4PMOA

Crystal structure of the mycobacterium tuberculosis tat-secreted protein rv2525c, monoclinic crystal form i
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
211
structure length
211
Chain Sequence
NLYFQGGSLGTLLDYAAGVIPASQIRAAGAVGAIRYVSDRRPGGAWMLGKPIQLSEARDLSGNGLKIVSCYQYGKGSTADWLGGASAGVQHARRGSELHAAAGGPTSAPIYASIDDNPSYEQYKNQIVPYLRSWESVIGHQRTGVYANSKTIDWAVNDGLGSYFWQHNWGSPKGYTHPAAHLHQVEIDKRKVGGVGVDVNQILKPQFGQWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tat-secreted protein Rv2525c
publication title Structural studies suggest a peptidoglycan hydrolase function for the Mycobacterium tuberculosis Tat-secreted protein Rv2525c.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
total genus 79
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08924 DUF1906 Domain of unknown function (DUF1906)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pmoA00
5BYWA 4CVWA 4PTWA 3WF2A 2ESCA 2G3NA 2D20A 2HISA 4D6EA 3WUFA 4AYSA 4MNMA 1V02E 1RPKA 1AQ0A 1JI1A 1GORA 1BSIA 2FH6A 5E0FA 2Q8XA 1CIUA 3AICA 1LLOA 3ZQ9A 2XFFA 3SURA 2BHUA 2VVSA 3WD3A 4FMVA 1WDSA 2DH2A 3PZNA 2UY5A 3AYRA 1DWHM 4ZE5A 1ZJBA 2DGAA 4EANA 1PIGA 2EEXA 2BXZA 3GBDA 4H7VA 2WCSA 2WVVA 5ABFB 3L4ZA 3WBEA 3K8KA 1FH7A 3BAJA 4CU6A 3NIYA 5I6SA 3BAKA 2QHAA 1D7FA 1UR8A 4PMRA 2VR5A 3QGVA 5E6ZA 1BQCA 1GQIA 4JFUA 3L4UA 3SCUA 1R7OA 1NWSA 2Y5EA 3O2LA 4D1JA 1GOMA 4AEEA 4U31A 3SCOA 2WK2A 2V3FA 4J27A 1OGBA 3AIRA 3AMGA 4D1IA 1M01A 4M81A 5A6JA 1OSEA 4UFIA 1GZJA 1HX0A 4ATDA 5LYRA 1J0KA 5I0DA 4HA1A 1X6NA 2DT0A 4JL1A 5CJ5A 1UD6A 2XVGA 3VX0A 1U30A 5E6YA 1HP5A 3CUFA 2VX6A 3WF4A 2WAGA 1BHGA 4PTMA 2EQDA 1M7XA 4J7RA 4J3TA 4J3SA 1JYVA 4LX4A 2E9LA 2NSXA 1WDPA 1FFQA 1GOKA 4BA0A 1SFSA 5CQ1A 2WZHA 1W9BM 4H8VA 3U57A 1RP9A 2NT0A 2EO7A 3AIWA 1CENA 3W6LA 4UFKA 3W26A 2PBOA 1B31A 2C8NA 4OBSA 4CCEA 4N0RA 2PF0A 4AWEA 3WENA 2WHKA 1BFNA 5A6LA 1P6WA 2WVVB 3L4XA 3GH4A 3BGAA 2WB5A 1PAMA 1B3WA 1V03A 2J8GA 3FN9A 3WEZA 3BLKA 3VKKA 3VD7A 4PMZA 5M17A 4XZBA 2IUZA 1BGGA 3SUTA 2NT1A 4YPJA 5E70A 3WDIA 4PMOA 4AC1X 5CXPA 3PZ9A 4EE9A 3L2MA 3WQ5A 3ZR6A 1OWQA 1CBGA 1HJVA 1VJZA 3GDBA 4R27A 4EKJA 1CDGA 2YL8A 2XGIA 2WCGA 4TTGA 3VD5A 3RO8A 3TP4A 4W86A 2ZIDA 1W3JA 3T2PA 3W53A 4MB3A 2E0PA 4XZWA 1C91A 1HKKA 3NSMA 4B3LA 1YHTA 4MJ4A 3NDZA 2X2YA 2O92A 1CYGA 5A6BA 3T08A 4GQQA 3IK2A 1QI0A 3ZJ7A 2EJ1A 1HJSA 3BXWA 1QW8A 4P7LA 3THCA 2AAAA 3PTMA 5DT5A 5BROA 2E8YA 5IXEA 2XG9A 3WY1A 3VILA 5BRPA 7CGTA 3SUSA 1EIBA 2W5FA 1E3XA 1GNXA 1GQJA 1B3ZA 1V0NA 2WYSA 1CXHA 3WDQA 1R8LA 3WKZA 3ZR5A 2YLLA 2DPEA 4AIUA 2YKKA 1MW0A 3ARPA 3QR3A 1JDDA 5A8OA 3N13A 2A3EA 3PZUA 1I1WA 3ZT7A 4WSJA 4GXPA 4TVCA 4HU8A 4HP5A 4L4OA 2W61A 2GFTA 1WZMA 3SCRA 2BY1A 1FHDA 2EBNA 3WDRA 4AEFA 3OLIA 4RL3A 2JIWA 2J7EA 1UH3A 4UZUA 5CSYA 5HNNA 2VO5A 3HN3A 2WMFA 1K9DA 2VQUA 4B3KA 4UOZA 1BYCA 3F5LA 1EOMA 2ZUVA 1ISXA 1GJWA 2DT3A 3PZIA 2UY4A 1EDGA 2D23A 4B9YA 4AZGA 1EO5A 3VIFA 4M56A 3W24A 4W87A 4B16A 3VU2A 1JZ5A 5JUVA 2PWEA 5HBFA 3N12A 2ZUMA 4ACYA 1NP2A 4NI3A 1E6QM 3K8MA 2VC9A 3OA5A 4WIWA 2AOSA 3BCDA 1UWRA 4AW7A 3GM8A 1ZU8A 3UG4A 2ZWZA 1GPFA 2YA1A 1FP8A 2PWDA 4OJYA 4F9JA 5M3WA 1K9EA 1E1EA 1H09A 2DSWA 1HIZA 4PMVA 4W5ZA 2J75A 4HZ7A 3KE0A 4NF7A 2CBUA 1HJWA 3WQ8A 2D24A 1C3FA 1CZ1A 3ALFA 1JAEA 1WCGA 2WW5A 2W63A 1R85A 1JYNA 1OD0A 4HA3A 1UQZA 5LA0A 4Q7NA 3BSGA 2WC7A 4UQEA 1EHNA 3UEQA 4KGJA 1UQYA 3VVGA 1GJUA 4CD6A 3DC0A 2UWFA 4TVDA 3SCNA 3T0AA 2W67A 3VUPA 3WDPP 2FHBA 3UETA 1NWRA 4ZXLA 3AIUA 3ARUA 4XUYA 1CECA 1BVZA 3UESA 1PZ3A 2O9TA 3ZJ8A 3ARYA 3MUZ1 3D3AA 1W3HA 3M7SA 2XTKA 2CERA 2IXVA 2D0GA 2ZXBA 3CZ8A 4W8AA 1E71M 1E4IA 3CUJA 2J7DA 2ZE0A 3WL0A 5LA1A 1UD2A 5AYIA 4MADA 1VENA 5CSUA 1LG2A 1V3JA 3TTQA 1IV8A 4CKQA 5C8BB 1A3HA 3OGSA 4F79A 3I3EA 5HXMA 1VEMA 3RM8A 6A3HA 3KWXA 2YDSA 3VGFA 1J10A 3VIJA 1ZBWA 4PMYA 4PSRA 4AD0A 2XVKA 5A6MA 4FLQA 1XYZA 1UD3A 3GBEA 3WDJA 4X0VA 1NOFA 1EQCA 4KGLA 5I3DA 4PUDA 2VRQA 3WH7A 3WNLA 1JL8A 1D2KA 3N18A 3W28A 1DWJM 3CBWA 4W85A 1VFFA 1OINA 1NWUA 1E6PA 2BY0A 5D8ZA 3VM5A 3IJ7A 3CHCA 3RJXA 2VTFA 2XWEA 1UR9A 2VZVA 3GNRA 2GSJA 4AZ6A 1U33A 2E8ZA 2WMIA 3MUIA 3VIMA 4JAWA 3VD3A 4GPNA 4OIFA 1SMDA 3CHFA 4PMDA 2OYLA 5GNYA 3ARQA 1V6WA 2FH8A 1CLXA 1CXIA 3THDA 4GO9A 2AMGA 4W8LA 3QOKA 4QP0A 3BAYA 4D6FA 5DF0A 3MV01 1JZ7A 1KR0A 1YQ2A 3WH8A 2VX4A 1LG1A 3PZQA 3VIOA 3VDHA 1OIFA 3FW6A 3RPMA 4U5IA 2OWXA 4UR9A 1L0PA 1JFHA 1UWUA 2DSZA 3BMVA 3WD2A 3FNDA 1UD8A 3VGGA 3UR8A 1W9PA 1OM0A 4OZOA 3ZOAA 4DWSB 2CHOA 3U7VA 4P7OA 3QHOA 2CXGA 2DIEA 1VRXA 3ECQA 2ZOXA 4IPNB 4AD1A 4P7QA 4MNJA 2YIHA 1UKPA 1LF1A 4OUEA 1F4HA 2J7HA 1DWGM 3IJ9A 3QHNA 1EXPA 1J12A 3FAWA 2E9BA 1J18A 1SR0A 4AZHA 3EDJA 4M1RA 1TA3A 3AI0A 4F8XA 2G8ZA 1R87A 3W38A 3EMQA 2QPUA 4QLKA 3GH7A 2EPLX 3AZRA 1C90A 4HPGA 1WNOA 1MXGA 1GOQA 3K1DA 1IT0A 3T09A 4UFMA 4ZENA 2WLYA 3SCTA 2WMIB 3AHYA 1O6IA 1OD8A 1B0IA 4HOZA 1WZLA 4UOJA 1GQKA 1JI2A 1KBKA 5I5RA 1PZ2A 2BVTA 4PMQA 1KGWA 1ISWA 1ECEA 4NRSA 4N42A 5I24A 2OSXA 1UHVA 4AISA 4AMCA 2QF8A 3MUAA 3PHAA 2WHLA 1JAKA 7A3HA 3GXIA 1BYAA 1ZBKA 3W37A 1V3IA 3I3BA 5F7UA 3POHA 4KMQA 1TZ7A 3TTSA 3WNMA 1ISYA 4NSBA 1NQ6A 1QBBA 2WMJA 5LA2A 1B3VA 2CYGA 2D3LA 4HOWA 3DHPA 