3K8LA

Crystal structure of susg-d498n mutant with maltoheptaose
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
649
structure length
649
Chain Sequence
WTALTASPDTWDETKRADISYQLLLYSFADSDGDGYGDLNGVTQKLDYLNQLGVKALWLSPIHPCMSYHGYDVTDYTKVNPQLGTESDFDRLVTEAHNRGIKIYLDYVMNHTGTAHPWFTEASSSSESPYRNYYSFSEDPKTDIAAGKIAMITQEGAAGYNAAEWFQVSDETAAVKGLLKFTLDWSNAPSPILVVSTGTKADEDNPDTGTDNAKYLYYGEDICKKFYDKGNNIYELTVDFESTWGLLIRTSNASFWPSGTKYGASSSSEKLALNKDFKLTNAGNPANIMFDSQQITYFHSHFCTDWFADLNYGPVDQAGESPAYQAIADAAKGWIARGVDGLRLDAVKHIYHSETSEENPRFLKMFYEDMNAYYKQKGHTDDFYMIGEVLSEYDKVAPYYKGLPALFEFSFWYRLEWGINNSTGCYFAKDILSYQQKYANYRSDYIEATKLSNHNEDRTSSKLGKSADKCKLAAAVLLTSAGHPYIYYGEELGLYGTKDNGDEYVRSPMLWGDSYTTNYTDKTDATVSKNVKTVADQQADTHSLLNIYFSLTRLRNTYPALAEGNMTKHSVYNESQEKDYKPIAAWYMTKDNEKLLVIHNFGGTAMQLPLTDKIEKVLFVNGETQQNTDSDSYTLKLGGYASVVFKLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title SusG: A Unique Cell-Membrane-Associated alpha-Amylase from a Prominent Human Gut Symbiont Targets Complex Starch Molecules.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Membrane protein
molecule keywords Alpha-amylase, susG
total genus 199
structure length 649
sequence length 649
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k8lA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3k8lA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k8lA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3k8lA03
2APBA 4XXCA 3GO1H 3QDMB 3VX0A 4B3LA 4AIUA 1BVKA 3DMMB 1G84A 1JK8B 5DD0L 1R5IB 3O41A 2CIIA 1MW3A 1ETZA 5FHBH 3KPMA 3RWGA 5CEYB 1FNFA 4DQOL 5DEFB 1UQYA 2CXGA 2Z92A 3SOBH 1HZHH 4XMKL 2GSGB 3WFLA 2PW2A 3ESVF 1VFBB 3RVTC 5DFVD 1UZ8B 3BZDA 1ZT7A 5GGTL 1A9BA 4KQ3H 3N1AA 5C0BB 3KJ4C 2D2OA 2C0HA 5I1HH 3PWJB 1T1XB 4YDLC 3QCVL 1E6SM 4PJ8A 5HYJD 4Y5XA 3VXTB 5A6BD 4K55A 2EC8A 2CRZA 3TBYB 4OV5B 4IDJH 1NCWH 1DSFL 2HT4D 4NWUL 5B22A 3B2UC 4WNQB 4CJ1A 4V1DE 1A3HA 5EO0B 3M8OL 5TE7H 2VDQL 4KHXH 1V6WA 1AE6H 3CH9A 4LRNL 3BIKB 4L29B 5LAXA 2GJPA 1UM6L 5DDHA 3BN9D 2F74A 5DGQA 5EBGA 3QH3A 3SDCA 5F1NA 1ZEAL 2X4PB 3QEUB 2FIRT 1OF2A 2FDBP 3MLVH 3QSKB 1EO8H 3RHWK 3N15A 5C0EA 4G43B 5E6ID 4OD3H 1JZ4A 5ISZA 1JDCA 1G1CA 5D2NE 5CGMA 3GSNL 3FB7A 1IM9A 5I2IB 2V5CA 3E8UH 4PUBH 2CYGA 1HJSA 3MMUA 4M43L 3PHOA 4ISVB 2DDQH 4WFHD 1WK0A 5CP7B 1HNYA 3RZCB 4U0QB 4LRIA 1HYSC 2B0SL 5J4MA 4GKNA 2DGAA 2JJSC 2H32H 2QQNL 3AROA 5IBTH 3SDAD 3NIDE 5CBEB 5CBEA 1VEMA 1QBLL 2BXYA 3SGDI 3W9DA 3WJJA 4NO0B 3MA7A 4PJ8D 3PZTA 3LKOB 1IVLA 2BOBB 8FABB 1E27A 3GMOA 1P7KB 1RJZA 1T5WA 2MTPA 2NXYB 5F6HJ 2ZOXA 1CR9L 4PRPD 1E6RA 3BPCB 4D0DA 2J75A 3ES6A 4WHCA 5I16B 3QPXL 2JEQA 1R46A 5L6YH 4ZO8A 1AC6A 4ELME 2EPKX 4B0MM 5FYJD 2DIEA 3U46B 3MXWL 2NY4B 2MMXA 1NCDL 5B8CA 1QBMH 4PYGA 1IGYA 5E6IA 5IVXA 5FA3B 5K9OB 3DYMA 43C9B 1GGTA 1KTDB 5IG7A 5KOVC 3GMNB 5C08A 5AYQA 1XH1A 1RULH 3WBEA 2DI7A 4IRJA 3MNWA 1MFVA 3RGVB 3CC1A 3ALWA 1OM3L 3DX4A 4X7TB 2HA1A 4M7LL 5B3NA 4GZJA 2F53B 2QSTA 4XZBA 1EEYB 4X9FA 1IARB 2ICEA 1KB9K 2VLLA 2ZZUT 1CZ8H 1IQWH 1E4KA 3S34L 1H2JA 3OPZH 4XWGL 1HHJB 2BNUA 1KCSH 3SKUD 4BA8A 1DBKH 1BF8A 3LSOB 1OQXA 4K07A 2WVSA 5M7QA 3WH9A 3EO0B 3DTXB 2ZNWA 4ZPVB 1RK1B 2GY7B 2VJXA 1DLFH 2K7PA 1A6PA 1S5IL 4Q9QL 1P4LA 1D6VH 1HILB 1WWWX 1U3HD 4NUJB 3SCSA 2DQJL 1JCKA 4Y88A 2WBJB 4I5BA 1LK3L 5EIIB 3BSZH 4WUKL 1HNGA 1I1FA 2E7LC 2JIEA 2P8PA 2YR3A 4GW1A 1MRCL 4LFHG 1MCOL 2EDBA 4HU8A 1ETZB 2VITB 3GSQB 5IB3B 3WXWL 2AABL 4M48H 2A1WL 4JG0H 4LCWB 3QIWD 4HMEA 3MRMA 4EBQH 2YKKA 1QFWI 4FRWA 1W72A 5EZLB 4W7VA 2WCGA 1HOCA 2WCAA 3R4DA 1F90H 4ZS7H 5DUMH 3I6KB 3PWJA 4IRJD 2GK1A 4OCXL 1QG3A 1BJMA 2X4NA 2DS4A 4HJGB 3I3DA 4XAKE 3NAAL 3QI9A 1U91B 4ZOCA 2OR8A 2C7FA 5A2CA 4OOZA 4ZXBD 5DT1H 1T0PB 2YWYA 4U0RC 5TH2A 4X9YA 2VLMD 1U58B 5IESL 1R24B 3OF6D 1A7RH 3FB6A 4HDIB 1KEGH 2KQMA 2IUZA 1ACZA 1C8QA 1UR0A 4NBXB 3QO0B 3MV9D 4X0VA 2VLKE 2H26B 1EMTL 1M05B 4OIAA 5BXRA 3DSFH 1LO2L 4WU5A 4F7EB 1DVFB 1RUML 4ZPTB 2XTKA 1NMBH 4FABH 1UENA 4R4NC 4KMLB 1WV7T 3G04A 5DI8A 2ZG3A 2EEAA 3MRGA 4U3XA 3AXIA 1X4ZA 3EYOA 3QEQB 3PV6A 4FTVE 4GSDH 3WS3A 1K4CB 1QSFB 4K94L 4LHUA 4M80A 4BQ2A 1S9XA 1LILA 4HIXH 3DHJA 3SE4C 3SJVA 1OGAA 1XF1A 3WQ4A 3I84A 4I18B 3S37L 5DRXB 2SEBA 2V5SA 5JUEH 4EAMA 5DTFA 2ZNXA 4WWKA 3QIWA 2ADFH 2VXQL 3HG1D 2EDQA 5FGCB 2AJ3A 2J8UB 4I13B 4JM2F 1GVYA 5DUBA 5SWZA 3SUTA 4JFFD 4FG6C 4XNXH 1WT5A 2N1KA 5FA3A 2FO4A 4LPVA 4HV8A 1OTUD 4UU9B 1JWUB 4GZEA 1J7VR 1CFVL 1Q4NX 1LJYA 1MI5D 3MCLH 1V8HA 2GJ6E 4RGMB 4LEXL 3G6DL 2ZUUA 4GRLA 4E41D 2V3FA 3WKML 5TDOB 4GAGH 3MRPA 1OSZB 1NJ9A 3F7VB 3QFJD 4HUMB 4Y89A 3RIKA 2FJGB 1GGIH 3PHQA 1PG7H 5I16A 5I8OH 1IL1B 1JPST 3JWOC 4FZEL 4HV8B 5I1GH 3HAEA 4LSUH 4NGHH 5F1IB 4RGMC 5J6GB 3GYCA 2XZAH 1VFAA 4I0PC 2X70A 4OD1H 2EIBA 3RP1A 2P5ED 5LGHH 2R0ZL 1A14L 5I17B 1J18A 3NN8A 1DWJM 4RWHA 4KKNA 5I74C 3GMRA 5GS1A 1MXGA 3FZUD 5E2VL 1NGZA 4RAUB 4MDJA 4M6MH 4OF3A 4JE4B 1I1AB 4U5KA 4DKDC 4G3YH 3KLSA 1NKOA 5HPCA 3T08A 1OGAD 1AR1C 3GKWH 1TZ7A 3G9AB 3IGAB 2AV1B 5E8DL 1G0DA 2XFXB 1S7UB 2RHEA 3IDXH 4TVPH 1GIGH 1E6OL 3TV3H 4U3HA 3T2OA 3WSUA 3RDTA 4FQQA 1RK0B 4HS6A 3BKML 4H25A 4P7RA 1CU4H 4U1MB 3TCXA 3TJEH 3FB6B 2CEQA 5KN5A 2CLVA 1F6LL 3DDGA 1WDQA 1CFSB 3H9SD 1KPUA 3W53A 