH2A 1VP5A 1J79A 3N12A 3EB4A 4FX6M 1JXKA 2PLCA 4P8WA 3WMCA 1ZP4A 1K8CA 1TVLA 2J27A 1OGBA 2VC6A 4PMZA 4YS1A 1R2RA 3BOLA 4GXWA 2CXGA 2P76A 4EPKA 1EO7A 4LSBA 2ZX8A 4GE8A 3LHYA 1PS9A 3DDMA 5CH9A 3WUGA 2AOSA 1KTCA 5HR6A 4PFHA 3CHEA 3W7HA 1IQ8A 4H8NA 2VZSA 3KWXA 1R3QA 1HKJA 3AISA 5FI8A 1OK6A 4O17A 1OK4A 1XYZA 5DRCA 1VBRA 5BWAA 3AFBA 5AHEA 2PTZA 2VUYA 5HJYA 3N9RA 1NWRA 1ZCOA 3CV6A 5DY3A 2BG5A 2FTWA 4GFIA 1NDYA 1N55A 3U7BA 4NAFB 1FUYA 2POTA 5M2FX 1XLGA 1S46A 4JIIX 1RHCA 5JBEA 1UJQA 4JS3A 3HPFA 3M46A 2BP1A 3K8LA 2A0NA 2V8ZA 3CUJA 2ONEA 1XIFA 3IGXA 5KZMA 2J13A 3CMGA 4S3AA 4CN1A 4C6MA 5HWNA 5A6AA 1IR1A 4M56A 1VFHA 1LLWA 4UQDA 2C15A 4ZB0A 1NFBA 5MKGB 2VEIA 3WJYA 3P84A 2OZ3A 4ACZA 3FFSA 2Z27A 4NF7A 2XFWA 3VZZA 2V9DA 3CHDA 3RN6A 3GFYA 3NSXA 3R8RA 4S39A 2BY1A 4UTWC 1XPYA 2EG6A 2FH6A 2OT1A 3W1QA 1FWHC 3PTQA 3TQ0A 2UY2A 1HL8A 1XP3A 4C6FA 1W17A 2PGRA 3UCDA 4EXAA 2PRHA 1CW2A 3QY8A 3CK5A 1T6MA 1HTIA 1TZZA 4DWDA 4ERAA 4HK7A 3AZRA 2E0PA 3G0SA 5I3IA 1L6FA 4AMAA 4D6CA 3AHVA 2I16A 1U5VA 4OWGA 4MF4A 4GISA 2EPMX 5D33A 2YL9A 1YRRA 3ZLHA 3H7RA 2HRWA 3TWAA 1H5YA 5SWUA 3QPEA 1MUWA 2FHFA 1CB2A 2PAJA 3EA1A 2J25A 3B04A 2VEMA 2G50A 2GGJA 1ONWA 1BF6A 4R34A 1ZSXA 5D2VA 1PIFA 3L7RA 3CASA 4FXSA 1V0NA 3S42A 2VENA 3EDKA 3TV8A 1ICQA 2VFEA 1VCGA 5HJXA 1JF6A 1IWBA 3VZYA 4PBFA 2QGYA 1U1HA 4CU6A 1XJBA 1NH6A 2ZUMA 4WR3A 5FL0A 3TJ4A 3QGAC 2E9BA 2ICSA 3EZ4A 1F7BA 3CH0A 2FLIA 2GQ9A 2YFOA 1J0IA 1OCQA 1UMYA 5I03A 3W1LA 4FZIA 2DQWA 4RX0A 1LOLA 3PUOA 4I5UA 3OGVA 4DUWA 2Q01A 4HPNA 2ZUNA 5TNVA 3LOTA 3GH4A 5LA0A 5BW6A 3QQ0A 2EG8A 4HSOA 4QG8A 1KC7A 4Q4OA 2VWSA 4PMXA 1R2TA 4EF8A 1CPUA 3MJMA 3TAOA 3KRZA 3DFSA 3MZ2A 3E49A 4BF9A 4TTUA 3V5CA 5F2LA 3NAVA 3EOLA 2CBJA 1XSKA 2IUZA 5CAHA 4JQAA 2YIHA 4XO7A 1NELA 1W1IE 3SDOA 4HCHA 3NQ6A 1XX1A 1NVMA 3SCOA 3HFTA 2QVHA 5HBFA 1UUQA 3T0BA 2V2CA 3NNTA 1KM5A 1W1A1 1J0HA 4ORMA 4ILSA 1IEVA 4NASA 3C3UA 2CETA 1US0A 3V75A 3BCDA 3C8NA 4D71A 1WZLA 3PPHA 1HL2A 1FY6A 4LB4A 1BWLA 1XDMA 3OJGA 3WUBA 1KKRA 3KVKA 3F4NA 5DQPA 1JZ8A 5I0DA 5E0CA 1DIKA 2CXEA 1E9YB 3KOWA 2R8WA 1F6YA 2WHLA 1CNVA 4MFDA 1JGMA 1EC8A 4MB4A 4NYYA 4KCTA 3F4WA 5GQBA 3F4VA 2Z6IA 1EJ7L 3S6OA 3I68A 1A0DA 3ARRA 1LWHA 3QGKC 1XIIA 3N1AA 1T8XA 4F0MA 2WBKA 3MV11 2XM1A 1XC6A 1R86A 1WKFA 2IXVA 1ZALA 2R1NA 4ZFCA 1VYPX 4TVCA 4R7OA 4O57A 1P43A 3AMDA 3HN3A 3C56A 4IMDA 3PBUA 3LCFA 2UBPC 3LMZA 4DEFA 5C9UA 3G1VA 1ZAIA 3OIHA 3PPFA 3VDHA 2YDQA 1UR1A 4CEXC 4FNUA 1FP8A 3W22A 1OYBA 3WJSA 3MHUA 2VEFA 1L6SA 1ZLPA 3RDKA 1HN1A 4LF1A 5BYWA 1L2UA 1BTMA 4R33A 2GPTA 1C8VA 4A35A 4PTWA 5IFPA 1KD0A 3MO4A 3EWWA 4EWND 3WKZA 1IXNA 2Y7EA 2QF7A 1TPB1 3W75A 1R3WA 2XH7A 3BGAA 3UCQA 4UNIA 2VR5A 