1IXQA

Enzyme-phosphate2 complex of pyridoxine 5'-phosphate synthase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
242
structure length
235
Chain Sequence
AELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEEGGLDVAGQRDKMRDACKRLADAGIQVSLFIDADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQELARIAKAATFAASLGLKVNAGHGLTYHNVKAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKRLMLEARG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyridoxine 5'-phosphate Synthase
publication title Enzyme-ligand complexes of pyridoxine 5'-phosphate synthase: implications for substrate binding and catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
total genus 90
structure length 235
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 2.6.99.2: Pyridoxine 5'-phosphate synthase.
pdb deposition date 2002-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ixqA00
1OX5A 1WOBA 1VLWA 1D3GA 5AC7A 2F84A 4GC4A 3MW7A 2A2IA 4JIPA 4QNWA 2ZTJA 3PBYA 4LC8A 4N9CA 1QMLA 2Q8ZA 4E38A 1SFLA 4K8EA 1TTJA 3FOKA 3P5YA 3MP4A 3LTYA 1JULA 4YLWA 1TIMA 4I9AA 3NQDA 1LP6A 3HJZA 4XUGA 1W8SA 3S0CA 2CZFA 4NU7A 2VEMA 2WSQA 1T96A 3W2KA 4XQ6A 1I2NA 3LCHA 1O60A 3KVJA 3TCEA 3G0XA 3QJAA 1FDZA 1I4NA 1SQ7A 4WY0F 3LM7A 5CPOA 4JEQA 1F6KA 3OVQA 4UFKA 2I1OA 1TSIA 3LX9A 4IMFA 2JKEA 3TUUA 1VLIA 4JTFA 5CPNA 1EWEA 4IOTA 2BLEA 2GVLA 3HGRA 3W23A 3L21A 3HF3A 3EEGA 4HNUA 1KTNA 3LXCA 2Y7EA 1TREA 4Z1DA 3S9YA 3OG3A 3E49A 4MUZA 1ZENA 4NUWA 4BFAA 4POCA 3TE9A 1NF7A 2ZZ3A 2JGYA 3IVSA 4NX0A 1TPUA 3WJYA 3ZR4A 4IXXA 3SIZA 1RD5A 3OVRA 5G2HA 1TMHA 3KVLA 5LKYA 2ABBA 1FWWA 1QCWA 2C0AA 2TMDA 1QPNA 1L6SA 4AWUA 3LHUA 3PY2A 4BWLA 5TBOA 3IVTA 2RHGA 1OX6A 3GKFA 4C1KA 2PRMA 4X9SA 4O0KA 4OE7A 3C61A 1P0NA 3W9ZA 1ME9A 2V2DA 3P84A 4UTWC 4HPXA 5EY5A 3B05A 3CEPA 3DI0A 3GXPA 4NX5A 3NQ6A 3LI1A 3LCWA 4JNMA 4XTIA 3SECA 2NWRA 4PA8A 1GJPA 4JDYA 4X22A 2C13A 3M6YA 4K6AA 5KTLA 2FQIA 3KVKA 3N3MA 1EEPA 4LUIA 3R8RA 4MZ1A 1MEIA 5HMSA 3G8RA 4IJBA 5D2VA 3PBUA 3LDVA 3TW6A 1SZGA 3ABSA 3PULA 3NQMA 2A7NA 3OBKA 4FX7A 1W3IA 5D38A 4CCEA 3UZJA 3NEVA 2JKAA 4FB7A 2JGQA 1K7EA 3JR2A 3W1UA 3HPXA 5LGXA 3FKKA 3W74A 4UTTC 1H61A 3UXAA 4LTSA 1KFEA 1P1XA 4RZ6A 3EWUA 3P7YA 2O7QA 2DP3A 2Y7FA 3BW4A 3Q37A 1H50A 3KFTA 1L6YA 1TRDA 1LYXA 3QF0A 1LM1A 5EPDA 5LNRA 1UUMA 4JDBA 4FXRA 3BLEA 2NXHA 3L5AA 2QCGA 3LLDA 3A5VA 4FXSA 3NQCA 4XTDA 4OV4A 4JICA 1VPXA 2D73A 4M6PA 4AB4A 4JTKA 3P60A 5F1UA 3NL3A 3H55A 3VNDA 4O50A 1G4TA 1CW2A 1TV8A 1KM4A 2DU2A 1NEYA 1HFBA 4CCDA 3PG9A 4I7VA 2RH9A 3R2GA 3FYOA 1YPFA 1M6JA 5D03A 1SR9A 4R33A 2A4AA 2FPVA 1KM6A 3WJSA 3P81A 1VH7A 2QAPA 1L9WA 4WY0B 3IRDA 3P8JA 1DJQA 3JRKA 1GVQA 4UTMA 3T44A 3IIVA 1PL9A 5G4EA 5D02A 4QSHA 2X2GA 1LORA 4UFHA 4I7UA 2NX1A 5I3HA 3GR7A 3IVUA 5FEWA 3HG2A 3F4WA 1ML1A 1ZALA 3PVFA 2QCHA 4JIQA 3ATYA 3GDKA 2VFFA 2V5LA 3W1MA 4JR5A 3EX6A 2ZZ7A 5G5IA 5I3GA 3SGUA 3P82A 3W1LA 3KRUA 1LDCA 1H7RA 5D33A 4LVDA 3QRHA 3E02A 4CQ8A 4MYXA 2HSAA 4UTHA 4QJ1A 3Q2DA 4MZ8A 1DHPA 3RNDA 3U8GA 1UASA 3PSWA 3WK0A 3M5XA 4JTTA 2TRSA 4YMZA 2ZZ2A 3A23A 1X8FA 2ZTKA 3HG3A 4RXGA 5AHEA 1D9EA 4FO4A 1GWJA 1JUKA 2WJZA 2HS8A 2CLEA 4EOUA 1O94A 4OGZA 3OIXA 4IPJA 4ICNA 5HWJA 3W1NA 3LBCA 2OT1A 3W6YA 3R13A 3GAYA 4MZYA 1ZNNA 3BV4A 3P5ZA 3ZWSA 3G1AA 3TNOA 1JR1A 1Q6QA 1SSDA 1VYRA 1F76A 1KLZA 3W84A 3QM3A 1KM2A 1OYAA 5FESA 2C19A 2FJKA 2Y7DA 3TJLA 3SY5A 5HQEA 1OFPA 3EXRA 3L68A 2ZQ0A 3B4UA 3QMTA 3LOTA 4DO4A 4M7SA 4RZ5A 2VFHA 2VFDA 4AMAA 5BRBA 1H51A 2RDUA 4A2RA 2W6RA 3TIMA 3HMJG 4NXSA 3AO0A 4ZVJA 1R2SA 1J5TA 2GUUA 3BVJA 3V1PA 3LV6A 3W2NA 5HWMA 3LRKA 4JTEA 4LVBA 1A50A 1EUAA 1C9DA 3AJXA 3S5YA 1ICPA 3BLIA 4UTKA 3BK0A 2QCCA 5EBUA 3W86A 3ZFHA 1BKSA 4WQ6A 1OF8A 3O63A 4O28A 3FYPA 5G1YA 2ZZ1A 2NV1A 3QFEA 1JCLA 2DZUA 3O8AA 1VJIA 3M41A 4UTWA 5HULA 2VELA 3GVGA 4LW7A 4M19A 3C52A 1NFBA 3VKJA 5TIMA 4HIBA 3DBPA 3CM4A 2E6YA 2PC4A 3BW2A 5AC6A 5G1TA 3RLVA 1AW1A 5AYXA 4H4IA 1VZWA 3LCLA 1JCYA 1YPIA 3W72A 1VYPX 1AW5A 2FPTA 3B06A 4I7WA 4UUIA 3QC3A 3W88A 3W7KA 3LCXA 3YPIA 1LBFA 4ONVA 2ZRVA 3LCGA 4MOZA 4AAJA 2B7NA 4RLIA 1HTIA 5HJLA 5EL1A 5KMYA 4O11A 3R12A 4YXGA 1XL9A 3TC7A 3W2UA 1LOSA 2DZSA 2DZWA 1YXCA 3OA3A 1P5BA 1ZJIA 3TK7A 1W5QA 6ALDA 3EXTA 2Y63A 2B7OA 3FFSA 3NGJA 2WNNA 3C8FA 5KSWA 1QOPA 1U83A 3LCFA 3L0GA 4OBTA 1SZFA 3W1AA 4O8RA 1XUUA 5BMXA 3LERA 4JX5A 4LY8A 4GXMA 4NQ1A 5J5DA 4NJGA 1FXQA 4ZQCA 2EAWA 1TPH1 4HN4A 3EWXA 2NLIA 4XZ9A 1EPXA 4ALDA 4LV4A 2E6AA 3PB2A 3ELFA 5HR6A 4UIOA 3NOEA 4O4VA 4XKYB 5A8GA 1KBJA 3PR2A 2A1YA 3UPBA 3CT7A 2FIQA 1UCWA 3W70A 3W7OA 4TMCA 1MEHA 2QUUA 2V2HA 2ZRWA 1RQBA 1N55A 1YTDA 3NA8A 4O4WA 1A5SA 3PBWA 1X6UA 1DJNA 2Z6JA 1OF6A 2YZRA 3HG5A 4ADTA 4N9BA 2P10A 3HIJA 3DAQA 5FEPA 3UWYA 2OJPA 3VE7A 1RQHA 4E2BA 3DI1A 1QWGA 1OFEA 2GVJA 4MVAA 3TFCA 4UNLA 1EP2A 4YWIA 2H8ZA 3QW4B 1S3HA 1YYAA 3G1FA 1P0KA 3GAKA 4GE8A 1LZOA 1SU5A 4NJJA 4R34A 1DQWA 4ZQOA 1I2RA 4OHQA 4NJKA 1I2PA 1GTHA 4UC5A 1FCQA 1V7YA 1SUXA 3INPA 3TAKA 1Q6OA 3STCA 3FKRA 3NQVA 3QMRA 3A24A 4JYDA 3WK2A 1FCUA 3W7IA 1NVMA 4PEKA 3CHVA 4HNNA 3TH6A 2QJHA 5E0KA 3MWAA 4QM1A 4FNTA 1W54A 3FA5A 4NNAA 1WBHA 2CLIA 3FS2A 4FNQA 3S5NA 3DKJA 1GG1A 3QPZA 4PODA 