1HI6B 5CEXA 3MNZA 4K71C 2FO1A 1IGCH 3D85D 3UTPD 3P73A 5FO7B 2HJLA 4IIQC 4OLVL 2CNCA 4GRLD 1KT2A 3S36H 4L4TA 3PZQA 5KVFL 3LD8C 3P0GB 1DN0A 2Q8XA 4ZOEA 4AYSA 3ZE0E 4X99A 3MV7D 4D0CB 4WNQA 4JFTA 1QPXA 1GYAA 3O6LL 3RAJL 5A8QA 5E4EB 1FORH 3AHTA 3CMOH 4FQLH 1KF9B 4U3CA 3LV3A 2I9TA 4QAWA 1JYNA 3MLSL 2X4RA 1WKYA 4NZRL 3GGWB 1FFNB 2VDNH 1BAGA 1X9QA 4BFGA 2E0PA 5MP6L 4JO3H 1PPIA 4BSJA 1RZGA 4DGYH 3GSQA 4UILL 5IHBA 3ESUF 5A3IC 1AGBB 2DWDA 3FAWA 2HT3C 3HNSL 2JJVA 4Z7UE 1OM3H 2CJUH 5CKAA 5C0CB 2XQYK 4L9LB 4C54A 2DQHH 2WP3O 4NQDD 5FM8A 1MRFL 4KI5D 2FJGA 2W63A 4D9LH 2NMSA 1SM3H 4ZO7A 2EJ1A 4UIKH 4BUGA 2GJJA 4PREA 4ZUTB 1DQQB 2A74B 1M6OB 2XYCA 5K9QI 4UTAH 2A77L 5DD6B 4ZMAT 5HDQH 3T1FA 4P99A 3SOBL 5I1DA 3OBAA 4NIKB 1F3JA 1CN4A 4PTUB 2FR4B 1V7NL 2GT9A 4KROB 4MAVA 1Q0YH 1DQMH 1EX0A 2JK5B 4EKJA 1AXSA 2W9DL 1E6JH 5TE6H 3QUMB 2VERN 4ODTL 1TIUA 4F2MA 1YEJL 3PGDA 4YH6A 3WELA 4HH9B 5INDB 1G7MB 3GIZL 1BD2D 5FA4B 3GK8H 1RZ8A 3ARZA 2XN9A 5FO9B 3CH8A 1UZ1A 3ECBB 4NDMB 5D96C 1E4XH 3DGGB 4M6AA 2AEPH 5CWSA 4OLZH 3VD9A 6CGTA 2VLLB 5GNXA 4L1HA 1Z32X 2X4QA 3IXTA 1NC2D 4YN5A 2FH6A 2DD8H 3SCMC 2IEPA 1YN7A 2E7HA 1JNHB 3UYRH 5IDIA 3RGVA 5JIIA 4JDZB 3EIFA 2DWEB 1CICD 2QV4A 4KV5F 3PZMA 7FABH 5C07A 2DRUA 4X6DB 5HI5C 3IDUA 4HMCA 1YC8A 5FGBC 4X6CE 1V3HA 2VR9A 1BIIB 4PRPB 3BKYL 3WMSA 3EKCA 4E41A 4HX1B 4CDHA 1ZLVH 1E4NA 4JRXA 1NJ9B 3F7VA 4HIEB 4DZBA 3HC3H 4U49A 2QHLA 1T83C 2XZAL 2ZUYA 4M93C 3RU8L 1DQDH 5IB5A 2O5ZL 2R1WA 4OI7A 4A3YA 3WIHA 4ELKB 4XHJD 5B39A 3DX6B 3RIFF 3F12A 1JI2A 2ZX9A 1OCWL 4O2FA 4GINA 3KXFA 4NQCE 2VLJD 3K0WA 1XR8B 2WC7A 1N59A 2FWOA 5CSBA 3C9NB 1OF2B 4FMVA 4AY1A 3DGCR 3KR3H 5EORH 5IHZB 5DEGA 1OP9A 2KZ1B 1MJ8L 1FFOB 4PJ9A 3CFEB 3WE6A 1FSKB 3ARGC 3OZOA 3TJHC 3IJSA 4G8EB 1CFBA 4NBYB 3Q6FB 1ZLWH 3U0PB 5I18L 4Z7WF 2XPKA 4P23B 3S4SB 4X8JB 1N7MH 4UFHA 2AQ2A 5T1MB 1QYGH 4OF5A 4YHKH 5L9DL 5IB2A 4IOSD 5FAAA 2I27N 2EYRB 1PX8A 2EZ0D 4OZHE 3UO1L 4RFOL 4XP9L 2D3NA 4P23A 3S4SA 2B7DT 2YD3A 4MXQD 4YEFA 1Y0LB 5CAYB 3HZYB 4JKLA 4HZAA 5LA2A 1I7TB 2MWCA 3KPQB 1YJDL 1N4XL 2XVNA 3RZWA 3PTKA 4J7RA 2QADD 3EDJA 3DUUB 4HUWA 4G42A 3MU7A 4FTVA 4HH8A 3PZGA 4NC1C 4Y5YC 5D5MA 1WWAX 1L9NA 4FFZL 1MFEL 2CKBB 1KBGH 3L4ZA 1FNSL 1RFDH 1C08A 2X4OB 4WI5A 4LNRB 2XSAA 2C4FU 3GIZH 2VIRB 2DQJH 5ACMA 2FO4B 2J7LA 4WJ5B 2R9HD 1UZ8A 4LCUA 3L2LA 3V0WL 5FD0A 4G80A 2C3HA 3SDAA 2Z8WC 3L3OA 4GQ9L 4WF7A 2NY0D 1DLHA 4BFIB 1MCOH 1T20A 2ZXBA 3HE7A 2BJML 3MLZL 4D1JA 3L3GB 5EFDA 3QQ3A 5DMGC 4BQBA 4BCEA 3S36L 1Z3GL 2VNCA 4YWGL 2HKFL 1UA6H 4N68A 5CUSL 3QPQC 5SV3A 3EO0A 5C0FA 2CDEB 3KL0A 3UCQA 3NIYA 4X6FA 3QUZA 2BZDA 3WD5H 2CLZB 3RL2A 2J7FA 2R29L 3HAEB 4KVCL 4NM8H 1F4AA 1I8KB 4JZJB 3X13B 4W84A 1RZ8B 1UJ3B 3FCTA 4WV1C 1D5IL 2O9PA 3CK0H 3AYSA 4KKLC 5F3BB 3FONB 4DZBB 4BQ4A 5KJRL 1X7QA 2JTDA 4HOZA 2A3HA 4Z7NF 1FZOB 5DRZA 3QPXH 3ZIZA 2X2YA 5IF0A 3BE1H 3H3BC 4J1UA 1UYQA 4HWZA 4KRLB 4I9WE 4NKDA 4EIGB 2J7CA 2AEPL 5ESQB 1W3JA 4TVSa 4KQ4H 4X5WA 3H7BA 1DL7H 2Q1EA 4H20H 1P4BL 1Y6KR 2E9LA 1MVUA 3WHE0 3IU4H 4AD4A 4R7NA 3QHNA 1MEXL 1YPZF 5E2WH 2XFFA 1DVFC 3V4UH 3AFLA 2DTML 4Y0GA 1I3GL 4X7SL 1BYBA 5C0GB 2ZG1A 4KUZL 1KG0B 4GKSB 3MOBH 4XP5L 1RJYB 3LHPL 5AY7A 2VKWA 2NX5B 1WIOA 3PJSA 3ZDZE 4LGXA 3PP4L 4K7PL 3TVMD 2VCAA 4H41A 2DMCA 3GSOB 3BXNB 3S5LB 5HPMB 4I3SH 5JBFA 3BQUC 5LQBH 5KS9A 2R0WL 3MXVL 4JY4B 5I8EB 1WVZA 3U36A 3W38A 3VFTA 1MAJA 2FX7H 5JIKA 2HRPL 2DDXA 5I71C 3P11L 3QPQD 5DYOA 1QVOB 3L5WB 5E2UL 3MROA 1SM3L 2VAAA 1S5IH 3O3EB 4FNSA 4LNRA 3DLQR 4HJ0D 5HYSG 1JHTA 1SYVA 2BDNH 1AI1H 1TTGA 5EOTB 3OLEA 3BP6A 4IDLA 5L88L 4GKZB 2J79A 4P5KB 3ARRA 3DJ9A 5ERWA 1YYML 1MCNA 2HLAA 3JTSA 5JXAH 3HZMA 3VILA 2H45A 3V79C 1AQKL 1FL6B 2J3SA 1S5HA 4AZCA 2VX5A 4CD7A 4NXSA 1CGSH 5C0CA 4AMXA 3QXAB 3BSGA 3VXOA 2IXUA 1CTNA 2HFFA 3OB0H 4ATDA 1WCQA 1F4WL 5EA0H 1NBQA 4QOKA 3AC0A 1IQDB 5GS2H 3VNYA 3EOAB 5HDBE 3IDJA 2CDGA 3MGAA 1H3GA 4U05A 4WEMB 2X44D 4LASL 3BUTA 4F7TB 1MFCL 1IV8A 4PJ7A 3VRJA 2Y24A 5CHNA 2RIKA 3UZVB 1B3JA 1DQJA 4M7JL 1I4FA 2C26A 1E4MM 2ICWJ 1CFQB 5A6KA 1TJHL 1O7DC 2LFGA 4NO3A 1RUKH 3KNBB 2YPKA 1QO3A 4MXQC 4Z95L 4JKMA 3D5OF 1ZWIB 2YPLD 4TUJB 1K9DA 1E70M 5I17A 1U93A 4PYHA 1TCMA 1OCWH 4TOYL 1HK6A 5J6HB 4JY5L 3F8UB 3GMRB 3DUSB 1JGDB 1ECEA 2G2RB 5I8OL 4KQ3L 4NXKA 3VD3A 4P8WA 4A2LA 1JFQH 4H8WH 1HHKB 1JXKA 5D7KE 2J8UF 4JM2B 5D1QA 1OWWA 1VGEH 3KPOB 3P77A 5TGBA 1JNHA 4AEIL 5ESAB 5C86A 5GRYA 2CKBL 3PBGA 1A3RL 1N3NB 3X12A 3S37H 3RDKA 2B5IB 4Z77A 4ZFOA 1CD9B 1KTRL 2XKNB 2VISB 3FN3A 5KSAA 3FQWA 1W0WB 1FP5A 1MCEA 1BREA 2QHRH 5F8QC 4BA0A 3BW9A 4LK4A 3CZSA 4PJCB 1XFPA 3ALXA 3TESA 3GHBH 4MNGA 5IJKC 1B4JL 4BELD 1EDGA 3GSXB 1HL9A 1ADQL 1CVRA 5DMKA 4G8GE 1V6VA 4ZUUB 2AI0L 4FFWC 1C12B 4N8VB 4PMNA 5FL1A 4HIXL 3SHSA 3O4OC 3GMQA 3QUZC 2RFXA 3RKPA 2CESA 12E8H 1T0NA 4JZOB 4HUUB 4D8PB 1GZQA 5DD1H 2W60B 2ZXDA 4OIFA 3REWA 3EYVB 1OP5K 1Q9LB 5FECA 1T1ZA 3N1PC 5DMIH 5IF0B 1QOKA 2JJSA 4AZHA 3PHSA 4HW6A 2HN7B 1BX2B 3HI5H 3WDHA 4LKCB 4RZCA 3PL6C 3FONA 3GSVA 3R1GH 3MRJA 1L7TL 1Q1JH 5GS0H 1BQSA 4CVUA 1RP8A 3MRKA 2W66A 5GGQH 3TPKA 1CLOH 4EXKA 4R6UA 4KJYA 2N7BA 2MFNA 1FAKT 4MB1A 3CMJA 2D4FA 4WI9A 4I18C 5T3XL 1N6QH 4NF7A 2CDGB 5I79A 4R4FH 2Y23A 4AEHH 2Y5EA 2I9LA 4BK5A 3QBTB 3MJ6A 4G6KL 