4LC8A

Crystal structure of the mutant h128n of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
222
structure length
222
Chain Sequence
DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSNPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of the mutant H128N of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with the inhibitor BMP
rcsb
source organism Methanothermobacter thermautotrophicus
total genus 84
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4lc8A00
1FCQA 4ADSA 3HG3A 3CC1A 4K36A 4C1LA 4M19A 1TTIA 3T4CA 2GQ8A 1QR7A 2V82A 3MYPA 3OVRA 1LOLA 1TPEA 4WXYA 4Y9AA 4GWEA 4I9AA 5DY2A 1SO3A 3M7WA 3G1HA 5DBUA 4RJEA 1SUXA 4OWGA 3NPUA 4FX7A 1KM6A 1N7KA 4JTJA 1WQ5A 2FLIA 1UUOA 4BR1A 1LDCA 1KFLA 4TX9A 1D9EA 1G4EA 2HS8A 4TMBA 1K02A 1OX4A 1LRQA 3SECA 4LTSA 3O8AA 2G96A 3OEXA 3GNNA 4RLIA 3S9YA 4ADUA 5D02A 2A7RA 1Q6OA 3MP4A 1B4KA 2C1HA 2ZRVA 2BWGA 2EHHA 2CZDA 4WOQA 3IIXA 4NXSA 1I2QA 4IPIA 4OBTA 5CZSA 2QAPA 5L6UA 1XBVA 1OHLA 3NXFA 3W1TA 3W3OA 3S1WA 1BWKA 3MBDA 3GX9A 3ATZA 5I3IA 1YPFA 3FA5A 1T0OA 3WK0A 3KOFA 5EA9A 3YPIA 4G1KA 3A5VA 3T55A 4FEZA 2ABAA 2X1SA 1B9BA 3W1XA 1IGSA 4UTKA 4OHQA 3NQMA 3P8JA 4NVTA 5G5IA 1SU5A 4AHOA 3L0NA 3LTSA 4JTSA 2NV1A 3VE9A 2A6LA 1VGAA 3S6DA 2J9XA 2ZRUA 4JS3A 2W0UA 4QAIA 3UWYA 3PUDA 2FB2A 1FDYA 5IBXC 3GR7A 4KWWA 4YCPA 1JUBA 1FWWA 1MEWA 2QCCA 4O8RA 2CZ5A 4DO6A 1W8SA 5KMYA 4LRSA 3O05A 5BMWA 2E5BA 1LRTA 4ZL1A 3M5XA 2QF7A 3STGA 1W5MA 1DOSA 4JXCA 3UY7A 4O10A 4O16A 2NLIA 3STCA 1XI3A 3GXTA 4H3DA 1VYRA 2BXVA 2CWNA 3P7YA 5IM51 2F7FA 1M7OA 1IXNA 2E1DA 2H8ZA 3PF3A 4JTKA 1TPVA 1KTBA 3P5ZA 3RK8A 4H6KA 1M5WA 4IXHA 3MYOA 1J5TA 1F6KA 5D2VA 4LUIA 1GG0A 4WUIA 4O54A 3BLEA 1L9WA 3FLUA 2B7OA 3QPZA 3W7QA 1LCOA 2ZA2A 3AO0A 1LBLA 4N9BA 5FEPA 1DBTA 3G0XA 3EWYA 4K7VA 3UZJA 4JTGA 4NX0A 2WNNA 3QZEA 4MY1A 2X30A 5E1QA 1M7PA 4NU7A 1WV2A 4RK8A 5HR6A 3N2XA 2LLEA 1KM5A 3C52A 1OYBA 4HKPA 4Z1BA 1PCKA 4PEKA 1NAL1 3FFSA 4LNYA 2C0AA 1YDNA 2G95A 3W6YA 3PUOA 3C8FA 4NJIA 1RZMA 3TAOA 3BG9A 1W0MA 2NWSA 1TJPA 3NM1A 2GOUA 3W2KA 5HJLA 3G1FA 3N9RA 2DZTA 3NPWA 5HQEA 4LUJA 3PBYA 3W7RA 1EIXA 2G97A 3BK0A 2EF9A 3W1PA 1KM1A 1Q6RA 2EAWA 3WJSA 4NZFA 1GOXA 5LHFA 1ZHAA 3O06A 3U2OA 1VCGA 3C2OA 2Y7FA 4HPXA 4Y8FA 3MHGA 3BPWA 3FYOA 4O52A 1AW5A 3MWAA 3DFQA 4AAJA 3ABSA 3CTLA 4YL2A 3M5YA 1OYCA 5CSRA 3CPRA 1OVDA 4GNJA 4JDYA 5AB3A 1EWEA 1RV8A 2RDWA 2CLIA 3TSMA 2Z0IA 2ZFAA 4HIBA 4UTHA 1OFAA 3PC0A 3JR2A 3QSTA 3W22A 3N2MA 4UFKA 1TYGA 3HQ1A 1XBYA 3C4UA 4O12A 3M1ZA 8TIMA 3FJLA 3TW7A 4B5NA 3TDFA 2XFWA 1H7WA 3KX6A 1YDVA 4PODA 2ZDRA 5CPNA 1EP2A 1FWRA 3I7RA 3L65A 4MYXA 1FDZA 1ICQA 3C56A 3VKJA 3W2JA 5AC6A 5D30A 3C6CA 2TPSA 4FX8A 3KHJA 4JY9A 4HSOA 2WPBA 3P81A 3UYCA 3WJWA 3M44A 1L6SA 2ZRZA 2Y61A 3RNDA 4WD0A 2CZEA 3HPSA 3DHFA 1VQTA 4MIMA 4UNLA 3PBWA 5IBXA 3SJ3A 2PRHA 5FF2A 2Y62A 3F4NA 1WBJA 4UMCA 5L9FA 2GVLA 1MEHA 3OBKA 2QJGA 3C2FA 3R89A 3M6YA 1VPXA 1LROA 3LOTA 4PCFA 1H1YA 4O4VA 3SW6A 4JTIA 3LCLA 1K7XA 1XKYA 3UY8A 1D3GA 3A21A 3EX1A 3LXBA 4Z0JA 2QUVA 4QSHA 3NQCA 4OE7A 3FOKA 3LTYA 4S2BA 3WFAA 4CCCA 3TK7A 5D2XA 1EPXA 1H60A 3LHYA 3S1VA 3PB2A 3UXDA 1KLYA 2E5CA 3NR0A 1HG3A 4PC8A 3NQ2A 1FBAA 1T8XA 1PL9A 3W74A 2ZTJA 4JX6A 4OT7A 3UD6A 1LBMA 1F05A 2Y7DA 2VFIA 1LOSA 2B7PA 1X1OA 2YYTA 1TPUA 4Q4KA 1KM4A 5CZJA 3BVJA 1XUZA 2AAMA 3E0IA 3LRMA 5F4SA 2ISSA 1SFLA 2FQIA 5H91A 3BW2A 1RD5A 3PAJA 1WOBA 4Y90A 5FEZA 4NJJA 4K37A 1XXXA 3SSJA 2P0OA 2OZ0A 2Z2UA 1C9DA 4N4PA 3B0VC 1OJXA 5AC8A 4HT3A 5HNRA 3T44A 1JCJA 5I3JA 1GJPA 3TV8A 5KTLA 2VXNA 5KZMA 1KFJA 1OYAA 3RU6A 1QPOA 2QUTA 1QPQA 3I7QA 4DQWA 2CLLA 2ZZ5A 2BSLA 3LXCA 1CW2A 3EX4A 1JVNA 2J88A 3HMJG 3OVQA 3W76A 3N14A 4NJGA 1AL8A 4HNTA 3NA8A 2ISVA 2DZWA 2VENA 4LV9A 4ORIA 1W1ZA 3DFOA 4MFDA 3GVGA 3M5ZA 3G1AA 3V75A 1LRNA 2Z6JA 4MVAA 1JQVA 5LGZA 1LP6A 2E77A 1FY6A 3GDKA 3WK3A 3IGXA 4GUGA 5C54A 2JGYA 5K9DA 1JCNA 1Q45A 4MLRA 2PRMA 3FYPA 5D04C 4OQVA 3PY2A 1YDOA 3GAYA 2A0NA 5I3GA 3QM3A 1AK5A 1U5JA 3IV3A 2WSYA 3EKZA 6TIMA 4L4LA 5I3HA 1R46A 3LLDA 3SZ8A 4UMAA 3E9AA 3P67A 3LHUA 4U4MA 1YTEA 1XC4A 2B7NA 3S1UA 3NZRA 2QCMA 1PE1A 3RLUA 1TMHA 1GWJA 4WX2A 1K7EA 4S2CA 4QNWA 3QMRA 5FF0A 4K8HA 4LRTA 1JRBA 1SZGA 1V7YA 4X3ZA 4TMCA 3NQ6A 4K7YA 3NOEA 3BW3A 3NPVA 2XN0A 4UTWC 3ABQA 3CHVA 3TW6A 5AOUA 2TYSA 1ML1A 2H3BA 2BX7A 1I45A 4XWUA 5DCBA 1LLZA 2O7SA 4CCDA 3S0CA 4AWUA 4O1BA 3QJAA 1R2SA 3BO9A 3W1LA 3S42A 1WAUA 3FIGA 5D2YA 1XBXA 1GVRA 3HB9A 4O19A 5KITA 3KVKA 3L5MA 3G8EA 2ZBTA 2EGZA 3TJLA 2V2CA 4BWLC 4S1FA 1YXCA 1VCVA 2ATSA 2B7QA 5CSSA 3IIOA 4U28A 1TCDA 3T40A 3SR7A 4GJ1A 3C0JA 2DZUA 3TAKA 3S8HA 3NQFA 2D73A 2F84A 2VEPA 4XUGA 2DZPA 3G1YA 1H7OA 3BGGA 3LI0A 2J9YA 2ZRXA 4FIQA 1GVOA 1QO2A 3VCRA 1GEQA 4MOZA 1H7XA 4KFPA 5CKSA 4YXGA 3RLVA 3LM7A 3O6DA 1VRDA 3GZ3A 1SO6A 1ONRA 3LHZA 1K3UA 4CQ8A 3M47A 3UQNA 5EPDA 2VELA 4M5PA 4LS1A 4HN4A 5E93A 5TQLA 1NEYA 1W5QA 5CZTA 1BWLA 2DZSA 1KM0A 4M7SA 3GIYA 4DO4A 3KXQA 1H50A 4WZHA 4BFAA 3LCIA 3AJXA 4O14A 3WK2A 4IMFA 2WJZA 1UASA 5F2GA 1RR2A 1XDMA 3W70A 4JEQA 1DQWA 1S5TA 1B3OA 1SW3A 5A8GA 4JYDA 2CFFA 1JCLA 5BW6A 3LCXA 2A6NA 2NUYA 3M0ZA 4R53A 4A2SA 4ADTA 