3K8LA

Crystal structure of susg-d498n mutant with maltoheptaose
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
649
structure length
649
Chain Sequence
WTALTASPDTWDETKRADISYQLLLYSFADSDGDGYGDLNGVTQKLDYLNQLGVKALWLSPIHPCMSYHGYDVTDYTKVNPQLGTESDFDRLVTEAHNRGIKIYLDYVMNHTGTAHPWFTEASSSSESPYRNYYSFSEDPKTDIAAGKIAMITQEGAAGYNAAEWFQVSDETAAVKGLLKFTLDWSNAPSPILVVSTGTKADEDNPDTGTDNAKYLYYGEDICKKFYDKGNNIYELTVDFESTWGLLIRTSNASFWPSGTKYGASSSSEKLALNKDFKLTNAGNPANIMFDSQQITYFHSHFCTDWFADLNYGPVDQAGESPAYQAIADAAKGWIARGVDGLRLDAVKHIYHSETSEENPRFLKMFYEDMNAYYKQKGHTDDFYMIGEVLSEYDKVAPYYKGLPALFEFSFWYRLEWGINNSTGCYFAKDILSYQQKYANYRSDYIEATKLSNHNEDRTSSKLGKSADKCKLAAAVLLTSAGHPYIYYGEELGLYGTKDNGDEYVRSPMLWGDSYTTNYTDKTDATVSKNVKTVADQQADTHSLLNIYFSLTRLRNTYPALAEGNMTKHSVYNESQEKDYKPIAAWYMTKDNEKLLVIHNFGGTAMQLPLTDKIEKVLFVNGETQQNTDSDSYTLKLGGYASVVFKLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, susG
publication title SusG: A Unique Cell-Membrane-Associated alpha-Amylase from a Prominent Human Gut Symbiont Targets Complex Starch Molecules.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Membrane protein
total genus 199
structure length 649
sequence length 649
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k8lA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3k8lA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k8lA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3k8lA03
3SKUD 1KPRB 3PWLA 3G08A 1LQSR 2RJMA 1PKQE 2DH2A 3RVWD 4LLMB 1BFVH 1WEJH 4DWSA 1ZMYA 1W0WA 4CVZB 4PTXA 1J87A 4HMCA 2R0KH 4P7LA 1VPOH 4NCC1 3CBWA 1E1EA 2WIIA 4HKBB 4F7TA 2HFFA 4PJXA 5EOCH 1KJ2A 1BD2B 2FATH 4PG9B 3WF2A 4J28A 3L7FA 2FX9L 4N0UA 3SDXF 1QSEE 1XGYH 3MBEA 3NAAH 5IUSA 1GOFA 3OMZA 4XP5L 1EHNA 1JFHA 2P47B 2E8YA 3KJ6L 5HYFA 2DLEA 4LSVH 1HINL 4IS6B 4D6JA 43CAA 1NAMB 2V38A 2EO9A 2QQNL 2YRPA 3BN9D 3LN5B 3M1BB 3ULVE 3ECQA 2UWEB 2Z9TA 2FDMA 1FHGA 3MRJB 2X4UA 2YA2A 2X7LB 5GZOD 1MCPH 3SPVB 5CLWA 4P23D 2OTWA 2XWJA 4MVBD 5GRJL 5I9QB 4CD5A 3VTRA 2EKSA 5EC2B 3P0YL 4J12A 4NO5A 3G6MA 4N90D 3HS0A 5IT2L 2WZEA 1KN2H 4JDTL 5MEOB 3QFDB 1MI5D 5FKPA 3ZYJA 4L9LA 4ZXBA 1WCGA 1CU4H 1GCYA 4FQXC 5I1EL 1GORA 5M5DA 1XH3B 4R4FL 4P23B 1H5BB 5JIPA 4BFGA 3RILA 1JPGA 4H88H 4I0PA 5SX4H 3R06B 4MNQB 1JRHL 1Q9WA 2OL3A 1CF8H 3LN4B 5DURB 5ALCH 3X3FL 4N0CD 3U82B 1NGXA 4P5MB 1JMXA 3AS1A 1XYZA 3BHBB 3FMGL 4P46A 2WZHA 4ZUWB 5BV7B 5KSAD 3P9MA 1LEGB 4Y2DB 5K9OB 4WTXA 2QV2A 4Y4HD 3W9DA 4MQ7A 3KXFD 2ZKHH 4POYA 2IXVA 1FO0H 2N56A 1EX0A 3I3BA 1IARB 1OCQA 4P5TC 3KLHD 4Z9KB 1NFDE 4JG1L 4M6AA 2ZUSA 1UQSB 4PREB 4E5XB 2OMNA 3LS5H 2WBGA 3POHA 1I3RB 4WUUA 4UDTB 1MFVA 1AQKH 5D7KD 1GPOH 4HQQH 4O4YL 4NWUH 1RJCA 2VKWA 3UEQA 2AGJL 1CBVH 4OCMC 4KK9D 2XWDA 3IDMA 2XVKA 4F15B 3MYZA 3ZMRA 3BUQA 3BE1H 3MC0A 5JUVA 3AFBA 1AXSA 1FAIL 1I7TA 1U8LA 2CKBH 1JHTA 1IGJA 1RUPH 1S9XA 5I1IH 4KKLC 5JIKA 4QAWA 1AR1C 3GBDA 1G5AA 4YHGA 4AMKH 2ITCA 4GLRI 1ODAA 3P4NA 1H0IA 4MCZA 2NY0D 5GZNC 1QNRA 1QNQA 5E8EB 1NGZB 4I3SH 1F97A 3ARDD 5I71C 1JN6A 1NCCH 1ETZA 3OXSA 1WBYB 1UFUA 4PJ8C 3SE3A 4OKDA 4JRYE 2EPNA 3N9KA 3NYDA 3PZIA 1EXUB 4KJPC 1MW3A 2C1OA 1X44A 4TTDD 4FNLL 4I4WB 3Q48A 3VXTA 2E4TA 3R4DA 2BERA 4YGVA 1WAAE 4KAQH 4ZFFB 4UQDA 3LKOA 2GFTA 4MB5A 3EFDL 2C3XA 3C09C 1F4WL 1WBZA 3ZE1F 2OLDA 4OI8A 1EMTH 4XPBL 2FGZA 2WWKO 3TTOA 4N9GA 1MLBA 1LDPL 2RAMA 2BVUA 4EANA 1I4FA 4JFHE 3S8WA 1QNZH 2NXZD 1ZT1A 3RPKA 2JELL 5FGRA 4Y5VC 3M46A 1H8OA 1AY1L 2IMNA 3V5DA 4PGBB 1SEBB 3O2WH 5T1KA 3FFCB 4LK4A 1FH5L 1KELL 1T1YA 1YA5A 1WUNT 3ZKNC 1WLHA 4BUHA 5JW4M 2P8PB 1ZVSB 4NJAL 3RU8L 3DX8B 1KCUH 4MLIA 3ULVC 3RFZC 4PJ5E 1QKZL 2NY5C 1ND0B 3MRBB 2DT2A 5KAQF 1E56A 2OQJA 1DBJL 1KFAL 5F9OL 3O3DB 5GGVH 2CXKA 4POZD 3NSMA 5EIIA 3A6OA 3BH8B 3QRGL 5DRZB 5SWSA 3OR6A 1M05A 5L2JB 3GH7A 3BZ4B 4AC1X 1DQDL 3X14A 1KCLA 3QCUL 1RULL 2F5AH 4FNUA 3HG1A 3KGRA 3VIHA 1KIRB 4QF1A 1ECEA 3OAUH 3BJLA 1U93B 4QHNA 5C09D 2V7HB 4KROB 1TJGL 3CZKA 5FUZH 1E6NA 3N15A 3OZOA 1NFKA 4MXVE 1DVFD 2AJZB 1BVKB 1CXLA 4MAVA 3QO0A 1CBGA 3PIQA 4FQJH 4XCCH 4FTVB 3DDFA 4ODXB 2BNRB 2FH8A 1OWRM 1R24B 1D6VH 5E8OA 5C08B 1HK6A 2DLIA 3EYOA 2KQMA 3UZQA 3P0VH 3GSQB 4MXQC 2NY4D 5E0QA 2XWEA 3AZRA 3MQIA 3WIHL 3HUJF 1PQZB 3UTOA 1A7RH 5DTFB 5IK3B 1KGWA 2VURA 2PKDA 4M62L 3VFWA 2Y6SC 4DWSD 3DV6A 1HKIA 1OTTC 1YNLL 5CSGA 4GMTH 1V6UA 3HLAB 4PGDA 3MCLH 1YEJH 2ZX9A 2C1PB 4LGXA 4U3AA 3FRPA 5EUKA 5L0QB 2D7OA 1FZMB 2NQCA 4JDZB 4ZYKB 1QNOA 3MLUL 4WI4A 5HVWA 5GS0H 1MPAH 1UJ3C 4G8GE 1AQDB 1U2HA 3H55A 3UTTA 5LA1A 1KLUA 1UD5A 3RVTD 4PLKD 1MFEL 4NFCA 5JORB 2W0KA 5B8CC 3AU1B 4FZ8H 1G7HA 3LKQA 1DEEA 3MBED 1GAFL 3NA4A 1CVSC 1S46A 3ARSA 4PJFF 4OUUA 2F18A 3MRNA 3FFDA 4YZFE 1WWCA 2D7TH 1IGML 2WIIB 4M6NH 5IKCA 2HFFB 1JNLH 4PJXB 2PO6B 1KJ2B 3DXAB 3V7MA 1RURL 3L3GA 3NCCB 2WINA 3VFNB 5D1QA 3TEUA 5BRZB 2WUBL 3IXAA 3DVIA 5I75B 1XCTB 4ALAH 4GG6A 2HT2D 1MY7A 4QLKA 4TUFA 4MD4B 4MD5A 4UTAL 4ENED 1XGRA 1TLKA 5HDLA 2D9CA 2MCPL 5F7NC 3FO1A 5BOPA 3PBGA 2X40A 4PRDA 4PJHF 4JHZA 2XN0A 5DEFB 4ZXBD 1ISZA 2BSTB 4PEEA 1FVCB 2H1PL 3GJEB 4BELD 1G0DA 3V7AE 4P57A 2EKSB 4I0PD 1ZL1A 3RDTC 1YDPA 4XCNB 3EHBC 5TF0A 1BD2E 5SWZA 1M1SA 1IFHL 1Q38A 3DROB 4XZUB 4GKSA 3RY4A 2Z8SA 2BCKB 2OJEA 2WV3A 4X9IA 4P46D 