4Y7EA

Crystal structure of beta-mannanase from streptomyces thermolilacinus with mannohexaose
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
302
structure length
302
Chain Sequence
VTGLHVQGGRLLEGNGNDFVMRGVNHAHTWYPGQTRSLADIKALGANTVRVVLSDGHRWTRNGPADVAAVIDRCKANRLICVLEVHDTTGYGEEPAAGTLDHAADYWISLMDVLAGQEDYVIVNIGNEPWGNTDPAGWTAPTIAAVKKLRAAGLAHTLMIDAPNWGQDWQGVMRADARSVYEADPTGNLLFSIHMYSVFDTAAEIDDYLEAFVDAGLPLVIGAFGGPPDQWGDPDEDTMLAAAERLRLGYLAWSWSGNTDPVLDLAIGFDPDRLSGWGQRVFHGVHGIGETSREATVFGKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase
publication title The loop structure of Actinomycete glycoside hydrolase family 5 mannanases governs substrate recognition
pubmed doi rcsb
source organism Streptomyces thermolilacinus
molecule tags Hydrolase
total genus 117
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2015-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4y7eA00
1Q4NX 2W5FA 2F8QA 3ZMRA 4W88A 3DYMA 1X6NA 1RH9A 4JAWA 1B31A 1KGUA 3AIVA 3BGAA 2J78A 5FKYA 1CGVA 3OLGA 4EKJA 4CVWA 3WD3A 2BFGA 4B9YA 4AZCA 1C92A 2YJQA 2E9BA 3W6LA 2VZSA 1QW8A 4UFIA 1ISWA 2TAAA 4FLSA 5BXRA 1UYQA 1B0IA 1EA9C 4P8VA 3RO8A 2JFEX 3RPMA 1W3LA 4OJYA 4BQ4A 2FH6A 4WKHA 4P8XA 2XM2A 3PZVA 2DT2A 2EJ1A 1BYDA 3WQ6A 3VM7A 3D5HA 1E6NA 5A69A 4GQRA 1PJ9A 1WDRA 2O9TA 2G8ZA 1CXEA 1OIMA 2DH3A 1GOIA 1J01A 2WBGA 3L4WA 2A3EA 4AZBA 1GPFA 1I1WA 1WKYA 1NWUA 4PMYA 3AZRA 3TA9A 4AMCA 4PMXA 2OSYA 1E6XM 5ABGA 3EMCA 2J7GA 2OYLA 1TFVA 3MU7A 3PZUA 4K68A 1LWJA 1Q6CA 3AS2A 1HF6A 1UD3A 3K8KA 5AC5A 1BPLB 4TTUA 1CBGA 3NDZA 2DSKA 1UH2A 2D1ZA 3T2OA 2CERA 3WKZA 4ZE4A 3WNOA 3DYPA 4NI3A 5CGTA 3ZR5A 1HJVA 2DPEA 3WD4A 1FH7A 4ZE5A 3M6DA 3SCRA 4LPCA 3PHAA 1ZB5A 3ARSA 3QOMA 1WDQA 3W81A 1E6ZA 5GPRA 3B9DA 1WAWA 3OG2A 4UTFA 1CGUA 2AOSA 3NSXA 2CCRA 1B2YA 1WB0A 2WWDA 4IPNB 3WF3A 5FL1A 4TX8A 1CIUA 3GXIA 2VC9A 2OWCA 1JIBA 4BQ3A 1LLOA 1JXJA 2YLLA 1QW9A 2WNWA 1G5AA 1SYTA 2CESA 3VNYA 1JZ2A 1KB3A 3WL0A 3TTOA 4JCLA 4MTVA 1NOFA 1E15A 1MW3A 4W7UA 4WK9A 3AHZA 5E0FA 1HL9A 1CPUA 2WBKA 3FXYA 2VOTA 3WQ5A 1CGWA 2C7FA 1UKTA 4UQ9A 1UR2A 3CZ8A 4B15A 1U33A 4AC1X 3GBDA 1DHKA 1C90A 1YHTA 1QI5A 2GJRA 3WMBA 4OIFA 4M24A 3IJ8A 5E9AA 3W25A 1WZLA 3WQ4A 2VQUA 3VOCA 1V3LA 1W3HA 3W26A 4AXNA 3AFBA 5EBAA 4JFUA 4KRTA 2J4GA 2CKSA 3AIUA 3GH4A 2ZUVA 4QCFA 5ABFA 1D7FA 1UKOA 3FHAA 2ZXDA 2WANA 2A3CA 3N15A 3M07A 5I23A 1OM0A 3I3EA 1XYFA 3NSMA 2XFFA 5CPSA 3AIEA 1LWHA 2WLYA 3T2PA 4U31A 3PN8A 4W7WA 3O6AA 4M29A 1V6WA 4W8BA 3I3DA 4LYQA 1E1FA 2VL4A 2RGLA 1PBGA 1SMAA 2XVLA 3TONA 2G3IA 3S6TA 3T0DA 2XIIA 3WUEA 5FCZA 1E6QM 1ZU8A 2VQTA 4KRUA 4AIUA 1SFSA 2GK1B 4J27A 3WUBA 2G3MA 4JZ5A 2FGZA 3BSHA 3U5YA 2PB1A 1EO5A 2VRQA 4AEEA 2BVDA 5HPCA 3NSNA 1G9HA 2ZX5A 4W87A 1C91A 1GORA 3IK2A 2EQDA 3HJEA 4MNJA 4D6JA 2O9PA 2VCCA 4P7RA 3F4VA 4MDOA 2XM1A 1NOWA 6A3HA 3T09A 1CTNA 1TR1A 5HBFA 3ZJKA 5EMYA 2WSPA 4J28A 4D72A 3WDJA 2O92A 1VFOA 3AHYA 3DYOA 1QBBA 1DWJM 1VEOA 4TVUA 4FLQA 2AAAA 7A3HA 4U5IA 3ARRA 5I24A 3PBGA 1JD7A 4AYSA 1JYVA 1KWKA 2VVSA 3ZT7A 2D23A 2VZOA 5HPOA 4MNKA 5DFAA 2CHNA 1IZKA 3J7HA 3BLPX 5JUVA 2WKGA 1HJWA 2BHYA 3CLWA 1BG9A 3AS3A 3BH4A 4JFVA 4OKDA 4RE3A 1LG2A 5LA0A 3VIHA 5CPQA 5ABEA 5JIPA 3UR7A 1ZL1A 4S3KA 1XD0A 1JXKA 1SR0A 2VI0A 2HVMA 2WC4A 1J0HA 1TUXA 2CPUA 5CJ5A 3BAIA 1B3ZA 2Y24A 5EFDA 3VGFA 1JDAA 1C8QA 4H7VA 1GVIA 1WZAA 1MYRA 1KQYA 5A6KA 1VF8A 1WPCA 2WXDM 1UWUA 1E0WA 4J3WA 1MFUA 4AW7A 1AQMA 1US2A 2FDMA 4HPHA 3EBVA 4CCEA 2YDQA 3OLIA 3VMOA 4Z2KA 1L8NA 1GOKA 2JALA 3LMYA 1UD6A 1NM9A 2ZUWA 1W1PA 2WM0A 1KBKA 4IUGA 4R5EA 3VDCA 3CUIA 2WMFA 4AD4A 3OGVA 1JI1A 1UWSA 2XWEA 3MSDA 1PZ3A 3WH8A 4J3XA 3TP4A 3O2LA 2XGIA 3L4YA 5BXPA 4GI6A 4JFSA 4DUVA 3G6LA 3VKKA 4B3KA 1JFHA 4GI8A 1VB9A 1VRXA 2E9MA 2F61A 1JZ3A 1JAKA 1E70M 4XZWA 3OGRA 4NRRA 3UERA 2XIBA 4PRWA 1K9DA 1BYAA 1UKSA 4JFTA 4WLCA 1EGZA 3EMZA 2OYKA 3L4TA 2D3LA 2ZUMA 3QOKA 4HA4A 2ZICA 1Q6GA 2E8ZA 3ZJ8A 4W5ZA 5A6JA 3N04A 1H09A 1Y7VA 5CSUA 1OWQA 2X0HA 2X05A 1OT1A 1E6PA 3UR8A 3U57A 3EDDA 5A94A 3BLKA 3RIKA 2WCGA 2YBTA 4XV0A 4AD0A 3ALGA 5CPTA 1V3IA 2WHJA 4M8UA 4UZSA 2FHCA 2YDRA 4PMUA 1EHNA 1C8XA 5DT7A 1QNSA 4M82A 1M03A 3TTYA 3F5KA 3NYDA 1ISZA 3RM4A 3VINA 1CDGA 3WD0A 2RGMA 3WH6A 2A3BA 5E70A 1FP8A 3WF1A 2NSXA 3VX1A 2PBOA 3AISA 3WSUA 4EANA 2ZXBA 1XV8A 1KGXA 2WVSA 1XH2A 5CGMA 4TVCA 5FIPA 2UY2A 4PN2A 2PWHA 1E40A 3WH7A 4M56A 3N12A 1XCXA 3IJ9A 4MJ2A 1QI3A 2WZIA 3VM5A 1TCMA 4UOZA 5I3DA 2CIPA 2Y4SA 4MPKA 4NF7A 4D6HA 5GNZA 4AY1A 2BY2A 4PTMA 4PMQA 1BHGA 1CGXA 4QLLA 1HVXA 3CHCA 2XVKA 4JKMA 1PIFA 2BVTA 3N13A 4U33A 1TZ7A 1TA3B 2GJXA 2AMGA 2CYGA 1UZ1A 3T0AA 1WZMA 1LQ0A 3MANA 4HZ6A 1GOWA 4CU6A 3MO4A 1NP0A 2XSBA 4DWSC 4M80A 3ARVA 3VMNA 3T2QA 4W85A 3VGHA 4MB4A 2E40A 2JE8A 1KFWA 4HOXA 2CBJA 2VCAA 4CVUA 1HJUA 4RL3A 5A3HA 3G6MA 2VURA 2WC3A 2CEQA 1V0KA 3BXWA 4TTGA 1W9BM 3II1A 1GOOA 1Q6EA 1CYGA 2GUYA 2MANA 2XWDA 3AXIA 2NW0A 2YDSA 4FF5A 4GKLA 3WEOA 4EE9A 5M3WA 1JNEA 3UCQA 3W24A 4N42A 5E09A 2BXYA 3VIOA 1FHLA 1UOKA 4AZ7A 4WIWA 4XX6A 1HJXA 2NT0A 4D6IA 1NOUA 2BS9A 1VBRA 1H11A 3AXXA 4NZCA 3BAXA 1JGIA 2JIWA 3N11A 2J79A 2A3AA 1JZ5A 2CXGA 1K9EA 3PZ9A 2DQXA 4GO8A 5FOOA 2YL6A 3M46A 1E3XA 3VIIA 