1LBLA 1AW2A 1YDVA 3TMQA 2QCDB 3MHUA 1CX9A 2YFNA 3L65A 2DZTA 4WUIA 4AXKA 2KZHA 4FIQA 2QKFA 4JN6A 3QW3A 5EMUA 3QQ1A 5LHFA 1SO3A 1G7UA 1SZNA 4Z1AA 3W76A 1H7WA 3W7NA 1G69A 2CLLA 1QPOA 1M7OA 3UY7A 3ABOA 4TX9A 4L4MA 3QH2A 1LOQA 1OX4A 3NR0A 1UJPA 3P80A 5FI8A 3R5EA 2GPTA 4QQ3A 5FEXA 2QF7A 4PL2A 3NQAA 1PVNA 3I7QA 1ONRA 2NXGA 5FF2A 3A22A 3GLCA 4GRSA 1MO0A 3LGEA 1W5NA 3PBVA 2E6DA 2NUXA 3N9RA 4NT0A 2A7PA 4Q32A 3QPYA 4JX4A 2R14A 2E5BA 3C56A 5DLCA 1RVGA 4UFIA 2IQTA 3HPSA 4UTLA 1Q45A 4DEFA 1XI3A 1W3TA 1ICQA 1SFJA 3GYEA 1KFJA 4MJMA 3G0UA 3T40A 2H8XA 2J88A 3PC0A 4JTUA 1F5ZA 1FY6A 1ALDA 4FNSA 1WYIA 4GNJA 4DELA 2E1DA 4WXYA 5SWUA 3M5YA 4HPJA 5LSMA 2VEIA 1LRNA 3VFLA 1FCVA 1VGAA 1TQJA 2ISVA 4LVGA 2BSLA 3QQ0A 1QFEA 3B0PA 2Y7GA 5CZ0A 1YXDA 1T0OA 4O17A 5I3KA 3F03K 3NM3A 3SZ8A 4JTJA 2ZA2A 1S5TA 3NQGA 1WA3A 2H3BA 4GFSA 4M7TA 3L5MA 4UTUA 4ZQMA 4JGDA 2X1UA 4NVTA 1TV7A 3W71A 4IUOA 2FDSA 1XXXA 1TO3A 3B0VC 3FJLA 4K38A 2QCMA 1OVDA 1PCWA 2YSWA 7TIMA 3LV5A 4NNBA 3PB0A 2ZRXA 2DJLA 4EF8A 2I9EA 3L67A 3DFOA 2E09A 1KFLA 3IIPA 5FF3A 2PURA 4AWSA 1DVJA 3D0CA 3I6RA 3KVMA 1O95A 5HINA 2Z1BA 3W22A 3L5LA 4LOCA 1FDJA 4EIVA 1EX5A 3VI2A 3W1PA 4JYFA 3MO7A 5AC8A 3KOFA 1YTEA 3L9CA 4IMDA 3THAA 4HHPA 3Q58A 2BX7A 4CCCA 3W1RA 5DCBA 2OMAA 4Y90A 3UWVA 3IGSA 1OYBA 1SPQA 3HPZA 1W31A 4FNUA 4DPQA 4O57A 1KTBA 2C1HA 5C2XA 3W07A 3TXVA 4Q33A 3S1XA 2A21A 1OFDA 3LBMA 1R2RA 2H6RA 5K9XA 4ZL1A 2YR1A 1YADA 4LS0A 2O7SA 4LS2A 4O1DA 3P8IA 5D04C 2WNQA 2QJIA 5IBXA 4X2RA 3PUDA 3H53A 4FNPA 1XBYA 3UXDA 5AB3A 3C2OA 1XUZA 1R2TA 4JTLA 2ZA3A 1XDMA 4R53A 1VC4A 2PCQA 1FWSA 4MYAA 1H7OA 1VS1A 4HT3A 1J4EA 1WQ5A 3RF9A 3KHJA 5CPMA 2AAMA 3A5FA 1YDNA 3CPRA 5BNKA 1Z44A 3M9YA 3S8HA 2Y85A 2H3DA 5D32A 4GUHA 1M7PA 2YPIA 2V5BA 3MI2A 3TQKA 4LNYA 3C3NA 4JYEA 1O4UA 3CB8A 4P2VA 2Y89A 3KRZA 2GJNA 3DKLA 1IIHA 3NO5A 5BOOA 4O13A 1WOAA 3EX2A 1W5PA 2UV8G 2Y70A 1B9BA 3ABQA 3I7RA 3H54A 2GQAA 3MP3A 4WX2A 4K8HA 3UWUA 1ME7A 5DXXA 1W37A 5I3IA 1S5WA 2E5DA 3MBDA 2ZCGA 5F4XA 3STGA 5HWNA 3N14A 4UXDA 1QOQA 3EX1A 1T8XA 4TIMA 4AH7A 2X1TA 1E51A 3N9SA 1ZHAA 3O6YX 2CLMA 1OG0A 1XCFA 4AVFA 2X1SA 4BI6A 4XWUA 3L66A 1LLZA 2V30A 4S2CA 1F73A 1X1OA 1IF2A 2B7QA 4GBUA 2QEZA 3W73A 3NQ7A 3W75A 3SW6A 2XFWA 5D2TA 4D2JA 1Y0EA 5CKSA 3M5ZA 2PE4A 3SI9A 2VEPA 3WJZA 4BI7A 2DORA 5FF0A 4IX2A 4GUJA 3QSTA 2R94A 2GQ8A 1TCDA 4RR4A 2A7RA 1WBJA 3TSBA 2ABAA 1XKYA 4P61A 2ZRZA 3G0SA 1QPRA 5G2WA 3B0UX 2ZFAA 3DFTA 1XBVA 4DF1A 4DBDA 2NX3A 2ZZ6A 3C4UA 2X16A 3MI6A 4AF0A 2G96A 3CEUA 3R89A 2G97A 2C15A 2QDHA 1OFBA 4IGHA 4A3UA 4LU0A 4O52A 1GVOA 3P67A 4N6EA 4CNNA 3NQ2A 1ICSA 3N19B 4O12A 4O1BA 1WX0A 4UMCA 4XBSA 3FJ6A 2EPHA 4ML9A 1K3UA 4JY8A 1XC4A 3G3MA 3CWOX 4U28A 3E9AA 4MFEA 2C6QA 4BF9A 4RK8A 2FPYA 1G6CA 5U7SA 1NAL1 3FLUA 3DENA 1NSJA 1L2UA 1W56A 4UMAA 2ZA1A 5LNVA 2YGYA 3BPWA 1X7FA 2Z0IA 5I3FA 4R7JA 1LBMA 1AK5A 4DF0A 3CQ0A 3DZ1A 1AL7A 1KLYA 3VE9A 3W85A 1HG3A 1QR7A 4WOZA 1YXYA 3P74A 2FLIA 3C0JA 3PUOA 1GTEA 1Q6LA 3WFAA 3B03A 4IWWA 2V2CA 5DBTA 3O6CA 4Z0JA 4LC6A 2HMCA 3UWWA 2V9DA 1UB3A 2XN0A 4JS3A 4LVFA 1TTQA 2PRLA 3GXNA 5AHMA 3T4CA 3G22A 5D37A 4UR8A 5E93A 4Z08A 4H3DA 1TTPA 1BWLA 4O14A 1ZCOA 4IMGA 1EA0A 3E96A 3O15A 4N02A 1KTCA 4HSOA 2RDWA 1X1ZA 3M16A 1K8ZA 3P62A 4MY1A 3W2MA 5K4ZA 4OU1A 4ZZ9A 5AFDA 2BWGA 5LNWA 4O0ZA 4TMBA 2VXNA 1GT8A 1LLWA 4RKAA 5HUOA 4Z0SA 4NNCA 3W87A 2ISWA 3QYQA 5EYWA 1QPQA 4KWVA 3L0KA 2W0UA 1TPDA 3P61A 1VCGA 2C3ZA 3HBLA 4WOQA 3W7GA 1HUVA 5C5YA 3G24A 1YTKA 2YXGA 2BTMA 4J9JA 1UUOA 1DBTA 1JVNA 2QDGA 4RZ4A 1SW3A 3NAVA 3IGUA 3RFAA 5CG7A 3OHIA 3NL2A 5D09A 1TTIA 3LI0A 2J9ZA 1L6WA 3NG3A 2B4GA 1EUNA 2ZZ5A 2WQPA 1K02A 4K36A 1RV8A 4IXHA 3S1WA 5LNSA 3S42A 4JTHA 1B4KA 1CI1A 4EF9A 3HGJA 1BEUA 4UFJA 2CLFA 3DFPA 3IIXA 1A53A 5AHFA 4DXVA 2QJGA 3N2MA 1I8JA 3VCRA 3PAJA 5DY2A 1R30A 2Q3OA 4ZQPA 3HOJA 2YCEA 3TR2A 3A21A 1KV8A 2Z2UA 5K2ZA 1BWKA 4O15A 3DHDA 3C6CA 2WSRA 4S1FA 3GIYA 4MY8A 1KW1A 1B3OA 1RPXA 3MHFA 5IBXC 3M44A 1TYGA 5AHIA 3W7MA 3TA6A 4AF0B 2ZRUA 1FBAA 4LS1A 2FB3A 2NV2A 3NQFA 5E1QA 4AHOA 4JTGA 2EGZA 2XN1A 3GB6A 3W7LA 5DCDA 3GNDA 4IMEA 2RDTA 4EVZA 3L0NA 2QCLA 1B57A 3USBA 4Y8FA 2Q3RA 3O1NA 2JBMA 3M5VA 3STFA 2GJLA 1LROA 2Z6IA 5F1VA 1DOSA 3HQ1A 2V0TA 5DN1A 4MY9A 4DO6A 3EWYA 4TR9A 1N8FA 1JUBA 1SSGA 4CLMA 1IXPA 4MPQA 1OK6A 1G7VA 5C6MA 2YW3A 4O1CA 3HG4A 3QZEA 1SO6A 3G1SA 1MSSA 2CLHA 2QUVA 2NUYA 3MYOA 1DV7A 3TX9A 4MJZA 3DFNA 5C55A 4JXCA 5MHBA 1WV2A 1TPVA 1FCBA 3HB9A 3IIZA 2A6LA 2CZDA 4NZFA 2W79A 2V8ZA 4CQ9A 4PCFA 5HR7A 1JRBA 2Y88A 4A29A 1R46A 1WDWA 1Z42A 3TU9A 1W0MA 3DFQA 3T55A 3LLFA 1JQVA 5AHLA 2J24A 4ZMGA 3WJWA 4N2YA 1PE1A 3CC1A 3F1QA 5DELA 1JCMP 3PUEA 3BG3A 1KA9F 3W1QA 2J6XA 4RXFA 3NXFA 4A21A 2FTPA 4EWND 5CZSA 2DZXA 1EP1A 1FUYA 2OCZA 4M5PA 5CGQA 1FX6A 4IX0A 1W1ZA 3RK8A 3BGGA 4L4LA 4KWWA 2ZYFA 4JX6A 4E0CA 1D3HA 3PSVA 3LHTA 1IXNA 3G1DA 4IPIA 2V81A 4MIMA 4ZQRA 1PV8A 3U6WA 2BXVA 3BG9A 4CQAA 3N2XA 1LCOA 3TKFA 4W9TA 5EA9A 8TIMA 1PIIA 2WKJA 3GDMA 2TPSA 1PCKA 2ZRYA 4S2BA 2CFFA 3SSJA 3LTPA 1IXQA 1AMKA 4HSNA 5D05A 3LTSA 4QNEA 4FF7A 3UQNA 4GUIA 3M0ZA 2CLOA 3W7DA 2QR6A 4KFNA 3GNNA 3T7VA 4FX6M 4U4MA 1R47A 3V75A 2YX0A 1GPWA 3PM6A 2EKCA 4MKNA 1W5MA 1OJXA 