1D3HA

Human dihydroorotate dehydrogenase complexed with antiproliferative agent a771726
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
367
structure length
364
Chain Sequence
b'MATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE
publication title Structures of human dihydroorotate dehydrogenase in complex with antiproliferative agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 136
structure length 364
sequence length 367
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 1999-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1d3hA00
1XUZA 3DKLA 2W0UA 2X30A 1LBMA 2DJLA 3N9SA 1YDNA 2O7QA 1LP6A 3GZ3A 4ZMGA 3W86A 3C2RA 3PG9A 4C1KA 4O13A 5AHNA 2E6DA 4A22A 1OYBA 3V75A 4GUHA 4LC8A 3EWXA 4Y90A 1EP1A 2CLLA 5FEZA 3HF3A 1TQXA 5HWJA 3HG4A 1IIGA 5AYZA 1TTPA 4O54A 3EWUA 3P67A 7TIMA 3NYZA 2CFFA 2ZZ2A 3W7HA 2H8ZA 2ZRYA 1YADA 3NQEA 2EF9A 4FXRA 4IXHA 2NUWA 1B4EA 1FCBA 5I3IA 4O50A 2QJIA 4BWLC 4JIPA 4BF9A 3G3DA 3U6WA 3L0GA 4BI7A 3MHGA 5K9DA 4DF0A 2HS6A 3LI0A 2ZZ7A 3H55A 2XN0A 4NUWA 1F6PA 6TIMA 2VOMA 4BWLA 2YGYA 2WKJA 4XTIA 1G4EA 3OIXA 3DI1A 4CLMA 3W76A 2G95A 3LCFA 3P61A 4FIQA 4LUIA 5KMYA 1PHQA 2TPSA 1O60A 3A24A 3LHZA 1LOQA 3QM3A 2GPTA 3H54A 3LLDA 4GUFA 3W1PA 4LV9A 1Q3NA 4Z1CA 5C5YA 2ATSA 2V0TA 1GVSA 3C61A 3TH6A 2C3ZA 1VCFA 1O94A 4JTFA 3BG9A 3QRHA 1HO1A 2F7FA 1AMKA 1K3UA 5AHEA 3L0NA 1R30A 3HGJA 2YW4A 3OG3A 3BPWA 4J9JA 3W7GA 2PRLA 3E96A 4MYAA 1C29A 4QM1A 1O4UA 3TAKA 5F2MA 5U7SA 1J2WA 3IGSA 1GVQA 4JICA 2DJXA 3K30A 3H53A 1ZALA 1LDCA 4LS0A 1ONRA 2TRSA 3HB9A 4G1KA 1W0MA 3UYCA 4KFNA 1LBLA 1XKYA 2J24A 3USBA 3NL2A 1OX4B 1M7OA 5J5RA 2A5HA 3B8DA 4HNNA 1YXCA 4IMGA 1Q45A 4JX4A 1PHWA 2P10A 2C19A 1IXNA 4JTEA 4FXSA 1SW3A 1KM2A 1WBHA 4QNEA 3SZ8A 1X8FA 4O0ZA 2EAWA 3EWZA 4JR5A 3PVFA 4NXSA 4RXFA 3UD6A 3T55A 3T40A 1W31A 1TMHA 3NGJA 4IJBA 3QEZA 3O05A 5CKSA 3IIVA 3DFSA 1GVRA 1ML1A 2NV1A 3QMSA 3W7QA 4PODA 3IIOA 2FJKA 3GDRA 3I6RA 3GX9A 2VEKA 3QW3A 1JUKA 1TPC1 3W3OA 3M16A 1B57A 3QF0A 3LV6A 4N4QA 3GYEA 3Q94A 1X6UA 2FDSA 2FPVA 1UUOA 4M6PA 1JCMP 2V8ZA 3UY8A 2A6NA 4WJEA 4IMDA 1EWDA 2QCFA 4DQWA 1FCUA 1T0OA 4MIMA 1JCNA 2ZRXA 2ZZ1A 3W70A 3KFTA 4UC5A 1SW0A 2NXIA 2JGYA 2PE4A 1XDLA 5DBUA 4CQ9A 2ZZ3A 3LTSA 5DCDA 2R94A 2WNNA 1I45A 4M5PA 1TSIA 3ZR4A 3EEGA 3S5NA 4ZQOA 2FIQA 3F4NA 3DFTA 1VJIA 3HGRA 1LRQA 1P1XA 3CIXA 2KZHA 3UPBA 2G5WA 5EYWA 2QAPA 3MP4A 1JRBA 1GG1A 1SO6A 1U5JA 3O15A 1L9WA 3R5EA 3RU6A 2V5LA 4EF9A 3O6YX 4DF1A 3DENA 1QFEA 1H1ZA 5DBTA 2AAMA 4OV4A 1BEUA 2E5DA 1FWRA 3EX4A 3UWVA 1XI3A 3W7PA 3LRKA 3CEUA 3KX6A 3W1NA 4DO6A 1FDJA 1LRTA 3C4UA 1WA3A 3LHTA 1HFBA 3ATZA 4CQ8A 1FCQA 5AHMA 3NQDA 3DBPA 6ALDA 3KAOA 4N02A 2A85A 5HINA 2BTMA 4O17A 3B0PA 1EP2A 1TPVA 4BK9A 1EUAA 2FB3A 2NX1A 4IX2A 1D3GA 3SR7A 1YLVA 4NNAA 2VC6A 1LLWA 3NQFA 2RHGA 5FF7A 1RZMA 3ZWSA 3ABQA 2C18A 5G5IA 1DJNA 1VCVA 3IRDA 3MMTA 3GAYA 1EA0A 1JQXA 5D02A 3W1UA 2DU2A 3FS2A 3NM3A 3YPIA 3PM6A 3W9ZA 2E5BA 1LM1A 3NPUA 1F6KA 1OFEA 1FWNA 3O07A 5DXXA 1RVGA 1QCWA 3M5YA 1KM6A 1EIXA 1RR2A 3TQVA 1G4SA 4CCEA 4OBTA 1ZENA 4QQ3A 1K7XA 2GQ8A 5C2XA 4MVAA 2QF7A 4PL2A 4UTWC 4JYDA 1OHLA 4Z0JA 1C9DA 2WO5A 4AWSA 4JXCA 3W7JA 4Y8FA 4WXZA 1OFDA 3WJSA 3C2OA 5BW6A 3W74A 3C2EA 3B05A 3MI3A 2Z6JA 5G2WA 2ISSA 2FQIA 3LXBA 4PC8A 1FBAA 3DXIA 5LKYA 4FHAA 2ZZ6A 4JTUA 3BO9A 3CLMA 3TSBA 4WUIA 3P7YA 4PTNA 3S1UA 3G1SA 3JS3A 2XN1A 2A1YA 3L66A 2ZBTA 1A53A 3A5FA 3PB2A 3W2LA 2Y61A 2CLKA 4O57A 4XKYA 3VNDA 1F74A 1GEQA 5K3VA 1TPH1 5TQLA 3NL5A 1WBJA 3LB0A 1I2QA 1CI1A 3NPXA 1F05A 3I65A 5G2HA 1FQ0A 4UMAA 4Z1BA 4EIVA 2G96A 4RX0A 3TDFA 1HTIA 3N2MA 4UTKA 1BWLA 4R53A 3LLFA 5A8GA 4AF0A 3HGSA 4L4MA 4GNJA 3A21A 3OA3A 1PS9A 4AF0B 2F84A 1QR7A 3VFLA 1YDVA 3RLVA 4NJIA 2J9ZA 3NQAA 4FNQA 1T96A 3CM4A 4OE7A 3QQ0A 3STCA 1KFEA 3LXCA 4JTGA 5D05A 3W7DA 3NZ1A 3S9YA 4AWUA 1RPXA 1SSDA 1TPWA 1OYAA 2QCDB 3UXDA 1TYGA 3P74A 3W7EA 4POCA 3P81A 3GDKA 3GDMA 5AOUA 3SSJA 1GZGA 1W3NA 1XBZA 1DV7A 3I7SA 3UZJA 1OFRA 4ZQCA 5K4XA 3FYOA 1K8ZA 3OHIA 1SSGA 2ATMA 3TNOA 2Q8ZA 1KTBA 3WJZA 5F4XA 2ALDA 3L0KA 2J88A 3MYOA 1I8JA 1PL9A 1RQEA 3U2OA 3O06A 2OJPA 1AL7A 1KBIA 1UJPA 1H7NA 1TJRA 3G1AA 1TPDA 3I7QA 3EWYA 1R47A 3KRSA 4IUOA 3PBWA 1VGAA 3NQVA 3TIMA 4JY8A 3LCLA 5D03A 4K36A 4RV8A 3S6DA 4X22A 1V7YA 2QKFA 4I9AA 3W2UA 4CNPA 1VR6A 3Q58A 3TU9A 1HL2A 3C52A 4JTTA 1S5WA 3MBFA 4AB4A 1YXDA 3G1HA 4FEZA 1NAL1 2QUUA 3UZ5A 5EA9A 4Q32A 5AN7A 4FNUA 1TPB1 1KFBA 1A5CA 1E51A 1JQVA 5MHBA 3LBMA 1LLZA 1JCYA 3O1NA 4JYEA 2B7PA 5DY2A 5HR6A 2YFOA 1ME8A 3UWWA 3CHVA 1MXSA 2NUYA 3WK1A 1W1ZA 5EMUA 1QMLA 1L6SA 3L65A 4MPQA 4ADSA 4K39A 2H8XA 4HNVA 4E0CA 4MJZA 3CB8A 3QMRA 1TO3A 3MWAA 4R34A 3GLCA 4HSNA 4XBKA 1ALDA 4IQLA 4QSHA 4HHPA 2YFNA 4O4WA 2X1SA 3C0JA 3QPYA 2CZ5A 1OJXA 4JTJA 3DFPA 3PY2A 3LCHA 4UTTC 5K9CA 3Q2DA 3ABOA 3QQ1A 3C6CA 3LXAA 4O52A 3TMLA 1WXJA 3DHDA 3LTPA 1H7PA 2GJNA 4UCGA 4UTTA 4WY0A 3QC3A 3LOTA 2CWNA 5GVJA 2WNQA 1TTJA 4O18A 4YXGA 1PIIA 3GKFA 1QOQA 1GWJA 3G1FA 4YL2A 2FPYA 2GJLA 3PULA 4JN6A 5EL1A 3S0CA 5KTLA 1P4CA 1IXOA 5FI8A 2DP3A 1LORA 3LBCA 2X1RA 4JS3A 4DXVA 3QYQA 3A9IA 1IXQA 4UTHA 3L9CA 2HS8A 4TMCA 3QPZA 1Z41A 2EPHA 