3K8LA

Crystal structure of susg-d498n mutant with maltoheptaose
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
649
structure length
649
Chain Sequence
WTALTASPDTWDETKRADISYQLLLYSFADSDGDGYGDLNGVTQKLDYLNQLGVKALWLSPIHPCMSYHGYDVTDYTKVNPQLGTESDFDRLVTEAHNRGIKIYLDYVMNHTGTAHPWFTEASSSSESPYRNYYSFSEDPKTDIAAGKIAMITQEGAAGYNAAEWFQVSDETAAVKGLLKFTLDWSNAPSPILVVSTGTKADEDNPDTGTDNAKYLYYGEDICKKFYDKGNNIYELTVDFESTWGLLIRTSNASFWPSGTKYGASSSSEKLALNKDFKLTNAGNPANIMFDSQQITYFHSHFCTDWFADLNYGPVDQAGESPAYQAIADAAKGWIARGVDGLRLDAVKHIYHSETSEENPRFLKMFYEDMNAYYKQKGHTDDFYMIGEVLSEYDKVAPYYKGLPALFEFSFWYRLEWGINNSTGCYFAKDILSYQQKYANYRSDYIEATKLSNHNEDRTSSKLGKSADKCKLAAAVLLTSAGHPYIYYGEELGLYGTKDNGDEYVRSPMLWGDSYTTNYTDKTDATVSKNVKTVADQQADTHSLLNIYFSLTRLRNTYPALAEGNMTKHSVYNESQEKDYKPIAAWYMTKDNEKLLVIHNFGGTAMQLPLTDKIEKVLFVNGETQQNTDSDSYTLKLGGYASVVFKLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, susG
publication title SusG: A Unique Cell-Membrane-Associated alpha-Amylase from a Prominent Human Gut Symbiont Targets Complex Starch Molecules.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Membrane protein
total genus 199
structure length 649
sequence length 649
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k8lA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3k8lA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k8lA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3k8lA03
4CD6A 4UNTA 4GS7C 2B4CH 4I77L 3B3IB 4GOSA 4F15B 4JPWL 3A6CH 4EI6A 2KPNA 4M1GL 4TTGA 1G7QA 2ICEA 1MFEH 5KN5A 1JWUA 1KCLA 1A3LH 1JGDB 2IJ0C 3NCEB 1FCGA 1IGYB 3H9SE 1UWEL 2DJUA 5GS0D 3PWVB 1HXKA 1EAPA 3LEXB 3IRPX 3DV6A 1WC7B 1MRFL 1LILA 2JB6B 5IFAL 5EO0B 1QYGH 3L9RA 2OS7A 4IDJH 3D39B 3GO1L 3O2LA 5I18H 4K94L 4UT9L 4FZ8H 1EEZB 1II4E 4LMQE 4D9QD 4G9FB 3W29A 5A8PA 2VCBA 3VXME 3WIIH 2F54D 1KB3A 3VCLB 4KKAD 1EHXA 3THCA 4X5WA 3PWPA 3K8KA 4PP2B 2D1ZA 2HJFA 5FF6A 5BS0A 3GHBH 2FB4H 1R3KA 4AQ1B 3HMWH 3EYQC 1NC4B 3WIHL 3CLEH 3PWPE 4RAUA 4AEHH 1ETZA 4OF6A 4RGOH 2XOTA 1C93A 3TPKA 4NX0A 5GSRA 4D3CL 3MRJA 2ZKHH 3FQTA 3RWCA 3U79A 4PIRF 3V0WL 3H3PH 5T5NG 2EE3A 1QEWB 3WBAA 2YBUA 2ZUUA 1T6WA 3KYMB 2VE6B 3BEVB 1CXFA 3NZHL 1OAQL 3DXAE 5MP6H 5L2JB 3FRUB 1NCDH 1OP5H 4HHAB 2FEDC 4KROB 4YIQB 3ULVF 3W81A 5HTSA 1VFUA 2X40A 1FH5H 2BFVL 3RGVA 3LIZL 3QZWA 3GNMH 1S5HB 3L3JB 4KPHL 4GH7B 4PJXF 2P8PA 2DSVA 3BDBA 5FOOA 3OZ9L 5F1NA 4JAMA 4LKXA 2EC8A 3LMJH 3TA3D 3D3AA 3IVKB 3BZFA 4BCEA 3DYOA 2XA8H 2A83A 3X11A 1VFMA 3FAWA 3RUGB 1AGFB 5JDSB 4NQCB 4OZHF 1W72H 1UYWL 1M6OA 2P5WA 2QADC 4RCAA 4P8UA 3F4VA 1I3VA 1KIRB 2WBJB 4OV5B 5CG0A 3GKWL 4X83A 4BQ8A 1JD9A 3NDYA 4PRDB 4B41A 5SX5K 2R2HB 3ZDZE 2HMIC 1JNHB 3GSXA 2QKIB 2CBUA 2ATPA 1E28B 4DAGL 4OKDA 4HOXA 2GCYB 1X5JA 3HLAB 1YJDH 1C5BH 1NBQA 5KSAA 2V7NB 4HFUL 5CILL 1UWQA 4JHBA 4P2RD 3EYPA 1HHJB 2WMPA 3KR3H 3ZM8A 1UB5A 2G60H 1TR1A 3WQ4A 2F61A 5I19H 1U8JB 1J12A 3INUH 4PP1D 1MXGA 3MRNA 4DFIA 1YDPA 3A5VA 1NCTA 2XN9D 3MZTA 3VRLE 2F53B 4ELMB 4O2FB 3TV3L 3MLPA 2F18A 3V4VL 1DSFH 1N7ML 3S2CA 1IGFL 1DFBH 4F9PA 4QOKA 5I1KH 4BQ5A 1QSFE 2BNQA 3BAXA 5EU7C 4Q74A 3SOBH 5A2BA 5GISH 4KHTH 1WZ1H 4YR6A 2OP4H 5I74B 2BNQE 1A7OL 2D4FA 3KYOB 3RBGA 1K8DA 4YC2C 3A67L 3O3UN 3MV8E 1FN4B 1N3NA 1U2YA 4P9HC 3U82B 4XWOD 4QXGL 4HXBH 1OSZA 5INDB 1G7HA 2OM5A 4CMMB 5IW6A 4I4WA 4R9HA 4XC1L 2ICCA 1INQA 3CH1B 5L0QC 5HHOD 2JALA 4NCDA 2H26A 3JV4A 5KZ6A 5CP7A 5FYKE 5GGUA 2VDPH 4Y16C 3TVMA 4WWKB 2R0LL 4BH7A 4X7SL 5EO1A 3S6TA 3O4OC 2A6JA 1TFHA 4RISH 3U0PA 1HX0A 4KTYA 2W63A 4OLYL 1HHGA 5HI5D 3LRLA 4MJ6A 3SGKC 1Z6JT 3VJ6A 3U46A 2P1YA 4NT6B 2J79A 1OGBA 2MPAH 1PAMA 4KRPD 3ULUH 4R0LB 3BCDA 3DX8B 2P5EA 3C6LC 1RZJC 4LRNH 2PBOA 2HRPL 1GOOA 1H3PH 4D6JA 3ROLA 1RQ5A 2A0LC 4HBCH 4J27A 3QIUC 4BSJA 4HIIB 4MHHI 3AIEA 4HIEB 3F58H 3HR5B 4DGYL 3OF6D 1EOMA 1F11A 3ALXA 3DVGB 3U0TB 3BSZH 1WCQA 2F54B 3QDJA 3MUGA 3BYTA 5ACLA 4M24A 4N5ED 4MXVE 4PSRA 1FNLA 3HCVB 3VIPA 2EKJA 4Y5XA 2WVVA 4NF7A 5JIPA 5TQ2L 3VXQB 3DX1A 4LSQL 4XRCA 1JTPA 4M56A 3HS0B 3PGCB 1KNOA 3OWEA 4UOQA 4HK0B 3L3IB 5SX4I 2VDLH 1A64A 3V5KA 1YY9D 2OSYA 2ZUSA 2R0KH 1FLTX 5JHLL 4EN3A 4JB9H 2ADFH 1RIVH 4ELKA 1KB5A 1W0WA 3EHBD 3MGTA 1E0XA 4H25A 3ZHLA 1BZ7A 4X6CF 4U6TA 1KELH 3V7MA 1UM6H 1AO7E 1BQLL 4C54A 4W85A 3U2SA 4WKAA 4JM4L 1WWCA 4HQQH 1DEDA 1ZBWA 3SN6N 1IGIL 3GSNA 1RUAL 2H2PD 1U8PB 4U05A 4NKOA 1MJJA 2ZG3A 4WGWB 3T8XA 4U0RB 1EQPA 3IAGC 4XCNA 3CFJA 1JK8B 5DRWA 4JRWA 1SQ2N 4WI7A 1U95A 1ECEA 5I1HL 4NP4H 1NCBH 3QUMB 1TJGL 5E2UL 2X4RB 5MEOB 3TA3B 4DGIH 3EDFA 1MCPL 1NBZB 4B50A 3H54A 2NY7L 3NPSC 4OLUH 4M80A 4JANB 5SWZD 3VXTB 4K71B 5AYIA 5CHNA 4G6FD 3EJJX 3FB7B 5JQHC 4MLSA 2JTDA 2IH1A 1K4CB 1HINH 2OMNA 4JZNA 3VD7A 1K6AA 5GHWL 4OD1H 1ZSDB 5ID0A 1JNEA 4OGAC 3S3JA 4LGRB 5LGHL 1Y6NR 4JRYA 4AMCA 3OXRA 4P2RB 3VE0A 1UKTA 4FQJH 5JR1H 5I8CB 4NO5A 3IU3B 3FTGA 1TNMA 2Z93B 1Q6DA 2E7CA 2GTWA 4QO1A 2QLYA 5DZOA 4HULB 5C86A 4V2BA 2V5YA 1XR8B 5DUPH 4UV7L 3QEGL 3UPCA 2XN9B 3MLWL 5D7KE 4NQTA 1TCRA 4NBXB 5DJCB 1D5BB 2YUXA 1MHEA 3ILQC 4M1CC 3KPLA 5CQ1A 2VXUL 3IDIB 4EJ1C 4OLWL 1ED3A 4MAUH 1H5VA 2GUOA 3WFBH 1OD0A 3CMOH 4ZUVB 3RTQA 1URLA 4K3JH 4CMHB 1VERA 3OKLA 1C5CH 4PGDB 3FZUD 2OTUB 1INEL 1YC7A 3ZKXC 1GIGL 2NQCA 1ULVA 