2ATSA 4QITA 3CU2A 1KM5A 1ZFJA 4K7YA 5FF4A 5AYYA 2NWSA 4WY0A 3G18A 5KZMA 3W1TA 2LLEA 2VENA 5F2IA 5DBUA 1PHWA 3S6DA 1F05A 4PTNA 1AL8A 4ADSA 3UYCA 1F6PA 5G4WA 1J2WA 1F74A 2FB2A 1QNVA 1VR6A 5CZTA 2VFGA 4Q4KA 3W83A 4QISA 2EHHA 3SJ3A 4LWWA 4CNOA 2E5CA 2JK2A 4OQVA 4N4PA 5F2GA 1I2OA 3ABRA 5D30A 3ANYA 4A2SA 3HGSA 5DCEA 3C2RA 3HGOA 2J9XA 3LHZA 3IV3A 5D2YA 1V5XA 1FWTA 4Y9AA 3QEZA 2C16A 4FNRA 3U2OA 3I65A 1B4EA 5CSSA 4BR1A 2I14A 3STEA 5CSRA 3MMTA 2NXIA 3LHYA 1TRIA 2E77A 1A5CA 1VYSX 3N73A 1TB3A 1O5KA 5J5RA 3KX6A 4O19A 5HUPA 4WJEA 2QCNA 2VFIA 3GX9A 1TJPA 4BI5A 2CZ5A 2G95A 1LRQA 3MHGA 3WK3A 3W7PA 1JRCA 1OK4A 1DORA 3MBFA 5FEZA 3THQA 3EWBX 5K3VA 1SW7A 3DFSA 3EWWA 5LHEA 3O07A 5C54A 2B0MA 3JS3A 3W7EA 3G1XA 4IQLA 4UFLA 3PG8A 4DF2A 3RMJA 1K8YA 4N4QA 1SZEA 4K37A 1THFD 3ZS4A 4CNPA 1H7XA 1OFQA 2QAFA 5FF7A 5H91A 5T26A 2Y62A 1M5WA 3K30A 3W3OA 5LZLA 4LVAA 1K8XA 1H63A 2X30A 1SO5A 1N7KA 1OHLA 1EP3A 1OX4B 4M6VA 2P1FA 3QMSA 1EIXA 3TC6A 1G67A 2B7PA 3O06A 1H7NA 2AGKA 5L6UA 4N6FA 5CPLA 2Q8LA 4FEZA 4UFMA 3IGXA 3TAOA 2YYTA 1MXSA 1Q6RA 3N34A 1A5AA 4IMCA 4LV9A 1YDOA 2ZDRA 3W2LA 1IXOA 1FWRA 3NZ1A 3E12A 3DGRA 4O18A 3NL6A 2V82A 3G1YA 3W7CA 3CWNA 3NPVA 3LRMA 1TPWA 5F2LA 1TJRA 5AHNA 1XM3A 4GWEA 3TV8A 3NPWA 3UPWA 3EX4A 3O6DA 4MLRA 3TFXA 3A9IA 4GUFA 3QSRA 3GZ3A 3Q94A 4RX0A 4UMBA 3LHWA 2HS6A 5BMWA 3GXTA 2QCFA 3W7QA 3CLMA 4C1LA 2P0OA 3IEBA 3M47A 2RFGA 4O10A 4JY9A 1WXJA 2VFEA 3UWZA 5KITA 1GYNA 1VRDA 3SGZA 3SFKA 5L9FA 1QDSA 1VCFA 3EB2A 1NF0A 1KM3A 2CW6A 2C18A 2RKXA 1RZMA 4K39A 4X3ZA 4JTIA 3TROA 4ZQNA 1F2JA 2QCEA 4LT9A 5AN7A 2ATMA 3BARA 3O16A 4Y6GA 1DL3A 5K9DA 1MZHA 4KKXA 1F7BA 4XKYA 1BTMA 1SW0A 1TV5A 1UBSA 4DO5A 5IM51 3UD6A 4WZHA 4O54A 1ME8A 4WD0A 4ADUA 1VQTA 3DHFA 1TPEA 4M6QA 2VEKA 4PC8A 4TU1A 3EWZA 1GG0A 3GDTA 5G2IA 2ZBTA 3G1HA 3G3DA 3I7SA 1A5BA 2WOQA 3CIXA 5U4NA 1H1YA 4AHQA 4HNTA 1LRTA 1C29A 4Y96A 3S5ZA 1K03A 3TSMA 2GVGA 3GDLA 3E0IA 3OEXA 2A85A 3KAOA 4UTJA 4BK9A 3RU6A 4H6KA 2A6NA 4LUJA 3TQ0A 3W1XA 5BW6A 1QAPA 3M43A 1DKWA 5A5WA 4UCGA 3F4NA 1RQEA 3C2VA 4FX8A 4MLJA 4PH6A 1G4EA 1EB3A 1XBZA 2WO5A 1JCNA 1I2QA 3NZRA 1GEQA 4OV9A 3W7HA 1KBIA 3O05A 3IIOA 2GQ9A 1K7XA 3CIWA 5H2ZA 2R8WA 3BLFA 3TQVA 4OWGA 1KM0A 5AOUA 3C2FA 3GDRA 3KXQA 4LRTA 2GOUA 4XBKA 4FHAA 4LRSA 1T99A 1RR2A 2WSYA 4DQWA 4AHPA 1JJKA 3GKAA 1WAUA 4A22A 2X1RA 1W5OA 2J9YA 3LCIA 3TSDA 5KZDA 2A0NA 2WNZA 1YLVA 2QCDA 4JTSA 5ABTA 3TW7A 4QAIA 1GVFA 3I68A 1C8VA 4GJ1A 3S1VA 4AEOA 1H7PA 1TPB1 1S5VA 4UNKA 3DU0A 3NPXA 1W3NA 1FXPA 1IGSA 2G5WA 3S1UA 3ATZA 2OX1A 1GZGA 1JUEA 5EKYA 3FEMA 4RCXA 3PF3A 4PFMA 3BW3A 4DBEA 4TO8A 1H5YA 1Q3NA 1VCVA 5KZEA 5F4SA 1FDYA 4YL2A 2CLKA 6TIMA 3UNDA 4NJHA 1ADOA 4RV8A 1EWDA 2OT0A 3TJXA 4YCOA 2YYUA 3NL5A 3W7JA 5LNUA 5K7JA 4BWLC 4OT7A 3EKLA 1FWNA 1HO1A 2VKZG 1TQXA 2H90A 1KV5A 4HKPA 5DXYA 3W7RA 4O53A 1ZAJA 3B8DA 5K4XA 3MI3A 3BO9A 1XDLA 3NM1A 4GUGA 3OVPA 1TPC1 1Z41A 2EF9A 4UTTA 2R91A 3NDOA 2YDAA 3MP5A 1KFBA 3WJXA 3CTLA 5AYZA 5CZJA 1GYLA 2NX9A 1GOXA 5K9CA 3LXBA 2CWNA 1HL2A 2CZEA 2JKPA 4HNVA 3LHVA 1KFCA 1FQ0A 3TMLA 2VOMA 1HO4A 1LOLA 2QUTA 1I45A 4ORMA 4N9EA 2ISSA 5F2MA 2DZPA 5LGZA 3W2JA 3NYZA 4NJIA 1GVRA 1OFAA 4RJEA 3M7WA 3T78A 1SO4A 4N9DA 1MEWA 1U5JA 1ZAHA 5D2WA 1GVSA 2FFCA 2DZVA 3EKZA 1OFOA 2E68A 3MJYA 3UWQA 3HO8A 5DY3A 1K7FA 2OZ0A 1ZY9A 4UR7A 3LXAA 1GQNA 2BZNA 2WV8A 4G1KA 1OFRA 2TSYA 2NUWA 4E2DA 4YCPA 4JD4A 3RLUA 5KINA 1XBXA 3PWAA 1JCJA 4NXKA 4WXZA 3LRLA 5GVJA 2CU0A 3TDFA 4Z1CA 3EXSA 3S5OA 3BG5A 1LTDA 3PS7A 1PS9A 3NVTA 1VHCA 2AQWA 5I3JA 4NZJA 3DXIA 2VC6A 1KM1A 2YW4A 3GK0A 4UTIA 1QO2A 3KRSA 3G8EA 2WPBA 3B04A 2ALDA 5D2XA 3M1ZA 1OYCA 5HNRA 3NPUA 2PRHA 1H62A 2XN2A 3NNTA 3DH7A 3WK1A 4Z1BA 1G4PA 1H1ZA 1KFKA 5TQLA 4K7VA 3UY8A 3TXZA 4DPPA 2ZZ4A 3GR8A 3C2EA 3SR7A 4QIUA 1VHNA 2DJXA 2HTMA 1G4SA 4KFOA 3NQEA 3NQ8A 2F7FA 1JCXA 2Y6ZA 4AWTA 4O16A 5F4WA 3L2IA 1IIGA 1ZAIA 1Z48A 4FIRA 4B5NA 3BGJA 3EX3A 3G1VA 3LB0A 1H60A 3FIGA 2TYSA 4MFDA 1O5XA 1XFBA 2A5HA 3UZ5A 1TPFA 2YFOA 1JQXA 1DQXA 2C14A 1QO5A 4ORIA 3ZWTA 1P4CA 1PHQA 2Y61A 2J27A 3MYPA 3MUXA 4O1AA 1OABA 1AG1O 4PL1A 2NZLA 2E6FA 4KFPA
chains in the Genus database with same CATH superfamily
1FH8A 2WK2A 4DUXA 1WOBA 5AC7A 1Y5WA 3UZXA 5E09A 3MW7A 2XGZA 4XK2A 4QNWA 2VQUA 2DGAA 4LC8A 4C6NA 1R3TA 1QMLA 3NURA 5HNNA 1ISVA 1CGXA 3P5YA 3QGVA 3MP4A 4M51A 1VFHA 1ITXA 2VRQA 5HANA 2PWEA 1EXPA 3GC2A 1XLCA 3HJZA 4HCHA 4R7OA 2E7FA 4S3AA 4XQ6A 1V08A 2VHLA 3LCHA 1FA2A 4W84A 4GY7A 3DFHA 1FDZA 3LM7A 3S2NA 1MUCA 4IMFA 3AS0A 2JKEA 4JTFA 2XVLA 5CPNA 2OXNA 1R5YA 4IOTA 2BLEA 4CN4A 3L21A 1OC6A 2VUNA 3WDPP 4R27A 3S9YA 1J0ZA 1FWFC 3CHFA 3E49A 1UD8A 4DO7A 4MUZA 2ONEA 3S6OA 2XGIA 3M7SA 4NX0A 1TPUA 3ZR4A 3WEMA 1EYEA 4LF1A 5CC6A 4GYPA 1X8CA 1PAMA 2R1LA 2X7WA 1L6SA 2E1WA 3C8NA 3LHUA 3PY2A 1KCXA 1TJ2A 1XGEA 5FJIA 4W85A 3I6TA 3TZFA 1XLAA 2DQXA 4O0KA 4UOQA 2PDPA 1P0NA 1KXHA 2V2DA 1JZ6A 4H8UA 4I5RA 5BRPA 3GXPA 3LI1A 4FSAA 3LCWA 4JNMA 4DBWA 1RJQA 4KBXA 2YB1A 1TCMA 3WMLA 4JDYA 4X22A 2E9MA 3N3MA 3SCSA 3TYDA 1MEIA 4KPLA 3PBUA 3LDVA 3GZAA 4HMDA 1BSLA 3EKGA 1X7IA 1RJRA 1C8YA 1W3IA 1TZ7A 3LGGA 3NEVA 4PEEA 2CEQA 1K7EA 3W1UA 3CQKA 3W74A 2X42A 3WLOA 3UXAA 4LTSA 3AISA 