4LC8A

Crystal structure of the mutant h128n of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
222
structure length
222
Chain Sequence
b'DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSNPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLLNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of the mutant H128N of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with the inhibitor BMP
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
total genus 84
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4lc8A00
2ZZ3A 2A6NA 4IJBA 3QMTA 3USBA 3WK2A 1XBXA 1KTCA 4NXKA 4I7UA 3S1VA 1X7FA 3OA3A 5HUOA 3UZJA 2ZDRA 4ZQMA 4PEKA 1JQVA 4AXKA 1SO3A 1EIXA 4IQLA 1QO5A 1JUKA 3MHFA 5AYZA 4QAIA 4UMBA 3DFQA 4GUHA 1GG1A 2ZZ2A 3INPA 3MHGA 3NPVA 4TIMA 3TQVA 3LERA 3I65A 3W6YA 4A29A 3A22A 2E1DA 3QFEA 5DCEA 3T4CA 4XZ9A 5DY3A 1SFJA 5F2MA 3C2VA 1EB3A 4UTIA 2TMDA 2Y7FA 1TRDA 2QCFA 4JTEA 5EKYA 1OABA 1FWRA 4PFMA 1EP3A 3W2NA 2TYSA 1UUMA 4PA8A 1I2PA 3G8RA 4JDYA 3GDMA 1Q45A 3KAOA 4QJ1A 3GDLA 1JJKA 3NZRA 2JGQA 3SFKA 1IXQA 4MZYA 4MJMA 4HNNA 3TXZA 2CZEA 2C13A 3VNDA 1IIHA 1XXXA 3GDKA 5K2ZA 5J5RA 4FX8A 1BWKA 1YYAA 2E6AA 3ELFA 3PUDA 4WJEA 3R2GA 2X16A 3UZ5A 4E38A 1YLVA 2ZQ0A 5L9FA 1LLWA 5D32A 3UWZA 2VFHA 4Q33A 3UNDA 2VKZG 1XBZA 3W7EA 4JTTA 2I14A 3SY5A 1ZCOA 2ZZ6A 3JS3A 3W9ZA 2GQAA 2C19A 3ATZA 4N2YA 3LLFA 4IOTA 2RH9A 1S3HA 4HIBA 3EXRA 2YFNA 1ZALA 5D03A 4PC8A 3G1YA 3UPWA 3IIZA 1JVNA 3WK1A 3GAYA 1LOQA 3MI2A 1GQNA 1L6YA 3NQ8A 3UWQA 1YXDA 3SGZA 2NX1A 4EF8A 3EWYA 3L2IA 4QITA 4AWTA 5LHFA 2ZA1A 1FXPA 3EB2A 2A7RA 5KITA 1G67A 4CLMA 2G97A 2YW3A 2V2CA 3STCA 1OFRA 3EX4A 3NEVA 5CGQA 3YPIA 3N34A 3DAQA 3W83A 3BGJA 3P62A 3HOJA 4MY8A 3ABOA 1G6CA 2V5LA 3U8GA 3T78A 5DXYA 1H1YA 5D37A 1KM2A 2J9YA 2QKFA 1Q6OA 3NYZA 4MVAA 3UXAA 2ZZ1A 3TW7A 4GUJA 4X9SA 3PBVA 1BTMA 3OG3A 1XDLA 2E6YA 4BI5A 4UIOA 2QAPA 1ZAIA 5BMWA 6TIMA 5LSMA 2HSAA 2P1FA 3CWOX 4RCXA 5DN1A 2JGYA 3EEGA 3UXDA 5DELA 3NNTA 4MZ1A 4DF1A 3HBLA 3PB0A 2C14A 3W23A 3P7YA 4K37A 4ZMGA 4M6VA 5I3IA 1TTJA 2JBMA 4HPJA 4WXZA 1MEWA 2XFWA 3NL6A 1C8VA 3SJ3A 4JS3A 1EA0A 5AC7A 3W1LA 1RQBA 3B05A 3QZEA 4OGZA 3W87A 1KV8A 5EA9A 3KHJA 5KMYA 3NL3A 5D2TA 5KTLA 5CSSA 5KSWA 2FFCA 2O7SA 3M5YA 5IM51 3LHZA 1RZMA 4O50A 1MO0A 5HMSA 3TXVA 1ME9A 3LHYA 4ZQOA 3VE7A 4WUIA 3GNNA 3GYEA 1KFEA 3S5ZA 1C29A 1KA9F 3TSDA 4CCEA 1J2WA 1ICQA 2WO5A 1Y0EA 2DP3A 4UFJA 4AAJA 3GAKA 3G1AA 5C54A 4JX5A 4IWWA 1XM3A 3S5NA 3C3NA 1SQ7A 1WYIA 5K9XA 4QISA 3U6WA 4I7WA 3PG8A 4DPPA 3G0UA 3R5EA 1TPB1 3TFXA 5LGXA 2W6RA 3WK3A 4PCFA 4UC5A 4UTUA 3NQDA 3LRKA 4O18A 4UFIA 1FBAA 2QCLA 4AB4A 4JX6A 1TPC1 5LNUA 4WX2A 1W5PA 3GDRA 1VCVA 1F74A 3NQ6A 3W1AA 1YTDA 4KWVA 3FYOA 2UV8G 3W7GA 4LWWA 1K7XA 4JGDA 5CPNA 4O17A 5I3FA 2QJHA 3O6DA 1VJIA 4JTHA 4I9AA 4DO6A 3HO8A 1WQ5A 4AMAA 3LTSA 1K8YA 3I7RA 3VKJA 1DQXA 3E49A 3NQ2A 5AHMA 3C6CA 4MPQA 1FWNA 1ICSA 4N9DA 1ZJIA 4AHPA 4XQ6A 1A5SA 5FEXA 3W72A 5LNSA 1RR2A 3TH6A 4ADTA 2NWRA 1IXOA 4O28A 4UTJA 1VR6A 2GPTA 3W70A 3W85A 2GJLA 4K7YA 2ABAA 3W2KA 4FHAA 3N73A 3C2OA 3P84A 5ABTA 4NJKA 2R14A 4K6AA 4QSHA 4E2BA 4DPQA 5CG7A 1F6KA 2QEZA 3DFTA 1TPVA 2YXGA 4K8HA 3UWVA 3A23A 4UR7A 3N14A 3LLDA 3P67A 4GUFA 5K3VA 1KBJA 2RHGA 1EX5A 1YTEA 3LCGA 5D05A 1WXJA 5C5YA 1PHQA 1R2RA 4UTHA 4O11A 3B4UA 1HUVA 5AYXA 4Q4KA 3BK0A 1GEQA 4JX4A 3QQ1A 3RNDA 1YTKA 4Y6GA 4DQWA 5T26A 2XN2A 3CT7A 2GOUA 3GKAA 3TAOA 1XCFA 3LCWA 2Z2UA 2A6LA 4U4MA 3LTPA 1P0NA 4LC6A 5HUPA 3BLIA 1ZAHA 3H53A 3HJZA 1TQJA 1W3NA 2EKCA 1FDJA 3W76A 2X2GA 4NNBA 5CZSA 4R7JA 2BTMA 1OX4B 3QSTA 1VZWA 1W5NA 2ISVA 3PULA 4LS1A 2C0AA 4FNRA 1G7VA 5CSRA 2VEPA 3QPYA 3W7DA 4ZQPA 1EUNA 3FJ6A 3A9IA 4JYEA 3LB0A 4NJHA 2ISSA 1TIMA 4K8EA 3O63A 1VCGA 4OE7A 3LHVA 3EXSA 5C55A 2BZNA 4FX7A 1YADA 4DEFA 3O1NA 1TSIA 2DJXA 3W1PA 4IGHA 1LZOA 3F4WA 3A24A 2E5CA 4S1FA 4WOQA 1PL9A 3NQVA 4FX6M 1LDCA 2QCCA 1SZEA 4RR4A 1NF0A 1ZAJA 4LRSA 4ICNA 1LYXA 5U4NA 3UY8A 5MHBA 1H1ZA 1ZNNA 1UCWA 2WSRA 1GVQA 3O6CA 2F84A 4CNNA 4MFDA 4Y9AA 3G0SA 4JTLA 4XUGA 1XBVA 2YDAA 5TIMA 2B7NA 1QDSA 3C2RA 4IPJA 4FNQA 4HNTA 5H2ZA 4IXHA 4MOZA 3O8AA 3G24A 4RV8A 3PBUA 4PL2A 1XFBA 4GE8A 5I3KA 3W86A 1U5JA 3NVTA 5FEZA 4ORIA 4XBKA 2GVGA 1LRNA 3UY7A 3W7RA 4LVAA 1W54A 3L21A 2X1RA 3HG2A 3SIZA 3LHUA 3IVTA 2OJPA 1H7RA 1MEHA 1AW2A 2ZRUA 1F05A 1KV5A 1VPXA 2E68A 3E96A 3HPXA 2HS6A 4K39A 5J5DA 1S5VA 5F4SA 3B03A 2J24A 4Z1BA 3B8DA 1SSGA 4N4PA 1F76A 3W74A 3V1PA 4AHOA 1OX5A 3MHUA 1WX0A 4EVZA 4CNOA 2PRHA 1I45A 2DZUA 2DZSA 3GXNA 3IIXA 2HS8A 2NUYA 1OFEA 4K36A 1O94A 2DZPA 4PODA 1GYLA 4FEZA 2VEIA 3QSRA 3ZR4A 2DJLA 1Q6LA 2ZZ5A 5CZTA 1R46A 1GVFA 4UTTC 2WQPA 5IBXC 1SO6A 1KTNA 3PUOA 1UBSA 1R47A 3Q58A 3NQGA 2OX1A 3R13A 4FO4A 3C52A 4LUIA 1H5YA 1PIIA 3A5VA 3OVQA 4E2DA 5K4ZA 5FF3A 1DBTA 3B0VC 2ZYFA 1Z48A 4RKAA 4AH7A 4OU1A 2A85A 2C3ZA 4LV4A 2YCEA 4AEOA 2VELA 3CLMA 1QPRA 4BWLC 4UNKA 2FTPA 3QMRA 3W1XA 2YR1A 1TV8A 1W1ZA 3EWXA 2V2DA 2ZBTA 3KRUA 4O12A 2QCDA 4FNSA 3NL2A 2QCGA 4IMGA 4CQAA 3FKRA 3LCXA 1DKWA 2D73A 2X1UA 3GXTA 3W7IA 2VC6A 3BLFA 1H51A 2Y89A 4LRTA 3DH7A 5L6UA 3NR0A 1PCWA 3PY2A 4O19A 1HFBA 3CHVA 4S2BA 3M43A 3S42A 1HTIA 