1OT1A 4Z2LA 2ZUTA 5A94A 1B90A 5EBAA 1A47A 1E6SM 3TONA 2CBIA 1MW1A 4MNKA 3TA9A 3MMDA 1ISZA 4GQRA 1U2YA 1UD5A 3VIIA 2BNJA 2OLHA 1J9YA 4UNIA 4LXFA 1EGZA 4DUWA 3W4RA 3LPGA 2CESA 2GUYA 2D3NA 3SCVA 2VX7A 3UERA 5CPQA 4X9YA 1US3A 3TTOA 3N04A 3T2OA 1EHAA 1VFOA 4KRTA 1ITCA 5A2CA 1V0LA 4V2XA 3KL0A 3MUY1 2WANA 4KRUA 5A6SA 4DM2A 5A2BA 1K9FA 4V27A 5IFPA 4LYQA 4Z2KA 4UQCA 4KWUA 3ARSA 4Z2IA 2YA0A 4AIEA 3OZPA 4JFWA 1E56A 1E6ZA 4HMCA 4UQ9A 3VNYA 4J3UA 3VINA 1C8XA 1VBRA 1C93A 4Q22A 3A4AA 1R86A 2F61A 4GZJA 1CPUA 4CN6A 3NSNA 4M80A 2OWWA 3WQVA 4W7VA 4ZEPA 5FOOA 5E0CA 1IZKA 2Y24A 1LL6A 1LL7A 3VMOA 2X05A 2J7FA 5ABGA 3L2LA 1VFMA 4M29A 4CN1A 3OLDA 1AQHA 3ZSTA 1VB9A 3OZOA 1XV8A 4CGTA 1V6XA 1Y7VA 4QAWA 4WKAA 2J79A 3RILA 1JD7A 4JKKA 4IPLA 5A6BD 1JIBA 2WKLA 3W6MA 5BXSA 1QI4A 1K9TA 4W7WA 4WJXA 5JBDA 2XM2A 3PZOA 3TOPA 5EFDA 1HN1A 1JD9A 3OLEA 1HJQA 1XCWA 1QPKA 4QCFA 2V38A 5FL1A 3WUEA 3CGTA 2V3DA 4U3CA 5ABHA 4QCEA 1XSIA 1GONA 2J47A 5I77A 1DHKA 4CU7A 5AYBA 3AS0A 4FLRA 1TVNA 2BHYA 3ZMRA 1QHZA 4E2OA 3WBAA 2B31A 2Y2WA 2XJ7A 5CPTA 2EXOA 1RP8A 1W32A 2G41A 3CPUA 2CKSA 1VEPA 3A4XA 1CXKA 1KWGA 1J01A 2CBJA 2WMKA 3OGRA 4MB4A 4Y7EA 4F66A 2ZX7A 1OGGA 4GI9A 7TAAA 4D6HA 3DYOA 4MB5A 3ZIZA 3VIPA 4BF7A 4C7DA 5HDRA 1BYBA 1PX4A 2VMFA 2WM0A 4W93A 1CXFA 1RH9A 4JHOA 5CGMA 3NUKA 4QFUA 3PZVA 3PN8A 1XYFA 2DSKA 1CXLA 3F5KA 2WKGA 3AMDA 1L8NA 1UZ1A 1W1PA 2YOCA 2Y8VA 1CWYA 1E73M 1V6YA 1J0IA 1UUQA 2D1ZA 1HL9A 1VIWA 2CPUA 2VVNA 1GOIA 2O9OA 3WELA 2A3BA 1SMAA 5IFTA 4AXNA 4RE4A 1E6XM 4HOXA 1CGYA 3AOFA 1E40A 4P7RA 1CLVA 2A3CA 3TTYA 2VCCA 3GXDA 2XGBA 4HA4A 3ARRA 1FA2A 1OB0A 1W2PA 1UH2A 4LYRA 2VUYA 4U5KA 2XWDA 2X0YA 2DQXA 2QMKA 1ZS2A 1MXDA 1TE1A 2J78A 3FAXA 1CNVA 1UWQA 1V08A 2UY3A 4K68A 1GVIA 1H1NA 2WPGA 3T0DA 2WMGA 2RGMA 2X0HA 4AZIA 3CUIA 1XH1A 1GW1A 3BAIA 1G9HA 4V28A 5D9OA 5D8WA 3CMGA 3SIMA 1QBAA 1J11A 3WH9A 1CGUA 4U3AA 1FOBA 2PI6A 3CLWA 4WKFA 3GTNA 4JZ5A 2PWGA 3MMUA 3ZM8A 1ZJAA 4CVUA 3AXIA 1QW9A 2GJXA 1TMQA 1JYWA 3NSXA 1MFUA 1BG9A 1H41A 4ATLA 1B9ZA 1WDQA 3NJ3A 4AZ5A 5CPSA 1BLIA 3HU7A 5KEZA 1TG7A 5D9MA 4BZYA 3MMWA 2UY2A 1PBGA 1E0XA 4URIA 3WIJA 2YDRA 2XFYA 1KWKA 5CG0A 1H0IA 1V3MA 3B9AA 4AY1A 3UR7A 1XRVA 4MB1A 1VJSA 3KEHA 3ARVA 4D6JA 5C71A 2BV9A 5AY7A 4UQAA 1JYXA 4W7UA 3WN6A 4DWSD 2ZUSA 2E40A 2W62A 3K4AA 2MANA 4GKLA 2XIIA 1MWOA 3AS2A 2E4TA 2ZX5A 1XSJA 2RGLA 4OBRA 1XHGA 4UQBA 2YLAA 1EDQA 2E9MA 5EB8A 1C7SA 3CUGA 2XM1A 4LYPA 3RIKA 1LQ0A 3WF0A 1KQZA 3BAWA 1LWJA 5A8NA 4P8XA 2WC3A 2OWCA 2F8QA 1JFXA 1J0ZA 4P7NA 5M03A 2VOTA 2YDQA 3WNOA 1E4MM 1GHSA 1JXKA 2EPNA 4MDPA 1UWSA 1DEDA 3WH5A 1G1YA 2GJXB 4AD4A 4C7GA 1PEZA 1H4PA 3CUHA 3A3HA 4H04A 2HVMA 1E55A 2QPSA 1RD6A 3AHZA 1WB0A 3UG5A 2WHMA 1H3GA 4UOQA 1UA7A 6TAAA 4DM1A 5BXTA 5FKYA 3MANA 3LPFA 3VD9A 2D0HA 3S2CA 1PX8A 2JIEA 2VCBA 1GHRA 4OOUA 3APGA 5DEZA 1MQRA 1KGUA 1QOXA 5C70A 3CTTA 1OGSA 4CUCA 1VBUA 2J77A 3M07A 3WQWA 1Q4NX 2BXYA 1MQPA 2JE8A 1E43A 1UR1A 1V6VA 6CGTA 5JBFA 1NARA 2X8RA 4LQ1A 2ZXDA 1KXQA 5BXRA 3CZEA 4ZE4A 1QI5A 8A3HA 3GNPA 3O9NA 1SYTA 1JZ6A 4X0NA 2WWCA 1Q6GA 3WQ6A 5A95A 3VO0A 1UYQA 4P8VA 2XHYA 5HOSA 4YHEA 1J0JA 1E3ZA 5M5DA 1W1VA 1DWFM 1G5AA 1TUXA 2TAAA 2EPKX 3ZSSA 4MTVA 1JZ4A 2W92A 3N1AA 2BY3A 3A6OA 3LPPA 2FHCA 2X09A 3U5UA 4PYSA 2ZUUA 3FY1A 3KL3A 3PTQA 4P8UA 1QNQA 3ARZA 5JIWA 5GPRA 1TCMA 3MKKA 1UR0A 2CNCA 1W3KA 3RDKA 1N82A 2YA2A 1M53A 2VRJA 1JG9A 1LJYA 2V5CA 4D6CA 4MPKA 2G3MA 1NP0A 1DWIM 4JHZA 2PWFA 3B9EA 3WUBA 3OGVA 1M04A 4PRWA 4A4AA 3AMCA 1DTUA 3PZTA 1QI3A 1CGVA 2JF7A 4HTYA 5DT7A 4GI8A 3WMSA 2XVPA 3WDHA 1W9VA 2J8FA 1WPCA 5I23A 3OG2A 5A69A 2VJXA 1XSKA 3CO4A 4U33A 3BMWA 2XVNA 4PN2A 4TXEA 4E4PA 1QNSA 1E5JA 4B9ZA 3EMCA 3HJEA 1M03A 1ZB5A 2YL5A 2J7BA 1HKIA 1CGTA 3BC9A 1UWTA 3G6LA 2WSKA 1BPLB 3EDEA 4J3WA 4FLSA 4CN4A 4LGXA 4PEEA 4D6DA 1BF2A 1UG6A 1QHOA 4YN5A 2D22A 2ZX9A 1KXHA 3CHEA 2ZUWA 5EMYA 1ODUA 2BVYA 3G6MA 2CKRA 3M6DA 2CITA 1FFRA 3VM7A 4QLJA 1PPIA 1G01A 3RM9A 2PC8A 5FD0A 1E1FA 3PZGA 4JCLA 3AS1A 3RM4A 5AC5A 2ZX8A 3WFLA 3VOCA 1B30A 1QNOA 2XSAA 3POCA 5ABFA 3S6TA 2QMJA 1HF6A 4U2YA 1UH4A 1W3LA 3U5YA 2XSBA 2VL4A 3ZO9A 2OYKA 1HVXA 3WFZA 3WMCA 3VGHA 4ML4A 5A2AA 5FCZA 1XD1A 3NYDA 4PSPA 3GNOA 3EBVA 4OOZA 1H49A 3BH4A 2G3IA 2BS9A 1MQQA 3EMZA 4JIEA 3WEMA 5GNXA 2NW0A 1E0WA 5CZKA 4TX6A 3WD4A 2J25A 3D5HA 3FXYA 3IAPA 1XC6A 1BVNP 2J7CA 3IANA 2F2HA 3WL1A 2DT1A 4JCMA 4JKLA 3ARWA 1W1YA 2YBTA 2WBKA 1XH2A 3VIGA 3AHXA 4GI6A 2JALA 1FHLA 3AIQA 4YHGA 3PBGA 1TA3B 3AMKA 3EDFA 4UCFA 1W9XA 1B1YA 1Z32X 2GJPA 1TFVA 1JF6A 2D0FA 4CU8A 1W9DM 2GVYA 2VX5A 1R7AA 3K4DA 2Y8KA 3W82A 1V0MA 1C92A 1PJ9A 4J3VA 4P8WA 1FH9A 1GCYA 1V3KA 4H8HA 3AISA 4CD5A 3DYMA 4PMNA 1BAGA 3L4YA 4HU0A 2VURA 4A3HA 1WO2A 4PCTA 3SUWA 5GQBA 1E4NA 1JZ2A 2A3AA 2PWHA 1MYRA 3SUUA 4IISA 4HZ8A 1XH0A 1E0VA 2XIBA 4WSKA 1NH6A 3IAQA 4W5UA 2QV4A 5CGTA 5A6KA 1FH8A 3VGEA 2CCRA 3CZJA 1EO7A 1NWTA 3W0KA 3VPLA 1KXTA 2VI0A 1ITXA 4Z2HA 2V3GA 3SCQA 1UKSA 5D9PA 2X1IA 3ZJKA 4BCEA 2G3JA 5AC4A 3DHUA 1GQLA 1HKMA 1KGXA 1WP6A 2XUCA 3T2QA 4ATWA 4TX8A 4HMEA 4A3YA 1QNPA 3AIEA 1EOKA 3I3DA 5BWFA 2DT2A 3F5JA 3ALGA 1JGIA 4UTFA 5ABEA 1I75A 5E09A 3BLPX 1Q6EA 2FDMA 3GXMA 5I78A 4GZEA 4RE2A 4MJ2A 3OIHA 