1KFEA 2G37A 1UD6A 3EWUA 2XDFA 3P7YA 2CHOA 3BW4A 5D4YA 1ZS2A 1CB2A 3WH5A 4IJRA 1NDWA 3S2MA 3VM7A 1W3LA 3U2ZA 5LNRA 4JDBA 3QHOA 3BLEA 3L5AA 1LL6A 1NDZA 1GPFA 1C91A 1QI3A 1VFOA 3TC3A 3C0LA 1OEPA 4JTKA 3NL3A 3H55A 2B81A 1NM9A 1A47A 4HHMA 2XH4A 4GQQA 1TV8A 4UQBA 2DU2A 2J62A 3BC9A 3POCA 4CCDA 3PG9A 4IQDA 2RH9A 2GQ3A 3WN6A 3FYOA 1WPCA 3POHA 3W28A 1U5VA 1ZLPA 3CQIA 3KCJA 2QAPA 3HQOA 3UETA 4F9DA 1QNPA 1GVQA 3AIUA 3RN6A 3RPTA 4JNZA 1PX4A 4NKCA 3P0XA 3UVAA 3H2NA 4Y9PA 2NX1A 5I3HA 3IVUA 3HG2A 1ML1A 3PVFA 4JIQA 4O1EA 3GDKA 4JR5A 1OZMA 3LMZA 5G5IA 3P82A 3KRUA 1H7RA 4LANA 1I0DA 1JI1A 2UY4A 3QRHA 3E02A 4CQ8A 4A6GA 4EPDC 1BXBA 3Q2DA 4QJ1A 3WQDA 2PA6A 5T9CE 3WK0A 1GQJA 2XVPA 1X8FA 2E9BA 2GVEA 2CLEA 3OW1A 3AMDA 3RPDA 1E72M 4KEUA 3W6YA 1ZNNA 4W89A 1CGVA 3TNOA 1JR1A 3P3BA 1F76A 3TZNA 3W84A 3QM3A 1SJCA 2EKGA 4S3KA 4GOAA 3RHGA 3TJLA 4AEFA 2ZXQA 3KEHA 5HMFA 1C8QA 4LX4A 3L68A 2ZQ0A 2DPEA 3E1F1 3OLDA 3LOTA 2XFFA 4RZ5A 1TV3A 3A3WA 6REQB 1ITUA 3AXMA 1A5KC 4HNOA 3V16A 5I24A 4GC3A 3TN6A 1OY0A 3AO0A 4NXSA 4ZVJA 2Y4SA 3BVJA 1KRCC 1V03A 4AIEA 3B8WA 1A50A 3IJLA 1DWAM 4PCSA 4FAMA 4ZO7A 4H7VA 2J25A 2EJAA 2HE8A 1ICPA 4Y8EA 3PJWA 4UTKA 3BK0A 1ELSA 2INFA 2WNWA 1J0IA 3W86A 1BKSA 1RCOB 1XGZA 4NSBA 2V38A 4B5SA 5HNUA 2QGHA 2DZUA 1MW2A 3O8AA 3T8LA 1K9EA 3GVGA 4M19A 1S38A 2PP0A 3VKJA 4HYVA 1TWWA 2F61A 5IOBA 3BW2A 2F38A 4M1RA 3RLVA 1AW1A 1OT2A 1PSCA 3CZJA 4TX8A 3LCLA 1D2KA 1YPIA 3W72A 3RCNA 4PBGA 2FPTA 3B06A 4UUIA 4Q4SA 4ZBCA 2VP8A 3YPIA 3W7KA 4ONVA 2ZRVA 4XKMA 2D2GA 3R12A 3W2UA 1LOSA 1QVBA 1AVAA 1ZJIA 3EXTA 2Y63A 4IP7A 3CAQA 4HOWA 3SADA 3LERA 1LQ2A 4GXMA 4NJGA 3L4TA 4FI4A 4ERAA 5HR6A 3SDOA 2DSWA 1JF6A 1YIXA 2VL4A 4H9ZA 4HGXA 4E8DA 4GACA 5C7HA 3RU8X 1UCWA 3MKKA 3W70A 2D0GA 1MEHA 1WDSA 4XIAA 1SMDA 3FDGA 1G01A 1YTDA 1PTDA 4JQAA 4O4WA 3OO2A 3H2FA 2UY3A 3WUEA 1QATA 1U2YA 4MKVA 3AIRA 1KKRA 3NZQA 3S47A 4F2BA 3DAQA 3UCQA 2BXYA 4C5YA 3DI1A 2KX9A 3U4AA 1F3WA 1MXDA 2BDQA 1ZBKA 2GVJA 4MVAA 4UNLA 3AOFA 2OLHA 2NQ5A 1ZTVA 1EFZA 1LZOA 2ZX8A 3MSYA 4R34A 4ZQOA 3N18A 1ZP3A 3VNIA 1R3YA 1F6YA 1CXEA 1M03A 1V7YA 2WC4A 2QW5A 1GHRA 3INPA 1BYBA 3STCA 3UPMA 3NQVA 3QMRA 2OR2A 2V67A 4DRSA 1VFTA 2Q6ZA 4B16A 3TH6A 4HNNA 2QJHA 3RO6A 3MY9A 4LAKA 1V3HA 4NNAA 3S5NA 1GG1A 5A6TC 5HPCA 4DIAA 2CITA 1YBQA 2DEPA 3U7BA 1B5TA 3WQWA 1W9BM 1EGZA 1NWTA 2QCDB 3QHMA 4KWSA 3TWAA 5M3WA 3BANA 4AXKA 4QCFA 4JN6A 2IS7A 4MWAE 3QW3A 3NXLA 3MJMA 1SO3A 1RALA 3W76A 1UZDA 3E5PA 1EZ2A 3ISIX 4I5UA 4TX9A 3QH2A 3T8QA 1OX4A 5EB8A 4EPKA 3R5EA 4IFRA 4KESA 2QF7A 4PL2A 3NQAA 3I7QA 2Z2AA 2NXGA 4PUWA 5FF2A 4HQVA 2KAUC 3B8TA 3LGEA 5CC5A 4GZJA 4HSHA 2NUXA 3KE0A 3LNPA 3S83A 1VFLA 3QPYA 2BV9A 2D3LA 2PWVA 3KL3A 3WNNA 4FOUA 2HWGA 2AL1A 1J96A 4TVUA 3AHYA 4AXNA 1Z7AA 4PB3A 3DYMA 1RVGA 1VEPA 3HPSA 5CG0A 2WJDA 1SFJA 1MVYA 1KFJA 4MJMA 2H8XA 3PC0A 4BJHA 1FY6A 1ZBCA 4AZGA 1P0EA 3S1GA 3VMPA 4PE8A 1WYIA 3RXZA 4DN1A 6CGTA 5SWUA 3M5YA 1DWHM 1LRNA 2RJGA 3VFLA 5CPQA 4LVGA 3C3UA 3MCNA 3F7JA 2Y7GA 4MJ4A 1QI5A 3U4FA 3AIEA 2PSNA 3F03K 4M8UA 3NM3A 8XIMA 2O92A 4H9MA 1O5RA 4JTJA 1S5TA 1XQLA 3QV9A 4M7TA 4PSRA 3Q65A 1A5OC 4QDWA 4ZQMA 1U22A 2O4MA 3W01A 4NVTA 4ATWA 2QJNA 3OGSA 3FJLA 5AVHA 4K38A 1PCWA 2A3AA 3K13A 2YSWA 2WZEA 3OZOA 4KQNA 1W3JA 3DOPA 1WUFA 4ZA0A 2ZVIA 4HOZA 4UR9A 3LV5A 2EPNA 2ZRXA 3UR8A 4J3VA 1CNVA 4HK5A 3DFOA 1Z32X 5BXTA 1UZ1A 5FF3A 4AWSA 1DVJA 3BAXA 3I6RA 4AVNA 3MB9A 1QK0A 3CZLA 4US5A 2AMXA 2ZUVA 4EIVA 1WDRA 3W1PA 3MO7A 1XIEA 3KOFA 3N15A 3L9CA 1NJJA 4ICMA 4S3JA 2PTXA 4XZNX 4QBXA 2WMFA 7REQB 2SFPA 3IGSA 1YRRA 1SPQA 1LT8A 3CMGA 3HPZA 4W5UA 1J0KA 4GINA 1POKA 3CAKA 3TXVA 3ICJA 4D6IA 5FJJA 3S9ZA 4XAPA 4O1DA 2WNQA 4IMAA 5AZ1A 4IGMA 3H53A 4HZ7A 4FNPA 3KDNA 3B4YA 6TAAA 2NT1A 3MWCA 3C2OA 2VRKA 1W9UA 1XDMA 3CL8A 3NSNA 2PCQA 5DANA 1H7OA 2QULA 4AW7A 2Z1KA 1S2UA 1WQ5A 3IJIA 3UG8A 3KHJA 5CPMA 4AZBA 3SEPA 4CQBA 3SRFA 2Y85A 1LWHA 2E8ZA 4J3TA 4GUHA 5D32A 2YPIA 3CUHA 4ICCX 2V5BA 4GIEA 3GC5A 4LNYA 3C3NA 2Y89A 1IIHA 4RZBA 2DDXA 4O13A 2C8NA 2WHLA 1WOAA 3EX2A 1W5PA 2VCAA 4Y9NA 3RO8A 1VRXA 5JBDA 4GJIA 3V0TA 1CWYA 3UWUA 2XVKA 4OIFA 3VDAA 3E5BA 5GJNA 2ZCGA 4JQ2A 2O0TA 4ML4A 4ROPA 5AECA 4AIBA 1TFVA 3N14A 3TEVA 4GI8A 1QOQA 3EX1A 4GQ0A 3SCQA 3MZNA 3WDHA 3BLPX 4EXAA 3TTYA 4W5ZA 1ZHAA 4IL0A 4NRRA 4AVFA 2X1SA 1XSIA 4BQ3A 1US3A 3L66A 1LLZA 3ANVA 2QHAA 5HMEA 3AS3A 3F5KA 3MKCA 2OGJA 4HZ6A 4S23A 4AQLA 1GOWA 4I9TA 4JKMA 4D2JA 1Y0EA 4Q8UA 1MXGA 3SI9A 5CEWA 3WJZA 2G41A 3ZZ1A 4EAMA 4H6QA 2CCRA 1JPHA 4IX2A 3DYOA 4PMYA 3RJXA 1XISA 1WBJA 5DO8A 3VOFA 5AYBA 2X2YA 3XISA 1MYRA 1IWBA 5I3DA 1XKYA 5H8UA 2ZRZA 1QPRA 3G0SA 5CAKA 2PD5A 3DFTA 1XBVA 3IJ6A 2YL5A 3CS2A 3C4UA 4ZGYA 4AF0A 4EACA 5FJPA 2REQA 2ZUSA 2C15A 1OFBA 4IGHA 2PCEA 5A6MA 1IWAA 2PDYA 1SFTA 4MNMA 4F0HA 4F3HA 4QLKA 5IRPA 2PGFA 4CNNA 1C3FA 3N04A 1WX0A 4UMCA 3FJ6A 2QVNA 1S39A 2PZ0A 1Z9AA 2A3BA 2WZMA 3OQ8A 3G3MA 4NILA 3CWOX 4MFEA 4BF9A 3KP0A 3QOKA 2VWSA 4UMAA 1TG7A 2JQXA 4AZHA 4B5UA 4R7WA 3QTGA 4R7JA 1LBMA 1JDAA 2HE5A 4CU6A 2WANA 3P74A 1J5SA 3ARPA 4GVIA 1YW1A 5A95A 5JH1A 1Q6LA 3B03A 2FZBA 3VX1A 1C8XA 4MMWA 1XPYA 4L6DA 2HMCA 3G77A 2WXDM 3UWWA 1IYXA 1OGBA 4LVFA 1TTQA 4L4OA 4PBFA 5D37A 4K3ZA 