1IXQA

Enzyme-phosphate2 complex of pyridoxine 5'-phosphate synthase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
242
structure length
235
Chain Sequence
AELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEEGGLDVAGQRDKMRDACKRLADAGIQVSLFIDADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQELARIAKAATFAASLGLKVNAGHGLTYHNVKAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKRLMLEARG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyridoxine 5'-phosphate Synthase
publication title Enzyme-ligand complexes of pyridoxine 5'-phosphate synthase: implications for substrate binding and catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
total genus 90
structure length 235
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 2.6.99.2: Pyridoxine 5'-phosphate synthase.
pdb deposition date 2002-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ixqA00
3E9AA 3TMQA 5AC8A 2ALDA 5KITA 5FF2A 1W3TA 3RMJA 1TJPA 4WQ6A 3S5NA 4YCOA 2YPIA 1JCJA 1XDMA 5TBOA 4RXGA 2FB3A 2QJHA 3W22A 4WOZA 4WZHA 3TCEA 1HO4A 4TIMA 4LV4A 4ORIA 1ME8A 1XBZA 4AHQA 3DKLA 1Q45A 2JGYA 3ABOA 2PRHA 3LRLA 3L9CA 3G1XA 1S3HA 3IIZA 1TPVA 3HMJG 3W7CA 1R47A 4A21A 1U5JA 1W3NA 2FIQA 4WD0A 1H7OA 3O07A 1EX5A 1ZHAA 5J5DA 4LV9A 3DFQA 4AWTA 5E0KA 4MOZA 1P0NA 3BG5A 4RCXA 1DVJA 4IXXA 1AL8A 1QPOA 1VYPX 5HNRA 1VC4A 1UBSA 1F76A 1LLWA 4AXKA 3JRKA 1QMLA 4AAJA 1FY6A 2Q3RA 4HNNA 3LTPA 1FDZA 1S5TA 2ZRXA 4JYEA 4BI5A 5I3KA 2IQTA 4S2CA 4GE8A 1ONRA 1XM3A 4EWND 2TSYA 5D33A 1VYSX 2KZHA 4N9EA 1LRTA 1TV8A 1Z42A 3DFSA 3CIXA 4RZ6A 1FCBA 1A5CA 3MUXA 3ABRA 2F84A 3LCHA 4BI7A 4K38A 1VJIA 4DF0A 3LTYA 4FEZA 3N14A 2R91A 1LBFA 1ICSA 5CG7A 5K4XA 3MO7A 1X7FA 1OFDA 1L6SA 1QDSA 1KM6A 1FXPA 2PRLA 1YLVA 1PCWA 1GYNA 3W1XA 3PG8A 4LUIA 2CZFA 4O4VA 2XFWA 3LBMA 1FWRA 5G2IA 4AEOA 4DO5A 1OX4A 4O8RA 4Q4KA 1K8XA 4PL2A 4Z1AA 3N3MA 3TW6A 2C6QA 4OT7A 1KFKA 1VZWA 1DL3A 3W1RA 1PL9A 3GDLA 4N02A 2ZZ5A 3B03A 1C8VA 5EMUA 3DHFA 5DELA 4TMBA 1LBLA 3TSDA 1BTMA 3LHZA 1A5SA 3PUEA 2A7PA 3NQ6A 3GX9A 3GZ3A 3O15A 5DN1A 3KAOA 1D9EA 3S5OA 4MLRA 1G7VA 5CPOA 1OJXA 4DO6A 3HG5A 4ZL1A 3M6YA 3C2RA 1CW2A 4N4PA 4NUWA 1AMKA 2C16A 3FIGA 4JD4A 3W87A 1GVFA 4ZQOA 1EP2A 2OMAA 4O17A 3M1ZA 5C2XA 2BX7A 4K7VA 1WBHA 3M43A 2YX0A 1TPB1 3SFKA 2EAWA 4MUZA 5CKSA 3PS7A 4BR1A 1TTPA 3NGJA 4JX6A 3A21A 5D32A 1F6PA 1OFBA 1THFD 3I7QA 3W75A 4ADSA 4GNJA 4UCGA 4O52A 1L2UA 3IRDA 3HGRA 3DI0A 1T0OA 4M7TA 5LNRA 4NJHA 2O7QA 4MFDA 4FNUA 5FF4A 2FPTA 1TMHA 4OWGA 3S1VA 2JKEA 1JULA 4ZVJA 3W73A 3F1QA 2HS8A 1FCVA 1ZENA 1VRDA 4NNAA 3GAKA 2QAPA 5DXYA 3DAQA 2E5DA 4UTIA 6TIMA 4PODA 3WJWA 1W5QA 2CLLA 2EF9A 2RDTA 4CQ8A 4HPXA 3B0VC 3NL3A 3M9YA 1UASA 3L68A 3TXZA 1KLYA 3G3MA 5HMSA 4E2DA 1M7PA 5D2TA 2QCHA 2B7OA 4MKNA 5TQLA 3TC7A 2PRMA 2E5CA 2I14A 3G8RA 4NT0A 4J9JA 3CWOX 4GUFA 4UMBA 4Y96A 1AK5A 1H50A 3R13A 4ML9A 4JTFA 3W72A 3W83A 2WKJA 1TTIA 4NZFA 1F05A 3GDKA 4QNEA 4DPPA 1VCFA 3LCFA 4MVAA 4N4QA 2FJKA 2X30A 2Q8ZA 4FF7A 4JIQA 5C54A 4PH6A 3W86A 3UNDA 1YADA 3NL6A 5K2ZA 4O1CA 4RXFA 1RD5A 1K7XA 1H7PA 4Y90A 3IVSA 5CGQA 5FF3A 3G3DA 3LRKA 4ONVA 2I1OA 4M6QA 3C2EA 4O0KA 3OIXA 2H3BA 3TDFA 2QDGA 2ZRUA 2YCEA 2G5WA 1WX0A 2OX1A 5EBUA 3O16A 5BOOA 5F2MA 1GOXA 3W7GA 1I8JA 4LTSA 3NQ2A 3YPIA 4R53A 1DQXA 2C15A 4UR8A 4LC8A 2QCEA 1J2WA 4M6PA 4YWIA 3W7HA 1K8YA 1EB3A 2YXGA 1ZAIA 3PB0A 4FXSA 1H62A 3W1PA 3OHIA 5CSRA 1VHNA 3OA3A 1XBXA 4H6KA 3HG2A 3G1AA 1TPC1 4R33A 1LORA 3ATZA 1Q6OA 3PWAA 4K8EA 3NL2A 4WUIA 1OYAA 3QEZA 1W37A 2E6AA 1U83A 5HULA 2CLOA 3S5ZA 3Q94A 3DENA 3SSJA 5G2WA 3M5ZA 3L5AA 3BV4A 5D30A 4IX0A 2H90A 4Z0SA 3IEBA 4RK8A 3MBDA 1NF7A 3MWAA 1LBMA 3LBCA 4RX0A 2A7NA 2J9XA 4M19A 4XWUA 3NQFA 3DGRA 3QQ0A 2BZNA 3EX2A 4JY8A 1OFPA 1A53A 3TE9A 5C5YA 4XBKA 1Z41A 2D73A 1JUKA 1WOAA 3BG3A 1G4PA 2ZZ6A 1QPQA 5DCEA 3QSRA 3L0KA 5E93A 4MJZA 2OJPA 1PS9A 1JCYA 1JRBA 3NQ8A 3W7MA 1C9DA 2X1TA 4ZQNA 2Z1BA 1VHCA 1XKYA 1EIXA 1Q6QA 1ZCOA 3TROA 4JTHA 5BRBA 3W1QA 1SW7A 3M47A 3HBLA 4UUIA 2VOMA 5LGXA 2VFHA 2X1UA 2CLFA 3TAOA 5EA9A 1OFQA 3CTLA 4GUGA 3UPBA 1KLZA 3DBPA 2B4GA 1H63A 5IBXC 4GBUA 3I68A 4Q33A 3MYOA 4AWUA 2QJIA 2VFGA 4LU0A 3W71A 2H6RA 4EF8A 3NAVA 3F4WA 3T7VA 1P4CA 2TPSA 4CCEA 2WQPA 4YL2A 4R7JA 4O1BA 3W7KA 1Q6RA 3DU0A 4TX9A 2GVGA 1UUMA 4RLIA 1DORA 3DFPA 3UWUA 2CLKA 1RQBA 3P62A 5A5WA 1VLIA 5HR6A 1DJNA 4LUJA 5AHEA 3C52A 2ZRVA 1PHWA 4KWVA 3SGUA 2Y61A 1H7XA 5AHNA 1HO1A 3GYEA 1E51A 1W5OA 3W23A 3HF3A 1BWLA 3LRMA 4I7UA 5CPLA 3GNDA 4Z1BA 3ZWTA 4DEFA 3QJAA 1GQNA 5FF7A 3LGEA 4JTKA 4BFAA 4NXSA 1TCDA 4E38A 4Y8FA 1TV5A 3KVLA 3M0ZA 2QCNA 2GUUA 4NZJA 2CLEA 1EPXA 3WK3A 1XBVA 4GUJA 5AOUA 4QQ3A 4K36A 3KXQA 3TH6A 4YMZA 3STEA 1GVSA 3VCRA 1G4SA 1OFAA 3NYZA 2XN0A 3V1PA 4CNNA 4MLJA 3GXPA 2DJXA 3R5EA 3W6YA 2Y6ZA 1B3OA 4NU7A 3C61A 2VEMA 4UFIA 1IGSA 3VE9A 3N9RA 2F7FA 1QCWA 4O14A 4LVGA 2Y88A 1YYAA 3UXDA 2ZYFA 1I2RA 4HSNA 3SZ8A 2JGQA 4XTDA 3EXSA 2YYUA 1RR2A 1ZJIA 4BI6A 3PAJA 5KTLA 3LHTA 3W1AA 3TU9A 1KA9F 5CPNA 3TA6A 4FX6M 2AAMA 2ZZ7A 1XUUA 3BGGA 5EPDA 1MEWA 4UTWA 5AHMA 4FHAA 1W31A 3KVKA 3NQCA 4ZQPA 1AG1O 4LVFA 2OCZA 3QQ1A 3HGOA 3UD6A 4EOUA 4WJEA 1DKWA 4MIMA 1A5BA 3B04A 1JRCA 3W3OA 3R2GA 4IWWA 2DZVA 