3K8LA

Crystal structure of susg-d498n mutant with maltoheptaose
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
649
structure length
649
Chain Sequence
b'WTALTASPDTWDETKRADISYQLLLYSFADSDGDGYGDLNGVTQKLDYLNQLGVKALWLSPIHPCMSYHGYDVTDYTKVNPQLGTESDFDRLVTEAHNRGIKIYLDYVMNHTGTAHPWFTEASSSSESPYRNYYSFSEDPKTDIAAGKIAMITQEGAAGYNAAEWFQVSDETAAVKGLLKFTLDWSNAPSPILVVSTGTKADEDNPDTGTDNAKYLYYGEDICKKFYDKGNNIYELTVDFESTWGLLIRTSNASFWPSGTKYGASSSSEKLALNKDFKLTNAGNPANIMFDSQQITYFHSHFCTDWFADLNYGPVDQAGESPAYQAIADAAKGWIARGVDGLRLDAVKHIYHSETSEENPRFLKMFYEDMNAYYKQKGHTDDFYMIGEVLSEYDKVAPYYKGLPALFEFSFWYRLEWGINNSTGCYFAKDILSYQQKYANYRSDYIEATKLSNHNEDRTSSKLGKSADKCKLAAAVLLTSAGHPYIYYGEELGLYGTKDNGDEYVRSPMLWGDSYTTNYTDKTDATVSKNVKTVADQQADTHSLLNIYFSLTRLRNTYPALAEGNMTKHSVYNESQEKDYKPIAAWYMTKDNEKLLVIHNFGGTAMQLPLTDKIEKVLFVNGETQQNTDSDSYTLKLGGYASVVFKLGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, susG
publication title SusG: A Unique Cell-Membrane-Associated alpha-Amylase from a Prominent Human Gut Symbiont Targets Complex Starch Molecules.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Membrane protein
total genus 199
structure length 649
sequence length 649
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k8lA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3k8lA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k8lA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3k8lA03
1UENA 4JHAL 4JVWA 1XAUA 4ODHL 1KN4H 3VOCA 3N1PC 2APXA 4F8XA 4KK5C 1JHTA 4R2GB 1X6NA 2V7NA 1NCBH 3INUH 1RK0B 3QAZC 4PTUA 1TR1A 3VRJB 5ETUB 3ARFD 4OLWH 2LAAA 2XZQH 4XMLL 3MBXL 1CENA 3FO0H 2VE6B 4WUUD 4YDLC 2APBA 4IEFB 4FQJH 1T03H 1MLBA 3TZVA 3BQUD 2BMKA 3RJDA 5D9MA 3D69A 4AW7A 3HI1A 5C6TL 4JCLA 1CVSC 4U1LB 1XGRB 1HJXA 3RGVC 5HHPA 3GRWA 1EPFA 4JFZH 3A6CL 4GW1B 2YA2A 2P5EB 3VGAC 1ISXA 4OQTL 1XIWC 3NCCB 1DVFC 2H32B 3O2DA 1O0VA 4L8CB 4ZXBD 3REWB 1OOAA 5CJXC 3CFJA 1RHHB 1RUAL 3NUKA 3MA9L 3ZHDA 1ES0B 5JXAL 4NRXA 4WKHA 1FFRA 5BO1H 4YHGA 2B39A 4PG9A 4ZAKB 3VFRB 5HXMA 1YDPB 1HILA 3WLWD 5F6IB 2D73A 1URLA 3GXPA 1IRAY 4L4VA 4GG6E 1UA6H 4YQXH 1KR0A 2I9TA 2DIEA 1B0RA 3FAWA 3RY6A 4RGMB 1AD0B 4GO8A 1KJVB 4EN3B 5FCUH 1QSFA 4JFDA 4JM2A 2YDQA 5E0CA 2WLZA 4ONHB 4L8BB 3UJTL 4KMTL 5DJ2A 1QR4A 4P5KB 1KEGH 2BNRE 1G6VK 1I1WA 3E6FA 2D4FA 5C0AE 1HJQA 3U5YA 2AQ2A 4ZNEE 2EH7H 3AFLA 5ICYA 3OZPA 1QNZL 2FHBA 2CRIA 4QDMA 4IIQC 4UT9H 4UFIA 3MJ9A 1ZHBB 5MERB 1SEBA 4M6MH 4MCZB 1VEOA 1YYLL 1JGUH 5DGQA 4XVUD 1XYFA 4DO6A 1ZLUH 2UWEE 5M3WA 2XRAH 4JFXB 3OPZL 2R39A 4QRSB 3RHWF 1NP0A 2J75A 5C70A 1LO0H 1DQML 4PGJA 2VLRD 3GJFK 1MCSA 3SGDI 2ZCLH 4P9HL 2B8OT 3QUZD 3W37A 5I3DA 4IMKC 3CPLA 3C5ZB 3QFJB 4JHBA 4ENEC 1WZLA 1U8HB 3HE6A 1PYWB 1J18A 4KUZL 3HZ3A 1ISYA 1LHZA 1KCSL 5D1QA 2D23A 5KZ6A 1UA7A 4NPYA 4Y1AD 3EYUL 3DXAB 1KJ2A 3FHQA 4QYOA 3AUVA 4OOUA 3PBGA 1BQSA 1N5YH 3VE0A 2MKWA 1GZPB 3I50L 2W0KA 4EUPG 4TTDC 4I2XB 2G9HA 1E6QM 5L2KA 1MOEA 1IGTB 3C8KA 1CQYA 4J3SA 4HJGB 4WFGE 2H9GB 4POUB 5ACMA 5IT2H 1WE5A 1DFBL 4PJ8C 5GHWH 3FB7B 4N0CD 4YXKH 3CSYB 1ZHNA 1GPFA 5C3LD 4MAYA 1F90H 2CITA 3GH4A 3ZHLA 4HCRL 1K2DB 3LEVL 4U1IA 3D0LB 5CEYA 2EIZB 4UQEA 5K9OA 5CJ8A 3RVUC 3TTQA 4KRMB 4MA7H 4XP5L 4P4KA 1B4JH 4PRHE 3H54A 2CH8A 3MO1A 5D9SA 1OGBA 3D9AL 1WP6A 7CGTA 2ICWJ 4F7EA 1CR9H 1NCWH 4HK3J 4P59H 3OKEB 3AJ7A 4AZCB 3WUWA 43C9B 5GS0L 3OKYA 2YD4A 3VFUA 5KSBF 2CDEB 4BFGA 1ZT7B 4LFHG 1FNLA 5AWNL 3M07A 4X0KB 3O9WC 2DRUA 5GIRA 3VH8B 5LYRA 2BCKB 3W81A 5DRNA 4F9PC 2A73B 4Z7UB 2NLJA 5J12C 5JHDD 4TVPE 4HIHB 5CXPA 3MNWA 1D7FA 1A3LH 1JZ6A 4V28A 2HMID 3MCKB 4Y2DA 2PUQT 4NN7C 1I9EA 5HSFA 2HFGH 3F5KA 3GB7A 1KQZA 4GZEA 1QRNA 4Y5VC 3MACL 1W72A 2F1AA 1Q0XL 3GMMB 4PJBE 3O3EA 1FNEB 3R1GL 3ZDYE 4OZOA 2OJZH 2WKLA 5SWSB 1O6IA 1UFUA 5TDPA 3KWWB 1RH9A 3CUGA 4X6CB 4YO0B 4KDWA 1I85A 3I6GA 3U7WH 5EA0L 4KJYB 3QXDA 3OKNB 1Q0YL 4ONFH 3OZ9H 4I13B 4Z77A 4W4OA 2VRKA 1AFVL 2C4XA 4X7SL 4I3RL 4UIKH 1SJEB 1CDGA 4N0FA 5DR5L 1FGNH 2QKIA 2W38A 1BSIA 2DBJA 3MFFB 5CJBA 4OCNC 1BIIA 1XCTB 1T7XA 1UR0A 3W39B 3VUPA 2WUBH 5I18L 2AV7B 4KDTA 3DX4A 5DZLA 4RISH 2Y72A 1KGWA 4JPVL 2OYMA 1MWAL 4FQ2H 3O3BA 4PJFF 4Y4KB 3UYRL 1I8LC 5LGJA 5IFHL 3W38A 5FEBA 3PZMA 4GMTL 3DHUA 4G6AC 3EYOB 4L3EE 5FM8A 1ZWIB 4B0MM 1QO3A 1R3LB 4KKCD 4KZDL 1EGZA 1OP3K 3SE8L 1C3FA 3HPJB 5E1HB 3DVGA 3DSFH 2A6JA 3MC0A 1U3ZA 2W60A 3M46A 1JYNA 2J7EA 4B41A 5I1CH 2CR3A 4LF3B 4OB5L 5I1LA 3HMXH 5FA4A 5DC0A 4KAQL 3KPSB 4U1KB 2VLJE 5ALBL 3CMOL 2DYPA 5FL1A 5DS8A 1CFQA 5I19H 4WI5A 3TYFA 3AS3A 1S7WB 2R29H 2HP4A 2ZG1A 1WC7A 3EO9H 3TVMD 4H5SB 4AMXA 3K8MA 5DVOA 2D31B 1E27B 4UDUA 2W0LA 4XPAH 3LPGA 2VLKA 4EZMA 4W6WB 5K9JH 1DBJL 4MXQC 4FLQA 3BT2H 1XV8A 5C09A 2FEDD 2Y23A 4OQ1A 4NQXB 1BZQK 4NQTA 3V0AC 5DMKA 2R2EA 3B83A 1RUAH 4JFHD 3L5WA 3N04A 1Q72L 2Q76A 4Z7WB 3N13A 3OF6A 1Y6KR 2D7TH 1N6QH 4D6JA 4QRPD 5E03A 5F88A 1R3IL 3Q5TA 3WUZA 1ECEA 2XGBA 4YBHA 3D39D 1OD8A 1FP8A 4R0LC 4ZFGL 2BNQB 3U1SL 1EK3A 2UY4A 4FQIL 1KIPB 1QRKA 4RGNB 3QWRA 4KZEL 3BHBA 4HMDA 4EIGB 2YL5A 4M93B 1EAPA 5IW1B 4WI4A 3CC1A 3EJSA 4MNLA 3U7BA 3AZTA 5E99H 2GFBB 2IH1A 1CICC 3L95B 4J3TA 1G7JB 5D7LB 1CXFA 5CMAB 3B8YA 4WI3A 1FYTB 1HIMH 3IFNH 5E8DL 5TPWL 2WAGA 4U6XB 3RIAK 4WWKA 5FGCE 1RUQL 3V5KB 