3L4UA 4L4TD 1BSIA 3EZJB 5CIPH 1JGEA 1R86A 1NL0H 3BD5A 4GKLA 1A6AB 5DD3L 4YO0B 5IR1A 5EG6C 3UMTA 1TZIB 2WBKA 3VTRA 3I75B 2HG5A 5E0FA 3Q0HA 3B2VH 3NUKA 3U0TA 1KTKE 3QIUA 1BJ1J 2Z9TA 3T3PF 3P4MB 4KJQD 2J1KA 2VI0A 3MV9B 2FGLA 1UXSB 4JFDE 2PXYC 1C5CL 4PRHB 2DL2A 3QHMA 1OTTC 2EH8H 4X6BB 1ZB5A 4R4BA 4GW1B 4R26H 3RTQB 1TZIA 4LIQE 2DLTA 3UTTD 7FABL 1GQKA 3K7UA 4NX0A 2D4DA 1JHTB 5HGDA 3HAEH 5E94A 1KN2H 4MXWL 4JJ5A 3VXUE 3BAEH 4XGZB 4GS7C 3WHXB 3OSKA 2XM1A 3WD4A 1NCNA 1SJVA 2J6EL 3TA3A 3V5HA 1KXHA 1NUDA 1I9RL 4X8XA 4R90L 1NUGA 4LYQA 3IDYB 1PZ3A 1U91A 2UY5A 3AICA 1IEAB 2BSTA 2PO6B 3UTZA 4Y1AA 3PZNA 4EDWH 3FRUB 2O61B 3LKQB 5ICYA 3RY6C 3CU7A 4BFBD 2I24N 2B20A 2UWEA 2OXHA 3A47A 3FXYA 2AQ3A 5C0AB 3Q5OA 1ZKAA 3PP4H 1H0IA 1Q0YL 1UA3A 3T04D 1FC1A 3MLSH 5A16A 4YHPA 5HJ3B 2W9DH 3TFKC 2PBOA 3BX7C 1N8ZB 5INCB 2YC1B 1MREH 1QR4A 4WHTB 4CADA 5HHQB 4TVCA 2ZP0T 3QIUD 5I0ZA 3MLRL 5B4MC 5DK0A 4YZFE 4L5FH 1FZOA 4UTAL 1MFUA 3C08L 5IVOA 2X7LA 4KTDL 1N5YL 1T1WB 4YE4L 3IXAB 2VLRD 1KLGA 3E8UL 4G8FA 5DHYB 5DFWH 1C1EH 3GZKA 5LQBL 5IB4B 2WBWB 3QDMD 3VRIB 5JOFA 3QNXB 5JO5B 4OI9A 4PUBL 2UWEE 5L8KB 3VFOB 1C16A 5AZEL 1BOGB 1F6AB 4X9HA 3VIHA 4HQQL 1ZLWK 5IBTL 1NLBH 1QLFA 5D7JB 3I02A 1T7XA 1WBXA 3MLYL 2EYSA 4WU7A 5EPMB 3RVXD 3X12B 4QNPE 5JA8B 3THML 1JPTH 1RIVL 4MD4A 4LKXA 4MNQD 4OF6A 4HKJA 4GOSA 4XP4H 3A6BH 4Z7VA 2W62A 4S11A 5DMKB 4U1GB 1IFHH 1RD6A 2W0KA 5TE7L 3U7WL 3GSOA 3O4LD 5I1AB 5HD8C 4C7GA 3BI9X 1E4IA 1V0KA 1Z2KA 1GRWA 1T0NB 2NCMA 1QD0A 1G9EA 4YHMH 3FO1B 3N1GC 1BGGA 3JV0A 5J57B 4JZ5A 1AFVH 2XN1A 4GRLB 2DIAA 2F5AH 5EO1A 2P4AB 4YHKL 5L9DH 5HDBF 5HGAA 4G6MH 3GIVB 2OSLA 4H8WC 5EU6E 4CW1B 4OT1L 2C1PB 2VLJA 4PRNB 2D0HA 1ZLVK 1F11A 2J6EA 4JKPL 1YECH 4MYWB 5BRZD 2IFFL 4U31A 1QA9B 4K9EL 5CG0A 4M61B 1M1SA 1WTLA 5D70H 1OLZA 3NCJH 1ZGLM 1D9KD 4XVTH 1KENL 3NACH 1L7IH 5C0EB 2D22A 3WLWD 3TPUB 2OTUA 4LHUG 3O3BA 3P4NA 4NM4H 1U2CA 3DX7A 1T66C 1OP3H 4S1QL 3I6KA 1FG9C 4UFLA 1YEKL 3BEWA 4YLQT 1BQCA 4M1RA 1PG7W 2F7PA 2ZUQC 2WHJA 5T3ZE 5H94A 1V3LA 5A69A 3TZVB 3O11B 1I8MA 3MRMB 2XT1B 4F3FA 3LKSB 1MI5A 4IOFD 5EO0A 4ZFZA 2HVJA 4F7TA 2QMKA 2FIKB 4MGXA 3D18B 4PJXF 2OYKA 4Y16D 4CD4A 4PJ8B 5BXPA 1UG6A 4NNYB 4XPAL 3HC4L 5DT7A 4D71A 1EPFA 3DROA 5EU7E 4QHKJ 4NNXA 3O6FB 3RWDA 1F97A 4WCYL 3TYFB 3CZNA 2UY7A 5IFJA 4JFYB 5KANI 3QWRD 1N64L 3DX1A 2F61A 1GUVA 1T7VA 4OZGE 5D1ZB 3MO1B 3KJ4B 1BYCA 3O9WB 1EXUA 2VL4A 3GHBL 3WUEA 1QSVA 2YWZA 3P9MA 1ZMYA 2YA0A 2BCKA 4MNGE 4HJGA 3WDPP 4O00A 1UJTA 4HTYA 3ZLQC 3N9GH 1WAAE 3V6ZB 1DUYA 1T4KB 2R0LL 1I7ZA 3EGSB 1YEEH 4L9LA 1UXWA 4QNPF 5BV7C 5F96H 3WF1A 4OBRA 5EZOL 1CTOA 3H9SA 3RGVD 4GG6A 3EOTL 2XVKA 4X5WB 3HE7D 4P5MB 3VD7A 2Y6SC 2BY2A 2DWDB 3MGTA 3LRKA 5F7NC 5GGVH 2D7QA 3POHA 4HEPG 1OW0C 4XNMB 1QVBA 1C92A 2VDKH 4ML4A 2YLAA 3G6JB 3KPRD 4P2RE 4CVXB 5DO2D 2IAMD 4GAJL 2J62A 2GUOA 4XVJL 1LK3H 2WMGA 1YY8B 2WP3T 3D1MC 5DC0A 1FG2A 4BZ1H 3HUJE 3ZE1E 4ZFGH 2WMPA 4P3DA 3NN8B 5DF0A 1FJ1A 3DV4A 4NKIL 4XNUH 2I07A 4W7WA 5HY9B 3HTLX 3D4ZA 4D6FA 3QUXD 4UQ3A 3EYVA 5FECB 5MHSD 3OXRA 4M8UA 3U46A 4HZ6A 3V8OA 1AXSB 3IFLL 4ORGB 2F7OA 4TTDC 1MFDH 2FRGP 4KDWA 3WEXA 1Z9OA 5A3ID 1N82A 2PYEB 4N90E 3QIBA 4MQXD 3TBWB 1JYXA 4HWUA 2VLJB 1J1PL 3MLTA 4TRPH 3KS0J 4ZSOB 4JJHA 3G08B 5GJTL 3VGDA 4AZGA 3TH2T 4NQDA 3CUIA 4P2QD 4LYRA 2J77A 2ADIB 5CMAA 5BOPA 4Y8AA 1DQTA 2YEZA 3GFUA 5AYUL 1LHZA 4JHWL 3UBXI 4OZ4B 5I6XC 3HS0A 4P23D 2J88H 1XHGA 2UYLB 2X05A 2IALA 5E2UH 5E2WL 1I1YA 1W9PA 2P43B 2PNDA 4KPHL 1AXTH 4FOMA 4MJ5A 3P4OA 4XRCA 5GRXG 5SWQA 1MFAH 1RZ7L 2EBNA 5CCKH 1RSFA 3LMYA 5D9SB 3JTTB 4N0UA 2IALB 1BBDL 3KWXA 2I25N 4OFDA 2IFGA 4OV5A 2AJUH 5DJ2B 2NZIA 3TTOA 2JCCF 3TTQA 1TVHB 4NO2B 3M17A 3GBDA 2XN9D 1QFPA 5L7XH 5D71L 3S88L 4HZLA 3L3HA 5F7WC 4G6AC 2MQ3A 4UILH 1QBBA 3OHXB 1Q9OA 3EJSA 4PMDA 4F9DA 1E4JA 3D2UA 3S3JA 5C6WH 5AZEH 2XA3A 3BUYA 3DETD 3ULUL 5LGKA 2IANE 3QDGE 3RI5F 4FNUA 1J1XL 4PRAA 1HP4A 4HKZA 4YDIL 1VPOL 4U7MA 1CD8A 3RWGB 4PMRA 2ARWA 3ZYJA 4L4TB 1N3NA 2NY3D 2D20A 2AJYH 4PJDA 4MADA 2LU3A 4PJXE 5C0AA 4Y5YB 1ITBB 3PV7A 3SPVA 1OAQH 1FFRA 1WICA 4OLYL 4FZEH 5I1GL 2CETA 5HHPA 3E3QC 4AMKH 4NFDA 1QNPA 1T1XA 4FP8H 4OZIF 1OAKL 3BYYA 4HAGA 2OZ4H 5D1XB 1UKOA 4JQXA 4PRHD 1WO2A 3TBYA 4GKOA 4WI3A 4PLOB 5HGBA 3LRSA 5EFIB 4PJ7F 2E9IA 2VDQH 5DI8B 2J25A 4L3ED 4PD4K 2JFEX 2AXGB 5BRPA 4G9FE 3HZ3A 3L4WA 4G6KH 4OZOA 5DLMH 5ADPL 3AYRA 3MO1A 1I1AA 2CKBH 4OIIL 4QGYA 3VXSA 1J0YA 4QKXB 1HVXA 5I1HL 3DX8A 5ITBL 3CZGA 4ELMB 3MOBL 4G8IB 1KIQA 1V5JA 3SGKA 1FA2A 2DKUA 5AWNL 5HXMA 3VOCA 1TLKA 2J12B 3OB0K 5KVGL 4QRPB 3D50A 1TQCB 4UTBL 5BMFL 1DUYB 4N0FB 4NJAH 3NSXA 4DGIH 3ARFB 1LWRA 1A02N 5D7IF 1CBGA 4JFDB 3OGRA 3RX8A 2D31A 2FYYB 4YHIB 4WWKC 3QFDB 4YDJB 4LCCC 4WW2C 5EU4A 4DAGL 1JWUA 3AY4A 3OG4B 4JEGB 2WZIA 3GMNA 1OT2A 1NGWA 3N06B 2OLDA 3BAYA 4HA1A 5FKYA 4ZSOA 3CSGA 1CLOL 1HEZB 1XF5A 2EZ0C 3RIAF 5E8OB 5EMYA 1WT5C 5FKAB 3KPRA 5FO8B 5LG1A 3SCNA 4EKXA 5EIIA 1MFEH 3SKJL 1H9VA 2ZUSA 2GEEA 2PW1B 4NKOB 1A2YA 1TETL 4JFXA 3A67H 4P57B 4Z2GA 1CLVA 4PJAE 1TFVA 2OX5A 3WH8A 4NKIH 3BPCA 4I4WB 3QCVH 5DJXA 4PJCF 4FQCH 4R0LB 1SEBB 4ZPVA 3WFHB 4JRYA 1JRHL 1CFNA 4PGEB 4PGEA 3SCMB 2NXYD 5F3HB 4QF1B 3HB3D 3CCHA 1E0OB 5T33L 2AV1A 5DJAB 1QNSA 1B0GB 4WY7H 5DJCB 