4LC8A

Crystal structure of the mutant h128n of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
222
structure length
222
Chain Sequence
DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSNPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the mutant H128N of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with the inhibitor BMP
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 84
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4lc8A00
5LKYA 1LP6A 4DPPA 4S2BA 4FXRA 4OHQA 4ADUA 3EEGA 1XKYA 1ONRA 4IMEA 3OA3A 2QCLA 5C2XA 2DZTA 5KMYA 1JUKA 3QFEA 4WOZA 3W2MA 3W3OA 1ME8A 1P4CA 3IEBA 3UY7A 4JICA 1KLZA 3M41A 1EA0A 1O95A 1K7XA 4FX7A 1W56A 5AHNA 4GWEA 4XBSA 3TH6A 1A5CA 4JYFA 1YLVA 2NUXA 3QQ0A 3TX9A 3UY8A 2B4GA 3SW6A 3HG3A 1WOBA 1TCDA 3G18A 4R34A 1DBTA 4XKYB 5E0KA 4ZVJA 1AL7A 3P81A 4JS3A 2RDWA 3T4CA 1SZEA 1JULA 3U6WA 3BG3A 2QAFA 3BK0A 5D2XA 4JXCA 3WJYA 3C61A 4JEQA 2WV8A 4IPJA 1EP1A 2ZRUA 4EVZA 1GTHA 1LBLA 5C5YA 2YDAA 1L6SA 3OBKA 2Y63A 1SO5A 2ZRYA 1RPXA 3G3DA 3SFKA 3GZ3A 1ADOA 2G96A 3G22A 4H6KA 1W5NA 5LNWA 1EP2A 3CWOX 4FXSA 3OHIA 1U83A 3LX9A 3JRKA 1EUNA 4NJGA 1UB3A 2Z1BA 4EOUA 5AHMA 3PBVA 1GPWA 1G7UA 4WY0B 4FIQA 3S5ZA 5DY2A 3EWYA 3G1SA 1ZAHA 1LZOA 3PAJA 3QPZA 1QPNA 5D33A 3DKJA 2VFEA 2Z2UA 2LLEA 1QNVA 3UWWA 1R2TA 1D3GA 4FNRA 3HQ1A 3A21A 1ZJIA 3E96A 1KV8A 2E5CA 1GEQA 3R89A 1XM3A 5DBTA 3HGRA 3DGRA 5IBXC 4XTIA 3LHZA 4LT9A 2OX1A 4WD0A 1TMHA 1L9WA 5CSSA 4XTDA 3BLIA 3C3NA 1NEYA 3MP4A 3L68A 4IMFA 5CPMA 1AW2A 2Y7GA 3SR7A 5CKSA 4RX0A 5HWJA 2V2DA 3S8HA 2QCDA 4LU0A 1KM3A 3EKLA 3IGUA 1FXQA 3HF3A 3ABSA 1H7RA 2A1YA 3NQFA 1OF6A 2DP3A 5AFDA 1K7FA 1OX4A 2JBMA 3MMTA 1W54A 3TU9A 4UXDA 3L5LA 1GG1A 3T7VA 2Y89A 3M44A 1J4EA 1G6CA 4FNTA 2YCEA 2BSLA 2PCQA 3BO9A 5K3VA 1E51A 1AW1A 3PG8A 2YYTA 1Y0EA 2BTMA 3D0CA 5I3JA 4N2YA 5KZMA 1THFD 1ZCOA 4QNEA 2ABBA 5I3GA 3S9YA 3DAQA 1ZAJA 1AG1O 1R2RA 1XDMA 2RDUA 3PM6A 1I2OA 3MI2A 2B7OA 3PF3A 4PFMA 3PULA 3K30A 1MSSA 1H61A 3LTYA 4MFEA 4BI5A 5FF2A 3TJLA 1JCJA 1W0MA 3NR0A 5HULA 2RFGA 1S5WA 2FB3A 4EWND 1OJXA 4I7UA 1BWKA 1TTIA 1WBJA 4LUIA 3TFXA 2AQWA 1V5XA 3BLEA 4MOZA 3T40A 1VR6A 4BI7A 3LHWA 2VFHA 1KA9F 1TPWA 4O4WA 3MWAA 4UFMA 3G0UA 5HUOA 4DEFA 2A6LA 5F4WA 1GZGA 1B4KA 3IV3A 2Y70A 2ISSA 4UUIA 4O16A 2GVLA 3Q2DA 1G67A 2QCCA 2D73A 1HO1A 1QCWA 2J6XA 2H8XA 4TIMA 4Q4KA 3W1LA 3NPWA 1ZALA 3LLDA 1HL2A 3LI1A 5G2WA 4NXSA 2J24A 3NQ7A 1YPIA 3WK2A 4HNVA 3NQGA 2ZFAA 4DELA 2ZTJA 5MHBA 4JYDA 3MYOA 2V8ZA 3M16A 3NPXA 1EIXA 1XL9A 3PC0A 5D09A 4OWGA 4I7WA 1G69A 1LROA 2WPBA 1GVFA 3L0NA 1RV8A 3PBWA 5A5WA 1VC4A 2EAWA 2VFDA 4NT0A 4N9DA 3KRUA 1SSDA 4O50A 2NX3A 4FO4A 4WY0F 3LV6A 4EIVA 3W1NA 3INPA 2J88A 3R13A 1QDSA 1CX9A 3UWQA 1PE1A 1QO5A 3NQMA 5F1UA 4AF0A 1TB3A 3SSJA 4IMDA 5AYYA 1G4EA 1F7BA 3BVJA 1K8XA 1EUAA 1KFCA 1R2SA 1ALDA 1OK4A 3QH2A 3HG4A 1OFAA 3JR2A 4UTIA 1SO3A 2ATSA 3C52A 2ZA3A 3W83A 3MP3A 1OFDA 1I2RA 4Q32A 3LCLA 4O19A 1EEPA 4JNMA 5DBUA 5KZDA 5CPNA 4LUJA 5F1VA 4R53A 4UFLA 3ABOA 4FNUA 4NUWA 3W7KA 4O54A 1SFJA 2ABAA 1XBZA 3IGXA 3ABRA 3PBUA 1QMLA 2F7FA 5BNKA 2ATMA 2W79A 3HO8A 1RQEA 4PTNA 3UD6A 4HNTA 5D05A 1TPDA 3G24A 1KTNA 5G4WA 4AMAA 4HSOA 2OT0A 1JQVA 4JX6A 3N2MA 3P5YA 5CPLA 4YLWA 2ZA1A 4ADTA 2C14A 3TXZA 2V2CA 2A7PA 3RNDA 1RVGA 1QPQA 3NQ2A 2A4AA 2O7QA 1G4PA 5E1QA 3NQCA 5K4ZA 1SQ7A 1YXDA 3HIJA 5DCDA 3NZRA 5D37A 5K9CA 5F4XA 4UTMA 4DBEA 3PUOA 1JCLA 2V2HA 2GUUA 3W75A 2XN0A 1Q6RA 2R91A 2VENA 2YFOA 4AAJA 1X6UA 3FOKA 2X1TA 1WA3A 2OMAA 4OT7A 1W5PA 1IXPA 3E49A 2YSWA 1O94A 4XQ6A 3UPBA 1H1YA 1IIHA 2G97A 2QJHA 4DF0A 3W7EA 3G1YA 2PRMA 4WX2A 1TV5A 4WOQA 3IIPA 4O1BA 1SR9A 1A53A 4RZ4A 2Y62A 4WZHA 3DBPA 5L6UA 1OX5A 5IBXA 1KM6A 4O1DA 1LOSA 4QISA 2EPHA 3NGJA 4QQ3A 2Q3OA 4UTTC 2WNZA 3W2NA 1OF8A 2QJGA 5DCEA 2AAMA 3HJZA 3NZ1A 5SWUA 3WK1A 2NUWA 3BPWA 4M19A 3PR2A 3F1QA 3I7QA 4XBKA 3MW7A 4Y96A 4K36A 1SSGA 5DXYA 5H2ZA 3SECA 4E2BA 1BEUA 3P61A 3SJ3A 3F03K 1AW5A 4OU1A 2CZEA 3P84A 4UR7A 3GB6A 2DZXA 1L2UA 4RXFA 1EWDA 1KM5A 2V82A 5EBUA 4A29A 3OIXA 4ZQPA 3HB9A 1VH7A 4ADSA 1LM1A 4CNNA 3W1PA 4R7JA 4RZ5A 1OVDA 3GXPA 3LTPA 4UTTA 1OX4B 3M5YA 2CLOA 1Q6OA 4PEKA 1OX6A 4I7VA 2QUUA 1M6JA 2Z6IA 4MFDA 1KM0A 2YX0A 3E9AA 5G2HA 3B0VC 3P80A 4J9JA 3TW6A 3OVQA 4ICNA 3UQNA 2ZCGA 1VRDA 1TPUA 5HUPA 3QMTA 4O8RA 3TSDA 5D2VA 3W7JA 1SUXA 2ZRVA 1LBMA 4UR8A 3LDVA 4Z0JA 1KV5A 4GXMA 3VI2A 2HTMA 1GYNA 4A3UA 4UNLA 3C56A 2ZZ5A 3KAOA 2C0AA 3B8DA 4IXHA 3STCA 3O07A 3B4UA 3W2KA 1YTEA 5K7JA 3HMJG 4QAIA 2XN1A 1MO0A 5LGXA 4WY0A 2EGZA 2ISVA 5CZTA 1ICPA 3LRMA 3H55A 1H60A 1M5WA 1GWJA 3TSMA 4NZFA 5LHEA 3ZWSA 5FF0A 2C13A 2DJXA 1D9EA 1SPQA 1FCBA 1PV8A 4HPJA 2PE4A 3C2FA 4ORMA 1EWEA 2QEZA 4R33A 1VJIA 3B05A 4JDYA 2I1OA 5K9XA 1NAL1 3CT7A 3IGSA 4LS2A 3A22A 2YGYA 4JYEA 3C6CA 3KVMA 3KXQA 2CLFA 4MY9A 3W07A 3BARA 2Y6ZA 1AMKA 4QJ1A 3LV5A 4X2RA 3L5AA 1IXNA 3NVTA 4LV4A 4JTKA 1Z44A 4IQLA 1LDCA 3NPVA 5AHFA 1NVMA 3ATYA 3VE9A 3TQVA 3I7RA 5ABTA 1OFEA 3GAKA 4GUHA 1S5VA 4CQ8A 3PSWA 3I65A 3P67A 4ZQOA 3S5YA 3M5ZA 5D02A 3TE9A 3LLFA 2Y7DA 3EXTA 1XUZA 2R8WA 3MO7A 4MYXA 5G4EA 3IVUA 2ZRWA 1VQTA 4JTLA 2QCFA 3B04A 1BKSA 1K7EA 1KFEA 