3C2AH 3MJ7A 1WAWA 2R15A 1OW0C 2CSPA 4KQ4H 1I3RB 4OCYL 3BKYL 1Q6EA 3G6DL 1H8SA 1GVIA 5K9KB 3PHQA 3QULA 4FXKA 4CNIA 2HT4D 3ARDD 3BKCH 1KG0B 2ESVB 1C8PA 2YIHA 3CUPB 2AK4E 2CR6A 3PWLA 4Z76A 3OGCA 1SEQL 3ZHKA 4H1LA 3O2VH 2Q86A 2CIIB 2X2JA 3QUXC 5FO9B 5F1OB 2X70B 3LN9A 4U33A 1H3GA 1YEFL 4BH8A 4YK4B 3NVQA 5D8JL 4ZXOA 4FMFA 3IETB 3LKPB 1MW1A 4P9HH 4CW1A 4RFEB 1KCRH 5B21A 3DUHA 3V4UH 1YNLH 4HDIB 4YFLF 3RVTD 4AG4H 4UQ2B 3QA3B 3BUQA 3U30C 1R5WB 2LFGA 5F9JA 3KNBA 4J27A 1ONQB 4LCWD 1NANH 3FKUS 1R3HB 2PYEE 4W87A 4TRPL 5J12B 1RK1B 1MCWM 1BPVA 3KPRD 4P57B 3WLBB 5K9QG 1VFUA 1H8OA 3HZVA 3U0PB 5KS9A 3X14B 2DIJA 2VITA 1B0WA 5IV2B 3O4LE 5E1AB 3LPOA 2CQVA 2DQHH 4CVZA 4LDOB 1HYSD 4PGDB 4U6VH 2W0FB 5F8RC 3FT4B 5BS0E 1IILE 3QIWA 3KR3L 5MHSE 1NSNH 4ZPTB 1X4YA 4P4RA 4LPXA 3N1MC 3T2OA 4ZTPL 1UD6A 1KTRL 3T4YA 2ICEA 3FZUD 2W92A 4YHZH 2NX5E 1W2KT 4YFDB 2XG9A 5IF0A 2FX7L 1NMBH 1LEGA 3S6CA 3QDMA 4Y4HC 2PYFA 3PGCA 5IEKA 3G6MA 3D48R 3VM5A 3Q1SL 3N1GC 1JZ2A 1L0XA 3C9NB 1IM9A 3MLRL 2VISB 1S7VA 4Y16A 5FECA 1PKQA 3WO4C 5IR1A 4Z7VB 4FRWA 3HS0A 5E6IA 4JAMB 2YD8A 1E6XM 3C6LB 4JGMA 1FO0L 4L9LC 3BVVA 4URIA 4YEEA 4K55A 3EYQC 4PTTB 4XZUB 4LVHC 1UXSA 1YC7A 4YHPA 3WIHA 4G43A 2XTKA 4A2MA 1MW0A 4LYPA 3VFWA 1L7IL 4NKIL 3IVKB 5CHNA 4HF5L 3HC3H 2WCGA 5HD8D 1Q6FA 4Z2JA 1NDGB 1UXWA 3ULVH 1WFTA 4MA3A 3V5DB 3MV8E 4K3HA 3SDXF 4JO4H 4H88L 4OLUL 4X4ZA 1GGUA 2ZOKA 3L4UA 1DL7H 2A0LD 3MV01 3NACH 3DDGA 2AXGA 1N2RA 4MJ5A 5DJZB 3VG9C 1Q94B 2W67A 4PBVC 3SHSA 5F3BB 3TT1L 3WS3B 4UQAA 1BFSA 1EEZA 3WFCL 4JZJA 2GITA 1N3NB 1YMMB 4XRCB 1JJUA 2ZUNA 1L9MA 3H9SE 1U42A 3LKOA 1WT5C 4KXZI 4KY1H 4HOZA 2GTWB 3QWOA 1DWGM 4U5IA 3TV8A 2AKRA 4ELMB 3P4NB 1GCFA 1MCHA 5D9NA 1NBQA 5EU3A 1TJGL 4N90D 3MCG1 3HC4L 4YXHL 4YWGH 3MUHL 5EFFA 3HNVH 5AZ2H 2J6EA 1UKOA 1RZGB 1FCCA 1RK0A 3JUYA 2E6QA 1A6VL 3VRJA 1QI4A 4MPKA 1CK0L 5ETUA 2E9LA 1AKJB 4KVCH 5DR5H 2ZCHL 1HXKA 1OD0A 1AQ0A 1KIUA 4PP1D 2VE6A 5GGTH 5I18H 2EXYC 5TQ2L 5K93A 5GZOD 3F4VA 5JDSB 2FRGP 4M4RA 4TVPL 2WSKA 2EPLX 5I1JL 4MAUL 3G6JE 4U1LA 1FH7A 1XGRA 4OCXH 3ZE1F 5I1IH 2ID5A 4HLZH 1TTFA 2CYGA 1OGSA 3SCMC 4GW1A 2RIKA 3U9UB 5IFHH 3EAKA 4FFZL 3SCWA 2P5EA 4WDIB 3SCPA 3ULSB 4ZOEA 2H32A 3P2TA 1FAKT 3UTZB 2G4FA 3SE8H 5L88H 2IG2H 2WW5A 5GJSL 2EO1A 3REWA 4X9BA 5C08D 4EUPB 1S7XA 1NUNB 1X5HA 3AB0B 5IBUG 4QHMB 1RHHA 1N4XH 4DQOH 3FJTA 3R4DA 1ZV5A 4JRXD 3HHRB 4OB5H 4ZENA 1ES0A 4HIIB 4LDLB 4EEEA 3MRPB 3MANA 1E3ZA 4ZAKA 3VFRA 1YDPA 2DKUA 5F7WC 1GPOL 3IJSB 2NYYD 2WIIA 4I48B 4R6UA 2F2HA 3DURB 3FQUB 1MIEH 2Q8AH 3S36H 3D6GA 3SDCC 4UFHA 2CO7B 1MNUH 4NSKB 1A0QL 4WUUE 4NNYA 1NOWA 1AD0A 5GRVL 5FO8B 1MCDA 1MAML 1UM5H 1KJVA 3TO2B 4EN3A 1OB1B 4NQEB 4JRYB 3QISA 4OD3L 5KVEL 1I7UB 5C7XL 4NGHH 3QUXB 1R0AH 4S1RL 3GHBH 1W1TA 4ONHA 5D7SL 4XVTL 3THCA 1UJTA 2ADFH 4XGZB 3ZYIA 2B5IB 1B3VA 4HCRA 1KB5L 3S97C 4P5KA 1KBGL 1NCAL 3C60B 5E2TL 4MNJA 4XP9H 3O6ML 1N0XH 4UZSA 3CFDA 2DT2A 4KZEH 5DJ8A 3QNXA 1M01A 4MA1C 2WHLA 5C9KA 1ZHBA 1ACZA 1WV7T 3QRFM 3MMUA 3ARGA 4LRNH 1P2CB 1P7HL 2F54D 3ARFC 1B0IA 2A1WH 1YEKH 1MRDH 4JFXA 4JCMA 2XN2A 1F45A 4QRSA 2GK0B 4LLAA 1XCWA 2O5XL 3GBDA 2F53A 8FABB 3HG2A 1AO7D 3SE3A 3C5ZA 3QFJA 2QMKA 1PYWA 2IGFL 5IMKB 3IXAB 1KPVB 1MELA 5CFHA 1MJJB 5KVGH 5BMFL 2YWZA 3CFBB 4DAGL 5TD4A 3T0EB 2IH3B 3ISWA 3KXFD 5C0BD 5DT7A 2X89D 2QSTA 4UU9B 4YHIB 5F8QC 1AE6L 1P9MC 4LIQH 3BPOB 1J1OL 2FGWH 3AM8C 3I2CL 4J3UA 4MCYB 2D2OA 1GZPA 2YD7A 4I2XA 1YEFH 3ZO9A 1IGTA 1LO4L 3S5YA 4MX7B 1QVBA 3SE9H 2C9AA 4HJGA 5D8JH 2H9GA 4AIEA 2MWCA 4GI6A 4GI8A 1P1ZB 5DT1H 1MVYA 2YMXH 3FB7A 2OK0H 3CSYA 1RD6A 4DW2H 5D8ZA 3LPFA 2BNJA 3RX7A 1NAKL 2YD9A 4F9JA 2F8XC 4EKXA 3VXQB 4XNYH 2VDRL 1KXQA 1CD1B 2HT2D 4ONGH 2CK2A 3D0LA 5I66B 2EIZA 1QBAA 2EH8L 1ZBWA 2ZSVB 2UUDK 4R26H 3RWEB 2VLRE 3VXRB 1S9WB 4P2OD 4OZGB 1YECH 3OKEA 4M3JA 3VSTA 2JCCF 2DT3A 4Q9QH 4AZCA 2OLHA 1CT8B 3BAXA 3ZO0A 2WBJD 5AUMB 4KKAD 4I4WB 2GFTA 5IFJB 2CDEA 1ZU8A 3VIFA 4WRLA 4E41B 1ZT7A 1MCRA 4LGPB 4KRPB 5L8JB 4X0KA 4A6YB 1QOKA 1WTGT 1I8IA 2PO6B 3S3SA 3VH8A 3SKUD 4FQLL 4GQ9L 5D2LB 2ZKHH 4TSBL 1LDPL 2BSRB 2A73A 4Z7UA 3WY4A 3S96B 4Z7QE 5I0DA 2BVEA 4O5LL 3GXTA 4W7WA 2EE2A 3G6LA 4HIHA 4JHZA 4ALAL 4XPGL 4N0UE 5JZ7D 2J8FA 4HS8L 4LCYB 4XVUC 4DKAA 3V6ZA 3MCKA 3VXMB 2Q6WB 2P8PB 3CVHL 1QLFB 3B2VL 3EGSB 3NPZB 3W0WB 5DJYA 1F6LL 2QHAA 3ROLB 2Q7YA 3QUZC 3NSNA 2DQIH 5F71A 3GMMA 5L9DL 5LKNA 1C92A 1PW3A 2VQUA 2F19L 3KWWA 3MOBH 5D7IB 2FEEL 4I0PB 1KB3A 2FB4H 2AJXL 4YO0A 5CG0A 1JNJA 1GOMA 4KJYA 1KFWA 4F79A 3OKNA 5EUKB 5J56B 1YEIL 4H88H 4V2BA 3MV7B 5JR1H 2LE9A 4OGXH 4YAQB 4NFBA 3MLYH 1SJEA 1NFDB 3GK8H 4LSUH 4DWSB 2AGJH 4HXAH 3TT1H 3NPSC 3MFFA 3RNQB 3AMDA 4KQ3L 1XCTA 1ZA6B 4N0CC 1J7VR 3TO4B 3W39A 5JHDE 2AV7A 1V3LA 3GTNA 1E0XA 4JKKA 4AEHH 4WLCA 4RQQB 4PTWA 1FNFA 3LXCA 2HLFD 5CJOL 2C1PB 1R87A 5HDBE 3F5LA 5KSVB 4WK9A 4NXSA 3EYOA 4UZUA 1ZWIA 4AIXA 3ZKXC 2PI6A 4HWUA 1R3LA 5IESH 3PL6D 1CD0A 1VSCA 3HPJA 2QQKH 3UTTB 4LBEB 4OCWL 5DEZA 4APQB 3JZ7A 3DARA 4UNVA 2GSIB 4LYQA 5GS2H 3KPSA 4U1KA 4PLKD 1R5VB 2R1WB 2VURA 1FPTH 4M7KL 3SOBH 4ZO9A 3CFKA 3T3ME 1S7WA 3H3PL 1R3JB 3FB5B 4XPFH 3GJEB 1TCRB 3ZE0F 1ZVHA 4H5SA 4GQPH 2P44B 1HIZA 3ZT5A 4YFEA 2ZWYA 2D31A 1JPTL 5CINH 4ZTOH 1E27A 3CZKA 2HMIC 4IIQA 3KL0A 2EDFA 