4LC8A

Crystal structure of the mutant h128n of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
222
structure length
222
Chain Sequence
DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSNPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the mutant H128N of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with the inhibitor BMP
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 84
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4lc8A00
3ANYA 3IVTA 5K2ZA 5CZTA 1JCXA 2CLKA 2NX1A 4O15A 3ZWSA 1ONRA 3W1MA 1HFBA 1WBHA 3QMRA 4IWWA 3W7KA 3LCXA 2WSRA 3NEVA 1KFJA 3PUDA 3TW7A 4S2CA 2BLEA 3B8DA 1EPXA 3E49A 3Q2DA 3SSJA 5AC6A 1M7PA 1W5OA 5KITA 4GNJA 2WO5A 2V0TA 3IV3A 2NV2A 2A5HA 2VKZG 4RV8A 2YYUA 2FB2A 2YCEA 5HNRA 1JCNA 4JIQA 2V82A 4DF1A 4BK9A 5EL1A 4JX5A 3NZ1A 3TV8A 4E2BA 4JDBA 1KW1A 1F5ZA 3W2MA 4HNVA 1WQ5A 2D73A 2ZA2A 4MY9A 5G2HA 3PR2A 4O17A 4MY8A 3F03K 4DQWA 2ISVA 2VFFA 4WUIA 1FCVA 3O6YX 4WY0B 2R91A 5EA9A 1OHLA 4ADSA 1AW1A 1F6KA 3P61A 1ZY9A 7TIMA 3W87A 1ZFJA 3NR0A 3G1SA 3QZEA 1LOQA 1W3NA 4JS3A 1F74A 3EWWA 4K8HA 1M5WA 2Z1BA 4J9JA 1WV2A 2VFIA 3TQ0A 4WOZA 3STFA 1H1YA 3R5EA 5LKYA 3P5YA 3ZR4A 3DAQA 4BI7A 3S0CA 1H60A 5BRBA 4M7SA 2RDTA 1YXDA 2HMCA 3C2FA 3GIYA 3L0NA 1TTPA 1L6WA 1VPXA 4CLMA 3W2UA 3HG2A 3LV5A 4FNSA 1XXXA 1UBSA 1FDZA 4GUIA 3QPZA 4X2RA 3CLMA 3MHUA 4AXKA 2JKEA 2ABAA 3GKFA 4GFSA 4UNLA 4Y6GA 3EX4A 1RPXA 2Q8ZA 5HQEA 3KVMA 4RXGA 2R8WA 1LP6A 1YDNA 4IPIA 3RK8A 1FX6A 1OJXA 4IMDA 4DXVA 3PB0A 2VEMA 3QF0A 5ABTA 4RLIA 5BW6A 1AG1O 1LLWA 3AJXA 4UFIA 5DCDA 1AK5A 3E12A 3GK0A 1SO4A 5IBXC 4IX0A 4UTUA 3SGZA 3HG3A 1GZGA 2JKPA 4AEOA 5I3HA 3OVQA 1VGAA 3U2OA 2ZZ4A 4NJJA 1F7BA 1C29A 3FA5A 2C1HA 4AHQA 3G3MA 3QC3A 4UTLA 3A9IA 4JTSA 4PC8A 1H7OA 3MYOA 4JYFA 5DN1A 2GJLA 3GR8A 4CQAA 1GYLA 3QJAA 3SGUA 2CZDA 1QOQA 1THFD 1K7XA 5DY3A 2C0AA 5C54A 1YPFA 5CPMA 2ZQ0A 4IJBA 3GAYA 2CU0A 1VHCA 1FWWA 3W2LA 1Z48A 3L5LA 3LHTA 5G2IA 2A6LA 3C6CA 2FB3A 3TFCA 2BWGA 4HNNA 4O28A 4Y96A 3L67A 1QO2A 1JRCA 1M6JA 4N9CA 3A22A 1XBYA 2FPTA 1TRIA 4O12A 3PG9A 1TV8A 1PVNA 3LOTA 2PC4A 5J5RA 5F2MA 5EY5A 3NO5A 3LI0A 3EWXA 1JUKA 5L9FA 1DQXA 4O4WA 2YXGA 1WYIA 4Q32A 4A3UA 4M7TA 3S42A 3N9SA 3N2XA 3OHIA 4I7UA 1W31A 3F4NA 1NVMA 3CEUA 4U28A 3CWNA 3PAJA 1TTQA 1Q6QA 2E5BA 5K9DA 4UXDA 4BI6A 1VCGA 2FPVA 4NT0A 3NQFA 4O50A 5KZDA 3FYOA 3TX9A 4YMZA 1K7FA 4N2YA 5AHLA 5F4XA 1O60A 4O14A 2E77A 2V2DA 1OFPA 2CZEA 3M16A 2ISWA 3TDFA 2XFWA 1J5TA 1O4UA 2ZZ2A 3NL5A 4KWWA 4LUJA 5HWJA 1QPOA 2WPBA 2DJXA 4AB4A 4IXXA 3W1RA 2JK2A 4EF8A 3QFEA 2NUYA 1JCMP 3NGJA 1W37A 3NPVA 4DO5A 1HL2A 2DJLA 3CU2A 4WY0A 5C2XA 1IIHA 3HGSA 5CZSA 1KM4A 3P67A 4GUFA 2C16A 3OA3A 3CIWA 3DENA 4DF2A 5CG7A 2WV8A 4AH7A 4R34A 2J88A 2A7PA 4CCDA 3UYCA 3LX9A 3W85A 1FXQA 1TB3A 3Q94A 3GXPA 2ALDA 3O6CA 2C19A 1G4SA 1I2PA 1TJRA 2CW6A 3KX6A 3C3NA 4N4QA 1GG1A 1L2UA 2LLEA 3BV4A 4MFEA 3KOFA 1H7XA 1K8ZA 2VELA 1QCWA 2WNZA 5HINA 4TMBA 5FEWA 2XN0A 1JRBA 2A7RA 4OGZA 3R2GA 4UTWA 3LRMA 4OBTA 3V1PA 1VLIA 3THAA 1KBIA 5I3FA 4G1KA 3I7SA 1P0KA 3LCIA 4QM1A 4K38A 4WY0F 4NQ1A 5I3GA 1FCUA 4RJEA 3TA6A 1OK6A 5AHIA 4R7JA 3M7WA 3VE9A 2H90A 3SZ8A 4ZQMA 4Z0JA 3BLFA 5LNUA 2CLIA 3CC1A 4I9AA 4KKXA 2CZFA 2NXIA 4EF9A 2F84A 5KTLA 1S3HA 1M7OA 3EWYA 3UWVA 3W7EA 1SU5A 2WNNA 1BWLA 4HPJA 2QR6A 3TKFA 4CQ8A 3IGUA 3NDOA 3RNDA 1JQVA 3DHDA 2VFDA 3W2KA 1J4EA 3BG5A 1ICPA 6ALDA 1F2JA 3NQ2A 2VENA 2V2CA 3LCLA 1R47A 1SFLA 5G2WA 5K7JA 1NFBA 5E93A 4GUJA 4RZ5A 1VHNA 3LCWA 2WKJA 3M0ZA 4GWEA 1O94A 3G0SA 3P82A 2QCEA 3W7GA 5TBOA 1WBJA 2I9EA 5D04C 1FY6A 2E6FA 3G8EA 4JTEA 2X1SA 4RCXA 4HNUA 4QIUA 3T44A 3M41A 3UWWA 1YPIA 4M5PA 2YGYA 4P61A 4Z08A 3GR7A 1IF2A 2Q3RA 2VEPA 4AHOA 4UTJA 1JR1A 1ADOA 3QYQA 4IMCA 3M6YA 3P62A 4EOUA 4GC4A 3QQ0A 4MLRA 4BI5A 1TREA 5D33A 4UTMA 3WK0A 5EKYA 2HS6A 5K9XA 4UFMA 2B7QA 4JTTA 3SFKA 2AGKA 3W3OA 3T4CA 3NQ6A 2YW3A 2QCNA 1MEHA 4JTFA 4YCPA 3G1DA 1QNVA 5HJLA 1FBAA 1S5VA 3PM6A 1SW0A 1XL9A 4UTTC 3W7PA 1KFEA 1W5PA 3H53A 3T55A 1MSSA 3GB6A 4TX9A 5D2TA 3B05A 1KM1A 3HO8A 4HHPA 5CKSA 2DZXA 1SZGA 4HPXA 3TXVA 2Y63A 1MZHA 1WOAA 3NPWA 2GUUA 3O06A 4NNBA 3UY7A 4N6FA 1GVQA 3W7NA 4PEKA 2NV1A 3TROA 1A50A 1KFBA 4Q33A 3CEPA 2EGZA 4L4LA 2QAFA 4N4PA 1EP1A 1OFDA 3LHWA 3C2EA 3PC0A 4OQVA 1GEQA 1LOLA 1LRNA 3W7LA 3OEXA 2A7NA 4XBKA 4TIMA 1FDYA 5LNRA 1C9DA 4BWLC 3FYPA 4E2DA 2ZRXA 3S5OA 3WJXA 2H8ZA 5LHFA 1D3HA 1TPH1 3BLEA 4BF9A 3TUUA 1N7KA 3RFAA 3U8GA 2GJNA 4PL2A 4XUGA 3P60A 4DF0A 1QAPA 5D37A 1CW2A 4LS1A 2FTPA 1SO3A 3TJXA 3UXAA 1GVOA 2YFOA 4W9TA 4UTKA 4FO4A 3UXDA 2E68A 1H63A 4O1CA 2H8XA 5DCEA 1QWGA 1XDMA 1ZAIA 2I14A 4PL1A 1IGSA 1KTCA 2DORA 2RH9A 5D02A 4JIPA 3W71A 2DZSA 3W9ZA 1FCQA 1AL7A 2OT0A 3EKLA 3QMTA 3EB2A 1OG0A 1KFLA 5F1UA 3S5NA 1SO6A 2EKCA 5F4SA 3MP3A 4FXSA 4P2VA 4FX7A 3W7CA 4UTHA 3L65A 1VQTA 5U4NA 4PODA 3M5VA 4GBUA 1L6SA 4ADTA 3SW6A 6TIMA 3G0UA 1A5AA 4GXMA 4R33A 2ZCGA 4IQLA 4NXKA 1PCWA 2IQTA 1LOSA 3NL3A 2P10A 2QUVA 1WDWA 2DZPA 4O18A 1GYNA 1OFQA 1K8YA 3G8RA 1NSJA 3LLFA 1MXSA 3GDRA 2GPTA 5AYZA 4Z1CA 2QCCA 4XKYB 4LW7A 1RQBA 3TMQA 3NVTA 1G6CA 5FF0A 4MZ1A 3BLIA 3PS7A 2DP3A 2Z2UA 3UWUA 1JUEA 4FXRA 