3M5VA 5EY5A 2VEPA 3EWZA 3LBCA 3LI0A 3EKZA 1I8JA 4RR4A 2VC6A 6TIMA 2CLEA 4ZQNA 1SZNA 1TO3A 1KTBA 5HJLA 3M47A 2ZZ1A 2BWGA 2V5LA 2RH9A 2J9XA 1YPFA 3Q94A 4MZ1A 4GFSA 2HS6A 4O15A 5G1TA 2YR1A 4ONVA 3W7QA 4IX2A 1TPEA 1SZGA 3PUEA 3IIXA 2J9ZA 2E6YA 3LXCA 2OZ0A 4UMBA 1K8ZA 5AYZA 7TIMA 2TPSA 1RZMA 5D2YA 3GAYA 2QUTA 1H7OA 5FF4A 5CG7A 4RCXA 3B06A 3SIZA 3NQAA 1BTMA 2VELA 1W31A 1LORA 3W1RA 5BRBA 4O4VA 1OFBA 4LW7A 2ZZ6A 1DJNA 3FA5A 3EX1A 1LOLA 4DF2A 1KFJA 1GVSA 3ABQA 3E02A 2WNNA 3NXFA 4NU7A 3CEPA 3P7YA 3VKJA 2DU2A 4GRSA 4UMCA 3QF0A 3TDFA 2CU0A 4JTHA 4IUOA 1MEWA 3OEXA 4K6AA 3DENA 1BWLA 3W72A 3W7NA 1YXYA 4XZ9A 5HMSA 1FWTA 2X30A 5D2TA 1HUVA 3LXBA 1FBAA 3TSBA 4JTIA 4JIQA 4HNNA 3W85A 3C2RA 3RLVA 1DOSA 1HFBA 1GG0A 3HG2A 1KLYA 4O0ZA 5C54A 3DFOA 3LTSA 5J5RA 2GPTA 1ME7A 5U7SA 2A2IA 3CU2A 2NWSA 3IIZA 3EWWA 1TPH1 3LHVA 4JIPA 4BFAA 4UNKA 1TREA 3M1ZA 5K4XA 4O52A 4NZJA 4HKPA 3QW3A 4O0KA 3W1AA 1XC4A 3DFQA 3WJSA 1EP3A 2NUYA 3W87A 3R5EA 1G7VA 1R46A 4FX8A 1PCWA 3P82A 1TYGA 5IM51 4JTFA 3DHFA 3QJAA 3SZ8A 2JKPA 2RHGA 2FLIA 3NQEA 1T96A 1XI3A 4JR5A 1FX6A 1A5BA 5D32A 5TBOA 2I9EA 4TMBA 2QCDB 3DU0A 3UZ5A 4K37A 3NEVA 3I6RA 1UJPA 1I2NA 4O11A 1W3NA 5G5IA 2HSAA 4NNBA 2VEKA 3THAA 1TTPA 1NF0A 3CTLA 2ISWA 2EKCA 2A85A 1Z42A 1DJQA 3EX6A 1YDNA 2CZ5A 1I2PA 3TW7A 5KTLA 4IOTA 1W5QA 1DHPA 4I9AA 5HWMA 5FF3A 4HPXA 3UWUA 1YTDA 1B9BA 5G2IA 4EF9A 2X1RA 3U8GA 4M7SA 1JCMP 3LM7A 1FQ0A 4XKYA 1EX5A 4CCDA 2HS8A 2TRSA 2Y61A 3TNOA 2ZRXA 3THQA 1O5XA 4QITA 1FXPA 1YYAA 3FYOA 1Q3NA 2JK2A 1KW1A 5CZSA 3LCHA 4AH7A 1UUOA 2A5HA 3W7MA 4HHPA 2Y7FA 1WYIA 3KVLA 2FFCA 1N7KA 1NFBA 2NV2A 3BGJA 3G1DA 4BWLA 3TFCA 3HPSA 3MHFA 3EXSA 4JGDA 1ZY9A 2FIQA 3PWAA 1LTDA 4UCGA 5F2IA 3SI9A 4PL1A 3VE7A 3EWBX 1T0OA 1K8YA 3G1VA 1F73A 1P5BA 1VGAA 3FYPA 4MYAA 3MJYA 1LCOA 3UYCA 2XFWA 4ML9A 1IXOA 3O6DA 4JTEA 4IGHA 3SGUA 2GJNA 2CLKA 3CQ0A 4CQAA 1JRBA 3EX2A 1OFPA 1VS1A 4IXXA 4Z0SA 4LC8A 1H62A 1GYLA 4NVTA 3TIMA 3FEMA 1VYRA 2CLLA 4IWWA 1U5JA 2A21A 1VLIA 4NJHA 5HINA 3BLFA 1TPC1 2QUVA 4M6QA 3TC6A 4G1KA 3G0SA 3DZ1A 4K39A 2C15A 2DZVA 1TQJA 3FKKA 2B7QA 3DKLA 4QIUA 3MYPA 1OFQA 1TTQA 4UFIA 4N4QA 2E5BA 3HG5A 3QEZA 3DXIA 3TXVA 1T8XA 3W7LA 1Q6QA 3L65A 3P62A 1JRCA 3YPIA 4EF8A 2C19A 2YXGA 4UFHA 3V75A 4M6VA 3ZS4A 3LCXA 1F76A 1DKWA 2GQ9A 2CLIA 5GVJA 1A5AA 1QWGA 3LB0A 3CIWA 2V5BA 3O05A 3PB0A 1EB3A 3TV8A 3EXRA 3B0PA 1PIIA 4DF1A 2WSQA 5EPDA 2Q3RA 3LCIA 2ZTKA 3IVTA 3HGJA 2J9YA 2DORA 3O16A 4A2SA 1O4UA 4DQWA 4WQ6A 4CNOA 4E2DA 2CZFA 4AVFA 4LC6A 5HR6A 4UTHA 1H7NA 3PVFA 4CLMA 5HWNA 1H7XA 3O63A 3LGEA 4ZQRA 3UXAA 3TQ0A 4A2RA 2YW4A 3PB2A 1PVNA 1QR7A 2RDTA 1VCFA 1SFLA 1WX0A 4N9BA 3W71A 5AC7A 4N6EA 1J5TA 4OV9A 3IIOA 4PH6A 2ZYFA 4X9SA 4UTKA 5EYWA 3GNNA 1Q6LA 1SW7A 3RLUA 4DO6A 5E93A 5BOOA 3PS7A 5BMXA 3NDOA 1VPXA 1GQNA 1FWRA 3I7SA 3GNDA 1LRTA 5AN7A 3F4NA 2NWRA 1WV2A 4RJEA 3TUUA 1LLZA 1W3TA 1KBJA 4OQVA 3S6DA 2BX7A 3TKFA 5D03A 3LOTA 1PHQA 2CLHA 2E1DA 3B03A 4O14A 1VYPX 3BGGA 3S1VA 1X1ZA 3UXDA 2O7SA 4YMZA 2W6RA 3W70A 3W1UA 3Q37A 2NZLA 3W7RA 2I14A 3U2OA 2H90A 2QJIA 3T55A 3P5ZA 3MP5A 3FKRA 1L6YA 4UFKA 2NLIA 4ZQMA 2WKJA 3W2LA 2Y85A 3N9RA 1GVQA 3W7DA 1RQHA 2TSYA 3GVGA 3A5FA 3QSRA 2E5DA 3V1PA 1OG0A 4YL2A 3FIGA 4U28A 2PURA 4O18A 5HNRA 3KVJA 4AEOA 3MUXA 1DORA 4KKXA 5DN1A 2OT1A 4LVFA 4PODA 4JDBA 2ZRZA 3WK3A 1I4NA 3LHUA 3W74A 3S5OA 2WQPA 4KWWA 1A5SA 3NL6A 2NXGA 6ALDA 4PL2A 1LRQA 4FNPA 3ELFA 4ZZ9A 4QM1A 1TPFA 3CM4A 3E0IA 2GJLA 2YFNA 3QZEA 3W7CA 4MY8A 4MIMA 1ZHAA 3W1MA 4UTWC 1F6KA 3FLUA 1F6PA 3EB2A 3NQVA 5U4NA 5G1YA 2P0OA 1JUEA 2KZHA 3UPWA 5AC8A 2ZZ3A 1JUBA 3GYEA 1G4TA 3QPYA 2CW6A 3GLCA 2GVJA 2QR6A 4RZ6A 2B7NA 4K8EA 1KM1A 2V30A 3LCGA 1X8FA 2E6DA 2CLMA 3ZWTA 3S0CA 5LNVA 4QNWA 5I3IA 1K03A 4O12A 1ICSA 5HR7A 1OFOA 1SW0A 4HT3A 4K7YA 3G1HA 3STGA 1TTJA 5AHIA 5DXXA 4GUGA 4DPQA 5KSWA 1FCQA 4LVDA 3L2IA 1W1ZA 3W23A 3GK0A 2H3DA 3L67A 1QPOA 4GUFA 4DBDA 1D3HA 1GVRA 2YW3A 4WXZA 2QCMA 3WJWA 2WOQA 4JX5A 2E68A 4RXGA 4IPIA 2DZPA 2G95A 1XBVA 2C1HA 3FS2A 5LNUA 1SO6A 4YXGA 1C29A 4NJKA 4NX5A 2CFFA 1VYSX 4Y90A 5AHLA 1F2JA 1W5MA 3CPRA 4H3DA 3FJLA 3T78A 3W1XA 4O57A 5FI8A 3STEA 2DZWA 1C8VA 3QMSA 1UCWA 1LBFA 2VXNA 2YZRA 3I68A 1TV8A 4K8HA 1M7OA 3PUDA 1TPVA 4Y8FA 3O6CA 4LWWA 4LY8A 4FB7A 5CSRA 3NAVA 3BW4A 2FJKA 1P1XA 1GOXA 3GR8A 3STFA 3KOFA 3S42A 1R47A 4NQ1A 4HSNA 3TR2A 2NX1A 1MZHA 1QFEA 3N14A 2QCGA 3IIVA 3EWXA 3UWVA 1AL8A 3P74A 3L0KA 1X1OA 1XBYA 3PY2A 3RF9A 3NA8A 2FTPA 8TIMA 4H4IA 5K9DA 2FB2A 3O06A 3S1XA 1WDWA 4UTJA 1H5YA 1CW2A 3WJXA 2ZZ7A 3S1WA 1SU5A 1H1ZA 4LVBA 4M6PA 3DFSA 1B3OA 5AHEA 3M5XA 3MBDA 3NL5A 3W7PA 4K7VA 3DFTA 3L5MA 4KFOA 1OYBA 2PRHA 1GVOA 5A8GA 3T44A 1HTIA 1FY6A 4N9CA 3AO0A 1K02A 1H7WA 1DV7A 2YPIA 3WFAA 2A7NA 1I2QA 3IVSA 2R94A 1YTKA 3LRKA 4RLIA 4PA8A 1JCXA 4MZYA 3W7IA 3O15A 2CZDA 2VFIA 2E6AA 4CCCA 3C4UA 3GDRA 3S1UA 2H3BA 1JQXA 2PC4A 1H7PA 2FQIA 2ZQ0A 5C6MA 1GTEA 4POCA 2X2GA 4C1LA 3G0XA 3L21A 1TJRA 5L9FA 1FCUA 1MEIA 5FF7A 4Z08A 1H51A 4UTLA 3UWZA 3AJXA 4AHQA 1DL3A 1UASA 3M9YA 2H6RA 3NO5A 4MY1A 1TJPA 4MJZA 2GQAA 4MLRA 5DELA 3M7WA 3N73A 3RFAA 3RU6A 3TK7A 1M7PA 4KWVA 1ZNNA 1VCGA 2VEMA 1FCVA 