1OK6A 3PUEA 3TKFA 4UFLA 3MYOA 4ADSA 1YXCA 2Y7EA 5F1VA 4IX2A 2QJGA 2QUUA 2QCMA 3P5YA 5D09A 3PB2A 3NM3A 3B0UX 2ZFAA 3FKKA 3W2UA 1XUZA 2Z6IA 5AC6A 4FNTA 3W2JA 4LUJA 2ATMA 2VFGA 2YW4A 3G1DA 5E93A 3LRMA 1KW1A 3W2MA 3BGGA 4O0ZA 4E0CA 3W7MA 1LP6A 3OVPA 1TTIA 4IXXA 3M6YA 3LI1A 1LRQA 2JKPA 2Y85A 2BLEA 1S5TA 3LCLA 3N2MA 4AHQA 3T40A 3CWNA 1IF2A 3TIMA 3IVSA 5I3JA 1W5MA 1M5WA 4JYDA 2C18A 2CLKA 5HWNA 1S5WA 3GIYA 4UTLA 2GJNA 4DBEA 1A5BA 2Y7GA 2VOMA 4XKYA 4X2RA 5LNRA 2ZZ7A 2GQ9A 4WZHA 3TC7A 3MP5A 1JCMP 5AFDA 3W1NA 3HGOA 1N7KA 1CW2A 3NOEA 1VHCA 3M16A 3BG5A 3FEMA 5FESA 1MSSA 3S1XA 1W0MA 1OFOA 4JNMA 1FQ0A 3I68A 3M1ZA 3RK8A 3LTYA 3WJXA 3MW7A 4L4LA 2Y88A 1PV8A 4ZL1A 3CQ0A 3NQAA 4UXDA 1JR1A 3HGSA 1AL7A 2B7QA 1WOAA 4NNAA 2BXVA 2WJZA 5HNRA 1OYAA 1Z42A 2I1OA 3O06A 5BW6A 1YDNA 3HPSA 3QH2A 3W7KA 5BMXA 1GJPA 1WA3A 1VYRA 2IQTA 1N8FA 2QDGA 4RZ5A 4IMDA 2PRMA 4JTIA 2V2HA 1KFCA 1EWDA 1DJQA 1B57A 3AJXA 1FCQA 1QNVA 3CM4A 3G1SA 2EPHA 1K8XA 3W1MA 2JK2A 2A7PA 2NUXA 1B4KA 3EX6A 3HB9A 4LTSA 1V7YA 1O5XA 2ZTJA 4N6EA 4GUGA 4CNPA 2A21A 2ALDA 3L5LA 2WNQA 3LGEA 1DJNA 1I2NA 4NJGA 5AHIA 2B4GA 1TJRA 4KFPA 2C1HA 4J9JA 1Q6RA 3W2LA 4O52A 3TUUA 2PRLA 3DU0A 4BR1A 3MI3A 1W5QA 2YYUA 1VLWA 2B7OA 4Z0JA 3PVFA 4IUOA 5F2IA 4UFMA 4NZJA 4H6KA 3IIPA 5E1QA 3S8HA 3SECA 4NJJA 4BK9A 3R12A 2V8ZA 4AF0A 2ZA2A 2E09A 1TB3A 5DLCA 1F5ZA 3FS2A 3T44A 2VENA 4MZ8A 2TRSA 1G4PA 1FWSA 1KFLA 2YZRA 1MZHA 5KZEA 3CU2A 4CQ9A 3PBWA 4N4QA 5G2WA 1PS9A 2R94A 1UJPA 3ZS4A 1WAUA 1L6WA 2KZHA 1TTPA 4XKYB 5FF0A 2V5BA 1OFPA 1W3TA 1SR9A 1XUUA 3GDTA 4TU1A 1H7NA 1LCOA 1ZHAA 4OT7A 3L9CA 3E02A 4O0KA 2QDHA 1QWGA 1SW7A 5BOOA 1H61A 2A1YA 1H50A 2JKEA 2Y62A 1JCNA 4LS2A 2C15A 5D33A 2A5HA 1D9EA 1QAPA 1KM4A 1H7XA 3TV8A 4WOZA 1TJPA 3W7QA 1NFBA 5AYYA 4AWUA 3P80A 3W7HA 5I3HA 4ADUA 3M7WA 4XWUA 3E12A 5EMUA 3O6YX 3NA8A 1BEUA 2G95A 3S5OA 3STGA 3LXBA 3NQFA 1AW5A 1SW3A 3NPWA 3VE9A 4WQ6A 1LBMA 1WV2A 4O8RA 3G0XA 4YMZA 1GVRA 2TSYA 3A21A 3M44A 3RLVA 3DFNA 3EWUA 1IXPA 2OMAA 5G4EA 3P8IA 4A2RA 4MYXA 3LOTA 3GNDA 3P60A 4GNJA 2AAMA 4ALDA 5D2VA 1K3UA 5D30A 3GLCA 3IGUA 3UQNA 3W7OA 5SWUA 5HJLA 1QOPA 3NZ1A 1JCXA 4M6PA 3QC3A 1T96A 3B06A 3O07A 6ALDA 5FF2A 2QAFA 4HKPA 5A8GA 1UB3A 1VH7A 1KFJA 4PTNA 1XBYA 3O05A 4R33A 5HWMA 3BARA 4DBDA 3L66A 2EF9A 4NXSA 5TQLA 3UPBA 1TPDA 4QQ3A 2R91A 3NO5A 4UNLA 1DORA 4JYFA 2FIQA 5G2HA 3ATYA 1UASA 4ML9A 2Y6ZA 4UFKA 5CZJA 4UTKA 1XI3A 1SZFA 1N55A 4HHPA 1NEYA 2O7QA 4AF0B 4UTMA 5K4XA 2NV2A 5K9CA 1QPOA 1P0KA 4NQ1A 3LV5A 2RDUA 7TIMA 1JCYA 1GTHA 2VXNA 2NUWA 1VYSX 2Y63A 1OFDA 3ABQA 2CLHA 5DBTA 4DF2A 2FPTA 3LCIA 5LNWA 3IIOA 1PVNA 1W3IA 1IGSA 4Z08A 2NXIA 3L0KA 3W1TA 5KZMA 2VFDA 2J6XA 4JD4A 2DU2A 3M41A 4N02A 5HR7A 4RZ6A 1L2UA 2FQIA 3PSWA 3M5VA 2CZDA 3CPRA 1F2JA 1O95A 4RX0A 4NX0A 3QF0A 1Q3NA 4O15A 3ZWTA 4HNVA 1TPH1 3SGUA 4GC4A 2X1TA 4S2CA 4YWIA 1G69A 4LOCA 5AOUA 1AG1O 1GVSA 2NXHA 1T8XA 4N9BA 1R30A 5AB3A 1CX9A 5EPDA 2CLOA 2FLIA 2ZRWA 1R2TA 3DGRA 4L4MA 2WNNA 4NVTA 1W5OA 2TPSA 3QJAA 4O54A 3DFOA 1B4EA 4Z1AA 1QOQA 3DXIA 4LT9A 1F73A 2DZTA 3DHDA 3MWAA 1H7PA 4LVBA 5K7JA 1OX6A 5FI8A 1OF8A 3FA5A 2ABBA 2H3BA 5CPOA 3OVRA 3TU9A 4N6FA 3SZ8A 4IPIA 1TPFA 1K8ZA 5CZ0A 3EXTA 4KKXA 4UMCA 1OK4A 4N9EA 3T55A 4BI6A 4BFAA 2ZRZA 5LNVA 3TMLA 2E77A 1JUEA 4O57A 4MLJA 2RDWA 3MP3A 5AHNA 4I7VA 4LVFA 3ABSA 1LORA 1TQXA 2WPBA 4Y90A 1SO4A 3Q2DA 1QPNA 1LM1A 2ZTKA 3KOFA 5F4WA 2QCEA 4M6QA 1OFAA 2QF7A 3W75A 1FCUA 2ZCGA 1O5KA 4D2JA 3WJZA 1OG0A 3G8EA 4OV9A 4LS0A 2Q3RA 3KX6A 3S6DA 1A5AA 1DHPA 5F1UA 3BO9A 3WK0A 3GZ3A 3CEUA 3DENA 3KVKA 4KFOA 3NL5A 2V9DA 1I2OA 3PF3A 3PS7A 3QQ0A 1FY6A 1NSJA 1P1XA 4JTKA 2Z6JA 3NQ7A 1QR7A 4JTJA 4HSOA 5BNKA 1KBIA 1X1ZA 1VLIA 2V30A 1VS1A 3HF3A 2C16A 5LGZA 3L67A 3G1VA 3MO7A 3M47A 4JTFA 4JTSA 4ORMA 1ONRA 2V0TA 1ME7A 1VHNA 2XN0A 3HGRA 1MXSA 1MEIA 1SZGA 1GOXA 1TPUA 2QR6A 2DZWA 3W73A 3ABRA 4O14A 3C8FA 2H90A 4MUZA 5FF4A 2EHHA 2VFEA 5HWJA 3LHWA 2YX0A 3JR2A 3FLUA 3ZWSA 4M19A 4UTWC 2FB2A 3PM6A 1TV5A 5HULA 1AW1A 3W71A 4CCCA 2OZ0A 1H63A 3BG9A 4GFSA 4JTGA 2GVJA 3N9RA 1HO1A 4H3DA 4NNCA 1WBJA 4N9CA 4UTTA 4OV4A 5IBXA 4P2VA 1A53A 1KM3A 2A0NA 4JEQA 1F6PA 2Y61A 1TREA 3TMQA 4POCA 2GUUA 1LRTA 5DCDA 4EOUA 3IEBA 3B04A 2DZXA 3G1XA 1Z41A 3STFA 2OCZA 2FPYA 3CEPA 1LBFA 1G4TA 3OIXA 3LHTA 3MJYA 3CTLA 4TX9A 1PCKA 1BWLA 3STEA 4WY0A 1DQWA 3EX2A 3TW6A 1DOSA 2H6RA 1ME8A 4ZQRA 1D3GA 2WSYA 1GZGA 5U7SA 4BWLA 1LOSA 3C2EA 2WNZA 1RQEA 2H8ZA 1VYPX 3TE9A 5KZDA 1WOBA 3RFAA 1I2RA 4JICA 3KRZA 5HINA 5I3GA 4LU0A 3RF9A 3PG9A 2W79A 3LI0A 3HMJG 4BF9A 1M6JA 5DXXA 2EAWA 4WXYA 3LBCA 3WJYA 3Q37A 3B0PA 1EPXA 1XC4A 3W3OA 3L65A 3M9YA 3TSMA 1KM1A 4Y96A 3FYPA 4AWSA 1LLZA 3K30A 2YGYA 3R89A 3HQ1A 1FDYA 3SW6A 3ZFHA 1NAL1 2AQWA 3LXCA 3G1HA 5F2LA 4NZFA 3BPWA 1SSDA 3S1UA 3EWBX 3QMSA 3OEXA 3H54A 4QNEA 4YXGA 3LM7A 5FEPA 2CLLA 3PAJA 1LOLA 2Y70A 4RK8A 4M7TA 4B5NA 1H62A 1OJXA 3QPZA 1ADOA 5FEWA 3NGJA 1WBHA 1G4EA 2WV8A 3KVLA 1K7FA 5AHEA 3LXAA 3EWWA 2CFFA 4UCGA 5AHLA 1M7PA 1SU5A 1F7BA 1X6UA 4NJIA 4DELA 3H55A 1K7EA 1X8FA 3W7LA 2J9ZA 1RQHA 3F4NA 1J4EA 2FPVA 2NZLA 5G2IA 2P10A 5CPMA 3TAKA 1KM6A 2VEKA 2NX3A 2A2IA 1OYBA 4U28A 4ONVA 3DBPA 