3HPSA 4TR9A 1JULA 3MUXA 1XFBA 1TV5A 3W1TA 3L0KA 1R2RA 3CHVA 4C1KA 5HWMA 4TU1A 3ZFHA 2CFFA 2KZHA 4CNOA 4AAJA 3C61A 3TK7A 2V8ZA 4N02A 5AYXA 1SW7A 3P74A 4XKYA 2Q8LA 3TMLA 5K4ZA 2BX7A 3E02A 1OFOA 4FX6M 3R12A 3GVGA 3PB2A 4IX2A 5K9CA 2CLFA 4CCCA 3C0JA 1UASA 4IMFA 2QCGA 3G24A 3QM3A 5CSSA 1RVGA 2YPIA 4LT9A 3L2IA 3UZJA 1V5XA 3R8RA 4RX0A 2X30A 3LHUA 5AC8A 2EPHA 1YTEA 5K4XA 2G95A 3A5VA 5D38A 2CZ5A 2GQ8A 5K3VA 1GVFA 4NZJA 4NJKA 1T0OA 4BWLA 3DI1A 1D3GA 2Z0IA 4AHPA 4LVBA 4D2JA 5G1YA 2EAWA 1KM3A 4GUGA 3UZ5A 3UNDA 4H4IA 3IIXA 5DY2A 1PHWA 1QMLA 4DPQA 2ATMA 2CLHA 3DFSA 1I8JA 1TPDA 5U7SA 1YADA 4QSHA 4CQ9A 4GUHA 1LM1A 4MIMA 5HULA 5EMUA 2FIQA 3LHVA 3W1NA 1R30A 3ELFA 2QCHA 2DZVA 4LTSA 2XN2A 2ZZ3A 1G7VA 3STGA 1ME8A 1LBMA 3CT7A 1XCFA 1MO0A 1VS1A 5AHFA 1QPQA 3FIGA 4WQ6A 3QSTA 1A5BA 3W1LA 3LRLA 1GWJA 5D30A 1ML1A 1DJQA 3MMTA 3FS2A 2ZDRA 1MEWA 3BVJA 2A1YA 4FIRA 2J27A 3DFNA 4PFMA 5FF2A 3NG3A 2Z6IA 3S9YA 4H3DA 3S8HA 3HG5A 1BTMA 1EP3A 3QH2A 1F76A 4JICA 5C5YA 1DV7A 4FNUA 1QOPA 2X2GA 1VRDA 4JY8A 1B57A 2HS8A 2EHHA 5IBXA 2ZA1A 3G1FA 5L6UA 5HWNA 2ZZ6A 4JGDA 3RU6A 4LV9A 3O8AA 1L6YA 3ABOA 4IUOA 2G96A 4HSNA 3IEBA 1H7RA 2J9ZA 1T99A 2Y85A 1EWEA 5EBUA 3U6WA 4DELA 4WXYA 2X1TA 3NQGA 3STCA 1HUVA 3PSVA 2V81A 3VI2A 3NQDA 2QCFA 2A6NA 4MUZA 3TSBA 3B06A 2VOMA 3WK1A 3DKJA 3HF3A 1Q45A 3FEMA 4LRSA 2E6YA 4O10A 3NA8A 1LTDA 2V30A 4I7VA 5CPNA 3W2JA 5H2ZA 1EUNA 1LCOA 4Z1BA 1OABA 4JR5A 1IIGA 2PURA 1ME9A 3EX1A 4UCGA 1TQXA 2QDHA 3W1QA 4LVDA 1A5SA 3IVUA 3DFOA 2QKFA 1I2QA 5TIMA 3BGJA 2NXGA 2QF7A 2TRSA 3TW6A 3NL2A 4MJZA 3ABRA 1Q6OA 2CLMA 4NVTA 2HSAA 4R53A 1I45A 2YX0A 4O1DA 2Y62A 1VYRA 1VJIA 4IOTA 3P80A 4MKNA 4AVFA 1G4PA 3BARA 3NQEA 1P1XA 3V75A 2GVLA 4NX5A 1XUZA 1ZALA 5IM51 4KFOA 4GE8A 3W7QA 1UUMA 2I1OA 1OFRA 3TNOA 1YTDA 1NF7A 4S1FA 3P5ZA 1NAL1 1KV5A 1ZNNA 2HTMA 3DU0A 2CLEA 5DXXA 2VEIA 3TSMA 3INPA 4AF0B 1SO5A 4CNNA 4LWWA 3W1PA 3OIXA 4LS0A 5FEXA 1VYSX 4O53A 2QJGA 1G4TA 3NM1A 4C1LA 5D2VA 1NF0A 2ZYFA 3FJLA 1WX0A 3TJLA 1H7NA 3QMSA 3M9YA 4ORIA 4MOZA 1FWNA 1W5NA 3NQMA 4A2SA 5CSRA 3IIOA 2FLIA 4JX6A 2NLIA 4QJ1A 4UFHA 5HR6A 5KINA 3CB8A 2WSYA 4WD0A 4JYDA 4JN6A 2YW4A 3H54A 4UTIA 1W56A 3MJYA 4NJGA 3W74A 1G4EA 2Y6ZA 3KVJA 5E1QA 2FQIA 3BG3A 3LXBA 4FEZA 3I65A 4LS2A 3DKLA 2ZA3A 1N55A 3W6YA 4YXGA 3O1NA 4LUIA 2PRHA 5FF4A 4O0KA 1QO5A 3EX3A 2O7SA 4H6KA 5DELA 2J24A 3C4UA 3P81A 3FFSA 1ME7A 1W5MA 1TQJA 3GDLA 4ALDA 1EUAA 3DI0A 4L4MA 4MPQA 5AN7A 3PSWA 3OG3A 3SI9A 4NJIA 2P0OA 4X3ZA 2BZNA 5DXYA 1RV8A 2ZBTA 3PBVA 5GVJA 3BG9A 3FJ6A 5LSMA 3BGGA 3M5XA 1RQHA 4JTHA 1OFAA 1K03A 3NQ8A 3QW4B 1PHQA 3TQKA 3LRKA 1TMHA 2BSLA 2PRMA 3FKKA 3FOKA 3K30A 3S5ZA 1GQNA 1EA0A 3W86A 1T96A 1TIMA 3N9RA 3B0PA 1GTEA 1TPFA 5A8GA 3G1AA 3RLVA 3GLCA 2QJHA 2JBMA 1OF8A 3B03A 1IXNA 1QPNA 3MBDA 1F05A 1TO3A 3TIMA 5SWUA 5A5WA 3O05A 2W0UA 1KM2A 2Y89A 1JCJA 2J6XA 3UWQA 1RR2A 3N3MA 4CNPA 3MYPA 4Q4KA 4ADUA 5I3IA 4XTDA 2QUTA 1EX5A 1VH7A 2E6AA 1QPRA 2Y70A 3A21A 3M47A 5D2XA 4AF0A 3P84A 2NUWA 3UWYA 1AW2A 2RDUA 4ML9A 1U83A 2C3ZA 2ZTJA 4LU0A 4M19A 3SJ3A 3W83A 2OX1A 4DBDA 3DFQA 3PULA 1EB3A 4N9DA 2GVJA 4XZ9A 3FKRA 3GDMA 1N8FA 5MHBA 1K3UA 3EXRA 4RXFA 1OX6A 3JRKA 3ATZA 5EPDA 1S5TA 3N73A 4K36A 2BTMA 2H3BA 1OF6A 3BK0A 2J9YA 5D03A 2ISSA 1IXQA 3GX9A 4NU7A 3N34A 3NQVA 2OJPA 3W2NA 3UQNA 3IIZA 4RKAA 1DBTA 2FDSA 3QQ1A 3G1YA 3IVSA 3TAKA 3MBFA 4O54A 3G1HA 3Q58A 4ZQCA 1HTIA 1T8XA 4LC6A 1CX9A 4E0CA 2RKXA 2B0MA 4JNMA 4Z1AA 3MWAA 4IMGA 1PV8A 3L0GA 3IGXA 1YDVA 1OYAA 3NPXA 1K8XA 1W54A 3LTPA 4A29A 2QEZA 1GT8A 3EEGA 3EKZA 4LRTA 4WX2A 5LNSA 1WAUA 1E51A 3F4WA 4RR4A 3NL6A 1TTIA 4ICNA 4PA8A 4XWUA 1B3OA 4M6PA 3MP4A 3W7IA 1OFBA 5HR7A 3UPBA 5AHEA 5D05A 4EVZA 2C18A 4A21A 4ZMGA 5J5DA 4K37A 3TCEA 1G7UA 4HKPA 1RD5A 4RZ6A 1LBFA 3HG4A 1Q6LA 2VXNA 5FF3A 3GZ3A 1NEYA 4O1BA 2YR1A 3HGJA 3JS3A 3HGRA 3W07A 1YLVA 1I2RA 3MI6A 3I68A 2ZZ1A 4A2RA 4TMCA 3W1UA 2PE4A 3GYEA 1KBJA 2QCDA 4WXZA 5KSWA 3I7RA 2NUXA 3C56A 1AW5A 3JR2A 4KFPA 2YZRA 3LCFA 5AOUA 1LORA 1QR7A 1LROA 2YDAA 4I7WA 2ABBA 1JQXA 5TQLA 2E09A 1VC4A 1EIXA 3NQCA 3TQVA 1FWSA 3L66A 3S1XA 4FNPA 3KVKA 3QPYA 1OX4B 2NX3A 4PTNA 4QISA 3C8FA 3EXTA 3LGEA 1KLZA 2VFGA 1KM0A 2PRLA 1FWRA 4IPJA 4HNTA 1OX5A 1VLWA 1KTBA 1KM6A 3LBCA 4X9SA 4JTGA 3KFTA 2DU2A 2WOQA 3L21A 3LHYA 4FNQA 5BMXA 3W7RA 1ZJIA 1VYPX 2RFGA 3TSDA 3GXTA 3CWOX 2B7PA 2RHGA 2V9DA 4S2BA 4Y8FA 2Y7EA 2H6RA 3L5AA 1FUYA 3KAOA 2FJKA 3KHJA 5AHNA 4JYEA 3T78A 4DO6A 3S1VA 5D32A 4MJMA 1TPVA 4N9BA 3HBLA 1B4KA 2VEKA 1Y0EA 1OX4A 2EF9A 1K7EA 1QDSA 1PS9A 5FESA 1GG0A 3PUEA 3L68A 3M5YA 3DHFA 3B0VC 3NAVA 3DFTA 1DKWA 4DEFA 2GQAA 4MZ8A 1FQ0A 4XTIA 2TPSA 2GOUA 3O63A 1GVRA 3MW7A 3WJYA 2PCQA 2WQPA 2QCLA 2NXHA 1EP2A 3G1VA 4ZQOA 1XC4A 2JKAA 3MHFA 5HUPA 3NXFA 4XQ6A 4EIVA 3KRSA 3QW3A 5CPOA 1UCWA 1LLZA 3R89A 1LZOA 1XM3A 1OFEA 3W73A 1X1ZA 4GRSA 2X1UA 1LYXA 4O52A 1B9BA 2A85A 2W6RA 4FHAA 5BMWA 5FEPA 4A22A 3PF3A 3RF9A 4LNYA 1XUUA 2WSQA 4HSOA 5CZJA 5T26A 2TSYA 3NPUA 3WK2A 2ZRZA 3W7OA 1TCDA 1L9WA 4U4MA 1SZFA 1SPQA 2ZTKA 5DLCA 3DBPA 1TJPA 2B4GA 2O7QA 3DXIA 3W7HA 1X7FA 3SR7A 2ZRUA 5DBUA 5D09A 1YXYA 1XBVA 3EX2A 3IIVA 5AYYA 2YFNA 2C6QA 