2Y2WA 4D71A 1PX4A 1JL8A 4PSRA 3VIGA 4N0RA 1XC6A 2WKLA 1E0XA 3LPGA 4U2ZA 1B9ZA 1QBAA 1O6IA 3GYCA 2Y8VA 2WLZA 1Z32X 3MKKA 3WF4A 4FLRA 1HJSA 1S46A 4QLJA 4U3CA 2W63A 3BMWA 1YQ2A 2VR4A 2VRJA 2D24A 1QI0A 3OGSA 3CZKA 1WCGA 3THDA 2B31A 1VJSA 3VPLA 4F9JA 3AMLA 3GTNA 1EOMA 4UQBA 4P7QA 5BRQA 1GHRA 1EIBA 3IJ7A 2Y8KA 3ZT5A 5DF0A 4MDPA 4JHOA 4ML4A 4PMRA 3ALFA 2QLYA 4UQCA 1UQZA 1VBUA 3AIWA 4QAWA 1E72M 3CMGA 2XVNA 3MUAA 3KL0A 3MV01 2C8NA 5KZ6A 2WWCA 3HU7A 1JFXA 1M7XA 1DTUA 1FOBA 1GOQA 3KZSA 3WQWA 4CD6A 1W9PA 2YL5A 1UWRA 5CZKA 2WPGA 2WW5A 1EH9A 5EB8A 3ZJ7A 2QMKA 1M53A 1NWTA 3ARQA 3W6MA 1OGGA 5HXMA 1ITCA 3VGGA 3FHQA 2WHLA 4W89A 4ATWA 1K6AA 5IFTA 3AHVA 2VVNA 3A6OA 4WKAA 1ESWA 1ODZA 2J25A 1XH1A 4S3JA 4WJXA 1EQCA 5D4YA 3VILA 1JZ8A 2DSUA 1B3YA 3SUVA 5JBEA 1KXVA 4P7OA 4TUFA 2CBVA 1JNDA 4RE2A 3AROA 2G41A 5BRPA 2DGAA 2FH8A 4KMQA 1GCYA 1OD0A 2YA1A 3WIJA 5I0DA 3POHA 3CTTA 4BQ2A 4UFKA 4B16A 1H1NA 3ARWA 4NRSA 5D8WA 7CGTA 4IM4A 3WD2A 1V6UA 3CZEA 2WC7A 5BWFA 5AY7A 5EFFA 1E6SM 4AD2A 4J3UA 4ZXOA 1GOMA 3UG3A 3WD1A 5IHSA 1E4MM 1OGBA 2WVTA 1CXKA 1EDTA 1OT2A 3W29A 1W2PA 4CD5A 4AZHA 4JCMA 1IT0A 1HKKA 2OSXA 5AYIA 1BG4A 2WHMA 5JBDA 3A4AA 3LPOA 2JEPA 1KR1A 4U5KA 1FH8A 3MMDA 3U5UA 4QCEA 1E5NA 3BAKA 1JDDA 2DDXA 3M7SA 1MFVA 1E56A 1CGYA 2XSAA 3WNPA 1BLIA 4CN6A 5CSYA 1KXQA 1NH6A 2BXZA 3VDAA 3UG5A 1V08A 1VJZA 4WSJA 4D6GA 2DSZA 2VMFA 1UWIA 2YL8A 1EOKA 3ARTA 2C0HA 4DUWA 5C70A 3VIPA 4UCFA 4ACZA 5A2BA 1QHPA 3PTKA 1J0JA 4FLOA 4M81A 3W0KA 2W66A 1OGSA 4J7RA 3CZLA 3O9NA 1BQCA 1W9XA 2E3ZA 2JF7A 3CZGA 2J7EA 1ZBVA 3CUGA 3LPPA 3K1DA 5D9MA 3W38A 1NWRA 1CNVA 2CBIA 2DSVA 4HA3A 2PWFA 5DEZA 1GVYA 1ISVA 2YA2A 5FL0A 2FGLA 3DHPA 3IAQA 1W1VA 4PTXA 5I78A 3AS1A 3ZT6A 5IHRA 1QNQA 1KXTA 3L4XA 3WMCA 1CXLA 1ODUA 1R8LA 5FD0A 2JF6A 2ZOXA 1R87A 4V28A 1JYWA 3PZNA 2W92A 1PEZA 1GZJA 4BCEA 2GSJA 4BS0A 4P8UA 2GDVA 5AYBA 2D2OA 8A3HA 5LYRA 1CENA 3N1AA 1G1YA 1WE5A 4PMDA 3VU2A 1UR8A 4F79A 1E55A 2IXUA 4PMZA 1RD6A 4FK9A 3FY1A 5A8MA 1GONA 4PMNA 1BFNA 2Q8XA 2GJPA 3WQ8A 4GI9A 2YKKA 4QFUA 2G4FA 3MSGA 2A3HA 2PI6A 2WMJA 2BHZA 1KQZA 1XH0A 3OA5A 4R27A 2BY1A 4YHEA 3PZIA 1E5JA 2WB5A 3E1F1 2VUYA 5BXTA 1CEOA 5A6BD 3F5LA 1B30A 1W9VA 1CWYA 4CCDA 4A4AA 3DC0A 4TXEA 4MADA 2EEXA 1V3JA 3WFZA 3GBEA 1LL7A 2ZUTA 3WH5A 2ZX7A 3CHEA 4KH2A 2QV4A 2WSKA 4LGXA 1XRVA 4GZEA 1V02A 1AMYA 1MWOA 2WVVA 5A95A 2WCSA 1CLXA 3WDHA 2ZXAA 1HIZA 3TOPA 1LJYA 2OSWA 2BV9A 2PWGA 4CGTA 2XUCA 1G01A 3CBWA 3FW6A 3KEHA 3WDRA 3RILA 1G94A 1E3ZA 2VCBA 4X0NA 5D9OA 4OOUA 4H8VA 4DM1A 2V3FA 4AZCB 1B3WA 4GIAA 2UY3A 3ZR6A 2DT1A 4ZXLA 3AIBA 1X1NA 1V0NA 2JEQA 4C7DA 3T08A 3WNKA 4D6FA 4BF7A 2CITA 2X09A 1HKJA 1E1EA 3PTMA 4ATLA 4GINA 4OUEA 1R86A 3ZJ6A 3HN3A 1ZS2A 2EPMX 3QHOA 4DWSA 2VZTA 4P8WA 3FAXA 6TAAA 3AOFA 5I5RA 3APGA 3ZM8A 1MW0A 4JKKA 3CIVA 1D2KA 3EDKA 3N9KA 1GQJA 2J7DA 3L2LA 1HVQA 2X8RA 1D3CA 2V5DA 2QF8A 3CHFA 1J9YA 1N82A 2WMKA 5CQ1A 2WCAA 5E6YA 4BZYA 3PTQA 1W9DM 3VGBA 3SCNA 2WMGA 5DO8A 4A3YA 5GNYA 4JHZA 3N17A 2DSWA 2VX7A 2V3EA 3K46A 5A8NA 1A47A 1W32A 4HMEA 3WBAA 2XGBA 2YL9A 3IANA 2EPKX 3WNNA 3CUHA 4AIEA 4CD8A 2GDUA 5I6SA 4CD7A 1W3JA 1IV8A 3BAWA 4UFLA 5IXEA 1ZJAA 1RP8A 2BNJA 2XPKA 3NUKA 4UOQA 1K9FA 4PTWA 1V6YA 3VIMA 3EDEA 4KGLA 4QLKA 1ZJBA 4H2CA 3GZAA 1E43A 2PC8A 1WO2A 1FH9A 2VX4A 1KXHA 4Z2HA 1GHSA 1BYCA 3EDFA 4E8DA 3ZOAA 1CXIA 1TVPA 2EBNA 2QPUA 1WZKA 4UOJA 1I75A 3FAWA 2OWWA 2J7BA 2WZEA 2FHFA 4ZENA 2VTFA 3WDPP 1WDPA 2V5CA 3SURA 4Z2IA 4CN1A 1UH4A 5M5DA 3BMVA 4J3TA 4IISA 2W4XA 2X0YA 1ECEA 2GK1A 1PAMA 3OZOA 2BY3A 3RM8A 4D6EA 4W86A 3CPUA 4MAVA 5A8QA 3WQVA 1WP6A 1UH3A 4OOZA 1UUQA 2JIEA 3MMWA 4WKFA 2W67A 3VO0A 2ZUNA 1C7SA 2EO7A 3RJYA 1NQ6A 1UD8A 1HJQA 2DIEA 4ZFMA 3HMCA 4C7FA 4GZIA 5ABFB 1W9UA 4UQEA 2ZWYA 2VZUA 1WNOA 3S2CA 1B90A 4CU7A 1NP2A 1ISXA 1U2YA 1DWGM 3WH9A 1UR0A 1ZBCA 1FHDA 4ACZB 1V03A 2BY0A 1C7TA 3WELA 3CO4A 1FFQA 4JFWA 1QHZA 1CLVA 3WUFA 3VTRA 4MNLA 2O9OA 1PZ2A 1ITXA 4GZJA 5A8PA 4L4OA 6CGTA 3WDQA 4UFMA 1UR4A 3SCTA 2J8FA 1TMQA 2PF0A 1FP9A 2ZE0A 5D8ZA 3WEMA 2EPNA 2OWXA 1XCWA 4YPJA 5E6ZA 1DWIM 1MXDA 2XG9A 4HOZA 1L0PA 3GNRA 1XSKA 1MVYA 5C71A 1E73M 4MNMA 1UWQA 3AHXA 1HX0A 1QNRA 1QVBA 3A4XA 1C8YA 1U30A 1LL4A 5A2CA 1E0VA 5A6AA 2CHOA 3EYPA 3GXMA 1GW1A 2J47A 4D1IA 3KL5A 1QPKA 1PX3A 3BCFA 1JF5A 3WL1A 2GVYA 4OZOA 4AZGA 3VD5A 4E8CA 4WF7A 1OINA 4E4PA 3ZO9A 3AIRA 2V38A 3OB8A 4X9YA 4YN5A 4HP5A 1JG9A 3ARPA 5C8BB 1DP0A 4A3HA 2XFRA 4JKLA 4URIA 4AZIA 4AIOA 1CGTA 5DT5A 3GH5A 4Z2GA 2Y5EA 3QR3A 2HISA 1VEPA 3MMUA 2BVYA 1LF1A 4U2YA 4HZ7A 3FNDA 1GNXA 3NDYA 1FA2A 3A4WA 2YOCA 1NARA 5A6LA 1VFUA 1F4AA 2XYLA 5A1AA 4HA1A 3AZSA 1Q6DA 4TVDA 4GPNA 3TTQA 3SCSA 3SCUA 5TD4A 5LA1A 1H3GA 3SCPA 3W37A 1OBAA 1P6WA 1JZ4A 2WVVB 1W3KA 1UKQA 3WN6A 3AMKA 5DMYA 2DH2A 2QHAA 1B3XA 3PZMA 1R85A 4UFHA 2DT3A 3WNMA 1I1XA 1HP5A 1Q6FA 3SCWA 3AIQA 5F7UA 2E9LA 3PZQA 2WVUA 2J77A 2PWDA 3K8LA 1KR0A 5KEZA 1UG6A 3L4UA 2J74A 3GXFA 1JI2A 1J11A 2VZVA 1J12A 4PEEA 4RE4A 3GH7A 3BC9A 1QHOA 3OLEA 1E9LA 4B9ZA 3BAJA 3ARXA 3LPFA 2OLHA 1KCLA 1KGWA 4W5UA 1H49A 1AQ0A 4JL2A 1LL6A 5GQBA 1EO7A 3CGTA 2WYSA 1V6XA 2PBGA 3UETA 1J18A 2J8GA 4PCSA 3VIJA 3EDJA 5I79A 1OIFA 4DWSB 4J3VA 1MQQA 1W1TA 4PTVA 