3K8LA

Crystal structure of susg-d498n mutant with maltoheptaose
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
649
structure length
649
Chain Sequence
WTALTASPDTWDETKRADISYQLLLYSFADSDGDGYGDLNGVTQKLDYLNQLGVKALWLSPIHPCMSYHGYDVTDYTKVNPQLGTESDFDRLVTEAHNRGIKIYLDYVMNHTGTAHPWFTEASSSSESPYRNYYSFSEDPKTDIAAGKIAMITQEGAAGYNAAEWFQVSDETAAVKGLLKFTLDWSNAPSPILVVSTGTKADEDNPDTGTDNAKYLYYGEDICKKFYDKGNNIYELTVDFESTWGLLIRTSNASFWPSGTKYGASSSSEKLALNKDFKLTNAGNPANIMFDSQQITYFHSHFCTDWFADLNYGPVDQAGESPAYQAIADAAKGWIARGVDGLRLDAVKHIYHSETSEENPRFLKMFYEDMNAYYKQKGHTDDFYMIGEVLSEYDKVAPYYKGLPALFEFSFWYRLEWGINNSTGCYFAKDILSYQQKYANYRSDYIEATKLSNHNEDRTSSKLGKSADKCKLAAAVLLTSAGHPYIYYGEELGLYGTKDNGDEYVRSPMLWGDSYTTNYTDKTDATVSKNVKTVADQQADTHSLLNIYFSLTRLRNTYPALAEGNMTKHSVYNESQEKDYKPIAAWYMTKDNEKLLVIHNFGGTAMQLPLTDKIEKVLFVNGETQQNTDSDSYTLKLGGYASVVFKLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Alpha-amylase, susG
publication title SusG: A Unique Cell-Membrane-Associated alpha-Amylase from a Prominent Human Gut Symbiont Targets Complex Starch Molecules.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 199
structure length 649
sequence length 649
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k8lA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3k8lA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k8lA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3k8lA03
4OTXL 5TF1L 5ITBH 1QPPA 2F8XC 3BLKA 1IT9H 4H0IA 1A6WL 1RJCA 4GAFB 1M05B 1EBAA 4LFHD 4HH8A 2YN3A 2QQNL 1YA5A 1S9YB 2DSUA 2BRRL 5I1CH 3VD9A 2C3HA 1NCTA 2NXZB 1AD0B 3O6KH 4MJIA 1CE6A 1WZLA 1JHKL 4UTAH 1CPUA 1GVIA 4L5FH 4IJ3C 4XCYA 3HG1B 5CG0A 4HUUB 5MI0C 5C0CB 2QBWA 1T5WB 3O3EB 4YDJA 5BS0D 5I66B 3PL6A 2BP3A 5CFHA 2HFTA 1RFDH 3DHJA 3X3GH 4S0SD 3A6BH 4MJ6B 3KS0H 3SPVB 1BF8A 4P3CL 4TOYH 5HYSA 1H8OA 3SCSA 1G5AA 2BHZA 3ARWA 4OB5H 3BSGA 4OOUA 4MDPA 4G8FB 5KSBF 1E6JH 4GFTB 2A1WH 3GJFK 3TWCH 3UAJD 3NTCL 4BH7B 3RWGB 4Z7UE 2EDWA 3MLWL 5I8OL 3V8OA 4X4YA 4QXUH 4J3WA 2R0KL 2VZUA 2GTZB 1GHSA 3MLXH 5ICXA 4ZOEA 4C7FA 5DMIL 1BZ7A 5FA4A 3MSPA 3X12B 3AMCA 2YL8A 3LN4B 4RRPA 1E6OL 4NJAH 4UOW0 5FO7A 4F15C 2F7QA 3D4ZA 2PXYD 4JN2B 3U36B 4UQEA 2AV1B 1G9ML 5J6HA 1B0RB 1A7QH 2DQEL 2R2HB 4HJGB 5LXGL 5E9DB 4QRRD 3AMLA 4HGWB 5ANMB 2F19L 2GJ6B 4U6VH 1QO3B 3SGKC 2IADA 2HT4D 7CGTA 1WGOA 4I77L 2XTJD 3FTGB 3TPUB 3QUML 4G6MH 5DDHB 3GNPA 2IAMB 1QFWM 2JCCE 3AFLA 2V3DA 4XTRD 3I6LD 1MVUA 1TCRB 4K71B 4KTEL 1HOCB 5E2WH 1FVDB 1H15B 4EKXA 3WF3A 2C4XA 4MA3B 3O8XD 4DCQB 4G9FD 1KYOK 1XGTA 2AJSL 3LRSB 5EA0L 2A9ML 3ULUF 2VDQL 4WNQB 2W9EH 4KDWA 4KH2A 4FNQA 1JGIA 1IAMA 4YBHA 4RMUA 4EIGB 2FEEL 3TYGH 5J13B 3G5ZB 3TNMB 3GO1H 1E4IA 3JV6A 5DVOA 2EO7A 1CLYL 3QUXB 5I19L 2XWBA 4HIEA 3WUEA 4NSBA 1OT1A 3B9EA 3HZMB 1D5BB 3GIVB 4PJXE 4NT6A 3WY1A 1UWEL 1QD0A 5AY7A 4YHKL 1CXLA 4XCFH 3AYSA 5DSCB 2VYRE 5E6ID 3WIIL 3L3IA 1P7QB 5T1MA 1FVCA 3FFCB 4ELKA 4W5ZA 4FNLL 5T3ZL 1IGIH 4Z2IA 1M4KA 4NCDA 1HQRA 1KNOB 5EMYA 1NQ6A 5F93C 3Q6GL 2APXA 2WK2A 3RVXC 2IH1B 1SVCP 3EO9H 1W9XA 1JE6A 2XRAL 5LGHL 3RP1A 5I73B 4Z7QE 4YHOL 3HE6A 3ARFC 3D25B 4K7PH 4E41A 1BPLB 3MRJA 2RGLA 1LG1A 5JA9A 1D7FA 3F5JA 3BZDA 2YDQA 5BJTA 4Y19A 3TN0D 1JYWA 4YFDB 3CLWA 1MCPH 4PG9A 4OZHE 4BQ3A 4N90E 3F5KA 5D7JD 4Y16B 2GCYB 2OM5A 3DPBA 3IKCB 1ES0A 1UVQA 2Y23A 2VDNH 1FNFA 2YXFA 4PJAA 3NFSH 3DDFA 3OG6B 3TBYA 4QRRB 1CZ8L 1QLFA 3WJJA 5C7XL 4L4OA 2DI7A 4IRZL 4Z0XB 5T1DL 5GXBB 3S88H 1AKJD 2Y36L 4WKAA 3DC0A 3HUJB 5GNYA 3ZHKA 3OWEA 2FL5B 5ERWB 1O7DC 2AXGA 2P7TB 4U1HA 3MMWA 2FGWH 3IJYA 1FE8H 3TBSB 3WN5C 3TJHD 2AJ3B 4MAUL 1KIRA 3GMQA 5AWNL 2I9LA 4GSDL 4XCNA 2JF6A 3AXHA 3RKPA 4NOBA 3HG3A 3VWKD 1WT5A 3BLPX 3MBXH 4KROD 4Q0XH 2ZX9A 5DR5L 2HFFB 2WWCA 1OW0A 4MNLA 1N26A 2BDNL 4PV8B 3T0AA 3C5SA 4X4ZA 3G6JA 2MKLC 4AK1A 3MV9B 4I0PA 1WFOA 3MC0A 5C0AD 1QI5A 4AEEA 2IG2H 3HNVL 1JV5B 1TIUA 4XPHH 1DVFC 5FECA 1BMGA 1AI1L 3KXFD 4KKBD 1XF4A 3BKYH 5DT5A 4HX1A 4P4RA 5ESQA 1HHGB 2WMFA 3UTSE 4FQQB 1ZLVK 1H5BA 3TC9A 5SWZA 4BSWA 4KK5C 2UZXB 3A47A 1LK2A 2DQFA 4KUCF 4UMGA 5MEQA 3VNYA 1V0KA 4I18C 4HD9A 1U3HA 1J7VR 3IJ8A 1M6OA 1HKMA 2YK1L 2O9PA 1N6QL 1TQTA 5MEPB 5MHSD 3WL0A 2YPVL 1PBGA 1J1OH 4XPFH 4JFZL 5DJYA 4U1SB 1KV3A 4G8IA 3OHXA 1RZJH 1WT5C 1CENA 3GXMA 4JFED 3GKZA 1KN2H 5MENB 5GS3A 1MREH 1W2VA 4XPAH 3ILPA 3W2DH 4DGYL 3AHTA 4HKXB 4KK9D 1EHLL 5CCKH 3N04A 1PGRB 3F12B 4DUWA 3LD8C 4I9WE 4PJIE 4HUWA 2F7RA 1JNNL 1MHEB 1U91B 1UZ8A 4AM0A 4AWEA 3HMXL 3QUYD 3OJDB 1GPFA 5IQ7H 3RVWD 2RCSH 1UWSA 1I4FA 4GG8B 4EBQH 1QKZL 4GQRA 4LYRA 4L8BA 3FN3A 3B6SA 5MEOA 4AD3A 4S1QH 2VRJA 1A7BA 1XGYH 2VB5A 2H41A 5C2BL 3JVGA 2IANA 3GSOB 3P77A 1NLDH 2R56H 2X9YA 4L9LB 4QT5A 1JRHI 3QHZL 4HPHA 3R0NA 4DJMA 3DGCR 4UOJA 4M93B 3SO5A 5AG8A 1MJJB 2QSQA 1QFWI 4PRHB 2I9TA 1FOBA 4WGVB 4Y2OA 5AAMA 3N15A 1J05B 5EBWA 4MB3A 5AYUL 2WVSA 5GHWH 4ZS7L 3SE3C 5H35A 5A2JH 4I13B 3ZE2F 4O5LH 3DETC 3VM5A 1KR1A 4W89A 3HPJB 3QEQA 3P11L 3CFEB 2XT1B 4ZUVA 1OCQA 1RULL 3ARBA 3PWUA 4JM2D 3ALGA 2A0LD 1J5OH 3BH8A 5DLML 2H26A 5D2NA 2YWZA 4Y89A 1HF6A 4PMNA 2EC8A 4N9OB 5CKGA 3D52A 3GBLA 5ACMA 4JG1H 4ERSL 1S9VB 1H3WM 1MNUL 2XQYK 5C6PB 4RFNC 1NM9A 2B0SH 4R7DA 2V3GA 4CADB 4GW1A 3MCLH 2DJSA 4HWZB 4FZ8L 3HG2A 5ABFA 