1D3HA

Human dihydroorotate dehydrogenase complexed with antiproliferative agent a771726
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
367
structure length
364
Chain Sequence
MATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE
publication title Structures of human dihydroorotate dehydrogenase in complex with antiproliferative agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 136
structure length 364
sequence length 367
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 1999-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1d3hA00
3NL5A 4PFMA 5HWNA 4RCXA 2YX0A 4JD4A 3LHVA 5KSWA 1QO2A 3T40A 1M6JA 2WO5A 5FF7A 1YPFA 1K7FA 4UTLA 4UTKA 3AO0A 2NZLA 1EX5A 1TO3A 3VFLA 1WAUA 5K2ZA 1P4CA 3LCLA 2WSYA 4MY8A 3SW6A 3ZR4A 5CZ0A 1KV8A 3M41A 2NV1A 1ZAJA 2QCLA 4FIRA 4TO8A 1S5VA 1I2OA 3LOTA 3E02A 1QMLA 1TPEA 4N4PA 4GUJA 4GWEA 1TPDA 3IRDA 3CLMA 3GB6A 3HG4A 3LRMA 1G4EA 3S1XA 3FKRA 3M44A 1TRIA 2FB3A 1E51A 3W7KA 1GTEA 1GG0A 3UY7A 4O17A 5CPOA 4Z1DA 4XKYA 3W86A 4O1CA 3NQVA 2OZ0A 2V81A 3HJZA 4XQ6A 1HTIA 4JS3A 1MEWA 4LS1A 3Q37A 1R2TA 2ISWA 1G67A 3KOFA 2CLKA 3O16A 3DFSA 2C3ZA 1JUKA 3KAOA 1SW0A 5MHBA 3MI2A 4JICA 5AN7A 4RZ6A 3Q2DA 1H7XA 3SY5A 3UWQA 1F7BA 4LS2A 2I14A 3MJYA 4N02A 1VJIA 4I7WA 3RK8A 1UJPA 4QISA 3SI9A 3SIZA 5LKYA 3I7SA 3NQ6A 4AH7A 3VNDA 2FTPA 4ZQMA 4G1KA 1ZFJA 2XN1A 3GIYA 1K7EA 1VYRA 4WQ6A 4HSNA 1AMKA 1A50A 1HFBA 3NL6A 1TTIA 5HUPA 4UFKA 5LNRA 4CLMA 1Q45A 2NX9A 4PC8A 2ALDA 2DZWA 5DY2A 3OG3A 1JCNA 3EXRA 3PVFA 3C52A 2DZPA 1XUUA 4WD0A 4Y90A 2WKJA 4RXGA 4QNEA 4JTFA 5K9XA 5LHEA 4J9JA 3NDOA 3NQEA 3I68A 1OYBA 1LOQA 5HQEA 3TMQA 4RKAA 3SJ3A 1VCFA 2O7QA 3EXSA 1FWTA 5FEZA 3N9SA 3LHYA 4YCPA 3GAKA 4WY0A 3W7NA 4LUJA 4OGZA 3F4WA 2DORA 5U4NA 5LGZA 1EP2A 3PSWA 2JKEA 1Q6QA 4GC4A 5AOUA 4M19A 2FPTA 3O6DA 5AC8A 1RD5A 3QPYA 1H7OA 3RFAA 2A85A 3B0VC 2QCDA 3HQ1A 1YTDA 5BNKA 5BW6A 1VS1A 5AHFA 1TSIA 4MZ8A 4UTUA 1UUOA 4YMZA 4MVAA 4L4MA 1OK6A 2YXGA 1TQJA 1TPWA 4JGDA 2ATSA 2GPTA 1QPQA 4JTSA 4GFSA 3CU2A 2YW4A 4UUIA 1O4UA 3DXIA 1ME7A 3EKZA 4H3DA 4TIMA 3DI0A 1ZCOA 3CM4A 2WNQA 3L5MA 3SFKA 5CG7A 3STCA 1OG0A 4WZHA 1R46A 3M5VA 4FHAA 4LW7A 1QPOA 3IIOA 3MYPA 2Y7FA 3L65A 3PS7A 1IXQA 4ADUA 1ZAHA 3L5LA 3CWNA 4LWWA 2GQAA 4NJKA 1FXQA 4POCA 1BEUA 3HPZA 3P5YA 1Q6LA 1JCLA 1TV8A 3W85A 2R14A 4WY0B 4OBTA 4A29A 4CCDA 1JQVA 5K4ZA 1ALDA 2E6AA 3PULA 3NVTA 5A8GA 2E5CA 4DF0A 4O53A 4X22A 3KVJA 5AFDA 1H63A 2HS6A 5G1YA 3LGEA 4O52A 1O94A 2VFFA 3M47A 4JTTA 2C15A 4NXSA 2DJLA 3IVTA 5ABTA 4PCFA 2ZZ3A 1I2QA 1VLIA 3LTSA 4N2YA 1Z44A 5C55A 1GG1A 1OX4B 4KFNA 3W7MA 5E0KA 1GT8A 1DQXA 2Y6ZA 3G1FA 1QO5A 1EIXA 4Z1BA 3QC3A 2NUYA 2ZRZA 3N2XA 4NZFA 1OVDA 1IIGA 1W3IA 4CNPA 2DJXA 3CWOX 4LU0A 3F03K 1MEIA 5F2IA 1AL8A 1WYIA 1AG1O 5L6UA 3H55A 1R30A 1DJNA 1K7XA 3GX9A 1N7KA 2J9YA 2C6QA 3TH6A 2OJPA 5SWUA 2Y89A 3TV8A 4EWND 1K03A 5DCDA 1KTNA 3B0PA 2ISSA 3B05A 4H4IA 2OCZA 1QOQA 2VFHA 3W76A 5LSMA 1SO6A 4NVTA 3STGA 1BWLA 3S1VA 4JX5A 1XDLA 3VKJA 1IXOA 3UXDA 1SPQA 4O12A 3HF3A 4QIUA 2QAPA 5H91A 4MJMA 4S2CA 2QAFA 4P61A 1GVFA 4MPQA 1TPVA 1LBFA 3QQ0A 1C29A 2B7OA 4E0CA 5FF3A 4Z08A 3DHFA 4DXVA 1UUMA 3I6RA 3NPXA 1YXCA 5G2IA 2YSWA 4HNTA 4RZ5A 4YL2A 1TV5A 3TCEA 3NQ2A 1MEHA 5EBUA 4FNQA 3TQ0A 4IMGA 2Q8LA 5G4WA 4A2SA 4O57A 2Y61A 2CLLA 3TJXA 2ZBTA 1C8VA 3S5OA 5BMWA 3W7RA 1XBZA 2ABAA 3C2FA 3C2VA 4E2BA 3IVUA 5LGXA 4JY8A 3DFPA 1V7YA 1ZAIA 3W2MA 1JCXA 1I2NA 3N19B 3PM6A 3GR8A 5G1TA 4E2DA 4I7VA 4NX0A 2QCGA 3TQVA 3M7WA 3W6YA 3FIGA 1Z48A 3MMTA 4IGHA 2QUUA 1FUYA 1L6SA 1LROA 4BI6A 6ALDA 3U8GA 2QDHA 1ICQA 3CT7A 3INPA 2R94A 1YADA 2V9DA 3BARA 4NUWA 3N34A 3LCGA 1FDZA 1W54A 4PODA 4JR5A 1FWRA 2H8XA 3A9IA 2A21A 2VEPA 5AHLA 5L9FA 4KFPA 2PRLA 1UBSA 3BGJA 1QR7A 3G18A 3MHUA 1DBTA 3LBCA 3QYQA 4ORIA 2TMDA 5J5DA 3GXTA 5DN1A 3L68A 3LCFA 1O60A 3LERA 4MZYA 5AYYA 4NXKA 3A5VA 3DENA 3IGUA 2GJLA 1T0OA 3EWYA 5DXYA 3DGRA 3W83A 4HNNA 1DKWA 5EY5A 1W5OA 3MBFA 2BX7A 3M5XA 2CFFA 3LCWA 1PCKA 2A5HA 2IQTA 3RLUA 1AW1A 3C61A 2G97A 1KLYA 5G5IA 1OX5A 1LLZA 3UWVA 1KFBA 3RMJA 4O54A 4UR7A 1BKSA 1EUAA 3LCIA 3LV6A 1B57A 2ZA1A 3F4NA 4ZZ9A 1O5KA 4NJHA 4O50A 1G4SA 2CLOA 4EF9A 2Y62A 4UTTA 3RNDA 3TFCA 1NF0A 1JR1A 3KHJA 4LC6A 3P74A 4W9TA 3PUDA 2A7RA 3LDVA 2B7NA 3LI0A 5K9DA 2VKZG 5G4EA 2X1UA 2ZQ0A 4HHPA 2Y63A 4UNLA 1U83A 3TNOA 2Y7EA 3CHVA 3GDRA 3BG9A 5DLCA 1MSSA 4AWSA 3HO8A 4UMBA 1KW1A 1DORA 3FKKA 4Y9AA 1F5ZA 4LVAA 2YR1A 1XBXA 3BV4A 3MHFA 4GUIA 3B06A 1W5QA 1TCDA 4FNSA 2EGZA 4WX2A 2DZSA 1NEYA 1K8YA 3G3MA 3QMTA 1G4PA 4MFDA 1TTJA 2QCCA 4WUIA 5IM51 4RXFA 2P0OA 2QR6A 4ORMA 3CQ0A 1W5PA 2V8ZA 4JTJA 4BR1A 2VFGA 1P0KA 2QUTA 4IWWA 1VPXA 4LTSA 3QRHA 2X2GA 3BLFA 3M5ZA 4FO4A 1FDJA 3NO5A 4X3ZA 1KM5A 1R47A 3MUXA 1OFAA 1OYCA 5F1VA 4AF0A 1N8FA 4UTWC 3E49A 4Y6GA 4IXHA 4AMAA 2A4AA 2WV8A 2WNZA 4ONVA 3DFTA 2GVJA 4ADTA 3ABQA 4LNYA 3DKLA 4FXSA 5IBXC 2PURA 5F2MA 2CU0A 1Y0EA 1XBYA 3KFTA 3UNDA 1NF7A 2YFOA 1JCJA 3NQFA 4LVFA 3IGSA 2WNNA 2R91A 2F84A 6TIMA 3NYZA 3WK0A 1QPRA 4DO6A 4ZQRA 1KM6A 1PHQA 3H54A 2EF9A 2CWNA 1QFEA 2RDUA 1PIIA 1KM3A 3EXTA 2ZZ2A 2E68A 4IMCA 2YW3A 1DL3A 3NQCA 4RJEA 3W1MA 5KITA 3TQKA 2XN0A 3TC6A 