3PY2A 2Y62A 1LCOA 2C0AA 1I4NA 2JBMA 1JVNA 1YTKA 5A8GA 3EWBX 3QC3A 5FF0A 4RJEA 3M16A 3SY5A 3NEVA 1XL9A 4O10A 4WXZA 4O1AA 1RZMA 4MZ8A 4PCFA 5K3VA 1GG1A 2X16A 1L6WA 1C29A 1Q6LA 1LYXA 1YDOA 3UWQA 3OVPA 5D2VA 2PURA 2DORA 1OHLA 3M5VA 1P1XA 2G96A 3QH2A 3FA5A 4PFMA 2E6YA 1HG3A 3QPYA 1J5TA 4AMAA 1JUBA 3A5VA 4CLMA 4UTUA 3OEXA 4A29A 2WOQA 3W7OA 1ICQA 3ZS4A 4WY0A 4MYAA 3QMSA 1XCFA 2Y7GA 3NO5A 3GDMA 4JTJA 4I7VA 3EWZA 2E09A 2ZDRA 3H54A 3GIYA 1OK6A 2ZA1A 1YPFA 3Q37A 3T40A 2BSLA 1KFBA 4O19A 3N73A 4DPQA 5AHIA 1GTEA 2YGYA 4EIVA 4QISA 3OBKA 5AB3A 2HTMA 2WSYA 1MEHA 3GDTA 3CT7A 1YXCA 1WXJA 4AF0B 4N9DA 4NJIA 3NG3A 4Z0JA 3KRUA 1MZHA 4HT3A 5LZLA 3EX6A 3GAYA 1ML1A 1WV2A 2X2GA 3UWWA 1Z44A 3WK0A 2CZDA 3STGA 1ZNNA 3L2IA 1W3IA 3FKRA 2XN1A 3TMLA 2NXHA 2G97A 4YXGA 1O60A 3EWXA 2RH9A 2Z6IA 3DKJA 4KWWA 1JCXA 1RVGA 1XDLA 2CW6A 3UWZA 1SSDA 2H3DA 5E1QA 1B4EA 3FJ6A 1RQHA 5H2ZA 3N2XA 4UFMA 5G5IA 4DBDA 1RPXA 3BLIA 3KVJA 2NUYA 1BKSA 1W5PA 2QEZA 1AW2A 3NPWA 3O05A 3CIWA 2C19A 1FCQA 1TPH1 4X3ZA 4K39A 1SU5A 3UXAA 3MW7A 2CLHA 3MI3A 1T8XA 3DZ1A 1TB3A 1QWGA 3FLUA 3BARA 3L21A 3WJZA 4UTTA 3QW4B 4UTMA 3KRSA 2ISWA 3S6DA 1O4UA 3NM3A 4G1KA 1TQXA 1GWJA 3TQVA 5F2LA 3UWVA 3P7YA 4IGHA 1W1ZA 2CFFA 3L67A 3QW3A 4NJKA 3UYCA 4UNLA 1QO5A 3SW6A 2ZQ0A 4TR9A 1EP3A 3DHDA 2C1HA 4A2SA 4OU1A 4LVAA 4IMGA 2RHGA 2GQ8A 5HWJA 2Y7DA 1AL7A 3SR7A 5FEZA 2ZRWA 2QAFA 1X1OA 5I3HA 5DCDA 3P8IA 3EX4A 3A22A 4ZQCA 5FEPA 4TMCA 4OBTA 1TTQA 2YR1A 4JGDA 1O5KA 2CZEA 1G4EA 2Y7FA 3HJZA 3LXCA 1SZGA 2Z0IA 3F4NA 4FX7A 4CCDA 2V2DA 4DQWA 1QPNA 1TSIA 2YSWA 4HPJA 1GJPA 3EWYA 3C2VA 6ALDA 4EF9A 4IX2A 4O57A 5FESA 3L65A 5D05A 3OG3A 2B0MA 5G1TA 5F1VA 3OVQA 2VEKA 1YXDA 1DBTA 1KFLA 1YTEA 3BLEA 3G0XA 3TAKA 3LERA 3O6CA 3BPWA 5FI8A 4JX5A 4LWWA 3U6WA 4UTJA 4CNOA 3W88A 5T26A 3PM6A 1KFEA 4JIPA 2ZBTA 1XUZA 1QOQA 1XXXA 3NZRA 1NFBA 4KKXA 3CQ0A 4ZQRA 3TXVA 5LNWA 3EKZA 8TIMA 1MO0A 3PBWA 4QNWA 2GPTA 5HINA 4HN4A 5G1YA 1QO2A 3UY7A 3EXTA 1ZY9A 1H51A 3QFEA 2WV8A 1P0KA 1OYBA 3PF3A 3FYOA 1H1YA 1TPFA 3N2MA 4GJ1A 4CNPA 5HWMA 1OFOA 3LB0A 4FX8A 2FB2A 3P5ZA 5AC6A 1L9WA 4I7WA 3S1XA 4M6VA 2A5HA 5I3IA 5K7JA 5D04C 3ZR4A 3VI2A 1TPEA 4XUGA 2VFEA 1VCGA 1R30A 2WNQA 2QCFA 3VE7A 1FUYA 3OVRA 2NXGA 4FO4A 3W7PA 3DH7A 3N34A 2DZSA 5KZEA 1YPIA 4ZQMA 2JKAA 5BW6A 3TX9A 3BO9A 3TW7A 4FNSA 5LHFA 3QM3A 3LCWA 5HR7A 2V82A 3UPWA 2C13A 5HUPA 4JEQA 3LOTA 4O28A 2A4AA 3ANYA 4RZ4A 3W1UA 4UXDA 1K3UA 3INPA 4BWLA 2GQAA 3HQ1A 1WQ5A 5H91A 4U4MA 4A22A 5AHFA 1EUAA 2PCQA 1SW0A 4NXKA 4XKYB 3P80A 2DU2A 1I2OA 3NQAA 3LM7A 7TIMA 1OF6A 1TV7A 1TTJA 3O6DA 3GR7A 1BEUA 3SI9A 3W7EA 1DOSA 2OT0A 1OFRA 4GUIA 4JTGA 5KZDA 2HSAA 4KFNA 3CPRA 2E77A 2DZUA 5AHLA 2QDHA 3CEUA 2VENA 2DP3A 3USBA 1KBIA 3KFTA 4QJ1A 4S1FA 1VH7A 3PUDA 2VEPA 1XC4A 4KFPA 2NLIA 2QCDB 1FWTA 5CZSA 2WSRA 2Y89A 4LC6A 1OX6A 2ABBA 4IMDA 3N9SA 2V30A 2RDUA 1JCMP 1YXYA 1SSGA 1IF2A 2JKPA 3RLUA 4K8HA 4O13A 5FEXA 2A7RA 1UJPA 3B06A 1SPQA 4HHPA 3PC0A 2ZA2A 1QAPA 4JTEA 3HO8A 4LVBA 5LGZA 1HL2A 3W9ZA 4X9SA 2ATMA 2DZPA 3S5YA 4E2BA 1GG0A 5AN7A 2Z2UA 3WJXA 3S42A 4JN6A 1PCKA 1FBAA 1IXQA 1FDYA 3G0SA 2ISSA 2E68A 5EKYA 3PB2A 2V8ZA 2DZWA 4IMFA 5AYZA 1ZALA 5F2IA 3TKFA 4UTLA 1Y0EA 4OV4A 1I45A 4IJBA 2VXNA 2GJNA 4JTTA 3W74A 3ATYA 4Q32A 2ZZ2A 3IIVA 4JTIA 3QF0A 1A5AA 3C0JA 1H5YA 3WJSA 4K37A 4K7YA 4HNTA 2ZZ1A 2R8WA 1H7NA 3NVTA 2ISVA 1W5NA 3EEGA 4U28A 4LOCA 3NA8A 2YW4A 2ABAA 3ABSA 3W1MA 1QOPA 1JR1A 1NAL1 3G1YA 4ZMGA 4CQAA 1G67A 1V7YA 1JQVA 1HFBA 4H4IA 4B5NA 2UV8G 3QPZA 4RV8A 3MHGA 1Q3NA 1VPXA 1IXNA 1YDVA 3LI0A 3NQMA 2VFFA 3WFAA 2CZ5A 3IGSA 2TRSA 3I65A 1K7EA 3LCIA 5HWNA 1KM5A 3GKFA 2X1RA 2CLMA 5GVJA 4A2RA 5CZTA 1XFBA 1EP1A 2QCGA 2P1FA 4O50A 1QFEA 2CWNA 3TK7A 1SZNA 2VEIA 1GVRA 4BF9A 5AYXA 1NF0A 3QSTA 3FEMA 4FNPA 5DBTA 4MJMA 1VR6A 4IQLA 3RNDA 3EWWA 1UB3A 2Y85A 2ZTKA 2V9DA 1GEQA 3C3NA 4QAIA 4UFLA 1LP6A 4LRTA 1DQWA 3NL5A 4QM1A 5LSMA 5HUOA 1NSJA 3G1VA 3B0PA 3BVJA 1OABA 3KOFA 4AVFA 1F6KA 3LXBA 4JR5A 3P60A 1AW1A 1X1ZA 5ABTA 5D38A 5KMYA 3QRHA 4C1LA 2J9ZA 3FOKA 1N55A 1LLZA 3WK2A 4CCCA 3VKJA 3W76A 4NJGA 1OX5A 1W54A 4HNVA 2NUXA 3M5YA 3UQNA 1EUNA 3PBVA 3NQDA 5F4XA 4UIOA 3C2FA 5L9FA 2Y7EA 2QJGA 3O1NA 1F74A 4LY8A 3P67A 3TQ0A 1L6YA 2NX1A 3W7QA 1B9BA 4O54A 2V81A 1SR9A 5EY5A 1LM1A 2JK2A 2GJLA 3WK1A 4N9BA 4WY0F 1KTCA 3QMRA 1KV8A 1TRIA 2WJZA 3T55A 4L4MA 1H7WA 4JXCA 3MP4A 3NNTA 4PEKA 3O06A 1NVMA 4O15A 4AHOA 1LOSA 4IPJA 2ZA3A 4JDBA 3G22A 3I6RA 4WXYA 2R14A 2GOUA 1G7UA 3ZFHA 2HMCA 5KSWA 3O8AA 1LRNA 1LRQA 1W8SA 1P5BA 5K9XA 3N19B 3HGSA 4LRSA 3P5YA 2A85A 5L6UA 1FXQA 1FDJA 3IV3A 3TR2A 4FNTA 3HIJA 3BLFA 1KFJA 1TPWA 3HPSA 3W2UA 1G69A 2GQ9A 3Q2DA 4BWLC 3QZEA 2FTPA 4UNKA 4WX2A 1S5VA 2FPVA 3EX3A 3U2OA 4JNMA 3G1SA 1OX4B 3LLDA 4K6AA 4A3UA 4ZZ9A 2YFNA 1OG0A 4UMAA 3HG4A 1M6JA 1N7KA 4TU1A 1R2SA 1DJQA 3H55A 1WOBA 3TJLA 2C3ZA 1OVDA 1TPUA 1SO4A 4NNCA 3LCLA 5D02A 5IM51 3PUOA 4MFEA 3S9YA 1SUXA 3T44A 4YCPA 5AYYA 4FNRA 1LTDA 2O7SA 3V75A 1TPDA 2BLEA 2V2HA 1ZAHA 1EWDA 2EKCA 2YDAA 2VC6A 1WAUA 1G4TA 3B05A 4M7SA 3W85A 3TV8A 1KBJA 3M44A 3UY8A 3HB9A 2NX9A 2QUVA 2QCMA 3TJXA 1ME7A 4EVZA 3MHUA 2C14A 4ICNA 3PSVA 4MPQA 3LCGA 2PE4A 4N6FA 4R34A 3B0UX 3PR2A 4QIUA 3FFSA 1SO5A 