3SJ3A 1T99A 4N6EA 3TFCA 4UUIA 1CX9A 3LDVA 3BVJA 2GVJA 2QDHA 4IMFA 3PSWA 5FF4A 5I3KA 3BW3A 3UWYA 2AGKA 5CPMA 1DORA 3C2VA 5AYXA 3W1AA 2VXNA 5U4NA 4Z1DA 5D37A 4AH7A 3F03K 4M19A 3TSDA 3IGXA 3JRKA 1OF6A 1WQ5A 5FEPA 4UNKA 5HMSA 1TB3A 3HG2A 3NZRA 2TYSA 1XCFA 4JX5A 1TTQA 3EX6A 3SI9A 4JTHA 1TPUA 1VH7A 2ISWA 2WNZA 3SFKA 1KFLA 4WOZA 1QAPA 2BXVA 1QPOA 2YDAA 4IWWA 4U4MA 4LS2A 2J9YA 3OVPA 5CSRA 5HUPA 5TIMA 4JDYA 1TREA 4O0KA 3HGOA 5EKYA 4RKAA 3GNNA 1MSSA 3W7CA 1R2TA 3HPXA 4GE8A 3W7IA 2FFCA 1XDMA 2FPTA 3GXNA 1V5XA 4UFMA 4CCDA 1VCGA 1QWGA 2CZFA 4NQ1A 1N7KA 3HPSA 2EHHA 1OX5A 4FO4A 2VEMA 2J9XA 5D04C 3OVRA 1B4KA 4HPJA 1HG3A 3W2KA 3NA8A 4DBEA 5K9XA 1IIHA 5C6MA 4UTMA 1NEYA 3ANYA 3EKZA 4UNLA 2Y62A 3W7LA 3B4UA 2QAFA 3LERA 2Z2UA 4LY8A 3EWWA 4MOZA 1IGSA 2BLEA 5H2ZA 3LCIA 4KKXA 1R46A 4ORIA 2D73A 1OX4A 1SO3A 4AWTA 1O5KA 2G97A 1OFBA 4NZJA 3IVSA 2ZZ5A 1FWWA 5K4ZA 1ZJIA 1VZWA 2QJHA 1RV8A 3KVLA 2ZFAA 1F76A 3MP5A 4A2RA 2Y88A 2Y7DA 4N9BA 3LHVA 3VCRA 5LGZA 1OG0A 5CZTA 2PRHA 5FF3A 3LRLA 1EB3A 4NJGA 1H7OA 2RDTA 2B4GA 4YWIA 4OU1A 1ICPA 3DFNA 2V9DA 2CLIA 1VLIA 1Y0EA 1B9BA 3RF9A 1L6YA 3M5XA 2B7QA 3C2FA 3WJWA 1I2RA 1SUXA 3MHUA 3FEMA 3W73A 1GQNA 4QISA 3ZFHA 1N55A 1EPXA 3W1QA 1DVJA 1RQHA 3LHUA 5KSWA 3M43A 2YW3A 2NLIA 4B5NA 3EX3A 1B3OA 2BWGA 4ZVJA 3PBUA 5AHIA 2ZDRA 3PR2A 1QPNA 3TK7A 3NQ8A 3MO7A 1YPFA 3SECA 3G18A 1X1OA 2R91A 4K37A 1DHPA 4PEKA 3R89A 3LV5A 4S2CA 2RH9A 4JX6A 3SGUA 2Z0IA 2CLHA 4UTLA 2ZA3A 4O16A 2QCLA 4AHPA 1OF8A 3SGZA 4MJMA 3NPVA 1DBTA 1FDYA 3TSMA 4FF7A 4PFMA 1SO5A 2ZA2A 5BMWA 2HMCA 1NF0A 1Z44A 1D9EA 4RXGA 1S3HA 2JKEA 2I14A 1H7WA 2NV2A 2A6LA 3U8GA 3A5VA 1KM5A 4N2YA 3E12A 2GQ9A 3WK3A 1NVMA 3HO8A 1QOPA 3P84A 3P8IA 3EX2A 3CU2A 2ZRUA 4MZ8A 2VFFA 3S1WA 5KINA 3M41A 4NXKA 5KZDA 4KFPA 3TJLA 3M47A 4E38A 1MZHA 4LS1A 4AEOA 2H3DA 1JCJA 5E93A 4O1BA 4K8EA 4RLIA 2GOUA 3W2JA 1T8XA 3LHYA 2NX9A 3AO0A 2YR1A 2QCMA 1SZFA 2QUVA 1FXPA 3M7WA 4M6VA 2EGZA 3UWQA 3IIPA 1XBXA 5DCEA 4CCCA 2IQTA 3W75A 3RLUA 3ABRA 2VFHA 4NT0A 4BFAA 5E0KA 4HNUA 1XBVA 1DQXA 2ZYFA 3THAA 4WY0F 5I3GA 4LOCA 4AHQA 1UBSA 4FX6M 4O10A 3GNDA 4H3DA 4DELA 1VLWA 3M44A 1EUNA 3QSTA 4LVDA 4R7JA 4DPPA 3N14A 3G1VA 4IPIA 1JUEA 1P0KA 4PA8A 3N3MA 4X3ZA 1FCVA 4IMCA 5K2ZA 4UMBA 3SIZA 4I7WA 4A21A 4EF8A 3EXTA 1OFOA 4UTUA 2C0AA 3DKJA 3UY7A 4ALDA 4XTDA 1OFPA 2I9EA 5D2YA 4QNWA 1A5BA 5D30A 1PCWA 2CW6A 4FNSA 2DZPA 4UR7A 2HTMA 4YLWA 3TE9A 1W54A 2PRMA 3LRMA 3IEBA 4E2DA 1TRDA 4LRTA 4LNYA 2OT0A 5AC8A 2NZLA 3NL6A 2V30A 1GTHA 4KFOA 3FJLA 4X9SA 3W7NA 3NQ6A 3WK0A 4JYFA 4N4PA 3BG5A 3FJ6A 2YSWA 4UTWA 4O1DA 3CT7A 5F4WA 3F1QA 1TV8A 4ML9A 2ABBA 4QITA 2NXGA 3HQ1A 4GUGA 3O16A 4MKNA 3O63A 1LRNA 1UB3A 3W7MA 2VFEA 5DCBA 1KV8A 3PBVA 1SW7A 4DO4A 1ZAIA 4MYXA 4GFSA 1TPFA 3W72A 4JD4A 4PCFA 4OQVA 1WAUA 5HULA 3DFOA 4NX5A 2Y89A 2YZRA 2PURA 2E77A 3M0ZA 5CZSA 3T7VA 4BI6A 3GVGA 1LTDA 2W6RA 3BW4A 4UFJA 4FNTA 5HWNA 3PS7A 1XL9A 3T78A 4TO8A 1KTCA 1SU5A 5LNUA 3P82A 2Y85A 3TROA 3P60A 1VHCA 1W5MA 3GB6A 3PSVA 3R12A 2FTPA 4NJHA 4K8HA 4UR8A 1QO5A 5D2WA 1BTMA 3W83A 4M7TA 5KITA 3NL3A 3TXVA 3B0UX 2WJZA 3THQA 2AQWA 3C8FA 3UWZA 3MW7A 5F2GA 1OK6A 2OX1A 2WSYA 2ZA1A 5DY3A 3FIGA 1ZAJA 2H90A 1OABA 1GG0A 4LWWA 4XQ6A 2VFDA 3HIJA 3C56A 3QJAA 3ATYA 5L9FA 1AW5A 1GT8A 2DZXA 2QCDA 4K38A 4NJKA 4TR9A 1K8XA 1JVNA 2V82A 1MEWA 1KFJA 2FLIA 2VEIA 3N73A 3TA6A 4GUIA 2BX7A 1EP3A 3O6CA 1H63A 3CTLA 1YTDA 2OCZA 1ME9A 1G4PA 5D32A 3VKJA 1YPIA 4LW7A 3W1XA 3TX9A 4FNPA 5F1VA 3PF3A 1F2JA 1OVDA 4MFDA 1KLYA 1QNVA 1BWKA 4TU1A 4AHOA 4NNBA 3V1PA 4OWGA 3L5LA 3PUEA 2B7OA 4CNOA 1VPXA 2Y7GA 2RDUA 3HG5A 1C8VA 5ABTA 1R2SA 5FEXA 4HSOA 3B06A 2C15A 2DZSA 1SPQA 3IV3A 2A7NA 2P1FA 4E2BA 3AJXA 1I2PA 4XBSA 1JJKA 2DORA 2O7SA 4IXXA 1Z42A 1G4TA 2Y7EA 5FESA 4ADTA 1W8SA 3IIXA 2WSQA 4N9CA 5LNSA 5D09A 1WOAA 2NWRA 3UQNA 3BLFA 5CZJA 1TIMA 3QFEA 5C54A 3W7OA 4NU7A 1WX0A 4MY1A 1IF2A 4LU0A 4IMEA 4S2BA 3A23A 4P61A 4AAJA 1W37A 4MUZA 1OYCA 3INPA 4H6KA 4O12A 3DFQA 1SFLA 3FLUA 3S1VA 2PC4A 3L5MA 3MJYA 2ZRZA 1R2RA 1H51A 4AMAA 4L4LA 4N6FA 3MP3A 5CGQA 3PB0A 1WYIA 2UV8G 4BR1A 3OEXA 3G0XA 4LRSA 4JY9A 4WD0A 3KVJA 4HN4A 1GYNA 1H50A 1FUYA 4XZ9A 1A50A 2CZDA 4OHQA 4RZ4A 3LTYA 3L21A 5IM51 3HMJG 4GRSA 3P62A 4MZYA 4OGZA 3R8RA 2J27A 2E6FA 3W84A 2A7RA 2NUXA 4QAIA 4DPQA 4A2SA 1F7BA 3NNTA 5AC6A 3KOFA 3NQ2A 5TBOA 1GPWA 2A4AA 3NR0A 4FNRA 3LI1A 3TC7A 5AFDA 1W5PA 4DF2A 3LCWA 4I7UA 2C14A 3GR7A 1GJPA 1HUVA 1L6WA 1K7EA 2C6QA 2E09A 4IGHA 5T26A 3PUDA 3UPWA 4FX7A 3HPZA 1M7PA 1GVOA 2CLFA 1FXQA 2JKPA 2TSYA 3I68A 1QO2A 3E49A 4JTSA 4MLRA 1ZCOA 3BLIA 4XWUA 1I2NA 2YYTA 5EY5A 1AW1A 4O53A 1KFCA 4ICNA 3BK0A 4CNNA 5CPNA 4ZQRA 3RNDA 2Y70A 2QCEA 3BG3A 2QR6A 2ZTKA 3DI0A 4MZ1A 3W1TA 1W3TA 2E6YA 4TIMA 1KFKA 5FEWA 1KBJA 4KWVA 5D38A 3QMTA 2ZZ4A 4QJ1A 1ZHAA 1JRCA 1G67A 1TJPA 2V2CA 3MBDA 3LM7A 4RCXA 3QSRA 2E6AA 3VE9A 4FX8A 5F4SA 4N9EA 4GC4A 2V2DA 4RR4A 3S5OA 1FWSA 3PUOA 4GBUA 4DEFA 4Y9AA 3STGA 4YCPA 1AW2A 3N34A 5CZ0A 3MI6A 3GR8A 3BARA 1G7UA 3SY5A 3WJYA 4OV9A 1PCKA 3CC1A 3W07A 4ADUA 5I3JA 2RDWA 3FYPA 3QZEA 2V81A 2C1HA 1ZAHA 3DH7A 3D0CA 3W6YA 1TCDA 3IVUA 2Y6ZA 3MYPA 4M6QA 4KWWA 3DAQA 1NF7A 3NM1A 1EWEA 