1D3HA

Human dihydroorotate dehydrogenase complexed with antiproliferative agent a771726
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
367
structure length
364
Chain Sequence
MATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DIHYDROOROTATE DEHYDROGENASE
publication title Structures of human dihydroorotate dehydrogenase in complex with antiproliferative agents.
pubmed doi rcsb
source organism Homo sapiens
total genus 136
structure length 364
sequence length 367
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 1999-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1d3hA00
1F73A 2NV2A 3TAKA 4RR4A 2GVGA 4YWIA 3N73A 1OX6A 5H91A 4O4VA 4IXXA 5LNUA 1S5TA 4UR7A 4Y96A 2A85A 5HR6A 4OHQA 4YCPA 3GDKA 3MBFA 4IGHA 2JKEA 1ZJIA 3TC7A 3N19B 1G6CA 1MZHA 1ONRA 4HN4A 3BGJA 4AWTA 3L0NA 5K3VA 1OFQA 2Y7EA 5CZSA 4R53A 1OVDA 1F6KA 1W0MA 1H5YA 1ZENA 1H1YA 2V82A 2YFNA 2B7PA 1FCUA 4AF0B 1NAL1 1PS9A 1EX5A 4EF9A 3SW6A 1P0KA 2DZWA 2E6YA 4WY0A 4A2SA 4C1LA 1EUNA 2WJZA 4Y6GA 5HWMA 3THAA 3RNDA 3NZ1A 1M7OA 1KBIA 3PWAA 3QF0A 4U4MA 2RKXA 1NSJA 1YTKA 2A7PA 4Z1DA 3GXTA 2JBMA 3MBDA 2QEZA 3BLFA 1I2RA 5D03A 3B0VC 3MJYA 1KM6A 1XBVA 4H3DA 5F4XA 2ZRWA 1FCBA 4QNEA 3LERA 2Z1BA 5AFDA 3CU2A 3FFSA 1FWRA 3VCRA 4JD4A 4QAIA 2P10A 2NXHA 5DY3A 5FEXA 1TPB1 1FWSA 3TMQA 3ABSA 4HHPA 3D0CA 3QW3A 4O28A 4FX7A 5D2VA 4MIMA 1T8XA 1OFEA 4EWND 3LHVA 4IOTA 2BSLA 5DELA 1TTJA 3VNDA 3NDOA 2QR6A 2NZLA 1SZEA 1SO4A 4JX5A 1JJKA 4K8EA 3MP4A 1RR2A 3NL5A 1XI3A 5BW6A 1PVNA 5I3IA 4P2VA 1VC4A 2RHGA 3FJLA 4AMAA 3HQ1A 3IVUA 1K8XA 1OF6A 1B57A 3NQDA 2E6DA 1HO1A 3BARA 3DI0A 2QJHA 2PCQA 1KFJA 4TIMA 4MLRA 3G1FA 2JGYA 5AOUA 3BO9A 4MZ1A 5LNRA 3L68A 1D3HA 4BI5A 4JS3A 1FCVA 1EPXA 4RZ5A 1DQXA 3W1QA 5DCEA 1SZFA 4O1DA 4LWWA 4WXYA 2QJIA 5LKYA 1WBHA 1SR9A 2I14A 1JULA 2V2HA 1JR1A 4AWSA 3OVPA 1OFBA 1FWWA 5KZDA 4AEOA 2PE4A 1V5XA 3QMTA 1MEIA 3RLVA 3SJ3A 3OA3A 1TV5A 2C16A 2GUUA 4UNKA 3TAOA 3LM7A 4NNCA 4K38A 3PG8A 1Z41A 1JCJA 3LV6A 2DZSA 3W6YA 1ADOA 3MP5A 3UWQA 1QR7A 3C8FA 1A5SA 3BW2A 3W1XA 3Q37A 2J9ZA 3W7QA 4O0KA 1S5WA 2BX7A 2NUYA 2ZRVA 1Z42A 3L5AA 1VYRA 3M47A 2PRLA 4IMGA 5EKYA 1L2UA 3QEZA 3ZS4A 4JIPA 4JTTA 3SECA 1AMKA 4LVFA 1K7EA 3C2VA 3LCHA 5AHMA 2CLOA 1TJRA 5D38A 5CZ0A 1GTHA 3G0SA 3W7IA 4LRSA 2Q3OA 3G1AA 3MYOA 3LBCA 4MZ8A 5DLCA 4TMCA 3C61A 3GK0A 1LZOA 1KV8A 5EL1A 3HG2A 4FEZA 4O53A 2IQTA 2X1RA 4JN6A 3UZJA 2VFFA 1SFJA 2CFFA 4G1KA 3VE9A 6ALDA 4GC4A 3B03A 1NFBA 2YX0A 1Y0EA 1ME7A 3CEPA 1SW3A 3DGRA 3TW6A 3G0XA 1AL8A 4HT3A 5I3FA 1OABA 3T55A 3K30A 2W79A 3NL6A 3JS3A 4IMDA 1H7WA 1VH7A 2ZTKA 2NX3A 3GDLA 4FX8A 1FCQA 4GUFA 3LGEA 3T44A 2VFGA 4UTJA 2QCHA 5HJLA 1ML1A 1THFD 2E5BA 3W1LA 2CLIA 1JCMP 3PBWA 4QISA 2C13A 4IQLA 1UBSA 3GYEA 4UFHA 2E09A 3IIXA 2YYTA 1IXNA 2A4AA 2W0UA 3LI0A 5BNKA 4Y90A 1NF0A 3OEXA 5KZEA 1K8YA 5F2GA 1VJIA 2A7NA 3GX9A 3NVTA 2FIQA 3TSMA 2CZDA 3P5ZA 3NNTA 3PR2A 3TDFA 5SWUA 1VYPX 1AW1A 5D05A 4MJZA 4ZQNA 4OQVA 4WX2A 3UNDA 3S1VA 2DZVA 3SY5A 3EXTA 1QPQA 1VQTA 1W5NA 2VOMA 4FHAA 1W5PA 2EPHA 3GDTA 3P74A 3DBPA 4MOZA 1LTDA 4JYDA 5FF0A 5DY2A 4NXSA 3N2XA 1OK4A 2B0MA 3L5LA 5J5DA 1CW2A 3PUDA 1I2QA 1WA3A 4O15A 1PCKA 4NZFA 3CHVA 1DORA 1K3UA 4O1AA 2HMCA 3W07A 3U8GA 4FXRA 1PCWA 1A53A 4AHQA 1N7KA 5AHIA 4M6PA 5A8GA 3NQCA 1A50A 4KFOA 5BOOA 1Z48A 2KZHA 3SGZA 3EWYA 1EP1A 2ZRZA 3W1PA 2H3DA 1KM5A 2P0OA 1XC4A 3HJZA 4OT7A 4A2RA 3UD6A 4CNNA 1TMHA 1J4EA 4HNTA 4L4MA 4O10A 3M1ZA 1ME8A 3E9AA 3LCWA 4I9AA 1Q3NA 2ZTJA 1YDVA 2I1OA 2TYSA 2QF7A 4ZMGA 2ATMA 1RVGA 3JR2A 3UYCA 1M7PA 3A22A 5D33A 1FX6A 4HNNA 1OX5A 1XBXA 1LLZA 4NQ1A 2A6LA 5MHBA 1YXYA 3M43A 5CZTA 5BMXA 4LOCA 4GWEA 4O0ZA 1RPXA 1R2SA 3O06A 3R12A 3DKLA 3ZWSA 3W7KA 3PAJA 4MKNA 1FY6A 4UMCA 5E0KA 1R2TA 2E68A 3W7MA 1EIXA 2X1TA 2NLIA 4N6FA 2V0TA 2W6RA 4JTSA 4UFKA 4WQ6A 1LBMA 3G22A 3USBA 3PSWA 3NR0A 4ZZ9A 5CG7A 4LC6A 2FFCA 5FI8A 4DPQA 2VEKA 2BXVA 3CTLA 4ML9A 3NEVA 2TSYA 4JR5A 3L0GA 4YCOA 3EXSA 4JNMA 1KM1A 3OVRA 2GVLA 5LNSA 4M6VA 4GUJA 1F74A 4PL2A 3L66A 5G1YA 3OHIA 3W7RA 1EWDA 3FLUA 4MJMA 3BLEA 3CT7A 2ISSA 3S5YA 3G24A 3N9RA 1FWTA 2X1UA 1MEHA 2DZPA 2V2DA 2XFWA 4XKYB 2CLMA 1FBAA 3CB8A 3V1PA 2V9DA 1PIIA 3QRHA 1W8SA 1OX4A 1OFRA 3S1XA 2JK2A 3PM6A 5EBUA 1H7XA 1QPRA 3NQ2A 4R34A 5TBOA 3HGSA 3W85A 2JKPA 1I2PA 4GUIA 3P82A 1VGAA 4N9CA 1SZNA 2WNQA 4E2DA 3FYOA 1UASA 1OFOA 3HO8A 3B05A 3LBMA 3WJZA 3GAKA 2Z6IA 3EB2A 2OZ0A 1GT8A 2FB2A 3W7DA 2GOUA 4BI6A 1H60A 4ALDA 3W74A 1P5BA 4MUZA 3NPUA 2WOQA 1YDNA 3GXNA 3DU0A 4LNYA 3KRZA 2G5WA 5D37A 2NWSA 4Y9AA 2AAMA 2DJLA 1UUMA 3TJLA 1QWGA 4N9BA 3W7NA 1P0NA 3C4UA 3W1RA 3YPIA 5K2ZA 2ZZ6A 1KM0A 3WJXA 5DN1A 3M44A 4M6QA 1TJPA 1FDZA 4HSNA 3SR7A 2E5CA 1IGSA 1WV2A 4FNSA 1QO2A 2R91A 1N55A 1V7YA 1R2RA 4N9EA 4IJBA 2CZEA 1JCXA 4S2BA 1TPUA 3G1SA 3M5ZA 1QOPA 2DZTA 5KSWA 4LTSA 4Z1BA 1GEQA 1GPWA 