3IIXA 3TFXA 1VQTA 1LOLA 3UWYA 3EXRA 3QYQA 2W0UA 1FCUA 2H8XA 1QNVA 3NDOA 3E02A 2QF7A 5HQEA 1TJRA 2E6DA 3C2OA 1S5WA 1SO3A 1ALDA 3A9IA 4IXHA 4E0CA 1F7BA 4O11A 2W79A 3L0NA 2A6NA 1DHPA 3L5MA 3MI6A 2CLIA 4NX5A 3T4CA 3TNOA 3CU2A 3W7JA 3G1DA 3LCXA 2Q3OA 3M41A 1VS1A 4JICA 3AJXA 4DBEA 1HUVA 3LXAA 4OGZA 3RU6A 4O12A 3LHWA 5F4SA 2J27A 1G6CA 3D0CA 4S2BA 5F1UA 3TQKA 1YDNA 4GXMA 3B4UA 4FB7A 1NEYA 3G24A 1IIGA 4PC8A 2ZZ3A 4KFOA 3NR0A 4MY9A 4LS2A 3I7SA 3LX9A 5HJLA 3IGUA 3FKKA 2YW3A 4JTSA 1PHQA 4I9AA 1SFLA 1TIMA 5IBXA 4ALDA 1X8FA 1KM1A 4UR7A 4L4LA 3E0IA 3BG9A 1GTHA 1LOQA 2ATSA 4Y6GA 1MSSA 2J9YA 4UFKA 4XBSA 2RKXA 1VLWA 3W7IA 2WSQA 1UUOA 1F5ZA 3MMTA 4NJJA 1TQJA 4Z08A 4O4WA 2AQWA 4AF0A 3HG3A 2YFOA 2ZFAA 4GWEA 2G95A 4JX4A 1GVOA 4LVDA 4PA8A 3W1NA 2NXIA 1VYRA 1I2PA 4GRSA 3AO0A 3O6YX 3O63A 3TUUA 1R46A 5K4ZA 3C6CA 2V2CA 5LNSA 1W5MA 3A5FA 5FEWA 3MHFA 3W2JA 4LW7A 1PE1A 4UMCA 3HPZA 4IPIA 4DF1A 2TMDA 3DI1A 1OF8A 1K7FA 1EEPA 2FLIA 4HIBA 4C1KA 3W1LA 4N6EA 5EYWA 3LHUA 3G0UA 5BMXA 2Y70A 3PULA 3E49A 2R94A 1PVNA 2HS6A 3LV5A 4OV9A 2Y63A 5U7SA 1J4EA 1KM4A 1N8FA 3NM1A 3L66A 2WNZA 3T78A 4FIQA 1R2TA 3LTSA 3GR8A 3NQEA 4IMCA 4ADUA 1TYGA 1JCLA 1I2NA 4LT9A 3IVTA 2DZXA 3K30A 1PIIA 2V0TA 4Z1CA 1KM2A 1M7OA 3EX1A 3BW3A 4LNYA 3KRZA 5AC7A 3NXFA 3G8EA 1Z48A 1GZGA 4UTWC 1K03A 1TREA 1WA3A 2QCLA 2J6XA 2NX3A 3CB8A 3G1FA 4MY1A 1B57A 1ME9A 5KINA 1WDWA 3CEPA 2YZRA 4N9CA 4YLWA 3CC1A 3MYPA 4HKPA 3RF9A 1RQEA 1F2JA 4JTLA 3S1WA 2CU0A 3ZWSA 2NV1A 2AGKA 3NQVA 4IMEA 2RFGA 1R2RA 5G2HA 3THQA 4IUOA 5G4WA 3W2NA 5DY3A 1GVQA 2ZRYA 4NQ1A 1F73A 4O53A 3IGXA 3LHVA 1H7RA 1UCWA 1WBJA 3NPVA 1PV8A 3P82A 2E6FA 3M7WA 4DF2A 5I3GA 4JYDA 3RFAA 4HSOA 4WOQA 3IIOA 1LROA 4O18A 4MY8A 5F2GA 3W7DA 5C55A 2NV2A 4NNBA 3L0GA 2VFIA 1D3HA 2A2IA 5D09A 2B7NA 3F03K 1FWWA 3WJYA 3S1UA 2EHHA 2NWRA 1YTDA 1EA0A 2WPBA 1FX6A 3H53A 3W1TA 1FQ0A 2Z6JA 5CZJA 3GB6A 2DJLA 2VKZG 5U4NA 2QR6A 3GDRA 3TC6A 4AWSA 3VFLA 2B7QA 1B4KA 5DXXA 2P0OA 4LS1A 2GVLA 4ADTA 1OFEA 1O95A 1JQXA 1H1ZA 1KM0A 2E1DA 2QUTA 3U8GA 4N2YA 4JTUA 1K02A 3NPXA 3C56A 3JS3A 4GC4A 2QKFA 3I7RA 3TIMA 1DV7A 4UFHA 3B8DA 3GLCA 2EPHA 1QPRA 3LV6A 3IIPA 5BNKA 1CI1A 1OK4A 3E96A 3W7NA 3ELFA 3EKLA 4CQ9A 1MEIA 1FWSA 5EL1A 3PBYA 3R12A 3CHVA 3CLMA 4MZ1A 3RLVA 4ORMA 3STCA 4FNQA 2TYSA 3NPUA 2J88A 2ZTJA 3BK0A 4MZYA 1FWNA 3W07A 4P61A 3W7LA 2QCCA 1JJKA 3RK8A 2A1YA 3MP5A 2GVJA 4Y9AA 2W6RA 1T99A 2B7PA 2QUUA 4UFJA 1TO3A 5LNVA 3G18A 5DLCA 4NX0A 3S8HA 4JYFA 3CM4A 1WYIA 3HOJA 3NQ7A 3DFOA 1XBYA 2FDSA 4H3DA 3GK0A 4JS3A 5G4EA 2BWGA 5I3JA 3Q58A 4UTTC 3S0CA 5D2WA 1AW5A 4Z1DA 3PVFA 1JCNA 2BTMA 2LLEA 4LS0A 3SECA 3EWUA 3TFCA 3TSBA 4D2JA 1A50A 2X1SA 5D37A 1QR7A 2YYTA 3A24A 3HPXA 2WO5A 3MBFA 4MYXA 5SWUA 3P61A 5C6MA 3SJ3A 4X22A 4UTHA 1KFCA 2ZCGA 5D2XA 3M5XA 5BMWA 1ZAJA 3C4UA 3BW4A 3E12A 3EB2A 1W0MA 3VNDA 2PC4A 2A21A 1ADOA 2XN2A 4JDYA 4GFSA 5D2YA 4DXVA 2I9EA 1M5WA 2OZ0A 3UZ5A 3GXTA 4XKYA 3GKAA 3LLFA 1SW3A 1O5XA 3NOEA 1I2QA 1CX9A 3FS2A 5K9CA 1GYLA 2ZRZA 5CSSA 3W2MA 2H8ZA 3CWNA 3P8JA 5LNUA 3STFA 4POCA 3IVUA 4AHPA 1H60A 3SGZA 2WNNA 1SQ7A 2FFCA 3KVMA 4XQ6A 1V5XA 4AB4A 3L5LA 3LHYA 1D3GA 4PL1A 1IIHA 3NQGA 3W84A 1X6UA 2C18A 1T96A 1KV5A 5K9DA 4X2RA 1EWEA 2P10A 2QCDA 4UC5A 2NZLA 3A23A 5DY2A 1K8ZA 2DZTA 1JUEA 2E5BA 1SZFA 2A6LA 2OT1A 4RKAA 1GPWA 1SFJA 3GNNA 1SZEA 1KTNA 4FXRA 3BGJA 4JY9A 4RR4A 3GXNA 2BXVA 1O94A 3JR2A 5DCBA 4WY0B 3W2LA 2A0NA 5D03A 1KM3A 1VGAA 1TRDA 2RDWA 5TIMA 4XTIA 3SIZA 1H61A 5DBUA 3R89A 4RZ5A 2Q8LA 2VFDA 3P74A 4O0ZA 2VELA 1LDCA 4PTNA 2NUWA 2EGZA 1HTIA 3DFNA 1W56A 3THAA 4TO8A 3W70A 3LI1A 5CZ0A 2FPYA 4NVTA 3R8RA 3DXIA 3DFTA 3G1HA 2FQIA 4O1DA 1ZFJA 3ABQA 1KTBA 2NWSA 4OHQA 4O16A 4GUHA 4QITA 4QSHA 4BK9A 3PG9A 1RV8A 5F4WA 1BWKA 3HGJA 4OQVA 2J24A 4M5PA 1GT8A 3LDVA 3NZ1A 3P84A 3W2KA 3MJYA 3P81A 4HNUA 3FYPA 3GVGA 3W7RA 5KZMA 4IOTA 1IXPA 2V5LA 4AH7A 3FJLA 1KW1A 5AFDA 3PSWA 4DO4A 4P2VA 1IXOA 3BW2A 3MI2A 1OYCA 5CPMA 2ZZ4A 3PBUA 5LHEA 3QMTA 1XI3A 1VCVA 5I3FA 1MXSA 3UZJA 5LKYA 4XZ9A 4DELA 4FIRA 5J5RA 1SO6A 3KHJA 3KX6A 3C8FA 5MHBA 1LZOA 4W9TA 4OE7A 1ICPA 3TSMA 3MP3A 2V5BA 4UTKA
chains in the Genus database with same CATH superfamily
5KITA 1W3TA 1CT5A 2IW0A 2YPIA 5FIPA 2QJHA 2IQDA 3PTKA 4C5YA 4RV3A 4ORIA 3U2ZA 4GY1A 1KBKA 3DKLA 5H6HA 5CSYA 3OVGA 3N2OA 1PUDA 3WLQA 3AHXA 3L9CA 3NFUA 1C9WA 1GNXA 3HMJG 3W7CA 2DZAA 3EWDA 1J96A 4MNKA 2V63A 1HVQA 1HP5A 1BGGA 3BG5A 2E9BA 1V02A 3W26A 1VYPX 3T81A 1TZ9A 1DIEA 1RBAA 4AAJA 3B9OA 4HNNA 4FF5A 1V6VA 5I3KA 3GXDA 3H12A 4A8IA 4GFIA 2E1WA 1XM3A 1Q4NX 1TUXA 2TSYA 2VNCA 5D33A 5GPRA 1XF0A 2PLMA 1FWCC 2HPIA 3MUXA 5ABFA 4BI7A 4PMYA 4DF0A 4FEZA 4KRUA 2PZNA 3WBEA 4RE3A 2R91A 4PCSA 5HJYA 3E74A 3MO7A 3H24A 4MADA 5E6ZA 4X60A 3NDZA 1L6FA 1FXPA 2YA0A 1XIGA 1H49A 4UQBA 2OEKA 4JN7A 3XIMA 1FHDA 4O4VA 4ZO7A 4GLEA 3UGVA 1VBRA 4O8RA 4Q4KA 1K8XA 4PL2A 1UIPA 3TOYA 3PTMA 5HMEA 3WD2A 1N8WA 3SUWA 4BF5A 4B5VA 1DL3A 3ALGA 1XIIA 1PL9A 3O0FA 4N02A 4W87A 1Q8AA 3UWEA 4RDVA 4AY8A 1C8VA 2R1PA 5T91A 4DXKA 4JTAA 5AVNA 1A5SA 3NQ6A 3SB0A 3FDGA 2WBGA 3EDJA 3SCNA 5I23A 5DN1A 1VPYA 4BCEA 1CXHA 4QROA 4DHGA 4DO6A 2XIBA 3M6YA 3ES7A 3DECA 2C16A 4JD4A 4Q8NA 2OMAA 4O17A 5JIPA 