4LUJA 6TAAA 4Q4QA 4HBKA 1CLVA 3O05A 1JNEA 1R2SA 1X6UA 3IIVA 2WYSA 3GVVA 1W5QA 4A3YA 3TMQA 3L2LA 3MCOA 4NX5A 1GZGA 3WBEA 4U5IA 3NQVA 2C0HA 1TCDA 2PLMA 3VYLA 1OINA 2J8FA 2WPGA 3IJIA 2VCAA 4B4HA 3KEHA 1NOWA 1QK0A 5C9ZA 5GNXA 3HZ3A 4NHVA 2PCEA 3T05A 4JTDA 4ZFMA 4H9XA 3TROA 4ZOBA 4IQDA 3FN9A 3SM0A 3CBWA 1YXDA 5EU9A 3IVUA 1N7KA 3SQMA 1DEDA 3CHFA 3R1ZA 3VIMA 3M0MA 5H8UA 1GONA 4AVOA 1H1NA 2CLHA 5D32A 3KRBA 3GTNA 1UWUA 2H9AA 3S2JA 1BGAA 3TTSA 3BLLA 3GR7A 1XLIA 4UFMA 1OSEA 2D22A 2FGBA 4D6HA 4MKVA 4J40A 3USBA 3AIWA 4MKSA 3E2RA 2NQHA 3XINA 3NGJA 2HSAA 3L0NA 3A4AA 3V36A 1PBGA 2E8YA 2Z6JA 1UROA 2WSKA 3BOXA 3W7IA 4EACA 4LUSA 4EK7A 1F07A 5BCAA 4CQBA 4ZL1A 3M7SA 4KFPA 2OWWA 2XZ9A 4KF1A 4ZGYA 2YDSA 2I9UA 4QJ1A 5EMMA 3MP5A 1H49A 4HMDA 1O66A 4H6KA 1SW3A 3GFXA 1KR1A 3TONA 5L6UA 5FIPA 3OLGA 3SCSA 3GWQA 4H2HA 3DGRA 4CNUA 3AIRA 1FWIC 4W8LA 4DO7A 4L1XA 3EWXA 2AMGA 3EEZA 3QV6A 2BXZA 5HMDA 4AHQA 4FP1A 5I23A 4HN8A 4ZBCA 5A6SA 3F2BA 3UVIA 2VTFA 1I2OA 2ZUTA 1PO9A 2PDHA 1K77A 3ANYA 4S1FA 3GKAA 5ABFA 1H0IA 1KCXA 4C6NA 2OG9A 3UZZA 1V03A 1OM0A 5D2WA 1TPUA 2NWSA 3VOGA 5I24A 4O12A 3IANA 1Q6DA 5HATA 3MMWA 4LF2A 2BS9A 3AIQA 2FDMA 2WQDA 1TV4A 3QV9A 4QCFA 4IH3A 1VH7A 4PUWA 4IUOA 2PCQA 3M0KA 4MLRA 1TV2A 3SCPA 1N82A 1K7XA 2VOTA 1VAHA 1L8PA 1CX9A 4CD4A 2ZZ4A 1VEMA 3HGSA 4S3CA 3WQFA 3CO4A 2QCHA 1OD8A 1VF8A 3HG5A 1J0YA 4AAJA 4GQRA 2E67A 3I6TA 1YHTA 4Q8VA 4ZXOA 4PTNA 3OBEA 3CUXA 4QBXA 4HZ6A 2HBXA 1QWKA 1XRVA 1V51A 4HJFA 4WDTA 4Z1AA 1W0MA 3MUCA 4N0RA 3AS0A 2QIWA 4QDWA 4UMBA 1FKWA 2EEXA 4N4QA 4M1RA 2OOFA 1O5XA 1CGVA 2QF8A 1ALDA 1CGYA 3PM6A 4ZEPA 4ZOAA 1OG6A 4UTWA 1KRBC 4L4OA 5DY2A 1YDNA 4DZ5A 1PAMA 1FDZA 3ABQA 4UFIA 3TXZA 1Q3NA 4ZENA 1RPKA 1CIUA 3SRHA 4TTGA 4FAMA 3D6NA 1UD4A 3PY2A 4IX0A 4H9MA 3S8HA 4IMFA 2PDJA 4LUTB 3FGCB 3TEVA 4KKXA 3SGUA 1E9LA 1HJXA 3FIGA 4AY1A 4PMNA 2WZTA 2A6NA 1NDZA 1EIBA 3W1AA 5D2YA 3LN3A 3G77A 5AHMA 3LRLA 2BHYA 3BANA 5E9XA 4XZWA 1PCWA 1DV7A 1ME8A 5A69A 3C0SA 5ABHA 1W3TA 2V63A 3HPAA 2PGWA 3TN4A 4B5WA 4G2DA 1OQFA 3LHWA 4A8LA 3GDKA 1XLFA 3G1DA 1AZ1A 1ITQA 1PZ3A 4FOUA 2XUCA 1R3RA 1ZJBA 1SYTA 3N14A 4AZCB 3WNKA 2IPWA 1R5YA 5CPLA 1FBAA 4DJFD 1IEWA 1NJJA 2HE8A 4C6QA 4KFNA 3VIIA 3RLVA 5CPNA 5D05A 3SJNA 1FWWA 2YSWA 2GZXA 4R85A 4JQ2A 1FWEC 2W91A 5BRPA 4J3ZA 2V5KA 1FWTA 4Q8MA 1WZKA 3AIBA 1CWYA 5B7ZA 4DELA 4P7NA 3TNOA 5AVHA 1ZJIA 2JK2A 3G8EA 4LAKA 1HJQA 2DVTA 3WBWA 4IFKA 3GW3A 1JUKA 4LGXA 2E6FA 4ML9A 3V0TA 4L6DA 3D47A 3CPGA 1BRLB 4M3PA 1O7AA 2QAFA 1RCXB 3WD0A 2AL2B 3M1ZA 1KM3A 3N13A 1XINA 1GYMA 2QEZA 1ZNNA 2VD9A 4NX0A 5BRBA 2WM1A 3VIHA 4WVXA 3VD5A 2VGGA 2ZYFA 3S1WA 2YLAA 2Z28A 5G1YA 3W7KA 3WK1A 3ES7A 2HCVA 3GG0A 4PUUA 3JU2A 