4UR8A 4ZQNA 4GUIA 4JN6A 1W56A 1G4TA 3P62A 2Y89A 3ZWSA 2C13A 1OFQA 3GXNA 2FTPA 5EKYA 3NPXA 3TNOA 3LRKA 3CLMA 3E96A 3GAKA 3W9ZA 2E6DA 4DPQA 1F6PA 1HL2A 3W2MA 1A53A 3EEGA 4WJEA 1UUMA 1QDSA 3B0UX 3P82A 3QSRA 4NXKA 4C1KA 5CG7A 4LVFA 3PBUA 2X2GA 1NF0A 3UZ5A 5G2WA 3DFSA 4TR9A 2QCFA 4FNTA 3NGJA 3S1XA 1AW1A 3L68A 4LVBA 4UC5A 3TROA 3T78A 3W7LA 2YCEA 4ICNA 3PUEA 4JX4A 2A21A 3G1SA 3NG3A 4LT9A 1DL3A 2YZRA 2QUUA 5K9XA 4N9EA 2VFHA 3N19B 4WY0A 5G2HA 4UTMA 1O5XA 3KVMA 3DHDA 4N6EA 3A24A 2YFNA 5HUPA 2V81A 4Z0SA 5CZ0A 5FF3A 3QW3A 2Y7EA 4UTWA 2HTMA 2YGYA 1LTDA 2YW4A 1L6WA 1TPWA 4EVZA 2TRSA 5HUOA 1QNVA 5CPLA 1I4NA 1QOQA 1TPC1 4O4WA 5K9CA 3DKJA 3S5YA 5D2TA 1KLZA 3W23A 4AXKA 1G7UA 1QO5A 2JBMA 3DU0A 2GUUA 4ZQMA 5ABTA 4N4QA 1TPB1 1AW2A 4JTEA 3EWXA 2VOMA 3STFA 1NVMA 4JIQA 4BI5A 3R2GA 1S5WA 4O50A 4BWLA 1SSDA 3NAVA 1GQNA 3D0CA 3GLCA 4UUIA 2YW3A 3UNDA 3UWQA 2YFOA 4MPQA 3TCEA 3QMSA 3G18A 3PG8A 4PH6A 1NF7A 2V8ZA 1TTQA 2JKEA 1TO3A 1LM1A 4CQAA 3TSDA 4JTLA 3RF9A 3W7DA 1FCUA 4HSNA 5C6MA 1LZOA 4O57A 4UTUA 3TKFA 2A1YA 3NL6A 3O6CA 1HFBA 1TIMA 1A5BA 3L5AA 2X1RA 1DJQA 3GYEA 1TRIA 4ZQOA 2C6QA 4BI6A 3M16A 3DFTA 3W7JA 3NNTA 3NQ8A 5T26A 3KVLA 3H55A 4Q33A 3ZWTA 2RKXA 1YXDA 3NQDA 4K38A 5TBOA 4JTHA 3H53A 4N2YA 3IGSA 5D09A 1GPWA 4GC4A 3L2IA 3NQEA 3LERA 3O15A 5G2IA 3WJZA 4FO4A 1FCVA 3WJXA 1ZAJA 3TE9A 5K4ZA 3EWWA 5FEWA 3ANYA 4O15A 3LTPA 4DBEA 3QYQA 4E38A 1B57A 4I7VA 1JQXA 1K7FA 2CLMA 3HG2A 5DCEA 3UWVA 1JUEA 4Z08A 2TSYA 4MJZA 1QMLA 3GKAA 3LV6A 4UFMA 1C29A 1F74A 1ME8A 4MY9A 3W7EA 3NM3A 5FEXA 4AHQA 3HG5A 1SW0A 3KRUA 1XCFA 4OGZA 2NX9A 3HIJA 4RCXA 5K3VA 3NQGA 5LNVA 2OCZA 3MP3A 3JRKA 1X7FA 3HJZA 2FDSA 2V9DA 4YMZA 1MXSA 5G1YA 1FWSA 4MZYA 4GFSA 1Y0EA 3QMTA 5AFDA 3KVJA 4DPPA 1OFPA 2V2HA 4WOZA 3O63A 5BMXA 1TPDA 1L6YA 3QEZA 4WXZA 3Q2DA 4IWWA 1THFD 1ZFJA 2QEZA 2E68A 2HS6A 4A29A 4FHAA 2FPTA 3SFKA 2C15A 1KTCA 2ZZ1A 3R12A 5AYXA 3HO8A 2V0TA 2JKPA 3CM4A 1X6UA 3W2LA 5AYZA 5F4XA 4NNAA 3B8DA 1KA9F 5TIMA 5HWMA 4HPJA 6ALDA 4E0CA 4XTDA 3P84A 4NQ1A 3VE7A 1KFKA 3HOJA 4LVAA 1XM3A 4X9SA 3W7NA 4AHPA 3O16A 4M7TA 3O07A 4RZ6A 5LKYA 1WBHA 3S5ZA 2A5HA 1J4EA 3JS3A 4MUZA 1Q3NA 1CX9A 4W9TA 2DORA 4Z1DA 3G3DA 4DEFA 2PE4A 1TTPA 3W7CA 2AGKA 1Q6QA 3BV4A 3OG3A 2E6FA 5D32A 5DXYA 1F7BA 3WJYA 5K7JA 4AH7A 4FNPA 1R30A 5CPMA 3R8RA 1W31A 3S5OA 2DU2A 2FJKA 1H1ZA 1PCWA 4N9DA 3TIMA 4JX5A 5D38A 2NXGA 3L5LA 1VHNA 4IMGA 5F2IA 2NV2A 4QJ1A 3W2NA 4IPJA 1SR9A 4EF8A 4IOTA 1YLVA 3P74A 4UMBA 1S3HA 3TJXA 3GDTA 5GVJA 1Z42A 3EWUA 1GTHA 2VFGA 5A5WA 3MJYA 1TV8A 2A2IA 4KFNA 1TPH1 2ZA3A 1OF8A 1P1XA 4N9CA 4L4MA 2TMDA 4NNBA 1QWGA 3BG3A 4LS2A 3C2VA 1LYXA 4CNNA 1JULA 3CQ0A 4GUHA 3UWWA 1OABA 2FIQA 4LWWA 1QPNA 3G1DA 4O0ZA 4JYFA 4YWIA 1H61A 2C19A 3PB0A 3OIXA 3DBPA 4XQ6A 3B03A 3TQVA 3L66A 3LCFA 1EX5A 3V1PA 3MBFA 3DFNA 2I14A 1P4CA 2RDUA 2Q8ZA 2NUWA 4DBDA 5BOOA 3TFXA 3PG9A 1N55A 3TXVA 1QPRA 1EA0A 3GK0A 3QPYA 4FNUA 4LOCA 3GDRA 3WK1A 3G8RA 2QAFA 1FDJA 1KTNA 4PFMA 3DI0A 1JRCA 2YPIA 1GVQA 3C3NA 3K30A 1SZEA 1TB3A 1QFEA 3PS7A 5FF4A 3LCGA 5DN1A 1JJKA 1OK6A 1ZNNA 3PM6A 4UFIA 4XTIA 3M9YA 3I68A 3BGJA 1DJNA 3BLFA 5HMSA 3M41A 3W7KA 1F5ZA 4I7UA 1OX4B 2IQTA 3LHVA 1ICSA 4OV4A 1L2UA 1TRDA 1PV8A 1ZY9A 2NX3A 1K8ZA 4CCEA 2ZRYA 4JTTA 3W75A 2ZQ0A 1EWDA 4O0KA 2DJXA 3C61A 3DZ1A 1YXYA 1K8YA 3Q94A 4NNCA 2I9EA 1TV5A 3MI2A 4XBKA 1YTDA 3W7GA 3N73A 2FB3A 3TMLA 3NYZA 1TREA 4XKYA 1MEIA 2WQPA 4TIMA 2VKZG 1FUYA 1SW7A 4CNOA 3GB6A 2OT0A 3W7MA 4JNMA 1JCMP 3E49A 1UBSA 2VEKA 4NJKA 3U6WA 3B04A 3IIZA 3CWOX 2R94A 3LRLA 2QKFA 3G0UA 1TPFA 1A50A 4GE8A 5CPOA 1W37A 4TU1A 4LV4A 2AQWA 1TSIA 4K39A 1T99A 3OA3A 4RXGA 1Z41A 4E2DA 3CU2A 4JR5A 1H5YA 3CWNA 4E2BA 3F1QA 4CQ9A 2E6YA 3MUXA 1RQBA 1KW1A 1OFRA 3LCWA 4LW7A 1TQXA 3PSVA 1LORA 5G4EA 1R2TA 4WY0B 1TTJA 1F2JA 1U83A 1PHWA 3LHWA 3W7HA 1KV8A 3O6YX 3LXAA 1W3TA 4HHPA 1EB3A 4X22A 3PULA 3W1NA 3ZS4A 1W5OA 2VC6A 3O1NA 4RR4A 3EXSA 3DENA 1P0KA 3TXZA 5LGXA 3KRSA 3A5FA 3TC6A 4MJMA 2CU0A 5BNKA 4RZ4A 2ISWA 2ZZ7A 5C2XA 3IIVA 4GBUA 4UFJA 4JTFA 2QDHA 1HTIA 2X1UA 4PA8A 4HNUA 1C8VA 1WXJA 5AHNA 2NX1A 2VFEA 1JCXA 4RX0A 3EX6A 2W79A 2E09A 3HF3A 3W7OA 4LC8A 1S5VA 3A22A 4XBSA 4ZQRA 1G6CA 1PS9A 3TMQA 4LY8A 1E51A 2Q3RA 2BZNA 4KFOA 1LOQA 1P5BA 2DP3A 1BEUA 1MSSA 3FKRA 4RZ5A 2JK2A 4UIOA 2ZZ6A 3MW7A 2GJNA 3KFTA 4A22A 1HO4A 1X1ZA 3DXIA 1QOPA 2W6RA 4UR7A 3HPXA 1GVSA 2NUXA 1GT8A 4CNPA 2B4GA 1EP3A 4UTTC 5F1VA 3TH6A 1BTMA 1KV5A 3W1AA 5U4NA 5AHMA 2Y6ZA 4TO8A 5BRBA 1IXQA 1ZALA 5LNRA 1YADA 4O53A 4DF2A 2ALDA 4EWND 3GR8A 3FKKA 3GKFA 2FFCA 3UPBA 3FEMA 2YDAA 4LVDA 3Q58A 2A7PA 3C2EA 4PL2A 1KBIA 1RQEA 3G1VA 4NT0A 3IEBA 3G22A 1JR1A 1WOAA 1YTKA 4WQ6A 4QNEA 3F03K 1VZWA 3DI1A 3C2RA 3TQ0A 5LNSA 2H8XA 1N8FA 3A9IA 1W5NA 3ABRA 1O5KA 4EIVA 3GXPA 3W7IA 2ZA1A 3RFAA 1VJIA 2PC4A 3NQAA 4RKAA 2RH9A 1G4PA 3BLIA 3BG5A 2A7NA 2XN2A 1TQJA 3B4UA 2A4AA 3UXAA 1H63A 3EXTA 3VNDA 5DY3A 1FXQA 2HSAA 2QCDA 2QCGA 4AF0A 5F2LA 5AN7A 3USBA 2WV8A 3I6RA 1UB3A 5D2WA 1H62A 3H54A 2R8WA 4ZZ9A 1EUAA 3THAA 1AL7A 4JDBA 3OVPA 4A3UA 2C16A 4M6QA 5DBTA 3P60A 4ALDA 3HGJA 2VEIA 4BF9A 4AEOA 2UV8G 2ABBA 2R14A 3NL5A 1SO4A 2NWRA 1OFEA 3LBMA 