3KVKA 4AAJA 1ZAJA 4U28A 2G95A 4A29A 1F2JA 3QQ1A 4UR8A 3E49A 2TMDA 5CZJA 2NX1A 3CPRA 1SSGA 3VI2A 4FNUA 5AC6A 4JYFA 2GJNA 3DAQA 5HQEA 3QFEA 3VE7A 3MI2A 2XN1A 3O1NA 2ATSA 3LRMA 1YXDA 4M7TA 3LCGA 3LLDA 4MYXA 5AYYA 3NAVA 1FXPA 3HB9A 3HPZA 2BZNA 3VFLA 3NG3A 5HINA 2VENA 5HR7A 1I4NA 3W7CA 3S1UA 1G4PA 5LNWA 2ZBTA 4QNWA 3G3MA 3W76A 1XXXA 2JGQA 4W9TA 3W7JA 1SW0A 3W2JA 2C15A 4IX2A 4LV9A 1JCYA 1QPOA 2Y88A 5F4WA 3O63A 1IF2A 3NGJA 2RH9A 4HPJA 3ABRA 1QOQA 4LY8A 1RQBA 3CQ0A 3UY7A 1QCWA 5GVJA 2CLHA 3PBUA 1RV8A 1K7FA 3NQMA 1SW7A 5FF2A 3ABOA 3TIMA 1F7BA 1W3TA 2Y85A 2VFIA 1SO6A 2X30A 1ZCOA 3TROA 3LTSA 2RDUA 2PURA 2XN2A 2YW4A 1IIHA 1U5JA 1W5OA 2QUUA 1LOQA 3QC3A 3QQ0A 1R30A 4RZ4A 2V2CA 4LS1A 3TR2A 3KVJA 1QNVA 3TV8A 2YDAA 1WOAA 2QDGA 4FO4A 1RZMA 4KKXA 4RK8A 1C29A 2JKAA 5ABTA 1P1XA 1S3HA 4AXKA 1VR6A 3I6RA 3MWAA 1X8FA 1H61A 3M7WA 3O15A 3LXBA 2XN0A 3PBVA 1LDCA 2YPIA 1SO3A 1EEPA 4UC5A 1F05A 1SPQA 4BR1A 3IRDA 3UWUA 1L9WA 3IGXA 4E0CA 5DXYA 2GQ9A 4IMEA 3DFTA 4PA8A 2HTMA 3C0JA 3ELFA 1W31A 1KTCA 3H54A 1H7NA 3P81A 4O1CA 3RMJA 4XBKA 2GVJA 5G2WA 3A5VA 2Y62A 1O4UA 3V75A 3HPXA 1TSIA 2TRSA 3TUUA 3TSDA 3S5OA 3DHFA 3L5MA 5F1VA 3TW7A 3FKKA 1GJPA 2PRMA 4M7SA 4TU1A 2HS8A 3SSJA 3UZ5A 5FF4A 4AF0A 3W83A 1G4SA 3IIZA 2WQPA 4NUWA 5AYZA 2HS6A 2FPYA 3GZ3A 3W84A 1TCDA 3W2KA 1BWLA 3LHYA 3NQ7A 3NYZA 1OF8A 1JQVA 5EY5A 4FF7A 4EVZA 5LHFA 1TPVA 3C6CA 4NJKA 4WY0F 3HG4A 5G1TA 3E96A 4FIQA 4JIQA 3IVTA 2FQIA 5K9XA 3VKJA 2B7OA 3NPXA 1SU5A 2C19A 3FA5A 5BMWA 1WXJA 5BRBA 2CLFA 1GVFA 1GG0A 4KWVA 3LTPA 1EA0A 1W54A 4O54A 2A6NA 1UUOA 4RXGA 1YADA 4RV8A 2A5HA 3SI9A 2AGKA 1NVMA 2BWGA 4IMFA 4TX9A 4YMZA 1QMLA 1M5WA 2RDTA 3TFXA 1SO5A 4RX0A 1OG0A 3A21A 3A5FA 4AHOA 4CQ9A 2QCFA 1XCFA 4O50A 5EPDA 4MLJA 3IIPA 3QPYA 3W71A 2QAFA 3QZEA 1F6PA 2ZRXA 5I3GA 4ORMA 3W7LA 1S5VA 1XUUA 1TPDA 1X1OA 4CNPA 1FXQA 3GDMA 1MEWA 4GRSA 4EOUA 1T96A 1ZAIA 2ZZ7A 1YXCA 2NUXA 2Y89A 3TQKA 3DZ1A 3EKZA 4GE8A 1G4EA 5G5IA 5K4XA 2DZUA 1U83A 2DJXA 4Z0JA 3KOFA 1DOSA 5EYWA 2ZFAA 2FTPA 3C2OA 2A7RA 3THQA 5L9FA 4J9JA 3W73A 4E2BA 2Y61A 2C1HA 3S9YA 1TRIA 3MHUA 2E77A 2C3ZA 4QIUA 5KTLA 1YPIA 4FX6M 1YTDA 2OMAA 1WDWA 4KWWA 1DV7A 2EF9A 3PF3A 3R13A 4DF1A 1VLWA 1W3NA 3N2MA 2Y6ZA 2OCZA 2QUTA 2OJPA 1KM4A 1WX0A 3EWWA 1JUKA 3TC6A 3HF3A 4DPPA 4FNTA 4FNPA 3L9CA 3QSTA 3ATYA 4JGDA 3DENA 1ZNNA 5C2XA 4O8RA 5HWJA 1O94A 3MI6A 4UTWA 3W1NA 3R89A 4KFPA 1XDMA 1BTMA 4UTIA 1LBLA 3DKJA 2EGZA 5K4ZA 2Y7FA 4GNJA 3BPWA 5CSSA 1JRCA 2VFHA 3CM4A 2Y70A 2DORA 1GOXA 3UWYA 4MFEA 3S5ZA 3Q94A 1GVOA 3PUOA 3TFCA 2CLEA 3B04A 3GKAA 4NX0A 5AN7A 4LC8A 1LRQA 1TIMA 1H63A 4BI7A 4UTHA 1OYBA 3NM3A 3KRSA 4JYEA 3FEMA 3C2RA 1TRDA 3I7SA 1VHCA 3EX4A 2PRHA 4OWGA 5G2HA 1IIGA 3HIJA 4NX5A 3LHTA 2ABAA 4OBTA 3P80A 4DBDA 3F4NA 3I7RA 1TO3A 2YYUA 4WJEA 3B8DA 3OG3A 1TTQA 3STFA 4PCFA 4ZVJA 2ZZ3A 3PB2A 3SZ8A 1H7RA 3P8IA 4A21A 3WJSA 4X22A 2O7QA 2YR1A 1VZWA 3I65A 1TPC1 4NXKA 5AHFA 3OIXA 4OV9A 3W86A 2QCLA 4MY8A 1DJNA 1CI1A 1PE1A 3FOKA 3O8AA 1YTEA 1X6UA 3DH7A 5D30A 3C2EA 1ZALA 1DQWA 4PL1A 3MW7A 3LDVA 1X1ZA 5AC7A 4NJJA 3NQ6A 4LRTA 3HMJG 2YZRA 2B7QA 2G97A 3LCXA 1KFCA 1KW1A 3W88A 3L67A 1HFBA 3IGUA 4FNRA 2YXGA 3DXIA 2WSYA 3UQNA 2DP3A 5LGZA 3HG5A 3LX9A 3A24A 3F1QA 2C18A 3S0CA 1ALDA 1RQHA 4GBUA 5CPOA 1DJQA 2GJLA 3P8JA 2DU2A 3W2LA 4O52A 4QSHA 4M5PA 3LHWA 1G69A 3S5NA 4MZYA 5AB3A 3GKFA 3NQAA 1XFBA 5IBXA 5I3JA 5C5YA 1ZHAA 5DCDA 4JTFA 3SGUA 3HGRA 2PC4A 4ZQPA 4O14A 4HNUA 1LOLA 1EP3A 3W70A 1UJPA 5KZMA 3DI1A 2F84A 2WSRA 1KFEA 4UTLA 4ZQMA 1XL9A 1TV7A 2Y7GA 4ZQOA 4WXZA 2VFEA 3QMSA 1LCOA 3PULA 1DVJA 3HGOA 1OFAA 1QFEA 5TQLA 3UWWA 3IEBA 2BTMA 1VS1A 4PEKA 4ICNA 3W2MA 4K36A 4AWUA 2X16A 4TR9A 4DQWA 2E5DA 3W23A 2E6AA 4JTJA 3LTYA 4Q32A 3KX6A 3NQGA 1LP6A 3ATZA 3TNOA 1B4KA 4O1BA 3LLFA 3M9YA 2CLLA 4L4LA 1LYXA 1C9DA 3W9ZA 1MSSA 2ZA3A 1D3GA 1EB3A 3QJAA 3STCA 2A21A 4UIOA 4N4QA 4XZ9A 3BV4A 3S6DA 2QCEA 4LU0A 5D04C 4LW7A 3S42A 5CPLA 3TXZA 3W7HA 3P67A 3O16A 4A22A 4K39A 1OFDA 2Q3RA 2VEIA 1KM2A 5HUOA 3WK3A 1F5ZA 1PHQA 2X1SA 3EWBX 5T26A 2QCDB 4DXVA 1VYSX 4DF2A 5C55A 3O07A 4LS2A 3L0KA 4MPQA 2YSWA 1IXQA 4O13A 2ZDRA 3NZRA 2NXGA 3WK0A 3DHDA 1O95A 1QDSA 3STEA 4LUJA 2A2IA 4MYAA 2WO5A 4JX4A 3HBLA 1WAUA 3PSVA 4BF9A 2WNZA 3W72A 1IXOA 5FF7A 3ZR4A 3DFOA 4BWLA 4S1FA 4CQAA 4HKPA 1KFLA 3PS7A 5IBXC 3T40A 4X3ZA 3NL3A 3LXAA 4DF0A 3UPBA 2TPSA 3NQVA 3NQ8A 3QH2A 1FWNA 2X2GA 1JUEA 1VPXA 3M5XA 2P1FA 1KFBA 3BG5A 5I3KA 2FPVA 5D02A 3G0UA 1KLZA 4JTEA 1ICPA 1L6WA 3RFAA 4JXCA 4ONVA 4POCA 1JCNA 1H50A 3KVMA 4WOZA 1OFPA 2E6FA 4WY0B 3AO0A 3B06A 4I7WA 4UFMA 2WNNA 3IVSA 1DHPA 2ZCGA 3TKFA 3UY8A 4XKYA 4MY9A 1O5KA 3MUXA 3F4WA 1W56A 3BVJA 1QPNA 2CU0A 3E02A 2OX1A 4ADTA 2V5LA 5KINA 3PC0A 3ANYA 1SFLA 4K37A 4LV4A 1FDJA 3QPZA 1HG3A 3LRLA 1TTPA 2B7NA 2ZZ1A 3EX6A 3PUEA 3GAYA 3Q58A 2CZ5A 3LHUA 5HNRA 5CKSA 