3LKOB 3L5JA 5EC1B 1WCGA 4ZS6D 3DVNA 3B9AA 1CFQB 3RFZC 1RJLB 3IB4A 3FONB 4CCDA 3HZVA 3KNBA 3MOBL 1OINA 4OCWL 1CLOH 2OXHA 3I75A 4TRPH 4CGTA 3HMXA 4OLVL 4XH2B 5DJAB 1C16A 2H9GA 5JIWA 4MNHA 4HGMA 1B4RA 2NPLX 4Z7WF 5JTWA 1AO7D 2X8RA 1TDQA 4HJ0C 3VJ6B 3H3KA 4OZIA 3BVVA 1TA3A 2X1OA 3P9LA 2P5WD 1HCVA 3GDBA 5B38B 4D3CH 3PE9A 5FUOL 4FFWD 4XMPL 3CPLB 2ITCB 3KPPA 1UWGL 2VDOL 4LLQA 2FATL 5JNYB 1IQWH 1NWTA 3V6ZA 3MRCB 1SMOA 3JTSB 2V3FA 5HGHA 4HBCH 4PJ9D 2G5BA 4O4YH 4YQXL 1E4LA 4MLIA 3BRFA 1FQ9C 1DL7H 4OZGF 4GRWH 2XHYA 4XMLL 1W0VB 4DWSB 3O2DA 4OFYA 1E15A 4PB0H 4LNRA 4PMQA 4ZXBD 5DRNB 3O3AA 4YGAB 4K3JL 2FGLA 1OHQA 4BQ5A 3QXDB 3D3AA 3W9EA 4WWKA 3GM0A 2VCBA 4UFHA 1UKOA 3NBNA 2G2RB 2NY0C 1OAXH 2NYYC 4J3XA 2DWDB 3DUHA 2FR4A 2QHLA 3R06A 2VLLA 1AE6H 2JKXA 3QWRD 4J8RB 2MPAH 2A6JA 1ZLWK 4UOZA 4D0BB 1MUJB 3F58L 3M1BB 2QV4A 3KYMB 2EC9T 2J8OA 2LAGB 4LLVA 3FCTA 1CLCA 4NN7B 4OUUB 1CD1B 4JZJA 1I9IH 4MNKA 2A73B 5LAXB 4X6DA 5BMFL 2IGTA 4N0CC 1B9ZA 1NDGB 4HUXA 3ULUH 4NQED 3BHBA 4U6TA 2B4CL 2BVPB 4WV1B 3UYOD 2LU4A 2XM2A 1JTPA 1JYXA 2YD9A 2EDBA 2WV3A 3ARRA 3SCQA 4HMDA 5FGBA 3C5JB 4GRLA 4UQCA 1Q6DA 5I1KH 3TA3B 5CZXC 1UXWA 4JPIA 4W93A 5C3TA 1F8TH 4OZHF 5FB8B 4L8SA 5I1LB 4KKLC 4P2QD 4W4OC 5E9DE 2ZCHL 3MKKA 5EOTB 4LSUH 1RP8A 4F8XA 2GJ6E 5I16A 1FH5H 2YL5A 4PFEA 3MGOB 3K1KC 1HVXA 3M8OH 3VRLE 4FQXD 4HWBL 1ZJAA 1DSFH 1INQB 3FXYA 1AR1D 5A2FA 4OZFA 1QVOA 2X44D 5CSBA 3C6SB 4G6AC 5E6ZA 4B50A 5LWYH 1HYRC 2W0LA 2B8OT 4AT6B 1RK0B 1A7NH 1ZS8B 4U5IA 4KUZH 4JZJC 2DYPB 3WDIA 4WFED 3L2LA 4UQ3B 5I74B 1IGTB 3V7AG 2HVJB 2P24B 4XNXL 4S2SA 3GTNA 3QPQD 1BQCA 2M1KA 2R4RL 3A6CL 2FDMA 1J12A 5ACZA 1QW8A 4QCFA 1E4WL 1IEAA 2Q86A 3FQNA 1UD8A 1YPZB 1FN4A 4N0FB 3VFGH 3WIFB 5TE4H 4GRWB 3MRGA 3UP1A 3D3VA 5K59E 4LSVL 4FFZL 4BQ2A 1I1YB 3SE4A 4XZBA 3LZFH 1A6UH 2VR4A 5DURD 1OB1B 1U42A 3MLPA 3QDMD 2JJSA 4P3DB 1J01A 5JIHA 4JZOA 3MREA 2F61A 2HJLA 5E99H 3AIWA 3FRUB 4NHUB 3WE6A 1U2HA 5J4MA 1F11B 4MA1C 2DWEB 1CFVL 4JRYD 3ZE1F 2IALB 3MJ7A 4HS3A 2D7TH 5B38G 3MLTA 5F72S 3HA0A 3T77B 2J8HA 3GJFH 1TUXA 3BO8A 3KPSD 5DK3A 4IBLT 4G6FB 3PWPB 4UT6H 2GAZB 2RQ8A 1WDSA 1QNZH 4JFQB 5DO2D 3G6DL 3CLEL 3FMGH 1TQUA 1FBIL 1ZV5A 3GBNL 3QDJA 3VFPA 4AH2B 1XZ0B 3WD2A 2ZCKL 2Q7NA 3T65B 1KTLB 5HGAA 4PBXA 3LAFA 1GRWA 5DMYA 4QRRE 1JZ3A 1EPFA 3VGHA 2EDKA 5JDJA 4LKCA 3CXDH 5EH1A 3KPMA 2XIDA 4GXVH 2EYSA 3Q3GB 2BS9A 1CDGA 3O2WH 2MCPL 3HUJE 3R1GL 4N0UE 5A8OA 3PGDB 3I6LE 2GHWB 4PGDA 2B4CC 3FZUC 3BEVB 3HC3L 1T1YB 2VZVA 4X6CB 2APFA 2VLJD 2VAJA 1QI2A 4H8HA 2E6PA 3AS2A 4APQA 2NSXA 4DVRH 1KIQA 2XPGA 1W1VA 2B1HH 4PRAB 5L8LB 2PWDA 3F7YB 3LQZA 1ZHBA 2YBTA 3PHQA 5IW6A 2J8GA 3BP4B 5IVXF 3FN0H 1TG7A 1M05A 1H09A 4JGJA 1S9YA 4LLUB 1SY6L 4KKCC 5K9OA 3A4XA 4JO3H 4O2FB 5GSVA 3SGJA 3DSFH 4M43L 3ZTNL 5BROA 3MV9E 5HXMA 2E9WA 4IOIA 4U4BA 5E2UH 1UM4L 3OKMA 2WHJA 4H25A 3S4SB 2NXYC 5ENWB 4HUNB 1WVZA 4PD4K 5I8CB 3L3JB 3HG1A 5FM8A 1HEZA 4JG0H 3ALWA 3C2AL 5C0CA 3IFLL 3EYOB 2EXYC 3O3EA 4LSSH 1K6QL 2Z35A 2AP2A 2N56A 2FEEI 1QRNB 2VDPH 3WSQL 3CH8A 4J1UA 5I3DA 1H3GA 1I9RH 1NAKH 4MJ6A 3SPVA 1FC1A 4G8GA 4UTBL 3VSTA 1FHDA 1H3PH 3HAEH 3VXMA 5T33L 3BD4A 2R2CA 1WEJL 1FORH 4QRPD 3SKNB 4G8FA 3N9GH 3ULVD 1U30A 43C9B 1CICB 3O6FA 3GJFB 1LQSR 1TFHA 2KH2B 3QEUB 5T1KD 4RMQA 3MRNB 4NN5B 4ONFL 5F70A 5E4IA 1TVPA 4PD4J 4F7TA 1C92A 3ARDB 1FAIL 4R9HA 1IM9D 5FEBA 3L4XA 5MENE 1VGEL 5ALBH 2W65B 2C1OB 3U2SB 3M45A 4XWGH 3QJHB 4KY1L 4RZCB 4ZPVA 5F9WB 4D9QD 1PKQA 3L4VA 3SGJC 2EAEA 4UV4L 5I24A 2EPLX 3U36A 4Z95H 3DGGB 3BIAX 1B0RA 2J7BA 1FLTX 2R2HA 4N0RA 1PBYA 4XRCA 4LCUB 3GIZL 4LHJB 4LPXA 2X4PA 2VZOA 1VFMA 5ANMA 2HH0L 4R97C 3W11D 1LO0L 1MCOH 2NY1C 5C09B 5C07D 2VLKD 1JUFA 2IAMA 3MACH 5GQBA 4XNUH 3OXRB 3QIUB 1AIFA 1GJIA 1XF5A 4RFOL 2EICA 1TCRA 5I75C 4F57L 4A6YA 4JLRA 1H15A 3B9KB 2G3IA 4Y8DC 5ABEA 2X1PA 4NNPL 3U9UA 5IFAH 3VD5A 4N1CA 1EX0A 5D9NA 4ETQB 1XR8B 4XX6A 1KCVL 4B5EA 2UY4A 3TNMA 2WC3A 4Y5YB 4AEFA 4NWTH 5ADPL 1P7KB 4OCXL 3V7AE 3SDDA 2ZIDA 2NY3B 3L6FB 2J7CA 3VRIB 3MV01 4P23C 5I9QB 1D5BA 2PYEB 5IB1A 1VGKB 4UIMA 2DIEA 1CXKA 1EEYA 1EZVX 2J6EH 1MCJA 4WHDA 5GIRB 3LH2L 2VSCA 1ZGLA 4LX4A 1KXQE 1T3FA 1U8LA 4AG4H 4FNSA 1JPTL 1M71B 2NNAB 5BVJB 1ZLVH 1ROWA 3FFCA 3EGSA 5DD5H 5HDBE 5TQ2L 1BAFL 4QRQB 1S9KC 1JAEA 2EKJA 2KUTA 3IDNB 2IMNA 1R24A 3EKCA 3QAZC 2IH1A 4NSKB 4JVUA 1KXVA 1UB6A 1MQKH 4Y4FD 3D25A 1U8IB 4P4KA 1YMHB 3QT2A 5D1XD 1GYAA 4AZ5A 2XVPA 4D72A 3KPNB 5KSVB 1E40A 2W67A 5CSZB 1Z9MA 5T5FL 2BCKA 5EU3A 4UOW1 3NCCB 3IKCA 3W0WA 1IKFH 1F3RB 4U1NB 4BFIA 1F4WH 3BCFA 1PX3A 5ADOH 3C6LB 3S4SG 3NFNB 3JV5A 1PJ9A 4IDJL 4DZBA 3ULSB 3ZM8A 2BC4A 1AXTL 1OAUH 4NM4H 5EO1B 4RMRA 1AJ7L 4Z0XA 2J5LB 4WFFE 4XWOD 3IF1B 1H1NA 4U1LA 4JO4H 2VC2H 1AH1A 4D0CA 2FL5A 2F54B 2BY0A 1ORQB 1AGEB 5ERWA 2WCAA 4HXBL 4YHYB 2K7PA 2P7TA 5A43C 3BZ4A 4NZUL 3CTTA 1J8HD 1QFUH 1BD2D 4MAYA 4LSRH 4URTB 4D9LH 4U6XB 3DJ9A 4Y1AB 3PQYD 4LF3A 1KGWA 5TF0A 1N5YH 2UY7A 3BKMH 2V5TA 1E4XH 2VLME 4TNVK 2OYPA 1KXVC 1CLXA 1QYGH 3HR6A 4P4KC 3LPPA 4PLNC 2V2TB 4X99B 3WFHB 4DAGH 5E56A 2EE6A 2FX7H 3BWUC 2W4XA 3GSXB 5CPSA 4MJ5A 1KLUB 2ITDA 2UYLA 1I1FB 3OQ3B 4NYLA 1JPGA 3ZTJH 5SV4A 2RAMA 4NDMB 3PP4H 4LL9A 2R23A 3MPCA 2E0PA 4I5BB 3GMMA 1NMAL 5FYLL 4ENED 2WMIA 2CH8A 5EFIB 