5KITA 5D2WA 5FEWA 3TAOA 4JX4A 4Z1CA 4GUIA 2DZUA 3O6YX 3RK8A 5BW6A 1XXXA 5FEXA 1ICQA 5K2ZA 2Z0IA 1WQ5A 2Y7EA 4WUIA 4CQ9A 4PC8A 3TMLA 3GIYA 3LRLA 1UBSA 2JKEA 4O1CA 2UV8G 3C0JA 4NX0A 4AWUA 3NL2A 3C2EA 5CZ0A 1Z48A 4NJIA 4RV8A 3EX4A 4L4LA 3DFNA 1A50A 1P0NA 2QKFA 3G1FA 2NX9A 4TX9A 4UIOA 2EF9A 3VNDA 1O60A 3H53A 3W86A 4GJ1A 1DVJA 3QC3A 2FDSA 1F05A 1LOQA 4NJJA 4XWUA 4GE8A 5I3FA 1ZAIA 4HIBA 1VHNA 1XFBA 3RMJA 5CZJA 4BF9A 2NV1A 1B4EA 3CLMA 5H91A 3W6YA 1NF7A 1PL9A 4AWSA 2B7PA 4AF0B 2VEIA 4N6FA 3BV4A 4LRTA 4NXKA 4RKAA 1ML1A 2RKXA 4RK8A 1KFBA 4A22A 1SO4A 1PHWA 1TSIA 2WO5A 1CI1A 2OJPA 2Z6JA 4E0CA 3R12A 4LRSA 3G8EA 4ZMGA 2X1SA 3CWNA 1YXCA 3OVRA 3W84A 3W73A 2P1FA 4MJMA 4UFJA 2X16A 5AB3A 4YCOA 5FEZA 2GVGA 4IMCA 4OGZA 4JY8A 3P60A 1WAUA 3KHJA 4D2JA 3NOEA 3KRSA 4AHPA 2QF7A 4JTJA 1OHLA 4W9TA 2JKAA 2EHHA 3O8AA 4PCFA 4UMAA 2TMDA 1FWNA 1VHCA 4LVAA 4Y9AA 3BW3A 4IX0A 1B57A 3ZR4A 2BXVA 4DO5A 4YCPA 1PCKA 3VFLA 2DJLA 1KFKA 3KRZA 2P10A 3KVKA 1ZENA 1HG3A 2C6QA 2NXIA 4O17A 3LXAA 3ZFHA 2OCZA 3LBMA 3A5VA 4TU1A 1AK5A 4JTSA 2WSYA 2ZBTA 4JD4A 4DO4A 5DCBA 1V7YA 3NM1A 4CNPA 1ME9A 4JTUA 4N9EA 1XBXA 3QMRA 5EA9A 2A0NA 3N2XA 1VLWA 4IMGA 1YDOA 4OBTA 4BK9A 2CWNA 4FF7A 3M6YA 3NM3A 1LRNA 1QOPA 3LCWA 5LHFA 3G1XA 1DQWA 1L6WA 2H8ZA 4ZQCA 1LYXA 3NYZA 2GQ8A 1JJKA 3GXTA 4Z1BA 1TRIA 3BG9A 5F2GA 5TIMA 2G5WA 2VOMA 1K3UA 3FFSA 3C2VA 3GXNA 3MBFA 2J27A 3BG5A 3M43A 1H63A 5CGQA 1FDJA 3DFPA 4LOCA 5I3HA 2WJZA 2E6FA 3USBA 3E12A 4BWLC 1QOQA 4NNCA 1G4SA 1WBHA 2VFFA 4YWIA 1JVNA 1IXQA 2JGYA 3TC7A 1KBIA 5KZEA 2R14A 3NQ6A 4OV4A 5TQLA 5AC6A 3MI6A 4TMCA 5EMUA 1LLWA 3CIXA 4GBUA 1Z41A 3OG3A 3R2GA 4P61A 3TA6A 4JTGA 4Z1AA 4ALDA 4JY9A 3DH7A 4M7TA 3TQKA 5FESA 2Y88A 5AYXA 2QDGA 3NG3A 3B0UX 2AGKA 2QAPA 1W8SA 1VCVA 3KX6A 3A24A 3C2OA 3SY5A 4B5NA 3MI3A 1TIMA 1OFRA 1SZFA 1NSJA 3LCFA 2B0MA 3FJ6A 3HBLA 5D38A 3LHYA 4AHOA 5D30A 3G8RA 2A6NA 4MPQA 4ORIA 3ANYA 2XN2A 3PG9A 4NNAA 4O10A 1P0KA 1GJPA 5EL1A 4TR9A 1IIGA 5LNRA 4CCEA 5BMWA 3W88A 3EX3A 2C16A 3GKAA 1S3HA 4MVAA 1TPB1 5C55A 1TV7A 4LS1A 1KM2A 3QW4B 3TJXA 3NQDA 2WSRA 3W2JA 2QCEA 4BR1A 1O5KA 3DI0A 5LNSA 3GDLA 4TO8A 4QSHA 3TAKA 3GDKA 2C18A 2GOUA 5LZLA 2FPVA 1F74A 1I45A 4AWTA 3W22A 2JGQA 4FNSA 3GX9A 1QPRA 3G1AA 4FNQA 4LS0A 4GC4A 1R30A 3QRHA 2TYSA 3NL3A 4KFPA 4LVGA 3S5NA 1OABA 1W37A 3A23A 5LSMA 3CC1A 3TCEA 2ZZ2A 4P2VA 4S2CA 1YADA 2NXHA 3N34A 4FEZA 4FHAA 3NNTA 4N4PA 1X7FA 4GUJA 1OK6A 3CHVA 3N3MA 1RR2A 2V81A 4S1FA 3UWYA 5I3KA 4UTUA 1W3IA 4M5PA 2E09A 2E77A 2ZDRA 4HN4A 4JTTA 4U4MA 3W76A 1WOAA 2BZNA 4GNJA 1KFLA 2PRLA 4O53A 3N19B 4MUZA 4Z1DA 3W1QA 3GDTA 1XDLA 1JCNA 3W7OA 3HPXA 1SW3A 1XCFA 3H54A 4LTSA 5EKYA 4BI6A 1FWWA 1F5ZA 3L9CA 3HGOA 1RQBA 3GDMA 1ZFJA 3L66A 1MXSA 4X3ZA 4WXYA 4O13A 3WK0A 4IJBA 1FUYA 3PSVA 5KINA 4AXKA 1FWSA 4MLJA 1GT8A 4KFNA 4L4MA 1J2WA 1WXJA 3MHGA 2DZSA 3PBYA 3SGZA 4JN6A 2ZZ4A 1N55A 1H50A 2FPTA 2HMCA 1T99A 1MEHA 2V9DA 1HO4A 3G3MA 2ZA2A 2W0UA 4ZL1A 1FDZA 3HOJA 5D04C 5DY3A 1KM4A 1OYAA 3LERA 3W2UA 2QCNA 3P8IA 3QYQA 1PS9A 5AOUA 5J5DA 3F4WA 4UTWA 1EPXA 2VKZG 1TRDA 1S5TA 1YDVA 2ALDA 1TQXA 3HGSA 2QCHA 5F2MA 2FPYA 1OYCA 3QM3A 4N02A 3VCRA 4AB4A 4Q33A 3EWUA 2BLEA 4HNUA 4E38A 1Q45A 1N8FA 4A21A 5F4SA 4O1AA 1FDYA 4XUGA 2A7RA 1VZWA 3UZJA 3DI1A 5CPOA 2IQTA 3BW2A 3IRDA 3QQ1A 4X22A 2V0TA 1XUUA 3O1NA 4MKNA 2X1UA 3WJZA 1JCYA 3NQ8A 3W7GA 5DLCA 2VFGA 3N9SA 1DQXA 3NPUA 3JS3A 5HQEA 3LHTA 1QO2A 1KTCA 3A9IA 5FEPA 4UC5A 5F2LA 1JR1A 3UNDA 3W1TA 4FIRA 4WJEA 1C9DA 2C3ZA 3KFTA 2F84A 3W7HA 1W5OA 2QDHA 1RD5A 5T26A 3CEUA 1UUMA 3R8RA 3C8FA 3W9ZA 3GR7A 3GKFA 3TMQA 4FX6M 3Q58A 3QSTA 1QAPA 4MZ8A 4Y6GA 3MHUA 1IF2A 1IGSA 5LGZA 3ATZA 4K38A 2Q8LA 3L0GA 4LNYA 3OVPA 4OE7A 3HPZA 2WNQA 3CB8A 3M0ZA 4DXVA 2YYUA 2Q8ZA 3TROA 3P8JA 4C1KA 3DHDA 4O28A 4LV9A
chains in the Genus database with same CATH superfamily
1WDSA 3E2VA 1JEZA 1S2AA 3R43A 4S2BA 4WDXA 4FXRA 4F0SA 4OHQA 4ADUA 4M1BA 4GFIA 4G6CA 4BQ5A 1XKYA 1B54A 1ONRA 5E9AA 4F2TA 2D24A 3IJIA 1F8MA 2J66A 3HTWA 5KMYA 3GTFA 3V1HA 4GX8A 1HQTA 3GBDA 3JU2A 1GPFA 3W2MA 2FGBA 4NSBA 3W3OA 4P7LA 2BVDA 1P4CA 1M41A 2GLKA 2UY5A 4I90A 4XBSA 1A5CA 2C79A 2DPEA 1NQ6A 3QQ0A 3WLSA 2B4GA 5E0KA 4Z2GA 1TG7A 1AL7A 2RDWA 4DWSB 1UR8A 1RP9A 4PSRA 1FWAC 2HXUA 4IFOA 2EPNA 3IJ7A 1QI4A 3UVIA 4D9PA 4JXCA 4LAMA 3C61A 3CJPA 1QUMA 2AQVA 5DEZA 4D8LA 4Z42C 1VFUA 1UZ1A 1XIFA 4F2BA 1LF1A 2EO7A 1A0DA 3OBKA 2Y63A 4Q22A 3R11A 4QG9A 1U30A 3VINA 1Q2RA 3UCQA 1EP2A 3CWOX 3RCNA 4YJ5A 3LX9A 1LWIA 3JRKA 2Z1BA 3G77A 1E56A 4QDPA 3MJMA 3UZXA 4WY0B 4JKMA 5HMDA 1W2PA 3EWYA 1XRTA 3PAJA 4QP0A 3OZYA 3UWWA 3TYAA 1R2TA 2JALA 3E96A 1B9ZA 1QNRA 1GEQA 3LYEA 3VGGA 3HGRA 4CN6A 3LHZA 3B8WA 4TX6A 2BP1A 3M6DA 1JYVA 3L68A 4IMFA 2Z29A 1EJSC 2Y7GA 4OECA 2GOKA 4M51A 4RX0A 1V02A 4C6CA 3D5HA 2V2DA 4LU0A 5A8PA 3EKLA 2WM1A 1JAEA 1B5TA 2A1YA 5AFDA 1K7FA 3A4WA 5FL1A 3E0WA 4UXDA 2D0HA 3NDZA 1PX3A 1HJUA 3M44A 1E6RA 2GWGA 3A4AA 3BO9A 2HVMA 4JQ1A 1E51A 3PG8A 3GW0A 2YYTA 1Y0EA 1DIEA 1IE7C 1XYCA 2QIIA 3ABZA 1BG9A 3EA3A 2INEA 5I3JA 3FSUA 1OCJA 5KZMA 2HPIA 5I3GA 4HA0A 3DAQA 4HZ8A 1R2RA 1RJRA 5I02A 1E4NA 1O66A 3CZGA 1I2OA 1N82A 4W89A 