1IXQA

Enzyme-phosphate2 complex of pyridoxine 5'-phosphate synthase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
242
structure length
235
Chain Sequence
AELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEEGGLDVAGQRDKMRDACKRLADAGIQVSLFIDADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQELARIAKAATFAASLGLKVNAGHGLTYHNVKAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKRLMLEARG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzyme-ligand complexes of pyridoxine 5'-phosphate synthase: implications for substrate binding and catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
molecule keywords Pyridoxine 5'-phosphate Synthase
total genus 90
structure length 235
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 2.6.99.2: Pyridoxine 5'-phosphate synthase.
pdb deposition date 2002-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ixqA00
3W7RA 4W9TA 4ZQPA 1OX5A 3R89A 1VPXA 2DP3A 3LGEA 3TIMA 4UMCA 2OCZA 1KV5A 2ZA1A 4LS1A 4WY0F 1YXCA 2P1FA 3TKFA 3PUOA 5AFDA 4RZ5A 3UY7A 3FJ6A 7TIMA 4ADSA 4K7YA 4Z08A 2WO5A 1O95A 1S3HA 5CSRA 4CLMA 5CZJA 4O18A 5D2XA 3ABOA 1QR7A 2QAFA 1Z44A 3M5VA 1AL8A 1GVFA 3FKKA 4XTIA 2WNQA 1KBIA 1ME9A 4EIVA 4ORIA 3E02A 4O54A 4FIQA 2Y61A 2QCLA 4JR5A 3QF0A 3TW7A 1P1XA 1EWEA 3S1VA 1ZAIA 4NU7A 2TSYA 2ZZ6A 2OT1A 2VXNA 1IXQA 3B8DA 5LZLA 2B7NA 4RZ6A 4JD4A 4JYDA 1JQXA 1K8XA 1WAUA 2ZZ2A 3DI1A 4HHPA 4GUFA 1QPQA 1P5BA 4MPQA 4JIQA 1OHLA 1IXOA 2Z2UA 5GVJA 4I9AA 3QPYA 3RK8A 3KVLA 4AWSA 3M9YA 3FA5A 4O1AA 3IRDA 5A8GA 4S1FA 1R2TA 1QMLA 5CZTA 3O6YX 4DO4A 1GVRA 1TQXA 4UIOA 4LW7A 4GUJA 5AHFA 3TDFA 5F4XA 2IQTA 3TFXA 2YX0A 4S2CA 3W83A 5KZEA 1R2SA 4MLRA 4UXDA 4M6VA 1H7OA 4BWLC 3GK0A 1R2RA 4O17A 4DF0A 3GR7A 1ME7A 1QAPA 1QFEA 3U8GA 3N2XA 3LTYA 1RD5A 1QCWA 3S6DA 2Z6JA 4UFLA 1M7OA 1DHPA 1VJIA 4K39A 2WJZA 3PUEA 4O1BA 4NZFA 3LI1A 1WBHA 2DJXA 2G5WA 3UWYA 3LCHA 1SO6A 5EMUA 4DELA 2YPIA 1Z41A 1J2WA 1P0NA 3W70A 1MEHA 2XFWA 1QOPA 2B4GA 3G1SA 5C2XA 2BWGA 4DF1A 3M16A 4UR7A 1YTKA 2NLIA 1LM1A 1XKYA 2CLLA 2XN1A 4E38A 5BMWA 2P10A 1GZGA 5BW6A 3BPWA 4EOUA 1DQWA 4K8HA 2GQ9A 4GUHA 3W84A 1Q6LA 3KVKA 2W79A 3NR0A 4M7TA 2R14A 1TRIA 3BW2A 3KRZA 1ALDA 1QO2A 4L4MA 1LBFA 1A53A 3R8RA 4IMEA 2EHHA 2JK2A 2ABBA 5KTLA 4O0KA 3TROA 2ZZ5A 4IWWA 5F2LA 5T26A 4JX5A 3LOTA 3M7WA 1ADOA 1GVQA 3GDRA 1YPFA 3NA8A 1YTDA 3O63A 6TIMA 3LBCA 3MWAA 4FNRA 3L66A 2A7NA 2FFCA 3IIVA 3EX1A 2PURA 4O50A 3G1AA 4XKYB 1YPIA 2JGQA 4NNBA 5AYZA 1ZAJA 1VYSX 3IV3A 1XFBA 1OFRA 3GDTA 4DXVA 3NQCA 3JRKA 1JRCA 3N73A 3W1LA 4O4VA 1DORA 1BWLA 3EXTA 4B5NA 2DZUA 4IMFA 1TCDA 3GKAA 1TTPA 4GNJA 3ZS4A 2YYUA 5DXXA 5K2ZA 4HT3A 5HUPA 1FDZA 2ZZ3A 2VFEA 4OV4A 3SR7A 3WJXA 4K6AA 2OZ0A 3N2MA 3PG9A 1KA9F 4XWUA 3TUUA 5AHEA 1W1ZA 3MI6A 1TV5A 1A50A 3W7LA 4DPQA 4O52A 3V75A 4R33A 4JDBA 3HOJA 3C8FA 4QM1A 2X16A 4AVFA 4FO4A 4LVFA 3GDLA 4OT7A 1XBXA 2H90A 5I3JA 1TRDA 2X30A 3S5YA 1TPB1 3G0UA 1PHWA 1N55A 3ZWTA 4JTUA 3HPZA 2QCNA 5C6MA 1DKWA 1LTDA 5U7SA 3P5YA 3EX4A 5DBUA 3W7KA 3TC7A 1GG0A 3LTPA 4PTNA 1RZMA 3PBUA 3MBDA 2O7SA 3W6YA 4GWEA 1EP3A 3A24A 4N02A 4NJKA 4LC8A 1SPQA 1TMHA 1GT8A 1HO1A 3M43A 3WJYA 1R30A 1FWNA 2CLFA 1H7WA 2EKCA 2B0MA 3OVPA 2GQ8A 2E6YA 1KM6A 4A2SA 1PV8A 4QIUA 3ATYA 3W88A 3NQDA 4OU1A 3S5OA 1EX5A 1JUEA 2DZPA 1DQXA 3TNOA 3GAYA 3D0CA 4LVDA 3W2JA 2VEKA 1Q6OA 3BG9A 3C2RA 1LZOA 2ZRZA 2WNNA 2GJLA 3I65A 5EA9A 3M5YA 2ISVA 2R8WA 4IGHA 4R53A 4LNYA 1JCJA 1PS9A 3W7DA 2VKZG 3HGOA 4M5PA 4ZZ9A 3L0NA 3NGJA 4C1LA 1RQBA 3W7JA 5D32A 4MY8A 1UB3A 2NX1A 2JBMA 3QQ1A 1WX0A 1XBYA 2C19A 2YZRA 1RQHA 2CZFA 1VCFA 4A22A 4WXZA 3MI3A 3UPWA 1GVSA 3KVJA 4LUIA 4IX2A 1KFLA 1K03A 3ZR4A 1JJKA 1K8YA 4KWWA 2Q3OA 2G96A 3R2GA 2V5LA 3IEBA 3P82A 3G0XA 1FDYA 3STGA 2A6NA 1W0MA 4LVAA 2VEPA 4YXGA 3EKLA 1OVDA 1AL7A 1FWRA 4MFDA 5FF3A 1WDWA 2VEIA 3HB9A 3B06A 3QQ0A 5DBTA 3GIYA 3MP5A 3QJAA 8TIMA 1XDMA 2E09A 4UTMA 5K4ZA 1JULA 3NEVA 3MI2A 1X1ZA 1KTBA 2ZTJA 4RKAA 1YYAA 5HUOA 2C16A 3NAVA 2QAPA 2Y89A 1K7FA 4Z1AA 3MO7A 3DAQA 3KXQA 1FCQA 5CZSA 1K3UA 3G3DA 3W7OA 5D02A 3EWUA 1KLZA 3W1TA 2JGYA 5HNRA 1HL2A 1M5WA 5D2WA 3PB2A 4UTKA 1FX6A 1YLVA 2A7RA 1A5AA 3PAJA 1K7XA 1SU5A 1FBAA 2VOMA 2G97A 4HPJA 2ZRXA 1BWKA 3QZEA 3WK0A 3T40A 4RLIA 3L9CA 1PCWA 4NVTA 2DZXA 5CPLA 4UFIA 3W7PA 5FF0A 3JS3A 4A3UA 1W54A 3V1PA 1XXXA 4MZYA 1B4KA 3W22A 2DZTA 3DKJA 4O15A 3A5VA 3MHFA 1KM1A 5HR7A 5G1YA 4WX2A 1PHQA 2QUTA 3KAOA 4MYAA 3NQFA 3BG3A 3FYOA 1XDLA 2FDSA 4UTWC 3PUDA 2ZZ7A 2C18A 1B3OA 2EF9A 3CWOX 2YW3A 4UFKA 1X8FA 2GJNA 3GKFA 3QC3A 4OE7A 3GXPA 3LCLA 1AW1A 4OHQA 3EWXA 1VHNA 1O94A 1OABA 4TX9A 5G2HA 2NWRA 5AC8A 3W85A 1VC4A 3DFTA 3H54A 2W6RA 1NAL1 1SSGA 1GYNA 2QCHA 3QH2A 1OX4A 5F2IA 3DFOA 5KINA 3S9YA 1LOSA 3TMQA 4NX5A 4IPIA 4O1DA 2OMAA 3GYEA 4ORMA 1LDCA 1H7NA 3G1FA 4BR1A 4DO5A 1OX4B 1ZJIA 1QPOA 2H8ZA 4DO6A 2QR6A 4FB7A 1DJQA 1EIXA 4YWIA 1UUMA 1Q3NA 1VZWA 1KFCA 4IMCA 2AGKA 1I2QA 2R91A 2J9YA 2QCMA 4FIRA 5KZDA 3IGUA 3DXIA 3B0UX 2ZRUA 1VH7A 1TPUA 1XUZA 3IGXA 1TO3A 4OWGA 3L2IA 3PBYA 1DV7A 3CU2A 4N9DA 3S1WA 4AWTA 3HO8A 5EL1A 3G1HA 2GVGA 4ALDA 1F05A 5D30A 1OFAA 4IUOA 3QSTA 1I2OA 4WY0A 4TIMA 5I3KA 1VRDA 3NYZA 2QF7A 3G0SA 1G69A 1BEUA 3NOEA 