3LCHA 5C2XA 3MI6A 1P5BA 3MBDA 1BKSA 3FJLA 4FB7A 3KVMA 4JN6A 4Z0SA 1FWWA 4TR9A 2Z0IA 5LHEA 4MYAA 3CC1A 2QCHA 4LC8A 1D3HA 3EWZA 5D2WA 4OWGA 3HG5A 3MUXA 3EX1A 4HN4A 4YLWA 4C1LA 1YDOA 4WY0B 2CWNA 1TPWA 2QUVA 5EYWA 4JY9A 4LNYA 2NX9A 2QCDB 1A5CA 5AHFA 3T7VA 5G1TA 3TROA 4LW7A 1GG0A 3FOKA 3TQKA 2WSQA 3M5ZA 4ZQCA 4ZQNA 4P61A 3GR8A 2PC4A 4TMCA 2EGZA 4PL1A 4PH6A 2ATSA 3TJXA 1OYCA 2NLIA 3S9YA 5BRBA 3S0CA 5CKSA 3TJLA 3UWYA 3LRLA 2G96A 2OT0A 3E9AA 3BVJA 1SZNA 3P81A 2CLMA 3DZ1A 1QPQA 1O60A 1GYNA 2CZ5A 2HMCA 3BW3A 3L0GA 3IGSA 3R8RA 1K02A 2PCQA 4Q32A 2CLFA 1KLYA 4YCPA 3PR2A 5DY2A 3UYCA 4UR8A 2H3DA 3IGXA 1OFBA 1EUAA 3MMTA 3KXQA 3QEZA 4JTUA 4MFEA 4NU7A 3W7JA 3TQ0A 1H60A 4O4VA 1KM5A 3N3MA 2YSWA 4MKNA 2OT1A 4O16A 2ZRYA 3DI0A 4YCOA 5AN7A 2NXGA 2Z1BA 4TO8A 4X3ZA 2DORA 3W07A 3W1QA 2PE4A 3DFPA 2VFIA 1SFLA 2F7FA 2WKJA 3WFAA 4RXFA 3DI1A 3PBYA 2C6QA 3N9SA 4DO4A 2ZZ4A 4RXGA 1TPEA 2GQ8A 2ISWA 5G4WA 4GRSA 2QUTA 1YDVA 1GVOA 4R53A 3W84A 2YPIA 2FDSA 1B3OA 3IVUA 4M5PA 5E0KA 3MBFA 4O1DA 3G18A 3RMJA 3GK0A 4Z1CA 3OBKA 2A4AA 3A5FA 2E6DA 4O1BA 3L5MA 3BW2A 3TR2A 1RVGA 3NAVA 3NQMA 4UMAA 1WDWA 4NT0A 1H7OA 3W1RA 2WOQA 3S5YA 5EY5A 3LV6A 5DBUA 4A2SA 4W9TA 4XTDA 3W7PA 3THAA 3NPUA 4LV9A 3TA6A 1OX4A 4JIQA 4K38A 3C4UA 4LVDA 1TV7A 5GVJA 1KFBA 1B9BA 2FB3A 3M5XA 2CU0A 3W7NA 1FDZA 3N19B 1EWEA 2Y7DA 4O1AA 3NXFA 5LZLA 8TIMA 3IV3A 3GB6A 5D2XA 4Y8FA 4QIUA 1K03A 3BV4A 3QW3A 3TC6A 4R34A 1TCDA 1QFEA 1I4NA 3VFLA 1YPIA 3TDFA 3NG3A 1FX6A 3W7CA 1I2QA 3I7SA 4NX5A 3P82A 3BG3A 3NQCA 1KFKA 4QNWA 3EKZA 4HSNA 1XKYA 3C61A 1DV7A 4AVFA 3DKLA 1KM0A 3F03K 2B0MA 1H7WA 3TFCA 3M0ZA 3FIGA 1GWJA 3G3DA 1AK5A 1JCLA 1SO5A 1ZY9A 1OVDA 1O4UA 1XL9A 4RJEA 4O13A 3KRSA 1YXYA 2CW6A 5TBOA 3IRDA 1EP1A 4WY0F 4HPXA 5H91A 1JQXA 3S1WA 1OFQA 4O10A 4DF0A 1KLZA 5D2YA 1VGAA 2XN1A 1R2SA 1C9DA 4DXVA 2BSLA 3L68A 1E51A 4IX0A 2JKAA 2CLEA 4M7SA 4XTIA 3TNOA 3HPZA 4IMCA 4YL2A 1G4SA 1FXQA 3QW4B 1QO2A 1Q6QA 4C1KA 1EP2A 3N2XA 3WJWA 2I9EA 3P74A 1NF7A 2E5DA 3GXPA 4CCDA 4FNUA 1W8SA 1ZENA 4FXRA 1M7OA 3BLEA 4FF7A 1X1OA 4KWWA 4EF9A 1LBLA 4HT3A 4GUIA 4MIMA 1W37A 3Q94A 3ANYA 3C56A 3P61A 2G5WA 3HGJA 4O4WA 1SUXA 5HQEA 1EEPA 2ZRXA 3WJSA 2RFGA 2ZA3A 1JULA 4JXCA 1L6SA 3UWWA 5HR6A 4NUWA 1OHLA 2VFFA 3LCFA 2H8XA 1DL3A 2ZRVA 1JRCA 1RD5A 1VC4A 1TO3A 1JCJA 3HIJA 3RU6A 1JUBA 2W0UA 4JY8A 2V81A 2CZFA 1ML1A 3FFSA 4K7VA 1FCBA 1HG3A 1PHWA 2DZVA 2AGKA 1G7UA 2E5BA 3AO0A 3TX9A 1ICPA 1THFD 4EIVA 3EX3A 4IMFA 3NDOA 4FIQA 5D02A 2J9XA 4H4IA 1KTBA 1Z44A 3W22A 1UUOA 4OBTA 5EL1A 4GBUA 4HNUA 5KINA 1PE1A 4OHQA 3KVJA 3L5AA 4MJZA 2BWGA 1ZFJA 2RKXA 5A5WA 4FIRA 3GX9A 1W31A 4MY1A 4LY8A 4FNPA 5F4XA 1QCWA 3O15A 3VCRA 4JIPA 5G1YA 3I6RA 4Z1DA 1HL2A 4IMEA 3P5ZA 4UFHA 3MP4A 1SPQA 2PURA 3SR7A 4A22A 3EKLA 1J5TA 3NPXA 4XBSA 1XDMA 2GVLA 1NVMA 1FUYA 4JDBA 1TMHA 4A3UA 3G3MA 5FF7A 4GXMA 3F1QA 4EWND 3O16A 4KFNA 5CPLA 1LTDA 4OQVA 1L9WA 1FCVA 1VQTA 2J27A 3MYPA 3GR7A 3RLUA 3L0NA 1I8JA 1YPFA 2FJKA 3GKFA 4RZ4A 3TSBA 4O53A 4MLRA 1P4CA 3KFTA 3W1UA 3PSVA 4JR5A 4CQ8A 4GWEA 3G1FA 2NWSA 1AL8A 3LDVA 5DCBA 1RPXA 1V5XA 2Q3OA 1ALDA 2RDTA 3NM1A 3JRKA 1SW0A 3HG4A 3IIVA 5AC8A 2QJIA 3P8JA 3SI9A 3OHIA 1T99A 2E6FA 3QYQA 3PWAA 2YYTA 5D04C 1LROA 3U2OA 2X1SA 3V75A 1T0OA 2A7NA 5D38A 2BX7A 4DO5A 1IIGA 4GJ1A 4QM1A 3DHFA 2B7PA 5G5IA 1VCFA 3W88A 5F2GA 3I7QA 4UTWA 3DFSA 3LX9A 4LVGA 5LKYA 1JRBA 3NQEA 2QCNA 3C2FA 4MY9A 1QMLA 3E0IA 4WD0A 1HO4A 2P0OA 4A21A 4G1KA 3CIXA 3QM3A 3DKJA 1AMKA 3UD6A 3D0CA 3UWUA 4UUIA 1RV8A 3TK7A 2J88A 1DVJA 4FXSA 4ZVJA 3TCEA 4TMBA 1GPWA 3CB8A 3BW4A 4O1CA 1CI1A 3THQA 3PC0A 2X30A 2Q8LA 2NV1A 5EBUA 2HTMA 1A50A 2YFOA 3LBMA 3SSJA 4RLIA 2V82A 3VI2A 3HG3A 3GVGA 1FWTA 4X22A 1U83A 3C0JA 1TTQA 1TRIA 1VRDA 2VEMA 1OF6A 2R8WA 1IXNA 3G22A 5C6MA 3CIWA 1TYGA 5K9DA 3QRHA 1GTEA 1GT8A 1W56A 2LLEA 4ZZ9A 4BI7A 2CLIA 2Q8ZA
chains in the Genus database with same CATH superfamily
3KTCA 4WKAA 2WHJA 1RJRA 1XBXA 3NO3A 4LYQA 2XFYA 3S1VA 4UQCA 1N82A 3UZJA 1JQVA 2XG9A 1QO5A 1JUKA 5AYZA 4JTQA 4S3JA 3TP4A 3INPA 3TQVA 3GD6A 2W92A 4EXBA 3EZ4A 5DCEA 2R9RA 4XZ9A 3CT2A 5DY3A 4LXFA 2ZE3A 1G5AA 4DUVA 2DT1A 1OABA 1FWRA 4PFMA 2G37A 4PA8A 4I6KA 1J10A 5IHRA 3NZRA 4LBSA 3SFKA 5REQA 2VCBA 3WMLA 3EMQA 4HNNA 3THCA 4ZB5A 1IIHA 1RXOB 3WLRA 5K2ZA 2J6VA 2Q8XA 4JHMA 1XLIA 2E6AA 3ELFA 3F7JA 4H8VA 3R2GA 1A3XA 1DIDA 2X16A 4H19A 1EXPA 2V3EA 4QE4A 3UWZA 2VFHA 2JIWA 2VKZG 2VZUA 4TX6A 3H8AA 3UESA 3RUBL 4GNKB 2FMNA 1XKJA 1FWCC 4EXAA 4B2DA 3JS3A 3TOYA 2GQAA 2C19A 1V3IA 4KEZA 5EMMA 4FLRA 4IOTA 5EFFA 4HIBA 4D1JA 1DJHA 1KFWA 3WK1A 3MI2A 1GQNA 3UWQA 4IZGA 2EO7A 4EF8A 3EWYA 3L2IA 3EB2A 3PN8A 5KITA 1CGUA 2PZ0A 4HMCA 1R3TA 3EX4A 3GU9A 3NEVA 3KE0A 4H9TA 1BF2A 3YPIA 3DAQA 4EXQA 2Z2BA 3BMXA 3EWDA 3BGJA 3P62A 1BRLB 2J7FA 4RV3A 3PBMA 1G6CA 5DXYA 4YTTA 1WP6A 4GXWA 1XYZA 5D37A 4P7QA 3T0BA 2QKFA 3AMKA 2ZZ1A 3SURA 4GUJA 4GI4A 4X9SA 1QI2A 1XH2A 4LYRA 5DX7A 1XDLA 3TWBA 5IRPA 2D2OA 1FWFC 4LSBA 1ZAIA 5JUVA 2HSAA 2XU2A 4WEVX 1Q2SA 2JGYA 2Z1XA 1Q6EA 4A8NA 4RDVA 5DELA 2GDUA 4Z2JA 4JQ2A 4ZMGA 4M6VA 5CAHA 2ACRA 4WIWA 4WXZA 3NL6A 4JS3A 1EJXC 2F2KA 3W1LA 1S38A 4TQTA 2GUBA 2WJFA 3W87A 