4LC8A

Crystal structure of the mutant h128n of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
222
structure length
222
Chain Sequence
DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSNPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of the mutant H128N of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with the inhibitor BMP
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
total genus 84
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4lc8A00
3O6DA 4YXGA 5LNVA 1S5VA 3UNDA 1KM2A 3FKRA 4O13A 1QPQA 3NQ7A 4BFAA 5LGZA 2GQ9A 4GE8A 3JS3A 4H3DA 3S1XA 3ZWTA 1GYNA 2Y7FA 3TE9A 1WQ5A 3TROA 3LCWA 3P5ZA 4DBDA 3H53A 5I3GA 2X1UA 1QNVA 3CEUA 2ZRVA 3S8HA 3MHUA 3KVKA 3IGUA 3T4CA 3FJ6A 1VRDA 3GNDA 1I2OA 4QITA 4FNTA 5AHFA 4CNOA 1OYBA 2R8WA 3P8JA 1SR9A 2TPSA 3QMRA 3LGEA 1FUYA 3GDKA 1G67A 4N4QA 1SUXA 1RZMA 2QCDA 2FLIA 4RKAA 3L65A 4O28A 1K03A 5AC8A 2GPTA 4M6VA 2E6DA 3G0XA 4A3UA 3DKLA 3NR0A 1WA3A 4XTIA 1Q6RA 1B3OA 4K38A 1HFBA 1PE1A 2WNNA 3MUXA 1F73A 1J2WA 3M16A 3PSVA 4LT9A 1U5JA 3R12A 3N2MA 3TU9A 5J5DA 4MOZA 3NGJA 4UTIA 3LCFA 2PURA 5HUOA 5DN1A 3STFA 1SZFA 1W8SA 1Q6LA 4NUWA 2OCZA 2CZ5A 3EX6A 2VEPA 3G18A 3GXTA 4JTHA 4CQ9A 5C6MA 1KM3A 3C52A 4CCEA 2CW6A 3W86A 1HO1A 3C0JA 1F74A 1WV2A 2TYSA 4ORMA 3UYCA 3CPRA 4RLIA 5C5YA 3L5LA 1W3IA 4MZ8A 2QCHA 1OFPA 4K39A 2JKEA 3N3MA 3O1NA 3W7OA 4PA8A 1U83A 5BNKA 3S1VA 3W7KA 3HPXA 4QISA 3BW4A 3DI0A 5H91A 2DZSA 3NQMA 1H5YA 5G2WA 1AL7A 1IF2A 2Y85A 4LS0A 1N8FA 3M5YA 4UFIA 3PG9A 4IMFA 5HINA 1CX9A 3FEMA 3IVSA 4O15A 1MEWA 3M44A 3OVPA 4I9AA 4BK9A 3EWXA 1ZHAA 4O14A 5D2TA 3R89A 4UMBA 4OU1A 2AQWA 3R13A 2G95A 1H7OA 3GDTA 4HIBA 3W7PA 1H62A 3IIZA 2NZLA 1SW7A 5LKYA 5LSMA 1FWSA 1JUKA 1PCWA 1XC4A 4YL2A 1A5AA 2I9EA 4OGZA 4RK8A 5K9DA 1PS9A 1W56A 4NU7A 1VQTA 3B0VC 1W5NA 5HULA 5G5IA 3U2OA 3NA8A 4JXCA 5MHBA 1EIXA 4EOUA 4UR7A 1RD5A 1G4EA 1JRCA 1K7XA 3N9SA 4N9CA 2ISSA 3RFAA 4AEOA 1FXQA 3EWBX 4XZ9A 3HGSA 3DFNA 5HWMA 3W74A 4FX6M 1X8FA 2VFHA 3N73A 4ADTA 3UD6A 4G1KA 5AYZA 2HS6A 4CNPA 4IPIA 3LTPA 1KV8A 4TO8A 4K36A 3L9CA 1S3HA 4IUOA 1I2PA 4HPXA 2C16A 3V1PA 3LERA 2WSYA 5EKYA 1YPIA 4E2DA 4MY8A 3PS7A 5KZDA 4ORIA 3ZWSA 3S1UA 2A5HA 1IGSA 4UTJA 4MKNA 3LHVA 1OJXA 4BWLA 5K4XA 3W2NA 4AH7A 1D9EA 1EB3A 1E51A 1GOXA 3V75A 4A2SA 4JYFA 2WKJA 3EWZA 4AMAA 3SIZA 3WK2A 1HO4A 3NQGA 5EMUA 1TRDA 2ZZ7A 4N6EA 1LM1A 1LRNA 3W70A 3KRSA 3LXBA 4U4MA 2YYTA 4LC8A 4JTUA 4UC5A 3W85A 1M7PA 3NQ6A 2ISWA 1LRQA 2O7SA 5TBOA 1LOSA 2TRSA 2ZA1A 2KZHA 4HNTA 4MJZA 3GX9A 1IXPA 3TC6A 4TU1A 4POCA 4R34A 1L6YA 4O53A 1W1ZA 5GVJA 2YSWA 3E02A 1D3GA 1HL2A 1TPB1 2ZZ1A 1CI1A 3F1QA 1SO6A 2CU0A 4Z08A 2C13A 1UUMA 1FWWA 3BLFA 3MJYA 3K30A 2WJZA 1TPWA 2V9DA 3KRZA 3CTLA 3GZ3A 5LHEA 2YW3A 1QR7A 3DXIA 2YPIA 3OHIA 2I1OA 2ZTJA 4DO4A 4JTFA 3FYOA 4X9SA 4MPQA 3EXSA 1Z41A 4TMCA 1N7KA 1TRIA 3L5MA 3DFSA 3TQVA 4O16A 2F84A 5IM51 4IJBA 1R2SA 1C29A 1GZGA 1WX0A 2CZDA 3ABSA 3W3OA 2JK2A 2PRHA 2VOMA 1YTEA 1RVGA 3UY7A 5HR7A 3A21A 4KFNA 4UTWA 3P5YA 3FIGA 1NF0A 1J5TA 2V5BA 4JX6A 3FFSA 1NFBA 2H8XA 3LHTA 3U6WA 3P67A 3BARA 5BMXA 3MW7A 3DBPA 2NX9A 1AL8A 1SPQA 3W7GA 1VHCA 3LV5A 3LB0A 3LLDA 1KTCA 3E49A 2B7NA 4C1LA 3S0CA 3OG3A 3SJ3A 2E77A 4MY1A 1VLWA 5K9XA 1AW2A 1KLZA 2V0TA 3NQDA 4GUFA 4JNMA 4X2RA 1S5WA 1VYRA 1JCLA 5EA9A 2YFOA 4LS1A 3NQ2A 2CZFA 3EX1A 1EWDA 1LTDA 4IPJA 2QCCA 3F03K 4LVBA 4MZYA 1MZHA 2NX3A 3TDFA 3KHJA 1XUUA 3MHFA 4BR1A 1H61A 1W5MA 4A22A 1WBHA 3W9ZA 4RR4A 3W7QA 3W83A 2E5DA 1T8XA 3QYQA 4R53A 2RDTA 4AWSA 4RV8A 2IQTA 1TCDA 3MI6A 2VFEA 4FXSA 4FX7A 3G0UA 2GJLA 4JTEA 1T0OA 2B7OA 4MVAA 5DXYA 3OEXA 2AGKA 3CWOX 3L2IA 1VC4A 1GYLA 1UB3A 5DY3A 4QIUA 3W7LA 5I3JA 5IBXA 3L0NA 3TH6A 3S5NA 2QF7A 4JIQA 1JULA 5CKSA 3RLVA 4ZZ9A 2VEIA 2FTPA 2QCDB 2ZRWA 1TPFA 3DFQA 5F1UA 3GK0A 2WO5A 1W3TA 3C4UA 4S2BA 1GVRA 2E6FA 1B4KA 3QW3A 2Z1BA 3W2MA 2WQPA 3BG9A 4HSNA 1DL3A 2Z0IA 2G5WA 4OQVA 3PULA 1YTKA 2LLEA 2Y7GA 3THAA 3TMLA 3USBA 5DXXA 3HF3A 3OA3A 7TIMA 5I3HA 1ICQA 3TAKA 1I8JA 1M5WA 1H7PA 3EX2A 4E0CA 3QC3A 1H7WA 3C2VA 1HUVA 2X30A 3VCRA 4LTSA 3NAVA 1EA0A 4QJ1A 1JCXA 3RLUA 1EWEA 1GTHA 2JGQA 3I7SA 5F1VA 3L66A 4O57A 4LVGA 1QOQA 2Y88A 3NL2A 1PL9A 2EAWA 1X1ZA 1JUBA 2WPBA 3QF0A 2C3ZA 5AHLA 1V5XA 1QDSA 1MO0A 1P5BA 2VELA 1JCJA 2YW4A 1KFEA 3C8FA 3IRDA 1YXCA 4ONVA 1OX5A 4AF0B 2C18A 3RK8A 3W7NA 1FCVA 1S5TA 4EF8A 1NEYA 2Y70A 5AYXA 3G1XA 3MBDA 3QSTA 4WXZA 3CB8A 3N2XA 4A2RA 4RZ4A 4BI6A 1ME9A 1XFBA 3VE9A 3S1WA 3W7CA 2B4GA 2O7QA 3ANYA 3BGJA 4NQ1A 1W54A 2FFCA 3PM6A 3R2GA 4OWGA 4IXXA 4L4MA 4PODA 3QM3A 4NXKA 1ZFJA 3BPWA 4HNNA 1DJQA 4WX2A 2P0OA 3TQKA 5FEWA 1UASA 3T7VA 1M6JA 3VE7A 3LCLA 3MI2A 4AVFA 1EEPA 1WBJA 3MMTA 3C56A 4NNAA 1OHLA 4LNYA 1RPXA 1A5CA 1RQEA 4PTNA 4XBKA 3TXVA 4QQ3A 1O4UA 2E09A 3G8RA 1L6WA 5AOUA 2V81A 1AG1O 3NZRA 1VYPX 3MHGA 5AN7A 3GYEA 3P61A 4M7TA 5DLCA 1N55A 2VEMA 3BLIA 1X7FA 3TUUA 3SW6A 3QPZA 1GVFA 1BWKA 3ZR4A 1TREA 3EKZA 4WJEA 1QO5A 4GUGA 4FHAA 3HG2A 1ZJIA 3GDLA 3QPYA 1EUAA 1EX5A 1YXYA 2GOUA 2E6AA 3CLMA 1OK4A 1KBIA 2TSYA 2J9XA 3O63A 3R5EA 4JEQA 2QJHA 1AW5A 4Q4KA 2Q3OA 5D30A 1OF6A 3CC1A 4K7VA 4N9DA 1LZOA 3CWNA 5HUPA 1ZAIA 3LOTA 