4Y7EA

Crystal structure of beta-mannanase from streptomyces thermolilacinus with mannohexaose
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
302
structure length
302
Chain Sequence
VTGLHVQGGRLLEGNGNDFVMRGVNHAHTWYPGQTRSLADIKALGANTVRVVLSDGHRWTRNGPADVAAVIDRCKANRLICVLEVHDTTGYGEEPAAGTLDHAADYWISLMDVLAGQEDYVIVNIGNEPWGNTDPAGWTAPTIAAVKKLRAAGLAHTLMIDAPNWGQDWQGVMRADARSVYEADPTGNLLFSIHMYSVFDTAAEIDDYLEAFVDAGLPLVIGAFGGPPDQWGDPDEDTMLAAAERLRLGYLAWSWSGNTDPVLDLAIGFDPDRLSGWGQRVFHGVHGIGETSREATVFGKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endoglucanase
publication title The loop structure of Actinomycete glycoside hydrolase family 5 mannanases governs substrate recognition
pubmed doi rcsb
source organism Streptomyces thermolilacinus
total genus 117
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2015-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4y7eA00
3OZOA 1BVZA 4P8VA 1JAKA 1M7XA 3GH4A 3VVGA 3F5JA 4JL1A 3KE0A 5CXPA 3U57A 1H1NA 3ECQA 3DHPA 1BLIA 5A6KA 3VMNA 4MB4A 4FLQA 1EGZA 1FP8A 1TCMA 4PTWA 3CUIA 2J7GA 2CHOA 1KR0A 2PI6A 2VZVA 4BF7A 1E70M 2JE8A 4DWSC 1E6PA 4PMNA 1VEMA 4J3WA 5BXRA 1KQZA 1CXKA 5A95A 3SCQA 4MAZA 1V6XA 1MQRA 3GM8A 4W88A 2UY5A 4H2CA 1UWUA 1JFHA 2BY3A 2XVLA 3O9NA 1ISZA 1C7TA 3RILA 3AIEA 4PMOA 3ZSSA 4Q22A 1C3FA 2WVUA 3W4RA 3S2CA 1GONA 1UH2A 3EDJA 5A2BA 5CSUA 1TE1A 5KEZA 4PMQA 3WH6A 2OYLA 1BFNA 3L4WA 3ZO9A 5I0DA 4AYSA 2AMGA 4PN2A 3VD4A 1R7AA 1JZ4A 1TG7A 2G3NA 2D2OA 1G5AA 1JZ5A 3BSHA 1GZJA 2PB1A 3WD4A 3ARSA 1E15A 1BGAA 1Q6GA 4NF7A 1V3HA 4TTUA 3WSUA 3BLKA 1ZBCA 2A3BA 3A47A 5A6BD 5CPQA 1L8NA 1US2A 2BY0A 1ITXA 3GZAA 8A3HA 1E4MM 4U2ZA 3CO4A 3WQ6A 3CUGA 3BCDA 2Q8XA 3PHAA 2Z1KA 1ISVA 1QNSA 4AEEA 1EDQA 1W3HA 1LJYA 1Z32X 2J62A 4LX4A 4Y7EA 1E6ZA 3WNPA 4RE2A 5ABHA 4P7RA 4HA3A 2VL4A 2MANA 3BGAA 4Q7NA 4B3KA 2FHBA 1J10A 3ARVA 3VINA 1JZ2A 2FHFA 3WUGA 4F9DA 2A3CA 4JFTA 4BQ5A 1S46A 3OLEA 1E55A 1TA3A 5DF0A 3TA9A 3FY1A 3AIRA 2A3AA 4GZEA 1E6RA 2BNJA 3KL3A 1UWRA 1GOOA 1TR1A 1ZBVA 1UR1A 3CGTA 1DHKA 1H4PA 4NRRA 4HMDA 2XSAA 3ARPA 4AZ6A 3AMKA 3GTNA 4TVDA 4A4AA 1GQIA 1GOKA 1RPKA 1H49A 4KGJA 4ACZA 4N42A 4D6CA 2J4GA 1GNXA 3AYSA 2W67A 2YL6A 3CZ8A 3TONA 4QAWA 4HTYA 4UQDA 4JHZA 2WMFA 1HJXA 1MQPA 3AS1A 1M01A 4AIUA 3GBEA 1W3JA 3T08A 1Q6DA 2ZWYA 2BV9A 3SCVA 2WNWA 4UQEA 1GJWA 1GW1A 2ZXDA 4CCCA 1BGGA 2GFTA 2V3EA 1D3CA 4CUCA 3WNKA 1XRVA 4PSRA 2ZICA 4NI3A 3ZIZA 5A8QA 1GPFA 3WDIA 4MAVA 4CD6A 1ZBKA 1EXPA 2XSBA 5DMYA 4H7VA 1BSIA 1LG1A 3WMCA 1ODUA 4GI6A 4WSKA 3AS0A 1L0PA 5CGTA 2YDRA 4DUXA 2FGZA 2V5CA 1V6WA 2YIHA 3QOMA 3CZLA 1F4AA 3BMVA 1LWJA 5JUVA 5JBDA 1W91A 2DQXA 3PTQA 1JZ8A 1WAWA 4CVWA 2VX7A 4ZXOA 5A6AA 4ML4A 4XZBA 1E0VA 2J25A 3AIWA 2WB5A 4WKFA 3WL0A 3GXIA 2CITA 2J7BA 4PSPA 2XGIA 1PX8A 2W5FA 1WB0A 1JXKA 3U5UA 3EDEA 4PCSA 3W81A 4M8UA 3THCA 1BYCA 3OGVA 2C7FA 4D6IA 4AWEA 1E6SM 3VD9A 3K46A 3OBAA 2VX5A 1PIGA 1OWQA 4JHOA 5JBFA 1ZBWA 1BVNP 5KZ6A 5BXTA 4V2XA 1B9ZA 4V27A 2XGBA 3AROA 1GQLA 4RE4A 1D7FA 4RE3A 1OT1A 1VEPA 1C90A 3I3DA 1N82A 1UHVA 2X1IA 1GOIA 2JF6A 3UR8A 4BA0A 1JI2A 2BHYA 4CCEA 2J7HA 2VRKA 4MTVA 3N11A 3BAKA 2D0FA 4WK9A 1J0YA 3WFLA 3ZMRA 1H3GA 3U7VA 4HA4A 5AC5A 2EEXA 4MNKA 4PMXA 4XX6A 1JFXA 3ZT5A 1B0IA 2WBKA 1UR2A 1HT6A 2G41A 5CPSA 2YA1A 4HPGA 4V28A 1W9DM 1B3XA 4JKKA 5M5DA 4M56A 2JEQA 1XHGA 5E70A 2E8YA 4UFIA 1R7OA 4HMEA 2QMJA 3FAWA 4JL2A 1WZLA 3ZJ7A 4D6GA 5AC4A 4J3VA 4D6HA 3VTRA 4RL3A 5D9PA 4PTVA 1E40A 1LG2A 4M82A 3BH4A 4ZE4A 3MUY1 2F2HA 1JGIA 1JYVA 4W7UA 3CUFA 4J28A 1C92A 4MJ2A 1VAHA 4D1IA 2J7FA 1B1YA 1PBGA 1ISXA 1NOFA 4AEFA 1G01A 1CBGA 1WZAA 3QHMA 2WZEA 5D9OA 4URIA 1E4LA 3VDHA 4TVCA 3VIIA 4HMCA 2D20A 5D9NA 2XFFA 4AC1X 1O6IA 3CZKA 3RIKA 4P8XA 3K4DA 5BXPA 1FHLA 1J0JA 3WH7A 2VR4A 4JCLA 2Y24A 4CN4A 3WEOA 3IJ7A 2RGMA 1V3IA 2OYMA 1XGZA 1ZL1A 3T0BA 2WMKA 5BYWA 4N0RA 3BAXA 3IJ9A 3AI0A 2CEQA 3L4XA 2WCGA 4S3KA 3DYOA 4UOZA 3CPUA 2E40A 4PMUA 4UQBA 2OWXA 4CN6A 1NWSA 3TTYA 4CD8A 3F5LA 4JCMA 5I77A 5BXSA 1GHRA 2DEPA 6TAAA 1XCXA 1J0KA 4JKMA 1NM9A 4J27A 5IDIA 4E8DA 5D8WA 3N12A 1DTUA 1K9EA 4UOJA 1DWHM 4F9JA 5A6BA 2JFEX 3ARXA 5D8ZA 1JI1A 1MXGA 1B3VA 4ZXLA 4H04A 1PEZA 4ATWA 3E1F1 3W53A 1KXVA 4MNLA 1DWGM 1XYFA 2J8GA 4W8AA 4L4OA 1CWYA 1BPLB 4PTMA 5F7UA 1GOQA 4TUFA 4F8XA 1OSEA 2OSYA 3WUBA 1DWJM 3WNOA 1E9LA 2QV4A 2WVTA 2VZTA 2ZXQA 2XIIA 1IZKA 1SFSA 3AIUA 1JF6A 2PBOA 3RJYA 4JIEA 3CHFA 2WLZA 1QI2A 4FMVA 2VNCA 3OLDA 1KFWA 4NRSA 3EYPA 4AZBA 2TAAA 4GO9A 3WN6A 2BVTA 3CZGA 3BXWA 3OG2A 4UZSA 3AICA 3B9DA 3FNDA 3D3AA 1HN1A 3PBGA 4ATLA 5D4YA 1D2KA 3EMQA 1XC6A 2WCSA 3BAYA 3QHNA 3WEZA 1FFRA 4MNMA 2IUZA 1H41A 4M81A 3WQWA 4CGTA 1UR9A 1WKYA 3F5KA 3OGRA 1HL8A 3NSNA 2QHAA 3ZSTA 2D0GA 2IXUA 2C8NA 1WDQA 2D3LA 2QPUA 1HL9A 2EBNA 4E2OA 1VBRA 3MV01 1E0XA 4UFKA 3DC0A 3MANA 4S3JA 3NSMA 3RM4A 1OB0A 1LF1A 3VX1A 4PMZA 4QP0A 4YN5A 3VD5A 1MWOA 1UKOA 2W62A 1V0LA 2J8FA 3ZJ8A 4YPJA 5GNYA 3VNZA 4GQRA 1IZJA 1JYXA 4GZIA 2DGAA 3ZQ9A 4X0NA 2PWFA 5HBFA 2YLLA 1UD6A 5CZKA 3TTSA 1BYDA 1W32A 1EQCA 3CZJA 1WDSA 1R8LA 4WKAA 4EANA 2O9TA 1AVAA 1QHZA 2VT0A 4ACZB 2F8QA 1J12A 1VFFA 4FLOA 1E1EA 3EDFA 3RJXA 2X2YA 3WQ5A 3GNRA 1KGUA 2VCCA 2X0YA 4A3YA 2CHNA 3N17A 