4DBEA 1WDWA 2ZCGA 3W1TA 3TXZA 1OHLA 2BXVA 1OABA 1FX6A 3N3MA 4RZ4A 3PBYA 4GUFA 3W7GA 4UFJA 2YYUA 3N14A 1VZWA 2ZZ6A 4DF1A 4DO5A 1FBAA 3W87A 4A3UA 3O15A 1ICSA 2FFCA 3OEXA 2V5BA 3IGXA 4NQ1A 3FFSA 2E09A 3PBUA 2Z1BA 5H2ZA 1FCVA 2TYSA 4FEZA 1D3HA 4JIQA 3GK0A 1OJXA 1C9DA 2Q3OA 3W7IA 3S5YA 4KWWA 1TJPA 3ZFHA 2PRMA 3BPWA 3W88A 4IUOA 4M6VA 3T7VA 5CSSA 1XL9A 1KM2A 1THFD 4Y8FA 3UQNA 3CIXA 3S5ZA 3FJ6A 1JCYA 5KMYA 1WQ5A 1DQWA 4NJIA 3W2JA 1RV8A 3L5AA 1SUXA 3C56A 4R53A 2C14A 4IPJA 4IOTA 3V1PA 3MYOA 1VHCA 2PRHA 1U5JA 3G1HA 3BGGA 3MWAA 4ZQPA 1ME9A 3O8AA 3N2MA 4UR8A 3LBMA 5A5WA 3NPVA 2F7FA 4N9BA 1LYXA 4M6PA 4KFOA 2Y7DA 1F76A 2GVLA 3PUEA 4FX7A 4RK8A 3LTYA 5HNRA 5AHEA 4K7YA 1WX0A 2CZ5A 2W79A 1H1ZA 2OT1A 4JX6A 2J88A 2ZZ5A 2GQ9A 1FQ0A 1I4NA 4DQWA 1D3GA 4IX0A 3LLDA 2J6XA 4WOZA 3TFXA 1GOXA 3AJXA 1FWSA 1L2UA 1LRNA 1RVGA 4LUIA 4OV9A 3W22A 3R89A 4HT3A 5DBUA 2NV2A 1EWEA 2JK2A 1LM1A 3UZJA 3L66A 4JYEA 4O19A 3CIWA 3M16A 3M5YA 4XKYB 3IIXA 3LXAA 5DY3A 1EEPA 3EWBX 4U28A 3C2OA 3NL2A 4FNUA 1OFEA 4O0ZA 4GRSA 3LRKA 4TMBA 4MIMA 4K7VA 1R2RA 3HMJG 3W23A 4JY9A 3MP5A 1F2JA 5C2XA 2EPHA 4P2VA 4AHQA 2W6RA 3NEVA 3W7HA 4ICNA 1LTDA 3K30A 1RQEA 3HIJA 4K8HA 4Z1CA 3EB2A 2VFIA 5HUOA 1W3NA 1RPXA 3C2RA 3I7QA 3VE9A 2GQ8A 5HWMA 3S0CA 3UYCA 5U7SA 3W1QA 5D05A 3G0XA 2WQPA 3GLCA 1K02A 3A24A 3NPUA 1G4TA 2Z6JA 4I7UA 5DELA 4IPIA 3NQAA 1B4EA 2B7PA 3CB8A 2E6YA 4GNJA 1GYNA 2TSYA 1OFPA 2YDAA 2QCNA 4JTHA 1W1ZA 1G7VA 5HJLA 1YLVA 3B8DA 4XBSA 3TAOA 2GOUA 1LRQA 3W73A 1XBVA 3DZ1A 3S5NA 1KM0A 4DELA 3GZ3A 4GXMA 4N9DA 2JGQA 1RZMA 3IEBA 1JUEA 3W7PA 3OVPA 4A2RA 3PY2A 4A21A 3ZS4A 4IMFA 2QCDB 1W56A 1AW2A 1XUZA 4NJGA 4IJBA 1X7FA 3M6YA 2E6DA 3GDKA 1UASA 2E5BA 4PA8A 5I3HA 1SZNA 1SSDA 3LCHA 5T26A 2X1SA 3SSJA 2NX3A 4WJEA 3EWUA 1XKYA 1SZFA 4N6EA 3GVGA 5D03A 5I3IA 1OF8A 1S5WA 3ELFA 4LV4A 2QJIA 5KZEA 2ATMA 3PBWA 2CLMA 3WJZA 3E9AA 3R12A 5DXXA 1PL9A 1YTEA 2YZRA 1VH7A 4LOCA 5I3GA 3BVJA 3DU0A 3B04A 4CNNA 3LM7A 3Q58A 4XBKA 1FCBA 1YXYA 1AL7A 3OA3A 3S42A 1L6YA 4M6QA 3HG3A 5D02A 4ZMGA 3ABSA 4JNMA 3NQMA 3E96A 4AWUA 3EWXA 1TPB1 1VC4A 2VFEA 5EKYA 5K9CA 4M7TA 2RHGA 1EP1A 2NXGA 1PCWA 5EPDA 2BZNA 1SW3A 2AAMA 1TRDA 3A23A 4K39A 3RLVA 1SFLA 3JRKA 1KA9F 1NAL1 3P5ZA 3B4UA 1M7OA 1SR9A 3C2EA 3T4CA 5FF4A 3KVLA 1VLWA 3IIVA 2HSAA 4JN6A 4LVDA 1VYPX 3N73A 5GVJA 3TXVA 3VCRA 3HPSA 3W7CA 5D37A 3UWWA 4EF8A 3R13A 5D2WA 1B9BA 1DV7A 4K6AA 3LTPA 4NX5A 2P10A 1I45A 1GVRA 5EA9A 2A7NA 4GE8A 3WK2A 2FLIA 5CPNA 4FIQA 4ADSA 3OVRA 5LNWA 5FI8A 1TPFA 4JTLA 4YLWA 1LORA 2C13A 3PG8A 4UC5A 1WXJA 3RF9A 1DHPA 3O6CA 3PSVA 1L6WA 2X1RA 4NZJA 3DFQA 4PTNA 3EX3A 3QW3A 1Z41A 1EP3A 1W0MA 4Z0JA 3WJYA 4A22A 5KINA 3FJLA 1X6UA 3T55A 1GZGA 1WOAA 2NLIA 4C1KA 2X1TA 1JJKA 1H62A 2J9XA 1GWJA 4Z1AA 5AHNA 1W31A 5I3FA 3NM1A 2UV8G 5LNUA 4BWLC 3P84A 1SO4A 4FNPA 3S1UA 1KFCA 2EKCA 4RLIA 4Q33A 5FF2A 3TR2A 3GXNA 1T8XA 4AHOA 1KFEA 5D38A 3M43A 4PL1A 1T99A 3N9RA 4Q4KA 3FS2A 1F6PA 1LDCA 1Q6RA 3UPBA 2I9EA 2H3BA 3IV3A 3L0KA 3LHUA 4UCGA 5HWJA 1EB3A 3BO9A 4O1AA 4JTIA 1F6KA 1FWNA 4R7JA 3TMLA 4HNVA 2EHHA 1KFLA 2O7SA 5EMUA 1LBLA 1OYAA 3I65A 3R8RA 1MO0A 3NQ8A 4OT7A 5E93A 1QCWA 2ZTJA 4JTEA 1H5YA 2VEMA 3LXCA 2HTMA 4HIBA 4BI5A 5AB3A 3G1YA 1JVNA 2CZFA 3NZ1A 1L9WA 4YCOA 1P0NA 2J9ZA 1A5CA 3W7LA 2B0MA 3O07A 4ZQOA 3NPWA 3QSTA 4Q32A 3STEA 1K3UA 3DFNA 3S9YA 1EWDA 3QM3A 4WXZA 5FEPA 3G1VA 4WXYA 3LXBA 3GKFA 3TW6A 3EX2A 3DBPA 2QDGA 4EOUA 2BWGA 4L4LA 5DBTA 3THQA 3UY8A 4AAJA 4FNTA 2OT0A 1J2WA 2YCEA 1W5NA 3BG3A 3DI1A 3ANYA 3KVKA 4MLRA 4QITA 1TPH1 3CPRA 1XI3A 3W1AA 4LV9A 3QEZA 3ABRA 1QOPA 3NAVA 1BTMA 1GVSA 5BOOA 3NQDA 2ABBA 4UTWA 4OV4A 5C6MA 1ZHAA 3W7EA 3QMRA 3VE7A 3M1ZA 5F4WA 2FJKA 3DKJA 3W75A 3HBLA 2D73A 1TTPA 1H51A 5IBXA 4AEOA 1A5AA 1RQBA 3O05A 4ML9A 3GNNA 4EVZA 2DZXA 3KVMA 1J4EA 3H53A 4QAIA 4N6FA 1XDMA 3G1AA 4WOQA 2ZZ1A 2QCHA 1JRCA 3LX9A 4CCCA 5KZDA 2C19A 4BK9A 1CI1A 4NU7A 3TX9A 3C8FA 5CGQA 1KBIA 4UTMA 4KKXA 3ZWSA 4BFAA 3QQ1A 4O4VA 3KRSA 2A1YA 3R2GA 4XUGA 3EEGA 4TR9A 4IQLA 2YYTA 4IXXA 3EX1A 1QAPA 2H90A 1YPIA 3B0UX 1O95A 3G0UA 2WJZA 5CZJA 1ZY9A 1YDNA 2ZZ7A 3A21A 3SGUA 3L0GA 4QM1A 3T78A 3VI2A 2P1FA 4O10A 1HL2A 4O11A 4O18A 4X9SA 4FNRA 3C3NA 4HSOA 1PS9A 4K37A 3W1LA 2ISVA 4WY0F 1MZHA 4M7SA 3EWWA 1XCFA 4MOZA 3R5EA 1LCOA 2AGKA 2BLEA 4JXCA 1H50A 2OX1A 2C0AA 2YGYA 2R8WA 3TSBA 3MO7A 3TUUA 3W2KA 3G0SA 3F1QA 3TSMA 1TPUA 3YPIA 5HR7A 1NVMA 4K38A 3E0IA 2VENA 1AK5A 2JKAA 1UB3A 4XTIA 4TU1A 2QCMA 5HULA 2B4GA 1YXDA 4XZ9A 2ZZ4A 1GJPA 1ICPA 2V2DA 1FXPA 4PH6A 1V5XA 2A0NA 4EIVA 1T96A 4IMEA 2QUVA 3A22A 3EX6A 4UMAA 4YWIA 4MJZA 3JS3A 1WBHA 3W1NA 3W07A 1JUBA 3A5FA 2ZTKA 1A5BA 2BSLA 4DPQA 4AF0B 5BMXA 4O4WA 5LNSA 4HKPA 4UTHA 5FEXA 4QQ3A 4CNOA 5EYWA 1SW7A 2Y85A 1WV2A 4AB4A 4FXRA 1W5MA 1GEQA 4UFHA 1SQ7A 4UTIA 3LV5A 2TPSA 4JYDA 4LS0A 5F2LA 4X2RA 3TK7A 3C6CA 4OU1A 3W2LA 2LLEA 1UCWA 5F4XA 4LRTA 2GJNA 1EPXA 1G7UA 1SO5A 4JEQA 1KFJA 3HGOA 2HS8A 2QKFA 1H60A 3TJLA 3B03A 2V5LA 3M0ZA 5F1UA 1W3TA 2NXHA 1P1XA 4MUZA 1GVQA 2TRSA 3TIMA 2ZRUA 2GVGA 1BWKA 4O15A 5G2HA 2A2IA 2Q8ZA 1H7NA 4M5PA 1F73A 4XWUA 4CCEA 4I9AA 5C54A 1ONRA 2H8ZA 1K8XA 2V2CA 2WOQA 5HMSA 3GYEA 2RFGA 