4PMOA

Crystal structure of the mycobacterium tuberculosis tat-secreted protein rv2525c, monoclinic crystal form i
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
211
structure length
211
Chain Sequence
NLYFQGGSLGTLLDYAAGVIPASQIRAAGAVGAIRYVSDRRPGGAWMLGKPIQLSEARDLSGNGLKIVSCYQYGKGSTADWLGGASAGVQHARRGSELHAAAGGPTSAPIYASIDDNPSYEQYKNQIVPYLRSWESVIGHQRTGVYANSKTIDWAVNDGLGSYFWQHNWGSPKGYTHPAAHLHQVEIDKRKVGGVGVDVNQILKPQFGQWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Tat-secreted protein Rv2525c
publication title Structural studies suggest a peptidoglycan hydrolase function for the Mycobacterium tuberculosis Tat-secreted protein Rv2525c.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 79
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08924 DUF1906 Domain of unknown function (DUF1906)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pmoA00
1CENA 3WNKA 1B9ZA 2J78A 3IAQA 3QOMA 5D9PA 1SMAA 3AIQA 3SCQA 5IXEA 2WCSA 4V28A 3FY1A 2VX4A 1ISZA 2XIBA 3VPLA 1WKYA 4CU6A 1A3HA 3W38A 1C8YA 2YA2A 1UA7A 1KGWA 3CHEA 4OOUA 1KFWA 1EXPA 3T08A 3WH7A 4OKDA 4JKMA 2VQUA 3AZSA 1E6SM 1TA3B 4CVUA 1ZL1A 1H11A 2MANA 4UOQA 1E70M 2CBJA 1UH2A 1W1VA 1H1NA 3AMGA 1V0MA 4AD0A 4W85A 3RM4A 2WCAA 3VGGA 5BCAA 1CGWA 2BFGA 1PX3A 2J7BA 4D6GA 5A69A 1XCWA 4NI3A 1OIMA 8A3HA 5CLWA 1XYZA 3K4AA 2WPGA 3MMWA 1W9XA 2VX6A 4URIA 3ARTA 5AC4A 3MKKA 5IFPA 1V3IA 1E6NA 2DSWA 4Z2JA 5CXPA 3W81A 2BHYA 3ALFA 1BVZA 4W87A 5CQ1A 3WMBA 2XFRA 3MUZ1 3VDCA 5BWFA 2CNCA 4ZFMA 4CU8A 2CETA 4TXEA 4JHOA 2EPKX 1EIBA 2GFTA 3GNRA 3ZJ6A 2OYMA 1GPFA 1UG6A 3WEMA 1QBAA 1F4HA 1GQJA 1W3KA 3RPMA 4LQ1A 3CLWA 4GQQA 1OSEA 5JIPA 1VBUA 3KL0A 4X0VA 3UG4A 1CXIA 4Y7EA 3U5YA 3KWXA 1JDDA 4UCFA 4TX6A 3RDKA 2B31A 3T2QA 3NUKA 1KWGA 3N17A 3VMPA 1BQCA 1HJWA 1HP4A 2YDQA 1WDRA 1EHAA 3I3DA 2WHKA 1PX4A 5IHSA 5M5DA 5BXSA 3SCWA 1ISWA 1WP6A 3UESA 4BS0A 4ATDA 5E6ZA 2CESA 4KRUA 1TE1A 5D8WA 3HMCA 5TD4A 4V27A 3N04A 3AS1A 2BHUA 1HX0A 2XJ7A 4ACYA 5CSUA 3DHUA 4C7GA 2J7HA 1V3KA 2VQTA 2WXDM 3WUGA 2WM0A 3F4VA 1XD1A 4DUVA 3VTRA 4CGTA 4WIWA 1UZ1A 3SUSA 4JCLA 2WYSA 1QPKA 1OGBA 1H2JA 1K9DA 2EO7A 2XWEA 1BVNP 4UOJA 3WDRA 3THCA 2WW5A 3BLKA 4HMDA 2O9PA 1JDAA 1HVQA 1PPIA 1Z32X 3GH5A 1GONA 3T0AA 1E5JA 5ABHA 3FNDA 5BXPA 4UOZA 4DWSB 1OBAA 1X6NA 4PCSA 1RH9A 3CMJA 3AIWA 4W88A 5DEZA 4AZ5A 2ZUUA 4X9YA 3VMOA 1Y7VA 5HPOA 1OB0A 3VGFA 2D22A 3MV01 1CXFA 4H8UA 2NT1A 1JYWA 4PMUA 4HPHA 3BCFA 3D5HA 2FHFA 3QHOA 2BXZA 1E4IA 3AISA 3VX1A 7TAAA 1EQCA 1TZ7A 3FHAA 5I77A 4PTWA 4RL3A 5ABFB 3PZIA 2VZTA 1OD8A 2YL5A 3IJ8A 3CUFA 3RMEA 1E3ZA 1HKKA 5JBFA 3WBEA 2CBVA 4JFSA 4HA3A 3VGDA 3WUFA 1GCYA 1KCKA 2VL4A 5A2BA 5M03A 3RJXA 4U2YA 4A3HA 1HN1A 1MW1A 2OWWA 4ZXLA 1NOUA 4CU7A 4UR9A 3W27A 1C91A 4GI9A 1HJSA 3QGVA 1V3LA 1B3ZA 2OYKA 1VFUA 5I24A 4UFIA 3UG5A 3SUWA 1CECA 4AZ6A 3AHTA 1CGYA 2PB1A 1UR1A 2WC3A 5A2AA 1K9FA 3GNPA 2BNJA 5A94A 3ZR5A 2D0HA 1YHTA 1FFQA 1Q6GA 3DHPA 2VC9A 4D72A 1BF2A 2XUCA 4AIEA 2XWDA 1UZ4A 3PZGA 4AZCB 4ATWA 3ARYA 3EDKA 4BF7A 3QHNA 1XD0A 3UG3A 1FOBA 3LPOA 1LWJA 2GDVA 2CBIA 3W37A 1XH0A 1JF6A 4PN2A 3N9KA 4WKHA 2YL8A 1NWSA 3AYRA 3L2LA 2GJRA 1EDQA 2VOTA 3WQ5A 4EKJA 1GJWA 2DT2A 4UQDA 2X8RA 2W61A 1AVAA 1HXJA 4UFKA 3VIJA 4FK9A 2AMGA 3BAWA 3K46A 1US3A 2Y2WA 4ZE4A 3OBAA 3WH6A 2EXOA 2W67A 3AMLA 2XYLA 2V3FA 2X0HA 1BYCA 2QF8A 3CMGA 4QLJA 2WBKA 1B3WA 3II1A 1JYNA 2FGLA 1K6AA 4AD2A 4Q7NA 5FL1A 3POCA 2W92A 1JIBA 2YL9A 2WVUA 4ACZB 5EFFA 4TX8A 5E6YA 1M03A 1PZ2A 1UWIA 4H41A 4JZ5A 3AXIA 1P6WA 1VFFA 2RGLA 3VVGA 3WBAA 4K68A 1GOQA 1NP0A 3RJYA 2J7FA 1BHGA 1DWHM 4QP0A 4F79A 2WMIB 2UY2A 3VM5A 1TMQA 2QLYA 4W5UA 3AZRA 2YOCA 3POHA 3EDEA 2VJXA 3L2MA 4A4AA 2CXGA 3WDJA 4U3AA 4MB4A 2BHZA 4TVUA 5CGMA 4PMNA 3WFZA 4PRWA 2VX5A 4MNMA 3WEOA 2V3GA 3ARPA 4D6IA 4D6CA 2WSPA 1XH1A 3VGHA 3F5JA 1PAMA 1J10A 1GHSA 4CD5A 2QPUA 4E8DA 4IUGA 1RP9A 1E1EA 3K8LA 1HVXA 3K4DA 1TG7A 4HMCA 4J3UA 3WF1A 3J7HA 1BLIA 1FH9A 2XPKA 1CPUA 1UR2A 1ESWA 1KB3A 3VKKA 4D71A 3CTTA 4OOZA 2ZUVA 3PTMA 3ZMRA 1CGVA 1QHZA 2E40A 1B0IA 2XM2A 3UCQA 1TVPA 2PF0A 5E09A 2G3JA 4P7QA 2CIPA 4GZJA 1EO7A 2XVLA 3CUHA 6TAAA 4P8WA 3GXMA 4PSPA 1LL7A 1DHKA 1E6QM 3BMVA 1VF8A 3AXHA 3FXYA 1BFNA 1WZMA 1KXHA 4H04A 2J47A 1E6RA 5ABEA 1MQPA 4X0NA 3MSDA 1W91A 4UZUA 2WMFA 5LYRA 4UQAA 3FN9A 2ZX8A 4UFHA 4OJYA 4QCEA 4OBRA 4S3JA 2JF7A 4UTFA 1JYVA 4D6FA 1CGXA 1KWKA 5GPRA 4F8XA 1ZBKA 4LGXA 4YHGA 4P8XA 1V3JA 1HJXA 2D3NA 1M7XA 4M29A 4EANA 3M7SA 2VRQA 1J0ZA 5A6KA 1H4PA 1OWQA 1UH3A 4HTYA 1XRVA 4GQRA 1ZJAA 4KRTA 4C7FA 3M6DA 3OGRA 2NW0A 3AHXA 5CSYA 1CDGA 3BAJA 2CPUA 1JZ5A 3EDFA 5I3DA 4M56A 1DWAM 4W8BA 1GORA 4AY1A 3IJ7A 1Q4NX 5I79A 2A3AA 4GZEA 3VDBA 1E5NA 1C90A 3GBDA 1KR0A 4N0RA 2F2HA 3GXIA 1XHGA 1A47A 2YA0A 5M17A 2FGZA 1GOMA 3EBVA 3MS8A 3FHQA 5A6SA 3QR3A 3PZQA 4J7RA 1V3HA 1E9LA 1JXKA 1I75A 4MDOA 5A8QA 2WC4A 2WZIA 2ZUWA 2ZX9A 4LXFA 1UKQA 3OLIA 3AS0A 4TUFA 1HKMA 3K8MA 3MSGA 1EA9C 2CCRA 2JF6A 1C7SA 1MVYA 4J3TA 4OZOA 4CKQA 4HOWA 4CN1A 1IV8A 3SURA 3NSMA 2ZXDA 1UR8A 3B9AA 4GIAA 3PTKA 5D9OA 4RE2A 2D0FA 3WNLA 1C7TA 4D1JA 3I3EA 1LL4A 4ATLA 1JYXA 2WZHA 2Z1KA 4GI8A 3WDPP 4DWSC 4JFUA 4GZIA 2PC8A 1HJVA 2WVSA 4E4PA 2UY4A 3VOCA 