4B5NA 5FEZA 3LI1A 3NZRA 4FX8A 3HJZA 3S1WA 4K8EA 3VNDA 4QITA 1WOBA 5FI8A 4LY8A 5DCBA 3SECA 1HO1A 3G18A 3M44A 3P8IA 2FFCA 1H51A 1R46A 3QRHA 4MY1A 3G3DA 4LVGA 4BFAA 3O15A 4ONVA 5LGZA 1Z41A 4IMEA 1TSIA 5I3KA 1I2OA 5KZMA 4IGHA 2B7OA 3W23A 1XKYA 1EEPA 2NWSA 3TH6A 2G5WA 3ATYA 2CLOA 1I4NA 1P0NA 3LXCA 4O0ZA 2TMDA 3DZ1A 3E9AA 4BR1A 2BXVA 5BOOA 3CQ0A 3EX6A 1I2NA 4JTLA 3NNTA 1SFJA 3HIJA 4UMCA 3M1ZA 1KLYA 3A24A 5AHMA 1R2SA 4FB7A 3MHGA 5LGXA 4JD4A 5EYWA 4OE7A 4Z0SA 3OBKA 4E38A 2ZZ7A 1GOXA 3DGRA 4YCOA 1JCYA 1KM5A 3B4UA 1W1ZA 1VZWA 2WJZA 4FIQA 2W79A 1A53A 4FF7A 4O11A 5F1VA 2GVGA 1YYAA 4POCA 5LHEA 1YXCA 2J9XA 3TC6A 1ZCOA 3TE9A 1TRDA 5BNKA 4MZYA 4XBSA 1D9EA 2Q3OA 2Y7DA 1W3TA 3TU9A 5FF7A 3O16A 3LB0A 3SY5A 5AC7A 3M43A 2NZLA 2Y61A 3F1QA 4UFLA 1PCKA 1Q6RA 4YWIA 3NOEA 3BO9A 1ZENA 3G22A 3GXNA 1DJNA 3S5YA 1ALDA 3STEA 1WXJA 3HOJA 2AAMA 2JGYA 2E1DA 3RLUA 3UWZA 4AWUA 3UY8A 3W22A 2E5CA 4NZFA 3PBWA 3PUOA 3LCGA 2QJIA 1OK4A 2AQWA 2R14A 4OV4A 3ZS4A 3EXSA 1DOSA 3WJWA 4JDYA 4AMAA 3W70A 3C2VA 1ICSA 4UFJA 3VKJA 4JEQA 3B0UX 3MP5A 3LV6A 4WJEA 2GQ9A 4EWND 3PBUA 4JTJA 1ZHAA 1C8VA 4NNAA 5G5IA 3EWUA 2V5BA 3VCRA 3QSRA 4NUWA 3I7QA 4WZHA 3W7MA 2DZTA 4LC8A 3O07A 1W8SA 3BPWA 1W5QA 3B04A 2P1FA 2A2IA 5G1TA 1SR9A 1AL8A 3W7DA 1H5YA 1HO4A 3HMJG 4JY9A 1GTHA 1FWTA 3NM3A 2NWRA 3PBYA 3OVRA 2VFHA 4DPPA 1VR6A 3CIXA 3AO0A 1SSGA 1QFEA 3TXZA 1O95A 3LTSA 3Q37A 3N2MA 2ZFAA 4DO4A 3CM4A 4QNWA 4X22A 5G4WA 2VC6A 5LZLA 2QDGA 3PVFA 1BEUA 3WK3A 3BW3A 4LVFA 4UC5A 3MI3A 1TPUA 1SZNA 1VCVA 3HPZA 1W0MA 4AWTA 5D2WA 3USBA 2ATSA 4IXHA 3IIPA 4N6EA 2A4AA 3IGSA 4Z1DA 3GAKA 3FLUA 4CCEA 3C2OA 3W76A 4DBEA 5E0KA 4TO8A 1JCLA 3GKAA 4JX4A 1GPWA 2RDWA 3ABSA 3DH7A 2QCMA 1IXPA 3E96A 3W1AA 1W3IA 1P4CA 3TC7A 1Q3NA 4UTTA 4KWVA 4LOCA 4UR8A 2V5LA 5F2GA 4MVAA 4LV4A 2QUUA 3TAOA 3S6DA 2FPYA 4FNTA 3C52A 1TPC1 1PIIA 3KVLA 3NQAA 2Y88A 4NX0A 4O8RA 3YPIA 5CPLA 1SW3A 1X8FA 2E6DA 4LVAA 4ZVJA 1H61A 2WNQA 3MI2A 1OVDA 3W7JA 2YSWA 4OV9A 5LNVA 2NX9A 4PCFA 2OMAA 4Y9AA 4GJ1A 4UR7A 4FNRA 1P5BA 2C15A 3RMJA 3TR2A 3ZWTA 5KZEA 4OT7A 3KXQA 4QQ3A 4K7VA 1FXPA 8TIMA 4JTUA 3M5ZA 3W1XA 3GDKA 3LTYA 4NNCA 3R13A 3E0IA 5DBTA 4ZQPA 4UMAA 4OHQA 1DHPA 3NQ7A 5F2IA 3A23A 4UNKA 1FCBA 2DZWA 3BW2A 3T40A 3QEZA 3HGOA 2X1RA 3A5FA 3VFLA 1JJKA 4MFDA 4O16A 4ORMA 2YYTA 3P7YA 1AMKA 4K39A 1JUBA 5G4EA 1XBZA 3W75A 3W84A 1LRTA 3IRDA 2G97A 4OWGA 1JVNA 1U5JA 3PG8A 3WFAA 1DQWA 5LNWA 2Z6JA 1V7YA 3N19B 4K6AA 4PH6A 5H91A 3LM7A 5F2LA 4MYAA 4UMBA 2JGQA 2Y7FA 5I3JA 1SZEA 4NXSA 3W88A 3W72A 1BKSA 3G0XA 1MEIA 1H7PA 1KFKA 3O6DA 3CPRA 3S1UA 4JTKA 1A5CA 3LHZA 2CLLA 1FDJA 1TPB1 5HMSA 4N9EA 2DZUA 1LBLA 4YL2A 2B7NA 3N14A 3PY2A 1F6PA 1B4EA 2X16A 3KRUA 1VCFA 1HG3A 1RQEA 3GNDA 2CWNA 1UUOA 3EWBX 1OYBA 1SQ7A 1H62A 4QAIA 1SSDA 3L5MA 2XN1A 5AFDA 1Z44A 1TPEA 3LDVA 4NJHA 4RZ4A 4ZQNA 1KFCA 3LCHA 1XDLA 5AB3A 1IXOA 3WJZA 3H55A 1UJPA 3PWAA 3G1XA 1DORA 1R2TA 1YTKA 2E5DA 1WA3A 3GNNA 4O1AA 3WJSA 1O5XA 1H7WA 1H1ZA 1PL9A 4JTIA 2F7FA 2ZRWA 3UPWA 4M6VA 1EWDA 4UFKA 1DVJA 1ZAHA 1KA9F 1S5WA 5C6MA 2V2HA 5CZ0A 3LXAA 3ABQA 3EWZA 4ZQRA 2VFEA 2ZRVA 1LDCA 5F4WA 3HB9A 1CI1A 4JXCA 4ZL1A 1X6UA 3BW4A 2ZRYA 1XI3A 3MO7A 2QAPA 3P8JA 1SUXA 1LRQA 2ZZ5A 4WOQA 3OVPA 2A21A 4YLWA 3KRZA 3D0CA 3T7VA 4UIOA 1OYCA 1TPWA 4M6QA 3C2RA 1GJPA 4Y90A 3LBMA 3LERA 2A0NA 1BWKA 2C13A 2QCDB 1UB3A 1Z42A 4MYXA 4O19A 3HQ1A 4UTWC 4O13A 2C14A 3I6RA 2Y7GA 3NYZA 2TYSA 1J2WA 1GVSA 4AWSA 2OT1A 2R94A 4QNEA 1KTNA 3GDTA 1H50A 4HT3A 4O57A 1YDOA 2OZ0A 1ZAJA 4UUIA 4O4VA 4K7YA 3HPXA 3THQA 3DFPA 4MLJA 1F73A 1XBXA 3VE7A 1G67A 5CGQA 1TV7A 1PE1A 1KV8A 3UD6A 4HIBA 4ZZ9A 1O5KA 1RZMA 3LLDA 1X1OA 4RK8A 4HN4A 3SIZA 4KFNA 1TTJA 5HUOA 1ICQA 5D2YA 2UV8G 3TFXA 1G69A 2OCZA 1DL3A 1TYGA 4OU1A 3CTLA 2H3DA 5KMYA 1K02A 3L9CA 5C55A
chains in the Genus database with same CATH superfamily
3IVTA 3AMLA 3KCLA 4GY0A 3DG3A 4O15A 1ONRA 3QMRA 5I23A 2F61A 4MB1A 2J66A 1KFJA 1BVWA 3DG6A 2BLEA 5AC6A 1M7PA 1UMLA 1DE5A 4KESA 4HCLA 4LUYA 3VMNA 2ZE3A 4GVHA 4BJHA 3KLKA 3I3DA 4JIQA 4UZSA 3SADA 4DF1A 4ILSA 3CAKA 1J8VA 4JDBA 1KW1A 4TQTA 3W2MA 2ZA2A 5G2HA 4O17A 3B8UA 5JH2A 5D9MA 3WQFA 3PTMA 4WUIA 1TWZA 1RY0A 5EA9A 1XYLA 2NSXA 1C8YA 1AW1A 1F6KA 3E5BA 3VGDA 3QZEA 3BLKA 4C1NB 1QTWA 1F74A 3NO1A 3T9PA 2E9LA 4NAFB 4J3SA 2DT2A 1WV2A 1BTCA 4QFUA 4OVXA 4IFKA 1IQ8A 3STFA 2ZUMA 1P6WA 1PDZA 5E5CA 3P5YA 3H4WA 3MB9A 4K2SA 3WMBA 2ZXQA 1OCQA 3DAQA 4MDOA 5TF0A 3S9IA 5EFDA 1XS2A 4FR6A 5BRBA 5CG0A 2GSJA 1KCZA 2Z7KA 2NQJA 2HMCA 4UOJA 4UQ9A 1TTPA 1VPXA 4CLMA 1VFUA 3HG2A 2Z2AA 4UNIA 3ITYA 4DBUA 3K8KA 1MNZA 1JEZA 2W91A 3NSNA 4H9TA 1DWFM 1ZQ5A 1FDZA 4GGHA 4PFHA 5CPTA 3LBOA 4AXKA 2JKEA 4GFSA 2WZIA 5HQMA 2CC0A 2DIKA 1MW3A 3EX4A 1Q4WA 5HQEA 3VDGA 4RXGA 3V36A 2R8WA 1US0A 1OJXA 3RXZA 1WUEA 2VX6A 2I9UA 2VEMA 3AS3A 3QF0A 5BW6A 3TWAA 1AK5A 1CXHA 3E12A 1ZGDA 3WLJA 5IBXC 1L0PA 4CNTA 2NVAA 3V5CA 3BCFA 1VEMA 1LL6A 1HKWA 3U2OA 1C29A 1VBRA 2JE8A 1QUMA 1EDTA 3QC3A 1CB7B 1HJWA 3A9IA 3NZPA 1R38A 3MYOA 5BOFA 5FACA 2I17A 3QJAA 2CZDA 3GXFA 2C0AA 4LXFA 2PDCA 1YPFA 5CPMA 2BVWA 2ZQ0A 1X39A 2PI6A 4GX9A 5A8MA 1Y5WA 1FWWA 3PTKA 3W2LA 3VINA 3U4AA 