3ARXA 5TD4A 4NZCA 4W8BA 3MSDA 2GK1A 4FK9A 4D6IA 1E4LA 2OSYA 3HMCA 4B15A 3AYSA 1MVYA 2PBGA 3VTRA 1Q6FA 2W4XA 4Z2GA 1W91A 3K8LA 1LL4A 4PTXA 3LPOA 1JDAA 4AD2A 1OBAA 1WKYA 4JKMA 3DECA 1XGZA 1VFUA 1V6UA 4XV0A 2YL6A 2VQTA 3GYCA 1JZ8A 3SCWA 1HKJA 2VZSA 4MAZA 1J0YA 2CHNA 3WD1A 2VT0A 1CEOA 1IZJA 2WVSA 4QLLA 3VDAA 2CETA 3WQ4A 2WNWA 1KQYA 1V3HA 3AXXA 2V5DA 1HT6A 4PTVA 3W25A 1BG4A 2WZEA 2C7FA 3VNZA 3AQUA 3N15A 4CCDA 3GH5A 1VF8A 4J28A 1H0GA 1GOOA 3RMEA 3WF3A 2VZUA 4S3JA 4AD3A 1HJUA 4WKHA 3CZGA 2JEPA 2ZWYA 4W84A 1UD4A 1CGXA 4D72A 1KCLA 4WK9A 5HPOA 1G0CA 2J74A 3ZJ6A 1ESWA 1MFVA 3WEOA 1UR4A 2Z1SA 3AHVA 3A47A 2WBGA 5I2UA 1B3XA 3WNNA 4W89A 2GK1B 3EYPA 5A8MA 1X6LA 3IJ8A 2D2OA 1QI2A 1US2A 3MU7A 4NRRA 1AQMA 1H5VA 3J7HA 2FGLA 2DSUA 4PCSA 4MNLA 4R5EA 1KR1A 1UWIA 1K6AA 1I1XA 4GINA 4KH2A 2J62A 2PB1A 1E6NA 3WMBA 3E1F1 2WCAA 3AIBA 1JNDA 1S46A 4PBGA 4F9DA 4BQ3A 2GJRA 3RJYA 1EDTA 2YBUA 2OSWA 4AZBA 1KBBA 1O7AA 2JF6A 1W2VA 2XFRA 4CD4A 2WWDA 3QHMA 4DWSC 1Q6CA 3RCNA 4IUGA 3ZT6A 3WD0A 2FGZA 2DSVA 2ZXQA 4DUVA 2QLYA 4LPCA 1KXVA 4FF5A 5HPCA 2VR4A 5FIPA 2J7GA 2EPOA 3VIHA 1HJXA 3L4WA 2BFGA 3WF1A 1UR2A 3II1A 3WNKA 5GNZA 3W29A 4BS0A 4TOQA 5IDIA 1GUVA 1VEOA 2FHFA 1JDCA 4Z2JA 5JBEA 1KB3A 2OYMA 3CIVA 1UKOA 5IHSA 1GOWA 4E8DA 2VZOA 1UA3A 1Q6DA 1JZ3A 1NOWA 2DDXA 1V0KA 2VZTA 3FHQA 5BCAA 3PTKA 3JUGA 4HZ6A 1WZAA 3AFBA 4TUFA 1LWHA 4TVUA 4ZXOA 2WVUA 4EK7A 4DUXA 4HPHA 4H2CA 4J3XA 3SCPA 1NOUA 3M46A 4ZFMA 4RE3A 2W91A 5DO8A 4AZCA 4MDOA 3W81A 3SUVA 1X1NA 3VD4A 4M8UA 5IHRA 2O9RA 2CIPA 1EQPA 2VNCA 1UKQA 3CZLA 4C7FA 3N9KA 1BTCA 2DH3A 5E9AA 5BXPA 4E8CA 3VDCA 5CLTA 2WMHA 2BVDA 5KZ6A 1GVYA 2BHZA 1ZL1A 3PZMA 4GIAA 4H8UA 1OT2A 5FL0A 3LMYA 4BQ4A 2VRKA 4M82A 3VX1A 2WZIA 1CXEA 1KFWA 2YL9A 3A4WA 1E70M 3F4VA 1B2YA 4EAMA 4M24A 3VGDA 5DFAA 4HMDA 5I79A 3N17A 3AS3A 1UOKA 4L4PA 4UFLA 5D9NA 1ZBVA 5EFFA 3CZKA 1ISVA 1XD0A 2EPMX 1HXJA 1C7TA 3CMJA 3UG3A 1ODZA 2XVLA 5ECUA 1V02A 4JFVA 3B8SA 1E9LA 1EA9C 2WC4A 4JFSA 2A3HA 3OB8A 3OLGA 1OCQA 1E72M 5A8PA 2CBVA 2C0HA 3VDBA 3VMPA 5JIPA 1MW3A 3AROA 1JXJA 3NCOA 1UKTA 1HP4A 1AMYA 4W88A 4DWSA 4D6GA 4AD5A 4TTUA 4UFJA 3AHTA 4AZCB 1AVAA 3VMNA 3WH6A 2WHJA 4BQ2A 2J4GA 3B9DA 1XCXA 2BY2A 2Y4SA 4S3KA 3UCQA 3GZAA 1W1TA 1C8YA 4CCCA 1KCKA 1V3LA 2GDUA 1B3YA 1TVPA 3EDDA 3T0BA 1PIFA 1W9UA 5BRQA 3K46A 1G94A 3WSUA 4CD7A 3BSHA 3MS8A 3ZT5A 3WUGA 3VGBA 4JL2A 3SCSA 3MO4A 3SEPA 4XX6A 3NDYA 3BCFA 3MV11 3BAXA 3L4TA 9CGTA 1CGWA 1FP9A 4U2ZA 5CLWA 3KL5A 1JF5A 4GO8A 3U7BA 1BGAA 1HL8A 3AZTA 1WE5A 1PX3A 1OIMA 3DYPA 2ZX6A 2DEPA 1DWAM 1CTNA 4XB3A 1C8QA 2WSPA 1HVQA 2ZXAA 1QHPA 3L4VA 4CD8A 2O9PA 5A8QA 4GZIA 4H41A 1E6RA 2YJQA 2ZICA 3CH9A 3ARTA 1F4AA 1E15A 2V3EA 4ACZA 5A6AA 4OKDA 1D3CA 2VCAA 4PMXA 5DMYA 1WAWA 3CHDA 4MAVA 3EDKA 5D4YA 2JFEX 4AZ7A 3KZSA 3AZSA 1BYDA 4WLCA 2WXDM 3AJ7A 1QVBA 5A3HA 1JNEA 1NM9A 1WDRA 4UFHA 2JEQA 2G4FA 4PUEA 1MW2A 2ZUNA 3W27A 2XPKA 3AMLA 1TR1A 3AIVA 4IM4A 2WLZA 1ZBCA 5A1AA 3VIKA 2Z1KA 2CEQA 1J0HA 1WZKA 3O6AA 4BQ5A 2XYLA 1VAHA 4AIOA 2E3ZA 1HNYA 1E5NA 8CGTA 4D71A 4QDMA 1EH9A 2WVTA 1UZ4A 4UZSA 3QOMA 1DP0A 1H2JA 3FHAA 3GXFA 4FLOA 4WF7A 3AXHA 2W66A 4UQDA 2GDVA 1QNRA 3MSGA 4PMUA 3OBAA 1H11A 4JFTA 4ACZB 3N11A 3WNPA 2DIJA 2IXUA
chains in the Genus database with same CATH superfamily
1DJZA 2QJNA 4R3UA 2V9DA 4PTWA 4HNLA 3NZRA 3OZMA 2ESCA 4AG0A 1MUMA 1RPKA 3R79A 1JI1A 2VYOA 1AQFA 1D8CA 4HHLA 3GD6A 3U9IA 1PYMA 3NPUA 1LOSA 3MWAA 4YTTA 1J6PA 3WD3A 4UMCA 4AXKA 3TYBA 1PIGA 2EEXA 2BXZA 8RUCA 7REQB 4S2BA 4NNBA 2IPFA 2ZZ2A 3QPEA 4DPQA 3WLLA 4IGSA 1IR1A 1T8QA 4HSNA 3LHYA 1D7FA 1UR8A 4M51A 4Z0SA 4EF9A 4PMRA 3MDWA 1EC9A 4WDXA 1B57A 4IIFA 3UA4A 3QRHA 1X8FA 4M6QA 3SCUA 4S39A 1R7OA 1RVKA 4NAFB 1TO3A 2C1IA 3VI2A 2WJFA 1J4EA 1MO0A 4Q4OA 2CC0A 2V3FA 1CI1A 2DV0A 4J27A 3AMGA 2OFJA 4M81A 3SN1A 4MMWA 3WQFA 3QYSA 5I0DA 5D02A 4JL1A 5I02A 4ICNA 5E6YA 3GTXA 1HP5A 4LUSB 3CUFA 2VX6A 3RLVA 1BHGA 4XAGA 1ZZMA 1JYVA 1NF7A 2E9LA 1WDPA 2E77A 4QS5A 1FFQA 3BANA 5D2TA 1GOKA 1UW9A 5CPLA 3HFYA 1SFSA 5CQ1A 3UNDA 1W9BM 4MWAC 3U57A 4OBSA 4RDYA 3PPGA 4QS6A 2IPJA 1PAMA 4MLRA 3GDRA 1V03A 2OTDA 2XISA 3BLKA 3VKKA 1HZYA 2X1UA 2IUZA 1EFZA 1OY0A 5E70A 4TV6A 1NDYA 1Q66A 4AC1X 1RJRA 1F61A 4N4PA 4NP7A 1A5KC 3NWRA 1XIDA 4IMDA 3L2MA 3GDBA 1CBGA 3BCJA 4EKJA 3C56A 3FXGA 4XAYA 4EVZA 2ZIDA 2ZRVA 3O15A 1LYXA 3QY8A 3ONCA 1R3TA 4PE8A 1JJKA 1HKKA 1REQB 3NSMA 3UP8A 1UC5A 3T08A 1A3WA 3IK2A 1Q7ZA 3NTYA 3BXWA 4NG3A 2Z2BA 1A5NC 2HK0A 4K7YA 4P61A 3BV7A 2XG9A 2GOKA 3VILA 3NM3A 4TO8A 3NL3A 2QIWA 3CB3A 3G3MA 1XIGA 2V6AA 3UCCA 1QR7A 2DZUA 4HSHA 1JCTA 2JKEA 1YTEA 5FF3A 5D38A 1H7OA 3OEXA 3WLHA 3FVDA 3LG3A 1XUUA 1NDZA 2JGQA 4MKSA 3TNOA 4A6GA 4GH3A 4Q8OA 3B4UA 3ZT7A 3GNNA 2TODA 5K3VA 4A21A 2E6AA 5FEZA 4HU8A 4HP5A 3SGZA 1W1A1 1PTAA 4UTKA 1ZPTA 4I3GA 2BY1A 2EBNA 4Y9OA 3WDRA 1G4SA 3OLIA 2JIWA 2J7EA 2PF8A 1IXQA 4QISA 5HAOA 3GW0A 3WLJA 2BOGX 1YEYA 5BWAA 4D2JA 4QE5A 2QZRA 1BYCA 3F5LA 1S5MA 1T96A 4RR4A 2YB4A 3VUSA 2HVNA 4QM1A 4PL1A 2BP1A 4WDTA 2D23A 1EL3A 3A4JA 1FDYA 5I3GA 4Y9NA 1EO5A 3VIFA 3IPWA 1GKPA 1P1MA 3UWVA 3R0DA 4B16A 1YNQA 1JZ5A 3GNDA 2PP1A 1A49A 2ZUMA 3Q67A 6PTDA 1KBLA 4HNCA 4NI3A 3K8MA 2VC9A 3OA5A 