1MAKA 2UZXB 4B16A 5GJSH 3DMMB 4R90H 3MA7B 2PR4H 5EULV 4YLQT 1ZLUK 3AREB 4PJAB 1CIDA 3S5ZA 4PMUA 1JL8A 4Z7WA 1P7QD 2ZUMA 1TETL 2Z8RA 4MXVF 4W5UA 2BNQA 4IMKA 2VDML 4GS7B 1YQ2A 5ACZB 3MUAA 3LQAH 3LV3A 3U79A 4EDXB 1KIPA 3BZ4B 2BNUB 4JKPL 1EEUA 3AIUA 5IW1A 1XSKA 3L3HB 3UBXI 3KPLB 3ET9F 4ZEPA 2GFBA 4F7TA 3O45B 3PP4L 1VF8A 2DQTL 1MYRA 1G7JA 5D7LA 4C83B 3NZ8B 4PJDE 4JQVC 2E0PA 4G5ZH 1FYTA 1GYAA 4U6XA 3EW3B 4LQ1A 5D7SH 3OJDA 2UY3A 3V5KA 3TOPA 4PJ5B 4MQXD 4QOKB 5J6GB 4MHHG 4YC2B 1I3RA 1VKXB 4GUPB 1KB5H 4M29A 2VVSA 3JWDH 3D2UB 1KBGH 4PJ9C 4M62L 4RRPG 5E2TH 2UWEA 4NX0A 2YUVA 3O6MH 3UCRA 1A9EB 4ACYA 4R97C 3L7FB 4M1DL 1ZTXL 2BJML 5A6BD 4FZEL 2ESVA 1YA5A 1D9KB 4M43L 1C5CL 3CUPA 4JFHE 1W0VB 2JK5B 2FX9H 1V7NL 1LO3H 4JQIH 4M48H 1VFOA 2GJ6D 4QRPE 4WGWB 5FO9A 2X70A 1KV3A 3D39E 3KVQA 3DRTB 1GIGH 4GO9A 4D6CA 3BVUA 1HJSA 1FO0A 2V5MA 2FLBT 5F89B 1CXEA 1WZKA 1IGFL 3TESA 2DQGL 4Q9RH 3IETA 3T0BA 5JUEH 2IXVA 4MNQD 4PJCE 3JVGC 2IFFH 3UERA 3SGJC 1CIUA 2HVJB 2I5YH 5DUBB 1YEEL 4HDIA 5ADOH 2YLAA 3TVMC 4UOW0 3O9WA 4ZPVB 3MXWL 3LB6D 1R5WA 3F6LA 1FG2B 3U4EA 5JLZB 4GIAA 4M61B 1ONQA 5LBSH 4ZNCD 4X4MA 1UD4A 1R3HA 5DLMH 1K8DB 4P57A 2FEDC 3WLBA 3U7VA 1KPUA 3U0PA 1FDLH 1XH1A 3UCQA 1EGJA 5I74C 5IV2A 1BQLL 1UM6H 5E1AA 2R0LH 1B9ZA 2D3LA 4PJ7E 4Z0BH 5FM4A 2NQCA 4M4PA 1T4KB 4QGTA 2W0FA 3FT4A 3RA7L 3H8NA 4HPYH 4LSSL 2N7AA 4JN1H 1WZ1H 3KPTA 2N1KA 1SYVB 3IT8D 2ERJB 4QTHB 3DTXB 4ZPTA 5D5MB 5CBEB 3GSNL 3AXXA 1MY7A 4ZE5A 1HVQA 1FHDA 1KIRB 3NYDA 2XQBH 4D9LL 3BH4A 1FVCB 1MIMH 1AGBB 2FECL 1Q6CA 1QSZA 4K71B 3MBED 2ZXAA 2YL6A 2WWMD 4JZOA 3C9NA 2Y6SD 2XY1A 2VISA 4L4JA 4MD0B 3UPRA 4Z7VA 4WW1B 3VFSB 4JAMA 3RP1A 5FYKL 3VA2C 3DX2A 3C6LA 2X9WA 4LCWE 5FUZL 4GRWF 3T0XA 2HT4C 1MHCB 3P9MB 4M56A 2YHGA 3KPRE 4DEPB 4P9ML 4TSBH 5JOEA 4HZ8A 2OP4L 1A6TB 2HRPL 3IVKA 4BQ3A 3F5WB 3S37L 5T1KB 3S35L 1SMDA 1NDGA 1OAQL 4PJBA 3WNLA 3V5DA 1TZHB 1CLXA 1C1EL 4QTIL 2OR9L 5DJZA 3B9VA 3B2VH 1EHNA 1EEYB 1Q94A 3ALPA 5FOOA 5L6YL 4WI6A 5F3BA 1GGCH 3WL0A 3WS3A 3V7AE 1KFAH 1OAYH 4Q2ZB 1CDCA 2FZ3B 3T8XB 1YMMA 4XRCA 3RVTC 3WKMH 1U8KA 1FL3B 1V02A 3EDEA 4OF3A 2GJXB 3UTSB 4BKLA 3F7PC 2GTWA 4N9OB 3P4NA 3D25A 3WIJA 1IVLA 1WF5A 2JEQA 1L0PA 4WJXA 1OF2B 5IDIA 5HYQB 2P8LB 3GKWL 3VWJD 3N18A 4U5KA 1B2WL 2VQTA 3NZHH 4G6MH 3IXTA 3WS6C 4HAGA 2FSEB 3MZGB 5DVKA 1AKJA 1A9BB 2CGRL 4DTGH 1HYSC 2A6IB 2DTMH 1QW8A 4QRTA 4PV9B 3ZL4L 1AIFB 3LXBA 3BZDA 3FZUC 4JG0H 5MENB 5HI5D 3G6AA 2OZ4A 3AXHA 3S4SB 1HEZB 3OTTA 4LGRB 4DVRH 3U9UA 4BQ5A 2DKMA 5A1AA 3K2UH 4WDIA 4OV5B 2Y4SA 1TQCB 3UTZA 1OAUL 1A6UH 2DQCL 2IBZY 4B15A 4JB9H 3V7MA 1CICA 2ZG2A 2OTPA 5C0JA 2WNWA 5GRJH 4LSRL 4N90E 2JALA 3MPCA 2RFXB 1PG7W 3DRQB 4HIIA 1Q9WB 3MRPA 5DFVD 5DMYA 1V7MH 4S2SB 3LS4L 1OW0A 3NCYS 3PUCA 4RWYL 3W82A 2VL4A 4L1HA 3WQ4A 4LVOB 4POZC 4Q0XL 3IJSA 4JO1L 5HD8C 4PJ9B 2EC8A 5JMOC 3DURA 4E4PA 3FQUA 3WFHB 1W9BM 1AR1D 1C8QA 3N85L 3QO1B 4KMQA 3VJ6A 3QI9B 2A0LC 3R0MA 4NSKA 1QI0A 1R86A 5FO8A 4IM4A 2D7NA 3TO2A 1QLEL 1OB1A 4JRYA 2IQ9L 4DGIL 1UR1A 1I7UA 4W70A 1TDQA 1UM4L 4LSTL 3QUXA 4PJHB 2DWDB 4NUGL 1ORSB 4OT1L 5T1LB 3V0WL 1QYGH 4DN4H 3NDYA 4RE2A 5EU6B 2NZ9D 3KLKA 1AH1A 3UC0L 5IVXF 3C60A 3GSXB 4JGJA 4MMXC 5CKAA 6FABH 3TV3L 1MRFL 3NIGE 2AABL 4FQPA 1SY6H 4OI8A 2CBJA 2NXZB 4BSVB 4PMDA 1LO5B 4X7TA 2NY0B 1JF5A 1WBZB 4NJ9H 5D8WA 2GHWB 1AXTL 1UCBL 4JRXE 5IOPB 4RSVA 2EKJA 4M1GL 4ZD3H 1P2CA 4Y89A 3HKFA 4NZUL 2AXFB 1G94A 1Z5LB 5I8KL 3RFZC 2GK0A 1MRCH 4AYFA 2GTZA 1MVUB 1VPOL 2VWEC 3BP5B 2X6MA 5GZOC 1UB6B 1UR2A 3P30H 5DEFB 2DF3A 4NZCA 4XP1L 4TX8A 4UILL 4PJXE 4U1GB 5IMKA 3NBNA 3IXAA 3L3KB 1KPVA 5KTEH 3AIBA 1MJJA 4OZIE 3CFBA 5AAWA 4M1DH 5JA9A 3RUGE 2BJMH 2IH3A 3T0EA 3IRPX 1CLZL 1BOYA 1GW1A 3HZKA 1C5CH 4M7ZB 4UU9A 3CVHA 4YHIA 5IHRA 4LPUA 4HT1H 4MSWB 2V3DA 4OAWA 3F58H 4ZE4A 4LEXH 1JGLL 4NCC2 3HMWH 5KOMC 1JTOA 2WBWB 3ESVF 4XHQA 1FVDA 3GZAA 4E2OA 2WMGA 4Z18A 1P1ZA 1TJHH 1JRHL 3BXNB 3S3JA 3DX3A 4L9LA 3RM4A 1MQKL 3QZWG 3VXQA 2NYYC 2F54E 4GXUM 1CD1A 4XB7A 3AY4C 2OQJA 1PY9A 5T5FH 4IS6B 1JMZA 5I66A 5D1ZB 4XCYB 5BQ7A 3O2WL 3CLFL 3SKMA 5D2NB 3RWEA 3U7YL 3VXRA 5KVFH 2GUYA 3O41B 4OZGA 3WXWL 1YJDH 4RDQG 4CMMB 1AO7E 4PIRF 1CLOL 3MJ6A 3EFFB 4UBDD 1QACA 4QF1A 5AUMA 3RWFB 1O7SA 3B2UC 2BHYA 5DMJB 4F9LC 5IFJA 4E41A 2IADB 3KEHA 4NKMB 1WDPA 2IPTL 5D7KD 3KXFE 1H3VA 5C0BE 5J1TC 4L8SB 4A6YA 5TFSH 2HVKB 3KGRA 5D9PA 3OG6B 2F5AH 5D2LA 1F8TL 2XYCA 6CGTA 2XOTA 4D9LH 2I60L 3VXOB 5IFAH 1HF6A 1L7TH 4LCYA 2B1AH 4KWUA 5T5NF 3DETC 4UMGA 2Q6WA 2P8PA 1GZQB 3Q3GA 1QLFA 3UEQA 4N8CH 3QWQB 3EGSA 4K94H 1HTYA 3W0WA 4WHCA 3A4XA 4XTRD 3ROLA 2K9UA 3FRPG 4HX1B 4KKNA 4UTBL 5E7FA 1JHLH 5GGUB 3BN9D 1KBBA 1QOXA 4KK9D 3H53A 4AK1A 5D7IA 4DK3A 2AEPL 2R23A 4PLOB 4JDZB 4NBXB 4OCSL 1MCNA 3MRBB 2DD8L 1J9CT 1NC4A 3V6OE 1FAIL 3MRIB 1RIUL 3WY1A 1UJ3C 4N5UA 5EUKA 4ODSH 3T77A 1SR0A 3MV7A 1WAAA 4QHUB 1ACYL 1NC2B 3B6SB 4YAQA 4JY5H 1E71M 4FQ1L 4JO2L 2WMJA 1TITA 1OCWH 1WBYB 4EXKA 5D71L 5EO1B 1NFDA 5LG1A 4DOHE 4DWSA 3JV0A 3RNQA 2GY7B 1ZA6A 1GNXA 5EN2B 3TO4A 4E8DA 3O0RH 3MSPA 1UWRA 3OLDA 5B4MD 1IT0A 1NOFA 3CZJA 4RQQA 2HT2C 4V1DD 2ED7A 4I18C 2G3MA 2C1PA 2E9IA 1MY5A 1W9UA 4LP4A 3DX0A 2R2BB 4MB4A 1V08A 5KSVA 1VGKA 4ZS6C 5I9QC 3WKNA 5LCVH 2CESA 2JF1A 5F96L 3H7BA 4WW2C 