4DXKA 1CPUA 1KKOA 1XF0A 2DEPA 3UU0A 4MFEA 4BI5A 5FF2A 4ZO8A 1UWAA 1P0DA 1YQ2A 4J3ZA 1OJXA 4I7UA 1BWKA 1TMQA 6REQB 1TTIA 4ZFMA 3F2BA 2AQWA 4MNLA 2VR4A 3NZPA 4YVPA 1OINA 3C3UA 2BVWA 2VFHA 4LCSA 2IKIA 6CGTA 1KA9F 2NQ5A 1TPWA 2R82A 3MWAA 4UFMA 1V6UA 4R85A 5HUOA 4CVWA 4I9TA 4V15A 3IV3A 5HOSA 3IUDA 4GHRA 7REQA 2HNHA 2GVLA 4XD4A 1LT8A 5FACA 5BZAA 3MDWA 2J6XA 3BXWA 3O2LA 4DJEC 2H8XA 2HROA 3NPWA 2W67A 1DWGM 5CC5A 3ZIZA 3GVVA 2BMBA 3AWOA 2ZTJA 5LIWX 5DRCA 3ARVA 4JYDA 2V8ZA 3M16A 1EIXA 1SJDA 2YKKA 3PC0A 5D09A 9CGTA 4FF5A 4OWGA 4F0KA 1G69A 5I23A 4U5IA 3L0NA 3PBWA 1LJYA 5FJPA 1GW9A 1JZ6A 3ZMRA 4NT0A 4F3HA 1SSDA 1JDEA 1I60A 1N8WA 4R9XA 1V6YA 4PUKA 2I57A 3H7RA 1JZ3A 5LA2A 1SJAA 1PE1A 2XWDA 4Y7EA 5I3DA 3PJWA 5F1UA 4W87A 2R24A 3QPEA 1Y65A 4DIAA 4IMDA 1G4EA 4KWSA 1F7BA 1K8XA 1EUAA 1JGIA 3QH2A 1OFAA 3T08A 4UTIA 2V3DA 1SO3A 3C52A 2HBVA 1FH7A 4FOUA 3MP3A 3VVGA 4ZSUA 4JNMA 3MT1A 4UFLA 3H70A 1XIBA 1JYWA 1DJXA 4FNUA 2I5IA 3W7KA 4O54A 1G5AA 5DRIA 1XBZA 3IGXA 3ABRA 1QMLA 5BNKA 3TZNA 4PTNA 5JBEA 1JZ7A 3ARRA 3BUVA 5G4WA 4AQLA 1VJZA 3EB4A 1A5KC 3KBWA 4JX6A 3P5YA 1NWTA 4TTUA 4GINA 2HE8A 1ZQ5A 4IPNB 3HU7A 2WZEA 2NW0A 4AY1A 1QPQA 1E9YB 2A4AA 3ARTA 5E1QA 1HGWA 4B5XA 3NSMA 1YXDA 1SFSA 4LCRA 5DCDA 3DYPA 3FX4A 4Q8PA 3GH7A 4DBEA 3VC6A 1CT5A 3W75A 4IGNA 2XN0A 4RNJA 1Q6RA 4X2PA 2R91A 2Z24A 3OG2A 4BEQA 2OMAA 4OT7A 1BSIA 3E49A 1TA3B 1O94A 5FIPA 2L5HA 5I5RA 3MSDA 5C9WA 3DBNA 3WFLA 3W7EA 3G1YA 4XD6A 3SCPA 3AU2A 2G50A 4O1BA 3IV8A 4AVOA 5BOFA 3MQTA 4RZ4A 4GXWA 3R10A 1S2CA 3VOFA 2ALRA 3WDQA 3JVAA 1JD9A 4I8YA 4QISA 2DV0A 1W3LA 3BOLA 3TQPA 3OYXA 3IAQA 1AD1A 1UYQA 4CU7A 4NHVA 3DFHA 3S3GA 1ZTVA 1MQPA 2QJGA 1AH0A 2CERA 2AAMA 3NZ1A 2XH4A 2PTZA 3WK1A 4J27A 2DH2A 4NZCA 3N9KA 5HQLA 3SECA 1BEUA 2DH3A 5I06A 3ANVA 3V5FA 4F79A 3F03K 3OGSA 3CH0A 1N2VA 4B92A 3AHZA 1TIWA 1Y8BA 4S3AA 4RXFA 1EWDA 3E6EA 1KM5A 5EBUA 3H2FA 3OIXA 3W37A 4GH3A 4WR3A 1UWTA 4RZ5A 4LBUA 1OVDA 1EA9C 3GXPA 3QBUA 4UTTA 3N6QA 2J47A 3T4WA 4CN4A 3ZR5A 2E9LA 1EJWC 2X7WA 2WZHA 1HKKA 4HP5A 3ENLA 5ECVA 4I7VA 3FNDA 2O9OA 1M6JA 2Z6IA 2VX6A 4D6IA 2YX0A 2QPSA 4J9JA 3TW6A 3THDA 5M2FX 2OX4A 1H2JA 3FJ4A 4GACA 2GJPA 3BAWA 3LDVA 1KV5A 3VI2A 1KCLA 4E4PA 3KAOA 1B0IA 3DN5A 1EJ7L 1LWJA 4WEVX 4R88A 1BF2A 2YCKX 4JTAA 3BH4A 3O07A 1H41A 1YTEA 3OO2A 5K7JA 3HMJG 3WBEA 2YOCA 3VKDA 4WY0A 1B90A 1GWJA 3WBWA 1PX4A 1FWDC 2DVTA 4RDWA 3MANA 4JIRA 4GISA 1IEWA 1PDYA 3BSMA 3MUIA 4ORMA 3U5YA 1J9YA 4JDYA 2I1OA 5K9XA 1BQCA 3CT7A 1US2A 4LS2A 1JDCA 1DE6A 3C6CA 1VEPA 3B4YA 2YA1A 3TOYA 1ITCA 4HVXA 3TTOA 1MDLA 3NVTA 1Z44A 4IQLA 4A6GA 1Q7QA 3NPVA 2OWWA 4J35A 1NVMA 4WDUA 2E3ZA 4JN8A 1J11A 4GUHA 3ECQA 3PSWA 3GS6A 2F8QA 3S5YA 5D02A 3EDKA 1QHZA 3EXTA 3W82A 3MMUA 4L1XA 5CQ1A 4YWSA 2PDBA 3IVUA 3NFUA 1Z32X 4JTLA 2QCFA 2ACUA 1BKSA 2PDNA 4RR4A 6TIMA 2CLEA 1UQYA 3BAIA 2OG9A 1SZNA 1KTBA 5HJLA 4TVDA 2CC0A 1IT0A 3M47A 3AHYA 3GIQA 4GQBA 3Q94A 1QBBA 1VEOA 4WSKA 1C8QA 3PUEA 1GOMA 1SZGA 3IIXA 4RPQA 4PMNA 4Q8TA 7TIMA 2TPSA 3WNKA 1H7OA 1K6AA 5FF4A 1TUXA 2PAJA 1E6ZA 1BTMA 2D3LA 2NSXA 4EP8C 1RXOB 1Y5VA 3KP0A 3GG8A 4LW7A 4XB3A 3URNA 4LYKA 1EYEA 3RCYA 4RL3A 3EX1A 4UCFA 3U7VA 1XC6A 4DF2A 1IEXA 3ABQA 3H21A 3E0VA 1EO7A 4NU7A 3T8LA 3AXIA 4C6EA 2W9MA 1EC9A 2CU0A 5IHSA 3Q4DA 4K6AA 4J1OA 3BGAA 3W7NA 5B80A 4RUBA 5D2TA 4I5RA 4YTRA 5ECUA 2V3EA 4JIQA 3C2RA 1CTNA 1DOSA 2CCRA 4FR6A 3C0SA 3W38A 3DEQA 3F2CA 4IQEA 2GPTA 3N4AA 2YB1A 3LHVA 3RX3A 2F2KA 1TREA 4ROQA 5K4XA 1UJQA 1OIMA 3QW3A 2E9MA 4O0KA 1XYBA 1BYAA 1G7VA 5EFFA 1R46A 4ZSTA 4EPKA 1KRMA 1HJXA 1K9EA 1XJBA 1TYGA 2XUCA 4LALA 1K70A 1C3FA 1BF6A 4S39A 3QJAA 4P7NA 2JKPA 1AJ2A 1TVNA 3JZEA 3AIBA 4AD4A 1XP3A 4PMXA 2I9EA 2ONEA 4K37A 1DHKA 2HSAA 1NQKA 1DXFA 2QDEA 2VEKA 1HJQA 4UOZA 4FI4A 4Y9OA 2A85A 2REQA 4W7WA 4JCMA 3MV01 5FJIA 5KTLA 1UWIA 2ZXDA 4DI9A 5CZKA 5HWMA 1H49A 2IQ0A 2O56A 1UR0A 4GKLA 3UWUA 3FA3A 4LCQA 2X1RA 4EF9A 4LAUA 4ICMA 3BC9A 1Y5XA 4CCDA 2TRSA 1FXPA 2PDIA 3AMLA 4QG6A 1V93A 3APGA 4GG9A 4AH7A 2A5HA 4HHPA 3UXLA 1XSIA 5C7VA 3KVLA 3TC3A 4HK6A 3A3WA 1T7LA 3TYBA 2NV2A 1H09A 3B8VA 3HPSA 3MHFA 2X41A 3EXSA 3MKKA 3LGDA 1LTDA 5F2IA 3UG8A 1ADSA 1K8YA 3G1VA 1F73A 1LCOA 2XFWA 3PTKA 1JXKA 1AFSA 2GJNA 4ZB0A 5BCAA 4C6QA 3ZJ6A 4CQAA 3M7SA 3DG3A 4OTKA 2DZBA 4IXXA 4PMUA 3RRXA 4LC8A 3TIMA 4GGHA 2D0GA 2CLLA 4AZ7A 2CKRA 4MKSA 5KZ6A 1TPC1 3TC6A 3WDIA 4G1KA 3G0SA 4QE1A 3V0SA 4KEZA 5DFAA 3L2MA 3WD0A 1X38A 1E1EA 1TTQA 4UFIA 4H1ZA 5G4HC 3QEZA 3DXIA 2EEXA 3TXVA 3W7LA 3GU2A 2FKPA 1QI3A 1YPXA 2AQOA 2YXGA 4HMNA 5E0FA 3ZS4A 3LCXA 1F76A 1DKWA 1MVYA 3CHEA 2DY3A 1YIXA 1A5AA 4H9MA 3B3DA 3O05A 2NVDA 2FTYA 3TV8A 3B0PA 2WSQA 2J7HA 3VD9A 1EHNA 2DORA 4DWSC 1O4UA 3TA9A 3EPNA 1MUCA 3CH9A 2R1NA 4CNOA 1XLFA 2CZFA 1DEDA 4H9VA 1PKYA 3QOKA 3Q65A 2D69A 1PKMA 2WKGA 3LGEA 3TQ0A 2YW4A 3PB2A 5AYIA 3D47A 3W71A 5AC7A 1DPMA 1GKRA 2BDQA 3PJTA 3POCA 2BGSA 3GNNA 1Q6LA 3BOFA 4ZOCA 8XIMA 5BMXA 1P6WA 3AQUA 2DT3A 1GQNA 3FVMA 1UZDA 3SURA 2GGIA 3V0UA 4KEMA 3FY1A 3LPFA 1PHQA 1CLKA 2CLHA 3BGGA 3UXDA 4YMZA 4B5VA 3W1UA 4XISA 2I14A 3IGHX 3S6OA 2H90A 2QJIA 3CXOA 3P5ZA 3V5CA 1L6YA 1JPMA 3QFWA 4KW2A 3W2LA 