1HXJA 3RPMA 4JIHA 3N9KA 6ENLA 4YTSA 4MUZA 4U2ZA 2W66A 4XIMA 3B8SA 4JX6A 4KPLA 1FVPA 3URNA 3VOIA 2BB0A 3GIQA 3W75A 1T0OA 4EKJA 1OSEA 4MFDA 3CZLA 2HDJA 3TVAA 1JULA 4ZVJA 2OGYA 3W73A 1T7LA 5C71A 3ZR5A 4E5TA 2QAPA 1A0CA 5DXYA 3IANA 5A8QA 6TIMA 4PODA 3OJGA 3WJWA 3VYLA 1W5QA 3FX4A 2EF9A 4CQ8A 3AWNA 4HPXA 1FHLA 4IICA 2QNEA 3C8NA 3QY7A 2OELA 1UASA 2PP0A 2OEMA 3PZIA 2L5HA 5E6YA 2I14A 3G8RA 4WJ8A 1ZP3A 1R85A 4HA3A 4GUFA 3EDEA 4Y96A 4D6JA 5CPQA 3ZO9A 1OC5A 1DIOA 4LAOA 5HANA 3AIVA 5A6LA 2WVTA 3MCOA 5A6BD 1E6PA 3B4YA 4MVAA 3UBPC 4JIQA 5C54A 1BYDA 1E4MM 1YADA 4O1CA 2J78A 5CGQA 3GBDA 1P7TA 2YL8A 3LRKA 1S5NA 2I1OA 2VZUA 3HM7A 1KXVA 2ZUUA 1XDJA 3PUGA 1LUCA 1O5QA 3VNLA 2QDGA 4LCRA 1PIFA 2G5WA 1SJAA 1CPUA 3W0KA 3O16A 4FLRA 5HDRA 1I8JA 1R3VA 3YPIA 4UR8A 3KL3A 4WF7A 1JDFA 1J2WA 1XS2A 1K8YA 1POJA 4FXSA 5CSRA 1F4HA 1XBXA 2F9RA 3OA3A 5FACA 1R86A 4R33A 3NL2A 4WUIA 3UVAA 1OYAA 3ARPA 4GI6A 3ZR6A 2E6AA 1U83A 4S39A 4LF1A 2JEPA 5G2WA 4U5IA 4IX0A 4L1XA 2PTYA 1BG4A 3KCOA 4Z0SA 4RK8A 3SCUA 3MANA 4RX0A 1TWDA 4BF7A 2A7NA 2J9XA 4XWUA 3NQFA 3QQ0A 1XFCA 1Q6EA 2BZNA 3KCLA 1OFPA 2Y8KA 2CXEA 5LXEA 1US3A 2I5GA 3WNKA 1W6TA 4OOZA 3OZPA 1K8CA 1QPQA 5E93A 1G0CA 3BMXA 4XAPA 1RSCA 1C9DA 1HJQA 1EDGA 1XKJA 2WLZA 3URQA 2Z1BA 1V4YA 1UH4A 1VHCA 1XKYA 3CHEA 4WSHA 4AEEA 3RM9A 1HT6A 3DHPA 3EPNA 3T05A 3TYEA 3KBJA 2VOMA 5LGXA 2PDJA 2VFHA 4JFWA 1CGVA 1QVBA 2OR2A 1MRQA 3CTLA 1E56A 1H63A 2QPUA 1UR9A 2BXZA 4GBUA 4E6MA 1BG9A 4G8TA 3ID7A 4HQVA 3W71A 1Q13A 2H6RA 4EF8A 2WMKA 3GS6A 4DJDA 2WQPA 4O1BA 3CZ8A 1Q6RA 5IDZA 1IHIA 4PUMA 3S1GA 3BSHA 4C60A 1UUMA 1QRQA 3LPGA 3UWUA 2ZUTA 4HU8A 3UA4A 5C9XA 1FFQA 1FWDC 3P62A 3AICA 4ZFMA 1SVDA 1VIZA 1C7TA 4YVPA 3PAOA 4B5XA 2YBUA 1A4LA 1EH9A 3OODA 3FW6A 5AHEA 2YA1A 1G94A 1SYTA 3SGUA 2Y61A 1XLAA 5AHNA 2VCBA 3MTWA 4KEZA 4HCHA 2OSWA 3GNDA 4DYJA 1XIBA 4AYGA 3LGEA 4BFAA 1XRTA 2IKIA 3G6MA 1TV5A 3KVLA 2QCNA 2GUUA 2CLEA 2Z2AA 1HJXA 1XBVA 4GUJA 3GM8A 4QQ3A 4K36A 5BU6A 1IWAA 4TUFA 2I17A 2BY2A 3SY8A 3STEA 1GVSA 4DUVA 4CNNA 3AS2A 1E4LA 3LK6A 2DJXA 3R5EA 2Y6ZA 1A0EA 1QTWA 3AALA 5I06A 3H2AA 3ZVHB 1B3OA 3C61A 1QI0A 4J4KA 3VE9A 2F7FA 4I8DA 4BEQA 1Q66A 5HBFA 4A3HA 2YXXA 3EXSA 4LSBA 1XRSA 4W7WA 4B3KA 1RUSA 4GK8A 3WBAA 1MNSA 3TU9A 4GVIA 3T6CA 2ZZ7A 1XUUA 1B3ZA 2FH6A 3RPTA 1MEWA 5AHMA 1FFRA 2R1MA 3VNYA 3KVKA 3NQCA 4LVFA 3VZXA 2REQB 1SM9A 2Z27A 4EOUA 1DKWA 3B04A 4GJIA 2J7GA 1KRBC 2ZXQA 2C8NA 4WKAA 4GGBA 4Z2IA 3F2BA 3FNDA 2VZTA 2Y62A 1IWBA 2Z4GA 3DX5A 2JBMA 1JVNA 2DW6A 3EKGA 3QC3A 3CXOA 3AHZA 2ZE0A 2VM8A 5FL0A 3A64A 1XL9A 1YX1A 3STPA 1YBQB 4MZ8A 1L6WA 1C29A 2JE8A 3OVPA 4TTUA 4H19A 3QPYA 4AD0A 4Q4PA 1IEVA 2HJPA 2WSPA 1K4GA 3E2SA 4UTUA 3OEXA 2WOQA 1GVYA 3WDPP 6XIAA 4WY0A 3GTHA 4IMAA 3KBWA 1GOWA 4EAMA 1D7KA 1GKQA 4D1IA 4K8GA 2Z25A 2E09A 3CS2A 3CUFA 1VFUA 2ZA1A 1EXPA 2C1GA 2BSLA 3CMGA 2GOKA 2J8GA 4M24A 4O1EA 3H2FA 1BXBA 1W32A 4L64A 4C6DA 5A2CA 9RUBA 2WSYA 1YXCA 4AF0B 1VKFA 2GFTA 3NG3A 4AW7A 1MZHA 4HT3A 1WPCA 2Y5EA 4EXBA 1JAEA 3GAYA 3GFYA 4CD6A 2INEA 2XN1A 3R58A 2ON3A 3EWXA 2RH9A 4GYFA 4W7VA 3DKJA 1NWTA 1XDLA 2CW6A 1RXOB 3K1DA 5E1QA 3FJ6A 5G5IA 3BLIA 1JZ6A 5DMMA 2QT3A 1BKSA 2ESCA 1AW2A 3RLHA 3O05A 3CIWA 1ONEA 2E25A 1FCQA 5B80A 1SU5A 2XIOA 5A6BA 3MW7A 3MI3A 1R3RA 1QWGA 4UTTA 3ITOA 1NQKA 1UD5A 4UTMA 2ISWA 1XSIA 4WK9A 1O4UA 4RPPA 3EEZA 3M0XA 2BHZA 9XIMA 4CU7A 4J2PA 3P7YA 4DJDC 2PGRA 1F6YA 4FOKA 1W1ZA 3L67A 1CCWB 4PUDA 3T0AA 1LG1A 4UNLA 2QJNA 3JUGA 3SCOA 4Z2JA 4HMNA 3OB8A 5M1TA 5E9XA 1DEDA 2E0PA 3SUVA 3BE7A 3GW3A 4LQ1A 2GGHA 1HKKA 3P8IA 3UR7A 3A22A 4L56A 2AQOA 2YR1A 2XINA 1DXEA 4JGDA 4GKLA 2BS9A 3LXCA 4ATDA 1SZGA 4CCDA 4DQWA 1QPNA 1TSIA 4F0LA 1GJPA 1GZJA 1XIFA 6ALDA 4IX2A 3L65A 2INZA 3EOEA 2ACRA 3SJNA 3S2CA 1AVAA 1PPIA 2VEKA 1MQPA 1D7FA 4GNKB 2R1KA 2WC3A 1YTEA 3DYMA 5CLTA 5D9OA 1BYAA 3BLEA 2DV0A 3TAKA 4NRRA 3IUDA 3MZ2A 3O6CA 3D5HA 1JEZA 3AAMA 2X7VA 1ENUA 1JFHA 1EXBA 3U6WA 2G41A 3W88A 4CNOA 3FVDA 4JTDA 2ZBTA 2X0YA 2BVYA 4WDUA 1XXXA 2JFEX 2XGBA 4KKXA 3UCQA 4F0HA 4W93A 3V0SA 1MO0A 1DYSA 3PBWA 4QNWA 5ABHA 5HQMA 2IUZA 1DWHM 2Z2BA 2CYGA 3WUEA 4GH3A 1H51A 2ZX9A 2I16A 3PF3A 3LENA 4GJ1A 4CNPA 1OFOA 1H41A 4GZEA 1L9WA 4I7WA 3WLHA 2A5HA 2CCRA 3VGBA 4QGCA 2NQZA 3OYXA 5CGMA 1NDYA 3B8TA 4DAIA 4Q7BA 3VI2A 3UJFA 4KF1A 4LUTB 1PIGA 2VFEA 3CB3A 3EOUA 1UQZA 5BRQA 3VE7A 4E4UA 3W7PA 2J25A 3PZMA 4FO4A 3DH7A 4ZQMA 2QIIA 1GOMA 3VDCA 4U3AA 1Z8AA 5DMLA 3CAKA 1S2CA 1XLBA 3LCWA 5HR7A 1ZBWA 2V82A 9XIAA 3BH4A 2C13A 2YOCA 4JEQA 4O28A 3E1F1 1UZ4A 1K3UA 4BWLA 5H91A 4A22A 2CHOA 4H9TA 1REQA 1SW0A 4NXKA 1E3ZA 1WDSA 4XKYB 3P80A 1EJWC 1H09A 1U2YA 3NQAA 2YCKX 2C91A 4L4PA 7TIMA 1DWJM 1QNQA 3EB4A 3A4JA 1TTJA 4DIAA 1KBBA 3GR7A 1ISYA 3FHAA 1M53A 3MSGA 4JTGA 4DLMA 3APGA 1CB2A 3VNJA 5AHLA 3CEUA 4GZ7A 2VENA 3WH9A 2DP3A 5GNYA 4QJ1A 2PDXA 3NSNA 1GCYA 1VH7A 3ITYA 4S3AA 4NILA 1DJXA 2XISA 3QYSA 3S5SA 5CZSA 1FWTA 2Y89A 3HPAA 5A1AA 4IMDA 4FR1A 3B8IA 3N2CA 1YXYA 1SSGA 4OECA 2YIHA 3WUBA 4L1GA 1TZ7A 4E4FA 4HHPA 4I8YA 4JTEA 2ZXBA 2ATMA 3S5YA 1GG0A 3QBUA 3S9ZA 3WJXA 3ARWA 1VFOA 3PNZA 4LUYA 3IJQA 3QR3A 3UXIA 2BY0A 2DT3A 1H11A 4IMFA 1JXJA 1OZQA 2PTDA 3RPDA 8XIMA 1ZALA 4LALA 5F2IA 4F9DA 4HOZA 