3A47A 3ZIZA 1H2JA 4PUEA 2VRKA 4QP0A 2EXOA 5A6SA 2ZX8A 3AYRA 4D6DA 3BSGA 4DM2A 4CD4A 3OLDA 5I77A 3SUWA 1AQHA 3AZTA 1W91A 4F9DA 2V3GA 1QNPA 3K8MA 4F8XA 2EPOA 3VGDA 1V6VA 1M04A 2DIJA 2WMIA 3AS0A 4DUXA 3SCQA 3BCDA 3RDKA 5M17A 1IZJA 3B9AA 2J7FA 2WZHA 1BSIA 1B3VA 1TA3A 4LQ1A 3AMCA 1UHVA 1A3HA 2D3NA 2F2HA 4EAMA 1W2VA 1CXFA 2XVGA 3UEQA 1JYXA 3CH9A 4W84A 2PWEA 1US3A 7TAAA 2J7CA 4OBRA 4JIEA 3VUPA 1QI4A 4AZ5A 2VR5A 1BYBA 4MB5A 2J62A 1O7AA 4ZEPA 1ISYA 4HZ8A 2UY4A 2GFTA 4XUYA 1EDGA 4HOWA 2D0HA 2IUZA 1E71M 1RP9A 5CXPA 3K4DA 1GUVA 4TOQA 4GQQA 1UR9A 1XHGA 4AD1A 4HPGA 1HL8A 1MQRA 3AI0A 3CHDA 3W28A 4J3SA 4KGJA 3SUUA 3A3HA 4KWUA 5JBFA 4Z2LA 4MJ4A 3PZGA 4D6CA 4HU8A 2XTKA 3WENA 1CZ1A 4PSPA 3RMEA 5ABHA 1JZ6A 1H0GA 2UWFA 4WSKA 3VIFA 3WFLA 1JZ7A 1HN1A 1MW2A 3SIMA 1MW1A 3AJ7A 2D22A 1W1YA 2GJXB 2VJXA 3VDHA 1XSJA 3RM9A 2E4TA 3L2MA 3AQUA 1KWGA 1E4IA 1VFMA 2XHYA 5HOSA 1FFRA 3MS8A 3ECQA 1X6LA 4DWSD 3ARYA 1VAHA 1BAGA 1UR1A 5BROA 3NJ3A 3AICA 1V0LA 4GO9A 1J0KA 1J0ZA 2ESCA 2OYMA 2YIHA 4OBSA 2Z1KA 2VNCA 2CKRA 1XD1A 3WNLA 2Z1SA 4PUDA 1LG1A 3KL3A 4CN4A 5A8OA 5D9NA 3VIKA 3VVGA 4MAZA 4D1JA 4HMDA 4W8AA 2FHBA 2ZIDA 3NCOA 1CECA 4HU0A 3SCVA 1QNOA 1F4HA 4Q22A 4XZBA 3VD4A 1BVZA 1XSIA 3ZSTA 1EXPA 1OD8A 3POCA 3W82A 4YHGA 1UWTA 3W53A 1RPKA 4W7VA 2VX5A 4UR9A 1NWSA 2G3JA 1PX8A 1E6RA 3W27A 2YBUA 1OB0A 3OIHA 5CLTA 1TVNA 1KCKA 2CNCA 1BGAA 4B3LA 4UZUA 1XYZA 4LYRA 3GXDA 2QMJA 3K4AA 5GNXA 1J10A 1QOXA 2J7HA 2W91A 1CXHA 1V3HA 3IAPA 1HXJA 1KBBA 3KE0A 1E4LA 2ZUSA 1HNYA 4PMVA 4H8UA 1GJUA 1ZBWA 1VFFA 1R7OA 5I2UA 2D20A 1BF2A 1UD2A 3BAYA 4P7LA 3OBAA 3B9EA 3WMSA 3SUSA 2CETA 4CU8A 2BHUA 4AWEA 3L4ZA 2VO5A 2X1IA 3CZJA 3TTSA 1E4NA 1GQKA 5IDIA 4V2XA 4UFJA 4V27A 4HTYA 4L4PA 5BCAA 4ATDA 2ZX9A 3AHTA 4XB3A 1UD4A 1H41A 1C93A 4LXFA 2XJ7A 1SMDA 4TX6A 1V02E 3WF2A 2D0FA 2XFYA 5HNNA 1JF6A 2ZXQA 1JAEA 4LYPA 1V0MA 5BXSA 1HP4A 1PIGA 1VENA 1OCQA 2WHKA 3W4RA 1J0YA 3PZTA 2E0PA 3WBEA 3MUZ1 3THCA 4FMVA 3SUTA 5LA2A 4CKQA 3SCOA 3WEZA 4QDMA 1HKMA 5A6BA 4AD5A 2QPSA 4HMCA 1ZBKA 1UQYA 3WF0A 1DWHM 2WK2A 4BA0A 3WY1A 4IPLA 2ZUUA 4Q7NA 3ZSSA 2W61A 4W93A 4E2OA 3VD9A 3KWXA 3NIYA 1UKPA 1MQPA 4NSBA 4U3AA 1TE1A 1EDQA 2D0GA 1QI2A 4P7NA 2G3NA 1GJWA 2V3DA 1PPIA 4C7GA 3VX0A 3ARUA 5BYWA 1HT6A 3AMGA 3B8SA 1JDCA 2X2YA 3EMQA 3GM8A 3GNPA 3CUFA 4BQ5A 2ZWZA 1GQIA 2XVPA 3U7BA 4MB3A 1R7AA 3OZPA 3AXHA 3QHMA 5IFPA 2ZX6A 3RCNA 9CGTA 4W8LA 5CLWA 1M01A 1DEDA 4F66A 1BGGA 4PMOA 3VD7A 3VNZA 1XGZA 2YLAA 3PZOA 2WMIB 2DEPA 2NT1A 3QGVA 1UA7A 1JD9A 5E0CA 1DWAM 4UNIA 4UQAA 1J0IA 3DHUA 4PCTA 3GNOA 4EK7A 2EPLX 5A6MA 2VX6A 2VT0A 4Y7EA 3ZQ9A 3L4VA 3AYSA 2UY5A 4PYSA 3VMPA 4AEFA 4M1RA 1WDSA 3DECA 5A2AA 3D3AA 1UD5A 8CGTA 3VDBA 1C3FA 1TG7A 4GXPA 3UG4A 1V3MA 3AMDA 1UA3A 1B1YA 5ECUA 5D9PA 2O9RA 2WAGA 3MUY1 3GDBA 4CUCA 5M03A 2CBUA 3UESA 3N18A 3WDIA 1JYNA 5AC4A 1UZ4A 3QHNA 1OSEA 1GQLA 1BTCA 2E8YA 4CCCA 3VGEA 3ARZA 3CUJA 1AVAA 1BVNP 3SEPA 2DT0A 4UQDA 4ACYA 1DWFM 1K9TA 3FN9A 4JL1A 1H4PA 5CG0A 2YA0A 1HKIA 4X0VA 1H0IA 1H5VA 4H41A 1MXGA 1VEMA 1V3KA 4AZ6A 3I3BA 3MV11 3U7VA 2W62A 3F5JA 2WMHA 3VD3A 4LX4A 4AISA 3MUIA 3JUGA 1EHAA 2IXVA 3WUGA 4MB1A 2J75A 4Z2JA 3CMJA 4H8HA 3T0BA 1EQPA 5HDRA 3RJXA 4PBGA 1VIWA 1G0CA 5JIWA 4AD3A 4H04A
chains in the Genus database with same CATH superfamily
2W5FA 2F8QA 3OO2A 3T8QA 1LOLA 1OFRA 3DYMA 4Q8QA 2VEIA 3ITTA 4N02A 1TTIA 2ZFAA 4ZSTA 1HZYA 3AIVA 3TX9A 5FKYA 1CGVA 3OLGA 3RX2A 1XCFA 2BFGA 4B9YA 3CV1A 1BRLA 3W6LA 2VZSA 1QW8A 2V2DA 3PAOA 4DZ5A 4P8VA 4G1NA 1F7BA 4S3CA 3KBVA 3R4IA 2Z6IA 3PULA 2H8ZA 2XM2A 1XLLA 2EJ1A 3MZNA 5D37A 1BYDA 3D5HA 3KOWA 4BR1A 1OK4A 2HVOA 4GQRA 3WQCA 1WDRA 2O9TA 1Y5XA 2FVLA 1FQ0A 1M41A 4GUJA 1CLKA 1GOIA 2A3EA 3LDVA 1S2UA 3NQEA 4AZBA 5DBUA 5D02A 4ES4A 4PMXA 6ALDA 2OSYA 3OQEA 2J7GA 1FWEC 1G4SA 3KM8A 4AB4A 4IPJA 3NYZA 3KXQA 1UD3A 4C6JA 1BPLB 4TTUA 1CBGA 4F3HA 5HR7A 2DSKA 3R11A 1UH2A 2SFPA 2CERA 3FXGA 3P8IA 2C1GA 5EYWA 3R5EA 5EMKA 4NI3A 4XTIA 3DFPA 4FXJA 2Z2AA 2E5BA 3VK5A 1AH3A 2DW6A 4JN6A 1V51A 4LPCA 3B04A 3JZUA 3W81A 5GPRA 1A5AA 3B9DA 1GTEA 2AOSA 2WSQA 4KWOA 5M2FX 1AL7A 5FL1A 2PDGA 3MBDA 4AQLA 3L21A 1LLOA 4BQ3A 3LLXA 5LIXX 4GBDA 4JCLA 4MTVA 1NOFA 1HL9A 5FJPA 1CGWA 4AC1X 4Y6GA 1DHKA 3NNTA 4OE7A 1YHTA 3OQ8A 4OIFA 4C6EA 3W25A 3NO1A 1JVNA 2Z1VA 2VQUA 5FAGA 3W26A 3KZPA 4AXNA 3AFBA 4AWTA 4KRTA 2J4GA 3V7PA 2IKIA 2CKSA 2GUBA 3AIUA 1RJPA 1O5XA 3C52A 2PDXA 3FHAA 1FRBA 3P3BA 4EPBC 3LLFA 3NZQA 5I23A 2VDGA 1OM0A 3IIZA 3VYLA 1JCNA 4FX8A 4UR8A 3O6AA 4HK5A 4W8BA 1F74A 2E67A 2DW7A 3GWQA 4F2BA 5LSMA 3TONA 2DZVA 5EL1A 2XIIA 1E6QM 1HUVA 4KRUA 1SFSA 2OPJA 1ONRA 3U5YA 2PB1A 3E5PA 2VRQA 4IJCA 2BDQA 1XLEA 4C6BA 4YWIA 1C91A 4HJWA 3HJEA 4H6EA 1P43A 2O9PA 2XIOA 3HJZA 3F4VA 1NOWA 3GAKA 3S5ZA 4JTDA 5H8PA 3T09A 2OLAA 1TR1A 2VWTA 5HBFA 2QPXA 2WSPA 4J28A 1VBGA 3U9IA 3DCPA 2R1MA 2O92A 1VFOA 2G5WA 3DYOA 1VEOA 3G1FA 2OGYA 3QXBA 1EJVC 5I24A 1A5BA 4CQ9A 1JYVA 1M65A 3S2LA 3BLFA 3ZT7A 1UP0A 2XH2A 1PL9A 3PP7A 2CC0A 3J7HA 5G2WA 4LUYA 4M6PA 3W22A 4B5TA 3D6NA 3G3DA 4I8YA 1KC7A 3W00A 2X40A 4CQCA 1LG2A 3ZZ1A 4ENLA 4Q32A 2A0NA 3GVGA 4QJ5B 2VHLA 4Y9AA 5JIPA 1S5VA 1TPH1 2VI0A 1JXKA 1SR0A 2HVMA 1TUXA 1IIHA 3OOQA 