3FXGA 1V3KA 3R8HA 3TFCA 2XFRA 1H41A 2J4GA 1JRCA 1M6JA 2HPIA 1YE6A 4TVDA 5JU6A 3W00A 4DNHA 1V0NA 3WH9A 5J5RA 5F2MA 1JUKA 5L9FA 4A3UA 1VBHA 4WJXA 4M7TA 3N2XA 4E2VA 3OHIA 4JHOA 3TYEA 4F3HA 3R43A 3CEUA 3PAJA 4QCEA 1TTQA 3GW0A 2E5BA 4UXDA 1VCGA 3FYOA 2FKPA 3RN6A 4KGJA 3V0TA 1HZYA 3FA3A 3VVGA 5HPCA 2D22A 4O14A 3W02A 2ISWA 2XFWA 1J5TA 2EXOA 4LUJA 5HWJA 5LIWX 4IXXA 2WK2A 2PWDA 3WLRA 2ICSA 1CYGA 3FXYA 2GLKA 4EF8A 3QFEA 2GK1A 3F5LA 3NGJA 2OWXA 2XFYA 1W37A 1CLKA 3HGSA 2FHFA 3P67A 4GUFA 4RDWA 3CIWA 3H7RA 3HJEA 2NQ5A 4GOAA 1K70A 1VB9A 1IT7A 3GQYA 3W25A 4DF2A 3F4CA 3MDUA 2V5JA 2WV8A 4AH7A 3AQUA 4R34A 1OCJA 2PZNA 3WIJA 2J88A 3UYIA 3SCVA 3PPGA 1LT8A 1FXQA 1TB3A 1CGWA 4BCEA 2ALDA 3M0YA 2CW6A 2X1IA 3M0XA 1L2UA 5C9ZA 3BV4A 3KOFA 1H7XA 5BXRA 1VIWA 1JRBA 4M56A 4DYJA 3LRMA 4OECA 2QW5A 3SUVA 5I3FA 3RX2A 1FKXA 3LCIA 4MNJA 2VL4A 3QYSA 4XK2A 4NQ1A 5I3GA 4RJEA 3TA6A 4R7JA 4HMNA 3WYZA 3FHQA 3CC1A 4UQEA 1E4LA 4TV5A 2GL5A 4J35A 4JCMA 1M7OA 3EWYA 3W7EA 4J3XA 3GE7A 2QR6A 1JQVA 4I5XA 4F40A 4WSKA 1XRFA 1ICPA 4CCZA 6ALDA 4CVWA 3ALGA 5ABFB 3GH5A 1R47A 1SFLA 1NFBA 3ARWA 1FP9A 3L4XA 4AYGA 2J79A 3W7GA 5TBOA 2G4JA 2I9EA 3D3AA 1OD0A 4P7NA 3G8EA 2IKHA 2XUCA 4HNUA 4QIUA 2GZXA 5CC6A 3UWWA 1VFFA 4EXBA 1GHRA 3U0HA 3FSUA 3V7PA 2W66A 4H9YA 5BCAA 2VGFA 3MCOA 1JR1A 4N7QA 4WCJA 4WF7A 5A6LA 4IMCA 3ZJ8A 4DI8A 2QGYA 4RV3A 4EOUA 2CHRA 4UTMA 5CSYA 4HA3A 2HS6A 2WWDA 3QGAC 4UFMA 4JTTA 3SFKA 2AGKA 1JNDA 3WLTA 3RIKA 4JTFA 2W9MA 1VF8A 4H6QA 1BG9A 2P5NA 3G1DA 4I9TA 5FA5A 4DJDA 4PR4A 3W7PA 3FW6A 1KFEA 1W5PA 4EPDC 1MSSA 3GB6A 3B05A 3URQA 3HO8A 1FKWA 2DZXA 5I00A 3AMDA 1MZHA 3H24A 1WDSA 3O06A 4NNBA 4FP1A 4JHZA 3AZSA 3UY7A 4N6FA 3H2MA 3UA3A 1A50A 1KFBA 3CEPA 2EGZA 1J9YA 3QV9A 3WLLA 1POKA 3QTGA 2WKLA 3OEXA 5HATA 2H8ZA 4UR9A 1TPH1 2OVLA 4KWSA 1KBLA 4BF9A 3KZPA 1EYEA 4WR3A 3P60A 3E6EA 1QAPA 3R58A 2G37A 2IKJA 3VUSA 3UXAA 1RCQA 1E40A 4GGBA 4QG6A 3ZM8A 3XISA 4C6KA 2H8XA 4A8IA 4GD0A 2TODA 4L4OA 1QWGA 1XDMA 2I14A 3NO3A 1IGSA 1GW9A 1KTCA 3PN8A 1FHVA 2DORA 3EDEA 4L65A 2FZNA 3F5KA 5D02A 2DT0A 3W71A 2AL2A 2VX5A 3IAPA 2VWTA 3W9ZA 3R7MA 3WELA 1DPMA 3EB2A 2GSHA 2PLMA 4RW3A 1YNQA 3JUGA 1SO6A 2EKCA 4AY8A 4J3TA 3APTA 1K6AA 3FNDA 5CLTA 2XFFA 1EDQA 3OVGA 3RX4A 3M5VA 1L6SA 1WXZA 4B5TA 4IQLA 4NXKA 3H22A 1WCGA 4FR1A 3UVAA 2DZPA 1GYNA 3G8RA 2BGNE 3LLFA 4L1GA 3EWDA 3GDRA 2D2JA 2GPTA 3SCUA 3A6OA 4L6DA 1HNYA 4Z1CA 2GGEA 1O6IA 4ZFMA 1CNVA 4XKYB 1RQBA 3TMQA 3W29A 3RDKA 1JZ3A 3BLIA 3PS7A 1BSLA 5RUBA 2Z2UA 3MUXA 3W1TA 3OLGA 2ODOA 1XLLA 4NF7A 3VZYA 4XIAA 4R7OA 3T0CA 1U22A 4QAWA 2CFFA 4Q8WA 3KOYA 4PMDA 4GKTA 1QK0A 1XD0A 4REQA 3C61A 1AH4A 4XKYA 3WNNA 1X7IA 2V6AA 4AX7A 4Q4MA 4IP7A 4NYYA 1WO2A 3BWWA 4FX6M 3R12A 4E3VA 3BLOA 3PB2A 1TJ0A 2CLFA 1K6WA 2BV9A 1UASA 5IHSA 1CXLA 3TYCA 4LT9A 3UZJA 4RX0A 2X30A 5AC8A 3SN1A 3IACA 2EEXA 1WP6A 4GI8A 4BWLA 5ABFA 5G1YA 4PB5A 4HTYA 3UZ5A 3UNDA 2VWSA 1PHWA 1QMLA 3DFSA 4ICMA 3AU6A 3GFXA 2YBTA 1HN1A 4NY2A 5I7GA 2OEMA 4DUVA 1NOFA 2I5QA 2J25A 1E6ZA 3GYCA 2GDVA 2YOCA 1S46A 5EU9A 4G8TA 1XCFA 1MO0A 1VS1A 4CD4A 1QPQA 2WCSA 1M7JA 5D4YA 4Y9PA 1ML1A 5DO8A 2WBKA 2ZX9A 5I3DA 1MEWA 2A1YA 4FIRA 4PFMA 5I03A 3S9YA 5JMUA 4DJFC 1A4MA 3QR0A 4JICA 3WH8A 4IIDA 4NZ5A 2VZTA 1ADDA 4PZVA 2YCKX 2OSYA 2BMBA 2YDRA 3G1FA 4LV9A 1L6YA 4IUOA 2G96A 3IEBA 2C79A 2J9ZA 1T99A 3EAUA 4B3LA 3STCA 4WSJA 2ACUA 1JD9A 5MKGA 3NQDA 2QCFA 4MUZA 4H9XA 2VOMA 3WK1A 2W67A 2PMQA 5I78A 3ZR6A 1V02A 4NI3A 2INZA 2V30A 5CPNA 3OQ8A 3LMZA 3CNYA 5H2ZA 4GFIA 4Z1BA 1S5NA 3AI0A 3U2ZA 1XC6A 5T9CE 1B54A 1ME9A 3OB8A 3SUSA 4UCGA 1TQXA 3W1QA 4I9MA 4HCDA 1A5SA 2YCLB 1XGZA 5TIMA 1W3JA 2Z00A 2AGTA 3BGJA 4LNCA 2NXGA 2QF7A 1RBOB 3NL2A 3PJXA 1DHKA 1N8IA 1W9BM 2HSAA 3USZA 1KBBA 3S83A 4D6JA 3FVMA 3GUGA 2QUNA 4O1DA 2Y62A 3P80A 4ZFCA 3QOMA 4AVFA 1ZJBA 1G4PA 3BARA 1XRSA 1P1XA 4PYSA 1RVKA 3LUTA 4AD1A 1ZALA 4CN6A 1S5MA 2PF8A 2I1OA 2WSPA 4HP5A 4ENLA 1XX1A 1NF7A 2QJJA 2IKGA 2J8TA 3DU0A 3N3TA 1RA0A 5CJMA 3INPA 4AF0B 1SO5A 3RO8A 4CNNA 4UOQA 4ZO9A 1LUCB 1F3EA 4LS0A 1KRBC 1IT0A 4O53A 4AEFA 1G4TA 3TWBA 5D2VA 4W8BA 1WX0A 3TJLA 1H7NA 2X7VA 2XDFA 1DJXA 1JZ8A 1ZP4A 4ORIA 4Q8TA 4MOZA 5EBAA 1FWNA 1W5NA 5A8PA 4PMQA 1WZAA 1KKRA 4GG9A 3IIOA 2FLIA 1MMFA 4RZBA 2NLIA 1B1YA 3WBAA 5HR6A 2FGZA 3CB8A 4WD0A 4E8DA 2FZDA 3O0KA 1XSJA 3HMCA 1V0MA 1TWDA 4GIAA 1G4EA 2FQIA 3UGVA 4GMEA 2HPMA 4KH2A 3W6YA 2DY3A 3ZIZA 1J0KA 4ZOBA 4Z2HA 3CL7A 2D2HA 2J24A 4GVFA 4GH3A 3CL6A 3FFSA 2WMKA 3GDLA 2D3NA 3ME3A 3TZNA 3VKKA 3UGRA 1UOKA 4X3ZA 3GNXA 3MV11 5DXYA 5HAOA 2ZBTA 3RRAA 5GVJA 3AMCA 3BGGA 3M5XA 7REQA 1RQHA 2VCAA 4JTHA 2HVOA 1K03A 3LRKA 2BSLA 3K30A 3S5ZA 2FZ9A 1T96A 2WW5A 4CQCA 1GTEA 1O12A 2RDXA 3G1AA 3T2QA 4ACYA 1UWAA 1PYFA 3RLVA 3GLCA 2QJHA 3IGHX 1IXNA 3SGGA 4ZTXA 5A5WA 1LUCA 2BP1A 1T5AA 4X0VA 4ZTYA 1IE7C 4Q4KA 5A8OA 3H2EA 2QUTA 1KCXA 1QPRA 4G56A 2PDQA 3A21A 3C0LA 3GG7A 1I1WA 4ACZB 4IGMA 2VEFA 3AWNA 1U83A 2ZTJA 4M19A 3BCDA 2OX1A 3GXDA 3QXBA 1GYMA 1A49A 2GVJA 3ARPA 3FKRA 4DUOA 3EXRA 1J79A 1S5TA 3N73A 3WLNA 3WQEA 4K36A 2H3BA 2WBGA 1OF6A 4DXKA 3QV7A 4E4PA 3BK0A 2DSKA 1XG3A 2FTWA 5D03A 3EYPA 1IXQA 1AJ2A 2DSWA 