4HOZA 4AZGA 4UFMA 1J11A 4EE9A 1TVNA 3UERA 2E8ZA 1WE5A 2G41A 3SCTA 4U3CA 5A6LA 3GXDA 3O6AA 2WHMA 1SMDA 2ZIDA 4PMYA 2WMJA 4FF5A 4AD3A 1XGZA 4V2XA 3CZGA 4AEFA 5BXRA 3SUTA 3WQVA 2X2YA 3OGVA 3TP4A 1VEPA 3AIUA 5E0FA 2DSZA 1V02A 3ARWA 1IZJA 3A4WA 4W7UA 4HMEA 1EOKA 2G8ZA 4LYPA 5CPTA 2YJQA 3W24A 1J9YA 5EMYA 1EGZA 3OB8A 1UD3A 5C71A 1CGUA 1U33A 1HL9A 3AYSA 1DEDA 5A8MA 1CXLA 3VUPA 4OBSA 2W4XA 1HJUA 3VD5A 1LJYA 3ZO9A 2DT0A 2F61A 4Z2HA 4NZCA 1G01A 3CHFA 1Q6EA 3QHMA 1LF1A 3ARRA 1NOWA 3ZT5A 4QDMA 4TOQA 3FW6A 2XHYA 1ODUA 5A95A 2XM1A 5DT5A 3AMCA 2W5FA 4UQCA 2EBNA 4PYSA 3ARXA 1C8XA 3CO4A 6A3HA 1J0IA 1BGGA 1R7AA 1UQYA 1JZ3A 2YIHA 3AIBA 1H49A 3VD3A 1JAKA 4WJXA 5D4YA 3WF0A 3WSUA 1KXQA 2UY5A 1C3FA 1JGIA 3HU7A 1ZS2A 4Z2LA 3U7VA 3WF2A 3WQ8A 5I6SA 2Y24A 1TA3A 5KZ6A 4CD4A 1O6IA 4B15A 1JD9A 2CKSA 1JNDA 2VCAA 5DO8A 2OSYA 1JZ8A 2VTFA 2DEPA 4DM1A 4WK9A 1HL8A 3NIYA 4PTVA 4XUYA 3ZT6A 3THDA 5GNXA 4M82A 4CVWA 1QHOA 5GNYA 5JUVA 3EMZA 1JDCA 1HIZA 5FOOA 1WDSA 4GPNA 1JAEA 3OLDA 1W9VA 2ZWZA 1KGXA 1VJSA 3U57A 1JD7A 1J01A 2OYLA 4BQ4A 2J77A 1V6XA 4TTGA 1LWHA 1F4AA 2WNWA 4P8UA 1E72M 1ITXA 2CHOA 4HU8A 3I3BA 4PUEA 4LYRA 2XIIA 5EB8A 5HDRA 1KBKA 2O9OA 4IISA 3SCSA 3WMCA 2QMKA 3ZR6A 1C93A 2VUYA 3DYMA 1Q6DA 1XC6A 3BLPX 4F9JA 2FH6A 1LG1A 2E3ZA 1JZ2A 4WSJA 1UKTA 2TAAA 4P7NA 1UD8A 3ARVA 3B8SA 4JHZA 3MMDA 2OSXA 1W2PA 4DM2A 3VINA 1E73M 3CHDA 1MXDA 5BYWA 1FP9A 1XSIA 2VI0A 3PZTA 1E0XA 2XVPA 3CZKA 2J7DA 4D1IA 2WVVB 1V03A 2EPOA 1CXHA 1D7FA 2VO5A 2X09A 3AMDA 3BC9A 4RE4A 3N1AA 4B9ZA 2GJXB 1KQYA 1SFSA 4RE3A 4AEEA 7CGTA 4MNKA 1BYDA 3WD3A 2J8GA 3CUJA 2WWDA 1LLOA 2XGBA 3IAPA 3A4AA 1QNPA 2OWCA 4PMVA 2XGIA 4N42A 5A1AA 3ARQA 4NF7A 2PBGA 3KL3A 2J7GA 4GKLA 4BQ5A 3D3AA 2VCCA 3AXXA 3NDZA 1JF5A 3SUVA 4AIUA 4E2OA 4JIEA 2WK2A 2WZEA 4EAMA 1BYBA 3F5KA 3PBGA 4QLLA 2WSKA 1MFUA 3CPUA 1U30A 5A6AA 1JFHA 1UH4A 5HOSA 5BRPA 2QHAA 3CZ8A 1V08A 4AMCA 4MAZA 1GVYA 5LA1A 3EDDA 2ZX5A 1B3XA 3AZTA 4ZENA 4M24A 1AQ0A 2YLAA 2VZUA 3BAXA 3WF3A 3BAIA 1H5VA 3K8KA 3VIMA 1J0KA 3PZVA 4UQBA 3WNPA 3SUUA 2X05A 3OG2A 2WHLA 2XFYA 4W84A 2WMHA 1J18A 3VIOA 1GOIA 2WKLA 3WN6A 3IANA 4IM4A 5ECUA 4MB1A 5GNZA 1VJZA 3WH8A 3WL0A 1JI1A 1PX8A 5M3WA 2XVNA 1JXJA 4PSRA 5A8OA 4TVDA 2BXYA 1R87A 3MUY1 1CZ1A 1OGSA 3RM9A 1VRXA 4L4PA 4YN5A 1NARA 1QI4A 5E70A 4M8UA 1J0YA 2PBOA 1KCLA 4BQ2A 2V3EA 2PWEA 1ZJBA 2D1ZA 1WB0A 1CIUA 1WCGA 4B3LA 4LPCA 3L4UA 2V5CA 4BQ3A 1UKSA 2Y8KA 2GK1B 3AS3A 2VVNA 3SCPA 3A6OA 1GNXA 1W32A 1V3MA 1GQLA 2G3NA 3G6LA 1UWRA 2WLZA 3OA5A 2JIEA 4E8CA 4JFWA 3WY1A 1G9HA 1E4LA 5JBEA 3VU2A 1JG9A 4ML4A 3GH4A 2O92A 2BV9A 1LG2A 1US2A 3GH7A 3WIJA 1XV8A 4PMZA 3WD0A 2ZUSA 1WPCA 1HT6A 2ZX6A 3RILA 3MO4A 1BG9A 1X6LA 1VFMA 4H2CA 1UWUA 1EDGA 4AC1X 4D6HA 5BRQA 1E15A 2O9RA 5CGTA 3CHCA 5A6BD 5IFTA 4MDPA 5I5RA 4GINA 1V6VA 3MANA 3ARSA 1FH7A 1B90A 4J3SA 3E1F1 5I0DA 4YPJA 1E40A 1UYQA 1ZBVA 3W53A 2D2OA 4NRSA 1E6XM 4C7DA 2JE8A 2WKGA 1PJ9A 2VZOA 1JFXA 4B16A 3A47A 4HP5A 1JZ6A 4OUEA 3S2CA 3AFBA 4GI6A 4H7VA 5HNNA 3CGTA 4KH2A 2GJPA 3AJ7A 4PUDA 1C8QA 3ZM8A 1DWGM 3GNOA 1MW2A 4U2ZA 1W9DM 1UR9A 4KWUA 2GVYA 1UKPA 1DWIM 1O7AA 3SIMA 3WQ4A 3VNYA 1V02E 2JALA 5E0CA 3PZNA 3CZEA 4J3XA 3F5LA 2ZE0A 2ZUTA 4AZHA 3EMQA 2D3LA 5C70A 3PZ9A 4PMRA 2XVGA 4M81A 1MWOA 2VMFA 1B2YA 2DT3A 4QAWA 1GQKA 1CBGA 5IDIA 2D24A 5A2CA 2DPEA 3T09A 1VFOA 2WMIA 1W9BM 1MYRA 5HPCA 1S46A 4QLKA 3TOPA 1TCMA 5D9MA 4CCDA 4HZ8A 4TVCA 4NRRA 1BTCA 1KQZA 3T0DA 2D0GA 4HU0A 3GXFA 1D2KA 1K9TA 2BVDA 2NT0A 3L4TA 4S3KA 3W6LA 2IXVA 1QNOA 4UNIA 2E0PA 1UR4A 1UHVA 3A3HA 3GBEA 1KR1A 2WANA 2ESCA 5I78A 2VR4A 1GOKA 1E55A 4U5KA 2BVYA 2E9LA 3N15A 4MNLA 3WQWA 4Z2IA 3TTOA 3W25A 2VX7A 1ISXA 3GYCA 3S6TA 1HF6A 4AD5A 3NSNA 3WEZA 3WELA 3M07A 1CWYA 3N13A 3HJEA 4AISA 2GSJA 3WMSA 3TONA 1ISYA 1J12A 5CLTA 4AD4A 1UD2A 2VRKA 3OLEA 3BXWA 1MW0A 3OLGA 5EBAA 3LPGA 2A3EA 2IUZA 4FLOA 3RO8A 1WDPA 3CZLA 2GUYA 1UUQA 4UQ9A 1PEZA 4JCMA 2QMJA 1ODZA 1HKJA 1MXGA 2J74A 1R7OA 1XSKA 2ZUNA 3MMUA 1GW1A 3ZSSA 2DQXA 3CZJA 3WQ6A 3WF4A 1V6UA 2G4FA 1RPKA 4JKLA 2YKKA 2DH2A 2C8NA 1ZU8A 3AOFA 1UA3A 2X1IA 2J79A 1VENA 4U5IA 1ZBCA 4HPGA 1E6ZA 1XCXA 3B9EA 1SYTA 1OD0A 5A3HA 2G3IA 4PCTA 1W9PA 5A6MA 4DUXA 1VBRA 3VIKA 2BS9A 1OGGA 4D6JA 3EMCA 3WH9A 4AWEA 3VGEA 4DWSD 2PWHA 3AIVA 4JFTA 3OIHA 2YA1A 2YL6A 1R8LA 1QBBA 2WB5A 4FLSA 4CUCA 2Y4SA 2AAAA 4XX6A 3MV11 2WWCA 1UQZA 3MU7A 1CEOA 1IZKA 4H8VA 4L4OA 1UD4A 2VURA 3SCRA 3VX0A 3FAXA 4MB5A 4TTUA 4JKKA 1MFVA 3N11A 2WVTA 4M80A 1V6YA 1M53A 1WZAA 2WAGA 2A3HA 1QNSA 4ZEPA 1EOMA 4CN4A 5HBFA 3AIRA 4GXPA 2JIWA 3ZIZA 1CTNA 1NQ6A 1X1NA 4J28A 4WF7A 6CGTA 1UKOA 4FLQA 3WNOA 1WAWA 2WHJA 5A6BA 1GQIA 1BPLB 1D3CA 1K9EA 2YBUA 2EJ1A 1ZB5A 3GM8A 1PBGA 3DECA 2F8QA 1V0LA 2YDSA 1DWFM 2PWDA 2D20A 1GVIA 3BMWA 2IXUA 3OZOA 1J0HA 5EFDA 1BG4A 5IHRA 4AZIA 3WH5A 1ECEA 3WDIA 3DYOA 2YBTA 3ARUA 3L4ZA 2BY3A 1AQHA 3CBWA 2C7FA 1NWRA 2XFFA 3T2PA 4KMQA 3HN3A 5AC5A 2WC7A 3KZSA 3N18A 1LL6A 2WBGA 1JI2A 1UOKA 1CNVA 2A3BA 4DUWA 5C8BB 3BAKA 2BY1A 3O9NA 3VIPA 2J8FA 1NH6A 4WSKA 2ZWYA 3W26A 1WZLA 5CJ5A 4P7RA 1TFVA 1EO5A 2UY3A 1FFRA 3VD9A 4GO8A 1FHLA 1QI0A 2EEXA 4W7VA 5LA0A 1KBBA 1L8NA 3UR8A 4J27A 1W1YA 4XV0A 1QI2A 3EDJA 2XG9A 1R85A 1PZ3A 