1RA0A 3P5YA 2Y24A 3VGFA 3R0KA 4ORMA 4AMAA 5AYXA 1E0WA 4J3WA 4JX6A 1AQMA 1US2A 5C2GA 4HPHA 4QIUA 2YDQA 3VMOA 5FI8A 1UR3M 3OZYA 2ISFA 3RLVA 1P0NA 2QVHA 4KS0A 4XD3A 1KBKA 4IUGA 3CUIA 4GABA 3TIMA 5H1WA 1NVMA 1FWHC 1P48A 3L66A 3FYOA 3UD6A 2PZ0A 3GXNA 3BG5A 4C6FA 4JTFA 5HAOA 2NUYA 3E0IA 1VB9A 4PB4A 1UWAA 4KWSA 4WY0F 3T4WA 5CSSA 1T0OA 5ABTA 3OGRA 2AAMA 1ZCCA 3KRBA 4S2CA 1XRFA 1K9DA 3T1GA 1UKSA 1OFAA 2RDTA 3EMZA 4YVXA 3XINA 2OYKA 4UTKA 2R1PA 3L4TA 3FS2A 2YB1A 2ZUMA 3QOKA 3EWYA 4B5NA 1E0UA 4HYVA 4IZGA 2P8BA 2Z2UA 1XM3A 5A6JA 3PB2A 2OZ3A 3WLHA 1FX6A 3LI0A 3WG6A 1OWQA 3E12A 1SZFA 1E6PA 3E2SA 3EDDA 3APTA 2YBTA 4MSSA 3MY9A 5CPTA 1V3IA 2FTYA 2OZTA 2YW3A 3SY1A 6XIMA 4B5UA 2CLPA 4K2SA 3EOSA 2FHCA 4PMUA 1Q65A 3RNDA 1C8XA 2PDFA 2QIWA 5DT7A 1PCKA 3T0TA 3KVMA 1M03A 4AVNA 1PZ0A 3WZ0E 4LAMA 4TX9A 2PSNA 5EMLA 3G24A 1Q85A 3F2CA 4I7UA 4IMCA 2Y70A 3VNDA 5HINA 3ZWSA 2ZA3A 4GYPA 2PBOA 5DY3A 1PKNA 2BOGX 2QJHA 1EX1A 4LS0A 1XH2A 3DN5A 4TVCA 3ITCA 1E40A 3CEPA 4M56A 3N12A 1KW1A 1OC6A 4UOZA 4GQ0A 2CIPA 2OX4A 1DJGA 2OOGA 4NF7A 3ZFHA 1U1HA 1UUOA 3H54A 4K1WA 3FIGA 4LFYA 4PMQA 3LB0A 3KLKA 2XVKA 2P5NA 1TA3B 2AMGA 3PBMA 2XN1A 4HZ6A 3VUSA 4CU6A 4NIRA 2Q6ZA 3VMNA 4GQBA 3UZWA 3VGHA 4MB4A 1XPYA 3E5BA 3EA3A 3L5LA 1CI1A 3TNBA 1MXSA 2QCFA 4N4PA 3HMJG 1JCJA 5DXYA 1F3EA 2GQ9A 1V0KA 4NAFB 4TTGA 3R10A 4H7CA 1GOOA 3GDMA 4WJ8A 1QRQA 3HGOA 1A3WA 1K8ZA 4PCPA 2XWDA 4FF7A 2YDSA 4FF5A 4IMFA 3UF9A 1JNEA 1QU4A 4LRTA 3L0KA 1FHLA 4TMCA 1JCLA 3UXIA 1H7OA 2NV1A 2NT0A 1S3TC 3W86A 3ABXA 4JTIA 1VBRA 3NPXA 3CK5A 1H11A 2OT0A 3BAXA 3KRSA 2JIWA 2J79A 1XUZA 2CZ5A 1JZ5A 1K9EA 1NDVA 5FOOA 3M46A 1M7OA 4A2SA 2YZ5A 2E25A 3LBOA 3VIIA 4D71A 3QZAA 4GNVA 3VIGA 4FR6A 4Y9OA 2BOFX 3PJUA 2R6OA 4QITA 1QBAA 3GDKA 2HBVA 3UNTA 1EJSC 2WLZA 4EPEC 3WF4A 4DY1A 3LHVA 4QLJA 4LY8A 1THFD 1B4KA 3BMWA 2VR4A 2PGRA 4B5SA 2Z6JA 2ZRXA 3CZKA 1WCGA 3THDA 4A8RA 3OU8A 3VPLA 4F9JA 3GTNA 4UQBA 1EIBA 4LUJA 4M51A 1MEHA 1QK0A 3MB9A 2ON3A 3N2MA 1GYNA 1A5OC 4ML4A 2QLYA 3AYVA 4UQCA 8RUCA 5HWNA 1HO1A 4FNSA 1I9CB 4NX5A 1UMLA 3RYSA 3HU7A 1JFXA 1R9ZA 1YTDA 1DTUA 3TUUA 3GS6A 2JGQA 1UWRA 4XKYB 1EH9A 2E6DA 1A0DA 1EP1A 3ZJ7A 3A23A 1M53A 1NWTA 1OGGA 1W1B1 1ITCA 4W89A 3F4NA 1GVSA 4CCZA 5XIAA 2RJHA 1WOBA 1B3YA 4TUFA 3MI3A 2C1IA 2G41A 5BRPA 2DGAA 3H21A 2YA1A 3WIJA 3POHA 4Q8PA 4PUMA 3LHZA 3TROA 4A29A 4G7EA 3ARWA 3WLKX 5C7VA 4IM4A 3WD2A 5KZDA 3CH0A 1R5YA 3GDLA 3DKJA 1IR1A 3KLLA 2EHHA 3UG3A 4DJDC 4JIIX 1FDYA 2WVTA 2VFGA 1EDTA 1ADDA 1Z41A 4CD5A 4AZHA 2ZQ0A 2OSXA 5HQEA 4AX6A 4O11A 4QTGA 2OR2A 4H83A 3R13A 2FFCA 3A4AA 2JEPA 2PA6A 6XIAA 5TF0A 1ZALA 4QCEA 1I2QA 2DDXA 1CGYA 2XSAA 3VC5A 1ZQ5A 1NH6A 3VDAA 5CSRA 4WSJA 4RZ5A 3IRSA 2DU2A 3MSYA 2VMFA 4WCJA 5HNTA 4LF1A 3W7LA 1EOKA 3D46A 5CPNA 3VIPA 4PB5A 1AODA 1OF6A 1I2OA 4Q8OA 4LC8A 3WFAA 2BG5A 1VFTA 3B03A 5LXEA 3W0KA 4M81A 3EXRA 3TJIA 3QW4B 3W76A 1RY0A 2PMQA 3O9NA 5AOUA 4WXYA 5C9UA 2A85A 3LRKA 3SADA 3V5OA 2G95A 3CUGA 4NJGA 3KVLA 2ALRA 1NWRA 2W9MA 3AWNA 1WXJA 2HNEA 4GACA 2YA2A 1JDEA 3DHPA 4YTTA 3HG2A 2GVEA 1KTCA 1W1VA 4C1KA 1IWAA 3FVDA 3KHJA 3LS9A 1WKFA 3ZT6A 1QNQA 4YTQA 3WMCA 3M0ZA 2JF6A 1W56A 4JQ3A 1MMFA 4V28A 1XYMA 3S8HA 1K4HA 2W92A 1PEZA 1GZJA 2VC5A 2GSJA 3E2RA 5EA9A 5C55A 3HA1A 1OX4B 2A2IA 1WE5A 4PMDA 1UR8A 4PCFA 4P5UA 2AMXA 2IXUA 1RD6A 2P50A 4KEVA 3W7PA 4FK9A 1BVWA 1BFNA 1UW9A 1Z7AA 5DMLA 1O4UA 2J9ZA 4EACA 1POJA 3P5ZA 4YTUA 3UPBA 2G4FA 3DIPA 1SUXA 3MTWA 1DJHA 2PI6A 2Y61A 2ZC8A 4FS9A 4RDVA 3QY8A 4R27A 2BY1A 2GGJA 1LQAA 1W0MA 5EGRA 2YFNA 1E5JA 5HUPA 3U4AA 4J2PA 2VUYA 2NLYA 2PTWA 4US5D 5A6BD 4Q8NA 1FTXA 1GWJA 5H6HA 3DG6A 4N9EA 2E5CA 3DC0A 4UCGA 1JPIA 2EEXA 1LLZA 5B7ZA 3ABQA 2I57A 3GBEA 3WH5A 1Z89A 3ZYZA 2WSKA 3CS2A 2XU2A 1TPFA 4GZEA 1V02A 2I56A 1MWOA 4LUSB 3UPWA 4AY7A 1IGSA 3GNXA 2ZXAA 3GSMA 1KM6A 2BV9A 3GG0A 3OVRA 4PB3A 4BI7A 2PLMA 4CGTA 2XUCA 3CBWA 3ANUA 1K8CA 4ZB0A 5AC8A 2FLIA 2RKXA 3S9IA 1E3ZA 2VCBA 4OOUA 4H8VA 4GIAA 3AIBA 4O57A 3QC3A 3O15A 3W7CA 3WNKA 1XGDA 3KVJA 2PDMA 3BW3A 3GHUA 3LG3A 3Q4DA 1SZNA 2X09A 1HKJA 3C2FA 4ATLA 4OUEA 5HNUA 5TBOA 4XO7A 3ZJ6A 4H01A 5K9CA 3PNZA 3QR1A 4HU3A 3RAOA 3VA8A 5F2LA 4HCDA 2PODA 3TYZA 4JKKA 3NWRA 5LNVA 1YBQB 3CIVA 1HFBA 1GQJA 2DZBA 3HQNA 1D3CA 3K4WA 3QLLA 2V5DA 3CHFA 3KX6A 5D2TA 1IF2A 2WMKA 2CLOA 5AHMA 3NPUA 3PTQA 1BWVA 3UVAA 2VEFA 3LK6A 3RRXA 4DELA 4A3YA 3H22A 1K7FA 4DIAA 2HWGA 2I17A 2VX7A 1JCMP 3K46A 1D3HA 4O19A 2YL9A 3BG3A 4MWAA 4BEQA 2DIKA 4JQ2A 2EPKX 3WNNA 3UWQA 3CUHA 1Q2SA 1CCWB 3UPMA 3A12A 4CD7A 1W3JA 1IV8A 3P84A 4J2MA 3Q65A 3NFUA 3OJGA 3DFTA 3CAWA 3C0QA 1RBLA 4NYUA 3PBYA 4QLKA 2V2HA 4H2CA 3DKLA 2DQWA 2NVCA 1WO2A 1FH9A 4Z2HA 1C9DA 1KFLA 1TVPA 4EOUA 2QPUA 1WZKA 3K5XA 4H3DA 3IRDA 1ZP3A 4FNRA 2WZEA 4R85A 1D8WA 1F05A 3DGBA 3E02A 3C0JA 2NQJA 1WDPA 1QCWA 4WY0A 1JULA 2YW4A 3BSMA 3BMVA 3KS6A 4J3TA 1G7VA 2Q8ZA 2TODA 3C8FA 3P8JA 4ZO7A 1VLWA 2X0YA 1ECEA 2GK1A 2PURA 1L6WA 1TWIA 4WZHA 3RM8A 4CQDA 4L7ZA 4W86A 4IFRA 4LEFA 1XLCA 2NQHA 4H9TA 3OBKA 1C7SA 3RJYA 1NQ6A 1NF7A 1HGWA 1HJQA 3HG4A 4F0HA 4PRTA 1EX5A 2Z27A 3AXKA 2P3ZA 3TTEA 5MKGA 2Z24A 5ABFB 1GK8A 1Y65A 2ZWYA 4LH8A 1B90A 1K8XA 3LENA 5A6TC 4AF0A 5KZMA 3TR9A 3TK7A 4AHPA 1DWGM 