3I4EA 3NQVA 4V33A 3W2NA 3UQNA 1DBTA 2FDSA 1DIEA 3GDBA 3MBFA 2VZUA 4TOQA 1HTIA 4CN1A 4DNMA 1M65A 3MTWA 1QXLA 4Y8EA 3WQVA 4JNMA 2HVNA 3MWAA 1PV8A 3ZJKA 2ZKMX 3L0GA 1OYAA 3VOFA 4X63A 5IXEA 3IUIA 1QK2A 3OBAA 3BLPX 3C3UA 4PMVA 1GOWA 3ORWA 1OG6A 1WAUA 1E71M 3NL6A 1Y8BA 3T8QA 1TTIA 2ZWZA 1S2UA 1JDFA 1W9DM 4ICNA 4AVOA 3G5EA 4B5UA 3VDHA 3ZSSA 1ZL1A 1QNRA 5AHEA 4DZHA 2C18A 4A21A 2WC3A 5J5DA 3VGFA 4WDXA 3BAIA 2GVYA 1Q6LA 4GXPA 3HGJA 4CD6A 3MI6A 1C8QA 3S6TA 3GYEA 2PU1A 1FWJC 2QCDA 4BF7A 4HVXA 4WXZA 3NFUA 3PFMA 2NUXA 2HQAA 3I6TA 4DJFD 4M51A 2ISDA 1EF3A 1AW5A 4PMUA 1LORA 2E0PA 1JQXA 4J1OA 1KD0A 2E09A 1PX3A 3KUMA 3S1XA 1XRVA 1ZUAX 3KVKA 3PANA 4XG1A 4FI4A 2NX3A 3HQOA 4PTNA 3VUPA 3NIYA 1HJSA 1C9WA 2VFGA 2GJRA 4JFWA 4G9PA 4REQB 3UR7A 1UROA 2WHLA 4Q4OA 1KM6A 2OO6A 3LHYA 4W89A 2Y0FA 4W88A 2RFGA 3TSDA 1GOOA 2RHGA 2V9DA 5A94A 1U33A 4AZBA 1XIEA 2H6RA 1V3HA 3L5AA 5LA1A 2IPFA 1EHNA 4MB3A 3T78A 4DO6A 1MW0A 4MJMA 3TJ4A 2ZX5A 1RK6A 1B4KA 1Y0EA 1A4LA 3RR1A 1BQCA 5AYBA 1QDSA 3DN5A 5CPQA 5FESA 3ZQ9A 3PUEA 4NL1A 4JAWA 1R6WA 2OZ8A 3ITCA 1H4PA 3AROA 2OQHA 3BURA 1PJ9A 1DKWA 4PTXA 1T41A 3VZXA 1OINA 4U31A 4I5RA 3WJYA 2PCQA 3FSTA 1EJXC 3REQB 1R3TA 1EP2A 3G1VA 1PTAA 3B9OA 2IPJA 4EIVA 3W73A 1OFEA 2ISFA 4PMXA 1G01A 2W6RA 1UJQA 3OW1A 3TP4A 2WHKA 3F4VA 4LNYA 2WSQA 4HSOA 2Q02A 1YMYA 3NPUA 1OCBA 3WK2A 4EK7A 2ZRZA 4U4MA 1RHCA 1TJPA 3W7HA 1RJPA 9RUBA 1XBVA 5AYYA 3UG3A 6TAAA 3HTWA 5B80A 1ZJAA 1UZDA 4B5NA 3JZEA 4F48A 3LA4A 1VP5A 5FI8A 5DCBA 1PUDA 1HO1A 1Y5XA 4MY1A 3O15A 4ONVA 1J96A 2Z4GA 2XH7A 2DSVA 5I3KA 4HMEA 1FOBA 1PX4A 3GNPA 2B7OA 2DIJA 4BQ4A 2UBPC 3HA1A 3UXKA 2G5WA 2Z7GA 2PBOA 3ATYA 1JGMA 3LXCA 2TMDA 1OC7A 3TNBA 4WHBA 2QUMA 1WPCA 5BXPA 3DZ1A 5I6SA 3T09A 2BXVA 2WNWA 3M0LA 1XYCA 1W1VA 1OIFA 3A24A 1A5NC 2PGEA 1KRMA 3N04A 4LAKA 1GZ1A 3QGVA 1CXEA 3OBKA 4E38A 3WLSA 3DGRA 4YCOA 4S3DA 3B4UA 3B9EA 1W1ZA 4FIQA 4S3GA 5GNXA 3PK7A 2VNCA 3RG6A 5F1VA 2GVGA 2CIPA 2IPWA 1A0EA 4I90A 3PUGA 1N82A 3S2LA 6ENLA 2PU0A 5CBBA 2ON3A 4JTCA 3ITVA 3C8NA 4GIYA 3SY5A 3DGBA 4O0QA 1EC9A 2YXOA 1PWMA 5CSUA 2O9OA 2AAMA 3TOPA 2E1DA 3RLUA 3WQGA 1AH0A 1TZZA 3UY8A 3PPCA 3KOWA 3WUEA 3PPHA 1VBJA 1OK4A 4B5WA 3EXSA 1BQGA 5CLWA 3OIHA 3WJWA 1BYBA 2CBUA 1XGDA 3C2VA 4HGXA 4TTUA 3CLWA 4UFJA 4Z2IA 1DJHA 1UG6A 3MP5A 4IFRA 4L80A 4C6FA 3TTEA 3WH7A 5CBJA 4WDTA 2OQYA 4PE8A 3OOQA 3CO4A 2F9RA 2VYOA 4K68A 1OADA 1E0WA 1BVZA 4Q7NA 1W8SA 3OP2A 2V3FA 1GQJA 2VOTA 1SR9A 3BLDA 3W7DA 1J6PA 3HMJG 4JY9A 2HBVA 3NM3A 5AZ1A 4AY7A 5LIUX 1XPGA 3OVRA 3SDOA 3V3WA 2VFHA 4LBUA 3AO0A 1SSGA 3ARYA 3TXZA 2XVGA 3OLEA 3AUJA 1E5JA 1Q7ZA 4AD0A 2DH3A 3CM4A 4QNWA 1TE1A 4X22A 5LZLA 4YYCA 3AS0A 3CH0A 3BW3A 1QOXA 4LVFA 5AVNA 1OQFA 4V15A 3E1F1 4CEUC 2WMIA 3HPZA 4XIMA 1W0MA 1J6OA 1SJDA 4U3AA 5LIYX 1RK5A 4ICCX 3USBA 4IXHA 4A3QA 2A4AA 3CHEA 4N42A 3CHFA 4IICA 5E0KA 1E9YB 1XYFA 4NILA 1W6TA 1GPWA 1GJUA 2WJFA 4JQ3A 3A12A 1HQTA 2OELA 3TQPA 2R1MA 2QLYA 4IFOA 3E96A 3CPGA 1YBQA 4R9XA 2FHCA 1DP0A 4KWVA 4FSAA 4LOCA 2HK0A 2V5LA 2G8ZA 1JD7A 4DZAA 4B15A 1S38A 1KNWA 2QT3A 3AYVA 2QGHA 4FNTA 4NAFA 4Q8UA 1PIIA 1W1PA 2Y88A 4O8RA 5CPLA 3R79A 2PCEA 1UKQA 3PFRA 4LVAA 3IK4A 5GJNA 4S3JA 1KXVA 1U1UA 1X6NA 2Q09A 2NW0A 3MI2A 2G50A 1OVDA 1VJZA 1W9UA 3LGDA 3CAWA 3K4DA 1E6PA 4Q4PA 1P5BA 1GOKA 3RMJA 1HGWA 1XJBA 4QQ3A 8TIMA 3ARSA 3W1XA 3WBEA 4H7ZA 4C6DA 4MSSA 9CGTA 5DBTA 5A95A 4PUKA 2BVDA 1M68A 5F2IA 4UNKA 2OGJA 3E0VA 3ES8A 3HGOA 2X1RA 4BEUA 3VFLA 1JJKA 4K39A 3WF3A 5G4EA 3IRDA 3SQLA 1UWRA 1DXEA 3R6IA 3NZQA 5DMNA 1JVNA 3WFAA 1YKWA 2CLPA 2OO0A 3MSGA 5LNWA 1EEXA 1V7YA 3M46A 2WMHA 3LM7A 1EDGA 1N8WA 1IEIA 3H2NA 2BVTA 4NXSA 2PD9A 2BOGX 5EMLA 1MEIA 1NDYA 4KW2A 3VCNA 3OZYA 1XYAA 3LMYA 1FWDC 1LBLA 4YL2A 2CXEA 3VNYA 1WKYA 1VCFA 1HG3A 2ANUA 4DB7A 4F2TA 1EQCA 3M7SA 3EWBX 2O4QA 1H62A 1SSDA 3ZR5A 3ANUA 1FVPA 4HA4A 1TPEA 3GXIA 3LDVA 1QT1A 4IIBA 3UT0A 1KFCA 5AB3A 3WJZA 1UJPA 1RA5A 1O5XA 4RUBA 2F7FA 2WZMA 2VDGA 4JFTA 4RDVA 4KRTA 5A8NA 5I09A 1GJWA 3WG6A 3GC4A 2EO7A 4JKLA 4U5KA 2IQDA 3LXAA 3K46A 1Z32X 3SQSA 3EWZA 4ZQRA 1EX1A 1WDRA 3R1ZA 3GUWA 4C5YA 2EG6A 4P5UA 2DSZA 4G1NA 5TAOA 1XYBA 4UQCA 3WX7A 4LF1A 2KX9A 3AIRA 3GG8A 3KRZA 3D0CA 1TPWA 3C2RA 4XZIA 1BWKA 3AICA 2C13A 4R7WA 2E8ZA 1B3ZA 5JVLA 4XD6A 4OBRA 3HQ1A 1EHAA 4O13A 2C14A 4NZCA 2AKZA 4ROPA 2Y7GA 3NYZA 2Y4SA 1J2WA 3TLQA 2R94A 1UKTA 3CV1A 2VJXA 1LJYA 1H50A 3ZYZA 4O57A 4S3FA 2FZ8A 1V4YA 3EMCA 2OZ0A 4J40A 4QG8A 2V5KA 4I8DA 1H09A 1L6FA 3F4DA 4MLJA 1EGVA 1F73A 2IKIA 1G94A 1XBXA 2WJDA 5CGQA 1NP2A 1PE1A 1W1IE 3M4HA 5M1TA 3VXGA 1QU4A 4HN4A 1TTJA 3WH5A 2ACRA 4GLEA 2UV8G 1PZ3A 1G69A 1K02A 1S2CA 3CAQA 1TR9A 1JCTA 5K2ZA 4NZ3A 1P48A 4M80A 4AIBA 1JCXA 2CLKA 4GA8A 1HFBA 1WBHA 2VGGA 3LCXA 3IPWA 3AXMA 4MPKA 4S2CA 3E49A 1W5OA 1YRRA 5KITA 4GNJA 2BVYA 2EKGA 1QHOA 3IV3A 3W82A 4L56A 2A5HA 2VKZG 1A5LC 2YYUA 4RV8A 1D7KA 3G2GA 2FB2A 2INFA 2V82A 3L4WA 2XINA 3NZ1A 4E2BA 2V67A 1F5ZA 3MUCA 4J5NA 4HNVA 1WQ5A 2D73A 2QULA 3TW9A 4MY8A 3F03K 1RLDA 4R88A 2VFFA 1R87A 1FCVA 5I02A 4B9YA 3C0QA 3R11A 1LWIA 4UB9A 3P61A 2I56A 3G1SA 4JQ2A 5BYWA 3H4GA 1W3NA 3IJ6A 1VBGA 2VX7A 2WVVB 3GHSA 4A8NA 