3BMVA 4CDGC 1IE5A 3FMGL 1O7VA 1NGZB 2FL5A 2ZOLA 4K7FB 3JV5A 1WIUA 5MI0B 1GAFH 1MAMH 1GCYA 2NT0A 4F9PA 3EOTH 5C0CD 4Z0XB 5HYIA 4B53A 3CZ8A 2ZIDA 1N7ML 2A3AA 5CEZL 3QO0A 5ESQA 1S9WB 3UERA 4LXFA 4TQEL 2V7HB 2BFGA 5FOBB 4CMMA 5F1KC 1E3XA 3GNPA 4HK3N 3MLWL 3GSXA 2NTSP 3LN5A 2W91A 2A38A 2AXGA 3QZWB 4KI1A 3MV11 2F5BH 1H8NA 1MW1A 3LRHA 2YD9A 2E6QA 1DLFL 4W88A 3FFCE 4ONGL 1NLBL 1QSEA 4GQPH 1OAKH 1YNLL 1DBML 4GRWF 2D7MA 1HHGA 1AP2A 4LMQE 2JLLA 5HHMD 4U1IB 5E08L 1AGBA 1HKLH 5ISZB 4LDOB 4HWBL 4PTMA 2XTJB 4HG4K 3KPNB 4OF0A 1IKNC 5KW9L 1R3LB 5F44A 1S7TB 1K8IB 4JFHD 2PO6C 4JFOB 3AI0A 4YFEA 1JPSL 2DQEH 4EBQL 4OFYD 3D2UD 2E4TA 5LYRA 5KAQG 4JDVB 2W9LA 1BFTA 2X6MA 5A95A 5I1IH 4Z76B 3SDYH 5DJ0B 5HI3D 1FO0L 3R8QA 2N56A 5KEZA 4F79A 1CZ1A 2BVUA 2V9TA 2GUOB 3EOAA 5MEPB 3NACL 5GSRB 5K9JL 5EFIA 3NA9H 4NQED 3M46A 3JV6A 3QXAA 4NPYA 3ZL4L 1I7RB 4J3OC 4M48L 1PDKA 3SUSA 5HYJA 2B31A 3G5VB 1WFUA 5DT5A 3VA6A 1G9NH 5CZKA 3MZGB 3SDAC 3S34H 1VFAB 3UJTL 3MO4A 3BVWA 4FQPA 1T0MB 5IB5B 4OCWH 1V7NH 2VDOL 2A83A 4RWYL 4L4VB 1BOYA 2X09A 5FK9A 3MRNB 4FQHB 4RFEB 4X4YA 1BYDA 4OIBA 5BV7H 1D6VL 5ALCL 5IGXH 1GZPB 1JE6A 3TIEB 3DX0A 4W85A 4GW4B 3BAWA 1ZBKA 4ZOBA 4E9LA 3H7BB 2VCCA 2YPVL 1ND0A 4X0NA 1SEQH 3LDBB 4WO4C 1FHGA 2WVVA 2X41A 3BUPA 4ONHA 1YN7B 3V5KA 1FN4A 1MNUL 4BM7A 4GKSA 3KZSA 2XWJB 5JHDA 1VACB 5JZ7C 4K3DL 2EDEA 4X6DA 2PKDA 2VDLL 5E9DE 1B88A 2JB6A 3ARBD 2J47A 1MCPH 2BX5A 4DKAA 1JZ5A 1RZFH 2CUIA 1TNNA 2XZZA 1TQBC 1UCBL 4ODXB 3QWQB 4P2OC 2J4WL 1SYTA 3RL1B 1EZVY 4LCYB 1VFUA 4NO5B 4GW5B 1WWCA 3EFDL 1ERNA 4XCEA 4GLRH 5D6DC 5J8OA 2VC2L 3QZWG 3VXUA 1I3RA 1JXJA 1D5IH 2ZJSH 5F93C 2DQTL 4RE3A 5GGSA 5I8KL 3EW3B 1P6FA 4KJWC 2XN0A 1HKKA 1N26A 1Z0MA 3MANA 1SEBA 5CJBA 3WL1A 4QT5A 3SDCB 2W60A 2FBJL 3BZ4B 1P5UA 3BZ4A 1P4BH 2FJFB 5BJTA 1J8KA 1HKLL 3VFUA 1NMAL 1G7LB 4KQ4L 4R7DA 2VRJA 5J0BA 3MMEA 4KI5C 4OAWB 1INEL 1BAFL 1FNLA 2YUWA 5IFPA 4XC1H 4LSUL 4V1DB 3QEQE 2XUCA 4Z7UB 5ABDE 3HI1B 4L8SB 2V2TA 3ZYIA 3SKMA 1NFDE 2ITCB 4WRLA 3TJEL 1NBYA 4HS3B 1YYLH 5JW4M 3ZOAA 2GCYB 3TA9A 3RIAK 3VXRD 4WI4A 5KVEH 4ZNCD 4ODWB 4NZCA 4EN3C 1JV5B 2V5YA 1E72M 3CJJA 2DIJA 3Q2CA 1GGBL 1V7MH 3T65A 1KC5H 2EO9A 1BQLL 4PJHE 4H04A 4JKKA 2P5WD 3Q1SL 5J1AA 4NO3B 1XYZA 2IH3A 1BFSA 1DBMH 2XXCB 1K3ZA 5GGRB 4Q0XH 3SY0A 2QQLH 1FIGL 3ILQC 4JPIA 1HJUA 4LSRH 3K4DA 5B21A 3MGOB 4WSJA 3TIEA 1SY6A 1ZVSB 5T1LB 1QI4A 1U93B 4K8RH 4HC1H 2WIMA 2HMID 3T09A 4FLOA 1YEEL 1MHEB 1OARH 5BRQA 1FFNA 4Z76A 4HEME 1UB5B 2BVQA 2C1OB 2YPKB 1QSEE 4DGVL 1O5DT 3U7YL 3OKYA 3UBXG 2OSYA 3U83A 3BO8A 3IYLW 1HT6A 1JVKA 2A6DB 3N11A 1ZT1B 4MA8H 3OAUH 1T5XB 1HJVA 1T21A 4KK6C 1FH9A 4MNQA 1MJ7H 3WF3A 4HT1L 4I48B 5E4EC 5GSRA 3GXTA 5SWZE 1BTCA 5IIEA 5F88B 3QYCA 4OFVA 3EJRA 2NW0A 4NBZB 3ZDYF 4F7CA 5JW5A 5K93A 3VXRA 2BNJA 1TNMA 4OQ1A 5T1KA 1A6WH 4ZE5A 2OL3A 4O5LH 1B0WA 4ODUB 4PJAF 5EU5B 4Z6AT 5JOPE 4D6EA 5IHRA 2J2ZA 4P3CH 3ZT5A 2C3VB 4BYHA 3VA2C 5IUSA 1ZTXL 3UJIL 1P7QD 2BRQA 3W9EB 1ODUA 4UZUA 5DYOB 2AJYL 1US3A 5FKPB 1N59B 2GJRA 4U7SA 1MWAA 4TSAL 3HRZB 2PTTA 4K8RD 1KSRA 4LSVH 4RMVA 2CIKB 3G5ZA 4WHYH 5IVXB 5DUPH 1S78C 2RFXB 4QRPD 1N0LA 4JQIL 3K3QA 4G9FA 4HIHB 2ORBH 4YX2L 2BC4B 2BNRA 4CVWA 2ITDB 4N90D 3HG2A 1CIDA 3ARFD 3NFPB 3TTSA 4NQSB 1D9KB 5IOPA 3D9AL 3NPSB 1PBGA 3RX5A 1OP5H 3PJSB 1BD2B 4UQ2A 2V17L 3UBXB 1DUZB 4NQTA 4EQ3A 2BMKB 5MEQB 2WC4A 3HNTH 1GHFL 4WUUA 5B4MD 4TNWK 3VXNB 5F7DB 4OAWA 1RV6X 1CDBA 1B0RB 1C3FA 5AWNH 2ICES 1DEDA 1D5ZB 3VWKD 4J3UA 2I9LB 5FCZA 4OFPA 1TVPA 2BSRB 3LPPA 2IPKB 2XZCL 4OZIE 1IZJA 4HPYH 5FYLE 1NM9A 3NSNA 3VXPB 4Y2DC 4FQIL 4PJHF 1OWRM 1BFVL 3BWAB 2DQIH 4X4ME 3E2HC 3VIIA 4PJGE 3VXUD 1CQKA 4TUJA 2HLFD 3IDGB 4J3WA 3NFNA 1E71M 4FNQA 5F9OL 4Q58C 3SBWC 4JG1H 5DHVA 3APGA 1K6QL 5D1ZD 5BZWB 1SJEA 4BH7B 3O9WD 4BFEA 4L4VE 1LK2B 4A6YA 3ULVF 4U3AA 4NC0B 3BGMA 2GSGA 3KLLA 4ZAKA 3BISA 5EU3A 4D0BA 3II1A 1E6QM 4WJ5A 2NY3C 5KS9F 3IB4A 2VR4A 3O3UN 3O41B 3OX8B 1ODZA 4PJAB 1AO7A 3NZ8B 4JPKH 1U8LA 1MFAL 5D5ME 2QV2A 2D31B 4O02L 4ERSL 3D0VA 1H3VA 3L3IB 3HZMB 4ZO9A 2VZUA 4MLSA 4HA4A 2DM7A 4PG9B 3WY4A 4M29A 15C8H 1A5FL 5C0BA 2QPSA 3IGUA 3VO0A 1CEOA 5K9KB 4UDTB 1HDMB 5DLML 5ENWB 1TQUA 4FHBD 2CDEA 1KJMA 2FHBA 3WH6A 4LBEB 4WENB 3DX2A 2O92A 2D7TH 1BEYH 3CXHJ 2V5DA 4NZFA 1LWJA 4NNXB 2IPUG 3HNVL 5LCVL 4NRXB 5CSZA 1KNOB 3GXPA 2R15A 2IMMA 5H35A 1Q72H 4HUVB 1HN1A 4PBVC 4MLIA 2QADB 5IEKA 2Z35A 2X40A 4EUPA 3C2SA 3MYZA 3LMJL 2F54D 1KNOA 3OJDA 4LARH 1FSKC 3ARGB 4P2QA 4R90H 4U5IA 5HYQA 3MBXL 5ICXA 4PTTB 4XCCH 4XPTL 2PTVA 2VZTA 5C92A 1OOAA 1UVQA 1GPFA 4QWWD 4NOBA 1MCJA 3UAJC 4M62H 5D1QC 4HJJL 5D9MA 3ALPA 1U3JA 2AJZB 4H20L 3ZSSA 3QP3A 4OD2A 1AQ0A 2R1YB 4P46B 4LQ1A 3ARUA 3RWIA 1C5CH 4W4NA 4G6AD 1NWSA 2IXVA 1A6WL 5IMKB 2KZWA 4UQAA 2ZSVB 3W0WB 5FYJE 5D2LE 3BWUC 3NTCL 1NOFA 2A3BA 1RURH 4N8VA 1C12A 4XTRC 1J8HB 1WJ3A 3H3PH 1QYGL 1NCBL 4GXUN 3RGVC 4TQEH 5CGTA 2DQUH 4HT1H 3KXFB 1ROWA 3CUPA 4JPVH 1JDAA 1M71A 4IIQB 2WHLA 1EO5A 4UBDC 1TJGH 2ZCKH 5C0RL 1J10A 2HN7A 5DJ6A 3U4EB 4JN1L 5DK2B 2EIDA 3ALGA 2IAMC 3U7YH 2WMKA 3RDTB 2ENSA 4WEUD 1DE4A 3TBWA 4Z5RA 3U0PA 4LQFH 2QQQA 3GSWA 3NFPA 4UOQA 2KPNA 1NANI 4K3JL 1V05A 4W81A 5HHOD 5KOMC 4DQOH 4LKCA 4DFHA 4ZS6D 3WJLA 3X3FL 2PO6D 4KMQA 2A3EA 1DJSA 2WINA 