1Q45A 4O16A 2VENA 2FLIA 1HO4A 3NM1A 5DCEA 3LHZA 1RQEA 1U83A 2VELA 4ML9A 2YXGA 1KFBA 4K7VA 2XN0A 4JTLA 4JDYA 5J5DA 5DN1A 1UBSA 3VFLA 4TR9A 3LERA 4KFOA 2YCEA 2HSAA 4QNEA 1H63A 2A0NA 3G1YA 4NJJA 5KITA 5D2VA 3W1QA 3MW7A 3BLIA 1UUOA 5FF2A 2EGZA 1ZNNA 1XCFA 3Q37A 5D2YA 1SR9A 2QCGA 4PEKA 1MEIA 3WFAA 4ADTA 3SECA 1NEYA 2OJPA 3E96A 4DQWA 2NX3A 1R46A 1VLIA 3PF3A 1RVGA 3VI2A 4WZHA 4NJGA 3P81A 4TU1A 4Z1CA 3TH6A 2KZHA 2ZRWA 4H4IA 3EKZA 4CQ9A 3GDKA 3GAKA 2Z1BA 3UXDA 2RH9A 3BGJA 4ZQOA 3N19B 1TIMA 4X9SA 4JNMA 4ZQNA 5D2TA 1JCLA 1T99A 4RK8A 3TCEA 3EX3A 3LCFA 2BX7A 3M41A 5E1QA 1B4EA 5FEXA 2PC4A 1SFJA 3G8RA 3A21A 4AHQA 3O15A 4Q33A 4DEFA 3S5NA 1T8XA 1OF8A 1C29A 4N4PA 4P61A 1F7BA 5MHBA 4N9BA 3C3NA 3CQ0A 2V5BA 1AW5A 1QDSA 3H53A 4BF9A 4WQ6A 3THQA 3NZRA 3P67A 3LTSA 5C54A 3FS2A 3N3MA 4CNPA 2ABAA 3NL3A 3E0IA 5G4WA 1OFEA 4XQ6A 1F76A 3CEPA 5KSWA 4NXSA 3MYPA 3W2UA 2ZFAA 1KLYA 3PR2A 2DJLA 2A5HA 3SI9A 1IXPA 4QAIA 2YYTA 3OHIA 3CWNA 3KX6A 3EEGA 2FQIA 4E2DA 4GXMA 4UCGA 3TSMA 5LGXA 2Y88A 3P62A 1M6JA 5G5IA 2E5DA 3DFSA 1H7PA 5FEPA 3EXRA 5C55A 1EUAA 2VC6A 5U4NA 3NQGA 5HINA 4HSOA 3HPXA 3UPBA 3HGRA 3NO5A 4LS2A 5DXYA 4UTHA 2NZLA 1X1OA 4IQLA 2P0OA 5D04C 1HTIA 2CZEA 3HG5A 2A21A 4KWVA 1H51A 3BV4A 5L6UA 3HG2A 5DCBA 4TMCA 1L6SA 2CU0A 4XBKA 3W7CA 2X1TA 5FF4A 2F7FA 4IXXA 4UNKA 1VYRA 4AHPA 4A2RA 3NXFA 1CX9A 5BMXA 1TTJA 2OT0A 5K4XA 1QOQA 3CC1A 4ZQRA 1W56A 1F74A 1KW1A 4Y96A 4N2YA 5LSMA 1FCBA 1XBVA 3QFEA 3W1UA 2B7PA 4JX6A 2QJGA 3I7RA 3RMJA 2GOUA 1P4CA 3W87A 1TV8A 4JTKA 3O6CA 2ZTKA 4O28A 3RU6A 4FF7A 1OK4A 2V2CA 3TXVA 2CLHA 1ICPA 3DHDA 3L21A 4DBEA 1Z42A 1TV7A 2CLKA 2H3DA 2WSQA 4HNNA 4QISA 2W0UA 1OFBA 4QSHA 5K7JA 4Z1BA 3C2FA 2A7PA 2PRHA 5CPOA 1BKSA 1QPNA 1YDVA 2R94A 5F1UA 3RLUA 4K38A 1AK5A 5AC7A 2JKEA 3QYQA 3WK3A 3UZJA 2E5CA 3PULA 4L4LA 2CWNA 4AAJA 1CI1A 4HSNA 2CLOA 5LGZA 4EF9A 2A2IA 4AH7A 1HFBA 3M44A 2A4AA 1ZCOA 3A23A 3PG8A 1W5PA 2TPSA 3RNDA 2Q8ZA 4UMAA 3OG3A 3STEA 3WJZA 2ZA2A 4YMZA 3OBKA 4LY8A 2QEZA 2VEMA 2TMDA 2B7QA 2AAMA 3AJXA 3L5MA 1YDNA 5DELA 3PS7A 4N4QA 4ZVJA 4GC4A 3LLDA 1F2JA 1ZY9A 4Y6GA 3P60A 3JR2A 3PB0A 4YLWA 3S0CA 3I6RA 4A21A 4O4WA 5DY3A 1A5BA 3IVSA 2E68A 4AEOA 3L0KA 3SZ8A 3HG4A 2QKFA 5C5YA 1TPC1 1PCKA 2UV8G 4LV4A 4PFMA 4BI7A 5F2GA 4LV9A 3E12A 2CLIA 3B0PA 5G1TA 3TFCA 5HULA 1TJRA 4WD0A 1CW2A 5I3FA 3SFKA 1OJXA 1G4SA 4QITA 3VKJA 4MIMA 2LLEA 2VFIA 4OV9A 4ADUA 2BLEA 2QUUA 2WQPA 1GJPA 3LCIA 3YPIA 1I45A 5LNRA 2FB3A 1THFD 3Q94A 5TBOA 1ZALA 3TXZA 3LX9A 3QM3A 3O05A 1G4EA 3O07A 5D37A 4EF8A 3W1MA 1GEQA 1W5NA 3L5AA 4BI6A 4O13A 5G2WA 2X1SA 2C0AA 3HGJA 4NJHA 5LHFA 4R7JA 5BNKA 3SSJA 1OF6A 3LRLA 2B7OA 1O5KA 3NQ6A 3S1UA 1JUKA 1TPFA 3W7MA 5ABTA 3CIXA 1OK6A 3W7EA 2I14A 5HJLA 1ICQA 3CLMA 3W7GA 1I2PA 4WY0B 3W9ZA 3IIZA 3HBLA 4Z0SA 2WSRA 5LKYA 1GTEA 1NF0A 2ZDRA 3B05A 3PVFA 1TTQA 3N9SA 1U5JA 3BARA 2BTMA 3OA3A 4DBDA 1AMKA 4O19A 4ZL1A 1ML1A 3BVJA 3W1NA 3C52A 4POCA 1H62A 3DU0A 4QJ1A 2JKAA 3T78A 3CIWA 4UC5A 3SW6A 1OYAA 3O8AA 3CPRA 2PE4A 3DI0A 3KRUA 4ZQCA 3UD6A 5AYXA 3NQMA 1T96A 3M6YA 1JCMP 1TB3A 1LYXA 1Z48A 2VFHA 2ZRYA 4AHOA 1TPWA 3B03A 3C61A 3W7NA 1YADA 4MYXA 2RDWA 4EVZA 5AN7A 3KHJA 3NQAA 5LNVA 5K9DA 2Q3RA 1PE1A 2FTPA 3NDOA 4PL2A 1SO4A 1JQVA 3INPA 4HNTA 2CZDA 1PVNA 3F03K 4MZ1A 4RZ4A 5CSSA 4M7SA 1I2NA 2QCDA 3NQ8A 3EWBX 3ABSA 2C14A 3PSVA 4LWWA 3P74A 2DZWA 2FPTA 3UYCA 2QJHA 3RFAA 3DFQA 5AHNA 4FX8A 2E1DA 1LRTA 1S5TA 3O6DA 2ISWA 2DZVA 2PRLA 3TX9A 5K3VA 4YCPA 5EY5A 3GXNA 1SZFA 5HQEA 1KFKA 4AWUA 4TMBA 1O4UA 1KTNA 3ZFHA 1WBJA 4X2RA 4RJEA 2GQAA 1W5MA 4UTTC 4LC6A 4JYEA 1QPRA 4IX0A 1ME8A 4I7UA 3A22A 2NWSA 4JTFA 3W7QA 3MJYA 3TJLA 4UTIA 4ONVA 2ISSA 1VYPX 4NQ1A 2TRSA 5TQLA 1F6PA 4XZ9A 1GOXA 3KVMA 5FI8A 3G24A 4GJ1A 3G8EA 1KM3A 3N9RA 1L6WA 4RV8A 1IXNA 1SO3A 3E49A 2FPVA 1MXSA 3L67A 1DL3A 1WQ5A 1B57A 5DCDA 1NSJA 3MMTA 3THAA 1JVNA 1TPH1 4A29A 2Y85A 1W37A 2Y70A 4WXYA 1FDJA 5AHMA 3NQ7A 5CG7A 1FCVA 1G7VA 4LRTA 3GNNA 4ZMGA 1IGSA 4O1CA 1GVOA 1XUUA 2GVJA 3W72A 3B0VC 2EPHA 4E2BA 1TSIA 4JTJA 1V7YA 2F84A 3KRSA 1DBTA 1S5WA 3W3OA 4NX0A 2X2GA 2ZQ0A 1FXPA 1KM0A 2ZRVA 4CCCA 3G1VA 3FEMA 3W2LA 3W73A 3WK1A 4O14A 3M0ZA 1EPXA 4LRSA 1ZAHA 3EWYA 1I4NA 4JTHA 2DORA 4MJMA 5KZMA 4BFAA 1OFQA 3UWVA 4H6KA 1RR2A 5AYYA 2QJIA 1E51A 3QW3A 4O57A 1SW3A 4BWLA 3NL5A 1G67A 4BI5A 3CT7A 3TV8A 3SJ3A 4LTSA 3DGRA 2Y7FA 3RF9A 3FKRA 5EKYA 5HWJA 4IJBA 4MOZA 1OFDA 1Q6RA 4N9EA 3VE9A 1VCVA 3W7IA 2YR1A 2Y7EA 1C9DA 2J9ZA 1H1YA 3A5FA 4RCXA 3G22A 1H61A 3UWZA 1ICSA 1X6UA 1LBLA 5D05A 3EXSA 4QNWA 1VR6A 2WV8A 3EWZA 4UMBA 2PRMA 3NM3A 3K30A 2EAWA 1GQNA 1KBJA 2J6XA 1LBMA 5I3IA 2Z0IA 2YFOA 3TK7A 3HGSA 3MHGA 3AO0A 3SY5A 1FWWA 2RDTA 3ABRA 3B04A 3C56A 3NPUA 1DOSA 3BGGA 3VCRA 2H8XA 3R5EA 4KFPA 2V2DA 5CKSA 3LV5A 1W5OA 3NVTA 4U28A 1WOAA 1H7RA 3S5ZA 3CHVA 4X22A 3UQNA 1UASA 3C2OA 5D03A 4PL1A 3W2MA 3NG3A 4DPPA 1XBZA 5HWMA 3S42A 2DZSA 1OYCA 1PIIA 3A9IA 4AF0B 3SGUA 3C2EA 5IBXC 4K36A 3TSBA 4UR8A 2Q8LA 2BSLA 3QRHA 3PC0A 2V9DA 1TQJA 4Z1DA 1EWDA 1HUVA 1MEWA 5AB3A 3PBVA 1IIHA 3FOKA 5F2MA 2TYSA 1TPEA 3LXCA 4NNCA 1SUXA 1YTEA 4JTEA 5IM51 3M5XA 4J9JA 3LHUA 5K9CA 3W1PA 1FUYA 2ZBTA 1SQ7A 4LS0A 2E77A 5E93A 5F1VA 3TSDA 4YL2A 1DJNA 3T44A 1LRQA 