4HS8L 4L9LB 2OTPA 5CINH 5LGHL 4HZ7A 4PMYA 1A6VL 3PWVB 1MWOA 4PJ9A 3VPLA 4YDIL 1MQ8A 1RPKA 3BJ91 1UR4A 1W2KT 1FIEA 4GXVL 4I0PB 3CU7A 1SVZA 4Z7VF 1DDHB 3REWA 2FYVA 2XV6B 3Q5OA 3WSUA 3QUYB 1Q9WB 3KPMA 2V9TA 4U4BA 1OAQH 2BOCA 4H8HA 3RX5A 4NN5C 5E56A 5IFHH 4OOZA 2MQ3A 1P5VA 1J8HB 2E9WA 2Z35A 1MFNA 3RTQC 4P46B 2KPNA 5HGHB 2IBBA 1WTLA 4YFDB 1KR0A 1L9MA 3P9MB 1A22B 4OTXL 5EG6C 4WUUD 2YXMA 3W9DB 1RZ7L 2E9BA 4WI6A 4ATDA 2DQIL 4NQDB 1AXTL 2DQHL 3CDYA 4LCYA 4MQXD 1QR1A 3VMOA 3V6FB 4HSQA 3C60A 1BZ9A 3SDDC 4RWHA 4ZXOA 4GW1A 1R8LA 1LILA 1NCTA 4PP2A 2Y07H 4PPTA 1IEBB 3MO1B 4K9EC 1S9KC 4KXZH 4MNQE 5CIPH 2VDNH 4AIXA 4N90E 1LD9A 4WHTB 2CBVA 3RNQB 1PSKH 2V2TA 4G6ML 3IDMB 5ESAA 4YN5A 5L2KA 4CDGC 3V6OE 1TPXB 4OZGA 1AXSB 1I7TB 3F5WA 1U8LB 4QWWC 3MRPA 4MJIA 3HZMB 3I02B 1QI5A 1NSNL 1AJ7H 4PV8A 3ETBF 3QIUC 2ITCB 4G6FB 5C0JA 2NT1A 5JHLH 4GIAA 3O9WA 4Q0XL 5I1HH 3BWAA 4MCZB 3W0WB 4F57L 1IC7H 1LO5A 2EH7H 2DJSA 1W9BM 1CENA 5GS2H 3BD4A 2WYSA 1C3FA 5HBBA 1LP9B 4TNVK 1HE7A 4GFTB 5E6YA 3LH2L 1R85A 4XC3H 1MHEA 4M1CC 2CJUH 4JE4B 4YFLI 4KRNA 1KB5A 5LWYH 3ULUH 4U5KA 4MB4A 1A7QL 5AZ2H 4HPOH 3OGVA 3KPOA 3V4VL 3LKOB 5TE4L 2JLLA 2J8UF 2ATKB 3HAEA 1C8PA 5T1KD 1WIPA 2FD6H 3QGVA 3L6FA 3N12A 1BIIA 5C0BB 1ZVYA 1ONQA 5DD6B 4OZGF 3O9NA 4LCIL 5F1SA 1NKOA 2W9LA 5EBGA 3BI9X 4L1HA 3QZWB 2K7PA 4KQ4H 4CMMA 1O7DC 4PJEE 2O5ZH 2H2SD 5BXPA 3V5DB 3A67L 4CKVX 3DTXA 5SWSD 1IRAY 3CUGA 5ANMB 3WN5B 5DMIL 3FXYA 3HG1D 4JFOA 3BXWA 1NAML 1A6WL 3EJJX 3H9SB 1F4XL 3IJYA 4WFGD 5C0AA 5DO2D 3RRQA 3X17A 3AIEA 4DM1A 2CLZB 5CJOL 5BJTA 1CE1H 3CH9A 4UQ3A 3TN0A 3WEMA 1ZHLA 3RVWC 4ELMB 2R2CA 1M05B 3D3VA 1URLA 2LU4A 5ELIA 5C0RH 2X10A 5DMGD 2GSJA 1LE5B 2VE6A 4QF1B 1P84K 3L4XA 2DYPD 3V5HA 5D5MA 1BJMA 4YDLC 1INQA 1YUHA 2HH0L 4UBDD 5I8OH 4JKLA 1YZZA 3ZKQD 3REVA 3MRQA 4M48L 1FJ1B 5GQBA 1J1OH 4DEPB 2HAZA 1RZ8A 5K9KA 4C7GA 4O5LL 4V2BA 2HJKA 1X5ZA 5DUML 3UTTD 5I9QC 3MLYL 2XT1B 1OAYL 5IHZB 2VB5A 3VFWB 4XP5H 2P5EA 5EO1B 1G6RA 4HULB 4LSSL 3BN9C 4PGDB 1S7XB 3VIIA 2GJRA 1E9LA 2QQNH 5GZOC 4P23C 3O6KH 1FP5A 4JZOB 4MVBC 3UTTB 3VFGH 3CDCA 1H49A 5K9JL 3NFPA 2G2RA 4FTVE 4LVHB 4XX1G 4U0QB 5D1QD 4P8WA 3FQWA 2BNRE 1VKXA 4PY8I 3KNBA 3MRKA 2GJ6B 4RMTA 4W4OC 5C08E 2EYRA 1WPCA 5GRJH 4OGXL 3P4OB 3SUWA 4ONFL 4WKHA 2PTTB 3P0YH 4WVRA 4L8SB 3FFDB 4OLEA 5BV7C 1OM0A 1P5UA 5C09E 1KULA 3V6OC 5IT2H 3MNVB 4Y2DC 1OSPL 4JDTH 4IMLA 4JB9L 2VERN 5A2JH 4IDLA 5CWSA 1NEUA 3ARTA 5D1QB 4PMXA 4OAWB 3CCHA 3PGDA 1MHPL 3JTSB 5DMYA 2WHKA 5HYQA 2VL5A 4GG6B 3UTQA 4FRWA 4QNPF 4KKAD 1I3UA 5KSAC 1J12A 3X3FH 2HKFL 3BKYH 4QOKA 1RIHH 2X4OB 5DUBB 5JDJA 4Y4HC 4WEBL 3VOCA 3GSUB 3FO1B 3HMXA 3N1GC 5FXCH 5J56B 3FMGH 3CHEA 4ODTH 1ZWIA 4H0IA 2PC8A 3M17A 2FJGA 1A14H 3RIFF 3S35L 5KVGH 1Q9LB 2EO1A 4F15C 5ADOL 5DJ6B 4PJ9D 1WDRA 3KLHC 4F9DA 3KAAA 3LS4L 2X1PA 2OSLA 3G6JF 2XTJD 4PJXE 3AZTA 3MMUA 4GUPA 1NL0H 3DXAE 4IRJA 3VFVA 5I1JL 5SWZB 1FIGL 4HUMB 2R4SL 1MCFA 3SURA 3FNDA 3P30L 4FFYH 2E3VA 1TCMA 3MLZL 4O2EB 3PP4L 1UKTA 4CAGA 5FHBH 2JIXA 4XWGL 4PJ9B 1IKFH 4LHQB 5MEQA 1Y7VA 1ZBVA 1RI8A 1ZT4B 5C0GA 4YIQB 4O4YH 5EDXA 4XP6L 2QADD 3PWUA 5BVPH 3AXIA 5I30L 3REWB 2C3HA 4K23L 4MSWA 3HNSL 2IBZY 3KPMB 1RZKL 5HD8D 5FHAL 1G7IB 2ALWA 3T77A 3C60D 1UWQA 2ZX8A 4Z77B 4AIEA 3ZM8A 2VXQH 1FAIH 2R29L 2I24N 2Z35B 1U2YA 2NY0C 1CICA 4FQQB 3BYTA 4WFFD 4LSUL 3SE9L 2JF7A 2XPKA 1Y18A 4YNYA 4HS3B 4QRSA 1EK3A 3B8YA 5JMOC 3WDQA 1QR1B 3QFJA 4JLRA 4YFLF 4JM2B 5D7LA 3T0BA 1U8MA 2EPMX 2KL6A 4N0YL 3C60B 4R27A 1MFAL 4TTDC 1ZLVH 1GONA 2QMKA 1BZ9B 3K0WA 4NOBA 1X1NA 2PBGA 3OIHA 4DAGL 4S3KA 5L2KD 1KWKA 4ONGL 1A64A 4WWID 2CRZA 2J79A 4R97B 1WF5A 4PP2B 3DI3B 4KDTA 5T3ZD 4DN3L 4MJID 3ZTNL 3WKML 5H8DA 1JWUB 2DRUA 4HGMA 4JFDB 2VLRA 1BECA 5A6BA 4DO5A 3O9WD 3RP1A 3ULVH 3P73A 3WY1A 3U36A 1IAIH 1J8HE 3SO5A 4NBXB 1F4WH 4UFJA 5GRVK 4F7CB 1CWYA 1A3HA 4XP4L 3QJFB 4KK6D 2R69L 5L7XL 3LPPA 1LWRA 4ZUVB 4NQDE 3WFZA 4Z7OF 5LVEA 2CMRH 1P9MC 1QQDA 2JELH 5DJDB 1ED3A 5DQ9A 4HUUB 1S7RA 1IT9L 1AY1H 2JFEX 1RIVH 3B3IB 3DETD 2X41A 3BWAB 1K3IA 4JY6B 3BUIA 1KELH 1FH5H 4WFHD 2XICA 4NJAH 1T21B 4Z2LA 4G9FA 1GQJA 1OQOA 4WUUE 4XCYA 2DJ4A 4POZC 3SKOA 4EDXB 1T03H 1EQCA 4BA8A 4GQQA 1RUML 1R0AL 2HT3D 3Q6FA 3JV5A 4FN0A 4S0TD 1W3LA 1UR0A 3CZEA 1WDSA 3VFPA 4MWFB 4UQAA 1RULH 1JZ4A 2VDML 1BIIB 1UWSA 1MXDA 2AJ3B 3RA7L 4K7FB 4R7NA 4Z7NF 3OGSA 3LQZA 4LLUB 3AAZB 3QOKA 3C5JA 2W65A 3BP6A 2EDHA 5C0AD 4NKMA 3AIVA 2VIRA 2NY4C 2HN7A 3L7EB 3U2SA 1W9UA 5A8MA 2WBWB 5IEHA 3MODH 3TN0D 1LP9E 4QKXB 2ICWJ 3D3VD 3UZVB 3D5HA 4DWSC 5HHQA 4G3YL 3T3PE 4P48A 4LF3A 2VUYA 4EN3B 4G7VH 1ZS8B 1VIWA 2HFTA 4UIMB 3WIHH 3IT8D 1BGXH 5H37H 3O6ML 4HZAA 3S98A 1KXHA 1OD9A 1MCSA 2NY7L 4XMLL 5IFPA 1YNLH 5IFJB 3P40A 2WZPD 5D9SA 2HTLD 2GVYA 1HWGB 1VA9A 3D3VB 2A9MH 5A8QA 1CL7L 1I85A 1FHDA 4ETQA 3NTCL 5C0FB 3MBEC 4YHOH 2VE6B 3RZCA 2BVDA 3JV4B 1AD0A 3ZJ8A 2AEPL 2IEPA 5IWLA 1LO0L 1MFEH 3HRPA 2WBKA 3JVGA 5DFTA 1DUYB 2X4RA 3MLWL 1GAFH 2P5ED 3DX1A 1AO7A 3OKNA 4N8CL 1IGMH 3MRQB 4UQ9A 2ZXDA 1JMZA 5L6YL 4N5UA 1G9NL 2HT2C 1UENA 5K9KB 3P11H 3UPAA 4XNQA 4KKBD 4ENEC 1OB1A 4RGND 2WUBH 4JFFA 5E24E 2IPTH 4LARL 2YRLA 2P5EB 4H2CA 1UADC 3W2DL 3F7YB 4XH2A 1HCFX 3HG1E 1A2YB 4DCQB 1MVFA 4L9LC 3ZDXE 3IB4A 2MCPH 3ZKXB 1JV5A 1J0ZA 