3G24A 1TIWA 3BCDA 1EP3A 4XBKA 5FACA 2PWDA 3N2OA 3T81A 4IG2B 4H83A 3H53A 4C6EA 4AU0A 3S9ZA 4L80A 1HIZA 3LNPA 3NVDA 3KE0A 4N9DA 5J04A 3IIOA 3UWQA 2E6YA 4ZOEA 2W63A 4X61A 5J5RA 3QF0A 1OD0A 2FPTA 3PBUA 2GZXA 4M5PA 3AYTA 3BSGA 4UQEA 1EHNA 3ITCA 3UEQA 4KGJA 4IPPA 3C61A 3WZ0E 5HR6A 4TMBA 1UQYA 3BQ5A 1GJUA 3SGUA 4CD6A 4TVDA 4O1CA 1IEQA 1F2JA 5LGXA 1GVOA 4O52A 2YW4A 5BOFA 3RCYA 1UR3M 3QSTA 2G96A 2NXGA 3D3AA 1W3HA 3WQEA 5MKGB 4HNUA 4FOJA 2ZXBA 1Q8JA 3LNMA 3CZ8A 3GIYA 3PR2A 4Q7BA 4C5YA 1E4IA 1L6YA 4FNRA 3KBMA 4BR1A 1Z89A 3W2KA 3WL0A 1E9ZB 2ADAA 5CSUA 5C8BB 3OOQA 3NL2A 3OGSA 2PDLA 5C7HA 3UF9A 3RM8A 5D32A 1J10A 1NDVA 3EKLA 1ZBWA 4L9ZA 4UIOA 1R5YA 2XVKA 1C8VA 2Y0FA 3WDJA 3PF3A 4V15A 2VRQA 3NOYA 3TYAA 1JL8A 1D2KA 3MJYA 2J27A 3TLQA 1DWJM 1Q7QA 5KINA 1Y8BA 4ZL1A 2AL1A 3GB6A 4IFKB 2XWEA 3CMFA 2GSJA 1H7XA 2F6XA 1U33A 3MUIA 3VIMA 1XW8A 3STCA 3VD3A 3U2CA 4OIFA 3CHFA 4PMDA 1TPVA 1QDSA 1CLXA 3QOKA 1LP6A 3MV01 3PAJA 3PJUA 1YQ2A 2PU0A 4LUTB 3TN4A 5CSRA 3FVMA 3NQ2A 3O07A 1OIFA 3E0WA 4HNVA 5LNRA 4RCXA 2Y5JA 3RPMA 1AH0A 2ACUA 3IUDA 3TLLA 1W3IA 2I56A 1T40A 2RDUA 4GUHA 3UR8A 4JS3A 4QE1A 4FHAA 5K2ZA 5G4EA 3QHOA 2DIEA 2Z1WA 1UKPA 3E6EA 3BG9A 1R2RA 2QUVA 1SSDA 1RCOB 2JKPA 2Q71A 4PCNA 5HNRA 1P6CA 1W5NA 2E5DA 3AAMA 4IQJA 2BOEX 4F8XA 3W38A 2F7FA 2QPUA 3MVIA 3AZRA 3BLDA 3E96A 4KWVA 1W1B1 1MXGA 2C18A 3MBDA 3ORWA 2TRSA 4GZ7A 2WLYA 3SCTA 5CZ0A 2EKCA 2WMIB 4HBKA 1W31A 1O6IA 1OD8A 3SQSA 3FA3A 4YWIA 4AWUA 3TC7A 1WZLA 3HG2A 4TIMA 4UOJA 2QQ6A 4PBEA 3G22A 2XGZA 3TC6A 1NFGA 3K1GA 1F73A 1ECEA 4NRSA 4Q33A 1AA1B 1UHVA 3GHSA 4AMCA 1TJ2A 2ODOA 7A3HA 3BZGA 3W1MA 1ZBKA 1KM0A 1V3IA 3W7PA 3I3BA 1MZRA 4KMQA 3E0FA 1ISYA 4NSBA 1NQ6A 3GRIA 1H61A 1B3VA 3V4BA 3LXAA 3GVVA 3DHPA 4Z2LA 5A94A 4JYEA 4DJFC 3NPXA 2JQXA 3GHRA 2FPVA 3GIQA 4MNKA 3TA9A 4GQRA 1UD5A 1V79A 3CC1A 4NT0A 3ZWSA 1SFTA 1J9YA 4LXFA 1EGZA 3TAKA 3C3NA 3LPGA 3NQ6A 2CESA 2GUYA 3UERA 3GFZA 5CPQA 4X9YA 1US3A 3FKRA 3GG8A 3CAQA 5BOEA 2GOUA 4PUUA 3EZ4A 1H7RA 2WANA 1XYBA 3UZWA 4DM2A 5A2BA 2P50A 4PRRA 3BV4A 4LYQA 4Z2KA 4KWUA 3KLKA 5D2YA 3FSTA 3PSWA 4HMCA 3VNYA 1C8XA 3VNKA 2C15A 3QR1A 2PDMA 4IXXA 4GZJA 3QGAC 4CN6A 1JPMA 1VFLA 2F6KA 3DOPA 1LL7A 1A5AA 3DC8A 4Y96A 2CU0A 3REQA 5ABGA 4QR6A 4AUBA 3OVQA 4CN1A 1D9EA 2Z1VA 3P81A 4L1GA 2XIQA 1FCUA 4XWUA 1XC4A 3OZOA 5REQA 2P3EA 1JPDX 1XR2A 2J79A 3C2RA 3WQOA 1FWJC 4W7WA 1K9TA 3FGCA 3S1XA 5EA9A 1DXIA 3N73A 1NELA 3PZOA 2R94A 1HN1A 4RZ5A 4E4FA 1XCWA 4KT2A 4J4KA 4Q6JA 3VOIA 3WUEA 3CGTA 4U3CA 3I7QA 3H12A 1M6JA 5I77A 3L23A 1IT8A 1E1CA 1Q6LA 1YYAA 3E0IA 3ZMRA 3WBAA 4YL2A 4PB3A 2BG5A 3LN3A 4JBRA 2YZ5A 2CLKA 4GI9A 4X9SA 4D6HA 2AQOA 2PPGA 3ZIZA 2PURA 1K03A 1HL2A 1R9YA 4C7DA 3VK5A 3DI0A 1BYBA 1PX4A 3V0SA 2NQLA 2WM0A 1XG3A 3NL6A 4W93A 1CXFA 2I5IA 1MDRA 4U28A 2NX9A 3DAQA 5IOBA 4JTFA 4F48A 1D3HA 3PN8A 1NVMA 4DHGA 1KRCC 1L8NA 1PCKA 1KFJA 1VC4A 4DBUA 2Z24A 4I8YA 2EG8A 4E4UA 4NNAA 3GY1A 3INPA 1UUQA 2G4JA 1PZ0A 2PE4A 1LZOA 1ECQA 2HVOA 3M0MA 4E2VA 3QQ1A 4C6DA 5HMEA 3VOJA 2VFGA 3W1TA 3AOFA 3BW3A 3NURA 3TTYA 2VCCA 3LOTA 1OB0A 4XZLX 4LYRA 1TYGA 5BZAA 1K7FA 2DQXA 3WCZA 5JU6A 3DU0A 4GD0A 4RZBA 4XG1A 4N7QA 1GVIA 1H1NA 2WPGA 2VC5A 3CU2A 8XIMA 1XH1A 1GW1A 3MA8A 3IEBA 5CG7A 3CMGA 1V93A 3HPZA 1KTCA 5BNKA 3C2VA 1UPMB 1AD1A 3W1UA 4ADUA 4PB5A 4LW7A 4ZBCA 3LZ3A 4GIEA 1JYWA 3CQ0A 1ME7A 4Y6GA 1MFUA 4QRNA 4GGHA 1WDQA 2EPHA 3HU7A 5I7GA 2J24A 1TG7A 4BZYA 2GDQA 1KWKA 1NJJA 1A5LC 1H0IA 3ERPA 4EPEC 3UR7A 4Z0JA 2ABAA 4KCVA 3IARA 4UR7A 3ATYA 3ARVA 4D6JA 3S2JA 4W7UA 3WN6A 3GR8A 3A13A 2QYGA 2A7RA 2AKZA 2ZE3A 2ZTJA 1MWOA 1RJQA 1BXBA 2E4TA 2ZX5A 1XSJA 4OBRA 2YLAA 1EDQA 2V2HA 5EB8A 5B7YA 2XIJA 1R3WA 3OYZA 3LHZA 4K6AA 3THUA 1EX5A 4E0CA 1JFXA 1J0ZA 5M03A 3LM3A 2VOTA 4O54A 2PRHA 2ZDSA 4GBUA 2WOQA 2GL5A 2GJXB 4LAZA 2JBMA 3SRKA 3UR2A 3ES8A 2FTYA 1E55A 3AHZA 3PWIA 3UG5A 3UT0A 1Q3NA 3PAOA 6TAAA 3MANA 4WSHA 1UIPA 1K4HA 4QE4A 3E12A 3O7UA 2VWTA 2JIEA 4KW2A 3TQ0A 1TQXA 4LB3A 3IJLA 5C70A 3CTTA 1OGSA 4UTTA 4CUCA 4K38A 3CQJA 4F2BA 1YDNA 3PM6A 3LCGA 2OT1A 5GJMA 4FNUA 1UR1A 3NO3A 5JBFA 5HJYA 3COTA 3I6RA 1H60A 4HVXA 2AL2A 3LTPA 3OHMB 2ZA3A 3A12A 3CUXA 2DVUA 3KOXA 1Q6GA 3WK1A 3USBA 1F3XA 1E3ZA 5M5DA 1W1VA 1G5AA 3I7SA 2EJAA 4BF5A 4HZMA 3ZSSA 4I6VA 4G8TA 4Z42C 2W92A 1CW2A 3QSRA 4JDBA 2X09A 1QW7A 4Q4KA 2C1HA 5CEWA 3PTQA 4NI8A 3ARZA 1O68A 1N8FA 3KOWA 1KTBA 2CNCA 3RDKA 2YA2A 1N2VA 2VRJA 2R82A 3GR7A 4HHHA 4D6CA 4NXSA 2G3MA 1XISA 2PWFA 3E5BA 4X3ZA 4BFAA 4OU1A 3NO5A 2EF9A 5DXXA 4M7SA 5DT7A 4GI8A 4PUJA 3Q37A 3S47A 3CQHA 1W9VA 2Q09A 5I23A 2VJXA 4U33A 5M2FX 3KVKA 3TU9A 5KTLA 2HBVA 2IKGA 2VXNA 1BSLA 3HJEA 4M7TA 1M03A 2J7BA 3GAYA 1S39A 1CGTA 4GNKB 4D8LA 1WKEA 5F2IA 5ENLA 3W2MA 2PODA 4GUJA 1OZQA 1BF2A 3TNBA 4IF2A 3CWOX 3RFAA 2LLEA 2VM8A 2ZX9A 1O94A 3G6MA 1SUXA 3JRKA 3B0PA 2CKRA 1LRTA 5DRCA 5FEWA 1G01A 4ZQPA 2PA6A 3UY7A 1WKFA 3TOYA 1WBHA 4OWGA 4HB7A 1MSSA 5FJPA 3KRUA 4GKTA 5F4WA 3S6TA 3CV1A 3OW1A 1XRFA 4AFYA 1SJBA 4IMFA 2VL4A 3BOFA 4LEFA 3WFZA 2ON3A 2Z6IA 2EKGA 3LHUA 3VGHA 2GVEA 5A2AA 2QAPA 2OKTA 3NYDA 1TCDA 3GNOA 4OOZA 1H49A 3BH4A 2G3IA 3STGA 3EMZA 1XQLA 3WEMA 4M1BA 1IEIA 1E0WA 2Q6ZA 4NAFA 3WD4A 4YJ5A 1QK2A 3QMRA 2F2HA 