3WLMA 3N4EA 4W8LA 3JZUA 4K8HA 3Q4DA 2Z1BA 1SFSA 4ATWA 4LBSA 3TQ0A 3IUHA 3CV2A 4PRWA 3R5EA 3WNPA 3EOEA 4Q4SA 3WBXA 5H8MA 1UZHA 1DWJM 1MFUA 3C2FA 4LAUA 5LA0A 2BY3A 3SSZA 3VCCA 1HJQA 4P7RA 3KE0A 1J12A 4FNSA 3HU7A 1OM0A 2WJEA 1UBSA 4S39A 4BA0A 1FHUA 4GUIA 1L2QA 3QPZA 3QY7A 4QEHA 3TYUA 2ABAA 1QW9A 4Y6GA 1US2A 1TIWA 5HNUA 2R82A 3QTPA 1RPXA 1W17A 4JIHA 4LEFA 3KVMA 1YDNA 1FX6A 3T42A 7A3HA 1S2WA 1CXIA 4PB4A 2ZWYA 3VYLA 4EACA 1AG1O 4UFIA 3VNKA 5JIWA 3CV7A 1HX0A 4DLFA 3LM3A 3GTHA 4HK5A 4ZOAA 4UTUA 3E38A 5MF5A 4B92A 2E4TA 2IUZA 1R7AA 4Q8OA 1GQIA 4PUUA 2JKPA 4AEOA 2DIEA 3OVQA 5D9PA 2J78A 4AHQA 4UTLA 4NAEB 4MG4A 1JDCA 2FVKA 4JTSA 1H7OA 1K4HA 4KETA 4IGSA 4HQVA 1KGWA 5HJYA 2FH6A 5CGTA 1K7XA 1R9ZA 1PKMA 2PDBA 1OC6A 3CYVA 3RLGA 2CU0A 1Z48A 2QVHA 3L5LA 1TA3A 1EXBA 3W28A 2XGZA 4Y96A 5HMEA 2WVUA 5H8PA 3A22A 3A9BA 1HGYA 2PDIA 1REQB 4C6MA 5E09A 1QI4A 4B5XA 1TV8A 3HN3A 3WEOA 2XWEA 1PVNA 3LOTA 5FSEC 2YXGA 4IM4A 2HXTA 3KBMA 4A3RA 3S42A 4QS6A 1UH2A 3RU8X 3MZNA 2ZE0A 1G9HA 1X8CA 4U28A 3CWNA 1XIDA 1JZ7A 1Q6QA 3Q45A 4BI6A 3NQFA 5KZDA 1I60A 4KEZA 1Q6DA 2O92A 2O9PA 5G4HC 4Q8MA 4DY1A 3TC3A 4YMZA 1A3XA 3APGA 4D6HA 1O60A 2PF0A 1IWAA 2CZEA 2ZZ2A 3NL5A 4KWWA 1I9CB 2DJXA 2QPXA 3I4KA 3AXIA 3GVRA 3W0KA 2DSUA 5I77A 3ICJA 2DJLA 1MYRA 3CU2A 3G6LA 6A3HA 2YBUA 3EB4A 3GY1A 3O2LA 1XYZA 1KM4A 4U10A 5JBEA 3URBA 3OGVA 2P50A 8CGTA 1BRLA 3DENA 4KCUA 3T81A 1TVNA 5CG7A 2D0GA 1FWBC 2A7PA 4QG9A 4LYPA 3UYCA 1PBGA 4H83A 4ZEPA 3VM5A 1TJRA 3N2CA 3SIMA 2E1WA 4N4QA 2VCCA 1K8ZA 4UTFA 1QCWA 1U2YA 3M0HA 1BFNA 4PCSA 3DERA 3AS1A 2A7RA 1F4HA 4UTWA 3WQ4A 4OBTA 3UR8A 1W9PA 1KBIA 1P0KA 2RJGA 3DHUA 2XIIA 2ZX7A 3VD5A 3KBVA 4S3EA 1H0GA 4PUEA 1OK6A 4DWSA 5AHIA 1WDQA 2EG7A 3SZ8A 4ZQMA 4P7QA 4A3HA 3CJPA 4QP0A 4KKXA 4EF9A 5KTLA 1JXJA 2P53A 4MWAC 3B8WA 5HMDA 1BWLA 4HPJA 4CQ8A 1GQKA 2XISA 3NTYA 3NXLA 2OYMA 4Q8QA 2OQLA 2VFDA 4E5TA 5XIMA 1UWIA 3BG5A 3M07A 1H1NA 6REQB 4MF4A 2G0WA 3N25A 5K7JA 3LEPA 2Y1HA 2VM8A 3F7JA 2G41A 2OLSA 3D5HA 2WKJA 2FJUB 2QCEA 4UOZA 1TZ9A 1WBJA 4GYJA 5D04C 5E0CA 2CERA 4LYRA 3T44A 2Z1WA 3M41A 1NOWA 4M5PA 3RCYA 4ZO7A 3VD3A 1M9HA 3NOYA 4XBJA 1IF2A 3LNPA 4QS5A 4UTJA 1ADOA 3S46A 2FMOA 2BB0A 4DI9A 6CGTA 4MKVA 3QQ0A 5D33A 1J0ZA 5EKYA 2I7GA 2ZVRA 2VGIA 2B7QA 2QMKA 3VFCA 3W3OA 2W62A 2YW3A 1MEHA 2RGLA 4YCPA 1QNVA 3MMWA 5FJTA 2A3EA 1XL9A 2OTDA 1Q65A 1EXPA 3H53A 4TX9A 3UR5A 5D2TA 4Q7IA 1KM1A 3OTRA 4IPPA 5CKSA 1SZGA 1JZ5A 3U48A 3TXVA 2Y63A 7ODCA 1GOQA 2HNHA 4P7OA 3TROA 4LCRA 2CCRA 4XSMA 4L4LA 2QAFA 4ZE4A 2CHOA 4P8VA 1EP1A 4XVDA 3C2EA 4K1GA 1LRNA 2A7NA 5LNRA 4B5VA 2WVSA 5C9RA 2ZRXA 1D3HA 3W27A 1N2VA 5A6SA 5BU6A 3BLEA 3TUUA 3GTNA 4FLQA 4KQNA 4UCFA 3RITA 3U8GA 4HHLA 2GJNA 5A8QA 5D37A 1CW2A 2FTPA 2Y24A 2YFOA 3II1A 4W9TA 2J8FA 2GUYA 5B7ZA 4O1CA 3N17A 3BAJA 3AFBA 4QXIA 5D9NA 1E0TA 1Y5VA 5DCEA 5EMJA 4YVVA 1ZAIA 4LCQA 4PL1A 4LALA 2RH9A 2ZXBA 4OIFA 3WDIA 4JIPA 4XO6A 3QHNA 2OT0A 3QMTA 2WMGA 3L23A 3GW3A 3OODA 3MP3A 1Q5MA 3VGBA 4P2VA 2OLAA 3E0WA 1EQPA 4RW5A 1AJZA 6TIMA 3SW6A 3W81A 1A5AA 2ZXAA 4ZE5A 2QJNA 2PTXA 3RCNA 3VKDA 1LOSA 2P10A 3MVTA 3CZKA 3VZZA 3U4FA 1A80A 1E6NA 4NKCA 3NEHA 2OWWA 1AUSL 2QCCA 3ARVA 2OOFA 2J7FA 2EPOA 1Z6KA 2GGHA 4LW7A 3NVTA 3BMXA 1G6CA 4Z1YA 2OKTA 3UWUA 5E9AA 1VFMA 1XFBA 3WNLA 1R2RA 4C1KA 4JTDA 4U3CA 4AZGA 3ZFHA 1LLOA 3KZSA 3HQNA 4AZ5A 4B16A 1E70M 1SW7A 3SCRA 4CQDA 3GIPA 3M0KA 2OR2A 3E02A 2YA0A 3K8MA 1JF5A 2NQ9A 2J7CA 4RE4A 2QCGA 4AZ7A 3QM3A 1XLFA 2UY5A 2R1KA 5CSSA 4ES4A 5GJPA 3KWSA 2XGBA 1W91A 1V5XA 1DTNA 3LHUA 1YTEA 3B8IA 5D38A 1JG9A 1TX0A 1GOMA 5A1AA 4IQEA 2GQ8A 1VIZA 3UZYA 4NZJA 3S6OA 2Q01A 3DI1A 1NOUA 3JVAA 1D3GA 4YVPA 4LVBA 1NARA 1ECQA 3ITGA 3PPFA 2EPLX 4GUGA 2J6VA 2VZOA 2JEPA 4WKFA 3ERPA 4PMNA 4AZ6A 3TN6A 4DPQA 1UD3A 1TPDA 3KBSA 1YADA 3CV6A 4CQ9A 1ADSA 1KR1A 1SJCA 1MFVA 1MZRA 3HFTA 5EMUA 1UR3M 3H70A 1R30A 3STGA 1F6YA 1LQAA 5CJ5A 5C71A 3CT7A 5AHFA 1UR2A 4PTWA 4U2ZA 4XVEA 4ERGA 4F0LA 3AIWA 3QSTA 1A5BA 1V8EA 1W3HA 1XV8A 1GWJA 3KW3A 4H9ZA 4H8UA 3IJDA 1DJQA 3MMTA 3BVJA 5C2GA 1V02E 5FF2A 3R10A 3MT1A 2Z6IA 3S8HA 1A5KC 1BTMA 3UESA 1EP3A 4JZ5A 4FNUA 1BHGA 4C1NA 3MDWA 1TX2A 5IBXA 2HS8A 2EHHA 2ZZ6A 4WJ8A 3O8AA 4HSNA 4RPQA 1H7RA 4GI4A 3A47A 5E6ZA 2E9MA 2V81A 4QLLA 1XISA 2A6NA 3P14A 2WVVA 4JQ1A 3B06A 3ARXA 1S1RA 3DKJA 1Q45A 4AG0A 1F9CA 2E6YA 1F8IA 2Z1SA 3MPGA 1TKKA 1BGGA 3NA8A 4I7VA 5H1WA 1PO9A 1XIBA 1EUNA 3RM8A 1OABA 4WGHA 4TXEA 4QLKA 3DFOA 3FV9A 2QKFA 3L4ZA 3ALFA 4B2DD 3UJSA 1UP0A 3TW6A 4MJZA 3ABRA 1Q6OA 2CLMA 4CD7A 3UU0A 1OBAA 3FAXA 3H23A 4R53A 1I45A 1U5VA 1XIIA 4IOTA 2XH0A 3CZ8A 3NQEA 1NDWA 3V75A 2GVLA 2ZXDA 4NX5A 3VILA 1XUZA 2JF6A 3BAWA 4KFOA 4GE8A 3EEZA 2HK1A 1GVIA 1YTDA 3B40A 1C93A 1YQ2A 4X0NA 4XKMA 4DJDC 2VD9A 3I6EA 3LGGA 3TSMA 2F6KA 1EO5A 3W1PA 1CEOA 1VYSX 2QIIA 1BD0A 1Y65A 3GVQA 2GJPA 1R0MA 3E2RA 3NM1A 4DWSB 1O1ZA 1JYVA 5CSRA 5ABEA 3KEHA 4JX6A 2FTYA 4QJ1A 2Z29A 3GXMA 3PZ9A 4PB3A 4JYDA 1DJGA 3H54A 2VURA 4BHYA 5C0QA 3RHGA 3MJYA 4NJGA 3WLPA 5ECUA 1FRBA 5D8ZA 4GQRA 2WCAA 2O55A 3BG3A 4FEZA 4J3ZA 4LS2A 4FXJA 3DKLA 3QR1A 4GYPC 1AD1A 2MANA 1SFTA 1AD4A 4LUIA 2PRHA 4O0KA 3WUBA 4GZIA 