2CLFA 2PURA 4JYEA 4LC6A 3GDLA 1RQHA 3IGUA 3THQA 1IIGA 3W1QA 1DKWA 3EWBX 1D3HA 3EX3A 5HR7A 2JGQA 2Y70A 5LNUA 2GPTA 3LBCA 2C3ZA 2Q3OA 3M5VA 1JUKA 1LBFA 1IIHA 1X8FA 3LLFA 3W72A 2PCQA 4UTLA 1G4SA 1OFOA 1XUUA 2J27A 1AG1O 2GQ9A 2GJLA 2I1OA 1H51A 3P61A 1A5CA 2OT1A 1MZHA 3QQ1A 4IUOA 1XL9A 1A5SA 1GG1A 3DGRA 3LX9A 1XFBA 1XDLA 2WO5A 2ZZ3A 4N6FA 3S5NA 4AVFA 1VLIA 4O28A 5EYWA 2V30A 2FPYA 1FWTA 3Q37A 4ZVJA 4ZQCA 1TJRA 1O4UA 1OK4A 2YR1A 4LVGA 1W5PA 4AWSA 1ICPA 3NVTA 1G69A 1SZNA 2DJLA 2X1TA 2R91A 1SO5A 3NL3A 4ORMA 5AHLA 4O17A 3R13A 2C14A 1EEPA 1WDWA 1NFBA 4JD4A 3IVSA 3L0KA 2V5BA 3HPZA 3B0PA 2OJPA 3B05A 1H7NA 2CLOA 3FJ6A 4K8EA 1W54A 3GNDA 4UFHA 3SY5A 2WKJA 4CLMA 4NX5A 3W87A 2X16A 3NO5A 3W73A 4DF0A 3QQ0A 1VC4A 3TFCA 1FWNA 4M6VA 4RXFA 4JY8A 4Y96A 3TA6A 2CLKA 1K03A 3I65A 1VR6A 4O13A 1UCWA 1SFJA 5D03A 4FNRA 4LS0A 1SZFA 5AYYA 5D05A 3SIZA 3VI2A 5HWJA 3TSBA 4IMCA 1ZCOA 3IVUA 3MI6A 1ALDA 2NZLA 4HNNA 1YPIA 3MHUA 3NZ1A 4O1AA 4WY0F 4Z1AA 3TUUA 2XN1A 3LB0A 4JIPA 1FQ0A 2ZZ2A 4GUFA 2B0MA 4UTTA 2VFFA 3LCHA 5LSMA 4J9JA 4UTJA 3KRZA 1SPQA 1R47A 1H7RA 5EY5A 3SI9A 4FB7A 5E0KA 5FESA 1FX6A 2CLHA 3CIXA 2QJHA 5F1UA 1WA3A 1KFEA 3LHTA 4P2VA 1I2NA 5HINA 3UWZA 4X2RA 4KKXA 3TC7A 2OMAA 5EMUA 3BW4A 1H7PA 1VLWA 1DHPA 1V5XA 2QDGA 4DO5A 3QW4B 1OX5A 3W07A 4RV8A 1EP1A 1ME9A 2V5LA 3G24A 3IVTA 3EX2A 2J6XA 2QCEA 2WNZA 4NZJA 3LV5A 1VYSX 2YX0A 3HGOA 4AMAA 3QF0A 1VHCA 4IGHA 5J5RA 2CZFA 3ZR4A 3HG4A 4QM1A 1IF2A 3ZFHA 3W83A 4GRSA 4AWTA 3UWUA 5I3KA 5FI8A 3PBVA 4LU0A 4QIUA 1ZAHA 1ZJIA 5G1TA 2QCNA 2ZZ4A 3W1MA 3I7SA 3NL2A 3MMTA 4UCGA 4MYAA 1VH7A 1G67A 2E6AA 3QFEA 2WNQA 2DZVA 1SSGA 1O94A 1T96A 1AMKA 5K4XA 2VFDA 5LHEA 1RVGA 4DXVA 1KM2A 1R2RA 4FNSA 1HO1A 3A23A 2GVGA 1B4EA 5H2ZA 5U7SA 1OF6A 4XKYB 2E5DA 1ZENA 2GVJA 3QC3A 3W1UA 5DXXA 4R33A 4EOUA 3QRHA 3VFLA 3OHIA 2VEMA 4DELA 4UFLA 3CIWA 4JGDA 4MKNA 3LGEA 3W1RA 2V2DA 4QQ3A 4O18A 1W3IA 5AHFA 2EKCA 1GYLA 1A5AA 2RDTA 3W86A 1F73A 4UTIA 2RFGA 5AHIA 2ZCGA 3NDOA 1LLWA 3NEVA 2J9ZA 3W2UA 2QCLA 5G4WA 3SGUA 3EKLA 4FF7A 3DKLA 4IJBA 2KZHA 3EB2A 2ZYFA 3QH2A 4BK9A 1F76A 1W3NA 3R5EA 3TQKA 2BTMA 3KAOA 1KM3A 5EL1A 4FNQA 5DCDA 4IMEA 4BI7A 2Y88A 4K6AA 5FF7A 4NJHA 2Z1BA 5F4WA 4UXDA 1NSJA 1ADOA 3EWZA 1BKSA 3E12A 4UNKA 3MO7A 4I7WA 4KWVA 4Z1CA 1Z44A 3ABOA 3TR2A 4POCA 3ATYA 3INPA 1GZGA 4QISA 3DFPA 4O1DA 2DZXA 1DQXA 3NQVA 1VS1A 2H3DA 2HMCA 4O11A 5CGQA 5LNWA 2QR6A 4NUWA 4JICA 3GDMA 3HGSA 2OX1A 3IRDA 2P1FA 3TU9A 5DLCA 1Z48A 4IX0A 4EF9A 1WX0A 1FCBA 1ME7A 2YSWA 1IXOA 1DV7A 1PHQA 1JCYA 3W84A 2YXGA 3L9CA 1IXPA 3T7VA 5MHBA 1XBZA 1CI1A 4GXMA 1OFBA 3DAQA 7TIMA 4FX6M 5I3FA 1Q6LA 1SQ7A 1I2PA 2H6RA 4IQLA 5DELA 3U8GA 2ZRWA 4JTUA 2RHGA 1O95A 1GTEA 1TV7A 1J2WA 4FXRA 4XZ9A 3EXRA 1OFDA 4MZ1A 5HULA 3M43A 2NXIA 2Y63A 3FS2A 4M6PA 1DVJA 4R34A 5KSWA 5C55A 2YYUA 3LDVA 4FIRA 5SWUA 2GQAA 3P5YA 3LI1A 2J24A 4Q32A 5KZEA 5AHEA 3W7PA 5K2ZA 4ZQPA 4DF1A 5KZDA 3N9SA 1RPXA 3IIPA 5D37A 3B06A 2Z6IA 3HGRA 4MFEA 3E02A 1O60A 3W71A 3UPWA 2O7QA 1M6JA 2G5WA 2Y7GA 1VYPX 1QAPA 2QJIA 1YYAA 3W85A 3CEUA 4MY8A 2QCDB 1KFCA 4AF0B 4IMDA 2ATMA 2CW6A 5F2MA 3CB8A 3P80A 2QCHA 2ZTKA 3PVFA 3STEA 5C5YA 2PRLA 4QITA 1VCFA 1ZAIA 5KINA 3N3MA 5HWNA 4OV9A 1QCWA 1MO0A 2WSQA 3F4WA 4R7JA 3DH7A 2JKAA 2C18A 3BARA 4PL1A 4YLWA 2WSRA 5EBUA 3MHFA 4MLJA 3L67A 5LZLA 1P0NA 4PTNA 1HUVA 3ELFA 1DORA 3TX9A 4YCOA 3N34A 5AC7A 1I8JA 1GYNA 2NXHA 4ZMGA 2FPVA 3P8IA 4IX2A 1I2OA 4ML9A 3MP5A 2CLEA 1KBJA 2H90A 4P61A 2P10A 3L0GA 3MI3A 5D33A 3SGZA 4MZ8A 3L21A 3HBLA 1OG0A 4O1CA 1G7VA 4Y6GA 1WYIA 4IXXA 1KFBA 1GVFA 3NQ7A 4OU1A 3PSWA 4H4IA 3RMJA 4A2RA 4GUJA 3PR2A 1PIIA 1UJPA 3G0SA 3G3MA 1I2RA 3CT7A 3CEPA 3PWAA 2A85A 2Q8LA 4HNVA 4D2JA 2Y85A 4FXSA 2BLEA 4AB4A 2EPHA 2WOQA 1OX6A 1PVNA 3G1XA 4N02A 1EUNA 1FXPA 4ONVA 3W88A 1K8XA 5J5DA 4A21A
chains in the Genus database with same CATH superfamily
3VIGA 3KM8A 5IDIA 4HHLA 4DUOA 4ADSA 2YCLB 4M19A 3T4CA 3TVAA 2GQ8A 1XISA 2PZNA 4IICA 4D8LA 1JGMA 1DJIA 4FOJA 1SJCA 4O8AA 3ZM8A 5C8BB 4HOXA 4F0KA 1M03A 1M9HA 4K1WA 1EJ7L 1TE6A 2OVLA 4RJEA 4J3XA 1SUXA 1XSKA 4FX7A 4JTJA 1WQ5A 4QXIA 2W67A 1TG7A 2IW0A 3ZXWA 3SECA 5C70A 5B7ZA 4XV0A 2UZ9A 1R3SA 1B30A 3R6IA 3ECQA 4JTAA 3PPFA 4ADUA 4EXBA 3AU6A 3U9IA 4ZOAA 2J79A 1IR1A 1Q6OA 3MP4A 1B4KA 3AHXA 2P50A 4NXSA 1I2QA 4IPIA 1X1NA 2QAPA 4WEVX 2E40A 1MQPA 1OHLA 2G3MA 4EWJA 5A6BA 7REQB 1UR3M 3LYEA 1BWKA 1L6GA 3AALA 3ATZA 2YJQA 1YPFA 3FA5A 1VBRA 3WD0A 3WK0A 5EA9A 4HBKA 5E0FA 4AZCA 2Q71A 3NZPA 3APYA 1B9BA 3RLGA 1NM9A 1PKLA 3W1XA 4OHQA 2OLSA 1G0CA 1UD8A 2WK2A 3KCJA 4GI8A 7CGTA 2V68A 3H2AA 3VD9A 4WKAA 3MUZ1 4ZSTA 2A6LA 1VGAA 3S6DA 2J9XA 3CAWA 2W0UA 1XQLA 4GFIA 3UWYA 4W84A 1JUBA 2XUCA 3BOXA 3AS0A 1NY1A 2J7GA 1UR2A 4ZFMA 4LB3A 4B5XA 1UC4A 4LRSA 4P7OA 2I7GA 5BOEA 1QBBA 1DOSA 2O9RA 4REQB 3DN5A 2BXVA 1S2AA 3ZLFA 1WZLA 1AZ2A 2H8ZA 1E9LA 1TPVA 1KTBA 3T2QA 1S5MA 3EAUA 3RK8A 4HYVA 3ZJ8A 5CC7A 2XU2A 1VFMA 1J5TA 1F6KA 1GG0A 3BLEA 3FLUA 1O66A 2B7OA 3QPZA 3CB3A 3W7QA 5FEPA 4X63A 4K7VA 3EWYA 1AH3A 3UZJA 4JTGA 3ITOA 1NWUA 4MY1A 2VQUA 2PC8A 3BLKA 4NU7A 2OELA 1KM5A 1OYBA 5CQ1A 4I5UA 4PEKA 3MDWA 4ZA0A 3BTNA 1CLVA 5A6BD 2GDVA 