1H1ZA 3LBCA 2QCEA 1LOLA 3HOJA 3QJAA 1NAL1 5BRBA 4RCXA 1LYXA 3GDRA 3KOFA 4RJEA 1GVOA 3DGRA 3UXAA 1XKYA 2Y61A 3LTSA 4M6QA 1ZAHA 1SQ7A 1W5OA 3EX4A 4UFJA 3TKFA 3GNNA 2R14A 1H51A 4UFHA 3GVGA 1Q6QA 4RZ6A 5CZTA 1QAPA 3UWQA 4PH6A 5KMYA 4Y6GA 3OVRA 2X16A 4EWND 1THFD 1YTDA 1JCNA 4S2CA 2NUWA 4DBEA 2XN2A 1OFBA 2B7QA 1GPWA 5EPDA 1IXQA 3JR2A 2YYUA 4ZL1A 1G6CA 1TJRA 2TMDA 4XTDA 1X6UA 1TPUA 1KTBA 5KINA 4AHOA 3DFPA 2V2HA 1FBAA 2AAMA 4K8EA 2ZA3A 1L6SA 4FXRA 4M5PA 4EVZA 4XKYA 5LHFA 4GBUA 2BSLA 3OVQA 1VR6A 2NV2A 1JUEA 3KXQA 3PVFA 3RNDA 5T26A 3B8DA 2VENA 5K3VA 3HO8A 4E2BA 4FO4A 4N2YA 1K02A 4LVDA 3W7HA 3DAQA 3GKFA 4OV9A 5BMWA 4Q33A 4KWVA 3Q2DA 2RHGA 3KRUA 2Q8ZA 1PIIA 2H6RA 1Q6OA 5DCDA 2DU2A 6TIMA 1TQXA 5G1TA 2OZ0A 3HIJA 1MSSA 4NJJA 1FX6A 1VH7A 2PCQA 2NXIA 5H2ZA 3DFOA 3G22A 3GIYA 4Y96A 3PB0A 3T40A 5ABTA 3W23A 1A53A 3MYOA 2BWGA 3W1TA 3C2OA 4X3ZA 3IIPA 3PUOA 1QCWA 3HGOA 1DQWA 2QCMA 1PVNA 2ATSA 3G1AA 3NL5A 3TAOA 6ALDA 2ABBA 4JX5A 3W2KA 1WOAA 1GQNA 3G0SA 1TO3A 2Y89A 3EKLA 3WJXA 3SECA 3S5OA 3GKAA 3NQVA 2BLEA 1QPNA 2XN0A 1ZCOA 2DZUA 4Y90A 3F4NA 1KM6A 4Z0SA 1XBVA 3NVTA 5HQEA 4BI5A 4WD0A 5AFDA 4JTGA 4WOQA 3FA5A 3HB9A 3HBLA 4ZVJA 4MLRA 3G1VA 1SSGA 3DENA 3M7WA 4Z1DA 3TNOA 4LU0A 4TMBA 4NJIA 1VLIA 1M7OA 1DJNA 3Q58A 3NL6A 5CGQA 3SR7A 1LORA 4IOTA 4NX5A 5FF7A 3YPIA 2CLEA 2NWSA 2V2CA 3E96A 2A6LA 1JJKA 3SFKA 3TK7A 4WY0F 3W75A 3B4UA 1TIMA 3INPA 4GRSA 1FCUA 1FY6A 4AWUA 3LRLA 2D73A 4DF2A 2J88A 3BK0A 5AB3A 2YXGA 5DBUA 2CLOA 4GFSA 4JYDA 3FJLA 2H3BA 1TPC1 3IIOA 2C14A 1K8YA 1TTJA 4I7WA 3T78A 3L5AA 3UWVA 2GQAA 4GNJA 3WJSA 2A0NA 1R2RA 4H4IA 4UTLA 2DZPA 1KV5A 3IV3A 5CSSA 4KWWA 4N9EA 3S6DA 2X2GA 3PY2A 4NXSA 1FDZA 2G97A 3TFCA 4HNVA 1CW2A 4CLMA 4K7YA 3G1YA 5LZLA 4K8HA 3P82A 1F5ZA 1LRTA 3NQ8A 2YR1A 3O6YX 1P1XA 1T99A 1TTQA 1ICSA 1VJIA 4KKXA 2ZTKA 3LXCA 4UIOA 2QCFA 4AHPA 1MEHA 3WFAA 2RFGA 2NX1A 5AHEA 1AW1A 3T44A 1GVSA 3QQ1A 1LDCA 5FF3A 1R2TA 1H7RA 4FNPA 3PBYA 4O1BA 5D05A 3CU2A 5LNUA 1H1YA 1XBXA 5DBTA 3W1MA 3LHUA 2E5BA 4WZHA 1KLYA 4JS3A 2J9ZA 3R8RA 3TJLA 4EIVA 5FEZA 2ZRYA 1EPXA 1D3HA 1YYAA 2FPVA 3PUEA 3W1NA 1YLVA 4Y9AA 4MFDA 4O8RA 4A29A 4O50A 3WK0A 1WXJA 3CIXA 2CLFA 1FXPA 2CLMA 1GG1A 4RXGA 1SO5A 1YADA 3M41A 3NQCA 1W31A 3W1AA 2DZVA 2FB3A 1MEIA 4HKPA 2CLIA 3UPBA 5AHMA 3PWAA 3STGA 3I7QA 5F2GA 4X22A 4DQWA 2Y6ZA 5DY2A 3W7DA 2ZDRA 1OABA 3GR7A 2E1DA 4GUHA 3PR2A 1LOQA 4NVTA 5EBUA 3NQFA 1LBFA 4O10A 5CZJA 1A5BA 2CLKA 3W2JA 1BTMA 1VHNA 1XDLA 4NJHA 2OX1A 2NWRA 5HWJA 2QKFA 2ZRXA 1TQJA 1IIGA 4HN4A 4K6AA 4TIMA 3B05A 3ABRA 1WOBA 3LTYA 3B0UX 5FI8A 3I7RA 2ZZ4A 4RX0A 3GR8A 1F05A 5KZMA 3PF3A 1QMLA 1OF8A 5HJLA 3A22A 4JDBA 3LRMA 3TSMA 3ZS4A 2P10A 1KFKA 3CIWA 4B5NA 4IMGA 1ZY9A 1YDVA 3W1LA 5D09A 3W7MA 3D0CA 4NNBA 4HPJA 4JTIA 3A5FA 5EYWA 5F4XA 5G4WA 2QCNA 3W84A 3HG4A 1C9DA 1RR2A 2QJIA 3RU6A 3DKJA 5CPOA 1PHWA 1ZALA 2J9YA 2Y62A 2A7NA 3TQ0A 3LHWA 1O94A 1OK6A 3RMJA 5FESA 3DZ1A 3PG8A 2E6YA 1LP6A 2FDSA 3M0ZA 4U28A 1Y0EA 5TQLA 1TYGA 1FCBA 1TV8A 1RQBA 3EXTA 4JTLA 3NNTA 1TTIA 3UWYA 5AC6A 3LRKA 1T96A 3N9RA 4JY8A 1IIHA 2ZCGA 4UMCA 3PBWA 4O4VA 4UXDA 1KBJA 3WJWA 2GJNA 1OX4A 4WQ6A 4UNLA 5LNRA 3I65A 4AB4A 3HPZA 3SZ8A 2ZYFA 3GAYA 4MYXA 5F2LA 2C15A 2C0AA 4ZQRA 1DV7A 2NXHA 5AYYA 2Z6IA 3L67A 2VFDA 1GEQA 1SFLA 2A21A 1TPEA 2V2DA 3C3NA 3NPVA 3L0GA 2JKAA 1G7UA 3Q37A 3W1XA 2JGYA 2Y7DA 2DJLA 5E1QA 4XKYB 2HTMA 5A5WA 4IMEA 3W6YA 2OT1A 2ZRUA 3QEZA 3ELFA 3I6RA 3STEA 4RXFA 5HWNA 1KM1A 2YZRA 3W2UA 3LBMA 3PSWA 2QAPA 4L4LA 3TC7A 3KFTA 4IMDA 2QEZA 2ATMA 5BOOA 2FQIA 1OFEA 5G4EA 2DZTA 3M5XA 3SGZA 2ZRZA 2NLIA 4WOZA 3IGSA 1B4EA 1AMKA 2FIQA 1C8VA 5D38A 4ZQMA 1W5QA 3QZEA 2WSQA 4YMZA 3HG5A 3OBKA 3O8AA 3LX9A 1F2JA 1SZNA 1JR1A 4JY9A 2VEKA 1TJPA 2DZWA 3AJXA 4GUJA 1VGAA 3S5YA 1SO3A 3BLEA 5DELA 3PBUA 3O07A 1ZNNA 1EP1A 3IEBA 4JD4A 4MIMA 5AC7A 3QMSA 4WY0A 5CSRA 5KTLA 3S5ZA 1O5KA 2WNQA 1Q3NA 2QJGA 4JN6A 4UFKA 5SWUA 2ZBTA 5DCBA 1YXDA 3LI0A 1VS1A 1WAUA 4O1AA 2VXNA 3W7RA 3FKKA 3MP4A 2CLHA 2GVGA 1ME7A 2X1RA 1BKSA 2GUUA 4DXVA 5K9CA 1I2RA 1DQXA 4IQLA 3NOEA 1DHPA 1YPFA 1SFJA 3W2LA 1G4TA 1OYAA 2WV8A 3ATZA 4JTKA 1VCFA 3KAOA 3NEVA 1W3NA 3W07A 1O95A 2W79A 4IX0A 2V82A 3QSRA 4HNUA 4PFMA 1FQ0A 2V8ZA 2I14A 5D32A 5U4NA 4JTTA 4Z1BA 5J5RA 1QOPA 1GVQA 3JRKA 1XL9A 5I3KA 5D37A 4PEKA 1KFBA 1Z48A 4QAIA 4LUJA 2A85A 4NNCA 4JTJA 3WJZA 3FLUA 4J9JA 3A24A 3G1FA 3G3MA 5E0KA 3T55A 1KFLA 5LNWA 3UXDA 3MI3A 1XCFA 3C2EA 4R7JA 5C55A 3M43A 4LW7A 4ML9A 1R46A 3A9IA 4K37A 3N34A 4OBTA 1OX6A 4LVAA 1ML1A 3F4WA 4N9BA 1LLZA 5G2HA 2NV1A 1PHQA 3MYPA 3P74A 3MP5A 1YDNA 1XBYA 3Q94A 1ICPA 1TPH1 2BTMA 5L6UA 3VKJA 2E68A 1QO2A 4YWIA 2V5LA 2BXVA 2QDGA 4LV9A 5D04C 3U8GA 1L9WA 1PCKA 1H60A 5FEXA 1SO4A 3THQA 5D02A 5FEPA 3LCHA 4O1DA 1VYSX 2WOQA 3VI2A 4FNRA 3LM7A 4NZFA 1K7EA 2R91A 1RV8A 3TX9A 3BV4A 2EKCA 2Y7EA 3SSJA 3KX6A 4ZMGA 4BI7A 3MP3A 5D2VA 1G69A 1TSIA 3LHYA 4UFMA 2ALDA 2GQ8A 4YCOA 1WYIA 2C1HA 4WXYA 3BO9A 4MFEA 4OHQA 4M6PA 4GXMA 1H7XA 3W1QA 1TV7A 3W7IA 3N14A 1P0KA 5G1YA 3FOKA 2J6XA 5D2XA 4DO6A 1XI3A 5CPNA 1BEUA 4Z0JA 5KITA 4CNNA 3NM1A 2A2IA 3G3DA 3C6CA 3GDMA 1TPDA 1HG3A 4OE7A 4AF0A 4CCDA 1OFOA 3QH2A 