3S3GA 5LXXA 1GKPA 4YPJA 3N13A 3U7BA 3UZXA 2YXXA 4GYKA 2YLLA 1W5MA 4TX8A 1TQJA 1H2JA 3CXOA 1Z7AA 4AIOA 5AN7A 3GHRA 3PSWA 2Y8VA 1NU5A 5DMLA 3GH4A 2OPJA 4V28A 3SI9A 2A3CA 1QI5A 3BICA 1RV8A 3PHAA 4XAPA 1PIFA 1G1YA 1GVYA 4UQBA 3BG9A 3FJ6A 1KC7A 2JQXA 5LSMA 1SVDA 3NQ8A 1M3UA 1TMHA 3FOKA 2Z25A 3ZSTA 1EA0A 3ARZA 3W86A 3T6CA 1J2BA 1P7TB 2BOEX 1SJAA 3CL8A 3N11A 1TIMA 3TTOA 3IJLA 3B0PA 1TPFA 4W8AA 1W8GA 1WDPA 1QPNA 3VU2A 3UJEA 1CTNA 5CAHA 1TO3A 5SWUA 2PDPA 1RR2A 1XICA 4MJ4A 4CNPA 3KL5A 4ADUA 4XTDA 5DANA 1M04A 1W2PA 4AF0A 6REQA 5IOBA 2NUWA 1EZWA 1LF1A 4LU0A 3SJ3A 4F8XA 3W83A 5IDIA 2Z2BA 2XSBA 4DBDA 1E3XA 3K1DA 1EB3A 3VPLA 4N9DA 3S1GA 3GDMA 1N8FA 1JZ6A 3JRKA 4YNGA 5EPDA 3QKEA 3KWXA 1XKJA 3PZGA 4AEEA 3EPOA 3XIMA 1B90A 2J9YA 2XIBA 1F3TA 1TVLA 2OJPA 1V6XA 3IIZA 5HMFA 3QQ1A 3G1YA 3IVSA 4WGXA 3TAKA 3H2OA 4XZHA 3K8LA 3G1HA 4OOZA 1ZSXA 4GX8A 3MMUA 3BJSA 4E0CA 1GQLA 3UNTA 4F9JA 4HK6A 4QHRA 1BG4A 4IMGA 4F4RA 4EP8C 4IP5A 3IGXA 1YDVA 1JPKA 1XFCA 1W54A 1V0KA 3EKZA 4MAVA 4LRTA 4OUIA 4LSBA 3KL3A 4X61A 3JW7A 3ZZ1A 4AYSA 1V3JA 3FDGA 4XWUA 1QW8A 3MP4A 3W7IA 5HR7A 4HOZA 4MM1A 2FHBA 4EVZA 3BXWA 1FH9A 1AH3A 1JNEA 1RD5A 1RCOB 2VXNA 5FF3A 1NEYA 5FOOA 2YR1A 2DZBA 1YLVA 3I68A 2ZZ1A 4TMCA 3W1UA 1KBJA 4G6CA 3AAMA 3WMCA 4MKSA 3HPAA 2R1NA 2X42A 1XIMA 1GKQA 2VVNA 1LROA 2EQDA 4Y7EA 1S39A 4EX4A 4GH1A 2VDIA 3QPEA 1EIXA 3NQCA 1FWSA 3L66A 4QDWA 1MXDA 3QPYA 5JIPA 2FDMA 1UR4A 4QISA 3LPGA 1UQZA 3C8FA 1PZ0A 4AD3A 1KLZA 2HVMA 4DXXA 4L1WA 4IGNA 4HNTA 1REQA 1OX5A 1VLWA 1R86A 2IS7A 3LBCA 1JDAA 4A3YA 4GI6A 3MZ2A 2VZSA 3WDRA 4QJ3B 1V3IA 5BMXA 3GXTA 4S2BA 4FLOA 2Y7EA 3ITLA 3R0UA 3ZVHB 3K1GA 1FUYA 2YJQA 2FJKA 1FWAC 3KHJA 3W26A 4JYEA 4HYWA 1RJRA 3GTXA 2VEGA 1D8CA 2EBNA 4KIRA 1JPHA 1OX4A 4LUTA 1XIGA 1TV4A 1B3VA 2EF9A 1XLJA 4G7FA 1PS9A 4GO9A 4WKHA 4S38A 3L68A 3M5YA 3DHFA 1BAGA 3B0VC 3NAVA 1AJ0A 3DFTA 3UR2A 3E74A 4DEFA 4HPNA 2I16A 3E5PA 4MZ8A 4OOUA 1FQ0A 4XTIA 2TPSA 3RLHA 3U2CA 3MCNA 3MW7A 2PLJA 2WQPA 5I0DA 2QCLA 2NXHA 3UZWA 4ZQOA 3ZLFA 2JKAA 1UR8A 4LYKA 3QW3A 1UCWA 2GQ3A 2DDXA 1LZOA 1X1ZA 1HKIA 3IV8A 4GRSA 1LYXA 3DFYA 1JFXA 2MNRA 5BMWA 5FEPA 4A22A 2E67A 3TTQA 1PTGA 4F0MA 1L9WA 1SPQA 2ZTKA 3CYJA 3BH4A 3THUA 2ZRUA 5DBUA 3EX2A 5E6YA 4OKDA 2C6QA 5HQLA 1B9ZA 4ASTA 3RPMA 3LI1A 1HKJA 3NZRA 4FX8A 4LB4A 4RNHA 2HCVA 4M1BA 4QITA 2BDQA 3UA4A 4LY8A 4RE2A 3M44A 1XLKA 3G18A 3P8IA 1H51A 3QRHA 4ZXLA 4ML4A 4IMEA 1I2OA 1K77A 4XZNX 3RUBL 3V0SA 1W1A1 8XIAA 2CPUA 1D3CA 3P3BA 4XX6A 3SUTA 4LFYA 1I4NA 1P0NA 5A3HA 2VRJA 3V16A 1V6VA 5TD4A 3WLQA 2YB1A 5AECA 4NIRA 4U5IA 3PJUA 3NNTA 3WBYA 3WD1A 2GDUA 3REQA 1SFJA 3CAVA 3HIJA 4Q6XA 1R2SA 1Q6CA 3R4IA 1EYWA 4FB7A 1JI1A 2HISA 2ZC1A 2JF7A 5HNNA 4JD4A 2PWFA 1RUSA 3BC9A 1GOXA 1VZWA 1QW7A 2WJZA 2W79A 4O11A 4IF2A 2PD5A 1YYAA 5LHEA 3O3RA 5IFPA 1XIHA 4GCAA 2PDYA 4DM2A 1LWHA 2C1GA 3N18A 1TRDA 1LL4A 4XBSA 2PTYA 1JPIA 2DVUA 1W3TA 5FF7A 3O16A 1XDJA 5AC7A 3F1QA 1Q6RA 3NOEA 3WL0A 3G22A 3L12A 4KF1A 3KDNA 3S5YA 1ALDA 3GVWA 1WXJA 4GIEA 4RNIA 2XZ9A 3HOJA 4KEVA 4EXAA 3WCZA 3J7HA 5CPSA 4RNJA 3UCDA 2SFPA 1XLDA 2AQWA 2DT1A 3QLLA 2R1LA 3AALA 3RM9A 1HJUA 3W70A 1UIPA 3SBFA 4CD5A 4PTMA 4WJEA 3PBUA 1QHZA 1ZHAA 3V5OA 4MWAA 4NUWA 4INFA 4WZHA 3WMLA 1QRQA 2ZICA 1W5QA 3B04A 4TTGA 2HZGA 3RILA 1QI2A 4US6A 5A6BD 5I06A 3SY1A 2ZADA 1U30A 1ELSA 1EFZA 1PB0A 4DPPA 1VR6A 2D23A 3DOPA 3CIXA 1O95A 4OBSA 3LTSA 1R9XA 2ZFAA 2VP8A 4EPEC 4D72A 2WMIB 1BEUA 3WK3A 4D8AA 3MI3A 4HPGA 1HJXA 3WSUA 4RDYA 4YTTA 3I10A 4HNOA 1AQ0A 1MW2A 1QBBA 2ATSA 4N6EA 2QVNA 1E43A 4O1EA 4H7VA 3T8LA 3NUKA 4CCEA 3EA1A 3GSMA 1XCWA 3W76A 4LH8A 4IFKB 3TR9A 2F6UA 2VO5A 4ZCWA 3WLIA 3RGTA 4DBSA 4GVGA 1IXPA 2AAAA 3W01A 2R24A 2HXUA 2BY0A 5C9UA 3LN3A 1EA9C 1LQ0A 4DRSA 4UR8A 3DX5A 5AY7A 3LK6A 4FS9A 2QUUA 1UR9A 3TAOA 3S6DA 2FPYA 1R3WA 1T6MA 2J47A 1OT2A 4GC3A 3KTXA 3KVLA 4NX0A 5C2CA 3L2MA 3FJNA 1CBGA 1QBAA 2E6DA 3M0MA 4DUWA 4FLRA 2WNQA 4ZSUA 4LANA 3KBNA 1VFTA 4LAOA 3H26A 1GGOA 5LNVA 3P6LA 2L5HA 2UY4A 4Y9AA 3QN3A 4D1JA 4C7DA 4EAYA 1V3LA 1S3TC 3E2SA 3PNZA 4C91A 1JZ2A 4LF2A 2WM1A 1YIXA 4LUSB 3TR2A 1E9IA 1CGXA 2X40A 4FLSA 1VKFA 4K7VA 4NYUA 3LTYA 4NNCA 1KGUA 3E0IA 4GPNA 4UMAA 5FIPA 5T9BG 4QCFA 3ZO9A 3NQ7A 1FCBA 2C91A 3BW2A 5PTDA 3AOFA 2NVCA 3A5FA 4ORMA 2Z24A 4AUBA 2CETA 2YYTA 3P7YA 4XZWA 3W75A 1XBZA 1CB2A 1U5JA 1DQWA 2D3LA 3N19B 3DC0A 3SCWA 1V77A 4MYAA 1CXFA 5KETA 4S3KA 2Y7FA 3FX4A 3VDCA 3G0XA 3FEQA 4CGTA 3CPRA 3S1UA 1TPB1 5HMSA 3PTQA 4N9EA 4JKMA 3F2DA 4GY1A 1JYNA 2XYLA 3KRUA 1XLEA 1OT1A 2CWNA 4GXWA 2PWVA 1UUOA 1RP8A 3AXHA 1BKHA 2W63A 1HW6A 2BOFX 2PPGA 3L5MA 1FWCC 3CMFA 4RZ4A 1GORA 3UXIA 1IEWA 3KM8A 1NDVA 1ITQA 2WPGA 2E5DA 3VMPA 1H7WA 2PP0A 2XM2A 3L4VA 1PL9A 4KMQA 7CGTA 2ZRWA 1ITCA 3QC0A 4O8AA 3VIJA 4M6VA 3CHDA 1EWDA 1PKNA 1DVJA 1EJVC 5HBFA 5C6MA 5CZ0A 3BUVA 1NM9A 2DUXA 2QJMA 2VFEA 1FHLA 2ZRVA 4GBDA 2XVNA 1CI1A 4G2DA 4NRSA 4ZL1A 1J0IA 4AZCB 2ZRYA 2QAPA 3P8JA 5BOEA 1BYDA 3ES7A 1LRQA 3CZGA 2G3MA 4WDWA 1GJPA 4Y90A 2XG9A 2A0NA 1DIOA 1UB3A 2PLKA 1KCKA 1XIFA 1W3LA 4WDUA 1MDRA 2OT1A 4GVIA 1NWUA 4J28A 1ZAJA 4C7FA 2RJHA 4O4VA 3THQA 5CC3A 3DFPA 3TCSA 1U5HA 1XD1A 3DYOA 