2WPBA 2EKCA 2QCCA 5SWUA 3FA5A 1TV5A 1THFD 3TKFA 1OX6A 2VEPA 1JCLA 2RKXA 4H4IA 1QDSA 5D33A 3BV4A 2E5CA 1HO4A 1S5TA 4HNTA 3G1DA 1LOLA 3IIZA 1ME7A 3G0UA 3KXQA 3NQGA 4A3UA 4EVZA 1Q6RA 3UNDA 2CLMA 3JR2A 3QH2A 5F2IA 1QPQA 4D2JA 4IPJA 5CPLA 3TQ0A 2Q8LA 4GJ1A 4JTIA 1YDOA 1OFQA 5EPDA 2X1TA 1OFAA 3W7RA 5F2LA 5D2XA 3O6DA 4K6AA 3GIYA 3ELFA 2W79A 1Q6LA 1TTIA 3A22A 4NZFA 3M6YA 3LCXA 1W5OA 2Y7FA 3F4WA 5D2VA 4NVTA 2OMAA 2ISVA 3E9AA 2XN2A 4CQAA 3VI2A 3PAJA 4Y96A 1AK5A 1D3HA 3LHWA 5C55A 1J5TA 5LHFA 4ZL1A 1UUMA 2X2GA 2WV8A 2NXHA 2A0NA 3M5ZA 2FB2A 3KVKA 4Q33A 1KV5A 1TPEA 4PH6A 1VHNA 3IGUA 3DGRA 4C1LA 1H5YA 1W3IA 1I2OA 1KM0A 3NG3A 4LVAA 5F1UA 1H1YA 4WOQA 3G0SA 1H7XA 3KRZA 4WZHA 3UWUA 1NSJA 2NWSA 5IBXC 2DZWA 4O1AA 1ZFJA 3G8RA 3VE7A 4UIOA 4GXMA 1M6JA 4YMZA 1EEPA 1XFBA 1G7VA 5IBXA 1MEHA 2OZ0A 2WSRA 2YPIA 4NNCA 3ZWTA 5LHEA 5DELA 1JCXA 1ZNNA 1LYXA 2QUTA 3E02A 3DZ1A 3FKKA 1EX5A 2CLOA 1RD5A 3FFSA 5G4EA 1XBYA 1AG1O 3M5VA 5D2TA 4OT7A 2P0OA 1UASA 2H6RA 1XXXA 2A2IA 3CEPA 4O19A 4DBDA 3STFA 3RMJA 4ZZ9A 1MO0A 5BOOA 4LT9A 3EX1A 1VS1A 1N8FA 1GYLA 4HPXA 3C3NA 3GKAA 3GAKA 2ZTJA 5LNWA 5HR7A 4MLJA 4WX2A 1WOBA 4IX0A 2VFGA 1H7RA 3TXZA 4RZ5A 3TAOA 1YYAA 3OBKA 3PC0A 5LNVA 4LUJA 1G69A 3S1XA 4LVBA 1Q6QA 3LX9A 3GK0A 4A29A 3P5YA 3Q37A 3S42A 4NJJA 3NDOA 5CG7A 5K7JA 3M9YA 2R8WA 3NPWA 4UMCA 5I3FA 1H60A 1A5SA 2BSLA 4FB7A 2GUUA 2NX3A 3L67A 2E1DA 4UFIA 1P5BA 1K02A 2DZVA 2LLEA 1KTNA 2X16A 3NAVA 5DXYA 3MHFA 4Q4KA 3W2MA 4I7VA 1P0NA 5HWMA 3TCEA 5FF0A 4M7SA 4MY9A 1SR9A 4FIRA 1LOSA 3EXSA 3PBYA 4O8RA 3MUXA 4MY8A 3G22A 2YYUA 4W9TA 4O15A 4JNMA 3WJXA 1K8YA 3BW2A 2Z6IA 3HG3A 4JTLA 5G4WA 5LNRA 1ICSA 3G24A 1TV7A 1O95A 5AHLA 3TV8A 1DQWA 1OK4A 3DU0A 4Z1AA 4JEQA 3ZS4A 3P8JA 1GVFA 5HNRA 1LBFA 4X2RA 5HUOA 2QDGA 3P80A 4R33A 4LV4A 3PG8A 3OVQA 2ZRVA 2VENA 5KZEA 4HT3A 2ZQ0A 3W71A 1DJQA 2OT1A 2JBMA 3CQ0A 5LZLA 1DOSA 2E68A 1L2UA 3EB2A 3NEVA 4S1FA 1ZY9A 3HJZA 1W5NA 2YX0A 5DLCA 3G3MA 1A5AA 2A7PA 3FOKA 1YXYA 1XM3A 4BI5A 2WOQA 1M5WA 2JKAA 2J6XA 2QJGA 3KHJA 3NOEA 2VELA 1RQBA 3G1YA 3B04A 3STEA 4LTSA 1YTEA 1SO4A 3BGJA 4Z0SA 2GVLA 4ONVA 3W1LA 5L6UA 3TUUA 1NFBA 2QCHA 2A21A 4UXDA 5HJLA 2CZEA 5I3HA 3L68A 1ADOA 1SFJA 3CPRA 3RFAA 3B0VC 2BZNA 4UFLA 3W23A 4UTIA 3ABSA 4XKYB 2ABAA 3O8AA 5AYYA 3CIWA 2I1OA 4UTJA 3S8HA 2V2HA 3EXRA 3R2GA 3BLEA 5G2IA 1AL8A 5G1TA 3G8EA 1PVNA 4AVFA 4O11A 3N9RA 3MI2A 2XFWA 3B03A 1SZEA 1TQJA 1VYRA 1LROA 2Q3RA 3HOJA 1GOXA 3DHFA 3IVTA 4K7VA 4LC6A 4JIQA 3NXFA 3S5ZA 5AB3A 1FWTA 1Q6OA 3TMQA 2GQAA 4ZQPA 4K7YA 4O4VA 1U83A 3TW6A 1DL3A 1LCOA 3QW4B 2B7NA 1FDZA 1IXPA 3R13A 3TC6A 1UCWA 4HIBA 1VYPX 4UFKA 2Y63A 3BGGA 4LVFA 5E1QA 4O14A 3EKLA 3NQ7A 4Z08A 2DZTA 5BRBA 1FX6A 1MEIA 3CWOX 4ZQMA 1S5VA 1XC4A 8TIMA 1JUBA 4HKPA 1YTKA 2R14A 4RK8A 3T4CA 2ZRWA 2Q3OA 3CWNA 3GXTA 3EWBX 3W2NA 4LVGA 4AXKA 3UXAA 5J5DA 4GWEA 1W56A 3LGEA 4EWND 2TMDA 5FF2A 5HQEA 5BNKA 1H61A 4EOUA 4TMBA 1J4EA 1VC4A 3L2IA 5A5WA 3SW6A 3GXPA 4N9DA 1XUUA 4RJEA 4TX9A 1QPRA 5DN1A 2VFIA 3P5ZA 3HBLA 2VKZG 2X1UA 2C16A 4U28A 3PWAA 5CSSA 3TJXA 2H3BA 3N2XA 3FKRA 3S5YA 2PCQA 1PE1A 2JGQA 4YCOA 5AC7A 2YXGA 1VYSX 1CW2A 2QCNA 1X1ZA 4O28A 5AHFA 1H62A 1SQ7A 3NQMA 3W7KA 3I7RA 1KW1A 1JULA 4WXYA 1KA9F 2GVGA 4GUJA 1F5ZA 4P2VA 3W87A 2RFGA 3E0IA 3RK8A 4ORMA 1KM1A 5H91A 3G1XA 4RZ6A 4ZQNA 3KRUA 1TRIA 1I4NA 3KVMA 4Y6GA 2B0MA 3TFXA 3N19B 5CPOA 1F73A 5LSMA 2QCGA 3NQCA 1LZOA 3W1MA 3W22A 3WK2A 4O1CA 4DO5A 1G6CA 1K03A 1K7FA 4UFHA 1KM3A 1O5XA 1SZGA 1X7FA 2Z1BA 3GDLA 2CU0A 4IOTA 4JTKA 5G1YA 1BKSA 3W85A 3M1ZA 3NO5A 4JDBA 3WFAA 3TW7A 1GTEA 2HSAA 2ZCGA 4XUGA 1VQTA 1W5QA 5KZMA 4QIUA 5EBUA 4MFEA 1ICQA 1KLZA 4JGDA 3TQKA 1VRDA 2C13A 3W88A 1WDWA 4NX0A 4PL1A 5LGXA 3L5AA 3LCGA 2YCEA 1SZNA 4WY0B 1FY6A 2QEZA 2DZUA 2JK2A 1KM4A 3T44A 1DKWA 1Z48A 3TR2A 2CLEA 3NVTA 3W1RA 1WV2A 3GDTA 1PV8A 5BMXA 2V5BA 4WQ6A 2WQPA 1JR1A
chains in the Genus database with same CATH superfamily
4CNUA 1ISYA 1YDNA 1LP6A 3GZ3A 4ZMGA 1GPFA 3P93A 1CLVA 4C6CA 4O13A 1R0MA 4A22A 3CT2A 3V75A 2VUNA 3ZJ7A 5A3HA 3EPOA 3KOXA 2FMOA 3HF3A 5C9RA 1TQXA 1TR9A 2W61A 1IIGA 2Y4SA 3HG4A 2OYMA 1JZ5A 3AIWA 3W7HA 2Z1WA 3GG0A 5JQ9A 3T07A 3NQEA 4IXHA 2QJIA 3AHZA 4N7QA 4BWLC 3G3DA 3WNPA 3MHGA 1XCXA 5A8MA 2GOKA 3CASA 4DF0A 3H55A 3EOEA 4AIOA 1F6PA 3DIPA 2PLCA 3LG3A 1WUFA 1UROA 3TYZA 4HBKA 1E0VA 1V8EA 1JG9A 3LCFA 3P61A 3EDJA 3CAQA 4LNCA 1OBAA 5A8OA 3TEVA 3H54A 5AYIA 3W1PA 4R7OA 3P6LA 3VDAA 4WDWA 1F3WA 4JAWA 3T05A 3C61A 1UWTA 1VCFA 3BG9A 1PYFA 5CEWA 1R30A 3WEOA 4YYFA 4IH3A 1NARA 3BPWA 5HANA 4MAZA 2PRLA 1U1HA 2CIPA 1RUSA 2Q01A 1UWUA 5F2MA 3VD9A 1GVQA 4GH3A 1HKWA 3U3HA 4EPDC 2D0FA 2UBPC 1YNQA 3OQEA 4JQ1A 1OIFA 1W0MA 1XIIA 3RYSA 2QZRA 2OKTA 3UYCA 4EAYA 4KFNA 1XKYA 2PWVA 1R87A 1XP3A 1PO9A 3B8DA 3H2AA 1YXCA 1MDRA 4AEEA 1JFHA 1AQMA 1XISA 4PB5A 4EXQA 2QDDA 4QDWA 4FXSA 1WBHA 3VD3A 3AAMA 1AUSL 3UD6A 3T55A 2HDJA 4HTBA 1XYAA 1W31A 5E6YA 4PE8A 3NGJA 1J93A 3QEZA 4ZEPA 3ENLA 3DFSA 1GVRA 2NV1A 3IIOA 2FJKA 3I6RA 2FMNA 2DQWA 1JUKA 3NEHA 3M16A 1B57A 1PSCA 4PCNA 2D23A 4TVUA 5LA2A 3WX7A 3GYEA 3VIPA 1X6UA 4M6PA 1JCMP 3UY8A 4N42A 4Q8NA 4E3VA 4LAKA 1FCUA 2OGJA 3RU8X 1JCNA 1KBBA 