3D39A 5E4EB 1TIUA 1GUVA 1F90L 3TIDA 1MRDH 3CUHA 1FNHA 1JYVA 2X89A 2A83B 4I0PC 1R7OA 1J0IA 2C4FT 2G2RB 4TULL 2IGTA 1VKXB 2H1PH 3KNBB 4N42A 4Y4KB 2AEQL 2H32A 2HRLA 4ZNEA 2ZXAA 3P9LA 2YKKA 4J23A 1B88A 2CR6A 4P46C 3U9UB 4EUPB 4V1DA 1XIWA 3TZVA 1UHVA 4S2SB 2E3ZA 4QOKD 3RM9A 1MF2H 3B5HA 4NZFA 1B3VA 3G5YA 4RIRB 5C7XH 5HGAA 2GUYA 4CD7A 3G9VA 4L5FL 4KC3B 1A6VH 5HYSB 1T80A 4YDIH 4A3YA 4KJYB 5DVOA 1CN4A 3S5LG 3CUJA 3NPSB 1YY8A 3UTQB 4GXVH 3WEXA 5FOJA 3BH9A 3JUGA 3A47A 2E6JA 2ATPB 3UTTE 1MJ8L 1D5BB 4Y7MA 4IRJD 1HQ4A 1MLCA 3VRLE 4AZCB 3HNTL 4MQXC 1U8JB 3KYKL 3OZPA 2UY7A 1JBJA 1J7VR 3LOWA 2UZXB 1L7IL 4AZ7A 4QEGA 4KK5D 4P3DA 4ZS6D 4TOYH 2JIXD 2DQIH 1AXTH 2DQHH 1UA6L 3SIMA 4XPFH 4LHUB 4UOW0 3M8OL 4AG4L 3MSGA 4GUPB 3UTSA 1CT8A 4WU5A 1A02N 2PF6A 4TNWF 2DWEA 1MCBA 1Q1JL 2VYRE 4OLUH 1YHTA 4ZOAA 2GK0B 4GG6E 1WCBA 2WKGA 1N3NB 1CICD 4YHML 4MAUL 2LTQB 2JIXB 4OUOA 4H26A 4PBXA 5ESQA 5C0GB 3GMRA 2X2JA 1KNOB 5T3XE 2CEQA 3EMZA 3QHFL 3SE3C 4G6MH 1CCZA 1N7ML 3QFJD 4MSWB 5D7LD 3VXPA 3EFFB 1JGIA 1U8HA 3T77B 1UCBH 1EV2E 5EFDA 4HWEH 3D4ZA 1SJXA 4O51A 3TJEL 4UINL 1CLOL 1NSNH 3IFNL 3BZEA 1AGEA 4G7YL 5IQ7H 1BG9A 3O6AA 3NFNA 4F57H 5EORH 5SWZE 4ZTPL 2FECL 4JLRB 5CILH 3MRFA 2VLRD 5D7LB 5A6BD 5I6XC 4H25A 4LSTH 5JLZA 3U30C 3HC4L 4PMRA 5HDBF 4LYPA 1AFVL 5JMRA 2DT0A 3LH2H 1ZA3A 4QRRB 4BSJA 3RWJA 4UTFA 1HJVA 2XTJE 3CFBA 2EIEA 5GGRA 5EIVA 5C07B 3WN5C 3VRIB 5F9AC 3N17A 3V4VH 3G5ZA 5TE4H 3ZE0F 2FO4A 4BFEA 1VJZA 1FDLL 4MA3B 4S1SL 5FCUL 1R3HA 1X7QA 2VKXA 3VD7A 1FHLA 4G43B 3WIIL 2H2SC 1YN6A 4G9FD 4LCIH 4KTEH 1MWAB 2B4CL 4QTHA 4MNHB 1NLDH 5F3BB 2PYEB 1FLRH 5FYLD 3SO3C 5I2IA 3A67H 4U1HB 3C9NB 4GAYA 1A4KB 2EXYC 4OD1H 2DI7A 2VUOA 1VFUA 3L3IA 3QOMA 3MLTB 4NDMA 5DO2C 4ZDHB 4HKZA 1NGYA 3WLBB 2CR3A 4X6DA 2XA8L 2X1XR 4NYLB 1D5IL 5J11C 3BFOA 2W1NA 1A6WH 5JA9A 1ZHKA 1F4XH 2IALA 1ISXA 1F42A 3ARPA 5E6ZA 2J7BA 1A6AB 5CJOH 5DMGC 4F37F 3GHEL 3Q6FB 3T2NH 1UWEH 1R3JB 2P5WA 4URIA 1JUFA 3CSPA 3TTYA 2XQYK 2APVA 3VFPB 4HFWA 3TNMA 3FT3A 4UBDC 5A95A 5T3ZE 5F1NA 8FABB 2OTUB 1U8QB 3WMCA 2O9OA 3UTZB 1S7VA 4NRSA 4G8IA 1WT5C 2D0HA 5JUEH 5DRWA 3OJDA 5I8CB 1KWGA 5CUSL 5C2BH 1JHLL 4UFKA 1OGTA 5C8JA 1DUZA 2W65B 2WMJA 3BP6B 2NW0A 1GGYA 4Z2KA 3J7HA 1NCAH 4NKMB 4WI8A 2HN7B 3KJ4C 4X5XA 2DLHA 2XZZA 5DSCB 3A4WA 4Z78B 4NXKA 4M48H 3RL2B 4GKNB 3TV8A 4AD0A 4LVHC 3OKYA 3QQNA 1TQVA 5HHQB 2GT9B 4JKMA 5D4QA 3BDXA 5DUMH 3RWFA 3MUY1 3MLYH 3RZCD 3ZL4L 4XC1H 1OAYH 5D9MA 3MGOB 4Y1AA 4ODUB 4WFHE 5IBUG 5BV7H 5LAXB 3K2UL 1DWFM 4FK9A 1YY9D 1AP2B 5DR5L 4HH9B 1AO7D 3FOLB 5E7FA 1W1TA 5D1QC 4LVNC 1ORQB 1FL3A 4JO4H 2YN3A 3NN8A 1HCVA 2A6IB 3L3JA 2XKNA 1K9DA 3QR2A 5K9JH 1C93A 3VFRA 3EO0B 2WB5A 3TM6A 4JFFD 1NANI 2HFEA 2XWTA 2V5YA 4ONFH 2VZUA 2YEZB 3F6IA 3TOPA 5F6HJ 4ZOEA 1N4XL 5I1AA 1RUKL 4P2QA 5MP6L 3IFPA 4OF8A 4OZHA 1OSPH 4BA0A 3I6LD 2OI9C 2AJYL 3DX6A 4JB9H 4JIEA 3D39D 5HI4D 2O9TA 3TT3L 1R3LA 4LVOB 4KKAC 4KRPB 3NCMA 3T1FB 1Q72H 2X89D 3B8SA 5ID0B 4HXAL 1MHPH 4PJ7A 4C55A 3D3VE 1R34A 2DL9A 2Z31B 1EO7A 1WZLA 4D94A 4HP5A 1T0NB 4M43L 2A1WH 3V95A 3ES6A 4V1DD 4PJIB 1XIWD 3D39B 4IRZL 4PJ9C 1FFOB 2BHYA 3TZVD 4LKXA 3BZFB 3TIDB 4JN2A 2ZUMA 4ZUUB 3F7RA 2XTJC 3G5XA 5ADOH 1RZIA 2F1AA 1KCSL 1YYML 3LS4H 1B0IA 3WDRA 3MRLA 4ONHA 3HR5B 2H32B 3P9LB 5F7DA 3KPQB 1RZGA 4M93B 1WWBX 2XVPA 2W9EL 1QI3A 1FIGH 1K8IB 4XB7A 5EA0L 4NNXA 3IFOA 4Q97A 3CZGA 1GC1L 3P30H 2QADC 5IW6B 1U92A 4MA7L 1U8IA 3MLZH 2P5EE 1TJHL 3PP4H 1BF2A 2W60B 5HD8C 2XNAB 3C60C 4PJ7F 3HHRB 4XP6H 1W72A 5AAMA 4JN1L 3WEXB 4K23H 3BH9B 4BZ1L 4MJ2A 1RZKH 5FHAH 1MQKL 5F8QC 1I7UB 4RGNE 5I8KL 3UTSD 5GRVL 4GH7B 1JGUH 1M7IA 3H0TA 5FOBA 4DM2A 4L8BA 4JZJB 1V6WA 3SDCA 3IETB 1HDMA 4L8CA 1LNUB 1MFBL 4X6BB 3FTGA 3BT2H 4AEHL 2EXWC 4N0YH 4HTYA 2PUQT 1CXHA 4ODSH 4DAGH 5EZIL 1CT8B 4WU5B 2WCSA 1FE8H 4X9BA 3T2QA 4P99A 4ONOA 5JA8B 3O9WC 1X5GA 3N11A 3L4ZA 1IGCH 3IDXL 1TG7A 2VSDA 2B39A 5KS9B 3WKMH 5FCZA 3LKNA 4JQVA 4KK6C 4S3JA 3WBAA 3GMRB 4A6YA 5E2TL 5F9JA 1AD9A 3KYOB 4KVCL 3L4VA 5E0CA 4XHJD 4Y8DC 4ZAKB 1UKPA 1MVYA 3EKCA 3NIDF 4XP4H 5MHSD 2R69H 4NC0B 1NCWH 2QHRH 4F9LA 3BXNA 4XRCB 1OY3B 5L7XH 1A1OA 1T7XA 3ARZA 3DETC 2MCG1 3S3JA 4BQ8A 4CNIA 1KTRL 5E6IA 4H8VA 2Q76A 4K7PL 4H8WC 3X3GL 4C57C 4DOHB 5DK2A 1AGDB 2VMFA 1IT9H 5ALBH 3OG6B 1JNDA 4AY0A 5ICZB 1E0XA 1KIPB 3DRTA 3NFNB 4M1GL 1BF8A 3K8LA 1EEQA 3MRFB 4DZ8B 1PFCA 4LBEA 1EEYB 2HT3C 1UD8A 3DYMA 4TTGA 1NGPL 4J3UA 4OGAD 3DC0A 3HZKB 3U79A 4WEMB 3RWJB 2AERT 4QHKJ 1K6AA 3ARFA 1R0AH 1HHGA 4W68A 2NY2B 4D6DA 1WITA 1A6ZB 5J3HD 1MCNA 1MCJA 3G5ZB 4EN3C 2F1BA 1PZ3A 2D73A 1G0CA 1FQ9C 2YR3A 1H0GA 4R2GD 1YNTA 3L95B 1R3HB 3ISWA 5FB8A 1RU9L 5F3HB 5CPSA 1B0WA 3HTLX 4FFZL 3SJVA 35C8L 4UQCA 1LGVA 3NPZB 3QISA 4QTHB 1KJ2H 4WW2B 2OX5A 1PBGA 4RFNC 2N7BA 3GMQB 5D7LE 1W32A 5I2IB 2V9RA 4NT6B 5D6DA 1XGUA 4D6FA 2P5WD 4ZPVB 4GAYB 1JF1B 3B2VL 4PG2C 1T1XA 4KFZC 4GRWF 4Y88A 1WV7T 2FHFA 4XCEB 1Y0LB 5E9DB 2VLJD 3VJ6B 4M80A 4JPVL 4G3YH 4HKZB 1NGYB 4UOW1 4CN4A 4QRPB 3O6MH 3TBWB 1ZHKB 1JTPA 1CD8A 2DM7A 2VLRE 5LXGL 5FYJD 4BK5A 1NC4B 5E8NA 5H94B 4PTWA 3VIJA 3RPMA 3WH9A 1KYOK 2QPSA 3WJLA 3GDBA 4YXHH 1MFUA 5ACZA 1DN0B 1ZHBA 4FQLL 4OF7A 1CL7H 3PGCA 4X8JB 1U0QA 3QIWB 3TNMB 1W9PA 2CBUA 3RWEB 1I9JL 2WC4A 3V6ZB 3HI1A 2AEPH 