4ZO8A 5FDYA 1JV5A 4P2RD 3DBXA 2PR4L 5GGUB 4J27A 3O6LH 1RZFH 3OX8B 4FLRA 1IT0A 1OTUD 1QBLH 1JFXA 2PUQT 1SYVB 5DZNA 2X41A 3LRMA 5F1SA 4X7EC 4PLKC 2OR9L 4MHHG 2NY7H 1L0PA 1FYTB 4IRSD 1WBYB 3QI9D 3ROLA 3IDIA 4S1RH 4GPNA 1KGCE 3HB3C 3EZJB 5TGBB 3M6DA 3QQ9C 1C7SA 1T0MB 3BEWA 5DS8B 1OAZL 3TYFA 3PDOB 3UJTL 3KVQA 5MEPA 3VXRD 5C0IA 5ETUA 1E6XM 3ARZA 4G43B 3MO4A 2G75B 1BFVH 1J0YA 3F7VB 4MX7B 1E0XA 3O41A 3PTQA 2A6IB 3BKCL 4F37F 1LQ0A 4G8EB 1EJ6A 3ZIZA 1H41A 2VR5A 4WTXA 1U8JA 1H11A 1E5JA 4QHLB 2ALWA 3A23A 4N5EC 1ZA3A 3QRFM 2IXUA 3BESR 1MH5A 1MHEA 4M9PA 1YPZE 2O5XH 5EOCJ 4AD1A 1UM5H 3I85A 4ELME 1UKTA 3RWJA 1QHPA 2IQ9L 3QDGD 1W2PA 3MZTA 4KDVA 4WLCA 4Z7NE 3CK0H 2BVDA 3UEZA 4NQDD 4RCAA 5I1EL 3P0YL 4NHCH 1MJ8H 1C5BH 3PGFH 1WB0A 1UYWH 5E8NB 3H0TA 5EORH 3A24A 2EDFA 4D0DB 3GSOA 1Q9WB 5F9JB 2OTPA 2X4QA 1M03A 1CXEA 2OX5A 4Y4HD 5FGCB 5JO5A 4OIFA 2CDFB 1AC6A 1NC2D 4WJ5B 3QCTL 5F1IB 2FO4B 4PRHA 1ZLWH 4X0KB 2R69L 3PIQB 1IAIL 3L5XH 1Q9OB 2Z31A 3TNNB 3HPJA 3CFEA 3WD5L 5IHBA 5GJTL 1A9BB 4PRPB 1K9FA 3K2UL 4XP1L 5HI3C 2C3GA 1CTNA 4LCCB 3SO3C 1KWKA 4GQ9L 5BRZA 1XCTB 5FOJA 3LB6C 1S9VA 2YC1A 5DJ2B 1ZGLM 1JGUL 4JVPA 3REWB 2FJHA 1KEMH 1B3ZA 1FLRL 4P2QE 4CADA 3BSZL 1Y7VA 4NKOB 1YN7A 1KUMA 2BSSB 1UA7A 1AQKH 3QQ4A 4U6YA 4DO5A 5IESH 4W84A 1G7PA 3TIEA 3VXUD 1E3ZA 2ED8A 4NGHL 2EADA 4MJ2A 3AB0B 1OAQH 4GXPA 2P42B 4YHZH 4IPLA 4X6CE 5D70L 4Z0BH 5D5MB 1MRCH 4FQ2L 2OI9B 4D8PA 1AP2A 3DMMC 1P53A 1S7WA 1WIUA 1ITCA 4M1GL 1LEGB 1KT2A 3ECQA 1A3RH 4ODTL 5ICYA 3NMEA 1VADA 3H9SB 5FYJU 1WBZA 2XM1A 1F58H 3AIRA 1P2CB 2Z31C 1CFTB 4PP1C 3CPLA 4YXLH 3FOMA 4LNVA 5H37H 5IW1B 3U0PB 1FJ1B 3BH9B 5I1GH 5DQ9B 3FNDA 5HYEA 4NJ9H 3UTZA 4UFJA 5T1LD 1VA9A 3NPSB 5HVWA 1TZHA 3MRMB 1MCLA 4DWSA 4M03A 2VDML 3T0ED 4MXVF 4NZRH 1NCWH 2CNCA 4X6BB 2D7MA 1OGAA 1JFQL 3DURB 4TTGA 4ODXB 3WNKA 2UZIH 4KTYA 2WWMC 3ORJA 1NC2B 4CMMB 1AGBA 1MW1A 1QRNE 5DK2B 3SJVD 1QNSA 2CERA 1Y6MR 2FJFB 1CFNB 2WUBH 4XHQA 2MQCA 3IU3B 3W6MA 2V9TA 1HYSD 2XFFA 4D0BA 3EJRA 1MUJA 1TJGH 4YDLB 4NQCA 2YR3A 3U7BA 2IPKB 1HINH 4GMTL 5KSUB 1ZVSB 4OUUA 5KZCD 4OT1H 5SWSA 2VDRH 5KVDH 3BZFB 2LV4A 1KB5H 4OQTH 1GONA 3VCLB 2VLRD 5J1AA 1CDIA 1RP9A 3U6RB 3HE7A 3DO7A 3PWJA 4UINH 3U48A 2OSXA 2F74A 4BFEA 1A1NA 2ZUQC 1FC2D 2YMXH 5DEGA 3QNXA 3HZYB 4YUEL 5E1AA 3BH4A 1O7AA 4P8WA 4P57B 1UB5A 5A3HA 3KYKL 2EKSA 1FGNL 3AS1A 3TA3A 3GGWB 1ZEAL 4NBYB 1IFHH 2XA3A 5HJ3B 3ZMRA 3PDDA 3D4YA 4WSJA 1R3IH 4HKBB 2EDOA 15C8H 2HG5B 2LQRA 5I79A 2ZX7A 3UG5A 4NN6B 1GCFA 2VLJE 1IC5L 3L95B 4JO1H 1YC7A 4NKQB 5D1QD 4L4TB 5C09E 2V7NB 5A3ID 1GGIH 3WHXA 1CVSC 3SE8L 3BN9C 1J0ZA 3GSNH 4GG6B 3VGBA 4E0RB 4FF5A 3S3JA 4PEEA 1INDL 3CZFA 4XXCC 2DQHL 5DZLA 5KSBA 1ZS8A 1SBBA 2DQTH 2Q76B 2YZ8A 4XI5C 2J78A 1I7TB 3BRDA 2P24A 4C54A 4RGMB 4F7CB 5JXAH 3D5HA 1CL7H 3B9DA 2VABB 3VWJC 3DX7A 3HE7C 3LHPL 3V4VL 5F96L 4JRXB 3DYMA 2DQUL 1WCQA 5HHQA 5GRJL 3NIFE 2QHRH 2AKRB 4HK0B 4N0FA 2XQYG 2ZNXA 2XGIA 4FQ1L 4L4VB 2PYEE 4JM2F 1UQYA 1DQMH 1WAAF 1WLHA 3FJTA 1JD9A 3UTQA 3STZB 1MPAL 2H1PH 1OB1A 3QQ3B 1HX0A 4JFFD 1LK3H 3O4LA 1ONQB 3SDYL 3O4OC 2XNAB 3WDHA 1U8OB 4KPHH 4QRPE 4QRTA 1OP5K 3ULVE 3K1DA 5HVHB 2M2DA 4QF1A 3ZJ7A 1XIWD 3LEVH 4RIRB 2IALA 1JNHB 5HVFB 2DQGL 2VE6A 1Y0LB 4P0DA 5M94B 3D85A 4KAQH 3UTTB 1KB5B 4AL8H 1V7NH 2A3CA 5EN2B 4PRDB 1A21A 2VTFA 4MD5A 4XHJC 1YEGH 3SDCB 2NY5L 1A8JH 2UWEF 1A6VL 3JWOL 3S97C 4PV9A 1HNYA 3CSBA 3T65A 5C70A 5CZVL 4GOSA 3RPKA 1Q8MA 1FP5A 1ZKAA 1NL0L 3ARVA 2VL5B 4YC2B 1JHTB 2MJWA 3D0LB 4F80A 1OF2B 12E8L 3Q3GA 4PB9H 3WL9A 1R3LA 2YXMA 2VIRA 4R2GD 3HR5A 5C07E 2ATKB 1R5WB 1YJDL 3RY6C 2WBWB 3NACH 3AREC 5AYBA 4XXDA 2D03L 4MDIA 4TX8A 2FX9L 3I3BA 1GAFH 2I25N 1W9PA 4JFPB 1QBBA 3T0DA 4Y1AE 5A16B 1DQLH 1RIUL 4PJ8B 3GXIA 3GSNB 3UCQA 2VXUL 4WEBL 5FDWB 5KVEH 1GHRA 3GH5A 5DZOA 5IBLD 5B22A 1OVZA 1W91A 3BGAA 1R0AL 1FL5B 1FV1B 3I6GA 4E5XB 2DOCA 5FF6A 3VW3H 3BP4A 1I3GL 2O92A 4NZFA 4AY1A 3IKKA 2J79A 5DT1H 3GXTA 1DVFD 4Z5RA 3FB8B 3CDFA 5FYKL 3THCA 1TPXB 3B3IA 1EEZB 2ZKHL 4O2FA 4DEPB 4POZC 4B41A 4LARH 3DSNA 3D2UB 1BREA 2X42A 3LKRA 5IG7B 4FMVA 4X0VA 1T2QL 2YD7A 3UG4A 1BZ9A 1EJOL 1KELH 5I8CA 5TQ0L 4YLQT 2ZP0T 4JQIH 3EYOA 1BFOB 2WW5A 3GSRB 2GK0B 2DMCA 4F2MB 1BQLH 4OF8A 2R9HC 2BVQB 1FYTE 4ATLA 2W0KA 4TVDA 1CN4A 2GT9A 2XN9D 3IAQA 2CESA 2JEPA 3KPOA 1H0DB 1EHAA 1UG9A 5T3ZD 3RWDB 5TE6L 3I50H 4JB9H 3GJFA 5J06A 4TUFA 3GSWA 4GBXC 5EO0B 4FNRA 3WUZA 3MRNA 5H37G 3L4WA 4HQQH 1XYZA 1U2CA 2EECA 2OW6A 3NVQA 4Q2ZA 4YBQD 5I0DA 4YDIH 1FYHB 3HHRB 3D39D 4ODVL 2C1OA 5LQBH 1X5AA 1IGCH 4ZOCA 5MERA 3MGTA 5FHBL 4FABL 1S7SB 1H0GA 4IISA 1MLCB 1GVYA 4IMLB 4JO2H 4YWGL 1R3JB 3GNML 5F9OH 2R4SL 3E8UH 1GPOH 3VFVB 3PGCA 4TNWF 3QUZA 2X10A 4BJLA 2A9NL 2PTTB 5TFSL 1XGRA 3V4UH 4L8DA 1EFXA 3LSOA 4WY7L 1JZ5A 2QR0B 2NY5C 2Q8BL 2DB8A 1RUKL 1DE4A 3OXRA 5FM5O 2XGBA 1DFBH 3UPCA 2V9QA 4PMZA 2PNDA 2F2HA 4GKOA 4X9IA 5FGCE 4ZTOH 3PWLA 4PGBA 4M48L 2HYMA 1LNUB 4K3EH 5TDPB 4PMDA 2RIKA 2W0FA 1NWSA 2ICEB 1CGWA 3UG3A 5CGTA 2PKDA 1YJDC 2GJZA 1FH7A 3KLAB 4QHMB 1XR8A 2E27L 3L3HB 3BAEL 3SKMB 1C8QA 1UASA 7FABL 3B2UC 4PRPE 2EH8H 5B8CA 4NFCA 4ZUSB 1EVUA 4LCWD 5KW9H 3QNZA 5JW4Q 1CIUA 4M6NH 3WEXB 4TVPH 3CD4A 4MA8H 5D6DC 4Z2JA 5IJKA 2WZHA 5D7LB 2DLFL 1DQDL 4C58B 2NNAA 2FBJL 3IGAB 