3VO0A 2XVPA 2DT3A 1E5NA 4GZJA 3UG5A 3SUSA 2YA2A 1U30A 2XVKA 1V02A 2YL5A 3L4YA 5ABEA 4XZWA 4JFUA 1V3LA 3FXYA 3VDCA 3MMUA 4PMDA 4ZE5A 2O9OA 1EOKA 1QBAA 3N18A 3WELA 3SCWA 3W26A 2BXYA 3VIJA 3TOPA 3CH9A 2DSWA 1CYGA 1XH0A 2ESCA 5E9AA 4P7OA 5FIPA 5ECUA 3WNNA 1CZ1A 1NWUA 2CIPA 2XM1A 4LYPA 3ARYA 4XB3A 4AIOA 1JD9A 2WSKA 6CGTA 3B9EA 1M53A 3K8LA 4IM4A 1QI4A 2CNCA 3A4AA 3UR7A 3MO4A 4UOQA 1JZ6A 1E72M 2ZX5A 3VX0A 3SCSA 1VB9A 2OWCA 3W24A 1W1TA 2C0HA 4OJYA 4B16A 1H09A 3ALFA 1CGTA 1KXTA 4QCEA 4EK7A 2BS9A 3WDPP 3M46A 2GJXB 4BS0A 1KBKA 3ARTA 1UKTA 1V6VA 3W28A 1W9VA 4U3AA 1GVIA 1FOBA 1K9FA 3AHZA 1B3WA 2J78A 3AZTA 1K6AA 1UD4A 4U3CA 4AZCA 5A6LA 3AMCA 4KRUA 4UFLA 2IXVA 4AW7A 1QI5A 1JDAA 3IJ8A 3NYDA 1NH6A 3NDYA 1XV8A 3L4TA 1ZB5A 8CGTA 3W27A 3W0KA 3WQ8A 3LPOA 1EHNA 4CU8A 1DWFM 3MKKA 2D23A 1TVNA 4D6EA 1AQHA 2ZX8A 5GNXA 2PBGA 4WIWA 4TTGA 1HJQA 1V0NA 3RCNA 3CTTA 4W87A 3MUAA 4D72A 1E5JA 2GJRA 1VJZA 2YDSA 3WMSA 1TMQA 5HPOA 3VIFA 1NOUA 3UETA 2CYGA 2X0HA 1ZJAA 3UEQA 5I79A 1WZMA 3LPPA 3WDQA 2V3GA 4MB5A 3SUVA 3SCPA 1UZ1A 5A94A 1GQKA 2DIJA 3MV11 1MW2A 1UWTA 3WD2A 1BF2A 2VQUA 3VGFA 2ZXAA 4YHGA 3CHCA 2HVMA 2O92A 3AS3A 1UA3A 1XSKA 2V3DA 1QNQA 1K9TA 3KEHA 3CHDA 3PZMA 3DECA 4HP5A 1MVYA 5HPCA 3O2LA 3I3BA 2DT0A 1FFQA 3M07A 1RD6A 3AMGA 4BCEA 3B8SA 1ESWA 3UERA 1JF5A 3RM9A 3WQVA 4WJXA 1AQMA 2JEPA 1LL7A 1E0WA 1GOWA 1VRXA 3OLGA 4W89A 4MADA 1E6QM 4B9ZA 1BHGA 2E9BA 1W2VA 2CESA 2X09A 3WDRA 3T0DA 4DWSD 1BAGA 3UG3A 4Z2HA 1OGBA 1KQYA 3A4XA 1BG4A 2WSPA 9CGTA 3WNLA 1EO7A 4W8LA 4AXNA 1V0MA 4AMCA 2WLYA 1XD1A 4PBGA 3UG4A 2E9MA 4AD0A 4CD7A 2XFYA 1C91A 4QFUA 5E6YA 4W5ZA 1WDPA 3N13A 3VILA 2Z1SA 3RO8A 3VMOA 4UQAA 1WP6A 1NP2A 2GJXA 3PTKA 4PMRA 1MXDA 2G8ZA 1DEDA 4AZGA 2ZUWA 2WW5A 4P8UA 1C7SA 3ARWA 1CLVA 1CEOA 1WE5A 4UR9A 4TXEA 1WNOA 3PZOA 1XH2A 1X6NA 2HISA 4PMYA 4C7FA 1UQYA 3WY1A 5BRQA 4QLJA 2Y5EA 2WC3A 2VR5A 3VIPA 4HZ6A 2AAAA 2GDUA 3AXIA 5A1AA 3K1DA 1MYRA 3NSXA 1XCWA 2XTKA 2VMFA 3NJ3A 2D0HA 3ZR5A 5C70A 1J11A 4JZ5A 2EO7A 1H0IA 3ALGA 3IK2A 1JNEA 1JIBA 2XWDA 1BYBA 2ZUUA 4NZCA 3ZOAA 2X05A 4JFVA 3ZR6A 1UR0A 1X6LA 3SUTA 1V03A 3GYCA 3PZIA 2WC7A 3WBAA 1OM0A 3AOFA 1C8XA 1CGWA 1JNDA 1VBUA 3QGVA 3W25A 1OCQA 2VQTA 2OSXA 2E0PA 1A47A 4XV0A 2G4FA 5A6JA 1CDGA 2F61A 1J9YA 3AHYA 1K9DA 3FW6A 2XVNA 2ZIDA 1IV8A 1B3ZA 2Y8VA 3T09A 5EFFA 1MQQA 5I5RA 1CGUA 5CSYA 6A3HA 4ZFMA 2EPNA 2E4TA 4GO8A 3VMPA 1CTNA 2WCAA 1WO2A 5A2AA 1CGVA 4WLCA 1XH1A 2W4XA 1BQCA 2YL8A 1NOWA 4GI8A 1WCGA 2X8RA 1UQZA 3ARRA 2WMIA 3GXMA 1W9BM 2PWHA 1HKJA 2FH6A 4U5IA 2V5DA 4W8BA 3HU7A 3WL1A 3WNMA 1UOKA 1GQJA 1B31A 3L2LA 4PUDA 1E43A 3VGEA 2J75A 1I1XA 2JALA 2ZE0A 1I75A 1TVPA 2EPMX 3FHQA 3AS2A 1OGGA 3AYRA 2VZSA 3FAXA 2PWEA 5AYBA 3T2OA 1SMAA 3MSGA 5AYIA 3HJEA 2YJQA 4M29A 1AMYA 1UKSA 2OYKA 4UZUA 3AISA 5LA0A 1V08A 3VDBA 2YBTA 1FH7A 2XG9A 4UQCA 4E8CA 3F4VA 3WUEA 1Q6CA 2FGLA 1FHDA 3AIQA 4KMQA 2VX4A 2JIEA 3SIMA 4AD1A 3AIVA 5BWFA 5I23A 1OGSA 1ISWA 1UD8A 2J77A 2ZUVA 1EQPA 4X0VA 4LPCA 1IT0A 4XUYA 4IPNB 1PIFA 1E71M 3WH5A 3VOCA 3EBVA 3VIHA 2G3MA 5A8MA 4P7NA 3ARUA 3VUPA 1JDDA 2YDQA 5FCZA 4P7QA 3NDZA 1C93A 1H2JA 1KB3A 3KWXA 1CXHA 5BROA 1RP9A 3ZT7A 3RM8A 2YOCA 3ZJ6A 3PTMA 1W9XA 1E4NA 3WF0A 5LA1A 1HJVA 2VRQA 2VJXA 4BQ4A 3EMCA 4H8UA 3MSDA 1CXIA 1VFMA 1QW8A 2EXOA 3VM5A 3MMWA 2EJ1A 3PN8A 3CBWA 3W82A 2XIBA 2VCAA 4Z2GA 2D1ZA 1A3HA 1NARA 1W1PA 5E0FA 5TD4A 1CGXA 4AZHA 5LYRA 1KXQA 3MU7A 1B2YA 1W9PA 4QLLA 1PZ2A 2ZUMA 4AISA 4R27A 2XVGA 3LPFA 2WM0A 1W1VA 1GJUA 1GCYA 3L4VA 2WZIA 2DSKA 4AY1A 1WPCA 3RDKA 4UNIA 5DO8A 1V3JA 3GNPA 5GNZA 4H8HA 2DSVA 1ODZA 5LA2A 4AZCB 4OIFA 2J74A 2DT1A 1MFVA 5C71A 3S6TA 3WQ4A 1UH4A 4MDOA 4CVUA 4AD5A 1GHSA 5AY7A 3T2PA 4B3LA 3JUGA 3AMLA 2XHYA 2FH8A 2W61A 2WKGA 2W66A 2Y2WA 1NQ6A 4P7LA 3IANA 5IHSA 3VKKA 5E6ZA 4MNJA 3PZTA 4DWSA 1U2YA 4PMVA 3N04A 1PX3A 1BTCA 3WEMA 1FH8A 5FD0A 3VM7A 2DT2A 3GH7A 1JD7A 3PZVA 2EPKX 2QPSA 1E6NA 3II1A 4MJ4A 1J0ZA 2DPEA 5CLWA 2PC8A 2WVVA 3CMJA 1C8QA 4FLSA 2J47A 3WMBA 4JAWA 2BVDA 2DSZA 4J3SA 3SCOA 4BZYA 3SUWA 1ECEA 4UFMA 3BSGA 5HXMA 2NT1A 1OINA 2NW0A 1HJUA 2VZUA 2DH3A 4OZOA 1AQ0A 4UTFA 4D71A 1H5VA 3WENA 3W38A 4KGLA 2UY2A 4J3TA 4BQ2A 2A3HA 4FK9A 3G6LA 3AZSA 1WZKA 4FF5A 5JIWA 1WDRA 1YHTA 4J3XA 1KWGA 1H0GA 3U5YA 2CPUA 3WH8A 3SCRA 2W63A 3EMZA 5BRPA 3NUKA 5GQBA 3CMGA 2E3ZA 1UZ4A 4DM1A 7CGTA 4UFJA 3MUIA 3OB8A 5DEZA 2BHZA 4A3HA 1HXJA 1OT2A 3U7BA 2ZUNA 1XSJA 4EAMA 1HKKA 1GORA 2ZX9A 5ABFB 3LPGA 3CHEA 3PZUA 2NT0A 1MW0A 3IAQA 3WD1A 2QF8A 1BYAA 1HVQA 4EE9A 3OIHA 3EDKA 1JDCA 1ITCA 3D5HA 1G9HA 3B9AA 5EBAA 2WHJA 1OD8A 3WF2A 4CN1A 2WXDM 2O9PA 1E3XA 3VIGA 2CBIA 3N9KA 1GOMA 5HDRA 2GK1A 1PZ3A 4LYQA 2BY1A 3AJ7A 1JZ7A 2YBUA 2VRJA 5HOSA 1UD3A 3OGSA 3W37A 3AZRA 2J7EA 4MPKA 3WIJA 3VNYA 1J18A 3AFBA 1G1YA 1V6UA 4AZ7A 2XJ7A 1B30A 2XWEA 2AOSA 2GDVA 2CXGA 4QDMA 3J7HA 2PWGA 4KWUA 5A6SA 4HOWA 1E4IA 3G6MA 4Z2IA 5I3DA 3SCUA 3VPLA 4OKDA 4FLRA 1SMDA 2UY4A 3L4UA 4NSBA 4LXFA 4GQQA 3OZPA 5EB8A 4JKLA 3OA5A 4HOZA 2VI0A 3ZJKA 2ZXBA 1PX4A 5CPTA 3PZNA 1H11A 3N15A 3M7SA 2BHUA 1EHAA 4AD4A 2VC9A 4P8WA 1JXJA 4OBRA 2WPGA 1VEOA 4F79A 5EMYA 5M17A 4WKHA 2BY2A 1HKIA 1XYZA 3QHOA 3NIYA 2EPOA 4Z2KA 3VIMA 2EPLX 1CNVA 4GXPA 