1Y0EA 4OV4A 4IJBA 2VXNA 1T41A 4LANA 3VOFA 4Q8MA 2ZZ2A 1A5AA 4XV0A 1PZ1A 3C0JA 4K37A 1LL7A 1EC9A 3VC6A 3ZJ6A 2ZC1A 2ISVA 1W5NA 4U28A 3NA8A 2YW4A 2ABAA 5JBEA 1LQ2A 2QW5A 4ZMGA 3G1YA 1JPIA 3K1GA 3BICA 4XAYA 3WEOA 3VO0A 1I75A 1JQVA 3C0LA 2UV8G 3QPZA 4RV8A 4W8BA 3MHGA 2OKTA 1YNQA 4IFOA 1HL8A 1OY0A 3NQMA 2CZ5A 1S2AA 4AC7C 3JW7A 3I65A 2ACSA 5HWNA 1XLIA 1KM5A 1TJ2A 3BZGA 2X1RA 2CLMA 3LM3A 5EMYA 3ZT6A 4HNOA 4ZSUA 3QLLA 1GPFA 3VU2A 1J8VA 4I5XA 4BF9A 2P76A 4XAZA 1VR6A 2X1IA 3EWWA 2Y85A 1XH0A 5A8NA 1OCBA 1FP8A 1LP6A 3H2CA 3BGAA 1PYFA 4D8ZA 3G1VA 3B40A 2PUZA 3B0PA 1W1B1 2Q09A 3LXBA 1NH6A 3KM8A 1Z32X 1X1ZA 5D38A 1HIZA 1N55A 3FOKA 1ZU8A 4RNFA 3PFRA 1R3QA 4V1XA 1XH1A 3ISIX 1GEHA 3C2FA 1T40A 3LBOA 4LY8A 3TQ0A 3W7QA 4YJ5A 2XFYA 5JMUA 1B9BA 4O54A 1WZAA 1ISWA 1SR9A 3RCMA 4B90A 1TRIA 2WJZA 3T55A 4L4MA 3SSZA 4JXCA 1FTXA 2IPWA 1K77A 2DSVA 4AHOA 3QGKC 1LOSA 4QBXA 3IJ9A 2O92A 3ENLA 1V6XA 1EQCA 2R14A 1V79A 2GOUA 1G7UA 4ROPA 4XD3A 1K1DA 2C79A 3N19B 4PMRA 2FZ9A 2A85A 1FXQA 4US5D 3IV3A 3HIJA 1S5MA 3MWCA 4IFKA 2QYGA 3HPSA 3WCZA 2GQ9A 4XZLX 4BWLC 5CJMA 1SJCA 2FPVA 1F8IA 1KGXA 2EKGA 1QU4A 4UQAA 1OG6A 1NQ6A 1DWGM 1PTAA 3GHTA 1DHKA 2GL5A 3UCDA 2ZWZA 4E8GA 4PTDA 5E09A 3PZGA 2DY3A 1JD7A 3E0WA 3TN5A 1JFXA 3LGDA 4ZO9A 1DJQA 4F2UA 4AD5A 4UBPC 1IEXA 2C3ZA 1A0DA 2WMGA 3AXHA 4PSPA 2WVVB 5C70A 4JAWA 5FJTA 2VC9A 4ICCX 4FNRA 3WH6A 4REQA 2NQ5A 3V75A 1EWDA 4AD3A 2VC6A 3B05A 2HK0A 3KP0A 1KBJA 3M44A 4NI8A 3HB9A 4R5EA 4EPKA 3TJXA 4ZB2A 2C14A 4IL0A 4N6FA 1TVPA 3PR2A 3FFSA 4M3PA 4O1FA 3EXRA 4OVXA 2EG7A 5CSUA 2EBNA 2AGTA 2R82A 3G2GA 2VZVA 1E4NA 2E6DA 3R0DA 4J3UA 3N2TA 1F7BA 3RM8A 2Q71A 4O11A 2EO7A 3L0NA 1I1XA 2HRWA 2A6NA 5FJIA 1J6PA 3BSMA 1DHPA 3AIRA 2CLIA 3CU2A 3KBSA 4XD4A 1C8YA 3WLPA 4R27A 1ZJHA 2YBTA 1GQIA 2G4FA 2XHYA 3QZAA 5JQ9A 3O6AA 4D6FA 4AC1X 1Q6GA 3TQKA 1A5NC 4YWSA 4LY4A 1NEYA 3KCJA 1IR1A 1L8PA 4LS2A 1R7AA 1W3LA 3FKKA 4HHLA 4JTSA 1J18A 1JG9A 4I9AA 1KRCC 5J04A 4H8UA 5IBXA 4ALDA 4UQCA 5I78A 2PBOA 2R1NA 2UY5A 3BG9A 3K2GA 4C7DA 2ATSA 2ZXAA 2DSKA 3PWGA 5M03A 1SR0A 2POTA 4KIEA 2RKXA 1VLWA 3R8HA 1E9LA 3SY1A 2WSQA 5ECUA 3D3FA 4NJJA 4MMWA 3NEHA 2GDQA 1WKEA 1LF1A 1PKLA 2YFOA 4GJJA 4D1JA 4JX4A 2MNRA 1C8QA 4MJ4A 4ZENA 2D0FA 4F0MA 3W1NA 1VYRA 1YRRA 1I2PA 1JZ7A 5LNSA 4J5NA 4UNIA 3A5FA 3MHFA 3W2JA 1BVNP 3H70A 1G5AA 4UMCA 4IPIA 1MXGA 3IACA 3WL0A 1OF8A 4Q4OA 4FR6A 1PKNA 1W9DM 1P0DA 3DG6A 3NUKA 4N6EA 5EYWA 5FSEC 1NOFA 5BMXA 3EWCA 1Q4WA 2PDGA 2HS6A 2V5DA 5U7SA 3LNMA 4S3FA 4CN1A 4UQ9A 4MG4A 3TZFA 1BLIA 3K30A 3UJSA 2H9AA 4JL2A 2CNCA 1UP0A 4E2OA 3KRZA 2OFJA 2QJJA 4IIFA 1KWKA 2E28A 1GZGA 1TREA 2QCLA 2J6XA 3G1FA 4MY1A 1B57A 3E5BA 3QOKA 1UROA 2YL9A 2YZRA 4N9CA 4UZSA 3CC1A 1EYWA 2JEQA 1WUEA 2B81A 4FMVA 1RQEA 4JTLA 3ZWSA 3KS5A 4GGHA 2AGKA 4WHBA 1Q2RA 1NFPA 1KWGA 1EF2A 2O0TA 3THQA 4IUOA 1K70A 3RCYA 2DUXA 1SMDA 2G0WA 4RNIA 2WC7A 1A80A 4CQBA 2E6FA 4DF2A 4F3HA 3KHDA 3TN4A 3V36A 1LROA 2IPGA 1UWTA 1JD9A 5T8GA 3W7DA 2NV2A 2WJDA 2A2IA 3IARA 3LPFA 2B7NA 3WJYA 2OLHA 4PMXA 1OEPA 1YTDA 1QK2A 1EA0A 2V3DA 1FX6A 2QXWA 1QPKA 3GB6A 6PTDA 3K8LA 2QMKA 3I10A 4MSSA 3VFLA 2B7QA 4L9XA 4GKTA 4PB4A 1RJRA 4PMNA 4IJRA 4XIAA 1WDPA 3U5UA 3OLEA 3HFYA 3C56A 4GC4A 2QKFA 1X96A 3U9IA 2AAAA 1VFHA 5KETA 2DQWA 3K5XA 2WNWA 3B8DA 3GLCA 2XIIA 1QPRA 2HVMA 2OYLA 3ZYZA 4R85A 3OBAA 1A3HA 1E0UA 1W9BM 4E8CA 5IHSA 1OK4A 3ELFA 2GGJA 5EL1A 3WBXA 4PMOA 1E73M 1QW8A 4TVDA 3QC0A 3T4WA 2W9MA 1IYXA 2BHUA 4DXXA 1M68A 4QX4A 4P61A 3RK8A 2WQDA 2A1YA 3RMEA 3LQGA 2W6RA 1Q7MA 3DYOA 1PAMA 3BCDA 5DLCA 4LB3A 1WDDA 1WYIA 3HOJA 1KD0A 3NQ7A 1XBYA 4JS3A 3GK0A 2BWGA 5DFAA 3S0CA 3BQ5A 4Q8VA 2XU2A 2Z29A 1AW5A 1EQPA 4XG1A 3PVFA 2ZX5A 1BRLA 2LLEA 1OGSA 3TSBA 4XBJA 2WZMA 2XPKA 2YYTA 5I00A 1FKXA 3ECQA 5LIKX 2OXNA 3HPXA 3MBFA 1WXYA 2X7WA 3PPHA 4US5A 3QXBA 3GH7A 1ZAJA 3E12A 3VIIA 4ACZA 2A21A 1ADOA 2PDCA 5D2YA 3RM4A 3LZ5A 2E4TA 2OZ0A 3MCNA 1EKOA 1O5XA 1I2QA 1GYLA 1B0IA 1XIJA 1XLGA 3W2MA 5LNUA 3W24A 2EPNA 3VD7A 1FWFC 4H00A 2WNNA 1SQ7A 4NYUA 2FFCA 5HOSA 4C6IA 3TA9A 3AUOA 3WQ8A 3VIOA 1S46A 4GXWA 3TJ4A 2QPSA 3AMCA 3OIHA 5ENLA 4GQRA 4PL1A 1I9CB 4FLQA 2C18A 1E9IA 4M29A 5K9DA 5DY2A 2J79A 1KNWA 2GJXB 3PJXA 1SZFA 2OT1A 4RKAA 1ADDA 1OZMA 4J35A 1KTNA 5FL1A 2BXVA 1O94A 4WY0B 3W2LA 2PODA 3MJMA 2D23A 1KM3A 4FAMA 4XTIA 2Y24A 4HYRA 3EA2A 3VOHA 4ZTXA 2BXYA 2FFIA 3Q45A 3P74A 1B54A 1GHRA 4PCNA 2NUWA 4HSHA 2EGZA 4KWUA 3W70A 2VX4A 2FHFA 3R8RA 3DXIA 3ZT5A 4BS0A 4O1DA 4X0VA 3ABQA 4MM1A 4EACA 4QITA 4JTCA 3PZTA 4W8AA 1Z69A 1BWKA 4OQVA 1VBUA 2OEJA 1KQYA 4M5PA 1GT8A 2VOTA 1CZ1A 4QR6A 2BASA 3H2MA 3P14A 1AUSL 3P81A 3AI0A 2BY1A 4B15A 5FJRA 2DEPA 1KW1A 3FJLA 3PSWA 4DO4A 2VX7A 1TWWA 2O9PA 5CPMA 4GCXA 3DN5A 2PDHA 4DWSC 3AFBA 1Q63A 1W8GA 1VCVA 1DXIA 3LUTA 5D4YA 3SN1A 1TELA 3UYIA 5I3FA 1KXTA 2WYSA 3UZJA 3A9BA 3KOXA 1SO6A 4DRSA 1VEMA 2SFPA 2ZIDA 1HKIA 3C8FA 4HTYA 1E5JA 4Q4SA 4OE7A 2V5BA 3E9AA 2ALDA 1XLCA 1YE6A 3WYZA 5MKGA 3RMJA 1TJPA 4YCOA 1JZ8A 5TBOA 1XDMA 1C3FA 1UKSA 1NWRA 3MMDA 1UZDA 4WOZA 2XVGA 3TCEA 2OQYA 4TIMA 4LV4A 3QR0A 2AKZA 1E9YB 3HURA 1Q45A 4IIEA 3ABOA 1A47A 3EA1A 2PRHA 3QTGA 3G1XA 1KXHA 5BXTA 1CXEA 1TPVA 5FKYA 2WXDM 4K68A 2W5FA 1ZHAA 5J5DA 