5K4ZA 3B0PA 3HQ1A 3GLCA 5D03A 4LVFA 1VCGA 3EXRA 1ONRA 1LCOA 1XDMA 4P61A 4CQAA 2ZZ5A 4E38A 4JX4A 4AXKA 5FF0A 2A6NA 1SZEA 3BVJA 5D33A 4JYEA 4IMCA 1V7YA 2A7RA 2F7FA 3P60A 4UNKA 1DBTA 1YDOA 4MYAA 5BW6A 4NT0A 1GT8A 3PB2A 4JGDA 2PRLA 3OIXA 1WDWA 2QCGA 1XM3A 1W0MA 2G96A 4ZQNA 1ME8A 4ADUA 5C2XA 2XN1A 3TSBA 3LV6A 1QFEA 3B03A 4UUIA 4UTTC 4FNUA 2ZZ2A 3P84A 3G1DA 4HHPA 4N02A 1BWLA 1FWTA 1OFQA 2QUTA 3GAKA 2QR6A 3L21A 4LS2A 2ISVA 3NM3A 4CCCA 3HGJA 5C54A 1I2NA 4BWLC 4A21A 3EWUA 3VFLA 1JVNA 4PL1A 4WUIA 1DOSA 2Z2UA 5LNSA 1DORA 1F6KA 3TFXA 1G4SA 2ZZ3A 1NVMA 5F4SA 3A5VA 3ZFHA 3L68A 4UCGA 1UJPA 2CZEA 2OJPA 4DPQA 5F2IA 4M7SA 1DVJA 1FDJA 1KA9F 3O05A 4FNSA 1GJPA 3O16A 4FIQA 3PUDA 3VNDA 3WJYA 1UBSA 1IXNA 3EWYA 4UTTA 3DHDA 1SU5A 1IXOA 2VFFA 5I3IA 3MBFA 1FWRA 4UFLA 1FWNA 4IWWA 3DHFA 1SSDA 3TSDA 2J27A 1JQXA 4QNWA 3BG5A 4HSOA 1JCYA 1EUNA 3HG3A 3NPUA 2X1SA 4PL2A 1UCWA 1OX4B 3QMTA 5FF2A 2FB2A 4JICA 4MJMA 3O6CA 1OFAA 1OFDA 1NSJA 2C19A 2A1YA 4LY8A 4IX2A 3QQ0A 2QAFA 1LBMA 1Z42A 4XWUA 4OT7A 3MWAA 2HMCA 3FS2A 1KM4A 1H7NA 2ZA2A 5CZSA 3KVJA 3NQAA 3KVLA 4S1FA 2WSRA 3W72A 4R33A 4UTHA 4GC4A 4W9TA 4DPPA 3C61A 1H50A 3DU0A 4I7UA 5E93A 4ALDA 1FDYA 3E12A 4NJGA 4LV4A 3M1ZA 4LRSA 3IIVA 3KVMA 4IGHA 1JRBA 3BW2A 5F4WA 4XUGA 3P7YA 1Q45A 4XBSA 1K7FA 2ZQ0A 5CZ0A 3M9YA 3SY5A 4DELA 2YDAA 2QUVA 4JDYA 4TX9A 3RF9A 1LBLA 1P0NA 2W6RA 1F6PA 2CWNA 4D2JA 4UTWC 1VPXA 2H3DA 1SZGA 2FPTA 4O18A 3QW4B 3PC0A 3NZ1A 4UR8A 1GG0A 2YGYA 1W37A 3EWWA 4ADSA 3FYPA 2Y63A 2UV8G 3BG3A 1JCMP 3UQNA 1ADOA 2YX0A 3NDOA 3LXAA 4QM1A 3H54A 2FPYA 2PC4A 2W0UA 4IXHA 4PCFA 1JQVA 3BGGA 3LCGA 4DF1A 3GXPA 3S9YA 3C2FA 4Z1AA 3G8EA 2ABAA 4ICNA 2GVJA 3DFTA 3H55A 3HGRA 3O06A 1OFRA 2HSAA 1QPOA 3NG3A 3B04A 3W22A 4LRTA 2B0MA 2DZXA 1G4PA 1L2UA 4WY0B 5TIMA 3TIMA 5HNRA 1XBZA 5K7JA 2WNZA 3GB6A 3TJXA 1TMHA 1TB3A 3AO0A 4CQ8A 4UTUA 3IGXA 4O52A 3WK1A 3ABOA 1XXXA 2VC6A 5I3FA 1HTIA 4NX0A 3BW3A 3LDVA 4LOCA 3M47A 4RZ5A 3SGUA 4Z1CA 3ATYA 1I2QA 3W7JA 4TR9A 2RDWA 3W76A 3TV8A 3S42A 3W73A 5HMSA 4O17A 3W87A 4AAJA 3IVUA 3W7EA 3LLFA 4M19A 2B7PA 3CQ0A 4PC8A 4OV4A 3UPWA 1I45A 2DJXA 2R94A 1K3UA 3LHZA 3NL3A 3E9AA 2NXGA 3M6YA 1ALDA 3LCXA 4ZQCA 1TTPA 1SW3A 4JR5A 1QPRA 5IBXC 1Z44A 5KZEA 3EB2A 3NYZA 3NQEA 1K8XA 4GUIA 4HT3A 1TPVA 5FF4A 4MZ1A 3P80A 3ABQA 2FJKA 3EEGA 3W1UA 4DEFA 3TCEA 4JTSA 3UWZA 1J4EA 4Q32A 4FF7A 2H8ZA 2C6QA 3TW6A 5HR6A 2BX7A 5DCEA 2CLLA 4ZQPA 3G1HA 4ZQOA 5EY5A 3CM4A 1R30A 3B06A 1I4NA 1KM5A 4QNEA 2A7PA 2OT0A 4O11A 5CG7A 3EX3A 2PE4A 1LROA 2VKZG 5G2IA 2E5CA 1KTNA 5K2ZA 2Q3RA 4QSHA 5CPMA 2H90A 4N6FA 2DP3A 3UZJA 1VZWA 2NUXA 4YCPA 3TW7A 1O5XA 3HPSA 3N19B 4JIPA 4O0KA 1X1OA 4NZJA 4LWWA 5D2YA 1GTEA 4O0ZA 4H6KA 4UMAA 2RKXA 2P1FA 4DF0A 3TMQA 5AHIA 1MXSA 3NXFA 4NJKA 3P8IA 4KFPA 2A4AA 1K8ZA 1XUZA 5L9FA 3E0IA 3MO7A 2X1TA 4FX8A 2QCLA 4O54A 2OMAA 3TA6A 3L0KA 3DI1A 3NPWA 5AHNA 2VFGA 2CFFA 5CPLA 4P2VA 2Q8LA 3G1SA 1KW1A 4DO5A 1LLWA 1QWGA 3HMJG 1DKWA 3GXNA 3W71A 1AK5A 3DH7A 3IIXA 3CHVA 4MUZA 4LUIA 5EL1A 2EPHA 3PAJA 1TV5A 4N4PA 1P4CA 1G7VA 4AHQA 1O60A 3A23A 3CT7A 4MLJA 5F2MA 8TIMA 2HS8A 1SW0A 2RDUA 3W88A 1A50A 4LC6A 2NUYA 2QUUA 1OVDA 4AWTA 2J24A 4GJ1A 1ZAJA 4XQ6A 2GVLA 2DORA 4O1CA 1F76A 5A8GA 1EP3A 4YLWA 4Y8FA 3W1RA 3IVTA 1UUOA 3P81A 3CEPA 1KFCA 1PV8A 3I68A 4UTKA 4FB7A 3TR2A 3TXZA 4KFOA 1F7BA 1RQHA 1NF7A 4UTMA 1ZENA 1B9BA 2YCEA 2QDHA 1KM0A 3M5VA 2ZFAA 1OG0A 1VCVA 2VFIA 1R47A 1W5PA 3O15A 3NPXA 4C1KA 2JBMA 4GWEA 1OYCA 2BZNA 3UZ5A 1B57A 3UWUA 2EF9A 1GWJA 2XFWA 4O19A 1FCQA 4O4WA 3NO5A 4FEZA 3W1PA 5KSWA 5LGXA 2JKPA 3SI9A 3STCA 3M5ZA 1KFJA 2ZZ6A 3LCIA 2EGZA 4EF9A 2V30A 3PBVA 3QRHA 1H63A 4FNQA 2PRMA 5D2WA 3UWWA 1A5SA 4BF9A 2EHHA 3LI1A 2YFNA 3HJZA 5U7SA 4FIRA 4O12A 1EP2A 3P62A 2RH9A 4MY9A 3UY8A 3WK3A 2Z6JA 3G24A 3QFEA 4I7VA 3C2RA
chains in the Genus database with same CATH superfamily
3O6DA 1KM2A 1QPQA 4BFAA 1W1YA 3EA1A 1TWZA 3NSXA 3AAMA 2XGBA 3DCPA 1GYNA 4GJJA 3UJRA 2Y7FA 1WQ5A 3P5ZA 3TCSA 2XSBA 3TWBA 2XIIA 3FN9A 3UA4A 4YTRA 3S8HA 5REQA 4PUJA 1RH9A 4M0XA 4H8NA 5HJXA 1BVZA 2J4GA 3NDZA 4FNTA 4H04A 1E6NA 4CNOA 1OYBA 2R8WA 3P8JA 2ASHA 1SUXA 1LLOA 4YHGA 4EPKA 4RKAA 3WFZA 1BVWA 3SCTA 2DV0A 3DKLA 1W1TA 1O5RA 1B3OA 4K38A 5FIPA 1ZBKA 4QROA 1CGUA 2BP1A 4W7WA 3PSVA 4LT9A 3R12A 3N2MA 3VM7A 3KTCA 4MOZA 5J5DA 3TU9A 3TYZA 5HUOA 1W6TA 3RHGA 3C3UA 1W8SA 3RGTA 1NOWA 3FGCB 1Q6LA 5C2CA 3CZJA 4LUSA 4JTHA 4XAGA 5D9PA 4DM2A 3C0JA 1F74A 4RZBA 1WV2A 3AQUA 3UYCA 2XH7A 3GNPA 1CB2A 1EDQA 1T40A 2OQHA 4RLIA 3QZAA 4F0SA 1S2AA 3LGDA 4CCZA 1J11A 1SFTA 1U83A 3S1VA 3B4YA 3CO8A 5H91A 2DZSA 3NQMA 5CZKA 4IG2A 5G2WA 1XIFA 3HA1A 3VABA 2FMNA 2Y85A 2DH3A 3R8HA 4BF5A 4UFIA 4CD6A 3PG9A 4IMFA 2PWDA 2VP8A 3M44A 3UWEA 2QIIA 1JDFA 3GSMA 1UKOA 5A69A 3VAVA 4AU0A 1ZHAA 2BHZA 3P14A 4B5VA 4O14A 2PP3A 3G2GA 4A35A 1H7OA 1RLDA 4HMCA 3UR2A 3IIZA 5LKYA 4BY3A 1PCWA 4HZMA 4OGZA 4RK8A 4DWSA 4PBEA 3WQVA 3WNOA 1VQTA 1W5NA 5G5IA 3U2OA 3NA8A 4JXCA 2D1ZA 2QGYA 3AROA 2E7FA 2NT1A 4UR7A 4V28A 4EK7A 1G4EA 2IMRA 2OG9A 1T6MA 3EWBX 4XZ9A 3KOXA 2CKSA 3HGSA 4E2VA 5HWMA 3W74A 4JAWA 1X8FA 4ADTA 4DRSA 2GGEA 5AYZA 3WF0A 5IXEA 1H49A 3LTPA 