2NY5L 4OGXH 3U79A 2XJ7A 5JLZB 1FNSH 1V3IA 2LTQB 3C5ZA 4JCLA 1KG0A 2NY6B 4JQIH 3GIVA 3G6AB 2QMJA 3D85A 3ZTNH 3UG5A 1EFXB 3CZEA 3WBAA 3A4AA 4C58B 3D51A 1UG9A 3N85L 3UPAA 1IGFH 3BFOA 5GIRB 5IHUL 5J7CC 4MNMA 2Y8KA 1WWBX 1VBUA 4JREB 5DDHB 4TX6A 2NZ9C 5DC9B 1A7OH 3E6FB 3TN0D 4YPGA 1A7QL 3ZKQD 4KZDH 3LPFA 4S0SD 5CJXA 2VZVA 4HCRL 2YSSA 5DRWA 4G5ZH 1QI0A 2EPMX 5DJZB 3S35H 4MNLA 4L3EB 2VLJE 1CDCA 1FDLH 1AJ7H 1Q38A 4DAGH 2WB5A 4W68A 4WDIB 3HI6H 1TA3B 3WUGA 4JPVL 3MTRA 1JNEA 6A3HA 4QTHB 4OKDA 5L2KA 1HOCB 1KTLA 2HFEB 4MSWB 2DM2A 1LL4A 1H5BA 3C60D 3QDJD 3NCBB 2BCKB 1W8NA 4NQXA 3VXRB 2RGMA 4XX6A 2BSTB 2PO6A 4M5YH 5EOCL 4Z8FL 5I2IA 5M94B 4TNWF 2EDYA 2R8SL 4W8LA 3MCG1 4HXBL 1OY3B 3QAZB 4FQCL 2BVPB 1LO3L 2PYFA 5C0ND 5B39G 4S2SA 3RUGA 3WIFB 3C5ZD 2GAZB 3NGBB 5GZNC 1XC6A 4YDLB 4XX1E 1IAKA 4WU5B 3HC0A 4KGJA 4HULB 3W39B 2GSJA 4G8GB 4WHTA 4CADB 5T1LD 3T0DA 4NRYB 5DSCA 4E5XA 2MOVA 2VWEE 4U1IA 2R1YA 3FN0L 3MJ9L 3BJ91 1QRNE 5ANME 3NTCH 3OL2A 4OZIB 2D7PA 4PTWA 5KG9A 4OTXL 2APVA 4JPKL 5DA4A 2P24B 3IT8D 3MV8D 4M02A 1T6VN 4JAWA 3EUUA 3MODL 3LS5H 3B8SA 2UWEF 3LKNB 2YXFA 3BVNA 5GGUB 2JF1A 1ZA3B 3B4NA 1N2RA 1OTTD 3EYQC 2ICWI 3RPIB 5DEFA 5HYSB 3GZAA 1IGYB 5KJRH 2LABA 4N1HB 3DMMA 3MLYH 3NCMA 3LKSA 4S1DD 5HDQL 4PJFB 5LCVH 1C90A 3EYUL 4LLVA 4KJYB 5F72S 1UZ4A 5FYJU 4JR9H 1ZJAA 2FEDC 3DTXA 3GM8A 4NHUA 4KKBD 1UKTA 3OLIA 1XGTB 4WW2F 4WLCA 2X89A 2UY4A 1S9VA 2F9BT 4HF5L 1FLTX 4UFJA 3L5IA 2WWDA 1OSEA 1Q9WB 1Z6JT 3ARVA 3VXPA 4MB4A 4HUUA 4ERSH 3PGCA 3CZFA 2V9QA 5E95B 4M8QB 3MV01 4OJFH 4YHEA 1A2YB 2EIZA 4JFXB 1XR8A 2CK2A 1MY7A 4JN2A 3L5XL 4U1HB 1KCUH 3HUJF 1GOKA 3FAXA 2XG9A 4PJ5D 3NPSC 1CL7L 1PZ2A 3IVKB 4LIQL 35C8L 4DVRH 3HI5L 5I9QB 1KWGA 2H9GB 3CX2A 2VSDA 4K3DH 5MI0C 4X0KA 4YGVB 4YJZL 1UUQA 2B4CC 2BRRL 2OYPA 2LV4A 3B9KC 4GBXD 4ZG1A 2VDRL 1CXLA 3TBSB 3O0RH 3QNYA 3SJVE 3DX9B 5BVJB 2AK4E 4QRQA 5IK3B 3ZMRA 3W0KA 1EQCA 4YK4C 4KXZH 2UY2A 1T83A 4BZ1L 3IDIB 4XPFL 5JW3L 1T20B 5MP6H 3RUGE 3QRFM 3NIFE 2IAMB 4R0LC 5D9PA 1UT9A 2Z31A 4XNYH 3MUIA 3DBXB 3BQUA 1OGTB 5J9PB 1RZ7H 2JCCE 4CKQA 3RWEA 2Z93B 4FXKA 4PY7A 1G6RL 1RZJH 5TQ0L 4ODHL 1IGMH 1GOQA 3VG9C 4UI2A 4C56D 1R5WB 3MRGB 4XWOC 3LQZA 4RFOH 5E9DA 1JGLH 5KVDL 3LAFA 1QBLH 1K2DB 4MMZC 1GAFL 1MAML 1LL6A 1H5VA 5DMYA 1KWKA 3BYTA 3JWOH 1VERA 3QEUA 4KROC 3EYPA 3DX3A 4LCWE 5FF6B 5DHYA 3ZR5A 3RPIA 1OAYL 1MJ7L 3GDBA 1D5MB 5J1SC 5DD3H 4YFLI 2PYEA 1JP5A 4XNZC 3GXMA 1IT9L 2BNRB 3EGSA 4Q2ZA 5F7LB 4MCZA 1FHLA 1TQCC 3CAFA 5IHUH 4DGVH 2OTWA 3C60A 3QDJA 3OJMB 4BQCA 5IJVA 1UWUA 1IGTB 1XZ0B 5D1XC 2J8FA 1VEOA 1ZT4B 1MSPA 5DUPL 2C3XA 4ZUVB 1YNLH 4GRMB 1X6LA 5T1KD 1LVEA 1EDTA 5GS0L 4L9LC 3UJJH 5DJ0A 1UXWB 5LBSH 4Q0XL 3PV6B 4GAGL 3CLFH 4UFIA 3BP7B 4OQTH 1F4XH 4ZTOH 4DEPB 4GMTL 5IMMB 5JTWA 3TV8A 2JCCB 3ZJ7A 1U3HA 2OK0H 3UTOA 2W65A 4XVJH 1M53A 1E4WH 3QRGH 2EPOA 3PDDA 1KIQB 4P5TC 1XCWA 2DMKA 3SE3A 1A7QH 1QFOA 2NY7L 4PGZA 4PJBA 3IJ8A 3ZE1F 3LN4A 1IZKA 3LPGA 3IJ9A 2ZCHH 5EBAA 4AH2A 1YEIL 2ESVA 3AXLA 3VMPA 1VEPA 1AXIB 4TVUA 2IF7A 5DO8A 2V17H 1GPOL 5I77A 1UM5L 4L8BA 5ILTH 1W72B 4IRSA 3AZRA 1J1OH 4ZSOE 2GKIA 3D18A 4IRJB 3BVXA 3KPSE 3F4VA 1YEHH 1OAYH 1MVYA 2VXSL 1GOIA 2O5ZH 2ZUXA 2OP4H 2G75A 4ZXBB 3O11A 5FOBA 1I8MB 4K7PY 5K9OA 1OINA 3W25A 2YHGA 3QXDB 4DM2A 1XCQB 2VRKA 1S7SA 2LAGB 3DO3A 3O0RL 5GGSY 4D9RD 3FHQA 1HF6A 1K4DB 3CXDH 1IAIM 3PGCB 5CEZD 3IAGC 1X5KA 3GKZA 3QXDA 5D93C 5I1KL 4K94H 1UB6B 1I3RB 3SE4A 4F37K 2ADGB 1QKZL 5D6DA 5E7BA 1NGQH 4MWFB 5A6LA 1JF5A 3JZ7A 3QA3B 4KKCC 1QACA 5D7LE 4ZE4A 2DQFA 1G7PA 5EU7C 5HDRA 4OB5H 4GMTH 1JFHA 1PZ5B 1MFBL 1YYMH 2MHAA 3U7WH 4HS8H 1W32A 4GXVH 1BG9A 3D3VA 2HT3D 4XMPH 1DBJH 3K8KA 4HBCL 3PQYA 1U42A 3G5YA 3MZTA 3B9DA 3R06A 1E28A 5HNNA 1AI1L 3RMEA 2YL9A 4YBQD 4NFCA 4HQQH 5BRZB 5CLWA 4HZ7A 3JXAA 1Q9KA 2J4WH 2V5RA 1TENA 3KYNB 3WD5L 4P5MA 3AQUA 1FVEB 2YXMA 5JMOC 2ZKHH 3ABZA 2XZCH 3G6JF 1KCVH 5JXAL 3UROR 2VISA 4IMKA 1F3DH 2DQTH 3L5XH 1M03A 4U1KB 4WKAA 3DUHA 1W9VA 4I3RL 1E4XI 3QFJB 4D0DB 2WYSA 4YBLC 3MV7E 4F15B 1CE1H 3C6SB 5I15H 3N9KA 2X2HA 1LD9A 2A77H 1UWEL 3MUGB 1LDPL 1T5WB 1KB9J 4QXTA 4FTVB 1J11A 2Y06H 1I7RA 2XA8L 3DRQA 4MJIE 4JR9L 3HZYA 3PWUA 5HYJB 3HFMH 1OPGL 5CJ5A 5IW1A 1FE8L 3O6FD 1OGAB 2R23B 3AU1A 3WO4B 1G94A 4NKQB 4G8IA 1A1OA 4UT7L 3GBNL 4MS8C 1FRGL 3SUUA 3SQBA 4HOWA 5JO5A 4JAMA 1RZKC 5KSVA 4NHCL 3RVVD 3WMCA 3LH2H 3BLBA 1V6UA 1W0VA 2E8YA 1YY9D 1A1OB 1W91A 5EBWB 3BRGC 1IBGL 2GJ6B 1T21B 1HIZA 4X6EA 4LVNB 4M3JA 3MRDA 5J3HC 5FO7A 1ITXA 1W2KT 5ESVB 2OJZL 3IKCB 3HLAB 5ADOL 5D1ZC 4PTVA 4XC3L 4PGDA 1CFSA 3BIKA 4RMWA 4YZFF 5I30H 5D7SL 3OKNB 4JVWA 2E6JA 1JTOA 4HK3J 1XCXA 4Y5VA 4Q9RL 1LO5A 3F7QA 5EUOF 1AE6L 3PZOA 1HNFA 2HG5B 3O4LE 5A1AA 4CNIB 4OZ4A 4XNZB 3TNNA 2EQDA 5FDWA 5TDOA 4NWTL 3PHAA 5HHXL 1A1MB 4U2ZA 3WQ6A 1WPCA 1D5BB 1ZANL 4P4KB 4HHAA 5C0NC 2VX7A 3LQMA 5C2UB 4QFUA 1CECA 2D73A 3SDYL 3VFWA 2WNWA 4YHLH 4R8WL 3HPJA 4LLAA 3KEHA 1DBAL 2ZUQB 3I6GB 1YMHA 3KLDA 4TVPE 3FW6A 3U9PH 4PRWA 4JJ5B 1YUHA 1R5IA 3CV5A 3BT2L 4IRSD 4Z0XA 2VLRE 4JM4H 1N0XL 4Y4HB 2NY4D 4JFFA 5C0JA 1S9WA 1FYHB 1U2HA 2WANA 1FZJA 4UT9L 4E42B 2DSKA 2JELH 2CGRH 3R06B 2H8PB 3H0TA 4XBPA 1U8QB 4U1GC 5JQ6H 3BKYH 3BEVA 4P0DA 12E8L 1RPKA 2ZG2A 3BH4A 2GDVA 3RWJB 3EYOB 4RFNB 4W89A 1X4XA 