2AS5M 3SDCA 4DKEL 4G6KH 4RBPH 1LWJA 3G6JA 3WYRA 1U36A 2VB5A 3UTTA 3V6OC 2E4TA 2VTFA 5L7XL 4TYUA 3B3IA 4ZG1A 4ZYKB 2YXFA 3QXTA 1U30A 3NIFE 2GSIA 3TP4A 1G6RL 4AZBA 5SWZD 3L9RB 1R5VA 2R1WA 1KXTB 1MF2H 2YBRB 2VNCA 3STBA 1HKJA 1R3JA 1PSKL 3GJEA 1HHGB 2R1XB 5JZ7C 2XM2A 3LHPL 3L3OB 1PVHA 2R0ZL 2E6PA 2R4SH 1KXVA 3TBTB 3DMMA 3WN6A 2DQCH 1LQ0A 1C08B 3MA7A 1O7DC 5LQBH 2ZCKL 3ARFA 1GGYA 4PJAA 5J3HD 1VA9A 2WWCA 3UXFA 3TNNA 2CERA 3PGFL 5J9PB 1L6XA 2DPEA 5FYLH 4ZUUB 2HTLD 2J7CA 5CIPB 3W6MA 4QXWA 4Q9CA 1T5WB 3SGDH 2JTDA 4FTVB 1NH6A 5ACZA 1KN2H 1GUVA 5LAXB 3EDDA 4EDXA 3BAYA 3BZ4A 1T2QH 4LKXB 2X0YA 2BNUA 4QCIB 1UWXH 1K9DA 1M7IA 3L3HA 3SE4C 3KPLA 1IMHC 2XV6B 3QCUH 2IANE 2NY6B 3O45A 2SEBB 3AFBA 2XVPA 1JI2A 1W8OA 3NZ8A 1UM4H 4HW6A 4PCTA 2ARWA 5GRUH 3GI9L 4K8RD 1MCFA 4FNLH 1WFOA 1T1ZB 4PJ5A 3RDKA 3MGOB 4QOKA 2E9WA 5J6GA 1VKXA 1ORQA 4GUPA 3PZQA 1TQTA 2HLFC 3D2UA 4M02A 2AEQH 3TV3H 1MRFH 3TA9A 1JXJA 4W86A 3O6FB 1A7PL 3L7FA 2OXGA 3G04A 3OV6A 1SVCP 2P5WB 1D9KA 4XPBH 4F80A 3Q2CA 1W0VA 4K3DL 5AY7A 2JK5A 3PL6C 4M1GH 2PN5A 2B1HL 3IB4A 3PZTA 2Z8SA 2E8ZA 1E0WA 1M53A 1OBAA 5D1XD 5J89A 3DRTA 4FQQB 4ACZB 4PRAA 5FUOH 3BSZH 1HKLH 4HJ0C 5F89A 4X5WA 2Y07L 4PLKC 3QIUD 2VABA 2NY2B 1QBBA 5ITBH 3FW6A 2YD5A 2HVJA 5DUBA 1KENL 2CUIA 2PTTB 3RPKA 1C8XA 1N26A 5CP3H 2VZ1A 4ZPVA 4B7IA 1FG2A 5JLZA 4WTZG 3BRFA 4X9HA 1HKKA 3NDZA 5KVDH 2KPNA 2QV2A 4WUKL 3ORJA 1K8DA 3KPNB 4WO4D 1T83A 3UDWA 5F7HA 5FGRA 1OAZL 1JE6A 4YHKH 2HKFH 1T4KA 6TAAA 2VLRA 3AHXA 5F9WC 1NBVL 5EOCH 3BKML 3DTXA 5DFTA 5CBEA 1G5AA 2GJ6E 5A3ID 2PETA 1KIRA 4M81A 4GRWH 5KSBB 3V4VL 3G9VA 2MPAL 1E4MM 1AGBA 3H3BC 4MNQE 5GRWA 5JO5B 3UJIH 3V2AR 1ZL1A 3QDGB 4K9EC 4ZODA 3S34L 2WWKT 3TJEL 4KRUA 3WF2A 3QEHB 3QIBD 4MWFB 5JIPA 1G0DA 1H15B 4MD0A 5EOCJ 3WENA 3BSHA 4M7JL 4WW1A 3VFSA 3FCTB 4MQXC 5HY9B 1ZVYA 4RAVB 5JW4N 3TTSA 3L1OL 1CXHA 2MNUA 4XX6A 1CG9B 2FBOJ 4TNWF 2ORBL 3P9MA 2PF0A 4R9HA 4PRWA 1IBGL 3SCTA 4AZHA 1JNEA 1UQSB 2HVMA 1ZBVA 1A6TA 3F5WA 3RWIB 4NOBA 3PWPD 5T1KA 2HH0L 1DHKA 3RWDB 1TZHA 3BPLB 5I9QB 3PZVA 4PRID 5TE7H 3O81A 3MO4A 4KK6D 1B0GB 2KUTA 3OAYH 1EEYA 4FMKA 5D70L 8CGTA 1P5VA 2Z91B 4UINL 2R2HB 3ARUA 4Q2ZA 3VXSB 5GGRY 4I1NB 3AXIA 2H41A 3T8XA 4L4PA 4HFWB 2LABA 3UTSA 4JAWA 3LB6C 1NCNA 2AEPH 1WIPA 4GKSA 4P7OA 2X8RA 3BJ91 1SJVA 3QXVA 2C0HA 4NO3B 3HI5L 1OF2A 4W7VA 3SUTA 2CLVB 5HYQA 4BUHA 2G3JA 2P8LA 4NQCD 5HHXL 3A6BL 4AMKH 4PUDA 4D3CH 5EZJB 5F1SA 1PBGA 2X2YA 5A8NA 1JZ8A 1HWWA 1A9BA 3O6LH 4PJFB 2EEDA 2JLLA 1I1RA 3WXVH 1FL5B 2A6IA 2VX7A 1V3MA 4XNMB 5DTFB 1A4JB 1AIFA 1KNOA 5HYJE 4XCCH 5MENA 4PYHA 5KSUB 2ADJB 3NCOA 4HUKB 4M80A 3S4SA 2L7JA 4DCQB 4CAGA 3ZKND 4UUJB 4B5EA 1D2KA 3MBEC 3EJTA 3QHZL 4OV5A 2Y06H 2QQLL 1JPFA 2WWMC 2YUXA 3SEPA 3OG2A 1MFAH 2E7MA 1UCTA 2QADD 5I1EH 1CS6A 2WC7A 1AXSA 5DK3A 3ZTJH 2GYSA 4WEBL 3Q6GH 3U36A 4UTAL 5IHSA 4HK3N 3D3VB 4PGBB 2F9BT 2AJUL 1W0YT 1HSAA 1Q9WA 3AU1B 4X6DE 4NWUL 2VZOA 5J13C 1Q8MA 3TZVD 3QZWB 2YDSA 1ZKAA 4PJ9A 5CGYD 5KANG 5IVOA 1DCLA 4NNPL 3WFHA 4GXVL 1MFDH 3QO1A 3QI9A 1S7TB 2P48B 2H26B 4DK6A 1T7YA 4IRJC 4KI5D 3BDYL 1TNMA 1IAKB 1T21B 4AD4A 1G7HB 1LEKB 4J6RH 4OZFH 2EABA 3ZM8A 5JPNA 4PJHA 1NFIB 1BAFL 2E3ZA 5T1LA 4HKBB 4LHQB 4J23A 3IANA 3S5LG 1DQLL 1V3KA 3GIZL 4J28A 4X8XA 5HGGS 4PJEF 5EU6A 1J1PL 5J4MA 1I3GH 3AMGA 2OJEB 1HJWA 3GSXA 4NRYB 4OJFL 3SGJA 3RX5A 4KK8D 5ESVB 4BSVA 5E5UB 1JXKA 1LO5A 2O5YL 2J1KA 1PQZB 1WBZA 1WFNA 4ZFOL 1UG6A 4TXEA 1M7XA 3BLPX 4CN1A 4PGCB 5BVPH 5IOPA 1MFEH 1ZS8B 1RPQA 1MJ8H 3IAPA 5A16B 3MODH 4G9DA 2YS4A 5EBAA 4Q9BA 1XCQB 3CU7A 3CH1B 4HTYA 3CV5A 4JFDD 2DDQL 4KHXL 2FWOA 4JM2D 2XFFA 2YN3A 4MAZA 4PGZA 3NN8B 1GAFL 3DO7B 1MVUA 3BP5A 4W7UA 4I77L 1UB6A 3O3UN 2W9DL 5HI5C 2BRRH 3JWOC 4QRPA 4K3EL 4ZO7A 5E8EA 5HVGB 3D18B 4M03A 3OXRB 5A69A 3DSNA 4F9DA 3MRDB 1IQWL 3WD5H 1E3XA 4EOWH 2X4NB 1H9VA 1ZJBA 2BSSB 3EHBD 5B8CB 3TBYB 5I1HL 1D5BB 4MSWA 2WYSA 2OLDA 1JGVL 2X4SB 3EOBB 5ERWB 5HYSB 4LXFA 3FFDB 4MB3A 1N6VA 5T1MB 3K1DA 1HHIB 4ODUB 1Z0NA 4NZRH 5DRWB 2C7UB 1KCVL 1HZHL 3HZMB 3GBMH 1NL0H 1Q9OA 2BSTB 2DL9A 5KZCB 1H11A 2LTQC 5A2KH 1WIOA 2BVQB 2WWKO 2OWCA 4N8PA 1U3YA 3HE6D 3ALXA 3HUJE 5D1ZA 1AR1C 4PJ7A 4XCYA 4RMQA 4HIEB 2JEPA 5D1QD 3DUSB 5D2NA 4OIIL 3O41A 4WUKH 4CMMA 1OT2A 3EFFA 3CHCA 3RWFA 4V27A 3QEGH 3KAAA 1OAZH 2DBLH 1F42A 1U8JB 4NKMA 4Y5XC 2J12B 3VRLE 4HUWB 3WDJA 4EJ1C 4L8SA 2W0PA 4HZAA 2EE3A 5L0QB 2HVKA 1KT2B 4XC3L 4XV0A 4MAYD 4KXZH 3KPMB 3PZUA 4WSKA 3VXOA 2WMIB 2J7HA 3WF4A 4P4KD 5E2UL 4R4BB 1TG7A 1GZQA 1MFBH 1F4HA 2X5PA 2EPKX 3FHAA 1HL9A 3WS6A 4F7PB 2NY4D 1X4XA 4O4YL 4LMQI 1JDCA 4F8TA 2DEPA 1P4BL 4HX1A 4K9EL 5K59E 1EOKA 3L1OH 1N7ML 4K7PX 2PWGA 1Q9KB 3IFLH 1JP5A 4LCUB 3SDXB 2VDOH 1YEDB 3SUVA 3LVEA 4JDZA 4BSWB 2EEAA 4WNQB 3MRBA 3MRIA 5D7KE 4CCDA 2QEJA 3RZCB 2OR8A 2G5BB 4QHUA 1NC2A 3B6SA 2VXSL 1WBYA 1ZBKA 1RIHH 5EO1A 4Y2DD 1T66D 5D7JB 1IC7H 3N9GL 4E9LA 1IC4L 2IBBA 5EN2A 3AIVA 1QRND 3IGAB 4M00A 4PJIE 2YSSB 4A3HA 5CEZD 1MPAH 3IKCB 5IUSA 4QXUL 3QHOA 1F3DH 1T3FB 4OZHE 2NW2B 5C2BH 1HKMA 5EB9A 2EDBA 2R2BA 1F4AA 3QP3A 4MNMA 4U1HB 5KW9L 3MX0A 2MFNA 4N0RA 3T1FB 1KXHA 1G0CA 1HQ4B 1NLBH 5FYJD 3A6BH 1NGPL 4UBDC 4OGYL 1E4WL 2ZG3A 4YDIL 3N17A 1ADQH 2DLTA 4IRJB 5HGHB 4QAWA 4M3KB 5F1IB 4F66A 4ZYKA 5DXWA 1F3DJ 