4UIKL 1IAOB 4XP9L 4G7VH 5IB1A 4F7EB 4TPRL 1GJIA 4WU7B 3BKJH 3KPPA 3N50A 1ZA6A 4OKVA 3RRQA 2LABA 3V6ZB 1QHOA 4U31A 3U4BL 5C0AE 5C09E 5CS7A 5DJAB 3VFUA 2JK5A 2VH5L 4X5XA 5FO9B 1LWRA 5HHOB 4PRIA 4LIQH 4AW7A 1B0RB 3MOAL 3U6RB 1KXTA 4LAJH 5JW3H 2B7DT 1W9UA 1BECA 1UCTA 3WJJC 5T1DH 3WS3B 1RULH 3L3HA 5CD3B 1CGTA 4JFOA 3IKKA 1Q9OB 3R06A 3GNPA 2Y4SA 4KRPB 1GJWA 1T21B 5GRXG 2D23A 3RCNA 4IRJA 4UU9B 3BAKA 3G04B 4TTUA 1MCOH 1QSVA 3CUPA 4LASH 3OG4B 1IRAY 4X9FA 3RX5A 4U1GB 1MCDA 5E99L 5JPNB 1CD1B 2J6EA 3L3KB 2XWTB 1QFOA 2H2SD 2AJUH 4FFVC 4OFYA 1JXKA 4LX4A 1P4BH 1J1PH 3K80A 3T65B 3D51A 5F7WC 2CH8A 1KPVB 3AS3A 1VFAA 4TVPL 2DEPA 1FG2B 1HDMB 5ISZA 5CGTA 4ZUUA 4UBDC 5GS1A 1FO0B 2IPUK 4HF5L 3UTZA 3WO3B 2C7FA 3MRQA 3TIDA 4X4YA 3D85A 5KG9B 4JRXA 5DD3H 5F8RC 4AYFA 5CINL 5HYSA 3O9NA 2I07B 5IBTL 1T1YA 3NACL 4H8WH 3DNKA 3RWGB 3T4AA 4K8RL 1S8DB 3WD5L 1RK0B 3QI9C 4AMKH 4C59B 4P5TD 4E0RB 3M8OH 2B4CL 3EO0B 1PFCA 4Q0XH 3A6CL 5CLTA 4L29A 1T83C 2FCBA 2Z31D 1MLCA 1S7TB 3MNVA 3QIWC 1MIEL 3OG2A 2B1AH 1MFEL 4Z7WA 4F2MB 4UUJA 1T1WB 2EQDA 1A3LL 2C1OA 1AIFB 5CIPA 1P7KB 2XV6B 1IKFH 3MRMB 3O3AB 2PWFA 1P9MC 2OTWB 2PTTB 1H0DA 5IF0A 3VFWB 2R0ZL 5KOVC 3ARVA 4IDJL 5C08A 4I0PD 3V0VB 4XPHH 5I18L 2XGBA 2YK1L 3JVGC 5D1QA 4J23A 3G08A 5TFSH 5SWZB 3OGSA 1QBML 4G6FB 1C3FA 1AXSB 3MRFB 4XNXL 4FQCL 2FEEI 4NQEE 5E8NA 3VMOA 4ZXBD 2GTZA 3QDMA 1KLUB 4I18A 3IU4H 5FOBB 3ESUF 2FB4L 3SE4A 3WQWA 5E5MA 2FR4B 1E4WH 2VLJA 3TBTA 3IFNH 3CLEL 1A9BA 2PO6A 4CVZA 4AEHL 4XB3A 4RGOL 1CE1H 3C6LA 5IGXH 1P69B 3PTMA 2ERJB 4Y7EA 4BUGA 3T4AB 4Z77A 4L8SB 5FXCH 2EXYD 4PCSA 3AS0A 1X5LA 1YEKH 4PS4L 3UTTA 3Q1SH 5I1AA 1AGCB 2FJFB 4WW2B 1OCWH 4YGAB 3LS4H 4PN2A 5TQ0H 1NCDL 4RE3A 3FO9B 3NZ8A 4NRXA 4LK4A 3VGBA 2H3NB 4AD2A 1D5MA 5BMFL 1NKOA 5DHYA 5C0RH 3HR6A 2M2DA 3VFOB 1WBYB 3H0TA 2X1OA 1K85A 4KKNA 1ZLVK 4JN2A 4K2UH 2Q3ZA 3GNML 5IMKB 4PR5B 3QNYA 4PY7A 4FRWA 4QRTA 4ZDHB 4N9GA 4GRWE 3UPRA 1K2DA 4JQIL 3PZ9A 5ENWB 1OWWA 4G8FB 2JCCE 2WWKO 3LMJL 4HK3N 5IESH 2PXYA 3NMEA 4ZQKA 4ZAKD 4AJ0A 3VWJC 3FNDA 1DLHA 3W28A 1CK0L 1NUNB 3BUDA 2XA8L 1IAMA 4R4BA 2CRIA 1AH1A 4Q6IB 1BM3H 1CZ1A 3H9HA 2B5IB 3HE6D 3QULB 5JIWA 3VD5A 3KLHC 4GQPH 3V5HB 1E56A 2XKSA 3WL9A 4C7FA 3T0VA 4H0HB 3DX6B 4JCMA 3FCTA 3RIFK 2GK1A 1TVHB 1MI5B 2CQVA 5IJVA 3WLBB 1U8MB 4X8JA 5F9WB 4GG6A 4TTDD 2PTUA 4APQD 2ED9A 4P0DA 3PP3K 1HH6A 4ZFOA 1YJDL 2VRQA 1C5BL 4OGXL 4YFLI 3EYVB 5D2LF 2WPGA 4L4OA 3BSHA 1IGJB 1TJIL 3DX7A 3IDGB 3O9WD 2LTQC 3KR3L 2ICWB 2G60L 4JIEA 3E3QC 3G6MA 1EJOH 5I19L 4IOIA 3HE7C 1GAFH 4UT7H 5AC4A 1OAXH 1E6ZA 3JUYA 4PUEA 3GH7A 5F7DB 1WWWX 3RWEB 3QUYA 2Q8AH 4P5MA 4XAWH 4YEEA 4PMOA 5I75B 4BFIB 5EULV 5B8CC 5I6SA 5A2IH 4KKLD 4DZBA 5IT2H 1ZHKB 2VQ1B 3JWDC 3PGDB 5HGHB 3A3HA 2HA1A 3TPUA 1TVBA 1O5DT 1FVEA 1T1XA 1CFSB 3KLAA 5CJ5A 1J1XH 1L4IA 1EZVY 5DI8B 5J1AA 5GISL 3FT3A 3UZQA 1NCCL 3PABB 2OP4L 2JEPA 1DE4B 2PF0A 3LV3B 1J87A 4YE4H 3NH7L 4U1IB 1Q6GA 4RRPA 2R29L 1FH7A 2BVQB 5I77A 3WQ5A 3OLDA 1BGAA 1U93A 3F5WB 3MROB 5EZIH 4YXLH 2XQBH 3GXPA 2HFTA 5F1KC 4XPAH 4FQHB 4EQ3A 4UOJA 1ZVSB 1QSEA 5DC9B 1YYMH 3MLTA 3OX8A 4R5EA 2QSCL 4P8WA 5DO8A 2XG4A 1CIDA 3KDMB 1C5DA 4HWEH 4UQAA 5FO7B 2C4XA 5IROA 3W11C 4P8XA 3IDNB 1QNSA 3T2OA 4RISL 2Q87A 1CLOH 4X6DF 2ZX8A 1AHWC 4P5TB 4MNHA 5DT7A 1E0OB 3EOBA 2O9RA 4LF3A 4G9DA 1FIGH 2MPAL 2A2QT 4RAHA 1I1AD 3T4YB 2E7LA 1IFHH 2AXGA 4LLAA 2Z31B 3KXFE 3RZWA 3VFGH 2J5LC 1N82A 4PJFA 5FYKH 1EH9A 2F7OA 4O51A 1H3PL 1U36A 3OGCA 3UYRH 2Y06H 2YDQA 2NX5A 5KW9H 4HBCL 4XBGB 1R46A 5BV7C 1AGBA 5FYJH 1HHKB 3CGTA 4UB0H 3HRZB 2X1QA 3MV9D 3F58L 4I0PB 4I2XB 4XNMA 5C0CA 2GJXB 1A5FL 1TZIA 1IEBB 4CD5A 7TAAA 3LS5H 1NCNA 2VDKH 4YJZL 2VT0A 1OBAA 3F5JA 2QPSA 1WZLA 1SJHA 1A7QH 4ZXBB 5J11B 2RB8A 1KXQA 5C0EA 4PMRA 1GHSA 3ETBF 4D6DA 1S9VB 1OD9A 4ML4A 4XAKD 1KFAL 4OCNC 3MLYL 4BFBD 1RJLA 3ARFC 4JDTH 4QTHB 2ADIB 2Z1KA 1PZUB 2Q76A 1U58B 4YHOH 5ABFA 5IQ7L 2R0KL 1KJ2H 3ILPA 4ACYA 4HA1A 4JB9L 2WSKA 4KK6D 5JOPE 4FTVA 4ZNEA 3CV5A 5HYQB 4RFNC 2H32B 4EDWL 1KELL 1E43A 1JF5A 4NZRL 2HISA 1UM6L 1R3JA 3FT4B 4F7MA 2AJZB 3OKEB 2X70A 2ATKB 2V5RA 5D2NC 3DBXB 4EK7A 1OB1B 4YWGH 3W9EA 1XF2B 1MAKA 3BIKB 4PJ5A 4HZ6A 4AZ6A 4YFLF 2IBBA 4OQTH 1ZA3A 3PIQB 2DM3A 4HPOH 1A2YA 4HEPG 1JGDA 3TH3T 3NPZB 5C07D 1NCBL 4X7TA 3WEXA 2IALA 1GGTA 3ARDC 4XV0A 4ZAKB 1FL3B 3CLWA 3HNVL 5B3NA 1GQIA 4GO9A 1MUJA 1MH5A 3AU1A 3SGDH 4AENB 4WFHE 5HD8D 3OL2A 5E0CA 5D72H 1EXUB 3HE6B 3LRSB 2I26N 2IQ9H 2XWJB 4RFOH 1HSBA 2E6PA 1GSMA 4G9FA 4PGZA 3KYNB 4ETYA 3D39E 1HNYA 2BNRA 2DQUL 3VCLA 4LCCA 4OZ4B 3QXVA 1YEHL 3ZKSD 1JWSB 4OD1L 3ZQ9A 4G9FE 4APQB 4XPTH 3SGJA 3O3BB 2Y2WA 1I8IA 4G8EB 4Z2LA 2DIEA 1FBIL 1R3LA 4R90H 5TE4L 3O45B 5GRVL 4WI6A 3TCLB 1VADA 3O9WB 3DURB 3P0VL 2IGTA 2APWA 1TVNA 4FOMA 2CEQA 3BPOB 1DQJB 4GFTB 4ISVB 5ITBH 3QHMA 1UKOA 2W62A 4MADA 1F6LL 5JXAL 2J7GA 5D93B 4L8BB 1EEYA 1YZZA 1FJ1B 3MMUA 1UWXK 3ARUA 2PW2A 3IDYB 5A6KA 1NDGA 3AY4A 3MRPA 4MAUL 4ZFMA 1JPGB 2F8XC 4QCIB 3SDYH 4KK8C 4YIQA 1MCFA 4NQVB 3WFBL 3E2HB 3H55A 1PZ5A 3CMOL 4MD5B 4MAZA 2DQEL 2XSAA 5ETUB 1C5CL 2ICES 3LHPH 1BYBA 3LKRA 4F9LA 3VXSD 5C0BD 2VXSH 4P23D 4DGVL 3L3JA 5EUOB 4G7VL 4FQ1H 1MCNA 1MSPA 1KIPA 2GY7B 4J3SA 2VDMH 3BKJL 1MCIA 3OLIA 2GUYA 1UUQA 3BDYH 2OJZH 1OTSC 2PUQT 