3WNNA 3W6YA 1J5SA 4NJIA 3TQPA 3BG9A 3KCOA 4XIAA 3W2KA 1XSIA 4W8AA 3G1FA 1C8YA 1CTNA 3W7RA 3UCDA 2I9UA 2HVOA 2EF9A 3W1PA 1KM1A 4GQQA 1FH8A 3G77A 5LHFA 1ZHAA 3OQEA 3L2MA 2B31A 2AL2A 1W6TA 4DBUA 3DCPA 3HQNA 4Y8FA 1V51A 2WMIB 3CAKA 4LF2A 4G7EA 4O52A 1AW5A 3DFQA 4GQBA 3H2NA 3S46A 3E5PA 5GNZA 1GOOA 1OVDA 3GU9A 1Z9AA 1RV8A 4QRNA 2RDWA 3B97A 3SIMA 1O12A 2CLIA 3WG6A 1GOMA 1Z89A 4IIDA 3N2MA 2PDQA 1EBGA 3BE7A 3C4UA 3KL3A 3FJLA 1YW1A 3OZMA 3TW7A 3ARVA 4I6VA 1H7WA 3KX6A 4PODA 5CSYA 3I7RA 4MYXA 4GISA 3SY8A 5D30A 5JUVA 1PX4A 3SBFA 4DVOA 4JY9A 5GJMA 4DJFD 1K1DA 2D20A 4GVGA 3V0TA 3DHFA 1VQTA 2GVYA 3CO8A 3CV1A 2VC9A 3F4NA 3IV8A 4UMCA 5ABEA 3EMQA 3QC0A 2F9RA 3R89A 3CASA 1LROA 1H1YA 1OIFA 2XVLA 3NYDA 2X0HA 3VIMA 1XKYA 5FA5A 1D3GA 4Z0JA 3SRDA 2PDYA 2BMBA 4S3GA 4PC8A 3NQ2A 1DHKA 3LY0A 3UD6A 1LBMA 4P8UA 3IACA 4PSRA 4WSKA 4WDXA 1HW6A 1X1OA 3T08A 3ZT7A 1EDQA 1E1EA 3VA8A 3T8LA 1V02E 5F4SA 3N1AA 2OWXA 5DT7A 2FQIA 4US6A 1K70A 5H91A 4KMQA 5CH9A 3T0BA 3PAJA 4K37A 4H1ZA 3S2LA 3QVQA 2Z2UA 2OKOA 4N4PA 4YPJA 3B0VC 1OJXA 4HT3A 1B31A 2J78A 4HU3A 5HNRA 1VPQA 3QHMA 3XINA 2HCVA 4Z2KA 3VNLA 2G4JA 5I77A 1GJPA 3F7JA 3TV8A 5KTLA 1E71M 1KFJA 1OYAA 1QJWA 4ERGA 1QPOA 3CZ8A 2YDSA 3I7QA 4RDWA 4DQWA 4OKDA 2CLLA 3GHTA 1YEYA 2PEVA 1E6NA 3OVQA 3SCOA 3W82A 3NA8A 2X1IA 3L7RA 1FWCC 4Y2WA 2VENA 3UXIA 3KDOA 3A9BA 4I8YA 5H6HA 3JW7A 4LXFA 4ORIA 1NFPA 3GVGA 1NJJA 5TD4A 3B40A 3TN3A 1JQVA 2A3HA 3WK3A 1J11A 4JKKA 4PMNA 1Q7ZA 1FFRA 4GUGA 2QJNA 2ASHA 5K9DA 1JCNA 1UA7A 3ISIX 1EGZA 3FYPA 2NQ5A 3PY2A 1T6MA 3GAYA 3VCNA 1AK5A 3CUJA 5FJTA 2WSYA 3EKZA 2ZVIA 2BHYA 2G3FA 5A8QA 3WBYA 5I3HA 4Q7BA 1DJZA 3LHUA 1YTEA 4NAFB 2QNEA 2J7CA 3P2VA 5CGMA 2B7NA 4US5A 1S1PA 4LGXA 2C8NA 4U5IA 3PZQA 1W9PA 3SCSA 4C6KA 5BRQA 4CNSA 2PWFA 3RLUA 4WX2A 4S2CA 3QMRA 5FF0A 4LRTA 3B8WA 1ISVA 2O9OA 2YB1A 1SZGA 2ZXAA 1V7YA 4X3ZA 4MAZA 3TZFA 1VB9A 3NPVA 4V2XA 2Z1WA 2ZX6A 3OPSA 2TYSA 4PGLA 1V3JA 2XIBA 1I45A 1M7XA 1RCQA 3VDBA 3GIQA 1J01A 3P3BA 4AIUA 3S0CA 1XYMA 4O1BA 3CQHA 3BO9A 3VMPA 3S42A 3FIGA 5D2YA 4Q4MA 3HB9A 1GVYA 3ZVIA 2ZBTA 2V2CA 1WKEA 4EPBC 3R11A 1YXCA 4LEFA 1VCVA 1CB2A 4DWDA 3WQ8A 2FH6A 2WZTA 2J8TA 1XRFA 1RA0A 2XGIA 5FACA 1X38A 4F9JA 3SUWA 3APTA 4XUGA 1L2QA 3VM7A 2Y8VA 1KCXA 4PMJA 1Q6GA 1FHUA 3AHTA 4ZE4A 1H7XA 3WQ5A 4YTTA 2PBGA 3LM7A 2GUBA 4GZEA 5A6AA 1ONRA 3MSRA 4PSPA 3U57A 1K3UA 1P7TA 3W28A 3M47A 2F2HA 2VELA 1WKDA 2OQYA 4H7VA 4HN4A 5E93A 5TQLA 1NEYA 1KCZA 3UG8A 2DZSA 2W61A 1FVPA 1KO0A 4DO4A 3KXQA 4GGBA 3NGFA 2DVTA 4A05A 1X6LA 3AJXA 4A8LA 5AC5A 1RR2A 4BJHA 3W70A 3BZGA 1DQWA 1S5TA 3QKEA 3SRFA 4US5D 3PJTA 1Y5XA 3XISA 1F3TA 2A6NA 3OLDA 4HOZA 3CHEA 4R53A 2X2YA 4A2SA 4ADTA 1XDJA 4UR8A 1JD7A 5CPSA 3P62A 3C3UA 2DT0A 3W26A 2HE5A 3CAVA 3NPXA 4HA0A 3LRKA 2GOKA 3VDHA 1Q65A 2Z2BA 3GE7A 1F8MA 1E3XA 4RPPA 3W6MA 4WDUA 1A53A 1TR1A 3EEGA 4CU6A 3SUTA 1JZ3A 4GQRA 2GJPA 5I7GA 4TVCA 1QDSA 3QSRA 4HGXA 4S3EA 4NXKA 3FGCA 1LG2A 1NF0A 3T9PA 3WUBA 4F4RA 5JBFA 2VT0A 3KW3A 3NGJA 1IEQA 4Q4PA 3EOOA 4LAUA 5A2BA 1UR4A 2CKSA 3GUGA 2YCEA 3FJ4A 2W3ZA 4CEXC 2PDKA 1DJYA 4JX4A 3NG3A 4HB7A 3QBUA 3W00A 3ARXA 3UJSA 4N6EA 4ROPA 1UC5A 3WNMA 5CZ0A 1OGSA 3ENLA 4MMWA 2Y7EA 3ARSA 2RGLA 2TRSA 1I4NA 4KEVA 2VRQA 3TOYA 3DKJA 3S5YA 2DY3A 2PPGA 5D2TA 3HQOA 3W23A 1BXBA 1G7UA 1MQRA 2INEA 1QO5A 2VD9A 4Y9NA 4ZQMA 1UKOA 4N4QA 4HMDA 2HBXA 2OQHA 1UG6A 1WZAA 4PB3A 2HNEA 4AD1A 5BZAA 3DEQA 4BI5A 5LXXA 1NDVA 3USZA 4BWLA 3NAVA 2D69A 2P5NA 4PUWA 1V79A 3GLCA 4UUIA 3LBOA 3ITCA 1KXVA 1OC7A 3ZLGA 3VNIA 4AEFA 3PG8A 4D6FA 1NF7A 2OSWA 2V8ZA 1TO3A 4HQVA 1LM1A 1H4PA 4JTLA 3W7DA 2J7FA 2A1YA 3FXYA 3L5AA 4F66A 4NILA 2CPUA 4EE9A 1DJQA 4ZQOA 2C6QA 1REQA 4OBRA 1UD3A 2OWCA 3H55A 3F4DA 3UG3A 2ESCA 4J4KA 3H53A 1NP2A 5D09A 4JCMA 3NQEA 3LERA 4GXWA 4ZO6A 3O15A 2X09A 3LUTA 3S5SA 1ONWA 3UXKA 3TE9A 5K4ZA 2H9AA 3EWWA 3GZAA 4WIWA 4I7VA 1JQXA 3H7UA 2CLMA 3HG2A 4HNCA 3DERA 3PZTA 1Q6EA 2HK0A 3N3TA 2C1GA 4MJZA 3R43A 1DE5A 3LV6A 3H2MA 2W92A 3NM3A 5FEXA 4XZIA 4K2SA 2IPJA 3W4RA 5AKQA 3AI0A 4RCXA 5AZ0A 3BSGA 3V5CA 2WMJA 3WD3A 2QDDA 1QK2A 4IG2B 3HJZA 4LJ3A 2EKGA 2FDSA 4YMZA 3WFZA 4MZYA 1LWJA 2QPXA 4GFSA 5E9AA 4DWSA 1Y0EA 1KR1A 4ASTA 4GJJA 4YS1A 4H7ZA 1FHLA 3QEZA 3IANA 3WN6A 2E68A 4A29A 2J7HA 3KBVA 3L4YA 2ZZ1A 3S9ZA 3ITGA 4GVFA 1LLOA 5F4XA 2DEPA 3S6TA 1KA9F 4XAZA 3FJNA 3UA3A 3MUAA 4HPJA 4ACYA 3ARQA 4YWSA 5LA2A 3MCOA 5JIPA 4X9SA 4LUYA 2C71A 3EWCA 1NQKA 5LKYA 4B5SA 3NVDA 2A5HA 4DIAA 2VCBA 1EC8A 3ONCA 1Q3NA 4MUZA 1T7LA 2VRKA 2QJMA 3RO6A 1CX9A 2OOGA 2DORA 1HX0A 1PYFA 2XFFA 1V93A 3G3DA 1W3HA 4DY1A 1CYGA 3I6TA 2AGKA 3CNYA 2E6FA 3ZMRA 5DXYA 1WKFA 4C7GA 4FALA 1DIDA 5K7JA 3VIHA 5HA7A 3MT1A 3L2LA 2QIIA 3TR9A 1W31A 2DU2A 3TIMA 4UTFA 4MNJA 4JX5A 1Z32X 3QV6A 1V3MA 2NV2A 5BCAA 3CMGA 4DJEA 1SR9A 1D3CA 2FHBA 2UBPC 1O1ZA 1S3HA 5GVJA 1Z42A 2PODA 4QR6A 3AISA 3WLQA 2VFGA 3VKDA 2YDRA 3NDYA 1OZMA 4H9TA 1W9XA 1TPH1 2ZA3A 1P1XA 4W8LA 4N9CA 2WCGA 4DWSD 1R3YA 1BRLB 3WBAA 2D3LA 3T2OA 4X0NA 3C2VA 3BZJA 1YQ2A 1MUWA 5CAKA 1JULA 1OCQA 2ZXBA 1GONA 3BCFA 1UJQA 1L8NA 1QPNA 1OCBA 2C19A 4AD0A 1S3TC 3IS4A 4P8VA 3L66A 3GO2A 4B2DD 1EX5A 3V1PA 5I2UA 