5DT7A 5DFAA 1QNRA 1J0HA 2OWWA 4DUWA 4ZEPA 2YLAA 1QVBA 2VURA 3WDJA 2ZWZA 5C8BB 4W93A 2V38A 1W3KA 1EDGA 4LYRA 5I24A 4ZENA 2WANA 1EOMA 3AHVA 1BG9A 1HNYA 3VGHA 3FHAA 2G3JA 1SYTA 4DUVA 1US3A 3A6OA 1E73M 2JF7A 2CBVA 1PAMA 3M6DA 4CU7A 2W91A 4Z2LA 2ZOXA 2VZOA 4WF7A 4PCTA 4E4PA 3SURA 5IFPA 2CBJA 5CQ1A 1V0KA 1W3LA 1UG6A 1SR0A 3W29A 1B90A 1V6YA 1V3MA 3BCFA 1J01A 2WMIB 1F4HA 1EDTA 4W7WA 3TTQA 4EKJA 2A3EA 5ABGA 2GSJA 1EO5A 4CCDA 1M04A 4KRTA 1CLXA 3CZEA 1XD0A 5ABFA 1MFUA 1PPIA 3AIBA 3VD7A 4H8VA 4TVUA 3VDAA 2JIWA 4Z2JA 4W86A 2XFRA 3WUFA 2CETA 2DSUA 4UQ9A 5M3WA 1E6XM 4HZ7A 5CGMA 5A8PA 1G0CA 2V3FA 4W7VA 4M80A 5IFTA 3UESA 1W9UA 4HA1A 2CKRA 3AHXA 1CIUA 1R87A 3DYPA 4ACYA 4F66A 1UWQA 1W2PA 3WD3A 2E9LA 3AQUA 2XM2A 1QBBA 2YL9A 4UFHA 2CERA 2YKKA 3GBDA 4HU0A 4CKQA 3AXHA 1HF6A 1JL8A 2ZUTA 1X1NA 2D3NA 1QPKA 1HJSA 3WF1A 2VVNA 3AHTA 4CD4A 1LL6A 3VIOA 1QI0A 3BLPX 4HZ8A 2DH2A 2BXZA 5I78A 2OSWA 1JG9A 3FN9A 4C7GA 3I3EA 3K8KA 1TFVA 1VFUA 4W5UA 2Y8KA 3UCQA 1KWKA 1DP0A 7A3HA 1JAEA 1O7AA 3DHUA 5HNNA 7TAAA 4IISA 4LGXA 4DM2A 3QR3A 5A6MA 1EH9A 1FP9A 3MMDA 4JFWA 3GNOA 1NWTA 2VX6A 2Y4SA 1ZJBA 3ARZA 3DYMA 3CLWA 5DT5A 3EDDA 4X9YA 3GXFA 1ZU8A 3RMEA 1UD5A 2ZX6A 1GUVA 1HP5A 3K4AA 1CXLA 1QW9A 3VD3A 3THDA 5A8OA 4IUGA 1CENA 1MW1A 2DDXA 4M24A 2CBUA 4W84A 2WHMA 4K68A 1R85A 2WBGA 3N1AA 4B9YA 3T0AA 5FL1A 3BAJA 1B3YA 4MDPA 1KXHA 1UKQA 2DIEA 2WWDA 1RH9A 4D6JA 2VTFA 1OD0A 1V3KA 2CCRA 3CUJA 3TP4A 1Q4NX 3PZQA 2EQDA 1OBAA 1OIFA 3VU2A 4DWSB 2FHCA 1DWIM 1KR1A 1UKPA 5A8NA 4WSJA 3T2QA 2WWCA 1KGWA 2ZX7A 3KZSA 3HN3A 1UA7A 3AMDA 3OLIA 2GJPA 3BAIA 5E09A 5JIPA 2PF0A 2WVVB 1YQ2A 4LQ1A 2UY3A 4GPNA 1RP8A 2FDMA 2UWFA 1EA9C 4M1RA 1UD2A 4MB1A 5FOOA 3LMYA 1UYQA 3SEPA 2XPKA 3PZ9A 5GPRA 3BMWA 2D24A 1Y7VA 2E8ZA 4AZ5A 3WBEA 1P6WA 5A2CA 3KL0A 2XYLA 3BAWA 2G3IA 1MW3A 4HOXA 1HKMA 4UCFA 4HPHA 4OOUA 4PUEA 2B31A 1QHPA 3SCNA 1CECA 2GVYA 4HU8A 4KH2A 1DWAM 1VENA 3A4WA 4QLKA 2VCBA 3QOKA 4JFSA 1LL4A 2WMHA 2VVSA 2WK2A 2W92A 3POCA 3L4ZA 4GIAA 1J0IA 1KBBA 3GXDA 2J7CA 4PTXA 2WYSA 3HMCA 3WH9A 1U33A 1LWHA 4GINA 4AD2A 1ISYA 3NCOA 4QCFA 4AD3A 2OLHA 1CPUA 3WDHA 3L2MA 1OIMA 4H41A 3MUZ1 3GH5A 3K8MA 1JYWA 3WKZA 1UWIA 3ARQA 1LLOA 2BVYA 4YHEA 5D9MA 2GK1B 1GVYA 1KGXA 5CLTA 1C8YA 4J3UA 4IPLA 5E0CA 3VGBA 2WMJA 1I1WA 4GI9A 1VJSA 1TZ7A 1V02E 1VFOA 2PWDA 1JZ3A 4OOZA 5FL0A 2QLYA 4D1JA 1CXFA 3SCTA 3VGGA 2QMKA 3APGA 4U33A 1VF8A 1UR8A 3ZT6A 4CD5A 2WZHA 3W6MA 4OUEA 1UR4A 5JBEA 2GUYA 2XUCA 1NP0A 3POHA 5CJ5A 1XSIA 5IHRA 1FH9A 2CKSA 1KCLA 3WFZA 4PYSA 4PRWA 1M03A 1E3ZA 4TOQA 5BCAA 2VOTA 4U31A 5I6SA 4R5EA 3GDBA 5FKYA 4D6FA 1CXEA 4U2YA 3ZM8A 1HVXA 1QNPA 1HX0A 5IXEA 1HP4A 3CUHA 2WC4A 4AZIA 4TX6A 1TUXA 3VIKA 4C7DA 3WF3A 4D6DA 4MB3A 3CIVA 1UH3A 3W6LA 1QOXA 2YA0A 2ZUSA 4W85A 3A3HA 1HJWA 4PEEA 3PZGA 1QI3A 1G94A 3TTOA 2BFGA 3VGDA 5EFDA 2VUYA 2D22A 1LQ0A 5M03A 3RPMA 3IAPA 1W1YA 4CU6A 2NSXA 5I2UA 1E1FA 4BQ3A 1HIZA 4ATDA 1QHOA 1ZS2A 2VO5A 3AXXA 4J7RA 3MS8A 1PJ9A 4L4PA 4GKLA 1UUQA 2WKLA 2RGLA 3BC9A 1TA3B 3SUUA 2WVSA 1VIWA 4B15A 2O9RA 3O6AA 3WD0A 2WHLA 1Q6FA 1Q6EA 2WAGA 1R86A 2J7DA 1UWSA 1JYNA 5A69A 2WHKA 5A3HA 5CG0A 2J79A 3WF4A 1FA2A 3KL5A 1EIBA 1CGYA 4OBSA 1E56A 1KCKA 4TX8A 1NWRA 1QNOA 4AIEA 4U5KA 2WMGA
chains in the Genus database with same CATH superfamily
3L23A 1JAKA 1WXZA 3F5JA 4JL1A 3VVGA 3U57A 2AQWA 1IWBA 5A6KA 3VMNA 1EGZA 2Y89A 2G0WA 1FP8A 1TCMA 3EA2A 2CHOA 2IKHA 1BXNA 4O0ZA 4A2SA 1I45A 5BW6A 2VZVA 4PMNA 4YLWA 3L0KA 1VEMA 2DY3A 3KVKA 5KTLA 5XIAA 1QTWA 4PB4A 1OG6A 4DLMA 1XGEA 2TRSA 3GM8A 3EPNA 1UWUA 4QXIA 1ISZA 2BMBA 1UH2A 3PUEA 4PMQA 1A3WA 4JD4A 3WH6A 4PTDA 4QJ4B 4CEXC 3GR7A 4PRRA 3EX6A 5I0DA 4AYSA 1HGWA 3VD4A 4RKAA 4YS1A 1JZ5A 1NU5A 3H70A 4RDYA 1GZJA 3ARSA 3VKDA 4G7EA 4HNVA 1Q45A 1Q6GA 1WX0A 1V3HA 2ZZ1A 4DLFA 2TMDA 3QGAC 1PTDA 3CM4A 3QR0A 3A47A 3A3WA 1L8NA 1WQ5A 1US2A 1RJPA 2Z1XA 4INFA 1JCNA 1E4MM 3RF9A 4F3HA 3PJXA 3EAUA 3WQ6A 1EF2A 4FI4A 4B5XA 3H2AA 1VS1A 3PHAA 1QJWA 1Z32X 4C60A 1TPB1 3IWPA 4LX4A 4I5XA 1UR3M 2Z1VA 4RE2A 1FRBA 3LZ3A 5ABHA 3LHZA 5IBXA 5I3JA 4HA3A 3BGAA 3KHJA 4HPJA 3ZLHA 1J10A 2DVUA 1M9HA 1JZ2A 3GR4A 1TIWA 4JFTA 4UNKA 1TA3A 4H00A 5DF0A 3TA9A 2BGNE 4K3ZA 3UCDA 2A3AA 2ZC1A 1H51A 3CWNA 3SDOA 5I3GA 2QGYA 5XIMA 3QFWA 1K4HA 1KKRA 3ARPA 4Z1AA 3BOFA 3QFEA 3WJXA 1RPKA 1GOKA 1UB3A 4DPQA 2DV0A 3A5FA 2EPHA 4Q8VA 3R5EA 4Q32A 3UGVA 2WMFA 1GW9A 1HJXA 1FXQA 1OFAA 3AS1A 4HPNA 1E9ZB 4GBDA 1W3JA 1Q6DA 2ZWYA 3M43A 4GRSA 1N7KA 1ONRA 1XIJA 4UQEA 3WQFA 1GJWA 2IS7A 3GTXA 2V3EA 4CUCA 3BO9A 3NZQA 3WNKA 2TYSA 4JY8A 4XAPA 4NI3A 2FGBA 5A8QA 1GPFA 3C61A 3KCOA 2ZZ6A 1LG1A 1O66A 2Y70A 1MSSA 3GXPA 1R3YA 4WSKA 4ZCWA 2I9UA 5CGTA 2WOQA 1PHQA 3P62A 1X7IA 4XZMX 1AW2A 4K1WA 3AAMA 2OPJA 5JUVA 5JBDA 2DQXA 1EX1A 3FJ6A 2UBPC 2G37A 2ACQA 4RK8A 3PTQA 3RU8X 2IMRA 4CVWA 1NEYA 4ZA0A 1UMYA 3D46A 1S1PA 4WKFA 3WL0A 5FJPA 2J7BA 1PX8A 4ALDA 2DZWA 3EDEA 4PCSA 3UXKA 4J4KA 3WJYA 4M8UA 2C0AA 3THCA 4QE1A 3M5XA 2VC6A 3OGVA 4PMJA 4AWEA 2QJJA 3GDKA 3ZFHA 4CQDA 2A4AA 1PIGA 2DZPA 3PBVA 1S2TA 1DJQA 2XFWA 4Y90A 5BXTA 1OZQA 1B9ZA 4V27A 2OQHA 3AROA 2QS8A 3KM8A 3P84A 1OT1A 1PDYA 1GOIA 4OGZA 1JI2A 1BWVA 4ZO8A 4R88A 2J7HA 1R9YA 4G6CA 3TSDA 