2D24A 3BTNA 1I2PA 3ZVHA 2I5IA 3V1PA 3LERA 4XAFA 1UA3A 1UMYA 3EMZA 3S1UA 4LYKA 2A5HA 1GOOA 1IGSA 1RY8A 1OJXA 4BWLA 3VIPA 2OWXA 4FS9A 4S3EA 1RD6A 3W2NA 1D9EA 2YDSA 1ZP3A 3FDKA 3UXKA 2G3JA 3CAQA 1GOXA 3V75A 4JYFA 2WKJA 3EWZA 1TZ9A 4AMAA 3EOEA 3WK2A 3DHUA 3COTA 5EMUA 1TRDA 3RO8A 1DJZA 1NWSA 2W27A 4OOUA 3LXBA 2D69A 4B5SA 3CAWA 3W85A 3NQ6A 1K70A 3IRSA 1PUDA 2O7SA 1KQZA 4HNTA 4MJZA 3R94A 4POCA 2XZ7A 4R34A 4Y2WA 2HVNA 3PZIA 3LU2A 1TVLA 5C70A 5GVJA 4GVGA 2YSWA 4KGLA 4QJ3B 3SEPA 3URAA 3EPMA 2J47A 2E8ZA 1Z8AA 2Y2WA 4CU7A 1FWWA 3BLFA 3N4FA 4L65A 3PUGA 3T2QA 2V9DA 3GZ3A 2Y8KA 3WN6A 3S2MA 2YW3A 2OLSA 4CVWA 4ERIA 1PO9A 4DO4A 3EXSA 2QS8A 1FTXA 2PC8A 1N7KA 3WNLA 2WWCA 2W4XA 4BQ2A 2BV9A 6REQB 4DWSD 1WX0A 1A5NC 3ABSA 3W3OA 2JK2A 3GG0A 2VOMA 2ISDA 1HJVA 4XD3A 1AJ0A 4RDVA 2Q8XA 4H8HA 2V5BA 1JDDA 4GVFA 4KETA 4GQBA 1POKA 1EXPA 3U6WA 4C6KA 2CEQA 2W92A 2BVDA 5E70A 2NX9A 1SPQA 3LB0A 4R88A 1PEZA 4QP0A 3AIVA 3VKKA 4GZJA 3RR1A 3WH8A 4LUYA 1QTWA 1ZBWA 3O0KA 2V0TA 1GQJA 4X2RA 4QHRA 1S5WA 3CQJA 2CZFA 4OFCA 4IPJA 1C8YA 3ZJ6A 2Z4GA 9CGTA 1BYAA 3PBMA 1XUUA 3MHFA 4BR1A 4A22A 1WBHA 1XR2A 4PMYA 4RR4A 5JMUA 3W7QA 2E5DA 3WL1A 2HZGA 1T8XA 1JL8A 2RDTA 4AWSA 3UG3A 3MVIA 3O3RA 3QLLA 4RDYA 1R9ZA 4S3BA 2Y8UA 2OOFA 1T0OA 4JL2A 2AGKA 1A4MA 7TAAA 3SCSA 3BAYA 3H4XA 1OADA 5REQB 2G37A 1UB3A 3E74A 2YKKA 4XZMX 2VWTA 3ENLA 1TX2A 5CC6A 2ZUUA 3DDMA 3ITTA 1TPFA 1EL3A 4F9DA 2WO5A 2P3ZA 3R11A 2RJGA 4IPLA 3C4UA 1GVRA 2XH4A 2FVMA 3UZZA 3QW3A 2WQPA 1P6BA 1RP9A 1W91A 2JE8A 2WMIA 3THAA 1B30A 5DXXA 3WCZA 4X0VA 4LAOA 4UNIA 4WSJA 3TAKA 1M5WA 1XLLA 3EX2A 3W82A 1KR1A 4LUSB 1K9TA 2GLKA 3QV7A 5E6YA 4GIRA 3RLUA 1XSIA 2JGQA 3BSGA 1HKIA 4LVGA 3NL2A 1PL9A 4ZFMA 3QF0A 4GH1A 1QDSA 3C86A 1OZMA 3C0SA 3TYAA 1U1JA 2VELA 3TOYA 1X38A 4EF8A 1GVIA 4PUMA 4IG2B 2Y70A 3SUTA 2PBOA 1M01A 3QSTA 3N2XA 2PZ0A 3E5PA 4C6MA 1GKQA 4JFWA 4LJ3A 3S1WA 4H00A 2B4GA 2WVUA 3ANYA 4HU0A 4NQ1A 2FFCA 2IQ0A 4PODA 4QXIA 4NXKA 1ZFJA 1AD1A 3T08A 1SJAA 2IW0A 1XQKA 4CD8A 4H2HA 4H9YA 1XYFA 3HTWA 4WEVX 1KXQA 3VE7A 1V6WA 2ZXQA 4MG4A 3MMTA 3UR7A 1OC7A 3GG8A 3P0WA 4XBKA 3TXVA 4AZ5A 4AY1A 3G8RA 2GSJA 5AOUA 4B2DA 4FOUA 2DW7A 2WHKA 3MHGA 2ZICA 4KWSA 1TJ2A 1X7FA 4RW5A 3TUUA 3SW6A 1UWAA 3PZUA 1GVFA 2VR4A 4AZ6A 3T07A 1I75A 1RALA 4B3LA 3UG8A 2WK2A 3AUJA 3VYLA 4H9VA 3HG2A 2DT2A 2YB1A 1EUAA 1EX5A 2FYMA 1ITUA 4ZO8A 4M1RA 1B90A 1AZ2A 1UHVA 3Q67A 3O63A 3UYIA 4JEQA 3ES7A 1FH8A 4DUXA 1IT0A 1AW5A 3H21A 4Q4KA 2X05A 1M41A 2Q3OA 3N6HA 4YN5A 4K7VA 4N9DA 3F7JA 3CWNA 1ZAIA 1XCWA 2VGFA 3UZWA 4L9XA 1KBBA 1KGUA 5CEWA 3AYSA 1XIIA 1JPMA 3LTSA 4P7QA 2OGYA 5BCAA 1JZ7A 4IIGA 3GVGA 1HKMA 2MUCA 1QAPA 1A80A 4DVOA 4BEQA 2DT3A 5XINA 2Y1HA 2VD9A 4Y6GA 3OVRA 4HOWA 1WZLA 2YBTA 3AHZA 4LALA 1G5AA 2J8FA 3PWIA 1GPWA 4AD4A 5EPDA 1I0DA 1MW0A 3BMXA 1IXQA 2GUYA 3QPEA 1X6UA 3K4WA 1PYFA 4J2PA 4AZIA 3JZUA 4DJDC 2W62A 4C6BA 3AZSA 3EOUA 1OCJA 4FXRA 4GBUA 1DJGA 4G8TA 3PAOA 1JUEA 1R9XA 3PVFA 4HA3A 4D6EA 3WDRA 2WLYA 5T26A 3B8DA 2R24A 5K3VA 4E2BA 1CXFA 3SADA 4EXBA 1MWOA 4OV9A 5BMWA 2HV5A 1WZKA 1PDYA 4B2DD 2EO7A 2EG7A 4HZ6A 4XKMA 5A6SA 1IEQA 3XISA 3BAWA 1PIIA 1UPMB 2DU2A 3MMUA 1TQXA 2OZ0A 3WLKX 3VD7A 4IIDA 4D8ZA 1FX6A 2PCQA 5H2ZA 3UJEA 2V3FA 4AZCA 4HHMA 3MYOA 1BSIA 1G0CA 1AQHA 2BWGA 3IIPA 4DM1A 4DNHA 3PZTA 1QCWA 1DQWA 4J40A 1OC6A 3IS4A 4HA0A 3G1AA 1PKLA 1WAWA 5KEZA 6ALDA 1B3WA 1WOAA 1GQNA 5GQBA 3EKLA 1HKKA 4ZE4A 3WJXA 3SECA 1GKRA 4KW2A 1H0IA 1UIOA 4KH2A 4BI5A 4N7QA 4BHYA 4XSMA 4JTGA 3FA5A 3ANVA 1DTUA 3HBLA 1IQ8A 4JNYA 4ZVJA 3K2GA 3G77A 4GQGA 2I17A 4LU0A 1DJNA 3Q58A 3CMFA 3QBUA 3IUIA 3P2VA 5CGQA 2OQYA 4HBKA 4IOTA 1XRVA 1O6IA 4W7VA 2CLEA 3NUKA 1VFTA 1QUMA 3ARXA 3E96A 2A6LA 2BXZA 3TK7A 4WY0F 2XIQA 1FCUA 1FY6A 4DF2A 1P6CA 1NM9A 5DBUA 4FK9A 1EC8A 4JYDA 2H3BA 2VRJA 1BQCA 4HCHA 3UWVA 2A0NA 4H4IA 4P7OA 3GHTA 3CXOA 4CD5A 3QGAC 4JTAA 2G3MA 2WMIB 2VM8A 3S6DA 3GHUA 2HISA 3WL0A 2XVPA 4AEFA 3TFCA 1V0LA 1CW2A 3ONCA 3SDOA 2F8QA 1LG1A 2C7FA 1X96A 1OGBA 3LPGA 1KXHA 5DANA 1P1XA 4J3TA 4AD1A 1ICSA 1QK2A 3SUUA 3SB0A 2WMJA 3RO6A 1C7TA 1QNOA 5HMEA 4AHPA 3OQEA 3V18A 2RFGA 1GVSA 4IL0A 4WKFA 8A3HA 5CAKA 1LDCA 5FF3A 1R2TA 1H7RA 4FNPA 2PWEA 4O1BA 4NAEA 3CU2A 4L7ZA 2GDQA 4H19A 2PDXA 1J0ZA 1XBXA 3W1MA 4AX7A 3LHUA 2J66A 4LYQA 1VBHA 4WZHA 3GTXA 1KLYA 4EIVA 2ZRYA 3PJXA 1SJCA 3PUEA 1TUXA 1E0WA 4MFDA 4O8RA 4DAIA 5LA0A 3U48A 4XK2A 3T8LA 5D9NA 4IP5A 3CIXA 4A6GA 2CLMA 2KAUC 4MB1A 4C7FA 3N2CA 1E0XA 3M41A 1YMYA 5I2UA 1W31A 2FB3A 2GOKA 1MEIA 1S2TA 4J27A 3B40A 1AH4A 1XIJA 1DJHA 2WBGA 2ZUNA 5F2GA 1JDEA 2ZX9A 4GYPC 2Y6ZA 4XAPA 1XYLA 1VFMA 2VR2A 1XIGA 4LY4A 4F8XA 3AHXA 2ZDRA 5I23A 3GR7A 2QF8A 3PR2A 3WLHA 1A5BA 3QOMA 1HJQA 3GVRA 3MSGA 3WUEA 3PBGA 2OX1A 2ZRXA 2J7BA 1TQJA 3WBAA 3WLRA 4IH3A 3UJ2A 3B05A 1BYCA 1WOBA 3LTYA 4HK7A 4E3TA 4FZIA 2NQZA 3CV1A 4NY2A 2WSKA 3F5JA 1F05A 3W6MA 3GH5A 1XGEA 4JDBA 4B5NA 2OYMA 1W32A 1YDVA 1ZY9A 3GUGA 1C92A 1J18A 3B8IA 5G4WA 1FWDC 4UQDA 4AFYA 1MRAA 3RRXA 1GUVA 2WVVB 1PHWA 1ZL1A 1RY0A 3IJLA 2Z7KA 1LP6A 3M0ZA 4AD0A 5TQLA 1TYGA 1R7AA 1TV8A 1UYQA 3BSHA 4P8UA 3CK5A 4PUEA 1UD3A 1TTIA 1GVYA 2ZDSA 5AC6A 3L12A 4UMCA 2ZCGA 