1P0DA 1P4CA 1XYZA 4Y9OA 4DBDA 2Z1SA 3OZYA 3GK0A 3QPYA 4FNUA 1MUMA 3GXMA 4LOCA 3WK1A 2QAFA 1FDJA 3QTGA 2P53A 2OZ8A 1E15A 3NSMA 3C3NA 1I0BA 1SZEA 1QFEA 5AECA 3LCGA 2HZGA 3WLKX 5DN1A 1O68A 1ZNNA 5A6KA 4UFIA 1TUXA 4XTIA 3M9YA 2POTA 1F5ZA 2V5JA 1TRDA 4CN4A 4NAEB 2P8BA 1EWDA 2DJXA 4LY4A 4NNCA 3ZR5A 2J74A 3VKCA 3CTTA 4Y9MA 3OJGA 1XIJA 4XKYA 1EIBA 3RUBL 1PTDA 5I6SA 5XIAA 2OT0A 2WMKA 2DSVA 4KCUA 1SGJA 1W1YA 1E40A 2EQDA 3EB3A 4NJKA 4XAGA 4DJED 3IIZA 1OINA 3VXGA 1C3FA 1PEZA 1TPFA 3G0UA 2XGBA 4LV4A 2AQWA 3VDCA 1T99A 3OA3A 1Z41A 2J8GA 4R27A 2BB0A 4YTQA 1E6PA 3J7HA 1C8QA 1OFRA 2AOSA 4F79A 1G94A 4UWMA 4HPGA 2R9RA 1ONEA 1LORA 1R2TA 5MF5A 3FXGA 4EP8C 1F2JA 3LHWA 3UFYA 1KV8A 1IZCA 3L4WA 1KD0A 4F3HA 4A6GA 1W1PA 1GYMA 2HEJA 1QUMA 3BUVA 3DENA 1P0KA 5LGXA 2UWFA 3M0MA 4I9MA 2CU0A 5BNKA 2ISWA 1GGOA 2G3IA 1K8CA 3MS8A 4GBUA 2PTXA 2OEMA 4JTFA 5ABGA 2VGIA 3QR1A 4ATLA 2Z24A 5AHNA 2NX1A 3ITYA 4Z17A 4BS0A 4HVXA 3HF3A 3W7OA 1OC6A 1LQAA 4XBSA 3T09A 1BAGA 4LY8A 1E51A 1SJDA 2BZNA 3C5QA 4KFOA 3UA4A 3FKRA 5JU6A 4P5UA 3KFTA 3DXIA 3WNLA 2W6RA 1GVSA 1UPPA 4CNPA 3TNBA 2B4GA 5CXPA 1BTMA 4AIEA 2HJPA 4TO8A 5BRBA 3NFUA 5LNRA 3UCQA 1YADA 1PZ2A 4EWND 5LIYX 4D6GA 3FKKA 2UY3A 1FOBA 2PWGA 3KTCA 1IEXA 1RY8A 6PTDA 1UUQA 4TVUA 1JPKA 3WDIA 1RJRA 1BHGA 1A4MA 2XGZA 4WQ6A 1R7OA 3C2RA 2XH4A 4RNHA 1BF6A 1PTAA 2OZTA 4LANA 3L12A 1A5UA 1N8IA 2DW7A 4PYSA 3ABRA 4EIVA 3A4JA 2PC4A 3NQBA 2BDQA 4XAFA 1MDRA 2RH9A 1XGEA 3BG5A 2A7NA 2YKKA 2XN2A 4WKFA 4FLRA 2GVEA 2WANA 2WSKA 2QCGA 5F2LA 6REQB 2XPKA 1UB3A 4A3YA 6ENLA 1EUAA 4JDBA 3O0FA 1S2UA 4A3UA 5G4HC 3ALGA 5DBTA 5CJNA 4M1BA 2VYOA 2PTDA 5HBFA 2UV8G 2J47A 2PURA 1ELSA 1RQHA 3W6LA 4KF1A 3THQA 3W1QA 1DKWA 3OLGA 3EWBX 5HR7A 1GQIA 2JGQA 2EG7A 3LBCA 3F5LA 1LBFA 2YB4A 1IIHA 1X8FA 3LLFA 1WXZA 3H2EA 4V33A 4DRSA 4B9ZA 1BYAA 3WUEA 4UTLA 3Q4DA 5FAGA 1AODA 1OFOA 1XUUA 1AG1O 4D8AA 2GQ9A 2GJLA 2I1OA 3P61A 3GR4A 1CBGA 2BVYA 3WDRA 3BLOA 1GG1A 1VJZA 1MUCA 3CQKA 3LX9A 1XDLA 4JIEA 1Q7MA 2ZZ3A 1K9TA 3S5NA 5A2CA 2FHFA 4QDWA 1OQFA 2FPYA 3Q37A 3EGJA 4LVGA 3LQLA 1XSJA 9RUBA 1G69A 4ZFCA 2X1TA 4ML4A 1TE1A 4ORMA 1EF3A 3FHQA 5BXPA 1EEPA 1MW2A 4B3ZA 3IVSA 4UQEA 3T4WA 3F5JA 2E9BA 2YCLA 3AIEA 1UA3A 1YE6A 1H7NA 3FJ6A 4M51A 2NQJA 1W54A 3GNDA 3W87A 2X16A 3NO5A 5M2FX 1E4IA 2WHKA 4M6VA 3TA6A 3V16A 2E9LA 2VP8A 3SUSA 1J0YA 5CBBA 3PWGA 3I65A 1VR6A 4O13A 3V5FA 3GG8A 4LS0A 3NSNA 1ONXA 3NOYA 4JFVA 5HWJA 3REQB 5FJRA 3ANUA 3K8LA 3E6EA 2NZLA 4ZCWA 3M0XA 1YPIA 1QT1A 3NZ1A 1XPGA 2OO0A 1AUSL 3AWNA 4PBGA 1SPQA 3GNXA 4AIBA 3SI9A 4KPLA 1HVXA 2QUNA 3CIXA 3BJSA 2QJHA 3QR3A 5F1UA 3WLHA 1KFEA 3WLSA 2PDMA 3LZ3A 1I2NA 3UWZA 3S83A 1R86A 2CETA 4KKXA 1CWYA 1H7PA 1DHPA 7REQA 1DQUA 4RV8A 1EP1A 4MJ4A 3CGTA 4DI8A 3G24A 3SUUA 1IZJA 4DXKA 4MB5A 2BOFX 5A3HA 2V63A 2QW5A 3TP4A 2YX0A 3HGOA 4XBJA 3AIQA 1XH1A 3BAJA 3VOCA 1IF2A 3EDJA 3FAXA 2XIIA 5CLTA 1VFFA 1F07A 4XAPA 1Z8AA 3PBVA 4LU0A 4QIUA 1WDDA 5D9MA 3IWPA 3BANA 4H83A 4ECLA 4MYAA 4MF4A 3V4BA 1G67A 2DZVA 4AYGA 1T96A 2PF8A 1A3XA 1AMKA 4REQA 5LHEA 4C5ZA 3MCNA 4ATWA 1KKOA 2GLKA 4DAFA 2PSNA 2GGGA 2ACSA 1KR0A 1SR0A 2GVJA 3I3EA 3LMYA 3VFLA 5EMMA 3FEQA 3CIWA 3POHA 3LGEA 4QQ3A 4MADA 4O18A 1GKRA 1RVKA 5AHFA 2WMGA 2EKCA 3BOLA 1K9EA 2RDTA 1F73A 2ZCGA 3NDOA 4FXJA 3WL1A 1R87A 5G4WA 2OX4A 3KHDA 1S39A 3EKLA 3BAYA 4FF7A 1A4LA 3DKLA 4L61A 2ZYFA 1NOFA 3LGGA 3N6JA 1UBPC 1ZRQA 1E6XM 3AS1A 2R82A 2BTMA 1KM3A 2HWGA 4Q8TA 4Z1YA 4RNIA 1V6UA 4IMEA 1U22A 4IP4A 1IEIA 1PB0A 1EXPA 4OZOA 2HVNA 2L5HA 3B8IA 4UXDA 1HKIA 1ADOA 4YVPA 1J0IA 4Z1CA 5EB8A 4ENLA 4GY7A 2V67A 3ABOA 1J0KA 3DHUA 1EXBA 3ATYA 4POCA 1TJ1A 1GZGA 1BQCA 3KZPA 4WF7A 1A3HA 2DV0A 2DZXA 3KOZA 5CGTA 4JTQA 4H6EA 2YA1A 4JICA 2WMIA 3IRDA 1Z48A 2RJHA 4HSHA 4EF9A 1WX0A 3TYBA 3WH7A 1Q8AA 2WC3A 3W84A 4XSMA 1CI1A 1UMLA 1NU5A 3DAQA 2PF0A 3DG3A 1Q6LA 3RU8X 1SQ7A 2P88A 4BF5A 5IHRA 2ZRWA 2RHGA 2WVUA 1O95A 1FH9A 1J2WA 5HAOA 4B90A 3M43A 4MHBA 2V6AA 1A5LC 1OSEA 1SMAA 1ZS2A 4NRSA 1JYVA 1MMFA 1UP3A 2YYUA 1JDDA 4D6IA 5SWUA 2GQAA 3BQ5A 3P5YA 2PLKA 2EPNA 1JZ5A 3GC2A 4KT2A 4ZQPA 3M0VA 4KESA 4OTKA 1TJ0A 3QPEA 4Z2JA 2OZ3A 3VKKA 4FR1A 3G2GA 3U4FA 3URAA 5FCZA 2FTWA 4ICMA 3UPWA 4MTVA 1I1XA 3DX5A 3W25A 3WLLA 1UQYA 1YYAA 4C91A 1WUEA 1M1BA 2PWHA 2QCDB 1KFCA 3ICJA 4AF0B 1AD4A 2Y5JA 2CW6A 2IQ0A 3KOXA 1QI3A 1UPMB 3C2YA 4XUYA 3STEA 5C5YA 1VCFA 2F6XA 4OV9A 1EO7A 5D8ZA 1MI3A 4B3LA 1MO0A 3B3DA 3BJTA 1FWIC 2JKAA 3DH7A 3BARA 4W85A 3CT2A 4YLWA 2WSRA 4OUIA 4WDWA 2BVWA 4B5UA 3FDGA 3FK4A 4MLJA 3SN4A 2Q01A 3L67A 1J6OA 1P0NA 3ELFA 3H7VA 3WBWA 7ODCA 1GYNA 1W9BM 1XP3A 4HPNA 3MP5A 3TWAA 1RY0A 2CLEA 4P61A 1DIEA 1QNPA 3L0GA 1HJXA 3HBLA 4YTSA 1JF6A 4R88A 4O1CA 4GJIA 4JIRA 3S4TA 4H8NA 3NQ7A 1ZU8A 3FV9A 3RMJA 2XVKA 2DPEA 4GUJA 1E73M 3CT7A 3T0TA 1GVEA 1UWTA 1ZBCA 5HMFA 4D2JA 3NIYA 5FJUA 2Y85A 2UY5A 4AB4A 2WOQA 1JAKA 4AG0A 4N02A 3GYCA 2E3ZA 5I07A 4A21A 1MRQA 1FCQA 4EAYA 1Q7QA 3CC1A 1TTIA 2QT3A 1ZSXA 3OVRA 4Y9AA 3RITA 4GWEA 3UYIA 1H11A 3DG6A 4PUKA 2BGQA 5DY2A 1TJ2A 4R7WA 3IJ7A 3PANA 3N4EA 3M7WA 5DBUA 1QHPA 2OLAA 1EC7A 2NQLA 5I78A 1KM6A 4W87A 2WHJA 3AROA 2VR2A 1H0IA 1LDCA 2HS8A 3RO8A 1K02A 