4D2JA 4DEFA 3BW3A 3NL3A 1OFDA 3CEPA 4KWVA 3SZ8A 2NWRA 2YFNA 3Q94A 1N55A 5I3KA 3NA8A 2FDSA 1DVJA 1WOBA 4MY1A 4DBDA 2J24A 1HO4A 3WFAA 3P7YA 5LZLA 4K36A 3HG2A 1S5TA 3V75A 5CSRA 5HINA 5K4XA 3MI3A 1ADOA 3MW7A 1TTQA 2VEKA 1H61A 3W70A 3USBA 5E1QA 3FOKA 5D2TA 1FDYA 4UFMA 1X1ZA 2X16A 5I3JA 1TV7A 3PUOA 1TIMA 4ZQCA 3HOJA 4JTKA 3TAKA 1G69A 4CQAA 1IGSA 2V0TA 4UNKA 4Z0SA 2QF7A 4O16A 7TIMA 4LY8A 1LOSA 3U6WA 3U2OA 5KTLA 3EX4A 3QF0A 3NNTA 3P62A 2C16A 1O5XA 2Z6IA 4JTUA 3TKFA 4MKNA 3W2UA 3NQ7A 5KZMA 5F2GA 1HO1A 1I2PA 1EA0A 3BW4A 2DP3A 3FEMA 4CQ8A 3OVQA 2H6RA 4IMDA 4S2BA 1S3HA 2VXNA 3W1RA 2OMAA 2H3DA 3L21A 2X30A 2CLHA 3GDTA 1DJQA 5AC7A 2CLEA 3BK0A 4PEKA 3IVSA 4MFEA 2FPYA 1JRBA 1OF6A 4B5NA 4ZL1A 1F05A 2V82A 4ZQNA 3OHIA 1LBMA 3O1NA 3IIZA 2FIQA 1NSJA 2ZDRA 5FEWA 4OHQA 1IXNA 5CZTA 4AXKA 2PC4A 3BLIA 3LLFA 4O1DA 2ZRYA 1P5BA 3L0NA 1ML1A 1PV8A 3E12A 1TB3A 2QCFA 1HUVA 3FA5A 3G1SA 3KRZA 5TIMA 3TA6A 2RH9A 2Y88A 2CLIA 1OX4A 2C1HA 1ZENA 3GKAA 1YDOA 1YDVA 4LRSA 5LNVA 3P8JA 3W1XA 3LB0A 1H7WA 4TMCA 3D0CA 1W37A 5CPMA 1XXXA 4E38A 2QEZA 2WSRA 2JKPA 4JDBA 1SSGA 1QWGA 5CPLA 2JGYA 3PWAA 2YPIA 1PHWA 4FF7A 3GAYA 1SU5A 1ZJIA 4UIOA 3TW7A 4GUHA 2Z0IA 1NFBA 2RDWA 1IXPA 4BI7A 3MBDA 2DZVA 2DZUA 4U4MA 2G95A 3UZ5A 1VGAA 2XN2A 1TJRA 1QNVA 1VQTA 5AHIA 1I2RA 1YTKA 4H6KA 1EUNA 3KX6A 4HPJA 1LLWA 1FCQA 4K8EA 3G1XA 1X8FA 3FYPA 5D2XA 3P60A 4UTJA 3TDFA 3W9ZA 3NG3A 1H7PA 2I1OA 3NXFA 4UXDA 4QNWA 3I7RA 3OIXA 4BWLA 2PCQA 4R33A 3PB0A 3W7DA 4OQVA 5G2WA 4O0KA 1VCGA 2FQIA 3QW4B 1OFBA 3SGZA 3EWZA 2ZRWA 5D09A 1KTCA 4O13A 3SECA 3QPZA 3UPWA 4RR4A 1VYSX 1J5TA 1F74A 1FCUA 4QSHA 5C5YA 5J5RA 3NZRA 1KLZA 3L2IA 3W71A 3MHGA 3G8EA 1R2SA 3BW2A 1FY6A 2ZA2A 2ZFAA 3GXPA 3W2NA 3W7JA 3RU6A 4GUGA 2E77A 3QJAA 1OFRA 4NNCA 1VCVA 2J27A 3O06A 1GPWA 1MXSA 2VFDA 3G3DA 3HB9A 3G1DA 4R34A 5DCBA 3IIPA 3UWUA 4LT9A 3PR2A 4Y96A 1SZGA 3PG9A 1HG3A 3KXQA 4N9EA 3PB2A 1FWWA 2NXIA 3TE9A 5K7JA 3W74A 1VHNA 1YYAA 3P80A 2FB2A 4HN4A 1XFBA 1W8SA 2QCEA 3CEUA 5D2VA 2GUUA 2ZYFA 3MP3A 1G6CA 4FX6M 1KFKA 1TMHA 2V2HA 2KZHA 1D9EA 2A7PA 1JQXA 4OWGA 1PE1A 3DH7A 1IF2A 3HGRA 5AHMA 1ME8A 3TROA 2NUXA 3W3OA 5D32A 4GBUA 4YXGA 3TU9A 2PE4A 1KBJA 3W7QA 3EKLA 1M7PA 3TC7A 1Z42A 2G96A 1K8ZA 2NWSA 1KTBA 3QSRA 3PF3A 2V30A 2VOMA 2B7QA 4ALDA 3FLUA 4NT0A 3UD6A 3G8RA 3QMSA 2EAWA 5AYXA 2E6FA 3PBVA 3GDLA 3LI1A 4O14A 3STFA 3W84A 3WK3A 4CQ9A 1TPC1 2C18A 2Z2UA 4UFLA 3T44A 3W7OA 5CKSA 4HPXA 3SR7A 1SO3A 1WA3A 4LVGA 5HR6A 4DO4A 4MYAA 1KM4A 3W1UA 1H1YA 8TIMA 2DU2A 1OFQA 1Q6OA 2BTMA 2XFWA 3LRLA 2CW6A 3TSDA 4UMCA 3O63A 5AC6A 3QZEA 5D33A 1XM3A 1ZALA 3WJSA 1RR2A 3LHWA 5CZSA 1A53A 2HMCA 3CTLA 4S1FA 3WJXA 4ZVJA 3FYOA 4QJ1A 1PVNA 1AW5A 3GNDA 2RDTA 3BG5A 1CX9A 2VC6A 4DF2A 4RV8A 4O8RA 1GYLA 3W72A 1TREA 3HGSA 5TBOA 4AVFA 3M9YA 3QH2A 3OBKA 3KRUA 3P61A 1KM1A 1CW2A 1VR6A 2ZRVA 3P81A 4N4QA 3S1WA 3GR7A 3NOEA 1JULA 1M5WA 2CZEA 4OE7A 2QJGA 4GJ1A 2FPVA 3PAJA 1SFJA 3MP4A 3L67A 4O28A 3LHTA 4FX8A 1IIHA 3WK1A 5K3VA 4JYFA 1OK4A 3THAA 2E5DA 3NR0A 3S8HA 4O1BA 4DPPA 2ZRXA 5BRBA 3DHDA 2E1DA 5D30A 2NX1A 3P82A 4LVBA 2Y70A 1VRDA 4NNBA 1GTHA 2VEIA 2G5WA 3ATZA 2A6LA 5EL1A 3UWYA 4PL2A 5TQLA 1RQHA 4NJJA 3GDMA 4AWTA 3O6YX 1LOLA 2NUWA 2AQWA 4LC8A 4FB7A 1JCMP 3UWZA 5LHFA 3P67A 3WJWA 1QDSA 3NGJA 4MYXA 3W1PA 3C0JA 4JX4A 3C4UA 5D04C 4N9CA 4UFIA 4MY9A 3LCXA 3S6DA 2DZTA 5F4SA 1TYGA 1TQXA 2ZA3A 4TX9A 1I8JA 4MZ1A 1A5SA 1OX6A 5FESA 4JTGA 1KV5A 3HGJA 4JDYA 4UTTC 2A6NA 1LRTA 4HNUA 4JIPA 1LZOA 4AHPA 3PC0A 3QFEA 5DCEA 5FF0A 4RX0A 3NM3A 5AYZA 3BLEA 4XTDA 3G22A 2RKXA 4C1LA 1OFOA 3UXAA 1QPNA 4MLJA 3ABOA 3DFOA 2Y7GA 3L9CA 1B4KA 3JR2A 4NNAA 1GVOA 3P8IA 3CC1A 1Q3NA 3DAQA 1LP6A 2QJHA 4BF9A 1SZEA 3NQGA 3ZWTA 3MI6A 1XC4A 3LHZA 2VELA 1X1OA 2JBMA 2WSQA 3HPXA 1B3OA 2W0UA 1GQNA 2CZDA 3HG5A 3G24A 1ZNNA 1DOSA 2Q3RA 5D2YA 2WPBA 1H7RA 1WBJA 3ATYA 4IX2A 2CLFA
chains in the Genus database with same CATH superfamily
5D8WA 1PJ9A 2DIJA 4QQUA 5HWNA 1DJXA 4Y2WA 4Q8OA 2YX0A 3LHVA 1JEZA 1QO2A 1W1A1 2BY1A 1M6JA 5TNVA 3N2CA 3LEPA 3K2GA 4ATDA 4R7OA 1WAUA 3LCLA 4MY8A 3M41A 5JVLA 4U5KA 4I3GA 2ZUWA 4FIRA 1VEMA 1I2OA 3LOTA 2Z29A 5DEZA 1W9UA 2D24A 4GY1A 1KKOA 4W5ZA 4GWEA 3CLMA 3HG4A 2HE5A 3LRMA 1GQIA 5A1AA 1NELA 1UG6A 1G4EA 3F5KA 3S1XA 3MSYA 2FB3A 1E51A 2XH0A 4WCJA 5CPOA 1PYMA 5H8MA 3RR1A 1HKMA 3UR5A 2X7VA 4KPLA 1EFZA 3L4VA 1I6NA 1HTIA 2IPJA 1R2TA 1HKWA 4TQTA 4F79A 3ZZ1A 3K8LA 1IR2A 4GISA 3EDFA 1JF5A 4RZ6A 3OQ8A 3UWQA 1F7BA 2CHNA 4GNKB 1IR1A 5A6TC 3I7SA 4OBRA 4HU3A 4G7EA 3V1HA 3CQKA 1S2AA 3R94A 4DJEC 1K7EA 4WQ6A 2BVTA 3LQGA 3W53A 1WZMA 1BVNP 2CEQA 4PC8A 1B54A 3OG3A 1YNPA 1AQHA 2DW6A 2UY2A 4H9ZA 4JTFA 4NZ4A 3NDOA 1B9ZA 2YDSA 3NDYA 4N7QA 4PTVA 5HQEA 5E0CA 5IHRA 4GMEA 1W9BM 3AYRA 3N9SA 3LHYA 3GAKA 4LUJA 4OGZA 1EP2A 2F9RA 4CNTA 1FA2A 2XJ7A 3KM8A 1QW7A 5CLTA 3WF2A 3QPYA 1IT0A 3RFAA 3B0VC 1YTDA 5BNKA 4B15A 5BW6A 3K46A 1VS1A 4OVXA 1TSIA 2I9UA 4A6GA 1CGTA 1VFLA 1L8PA 3SN4A 2H9AB 3N12A 4JGDA 2GPTA 5HAOA 4L9XA 1QPQA 1XP3A 4JTSA 1UKPA 1CECA 1V6UA 1O4UA 3KBMA 4HK6A 1ZCOA 4DM2A 3GXMA 2WNQA 3T2OA 3SFKA 3TC3A 4UZUA 2Y7FA 2DZBA 5AZ1A 1ZAHA 2VRQA 3L5LA 1XIDA 4LWWA 2FZMA 3QOKA 