2Y85A 3N9RA 3GVGA 4PULA 2JFEX 4Q4MA 3W01A 3QSRA 5HNNA 2HCVA 5AC5A 4MJ4A 2V5DA 2VRKA 4O18A 4U2YA 7ENLA 4PODA 3KTCA 2OGJA 4U31A 4UR9A 4IMAA 3LD5A 3ISIX 4HA3A 4XZNX 4W88A 3U2CA 1D3CA 2HK0A 1TJ1A 4W86A 1QOXA 1TPFA 3N2CA 3UW6A 3W7CA 1HT6A 3I4EA 4H04A 3KE0A 4MIMA 2NQZA 4UTWC 4EAMA 3QGKC 5HAOA 5U4NA 3FHAA 5E5CA 3VMOA 3WMCA 4WKFA 2QVHA 3GNRA 2BS9A 3RRAA 2ZX7A 3R8HA 2CW6A 3TR9A 2GVJA 5FL0A 4RZ6A 1WKYA 2B7NA 4K8EA 2YA2A 2E6DA 3S0CA 4GYPC 1K03A 2DSZA 3I6TA 3ARQA 4G1NA 1OFOA 3VDAA 3R0DA 4MDOA 2YL8A 3RO8A 1TVPA 5KSWA 4QLKA 1FFRA 2ZKMX 3ZT5A 3JZUA 1FCQA 1W1ZA 1MUWA 3W23A 2H3DA 4GUFA 4GVHA 1GVRA 1NH6A 2YW3A 4ZGYA 4WXZA 2YDSA 1E4MM 2P0IA 2QIWA 1EGMA 1XKJA 1XBVA 4YXGA 3LY0A 4NX5A 2CFFA 5AHLA 1W5MA 3LQGA 2ZVIA 1S38A 5FI8A 4QE5A 1F4HA 5CPTA 1UCWA 1LBFA 3CB3A 1D7FA 4DVOA 1M7OA 1LLOA 1GOKA 3W81A 4MPKA 4M56A 2V63A 5FSDC 2QGHA 2WM0A 3PFRA 3P93A 3DDMA 4LY8A 4BKNA 4FB7A 3E2RA 1WAWA 2DZAA 1O12A 3PWGA 1OGBA 2FJKA 3UESA 1P1XA 4PMRA 4L7ZA 3TR2A 4M81A 3GXMA 2FDMA 2PZ0A 2CIPA 1MZHA 2NX1A 2OZTA 3IIVA 3H26A 4IL0A 4FLSA 3L0KA 1XBYA 2BHZA 3IACA 3RF9A 1EOMA 2O9RA 1ZLPA 4DLMA 8TIMA 4IFKA 4H19A 3CQJA 4H4IA 1WDWA 2ON3A 2DT1A 3AS2A 3CPGA 1BRLB 1H5YA 1CW2A 4TTGA 2DSWA 2ZZ7A 3PHAA 3DUGA 4AEFA 1R3QA 1V6VA 4NZ1A 3S9IA 3MVTA 5BROA 5AHEA 5CJ5A 4BQ2A 3W7PA 1XYMA 1QI5A 3DFTA 2XVNA 1GZJA 3B97A 5AY7A 5A8GA 1W9UA 1XDJA 1HTIA 4ZO7A 2VQTA 1HJVA 4KRUA 4MWAA 1IWAA 3CS2A 1GZ1A 2A7NA 4GIAA 1P0EA 3IVSA 3LRKA 1RJQA 3K5XA 3O15A 2CZDA 2E6AA 4CCCA 3C4UA 3GDRA 2CETA 3T09A 5FJJA 3S1UA 2H3BA 2BHYA 3U4FA 2G3MA 3RXZA 5IOBA 2OLSA 4POCA 5HDRA 1SJBA 5FF7A 3UWZA 3H6OA 5T91A 1MW1A 1PYFA 1DL3A 3R94A 3NO5A 4XVDA 2GQAA 3GHTA 3RFAA 3TW9A 1XISA 1SJCA 4RPPA 4I9JA 2VR5A 3U5UA 1FCVA 2XDFA 5D2WA 3TAOA 4Z1CA 4GUIA 1QVBA 1O7AA 2YCIX 3PPGA 3FHQA 2D22A 1R0MA 1ICQA 5K2ZA 2EBNA 1WQ5A 1C92A 4CQ9A 1EBHA 2PI6A 4HQVA 4HOWA 2PLJA 3LM3A 1NFGA 2PGFA 3C0JA 3AUJA 3BAXA 1WKFA 3EX4A 3CZEA 4J4KA 1A50A 4UIOA 3VNDA 3H53A 1DVJA 4TUFA 2RUSA 4PUUA 3MCOA 1E15A 1E4LA 3OVGA 2NV1A 3HV9A 3URAA 2P53A 2B31A 3PWIA 2B7PA 4AF0B 2VEIA 5AVHA 4N6FA 3BV4A 3ZJ7A 8XIAA 2VUYA 4GNKB 2EPMX 2X09A 1E5NA 1PHWA 1MMFA 3DHPA 1UH2A 3V0TA 3R12A 5HMFA 1WXZA 4ZMGA 3CWNA 4R7WA 4GI8A 3W84A 3W73A 1XIEA 5AB3A 5FEZA 2DVUA 1VENA 4OGZA 1PDZA 1WAUA 3N15A 4D2JA 3EWCA 5H6HA 3KRSA 2QF7A 1GVYA 4W9TA 1V08A 4PCFA 4LVAA 3BW3A 4IX0A 1TA3A 1W2VA 4PE8A 4DO5A 2BVTA 3SIMA 3D6NA 2NXIA 4GJIA 3L4YA 2AKZA 3GTHA 1HVQA 3SSZA 2WSYA 4JD4A 3M0MA 3WEMA 3NM1A 4N9EA 4E2OA 1XBXA 2A0NA 2J77A 4YVVA 1D8WA 4IMGA 1YDOA 1UPMB 2CWNA 1W8GA 1AH4A 1LRNA 1QOPA 3WQPA 5LHFA 1OGSA 1L6WA 2H8ZA 4ZQCA 3NYZA 2GQ8A 2G4JA 1Q6FA 1OIFA 1UMLA 1TR9A 1JJKA 3GXTA 4Z1BA 3W00A 4Q8NA 2E0PA 2G5WA 4PBFA 3AIVA 3MBFA 2J7DA 2J27A 5A6KA 2OOFA 4LOCA 1GQJA 1OG6A 3USBA 3E12A 1QOQA 4NNCA 1W1TA 1G4SA 2VFFA 4GYFA 1ZGDA 1JVNA 2OEKA 2JGYA 7A3HA 3KRBA 4C6BA 1R86A 3PBMA 5KZEA 2R14A 1WPCA 3NQ6A 1XW8A 1Q8JA 3M0IA 3II1A 4P61A 1B3YA 3BL3A 4JTGA 4ALDA 1S5NA 3USZA 3TQKA 2Y88A 5AYXA 1M7XA 2QDGA 2ZE3A 4HYVA 3IJLA 3NG3A 5CGTA 1XR2A 3ZM8A 3UPMA 4E3TA 2F6UA 5EMYA 3T6CA 4OJYA 1QNOA 1NSJA 3LCFA 2B0MA 4AHOA 3GXDA 3VUSA 3S2MA 5EL1A 1KRAC 2W61A 1IIGA 2BV9A 5BMWA 3WLRA 1AQ0A 2C16A 2A3HA 4IZGA 5CXPA 1QTWA 5C55A 3WH9A 1TV7A 4H7ZA 4BR1A 1O5KA 2WCGA 2Q8XA 4HZMA 2X0SA 1O5RA 3AXKA 3KLLA 2GOUA 1F74A 3FK4A 3W22A 4WCJA 2PDKA 1WP6A 1TCMA 2WVTA 3TZFA 2O55A 4BCEA 4Z2KA 1YHTA 3TCEA 5MKGA 2ZZ2A 4S2CA 1YADA 2JQXA 2TAAA 4FEZA 4IISA 1RHCA 4MSSA 2E09A 4HN4A 4M1RA 1B2YA 4HNLA 4Z1DA 3W25A 5HNTA 1XDLA 4BI6A 1TJ2A 1L0PA 1WKEA 5BRPA 4XAFA 1F5ZA 2Y5EA 3L9CA 1RQBA 3BJTA 3EA2A 2B81A 4WXYA 4B3LA 1FUYA 3VIOA 1F3TA 4A3QA 5KINA 4F0LA 4MLJA 4GNVA 2G3JA 2HVNA 1UG6A 1WXJA 3ALFA 3CO4A 5DMYA 4PCTA 1N55A 1QXLA 2OKTA 2OSWA 1T99A 2V9DA 4CQBA 2FZDA 5DY3A 1KM4A 4PSPA 5BU6A 5J5DA 3F4WA 4UTWA 1EPXA 2VKZG 5I07A 2XFRA 1TQXA 3EPOA 2FPYA 1OYCA 2D0FA 3CV6A 3FN9A 5XINA 2WWCA 1ITXA 4Q8VA 1Q45A 5F4SA 1UH4A 3RX4A 1GYMA 2PA6A 4XUGA 2Y5SA 5I79A 2IQTA 3BW2A 2GJXA 2F38A 1SZRA 2V0TA 4MKNA 3ZVIA 2X1UA 2RJGA 3W7GA 5DLCA 2J75A 2E25A 4JIEA 3NPUA 1M53A 1UC5A 3U3HA 3N2BA 2ASHA 5BXTA 2WXDM 2YB4A 2GWNA 2WMHA 3QY6A 3QYSA 1KTCA 3WQOA 5FEPA 5F2LA 3WMLA 4GZIA 4REQB 4ATLA 4JNYA 3KL5A 3W7HA 2GSEA 4NZ3A 1RD5A 3LNPA 4XAYA 3C8FA 3GDBA 4FLOA 4LF2A 2GDUA 3B0YA 3V3WA 2DUZA 4GCXA 3ZQ9A 4DUOA 3CZLA 3OVPA 1QPKA 3W02A 3TROA 1OM0A 3MB9A 1IZKA 3P8JA 2PWFA 4O28A 5LKYA 3RYSA 4C6JA 2PDUA 3S9ZA 3ZLHA 3UA4A 3EEGA 5CBIA 3KHDA 2J7BA 4IMEA 2BG5A 4GLEA 4AEEA 1BAGA 3RLGA 4DZIA 3LPPA 2PDFA 1JUKA 3NVDA 2VJXA 1GQKA 1XIGA 2EPKX 2DSKA 4FAMA 3IEBA 3VC5A 2C7FA 1W56A 4FX7A 1JI2A 3C2YA 4CCZA 4JYFA 4AYSA 2YDQA 3SW6A 1WOBA 1DBTA 1S5MA 1KNWA 3WFZA 1Q66A 1M1BA 5D9NA 4GIEA 4DJDA 1SZEA 4HU0A 1DXEA 3VZYA 2QAFA 5D2XA 1UA3A 3BQ5A 2XVKA 4FOJA 4JEQA 1F07A 1U5HA 5M03A 2WV8A 4IPJA 2IXUA 1LT7A 1GTHA 1LBLA 1L6SA 4C7GA 5I7GA 5BWAA 1TKKA 2AL1A 2OSXA 3U7BA 3DHUA 4A8LA 1P1MA 2WMGA 3RUBL 2V6AA 2BY3A 1EUNA 4H83A 4ZOEA 1UB3A 2WC4A 1FVPA 4EOUA 1GPWA 5DY2A 4Q3MA 4JKLA 1ZAHA 4F0MA 4HMEA 4HHHA 3QPZA 1PWLA 1TWSA 5D33A 3DKJA 1PJ9A 3COTA 1QNVA 3HQ1A 5E6ZA 1M7JA 2E5CA 