3SCVA 1U2YA 1E43A 1XYFA 4W8LA 2VR5A 1AQMA 2XTKA 2V3DA 3SEPA 5AY7A 3UR7A 2PWFA 2Z1SA 2WCGA 5LA2A 2W91A 4W8AA 1E1FA 1GHRA 1CLXA 1G1YA 3MUAA 3DC0A 1E0WA 1GOOA 1VEOA 3VDHA 3PTQA 5DFAA 4P7OA 1KXTA 3LMYA 4PTXA 1JZ4A 3N12A 3SCOA 2G3MA 3L4WA 2WMKA 3TA9A 2V5DA 1OT1A 3VILA 2FDMA 3O2LA 4R5EA 2ZXBA 3L4YA 4HZ6A 3W0KA 3CH9A 3NDYA 4PTMA 3W4RA 3U7BA 2DGAA 1OIFA 3DYPA 1QHPA 1XSJA 2VT0A 4A3YA 1B3YA 1W3LA 2EPMX 3AHYA 1QNRA 1FA2A 1NWUA 4HOXA 1LQ0A 4AD1A 1CYGA 2VNCA 4XZBA 3T0BA 2J62A 1OINA 1KGUA 1VAHA 5FCZA 1QOXA 3WNMA 3VO0A 2E8YA 3AROA 3BGAA 4GO9A 1VIWA 2HVMA 3A4XA 4CD8A 1B30A 2VVSA 3W6MA 2AOSA 1KXVA 2ZICA 4ZXOA 4R27A 3GTNA 3BH4A 4P7LA 1UD5A 3ALGA 1CLVA 4JL1A 3LPPA 2PWGA 3JUGA 4D6DA 3OGSA 2JEQA 2E9BA 3PN8A 1V0NA 3VM7A 2CITA 4UZSA 4XZWA 5AYIA 1I1XA 5BROA 1IT0A 3L4XA 5CZKA 3IK2A 1W2VA 4U31A 1M01A 1YQ2A 1W3JA 2CKRA 4Q22A 8CGTA 3AHVA 4JL2A 2C0HA 2HISA 1OT2A 3GDBA 3WUEA 1V0KA 1Q6CA 4FMVA 4YHEA 4MJ2A 3SCUA 2RGMA 3EYPA 3TTSA 5D9NA 5GQBA 3ZJKA 1ISVA 3GZAA 4DWSA 2YDRA 1FHDA 1WO2A 1H41A 3VMNA 2VZVA 4JFVA 1JL8A 3WFLA 1CXKA 2FH8A 3TTYA 2XVKA 2WVVA 1DTUA 3AI0A 3APGA 3LPFA 3ZJ7A 3ZQ9A 3K1DA 7A3HA 4W89A 2DDXA 1CGTA 2GJXA 3NCOA 4QFUA 1BGAA 4W7WA 4KGLA 4AZ7A 3G6MA 1HP5A 1OCQA 3RM8A 2A3CA 3NJ3A 2E4TA 2J4GA 2QPSA 4QCFA 1VB9A 2NSXA 5BXTA 5ABFA 3OZPA 3ZT7A 1QNQA 1G5AA 5I23A 1GZJA 3PZOA 3ZJ8A 1E6PA 2V38A 3BAYA 2EPLX 1NOFA 1QW9A 3KL5A 4PMOA 4B9YA 1VEMA 1AMYA 4D6EA 4WKAA 3U5UA 2J7CA 4F9DA 3WENA 4CD7A 1J0JA 2VCBA 3BCDA 3MUIA 2VRJA 2FHBA 2PI6A 3RIKA 3TTQA 3SCNA 3IJ9A 2J25A 1G0CA 3B9DA 1W9UA 1ZBWA 4LX4A 1UD6A 3CUGA 1XH2A 5CG0A 1E71M 2BVTA 4BCEA 2E9MA 4WLCA 3KE0A 2DSUA 3L4VA 4AZCA 3WD2A 4MB3A 2EQDA 5CPSA 2XSBA 1B3VA 2CYGA 2DT1A 1GOWA 4B3KA 3AS2A 4J3VA 1DWJM 3BSGA 5A8PA 3WD4A 3NYDA 2WMGA 3AIEA 1W1TA 3QOKA 3PZUA 3PZMA 5HXMA 1UWQA 1OM0A 2O9TA 3WKZA 1HNYA 2CEQA 3VIIA 3ZOAA 3AMKA 2DSKA 3M46A 4BZYA 2CHNA 1UWSA 1MQQA 2JFEX 5I2UA 5A8NA 2QV4A 1W3HA 4BA0A 5AYBA 3ZSTA 3VD4A 2DIEA 3W82A 5FIPA 4HZ7A 2WLYA 1V6WA 3VD7A 5DMYA 2YLLA 4HA1A 4AZBA 1E4NA 1H0IA 4HA4A 4U33A 4UQEA 1HJQA 5DF0A 4KGJA 1H09A 5FD0A 3NSXA 4IPNB 2GK1A 1E4MM 1W1PA 4MPKA 1BYAA 1E0VA 2DH3A 4MAVA 2ZXQA 1PIGA 2OLHA 4ACZA 2W62A 2W63A 4Z2GA 2J7EA 5CPQA 3WUBA 5KEZA 1QW8A 2VZSA 5D8ZA 1PIFA 1MW3A 4W93A 4MJ4A 4CCCA 4W5ZA 2ZOXA 4CD6A 1FP8A 3UEQA 5FKYA 3ARZA 2EPNA 2ZUMA 1I1WA 3PHAA 2CERA 4PEEA 1CXEA 4FLRA 2BY2A 2Y8VA 3KEHA 4EK7A 2GDUA 1RD6A 4J3WA 4PMDA 4CCEA 1QVBA 1QI3A 4MADA 4UFLA 1RP8A 3VGBA 2CBUA 3AICA 4ZE5A 3WNNA 1NM9A 4UFJA 1N82A 1BSIA 1B1YA 4OIFA 2DSVA 3AHZA 1SR0A 5JBDA 1JZ7A 1R86A 5F7UA 1UR0A 4W86A 1H0GA 2J75A 1EH9A 3W28A 2ZXAA 4F66A 1TR1A 4AYSA 2FHCA 1EQPA 1C92A 3VIFA 1Q6FA 1BAGA 5A6JA 1QI5A 2ZX7A 2W66A 4MNJA 3FAWA 1WZKA 1WNOA 3UETA 1NWTA 3VIGA 1HKIA 2D23A 1MQRA 2Y5EA 4JAWA 3VNZA 4P8VA 4PMXA 5FL0A 4Z2KA 1NP2A 1UWTA 2JEPA 3VIHA 3RCNA 4XB3A 2Q8XA 1E3XA 2X0YA 4IPLA 1GJUA 2DIJA 4H8HA 3WL1A 4MTVA 2OSWA 4WKFA 3CUIA 3WD1A 4M1RA 4AIOA 1M04A 1B31A 3CIVA 1EHNA 2UWFA 1G94A 4PMQA 9CGTA 1JNEA 1FH8A 2OWXA 2XSAA 5E9AA 1WDQA 4NSBA 3W29A 4CN6A 4PBGA 3AQUA 4AW7A 3BSHA 1L0PA 1TUXA 5ABGA 2BY0A 3WDQA 3WDHA 4AXNA 1DP0A 1H3GA 1ITCA 3T2OA 1E56A 4LYQA 5JIWA 5DT7A 3VDAA 1GUVA 1EDTA 3ECQA
chains in the Genus database with same CATH superfamily
3RMJA 3WNKA 4IF2A 3IAQA 5CC7A 5D30A 2NQ5A 3DKLA 1PYFA 1KM4A 2ZZ7A 1ISZA 1GYMA 4S38A 3PUEA 4RW3A 1WKYA 4CU6A 2A21A 3TYEA 1IXOA 1C8YA 3UR2A 2W6RA 2FZ8A 2GOUA 1YDOA 2TYSA 4JYFA 1A0EA 3FJ4A 4OKDA 3YPIA 2HK1A 3E49A 1YEYA 4CVUA 1E70M 3S5SA 2P50A 4O16A 3W86A 1WKFA 3SRDA 8XIAA 1EF3A 5K3VA 4TIMA 5CSRA 1QU4A 1TV7A 3VGGA 2D69A 2NXHA 1CGWA 2BFGA 3G1AA 3PWIA 1VBHA 4NX5A 4Q7BA 1NFPA 4UTWC 2C19A 1YNPA 3T42A 1XCWA 1S2UA 5CJNA 2ATMA 1XQKA 8A3HA 3TOYA 5CLWA 1XYZA 3K4AA 3R94A 2VX6A 3MW7A 3N34A 4URIA 4M0XA 4ICMA 1V3IA 4BKNA 2DSWA 4DAFA 4Z2JA 5CXPA 3W81A 4S39A 5CQ1A 2ZA1A 4ASTA 3WLJA 2G5WA 4AWSA 1S38A 3LGEA 3IRSA 2CNCA 1DQWA 3LY0A 4ZOCA 2EPKX 1Z69A 1KRBC 3C52A 1UG6A 3GR7A 1W6TA 1GQJA 1FVPA 1W3KA 3B0VC 4LQ1A 2QDHA 3CLWA 1OSEA 4IFOA 5JIPA 3KL0A 1EJVC 5CJMA 4TX6A 1BTMA 3RDKA 2B31A 1EIXA 3QF0A 4GIEA 3NUKA 5D2VA 3VMPA 1L6SA 1FQ0A 1JUBA 2FVKA 3KDNA 1HP4A 2Q01A 5D2TA 3S5NA 1EHAA 3L0NA 5G1YA 1WP6A 4GHRA 4REQB 2OG9A 3NQ7A 1IGWA 1W5QA 3LBOA 3HMCA 1QNVA 4V27A 2X1RA 3N04A 1HX0A 1YLVA 4C7GA 2VQTA 3WUGA 2WM0A 3QGAC 4DUVA 3N2OA 3VTRA 1KD0A 4IPJA 4WIWA 3NPXA 3KLKA 2WYSA 3B40A 1IXPA 4O1BA 3R43A 4UOJA 3UWWA 2QVHA 3THCA 4HMDA 2O9PA 1PPIA 4G2DA 3QM3A 3GH5A 3B8IA 5TNVA 4C6KA 3AUOA 3VCNA 3ZWSA 3URNA 1RALA 3GX9A 4DWSB 4DBEA 1RH9A 1SJBA 4QNEA 3IV3A 4XO7A 3OZYA 3W7DA 2GUUA 3QLDA 3USBA 2D22A 2PD9A 3MV01 1CXFA 2NT1A 3VC5A 1JYWA 2GSHA 2AMXA 1YMYA 2HJPA 2FHFA 1E4IA 4PUJA 4Q4OA 2I1OA 5FF3A 2FFIA 3CUZA 3L5MA 4PTWA 1FWSA 3VKJA 5KZMA 3B04A 1FWHC 2VZTA 3H2CA 4G7EB 2YL5A 3CUFA 1HKKA 3WBEA 2CBVA 4JFSA 3O6YX 5C9XA 4DNHA 2VL4A 4G56A 3RJXA 3S83A 2OWWA 4ZXLA 2O0TA 3IJ6A 3W27A 5DMNA 3G77A 3WYZA 1V3LA 4EOUA 3WLOA 3T0TA 4LUJA 3FLUA 5I24A 4JIIX 2NZLA 2PB1A 3W1LA 4GYPC 2CLEA 3TQPA 2BNJA 3ZR5A 2D0HA 1YHTA 1FFQA 3HV8A 4OECA 1AJ2A 1SZFA 3RYSA 4O4WA 2XWDA 2VEKA 2CLPA 4FNSA 3PZGA 3ARYA 3MPGA 3TNBA 3LPOA 4LY4A 3WLHA 2GDVA 