2E8ZA 3A4WA 2X1SA 2PGEA 3KOXA 4N2YA 2Z2UA 3E2SA 4FLRA 1OC7A 4PC8A 4IMCA 3RPTA 1BFNA 2ZZ5A 3U48A 3LGDA 1OYCA 4GIAA 1XLHA 4R9XA 4UQEA 1HT6A 3TA9A 3L4XA 1PTGA 1IIGA 4D6JA 4B5NA 5LIYX 1XLBA 5H1WA 3BL3A 1G4TA 3BW4A 3PJWA 4LCRA 2ZWYA 4H6RA 1A5SA 3NDYA 4XSMA 2A21A 1JPKA 1EEXA 1Q4NX 4GK8A 4MZ8A 3RPMA 2UY3A 5G4EA 2WVVA 2HISA 1XLAA 1O68A 1Q5MA 4K7YA 3W2KA 1XW8A 2ZADA 1VBJA 2DJXA 2YBVA 5FEZA 2Z24A 2Q8ZA 3C2YA 3LSCA 4Q8NA 4POCA 4CVUA 4AC1X 4GIEA 5HQMA 2OQYA 2TODA 2R91A 1KGWA 1YADA 4BS0A 3BAXA 2WOQA 3GC4A 3O06A 3TLQA 1GOMA 3CUHA 3TYBA 3U5YA 3UWQA 4JN8A 4KMQA 4NSBA 2ZXBA 4IG2A 2QDGA 2P10A 3O63A 3B9NA 3LU2A 3GC2A 1SO3A 3GVQA 3P3BA 1J5SA 4AB4A 5FJIA 3ARWA 1OZQA 2GVJA 4MJ4A 2YCJA 2XPKA 3CXOA 3IEBA 3QTGA 4B91A 4DBWA 1TQXA 5H8PA 1UH3A 3QSTA 2XWDA 4H83A 4AD2A 2G97A 5FF0A 4C1KA 2ZC8A 1B0IA 1QI5A 1PYMA 3EWDA 7REQA 2ZX7A 1TWDA 3ALGA 4YVXA 1TV7A 2XFFA 1ECEA 2A1YA 2TYSA 3E0IA 1QW8A 1A49A 5D03A 2WJDA 8RUCA 1AH3A 2J7HA 3QYSA 5C5YA 5MKGA 3H2AA 1I45A 3ARSA 4Q6XA 1FDYA 3MSDA 3NIYA 4ZSTA 4GGHA 1C7TA 4ZODA 3GTIA 2GUYA 1KV5A 2VM8A 3P81A 4V1XA 2ZE3A 4LV4A 4LWWA 2PDUA 4MWAC 3L4YA 1EP1A 2PWUA 3SB0A 4JTSA 4KS0A 3TCEA 1CLKA 3ZXWA 1AUSL 2XSXA 4W7WA 5JMUA 1S2WA 1KW1A 2IW0A 3PC0A 4F66A 1Z8AA 3WNOA 2Z1SA 1KRMA 2EBNA 2PF8A 2VKZG 3UG3A 4BFAA 1DIDA 2WZEA 4H8HA 3LCWA 2OZ8A 1M7XA 1BD0A 5KETA 2VFDA 1K9TA 1Q63A 3QH2A 4FALA 1QHPA 3TN6A 3ANUA 3OQ8A 3WIJA 1XGEA 2A3HA 4S3GA 1VFUA 4DF2A 3W25A 3TYZA 3AYRA 3SFKA 3T55A 2HK0A 4N6FA 1XLDA 1PUDA 1YTEA 3SRFA 4LVFA 1XYAA 3LD5A 2HXUA 1H62A 1Y65A 4MNJA 1E6XM 2PP1A 1F3WA 2ZZ6A 3W02A 1YNQA 1AVAA 1TV5A 1REQB 3EWYA 2R6OA 3NOEA 3L4VA 3LZ3A 4QLKA 1OB0A 2H6RA 3FOKA 2X8RA 5M17A 3VMOA 4OBRA 3W7MA 3DFYA 4XIMA 1KFWA 2XGZA 5HQEA 1EA9C 1JRCA 1DJGA 3C2FA 4F79A 3NQMA 3KM8A 4YLWA 3GU2A 3B8SA 2ZDSA 3PWAA 1MYRA 1ODZA 2XH2A 1BYAA 2D24A 3W74A 2Z7GA 1K70A 1ZCCA 2DZVA 2X0SA 3OVGA 2VDGA 3VGHA 4L9YA 4TR9A 5I09A 4Q4KA 3C8FA 4YYFA 4LS0A 4ZO7A 3S1VA 1Q6OA 5C2GA 4H6QA 3PAOA 4IWWA 2QYGA 2CNCA 4F0LA 4UTKA 1WA3A 3AXMA 5AOUA 1W1TA 3B8WA 2KZHA 4YJ5A 2RKXA 3WJXA 2DW7A 1DIOA 1R87A 2PDQA 2CLOA 4AVFA 1OFDA 1CDGA 5B7YA 1DOSA 3GM8A 4DUXA 3GDTA 3RM9A 1EJSC 1LRNA 1FX6A 5C6MA 3WNNA 4XD5A 4LYRA 3PFMA 2VGIA 3WBXA 2CZFA 9CGTA 1UP2A 3ECQA 4DUVA 1NF0A 1Q2RA 4ZB2A 4AEFA 4A22A 2HWGA 3HGRA 5T8GA 3W7JA 1DQWA 2C13A 2OZ0A 1OZMA 3QPZA 1MMFA 4U31A 3W72A 1KFJA 1IIHA 4GY0A 3VNZA 3HMJG 1RBAA 3OP2A 1XLJA 3U2CA 1XISA 3VNJA 4E0CA 3FHAA 4DPQA 4Y9AA 4DWSC 4R9OA 2QCCA 1S2VA 2ZUVA 2Y7GA 4IGMA 5FF2A 1PVNA 3VZXA 2FPVA 3GQYA 1NF7A 4RE0A 3TZFA 1DYSA 1GTHA 4ZB5A 1HL9A 3OLIA 3T8LA 2PE4A 4JNMA 4NG3A 3I4KA 1TPEA 1QI2A 1QCWA 1O5RA 4BJHA 3KBVA 3L4ZA 3UEQA 4HSNA 2GK1A 