4DXXA 4PMDA 3R89A 5DBTA 4HK7A 4PUEA 4LT9A 2OX1A 4PB3A 5CSSA 3BLIA 3MP4A 2D2HA 3WQVA 5A6BA 1E3XA 1ONEA 3NZQA 1YBQA 3S8HA 1E4IA 3SCVA 1KM3A 3FCPA 3WNPA 3GFYA 3IGUA 1FXQA 3HF3A 4NKCA 3WQ6A 3URBA 1H7RA 3T07A 1AJZA 1OF6A 1OX4A 3MMTA 3NO3A 3TTQA 1KKRA 1VFMA 2PP1A 1KWGA 2Z26A 2PD5A 4M6UA 1G6CA 3SCOA 2YCEA 3A12A 1EKOA 3CHCA 2DIKA 5K3VA 2XHYA 3DG7A 1YE4A 3O9NA 1Q6DA 3BZJA 2BTMA 4L6HA 2QNEA 3CWHA 4LANA 4RE0A 2RDUA 4J5NA 4PTWA 3WO8A 2FHBA 2PDQA 3FXYA 3MI2A 3PJXA 2B7OA 3D3AA 3M0JA 7ODCA 2OGYA 4PFMA 4DYKA 3PULA 3MZ2A 1BRLA 3LTYA 3BLPX 3KCOA 2R1LA 3TJLA 3VIHA 3BCDA 1W0MA 3OA5A 1R85A 1S5WA 4EWND 2PFHA 4HK5A 3TFXA 2VWTA 1CIUA 1V5XA 3DC8A 1KCXA 4BI7A 3LHWA 3GE7A 2FH6A 3FXGA 4DEFA 4H00A 3QGVA 1GZGA 1B4KA 1SYTA 2YLAA 3TLQA 4UUIA 3Q2DA 2GYIA 1G67A 2QF8A 2VGGA 2QCCA 1HO1A 4TIMA 4Q4KA 3CAKA 3W1LA 3MCMA 3VABA 4NXSA 1V0KA 3WK2A 1RCQA 3WQEA 4HNVA 3SUSA 3NQGA 3OODA 3CUXA 3R8GA 5MHBA 1A0CA 4N42A 2QJNA 1OD8A 4CN1A 4U3AA 1S2WA 5A5WA 2GDQA 5AYBA 1EFZA 3WDJA 2EAWA 2VFDA 4KCUA 2YL6A 4O50A 3W1NA 4V1YA 1QDSA 4ZO6A 3M0YA 4C1NB 4P8UA 1UUQA 3UT0A 1ZPTA 3OOQA 4MB4A 1TB3A 4OZOA 3BANA 5AYYA 3BVJA 1ZJBA 3MUAA 1R2SA 4ZO9A 4LY4A 3VKKA 2ATSA 2ZA3A 4Y9PA 1TV4A 3BV7A 1I2RA 4KERA 4UQBA 3LCLA 4H2HA 2XISA 2Y8VA 4LUTA 5F1VA 2XFYA 4GCAA 4LX4A 1Q5MA 2PDWA 1XIJA 3PBUA 4GKTA 1ZU8A 5I2UA 5D05A 1TPDA 3G24A 1KTNA 4AMAA 1VD6A 3UFYA 1JQVA 3N2MA 1F3EA 5CPLA 2ZA1A 1HNYA 1HZYA 3TXZA 4XKMA 4ACZA 4P7RA 2OYKA 3RNDA 2P3ZA 1RVGA 1F8IA 3SUUA 3UCCA 3NQ2A 3OIHA 2O7QA 3OHMB 1S39A 4MMWA 4DY1A 1ONWA 1AZ1A 5K4ZA 3TP4A 1SQ7A 4NAFB 3VD3A 4AD3A 1JF6A 1VJSA 2KX9A 3GZAA 1JCLA 3AXXA 4J2MA 1XGEA 2YCLA 2VENA 3UJ2A 1X6UA 3FOKA 2X1TA 5C9XA 4ICCX 1W5PA 3HZ3A 1IXPA 1SMDA 3A64A 1QK2A 3I6EA 1IIHA 2QJHA 3VYLA 4ROPA 3H2MA 4MF4A 2Q02A 1CYGA 1DWAM 4WZHA 4LBRA 3NQBA 5LIKX 2J78A 4ES4A 4L5ZA 3CZJA 3WQ4A 1UA7A 3GR4A 1EXPA 3A3XA 3AMGA 1EZ2A 4J3SA 3VCCA 4QQ3A 3A6OA 4NYUA 1I1WA 4UTTC 2WNZA 3VNJA 3RILA 3W2NA 5JQ9A 4JFTA 3HJZA 3MUZ1 1TMLA 3F1QA 3I7QA 3PR2A 4J7RA 4XBKA 3FDGA 5IHRA 3P61A 3SJ3A 5CC7A 4C65A 4LUSA 2DZXA 1ITQA 4WKHA 3I10A 1J93A 2XVPA 3HB9A 3W1PA 3AHTA 3HPAA 3AIWA 1V3MA 4XSMA 1XLBA 1TWWA 3E38A 3LMYA 4JQ4A 4PEKA 1J0YA 5CEWA 3BMVA 4DJDC 3CASA 2D20A 4URIA 1KM0A 4WSHA 1I75A 3E9AA 2ZC8A 3VPLA 2DW6A 1VRDA 4IGMA 3QMTA 1OC5A 4O8RA 5D2VA 3W7JA 1HP4A 1SUXA 4UR8A 4D6GA 4Z0JA 4GXMA 2HTMA 4WDWA 3R7MA 3W53A 4X63A 1Z7AA 5FJUA 5CC3A 3B8DA 1J0JA 2PGWA 4TQTA 2QW5A 1ZP3A 2YLLA 4QAIA 2Y0FA 1L6FA 1CGTA 1MO0A 5LGXA 4E4FA 1M65A 1R3YA 1F6YA 1ICPA 2WJEA 5CZTA 3TSMA 5LHEA 3SDOA 2OELA 3TJ4A 2FGZA 3L4UA 2C13A 2PEVA 1D9EA 3CAVA 1ZJHA 3CQKA 1DIOA 3KL3A 1EWEA 4LAKA 4R33A 3N17A 4NP7A 4RE2A 1NAL1 3WLOA 4LGXA 1GUVA 3IGSA 2YGYA 4JYEA 3TJIA 2BHUA 1EF3A 1EHAA 2Y6ZA 2IS7A 3A4JA 1NDVA 4QJ1A 3EPMA 3RIKA 4GD0A 4BQ3A 4LV4A 4YYCA 2G3IA 2Z2BA 1LDCA 5AHFA 3S2JA 2FMOA 3VDGA 4PTXA 3TQVA 1LUCB 3PPHA 4CQ8A 1UR3M 4X61A 1OCQA 4O1EA 1Q6EA 3TE9A 1R9XA 3OW1A 3BLKA 3RN6A 4MYXA 3VUPA 1HKIA 4ZTYA 3M5VA 3MC5A 5EY5A 2VEPA 5HPCA 1E0TA 3LI0A 1DWHM 4GMEA 4UZUA 1X8CA 2ZZ1A 2V5LA 3QV9A 2F61A 2BOEX 2E28A 2HS6A 5G1TA 2YR1A 4ONVA 1GGOA 7REQB 3W7QA 4S23A 1EDQA 2VZUA 2E6YA 3LXCA 1K8ZA 1BVNP 2ACRA 5AYZA 5A8OA 1JAKA 3GAYA 3NZGA 1UR9A 1DTUA 2ZWZA 3NQAA 1W31A 3SQLA 4OIFA 3WD1A 4A8IA 1XX1A 2P8BA 4AIUA 1AQMA 3WDPP 2WC7A 2BGNE 4OOZA 1DJNA 1PKLA 3DOPA 1GVSA 4IF2A 2FFIA 3NXFA 4TVUA 2I9UA 4RNHA 1X98A 1SVDA 3P7YA 3K2GA 4UMCA 4Q8OA 3VU2A 3PNUA 2C1GA 4PUNA 4XZ9A 1BD0A 2X30A 3ARYA 5EB8A 2A3CA 1FBAA 3TSBA 4JTIA 4HNNA 1V6TA 3RLVA 4IG2A 3F5KA 1GOQA 5C54A 3IPWA 1QHOA 3DFOA 2VDHA 3CU2A 3IIZA 1ZBVA 5JU6A 3QR1A 3CMJA 1BFNA 1KO0A 4S3GA 3LZ5A 4NZJA 4DI8A 1CLVA 3V16A 1EJTC 2RJHA 1XC4A 4HN8A 3N2TA 4WSJA 5HXMA 2J25A 2ZUTA 1CNVA 1PCWA 2RGLA 1RJPA 1GEHA 3OZPA 4JL1A 3DHFA 3EYPA 4ZXLA 1T96A 1A49A 1XI3A 2E8YA 3B9DA 4DUXA 3WQ5A 1A5BA 5CLWA 4C5ZA 4TMBA 1EIBA 2QCDB 1SGJA 1QBAA 3VGHA 1YW1A 2C71A 1I2NA 1W3NA 5G5IA 4JTDA 1TTPA 1NF0A 4GH1A 4L1WA 2ISWA 3WD4A 2Z25A 4IIDA 2EJAA 1LQ0A 3WKZA 4IOTA 2VWSA 4LEFA 3WCZA 1HKMA 3APTA 2HNEA 2J4GA 5FF3A 4UQCA 1VBUA 1ZL1A 4HPXA 1Q63A 4HU3A 1A3WA 3N2OA 4CUCA 5G2IA 3U8GA 2EPOA 3T0AA 3HJEA 1HVXA 3BZGA 4PMQA 1XH0A 3VK5A 2KAUC 1KW1A 5CZSA 1OD0A 3LCHA 1YX1A 1FKWA 1XRSA 2Y7FA 2PF8A 5BXSA 2VDIA 2PDXA 4RV3A 3DIPA 3M4HA 1N7KA 1NFBA 1XH2A 2GVYA 1UWUA 3BGJA 4D6CA 3WUEA 1FHLA 1XYAA 3S2LA 2CXGA 1ZY9A 1NDZA 3PWAA 5BWFA 3VILA 3RM4A 4OVXA 4UCGA 4PL1A 3EWBX 1T0OA 1V3IA 5JH2A 1VGAA 3FYPA 1E0VA 3O6DA 2QDDA 1JZ2A 3B9AA 3SGUA 3TVAA 1G94A 3TONA 1OFPA 4EANA 2WNWA 1VS1A 1WDPA 1BSLA 2YCJA 4U3CA 1H62A 1GYLA 4NVTA 3FEMA 3VGFA 1VYRA 4PRRA 4UZSA 4IWWA 1E0WA 1FRBA 5HINA 4L1GA 2Z1WA 1OZMA 2P5NA 3DZ1A 6REQA 1LL4A 1QI0A 4Q4PA 3DKLA 3QZAA 1Q6QA 1WXYA 3P62A 1JRCA 3QR0A 2J7CA 4MHBA 1ZZMA 5T9CE 4GIRA 1OC7A 4PGLA 3LB0A 3CIWA 4U10A 1PWMA 1H5VA 4Z2JA 4IG2B 2DT0A 2VCCA 4I3GA 4HZ6A 4QJ3B 3ITLA 2ZTKA 4DN1A 2J9YA 4RDYA 1RD6A 2FHFA 1RBLA 1C8XA 5CBBA 1ZP4A 2ZUSA 1UP3A 4OFCA 4LC6A 3EOUA 4U2ZA 4UTHA 4AZCB 3PVFA 1R3WA 2V3GA 5GJMA 2JF7A 1H7XA 3QZ6A 2BBFA 3GYCA 4HNCA 3POHA 1QT1A 2A3EA 1J5TA 3IIOA 4PH6A 3SRHA 5E93A 5BOOA 5FKYA 