4POCA 2HCVA 3IJIA 1BEUA 3ABZA 4AZ6A 1JCLA 2FH8A 2R14A 4WY0B 6A3HA 4HP5A 1MNZA 1Q6DA 4L1WA 5CAHA 2PDYA 3K1DA 5A8GA 1KGXA 1NDVA 2NVCA 2HS6A 3UCDA 2NQ5A 3M47A 4JTTA 2C15A 4D6CA 2FVKA 1NQ6A 2ZZ3A 4CKQA 1VLIA 1AQMA 3VU2A 4ROQA 2GQ3A 4JPGA 3WLQA 3GRIA 4KFNA 1W8GA 4GI6A 3F2DA 4PFHA 3G1FA 1R7OA 3RCMA 4FSAA 2NUYA 1A80A 2ZRZA 1IE7C 3N2XA 2ON3A 4NZFA 1ISXA 1IIGA 1W3IA 4CNPA 2DJXA 2PZNA 2Z00A 4LU0A 4WKFA 2ZX9A 2X40A 3H6OA 1AH4A 1WYIA 2PWDA 1K7XA 4P7QA 1N7KA 2VX4A 1JDFA 2J9YA 3ZVHB 2C6QA 3EDKA 2ZXQA 5SWUA 3VIMA 5EMYA 3T8LA 3TV8A 1K03A 3VVGA 2P3ZA 3R6IA 2OCZA 2PDUA 2VFHA 3W76A 3F4CA 4JQAA 3STGA 1BWLA 3C0QA 3CGTA 5B7YA 3VKJA 3UXDA 1SPQA 2XYLA 1F8IA 1V3KA 1A0CA 3B0XA 4MJMA 4P61A 1KR0A 1V3LA 1EF3A 1FWIC 4MPQA 1D3CA 3O9NA 1C90A 2V6AA 1C29A 5AYBA 4E0CA 4F2BA 4GO8A 4J7RA 4IF2A 1E9LA 4H6EA 2XVNA 2XVLA 3UT0A 3TCEA 3AIRA 5BU9A 3TQ0A 2Q8LA 4A2SA 1RP8A 2Y61A 4LAOA 3KS5A 4RV3A 4AISA 2BGQA 3I4EA 3KWXA 1HT6A 5A3HA 3WF4A 4LUTB 1FWGC 5A69A 3HQOA 5B80A 4Y8EA 5T9CE 4IPLA 4GGHA 3L4ZA 4E2DA 4I7VA 1UA3A 2D22A 3M7WA 4YN5A 3FIGA 1Z48A 3MMTA 4CVWA 2QUUA 2E4TA 2OZTA 1FUYA 3U8GA 7TAAA 4HZ6A 1YADA 2X8RA 2POTA 4NZCA 3N34A 3LCGA 1M01A 4PODA 4KFPA 3GY1A 3F4DA 3HU7A 4FOKA 1EDQA 1X8CA 2WC4A 1EIBA 3LERA 1HN1A 2WB5A 4NXKA 4Q7BA 3W82A 4JNYA 3NUKA 1CXFA 4F0RA 3CQJA 1O1ZA 3QGKC 1PTGA 1W9DM 3W83A 1VEPA 3VFCA 1DKWA 1V6WA 1W5OA 2JF6A 2IQTA 1AW1A 4JIHA 1QBBA 4LUSB 1E3ZA 4DUXA 3GNOA 4AZ7A 2J13A 4O54A 4UR7A 3TYCA 5IDZA 3GU9A 4JHZA 1B57A 2ZA1A 3F4NA 3H4XA 1O5KA 1HJSA 3ONCA 4H9TA 4KRTA 2PTZA 3TFCA 1NF0A 1U30A 1JR1A 3V3WA 3AUOA 1I0BA 4J3UA 3PUDA 2A7RA 1EBHA 5G4EA 3MKCA 1QK2A 7PTDA 3MZNA 1EQPA 1U83A 5DLCA 3Q45A 1HJUA 4ZB5A 3PWGA 1PIFA 3WQ5A 3AI0A 4PSPA 1F5ZA 4NZ5A 1XD1A 3VZZA 1W5QA 1XH2A 1ZL1A 6XIAA 4HA1A 4E8DA 1R9XA 2EEXA 2EPLX 1J6OA 3FGCB 4MHBA 4FMVA 1A4LA 5JUVA 2ZUTA 3NTYA 3M0XA 1P0KA 3UG4A 2J7FA 3QRHA 2CYGA 3BLFA 4W87A 4FO4A 3PTKA 4X3ZA 1HVXA 4DM1A 5F1VA 3B8IA 1F9CA 4V1XA 3XISA 4AF0A 3E49A 1XLGA 3EOUA 4AMAA 3RLHA 5BXPA 2WV8A 3UNTA 2WNZA 3BE7A 4MAZA 4DUWA 3BAJA 1EHAA 2QT3A 2VGBA 3ALGA 3IUHA 4U3AA 5IBXC 4GZ7A 1EHNA 3UNDA 5E9AA 3ZLFA 3ZT6A 2PTYA 2WNNA 4Q4MA 2R91A 2F84A 6TIMA 3NYZA 4MJ4A 4ZQRA 1KM6A 3H54A 1W1TA 3AZRA 4H8UA 1D7FA 3FX4A 4HJWA 5E9XA 2I16A 4ZOEA 4IICA 3TXZA 2OTDA 3PBYA 2PWHA 2HROA 1BG9A 2HZGA 2YYUA 4H83A 4NASA 1JZ5A 4IIDA 2VRKA 2P3EA 1E1CB 2FFCA 3GWQA 4NRSA 1AD1A 4NQ1A 3R8GA 1TWWA 1OCJA 3DN5A 3WQGA 7ENLA 2Z1BA 3MDUA 8XIMA 5H2ZA 5CEWA 4UTFA 2IXUA 5REQB 4F3HA 1DXEA 2XVPA 2FMNA 5A6LA 1LL7A 3QR1A 3EAUA 2Q3OA 3W7IA 1TJPA 1EJSC 1P48A 3BPWA 4ZO8A 1GKPA 3FY1A 3W88A 3CL7A 3SY8A 1UH4A 3VOIA 2D0HA 1THFD 4Y8FA 3CIXA 3ME3A 3S5ZA 3VIGA 1WQ5A 1DQWA 4KRZA 3ZJKA 1V3MA 1EC7A 1FP8A 1RV8A 3C56A 1VFTA 4QCEA 4NG3A 2XM2A 4GVFA 4GKLA 1IT8A 3LBMA 1EQCA 3EGJA 3VGBA 4C6MA 1LYXA 4Q4PA 5HMEA 3M6DA 4KFOA 1EJXC 2GVLA 5HNRA 3VKKA 4AY8A 4ECLA 4B5XA 1GOWA 2W79A 4JX6A 2A3AA 2ZZ5A 1XRTA 2WC3A 3VD5A 4FOUA 1TA3A 2JEQA 1FHVA 3FK4A 4XZMX 3GU2A 4IX0A 3TFXA 1HKJA 4H00A 5CC3A 2VGFA 4GVHA 3D3AA 2JK2A 3CUZA 3N4EA 1LM1A 3WD2A 4O0QA 3L4YA 1UD8A 3M5YA 1LJYA 1J2BA 4HYVA 1YBQA 1SJDA 1CGWA 3LXAA 2X0SA 3NL2A 1MFVA 1X96A 2PTXA 3AUJA 3S1GA 2R82A 3KS6A 1AD4A 1WDDA 4MIMA 4XZIA 4JY9A 1S3TC 1F2JA 2DT2A 2EPHA 1T5AA 2W6RA 2G3NA 1E72M 3DG6A 2HV5A 3H7VA 4OUEA 5H1WA 4CD8A 1B2YA 4K8HA 4Z1CA 1X98A 1SGJA 3HV8A 2VFIA 2FH6A 3MU7A 3C2RA 1K9DA 5HATA 3S0CA 5HWMA 4B92A 4PZVA 3AZTA 3NPUA 3WQWA 3WFLA 1YDYA 2FGBA 2NVDA 3I3DA 1ZLPA 1HL8A 1SMAA 3CB8A 3QOMA 5HQMA 1OG6A 2E6YA 4I5UA 1OFPA 2QCNA 4L5ZA 2VVNA 3MT1A 4EX4A 1WPCA 4XBSA 4HTYA 2INFA 5DX7A 1E9IA 4DB7A 3DZ1A 3S5NA 1KM0A 3BOXA 4GXMA 3LPGA 1XYBA 4URIA 2J66A 2PLKA 3SCRA 1RZMA 5C7VA 4IMFA 5C8BB 1VPQA 2QCDB 1W56A 1XFCA 4JL1A 1BVWA 4HU0A 4KH2A 3M6YA 5I7GA 4D6HA 4PA8A 1M7XA 1CT5A 3LCHA 5T26A 5HOSA 1OB0A 2J75A 1BFNA 4JAWA 4ACYA 1XKYA 4F0MA 1XR2A 3WLIA 5I3IA 1X38A 4W8BA 2QJIA 3BAWA 3PBWA 4XUYA 3WJZA 1BXBA 3R12A 4Z2GA 1PL9A 3UJ2A 3UCQA 1OT2A 3B04A 5A2BA 3Q58A 4XBKA 3T2QA 1WB0A 4HQVA 6TAAA 3ABSA 3HTWA 3EWXA 5D9PA 1R3QA 4IP5A 4IQDA 2ACQA 1XYFA 3P5ZA 3VIIA 1UWIA 4B9YA 3FVDA 1ESWA 1VLWA 2AKMA 4JEJA 1VYPX 1ZS2A 2YCLB 3VUSA 2Z27A 3VCRA 3HPSA 1CGUA 5D37A 1W1B1 5FOOA 3R13A 5D2WA 2G8ZA 1DV7A 3PFRA 1I45A 4GE8A 3SCWA 4ADSA 2A3CA 5IHSA 2ODOA 1U5VA 3KHDA 2C13A 3PG8A 5AECA 4TX6A 4UC5A 3ABXA 4CN6A 2WSPA 1XLBA 3EWDA 1V08A 4YPJA 3DFQA 2HEJA 2GGGA 3WJYA 4Z0JA 2E7FA 2X7WA 3VMNA 3GFXA 3KDNA 3FJLA 4HYWA 3B8WA 4C6CA 3ANUA 2NLIA 4DJFA 2X1TA 4D6FA 2J9XA 3M46A 3E0WA 2VR4A 3MA8A 1W31A 5I3FA 3IACA 3S1UA 2EKCA 4RLIA 3H70A 4AHOA 1GORA 4YHGA 3M43A 2G3MA 3NO1A 2W9MA 1T99A 1DE6A 4Q4KA 1Q6RA 2I9EA 2QMKA 5HMDA 5I00A 1EJ7L 4UCGA 5HNTA 1R0MA 4L7ZA 1EB3A 3WQDA 3BO9A 1F6KA 2WZHA 3RRXA 1OYAA 3R8RA 3AYSA 4WGXA 1MO0A 3TTEA 1PUDA 4OT7A 3KZPA 3VZXA 3A12A 4NRRA 1ITUA 2HISA 4PSRA 2CZFA 4MF4A 3BJFA 1R38A 2PWGA 3RM9A 3W7LA 5I06A 3NPWA 3QKEA 4AIUA 1ZP4A 3ID7A 4ZO7A 1H0IA 1EWDA 3R0DA 4FXFA 1UZDA 5CAKA 4I5XA 3OVGA 3R79A 4GIRA 2YIHA 4OUIA 2OT0A 3WH6A 1J2WA 1W5NA 3WD0A 1BXNA 1Q8AA 4Q4RA 3BG3A 2XH4A 4I5RA 4KCTA 4QITA 1TPH1 3CPRA 1XI3A 6ENLA 2VT0A 4WF7A 3NAVA 