1IV8A 4A2RA 5XINA 4DBDA 1BG9A 3NL5A 3SN1A 2WMJA 2DT0A 1RP8A 4BQ4A 1ZUAX 1XH0A 3REQB 4B2DA 3IVSA 5CGMA 3ABSA 5M1TA 4LT9A 1WKEA 1W3JA 4OHQA 3W1UA 3GB6A 1O94A 1VCVA 4RDVA 2YOCA 4Q4PA 2CLEA 4WOZA 1KO0A 3ERPA 3VAVA 3H2CA 3S5NA 2E28A 3CT2A 2NXIA 4CNNA 3RM4A 2HNEA 2BB0A 3EWZA 1DHPA 1TE6A 1XH1A 1X7FA 5MF5A 4O54A 4Q7NA 2RDXA 1FCVA 1GKQA 3R11A 4B5VA 4B3KA 1D8WA 3W7PA 4IGSA 1QPNA 1C92A 1N8IA 5AC8A 3P5YA 4M8UA 3ZR4A 3R79A 3IJLA 2MANA 3TUUA 3KVMA 4E4PA 2FPTA 4CKQA 4XTIA 1NEYA 2ALDA 4LALA 4IJCA 4MZ1A 1RBLA 4QR6A 1VHCA 1S2TA 1TE1A 3T4CA 1JCTA 4ONVA 4I7WA 2PWFA 3UZYA 3KBMA 2F8QA 1LRTA 2OWXA 2YCEA 3C2RA 3K30A 4B16A 3CB3A 3M4HA 4A8IA 4UFHA 4WGHA 5LXXA 2QLYA 4RZ4A 5KTLA 4NVTA 1OX5A 3WNMA 2OOGA 3GR4A 2JKPA 4GQQA 3GC5A 4NIRA 3EPMA 3ZJ8A 3RX2A 3TYAA 1AL8A 3GG1A 3OGSA 1U30A 1EOKA 2VRQA 2C19A 1LOSA 4PL1A 3UESA 3SCQA 3FK4A 3RLGA 4DUOA 2DZXA 1ME7A 3BG9A 3R0KA 4I9AA 2YW4A 4KWVA 1WP6A 3B0PA 3DG6A 4O14A 4CUCA 4ICNA 1XHGA 5DT5A 3WYZA 3GXIA 3CUZA 2ZX5A 1FCQA 3U2ZA 4HK5A 2WLYA 2FZBA 3TLLA 2Y8UA 3FYPA 4G6CA 3CYJA 2XDFA 4HU4A 1S2CA 1C29A 4GY7A 2Y63A 1AJZA 3N6HA 1J6PA 3FAXA 5U7SA 4RNFA 5LNRA 5C70A 1W9BM 4R7WA 5EMKA 3W26A 4KETA 1F05A 1FWDC 5A6TC 1OFEA 5JUVA 3NQDA 1G7VA 1FWSA 3SR7A 5DLCA 1GOQA 3FJLA 2P8CA 4J4KA 7XIMA 1CB7B 4ROPA 4W93A 1WAUA 1I2QA 1CGXA 3TOYA 1QPKA 1S5TA 4DJEA 3CB8A 3QOKA 2Z1WA 4GVHA 1TUFA 1B4KA 3G5EA 3TWBA 3GHTA 5T9CE 1A3XA 4YTUA 2J7GA 1W1B1 1MFUA 4JTAA 1P0KA 3A4JA 1POJA 4AIUA 4JAWA 2RAGA 3RUBL 1XIJA 4DJFA 3G3DA 2QXWA 3VKBA 3TYEA 4NI8A 4I6KA 1R3TA 2G3NA 3HG3A 2EPLX 2FVLA 2WMGA 3FXYA 1O1HA 5A6BA 4H7VA 4A2SA 3HJEA 4XO6A 2Y1HA 3IJQA 4U5KA 4E8GA 1QRQA 4AMCA 4NXSA 4EXBA 4LS2A 3ELFA 4QG9A 5A6KA 2QCFA 5GJNA 3F2DA 4N9EA 1A53A 4PCFA 1WB0A 1RJRA 4YYCA 2I57A 2P88A 5XIMA 1TR1A 2ZVIA 2DDXA 7ODCA 5D8ZA 5IRPA 3TYUA 2X41A 3VIJA 4FLSA 3BGJA 4JICA 1QWGA 5AYYA 3ATYA 1O60A 1GHSA 3ABZA 4BEUA 2WZMA 1HQTA 1GOXA 2AL2A 2HS8A 3RNDA 2AQOA 1HXJA 1KQYA 1P0BA 4TOQA 1HGWA 1JNDA 1E4IA 1HKMA 4IJRA 1E71M 3KDOA 3IAPA 4V2XA 5BXPA 1GZJA 2P3EA 3BSGA 2WZIA 1SW0A 2PB1A 5DANA 1H7PA 4B3ZA 4R3UA 3L68A 2GJRA 4US5D 4UNLA 3TK7A 1M6JA 3VIGA 4LPCA 1XH2A 3V7PA 1Q45A 4GBDA 3OQEA 5HANA 5D9MA 4HA1A 2E09A 5LIUX 1A5OC 3LI0A 2RDUA 3P2VA 1XUUA 4AX7A 3NQ8A 4ERIA 2OQLA 3ITYA 4LANA 4OZOA 2PWVA 3VGFA 4G7EB 2XHYA 3EWCA 3U4FA 2IPFA 4FX8A 3IWPA 3MI3A 4Z2HA 1HKIA 3V3WA 1H4PA 2X09A 4HU3A 5K9XA 3SGZA 3WDIA 1JZ4A 3FCPA 1WZMA 1FKXA 1N8FA 2C7FA 4CEUC 3NQEA 1W1PA 4D8AA 4XSLA 2DIKA 3WLSA 2DZWA 1KXVA 2QMJA 2ZIDA 1E40A 1TIWA 4D8LA 3R4IA 4QLLA 4MWAE 2ZRVA 2QVNA 5G4WA 3L0GA 3R13A 2IKIA 1C8XA 2XIJA 3TAKA 5LA2A 1A4MA 3I3DA 4K2SA 1LL7A 4S3FA 5J5RA 3W1NA 1TREA 1REQA 2QULA 1LT8A 1TCMA 