2FSEB 3M6DA 3WY1A 4OCWL 2JIXD 4MNHA 5D7JC 4Q9BA 2DYPB 3UP1A 1EERB 1GOMA 2YD5A 4DWSC 5JIHA 3GXIA 2F5BL 4KUCF 3FQXB 4PTUA 2FR4A 1G01A 1KXVC 1W8OA 4LSPL 5I9QC 1QNRA 4HFWA 4WI6A 4IMLB 4BKLB 3T3PE 4XCFH 4MNHB 2DLHA 2XZQL 5FDYA 3PGDB 3WNPA 2F74B 4E0RA 4Y4HC 2WUBH 4NZDA 5ITFB 2EO7A 4XBGA 5DK3A 3K1KC 5CZXD 3IFOA 1H3UA 1R34A 3ULSB 3DVGB 4LVOC 3BRFA 3PQYD 5EOCH 4LLWA 4W86A 3ULUF 1ZHNA 1JF1B 1Y6MR 1TQWA 3VSTA 3FRUA 1QNZL 1LEKB 2R0KL 5HOSA 4Z7WA 1XEDA 2AJXL 2ZUWA 2XN9B 4ONFL 4WEBH 3V5KB 2CO6B 2F54B 2A9MH 2FYYA 3LKOA 8CGTA 4WUKH 1KOAA 5EO9A 5IW3A 4IISA 3F7PC 3N0PB 1GGBH 4HKJB 4NCDA 4XI5C 1UM5H 3THCA 1FZKA 1E3ZA 4NPYB 1I85C 1V7ML 3DXAE 4KZDL 4LLDB 1GCFA 3UYRL 4UQDA 2HMIC 2FB4L 3BP7A 3HMWH 3HPLA 4OZFG 3VI3E 1IKFL 5FK9B 4XTRD 1AGCA 3JVGC 2OZ4L 3BIBX 4P2RA 2H32B 4U1NA 1AVAA 1II4E 3T0WA 1LO2H 4M8VA 1B2YA 1E4XL 3FO2A 3NCYS 4WTZA 2EADA 4RDQF 4FLQA 2X1QA 1BBJA 5DT1L 1U6AL 1Y6NR 4DN3H 1A21A 1O7AA 3V4VL 3U5UA 4FXLA 1SMOA 3MV8E 3MRNA 4FQHA 4JFEA 2VABA 3H9SE 4AENA 1W72L 1Q0XH 2E7MA 2ITDA 1CLCA 3WXVH 5ESAA 4M3KB 1JGIA 5B3JF 1MJUH 5HHOA 3ROLB 4GIAA 2EO1A 5IG7B 3HG1A 1ZS2A 2CBJA 4OT1H 1PKQE 4U1MA 4JHZA 4OM0H 3O3DA 3LXCA 1URLA 2NYYD 1GJWA 4CL7A 1GGCH 4HUXA 1J0JA 5EORL 2A6KA 2QL1A 4N42A 4P7NA 2IPUK 4HKBA 4N8CH 2BS9A 3H8NA 4EOWL 4YNYB 4JGJA 1LE5B 1A4KA 1HJWA 5I1EH 3BXWA 4PTXA 1EHXA 2F8OA 4NZTL 4YXLH 3A21A 4HKXB 3OXSB 1YMME 4I3SL 3C5SA 3QWOA 3KWWB 4OFIA 4GI9A 3QDHA 4X5LA 3G9VA 2FATL 4NHCH 5SWQB 3OPZL 3QFJE 3A67L 3CFDB 4RQQB 1F5WA 4LGSB 3GTNA 4UOJA 2J88L 4XV0A 2X10A 2EC9U 4V2XA 3QUYC 3W29A 1A4JA 1GGYA 3BP4B 1F3DJ 3V5DA 2VURA 3H42H 3GMQB 1DWHM 1RZKH 2ZPKL 1P9MC 3CIVA 3N50A 1XGQB 4O2FB 3QUXA 4XPGL 4M62L 4PY8J 2OJZH 2ZE0A 3STLB 4HKZB 4C7FA 2MKLC 4OUOA 1TTFA 2F54A 2XY2A 3RJDA 4ELKA 2Y06L 5DJ6B 3WDIA 4S10A 2DBLH 1RJYA 1K8DA 4E0RB 3LH2L 3L3KA 2Q86A 2V2WB 1NAMA 3CVHL 5CD3A 3MA9L 3HI1A 4OD1L 1CD1B 5D71H 1K9EA 1N6UA 2NY0B 4DKEL 4U6HB 4LLDA 2IQ9L 4PGCB 4UT7H 4BH8A 1D2KA 3CHFA 3VPLA 3OKKA 1WBZB 2V3EA 1GOGA 1A3LL 1NGXA 3BJLA 2YK1L 4GRLC 3TT1L 3VCLA 4AMCA 1OM0A 3ZSTA 3HAEG 4ODWA 1D5XB 1A47A 2H1PH 2WINB 4S0TD 4BKLA 3G5XA 1PQZB 3I9GL 4Z0BL 3MA7B 2KDGA 1A6TA 2IQAB 3PXJA 1H3XA 3NCEB 1WUNT 2G8ZA 3ULUC 3LN9A 3MLZH 3VD5A 4X6CA 1YY8A 1YMMD 1EGJL 2WPGA 1INDH 3BHBA 1C93A 1FG2B 5JPNA 3VWKC 1U8HA 2VDKL 1UJ3A 4PCSA 1ISXA 1QFUL 3DVGA 4K68A 1DQJB 1JZ8A 3L5HA 1H15A 2P8LA 3UETA 1HZHL 3CVHA 2Q7NA 2XIDA 5EZOH 5IEKB 2A6IA 3QG7H 3HZKA 3TA3B 2MANA 3WMBA 3N17A 3F58H 1XD1A 4OJYA 1HH6B 3OGVA 2A73A 1CENA 4U6XA 4CCEA 3INUL 4XNMA 1EUTA 3ARFC 3EJQA 4WHDA 2BVEA 5KZCD 1DUZA 2NLJB 1KIRB 1J05B 2IPTL 4I1NB 1GIGL 4FFVC 1EEQA 4O2CB 4CKVX 2WZEA 3S96A 4J3TA 4XNUL 5DSCB 1V02A 2DI9A 4OLXH 1K5NB 4N8VG 4PUEA 3HPLB 5JORA 3HJEA 1RI8A 3HMXL 3QQ3B 3Q48A 1ZTXH 1E73M 2XXMB 2AJXH 1MWAB 3ZKND 1VENA 4KY1H 1WTGT 1GOOA 4U1SA 2BVTA 3ZZ1A 4MZ3A 5DZNA 5ETUB 3PDOA 3VJ6B 5D8WA 1HXYB 3U6RB 1AGEA 4HIJB 1TCRB 4N0RA 3W24A 5D7LB 2FD6L 1OTUC 5HHNA 4MVBD 4X7TA 4ZO6A 4AT6B 4MVBC 1C5BL 1HKJA 4XCFL 4YR6A 4PCTA 5TDNA 4MJ4A 4EDXB 3GB7B 2BHZA 3KR3L 1A6VH 2A9ML 4H1LH 2DKSA 3ZKXB 4LL9A 1CGUA 4FQ2L 4YBQC 1B3WA 3DWTA 4POZD 5IEHB 5F8RC 5DVNA 1DN0B 3NABH 4Y5YA 1WCBA 3D25A 3D0VB 5AEAA 5GHWH 3VDAA 1B4JH 1G7JB 2CXKA 4YO0A 1XIWD 1YEIH 3S36X 3ZTNL 3WENA 4JO4L 1BPVA 3WD0A 5ABEA 1PYWA 2WWKT 4PP1D 3F5JA 4OB5L 1MQ8A 1J5OL 1MHPL 3MLXL 5IFAL 1R3KB 4WUUB 2DSZA 1CICB 4S1QH 5HGAB 5TDPB 2DYPA 4F57H 1PY9A 1UFUA 3GBLA 4XCEB 3EHBD 3IFNH 4ZTPH 1YEDA 1MJJB 1U8MB 2H2PD 3QIBC 4P2CG 4PGBA 4FLSA 1MFCH 3KPTA 2X42A 5JNYA 1FLRL 2PWDA 3GNOA 5JUVA 2ATPB 1MCWM 5IBLD 3AM8A 3SUVA 4L8CA 4LQFL 1FGNL 4NQCB 5IQ7L 5M17A 3KGRA 3VIFA 3P4NB 2QSCL 4JM2A 4IHOB 3GBEA 4RIRB 5FM5M 3ARGD 4KK6D 3SEPA 1KB5H 1UR2A 3SBWA 4X4ZA 1EO7A 3PL6B 1CGVA 1EH9A 5MEOB 4LCWD 1XCTA 4ODTH 3TT3H 2V2WA 4AG4H 2VXVH 2Q6WB 3OF6A 2VVSA 5IROC 1HHIA 3BOVA 2EICA 3BAXA 2NY1C 4U6YA 2DT1A 2UYLA 3WNLA 3VXME 3UTPE 4DO4A 2HP4A 3O4OB 4POUB 3R0MA 1LEGB 5E8EB 1HJXA 3TBSA 5D2LB 1NBZA 3UXFA 1U8KB 2VL5A 2YOCA 3CMGA 4OZGB 5DQJB 4LVHC 2NW3B 3F62A 3ILQD 4PJ7B 3BH9A 1D6EB 1G7HA 2Z4QB 4MWFA 5JW4N 3TP4A 4HGWB 2DBLL 4PJEA 3LIZL 1K9FA 1W9XA 3KLAB 4EQ2A 3T0ED 4M7JH 2GK0B 2HTLC 2NY5C 5J12B 1H11A 4AISA 4MQXC 1ISYA 1WITA 1AD0A 1U95B 2XYLA 2AERT 4JFQA 3SE9H 3W9EA 1CICC 4YGAB 2R4SH 2CO7B 5IMOA 3VDCA 3QHOA 1QI3A 1IMHC 1T2QL 3VFOA 5TQ2H 1AGDB 3OWEA 3ARQA 1KPRB 1MQPA 3ARGA 3OJDB 2IBBA 1ZHBB 4U1SB 1XGYL 2L7JA 3DVNA 3MACH 5JHDB 3JUGA 1KJVB 3HG1B 4R2GB 3FTGA 3OKMB 4XAWH 1BD2E 1NMCB 1TVDA 1D3CA 3TCLB 4CVZA 4DO5A 2C3WA 4PYSA 1R7OA 2DOCA 5E5RB 3G6JA 4FQJH 1B31A 1GC1H 5HYSA 2GY5A 4DTGL 3QHTC 2BHYA 3W6MA 4JY6B 4JGMA 5C07D 1F2QA 4IEFB 1RU9L 4J27A 1NEUA 2A9NL 4TUOB 4F7PB 4JFVA 4QXTB 5K59F 2L4OA 4QY8B 1AQDA 5MHSE 4UV4H 5CQ1A 3WKZA 1J9YA 1BQHG 2G3JA 3U30B 4XWOD 5DJ8A 4R96A 2NX5E 3SQOH 4I2XB 3I75A 5CFHA 1RZFL 4OD3L 4FNPA 2HRPH 3H6JA 2BNRE 3BDBA 4X5XA 3WDRA 1T04B 4D3CH 1EV2E 4FZ8H 4IUGA 3KPPB 5FL0A 2EH8L 4S1SL 1WE5A 4N0CD 1WFNA 3IETB 3VE0B 1R8LA 2X2IA 2XQBH 1U8LB 3AY4C 4F9LA 1JDDA 3BGMB 1YEFH 4G9DA 1FGNH 4WFEE 4HS3A 5AUMA 2QQNH 1OP3K 4Z7OF 5AYIA 1NBZB 2A0LC 1CWVA 2YN5A 1JNDA 3BAEL 2HTLD 1NOWA 3I6LD 2FIKA 3A4WA 3GNML 5CP3A 4PS4H 1Q0XL 3U5YA 2R1XA 4X6DF 2WVUA 