2CBIA 3W37A 2HVOA 3GR4A 4O17A 2GVLA 4WKHA 2YL8A 4E2VA 1LBFA 2FZBA 1H7WA 4ECLA 1TWSA 2BODX 4XD4A 1K8ZA 1KM3A 3WQ5A 5HWJA 4QIUA 3W1XA 3V1PA 1DORA 4LUTB 1AVAA 5H8UA 3XISA 4YVXA 4FK9A 4ZBCA 1FCQA 2AMGA 1US3A 2VGFA 1N2VA 4TU1A 3W72A 4DRSA 3R0UA 1Q4WA 2EXOA 3AMLA 4YTTA 4EXBA 4MKNA 2OTDA 3LCIA 2X0HA 3LOTA 2WSQA 2H9AA 1JYNA 1VZWA 3I7RA 2FGLA 1K6AA 3I68A 4Q7NA 3POCA 3KFTA 4L4LA 1R3QA 2W92A 1JIBA 3DUGA 4ACZB 3Q94A 3T4WA 1THFD 3DFSA 4IP4A 1AW2A 2YXOA 4M3PA 4ZO9A 4KEVA 4K68A 2J7FA 2QCDA 1B57A 1LRTA 2DZVA 3KUMA 4LBUA 4QP0A 1XPGA 1TMQA 4W5UA 1XW8A 4A4AA 1OFBA 4U3AA 4MB4A 4ZTXA 3EPNA 4PMNA 3VNIA 5CGMA 3WEOA 1T5AA 1VYSX 3F5JA 1DHPA 1PAMA 1J10A 4UMBA 3PBUA 2PDKA 1GHSA 3FCPA 4ZODA 1XYLA 1RP9A 3PB2A 4PCPA 3EX1A 1FWNA 3K8LA 4HHMA 3K4DA 1TG7A 5FEWA 3PSVA 1XLIA 2V67A 3P2VA 1FH9A 1JRCA 1EX5A 1FXPA 1KB3A 5BWAA 1QHZA 1PVNA 3TMQA 3TA6A 3GB6A 2G3JA 3FA4A 4P7QA 3B9NA 3UJSA 4GZJA 4UTTA 5IBXC 6TAAA 1CB7B 1AH4A 3PPGA 2PRHA 2PDQA 4PEKA 4S3AA 1U1UA 1LL7A 1DHKA 3QZ6A 3BMVA 5EL1A 3VKCA 1WZMA 1G6CA 1XLLA 2J47A 5EMLA 1QMLA 3MO7A 1ZZMA 4X0NA 5CC3A 3ABRA 1W91A 2VGIA 1P7TB 3FN9A 4LFYA 4QCEA 4S3JA 2JF7A 2EHHA 1JYVA 4D6FA 5C6MA 2XIQA 2QQ6A 4DPQA 3V4BA 4F8XA 2HWGA 3KS5A 3E2QA 1LOQA 2YCLA 2ZRYA 2D3NA 3A5FA 4QM1A 3EPOA 4M29A 4RXGA 3IIPA 5CEWA 3M7SA 3LSBA 5A6KA 3AJXA 4WSHA 1UH3A 4HTYA 2O56A 4GQRA 4QSHA 4A3UA 4C7FA 4S3EA 4DXVA 3MWAA 3E2RA 3HPAA 3E74A 5I3DA 4M56A 1T7LA 4GYKA 2V68A 3KTCA 1SZGA 3LHYA 5D2YA 3VDBA 1TJ2A 3LCGA 1ZRQA 3QZAA 1KR0A 2PDHA 3GXIA 3RLUA 4QR6A 3EKGA 4X3ZA 1A47A 2YA0A 4US5D 5DANA 3BCJA 4DI9A 2W9MA 3CL7A 3R10A 1X6UA 1SPQA 2FDSA 2NQLA 1DJNA 1HZYA 1LWIA 1I75A 2YCJA 1UKQA 3W7NA 1TYGA 2Z2UA 4QX4A 2BGQA 3LEPA 4LUIA 1JCLA 4XZLX 3PJUA 4N4PA 4DJDA 3LDVA 4ADSA 3SGZA 3THUA 4O53A 2C6QA 3W7MA 4ATLA 1LL4A 3QR1A 3MC5A 3O05A 2Z1KA 3B03A 4GI8A 3WDPP 4DWSC 2FB3A 3CB3A 4JFUA 3H2AA 5EKYA 1PO9A 1KM1A 3PPFA 1HJVA 1GG1A 5HK4A 2WVSA 4E4PA 3RX3A 3NR0A 3FJLA 4EE9A 2WM1A 3UERA 3IUHA 2G41A 2QT3A 5G2HA 4JY9A 1VLWA 1YX1A 2F6UA 3KRBA 4PMYA 4QJ3B 1WKEA 4AD3A 1XGZA 5BXRA 4L65A 4CCZA 5FJIA 3GYEA 1YNQA 4Q8PA 3S2JA 1T41A 3OGVA 4J35A 1VEPA 3AIUA 3UA3A 3L2IA 1V02A 4KFNA 3A4WA 2PURA 2VEIA 2G8ZA 4HMEA 1MZHA 5CPTA 2RH9A 3RHGA 1XPYA 2X30A 1BRLA 1EEXA 2R82A 4UBPC 3OB8A 1UD3A 4G7FA 4FOKA 1DEDA 1G4EA 5A8MA 4F2BA 3BDKA 3CIWA 2BOEX 3VUPA 2W4XA 1HJUA 3MA8A 3VD5A 3ZO9A 2QDEA 1FDZA 4I9AA 4FOJA 4H83A 3R58A 4MOZA 5DMLA 3ARRA 1V6TA 5EMUA 4IIDA 2BOFX 2QIWA 5A95A 4KCUA 1TQJA 4JN7A 2W5FA 4UQCA 4C6OA 2EBNA 4QG9A 3ARXA 1J0IA 5B7ZA 1SVDA 4KFPA 4UMAA 1R7AA 3Q58A 1U5VA 4PRTA 5D4YA 3WF0A 4V1YA 4FXRA 3OHIA 2UY5A 1C3FA 2QIIA 1JGIA 1FHVA 3WF2A 3L0KA 5K4XA 1W3NA 5I6SA 4KEZA 5KZ6A 4B5XA 4GZ7A 5DO8A 4IMEA 3LZ5A 1G4PA 1AD1A 3NIYA 1LQ2A 1PSCA 3W7OA 3STGA 1OFAA 2J6VA 5CBBA 3ZT6A 2C1GA 4M82A 1QHOA 4F0MA 4JTEA 3B0YA 2PU0A 3SY5A 3N2CA 4ERIA 1WDSA 2ZWZA 1VJSA 1JD7A 2XINA 1KO0A 3FXGA 1KM0A 1IEIA 2PCEA 3R0DA 4DBDA 3QFWA 4PODA 3IRDA 5KETA 4P8UA 3R8HA 1GTEA 3M5YA 3S1VA 2W3ZA 1L6FA 4IMDA 3SCSA 3WMCA 5AZ1A 1XC6A 2FH6A 1H60A 1LG1A 3ZFHA 3CWNA 3E96A 1VYRA 4CQDA 1R9ZA 1UD8A 3LM7A 4ZO6A 3G8RA 2OSXA 7TIMA 3KXQA 2DP3A 2NX9A 3PZTA 4Q8UA 1E0XA 4MLJA 1Q6RA 4D1IA 4Q4MA 2QDDA 1CCWB 4KCVA 4B9ZA 1KQYA 4M1BA 2I57A 1QOQA 4XD3A 4FNTA 5FJUA 3GNNA 2XGBA 3IAPA 2CZVA 3GDTA 4L9XA 3PAOA 1XP3A 1QNPA 3GK0A 5LIYX 4NXKA 4Q8QA 1ZCOA 3V0UA 2R1NA 4BQ5A 2AL1A 3N4FA 3SUVA 3LM3A 4JIEA 5XIAA 4ES4A 2FMOA 1BYBA 3PG9A 9RUBA 1SGJA 2WSKA 4JX4A 3S1WA 1MFUA 1U30A 1AJ0A 3MDUA 5BRPA 2DZWA 2RFGA 3PAJA 4RV8A 3HQ1A 2PDWA 1V08A 4AMCA 5FJPA 4U28A 1VFLA 1LOLA 3FKRA 1Q6OA 1SO5A 2ZX5A 5LIKX 1B3XA 3AZTA 2NV9A 4E38A 4ZENA 1R46A 1F73A 4UNKA 1H5VA 3VIMA 1J0KA 3PZVA 2INEA 3QH2A 2OU4A 2X05A 1IXNA 4L80A 2VFFA 1JR1A 1OK6A 3UGRA 2H90A 4HNLA 1O1ZA 2ALRA 4MWAC 4HA0A 4CQ9A 1FY6A 5GNZA 3WL0A 4DO4A 2QULA 1W1ZA 2A7NA 1PX8A 2R24A 3VKBA 5M3WA 1YXDA 3TYBA 1GVFA 3HG4A 4UTMA 4O19A 1JXJA 4PSRA 1EZ2A 2E6DA 5A8OA 2CZEA 3QQ1A 4IFRA 1OGSA 3RM9A 4LYKA 4A21A 4L4PA 4HBKA 5E70A 3GC5A 4UTWA 3U0HA 3WLSA 1WOBA 2Q8ZA 1YPIA 4IXHA 4B3LA 2OOGA 3O16A 3NPUA 3KX6A 1IR1A 2GK1B 3KHDA 1GNXA 2DW6A 3V1HA 4ZVJA 2WLZA 3OA5A 4E8CA 4XUGA 3GO2A 2DY3A 2ZZ6A 1G9HA 1XIJA 1FTXA 1NY1A 5EBUA 1GKQA 1SQ7A 6PTDA 1TVLA 1JG9A 4B5VA 4ZOBA 6REQB 4Q3MA 1LG2A 3QV9A 3WIJA 4IIGA 2ISDA 2Z1XA 2ZUSA 1WPCA 3MP5A 4L9YA 4XTIA 1HT6A 3KDOA 4XK2A 4C6BA 1X6LA 3GAKA 4H2CA 3MBDA 1TTPA 5HUOA 1N55A 2YCIX 2INZA 3CHCA 5A6BD 3VOHA 3V5CA 5I5RA 3SRKA 2ZA3A 3MANA 5G4WA 4LC8A 4M6UA 4MIMA 1E40A 1ZBVA 1SW3A 4NVTA 4LS2A 4C7DA 2WKGA 2PP1A 1PJ9A 2VZOA 4HSHA 1JFXA 3GG8A 5F4WA 1JZ6A 4LUYA 4GI6A 3WZ0E 5CPOA 1HO1A 3BLOA 4PUDA 1VC4A 3ZM8A 3ATZA 4LAOA 5KMYA 2PDJA 1W9DM 2BXVA 3KTXA 1UR9A 5CKSA 4DYKA 2R1MA 4KWOA 4JYEA 2GVYA 1UKPA 1O7AA 3WQ4A 5E0CA 4K1WA 3F5LA 2ZE0A 2ZUTA 4AZHA 2D3LA 2V63A 3PZ9A 4PMRA 1CLKA 1XXXA 1PKLA 2VMFA 2DT3A 5BZAA 2V0TA 2INFA 3DERA 2O7QA 3UYCA 2J8TA 2DPEA 2WMIA 1W9BM 4NZ1A 3U4FA 1EA0A 2HZGA 1Q2RA 3UGVA 3TOPA 1BTCA 4O18A 1KQZA 1NJJA 3T0DA 3V36A 3TW9A 1W3TA 4C1KA 2HPMA 1QNOA 2E0PA 1UR4A 1UHVA 2X1TA 3A3HA 4M51A 3R13A 4GLEA 3G0XA 3QBUA 1O5RA 2VR4A 3CV6A 3L12A 2E9LA 3N15A 3WQWA 3S5ZA 3SZ8A 1ISXA 2BG5A 2ALDA 