3QQWA 2OG9A 3W70A 3O2LA 1UA7A 3E1F1 2R94A 2WNNA 4M5PA 2DIEA 2QIIA 4ZQOA 1JYVA 3A13A 5FJOA 1VJIA 4MB4A 3HGRA 1LRQA 4UWMA 4Z2LA 1M3UA 4DO7A 5EYWA 3ZZ1A 3MP4A 4AD2A 1GYMA 3AJ7A 5A6AA 3R25A 2WJEA 3B8VA 3R5EA 2EBNA 1RK6A 4DF1A 5JVLA 3K8LA 3SUTA 1N2VA 1HKVA 2OQHA 4NAFA 3POCA 1EDGA 1XI3A 4B2DD 4DO6A 3CEUA 3KX6A 3M6DA 2PDCA 1FDJA 1WA3A 4MUPA 3LHTA 1FCQA 5AHMA 3L4WA 3CQIA 4HYWA 3VKBA 4PSRA 3DUGA 4N02A 1J0JA 3MWCA 4FP1A 2ONEA 2HNHA 4O17A 1UR0A 2I9UA 3W24A 1EUAA 2FB3A 2NX1A 4EP8C 3SR7A 4HU8A 2XHYA 1YLVA 4LEFA 4NNAA 3ZJKA 3WLOA 3NQFA 5BXRA 4B5SA 3ZWSA 3ABQA 5G5IA 1DQUA 4JNZA 3RDKA 3WQVA 4GQGA 1EA0A 1VBUA 2PZNA 3W1UA 2VWTA 3FS2A 2GSEA 3PM6A 1DJWA 2WHKA 2E5BA 1LM1A 5BOFA 5DXXA 1M03A 2J7EA 1RVGA 4QLLA 2WHLA 3M5YA 3FA3A 5C71A 1HW6A 2DUXA 1G4SA 4CCEA 3N15A 1ZENA 1K7XA 5C2XA 4ACZA 3WDRA 4UTWC 4JYDA 3AIBA 3HN3A 2WO5A 5EMYA 4CN6A 5CJNA 1F9CA 3C2EA 3B05A 5G2WA 3PPCA 2FQIA 1GCYA 1F8IA 1FBAA 4LUTB 4MNJA 3CLMA 1PJ9A 3AWOA 2DUAA 3H2CA 2XN1A 3ALFA 2ZBTA 4C1NA 1OD0A 2DSWA 2Y61A 4XKYA 3A3WA 4M0XA 4LQ1A 1GEQA 3E0WA 1TPH1 3OLGA 5FSEC 4DUXA 3H4WA 1XLFA 2CESA 3QLDA 2GGEA 2VZSA 3QHNA 1Q8JA 4L4OA 3LM3A 1WBJA 1L0PA 3LB0A 2PDIA 4WKFA 4RDZA 4LPCA 4P7NA 5ABHA 4UMAA 3VOIA 4EIVA 4KCTA 1SYTA 2G96A 4RX0A 1MXDA 1OQFA 1BWLA 5T91A 3OZPA 1AH0A 3HGSA 3VUPA 4DIAA 1I1WA 1RP9A 1DXIA 3A21A 1PS9A 4U2ZA 1FWGC 3O0FA 3VFLA 2E0PA 4QJ4B 3RLVA 1QNRA 5A69A 1M65A 4JCLA 4A3HA 4LAMA 4FNQA 1US0A 4B5XA 5A2AA 3QQ0A 1PDYA 2BHYA 2OO0A 1UOKA 5D05A 2ZADA 3RX4A 3E0LA 3MUIA 3NZ1A 3S3GA 1SSDA 2QCDB 2G4JA 4HHHA 1EJVC 1TYGA 1J01A 1KR1A 3W7EA 3QFWA 3WN6A 3PTKA 3P81A 1E6QM 3GDKA 2HK0A 4AIUA 2J66A 4P5UA 2VVNA 3QV9A 4GGBA 3SSJA 1GZGA 1W3NA 1QT1A 2X0SA 4ZQCA 4XD3A 3FYOA 3F4DA 4GYJA 2IKGA 2WMGA 3WJZA 2DPEA 3L0KA 4MGGA 3UA4A 2HE8A 3MYOA 3U2OA 3O06A 1UJPA 1PWMA 1TJRA 3G1AA 1TFVA 4GPNA 3WQOA 2WBKA 3EWYA 1R47A 1RLDA 3PBWA 1BGGA 3TIMA 4DYJA 4NI8A 4WSHA 2AGTA 4K36A 2BGSA 3CZEA 1FWJC 4OIFA 3WNNA 4RV8A 1AQFA 4X22A 2QKFA 2YCJA 4AB4A 1NAL1 5AVHA 1KFBA 1E51A 4DJDA 3FDKA 3O1NA 5C2GA 5T8GA 2FKPA 5JBFA 4W89A 3H2MA 1KXVA 1UD5A 2YCKX 3UG4A 1W1ZA 1QMLA 3BH4A 1R7AA 1G94A 1EYWA 2IXUA 4NZ3A 3GLCA 2NQ9A 1EFZA 1ALDA 4QSHA 1FHUA 2YFNA 2OZ8A 2X1SA 5BU9A 3QPYA 2CZ5A 1OJXA 3PY2A 2WKLA 4WF7A 1FKXA 3ABOA 3QQ1A 2GFTA 1VBRA 3DHDA 2NQLA 1H7PA 3HQPA 4OJYA 4UCGA 1PX3A 3WUBA 1AJ2A 1P48A 1GOOA 4W7VA 2WNQA 2EJ1A 1PIIA 4XBJA 3N12A 2V5KA 3PULA 5EL1A 1UZ4A 3SUSA 4KQNA 4DXVA 2VCBA 3BCFA 4KETA 3QPZA 1Z41A 2XIJA 4D6IA 1KKRA 4JFTA 1CX9A 3LDVA 4DUWA 4IMFA 2RUSA 3PSWA 3DHUA 3CV7A 1XX1A 2AGKA 3QKEA 1JPMA 4H7VA 2Y8KA 3V5OA 3ARRA 2DGAA 4I3GA 4W85A 3HV8A 5FEPA 4UNKA 4YTSA 3DDMA 3QR3A 3T8LA 2ZDSA 4PMOA 1VBHA 3VDHA 2I17A 2ISWA 3SFKA 1R8LA 4Q4SA 1KFLA 1QAPA 2WNWA 4C91A 2BVTA 2IKIA 3EOUA 4AFYA 1SJCA 4H41A 2HPIA 3VMPA 1MSSA 3W7CA 4GE8A 3W7IA 2FFCA 2DQXA 1VCGA 3CL7A 4Y9PA 2CZFA 4NF7A 4GFIA 1PTDA 3HPSA 2NQ5A 2Z26A 2Q02A 5D04C 3AS1A 4AIEA 3UESA 4HPJA 4OZOA 1HG3A 1V02A 1XLLA 5C6MA 4UTMA 4L6HA 1POKA 2EQDA 3ANYA 1V0LA 2VX4A 5CG0A 3GG8A 5TD4A 2GJXB 3T42A 3GTNA 2Z2UA 3GU2A 4LY8A 1UR1A 2E28A 3T2PA 3PP7A 1AH4A 3B0YA 3WLPA 5H2ZA 2BOEX 3GE7A 1PX4A 4MADA 2ZZ5A 1HX0A 3R94A 1FWWA 1UZ1A 5E9AA 3W37A 2QJHA 1RV8A 3KVLA 4G5DA 1W3HA 4FF5A 1S1RA 3SCOA 4N9BA 2Y7DA 5LGZA 1EB3A 4I90A 3N25A 1B3XA 1R9ZA 1ICPA 2V9DA 2CLIA 4GI6A 3CUGA 2YCLA 1B9BA 3WEZA 1L6YA 1JZ4A 1KGWA 1SUXA 2EPOA 1GQNA 5GNXA 5C7VA 1BTCA 4IISA 1BD0A 1DVJA 3LHUA 2YW3A 2NLIA 3CYVA 4B5NA 1KO0A 4M29A 5AHIA 2FZNA 3PR2A 1TZ9A 4UQCA 1IWAA 3MO7A 2XIIA 1YPFA 1TG7A 4L1XA 3F2BA 4PMYA 5ABFB 1NWTA 2YA2A 1X1OA 2BOGX 4PEKA 1DHPA 2O55A 3AS3A 3LV5A 4S2CA 2VR5A 2RGLA 2D3NA 2ZA3A 4O16A 1OINA 2OGYA 2QCLA 3PBGA 4KF1A 1GHSA 4MJMA 1RHCA 3NPVA 3SAZA 4TVCA 1DBTA 3TONA 4PFMA 3PZQA 1D9EA 4B9ZA 1S3HA 1H7WA 2A6LA 1MW0A 4UOJA 1QOPA 3BQ5A 3EX2A 4D72A 1CYGA 4NKCA 3S1WA 3M41A 3TJLA 3M47A 4LS1A 4AZCB 4AEOA 1SVDA 1XRTA 2H3DA 1JCJA 1XWYA 5GJNA 3WLLA 2QMKA 2QCMA 1SZFA 2VQTA 1FXPA 4DYEA 2VURA 4CQDA 3QV8A 3SDOA 4QXIA 2YL6A 4I8DA 3RPMA 2W62A 4AU0A 3ABRA 2VFHA 4NT0A 2WM1A 2GVEA 4URIA 4HNUA 4WY0F 3VNZA 3WH5A 4DJEA 4PUWA 4AHQA 4FX6M 3GNDA 4LYQA 2IKJA 2R9RA 3M44A 4DPPA 4LVDA 1V7AA 2WZMA 3N14A 3WMLA 3EDEA 2NSOA 1QI0A 1P0KA 4IMCA 5K2ZA 5HK4A 1CXEA 4I7WA 4HGXA 4A3YA 2PZ0A 5DRIA 2X05A 4HSHA 4KWOA 3WBEA 1UWRA 4CNSA 1A5BA 2CW6A 4Y9OA 4FNSA 4UR7A 1W54A 3ZLFA 1BSLA 3IEBA 1TRDA 4LRTA 3S2NA 3WCZA 5AC8A 1HVQA 5I24A 3WK0A 4KRTA 4I9MA 4UTWA 3IJIA 3UP8A 2VCCA 2AMGA 3GUWA 1Q6EA 1D7FA 4A8IA 3O63A 1LRNA 5CAHA 3LZ5A 4ZFCA 1TV4A 4XAZA 5C0QA 3W72A 3A47A 5HULA 3DFOA 1VB9A 1PBGA 3HA1A 3M0ZA 1CGWA 3T7VA 3WQPA 4BI6A 4FK9A 1EHAA 1UJQA 2YLLA 4FLQA 4FNTA 4PCPA 1W9PA 3P82A 1YBQB 3P60A 1W5MA 3GB6A 3WF1A 1Q85A 1IT8A 1TA3A 4C6IA 3GVRA 4CD4A 1BTMA 4W4QA 1UKQA 2WVTA 1EH9A 1XW8A 2G3IA 3F4CA 4DY1A 3MW7A 3WQEA 1MRAA 5DY3A 1R38A 1BF2A 7REQB 4XQ6A 3HIJA 3C56A 3DHPA 3AU2A 1AW5A 3LUTA 2WCSA 5A8QA 1K8XA 2O9TA 2VHLA 3RX3A 2V82A 1H41A 1GKRA 5CBJA 1SR0A 2BX7A 1B9ZA 4FXFA 3O6CA 2DFAA 1H63A 4WR3A 4W87A 1G4PA 1BKHA 4LW7A 3PF3A 4MFDA 3EOOA 1KLYA 3OZMA 4TU1A 4OWGA 3L5LA 1VPXA 3N1AA 3HM7A 1GOQA 4B9YA 3HG5A 2D2OA 