4X6FA 1OSZA 2J6EL 1T1ZB 3IGUA 1OGTB 5C8JB 5I8EA 1DUZB 2ZCHH 4JZNA 4Y1AD 1GIGL 3VNYA 4JPIB 3CMJA 1U3HB 5DJAA 2V17H 1S7WB 1FZOB 3VXRA 1M7DA 2XYLA 5CPTA 4RGNC 3ZR6A 4NNPL 4BKLA 1E4XI 5L6YH 2XRAL 3FN3A 2X4NB 3ZYZA 5FYLE 2OS7A 5EUOA 3QCTH 4Y4KC 5KSBA 2CETA 4NP4L 4KGLA 5AD0B 1WZAA 1B0RA 4HEPG 3PWPB 4LARH 3MROB 5FDYA 3W2DH 5CLTA 5DI8B 2ZUQC 3VE0A 3CZSA 1E70M 3GXNA 4Q2ZA 2UY4A 1KJMA 3TBYB 3SKNA 4P2QD 3CUFA 1GHSA 4IRSA 3GXPA 2PWHA 1F90H 1T22B 4WFED 1Q6GA 4I18A 1DBBH 4HOWA 3PWNB 5BOZG 1FV1A 5CJXA 2FYYB 3VFRB 3O3BA 2WW8A 5JPMB 4ACZB 5KG9A 2HFEB 3GB7B 2AEQH 4X4YB 4E0RA 1E55A 3EJQA 4RISH 5I1AB 5I76B 3U4EA 4P2QB 3KL0A 5J4MA 4FQ2L 5DJCA 3TYGH 3DX6B 4H1LB 3U4AA 1NP0A 3IU4H 3LDBB 3GGWA 5FF6A 4HX1B 1R3LB 4ODVL 5I1KL 3S34L 1RK0B 2ZCLH 3N1PC 4ZXLA 5ICXB 2DI8A 4YXKH 4HJJH 1VFAA 1MFCL 1J05B 3RNKB 4D72A 5M94B 3OZ9H 1C5DB 1SMDA 4KK5C 1MJ8H 1JWMA 1F2QA 3ES6B 4JPWL 4CBPA 1JD9A 2DLFH 1L7IH 3WLWD 1NH6A 1DEDA 3TJHC 1IJ9A 2AJSL 1AO7E 5EO9A 5F6IC 1T5WA 1UA6H 4YDKL 2W66A 2DT3A 3M8OH 5F7DB 5CP3H 4XMKL 2GCYB 1CICC 3WSQL 4HZ6A 5ID1A 4MADA 1PJ9A 2KKQA 1FN4A 4OSUH 2ADIA 2R8SL 4JFFE 4E42A 4Y2OA 4DFHA 2AKRA 5E95B 3GNRA 2D7QA 4YXLL 2Z93A 5BVJA 2A38A 4MAUH 3SDCD 1CFSA 1AC0A 4MD0A 2I9TA 4CCEA 1VBRA 2FLBT 3S4SG 2CKRA 1UG9A 1MWAL 2R9HD 3QHFH 3I6LE 4Z95L 4N8VA 3WF0A 5T1DH 4ZO7A 3D39E 3S96A 3QUXB 1YPZA 2NZ9D 1KLFA 1B3XA 4KDTC 4JY4A 5HGBA 3QDMA 1B6DA 1ZLUK 1M7IB 4LU5H 3H0TB 4R6UA 3CDGB 3GSVB 1SM3L 1P2CB 3GMNA 4L8BB 3AHTA 1NBZA 2GI7A 1MIMH 3TJEH 1MEXH 4K3GA 1CLOH 4UINH 4LHJB 1Q94B 3IFNH 2DQXA 1HDMB 5BZWB 4P9ML 3FQTB 4G7YH 3U6RB 3RWIA 4DKEL 4GXPA 4F3FA 3HG3A 1FP9A 1MCRA 5IG7A 4V1DE 4LSPL 1GW1A 1VERA 2ORBL 2HISA 4ZTPH 5FO9A 1NCBL 4G8EA 2JJTA 3HC4H 4TSBH 4WSKA 3GK8L 4OLYL 1AFVH 4E41A 1RJYA 3QPXL 4X9GA 5TE6H 4RMWA 2XHYA 3TESA 3T2PA 5E6ID 3S35X 3BD5A 5HI5D 5IR1B 1ZU8A 4IBLT 3OPZL 2MPAH 3T0XA 5LBSL 4I77L 1X5LA 5ICYB 5BMFL 2R2EA 4UAOB 2IANB 2VXSH 4RNRA 5JHDA 1YPZF 4AMCA 4S1SH 1EZVX 3TV3L 5A6KA 5JIWA 3KPSB 4URTB 1FVEB 2BJMH 3BXNB 1MJJA 1CGXA 4PD4K 3O2DL 2F74A 1QFWM 5E6IB 5SX4I 2JCCA 3DNKA 3I3EA 3CX2A 2H8PA 5E99L 5C0IA 3CVIL 4LDLB 1V02E 4PY7A 2J88H 3ARFD 5DVMA 3DRTB 2AK1L 1I8MA 3UTSE 1JNNH 1AH1A 2VRAA 5CGTA 5EWIL 3M6DA 3HPJB 4LIQE 5D1ZA 4HPYH 2CESA 4HOZA 4EK7A 3V0WL 4PYHA 2EPLX 3O6LL 3SJVD 5HHXH 5IOPB 4NRYB 2GJJA 3ARFB 3F7VA 3QB7C 5IB3B 12E8L 4HUXA 3CHFA 1XFPA 4X7TB 4V27A 1E6OL 1JWSB 4RMRA 3WHE1 4UV4H 2HVKB 1P6FA 4DOHE 2CO7B 4OCNC 3DOSA 4X98A 3SJVB 4HV8B 4JVPA 5CUSH 1UVQA 2JCCF 1B4JL 3GZKA 4UDUA 4D6IA 5D9PA 4I9WD 4DVBB 3T0AA 2E7LA 5IXEA 1XGUB 3W0KA 1OCWL 3CZNA 3RZCC 4FQIL 1IE5A 2A6JB 4HWBL 4NZUH 1XAUA 5IWLC 3FQRB 4LCUA 2LFGA 2C4XA 4XVTH 3LQAL 3JVGC 4GLRH 4IDJL 2VTFA 3TYFA 5T3XH 2APBA 4PJDA 5D7IA 5A2CA 3ARBA 3ZL4H 3IDIA 1HHHB 1S7TB 4GAFB 2EDBA 25C8L 3FT4B 5GNZA 3K2UH 3GMLA 4JO3H 1RZJC 3D25A 3DYOA 5E8NB 4HS6B 2ERJB 4AWEA 5C0CB 2R0WH 3VXRD 4ZENA 4KRPC 2VR4A 2DQGH 3MV11 4UOQA 1CNVA 4Z76B 3HI1B 1NPUA 5D93B 4PRHA 4UB0L 3OKLB 4IISA 1FNGA 3LQAC 2Z31C 5ESVA 4FQCL 1QFUL 4JM4L 4NBZB 2XZCH 1A6TB 4NHCH 3GMOA 5I8EB 5E9DE 1Z5LA 5TQ2H 1VENA 4LX4A 1FAKT 4X6DE 4U3CA 3K81A 4WDIB 5MP6H 5AUMA 4DKAA 1TTUA 3SE4C 1ZXQA 2AJYH 2DMCA 3P77B 1YMMB 1HIML 4IRSD 3SUUA 1X5KA 1KGXA 3PABB 4GPNA 4PGJA 1R5VA 2AQ2A 4HD9A 4KDVA 2CDGA 2EPKX 4MNKA 1DQML 3O45A 4HXAH 4P2OA 4M6OL 1XIWC 3TZVC 4OB5L 2CPUA 4R4BA 4QCEA 2AQ1A 3MA7A 1NMCB 3DJ9A 4Y5YB 4O2FA 1UA3A 4NSBA 1KJMB 3AM8A 2DIBA 3QNXA 3TCLB 1TA3A 3WNPA 2EYTA 1HKLL 2FEDD 5GGTL 5FYJE 4GSDL 1BFNA 1MCOL 5JOFA 4KMTH 4M3KB 3VGBA 4U6HA 1BVLA 3O3BB 4PJFB 1PS3A 5TE7L 1KCSH 2GSGB 1YYMH 2DM2A 1GHRA 2O92A 1MRCL 2QKIA 1PG7X 3EYQD 3EYSH 5IMMB 4GRMA 1WC7A 2C9AA 2DQEL 4M7JL 2W9EH 4DGVL 4DKFH 5EFFA 5B39A 5EA0H 3T0EA 1JFQH 5DJCB 2Y7QA 3PWPE 1E6JL 1O0VA 5FF6B 4XTRD 3AROA 3EJYC 4MNGA 5D8JL 4TVUA 1DN2A 1HSAA 1CFNB 5T3ZH 1VFAB 4YFEA 1QLFA 2EC9T 1DANT 1MUJA 4JN1H 5D72L 1HX0A 4E2OA 3N1QC 2GSIA 3BPOC 1ACYH 1JWMB 3EJUA 2R4RL 1PBYA 4LFHG 4QYOA 3GSNL 3AHVA 4HUVA 1FC1A 1T89A 3T08A 2B1AL 1U8NA 2CUIA 4ZAKC 1MFBH 4YDJA 3WKNA 5BW7A 5EZJA 2B0SH 1FO0A 4P2QE 4PLJD 4PTTA 4JPKL 1TQWA 5FIPA 5GRWA 1NBYA 3OB0K 3VIMA 3MRHA 3ARGA 5DJ0A 1KPUB 5DT1L 3STZB 2RB8A 1IGTB 1Q9KB 5EZIH 5INCB 2YD3A 3MRGB 3IJHB 4H8WH 4F66A 3HAEH 2YC1A 3QDMD 4E42B 4XHJC 3WIFA 3MRMB 3EDDA 3IDXH 5CP7A 3RIKA 2HTKD 4Z7VB 3LRKA 3AXHA 3PTKA 4K3DL 2I07B 3LQMA 2DKUA 2I5YL 5E2TH 3SGJA 3TBSB 3QO1B 4TYUA 1QLEL 4N8VB 1UXSB 3S96B 4YC2C 1HILA 4FFWD 1CR9L 2MSPA 5DUPH 3MANA 3CFCH 2CKBA 3EO1A 4CCCA 3VFUA 1W1YA 1NMBL 1LO3H 2NY2C 2GJZB 1W9DM 1F45A 1V6XA 1ZJAA 2ZOKB 2FL5A 3GMNB 1A4JB 4K7PH 4E41D 4I5BB 3HE7A 5AG8A 5JNYA 5B38B 2KZWA 1BTCA 1BAGA 2GYSA 3RWIB 5CEYA 4EE9A 3DUSB 4JRXB 5IG7B 4M1GH 1FZJA 2N7AA 4OGAC 4RAHA 2YUVA 3T4AB 3AXXA 2J5LC 1HN1A 5EU7E 2FIKA 4U6XA 1EDGA 5JHDD 1XSKA 4GI8A 4F79A 3MR9B 1X6LA 2G5BA 3MUJA 4M4RA 1NGPH 3W37A 1AQ0A 3JUYA 1T3FB 3B9KB 3FO9A 3LKRA 3VWJA 1A1NA 4R2GC 3TBVB 2OR7A 3BIBX 4PB0H 3ELAT 1CDJA 1E4MM 4JJ5A 2R2EB 1N59A 1XSIA 4CCDA 2A9NH 4G80A 3T4YB 4LPTA 2WVVA 3ZR5A 3EGSA 3MRCA 2ADGB 1OL0A 2J47A 5BQ7B 4Z7WA 3C8KB 3X12A 4L3CA 4CW1B 1TMQA 4HOXA 35C8H 5D1ZD 3NCJH 5KW9H 1ZGLP 4X6EA 5I16B 4W7VA 1DL7L 4AH2B 2ESVA 1BYBA 3IKCB 1DE4A 1I8MB 3P4LA 