1UKSA 2PBGA 1QI4A 3H22A 3WQGA 3NL3A 2IXUA 5CSSA 1IQ8A 5KSWA 2FFCA 3M5YA 3LHZA 2PCEA 1LWJA 1DWJM 1V6YA 4XZLX 1JGMA 4ZQOA 4NYUA 4WUIA 3S5ZA 1C29A 2NW0A 4CCEA 1J2WA 1XYLA 2WO5A 5BU6A 1Y0EA 3V5CA 3NVDA 4DAFA 2P53A 4W5ZA 2DGAA 4JX5A 3C8NA 3S5NA 3C3NA 2PDYA 4QISA 3MUIA 3IV8A 3U6WA 4B5TA 4I7WA 3JU2A 3A4WA 3R5EA 1TPB1 5HNUA 4UC5A 1FBAA 4AB4A 1MW3A 1TPC1 1EC8A 3COTA 4DJFC 1W5PA 4YNGA 1F74A 3WLPA 3GXIA 3W7GA 4DJFA 4MWAA 1M3UA 2BY3A 1GOIA 3UGVA 3O6DA 1VJIA 3TTQA 3HO8A 3VMPA 2HK0A 1P43A 3R10A 8CGTA 1R86A 2PD9A 1GJUA 3PZTA 2J66A 4HD5A 1XGZA 4HMDA 3C6CA 4JKKA 4MPQA 3MUY1 4G5DA 4N9DA 1ZJIA 4MM1A 1A5SA 2JFEX 1E40A 4O28A 2GPTA 1TR1A 1UROA 2GJLA 4K7YA 3OYXA 4FHAA 3N73A 3P84A 4LCQA 3CZLA 2WCAA 4LFYA 3GWQA 1HKVA 2R14A 4LF2A 1SJBA 3BE7A 1AZ1A 1W9BM 1F6KA 5I03A 1AZ2A 2WPGA 2RHGA 5FJRA 3LCGA 2VDIA 5D05A 1O66A 3PZUA 4YTRA 5AYXA 3SCOA 1MQRA 1GEQA 4IMAA 3NZQA 4DQWA 2C7FA 5A8MA 3FN9A 1XCFA 4MNLA 5A2AA 1P0NA 2XHYA 3HJZA 4AZCA 1REQB 3N2CA 3W76A 2DSKA 4F40A 4PMOA 1OX4B 5TF0A 2YB4A 3QSTA 5ECVA 3PULA 4W4QA 3RM9A 4ZQPA 7ENLA 1EUNA 2VRQA 2I7GA 2UBPC 1UOZA 3DDMA 4JYEA 3SM0A 4K8EA 5CG0A 2J79A 4DEFA 2A79A 3T2QA 4RDYA 4EP8C 2VOTA 3KTXA 1A3HA 3FVMA 4S1FA 1PL9A 3BSHA 3MKVA 4FLOA 4FX6M 4LUTA 3TR9A 5A8PA 2I5QA 5A6AA 1F8MA 4ZOAA 4RR4A 1E71M 4GQGA 3MC5A 5U4NA 3UY8A 3UR2A 1ZJAA 2WSRA 1GVQA 3LYEA 3O6CA 4CNNA 2OYKA 1C8YA 2PC8A 3O0FA 3MPGA 1F3XA 1QDSA 3PAOA 4C7DA 2O92A 1ODUA 1KXQA 1OINA 1NWTA 3UVAA 1IEVA 5FEZA 1LRNA 4J3XA 4LVAA 5IOBA 2VTFA 3HG2A 3LHUA 3NOYA 2OJPA 4RW3A 1H7RA 9RUBA 1MEHA 1F05A 3GFZA 1EEXA 1KV5A 2VC7A 3E96A 4ATDA 2J24A 1V8EA 1QRQA 4KW2A 3B8DA 4P8XA 4H9YA 1OC5A 3ABXA 4AZHA 2VUYA 1UR8A 3WUBA 3QY7A 3MKCA 3MV11 3W74A 4EVZA 4JQ3A 2W9MA 3AXIA 2NUYA 2TAAA 2PODA 4L61A 2DZPA 4PODA 1GYLA 3GG7A 3ARQA 2PU1A 3AI0A 1E1CB 2DJLA 4Q4MA 3DGBA 1GVFA 1Y5VA 4PUNA 3WMSA 1KTNA 5HJXA 4ZA0A 3HURA 1UIOA 1OC7A 4FI4A 2WCGA 1H5YA 1PIIA 3BJSA 3IWPA 2D1ZA 1J0YA 3RPTA 1DBTA 3B0VC 1Z48A 4A8RA 4ZFCA 2W63A 4OU1A 3QPEA 3U9IA 2PTZA 5GNXA 3KM8A 1B3WA 2PDWA 2VELA 2XGZA 3AIUA 3ARYA 1XRFA 2FTPA 5JQ9A 2J8TA 1UD8A 4W5UA 2YR1A 5I02A 1W1ZA 1MDLA 2V2DA 2ZBTA 2C1GA 2G3JA 2G50A 4C6CA 4FNSA 4B90A 4FZIA 3FKRA 3WLHA 6ENLA 2VC6A 3BLFA 4RPQA 5IXEA 4NAFA 1TA3B 3SCVA 3TJ4A 3DH7A 4X9YA 3S2NA 2VHLA 1OQFA 3S42A 1OK6A 3URNA 4I9TA 4KESA 3VMOA 3MDWA 4K1GA 2QJGA 4GYPC 5D09A 1NDVA 1OGBA 3WF0A 2ZFAA 3FKKA 1EC9A 4XD4A 3WSUA 5AC6A 2ATMA 4F2TA 2VFGA 6XIMA 3BAYA 2PWHA 2XFFA 1EF3A 2E28A 3E0VA 4FMVA 1LP6A 3OVPA 2V67A 1TTIA 4IXXA 4WDWA 3B8UA 2IUZA 2PPGA 2PLCA 2Y85A 5KETA 3N2MA 1ZP3A 3T40A 3VD9A 1V0NA 3IVSA 1HKIA 1W5MA 2C18A 3E1F1 5D9PA 4C6IA 2VR2A 1V3JA 1Z32X 2C91A 3HV8A 1H4PA 3VKAA 2GJNA 3BLKA 4JFUA 4ILSA 5I78A 5DT5A 3ZSSA 2ZVRA 5LIKX 2Z7GA 4PRWA 4WZHA 5AFDA 4H7ZA 4ZGYA 1GUVA 3AOFA 2O4QA 3M16A 1TIWA 3TZFA 1IT8A 1OFOA 1KWKA 4GJJA 2FMOA 1FQ0A 2DIJA 3R7MA 2ADAA 3T0TA 3BMVA 1A0DA 3CO4A 1PV8A 1XH0A 1UZDA 3RX2A 3BAKA 2ZUNA 2WMKA 4U31A 5HNRA 4CNTA 5BW6A 1J0IA 1XLJA 3HPSA 3AICA 1K6WA 1N8FA 4CU7A 1TR9A 2QDGA 3CS2A 3OLDA 5C0QA 2F61A 1XYMA 2V63A 1KGWA 3ALFA 2WLYA 3G1SA 3CO8A 3DERA 3NUKA 2EPHA 2V6AA 4HSHA 3QN3A 2WAGA 2JK2A 2WMIA 1B4KA 3CPUA 1EJRC 2W62A 3HB9A 2P3EA 1O5XA 4N6EA 2Z25A 1W2PA 4Q8OA 1GQIA 1DJNA 4NJGA 4KFPA 4WGHA 1LJYA 2VZVA 4LEFA 4BR1A 3MI3A 1WKDA 3BV7A 1LQAA 4NZJA 4H6KA 1I6NA 3IIPA 3S8HA 2F6XA 3EA1A 3AWNA 2HVMA 2IKJA 1UWAA 2D22A 5DLCA 3N11A 3T44A 4MZ8A 4BEUA 4HZ6A 1KFLA 1FWHC 3N04A 3PBWA 3B0YA 5HNTA 1HP5A 1KKOA 1RJQA 2R94A 2EPNA 3WBWA 1L6WA 2KZHA 3MU7A 1WDRA 4IPNB 1OFPA 2O56A 2Z28A 3AXHA 1W32A 1SR9A 3UG4A 2ZX9A 1H7NA 3V5OA 1B30A 4QSFA 1XIEA 3L9CA 4O0KA 2FVMA 3OU8A 1SW7A 3VDCA 1H61A 3BWWA 1DHKA 3UXKA 2ZE0A 4H01A 1NOUA 1ITUA 4Q8PA 4DI9A 3W7HA 3OLGA 1XIGA 3BGAA 5EMUA 1GOMA 3O6YX 3STGA 1BEUA 1ISXA 1XG3A 4U2YA 3NQFA 1SW3A 2ONEA 3P14A 1WV2A 4O8RA 5BCAA 2FHFA 4TTGA 3ALGA 2BY0A 1OWQA 4Q4PA 3ZJ6A 3VOGA 3A21A 3AMGA 2ZIDA 3EWUA 5DT7A 4QG8A 3AUOA 1ZJHA 3LOTA 2AAMA 3S2MA 3LSCA 4H6QA 2GJRA 3NTYA 1T96A 1NOFA 1CXHA 2J7HA 3O07A 4L1GA 1PDYA 1KFJA 2NVDA 3O05A 5HWMA 3BARA 2EF9A 4WSJA 3UPBA 4TV6A 2FFIA 1FWEC 1SM9A 2D3NA 1ADDA 1DORA 2XSAA 1VBUA 2V5CA 5CZJA 4UTKA 4HTYA 3SRHA 3AIEA 4NL1A 4W8BA 2BASA 1V3MA 4HZMA 4H00A 4UTMA 4DJED 3UFYA 5A6BA 2Q6ZA 4ACYA 2NV2A 5K9CA 3LV5A 1O68A 1UW9A 2NUWA 2Y63A 1OFDA 3WEOA 2FPTA 1GKQA 5LNWA 4AD4A 1PVNA 1W3IA 3WO8A 4DM2A 2NXIA 3R11A 2J6XA 3M41A 1L2UA 3HJEA 3PSWA 3SUWA 1IWAA 4WKHA 3H26A 3K8MA 3EOLA 1O95A 3QF0A 4O15A 2P3ZA 3ZLHA 4GC4A 1E5JA 3S1GA 2OSWA 1XD0A 1XICA 3VIKA 1AVAA 3WUEA 4TVCA 5E9AA 3LBOA 1T8XA 2W4XA 1UPMB 4ZO9A 4EANA 3CAVA 3VA8A 3MCNA 5DFAA 3MWCA 3WQCA 2OGJA 2VRJA 1S2AA 1BHGA 1CX9A 5HJYA 3MTWA 1RUSA 3H2MA 4OUIA 3DGRA 4QROA 3MO4A 3OYZA 4NVTA 4ENLA 3QJAA 5BYWA 5CC3A 4PE8A 3PZOA 2GFTA 3AHTA 4IIGA 3DUGA 2IPJA 4LVBA 5K7JA 1OX6A 1OF8A 2J7EA 3OVRA 1X8CA 4TXEA 4N6FA 1K8ZA 1J0ZA 4KKXA 1X1NA 2RGMA 3CV7A 3PPCA 4PMDA 4N9EA 4S3GA 4BI6A 3RCMA 3TMLA 2RDWA 3MP3A 1JIBA 3UWEA 4BQ5A 1LORA 1LUCA 4B3ZA 1EKOA 1QPNA 2ZTKA 1QNQA 3AYSA 3W75A 1M04A 4B5VA 4MB1A 1O5KA 5CGMA 1OG0A 3A3WA 3G8EA 4RZBA 2Q3RA 3KX6A 3S6DA 3SCNA 1DHPA 4PMRA 5F1UA 