4BFAA 3GXPA 1IXPA 4CQ8A 1ZAHA 3P84A 3MP3A 1VCFA 1LORA 5F2MA 4NNBA 3FS2A 1B3OA 3P62A 3NM1A 3O6CA 4LVGA 4S2CA 3BLIA 5DCBA 1VCVA 1K7XA 4I7VA 1JVNA 4JDYA 4Z1AA 1L6YA 2Z0IA 3G1XA 1RD5A 1L6SA 4XTIA 5K7JA 3NA8A 1I45A 1TYGA 3PB0A 4H6KA 4GUGA 5D2YA 1YPFA 3RF9A 2J24A 4IPIA 3TQ0A 4BWLC 1W5QA 4AB4A 3L2IA 3W7GA 3CEUA 4MY1A 4N02A 4NJIA 1I8JA 3T78A 4XQ6A 3IIOA 5CSRA 3DFNA 1LM1A 4JX6A 5LSMA 4LVBA 7TIMA 3P61A 5E1QA 2ZA1A 3A9IA 4JTIA 5F1UA 5FF3A 1UCWA 1GWJA 3EWZA 4E38A 4NVTA 1LLWA 4LT9A 4MFDA 1WYIA 3HGJA 4JTKA 2AQWA 5A5WA 1JQXA 5D32A 3W22A 1F76A 2CZFA 2VKZG 4K7VA 5EA9A 1KTNA 3R8RA 1N8FA 2GPTA 1MO0A 4GFSA 3O6DA 1H1ZA 4XWUA 4OU1A 2WKJA 4LS0A 3W75A 3GIYA 3BG3A 2ZYFA 3F03K 3MHGA 2R8WA 3EEGA 1KBJA 1JRBA 5G4WA 4O17A 2YW3A 4IXHA 4DELA 3QSRA 4OGZA 4JTHA 1VHNA 3B0PA 2F7FA 2Z6JA 4IWWA 1ME9A 1GYNA 5HULA 4WZHA 5IM51 4N2YA 4UFIA 2LLEA 4Y8FA 3TX9A 4MVAA 3EX3A 3B0UX 3SIZA 4UMBA 3L21A 3Q2DA 4QJ1A 1W1ZA 2V81A 2VXNA 2J9YA 2R94A 3GDRA 2WV8A 3KXQA 2EAWA 1JUBA 4JTGA 3WFAA 3KFTA 3WJYA 4EIVA 2NV1A 3ZFHA 1XKYA 6TIMA 4GUHA 4N4PA 2EHHA 4PH6A 4JTUA 2QCGA 2Q8LA 4D2JA 1TB3A 3TXVA 2CW6A 3G8RA 1H51A 2BLEA 3EX1A 3W2NA 3NOEA 1SQ7A 8TIMA 5LNVA 4NJHA 3KRUA 2D73A 4BK9A 1Z44A 1XBYA 1H62A 4FB7A 3BGGA 4UFLA 5F4SA 4UTUA 1W5MA 1R46A 4A3UA 2CWNA 1WQ5A 2C6QA 2NWRA 1KA9F 3HG3A 1DL3A 1T99A 4FIRA 1GTEA 3MYPA 5D2XA 3TK7A 5HMSA 1SSDA 4ADSA 4JDBA 5FEPA 4EF8A 2NUWA 3M41A 1M6JA 5HWNA 3INPA 4PFMA 3WK1A 3G1VA 1JCLA 4Z08A 5L6UA 2J9XA 4UTKA 3LV5A 4UNLA 2RFGA 3HPSA 4FNQA 5CPNA 1O60A 5AC8A 1AW2A 1XBZA 3PY2A 4DEFA 3FYPA 2ZZ4A 3NPVA 1NEYA 4N9DA 1G67A 1GVSA 3CC1A 3C3NA 1TREA 3O05A 2OT0A 4QM1A 4QQ3A 2QCCA 1WOBA 3FJ6A 2YCEA 3GR7A 5KITA 2E1DA 1RQEA 3W3OA 3T4CA 2Y7DA 3TU9A 3LHZA 4JICA 3T7VA 2ZZ5A 2H3BA 2YGYA 2YFOA 1NF7A 4OV4A 3M16A 2A0NA 3BW3A 4PC8A 4KFNA 3BK0A 2EKCA 3P7YA 3KVLA 1I2OA 3OBKA 3M6YA 3CLMA 5TIMA 4HIBA 5E93A 1B9BA 3W7EA 3TH6A 2OT1A 3KHJA 3W1UA 3W7OA 2QJGA 3LCIA 4H4IA 3IGSA 1XUZA 3NO5A 3BW4A 4AHPA 1AW5A 2ABBA 3M5VA 4ORIA 4DO4A 4K6AA 5F2IA 1J2WA 3G1YA 1OHLA 3EWUA 3TMLA 3NQFA 3ZWTA 1OK6A 3LRKA 3CIWA 3QW4B 1K02A 4O18A 4O19A 1J5TA 5DXXA 1YDOA 4RJEA 4JY9A 3N9SA 4GXMA 2J88A 3N34A 4NZJA 4XTDA 3C2FA 4AH7A 1C8VA 3LCFA 1HO4A 4O4WA 3G18A 3NPWA 4X9SA 3NXFA 5DBUA 2NX9A 4GJ1A 3DFQA 4NJGA 3B4UA 3QM3A 2CLKA 3TA6A 1A5CA 1VRDA 1D9EA 2WPBA 2ISVA 1H7PA 2C0AA 2I9EA 4WOQA 2HSAA 3G3DA 4UUIA 5EMUA 2A1YA 5AHNA 4NT0A 1X7FA 1BEUA 1KFKA 3FKRA 3WK2A 1H7OA 3M5YA 1W37A 3BG9A 4WD0A 3P5YA 3LOTA 1TTIA 2ZA2A 4RZ6A 3CIXA 1TPWA 3MHFA 4YL2A 4NU7A 4DO5A 2B4GA 5CGQA 1Q6QA 5LHEA 1O5XA 1GQNA 2H8ZA 1CX9A 1UB3A 1ICSA 4C1KA 1AK5A 4HPXA 3PVFA 3TJXA 4ZQRA 1OJXA 4WUIA 3GNNA 3W1AA 4CCEA 4X2RA 2QAPA 3W1TA 3NL2A 4Q33A 1BKSA 1EP2A 4LUIA 1TPH1 1ZY9A 3IV3A 3C56A 1GVQA 5AYXA 1TPFA 4M19A 4ZQCA 1QO5A 4RKAA 4Q4KA 4OE7A 2GQ8A 1PL9A 2QKFA 3E0IA 4UTTA 3CWOX 4RXFA 2Q8ZA 1ZFJA 3R5EA 5I3HA 1AL7A 1LOSA 3UWZA 1T0OA 4ZL1A 3LI1A 1OYAA 1FQ0A 5CPMA 2G96A 1HL2A 2FPTA 1XM3A 4PODA 4PTNA 1FUYA 1R47A 1PV8A 4UXDA 3LCLA 5AHLA 2C14A 4UFJA 1Q6LA 1E51A 4UTWC 5LZLA 4DO6A 2H6RA 3ABQA 3CWNA 1OX4B 2J27A 3N3MA 4IUOA 3W7PA 4K8HA 2R14A 3H53A 4I7UA 5K9CA 2QDHA 2ALDA 4YLWA 1OYCA 2FB3A 3U2OA 1BWKA 1LRNA 1WBJA 2NXIA 3AJXA 3NQEA 3UWVA 3IIVA 5U4NA 3LB0A 4JTLA 3GR8A 3QYQA 3LXCA 1KM3A 3UXDA 3DFPA 4Z1CA 4LVDA 3G8EA 3W87A 2Y63A 1MXSA 3I7QA 3RLUA 3TSBA 3MMTA 4RCXA 2UV8G 4CCCA 1DKWA 2V30A 4O16A 1Q6OA 5FEZA 3UXAA 2QUVA 3UPWA 1QAPA 3EKLA 3GVGA 3R2GA 3STGA 4HSOA 1GZGA 4DBEA 4CCDA 3FIGA 4IMCA 1EUAA 3L65A 4ADUA 1LBFA 4JEQA 5C6MA 2RDWA 1G7VA 2VEPA 2H8XA 3P60A 1EWEA 1P4CA 3MO7A 4K7YA 2V5BA 3QMRA 5J5RA 5HUPA 1DBTA 5C54A 5D2WA 3PBYA 1GYLA 3KAOA 3S1WA 5H2ZA 1I2NA 2QCMA 4RLIA 5D2TA 1TQXA 4P61A 4LVAA 2VFDA 3SFKA 2ZRUA 3G1DA 4Z0SA 1K03A 1W3IA 2J6XA 4XBSA 1KLYA 4UTTC 1YLVA 1A5BA 3M0ZA 3TCEA 1GG1A 2VELA 5F2LA 3O6YX 3EWXA 4TMBA 3DFSA 4O11A 2GQAA 3OVQA 4YXGA 1HUVA 2QCNA 2DZXA 1TPEA 1A5AA 2Z2UA 1XDLA 3E12A 3N14A 2FJKA 3EXRA 4JY8A 1PHWA 4AVFA 5LGXA 3S8HA 1Q45A 2H90A 1YYAA 4O57A 5KMYA 1VCGA 2ISWA 2V8ZA 3G1HA 1VLIA 3WJWA 2ZQ0A 4FXSA 3W1MA 1G4TA 4N6EA 3JRKA 3W2UA 1SZGA 5D09A 3H55A 4NNAA 4IX0A 3MI3A 5G4EA 4R7JA 3RU6A 4UCGA 3GNDA 1HTIA 2WSQA 5FESA 3TQVA 5G2IA 1ICQA 1B4EA 3C52A 3RK8A 1SUXA 2FDSA 3PG9A 4O12A 2O7SA 1KTBA 1LRTA 1K8ZA 2ZRYA 4IPJA 4TO8A 4XUGA 3U6WA 4QITA 3I68A 1AG1O 4HNVA 5U7SA 3EX2A 3TE9A 5FEWA 2QCDA 1G7UA 2ZZ2A 1TQJA 2VEMA 1FDYA 4UTMA 1KV5A 4R33A 3HOJA 4CNOA 3GB6A 1GVRA 5K9DA 4UMAA 3GLCA 1LROA 4B5NA 1Q6RA 2FLIA 3A23A 5DBTA 4CLMA 5AHEA 1TV8A 2VC6A
chains in the Genus database with same CATH superfamily