4WKHA 4Q8UA 1KD0A 3REQA 1KBJA 3CHEA 3E0VA 4H7CA 4WQ6A 2ZYFA 4MYXA 1XD0A 2ZUVA 2C15A 3S6OA 2P88A 3RU8X 4H9TA 2NXHA 2Z6IA 3AMLA 3IWPA 1GEQA 1UC5A 1CGXA 6TAAA 1DPMA 2ZWYA 3VKAA 2D3LA 2JKAA 3BLOA 1DIEA 3UEQA 3Q37A 2D2HA 4JTRA 1XRSA 1NWRA 3ZOAA 5A5WA 1ZP4A 2OT1A 5BU9A 4FOJA 4MNKA 3WQOA 3AXXA 1BF2A 4BJHA 2PWHA 4IFOA 1E1EA 3CIVA 1DEDA 5CC7A 2UY4A 2YCKX 2WJFA 2ATMA 4RE4A 1E43A 1OFEA 2O92A 2DZTA 3SGZA 2ZRZA 4KRTA 3IGSA 5DT5A 3ITXA 1B4EA 4PR4A 4ZQMA 3QV8A 5C71A 1W5QA 4Q4PA 5EMKA 1F2JA 4AZCB 2XPKA 2VEKA 2DZWA 3EB3A 4ZR8A 3S5YA 2ZX6A 1SO3A 3W26A 2F6XA 3PBUA 3KP0A 5D8ZA 1YHTA 5AVNA 1ONEA 4LCSA 3A13A 1NFGA 1MW2A 4MIMA 4ZTYA 4UOJA 1O1HA 3GC2A 4C60A 3E2RA 3NDYA 4ZOCA 4WY0A 5KTLA 4JN6A 4EKJA 5SWUA 3QKEA 3FA4A 1YXDA 4HA4A 4O1AA 1A0DA 2VXNA 3VOCA 3W7RA 1JPIA 1RVKA 4J2MA 3R8GA 1QPKA 2VX6A 4CD4A 1BKSA 1I2RA 3CQIA 4IQLA 1DHPA 4JTKA 3KUMA 2ZX7A 3W07A 1W3NA 2W79A 1DYSA 3LM3A 1NP0A 4IX0A 3WUGA 4HNCA 2XFYA 4P8XA 1FQ0A 2V8ZA 4CU6A 1O7AA 2X09A 2F6UA 4Z1BA 3WDQA 5D37A 4PEKA 1KFBA 5A6MA 2A85A 5I78A 4JTJA 4S3KA 1CXLA 5BRQA 1JD9A 3G3MA 3G1FA 3T55A 1V3KA 1UWRA 3MI3A 1V93A 4IIHA 4R7JA 4PBFA 5C2GA 1XGZA 3AMCA 2NQJA 1QOXA 4C6JA 1Q8JA 5G2HA 4WSKA 2NV1A 1PHQA 1R8LA 4DXXA 1OCQA 2XM2A 2PWVA 4DUWA 4XD5A 4YWIA 2QDGA 5D04C 4LV9A 4V15A 1H60A 5D02A 1J0YA 1MMFA 1CXEA 2NV9A 4O1DA 1VYSX 5E9XA 3EBVA 4ERAA 4NAEB 4ZFCA 3BV4A 2Y7EA 5BRPA 1TJ1A 1TX0A 2AOSA 1NWUA 4P8VA 4JEJA 1TSIA 4OTKA 3S47A 3TLLA 2FMOA 1XS2A 3DC0A 5LIKX 3LNPA 3BO9A 1K6AA 1TWIA 2PDMA 3OBEA 3GIQA 1XCXA 3L4WA 2Q01A 1QNQA 3FOKA 2CWXA 2OYKA 4H1ZA 4KIEA 4G7EA 1XI3A 1K4GA 1W9UA 5KITA 1GONA 5CLWA 3T0AA 2HRWA 3NM1A 1V79A 4A8RA 1JYNA 1HG3A 1R87A 1Q6DA 1OFOA 3VKCA 3RDKA 3GLCA 3PFRA 4LVFA 3EXRA 1XDMA 4P61A 1J79A 3FV9A 4AXKA 2HNHA 1SZEA 4ZO7A 4JYEA 2GYIA 2X8RA 1A5KC 2D3NA 2F7FA 4AIBA 3W0KA 1YDOA 1VFOA 2VD8A 2X2YA 2QCGA 4FOKA 5LYRA 1SZRA 4Q7IA 1XM3A 1H41A 1W3LA 3A6OA 4ADUA 3LV6A 1QFEA 4PUUA 5CH9A 1B3VA 4FNUA 1T7LA 4HHPA 1NY1A 2OXNA 1XYZA 1EBHA 1KB3A 1V77A 3D47A 4ICCX 4QS6A 1TG7A 4CNSA 4BWLC 2CITA 3VFLA 2VUNA 1JVNA 3LUTA 5IOBA 1WCGA 3TFXA 1UH4A 2ZZ3A 4ZXLA 3A5VA 3UW6A 1HIZA 4UCGA 2CZEA 3H12A 1UR9A 1GJPA 2VQTA 2GJXA 3VNDA 1D3CA 4UTTA 1SU5A 2VFFA 5I3IA 1J2BA 3SCRA 3N4AA 4S23A 2XYLA 4MDOA 3VC5A 4QNWA 4H9XA 1R38A 5FF2A 4RNJA 1Q7ZA 3SGGA 4MJMA 2O55A 4GINA 1OFDA 1K9FA 4JCMA 3B0YA 1HVXA 2D0FA 1Z42A 4XWUA 4QX4A 2WMFA 4OT7A 4PMUA 1EBGA 3FS2A 1KM4A 4AMCA 2ZA2A 3SQLA 3KVJA 3VOJA 3NQAA 4S1FA 4ALDA 5AYIA 3UCDA 4NJGA 4LV4A 1O1ZA 4LRSA 3KVMA 4IGHA 3BW2A 4XUGA 2WCAA 4XBSA 1K7FA 5CZ0A 5DRIA 5HK4A 4B5WA 4DELA 2YDAA 2PDYA 3WDPP 4AZ7A 3TONA 1IV8A 5BYWA 1F6PA 2CWNA 4XIMA 3R25A 4O18A 3FEQA 2XDFA 1POJA 3ZQ9A 3BSMA 3QKZA 1W37A 4WKAA 3EWWA 2UV8G 1JZ5A 1CXHA 1W9VA 5CSUA 1ADOA 2YX0A 3NDOA 3WDHA 3S5SA 4PCFA 2KX9A 4XD6A 2A3EA 3FX4A 1VIZA 3S9YA 3WY1A 3G8EA 3MV11 4ICNA 2GVJA 3DFTA 3HGRA 1UH2A 2HSAA 4CGTA 1Y5VA 3GNRA 4WY0B 1L2UA 1XBZA 4PULA 1UWIA 2BY3A 3WK1A 3V16A 1JF5A 1HTIA 1AA1B 4LOCA 4TR9A 5LIXX 3E2SA 3MS8A 3W73A 5HMSA 3MVTA 3W87A 5DRCA 1EYWA 2O4MA 1EOMA 3LLFA 4M19A 2B7PA 4XZWA 1QJWA 1F3TA 3DERA 1W1IE 2NXGA 3NFUA 4NRSA 2WXDM 3M0IA 4ZQCA 1XLCA 4JR5A 5XIAA 2HK0A 4PSRA 5KZEA 3EB2A 5HPOA 3OOQA 1K8XA 4GUIA 1DE5A 1C90A 5FF4A 5HQLA 4TTGA 4MZ1A 3ABQA 2XUCA 2FJKA 3OPSA 2FGLA 3MY9A 3HPAA 1MQPA 4JTSA 4Q32A 1HGYA 1WDQA 2DSZA 5EY5A 5C9WA 3CM4A 1KM5A 3VGBA 5CG7A 1TVNA 2PE4A 3A4JA 3KTXA 2VKZG 1KTNA 5K2ZA 2Q3RA 1IHIA 4Q7NA 2YIHA 4MB3A 4N6FA 2DP3A 2ZUTA 2R1MA 1VZWA 2NUXA 4H2CA 4IFKA 1WKYA 1TR9A 1X1OA 3TQPA 3E6EA 5D2YA 3POHA 2P1FA 2AQVA 3BANA 3TMQA 2NT0A 4GNKB 3PHAA 3TJIA 5TF0A 4UZSA 2HVOA 4GXWA 1WNOA 2PDJA 5L9FA 2X1TA 4O54A 2OMAA 5AHNA 1CZ1A 2BVYA 4XD4A 2Q8LA 4WJXA 3IV8A 4M3PA 1DKWA 3GXNA 3FAWA 1AK5A 3WBYA 4IMAA 5EL1A 4G7EB 3DHPA 1S5MA 3CT7A 4MLJA 2WC7A 5F2MA 1JFXA 1SW0A 4BQ3A 3NURA 3BJFA 3RM9A 2ACRA 2QUUA 3ITGA 2ZKMX 3ARUA 3WELA 3L7RA 3RJXA 3URBA 4O1CA 3DESA 4W86A 1F76A 5A8GA 1EP3A 4YLWA 3IVTA 1UUOA 2AL1A 2EQDA 1E15A 3HV9A 1KFCA 4MJ4A 1PV8A 3I68A 4UTKA 3TR2A 2QVHA 1NF7A 3BJTA 1GEHA 2P50A 3FNDA 3APYA 2J6VA 3VNZA 5EMMA 1M9HA 3APGA 1BRLA 5CJ5A 1W5PA 4DBWA 3DUGA 1R3YA 1GK8A 2JBMA 4GWEA 4QR6A 1RA0A 5A1AA 2BZNA 4EAYA 2EF9A 3GVWA 1F3WA 4UBPC 1FCQA 4PMZA 3NO5A 4FEZA 3W1PA 3M5ZA 3LCIA 2EGZA 5JXQA 3AYRA 3NXLA 1VENA 3H2MA 2PRMA 3K8KA 4BF9A 5FSEC 2BGSA 2YFNA 3HJZA 2P0IA 4O12A 4D6HA 1NP2A 3UY8A 3WK3A 1CYGA 2GJXB 4I7VA 4NYYA 4C6EA 3C2RA 1GGOA 1JZ6A 5LNVA 4O13A 1ECQA 1ZZMA 1EGZA 1PWMA 5LGZA 2GQ9A 2Z1VA 3JS3A 4H3DA 3S1XA 3ZWTA 2J75A 1DQUA 3LCWA 3DYPA 1XG4A 1E6PA 2PFHA 1QNVA 2YA1A 5BZAA 2ZRVA 4MAZA 1Z7AA 2PB1A 3IGUA 1TA3A 3VNYA 1KBKA 2PP1A 3GNDA 1K4HA 1V3IA 4PFHA 4QITA 2PZNA 2C8NA 3GU9A 3H2FA 4US5A 3N25A 4F3HA 3EDFA 1HN1A 5AYBA 1G67A 4N4QA 4IQEA 1KQYA 3AMGA 5PTDA 3L65A 3EGJA 4O28A 5AC8A 3R10A 1NOFA 2GUBA 4M6VA 3WH6A 4F4RA 3NR0A 4C5ZA 4XTIA 1Q6RA 1HFBA 5HQMA 4GZEA 3MUXA 1F73A 1XIDA 3SCQA 1J2WA 3QVQA 1U5JA 1GQKA 4YVVA 3LCFA 1F61A 2PURA 5DN1A 1SZFA 3AMKA 1MQRA 2OCZA 3S2CA 2VEPA 4CQ9A 1Q4WA 1I0BA 1KM3A 1R3WA 4CCEA 1DJWA 1HO1A 2E67A 4E8CA 3VDGA 2OSWA 4AZGA 3CPRA 3N29A 3L5LA 4MZ8A 