4EXPX 3KPLB 3NFSH 3PZUA 3U7WH 4JPVH 4MTVA 1RFDL 5B3JF 3MRRB 4MAYA 5IIEB 3AC0A 1IC4L 4PJCA 3WS3A 4QHLA 5FDWA 1SYSA 2J8UB 3F7VB 4JFEA 4U5IA 4OZFG 4X0NA 4HUXB 2DQDH 2BVEA 3KPSE 3TO4A 5CAYB 1KBBA 2EE6A 4FQLH 4OJFL 4CADB 4NM8L 2Y36L 1I9JH 3K4DA 2YXFA 4EUPH 4KXZI 2WSPA 4OI7A 4JDVA 4YEEA 3U4BH 1HXJA 1YQ2A 4TVDA 3QCVH 4NKOA 2K9UA 4N0FA 4X98B 2Q3AA 2J6EH 2NTFB 3ARBD 1BPVA 4HXBH 3MLXL 1AXIB 2VH5H 3RWGA 5EO0B 4L3EA 3RQ3A 4UFLA 3O4OB 2J75A 4OBRA 2WCGA 2V2WA 2XKSA 1XF2B 2VVSA 1GL4B 4NNPH 1GJWA 3HI5L 1QPKA 1HEZA 1QLRB 1QI2A 4GQ9L 4LGSB 3HMWL 4NP4H 3RKDD 3T8XB 4PRHD 3HMXH 3ZE1E 3L3HA 4UV7L 2P8MB 3WY2A 1JTOA 1IZJA 4HKJA 1SEQH 3D48R 1QRKA 3QUMA 3MMEB 4R96A 3HMCA 4X4MA 3PJSA 3VFMA 3VRJA 3ZDYE 3FO2B 4OLVH 4PUBL 3L5WA 1PW3A 3NSXA 3SJVE 3GO1L 1T0MA 2E7HA 4OZOA 2PN5A 3HRZA 1FFQA 3OKKA 4UZSA 5JOPE 1FNGB 2FHCA 3MOAH 3MJ6A 4DQOL 1RIUL 4P2OD 3P4MA 3AIBA 4RGMB 4JHBA 4YUEH 3ALFA 5E9AA 3JXAA 4PGEB 1G7MA 3MS8A 3OKDA 2VZ3A 1JF5A 4W93A 5ENWB 4ELKB 4QXUL 3MJ8A 5AUMB 1MAKA 3POCA 4FQ2H 1ZGLA 3CC5B 1JAEA 4I9WE 3WF4A 3S34H 1WO2A 5AYUL 2XSBA 5ISZA 3DX0A 3F5KA 4BH7B 1WJ3A 3UJIL 4XBEH 5HJ3A 1MFCH 1YECL 4PRBA 4WJ5B 4H41A 3QXWA 4R4BB 4QRQA 5EU7C 3QI9B 2BNQA 3O2LA 1TA3B 4JZ5A 4TPRL 1BX2B 1MRFL 3LV3B 2VR9A 2AV7B 3DX7A 3T0ED 5HHMB 4L4VB 3VG9C 2Y4SA 3AS2A 4MDIA 1WDQA 3PDOB 3S7GA 1XGPA 1U2CA 1MY5A 2CGRL 5ADPL 3VXRE 4E9LA 1LK2A 2NW2A 4GQRA 3CVHA 1H5VA 1NDGA 5GXBB 1G1CA 1K5NA 4XVSH 4YDKH 1T2JA 1DQQA 2VLME 5IHLB 5J1SC 1YMME 4XMKH 4OCWH 3QXDA 4XP9H 5T5FL 3T0VA 3TVMA 5EUOE 3WSQH 5KSBE 5B39B 2D24A 4H20L 3T0EB 5AY7A 3NZ8A 2R8SH 2R9HC 5DD3L 3IDGB 4YXLH 5EU4A 4AIZB 2QR0A 3LVEA 1CYGA 2L7JA 2CUHA 2ZPKH 3ZT6A 3WUWA 1MWAH 3BZDA 4Z95H 1EJOH 1GJUA 4KZEL 4LLWB 4G6JH 3IVKB 3BVTA 5I24A 5HPCA 3QNZA 1R3IL 4A4AA 5SV4A 4IIQA 4OFYA 3ULSA 3ARGD 1FPTL 3BGAA 3QDHA 1GGTA 4JFYA 1SM3H 4GAJL 4JQVC 1EBPA 1F11B 5F71A 1IAOA 5I1CL 5J12B 3LKPA 4RQQB 5I19H 2ZX5A 3FN9A 3VGDA 5TDOB 5A6LA 3T1WA 4YDJB 1P6AB 3G6JB 1OT1A 5EZJB 4LSPH 3SHSA 2RR3A 4HLJA 4MA8H 5FYLH 2EIZA 1NCBH 2AMGA 3VI4F 1NBYB 3MRHB 1I8KA 2RIKA 5E6IC 2ZUTA 1NBVL 3KHQA 2YDRA 3GK8H 4J6RH 5CSZA 1YNKH 5B3NA 1UWTA 4Y5XB 4Z5RB 3DVNA 2WHLA 4ZUTB 2EO7A 3WIFB 2R56H 3HE7D 2EDRA 3OPZH 3RMEA 2ZUUA 1QEWB 5CEXB 5L8JB 4I3RL 5BMFH 4RSVA 4MZ3A 3TV3H 4KZDL 1T1WA 1HILB 3ZKMD 5KANI 1KTDA 4M61B 4B0MM 3ARFC 4LSQH 2QJDA 3VFUB 5KSVA 3O2DH 4PRAA 2FL5B 3F65A 5E8DH 2G75B 1IC5H 4NCC2 5TDPA 3FB6A 2AS5M 3LPOA 1Y6KR 3HE7B 3ROLB 3CVIH 3VWJD 4HF5L 1CE6A 2IAMA 1QFOA 4GRLB 2C7UB 4DK3A 2AK1H 4P8UA 1YEHL 2HA1A 1OPGL 4U1MB 3LEVH 5EWIH 1LO2L 3RGVB 1OQXA 5A16A 5ABHA 3AIQA 1CK0H 2G5BB 5A3ID 2VRKA 5D6DC 3V0WH 5CSUA 3JWOC 3O6LH 5KSUA 1II4E 3LKRB 3VWJB 3NIFF 2X4PB 2YSSB 4RDQF 4IOIB 3EO9H 4PJGB 2ESVD 4AZ5A 1V05A 2YOCA 4JJ5B 2DQTL 1KB9J 1HOCA 1KXTB 4G80B 4YHNA 2WVVB 2X8RA 2K3TA 1V08A 3UX9B 1US3A 4N5EC 4L3CB 4MAYD 5HDRA 2XN9A 3FJTA 4Y7EA 3WJLC 2Z8WC 2NYYD 5DD1L 4PR5A 3LSOB 2OR9L 4X6EB 3OLDA 3FHQA 4I48A 4W5ZA 5F7UA 5ABDE 4JFED 4TXEA 3BAJA 1OCWH 1DE4B 2AXFA 4WTZG 1OAZL 3RGHA 5BS0A 4HKXA 1NC2A 3TO4D 5E0FA 1D7FA 2ZG3A 2WC3A 3LQAH 1K4DA 1YMHB 3ARVA 4IDJH 4XAKD 1G6VK 4CVUA 4QHLB 1JNEA 4NO0A 5JDSA 1SYSB 3FOMA 5JHDE 4P2CG 4L3ED 2YD4A 5IBTH 1OD0A 1OP3K 5H35A 2BFVL 3I6GB 2H32H 1AKJB 3BO8B 1WZKA 2Q8XA 1IC1A 2XN1A 5DEGA 5BROA 2V2XB 1TCRA 4NN6B 1HH9B 4UB0H 5IGXL 1DZBA 4HHAA 1ZJBA 1BFSA 3UCRA 5GIRA 1IAII 3HCVA 4HIXL 3V8OA 4K3HA 4U6YB 4L3EB 4APQA 3QIBB 4IRSC 1KEMH 4UCFA 4HIHA 3ILPB 3BD3A 5F88B 3IDNA 4I18C 2V2WB 1BHGA 5DDHA 2MFNA 4MDPA 5CJXC 3UBXA 1P7KB 5GS0D 4K68A 3RIAK 3BP4A 2BOBA 2UZIL 5ITFA 2J8UE 4M7LL 3MJ9L 3OKEB 3UC0L 1DQMH 2EIBA 4GQPH 4FMVA 2MJWA 5GSVB 2J7DA 3RM8A 4D8PB 3PG2A 4U1NB 1A7OH 3O8XB 1DBML 1HHIA 2FEDC 3QUMB 4BSVA 3IS1X 1CDGA 3C5ZB 4MYWB 4R96B 1B4RA 4HZLB 3HC0A 1WZ1L 2J1KA 3VRJB 1HKLH 3CK0L 2M8XA 4YHZL 3QH3A 1UD4A 5CBEA 5D7SL 5GGTH 4KWUA 1T04B 4ESKA 4WW1A 2QLYA 3OKKB 4GSDH 1KQYA 3EYQC 1WE5A 5BZDA 4U3HA 3WFLA 5TE7H 5ISZD 4P9HL 4M5ZH 1J11A 1NQ6A 1M6OA 1MRCH 3L3KB 2O5YL 4J27A 1K4CA 1G7MB 4XTRC 4YPGA 4FLSA 2DQEH 2BNQD 4M7JH 4WY7H 1BQHG 3LHPH 2CH8A 4LCWA 4F7PA 4U33A 1CQYA 3VILA 1E6JH 2ARJQ 1LDSA 1JNHA 2H26B 1PY4A 3PDGA 1QO3A 4HMEA 2F15A 5D8JH 3U46B 3BW9B 2CLVB 2X2IA 1VJSA 1PYWB 2IH1B 3G5VB 3H9HA 5IB5B 3WH5A 4KUCF 5HBFA 4TUOB 4XMPL 1C8QA 3FB7A 5D72H 1OAXH 4RCAA 1XGQA 2DDXA 3O11B 5KTEL 3GM0A 2BY1A 3TVMD 2R4RH 1IEAA 4LP5A 5GNYA 5D1XA 1NJ9B 4PLJC 1TVHA 1AI1L 2B1AH 3QQ4A 3O4LA 5EOTA 4P4RA 3EDEA 3DUUB 3EOAA 5D6CA 5HTSA 5EBAA 2DL2A 3PXJA 4HIEB 4LLYB 3CVHB 3INUL 3CLFL 2EDFA 5CHNB 4JPKH 1BGAA 3CFJB 1V6YA 1K6QL 2HTKC 1YYLH 4OFYD 5CCKH 3A23A 1YEKL 3KS0H 4W8LA 1V7NL 4GZEA 4X6CA 4OFPA 4Q6IA 3D4YA 4J3VA 1L0PA 1LE9B 2R0LH 3QQ9D 2WMKA 5EU4B 2L7UA 3QDJA 3TA3A 1JPTL 3BQUA 2ZNXA 4X4ZA 2JJTC 4Y0GA 5K59F 3WUFA 3KVQA 5HHNA 1XZ0A 2OCFD 3G6DL 1DJSA 5HHME 2FIRT 1CR9H 2G9HA 4TNWK 4IIQB 2Y24A 2NX5B 1QOXA 3VXSA 3CD4A 1NMBH 4UFMA 1VFMA 4I3GA 2BVOB 4PS4H 1IAOB 2VL4A 4NHUB 1HJSA 3S36X 3WMSA 1BBDL 4C4KT 4P2RB 3QEHA 1TVNA 2A0LD 3LRHA 2DT1A 1C16B 5CS7A 3T0EE 5SX5H 3VG0L 1QSEA 5D9NA 1OGBA 2IWGA 2A77L 2V3GA 1H3TA 5FO7B 5CSZB 3VI3F 1A3QA 5DHXB 3U1SL 5E2VL 5BO1L 3D69A 4B3KA 1ZVHA 3NJ3A 2D7NA 1F8TL 3O41B 3WY4A 1WICA 2OYPA 2KDGA 1TQSA 