5ABDE 2HLFD 3VD9A 1OGAA 3JUZA 2IXVA 3DSFL 4W81A 4NQCA 3B2VH 1Z5LA 3MMEB 1RZ8A 1JZ5A 4OV5A 2FWOB 4UZUA 3RUGE 1FFNA 5KZCD 4XH2B 4QWWD 3ABZA 4NQCE 5EFIB 1CGYA 4Z7WF 4XZUA 1X6NA 3MRGB 1NEUA 2P42B 3HLAA 1YQVH 5FV1L 4HS6A 2EDBA 2VQTA 4PRPA 4JFYA 1YEEH 4XXCA 1VACB 3GBLA 3PZNA 1I1AB 3KS0J 2WQ8A 4XCYB 5F72S 1NAML 4A6YA 2OXHA 3G6JA 5GGQL 1TMQA 4GG8B 1FH8A 4JM2C 1KJVB 2D22A 1G6VK 3UTQA 4MQ7A 4ONHA 1UZ6E 3SO3B 5CGYD 2EXOA 1GZPB 1MCOL 4LASL 3ZYOA 5JXED 3VRIB 2HWZH 3WN5C 3DWTA 3H2WA 2DKUA 1EJ6A 3J7HA 2IH3A 3MV9B 1MVYA 2AJUL 2ITDB 4R7DB 3RVTC 5BJTA 2F53E 4ELME 4W6XB 1J1PL 5D6CB 1PKQA 4WDIA 4C83B 2YL8A 5BXFA 1WZKA 1B2WH 2OR8A 3EJQA 2A3EA 1RUKL 1EDQA 1OW0C 4NRSA 1XF3B 4FQIH 1U8LB 1GC1L 2J3SA 3NIDF 3O6KL 5JNYA 4L1HA 3HE7A 1UOKA 3KJ6H 4S0SD 1CI5A 1HJXA 4F7TB 1JXJA 2J6EH 3POCA 2AVGA 5T33H 4N90E 3SCNA 1KLGA 1UWSA 4OD2B 1YUHB 3TCXA 2QHRL 2BOBB 2AJSH 4H8WL 1R85A 5JBEA 5DUBB 3DOSA 1UJ3C 4U1KB 3L2MA 4AMKL 2E6QA 5FECB 4ALAL 1N6UA 1UXSB 4EKJA 1K5NB 4Q0XL 2E9IA 1A8JH 4XVUD 4FQQA 3SE8H 4NT6A 2XPGB 4HP5A 1P6AB 4YHNA 2YD2A 1YMHB 1VSCA 2B1AL 4POYA 2YRPA 1S7RA 1A0QL 3BZ4B 1HIMH 3WFCH 2LVCA 3WDPP 3OXSB 1IKFL 3SKUD 3X17A 4HMCA 3WNNA 5C07B 2DQFA 2OX5A 3RWDB 3VXUA 3D3VA 1XCWA 4D71A 4QHNB 1ZWIB 3MRHA 4YFEA 5JZ7C 2FH6A 3HRPA 1A1NB 4NRYB 4XPHL 3IKCB 3CFDA 4HIEA 3I75A 5GRJL 5DRXA 5A8NA 4L1DA 1IL1B 4OSUL 4WI3A 2DTMH 3GMMB 3DVGA 5FEBA 2GJPA 4PMQA 2F54A 2AKRB 2EC9U 5F3HB 3IU4L 1XGYL 3MJ9A 5GSVA 4X0KA 2G3MA 1YN7B 4RGND 1E4WL 2JJSC 3NAAL 4D9QE 3IFNL 5CIPH 4X9YA 3IXTA 4MNMA 2F54E 3CZGA 5JPMB 5IGXL 1RIUH 2VRKA 1DWFM 3ZDYF 5BZDB 3WD3A 1I9RH 4TVUA 1A7PL 5I0DA 2DQIH 1I1YA 4LLQB 3H9YA 1MW1A 3KLLA 3Q1SL 4KJWD 1IM9A 4W7WA 3JTTB 1OQOA 4G3YH 5FGBC 1FVDA 2BCKB 4C7GA 1OCWL 1DCLA 3AIVA 4BELD 1RVFH 1F97A 1CXHA 4G80A 1ZK9A 2YPKA 3KPQA 2Y5TB 5C0RL 4YXKH 2EECA 3WHXA 4ENEC 3VX0A 2PWDA 1U8PA 1BIHA 1ZT1A 2VN4A 2QV2A 4K2UL 1R5IB 3L1OH 4JY4B 4IM4A 4PYGA 2DOCA 2V3EA 2CHOA 1YEDA 3ARFA 5FOJA 3VXSB 4FA8A 5HVWA 5C0BB 5I66B 4P23B 5HBBA 3DGGA 2QSQA 5I76A 1PIGA 2EPMX 4GKNA 5IESL 2WM0A 4KQ3H 4KGJA 2YMXH 3CVIH 2G5BA 2PYEA 3WBEA 1S7XA 2VWEE 1T0OA 4BQ6A 4Z8FH 1UEYA 2MQCA 4Y4FD 3RP1A 1BM3L 5I9QC 2AS5M 4B7IA 4XNYL 1HWGB 1KSRA 1Q9LB 2Q8XA 1KCSH 3KLKA 1CXEA 4P2OC 3WF4A 4YHIB 1HYSC 1KGXA 3HAEB 1QWUA 4MTVA 4EI5D 2YZ8A 5KZCB 2XTLA 3HAEG 1A6AA 5IHZB 3X14A 4PJFF 5B22A 1IQWL 1DWAM 2BHZA 3GB7B 3HC4H 4K23H 2GEEA 2FDMA 1T6VN 3OKKA 2COQA 4WO4C 1EJOL 2W0KA 1NFKA 4UT7L 2G75B 3AM8A 4P2RE 3TO4C 1LE5B 4RMWA 5C0ND 4XAWL 2Q8AL 3PZGA 1ZHBB 2HT4D 4GUPB 1YQ2A 3ES6A 3RZCC 5IT2L 2XVKA 1V3KA 3HFML 3O8XC 4ZFFA 4UINH 3PDDA 1WFTA 5T3XH 2XN9E 5A2AA 3EDDA 3C60D 1FHGA 1BVKA 5BXTA 4UILH 1J1XL 5HDQL 1KJ3H 4MD4A 3GSUB 1H11A 3QEUA 5AWNH 5TH2B 4QF1B 3PWUA 4PUBL 1BWMA 2X4NA 2F7QA 2EAEA 2Q8BL 4PMNA 4YE4L 1A4JB 1DQMH 1ZBKA 3BN3B 2ZWYA 3WLWC 3F12A 2XQBL 1JGUL 1ORQB 2IEPA 1KPUB 4XPAL 3V6ZA 1KR1A 2G2RB 1MCKA 3KWWB 2B31A 3QJFB 3LD8B 3MACL 1MELA 3QHTC 5I71B 3AHTA 1PZ2A 1RH9A 4JFQA 3VGHA 2HT3C 1FNAA 4HWEL 1KB9K 5E1AA 2EEDA 3VIOA 1HWWA 5HHOE 1ITBB 3Q5OA 4JDZA 2YPLA 1I8LC 3MXVH 3B9KC 5IBLD 2XFRA 3CCHB 3TTSA 2FZ3B 1AJ7H 1FIGL 1L7TH 5F93C 1IFHL 3SCQA 5I16B 4UAOB 5E9AA 2XQYK 3SJVA 3BVXA 2C0HA 1EUTA 3RNKB 2BOCB 1OAKH 1QLRB 1XYZA 3ARZA 5IVXB 4X6EA 4W5ZA 5KOMC 3TBVB 1YMMD 4ZE5A 1HILA 5E8EB 4GRLD 5A2JH 2H8PB 4OFVA 5KW9L 1KGWA 4AMWA 3GSWB 1H49A 3IANA 2W61A 5FYJL 4UB0L 1I7RA 3HUJA 4NKDA 4NJAH 1CXKA 3NCYP 4HPHA 4RQQB 3IDMA 5F88A 2ZX9A 4P3DB 3D2UD 5I1GH 3LS5L 2VDKL 4H88L 3RWIA 5I73C 2VXTH 4D72A 4POZC 1A7QL 1IAII 1XGTA 1DBJL 4H20L 4NDMB 4M62H 5T1MB 4NN7C 1KPVA 2GQHA 2YSSB 4RGNB 1FG2A 3SDCD 1G6RA 5KAQG 3KS0H 4CADB 3SE9L 4R3SA 4Z7OE 4JDTL 1G01A 4IOFD 4NM8L 4LCUA 2EEXA 1NEZA 1OAZH 4ZE4A 4YHOL 2OMBA 4XB7A 1MEXL 2DLEA 1BQHA 2ZOLB 3B5GA 1GGIL 4JVPA 3MUY1 3BO8A 4N8VA 1OSPH 5D1ZC 4C4KO 3EBVA 2BSTB 4QAWA 2D31A 3UETA 1NMAH 5DJZB 4JG1L 1QUNA 4BSVA 5A8OA 1S8DA 1V0KA 4XVSH 4E0RA 3PHSA 2EC9T 3LKQA 1I1CA 4KC3B 3CTTA 3EO0A 4YWGL 1T66D 1DBAH 2P7TA 1BVLA 2XFFA 4JFFA 4GAFB 1QVOA 1PBGA 3SCUA 3VXPA 2F7RA 4LHUA 3HZYA 3WMBA 2GDVA 1UGNA 2QR0A 1KB5L 3TOPA 3X3FH 3TA9A 1DQDH 3C8KA 2V2XA 1ZLSL 2DWEA 1FP9A 2ZCKL 1BX2B 2BY0A 2FNBA 4Y4FB 3V0VA 1MCWW 5D72L 4JQXC 3NJ3A 2VJXA 2IQ9L 4PV8A 3L2LA 1TE1A 2ZJSH 3GSNL 2CLRA 1Q94A 3P0GB 5F71A 4P7RA 3FQNB 2P47B 3TJEH 4D1JA 5SWZE 4EI5B 1L0YA 2VKXA 3G6JF 2O9TA 5I17B 4ZO8A 4LCWA 4XPTL 3LDBB 4YN5A 1A6WL 1FZMA 5HYJD 1D2KA 4G6ML 5B38B 1UR4A 3SUTA 4MD0B 2EDWA 1B4JL 4R90L 1DBBL 4PREA 4HMEA 1WBXA 5B38G 1XZ0A 3ZZ1A 2O5YH 1BLNA 5ITBL 3MRLB 5AYQA 1V0LA 3L4TA 2AABH 1IAKB 4UV4H 3P30L 4PJGB 1HL8A 1C92A 1T5WA 4YHPB 2FJFA 4URIA 1IM3B 3MCG1 3F7RA 3F7PC 3F5LA 3WQ6A 4PJAA 1NJ9B 3FO9A 6TAAA 1V08A 3L5HA 4TNWF 3C60B 5CUSL 1WBYA 3S35L 5KSVA 4X6FB 5BVJA 1XEDA 5ECJE 2R9HC 4PMUA 2L7UA 3LHPL 2VXSL 4TVPD 1FGVL 5MERA 2VVSA 3QBTB 3IDXH 1HL9A 3FT2B 2X05A 2VDML 4BK4A 3I50H 5K33A 4QCEA 3FB6B 3BDYL 1BJ8A 3MNZB 3W37A 2OJZL 1XIWD 2MANA 1IBGH 1B6DA 4Y2DD 2BDNH 3Q3GA 1T0MA 3G6AB 3C2AL 3ARPA 4M48L 4Y5YB 5C0IB 5HGBA 4AISA 5DSCB 4CU6A 3QSKB 3VDAA 3P4OB 5BOZG 5DEFB 3CC1A 1L6XA 1NSNH 1NC2D 5KJRH 1BQCA 2D7PA 3VFVA 3NCJL 3V9FA 5HDBE 4OAWB 1F2QA 5DMGC 4K8RD 1I7ZA 1LEIB 3ARXA 1IARB 3VXRD 1GGBH 3PXJA 