3CZJA 1QI4A 1XRVA 3B40A 1SPQA 1UKTA 1EC8A 3PZIA 2P1FA 4PCSA 3AJXA 4U3AA 2XFFA 2DORA 4ILSA 2HVMA 2O7SA 4IXXA 1G4TA 2Y7EA 1L8PA 2QHAA 1DWIM 2OSYA 2RGMA 4JKLA 1W8SA 4YS1A 3IIXA 2WSQA 5A6BA 4RE0A 2NWRA 1A47A 4QP0A 3BSHA 4MNLA 2HCVA 3WQ8A 1WX0A 1GZJA 1A0CA 1J10A 1O5QA 2XIBA 3A23A 1P7TA 3BJTA 3IAPA 3TLLA 3ZIZA 1UPPA 3PWIA 4C6OA 4ZB0A 1R2RA 1H51A 3CO4A 2V3DA 4L4LA 3GH4A 2XSXA 2UV8G 4XIAA 1FWIC 2FH6A 3BSMA 4WD0A 4MNKA 1GYNA 2CZDA 4S38A 1EL3A 3HMJG 4XIMA 3SUUA 1E5JA 2E6FA 2A7RA 2I5GA 2NUXA 1XF0A 2G37A 4A2SA 4CEXC 3NNTA 5AC6A 3KOFA 4S3KA 3UGRA 3BLLA 2VDHA 4S23A 1XIJA 3TC7A 4GY1A 3S9ZA 3LNPA 1L6WA 4MDOA 3UPWA 3VIMA 3GG7A 2JKPA 2TSYA 3LQGA 2HVOA 3E49A 4JTSA 4IIHA 4V28A 1XGDA 1KR0A 3DBNA 4XWUA 5DMMA 4S3DA 1KFCA 4ICNA 5TAOA 4BY3A 3RNDA 3ORWA 2WC7A 2X8RA 3T0AA 5IHRA 2ZTKA 1YIXA 1K9DA 1W3TA 1EHNA 2Y2WA 1KFKA 3NCOA 1WXYA 1S5NA 4KWVA 1I0BA 4DRSA 4ECLA 1CBGA 1G67A 1N82A 3DOPA 2IPJA 3MBDA 4RCXA 2PWDA 2CCRA 1MWOA 1BXNA 4J3TA 3KOWA 4BEUA 1BGAA 2IPWA 4HU0A 4D6GA 2J13A 3FXYA 3O3RA 4HMEA 3ZJ8A 5A8PA 3VKCA 2QMJA 4OV9A 4C7GA 2OWXA 2Q71A 3WLMA 1TV3A 3AMLA 3W6YA 3E0FA 2R1MA 1Q7ZA 4Q4MA 3U7BA 4OECA 4X0NA 1T5AA 4KWWA 2WHMA 3DAQA 5GQBA 3NM1A 3GYCA 1EWEA 2Y8UA 2BNJA 3F2DA 3GW0A 4TVDA 3FA5A 1THFD 3VNYA 1SJBA 2PAJA 5H8MA 1JCLA 1QDSA 4KEUA 4LAUA 2E5CA 1C7SA 3WEMA 4KWSA 3KXQA 1ME7A 1K1DA 3TQ0A 1XLJA 4A05A 2CNCA 1OFQA 3VDCA 1C93A 2RJHA 1S39A 5D2XA 5I07A 3K1DA 1UKOA 3ELFA 2W79A 3AZTA 5FAJA 1TV2A 1Q6LA 3EDKA 2PEVA 3M0HA 3A22A 1JZ3A 4NZFA 4L1GA 3LCXA 3F4WA 4P7QA 4GZ7A 3LPOA 5RUBA 1TZ7A 3LEPA 1JF5A 4MKVA 4AQLA 1JI1A 3LA4A 1ZTVA 5LHFA 3ZJ6A 4ZL1A 1UUMA 1R9XA 2A0NA 2ADAA 1ZS2A 2FHCA 2XM2A 2QS8A 1J0ZA 3DGRA 3FVDA 4LALA 1W3IA 3WD1A 2GWGA 2VP8A 1RJQA 1ZU8A 1S2TA 2JF7A 4UTFA 3UWUA 5ECVA 3DEQA 5IBXC 4LFYA 3IGHX 5EMMA 4A8LA 4DNMA 1FWBC 2PWEA 4GVGA 1KGUA 5C2CA 2OZ0A 1VPYA 2WSRA 4NNCA 4H8HA 5DELA 3N4AA 1HJUA 3QGKC 3E0VA 4E4PA 8XIMA 2Y1HA 5FJTA 2A3BA 1GKPA 3PFMA 1XLKA 3RCMA 5C9WA 1RD5A 1NIUA 1XBYA 3SJNA 2H6RA 2VRJA 2A2IA 4O19A 3STFA 5BOEA 4J4KA 1MO0A 2VC9A 3EX1A 1VS1A 1B1YA 5EU9A 6XIAA 3C0SA 3GAKA 1UYQA 4FALA 1QW8A 1UH3A 4MLJA 1WOBA 3JVAA 5AY7A 2VFGA 3TXZA 4PMUA 3TAOA 1YYAA 3OBKA 4LUJA 1G69A 4JIRA 1Q6QA 4JQ3A 1V08A 4HZ7A 3WL0A 4NAFB 3NDOA 5CG7A 5K7JA 1H60A 3AALA 2BSLA 3FSUA 5EFDA 2E1DA 4IP4A 3CXOA 3W29A 2DZVA 2X41A 4E6MA 1I0DA 4GQRA 3NAVA 2G8ZA 5DXYA 4Q4KA 5A6KA 3RILA 4C6PA 5HWMA 3T8QA 4F0SA 3TCEA 2J47A 2G0WA 4MY9A 1SR9A 1TE6A 3MCMA 4ZGYA 1V6UA 1CTNA 4O8RA 3MUXA 4MY8A 2WZHA 2YYUA 4Y9MA 4W9TA 4JNMA 1B3WA 1K8YA 4GBDA 4JTLA 2O9RA 4IIGA 1OK4A 3DU0A 4QEEA 4GABA 5HJXA 3OPSA 3GVQA 3P8JA 1BVNP 3OOQA 3EMCA 4X2RA 1YRRA 1Q5MA 3OVQA 5KZEA 4UR9A 4HT3A 2ZQ0A 5JH2A 4IHCA 3B3DA 4B90A 2GGJA 4S1FA 3RLGA 2AKZA 2VD8A 1ZY9A 3N6QA 2YX0A 5DLCA 4YHGA 3K2GA 4BI5A 2WOQA 1MZRA 2PGRA 4B3KA 4ACZB 4DWSD 2QJGA 3THCA 6A3HA 2VELA 1RQBA 4PTWA 2PU0A 1E0UA 3MMDA 5A6MA 4CD5A 3RN6A 1KFWA 1P1MA 2INZA 3MS8A 5LA1A 1XHGA 4UXDA 4XVDA 1VFTA 4J7RA 3L68A 1BFNA 3H70A 4Z1YA 4GYPC 4C1NB 4S3AA 3CPRA 3RFAA 3APYA 3KBSA 4UTIA 2XSAA 3W23A 2YB4A 2B81A 4XKYB 2ABAA 2MNRA 3BOXA 3HQOA 4GY7A 4IP7A 2OQLA 4F8XA 3UR8A 3BLEA 2OPJA 4CU6A 2XFWA 2W67A 3S6TA 1TQJA 1VYRA 4B91A 3W28A 1H0IA 3EEZA 2GK1B 3IVTA 4K7VA 1FFRA 3II1A 3S5ZA 2QJJA 1JYXA 4ZQPA 4CKQA 1Z8AA 1FDZA 3B4YA 1IXPA 3THUA 3ZQ9A 3N4EA 2W27A 3EKLA 3M0YA 2DVTA 1BAGA 2VM8A 4GZIA 4NILA 4F0RA 2DZTA 1WDDA 3CWOX 4I8YA 3R0UA 2I5QA 5D9OA 3NQBA 3XIMA 1VAHA 1Y65A 4RK8A 2ZRWA 2XH2A 1K6WA 1AODA 2ASHA 3AYRA 1M9HA 3FCPA 5T9BG 3CHFA 5A5WA 1XH2A 1XUUA 4RJEA 5GJPA 4TX9A 1QPRA 3P5ZA 4NASA 4CGTA 3PWAA 4PTVA 3UFYA 5CSSA 3TJXA 3H21A 4KGJA 3S5YA 2PCQA 5HATA 2QJMA 4R85A 2VYOA 3SIMA 5AC7A 2PDPA 1CIUA 3B9AA 3ZVHA 3MSGA 1CW2A 4OKDA 4HZ8A 1QHPA 1U5HA 3PZOA 1KW1A 1BLIA 2OEMA 4UZUA 3VNLA 1F5ZA 2CZVA 2PB1A 7ENLA 4FA3A 1R9YA 5H91A 4RZ6A 1CT5A 2R1LA 1WUEA 1Q63A 3VX0A 3TFXA 3N19B 5CPOA 1F73A 2ZICA 3SCSA 2BHUA 1LZOA 3W1MA 5FJIA 4O1CA 1G6CA 2XDFA 3VOCA 1EJRC 2Z1BA 2J62A 3W85A 2R24A 3K13A 1SMAA 1H3GA 3GC5A 3STPA 4E8DA 1W5QA 1ZBWA 1QNSA 3MSDA 4MFEA 3MKVA 1VRDA 4EPBC 3LZ3A 3L5AA 1SZNA 3OO2A 1FY6A 5C7HA 3W00A 4DJFD 2WVUA 3T44A 1DKWA 3TR2A 2CLEA 2NQHA 1QATA 3NVTA 2IMRA 5ENLA 3TOYA 4JQAA 1VFUA 2V5BA 5EFFA 2WQPA 5MKGA 5DMNA 1LBMA 1BYBA 1Q65A 1WP6A 1YE6A 3N9SA 3KCJA 1K9TA 3W86A 3C2RA 1CEOA 3PG9A 3FEQA 5AHNA 2A3CA 3SM0A 4GD0A 1EJUC 4BEQA 3MANA 1QVBA 2XH4A 4Q3MA 1DE5A 3I3DA 5AYZA 1TTPA 3EWUA 2ZWYA 1E6NA 3CHCA 2ZRYA 4QJ5B 4FXRA 1FCBA 3UZZA 2FZMA 5HNNA 2NV9A 3BZGA 3CTTA 5K9DA 2HS6A 1DTNA 1KKOA 3M64A 2ICSA 2YGYA 4FZIA 3OIXA 1ODZA 1X97A 3WFLA 3DI1A 4CLMA 1EIBA 1QRQA 4FIQA 4LUIA 5KMYA 4IIDA 3LHZA 2VTFA 1ZJAA 2ZX7A 4PUKA 4GUFA 5LXXA 4LV9A 1NY1A 2V0TA 1GVSA 5CSUA 5ABEA 4IIEA 7A3HA 1VFMA 2OEJA 2F38A 3SSZA 1GEHA 3TH6A 2C3ZA 2PDMA 4YWSA 1O94A 1HJXA 3F2CA 1HO1A 4XSLA 4K8GA 4FS9A 2ZC8A 2F7FA 4FI4A 1AMKA 1DJHA 4GVHA 5AHEA 2PDNA 3BLKA 3SCWA 4G1NA 1W9XA 1GORA 3I3BA 1UD8A 2OYLA 1QHOA 4QM1A 3O6AA 2P50A 1J2WA 4JICA 2WPGA 4PR4A 3MV11 4GACA 3FY1A 1ONRA 2W92A 1AD4A 4P8WA 5LIUX 1LBLA 1RBAA 2J24A 3USBA 1M7OA 3M0XA 2A5HA 2V3EA 1AJ0A 4FXJA 1UOZA 3UG3A 3CH9A 3AXXA 