2CHNA 3HU7A 4RR4A 2X7WA 2GVGA 5FJTA 4YWIA 3N73A 3NUKA 4AUBA 1S5TA 1PKYA 3W81A 1E1FA 1DWIM 4E3VA 3GDKA 3MBFA 4CNSA 2JKEA 4GIRA 4AZ7A 4ZO9A 1G6CA 1MZHA 3BGJA 4AWTA 2WHMA 2Y7EA 3EPNA 5FA5A 3UJ2A 2IXUA 1H1YA 2V82A 2B7PA 1NAL1 4KESA 1PS9A 4GZ7A 2E6YA 2W91A 4C1LA 2XZ7A 2Z24A 2JEQA 1EUNA 2OQHA 4GGBA 2PTXA 3PWAA 2PDNA 1NSJA 4DJDC 3KEHA 3P0XA 1W1IE 5EMLA 4AZ6A 2QEZA 4F8XA 2X0YA 3B0VC 3AS3A 1KM6A 5F4XA 4H9UA 1Y5XA 1CXIA 4GFIA 3APYA 4D8ZA 2ZRWA 4IL2A 4QNEA 1XJBA 3ZJ8A 4HVXA 4CNTA 4JPGA 1HKMA 3GNOA 1VBUA 3FFSA 3VDGA 1FWRA 3B8SA 3EA3A 1IWAA 3SCVA 4JBRA 1CXEA 1XCWA 3LSBA 5FEXA 3LNPA 1UWIA 2PDQA 4PCSA 3SCRA 2NT0A 3IWPA 3MUAA 3QVQA 4QS5A 4O28A 2E9MA 5D2VA 2BSLA 3PTQA 1QNQA 3U4AA 1TTJA 2W9MA 1T8QA 4PRRA 1SZEA 3AIWA 1SO4A 4DM1A 3MP4A 3NL5A 1XI3A 3PZOA 2O9TA 1FOBA 1PVNA 2WZMA 2O4MA 2RHGA 4AMAA 4B5TA 3M46A 3HQ1A 2YBTA 2E6DA 4HD5A 4DZHA 3A9BA 5CPTA 2QJHA 2PCQA 4ZEPA 2P76A 5LNRA 1D3HA 1IZJA 1MNSA 4HN8A 1FCVA 2VCAA 1U1HA 3TYCA 5CJMA 1NELA 3W29A 1FKWA 1HT6A 3CAWA 4XO6A 1Z9AA 1SR9A 1ODZA 4L65A 2E4TA 3WH7A 5J04A 2ANUA 3CH0A 4Q4MA 5IHSA 1FWWA 1DIOA 1XLFA 4F0KA 3WQ5A 2C16A 2G41A 4UNKA 3LM7A 1LWJA 3CYJA 2E0PA 3AMLA 3MP5A 2AQVA 4CVWA 5MF5A 1H3GA 1E6XM 2CHOA 1WZAA 2AL1A 1GVEA 4OZOA 4PMQA 1Z42A 4G8TA 3OZPA 2PRLA 3AWOA 2DVXA 2BVDA 3QGVA 1UD2A 3R43A 4QE4A 2CLOA 6A3HA 9RUBA 1TJRA 3EDJA 5D38A 4LRSA 2IXVA 3BUVA 2QV5A 3C61A 5LIYX 2GJXA 4JQ1A 5EL1A 4FEZA 3WLIA 2UY3A 3UZJA 3T4WA 2VOTA 4H2CA 3TQPA 1S3TC 4HJFA 3CEPA 4HT3A 3IJQA 4OBRA 5I3FA 2W79A 4IMDA 1H7WA 3M0MA 3GDLA 3PANA 1JYNA 3ARRA 4LUSA 1PDYA 1BKHA 2CLIA 1G5AA 3PBWA 4W5UA 4GQQA 1E1CB 5EFFA 4IQLA 1QUMA 1UBSA 4UFHA 1E72M 1XYZA 3IIXA 1ZBWA 3OLEA 1IXNA 2A4AA 1YPXA 3MY9A 3OEXA 2HZGA 2YL8A 1VJIA 3GW3A 3WBAA 3CZKA 3NNTA 1XINA 1WKYA 1V3JA 1VYPX 2YXOA 1KKRA 4WX2A 2ACRA 1SGJA 2XGBA 3EXTA 1W5NA 3L2MA 2VOMA 2BB0A 4TVCA 1Q6EA 1U5VA 1LTDA 4ZB0A 5LIWX 3N2XA 1IT0A 3L5LA 3LSCA 4FSAA 3NQBA 1WDRA 1SVDA 3CV7A 2G50A 3ZO9A 1VJSA 4RDZA 3GTXA 5A6MA 1JZ4A 2EKGA 3W07A 4FXRA 1PCWA 4XIAA 1V77A 5BOFA 4JKMA 3NQCA 1A50A 4L9XA 1XWYA 3SGZA 1HJSA 2J7BA 1FTXA 3W1PA 1EP1A 3LGGA 2NQLA 2P0OA 3HJZA 4KW2A 1TMHA 2E8YA 1J4EA 2VUYA 2CKSA 2P8BA 2Z7GA 4L64A 3LCWA 4JTCA 2Z27A 2VGFA 3WQPA 1FA2A 5C9WA 1E3XA 4F0HA 4Z1YA 4QS6A 3UYCA 1JPKA 3AS2A 3HQNA 4AIUA 4GOAA 1JI1A 2CXEA 3T1GA 2BV9A 4MNLA 4HNNA 4UOZA 1NDVA 2FFIA 5BMXA 3KP0A 4O0ZA 2PDFA 1FKXA 3R12A 1DXFA 2ZIDA 4Z42C 4XISA 3VC6A 3NGFA 4MKNA 1FY6A 1R2TA 1EIXA 1Q2SA 3CASA 4GY7A 3T2OA 2Z7KA 3T8QA 5HJYA 1W1VA 3K46A 4GBDA 2WC3A 4ZZ9A 4QTGA 5FI8A 4YHGA 1W1B1 1FRBA 2BXVA 4JR5A 4OKDA 3EXSA 4GZIA 1GUVA 1KM1A 3OVRA 2GVLA 1XLKA 4GIYA 3AYTA 1DIEA 4M6VA 4IT1A 4GUJA 3CV1A 1KKOA 5A6JA 3OHIA 3SN0A 2HBVA 2EBNA 3KDOA 2MUCA 3FLUA 5A2CA 1SJCA 3CT7A 4JFTA 1S38A 1OC6A 3N9RA 2XSXA 2DIEA 3KOWA 4BQ4A 2V2DA 3SM0A 2CLMA 2WZEA 1A5MC 3AROA 1AODA 4B5UA 1PTGA 1W8SA 1OX4A 5GJPA 1JPDX 1LF1A 3L4ZA 1QPRA 1SZNA 3S46A 1EHNA 1UASA 3D3AA 3B05A 3PZVA 3W74A 1OD0A 1P5BA 5A8MA 3GTFA 3DU0A 4LNYA 1E71M 3AI0A 1UUMA 3TJLA 1QWGA 4WGHA 3C4UA 2XSBA 4LFYA 3CBWA 1KM0A 4OECA 5CC7A 5DN1A 3M44A 4M6QA 1NJJA 2I56A 4Q22A 1FDZA 2OX4A 3SR7A 2BOEX 4C5YA 1QW9A 2OFJA 2CZEA 3G1SA 3U2ZA 1GEQA 4AMCA 3ZIZA 1ZAJA 2G95A 4J3VA 4HPGA 3VXGA 1SSGA 1SM9A 4BEQA 1EJRC 2V67A 3DESA 4HZMA 1VAHA 3CHEA 5XINA 3STPA 3L23A 4IQDA 3LLDA 4B5XA 4NRRA 3UJEA 4Q4RA 4RNIA 3HPZA 1ZL1A 2BZNA 4A8LA 3AYRA 5HR7A 1I4NA 3ITYA 3VNLA 2PDKA 1CPUA 2HVOA 1SW0A 3W2JA 3GH7A 2J7CA 4LV9A 1QPOA 5F4WA 1IF2A 1HGWA 3CQ0A 3UY7A 3NURA 5GVJA 3CUJA 3XIMA 3PJTA 1J0IA 1K7FA 4XK2A 6PTDA 1NP2A 1XIJA 1SW7A 2AOSA 2GUYA 5FF2A 2Z26A 3ABOA 4A4AA 3TIMA 2Y85A 3IJ7A 1C8XA 1GYMA 3BAJA 3MDUA 1OT1A 2XN2A 1W5OA 4OIFA 1V02A 1LOQA 4W7VA 3QQ0A 1R30A 2REQA 4PBFA 1WP6A 2BGNE 4NASA 4MWAB 3UZXA 1TWDA 2WZTA 4UQCA 3TV8A 1E6QM 2P5NA 2QDGA 5DF0A 5E6ZA 1C29A 4HBKA 2Y8UA 1S3HA 4CN1A 2YDRA 1OWQA 2PDPA 1GZ1A 4ECLA 4V15A 3PBVA 1LDCA 1PX4A 4KIEA 4RE4A 1SPQA 1Q6FA 4BR1A 3SSZA 3UWUA 1VFSA 1IWBA 1R86A 2GQ9A 1XISA 2VVSA 4LAZA 3C0JA 1KTCA 1H7NA 4O1CA 3RMJA 3SQMA 4D6CA 4XBKA 3EAUA 4OOUA 4PMYA 3SDOA 3DHPA 3A5VA 5HPOA 3WF3A 1R9XA 4OOZA 1Y7VA 3TSDA 3DHFA 5HQLA 1GJPA 4M7SA 1HKJA 2ZXAA 1OBAA 5IOBA 3SSJA 3ENLA 3KOZA 4AF0A 1VBRA 1G4SA 3RJXA 3IIZA 2WQPA 3GZ3A 1ADDA 3EA1A 4QE5A 1R7AA 3ARSA 4CN6A 1X6NA 1QVBA 1WXZA 3ORWA 3NQ7A 4DIAA 1OF8A 1V0MA 2FZ8A 2QJJA 3VIFA 1ENUA 2IQ0A 3NZGA 1CENA 1TPVA 4Q8PA 4K68A 3HG4A 1UR9A 3E96A 2FQIA 5K9XA 3NPXA 1SU5A 3FA5A 5BMWA 2XYLA 5BRBA 1GVFA 1GG0A 4HB7A 4KWVA 1EA0A 1KCXA 2HVNA 1KCLA 4RV8A 3SI9A 1EDTA 1NVMA 1GW1A 1OC7A 3CHFA 4IMFA 4TX9A 3HTWA 5C7VA 4H9TA 3VVGA 3H6OA 4RX0A 3A21A 3A5FA 3TONA 3SURA 2XFYA 1TA3A 3EA2A 1XCFA 3AXIA 3W71A 4FPSA 1TX2A 2J7GA 2QAFA 4YYFA 3QZEA 1F6PA 1J79A 2ZRXA 2OSYA 3WBWA 2VP8A 2D20A 4W89A 3GDMA 1PYFA 3VIGA 2NUXA 3TQKA 2EJAA 3UA3A 4GE8A 1G4EA 7XIMA 2DZUA 3VCCA 3VMOA 3CQHA 1LWIA 5EYWA 2ZFAA 4LBSA 2FTPA 1MW0A 3C2OA 3TN6A 5C9UA 1OZQA 2OGYA 2ZUMA 4GVGA 2GFTA 5JH1A 5AVHA 4FX6M 1YTDA 5T8GA 5FJUA 4DI9A 2PDYA 3PF3A 3WQVA 1PWMA 4MB1A 3N2MA 2DIKA 1JUKA 