2FB2A 1D3GA 3W74A 1W31A 1KV8A 4NT0A 4O0ZA 3W1AA 1VLWA 1FXQA 3MYOA 3W1XA 1SW0A 2H6RA 4N6EA 5D09A 1YDOA 3MUXA 1SZGA 3USBA 3UY8A 2NXIA 1D3HA 5CPNA 4FHAA 3F1QA 1VQTA 4K37A 1VGAA 4PODA 1TPDA 2YFNA 5F4SA 1X7FA 3G18A 1KFJA 5IBXA 3CM4A 2WPBA 3BLEA 4JS3A 2XN2A 5EYWA 1JCNA 2CLMA 3BG5A 3T4CA 1ONRA 2H3BA 2A85A 3BLFA 1I2RA 2NUWA 4IOTA 2HS8A 1SZEA 3ATZA 1Q6QA 1EP2A 3LHYA 1OYBA 3FLUA 1TTIA 3LRMA 2CLEA 2G95A 4HN4A 1LROA 3IIPA 3DZ1A 5CZ0A 3WJWA 2NUXA 4CCEA 2V2HA 3OEXA 3NQVA 3LCWA 2QUVA 3G1XA 3LCXA 2GVLA 1WOBA 1GPWA 3P8IA 4O12A 3W2NA 2AQWA 2WSYA 5LNUA 1A5CA 3NQ2A 1SFLA 1UJPA 1OFPA 4I7WA 2X1UA 2WOQA 3C4UA 4HPXA 4OGZA 5EPDA 3UWWA 2C6QA 4R34A 3TAOA 1N8FA 4LUJA 3W76A 3N14A 3LBMA 4FNUA 1MSSA 3TA6A 1G6CA 3ANYA 1MZHA 3QPZA 2V30A 3LI0A 4GUIA 2PCQA 2D73A 3QW4B 3U6WA 3CTLA 3GXTA 3L5LA 3W75A 4JN6A 1EP1A 3ABQA 2NV1A 2GUUA 3G1DA 1XI3A 4LU0A 2CZ5A 4Y8FA 5FEZA 2HMCA 3KOFA 3UXAA 1M7PA 2JKPA 3TMLA 4MZ8A 4GFSA 3L0GA 4HIBA 4EWND 1KTCA 4X3ZA 3P8JA 2QDGA 3EX6A 3MHUA 3L65A 3TJXA 4JY8A 4PH6A 1XM3A 1J5TA 3IIXA 5AHLA 1PL9A 3HQ1A 3LXBA 2ZA3A 4LOCA 4FX6M 1JCYA 4JTTA 2QCCA 3DHFA 1QNVA 4AF0A 3O06A 5FF7A 5LNSA 3SIZA 4MY9A 2NXHA 5I3GA 3ZWSA 1IIGA 1G4TA 1TPVA 3C2VA 4NJIA 1WA3A 4JTIA 4NXKA 3W7HA 3Q2DA 2ATSA 4AMAA 3TR2A 4IMDA 3IIOA 5EBUA 3NPXA 3CEUA 1R47A 3M1ZA 5AC6A 1NFBA 5H91A 4UFMA 3W71A 4S2BA 1FQ0A 3PM6A 4XKYA 1KM5A 2GPTA 2V8ZA 2BXVA 1LLZA 1DVJA 1W5QA 1MO0A 4Y90A 1VHCA 3TAKA 3UZ5A 4UTJA 3T55A 4RXGA 4CQ8A 2FJKA 1YXDA 4MKNA 1L6YA 3TQKA 3RLVA 3KFTA 2YSWA 3GX9A 4YCOA 1JR1A 4NUWA 3BW4A 1H50A 5CPMA 4CQAA 1G4PA 4RR4A 5LNWA 2NX9A 2RHGA 4XTDA 5AHIA 4I7VA 3GLCA 3STFA 3LM7A 5FEWA 5SWUA 4UTWA 3W07A 3NL6A 3MP3A 3BO9A 4FNPA 3S8HA 3DH7A 2V82A 3LCGA 1D9EA 1HG3A 2ZCGA 4JEQA 1OFOA 3W2KA 3UWQA 3QMSA 1AG1O 1O60A 1VCGA 1EA0A 4ICNA 3DBPA 2YDAA 5E0KA 3P5ZA 2C1HA 5G2IA 2Z6IA 1ZHAA 3GVGA 4FEZA 4MJZA 4MVAA 2ALDA 3PWAA 3DENA 3P84A 3WK2A 2I9EA 1G7UA 2BZNA 3LB0A 3GNDA 3QMTA 1LRNA 3T7VA 4LVGA 3STCA 3FJLA 1LOLA 3GR8A 4GUGA 4UNLA 3NPWA 2YW4A 4FNTA 1FCUA 4G1KA 1T0OA 3I7SA 3QEZA 4O8RA 3I68A 4LVBA 4JXCA 2DU2A 3P61A 4Z0JA 3ELFA 2VFDA 3HG3A 4TO8A 1LORA 1TYGA 2X1RA 3B4UA 3FFSA 5F4WA 4P2VA 5I3HA 5H2ZA 3PY2A 3HIJA 4UFJA 3EB2A 2Y62A 4MLJA 5HWNA 4D2JA 4K8EA 1W3NA 4UTUA 5HR6A 2QCEA 5HMSA 3OIXA 5J5RA 4AXKA 4NZJA 1OX6A 3UNDA 3E9AA 2Y7DA 1P0KA 3NPVA 3QMRA 2FPYA 1EUNA 3TE9A 3NL2A 1TJPA 3FYPA 5L9FA 3FIGA 1LOQA 4WOZA 2E5BA 5DLCA 5FESA 4N6FA 2E6FA 1K8ZA 1S5VA 3PSWA 3QSRA 4RX0A 2V0TA 1H7XA 1I8JA 1F6KA 4CNOA 5KMYA 4ZQMA 3M47A 4WUIA 2CW6A 3TW6A 3VE7A 1LLWA 1C8VA 4HNUA 2V81A 4XUGA 1GG1A 1RV8A 4GBUA 3I7QA 4E0CA 1SZNA 1TREA 3NNTA 3R13A 4O10A 4PCFA 3EX2A 1EB3A 3OVRA 3HPSA 1FWTA 2WKJA 1WV2A 5BOOA 3HMJG 3DFPA 1N7KA 5BRBA 2VFFA 1B9BA 4IPJA 4M19A 5AOUA 4QQ3A 4U4MA 3MBFA 1FY6A 2J88A 1GYLA 4M6QA 4O53A 1GWJA 1W8SA 3OVQA 2NXGA 6ALDA 1ZENA 3CB8A 2ZYFA 1IF2A 3H55A 2HS6A 3IVUA 3F4NA 2RFGA 4JY9A 1LP6A 1WYIA 1Y0EA 4JIPA 2E6AA 2I1OA 2RKXA 1K02A 1F5ZA 2OX1A 5A5WA 5G4EA 4C1KA 3S1XA 1V5XA 1O5XA 1SW7A 2J9XA 5TIMA 3BW3A 1LCOA 4JTGA 4CCDA 4UTTA 2NUYA 4JICA 2FIQA 3IVTA 4UTLA 4HKPA 3TQVA 4FNSA 3EWWA 1VS1A 4CNNA 3LV6A 2WNZA 1UCWA 4KFNA 2ZZ1A 3O16A 4FX7A 3LHVA 1RPXA 2ZZ4A 4UUIA 3LLFA 1H5YA 3HJZA 4PC8A 4NNAA 4DF2A 5LHEA 2A1YA 3N34A 2QCFA 2VFGA 2NV2A 3O1NA 4HNVA 2J27A 2Y63A 1XC4A 3LRKA 1H1ZA 1JRBA 5K9XA 1OG0A 1JCXA 3M5ZA 2QDHA 3C0JA 1J4EA 3MP4A 4OBTA 3LHWA 2YGYA 4JYFA 1JUBA 3HF3A 3TQ0A 1NF7A 1ZFJA 4AB4A 3LXAA 3F4WA 3W23A 5D33A 3W86A 3U2OA 4LT9A 1YXYA 3P80A 3GDMA 1EEPA 5CGQA 4FNQA 3PBWA 3WJSA 3NQEA 1SSDA 4Q4KA 4FXRA 2QCDB 1GTHA 3G3MA 1F73A 2C3ZA 4IXHA 4N9CA 2Y6ZA 4GRSA 1QWGA 3VNDA 1W3TA 2Y7GA 1BTMA 1KM4A 1NVMA 3BK0A 4FXSA 4BK9A 1SO5A 1QO5A 1KFEA 2E6DA 3L68A 3R12A 1W3IA 3C6CA 2RDUA 3GZ3A 3DFNA 2C13A 4JGDA 4JTSA 5D38A 1AW2A 3NZ1A 1L2UA 2O7QA 4Y9AA 1H60A 3LDVA 3TU9A 1KM2A 4MFEA 3W1RA 5DY2A 4XBSA 2CFFA 1FWSA 1XL9A 4Q32A 4JX4A 4IMGA 3TC6A 1L9WA 2HTMA 2J24A 3IGSA 4GE8A 1WXJA 1K7EA 4RXFA 2C15A 4UFHA 4M6PA 4WOQA 4MUZA 3LHTA 4H3DA 2ATMA 4OQVA 2A6LA 4KKXA 4O11A 3DKLA 3GB6A 3P7YA 3UWUA 4PA8A 1A5SA 4MY1A 4WJEA 3Q58A 3SGZA
chains in the Genus database with same CATH superfamily
1GOKA 4W9TA 3GDBA 3ITCA 1OD0A 3QHNA 4LS1A 3UGRA 4DNMA 5AFDA 2WNWA 3SM0A 2YCJA 4MHBA 3QKZA 3FJ6A 4H9ZA 2WMIB 4A35A 3TN3A 4UWMA 3QC0A 4V28A 1GVFA 4XTIA 2XIOA 1MI3A 1PIGA 3EOLA 3WF0A 2FVMA 1XPGA 3VMPA 4FIQA 4A8RA 2Y61A 1EWEA 4NU7A 3F7JA 3U57A 1VB9A 3CHFA 3ZT5A 1US2A 1PX3A 4MB4A 5HMFA 3BLLA 1L0PA 5I79A 4HHPA 5A6TC 1GQIA 1QPQA 1P5BA 1GKPA 2VCBA 1OHLA 2DIEA 3KVLA 4O1AA 3GU1A 3AS0A 1UR3M 4XO7A 5A8GA 3O6YX 3WQWA 1TQXA 1UW9A 3S2JA 5F4XA 2IQTA 2YX0A 2PP1A 1KRCC 3QYSA 4MDPA 5KZEA 1R2SA 2AQVA 4I9MA 1CXEA 4DJFD 3UW6A 1A0EA 2OX4A 1J93A 4W93A 4GY0A 2J7DA 4BQ2A 3U8GA 1DJZA 4MAZA 3S2MA 3WLIA 3WFLA 4F79A 2X41A 3TJ4A 1A0DA 1KRMA 1M7OA 4K39A 2ACUA 4YIWA 3T6CA 2YPIA 4HHHA 3W70A 4DF1A 4GIAA 1UD5A 1YTKA 3IUDA 1XKYA 2CLLA 3CV6A 2XVKA 1UPPA 5BMWA 4GD0A 3B0YA 5BW6A 4GHRA 3SDOA 4K8HA 2GQ9A 1WKDA 4PMRA 4GUHA 4CVWA 4K8GA 3KVKA 2VVSA 2W79A 4M7TA 5BYWA 5AC4A 4NZ5A 1A53A 2W66A 4IMEA 3R8RA 1E55A 4NY2A 2EHHA 5AVHA 3VIGA 1EJWC 5F2LA 3WQDA 1QUMA 2ZUTA 1ADOA 3GDRA 3NA8A 