4K39A 2QZRA 3P93A 2FKPA 2JKEA 3N3MA 4Z17A 4PA8A 1GCYA 1TZZA 3BW4A 4DN1A 1H5YA 1AL7A 3ARQA 2QPUA 1UZHA 1JCTA 1VBUA 1CX9A 3FEMA 4Q4QA 2OWWA 3ZVIA 4W4QA 4BK9A 3UJFA 3R89A 3POCA 4OU1A 3N17A 3SURA 2XG9A 3AXIA 3GDTA 1VBJA 1MVYA 4HIBA 4P5UA 3SCVA 4NZ1A 2NZLA 2OFJA 2P8BA 3WNKA 4H01A 1FWSA 4ML4A 3KP1A 2RDXA 5BXSA 4S38A 5GJNA 2ZVIA 1V03A 2PTYA 3M4HA 3H7UA 4TOQA 4UR9A 1JEZA 5MHBA 5A6JA 4LNCA 3TP4A 1JRCA 3ARRA 1FXQA 1DWFM 3DFNA 3KW3A 4FX6M 4AX6A 3O0FA 4US5D 4G1KA 3VOFA 3WF1A 1DE6A 1E9ZB 3LZ3A 3WX7A 1UUQA 2HBXA 1KV8A 4ECLA 3RCNA 4U2YA 2IKIA 2ON3A 4ATDA 2C16A 1P1MA 3VZYA 1RSCA 3EPNA 1YPIA 4MY8A 4FR6A 3W29A 4UTJA 3LHVA 5K4XA 2B31A 2XINA 1EB3A 4A3YA 4IFKB 1E51A 3VNLA 3CAVA 4OECA 4AD2A 1WKFA 3SIZA 1V3LA 2ZZ7A 1B0IA 1HJWA 3W70A 3EOSA 3QC0A 4OBSA 1JAEA 4R7OA 1LRQA 5TBOA 1LOSA 1KXTA 4HU3A 1SMDA 1JPHA 3TC6A 2D0HA 1GOIA 3ZT7A 3WLLA 2FVKA 4C91A 3E02A 1P48A 1BGGA 1ZUAX 1TPB1 3ZO9A 1CI1A 1AH0A 1SO6A 2CU0A 1UUMA 3A3HA 3AHVA 4MHBA 1TPWA 5A2BA 2VYOA 3KRZA 3H6OA 2QJNA 5LHEA 3DXIA 3DG6A 1W1A1 4TQTA 1UOKA 1V4YA 3ALGA 1TIWA 2DY3A 2PDIA 1JXJA 3TQVA 1Z3NA 4QS5A 1R2SA 1C29A 3H2EA 2NLYA 4K3ZA 2PRHA 1ZTVA 1RVGA 1BFNA 3UY7A 1FWHC 3KDOA 2YL8A 1XSJA 4KFNA 4UTWA 3P5YA 3CZEA 2XFRA 1BRLB 3FIGA 1AJZA 3NVDA 1XRTA 2PWGA 1ISWA 3R43A 1P43A 1NFBA 1RBAA 5AKQA 4PTMA 2H8XA 2X0YA 3P67A 3BARA 1EYEA 3BGAA 1RK6A 1AL8A 3W7GA 4IIFA 1R9YA 7XIMA 4GY7A 3B9AA 3S0CA 3CHDA 2E77A 1VLWA 5K9XA 1AW2A 5CBJA 3MCMA 4GUFA 3OZOA 3T4WA 1VYRA 4FP1A 3BQ6A 4XZIA 4LS1A 4UWMA 3NQ2A 1IZCA 1Z6KA 3VIFA 2CETA 1LTDA 4MZYA 1S38A 1TWDA 2IPGA 3WQEA 3TDFA 1BGAA 2NW0A 3IJ9A 1Y8BA 1IZJA 1E9IA 2OVLA 1J10A 2EPLX 3W9ZA 3MUZ1 1ZJBA 1DWJM 5FJRA 4V1YA 4NL1A 5FJTA 1KRBC 2IQTA 1NFPA 4H8UA 1EOKA 4U33A 1MZRA 2XVKA 2HXTA 4JTEA 1CGTA 2H9AA 2B7OA 2QULA 4PUKA 1S2UA 3L2IA 3N15A 3S9IA 1ITXA 5DY3A 4EE9A 2P76A 2ZC8A 4AVOA 1TA3B 3MT1A 5IBXA 1CECA 3L0NA 3TH6A 3KBJA 3LA4A 4JN8A 2QF7A 4JIQA 3S2NA 3B9DA 4AG0A 3B9NA 1OQFA 4ZZ9A 1XIBA 1JYXA 2VEIA 3QGVA 1X6LA 3VX1A 1W3TA 4YJ5A 2ACUA 1NARA 3W2MA 3BG9A 3QXBA 1I9CB 3PULA 5D8WA 1V3JA 3ZXWA 6ENLA 1OCBA 2LLEA 4L9ZA 3HF3A 1EKOA 4ACZA 3VD4A 2D2JA 4MKVA 5I3HA 2Z1KA 1PTDA 3LYEA 2WPGA 2NVAA 3MA8A 2CBVA 2DSKA 1EA0A 4QBXA 1GTHA 3I7SA 5F1VA 1CTNA 3AALA 3PTKA 2Y88A 7REQA 1X1ZA 4OUEA 1UR3M 1JUBA 3CYVA 4B15A 3C8FA 1KFEA 4HB7A 1XYBA 4AF0B 4PMRA 1RP8A 1UR2A 4B9YA 3W7NA 3RK8A 1FCVA 2OELA 2UWFA 3VOHA 2FTYA 5AYXA 1UWQA 1MXGA 1XFBA 3TN4A 3VE9A 3GXDA 3GW0A 2O7QA 1PX4A 1TFVA 3RYSA 1S46A 3ZR6A 2FHBA 1VB9A 4IXXA 4OWGA 4L4MA 4V1XA 2X7VA 3ARVA 3GRIA 4WX2A 3N2BA 1UASA 3MI2A 1NJJA 4JIIX 4D6JA 3AUOA 4NNAA 1OHLA 1RQEA 3GHSA 3KCJA 3PN8A 3OYZA 3TZNA 3WLJA 1L6WA 1AG1O 1EEXA 1EZ2A 4NZ3A 1N55A 1F9CA 1AH3A 3BLIA 4AD3A 3KWXA 4KEMA 3B8UA 3S46A 4JCLA 5FJPA 3BAKA 4L5ZA 4KBXA 4WDTA 3T2OA 1BWKA 1TREA 3EKZA 4WJEA 4DYKA 5I3DA 3CB3A 2NQLA 1YXYA 1DWGM 1IE7C 1KBIA 2TSYA 3KS5A 1NQ6A 2CBJA 3MU7A 1DXIA 1SVDA 1UKTA 1LZOA 4R27A 5HUPA 3W38A 3LBCA 4Z2GA 2UY5A 3QJAA 1SYTA 4FF5A 4IL2A 2JF6A 1Q66A 3ITLA 3CYJA 1AD4A 3AYVA 3C0QA 2GSEA 1GVOA 1K77A 4INFA 1VKFA 4I9MA 1IR1A 1W5OA 4DYJA 3EX4A 3KLLA 4UFJA 3AYTA 4GG9A 1BYDA 3WQDA 2XSXA 3UWQA 4P7LA 3BLPX 3M6DA 5KMYA 3L2MA 4URIA 2YB4A 1ODZA 3ECQA 4EWND 1THFD 3TYCA 3TTYA 3UT0A 2B7QA 2Z7GA 4EPDC 1REQA 1LL4A 3JR2A 3SCWA 2YYUA 1G6CA 2QPXA 5HDRA 2TMDA 3RX4A 1SMAA 1KCLA 5KINA 3BJSA 3BCJA 1KCKA 2AAMA 4K8EA 3TN5A 1DJXA 2IPFA 4M5PA 4EVZA 4XKYA 3VDBA 5LHFA 2GGIA 5EMJA 2BSLA 3WSUA 1V6XA 2NV2A 4C6PA 2QUNA 3KXQA 1XWYA 2VENA 2ZADA 2FH8A 3B3DA 3HO8A 4RNHA 3ARSA 1Q7QA 4FLOA 4LVDA 4F0RA 1W9XA 3DC8A 1IWBA 1PXGA 3DAQA 3HM7A 1W2VA 2CNCA 2VO5A 5FJJA 1BQGA 1M53A 2RHGA 3D3AA 2PLKA 2Q8ZA 2FZDA 2H6RA 5T91A 2G50A 1Q6OA 4DJDA 1FH9A 4Q8QA 4KGJA 3V7PA 1QASA 1U2YA 3CV2A 1VH7A 1GPFA 2NXIA 1UWSA 3C8NA 3FSUA 2SFPA 3DFOA 4Y96A 3GIYA 4IPPA 1UG6A 1FFQA 2Z2AA 2PTWA 2BDQA 4JTDA 1V02A 3PUOA 1OSEA 3LMZA 5LIUX 3T1GA 1PVNA 2ATSA 1S39A 4JX5A 3G0SA 2DUZA 2Y89A 1BLIA 2W66A 3U9IA 2BLEA 2F61A 4JN7A 1QPNA 1ZCOA 2DZUA 4Y90A 3F4NA 4UOQA 4Z0SA 3NVTA 5HQEA 3NEHA 4YYCA 4G6CA 1S3TC 1CXIA 4WHBA 1TZ7A 2WVTA 4MLRA 3G1VA 3PWGA 4A8LA 4Z1DA 3GFZA 3GH4A 3TNOA 2BASA 3KTSA 3DBNA 4TMBA 2QNEA 3NL6A 3CL6A 3N04A 1MI3A 1Q4NX 5FF7A 2ZX5A 1UBPC 3KOZA 1NQKA 2NWSA 2V2CA 5C9RA 1JJKA 1TIMA 2PDFA 2OOGA 1O5QA 1GW1A 4LFYA 1TPC1 3L5AA 4A4AA 3WLIA 2WNWA 4UTLA 2DZPA 4IZGA 2G3IA 3AIQA 1PZ1A 2Z2BA 4GY1A 1JG9A 3R0DA 4H6QA 4KWWA 1GNXA 2HE5A 1TR1A 4NXSA 3WQGA 4AW7A 2I9UA 4ACZB 1FDZA 4IPNB 3VUSA 3NZQA 4CLMA 1J6PA 1HGWA 2CBUA 3SQSA 3WQFA 4IIBA 4DLFA 5I02A 3M0MA 3T2PA 1IEXA 4C6FA 1LRTA 1B54A 3H70A 2GWNA 4M80A 4XV0A 4DJDD 1VJIA 4J3UA 4HMNA 3AJ7A 7REQB 4UIOA 4DLMA 1MEHA 3WFAA 5GJPA 3ZT5A 1YE4A 5B7YA 5D05A 3JZEA 2WKGA 3WFLA 3RAOA 4X60A 3GE7A 1E1CA 4JS3A 3I10A 3IJ6A 3R1ZA 2INFA 4A29A 2PODA 4O50A 3WK0A 4UOZA 1WXJA 3CV7A 3SCNA 4F0MA 1KWKA 1GG1A 1DP0A 3N6JA 1SO5A 3K1GA 1YADA 3B0XA 2AMGA 3NQCA 2DZVA 1A0EA 4TX6A 1EQPA 4LAUA 3PWAA 1TV2A 4ES4A 4DQWA 4NHVA 3RR4A 2E1DA 2ZOXA 4NVTA 4O10A 1K9DA 2OO6A 4LX4A 2XGZA 1VHNA 5HWJA 1EJRC 3TTEA 1IIGA 4Q4MA 4HN4A 4TIMA 2J7GA 3KCOA 3RJYA 2A3LA 3GFXA 3B0UX 3TC3A 1NWTA 