1CGTA 1XSIA 3HF3A 4FNPA 4HA1A 5E9XA 1XRSA 3S4TA 1EYWA 4P7LA 5C2XA 1J18A 2MANA 1REQA 3R89A 4PUDA 2YBUA 2DFAA 1TVLA 3BJSA 5BRQA 3OG2A 1KRAC 5LXEA 1CIUA 1QATA 3CM4A 3RGTA 5A2BA 2ZUUA 1XDJA 2PTWA 5TD4A 4MNJA 1A3WA 1TMQA 2CLEA 4NX0A 1O5RA 1QK2A 5AN7A 1H63A 2ZC1A 1XICA 4JYEA 3EB4A 4W87A 3E38A 3C2RA 3GRIA 1TRDA 3KM8A 3DYMA 4DWSA 2CWXA 3LHTA 2ABAA 3RRXA 1BVZA 1XG4A 3W00A 1C91A 3QR3A 1CCWB 4PB4A 3AMKA 3STFA 4PCFA 4BCEA 3AIRA 4A21A 1OCJA 2YR1A 3I65A 3T81A 1UYQA 3OZMA 3O8AA 1YTEA 3PTMA 1X6UA 4O0QA 4NJJA 3NQ6A 4FR6A 5C70A 3HMJG 1UUQA 2PDBA 3LCXA 1KFCA 1W9BM 4C6CA 1UMLA 4PCTA 4AY8A 2QJNA 1GVYA 2WSYA 4S3DA 1XH0A 4NAEA 2OO6A 2DP3A 4PR4A 3RX4A 3S0CA 1JG9A 5CPOA 1DJQA 3KHDA 1UD8A 4QSHA 4M5PA 1G69A 3S5NA 3NQAA 1XFBA 2WKGA 1SZRA 4H8VA 3PBMA 3R11A 2EG8A 1ZHAA 4IQJA 1QWKA 2I17A 4QROA 1B9ZA 3HGRA 4ZQPA 1R87A 2G3FA 3K13A 1V6YA 1EP3A 3W70A 3DI1A 3MCNA 5A95A 1KFEA 4ZQMA 2OEKA 3ISIX 2DVTA 3QY7A 3PULA 4AC7C 1DVJA 4MB5A 1K9TA 2ZUNA 3MSRA 3M07A 3B4YA 4AZBA 4PEKA 1BGGA 3CMFA 4DUOA 1FVPA 1XPYA 1VBJA 4XAGA 1CBGA 4DQWA 1GKQA 1RCOB 6XIMA 3V35A 4O1BA 3LLFA 4L4LA 4LNCA 1U1JA 1LYXA 1C9DA 3W9ZA 4AFYA 2ZA3A 1B90A 3ONBA 3ZJ7A 4Z17A 3LY0A 4AD5A 2P50A 3WDRA 2DQXA 1R38A 3KBMA 2ZC8A 5CPLA 3TXZA 1VFTA 3THUA 2OTDA 3W7HA 3HFTA 3VD5A 4A22A 4K39A 1UR3M 4J2MA 1KM2A 3K8KA 3M64A 5A69A 1F5ZA 4QJ5B 2X1SA 3EWBX 2QCDB 3GTHA 2PA6A 5AYBA 4DF2A 9CGTA 2PWHA 2YSWA 3N11A 4FP1A 4LCSA 4PCNA 4O13A 3VZZA 3DHDA 2PS2A 4IFKB 4DB7A 3U7BA 3HBLA 1H4PA 1W32A 3VD4A 4GLEA 3R8GA 4BWLA 2IPJA 4S1FA 4KGLA 4Q7NA 4M82A 2X0SA 2GLKA 4X3ZA 3LXAA 1LT7A 1PIFA 3NQVA 1BVWA 3M5XA 4C1NA 5I3KA 4S3CA 2FPVA 4MUPA 1KLZA 4RPQA 1IEWA 4C6DA 4HU3A 3BJFA 1I0DA 1JCNA 1KB3A 2IW0A 6XIAA 1J93A 1ZBKA 4FA3A 4I7WA 1A47A 2WNNA 3QPEA 5CJNA 3NEHA 4MY9A 1O5KA 3W0KA 3F4WA 1QPNA 4ACZA 3TZNA 2DSZA 4GH1A 1XIFA 5KINA 4CUCA 1J8VA 1J0JA 1S39A 4B90A 3PUEA 5HA7A 3G5EA 1NU5A 3GAYA 2CZ5A 1MFVA 1DJZA 1SFSA 4IJCA 4J27A 3MUY1 5HNRA 4BFAA 2QW5A 3NZPA 3P84A 4NILA 5F2MA 3A4XA 1A4LA 1XYLA 2WCAA 3FS2A 4DBSA 1B3OA 3P62A 3NM1A 1RBAA 3URQA 4XAFA 4HPHA 2GJRA 3V0SA 1EC8A 7REQA 3EBVA 4XTIA 5K7JA 3NA8A 4ZE5A 4Q4QA 1I45A 2IKHA 4AQLA 2PD9A 2UZ9A 5IHRA 1HW6A 3VIPA 5AZ1A 2XM2A 1F4HA 4LY4A 3RF9A 1Q6DA 4WSHA 1XRTA 2F2KA 1W5QA 4QAWA 6TAAA 4XG1A 4PRWA 1CXFA 5CSRA 3M0XA 1LM1A 2F6KA 1XPGA 3FXYA 3LA4A 4JTIA 5FF3A 5A6TC 3CQIA 3KS5A 1LLWA 3WUFA 1WYIA 4JTKA 3W6LA 2AQWA 5A5WA 4KCUA 1F76A 4TXEA 4K7VA 4Q8WA 3WQ8A 4TQTA 4Q8UA 2GPTA 3GO2A 1MO0A 3O6DA 4XWUA 1FH9A 4NYYA 3MHGA 2R8WA 3EEGA 4IZGA 2PZNA 2QPXA 4DX3A 5JU6A 1VFFA 2JEPA 3L12A 1Y65A 2R1PA 4EAYA 4RV3A 1H0IA 4IWWA 5FJPA 3A3WA 3T42A 5IM51 4Y8FA 3TX9A 4MVAA 1MUWA 1V6VA 3SIZA 2HXTA 3L21A 4GYPA 3VOFA 2R94A 2A3AA 2WV8A 1E56A 3KXQA 3VIJA 2EAWA 4RUBA 4JTGA 3WFAA 5XIAA 4EAMA 2GDUA 4ACYA 4PMXA 4N4PA 3PK7A 2PFHA 6CGTA 4GI9A 1HJVA 4MB3A 3LEPA 3TXVA 4M80A 2CW6A 1YQ2A 2VR5A 2VDGA 8TIMA 3VCNA 4NJHA 4F48A 3OGRA 4BK9A 1SFTA 4UFLA 1M7JA 1CTNA 5CCZA 2CWNA 2C6QA 2G3JA 2NWRA 4REQA 5M3WA 3VFCA 3TK7A 3MYPA 5D2XA 4FOJA 5FAJA 2WVVA 4EF8A 1XIIA 3M41A 3G77A 4GQ0A 4HHHA 1DHKA 2J9XA 1UD6A 3E3HA 1LG1A 3VX1A 1K4GA 5CPNA 1IV8A 4RNHA 4LUSB 3GHSA 3PY2A 1TUXA 1EC9A 4DEFA 3WQGA 5JBFA 2ZZ4A 1EJVC 2R1LA 2XINA 5H8UA 4PEEA 4QM1A 3FJ6A 3BAWA 1RP9A 2QZRA 3T4CA 2Y7DA 4R7OA 4ROPA 3G6LA 3TU9A 3GH5A 1AZ1A 3QV6A 3T7VA 2PMQA 2YFOA 4OV4A 4PC8A 2JIWA 3BW3A 1ITCA 1I2OA 4C6PA 4HHLA 3R8HA 3H7UA 4JNZA 1EBHA 1E6ZA 2YLLA 3W1UA 1U33A 2QJGA 2WM0A 3IGSA 4GC3A 2D2OA 1G94A 1FFRA 5ABFA 4AHPA 3M5VA 4GI6A 3WUGA 1CGYA 2ZXQA 4K6AA 1M04A 3WENA 3EWUA 1TR9A 3NQFA 3ZWTA 2DT2A 4MWAC 2EPKX 3LRKA 3MJMA 4O18A 1K6WA 3N9SA 3N34A 3K5XA 4AH7A 3LCFA 1B54A 1E70M 2D0FA 3NPWA 3IACA 2WLYA 3B4UA 3TA6A 3SCPA 1VRDA 4DBUA 4HPNA 2ISVA 3A3HA 4C5ZA 1MXDA 4AD2A 3CUIA 2C0AA 3H2MA 4WOQA 1XYFA 3G3DA 4UUIA 4GVIA 1BEUA 3FKRA 4HZ8A 4LUTA 3MPGA 1H7OA 3UCDA 2UY2A 5BCAA 2AMXA 2XIQA 1N8IA 4WD0A 3WG6A 1A80A 5B80A 1MW2A 4F0MA 4NAFA 3BQ6A 3MHFA 1R85A 1NOWA 2EJ1A 3B9AA 3KZSA 1O5XA 1GQNA 4GZJA 4JIIX 4A3QA 1AK5A 3TJXA 2BXYA 2V5JA 2XVPA 2J78A 4ASTA 5BYWA 3W1AA 4X2RA 3UG3A 3O3RA 2OLHA 4WLCA 1BKSA 1XIDA 1EP2A 1IT8A 3IV3A 1MXGA 3C56A 1GVQA 3GDBA 4DUVA 1QO5A 3N2CA 1RVKA 1PL9A 3E0IA 4LANA 3RLGA 2BNJA 3KP1A 3UWZA 3CZLA 5EGRA 1R6WA 4ZL1A 1FP8A 2R9RA 2FPTA 1XM3A 3WFLA 4A6GA 3M0LA 4Z2KA 5AHLA 2VNCA 4XX6A 1CGXA 1PB0A 1E9LA 1E51A 1Q6LA 5JUVA 1CDGA 1OX4B 4JOMA 2J27A 4XKMA 3N3MA 4IUOA 5A6SA 3DG6A 5K9CA 2J7EA 1HZYA 3U2OA 3NQEA 2FVLA 3EEZA 3LXCA 3ITCA 1V0NA 4MM1A 1YW1A 1K9DA 3TSBA 5HQMA 4Q3MA 5GNZA 2IPFA 1SJAA 2DZBA 2V30A 4HA3A 5FEZA 3RPDA 1QAPA 2QGYA 3EKLA 4HMEA 1GGOA 1T40A 2V5DA 3R2GA 4HSOA 4HP5A 4CQDA 1E5JA 1GZGA 3FIGA 3L65A 5BZAA 3SQSA 3MMUA 4UQEA 4EPEC 4ADUA 1LBFA 4JEQA 3T05A 5TNVA 1NP0A 3QMRA 2CESA 5EMJA 5HUPA 4M24A 5JXQA 2J6VA 2XGIA 1GYLA 5H2ZA 