1QBAA 4LTSA 3D3AA 5HXMA 3WEMA 2CESA 3OEXA 1F3XA 3V0SA 4IFRA 1XIBA 3S9YA 4ATDA 5AC4A 4NAFA 3TYEA 1E9YB 2OO6A 3GXIA 2E1WA 3VIKA 2EHHA 1E0WA 4OBTA 4BKNA 3OODA 4YHEA 2FYMA 4C6MA 3W1TA 3W3OA 1XCXA 5EGRA 1JD9A 4IIHA 2AQOA 5I3IA 2FGLA 3YPIA 3A5VA 3T55A 3N29A 2ABAA 5PTDA 2X1SA 7XIMA 2D0GA 3P8JA 2R1LA 4AHOA 2VURA 3LTSA 4JTSA 3A4AA 1ENUA 3VE9A 4PBEA 2CBUA 5JH1A 2ZRUA 2QJJA 1G1YA 2DW6A 2FB2A 4GGHA 5IBXC 4FI4A 4YCPA 3S1GA 1OM0A 4RW3A 2VX7A 1J10A 2QCCA 3MPGA 4O8RA 1MFUA 4DO6A 1W8SA 3CHCA 5KMYA 5BMWA 2E5BA 1R3QA 4D6CA 3EMCA 4O10A 4O16A 5CC6A 1TV4A 1VYRA 2CWNA 4Q8MA 4PMDA 4GMEA 1O7AA 2GZXA 3T42A 2F7FA 3OYXA 2E1DA 4W4QA 4FOUA 2OYLA 3UEQA 4HP5A 1ECEA 3WO8A 1HP4A 1N8WA 3VGFA 1V8EA 3V35A 4LUIA 1L9WA 4HPHA 4WVXA 4PTDA 1LCOA 1JEZA 2ZA2A 2Y8KA 2D2GA 1LBLA 3ITLA 3GTFA 4CD7A 3IPWA 2YCJA 4NX0A 1RLCL 1UIPA 1M7PA 1WV2A 4RK8A 5HR6A 4UBPC 4AUBA 1W2PA 1NAL1 4PMUA 2VR4A 3NURA 4LNYA 3M0YA 1CGXA 4GKLA 4FAMA 2TODA 5A6MA 3PUOA 3C8FA 4GCAA 2GOUA 2RAGA 4HMNA 3N9RA 3R79A 5HATA 4OOZA 3FYYA 4OVXA 1EIXA 3H2OA 1FA2A 2ZUUA 1Q6RA 5C7HA 1XLIA 4IQEA 1Q63A 4NZFA 3EZ4A 1GOXA 3CL6A 3O06A 1J2BA 1VBJA 2ICSA 5H1WA 3VNZA 3U2OA 2Y7FA 4O1EA 4HPXA 3MHGA 3BPWA 3IUHA 3FYOA 1RHCA 3KWSA 3TN6A 4NHVA 1MW0A 2J75A 4C6IA 4AAJA 3CTLA 4LBUA 3PPCA 2BBFA 3CPRA 2QZRA 2PGWA 1GORA 2PDPA 1V0NA 4CKQA 3KEHA 3KBNA 3TSMA 4PFHA 4F2TA 1SFTA 2Z0IA 3JR2A 3QSTA 5H8MA 1GCYA 4BEUA 2XFWA 3R7MA 3EB4A 2VDGA 2ZDRA 4JL1A 2VD8A 1EP2A 2ZXDA 3L65A 4R9XA 4ILSA 5GJPA 3C56A 3VKJA 5AC6A 3STPA 1E72M 3QN3A 4JTCA 3C6CA 3P93A 4LUSB 4FX8A 1KGWA 4JN7A 3KHJA 4K8GA 2WPBA 2BY0A 2PCEA 3WJWA 2PP1A 4QX4A 3SN0A 2Y61A 3RNDA 4WD0A 1Q85A 3HPSA 3NXLA 3PP7A 1W32A 2WHLA 1WBJA 4Q8PA 3MB9A 2GVLA 1EJXC 1W91A 2ZADA 2G4FA 1E6QM 2XINA 3AMGA 3G1RA 1J18A 5LIWX 3LCLA 3UY8A 3EX1A 3R58A 2QUVA 4H9UA 3TTOA 1U33A 1US0A 3WLIA 2PDHA 5D2XA 3S1VA 3PB2A 4L6HA 1KLYA 3NR0A 4GI6A 1RCXB 1HG3A 2W62A 3UJ2A 2XG9A 1T8XA 1XS2A 2VWTA 4IM4A 2Y7DA 1UH2A 1UD5A 2B7PA 1RPKA 3MU7A 3VOJA 1E56A 3AS3A 5CZJA 5LIKX 2AAMA 3E0IA 2X05A 4PMVA 4XD5A 4HTYA 5BU6A 1NARA 2J4GA 4V1YA 4Y90A 2D0HA 4PCTA 4NJJA 1XXXA 3SSJA 4Z42C 2OZ0A 3GTXA 4JFTA 1C9DA 1A5KC 3F4CA 1EJRC 5FIPA 1XIHA 3BDKA 1B3VA 2INZA 5E5CA 5KZMA 1KRBC 4ERAA 3FY1A 1OADA 2QUTA 3WLTA 1ITQA 5M03A 4MNMA 2ZZ5A 1DXEA 4UZUA 3LXCA 1JVNA 3HMJG 3W76A 3N14A 4I9TA 3B8SA 3WLPA 2DUXA 4HNTA 3KL5A 5AVNA 3SO7A 1ISZA 2BNJA 2DZWA 4J35A 3UG4A 1G9HA 5C9UA 2D0FA 1L0PA 4MFDA 1YBQB 1EGVA 3M5ZA 3G1AA 3V75A 1PAMA 1LRNA 2Z6JA 4HD5A 2X41A 3B9EA 1OWQA 1LP6A 3VIIA 1CXKA 1I60A 3V18A 3IGXA 2JGYA 2PRMA 2F61A 2ZX7A 5D04C 4PMOA 3T8QA 2PWDA 1RK5A 1U5JA 3IV3A 4V28A 2E7FA 4L4LA 4B5VA 4LNCA 1JPMA 3VC5A 3VMNA 5IHSA 3UETA 4AZ6A 4GNKB 3MVTA 1JDEA 3T07A 1EZWA 5HMEA 3S1UA 1IE7C 3NZRA 1CGUA 2QPSA 2CZVA 3K8KA 3WUGA 1WP6A 4L1GA 3S47A 4QNWA 1JRBA 2BV9A 3NOEA 4GABA 5JXQA 1RBAA 3ABQA 1XIFA 1AA1B 4F9DA 1QU4A 2O7SA 1IGWA 2WNWA 3H6OA 4O1FA 4AWUA 3URQA 1R2SA 3N04A 2R24A 3U48A 2PZ0A 3LS9A 3GS6A 5KITA 1WE5A 1UIOA 2PD5A 3G8EA 1OBAA 2X7WA 2EGZA 3TJLA 4CVUA 1UWIA 4WKHA 4QGCA 2ATSA 2B7QA 5CSSA 3IIOA 3T40A 3SR7A 4XAYA 3NEHA 4EK7A 1TX0A 2CEQA 2FVMA 3LLXA 2DZUA 2X7VA 5HJXA 1ZCCA 1S2CA 3NQFA 2D73A 5CBJA 3GBDA 3DC0A 1F8IA 4GLEA 1BRLA 2J9YA 1GVOA 4Q4QA 3TYCA 4TX8A 4MOZA 4KFPA 4YXGA 3O6DA 2ALRA 2E8YA 3GZ3A 3RRAA 3VGBA 3UQNA 1FWGC 5EPDA 3SRHA 4JNYA 1POKA 3VNYA 3WQWA 4J40A 2HRWA 2CERA 3AIVA 4WZHA 3R8HA 2MANA 1E0TA 1JFHA 4RL3A 4XSLA 3GFXA 3IJ9A 2CFFA 3RHGA 3TW9A 3C0LA 5BW6A 3LCXA 2NUYA 3EA1A 2V3DA 1RK6A 2WM1A 4NZ5A 4ZQNA 4GUIA 1W56A 4AQLA 3UGVA 3ZWSA 4FR6A 1WCGA 4NAEA 1MVYA 4P7LA 2AAAA 3AFBA 5EKYA 3TNOA 3MKKA 3GG1A 3E96A 5BU9A 3UGRA 2E6DA 4DPQA 1HNYA 4QDMA 3WQGA 1HL2A 3W2MA 4WJEA 3QY6A 4QFUA 2XFYA 4LFYA 3VINA 4W7UA 3BMVA 2W91A 4D1IA 4KGLA 1WDRA 3K2GA 4GIAA 1XLHA 1BTCA 4C6BA 4C1KA 2XJ7A 4WDTA 5CG7A 1PWMA 3PBUA 4MB4A 2VX6A 5CC5A 4C65A 7ENLA 5E70A 2W5FA 4TR9A 3QY8A 4FNTA 3S1XA 3S2CA 1X97A 3L68A 4UC5A 3T78A 1MXDA 3W7LA 4YNGA 3IARA 3BAWA 4ICNA 1WZKA 1FRBA 2VI0A 2A21A 2YZRA 1EGMA 5K9XA 4BHYA 1TZ7A 2DGAA 3IK2A 2ZWYA 4MM1A 3LG3A 1J0ZA 4UTMA 1CGTA 1Z3NA 4WJ8A 1XV8A 4H6RA 2YFNA 5HUPA 3GH7A 2V81A 4Z0SA 2PDXA 1JI2A 1XWYA 4E2OA 1LTDA 2GJRA 2YW4A 1FHDA 1TPWA 1HKMA 3QHOA 2QDEA 5DANA 3UP8A 1TPC1 2PGFA 1LT8A 1KLZA 5A6SA 3DU0A 3WF3A 4DBSA 1VFSA 5ABTA 1TPB1 1Q2RA 4JOMA 1AW2A 3KLKA 1UWRA 3EWXA 3STFA 1NVMA 3N9KA 1ZBKA 4JIQA 3RX3A 2BASA 4O50A 3OG2A 3RR1A 2XISA 1GQNA 3D0CA 2YW3A 2YFOA 4XX6A 4AD5A 1R38A 4PH6A 3U2ZA 5LIXX 1E4NA 2JKEA 3MUIA 4JKLA 4CQAA 1FCUA 5DRCA 4J3VA 3TKFA 4L4PA 1HFBA 4FP1A 2X1RA 4EACA 4M1RA 1R3RA 3DFTA 3W7JA 3CHDA 3QGVA 1UOKA 3KVLA 1HIZA 3ZWTA 1CNVA 2JEQA 3NQDA 4PE8A 2ZUTA 1HN1A 1VIZA 4Q8VA 3EA3A 2WZIA 2O4MA 1LL4A 2HE8A 4E3VA 1FCVA 3GBEA 4H01A 5GNXA 3GSMA 1XH0A 2QULA 3ITTA 3LTPA 4DBEA 5DCEA 3UWVA 3L4VA 4ZOCA 1JUEA 1Q6FA 4PTVA 2TSYA 1EOKA 4R3UA 4E8CA 3PPHA 1HL8A 2GDUA 1ME8A 4A8RA 4G8TA 3NTYA 3G6MA 3WIJA 6REQA 3NQGA 1D8WA 3JRKA 4RNFA 4E2VA 2CHRA 5H8UA 4JTRA 3OGVA 1MXSA 1FWSA 4H00A 1QW7A 2Z27A 1QNOA 1K77A 4DPPA 1OFPA 4JKMA 5CC3A 2V2HA 3BURA 4WOZA 1XLKA 3O63A 5BMXA 1TPDA 1MFVA 1HVQA 3Q2DA 1XKJA 2XZ7A 