5AECA 1NH6A 3BZGA 2OXNA 4H2CA 2HWGA 1ZCCA 3KVKA 4NZ1A 1P1XA 4JTKA 3DG3A 1UD3A 3MS8A 1QR7A 3RJYA 1VLIA 3SQLA 2CWXA 2Y24A 3UA4A 5GJPA 3ISIX 3L67A 4JTSA 3GXFA 3LQGA 5BOFA 1JYWA 1VHNA 4ZTXA 1XSIA 3HGRA 1MEIA 1SZGA 3GSMA 4FPSA 3W73A 1XFCA 3NSNA 4XZHA 4MUZA 3ZWSA 3UJ2A 3RPDA 1TV5A 4MUPA 5HULA 1MZRA 1QUMA 2FZ8A 4L1WA 3UCCA 4F48A 3LMZA 3PTDA 4GFSA 2XVPA 4KRTA 1FWIC 3N9RA 4H3DA 2OWWA 2I5GA 4X63A 2E9MA 2WKLA 5I09A 4UTTA 5IBXA 1OZQA 3L2LA 4JEQA 4JNZA 2DIKA 3NYDA 1V93A 3VABA 1LG2A 4HK7A 3U3HA 2C8NA 3IEBA 4GVHA 3THUA 3G1XA 1US2A 3STFA 2YOCA 3VM5A 3LHTA 3OIXA 4GC3A 4H41A 1PCKA 5LIWX 4AY7A 3ZLGA 4FOUA 4GACA 2RAGA 1DWHM 2WVVB 5GPRA 3TW6A 4D6JA 1L8NA 1ME8A 3B8TA 4L9ZA 5U7SA 3CJPA 1GONA 1RQEA 3QQWA 3TE9A 3JW7A 4Q22A 3XISA 1U5VA 2PDMA 1KGXA 2VDGA 3RFAA 1KC7A 4JICA 3KRZA 2D2GA 1R3RA 3H21A 1BRLA 5E0CA 4BF9A 1M6JA 3LBCA 2WLZA 3WJYA 1BVWA 4E4FA 1K8CA 4PUDA 5F7UA 1BFNA 3L65A 4XIAA 4NSBA 3WDRA 2XSBA 3TYCA 3LXCA 3G1HA 1SSDA 4QNEA 1W17A 2DIEA 3AXMA 3VD5A 1F6YA 1HT6A 4M7TA 1H62A 3QPZA 4GFIA 1ADOA 2WMFA 5FEWA 3NGJA 1K7FA 3S46A 1TV3A 4LCSA 5AHEA 2CFFA 3CQJA 4R3UA 5AHLA 1UR0A 1M7PA 1B2YA 1SU5A 2OLAA 1F7BA 1X6UA 4DELA 4PBFA 1UBPC 3E5BA 4DWSA 3H55A 5DMYA 9CGTA 2VZOA 2V3FA 3F4NA 2NZLA 3DC8A 4ZENA 2P10A 3TAKA 1E15A 2OYLA 2NX3A 4ONVA 4J28A 1GOOA 3FXGA 5C2XA 4HU0A 1XH1A 2P5NA 3MBDA 4HQVA 4L80A 1BKSA 2TODA 2UZ9A 2WMGA 5LHEA 4PSPA 2DW6A 3MUXA 4WY0B 1TPWA 5EYWA 3A13A 3ANVA 3GTFA 4KWSA 4HMNA 2WSQA 3T0AA 2XZ9A 4ZQCA 3GNRA 1YKWA 3PP7A 2HK1A 4S3EA 4TMCA 1CCWB 4PL1A 3LS9A 2VD9A 2OO6A 3FHAA 4B16A 3S9YA 3H4XA 3UWYA 4YYFA 3MQTA 4HHHA 1SZNA 3BXWA 2CLMA 1QPQA 1YQ2A 4GINA 5A6MA 3MUZ1 1KLYA 1R9XA 1NIUA 1Q6FA 3VUSA 5LXEA 3H7VA 1XSKA 3MMTA 3WH9A 4JTUA 4NU7A 1IEQA 1FA2A 4O4VA 3R0UA 4GK8A 4C6MA 4MKNA 3B40A 3BCJA 3GNOA 3DI0A 1KKRA 3IANA 4QJ4B 5CLWA 4X3ZA 3W07A 3W1QA 4DO7A 2PE4A 4JPGA 4UR9A 2F7FA 1S2TA 3WFAA 4B9YA 2Z4GA 2C6QA 4DO4A 4RXGA 2PDHA 3VX0A 1TPEA 2J47A 3H2CA 4AC7C 5G4WA 4GRSA 3ABZA 1GVEA 1EGMA 1O12A 3L4VA 3S9IA 4BF5A 4GH3A 3PJTA 1B3OA 5J04A 3HV9A 5E0KA 4GQQA 1ZBCA 5FJTA 3USZA 3GK0A 2A4AA 3WQDA 1MUMA 2XUCA 3P0WA 4N0RA 3L5MA 1RSCA 1QHPA 4UMAA 1FKXA 1REQA 2WOQA 4KETA 1WKEA 5EY5A 4A2SA 1BXCA 4XTDA 4LV9A 3TA6A 1OX4A 4JIQA 1XISA 3IAQA 3BCFA 3H12A 2QULA 5GVJA 4Z2HA 2FB3A 3LD5A 2J7CA 3GM8A 5CSUA 3VX1A 3WNMA 5EMJA 2REQB 1DJGA 5D9NA 1EWEA 1VP5A 3N6QA 1YE4A 1VBGA 4J3TA 3NXFA 1G1YA 5LZLA 3W01A 3WEZA 4US6A 3BV4A 3VNJA 1QFEA 3VFLA 1FX6A 4S3AA 4YWSA 1F3TA 1FHDA 1GQLA 1Q6DA 3GFYA 3K4AA 4HMEA 4E6MA 4AVFA 3BJFA 3DKLA 1QXLA 3F03K 2B0MA 1UKQA 2AL2B 3APTA 1JZ8A 3ARTA 1AK5A 1VFHA 1BF6A 2MNRA 3S83A 3KRSA 1BTCA 3E5PA 3KHDA 3K13A 4HPXA 1OFQA 2PDIA 3PNZA 4E2OA 4PR4A 4IPPA 4M7SA 3OHMB 3GUGA 3UCDA 3HPZA 1KBKA 1G4SA 1ZBKA 1QO2A 1E56A 1WCGA 3P74A 4Z1YA 4LQ1A 4DXXA 1HGWA 1R3WA 4FXRA 1HJWA 3BLEA 3M0JA 3SUTA 4EF9A 1FTXA 1B0IA 3QR0A 1LBLA 4MDOA 3WLTA 3ANYA 2A3HA 3P61A 1AH3A 1SUXA 2RFGA 3T9PA 2XH7A 4JXCA 5FCZA 3TONA 3WBXA 2FHBA 3LCFA 3QZAA 4F8XA 1JPDX 1VC4A 4G2DA 3WBAA 3RU6A 1JUBA 1RA5A 1I0BA 4JY8A 3FFSA 3QVQA 4BKNA 1XLLA 2X41A 4JFSA 2BY1A 2DZVA 3CK5A 2AGKA 2PDBA 1E3XA 1HF6A 1HKKA 3UJEA 1ICPA 2ZADA 2VDHA 3EX3A 2D2HA 2QXWA 4FIQA 5D02A 3CL7A 3GXDA 3WUGA 2J9XA 1G0CA 1CLVA 4MSSA 4HNUA 2Q02A 2YXXA 1PE1A 3VIFA 2IKGA 4OHQA 3WN6A 3VOFA 1HX0A 3SJNA 2RKXA 4FIRA 3WH8A 1J9YA 1Q65A 5CJMA 2CYGA 4LY8A 4ML4A 3ES7A 3W53A 1U1UA 3LGDA 1HL2A 1AJ2A 2G3NA 2D2JA 4MJ2A 3KL3A 3MP4A 5CSYA 4QGCA 2PURA 2QVNA 1FP9A 1NU5A 3K2GA 3KTSA 4AISA 4HYWA 2GVLA 2J8GA 3GVQA 1A49A 1W1IE 2R1NA 4EWND 1TA3A 1TZZA 1ZUAX 1XYAA 5CPLA 4NI3A 2ZUUA 4AEEA 1M7XA 1L9WA 4I8YA 5LA0A 3MMWA 1YPFA 2FJKA 3TSBA 4O53A 4MLRA 3VNIA 2ZXBA 3CZ8A 3PSVA 4IQEA 4CQ8A 1AL8A 3LDVA 3WQ4A 2Z2AA 1ALDA 2RDTA 3I4EA 1EQCA 1TUFA 2O9RA 1RBAA 1T5AA 2QJIA 3P8JA 3LK6A 2E6FA 1KCXA 2YYTA 5D04C 1LROA 3RGTA 4DO5A 5D38A 1CXKA 1OCBA 3BURA 3A4JA 4QM1A 4AZ7A 1QI5A 5G5IA 1YW1A 4AMCA 1ESWA 4UTWA 4IGMA 4PFHA 1RBLA 3LX9A 2ICSA 1W3JA 1JRBA 3FA4A 3CASA 4DLFA 3CIXA 1BYCA 3D0CA 2Y8KA 1DVJA 2WC4A 1XYCA 1I1WA 5EGRA 2BHYA 3HPAA 4GVIA 4L56A 1GPWA 1TVLA 3CB8A 2YB1A 4ASTA 3BW4A 3THQA 3LBMA 3SSJA 2R1MA 2V82A 5I6SA 4V28A 5HXMA 2G41A 2VM8A 5EMLA 3RG6A 4X22A 1BG9A 1TTQA 1VRDA 2ZDSA 5JVLA 4DJDC 2CKRA 4QG9A 2R8WA 4KERA 3ZVHA 4RUBA 3A4XA 3QRHA 4C5YA 1K4HA 2E67A 5DANA 4P8VA 2LLEA 2CLIA 4IQJA 2ZVIA 4IJBA 4INFA 2PDCA 3USBA 2VX7A 5CC5A 3WQPA 2AL1A 3QV7A 3CB3A 2E8YA 2XIBA 1XIMA 1XPGA 3TTYA 2NSOA 4AXKA 4NI8A 1SO3A 1EIXA 5B7YA 4QAIA 4UMBA 3TEVA 3KBJA 1V0LA 3W37A 1OZMA 3LN3A 1FFRA 3GG0A 4TIMA 3T8LA 3I65A 3LSBA 3A22A 3HQPA 2E1DA 4YJ5A 3DHPA 4RE2A 2PGWA 4HOZA 1EB3A 4UTIA 2TMDA 2Y7FA 1TRDA 2QCFA 4KMQA 4PB4A 1I2PA 3G8RA 3GDMA 1Q45A 3CGTA 3KAOA 2J78A 4JAWA 3WQVA 2GWNA 3GDLA 1JJKA 4XSLA 1A5UA 4XB3A 1IXQA 4MZYA 4XBJA 2CZEA 4PCNA 3GFXA 2W61A 3WNLA 3VNDA 1XXXA 5J5RA 4V15A 1IV8A 4R9XA 2WBGA 4WJEA 1CIUA 1Z89A 3OLEA 3P2VA 2XM2A 4ZTYA 4Q33A 3UNDA 3UPMA 3R4IA 1A4LA 2VRKA 1XBZA 4F0HA 1BAGA 5DRIA 1YEYA 2I14A 1VEOA 1GPFA 3BJTA 3TN6A 4D71A 1TMLA 2RH9A 2EPKX 2JQXA 4PC8A 3B8WA 3G1YA 3UJRA 3GAYA 1HGYA 1YXDA 5B7ZA 4QITA 5LHFA 4AWTA 2XSXA 2HV5A 2WZMA 