5LXEA 3TDFA 2F84A 4UCGA 1J0YA 4S2CA 2V8ZA 3ZMRA 4I7UA 4RZ4A 5AC5A 5CBJA 3C2EA 4HN4A 1UR2A 2PSNA 2VGGA 1W9DM 3BJFA 4M56A 4GOAA 4ZVJA 1XHGA 2XSXA 2E8YA 4UFIA 4HMEA 3EWCA 2QMJA 3O07A 3FAWA 4JL2A 1WZLA 3LV5A 4J3VA 3TJIA 2QULA 3VTRA 4AWUA 2AMXA 1E40A 2RHGA 4M82A 3QPEA 3NL6A 1RY8A 4HKPA 4DBUA 4TQTA 2YXXA 3OW1A 1C92A 3ZXWA 1X98A 1ZJHA 4D1IA 2RKXA 1B1YA 2BODX 1NOFA 4AEFA 3QHMA 2OZTA 5D9OA 4BJHA 2YB4A 1YMYA 2C18A 2D20A 5FF3A 3NL2A 1XDJA 2QCGA 2Q3OA 3WJSA 3BMXA 4AC1X 2Z7KA 3CEPA 3SW6A 3TFXA 1FHLA 4A05A 2VR4A 4LVFA 2Y24A 4LRSA 3E0WA 4JTSA 3UJ2A 3WEOA 3IJ7A 2PDFA 3VNJA 4PFMA 1VPYA 4UTWC 5KZDA 3AI0A 1GKRA 3EB3A 3L4XA 2V82A 2WCGA 1T99A 2CZVA 2Z2BA 2J6VA 3LRMA 1PYFA 4F2UA 2OQYA 4JQ3A 4JCMA 1DE5A 2AQOA 3PPFA 4DYKA 1XCXA 1U5JA 3WQEA 2QUTA 1AODA 2O56A 4J27A 2IKJA 2EJAA 4NHVA 5G1TA 1DTUA 3W1AA 4UOJA 2JFEX 4C6BA 1R47A 5D8ZA 1FWHC 2E25A 1MXGA 4KCWA 2P0OA 1E9YB 3TSBA 2OZ8A 1IXOA 1VFLA 3JZUA 3BZJA 2XN0A 1XYMA 5FI8A 3W9ZA 4IPPA 3EX1A 4WR3A 3MKCA 4M5PA 4EWND 4GLEA 1W8SA 1GVRA 3TLQA 4W8AA 4L4OA 1QU4A 3L65A 5FJOA 5G1YA 1AH0A 3V4BA 4IZGA 2OO0A 3WNOA 3OU8A 3O6DA 1FWFC 2DZTA 2ZFAA 1KO0A 1JF6A 1OVDA 4EPBC 4QTGA 1KFWA 4NRSA 3EYPA 4AZBA 4GO9A 4WX2A 5MKGB 5CAKA 5LHFA 1ZAJA 4UZSA 4O16A 3RXZA 3AICA 3B9DA 4TIMA 4J3ZA 3PBGA 3P80A 1XRTA 4PBFA 3BAYA 4MNMA 1YKWA 3EOLA 4LAOA 4LUJA 2IUZA 1UZDA 1H41A 4M81A 3M0VA 3WQWA 1WKYA 3OGRA 2QHAA 3ZSTA 3NXFA 5FJRA 5AZ0A 1OFEA 3UXLA 1XKJA 2NX1A 1JRCA 2DP3A 3IVTA 4WD0A 1VBRA 4L1GA 4QRNA 2QUMA 5T9CE 1PKLA 3BURA 4UTIA 3WJZA 4S3JA 3NSMA 1O5RA 2VHLA 1OB0A 4MWAA 5C54A 2E67A 3VX1A 1UIOA 2V63A 3VD5A 3WK0A 5LIKX 1I60A 1W0MA 4PUJA 5C9ZA 1V0LA 4PUWA 1TZ9A 3WLNA 4YPJA 4NNAA 2E7FA 1JYXA 4LEQA 3M0LA 3ZQ9A 1SZFA 4X0NA 1Y0EA 2PWFA 3CAWA 5HBFA 1KKOA 2CHRA 3TTSA 3UY7A 3SRKA 1W32A 2R82A 4C6PA 1KFCA 2O9TA 2NQ5A 6TIMA 3DG6A 3ABXA 1W31A 2VD8A 1VFFA 1E1EA 5I07A 4XKYB 1R2SA 3RJXA 3GNRA 3AXKA 2X0YA 2QUUA 2CHNA 4RDZA 8RUCA 1E5NA 4R7JA 3ZZ1A 3SUSA 2HCVA 4IL0A 2FLIA 4B4HA 2XVKA 2PCEA 4N9CA 3R43A 3URNA 2X16A 2REQA 5ABEA 3F2DA 1RBAA 2X40A 1V3LA 2I16A 4NP7A 2PDWA 3VC5A 4LC8A 3MMUA 1OFPA 4DZ5A 4PMDA 2GZXA 3KVMA 3WELA 3DHDA 1S2VA 1XCFA 3BANA 2BXYA 3WLOA 3TOPA 3CH9A 1TWSA 3M5ZA 2H9AB 3M47A 1XH0A 2ESCA 5CC7A 3GLCA 4P7OA 3NA8A 1A0DA 1CZ1A 4S23A 1JD9A 4YTTA 1XS2A 3MP5A 1JCTA 1M53A 3TX9A 2XH7A 4OFCA 3BV4A 2QNEA 2TSYA 3SCSA 1W1TA 4LJ3A 1KRAC 2ZE3A 1L6WA 1QK2A 4OJYA 1M7JA 3ALFA 4E6MA 2ZRZA 1CGTA 3LHUA 3WDPP 4Z0JA 2GJXB 3ARTA 1G4EA 2PS2A 5J04A 3NWRA 5F2LA 3TK7A 2RAGA 1FOBA 3QZAA 2ZC8A 3KOWA 3AHZA 1PYMA 1ICSA 1J5SA 1K6AA 1UD4A 1GKQA 2FKPA 3P60A 5K9XA 2IXVA 4WDXA 4IG2B 1JDAA 1KV8A 3UXIA 4F0MA 2EKGA 3LPOA 9RUBA 3MKKA 4Q8UA 4D6EA 3E0LA 2PBGA 4IIFA 3GDRA 3QY7A 4DZAA 1HJQA 1V0NA 1POJA 4NT0A 3RCNA 4K39A 1ZP3A 3MUAA 3NGFA 2GJRA 2OQLA 2X7WA 2DVTA 4F4RA 5I09A 2ZA3A 2CYGA 2X0HA 2G5WA 2NVDA 2DZUA 1FWWA 3LPPA 3WDQA 3SUVA 3SCPA 1UZ1A 4DBWA 2G50A 3MV11 4Y9NA 2B7OA 1BF2A 3EOUA 5FA5A 3CHCA 4HHHA 2Y7GA 1H61A 4UTTC 1XSKA 1XYLA 3BJSA 2NXIA 1ADSA 3M0IA 1K9TA 3O6YX 4NZ3A 7ODCA 3DECA 4HP5A 4IL2A 4LSBA 1MVYA 1YXCA 1RK5A 3QTGA 4MUZA 3W7LA 2V67A 3APYA 4WJXA 2JEPA 4ZOBA 1E0UA 3OLGA 4W89A 4R85A 3W2JA 1BHGA 2E9BA 3CQ0A 3HMJG 2X09A 2X1UA 5CZJA 1QOPA 4Q8QA 3UG3A 5TIMA 4F2TA 1OGBA 3FIGA 2D2JA 1KC7A 3WNLA 4W8LA 5LNSA 3TUUA 3CYJA 4AMCA 2EHHA 4CD7A 2XFYA 2QIWA 4QFUA 2HDJA 3MO7A 3BPWA 1ADDA 3EOEA 4AB4A 4P61A 2H8ZA 3N13A 4BI7A 4JN6A 3OO2A 4UQAA 1WP6A 3EPOA 1KM2A 3QMRA 3HURA 3MKVA 2PA6A 3FV9A 4AZGA 1R0MA 3VNDA 4EX4A 3G3DA 2ZUWA 1G6CA 3V35A 3REQA 4QAIA 3KVLA 4P8UA 1IIHA 1PKNA 4CQCA 1CEOA 4DXXA 2ISSA 3PANA 4TXEA 3PZOA 2X41A 1XH2A 3O06A 3EXTA 4HZ6A 1K8YA 3AXIA 1AK5A 1MYRA 2V69A 1IYXA 4IQLA 1N8FA 1D8WA 5C70A 4NILA 4H2HA 3NQCA 3IK2A 2W0UA 1H7OA 2ZUUA 3ZOAA 1IE7C 4C6OA 3E2VA 1UR0A 1X6LA 2QQ6A 5BZAA 4XAFA 3QQ0A 2ZZ3A 2YW3A 4FIQA 3SGZA 4BF5A 4RDVA 1VBUA 1XGDA 4CQBA 3R0UA 1OCQA 3DBNA 4UBPC 2VQTA 5CJMA 3IGHX 1XLIA 1RVGA 3FA5A 2ZZ4A 1Z3NA 3AHYA 1EJRC 1B3ZA 3KRUA 1VYPX 1CGUA 2CW6A 4I8YA 4Y9AA 3T78A 5CSYA 3R10A 4GO8A 4MYAA 5A2AA 4RZ6A 2ATSA 1OC6A 2GGIA 2OO6A 1TTIA 2ADAA 3BZGA 3MVTA 3E96A 1XQLA 5EGRA 1HKJA 4L6DA 3WL1A 4W8BA 1GQJA 3BOLA 1FHUA 3PUGA 3BOXA 1SM9A 1TVPA 2WSYA 3FHQA 3BLDA 4I3GA 4ASTA 3AYRA 3P93A 3T8QA 3TYBA 2YCLA 1FWIC 3S9IA 4M29A 2WSRA 4UZUA 3HFYA 3E49A 3P5ZA 1V08A 1RA5A 4O50A 2V0TA 1FH7A 2XG9A 1B54A 3F4VA 3WUEA 1I8JA 2PDYA 3AIQA 4KMQA 3UVAA 5BOFA 3SIMA 4AD1A 5I23A 2XIOA 1OGSA 1VYSX 4ZZ9A 3B03A 2QVNA 3RRXA 4GIYA 4QHRA 1IT0A 3UWEA 4AWSA 3WH5A 5F2GA 4L80A 5A8MA 3ARUA 1JDDA 5FCZA 5AN7A 4JYFA 1CX9A 3NDZA 4P7QA 1NY1A 3MJMA 4GX8A 1KB3A 5BROA 1RP9A 2FVMA 2Q09A 3RM8A 4ROQA 3S1VA 2EG7A 1W9XA 1VFMA 3S9YA 4I5RA 5FEZA 4ZOAA 3KX6A 5D2VA 3CBWA 2XIBA 3S83A 5E0FA 5TD4A 1CGXA 4AZHA 3FJ4A 1DJXA 5LYRA 4QG6A 1KXQA 5HQMA 3CQHA 4B2DA 4O57A 1W9PA 4N02A 3G0UA 2ZUMA 1TV3A 4ERAA 4HSOA 1W1VA 2WZIA 2DSKA 1MI3A 3I7SA 4K8EA 2ALDA 3GNPA 4RV8A 2OELA 4JGDA 4XVDA 1ODZA 4WHBA 1SJAA 4AZCB 3ZWSA 3MA8A 2FZ8A 3ZVHB 3W00A 3IJLA 4HQVA 5C71A 3LNPA 2VFFA 3LTPA 4AD5A 2I1OA 1D3HA 3N2TA 3L66A 3M9YA 1ITQA 1YEYA 2A79A 2WKGA 1P7TB 4C6QA 1NQ6A 4P7LA 5IHSA 2NLIA 5HJYA 3PZTA 4DWSA 4WVXA 2VENA 3GSMA 4LUTB 