1V77A 2O9TA 1CGXA 4YVVA 1P0NA 2P0IA 3PZUA 1DVJA 3MKCA 1QPOA 2V3GA 5HNRA 1VC4A 1UBSA 5A2BA 1F76A 2W91A 3JRKA 1QMLA 3L4XA 1TX2A 4LYKA 1FDZA 4JYEA 4IIDA 5DANA 1WXZA 5BYWA 4KBXA 3CZGA 1J11A 3D6NA 4EWND 2WVUA 1P43A 5BWAA 1MFVA 2OYMA 3T09A 3TOPA 1TV8A 3AZSA 3ABRA 4D8AA 2XGZA 4AZCA 3N14A 4FPSA 5K4XA 1L6SA 3S9IA 4C6BA 1KM6A 4GI4A 4QAWA 4F0KA 3W1XA 4LUIA 3U2CA 2EPMX 2XFWA 4AEOA 3TWAA 3DOPA 3UA3A 1OX4A 1JPMA 3AMLA 1HGWA 3TW6A 1KFKA 3S6TA 2ZOXA 1VZWA 2WZTA 2WWCA 1BD0A 3W1RA 2CEQA 4IGNA 3B03A 2GSJA 4XZWA 3DHFA 3MUZ1 1ZB5A 2VDHA 3LHZA 2W63A 3ITVA 3C86A 1DXFA 4GX8A 3QY8A 2DZBA 4DYKA 2RJHA 2CBJA 1UA7A 3HG5A 4JKKA 4M56A 3FIGA 4DZ5A 4ZQOA 4B91A 3V3WA 1RA5A 4K7VA 2F6UA 1KCXA 3IRSA 3PS7A 1TTPA 1M7JA 1OFBA 3I7QA 1THFD 4ADSA 1REQB 4UCGA 1RVKA 2VDIA 5TAOA 3KUMA 3VTRA 5DMYA 4LEFA 2FPTA 3UT0A 1BAGA 1R3SA 1UD3A 3CAQA 4HHMA 1UWQA 1OT2A 1FCVA 3WLTA 1TE1A 3DAQA 2HQAA 4C65A 4Q8WA 1FH9A 2RDTA 1GW1A 4LB4A 5H1WA 4CUCA 1W2PA 2HCVA 3H23A 1M7PA 4GY7A 2B7OA 3TC7A 2PRMA 4H6RA 1PZ0A 2E5CA 2YLAA 4DZAA 4P7QA 4H7VA 1CGYA 3ZJ8A 2F61A 4AZIA 1TMLA 1L2QA 1OC7A 4J9JA 1W91A 3V4BA 4MPKA 1VD6A 4UMBA 1H50A 3EAUA 4C1NA 3W83A 2P88A 2PEVA 1RPKA 4LAMA 4HA4A 3GG7A 1HKMA 1IT0A 2FJKA 4QLKA 2E8YA 1DIKA 2Q8ZA 2PDLA 3NL6A 4RXFA 3W29A 4Q7NA 1QASA 1V3KA 4EAYA 4ONVA 4M6QA 4O0KA 2H3BA 4HP5A 2WWDA 1KFWA 1WX0A 1MI3A 1H0IA 1B3WA 3UG3A 4R53A 4DO7A 2C15A 1UWIA 3N4EA 3I6TA 3WY1A 3QV6A 1KBLA 1M65A 1ZAIA 3AIQA 4MNLA 1H62A 1POKA 3QGAC 1VHNA 1ZJBA 4KCWA 3CO8A 1TA3A 3G1AA 1TPC1 3ATZA 1Q6OA 1UWRA 3IJIA 4KERA 4UOZA 4KIRA 4KW2A 3L4WA 5HULA 2CLOA 3MB9A 3DENA 3M46A 5XIMA 3M5ZA 1I6NA 4XVEA 3A4WA 3BV4A 2PGWA 3IEBA 3MBDA 1E1EA 3MWAA 1EFZA 4AVNA 1LBMA 5LIUX 4IM4A 1EDQA 2XSAA 4W86A 4QG6A 1A53A 4XBKA 1Z41A 4MWAE 3VIGA 1JUKA 2ISDA 2D22A 1WOAA 3A47A 1G4PA 1BXCA 2OJPA 4FLSA 1FRBA 2X1TA 4HGXA 3M64A 1UR3M 1EIXA 3N2BA 1ZCOA 1A5KC 1GORA 1HZYA 3MV01 4FA3A 1IT7A 3TYCA 1NOUA 4M80A 3W1QA 1XGZA 3M47A 5TD4A 3AYSA 1CNVA 4AD1A 3UPBA 3KOZA 3DBPA 4WEVX 4DBUA 4L9YA 4HMCA 2I56A 1BF6A 2P5NA 3MYOA 1LL4A 3PJWA 4LU0A 3WQOA 3NAVA 3F4WA 1S1RA 3EB3A 1P4CA 3UERA 4AIEA 3APTA 4CCEA 3BMVA 3W7KA 2D2HA 4LYQA 5FJUA 4JIEA 1FH8A 4RLIA 1DORA 3DFPA 4AIUA 1EJXC 4FP1A 4Q6XA 3CUZA 2OWXA 2BOGX 3SURA 4D72A 5A6KA 5HPOA 1MMFA 4QFUA 1HKJA 3CV7A 2VI0A 3MC5A 2PWGA 4IFKB 1PHWA 1WKDA 2XVKA 4HK6A 4KWVA 4AZBA 4AX6A 1R8LA 1TR1A 5BRPA 3V7PA 3GYEA 1W5OA 3HF3A 3LRMA 3ZWTA 2GDUA 3QJAA 4ZOEA 4GVFA 3IK4A 4JTKA 1TCDA 3M7SA 3ANVA 3AMDA 5TF0A 1YW1A 3U3HA 1QXLA 1XYCA 3KXQA 4IPPA 3BCJA 3E6EA 4L1WA 3F5JA 2GZXA 4NZ3A 1JI2A 2XN0A 3DYPA 2FHBA 1AJ2A 4GPNA 4MLJA 3GXPA 2J7CA 3W6YA 2ZUNA 4REQB 1Y5XA 4Y7EA 2FTWA 3TTEA 4M81A 3EMCA 1QCWA 4LVGA 1XCXA 3H2EA 2ZYFA 3BJFA 3VIMA 2JGQA 3I3BA 4HPHA 2DVXA 3AS0A 5DF0A 4BI6A 2X40A 5KTLA 2D3LA 4F66A 2P3ZA 1NP2A 4IQJA 4EPDC 1W31A 1BKHA 3VZZA 1AG1O 2GSHA 4AY7A 3UD6A 4HYWA 4WJEA 4MIMA 3V5FA 4JNZA 3T2OA 4GMEA 3C5QA 2DZVA 2IKGA 1LCOA 1YTKA 5A8GA 4C6EA 2FYMA 1CGUA 1PDYA 3M16A 4GX9A 4RJEA 3SY5A 4G7EB 1RCXB 1RZMA 1PDZA 5K3VA 1GG1A 1LYXA 1YDOA 3GHSA 3UWQA 4NASA 1RHCA 4Y9NA 2PWEA 5HPCA 5D2VA 2J7EA 2G96A 3E3HA 1HG3A 4Z2GA 3L4YA 1JIBA 3H22A 4HNCA 5M2FX 1ICQA 4J27A 2WW5A 3ZS4A 1H2JA 3GVWA 2NSOA 5BOEA 2D24A 1DQUA 3QMSA 3QN3A 2Y7GA 1NU5A 3GDMA 4JTJA 4I7VA 3EWZA 1OK6A 5JIWA 3CMFA 3Q37A 3T40A 1E71M 1NY1A 3CZEA 4KT2A 5AHIA 3R6IA 3RG6A 4GBDA 4G5DA 3SCVA 2HTMA 3CT7A 2Q01A 1WXJA 2AKMA 4XB3A 3NYDA 2YKKA 4C6JA 1KQZA 2OO6A 4NJIA 4PUJA 3SRHA 3KRUA 4MB3A 3EX6A 3KDNA 1HKWA 4NIRA 1ML1A 2X2GA 3UWWA 2FH8A 3CH0A 1TV4A 3L2IA 3UF9A 1W3IA 4DN1A 4IISA 4GA8A 2G97A 4YXGA 1EPVA 3SRDA 1SSDA 1E0WA 2H3DA 3ARZA 2NV9A 4UFMA 4DBDA 1RPXA 1IGWA 4URIA 2VVNA 4GY0A 2REQA 5HK4A 3QVQA 3B8VA 5GJMA 3RO8A 5E0FA 5LA1A 1OCJA 2C19A 2A3EA 3R7MA 2QGYA 4K39A 1J01A 1QNPA 1T8XA 2H9AB 1X7IA 1TB3A 3C3UA 3FLUA 3F4CA 2PDQA 3WJZA 3KL0A 4A8LA 1XLFA 3S6DA 2MUCA 5A95A 4HJFA 3AQUA 1YBQA 3UWVA 3VAVA 1IEQA 3QW3A 2J7HA 1LL6A 4GQQA 3UYCA 1QO5A 5JU6A 3M4HA 3WF4A 1TWZA 5IXEA 1EP3A 5C0QA 2C1HA 4OU1A 4IMGA 2GQ8A 1U33A 3W4RA 3VIHA 3WD3A 2ZRWA 3AC0A 4G56A 2PBGA 2OKOA 1X1OA 3EX4A 2ANUA 5HMFA 4ZQCA 1V93A 4TMCA 1TTQA 4JIRA 3TYUA 2CZEA 1J12A 2FVMA 2Y7FA 1R0MA 5FCZA 3TEVA 2YSWA 3G5EA 3EWYA 3Q67A 4U31A 2J74A 4EF9A 3PANA 5FESA 4H1ZA 4E3VA 1UMLA 2OU4A 3S46A 5PTDA 3PTQA 4J3XA 4L65A 3CT2A 5IRPA 3AYRA 3OVQA 6CGTA 3VIPA 2EPOA 1DBTA 5HAOA 2ISFA 3LERA 2FGZA 4ZA0A 5FI8A 4LAZA 3OW1A 4JX5A 3B0XA 4NY2A 4LWWA 3UR5A 3MV11 1XUZA 3EPOA 3ZQ9A 3F2CA 3MMUA 3NZRA 3CL6A 4ZQRA 5I3DA 4DI9A 5I6SA 2BMBA 2CHRA 3UJEA 1AFSA 1AH0A 1E6RA 3SQSA 3EXTA 3UGRA 1QI3A 3PPCA 4GH1A 4PN2A 5HWMA 3LB0A 6XIMA 4FX8A 4GIYA 3WQFA 5AC6A 2CERA 3S1XA 4M6VA 4JFTA 4BY3A 3LEPA 3HPFA 1JXKA 4IUGA 3ZR4A 3V16A 2PF0A 3OOQA 3TP4A 2WNQA 4DLFA 1Q8JA 2D1ZA 3R79A 3N34A 5KZEA 1YPIA 2PZ0A 3QFWA 1D8WA 3RGTA 1BRLB 3TX9A 1U1UA 4GG9A 1XIDA 3CK5A 1EBGA 2DUZA 1F61A 4YNGA 1RCQA 4JQ4A 2A4AA 4W88A 4UXDA 1EA9C 1E15A 2GQAA 5AHFA 3U0HA 4AEFA 1L6GA 1Q5MA 4H9XA 4RW3A 1RLCL 3DG7A 3LM7A 4LUSB 3O6DA 3SCWA 2W67A 1K9TA 4CGTA 3HQOA 3ITTA 1DOSA 2OT0A 1OFRA 4GUIA 3W81A 4QTGA 2V38A 3GG0A 4HD5A 4MDOA 4DZIA 2BNJA 3N18A 3USBA 1CGWA 1BYCA 3KFTA 4S1FA 4IH3A 