3P82A 1HF6A 5C0QA 1QCWA 3WELA 2PEVA 3WQCA 2J6XA 4Q4SA 5DY2A 1ADSA 3WMSA 4RZBA 4AD4A 4R88A 3UWQA 3F7JA 2DUAA 2F7FA 2QGYA 2DZTA 3OLEA 1MW0A 2IUZA 1HL2A 2VD9A 4FLOA 3RO8A 1WDPA 1PZ0A 3FKKA 2QMJA 4GYPA 1HKJA 1MXGA 1R7OA 1LZOA 1E9YB 1H7RA 3UWUA 1S1RA 3EKZA 3S2LA 1LCOA 4A22A 3CZJA 2X1UA 1V6UA 3GE7A 2YKKA 3C0JA 2DH2A 2C8NA 4F40A 2Z2AA 1UA3A 2C0AA 3B0PA 3UZZA 2RDUA 2X1IA 3N9RA 3OBKA 4Y90A 1DIDA 1L9WA 2GYIA 4O12A 3VUSA 3CQ0A 4O8AA 4ZOAA 3B9EA 1SYTA 5A3HA 4EIVA 3WLLA 5A6MA 4HHPA 2PP3A 3NOEA 2OZTA 2VWSA 3B8DA 3MZNA 4CUCA 2Y4SA 2AAAA 3H23A 3KOFA 5AYZA 4FXSA 2ANUA 2PA6A 1CEOA 2Y88A 4L4OA 2QPXA 1TPUA 5DBTA 1MFVA 1UC4A 1YTEA 3DG3A 4MFDA 2A3HA 3O6CA 4V33A 1QNSA 5I3KA 4DF2A 4ZEPA 3ZS4A 3E02A 4ZQRA 7REQB 4NJHA 5HBFA 3AIRA 3TROA 2J9ZA 4IQJA 4Y8EA 4BWLA 1SO4A 4GC3A 4WF7A 4DO7A 3MUCA 1VKFA 1TIWA 3W1NA 1BPLB 1D3CA 4NUWA 4TV6A 1UP3A 4PA8A 4I6KA 5E1QA 3W2KA 3DECA 2F8QA 5LIXX 3GU9A 3A23A 2YDSA 4GJIA 2PWDA 4FNQA 1GVIA 3BMWA 3NQCA 2IXUA 1D7KA 3OZOA 1BG4A 2R94A 1HFBA 1OYCA 5IHRA 1XIFA 1PHQA 1REQB 1GW9A 2F38A 3WH5A 4WXZA 3WDIA 2NVAA 4HHLA 3UZ5A 1AODA 4LUSA 3V3WA 1AQHA 2C7FA 3EOOA 3W07A 4O10A 4B2DD 3KZSA 3N18A 2WBGA 4LEQA 4AX7A 5C8BB 3HFTA 3W26A 3NZQA 1WZLA 1TFVA 4H9UA 2GUBA 2FLIA 3VXGA 1EC9A 4W7VA 1NF7A 3GU2A 1FCBA 4JTCA 3EDJA 5IBXA 2J13A 1XYFA 2RUSA 2XTKA 3FYYA 3VOFA 1V79A 3SEPA 5AY7A 3UR7A 3U4AA 2VGBA 2WCGA 2W91A 3WK3A 3T1GA 1FWTA 4GUGA 1XX1A 5J04A 4WEVX 3BZJA 1POKA 3PTQA 4MF4A 3MI3A 3NQMA 4UTJA 3ITLA 3M0YA 4ZQCA 2DZAA 1A5CA 4A35A 3B8VA 2P88A 3TA9A 1EP3A 3VILA 3KS6A 2ZXBA 4GUHA 4HZ6A 3FEMA 3CH9A 3NDYA 1PZ1A 4J2MA 3GC4A 1QHPA 4EWJA 1XSJA 3HQOA 1CW2A 1QNRA 1NWUA 3ITCA 3QRHA 3L67A 4ERGA 1S5NA 1I45A 1QOXA 4JTRA 2EKGA 3WG6A 2V5BA 2HVMA 4AWTA 1RLCL 3W6MA 1U22A 4ZXOA 2HXTA 1G7VA 4K3ZA 3AC0A 3JUGA 4JTSA 3OGSA 2OGJA 3N2XA 3VM7A 2CITA 4XAPA 5AYIA 2PE4A 3UPWA 4PULA 1I0DA 1H7PA 5CZKA 3HG2A 2G96A 1TPEA 4DNMA 1W5OA 4DZAA 4HPNA 2PUZA 5DCDA 1YQ2A 3CHVA 2CKRA 3LRKA 2DJXA 3QV6A 3PNZA 4Z0SA 5B7YA 1Q6CA 4YHEA 3EYPA 3MDWA 5D9NA 5GQBA 4WDWA 5D33A 1ISVA 4DWSA 2YDRA 4JTFA 1FHDA 1FWFC 3V5OA 4JFVA 1JL8A 3G1VA 1DTUA 3AI0A 3LPFA 1FKWA 1QDSA 2EG8A 1HG3A 2WPBA 3NCOA 5AHLA 3IEBA 1TRDA 4W7WA 1HP5A 3RM8A 2PLMA 2Z1WA 3NQVA 5BXTA 1R3VA 2E1WA 1G5AA 4JY8A 1UR3M 1Z42A 5I00A 4HK5A 3E0WA 3BAYA 3NQDA 1RCXB 1NOFA 4NILA 4PMOA 4O1EA 2PLJA 4I6VA 4WKAA 2J7CA 5E93A 3PC0A 3FYOA 2P3ZA 1GVSA 5J8LA 2HBVA 3T05A 2E5BA 1I2PA 1M1BA 3MUIA 4LF1A 4FR6A 2FHBA 3RPDA 1S5MA 2AKMA 1XR2A 4UIOA 1IHIA 1W9UA 2OQLA 1JUKA 1GPWA 3NO1A 5CG0A 4I3GA 2BDQA 4GVIA 4BCEA 2E9MA 4HZMA 3V75A 3LBMA 3P93A 2YB1A 1XBZA 3WD2A 2I5GA 4QJ1A 5CPSA 1XS2A 2XSBA 2CYGA 4CNSA 1GOWA 4B3KA 3AS2A 1DWJM 3BSGA 3MWCA 4GUJA 1HKVA 2Q71A 2ZVIA 5LNRA 3FFSA 3PZUA 2PCQA 1J2BA 1M7JA 4DJEC 5BW6A 3VIIA 3ZOAA 2WJEA 4BZYA 2CHNA 4IUOA 4XZHA 4Z1CA 4XTDA 3R8RA 5MHBA 4I90A 5A8NA 2QV4A 1MZRA 4DJED 5FIPA 4F4RA 4HZ7A 1V6WA 3VD7A 1TV5A 3C61A 2DVXA 2DZSA 4HA4A 1HJQA 1P6BA 1V93A 5DF0A 4EPKA 1H09A 4GJ1A 3BICA 2J24A 3DG6A 3UVIA 1ME7A 1ZJHA 1E4MM 1W1PA 3NA8A 4A2RA 3PFRA 1E0VA 1BKSA 2OLHA 4ACZA 2W62A 4WGHA 1EJWC 3JW7A 5CPQA 5KEZA 1NEYA 2CC0A 4WD0A 3NL2A 1EXBA 3NQ8A 4CNOA 2HCVA 1W37A 2QJJA 3PHAA 4X63A 4PEEA 1CXEA 4FLRA 2Y8VA 5LGZA 1TJ0A 3B8WA 4EK7A 4G9PA 1DJWA 2PDIA 4JTIA 2YCKX 1QVBA 2Z26A 4UFLA 1RP8A 3VGBA 3WNNA 2REQA 4ZE5A 1WUEA 4UFJA 2Y0FA 3ORWA 2GSEA 1S2VA 1DE6A 3PANA 1HUVA 1B1YA 1FX6A 1XL9A 1JJKA 5D2WA 4OIFA 2DSVA 4MVAA 3AHZA 1SR0A 4NG3A 1Y65A 3MCOA 1UR0A 2VFGA 5EA9A 3BQ6A 4F66A 5F2GA 1LROA 3I4KA 3VIFA 4HGXA 1Q6FA 3NNTA 2ZX7A 1XFBA 2W66A 4MNJA 3FAWA 3PSWA 1WNOA 3HV9A 3RK8A 3M0IA 5FL0A 4ZB0A 2ISFA 3W74A 3BG3A 3RCNA 2PDNA 2Q8XA 2X0YA 1P7TA 1KBJA 4GKTA 1G7UA 3R2GA 2QYGA 4JR5A 2DIJA 4H8HA 3OJGA 4MTVA 4JNMA 3W70A 1RJPA 3STEA 3CUIA 3WD1A 3NM1A 3LGDA 3UWZA 5CG7A 4AIOA 1SW0A 4XZNX 3UQNA 4PMQA 4LVBA 1L6GA 3V16A 9CGTA 3KBWA 1B54A 3HPSA 5E5CA 4JTJA 4MWAA 4AU0A 3FVDA 4AXKA 5H91A 5FAJA 2J9XA 3C2OA 3TNOA 4Z42C 3WDQA 3KCJA 4AXNA 2IQTA 3T2OA 3O1NA 4LYQA 5JIWA 3NQEA 4YVPA 3I6EA 1X7IA 1GUVA 1XLDA 1Q8AA 2PWVA 1CENA 1B9ZA 2A3LA 3W7GA 2OJPA 4AUBA 1SMAA 1BSLA 3AIQA 2B7NA 3SCQA 1MDLA 2Y62A 5IXEA 5LNUA 2VX4A 4HIBA 2XIBA 3UZJA 3MSRA 5HQMA 4GWEA 2C71A 4F3HA 1ONRA 4NNCA 1OX4A 2R1LA 3MZ2A 1UA7A 5REQB 1KFWA 3T08A 4HYRA 2ONEA 4Q6XA 5C2CA 5AVNA 1E6SM 1P6CA 1R3WA 4H9ZA 1RZMA 1ZL1A 4UOQA 3TC7A 2CBJA 3N6JA 2X42A 1W1VA 4GABA 1C8VA 1O1HA 1OC7A 1M65A 1GVRA 2JKAA 3ELFA 3AMGA 1UIPA 1V0MA 2CZFA 2ACRA 3BSMA 1Q65A 4JN8A 4NZFA 1CT5A 2DZUA 4XG1A 3K13A 3BPWA 1OG6A 4LF2A 3N2MA 5AZ0A 1OIMA 3G1YA 1MEWA 1PUDA 2Z4GA 3ICJA 1MO0A 4K8EA 1L2QA 3MKKA 3CB8A 1E6NA 4C6QA 5HMSA 2FIQA 3PG8A 4W87A 1BVZA 3WMBA 2XFRA 1KFBA 3LV6A 3W75A 3MUZ1 3APYA 5BWFA 1H7NA 2CETA 4TXEA 1PWMA 4RZ5A 2P8CA 1TWDA 3AWNA 1WDDA 1M3UA 2GGHA 3WEMA 5K4ZA 1QBAA 1F4HA 3AYTA 3RPMA 4JGDA 3PP7A 4GQQA 4HNOA 1LUCB 4X0VA 3TU9A 2I17A 3GG7A 3AO0A 3W7KA 4MLRA 1XIGA 3RLVA 4H3DA 3GKAA 2OFJA 2WJDA 4KRZA 4UCFA 2ZBTA 3T2QA 1KWGA 3N17A 1BQCA 1NVMA 3KWSA 2YDQA 3I3DA 2A5HA 2WHKA 3VNMA 5FF7A 2CLIA 3K30A 3SCWA 1ISWA 3VNLA 4BS0A 5G2WA 2E1DA 4FI4A 1N8FA 5TD4A 1AZ2A 2BHUA 5CSUA 1FWGC 1HGWA 3TR9A 2WXDM 3F4VA 1XD1A 1RR2A 1UCWA 