2VZTA 1YQVL 1A4KB 3WEMA 2CYGA 1MI5E 4LMQI 4O5LH 5CJXC 1CLXA 1K9EA 1FE8L 3IJSA 1OLZA 4J3VA 4YK4C 4P57A 1LO5A 3WHE0 2NZ9C 2QMJA 3U9PH 3CDFA 1PIFA 4NOFA 3DYPA 3T2QA 1YMMB 1H0IA 4G6KL 3HC0B 4GRLB 4F37K 4LLYA 1OVZA 1XGPB 5EBMA 2HWZL 4JVUA 4J1UB 4NSBA 2KH2B 1JI2A 4MXWL 1KJMB 1HEZA 2HLAB 2BVEA 1OAUH 5DRNB 2PN5A 2DQHL 3U5UA 5FHBL 1MLBA 4PUDA 3D2UB 1CFSA 1NM9A 2UVFA 3SDDC 1B2WL 3L5IA 4A6YH 4YDKH 1ZOXA 1Q0XH 5T1KD 5TE6L 1H3UA 3LV3A 3WEZA 3PHOB 2VLLA 4JY6B 5F89B 3SDCB 1V6VA 3CFCH 4Y4HA 3BX7C 4MAYD 4PJ9D 3I02A 4P3CH 2YA2A 1E3XA 4PBXA 1AQDA 2J6EL 4UFHA 1DN0A 1DQLH 5T33L 4W4OA 4AD4A 1JV5A 5IHBA 3N9GL 3MODH 5GNYA 2AJSL 4AQOA 4YBHA 3PL6A 5D7SH 1FYTA 5D7JC 2YBRB 4G42A 1TQCC 2E9LA 2YC1B 1XGUB 1JGEA 3GRWA 1WAAE 1UASA 5GGVY 4NWUH 5DMKA 4PJIA 3IF1B 1BOGB 2GJZA 3DGCR 1NMBH 1H8SA 4AZ8A 3KNBB 2QHAA 1E72M 1XCQA 2E27H 2A73B 3UYPA 3PV6A 1M05A 3B4NA 4P4KC 2ZUWA 3VIJA 1UA6H 4MA3A 1JHTB 5GQBA 3WY2A 3GI9H 1JRHI 5C0FA 1GONA 2PCPB 2GJXA 1IQDB 2W0LA 4KI5F 1A1OB 1RK1A 4I48A 2DTML 3DECA 4FQXD 2K3TA 1W3KA 3QA3A 3OJVC 5C6WH 3WF2A 4KJQC 2HFEA 3I9GH 4I2XE 5L2KA 3UJIH 3IETB 1DTUA 2VX6A 5HHNB 1AC6A 4XGZA 2EEBA 4HX1A 1WB0A 5HYJB 3OR7A 3SBWA 5HHVL 5GS0H 1HYRC 4KDVA 2L4OA 1H5BC 5HY9B 4L8CA 3MJ8A 2FSEA 1S9WB 3ALWA 1I9RL 4JJ5A 4HXAH 2DQIL 5I2UA 3TH4T 2DQJL 3AIUA 1LO4H 4XNZC 5LVEA 4G3YL 2WK2A 1C8QA 3SE3A 3STZB 3CH8A 1EO5A 4DVRH 3QG6B 1A6UH 3FT4A 3ARGC 3BPNB 4HC1A 4FXKB 1RVFL 5I8EA 1JVKA 3AXLB 4FS0A 3MJ9H 3D50A 5D71L 4Z7UB 3BE1H 4YXKL 3OB8A 1B9ZA 5JW4N 2EZ0D 1J0KA 2V2WB 4OF5A 5DYOB 5IP4A 2CDGB 8FABA 5ACZB 3L1OL 3GYCA 1XCXA 2PBGA 4MSWB 3BKCH 2HRLA 3PGFH 2EH7H 2NNAA 5FYLL 5T3ZD 3N17A 1A9EA 3E6FA 4JL2A 4IMKC 3SCMC 32C2B 2AXJA 3IDJA 4OGYH 3L7FB 1H4PA 2DD8H 4Z8FL 1WDQA 4M6NH 3T2PA 1XIWB 3DETC 3D69B 4PLNC 5ELIA 4MB5A 4Y2DB 5EUKB 4Q97A 3MLXL 3ZE0E 1EBAA 1WIOA 2X44D 4WI5A 4NZJA 5ABEA 1MQ8A 1J10A 3L5JA 1NC2B 3DX3A 3MOBH 3WKMH 1RU9H 4M7LL 1ZV5A 1FCCA 1BPLB 4GBXD 1FFOA 4HFWB 1ZS8B 3VXRB 2EICA 3C5ZA 4OUOA 4JLRA 4M7JL 3UPAA 4ETQB 2ICWJ 3HC4L 4G8EA 3QUMH 4C55A 3WH9A 2VLKD 3DRTB 5DUMH 1AD9B 3O9WA 2DQDH 4LLDA 3HUJF 4HIJB 4H5SA 2DKSA 4KXZH 3NCYS 1G7PA 1SEQL 1A47A 3MYJB 1E6QM 1JFQH 2GHWB 1E6PA 1YNKH 3FOLB 4NKIH 4NQUA 4DK6A 5MEND 1FJ1A 2ZUNA 4YNYB 4XVJH 4OZIF 4F9JA 3PWLB 4PJEA 4UQ3B 4E9LA 5T3XL 3MREA 4M3JA 4ODVH 4ZFOL 3MU7A 1MFCH 4GIAA 2F74B 1KJ3L 5HXMA 2E0PA 5EB8A 3QCVH 5AWNL 8CGTA 3QRFM 1C08B 2VXVL 4R26H 1BHGA 4PYHA 4ZOEA 3K0WA 2R1XB 1EGJH 1CT8A 5T1KB 1DQML 8A3HA 4NJ9L 4UDUB 3FO1A 1NOUA 1QRND 3VRJB 4MAYB 1B1YA 4PJ9B 5F8QC 3BXWA 1T1ZB 5EUOE 2DLFH 3FFDB 5EB9A 5CCKH 3UROR 4CDGC 3BP4B 1HF6A 3MXWH 1KCKA 4YO0A 4ZD3H 1I7TB 2YA0A 2Y72A 3FQWA 3JWOC 5KBNC 1JFHA 2MQ0A 4GLRH 3BAYA 2D3VA 5LXGH 4KUCD 2Y6SD 3G9AB 4DW2H 3FQUB 4EDXB 2J7CA 3SKOA 4KROC 3REWA 4JDVA 2VIRB 5FUOH 3OAUH 1MFUA 1BYDA 4GMSH 3LZFL 3JUGA 4RE2A 5HPMB 2J7FA 5HYIA 1ES0A 3UBXA 2DN7A 2VLRA 1OAKL 5J56B 3FFCA 2YXMA 3NCCB 1NGZA 3S8WA 3G5VB 4XBEH 3VNYA 3RO8A 1LDPH 1JMXA 5MEQB 2ZSVA 5CPSA 5IB4A 1NPUA 3D87B 1GVYA 3MBXH 4ONGL 1U8IA 2WBJC 4Z7VB 4KJPD 4R7DA 4MVBD 1CLYH 4GAYB 3X13B 5I1GL 3X3GH 2JJVA 4OQ1A 2EYSA 4PD4K 2CBVA 4FQXB 3WQVA 1QPXA 4LEOA 4X7EC 3MV9E 1PLGH 3O0RH 1X44A 3VG0L 3LN4B 2YKLL 5EU4B 2W59A 1JAEA 1CFNB 4WI2A 4ORGA 4NNYB 5CPTA 3LQAH 4HKJA 4OB5H 2ARJQ 2CK2A 1B3ZA 3BP5B 4OV6F 3KPNA 3S34H 1R5WB 1NH6A 1N6VA 1MJUH 4XAKE 3V6FB 3LPOA 1HXMB 4HKBA 4PJAF 4U49A 2ZZUT 1OSPL 3AVEA 4QT5A 1GGCH 1ISYA 1NMAL 4IRZH 4ODWB 5DWUH 4ZSOA 4HZ8A 1ZHLB 1EO8H 1FZJA 2P49B 3MPCA 3FY1A 4JFED 4PRBB 1K5NA 3TN0D 5IMMA 3HI6L 1DBAL 2LU3A 3U7WH 1ACYH 1G6RH 3MUIA 3WO4B 5I74C 3W39A 1YMHA 5EU6D 1ITXA 3O4LD 2NXZD 3TBWA 4P2QD 4LBEA 1TA3B 1AD0A 3X3FL 2EIZB 5DJ0A 3C5JB 4NUJB 2P8LA 4P2YA 1H3XA 2A77H 2CUHA 4BA8A 4NRYA 4BZ2L 4NPYB 3LMYA 4ZUSB 5C07E 4LNRA 1BJMA 1BVNP 3Q5YA 4MS8C 3GGWA 4XHJC 3TJEL 2VX4A 4ACZB 4UFMA 3IK2A 1RZKH 4MDJA 3HMXA 3F6IA 1G7MA 1G9MH 4GBXB 1A6ZB 4P99A 1YY8B 4WUUA 4AZIA 1MF2H 3K2MC 4JL1A 3GXMA 4WTZA 4YZFE 4GMTL 1R3HA 4L5FH 1NFDA 5DS8A 2IPKB 2VLKB 4TNVF 2YEZB 5JOEA 4ZYKA 4QRPD 3V8CA 5GS0C 1OTTD 4PJXB 1WVZA 4ZODA 4HUWA 4AZCA 1Q72L 4HGWA 3H7LA 2NR6D 3ZJ7A 4UV4L 3QYCA 2O92A 2IAMD 3ZTNL 5MENB 5FB8B 1OM3H 4S2SA 5FKAB 4OZHB 1SBSL 4MA7H 2DWDA 1UXWA 3DMMA 4KKAC 1ZT4B 1JPTH 1FV1A 2V2TA 2DT2A 1Z32X 4MQXC 2RCSH 3ZE2E 3DVIA 4HKZA 2VRJA 3SGEH 3VXSA 4M93B 3IDXL 3I50L 4IM8A 4OFKA 3RKPA 3O2VH 4HH9B 3E6HA 2WC3A 2WANA 3N18A 3ZHKA 1NANI 1QRNB 2V3DA 2WMJA 4LPXA 1IBGL 3VXSE 5C0BE 2BDNL 1Q9LA 2J4WH 3A6OA 3K3QA 2J74A 4ZOCA 5KS9A 4PV9A 4PJIF 3O6FD 1QI5A 3GMNA 1Q9KB 1XGRB 4OCWH 4ONFH 4EOWH 1V0NA 35C8L 3VH8B 1GZQA 4XP4L 5L8KB 1GGBL 5JA8B 4HZLB 3VH8G 1BF8A 3LH2L 1HN1A 3DHUA 4WF7A 1UZ8B 3MUJA 5LG1A 3MMWA 1YNTB 2YS4A 2XTJD 1OARL 4J7RA 2GI7A 4HUXB 1FVCB 1U8QB 3T0DA 4WV1B 4XVTL 5F7UA 1LE5A 4FHBD 1KEGH 1MW3A 3ME0A 1DBKH 2GFBA 3NTCL 3HG1D 3VUPA 2V5DA 1WFOA 2XQYG 5IR1B 4K71C 1H9VA 4FMKA 1MPAH 3BD4A 3BW9B 3AYSA 4GSDL 3EFDH 1P4IH 1HOCB 1RUPH 4OCYH 1BQSA 1N6QH 4EIZC 3THMH 3WIFB 3N06B 3CU7A 3LN9A 1EBPA 5KVEH 3QEQD 4G5ZH 1J0ZA 3OHXA 2PW1B 2R1YA 4YDKL 5D70H 4A6YL 1Q0XL 1NDMB 4LGXA 1CGVA 1V3IA 3Q5TA 2D20A 4E2OA 1ZVHA 4I3SH 3CZFA 3CFCL 3D0VB 3SO5A 1D5ZB 4PBWD 4M1RA 4EVNA 1KR0A 1VKXA 1ORQA 1OTUD 4GT7A 