4G1NA 3NXLA 3VILA 2WW5A 1QO5A 1TPDA 5E0KA 1ICSA 4UCFA 4MFEA 4XV0A 4TV5A 3LTYA 4O16A 3WLJA 2J7BA 4UMCA 5T26A 1ISYA 3EX6A 3ZS4A 3A12A 1H50A 1DXEA 3H4WA 3UWYA 5BRQA 4JTFA 3BG3A 3UF9A 3F5JA 3S1GA 3EWBX 4Z2JA 2QS8A 1F74A 4Z1CA 1UQYA 4W87A 1GT8A 1B3WA 4JHZA 4PB3A 2B31A 3H7UA 2QHAA 1E1CB 4Z17A 1BPLB 3W1PA 2C1GA 1CENA 3N2TA 6REQA 2Q02A 2P3ZA 1UKOA 4B5UA 5DCEA 2ZRYA 1XQLA 2W67A 4I90A 1FVPA 4N02A 1XFCA 1TX0A 5CKSA 1EJWC 1UWQA 1D7FA 2VEPA 2G4JA 1XFBA 2X40A 4W9TA 2QW5A 3KW3A 4QE1A 3BLOA 1EL3A 3E96A 3DHUA 4C1NA 4E6MA 1UUMA 4J7RA 4UR8A 5BU6A 3AZTA 2CZVA 4D9PA 1XLEA 3QR3A 3QKEA 1YTKA 2Z1KA 3GNNA 2NQ5A 5JU6A 2QCDA 3BLDA 2CW6A 1QNRA 1I2PA 1ITXA 4JYEA 4L6OA 4PUEA 3CWHA 1VBUA 3LHUA 5BROA 5JBDA 6TIMA 3SY5A 3DG7A 4QNEA 1R85A 4V33A 5E5CA 2XN1A 3GHUA 3QHMA 1Q8AA 3SSJA 5LNSA 1AW1A 2V3GA 4CNTA 4RV8A 2P0IA 1B9BA 3WK0A 4HB7A 1D7KA 3C2VA 3WK2A 5I79A 4CNSA 2ZZ2A 3Q2DA 6A3HA 4JTKA 4KEZA 3GKFA 4ZXLA 3ZVHB 1XSJA 4TVDA 2VUNA 1V77A 1JYXA 1E6NA 2Q8LA 1MUMA 5H2ZA 4HGXA 1Z32X 2QKFA 1KCKA 3LUTA 3PNUA 1P1MA 4PMRA 2WC3A 1GW1A 3I6RA 3STFA 3UG5A 1C90A 1VGAA 5D09A 1UG6A 1A0EA 3I65A 2CLMA 4MUZA 1XCFA 3IIXA 3C61A 3PN8A 1K9FA 3M5YA 2RHGA 3SRDA 1LLOA 2CKSA 2H9AB 3HQNA 3W7QA 5ABTA 1FP9A 4HP5A 3MSYA 3ALFA 3O3RA 4G9PA 4GYJA 5T91A 1Z48A 4D6GA 1U22A 2PDKA 2XFRA 3LCIA 1EJRC 1D3CA 3QZEA 4OQVA 1OFBA 5F7UA 2EPNA 1KCLA 4K1GA 4Q3MA 3PWGA 4GRSA 1YPXA 2J4GA 4EAYA 5I00A 3KAOA 1DBTA 4AH7A 3SZ8A 5AHNA 3M47A 2ZBTA 4IP7A 7TIMA 3IV3A 1RQBA 1XD0A 4LW7A 4MB3A 3D0CA 4JIRA 5H8MA 5FJTA 4J35A 3LRKA 2E6YA 1KLZA 3QF0A 1B3YA 3DFHA 3VC5A 3CTLA 3WNLA 2RDTA 4O8AA 3A9BA 3O7UA 3TE9A 2F84A 2HE5A 1RK5A 2DVUA 1HX0A 1UHVA 1PX3A 3UY8A 1BF2A 1RALA 3TTYA 2HDJA 4GLEA 3EMQA 4Y6GA 5CGTA 1OABA 1CXEA 2WHKA 3SUWA 1BXBA 3MUIA 1TTPA 4KWUA 1XYFA 1ZZMA 3RF9A 2XG9A 4TV6A 1Q8JA 3QN3A 2OSXA 4P7OA 2GJXB 3PVFA 3UR5A 4QISA 3GXMA 1J8VA 1BEUA 1LORA 2NX3A 1VFLA 2P8BA 1KWKA 2XYLA 3B8VA 4HNCA 3QPYA 4FF7A 1DJIA 4KEMA 5BOFA 1H11A 4UWMA 1RAKA 1UP3A 1UP0A 4GOAA 1GOIA 3PUDA 1CGWA 1M04A 3RAOA 1MO0A 4HHHA 3IAQA 4GGBA 4F0HA 3B0UX 2C71A 1XCXA 1Q6FA 4K38A 3GFZA 3OEXA 1PIGA 2EKGA 5CBBA 4Y9PA 1PTAA 2YYUA 5AY7A 1FH8A 3KTXA 2DFAA 3VNLA 3N19B 4AISA 3PR2A 2D0HA 2OB3A 2ZX6A 3VDBA 2FZ9A 1CI1A 1W2VA 1W54A 1E6RA 3LXCA 2FJUB 4JBRA 3W1RA 5FA5A 4M6PA 4GACA 1A3HA 3GXDA 1H1YA 5CPTA 4I9TA 1QI4A 5AVNA 3RIKA 2WCGA 3G1XA 3AOFA 3LM7A 4MYAA 1C7SA 3BQ5A 1W56A 5G2WA 5I02A 3B06A 3WENA 1FWNA 4V28A 4CQAA 3EB2A 4E2VA 1K3UA 2VL4A 3LCLA 3MBFA 4BF5A 3OO2A 2V5JA 2J8GA 3HO8A 4KIEA 4I9JA 3GZAA 3W7OA 1VIZA 1JAEA 4JKKA 1Z41A 1IXQA 3IGSA 3OZMA 4Z1BA 3QVQA 1PCKA 3H2EA 3T0DA 1YDVA 3P61A 2Z0IA 2ATSA 1F6KA 3MS8A 2X05A 3PJUA 1UWIA 3AAMA 4BWLC 