4CGTA 4JTLA 4JCLA 1QPKA 1OGBA 1H2JA 3EB4A 1A53A 3OP2A 1K9DA 2EO7A 2XWEA 1XLCA 3WDRA 4QXIA 3W3OA 3IUDA 4OV4A 4F48A 2HNEA 3BLKA 2GDQA 4E2DA 3BV4A 3T0AA 3NVDA 5C54A 1RJQA 3TYCA 3GR8A 2QGHA 1PCWA 4ZQNA 4PCSA 2MUCA 4IFKA 1DIKA 4US6A 3R8GA 3CMJA 3AIWA 4W88A 3M16A 4ICCX 2VP8A 5LGXA 3VGFA 1XCFA 3IACA 4PMUA 3NL6A 4JX6A 1SM9A 3DCPA 3TXVA 4DF0A 3QHOA 2CLFA 5AC8A 3AISA 1UUOA 3LQLA 9XIAA 4RL3A 4HNUA 5ABFB 3QJAA 4MY1A 1OD8A 5G4EA 4DQWA 4F0SA 2C14A 3T8QA 1G69A 1E3ZA 4IGNA 2V82A 4HA3A 1GCYA 3NG3A 4MZ1A 4NQ1A 5M03A 3URAA 1WAUA 1NOUA 4CU7A 1C91A 1QATA 4YMZA 3QGVA 3CT7A 5FA5A 3EXSA 5I09A 1ONEA 4HKPA 3GNDA 1XJBA 1CECA 3SUWA 3AHTA 1UR1A 1RQHA 5A2AA 3GNPA 3PUOA 5A94A 1DOSA 1X8FA 2GGGA 5AHMA 1BF2A 3H4GA 4AIEA 2OB3A 3GVWA 2FTPA 4UB9A 1VCFA 4XZIA 1H61A 4AAJA 2A7RA 4KS0A 3EDKA 3QHNA 1XD0A 1TE6A 1W3IA 3DOPA 3M5XA 4NAEA 5MKGB 4UTKA 1LWJA 1EJUC 1TJ1A 1A0CA 1XH0A 4S2CA 2VDIA 4PN2A 3N9KA 1NWSA 3AYRA 5HWNA 5AKQA 3HPFA 1BWLA 4RDYA 4EKJA 4O1FA 2DT2A 1OYAA 3W7QA 1QO2A 4WGXA 4UFKA 1HXJA 2OQHA 2P0IA 3VIJA 3MCMA 1QTWA 3NZ1A 1SFLA 3OBAA 1DTNA 4R34A 1XIHA 2W67A 3GW3A 5BNKA 2V5JA 1H50A 8XIMA 5AN7A 2FTYA 4O4VA 3W2MA 2FZDA 2VR2A 3VE9A 3S9ZA 4OGZA 4FXFA 5FSEC 1O94A 3D6NA 1MEIA 4C60A 1UWIA 4AMAA 3TTEA 4DBUA 3EWZA 5HNTA 1Q63A 1LP6A 2HNHA 1R9XA 2O4MA 3VVGA 3WBAA 3K1GA 1GOQA 3RJYA 4PL2A 5HR7A 1KRMA 3F1QA 4UR7A 3CH0A 2OEJA 5C9WA 2F9RA 3AZRA 3VAVA 2YOCA 1QPOA 3SB0A 3L2MA 3WDJA 3LXBA 4LU0A 4ZO8A 2BHZA 3FGCA 1YIXA 3LCXA 4TVUA 4PRWA 4MNMA 3LENA 1VD6A 4D6CA 2WSPA 3W7HA 3VGHA 3UR5A 3LU2A 2ZADA 1OEPA 1V51A 3DBPA 3UXAA 4HMCA 4BY3A 3WF1A 3J7HA 1BLIA 3NM3A 2XPKA 3U2EA 3VKKA 4ZGYA 2YZRA 4JTTA 2E40A 2XM2A 3UCQA 3IJQA 4JNZA 3TJ4A 1VRDA 3CUHA 4ALDA 4P8WA 3RUBL 3GXMA 4PSPA 1E1CA 3W9ZA 1E6QM 3AXHA 1BFNA 1FUYA 5ABEA 1K03A 2O55A 1A49A 4O8RA 4UFHA 4OJYA 3V0TA 1WBHA 3W7IA 1Z9AA 1CGXA 1S5TA 1EWDA 4DJFC 1PYMA 4XAFA 1ZBKA 3FVMA 1M7XA 2G0WA 3C86A 4KBXA 1XRVA 3WLQA 3DFNA 4KW2A 2NW0A 3CWHA 3AHXA 5CSYA 2CPUA 2ZZ2A 4GIRA 1V77A 4DZIA 4W8BA 3BARA 1Q4NX 5I79A 4GZEA 5F4XA 1VBJA 4I9TA 4N0RA 4F2UA 4RNJA 5DELA 1J93A 1TRIA 2FGZA 3BLEA 1P0EA 2VXNA 2CXEA 3ZLHA 1TPVA 5A6SA 1Y8BA 5E0KA 2ZRUA 3P8JA 4HSNA 5A8QA 1VFTA 4LXFA 1V7AA 1FDJA 3AS0A 3UNDA 4WDXA 2FGBA 3VYLA 2VHLA 3MSGA 3AU2A 3OBEA 3H4WA 4AVNA 1AH0A 2CCRA 2YYTA 1C7SA 4OWGA 1MVYA 3VK5A 4OZOA 2IPFA 4CKQA 3U2CA 4HOWA 1FKXA 4ZO7A 2JKEA 4ZZ9A 3DENA 1UR8A 4QQUA 1XUUA 5H1WA 2ON3A 5LXEA 2ISWA 3WNLA 3IPWA 3P80A 3TWBA 2QCNA 3GFXA 2NUYA 4WHBA 4GZIA 2PC8A 5IRPA 2XFWA 2UY4A 5HULA 4HOZA 3TQ0A 4Q32A 4XKYA 3LCWA 3TCSA 3MMTA 3LERA 4UFMA 1KFCA 3H4XA 2E6YA 4Q4RA 1J11A 4R53A 5DY3A 5CGQA 1R3YA 1WE5A 1WXJA 3Q67A 3CMFA 4H19A 3CK5A 3B05A 5A6LA 5I3IA 2ZIDA 4X60A 1OHLA 4Q8WA 3BG9A 3S1GA 4UC5A 3R12A 3HZ3A 1ADDA 2E77A 3U2OA 4X61A 3ARWA 1IZJA 4LYPA 4IIEA 1KC7A 2YJQA 2ZRXA 4KWVA 3NPVA 1EGZA 3GDKA 4BI6A 1HL9A 3AYSA 4A8IA 1M7PA 1U1JA 2RDTA 4B5SA 4IT1A 1LJYA 9XIMA 5I3FA 4JPGA 1VPYA 1G01A 5F2MA 1P0DA 1LF1A 2C1IA 3WLKX 4QDMA 4TOQA 1ODUA 1XLKA 1I2QA 3M6YA 2BB0A 2PDLA 1T99A 2PDGA 2QXWA 6A3HA 4DUOA 1FWEC 1UQYA 1JZ3A 2YIHA 5AVHA 2ODOA 3WSUA 2ATSA 4CLMA 3ENLA 4IOTA 4WJ8A 4LC6A 4JICA 2GLKA 3U7VA 1R3TA 3WQ8A 1TA3A 3VI2A 5M2FX 3QN3A 1O6IA 4B15A 1JD9A 2Z1VA 4HPJA 1SFTA 2OSYA 3G5EA 1TWWA 4DM1A 2VD8A 4C6IA 1GZ1A 4WK9A 4J2PA 3W73A 2DQWA 3GXPA 4M5PA 4IWWA 4DBSA 1SSDA 1OZMA 2NLIA 2PDCA 1UPPA 1AW1A 1HIZA 5EY5A 2A6LA 2GQAA 2W27A 1J01A 5FJOA 2OYLA 2CLOA 3APTA 1ICQA 1W1IE 2FTWA 2J77A 1YTDA 3E12A 4PUWA 1V6XA 1LWHA 3DI1A 3CPGA 4HU8A 4JTUA 4GNKB 3WCZA 2QJNA 2XIIA 3PB0A 5AOUA 1M7OA 3ABXA 3VE7A 1AJZA 2QMKA 2OXNA 2OEMA 3ZR6A 3IARA 5FJTA 3NGFA 8RUCA 2FZNA 4P7NA 4GK8A 3ARVA 4JQ3A 3B8SA 3EOEA 3T78A 3MVTA 4M7TA 7XIMA 3VINA 2FPYA 1F3EA 2DVUA 1DJGA 1E73M 1DPMA 5EMMA 3ID7A 3CZKA 3EX2A 3QKZA 2EPOA 4BEUA 3H7RA 2EAWA 2POZA 3HGRA 3N1AA 3VA8A 4AH7A 1SFSA 3UFYA 4XWUA 1BYDA 3T9PA 1XIEA 2WWDA 3I7QA 1LLOA 3ZWTA 3A4AA 5HMDA 2OWCA 4GQ0A 3MI2A 2CWXA 4NF7A 4PH6A 5DN1A 3D3AA 2VCCA 3AXXA 2WV8A 3KRUA 4E2OA 3RO6A 2WK2A 3F5KA 3SQLA 3PBGA 4GX9A 1UASA 3R5EA 1IEVA 3M0VA 3VNDA 1UH4A 1W56A 3O07A 2QHAA 3QKEA 4LOCA 1W54A 1DXIA 1DXEA 1GJPA 4MAZA 5CBJA 1GVYA 3WJWA 3QGKC 3MKVA 3COTA 1TPDA 2Z7KA 2Y7EA 4Z1AA 3S0CA 2IMRA 4M24A 1R6WA 2VZUA 3RG6A 3BAIA 3WF3A 3OEXA 4H9VA 3SN1A 3CIXA 4TMCA 3HJZA 3LGGA 4KIRA 3WN6A 1I4NA 4TV5A 3IANA 2HV5A 5ECUA 4MB1A 3WH8A 1JI1A 3VFCA 3MHGA 3ONBA 4XQ6A 1P5BA 4IGMA 3U6WA 1EGMA 4IZGA 1R87A 2PC4A 3MUY1 1CZ1A 3GTHA 4YN5A 1NARA 1EKOA 5K9XA 4YWSA 3VCCA 1BEUA 3E38A 3CYJA 4NZ5A 4BQ2A 3GLCA 2V3EA 3KVJA 4CNUA 2D1ZA 4PUMA 1CIUA 1WCGA 3MYOA 5KZEA 3PVFA 1TX0A 5DLCA 1V8EA 4DB7A 4Q8MA 1UKSA 2Y8KA 2FMNA 4L1WA 1MDRA 3SCPA 3KOWA 3LA4A 1W32A 1V3MA 3N2TA 1GQLA 2G3NA 3G6LA 1EGVA 3WY1A 2H3DA 1ELSA 3EX3A 3W7RA 1P4CA 3TH6A 1X8CA 1E4LA 5JBEA 3TEVA 1S1PA 4K6AA 4ML4A 2O92A 3GH7A 2ZVRA 1XV8A 4Q4PA 2NLYA 3N6QA 4PMZA 2RDWA 3A3XA 5A6TC 3S5YA 1IR2A 3KOYA 3TMLA 1EDGA 1E15A 2ABAA 3GTFA 3BW4A 2XSXA 4L9ZA 3W7CA 5CGTA 1WV2A 4MDPA 3IIVA 4WZHA 2Y8UA 3SGUA 1B90A 4B5NA 4YPJA 4FEZA 5A5WA 2D2OA 4NRSA 1E6XM 3HURA 5L9FA 2JE8A 1RQBA 4PBEA 4LAKA 3M0LA 3A47A 4GACA 3OQ8A 1J6PA 4OE7A 3AFBA 2QNEA 3CGTA 4I8DA 3W2NA 