2IAMD 5FYJH 4KQ3H 5D1ZC 1Z9LA 3VXQA 1FL6B 1F3RB 1XR8A 2OWXA 1HL8A 1H3PL 3VD5A 1C12A 1BQSA 1QYGL 5DYOA 1CFQA 2B5IB 4PRAB 5D2LA 1EVUA 1XR9A 3QXAA 3JTTA 1JPSL 3FB6B 4YE4H 3ULUD 2XM1A 3RKPA 4HCRL 1CE6B 2P24A 5IHSA 3RJQB 2CCRA 5LCVL 3FQNA 3WO4C 1F4HA 4AD3A 4NQUA 2XACC 4GG8A 2BSRA 2VQ1A 3W29A 1RFDH 2XG5A 3BGFB 3I84A 2DLGA 4G8FA 2RFXB 1IC4H 1EEZA 4G42A 3VWKB 1U8PA 2E7LC 1IAKA 3FRUA 3RWDB 2XN9D 5TF1H 2CO6B 3UG3A 1PZ5A 1AQMA 3GJFA 1BBJB 4JO1L 5GGSA 3ULVF 2AAAA 3PHSA 1RVFL 2YPVL 2PW1B 1PX4A 2Q3ZA 4AJ0A 5BS0D 2Y36H 3ARBC 1NC2D 2NLJB 4LMQI 4HLZH 3A0OA 2EEBA 3Q6GH 1A3LL 1G7QB 1JGVL 2HKHL 4HIIB 2GFBB 4H1LH 5IJVA 1R75A 1AGBA 3MLXH 3GIZH 4PR5B 1M71B 4HGKC 4A2MA 1D6EA 1NFDA 3DVGA 4I48B 4NO0D 5ACMA 3B43A 1NWSA 5LKNA 2COQA 1HH6B 1ORSA 4LNRA 1J1PL 2WC7A 3L2LA 3MUGB 4HKXB 3RKDC 1NC2B 5C3LD 3HI5H 3IJ8A 4FMKA 3HMWH 4LEOB 4R90L 3WIHA 3MI6A 2WW5A 1GOWA 1O7AA 4Q9QL 4PJGE 3N85L 3PHQA 4UV7H 2LV4A 2VDLL 5E00A 1YEGL 3RHWF 2VDQL 4APQD 1JYWA 4LRNL 1YEFL 3Q3GA 2W61A 3IF1A 2DWDA 5KVFH 4PUBH 2CERA 5A2LH 1JCKA 1ODUA 3GO1H 1XCWA 5ABEA 4LLVA 4P2OC 3KPNA 4PTMA 3QWOA 4BQ9A 1W2VA 2ESVE 1MCEA 1U58A 2PI6A 1BQUA 1ZSDA 2H6PB 5GIRB 3D0LA 3O3AA 4DQOH 1W0VA 1NFDF 1RIUH 2DKMA 3HZ3A 4YHPA 1GPFA 2E27L 1UACH 1TQBB 3HA0A 2D3LA 1GGCH 2IH3B 4QXUH 1GGUA 5DDHB 4Y16B 3UBXB 1W72H 1X4XA 4KRMB 1WAAA 1RHHB 3MXWH 4HK3J 4PJCE 1UD6A 3KLKA 1J0KA 4KDWA 2BSSA 5AYUH 4HBCL 1GH7A 4PFEA 3ZO0A 3UJIH 4R3SB 3PTMA 2CDEA 3CFEA 3BKJL 1L6XA 4CVXA 3T0EC 4JHAL 1DSFL 3EOBB 1NARA 3HC0B 3WQWA 1P1ZA 1G1YA 1KN4L 1I1WA 2NY3D 4OFKA 2ZOLB 2ZIDA 2MANA 2WZIA 1MRFH 4LCWD 2IPKA 5CBEB 3FQUA 1EOKA 4ZSOA 1P4LB 1ZLUH 4L3EE 4ZNCD 3AREB 2CGRH 5ADPH 1UWIA 4HFUL 1W3JA 4Y4FB 2X1QA 4YDVA 1ADQL 3AHYA 4PJ5A 4LASL 3HE6B 1YEDA 2YUWA 3OV6A 1K4CB 2FZ3A 3WL9A 4D9QE 1T89C 3UP1A 4LAQL 5J12C 2VWEE 2FBJH 3C6LA 1ZLWK 2D7PA 2BDNL 2D4FA 1VBUA 3QUKB 5BW7C 4TVPL 4OLZH 4UQ2A 3AY4A 5D1XD 2J7GA 1QO3B 3SCMA 1WP6A 2A6DA 5MI0C 4WI9A 3FN0L 2Q7YB 1BM3H 3O4LD 3WHXB 3RO8A 4W6YB 3ARGC 4WV1A 2E5EA 1OD7A 5GGSY 5E1HB 5J6GB 2EABA 4L29A 4Y5XC 4OZ4A 1R3IH 3PV6B 3BUYB 1JGEA 3VGAB 5L9DL 4JFZL 2X9YA 1FPTH 3D0VA 2MOVA 5KZ6A 3ME0A 2FSEB 4GAJH 4MDJA 5D1XB 5JW3L 3SGJC 1IEHA 3O4LB 1G94A 3DHPA 3WDHA 4GZIA 4Z0XA 3AZSA 3TH2T 4AY1A 3EOAB 4MZ2A 3KYMB 1HNGA 1NKRA 4U1KA 3QDJD 3TA3D 4HT1L 3T65A 4M24A 5ETUA 3BQUD 3NBNA 1SY6L 1H0DA 2VXVH 4PJ8D 1H3UA 2GDUA 1ES0B 5I2UA 2DSWA 1NBVH 1F3DH 3I3DA 2KBGA 3GMPA 2X09A 3HE7C 4JCMA 4KJPD 5EU5B 1G0YR 4ZUSA 1DQLL 4O2CB 3VXSD 4GRLC 4X6CB 5JXAL 1QNSA 3NCFB 3E3QE 3W6LA 3DUHA 4TUKH 3GBLA 5FA4B 5E8PB 1RK1A 4G8GA 4JREB 3ZKMC 1KFWA 5FO8B 2NW3B 5GS1B 2B2XL 2EACA 1BQLL 1XZ0B 5IVZA 2XA3A 3VFSA 1G7JB 1I3GH 4NKIL 4MXVF 1QSED 1MNUL 3VWJC 3X11A 2VC2L 1E27B 1QVBA 5IVXA 1MH5B 2ADFH 4EI6A 2OK0H 3WFDL 4DWHA 1KXVA 2WMFA 2V7NA 5DZOA 4PCSA 4D6CA 4PGCB 5A3IC 2WHJA 1YEHH 3ARRA 3MFFA 1VACA 1REIA 1LEIA 5D7JB 4FXKA 3KL5A 1AE6H 1NGWA 1OPGH 4JRWA 3EYFB 1JK8B 3V8CA 3O6FB 5I73B 3RI5K 2IG2L 1XCQA 4UFIA 2YBUA 3VINA 2XXCB 2ID5A 3DX2A 1ZEAH 3CPUA 4LLMA 3A22A 4W7WA 2WKLA 1N2RB 2WWKT 2D31B 1ERNA 3FRPG 5C0ND 2ZNWA 4CVZA 2X4SB 1U95A 3H3PL 2Q6WB 2DQTH 5CJQH 2BV9A 2QSCH 2NYYC 3CGTA 3NGBB 3VXQB 1MCQA 1F4AA 4WI2A 1KTKE 3ARYA 5GSRB 4HKBA 4JJHA 4YZFF 1CFQB 3PL6B 4EIZC 5DD1H 3TO4C 1BD2A 1XR9B 1BOYA 4P2RE 3WNOA 5CD5D 5CZVL 1N64H 4PG9A 2D3VA 3OGOE 4UU9B 1EFXB 4ODHL 5E08L 2P24B 4DO6A 1VFBB 2YA1A 3FQNB 3GJFK 1OP5K 2DAVA 4JANB 1EFQA 1NCDH 4NXSA 4QY8B 5FUCC 4NQEB 1NEZA 4PBVC 4IS6A 3VXOB 2VQ1B 3B9AA 1NAMA 4BJLA 3GUTA 1OTTD 2AJVL 3QIBC 4HWZA 1UCTA 4DZBB 1EEZB 3GXTA 2C0HA 4JR9H 2QTEA 4F58H 1OSEA 3LN5A 3M1BA 2UWEA 3FRUB 1C91A 1S9YA 2JK5B 1VADA 5IB4B 1JP5A 3MRJA 5C6PB 5J7CC 4Z18A 2CBIA 2FLRT 4JKWA 2X7LA 3SDAB 1C5BL 2OSYA 1YC7A 5EZLA 1KEGL 2VWEC 2YD2A 1RP8A 4JVWA 5HDQL 1KCRL 4L1DA 1M03A 3V9FA 4TTUA 1DLHB 3NSNA 5IGXH 5MEOA 4PLOB 3SGKC 2EE3A 4WF7A 2YFNA 2IF7A 5IJVB 2EYSB 3VA6A 2JEPA 4HIXH 3NA9H 1D6EB 4IUGA 1XF5B 4GRWB 5GS0C 5LJYH 1XH3A 1FNLA 4W86A 2JEQA 1H5BA 1TVPA 4OQ1A 4LNRB 4ATWA 3BAKA 3MV8B 3R06A 1B3WA 4MNQA 3LN4A 1UWUA 5GRXG 4NNYB 4P5MA 4X7SH 1GOHA 2ZUYA 5IJKC 3B9DA 3ULUE 3BHBA 2DQFB 3MJ9H 3UC0H 4ZUWA 1FBIH 2UZYB 1ZANL 1LEGA 4QXGH 3V6OA 4Y2DA 5F7LB 2ICWA 5K9OA 1H9VA 3SCNA 1TTFA 4YK4B 1KQZA 1WZ1H 1OB0A 4LDOB 3IF1B 2DWDB 3ARWA 3CFIC 3HPLA 3TLRA 1JZ7A 5D7SH 3BLBA 1JIBA 3E3QC 4K94L 3MMDA 2J7EA 1UZ6E 3DWTA 1UQSA 4E5XA 5KVDH 2F7RA 5AG9A 4HJGA 3AICA 5FAAA 4P9HH 3O3AB 3OLEA 3KLDA 5I66B 3WXVL 1GJIA 1QHZA 5HSFA 4HAGA 3LXCA 5INDB 2FGLA 1ZKAA 1LLOA 1G9ML 3SUVA 1XF4A 3VIKA 3OB0H 2A6KB 3LKSB 1P4BH 5I18L 4W81A 1HKJA 1BPLB 3AB0B 2J4WL 5KN5B 4O9HL 2F8QA 3TVMC 1QOKA 5IROC 3CFEB 1G7LB 4QXTB 3DSNA 4XMPH 2NY6D 4PJ5D 2B20A 4DGYH 3N1AA 5E8EA 4BYHA 1JL8A 5HHOA 3KPRA 2LAGB 2F7OA 4XWOC 1TETL 3C6LD 7FABH 3W39B 1JE6A 1WBYA 2DBLL 3FQUB 1AHWB 1AI1H 1FGNL 2C4FU 3EJSA 3RUGF 5MENA 4F33A 4Q9RH 3SCMD 1XGTB 4PIRF 1MJUL 1EXUA 4ZFZB 2DIEA 1CL7I 1S7SB 2EC8A 3UTPE 1TJIH 1WFTA 5FFLA 5KZCD 3INUH 3CLFH 4IIQC 2NY6B 3QP3A 4I4WA 4AD1A 1JYNA 1FYTB 4ZFFA 1GCFA 1K6QH 3QQ9C 1MCIA 3A6CL 4PJAA 3F12B 1YEKH 4JL1A 3KR3L 3CX5K 3BCFA 1D5MB 4ODBD 4YO0A 2FCBA 1JPTH 4B15A 3HAEG 5J06A 1MOEA 2G4FA 2V9QA 3UPCA 2W38A 4QWWD 1SEBA 2VO5A 4OZ4B 1QRNB 3FFCA 