3WH9A 1UR0A 3HV9A 2G0WA 1FHDA 1WDWA 3GK0A 2H9AA 2ZVIA 3CV7A 5CBIA 1C7TA 1TQJA 1FFQA 3MWCA 3VTRA 2PRHA 2O9OA 1A53A 4MFEA 5BU9A 4S23A 3KWSA 6CGTA 5E1QA 3I6EA 1VP5A 2GUUA 4PMJA 4LW7A 3GFXA 3GXTA 2PF0A 3UYIA 2ZE0A 5D8ZA 2V2CA 1NQKA 3BOXA 1ME9A 1L6GA 3B97A 1MVYA 4CEXC 5C71A 4MNMA 3URAA 2NQLA 4OV9A 3GVVA 3PPHA 1QVBA 3A4XA 1C8YA 1LL4A 5A2CA 1E0VA 3VE9A 5A6AA 1KM5A 2PEVA 5FJRA 2XIMA 5HNRA 3KL5A 1R6WA 2XGZA 4J4KA 1JQVA 1SJBA 1WBHA 1JF5A 2E1WA 2O4MA 5D38A 5IBXA 1T40A 1WXYA 1NFBA 1OX6A 1O5RA 3THQA 1RBOB 3N3TA 2V38A 3OB8A 3PFRA 3BTNA 4G9PA 5ECVA 3ARPA 4AH7A 2Z4GA 4LEQA 4IIFA 4HMNA 1VYRA 4OTKA 4URIA 3COTA 1EEXA 1EPVA 5DT5A 1EUAA 2V8ZA 1A49A 4I5UA 2HISA 2CLLA 1FXQA 3MMUA 3MYOA 1A5CA 4AU0A 1JUEA 4LBSA 5FJTA 1GNXA 3A4WA 3SJNA 3OIXA 4MY1A 4LF2A 2A7RA 4NKCA 5TD4A 5IM51 4QGCA 1JJKA 3SCPA 1P6WA 2EG6A 4NZJA 2FJUB 1RJQA 2IPWA 4FI4A 2V6AA 4HKPA 2DH2A 2VFEA 3BLIA 1B3XA 2Y5SA 2E7FA 1HP5A 2VKZG 1JDFA 1X8CA 1TV5A 1N7KA 4C5ZA 3RHGA 1Q6FA 1KTBA 4I5RA 1OZQA 2J77A 1KR0A 5H91A 2J74A 2FGBA 1W8GA 4PEEA 4JTTA 1QHOA 5D05A 5BMXA 1VZWA 1UCWA 4FX7A 5DANA 5GQBA 1EO7A 4K8GA 3UETA 5G4WA 4PCSA 1N2VA 1OIFA 1N8IA 1XIIA 2ZBTA 3RUBL 4J3VA 1MQQA 4PTVA 2VRKA 1XLIA 1O1ZA 3BSGA 5IBXC 3OW1A 3URQA 3GTHA 4IG2B 4QROA 3W88A 4YTSA 1M68A 5I77A 1K4GA 3SUWA 2C0AA 4F9DA 4ZA0A 1QNPA 1EEPA 3FK4A 1EJRC 3TU9A 1XC4A 2X0SA 3UXKA 1V6VA 5T26A 2WMIA 3AS0A 4DUXA 4XZ9A 1R3YA 3BCDA 1P5BA 1VC4A 2OOFA 4MKVA 3W1RA 4DLMA 3TMQA 1RLCL 4NHVA 3GU2A 1UHVA 4X22A 4L1XA 5EY5A 2DZXA 2OJPA 4O12A 3HPSA 4J5NA 3CNYA 1CXFA 4ECLA 2X1SA 1JYXA 4W84A 1QWKA 2PWEA 4EF8A 4OBRA 4AZ5A 4Q7IA 4UTWC 2UY4A 1Q13A 3FEMA 4XUYA 1EDGA 2PWUA 2D0HA 2IUZA 1RP9A 2V82A 1IR2A 4AD1A 3SIZA 3DFSA 3CHDA 1R3VA 2PDHA 3R8HA 4LRSA 4Z2LA 4MJ4A 3PZGA 1I8JA 1W1ZA 4D8AA 1TE6A 1D3GA 4TU1A 4XTDA 5ABHA 1QOQA 5FF2A 1MW2A 3KUMA 1WKDA 1LOQA 1O94A 1MW1A 4WVXA 3RM9A 5CJNA 1FY6A 4RV3A 4L6DA 4RZ4A 5HOSA 1FFRA 3MS8A 3ECQA 2J9XA 1BAGA 1CB2A 4OBTA 1MO0A 3H2OA 4DJED 3NJ3A 4MY8A 1V0LA 3CTLA 3UZ5A 3H2CA 3TCSA 3M5ZA 2OYMA 4NZ4A 4RX0A 4N2YA 3G77A 4OBSA 3V0TA 2CKRA 4QE1A 4V33A 3VCCA 3UZZA 4CN4A 4C91A 3AO0A 3VVGA 4MAZA 4W8AA 3T8LA 5FSEC 2G4JA 4E0CA 5U4NA 1OK6A 4HQVA 1PTAA 1EZ2A 3WK2A 2Y0FA 3ZSTA 1EXPA 4NZ5A 3S9ZA 2NV2A 2NUWA 1WKEA 3WK3A 4YHGA 3MCOA 3TYBA 1ZP4A 1ADOA 1RPKA 3PG9A 1NWSA 3MA8A 1Z6KA 1E6RA 1IEXA 4HIBA 5IOBA 3UWZA 3GR4A 5D09A 1ZPTA 1TJRA 1KCKA 3P74A 3R0DA 3UBPC 1BGAA 1HKVA 2BSLA 1A5SA 1QOXA 2J7HA 1FVPA 3W72A 2W91A 3CASA 3SGUA 5AHLA 4ROQA 1V3HA 4JTHA 1KBBA 1PVNA 5J5DA 3L9CA 2PDIA 2X1TA 1X38A 2YSWA 1KO0A 3BAYA 5D2VA 4AWEA 3ZR4A 2V67A 4L9ZA 2OLSA 1BQGA 3TC3A 3M0KA 4UFJA 2I9UA 1SW0A 2XZ9A 5BCAA 4ATDA 2ZX9A 4FZIA 4P61A 1BWKA 3M5XA 2XJ7A 3NGFA 1XDJA 1BEUA 2ZE3A 2NWSA 2X1RA 4ZQMA 5HNNA 4QSFA 3QBUA 1JF6A 1ZJIA 2ZXQA 4LYPA 1W5NA 5BXSA 1PIGA 1VENA 1KM0A 3CAKA 3OP2A 3WLIA 4Q4RA 1W54A 4CNSA 4A6GA 2ZVRA 3WBEA 2GGEA 3QGAC 4REQA 2OMAA 4DRSA 3DH7A 4CKQA 3G1YA 2DZSA 1TMHA 4M0XA 5AYZA 1KFKA 3SECA 3C61A 3IIPA 4HMCA 4YTRA 1ZNNA 1OFOA 4L80A 3QVQA 1UKPA 4Y90A 2IMRA 1TE1A 3I4EA 3JRKA 1QI2A 4W9TA 2DORA 4Y8FA 3VX0A 4H9ZA 4E6MA 1NELA 3SY8A 4C1NA 5BYWA 1HT6A 3B8SA 2INEA 3CC1A 3QM3A 3AAMA 1DE6A 4DLFA 4AVFA 3LN3A 2Y7FA 2PP3A 3VOGA 4DF2A 5CLWA 4GJIA 3H23A 4Q6XA 3QFEA 1ITUA 1BGGA 3VD7A 3VNZA 2DEPA 4FNUA 5E0CA 3C2OA 4UQAA 3SQSA 4PCTA 1K77A 2ALDA 4Y7EA 5CPOA 4JTRA 4PZVA 3O07A 1B3OA 2PD9A 3EKLA 4UTHA 3VDBA 4GXPA 4EX4A 2G96A 5D9PA 2V63A 2O9RA 4CUCA 2GGIA 3LA4A 1I0BA 3YPIA 1TWWA 1VH7A 3LTPA 3QHNA 4IT1A 3N9SA 3UGVA 3EXTA 1GG0A 1X6UA 5I3KA 3E96A 1XGEA 4UQDA 1UB3A 2I5QA 1DWFM 3VNLA 2QAFA 1K9TA 2ABBA 2PTXA 4BWLA 2YA0A 5BU6A 4X0VA 4S3AA 4H41A 4JTJA 1PWLA 1Z3NA 3T44A 4AZ6A 1IWBA 3LEPA 1X98A 3TAOA 3F5JA 4JXCA 3MP3A 2WMHA 4M6UA 4LX4A 3MUIA 4ZL1A 1I45A 3GNNA 3RJXA 1VIWA 1Q4NX 1YRRA 4W88A 4GUFA 1EC8A 1X6NA 3V3WA 3RR1A 3L0NA 1UOZA 3SSZA 1I4NA 3BGAA 4HHLA 4WDXA 4NX0A 2J78A 1VJIA 4EKJA 4F0KA 4IGNA 4AZCA 2R8WA 2E9BA 2TAAA 1EJTC 4FLSA 5BXRA 1J79A 2JFEX 3SN1A 2YCLB 4OJYA 4BQ4A 1OJXA 4P8XA 5FJUA 3ELFA 3PZVA 3AWOA 1GT8A 3WQ6A 3UXAA 3VM7A 1E6NA 5A69A 3THAA 1PJ9A 3C2VA 1F2JA 3O6DA 2NSOA 2DZWA 1XG3A 5DX7A 1OIMA 2J8TA 1J01A 2WBGA 3GVWA 5BW6A 3TQKA 3S42A 5REQB 3TA9A 1DJZA 5F4WA 4GYJA 3N2XA 2BXVA 3TH6A 1E6XM 2RDWA 3GFYA 3EMCA 2OYLA 2NVDA 2ACRA 3PZUA 3G0SA 1Q6CA 4U10A 4FNQA 4DEFA 3LMZA 1LORA 3DG3A 2D1ZA 3T2OA 3WKZA 1NY1A 1DIEA 1VCFA 1G67A 5CGTA 1RHCA 2HRWA 1HJVA 3ZR5A 1MDLA 4KIRA 2HMCA 4IL0A 3M6DA 3SCRA 4XZIA 3PHAA 1WDQA 3INPA 3PJTA 1E6ZA 2OO6A 1K8YA 4ZTYA 4NZFA 1Z48A 3G18A 1WB0A 1ZGDA 1B5TA 3GXIA 2OWCA 4JIQA 3QY6A 2QJNA 2WNWA 1SYTA 2Q01A 3VNYA 3LD5A 3HURA 4JTUA 1TJPA 3MI2A 1E15A 2H3DA 3IWPA 3CJPA 1KTNA 1CPUA 2WBKA 4DN1A 3KOFA 3LUTA 4UQ9A 4B15A 1XR2A 1XBVA 3GBDA 4R9OA 1RLDA 3E2QA 1FWNA 4YVPA 4DBEA 3V75A 2GLKA 2GJRA 4ZO8A 3WMBA 5CC7A 3R6IA 4HB7A 5J8LA 1XLBA 3O1NA 4AWUA 3BW2A 1QXLA 4FA3A 1A50A 2CHRA 1FWJC 2NQ9A 4ZQRA 1NJJA 2XN2A 2Y62A 1GQNA 2OQYA 3GZ3A 1D7FA 1UKOA 1Z9AA 3BLOA 1FWDC 2ZXDA 2CLMA 2A3CA 2WANA 2C15A 1F8IA 2J6VA 4JTAA 4IP5A 2F6XA 5CC6A 1W6TA 3THUA 2Z2BA 4GBUA 4M29A 1V6WA 3I3DA 1E1FA 1VPXA 5FEXA 1M3UA 1PBGA 1SMAA 1VBHA 2H6RA 3HF3A 3NO3A 2KZHA 1TWDA 5TQLA 