4FOJA 1UQZA 4UOZA 3UCDA 1R3WA 4Q4OA 3URNA 4AYSA 4QJ5B 1TZZA 3O15A 2OOFA 4N02A 4H9TA 2RDWA 1X1ZA 3BUVA 5E6ZA 3WZ0E 2PDWA 3SY8A 4OU1A 5LNWA 4GI4A 2ISWA 3H26A 3QYQA 1QPQA 2OWCA 4KWVA 3L0KA 2WCSA 3UJSA 1EJRC 5C5YA 3FEQA 3AJ7A 5JIWA 5CBBA 4C65A 1R87A 5HDRA 2PWDA 2QDGA 1O12A 1WZLA 2G3IA 1Q66A 3WF1A 2VC7A 3OP2A 3OHIA 5E9XA 3SCVA 3R58A 1C90A 2DT1A 3UYIA 2I17A 1V3LA 1HVQA 1KB3A 2HV5A 4K36A 1OT1A 4JTHA 5A6KA 1CXKA 4ILSA 4DY1A 4P7NA 3HGJA 5I07A 2YA0A 2VUYA 2BGSA 3ZSSA 5A8OA 2Y5JA 4DXVA 4H19A 3KTSA 5DY2A 3KBVA 3WH7A 1J11A 4XD6A 5K2ZA 2PWGA 4O15A 1UKTA 3VC5A 4MSSA 3GIYA 4HCLA 4MY8A 1KW1A 3M44A 2NT0A 2YKKA 3UEQA 4TX6A 4LS1A 2FB3A 1Q4WA 2HVMA 3VD5A 2VWTA 3FA4A 3W7LA 3JZEA 4EVZA 3L0NA 2QCLA 1PWLA 5MF5A 3PJTA 2Z00A 3M5VA 1EHNA 3EZ4A 1JUBA 1SSGA 2MNRA 4CLMA 3CHCA 1IXPA 4MPQA 5C6MA 2YW3A 3QZEA 2CLHA 2NUYA 1DV7A 3G6MA 2WVSA 4KIEA 2WYSA 1WV2A 5G4HC 2A6LA 1HJXA 2V8ZA 4PCFA 1F07A 4LB3A 3L23A 3VGFA 2J24A 4N2YA 2R82A 2QNEA 4YTQA 4F40A 3VINA 1JCMP 1EPVA 2CLPA 3W1QA 2FTPA 4ZXOA 4NZ5A 3DERA 3W6LA 1UWQA 4M5PA 5CGQA 3CV6A 3O2LA 2CESA 3WBAA 2G3NA 4JX6A 3PSVA 3LHTA 3AZRA 4LJ3A 2QUNA 1K4HA 1SYTA 2OB3A 1LCOA 4MHBA 3GDMA 4XD5A 3CZGA 3SSJA 4D8LA 3NYDA 2V69A 3WQ8A 4Z2KA 1JZ4A 2MANA 4KWUA 2GOKA 3M0ZA 1ADSA 3D3FA 4KFNA 3GNNA 2FDMA 3T7VA 5FD0A 1ZJHA 3H2EA 3V75A 1Q5MA 3QV8A 4QG8A 4M0XA 4QITA 1KM5A 5A8PA 2NWSA 3AU2A 2Y5SA 3SCNA 1R7AA 3G18A 4G7FA 5KZMA 1XLHA 4ZCWA 1U30A 1RUSA 2VENA 1PHWA 3TYBA 1EKOA 1FP8A 3BOFA 4ADSA 3W02A 4R88A 1J2WA 1KKOA 1A3XA 2YCKX 3HTWA 1EZWA 2VFGA 3VUPA 4Q4KA 3WQPA 4JQ4A 2EHHA 1AFSA 4CNOA 3C2YA 3SO7A 3N9KA 4AVOA 2EG6A 4DVOA 1JYXA 1H0GA 3ABRA 5TD4A 3GVRA 4D6HA 4K1GA 8XIAA 4OOUA 3CV7A 5D2YA 3CUIA 4FXJA 1FWTA 4Y9AA 1ZGDA 3V4BA 1JPDX 3QEZA 1E56A 3I65A 4XZIA 4X2PA 5CSSA 1X96A 3STEA 3MMTA 3LHYA 3TW9A 3NDYA 3N73A 2CBJA 3LU2A 1O5KA 1GZJA 4CVWA 3QN3A 5HUPA 4WJEA 4Z2LA 3GX9A 7XIMA 3GXMA 1XSKA 1LRQA 1E1EA 2D3NA 4D71A 1JRCA 3KL5A 1DORA 1DIOA 5FEZA 5K3VA 3MV11 1UR2A 4IIFA 2QYGA 5C54A 1PIGA 2B0MA 2WLYA 3L4ZA 4GQRA 1JZ3A 3PG8A 3PUGA 3FDKA 4N0RA 3ZS4A 4CNPA 1ONWA 4R9XA 3PZGA 5FF7A 1FP9A 1M5WA 4IFKA 4LVAA 2OLAA 2X30A 4LYPA 2Z26A 3MA8A 2V6AA 1E71M 1OHLA 3IJ8A 3SQLA 1OX4B 4DJEC 3QMSA 1G67A 4MB1A 2WBKA 3O06A 4YPJA 4N6FA 1LWIA 4QLLA 4J2PA 4FEZA 4PYSA 4FXFA 4IMCA 1YDOA 3W2LA 3DGRA 1EDTA 2V82A 4WRHA 2IQ0A 3NPVA 4LXFA 3AYVA 3FHQA 1TPWA 1K4GA 3OZYA 1TJRA 5AHNA 1HVXA 5CGTA 2PP3A 4GWEA 1AD1A 3TV8A 3VXGA 4CD4A 3NPWA 3O6DA 4MLRA 4INFA 4ZB5A 3WLKX 4RDVA 5A8QA 3LHWA 5BMWA 3VD3A 3OYZA 2BXZA 3W7QA 3CLMA 3M47A 4MAZA 1JXJA 3MANA 4FMVA 1B9ZA 5L9FA 4Q8QA 2I7GA 3R0UA 1KM3A 1OCJA 1JZ8A 4H8VA 3GTIA 2G4JA 1KBLA 1F2JA 2QCEA 4ZOEA 2E4TA 5DRCA 2ATMA 3WEOA 1MZHA 2C1GA 4KKXA 1F7BA 2IW0A 3AS1A 3UVIA 1EOKA 1FWEC 1EO7A 1BTMA 1TV5A 2VQTA 1UBSA 2PU1A 2DH2A 1MWOA 5C9XA 2OQLA 2QJJA 4M3PA 2WKGA 4HNCA 1ME8A 4MNKA 4WD0A 2VCCA 5HXMA 3DHFA 3WD3A 5DX7A 4PC8A 1JAKA 3EWZA 4OBSA 5G2IA 2WCGA 1XICA 5HJXA 1XLFA 2POZA 3PPFA 1BF6A 3AQUA 1A5BA 3PFRA 1OZQA 3A3XA 4WDUA 1CDGA 4ASTA 1E0XA 1JYNA 3OEXA 3IK2A 3KAOA 2OFJA 1W1B1 4LAZA 3GSMA 2A6NA 2PLCA 4LUJA 4DI9A 3VIPA 1QAPA 3M43A 4GO8A 4FK9A 4UCGA 3VIGA 4PH6A 1GEHA 4PUDA 2PBGA 1GEQA 1UR3M 4OV9A 2X0YA 5CZKA 3IIOA 1T7LA 3C86A 3OA5A 4RE4A 5C8BB 3C0SA 8RUCA 4OWGA 3U7VA 5AOUA 4W8AA 2R1MA 2GOUA 4XBKA 1UWTA 3DX5A 1T99A 3FJ4A 3QY7A 5I2UA 3NO1A 4J28A 3KBMA 1DP0A 1W5OA 2J9YA 3LCIA 4W88A 2WNZA 7ENLA 2ZWYA 9RUBA 4PN2A 3VGDA 2DT0A 4QAIA 2FFIA 1CBGA 3APGA 4LGXA 2V3FA 4FF5A 1KBBA 5M2FX 1CXIA 4LUYA 3BGAA 3DG3A 1Z3NA 3N13A 4OBRA 3UG4A 1UZ4A 3DC0A 4XBJA 1TPB1 4B5WA 3NPXA 1IGSA 3S1UA 2OX1A 2VC9A 2GDUA 3FEMA 1RH9A 3LUTA 4J27A 2ISDA 1Q3NA 4YL2A 6TIMA 3UT0A 4RV8A 4YCOA 3W7JA 3IUHA 5LNUA 1JYWA 1HXJA 3TR9A 2NV9A 2GLKA 4H9XA 1HO1A 3E38A 1VIWA 5DXYA 1ZAJA 4DUVA 1B30A 3NM1A 2EF9A 1Z41A 3NDOA 1YNPA 3EDEA 3MP5A 2ZX6A 4A3QA 3EDDA 1TVLA 3IAQA 1QI0A 2Z1SA 5AYZA 4OTKA 3UJEA 2NX9A 5K9CA 3VTRA 3QY8A 2JKPA 1T40A 4WK9A 1KFCA 2AQOA 3FAXA 4N9EA 1IQ8A 1GJWA 5F2MA 1G94A 3T78A 3M7WA 1MEWA 2PDNA 4DAFA 1ZAHA 1DJGA 2DZVA 3EKZA 3F4VA 5BZAA 2ZWZA 1NH6A 4G1NA 1SJAA 3B40A 2VGBA 1J18A 1ZY9A 2Z27A 3UZZA 2O55A 2REQB 1ISWA 5DF0A 1JZ5A 2BZNA 2NUWA 4PCPA 2VDHA 2E40A 4QHRA 3BLOA 3KRBA 5JIPA 1MMFA 1GONA 1BG4A 3EXSA 3S5OA 4DZIA 3LM3A 1PS9A 1VHCA 2AQWA 4GHRA 3DXIA 2NW0A 4JIEA 2J8GA 3G8EA 4IF2A 2YIHA 2VURA 1OYCA 2IPWA 5HNRA 3KOZA 3NNTA 3DH7A 4R9OA 3AICA 4W86A 3WD4A 1KFKA 5TQLA 5CBJA 4K7VA 2XSXA 1CECA 3TXZA 5RUBA 3GR8A 4H8HA 3C0QA 2OYKA 1UZHA 2D0HA 2DJXA 2HTMA 4KIRA 4JFTA 4GGBA 2F7FA 3NQ8A 4BKNA 2I5GA 1V02A 3UGRA 1IIGA 1Q13A 3MDUA 4FIRA 4D6JA 3RCYA 3EX3A 3G1VA 3UU0A 3K4DA 1H60A 3SN4A 2TYSA 4MFDA 1O5XA 1OC5A 3AHVA 1E5JA 3ZJ7A 1R8LA 3EDFA 2ACUA 1ZZMA 3SAZA 2Y61A 3MYPA 3RDKA 1FTXA 1B1YA 5TF0A 1OX5A 4K1WA 3WQ4A 2F84A 2P76A 2A2IA 4JIPA 3E2RA 4N9CA 1PZ1A 1JZ7A 1TTJA 3FOKA 3GR4A 4P8UA 1K77A 1SJDA 1W8SA 5BWAA 7PTDA 2CZFA 4NU7A 3IJ7A 3GNRA 2VT0A 1T96A 3W2KA 3B9DA 1I2NA 1O60A 3WDIA 9XIAA 2J74A 2D0FA 2DSVA 3AMCA 3TCEA 3QJAA 1XIBA 1JPIA 4JEQA 2PDMA 3OVQA 4UFKA 1TSIA 3WH9A 5I06A 4U2YA 1FWDC 1UMYA 3PJUA 3TUUA 1VLIA 4AX7A 3MVTA 1U5HA 1WZMA 1VEMA 4GIYA 1JDDA 2FGBA 3SBFA 3BTNA 3T08A 1KTNA 