4JKLA 2RDWA 4YTSA 1W1YA 2YBTA 3I4EA 3LA4A 4REQB 1MRAA 1XH2A 4IZGA 4TX9A 4GI6A 1RHCA 3PS7A 3UYIA 4Q8VA 2P3ZA 3IUIA 1X1ZA 4QNEA 3DH7A 5G4WA 3B0YA 1PWMA 3F7JA 5E0KA 1B1YA 4LTSA 3O6DA 1SO3A 4B5WA 2QIIA 1OFAA 1OX4B 4GH1A 2YCEA 1VBJA 2Y89A 1K3UA 1UPPA 1UUOA 2VC7A 1M7PA 1W5QA 3T1GA 3D6NA 2VX5A 2XH4A 1GJPA 2XH7A 3R58A 1PJ9A 4J3VA 3NQVA 3W1NA 1YE6A 2X40A 4GWEA 3I68A 4ZA0A 1X6UA 3LI0A 4PCTA 3ZZ1A 5GQBA 5CCZA 1JDEA 4XZ9A 1E4NA 4YVVA 2J6XA 1NH6A 5LIKX 1RK6A 2O7QA 5CZTA 4I9JA 3TYZA 3CZJA 3GFYA 1KXTA 1FY6A 4Z1DA 1ITXA 4B5UA 3SCQA 1UKSA 4EWJA 1ME9A 3RHGA 3KWSA 4KWSA 2AGKA 4HHPA 5HNUA 4ATWA 2R1NA 4QJ4B 4A3YA 1W8GA 5AYYA 3AIEA 2O55A 1R47A 4TV5A 3FYPA 4CNUA 4R88A 3N19B 4UTFA 4HNOA 3U6WA 4WJEA 2DUAA 2PWVA 3SI9A 3BG3A 4LAKA 4UTHA 1Q6EA 3P14A 3GXMA 3OVRA 4XAZA 4ROQA 4RE2A 4PA8A 1P0EA 2PDWA 4WHBA 3LBCA 3OIHA 3CV2A 3K2GA 4W8BA 2OSYA 3HMCA 4B15A 2FVLA 4ZGYA 2VFIA 3DZ1A 4JTGA 2PBGA 3S4TA 3WLKX 3NQ8A 1Q6FA 3K5XA 5LIYX 1QWGA 3C86A 3PWAA 3W1RA 3SRDA 3VNLA 1ZHAA 2Y7DA 5DLCA 4AD2A 4JKMA 5DBUA 1XGZA 3TFXA 5CKSA 4XV0A 1R3RA 1SJDA 4V1XA 3GX9A 1HKJA 3MVTA 2CZEA 4OECA 5AKQA 1KD0A 3CPRA 3A64A 1BKHA 3G8EA 1RPXA 1M68A 3RAOA 2WVSA 3QM3A 4QLLA 3MKVA 4H1ZA 4RXFA 4XD5A 3GHUA 2YCLB 3Q65A 1BG4A 3VNZA 1VF8A 5A6TC 3NQ7A 3LB0A 3NDOA 3LGDA 3EWDA 4WKHA 2QCNA 4W84A 3KCLA 5EYWA 3W9ZA 1I0BA 3BLOA 5HPOA 2J74A 1MFVA 4H9TA 1AH4A 2Z1SA 3RCMA 3JZUA 3EA3A 3WNNA 3EYPA 5A8MA 2ZVRA 2W0UA 4XTDA 1O1ZA 1US2A 2R8WA 3MU7A 4IP4A 2C71A 1TX2A 3H7VA 3P74A 3QV6A 2QVHA 1TKKA 1KR1A 1QK0A 3D3FA 1I1XA 4KH2A 3LEPA 2WCAA 1H50A 3NNTA 2NVCA 2QPXA 2GJRA 1IQ8A 4L61A 3S5OA 3HV9A 4JTJA 2PDYA 4C90A 1M5WA 2JF6A 2P10A 3RMJA 4IUGA 4MUPA 1SO4A 4EXQA 3HG4A 3QPYA 4G7EB 1KXVA 5DX7A 4GQGA 2EPOA 3KTSA 3VIHA 1HJXA 3VA8A 3WF1A 4QEHA 4ECLA 2NQZA 1Y5XA 1WXJA 1RBOB 1Q5MA 1HKWA 5A8GA 3EOUA 2NVDA 4Z2JA 5JBEA 5FAGA 1QMLA 1FWRA 1UA3A 4J2PA 1Q6DA 1NOWA 2DDXA 1LRNA 3FHQA 4ENLA 4O50A 2H9AB 3JUGA 1ZAJA 3AFBA 2RKXA 1LWHA 4LBRA 1W17A 3C2FA 2WVUA 3VC6A 4EK7A 4DUXA 3ZVHB 3DFOA 3RRXA 3SCPA 4QJ3B 1HTIA 4O1AA 3A9IA 3VD4A 3UW6A 2XH2A 2CIPA 3CZLA 1BTCA 1ZENA 5BXPA 2DJLA 4QBXA 4KWWA 1GVYA 2BHZA 1OCBA 3GE7A 4AX6A 4LAMA 3LMYA 1SZRA 2KAUC 1YXCA 2WZIA 4DYEA 2I9EA 3F4VA 4S3BA 3E5PA 1EC8A 3TYCA 3KXQA 5DFAA 4HMDA 2PLKA 5I79A 1JCXA 3LZ5A 1GZ1A 3H55A 2Z4GA 2VKZG 4R9OA 2X42A 3VFCA 1K7XA 4ZTXA 3KBNA 3NQGA 3ATZA 1XD0A 3VNIA 2EPMX 4O8RA 1C7TA 1EP1A 1V02A 1XDMA 4NL1A 2WC4A 4JFSA 4JICA 1OCQA 1KM6A 4JTIA 3FS2A 1ML1A 1MW3A 4R33A 3T40A 3VFLA 4AD5A 4TTUA 2XZ9A 4MZ8A 1GG1A 3AJXA 2A3LA 1XCXA 2FVKA 2Y4SA 4L56A 4IQDA 1RJPA 1UB3A 3RK8A 3GZAA 1LLWA 3CUZA 1R9XA 1XKYA 4W9TA 1B3YA 3N3TA 5DN1A 2P5NA 1LM1A 3K46A 1G94A 1R9ZA 3BSHA 2I17A 4R7WA 4ML9A 4JL2A 2I7GA 3TK7A 4B5VA 3H70A 3GSMA 3M1ZA 1PE1A 1R46A 3IJQA 1FP9A 4U2ZA 3V5FA 2CHRA 3M43A 2INEA 4IOTA 4YMZA 4HJWA 5D09A 4BY3A 3KRSA 2ZX6A 3MUXA 2PZ0A 1SR9A 1DJWA 2WSPA 1HVQA 1P5BA 4MZ1A 4H9UA 1MXSA 3IJ6A 3BLEA 4ZOCA 4CD8A 4XSMA 2QDGA 3W7DA 3MMTA 3SRFA 1VHNA 3UXDA 2R6OA 1S2UA 3SM0A 2YJQA 3LHWA 3ARTA 2HPMA 5EMLA 1TPC1 3LSCA 4FPSA 5A6AA 4I8DA 4IIHA 3H7RA 4DLMA 5D4YA 1MEHA 2DU2A 2JFEX 4AWSA 1D3GA 1BYDA 2WXDM 3H24A 4QJ5B 1QVBA 3EX3A 1NM9A 1WDRA 4Q8NA 2H90A 1P7TA 3DBNA 2QDDA 3W27A 4NAEA 4XK2A 3AIVA 2WLZA 5HA7A 1R2SA 1AW1A 1VJIA 3W85A 2CLOA 3B03A 1JPIA 4C1KA 1WZKA 4RE0A 1FWDC 3O6AA 3OVPA 5EGRA 2I5QA 2XIOA 4V33A 2XYLA 3VZYA 1HNYA 3H7UA 4LC6A 4OQVA 3WJZA 3WLSA 3LHTA 2BASA 1UP2A 4QSFA 1FTXA 1IIHA 4KRZA 4DQWA 4M19A 1VIZA 2GDVA 4J40A 1H11A 3B3DA 2HS6A 4KF1A 3TXZA 3B4YA 3BZJA 2B7PA 1AK5A 1DJNA 1A50A 2QAFA 3IIZA 4OV4A 3HFTA 2G3NA 2W6RA 2HK1A 3FK4A 4HYRA 4N6EA 1GZGA 3LRKA 2Q8XA 1Q63A 2NXHA 1FKWA 2X0SA 2FTPA 3SURA 2OU4A 4YTUA 2P76A 1WDSA 3IIPA 2DH2A 3LU2A 4ZE5A 2F84A 3GBDA 4I7WA 4H7VA 2WVVA 2C91A 5ABFB 1HQTA 4L65A 3QQ0A 1QPQA 4GYKA 3WBEA 1FH7A 3BAJA 2OCZA 5G2WA 2Q02A 4FXFA 1XLDA 4FA3A 1XLCA 3G1AA 2QHAA 4DO6A 2ZQ0A 1OYAA 3VNJA 4G9PA 1XPYA 4YIWA 1S2CA 2QCCA 1VBGA 4G7FA 5BU9A 3N3MA 1FWHC 1NWSA 3O2LA 1KBIA 2RJHA 3C2YA 4D1JA 1Q6OA 2FZDA 3L9CA 3U2ZA 3TA6A 1E9YB 4AEEA 1GOXA 4U31A 4FX8A 1XLLA 1DXFA 1OGBA 2D73A 3UZ5A 1TSIA 1W54A 4LALA 1IXOA 2PP3A 4UFIA 2X16A 4ATDA 5LYRA 2OZ0A 1X6NA 3B8DA 4RDWA 2XVGA 2QJMA 2ZZ4A 3A5VA 3H4WA 3TN5A 1EA0A 2WAGA 4JN8A 4J3SA 3I7RA 4LX4A 2NSXA 1EBHA 3W7CA 2YCKX 4BA0A 4BI5A 1XYCA 2WZHA 3PB0A 4TR9A 2WJZA 2HMCA 1B31A 3TX9A 1WDDA 4E8GA 1OVDA 2VDGA 4AWEA 2WHKA 1BFNA 3BGAA 2HS8A 3NQFA 1B3WA 2J8GA 5AVNA 5CC3A 3MWCA 5M17A 1BGGA 4L9YA 3VKAA 4YPJA 5LHFA 3W76A 3CV6A 3DBPA 3PZ9A 4HU4A 3WQ5A 2TMDA 2ZZ6A 1HJVA 4AHOA 3FYYA 3TJXA 3W7OA 4KPLA 1AMKA 1CDGA 4INFA 4TTGA 3E2SA 4H9YA 1OK4A 2OXNA 1YNPA 3T2PA 2H6RA 2HV5A 1E9IA 1S1PA 1AJ0A 4XZWA 1I8JA 1VD6A 1YHTA 4MJ4A 2X2YA 4ZQCA 4IIBA 4F0RA 4WY0A 1MRQA 2J66A 3DG3A 3RX2A 3QXBA 2WSYA 1J8VA 1TTPA 3THCA 2NV9A 2AAAA 3KRZA 3R43A 4AEOA 3LCHA 1GWJA 2W5FA 1E3XA 1GNXA 3KBJA 3VNMA 3S1UA 1V0NA 3STEA 3UJ2A 2RAGA 4E2BA 2GSEA 1R8LA 3WKZA 3ZR5A 2Y1HA 2DPEA 4AIUA 4M3PA 3N2CA 4O0KA 1OX6A 4E2DA 1JRCA 5A8OA 1UZHA 2A3EA 3YPIA 1FWIC 1IZCA 4FIQA 3N2TA 4QXIA 3PZUA 5LIXX 3AXKA 3N25A 2R91A 4O16A 4L4OA 3S5NA 4FF7A 1GG0A 3TYEA 2W61A 4XVDA 4UTMA 3SCRA 3QTGA 1FHDA 4AEFA 