3C5ZB 1E15A 2J8OA 3QUZB 3MKKA 3AIVA 2Z31B 3EJYD 4YWGH 3MJ9H 1P6WA 1EA9C 4F3FB 4L8SC 4LLYA 1JGUL 4IOFC 32C2A 4OGYH 2R0KH 2NW2B 4M61A 3T0BA 3N13A 4MZ2A 5T3ZD 5BROA 2BSRA 3B9KA 4NM8L 4PMOA 4XZUA 1SBSH 1X5YA 3BWAA 1U8KA 2NX5D 3AAZA 1BVLA 2GT9B 3CFJB 5FM5O 4KK5D 3WNNA 1UH2A 4OZHB 2LU4A 4G5ZL 3C6LC 3FB5A 5T5NG 5BS0E 5J06A 5MERB 5KSBF 3CHCA 3LEXA 2HKFH 2XOTA 4LP5A 2ARJA 2E7BA 1IM9B 2BVOB 3E0GA 5IKCA 2EKSB 3CH1B 4LPWA 1E0VA 2P44B 3QR3A 2CQVA 3IXAA 4Z7QE 4P7OA 3F5WB 1KEMH 4NO0A 3VXQB 2JKXA 3BZFA 1KUMA 2HTKC 3FB5B 3L3GA 4MD4B 4D9RE 3UTQB 2PB1A 5JBDA 3L9RA 4I77L 3L3OB 1YPZE 1IC1A 2P45B 2Z8SA 4JDZA 2IC2A 4KVNL 1T7YA 1A14H 4P46A 4XNYL 1W2VA 5E6IC 3P4LA 4DKFL 1E5NA 4MX7A 4YAQB 4A2MA 4IIQA 1NFDA 5D93B 2ATKA 2W65B 2DD8L 4FFVD 5IBUB 3AS2A 4UFMA 5BMFH 4RMQA 2HH0H 1FJ1B 3BUBA 1KBBA 1RIUH 5FYJL 2DLEA 2CR6A 3FB7B 2YD7A 5D9OA 5FA4A 4ZDHA 2P5EE 3UDWA 4WW1A 3FOLB 3S4SG 4M4RA 1GGUA 3VFMB 3ARDA 4KRMB 4HUVA 1TG7A 3PIQA 4Z7QF 3WEXB 4A6YH 1I9IL 2AJSL 3IAPA 4TNVF 2IBZY 1BVKB 1F13A 2OR7A 1FAIL 3FO9B 2PR4L 5D2NA 1IRAY 3BIAX 4E41E 2XNAA 3L5JA 5LGJB 3QUKA 4HXAL 3EMCA 2DT0A 3WNOA 1IGJA 4MA3A 5I8KH 4XMLL 4ZOAA 5ICXB 1GQIA 4GI6A 3FFCB 3U4BL 5F9WB 2E9MA 5ABHA 4DUWA 3Q5YA 1ZT7B 5ESVA 4F7PA 2CIPA 2QPUA 2ADJA 4IRSB 5EIQA 4L4OA 4XNQB 1I1CA 2Q7YB 4AIEA 3JWNC 4ODHH 3IJHA 1INQB 2HISA 2DEPA 3GMLB 4PP2A 3T0XA 2Z92B 4Y5XB 3VXTA 3L4YA 2R69L 1RQ5A 1SVCP 1CDYA 5I1LA 3K4ZA 2XSBA 2JJTC 3VXMB 1ED3A 4WFHE 1Q94B 2O9RA 1JZ2A 2DKMA 3MACL 1RURL 2CJUL 3H54A 1NWUA 5F1SA 2YL8A 3ARPA 3RHWF 5I1LB 5AG8A 2Z0BA 4XGZA 4EK7A 3SUWA 3M07A 2VDPL 3VWJD 2EEXA 5IFTA 3O6FA 3RWDB 3W0WD 3C8DA 1CNVA 4MSWA 5J3HD 5F6HI 3U0TB 4P8UA 5HGDB 2GITB 4YFDB 5DJAA 3LEVL 4I3GA 1KELL 4OGZA 2CR3A 3MMEB 1WBYA 2WUCH 2YEZB 3BLKA 4UV7H 4M1CC 3GI9L 3SURA 4R4BB 3ULVD 1X44A 1QTYT 1NEZB 5C08D 4P5KA 4ZFFB 3ULUH 1KULA 5DWUH 4AEFA 1QI5A 1G6VK 1ZBVA 4XPTH 2LQRA 3A6OA 3SKMB 5CKGA 3ZE2F 3MJ8A 3P0YH 1G9NL 4YHNA 3ZE2E 4JFSA 2HTKD 4ZAKB 3LKPB 3SCUA 5L88H 4KXZI 5SWSE 5I5RA 4U6XB 3CFKA 3WL9A 3GSRB 4NQUA 5DQJA 1JHLH 3O3BB 3QGVA 3LN5B 1T0OA 4AD1A 3X3GH 4S2SB 5EH1A 3RUGB 4WUUD 1JYVA 3N18A 5T3XE 1AR2A 4Y2DB 4M1GH 1VHPA 4NO5A 3T8XB 1SR0A 4LF3B 1X5ZA 1ZS8A 3N1MC 4ALAH 4WV1A 1GH7A 5FGBA 5CCKL 2YZ8A 3BH9B 1UWXH 1F45A 2X4UA 3PWLA 5EZJB 3UCRA 1VBRA 3AMDA 1OAZL 2DQHL 4RX4D 3GSVB 1JF6A 2PN5A 1S9YA 1XGQA 2D7NA 3CVHH 4MX7B 4QCIB 3BH8A 1BJ8A 4XP1H 4YAQA 1I8KA 3AIBA 1RU9H 3MLRH 3PDGA 4NCC2 2YD4A 2X4UB 1DBJL 3MA9H 4H5SB 3LB6C 1Q1JL 3C6LB 3PL6D 4PLKD 4UIKL 2CIKA 5TFSL 2GFTA 4ZQKA 3D87B 3ILPB 4JLRA 3BLPX 1BVZA 1RJLB 1BZ9B 3TN0B 4L4TE 1RMFH 5JDSA 3T2QA 4FXGB 1ZA3A 1RZGB 5D1QD 2L7UA 4EZMA 3LEVH 2YUVA 1QUNA 2YL6A 4G8FB 2EYSB 4YHIA 3SDDD 4MAUH 5HGHA 3HG4A 3RPMA 4J3VA 1EJ6A 2VLKB 3MREB 2Y07H 3DRTB 4CN1A 2W0FA 2OL3B 3I85A 4JM2C 2YBTA 4M6NH 1WLHA 1QRND 4M1DH 2FGWL 1XAUA 1B1YA 4F8QA 3NPZB 1NPUA 3QFDA 4YDJA 1MRDL 4M7LT 3WUWB 2CRMA 1QPKA 2DSWA 3EYFB 2CUHA 2EIZB 1D7FA 3CLWA 5FKPA 3W39A 1PYWB 3MBEB 5HDOA 1YZZA 4NZRH 3D39E 1KGUA 4MAYA 4JQVA 2WBJA 4I5BB 2EACA 3Q3GA 1DANU 4Z5RB 3MCKA 2YMXH 3CVIL 3TIDB 4ONFH 4QTIH 4WEBL 4C83A 1OAUH 1R75A 4PGBB 4G8GD 3FO2B 4RGND 3V0WH 4ONOA 5EB8A 4Q7NA 5TPWL 5CJ8A 2PW2B 2F7RA 5EN2B 4XBEH 3WUZA 5EUKB 1JPFA 3OKOA 4V2BA 5EBMB 5EWIL 2BNUB 3ULVH 4JDTL 3TIDA 4UQEA 3EHBC 1A1NB 3LS5L 4AQ1B 3CUGA 2PETA 4MJ2A 4CCCA 1HIML 2DN7A 1B90A 2HJFA 1B4RA 1VFBA 3MNZB 5J9PA 1GHRA 2QQKH 5BVPL 2VYRE 4D0CA 1XIWA 3U7VA 1RUMH 4R3SB 4R3SA 3VM5A 3VWJC 2CLVB 4AW7A 3P4MA 3QFJA 4E2OA 1UQSB 1KTBA 2OSWA 4HA3A 4MD5A 4P48A 4TSAH 3L3IA 3NAAH 4MXVE 3OKDA 3S5YA 4P5TD 3ZTJG 4XUYA 5JMRA 1OL0A 4P9ML 1QSEB 2XKUA 3EYSL 1QW9A 2WVTA 2HKHH 4UZSA 2YRLA 4UOW0 4Q97A 4R2GC 4FTVD 2WSPA 5HYJE 3LQZB 4R9HA 4BQ8A 2PWFA 5B39B 2E8ZA 5BQ7A 1OSPL 1QKZH 4YHZH 1E40A 1MUJA 3PDOB 4UDUB 1EMTH 3IS0X 4H25B 4HS6B 5ITFA 4WIWA 4LSSH 3DYPA 3UTTA 1UKSA 4GO6B 5BRZA 3TYFA 1I1XA 1PKQB 3SO3B 3PF2A 5H35B 4CAGA 1O6IA 2WHKA 3U9PL 4DUXA 4YBLB 4F15C 4V2CB 2V6HA 2YMXL 3MUAA 2JB5L 5KANG 1CFVH 2EDTA 3VRLE 1NCTA 4AZIA 2B1AL 4XP6L 3SQOL 6FABH 4M82A 1AJ7L 2P8MA 4PJ5B 1IM3A 2ZWLT 1A3QA 2ZX8A 2R0WH 3GH4A 4HC1L 4PG9A 3JUZA 4QRQB 5IK3A 3JBG7 4UIMA 1HYRC 2WMFA 1VGEL 4AEIH 4OLYH 4UNIA 2APFA 2AEQL 3ZKMD 4BH8B 1EFQA 1SQ2N 4AMKL 1G9NC 4CBPA 2D9QB 1Q6EA 4O02H 4UU9A 4WV1B 1JFXA 2B1HH 5EFFA 2H2PC 4PRBB 3V0VA 4UIMB 2YRZA 4YHOL 4Z2KA 4EI6A 3O6ML 4Y16B 3DV4B 3U4AA 3GNMH 1UWTA 3AXHA 1H15B 4JRYD 4H26B 1XSKA 1AHWA 3BDXA 1S7WB 1KACB 3AUVA 2OW7A 5IW6B 1AIFB 3CTTA 3HNSH 2CPUA 2I07B 4QTIL 3SO3C 5E09A 2WMJA 1HKIA 2OQJB 1J0KA 1NARA 1P7HL 3VE0A 3BAKA 3I9GH 4YHYB 1R0AH 1EIBA 4OCXH 3LIZH 2VRAA 1K4DA 5I66B 2XWJA 4PJEE 4X6EB 5IB1A 1MH5B 4JHAL 3MBXH 4KRPD 2AV7B 4UV4L 1ED3B 3UG4A 4QYOA 5HHVL 4P8XA 1A1NA 1EBPA 3IJHB 4KWUA 3B43A 4WFGD 3DC0A 5E8OA 5A2AA 1Q94A 3G6JE 4Y19E 1NLDH 2JIXB 1T1YA 1XMWA 2A83B 3WUWG 2ENYA 1ONQA 1RK1A 2DYPD 3EJUA 3U0WL 4F7CB 1JHKL 5IVXE 1ULVA 5EU4B 3VXMA 4W5ZA 4QXUL 1EVTC 4RAVA 4EVNB 3QQ4A 5E99L 3OAYH 3QCTH 5FUOL 1U92B 2A6JA 2VZ3A 4K71B 5E5MB 3AS3A 2IBZX 4H1LG 4MAYD 3CO4A 3ORJA 3V4UL 4MD5B 2ZX7A 4XB7A 1HXMB 2YDQA 3WE6B 4URIA 1OTSC 1W1PA 4HIHA 3MLVL 2D23A 5D2NC 1YPZB 2BY1A 2FGWH 3EMZA 1CE6B 1Q8MA 3CMOL 3OGCA 4YDKH 4D6CA 2HJFB 3D2UB 