1VGKB 4OF3A 4CN6A 1A3RH 4PP1C 2GDUA 2VO5A 4D8PB 1Y7VA 1Q8MA 3TFKD 1N0XH 3UO1H 1V0MA 5D7SL 4IIQC 4L3CA 1W3HA 2X0YA 1CVSC 2AEWA 2QBWA 5BS0D 1X4ZA 4JFEB 4U6YA 2G9HA 3CUJA 3M17B 4HJGA 4NWUL 5F1IA 3A24A 4QRQB 1NMBL 3TN0B 3ALGA 3MCKA 4P7QA 3VTRA 2ZXBA 1M04A 1SYSB 2E27L 4AT6B 3CXDH 2NY4D 5EU6B 3RL1A 5D9SA 3T0AA 3O4LB 5FDWB 1VB9A 2NXZB 5AG8A 4FNRA 2JKXA 1IEAA 4P2QB 4RX4D 4XWOC 5E8EA 3KGRA 4KKBC 2H8PA 4YAQB 5C6TL 3DX4A 1T03H 3O3DB 3RY6A 2F19H 1LK3H 1TFVA 5IVXE 4PJHA 1JNDA 2J7HA 2BVOB 4BQ9A 1YEGL 3CZEA 5M95B 4QY8B 1FHDA 5A6BA 3QNZB 4WCYH 2MCPH 1AQHA 2WLYA 4X6CB 2NPLX 1WO2A 4U6XB 3I9GL 4DWHA 4AD0A 2CIIA 5J1TC 5HPOA 3N0PB 5HI5C 1FAKT 3WH6A 5CZVH 1OGTB 1JN6B 1WWAX 4PTUA 1CGXA 4IS6B 4YHLL 2ZCHL 2V6HA 3PWJB 4X0NA 4WW1A 4L8DB 1P53A 1NAMB 3TNNB 4HWBA 3LQAC 4YUEL 4RGNE 1EFQA 5F9JA 1UR9A 3MOQA 4QRPB 4PJEF 1EAJA 3SHSA 2NLJB 4NQXB 5ADOL 1HKKA 3B9VA 2P5WD 2FO1A 3VIIA 4DFHA 3STLB 3VFRB 1V02E 2VZ1A 1RZIA 1IC5H 4U1GC 3MFFB 4N0FA 1JBJA 1CLCA 1JTTA 4Y5VA 2IAMB 3DTXB 5DJZA 4D9LH 3G5XB 2BERA 2XICA 4YGVB 1TTGA 3QUZA 3MJ9L 3REVB 4Z7NE 4EEEA 1FFPB 2CXKA 4RAVA 3BE1L 5KSAD 1OT1A 1VEPA 1W9PA 3GZAA 1QFUH 7FABH 3ARWA 4NC1C 3EJYC 1OWRM 4N5EC 3V6OA 1U8KA 4NQSA 5HHXH 3ARBC 1DDHB 2UY4A 2BC4B 2C3XA 4MDIB 2EH7L 1W9DM 5BXPA 4UNVA 1HJUA 2XFXB 4KRNA 2PYFA 4OGYL 3FQRB 5I8KH 2DD8L 4M6NL 1YY9C 5KSBA 3TT1H 4HC1H 4LLVA 5E8PA 3QO1B 4EUPB 4QOKD 4Y19D 3RJXA 4D6GA 3PG2A 2OSLA 4OTXL 2P8MB 3KPOB 2EJ1A 2NY2D 1TDQA 4EUPG 5DQ9A 2CKRA 2F5BH 5A69A 3O6FB 1IKNC 4PJ7A 2VR9A 2QTEA 3WFHB 4HGMA 1RU9L 4JEGB 5L6YL 5EU5A 5DLMH 3TGXA 1ISWA 4X98B 5I2IA 3NIYA 3W24A 3TNMB 2D0GA 1T0NB 2H2PC 5CBEA 1TUXA 2Q86B 5HDRA 2ITCB 1G9MC 1BGGA 5C3LD 1LE9A 1G9NC 5DUML 3WXWL 5DMYA 1RI8A 1SMDA 3FXYA 2DQDL 4D9RD 2XTJB 5LA2A 2J8UA 4UDTB 3QO0A 5LCVH 4DWSC 4Z78B 5AZ2H 2ZG2A 2RGLA 2Q20A 4NO0A 3G5YB 1N59A 3BVTA 5CSZA 4DVBB 5DJ8B 3N13A 1FC1A 5F44A 3QG7H 5FYJD 4NKIL 4BKLA 3HG1B 3L7EA 2W60B 3LKOB 1F00I 2G3NA 1NFIB 3MLUH 2V7HA 5C0GA 1Q9WA 4PJGE 3PZQA 1MY7A 5DA4A 4TQEH 3C60A 4EI6B 4OI7A 3QCVL 1JZ4A 2XN2A 2JJUA 1R5VA 3MV11 1F4WH 4R26L 3QEQB 2ICEB 3FO0L 5KN5B 2P5ED 1I1RA 3VMNA 1JWUB 2ZNXA 3BIAX 1EAPB 3FT2A 2XKNA 4J4PD 1U33A 4X4MA 4EBQH 1N4XH 2GSGA 3DV6B 4L8SC 5KVFH 3LB6D 3WV0A 2DLFL 2R23A 1I8MA 5CCKL 4WENB 3L9RB 3U1SH 3FO2A 4K3HA 3MXWL 4XP6H 4X4ME 4KV5F 3AS1A 1JNNH 3BUYA 2E7HA 4ZD3L 4XT1C 1T89C 4R4FH 1VBRA 3ROOA 1R6VA 3PZMA 3OKOA 5AYBA 2NTFA 2DM2A 2Z35A 3ULSA 2DIAA 4WW2C 1WZMA 2BRQA 5LXGL 5GZOC 1JHKH 2IWGA 3QDJD 4X5WB 2Y7QB 1DWJM 3BGFB 2HJFB 4U0QB 5FUOL 5FF6B 3GXNA 5BS0B 3EDJA 3OAUL 2VCCA 4GMSL 3ZDXE 3C5SB 1I1FA 1A4KA 1T2QL 1ESWA 3WMCA 1CGWA 3EMQA 2QQKL 4RAUB 4KK9D 3FZUC 1ETZB 1KBGL 5I15H 2NY4B 1TQVA 2DM7A 5GSRB 4WTWA 1E27A 4QP0A 3MO1A 2DAVA 4CU8A 3MRJB 4FXLA 4EN3D 3RWCB 4U3AA 3TP4A 1YMMA 2HJKA 5JO5A 2FHCA 4XBEL 1LLOA 1LDPL 4Q6IC 4NHUB 3L4VA 2ARWA 1W2VA 4LSRH 3MBXL 1LEKB 1YMME 4WJXA 1K9DA 1US2A 4JREB 3LEYL 4LDLB 4NFDA 5IM7A 3W6LA 5F9WC 4N8CL 1UR0A 4P59L 4F7CA 1PLGL 3O0RL 3WJLC 3QZWB 2YOCA 4PEEA 3N12A 2HTLC 1A3HA 3QZWG 3FHAA 4HUNB 1CENA 5F1NB 4JAMB 4LKXB 5F89A 1GRWA 2NCMA 4OB5L 3SIMA 3BZFB 3AOFA 2FECL 2FHBA 2BXZA 4HJJL 3S34L 5DHVA 3T0EA 3X11B 4CD8A 4JCLA 1YPZF 5M94B 2Y8VA 1MJUL 5AEAA 1M6OB 4XCCH 5D8ZA 5TDPA 1GGCL 1IC1A 2P5WB 5I75C 4JKPH 1KCUL 3DHJA 4ZENA 4PJ8C 1E4IA 1HTYA 3AXIA 2DF3A 1EO8L 3GHEL 3TYGH 1RD6A 5HHMD 1SM3H 4K68A 2H2SC 1LL7A 2ARJA 5FA4A 4FZEL 2XZAH 1R8LA 1NBVH 5KSAB 1ACYL 1G6RL 4JRYD 5JBDA 2O9PA 3C9NA 3KNBA 1JFXA 1FA2A 1BYCA 5C0DA 1LG2A 1UB5B 4PLKD 3GMOA 1GCFA 5DZLA 1SY6A 4F33A 3MRNB 1UD3A 1YDPB 5SWQA 5F97E 3WKZA 2A77L 1WT5A 1XF1A 1CR9H 3HI5H 1KN4L 3AFLA 3QIBA 4IIQA 1GOHA 1N2RA 4QOKB 2BSRA 4Y19B 4CKVX 2IADA 3P4MA 1ZGLP 2VDQH 3BDXA 3I84A 2NY2B 1U8HA 2EDNA 5D7IA 3BEWA 1DLFH 1MJ8L 3MRIA 3OB0H 3RTQD 1NKRA 1RZKL 2RJMA 3QB7C 4P5TC 4H8VA 4LCYA 1FOBA 2FX8L 3BESR 4YR6B 2WCGA 1O7VA 3RI5K 3HC3H 1MF2L 1K8DB 3OLGA 2Z31C 1N3NB 4FK9A 1RAMA 4DKAA 2NY5L 4Q2ZA 1OSZB 1G7HB 5GGRB 5EBWA 4I4WB 1L0XA 4S1SH 4DUWA 5IFPA 5HYJE 1INQB 2V9QA 2ZXDA 5AY7A 3ZE1E 3EJRA 4PRID 4OCLC 1KV3A 5FM8A 2H26B 1J8HA 2EH8L 3JV4B 4HWZA 5CWSA 5CP7B 5GGUB 2EIDA 1U3HA 1HQ4A 1Q1JL 4I0PC 3TVMB 4BH7B 4NZUH 2A6JB 1K3IA 3SCSA 3U0PB 4ERSH 4MA7L 1HHGB 2XKUA 1RPKA 3LN5A 4MJ6B 1VEOA 5HDLA 2Y5EA 1CXIA 3VJ6B 4U5KA 3U46B 2V2WA 4ZXBC 5J11C 4JFTA 5CFHA 5ACZA 2RCSL 5HDOA 4M6AA 4Z7UE 4WUKH 5A6JA 2P5EB 4KZDH 3MJ7A 3AXXA 4NM4H 3ROLB 3L3GA 1ZTXH 2WWMD 2QADD 2J25A 5C2BH 4TVPE 2C26A 1RURH 3D69A 3SQOH 4LOUC 4Y2DA 4J3OC 1EX0A 2X2HA 4OFYD 5FCUL 1QFWI 4OF0A 3I2CL 4JE4B 2J2ZA 4XI5D 1F11B 1U9KA 3SDAA 4OCWL 2OBGA 4EOWL 3AXHA 2VUYA 5TJWK 3QDJB 3MUGB 3KYAA 3EO1A 2DM4A 1J0YA 3VXRA 1CPUA 4Y5XB 2WMFA 2WVVB 5ISZD 3QFJA 1CDIA 2VNCA 4F7PB 3MZGB 1HSAB 2APFA 2I9TA 4XRCB 5H35A 5IWLA 3RX8A 4AG4H 1KNOB 3QUKA 4IDLA 3VXRE 5IHRA 4JFZH 5GIRB 4PJHF 4JRXD 3V5KB 1EHLH 1VEMA 2ZX6A 5J06A 4ZAKC 4EN3B 4C56A 1KEMH 1KB5B 1W0WB 2ZP0T 4FLOA 3MGTB 1DBKL 4H25B 1BZ7B 3HNSH 5HPCA 1C16A 1UM5H 3VSUA 1YC8A 3BGAA 3HE6C 1MPAL 4Z0BH 2X2JA 3VWKA 1WAWA 2HTKD 3EDKA 2CLVA 4LU5L 3EFDL 5KAQF 2UUDH 4KTDH 3GBMH 1RUPL 4OCYL 1F4XH 2XJ7A 1RJCA 3THML 2VDNH 3BGMB 4ZTPL 3GSNB 2JIEA 4I77H 2F74A 2APXA 4JPWH 2BY2A 5KVEL 1ZEAH 4G5ZL 4NKOB 4M1GH 