1MREH 3ARXA 4TUKH 2FGZA 3WD2A 2V5TA 1CECA 5ID1B 3BKJL 3HC0B 2YBRA 3KE0A 2A6KB 3IDJB 1R8LA 1ZA3B 4KJWD 1HHGA 5GGTA 2R1XA 1NCDH 4O02L 2MQ0A 1BGGA 5CILL 3VRLF 1B6UA 3L3OA 2H1PL 1DBAH 3FRUB 3QHZH 3VA6A 2QQLH 2CK0L 4M6AA 3VI3E 4HFUH 4UT6H 2ADIB 3VGGA 2LVCA 4N1CA 1C08A 1QA9B 2B4CH 2NY7L 4V1DE 1ZB5A 3ROOB 4XTRC 4J3OC 1P84K 1JYVA 1AGFB 1S7SA 1VESA 5J0BA 4OLYH 3WELA 5J9PA 5DA4A 3FL7A 3SBWC 1QNSA 1OTTC 4ZUUA 3BN9C 3L5JA 4NWUH 5CIPA 4KK9C 3IS1X 1KC5L 1T5WA 1KOAA 3EOTL 2WKGA 1V3IA 1A02N 1MI5B 2WPGA 1Z9LA 4UAOC 2A77L 5LAXA 1J88A 3LIZH 4QCIA 2G60H 3MLZH 5T3ZD 2CKSA 4K68A 1PG7X 3CK0L 1XF5B 1NPUA 3VGDA 5E94B 5SWZE 4JLRB 1HINH 4YBLB 5GJTH 4GRMA 2SEBA 2Z31B 2VLKD 1BFVH 5KG9B 4H20H 1BAFH 5C09D 4PD4J 4Q97A 1T1ZA 2XIIA 2J88L 1F2XK 3KJ6H 3EJUA 3MUY1 1FJ1A 2QTEA 3GIZH 3MGOA 5B4MC 1GQLA 4JANB 1RZ7L 5DHVH 2DLFH 5B39G 1R6VA 3BOVA 4H41A 4OJFH 5HDLA 3FO1B 3ZTNL 2PKDA 4TQEH 2R56L 1D5IL 3O6FA 1INDL 4ZS7L 2M1KA 2O5YH 1US2A 4S1SL 5BVJB 3DIFB 5DQ9B 4KTEH 5F7NC 4XAWH 3QWRD 4FN0A 2WANA 1LWRA 1ZT1B 2VXVL 1RZJH 1RUML 4FQQA 4TOYH 3QFDA 5DZNA 4ACZA 1X5XA 3P77B 2UY5A 3VRIB 2BXZA 5FUCE 4WWKD 2XFYA 2FJHA 5CGTA 1FNSH 3PIQB 1OAKL 1OARH 2PTTA 1HP4A 4I5BA 2D03L 3TGXA 2GSGB 4QHNB 3DVFA 3SGKA 5EU4B 4AISA 1I1XA 3F12B 4P46B 1AQKH 4QNPE 1WKYA 4JFOB 2D7OA 2X1QA 3T0AA 3KPNA 4WY7L 1FORL 3WH7A 5J3HC 3DYPA 1JGIA 4PGEB 1KCVH 5ALCH 1NEZG 3QPXL 3BVXA 2HTLC 2ZE0A 1YEJL 1HSBB 4JFVA 4RL3A 3PWJB 4ZOBA 3VI3F 2YKLH 3AMCA 1XYZA 4J3XA 2I27N 3ZTJG 4ERSH 2JCCB 1FHLA 2CKRA 1MFNA 1LDSA 3E2HC 5FUCC 2DT1A 4XC1L 5KSBA 3D5OF 4AEIL 4MYWB 4Y4FB 4IISA 3MCLL 5CP7B 4YHMH 5C0BA 2EIEA 3PHOB 4HZ7A 5FGBC 4XHJD 3QDGA 2X1PA 1UJ3A 3GSRB 3QEHA 4I8DA 4QRQB 4CU7A 2JB6B 4MWFA 1I9RL 1H15A 4PY8I 3L4TA 3RKDC 3K3QA 4AWEA 3FCTA 5HY9A 1W2PA 3TIEB 4NC0B 2YD1A 4RAVA 4DGVH 5IM7A 3RJXA 1B90A 4OZFG 1CG9A 1X6LA 2ZXDA 2GSJA 5A8PA 3QIWD 5BV7C 4XC3H 3M8OH 4HS3B 1UQSA 1FE8H 1V0KA 1E6SM 3RWIA 4AH2B 2APFA 3DX9B 1LO2H 5DK2B 5DFWH 3I3BA 4R8WL 3RWDA 4JVUA 3QDMD 4JKMA 4K7FB 5IHZB 3NGBB 1R7AA 3BWAB 3E1F1 2VN7A 4RBPK 4CADB 1B0GA 1DR9A 3TBVB 5DHXB 2VSCA 3PWVB 1OP5H 2YFOA 4OUEA 3HNTH 2Z91A 1G0XA 5FA3B 1IM9D 2R2HA 1C12B 1I1YA 3QIUC 5ICZB 2Y36L 3V6OA 5HHNB 3S5LB 3VXSA 4HU0A 4P7NA 2EDHA 4D0CB 1MJUH 2DLIA 1ZEAL 1EFQA 2W9EH 4HFWA 4OI9A 5DURD 2AJYH 5EO9A 4BZ2L 5AYUH 1VBRA 3HG1B 1A2YB 5LA1A 1JNLH 1FGVH 4NO3A 3LEYH 2CLVA 1K4DA 2BVTA 1LEIB 1CFVL 4S1QL 5CPSA 3HG5A 4WO4C 4CMHC 4Y2OA 4O58L 1AI1L 1BX2B 1WDQA 3U9PL 1BEYL 1CLVA 4PJFA 1WGOA 2YA1A 3OKOB 1FL5A 5I23A 4RFNC 2OMNA 3PWPE 1BZ7B 5A2AA 4XNMA 1IKNA 1CXIA 1A4JA 2HJLB 5A3IC 4G6FB 3IFOB 4RA0C 4AQ1B 4PRIE 5DD3L 5EDXA 5KSUA 4C57C 5E8PB 2ADJA 1RURH 3BAEL 1IGML 1ZT4B 2E7BA 3EYSH 4DCQA 3T08A 5KW9H 1WQVT 4DZBB 4UAOB 4UUJA 1UWXK 3KYKL 4GO6B 3BZEB 3QIBC 4R3SB 3VFTB 3FO2B 5LXGL 1QTYT 5F9OH 4LHUB 3IU4L 4KRLB 4R2GD 1V0NA 4BZ1L 3GXIA 2HRLA 5EO0B 7FABL 1W9PA 1D6VL 2V3GA 4GXPA 4XPTL 4YDVB 1SBSH 2P7TB 3D3VA 1Q6DA 4PGBA 5E2VL 4L4TA 1HL8A 3AU1A 4Y1AB 5ILTL 5H2BB 5T5NG 4H8WL 4NQCE 3BKJH 5C0ND 1MEXH 4KTYA 1JK8B 3F7VA 4NHUB 3VG0L 4UFJA 4NT6B 2C26A 3T04D 3ZQ9A 1LVEA 3MLXH 3IDIB 3NIDF 5CILH 3LRHA 2EE9A 1GGIL 5B3JE 2WUCL 5EZIH 4KJPC 5ISZB 1S7TA 4N0UB 1BVKA 4G9FB 3P3YA 3L4VA 2H26A 4N0YL 2P5ED 2J7GA 1T21A 4LRIA 1LEKA 1C5DB 5DQJB 2OL3L 1NFIA 2XXCB 3CXHK 3VXNB 4HKBA 1L4IA 1UWUA 3MS8A 3VW3L 3EYFB 4HXBH 2J7BA 3WUEA 2E27H 3MLSL 2YK1L 5AZEH 1W1YA 3FOMA 2IANA 1U8PA 2ZPKL 2OJEA 3TA3B 3EOTH 4NRYA 1F4YL 1TMCB 1MJ7H 4ZAKD 1EBPA 1IGYB 1PQZA 4AD1A 2BFVH 3CK0H 4LEOB 3UJJH 3V6BR 1ZK9A 4PGCA 5DRZA 5BXTA 1ZS8A 2H8PB 1E6JL 1KLGB 2AV1B 5A16A 4NM8H 1W0WB 4DZ8B 1RZFH 3NA9H 1XCQA 2UZYB 3SDDC 2J7FA 3GSOA 4FQXC 5IHUH 3CH1A 2FBJH 4EN3D 2V2TB 1ZHKB 3JV4B 2AW2A 1R47A 3NN8A 1GJUA 4GI9A 1V3HA 1MFCH 3D18A 5TDNA 3OXRA 4LGSB 4KI5E 3ZDZE 3MRDA 2YZ1A 2QHRH 3DV4B 1INDH 4LSQL 3ZKNC 1QWUA 3KYNB 2ZZUT 1MQQA 3PV6B 4QRRB 2X4NA 5LGKA 2YZ8A 2BSSA 5DQDH 5B8CA 3TBYA 3NCJH 1D5BA 3DJ9A 2X4SA 3CZFB 5GS0D 5HYSA 2QADC 5ABHA 3FFDA 3ARGD 3L7EB 4LCCB 3TN0C 4M9OA 3ECQA 4XNXL 4Z7NF 5T1MA 1A3HA 1HHIA 1QI3A 4OD2B 2C7UA 3AHTA 3HZMA 1FZOB 2EIDA 2BSTA 3U0WL 3WV0A 2Y2WA 2J78A 4TPRH 3BESR 3TZVC 5CZXD 5HGAB 3C5ZD 3QFJD 3KHQA 4XBGA 5CGYC 4N9GB 3P0GB 2BS9A 4JFDE 4JR9H 3P0YH 4HIEA 5A6BA 1J1XH 3WJLC 5K33A 5GPRA 1IV8A 3DUSA 3X3FL 4HMCA 1DBMH 5FK9B 1EBAA 4KI5C 3WIIL 3DHJA 3DXAD 4OV6F 5D6DA 4MDJB 3I9GH 2RAMA 1T20B 3OAYK 5HHMB 5F3HA 2F58H 1KGXA 1U8JA 4GG8B 5A40E 1RUKH 3WFLA 5EOTB 4HUWA 4GSDL 4P3CL 1R85A 1KT2A 5GQBA 4KK8C 2O9OA 3CZLA 3AQUA 1FC1A 3SDYH 1RU9H 2F18A 2WMIA 1OTSD 3QUML 3MRRB 1IJ9A 1Z0MA 2NW0A 3RY6C 5FOBB 4JHWH 4R4BA 4MJIB 4GRWB 4KUCD 4S3JA 3ZKSD 1FVEA 2FATL 5HVHB 1GOIA 3W27A 3KPQB 3UPAA 4JM2C 4F7PA 2R0WL 3TC9A 1V6WA 3DHPA 3AROA 1JDAA 3Q5YA 3CDCA 2JB5L 3CCHA 1Q9KA 3DUUB 1MCOL 1WO2A 4DUWA 4LCUA 3SDXA 1UGNA 5CJQL 1QFOA 3MKKA 4RFNB 4K8RL 3WEMA 5IJVA 1DP0A 1WEJL 1YEDA 4EKJA 1RVFH 2X9YA 2DQFB 4N1EA 2VDLH 1HX0A 2H2PC 3LDBB 4WU5A 3FB8B 3EHBC 2WP3O 3DO3A 5IGXH 5BV7L 4AD0A 5A2FA 3EDKA 4CCCA 5E1QA 3RZCA 2G5BA 4UB0L 1PS3A 1QHPA 1KCUH 4I3GA 4P2QB 5D7JA 5MEPB 1QP1A 1C8YA 1D5MB 5HHVH 1HN1A 3IGAA 4G6JH 4FQHB 3TBWB 5B39B 3GJFH 5CLWA 3IKCA 4YHOL 3HE6C 1T3FA 5SWSD 3LD8C 2NW2A 3BH9A 1PX3A 1G9NC 5D1QC 