3ITYA 3HQPA 4HNOA 4NHVA 4UTWA 5C6MA 3QMRA 4K8GA 4DI9A 2FJKA 2AQVA 2DZXA 3KVMA 2I17A 4QAIA 2XZ7A 3UXKA 4YTRA 1VRXA 4QLKA 1CXLA 1JNDA 4QG6A 1QHOA 4MKSA 5KZDA 1DWGM 3BICA 4BK9A 4AC1X 4NU7A 3NGFA 4HOZA 2V5KA 3SO7A 3ARPA 3IANA 3QQ1A 3KRSA 2A1YA 2XH2A 1ZJBA 4Y9PA 2PA6A 4IIEA 4XUGA 3EEGA 2I7GA 4IQLA 3CUHA 1DIOA 2YYTA 3M0HA 3EX1A 1JPIA 2V3DA 3C0LA 4L9ZA 1EJUC 3WF0A 2WJZA 3WO8A 3WIJA 3VI2A 3AXKA 3CIVA 4FNRA 4HSOA 1N82A 4JFVA 3W1LA 4M7SA 1UYQA 3EWWA 2VC7A 1VBUA 3WDHA 3R5EA 6XIMA 3BMXA 3CH9A 4CVUA 4LALA 4UOZA 2C0AA 3SCQA 3TSBA 1WDPA 1TVNA 4I9MA 3S2MA 1NVMA 1BAGA 2ACRA 2Z1XA 2JKAA 1PZ3A 3SCOA 2O0TA 2QCMA 4DNMA 2B4GA 4XZ9A 4DZ5A 2V2DA 2ZX8A 1FXPA 5IOBA 1FHLA 1Y65A 3BTNA 2Z24A 4B9ZA 4C7GA 4IL2A 1UMYA 3JZUA 4BKNA 4HHMA 2WC7A 4H9UA 3UG8A 3SAZA 3W1NA 4B5VA 3CWHA 3A5FA 2BSLA 4DPQA 4UTHA 3L7RA 2VO5A 3GXFA 4D8ZA 1CB2A 4JTAA 3CHFA 3DYMA 1MW1A 4AUBA 3VKAA 2LLEA 1UCWA 4LRTA 1EPXA 2FYMA 1G7UA 1O6IA 4E8GA 3P3BA 1KFJA 4LAZA 1ZP3A 4Q8QA 2NXHA 1P1XA 1E6XM 4MUZA 3TIMA 3KCJA 3E1F1 1KQZA 1AODA 4M5PA 1F73A 4XWUA 3AIEA 3WKZA 3ONBA 1ONRA 4V33A 4QLLA 2WOQA 4DWDA 4D2JA 5HQLA 1EA9C 2VM8A 4HZ7A 4EP8C 4KWVA 3SZ8A 3EYPA 3UA4A 1YPXA 1KBKA 4HU4A 1N55A 4XD6A 4XSMA 2R1KA 4DBDA 3KLLA 1HO4A 4K36A 1UD6A 3TOYA 1TE1A 2L5HA 2PDQA 3ZR5A 5K4XA 1TTQA 1H61A 2PGRA 4QDWA 1Q2SA 1RPKA 3FOKA 3QTGA 1FWAC 5I3JA 2DSWA 5ABHA 1F61A 1TIMA 1EJVC 1WZAA 4CQAA 4NAFB 4MG4A 4O16A 2HVMA 1K4GA 1LOSA 3U6WA 4LSBA 1BF6A 2Z6IA 3ZYZA 1HGYA 5DT5A 1XF0A 5F2GA 1HO1A 3U57A 1EA0A 1R3WA 3FEMA 3OVQA 2NQJA 1UIPA 2BHYA 2PEVA 2F38A 2OMAA 1DYSA 3KOWA 3ZJ7A 2PODA 4G1NA 2AGTA 1W3KA 3PJWA 4MFEA 2FPYA 1D2KA 5A6MA 4S3FA 4MWAA 4CCZA 1LBMA 3S4TA 9RUBA 1NSJA 2X41A 1AMYA 4CD7A 3UXLA 3VNJA 3GXDA 4AXKA 1LQ0A 1TVLA 3CAKA 3BLIA 4Z2KA 3KBJA 3LGDA 4O1DA 2ZRYA 1P5BA 3QYSA 1QPKA 3E12A 4J4KA 3ANVA 3TA6A 2RH9A 4OFCA 2Y88A 4PGLA 1SZRA 3GKAA 1CGYA 2G3FA 3OHMB 1YDOA 2UWFA 4A8RA 5MKGA 4WEVX 3D0CA 3BQ5A 2VCBA 2PWVA 1CCWB 5FSEC 1E71M 2WSRA 2JKPA 4ZOAA 4JDBA 4HN8A 1QWGA 1BPLB 3SCTA 1NJJA 3GW0A 1XH0A 2YJQA 5CPLA 4MKVA 1VP5A 5E5CA 2JGYA 3PWAA 1PHWA 4XVEA 1RA0A 3GAYA 3TW7A 4GUHA 1LLOA 1G9HA 2RDWA 2PDPA 2XM1A 2R24A 5EMLA 1HP4A 3DFHA 4U4MA 2I57A 5I2UA 5C2GA 2G95A 3OIHA 1U2YA 5AHIA 2VZSA 4HPJA 1LLWA 1UOKA 1VB9A 1XYLA 3BSMA 5XIAA 5BRPA 3A6OA 1WP6A 1V0LA 1WKDA 4UXDA 3AXHA 1SR0A 4CQBA 4R33A 3AU6A 3U2CA 1FH8A 4OQVA 4AC7C 2PWEA 2PMQA 3ITVA 2PP3A 4O13A 3N1AA 4ZEPA 3T05A 3SECA 1GZ1A 3CAQA 3QPZA 3UPWA 4RR4A 1H3GA 3RCYA 1KLZA 2YXOA 3QXBA 1LUCB 4LYQA 3G8EA 1JPHA 2QUNA 3O0FA 3BW2A 1V6YA 3DYPA 1W1YA 1W91A 2RGLA 4C90A 4BA0A 1GOQA 1OFRA 3TN6A 2VWSA 2J27A 3H24A 3QY6A 4HMDA 1MXSA 2J25A 1QTWA 3G1DA 3RDKA 3PZOA 1JPDX 2XIIA 3PR2A 4YS1A 3ZT5A 1SZGA 1HG3A 3F2BA 1S39A 3IAQA 3ZIZA 3P0WA 1YYAA 2SFPA 1XFBA 3UZXA 2QCEA 5D2VA 1RLDA 2ZYFA 4FX6M 2CKSA 1KFKA 2YLAA 4QEEA 1HJXA 2KZHA 1JDEA 2XZ9A 1JQXA 3DH7A 3UCCA 3TROA 1UMLA 3AHXA 4WHBA 4WRHA 1H2JA 3EPOA 5H6HA 1S2WA 4YXGA 3TU9A 4RNIA 1XJBA 1IEXA 2CWXA 1V02E 1XLCA 3B9NA 1NWTA 3AXIA 4IFRA 2VOMA 2NSXA 3TQPA 4A35A 3FLUA 4BQ3A 3QMSA 4CD6A 3SBFA 1J0YA 1KXTA 4MB1A 5AYXA 3GDLA 3STFA 3VABA 1XRVA 4H7CA 3AU2A 3WK3A 1NWRA 5C9RA 1TPC1 3WBAA 5CKSA 1C7SA 3SR7A 2JEPA 5I3DA 1ITQA 3O0KA 2XDFA 4N42A 4MYAA 4DIAA 5ABFA 3W1UA 4EKJA 1Q6OA 1VFSA 5D33A 4ZFMA 3BMVA 2A79A 3LHWA 3OLDA 3K1GA 3N6HA 4LFYA 1RY8A 4ZR8A 2DZAA 1VBGA 5BRQA 4XZHA 3FYOA 2G4FA 4EACA 4C1NB 3GNDA 1AW5A 2RDTA 1FKXA 3BG5A 2VC6A 4IIFA 4JHMA 4TX8A 3HGSA 3BL3A 1O1HA 4W7VA 2O9RA 3K4DA 2OQLA 3QH2A 3KRUA 1CDGA 1KM1A 1EPVA 4GH1A 3NOEA 5EU9A 3W02A 3CHCA 3MP4A 3L67A 1IIHA 3WK1A 1N8WA 3THAA 1KQYA 5T91A 4DPPA 5BRBA 3B8TA 1HKVA 4LVBA 3CQIA 4NNBA 3SADA 4H2HA 2A6LA 2BY0A 4LAKA 3WQ4A 3ARRA 4AD2A 5A8QA 1UKSA 3GDMA 4AWTA 3V5OA 4FB7A 1FWEC 1JCMP 2CXGA 3W1PA 2HPIA 4YHEA 3GDBA 1F6YA 3A4WA 3S6DA 1OCBA 1PX3A 3VNIA 5CXPA 1TQXA 3TN5A 3GD6A 3WH7A 1GEHA 5JXQA 4MZ1A 3F7JA 3VNLA 1QHPA 1KV5A 2R6OA 3HGJA 4HCHA 4IUGA 1G94A 3WLLA 4NAEB 3EEZA 5LYRA 3HURA 1DIKA 1QASA 3UP8A 3C2YA 5A94A 1UROA 4HNUA 4BJHA 2XGIA 3PC0A 5PTDA 4RX0A 1GJUA 4JFUA 4DXKA 4LBRA 2GZXA 1S2UA 1IZCA 4C1LA 4Z1YA 2V5JA 1RJQA 4MLJA 1GK8A 3OP2A 1B4KA 3JR2A 3GUWA 3CC1A 1JF6A 4NYUA 4KEVA 4BF9A 1E1FA 3ZWTA 2VELA 2JBMA 4XZNX 2BDQA 4WDTA 3KP0A 2W0UA 3M64A 3RITA 3H7UA 1ZNNA 1UZHA 1CGXA 3NSXA 2REQB 3U5YA 1BRLA 1WBJA 4XV0A 2OG9A 4IX2A 2CLFA 3DDMA 4H9VA 3LPOA 2X42A 4RCXA 9XIMA 4JD4A 3T40A 1R3YA 2FHBA 5FF7A 3GNXA 1T7LA 2HNEA 3AO0A 5GQBA 1EX5A 4HJFA 3VFLA 4S3AA 3PZNA 2WSYA 1QU4A 3CYVA 5CZ0A 3ZR4A 1KV8A 1E6PA 1ZAJA 1IZJA 1N8IA 2GUBA 4TO8A 3WUBA 2DVXA 1PB0A 5CCZA 4KWOA 3QVQA 1XYZA 3TONA 1TPEA 5FJRA 3BC9A 4LCRA 4EXBA 5C9ZA 4ZSTA 3GNPA 3W7KA 1GTEA 3UY7A 1XSJA 4XKYA 1C92A 4LAMA 1YW1A 4L61A 4NSBA 2OZ0A 2V81A 3H2NA 4R85A 1XLHA 1MEWA 3MY9A 4S3DA 4LS1A 4B91A 1G67A 3KOFA 3O16A 2IKJA 1FOBA 3E6EA 1DWJM 4AZGA 4QE4A 1OM0A 1H7XA 1EKOA 2WHKA 4Y9OA 1HKIA 3UGVA 1P6BA 5DMLA 1RBOB 2A3BA 1VJIA 4I7WA 3HN3A 4QISA 3VNDA 5BOFA 2FTPA 2Z7GA 4G1KA 1ZFJA 2RUSA 2OOFA 3GIYA 4R27A 1VYRA 3T08A 4HSNA 4RL3A 2ISFA 1A50A 3NL6A 3RXZA 1TTIA 1ONWA 3VD9A 4CLMA 1Q45A 4Y9NA 5BXRA 2ALDA 5DY2A 1PWLA 3II1A 3E3HA 8CGTA 