2NXGA 3OZOA 3PANA 3BICA 1NFPA 2P53A 4EVZA 2DH2A 1WYIA 3PPCA 1WDWA 2YXOA 3HPZA 3U2OA 3VUPA 1RQHA 3LHTA 3HGOA 2ACRA 1P4CA 4Z1YA 2YYTA 4QHRA 7ENLA 2XVPA 1JZ5A 1XL9A 3BUVA 4QQ3A 1C3FA 2JE8A 5JH2A 1M41A 3WD3A 2QGHA 4JNYA 3S5SA 1PX8A 5H91A 1ZQ5A 4CQCA 4A4AA 3L66A 4ICMA 5LSMA 4BQ2A 1R7AA 2ZKMX 3VE7A 2YZ5A 3P82A 3GDBA 3S1XA 4A29A 3CZGA 2WO5A 3QW4B 3C5QA 1ZBWA 3S2LA 2QCLA 3TSBA 3QHNA 3GU9A 1JYNA 2PD9A 2Z2AA 4O13A 4AQLA 3VCNA 2DU2A 1KCZA 3BAYA 1GTEA 4L6HA 4GUHA 5A95A 3OG2A 3AIUA 4HCLA 1XG3A 3CH9A 4UNKA 3V1HA 1G94A 3CO8A 1LRQA 3M44A 3ITXA 4PCPA 3JRKA 1QAPA 3RM8A 1OIFA 4UXDA 3MYPA 2Z7KA 3WDQA 3IS4A 5FSDC 2J74A 4QGCA 1GEHA 3ZLGA 3MWAA 1JL8A 3UA4A 1I6NA 2YB4A 4LAOA 1TB3A 1VCFA 1KWGA 2BBFA 4GC4A 5TIMA 5FEWA 2NV2A 4GVIA 4LQ1A 4GD0A 2DUAA 1RUSA 4XBKA 3ID7A 4Z42C 2FVKA 3MQTA 3QR1A 3NQGA 5AYXA 5DELA 1PHWA 3EMZA 3VOFA 4BZYA 3W0KA 1ZL1A 3E0FA 4JHOA 4EWJA 3FAWA 3DERA 2PC4A 4JYDA 2Z1VA 3UXAA 4TIMA 3W7DA 2XIBA 4JEQA 4B4FA 2P5NA 4IISA 3D5HA 1EPVA 3A13A 5EMYA 1NFGA 4JQ3A 2BY3A 3BDKA 2HPIA 5EMLA 3DU0A 5ECVA 1J93A 5ECUA 4F4RA 5FJRA 4Q7IA 1M53A 3ARVA 3A47A 2ZC1A 5HQLA 2FZDA 3NM1A 1GPWA 3TQVA 3N29A 2J6XA 3WNPA 3AU2A 1UD8A 1DE6A 3B03A 4GX9A 4MWAB 2R1MA 3SUTA 1BSIA 1GG1A 3GZ3A 4PUKA 4MUPA 1BWKA 3RMJA 4H9UA 4LJ3A 4AEEA 4QE4A 4AD3A 2ZA1A 3CZKA 1OT2A 1I75A 3WMLA 1QOPA 3C3NA 2B7NA 1W5PA 3APGA 3QKZA 4MWAA 5EBAA 5AHFA 3FX4A 1BYCA 1ZGDA 1A5LC 2ZA3A 3AHYA 4TO8A 4JEJA 3IVTA 1J5TA 3HG4A 1DXFA 1A5AA 5G2HA 3DEQA 4FK9A 1MNSA 2RJGA 5AB3A 2ZCGA 3QBUA 3AHZA 4B2DD 1KTNA 4AD5A 1LWIA 3DESA 4GJJA 4XAYA 3QHOA 2TRSA 4F9JA 2XM2A 3W83A 4PBEA 5HOSA 1I0BA 3N2OA 4H7CA 1Y5XA 3W2JA 1Z7AA 4LCSA 2QUTA 5DBTA 4MHBA 1TYGA 3VTRA 2CPUA 2IKHA 1KA9F 3SUSA 3H2FA 1C93A 2YDAA 5HUPA 1CGUA 3WQEA 1KRCC 1VPXA 4UQAA 2FGLA 4ZE5A 1PE1A 4A3QA 1L6YA 1QW7A 3CIWA 4JL2A 2PSNA 5A8QA 3LX9A 1PKNA 3N6JA 4CN4A 3LM3A 2CEQA 1OCJA 3CPUA 5A2BA 2VHLA 3R10A 1TRIA 4NNBA 4OJYA 4U2ZA 3A9IA 2ISWA 2VJXA 4P7QA 5CC3A 5REQB 5D30A 1QDSA 3GVRA 3FA4A 3ONBA 4PN2A 3UPWA 3PJTA 2OLAA 3O6AA 4HNNA 2OGYA 1UIPA 5EY5A 1MVYA 4JIPA 5E6YA 2R24A 3CQIA 3R8GA 4C6PA 4EANA 2WMIA 4ZQMA 3ARPA 3TYCA 4RCXA 3SGGA 4WXYA 4UFKA 5AC4A 5CEWA 2F2HA 4DAIA 2EPOA 4PMQA 3LK6A 1OF8A 4L4LA 1H63A 3PPGA 1QNPA 1RJQA 2R9RA 3SUUA 4IJBA 2NQJA 3NEHA 5BXSA 5JIPA 1PIIA 2OU4A 3EXSA 1ZAJA 3KS5A 1E51A 4O10A 4Y7EA 3P8IA 4JTJA 5I7GA 2UWFA 1XIHA 4W85A 9RUBA 3I6EA 2Q6ZA 1TJ2A 4FA3A 1UCWA 1IEQA 1UC4A 7CGTA 4LX4A 1JULA 2J7CA 1TUXA 2VVNA 1UKSA 4C6JA 4RUBA 4XAFA 3K4WA 1YMYA 3NTYA 2P0OA 3PULA 5EPDA 3DHFA 1TFVA 2O9PA 5A94A 3NA8A 3EOEA 1E9ZB 4GVFA 4PMDA 3P6LA 3WQGA 1OX4A 4NY2A 2DY3A 1V3HA 1X1NA 4ALDA 3ZJKA 2WXDM 2XSBA 2WNZA 3LHVA 4PFMA 4ATDA 