4HLZG 4MS8C 1HXYA 2JTDA 1V7ML 4QRQA 3INUL 1D5XB 2DEPA 3SKJH 1ECEA 1TVBB 3MBED 3QO0B 4XZUB 3MJ9H 4IHOB 5IV2B 2D31A 3HAEA 5JOPD 4M4RA 2PWHA 3S7GA 1G84A 4DGVL 4TSBH 2GK1B 3RVTC 3QUKA 5D5ME 2W59A 3Q0HA 3WUGA 1NJ9B 1SJHB 5ESAB 3VXTB 1OWRM 4J23A 3KPNA 4LYPA 2FEDD 4U0RB 1RHHB 3LMJH 5CSZA 2D4DA 3U7YL 1PX4A 2AAAA 3RWFA 1FZKB 4NO2B 1A7OL 5KSAA 2WKLA 4H26B 1UJ3C 1BPVA 3DRTB 5EIIA 2AVGA 2WSKA 5ISZD 3QDGE 3NFNA 1BJMA 1F6AA 1CWYA 3PTMA 3GJEA 5EO1A 2AK4D 5IJKC 4JDTL 1AFVL 5FKAB 4ODBD 1BIIA 2ICWB 3O6MH 3LKSA 1RIHH 3C8KB 2F54A 3Q5TA 5JORA 4KI5D 4NRXA 4CDGC 1NP0A 2CDGB 3MV8B 4GUPB 1YUHB 4WCYH 4XCCL 3IU4L 4GW4A 4PN2A 1JPFA 3HU7A 4NP4H 1DBKH 4HDIA 4XCEB 1KTKE 1Z9LA 5IMLA 3RWCB 3VFNB 5GPRA 4U6HB 3RTQD 1D6EA 2Z9TA 4MSWA 2PW1B 4XVTH 2VISB 4L9DA 1N2RB 3AY4A 2HJFB 4HKZA 4Z7WA 5EU6D 3ECBA 4V2XA 2WUCH 3T4AB 2M8XA 3STBA 3THML 2V7HA 1XSIA 3SCUA 3TVMA 3ULVF 3SUUA 1KLUA 2P8MA 5EUKA 5D1ZB 2Y1VA 1WUNT 5BZDB 4MXQD 2GW5A 3GKWL 4NDMA 5KSAC 5ICZB 4FZEL 1ISYA 1KIPA 5D7IF 1JGEB 4I5BA 3CVIH 1BFNA 4TX6A 2Z8SA 2Q6WB 2I5YH 4KKLD 5JW3H 3WMBA 1A1MA 3KE0A 3PBGA 5EFFA 2WPGA 4KQ3H 1MI5D 4HIJB 1AHWA 4BF7A 5JHDD 4EK7A 1HXJA 3OX8A 1LLOA 4PR5B 3WNPA 1IAII 4I3RL 1Q4NX 3VXUE 5DI8A 4OZGA 4LCYA 3FAXA 4OLZH 3ELAT 4M7KH 5CIPH 1LE9B 3GSQB 2A3BA 2QV2A 3JSSA 4BK4A 1Q72L 5DRZB 3PZMA 3X14A 3VFSB 5JXEA 4C56D 4AD4A 4JHAH 2X40A 2CPUA 1DDHB 2D2OA 1DLFL 4DO4A 4WU5B 1T0MA 3QIWD 4J2XA 4Q9CA 4WFGD 1XYFA 1INEL 4RGOH 5M17A 1JVKA 2SEBB 3TV3H 1FL3A 4G43A 1MF2H 4G42A 4GG6E 4FTVB 5I2IB 4MX7A 3BE1H 3RL2A 4IS6A 1KG0B 2ZPKH 3TFKD 4AIXA 4R0LA 3AY4C 3TH3T 5KN5B 1QBMH 4NKMA 3G5XA 4CNIA 2GITA 3QDAA 3S37H 1NCDL 1CI5A 3CFJA 3HRPA 1UZ4A 1A47A 1E73M 1NFDF 5I6XB 5IQ9B 1P5VA 1NBQA 3EIFA 5BO1H 4JRXE 2J7GA 3T0EE 1UT9A 1N7MH 3ALPA 4V1DD 1CR9L 4L4VE 4J3VA 1WC7B 5IHUH 3EYVB 4K7PY 1KJMB 1TVHA 1BLNB 2DF3A 1TNNA 4FQJL 4PRIA 3WFCH 2QQLH 4DM2A 1GZQB 4OZHA 4BA0A 1DUYB 4BFBD 5BXRA 2AAVA 4D0DA 3MA7A 4HIIB 2AEWA 1K8DB 1H3UA 4OAWA 3ARGB 3DHUA 5F9JA 5JXEC 3C60B 3LCYA 1A3LH 4FXGB 2GSJA 4K8RC 5F1IA 5K9QI 1R5IB 4NUJB 1G1CA 4ZDHA 5TDNA 2P5EB 1YY9D 4JFHE 5HHVL 3D0VB 1R7AA 2BFVH 3WJLC 3NDYA 1W3HA 5IFJA 3IJ9A 3TNNA 3M07A 3UTTE 1PG7X 1BEYH 1G7LB 5I2UA 1NC4D 1MFDH 3CZLA 2E7CA 1AMYA 2NT0A 1A9BA 4Z7VB 3O45B 2VOTA 3DX8B 4MAVA 1NMBL 3A67L 1UKSA 5C0BB 2CRIA 2H3NB 1E27B 4UAOC 5DJ2A 3W81A 4HWEL 1RVFH 2EYTA 3V52L 1V6YA 5H2BB 1QSFD 3P4NA 5CPQA 2XXMB 1TITA 1CNVA 4UU9B 5LBSH 1GOMA 3W38A 3OB8A 4FMKA 5DD1L 5CIPB 2O5YL 3MRHA 4RE3A 3CFDA 1VFBB 3BGMB 1RSFA 4X7CC 1FDLL 3N17A 3SBWC 1NGXB 2DL2A 3SKUD 1BGAA 1GGCH 1QLRB 5GJSL 4QCEA 1FZJA 4K94L 4XPGL 1LO5B 2B7DT 3RKDD 2H2SC 1BBDL 5IKCB 1LEGA 2GJPA 3WHE1 5DGQA 1CFSB 4YO0A 1I9JL 2X05A 3H9SA 2IH3A 4KKCD 5LCVH 5CWSB 4CVXB 5JIPA 4ZFZA 3G04A 4YHLL 1PVHA 5D8WA 5AYQA 4GXUM 2Z8RA 5IW1A 3BH9A 4JY4B 1FGVL 5DFAA 4P2OA 3BW9B 4TSCH 4EDXB 3QNYA 4FFYH 4NKDA 4MAZA 3QWQB 3G08B 4FLOA 4HPYH 3JV4B 5FGSA 4I2XB 1DBAL 1YMMD 2E9BA 4IRJC 1W3JA 2ZX5A 1G0DA 4LU5L 1CGSH 3VFTB 3DURA 5IMOA 1BWWA 2MQ0A 1JMXA 2APBA 2Z4QB 5ALCL 3G5VA 1ZBKA 1BM3L 5DD0H 5IOPB 1ZT1B 2XQBL 5DK2A 2N4IA 4WEMB 2OJEB 2LTQB 1M7XA 1AQMA 3IU3A 1OP5H 1TQSA 3ZYZA 4JHWL 4EEEA 1I85C 2CIKB 3MRDA 1YY8B 1WZ1H 4AZIA 1A4KB 1ZT7A 1QPKA 4JFSA 5KSUA 1KENH 1HIML 1MAMH 1GJUA 1JNLL 4F9PA 1YC8A 4J4PA 1D5MB 3VCLA 4ZAKD 2DBJA 3DYPA 3DECA 5KANG 5EB8A 4WI8A 1NGYB 2CSPA 2A83B 2NW2B 3UJJL 5IVXA 4MTVA 3HZYA 1T04A 1XH3B 4ISVA 4P9ML 2IQAB 1JGLH 1OQXA 4UQDA 5A6AA 4K23L 4OLXH 3WKML 3MRBA 1FNGB 5TE7L 3T2OA 4EUPA 1C5CL 4AIZB 5IHZA 3LXCA 3QCVL 2VXQL 5BQ7B 5E2VL 4KC3B 5HHXL 3SIMA 4ETYA 2X4OB 1L9MA 1QQDA 4POUB 3JWDH 4L4TA 2PCPB 2XKSA 2C8NA 4RSVA 5CPTA 2V7NA 3VG0H 4HT1L 1TJHH 5DC9B 2OTUA 1JN6B 3B43A 3MXVL 1RJZB 4QHKJ 4JFYB 4X80L 1EK3A 4K2UH 2F18A 1I7TA 2Q8AL 4P23D 1UZ6F 4F9PC 4XP5L 1MRFL 3MRPA 4X7FC 4NRZA 2VABA 1A6ZA 1YMMB 3ZHLA 3VIMA 4GKZB 2AEQL 1NGZB 3KWWA 2AKRA 3CH1A 2R2EB 5DMKA 4C4KT 4K94C 5BZWB 4U1GC 4Y4KC 1FIGH 1LWJA 4JCLA 1ZWIB 2EEBA 5ITFA 3IANA 4LEOB 5D7LE 3KPLB 4QXWA 3STZA 2JIXB 4ZSOB 3KPRA 5FUZH 3UBXB 1IAOB 2FRGP 3Q1SH 2Q7YB 1J10A 3IFOA 3QQ3A 2CKSA 1C1EH 1W0WA 3VX0A 1BZQK 1F00I 4Y5XB 2XN9E 3T2PA 3BPCA 2ADGB 2FIKB 3QEHB 5CP7B 1CGTA 5MP6H 1ED3B 2IBGA 1MCFA 4RIRA 3DI3B 1JNHA 1QZ1A 1ODZA 2PO6C 2JB6A 1Y0LA 3HZKB 3ALFA 2XZCH 4EVNA 5BV7H 2BNRA 1YEJL 2FX8L 4RMSA 1HXMA 4PY7B 3D39E 4R8WH 2VITB 1HILB 4MVBC 5JHLL 3MLVH 4RX4A 4O9HH 3ZQ9A 4XZWA 1ZT4B 1DWHM 1ZTXH 4WHYH 5ITBL 1QNQA 2K3TA 1FZOB 3W37A 1IL1B 4Z2KA 1DBMH 2GY5A 2VT0A 2F53D 1IGJB 4EI5C 1G0CA 5I1CL 1I1WA 2OL3H 1PG7H 4S1SH 4AYGA 5IBTL 5KEZA 3O6KL 4CU6A 2GTWA 4DUVA 1X6LA 3ZKMC 3AMKA 4MDJB 3VI3E 1X1NA 1R5WA 1D9KC 1HJVA 2NR6C 3BQUB 4KVCH 5KAQG 1EGJA 5JPNB 1TQBB 5A6KA 3MV8E 4WI7A 3X11A 3SCMB 2NX5D 1XT5A 2CGRH 4NQSB 3X3GL 1E1EA 1DN2A 3A6BL 3EW3B 4G7YL 2H6PA 3UYPA 3GSNA 3ETBF 4Q7DA 2QLYA 5I76B 1N8ZB 1S7QA 1UQSB 3IDXH 4OD3L 4PJGB 3SKOA 4NQUA 2A1WL 4G6JH 1F3DJ 1IV8A 1T1ZB 5DUMH 3TWCL 1VFUA 1A5FH 3S8WA 3STLA 1LL4A 4OCYL 4P5TD 4PRNB 4LKXB 3MRKB 4M81A 5I18H 3H9HB 4R4NC 1U41A 4YNYB 2ESVB 4QXUL 4UFMA 5C08A 5E08L 3RUGB 2GFTA 4PJBB 4P8XA 3I84A 1SHMA 3OGSA 1NGPL 3QIBD 4NJAL 2PTUA 3NIGF 3BAYA 4PLKD 2AJXL 4TVPE 4RMWA 3VI4F 4LSPH 3CC5B 2XVKA 3BD3A 3BJ91 3G9VA 