4U1HA 4F15C 3HG3A 3M7SA 1JFQH 1FBIL 3T1FA 1XFPA 1HQ4A 1LD9B 1CFVH 5GNXA 4H2CA 2MCPH 3OXSB 5HYJA 1RZKC 4D9RE 3LKQB 4EI5B 3HFML 5C0DB 4IRJA 1BEYH 5HGHA 2YD2A 5I78A 3EJQA 1XRVA 3W2DL 5JW5A 1N8ZA 3M6DA 1EJ6A 4IPNB 3VFOB 1DQTA 2AJSH 5CCKL 5FF6B 5ID1A 3HC0A 3ARYA 2A6KA 3IDJA 4C4KT 1E6NA 4RFOH 3CDFA 4YHNB 1G7LA 2VXUH 5DO8A 1ZA3A 3DECA 1W1VA 3P9LB 4Z6AT 4QP0A 3WBAA 3AS1A 4WHYH 4WTZA 4Y4KD 2R4RH 1K85A 2WINA 3FRUA 4P4KC 1LP9E 1QRNE 3LZFL 4Z78A 5CBAA 5CEZE 4MNKA 5E6ZA 1JPSL 1MFUA 2MQ3A 1IGJB 5DUPH 3LKSB 1QA9A 2NY4C 2GQHA 2XN9B 3ROOA 4BSJA 3SIMA 1AGFA 4E8CA 3SDDB 4FQXB 1XHGA 4OIBA 2AEIT 5M7QA 2IPKB 1NQ6A 1G7IB 4MZ2A 4H8WH 5FYJE 1CGSL 3VXUE 1DN0B 3KPSD 1MI5A 4XPHL 4JPIB 2O5ZL 1BVLB 2PXYB 1XSJA 1A1NA 1FIGH 1TQBB 1GGIH 5JQ6H 3MSDA 1XF5A 5I76B 1M71B 4Z2IA 4JLRA 2ZUUA 1BD2B 1BAGA 5IVXB 4Y2DC 1T66C 2Z31A 1QUNA 1CLYL 1E6OH 2A38A 5KG9A 3TN0B 4JPKH 1GGTA 1UZ6E 4IPLA 5M03A 3BEWA 1VGEH 4JANA 5ELIA 3SO5A 2YK1H 1DQDH 3NH7H 3ZJ6A 5E5MB 4GJTB 3GGWB 3LY6A 3FO1A 1TLKA 2BNQD 5C07B 5BVJA 3DIFA 1OB0A 2XKSA 5DQ9A 4RGND 4AT6B 1I85C 2CNCA 4AD5A 5JIWA 1ZT1A 2E9JA 2DLHA 1U8MB 1RI8A 2WMPA 5D7LD 3LS5L 3VFPB 1FYTD 4BM7A 4GZIA 2Y1VA 5T3ZE 2F8OA 4PBXA 4WI8A 1BZ9A 5FAAA 1K3ZA 4YZFE 5EZOL 3PIQA 3MUGB 3AIEA 2Z8WC 4X7CC 3BMWA 4JQXA 2GSGA 2CDFB 2HKHH 5TE4L 2VLKE 5EU4A 1BGXH 1NDMB 2M26A 3WSQL 3LPWA 1E55A 5C09E 3HE7B 1XH2A 4F33B 3F12A 4X98B 2ESVD 2DGAA 2UYLB 4JFOA 2UV3A 2V5SA 4MNGB 3PTMA 3IFPB 2J8UF 1OP3H 3WNKA 3MUIA 4M9PA 1S9VB 2XNAB 4NN6C 1V5JA 2F5BL 1FC2D 3RBSA 1HSBA 1HCVA 3UBXG 3PWJA 4NNXB 2W1NA 3D0VB 1DWHM 3WFDL 2CJUH 1C93A 1G1YA 5EU7E 3II1A 4HHAB 2UY6A 2V5YA 2WLYA 2OSLB 4Y4FA 3DV6B 5CP7A 5T33L 1V05A 3PHOA 2AI0L 5DA0B 4F37F 3EFDL 4GKNB 4S0SD 3RL1B 3VNYA 1G9ML 4BQBA 3GSRA 1JTPA 4GRLC 4QRQA 1UD3A 2JB6A 3GRWL 5I1KL 2V17L 3LEXB 2XPGB 1AC0A 1YPZF 2WZEA 5I2UA 3OIHA 3TIEA 3BVWA 3O2DL 5TQ0H 3PABA 3VMNA 4JGUA 4P3CH 2F61A 4PUBH 1T2XA 4HS3A 3CXDL 1U9KA 3IJYB 5SX5K 4H8VA 1B3XA 5C08B 2VZUA 4JM4L 4H25A 5EIIB 3BVNB 1QVOB 4AH2A 4TSCH 3DX9A 5DK2A 2B0SH 2OI9B 1MHPH 3DX7B 4K7FA 2Z9TA 5KJRL 1DQJB 3BWAA 2OX5A 2XT1B 4CADA 4PB9H 2FATH 1G7PB 4WHTA 3TBVA 3W53A 2QPUA 2ARJQ 1JNNH 1ZAGA 4ODVL 5FA3A 3QBTB 5ICZA 1C12A 4WWKC 5HHNA 1AMYA 4D0CA 3C6LD 1FOBA 1NAML 4HOWA 1HDMB 4K8RH 1CBVH 2V5CA 2KDGA 3SUUA 5DJDB 3HG1A 1A2YA 5IB4A 1U3HB 5C0EB 3MRFB 3THML 4CU8A 4XCFH 3W26A 3MU7A 4PJIA 1S3KH 1T1YB 1U0QA 1NCUA 1LEIA 1UZ8B 2FJFB 2OL3A 3VI4E 1C90A 2W61A 5CD5D 4LVEA 1BX2A 2ZICA 2PTUA 2D9CA 1JHKL 2C7FA 3MJ9L 3S98A 3UG3A 4K23L 3QQNA 3OKOA 5BRPA 4YDKL 1J87A 5D96B 1BZ7A 1FLRL 1AHWC 1S9KC 2HJLA 1KLUB 5F7DA 3QDME 3SBWA 3QCVH 5HOSA 3IFOA 1YMMD 4KRNA 1CLCA 4D6EA 1ZT4A 3QNYB 4DZBA 2GCYA 4XHJC 1PKQE 3BZEA 1I7TB 1I7RB 4PJGE 3MLUL 4R3SA 1IAIL 3FO2A 3VFTA 5J11C 4LHUA 4P23B 3NAAH 1G9NL 5HHQB 2OWXA 1R24B 2AEWA 5D6CB 5EO0A 4MTVA 4YDVA 5E95B 2P7TA 1KJ2L 1AKJD 2YFNA 2ZUQC 1RZKL 2V9TA 3X3GH 3QIWC 1TPXB 5H2BA 5CCKH 3CFEB 3U2SB 3L4ZA 2JIEA 4Y19B 5CPQA 4PRDB 4QHKI 3RTQB 3WN5C 4X7EC 5E4EB 1F3JB 1QSEB 1JK8A 4NCDA 3FN3A 4NT6A 1IGIH 1E56A 3IDIA 1IAMA 1XH0A 1MQ8A 4KV5F 5A6MA 5DHYB 4G9FA 3BP4B 5C6PB 1JD9A 4RNRB 3BD4A 5D72L 3UO1L 2MKLC 4JDTL 5CZVL 5HDQL 5AD0B 1C5DA 3OAZH 4Z2KA 1PY4A 2OR7A 2XKUA 3TFKD 3EYFA 1YNTB 1PGRB 2Z35B 4AM0B 4UT7H 1IC5H 3MV9B 4J4PA 3PWNB 3QUYB 1GHFL 3A67H 3F5JA 3TA3A 5DK0B 1X5GA 5IQ9B 4X6EB 2XHYA 2P8MA 2GT9B 1B31A 1LF1A 5DVLA 1F6AB 1OP9A 1IGYA 1QBLL 5D93C 1OTUD 4LEOA 4YPJA 5MP6H 4DVBA 4LASH 2H8PA 1KLGA 2AV1A 1KGUA 3WF1A 1W0WA 1FSKC 4AY1A 4ORGB 2V2TA 1BTCA 3HCVB 4MNHB 1ZHKA 1OQOA 4NQED 3SQOL 4JRYD 5LWYL 3CHFA 3HA0A 4JHOA 3VGFA 3QUXD 5KS9F 2ZIDA 1U2HA 4PS4L 2HT3D 1XGYH 2W07A 3F62A 4PPTA 4U0RB 4LFHD 1V0MA 1NMAL 1MCPH 4LCIL 2P5EE 1MQPA 3Q0HA 2M8XA 2YRZA 3V0VB 2OSXA 3GNRA 3C60D 2FEEI 5AEAA 3KYNA 2VVNA 5CEZL 3PV6A 5DHVB 1WSST 4HIJB 2AJZB 4QRRA 1RJZA 1EIBA 1SJXA 4RMWA 4URTB 2F7OA 1E9LA 1S46A 3ZLQC 3WD0A 3CZFA 1CU4H 5HYIA 3L7EA 2NY1B 5JOFB 1QFWI 1WFUA 4BK5A 4Q6IC 3P11L 1RIVL 2BC4B 2J3SA 5FXCH 3ULUD 5EFIB 4HC1H 1FH5L 5FYJL 4P5MB 4OD2A 7TAAA 4GRLB 1CXLA 3CZSA 4H8HA 5BCAA 1NM9A 1R3KB 2VCAA 5CD3B 1EJOL 3OJVC 5C0NC 3ALFA 4O2EB 4TSAL 5HGAA 1IT9L 15C8L 2F7RA 2FNBA 2VL5A 4N9GA 2D1ZA 3VXTB 1HKFA 3HNSL 1U8QB 4OIAA 3T0ED 4X7FC 5FK9A 1P7KB 4HBCL 1OHQA 1UD5A 3VIKA 3NCMA 4ML4A 25C8L 2FD6H 3LCYA 4WHYG 3RWCB 1XSIA 4P2RB 1LL4A 1F4WL 1OP5K 3BGMA 5DT5A 2JJWA 3MRCB 5JW4R 5GZND 4GG8A 5F7KC 1VERA 5EOTA 1LL7A 3WDHA 3TYGL 1Z9OA 3WHE1 5D4QA 3UTQB 1WNOA 3QIUA 4J8RB 4AZ6A 5HGDB 3PJSB 1IKFH 4ZAKC 1EH9A 5MEQB 1W3JA 5F6IC 1KEMH 1XT5A 4UV7L 3V4PL 4NBYB 4JPWL 1T04B 4B3LA 3NIYA 2X05A 2AI0H 2VX4A 3WFBH 1QI5A 4RGMC 5FOBA 2NNAA 1G9MH 1EHLL 4MJIA 5T3ZL 5I1DB 4EN3C 3VXRD 4HIXL 2E7CA 3W24A 2C3GA 2NY5H 3QFJE 2XVNA 2ITDB 4PMVA 1E28B 2ZX8A 3GBNL 3O2DH 1QLRB 4E41D 1NCCL 1C5BL 3DUUA 1KBKA 1AGDB 2X40A 1A5FL 1A6ZB 4KRPD 4ODBD 2ZWLT 3VFGL 4ZQKB 3KPPB 5BRZB 1AHWB 3DXAE 4C55A 2PO6D 4GKZB 3MYZA 2DQFA 3FB8A 4D0DB 4NHCH 1IM3A 1INEH 3ELAT 4I2XE 4UV4H 4JFTA 1WBXB 5EFDA 4NN5B 4OM1L 4PB0L 1DBBH 5F7YC 3NABL 4DFIA 3UR7A 4FNSA 3VXMD 3BIAX 3CPUA 2RCSH 1EZVY 2V7HB 4FABH 1D5MA 3KLAA 4OF6A 4AD3A 1KXQE 2YC1B 3W0WD 2OXHA 3CVIH 3IJ8A 4FQHA 3TBWA 2YPVL 3SE3C 3C5ZC 4HWEH 3ZJ7A 5EORH 4AYGA 