1Q85A 2IQDA 1G67A 1E6SM 3PFRA 2YDRA 2YW3A 2V2CA 4U2ZA 2QNEA 1R7OA 1OFRA 5CGQA 1DIEA 3W83A 3E0FA 4H7CA 1EX1A 1C3FA 2DY3A 2CEQA 3O7UA 3T78A 1T40A 2PFHA 3NYZA 4AYGA 2ZX8A 3UXAA 3TW7A 1WXYA 4U3AA 4GZIA 1UUQA 1AUSL 2AKZA 5BMWA 5IHSA 1V6VA 4DJEC 4J3ZA 4RCXA 2WWCA 3URAA 5BU9A 3T6CA 2OX4A 1JDDA 3NNTA 5LXXA 3KUMA 4DJEA 3PB0A 4XD3A 3W23A 3PWGA 3KOYA 4G1NA 3WH6A 4HPJA 2NV9A 4CD5A 4Q8MA 4UQDA 1DYSA 4OFCA 4IISA 5REQB 3ICJA 5KTLA 4X60A 1LLOA 3SEPA 2QHAA 3F5KA 5IM51 3M64A 2VWTA 1RZMA 3EPOA 1MO0A 1CGTA 3TXVA 1ME9A 2ZUTA 1QTWA 1QNPA 3VE7A 4LALA 9XIAA 3GNNA 4Z42C 4Q6JA 2GGJA 3TSDA 5FKYA 2ZUSA 3RHGA 3NSMA 4PUMA 4XSMA 1XIIA 4M80A 3GAKA 3G1AA 5C54A 5MF5A 1E9LA 3CUGA 1SQ7A 5K9XA 3EA2A 1AQMA 4B91A 4J3SA 3TN4A 3TFXA 3EYPA 1YNQA 3JZUA 5CBIA 4IL0A 2Y1HA 3LRKA 4LH8A 5CZKA 3EMCA 5LNUA 2DQXA 2O55A 4D8LA 4WX2A 3T42A 4GLEA 2UWFA 3E2SA 5M2FX 3NQ6A 3W1AA 3G2GA 4KWVA 3FYOA 1OBAA 2ACUA 3MZ2A 4H83A 1K7XA 4JGDA 3LPPA 1POKA 3ANUA 4F66A 3VZZA 2AQOA 4JTHA 3D47A 5FA5A 2Z1VA 9XIMA 4F3HA 3RN6A 1K8YA 4BF7A 4C6FA 4EPBC 1BPLB 1H1NA 1RCQA 4X61A 3W82A 3A9BA 1M01A 5KEZA 1FWNA 3PANA 1ICSA 5HANA 2EEXA 3WNOA 5FEXA 4AFYA 3B3DA 2NWRA 4HGXA 4ACZA 1CXLA 4CQDA 3W85A 3AMCA 3W2KA 3VU2A 1ZJBA 4FF5A 4EX4A 4JCMA 4NJKA 4K6AA 3FGCA 4QSHA 3QTGA 5XINA 4IP4A 3H2AA 1YBQA 1MRAA 5ENLA 4DN1A 3UWVA 3LLDA 3P67A 5K3VA 2J7GA 1EJVC 2XM1A 1PHQA 3MY9A 2YBUA 4E8DA 1HUVA 3QQ1A 5CC6A 3LU2A 3WLIA 2BHZA 5T26A 2XN2A 3GKAA 3TAOA 4LAKA 4I8DA 4DX3A 2PDLA 2Z2UA 4U4MA 4MB5A 1UMYA 4LC6A 5HUPA 3BLIA 1CGVA 3H53A 4CVWA 4ZO8A 2BNJA 1D2KA 2VQUA 3BANA 4HU8A 3PJUA 1E55A 2C0AA 1G7VA 3AS0A 4I90A 1X96A 4TVUA 1JFXA 5E09A 1X38A 2ISSA 4DRSA 1VCGA 3T09A 3EXSA 1UP0A 2QW5A 4MWAB 2BZNA 4FX7A 3M0XA 1EPVA 2POZA 2XFRA 3FDKA 2JF7A 4IGHA 4M8UA 1CGWA 1LZOA 3F4WA 2E5CA 2QMJA 4WOQA 1RCOB 4AX7A 1VBJA 1KB3A 3DG7A 4ERIA 3E2RA 1LDCA 3N6HA 2V69A 4ICNA 1LYXA 4MWAD 1BGAA 3AISA 5MHBA 4MB4A 4DBUA 1UH4A 2F84A 4Y9AA 3H2FA 3PJWA 4JTLA 1J8VA 1YNPA 1RK6A 4Q8UA 4UNIA 1DJIA 1S1RA 2XIQA 4QEEA 2B7NA 3ONBA 4HNTA 5H2ZA 4WGXA 3G24A 1EBGA 1EJSC 1AQFA 2QUMA 3BSMA 5DMLA 4ORIA 2BHUA 5T9CE 3UY7A 3WQEA 4KCVA 1W54A 5ABGA 4PSRA 4J3WA 3B9AA 2X1RA 1ZLPA 1E9ZB 4W89A 4YTSA 4GY7A 2G3FA 1AW2A 2ZRUA 3UA3A 3LUTA 5A69A 2C1IA 2E68A 4EPEC 4K39A 5F4SA 3OP2A 2AOSA 2OODA 3GS6A 1UKTA 3CQHA 1SSGA 2ACSA 1MXGA 4IP5A 2SFPA 4N4PA 3SCQA 3U5YA 1K4GA 1JPIA 1F76A 2GSEA 3RX3A 3OZYA 2GK1A 1H41A 3SDOA 2DW7A 1HKJA 4K68A 2NQZA 2DZSA 2HS8A 4FEZA 1LL7A 2BB0A 1P0DA 2XH2A 2WMHA 7REQA 5CZTA 2WQPA 1SO6A 2PDQA 2HNEA 2INEA 2Q09A 1UBSA 1CECA 2NVCA 4J27A 4C91A 4HU4A 4LUIA 1V3HA 3OVQA 4E2DA 4GG9A 1WZKA 5IFTA 1TZ7A 2ZYFA 3CV6A 4LAUA 4RKAA 2BGNE 1FVPA 2YCKX 3GTIA 4AH7A 3UXLA 4G7FA 4LUTB 2C3ZA 4UOZA 2D0FA 4AEOA 3CLMA 4UNKA 2EG6A 2BVWA 3M0HA 1M41A 3AIRA 1TV8A 3EWXA 4AX6A 4F0SA 4O12A 3H7UA 3MSDA 5CPTA 3RCNA 3FAWA 4MG4A 5XIMA 1EXBA 2X1UA 3QC0A 1PYFA 3E38A 2OU4A 1EQPA 1SJAA 4WJXA 3V36A 4YIWA 1NQ6A 3M43A 1FWJC 4PMVA 3CYVA 1EJUC 2VVSA 3PUEA 4E2VA 2HRWA 5JIPA 2E1WA 4UFLA 2Y7EA 5A6JA 3WDIA 2QUUA 4FXFA 3P5YA 1UG6A 4KIEA 3NM3A 3B0UX 2ZXQA 3F2BA 3W2JA 2F2HA 2YW4A 3M0LA 4G9PA 3W2MA 2AKMA 3B4YA 3BGGA 5H8PA 4YHGA 3ZSTA 3WF3A 5D9OA 1YE6A 3B9NA 4REQA 3SB0A 3NURA 3LI1A 3CV2A 4URIA 3IJ6A 3VDGA 3S47A 4AD2A 1S5TA 5E6ZA 1XLGA 4DNHA 3P0XA 4L65A 4FAMA 4CU6A 3TTEA 1U33A 1EOMA 2CLKA 3T07A 2WQDA 4UTLA 3CUHA 2ISDA 3WNKA 1UD6A 4XKYA 1J79A 3WLLA 2QUNA 4X2RA 2ZZ7A 4HCLA 3PNUA 1UWSA 3G6LA 1QW9A 3NOEA 2WZTA 1W0MA 3VDBA 2DVXA 3I68A 3LTYA 3WJXA 4L4LA 1NDYA 4DVOA 4YVXA 3ZT5A 1JR1A 3HGSA 4JKLA 2ZWYA 1XLBA 2DUZA 2BXVA 4WRHA 3K1GA 1Z42A 1PKMA 5JU6A 1YDNA 1M03A 1KXVA 4WHBA 1VYRA 4GBDA 4WSKA 1PPIA 4IMDA 1IEWA 4NAFB 3R6IA 3CM4A 5IDZA 3WG6A 2DV0A 2NUXA 1WB0A 3WMCA 1KRBC 1UA3A 3SRKA 3SFWA 4GUGA 2ODOA 1W9VA 3VFCA 2A21A 1F61A 3EDEA 2JE8A 1XLKA 2OEKA 2C1HA 1Q6RA 3W2LA 4O52A 1VLWA 2B7OA 4Z0JA 4H8HA 2AL2A 4UFMA 5C9ZA 4NJJA 2V8ZA 4AF0A 2ZA2A 3VGHA 2PWVA 2TRSA 3JVAA 1W6TA 1FRBA 5KZEA 5DF0A 1CNVA 4AVOA 4D72A 3TYBA 3HN3A 5BWFA 4QDWA 1WAUA 4QDMA 1VJZA 4FK9A 1TTPA 4CN4A 2J74A 3K5XA 3GDTA 5HK4A 2GLKA 2WMJA 3N4EA 4OT7A 2QDHA 1Q8JA 3R0DA 5BOOA 2Y62A 4GVFA 4CNUA 2J7BA 4I3GA 1D9EA 3EOOA 1QAPA 1H7XA 1RBOB 3W7QA 1NFBA 4GO9A 1UZ1A 3E12A 3NA8A 3N25A 3SGGA 3S5OA 3UVIA 4UOJA 3LXBA 4K8GA 3S9ZA 3CXOA 4WQ6A 3PUGA 4XO7A 3WQWA 3G0XA 4YMZA 1GVRA 3KOWA 2TSYA 1OT1A 3M44A 4MWAE 2BDQA 3RLVA 1CLXA 1IXPA 1PYMA 1VB9A 2OMAA 2Y5EA 2WM1A 4MYXA 4PZVA 4FSAA 2HQAA 3P60A 3GNDA 1Y5WA 3PJXA 1JPKA 3R1ZA 4RNJA 4ALDA 1N8IA 4RL3A 3GLCA 5SWUA 5HJLA 4AQLA 4FALA 3WH7A 3QC3A 1GHSA 1V4YA 4EAYA 1QWKA 3OQEA 6ALDA 4HKPA 5A8GA 1VH7A 1X7IA 4PTNA 3VC5A 1XBYA 4R33A 3UP8A 3RO6A 4NXSA 1FH8A 5H8MA 3NO5A 3N18A 1JXKA 1E0VA 1JAEA 3SCUA 3ATYA 1UASA 2Y6ZA 4UFKA 4ERAA 4IIBA 3ZLFA 1DJXA 1S39A 3RRXA 2WC3A 4CQCA 1RPKA 5K4XA 3B9OA 1XDJA 5A3HA 3UW6A 7TIMA 2RDUA 1V6XA 4B5XA 2VMFA 1ZQ5A 2VXNA 3ABQA 3D5HA 1IZCA 3B9EA 1IGSA 4QLKA 4Z08A 5A8OA 3L0KA 2VFDA 3WD1A 4Q7NA 4JD4A 2YL6A 3R25A 3VGBA 4WDUA 3M5VA 3PZNA 4Q6XA 5CPSA 3UJFA 2CZDA 3CPRA 2FZNA 3VC6A 4M29A 3FCPA 1F2JA 1DE5A 1Q3NA 1R0MA 3ZWTA 4HNVA 3SGUA 2X1TA 3GH4A 4NILA 4R7OA 