3WF3A 4IMGA 4L6OA 1CCWB 4JX4A 2P10A 2XU2A 3K4DA 9CGTA 1RBLA 3WQWA 2E7FA 4TQTA 4XZBA 3SZ8A 3V36A 1X8FA 2EAWA 3EWZA 1UKPA 1GNXA 1OY0A 5CKSA 2HVNA 2G41A 3IIVA 2YCLB 1ML1A 3QMSA 4PODA 2G4FA 3GDRA 3GX9A 4KWUA 1XLDA 3UA3A 3ZYZA 1UC4A 1TPC1 3W26A 3LV6A 4N4QA 3B9DA 3VGFA 3ERPA 1JDFA 2FPVA 4Z2JA 4WJEA 3UVIA 1ISVA 1O7AA 2PF0A 3U4AA 3S9IA 5BYWA 5C8BB 2ZRXA 2ZZ1A 4JHOA 3ITVA 2OTDA 3UVAA 2A3AA 2J79A 2PE4A 3LTSA 5DCDA 2HK1A 4HYVA 3KS5A 1TSIA 3EEGA 4C7FA 4W5UA 1KBLA 1U30A 2QAPA 4QGCA 1FH9A 1XDJA 2OWWA 3H4GA 1PIGA 1L9WA 1AMYA 3O6YX 2XWEA 1WZKA 3VZXA 2FJUB 1TVNA 1XRSA 1BEUA 3VYLA 2E5DA 1AJZA 1EO5A 1O68A 3LRKA 1LRTA 3PPFA 3MV01 2XYLA 1MMFA 2NLYA 3DBPA 3ZT7A 3FN9A 2ZX8A 1LF1A 1Q6GA 2A85A 4DXKA 4F40A 3KZPA 4IPPA 4HOWA 3ANUA 3NFUA 3GUGA 1MFVA 3B0PA 4GYKA 4DNHA 1PIFA 4BK9A 1D3GA 1R3RA 2QQ6A 3GTHA 4H9UA 2VC6A 4HU4A 2RHGA 1RZMA 4DZ5A 3K8KA 1UG6A 4CN4A 2CBUA 1EGZA 2FFIA 2C18A 2XVPA 4NAEA 1XLBA 3GAYA 4AC7C 1S2CA 6ENLA 3NM3A 3TTQA 1C92A 1DJZA 1FWNA 3ITOA 4AYGA 2HZGA 1RR2A 3BJSA 1V6XA 2GQ8A 4HPGA 4HQVA 2FHFA 2HRWA 1OHLA 4Z0JA 4AWSA 5HPCA 4Y8FA 4WXZA 3C2OA 5BW6A 3MI3A 1PKMA 4PYSA 2ISSA 2RAGA 3LXBA 4M82A 5FJPA 2ZZ6A 4Z42C 3SCTA 3TSBA 1FHVA 3QZ6A 3L12A 2ZX5A 3A5FA 1TR1A 4TX8A 3B8SA 1G01A 1HN1A 3C2YA 1F74A 5JU6A 2FHBA 5TQLA 5BWFA 2R1NA 4Q8OA 2REQA 4K2SA 4QS5A 3TTSA 5A2BA 2HISA 4DWDA 3RR1A 1CI1A 2PI6A 1FQ0A 4S3EA 4Z1BA 4FLOA 1E40A 1HTIA 4RNFA 3VC5A 1TA3B 3U48A 3GU9A 1RP8A 1W2VA 3UCQA 4AF0B 1E3XA 7TAAA 2F84A 1KBKA 1H09A 4WLCA 4NJIA 4X60A 2CPUA 3D46A 1E0TA 3NQAA 4GJJA 4INFA 5I03A 3TQPA 4TTUA 4D1IA 1EBGA 2JE8A 3STCA 3MZNA 3URQA 3VD5A 1Q13A 3W7DA 2IQDA 3S9YA 4AWUA 1RPXA 1TPWA 1OYAA 3B9EA 4MWAC 3UXDA 4JBRA 2XGBA 1K4HA 1VENA 4CUCA 2XGZA 1QOXA 3LK6A 1XBZA 4KH2A 4X2PA 1DV7A 3UZJA 1RY0A 4JFVA 5K4XA 1J5SA 4Q4QA 3XINA 1V4YA 2QIWA 1G5AA 5A6JA 1XIMA 2J88A 1IEXA 4AW7A 3I3EA 1TPDA 2PP3A 4LCSA 2DSVA 3I7QA 5J8LA 4C6FA 3NQVA 5A94A 4HCDA 2G3NA 4AZ7A 4PZVA 3PZTA 1AH3A 4I9AA 3W2UA 3DG3A 1HL2A 5BCAA 1E71M 4P7LA 1MYRA 3MBFA 1TVPA 1OGGA 1YXDA 3G1HA 4YTUA 1W9BM 1EC7A 3W38A 3UZ5A 4Q32A 1TPB1 3OBAA 3CMJA 3KL3A 3MUY1 1A5CA 1BVWA 2IW0A 3LBMA 2HV5A 1LLZA 1B3ZA 4QEHA 4C6NA 4PMNA 5DY2A 3WD3A 1P7TB 1ME8A 3UWWA 2GGHA 2NUYA 3WK1A 4HNOA 2XG9A 4EACA 1MUMA 5AKQA 2F8QA 3S6OA 3MWAA 1B54A 1XR2A 5CLWA 4XBKA 2OSXA 4GXPA 4PN2A 1NH6A 4HHPA 4JTJA 5D9PA 3LXAA 3P2VA 5BXTA 4O52A 2CEQA 2QXWA 4UTTA 4QJ3B 1DHKA 4X9YA 4I5UA 1JDCA 3LOTA 3BZJA 1JPIA 3B0XA 4JQ4A 1QOQA 1CB2A 3G1FA 4YL2A 4JN6A 1OEPA 1XLHA 3PAOA 5H8UA 1IXOA 5FI8A 3BL3A 2NQZA 2FTWA 4JS3A 3BAJA 2YZ5A 4Q7IA 4HK6A 3L9CA 4ZE4A 3GXDA 3SJ3A 3TFCA 1NJJA 2GVJA 2QDHA 2BXYA 3UEQA 1J0IA 3VO0A 3N2TA 3ZOAA 4AD4A 3UWYA 3VOGA 1QJWA 1YDYA 3C2VA 5HAOA 3AHVA 1GQLA 4B2DA 2Z7KA 3GHRA 4NRRA 4M19A 1HZYA 1UQYA 4H01A 3IGXA 1VEPA 1OF6A 1QPKA 1SJAA 1I75A 3HG2A 3NZRA 1B30A 3BCDA 3CQJA 4P7OA 2FGLA 1TTQA 1TPUA 1VH7A 4X0VA 4WOZA 2BXVA 2YDAA 4U4MA 3KS6A 3OVPA 2W91A 2VZUA 4W88A 4JDYA 1TREA 2Z28A 3SCPA 3HGOA 5EKYA 3S1GA 1XLAA 4B5UA 2A79A 5CC5A 3HPXA 3CLWA 2FPTA 4GKLA 3FK4A 4PB3A 3DG7A 1YNPA 3VNJA 3LGDA 3RM9A 4LB3A 3FYYA 2YBVA 2EHHA 1OX5A 2D2JA 4E8CA 3GIPA 3Q65A 1B4KA 4DZAA 3W2KA 4DBEA 5K9XA 2E67A 2GJXA 3EKZA 4YVVA 3WD2A 3B4UA 2QAFA 4MTVA 4PUNA 1V03A 4C6JA 1XLIA 3EWWA 1DP0A 3TZFA 3VMNA 4PMXA 2BLEA 4KKXA 1FP8A 3BURA 4ORIA 1SO3A 4JZ5A 2BMBA 4A4AA 4G7FA 1OFBA 1BHGA 1V02E 2Z2BA 4NZCA 1JXKA 4BA0A 4P8UA 1EA9C 1VZWA 2R1PA 3SUWA 1MRQA 1BYCA 3LHVA 2Z1XA 4IG2B 4PMVA 2PRHA 4NYUA 4XSMA 1H7OA 4E3TA 4EXBA 1C91A 3EMQA 3TZNA 1Y0EA 3RF9A 1X38A 3UR2A 1D3CA 1PXGA 3CPGA 1I2RA 3IANA 3ZXWA 3DERA 3W73A 3U2EA 2Z1KA 4QISA 1EPXA 5D9MA 2INEA 3CK5A 1PUDA 3RITA 4L1WA 4ZE5A 4ZSUA 5FL0A 1WPCA 3PBUA 3KE0A 3NQ8A 3TTYA 1MW2A 3SFWA 3DFHA 3SECA 1J0HA 1JDDA 4HZ6A 2AQOA 1BF6A 5ECUA 1XLCA 3VIHA 3VKKA 2Z0IA 4DN1A 3GNPA 1OZQA 4AZIA 1GQJA 1DPMA 2D22A 3DX5A 4AHPA 3TSMA 1ZBCA 1SO5A 1F3XA 2HMCA 2JKEA 5E0FA 1RALA 3WUEA 1KM5A 3E12A 2G3FA 4KEMA 3P8IA 1XCWA 2JEQA 3DYPA 2DSKA 3CU2A 4MZ8A 2VT0A 4RDVA 2E9BA 4NXKA 5KZDA 4CCZA 3VX1A 3MMUA 3WMSA 4WHBA 2Y8VA 4RLIA 1MI3A 5BROA 4BKNA 4HOZA 3LHYA 3AO0A 3WH6A 2YR1A 1PWLA 3M7WA 4M6VA 3D6NA 4NIRA 1M7JA 1RPKA 4FOUA 4U2YA 5I06A 3W75A 4BFAA 5E0KA 4QE4A 4L5ZA 4R7JA 3G1VA 4IPIA 4LANA 3LENA 4EE9A 3UG8A 3N3MA 1DWFM 3PTQA 4Y8EA 5IDZA 4OBRA 4A21A 1UZDA 2GDUA 4RL3A 3TTEA 3CUHA 3A4AA 2I9EA 1HJSA 5D30A 1UQZA 1M04A 4DYKA 3TNBA 5HQMA 1CGTA 2BGNE 4WK9A 4XAFA 1GUVA 3VIFA 1NOFA 2NZLA 1IZKA 2V30A 1J0YA 1GTHA 4KFOA 4YHEA 4D9PA 1WKEA 2C7FA 5JIWA 3WBAA 4BQ3A 1RSCA 4O1DA 3CT7A 5F4WA 3DECA 1BVZA 3FAWA 2ABBA 2RJGA 1POJA 3IJ8A 3NVDA 4ROPA 3WDIA 2NXGA 3HQ1A 2XVKA 4MKNA 3E2RA 4EANA 2VFEA 2GSJA 4GI9A 1A0DA 4HVXA 4MYXA 2POTA 4A6GA 1TPFA 2OLSA 1W3LA 1E0XA 4PCFA 4OQVA 1WAUA 3GTXA 4HJWA 2Y89A 2YZRA 2PURA 2E77A 1K70A 3GVGA 4J40A 3N2CA 5D8ZA 2CXEA 1W9UA 4H9MA 4UFJA 4GG9A 1XL9A 3T78A 4TO8A 1YBQA 1KTCA 1VHCA 2P8BA 4DBUA 1J12A 4NJHA 4ZB2A 1DE6A 4K8HA 3TA9A 2ZXAA 1J6PA 5KITA 3NL3A 2GGGA 5B7ZA 2WJZA 3IJ9A 3THQA 1HKMA 3C8FA 4QFUA 1G1YA 1ZAJA 1GG0A 4LWWA 3QJAA 1XG3A 2UY2A 3AHXA 2WMKA 1GT8A 2DZXA 1H1NA 1S2WA 4K38A 4NJKA 2NVDA 2VVSA 4TR9A 