3RMEA 3CHDA 4LVAA 2QIWA 2OVLA 3G1DA 1K03A 3W82A 1W3IA 4H6EA 2J6XA 2VEFA 4UTTC 3H2AA 2ZICA 4QCFA 4TMBA 3DFSA 3VAVA 2GQAA 3OVQA 3WY1A 5HMFA 1OC5A 4ZO7A 4V27A 2ALRA 3BTNA 3N14A 3KUMA 4YTQA 3TN4A 2Z29A 3QKZA 1E4IA 3LBOA 4CD6A 4F9JA 3PPHA 1H1NA 1VLIA 1G4TA 3W2UA 4EKJA 1R3TA 4Q4SA 1EOMA 1AUSL 2GUBA 4J1OA 1F61A 3WQFA 4IX0A 3CIVA 3GVVA 3RU6A 3GNDA 5FESA 3WF1A 1LJYA 3U0HA 2HEJA 1M3UA 1KO0A 2JIEA 1SUXA 1CXKA 2HBXA 3PG9A 2O7SA 4UOJA 3CV2A 3RN6A 2UY5A 3MWCA 1K8ZA 1KC7A 5LA0A 4IPJA 3S83A 3B8VA 3U6WA 4HNVA 3BOFA 3EX2A 5FEWA 1TQJA 4LJ3A 2BY3A 3EZ4A 3PPCA 1L6GA 1VD6A 1DEDA 1GVRA 1EHAA 4UMAA 3P2VA 4B5NA 3V1HA 5DBTA 3SQLA 3T0TA 3WSUA 4R3UA 3WX7A 2VC6A 2NV2A 4J3TA 1V6TA 5H91A 4UR7A 1AA1B 2I9UA 1C7TA 2A85A 4OHQA 1JL8A 3VKKA 2WMFA 3N4FA 4IGHA 1ZJIA 4HN4A 4P7NA 5K3VA 3L4TA 3WLJA 2Z1KA 1OVDA 3RPTA 2QUMA 2YFNA 4AF0B 1OB0A 3UERA 2NQ9A 4EF9A 4UR9A 2DZWA 4J35A 1PDZA 2QT3A 3C0SA 3MKVA 4L80A 4DAFA 4IG2A 3THAA 2CCRA 3NZ1A 1M7OA 1KBIA 3IJ8A 4G6CA 1S2VA 2XH2A 2A7PA 2BOFX 4US5D 2PEVA 2Z1VA 3BLFA 2FTYA 3HQOA 3MJYA 3D47A 1T6MA 3W25A 2OWXA 4C7FA 3LERA 3OB8A 3T9PA 5AFDA 4GQBA 1M9HA 3VCRA 1K8CA 4JD4A 4XSLA 3E0FA 2P10A 2VC9A 4C6NA 4S3FA 1Q8AA 1TPB1 3ITGA 3ES8A 3GM8A 3TMQA 3ABSA 4ZTXA 5LA1A 1TA3B 3D0CA 3V0UA 4FX7A 4ZTYA 4UCFA 4J28A 4Q7IA 1OFEA 4NL1A 2ZXDA 3LHVA 4EWND 1M01A 4ZA0A 4IPPA 3WD0A 3VNDA 3ARZA 3UVIA 1L2QA 4EXBA 2NZLA 4LEQA 5BW6A 3BMVA 1VC4A 3FJLA 1A5NC 4KQNA 2E67A 2J13A 1UH3A 1VEOA 4JNYA 1YEYA 2VTFA 4TUFA 4DYKA 1V6XA 3BARA 1TVPA 3DI0A 3IAPA 3R1ZA 4MLRA 4F0SA 3G1FA 2JGYA 2O55A 3BO9A 1US3A 3L68A 5JIWA 1KGUA 4DJDD 2W66A 4HU8A 2PDLA 3W1QA 3QZAA 4QDPA 3GXIA 4ZCWA 2DY3A 4M0XA 5J8LA 2GDQA 4BQ3A 4H7CA 1JULA 3ZLFA 4BKNA 1MEIA 4OJYA 3DX5A 4KF1A 1Y5VA 3TAOA 2YKKA 5G4HC 1NM9A 5RUBA 1VFLA 5HMEA 4X0VA 1ADOA 1REQB 3UWQA 1B2YA 1QR7A 3C8FA 1UD5A 1PZ2A 1DE6A 3Q37A 3H7RA 3I10A 4O0KA 5HBFA 4M56A 3CL6A 1VYRA 1FP9A 5ENLA 3ARUA 2XDFA 4IMGA 2PZ0A 1BQGA 3CUGA 4MADA 4HCDA 3QEZA 3QV8A 1MQQA 3VIKA 3CUXA 4GYJA 4JIPA 3SECA 4NKCA 3RYSA 1AMKA 4LVFA 4DBWA 3C2VA 5AHMA 2PDHA 3U48A 2F2HA 3G0SA 1HXJA 3JZUA 1E0TA 4DWSB 3UJRA 3G1AA 4MZ8A 5DLCA 3W38A 2DIJA 1KV8A 4LB3A 2IQTA 2X1RA 3JW7A 4NI3A 2ZX7A 3PJWA 2VFFA 2CFFA 4G1KA 2RGMA 3GU9A 2ICSA 1W8GA 5CSUA 3ZVIA 3TW6A 2CKRA 3DGRA 1AL8A 2D22A 4PUUA 1B3XA 3T55A 4NSBA 3WEMA 1JYXA 3K30A 3NL6A 1HN1A 4FXJA 3W26A 3B9EA 2VFGA 1S2CA 2QCHA 2PDUA 5HJLA 1ML1A 4DO7A 2E5BA 1DE5A 4QISA 4XIMA 3P3BA 4NAEB 2E09A 2YYTA 3ARPA 2W0UA 5BNKA 4WRHA 1P43A 3WLTA 1NF0A 4D1IA 1HJQA 4AZCA 3TTSA 1XLDA 4L6OA 4LBRA 3UZYA 4QG9A 4HK5A 1FWFC 3PR2A 3MVIA 4WGXA 1AW1A 1S5MA 3CB3A 3UNDA 3XISA 4KERA 1VQTA 4I6KA 4FHAA 4F0RA 3DBPA 4JYDA 1ZUAX 1RP8A 1VFMA 4DYJA 3F2BA 4QQUA 4NXSA 2BFGA 2B0MA 4KRUA 1CW2A 3PUDA 1WA3A 1XYMA 1OEPA 4NZFA 4Q7BA 1K3UA 1SR0A 1EZ2A 3L4WA 2G4JA 1A53A 1V03A 3W6MA 4KFOA 3OA5A 1Z48A 2ZX5A 4XB3A 4FAMA 3RHGA 1X96A 1XC4A 3UD6A 2P0IA 4HNTA 4L4MA 5JIPA 4O10A 5FJRA 1ME8A 4KT2A 3HPFA 4I9AA 1TJ0A 2PWFA 4H9MA 1I60A 3N04A 1UPMB 3V5FA 1PZ1A 2TYSA 1TV2A 1LT8A 2ATMA 3N1AA 1E0VA 3OW1A 1M7PA 3ITVA 1S2TA 1C3FA 1XBXA 1LLZA 5CZTA 4LOCA 1QPKA 3O06A 1YMYA 3DKLA 3RM9A 2P3EA 1V51A 3ZWSA 3W7KA 2E68A 2NLIA 5D8ZA 4N6FA 2W6RA 4JTSA 4UFKA 3AUOA 1UROA 1LBMA 3PSWA 3NR0A 1QHPA 2D2JA 4LC6A 1KXQA 2FFCA 1VB9A 3FAXA 4ML9A 1PUDA 3L0GA 4YCOA 4JNMA 5HXMA 4C1NB 1QOXA 4PSPA 4QLJA 1F74A 1S5NA 4PL2A 4UQDA 1EWDA 1Q4WA 3QR1A 2ISSA 2VX7A 3AXXA 1W9XA 1WPCA 3C86A 2ZUWA 3ZJ6A 3P0WA 3MS8A 2OKTA 1MQPA 2DZPA 3CO4A 3PTDA 3JUGA 2V9DA 3IJLA 1PIIA 2CPUA 2Z25A 5EBUA 1W9VA 1H7XA 3HGSA 3W85A 4GUIA 1I2PA 3P82A 4XZMX 4N9CA 4JEJA 5DFAA 2WNQA 3R0KA 3ZR5A 4KMQA 3APTA 4E2DA 5F7UA 2WJEA 4WKAA 2FB2A 3AIBA 4AIBA 1CEOA 3TJ4A 1BD0A 1XV8A 3PZMA 3HV8A 4GKLA 3GXNA 3II1A 3UR5A 2NWSA 1MRAA 3WQWA 2BP1A 1X98A 2QF8A 3W7NA 7REQB 3YPIA 5K2ZA 1MRQA 4PULA 3WJXA 1DIDA 3DYOA 1WXYA 3ZOAA 1G0CA 8XIAA 1IGSA 1B1YA 1JDDA 1N55A 1R2RA 1KFWA 4KCVA 1JCXA 4S2BA 4LTSA 1PTAA 4AAJA 4U28A 2FVKA 2X05A 2V68A 1GOQA 3QQ1A 2NX1A 3CPRA 5B7ZA 5CBIA 1V3IA 4FLRA 5IDIA 2GJNA 2DDXA 4WIWA 5HQEA 2XN1A 4M7TA 7ODCA 2ZWYA 3LCGA 5T9BG 3F2CA 1W17A 3MV11 3VFLA 3NG3A 5HINA 3W7CA 4QNWA 3G3MA 1UR2A 2JGQA 2BMBA 3PWGA 4W9TA 3W7JA 3GH4A 2DUZA 3S47A 3VM7A 1TZZA 2OGJA 2HCVA 3T07A 1EX1A 1D7FA 4MJ4A 1EJWC 1BYAA 2RH9A 4LY8A 5CJ5A 3PBUA 3T8LA 4R7WA 4JHMA 1WKFA 4WJ8A 1ZPTA 1CWYA 4HYWA 1W3TA 1SO6A 4NF7A 3F2DA 1ZCOA 4QGCA 4LAMA 4NZ5A 3TROA 3UJSA 5AECA 1IIHA 1U5JA 1UH2A 3QC3A 3C2YA 4RZ4A 2BXZA 1BAGA 4F79A 4K8GA 3GD6A 1BGAA 3KWSA 1VEMA 4RK8A 3W27A 1OGSA 3GYCA 3CUZA 5ABTA 1VR6A 1H61A 1HL9A 2R24A 3M7WA 1UZ4A 4REQB 2PTYA 5GPRA 4AEFA 3GXMA 2YPIA 1EEPA 3NCOA 4UC5A 1S46A 2C8NA 2O9PA 4AD3A 2WVVB 2ZE3A 3H4GA 1L9WA 2ZXBA 5DMNA 1RSCA 3DFTA 4PA8A 2HTMA 1EIBA 1W31A 3JVAA 4US6A 4IIBA 3KW3A 3WIJA 2C7FA 2GVJA 4NHVA 4CD4A 3AC0A 1SYTA 