1HJWA 3BOFA 3OYXA 2FFCA 2FHCA 4O50A 3O0FA 3QZAA 1VYSX 4K68A 3IV3A 4PRWA 2ANUA 4DXVA 4J28A 1DORA 1BWLA 3WH5A 5JU6A 4IMFA 1R3SA 3GKAA 1J5SA 3HFTA 4IPPA 3LUTA 2WCSA 3C0QA 1FDZA 2OZ0A 1EBHA 1R3YA 3PG9A 5AHEA 1W1ZA 4GQQA 3W7LA 3EA1A 4Y9MA 4WIWA 4JDBA 4QP0A 3VDHA 4I6KA 2PUZA 4FO4A 4LVFA 1XBXA 2H90A 3LD5A 5IOBA 2DDXA 1PHWA 3IJQA 4JTUA 3RO8A 4B4HA 5C6MA 3KOWA 1DKWA 1GZ1A 1XJBA 1BKHA 2DT3A 5U7SA 1RVKA 2A3BA 3SSZA 3W7KA 4R85A 3OGVA 4XG1A 1MFUA 1RZMA 3PBUA 3WBYA 3MBDA 3IAQA 4U10A 3A24A 4HU3A 4NJKA 4LC8A 4WHBA 1SPQA 3V5CA 4S3KA 1R30A 1PWLA 1HVQA 3W0KA 1ZGDA 1PV8A 4QIUA 3WLKX 3RR1A 3S5OA 4OUEA 3SAZA 1JUEA 1DQXA 5DRCA 3GAYA 3HN3A 3D0CA 4R88A 3W2JA 1NOUA 2WNNA 2I5IA 3VOIA 1F3EA 1PJ9A 4TXEA 4Y9PA 4FI4A 4N42A 1HIZA 2DY3A 3W7DA 2HVNA 3CO4A 1AJ0A 1DIOA 5EMJA 2O0TA 4RL3A 2DZAA 3W7JA 4B5XA 1UB3A 1XYLA 3EB3A 3J7HA 3WLRA 3MB9A 1KD0A 4LB4A 4A22A 2GDVA 3ALFA 4IX2A 4R7WA 4W4QA 5BU9A 1OBAA 3E0VA 4H8NA 2Q3OA 3IEBA 3RLGA 1T8QA 2WCAA 4D6IA 4YXGA 1DPMA 4LQ1A 3T0CA 2DQWA 3VD3A 2PDGA 3B06A 5DBTA 4ERGA 1TA3B 1DWFM 3OTRA 5ECUA 2E09A 4UTMA 2QJNA 3NEVA 4R7OA 3EWDA 1X1ZA 3H2NA 1KTBA 3RCYA 2J4GA 4MG4A 3ABXA 3TYBA 4Z1AA 4RV3A 5J04A 5CSYA 1FCQA 2ONEA 4H9TA 4ZEPA 4H01A 1KGXA 1SJCA 4Q3MA 5GNYA 3PJUA 3FGCA 3PB2A 3R10A 1GOOA 3FCPA 1K7XA 5M17A 1SU5A 3BURA 2G97A 3WK0A 3T40A 3KBMA 1JI1A 3L9CA 1AMYA 3F5KA 4UFIA 1W54A 4WF7A 3W22A 4LUSB 3K46A 3JUGA 5HR7A 3BL3A 2IKJA 1M04A 1W17A 1F3WA 1XDLA 3GTHA 1X8FA 1BVWA 1W9PA 3LCLA 4TOQA 2BY0A 4ERAA 3T8LA 3QN3A 1TVPA 4GKLA 5AC8A 4NRRA 2WCGA 2BVYA 4AD0A 1S1PA 3DFTA 3H54A 3CAKA 2Y4SA 2WC7A 3NWRA 4GZJA 3L7RA 1GYNA 5A69A 5DMLA 2G3MA 3H2OA 1H49A 2PAJA 2BODX 3DFOA 5KINA 2HISA 2J8TA 2W61A 3OOQA 4AZGA 1BXBA 4NX5A 2OMAA 1UR2A 1F8MA 3TA9A 1OX4B 1CCWB 3MSDA 1ZJIA 8RUCA 1QPOA 4F0LA 2O56A 1EDGA 4XD5A 2QT3A 4YWIA 4HMCA 1UUMA 1Q3NA 3SN1A 5A6JA 5D9OA 5HQLA 1GORA 3GU9A 2J9YA 4FIRA 2PDIA 1BRLA 1XLKA 1TPUA 4E2OA 1XUZA 3IGXA 1TO3A 4OWGA 2DFAA 3PBYA 2DQXA 4N9DA 3MU7A 3WLMA 1ZZMA 3PTMA 4IUOA 1XH2A 3UFYA 3K1GA 4S23A 3G0SA 2VL4A 4DVOA 3MKCA 3HZ3A 1EKOA 1HO4A 3NM1A 1OCQA 1I1XA 1RQEA 4XZWA 1C92A 2YXGA 3TTQA 1KFBA 1NOWA 1HJVA 5J5DA 3OLIA 3VFLA 4HA0A 3RPTA 3IK4A 2WMHA 4D6EA 3OIHA 4GYKA 4IM4A 2XZ7A 2FZMA 2VOTA 4PUUA 1DIKA 3G1YA 3JVAA 3MW7A 1PX4A 1D8CA 2CC0A 4DBWA 1CBGA 4MKVA 1UWUA 4PEKA 1MEIA 3WFAA 2VGBA 2OJPA 3UG5A 4DQWA 2NX3A 1RVGA 2DVXA 4B3ZA 4TU1A 4CVUA 5TNVA 4KEZA 5FKYA 4H4IA 3TYDA 2VURA 3BE7A 4ZXLA 2Z1BA 4ZQOA 1VKFA 3QLDA 3S9ZA 1I75A 5C9XA 1JCLA 5IHRA 4C6FA 1QK2A 1X97A 3WDJA 1TUFA 3M41A 3G8RA 3EPOA 3MA8A 1FWGC 2V5BA 1AW5A 3EMCA 2G3FA 1QDSA 3DYOA 4WQ6A 4HHLA 2JEPA 4GABA 3APYA 4QSFA 5A8QA 1IT8A 4EACA 3IJ7A 4BF5A 2B81A 4GX9A 3GWQA 2JF6A 2ABAA 2WLYA 2PDLA 1OFEA 4XQ6A 3USZA 4C6CA 4MPKA 3UERA 3LS9A 3W2UA 3MANA 3UP8A 2JE8A 1IXPA 2YYTA 1ZSXA 3KX6A 2PDBA 3VDBA 4E2DA 2PTXA 2ZIDA 1BHGA 1M9HA 5H8PA 1V6YA 4S3AA 3SCWA 3EAUA 2O9OA 4GA8A 2VTFA 2E5DA 3DFSA 1H7PA 1Y5XA 5FEPA 1W91A 4U5IA 2QGHA 3WQ4A 5HINA 2Y2WA 1HZYA 3HPXA 3I6EA 3OZPA 1XG4A 1CENA 4QBXA 4DZIA 4R5EA 3R8HA 3NO5A 3KS5A 5D8ZA 2NZLA 1X1OA 3GZAA 2HVOA 2E7FA 3V16A 2BDQA 4GFIA 1TR1A 5BCAA 5DCBA 4TMCA 1UYQA 4Q8MA 4D1IA 4JTAA 5FF4A 2F7FA 4UNKA 1XISA 1XGZA 1VYRA 2V63A 4AHPA 1TTJA 4KF1A 5K4XA 1I60A 4DLFA 4PMZA 1EC7A 3N2CA 2BOEX 4ZQRA 1W56A 1Q7MA 1WUFA 1KW1A 5LIYX 1UMLA 3KEHA 3NIYA 3GG8A 2B7PA 3RMJA 3HV8A 2HBXA 5DMMA 3RU6A 3R94A 4E5TA 2V2CA 3TXVA 2CLHA 3DHDA 4O8AA 2PD5A 1Z42A 2O92A 2HPMA 1MQRA 3PZNA 2Q09A 3DUGA 3CB3A 4TVDA 3AU2A 5K7JA 3DDMA 4Z1BA 3E0FA 3R11A 3UNTA 3B9AA 4HYWA 3E2QA 4W7UA 5CPOA 1BKSA 3KBNA 1YDVA 2R94A 4L7ZA 3VOCA 1I0BA 3QLLA 4K38A 1B0IA 2DUAA 4HSNA 1XQLA 2F6KA 2ZWYA 1PAMA 1UR0A 3I3BA 6TAAA 1T41A 3ICJA 2EPNA 3H70A 9XIAA 2VHLA 5HNUA 3A23A 3PG8A 3RNDA 3VIFA 2Q8ZA 4UMAA 1B30A 3OG3A 4QEHA 5M5DA 1XLBA 4LAKA 3PJWA 5C9WA 4YMZA 3WQOA 1DJGA 3OBKA 3WH8A 3AJXA 4JIHA 2D24A 4IGNA 3BJFA 4GC4A 1TFVA 1ZY9A 3P60A 3TW9A 3VGFA 2XFFA 1MZRA 4WDUA 4PSPA 1EQCA 2PD9A 3CH0A 3MTWA 1GVYA 5DY3A 2E68A 5DO8A 1IR1A 3SZ8A 3HG4A 5C5YA 1KGUA 5EB8A 1TPC1 4LV4A 1IZKA 2UV8G 1EJVC 3ITXA 3E12A 2X0YA 1RY8A 2Q71A 2P53A 4UQEA 4WD0A 4GIEA 3SFKA 4PEEA 2AMGA 2EPOA 3VKJA 4MIMA 1VFUA 2G37A 1OGBA 2P3ZA 4ADUA 3CPUA 1GJPA 4U3CA 5FL1A 1ZALA 2YDSA 3TXZA 3O05A 5D37A 1Q13A 5D9PA 2OELA 4EF8A 4MWAC 4A8NA 3W29A 2X1SA 3HGJA 3CAQA 4HN8A 3SSJA 4JBRA 3LRLA 1O5KA 3NQ6A 4RDWA 5CXPA 4Q8UA 1EL3A 1YE6A 1MNSA 2J79A 1H1NA 2POTA 1ICQA 2YXOA 4PTWA 4DWSC 3GVWA 3IUIA 1QHPA 4LUYA 1GZJA 3IIZA 4AZCA 1GQLA 1GTEA 3VKDA 1NF0A 3B05A 4GO8A 3N9SA 4O19A 3H2FA 1ML1A 2JKAA 3WQ6A 3WDHA 3SQSA 2R9RA 1VFFA 2DH3A 3O8AA 1WDPA 5LA2A 1O5RA 5HXMA 4XVEA 1AQ0A 2XIIA 4YTRA 3UD6A 1EJUC 2DSUA 3C2YA 3WLSA 1C7TA 1GKRA 1TB3A 3BXWA 1Z48A 3AZTA 3VUSA 1TPWA 1AJZA 3W7NA 2J47A 2FYMA 2V3GA 5B80A 1XD1A 4H9MA 5LNVA 4IJCA 2Q3RA 2FTPA 4XISA 2Z24A 4LYRA 3F03K 4M1RA 4RZ4A 5A6SA 4B5VA 5T9CE 1I2NA 3UR5A 1WZAA 1R3RA 1S2AA 4C6BA 2RDXA 2C14A 4LWWA 1MDLA 3P74A 1I9CB 5ABFA 3DIPA 4L1WA 3UXLA 2WVTA 1FH8A 1KR1A 5AHNA 4ZO7A 3PZVA 2PRLA 4URIA 4YCPA 1FVPA 3E5PA 3GXNA 3UT0A 1BGAA 1KFKA 4WJ8A 3ZFHA 4GYJA 1W5MA 3QPEA 1LUCA 3FVMA 1XV8A 1T5AA 4I7UA 3A22A 1P0BA 3MJYA 4XSLA 3TJLA 1QOXA 