3NO1A 1A3HA 2SFPA 3ITCA 4GUIA 4MWAA 1IE7C 4AD5A 2XIQA 1W8GA 8XIAA 1YTDA 1JNDA 3CV2A 1YPIA 1QK0A 3TX9A 4C5ZA 3OGSA 3URNA 4CNTA 1QNVA 4DLFA 4AHOA 1WKDA 4YTRA 1F4HA 3CHEA 2B7OA 3IK4A 4CNOA 2HXUA 5PTDA 2RDUA 1R2SA 1C90A 3CL8A 1A80A 2P88A 4E2BA 1I2PA 2PU1A 1JJKA 1JDAA 3AHYA 4JL1A 4BF5A 3GVWA 4PBEA 1Z42A 3FXGA 3ZSSA 1XIDA 4AZBA 3WENA 4F4RA 1BG9A 4N9CA 5LNSA 1WOAA 1B31A 4DJED 3BLFA 1TIMA 3V3WA 3W02A 5C54A 3ZVHB 4F3HA 4HJFA 3EYPA 4MY1A 1HVXA 4F9DA 4IMEA 1ZBKA 1ITQA 1Y5WA 4S2BA 5IOBA 1VP5A 5FJJA 3WLIA 1W37A 1NDYA 3KTSA 3BDKA 4F0LA 1AD1A 3IV8A 3KZSA 4O12A 3DFQA 1SFLA 3GBEA 3S1VA 1DIEA 2QPUA 1OGBA 4AMAA 1XFCA 4LUSA 3MP3A 3GM8A 1WYIA 1R3WA 4JY9A 1FUYA 4L9YA 1A50A 2QF8A 5EMLA 1EC9A 3TYBA 3LTYA 5IM51 4C5YA 4D6JA 2IS7A 4GRSA 4ES4A 4H6RA 4B15A 2MANA 3WUFA 1JD7A 4QAIA 3K8MA 1Z6KA 2CETA 2HPMA 4XZNX 2I56A 4FNRA 2PDYA 7CGTA 2OLHA 5AFDA 2X0YA 4DF2A 2D24A 2AQVA 4I7UA 1Q2SA 4CQBA 2DT1A 3GR7A 5CC3A 1A3XA 5T26A 4FX7A 2VZTA 4IM4A 1GVOA 5IFPA 2ACUA 1DJXA 1FXQA 3I68A 4KBXA 3L7RA 1L8NA 4LYKA 4MLRA 1HP5A 3WF0A 3OLEA 3BLIA 2YYTA 5EY5A 3R43A 1QUMA 4O53A 3VGHA 4W5ZA 4CNNA 1RAKA 1OC5A 5MKGB 4AVOA 3BG3A 2QR6A 1GVEA 2DT0A 3EA2A 2E6YA 3OIHA 3WH8A 4TIMA 3K5XA 4XAGA 4UQEA 1HJVA 3QMTA 4UB9A 2ZZ4A 2DEPA 1ZHAA 3QSRA 3QC0A 3VE9A 3IPWA 4FX8A 5F4SA 1OIMA 4P7RA 4UQBA 4N9EA 2V2DA 5KZ6A 5HJYA 1FWSA 4KEZA 3PUOA 4IZGA 1IZCA 4GBUA 4Y9AA 3STGA 4YCPA 1AW2A 3N34A 3ABXA 2DUZA 2VMFA 3GR8A 1JXJA 1EDTA 2TAAA 3SY5A 3WJYA 3JZUA 1PKNA 4Q7BA 4F0HA 4IFKA 2E3ZA 2RDWA 3MQTA 3FYPA 3DH7A 1ZAHA 4DM1A 3QGVA 1JZ7A 5LYRA 3CJPA 4DUVA 3S2MA 3ZR5A 2XIOA 3AS0A 3AMDA 1NF7A 1B90A 4HK7A 1FHDA 2QCCA 3USZA 3DYMA 2RKXA 3WKZA 1Z32X 3BV4A 1HO4A 1DWHM 2ZX9A 1FVPA 1VJZA 3V4BA 3T6CA 3G0UA 3ID7A 1Q6RA 3QH2A 2QLYA 4IPJA 4YTTA 3B9NA 4DWSC 1YDOA 5EPDA 4Q4OA 2X1TA 6REQA 5J04A 3W7RA 3EMZA 4ML4A 3ONBA 4GO9A 4L9ZA 4HYRA 3O6DA 4K6AA 1HL9A 4M81A 1UR8A 3APGA 3M4HA 2ZUSA 3M6YA 5D2VA 4NVTA 2OMAA 3FVMA 3E9AA 2DVXA 2XN2A 3PAJA 2DSUA 1AK5A 2VZVA 3LHWA 5C55A 4LCRA 3GW3A 2E4TA 2O9OA 2NXHA 1X1NA 2VX6A 3VAVA 2Y5EA 4GCAA 3WLQA 4Q33A 1TPEA 4PH6A 4KW2A 5FA5A 3H22A 2J7GA 5F1UA 5HBFA 4WOQA 1S38A 3BANA 4GQ0A 2GZXA 1XYCA 1NSJA 2NWSA 3WDPP 4O1AA 4UIOA 3F4VA 4GXMA 4YMZA 5EBAA 4Q6XA 1MEHA 3WIJA 4HMDA 5LHEA 2PWFA 1PEZA 1XGEA 3OJGA 1JCXA 1GW1A 1EF2A 3NWRA 3DZ1A 4WSJA 3FKKA 1VIZA 2PTDA 3WLNA 2CLOA 3KBVA 4I6VA 5AC5A 1AG1O 5D2TA 2P0OA 2F6XA 1XS2A 1HXJA 3AZSA 3GIQA 3ITLA 3V0TA 1N8FA 1YPXA 3C0LA 4HPXA 2PTWA 3GKAA 1P0EA 5HR7A 5I7GA 1XD1A 2J4GA 1H7RA 2JIEA 3MVIA 3SGGA 4GLEA 3PC0A 5LNVA 4Q22A 2JEPA 3W6LA 1GVIA 3P5YA 3Q37A 2O56A 1A5SA 3B8TA 5GPRA 2NX3A 3KL5A 3VK5A 2EPKX 4V15A 4I9JA 4R3UA 1K02A 1UHVA 2LLEA 1W1TA 2X16A 3A3XA 3H7VA 1TE1A 4I7VA 2YXOA 3V1HA 4M7SA 4DX3A 3VABA 4GX9A 1H4PA 4R27A 3CAVA 1HNYA 3BW2A 3HG3A 3ALGA 1R86A 1GW9A 3WSUA 5AHLA 1VEOA 4Z1AA 1X6LA 4JEQA 4PTDA 3GSMA 3N18A 3UBPC 4EAMA 1LBFA 1QTWA 1UBPC 2QDGA 3E3HA 4NAEB 4R33A 4LV4A 3EDFA 2ZRVA 2OT1A 3CQ0A 1V3KA 3AXMA 1PKYA 1DOSA 4HNCA 1XPGA 2IKHA 4HP5A 4FLSA 4AMCA 3NZPA 4D8LA 1A5AA 2J78A 3L4VA 3KL0A 1U2YA 5JBEA 4RPQA 3UZYA 1CXHA 2GWNA 3STEA 2Q6ZA 4DJFC 3A6OA 3T09A 4OUIA 2WVVA 4GQBA 1SO4A 2ZUTA 5CGMA 5I00A 3AWNA 4MB1A 4Z0SA 3W1LA 4MF4A 1NFBA 3BOLA 4ZTXA 1EJWC 3QOMA 3I6EA 5I3HA 5EMKA 3A3HA 3ABSA 1NQKA 1IWBA 2W9MA 3D5HA 3PFRA 2I1OA 3CBWA 2V2HA 3EXRA 2REQB 1AL8A 3KBJA 3B97A 3MI2A 3AYTA 3AQUA 1D7KA 4GVFA 2GK1A 5E9XA 1GOXA 3TP4A 3DHFA 4GINA 1KRMA 4JIQA 3NXFA 3VOHA 3AU6A 2NVCA 1CZ1A 1MQRA 1Q6OA 4K7YA 3WDQA 1CWYA 4O4VA 1EKOA 2I57A 3TW6A 2QV4A 3AICA 3NDZA 1XGZA 3R13A 3TC6A 1UCWA 4ATLA 4UFKA 2Y63A 1GJUA 2OQYA 4U31A 3TN6A 4ZB5A 4IL0A 5BRBA 1FX6A 1S5VA 4J3UA 4WRHA 1JUBA 1A5KC 3T4CA 1J2BA 3LMZA 4JKMA 3CWNA 3GXTA 4XZWA 3GC2A 1CDGA 1JNEA 3UXAA 1W56A 3C5QA 5FCZA 4EWND 3V0UA 4UOZA 4TOQA 5FF2A 3GXMA 5HQEA 3ZT5A 5BNKA 1H61A 4ZA0A 4EOUA 1VC4A 3L2IA 2OWCA 3OZOA 3GXPA 1J18A 2VFIA 3HBLA 2VKZG 4J28A 3OU8A 4EKJA 2C16A 3AS2A 4I9TA 2ODOA 3N2XA 1R3YA 1OB0A 5MF5A 1NDWA 4YCOA 4GH1A 3VXGA 2YXGA 4AD1A 2YL5A 5LXEA 4O28A 3VGDA 1Q6CA 1ZZMA 2PDWA 1R3TA 2HQAA 4WXYA 2FGZA 2GVGA 5TNVA 2XZ7A 4PBGA 1K9FA 1EQPA 4HPNA 4Q8TA 5B80A 4XG1A 3AOFA 3ZR6A 4ORMA 1REQB 2P3ZA 4D6HA 4MJ2A 3G1XA 3SN1A 3UJSA 1E4NA 2PLJA 3KWSA 1FOBA 2NT1A 4G7EA 4Y6GA 1UH4A 1XIFA 4TXEA 5LSMA 1J8VA 1B0IA 4YU1A 3WK2A 1M01A 1O5XA 4G56A 3LSBA 3VOJA 4JTKA 4JDBA 3NTYA 5C9UA 3SQMA 4LH8A 2MUCA 2HSAA 2WMHA 3WUGA 1VQTA 3N17A 3VTRA 1BG4A 1YEYA 5EBUA 3WYZA 3GO2A 3TQKA 3EB3A 2PTYA 3SCVA 4PL1A 1UD6A 3OTRA 4JIHA 1XYLA 3LCGA 2QUMA 3ZM8A 2QEZA 4D1JA 2DZUA 2JK2A 3MCNA 4RUBA 3QLLA 3RO8A 3W1RA 1WV2A 3B8WA 3N13A 1PV8A 2POZA 3QR1A 2WZEA 5BMXA 4WQ6A 3E2VA 2ANUA 4A29A 3KOYA 1XUZA 2CITA 2DJLA 4HD5A 2KX9A 1E4MM 4XB3A 4J2MA 4C1KA 2E6DA 1OYBA 1U33A 3H7UA 3EWXA 4Y90A 1E6RA 1EP1A 4GA8A 1X7IA 1WO2A 4XZHA 5HWJA 4O54A 1E6PA 2VDGA 3S2CA 5H1WA 3NYZA 2H8ZA 1YE4A 2WC4A 2EKGA 2EF9A 1Q66A 3CHDA 4QQUA 2NUWA 1B4EA 4O50A 2VC7A 4KCVA 1AQ0A 2R6OA 2ZZ7A 3HPFA 2VOMA 3NIYA 4BWLA 3RR4A 4CQCA 2XJ7A 2YCIX 3LYEA 1OSEA 4RE4A 3W76A 2G95A 1ZP4A 1QBAA 1WZLA 2TPSA 2E8ZA 1O60A 1LOQA 1UW9A 4L4PA 8CGTA 2VR4A 1C8XA 1ISZA 1UIPA 