1XCXA 2FZ8A 3APTA 4LCRA 2ZZ3A 4XSLA 1RD5A 1J8VA 1C92A 1V6WA 3OVRA 3P14A 4GBDA 3RR4A 5LKYA 1FWWA 1CGWA 1BFNA 5F7UA 4O8AA 2FTWA 4UB9A 3WUBA 2DT2A 1OX6A 4C1KA 2WM1A 4E2VA 4ECLA 2W67A 4W7VA 4OE7A 4C5ZA 5BU9A 3W9ZA 4E4PA 1MFUA 1MI3A 5EY5A 1MW1A 3B05A 3CEPA 3M0MA 4LSBA 1AODA 1N2VA 4U3CA 2NWRA 4PA8A 1V0KA 1Q65A 1DE5A 4K6AA 4LF2A 5KTLA 4XAYA 4MG4A 4ZE5A 1POJA 4H83A 3B8SA 3RILA 4LUIA 4F48A 4PUEA 5HMSA 2G3JA 4IJBA 4GH3A 4QEHA 2OQYA 2GSJA 2YZ5A 3PULA 3CT2A 3KUMA 1ZJAA 1N8IA 5D38A 3UZJA 3DECA 2OQHA 3ME3A 5J8LA 3WBYA 1H61A 1AJZA 1P1XA 4G8TA 4Q22A 4LCQA 4JQ3A 4C91A 2Y7FA 3Q37A 3KFTA 1UW9A 4IIEA 4TQTA 4LYRA 5EPDA 1OSEA 4L61A 3ZVIA 1UUMA 3ARXA 4ZR8A 2H9AA 4OV4A 1D3CA 3DN5A 4GQBA 2D73A 4M6PA 4E2OA 3OGVA 4BY3A 1KM4A 2FYMA 2ZX5A 1HFBA 1XV8A 1UPPA 4PMNA 3N4FA 1YPFA 4LUTB 4ZTYA 1SR9A 3WQOA 4R33A 5HQMA 2EEXA 1DEDA 1HKMA 4I90A 1KM6A 1E43A 2J7HA 4OOZA 3P81A 1N82A 1L9WA 1DJQA 2X40A 3RLHA 1V0LA 1X38A 4P7OA 1KQZA 1EJUC 1EBGA 3CPUA 4UFHA 4GXPA 1Q4NX 3N1AA 3F4WA 3LPGA 1ZALA 3IANA 2QCHA 2O9OA 4MM1A 3UA3A 1CXLA 1NFGA 2ZZ7A 3KBSA 3SGUA 3OBAA 4H9YA 3UNTA 2VTFA 4TXEA 2OODA 4A05A 1ECEA 4DUWA 5D33A 1E40A 4MZ8A 4IJCA 4PMOA 3U8GA 3PSWA 1QASA 2Q09A 2F2KA 3M5XA 3HG3A 4RXGA 4FO4A 1Q8JA 2WJZA 5M1TA 6ENLA 1O94A 3R0DA 3H21A 3OIXA 5H6HA 4ICNA 5HWJA 3W1NA 3LBCA 1IEQA 1CLVA 1VFMA 3GAYA 1HW6A 3BV4A 3WDQA 2WB5A 3ZWSA 3G1AA 8A3HA 3GQYA 1Q6QA 1VYRA 3OLIA 4DX3A 1FVPA 1OYAA 4AD5A 4IIBA 3K5XA 2FJKA 2Y7DA 3CK5A 3WQGA 3WNPA 3V1HA 4FPSA 3EXRA 3LG3A 1UJQA 4CCZA 1ODUA 4M7SA 1GQLA 4F4RA 2VFHA 4AMAA 1ZP4A 1H51A 5DFAA 3M0KA 3PZOA 4A2RA 1LQAA 2BY0A 2GUUA 1J5TA 3V1PA 3E0LA 4DWSD 5LA0A 2YLLA 5XINA 3W2NA 1F8IA 2PEVA 3LRKA 4OECA 4XX6A 5DEZA 4IFKB 1XLMA 3BLIA 1P7TB 2QCCA 2C71A 2HK0A 4QAWA 3ZFHA 3ITOA 4WQ6A 3RM4A 3CUFA 3FYPA 1FRBA 2ZZ1A 3QFEA 1JG9A 3M41A 4UTWA 2VELA 3FVMA 1NFBA 4AZ5A 3W82A 1MDRA 1PB0A 1EJXC 2P50A 4PMVA 2YL9A 2W91A 3DBNA 3H2AA 1YEYA 3QC3A 3W88A 4Z2JA 2GK1A 3IARA 3LCGA 1VKFA 4MOZA 4V33A 4GIAA 2FKPA 4BZYA 2B7NA 4RLIA 1HTIA 3ITXA 3A3HA 5KMYA 2PDHA 1XL9A 2CBIA 1BGGA 3TC7A 2DZSA 5C9RA 4J35A 4GI6A 4QEEA 3TK7A 1W5QA 1B3VA 2B7OA 4PRRA 4JN8A 2W4XA 3C8FA 2BY3A 1QOPA 3SN0A 2RJHA 2FH8A 4OBTA 3W1AA 4O8RA 1XUUA 3GNPA 3PWIA 2GUBA 1Y7VA 4JX5A 4IT1A 1FXQA 2WMIB 2EAWA 3WL0A 4HN4A 1XQKA 5C2GA 1P6BA 2E6AA 3A4JA 3T2PA 4UIOA 2AMGA 1KBJA 3PR2A 2A1YA 4Q7IA 4DWDA 2FIQA 1XF0A 4H9UA 3TN3A 4AIUA 2D1ZA 3ZJ8A 3G2GA 3LPOA 2W92A 1A5SA 1KXVA 3PBWA 1X6UA 2Z6JA 3FYYA 4HNLA 3EWDA 1W17A 3KHDA 2P10A 1M3UA 2QT3A 4YN5A 2OJPA 1RQHA 4UZSA 2YDRA 2GGHA 4GCAA 2BHYA 1XYLA 1FWAC 4HA0A 5DQPA 3TFCA 4GZIA 3VUSA 1S3HA 1YYAA 5HJYA 1P0KA 3AMLA 4D6CA 1SU5A 4Y9OA 4OHQA 3PZNA 1GTHA 4DAIA 1FCQA 3TYUA 3CH0A 4JKLA 3OQEA 3A4WA 1BAGA 1DQUA 2DT3A 3VK5A 1HKJA 1R9ZA 3D3AA 4JYDA 3WK2A 3W7IA 3CHVA 3MWAA 2D20A 4FNTA 4GNVA 2CLIA 3FS2A 4FNQA 4L56A 4N42A 1SR0A 2HQAA 3QPZA 4PODA 3UFYA 1LBLA 3T0CA 2V5CA 1AW2A 3UGVA 3TMQA 3HV8A 1F3TA 1H4PA 2YFNA 3K4AA 4S3CA 1AH4A 2WW5A 1LLOA 1XCWA 3E6EA 3VNYA 3A47A 3BMVA 4A3YA 4FIQA 1BQGA 4AX6A 4AG0A 5LHFA 1G7UA 1SZNA 3WQCA 1G69A 1QPOA 1W9VA 1M7OA 3CQJA 3QY6A 3G5EA 1BYDA 4L4MA 1GHSA 1P0BA 3WD0A 2J8TA 3UG3A 1EEXA 1TUXA 5C70A 4QQ3A 5FEXA 1J2BA 5HATA 2PLJA 3AHZA 1W8GA 4GRSA 5A8MA 3UXLA 3AC0A 1W5NA 4IHCA 4PMQA 4AWEA 3PBVA 1BD0A 1B31A 2HROA 1KCZA 4Q32A 2GSEA 1CZ1A 2E5BA 1F4AA 3RX3A 2DQWA 5A3HA 3SJNA 7A3HA 4DEFA 1XI3A 1ICQA 4R5EA 3AU6A 4FLQA 1UQYA 3NO3A 3T40A 3KLKA 2X05A 4GNJA 2E1DA 3TONA 3VILA 2PODA 4HPJA 3QQWA 1VGAA 2Z4GA 3QQ0A 4GX8A 1QFEA 4IQEA 3IJQA 1HJQA 1TWIA 4MDPA 5CZ0A 2DW7A 4S38A 5I3KA 1EF2A 4HTBA 4X0NA 1KGUA 3SZ8A 5IDZA 2CBUA 2ZA2A 3WBWA 3RYSA 1LL7A 3L5MA 3CWHA 2BFGA 4H2CA 1LG2A 3HJEA 1TO3A 2V63A 4Q8MA 1E9YB 3CZ8A 5LIXX 3SCPA 2DUZA 3WBXA 4EF8A 3L67A 3GUWA 4PRWA 1WDPA 5ABEA 1SVDA 2E0PA 2GGIA 4DJDA 1HX0A 4ACZA 3ZLGA 2EG8A 4LOCA 3WLPA 4S39A 5T91A 3CB3A 3VOGA 5FL1A 2BVWA 4XIMA 4I8YA 1W32A 2OLSA 3W1RA 4J3SA 2OMAA 3UWVA 1OYBA 4DPQA 1KTBA 2PF0A 3GTHA 3SN1A 4Q33A 3S1XA 1U33A 1OFDA 2JFEX 3VVGA 3LBMA 1R2RA 1UD4A 3WLIA 4AY1A 1D7KA 2OSXA 2YR1A 4LS2A 4QXIA 3P8IA 2QJIA 1E0VA 4D6GA 3PUDA 2XIOA 5AB3A 5M17A 2XFRA 5JQ9A 4O1FA 1VFFA 2ZA3A 4JTLA 2OKOA 5MKGA 4MYAA 1WAWA 1VS1A 4HT3A 4U5KA 1OC7A 5KEZA 3RF9A 2YBVA 1CGYA 3ITYA 3BCFA 4JFUA 4M81A 4LAOA 1Z44A 5BNKA 1L0PA 2H3DA 1SM9A 1M7PA 2WLZA 3MUY1 4U3AA 3CB8A 2W3ZA 4YHEA 5I79A 5LIYX 3LZ5A 4Q8VA 3PBGA 3SSZA 3WLTA 4MWAA 4A35A 3H54A 2DY3A 4WX2A 4K8HA 1ME7A 3D47A 5DXXA 4H6RA 1W37A 1NARA 4TV6A 4WKAA 4LPCA 4UXDA 4WJ8A 1T8XA 4I6KA 3JU2A 4AH7A 4IZGA 1K6AA 1MQPA 1D8WA 4KW2A 4NZ3A 2WVUA 1I9CB 3OPSA 4YS1A 3I10A 3VKBA 1PKNA 3V3WA 2CLMA 3SGGA 4BI6A 3GG7A 4XWUA 1CCWB 2F2HA 3WLLA 1NWUA 4ACYA 3GY1A 3I4KA 2WHJA 1H11A 2B7QA 3E0WA 3WLRA 1Z89A 4QSFA 1VBHA 3GU1A 4C1NA 3A64A 2BOGX 3M5ZA 1KQYA 1W2VA 3BCJA 4XV0A 3IJDA 2HVOA 2ASHA 3PTMA 2IKHA 5G2WA 4TTUA 5FJRA 2ZFAA 1R9YA 4DBDA 1HGWA 2NX3A 3UR7A 3KOWA 5HPOA 4A3HA 3MI6A 2AKZA 2XHYA 2G96A 1NWSA 3B0YA 5CCZA 4C7FA 3KOXA 2CETA 4A3UA 1AH0A 4N6EA 3QKEA 1TE1A 1ZCCA 3N19B 4O1BA 2IKJA 3D5HA 2EPHA 4AC1X 4DZHA 4RK8A 2FPYA 3TOPA 4Y7EA 1Q6GA 2WKLA 2POTA 3F2DA 1NAL1 1DXIA 3WLSA 1NSJA 1L2UA 3FHAA 1UOZA 3VNMA 5I3FA 