1EGMA 4Y9OA 1VYPX 5TQLA 1H0GA 1D7FA 4XZ9A 1GOXA 4DM2A 3I4KA 4WKAA 4HCDA 1NM9A 1W3JA 1KC7A 4QXIA 3KTCA 2FVKA 1SVDA 2BG5A 4RV8A 3ZO9A 1SO3A 2VRKA 1MXSA 2WZHA 2CITA 2WVVA 1DL3A 3OODA 3AWNA 4ROPA 1NSJA 4US5A 4A29A 4XB3A 3CZKA 4G2DA 2Y70A 1FCVA 4XSMA 1G7VA 1F9CA 4LRTA 2A3CA 1RUSA 4ACZB 4O1CA 1GVEA 1GVOA 5CPQA 4JTJA 1V7YA 4DJDC 3ISIX 4D6FA 4MWAB 1KM0A 4C1NB 5E0CA 3VDAA 1F3TA 2PU0A 3H4WA 3W73A 4O14A 4KT2A 3ZJ8A 3VNLA 1EPXA 4LRSA 7ODCA 1I4NA 4ROQA 4YNGA 1OFQA 3F4VA 1AD4A 4ICMA 3QW3A 4O57A 3RUBL 3TV8A 3SJ3A 4LTSA 3RF9A 2P88A 1Q5MA 4N9EA 1OFDA 1Q6RA 1OCBA 3VE9A 3H12A 3W7IA 4D72A 2Z4GA 2OZ3A 2QDDA 5C70A 1C9DA 4J27A 3U2ZA 4G7EA 3SCRA 1LL7A 1P6WA 4B92A 3UWZA 2JALA 1ICSA 2PC8A 2W3ZA 4QNWA 5BRQA 2XJ7A 4JIRA 5IFTA 3FNDA 1YPXA 4FALA 4JL2A 4O1EA 3MMUA 2DSVA 1B3VA 3AO0A 5DF0A 3WCZA 4JIEA 4IL2A 1KQZA 4M3PA 4OUIA 2PS2A 2PZ0A 3VCRA 2H8XA 3BLKA 5CKSA 1E1EA 4U28A 1WOAA 3ZJ6A 3CHVA 3C2OA 4DPPA 1XBZA 2R1LA 5HWMA 2VGGA 5IBXC 3AHVA 1VPYA 3C2EA 3MT1A 3V0SA 3FJNA 4AY8A 3SGGA 3NSXA 1AQHA 2XYLA 4HYVA 2RGLA 5D9MA 3CL8A 4Z1DA 2WM0A 1MEWA 1HNYA 1QPKA 3EDKA 5F2MA 1MW2A 2TYSA 3ZYZA 4BQ4A 4D8AA 2SFPA 4NNCA 5FJPA 1EJRC 3E3HA 3SRFA 3CPGA 1JDFA 4J9JA 1FWEC 3BMXA 4MNKA 2NLYA 2E77A 1NARA 5DX7A 4JTCA 5F1VA 4YL2A 2WMGA 2VEFA 1KBBA 1LRQA 3RM9A 2HZGA 1D3GA 2WPGA 3W1AA 1NOFA 1VLWA 4MNMA 1W9XA 4N6EA 4C60A 3TOYA 4L61A 3USBA 1E6XM 2ZX7A 4IICA 4H1ZA 5CPNA 5HA7A 4K37A 3IGHX 1TPDA 1X7FA 1KFJA 2WPBA 4WSJA 2X40A 3UZYA 1ZBCA 2XN2A 5EYWA 4UR9A 4K1GA 4ZOAA 3GS6A 1ZUAX 4H7CA 3K4DA 5A2CA 1I2RA 2NUWA 3LQLA 3THCA 4S3EA 1Q6QA 2JF7A 4JFWA 1IHIA 2D2JA 4MWAE 2CLEA 3KRBA 3CZ8A 5C9RA 3WJWA 3LPPA 1OT1A 2NUXA 2NT1A 1KRBC 3NDZA 4GXPA 3VIJA 1WOBA 9XIMA 4Q4MA 1GPWA 3P8IA 3W2NA 2BY1A 3B40A 1MFVA 4HPGA 1MWOA 3BQ5A 4JEJA 1J6OA 1JEZA 3K4AA 3TAOA 1F3XA 4IIFA 3W76A 4FNUA 1MSSA 2ZKMX 5A95A 3ANYA 1MZHA 3LI0A 3B9NA 2D73A 3VD9A 4PTXA 4DJDD 3S6TA 3VD7A 4DUXA 3N18A 1EP1A 2WJDA 3ABQA 4I90A 2VT0A 2REQA 1W3HA 4LU0A 4CQCA 4MAVA 4GGBA 3UJFA 5MKGA 4FOJA 1KTCA 4QG8A 3P8JA 1P0DA 3GFZA 3EX6A 1QATA 4B9YA 4EXAA 1XIBA 2VO5A 2E40A 2WKGA 2Z27A 4P8VA 1J5TA 3IIXA 2OGYA 3HQ1A 3VUPA 3GY1A 2ZA3A 2OSXA 3UVIA 1NWUA 2FTWA 4YTQA 1JCYA 1AQFA 3EBVA 1GJWA 4S38A 4AF0A 3SIZA 2QLYA 1YNYA 4MB5A 5I3GA 2Z00A 4LGXA 3Q2DA 3IIOA 1YBQA 3NPXA 3M1ZA 5AC6A 1NFBA 1PYMA 3UG3A 3W71A 4CU6A 4XKYA 1KM5A 4KMQA 2GPTA 3RIKA 5LXXA 2V8ZA 3MVTA 3SB0A 3Q67A 2AMXA 1XLHA 4LEQA 3U7VA 1XIIA 4RXGA 2V5DA 3S6OA 3H2CA 6A3HA 3URBA 4CNUA 4QLJA 3HQPA 3GX9A 2IKGA 3GW0A 4DYEA 3ZT7A 3O2LA 3AIBA 4V1XA 3I10A 1E56A 4YYCA 4RR4A 2NX9A 4LEFA 1UROA 4IIDA 5E9AA 3DH7A 4KIRA 2ZUVA 5E70A 1FFQA 3W2KA 3ENLA 3QMSA 1VCGA 1O60A 1EA0A 4PBEA 3DBPA 3IANA 3P5ZA 2VWSA 3GVGA 4MVAA 1F61A 4AXNA 3DENA 3ARRA 3P84A 1UR1A 2CKRA 3VCCA 1G7UA 2BZNA 4B4FA 1DTNA 3STCA 2XH0A 3GR8A 2HQAA 1WUEA 2ZC8A 3WLQA 1NDYA 4HA4A 3QEZA 4C6NA 3I68A 4LVBA 1PX8A 4JXCA 2DEPA 1UHVA 2AL2A 3P61A 2PEVA 5A6AA 3HG3A 1XIEA 1TYGA 1L8NA 3FFSA 3RJYA 3CV7A 1XH0A 1Q2RA 4P2VA 1EF2A 3H2EA 1JCTA 3R43A 4UFJA 2Y62A 4C7GA 4D2JA 1W3NA 4UTUA 4NZJA 4J2PA 4PMOA 2XHYA 3UNDA 3MCMA 1P0KA 3R4IA 3NPVA 3SN4A 2J8FA 1EUNA 1B3YA 3EYPA 2W62A 2GJRA 3Q65A 3CXOA 3FIGA 5FESA 3TTSA 1XYBA 3G6LA 3QSRA 5M3WA 3PANA 1H7XA 1E5JA 2GJPA 4HOWA 3BC9A 4FP1A 3AYSA 4AWEA 1LLWA 2OPJA 4HNUA 5DMYA 1RV8A 1UWSA 3N1AA 1TREA 3C0SA 4WKHA 4PCFA 4C90A 1KNWA 3M0LA 1FWTA 5LIXX 4RE2A 3HMJG 3WDRA 1VFHA 3DFPA 3GHUA 5CC3A 1N7KA 3BLOA 4M6QA 2D2OA 3OVQA 1L6FA 2NXGA 3NOYA 2YJQA 1PPIA 2F8QA 2ZYFA 5D4YA 5ABEA 4W87A 1GVIA 1WYIA 2EEXA 5HPOA 4JIPA 1HN1A 2RKXA 3ZVIA 1F5ZA 4C1KA 2IKHA 3S1XA 4W8BA 1K6AA 2QNEA 3AZSA 3M0IA 4I5RA 4AZHA 2V38A 3LGDA 3VC6A 1F4AA 2NUYA 4JICA 3F2CA 2QDEA 1ENUA 4UTLA 2OKOA 1BGGA 5HJYA 3VOFA 4J40A 4CNNA 1C8QA 3PJTA 1NTHA 4KFNA 5A6MA 1W8GA 4IGMA 4D6JA 1E40A 1BFNA 4NNAA 2J77A 1PZ2A 4PMNA 2A1YA 3N34A 3LSCA 5FJTA 3O1NA 2PF8A 1PZ3A 4L65A 4Q8WA 2CXEA 3OPSA 5K9XA 2G50A 1GYMA 5AYIA 1Q63A 3XISA 2YGYA 3MCOA 1V93A 1NIUA 3HF3A 1XYFA 1NF7A 1ITCA 4AB4A 1YDYA 3LG3A 5FAJA 2ZE3A 3ITVA 5GQBA 3U2OA 1XRSA 1TVLA 2CNCA 5FL0A 1EEPA 5CGQA 4KCUA 3NQEA 2WHKA 1GTHA 3KTSA 3M46A 4N9CA 3UA4A 1JZ7A 1L6GA 2HE8A 2Y7GA 3SADA 4G8TA 1SO5A 1QO5A 5HMDA 4CQBA 3L68A 4NSBA 4E3TA 2QMJA 1GEHA 3C6CA 3FXYA 4G7FA 1H0IA 3DFNA 4JTSA 1AW2A 2O7QA 1NY1A 4NYUA 1H60A 3WIJA 2C91A 5A6BD 1ISWA 4MFEA 3N9KA 5CJMA 3UPMA 3TONA 4XBSA 3L2MA 1UH3A 1E0VA 4Q32A 4B5SA 3WF2A 2DSWA 2YL5A 3MSGA 1PSCA 4Q8PA 4J2MA 5C2GA 4AX6A 1OC7A 2X1IA 4PUJA 4AQLA 1WXJA 4JCLA 4DJFC 4F0RA 4A4AA 5FCZA 4RXFA 5HK4A 2QQ6A 3GTXA 4UFHA 4WOQA 4IISA 3LENA 2R24A 1A5UA 2A6LA 5EMLA 4PA8A 4ZTXA 1UH2A 4QQUA 1YIXA 1A5SA 4J3ZA 4UOZA 2E6YA 2Y5SA 4ZQPA 1VPXA 3TIMA 3L2LA 4WY0F 3TKFA 2P1FA 1J8VA 3PUOA 5BRPA 5CAKA 4RZ5A 5M1TA 2ODOA 4JQ2A 3ARZA 7ENLA 1ZJHA 4OBRA 2WO5A 1R3WA 1S3HA 3SO7A 4EPBC 4CD8A 2DT1A 3CQIA 1Z44A 3M5VA 1JDAA 3IPWA 3FAWA 4NILA 2WNQA 4U5KA 3CO8A 1LT8A 1B2YA 4D9PA 2YCLA 2QCLA 4DWSD 1XLIA 3QF0A 3S1VA 2CHNA 4HZ6A 2ZZ6A 4NAFA 2ZC1A 3K13A 3QGVA 3B8DA 5LZLA 2VGFA 2B7NA 4RZ6A 2P5NA 3AALA 1K8XA 2ZZ2A 4OKDA 3CL6A 4GUFA 4MPQA 1DWJM 3SIMA 3MUZ1 1IXOA 1QI2A 1HF6A 2GDUA 4JQ4A 3QPYA 1K9FA 3IRDA 3PPCA 3FHAA 1UPMB 5CZTA 4G5DA 