1MJJB 4MJ5A 3T8XB 4TTDC 3VG9B 2ZG1A 4JQVC 4XCNB 3CFJB 4OCRL 3DDFA 3QOKA 5GPRA 4RMSA 4FABL 4XX1G 3LKNA 4X6DB 4D2NA 1H0GA 4U33A 5DRWB 4I3SL 3RUGF 1W8NA 1ZKAA 1FDLH 2ZWLT 4U6HA 1JZ3A 1W3JA 4QHLB 3NIFF 4DWSA 4MAYA 2CBJA 1T1ZA 5C08D 1MRFH 2UYLA 5LA1A 3FFDA 2ZNWA 3GO1H 1A21A 5J3HD 1GOGA 4NIKB 4RMUA 1U3ZA 4K94H 5CHNB 4XP5L 1X6LA 4O02H 1BPVA 2WMHA 3FN3A 4M5ZL 1LDSA 4BUHA 1F90L 3KLSA 4K3EH 3IDYC 4KKLC 2IH1B 3BT2H 3QDMD 5HHMB 4JZNB 2P43B 1I4FB 2VLJD 5ID0B 1AFVL 3UMTA 3WN6A 4JRYB 4MNGB 5CJQH 3C6LD 4BJLA 3OXRB 5J12C 3I3BA 3CXDL 2A9NH 3BH9B 3W0WA 4KXZI 3T3PE 3VE0B 5KSBF 5EPMA 1FNSL 2EACA 2A38A 3FTGB 4D3CH 5FYLD 2GTWB 1T80A 3UTTD 5EBAA 3V0WH 2GJ6A 5DO2D 2H1PH 2JIXA 4WWID 2WWDA 2JF1A 4PJ7F 4YBQD 1LK3L 1OB0A 1T89A 5MEQA 2Z0BA 4NYLA 1TCRB 2N7AA 5E5RB 4YHZL 1CDBA 2VRAA 1MHEB 3KPLB 3GRWL 2MSPA 1I8KA 5BQ7A 1U2HA 1BTCA 3GMRA 4HWNA 5FK9A 1ED3B 4ODSH 2XXCB 4WCYL 3N1MC 2MCPL 2GUOB 3WCYA 4KMQA 2NY1D 4Z7VE 3RTQB 2BFVH 3OKLB 2R8SL 2J8UF 4WJ5A 5EU4A 4KPHH 1FZOA 3KAAA 5IB1B 2PXYD 3OZ9H 1UA7A 5J13B 1T5XA 4YDVB 3KPPB 1ZA6B 4OKVB 4IMLB 5A2LH 3SCRA 2CPCA 3IFOA 3SO3C 4GRMA 1WKYA 4ODXB 3VPLA 2YD4A 1UG6A 4PGBA 4TYUA 2JK5B 4X5XB 2WVTA 4GLRI 4OIBA 3GM8A 4PRIB 4LYPA 4XNQA 1IC5L 5FO8A 3PV7A 4ODWA 4WNQA 3AAZA 3GKWH 1UWIA 4L9LA 5T3XD 5AAMA 1XR9A 1DEEA 3L3HB 4OOZA 4ZUWB 4TOYH 1X5IA 3DUSA 3VFPA 4HFUH 5I24A 4MDPA 4JFOB 3BVNA 3R06B 5HHXL 5M03A 4JFDA 2IBGA 2NTSP 3A21A 5DJDA 4HWBH 2DI9A 4TUJA 1P6WA 2YDSA 3CUPB 1PGRB 4RBPH 2J62A 2IANA 3M6DA 3BRFA 1R34A 3TT1L 4HC1L 4KK6C 1SJXA 4FFWD 1E0VA 5T3ZE 1IGFH 4MWFB 3GI8H 3B8SA 1QPKA 4FXGA 4GW4A 2F5BL 5D1XA 4FLRA 1QFPA 4TSBH 3OR6B 1MCCA 2P45B 3PN8A 4X99A 2LVEA 5DLML 5IXEA 2Q6WA 1GOKA 1VFAB 1X5XA 2ZUQC 4D6HA 4AXNA 5IVOA 1KXVC 5ISZB 1CFTA 3I6LD 4ZUUB 2G4FA 3T08A 1NOFA 3WH8A 5GS1B 4Y4KC 3UTZB 3PZVA 3MRQB 3TIDB 4PJDA 1FL5A 4QXGH 2VLKA 5IMLA 1S7QA 2V5MA 3SDXA 4X4YB 5CEXB 1QSED 5LCVL 1AP2A 4JRXB 5AZ2L 6FABH 5HYSB 3K8LA 2VLKE 4W68A 4WTXA 5E24E 1QNOA 2D9QB 3NA4A 3QG7L 4AD5A 1B88A 1T1YB 1BFOA 2ZE0A 5HYSG 3GMQB 4PJXE 3VI4E 2PTVA 2L7JA 2OJEA 2R0LH 2EDRA 3FB8A 3MLUL 4X7SH 3S4SA 3S97C 3UJTH 3PTQA 4L4TD 3A6BH 3GIZL 4ZO7A 5C8BB 2UY6A 3EOTH 4TQEL 4L29B 5MENE 1BFTA 4G8GA 2YZ1A 4B7LA 1MLCB 3MNVB 4ZS6D 5DVNA 4OZHE 1W1TA 4IJ3B 4Z7WB 2APTA 4UUJB 2C9AA 3RIAF 2C1OB 3LPFA 3I3EA 4K3DH 1KTLB 3WDQA 2WB5A 4EBQL 1N4XL 2NX5D 5KVFL 1H0DB 3HN3A 4OZGA 3KVQA 5E9DA 1QWNA 4Q6YA 5C08B 1KGUA 4C7DA 4XP6L 1JNNL 1K4DA 3OG6B 5C0CD 2XA3A 4R4FL 2AXFA 3HZVB 1QRNE 1OP3H 3PHAA 4DGYH 5E7FA 3JWNC 1XGRA 1JHKL 2CO7B 4CRPA 5E8NB 3RX7A 5I3DA 4Y89A 1UH4A 3MC0A 1KLFA 2GTZB 3QDMB 4I18B 5HGDA 4GZIA 2HYMA 4W6WB 4U1LA 2R2EA 2KQNA 2VLJB 3FKUS 3TBTB 3NIGF 2LAAA 5TQ2H 4D0CA 1A9BB 4LSQH 1S7VA 4CVZB 3C6LB 1UCBH 4HSQA 5SWSA 5I15L 4OZFA 4Z77B 3EBAA 3PXHA 1MVFA 2HAZA 1DWIM 5LA0A 2ZXAA 4FTVD 5JHLH 1G84A 4JZJA 3UTTB 2HVKB 5D7IF 5I1AB 5GGRY 2CPUA 3UAJC 1EXPA 5CXPA 1D3CA 4BFGA 4N1CA 4NQDA 3QDAA 4NRXB 3TM6A 3WDIA 1D5MB 4JM4H 5DHYB 3MUAA 5IVNA 4PJ5D 1IGIH 3B9EA 4QWWC 1JF1A 1RUAH 3H0TB 4F80A 1MOEA 3SGEI 2NY1B 4JN2B 3P2TA 3QNYB 4PY7B 4QRTB 3V52H 5DMIL 1NDMA 3RY5A 4N9GB 4JKKA 3S35X 3UPRB 4DUXA 2PXYB 4ZQKB 4XWGL 4OFDA 1DLHB 2VTFA 2YD5A 4R4BB 1CTOA 4U7MA 1MFVA 1MCPH 3DO3A 2CCRA 2YLLA 5F3BB 3H9HB 5A3ID 4XCEA 4EAMA 3BPLB 3BUIA 4JKPL 1FH9A 1ND0A 4OZOA 5JXEC 1U42A 5I79A 3WL9B 1VF8A 2BNRD 3TYGL 4K94C 3FCTB 3NSXA 1SM3L 5EIIA 1WPCA 5IJVB 4X8JB 4GG6B 1EUUA 1PW3A 1HH6B 4ZFOB 1A6VH 3T0XA 2VDOL 3TN0A 4M03A 4ATWA 4JFEE 4OLVH 1QI0A 4AT6A 3MI6A 1U41A 4P2CG 3NCMA 3T04D 5FDWA 4IOIB 1NWUA 4P2QA 4DO6A 2EE9A 5EU6E 1BZ9A 4P5MB 3O4LE 3LD8C 1FNGA 3MLWH 5I71C 2DMCA 4P2QE 1AY1H 4DZBB 3AREA 3TPUB 2VDQL 1TVBB 1S5IH 2HP4A 5A43C 1R24A 1FVEB 4GZEA 1T1XB 1MY5A 4ZMAT 3KLAB 5J1AB 2ICWI 3MGOA 5K59E 1CICC 3HC3L 4PBVC 4XVUC 2PWEA 3S5ZA 1INEH 5GGTA 1GIGH 4X6CE 1SY6H 4UAOC 4XP9H 1FP8A 2EDHA 4H1LA 2AK4A 2Q7YA 5JW5B 1U93B 4RRPG 4YDLB 3TNNA 4NC0B 2VL4A 1OGAD 1PQZA 4S1SL 2NXYC 2F8VA 2OL3A 4U2YA 1QSEB 1GJUA 2AJYL 1MHPH 2NLJA 4LSSH 3MLTB 3OX8B 4QHMA 4LAQL 3NFPA 3STLA 1UADC 2WAHA 4LPUA 2X6MA 4QRPE 4U5IA 2ZOKA 4NZUL 3HMXL 1I9JH 4L4TB 1U91A 2Y25A 4B53A 3BH4A 4MNHB 3EOBB 3MX0A 1CNVA 1OM0A 4LF3B 4PRPD 5J9PB 3KL0A 4JGMA 2W91A 1G0DA 4HKXA 1BP3B 3B6SA 4TNVK 3N15A 4PJFB 1B3WA 4KZDL 1WBZA 1QHPA 4J8RA 3PZTA 4NM4L 1GGUA 3OGCB 2QSTA 1ODAA 2XIBA 2NX5B 5C2BL 2F8QA 1AGBB 3SQOL 3ZIZA 1S9XA 5E99H 3QO1A 1LWJA 4PLOB 4KJWC 4XNMB 5DD6A 1J8KA 1TZGL 3OQ3B 1U2CA 5C0CB 3TZVC 3HKFA 1TZIB 1Z9LA 1HT6A 1MHCA 5SV4A 3DX0A 5EOCL 3A0OA 1AR2A 1BFSA 1HNFA 1UWXH 2G8ZA 1YNLH 1SJHB 3LPPA 1RUMH 2H45A 1KB9J 2DJSA 3C2SA 4HLZG 4S0TD 1HP4A 3KYKL 4AD1A 5C0EB 1MQKL 3TNMA 1OIFA 4TVPH 1V8HA 4JPKH 1N8ZA 1NWRA 4AG4L 2EE6A 2ITCA 3HE7D 4HAFA 1RJLB 1TETL 5HI3C 1CFBA 4HF5H 3BH8A 4JFZL 3VKKA 5DMJB 1EHLL 4NBYB 5ABFB 4UDTA 3ILPB 3PDGA 4WW2F 1KEML 4R2GD 5AZEH 1SJEA 1AVAA 1KIUA 4FTVB 3LRMA 5CINH 5GGVL 5CD5D 5IBTH 3G6DH 3HNSL 2XTJE 4Y4FC 4LCIL 1N5YH 1R3JB 4Z0BL 3VO0A 1IT0A 3MKKA 3PZOA 4FLQA 1UH2A 4KTDL 3GBML 4UIMA 2X70B 4QNPF 3WD5H 1F4XL 2Q3AA 5C9JA 2VDNL 1D6VH 3HG1E 3W9EB 4EI5C 1ZEAL 4PJ5B 4M1DH 1KXVA 3EFFA 3LDBC 3QEQA 4GZJA 1KXHA 3BP6A 1MIEH 1FLRH 1XMWA 3OZOA 1J5OH 4LLWA 5B39A 1ZA3B 4V2CB 3DHMA 4Y4KA 1A2YB 