3FA4A 4FXSA 3HN3A 1R3YA 1R3VA 1TWWA 4CEUC 4H7ZA 2J9ZA 3F03K 1T6MA 3JW7A 3SJNA 4MWAA 3EOSA 3UZJA 1ISXA 2DT3A 1G4EA 3PZIA 1EDGA 3KVLA 4B9YA 5AVHA 1ZQ5A 1OFRA 4W87A 1LBMA 3N12A 5K4ZA 1E6QM 4KCWA 1UBPC 4WIWA 1KCZA 2AOSA 4C1LA 3N4EA 1ZU8A 1KA9F 2CZFA 3UG4A 3W7RA 1GPFA 2ABBA 5C2XA 2QCMA 5M3WA 3IGHX 1X96A 2JGYA 2ISDA 2HROA 4AIBA 4W5ZA 2NXIA 4HCDA 9RUBA 4ICMA 4O4WA 4A8NA 2DUZA 5CC6A 3A3WA 3ALFA 1LBLA 1JYNA 4HA3A 3B0XA 1W5PA 1T8XA 1RR2A 2ZRUA 1DQXA 1KO0A 3VVGA 4LANA 4JQ4A 1TTIA 1TWSA 1U22A 3DC0A 3UQNA 3TEVA 1I9CB 3VUPA 3UETA 5C5YA 1EJ7L 3W1AA 4KCTA 1OG0A 3UESA 1PZ3A 3ZJ8A 1K8XA 4IGNA 2ZDRA 2XTKA 2CERA 2IXVA 2D0GA 1FDZA 4EX4A 1KFLA 3CWHA 3T78A 1ZALA 4YVPA 1XPGA 4HD5A 5AYIA 3N2BA 1VENA 2Z0IA 3RYSA 5EMUA 1IV8A 4F79A 3LDVA 4MYAA 5HXMA 1MDLA 6A3HA 1A5CA 4GHRA 2Z27A 5RUBA 1EJUC 4JTLA 2NQ5A 2NUWA 2QCGA 2V81A 2AMXA 3KOFA 2QF7A 5FEPA 4AHQA 1AODA 1XYZA 1UD3A 2VOMA 4EAYA 3N14A 3UGRA 1EQCA 3GTHA 3T6CA 3EA1A 3WNLA 1H5YA 4P5UA 1GK8A 2H3BA 1DXEA 1UIOA 1SJAA 3CIXA 2FQIA 4W85A 3FCPA 3GU2A 1OINA 3BG5A 2BY0A 4JX5A 3IJ7A 2VTFA 2HRWA 1OFQA 1S38A 5EMJA 3GC5A 1GVQA 5BOOA 4JAWA 4EOUA 4HPXA 2PLJA 2X1RA 4GPNA 1DKWA 1V6WA 2FH8A 4W8LA 2Z28A 1KR0A 3W7JA 2OVLA 4NX0A 3VIOA 3BICA 1XIJA 3UJSA 3FW6A 2P88A 1XLMA 1ZFJA 1UROA 3PG9A 2OWXA 4GC3A 1ZRQA 4UR9A 1L0PA 3UFYA 3WK0A 3NQCA 3IJIA 2DZAA 7TIMA 3VGGA 3M5YA 1I6NA 3ZOAA 4OZOA 1ENUA 1O60A 3N2XA 2CHOA 3S8HA 3U7VA 4FZIA 3BGGA 4C6CA 4O4VA 2CXGA 3ECQA 4Q4MA 2Y85A 4MNJA 1Z8AA 1QOQA 1LF1A 4US6A 1F4HA 4ZVJA 1DWGM 2Z29A 3IJ9A 3QHNA 4FNTA 2E9BA 5TNVA 3HZ3A 4M1RA 4A3RA 1XG4A 2G8ZA 1R87A 1YPIA 3GH7A 2EPLX 1OJXA 1C90A 4MFDA 1WNOA 4GUGA 4NIRA 3T09A 4U10A 5MF5A 3DFYA 1F3WA 1B0IA 1OABA 4C5ZA 1Q7MA 1GQKA 1JI2A 1KBKA 3Q2DA 1KFKA 4A8RA 4CNOA 3BOLA 5T91A 2FB3A 4C6FA 5I24A 2V2DA 4UC5A 3TXVA 4MZYA 3W1XA 3UVAA 3MUAA 3R7MA 2WHLA 1HKVA 3RX4A 2FZBA 3WQCA 3M0JA 3TTSA 1QBBA 2PTDA 1ADOA 5LA2A 2CYGA 3DGBA 2GJNA 1OT1A 1B90A 2CBIA 3N4FA 1S2VA 1KFCA 1MW1A 1R3SA 2PUZA 3MYPA 2BOFX 1U1HA 1ME8A 2VUNA 2BNJA 3LCIA 3T9PA 4DBEA 3SCVA 3TTOA 3T2OA 1EHAA 4KRTA 5A2CA 3LK6A 1V0LA 2QCHA 3KL0A 3MUY1 4K36A 1VRDA 1K9FA 1RLDA 2YA0A 4AIEA 4MKNA 1E6ZA 1GEHA 3MB9A 4JIQA 2HE5A 3KS6A 4BWLC 1VBRA 3PJXA 4O12A 4UBPC 1R86A 2HNEA 1ZP4A 4F3HA 5FA5A 3URAA 1CPUA 3HG5A 4J1OA 5JQ9A 3QC0A 5E0CA 3BLIA 1EPXA 3BO9A 2J7FA 4KEMA 3L2LA 1ZAHA 2WM1A 4HT3A 4JOMA 3B04A 2A2IA 3PTDA 4QAWA 4WKAA 2IQ0A 3TW9A 4EXBA 3RILA 1JD7A 5C9UA 3LLXA 1KM4A 3CLMA 4DBWA 5BXSA 3BGJA 4O10A 1Y5WA 5JBDA 1W3TA 4HNTA 1Y0EA 3TOPA 1POJA 3LCXA 1JD9A 2PD5A 3EB2A 3V35A 4CNSA 4CCZA 4QCFA 2V38A 5CBJA 3H22A 1HGWA 1H63A 1A5BA 1LCOA 3URQA 3LGEA 1TVNA 4YYCA 3SGGA 1Z48A 2EXOA 4S3DA 3LYEA 4DO7A 3W6YA 4JQ2A 2C16A 3CPUA 4Q4QA 1VEPA 3A4XA 3WO8A 4MB4A 3GTIA 1M9HA 4DY1A 2ZX7A 1KW1A 4D8AA 4GCXA 4Z1AA 4MB5A 1W5MA 3R25A 3S2NA 3CO8A 5EKYA 4DJFA 3R8HA 3REQB 5U7SA 4NKCA 5HMFA 2H3DA 2WJEA 1UC4A 3HQPA 3LENA 4GVHA 2REQA 2OQLA 5REQB 2Y70A 5CGMA 3NUKA 4MWAD 3AC0A 3VE9A 1GVSA 2WKGA 3AMDA 4C6JA 1I45A 1UZ1A 1W1PA 4GQBA 2Y8VA 4Q6XA 3L66A 3ZXWA 1CWYA 3O1NA 2Z2AA 1J0IA 4QQUA 1GYLA 3TR9A 1VIWA 1GOIA 2O9OA 1SSGA 3VOHA 2XU2A 4CLMA 1EF2A 1LUCA 4QAIA 1YADA 4AXNA 3B0UX 1E1CB 4N9BA 4RE4A 4L4MA 1FCQA 1EP2A 4HOXA 1CGYA 2NWRA 1LOQA 4NZ5A 4P7RA 3GS6A 2A3CA 1UP0A 2DZXA 2ZZ1A 1XDJA 2PDKA 1J2BA 1W2PA 4ZQRA 4O14A 4U5KA 2X0YA 2QMKA 4B3ZA 1TVLA 1MXDA 3G18A 1CNVA 4IX0A 1XL9A 4JTTA 1QPNA 1G6CA 1V08A 4H8NA 2UY3A 4K68A 2WMGA 5F4SA 3AXMA 2VFDA 4DI9A 3BK0A 3STFA 5CH9A 5I3JA 3AU6A 2VELA 3CQKA 4GA8A 3T4CA 1QBAA 4S2CA 1QPOA 2VEIA 4LY4A 1N8IA 3LX9A 1S2TA 3FDKA 3WQPA 2BX7A 2PI6A 2PWUA 4ILSA 1XQKA 4KBXA 4WKFA 1DE5A 3MMUA 3ZM8A 3S1VA 4CVUA 3PULA 1QW9A 3P67A 3H26A 3PNUA 3NSXA 1GYMA 3ENLA 1ONWA 1BG9A 1H41A 6XIAA 1ALDA 4AZ5A 1BLIA 5KEZA 5D9MA 1GTEA 3IV8A 1UMYA 1E0XA 2NUXA 2YDRA 3WIJA 4Q4PA 3L67A 5G1TA 3W73A 1XRVA 3KBVA 1ICPA 4UQAA 1JYXA 3IRSA 3M44A 3QW4B 1TZZA 4Q8WA 4GKLA 3LV6A 2QJHA 5U4NA 2PLCA 1XLBA 2WNNA 4H6RA 1IWPA 4GK8A 4XZMX 4C6BA 1XHGA 1C7SA 2IQTA 5FJTA 3SY8A 2NQJA 1L6WA 3CUGA 1AW2A 2XM1A 2ZRZA 1KQZA 3BAWA 3DI1A 4P8XA 2WC3A 5A8NA 2F8QA 2NX3A 4FNSA 1CX9A 3TDFA 4P7NA 1DV7A 5G1MA 2YDQA 4PL2A 4UMBA 1JXKA 2EPNA 2Q8ZA 4AF0A 1VS1A 4MDPA 3UWYA 1F3TA 3S6OA 5I03A 4E6MA 4C7GA 1PEZA 3CUHA 1SO5A 2X7WA 3KZPA 1WB0A 3CL6A 5LSMA 3QTPA 3HM7A 2ACRA 2OO0A 3S83A 4DM1A 2UZ9A 3U2EA 3TW7A 1XLJA 3DCPA 5FKYA 3L2IA 3QW3A 3VD9A 3FEQA 5TIMA 2PTXA 5DY2A 3BL3A 3L7RA 4W4QA 3VE7A 3MP4A 4O0ZA 1V7AA 3URBA 2ZTKA 4R7OA 5DEZA 1KGUA 4RJEA 1KCXA 4N2YA 3VABA 2B4GA 1YPXA 2YZRA 2NQ9A 3M07A 1X1OA 3PUGA 4NHVA 1Q4NX 5LIUX 2BXYA 1MQPA 1E43A 1V6VA 1XWYA 6CGTA 1NARA 3SW6A 4KFOA 3GDTA 4ZE4A 8A3HA 1SYTA 3DXIA 3I6TA 3MJMA 2P0IA 3WQ6A 4L6HA 3VO0A 1UYQA 3S46A 2XHYA 4HK6A 1NQKA 2Q8LA 2Z26A 4OE7A 1K8YA 2DZBA 4S23A 4MTVA 1XRTA 2AAMA 3P2VA 3MHGA 3N1AA 3C52A 3U5UA 2BGQA 2YBVA 4PYSA 2GQ9A 2ZUUA 5GPRA 1KFEA 4PMJA 3MKKA 5K4XA 2C3ZA 1DORA 5C9XA 4UTIA 2OX4A 3C3UA 3W70A 3GG0A 3B9EA 1MMFA 1M04A 4A4AA 3W1PA 3MY9A 5IDZA 2IKIA 4NZ4A 1QI3A 4Q8UA 5HANA 4HTYA 2XVPA 3WDHA 8XIAA 3UPWA 5AYXA 3W7GA 3KHJA 1J2WA 3BMWA 4PN2A 1JVNA 4E4PA 2E09A 5LKYA 3EMCA 1XINA 3GU1A 4HHMA 2AL2B 4JIRA 1RCXB 1SJCA 5AHIA 