4N42A 4X60A 3TUUA 3LNMA 2HS8A 4WCJA 1RBOB 2V3DA 5I0DA 5FF4A 4AYSA 1W3HA 1QHOA 1YRRA 2VX4A 4NUWA 2D23A 1DWHM 1FHDA 3LU2A 3TYUA 2GGEA 4CD7A 4AISA 3UG8A 3W2KA 1BWLA 3LHYA 2XGZA 4RL3A 4V33A 1V3LA 3KOYA 5LHFA 4NJKA 3C6CA 4EK7A 1H49A 4PTXA 2F6UA 2VURA 2B7OA 4UTFA 2CLFA 2E9LA 5ABFB 3LTPA 1W54A 3IPWA 2A6NA 4O54A 1NH6A 5A6LA 2AGKA 1CNVA 1R3YA 3LPFA 1UKOA 1KWGA 3GNXA 3ARVA 3ZVHA 2PU1A 1OG0A 1LWHA 3LQLA 3NSNA 4GD0A 5IRPA 3M0HA 1JXKA 4XZLX 2BHUA 4AIOA 4B5WA 5EPDA 2YDSA 1EGVA 3BCJA 4PMJA 3QPYA 1B3ZA 4B91A 4ICMA 1IEVA 3WQDA 5I3GA 3W7LA 1FH8A 1TPDA 1VRXA 1X1OA 5HATA 4GRSA 4LUTB 4EOUA 5HMDA 1EJUC 1YXCA 4F2UA 9XIAA 1WKEA 1R3WA 5TF0A 4YPJA 4H7ZA 1OCNA 4AD4A 2A7RA 4NAFB 1EQCA 2Y61A 2WSKA 1B30A 3S9YA 1TRIA 2E77A 2W61A 3SBFA 3FV9A 1YPIA 4LGXA 3DYPA 2OMAA 1WDWA 4HYVA 1RA5A 1DV7A 1HJUA 3KCLA 4GX8A 2Y6ZA 2YIHA 2OG9A 1WX0A 3M0VA 4H8HA 3DC8A 3UT0A 3TC6A 2XU2A 4DPPA 4W84A 4FNTA 3WBEA 5A8OA 2YA2A 3L9CA 1CB2A 4JGDA 3NIYA 3RCMA 1Z69A 3MI6A 2YCJA 4KFPA 1XDMA 4UTIA 3DKJA 3E1F1 6REQB 4GNJA 3BPWA 4ATLA 3E5PA 3ITXA 3OBEA 4MKSA 2XIIA 4ZO8A 2WBKA 4MFEA 1PPIA 1RXOB 3PUOA 1V7AA 5FL0A 5HJXA 4LC8A 4BI7A 3MU7A 4P7RA 3RUBL 1G01A 3EX4A 1K70A 1YE6A 2PRHA 2OR2A 5G2HA 1XGEA 3V5OA 1IIGA 4E3TA 3UU0A 2WQDA 1E15A 1PYMA 3FY1A 3I7RA 3JU2A 1TO3A 4V1YA 1A0DA 2WZHA 3LMYA 4J3WA 3OG3A 1TJ2A 3J7HA 3BANA 4PZVA 2ZZ3A 4IPLA 2OWCA 5I03A 1VZWA 1TPC1 4J3XA 5AHFA 3OIXA 4OV9A 3W86A 1CI1A 1P1MA 1TFVA 3SADA 4FALA 2DSKA 3I3BA 4AG0A 3RG6A 4Y2WA 4IIFA 5D30A 3C2EA 4PL1A 3A4AA 3LDVA 4H6RA 3NYDA 3MSGA 2HNEA 2X09A 3UR7A 3UZWA 3WBXA 2Z28A 2D2GA 2YOCA 1U30A 3VIHA 1F4AA 3DXIA 2PLMA 4A3HA 3HG5A 3RO8A 1L8PA 2GJLA 3P8JA 4C91A 3W2LA 4O52A 1UQZA 4CQCA 5H1WA 2D69A 3GKFA 1F3WA 4MAVA 5IBXA 4MHBA 1DJWA 3SGUA 5FOOA 1EJSC 2PC4A 4O14A 2OWWA 4HNUA 2R82A 4YVPA 2XPKA 5CH9A 1BQCA 3N12A 1TV7A 2ASHA 4ZR8A 3QMSA 3BMXA 3HGOA 1OFAA 3U5YA 3UWWA 4GNVA 3DERA 3H24A 3IEBA 4FLOA 3N29A 1W3JA 1UP3A 1IR1A 4DWSC 4EANA 1MUMA 1CGVA 3KL0A 1UWAA 4QE1A 3W23A 3H2NA 1KQZA 1EJXC 3ATZA 2WB5A 2CLLA 4C6MA 4GVHA 1MSSA 3OVGA 3KTSA 2IKGA 2C1IA 1EB3A 3QJAA 1GCYA 1AD4A 4DNMA 3SUWA 1WUEA 3LM3A 4QJ3B 3GG7A 2YL6A 3LQGA 4LW7A 1UWUA 3S42A 4XVDA 3QGKC 4P5UA 3PHAA 4M51A 2PF8A 2VGIA 2J8TA 1BRLA 1RBLA 2Q3RA 4M6UA 4WHBA 2FYMA 1XLEA 1E9YB 1VYSX 4XZIA 4CNUA 5C55A 4LS2A 1UW9A 1UQYA 2NXGA 3WK0A 1AFSA 1O95A 3UG5A 3QHOA 3STEA 4MYAA 3P93A 2X1IA 2V3GA 3PSVA 3W72A 1EC7A 3FDGA 3DFOA 2CHRA 4J5NA 3THCA 3PS7A 1ONWA 3NL3A 4DF0A 1NQ6A 5A6BA 2VL4A 2X2GA 1PIGA 1JCTA 5D02A 1MW1A 3BG5A 3UWEA 2PDGA 1JDFA 4JTEA 1L6WA 3BAKA 3USZA 3GW0A 4ONVA 4D6GA 3WD4A 4POCA 3KVMA 4C6OA 5I3DA 2UY4A 4UWMA 3E0WA 4KWSA 1QJWA 3TTQA 4IG2B 3REQB 1P0BA 3EPMA 4YWSA 3MUXA 3WH5A 3BVJA 2WWDA 3N17A 3MANA 4AZIA 3CLWA 4DRSA 1ISYA 4ADTA 2X7VA 4M1RA 3ZSSA 3PC0A 5JBEA 2PWDA 1SFLA 3BXWA 1HIZA 4LYQA 3Q58A 1E5NA 5I06A 1IYXA 3GXPA 4CQ8A 1LLOA 3IS4A 4H00A 4UQ9A 2QPSA 2WAGA 2PODA 3LPGA 3O6CA 4LVGA 4S2CA 4C6IA 4BZYA 5DCBA 1K7XA 3QHMA 4I7VA 1IEIA 3PFRA 3W28A 3POHA 3DECA 1OZMA 1L6YA 3LD5A 2XIMA 1VFUA 2XH0A 4S39A 2OYKA 1TX0A 1VKFA 1PBGA 4E8DA 4H6KA 1S1RA 2J24A 3TQ0A 4BWLC 4X2PA 5ABHA 3B97A 3FW6A 1ODUA 3L2IA 2EPLX 3OOQA 3RDKA 1I8JA 2PDMA 4XQ6A 3IIOA 3V0TA 2OEMA 1E55A 4JX6A 2O56A 2D0GA 4LVBA 7TIMA 2VYOA 2C0HA 4PYSA 5F1UA 3CZGA 4ZSUA 4NVTA 1ZBCA 1OD8A 4TOQA 4MFDA 3TNBA 1F3XA 3VZXA 2CZFA 2HK1A 1AJ2A 5EA9A 3WEOA 1KTNA 5DMYA 4J7RA 2DPEA 4LXFA 4OU1A 2WKJA 1ZCCA 3GIYA 1ZGDA 2R6OA 3D5HA 4I5UA 5G4WA 4S3BA 3IV8A 4E6MA 2YW3A 4IXHA 3S2CA 3ZLHA 4Q8VA 3CNYA 1XCXA 3V4BA 4Q8OA 3VZYA 1A5OC 4MNKA 4WZHA 4N2YA 2LLEA 1ZLPA 1R0MA 2PTZA 3PJUA 3UXLA 3GTNA 3UBPC 4UMBA 3Q2DA 4QJ1A 1W1ZA 5C9XA 4JHZA 3IARA 3KFTA 2NV1A 1BXNA 4PH6A 4JTUA 4MDPA 1TB3A 2A3BA 1EEXA 5LXXA 3U2EA 1QHZA 2GDVA 2PDWA 8RUCA 1YNQA 3KRUA 1JD7A 1Z44A 1XLGA 3OTRA 3BGGA 3FNDA 3QZ6A 4FB7A 4RNJA 4A3UA 5CC5A 4L9ZA 3W53A 1T99A 4UQAA 5HMSA 1T41A 3EOUA 4JDBA 1ZU8A 1JDCA 2NUWA 4QCEA 1M6JA 5HWNA 3INPA 3AU6A 3G1VA 1JCLA 4Z08A 3M0YA 4U10A 3PZTA 5KZ6A 3F4VA 4Y8EA 1JF5A 3WLRA 1XG3A 2Y1HA 2RFGA 1EL3A 3HPSA 4FNQA 1XBZA 1UC4A 4L6DA 3MKKA 3FYPA 5BXSA 4HTBA 4N9DA 2EPMX 1GVSA 1TREA 2PWUA 5CGMA 2XM1A 1WB0A 3AYSA 2A79A 2E1DA 3BC9A 2BVWA 4W7WA 3ZYZA 3ITOA 2D1ZA 2VRQA 3IAQA 4LB4A 3CO8A 3LHZA 2HE5A 3O7UA 4L4PA 3S9ZA 2H3BA 4RE3A 4ZB5A 4YTTA 2VMFA 4KFNA 1HKVA 5BU9A 1TELA 1UA3A 2EKCA 4IM4A 3KVLA 1J2BA 3OBKA 3M6YA 3PTKA 4GYPC 3CLMA 3HA1A 5TIMA 2X40A 3MMDA 4JQ2A 1AJZA 5A8NA 3W7OA 1WO2A 4PN2A 3NO5A 3BW4A 4HMDA 1LUCA 1NQKA 3QV9A 2PP0A 2WMHA 5F2IA 1J2WA 3G1YA 1OK6A 1R3VA 4RJEA 4JY9A 3T08A 2XZ9A 5D9OA 4C90A 2FHBA 4O4WA 4X9SA 1ONEA 5CAHA 5JMUA 4GJ1A 4FOKA 2CLKA 4EP8C 5C2CA 4A8NA 3VOHA 1H7PA 2I9EA 4G2DA 2HSAA 3AALA 1RUSA 1P0EA 5EMUA 2A1YA 5CPSA 3DFYA 3WK2A 3M5YA 4TTUA 1BVNP 3CT2A 2YCLA 1W37A 3BG9A 4IJRA 2QMJA 1TTIA 4H19A 2WMKA 