3GUTB 1U8MB 4KRMB 4F7MA 3AIUA 2YA2A 3HB3D 1T7WA 1XCQB 3SDAB 2WWDA 3O2VL 1U6AL 3U4BH 1BFOA 1RH9A 1NCNA 3GSRA 3HI1A 2GK0A 4JQXC 1VFAB 2Q3ZA 4XB8A 5IFHH 4GMSH 3HCVA 3P30H 3G5YA 3MLRL 4BK5A 4PGJA 4X9BA 4YAQB 2BVQA 4BQBA 4RGNC 1NANH 3BYTA 1W72L 4M6AA 3WFBH 1ACYL 4FN0A 2E7MA 2EXWC 3PWVA 2AQ2A 5FK9A 5BS0A 5E2WL 2YUZA 1Z2KA 4WUKH 1CU4L 1MFAH 1VSCA 4LBEB 3WXVL 3UDWA 5CAYB 4N5ED 5JUEL 4YEEA 4QTHA 3NCOA 3BIKB 1T22A 2XFXB 3OKLA 5FO9B 1U3ZA 2VZ3A 4X4MA 3TYGL 1MCRA 1XGQA 2C5DC 3AS3A 2WBJB 1T21A 3IFNH 1UD4A 3QO1B 5CUSL 2VUOA 5JMOC 4AYFA 4EKJA 1MWAH 2X89D 3CSYB 3WO4B 1GGBL 2IBBA 3UBXG 5JQ6L 1OTSC 4KI5E 1NBYA 3GBML 1R3JA 2DQDH 4XCFL 1VJZA 4F58H 4S3JA 1ZXQA 3UCRA 3I3EA 1FNSL 4WI3A 2GJRA 4Z2LA 4Z9KB 3EYQD 1MXDA 4GZJA 3GBDA 4JY6A 2PXYA 3QCUH 1IGIL 5J13C 1MEXH 4K9EH 1JPSH 5L2KD 3QUXC 1XSJA 3AFBA 3EO9L 5EU6E 1LNUA 3HMWH 5HI3D 2P5EE 5DJZB 3HS0B 5HHOB 4HZLB 1KOAA 1LO3H 1MSPA 4OCRH 1RZKC 2XG5A 5TDOB 4QHMA 3LB6D 4NO5B 3MRIA 5AC5A 1DN0A 3SKMA 1TZGL 4B7LA 1MI5E 4OF6A 2CXKA 4Z7VE 1W72A 5JHDE 4YXHL 3O8XA 4G9FA 1NAMH 2VDNL 1PW3A 4OCNC 3QSKB 4WW2B 2PWFA 4DGIH 5EUOF 1T5XB 5GS0D 1F45A 3FO0H 1VHPA 3OKKA 1A6AB 2VL4A 2I60L 3RMEA 4F7PA 3AYRA 2A77L 4LRNL 1B2YA 3I02B 4TVCA 4PJ7B 3F4VA 5FYLD 2CETA 5KVMC 2B2XL 4C56E 4W8BA 1FFPB 5CJ8A 2AJUL 3VXQA 4QXTB 1ETZA 1TVBA 3QO0A 1KN4H 5IVNA 2AMGA 4HKJB 4IHOA 5IV2A 2WP3T 3DX4A 4Y16C 3TZVD 1FRGH 4LVOB 5HHMD 1FE8L 3RZWA 5D2LB 4NZTH 2GK1A 2ZXBA 3DUUB 4Q6IB 5E6IA 4LPTA 1J1XL 4X98B 2X5PA 5CEYB 2HLFC 5EU4A 1JF6A 4P3WA 3ZJ6A 4XVSH 5HYFA 1AXSB 2AJVL 2HT4C 2AW2A 35C8H 1RK1B 5EZJA 3GSUA 1JYNA 5CBEB 4HXAL 1JK8A 3K80A 2ARWA 2BV9A 5JQHC 4NFBA 4UT7H 3MBXL 4XTRC 1P5UA 1NKOA 3QZWB 4UIKH 4Z76A 1N64L 5CJXA 1E0OB 1IM3B 2GJXA 5D96B 1KC5H 3QFJD 4XP4L 3O8XC 5EOCL 1LP9F 2CDEB 2YPLB 1MWAB 3GMNA 1BWMA 5DRWB 3S5LB 1UH2A 2XZQH 4I2XE 1KQZA 2WWMD 3TN0A 2MNUA 1X7QB 4JGMA 3U30C 3GHBH 5GGTH 5D7JA 4UB0L 2E7HA 3OG2A 1GQLA 2DQIH 2EE2A 1GH7A 4OIIH 2CDGA 3DV6B 1EDQA 2Z92B 3I2CH 3EOAA 5E8OB 3LIZL 2BNQD 4L3ED 4BQCA 1AKJA 3AJ7A 4ZNEA 4AMXA 2OJZH 3GI9H 5F7DA 3ZYIA 5JW4R 1J0IA 4KMTH 4F7EA 5F3HB 5GS2D 1QSEB 4UFLA 2HJFA 5GZND 3SCVA 1QFWH 4XPFL 3ES6B 4WHYG 1K9TA 4O02L 5AEAA 5IWLA 3BAIA 3ARXA 4P46B 5DD3H 1KN2L 1PD6A 4FQCH 5ICZA 5GS1C 5BW7C 2XWEA 3VOCA 1G6RH 1CD0A 1JGEA 2ADIA 5JBFA 3NIDF 1QSFE 2AQ1A 1HJQA 1LE5A 3VWKA 1VERA 5J12B 5ABDE 2O9OA 4HA4A 3TO4B 2Q20A 4I48B 4XPTL 5CINL 5E0QA 4A2MA 3GK8L 3OGCA 2Y24A 3FO1B 3GMLA 1KCRH 2HVKB 3KYNA 5JW4N 1NGWA 1LE9A 4HC1A 3VG9B 4P59H 1XGUA 3NPZB 3WIHL 1HZHH 4EN3B 3MUY1 5C0AA 4WO4B 4LVHC 4URIA 1HHHB 3MJ9A 2R8SL 5E8PA 1TQWA 3W6LA 4LDOB 4LASH 1DDHA 3SUSA 4S11A 3VX1A 2IMMA 3NGBB 1NLDL 2X4UB 2R56L 2X09A 3KXFA 2XN2A 1S5IL 4ODHL 3PABA 4HMCA 1HCFX 2VMFA 4QOKB 2CUHA 2RFXB 3FO2B 4FTVA 5I2IA 4PMXA 2OR8A 2IFFL 4N0YL 3T2NL 3VWJD 3MRRA 4XBEL 4OSUL 3UJIL 1Y18B 3VE0B 5BOZG 5KN5A 4PJHF 3EFFB 3RU8H 1MJ7H 3TJHC 4O5LL 5E94A 2ADFH 1SM3L 1YMME 1J5OL 3B2VH 4JKMA 1B30A 4ZOAA 4E8CA 1JHLH 2V5MA 3ZKSD 6TAAA 3N1AA 3CU7A 3OF6D 4M93C 2LVCA 3HPLB 4HEPG 3O0RH 4JFEA 3EYVA 3UXFA 1K9DA 4KROC 1KJMA 2X2YA 1BQHB 3SN6N 1JAKA 1BLNA 5FYKU 4KWUA 5F3BA 4CDHA 1AR2A 1WFNA 4Q22A 4DN4H 4BUHA 5HYJB 5GRWA 2GSIB 3X13A 4V2CB 4HFUH 5CSYA 4BQ9A 1CLOL 4RQQA 3B5GA 4L3CA 4YHIB 2XKNB 4KKBC 4WU7A 3V8CA 1A7RH 1UC6A 3AHVA 3BT2L 3HLAA 5CJQH 4X9YA 1WBXB 4XHJD 3TPKA 4H7VA 5KVFH 3NH7L 3QZWG 4QP0A 2V2XB 1IQDA 5A2AA 3O6AA 1KQYA 1JCKA 1T1WA 3O45A 2HA1A 3DX8A 4EQ3A 1IQWL 2JB5H 5C0BA 4JM4H 3U4EB 4DK6A 3S5LG 2P1YA 1E27A 5DQDH 3VIGA 2ZXDA 2VRAA 1F90H 3LPOA 1DCLA 1DL7L 4AZCA 4NQTA 3NSNA 5KTEH 3GSVB 4HOZA 4JM2A 4PB0L 1WAAA 1AY1L 1J87A 1KJ2H 3FB7B 1GHFL 2VXSL 3OGOE 4KK9C 1VFBA 5A94A 5C0DA 3UPRB 4MJID 1L7TH 1Q9KA 2WC7A 2ZWYA 1EBPA 3QUYC 1OAXL 4JIEA 1AGCA 1UWQA 3V5DB 3UC0H 1TZIA 5HY9B 1UH3A 3IJSB 4I3GA 4CVWA 2MPAL 2J7EA 1QNOA 3R8BB 4X7TB 4O00A 5J6GA 2D9QB 4WI2A 4PJGE 4YBLB 4LGRB 4JKWA 3VXOB 2DLTA 3T08A 3RDTB 3U7AA 3RZCD 4PS4L 4PJEF 1AQDA 4QYOA 2VH5H 4NFDA 4UR9A 2ESVE 3Q6FB 5HNNA 4PRBA 1AO7A 1C90A 2ZG1A 2ZUNA 3RUGE 4PJBE 2EC9U 2P5WA 5GZOD 3QR2A 5F71A 2UWEA 3JV4A 5FA3B 5J9PA 3VH8B 4MCYA 1LDPL 4H5SA 4EDWH 4KZEH 4R90H 3TV8A 4P5KB 1YECH 2WKGA 5IR1A 4PCSA 2QF8A 4JM2C 2A0LC 4NO0D 4M3KB 4PJ9A 3VVGA 3EJSA 4IJ3B 4XNQA 3MNZA 1UR0A 3C08H 1FH5L 2QSCL 4OTXH 4WV1C 5TF1H 4M82A 2NY2D 4PJCE 4ZMAT 3MUZ1 1A6WH 1K4DA 2V9RA 1DSFL 1A4JB 3L3GB 2DJUA 3KPTA 4ZXBA 2QQNH 2BRRH 4O2CB 5LA2A 2Q8XA 3RWEA 1BVZA 1KJVB 1JHKH 4WDIB 3RX8A 1A7NL 1P9MA 4JFDB 4BKLA 5I71C 3EO1B 4B3LA 1XHGA 3CX2A 2A83A 1YEHH 4HLJA 1WQVT 5JMRA 4WGWB 5BYWA 4MNGE 4OLUL 2X70A 1JXKA 3IXTA 3BUPA 1PDKA 2BSTA 3EOBA 4IM8A 1LWRA 4XBGB 5E6YA 1T03L 3KJ4B 4JL2A 1F3DH 1BQHG 4F15B 4P3CH 4NQEA 1H5VA 4FXLA 1FCGA 3GMRA 2DICA 3MO1A 1ERNA 1CE6B 1D2KA 3VM7A 1MJUL 3AMDA 3ZR5A 3LZFL 2NX5E 4PJ9C 4OKDA 3MR9B 5DJCA 3NTCH 4XCYB 5I74C 5DO8A 4M1CD 3RWHB 4MNQD 1MFCL 3L5HA 5I8OH 4Z2HA 3KJ6L 4YDJB 5IROC 2R0KH 5E99L 3PL6B 5INCA 1ADQL 4EZMA 5DMIH 3VMOA 1YHTA 4ZYKA 2HKHH 3ESVF 4ZXBC 5F21B 1E6OH 2Y9RT 3S36L 1UKPA 1RJZA 5HYSB 2F8OA 2E4TA 5A8QA 4M5YL 2VQ1A 3RJQB 2DQEH 4FQXA 1P9MC 4UT6L 2EXOA 1CBVL 1QNZL 1JNJA 3FMGL 4X6FA 1CXHA 1EZVY 2F19H 3BC9A 3H7BA 5C92A 2NY4B 1NGZA 4I77H 4X4YB 4QY8A 2R2EA 5FYJH 3QUMH 