5J0BA 4PJEF 3A6BL 2FR4A 3D0VB 3QRFM 1ZVSA 1PIGA 3S3SA 3DX8A 4MDJB 1A0QH 2A0LC 4CL7A 2V3EA 4NM4H 1ND0A 3QAZC 3AMLA 2W0LA 1BBDH 1RJLB 4G8GD 5HHPB 4AEIH 1TQCC 3VG0H 3L2MA 5TJWK 1K8DB 2B5IC 3BH8A 5DRZA 5KBNC 5L2JA 2PYFA 1QFWL 2ILLA 3CMGA 4QO1A 3BZ4A 2OYKA 5E5UB 4B5EA 4ZUSB 1H1NA 3G6AA 3RWHB 3U1SH 3DIFB 5E2VH 2IAMC 1KIRA 4UNVA 3AIWA 2L0DA 4XBGB 3DV4A 2Y9RT 3KDMB 1U93A 1UKQA 3RX7A 3U7AA 2PWGA 2V7HA 5GISL 2ZWZA 5CG0A 3GI8L 1HZHL 2GAZB 2AJZA 2XG4A 1BVKA 1GOOA 2HWZH 4OOUA 1MELA 4FTVA 5I17B 4ODXA 2BNRA 5ITBL 1R24A 4PY8J 1N0XL 1CLYL 5C08A 3O4LE 2XZAL 1OAUH 3ULUC 4C7DA 1RJZA 5F6HI 5IVXB 3GSQA 4EOWL 3SGDI 1JPSH 1PQZA 1US2A 4WIQA 5CJBA 5IK3A 2HG5B 4HCRH 5BXSA 3F58L 2UY3A 3MFFB 5F1OB 1VACB 1C90A 3HLAA 3DECA 2R0ZH 3I85A 4DUXA 5K9QI 4K2UH 4X6CE 2F53B 2QSQA 1PX8A 1CTNA 4F8QA 5CKAA 1FZMA 3OAZK 4JDZA 4ZYKA 3CLWA 1XCQB 4X5WB 1X4YA 3AIUA 3QDJE 1AQDA 1BOGA 5TQ0L 4M8UA 3ZE2E 4XAWL 4F2MB 4HUWB 1GQKA 1BD2D 3DDGA 4EQ3A 5JORA 4JO1H 3AU1A 1U95B 1KJVB 1RVFH 2VX4A 2YPVH 3VXSE 1TMCB 1HWWA 1KSRA 4A2LA 1A3LH 1OLLA 1EGZA 1A7PL 2V3DA 2VOTA 5TGBB 3SDYL 1JGVH 2HKHH 1V3HA 2EDQA 2PO6A 3DXAA 1PEZA 1F6FB 3VFNA 5BRZA 3PZTA 4RFOL 4G5ZH 4RWYH 1XCTA 3LEYL 43C9B 1JG9A 4MD4A 4BM7A 5D71H 1PDKA 3D2UA 1NEZB 4AENB 4BZYA 3WD2A 4EKJA 3GUTB 4APQC 4LLDA 4HWZB 5JZ7D 2Z8RA 4FHBD 2FECI 1V3IA 4YEFA 4OIIL 1QHOA 2XY1A 3MA9L 1S9YB 1GVIA 1VADB 5DEFA 2VDLH 1OF2B 4Y16C 4DKDC 1YEGH 1BG4A 2BSTA 5IFTA 1FVCA 1YEFH 3GJEA 4CMHB 5EZLB 4Q7DA 5DD0L 2CIIB 5CBAA 2V5DA 5DJYB 3BESR 3QYCA 5J89A 1FP8A 4MNQD 4XCNA 5D2LE 2BC4B 5DURD 1D9KB 5KVMC 3DROA 4XZUA 3QUZB 4PJXF 2BCKA 1IBGL 4U7MA 5F1KC 2FH6A 4BSWA 2F5BL 2CLRB 4LSRH 2Y06H 2X70B 3PWVA 4JFTA 2F8VA 2YPLA 4X7DC 4Y2DD 5MERB 3WE6A 1NP2A 4W85A 4NQEE 3EUUA 1DDHA 1HKFA 5EU3B 2A3AA 4AMXA 3QUYA 2ARJB 5FA3A 3JZ7A 3W25A 3QEQB 3UJTL 3OG2A 3K46A 4NBYB 4AISA 4ERSH 3WCYA 9CGTA 5ERWA 1J8HA 2ZCKL 5HGHA 4QTIL 1EERB 3O0RL 2NY3C 2CIKA 5EIQA 3V4UL 1XF3B 2ICWB 4JHAH 3GEWB 3MGTB 1DSFH 4ISVB 1J0JA 4NQDA 4C83A 2XFRA 1Q9OB 1ZHNB 2OM5A 3FY1A 3TC9A 3V6FA 4XHQA 4RX4A 5B22A 4FG6D 3HPLB 2VDPH 1SJEB 1CLVA 4XNZB 1CLZL 2GUOB 5BXTA 4HZ8A 5AC4A 4GRWE 2MKWA 3DARA 3PGFH 3C08L 4HFUH 4HJGB 4XZBA 2PR4H 3VU2A 1IEBA 2C3VB 3MO1A 3MV8E 5HI3C 3LD8C 1DWIM 2PBOA 3N0PB 4P2YA 2NY1B 4RZCA 5D1XC 1I1XA 4WHTA 2FEEL 1UD2A 3I9GH 4LAQH 3RNQA 2O9RA 1XF4B 1S5HB 1MYRA 2BDNH 1KGUA 2A3HA 1T0PB 5E2JA 5F7FA 3KPRD 5HHOD 1JD7A 1FH9A 4TVPH 1EO5A 1WTGT 1BVNP 3FCTB 2V3FA 3TBTB 1C1EL 4WEUD 5MEND 3HZMA 1CG9B 3I02A 3O81A 4XNXL 4F7EA 3ZIZA 5DQJA 1FRGL 3WH8A 3OR7A 1Z3GL 5JBEA 3KLSA 3W0WA 4Q6IC 4R26L 1NFIB 4JFZH 5L9DH 5HHOB 3KPRB 3WEZA 1J0HA 5KEZA 1FSKC 4JREC 3TA3C 1QBLH 3BQUC 1AR2A 1LP9A 2J8HA 4LEXL 5GS1C 2GY7B 3MLPA 5MENB 4F33B 1TITA 1IGYA 4NN7C 2JJSA 1WFOA 3MCG1 4S1RH 4J8RA 4GXUN 3O2VH 3JV6A 2EE9A 2J2ZA 5CP3A 4EBQH 4YWGL 3BVUA 2X1IA 5EB9A 2ATKA 2EADA 2HLAB 3BSGA 1BWMA 5IMKA 3FFCD 1DQLH 4PJAB 4CGTA 4GS7B 5C0BA 3MRDB 5JXAH 5DD6A 1LVEA 1EUTA 2VRJA 1N6QL 2Z0BA 4WCYL 5HPMB 1NUNB 3K2MC 4HIJB 3KWWB 4YO0B 5GRYA 5I73C 3QZWA 2P49B 4NWTL 2DQJH 2B2XH 1PPIA 3WF3A 4M7KL 3L1OL 4NKIH 4ZSOE 3LRLA 3LPGA 1KLGA 2UV3A 2FR4B 2VC2H 5ANMA 3WN5A 4U0RB 1L0XA 3C2AH 1UWRA 1JNJA 3TPUB 3EYVA 2BVTA 3UCQA 1CS6A 1XGZA 3TT1H 2XQYG 4WHYH 1YJDL 3H9SA 3EDJA 3T3PF 4GKLA 1B3JA 4KROD 4O58L 2ZSVA 1Q6DA 2CLZA 3PNWA 3U9PH 4ZOCA 3WFEL 3PL6C 4ELMA 4FTVD 4KRUA 5JTWA 2PYFB 4YLQT 2BNRD 1JFXA 5C0NC 5C08D 2VITB 4NFBA 1KG0A 3G6AB 2D1ZA 1LE5A 2IUZA 3GSXB 3DV4B 4E8DA 3CJJA 2NPLX 5K93A 4D9RE 1I7ZA 2OWCA 3E6HB 5HDOA 1PZ2A 3WF1A 1QRNE 2CK0L 2X9WA 1DTUA 3H3PH 3BC9A 1V8HA 5ILTL 3KLLA 5CD5C 2A74A 3IFLL 3GHBL 1OP3H 2YJQA 1FJ1A 3VXMA 4P8XA 1RJZB 3CZJA 5DK3A 4O00A 1HWHB 2LAAA 4GW5B 1JXKA 4ZEPA 3B6SA 1MIEL 4P4KA 4ODHH 5IHZA 1UR8A 1J1XL 4M8VA 2Q8AL 5EO1A 5L88L 5IHUH 1S7UB 1WT5A 2J74A 4NPYB 1S7XA 3IDYC 2YA0A 3QUMH 4LMQE 4MHHG 2Y23A 3NCBB 3PHOA 4RE3A 2AJVH 4BCEA 4F7MB 1R3KA 1BOGB 32C2A 4JZOA 2PO6D 3DXAD 4PJBA 4MXWL 1JPFB 4Z7UB 3UYRH 5BRZD 1VEMA 1C5BH 2GJ6A 2QHAA 1KEGH 5F8RC 3P4OA 2PTTA 2DBJA 3VXNB 5IVXE 4L8SA 1LF1A 1DFBL 4O02L 1UM5H 2XQBL 3VA2C 3D3AA 3MNVA 3D2UD 5T33H 5C1MB 3CZFB 2LABA 4LPXA 4KTDL 1BEYL 4NFDA 4X9HA 3R8BB 4YK4C 4L4JA 4JVUA 3WH7A 2J8FA 2YS4A 4UT6L 3QHZH 2JE8A 1OWWA 4OAWA 3QDGB 2APTA 4GOSA 1RY7B 3BKCH 2H45A 3JTSA 3FZUC 2PTUA 1P7QA 1BAFL 3D5OF 1JDAA 4KU1A 1IM9B 1GNXA 1LEKB 3D2UB 2X4OA 4XXDB 4AT6B 3BVNB 4Q9CA 5J13B 5DUBA 4H7VA 3W38A 4OBSA 1NDMB 3GSUA 4LLDB 4R9HA 3MRIA 3CIQA 2DIAA 1ZANH 4GXUM 4PRIB 3BVXA 2MTPA 3VRLF 1YEIL 1Q9LA 3OX8B 5DJ6A 1X3DA 2W0FA 4ZODA 3OXRB 4GAGL 3CVHH 5CBAB 2E9MA 2X0YA 1FVDA 3QUYD 2I60L 4W88A 4K94H 5JR1L 3IJ7A 2XI9A 5CFHA 1J8HD 4BSWB 2IQAB 3VCLB 2VCBA 4O2EA 4W6WB 2QMJA 3I6KB 1A7BA 4N68A 2XOTA 2YPLB 1ZT4A 3WE6B 3WY3A 4YIQA 4W89A 1AHWC 4U1SB 4GG6F 3RL1B 4NQDD 4OF0A 2Y8KA 2B7DT 3ZTJG 4UR9A 3DGGB 4P59H 4X9YA 5FA3B 4RX4D 2YLAA 1EHAA 3F5LA 2EIDA 1G7IA 4HC1L 1UM4H 2BMKB 1T5XB 2UWEE 4Z77A 1R5IB 2EH8L 2NY6C 5EZOL 4O9HH 4PRWA 5ERWB 5IHBA 4WK9A 2GITB 3BIKB 4FQQA 2CIKB 2I9LB 1QI4A 1T66D 3C6LC 3FAXA 3GRWL 4HS3A 1UZ8B 4C83B 2W59A 4UT9L 3AY4C 3SCMC 4JM2A 2IBZX 4AZBA 1CFTB 1GQIA 3W11D 5DGQA 2DBLH 4OM1L 1FGNH 4WV1C 3SGEI 4LQFL 1MJUH 2W0PA 1OGAB 5I0DA 1U6AH 4XP1L 1QSFA 