2WCSA 1MUCA 2XDFA 1TJ0A 2EG6A 4KFPA 4V1YA 3REQB 2AMGA 4Q6JA 3N9SA 2V30A 4WCJA 2RDUA 1F3EA 1IF2A 4J3VA 5BXPA 2X2YA 2A7RA 1R3TA 4JTQA 1SPQA 1IZKA 5T9BG 5XINA 4US6A 2ZA2A 4C5ZA 3CQIA 1QAPA 3MKKA 3HO8A 4TX8A 4I3GA 3ZVIA 2G50A 1FBAA 1IXQA 3BAIA 3MMWA 1UC5A 2E68A 1VFFA 1MDRA 3PB2A 5FAJA 1V3LA 4ZODA 5AYZA 1OB0A 1XP3A 3SCRA 3WH5A 4CNSA 1I45A 4JTTA 3W74A 4O0QA 3ATYA 5CG0A 3QF0A 4H8HA 1H5YA 3M0MA 3ZSSA 3WJSA 4K7YA 4HNTA 1UD6A 4B4FA 2R8WA 1J0YA 1H7NA 2E7FA 3NVTA 5CPTA 3R8GA 3EEGA 2WVSA 2RDXA 3T2PA 4X9YA 5TNVA 1V7YA 1VAHA 4UTFA 2VO5A 1HFBA 4B5NA 3L2LA 1S1PA 1ZPTA 1GGOA 3U7VA 1IXNA 3MQTA 4DUXA 4QSFA 1X8CA 3WDIA 3WFAA 1CIUA 2WMFA 4WR3A 5A69A 3FAXA 3GFZA 1UG6A 1OIMA 2VRJA 1RD6A 5GVJA 2EPLX 1CWYA 5CZTA 2P1FA 1QFEA 3WUFA 5D9NA 3ARQA 2QS8A 3TK7A 4DJFD 1PEZA 2X41A 1NF0A 4FNPA 3FVMA 3GFXA 1RH9A 1S2WA 3AYVA 3URBA 2ZTKA 4QAIA 1EL3A 5MKGB 4LRTA 1DQWA 1NSJA 4TX6A 3CZKA 5FJPA 3WQCA 4AVFA 1XISA 3P60A 2XH7A 5ABTA 5E9AA 5KMYA 4NG3A 4PTWA 1EC8A 5GQBA 4J3WA 3RX3A 3VKJA 3W76A 3EPMA 3KRBA 3DC8A 4LGXA 3M5YA 1EUNA 4LAKA 3NQDA 5F4XA 4AIOA 2Y7EA 5C2CA 2QJGA 3S3GA 3VX0A 3WNPA 5HA7A 3GH4A 4XKMA 4C6FA 2GJLA 2OOGA 4RPQA 1H7WA 1FP9A 5D8ZA 1B3XA 1ZQ5A 4BHYA 3NNTA 1NVMA 4O15A 1XPGA 1FWHC 2ZA3A 3WEZA 2QULA 3WZ0E 2NQ9A 2WCAA 4L61A 1JZ5A 1BGAA 4HPGA 3WDQA 1V3MA 3VC5A 2YDQA 2HMCA 4AZCB 3A3WA 5KSWA 1LRQA 1W8SA 3M6DA 3GTIA 4AZ6A 3P5YA 5L6UA 4IIBA 2AL2A 3BXWA 3TR2A 4FNTA 1FHUA 1GQJA 3GG8A 8CGTA 3BLFA 1TPWA 1ODZA 4UNKA 4NZCA 3SCTA 3AROA 3WN6A 1OX4B 1Y8BA 3TTQA 1JYWA 3VXGA 3TYBA 4K6AA 2PCEA 2YFNA 4S3JA 5CLWA 4UMAA 3PZVA 1KR1A 4Y2WA 1W1TA 5I5RA 1W2VA 4LJ3A 4L5ZA 1WOBA 1EJSC 2G37A 4RZBA 3R94A 1TPUA 4C6MA 1UHVA 2VT0A 4MFEA 1AQ0A 3S9YA 4P7LA 1W9UA 2XIQA 4YCPA 5AYYA 2PP3A 2O7SA 2BLEA 1ZAHA 3VINA 2Y2WA 2YDAA 3CPUA 2HWGA 1G4TA 3GNRA 3W85A 3TW9A 3TN3A 1GKRA 2QCMA 1JYVA 2OTDA 1ME7A 4A8NA 3GXIA 4YIWA 3PSVA 4GD0A 2Z28A 4EK7A 1Q2SA 4IP5A 1S38A 2PE4A 3B0UX 2Z24A 4QIUA 1GQKA 1NIUA 3TFXA 5IFTA 1LOLA 4P7OA 2W0UA 1FCUA 8A3HA 1QNVA 3E2RA 3E02A 4F2BA 2E9LA 2QF7A 5HQEA 2BG5A 1BVZA 3BANA 3O3RA 1ALDA 1J0HA 2WHJA 1VP5A 1V0NA 1FWBC 4ICMA 4DM1A 3MI6A 4NX5A 3T4CA 3TNOA 3WF3A 4Q3MA 3W7JA 3LCXA 2Q3OA 1K6AA 3M41A 4JN8A 4DBEA 1KB3A 2YB4A 3LXAA 5F4SA 2J27A 1G6CA 2CPUA 3D0CA 1YDNA 3W28A 4GXMA 3B4UA 4FB7A 4PC8A 4MY9A 3I7SA 3LX9A 4TTGA 2DDXA 4AY1A 1UH2A 1RBOB 2DPEA 2YW3A 4X0NA 3UP8A 1BQGA 4C1NB 1TIMA 1M03A 4W5ZA 1X8FA 4KH2A 3WF2A 4L4LA 3E0IA 4QCEA 1K4HA 2VVSA 1A3XA 1MSSA 3TZNA 2J9YA 3IJ7A 1SJBA 1UUOA 1F5ZA 1BFNA 1EHAA 2WVVA 1E4IA 3VDAA 3VILA 2ZFAA 4MF4A 2G95A 1GVOA 2QMJA 1YKWA 3MUCA 2RJGA 4J3TA 4GRSA 1EBHA 4PRTA 2XH2A 3O6YX 3O63A 1R46A 3VCCA 1TWIA 3C6CA 2QV5A 5BU9A 4LW7A 2G4JA 1PE1A 4DF1A 3ARSA 2QUNA 3L4TA 1V0KA 3LD5A 2Z1XA 1K7FA 5C7VA 1EEPA 1QK0A 4LBSA 3W1LA 5I7GA 3LHUA 3PTDA 1XYBA 3SDOA 3E49A 2R94A 1PVNA 1TA3B 1WDQA 3PN8A 2X05A 4I6VA 4OV9A 3VKDA 3VM5A 4OIFA 3HV8A 4TOQA 1N8FA 1R2TA 4ADUA 1VF8A 4LT9A 3IVTA 1PTDA 3KW3A 3ABXA 1PIIA 4Z1CA 1ZTVA 1KM2A 1E5NA 3WNOA 5EB8A 1EEXA 3ICJA 4ZSTA 2OPJA 2VGBA 4UTWC 1WA3A 2VZOA 4QE5A 2NX3A 3R1ZA 5KINA 1WDWA 1P6BA 4OOUA 4YLWA 3MYPA 4AZ5A 1M7XA 4TXEA 4V27A 2ICSA 3RF9A 4XSMA 3WIJA 1NDVA 1X6NA 3WLOA 3S1WA 1O5RA 2NV1A 4IMEA 4U5KA 5DY3A 2ZRYA 4NQ1A 4O53A 1UCWA 3NPVA 3GVRA 1YEYA 3P82A 4M82A 3ZMRA 4I90A 4WOQA 3IIOA 3EZ4A 4MY8A 1VBHA 5C55A 3PZOA 2XWDA 2VFIA 4QDMA 1HVXA 2Y4SA 3EDFA 5D09A 4NHVA 1KR0A 4Q4RA 2YDSA 2Q8XA 3H53A 3W1TA 1TCMA 1BYBA 5CZJA 4DJFA 3OBEA 3UJRA 1FWGC 3TR9A 3NCOA 1B4KA 2P0OA 4LS1A 3VA8A 2GVLA 3IK2A 2BVWA 1TIWA 1O95A 3R0KA 3CPGA 4PTXA 4WRHA 3OP2A 1KM0A 4K2SA 2E1DA 2QUTA 3U8GA 3QV8A 4I9MA 1ITXA 3MO4A 1UIOA 3O2LA 1VEPA 4DJED 1TZZA 4J1OA 4Y9PA 2BV9A 1FWSA 1W3KA 3CLMA 3RLVA 4IT1A 1HJUA 2HNHA 4EPBC 3LGGA 4QJ5B 3JU2A 4HZ7A 3NURA 3TTYA 4AWEA 1DJWA 1WZLA 4G7FA 1IR2A 5EU9A 3H2OA 2A3LA 1TO3A 3G18A 5D9MA 3S8HA 1JGIA 1E0XA 2VYOA 4JYFA 1V0LA 3VNIA 4XISA 2CIPA 2FDSA 5D2WA 4GYKA 2XZ9A 1UZ1A 1QW7A 3K46A 2ODOA 3VMOA 1ZLPA 3A4XA 5LIYX 5CH9A 3L4ZA 2WO5A 1ZUAX 4W5UA 4CD7A 3KEHA 2ACQA 4UTHA 4ERAA 2ZCGA 5D2XA 2QPXA 3OU8A 3EYPA 1PJ9A 1RY8A 2XN2A 4YHEA 4PULA 1NTHA 4GFSA 2PDWA 3VDBA 2DUAA 2EPKX 3GHUA 1SW3A 4ZXOA 4Z1YA 4ZGYA 3FS2A 2YLLA 5CSSA 5IHRA 1WB0A 1UUQA 2H8ZA 3CWNA 3RITA 1J0JA 1XHGA 3WQ6A 1H60A 1T6MA 3KVMA 4XQ6A 1O66A 2WM1A 4ZBCA 4AB4A 4CU6A 4C6QA 1ZRQA 1CLKA 3KZSA 1D3GA 3FAWA 1IIHA 3AUJA 1T96A 1KV5A 4X2RA 3MSYA 1EWEA 2QCDA 1EOKA 1K8ZA 2P53A 1JUEA 2A6LA 2NVCA 7ENLA 4FXRA 4PUUA 3VX1A 3BGJA 4JY9A 1J0ZA 1BTCA 4QLJA 3KWSA 1VGAA 4F4RA 5TIMA 3WENA 1K9FA 3SIZA 5DBUA 5CAHA 3R89A 2TODA 4RZ5A 3WBYA 4S3CA 3UJ2A 6A3HA 1LDCA 4PTNA 3BV7A 4IF2A 1OD0A 3MT1A 1HTIA 3DFNA 1W56A 1VPQA 1VRXA 2YL6A 1OINA 1Q7ZA 3ZJKA 4NVTA 3CAWA 4JBRA 2FZBA 3PZNA 4OHQA 3QHOA 3I3DA 4BK9A 3PG9A 1RV8A 2VCAA 5M17A 3E0VA 5F4WA 4MDPA 2PB1A 3BLDA 3OZYA 2VL4A 2W4XA 4LBRA 3W38A 3MJYA 3FYPA 3GVGA 5HQLA 2FZ8A 4XK2A 4P2VA 1GZ1A 3THCA 2ZZ4A 4JIIX 3H7RA 1YNYA 1XI3A 2GUYA 4D6CA 3B9DA 5I02A 2D0GA 4ATWA 3VGEA 1MXSA 3BJTA 5T9CE 7CGTA 3AXMA 4UWMA 2JF6A 2VGGA 1MXDA 4DJFC 4DAFA 3F4DA 5MHBA 2NVDA 4P7RA 4NI3A 2F2KA 2VUYA 3VPLA 3BAXA 3TMQA 5AC8A 2GJXA 3ARUA 4JCMA 3CL7A 4WQ6A 5HMDA 2VWSA 3PFMA 