5TAOA 4LOCA 4L4OA 5AOUA 3FK4A 4W86A 1BQGA 4N9BA 2NXHA 4NZ3A 1F4HA 1OD0A 1R30A 2OYMA 3I6TA 3QKZA 2R82A 1HL9A 1CGYA 1YMYA 3A12A 4D6DA 2XVKA 3WL1A 2WNNA 1W5OA 2PU0A 3OGRA 1B4EA 5DO8A 4Z1AA 1KQYA 3DXIA 3MWAA 3CHFA 2PBOA 4V1XA 4F0LA 3IARA 3FA5A 1DE6A 3N3TA 4IPIA 3RR1A 1ECEA 3R94A 2DQWA 1OCNA 1KCLA 3T55A 3VZXA 3UG8A 4BFAA 3SCPA 1UR2A 1ADSA 1JUEA 4O57A 3ITYA 1QK2A 4I7VA 3BQ6A 2O0TA 3RLHA 1R3VA 3HMCA 2BG5A 3NGFA 3Q2DA 2DDXA 3KOFA 3MMUA 4XZMX 4QG6A 2QCEA 1TWSA 3A64A 1OFAA 4E3TA 2QF7A 1FCUA 4OV9A 1H49A 1A5AA 4IG2B 4C6DA 3BZJA 3DENA 4GIEA 1B1YA 2PWGA 1I2OA 3GYCA 3PS7A 4R9OA 1TE1A 1FY6A 2Z6JA 3NQ7A 1FH9A 4JTJA 3T2OA 4HSOA 5FL1A 2V30A 1VS1A 2OLSA 1A0CA 3HQOA 1DJYA 1WNOA 4Y9OA 4LBRA 1JGIA 5A6BD 4KRZA 1GOXA 2DZWA 3WQFA 1E4LA 3ABRA 4O14A 3C8FA 2VEFA 5FF4A 5MKGB 5HWJA 3FLUA 3VM7A 3PM6A 1WKYA 4OZOA 2R1KA 1I1XA 1J12A 2B81A 1XQLA 3GXMA 1NWSA 4DBWA 2FZBA 2GVJA 1W9UA 4DWDA 4N9CA 4AD3A 2DT3A 1RK5A 2Y61A 1TREA 3TMQA 2XH4A 2WB5A 1US3A 1FHLA 3RYSA 1Z8AA 2FPYA 1G4TA 3MJYA 3CTLA 1OC6A 1P6WA 4HCHA 3STEA 1VFFA 1E73M 4ZQRA 4BZYA 3L4TA 4RNFA 1Z6KA 1XQKA 4BWLA 1LOSA 5H1WA 1XC6A 4QFUA 3WDHA 3CZJA 3WLMA 3CUXA 2WZEA 4L1XA 5AYIA 3BAIA 3GHUA 4X2PA 3O9NA 3DC0A 2WZHA 4A3YA 4LU0A 1F8IA 3LNPA 4NASA 3DCPA 3GNPA 2DT2A 1W9DM 1AA1B 2HCVA 3UERA 2EAWA 2GOKA 5FAJA 3B0PA 1XC4A 3KLKA 3WQOA 1QPKA 1DIOA 2NQ5A 2YGYA 3R89A 5CXPA 1EDQA 3HQ1A 1TE6A 1AH4A 3SQMA 1P48A 5F2LA 4H9XA 4LF1A 1O1HA 2DSUA 3OEXA 4IIHA 5EB8A 3H54A 2XINA 3LM7A 4Q8TA 2YDQA 5BWAA 2CLLA 3L2MA 1LOLA 3EEZA 3UBPC 1OJXA 1CXFA 2OG9A 4PMXA 1E6QM 4P7LA 2Y5SA 1UR1A 3CV1A 1X98A 4ZE4A 3LPGA 3MKKA 1X8FA 3W7LA 2J9ZA 1RQHA 1E43A 1ZB5A 4ZE5A 4GQ0A 1B3VA 1BG4A 2D23A 1W3LA 1EF2A 1OYBA 1Q5MA 3WD0A 1V03A 4KEVA 3MI6A 3VNMA 1P5BA 1E0TA 3KVMA 2Z0IA 1DWFM 3GY1A 4LC8A 4MB3A 5D2WA 3EWZA 4OWGA 3HG5A 3EX1A 5C9XA 4C1LA 3VXGA 4NZCA 4W85A 2W3ZA 3U2CA 2G8ZA 2QCDB 1OGSA 4H1ZA 5AHFA 3TROA 2O9PA 3KBWA 1EHNA 3QLLA 4KT2A 4ZQNA 2PC4A 2EGZA 1P1MA 2ACQA 3GW0A 4WVXA 3S0CA 1XYFA 1RY0A 2DSVA 2G96A 3E9AA 4F79A 5CJ5A 3DZ1A 4ATWA 1GYNA 2CZ5A 5T9BG 4DYJA 3ZIZA 1A4MA 4Q32A 5AY7A 3PR2A 3UYCA 4UR8A 3IACA 3RJXA 3PZGA 3IGXA 1R8LA 1EUAA 1VFTA 1PDZA 1ITCA 3KXQA 4MFEA 3W7JA 4HZ7A 5FJUA 1KM5A 3N3MA 1RP9A 4PMQA 2VUNA 2YSWA 3AROA 2ZRYA 4IIFA 1YDYA 4B92A 3V18A 2VCAA 4GPNA 1CWYA 3DI1A 4MTVA 3PBYA 3N9SA 1MRQA 4Y9PA 1VFLA 4A4AA 2ISWA 3AWOA 4DWSB 5FJOA 1YDVA 1GVOA 1Y5XA 4R53A 3W84A 2YPIA 3E74A 2FDSA 3IVUA 1GVYA 2P76A 4JHZA 4M5PA 4NP7A 3KW3A 3G18A 3A5FA 2QT3A 4PMUA 1GZJA 3K1DA 1YRRA 3M0KA 4XG1A 3TR2A 3S5SA 3V5FA 1WDWA 2UY2A 1PZ1A 3QV6A 3GDBA 4DWSD 2FDMA 1TELA 4GIRA 3LV6A 5DBUA 1UZHA 4LVDA 4M0XA 1WE5A 4O8AA 4W87A 3M0MA 1W1B1 3QBUA 4MWAC 3N19B 3LMYA 2VX6A 3G77A 3GO2A 1GQKA 2ESCA 1K03A 5E5CA 4I6VA 1XLCA 1E0UA 3W7CA 4OBRA 2FHCA 2ZOXA 4NX5A 4XAPA 3BG3A 8RUCA 1TFVA 3EGJA 3T4WA 2GWGA 1AQ0A 3E6EA 5JXQA 2VGGA 1H7WA 3TFCA 1JDFA 4KEMA 1BQCA 1GWJA 3FJ4A 1ZY9A 2QPUA 1O4UA 1LWIA 4RJEA 1DEDA 3PZQA 1YXYA 1M53A 5TBOA 3IRDA 1EP1A 2DPEA 4O10A 4NYYA 3KZPA 4M1BA 2JKAA 2AMXA 5C9WA 3CHEA 4IMCA 1XR2A 3VNLA 4C1KA 1CGXA 3N2XA 3WJWA 5A95A 3GW3A 4AZBA 3J7HA 4CCDA 3ME3A 1E5NA 4FF7A 3A6OA 4KWWA 2PF8A 1CYGA 3VO0A 1WXZA 3BLDA 3NWRA 2ZRXA 4KCUA 4YVPA 1V51A 1L6SA 3UWWA 2VFFA 2H8XA 1POJA 1DL3A 3ARVA 1IEXA 2ZRVA 1EHAA 1O5QA 4XK2A 5A8QA 1TCMA 3OOQA 3WFLA 5A2CA 2Y8UA 1FCBA 1HJQA 1HG3A 2PWEA 3EDJA 3NFUA 4QTGA 4UB9A 3TX9A 1THFD 4ROQA 2XGBA 1GJWA 3TYAA 1KTBA 1Z44A 4OBTA 5HBFA 2R1LA 1FWBC 4GBUA 4G7EA 3KDNA 3L5AA 4MJZA 2BWGA 4M24A 1H0IA 1V0KA 1ZFJA 1BSIA 4KWOA 4MHBA 5PTDA 3EKGA 3OGSA 1VFMA 3KCJA 1XG4A 2OZTA 4Q4OA 2HPMA 3VCRA 1QI3A 1ZZMA 2PP0A 4AIBA 4Z1DA 5G4HC 3OPSA 1PIGA 1K9DA 4XBSA 1XDMA 2WVTA 3AFBA 4A3UA 4YTQA 2CIPA 3F1QA 6TAAA 1ZL1A 5TD4A 2XVNA 4GIAA 1LTDA 5J8LA 4OQVA 3W25A 1RAKA 4IQDA 2QDDA 2YCLA 3MYPA 3APGA 1I8JA 3GKFA 3PBGA 3GVRA 4RZ4A 1D8CA 1P4CA 3W1UA 3S3GA 4AEFA 2D0GA 1XF0A 4JR5A 4ZB2A 2Y5JA 2CHOA 1V5XA 1J5SA 1SW0A 2EBNA 3IIVA 3WQ6A 1R3YA 2DT0A 2OQYA 1T99A 3QYQA 4HOXA 1BYAA 3ARXA 2X1SA 1A3WA 3V75A 2A7NA 2BX7A 1CDGA 4GJ1A 4HA0A 4EPKA 3DN5A 3U2ZA 1VCFA 2J62A 1PAMA 3DFSA 4LVGA 5LKYA 1C8QA 1R6WA 4M82A 4MY9A 2P8BA 2P0OA 3DECA 3JUGA 5CAKA 1EO5A 5ABEA 4AVNA 4UUIA 3TK7A 1XX1A 2WM0A 4ZVJA 2XZ7A 4TMBA 1MUCA 4O1CA 1D3CA 1A50A 2YFOA 2CXEA 3HG3A 1MW2A 4AYSA 1W1TA 6REQB 1U83A 3PPGA 4G8TA 1N8WA 2WCSA 2WHLA 3SAZA 2VZTA 4CEXC 3CIWA 3ITXA 2P8CA 1CZ1A 2BVTA 3VYLA 1NTHA 1JF6A 3WELA 4KQNA 1GT8A 1L6GA 4ZZ9A 3T8QA 4I9JA 2ZZ3A 3WK2A 3RMEA 1KTCA 5BROA 4NXKA 1X7FA 3OA3A 5HUOA 4H2HA 4ZQMA 4PEKA 2PGRA 3NO1A 2H9AA 4K3ZA 5JBFA 4CD6A 4S39A 4IQLA 3MHFA 2Z1SA 3DFQA 4GUHA 1GG1A 1JL8A 1MXDA 3NJ3A 2GJXB 1SZRA 1AJZA 3FYYA 3BL3A 3NPVA 2FJUB 1GGOA 3OBAA 4A29A 3QFEA 3T4CA 4J2PA 3GUWA 4IGSA 3C2VA 1S2VA 1K9TA 3W2NA 3VGFA 1EP3A 2TYSA 3W81A 2OWCA 5A8NA 1UYQA 3OZPA 3H6OA 1SMAA 3HFYA 3RILA 1ONXA 4MJMA 2C13A 1W3HA 2VJXA 4GZJA 5G1MA 4PUJA 1SJCA 2YA2A 1BWKA 1B3YA 2OSYA 4UQAA 4GJIA 4HU3A 2ZQ0A 3OJGA 5I00A 5L9FA 1LLWA 1XD1A 2MUCA 4PBGA 1W1VA 3W7EA 4JTTA 4H8UA 3SY5A 3W9ZA 3QR3A 3ATZA 4N2YA 4I5RA 5IFPA 2BY2A 2GSJA 4JNYA 2XIJA 4TX8A 3EXRA 2YFNA 1ZALA 4A3RA 3UPWA 