2HBXA 4F2TA 3BUVA 4E6MA 3NZRA 1MW2A 4C6CA 4WR3A 4DYJA 3L68A 4CQCA 2EKCA 3HGJA 2QCFA 3R6IA 3SIMA 2H8ZA 3VNYA 1G4TA 2ZDSA 3EMQA 4YTSA 3JU2A 3TYZA 5C70A 4ZB2A 2XVGA 3AAMA 1CBGA 5T91A 5A2CA 4HK7A 3FJNA 1WOAA 1VQTA 4HNCA 4HCHA 2WNNA 4G5DA 1YTKA 5D9MA 3RU8X 3NEHA 3PBWA 4NRRA 1GGOA 5FEXA 3GDMA 4HU0A 1PTAA 3GXFA 4GFIA 4KFOA 3LUTA 3LN3A 4C6NA 1K9TA 2BVDA 2UBPC 4S3KA 1RY0A 3W6LA 3KTSA 4OHQA 4FAMA 4P5UA 4R7WA 4BI5A 2WANA 5I78A 3MP4A 2OCZA 3A5VA 3UP8A 1GOKA 1E55A 2BVYA 4MNLA 4Z2IA 3GSMA 3UYIA 3D47A 3TN6A 1WQ5A 4C5ZA 2GOKA 3SQMA 3W22A 5H8PA 3NSNA 2PGWA 4K7YA 3WEZA 1CWYA 2OODA 3N13A 4EWND 2G95A 4IG2A 1Y5VA 4WVXA 5JXQA 1J4EA 3TONA 1ISYA 3M64A 2YYUA 1ICPA 3BLIA 2CU0A 2VEMA 3BXWA 1IZCA 4OU1A 2RKXA 1R2TA 5L6UA 4MSSA 2AGTA 3CZLA 5TIMA 3HG5A 2G3FA 3T07A 2ZKMX 3E5PA 1ODZA 2KAUC 2Z1BA 2J74A 2TPSA 2ZUNA 4CEXC 2DQXA 4HJWA 4DY1A 3S2NA 1A5BA 3KCOA 5C7VA 1Z44A 3DXIA 1F9CA 4GA8A 3AOFA 4ADTA 1VYPX 3W88A 4GUFA 6ENLA 4O54A 2CLMA 4S23A 1TB3A 2PF8A 5TAOA 1E6ZA 1XCXA 4FIQA 1I2OA 1GEQA 2G3IA 3BGGA 2FB2A 3LI0A 2TMDA 1VBRA 1KW1A 3TLQA 1OGGA 4Q8VA 1XLEA 3UCCA 1UW9A 3OIHA 1E9ZB 3TW7A 2WB5A 2HPIA 2TODA 4FLSA 3T0CA 2WWCA 1UQZA 2DUXA 1DV7A 3RX4A 3H7UA 3SCRA 3MVIA 1H63A 3C5QA 3WQEA 4TTUA 4AQLA 3SQSA 4OQVA 3QTGA 2V30A 3BV7A 1WZAA 2WAGA 5PTDA 1RBOB 4NU7A 4XZMX 2ZC8A 1CTNA 3CEUA 4NZ4A 1RQEA 2QW5A 3G1DA 3MBFA 1UKOA 4FLQA 3SN4A 1WAWA 2WHJA 2Y63A 1JPDX 2HE8A 4YCOA 1K9EA 2HVNA 4N6FA 3GUWA 5AHNA 1ZB5A 3GM8A 1PBGA 1F5ZA 4O52A 3QC0A 3N14A 1LBLA 3G1FA 2XIOA 4JTDA 1VLIA 2YBTA 4IXXA 6XIMA 3CL6A 3P61A 1EUAA 1XYMA 3L4ZA 3UG8A 3CBWA 1P1XA 1NWRA 2XFFA 4HYVA 3HN3A 2WC7A 5REQA 1OYBA 4C6MA 2A3BA 1VH7A 4G8TA 3VKDA 1NH6A 2ZWYA 4IH3A 5BOOA 4P7RA 3KHJA 1FFRA 3VD9A 3QQ0A 1FHLA 1PTDA 1IEQA 2CZ5A 4D9PA 3P74A 1OABA 3EB2A 4J27A 4K38A 1QI2A 1DJQA 2E09A 3S42A 4PB3A 3IJIA 3DKJA 3SCVA 2QV5A 3SADA 1SW7A 1AQMA 4NJKA 1K02A 1SSGA 3VOGA 2AQWA 3UT0A 5LSMA 1R2RA 3HMJG 2WJFA 1XM3A 3Q4DA 1E1FA 1N8WA 1UMYA 3DC0A 2I9EA 1OG0A 4RX0A 4GFSA 4RE0A 1GOOA 1FCVA 2OO0A 2UZ9A 4DJFA 2IS7A 1V4YA 3C56A 1QPRA 4ZFCA 2ZTJA 3SCOA 2G3MA 1I2RA 4UTIA 5HINA 4ZB5A 3O2LA 1OCNA 4W4QA 1Z8AA 5H2ZA 4PTMA 3W4RA 3U7BA 2OMAA 4C6FA 3DYPA 2C16A 3F4NA 3AWOA 4O11A 4YL2A 2YDAA 4A3QA 4XZBA 3T0BA 1KFKA 5JVLA 1XBYA 2Z29A 4B90A 2OEKA 3BGAA 3VNKA 3MQTA 1KKRA 4R27A 3GTNA 3ALGA 4NZ3A 4JL1A 3MHUA 1TIMA 1A4LA 5K7JA 1XISA 2E9BA 3UBPC 4N4QA 4AX6A 4XZ9A 3FYPA 1IT0A 3LYEA 3LRMA 3ISIX 4U31A 2QS8A 1M01A 1O12A 1KTNA 1SJAA 1EYWA 4Q22A 8CGTA 1OT2A 5CC6A 3L7RA 3H8AA 1AK5A 3SCUA 4LCQA 1A80A 3TTSA 1UIOA 3GZAA 3C6CA 4GJJA 1EEPA 2X7VA 4Y9AA 3CO8A 3M0HA 4DLFA 1WO2A 1H41A 3QMTA 3VMNA 2VZVA 2PGRA 3WFLA 1UMLA 1Z7AA 4ILSA 3GRIA 2WVVA 1GEHA 3MHFA 1YE4A 3K1DA 2GJXA 1CGTA 1XINA 2ACQA 3REQA 2IKHA 2QCEA 4IP5A 1VB9A 5ABFA 4GQBA 4NASA 4O1CA 2NUXA 3VDGA 2QZRA 5I23A 2IPGA 4B5TA 1A5NC 3ZJ8A 1MXSA 4POCA 2Z28A 2EPLX 1BXBA 1JUEA 1E9IA 4MKSA 2V2HA 4HT3A 2QCDB 4B9YA 4LANA 1AMYA 1NELA 4D6EA 4AY7A 3EX6A 3WENA 1PKYA 3N73A 5U4NA 3WLRA 4CD7A 2CLKA 5CZTA 3BCDA 5FESA 4HQVA 1TV2A 3I4EA 3LTYA 5TQLA 2G50A 1ZP3A 3B9DA 1Q7MA 4O28A 1ZBWA 1UD6A 3CUGA 1UP0A 1DXFA 3N25A 1A5KC 4V1XA 4HCDA 2BVTA 1TJPA 4WLCA 4Q4KA 3KE0A 2VEPA 5D02A 1MNSA 3IS4A 2C3ZA 2XGZA 1NTHA 3EA1A 2DT1A 3R79A 2BSLA 1EC7A 3CXOA 3WD4A 2WMGA 3AIEA 4I5UA 4D2JA 4PFHA 2X7WA 2ISVA 1KTBA 1OFDA 3PZMA 2ICSA 1OM0A 2O9TA 2P53A 5AHFA 2CEQA 4AIBA 3C0QA 4DLMA 2PDUA 5KTLA 1TZ9A 1F74A 1UWSA 3N9SA 5CC5A 1F6YA 5I2UA 1RD5A 1W3HA 4BA0A 3W82A 3V18A 1Q13A 2F6KA 3GIYA 1XBXA 5SWUA 2X41A 1LT8A 2YLLA 5DMYA 4HA1A 4AZBA 3WJYA 1XIIA 1X7FA 2WJZA 2XZ7A 4Y2WA 4UTHA 4E5TA 2YCLB 4IPNB 5B80A 3AU6A 3BG5A 4GC4A 5AHEA 3LXCA 3SDOA 5DBUA 1XC4A 3SRHA 2AGKA 4GVFA 2JKPA 2XU2A 3H2FA 3WUBA 4HYWA 4HU3A 1WX0A 1PIFA 1MW3A 4W93A 2ZOXA 3ITTA 4MG4A 3GHRA 1PKMA 1ECQA 1GVQA 2EPNA 2Q09A 2ZUMA 4O14A 1JULA 1I1WA 3TX9A 2PS2A 2W79A 3IVUA 2PTZA 1RD6A 2YGYA 4PMDA 4L1XA 3WLPA 2XZ9A 1KNWA 1YYAA 3EPMA 3EB3A 3CL8A 1A5LC 2EF9A 1BSIA 5XINA 2VEGA 4PCFA 3PBMA 4JHMA 2A85A 1JZ7A 2ASHA 1KFJA 4ZCWA 5F7UA 4W86A 2XH2A 5TBOA 3W28A 3QTPA 2B7QA 4PUNA 2FHCA 1EQPA 4N6EA 1QI5A 1KFEA 1O60A 5C7HA 4LVFA 3VOJA 1NWTA 1UBSA 2R14A 2BASA 1JVNA 5C5YA 3TFXA 3CPRA 2D23A 4PMXA 1TCDA 3WX7A 4A3RA 1UWTA 3UJEA 3VIHA 3UXDA 4XB3A 2EJAA 3M47A 2FVMA 2FZ9A 4IPLA 4KPLA 3H2EA 3WL1A 5FF4A 1XG3A 4R85A 2GVEA 1PDZA 4M1RA 3N3TA 1JEZA 5I3HA 3GS6A 4JXCA 1B31A 4RZ6A 1NSJA 1FH8A 2XSAA 4GGBA 2I5QA 3GDRA 4CN6A 4PBGA 3AQUA 1BRLB 1JCJA 4L7ZA 3KVKA 3TVAA 3S5OA 5ABGA 2BY0A 3NVTA 3B06A 1DP0A 1H3GA 1LYXA 1Q5MA 1E56A 3VDAA 1RXOB 3I65A 5F2IA 2J78A 1DIOA 5D9PA 3T55A 5F2LA 3IVSA 3LRLA 2QKFA 4YTUA 1X97A 3W7JA 3M44A 1VBGA 1A3HA 3KOXA 3UZXA 1RA0A 1D3HA 3R11A 1OX5A 2RAGA 3GFZA 2DZXA 3K4WA 3CHEA 3D46A 2Z6IA 1Q7ZA 1FWBC 3WH7A 3N2BA 1SR9A 4JKMA 2VQUA 1D8CA 2QCMA 3AZSA 4I7VA 4ROQA 3NQ2A 3TAOA 1H1NA 4ZMGA 1RJRA 4MJMA 3HF3A 2DW7A 4ZSUA 3F2DA 4B91A 4F0RA 1DE5A 4H7CA 1UBPC 3DFTA 4EF8A 1JCXA 4O15A 4N9EA 5A69A 4NI3A 3LLFA 1XDLA 2D2HA 4H9TA 3I10A 3MMWA 2WPGA 1W9XA 3NXFA 4WQ6A 1BWVA 1UPMB 4E4UA 4UTLA 2YX0A 4ZFMA 4CU8A 1XGDA 1K6WA 2NQJA 3ZJ6A 4IMCA 1GPFA 4QE1A 2OZ3A 4LB4A 4MY9A 3PBVA 4JQ2A 3UG4A 1CXIA 3GVRA 3KWXA 1JDDA 