4HD5A 4PMVA 1PX3A 4Q4QA 1FH8A 3GIPA 3FYOA 1VZWA 3BVJA 2OX4A 3GH7A 3VOIA 5C55A 1TB3A 4FZIA 3RR4A 4YTSA 2DPEA 3Q2DA 1Q8AA 1BVWA 2Z26A 3P6LA 2BVDA 4J3SA 1WKFA 3SCOA 4IFOA 1ECEA 1OINA 2VZUA 1O5QA 1K7EA 4Q8PA 4D71A 2TPSA 5T8GA 3LSCA 3O0KA 4QROA 4QEEA 1ZFJA 3GR8A 1LTDA 5D37A 3N2CA 1REQB 2XH4A 4ZTXA 3OVGA 4DJED 3RGTA 4A8LA 4O10A 1DJYA 5CPNA 2Y6ZA 5BRPA 2W63A 1UZ4A 1NFBA 4UFJA 3RHGA 3OB8A 1KA9F 1X97A 4IJBA 4S3CA 2BHZA 4LB4A 1OT2A 3NZ1A 3U7BA 1XSJA 3H2MA 2ZX9A 3KP0A 1S3HA 3LXCA 3TN6A 2QF8A 1BYAA 3P74A 4EE9A 2C19A 2P8CA 2Z1WA 1IEIA 3B9AA 1RSCA 2WHJA 4JEQA 1PUDA 4CN1A 1M5WA 3STEA 2E28A 3SSJA 2CBIA 1B4EA 4HCLA 3B0YA 3AJ7A 3NQFA 2I7GA 2FTYA 2OB3A 3C0SA 4O1BA 2QUNA 5DCBA 4GZ7A 4M51A 2J7EA 4FXRA 1U1HA 1YTEA 3GG1A 4EPKA 3F4DA 2XWEA 3S47A 3NPVA 2CXGA 4QDMA 4FNQA 1EJSC 4UB9A 3BUVA 3MSYA 4KWUA 3F7JA 3G6MA 4Z2IA 5I3DA 4FLRA 4LRTA 4A8IA 1JDEA 4NXKA 1AL7A 2OTDA 1SU5A 1PX4A 1S2UA 5CPTA 4JN8A 2QCHA 2POZA 4AD4A 2ANUA 3DZ1A 4OBRA 1Q6OA 1VEOA 1MUWA 5EMYA 4DF0A 4WKHA 1HKIA 1XYZA 3W7JA 3ES8A 4F48A 1TPH1 1VHCA 3NIYA 1K6WA 1VKFA 1L8PA 5DT7A 4J5NA 1QNRA 4HU4A 4JICA 4RNHA 4O0KA 1J0HA 2OWWA 1OYAA 3BG3A 3MDUA 1Q65A 1QVBA 2YLAA 3O3RA 4LT9A 3S6OA 1W3KA 4LYRA 4ZENA 4LUIA 1BG9A 1WYIA 3UNDA 3E2RA 1K4GA 3Q94A 3QJAA 3QM3A 5C2CA 5K3VA 2O4QA 1PAMA 3KOXA 4CU7A 3IARA 1E9IA 2IQDA 2QT3A 4GNJA 4PCTA 4E4PA 2TODA 3SURA 5IFPA 4YYFA 4H83A 1V3MA 3BCFA 1J01A 4ZL1A 4G2DA 4ORMA 3H2NA 1O95A 2A3EA 4D8ZA 3M5YA 2VR2A 3IUIA 3OZMA 6XIAA 2IPJA 4FO4A 1OZMA 2NQ9A 1MFUA 4LS2A 3HA1A 5CPMA 1WXYA 4Z2JA 2DU2A 1XLMA 2XFRA 1AG1O 3TQPA 2CETA 4XIAA 3ITXA 5CGMA 1KM4A 1G0CA 3OG3A 5H1WA 2DJLA 1ZCCA 1CI1A 2CKRA 4HA1A 2WJDA 2Y0FA 4NZFA 2MUCA 4F66A 1ZALA 4LNYA 1SJCA 2G97A 4IMFA 3W1XA 1V8EA 2BOGX 4E2BA 2ZUTA 6XIMA 1A80A 2NZLA 5EMJA 1JGMA 1UASA 1X1NA 2D3NA 2DZSA 1FKXA 2VVNA 3OQEA 4GFIA 5E9XA 3WLQA 4QM1A 3E3HA 3XIMA 3BLPX 4KFPA 1JG9A 4RR4A 4RNJA 4EVZA 3I3EA 1IR2A 1VFUA 3EX2A 4RXGA 3V5FA 3TJXA 4CNNA 1DP0A 4B5NA 3DFHA 3IPWA 3R4IA 1JAEA 1O7AA 7TAAA 1IF2A 4IISA 1T8QA 1JCJA 3M1ZA 5HNTA 4JFWA 3ARZA 1P1XA 3NR0A 4Q8MA 4TU1A 5DT5A 5HWJA 4U4MA 3S0CA 1N8IA 2J27A 2OFJA 2QCDB 3T42A 2QW5A 1F6KA 3ABOA 4DI8A 3NO5A 2GGGA 3EXSA 2DDXA 4M24A 3GO2A 3HG4A 2WHMA 4K68A 2FMOA 1EP2A 3NFUA 3PNUA 3RFAA 3SJNA 5FF2A 1OD0A 2CCRA 1LQ2A 2V2DA 3TP4A 4AX6A 2FHCA 5FEWA 1KR1A 4R9XA 2J24A 2ZX7A 4S3GA 2ISVA 3HN3A 4JTGA 4ONVA 5AHNA 3BAIA 1OK4A 5JIPA 3ERPA 2WVVB 1BWKA 1RXOB 1EA9C 5CSSA 4MB1A 5FOOA 1R3QA 3OTRA 1UYQA 2NUXA 1Y7VA 4E8GA 4JPGA 2QJIA 4JTIA 3HPZA 4UR8A 2ZTKA 3BAWA 2ZRVA 4HNUA 3PP7A 4HOXA 3NVDA 4UCFA 4OOUA 2Y7FA 2B31A 3ONCA 4GACA 5LIUX 1CECA 4HU8A 2E6YA 1O1ZA 1VENA 3A4WA 3PBMA 3QOKA 2O7QA 1J93A 2Y5JA 3BGJA 5CAHA 2BSLA 3CUXA 4DJEC 1TJRA 3PWIA 1Q66A 4O28A 3KVJA 1KFEA 2HPMA 4HVXA 2UV8G 3ITCA 3U2ZA 3NCOA 1Q85A 3NVTA 2OLHA 2FJKA 3WFAA 4YCPA 2WNNA 3B0VC 3K8MA 2ZZ7A 5BU6A 2BVYA 4YHEA 2DW6A 2GK1B 1KGXA 1YDVA 3VGBA 1PCWA 1VJSA 3GE7A 4DF1A 5CZSA 4E38A 2PWDA 1Q2SA 4D1JA 2QLYA 3MHFA 4YMZA 5XINA 1QXLA 5KZMA 4H6QA 2X42A 4OUEA 4RNFA 3CS2A 4WXZA 3VI2A 1WBJA 3POHA 5CJ5A 4HNOA 1XSIA 1D9EA 1FH9A 4MM1A 4PYSA 5C2GA 2F2KA 4PRWA 2IW0A 1T96A 3CJPA 1E3ZA 1Q6QA 1QWKA 1XIFA 1CXEA 4U2YA 1RCOB 1YXDA 3QMTA 4OTKA 1HP4A 1SW0A 4TX6A 1C8VA 4LS1A 2GYIA 1KBJA 3NQ8A 1B5TA 1DE6A 2R1PA 1SZRA 3GUWA 2CFFA 3W6LA 3LG3A 4PUNA 1HJWA 4RDWA 2WSQA 3ZR4A 1RA0A 4AFYA 3RPMA 1ALDA 3IAPA 4CU6A 2NSXA 3DIPA 1HIZA 4XKMA 3MTWA 1V6TA 4L56A 3W2UA 4J7RA 3MS8A 5D33A 4GKLA 2WKLA 1EWDA 1JPMA 1A5AA 3NGJA 3UG8A 3O6AA 4O4WA 2WHLA 1EPVA 2WAGA 1X7FA 5CG0A 5HMEA 3H2OA 1CT5A 3M7WA 1CGYA 2Z7GA 4OBSA 1E56A 3QV6A 4G7FA 1XIDA 2PTYA 1SSDA 3P81A 1FWTA 2WMGA 1BVZA 1KFLA 2GL5A 4C1LA 2HZGA 1M7XA 3GH4A 3Q4DA 3ECQA 3DHPA 1BLIA 4MB4A 4FLQA 3S5YA 4IFKB 2Z6IA 3UVIA 1H1ZA 4MMWA 3UT0A 3W72A 1A50A 1K1DA 1E0TA 4BF7A 2OGYA 1E6PA 4Q4OA 4R33A 4EOUA 3HQOA 2QJGA 5BXRA 1OABA 5A95A 4MAZA 1V6XA 3NL5A 1TX0A 4JTHA 4H4IA 2XVLA 3O9NA 1FWBC 2I14A 3AIEA 4PMOA 3ZSSA 1C3FA 4TO8A 4AY8A 6PTDA 4B3ZA 3R8GA 3PG9A 5A2BA 5CSUA 5KEZA 5AYYA 3QSTA 1H7WA 1VIZA 1LP6A 2OYLA 5C9UA 1DHPA 4BI6A 9XIAA 4PULA 4GUIA 3L0NA 3FSUA 3M16A 1TG7A 1XIBA 1G5AA 5AECA 4NG3A 3BSHA 4N7QA 2CU0A 2PB1A 3UW6A 3VOJA 3QXBA 3NQ7A 5I06A 3WSUA 3EWZA 3H24A 2GQAA 4U10A 3BLKA 1ZBCA 3C56A 5A6BD 4JIQA 1KFBA 1JVNA 4GNKB 3NQDA 1T8XA 1HL2A 3SO7A 5G4WA 4U2ZA 2Z27A 1JJKA 4OV9A 6ALDA 3OA3A 4S3DA 4EAYA 3BCDA 2DUXA 2Q8XA 2RUSA 4AEEA 2Y61A 1EDQA 1UW9A 4JQ2A 1LJYA 2J62A 4RPPA 2JBMA 4ZO7A 3D3FA 4Y7EA 1TQJA 4REQB 2ASHA 4A6GA 1FWRA 4L6OA 4Q7NA 1M41A 4PEKA 2FQIA 1T0OA 3VINA 2FHFA 2A3CA 2KZHA 1S46A 3DU0A 4NVTA 4HA0A 1TQXA 1WA3A 3AIRA 1EJXC 3GKFA 4GZEA 1ZUAX 4G9PA 1E6RA 3HQ1A 1XG3A 1UWRA 1GOOA 3RK8A 1ZBVA 4O0QA 1UR1A 3CGTA 4XD3A 2J8TA 3GTNA 4TVDA 1IGWA 4B5SA 4KGJA 3MP4A 3HBLA 2J4GA 3BTNA 2YL6A 3TONA 5C6MA 4PFHA 5TF0A 1J2BA 2FZMA 4AIUA 3GBEA 2BV9A 4QG9A 4C65A 1ME7A 1LOLA 1DJNA 4CCCA 1BGGA 3WK3A 1LRNA 1BTMA 2ZICA 3ZIZA 4CD6A 1ZSXA 3RAOA 1VCVA 1DJHA 3HFTA 3NZGA 3QOMA 1F4AA 5G2WA 4GQBA 2HXTA 3BMVA 4LVGA 1Y5VA 4O54A 3MCMA 1W91A 1W6TA 1ME8A 1R3RA 3GG0A 3K1GA 3H21A 3ATZA 4JTEA 3ITLA 3NEHA 3UF9A 4IP4A 1HW6A 4LB3A 4F0SA 2Q02A 3IJIA 3U5UA 3W81A 1T40A 