5BZWA 5ICXB 4KK6C 3OLGA 4OI9A 5FA4B 1BZ7B 4RISH 2F5BH 3OZ9H 4JCMA 1WTGT 2UUDK 3HNSH 1G7QB 4Y19D 5FO7B 4ZSOA 1FH8A 2HT3D 2EDQA 4YEFA 3AOFA 5J6HB 2AJSH 4UNVA 4PJ7E 2VDQH 3CUFA 4O2EB 4G9DA 4IMKA 4Y5XA 1IBGH 2ADGA 3QEHA 2X4NA 5LA1A 2IADB 1UXSB 5D2LE 1CLYH 1RAMA 4H8WC 3GFUA 3HZKA 3QDMA 4LQ1A 5IUSA 1MVUB 4PY7A 1FAKT 3CV5A 3ZLQC 4YHKH 3WFZA 4HJJL 1HILA 4N8CL 3WIIH 3ZSTA 1P4BL 5B3NA 1TE1A 1AR1C 4JRYA 3CXHJ 2ZSVA 3MXWL 2AV7A 1IL1A 8FABB 3V7MA 1IGJA 1RZGA 3VH8G 4QKXB 5IFPA 3KPSA 2WQRA 2YPLE 2WIMA 3JV6B 3T4YA 1OAYL 1H8NA 2YKKA 5C9JA 3KDMB 3Q6GH 1C8XA 4BCEA 3THDA 1TTUA 3EYFA 5DMJB 4HIEB 1CGXA 3AXIA 2E3VA 2CITA 5GRUL 4BZ1L 2X2JA 4NT6B 1NCCH 3QPQC 1K85A 3R0MA 4YR6A 4JFVA 5JPNA 4G3YH 2FGZA 3L3IB 4YFEA 1C93A 2WBGA 1GOKA 3KHOA 4HFWA 4WIWA 1I9RL 1I1AD 4ELKB 5GGVL 3ULVL 1MVYA 4HU8A 3APGA 1Q94A 1HQRB 1S3KL 3S35H 3WY2A 2CEQA 3WN5B 3V79C 1GQIA 5I0ZA 2Z1KA 5SWZD 4LHUD 4NC0B 4B7IA 3N9GL 1BECA 1T1ZA 4HGKC 3SGDH 4E42A 1JFHA 1QSEE 3C9NA 5C7XH 3HE6B 3SE9H 1ZLUH 4IRZH 1U3HD 7A3HA 4E41B 4FLQA 1MQQA 3MRJB 2QJDA 3L7FA 3WD1A 4OGZA 4ZTPL 4Y5VA 4XWGL 2FYYA 4FLSA 1JD7A 1W1PA 1UVQB 3D9AL 4PJAB 2FECI 3TBYB 1LP9B 1VFFA 5AWNH 3VD3A 4ACZB 1H3VA 2IBZX 4GSDH 1CICC 1QLFB 1XGPA 1V0MA 2OS7A 4GJTB 3ABZA 1V02E 3EFDL 2LU3A 4QRSB 2I26N 3ARSA 1MCOL 1S9XA 4ZO6A 5DR5H 1XCXA 3MACL 2BDNH 4XNUL 4NC1E 2IJ0C 3HTLX 5HGDB 2VURA 1FHLA 4KJWD 5F9WC 4H0HB 4M5ZL 5B3JE 3IJYB 5HYSG 5KS9F 1KIRB 3GMQB 1JNDA 5D9OA 2I9LB 4FXKA 1GCYA 4XCNB 1T6WA 2HN7A 1AI1H 5EOQL 3RAJL 1DEDA 2AQ3A 3QFJE 5F1NA 4YDVA 4BYHA 4NI3A 1YEDB 4Y5VC 2OL3A 2JK5A 3OBAA 1U8NA 4RRPG 1O7SA 5T1KA 5D7IA 5C6TL 2DT0A 2ICCA 1UM6L 2YEZA 4QXGL 3T8XB 2YK1H 1YNLL 4I0PB 1S46A 1N6QH 1IM9A 2FLBT 3TH2T 3TCXA 5FECB 4AG4L 1J9CT 1XFPA 3SQBA 4V28A 3WS6A 2YPVH 1XF4B 4D9RD 4L3EE 4P4RB 3TLRA 4PBGA 3L3KA 5HYJE 1H5BB 4BSWB 5I77A 1A2YA 1LO4L 1NLBH 1UGNA 3VRJB 4DGYH 2NY3C 1LK2B 2DQFB 2QADB 4U1IA 3U46A 3BP6A 4S1DD 1SZNA 1ZBCA 5JR1H 1M6OB 6FABH 4AXNA 1EQPA 1MQKL 1JNNH 2VDKL 5HHOA 2RJMA 1B2WL 3HMXH 5C07A 1MFNA 1XR9A 2VLKA 3AGVA 1QHZA 5EU5B 4U3AA 1T0PB 3QDHA 4NO5A 1QKZH 4PJCF 4CL7A 4AISA 5DJYB 3ZDZF 3VIFA 4JHZA 1CF8L 2CD0A 1FVEA 4G8IB 2G41A 1X5LA 3OHXB 1IKFL 3ULVC 3GMOA 3FT2B 5C2BH 4XVJH 1KGXA 3FN9A 3ILPB 1NFDA 1G01A 1T5XA 3MNVB 3AS0A 5EZIH 3VDCA 3A21A 3L5WB 3QHZH 4N90D 2P47B 2Y8KA 2XN0A 4HPGA 3QJFA 3MOAL 4HUWB 4X6EA 3I02A 5FM5M 1UZ8B 4AM0B 1DWFM 3T2QA 4JO4L 3V6OE 1I4FB 2XZAL 5AYUH 3E2HC 3O2DH 4XNMA 4YX2L 4ZS7H 3BVNA 2H2SD 4L8BB 5F7HA 4LQFL 1GXEA 5MEOB 4JREB 4D9LL 4EOWL 3DUUA 4Q6IA 4X98A 2IANB 3TCLB 2RHEA 4QT5B 3OKYA 1AXSA 4ERSH 1KB3A 4PJFE 1MNUH 4CN4A 3W11C 4OUOA 3MS8A 2UWFA 4AZ6A 3RGVD 2I9TB 3TTOA 1ZVYA 4DAGL 3O9WD 4FZ8H 1KXTA 2FX7L 3BWAA 5H35B 2GUYA 4Y4FA 3QEQB 1JYVA 4JKPL 2XWTA 3CUIA 1ZHLB 3MOBH 5FV2A 3ARBB 3PWUB 1P6WA 3BH8B 3FQRA 1CDUA 5D2NB 1CEOA 3O6LL 4OLVH 1JZ4A 2WMGA 3JTTA 3MFGB 1F4XL 4K68A 2X4RB 3EDFA 5BVPL 1DHKA 1QBLL 1QNRA 1OIMA 4Z7OE 1H0IA 1M1SA 2DBLL 2NY7L 5EU7E 5E4EB 2Y07L 4IUGA 5FUOH 4S1RL 1UWGH 5A69A 5M7QA 2VDOH 2FATH 4ZPTA 2NY0B 3UTSD 2YBRB 3HZVB 1S8DA 1H8SA 4HOXA 1S7VB 4B16A 4KDTA 1ESWA 1X9QA 5IB2B 1A6TA 4YZFE 4PMVA 3U7WL 1C16B 2VZTA 4XNZB 1J8HA 4MNHB 1BD2A 1BFVL 2YUWA 4OZFH 2AJZA 1EA9C 4XMLH 3UYRL 3OAZK 4AEIH 4XBPA 3PQYA 4OZIB 1TA3B 3OGVA 4JFDE 1DJSA 2LAAA 2B31A 2Z1SA 4K3JH 3RBGA 4PJEB 2VX4A 4JR9H 1NAMA 3QG7L 2YA0A 3KPPB 1HHJB 3ZKQD 4ACPA 1HNFA 4LLQB 4UDUA 5D1XC 4OD1H 3V6ZB 1IGMH 3TO4A 2BHYA 5HGHB 4PUBL 2G5BB 1ITXA 2HTLD 1D5ZA 4G6KL 2L4OA 3CK0L 3F58H 4MJIE 3RGHA 3G6MA 2DTML 3MV7B 4HG4J 3WYRA 4NHCL 4EN3A 3DIFA 1C5BL 4YHPA 4L1DA 5BMFH 4OV5A 1HHHA 3O3AB 4P2RA 4K55A 4EI6A 3W9EB 2X4UA 3D3VD 4WWKB 2B4CH 5JLZA 4XWOC 2J62A 5CD3A 3P40A 4JHOA 1TTFA 1UACL 2J88H 2FR4B 3R06B 2VLLB 4DKEL 2XWJA 4IRSA 3LN9A 1Y18A 4PGEB 2A6JB 5IHLB 1KLGA 2AJYH 1A3QA 3L5XL 2CIIA 2ED7A 1O7VA 4UI2A 4UQ2A 5F7FA 4LLVB 2V6HA 3FCTB 1H9VA 3OR6A 3QB7C 4V2BA 3SCPA 4JZJB 5D9PA 1J0KA 1JDDA 5EFDA 4X6DB 3VXSA 3RL1A 1KTDA 3VXRA 3K4DA 4HUXB 4OGYL 3ARYA 5J0BA 3BHBB 3HN3A 3ZE0F 1X4XA 4CU8A 2DS4A 4JN1H 5EB9A 5A8MA 4XP9L 4UDTA 4JPVL 4HWBH 4JZ5A 4OI8A 2OBGA 4PGCA 3RNQA 2DIAA 2A74B 4GRLB 4JZNA 1OGBA 3VMNA 4GKNA 1CQKA 3LKQA 1UXWB 4JPIB 2DT3A 5DT7A 1L7IL 1E9LA 3WH5A 5IESL 4L8SB 4ENEC 2XN1A 4XNXH 2DM3A 1G7HA 3V6FA 3ZHDA 3H6JA 5I16B 2GQHA 2R4RH 3A6CH 3EYUL 4NQDA 1XF2A 5GNZA 4Y2DA 1OTUC 1MRCL 1Q0YL 3AHXA 4MB1A 5I1IL 4YK4B 4OZFB 1A3RL 4HS8L 2CIPA 3QI9C 4M8QA 4EI5D 4W5UA 4FFZH 4NBZB 4Y4HA 3RX5A 3QHTC 1G6RA 5B3JF 5E95B 4S2SB 5D9SA 1HJWA 4H1LH 1X3DA 1GC1L 1D9KD 3VGEA 5ACZB 2NR6D 1IEAB 2Q86B 1UHVA 3C5ZD 3FQNB 4I1NB 1FN4B 1CFVH 5E0CA 3MRGB 2R2BB 5B4MC 2CK0L 2CLVB 5J11C 4UQ9A 5CBAA 5DF0A 1G7IB 1TFVA 3EJTA 2NXZD 1J0JA 1KB9K 3AM8C 5F7YC 3CLEH 3M17A 3EJZC 5DUBB 1U3YA 4JZOB 4MD0B 2WMPA 3GBNH 3HG1D 3MREB 4X5XA 3IJSA 5I17A 3EDJA 2ZCKH 1YQ2A 5C0CD 3PZVA 4WJXA 2WB5A 1TJGL 3WE6B 1QOKA 3RWIA 3TTQA 1HINL 5CEZD 4W7WA 3RDTA 5E03A 1QP1A 4HS3B 5KVDL 3MLTB 2ZJSH 1KPUA 3HI5L 1YN6A 1FFQA 4OQTL 2VR9A 3OKEA 1I7UB 3BO8B 4Y4HC 4E41E 3A4AA 4RFEA 1NDMB 2VN4A 3R1GH 3BMWA 4YDKL 1MIML 4Y19E 3WFEH 5FYJE 3HC3H 1G94A 3QDJB 3VFPB 4FRWA 3RM9A 2QQKH 1DWGM 4PJAE 4HMEA 2IPUK 1BJ8A 2NZ9D 2EIZB 1NMCB 2DQCL 2UUDH 5HGAB 2CR3A 5F7EL 1US2A 