3LLDA 1XSKA 5JBDA 3I4EA 2ZUUA 1Q3NA 4Z1CA 5C5YA 5BXSA 3O0KA 3CQHA 1WZAA 1XH1A 3H12A 4J27A 1L2QA 3GNXA 3WNLA 2C79A 3NGFA 2E25A 1JD9A 1WKFA 1FWEC 3NSXA 2CBJA 4H83A 3UZWA 3HGJA 2YW4A 4J9JA 4L7ZA 3W7GA 4OUEA 4W8BA 4GGHA 1PZ0A 3E96A 4AD3A 1C29A 2EO7A 1O4UA 3TAKA 5T9CE 1LL6A 1IQ8A 1ZALA 4US5A 4DWSA 2YLAA 2TRSA 2BBFA 4GNVA 1JZ6A 2BASA 5GJMA 4O0QA 3LD5A 1MDLA 1GOWA 4HNNA 3EAUA 4U10A 2FDMA 1Q45A 1PHWA 2D1ZA 4AZGA 1IXNA 3URAA 4JTEA 4M24A 1SW3A 1KM2A 4QNEA 1T8QA 1CGYA 4JTQA 1SZRA 4PEEA 3MDUA 4NXSA 1LUCB 1R5YA 1TMHA 3AIRA 2Y5SA 2PDXA 1S3TC 2D0HA 1AZ2A 1EJSC 1VBJA 1WDPA 1FA2A 1R3SA 1QI2A 4PRWA 4HHLA 3QF0A 1LL4A 2C0HA 3Q94A 1C7TA 4AD0A 1LWJA 4PUEA 1EWDA 1T0OA 2PLMA 2ACSA 1H5VA 4ZR8A 3NSNA 3KFTA 4UC5A 1SW0A 1D2KA 5FKYA 2NXIA 3V35A 2ZZ3A 1I45A 3ZR4A 1U1JA 3WBWA 3S5NA 3G6LA 2FIQA 1EF3A 2ZX6A 3F4NA 3RHGA 3CUZA 4P8VA 1P1XA 2PD5A 1EOMA 2KZHA 3LNMA 3UPBA 2G5WA 4B5WA 1JRBA 1SO6A 3CZKA 4IJCA 1U5JA 2J74A 5AYBA 3HURA 3RU6A 2V5LA 4EF9A 3NYDA 4Q8QA 3TYDA 3ICJA 1ZLPA 2JQXA 3FA4A 4OV4A 3OODA 5CCZA 4GJIA 4L65A 1S5MA 3UT0A 4D6CA 2WK2A 4QSFA 3W7PA 4LGXA 4NRSA 3R10A 3UYIA 1HFBA 4U5IA 3ATZA 3R4IA 3KEHA 1KCLA 4GVIA 5I79A 3NQDA 3KAOA 3T08A 4GOAA 2OX4A 4XZIA 2Y5JA 1U5VA 1SFSA 3JW7A 5KETA 1EP2A 1DWJM 1QHZA 1YQ2A 3U9IA 4IX2A 2HE5A 5DMYA 3DG6A 2OXNA 2AL2B 2XZ9A 1E3ZA 1T6MA 5AZ1A 1DJNA 2V5CA 1KNWA 3MMTA 1NU5A 1CXKA 3C86A 1JQXA 5D02A 1W3KA 4YN5A 2DU2A 5CQ1A 3YPIA 3W9ZA 3NPUA 3O07A 3ZMRA 3ABZA 4GIYA 3VIKA 1QCWA 1KM6A 3T9PA 3N2BA 2VR2A 1QU4A 3T1GA 3TWAA 3VIIA 4HHMA 2QF7A 4PL2A 3CUIA 3VIJA 5M03A 3W7JA 2E9LA 1OFDA 2QJNA 2GDQA 3UJFA 3WJSA 2EG8A 4H6EA 2Z6JA 2TODA 3BXWA 1A5MC 5LKYA 4JTUA 3BO9A 4JNYA 1ZB5A 5CSYA 1MUWA 4H6QA 3P7YA 3W25A 3JS3A 2A1YA 6CGTA 1RD6A 4TTGA 1A53A 3W2LA 2CLKA 2VWSA 2VC5A 2YIHA 1M53A 3VNDA 3EOSA 1XSJA 4B4HA 1DIKA 2PDGA 1I2QA 3PZUA 3NPXA 3I65A 5G2HA 3A4XA 3FJNA 8RUCA 4PMJA 5D4YA 3UERA 4ACYA 1AZ1A 3N2MA 2X42A 1Z89A 4UTKA 3T0BA 3LLFA 5A8GA 4IP5A 3AXKA 4AF0A 5E5CA 5A8NA 3VDBA 3OA3A 4Q7NA 2DZAA 4S3GA 1TJ0A 2QDEA 2J9ZA 4FLRA 4DZIA 4UNIA 1BWVA 1GGOA 3R0KA 1T96A 3PZMA 3CM4A 1Z3NA 2WMFA 2BODX 4WIWA 1M41A 1KFEA 2V69A 3LXCA 5FD0A 1XH0A 2NSXA 1C9WA 4Y9NA 4CVWA 4HU3A 1YKWA 3P74A 2F2HA 2UY5A 3HQNA 5AOUA 4A3RA 4MWAB 3I4KA 1OFRA 3B9OA 3EBVA 4H9XA 2CBVA 3TYEA 1SSGA 2Q8ZA 2CYGA 4QBXA 5CAKA 1KTBA 3VNIA 5F4XA 2ALDA 4NYYA 4JTDA 4IUGA 4RZBA 4KMQA 4WDXA 1I8JA 5HDRA 1AL7A 5DRCA 1H7NA 1O1HA 5FACA 2PMQA 4IUOA 2GYIA 3BLDA 3LCLA 3CUJA 5D03A 1GK8A 4KEVA 3AZRA 3DC8A 1JZ8A 1BXCA 4UOQA 3S6DA 3K4WA 1HKJA 1UWSA 1VR6A 3Q58A 3TW9A 3QV6A 2WW5A 2E8YA 3FAXA 1CGXA 2GLKA 5EA9A 4JEJA 3SCUA 2VI0A 1E43A 1JQVA 2VDIA 1LQAA 4DAIA 5MHBA 1IR1A 5IDIA 1BPLB 3E38A 4JYEA 3DESA 4WDUA 2YFOA 3EKGA 1V6WA 4HA3A 4XZLX 5EMUA 2J7HA 2Z4GA 4MPQA 4ADSA 4E2VA 2OODA 4E0CA 1OCQA 2CLPA 4MJZA 2F6UA 1FWAC 4IQLA 4LUSB 3U7VA 5BWAA 3C0JA 3IACA 2NQJA 2UY4A 3LCHA 5K9CA 1E6ZA 4IIFA 1V6VA 3TMLA 2YBTA 3LTPA 3WQFA 4XD5A 4AEFA 2GJNA 2WM0A 1H11A 1RY8A 4WY0A 3DCPA 4Q6JA 1JZ2A 4JFSA 1Q8AA 5GVJA 4O18A 4YXGA 5H8PA 1KRBC 4QLJA 2FPYA 3BAKA 4IJRA 3ANVA 2DP3A 2AMXA 1LORA 1PX8A 3A9IA 4UTHA 4TMCA 4AY7A 5LIWX 4FR6A 2EPHA 5CH9A 1W32A 1T99A 3L4TA 2QGYA 4UUIA 4WEVX 3BVJA 1EPVA 3EPMA 4CN1A 2OFJA 5I3KA 1KWKA 2UY3A 5CPMA 4XKMA 1DORA 3GBDA 2F61A 1XQKA 5AVNA 2GUYA 4IIBA 4ZXLA 2VXNA 3MUAA 4JTCA 2GJPA 1IEVA 4Z1DA 5D37A 1OM0A 2VQUA 4L61A 3TSDA 3GXFA 3JRKA 3D3AA 3QY7A 5HMSA 1TB3A 3MDWA 3GU1A 1QNPA 1XCFA 4GZEA 3CIVA 3SI9A 2GSHA 3ECQA 5C9ZA 1QPOA 3MJMA 4H9TA 3VNMA 2D20A 3BCJA 3DC0A 3WG6A 2DZBA 1EGVA 4AYSA 1Q4WA 4RKAA 4S3CA 3GHSA 2V67A 4GIEA 1R2TA 5CC6A 3G6MA 4S3JA 4UFMA 4CCDA 1QWGA 3TC3A 3BSGA 1G9HA 4AISA 3WQGA 1N7KA 3ITTA 3UWEA 4IFKB 4FO4A 1EDQA 1J0KA 1W17A 2VEMA 2J9XA 1T41A 1IGWA 4J3WA 4QLKA 1CXLA 2P5NA 3NA8A 9RUBA 1PZ2A 3ONCA 4GHRA 1NEYA 4UNLA 3ARXA 1A3WA 3W7LA 3NO3A 4PMQA 1SJDA 4QCEA 5IXEA 3KTXA 3QOKA 1R46A 3VA8A 2D73A 1OX4A 3NZGA 1KRAC 4AWTA 2CKRA 2W66A 3LSCA 1WE5A 1PZ1A 2G97A 3SRDA 1ITCA 3ARYA 4NZJA 3IVSA 3PJXA 5K4ZA 1ZJIA 3E5PA 2ZFAA 6REQB 3MB9A 1RCXB 1ELSA 3MP5A 1LT8A 3NXLA 4A2RA 4IG2A 3VCRA 4L56A 3QY8A 5FF3A 2L5HA 1IEQA 3PPGA 2RDTA 2B4GA 4QX4A 4YWIA 4OU1A 3DFNA 3IK2A 4H00A 1VLIA 2UWFA 1K6AA 2B7QA 3C2FA 1LQ2A 2VEGA 3MHUA 3FEMA 1IR2A 3FNDA 3UJRA 3GHTA 5HPOA 1SMDA 2WBGA 1A4MA 1N55A 3W1QA 1RLCL 1E70M 1RQHA 3M43A 2YDQA 4ZOEA 3EX3A 1T7LA 4XO6A 2BWGA 3VINA 4ZVJA 1E73M 2ZDRA 2EEXA 5D9NA 2ZVRA 3TK7A 1QXLA 4XISA 5C9XA 4RW5A 3R89A 2QYGA 2RH9A 1TIWA 2EJAA 3SGUA 2CLHA 4UTLA 2BVYA 4XO7A 1XYBA 3R6IA 1TWDA 1WCGA 3SGZA 2GVYA 3CPUA 1FDYA 2ZA2A 5BMWA 1Z44A 2I14A 4M51A 2NV2A 4N2YA 4D6DA 1MNSA 2GQ9A 5LIXX 3MUZ1 3WK3A 3HO8A 3P84A 4CD8A 1SGJA 2WHJA 3G77A 3CZ8A 4S39A 3KOZA 1MZHA 4WDTA 5E93A 4K8EA 1OD8A 2XIMA 2GOUA 3W2JA 1T8XA 3WNOA 1XV8A 1V3MA 2NX9A 3OQ8A 2EGZA 2YKKA 1E1EA 1ZSXA 1XBXA 5DCEA 4CCCA 4H2HA 4DJEC 3UXKA 2BG5A 3U4FA 1LT7A 3AYSA 1XBVA 1KCKA 4QTGA 5I3GA 1E56A 4LOCA 4V1XA 2XINA 4O10A 4H3DA 4DELA 2W5FA 4YIWA 3QSTA 3G1RA 1JUEA 3TN5A 3R79A 4X3ZA 4UMBA 1TWSA 1NFGA 1XJBA 2WMIA 3EXTA 1OFOA 5C70A 2C0AA 3UY7A 4ALDA 1LG2A 4XTDA 1OFPA 5D2YA 1Q7MA 1U1UA 1PCWA 2DZPA 3N04A 1Z69A 4IF2A