3PVFA 4Y90A 2RAGA 2WKJA 2GK1B 2YA2A 5LHEA 4J9JA 4WDXA 1OYBA 4F40A 1LOQA 3AICA 1WE5A 3SJ3A 1VCFA 2WVVB 2J8GA 1EXBA 4WY0A 4L9YA 3W7NA 2DORA 2YKKA 2ZX5A 2JKEA 2GGEA 1XH1A 3F2CA 2FPTA 3O6DA 1GQKA 1XQLA 2A85A 4DHGA 2WM1A 1UUOA 2PPGA 1ZRQA 4YMZA 4DYKA 4Z2IA 4MVAA 2V38A 1QNQA 1E1EA 1IGWA 2YXGA 3OW1A 1TQJA 4G6CA 2YW4A 1J79A 1PYFA 1G5AA 1OADA 4L80A 4TVDA 3WF3A 4ACZB 3EKZA 4H3DA 3DI0A 4F0KA 1CZ1A 3WNNA 2HE8A 1R46A 3M5VA 4C6NA 1BQGA 3IIOA 3MYPA 1J6PA 1VBJA 3GC4A 5E70A 1IXQA 4H7VA 1NY1A 3VD3A 4M29A 2ONEA 4DUOA 4NJKA 3UR8A 1XIIA 3M0YA 4HOWA 1Q6LA 3D6NA 1VIWA 4OBTA 1JQVA 4NZ1A 4LCSA 2HVNA 1ALDA 2E6AA 3NVTA 2E5CA 5AFDA 3LK6A 3MUZ1 4V28A 5G1YA 1E0XA 3ECQA 5I24A 4NI3A 3N3TA 1P6CA 1UR4A 3IVTA 3TYDA 2D3LA 1Z44A 1A3WA 1CYGA 3WDRA 1GG1A 3PZTA 4PYSA 1OX4B 3W7MA 1UWUA 2BODX 5E0KA 2Y6ZA 4R3UA 1S38A 4Z1BA 4QROA 4PRWA 4L6OA 3FAXA 1TUXA 1L6GA 5F2IA 3G6LA 1MDRA 3H55A 1R30A 4FI4A 4HBKA 3Q67A 1K9FA 2OLSA 3TWAA 3TH6A 3GC2A 4TUFA 3GNRA 1M53A 3G2GA 4WGHA 2W27A 4LNCA 2X09A 3UG5A 3GE7A 4WLCA 2DT0A 2VUNA 4H4IA 4NVTA 4EE9A 3S1VA 1A5NC 4JX5A 2ZX6A 1XDLA 1IXOA 2IQ0A 4AMCA 3W26A 1XRFA 5H91A 3CH0A 1UW9A 1XKJA 1TPVA 3WL0A 3QQ0A 5I5RA 1VJZA 2B7OA 5FF3A 4Z08A 3DHFA 4DXVA 1ISYA 1UUMA 3I6RA 4J2MA 2YSWA 3LENA 2QV5A 1KO0A 5IDIA 3BLDA 4OTKA 1TV5A 5AVHA 1W3JA 4M81A 3UPMA 5G4WA 4R88A 4O57A 1C8VA 2QZRA 3C2VA 4E2BA 3VA8A 4Q6XA 1H49A 3DFPA 2GOKA 5JBFA 3WBWA 1I2NA 3N19B 2ZICA 5C71A 4NX0A 3TQVA 4IGHA 3GFYA 2W91A 1L6SA 4QG8A 1B5TA 1J93A 3CT7A 2XIMA 4YTSA 3UBPC 2V9DA 3BSGA 4GY0A 3B4YA 4H8HA 1Z9AA 1FDZA 2BG5A 4IG2B 1FWRA 2PLCA 1PX4A 3A9IA 3T09A 1P43A 2A21A 4I6KA 4CN1A 1SJCA 1Q65A 1UBSA 1QR7A 3MHUA 1DBTA 2J7HA 3LBCA 5CSYA 2HBVA 2G4JA 4CD5A 3B9OA 4I9JA 1AZ1A 2GJLA 2YA0A 3DGRA 1ECEA 2PDGA 2Z28A 3VTRA 3MMWA 2J47A 1SFSA 1YE6A 1KXQA 2BX7A 2CFFA 3LCWA 4DJFC 2A5HA 1LQ2A 3H2MA 1C8QA 3CZEA 1HL9A 2ANUA 1E0VA 2WPGA 5G5IA 3GC5A 3UWVA 4HTBA 4QR6A 2V68A 3RMJA 5MF5A 2EG6A 3L23A 2HK1A 3LV6A 1GKRA 4IFKA 4UTTA 4JIIX 3RNDA 5ABGA 1XPYA 2DUXA 3AJ7A 4C6KA 2OKTA 3LDVA 4MJ2A 2B7NA 4P7RA 3LI0A 2VKZG 2XGBA 2X1UA 1P0EA 2Y63A 2PWFA 1TMQA 4AU0A 2O4MA 4AVNA 2Y7EA 3CHVA 3GDRA 2W61A 3NIYA 4W7WA 2NVAA 2VURA 1KW1A 3ARQA 3FKKA 3DEQA 4Y9AA 2W66A 3EOLA 2YR1A 1XBXA 3BV4A 4GUIA 1E6NA 4DZHA 3B06A 2CXEA 5T9BG 3POCA 4WX2A 2DZSA 1K8YA 3G3MA 4XG1A 1Q4NX 5FJUA 2QCCA 4WUIA 1PX8A 1H4PA 3PBMA 1KGWA 3QV9A 5AKQA 2RGMA 4V2XA 5IFTA 2V8ZA 4BR1A 2VFGA 4S23A 2QUTA 4LTSA 5DMYA 3NO5A 2WMKA 1V3JA 3MUXA 2VI0A 3PJTA 1OYCA 2HVOA 1GVIA 4UTWC 3CV1A 4Y6GA 1XIBA 3FJ4A 3WQ8A 1E4MM 5LIUX 2GVJA 4ADTA 4LGXA 3ABQA 4FXSA 5GNYA 2DIKA 5REQA 4GZJA 1EC9A 2WMFA 4MGGA 1Y0EA 1XBYA 2PD5A 1NF7A 4JHOA 1XIEA 4ZOBA 1C7TA 4LVFA 1QK0A 5CJ5A 1QPRA 4B5UA 1MRAA 4GI8A 3PZIA 2IKGA 1PIIA 3F5LA 3EXTA 3ARSA 2ZZ2A 2YW3A 1UC5A 3CV7A 3FW6A 5KITA 3N25A 4DBEA 2ZCGA 1OHLA 2ZOXA 2W92A 4M82A 4O1EA 2G41A 1FX6A 3N3MA 4LF2A 2DUAA 1VZWA 2PDKA 4DF1A 1ITXA 1FBAA 5FAGA 1ICSA 4HSHA 4Q8TA 2V5BA 4F0SA 1OQFA 1LWIA 3LN3A 4WR3A 4RNHA 5I78A 3WL1A 5TD4A 2E09A 3UGRA 1FCVA 4WSHA 2CITA 2EXOA 1E4LA 4JIQA 1WDSA 1C9DA 3JW7A 1TJ1A 1XRSA 3AIWA 1DE5A 3MB9A 1CLVA 4KERA 2GFTA 2PRMA 4RW5A 1REQB 1CWYA 4WJ8A 4M6VA 2Y8VA 4S3CA 4ZB0A 1GUVA 3FJ6A 1JCYA 1D7KA 3W2JA 3L5AA 4H9XA 5TF0A 5XIMA 4KGLA 1JL8A 4H8VA 1R3VA 3E2RA 3MYOA 1NFGA 1VHCA 4AZCB 3N6QA 1ME9A 3O8AA 4HCLA 1B0IA 3N2MA 4W89A 2XVKA 1Z32X 3KL0A 1WNOA 1ADDA 1CLXA 4M6PA 1I75A 3PUEA 4C5YA 5M2FX 1HJWA 4QJ5B 3HV9A 3VNKA 3M7SA 4J2PA 3LTYA 1O12A 1WX0A 5I0DA 2WJFA 3CK5A 2OT1A 2QJMA 2J88A 3K4WA 1SVDA 2J6VA 2GQ9A 2Y0FA 5JIPA 4Z2HA 1D3GA 1QRQA 4AG0A 4WOZA 5H8PA 1GOXA 1L2UA 1WAWA 3JZEA 5A6BA 4FXJA 2FZ9A 4IGSA 2PDIA 4ZTXA 4HCDA 4HT3A 3VC5A 4H41A 1EYEA 4OBSA 4PCPA 1X6NA 2VP8A 3L66A 4DAFA 4K68A 4JYEA 4KWSA 3CIWA 1YRRA 2QXWA 4QLJA 4Q4SA 3WG6A 3IIXA 1UR8A 4IP7A 2EPNA 4FNUA 4UNIA 1KFWA 1OFEA 4GRSA 4LCQA 4K7VA 3W23A 3MP5A 5C2XA 3O2LA 3OZYA 3SFWA 4ICNA 2NSOA 4INFA 3HIJA 1NH6A 3CUGA 1P6WA 1G1YA 3VE9A 4G7EB 1XISA 2GQ8A 3WNOA 1TMLA 5U7SA 3K8KA 4F2UA 2WMGA 1A3XA 3GLCA 4W8AA 1M7JA 2Z6JA 4A05A 4MWAD 3GG7A 3TYBA 4IPIA 3NQAA 1B4EA 2B7PA 3AALA 1XIFA 4AZ5A 2I5QA 4D71A 2PZ0A 4GNJA 1J0JA 3NOYA 4ZCWA 2BBFA 2YXXA 4JTHA 4DX3A 1M68A 4KEUA 1YLVA 3E0FA 2GOUA 3H2OA 3W73A 4DBWA 1V0KA 1A4MA 5FJIA 4N9DA 3E5BA 3IEBA 1JUEA 3OVPA 4A2RA 3PY2A 4Z42C 3ZS4A 4YNGA 1XUZA 4NJGA 4IJBA 1XC6A 3ITCA 5D8ZA 3WMLA 2VCCA 4LF1A 3GDKA 1QOXA 3MMDA 4LQ1A 1SZNA 1DJGA 3CTTA 2X1SA 3A64A 1T41A 4H2CA 3KRBA 3PN8A 1SZFA 1BHGA 4MWAC 5FAJA 4PUMA 5GPRA 1JYXA 3NYDA 3WLKX 4QFUA 4PN2A 3MZ2A 2ATMA 5ABEA 3GVVA 4GABA 3V0SA 1J0ZA 1YTEA 1VH7A 5I3GA 4LY4A 3BVJA 1AUSL 4CNNA 3LM7A 1RHCA 4XSLA 1AL7A 4M6QA 5FJTA 4JNMA 1FWJC 1TPB1 1VC4A 5EKYA 2P50A 1FWDC 3OGVA 4M7TA 3CAWA 3RYSA 3U7VA 3UJRA 2BZNA 4PTDA 4K39A 1TRDA 3A23A 3RLVA 3M0JA 1SFLA 3B4UA 1VFUA 5FF4A 3IIVA 2HSAA 4LVDA 3N73A 3NO3A 3UWWA 2IPFA 2Y1HA 5C7HA 4K6AA 1PDYA 1EZ2A 2XWEA 1GVRA 1UWRA 3VIKA 5FACA 5EA9A 2PDNA 3EBVA 5FI8A 4Q4OA 5E09A 4JTLA 1TV2A 3GTIA 3W38A 2YDQA 1Z6KA 3RF9A 3O6CA 3PSVA 1EH9A 2X1RA 4NZJA 4WDUA 4LBUA 3VCNA 3EX3A 1F3TA 4IPNB 2C8NA 3KZSA 3T55A 1BQCA 4IJCA 2V3FA 1JJKA 3VM5A 1H62A 