1ZFJA 2QEZA 2HS6A 4QEEA 4FHAA 4L7ZA 1KCKA 3R12A 4HOWA 3HO8A 5EMLA 4L5ZA 2JKPA 3CM4A 3OLIA 4YTRA 1QK0A 4J3UA 4NNAA 3WH8A 3B8DA 3W53A 5HWMA 1YNPA 4XTDA 2EEXA 1EEXA 1TWWA 3RN6A 4NQ1A 4CN1A 2SFPA 4RE3A 1DWJM 2UY4A 1CECA 3HOJA 1XM3A 3W7NA 3O16A 1AH0A 4HK6A 3IJDA 3APGA 3S5ZA 1VBUA 1IQ8A 3MQTA 3R25A 4HCHA 4MGGA 1B2YA 5KZ6A 1XPYA 4BQ3A 2GYIA 4C6LA 4W9TA 5I3DA 5ENLA 4Z2IA 5JBEA 5IOBA 2VGGA 3TYZA 2PE4A 1TTPA 3MMDA 4YVXA 3OG3A 3I10A 1V6YA 4BZYA 3B8VA 4X2PA 4DYEA 3WJYA 2FHCA 4XZLX 4FNPA 5CPMA 3R8RA 3GFYA 5D38A 2NXGA 5F2IA 3V0UA 4EF8A 3DC8A 3REQA 1YLVA 4AX6A 3TJXA 3EMZA 3GDTA 4HTBA 3EWUA 1GTHA 3QV8A 2QUMA 3TC3A 3LPOA 2A2IA 2XH7A 3VIPA 1OF8A 2DT2A 4PTXA 4AZIA 2WAGA 3WQDA 4QCFA 3QXBA 1PUDA 4XZMX 1HF6A 3MC5A 3VD4A 2DZAA 2PU1A 1QWGA 3GNPA 4LBRA 1IT8A 3RXZA 4AFYA 4IQDA 2WKLA 5DMLA 5ECUA 4CNNA 2XVNA 3CQ0A 2FIQA 4LWWA 3AYRA 3TA9A 3RM9A 4S3FA 4O0ZA 1EHAA 4YWIA 1XLBA 4LAMA 3TOPA 1UMYA 3VNKA 3OIXA 4E4UA 3B03A 3LCFA 2YOCA 2B81A 4GIEA 2RDUA 2NUWA 2J13A 1NQ6A 1XJBA 2NW0A 3TXVA 1QPRA 1EA0A 2EJ1A 4JFWA 3E2RA 2Y24A 1CIUA 1JRCA 3K30A 1TB3A 4PUUA 1DJGA 5FF4A 2BY1A 1F4AA 3PM6A 3O0KA 2QQ6A 3H22A 4JPGA 3I68A 3GXDA 3M41A 4MWAB 5E6YA 3M07A 2IQTA 2Y1HA 3CMJA 1L2UA 1PV8A 2VUYA 5DFAA 2NX3A 3K4WA 1E70M 4B9YA 1XG3A 2ZUSA 4AYSA 2ZQ0A 2HPMA 3C61A 3DZ1A 3AMDA 2I9EA 4LQ1A 3PWIA 4XBKA 5A1AA 4PRTA 1YTDA 3W7GA 1XIGA 2JE8A 2PFHA 3C0SA 4CU8A 4JZ5A 3U4AA 1JZ7A 1DE6A 3N73A 3NYZA 1R3VA 4CD6A 1FUYA 2GUYA 3GB6A 3AIUA 3W7MA 1UBSA 4IQJA 4IPPA 1EF2A 3OGSA 2QS8A 3AYVA 4ZTYA 1CEOA 3LU2A 2DSZA 3LRLA 1A50A 3VNJA 4K39A 1FWJC 1H5YA 3ABZA 2OB3A 1W17A 3F1QA 4QDPA 1KW1A 4FZIA 3ZSSA 1UQZA 1IV8A 3W7HA 1RUSA 3O6YX 3HFTA 1ZLPA 4QE5A 3AOFA 3WKZA 1LUCB 1EB3A 3PULA 3ZS4A 4I5XA 2F8QA 3TXZA 2ADAA 2XVPA 4H2CA 2ZZ7A 5C2XA 2OYMA 1R3TA 3OW1A 4UFJA 2NV9A 4DZIA 1HTIA 2X1UA 4PA8A 2WCSA 1WXJA 4PZVA 1US3A 1GHSA 1PZ3A 1C92A 4LC8A 1S5VA 3RGTA 3MCMA 3GHUA 2VTFA 1PS9A 3TMQA 2Q3RA 4CN6A 1LOQA 1KRAC 3UW6A 1LL7A 2JK2A 1UD6A 2ZZ6A 2GJNA 2R6OA 4A22A 4M29A 3SADA 4UR7A 4PCSA 2NUXA 5F1VA 4WGHA 3HM7A 1KV5A 2OTDA 4EANA 5U4NA 5AHMA 3SCQA 1V6TA 3I4EA 5T9BG 4GY0A 3S2JA 4E3TA 1RSCA 3GR8A 3VIFA 1Q13A 4QG8A 3FEMA 4LVDA 3Q58A 2A7PA 5FL0A 1HKVA 4C6QA 1DWAM 4C6CA 3G1VA 3IEBA 3E1F1 1JR1A 1WOAA 1E43A 1V3IA 1YTKA 4NY2A 1H41A 3SGGA 3GU2A 1E1FA 4XIMA 3UWEA 1W1B1 1N8FA 4E5TA 1W5NA 5CEWA 2O9TA 3GXPA 3M0KA 3RFAA 3T1GA 1CB7B 1G4PA 4KRTA 1TQJA 2A4AA 1R0MA 3UXAA 3EXTA 5DY3A 2HSAA 2QCDA 4AF0A 5AN7A 3U0HA 2HK1A 5I0DA 4GH1A 4NF7A 3RM8A 1K6AA 5D2WA 4ZZ9A 2ZUNA 2R8WA 1S2VA 3ITVA 3THAA 3TLQA 4J3ZA 4M6QA 3LEPA 2NSOA 1NWTA 4B15A 3WMLA 5C0QA 4XD6A 3HGJA 2VEIA 3VIJA 4BF9A 5JBDA 1IYXA 4IFOA 1OFEA 1ZGDA 2AKZA 3AYTA 1VENA 3AYSA 3GDLA 3GDBA 1IIGA 4BQ5A 4E8GA 4QE4A 1R6WA 2C3ZA 1PX3A 2PGRA 1JUKA 5BYWA 4IL2A 3CZGA 1MYRA 3W72A 2BXZA 2PCQA 2VEGA 3AIBA 1A3WA 4DNHA 5A69A 2J27A 4WCJA 1H51A 4W7VA 1H5VA 1MZHA 3QQ1A 4UQBA 3WMBA 1QNQA 2QIWA 2WVSA 3KTSA 3FNDA 3RMEA 1T8QA 4AVFA 4O28A 1GKQA 2DH3A 1GHRA 1OK4A 2DIJA 1OGGA 3FN9A 3NVTA 1SZNA 4M56A 2DJLA 2R91A 5AHLA 3NL3A 1R8LA 2PLJA 1WDWA 3LSBA 4JD4A 1TV3A 1B5TA 2VHLA 3WQCA 1NFGA 4J7RA 3B0PA 2OJPA 4S3JA 5DMMA 2HNHA 4DJFA 1H1NA 3CUHA 1CENA 1F61A 3QQ0A 2GK1B 1EJWC 1FWNA 3TFCA 4KQNA 2CLKA 4JTDA 1B90A 1GOQA 1WAWA 1SFJA 1PZ1A 5C9ZA 4QTGA 2P76A 4FNRA 1SZFA 3SIZA 2BG5A 5D05A 3GNRA 3TSBA 4RDZA 2GGEA 4IMCA 4P7RA 4CUCA 4I8DA 4GY1A 2ZX9A 1XYBA 3KL0A 1KFWA 3L4UA 1PZ0A 2X0YA 2ZZ2A 7TAAA 3LPGA 2FMNA 2PLCA 2VFFA 3LCHA 4J9JA 4UTJA 1YKWA 4IPNB 1H7RA 4H7CA 4DZAA 4IUGA 1HP5A 4M3PA 2PB1A 5CAHA 3AXMA 5HINA 4IP7A 4X2RA 3TC7A 3MZ2A 4CCZA 3BW4A 4J3SA 1OX5A 4AEEA 4I3GA 2EPLX 3IVTA 1XFCA 1E1CA 2ZVRA 5A2AA 3AMKA 2QCEA 3DHPA 3MUY1 4OJYA 3WQ6A 1VYSX 4J5NA 1RAKA 1VHCA 4IGHA 2G37A 3GTNA 3GQYA 4C6DA 2ZE3A 4FF5A 5F7UA 2XHYA 4QE1A 3W83A 3SQMA 1IT0A 5FI8A 4ZR8A 3V5OA 1N82A 4AZBA 2QCNA 2ZZ4A 1MQQA 3BGAA 2IKIA 3I7SA 2FGBA 3ZZ1A 3NL2A 4S3AA 4UCGA 1VH7A 2E6AA 4PCNA 2WNQA 4LCRA 3BC9A 4DX3A 3IUIA 1GVIA 2VFDA 1QTWA 3AIWA 2ON3A 2YL5A 1HO1A 3A23A 1OF6A 2QPUA 2IMRA 1ZBVA 3W1UA 3LGDA 5BXTA 1M7JA 1CXHA 1NTHA 3QRHA 4GZIA 4F8XA 2PDUA 4JGDA 4KWUA 3W1RA 2BGSA 3SAZA 2VOTA 2BVTA 4JL2A 1A5AA 3XIMA 4UTIA 2RFGA 3O6AA 5AHIA 1EJTC 2XYLA 3W2UA 2QCLA 4XG1A 5D8WA 4F0MA 4G5DA 1V02A 2QV4A 3QH2A 3ME3A 1VFOA 4BK9A 5I79A 4N42A 2I56A 3R5EA 2JALA 3KAOA 5EL1A 3S6OA 3VVGA 1KXQA 4QJ5B 3AUOA 3O9NA 5HQLA 5CLWA 3RR4A 3PZGA 4FXFA 3UERA 4NJHA 1AD1A 4BEQA 4S38A 4B5TA 1HXJA 5C2GA 3R94A 4I7WA 3BXWA 1Y5WA 1EL3A 1U5VA 4GACA 3VD3A 4QAWA 1HQTA 3A3WA 3TR2A 5HMDA 4HMCA 3INPA 2EJAA 1DQXA 1Y8BA 1M01A 2H3DA 2HMCA 2Q02A 4ERIA 2WMFA 2GSHA 3GDMA 3MDUA 3TU9A 2CITA 1MW1A 2YXGA 1Y7VA 3T7VA 3UVAA 1CDGA 1XBZA 2Q09A 3FHAA 1OFBA 2TAAA 5CSUA 1P43A 7TIMA 1J93A 5I3FA 3CHFA 9CGTA 1CXLA 4F0LA 5C7VA 2CXGA 3U8GA 4D6JA 5MKGB 1GTEA 4DYKA 1JI1A 1UKPA 1F6YA 2Y63A 2AGTA 5C55A 2KAUC 2QYGA 5A8MA 5BRPA 3TJ4A 2J24A 1VJSA 4LUSA 4DF1A 5KZDA 3N9SA 2OEKA 4EXQA 4LYKA 4XD4A 1AMYA 5D37A 3HGRA 4UNIA 4MFEA 3E02A 3W71A 1BXCA 3LPPA 3SCNA 4AD4A 1M6JA 2G5WA 1QAPA 2HVMA 4GPNA 3W85A 1FFQA 2ZC8A 2IPGA 3BJFA 2OXNA 1P1MA 3CEUA 3GVVA 1QHOA 1PYMA 