5AC4A 4DF0A 3ZIZA 1HG3A 3VDGA 1QR7A 4WOZA 3H24A 1U1JA 4KRUA 4Q3MA 3NTYA 2FLIA 3N12A 4ZFCA 2H9AB 3G6LA 2HK1A 2G3FA 2V9DA 4KCUA 1CGTA 3ARQA 3VZXA 3GXNA 1G5AA 4C6LA 4PUJA 1V0NA 2ZOXA 4PRTA 5E93A 2QF8A 4Z08A 1GK8A 1XINA 4IMGA 1QU4A 4HMCA 2INZA 1JDCA 4G7EA 1YMYA 3JZUA 2QV5A 2PGEA 1XHGA 3VGEA 3CL7A 4IL2A 4O0ZA 4RKAA 3L4UA 5EYWA 5DT7A 1P43A 2W0UA 1TPDA 2FGLA 3N6QA 3HBLA 4AIOA 1VJZA 5CC7A 1EH9A 2ZKMX 4ZB0A 4J9JA 1DBTA 2Y8KA 2PAJA 3BXWA 2BVYA 4DJEA 5D09A 1TTIA 3LI0A 1J0HA 3SQSA 1O5QA 1WO2A 2FTYA 2B4GA 1S2AA 2WQPA 5E0CA 3K2GA 4XAGA 4IXHA 2Z25A 3MVIA 5EMMA 4JIHA 4F0MA 4EF9A 3ZJKA 1KGWA 3DFPA 2XIIA 3T0BA 1WCGA 3IIXA 1JDFA 3N2MA 1I8JA 3PAJA 1FOBA 3O0FA 4ZQPA 4JHZA 3HOJA 2YCEA 3TR2A 2Z2UA 1IT0A 1XD0A 3C6CA 1OCBA 3HFYA 3AWNA 1B3OA 4V28A 3MHFA 1TYGA 1FFRA 4XAFA 3WY1A 4XG1A 1K1DA 1FBAA 5BXRA 4YNGA 3RRXA 2EGZA 5DCDA 3GNDA 4IMEA 1R3SA 1WXYA 3USBA 4V1YA 1GOQA 1DJHA 3NWRA 1LROA 2Z6IA 1DOSA 3HQ1A 4MY9A 4DO6A 5AKQA 3S2CA 3QGKC 1DJIA 1FH7A 4L65A 2EPLX 3UBPC 1EGMA 2ACQA 1OK6A 2OWWA 2VR2A 1MSSA 2PDQA 2ZE0A 4B3LA 3OVGA 4MJZA 3DFNA 1EJSC 4J7RA 1XRTA 5MHBA 2DZBA 4C6IA 3HB9A 4XSMA 2NQHA 2XZ9A 4HU4A 1P6WA 2Y88A 4A29A 1O66A 1K6WA 3T55A 3F1QA 1UWAA 1B3XA 1YNQA 3ZT6A 5DELA 4HBKA 3VCNA 4EWND 3KWXA 2HNEA 2DZXA 1EP1A 1FUYA 1SJBA 2GK1B 3UCCA 1FX6A 4IX0A 2FVMA 1W1ZA 2OSYA 3RK8A 3BGGA 4L4LA 1HZYA 2J7CA 1PV8A 3U6WA 4P7QA 3BG9A 1X98A 1W3KA 4H1ZA 3VM5A 2OG9A 4W9TA 5EA9A 3RM9A 3TKFA 3UESA 1X1NA 6A3HA 2TPSA 1PCKA 5CJNA 1J6OA 5EGRA 2NVAA 1AMKA 1QBAA 1BRLA 1V6YA 3GD6A 4HSNA 1P0DA 5D05A 3LTSA 4MAVA 4QNEA 2GJPA 2YCJA 3VU2A 4DZAA 4GUIA 3M0YA 3GO2A 3W7DA 3CUXA 2QR6A 1S5NA 5ECVA 1R47A 1W2PA 3TTOA 4MKNA 4B91A 4LB4A 1ZFJA 4K7YA 4KT2A 4PUNA 3BQ6A 2QPUA 4CKQA 3SUUA 1BVZA 5F2IA 4H9VA 1V6XA 3E74A 2BG5A 4FZIA 1M04A 4FA3A 1F05A 4PTNA 1XC6A 3UYCA 1CXFA 3P2VA 2FB2A 2WZHA 2DH3A 2DIJA 3ABXA 2YCLA 1FH9A 4N4PA 3WBEA 4H6EA 1Q6EA 2G4FA 5A94A 4RDZA 1OINA 3ENLA 3T6CA 4AC7C 1PEZA 2J9XA 5HNTA 3W29A 3VNKA 1V5XA 1M41A 2IXUA 1PJ9A 3GIPA 3N2CA 2XSBA 1EJ7L 1B4EA 1RJPA 5CSRA 2PUZA 3H22A 3AIVA 4HZMA 2E77A 1JPMA 1OIMA 1VYSX 1QK2A 2NQJA 1GW1A 4FR1A 2OZ3A 1I60A 2QCNA 1RCQA 5GNYA 4BI5A 2CZ5A 4ATDA 3MHGA 2BY1A 1OK4A 3K46A 3EWBX 3LNMA 3UP8A 1EQPA 3UZWA 3DFSA 1UC4A 2FHFA 4MGGA 3O07A 4AYGA 3JS3A 2NQLA 4LALA 4XO7A 3G1XA 1KR1A 1OGSA 1NTHA 4UFLA 1GUVA 4WEVX 4DF2A 4C6EA 1THFD 1H7XA 3XINA 3GHUA 2V5KA 1OFQA 5H91A 5T26A 4MUPA 3K30A 5FSEC 5LZLA 3AXIA 3H7VA 1A49A 2OZTA 2Z28A 3VDBA 1NP0A 5CSYA 1CB7B 4PULA 2CNCA 1DTUA 2ZVRA 1H7NA 1JGIA 2JEPA 5CPLA 3VIKA 3TAOA 1QHZA 4DJFC 4GK8A 3ZM8A 3N34A 1A5AA 1QT1A 3RUBL 3E12A 4O18A 1W1YA 3WFZA 4UWMA 5I78A 5F2LA 4M56A 3B8UA 3QV7A 1VFUA 1NDYA 4UBPC 3II1A 5E6YA 1R3QA 4GIRA 1UKPA 2VMFA 3O6AA 3AYTA 2GJXB 4LYKA 3LY0A 2OPJA 4YU1A 4RX0A 4CEUC 3BJFA 2QCFA 3MV01 3WNOA 2RFGA 4O10A 1UWSA 4REQA 4F9JA 2WZIA 3GG8A 3EB4A 1IR1A 1VRDA 3SGZA 1E9IA 3SFKA 1UYQA 2YA1A 1NF0A 3EB2A 5LIUX 4K39A 4JTIA 3TROA 4ZQNA 4PMUA 1F4HA 4LT9A 5AN7A 4F79A 4F0KA 5I23A 3U5UA 1JFXA 1DL3A 1UR9A 3GXIA 3ANUA 1Y5VA 3S3GA 4E8CA 4ENLA 5IM51 1HL9A 3UD6A 1HKKA 3RGTA 3VNLA 4GLEA 4M6QA 1FWJC 4P8VA 5D9NA 1GG0A 4I5XA 3LQLA 1V7AA 1V3KA 2CKRA 3G3DA 4IISA 1YHTA 4B4HA 3PTQA 1VF8A 1W9PA 3CIXA 2CXGA 1H1YA 4AHQA 1B0IA 4ACZB 4Y96A 4HTYA 2R9RA 4WHBA 2ZC1A 1FKWA 2A85A 1NQKA 2YJQA 1XGDA 3GW3A 4BK9A 4H6KA 1W1VA 1XYBA 4LYQA 5BW6A 4IIHA 3GVQA 4A8RA 4MLJA 1G4EA 2WO5A 1I2QA 3W7HA 1KBIA 4DYEA 3DC8A 2Y8UA 4B2DA 2QMKA 3TQVA 1XYAA 4MB5A 3MSRA 1YNYA 3FX4A 3KXQA 4LRTA 4FHAA 4ZB2A 4AHPA 2J13A 4A22A 1UD5A 5MKGB 2X1RA 3TSDA 1T5AA 2A0NA 3BZGA 4PUMA 2AOSA 2JE8A 4BF7A 4I8DA 2OEKA 1YLVA 4JTSA 3W26A 3GHSA 1E70M 1HGYA 3DIPA 1A0CA 5ABTA 1GVFA 3M0IA 2GYIA 1XLBA 3S1VA 4CVUA 1XIJA 2VNCA 4GXWA 5DMYA 1S5VA 4J1OA 2G5WA 1JUEA 5EKYA 1TJ1A 3XIMA 4P8XA 3BW3A 3F2BA 4ZO6A 1H5YA 3EA2A 1VCVA 4HA4A 1KBKA 1UOKA 2CLKA 1UR1A 2QMJA 5G1MA 4IH3A 4NJHA 1UD3A 1ADOA 3PAOA 2YYUA 3NL5A 2VEGA 1TZ9A 3I3BA 1FWNA 1TQXA 2H90A 5C71A 2WBGA 4O53A 3B8DA 3BO9A 5AYIA 4GUGA 2Z1VA 1TPC1 2VZTA 3GNOA 3CTLA 3HM7A 1PWMA 5CZJA 1A3HA 2E3ZA 1M65A 3LXBA 4C1NB 1DWJM 4DXKA 4MNLA 3LHVA 1QI2A 1PZ2A 3G1RA 2PGWA 1HO4A 1M53A 4ORMA 1RAKA 1F8MA 1WUEA 2DZPA 5LGZA 4WKFA 3W2JA 1MUWA 2ISFA 1GVRA 4CD5A 1NU5A 1TJ0A 2XZ7A 2J7EA 4DJED 2P53A 4DYJA 4N9DA 1U5JA 5H8MA 1GVSA 3I6EA 4A4AA 3NZGA 2E68A 4U5IA 5IXEA 3WUGA 3HO8A 3R8HA 3RX4A 5JBEA 4UR7A 2VX5A 4P7RA 3Q67A 4RUBA 5HA7A 1JFHA 4B3KA 1OFRA 2TSYA 3GHRA 3LLXA 4E2DA 4YCPA 3RLUA 5KINA 1XBXA 2EO7A 5EMKA 4H00A 1LG1A 5GVJA 3R25A 3M64A 3TDFA 1RCXB 3ZJ6A 3BG5A 3TOYA 3TTEA 1RY8A 3QTPA 3SURA 3WLHA 4NZJA 3GH4A 3CUGA 4V2XA 2VC6A 1US2A 2O4QA 1EJTC 5A6JA 4X60A 4IUGA 3ZLHA 4C6PA 2ALDA 5JVLA 2XN2A 3WK1A 2X0SA 3ITVA 4DPPA 4MPKA 1PX8A 1XR2A 1H49A 4ZXLA 2NQ9A 5IFTA 3SR7A 3WQVA 2VX7A 1JCXA 2Y6ZA 4AWTA 4XZLX 3L2IA 2P3EA 2C79A 2DVXA 1O7AA 1Z48A 3BGJA 3KDOA 5XIAA 1ENUA 3LB0A 3QLLA 4QG9A 1UHVA 3FIGA 5FL0A 1UWRA 2QDEA 4BF5A 3UZ5A 1TPFA 2YXXA 1JQXA 1DQXA 4UNIA 2GGJA 2RAGA 1J10A 3QVQA 5A6LA 2EQDA 4ORIA 3WQ6A 4G7EB 1TWSA 1XIGA 3WF2A 2J27A 5CSUA 4J40A 4LBUA 1XG3A 4PL1A 3B3DA 2VO5A 3WMSA 2DUXA 1JF5A 1UKOA 2O56A 1A4LA 1MW0A 2DVUA 2ZTJA 1HP4A 3PBYA 2Q8ZA 4E38A 