2DJXA 3WUEA 1LTDA 4I90A 2HNHA 1ZU8A 4PL2A 4NI8A 4F4RA 4JZ5A 1XG4A 3KP0A 1G4TA 4LALA 3RCYA 4NXKA 1EO5A 4AEEA 2J6XA 5HPCA 2B0MA 2BGSA 3M0IA 4W87A 3DG7A 1GORA 3VE7A 3C2EA 3DESA 2E68A 4B5VA 4XZLX 4P7RA 1YXCA 1OFDA 4UTJA 3OYXA 7PTDA 1CTNA 4DHGA 3ZJKA 5EMYA 4D72A 3WLSA 3U2CA 2R91A 5HANA 3SB0A 1OCNA 3D3FA 3NQ7A 3AHYA 4PGLA 1QBBA 3SRHA 4FLQA 2AAAA 2ZTKA 2FTPA 4AWSA 2A4AA 1OCBA 4AYSA 3GX9A 2D23A 2PLKA 2HQAA 3A64A 4MNKA 2CHNA 4DO4A 1IZKA 4B90A 3BLPX 4JEJA 5JUVA 1TZ9A 2IQTA 1HJWA 3M16A 4FIRA 3ZS4A 5MF5A 2ZZ1A 1OHLA 4I9AA 3OHIA 3BH4A 4KCWA 4FSAA 4BFAA 4OKDA 2BMBA 3ORWA 4N9CA 1LWIA 4ICNA 3CMFA 1MRAA 4IQEA 3UR7A 3V35A 2OEMA 1B3ZA 1S38A 5EFDA 1GVIA 4R34A 1WZAA 5A6KA 1VF8A 2I5IA 2WXDM 1R0MA 1O5KA 1LRNA 1FWWA 1SZEA 3BMXA 2JALA 3PAJA 1UD6A 2HE5A 1VIZA 3BW4A 1W1PA 4H9XA 2WM0A 1BKHA 4R5EA 3LCFA 3VDCA 2VFDA 3CWHA 3OGVA 4NZ1A 3LRMA 3O16A 4GRSA 2ZC1A 3DENA 3IJIA 4JFSA 4XK2A 2QUMA 4FAMA 3B8WA 4GI8A 3NL6A 1VRXA 2VEPA 4MZ8A 3EZ4A 1E70M 1M9HA 2Y6ZA 2W6RA 4WLCA 3M4HA 2ZZ7A 3QPZA 4NJKA 2D3LA 2Z0IA 3ITXA 4IMGA 4BKNA 1RVKA 1Q6GA 2E8ZA 3ZJ8A 3N04A 5CSUA 2GOKA 2QQ6A 4X61A 1SGJA 1GVQA 3VCNA 3BGGA 3QZEA 1Q6LA 4QG9A 4M8UA 4UZSA 4GVFA 5FF3A 4GXMA 4OV4A 4EXBA 2UV8G 5GJNA 1J2BA 3RF9A 1KLZA 1FWTA 3H4XA 3NYDA 3FJ6A 1Q66A 4JIPA 3E3HA 1OG6A 1XIDA 4JN8A 1ISZA 5E5CA 4I6KA 2RGMA 1REQA 1RVGA 5E70A 3NOEA 4HNLA 1H63A 3WF1A 3VX1A 2DZPA 1V4YA 1XV8A 1KGXA 1EIXA 2AL2A 5AECA 4ZQCA 1PWMA 3MPGA 4PN2A 2PWHA 4BK9A 4CQAA 3PWGA 4DJDD 4DZIA 1QI3A 2PGEA 2WZIA 1XP3A 3EWUA 2V5KA 1AA1B 4GXWA 3UA4A 3BOLA 4D6HA 2ODOA 1N8FA 1BHGA 4QLLA 4DBSA 3V5FA 4B4HA 1R3SA 1UC5A 6REQA 4JKMA 2UZ9A 5HWMA 4H4IA 4U33A 3TLLA 1TZ7A 5FJIA 3MJMA 4CQBA 1EBGA 1WZMA 5DN1A 2Y1HA 1H61A 4O0ZA 1DBTA 4DWSC 1ZLPA 2L5HA 3ARVA 4M80A 4XD6A 4S1FA 1Q2RA 3B9OA 2DVTA 4UXDA 4DX3A 2KX9A 4JYEA 4MUPA 3GVRA 4CVUA 1HJUA 4RL3A 5A3HA 3G6MA 4MOZA 3B40A 3PUEA 1OC7A 4JPGA 4Q4SA 1W9BM 1CYGA 1OC5A 1ONXA 2GUYA 4I7VA 2GQ8A 2MANA 3UU0A 3VKAA 2NW0A 3G1SA 3KTCA 4Q8MA 4GKLA 3WEOA 1S2TA 4LY4A 3A5FA 4AVOA 3TOYA 1YDNA 3SGZA 1CT5A 2BXYA 3VIOA 4NXSA 3WJWA 1UOKA 1ZZMA 3IS4A 4WIWA 3S3GA 1TO3A 3UVIA 4D6IA 3PPCA 4GQGA 3STPA 3UP8A 3RFAA 1SU5A 3AXXA 1YPIA 3N11A 2CXGA 2DQXA 5CBBA 4GO8A 1VHNA 4ZO9A 1PX4A 1VBJA 5C7HA 5C6MA 3C4UA 1J5SA 4K39A 4N0RA 3LPGA 4U2ZA 1TX2A 2F6KA 4UUIA 1BD0A 3GYCA 2Y8VA 3RCMA 2BB0A 2E6AA 4FLRA 1OG0A 4NJIA 2W63A 1R3RA 3RU6A 4LCSA 5LGXA 2CLEA 2B31A 4IJRA 1MZHA 4HU4A 5FESA 3QN3A 1KKRA 1GHRA 4AEOA 3SGGA 3W3OA 3TC7A 5DRCA 2R14A 4YIWA 3QQ0A 3TA6A 4PMRA 3ALFA 1Z69A 4UMAA 1E51A 1UQZA 1RQEA 2QDGA 3CMGA 3MUAA 3I7RA 3KL0A 3W7RA 3U2EA 3MV01 3E2VA 2I1OA 3M5YA 3UG8A 2WWCA 6ENLA 3WQWA 3KZSA 1TELA 5CZKA 2WPGA 3GG1A 2A5HA 4GNKB 3OZMA 5EB8A 4ADTA 2QMKA 3B05A 3ARQA 3W6MA 3F4DA 3VGGA 4DXVA 1XF0A 5TAOA 1K6AA 3A6OA 3QKZA 4GFIA 1YKWA 3U3HA 1TJ1A 1LRTA 2OCZA 3QV8A 1EGMA 4IX0A 1EQCA 1TPEA 2VP8A 3RO6A 2DSUA 4QQUA 1N8WA 4OVXA 3M1ZA 3AROA 4Q3MA 1WXZA 2FH8A 3IVUA 4GLEA 2UBPC 2INZA 1H1NA 5D8WA 3W1LA 1UJQA 3CZEA 1EFZA 4NG3A 3NQ6A 1VFHA 1E6SM 4AD2A 4H9VA 2YCKX 2QT3A 1GOMA 1K7EA 2PDUA 3WD1A 5IHSA 3C3UA 4ZO6A 1TTJA 4KBXA 3BCJA 1EB3A 4V15A 3CL6A 1CX9A 3W29A 3RLGA 2NX1A 1G69A 1W2PA 3CPRA 5AN7A 3IGUA 4LNYA 1RCOB 4LCRA 1HKKA 4QG6A 5LIYX 5AYIA 4O53A 1KM3A 2TMDA 2YR1A 4H9UA 1ZY9A 2G50A 3B8IA 3VZZA 1I2PA 1RAKA 1E56A 3NQAA 4H9MA 3ZVIA 4I6VA 1KXQA 2BXZA 3CO8A 3GQYA 1LM1A 1J8VA 4D6GA 2DSZA 3VKDA 2YL8A 2Y7EA 3ARTA 2XH0A 2C0HA 5I7GA 4S3DA 2PF8A 1QJWA 1XPGA 1YX1A 1IEQA 1DJYA 3TN6A 1QHPA 4M6QA 3PTKA 1J0JA 3SJ3A 1QMLA 4FLOA 1VRDA 1B9BA 2DVXA 1F07A 3LTSA 1OGSA 5CEWA 5I06A 1BQCA 3CIWA 3W6YA 2F84A 1ZBVA 4CNUA 3PUDA 4ZQPA 1IYXA 3W38A 1AJ0A 3PWAA 1CNVA 5KSWA 2PWFA 5DEZA 5DMMA 1GVYA 1ISVA 1EZWA 1R38A 5M1TA 1BXCA 5CZSA 1HQTA 3IAQA 5I3JA 3TYUA 5IHRA 1TUFA 3L4XA 3NXFA 4QJ4B 3R0UA 3BURA 2HVNA 1XFBA 2OZ0A 4A8LA 3ABOA 3FGCA 3RG6A 1JYWA 1AD4A 4A05A 4R7WA 3W71A 3RU8X 5KETA 4TO8A 2GDVA 4FOKA 1Q6OA 3GRIA 5A8MA 1GONA 3V1HA 4HSNA 3K13A 3R25A 3WQ8A 1SJAA 4ADSA 2YKKA 4KETA 1Q7QA 2A3HA 2PDLA 3MBFA 2BHZA 1KQZA 4YHEA 3PZIA 1WOAA 3TYDA 4M7TA 5BXTA 1CEOA 3RLHA 3HFTA 1B30A 1MRQA 1OEPA 4C1LA 4A4AA 3T0CA 4TXEA 3DAQA 2JKAA 4LB4A 4I3GA 4JIRA 3WFZA 1J2WA 4O18A 2QV4A 3KDNA 1XRVA 3BV7A 2Z1XA 1E1CA 4O1AA 4L9XA 4JQ1A 2WCSA 1CLXA 3WDHA 3STFA 1HIZA 3TOPA 2OSWA 3E74A 1L6YA 2PWGA 1K1DA 2VD8A 3ZLFA 2HROA 3U0HA 2V0TA 1G01A 2R82A 1HGYA 3FW6A 1RK5A 4WGXA 3KEHA 1G94A 1RV8A 4Q8TA 4X0NA 2B4GA 1B3WA 1BRLB 3UY8A 1SW7A 1MUMA 3M0VA 1B57A 4MGGA 1E9YB 3T08A 2ACQA 1ZRQA 4BF7A 2CITA 7REQA 2WSRA 3PTMA 1R86A 4QXIA 4ERIA 1Q63A 3W85A 1TPWA 6TIMA 6TAAA 5I5RA 3PC0A 1JGMA 3ZM8A 2JQXA 1MW0A 3TVAA 2P10A 5DELA 1FCUA 2J7DA 1T8QA 2NWRA 1U83A 5CQ1A 3VAVA 3B0VC 3O8AA 1XXXA 3MW7A 5DO8A 4H19A 4PBFA 5GNYA 2QUNA 4JHZA 3EWBX 1F9CA 2DSWA 3R94A 2HPIA 4K1GA 3NG3A 2QVNA 4Z1AA 2XGBA 3TW6A 5D04C 4LVFA 2ZCGA 3W7EA 3G1AA 3K2GA 5D32A 1J5TA 4UOQA 1TPC1 1XDMA 4KGLA 4DAIA 3QMTA 3FOKA 1ZJBA 3LQGA 4LUIA 1KXHA 3BZJA 1UROA 4FPSA 4Y9PA 3VZXA 3UQNA 3EDFA 4E8DA 2FMNA 4DBUA 4XIAA 4UOJA 3B8UA 3R89A 3GC2A 2VTFA 1AFSA 1SO3A 4Z2IA 1BTMA 4DI9A 2BWGA 3RX3A 2FPYA 4DB7A 1GG1A 1IGWA 1OABA 1KRMA 1WP6A 1UUQA 2JIEA 3O0FA 3LZ5A 3S1VA 