3LDVA 3VDGA 1S1RA 3VD9A 3K46A 1ZRQA 3OBAA 1GGOA 4XBKA 1XINA 1ZHAA 2VEPA 1ZBWA 1BVNP 4OVXA 5KZ6A 4ZQRA 4UTHA 2OX1A 5F1VA 2XGBA 1TWDA 4UTKA 3PVFA 4C6JA 1VEPA 1AZ2A 1A5LC 3N6JA 2GOUA 1ZNNA 3B97A 1SO3A 1N82A 4UTWA 2JF6A 6REQB 4BA0A 1AD1A 4H1ZA 3LQGA 1BXBA 2XDFA 3GD6A 3N11A 3ITGA 4JTLA 1BRLA 2D0FA 2NWSA 3WFLA 3TTEA 5HQLA 3U7VA 4QBXA 1B0IA 7XIMA 2WBKA 4QDPA 3MBFA 4XIMA 4CQ9A 5B7ZA 1PCKA 5M5DA 5DMNA 3WBWA 2RDXA 5E70A 4KWSA 1R7OA 4MHBA 3G18A 4NAFB 3KUMA 4X22A 2V2CA 1I0BA 1KRCC 2V9DA 4IGHA 4D6GA 1AQFA 2NSOA 5IM51 4RL3A 1TWIA 2XIQA 3VFLA 4G1NA 4GVHA 1W56A 4DYJA 1DQWA 3MUY1 1JGIA 3CUFA 4GKTA 4J28A 1F05A 2J7FA 1PBGA 2C91A 3AC0A 4GJJA 1CBGA 4Y2WA 4PBEA 3IV8A 3ME3A 1IHIA 1YXYA 1TV8A 4TVCA 4NAEA 4HMCA 3JRKA 3MHGA 2XFFA 1O6IA 3RIKA 1XYBA 5BXPA 1J0JA 3WH7A 1DXEA 6ENLA 2RGMA 1LT8A 1BKSA 2OYMA 5MF5A 1ZL1A 2VFGA 2J66A 4N6FA 3W7HA 5CC3A 5BYWA 1K3UA 4N0RA 2DZBA 1QAPA 3GHRA 3RX2A 3LHVA 3K2GA 3TU9A 4UQBA 1I0DA 2OWXA 2GQ3A 5F1UA 5JU6A 2Y88A 1LBLA 1GHRA 3R13A 3MMTA 3NM3A 5E0KA 1C29A 5IDIA 4E8DA 3N12A 2ZRYA 3C2FA 5D32A 1DWHM 4F9JA 1SR9A 1V93A 3RITA 3ARXA 2QDDA 4IXXA 3UYCA 2ALRA 4JX5A 1KM6A 3E1F1 1KXVA 1RCXB 3LU2A 3NQEA 1C9DA 4ZBCA 2Y85A 3NNTA 1Z48A 4DWDA 5LGZA 3GDTA 1GOQA 4H01A 4F8XA 1DWJM 2PGWA 2PDLA 2CLFA 4HZMA 5ECVA 3LBCA 2WVTA 4LCSA 2Q01A 3W7DA 4HN8A 3A9BA 1A5MC 4I9TA 3AIUA 3LSBA 3CHFA 2WLZA 3OLDA 3CV6A 1XBVA 5D05A 2TAAA 3ITTA 3WN6A 1XWYA 1DYSA 1XDLA 3OG2A 1IQ8A 4O17A 1S38A 4HNLA 5C2XA 1Q6LA 4NNBA 1J5TA 1HN1A 4ATLA 5D4YA 2CWNA 3EA3A 5EMUA 4ZR8A 3QHNA 3WEZA 2C15A 3SM0A 3OEXA 4ZQCA 1LORA 1V4YA 2ZBTA 2IXUA 2C8NA 2RJGA 3TAKA 1ZQ5A 1RK6A 5K7JA 2VFIA 1B4KA 4E2OA 5D2WA 1HQTA 3H7UA 1UWAA 3RM4A 4B5VA 3E2QA 1O94A 4WEVX 4PMZA 1ELSA 2FVLA 5DCEA 4XBSA 4YN5A 1UKOA 1NF7A 1PTAA 1F9CA 4H6KA 4M7SA 2W62A 3LUTA 3PY2A 3ZJ8A 2GWGA 3FA4A 3VNZA 3TYEA 1H7NA 3FGCB 1GTHA 3UNTA 2C71A 3B8UA 4H7CA 2YLLA 1P5BA 3LBMA 3UJSA 2NUWA 3A64A 3TQ0A 2DZXA 1OF6A 2XZ9A 2E1DA 1YNPA 1EQCA 3GVGA 3CZJA 1WDSA 4Z17A 1R8LA 1QHZA 3Q58A 2PP1A 2V5JA 1UP2A 4DJFC 4FLOA 4LWWA 1LYXA 4ZQOA 3EZ4A 3WQ5A 3M0MA 1SW7A 2VCCA 4C6KA 4WY0A 3VO0A 2XGZA 2DT3A 4AY7A 3MYPA 1V02A 3O8AA 3RO6A 1O12A 3AU6A 3EKZA 4XZWA 2V5BA 2QVHA 3GKAA 2FYMA 2PCQA 3S5NA 2O9OA 3S46A 1EOKA 1QBAA 1TMHA 3SCWA 3I6EA 1FWCC 2DSWA 2OU4A 4IGMA 3NPWA 4MFDA 4C6FA 3TR2A 2VC7A 1LRTA 4WXYA 5FIPA 3CQJA 2GWNA 2CIPA 4S3EA 4LCQA 3NTYA 4CLMA 3HV9A 4IM4A 1UC5A 4TMBA 2CNCA 1JZ6A 3MY9A 4LF1A 2ZX5A 3LHWA 1VB9A 3W07A 3W23A 5AB3A 3QW3A 4DXKA 4OT7A 1H09A 1KXTA 4QCEA 2BS9A 3M46A 3HO8A 4BS0A 4CNUA 1IEWA 3QZ6A 4ZB5A 4PCNA 3PAJA 4LW7A 3GAKA 4DNMA 2ZVRA 1XP3A 3GUGA 1X96A 2DJXA 2NX3A 3U48A 4U3CA 5A6LA 3AUJA 4D8AA 2PUZA 3CPRA 4HJFA 4QSHA 4AW7A 1ZLPA 5DLCA 4HYWA 4LVAA 4QJ5B 5BOOA 2CLHA 5DMMA 3W27A 1OC7A 4V33A 1GK8A 4CU8A 1DWFM 2D23A 1TVNA 3R8HA 1XIEA 1NDWA 1K02A 4TTGA 3OBEA 3R2GA 3STGA 4AHOA 4DIAA 2HTMA 2YDSA 3WMSA 4XZIA 5HPOA 2VD9A 2C79A 4BF9A 3KOYA 3RR1A 4H9VA 5HNRA 1XIMA 4MB5A 5A94A 4UWMA 5J5RA 1CCWB 3VGFA 3E0IA 4Q3MA 1IT8A 3NO3A 3KLLA 4WGHA 2V3DA 1F3EA 3U4AA 3LZ5A 4XKYA 3KDNA 1AFSA 2A5HA 5HPCA 3I3BA 4CQ8A 1TTPA 3AMGA 1R6WA 1VLWA 2PGEA 4BCEA 1ESWA 3DKJA 5AC6A 1QPQA 3RM9A 1DORA 3GTIA 3WQVA 3UZ5A 2XZ7A 3KRZA 3PUDA 3RPDA 4Y9MA 1GQNA 2F6XA 3GIYA 4MADA 4B9ZA 4O13A 4BFAA 1L2QA 2NX9A 2H9AA 3A4XA 1OCNA 5B80A 1TELA 1BG4A 2WSPA 3CMFA 3H54A 3N4EA 9CGTA 1PB0A 4ICCX 3MQTA 1XPGA 3S2JA 1V0MA 4GISA 5T26A 3LXBA 2A7PA 1EZ2A 4PBGA 1SFTA 1LLWA 3MW7A 3UWUA 2ZDSA 1EB3A 1IEVA 4DYEA 1OC5A 3W84A 4ZQPA 3S1UA 5I7GA 2GJXA 1SVDA 3V1HA 3LB0A 2PPGA 2O0TA 4AHQA 2GJLA 2DIKA 2WW5A 1C7SA 1FKWA 1NELA 1WE5A 4UR9A 3RG6A 3LERA 4JXCA 1W8GA 1X6NA 4PMYA 5TNVA 1UQYA 3N34A 3WY1A 4LAMA 4QLJA 4XZ9A 2WC3A 3VIPA 3LCGA 3HV8A 2R14A 3EX4A 4I9MA 1XCWA 3UCCA 4RPQA 2XTKA 4C6LA 4E0CA 3NJ3A 2EO7A 3ALGA 3WCZA 3FEMA 5HMDA 3GNXA 1QFEA 4US5D 2XWDA 4YU1A 1Q5MA 5CBBA 4EXBA 1Q7MA 2X05A 1CLKA 1K8CA 4JFVA 3NQMA 4GQ0A 3PZIA 1O1HA 3WBAA 3E2SA 1OM0A 3AOFA 3IV3A 1ICPA 4GD0A 3QGVA 3HPSA 3W25A 1VLIA 4H6EA 4XTIA 1TPEA 1VH7A 4JQ1A 3VE7A 5CCZA 1HTIA 2OSXA 3VC6A 1A47A 3UY8A 3UZWA 1KD0A 1DQXA 3BLLA 1A5BA 3N9RA 4AEOA 1J9YA 3GG7A 1TV5A 4GIRA 1A5NC 2D69A 2Y8VA 2P50A 5EFFA 5I5RA 4J2MA 1LRQA 6A3HA 3BW3A 4ZFMA 4O8AA 2E4TA 3P7YA 1CTNA 4FF7A 3M0YA 3AJXA 5JH1A 3GG8A 4CNOA 1XH1A 3GY1A 4GVGA 3NURA 1BQCA 1FCQA 4RX0A 3JZEA 2GQ8A 3S5SA 4B4FA 3WYZA 1C9WA 2B7QA 3UWZA 1WCGA 3QV7A 2WMIA 3TZNA 1W9BM 2PWHA 3HU7A 1UOKA 1DVJA 2QPXA 3PF3A 3WQCA 1XFCA 2J75A 1I1XA 2ZE0A 3W1LA 2FMNA 4Z42C 4C6MA 5EBUA 4HHLA 4LBRA 3VKBA 2EF9A 4K2SA 3S9ZA 2JGYA 5TQLA 2PWEA 1Q13A 3MSGA 1ZP4A 4N9DA 2FZ9A 1AMYA 2OT0A 1UKSA 1ONWA 1XPYA 5C5YA 1Z41A 3VDBA 2YBTA 1S2CA 4UQCA 3MC5A 2REQB 1F6PA 3T6CA 1FHDA 3AIVA 1I2OA 1GVSA 3TV8A 5E93A 4XWUA 1EUAA 4DVOA 4I7VA 1RBOB 5FSEC 4Q8TA 3EBVA 4GUGA 1DIOA 3GVWA 3K13A 3P67A 2HE8A 3IUHA 4PA8A 2ODOA 1CXHA 1R3TA 4HK6A 3W88A 1V7YA 3G1YA 4O11A 2VRQA 2VJXA 4IMDA 1CXIA 3LTSA 4XD4A 3W1RA 3MMWA 1FBAA 1SJBA 1F3XA 5DELA 2VCAA 3RX4A 2D1ZA 1A3HA 1NARA 1AJZA 4KERA 4PRTA 1RQHA 1MRQA 2QCMA 2XN1A 4QLLA 1PZ2A 3UA4A 3RCYA 1EJUC 4B90A 2VGIA 2XN2A 3LPFA 4GE8A 3L4VA 4KEZA 1WPCA 3KBJA 1JQVA 5DO8A 2Z25A 1ZPTA 2DSVA 3N19B 1XICA 