4LWWA 4YLWA 4WDTA 4TO8A 2VOMA 3RU6A 1XQLA 3UJFA 3GG0A 1HJWA 5IOBA 4LB3A 5K9DA 4PC8A 3HPZA 4WX2A 3IUIA 1P0BA 2R1PA 5IHSA 5D2XA 3WQDA 5M5DA 4C91A 2I7GA 4ATDA 5E6ZA 1O95A 4XIMA 4GG9A 4KRUA 1TE1A 1AH3A 2A1YA 5CSSA 1H7OA 4I5RA 3CLMA 4JTAA 3AS1A 4ACYA 2Y61A 3BO9A 3DHUA 1KRAC 4GRSA 2PGEA 1FWWA 3W00A 2BGNE 3WJZA 2NVDA 5H6HA 3E0LA 4RNFA 1AD4A 3SUSA 3AYVA 4YWIA 3NL3A 1AL8A 4DZ5A 4V15A 3O6DA 1JDAA 1HVQA 4IQDA 5U7SA 2GQ3A 1E5JA 5ABHA 4YTRA 2WSYA 1F2JA 3OW1A 3I6TA 1AZ1A 3GHTA 3H7VA 1QR7A 4UOZA 3B0XA 1OBAA 1X6NA 4WY0B 1A5MC 4G1KA 5DEZA 2ZUUA 3IJDA 4B4HA 3VMOA 1Y7VA 1OB0A 4KQNA 2VELA 1F76A 1R5YA 4HPHA 4QS5A 2BXZA 1ZJIA 1EQCA 5HMFA 3FHAA 1JPHA 1F6KA 5I77A 3G1RA 3DX5A 3EWUA 1ICSA 1KBLA 1F8MA 3IJ8A 3SSJA 3WK2A 3RMEA 4TMBA 1H1ZA 2EPHA 5JBFA 3OG3A 4C6PA 3VGDA 3WUFA 4UCGA 3ZLFA 1KCKA 3MI6A 1GQNA 3K5XA 3RNDA 5DCEA 3LHZA 1HN1A 4X22A 3JZUA 4GI9A 1HJSA 4Y9MA 2QJHA 1OQFA 1B3ZA 4N9DA 3S9IA 1VFUA 4C1NA 2E5CA 3DI0A 2YZ5A 5H8MA 2FVLA 3VOIA 1CGYA 2WC3A 4W9TA 3A21A 3B4UA 3D3FA 4C1LA 3DHPA 2VC9A 4FB7A 3S8HA 4RDWA 1UZ4A 4A8NA 4AZCB 3BOLA 1YNYA 4ROPA 4ATWA 4ZQPA 1DQUA 3UWEA 3G1HA 1KBIA 3LB0A 1H51A 3UG3A 4NXSA 2H6RA 1B5TA 4O0KA 3LBCA 4FF7A 5JU6A 4PTDA 1HKWA 2VWTA 4K37A 4DJDD 1JF6A 4FO4A 3PWAA 5BOEA 1EX1A 2CWNA 4EACA 4FSAA 3BLLA 3O0FA 3WBYA 1XLHA 3NQ6A 2VOTA 4NZJA 3GXTA 4AF0A 1GJWA 2X8RA 3PPHA 4MZ8A 2BOGX 1U1HA 1B3OA 3K46A 4PE8A 4IPPA 1VR6A 1DJIA 2Y2WA 4ZE4A 1SZNA 2BLEA 1H5YA 3UD6A 2FKPA 2HRWA 2XYLA 2V3FA 3I6RA 2QF8A 4WOQA 4NAFA 3U8GA 4QLJA 4HNVA 4TR9A 3II1A 3C0SA 4GCXA 4Q8OA 4PRRA 1OX6A 3CWOX 3K2GA 3LI1A 3WBXA 4O0QA 2YL9A 2IKGA 2WVUA 4EPEC 1M03A 5KITA 1PZ2A 4KEUA 1KM2A 4JZ5A 3AXIA 1VFFA 2AQVA 2RGLA 1M41A 4D8LA 1BHGA 3OPSA 4F79A 2WMIB 3RPTA 2UY2A 3GXNA 2VJXA 4JQAA 2GGIA 1P48A 4CNNA 1FWRA 1NDWA 4GVGA 1QRQA 3QW3A 4D6IA 1OC6A 1XH1A 2PU1A 3EWXA 2QJIA 4YTQA 2Y7DA 5GJNA 3P0WA 4CD5A 2QPUA 4PUKA 4E8DA 3ES7A 1T40A 4J40A 5HATA 3P81A 1HVXA 3THAA 1J79A 3HPXA 3WLIA 4HN8A 3NFUA 4RCXA 4AVFA 5TF0A 3LX9A 4C6EA 2A7PA 3FX4A 4GI4A 4L56A 4D71A 3CTTA 2ZUVA 1CGVA 1B0IA 2Q02A 1K77A 1TVPA 2OO6A 5HAOA 4D8ZA 3T7VA 2CIPA 1EO7A 1P43A 4Z1YA 2VEFA 1JPMA 1WKDA 1VF8A 1WUFA 4NJGA 4WXYA 3FXYA 5FF2A 4H04A 2YW3A 1E6RA 3MJYA 1MQPA 4WJEA 4XBJA 2WMFA 5LYRA 2G4JA 1AA1B 4UQAA 2ZX8A 3RR1A 3MYPA 2QCHA 4OBRA 3IWPA 4UMCA 2VKZG 4PFMA 4FPSA 2CW6A 4NKCA 2RHGA 4LV9A 1KWKA 2AQOA 1LRNA 3NXLA 5GPRA 3F4DA 5CPMA 5I03A 2FZMA 4Z17A 3R0KA 5K9CA 3W7LA 1KA9F 2ACUA 4LVDA 2VRQA 1BQGA 2QUUA 1H4PA 3MSYA 1OWQA 3ZR4A 2R91A 1GKRA 1ZJAA 2B81A 3QQWA 1EF2A 4IGSA 4KRTA 3OGRA 4RJEA 4DO5A 1Z41A 5HR6A 3S47A 3N4AA 3HQNA 1JZ5A 3EDFA 3C3NA 1UZHA 1GOXA 3ZVHA 3H21A 4PL1A 3PWGA 1K8CA 2HS8A 4JD4A 1KM6A 3SN0A 1E5NA 3QFEA 2AL2A 2E7FA 1OC5A 1XHGA 4DN1A 5M17A 4XD5A 2R8WA 1GOMA 3EBVA 3MS8A 2LLEA 3PZQA 2PRMA 2BWGA 4J7RA 4A2SA 4NP7A 4MDOA 5JH1A 2WC4A 2ZUWA 3L0GA 3LK6A 3QEZA 1YBQA 2PZNA 1HKMA 1EB3A 2PTYA 3LCFA 1O5QA 1EA9C 2QCLA 5EPDA 3TDFA 2Y70A 2JF6A 2Q3RA 3IVTA 4BR1A 3LD5A 2OOFA 4CN1A 1IV8A 1HO4A 2OZ8A 1R30A 2C18A 4I9JA 4HPXA 3B9AA 3ITXA 2V5LA 2FYMA 1JPIA 2D0FA 1C7TA 1W8SA 1JYXA 3W1AA 2WZHA 4BI7A 1K7FA 1UZDA 1J96A 5FI8A 3PJWA 4K8HA 1SUXA 3VOCA 2L5HA 3C2EA 3EOUA 3U3HA 1GG0A 4LUSB 2GL5A 1TTIA 1POJA 1QW7A 1TVNA 1TTJA 3T40A 3A22A 1CB2A 1WXZA 3I7SA 3GXDA 2NV2A 2WHMA 4OVXA 4XD6A 4HMNA 2PDXA 3V5FA 4V2XA 1ZNNA 3CZGA 4AEFA 3SUTA 3RCMA 3OA3A 3IJLA 4QBXA 2DSZA 1G67A 4XIAA 3U2ZA 5J5RA 4W7UA 1EOKA 4GH1A 1OCJA 5FACA 1NDVA 5EMYA 4N7QA 4MM1A 5D32A 3CS2A 3GD6A 1UWAA 4YCPA 1M9HA 1TMLA 2QUNA 2DJLA 4KERA 3G0UA 2JGYA 4Z2HA 4GCAA 4E3TA 1YDYA 3CHFA 1Q6EA 3QHMA 5AHIA 3NQFA 3ZT5A 1EZWA 4GY0A 5JH2A 3FW6A 2B7OA 2XM1A 3CJPA 3AMCA 4IMFA 3CO4A 2E25A 4KETA 2Z6JA 1GZGA 1H49A 1JAKA 4WJXA 3NOYA 5AC7A 3PFMA 1Z89A 2G37A 2PWUA 3HU7A 2DV0A 1ZS2A 4MZYA 4Z2LA 3W2LA 3C0LA 3LCHA 2Y24A 1ALDA 5D05A 4FX6M 1DKWA 4CD4A 1ZAJA 2I5IA 2A0NA 2WOQA 2CKSA 1JNDA 2VCAA 1QASA 2C13A 3T6CA 2DEPA 3SAZA 4QG6A 1OK4A 2PMQA 4BF5A 3THDA 5GNXA 4CVWA 5JUVA 3EMZA 3UVAA 3KVLA 4L4MA 2HK0A 2PAJA 3R4IA 2GQ9A 3OLDA 1W9VA 2E67A 4DYEA 3ANVA 4NNAA 4F0HA 4LTSA 3O7UA 3DFPA 3ANUA 4H7ZA 2PTXA 2CHOA 2OR2A 4LCRA 3I3BA 4PUEA 1ZALA 4ENLA 3FDGA 2BGSA 1Z6KA 5HDRA 3GC2A 3F4WA 5CPNA 1VHNA 2VUYA 3DYMA 1Q6DA 3BLPX 4F9JA 3UCDA 1F05A 1TMHA 2E3ZA 1JZ2A 1JCMP 1UKTA 2AAMA 4UTUA 4JHZA 3MMDA 2HQAA 1W2PA 3M5ZA 4DM2A 3PULA 5FJJA 2YXGA 3SR7A 1MEHA 2VI0A 3ATYA 4US5A 2J7DA 2XH0A 3GHUA 1V03A 1CXHA 4M6QA 1D7FA 4Y8FA 2X09A 3AMDA 4RE4A 2O4QA 3NL5A 2POTA 2XISA 5GVJA 5LNWA 2VGGA 4RE3A 1F3WA 4AEEA 4REQA 7CGTA 1S2CA 2J8GA 4I7WA 1HW6A 4J5NA 2QEZA 7ODCA 3ANYA 4YS1A 4PMVA 4NIRA 3U9IA 5G1TA 4N42A 5A1AA 5CH9A 1E0TA 2E6FA 4L6DA 4GKLA 2HDJA 3NDZA 2NWRA 3STFA 1K70A 3USZA 4N02A 4AIUA 2WZEA 3JS3A 4QLLA 4KT2A 2FQIA 2WZMA 3ABOA 2VFEA 3H55A 4OUIA 5HOSA 1V7YA 3CZ8A 4IQEA 2GJNA 1ZCCA 1DJXA 1VFHA 1AQ0A 3BAXA 3LTPA 3K8KA 3DBNA 4UQBA 3WNPA 1S2TA 4DXXA 3SUUA 5LKYA 4Y96A 3DFOA 4GYFA 4P2VA 3OG2A 2XFYA 4W84A 2WMHA 1J18A 2QVNA 3A24A 3VIOA 1GOIA 2WKLA 4G7EA 4IM4A 2FFCA 3BW2A 4GY7A 1XDMA 2PTWA 4LEFA 1R3SA 1K4HA 4TVDA 4H1ZA 3FSUA 2BXYA 4ADUA 4AFYA 3SO7A 4R7OA 5AB3A 2QCGA 2NUWA 2J88A 3WQGA 4M8UA 1XG4A 3QC3A 2PBOA 2PWEA 3NQA