3M0JA 1JCNA 3KWSA 4CGTA 2BXVA 5GJMA 2E7FA 4A3HA 5HPOA 2BVTA 4KGLA 4HZMA 4XG1A 1GNXA 1QI0A 4XB3A 3AWOA 4J1OA 4H7ZA 3OLDA 5DT7A 1H41A 4U10A 1TMLA 2G3FA 2G3MA 3WO8A 4D72A 2QT3A 3VPLA 1P6WA 4XWUA 4LUYA 1R7OA 3H2OA 6PTDA 3LI1A 1BG4A 1VFOA 1FCUA 4RL3A 3VUSA 3VD7A 1GVIA 2ZRUA 1H7NA 3JZUA 3J7HA 1QOQA 3IK2A 1MRQA 4KQNA 4EPDC 2VVSA 2EXOA 1QOXA 4IPNB 2GGHA 3GXNA 4KESA 4Q33A 4GNVA 4LVDA 3CZ8A 4M0XA 1DPMA 4UOQA 1NTHA 2YPIA 3RXZA 1W5OA 1TQJA 2VRJA 3S9YA 4IG2B 4C5YA 1XDJA 4ADTA 3D3AA 3KBJA 5BMXA 5C7HA 3SCUA 4S23A 6CGTA 3NFUA 2PDBA 4PSRA 1MW2A 3DBPA 3TOPA 1Y5WA 3R5EA 3CZLA 4GH1A 2GLKA 5I07A 1T8QA 1U33A 1G01A 3KCOA 1WDRA 3V0SA 3UZWA 1GCYA 4MNMA 3TC6A 3UXIA 2O55A 3EX2A 2AAAA 4W7VA 2BGQA 3HM7A 3B8UA 4CNOA 1M65A 4HOXA 3GK0A 3V4BA 4NP7A 3OBAA 2BGSA 1EJXC 2PEVA 1AQ0A 4PEKA 2HROA 3SY8A 4HHLA 3MDWA 1JI1A 3H24A 3BOFA 1KM4A 2CHOA 4H00A 1LOQA 4QP0A 2YBUA 2O92A 1E3XA 3T0CA 4C6OA 3GVWA 3DHDA 3EDJA 2QPSA 1VZWA 2OX1A 4XZHA 4X3ZA 1TTQA 1DP0A 3VMPA 3TKFA 2B7QA 1R9XA 2OELA 4NZ5A 1E0VA 2RH9A 3TDFA 2PTYA 3K1DA 4OUEA 4LAZA 2BOFX 1AH0A 1C8YA 2C18A 4BEQA 3VC6A 1JGIA 3EXTA 2FB3A 3N11A 3CQKA 1I2NA 1EGZA 1PX4A 1TA3B 3S2NA 5CSUA 2ODOA 4E4UA 5AYIA 1LL4A 1DTUA 3H23A 3UBPC 3IUDA 4Y9OA 2REQA 1FCBA 1AG1O 4ZMGA 5I06A 4ENLA 1KM1A 4DF1A 5K3VA 3B9EA 4LUTA 3ZO9A 3ZOAA 4HNVA 1YLVA 4L4MA 1VRXA 3GIYA 3CZEA 3RJYA 3VD4A 4DO4A 2Y24A 2OKTA 4W88A 1HP5A 4DO6A 1W8SA 1EDTA 4RNHA 2WWDA 4S38A 2VCBA 1YX1A 3OTRA 3W24A 2QJHA 2YL8A 3LTPA 5C2CA 4GWEA 4W89A 5DCDA 1R3SA 3E0WA 1OCNA 2XVKA 4PULA 3HB9A 2DZPA 4OFCA 3C2EA 4S3JA 1SFSA 1QBBA 4AXNA 1V5XA 1TR9A 1MI3A 2YR1A 2XIMA 1FHDA 1S5VA 3KOFA 4QXIA 2FQIA 1DJXA 2FFCA 4HPXA 3HV8A 4J2PA 3SW6A 3QW3A 2HEJA 2X1RA 3U0HA 2XSAA 4BF7A 5A3HA 4I5RA 4J3XA 5E70A 4UTMA 3C0JA 4QAWA 4DXKA 1V7AA 2OFJA 3EGJA 2PTWA 3UR2A 3VOHA 2ADAA 4CCCA 2WWCA 2PDXA 3HTWA 4H41A 3N18A 3MSRA 1GQIA 3RX3A 3RHGA 1EX1A 3W81A 3V1PA 3L4TA 2GDQA 2J79A 3GY1A 4RE4A 1V02E 2CBIA 1HG3A 2E25A 3M7WA 1HJVA 5HUOA 2VFIA 3BW2A 3WFLA 4M51A 1SJBA 1WUFA 2QMKA 2RGMA 5HNUA 3N04A 2GVEA 1UB3A 2QJIA 2VGFA 2FVMA 3E6EA 1W2PA 4RNJA 3ARXA 1DWIM 3SBFA 5J8LA 4DNMA 4P5UA 2VI0A 1HGYA 4X63A 4K1WA 3A5VA 3S5YA 3RRXA 1JEZA 3MW7A 3EDEA 1UBSA 4G5DA 4D6IA 4GZIA 1UC5A 2VYOA 2WJFA 3EDFA 4LV9A 4AY8A 4KWWA 4WY0F 3R0DA 4R53A 3VIOA 2V69A 3C52A 1BHGA 1H7WA 4UTIA 2GGGA 2GQ3A 4BWLA 3VI2A 2VT0A 3RCYA 3T07A 4GG9A 1J01A 1ECQA 1ITCA 3QV7A 2J24A 1JUEA 1FXQA 5HNRA 1UH4A 2Y88A 1KBKA 1DJQA 3MKCA 4TX9A 4DWSA 4H6EA 1L6GA 3ZSSA 1B4EA 3POHA 4ZCWA 4D6DA 1WO2A 1JVNA 1K02A 4GO9A 2NVDA 5K9CA 5CZKA 1H09A 2INFA 4UQBA 4HJWA 1EDQA 1P0NA 2D23A 2G4FA 1I9CB 3WEOA 1JF5A 1PKYA 3PZIA 4N4PA 1LUCB 1W3IA 3KLKA 3W71A 1S38A 4XD6A 