3IUHA 2PDBA 3CL8A 1ME8A 1XBZA 4C6OA 3WLIA 2PP1A 2JGYA 2QGHA 3ONBA 3CMJA 1UA3A 3ERPA 1IZCA 3L23A 4HU4A 4H04A 1S3HA 3W6LA 3IIZA 4CVWA 4IGMA 2WC4A 1W3NA 2W3ZA 1H7OA 1EZWA 5BROA 5E0KA 4GVGA 1OQFA 3VUSA 1A49A 4ZCWA 2VD9A 3J7HA 4ZOBA 1LLWA 1P6CA 1GYMA 1FY6A 2Q3RA 1PX3A 3LTPA 4UQEA 1S5TA 4BI5A 4CVUA 1VFMA 1XSKA 1C8XA 2BGSA 3OZMA 4GE8A 1GOKA 1UR8A 1ONRA 4H83A 1VYSX 4D6HA 4N9EA 4NAEA 3ES8A 1X1NA 3CIXA 4RZ6A 3U5YA 3LCHA 4K38A 2DT0A 2GGEA 3LTYA 2E3ZA 4MAVA 1ADSA 2VC7A 4B92A 1LBFA 1ICSA 2HV5A 3GVQA 5CG7A 2ZUVA 1X7FA 1B5TA 1Y5VA 1JPKA 3MSRA 2J77A 2PRLA 4MHBA 1PCWA 4JOMA 2QIWA 4I5RA 2WJEA 5G2IA 3N3MA 4ZO8A 3TYDA 2C6QA 3BLOA 4OT7A 3VIFA 3RRXA 1VJSA 4EANA 1X97A 3GDLA 2ACUA 5DELA 4TMBA 3R10A 1OIFA 3TTSA 2Y5JA 3TSDA 1BTMA 1CDGA 1E55A 2IS7A 3DDMA 1Q6DA 3GU1A 3VDGA 1S39A 2QQ6A 3GZ3A 3U2EA 3EA3A 1OJXA 4KRTA 5CPOA 4L4OA 3T0DA 2UZ9A 3TONA 4N4PA 1H5VA 1I1WA 4NUWA 3W87A 3WQEA 4BQ5A 1UW9A 2IPFA 2XZ7A 5C2XA 1PYMA 3M43A 4PR4A 3SFKA 3NGJA 5D32A 3A21A 2R1LA 1XRFA 3W53A 3ZLFA 4JFSA 4KMQA 3BLKA 4GNJA 4O52A 1L2UA 4JQAA 3DI0A 5LNRA 3UETA 2WM0A 2O7QA 3NDYA 5FF4A 1P0BA 4C6NA 3ITLA 4OWGA 3ZSTA 3S1VA 1B9ZA 2JKEA 3AIBA 2HS8A 1ZENA 1VRDA 3SCPA 1LJYA 4ERGA 4PYSA 2ZVIA 3DG3A 3B0VC 3DIPA 3OZOA 1XYLA 4PUNA 3MUY1 3V0UA 4G2DA 3NL3A 3BLLA 2DH3A 3L68A 1KLYA 3G3MA 4OJYA 2VX6A 5D2TA 2QCHA 2VQTA 1B90A 4GQBA 4QJ3B 7REQB 1QT1A 4NT0A 5CC3A 2ZX6A 7ODCA 3BAYA 2I5IA 4UZUA 2JQXA 5CAKA 4AD4A 2VQUA 3SRFA 4F9JA 5ABGA 4JTFA 3W72A 1TTIA 3EDKA 1W1PA 1EDTA 3OQ8A 3GDKA 4QNEA 4N4QA 1XICA 1W1A1 3W86A 1XYFA 1K7XA 3IVSA 5FF3A 3PBGA 2P3EA 5JVLA 3C2EA 3NGFA 3CUJA 1NELA 1P6WA 1PO9A 3OIXA 4AX7A 3ZM8A 4CQCA 2ZRUA 2GJPA 2XWEA 5CZKA 1GOXA 3OA5A 3W7GA 4LTSA 3NQ2A 1DQXA 3H6OA 3U48A 4QEEA 2QCEA 3W7HA 4YWIA 1EB3A 1J2BA 3T8LA 2YXGA 3WFLA 5CPSA 3BLPX 5A6MA 3VOJA 4C91A 3W1PA 4BKNA 4MB1A 3VD5A 1LORA 4K8EA 3GVVA 3QEZA 1W37A 2UWFA 4C6KA 4PUEA 3S5ZA 2AQVA 3Q94A 3VNMA 2QDEA 4GC3A 3C2YA 5H8UA 1XCWA 1XSJA 3AMGA 5D30A 4HA1A 2CWXA 2H90A 1BF2A 2VC5A 1VB9A 1NF7A 2JIWA 5G1MA 3U4AA 4M19A 4HN8A 3T1GA 3EX2A 4JY8A 1XIMA 3TE9A 3WF1A 5C9WA 2D73A 2CITA 3CUIA 5GNZA 3PZQA 3BG3A 2WHKA 4FOUA 2AMXA 1G01A 2ZZ6A 2EG8A 3Q65A 2CKRA 3L0KA 3MKVA 4MJZA 1PS9A 1JRBA 1MUMA 3OLDA 2YB1A 3A6OA 3FDKA 4UOQA 1Q6QA 4RNJA 3TROA 4JTHA 1A5OC 1SW7A 4H9YA 3RUBL 3HBLA 1R87A 4UUIA 1C92A 1DJHA 4B5TA 1QI2A 3W6MA 3TAOA 2IXUA 4CEXC 4H6EA 1OFQA 1E1CB 1EGMA 1UPMB 1S3TC 2FDMA 2XIJA 3POHA 4Q33A 2V5KA 4AWUA 5BCAA 2QLYA 1KXQA 2QJIA 2VFGA 3WQWA 3S47A 3UR8A 3T7VA 2TPSA 5DEZA 4R7JA 2YL5A 2QVHA 1PWLA 4WSKA 2C1IA 1CB7B 3DU0A 2GVGA 1AA1B 1XR2A 4A4AA 4OUEA 3T07A 2D0HA 1RQBA 2CKSA 5A5WA 1VBGA 1E72M 4ILSA 3N25A 4LUJA 2AL2B 4DWSD 4DJEC 1PXGA 3IS4A 3C52A 4DBWA 2PPGA 1J0IA 1GJUA 5LA2A 3PHAA 1H7XA 3B9NA 3VDHA 4F2TA 3GNXA 2RGLA 1UR1A 3WD4A 5M3WA 3F7JA 3VOCA 4YHGA 4IHCA 3GBEA 1KGWA 1EOMA 4F0RA 1XIEA 4Y8FA 1MQRA 4JEJA 1EPXA 5H8PA 4U10A 4B9ZA 4DX3A 1FH7A 2PTXA 2DT1A 3TH6A 4H6QA 3VCRA 1G4SA 1OFAA 2DIJA 3II1A 2VEMA 1U5VA 4UFIA 1IGSA 4LNCA 3N9RA 2Y88A 2YCLA 1YYAA 1L0PA 3UXDA 4HSNA 3QHNA 5I79A 3CQJA 4QHRA 2OLSA 1W1YA 3PAJA 3E2VA 2PWVA 3B8UA 4D9PA 1TX0A 1KA9F 5CPNA 4RDYA 3TA6A 4FX6M 2AAMA 5EPDA 3SAZA 4FHAA 4DZHA 4EXQA 1G9HA 1GOOA 4I9TA 3WH8A 5I24A 4HZ8A 1HNYA 1A5BA 4V33A 5B7YA 2CC0A 3RRAA 2WPGA 2XIMA 1IWPA 2P8CA 3FGCA 1I60A 3IWPA 3NQBA 3R2GA 3WX7A 3RAOA 4NL1A 2J47A 2O4QA 2C0AA 4XAGA 1I4NA 3EWBX 4Q8OA 2ONEA 1XYZA 3ZJ7A 4AMCA 1US0A 3NEVA 3APYA 4O10A 4WXZA 1DJZA 3HN3A 4PCFA 1Q6LA 1MW3A 2W27A 4XZHA 4K1WA 2PURA 2DORA 3M5VA 3QH2A 4PFMA 3FA5A 2E6YA 1EZ2A 1FWAC 4AMAA 5I03A 2JALA 3QOMA 3A5VA 4CLMA 3W7OA 3LSCA 4CD8A 2PTZA 4GI8A 1XCFA 1V51A 3DGBA 4Q4MA 3NO5A 3COTA 3HZ3A 1FOBA 4L9ZA 1DWFM 1RJQA 1OD8A 3WO8A 1KFBA 3BAWA 1GTEA 4EIVA 3FA4A 4QISA 3OBKA 4FSAA 3T8QA 4LH8A 1X39A 3UFYA 1YQ2A 3UG8A 4N9DA 4Z0JA 3K8KA 1K9EA 1EJ7L 5DQPA 4MNJA 1WV2A 2VURA 1UZHA 5AC5A 3FKRA 2XH4A 1ZSXA 1UC4A 5C7HA 4KWWA 1U30A 3WMSA 1LQAA 4DNHA 1B4EA 3VD9A 3N2XA 1K9DA 3WQ4A 3NTYA 2P50A 5CBJA 1W5PA 1K6WA 2QEZA 3NPWA 2F8QA 2DW7A 5LXXA 5FOOA 3B3DA 1E6NA 4X3ZA 4P8WA 2CLHA 3V1HA 3AOFA 4G6CA 3DZ1A 1V7AA 4A3YA 1SFTA 4IJCA 3BARA 5IFPA 3QW4B 2Q02A 2NQLA 3POCA 4G7EA 3NM3A 2PMQA 1TQXA 4UB9A 1B1YA 2PGFA 5CJ5A 2VR5A 2CFFA 1AMYA 2V5CA 5FAGA 4PTVA 3SW6A 4FOJA 2ZQ0A 1JL8A 3DHDA 5JBFA 1CEOA 1PB0A 4E8DA 1E6XM 2RHGA 5HWJA 4YS1A 1WKFA 3AHTA 3FV9A 3ABZA 3SR7A 3V5CA 5FEZA 4WKHA 1JPHA 3I3EA 2WMJA 2PDKA 3LG3A 4DM2A 5HXMA 4W4QA 5FEPA 2PSNA 4H8VA 1LT8A 3VVGA 4FX7A 4JQ3A 1M01A 4QLLA 4HPJA 4UOJA 1JDCA 1DE6A 4PMZA 3C2VA 1MDLA 1WDRA 3A13A 4QP0A 3MUAA 5D05A 8RUCA 4X61A 3OG3A 2B0MA 2HROA 4CN4A 1J79A 1RY0A 5A8PA 1O6IA 3KOWA 1KFLA 5AY7A 1HL9A 2CZVA 2OYKA 1E0TA 1UKPA 2QUMA 2YA2A 3BPWA 4AZ7A 2PLJA 3DFHA 4XO6A 5T26A 3PM6A 4KWSA 1QNSA 2WKLA 3D46A 1KFEA 3EGJA 4JIPA 5EMMA 3KP1A 3BUVA 1NFBA 3V18A 3USZA 3TXVA 1R6WA 1H4PA 2VCCA 1WO2A 1M9HA 1V0MA 3GO2A 4HN4A 5HINA 5G1YA 1EIBA 3QFEA 2WV8A 1HX0A 1P0KA 1OYBA 1H1YA 3OYZA 1TPFA 3N2MA 3VKKA 4GISA 2WCGA 2ZX7A 2FB2A 3P5ZA 1XC6A 1YDYA 2BVDA 1E9ZB 2ALRA 3H7VA 3HA1A 5HATA 4LXFA 2D20A 5K7JA 2W61A 5D04C 3VNZA 1CLVA 3ONCA 3P0WA 4NYYA 1TPEA 2GVEA 3M0KA 4XUGA 4R7WA 2QF8A 4FI4A 1FUYA