2BDQA 4HU3A 5LA2A 1WOBA 4XSLA 5C7HA 1IXNA 3EWWA 2J74A 3CV1A 1UH4A 3VNIA 2BBFA 4CVUA 2LLEA 3JUGA 1QK0A 1EJWC 1XG4A 2CZFA 3TYAA 3U2OA 4G5DA 4L9XA 3IANA 4Z1YA 3A9IA 3VKKA 3HGOA 1U2YA 1G67A 3H7VA 4AXKA 2PGFA 1BTCA 1H60A 1HKVA 2DT2A 1YX1A 1H1YA 3FEQA 1RAKA 3BE7A 1EGVA 3II1A 1J0ZA 4YVPA 2PC8A 3PWAA 4Q4PA 4KFNA 4BZYA 3H55A 4HNTA 5HXMA 2NT1A 2HVOA 1VR6A 3A22A 1T6MA 2FFIA 1LDCA 1AQ0A 3BICA 4UTFA 3MVIA 1DJZA 2W6RA 1H5VA 3ABQA 3WENA 3UPBA 1BXCA 1GG0A 3TAOA 2O7SA 3G6LA 1A5UA 1ADOA 1YYAA 2ZA2A 1OK6A 4Z08A 4FF5A 5JIWA 2IPFA 1KWGA 3U5YA 1KFJA 1OFBA 3VA8A 4HNNA 5GQBA 1LROA 2ISWA 4AMAA 4MKNA 5FF0A 3IRSA 5DEZA 2BGQA 1EUNA 2E68A 4POCA 1Q7QA 3DG3A 2VC5A 3IIPA 4IGNA 2VDHA 2ZUNA 5HWNA 2HEJA 4ZO6A 3FSTA 3LPGA 4N9BA 1DQUA 3NZPA 3OIHA 3EDKA 2GPTA 1FWEC 1G9HA 3WF2A 3KOFA 3W6YA 2O9PA 3VIGA 2ZDRA 5HDRA 3URQA 1PZ3A 4LYQA 1YRRA 4W9TA 2ACRA 4B91A 3OVRA 4MYXA 4PC8A 2VRJA 5FEPA 3W37A 2HNHA 4MPKA 3L9CA 3R11A 1J18A 3FDGA 3REQB 3IGUA 2AOSA 3J7HA 1HO1A 2PWGA 2YW4A 1IXQA 2G95A 2QCEA 3HB9A 4HOWA 1QCWA 2CZEA 1PKYA 3ZVHA 3C2YA 4LC6A 1SMDA 2UY4A 4NSBA 3OZPA 5EB8A 4JKLA 2Z0IA 3OA5A 4HK7A 4V1YA 1OYCA 4HOZA 1SO6A 1WBHA 3MWCA 3M44A 3PZNA 5K4ZA 3R94A 3M7SA 3PPHA 4N4QA 4P8WA 1JXJA 2WPGA 1P7TA 7TIMA 3OOQA 1TMLA 4K1GA 2BY2A 2FPVA 4LUTA 1BEUA 1KNWA 1Q2RA 5K9CA 1Z44A 2EPOA 4ZODA 3NXLA 4GXPA 5DFAA 4FX7A 5FJUA 1JUEA 2OKOA 4AU0A 3GYEA 3AWOA 1GOXA 5F2MA 2OLSA 3WDJA 5DBUA 3R25A 3QV8A 4AYGA 1QW7A 2V38A 3TYZA 3CB8A 1EOMA 3AHVA 4K36A 4OWGA 4Z1DA 4AF0A 2DUAA 3IACA 4AX7A 1SYTA 3A6OA 4JNMA 3R1ZA 2Q71A 4OE7A 5AOUA 3M6DA 3ZS4A 2GUUA 1EEPA 2PLMA 3GTHA 3GWQA 1EXBA 2PRHA 2FTPA 2CBJA 5CQ1A 1JUBA 1V0KA 1W3LA 3CIXA 1UG6A 1AJ0A 1SR0A 3PJWA 3W29A 3HGJA 1EDTA 5CZ0A 3TTQA 3MHUA 1LCOA 1UC4A 1YDYA 4A3RA 4CCDA 1PTGA 5JQ9A 5D38A 3HGRA 3F4WA 4LUSB 3B0XA 2J6XA 2B7NA 1PPIA 3VD7A 4H8VA 3VDAA 2JIWA 2QCFA 1IWPA 1YIXA 2YCLB 2ZVIA 3PBYA 3WUFA 3AWNA 2QZRA 5M3WA 4LAUA 3V0UA 4HZ7A 3NOYA 1ZZMA 2V3FA 5HK4A 3FKRA 4OU1A 1RJQA 3DYPA 2ACSA 3KS6A 3GXTA 1UWQA 2CWXA 3AQUA 4GBUA 2QUVA 4MZ1A 2YL9A 4UFHA 4M6QA 3KBVA 4I6VA 3VCNA 4HU0A 3LD5A 4K38A 4CKQA 3C2OA 3TJ4A 1JL8A 3KXQA 3Q65A 3P61A 4NZ5A 5M1TA 1GVOA 1QPKA 3BLOA 3WF1A 3N2BA 2R1NA 1GKPA 1LL6A 3VIOA 3BDKA 5I78A 3SB0A 4NNCA 3QLLA 3VYLA 1TFVA 3D6NA 1N2VA 1IXPA 3UCQA 3PPGA 2PU0A 1VHNA 7A3HA 3EX3A 1ZY9A 4GUJA 4KF1A 3DHUA 1IEXA 4KRZA 3G77A 4LGXA 3W7IA 3QR3A 5AC7A 5A6MA 1FP9A 2I5IA 2OOFA 3MMDA 1OCBA 1ZJBA 3S5ZA 1X38A 3OVQA 4B5UA 4S3BA 1RUSA 1XYCA 3RNDA 3RMEA 1TPUA 2ZX6A 3W85A 3TMLA 3SIZA 3I7RA 5DY2A 1QATA 3B8DA 2I17A 1XC4A 3VD3A 4D9PA 3WQDA 2CBUA 1HO4A 2PD9A 4B9YA 3T0AA 4DJEA 1B3YA 3VZXA 4YTQA 1D7KA 3MUXA 2DIEA 2WWDA 4QQ3A 5KITA 2B81A 1K8ZA 1YDNA 5CH9A 4NXSA 2JGQA 1Q4NX 3PZQA 3H12A 2B4GA 2EQDA 4DWSB 1S5VA 3NEVA 1OEPA 1DWIM 3LLFA 5A8NA 3UPMA 1QOQA 4L5ZA 4WSJA 3T2QA 2WWCA 3P2VA 1F8MA 4LALA 2YCKX 3MI2A 1UA7A 3OLIA 5JVLA 4MVAA 5E09A 4LQ1A 1BQGA 4GPNA 2FDMA 2UWFA 3V5OA 3FFSA 2HK0A 1HZYA 3SEPA 4HK5A 4DB7A 3PZ9A 4I6KA 4FB7A 4AZ5A 1FDYA 3WBEA 3G0SA 3Q37A 4PZVA 1P6WA 3ORWA 2VYOA 4Q6JA 5A2CA 2XYLA 1MEHA 2OMAA 4PUMA 3CNYA 1Z89A 3K4WA 2G96A 4L1WA 1J8VA 4AVNA 1XI3A 3W1MA 1WDDA 4KH2A 5D02A 2VCBA 1N55A 1P0NA 1UPMB 2WMHA 2VVSA 3POCA 1AD4A 2NV1A 3L4ZA 4GIAA 2QJMA 1PDZA 3S2LA 4AD2A 3O7UA 3W1TA 1CPUA 3L2MA 4J9JA 4XSMA 3MUZ1 3WKZA 1UWIA 4ADUA 3NYZA 1S5NA 3CAQA 1FCUA 1GPWA 4RZ5A 2OODA 5CLTA 4LU0A 2ZZ5A 1O68A 4J3UA 5AFDA 3H8AA 1EP3A 3HF3A 1V02E 3TC6A 3S1GA 1TREA 5KMYA 1EGMA 2XH2A 4IIDA 3TCSA 3VGGA 1Q3NA 4I9AA 1TV7A 1UR8A 4O18A 1UR4A 2PFHA 2QCCA 3W01A 4FXFA 1NP0A 1JPDX 1X8CA 3UA3A 4X61A 5I6SA 3CYVA 1AH4A 1R2RA 3ZM8A 1HVXA 5IXEA 2WC4A 2WKJA 1TUXA 3W7EA 4C7DA 1XLGA 2ZA1A 4DZHA 3BARA 1RLCL 3PB2A 1JUKA 3EB4A 2YA0A 3A3HA 1F6YA 1FDZA 3C2RA 1QI3A 2V5LA 3HTWA 1G94A 3TTOA 2VUYA 2YCIX 2D22A 1IT7A 5I2UA 3L2IA 5SWUA 1T7LA 3TN3A 3RRAA 2ZRWA 3GNDA 3LCFA 2PDUA 3GHUA 1PJ9A 4L4PA 3RYSA 1UUQA 4UMCA 3GU2A 1KM5A 2WVSA 2O9RA 3STPA 3WD0A 1Q6FA 3W7PA 4WUIA 3U0HA 1R86A 3URAA 4ERIA 1QUMA 5DRCA 1Z42A 5IDZA 4HBKA 1VCGA 4DO7A 3KL5A 1EIBA 3PBUA 4C6NA 1YPIA 3TYDA 1B57A 4E4FA 3F1QA 4U5KA 3TROA 3CB3A 3OZOA 3FJLA 3NAVA 4NX0A 2VP8A 3CH0A 3BG9A 1H1NA 2NVAA 4ZQMA 1DL3A 3L5LA 3N4FA 3USBA 2C14A 2VELA 4PTWA 1P43A 3CUIA 4DEFA 3DCPA 1KR0A 4TV5A 3THQA 3IIXA 1U5VA 1X39A 2Q8ZA 2JE8A 4DWSC 4KS0A 3COTA 4Q7BA 3L12A 2P0IA 1KCXA 1KQZA 3W2MA 1CXKA 3SCQA 3KAOA 3KBNA 1MQRA 4W88A 2PZNA 1C7TA 3U8GA 1UIPA 4Q22A 2WVUA 3VFCA 3S2CA 1LWIA 1GONA 4E4UA 1F73A 3GW3A 1FWJC 2ICSA 2XIMA 3GAYA 3WLPA 2QR6A 1BFNA 3DFNA 2NXGA 3ZO9A 2AMGA 4IGSA 4PN2A 1R7AA 4HSNA 2FDSA 4ICMA 3GVRA 3W1UA 4HSHA 2AL2A 3T81A 1EKOA 2OZ3A 1TCDA 4F0RA 3W02A 4FSAA 2A3BA 5CPQA 2AKZA 1AH3A 3UWQA 5FJIA 2BY0A 4M7TA 3H23A 1W1ZA 2FIQA 1O60A 5HMSA 4JN7A 5FF4A 3CUGA 2PGRA 2R6OA 4Y96A 2Z1KA 5LIXX 1L6GA 1H7XA 1W3HA 3HPAA 3HZ3A 2R94A 3WNPA 2QDEA 2BX7A 4P7RA 5HINA 2ISDA 2VL4A 1NFGA 1R5YA 4N6EA 4AAJA 4S2BA 1F7BA 4I8DA 4Y8FA 1P1MA 3WUGA 4IQEA 3TJLA 1PIIA 1MMFA 1NDZA 4Q4SA 3QEZA 3LY0A 1QO5A 3FY1A 3L5MA 1EA0A 3KL3A 4A8RA 1LOQA 4XISA 1NAL1 1DHKA 4DY1A 1H4PA 1T41A 3AMKA 2VM8A 3WQOA 1XRSA 4ACZA 1Q63A 2HV5A 4L65A 4D6CA 1NJJA 1BWLA 3CZ8A 4QAWA 4HTYA 4YVVA 