5BZAA 3PPGA 1VENA 1JZ5A 3BZGA 1Q4WA 3P93A 4LW7A 2Z1KA 3VINA 3VIMA 5BXSA 3TC3A 2E1WA 4S2CA 1VIWA 1XLEA 4UXDA 4AU0A 2FGBA 2YZ5A 4ATDA 4BWLC 2VUNA 1EJSC 3GR7A 1ME7A 4V33A 5TD4A 3MC5A 1TV3A 1CPUA 2Z6JA 3WBXA 3ZMRA 3PZQA 4LJ3A 3U2EA 1V6UA 3M07A 3LI1A 2VJXA 2A3LA 2ICSA 4HGXA 4DELA 1J2WA 4LBSA 4S3DA 2XFWA 3G1SA 3M16A 1Y5VA 2XN1A 4QRNA 4E38A 4U31A 3GM8A 2HBVA 1UA3A 3NDYA 4LX4A 3DECA 2VZVA 1ESWA 1VAHA 3BPWA 4Z17A 4EOUA 1KQYA 4JKLA 4REQA 4E8GA 3ZLHA 4Y9NA 2J7BA 2QGYA 3NR0A 5LIWX 2E28A 1LQ2A 3TROA 2ZZ5A 1CNVA 3OZMA 2C8NA 2WZMA 4NL1A 1GVQA 4J35A 1TJ1A 3MWAA 3L66A 3QFWA 2A7NA 2PI6A 3G1AA 4HP5A 4OTKA 1QJWA 1FKWA 1ZAJA 3MMWA 4I3GA 1XFBA 1UIOA 2BMBA 1V03A 3NQCA 2B31A 1JRCA 4US5D 2VRJA 2PTZA 3ZT6A 1V6TA 4B5NA 3B0XA 4Q4OA 3VILA 5ABHA 3LGGA 4GNJA 1KCKA 4PYSA 5K2ZA 4ML4A 1DQUA 4PTDA 3UEQA 2ZZ3A 1K4GA 4IIBA 1E9LA 4K6AA 5H6HA 4QFUA 3AXMA 1B5TA 1TV5A 3OB8A 4DPQA 2CBIA 4R33A 2FJUB 4PBFA 1KBKA 1RPKA 3GDLA 4C6DA 3QV8A 1JDCA 1R8LA 1N55A 3HPZA 2QCNA 1MYRA 3LMYA 5E0FA 3A3XA 3AMCA 1S1RA 2FFIA 4PTNA 1ODZA 1XLCA 3AQUA 3KWXA 4OOUA 1EP3A 5DT5A 3LNPA 4NKCA 1J0YA 1XIJA 1HO1A 1FP8A 3M43A 2VUYA 1H7WA 2B0MA 2GQ8A 1KM6A 3FXGA 3PBGA 3ATYA 3W88A 1NWSA 4HJFA 1XGDA 2PA6A 3B9EA 2Z7GA 4PMQA 2VEKA 4KCWA 2ZRZA 3M5YA 5GJPA 2DT0A 4GCXA 2R8WA 2YXXA 1XG3A 3URNA 5H1WA 4Q7BA 1DWHM 4ZZ9A 1LL4A 4GO9A 4X0NA 2E67A 5DEZA 3I4EA 5T91A 1SYTA 5IDIA 2NX1A 2JBMA 3O3RA 2C19A 1CDGA 5ABGA 4NI8A 2CZFA 1W1IE 2IUZA 4WXZA 4DY1A 1EFZA 3SUSA 1KFLA 2WQDA 2VZTA 2G96A 2JQXA 2XVLA 5H8MA 3N4FA 3POHA 1FWHC 5I07A 3STGA 2A6NA 2VEPA 3VZZA 1OVDA 1AL7A 2E0PA 4MFDA 5FF3A 1WDWA 2VEIA 3QQ0A 1IEQA 1OM0A 3GIYA 3QJAA 3GVRA 2INZA 1D3CA 4ZA0A 3WG6A 2ZTJA 1YYAA 5HUOA 1WXYA 1R9XA 1E43A 4C6PA 1K7FA 3MO7A 3HMCA 3DAQA 3K8MA 1KCXA 5CZSA 3OBAA 1U5HA 3ID7A 5D02A 4ZOCA 3HA1A 3URQA 3W1TA 1GQKA 1HL2A 4LB3A 4DRSA 3AC0A 2D2GA 4UTKA 3TTOA 3UJSA 1FX6A 2A7RA 1A5AA 1GGOA 4ZSUA 1YQ2A 1FBAA 2ZRXA 1BWKA 2XVNA 3ES7A 4YTUA 4RLIA 4UQAA 1AUSL 1W6TA 4J3WA 3AOFA 1PCWA 4NVTA 2XIJA 2DZXA 3W7PA 5FF0A 3JS3A 4A3UA 2GSJA 1RBOB 3H4GA 4MZYA 2DZTA 3DKJA 3MHFA 3VO0A 4WX2A 2QUTA 3KAOA 4PMXA 1NJJA 3NQFA 3BG3A 2ZZ7A 3CWOX 2C18A 1B3OA 3BICA 2GJNA 4OE7A 3GXPA 1AW1A 2HV5A 1RY0A 5G2HA 2NWRA 1S2TA 2WAGA 1SSGA 1R38A 4DZ5A 3TYEA 2QS8A 2VZOA 1OIMA 3TZFA 2GL5A 4QDPA 4ATWA 2PODA 3S9YA 1LOSA 3D46A 1FWAC 4UQ9A 1H7NA 1QNSA 3G1FA 4DO5A 1J0KA 3AWOA 3PZ9A 4FB7A 4L64A 1DJQA 3RX2A 7PTDA 5A8PA 1E6QM 3FW6A 3M0XA 3AMKA 1C91A 3K5XA 1M3UA 3DXIA 2ZRUA 2P8CA 3SRHA 1VH7A 3STPA 2BBFA 2XIQA 3SQMA 2BGSA 3L2IA 3CU2A 4AWTA 4HNOA 5EL1A 5H8UA 2GVGA 4ALDA 3VVGA 1OFAA 2QVNA 3AIQA 4PUMA 3PHAA 2GDQA 2OXNA 2VM8A 1IGWA 1DHKA 3RM4A 1Q45A 4O16A 2FLIA 3ZQ9A 4QCFA 2PB1A 2VELA 4K7VA 3IJ8A 4JTLA 1OINA 1UBSA 4PBGA 3IJLA 2NW0A 3HPAA 3A4WA 2HSAA 4QNEA 2A0NA 2I16A 4NJJA 3R0KA 2H9AA 1S2VA 3BLIA 1Q65A 2ZXDA 2OB3A 5FF2A 3WBAA 2QCGA 3HFYA 3PUGA 3U2CA 1NEYA 1RP9A 2Y8KA 1YKWA 5C8BB 5CLTA 3CZGA 4X60A 1PO9A 1HJUA 1R46A 4NJGA 3P81A 3BAIA 4MB3A 2WMFA 5CLWA 2RH9A 4F3HA 3N19B 3V3WA 4X9SA 2HNEA 1W1YA 2OWCA 2VR2A 2MNRA 5D2TA 1PXGA 2VGIA 1T99A 4FOUA 4C6QA 3DYMA 3TCEA 3EX3A 1MXDA 2J74A 4L1GA 2BX7A 3SEPA 5E1QA 3T09A 2AQOA 2PC4A 7CGTA 4KGJA 3UXKA 4Q33A 3UF9A 4DO7A 4P61A 4BF9A 2P50A 3H53A 5FAGA 4JZ5A 3THQA 1A3XA 1R9YA 3C5QA 3RCMA 4OZOA 2IPWA 3FS2A 4DJED 3U5UA 4CNPA 3RITA 1R5YA 2VMFA 3CEPA 5KSWA 3MYPA 4B16A 4W5ZA 1C8XA 3AIUA 1MW1A 2DJLA 3SI9A 1VBJA 3SUUA 3CWNA 3EEGA 2FQIA 1HJXA 2F2HA 4FLSA 4GXMA 1OCJA 2VDGA 2VX4A 3ZVHA 4OBSA 3P62A 1M6JA 1VFLA 3APGA 1LG2A 1AODA 1WP6A 3GG1A 3N2BA 3NQGA 4CEUC 1TIWA 3GTNA 2O9TA 1ZP3A 5A6BA 4TQTA 4E3VA 5E5CA 1UMYA 3WNOA 1P6BA 1GW9A 2R6OA 3DC0A 2DVUA 1BYAA 4LS2A 4TV5A 3WQEA 2QYGA 4AW7A 4Z2IA 3V0UA 2P0OA 3QR0A 5D04C 1HTIA 3HG5A 1BTCA 3BV4A 5L6UA 4H2CA 1L6SA 2GGJA 3N4AA 2VYOA 2XIMA 3VGEA 2ZX9A 1AFSA 3NXFA 1CX9A 2GVEA 5BMXA 3PK7A 3VD5A 2OT0A 3REQA 3MZNA 4FLRA 4Y96A 4AIOA 5LSMA 3V5FA 3RPMA 3QFEA 4N0RA 1W9UA 3LPOA 1R3TA 1V51A 5C7VA 4O28A 4FF7A 1OK4A 3VU2A 1UQYA 4AY7A 4TTUA 2CLKA 2WSQA 4HHMA 3GH4A 4QISA 2WK2A 1R87A 1OFBA 2XWEA 4GIYA 4F48A 2A7PA 2WSPA 4LUSA 4JQ3A 1EDTA 1M65A 3PFMA 4CUCA 4GNVA 3RLUA 4CD4A 5BXRA 3KS6A 2JKEA 3QYQA 4XZNX 1G94A 1EBGA 1P48A 2YA0A 3A4XA 1J0JA 2CWNA 1DYSA 1CI1A 1EA9C 2WSKA 3UVAA 1B54A 2CLOA 4EF9A 1E73M 2V3DA 2D0HA 5FOOA 4ZO6A 4AH7A 1VEMA 2ON3A 3G1RA 4HPHA 1QTWA 4IFKA 1EH9A 1EZWA 1RAKA 1W5PA 4TVUA 2WANA 4GJIA 4QLKA 4DWSB 6PTDA 3VCNA 2ZA2A 2A3HA 4AIBA 4C6JA 4H6RA 2QEZA 3TZNA 2VEMA 4AX7A 2TMDA 1US3A 3N6QA 3L5MA 3RR4A 7REQA 4JN8A 2EPMX 4Y6GA 1Z9AA 1U30A 4YLWA 1V3LA 2WMJA 3LN3A 4O4WA 2PWEA 1S2CA 4XBJA 1A5BA 3IVSA 1O66A 1MQQA 2O55A 3L0KA 4DJEA 1XDJA 1DTUA 4BI7A 1A49A 3UYIA 4LV9A 1MRAA 2CLIA 1AA1B 1XGEA 4RNIA 1HKMA 4MNLA 4OV9A 2BLEA 5A3HA 2QUUA 4IIHA 3YPIA 1CB7B 3VNYA 1I45A 5LNRA 2FB3A 3QV6A 3Q94A 1E4LA 3QM3A 3CV1A 1G4EA 4B2DA 2NSOA 1ZLPA 5C71A 1GEQA 4BI6A 5G2WA 4R7JA 1OF6A 2WMKA 3S1UA 1JUKA 1TPFA 3W7MA 4IF2A 5ABTA 3WMSA 4W86A 4V1YA 3BAXA 2WXDM 3KBJA 3PTKA 4J1OA 1I2PA 1Q66A 4L9YA 4YVVA 1QI4A 3V1HA 2Y5EA 3W9ZA 1J11A 3V5OA 5E09A 1FH7A 1CTNA 2ALRA 3CGTA 2ZDRA 3PVFA 2BTMA 3OA3A 1OY0A 3BVJA 3C52A 4POCA 4QJ1A 2YA1A 4BZYA 5JH1A 