3IIZA 3A3HA 1JVNA 5JH2A 1LOQA 3VDHA 8XIAA 3OW1A 4W8AA 4MGGA 3BQ5A 3ZVHB 3CMGA 4CLMA 2G97A 4JN7A 2OZ8A 3WNPA 3TLQA 5CCZA 1UC5A 4Y7EA 4EKJA 3EWCA 5M03A 2ZUVA 3HOJA 3ZM8A 4LEQA 3U8GA 3H23A 1H1YA 4NIRA 6CGTA 1KM2A 1KQZA 2J9YA 3BMWA 3VVGA 1UP2A 4C6OA 4YU1A 4Q4SA 1BTMA 3VIGA 3C0QA 2P1FA 3CWOX 3O6AA 3VKDA 1IZJA 3EEGA 3WF2A 3BOXA 1XIBA 4BS0A 2Y4SA 2BGSA 3MSRA 2DH2A 4MZ1A 3RXZA 4XZBA 4DF1A 5HMEA 2JF6A 4GMEA 1XINA 3P7YA 4K37A 5I3IA 2RDXA 1TTJA 3NIYA 3OB8A 1EA0A 3N9KA 1UR9A 3QY8A 3B05A 1KV8A 1UWTA 5EA9A 3KHJA 5KMYA 3KP0A 2CZVA 2BS9A 2G3IA 1KBBA 1Y7VA 2YZ5A 1QBAA 3ITVA 2Y0FA 3U48A 1NM9A 4QR6A 5CJNA 4BCEA 4H04A 3GYEA 1KFEA 1KA9F 3H4WA 4PRTA 4F0RA 5XIAA 2DP3A 4UFJA 4AAJA 1EDGA 1B3XA 3ITLA 3DYPA 4W7WA 4IWWA 3TZNA 1DQUA 5DMMA 4JEJA 1BSLA 1XCWA 5LGXA 2W6RA 4W84A 4PTDA 3WK3A 4O18A 1E70M 3H4GA 1E6NA 3NEHA 1Y8BA 1A5NC 1FHVA 2IXVA 1UWQA 1ELSA 3GG1A 3SY1A 1DJZA 3BTNA 3VIOA 4LWWA 3AS1A 1XLAA 4LB3A 3CZKA 4E5TA 1SR0A 4IH3A 4I9AA 3WF4A 3V16A 3V0UA 4L7ZA 5FD0A 2WJDA 4S3FA 3I7RA 3VNZA 1DQXA 4QDPA 4AD0A 1UHVA 4PCSA 5A6KA 2DFAA 1SMDA 3NSXA 1MWOA 3II1A 2NLYA 3GH5A 1DIKA 4XQ6A 4AHPA 5LNSA 2I5IA 3QZ6A 3TH6A 1CXEA 2UY5A 2PWUA 4XX6A 1MFUA 2ABAA 4PRRA 1OD8A 2PTWA 5I2UA 3C2OA 3GIPA 4Z2GA 1LG1A 2GGGA 2OO0A 3I6EA 4E2BA 3T0CA 1V02A 1W1YA 4ZXOA 3UYIA 1XLHA 2QEZA 4E3VA 3DFTA 1TPVA 2YXGA 4LPCA 4GKTA 1NWUA 4GUFA 4IG2A 5AYBA 1EX5A 3U4AA 1WXJA 1R2RA 1NP2A 4O11A 4Q4KA 1AODA 3RNDA 3T1GA 4C7GA 4Y6GA 5ABFA 2DZAA 3AU6A 1VFOA 4BQ4A 3CT7A 4GZ7A 3UU0A 2GOUA 1MMFA 2BBFA 3W29A 2OR2A 2ANUA 1ZAHA 4YYCA 2EKCA 1FDJA 4KGLA 4NNBA 5CZSA 4MMWA 3W24A 4LY4A 2BTMA 5I24A 1VZWA 1CBGA 1VJSA 4XISA 2ISVA 5MKGA 4LS1A 2A3LA 3QPYA 1JZ7A 3W7DA 1BVNP 3UGRA 4ZBCA 3FJ6A 4IUGA 2BOGX 2FH6A 2WW5A 2PDPA 4OECA 4NJHA 1TIMA 2YL8A 3O63A 1JZ3A 2X05A 4YS1A 1TSIA 2J13A 2VP8A 3BOFA 3CTTA 1UQYA 2HDJA 2QIWA 1CLKA 2I16A 1OB0A 1ZU8A 1HJVA 1ZRQA 1GZ1A 3EB4A 5I77A 2QCCA 4DZIA 5LYRA 1SZEA 1NF0A 4LRSA 4B4FA 3VOHA 4Q8WA 2PF0A 3R8GA 4Z2LA 4QX4A 1H1ZA 1UCWA 4MFDA 4ACZB 2QJMA 3AXXA 1XBVA 1EBHA 3UZYA 5TIMA 3C2RA 4IPJA 3IPWA 4FNQA 1HKMA 2CPUA 4NRSA 4MOZA 3O8AA 4RV8A 1J6OA 3PBUA 3FGCB 1XFBA 4PL2A 4GE8A 1B31A 2QV4A 3ID7A 1TJ1A 3SADA 3EB3A 1ZPTA 4XBKA 1YBQB 2GVGA 4NG3A 3OTRA 1QNOA 2NQJA 3VGEA 3W7RA 4N42A 5CPQA 4TOQA 3WMBA 1HJXA 2CBVA 3E3HA 4D6CA 4TV5A 1J2BA 3HPXA 2HS6A 5J5DA 1S5VA 4OOZA 1E72M 1EYWA 6XIAA 4C65A 4KCTA 3N2TA 4AHOA 1OX5A 3MHUA 1WX0A 2WJEA 2DZUA 3GXNA 1FWDC 1E4NA 1OFEA 4K36A 3Q45A 3APYA 4I5XA 2ZUMA 1TV2A 3ZR4A 2ZZ5A 4JIRA 1R46A 5B80A 4UTTC 5C2GA 1IT0A 5IBXC 3AJ7A 3N29A 1PKNA 3QHOA 3Q58A 4X0NA 3R13A 4FO4A 1VBHA 4PUEA 1F07A 3TCSA 5C7VA 3N4FA 3A5VA 1VPQA 3CQIA 3KS6A 5K4ZA 4CEUC 3IGHX 2V3GA 3GHRA 3BAJA 1XLMA 3ZR5A 5CBBA 2GUYA 2YCEA 4OIFA 4L6DA 1H3GA 1L8PA 3QMRA 3WL0A 2CBIA 3TNBA 3W1XA 3AHYA 2VL4A 2QCDA 4DYKA 1WDDA 3NL2A 2QCGA 4C6JA 4IMGA 3LCXA 2V68A 3F4DA 2D73A 1CB2A 3VTRA 4ATLA 3W7IA 4GXPA 4KWUA 2Y89A 4LRTA 5LA1A 3NR0A 4O19A 4S2BA 3CHVA 1V3LA 2ZX5A 1HTIA 1X39A 1JDCA 2E0PA 4ADSA 1YXCA 3LQLA 4XZNX 3GIQA 1XUZA 4KRUA 2A3AA 2YJQA 1KRAC 5E93A 3G1DA 3ZJKA 1KW1A 4ZODA 3ZVIA 4E0CA 2FGZA 1ECQA 1EZWA 1V7AA 2BV9A 4FOKA 3H2NA 2GK1B 1LRQA 1EL3A 4AHQA 2ALRA 1BLIA 3CWNA 1YHTA 5AKQA 4JYDA 4DWSC 5HWNA 3SCSA 7REQB 3GIYA 1NDZA 4GO8A 3ZR6A 3L4YA 2VI0A 1A5BA 2VOMA 3IAPA 5LNRA 2IPGA 1KR1A 5JH1A 3TC7A 4E8GA 4S3BA 1JCMP 3W1NA 1F3EA 1J0KA 3HGOA 1N7KA 1CW2A 3WBYA 1VHCA 2FZ9A 1VD6A 3PZMA 1IWPA 3GBDA 3M1ZA 4GGBA 3RK8A 4H9VA 2OQLA 3MW7A 4DUOA 3VZYA 2Y88A 2FGBA 5E0FA 4ZL1A 3U5UA 3S2CA 1Z3NA 1AL7A 2B7QA 1RALA 3BH4A 4NNAA 4OTKA 4JTCA 2WJZA 3FVDA 3RM8A 3O06A 2OVLA 4HJWA 5C7HA 5GNYA 1T8QA 4ZSTA 4V33A 2PDNA 5BMXA 1GHRA 3SO7A 1F3WA 1S5NA 1KGUA 4GCAA 3WNNA 2PI6A 4RZ5A 2BMBA 3QLDA 1KFCA 1B57A 1FCQA 1KO0A 1QNVA 1ENUA 2YLLA 1K8XA 3AHXA 2A7PA 3EX6A 4QBXA 1X6NA 1Q13A 4D6EA 1XW8A 3DBNA 4LTSA 1V7YA 4CNPA 2ZKMX 4QJ3B 3EDFA 3UZZA 3LGEA 1UJQA 1GKRA 3EOUA 4L5ZA 3C0SA 3XINA 4V2XA 2PDKA 1LWHA 2PRLA 3DU0A 1EGVA 1W5QA 2YYUA 4B3KA 4IUOA 3N6JA 4REQB 3SIMA 3MSYA 1A80A 3MVIA 3SRFA 5E1QA 3ZMRA 2AGTA 5EBAA 3R12A 2E09A 1XS2A 3WH5A 3T81A 1QW8A 1F5ZA 2PDJA 1VIZA 4HA3A 3WY1A 1G4PA 2J25A 2YZRA 4DM1A 3CU2A 5G2WA 4N4QA 4IFRA 2EPLX 1PS9A 1UJPA 3DG6A 2FKPA 1GORA 4XKYB 2X09A 2V5BA 1W3TA 4JOMA 1I9CB 4TUFA 4TU1A 1LCOA 1ZHAA 4BQ2A 4UOQA 1QWGA 3UR7A 4D9PA 1JZ5A 2BGQA 4DNMA 1JCNA 4LS2A 2C15A 5I79A 2HBXA 2A5HA 4AD1A 4GKLA 1TJPA 1JI2A 3UF9A 3AS3A 4GX9A 2WXDM 5AYYA 4NZ4A 3P80A 3W4RA 4ADUA 4XWUA 3MB9A 2HVNA 2XPKA 1AW5A 3NPWA 3VE9A 2CETA 3CNYA 3EDKA 2JEQA 2PLMA 2VVNA 1B90A 3UEQA 1PIFA 2FVLA 3GTNA 1LQ2A 1WO2A 3CUJA 5G4EA 1XLFA 4A2RA 4W7UA 5CLTA 1SJDA 3VINA 2CESA 1EJ7L 4S3DA 5EU9A 5AVHA 4PUUA 1VKFA 5D30A 3LZ5A 1QOPA 4S3CA 2QDEA 2QAFA 1R87A 1EYEA 1UB3A 3MSGA 1KRCC 4MF4A 1XCXA 3L66A 3P6LA 2PP1A 3DIPA 1U22A 4PTWA 1TPDA 2VT0A 4QQ3A 2R91A 2Q71A 3AIQA 3BAWA 3W02A 1TWDA 5G2HA 1BWVA 1XI3A 3S2LA 1SZFA 3CH0A 1N55A 2O7QA 1XIHA 1GKPA 4AF0B 2Q01A 1VENA 4YHEA 4XZIA 1J0JA 3FEQA 3M7SA 3URQA 1P0KA 4NQ1A 1JCYA 5A94A 3AC0A 5DBTA 4GY0A 3THDA 4DY1A 4R85A 2X0HA 3NDZA 2XGIA 3M0IA 3W1TA 5KZMA 4O0QA 2DU2A 5HR7A 4N02A 4RZ6A 2FQIA