4Z1AA 3MANA 2XSAA 4TOQA 3TJIA 2P53A 2CETA 2PDJA 3W29A 3P84A 1M65A 4PE8A 3F5JA 3VDBA 5FF2A 4JKKA 5D38A 3WLJA 4LEQA 3CUFA 6REQA 1F6PA 3MSRA 1LDCA 1ZBWA 2H3BA 1WZLA 1WXZA 3IV3A 2X2YA 1VFOA 3A4AA 4PR4A 4HNVA 1C91A 3UYIA 1FTXA 4XVDA 3AYVA 4V1YA 3PJUA 3I65A 3IJLA 2QHAA 1L2QA 4DWSA 1VFHA 5E93A 4IJRA 1P0DA 1XG4A 3MMUA 4NIRA 2HTMA 3CMJA 1BSLA 5AB3A 5BU6A 4MAVA 4J3VA 4PUEA 1P0NA 2J9ZA 1U1HA 2B0MA 5FA5A 2FKPA 4QRNA 4FLOA 3DFNA 3S9YA 3VX1A 3CUIA 3GKFA 3SN0A 2NT0A 2OELA 4NY2A 3EX2A 3DBPA 2BWGA 3C5QA 1HJVA 3UY8A 4FLRA 4FNTA 1XICA 4QE5A 1S2CA 2Z2AA 4Q8NA 4EXQA 3E0LA 2Y4SA 3GG0A 3CJPA 1RD6A 3KVKA 4MLRA 1Q85A 2PBGA 4H6QA 1G0CA 4PRTA 3ABRA 1UR1A 1RP9A 1M1BA 3RPDA 1J96A 3VGEA 3RO6A 2WMIA 5BOOA 3TTYA 3NQDA 3KW3A 4OV4A 2DV0A 3AWNA 4XAFA 2F61A 2WCSA 1KXVA 1WXYA 1TTPA 4P5UA 2WWDA 1RQBA 3O05A 4GO9A 4GYKA 1PSCA 4GX9A 3AHZA 3G1AA 1QVBA 2QCHA 2ZE3A 4J3XA 3VO0A 4CCCA 3TX9A 3WNMA 4LYPA 1TWDA 3CNYA 1ISVA 2ZWZA 4JNZA 1FFQA 3SSZA 3BOLA 1MWOA 2QNEA 1E15A 2JF7A 1OSEA 4TR9A 2WSKA 4GJJA 3VCCA 3MVTA 3W0KA 3B97A 2WYSA 4UZSA 1YNYA 1JIBA 1O95A 2YBVA 3PZ9A 2FGLA 1EEXA 5CZJA 1OY0A 2ZE0A 4RW3A 3A21A 2QGHA 3GBDA 3T78A 4O10A 4O11A 4ZO9A 3SUWA 4ZOCA 2GSEA 4MTVA 4K37A 4WY0F 1MZHA 1XLMA 4LB4A 3STPA 5FKYA 4M3PA 4MOZA 4QJ3B 2QIIA 1GOMA 1LCOA 1UWAA 3WYZA 2BHUA 3F1QA 2FZ8A 1TPUA 3YPIA 5HR7A 5IRPA 3WLPA 2VENA 3S2JA 3TCSA 2G37A 3LPPA 4IGNA 4GXWA 3QGVA 1TIWA 1FWHC 2E9LA 5HULA 2CCRA 5T8GA 2A0NA 1PEZA 3PNUA 4IMEA 3EX6A 4UMAA 2I5IA 3JS3A 1JUBA 2ZTKA 4UQEA 4AF0B 5BMXA 3VMOA 5FEXA 4KIRA 3P0XA 2YDRA 5H8UA 3WFZA 1WCGA 4QX4A 3SCUA 1NDWA 3MKVA 1WV2A 3SRFA 1T6MA 2VX5A 2TPSA 2UY5A 3WQEA 4X2RA 3GTFA 1LWJA 3C6CA 3TK7A 1IEWA 1EGMA 3W2LA 2W5FA 5F4XA 1K6AA 1SO5A 2Z26A 1ZUAX 3T0TA 1X7IA 2QKFA 3B03A 5F1UA 1JDDA 1V6VA 1W3TA 1TR9A 1UH3A 1GVQA 4GJIA 1W1PA 4GQQA 4IISA 2BV9A 2A3HA 4I9AA 1FH7A 5C54A 1V3IA 3GYEA 4DEFA 3NL3A 3E2SA 1K6WA 4QEHA 3GVWA 1PZ1A 4UOJA 2NWRA 3GH7A 3EMQA 4KWUA 4IGMA 1A5MC 3GHTA 3NA8A 1PBGA 2J24A 4IIBA 2YBTA 4ERIA 1E56A 2OU4A 4XAPA 2XSBA 3V75A 3QLDA 2O92A 5HINA 1O7AA 3MI3A 4DAIA 1B3VA 1FDYA 3VOGA 3AOFA 2F6XA 2X16A 1TV7A 3CMGA 1S2VA 5JBEA 3N29A 1V7AA 1AA1B 1E0TA 1NWSA 4KETA 3OBAA 4UNKA 1XIGA 4KS0A 4M1BA 3O6AA 4LY8A 3CLWA 3QTPA 4RE3A 3U2OA 4DUVA 3QF0A 1QUMA 2C16A 1L6FA 1R3SA 2WZEA 3G77A 3IARA 3QV7A 4IM4A 3UR2A 4GVGA 5KZMA 2DSZA 1BYCA 4ERGA 3QY7A 3BW4A 2DP3A 4CQ8A 3H21A 1VKFA 5BOEA 1S3HA 2Y5EA 1Q4WA 3W1RA 1TA3B 3L21A 3MJMA 2VL4A 2V67A 3D46A 1UWTA 1DJQA 2FFIA 3S83A 1Q7QA 1B3YA 1OF6A 2V82A 1JGMA 4DBUA 3OGRA 4RNJA 4C5ZA 3QR0A 3GZAA 4OHQA 4IQJA 4UQDA 5AY7A 1GQLA 3NZGA 3V4BA 3WUEA 1YBQB 1PV8A 3SEPA 2QCFA 3BLOA 5HK4A 4Q3MA 1HUVA 3FA5A 2Y5SA 4E8CA 1VBRA 9CGTA 3FXYA 4PB3A 4IZGA 2OEKA 3LB0A 1H7WA 4TMCA 1W37A 5HBFA 5FL1A 1R86A 4AIBA 3RHGA 3PUGA 3TZNA 2VUYA 1N2VA 4DNHA 3DBNA 4FF7A 3S9IA 2I5GA 4UIOA 3ARXA 1IV8A 3T0AA 1YIXA 3MBDA 3KLKA 4B4FA 3NCOA 2J7CA 2Z7KA 4F9DA 4XD4A 3LNPA 2QJNA 1X1NA 4OECA 5HJXA 1QNVA 3PTQA 3HFTA 2BGSA 1S2TA 3H2FA 1I2RA 1YTKA 3KX6A 3DIPA 1XCXA 1FCQA 2EJ1A 2GL5A 3QLLA 1X8FA 1PO9A 1UH2A 4UTJA 3TDFA 3U5UA 2DY3A 4KF1A 1H7PA 3NXFA 2WMJA 4MNMA 1OC5A 5BWAA 4QNWA 3OIXA 4KESA 4NILA 2INZA 3TTQA 3F4VA 4YJ5A 3PB0A 2GJPA 3R7MA 2CBJA 4D1IA 4BZYA 3VMPA 1OFBA 3C8NA 4AFYA 3EWZA 2INEA 2ZRWA 5LXEA 4C6FA 4P8WA 3H22A 1MYRA 1VYSX 3BCFA 4BQ4A 1FCUA 3MKKA 4QE1A 5J5RA 3FHAA 4HZ8A 1UPPA 4DLFA 3MHGA 1J0IA 1ONXA 2ZA2A 4AWEA 3S46A 5FL0A 3W7JA 3RU6A 3H4WA 4GUGA 2E77A 3PJXA 4NNCA 4ZB2A 3FDKA 2PDWA 4P8UA 1GPWA 1UP3A 2VFDA 4R34A 3IIPA 5ENLA 3AQUA 1F3EA 2R9RA 5K7JA 5G1MA 5CBBA 3W74A 3P80A 1XWYA 2FB2A 1U1UA 1W8SA 2ZUVA 3CEUA 4ZXOA 1VPYA 1G6CA 1W9XA 4J1OA 3RX2A 3LS9A 1UZ1A 3L4WA 1FWBC 1BWVA 1POKA 2Z1KA 3FSTA 1ME8A 4Q7IA 3JUGA 4GBUA 2PE4A 1KBJA 1M7PA 1RAKA 1UKQA 1V77A 1K8ZA 1TR1A 2V30A 1UKTA 1R6WA 1S1RA 3WQVA 1H11A 2ACUA 1D8WA 3AMGA 4AD4A 2D20A 4AVOA 3KBWA 1TV3A 1RALA 2GYIA 2ZXBA 4HYRA 2E9BA 1NU5A 2P8BA 3FDGA 2Z2UA 3W7OA 1M41A 1F3WA 1SO3A 3UZWA 4LVGA 5HR6A 4IP4A 3B8VA 2HK0A 2FDMA 5DFAA 8TIMA 2DU2A 2P76A 1OFQA 3SQSA 3TSDA 3WDJA 1QATA 5AC6A 3QZEA 1XM3A 1ZALA 1JD7A 3OQEA 3EMCA 1XV8A 1A53A 1J12A 2ICSA 3EOOA 1RK6A 2HMCA 1GVEA 3UETA 4H8NA 3EZ4A 2QVHA 1EOMA 2VRJA 2QUMA 4DF2A 1GYLA 3W72A 2YLLA 5HXMA 1GOOA 3B40A 5A8OA 2VX7A 1IQ8A 1FRBA 5C9WA 3M9YA 3WBYA 4DZAA 2ZRVA 3S1WA 2DIEA 3MO4A 1E6ZA 2VCAA 4GJ1A 1QWKA 4O28A 4FX8A 2OYLA 1AH0A 4PBEA 4JYFA 5FJPA 3NR0A 3S8HA 3REQB 1SJAA 4GYPA 5M17A 3DHDA 2E1DA 5D30A 3UU0A 2R1LA 1VRDA 2VOTA 1GTHA 3CASA 3ATZA 4S39A 1OD0A 1BTCA 5C9UA 2PU0A 5EL1A 1RQHA 1HGWA 2VDHA 3O6YX 1LOLA 3B9DA 4K1GA 4QDPA 3TVAA 3U48A 3GBEA 3WQ6A 1ZCCA 5KZ6A 2WXDM 1IT7A 2GSJA 4MYXA 1XHGA 1JPMA 3C0JA 4JX4A 1PKLA 3OGSA 1TYGA 2WAGA 1I8JA 2VC5A 1A5SA 3W00A 5FESA 1PTDA 3RO8A 2DT1A 1CIUA 1BVZA 4JDYA 5A2AA 3QHNA 4B90A 4GNVA 4UTTC 4C91A 3URAA 2WLYA 1OGBA 1JZ4A 4AHPA 1LZOA 2F6KA 1VJSA 3QFEA 5DCEA 5FF0A 3VNZA 1MUMA 1ZTVA 3SCSA 3DC0A 3EOEA 3BOFA 3AS2A 1XDJA 2AMGA 4ILSA 4NNAA 1GVOA 1KCXA 3V0UA 3Q4DA 2ESCA 2QJHA 3NQGA 3MI6A 3LHZA 5LIYX 2PGEA 1BGGA 2CZDA 3HG5A 1EJWC 5A6KA 2PU1A 1DOSA 3KOYA 5HMFA 3RX3A 1MW0A 1UR2A 4A8LA 3EB4A 5AVNA 1P7TA 