3IF1B 3WN5B 2CKBB 3LH2H 4XXDB 4JG1L 3THMH 2YUWA 4D6HA 4U49A 2CBVA 4I0PD 5EUOF 3WL9B 3VFMB 1UASA 5DEGB 4BFBD 4GAGL 1PKOA 3MOAL 5FKAB 2DKSA 4YE4L 3OXSA 1U92B 3AHVA 2AJVL 3LKQA 3MV7D 3CUHA 1YNKH 3QO0B 1BBJB 5C0DA 1BQHG 3NCFB 1OIFA 1EEQA 5CSYA 4DWSD 3VFOA 2LAGB 4N68A 3PZOA 3LQZB 4Z7UE 5FF6A 5HTSA 3I3EA 3UG5A 3TO4D 4XBEH 4YHNA 1OGAB 3GIVB 4C56B 3TCXA 4LU5H 4GMSL 1OTSC 3P9LA 2JIWA 3NCEB 1H1NA 2J2ZA 2EDRA 5IB5B 2WIMA 3D1MC 5HJ3B 5I17B 3J7HA 2IFGA 4R7NB 2ESCA 1TZGH 1XD1A 2XN9A 3OKKB 4LDEB 5SWSE 3SDDA 3UTTD 4HBQA 4FQXA 3D5HA 4APQD 3UBXB 5LGHH 2IPKA 3O6KL 4X6CE 1G7IA 5SX4I 5KANI 5SWQB 1ZANL 4JPIA 1NJ9B 4F57H 4H8UA 2DB8A 1BVLA 2PXYA 4W6XB 5BW7A 2ZUWA 1E43A 2WNGA 2FECI 5IK3B 3QXAB 3WJJA 5I76A 1GC1C 3P0VL 4PJEB 3H55A 4IJ3C 2VX5A 2ICCA 4F7MB 1BD2A 5DD5H 4X4YB 4ONOA 4JDTH 2JFEX 5IVXA 4W81A 5E08L 3MREB 1XGUB 3DMMD 3Q48A 4U1SB 3TN0A 4Q6IB 1DTUA 4NO5A 1QHOA 2B2XL 2VDNH 2XA3A 4R4ND 3FQXA 2MJWA 4UDTB 1VFAA 1WZAA 2H45A 5E5MA 1Z6JT 3GGWA 5BXPA 3FQRB 1TJIL 4DKFL 5I8OH 3NFSH 1KWKA 2CRYA 4AT6A 1FZMB 3WIHL 5E7BA 4BFEA 4XB8A 3BW9B 3WJLA 5DMIL 1PLGH 4IHOB 1U8MA 4KUCF 3KPSE 2HG5A 4XWGH 3HJEA 4NZTL 2VR4A 3CLWA 5A6JA 4ZFFB 2WMKA 3RM8A 2MOVA 5I30H 2EICA 1KCKA 5HDRA 4QT5B 3OAUH 3GXMA 1NFKA 4PJ5D 4QOKD 3MUGA 4LCIH 1EXPA 3T4AB 5DMGD 3FFCB 3D2UD 2G41A 1W72H 1CGYA 4Y4KC 1NDMA 3E3QE 4S11A 2HA1A 5JUVA 3QGVA 4KTDH 1ZHLA 4F33A 1N82A 1UACH 3GSQB 4X98A 1D9KD 2UYLA 2EDLA 1DJSA 3WL1A 5DJAB 4YJZL 4MNGA 3IFPA 4Z7WE 3WCYA 2DLGA 5HPMB 2VRQA 1FH5H 1S9VA 3BIKB 1TQVA 5FYKD 3FOLB 2BNQE 1NAMA 2J6EL 5FM5M 3WIFB 3SUSA 4W85A 4RGNE 4NNXA 3D0VA 4OUUB 5IBTH 1QEWB 2J5LB 3ZE2F 1GJIA 2WCAA 3IGUA 4HHAA 2FX8H 3QNZB 3PF2A 4CJ1A 3EOAB 1H3PL 2FO4A 2ED8A 1NCTA 3DV6A 4RZCA 5D7LE 2AK1L 4F58H 3PTKA 1FYTE 3REVB 4QRUB 1BF8A 4GKNA 3RL1A 3FB6A 3LQMA 2XWDA 1CFNB 3HLAB 2DMBA 3GH7A 3E3QC 2R0KL 1JN6B 2RBLA 2VC2H 2VJXA 4HWBL 2YUZA 3DPBA 1CQKA 3GMRA 3EO1B 4IOIB 3BRGC 1J8KA 2ESVE 1AY1H 2QPSA 4DJMA 2F1BA 1AJ7H 2WK2A 1QBML 2VXTL 3IJYA 1QFUL 3RJQB 4RGNC 3SJVB 2YOCA 3BVNA 4M93C 4P2YA 4I0KA 4KVNH 5A8MA 1A7RL 3CFCH 3DX7A 5JPMB 1H5VA 1J0HA 1KTKE 4U4BA 5T3ZH 1DQJA 4HIXH 3ZDXE 1G7PA 2DQEL 1HNGA 5CUSH 4QGYA 4K7PL 4H04A 1C5BH 1UWEH 3OR6B 1W3KA 1ROWA 5JW3H 1A5FH 1U8IB 1HDMA 5A8QA 4X4ME 2BVUA 3OLEA 1FNHA 2BY3A 4TUJB 5DJDA 3S36X 2NW3B 1U3HA 5C0EA 4JL1A 3MRFA 2ZJSH 3O3AB 3GNPA 1KCLA 1KGCD 1T5XB 1DSFL 5DVNA 5L8KB 1DDHB 5BOPA 2QQNL 1T1YA 1FFNB 5T1KD 4GFTB 1UZ8A 2FJFA 4OM1H 4G80B 1TQWA 3TT3L 2V38A 5ABGA 1JVKA 2BY2A 4UNUA 2R69H 4YK4C 2HAZA 1NWTA 4YXLH 4FFYL 5FKPB 5E24E 4OFIA 4GG6F 1H0DB 2HFEB 4Q6YA 1Q9LB 3IDXH 2R8SH 1NGQH 3OGOE 3UTSD 2C3VB 3BD5A 3QNYA 3RDTB 5IHLB 3GJFB 3C09C 5FHAH 4L5FL 3L5XL 4HPOL 3CLEH 4Z7VE 5HGBB 1I7TA 1VADB 1I7RA 1S9YB 5H8DA 4ODTH 4FZ8H 1YYMH 4P23A 4WKFA 3MNZB 3V8OA 5HHQA 1R24A 5D6CA 4IJ3B 4XWOD 4JFPB 1ED3B 1SHMA 3NCBB 3RVVD 3Q5OA 4H1LH 4GAJH 2VH5H 3AS0A 3H7LA 1LP9A 4NWTL 1EUUA 1JRHI 3BE1H 1ADQA 3CFEA 2NT0A 1PFCA 2JF7A 1J05B 4PRDA 3RTQA 3UETA 1U6AH 1QSEA 3TWCH 4MDIB 3KPOB 4NUJB 4GMSH 3V6FB 5MEND 1E0VA 1OPGL 2XZCL 1TTGA 2UWEF 1KELL 5F7EL 5IJKC 2XWTA 4XNUL 5DHYA 4D94A 4PBWD 2GAZB 3B9DA 3BP4A 4M6NH 4YUEL 1W91A 4RNRA 3VXUA 3RIKA 2JJSA 4OZ4B 3S88H 1ZVSB 5AD0A 5BRQA 2VDKH 3VIIA 1M6OB 1Z3GL 1YMME 5C0FB 1I7ZB 1V02E 1T0MB 1YNTA 4NP4L 2Z35A 3S7GA 4AM0A 4ELME 3C6LC 1AGCB 2IJ0C 3W4RA 4M8QB 4QCFA 3MV9A 1QSVA 3PWNA 3QUYA 1K8IB 3BP6B 1R34A 1UWGL 3ARWA 3GHEL 4KJQD 1ND0B 1EO8L 3UZVB 1ZANH 5IQ9A 1IE5A 3FY1A 4IDJL 2GT9A 2PW1B 1F6AA 1N0LA 1PG7L 4NM4H 5I2IA 4HMEA 1YEGL 3UMTA 2BRQA 4PJ9D 1BFOA 2E7LC 3WY3A 5CD5C 4JHAH 3BAKA 1FRGL 4ODHH 3QI9D 4A2LA 1X4ZA 4ORGA 3IDNB 1SFSA 1CE6A 3RO8A 5A43C 2XUCA 5DJCA 3IJ7A 2EKSB 2VERN 3WEXB 1RFDL 1GC1L 1E5JA 4EANA 5T1LD 4KPHL 4LSPL 3BUYB 4XMLH 4X80L 3K46A 3MBXH 4U6TA 1BHGA 1WDRA 5EU6D 3V0VA 3DROA 5DI8B 4BQ8A 2DTSA 3L3IA 5EWIL 4ETYA 5DHVA 4W4NA 5C6TH 4HIJA 2H3NB 2AJZA 2P49B 2NXZD 4EBQL 2NY0D 3QHFL 3G5XA 2X4TB 5EBMA 4NQVB 3A6CH 1CYGA 5JOFA 4YX2L 4EK7A 4OQTH 1VB9A 3F7YB 5MEOB 5EFIA 4ZUTB 1EXUB 4P5MA 4GRLA 5CD3A 5FHBL 5C2UB 3WEOA 5CAYB 1U8NB 4O2EA 4PCSA 4MQTB 3BISA 1I9JL 3UTPD 3MA9H 5JXAH 1M04A 3A4WA 4M7LL 3GI8L 1MCIA 4RE3A 3B8SA 4FG6C 4RDQF 3VWKC 2GEEA 4NQEE 5ENWB 3VXTA 4JRYE 2WVSA 4Z2HA 1U8QA 1PIFA 5ESAB 1PZ5B 3KLHD 1BJ8A 1P7KA 3F6IA 3BPNC 2YD3A 4PY8J 4OM0L 3GMLA 5AC4A 1ITBB 2OM5A 4DN3L 3BVTA 2Y5TB 3ARPA 4PJBF 3ZDYF 3RWCA 3TFKC 4P2RA 2X09A 3FONA 1BQHB 5CS7A 4AL8L 3AB0C 3MRCA 1FLTX 1RMFL 3QDHA 3HI6L 5A8OA 1X5JA 4JY6A 3UTQA 5JNYB 3JTTA 4J8RA 3CSPA 3ARVA 3PJSA 4XMKL 3UJTH 2EDEA 4XMPL 1X5KA 4KMTH 5C0GB 3FMGL 3PXJA 3X12B 1GONA 5MEQA 3GMNB 1OTUC 3RAJL 3ULUE 4HJJL 5C0CB 1T04A 5D1ZD 5E56A 4XZBA 4WIWA 1VCAA 1QNZH 1RULL 5I1DA 1SQ2N 1S78C 2QR0B 2ITDA 1YYLH 4BH7A 2PC8A 1E28A 2HT3C 5ANMB 2H32H 1ETZB 5MI0C 2DJSA 3OPZH 4HA3A 4NRRA 2DWEA 1AGDA 3MXVL 3T0EE 2B5IC 1KYOJ 3PV7A 4PREB 1CD8A 1DQMH 2XG4A 4ZQKA 3KPPA 5BRZA 1AHWA 3C60C 4FQCL 2X1WL 2VXTH 4GKZA 1XGQB 4LPTA 3WUWG 4D0DA 3A4AA 4KUZH 1UA3A 3C5JB 1OVZA 1BBDL 3BI9X 3L6FB 1KCSH 4C59B 3CO4A 3QEQB 4MXWL 1T1WB 1GH7A 2VXQL 3C09B 3ULUC 1JCKA 3EYUH 4FNRA 2BVOB 2DQEH 1Y18B 3QYCA 4NDMB 2V7HA 3I50H 4X9FA 4HAFA 5LA0A 2HN7B 2YC1A 3TPKA 1I75A 1DFBH 4OGAD 3VXRE 4OTXL 3IF1A 