3KJ6L 1JPFB 3OKOB 3F12B 4KK9D 4N0YL 4YXKH 1V0NA 1MF2L 4FQQB 3VW3H 3RY6A 1ZHKB 3N1QC 1MQKH 4XMPL 4XP1L 2HVJB 3UDWC 1QI2A 1NSNL 4PRHE 3DMMC 2OZ4A 5D7LA 3SN6N 4QOKD 4DW2H 1T6WA 2BY0A 4P4RA 4PBWD 4NNYA 3G6AA 4YDIH 4E8CA 5GRWA 3L6FA 2XPGA 3WIHH 5HBBA 2WZHA 1KFWA 4P3WA 1EXPA 1B0IA 2FE0A 3CNKA 1RZIB 3OR6A 3QDAA 3REVB 1Q9KB 2O5YH 1QBML 4GMSL 3CXDL 2R4RH 3MJ7B 2GCYA 1DQML 4LSDA 5GRUH 3E6FA 2IH3B 1L4IA 1X5AA 2NX5A 4M5YL 4W6XB 5JXEC 4U1LA 4QHMB 3CZJA 4ATLA 2FWOB 3HG5A 4OZFB 2X4TA 2AEWA 5DEGB 3RA7L 3BKCH 3VH8A 1RUPL 4JY4A 5I8EA 4PD4J 1LD9B 1WNOA 1UB5A 2BVQB 2C1OA 2OQJA 1B2WL 4UT6L 3X17A 5EOCJ 1FO0H 1UGNA 3FO0H 4AD3A 1HHGB 5DUBB 5SWZB 4EI6B 4OKVA 5DMGD 2CDFA 5F7MC 3ECQA 5EU6D 4GXVL 2HWZL 5MEOA 1W1YA 3ILPA 4JLRB 4OM1H 3WNMA 2VX4A 2AK4D 1JPSH 2IANA 3QDGA 3RCNA 2J8UA 4G6JH 1ADQH 1BQHA 1AGFA 1ES0B 4J8RA 3RDTC 5FYKL 1M7DA 2VXUL 4WU7B 5EPMA 3I2CH 1CLYL 4P2OA 3MUZ1 1HQ4B 5IVXF 1V0LA 1EZVX 4JVUA 2PF6A 3P4OB 3IFNL 2Q76A 4XRCB 4M9PA 3FJTA 2VXTH 1NGWB 5SX4I 1G0YR 2WUCL 4APQA 4I2XE 4QCEA 5CIPB 3OXSA 1F8TH 3GUTA 5E8NA 5DD5L 3QG6A 3LQAL 4JZJA 1DFBL 4P57A 3EJJX 1E0WA 1HKMA 3WJLC 5CHNB 3LY6A 4I4WA 4KMTL 5DS8A 5GJSL 5D1XD 2EC9T 3WFHA 2PR4H 2DLFH 1YNKL 2D3LA 2WBGA 4JN2B 1FN4B 2IGFL 1YQVH 1Z9SA 3ROLA 3L95B 1MQQA 4B7IA 5J11C 5EU6A 3LVEA 5F3BA 3I6GA 3SCOA 1LO3H 4RGNC 1NMBL 2WVVB 2V9RA 4L8BB 2VABB 1ZV5A 2ADFL 2VXQH 2X4SA 1CD0A 1TCRA 1JN6A 3TM6A 3IF1B 1MELA 1W0WA 2UY3A 3WO3B 3GJFB 5BXTA 2XKSA 5D7JD 5D5MF 4F7MA 1PLGL 3OZ9H 1P4IL 5IOPB 3ZJ6A 1LLOA 5ADPH 5F1OB 1L0PA 4NHUB 3WIIL 4YR6B 1BZ7A 3RUGF 3MRQA 3RGHA 1NQBA 4NZUH 1BZQK 4PMYA 4TUOA 5ADOH 2D1ZA 4MMXC 3CUJA 1A4JB 2VDLH 3UJIH 3CFCL 3T4YA 4CD6A 3T4YB 1MHPH 3PGFH 5DJDB 3U2SA 1YYLL 2FJHB 2Y7QA 2DSUA 3B3IA 4FFWD 4GJTB 4PRID 4GG6F 3DUUA 1ORSA 2LAAA 3HA0A 3NIGE 1CDJA 3BXNA 4OFKA 5HPMA 3W28A 5HSFA 4YXHH 4JFPB 4JDVA 3CLEH 5CPTA 2X5PA 1VB9A 3UTSD 3MCLL 1JF1A 2MCPH 1L6XA 2YD8A 3UAJD 1S7TA 5LGJA 5JA9A 1U8NA 2QLYA 1ZSDA 1FCCA 3LV3B 2I9TB 1BX2A 4ORZC 1ZU8A 3IAQA 1H0DB 2NY4C 4P4KD 4LYPA 5E0CA 3MJGX 3BT2H 5HHPB 3MXWH 1VADB 5FUZH 5KAQF 3S88H 1YN6A 2HJKB 4WI2A 4XX1G 3VXOB 5KZCB 4KRNA 5BW7A 4X6DE 3OKKB 4XP5H 4F37F 5BRZE 7CGTA 4DWHA 5IWLC 2ILLA 5EUOE 3WY3A 1FIGH 4XCYA 4FNRA 2C3GA 1HINH 4OZGA 2NXYC 1KCRH 3I6LE 4CD5A 3MXVH 4NT6B 4A3HA 3QI9C 4WTZG 3TNMA 25C8H 1YY9C 4F9LC 1BEYL 2D7TL 5E0QA 5A8NA 4U1JA 1MCQA 2ID5A 2VL5B 5BZWA 4BH7A 1F4YH 4JPIB 2CSPA 1BWWA 1D5XA 4TVPD 2AXJA 3RI5K 3R0NA 4RA0C 3RVUD 4XC3H 3X14B 5GS1B 4AWEA 4WDIA 3BDYL 4JO2H 2EPLX 5I30L 1KXQE 5FYKD 2RCSL 4D9QD 5E8DH 2ZOKA 4Y4FC 5DRWB 2AQ1A 4D6GA 1QHPA 4LGPB 4IPLA 3KL5A 1Z9MA 5E6IB 5ISZD 4R97C 4ZENA 1LO0L 5ALCH 2NTFB 2LVCA 4OUUA 4GPNA 5LA1A 4OUEA 3DIFB 1NQ6A 3MLTB 4L5FL 5IKCB 4ZUUA 1QRNA 5ANMA 2VWEC 4DWSB 1WQVT 5B38B 4LPCA 3LEYL 2C7UB 1PKOA 3B9EA 2VSCA 3NZHL 4LSQL 4OLVH 3BPOB 4F58L 2E9WA 2J7HA 2NTFA 1X5LA 4LRNH 2DH2A 1BIIA 4RSVA 1N8ZA 2FX7L 4PJHA 4KKBC 4N1CA 5FHAL 1ZLUH 4N8CL 1Z9LA 5GZND 2WBJD 1BFOB 3LXBA 5CILH 4JB9L 1X7QB 3RWIB 5I1EL 1MCPL 1Q6CA 5EOQH 3LS4L 4MD0A 2OI9B 3PZUA 2BC4A 4QLRA 3VXUB 1R6VA 2ZSVA 3RWHB 3W0WA 2YPLA 4Y4KC 1JMZA 4K7PH 2EXOA 1JG9A 2P47B 4RNRA 2BNQA 4K2UH 4U6TA 4XPHL 3NBNA 1QFWH 5EBLB 4OLUL 3O6AA 1UM4L 1IC7H 1H0DA 1CFTA 3C60C 1J01A 4HIJA 1AGEB 3WXVL 2DQEL 4PRDB 3T1WA 1EJOL 1QZ1A 4KRPC 4QXWA 1W72H 5CEYA 1KLGB 1NGQL 1SYVB 4N8PA 4J12A 5DGRA 4P4RB 3MJ9A 3PABA 1JWMA 1YUHB 4G3YL 4LFHD 1HXYA 1NCWL 4GG8A 4O4YL 2EDDA 2J78A 1HTYA 3GI8L 2GK1B 2AAAA 3ET9F 1INQA 3RWCB 3V9FA 3FY1A 5C6TH 2OCFD 3V6OA 1N64H 2VE6A 5A2FA 3RTQA 1U58A 4RA3A 1OQOA 4F8XA 4EDXA 1OW0A 4JGUA 2G60L 2VQUA 4L3CB 3UYOD 4Y5VC 5F9OH 4KJPC 3RWCA 4LBEA 3WL0A 3MNVA 1JGEB 3MNVB 2V5MA 5FYKU 4LEXH 3VIGA 4KTEH 2XWDA 4AYGA 2J7EA 5AC4A 5F70A 1DEEB 5IR1B 3EJZC 2PUQT 3RJYA 1BFVH 4L3CA 5C0IB 3RVWC 4NN7C 3SGJA 5GGVL 1TDQA 3M45A 1M7XA 4KTYA 2GSIA 5GZOC 3WO4C 4Z9KB 3FOMB 1I3UA 1R5VB 2A6IB 2C1PA 2NYYC 4PJAA 5ID0A 4AJ0A 4Z7WB 1UHVA 1CDUA 4UUJB 1QW8A 3VRLF 3GBMH 3JV4A 1NAML 3WKNA 3C6LD 3IJYB 3QUML 2DQDH 4FNLL 1MHHA 1KFAL 3FFDA 1MCIA 1U8JA 3L3DB 4JY5H 1RZJC 1NUNB 5DHVB 2DPEA 3MLPA 3BZEB 1MI5B 1YNKH 5DVKA 3TO4D 3DX7B 1XD0A 1HHIB 1FYTD 1NMCC 3WQWA 5I8CB 5CIPA 3WFDH 4NOFA 5C0FB 1H1NA 1BFOA 4H8HA 1LE9B 5F71A 5A8OA 4PLJD 3E6HA 4TTDD 1LF1A 2XQYG 4P9HC 1XGPB 5EA0L 1FFPA 3VGGA 3KYAA 5IROA 4BQ9A 5A40E 3EDFA 2D03H 1D6EA 1TZHB 4L3EA 1S9KC 1U95A 5GRZA 1J8HD 1PQZA 3MRPB 3RWFB 3SDDC 3BGFC 4PJEB 2F1BA 1DDHA 1LEGA 2ARJB 3F65A 1PGRB 3KLAA 1TQVA 1KC5L 1I1AD 5A2KH 2EIEA 3W27A 4PV8B 6TAAA 3WD2A 4C57C 2GFBB 4F9JA 2GFBA 1L7IL 2R1WB 3E2HB 2Z4QA 1VGKA 5D72H 1D9KA 3QEQD 5KVMC 5DUML 2ED9A 2P5WB 3RDTD 2DH3A 3IFPB 1NDGA 1YMMB 3CLFL 3WUBA 3T3MF 2UZXB 2WWMD 5GZOD 1FE8H 1FP8A 3LKRB 1WCBB 3D25B 1QP1A 3CGTA 4G6FB 1CDIA 5HJ3A 3KPSD 3EJZD 3HLAA 5LXGL 3QXTA 2AVGA 1NCBH 2YK1H 1QLFB 4JRYE 1UWSA 1OARL 3THDA 2XACC 2YS4A 4QEGA 3MV7A 2G3MA 1A4KB 5LKNA 4L8DA 1YEDB 2GQHA 1RIUL 1CGYA 4UQ2B 5FYJH 3BUIA 2EH7H 1U8IA 5JNYB 1J8HA 4HKXA 1T7WA 4DKEH 3AGVA 3C2AL 1S7QA 1LO0H 4RCAA 2DMBA 4RX4A 3AOFA 3HMXH 2B0SH 3VRIA 5JOFB 1ODAA 2QKIA 4HHAB 4X99B 3QNZB 2XWBB 3CIQA 5KSBE 5HBFA 2NQCA 4PB9H 1NBVH 5AUMB 3V5DB 2H3NA 3MODH 4M5ZH 1QFHA 2ERJC 3WN5A 1C5DB 1VKXA 3PQYE 5EBMA 3SCMD 3AIUA