1VFFA 1JZ5A 4GK8A 1VP5A 3I7SA 3GNDA 3NCOA 4ERAA 1WV2A 4RJEA 4GZEA 3TUUA 1LLZA 4KIEA 3WUFA 3VIJA 1U1UA 2XVGA 2W5FA 3S6DA 2NV9A 3THCA 2W66A 3PK7A 3S1VA 2IKHA 2W6RA 4H7CA 3W7RA 1G0CA 2POTA 3T55A 4ZQMA 2WKJA 2J6VA 2UZ9A 4Z1YA 2GGGA 1XD1A 4KESA 2E67A 3M0XA 3LPOA 4WJ8A 2VZVA 1OG0A 4PUDA 4YL2A 3FIGA 5A6SA 4W8AA 2YL9A 4AEOA 3MUXA 2JEQA 3GG0A 2Q71A 3WK3A 4I9MA 1E5JA 1UW9A 2PDGA 1RY0A 2WQPA 4CGTA 1AVAA 2BY0A 1PZ2A 2NXGA 4PL2A 2I56A 3OBAA 1LRQA 4ZZ9A 1K4HA 4QR6A 5JXQA 2GJLA 1TUFA 3M64A 3LUTA 4F48A 2F6XA 1F6KA 1F6PA 3KOYA 5FD0A 3BOXA 5G1YA 1JUEA 3UPWA 5AC8A 3O6AA 2CXEA 3VOHA 1PPIA 2OU4A 3ZJ8A 3MWCA 3GLCA 1QW7A 3C8NA 2OR2A 3GUGA 1VPQA 1X8FA 1EF2A 3BQ6A 2ACQA 2BXZA 2CLMA 3ZWTA 5I3IA 1P6BA 3ITCA 1SW0A 2HPMA 4HT3A 4W7VA 3G1HA 2XM1A 3STGA 3KUMA 4NL1A 1HX0A 9XIAA 3K13A 5DXXA 5BXPA 1C8YA 1B3ZA 2UY3A 1ENUA 4V27A 5A1AA 4QG8A 3L2IA 3ARPA 3GO2A 3L67A 1D3HA 2QCMA 2VYOA 4H9ZA 3H2OA 3WN6A 4RXGA 2G95A 3FJNA 1V6XA 3FS2A 2OEJA 4Y90A 4EK7A 4MB5A 4H3DA 1J0ZA 3R79A 1E43A 4O57A 4YS1A 4FPSA 1TV8A 3O6CA 4LWWA 3TYCA 2ISFA 1MNSA 4LXFA 5CSRA 1JDDA 4K1GA 1X97A 1VF8A 3KOFA 3S42A 4BS0A 4GZJA 1B1YA 1W9DM 3N14A 1BHGA 1XWYA 3T8QA 3AICA 1XRVA 5LA0A 5EGRA 3S46A 2QLYA 1Q6CA 1XQLA 2CEQA 3AALA 4L80A 4G5DA 2VZOA 1TE6A 3HV8A 2FB2A 2Z7GA 3JW7A 3WLJA 1W1PA 4XZLX 1W17A 3WG6A 2HK1A 4WJXA 3S1WA 1XLLA 1H1ZA 4LVBA 3CL8A 4LB4A 1B3OA 3RMEA 4H6RA 3IK2A 3K46A 5JVLA 2POZA 3L5MA 3H2CA 2PRHA 3T44A 1B3WA 1FY6A 3NO1A 1UC4A 4EX4A 3T0DA 3VO0A 1H7WA 2CKSA 1Z69A 4JL2A 3PTQA 1KR0A 3WFAA 2XGBA 3VTRA 1I2QA 2R94A 4RLIA 4PA8A 3W7IA 3VGEA 1JQXA 4BJHA 3CNYA 2OOGA 2ZQ0A 1O1HA 3ITYA 1M68A 2PTXA 4MAVA 1TV3A 1FCUA 4KGLA 4UTLA 1P48A 3AJXA 4AHQA 1E6PA 4MY1A 3M9YA 4RNIA 1TJPA 3PZUA 5DELA 3RU6A 1M7PA 3GH5A 4KWVA 1ZNNA 2VEMA 4HYRA 3ZXWA 3VDBA 1KFWA 3GY1A 1DJYA 3RPMA 5FEWA 3E0FA 2IXVA 4JFVA 3URQA 2CESA 3O6YX 5BW6A 1XXXA 1V6WA 5FEXA 1EJUC 4D72A 4GZ7A 4G9PA 4WUIA 4PC8A 3M0LA 1JDFA 2FJUB 3AFBA 1SFTA 4JHOA 4NX0A 4AWUA 3NUKA 3NL2A 3OLEA 4CU6A 3AHVA 3XINA 1OBAA 5CZ0A 4RV8A 3VM5A 2HRWA 1P0NA 5E9XA 5FCZA 1UHVA 2A3LA 2EF9A 3W86A 3QC3A 2FDSA 4M82A 4XWUA 2V68A 5I3FA 2Y5JA 3WNNA 1IZJA 2XINA 1BTCA 3CYJA 1E1CA 5D8WA 5H91A 3EMZA 3W6YA 4AWSA 1I0DA 1R7AA 4RKAA 1ML1A 2RKXA 4RK8A 3MKCA 3O7UA 1SO4A 2WO5A 1CI1A 4L6OA 4O8AA 1VIZA 4QDWA 3GRIA 3OVRA 1YXCA 1SR0A 2P1FA 3E74A 2CNCA 4UFJA 5C2CA 1Q65A 4YCOA 3AHXA 4WGHA 2GVGA 3AIEA 2G8ZA 1EBGA 4IMCA 4X0VA 1J18A 5IFTA 1XLJA 4OOUA 2WVVA 4GQRA 1S1RA 4JTJA 3G6MA 3LLXA 2JKAA 4ERGA 2A3AA 3SY8A 4BZYA 3TTSA 2CBIA 4IFRA 4R9OA 4ZR8A 2BXVA 2NLYA 4YCPA 4GOAA 3E3HA 1U1HA 3IAPA 3VFLA 2P10A 3KVKA 1HG3A 3GVWA 1W91A 4O17A 3LXAA 1K9DA 2PWHA 2OCZA 3LBMA 1Y7VA 3A5VA 3S1GA 3RG6A 4JTSA 1V7YA 4HNOA 2P8CA 1VLWA 4OBTA 4QDMA 4FF7A 3M6YA 1ELSA 3NM3A 3LCWA 3G1XA 1EXBA 4L9XA 4DJFA 5HATA 4H9UA 1IHIA 5E09A 2VRJA 1A5LC 1DP0A 1TRIA 3EB3A 4DAFA 2VOMA 5A6TC 2ZX9A 1MNZA 1EH9A 1KCKA 3AZTA 2PDCA 2ZDSA 1Q4WA 1FDJA 5CGQA 1RALA 3DFPA 4B9YA 4PMZA 3H8AA 3WEOA 1KBIA 4OV4A 3TTYA 4HCLA 3MI6A 4TMCA 1LLWA 3CIXA 4GBUA 3OG3A 2FMNA 3DH7A 5DQPA 2PBOA 2FVLA 1PIGA 2PDYA 1VCVA 3KX6A 4D6DA 3A24A 3C2OA 1KGWA 4B5NA 3MI3A 3H22A 1CGXA 4A35A 5EMJA 1BKHA 4HPHA 1QWKA 3UF9A 3XIMA 2TODA 2W27A 4MPQA 2XN2A 1P0KA 3ZT6A 2Y1HA 4CCEA 2AL2A 3GTIA 1QI2A 3KOZA 2PDHA 1W9PA 4JHZA 4IUGA 4MVAA 3STPA 1TPB1 4LS1A 1BWVA 1YBQB 1JGMA 4ENLA 3T42A 1RK5A 2GGJA 1J5SA 1E6XM 5LNSA 4TO8A 3TAKA 2OZ3A 2FPVA 3RAOA 3WLLA 2JGQA 5I6SA 1LG1A 3AZSA 3G1AA 4GC4A 2E4TA 1R30A 2YBVA 1J0KA 4D6JA 5LSMA 2ZICA 4DBSA 4YTTA 4P2VA 2BY2A 2RGMA 5TF0A 2XVLA 4FHAA 3AYTA 3NNTA 4N4PA 2IQDA 3MY9A 4GUJA 4J3WA 3N3MA 1RR2A 2V81A 4FZIA 4S1FA 3UWYA 5I3KA 2ZXQA 1QNSA 4U4MA 2NQJA 1KFLA 3VFCA 1QW8A 4MUZA 1XIDA 3WMBA 3KZSA 4JZ5A 2DW7A 1JCNA 1ISWA 3T2OA 1SW3A 3H54A 1XPYA 3MS8A 1Z6KA 1POJA 2FZNA 1ZFJA 3GDMA 1MXSA 4LYPA 4GQQA 3WUGA 1TR1A 3CT2A 4KFNA 4KRZA 1V03A 2CBVA 3T2QA 2DDXA 3SCTA 2OQHA 3N11A 3SGZA 2JEPA 3AYSA 3KOWA 2FPTA 2HMCA 3G3MA 4ZL1A 1FDZA 1P7TA 3HOJA 3LERA 1M01A 3ABXA 3P8IA 4I6VA 4EE9A 5G1MA 3W27A 4OUEA 1IYXA 4K3ZA 3UGRA 1LUCA 1TRDA 1EC8A 2ALDA 3VKAA 1BVZA 3FSTA 4N02A 1JD7A 1KXTA 2BLEA 3WQFA 3H4WA 4H9TA 4PEEA 4O1AA 2ZXAA 2A7RA 4FLRA 1UZ4A 3P0XA 3UZJA 3DI1A 1E6NA 1WUEA 4IPLA 3UNTA 4X22A 1BGAA 1XUUA 3ZT7A 4GPNA 3O1NA 3WF2A 1TWZA 1RH9A 5C2GA 4M29A 1DQXA 4GA8A 4A05A 2VD9A 1QO2A 4UC5A 1EYWA 4FA3A 4WJEA 1V8EA 3WH5A 5EMLA 3KFTA 5A6JA 3AI0A 4IH3A 3CEUA 4PTDA 3GNXA 4XUYA 3TMQA 3GKFA 4FX6M 3ZZ1A 3QSTA 1QAPA 4MZ8A 5CLTA 1CECA 3MHUA 1IZCA 4X60A 5DT5A 2J13A 2WHLA 1ZJAA 2XSXA 4IPPA 1R3SA 2R1KA 2GK1B 1XPGA 3ATZA 3KBVA 2Q8LA 3L0GA 4LNYA 4XAZA 4G7FA 3CB8A 1S3TC 3N12A 2VUNA 3DHDA 4C90A 4DPPA 4NRRA 1P0BA 3S6TA 2PGEA 4S3CA 2JIEA 3OA3A 1S2UA 2DZTA 4M0XA 3QFEA 1K9TA 2V5CA 4WOZA 5TAOA 4C6MA 2YXXA 2X8RA 3W6MA 3UY7A 4JICA 4GX9A 3M41A 3AC0A 1O95A 1K7XA 5AHNA 1R3RA 1R6WA 4GWEA 1VBRA 1PIFA 1YLVA 2NUXA 3TX9A 3UY8A 3JUGA 3HG3A 1TX0A 1TCDA 3G18A 4R34A 4XKYB 4EKJA 4ZVJA 3P81A 1N8IA 3M0VA 1XIMA 1UIOA 3U6WA 2HE5A 3BK0A 4V2XA 3E0LA 2AOSA 3IJDA 2ZRUA 3BLLA 2VP8A 2ISDA 2PWEA 1Q6GA 1SO5A 2ZRYA 1GVEA 3G3DA 3SFKA 1ADOA 2G96A 3G22A 1CXIA 4H6KA 