4UQDA 4L9ZA 4FOJA 1MQPA 4JEJA 3T08A 2PWVA 1XRFA 2WNWA 5BOEA 1GW1A 3ANVA 5C9XA 2J13A 3IJ6A 3NQ6A 1D3CA 1DIDA 4PSRA 4LEFA 3IGXA 4M6PA 5DX7A 4JTQA 3WDIA 4X2PA 2VEIA 1ZBKA 1W37A 2XSBA 4H7VA 1A53A 2RH9A 1ODUA 2AL1A 5G2HA 3ABZA 3MJYA 3AS0A 1L0PA 4DUXA 1V6WA 2YIHA 3A4JA 3CZLA 3ES7A 3UZJA 1A4LA 5HUOA 1F3TA 4AQLA 1NIUA 4WRHA 4UTUA 3EPMA 1NDYA 2R1MA 3H2FA 1WAWA 3WK1A 2ZKMX 2VX7A 3C3UA 3B4UA 4ZXOA 5A6AA 1QO2A 4ML4A 4XZBA 1E0VA 3T55A 3OP2A 1OFQA 2WB5A 1K7FA 4PTNA 4HCHA 3GXIA 2CITA 2GUBA 2XGIA 4EXAA 1XKYA 2W5FA 3UXDA 5AVNA 4MY9A 3ELFA 1BYCA 3KW3A 3R79A 1W5QA 1R2TA 2C1IA 2C7FA 4D6IA 1SSGA 1E6SM 3GDLA 4CNSA 3VCCA 4X2RA 2VX5A 1OX5A 3LCXA 1DXFA 4FIRA 4V2XA 2HS6A 2WJZA 3CC1A 3HPXA 1LBFA 4RE4A 1D7FA 1UROA 4RE3A 1JCYA 4BKNA 1C90A 4L7ZA 1UHVA 2X1IA 3E0VA 3UR8A 3O0FA 2BHYA 3T0CA 4JR5A 4MTVA 4REQA 1Q7ZA 1EX5A 5AHFA 4XUGA 3BAKA 4WK9A 1PWMA 3GU9A 1H3GA 5G4EA 1MUCA 3NL3A 1OY0A 3AXMA 3NQBA 2IKIA 4AG0A 5CPLA 2YA1A 4HPGA 4JKKA 2JEQA 3LBOA 3MB9A 4X63A 5EMLA 3W7MA 3ZJ7A 5AC4A 1Z69A 3G1FA 4XAZA 3KZPA 3BH4A 3NZRA 4ZE4A 2F2HA 1JYVA 4YCOA 4DO6A 3T1GA 2IPGA 2ZTJA 3I10A 2BTMA 3FJNA 1ISXA 2J9YA 1G01A 4ILSA 2WZEA 2POTA 1E4LA 3VDHA 1TX2A 2AAMA 2ONEA 5D9NA 2AQVA 4L6HA 3SFWA 1YTKA 4GYFA 3K4DA 4UR7A 4JCLA 2BVWA 1PVNA 1BD0A 2JQXA 2YBVA 1V3IA 1XGZA 3T0BA 3APTA 5HATA 3C0JA 3BAXA 3ONBA 2CEQA 2NQJA 1AL8A 4UOZA 4ZO9A 2E40A 3E0FA 2G4JA 4PMUA 3DDMA 2A0NA 2ISFA 2HVNA 3N73A 4CN6A 4IMCA 3TTYA 3BLIA 4IIEA 5BXSA 5I77A 1BF6A 3CQIA 4H9YA 3O16A 3W7NA 1NM9A 2QF7A 1K9EA 4MKSA 5A6BA 1K8XA 4HB7A 1FWNA 1F3WA 1TPVA 4XAYA 2PDMA 1B3VA 1EFZA 1GTEA 5HWMA 4ZXLA 1IWAA 4H04A 5EYWA 1PEZA 1OFRA 4QE5A 3GS6A 5D2YA 5CJNA 1XYFA 2J8GA 4DF2A 4G1KA 4TUFA 1OSEA 2OSYA 5DXYA 1G7VA 4GIEA 3S2NA 1DJIA 1IZCA 3TLLA 1SQ7A 3TFCA 4KIEA 4FXSA 2ZXQA 2XIIA 1IZKA 4CEUC 6REQA 3N25A 2PBOA 4JIEA 5GJPA 2A21A 1QI2A 3FLUA 2VNCA 3PBWA 3F4NA 1XLDA 1TJPA 3QF0A 1VPXA 2BVTA 3KDOA 3EKLA 2H8XA 2WO5A 1XC6A 2WCSA 4NJHA 2WZTA 1FFRA 4WDTA 5C9WA 4CGTA 1UR9A 1W1A1 3F5KA 3UWVA 3NSNA 3T0TA 7PTDA 1G4TA 1XLEA 2D0GA 1SFLA 3HQNA 3G1HA 2D3LA 2QPUA 1HL9A 3G1XA 5F2IA 1JRBA 4ZOCA 1TTJA 1XM3A 4IICA 1DIKA 1E0XA 1EP1A 4UFKA 3MANA 1XX1A 3FOKA 3P82A 4QP0A 1HUVA 1IIGA 5HULA 1TJ2A 4DO5A 4DI9A 2J8FA 3WLJA 2PWUA 2VGBA 5GNYA 4GQRA 1IZJA 2DGAA 1YW1A 3ANUA 5KINA 2KX9A 3R58A 3LTYA 4HMNA 4G56A 1WUFA 4HYVA 1NDVA 2C16A 4OV4A 1UD6A 5CZKA 1TTQA 3DESA 5G1MA 3CXOA 5REQB 4C1KA 2FPTA 4WKAA 4EANA 1AVAA 1K77A 2PDXA 2VKZG 3WG6A 2V6AA 3EDFA 1MUMA 2X2YA 5AYXA 3LHTA 2PC4A 1EC9A 4A3YA 3N17A 5CC6A 1ME9A 3UXAA 3THUA 3B06A 1TZZA 4GZJA 3UG5A 3VZYA 2BZNA 1A49A 3IJDA 2CLMA 4JFUA 3L68A 3FXYA 3G1SA 3LXAA 1YBQA 3VDCA 4U28A 5EMMA 2OG9A 3N18A 2H6RA 3W26A 2PDIA 2YFNA 3W83A 1YDOA 1NQKA 2EG8A 1CYGA 5E9AA 5ECUA 4LY4A 3LEPA 4BI5A 1NWUA 3ARYA 4AIOA 3N29A 4MKVA 2PDBA 4IPJA 6CGTA 3U2EA 2WV8A 4NYUA 3K8LA 3FA3A 1QI4A 3WBXA 3A4AA 1D3GA 4UOQA 3UBPC 3WX7A 1E72M 1TKKA 3VX0A 4WOZA 3W24A 2C0HA 4O1EA 3DKLA 2AGTA 3LQLA 3G22A 4EK7A 4LS0A 1KBKA 4FX6M 1UKTA 1GWJA 3W28A 4F2BA 1EYEA 4U3AA 4JTJA 1K9FA 1XUZA 3SN4A 4GI4A 4WDWA 1M7PA 4QS6A 3U9IA 1MZHA 1NFPA 3AZTA 4DX3A 4KRUA 4UFLA 4MFEA 4PCFA 3NYDA 4BEQA 4KESA 3L4TA 8CGTA 3V5CA 5H8MA 1ZENA 1EHNA 4DAFA 3QPZA 1AQHA 2ZX8A 5GNXA 3GZ3A 1VBJA 1BRLB 5AKQA 5I3HA 3ITVA 1UJQA 4M6VA 4MOZA 1FWSA 1TJ0A 2QDHA 4H9ZA 1X1OA 4D72A 1E5JA 1VJZA 2B7PA 1NTHA 1TMQA 3FGCA 3T07A 3VIFA 4ENLA 4NU7A 1FTXA 3UETA 5E1QA 1KFKA 2PLJA 2QJNA 1ZJAA 1J4EA 5AHEA 3I6RA 2WJFA 1WZMA 1OQFA 5I79A 2V3GA 1GQKA 2DIJA 1MW2A 5EPDA 3WD2A 3PNZA 2ZXAA 5C7VA 2RDWA 1TPFA 2Y7EA 2CZ5A 2YYUA 4GYPC 3NQ2A 3BGGA 4M0XA 3T4CA 5BNKA 3QKZA 3P8JA 3KEHA 4Z1CA 3PZMA 4GH1A 3KWSA 1A4MA 2NWRA 4ZB2A 3NQAA 3O2LA 4NAEB 1FFQA 1UMLA 1WV2A 3M07A 1SZGA 1RD6A 1UCWA 2OVLA 3BLFA 5K9DA 1V77A 1JF5A 3VNMA 2JKEA 1RR2A 1DBTA 5EY5A 3V0SA 2DW7A 1LL7A 3QSRA 3RLVA 3DFOA 1E6QM 4WCJA 3WDRA 3DI0A 4WGXA 7REQA 4RUBA 3AO0A 4Z2HA 3TVAA 9XIMA 2E5BA 3LGGA 2GJNA 5T9BG 4DBDA 1KV5A 1KRBC 1UBSA 3UG4A 2E9MA 3HPFA 3JVAA 4AD0A 5JXQA 1PXGA 2HS8A 5E6YA 4QX4A 4NJJA 1WDPA 3RLHA 4IH3A 4KCUA 1WAUA 3LCLA 3QC0A 2Z29A 4FOUA 3DC8A 2YGYA 3GU1A 1MXDA 2G8ZA 3UYIA 2F38A 4XBJA 1TUFA 3L67A 1CLVA 4DUOA 1JPHA 3OQ8A 2V30A 4C7FA 3GX9A 5BRQA 2VR5A 1F8IA 1LM1A 3LA4A 3TC3A 2GDUA 2WZMA 2WJEA 5A1AA 3KHDA 4A2RA 3K1DA 4X60A 5I3IA 3ABRA 4GUFA 3KTSA 1XLAA 4DJDD 3QY8A 4KEVA 5LNVA 1KTNA 1OFOA 4JZ5A 4KWOA 1XBZA 1DXIA 4LVDA 3S2MA 3W87A 4NZCA 4GH3A 3CQKA 3ZR6A 1THFD 1HFBA 3GYCA 3IVUA 1L2UA 4RZBA 4ES4A 4DAIA 1CGWA 2IQTA 3GK0A 4PH6A 1JNDA 5LIYX 4BEUA 5TBOA 4NQ1A 2X30A 3N2XA 2HNEA 1SFJA 2PTZA 4NJIA 4QE4A 1FUYA 2FZDA 4ADTA 8XIAA 3TW9A 4ADSA 2G4FA 2WPBA 1CDGA 4V15A 1A0EA 3FW6A 3LRLA 2ZIDA 5TAOA 1IV8A 4ZTYA 1PO9A 4MIMA 2DVXA 3W7GA 5BMXA 4GCAA 1O5KA 4DBEA 2X0SA 4ERGA 3EEZA 2OR2A 2Z2UA 4GGHA 3RMJA 2EPNA 1WO2A 1CGVA 1LLZA 1QASA 5H6HA 2FB2A 1RPXA 1RD5A 2SFPA 4JHMA 4Z1BA 4GI8A 1OYBA 2ZZ2A 3VCRA 2X8RA 3ARRA 3GXMA 1ZAIA 4U5IA 3WNMA 1B31A 5A5WA 5HAOA 1AJ2A 3H53A 4PUDA 2CLEA 1E43A 3VGEA 1FWAC 1I75A 3FK4A 3SBFA 4O1FA 1EL3A 3FAXA 3W86A 3GC5A 1QPRA 2WQDA 3UZXA 3LLXA 4YL2A 3LCHA 4MG4A 3AU2A 3W1QA 3HOJA 3G24A 3HJEA 5LGXA 1H5YA 4GX9A 4MWAE 4WY0B 5LA0A 3R0KA 3GHSA