3K4AA 2DTSA 4KTEL 4S10A 4X7TB 1X7QB 1FDLL 3JZ7A 4P46C 2IALB 3D3VD 3QEQE 4Q9BA 3U4AA 3VXUD 3L3DA 1LO0H 5FFLA 2FJGA 3L4UA 2I25N 3VM5A 3N85L 4BFEA 4AD3A 2R0ZH 1F3DH 1MUJB 1MH5B 3AU1B 3MLZH 2XVLA 2YK1H 5C0NC 1K9TA 1D6EA 3PHQB 4H0GA 4O02L 5DVMA 2HT4C 4X4ZA 1QBMH 1HSBB 1RV6X 4JO4H 3PBGA 4HA3A 3Q6FA 4K3EL 4MB3A 4FQCH 4XNXH 2BNRB 3BT2L 3WF0A 3L3OA 4LCCB 1QW9A 5BROA 2Y7QA 4UQ9A 1VFOA 4AZBA 3VGDA 4RA3A 3C5SA 3J8F7 4CVUA 1I8IB 5CJQL 2JJTC 1QR1A 3TYFA 4U1NA 1R3LB 4BH8A 2A9NL 3QFDB 4FNLL 4JKMA 5BS0E 2XHYA 1VADB 4NXKA 5C7XH 2EDTA 3RHWF 3BAEH 2VC2H 2VXQH 1TENA 2X4OA 4TUKL 4RX4A 3AROA 5AG9A 1IM9D 2H1PL 3FMGH 2QMKA 1IGMH 4PS4H 4Y5YC 4NHUA 3U5YA 1EEYB 1NGWA 4O2CA 1BFNA 1P7QA 1LEKA 4U6VL 2OQJA 2PW2B 2QV4A 1NDGB 3MRPB 4I0CC 4ODSL 3A47A 3E1F1 4OBRA 3ZJ6A 5BMFH 5FD0A 4GAJH 1PZ5B 3MV7A 3GMLA 4PJDF 3SDXF 3LKRB 1OL0A 4QLLA 3ARFD 5FKPA 3FAXA 3EGSA 3ZKND 4JQIH 3O81A 1KIPB 2E8YA 2P46B 2PYED 5E6ZA 2W65A 2R56H 5E6IC 4IRSA 3RVWD 1CK0H 4LVOC 4HPYH 3ZT5A 3H53A 1OGAB 1WDSA 1NGPL 3WD2A 1Z5LB 3D48R 1RZ8B 2WZIA 2UWFA 1SVCP 2VERN 2FJHA 3IGUA 1KIQA 1FFNB 4B9YA 1WISA 4JFVA 2P5WE 2X1XR 4XZUB 3OZPA 4LNVA 5DT5A 4KI5D 1PBYA 1E4KC 4TOYL 5JIIA 4OGXH 4HS6B 4PRPB 4JFYB 2BSED 3TTYA 3SPVB 4PJBA 4E8DA 1TJIH 4OZGF 4A6YB 3G6JB 3WY1A 2P48B 4HWBL 3SDCC 1B90A 1SYVA 4RMVA 3UTQB 1P4LA 1ZHNA 4MQ7B 4YDJB 5F1SA 4NGHH 4ONHB 2J77A 5IJKA 4IOFC 2Z91A 3ALPA 3P73A 5T1LD 3SUVA 2XYLA 2Y9RT 3QUXA 2YN5A 4KQ4H 3S36L 2MOVA 1PEZA 2X4TA 1UD5A 1BBDH 4H26A 2XWEA 2IH3B 1WDPA 4Y19A 3GI8L 3GJEA 5BJTB 2X7LA 3HPLA 1WGOA 5GGSY 4TSBL 1IZKA 2A1WH 1E4NA 1PKQB 4WDIB 4QXWA 5BXFB 3MR9A 4QOKE 4Y19E 1NCCH 4NCC2 4Q9RL 4EQ2A 1I85C 3QHNA 2QSVA 3DROA 5D5MA 5HGAA 4I3RL 2BVTA 3NH7H 5T3ZH 2R29H 5JNYB 3HE7B 2AGJH 3ZOAA 1E0WA 3CVHA 1T4KA 3RJYA 4QXTB 5GGRA 1F45A 4Z5RA 1X5FA 2ORBH 5LQBH 1P1ZA 6FABL 3VSVA 4M7ZB 4P4RA 4R2GB 1KLGB 4E4PA 4KUZL 2WV3A 2QSCH 4D9RE 3UJTL 2R1WB 3CPLA 1VGEH 2YPLD 3A6BL 4MAVA 3EOTL 2WZHA 4FQQB 5FYJE 3AQUA 4OI9A 3ULVH 4YHNB 1XRVA 3SJVD 1CU4H 5J1SC 1MIML 2K9UA 3ZMRA 1J88A 3DRQA 1S7RB 1UZ1A 3W38A 5FM5M 1GGYA 4K3DL 4KZEH 4DEPB 1U8OA 3P77A 5D2LA 2IMMA 2DQFB 1AE6L 4J4PA 1J05A 3D3VB 3VXUB 4PTTA 4B15A 2P5EE 3MRHB 1Y0LA 2MQ3A 3U0WL 4R97C 3CFDB 3I75B 5I1IH 1HNGA 5DRXB 15C8H 1A5FH 3IS0X 1GOWA 3NUKA 3BPNC 2AJ3A 4KJYA 4KMTL 3PNWA 2AV1A 4OGZA 3ALFA 4HU0A 4LRIC 5ACMA 1V3JA 3K1KC 5GSVB 2DRUA 4X0KB 1KOAA 2D7QA 2RFXA 1GORA 4Z95H 1BIIA 4F7PA 1HSAA 3IXTB 5KSUA 1TPXB 3RM4A 1KFAH 3QDJE 1MFAH 3MLYH 1UCBL 1UB6A 4D0BA 5GIRA 3DDGA 1SEBB 4EE9A 2J8GA 5IQ7H 4YDIH 4PTWA 3MO4A 1KCRH 1I1YB 4JHAL 4UTAH 5FAAA 4GXVL 1X5GA 1XIWC 1IM9B 2D3LA 1NLBH 1TCMA 3QDHA 3S3PA 4X5LA 3RVTD 3O3EA 1FVDB 4EDWH 4NZRH 1RZGA 3OB0K 4JHWH 4G80B 2ID5A 1O0VA 1U0QA 2YPKB 3KPQB 4L3AA 3BGMA 3W0KA 4KRUA 4LPVA 3WHXB 4K8RC 1OT2A 1ZT1B 2AV7B 4JFFD 5D7LA 3WEXB 2B4CC 3TWCH 3V52L 3A4WA 5HVGB 2ZICA 4OZFH 5AD0A 4WEBL 5AUMA 3N1PC 1YEDB 3ARFB 4X6DA 5I76B 4LHUD 3DGGB 2IG2H 4GKNB 4XX1E 5ERWA 1TQBB 2G5BB 2PYEB 3ELAT 4QHLA 5J8OA 5FCSH 1S7XB 3HB3D 1OINA 3BKML 3HNVH 4I3GA 3VXOA 3U9UA 3S9DB 5C0JA 4QXUH 4GW5A 2VMFA 3RMEA 4AZ5A 3BQUC 4PCTA 2OLDA 1S7UA 2UV3A 4Z2HA 4JFPA 2PETA 3FRPA 3KJ4B 1WTLA 2YDRA 5ESVA 5D2NB 2DQUH 1UENA 3ZL4H 1A6AB 4LCWD 4X6BA 3VFMA 1YEHH 1A6VL 3X14B 3U30B 1I4FA 1DUZA 5A2KH 4QHUA 5F9DC 3UG5A 3HG2A 3RWJA 4MNGA 4L3ED 5HHME 3C87A 3EJZD 2R0WH 1FBIH 4OLVL 1A7BA 1E70M 3BH9A 5TE4H 3HHRB 3OKKB 4PMVA 3CHEA 4D94A 3P0VH 3CFBA 3WDRA 4M8VA 3B2UD 4JRYE 4MNGE 1WTGT 4PJ9C 1UWUA 4UT6H 4M43L 1AQKH 1JWMA 2DIJA 4PG2C 5T1LB 5JXAH 1JHLH 4LDOB 1W1PA 1AY1L 3ES6B 1LP9A 2Z92A 1M4KA 3WEOA 4ZFFB 1S5IL 1J9CT 3ZYZA 1LF1A 1BVKB 1T3FA 4MD4B 1MXDA 3QEUB 3T0WA 3PWUB 2DQEH 1QKZH 4OUUA 3KE0A 1MAMH 2WW5A 2X4NB 3C08H 1FHLA 1V03A 5FYKU 4DGVH 1SY6L 5DEGA 1BOYA 3IAQA 4XP1L 4YDVA 2ZWZA 1T22A 3F12B 1NGYA 4IMLA 5FUCE 5IIEA 1CGUA 5FYJU 5TF0A 2FLRT 4ODXA 2DSKA 1MHPL 1ONQA 2HT2D 4LSSL 3DSFH 3S37L 2V3GA 1W9XA 5CBAA 1IGCH 5FA3A 2UUDK 4MZ3A 1FFRA 4JFQB 5E1AB 5MEPB 4QGTA 4PRIE 2F7PA 1I9JL 4BA0A 4JDZB 2YPLB 1HVQA 4FQXC 1WF5A 5GGTH 4ZUWA 1EDGA 43C9A 4XZBA 2W1NA 2ADGB 3SJVB 1YJDC 3AUVA 5INCA 5HHPA 1NAMH 5GGQH 3RVVD 1E6JL 1M53A 3CK0L 4X6EB 1RP9A 2WSPA 3QHFL 4KDWA 5GNZA 3MNWA 1HILB 4K7FA 1OD7A 1OF2A 2IMNA 3D0LA 3FB5A 1UD8A 1I7RB 3HUJB 4NKDB 5DFAA 2UZXB 1PEWA 1UR1A 5F88B 3IDMB 2CKBB 4NI3A 4MWFA 4PG9A 43CAB 1QX1A 4DN4H 4M81A 1HKIA 2CKSA 2AAVA 3RWIB 1TIUA 3OR6A 3SKJL 1N26A 1YNLL 1D9KC 4TVSa 1RUML 4ATDA 1I9IL 3K81A 5KVGH 1JI1A 1XGTB 2X9YA 4OZIB 4U1JA 3CDCA 1RUKH 3WO4C 2EZ0C 4U1MA 1UKQA 4JPKL 1M7DA 1G6RB 1PYWA 4Y4HD 4R3SB 4R7NA 3WH7A 1GC1H 3IS1X 3O6KH 4LCUB 5B4MC 1NEZB 4TX6A 5EG6C 2ENSA 5CEXA 4YH6A 3W5NA 5ISZE 1NEZG 5E8OA 1BQHB 5AZEL 4EUPH 2ZUTA 3CUFA 3BO8B 3E0GA 4N8VB 3WN5B 1UC6A 3ZE2F 1UD6A 3G6DL 5KVDL 1BQHG 3PL6D 1NCUA 4R8WL 1FYTD 5IDIA 2QHRH 2D31B 1ZAGA 2J88H 3GMQA 4JRXE 4N8VG 1N5YL 3UESA 3QAZC 4BSVB 2NY3D 4FNPA 2WBWB 1MNUH 1VFBA 3AS2A 4ALAH 2GK2A 2GJJA 1D6VL 3LKQB 3R4DA 1A3QA 3WY3A 1E4MM 4MMZC 4M1DL 2P7TB 2EXWD 2XVNA 1BVLB 4PD4J 3K4DA 4JFFB 4XCFH 1QVOB 1FLRL 1J5OL 3O2DA 1PG7W 3VXPB 1A0QH 2CMRH 1O6IA 1EV2E 3VFTA 4LHUB 3HZYB 2QR0B 1CG9A 1KTLA 4HZAA 3ULUC 1LO0L 3C8KB 4J3TA 2V2XB 4Z7WE 2DWEB 3LRGA 4LHUG 3R1GL 5E8DH 3QCTH 