4TXEA 3NL5A 4U5IA 1IWBA 5KSWA 1MZRA 4E4PA 4MB5A 2WO5A 2J4GA 1YPFA 1K7FA 5A6SA 1ADSA 3T4WA 2BB0A 2NZLA 3FV9A 3C86A 4S3JA 1LG2A 1XYCA 3THUA 1BSIA 4J3WA 3RG6A 3SW6A 2QDEA 2HRWA 1S5VA 2KAUC 1AJZA 3B8SA 3E02A 1QMLA 4CD4A 4MSSA 4RE0A 4GUJA 1TPDA 3P6LA 4A3RA 5DRIA 1TRIA 3OG2A 4O17A 1RJRA 4A3QA 1KWKA 4B3ZA 3V36A 2OGYA 3W86A 3ZJ6A 2YBUA 3NQVA 3PK7A 1JI1A 4PUKA 3Q37A 2VEFA 4J3TA 2ISWA 2J7EA 4NKCA 2CHOA 5EGRA 3N4FA 3MSDA 3DFSA 4JTDA 2C3ZA 4EPKA 4LXFA 1JUKA 3N11A 5LA2A 5AN7A 4PCSA 3Q2DA 3SY5A 1O66A 5BZAA 3H8AA 4V15A 3RK8A 3SI9A 3SIZA 5LKYA 4AH7A 1XD0A 2GGHA 1EBGA 3KUMA 2XN1A 4EPEC 4D6DA 2F2HA 4EAYA 2NV9A 5A6BD 1HFBA 3AROA 5HUPA 5LNRA 2NX9A 4C6IA 4AZBA 3MQTA 2DZWA 4IHCA 4Q22A 4RPQA 4Z2LA 5JH1A 3C52A 1QNOA 4WD0A 3IRSA 4FPSA 3WDIA 2ZUSA 1US0A 5BXTA 4QJ4B 5K9XA 3NQEA 3I68A 5D9OA 5XINA 1JYVA 1R8LA 3ARYA 5I09A 1DWHM 4ZXLA 3EXSA 1FWTA 5FEZA 5LGZA 3F4WA 3QBUA 4B2DA 4GC4A 5AOUA 1BGAA 4M19A 5AC8A 1RD5A 4JIEA 2G3IA 2E3ZA 1H7OA 1L8NA 2XHYA 3HQ1A 1ECQA 5EMJA 2J74A 3R43A 4MZ8A 3XINA 4UTUA 3RX4A 1H5VA 4L4MA 1OK6A 1TPWA 2DSVA 2YOCA 4GFSA 1E6SM 4UUIA 1CNVA 3DXIA 1ME7A 3N18A 4HNLA 2DH3A 3CM4A 3L5MA 1GOIA 1A5KC 3STCA 1OG0A 3WLTA 4D6JA 4PMNA 4MNLA 3DCPA 3PS7A 2XIJA 4ADUA 4D6GA 3KOXA 2J7GA 4CUCA 1XLFA 3A9BA 1DWFM 2VZUA 3WNKA 1FXQA 1TELA 1F8MA 3HPZA 3VOCA 1B3XA 1V4YA 1DWAM 4HVXA 4GI9A 3W85A 3M0LA 4CCDA 2OGJA 2Z1WA 3V35A 3ALFA 5K4ZA 4I90A 4U3CA 2BXYA 3PULA 3W4RA 4DF0A 4O53A 3USZA 3ARWA 3LBOA 1H63A 2DDXA 4O52A 1O94A 2VFFA 1JZ6A 4BQ5A 2WKLA 4NXSA 2DJLA 1OZMA 3EMZA 1I2QA 3LTSA 2JQXA 5C55A 1GHSA 4GKTA 4LYRA 1DQXA 5JU6A 1QT1A 1EIXA 4JKMA 5MKGB 1OVDA 1UR3M 4Z2JA 1NOFA 1Z7AA 1U1JA 4FAMA 1DJYA 1MEIA 1AL8A 4TV5A 3R11A 4PB4A 3WMBA 3IV8A 1DJNA 3GX9A 5CH9A 2VZOA 3AZSA 2IPGA 4AEFA 4C6DA 2OJPA 1QI2A 5DCDA 1YEYA 2RJGA 5JBDA 2OODA 2ISSA 3GTHA 1W9VA 2FTWA 2F2KA 2WQDA 5LSMA 3UF9A 1KBLA 4JOMA 4U10A 1X6LA 3THCA 4HOXA 4GQBA 5JQ9A 3RIKA 3HF3A 3AHVA 4S2CA 1YE4A 1GVFA 3PP7A 3VX0A 4P7OA 3W81A 4EXAA 2AOSA 1LBFA 2P88A 1TWSA 2B31A 5G2IA 1PWMA 4HNTA 4YL2A 4WKAA 1Q7MA 1KRMA 1J18A 4YIWA 3NQ2A 4FNQA 3VIJA 4FF5A 3UZZA 3UR7A 3S5OA 5A8PA 1XBZA 3C2FA 1T40A 4GVIA 4JY8A 4I6VA 4LH8A 1ZAIA 3ES7A 3W2MA 3RPTA 1JCXA 3PM6A 2J7DA 4GG9A 2OO6A 5G1TA 2QCGA 3W6YA 2OOGA 2AL2A 2OSXA 2ZDSA 3NVDA 6ALDA 4MMWA 2QDHA 3QQWA 3INPA 2R94A 2XFFA 1OBAA 1V79A 2DUZA 2HBXA 3NSMA 3ARTA 2H8XA 4CU7A 4X61A 2PRLA 3G18A 2X0HA 2YL9A 3QYQA 3GXTA 4DWSD 4IL0A 5GNXA 3T6CA 2FVLA 3LCFA 1O60A 2OEMA 4A3YA 5AYYA 3GUGA 3A5VA 3CT2A 3DENA 3KCLA 3IGUA 1T0OA 3EWYA 2EJAA 2FGZA 2DSKA 3TLQA 3URBA 4K3ZA 1VENA 2FHCA 3PPHA 1L0PA 1PCKA 3RLUA 4KGJA 1A5LC 1GKQA 2G97A 1KFBA 2VJXA 1EUAA 3LCIA 3BV7A 5AZ0A 4P7NA 3KHJA 6PTDA 3P74A 4YVXA 2QLYA 4W9TA 2IPWA 5K9DA 2QVNA 4DWSC 4LEFA 2DGAA 1FWCC 2Z1VA 4UNLA 1XGDA 2YCKX 3BG9A 1WKFA 2PUZA 3BAKA 3L4TA 3HO8A 3CHDA 2PS2A 2D1ZA 2WMHA 1LQAA 1HKKA 5E0FA 3E38A 4QCFA 4GCXA 1TCDA 4FNSA 1JYNA 3MUAA 3QMTA 1KNWA 1G4PA 4AX7A 5CSUA 3RGTA 2BY3A 4PMJA 4RXFA 3T1GA 3CQ0A 1W5PA 5GJNA 1RJPA 4JTJA 4IWWA 1VPXA 3BZGA 2PSNA 3ITXA 2X2GA 4UCFA 4F48A 1FDJA 1KM5A 1R47A 4A4AA 1OFAA 1MFUA 1W1VA 3CUJA 1NP2A 4AD5A 4PB5A 4IXHA 1KR1A 4ONVA 4CU8A 1XYMA 3CV2A 4LNYA 1VFMA 4AXNA 2VD8A 2PURA 5F2MA 1QI0A 4Q8VA 3WCZA 4S3BA 7CGTA 1JCJA 5HNNA 3IGSA 4HNCA 3M4HA 3WK0A 4DO6A 1PHQA 2CWNA 1QFEA 3OODA 4C65A 3C3UA 3QN3A 3LD5A 3NWRA 1K1DA 4Q8UA 5I03A 4AZHA 3AISA 3AC0A 3NQCA 1UWSA 4RJEA 1GGOA 3TN4A 4DY1A 2XN0A 4M6UA 4RE2A 3TC6A 3W1TA 2NT1A 1CENA 4WIWA 3E0VA 2E8ZA 4RZ4A 8RUCA 4QSFA 3N14A 4Y9MA 4PEEA 1OIFA 3W87A 3R1ZA 4A3UA 3V16A 3FEQA 3OEXA 1KRAC 3IGXA 4Q8MA 1KD0A 3ZT7A 3TYEA 2TYSA 4QDMA 2W63A 3IUIA 1D3HA 2WBKA 2O4QA 3DX5A 3GK0A 1OJXA 1DWIM 4DJED 2DFAA 1UR9A 2Z25A 1XLLA 3K13A 4IUOA 2FZNA 1Q6EA 1KM2A 1QI4A 3UESA 2AQOA 3UQNA 2VDGA 4GA8A 2GGIA 4RZBA 5CJMA 5KMYA 4NJIA 1ZQ5A 3PPGA 3PZQA 4H1ZA 4KMQA 1W3LA 4IPJA 4M51A 3WQCA 1BRLB 4D8AA 1Q6GA 2HDJA 3ZXWA 3BGGA 5CC6A 3MWAA 4ZQPA 2W3ZA 1DXFA 4H04A 3URNA 4TVCA 5CPQA 4MADA 1IHIA 5A5WA 3NPVA 2Y7DA 2D69A 1DTNA 3SUSA 2DQWA 4UQAA 3HJEA 1VEOA 4Q8WA 2HXTA 2WBGA 1I4NA 2PDFA 1MXDA 4DQWA 1GJWA 4QAWA 1ZBKA 3TN3A 5A95A 4S3KA 2ADAA 2OLAA 1LRNA 3VK5A 1RVGA 1I1XA 4GQGA 4GINA 2EG8A 3SUTA 2NV2A 1EWEA 3N2TA 4XZLX 1E6RA 1RVKA 4XKYB 2PF0A 3VNYA 3A4JA 5DY3A 3C2OA 3SCPA 4ENLA 1JGIA 1R7AA 3OZMA 2OVLA 3LRKA 1KB3A 1Z8AA 1YKWA 2ZC1A 4PUNA 1R2RA 3SRHA 1UA7A 3THDA 4P2VA 3NEVA 4BQ2A 4FP1A 2PDBA 1RQEA 4AY7A 1B3WA 2VZTA 5HUOA 1W3NA 1RPXA 3HA1A 3WUGA 3I7QA 1AFSA 1R3TA 5D05A 3M07A 2WQPA 4ATLA 3GG1A 1XIMA 3A24A 4S38A 3R8HA 1A0EA 3WELA 4I7UA 5BYWA 4GZEA 5DELA 1KCZA 3H2CA 1OZQA 5LA1A 3KBSA 1RCXB 1FWFC 1GYNA 2OLHA 2TSYA 3DHUA 5DT7A 3SQLA 1W1ZA 2OB3A 3AS1A 3BAXA 3TAOA 2WHLA 2MUCA 1LRQA 1XBVA 4DELA 4REQA 2QV4A 3S2NA 3DC8A 4YVPA 1RUSA 4CEXC 4A21A 1R9ZA 4RE4A 1H09A 2OQHA 4PMQA 2VYOA 4B5TA 1XLJA 1UASA 2ZIDA 1SSDA 1SM9A 1OGSA 3SSJA 1XG3A 2NX3A 4WJEA 4US6A 4N6EA 2XWDA 1C9WA 5D03A 1LL4A 4EPBC 1OF8A 1S5WA 3ELFA 4GZIA 2J79A 4LV4A 1R9YA 3UJEA 2CLMA 3E9AA 3AXXA 1EC8A 5DXXA 3LA4A 2YZRA 3DU0A 3D47A 1ENUA 4L6HA 1YXYA 3OA3A 3S42A 3WBXA 1L6YA 5D02A 1Z3NA 4ZMGA 3E96A 4DBSA 2BASA 2RHGA 5EPDA