2PLMA 2PE4A 4A3QA 4KESA 3GC2A 2PWVA 4XD6A 3IJ6A 1T96A 1LYXA 2VFHA 2AAAA 1VBUA 4PTVA 2PDXA 1UG6A 1YADA 4EVZA 1PEZA 5AN7A 1JD9A 3NQAA 1K1DA 1UWRA 1PE1A 1JQVA 4BS0A 4E8CA 1V79A 4HNTA 2HXUA 2Z7KA 2CZDA 3BSMA 4MB1A 1UIPA 4M7SA 3EWBX 3GHSA 4UOJA 1CXLA 2DZWA 1PDZA 3UYCA 4A8IA 2PCEA 3DFQA 4FX8A 1LRTA 1ZS2A 5IXEA 5LA1A 2V69A 3TX9A 3BMWA 3H2MA 5EY5A 4QJ4B 5CBBA 4GX8A 3E2VA 3PFRA 2W91A 3R58A 4ZR8A 4XD4A 2GQAA 2J62A 3DESA 4UTTC 2DVTA 1ECQA 1AH0A 1DJYA 1QPRA 4IX0A 1PKMA 1ME8A 5CSUA 3N3TA 2CEQA 3QV9A 1J9YA 3AXHA 1XSIA 1D7KA 2TRSA 3GC4A 5C0QA 5FI8A 3KVMA 4MDOA 3G24A 4PRRA 3Q45A 2XZ9A 1V02E 3N9RA 1L6WA 2R1KA 4JQ1A 3L67A 1WQ5A 2FHFA 4Z2KA 3ITTA 3M0MA 1B57A 2VDIA 3ANUA 4JHMA 2BHYA 3MMTA 3THAA 4PRTA 4F0SA 2Y85A 1W37A 1FDJA 4E4FA 2BGNE 5CG7A 4GQBA 2GYIA 3GNNA 2A3AA 3PZUA 4ZMGA 2GVJA 1XLFA 1UWTA 2F84A 3Q4DA 1CGYA 3KRSA 2BFGA 3T81A 2X2GA 3WF4A 1MNZA 4C5ZA 1LT7A 1ZBKA 4D8ZA 4RDVA 4Q6XA 3F4DA 2WM1A 3EWYA 1UWIA 4Q22A 2DORA 5KZMA 1XPYA 3AS3A 2WBKA 4CGTA 1J0HA 4H6KA 1RR2A 2QJIA 3N17A 3NL5A 1G67A 1TJ0A 3CT7A 3DGRA 3ZR5A 3FKRA 3PTQA 3U7BA 4MOZA 3GYCA 1VCVA 1BQCA 2OOGA 2Y7EA 3A47A 1I1WA 3AUOA 4X61A 1E3ZA 3A5FA 3G22A 1LBLA 5D05A 4LUTB 2WB5A 3B4YA 3RGTA 1V6XA 3EWZA 2GUBA 3AS2A 3T0TA 5I3IA 2Z0IA 3HGSA 2GK1A 4AD5A 3MHGA 1J12A 2D3LA 3WQ5A 3C56A 2PDWA 4IPLA 3R5EA 2HPIA 1W5OA 2FGZA 1Q7ZA 3G77A 2ZOXA 1Q2SA 2AL2B 1UASA 4MJ2A 5D03A 2ZX5A 3W2MA 3NG3A 4ZO9A 4E6MA 1U2YA 2DZSA 3A9IA 3SGUA 3SN0A 4C7FA 3WLHA 1TELA 3WELA 3C3UA 4UR8A 2HXTA 2WWDA 2F6XA 3LZ5A 1PUDA 1E15A 3GXIA 1MW3A 4D6GA 4M1BA 3FOKA 1TPEA 1SUXA 4ZFMA 4JTEA 4MJ4A 2WJFA 3FAXA 5IDZA 3WD0A 3W1PA 1EEXA 1SQ7A 4NASA 5AC5A 1KGWA 1FWIC 4DHGA 3VK5A 1DJNA 1W31A 4NT0A 4O0ZA 1FXQA 4PMYA 4H9YA 5D09A 4HD5A 1SZGA 3PZGA 2VZUA 2NXIA 1D3HA 2D20A 4FHAA 2XWDA 1VGAA 1ISZA 2YFNA 3CUJA 3CM4A 5IBXA 3WLPA 3BLEA 4HK5A 4L56A 3VGBA 3QY8A 3N29A 3NUKA 2CLMA 2H3BA 1RJQA 1W2PA 4LBUA 4LCQA 3V7PA 4KRZA 2QUMA 4IOTA 2P8BA 1UKTA 3GXDA 1OYBA 3MDUA 4I8YA 5CC5A 2W67A 2P3EA 2G95A 5I00A 2IMRA 2QZRA 3DZ1A 4P7OA 4IIEA 2NQHA 2V2HA 2QUVA 4WDXA 2GVLA 3IWPA 3MQTA 3BAWA 4H6QA 2WSYA 2OR2A 4GMEA 3A6OA 1RSCA 4I7WA 2WOQA 3C4UA 3UWWA 3S83A 1UBPC 4LUJA 4U2ZA 3N14A 2HNHA 3TA6A 4ZENA 1CXFA 1G6CA 4Q6JA 4GUIA 2PCQA 5I2UA 1JPKA 3RPDA 3RMEA 3U6WA 4FMVA 5KETA 4WCJA 1GPFA 2Q8XA 4JN6A 3VMNA 2NV1A 1GW1A 2E8YA 3G1DA 1FH9A 3BAJA 2BY3A 2CZ5A 3GVQA 4C6EA 1XLAA 7XIMA 1UC4A 3IJIA 3UXAA 2JKPA 4GQGA 3D6NA 3TMLA 4PMVA 9RUBA 4HIBA 4B5TA 1BG9A 4KIEA 4X3ZA 1JAKA 2XINA 5FSDC 5CAHA 2GJXA 3TJXA 5CEWA 3PWGA 4PH6A 4IIGA 5AHLA 1PL9A 1NDVA 2PDJA 1MQPA 4DZAA 1OIFA 5FSEC 3KE0A 1LQAA 4AD3A 4MGGA 3ZWSA 1TPVA 4WGXA 3W7HA 3FJ4A 2OWWA 2ATSA 5FA5A 4F0HA 1ZP4A 5EBUA 3T2QA 1R47A 4L6DA 2FZDA 5CQ1A 1PWMA 3VTRA 2ADAA 5H91A 2DSZA 2VD8A 3CIVA 3TYZA 1PB0A 2GOKA 2BXZA 1MO0A 4HK7A 3GUWA 4UTJA 3AI0A 2QIIA 4OJYA 4EANA 4IFKB 3D3FA 4CQ8A 4MKNA 4FZIA 3RLVA 4FR1A 2O4QA 2YSWA 4YCOA 1JR1A 4NUWA 3BW4A 1H50A 4AMCA 1G4PA 5LNWA 5AHIA 2INFA 2CCRA 4Z2HA 3STFA 3P14A 4UTWA 1XIGA 3GH5A 1WCGA 3BDKA 3S8HA 3LCGA 4XZLX 1NU5A 4L4PA 3UWQA 5IRPA 2IQDA 4PCSA 1PTAA 2C1HA 2Z6IA 1ZHAA 2E3ZA 2QMKA 3WK2A 3P3BA 1E1FA 2OLHA 1EXBA 4L4OA 2CHRA 3QMTA 1H09A 1BRLB 5JBFA 1UD8A 4LVGA 3CUGA 3FEQA 5CBIA 4QG9A 1LOLA 1ADDA 2YCLB 2EG7A 2ZUMA 1IEWA 2YW4A 4FNTA 1FCUA 2Z1SA 3DBNA 4AZIA 2EKGA 1AH4A 3KP0A 4Z0JA 1H3GA 2GFTA 2DW6A 3MY9A 4KRUA 1LORA 1BF6A 3B8UA 2NQJA 4H04A 2R82A 3QXBA 3HIJA 3EB2A 2GSHA 1JPDX 4KWOA 2WZTA 4JFVA 5HR6A 1OX6A 5AZ0A 1B90A 2FPYA 3TE9A 3C8NA 3KOZA 3D5HA 4LSBA 1LOQA 1K8ZA 1S5VA 2OSYA 5KMYA 1JGIA 4ZQMA 2VVNA 4WUIA 2CW6A 3TW6A 3VE7A 4IJRA 1RD6A 4XUGA 1GG1A 2L5HA 4GBUA 4J7RA 3WNLA 3TP4A 3THUA 1B1YA 1RA5A 3WEOA 1WV2A 1Y7VA 4F9JA 8XIAA 4M19A 5AOUA 3MBFA 2J88A 4KCVA 1U1JA 1GYLA 5I0DA 1E6RA 4W7WA 6ALDA 1ZENA 5B7ZA 1TV4A 3BTNA 3T0DA 4AZBA 2RFGA 4JY9A 3POCA 4DXXA 1ZTVA 3ABZA 1TWZA 3NYDA 1O5XA 1TUXA 3MCNA 4CCDA 3OVGA 4G7EB 4PMUA 5DRIA 4FNSA 3EWWA 5D8WA 1MW0A 3LV6A 3SQLA 1UCWA 4EK7A 2ZZ1A 3LHVA 4GPNA 4UUIA 1V4YA 3LLFA 1H5YA 4PC8A 4HA3A 2HVMA 4DF2A 4MUPA 1K70A 3EZ4A 4YU1A 2QCFA 2VFGA 2NV2A 3VIPA 2CXGA 2J27A 1Z8AA 2VX6A 5LYRA 2I5QA 1JRBA 2YL9A 1XRVA 5I24A 2GVYA 2E9BA 3DYPA 3ZIZA 4LCSA 4IHCA 3EMZA 3CASA 3A9BA 3UR2A 1CEOA 4P7NA 3WMBA 3VX0A 1U1HA 3FX4A 3MV01 1Z69A 3LXAA 3F4WA 5D33A 4PUEA 3W86A 1YXYA 3P80A 3GDMA 2XM2A 3PBWA 4AISA 3RG6A 4B2DD 4JTDA 1V77A 3OA5A 4EXQA 3NZGA 2C3ZA 4H41A 2Y6ZA 3N15A 3ZZ1A 5HJXA 5FJOA 2WHLA 1TV2A 4ACYA 1MVYA 3OHMB 1QW9A 1KM4A 1JZ2A 4AZ6A 4FXSA 2VD9A 1VBRA 3PZIA 4DWSA 1KFEA 4EAMA 3ARWA 1FWFC 3S47A 1NH6A 2RDUA 3UGVA 4PB5A 4CCZA 4JGDA 1WZMA 2J78A 3NZ1A 1L2UA 4QEEA 4Y9AA 2FGLA 3VX1A 1B3ZA 3ECQA 3LDVA 1RJPA 2NSXA 3WH7A 3WENA 3W1RA 4QE4A 1Q6DA 3BANA 1Q4NX 1DJWA 2CFFA 4RPQA 1WE5A 4JX4A 4IMGA 3TC6A 3OGSA 1L9WA 4GE8A 3QZ6A 3U3HA 4C6KA 3BV7A 4PB3A 2GWNA 3AROA 3LHTA 4DXKA 3TLQA 1XLGA 2NT0A 4C6LA 4KKXA 4YVXA 5EBAA 5C9UA 1DJIA 3GB6A 3M0JA 2EPLX 4Z2LA 4AC1X 2I9UA 3AXXA 1OX5A 2DP3A 3LGEA 4UMCA 1FHDA 1XIDA 2OFJA 1YXCA 1GONA 3UY7A 3N6HA 4RW3A 1QT1A 3H26A 3GTFA 1O95A 5CSRA 5CZJA 4D8LA 3IRSA 4O18A 2HCVA 3ABOA 5I77A 3R0UA 3FKKA 1KBIA 1ME9A 4EIVA 3VC5A 4O54A 3UJ2A 3VKAA 3C0LA 4DAFA 1KR0A 