2V5DA 4B9YA 1IT8A 4PL2A 2VEKA 4TX8A 4AWSA 4YL2A 2C14A 4BI7A 5K2ZA 4M7SA 1TWIA 1TJPA 2QJJA 3MUZ1 2I5IA 2CLLA 3MI2A 4AX6A 2D1ZA 2BWGA 2DUXA 3W73A 2VX7A 1LG2A 3VU2A 3SECA 1PZ2A 4MMWA 1T99A 4JTTA 4EPEC 4DJFC 3W37A 3GO2A 1HP4A 4GC3A 3N3TA 1NWTA 3P74A 4WD0A 3B0XA 4UR9A 3Q65A 3MZNA 4DM1A 3G6LA 2XH4A 4JQ1A 4IIDA 3KFTA 1MDRA 3DYMA 2V38A 3ZT6A 3WBAA 3S3GA 4GBUA 3VABA 3PBGA 3QC3A 5G5IA 3A21A 1VLIA 2OKOA 2R1LA 3WLQA 2WQPA 1P0EA 3ABXA 1MQPA 1QU4A 3PWIA 1JPHA 1DTNA 2WAGA 3G1SA 3THAA 1XC4A 4D2JA 4JDBA 4ZO8A 3P80A 1FWRA 3N2CA 2O0TA 2WMHA 2JIEA 3CQHA 1E70M 1MFVA 3M0VA 4NNAA 1QO2A 3KXQA 3R7MA 3QZAA 4I6VA 1AA1B 3SI9A 4NXKA 4FIQA 3QEZA 3QR0A 4GZ7A 4MLJA 4R27A 1QT1A 3S83A 1V08A 1XLLA 4KPLA 4XUYA 4GNJA 1UD5A 2BZNA 2VZUA 3RGTA 1V3MA 2VWTA 4AF0A 5LNWA 3BJSA 4JTQA 5DMYA 1OVDA 3LLDA 4AIBA 1CEOA 4PA8A 2Y7FA 4K8HA 2SFPA 1FH9A 2FDSA 2GUBA 3WLHA 1WCGA 2WANA 1JAKA 4TVUA 4NRRA 3QV8A 1V7YA 3WFAA 4C91A 3M0ZA 3W1MA 3W7GA 1FWAC 2EPHA 1KR0A 1MZRA 3W6MA 2XIOA 4YIWA 1B2YA 1L8NA 3DKLA 4EX4A 1GUVA 1QW9A 1XBXA 2G96A 1SQ7A 4F2UA 1H1ZA 3CWNA 4GY1A 3H2NA 1KXQA 1A5NC 1TPH1 1M5WA 4F40A 2DIEA 4MOZA 4W8BA 3W6YA 2I56A 4WGXA 5CC5A 3T81A 1JFHA 3Q37A 4B90A 1JQXA 3DOPA 3CQ0A 4M7TA 4Y2WA 3WDPP 4RW5A 3R43A 1WQ5A 3RILA 3WH7A 1SM9A 2FZ8A 5I3JA 4JDYA 2GOUA 1KFKA 3CEUA 4J27A 4W5ZA 1RD5A 2I17A 4Q8QA 1OFAA 5DMNA 3ARZA 2FHCA 2YW3A 1RLCL 3VKDA 3CEPA 4S2BA 1XR2A 2Q71A 4RXGA 3S9ZA 2IPJA 3PSWA 4RR4A 4B92A 5T9BG 2EGZA 3B8IA 9XIMA 3FS2A 4N7QA 1JD7A 2VQTA 4O15A 4O52A 2OJPA 4IICA 2BLEA 4AZGA 3MI6A 4P2VA 4HNOA 2VR4A 4QITA 3QOMA 5D37A 1OX6A 1W3KA 4W86A 1LLZA 4AF0B 4FEZA 4IXXA 3VX0A 3VOCA 1FHLA 3I7QA 5AC7A 3WQVA 1GPFA 3CAKA 4FLQA 2CZDA 2YCIX 3DYPA 2UV8G 5A8NA 4NL1A 5DXYA 3GNXA 3MKKA 4LOCA 2XGBA 1FFQA 3WSUA 1FA2A 4FO4A 3M6DA 4XKYA 3TTOA 1JRBA 3C0LA 3THDA 2BMBA 4O8RA 3QC0A 2F6KA 1X96A 3CQJA 2J66A 1MEHA 3UT0A 1M01A 3OZYA 5EMUA 4ZVJA 2XVLA 4C6CA 4BY3A 3O6YX 2V30A 4Q4RA 4LBUA 4IT1A 5HWJA 4XZLX 1LDCA 2GJLA 1VHNA 4HD5A 5CSSA 4O4WA 4TXEA 1YDYA 3BMVA 5EFDA 4KFOA 2QV4A 1MNZA 2R1PA 1E5NA 2XH0A 1U1UA 3BMXA 4Q8OA 5BWFA 4QM1A 3ZWSA 4F2BA 1K9DA 1GOWA 3N6QA 1FTXA 1MSSA 4X9YA 1XG4A 1N8WA 4IHCA 1M1BA 4KCUA 3TFCA 4FSAA 4PRRA 2E77A 3LQGA 3NPWA 3STEA 3NQ7A 1QUMA 4XUGA 1JYVA 4LC6A 4RPQA 3CLWA 2VC7A 1ZB5A 3REQA 1TA3A 1CCWB 3CAVA 5LA1A 4UZSA 3CHVA 5CJ5A 4M6VA 4OV4A 5IOBA 4JFTA 4IPJA 1VJZA 1JJKA 3RU6A 3AUOA 3MCNA 1UIOA 4QEEA 3D46A 4RPPA 2ZTKA 1YKWA 4A3UA 4PTMA 2LLEA 3TSMA 2O9OA 1XYCA 2XWEA 1UPMB 1XYBA 3GW0A 2OO6A 4PMUA 4QNWA 3WELA 2F7FA 5HJLA 3E74A 3WUEA 3CUIA 4FS9A 3KP1A 2G95A 4MNKA 1SW7A 2EJAA 1YBQB 2WC7A 3LQLA 5K4XA 3BLKA 4NJKA 4DYKA 4MSSA 1V3LA 3BPWA 3CJPA 3NPXA 4H19A 2BSLA 1EJUC