3WUBA 3CUIA 2I24N 2FO4A 2DIBA 3UDWC 3MLZL 1I3GH 4M02A 2OI9C 3VMPA 4KRMB 2VAAA 5I1CH 4Y16A 1EZVX 3ET9F 3HZVA 4PV8B 1NP2A 5TE7L 4JO4L 5GRJH 1WFNA 2CLRB 1Q94B 3NFSH 4UTBH 3DI3B 4OSUH 5C08E 3AYRA 5EH1A 2ESVD 5L2KD 4PJBF 3TJHD 3SGKA 1B0WA 1XGYH 1LK2A 1MHHA 4LCWB 1G9NL 4EIGB 3TBYA 3GBNL 4S1RH 1FZMB 5IQ9A 1R7OA 1QFWM 2X1WL 3NAAH 5JUVA 5EOQH 3QDME 3E8UH 2BRRH 4F66A 4PREB 4KKCD 4L3EB 1WBXB 5DT1L 3L6FB 4HIXH 5C7XL 4RBPK 1KYOK 2VLJE 1QLEL 3HNTL 3A22A 3AHVA 1XZ0B 3BAEL 3ZKMD 2VC2L 1BLNB 2VXQL 5A40E 3UG4A 1A7PH 1US3A 2JELH 3QIUA 1A6TA 3FMGL 1IGML 2GY5A 4GPNA 1A7NH 5GGSA 2HVKA 1T5WB 2EYTA 2OSWA 5FYLE 1HH9A 2E4TA 1RJYA 1ODZA 2PB1A 3GSOA 1G7JA 5D4YA 4M4RA 3NIDE 2D2OA 4KU1A 4PJAB 3UTTE 2EPOA 1RFDH 5D5MF 5HHQB 1ADQA 4CN4A 3S5YA 2CERA 2Y6SC 4GAJL 3PUCA 5KSVB 5BVJB 3Q0HA 3CBWA 5I1DA 1EIBA 4RWYH 1VBUA 4N1EA 1NUFA 2NW3A 5AYUH 3SKNA 1EK3A 3WSQH 2Z8SA 5MERB 2VITA 4M3KB 2R56L 4G6AC 5D1ZD 4KDTC 4HPYL 4WV1C 5IB2A 4H41A 3Q3GB 1T0MB 5F3BA 2KZWA 4OIIL 2ESCA 1RMFH 3P40A 4OD3H 4XNYH 5HGBB 1OP9A 5I8OH 2X1IA 4MB1A 2DL9A 2EO9A 2WVUA 3VFVB 1ISVA 1I7ZB 4KJPC 4MVBC 2AW2A 4S11A 3C5ZD 1J0IA 4OM0L 1WICA 3B5TA 1PY9A 5DK2A 1IQWH 1FORH 3G6LA 5D9MA 2DQGL 4ZXLA 2RIKA 1L8NA 3MBEC 4P49A 4GG6E 3IJSB 3EZJB 2YN3A 5T3XE 3QRGH 5CEYA 2FD6H 3GXFA 4P57B 1HIZA 1LO5B 5D8WA 3QQ4A 4PGJA 4NGHL 2BX5A 4YHYB 3P4NB 3S98A 1LL6A 4LLYB 4KQ4L 1OP3K 3ZTJG 5EBGA 5CJOH 5LKNA 3RDTC 5EBMB 3VI3E 1E4LA 1BBDL 2XNAA 1NWSA 5ABGA 1LEGA 1HEZB 1DWGM 3HFMH 4X7DC 1CFQB 1TJHH 3PQYA 4XC3H 5IVZA 4UNIA 2DQCH 1MLBB 2A1WL 3KPSA 3ZDYE 4YQXL 1K8IA 3MA7A 4L4VA 2EO1A 5HDQH 4NWTL 1WDRA 2EPNA 1X4YA 3SUSA 3BUPA 4PUBH 2F2HA 3HZKA 4KK5C 5L8LB 4OLEA 1GUVA 2VLLB 2Q8BH 5SV3A 1NGXA 1HJWA 2J7EA 4F3FA 5T3ZL 2DICA 3OJMB 4Y4HB 4Z7NF 3OJDA 2AGJL 1I7UA 5JW5A 4RMTA 4MJIA 2NXZC 3I02B 1JGUH 5E0QA 5BRQA 2XY1A 3ESVF 2ORBL 2E7BA 5LQBL 4HS3A 2OWWA 1AQDB 1DN0B 3I6LE 1Q6EA 2A3CA 2Q7NA 3MACH 5GXBB 1DVFC 1JV5B 1C12A 3HTLX 1YECH 4RL3A 1BGXH 3PL6B 1FYTB 3ZYIA 1QSEE 2CGRL 1C8PA 1VGEL 4G42B 4P8VA 1JGEB 2YUZA 2NY3B 4L4TA 1BEYH 1Z0NA 5DMKB 4PJIB 1WWBX 2GJZB 1XHGA 4X4XA 3ULVL 5J9PA 2RGSA 2V5CA 2VLRD 1CU4L 3MANA 1XCQB 2D7TH 5ITFA 3FFCD 1PG7L 1OWQA 2EDJA 3PV6B 1WP6A 4KZEL 1M05B 3RNQA 3CMJA 3T1FA 1Q4NX 4MA3B 1OHQA 1XCTB 5ALCH 5FGRA 5F70A 1OTTC 4PJFE 3I6KA 3DV4A 5C0FB 2BVYA 4WY7L 5DMGD 3U7YL 2XM2A 1W72A 5I1IL 2NX5E 15C8L 2HKFL 1RK1B 2IAMC 4I48B 1KTDA 5CSGA 3QA3B 5MI0B 3RIFF 3WJJA 1BJ1J 1MQPA 2HFEB 4H88H 5DVKA 4FNTA 1IGTA 5CZXD 2ESVB 1LHZA 2J1KA 4E41D 5L2KB 3AMLA 3DIFA 5C0CE 1QVBA 1J1OL 1DBJH 4H20H 1WIPA 4W86A 4XGZB 3OKNB 3FONA 3IAPA 4Z95L 4HX1B 3O11A 1NCWL 3RIAK 3OR7B 1E4XL 1MFAL 3SE9H 3R8BB 1KXQE 4NM8H 4YBLB 1UZ4A 4PJCA 4L8CB 2MKWA 3MJ8B 2FSEB 3NFNA 1OD8A 3HPJB 1LP9F 4JJ5B 4J28A 1KENH 4YDIL 1UQSA 4U1SA 1KCRL 4WKHA 1MEXH 4HOWA 4UTAL 1FSKB 1S3KH 2N7BA 1GGIH 1QNZL 4H2CA 1NLBL 1S7SA 1AQ0A 4UZGA 1JGLH 1W0VA 4RNRA 3LX9A 4WLCA 2VKWA 1H15A 5I8EB 4JG1H 4JHWL 1VJSA 4FTVE 4ZNEE 3HG3A 1B2YA 4H8WC 1D9KA 3NA9L 3O6FC 5ICXA 3GM0A 1HJVA 4OLZL 4TXEA 1M1SA 8FABB 2HN7A 5HI4D 4MXQD 4EANA 4W4NA 3TWCL 2BS9A 2CD0A 4OT1H 4POUB 1CXLA 2XZCL 1VHPA 2IG2L 2NNAB 4PJ5E 1A9EB 3E6FB 1X7QA 4LLUA 2VVNA 1KB5H 2XTJC 2YL9A 3IDJB 7A3HA 1ZLSH 2O61A 4FQLL 4JFXA 1XH3A 5D1ZB 2ZCKH 1B4RA 5FUZH 4QXUL 3O2WL 2VAJA 4LLMA 1E40A 4WKFA 4LEXH 3LXCA 5D7JD 4MDOA 3IFPA 2ED8A 3PHQA 1RIHH 2R15A 3VDHA 3WUFA 2F58H 5I78A 3VA2C 3FOMA 1AKJA 3GSNH 3QI9A 4PYSA 5DA0B 3AGVA 1MVUB 2VX5A 3ECBA 3ZL4L 3N9KA 1MFDH 3D18A 4YHKH 1FFOB 4WUUD 1T83A 3C5ZB 2WWCA 5M17A 3QIWA 4JLRB 1A6WH 3VX1A 2BNRE 4G6MH 4DK3A 2O5ZH 5C8JA 3FN0H 5EOTB 2R0WL 3QFDA 1B4JH 1DBBH 4LLDB 1P9MA 1UEMA 4H5SB 3JV6A 1G7PB 1BSIA 3QHZH 4UT6L 1AQKL 1KTBA 1QSZA 1RUQH 3MRKB 3QQ9D 1JHLL 3JVGA 3WFLA 3P30H 3TFKC 3W26A 5C71A 1V6WA 4PJEB 4M9PA 4KJQD 3W9DA 3OJ2C 1GQLA 4LSPL 3X12A 5AAWA 3MREB 1GPOH 1C90A 1JAKA 1HCVA 3DMMD 4MX7B 2ZCLH 4XTRC 2MHAB 3BGFC 5CUSH 1J86A 2R2CA 3S35H 1G9EA 3CDYA 1QKZL 4PTMA 1MAML 3C08L 4MNQA 2WXDM 4LP4A 4Q7NA 1TQTA 1LD9A 4QRRA 2LU4A 1CT8B 2G3IA 1FGVH 3D25A 2PC8A 1JPSH 5F9OL 3FO1B 4K9EL 3P9LA 5HVHB 1JNLH 2NY4C 1C8XA 2OW6A 1CDJA 2ADJA 2EDEA 2WHLA 3C2AH 4M48H 4YO0B 3ARGD 1IGCL 1JPFA 2EDDA 5JTWA 3OLEA 3FQWB 2P24A 3HZ3A 4RZCA 3D52A 2J47A 1OGAE 1XFPA 4F57L 3NCJH 4FG6D 4TSAH 4NOBA 4NFCA 4JREC 1V6YA 3SKOB 3REWB 4JDVB 3IB4A 3S3SA 4NN5C 4UOW0 5GGTL 5HD8C 1NGQH 4GXPA 3RGVC 1Y18A 4PY8J 3TO2A 1ES0B 3BP7A 3UBXB 1TQUA 1CECA 2XPKA 4M8QA 2W0FA 4J3XA 3SPVA 2D3NA 2VLRB 3BJLA 1FE8H 1JD7A 3UBXG 3L5WB 4CCCA 2N1KA 3VWJA 2OL3L 2IBZX 3CAFA 3FFCB 3HU7A 4M7KH 4PRPE 4YDJA 3JTSA 1NGZB 1LJYA 4HG4K 4GKZA 2QQNL 1CE6A 2BY1A 2GITA 3G6JE 4G6KH 3IXAB 5IG7A 2XM1A 2ZSVB 1OQXA 5IB4B 4Y2OA 4PPTA 2XWBA 4BZYA 1U8IB 4RSVA 4MXWH 1LQSR 3CC5A 1CS6A 4DN4L 2DQHH 5JUEL 2EYSB 1GHFH 5FHBH 5IB3A 3LXBA 1BD2A 4KI1A 5KVGL 4LEOB 4WRLA 4E41B 5KSAC 3S5LA 5EU3A 5TE6H 3GXDA 5DRZB 4PGCA 2WMIA 1PKQE 4U7KA 4ORGB 5CKGA 4HKJB 4JO3L 1FNEA 3QGVA 1B0GA 3KPNB 3S96A 5JHDA 2MMXA 3V4PH 4QXTA 1AQMA 3C8DA 4WHDA 5FM4A 3WNKA 3E3QE 3RDTA 4HKBB 4QT5B 5B8CA 2RR3A 3BZEA 3N9GH 3IJ7A 5A6SA 2J88L 3RDKA 4ZSOB 3QH3A 4F9PC 1U8NA 2R1WA 1FZJB 1OOAA 4A4AA 1MNUL 2APVA 4Y1AA 4UFLA 3KPMA 1AGDA 4WVRA 2MNUA 5F1OB 2C5DC 5IMMB 1GNXA 4XCFL