3E74A 3KCOA 3TW7A 1AZ1A 4NHVA 2TSYA 1QK0A 1EHAA 3NQBA 3N25A 2VXNA 1IXQA 4WGHA 5E9XA 4KW2A 3WLOA 1JQXA 3QY6A 3DI1A 4EXBA 2Z2UA 1UQZA 4I9AA 1P1MA 3M9YA 3FA5A 4UQDA 3P0XA 4S1FA 1R2TA 4DO4A 4K3ZA 1GVRA 2WC3A 4GUJA 3TDFA 4ENLA 1E9IA 3TFXA 3GNPA 1WDRA 1ADSA 2PGWA 1H7OA 1ITUA 1KXQA 3UCQA 4DF0A 5LA0A 4HMDA 1QAPA 1X8CA 2GK1B 1QFEA 2ZADA 1RD5A 3S6DA 4UFLA 4P5UA 1HJQA 3TEVA 1WDQA 2JIEA 4OFCA 5HMEA 1WBHA 4V2XA 1NWTA 3U9IA 1TVNA 4RE0A 3LCHA 5EMUA 1P0NA 1MEHA 2RAGA 2B4GA 4WSHA 1JNDA 3GXMA 3R6IA 4UR7A 1VFOA 2NLIA 2Z1VA 1LM1A 5BWFA 4Y8EA 3QKEA 3VKKA 5DQPA 3EOUA 2Z2BA 4BF7A 2WYSA 1W1B1 2HJPA 4LH8A 1XS2A 1Q6LA 1KXTA 4BQ3A 2R14A 1TRIA 3BW2A 1ALDA 1QO2A 4CN4A 1HL9A 1LLOA 2JK2A 2ABBA 5KTLA 3AJ7A 4O0KA 1X96A 1ZU8A 4IWWA 1E71M 3VPLA 4GGHA 5T26A 1NQKA 4HVXA 3LOTA 3M7WA 1TWIA 5FD0A 2ZXBA 1YPFA 3CV2A 3N13A 4ASTA 1YTDA 3O63A 2VRQA 3LBCA 4FNRA 4HZ8A 4HOXA 3L23A 3EX1A 2PURA 3LY0A 1Q8AA 2JGQA 1O7AA 2G3IA 3CBWA 4OECA 5AYZA 1OFRA 3GDTA 3GFYA 2WWCA 2GGIA 4O4VA 1A5MC 1UD3A 3SCPA 2DZUA 4PUNA 4WLCA 4HPNA 1TTPA 3A3HA 1KWGA 2BOFX 2PMQA 4HT3A 3SCTA 3SUVA 4OV4A 2VFEA 4B5WA 3SR7A 1KA9F 4XWUA 3MI6A 3MZ2A 1A50A 4O52A 5EFDA 4IL0A 3BAKA 3C8FA 3MSYA 2VR4A 4QM1A 2X16A 4AVFA 5BWAA 4Z1YA 4OT7A 2X30A 3S5YA 2WZIA 3ZWTA 1W9DM 3VMOA 1SMDA 1OD8A 5CPTA 2QF8A 2PP0A 4DI8A 1LTDA 4DNHA 3P5YA 3EX4A 1ZL1A 5DBUA 3IV8A 2ASHA 3TC7A 1TCMA 3CAWA 2E25A 4CD6A 1E72M 1H41A 1FWDC 1GQJA 3AXKA 3LK6A 2NVDA 3GHRA 2O7SA 2VZSA 3VGDA 1YMYA 1ZQ5A 1VD6A 1V0MA 5HNNA 1TMHA 1GT8A 1W9VA 4ZB5A 3WJYA 3IARA 3MUIA 1LWJA 1TKKA 2UY3A 1JFXA 1EX5A 2POZA 3S2CA 1R86A 2DZPA 2ZXAA 3TNOA 3BG9A 3C2RA 3W82A 2GJLA 5EA9A 3W26A 4C5YA 4IGHA 4Z2GA 3K1DA 1PS9A 3TYCA 3HGOA 4JAWA 3DFHA 3QOKA 4A8LA 3L0NA 1IZJA 3NGJA 2QIWA 1WKFA 3QQWA 4C1LA 1RQBA 4MY8A 2PP3A 3WN6A 1WX0A 1XBYA 3TJIA 1VCFA 1XR2A 3SURA 3MI3A 3UPWA 1GVSA 3NCOA 1K03A 3ZR4A 1JJKA 1K8YA 4P8XA 2F2KA 1NWRA 1XYZA 3ARXA 3R2GA 2V5LA 3SRKA 3CHEA 1FDYA 1EO5A 1REQB 1W0MA 4LVAA 4P7QA 1JDDA 3EKLA 2WLZA 1V3HA 2IS7A 4EWJA 5LIUX 3HB9A 3WQPA 3WUGA 4F2TA 3D3AA 8TIMA 2P0IA 2NV9A 5K4ZA 1JULA 2DGAA 4IZGA 4WR3A 1HGWA 3RO6A 3IAPA 2QAPA 3S46A 4PUDA 3KXQA 4L9ZA 4B91A 1K3UA 3G3DA 3W7OA 3HM7A 1RP8A 3LQGA 1KLZA 3T0BA 1ISXA 5HNRA 2D1ZA 1KFWA 3T08A 3DERA 2E9LA 4S3GA 5D2WA 3FA4A 1V6VA 1YLVA 3PAJA 1NDZA 4ICCX 3NXLA 1JL8A 3RRXA 4YTSA 5CPLA 1UD4A 1NP2A 1FFRA 2OO0A 5JQ9A 1BVZA 2NVAA 3OJGA 1FWBC 5A94A 4JKMA 1IEIA 3M4HA 1IE7C 3A5VA 3EOSA 3APTA 1NP0A 1GUVA 3RXZA 1KM1A 5G1YA 1NQ6A 3ZR6A 3CYVA 4MYAA 3FYOA 4UTWC 3BSGA 3PUDA 1Z6KA 2YW3A 3QC3A 4OHQA 3EWXA 3V35A 4QCEA 2FMNA 1UC5A 1ONWA 3W85A 1VC4A 3B3DA 4IT1A 4TV6A 5GJMA 3COTA 4GZEA 1FWCC 2QCHA 3QH2A 1OX4A 1SJBA 2PLJA 3H23A 3VNMA 4G56A 4IPIA 3GYEA 4ORMA 1CGXA 1QBAA 3WLNA 1LDCA 3WFZA 4CU7A 2XUCA 1JD7A 2QPXA 3HV9A 4DO6A 2QR6A 2HDJA 1EF3A 4ZE4A 4WKFA 1I0DA 2AGKA 1I2QA 2J8GA 4QE5A 3WL0A 2QCMA 4F8XA 1A5KC 3BOLA 1SM9A 3RM8A 3B0UX 2IPFA 4MKSA 2XH7A 3IK2A 1DV7A 4QDMA 2C79A 3SY8A 4IGSA 4PULA 4EKJA 3QSTA 4XVDA 3GR4A 5I3KA 1VRDA 2C7FA 4TX8A 4C6OA 2QF7A 3A12A 3B8SA 4YWSA 2YBUA 4YVPA 1XRFA 1BEUA 1V3IA 3NOEA 2VENA 5DCEA 1HQTA 4AIUA 2XN0A 3PAOA 1E4IA 4JDYA 4J3XA 3L12A 1MUMA 5DN1A 2BVTA 2HEJA 3KBVA 4KFOA 2YCEA 3ARPA 2VC9A 1H63A 3AZRA 5KITA 4ATLA 5GJNA 1VEPA 1R7AA 1ZNNA 2WJEA 1XCFA 3HPFA 4DYKA 5D2YA 4ADTA 3SECA 1DJHA 1CWYA 3EPMA 4UOQA 3VI2A 3PF3A 4WZHA 4F66A 4Z1CA 2KZHA 4LAOA 2ZRWA 3FDKA 3EKZA 1BYCA 1UZ4A 4CQ9A 3SRDA 3B9OA 3GAKA 3GDKA 3UXDA 2OVLA 3BGJA 1W2VA 1TIMA 3B8VA 1J96A 1AD1A 4M51A 4ZQNA 4XK2A 1O1HA 1JYXA 3LCFA 2V3EA 3L4XA 3CAVA 2IW0A 5FEXA 1SFJA 4AHQA 4K2SA 3O15A 5PTDA 3RRAA 1TJ2A 4REQB 4JL1A 1HT6A 3S5NA 4DAIA 3GVVA 1OF8A 1G5AA 1C29A 4N4PA 1V3JA 5MHBA 1E4NA 4N9BA 3C3NA 3CQ0A 5JIWA 1W1A1 3THDA 3CUIA 1SMAA 3R0DA 5A8OA 3C86A 3LTSA 2EBNA 3H7VA 5C54A 2PWGA 3BMVA 5CJ5A 3N3MA 2EQDA 1G01A 1KKOA 1JIBA 4WJXA 3AMLA 1IWPA 1GCYA 3E0IA 1QW7A 2PDKA 4NXSA 2ESCA 2Z29A 1BXNA 1NELA 3PR2A 3OGRA 3W02A 1J10A 1VFSA 3W01A 4QAIA 3OHIA 4TUFA 3OZOA 2PLCA 3QVQA 3JW7A 4MSSA 1FHLA 4GC3A 5CC7A 2Y88A 1IQ8A 5G5IA 4IH3A 9CGTA 1YNQA 2VC6A 3L4TA 3DG3A 5HATA 2QVHA 5U4NA 4HK6A 4HNCA 1BWVA 4NP7A 1OEPA 2FZNA 3HGRA 4E4PA 2VCAA 1HVXA 1RK6A 1WXZA 1VFMA 3VA8A 4UTHA 3OU8A 5TF0A 4IQLA 4KPLA 3VGGA 3AAMA 2QV5A 1E1CA 2CZEA 3L4UA 4KWVA 1H51A 3H7UA 3HG2A 4PSRA 3LM3A 4D6DA 1WZLA 2CU0A 4XBKA 4XV0A 3W7CA 4IXXA 3CS2A 1XX1A 2EXOA 3BSHA 4A2RA 4EAYA 2C71A 4QS6A 2G4JA 2Y24A 1M7JA 3CTTA 3P0WA 3ORWA 1F74A 3EGJA 4PMJA 4H7VA 3W53A 1MRQA 4GOAA 3W1UA 2NQ5A 3RX3A 2GOUA 3W87A 4J3TA 1A0CA 1GKQA 2ZTKA 4JHZA 3L21A 4DBEA 4HZ7A 2H3DA 3NEHA 4HNNA 1KCLA 1XIMA 5AY7A 4PCPA 4QSHA 2Z2AA 1RALA 4GY7A 3C2FA 4EPKA 3VM7A 3OBEA 1QPNA 5F1UA 1JAEA 1AK5A 3WF3A 4S3CA 3WK3A 3UZXA 4R9OA 3UZJA 2E5CA 5EMMA 3BOXA 3TN4A 2UY2A 3B97A 1RA0A 3GG7A 4R3UA 2AOSA 3M44A 3CNYA 3H6OA 1ZCOA 3N04A 3WMLA 1FHVA 4GACA 4CN1A 3N2TA 3LPFA 5CJNA 1CIUA 1GOIA 2AAMA 3TN5A 1QHZA 1V08A 3PS7A 4NI3A 4N4QA 3LLDA 1F2JA 1ONEA 3QV7A 3JR2A 3S0CA 3I6RA 4H83A 2CWXA 3A3WA 1BXCA 2QKFA 1BG4A 4DZHA 1PCKA 2IXUA 2ZUSA 2NQ9A 1GK8A 2XSAA 2XH4A 5G1TA 4US6A 5HULA 3T4WA 4A3YA 1TJRA 5I3FA 1G4SA 4QITA 3KOYA 4LYQA 3K8KA 1EYWA 3QHOA 2YDRA 2WQPA 3LCIA 1HJSA