3GR8A 4KESA 2MNRA 1OF8A 5HJLA 3LRMA 3CIWA 3QV9A 3LN3A 1OM0A 1W1VA 5D09A 2QDDA 3D0CA 4NNBA 4Q6JA 3WMCA 1V51A 3DECA 5EYWA 5F4XA 1YQ2A 2YJQA 4KF1A 2J9YA 3TQ0A 3RPTA 3ALFA 2OX4A 3RMJA 3PG8A 2FDSA 2VT0A 4GYKA 4NP7A 1RQBA 4JTLA 5I00A 3FJNA 3UWYA 1T96A 1RXOB 1CIUA 1US0A 3PBWA 2YL9A 4O4VA 1X8CA 3WJWA 1UJQA 4AIOA 1I6NA 3CHCA 4U5KA 1RK5A 3MANA 5CPQA 1UMLA 3SN4A 2QJMA 4H83A 2A21A 3ABZA 3LLXA 1M7JA 3MUIA 2JGYA 2PDPA 4IGSA 1BD0A 2HTMA 4XKYB 2PF8A 4XZNX 3W6YA 4QCEA 3I6RA 3STEA 3GM8A 4RXFA 5HWNA 2FZ8A 1KM1A 2YZRA 3LBMA 3HN3A 3PSWA 1JF6A 1TE6A 2Z1SA 1LT7A 1NU5A 5CLTA 2QAPA 1CLXA 1GKPA 2PTZA 1ZB5A 1NDZA 2QEZA 4I5RA 3WLTA 5BOOA 5G4EA 4DO7A 4BCEA 2DPEA 1JZ4A 3T09A 1VEPA 2ZE3A 2WC3A 1UWTA 2XFFA 5BXPA 4KRZA 4L1GA 2WSQA 2P53A 2D20A 3HG5A 3OBKA 3O8AA 2E9BA 2IPWA 4PYSA 4N0RA 1JR1A 3HPFA 1TJPA 1OIMA 3AIEA 5B7ZA 4QG8A 2YXXA 5DELA 2ACQA 2A3BA 2OZ3A 3W6LA 3N12A 3F2DA 3WKZA 2VEFA 2HNEA 4JD4A 2XWEA 5G4HC 4D72A 4S3JA 1O5KA 1R86A 3TW9A 3PZ9A 4AY8A 4J35A 3TN6A 2QW5A 1VS1A 1WAUA 4XVEA 3MP4A 2CLHA 2GVGA 3A12A 2WCSA 1V08A 3QFWA 5ECUA 2GUUA 3WF2A 2FZ9A 1HP4A 1DQXA 4GYJA 4R7WA 1G4TA 2G8ZA 2C91A 3QYSA 4J3XA 4MUPA 2V82A 2EPMX 2Q02A 3QSRA 1WZAA 4ZTXA 1GHRA 1XLBA 2DZBA 1B31A 1QOPA 3UERA 1GVQA 3JRKA 3ZSSA 5I3KA 1U1HA 2OWCA 4ZB0A 1H4PA 2PBGA 4GOAA 5FCZA 1VPQA 1Z48A 4JIHA 4DZHA 1NIUA 1J96A 4W87A 4Z2IA 3BMVA 1KFLA 1QWKA 1E3XA 1PPIA 1ZBVA 3C2EA 2ZIDA 4ML9A 4REQA 4LEQA 4IUGA 3OVGA 4OBTA 1ML1A 4N9BA 1LLZA 3QHOA 4M24A 3MP5A 1PKNA 3BC9A 1XBYA 1EJUC 4OZOA 1ICPA 3AWNA 4F2TA 4XZLX 3IGHX 5L6UA 3PPCA 3VKJA 1QHZA 4FLRA 3GVVA 1L9WA 1PCKA 5FEXA 1SO4A 1X1NA 1FHLA 3VGDA 1HKWA 3VDCA 2BOEX 3LCHA 4CEXC 1IR2A 5HMDA 2WOQA 3H2CA 3VI2A 4U5IA 3LM7A 4NZFA 4X0NA 2R91A 2E40A 3K8LA 3SN0A 3SSJA 3KX6A 4ZMGA 4Q6XA 1E1CB 4BI7A 3MP3A 5D2VA 4KMQA 4UFMA 5GNXA 2UZ9A 4WXYA 4AZHA 4OHQA 4K1GA 4GXMA 2VHLA 1TV7A 3CMJA 3K4DA 3BAJA 4GI9A 5A6LA 4PCPA 3GNXA 4PRWA 3CLWA 9XIMA 5FAGA 4CNNA 1SFSA 4XX6A 4AUBA 3GS6A 3GHRA 3NO1A 4C7GA 3S3GA 4FI4A 3PTDA 4LGXA 3HQ1A 4L61A 1NDVA 4MADA 2ZZ5A 1J5SA 4E38A 4JQAA 3BWWA 5H1WA 3BUVA 3F2BA 2VRKA 4XAYA 4IMCA 3PZVA 1YIXA 1EJXC 4K1WA 1FFRA 1F6YA 3S1GA 2QUMA 4MYAA 5BW6A 2NSXA 2VX7A 2P8CA 1WDWA 4GQ0A 2ZE0A 5RUBA 1ME8A 1S2WA 3IK2A 5C2XA 3BH4A 3TSBA 4HPHA 1EGVA 4UUIA 3UF9A 2ZZ2A 3G1DA 3M0YA 4N02A 3GAKA 1BXCA 4LS2A 2ISVA 5E6ZA 3HGJA 3THDA 3L4UA 1I2NA 2PGWA 4A21A 3EWUA 3NZGA 3VCNA 1NVMA 4HVXA 5F4SA 4GO8A 3EA2A 3ZFHA 1DJIA 1UJPA 3AI0A 4Q4RA 2DVXA 5F2IA 3UJSA 2IXVA 3O05A 4NG3A 2R1NA 3O16A 3M0XA 3PUDA 3LEPA 1UBSA 1CPUA 3EWYA 4XZBA 1E56A 1IXOA 3MBFA 2OZTA 1SSDA 2J27A 3EDKA 1WKEA 3II1A 3BG5A 1JCYA 3HG3A 2WMGA 3TNBA 1GZJA 3NJ3A 3KZSA 1UOZA 2WCGA 1YNPA 1YBQA 4JICA 2A3AA 2WM1A 3STPA 3O6CA 2QT3A 3OZMA 1EIBA 4L1WA 4R9XA 1GZ1A 3HFYA 4MDPA 1V02E 1CGVA 1YNYA 1LBMA 3MCNA 5FSDC 1MDRA 3NZPA 3KVLA 3W72A 4UTHA 1XPYA 1A47A 3DU0A 4I7UA 1ZGDA 3LK6A 4MWAB 2FJUB 2DDXA 3T0BA 1JRBA 1BHGA 3UP8A 3C0LA 3WH5A 1P0NA 3ZZ1A 3L4YA 2W6RA 1UKQA 1AQ0A 3OB8A 3SRDA 4UTWC 4M8UA 2H3DA 1FWCC 5A8NA 2PTXA 3NZ1A 4PCTA 4ADSA 3FYPA 2X41A 4DNMA 2PGEA 3BLLA 2QXWA 5I7GA 4DWDA 4QM1A 3H54A 2FPYA 2W0UA 3GD6A 1UR8A 4H7VA 4HOZA 5E0CA 2ZX8A 3MSRA 1T41A 1CDGA 4I8DA 2PMQA 4Z1AA 2ABAA 3UBPC 4GBDA 3N2OA 3MKVA 3O06A 3MZNA 3VIHA 3WLPA 1A5OC 1OFRA 3KS6A 1XLJA 3B04A 4GGHA 2PU0A 2B0MA 1N8IA 1G4PA 5TIMA 3VD3A 5CBBA 2B81A 2DEPA 4IP4A 1LL6A 4GX9A 5C7VA 3IGXA 4MNJA 3G1RA 3ABOA 1RCOB 4HHLA 3W00A 5I3FA 4NX0A 3M47A 3SGUA 1HKJA 4Z1CA 2WJEA 3TV8A 1IEVA 4XG1A 5FJIA 1RAKA 2QJJA 3CQ0A 3UPWA 1QBAA 3NL3A 1OWQA 1J0KA 2XVNA 1ALDA 3LCXA 4L56A 2L5HA 1C7SA 3WQWA 1MDLA 3AU6A 5IBXC 1PIGA 3O2LA 3WQPA 3WDJA 4AEEA 2Y0FA 2ODOA 4R5EA 1ZSXA 4IF2A 4J5NA 1W2PA 2BS9A 3Q4DA 3B97A 3TCEA 3MKKA 1J4EA 3ARPA 4ZOBA 4FF7A 2OO0A 1EHAA 2BX7A 2CLLA 1EJVC 1QW8A 3D6NA 3PFMA 4REQB 4CN1A 1J12A 3EX3A 1Y5WA 4KT2A 1B3XA 1Q8AA 3VFCA 3EPOA 2BFGA 2H90A 4FALA 4YTSA 3UZJA 3AS2A 2I57A 3DFHA 4PCSA 1HF6A 3GBDA 4OUIA 1S5NA 3K5XA 1VFLA 4UMAA 3AIBA 3BL3A 3NXFA 3P8IA 4KFPA 4XISA 1GOMA 4H8VA 2VURA 3R6IA 2OEJA 1TJ0A 3TA6A 3L0KA 4HTBA 4BQ4A 1H2JA 4QGCA 3PANA 4YIWA 1DWHM 1HNYA 1TMQA 3QLDA 3WQ8A 3HMJG 3OLEA 5AY7A 4H41A 3IIXA 3CHVA 2YZ5A 4WVXA 1MW3A 3BDKA 4DJFC 4AHQA 3TYEA 3A23A 5IHRA 1US3A 1EO5A 1UH3A 2HS8A 2RDUA 2WC4A 4JQ2A 4GD0A 3ZT6A 3E0FA 2XISA 3GIPA 2NUYA 3KBNA 3LMYA 3NOYA 3ANUA 4AWTA 1CLKA 1H3GA 4IQJA 2FZNA 3TR9A 1A4LA 2Q09A 4D1JA 1PB0A 1XD1A 2QV5A 3CEPA 3F5KA 4R85A 2PF0A 4OJYA 2ACSA 1RQHA 4RUBA 4EXAA 2YCEA 1M03A 3M5VA 2PDKA 3DYMA 5H6HA 1VCVA 1XRFA 2HBVA 3FAXA 3MUAA 3O15A 3HJEA 3Q45A 4C1KA 6XIMA 3E38A 1V6TA 1RHCA 3N11A 4XO7A 2F38A 4EANA 2TODA 2BGQA 1EHNA 5I07A 5KSWA 5LGXA 3STCA 2J79A 2ZZ6A 4CN4A 2BNJA 1G94A 1H63A 3UWWA 1GHSA 3LI1A 2VNCA 3UXIA 3FYYA 1XX1A 4FIRA 4NYUA 3P62A 5JH2A 2RH9A 4MY9A 3SRKA 3CUJA 1UW9A 4FXFA 3WMBA 2Z6JA 3IK4A 4KEVA 3K13A 4OBRA 5E09A 4YXGA 1S5VA 2EEXA 3KEHA 3RITA 1X6NA 4FSAA 3OZPA 4GE8A 3AIUA 4C6OA 4D6GA 3TE9A 4DBDA 4CKQA 3H53A 3HMCA 4KCVA 1YBQB 2OKOA 2OLHA 2JIEA 2WVVA 4LYPA 1BYBA 1G01A 3MHUA 3W28A 1MYRA 3DG7A 2Z1XA 4E4UA 1VRDA 3AICA 1SGJA 2VR5A 2F2KA 5AHFA 5A8PA 4ILSA 3VO0A 1MFVA 