3PAOA 5LNWA 2W4XA 1C7SA 4FXSA 3DERA 3UGVA 3IUHA 4NJGA 3ONCA 5AHMA 1GKPA 2J8TA 4ILSA 1G7UA 1PZ3A 3S5ZA 3ZO9A 3HN3A 3G1SA 4UNIA 1LZOA 1DWIM 4NAEA 4W7UA 1NU5A 2VFEA 2Z2UA 4MKVA 1NOWA 4FNRA 1ZJIA 1E6QM 1E0XA 1E0UA 4RNFA 2OTDA 3B40A 5IBXC 4DLFA 3WNLA 4WD0A 4E8GA 1L9WA 2C8NA 4XTDA 3C3NA 1CXKA 4IIGA 2VVSA 3CLWA 5CKSA 3SR7A 5HWJA 1O5QA 2XIIA 5HMEA 1CGVA 1Z89A 3WMSA 3TN3A 3VDHA 4NI8A 4Q6JA 4JCLA 1PZ1A 3ABSA 3MO4A 3NQFA 3WLKX 1FWEC 4AC1X 3NXLA 4HHLA 1GG1A 3W6LA 2ADAA 4B5WA 4DJED 3T7VA 1PO9A 1XCWA 2Y89A 1DJWA 4FNTA 2YZ5A 4M3PA 2PCQA 1WZKA 1X6LA 3QXBA 1AW1A 3AMDA 4OUIA 2VMFA 1KGUA 2D23A 1ONXA 3D0CA 4N2YA 1ZCOA 4MDPA 2ABBA 1V0LA 3S9YA 1AD4A 4KWOA 1AG1O 3QLDA 3WQGA 4YU1A 1U22A 4GO9A 3PM6A 2YXOA 3QR3A 3EMQA 3PF3A 3F5LA 3RCMA 3K30A 6TAAA 2GK1A 2WJFA 1MSSA 4DNHA 1H61A 3CK5A 5T8GA 4Q7BA 3CAWA 1JCJA 3TN5A 2Z1SA 3WLQA 1M04A 3GXIA 2GDVA 5HULA 1X1NA 1VBGA 3ITOA 2FB3A 4UB9A 5CH9A 2YBTA 4LUIA 3E5PA 1W1IE 4GGBA 4QSFA 4XG1A 4MOZA 3CYVA 4MWAB 4MNKA 3T40A 4O4WA 3G0UA 4YVXA 2VDGA 2A6LA 2OQLA 5F4WA 2RAGA 1NFPA 3H24A 3OTRA 2J7GA 5A94A 1MW2A 3VM7A 3SGGA 1QNPA 2D73A 1QCWA 2VEGA 3XISA 4DHGA 1CB2A 4RDVA 2FH8A 1CEOA 2R1PA 3LI1A 2J24A 1YPIA 3SN1A 4BQ4A 4IL2A 2ZFAA 4B2DA 4DWSA 4DELA 1FWIC 1PAMA 5JH1A 4GYKA 1CENA 2CPUA 2WVVB 1UMYA 2AL2B 3ITXA 3PUGA 4JHMA 1GVFA 1RV8A 2NX3A 4FO4A 1P7TB 4WY0F 2J88A 1M9HA 4HZ7A 1J12A 2ANUA 2J8FA 1J6PA 3B9NA 1QO5A 4AUBA 4R27A 3NQMA 3BMXA 4R3UA 4AF0A 3VOJA 3SSJA 1E1CB 3CHDA 4UTFA 4HYWA 3JR2A 1GQIA 1REQB 1FWHC 5D9MA 1EJXC 3PZNA 3RLHA 4LAZA 4O19A 1EEPA 4QQUA 4LB3A 5KZDA 3TLLA 5CPNA 2HWGA 4LUJA 2V38A 1KCZA 3NSXA 3REQA 3L4WA 4NUWA 2IPWA 4XZIA 2F7FA 1XCXA 2ATMA 3HO8A 2ZVRA 2PU1A 1C90A 1K1DA 2OT0A 5A8MA 5MF5A 3F7JA 4YLWA 1CGYA 1ZBKA 2PC8A 3H4XA 4ADTA 2C14A 2V2CA 2FZ9A 1LQAA 4IJCA 3ZYZA 5J04A 3L23A 1G4PA 3EOEA 3NQCA 3HIJA 5D37A 1XLKA 2QPXA 4LEQA 4UTMA 4LUYA 2V2HA 3FW6A 3VMPA 4L4PA 2QHAA 1WA3A 4GQGA 4ZEPA 2PTYA 2YSWA 4XQ6A 1H1YA 4DF0A 3SCQA 2E1WA 3DCPA 4WX2A 1TV5A 4WOQA 3NDYA 1A53A 3F4CA 2Y62A 4D1JA 4ZB2A 3TYZA 1PKNA 2WLYA 1NY1A 5IBXA 2EPHA 5C9RA 3R25A 4ZOBA 1EPVA 2F2HA 5AZ1A 5DCEA 1NJJA 2NUWA 3LENA 3R4IA 3BPWA 1W3KA 2BFGA 3PZ9A 3MW7A 4PMOA 4Y96A 4K36A 4AISA 3T9PA 5DXYA 4PB5A 5H2ZA 1CXFA 3MUY1 3K1DA 4IT1A 1AW5A 4GO8A 4OU1A 2CZEA 3M07A 3P84A 1MI3A 4UR7A 3GB6A 1FP8A 3WQWA 2OKOA 4JTCA 2WBGA 4L6DA 4J28A 5GPRA 2HJPA 3NIYA 4IQJA 4CNNA 3VIPA 4P8XA 2OSYA 4R7JA 3ITVA 4NZ4A 4MM1A 3M5YA 1Q6OA 2CBUA 1JG9A 5M17A 3NJ3A 1HF6A 4LUTB 3WQCA 4MFDA 2VGBA 5G2HA 1XGDA 2DGAA 3P80A 3OVQA 4Q8UA 4ICNA 5GNZA 2ZCGA 5HUPA 3WQ8A 4D6FA 2CITA 1K9FA 3TSDA 2ZRVA 1LBMA 3GXFA 5JIPA 3T81A 4GY7A 3VNYA 1X7IA 4UNLA 3C56A 1QNQA 3VOGA 1OT2A 3C5QA 4IXHA 3STCA 4US5A 3B4UA 3AOFA 1MXGA 3W2KA 4WDTA 1PUDA 4MB3A 2EGZA 4N7QA 3H55A 3N6JA 2V3FA 1H60A 4CD5A 3MVIA 4RW5A 3TCSA 3OPSA 5FF0A 3GVQA 2DJXA 3T0BA 1J79A 1PV8A 4HPJA 3PPCA 2Q01A 1WZLA 2PE4A 2QEZA 4L64A 3B05A 3AMKA 3B9OA 2UY4A 3BJSA 4NIRA 2NVAA 4WHBA 3A22A 3KXQA 3S2CA 2I5GA 4W8LA 1YNPA 3BARA 5D8ZA 4YNGA 2W3ZA 3ZLGA 3KBNA 4X2RA 4Q8QA 3L5AA 4C6NA 4FS9A 1YDYA 3CQHA 4FXFA 3B8UA 4JFUA 3APYA 2DFAA 1A5NC 3VE9A 4U33A 3I7RA 4B4HA 1OFEA 4ECLA 3I65A 1BGGA 4Z2HA 1VPYA 1RCOB 3M5ZA 4NILA 2Y7DA 3TEVA 1XUZA 2QV5A 4ZE4A 3CHFA 4FALA 2ZRWA 4TV6A 3CUIA 2OWXA 3B04A 4CD4A 1K7EA 1KFEA 3EWZA 2WBKA 3LBCA 3EKZA 4FXJA 4XO7A 4G7EA 2VC6A 4C7DA 1EQCA 2Q09A 3FAWA 1TO3A 4AW7A 3AIUA 2FZBA 1E3ZA 4XZWA 3GH4A 2PUZA 3HQNA 1UIPA 1RCXB 3GTXA 3BURA 2BWGA 3H12A 2RH9A 5JIWA 4FP1A 3OB8A 4MZ1A 2NQHA 4KCVA 4O15A 4JBRA 5AKQA 1TPEA 4PCNA 3F4DA 2DSUA 5EMMA 2OZ0A 4UMBA 1S46A 1MRAA 2CHOA 1PBGA 3V35A 3GNPA 1ECQA 3B06A 1WDDA 3SIZA 3KS6A 3ES8A 2VELA 3VX0A 4B9ZA 4B90A 1LORA 3W26A 2G4FA 3G2GA 4KCWA 3VXGA 3UR8A 3WLMA 3FGCA 1NOUA 2PTWA 1QK0A 4MB1A 5MKGB 1KFJA 2WNNA 4WGXA 3AWNA 4JN7A 1KXVA 3CEPA 3QF0A 3TDFA 1K4GA 4B2DD 4JTHA 4IUOA 3OEXA 2AKMA 1BWLA 4W4QA 5HMSA 2X2YA 1FWTA 3FDKA 1BVWA 3TNBA 3W85A 3RU8X 1GG0A 3HG2A 1KLYA 4O0ZA 4C6KA 3NGFA 5REQB 1H0GA 5J5RA 1ISVA 1UH3A 5U7SA 1DXIA 2NWSA 3EWWA 4F2UA 1TPH1 4JIPA 1EQPA 4UNKA 2NVCA 3UETA 4O52A 3B0XA 4HKPA 2O4QA 3W1AA 1UR2A 1Z8AA 1V02E 1L2QA 3DFQA 3PJUA 3WJSA 1RVKA 3CQIA 1DWJM 4FX8A 3H7UA 3P82A 2HZGA 1WZAA 5IM51 4JTFA 3KWXA 3SZ8A 2CWXA 3CUZA 3NQEA 3SB0A 1KD0A 2ZUWA 4H6EA 4EXQA 3DU0A 3WENA 2WMKA 3NEVA 3PZIA 1UJPA 4O11A 5DMMA 5M1TA 2BB0A 4H41A 4NNBA 4KBXA 1FWFC 4R5EA 2EKCA 2NQLA 1RA0A 1EZWA 4OKDA 3EX6A 2CZ5A 1I2PA 2J7FA 1KXHA 2CZVA 3UCDA 1W5QA 4F9JA 4IGSA 1DHPA 1NDWA 3GQYA 3CL6A 4Q4OA 1YTDA 1J0HA 1B9BA 1ISYA 4JKKA 1Y5WA 2QGYA 1D8CA 3LM7A 4XKYA 3WIJA 2Y61A 3THQA 4AU0A 1KR1A 4QITA 1YYAA 3GIPA 3FYOA 2JK2A 1MFVA 3UG5A 4JTRA 1UUOA 2DSVA 4UOJA 3W7MA 5D9PA 1WYIA 1ECEA 1EX1A 4QHRA 1OY0A 2FFCA 1ZUAX 3CV2A 3VNIA 3G1DA 4BWLA 3SFWA 7CGTA 3G1RA 3TFCA 2DIJA 4JGDA 2WQDA 4HOXA 2WLZA 1IWBA 2FIQA 2YJQA 5D9OA 3ITGA 1XIHA 3SI9A 3VE7A 3O3RA 3UYCA 3CV7A 1P5BA 4MYAA 3MJYA 2WPGA 4JTEA 4PMYA 1WDQA 2F6KA 4HMCA 4IGHA 1W32A 4US6A 1DJHA 2CLKA 3EX2A 2DUXA 1XYFA 4UOQA 1J8VA 1WKDA 5E70A 3UXIA 4B5TA 4Q7NA 1VLIA 3RGTA 4NF7A 4RE3A 4HD5A 1GOWA 2BY1A 2QVNA 2C15A 1JYNA 4JQAA 3VD7A 2PDLA