2NXYB 1IFHL 1C12B 1X44A 1OCWL 3H42H 3EJUA 1E4MM 3KPMB 3DYOA 2EYSB 4KKNA 3M46A 5T1LA 5DC4B 3RIAF 2KBGA 3MJ8A 2DAVA 4JFXA 3SCOA 4PGDB 5E9DD 5AC4A 1GGIL 3VIKA 1LJYA 1SY6H 2GJ6D 4M43H 3ZTNH 4N68A 3L4YA 1UM4H 1T4KA 4YHEA 1BG9A 3HFML 4GAJL 4FP8L 4A6YH 3OXSA 4MZ3A 1L6XA 2IAMD 3SJVA 3BD5A 1B1YA 4APQB 5B21A 1EO5A 1YEKL 1KIQB 2XPGB 5AZEH 1F5WA 4XC1L 3UO1L 1TCMA 3LQZB 2Z91A 4NN6C 3VFWA 1KPVA 1OTSD 2ARJA 4N1HB 3PHQB 5JXAL 5FAAA 1K6QH 5IW6B 5IB5A 4MHHI 2P49B 3PZ9A 4KVNH 1DWAM 5T3XE 4TSAL 3B9VA 2F7OA 4XBGA 4L8CB 3OB0K 5T33H 1J88A 5K9OB 3G6JE 1SR0A 5GSVB 2QHAA 1SYSA 2VLRA 1WEJH 3FT3A 4IOIB 1PSKL 3OKMB 2MSPA 1KJ2A 4OLEA 3G9AB 4H25B 1AVAA 3QUXD 2XUCA 3MR9A 2ZSWA 1T6VN 3RWHA 1HEZB 1GSMA 4ONFH 3MUJA 4HK3J 3SGKA 4EQ2A 3SURA 2NCMA 1FAIH 3EBVA 2J12B 1SBSH 3CSPA 2NY1B 2Z35B 3KYOB 5SWZE 4JAMB 3T0EC 2ZUTA 4QO1A 4J1UB 4PJDF 3TGXA 1P7QD 1GC1C 1V3JA 2APTA 1AGFA 3LEVL 3LKPA 4KY1H 4G8GB 4OZFG 3VXMB 5I75B 3IFPA 4UV4H 2BHUA 4UCFA 3FFCD 3B5TA 4M6OL 1MCKA 1FO0L 1LO2L 5KVGL 5D1QA 4ML4A 3GIZH 1V7NL 3O6FB 4P99A 4Z77A 4RDQF 2R1XA 1HYSC 2VZSA 4JQVA 4F7TB 1C5DA 2EEAA 5E5UB 1FA2A 2QMJA 3IRZA 1LDSA 3BYYA 4ZPVB 1G7QA 4RFOH 4BELD 1PKQB 2B5IC 4X9GA 4F57H 5FFLA 4S3KA 4GLRH 4Y16D 4BZ2L 4X4XA 4N42A 5JPMA 1UG6A 3PXJA 3DROA 2O5ZH 4MMXC 4NNPH 1UD3A 2WCSA 3N12A 4O2EA 4XRCB 2VUYA 1YEFL 2HLFD 4OGXL 5D71H 5GGSB 5I1HH 1HKLH 2X4PB 3ZL4L 1P1ZB 1GAFL 5IF0B 5BOPA 1CT8A 1KCVH 3RILA 3PZOA 1UXSA 5ADPH 4OCXH 1E55A 1JUFB 2HFGH 1DQLL 4Y0GA 1Q6GA 1C7TA 1AIFB 2IANE 5KVEL 4JFFA 4M7JL 1GNXA 4EANA 1XF5B 5DJDA 2BNUA 4A6YB 2J8UF 3Q5YA 4JLRB 4F66A 3ARFA 3CDGB 2B1AL 3LH2H 2UY3A 5D1QC 3T0VA 3DOSA 1YDPA 5M03A 4UUJB 1QLEH 3U9UB 5A3IC 1XIWA 1JPTH 1WFUA 3F5WA 8FABA 4OV6F 4JQVC 5TQ2H 1BAFH 2OLHA 2X1IA 3WQ5A 4WWID 3QPXL 2HJKA 3JWNC 3L4ZA 2XYCA 1N5AA 4LPWA 3KDMA 3SDDB 1K2DA 5D2NE 4XPBL 5EUOA 2XWDA 2D4FA 1M01A 1KELL 1FL6A 1FO0A 4D9RE 3T04D 4ODUB 3V9FA 1R8LA 1HKKA 5IB1B 4UIMB 43CAA 2BJMH 1EEYB 3MV9D 2ZOLA 3MMEA 1ZGLB 1T3FB 1U8LB 2EACA 4HF5L 1TPXC 3EGSB 3IVKA 1BYAA 2PW2A 4OQ1A 4C57C 3WN5A 2DM7A 1R24B 3A4WA 3IGUA 2DSZA 3WIJA 4KV5E 3I50L 1KACB 3UERA 3NA9L 1Z0MA 1UB6B 1F2XK 4LSTL 4XGZA 2I27N 2BSED 4MNMA 1K5NA 1G7JA 4P4KB 4AMCA 1R7OA 1KCLA 4OZIE 4TUOA 4YDIL 2VWEE 4BSJA 1XIWC 4HXBH 3GRWL 5LQBL 1HH9A 2DQJL 3QUMA 3MUAA 2BCKB 5EU3B 3W0WB 3GHEL 4BFIB 1I8MB 3FB5A 3OKNA 1LP9A 4ACZA 5MEND 1DVFA 4DZBB 4JO2L 1C08A 2BC4B 1QFHA 1KGUA 1M7DA 4MCZA 4QRSA 2DDQL 2HWZH 2WM0A 3IETA 4U1LB 1VENA 4D0CB 1JJUA 2C4FT 1T1XA 2VZ1A 5HGDA 3BZ4B 1DFBL 4I18A 2O61A 4MAYB 4JFWA 3OG4B 4R2GC 5F7KC 1NMAH 4LF3B 5FYLH 1FSKC 4ZTOL 4IIQA 3SDXF 4K3EL 2PR4H 1G9MC 1LGVA 3IDYC 4LCIL 4JPWL 4LVEA 3DUSB 2EIDA 2OR9H 3WV0A 4X6DE 1WWCA 4PRHD 1YEDA 1WCBA 4MJ5B 5IBLC 2ITDB 2EYRB 1IAKA 2UYLB 2F8VA 4NYLB 5IIEA 1JPGB 3W29A 2NTFA 3SOBH 2Y5TA 3B8SA 3LVEA 2R23B 4TVPL 3T8XA 3ZDXF 3GMMB 4NO3B 4UNIA 4JVWA 4IEFB 3RVUC 5I1AB 1DANT 4U33A 2WMIB 2VX6A 5LA0A 2VCAA 3DBXB 3HZ3A 4DK3A 1QFOA 4PTTA 3CGTA 1PEWA 3BDBA 1E0WA 2VKWA 4CN1A 3GBEA 3WH9A 2HT2D 4DUXA 3DX6B 4XX1G 3SKJL 5GGVY 4M7ZB 5D4QA 2R29L 3VRJA 1OM3H 1MWOA 3ROLB 2A3HA 3IDIB 4TSBL 4GS7C 1ZHKB 4OKVB 4RWYH 5FHAH 1DR9A 1SJEB 4P2YA 4Z8FL 3VILA 2IC2A 3BEWB 3VFRA 4B3KA 4IIQC 1QHOA 5IXEA 2ZUYA 4WK9A 3TYFB 4AMKL 2IQ9H 2GYSA 1TMCB 3OPZL 5EU5A 5C0IB 3KEHA 5ETUB 3WBAA 3OAZH 3SE3A 3CFCH 3O41B 5I1EH 1R3HA 4PJHA 4U3XA 4HV8B 2GKIA 4HW6A 5A2IH 1EMTL 3FT2A 4QHNA 1U8JB 5C0JB 2GK2A 1MHCA 4LSQL 3MNVA 4M62L 5HDOA 3VIIA 3SO3B 2EDNA 3L5WA 1ZA3B 5F6IC 1VAHA 4YBQC 1MRDL 4YHNA 4GQQA 3IDJA 1MH5B 1OP9A 3QCTH 2YSSB 2H32A 1U8HA 5CLTA 3AICA 3RWJB 3O6ML 4LCWA 3D3VE 4QCIA 2YHGA 4I4WA 1BGXL 3F62A 4WFFD 3C09C 4WCYL 3WD5H 5HHPA 1E6ZA 5BXTA 3UR7A 3H0TB 4DWSD 5GJTH 1DBKL 2CMRL 4KRNA 3K2UH 4XP1H 2QKIA 2X4TA 4FQIH 3TCLA 2CRZA 1OSEA 4ZODA 3CLFH 2X4QB 5FCZA 5JO5B 1JGUH 1IGYA 1KFAL 3DMMB 3UTPE 1FLRH 3D1MC 3WFDL 3CIVA 4CW1A 3BSZH 1UYQA 1A64A 2VLMD 3P9MA 2Z31B 1V3MA 2R1YB 4JANB 5EWIL 1ZHLA 1B6UA 1E4JA 5JW3L 1M04A 3MSGA 2VERN 3QDJE 4MQTB 5FO8B 5BRZB 5IEHA 3DXAB 4FQ2H 3QRGL 4GAYB 2YC1B 4RAVA 5D93C 1PKOA 2X4RA 3CFBA 2FJHB 2F8QA 4M1GH 4Z7UF 1FG9C 5ISZA 3D87B 5E0FA 5BRQA 2Y2WA 2Y06L 1YNKL 3RIFF 1YN7B 2CLZA 2ID5A 3QQ4B 4U6YB 3TA3D 1G7PB 2AK4A 3TIEB 3TJEL 4JHAL 3H8NA 2YBRA 1BJ1J 1S7VA 2BOCA 1OAKL 5IB2A 1KGCD 1MF2L 4F9JA 4D8PB 1AP2B 3CNKA 3H3PL 1S7WB 3LX9A 4ALAL 2ZPKL 2VDMH 3MBEC 1KT2B 4D6GA 4HU0A 5ICYB 1VADB 1JFQH 1WBZB 3W24A 4PJEA 2D0HA 4X7SL 2JCCF 3S37L 5L7XL 4UZGA 1HHJA 1HWHB 3FOMB 1XCWA 1Q0XH 3DTXA 2ZUQB 1Z6JT 1Z9OA 1N7ML 2FEDC 2DYPD 3AIBA 3VIHA 3UTZB 2X1XR 3U1SL 5JW5A 2EJ1A 3HC4L 1TZHB 2Z93A 1KJ3L 4KRPB 4NUGH 4GMTH 3WFCL 3MV7A 4W4OA 1TNMA 1OGAB 3HG1E 1R75A 5C0CE 3U9PH 3E6HA 5EIQA 2R0LL 4BSVA 1AGBB 4PJXF 4X5WA 4YE4H 5CEZE 1OTTD 1RZIA 4HIXL 4YUEH 3U0WH 5FXCH 4KI5C 4G8GE 5EC2B 4PGEA 5FUCE 2BFVL 1MCWW 2R0ZH 4NQCB 2V5DA 3MYZA 1I1RA 4KK6D 3QIWA 3BZEA 1BEYL 3BUDA 3AMGA 3LS4L 1W32A 5SWSB 1JZ7A 3MROA 4WUUB 3ZDYE 3RTQC 5J1AB 3ARGC 3BVXA 3HE7B 3DO7B 3PWJB 2F74B 2VRQA 4G6FD 3PWPD 4Z7QF 1A1NB 3T3PE 2WQ8A 3O3DA 5DEGB 3QNXB 5E1AB 3QHFH 2A74A 3SE8H 4X0NA 1E70M 5JOFA 1UB5B 32C2A 1ZVHA 2JELH 1PKQE 2DI8A 2EKSB 2GSGA 4MXQC 5A2CA 1INDH 5I8EA 2OTWA 4C59B 5CZKA 3QGVA 3CFIC 3P2TA 4V1DA 