5F2MA 2AMGA 2G50A 1NDWA 4DB7A 3R0KA 2ZTKA 4U31A 4QITA 4KH2A 1ZAIA 5KINA 4RZBA 5E09A 5HWNA 2C79A 4OECA 1DJXA 2J25A 3IK4A 2W9MA 1FP9A 4OBSA 1XCWA 1O5QA 3N34A 1XHGA 2FPVA 1KNWA 3P8IA 5LYRA 2NQZA 1V77A 1L8PA 1OG0A 2J62A 4Y6GA 4AXNA 1YRRA 4IXXA 1KFBA 2PP3A 2V3FA 4ES4A 4YYFA 5EFFA 4LBSA 4OU1A 3PSWA 3B9AA 4HZMA 1FWHC 4A2RA 1OY0A 3P14A 3AHYA 3G0SA 3G3MA 1I2RA 2VDHA 4TOQA 2PUZA 4PMRA 4FXSA 2BLEA 3CV6A 3SY1A 1DWFM 2XTKA 3G1XA 4AVOA 1FXPA 4ONVA 2WQDA 5J5DA 5J8LA 4K36A 3TYDA 4C1LA 4W88A 2PBOA 1B3WA 3MYPA 1YBQA 4EAMA 1F3WA 1SO3A 2V3EA 1ADSA 3BCJA 5KEZA 2V5DA 4IIBA 3NPUA 1PBGA 4D6EA 1UUOA 5C9WA 4BR1A 5A6TC 1KFLA 1D9EA 3MANA 2OG9A 3OQ8A 3AC0A 4NYUA 1OX4A 1LRQA 3BH4A 4AZHA 1ZTVA 4RLIA 2YL8A 4L56A 3ARZA 2A7RA 4EX4A 2Z00A 3UPMA 2C1HA 2ZRVA 2BWGA 4RE0A 5L6UA 1WDSA 2WVVB 3LNMA 5EBAA 1O1HA 4XO7A 4UQDA 4GK8A 4ICCX 4AZ5A 3GX9A 3A64A 1T0OA 4IIFA 4RE2A 3H7RA 1EYEA 4G1KA 1OB0A 4FEZA 1QNRA 4U2YA 3NQMA 4NVTA 1SU5A 1JYNA 4IF2A 3WMSA 3AWOA 4S39A 2EO7A 3ZVHA 3MUCA 4JS3A 3CUZA 3R10A 1FWDC 1E0XA 4AU0A 4F0RA 1FDYA 2EBNA 3GR7A 4KWWA 4NZ1A 1J8VA 3IAPA 2VDIA 1FWWA 1MEWA 1W9DM 3WDHA 3GG0A 3FCPA 3O05A 4IP5A 4IMAA 4ZL1A 3M5XA 2QF7A 3STGA 1W5MA 4JXCA 3UY7A 1EYWA 3PJXA 1XI3A 3P7YA 5IM51 3BCDA 1LT7A 4V27A 1M7OA 3VZZA 1XRTA 3KOYA 2GWNA 3DUGA 3S9IA 3PF3A 2A3AA 4GCXA 3P5ZA 3CS2A 1Q4NX 5LA0A 3WF1A 2J8FA 4H6KA 4IXHA 4ZOEA 2J7DA 2Z26A 3MYOA 4NYYA 4OIFA 4ACZA 3GHRA 2P3EA 4QBXA 5D2VA 2Z29A 4WUIA 4O54A 3OTRA 5AZ1A 4HYRA 4CD4A 3AXHA 3AO0A 1DBTA 4H19A 3WQVA 3H12A 4BF7A 5I09A 5E1QA 2E4TA 3N2XA 2LLEA 1FHVA 1KBKA 4H9ZA 3T0DA 4PULA 1YDYA 2R1NA 2KX9A 1PCKA 3SFWA 3PTQA 3W37A 3WD1A 1A5OC 3VILA 3FFSA 2C0AA 1PWLA 2FZ9A 1YDNA 4Q8OA 2G95A 1FKXA 3KLLA 1RZMA 3B0YA 2NWSA 4XISA 4HA1A 1TJPA 3NM1A 1HJSA 5HJLA 4RDYA 5ECVA 5D4YA 5HQEA 3AICA 1X98A 2Y0FA 3RG6A 4U2ZA 2G97A 3BK0A 3HQPA 2YA2A 1TZZA 1I6NA 3WJSA 1VF8A 3N2TA 3I4KA 1VCGA 3OP2A 1E55A 2ZOXA 3E74A 1DWHM 2ISDA 3DYMA 3MWAA 2NVCA 4GKTA 3HN3A 4E8DA 4YL2A 1LWIA 5A8PA 4GNJA 5AB3A 3QR0A 1EWEA 3GIPA 4JBRA 1GNXA 3VX0A 3HA1A 4PMYA 1XLJA 3WLRA 3VDAA 2ZFAA 3LSCA 4IL0A 4HIBA 4UTHA 2XH0A 3GFZA 3W22A 4UFKA 3TYUA 2FVKA 3WLJA 1XBYA 3HMCA 3M1ZA 4FSAA 5TNVA 3CV7A 1FWRA 1UZ1A 8XIMA 1TZ9A 3BSHA 4Y8EA 1M53A 4CQDA 3W2JA 3EDFA 4GX9A 2WJEA 3EYPA 4B2DA 4HSOA 3P81A 2IKHA 3UYCA 1MZRA 4J2PA 5BWFA 3M44A 2ZRZA 2PU0A 2Q6ZA 1W2VA 2XWEA 4UNLA 4MIMA 4DM2A 3PBWA 5IBXA 1ZJHA 2PRHA 5FF2A 2Y62A 5XINA 3CQIA 2V3GA 4J27A 5L9FA 2QJGA 1AJZA 3W0KA 3C2FA 3M6YA 1VPXA 1HJWA 3TTSA 3LOTA 4PCFA 4ZO9A 4U33A 4RV3A 2WCAA 1FH7A 3QKZA 3A21A 4MKSA 3LXBA 4QSHA 3U3HA 3NQCA 4OE7A 3FOKA 3LTYA 4YHGA 3VO0A 3KBSA 3WFAA 3TK7A 3U7VA 1H60A 3LHYA 3KTXA 4IH3A 2E5CA 1PL9A 3W74A 2ZTJA 4JX6A 1SFSA 1F05A 2HXUA 2VFIA 4HU0A 1LOSA 4TQTA 2POZA 5I5RA 2YYTA 1TPUA 3C86A 2F6KA 2G3NA 1XUZA 1XLLA 1DYSA 4KEZA 4DJDC 2ISSA 1SFLA 4XZWA 1IWAA 1RD5A 2A3EA 1R7AA 2YLLA 4PEEA 1VP5A 3RCNA 4XZHA 1NIUA 2C7FA 5AC8A 5GNYA 4HK7A 1JCJA 1PJ9A 5BXRA 2WM0A 1FWFC 3AJ7A 2VXNA 1QHZA 2WZMA 1PXGA 3RU6A 3CBWA 5HK4A 3QY7A 2BSLA 4C7FA 3KP1A 2Z1XA 3WDQA 1A5MC 1R85A 1FWAC 4U3CA 4JQ3A 3P0WA 4MVAA 1RBLA 5LGZA 1GOWA 2E77A 2WWDA 3GDKA 4TTUA 1XYLA 6TAAA 1YDOA 4ZXOA 2A0NA 3QM3A 4XVDA 3MKCA 6TIMA 2VO5A 3GC5A 1XQKA 1R46A 3LLDA 4UMAA 3E9AA 3WH5A 2D2HA 3P67A 4U4MA 1XC4A 3PK7A 1E6ZA 1VPYA 2QCMA 3M0JA 1YPXA 3PN8A 1ZZMA 2PA6A 5IDZA 1BF2A 3ZQ9A 1TMHA 4S3KA 4HYWA 3ARTA 5I02A 4TMCA 1ZJAA 3SEPA 3NQ6A 4IISA 4K7YA 4W5UA 2XN0A 2JF7A 4P7NA 4UTWC 3CHVA 3TW6A 1XYCA 1GOIA 5EMJA 2H3BA 2BX7A 3K4DA 3D47A 4YJ5A 3VGGA 1LLZA 3VGHA 2QV5A 3WF2A 4L1WA 4CCDA 2YXOA 1KQYA 3S3GA 3QJAA 1QASA 1NWSA 5I24A 1XBXA 1FP8A 1GVRA 4O19A 2FDMA 5DMNA 3CUIA 1TELA 4S1FA 4X60A 2X42A 2PDFA 4U28A 4XD3A 1TCDA 4WGXA 4IIGA 4GJ1A 1QI5A 4HCLA 1ITCA 3TAKA 3VOGA 2BXYA 3S8HA 3S2MA 2F84A 4KEMA 3G1YA 1H7OA 3LI0A 2RJGA 3CIVA 5JMUA 1JYWA 3GTHA 1GEQA 5CKSA 1SO6A 3LHZA 4PB5A 4CQ8A 4UZSA 2MUCA 2I5GA 2QHAA 4TVDA 2OKTA 5FD0A 5CZTA 1BWLA 2WYSA 2ONEA 1KM0A 2VQTA 1UWAA 1H50A 4BFAA 3WK2A 4O14A 1U2YA 2WJZA 3ZOAA 1XDMA 4JEQA 1SW3A 1B3OA 4JYDA 1TWIA 1JCLA 1Z69A 1VD6A 3W24A 2CCRA 4Q8WA 3AIRA 4J3WA 4JN6A 4MWAA 4GYPC 2Y89A 1BYCA 4X0VA 2C13A 2NQ9A 1OFQA 4AY8A 2Y5EA 3GXNA 1BG9A 1VEPA 1ODUA 3W9ZA 4S3DA 3CXOA 2X8RA 1F6PA 3OB8A 1LQ2A 3QGAC 1PIFA 2A3BA 1Y5VA 4LEQA 2FZNA 4LYPA 1UUMA 4PTWA 5HANA 1L6FA 3B0XA 3B0UX 3UJRA 3AZTA 3KBMA 5HOSA 3CMFA 4I9JA 2X2GA 4MSSA 3UZ5A 3R0UA 3DFSA 1JGIA 2BOEX 1W8GA 2BVDA 4IPLA 2VR5A 3VNMA 2CWXA 4HNLA 1E3ZA 5RUBA 5JIWA 4LVBA 2Z7GA 3AXIA 1TVPA 1LL6A 3CK5A 4HU4A 2V38A 3WNKA 1DWIM 5HNUA 2DIKA 1ADDA 5A8OA 4N9EA 3N19B 5G2HA 4MUPA 1A47A 1O5XA 3WF0A 3KVMA 2XM2A 5FF3A 2OYKA 1LUCA 2YL9A 2PWVA 1R9YA 1QNVA 5CPLA 4O4WA 1PKNA 5K9CA 1HL9A 4LPCA 4F2BA 2ODOA 2JBMA 2QVHA 2X40A 3E2QA 4JTEA 4WK9A 3FDKA 2PWEA 2CBVA 3R2GA 4MWAD 1SSDA 2VGBA 4NIRA 3QOMA 3UNDA 3WQ4A 2WC4A 4MPQA 3FVMA 3H8AA 3G18A 1TTQA 3VOFA 3DIPA 3JUGA 3TSDA 1PO9A 3LA4A 3RF9A 4HSNA 4ZEPA 1LZOA 4H41A 4O57A 4TUFA 3O6CA 1A5BA 3GYEA 1TRIA 3GH5A 4BI6A 3PZVA 4JQ4A 4F2UA 5T26A 3RDKA 4Q33A 3PJWA 4H8HA 1YXDA 2VMFA 3GVQA 3SQLA 2AL1A 4JTHA 3IGSA 1J79A 4XO6A 2JQXA 2D23A 2NQHA