1SR9A 2TPSA 3QMRA 3LGEA 1FUYA 3AXHA 3GDKA 4KCWA 4X9YA 4U2ZA 3BV7A 1LF1A 4RNFA 2QCDA 4GC3A 1BSLA 4LSBA 1XLEA 2J7CA 2E6DA 3G0XA 3T05A 2YXOA 4MPKA 3E1F1 1WA3A 3VGEA 3VK5A 3F5LA 1PE1A 3CTTA 1L8NA 3E2QA 1W8GA 5IFTA 2DZAA 3MSDA 1WDDA 2QMKA 1US2A 4C90A 3STFA 1ONXA 4NZ4A 1HW6A 3EX6A 3GXTA 3ZIZA 1CEOA 3QQWA 3U57A 4ORMA 5CPTA 3ID7A 5LIWX 4CEUC 5C5YA 3PZOA 3F2CA 3CUXA 2QCHA 1OFPA 1WDRA 3I3EA 3W25A 3O6AA 3BOLA 5E5CA 3O1NA 1RBOB 3PTQA 4ZE5A 3FXGA 3WEZA 3W7KA 3HPXA 4QISA 2QV4A 1FWEC 4GI6A 1FWGC 1MUWA 2POZA 1VBGA 2WZIA 3VIGA 2ANUA 3AZRA 1N8FA 2ZUSA 1M3UA 4GYFA 3UR5A 1X97A 4O15A 1MEWA 3OVPA 3VGHA 3MKCA 2IKJA 5D2TA 3VNKA 3E0LA 4IM4A 3R13A 3EDDA 3F4DA 5I77A 4B3KA 3TYBA 3W7PA 1SW7A 4ZO9A 5LSMA 1L8PA 1WPCA 3CAKA 1XC4A 5D9MA 4YYFA 2VX4A 2I9EA 1UA7A 1VBRA 3BZGA 4LBSA 4S3AA 1RD5A 1UZ4A 3CZLA 5EU9A 3THCA 4E2OA 1K7XA 1RJQA 3SCPA 3N9SA 3RFAA 4AEOA 4NRRA 5I03A 1LWJA 2W63A 3ZJKA 1A5MC 1FHVA 4F0HA 1VRXA 2EBNA 4J7RA 1KGXA 1TE1A 4P8WA 2HS6A 4CNPA 8RUCA 4IPIA 2CKRA 3UZYA 1CWYA 4TO8A 3L9CA 2WYSA 4ZXOA 3NCOA 5EKYA 5D4YA 3LENA 1AFSA 4JHZA 4E2DA 2EPKX 5KZDA 3ZWSA 4KWOA 4CVUA 6CGTA 4IP7A 5CGTA 4H6RA 3SM0A 3DGBA 3RN6A 1IZKA 2PLJA 1N82A 4BKNA 4EPEC 3H4WA 4A2SA 3V0SA 4Y9NA 4HPNA 2I7GA 1HO4A 3NQGA 3KDNA 4N6EA 5FL1A 4Q4OA 1LM1A 1LRNA 3KRSA 2XHYA 5JQ9A 4GK8A 4LC8A 3PJUA 4KCTA 4UC5A 3H7VA 1M7PA 1VP5A 2TRSA 2KZHA 3GX9A 1IXPA 1L6YA 4W93A 4TV6A 5BWFA 2DUXA 2V5CA 4A3HA 2EXOA 3RX2A 4IIEA 4HZ7A 2WMHA 4JNZA 4QAWA 3RUBL 2ZZ1A 3F1QA 4W84A 4D8LA 5EFFA 4Z08A 2C13A 1AJ2A 1QRQA 2J25A 1XP3A 1O68A 1RCXB 3CTLA 2PDNA 3EEZA 2I1OA 2ZTJA 4C7DA 4Z2HA 1XLHA 4MPQA 1Z41A 4NASA 4TMCA 1TRIA 5JU6A 4O16A 2IKHA 3M64A 2F84A 5IM51 2NSOA 1RLCL 3WUFA 5JBFA 1R3TA 1IWAA 1PBGA 4ERGA 1CENA 4AIEA 3TA9A 3NIYA 3HU7A 2QQ6A 4YVXA 4XSLA 5ECVA 5FKYA 4HK6A 4JX6A 4F9JA 3WNPA 2Z28A 3LHTA 1JGIA 3CZKA 3MW7A 4Y9PA 4YS1A 5IHSA 3N3TA 4B90A 1VHCA 2GJRA 3OW1A 3E49A 4U3AA 4C1LA 3ZLFA 1ZRQA 4AC1X 3KBWA 3OLGA 3SJ3A 1TV3A 4ZGYA 5EA9A 1YX1A 1PAMA 1EWDA 3F03K 2XIBA 4LVBA 3VMOA 1MZHA 3CJPA 1FWJC 2WZMA 5F7UA 3MSYA 1H61A 1JDCA 4D9PA 4PUDA 5CCZA 1F8MA 3EDJA 3UESA 4R53A 3UG4A 2CIPA 4RV8A 1TCDA 3BAXA 5M5DA 1BF6A 2P5NA 4QJ4B 1W9PA 5HOSA 4FXSA 3VGFA 3C2YA 3G0UA 4IJCA 4MVAA 5DXYA 4DI9A 5LA2A 2VOTA 2VCBA 4QLLA 1VC4A 1TKKA 5I24A 2R1LA 3W7LA 1N8WA 1WE5A 2AQOA 2EJAA 3S5NA 4QE1A 3RLVA 2FTPA 2QCDB 2ZRWA 1E0VA 5BXTA 3OP2A 4S2BA 3WQCA 1KCXA 1UPPA 4MWAC 2Z1BA 3W53A 4HSNA 1ZJHA 1DL3A 3BICA 1YTKA 2Y7GA 2CPUA 3USBA 3OA3A 5LXXA 3VA8A 5H8MA 1H7PA 1JIBA 1OINA 4E0CA 3QC3A 2XIMA 1EJSC 1H7WA 2JEQA 3C2VA 2X30A 3VCRA 2DSWA 3NAVA 1YW1A 1TUFA 4LF2A 1JCXA 1OD8A 1JZ2A 3GTIA 4EWJA 4O57A 3ORWA 4LF1A 3O7UA 2WPBA 2C3ZA 5LIYX 1V5XA 1Q5MA 4BZYA 1P5BA 2YW4A 3LGGA 4WLCA 3IRDA 1OX5A 2C18A 3RCMA 2BY0A 3MCOA 1S5TA 2Z00A 3SJNA 1NEYA 3G1XA 2R1KA 3BOXA 4Y8EA 4AY7A 4A2RA 1VEMA 4RZ4A 3QTPA 4BI6A 3BGJA 1J8VA 3UVAA 3SUSA 1W54A 3PM6A 3R2GA 4F2UA 2VRQA 4G9PA 5IDIA 4IJRA 4JTQA 1ADSA 4GABA 3ZLGA 3T7VA 3PZQA 2XVLA 3TTSA 1EEPA 1WBJA 4L80A 4LNYA 1RPXA 4PTNA 2E1WA 3BLKA 3GWQA 4MF4A 2E09A 1AQFA 3B8SA 1H1NA 2V81A 2OGJA 3S2JA 1E40A 1VYPX 5AN7A 3GYEA 3WF4A 5DLCA 4M7TA 2VEMA 2ONEA 1FWBC 1GJWA 1ECEA 3RG6A 3QPZA 1Q2SA 2XGIA 4DHGA 4D71A 1E4IA 3A4XA 3AISA 3H2OA 3ZR4A 1QO5A 4GUGA 4YNGA 1FH7A 1UD2A 5M1TA 1HQTA 3QPYA 2WAGA 1J01A 3M7SA 1QATA 1OK4A 3MMDA 1FWAC 4US6A 3BCFA 3UG5A 1SJBA 5FJOA 3EMCA 1OF6A 1XIMA 3CC1A 1H1ZA 3IJQA 4PTDA 3HOJA 3WBXA 5BRBA 1LYXA 1TCMA 3KOFA 5C0QA 4TUFA 3DGRA 1BG9A 1XKYA 1DXEA 2Y61A 8XIMA 3EKGA 1W9DM 4D1IA 1BVNP 4E4FA 5CGMA 3GNNA 4C5YA 4RZ6A 1GOQA 5CZTA 4PH6A 2EG6A 1J0JA 4L6DA 1YTDA 3QR3A 2NUWA 3DX5A 1OFBA 3TZFA 3RLGA 1S2CA 1TJRA 4XTDA 1KCZA 4CU8A 1TPUA 1KTBA 2WMKA 2V2HA 2NQHA 2ZA3A 5GNYA 2V3DA 1HJXA 5IRPA 4BF7A 3RNDA 5A8QA 4R3UA 1TWSA 4V33A 4N2YA 1K02A 4L4OA 4B16A 5AVHA 3W7HA 3QOKA 3GKFA 4Q33A 3KRUA 1XISA 4QLKA 5JIPA 4DI8A 2VVSA 3THUA 1JNDA 5DCDA 2J62A 1U22A 3HIJA 1MSSA 5FAJA 1CB7B 1XLFA 2W67A 5IFPA 4M1BA 4V2XA 3G22A 4QCFA 4IT1A 3T40A 5ABTA 2HROA 3KE0A 3W23A 1A53A 1XKJA 3W1TA 3C2OA 4X3ZA 3ZJ7A 1VJSA 3DN5A 2IS7A 4PMVA 2QCMA 2GGGA 3G6LA 3NL5A 3TAOA 1XH1A 3SRFA 4GISA 2JFEX 4RE0A 1EPVA 3GKAA 4W5ZA 3NQVA 1B2YA 2VZUA 2XN0A 2PA6A 2YDQA 2BBFA 3CPGA 4WD0A 2O9PA 1UP0A 3SAZA 2XM1A 3T42A 5I79A 2RGLA 1EZWA 4NJIA 1M7OA 1LQ0A 4FR1A 4RPQA 3ME3A 3UA3A 1Q65A 4NX5A 3YPIA 1KRMA 2F9RA 1BXNA 4EACA 1B1YA 3INPA 4GRSA 3LRLA 1ISXA 2D73A 2J88A 1S1RA 3RLHA 3BK0A 3U4FA 5AB3A 4M6UA 2YXGA 3CUFA 2GWGA 4GFSA 3IJDA 1FHUA 3IIOA 1TTJA 2G3NA 4I7WA 3T78A 4GNJA 1Q6GA 2CCRA 3UNTA 1WDPA 1A3WA 2JEPA 4C6QA 3AS3A 1K1DA 2XTKA 3CZ8A 4KWUA 2X2GA 3PY2A 4TXEA 4QG6A 6PTDA 2G97A 4H9ZA 1H0GA 4HNVA 5EMYA 3VC6A 1M7XA 2R6OA 3G1YA 3GNOA 3VTRA 4K8HA 1XF0A 3P82A 1F5ZA 3UCCA 4MB5A 3M0VA 3UR8A 1T99A 1TTQA 4GIEA 5BWAA 2OSYA 4KKXA 2ZTKA 2XH0A 4F40A 2QCFA 4KRUA 3KZPA 5DMLA 5AHEA 3GH7A 1TWWA 3PBYA 1K6WA 4YTQA 1H1YA 5DBTA 2VX5A 4PMXA 2E5BA 4MJ2A 3TJLA 1JZ8A 4JTCA 3B8WA 1EPXA 1D3HA 1YYAA 2WBKA 1YLVA 4WSHA 2DSUA 1J0HA 3QZ6A 2E9LA 1WKDA 3HQOA 1XSKA 2CLFA 1FXPA 5TD4A 3WG6A 1R85A 5HMFA 4HKPA 2CLIA 4A8NA 1ISZA 3SQMA 5AHMA 5DMMA 3STGA 1VFFA