2E25A 1BPLB 3VC5A 3CWNA 4LGXA 3VZZA 1W1ZA 2I57A 3ICJA 3RNDA 1UG6A 4FEZA 2QJGA 2D22A 3PVFA 2BZNA 5EMYA 4A35A 1W6TA 3RM9A 5FD0A 3RM4A 5AC5A 2ZX8A 3JZEA 4CEXC 1QNOA 1RY0A 5ABFA 2QMJA 1HF6A 5IRPA 2Y63A 3G3DA 6TIMA 1XIFA 1TPB1 5HNTA 1TZ9A 1OF6A 2A21A 3EX4A 1FX6A 2AQWA 4WY0F 1F7BA 2BS9A 4JIEA 3QZEA 4TX6A 2ALRA 3WLNA 1KV8A 4AY7A 4O18A 5D04C 3T8LA 2VEKA 2X1SA 2HTMA 3MI2A 3NYZA 2DT1A 3HQ1A 4JCMA 3E38A 5D05A 3VIGA 3LD5A 1KBJA 1N8WA 3AHXA 1FHLA 5EMMA 4YHGA 4EP8C 1TA3B 3I65A 4UCFA 3DFNA 2J9XA 3G1FA 1MUCA 2GJPA 9XIMA 1ADDA 1RLCL 1JF6A 2DZPA 2D0FA 3LXBA 4ICCX 1T99A 1RZMA 1W9DM 4QITA 4DJED 1A5MC 2C14A 1EF3A 1R7AA 5B7ZA 1X98A 1F76A 1V0MA 2GGHA 4B2DD 3EX2A 3IVSA 4H8HA 3AISA 3W2LA 1NFBA 4A8LA 3G77A 3T7VA 2VURA 4A3HA 1H1ZA 2QCLA 3RGTA 3CAWA 3SUWA 4BEQA 4DJFD 2EG7A 3GVGA 5FF0A 2PWHA 3HPFA 1MYRA 1XH0A 4LV4A 1E0VA 4W5UA 4FNQA 1ZNNA 2QV4A 1OYCA 1FH8A 1FBAA 4MLJA 4JIHA 3VGEA 1EO7A 1NWTA 4AVFA 3TCEA 2VI0A 1IHIA 1QFEA 2DW6A 5H91A 5D9PA 3ZJKA 1LRQA 1SW7A 3DHUA 1GQLA 4HU3A 3T2QA 4NUWA 4GNJA 2FFCA 1QNPA 2HJPA 2A0NA 1C9WA 5HUOA 1AZ1A 1PIIA 2DT2A 2OB3A 1I75A 4Z17A 3PPFA 5E09A 1DJYA 5AC7A 4JEJA 2FDMA 5I78A 4KQNA 3ES7A 4YTQA 3WLMA 2GK1A 1Q65A 3ITOA 4FB7A 3AYSA 3M0KA 1M3UA 1MVYA 5FJOA 3UNTA 2PGFA 3KX6A 4PBFA 4JQ1A 5LNSA 1OFPA 4JN6A 2W4XA 1FRBA 3K8LA 4JX6A 3LERA 3C6CA 4WXZA 3LLDA 4FSAA 5HMSA 2PD9A 2HNHA 3GUWA 1WKYA 3DECA 4LB4A 1VFUA 4BI7A 1V6UA 1JZ8A 2XSXA 3QQWA 4JGDA 2W9MA 3WD1A 2VT0A 2OMAA 3LXCA 3OTRA 2V5DA 1HT6A 3BLFA 4PTVA 1TJPA 3W25A 3BTNA 3S5ZA 4LC8A 1VGAA 3N15A 3C8FA 4J28A 1H0GA 4JY9A 3WF3A 4S3JA 3TZNA 4AD3A 1D7KA 2JEPA 2ZWYA 3KLLA 1CGXA 3SAZA 3THAA 6REQA 3DDMA 2V2CA 4LS1A 4QEEA 2PCEA 4DB7A 2GJLA 3WQGA 3H2MA 1YBQA 4O11A 3EXRA 5I2UA 1O5XA 1X6LA 1QI2A 4NRRA 1AQMA 3N2MA 3BPWA 1TELA 2DSUA 4MNLA 2DZVA 4X63A 4F0HA 1E6NA 3WMBA 3AIBA 2E5BA 4PBGA 3O8AA 4AZBA 2VGGA 1D8WA 4UUIA 1W1IE 1KBBA 4TU1A 1B4KA 1DIDA 2QDHA 2WWDA 3QHMA 3ZT6A 1A53A 2QLYA 3H2CA 4LPCA 4RPQA 5CPNA 5HPCA 3WLPA 4BHYA 4C6MA 4HPNA 3L4WA 1RQEA 4JR5A 2BFGA 2C13A 2INFA 3OO2A 4PRTA 3DKJA 4K8GA 5IDIA 2FHFA 1JDCA 2ZRXA 4G2DA 3EOEA 4Q4RA 4E8DA 3WJWA 4JYDA 1TTQA 4E3TA 1S2WA 4H9VA 3PTKA 3F4NA 2P8CA 4TUFA 3M0VA 4ZXOA 3TR2A 1YDYA 2VGBA 4WJ8A 4HPHA 1MZHA 4J3XA 3M46A 4ZFMA 4RE3A 2V68A 2W91A 4AZCA 2NQHA 4MDOA 4POCA 3SUVA 3V0UA 1X1NA 4M8UA 4XKMA 4A22A 4PTDA 2O9RA 3CPGA 3TQVA 4IIEA 5E9AA 4OT7A 4JY8A 4O0QA 3RU8X 4E8CA 3GXTA 1GVRA 2WQPA 1XBZA 1ZL1A 3RRAA 1OG6A 3IGSA 2B81A 5FL0A 4ROPA 4ZSUA 2QGYA 3QZ6A 3RPTA 1EJRC 4FX7A 1E70M 3QMSA 1G7UA 1V51A 2OQHA 4AWTA 4M24A 5LIWX 3N17A 3AS3A 1UOKA 5E9XA 1F8MA 2GYIA 4LH8A 4JTRA 1TRIA 1T7LA 3U4FA 5CC5A 3H23A 2RH9A 1VFTA 3STPA 1HXJA 4YWSA 5ECUA 3CNYA 4XIMA 3B8SA 3O0FA 1QU4A 4IUOA 2OELA 5A8PA 4L6DA 3EWXA 2GWNA 3HGSA 3W87A 1JXJA 1R0MA 3JVAA 1UKTA 3B8TA 1ICQA 4W88A 1LT8A 2GGIA 4D6GA 1ONRA 1NAL1 3DFTA 1B9BA 1AVAA 4RW3A 3WH6A 1NF0A 3Q4DA 3B9DA 4FNPA 4S3KA 5CZSA 4R34A 3UCQA 2FZNA 5KZEA 3P60A 3PG8A 1KCKA 4X22A 3T0BA 3MI3A 1PUDA 1MEWA 5BRQA 3WSUA 5AZ1A 1ZAIA 4N02A 3ZT5A 2ZFAA 1XGEA 1RSCA 3VGBA 4JYFA 2VEPA 1PYFA 3R1ZA 4E3VA 3U48A 3DFSA 4LAUA 4JIPA 5CLWA 2YW3A 3QVQA 3NL5A 4GO8A 4IMCA 1TWIA 2QCFA 3FJ4A 1WE5A 3CT2A 3R5EA 3BJTA 4C60A 4PUKA 4XB3A 1C8QA 1ADSA 4EF8A 3MYOA 1P0DA 2O9PA 1B4EA 1O1HA 2ISSA 4GZIA 5AYZA 1E6RA 1F4AA 2HXTA 2CW6A 1E15A 4ACZA 1D3CA 2VCAA 3CT7A 3AWNA 4PMXA 3CHDA 4Q8QA 4OBTA 4JEQA 4AZ7A 3KDOA 1A3XA 4ZOAA 4WLCA 1ZGDA 3SN0A 3NZQA 3GW3A 1GTHA 5A3HA 2WZMA 4IWWA 3G1VA 4D8ZA 2DW7A 1EJVC 3G0SA 4PUEA 1TWDA 3P61A 1IEXA 1XBXA 3AMLA 1TR1A 3DG6A 3EGJA 4IM4A 5BMXA 1ZBCA 4HCLA 6ALDA 4FP1A 4Y2WA 1YMYA 2CWXA 3ANUA 4B5XA 3IJDA 1J0HA 4DLFA 3WBWA 1BKSA 2V8ZA 2PU1A 4BQ5A 1RAKA 1EB3A 1VAHA 4WVXA 2E3ZA 4IMEA 4N6FA 1E5NA 8CGTA 1EH9A 4XAPA 3R0KA 4C6NA 1RV8A 4UZSA 4XD4A 1DP0A 4Y90A 4J3ZA 2HE8A 3EXTA 3R8GA 4DJEC 5I00A 1WOAA 4UQDA 3MSGA 4PMUA 2YXGA 3N11A 1TTJA 1PKYA 4I7VA 1NDWA 1FWSA 4CVWA 4K7VA 2PFHA 3W01A 4G1NA 4D6EA 3HPAA 1HGYA 1V4YA 3WUFA 4AYSA 5EY5A 3R12A 1AQ0A 1GORA 4O57A 1JPKA 1BSIA 2FH6A 1JUKA 1P7TB 1ZTVA 3AICA 2NUYA 1LLOA 3ZQ9A 2XFFA 4OGZA 3FLUA 4DN1A 4GYFA 2MUCA 4NAEB 3QR0A 1Q85A 4V1YA 4FMVA 3PZNA 1DWHM 1ZJBA 2DGAA 2QCEA 4NJIA 2WCSA 3L4ZA 3KS5A 3F2CA 3S9YA 1TPUA 3K8KA 1FWWA 4HA0A 3NIYA 4J35A 4K2SA 5I6SA 1NTHA 1FWNA 3VCNA 1P0NA 2QCDA 4MJZA 5AECA 5AZ0A 4O28A 3HGJA 3E0VA 3EWYA 3QGVA 1BQCA 1GQIA 1BWLA 5HATA 3JS3A 1I0DA 1IXNA 3WJXA 3L4UA 2ISVA 3ANVA 1ITQA 4FXJA 3SY1A 1SZEA 3VKBA 1BXCA 1GOMA 3AIRA 2UV8G 4D1IA 3WJSA 5A6JA 2CZ5A 1OSEA 2E68A 5EU9A 2DT0A 1JQVA 4NZJA 2F6UA 3VKCA 3VX0A 1U30A 1AD4A 4DUOA 1XYLA 3UPMA 3WF4A 4DF2A 2EQDA 4J3TA 3BARA 5HJXA 1FCBA 4S3FA 4I5RA 1PKNA 5HINA 4XUGA 3GKFA 5JMUA 2POTA 3LGGA 3ZLHA 3V1PA 3HF3A 4QJ1A 3CTLA 1RP9A 2NT0A 3W6LA 1CENA 3S6DA 5KMYA 3IGUA 3LI1A 4UFKA 1KRMA 2PBOA 1JCLA 4BK9A 2C8NA 4CCEA 3HBLA 4QG8A 1TJ1A 2P0OA 2WVVB 5A6LA 3L4XA 4YCOA 2OO6A 3W1LA 3GH4A 3L0NA 2WB5A 4GFIA 4DIAA 5TAOA 3WEZA 3T4WA 3SUTA 4GJ1A 5FSEC 3WDIA 2TYSA 3V5OA 4LS2A 5CXPA 1PTGA 4EE9A 1OWQA 4R27A 4ZB2A 1YXYA 1H51A 2XGIA 3RO8A 2YXOA 4W86A 5LNUA 3W53A 3FJNA 5BRBA 2J6VA 1C91A 4PEKA 3NDZA 2O92A 1CYGA 3DESA 3IVTA 2X41A 4DI8A 1AW5A 5FF7A 2VFEA 1PO9A 