4AMCA 1KXQA 3F5JA 3EGJA 1O5KA 1RZMA 1LG2A 3LLDA 4RK8A 3CO8A 1ICQA 3VD9A 1EF2A 5FD0A 3FAWA 2D0FA 4H2CA 1DL3A 1TYGA 2BASA 3IRSA 4OU1A 2PP1A 3AUOA 1UWUA 1W9XA 4C6NA 5KMYA 4X2PA 3L9CA 1BLIA 3ANYA 2D0HA 2QYGA 5CZTA 3MKCA 4ZO8A 4LJ3A 3ZWSA 1HKVA 3TW7A 1EZ2A 4MADA 3XINA 4QQUA 3Q2DA 3CMGA 2ZX6A 1TJ1A 1EIBA 2WO5A 3S5SA 2V0TA 2FGLA 1BSIA 3ZJ7A 3N6HA 2V3DA 5HNRA 3DCPA 3OYZA 4YTQA 5EL1A 4JX5A 3TV8A 3UZZA 3N4AA 4IJRA 1VFHA 5HOSA 3L4YA 4GHRA 4M24A 2REQA 2G3IA 1JIBA 4F2UA 4WY0B 3PTDA 4ADSA 1TV2A 4JTQA 7TIMA 4LY4A 1ZFJA 3NR0A 4JS3A 3CZLA 4MNKA 3EWWA 1M5WA 4ZR8A 2V38A 3CWHA 3TYBA 2VFIA 5E70A 4WOZA 3MKKA 1H1YA 5TNVA 1TWIA 1Q63A 4BI7A 2PEVA 4QDPA 1H60A 3OHMB 4QE4A 4M7SA 3VIOA 5A2BA 1YXDA 3SJNA 3BSHA 1VJSA 1XLHA 3W2UA 1XXXA 1NFGA 3COTA 4HOXA 3VOHA 3IAQA 2X09A 1CGYA 4XZLX 1BXBA 3WEMA 1XG4A 4MNMA 4X2RA 3CLMA 3MHUA 1XW8A 3WKZA 1EOKA 4UNLA 3WQCA 3AHTA 1UZ4A 1V6TA 2Q8ZA 1NTHA 4HJWA 2H9AA 3RK8A 3QOKA 4DXVA 3W4RA 4FMVA 5ABTA 6XIMA 5DCDA 5A6KA 1R3RA 3GBDA 3SGZA 1BXNA 1GZGA 3LS9A 3QHOA 2GFTA 4QROA 1OY0A 1TFVA 1E56A 3BQ6A 1DTUA 2ZC8A 1VGAA 1NH6A 2ZZ4A 1F7BA 3C86A 4NJJA 5I24A 3CT2A 3FA5A 3GU2A 5FJJA 3G3MA 3RMEA 3VIHA 2VR4A 5BRPA 2GJLA 3GR8A 3GG1A 1GYLA 4CNSA 1G5AA 4OUEA 2R1PA 2XPKA 5C54A 3ZVHA 3T0DA 5GPRA 3PWIA 3GAYA 1POJA 4LCSA 2YL9A 2BWGA 4HNNA 4O28A 3L67A 1QO2A 4HMDA 2B31A 1MQRA 1DJWA 1SJBA 1X38A 1Z8AA 3RPTA 4O12A 3PG9A 3SUUA 2PC4A 1TUXA 2ZUNA 3RJYA 5EY5A 1X96A 1QHPA 3AYTA 1DQXA 4O4WA 2WKGA 4HHMA 4IQDA 2EPMX 2HE5A 3RO6A 3EMZA 2J8GA 4I7UA 1OZMA 1W31A 4H6RA 1NVMA 1K9TA 1GVEA 1KB3A 3LPFA 1O5QA 2FPVA 5G1MA 5EMMA 4CU7A 1V03A 2XGIA 2BY1A 1WZLA 4O50A 1PKYA 4Z2LA 4F0HA 3T2PA 1K7FA 4JFSA 3QY6A 2V2DA 3A3XA 1OFPA 2JEQA 4JEJA 3TDFA 4RPPA 1JDEA 4AB4A 2WPBA 2VR2A 4HJFA 4JN8A 3W1RA 2WXDM 1JCMP 5FJOA 1ZTVA 3NPVA 3EBVA 1HL2A 1HKKA 4Z42C 4DWDA 2WM0A 5HXMA 2AQVA 4KIEA 4TV6A 5C2XA 4J2MA 5CZSA 3AZTA 5I07A 2QXWA 2C16A 1HF6A 3PP7A 4Y9OA 2EJ1A 3CASA 3UG4A 1EGZA 4PMYA 4O1FA 1VENA 3WLKX 1RPKA 3W85A 2C19A 4B4FA 4RNFA 1G4SA 1B3XA 2LLEA 2WNZA 4EANA 1UD8A 5HINA 3RCMA 4JBRA 2XN0A 4OGZA 3R2GA 3S9ZA 1DXFA 4M0XA 3THAA 3PJTA 2PDHA 3EB3A 4K38A 2V5CA 4S3CA 1VFLA 4WY0F 3RPDA 3B0XA 1FCUA 4XO7A 1MXGA 1ISVA 1IV8A 1DIDA 4F79A 3VE9A 2H90A 1EKOA 4Z0JA 4AZIA 5HDRA 4URIA 1L8PA 2F6XA 4H01A 4GYFA 2CZFA 2NXIA 3DECA 3U3HA 3ID7A 2PTZA 1SU5A 2WNNA 2O9RA 2XIOA 1ZS2A 3TKFA 2ONEA 3HFYA 3NDOA 1EH9A 5AC5A 3DHDA 3KCJA 2Q6ZA 8RUCA 3LG3A 3W2KA 3GFYA 2OYLA 1F2JA 3NQ2A 2OKOA 2V2CA 2YKKA 2NT1A 3KRBA 5E93A 1XH0A 1VHNA 2IXUA 4L4PA 3M0ZA 1O94A 2FZBA 3G0SA 1A0DA 3BOLA 1FY6A 1W32A 4JTEA 2X1SA 1PDYA 2DW7A 4M29A 1YPIA 4PMZA 4P61A 3GR7A 3CUIA 3KTCA 2Q3RA 2VEPA 3AHYA 4FA3A 1ZPTA 3E2VA 4ROQA 3QYQA 1ZBCA 1O1HA 1TREA 2PWGA 3WK0A 4GQGA 3SEPA 4RE3A 1OC5A 3K5XA 2RGMA 5BWFA 2E28A 3GNRA 5IHRA 1XHGA 3CUHA 1Y7VA 1ZU8A 3QLDA 1X97A 1S5VA 4UTTC 3WQ8A 4HHPA 4BEQA 4HPXA 3VKAA 2EG8A 2GUUA 3DFHA 3W7NA 1V6WA 4B91A 4Q33A 3WDJA 2X0SA 4N4PA 2C7FA 2HROA 3LHWA 4AVNA 4AZHA 5M03A 4OQVA 1GEQA 5DMYA 4TIMA 1FDYA 4IQJA 1C9DA 2X8RA 2PGFA 3FYPA 4EAMA 2XTKA 2YB4A 3S5OA 5LHFA 5C7VA 2O56A 4PL2A 4XUGA 4DF0A 3BQ5A 3WFZA 4LS1A 1SO3A 3TJXA 1GVOA 4QEEA 4UTKA 2YBVA 4EE9A 2E68A 1H63A 2J77A 4E6MA 3L7RA 3RR4A 2J7DA 3VIGA 4CD8A 1D8WA 3FJ4A 4IT1A 4EPKA 1VAHA 1NWRA 2W61A 2DZSA 1FCQA 5AC4A 1AL7A 1QI3A 3EKLA 3CTTA 3H2AA 3NDYA 2G3NA 3AIQA 1KFLA 1OG0A 4IL2A 3RAOA 4W7UA 4DYKA 4A8LA 4FXSA 2D24A 2Z27A 1KKOA 2OX4A 4UTHA 1E6RA 3L65A 9XIAA 4D1IA 5U4NA 4PODA 4GBUA 4C6CA 1GONA 5M2FX 2DFAA 2PDXA 2R9RA 2AMGA 2ZCGA 2PFHA 2PODA 3NL3A 3NQBA 4QLJA 1HL9A 4ZB5A 1K8YA 2VRKA 2W27A 1MXSA 4B2DA 5AYZA 4J7RA 3N9KA 3ARRA 1XH2A 3A3HA 4ERIA 3DEQA 1BVNP 5FF0A 3H6OA 2DP3A 3FN9A 4AC1X 3HPSA 4TR9A 2FH8A 4GABA 3KLLA 3L0KA 4OJYA 1UD5A 3WLHA 4ECLA 2ZIDA 4GQ0A 4IL0A 3GS6A 2AMXA 3UPMA 4CNOA 1GPFA 4D6EA 1E3ZA 1A5MC 3TK7A 1T8QA 1JZ4A 2J7GA 5K4ZA 2BX7A 1OFOA 2XSAA 3AHZA 1E6SM 1M01A 2GJXA 3GVGA 4IX2A 5K9CA 4CCCA 4R27A 4US5D 4IMFA 3G24A 2ADAA 1RVGA 2XH4A 2YPIA 1OB0A 3V18A 1TWSA 2WC4A 2EPHA 5A6JA 2OODA 5K4XA 2G95A 3A5VA 2C0HA 5J8LA 3V0UA 3WF0A 2ACQA 4AW7A 1J01A 3CZEA 2CZ5A 4NJKA 1T0OA 3LPOA 5CGMA 2EAWA 1KM3A 3O6AA 4QRNA 3IIXA 1DQUA 5DY2A 2ATMA 1BF6A 5C70A 1I8JA 3AC0A 3CK5A 3VD7A 3VAVA 1NWTA 4MIMA 1TCMA 1E0XA 3LHVA 4PRRA 2RAGA 3ZOAA 1YE4A 1B3YA 4I8YA 4JNZA 2DZVA 4LTSA 2IMRA 4HZ6A 2VUYA 4WQ6A 4GJJA 2UZ9A 1Q6FA 4IP4A 4GNKB 1RBAA 3MSDA 1HT6A 2EPNA 2J27A 3DFNA 5T91A 3T2OA 4F2BA 5BROA 4H3DA 1WE5A 3NDZA 4OZOA 4HOWA 1F76A 4LAZA 1BYCA 2X2GA 1EJSC 3RYSA 3VMOA 4JCLA 3OZPA 4XB3A 4C6JA 1JPDX 3R8GA 4G7EB 4JGDA 3RU6A 3QZAA 3DHPA 5CAKA 2PDUA 4IIFA 3L2LA 2DH2A 1EWEA 2X1TA 3UETA 2D20A 3UCQA 3TSBA 2DQXA 3STPA 3FEMA 1CT5A 2GSEA 3BJTA 4IH3A 1LTDA 3W2JA 3E0FA 4N0RA 4JR5A 4I6KA 3AMKA 1IIGA 2BY2A 4W86A 1WKEA 2X7WA 1PSCA 3GVVA 1S2AA 3HV9A 2XIQA 1UR0A 1AFSA 1I2QA 1V6YA 7TAAA 1TR1A 5CH9A 2BG5A 4WEVX 5GNYA 1RCXB 2YX0A 2DGAA 2QPSA 3M0VA 1CPUA 1R3VA 3R25A 3PZMA 4B9ZA 3W7QA 1UUMA 3MKVA 1PTDA 3ZJ6A 3QGKC 2UY2A 2O9TA 3P5ZA 4KEMA 4S1FA 1Q7MA 1ZNNA 2HTMA 2CLEA 5DXXA 2VEIA 3EOOA 1B3WA 4LEQA 3OIXA 1K9EA 1OD8A 4FF5A 4C1LA 2F2KA 2VTFA 3FJLA