3WN5A 4OZGE 2CKBA 3O3DB 4PBGA 4XXDA 1I9IL 2WHKA 4Z7OE 3T0EC 2BY0A 2D0FA 3CD4A 3WL9A 2A9NL 2JELL 4HCRH 5DD6A 3VFMA 1SJHA 3LEVH 5DEGA 5TF1L 5EIVA 2HISA 1TIUA 2VZ3A 4E41E 5FKAA 3BPOC 1U92A 3WQ6A 4XP5H 1JWUB 5IIEB 3QR2A 3VGHA 3D9AH 1NC2D 2DJUA 2I9LB 5GZNC 3OAZK 4JFFB 5GS0H 3JTSB 3BMVA 5D2LE 1OLZA 1ODAA 1YMHB 3ULVD 2XKNB 3MUJA 5F44A 1OQXA 1CGXA 3LQZA 4PJGA 2J7DA 5ECJE 1AQDB 1TCMA 3GMOA 5AWNH 1OGAA 3GIVA 1F5WA 1UZ1A 3VXME 2GKIA 1IL1B 3N9KA 3TCLB 2ZX5A 1WCQA 3DVIA 3SY0B 4S10A 4POZD 3W0WE 3WD4A 3BLBA 1DEEB 4DGYL 5I17A 2AXJA 1WPCA 4R7NA 3A24A 6A3HA 3F65A 2IAMB 3OKKA 2F7PA 1Y0LA 3MRGB 1Y6NR 5D7IE 4EE9A 5EG6C 4KRPC 3PQYB 4NWTH 3UBXA 4U2ZA 2E8YA 5DGRA 5SWQA 3MACH 3K4ZA 1M05B 2PO6C 4E0RA 1EGJL 2XICA 1Q0XH 1OM3L 3R1GH 1BYDA 1XF1A 1NJ9A 2EDXA 4Z95L 1E1FA 3EO0B 3MV7E 4TX6A 3UR8A 1WAAE 4MA8L 2DN7A 2XZCH 3H9ZA 2C3XA 3CIQA 3I75B 3EYVB 5INDB 1QHZA 5IK3A 1A7NL 1NFDE 2UVFA 3QXAA 4PJEA 3MQIA 1T6WA 4F7MA 4X4YA 3C8DA 2IC2A 5EA0H 3MRQB 1Q0YH 1K6QL 1XGUA 4XVSL 2IF7A 2Z4QB 4U1SA 1ZBCA 1SBBA 1AFVH 4LARL 4Q6IA 2HWZL 4X7SH 4I3RH 2XM1A 4BCEA 4ZFMA 4UDTA 1UT9A 3VD3A 4QCEA 5H37H 4NIKB 3GHEH 4FFWD 3FN0L 2DSVA 3CHEA 4ZXLA 3SCRA 4QXTB 4FTVD 4I0PC 1NOUA 3SCNA 4EDWL 2OW7A 3GSWB 1B3WA 1YEGH 3VWKB 4JPVH 3UTTE 1MWAH 1FZMA 4PEEA 1MCCA 3NSMA 4J2XA 3UYRH 2ENSA 2W5FA 1A3RL 3U5UA 4OCRL 3BW9A 5KEZA 4GMTH 4PMOA 2NCMA 4IHOA 3BPNB 1WZMA 2NY6D 4L8CA 4KZDH 2D7PA 4HWBA 5E9DB 1CGUA 3QXWA 4FNQA 4DWSC 4ZFFA 2DQDL 5A94A 1G9EA 2YPKB 4QT5A 4LAQL 3TO4C 4F2MB 3IS0X 2WC4A 3VDHA 1JFXA 4JO3L 2ARJB 4AC1X 1Q1JL 4QY8B 5HYEA 1EHXA 2XXMB 4KAQH 5ALBH 4LNRB 3CMOH 1IQDB 3VIPA 2XQYG 3O6FD 4EAMA 1IFHL 5I6SA 3QDJB 2P5WD 3PE9A 3D85B 1Z9SA 1ZOXA 4PJAE 3EJPA 4OLVL 4RAHA 5E09A 4FP8L 3RCNA 4UCFA 5HPMA 4J12A 1XC6A 1S5IL 2YPLB 1HWGB 3SKJL 1DBJH 3BIKA 1VFBB 3ZR6A 3ZKMD 1T7VA 3FOLA 4APQC 1OD9A 3K8LA 3WIFA 4RWHA 4RGOL 3B2UD 4OUUA 4L8BA 35C8L 5MI0B 1Q72H 2NY2D 3QCTL 2D20A 4C58B 4H1LG 1R3IH 1J11A 5E0FA 1X5ZA 3QNZA 2ZNXA 4ZFGH 1LK3L 3U1SH 5FDWB 2EDKA 4PLNC 4FQIH 4G3YL 3REVA 1WITA 3TM6A 2XA8L 3VNZA 3CZEA 1TVNA 1CFNA 5MERA 2OZ4L 1KXVC 3HLAA 4PJ5E 3T09A 3DMMC 4QOKE 1KJ3L 1LK2B 2OS7A 1JN6A 2QLVB 4HD9A 4MCZA 1JUFB 2VDQL 4AL8H 3DETD 3AREC 5JHLL 4PR5B 4XNZB 4R4NC 2DM4A 4M1CC 4IRZL 5E8DH 5TPWH 1TENA 3EO1A 4IOIA 1RUQH 3FMGH 4OCYH 1H5BB 3BUDA 4GS7C 3BKYH 5FL0A 3G6DH 1E4KA 3UYPA 2P24B 1U8HA 2V7NB 2JF6A 3SJVA 4PTUB 5FYKE 2EZ0C 1FQ9C 3JV6B 5ID0B 4WIQA 3KL3A 1Q4NX 3DXAA 1P4IL 1DBKL 1SEQH 3QDGD 5T1DL 2EO9A 4YIQB 4MAVA 3MRHB 1K6AA 3D69B 3G6JF 1T6VN 2YN5A 4PV8B 4M5ZL 2JIXB 3OR6A 4YC2C 3MXVH 3RGHA 4L8DB 1U8IA 4Y8AA 5DMGC 4K3JL 1IGCL 4UFLA 2NW3A 5HI3D 1DWIM 4C7FA 2WVUA 1GSMA 1T5XA 4XP6L 1D9KC 1H8NA 1K2DA 4ZDHB 4ZOAA 4XI5C 1FFNA 2C8NA 2YWYA 2E7HA 3MZTA 4G80A 1GGBL 4ZS6D 5T3XD 2O61B 1Z2KA 2RGSA 4TRPH 4KDVA 5I71B 43C9A 5CSUA 2CLZB 4G7VL 1REIA 1J8HB 5D5ME 5JIHA 4PG9B 2O92A 3ULUL 1WCBB 5FKPA 3FXYA 1I8KB 3VXSD 1UZ4A 2A9ML 4L4VB 2CBIA 2HFEA 1F4XL 1Q9LA 4LQFL 2DSUA 1I1AB 3KR3H 1KB9K 3RZWA 2C3VA 3RDTA 2BCKA 4ZTPH 1QSFB 4N42A 3GJFA 5ICXB 2NY3B 1GQIA 1UWIA 4MS8D 1WWAX 4D6FA 4UZGA 2FX7H 1VADA 4FLRA 4OSUL 1G1CA 4ACPA 3MNZA 4JFPA 3Q1SH 1T83C 3UDWC 5IMMB 3U48A 3NTCL 1MUJB 2FO1A 3MLRH 1WISA 3ES6B 2G2RB 3CIVA 1KGCE 1LJYA 3CZNA 5ICYB 1FO0H 3I84A 2ERJC 2RGLA 1FNEA 1SEBB 2CD0A 4MDIA 3BUIA 4OLZL 3KPOA 2DICA 4NUJA 5SWSA 3V6FA 1A7OL 2V6HA 3QB7C 1RSFA 1A7QL 1L7IH 2BOBB 4NKIH 5A6AA 3Q6FB 4K71C 3PDDA 4X6CA 2GAZA 5BXRA 4HF5H 2EDYA 4OZ4A 1ZVSA 2VDPL 4RIRB 1M6OA 2DM3A 5DDHB 4OLUH 3LMJL 1JPST 3CPLB 1I7ZA 5DUML 1QFWL 5E2WL 5C0FA 1QFPA 1T0MA 3UTSE 4L29B 2N56A 4MB5A 4M8QA 4CCEA 3CC5B 4WEUD 1K8IA 3D3VD 4L4TD 4QXGL 3WFCH 1ND0A 3RU8L 3B43A 2WQ8A 4DEPC 2OTWB 3ARTA 4A6YL 4O9HL 1YZZA 2Z8VC 4CDHA 5GS2D 4Y4KA 5L2KB 1TJGH 3QR3A 3HC4H 4OF7A 4YXHH 3HMCA 5GNZA 4QLJA 3AIRA 5DWUL 1XR8B 1A1OB 3GH5A 3IAGC 3IDNA 4F37K 3N15A 3MLWL 3WEXA 3ZYZA 1A6VH 5MENE 4YFLI 1CK0H 5C0RL 4CD7A 2ZCHH 3BUYA 4HJ0D 1VJSA 4JJ5B 4LF3A 2VMFA 5J8OA 1EUTA 2IAND 5D9SB 5TQ2H 4F7EB 4TVPH 4X99B 1HQRB 2H3NA 5I1JH 2XZZA 1LG2A 4MAUH 1SVZA 2VRJA 5DD1L 1GHSA 1UWQA 2X4TA 1U41A 4NQVA 1AD9B 4FFZH 3QQ9D 4XWOC 4YGVB 3RVVC 3F7YA 5LJYH 1N6UA 5MEOA 4ZUTA 4Y88A 3TPUB 4IBLT 3UG4A 4NQXA 1S5HB 1MAJA 4HGWB 3TLRA 3WQVA 4RMTA 1U8NA 4Z7QF 4I3SL 3E8UL 1BQUA 2J8UB 2EADA 2XPKA 4EXPX 4IDLA 1ESWA 5ENWA 2X1OA 1BOGB 4KRTA 3NOIA 4XP4L 1GPOH 3AOFA 5ESAA 1PZ5A 4PJHE 1ZLSL 4GW4B 1CF8L 4JDVB 1F00I 1TQCC 4G8EB 4LNVA 4P5TB 2Y5TA 4AY0A 2BDNL 5EOQL 1E72M 4HQQL 1A0QH 2IWGA 5EU6E 3C08L 1MAMH 2ZP0T 2PBGA 2EBNA 2WXDM 3L95A 3OB0K 2DT0A 4OD3H 5KVEH 1BQCA 5C7XH 1UKQA 5CMAA 3HZYB 3PZ9A 5JNYA 4S1RH 4KJQC 5KZCD 3PDOB 4XVTH 1VFFA 4IOSD 1P69B 5C0GA 1KN4L 3X12A 3DC0A 2EC9T 4LVOC 5INCB 3GMNA 1CDIA 5K9KA 1YPZB 1NCBL 1NCAH 5C0CA 5IROA 4OLWL 3SDAC 1KG0A 2XZQL 2XA8H 3QI9C 4CKVX 2X2IA 4KROB 3KS0H 4GKOA 2B31A 3D3AA 5J1AB 1OSEA 1X5FA 2OZ4H 3FO0L 4PTXA 1WIUA 3O8XC 3UTPE 1K9TA 4FQJL 2CIIA 3HR5B 2QR0A 5GS1B 1T03L 2ZX6A 5I5RA 1AGEB 4G7YL 4NZFA 1ETZA 5GGSB 3AIQA 5HDBF 2VT0A 3O3BB 1A47A 1GOQA 1H3UA 4JFZL 4PREA 3TONA 3LKPA 2O5XH 1OWWA 2XQYK 4AEEA 5LGJB 1E5NA 4RFEA 1A4KB 3KS0J 2CXGA 4Y5YB 2NXZC 3WDRA 2A74B 2IGFH 4UQ2A 2NY0C 3C5JA 3QA3A 5H37G 4K2UL 3QEQA 3CX2A 1T1WA 5BMFH