3F4DA 1LT7A 4GQQA 1QI0A 2PAJA 4NASA 5C9WA 1HJSA 4PGLA 4P7LA 5I3FA 5MHBA 2IKHA 1FHVA 5DT5A 5BROA 4LVAA 1K8CA 3WY1A 5BRPA 7CGTA 1EWDA 3SUSA 2BGNE 1L6SA 5D2VA 1EIBA 5A5WA 5T9CE 3W7LA 1GQJA 3TV8A 1ONXA 1YNYA 4Y9MA 1CXHA 2PTWA 3WDQA 1WBJA 3RUBL 3NQEA 3P80A 3UXLA 1JDDA 3SN4A 1F5ZA 3CH0A 1RY8A 4QG6A 3C4UA 2QUMA 2F2KA 4RZ6A 3KAOA 5DCEA 3TH6A 4WSJA 4GXPA 3LRLA 3I10A 4AQLA 3H4XA 4AVNA 4RL3A 1I2PA 3PSVA 1UH3A 4JQ3A 4UZUA 5CSYA 3SR7A 2VO5A 2WMFA 2DUXA 1K9DA 4S3CA 2VQUA 4WDWA 4B3KA 2Z1BA 4IICA 1XIHA 1A4LA 1IR2A 3OYXA 2ZUVA 4WY0B 2Y7FA 1CLKA 3E9AA 2SFPA 1UP3A 1QOPA 5H8UA 1WX0A 2YPIA 2GWGA 4MY8A 1LLZA 4M56A 1XLEA 3W24A 1VKFA 4C6QA 2FZ8A 3VU2A 3WBXA 5JUVA 2PWEA 5HBFA 3IIXA 1J96A 4LCRA 4ACYA 1NP2A 1XM3A 1TV3A 3G1RA 1TPEA 3GC2A 3GM8A 2ZWZA 2YA1A 4KEVA 4OJYA 1FXQA 4DZ5A 1K9EA 1E1EA 3ZS4A 2FFIA 1H09A 2DSWA 1TE6A 4RDZA 4PMVA 4BJHA 2HQAA 1J79A 1KNWA 3C2OA 3HMJG 2PDFA 2V67A 2CBUA 2PRMA 1C3FA 4Q7IA 3DUGA 3PBWA 1SGJA 3G0XA 1WCGA 2WW5A 2CXEA 4M6UA 4NJKA 1ONEA 4ERGA 4DEFA 3SADA 4NX5A 1JEZA 2V5BA 3GAKA 1YTDA 2UWFA 3OBKA 4MWAB 5CSSA 3SCNA 3T0AA 4R7JA 1YRRA 4XISA 1NWRA 3RG6A 3AIUA 1R3QA 3ARUA 3H2FA 4QROA 4XUYA 2A6LA 1ZY9A 3QZAA 2O9TA 4JNZA 3MUZ1 3M7SA 3JR2A 3FA5A 2J9YA 2X1TA 4W8AA 5FJJA 3CEUA 1E71M 4WZHA 2J7DA 5LA1A 2L5HA 4O1DA 3HTWA 4MADA 2CLHA 1K6WA 4GYPC 1LG2A 1V3JA 2OLSA 3TTQA 1TIMA 4LF1A 1WOBA 3M7WA 1AJ2A 3NOEA 3M5XA 3KWXA 1PSCA 2YDSA 3VGFA 2EAWA 4WXYA 3F4WA 2Z6JA 2PDCA 3QH2A 1O95A 3VIJA 4PSRA 2QEZA 4O1BA 4AD0A 3EWWA 5A6MA 1JRBA 2NX1A 5DQPA 3TC3A 1G4TA 4KGLA 5I3DA 1N7KA 3KRBA 3N18A 3PP7A 4Y9PA 3P8JA 2FB2A 4OUIA 1XYAA 1A5SA 3CBWA 1LBFA 3NZ1A 2VGIA 1NWUA 1E6PA 1F8IA 1RQHA 1RUSA 4ONVA 2R1LA 1KKOA 1UR9A 4CQDA 1DBTA 1W0MA 4BI6A 4AZ6A 1R30A 4H9XA 2HWGA 3TTEA 3SDOA 3EPOA 1YLVA 1SMDA 3D47A 1JULA 5G1YA 1CXIA 2AMGA 4QP0A 3BAYA 1Z42A 3IV3A 3BW4A 3WH8A 4K8HA 3K13A 1ZP3A 1HG3A 1JGMA 1X7FA 5CC7A 4QHRA 3GDLA 2DSZA 1JFHA 3BMVA 3WD2A 1XUZA 4JIIX 1DIOA 4L9XA 1AL8A 1VLIA 1W9PA 2NLYA 2O7SA 4P7OA 3KVJA 1OCNA 3KTCA 1TMLA 4NILA 3G1XA 2ZOXA 5L9FA 4IPNB 4AD1A 2A5HA 2YIHA 1FWCC 4KWOA 4OUEA 1DJGA 1J12A 1TV7A 4CNTA 1J18A 4Z1YA 1SR0A 1YX1A 3EDJA 4AZHA 1TA3A 3H2NA 1XBYA 4QLKA 2OX1A 4UNLA 4FAMA 3P5ZA 4E5TA 2J13A 1GOQA 3HGOA 3VOGA 3K1DA 1IT0A 2BSLA 3MCOA 1K77A 4X60A 4HOZA 4DZIA 3ZLGA 4GACA 4FALA 4XIAA 4MY9A 4PMQA 1KGWA 3EPNA 3OBEA 3GZ3A 1PS9A 4N42A 4LBUA 3M6YA 4GE8A 2ACSA 4PUWA 2PDUA 1XRSA 2QF8A 3PHAA 2RJGA 1YKWA 3GXIA 3C0SA 3W37A 3ITTA 3TJLA 1A0CA 3POHA 2OODA 4JTEA 2E1DA 3CHVA 1X38A 4TMCA 2FLIA 3WNMA 1P43A 4EPDC 3W02A 2WMJA 5H6HA 4MM1A 2O4QA 4HOWA 1XFBA 5AN7A 2G95A 1PZ1A 5EBAA 3TONA 4HK7A 4N9EA 1RD5A 3RITA 3MMDA 2E6DA 3W7NA 3VIIA 1R6WA 1TV5A 1GVEA 3DFHA 3ONBA 3ZVIA 3PWGA 3W71A 3S2LA 1WXZA 4L64A 4DJDA 3UGVA 4DUWA 3W4RA 3MI6A 1VCVA 3BUVA 1UUMA 3NG3A 3G0UA 4FS9A 1U1UA 1Z6KA 1ITCA 1EEPA 2XN0A 3V3WA 2VFFA 2WJDA 4V27A 3ELFA 1UBSA 2A85A 1ZJIA 4UQCA 4WGXA 3ARSA 4JFWA 1E56A 4UQ9A 4QX4A 1XFCA 3L5LA 3C0LA 4Q22A 3P7YA 2F61A 3NSNA 3HPSA 4B5TA 1B3OA 2OWWA 1ICSA 3WQVA 4H9MA 2Z00A 4ZEPA 5FOOA 4LNCA 1XLIA 1IZKA 1LL6A 3VMOA 1PWLA 3NZGA 1VFMA 2O4MA 4M29A 3GVRA 3W7IA 1O4UA 4GXWA 3M5ZA 1ITUA 3OLDA 5CBBA 2GQAA 1EJWC 4CGTA 4PH6A 4JKKA 1S3HA 4IPLA 5AHMA 1JIBA 3B9OA 5CZJA 3PB2A 2R1KA 3W75A 3JU2A 4IH3A 3BOXA 4NZ3A 4FXRA 2YXXA 1Q13A 3OLEA 3BLLA 5FEXA 5XIAA 3VOFA 5FL1A 3L68A 2V3DA 1BQGA 3HIJA 1U5HA 1GONA 2J47A 3W1QA 5I06A 1DHKA 5AYBA 1VHCA 3AS0A 4FLRA 2PDQA 2B31A 2Y2WA 2QUNA 2XJ7A 4O53A 2ZC1A 5CPTA 1FKXA 1RP8A 1W32A 2G41A 5C6MA 4WCJA 1KWGA 2HBXA 1J01A 2WMKA 4AYGA 3OGRA 4Y7EA 3R13A 4IHCA 4Q32A 4ES4A 1LROA 2X7VA 3R4IA 7TAAA 3TWBA 3M0ZA 3DYOA 2PDJA 3QEZA 4AC7C 2QDEA 3UJRA 5HULA 1OF8A 5HDRA 5E93A 3PUEA 1XICA 2DZWA 5I3IA 4QIUA 3G1DA 4LS0A 3TFCA 1FQ0A 3PZVA 4GQ0A 5BMWA 1CXLA 3F5KA 3RLHA 5HUPA 5HQEA 2D2GA 2Y7EA 2Q01A 3W88A 2DFAA 1E73M 2OOFA 4IIDA 3B8UA 3ABOA 2PTZA 2PDXA 2VVNA 3ISIX 3PFMA 5T9BG 4BWLA 3WELA 2A3BA 3QBUA 1SMAA 3RLUA 3KOYA 5AHNA 5IM51 1MNSA 4IL2A 3WMLA 1E40A 1CLVA 2HZGA 1BWKA 3SRHA 3GXDA 1NY1A 2YB1A 1NFPA 3ARRA 1FA2A 4HA4A 3UJEA 4DWDA 3KM8A 3MPGA 2CZDA 2PLMA 1GVFA 2VUYA 5LNVA 2XWDA 5AHLA 4KFNA 1ZS2A 1TE1A 4O8AA 2J78A 4GOAA 3FAXA 1UWQA 1I2NA 3T0DA 2RGMA 5GVJA 2X0HA 1IWBA 3KBWA 1IF2A 3CUIA 3BAIA 1G9HA 4V28A 2OZ8A 5D9OA 3MBFA 1FHUA 3ITYA 3SIMA 2REQB 1BRLA 3LCWA 4O17A 1FOBA 2OKOA 3MKCA 4OFCA 5HR7A 1FWFC 1TR9A 4XKYA 1ZJAA 3AXIA 4DAIA 1IEVA 1IGSA 2E67A 2Z25A 4FOKA 3OPSA 3W7MA 4ATLA 3P3BA 2WZTA 4RLIA 3QPZA 2YDAA 2VEGA 4GLEA 4QQ3A 4WD0A 4A2RA 3ZR4A 1LUCB 5DCBA 2UY2A 2ZYFA 1QASA 1VCGA 2XFYA 3V7PA 3QC3A 1VYSX 5LXXA 4GFSA 2JKAA 3KEHA 4L4LA 2A7PA 4EXAA 5C71A 4MUZA 3F1QA 2BV9A 3O3RA 3RO6A 5FJIA 4DWSD 2W62A 2DP3A 2MANA 4A8IA 3W7HA 2G3FA 3AS2A 3PK7A 1VP5A 1FXPA 2PDHA 1IXPA 2E9MA 4FIRA 4JTUA 3V36A 5DMNA 3RIKA 3WF0A 5ABTA 1RA5A 3BE7A 2VFHA 3WNOA 4JNMA 3MO7A 2B7NA 3KHDA 3WH5A 1DEDA 1X97A 2NSOA 1H4PA 4JD4A 3KP1A 3LUTA 2Z1XA 2HVMA 2QPSA 1M65A 1SZFA 2ISWA 2WHMA 3E74A 4Z1CA 1H3GA 4UOQA 1GKQA 1XF0A 3W2JA 3HG3A 2I14A 3LPFA 1Q8AA 2Y6ZA 2PGWA 3R8RA 4E38A 1WUFA 1MNZA 4HQVA 2VCBA 1GHRA 1G4PA 4OOUA 3Q58A 4JTHA 3APGA 1Q6QA 2OEMA 3APYA 2IQDA 1QOXA 3T42A 4YU1A 3E49A 3NFUA 3LQLA