5ANME 1ZS2A 2CXGA 1GGCL 5ECUA 2J2ZA 4XX1E 4AZGA 1WO2A 2DQUH 5GRJH 5GGQL 3D18A 3DX0A 1A7PL 1F3JA 1QNPA 3WHXB 4PJDB 2BSRA 3EYPA 5E09A 5ILTL 4QNPE 4MQ7A 5K9JL 4HZAA 3AU1A 1I1XA 2WVTA 1MPAH 3CZFB 2WVVA 4D6DA 3QIWC 5KSBB 1P4LA 2JJUA 5A2LH 3RDKA 2XA8H 5D4YA 2XY2A 2DPEA 1KTBA 3SDYH 4FFYL 4HUKB 3DX7B 1MFEL 3KLHD 3TFKC 1CG9B 5HHQB 4DO6A 3BUYA 3OB0H 1VPOL 1GQKA 3MNWA 3MLSL 3N1MC 2D7OA 2DQGH 1K3IA 2R2BA 1CGSL 2R1WA 4NX0A 2CLVA 2CPCA 5DD6B 2J77A 1DWIM 3EMCA 1G7IA 3UTQB 4CD5A 1V8HA 2G4FA 4TULL 1T2JA 3NCYS 5I5RA 1CL7I 4U2ZA 1OSZA 1U8KB 3AREB 2J7FA 5HPCA 2E8YA 5DUBA 4MD0A 5E8DL 5C8JB 3FFCE 3O4LB 2DDXA 4I3SL 5HYQA 1A6VH 5D9MA 2Y6SC 2PBOA 4QRTB 2BOBB 5CZVH 5DHYA 1XEDA 3EHBD 1NL0H 4QF1B 1DUZA 5LYRA 1QRND 1T0NA 2VE6B 4W8LA 2A6KA 2WYSA 1GJWA 3D85B 5IB4A 1I7UA 1VDGA 3LQAL 1NDMA 3VNZA 1YJDH 1K3ZA 2O9TA 3AIEA 4UOQA 2D03H 4J12A 1CICD 5EIVA 2FX9H 1YY9C 4MD5B 2LTQC 2XOTA 3MA9L 3AIVA 2E9JA 4HWBA 3W0WE 5DMGC 4PV9B 2F5AL 1MVFA 2EIZA 3ARDD 3PZIA 1X5JA 1RIUH 1U58A 2VXUH 4O58L 1C12A 4NKIH 4U7MA 2FB4H 4FQLH 2DKSA 1EIBA 3WL9B 3WUFA 1R3LB 2VIRB 1VEOA 3CVHL 3L7EA 3HR5B 3RQ3A 1I3GH 3WLWD 3JWDL 4PJIF 4G5ZH 4XXDB 5FYKH 4MDIB 1GL4B 3VG0L 3WBDA 4NRRA 1GOHA 5ID0A 4WSKA 2ZKHH 4QTIL 5DFVD 3MRQA 3W26A 2Q3AA 4AQ1B 1RJYA 2EPMX 5HHNA 5C09D 1T2QH 1EJOH 4GBXB 3QIUD 3WY4A 2WINA 3HC0A 4LPCA 2LVEA 5F97E 3B9KD 3I6GB 5FF6B 3RKDC 1QSVA 2ZUUA 4H1LA 5H8DA 4Z5RB 4H04A 2EDXA 3B3IB 2WC4A 4L8CA 2EABA 1A1OA 1TJIH 1U95A 2CBUA 2D20A 4ZAKA 3GH7A 5CKAA 2FYVA 4RE4A 1FNEA 1U92A 2YD2A 4XVUD 2C7UA 4K07A 4QLLA 2DT2A 4LEXL 3LKRB 1ULVA 5FUZL 3CMJA 5TE6H 1URLA 1BZ9B 2NY3D 1L0QA 3IJ7A 1CWVA 1LF1A 2PYED 3WCYA 2D3LA 2PETA 4L1HA 2E8ZA 3DRQA 2UY5A 4D1IA 3KYOA 4C83B 3SEPA 2YPKA 4JAMA 4ODVH 1FZMA 4KHTL 1ACZA 5FHBH 4FABH 1R47A 2GT9B 2MOVA 4KQ4H 3PZTA 3KPOB 5J8OA 4BZYA 5KS9A 5CD5D 3V4PL 3ZKXB 3SCNA 2X4SA 3I3DA 2YBUA 4R6UA 4YWGH 3GNMH 5DRXB 3GSWB 1ZTXL 1MW2A 5TFSH 4Q2ZB 3SUVA 4Z78A 1NCBL 1U8QA 4WY7H 3SY0A 4PBVC 3NZ8A 5EO9A 3TONA 3AXXA 2Q8BH 1CDJA 4D6EA 1PY9A 2D7PA 3H2WA 4P23A 5MERB 1UR4A 5DTFB 3MGTB 4HWUA 5EPMA 1Q9LA 4ZAKC 2YOCA 4M48H 3L3DA 4NM8L 1K9EA 3A6OA 3RPIA 1UENA 4R96A 5A6MA 3C6LD 5DJXA 5DVMA 3MJ6A 4ORGA 5GGSA 3LQAC 1LILA 4J7RA 1U0QA 3PGCB 4OCMC 1P1ZA 1RZ8A 5IF0A 3CZGA 3QUZB 2E27H 1GOWA 5ABGA 4R5EA 1XGRB 3BAEH 2CGRL 4PJ5A 4L8DB 1EFXB 3LSOB 1SY6A 1QX1A 5CJBA 1DE4B 2F54D 2W1NA 1BHGA 4R3SA 2RBLA 3BGFC 4Q7NA 1C8PA 3KS0J 4G6JL 3CDGA 3PWLB 4PGBB 5DUML 1WAWA 4Y1AD 2ICWI 3GH4A 1VEPA 4PRHE 4YIQA 2W0FB 4UUJA 1HP4A 2FBJH 3BQUC 5I1DA 2FWOB 1KBGL 2GJZB 4PJCA 3SCMC 4JL1A 4F37K 2C3VB 4A3YA 1X5KA 4LRIC 1KPRA 3POHA 2IPUG 4HUMB 5JZ7D 5E5MA 3SUWA 5B8CB 4OZOA 4DGVH 1ZBWA 3T3ME 3QNZB 1HSBA 5BRZE 4ODUA 5GGRB 2OSLA 5L88L 2F53A 2XTLA 1PPIA 1P84J 1GOIA 2XACC 2FNBA 4KTDH 4GMSL 3P30L 3U7YH 1MHPL 1HXYB 1A7OH 1H49A 2UY6A 2D31B 3HAEB 5C71A 4ATWA 2GVYA 1N0XL 5TJWK 4K8RH 1FYTD 3FO9A 3QUKB 1MFAL 5IHRA 3SDAC 3LKNA 4JDTH 5ESVA 2ORBH 3IDGA 3VD4A 2BVOA 2A2QT 2WMHA 2OZ4L 4OJFL 2YDRA 2QPUA 1MCDA 3VRLF 4HP5A 3RWFB 3N1PC 5FOOA 2KL6A 4NZJA 5EBMA 4ONHA 3IU4H 4XCCH 3IFNL 4DN3L 5KSAB 2F58H 3WKZA 1I8MA 2CO6B 2H2PD 1MWAL 5EIIB 4W81A 2PTVA 1Z3GL 3LY6A 1YYLL 2VQTA 1HKFA 1F6AB 4HCRL 5E70A 3VXNB 2VKXA 3C2SA 4F58L 1U8PA 3GJEB 1QSZA 2FJGA 3WN6A 1SFSA 2UZYB 3QHNA 1KCUL 1BIIB 3LKSB 4BH8A 3THMH 1E72M 3QCUL 1OGAE 5JORB 4NRXB 2J4GA 4YGVB 3EUUA 2B20A 2EBNA 5KANI 1A22B 4U1KA 3II1A 3MCKA 4GW4B 4M6MH 1JPFB 1Q38A 4HDIB 2OMNA 3DX9B 1KCSL 1NP2A 2H45A 2X7LA 4N9GA 5K59F 5IMLB 1RPKA 4ODWA 5CP3A 1F13A 3BLBA 1D6EB 4ZFFA 4I3RH 4MSWB 3QFDA 4NRYA 4KRTA 1UEMA 5FV1L 4YXKL 4Z7WB 4ZO7A 4HKZB 2IGFL 3DUSA 4PP2A 3ECBB 2XICA 2V7HB 5GS0L 3TVMB 1DBBL 1L8NA 3FFDB 3CZ8A 2AXFB 3NCMA 2P8MB 4K3DH 5EUKB 2EYRA 2NMSA 5HYIA 3WEZA 1X5ZA 1OGTA 1KIPB 1DLFH 4DGIL 4NO3A 1KCKA 3FO0L 1NCUA 4P5TC 5I1AA 1A1MB 4PRPD 1INEH 1AHWB 1A0QL 4RA0C 4OBRA 2HMIC 2EDLA 3PZUA 2AABH 4OZGB 5DI8B 2WHKA 3DX6A 2FH6A 4LCYB 1QR4A 3QIBC 2XG9A 4LIQH 1FRGL 5C0NC 4MADA 4HHAB 2VXTL 4HA3A 4CRPA 1ZHKA 4NC2B 3X14B 1AD9A 4WW2C 1I7ZB 4OKVA 1XF3A 4DKDC 2A3AA 1SJEA 5DJ8A 1D6VH 4H2CA 2BFGA 4MNJA 4PJXB 2QMKA 4UV7L 1CR9H 35C8L 4OLYH 2EEXA 2V5YA 3HUJF 1FL3B 2MHAA 2P8LA 4FFVC 4FQHA 2BXZA 4G42B 3PHOB 4MD4A 3RL2B 5L2KA 4IS6B 4FQJH 1DTUA 3ZJKA 4R0LB 3WHE0 4HV8A 3BAJA 3BDYH 5KSBE 1I8KA 4NKMB 3G5XB 4CNIB 2GITB 1T20A 5C0JA 3WEOA 2W66A 5B4MD 3CFJB 3H9SD 3BUQA 2YRPA 3KGRA 3ZR6A 4BA8A 4UAOB 1V5JA 1MIEL 2YSSA 3GHBL 5GGTL 3EJZD 1C3FA 4GRWE 4OD2A 5HHVH 5AG9A 4OIBA 1TVHB 4OIIL 3BXNA 4FQPA 4PRIB 3IDMA 4OZHB 4HUVA 4PCTA 5E7BA 3HAEG 2E9MA 3MA7B 5EZLB 3JUGA 3A67H 2J74A 4OAWB 2WSPA 3B83A 3DMMA 3V52H 3EYQC 1E56A 4WTZA 3U83A 4ZDHB 1LEKB 5TDNB 2YA1A 3ILQC 1B0WA 5IFJB 2J8FA 5DD1H 1EO8L 2O5YH 5DD3L 2R1YA 4JANA 3PWPE 5CHNB 1Z5LA 2VSDA 3ULUE 4CN6A 5JUVA 1FDLH 1QBAA 1HNGA 2KPNA 4Y7MA 1BVNP 5D7KD 5FO8A 4J4PD 1ISZA 3DXAA 1JWMA 3TT1H 4K94H 4XPGH 4GAYA 2EYTB 1HHKA 4ZQKA 4JDVB 1BBDH 1KCRL 3HI6L 1MLBA 5BXSA 1I9JH 3P4NB 4EUPH 4P59L 5SX4H 2WIIB 3AAZA 1RIVL 1I9EA 5GS0C 4YHLH 3MRHB 3CFDB 4U7SA 1QFPA 1VBUA 5C6WH 1FGVH 4ZO9A 2X2HA 1ZB5A 1BFTA 1XSKA 3ZYJA 4LDLB 1FZJB 1P4IL 1DBAH 3W9DA 1T2XA 2DQXA 2WZEA 4L4TD 2BNQA 4L3EA 4YO0B 3TZVC 3N1QC 4A4AA 1B6DA 1ZANL 4KRLB 2IH3B 4MB4A<