1SFLA 3AMGA 4K8EA 1V6TA 2OO0A 4YJ5A 1EOMA 3LTYA 4DUOA 4C6CA 1JULA 1TIMA 4I9AA 3NQDA 3CUZA 1RA5A 1LP6A 3T07A 1V3JA 2WSQA 4XISA 3GBEA 4LCSA 5IHSA 2X7VA 2NVCA 3G0XA 4ZOAA 5CPOA 1F6KA 2WQDA 1TR1A 1HT6A 1NP2A 2I1OA 3LX9A 2NVDA 1GYMA 5GJMA 4EE9A 1EWEA 3GDBA 4IPNB 3HGRA 2GVLA 1R7OA 3VGBA 4E6MA 3HF3A 1JNDA 3EEGA 4HNUA 3LXCA 4Z1DA 1TREA 3K1DA 3CH9A 3GTXA 4NUWA 3S5SA 4POCA 4GO9A 2JGYA 3IVSA 2GFTA 5D8WA 5G2HA 2Y24A 2XIBA 2C0AA 2TMDA 4V27A 3Q4DA 2E28A 2G0WA 4AWUA 1OD8A 4BWLA 4GKLA 5TBOA 3IVTA 5FIPA 2RHGA 3GKFA 2PRMA 1YDYA 1MQQA 2X09A 3SCOA 3RG6A 4XAZA 1ME9A 3O3RA 1GNXA 2WVTA 4UTWC 1TUFA 5CPTA 3T09A 1UR4A 4QJ3B 3NQ6A 2PWUA 4P8WA 4XTIA 5D8ZA 3SECA 1ISZA 1GJPA 3M6YA 1MQRA 2FQIA 5DT5A 3HPFA 1DE6A 4HN8A 2J8FA 4MZ1A 5FJTA 3G8RA 4Q8OA 5D2VA 1PBGA 5BCAA 3GVVA 3TW6A 1SZGA 3ABSA 4GKTA 4W87A 5I00A 3NQMA 2A7NA 3OBKA 4FX7A 3R79A 4PFHA 4HJFA 2EPMX 4D6DA 4CCEA 2D2OA 4FB7A 1Y5XA 4IFOA 4WDXA 3JR2A 4AZ6A 1JI2A 3HPXA 4IPPA 4UTTC 4KRTA 3TTSA 2P3ZA 2WPGA 4JAWA 4RZ6A 4J4KA 2G8ZA 2DP3A 4Z2GA 1H50A 1L6YA 4LEQA 1X97A 2NSXA 5ABFB 1TRDA 1LYXA 3QF0A 4C7DA 3BLLA 4RPQA 2OZ8A 4DM2A 5JUVA 5E9AA 3WF0A 4HP5A 4FXSA 7ODCA 4XTDA 3WQEA 1YE6A 4MTVA 2XINA 2PGRA 1CPUA 3ZOAA 1BRLB 2HXTA 4RNJA 1QOXA 1EJVC 3VNDA 2FH6A 1G4TA 4JFVA 3U48A 4B3ZA 4LH8A 3VIJA 2JF7A 1KC7A 4QLJA 4I7VA 2GSHA 2XGBA 2XIJA 3H8AA 1M6JA 3OB8A 2RUSA 2V5JA 1Q7ZA 1TWZA 2A4AA 2PLMA 2FPVA 1AUSL 1SMAA 4U10A 4RDYA 4GH1A 2IPFA 4AD1A 2VD9A 3P8JA 1HIZA 1ZBVA 3VKAA 1B3WA 1SFSA 3AIQA 4J3XA 3WIJA 2BOEX 3IIVA 1PL9A 4KGJA 4NI3A 1JPKA 2BB0A 3ALFA 4DLFA 5FEWA 1A0EA 3C5QA 1NQ6A 3ATYA 2VFFA 2V5LA 2HVNA 3EX6A 2YCLB 4XD3A 3UA4A 3L4YA 1OADA 2D2JA 2ANUA 4PZVA 3ZT5A 1C7TA 4LVDA 4JEJA 4UTHA 5JH2A 3H4GA 3U9IA 3CPGA 1DHPA 1GOOA 3NGFA 4YVVA 2J7GA 1UASA 3ZQ9A 1EGVA 1B90A 4JTTA 2TRSA 4YMZA 5AHEA 1IE7C 3A23A 4RDWA 3GG0A 2BMBA 4CQCA 1D9EA 1GWJA 1JUKA 2HS8A 4EOUA 3OTRA 2YXOA 1RK6A 1E6SM 2OT1A 2OOGA 4CNTA 2HPMA 4EXBA 1MNZA 3EOEA 1ISXA 2HJPA 2FGZA 3GRIA 1SSDA 4B5XA 2JALA 3B8IA 3M07A 1KM2A 4CUCA 1XH2A 3VX0A 5FESA 2C19A 3LZ3A 3SY5A 1BPLB 2VGGA 2YB4A 3EMZA 2HEJA 2UWFA 2FZMA 1ZJBA 3B4UA 4TTGA 2YCIX 3LD5A 3QMTA 4DO4A 2VFDA 4GYJA 5BRBA 2RDUA 2W6RA 4H01A 3TIMA 1QBBA 4DXXA 5BYWA 1R85A 5DRIA 1GCYA 1H3GA 4JTEA 3HN3A 3RMEA 1L8PA 3CO4A 3S5YA 3LSBA 5GNZA 4MB3A 2WSPA 5EBUA 4EPEC 1OF8A 2V68A 3QC0A 1R3RA 1X39A 1XYFA 4OUEA 4YTSA 3ZXWA 1D7FA 5I09A 1QHOA 5TIMA 1GQKA 4B2DD 2C7FA 4TV5A 1PUDA 5G1TA 4W7WA 1PYFA 1R86A 3MO4A 1JCYA 1L8NA 1VYPX 2V3EA 3F4CA 4YHGA 3LCXA 1M9HA 1LBFA 4AAJA 2EPKX 5HJLA 4O11A 1XLEA 2VZSA 1V4YA 2DZWA 4D8AA 1YXCA 5JU6A 3H7UA 6ALDA 4REQB 3FFSA 1XIHA 5EMYA 1J93A 3AMKA 1Q6DA 1U83A 3L0GA 1SZFA 1E6ZA 4GGHA 3GC4A 1OWQA 2GUYA 1TPH1 4MADA 1EIBA 2NLIA 3VNJA 4ALDA 4F8XA 3ZLFA 3P93A 3ELFA 4V15A 4A8IA 4DJDC 4O4VA 2JIWA 4L5ZA 3ZR5A 5A8GA 1Z69A 2VGFA 5LYRA 3NEHA 3CUJA 3TCSA 3W7OA 1CXHA 1F9CA 2CXEA 1VD6A 3CBWA 2I9UA 1UP3A 1HJUA 3N3TA 1OB0A 5CXPA 4C60A 1DJNA 1UP0A 2YZRA 3AI0A 3VOJA 2QJMA 2AKMA 3LBOA 1XX1A 1TELA 1P1MA 3HIJA 1K8CA 4HMEA 5FEPA 3UWYA 4KF1A 4UQCA 2FVLA 1W1A1 4E2BA 3IUDA 1J0JA 3AYSA 1REQA 4YWIA 4QFUA 4GE8A 5M03A 1DQWA 1QUMA 3KOYA 1I2RA 1E3XA 2Y0FA 4NJKA 3WKZA 4DNMA 3GXDA 3ID7A 4LQ1A 2F6UA 2CIPA 1Q6OA 1K9FA 3VIHA 2VC5A 4PEKA 5E0KA 2QXWA 4QM1A 1GVIA 1DPMA 1WBHA 2GWNA 1IHIA 3JW7A 2HCVA 3DKJA 2VX6A 7TAAA 5DMNA 1FHLA 4MWAC 3MHUA 1DWFM 4WVXA 1CX9A 3U57A 2GWGA 3GM8A 2ON3A 2DV0A 4GJJA 2DZTA 4WUIA 1BYAA 3WELA 1DTNA 2QKFA 4RNIA 2XVGA 3QQ1A 5T9BG 4CD7A 4Z1AA 3FJNA 1H7WA 3W7NA 5IDIA 2Y1HA 3UY7A 4JHMA 3B97A 1FWIC 5HAOA 3P80A 3T81A 5FI8A 4ZEPA 3EAUA 2GPTA 3MUAA 1W91A 3IK4A 4Q8WA 2F6KA 3RRAA 1PVNA 3OG2A 1ONRA 4PCTA 2VVSA 4DI8A 4NZCA 3RR1A 3PZUA 3V7PA 2PDCA 2E6DA 3N9RA 7CGTA 3LPFA 3V5FA 1OM0A 4JX4A 2R14A 3TWBA 2D2HA 1O1ZA 1SZRA 3URQA 3C56A 5DLCA 4DWSC 4UTLA 1W3TA 1EBHA 3TQPA 3LPPA 1BKHA 3VKCA 5KZ6A 3G0UA 2J88A 1I75A 3PTDA 1LF1A 2TODA 1LWJA 5FAJA 4WXYA 5LSMA 2VEIA 2OKTA 1TQJA 2ISVA 2FZ9A 2BSLA 1E6PA 4H04A 3R4IA 5IHRA 3UZYA 2BOFX 3PK7A 3VGHA 1YXDA 4O17A 1GOMA 4GNKB 3GFXA 1RP8A 4QP0A 3NQGA 1G9HA 1WA3A 2H3BA 4GFSA 4JQ1A 4UTUA 4JGDA 2X1UA 3SCUA 3WD1A 4IUOA 1AMYA 1XXXA 3WUFA 2UZ9A 4HPNA 4RPPA 1V6UA 4MJ2A 3AZSA 3VZYA 3FAWA 1G0CA 4NNBA 3PB0A 2CERA 4LAUA 2DJLA 1UWIA 3DG7A 2PDJA 2E09A 3NZPA 3IIPA 1M7XA 1S2TA 3PZVA 2Z1BA 2FJUB 3L5LA 3WQFA 1FDJA 1J9YA 1DHKA 3VI2A 1DYSA 1MRAA 4PMJA 4JYFA 5AC8A 3THAA 3Q58A 2BX7A 4ROQA 4QQUA 5C9UA 3SCTA 4FS9A 1KRMA 1W31A 1YBQB 4Q6XA 4E3VA 4FNUA 1IT8A 4O57A 2C1HA 3W07A 2UY2A 2R1NA 1UA7A 2E8YA 3E0FA 1ZPTA 2H6RA 3KM8A 4L1WA 4WDTA 5K9XA 3I3DA 4ZL1A 3PNZA 2OVLA 3BCDA 4LS0A 4US5D 5D04C 2X41A 3S2LA 4X2RA 1CIUA 5I0DA 3BWWA 1XBYA 3UXDA 4XVEA 1WE5A 1XUZA 4R53A 2CPUA 1BXCA 1J4EA 3R7MA 1ZL1A 4B15A 3HFTA 2AAMA 1E9ZB 1PX3A 1YDNA 5JBFA 3CPRA 3NDZA 1UKSA 8CGTA 4KEVA 4BQ4A 3PWGA 1CGUA 1U1HA 5AZ0A 1Q7QA 3OLEA 1BVWA 2PF8A 3KRZA 3DKLA 3V36A 1VBGA 1E4NA 3H70A 4FLRA 2W66A 3UJRA 1W1IE 3MU7A 3AAMA 2XSAA 3MP3A 3DUGA 4BEUA 1DJZA 3QOMA 5I3IA 4LBRA 1S5WA 3MBDA 5F4XA 3STGA 3KS6A 5HWNA 2BVTA 1G1YA 3F4DA 1E51A 1XLDA 4HK6A 3VFCA 3DHUA 3FW6A 3T05A 2PBOA 1VP5A 2J7FA 1M1BA 4TVCA 1OG0A 2V30A 4S2CA 4R3UA 3DG6A 1F73A 4M82A 3WO8A