1E4WH 4JKKA 2O9PA 1JWUA 5F21B 4RZCB 4G6FD 4JFDA 3QEGL 3QEQE 1QACA 4LPVA 3W0WD 2WNWA 3CV5A 1DBAL 4Q58C 4F7CA 3V5KB 2E8ZA 3KR3H 2OXHA 3QJFA 2VZTA 4GMSL 3CSBA 4ZUVA 4B9ZA 2XWBB 4IM4A 4F7EB 5DJDA 5DQJB 3BKML 4HUUA 3OR7B 1U41A 3B3IA 4GBXB 3H7LA 4JY6A 3OWEA 4KY1L 4NRRA 1OTSC 2OLHA 3BIAX 2PTVA 1T21A 2DN7A 2WLYA 4OLWL 5C0BD 3DX9B 2GTWA 1IGYB 4EDXA 3NCOA 1B2WL 1YEEL 4XPAL 3VFOB 4J8RB 5FM4A 2LE9A 1QZ1A 3JV6B 1INDL 3GFUA 4FP8L 1WCQA 4RFEB 5KJRL 5C86A 3AIRA 1A3RH 5IMKB 4MWFA 1KXVC 2GJXB 1RV6X 3CSYA 3QXVA 1FFNB 4M9PA 5FL1A 2AJ3A 4K7FA 5HY9B 1HIZA 2VX7A 5FYKE 4M7LT 5GISH 2J25A 1Z9SA 3AAZA 4LLUA 1Z9MA 5BWFA 3H9SD 3LZFH 2LVCA 2WWMD 5DC0A 3SCSA 5HHOE 3KPRE 5FECB 1T4KB 3L7EA 5JOEA 5DLML 4M82A 5DS8B 5ITBH 1M53A 3BPCB 1N0XH 1CLYH 4OCLC 5B4MD 3SOBL 5C9KA 2XZAH 1KLGB 1V3LA 5MENE 1SFSA 1P4IL 1IZKA 5C0EB 1S9VA 3EYVB 4EN3A 1ZS8A 4UIMA 2EXYD 4CUCA 3OTTA 2C26A 4ZTOH 1WBXB 3Q0HA 4MX7B 1ZT7A 4Z7QE 4P7RA 3D18B 2ZSVB 3E2HB 2I27N 4JFPB 5IFJA 2AQ3A 5TDNB 3PNWB 4UI2A 4PJAE 1O6IA 6FABH 4WIWA 4PGZA 3WDPP 5IEKB 4EDWL 1EVTC 3U5UA 3MUZ1 4YJZL 5M03A 1KG0B 3VXMD 4YR6B 5C0FA 5E2UL 3EBAA 4HU0A 4WWKA 4XAWH 4BH8B 4BQ6A 3JV4A 4PG2A 1Z0MA 4DGIL 3IDJA 1I7ZB 1KV3A 1JVKA 3FB5B 1INEL 1H3GA 1N26A 4M1DL 1DUYA 3BP5B 3DMMA 4P4KD 1F02I 4GI6A 3OL2A 3FFCE 1T7ZA 3GKWL 4OCXL 1NAKL 2A74B 3SKMB 4EVNB 5TFSL 1BJ1J 4LGPB 3VXMB 4MPKA 3SDYH 4JAMB 1UH4A 2FX8L 3JV0A 3ROOA 1F4YL 2YBRB 4DUVA 3B6SB 3CHCA 2FX9H 3FKUS 4P4KB 2CPCA 4RFOH 4GO6B 1HP4A 4H1LG 3F7YA 2GJ6D 5JZ7C 3S4SB 4RMUA 3KJ6H 4NO3A 1KIQA 1A2YA 4DCQA 4L8DB 4NGHL 1HINH 3QJHB 2J12B 2IBGA 3PHOB 1JAKA 1CDHA 4XNYL 1R3KB 1UJTA 1H5BC 32C2B 2HJFA 3BP7B 3NIGE 3MA9H 2A83A 5D5MF 3KYNB 4PJBB 3WO3B 3SCVA 4JCLA 4R8WL 2DTML 4D0CB 3SUSA 4WRLA 1RH9A 4XNMA 5DD0H 4Y4KA 1P7QD 1Q0YL 5F7EL 4EUPA 3U9UA 3DYPA 5A8NA 1QTYT 3CMOL 2G60L 4XB8A 4S2SA 5T3XD 2JJWA 2J6EA 1IBGH 1GSMA 1OW0A 2XYCA 3EZJB 4RIRA 5J9PB 2F5BH 2LQRA 3VSUA 3V6BR 5C70A 5HVFB 5HYSA 5I1EH 1HKMA 3M7SA 4NJ9L 4KJYA 2NTSP 4R4FH 4NUGL 4XNZC 3WUZA 3H7BB 1RSFA 1P7QB 1IM3A 1DLFL 1V7ML 4FLRA 4ZO8A 5FYKL 4GT7A 1JRHH 5HYEA 3L5HA 5LGJB 3QHMA 2ATPA 4I0CC 3UJTH 4L4TB 1D5BA 1ZLWH 4S10A 2VDOL 1AGCB 2ZCKH 5CZKA 2OBGA 5SWZD 4AZCA 4Z7UE 2O26U 2NY1C 1U8JA 2WBJA 3MRIB 3WEOA 4KI5D 4FG6C 1E73M 3V4UH 2QLVB 1VPOL 1TNNA 3VGHA 2W0FB 2J7FA 4PBWD 1KT2B 4LHUA 4OFIA 4OUEA 4YGAB 3KYAA 3GH5A 5DHVA 1FVDB 3FB8A 4K7PY 4B9YA 1X5IA 4JG1H 3QDGE 5BRZE 4WHDA 1XGYL 3C08H 4ORGB 4PUDA 3NAAL 2DIJA 2OJZL 4WSJA 2GK0A 3QQ3B 3N1FC 3ET9F 1JPST 1N3NA 5LGKA 1DWAM 5HHVL 4XXCA 4D2NA 4DVRL 1L6ZA 1SVCP 4BQ3A 1KNOA 3RAJL 4M7ZB 2AGJH 1U3YA 4OQTL 2WANA 3VH8A 4JM2D 4EEEA 3OKOB 3EFFA 2M1KA 5T1MB 4PRIE 1QBML 2WMIA 1N8ZA 3BEVB 1ZLSL 4MHHI 3W9EB 5CKGA 2IPUK 3L4TA 1MCPL 4XNXH 1SMAA 5HVHB 2NR6C 1FRGH 2D9QB 1QSFD 3PTQA 2D03L 4NQTA 4D0BB 4NZDA 4R26H 1IQDB 4DW2L 4JFDD 1KN2L 2H41A 4PRPB 3TF7C 4NQCB 5J57B 1XF1A 4FFVC 1CU4L 1RZKC 1WGOA 2YPLE 4QRRA 2EXWD 4TRPL 4FNLH 1QSFB 4XVJL 5C07A 4U0RC 1UZ4A 5ALCL 3TH4T 3VRIA 1LG2A 3EFDH 4FXGB 1H11A 5FGCB 3WFHB 2ZX6A 4MA3A 4QCIB 5F7MC 4XPBH 2L4OA 4G43A 2XFFA 4U7SA 1LDPH 4WCYH 1K85A 1CXEA 1MWAA 1Q6CA 4MNHA 4U1LB 5F3BA 4EAMA 2PYEA 4U31A 1NBQA 4FQXB 5SV3A 1H2JA 2XM2A 4BQCA 4U1HA 3C9NA 1J01A 1A4KA 1PEWA 1SYTA 1V0NA 3MLTA 3VGGA 4KROC 4ZDHA 4C56B 3RU8H 3NCYP 3WLBA 3LS5L 4NYLA 1MW0A 3E1F1 1QKZH 1AQKL 2GTWB 2JJUA 4IJ3B 1DBJH 1KFAH 1A6AA 2CD0A 5F9OH 1R3JA 3V52L 5IW1B 1T2QL 3QRGH 3U0PB 4I8DA 3GJFH 4M8QB 5E1AB 1OP5H 1CD0A 3SN6N 1DQDH 3QCUH 4KJWC 8FABA 3LRMA 4NRZA 3CSYB 2OTUA 2WNGA 1U8QA 5E70A 3UTZA 1FOBA 4QT5B 4AMKL 4EN3D 5I8CA 3F4VA 1TJGH 5EN2B 3W0WE 2CK0H 5L0QC 4IHOA 4HK3N 4I3SL 4S1DD 5ILTH 2YL6A 4GRWH 5DSCA 3UESA 2EKJA 1QVOA 3SKJL 4AD2A 4Z78A 3O2DA 4GKNA 3RL2A 1T0OA 1H41A 5DK0B 2GT9A 4QDMA 1S9VB 2BNUA 1UM6L 3RDKA 2GTZA 4RE4A 1I1AA 1I9RL 4K3JL 4KAQL 4GO8A 3MGOA 1ZT7B 2YKLL 2C3GA 1J1XH 4M62H 4ODUA 5DVKA 3MSDA 5LAXA 3ZLQC 3DMMD 2EDOA 1AP2A 1PG7L 2PO6C 5C0BE 4HH9A 1HJUA 3FOLA 3MREB 3FQXB 1B3YA 4HU8A 1ORQA 2Z91B 5I71B 2UVFA 3MLUH 5I75C 4H5SB 4XBPB 1QNZL 2A6IA 4WWKB 4LXFA 4TUJB 3IDJB 3EO0A 2ADJB 3DMMB 3U0TB 4AM0B 2FE0A 2IFFL 2YEZA 5ANME 2RGMA 4FS0A 4G9DA 1DFBH 4O02H 2R1WB 5E94B 1FNSL 1GRWA 3C09B 5CEZL 1PIFA 2EEXA 4KTDH 3H9SE 2X4TB 1BEYH 3ROOB 4N9OB 1MQRA 1HYSD 2ZX7A 4KPHL 2ZJSL 3QG6A 4YHLL 1RURH 4UT6H 3ZDZE 3TFKD 3T1FA 2XGIA 4YHIB 5ID0A 4ELME 4AQ1B 4YBQD 1BAFH 1U3JA 2F5AL 2Z31A 4Y4KD 4UTAH 4NO3B 1KIQB 1T0NA 4HDIB 4I1NB 5EPMA 4PV9B 3OAUL 4PJIA 5EOCJ 3U83A 4DTGL 1I9EA 1FFOA 3PF2A 3BX7C 5FUZL 3BZFA 4Y19A 5EULV 2HJFB 4ZUUA 3TONA 4B16A 2R1XA 2BVPB 3SE4A 1G9NC 3QUYC 2G41A 3PZ9A 3ILQD 2DSUA 1IGFL 2JF1A 1VRXA 4XNMB 3HR5A 3VXME 4QP0A 3P0VL 3KPQA 1PG7W 2BXYA 5K33A 1IFHH 1K8IA 5JR1H 4D0DB 4JGUA 1GZJA 4JEGB 5IW6A 1E72M 4HS8H 4UOZA 2WBJD 5LGHH 3RY5A 1UOKA 2W60A 2VNCA 1IL1B 5A69A 1ODZA 2XNAA 2CKSA 2CNCA 1I7RB 4PYSA 1D2KA 1IM3B 1A9EB 2E7MA 4LHUD 2J62A 2BY2A 1B0GA 1Q0XL 1T66C 2ZUXA 4HC1H 1NOUA 1I7UA 2EH8H 4PJBE 3MNWA 2VISB 3MKKA 2O93L 1AGFA 2WBJB 4N8VG 1B9ZA 4JZJA 2GJ6E 2VZOA 3IETA 4OTXH 5GJTL 3PZGA 5I1LB 1LNUA 2DM4A 3W11C 1A7NL 1NOWA 3GRWH 1RZ7H 4X6BA 1TPXC 2VXUL 4CN1A 1V02A 4M6NL 5HOSA 4NC1E 3TJHD 1FNEB 2GY5A 1JNLL 5GGTA 5LYRA 5B38G 2AOSA 5DHVB 2PNDA 3FB8B