1M7JA 2EO7A 1A0EA 1UD8A 1V8EA 3BJSA 3ITLA 2X42A 5J04A 3BV4A 1F5ZA 1TV2A 1QPOA 3QTPA 3TFXA 3DU0A 4M5PA 3LQLA 3S2CA 3UJ2A 5K3VA 2VR2A 4JGDA 4UC5A 3L5MA 2VELA 1S1PA 4YL2A 2NQ5A 4ACZB 1TR9A 3CO4A 5AFDA 1RSCA 4F48A 4JFWA 1QHZA 2YZRA 5LIKX 1TV8A 4MNLA 3TJ4A 4MKSA 1ELSA 5K9DA 4L4OA 5I02A 3T07A 3GVQA 3TKFA 2FVKA 3KDOA 1XLAA 2J8FA 2J9YA 2XDFA 1KCXA 3WJSA 4J3ZA 1ICPA 3TXVA 3XISA 1PKMA 4YPJA 1PTDA 1L0PA 3LCXA 3GNRA 7ENLA 5HMDA 3S5NA 4INFA 1E73M 3BJTA 5CZ0A 2JKEA 1U30A 3NZPA 3GXMA 2DP3A 2IKJA 5CAHA 3PG8A 3LTYA 3ENLA 2BGQA 1RXOB 3BANA 1TMLA 1Y5WA 3S1XA 3BCFA 3WL1A 2GVYA 4M7SA 4OZOA 2FDSA 2QCNA 4KCTA 4UR7A 3CV6A 4WF7A 1OFQA 5DXXA 3Q45A 3ZO9A 1LBFA 4US6A 1W37A 1IXPA 5F2IA 3GY1A 4WUIA 1CGTA 3W1PA 3GH5A 2P8CA 3IJDA 4MJZA 1LF1A 3QEZA 1A5UA 4U2YA 5C2CA 3M6YA 2YOCA 3D0CA 4EWND 4NT0A 5A6LA 2PC4A 4LVBA 1YXYA 4TR9A 1F4AA 1VHCA 4HA1A 3AZSA 1Q6DA 1RUSA 4TVDA 1W5OA 3SCSA 1MI3A 3TW7A 3KOZA 3SCUA 5LA1A 3C0SA 1P6CA 2A21A 3LCHA 1OBAA 4GC4A 4CNOA 4B5WA 1U22A 3NEHA 1Y0EA 3WN6A 1EKOA 3FSTA 3AMKA 2QHAA 3PZMA 1R2RA 1FWSA 2B81A 1H7WA 4Q8VA 4KCUA 4L65A 1RK6A 4Y8EA 3SCWA 3H2FA 2E9LA 5HJYA 1JPKA 3TLQA 1Q3NA 3Q2DA 1S5NA 3GXFA 4LVGA 4RLIA 3BC9A 3BAJA 2ACSA 1KCLA 3BDKA 2VC7A 3R1ZA 1H49A 3CEUA 4EP8C 3GE7A 3CGTA 1RR2A 2PBGA 2Y88A 1EYEA 1LUCB 3H70A 1R30A 3A47A 3HM7A 3ZIZA 4JX4A 3EX1A 4HA0A 3JZEA 2CXEA 2EXOA 5A6SA 2GQ3A 4ZCWA 3DFYA 1W3TA 3IGXA 4DM2A 1S2VA 2VDIA 1WQ5A 2WNNA 1QO5A 1JRCA 2DZTA 1P4CA 1AQHA 3W74A 4GD0A 1Z44A 3K8MA 1A5LC 4F8XA 2EPOA 3HFYA 4HPNA 4QQ3A 3NL2A 4K8HA 3VGDA 1M04A 2DIJA 5HUOA 4DAFA 2JBMA 1KM1A 4HT3A 2PE4A 1K3UA 3IGHX 4L61A 1BSIA 1B3VA 3BE7A 3WLTA 3P62A 1XS2A 3NO5A 3QJAA 3TC6A 2YXOA 4LUTA 4IFKA 1A3HA 2D3NA 4UBPC 4DBWA 4F0MA 4NILA 3UEQA 3WLPA 3CH9A 5B80A 3DBPA 1RQHA 3EPNA 3B0PA 1GVEA 4JIEA 2VR5A 3HOJA 1TZZA 4GG9A 4NVTA 4HZ8A 2FB2A 3NR0A 4B2DD 3QSTA 3REQA 4DPPA 1EJUC 1GUVA 4TOQA 3VKBA 5AHNA 5KINA 5I00A 1SQ7A 1HL8A 3W28A 3CQKA 4FNPA 4KGJA 5IDZA 1FCQA 1YE6A 4DBDA 3A3HA 3EOUA 4KWUA 4D6CA 3N14A 3WENA 1CZ1A 4PUJA 2HPMA 2PDNA 3FA4A 4PSPA 3RMEA 3PBUA 2OEJA 3N2CA 3WJYA 4WSKA 1JZ7A 1ML1A 3RITA 3SIMA 3LBCA 2D22A 3VDHA 2ZZ2A 2QCCA 3L2MA 3BO9A 1PYMA 4K3ZA 4D8LA 1ZCOA 5LZLA 1GVRA 4U4MA 4Z0SA 3CV2A 4RW5A 1EJWC 1OFPA 1UR1A 5BROA 4XKMA 1J0KA 3DERA 2NXHA 2ESCA 2YIHA 1DIOA 1WUFA 1XD1A 3WNLA 2E6YA 4RE0A 3QV7A 3A4JA 5EKYA 5A8OA 2ZDRA 3TR2A 1AD1A 2VGFA 3DBNA 2FHBA 4O1CA 1CECA 3SCVA 1ZAJA 4QNWA 4Q22A 1X7IA 3RXZA 1XSIA 1XYBA 3S4TA 3TSDA 3P2VA 4LSBA 3P81A 1TWZA 4LB3A 4W7VA 2VX5A 4JNZA 1FKWA 2G3JA 3PM6A 2VEGA 3W27A 1OB0A 4OGZA 4DQWA 1IXQA 4FR1A 4GCXA 3EB2A 4ZBCA 1IEVA 2GZXA 2XH7A 3EX3A 3K4AA 1J10A 2IS7A 2PGFA 4KFPA 4QBXA 4PMVA 4H8UA 1TJ0A 2QCGA 4DYJA 1R7OA 2D20A 4LVAA 1T41A 3SUSA 4CU8A 2BHUA 3N9RA 1IWPA 4GNJA 1NDZA 2VO5A 3SZ8A 1XBYA 1GQKA 2QS8A 1R9XA 2HJPA 5IDIA 3GIQA 3ONBA 1TWSA 4V27A 4HTYA 5F2GA 3NQBA 3M7WA 3H4WA 3AHTA 1UD4A 3SRKA 4LXFA 4NAEB 4TX6A 1V02E 4Y9MA 2AQOA 3QPEA 3AC0A 1HL2A 1QOPA 2FZMA 3UXLA 1NAL1 1OCQA 3G22A 4KERA 3W4RA 3NQ8A 2E0PA 5FA5A 3KOYA 2PZNA 4YS1A 4FMVA 2I16A 5LA2A 4NASA 3WEZA 2QJJA 4QDMA 4US5A 5A6BA 2NVAA 3RGTA 2VEMA 2QUTA 2QPSA 1ZBKA 2C1HA 1UQYA 1DWHM 2D2HA 2ZTJA 1KRAC 4GX9A 1KBLA 2WK2A 4IPLA 1AJ2A 4RW3A 2W61A 2WM1A 4E2OA 3C5QA 1A3XA 2NX9A 2PCQA 3NM3A 2B7PA 2HCVA 4MMWA 4U3AA 3H53A 4L6HA 4GVHA 4P7NA 2V3DA 4C7GA 1JPHA 3GTXA 2I7GA 3O0KA 2WJFA 3GDTA 4G7EB 4Q4MA 4E2BA 3BUVA 3EMQA 3GM8A 3QC0A 4GUIA 3IV3A 4QS5A 4S2BA 3QHMA 3MDUA 5IFPA 4GH3A 2ZA2A 4F0SA 1Z42A 4Y9NA 9CGTA 4LVDA 4A22A 4ICMA 1SSGA 1DJXA 4POCA 4EPDC 3IUHA 4C6LA 2IPJA 3VNJA 3S2JA 1LT7A 1JD9A 4C6CA 1J0IA 2ZRZA 4EK7A 2VT0A 3ZQ9A 3L4VA 2UY5A 3PBWA 4PYSA 1UIOA 3NTYA 4AEFA 3A3XA 1WDSA 1MUCA 3UT0A 3DECA 5A2AA 4A2RA 4RNJA 3BARA 5LIUX 3UG4A 3W83A 2Z7KA 4AC7C 1UA3A 1B1YA 1YTKA 3N6QA 3HPFA 5DCDA 3G1RA 3IUIA 3M0YA 3MUY1 3B06A 3TJXA 1IXOA 2WQPA 3BVJA 1JYNA 2A7PA 2ZADA 3EWCA 5AC4A 1UZ4A 4UMBA 1V77A 3WO8A 1GQLA 5LXXA 2E8YA 3VGEA 2RAGA 1PS9A 3ARZA 4XD5A 3PSVA 2D2JA 3SEPA 3VDGA 3F1QA 1JRBA 4ACYA 4OHQA 5I3IA 5CG0A 1Y5VA 2AKMA 1TX0A 4GVGA 3Q67A 1V3KA 3G0XA 3B4YA 3EWZA 3H7RA 4LANA 3I3BA 3MV11 3NQMA 4U28A 4C6MA 3SAZA 3SDOA 3C6CA 4LT9A 2IXVA 3USZA 3WUGA 4MB1A 4YXGA 3CMJA 3T0BA 1EQPA 1YXDA 4JHMA 2TRSA 2ICSA 2Y7GA 4E4UA 4AD3A 4H04A 4GYPC 4NP7A 1IHIA 2ZZ3A 4JAWA 2QYGA 1B31A 3V36A 2ZKMX 1G6CA 3NQFA 3L7RA 4O54A 4LAUA 2E5DA 2OXNA 1DPMA 1YADA 1C92A 2QEZA 1PO9A 2YJQA 1RJRA 1KCZA 4L4LA 3MUCA 1JR1A 1UYQA 3RO8A 3RPMA 2PUZA 1T5AA 2Q02A 4WKHA 1GKQA 3ZXWA 4CLMA 4MLJA 3C56A 2EG7A 3LSBA 2DH3A 3TQPA 3OG3A 1I1WA 1WKYA 3AZRA 4WQ6A 4GGHA 4AMCA 5CCZA 3MU7A 1PDYA 5LIWX 2A79A 1LWJA 3AS2A 3K8KA 4HD5A 5AC5A 3CPGA 3DZ1A 1S2CA 3GUGA 4N6EA 3WNOA 4ZE4A 4DVOA 3O63A 3E38A 2RHGA 5LNUA 4O1DA 5TNVA 2DPEA 4DJFD 3E0VA 3E0LA 3WD4A 1FH7A 3W01A 1DYSA 3WQGA 3ARSA 3W1MA 3GO2A 3FKKA 4PRRA 4XO6A 1WAWA 5JH2A 3NSXA 1Y8BA 2CCRA 1B2YA 2DUZA 2WWDA 4ZQNA 4TX8A 2BLEA 2VC9A 4JICA 2I5GA 1JIBA 4LAZA 1JXJA 3WK0A 1QW9A 2C3ZA 3APYA 3MVIA 3I68A 4H6QA 3TTOA 3DFQA 3HGRA 4W7UA 4WK9A 3AHZA 3UY7A 3IVSA 3B0UX 5EU9A 1TREA 3WQ5A 4GC3A 2C7FA 1UKTA 2QUVA 1UR2A 2XIJA 3CZ8A 1U33A 1P6BA 3TAKA 2YCEA 3S2NA 3TNOA 1RCXB 3WLOA 4H6RA 1QW7A 2GGGA 4FOUA 5AKQA 4MWAB 1HW6A 5CAKA 1QI5A 1YDVA 4JX5A 5FF7A 1WZLA 9RUBA 3WQ4A 3VOCA 1V3LA 1W3HA 1QR7A 3IJ6A 3P82A 4JFUA 2B7QA 4IPIA 1XIMA 3LOTA 3TQ0A 4QCFA 3W1QA 1H7RA 3I3EA 3CM4A 1FDZA 3HIJA 1XYFA 1CW2A 2AQWA 3NSMA 3B0XA 1LWHA 3T2PA 4U31A 3TZNA 3LNPA 3PN8A 4W7WA 2PDJA 4FOJA 4HHHA 4ONVA 3W7MA 4KIEA 1YNPA 4LYQA 5HATA 2ZYFA 4LBRA 3KRZA 3CAQA 2XVLA 2G3IA 4WY0B 3S6TA 3UW6A 2QUUA 1VFLA 5FCZA 2VQTA 1PCWA 2GK1B 4J27A 5BZAA 1FKXA 2FGZA 3NM1A 3BSHA 3MHGA 3WLQA 4EAYA 4F40A 1EYWA 3KS5A 4N4QA 1IIGA 4FEZA 5MHBA 5K9XA 5GJPA 2EQDA 2Y85A 3UJSA 1XW8A 2VCCA 3S6DA 5FJOA 4RNIA 1XLMA 1SR9A 2BBFA 4G8TA 1H1YA 4MDOA 1FCBA 2XM1A 4MIMA 4QSHA 4PA8A 6A3HA 2VGBA 5MKGB 1Q4WA 2OGJA 1DQXA 3WDJA 4A3RA 4OFCA 2EG8A 2A1YA 1YE4A 2YFOA 4R7OA 3K30A 1DWJM 4TVUA 1XLFA 3P80A 1YPXA 4U5IA 2H9AB 3ARRA 2Q8LA 3EX6A 4YWSA 5HPOA 2VC6A 5DFAA 3QZ6A 4B91A 5CH9A 5AC7A 2BHYA 3CLWA 1BG9A 3F4CA 1L6FA 3AS3A 3NQVA 2A6NA 2Q09A 3EA2A 2EKCA 4RDZA 5LA0A 2ZRYA 4BF9A 1W3NA 1AJZA 2PDBA 1O5QA 3VIHA 1US0A 1ZL1A 1XD0A 4XZHA 3EA1A 2WC4A 2CFFA 2PRLA 1I2NA 2CPUA 2DY3A 5CJ5A 3BAIA 1JDAA 1C8QA 4H7VA 5D2XA 3IEBA 1MYRA 4K7YA 1NTHA 1UWUA 3I4KA 1MFUA 4AW7A 3DFOA 1OADA 2FDMA 3CQIA 1R3QA 4RCXA 3OLIA 4GCAA 4Z2KA 1GOKA 4HNVA 1NM9A 1TRDA 5G1TA 3NEVA 1QPQA 1XRSA 2HBXA 3LHTA 4AD4A 2WMFA 2FJKA 3LXCA 2VFHA 3WH8A 4J3XA 3TP4A 1VD6A 3O2LA 2XGIA 2R1KA 4DUVA 3UGRA 1QFEA 4B3KA 3KVKA 1FWCC 1TV3A 2PD5A 4F2UA 4NRRA 3UERA 2ZZ4A 2XIBA 4PRWA 4YJ5A 4C6KA 3O3RA 3TWBA 1BYAA 4JFTA 3L65A 3DI1A 4JTKA 4UIOA 3UWVA 3E49A 4DJEA 4HA4A 2MNRA 5XINA 4C6OA 5C0QA 3VZYA 4Y2WA 3TN4A 4QNEA 2AKZA 1H09A 3O6CA 4JTCA 1Y7VA 1SVDA 4NY2A 2X0HA 2X05A 3W7HA 3UR8A 3U57A 3BLKA 3RIKA 1QTWA 4P2VA 4XV0A 4AD0A 3P93A 1TSIA 5I07A 1UJPA 4NYYA 5FEZA 2YDRA 1QT1A 4C6QA 1EHNA 2LLEA 1ZAIA 3IV8A 1QNSA 1KV5A 3TTYA 1XX1A 3TJLA 1I6NA 3SR7A 3RM4A 3VINA 1YMYA 1CDGA 3WD0A 3WH6A 2OQHA 2BZNA 3GUWA 3GIYA 2Q71A 2A3BA 1L6SA 3JU2A 3W07A 3GR8A 2NSXA 4EANA 3AISA 4XAPA 2ZXBA 3QMRA 7ODCA 8XIMA 2WVSA 3A9BA 4DF0A 3F03K 3S83A 2F7FA 3CUZA 2UY2A 3B8TA 3WH7A 4KEMA 4MJ2A 4K36A 3VM5A 3CLMA 1TCMA 4HK6A 2Y4SA 4MPKA 1FWIC 5GNZA 2BY2A 4PTMA 4FO4A 2ISWA 3W1NA 2ABAA 2ATSA 1PIFA 3SQMA 1YDOA 2QCDA 2GJXA 3WBXA 4EPKA 4XBKA 3MANA 3DFHA 3MO4A 2XSBA 3SRFA 3NZRA 4W85A 2JE8A 3DDMA 2C79A 4HOXA 5K4ZA 3MCNA 2VURA 2QDDA 2X41A 2WC3A 4JDYA 2CEQA 3BXWA 4PODA 4PULA 2CU0A 1KRBC 3GR7A 1Q6EA 3T6CA 4IQLA 1U5JA 3ES7A 4E2VA 3TDFA 2D73A 2C16A 1M6JA 1P0BA 4XG1A 5M3WA 2FMOA 4MWAC 3UCQA 3FDKA 5C9ZA 5E09A 2NQZA 2PDWA 1IEWA 3NL3A 1Q45A 1F3WA 4XX6A 4Q4QA 1TTQA 2FZ9A 4C60A 1W8SA 4H2HA 1YW1A 1P1MA 1K6WA 1NOUA 2BS9A 1PXGA 1H51A 2XFWA 4NZCA 1JGIA 3L23A 2A3AA 2OFJA 1GVFA 2YL6A 2FTWA 1D7KA 1E3XA 5JMUA 4Z1YA 5DBTA 1JL8A 4PSRA 4MM1A 1PUDA 2WKLA 1E0XA 1O6IA 3LXBA 5DRIA 1Z32X 3MKKA 2YBVA 2EKGA 4OT7A 1HJSA 3GAYA 3SRDA 1S46A 1IT8A 3TYAA 4LC6A 1YQ2A 4WSHA 1QI0A 4CNTA 1S5TA 1FBAA 3OGSA 4IIBA 3FA5A 1VJSA 5D03A 1Q6QA 3U2ZA 1EOMA 3R58A 5BRQA 3HBLA 4KFOA 2VOMA 3TXZA 1O68A 4ZOBA 4OUIA 2FQIA 3N73A 1NU5A 1QNVA 4YCPA 5HMSA 2R9RA 2ZDSA 2GYIA 4QAWA 3ATYA 1E72M 3A9IA 2XH4A 3URNA 3MCMA 1OCJA 2XVNA 2C91A 1GJPA 4L9YA 3KBNA 4H7ZA 1E9IA 3W23A 1U1UA 4KEUA 1M7XA 3URBA 2W0UA 1FOBA 1M5WA 2WO5A 4CD6A 1W9PA 1AMKA 2RDUA 4HYWA 4ILSA 4E3VA 3FSUA 3GNDA 4XAZA 1AUSL 2V5JA 1J4EA 1JCTA 5HXMA 3UZJA 2WHLA 4ATWA 3LGDA 4IIEA 4BI5A 2I14A 4WKAA 1ESWA 3SFKA 2J25A 4ERAA 3VOIA 4H9YA 4JOMA 1LQ2A 1XH1A 4S3JA 5JH1A 4WJXA 1RA5A 1EC9A 3FKRA 1JZ8A 4J9JA 3AYTA 5JBEA 4TV6A 1XLHA 1SFTA 4RE2A 4FALA 3W2MA 2E1DA 4RXFA 3TFCA 4O4WA 1GCYA 4KMQA 3CTTA 4BQ2A 1VGAA 1O95A 2E28A 4UFKA 2H3BA 4B5XA 3CL7A 4HTBA 4NRSA 3GG7A 3TZFA 1V6UA 2PTZA 2OEKA 2WC7A 5BWFA 5AY7A 3IPWA 1ZENA 4J3UA 1W5PA 4MLRA 4LJ3A 3ME3A 1AQFA 5LNSA 2AGKA 1OGBA 4M1BA 4JCMA 1Q8AA 1AK5A 4REQB 4LAOA 4GIEA 4M3PA 3CHVA 2QW5A 3EEZA 1WAUA 4J40A 1KR1A 4U5KA 1FH8A 3U5UA 1E5NA 4GWEA 1JDDA 1DQUA 3M7SA 1BLIA 1TJ2A 2C6QA 1YEYA 3UG5A 4WX2A 1VJZA 3LGGA 4KPLA 1DTNA 1UWIA 1LROA 4FIQA 2CZDA 2QAPA 2WKJA 4UCFA 1RY8A 4ACZA 5A2BA 1HG3A 3HV8A 2H8XA 3MDWA 4IX2A 3ERPA 4XAFA 2PTYA 4C1NB 2G37A 3BK0A 1AL8A 1UMYA 2W66A 4J7RA 2HS6A 1PZ1A 1W9XA 2E3ZA 4N7QA 3W1TA 2O4QA 3LPPA 5E0KA 4B4FA 3UNDA 2DSVA 2GOUA 5T9BG 4MG4A 3A22A 4X3ZA 3QV6A 3IK4A 4PTXA 4HHMA 3QFWA 1T99A 1CXLA 1ODUA 5FD0A 1XL9A 3S9YA 2ZOXA 1TVLA 1R87A 4R88A 1AG1O 3DXIA 4KW2A 3N6JA 5AYBA 1DOSA 2D2OA 1KD0A 1ZFJA 3FJ4A 8A3HA 1CENA 3KAOA 1G1YA 5G2IA 3BWWA 1E55A 3WMLA 5CZJA 2NZLA 4C6NA 1XDLA 3FY1A 4K7VA 4PMNA 3FJLA 2P1FA 3LBMA 3OVGA 1MNZA 3MSGA 2WMJA 1W5MA 4NZ3A 2R24A 4WEVX 3W7OA 1XH0A 3OA5A 4QDPA 1KRCC 3H55A 3RPDA 3M0HA 2WB5A 4XVDA 3ID7A 3G1DA 1W9VA 1FXPA 4CCDA 3W70A 3SN4A 4MADA 1N55A 3GW3A 4O0KA 3UZXA 4QEHA 5F1UA 3CHEA 4KH2A 3JVAA 4LGXA 3LXAA 1SZRA 3A21A 2BTMA 4YCOA 3P0WA 1DE5A 4HYRA 1OFBA 1RZMA 1YDYA 4HN8A 1NFGA 2YCIX 1JQXA 1PHQA 4O4VA 1NIUA 1XIGA 3B8VA 5AVNA 4EWJA 3SY5A 4JNYA 3MMTA 4HZMA 1A5NC 2GDQA 1ZSXA 4Q4OA 4G7FA 2V3FA 4AZCB 2UY3A 1U5VA 2DT1A 4NQ1A 1X1NA 3LCLA 1V0NA 4QHRA 4C7DA 5JQ9A 3PR2A 5LHFA 5BOOA 4PH6A 1UZDA 1IQ8A 1E1EA 4GINA 3W02A 3ITOA 1EP2A 1LUCA 3HN3A 4IUOA 1ZS2A 4L56A 2EPMX 3QHOA 2J24A 2VZTA 4P8WA 2QCMA 4AHOA 1XYCA 3WQFA 1D2KA 3D47<