2GVYA 4RZ6A 2DW7A 3TWBA 1OQFA 2XFRA 1IEQA 2B4GA 3BQ5A 8XIMA 1KRBC 5I24A 2H8ZA 1UB3A 2GSHA 1UP2A 3TYBA 1GOIA 2PLJA 3V5CA 5A94A 2CLPA 3I3DA 2XIBA 4ZQRA 2WLZA 2GJPA 4CCEA 1CLKA 2QAPA 4MAZA 3GNPA 4DUXA 3KCOA 2PDXA 3H12A 1XW8A 1TPFA 2KAUC 2PB1A 3LENA 4MWAD 3DG3A 4ZQCA 2Q01A 4Q4KA 2AL2B 2GQ8A 3CWOX 4RXFA 5DT7A 3EDEA 3LZ3A 3AHTA 4S3EA 1LOSA 4Z2HA 5BROA 4YTUA 3N9KA 1FQ0A 3WMLA 5CPMA 2NVAA 2G96A 1DTNA 2ODOA 1HL2A 1QI0A 4PTNA 4NRSA 4PODA 1TR1A 3VDHA 2Y2WA 3LCLA 1OG6A 1W3KA 3S1GA 4WSJA 3PZGA 4UTWC 4DO6A 1PTDA 1GOOA 1XLIA 2XHYA 3ITLA 3W7PA 4RW5A 3EMCA 3QY8A 2QDHA 2ALDA 1QRQA 3G6MA 5D8WA 2WMIA 5U4NA 3QYQA 4HNLA 1HQTA 1XD1A 3GFZA 1CLXA 3S6OA 3DFPA 3G8EA 2Y63A 1MXSA 1RA0A 2UV8G 3Q65A 2PUZA 4RCXA 4MJ2A 3WDQA 4W8LA 5HOSA 3NOYA 3TYAA 1GOKA 2PBOA 4IMCA 3QLLA 3EMQA 3ZSTA 1HX0A 4C6BA 1XYAA 4LYPA 4ZO6A 4QFUA 1AZ2A 2F6XA 4GPNA 1G7VA 2VEPA 1FWEC 1UZDA 1ZBVA 1LL7A 1P48A 5J5RA 5PTDA 5REQB 5FJIA 4GA8A 2RAGA 3AZSA 2GGGA 3GUGA 2QCMA 1TQXA 2TODA 4EXAA 4Z0SA 4C60A 3R7MA 3A3XA 5E0CA 5F2LA 4GZEA 3O6YX 3NWRA 3EWXA 3AIVA 3GE7A 1Q13A 1TPEA 3MO4A 1A5AA 2Z2UA 4L56A 3VC5A 4HTYA 4AVFA 1C8YA 2H90A 4O57A 4DZIA 3AHYA 2PDJA 2TAAA 3DN5A 4ZBCA 4Z2GA 3G1HA 4XAZA 3W1MA 1GOMA 5FSDC 5D09A 4AY7A 1VIWA 4NNAA 3GC5A 4ZE4A 5G4EA 4R7JA 1WDDA 4UCGA 3AISA 5DEZA 1MWOA 2WSQA 2VD9A 1LQ0A 3QLDA 3QTPA 4WSKA 4F2BA 3RK8A 4HCLA 1XC6A 1L6FA 4XD6A 3UF9A 3WQOA 3W01A 3AZRA 4TX8A 4XUGA 5M1TA 2WXDM 3RCYA 5U7SA 3TE9A 3GC2A 1M53A 4L1GA 4ML4A 2ZWZA 2VEMA 1Z89A 5TAOA 4UTMA 4WDWA 3HOJA 5MKGA 1F3TA 1ISVA 2NQ5A 5K9DA 1RPKA 2C71A 3DGBA 1NFGA 1FHVA 1BHGA 3PFMA 2GK1A 3OHMB 5ECVA 5CZKA 1GHSA 5AHEA 1IR2A 5D9PA 3ZT5A 3TAKA 1XLJA 1Q66A 4DJFD 1Q5MA 3WLOA 1OX6A 4WDTA 4UB9A 4PFHA 3O0FA 4O4VA 4I9JA 4IXXA 4Y96A 1J96A 3E0LA 4H04A 5HR6A 4PMZA 1NFPA 1FWCC 1EGMA 3N19B 3AXHA 5CZSA 4R53A 3ES7A 3GG8A 4AWEA 1S1PA 4CEUC 1W0MA 4X61A 1ZENA 1MW3A 3T0BA 4GXPA 5M5DA 2XH7A 1EX5A 4U3AA 3SW6A 1P0KA 4WY0A 3VNKA 1GEHA 1MQRA 2B81A 3OZOA 5HWMA 2OU4A 4H8UA 4Q4OA 3PZ9A 1EA9C 4U4MA 2RKXA 3SCTA 3LPOA 1YTKA 3BCFA 3ARXA 3DFHA 4Z1DA 2VGGA 2QJMA 4NZCA 1MZRA 3GXTA 2JBMA 1EO5A 4LH8A 4FK9A 5D03A 3RX2A 4B15A 5AZ0A 4PTVA 2OZ3A 1PKNA 5C8BB 4UZUA 3QGAC 5FL1A 4H7VA 1IQ8A 1W1A1 2ZKMX 1CXLA 2DV0A 1JEZA 3R4IA 3ZVHB 2NXHA 3H21A 1G1YA 5EU9A 1A49A 3BL3A 3QW3A 1HJXA 1I9CB 1Q7MA 1GQKA 4IOTA 5DELA 3NDOA 4BF5A 3A4JA 2QR6A 4DYEA 3MQTA 3DHUA 1B0IA 1W6TA 4DJED 3T0CA 4KCTA 2AAAA 3OBAA 5I3IA 3AHZA 4HU0A 2VZOA 2ZX6A 4IISA 2VZVA 4ZODA 4IF2A 4W7UA 3NQDA 4B5VA 2ZDSA 2HV5A 1KFJA 1O66A 3VD7A 4OUIA 3WH8A 5AOUA 4MZ1A 1JIBA 3H2OA 4BI5A 4MTVA 2FGBA 3OP2A 5I7GA 2FKPA 5CC6A 1EZWA 1DQXA 1WDPA 1DWAM 3BE7A 1UBPC 5DCEA 4O1DA 4ENLA 4RPPA 2QJIA 5LKYA 5T9CE 1WBHA 2I14A 4H9YA 1E3ZA 3WNOA 5LIUX 1JPIA 4ERAA 2V2HA 3MTWA 4AEOA 3RLVA 3SJ3A 5AYIA 2VRKA 3OA3A 1TV5A 4ZOAA 3HJEA 3VINA 3AXKA 4B9YA 2GUUA 3N13A 9XIMA 4K38A 4GXWA 3PG8A 5HNUA 1Z41A 1FH7A 2DZSA 4E5TA 3W6YA 3SCUA 2WPGA 4QG6A 1A5SA 1FWHC 3G2GA 4AXNA 3W7QA 2BX7A 2NUYA 3VGGA 3WLKX 3L5AA 4V1XA 4FF5A 4ERIA 5EKYA 3T6CA 2G37A 1IEXA 3FX4A 3EWDA 1NDZA 4PTWA 4D9PA 3BURA 3EGJA 3ZS4A 2OKOA 1K7EA 3Q67A 2BASA 1BSLA 1JNDA 3TTOA 1MNZA 2Q3OA 5T91A 4GYKA 2OZ8A 3KTCA 3FYYA 5BWFA 2V3FA 4DUWA 2YZ5A 3HG2A 4JN6A 1I0BA 2SFPA 3GIQA 3VE9A 2IKIA 4UBPC 6ALDA 4GC4A 4I8DA 1NFBA 2YX0A 3D46A 5BXTA 1RLCL 1J9YA 1SW3A 4LYKA 4IUGA 3VA8A 1XQLA 4U2YA 3TVAA 4XZHA 4TVDA 1VH7A 3O0KA 2ZTKA 3S9IA 4FX8A 1FCQA 3T44A 2VZSA 1SJDA 4UTJA 1THFD 4KGJA 5AC5A 4U5IA 2XG9A 2VUNA 4S38A 4H9VA 1W2VA 1NDWA 1FFQA 4Y90A 5CC3A 3B0YA 5KZEA 2OXNA 3GX9A 3NVTA 2FIQA 2CZDA 1XSKA 2WVTA 3P5ZA 4RW3A 3WD3A 5D05A 1WCGA 4MJZA 2DZVA 5A2AA 3SY5A 3GU1A 4NYUA 5GQBA 4Q6JA 3C3UA 4HCHA 1W5PA 2EPHA 4BA0A 3OU8A 3P74A 3AYVA 1X6LA 2ZUVA 1Q85A 2PU0A 5FF0A 5DY2A 3SIMA 8A3HA 1OK4A 2XH4A 1S2UA 1I2QA 5ABEA 3T0DA 4O15A 4AZGA 1DORA 1UR8A 3GQYA 3AXMA 1XH1A 4O1AA 2PGWA 4XAPA 4K1GA 1N7KA 4JTAA 4S3AA 4M6PA 5A8GA 4A8IA 5BOOA 3TC3A 2IKJA 2ZRZA 2H3DA 3VX0A 1XS2A 4OT7A 4A2RA 4DJFA 1FHLA 2WBGA 3MUCA 3M1ZA 2F38A 2CBUA 3E2RA 3K1GA 1Q3NA 4ZGYA 2ZTJA 1YDVA 4H1ZA 4PBGA 2EPNA 1RVGA 1U2YA 5D33A 2H9AA 1FX6A 3ARWA 3TLLA 4XZWA 4NQ1A 4URIA 1HP5A 1BTCA 3E2SA 4GWEA 1RPXA 1R2SA 1HJWA 2Z1WA 3O6AA 5E0KA 1D3CA 3W7MA 3SUTA 3VOJA 4A3YA 2YB1A 4WQ6A 3G22A 3USBA 5H8PA 3LS9A 4LX4A 4QBXA 1AH3A 2Q71A 3RX3A 1OT2A 4DPQA 2VEKA 5C9RA 3CTLA 1K4HA 1PZ0A 1ZQ5A 3NEVA 2TSYA 1A4MA 3V16A 3WL1A 1VPQA 2D3NA 3AIQA 1XFCA 2C79A 3VOIA 1TZ7A 3BLEA 1YE4A 3RR1A 3S5YA 3G24A 1YBQA 2ADAA 5CG0A 1FWTA 1XH2A 3RILA 4JIRA 3K2GA 1MEHA 3BLKA 3BGAA 1I1XA 2X41A 2QDEA 2PWVA 1J0ZA 2Z00A 4KEMA 1W2PA 3RAOA 1OFRA 2JK2A 3PM6A 2VR2A 3NQ2A 5TBOA 3N3TA 2JKPA 1VGAA 4QXIA 1ECEA 1VFHA 3ZLGA 4BHYA 3LBMA 2QQ6A 2Z6IA 3EB2A 2GL5A 2OZ0A 1GT8A 2V63A 3W7DA 4BI6A 1H60A 3W4RA 2BY0A 5FIPA 3H23A 4JFWA 1WDQA 5I00A 3KRZA 2FH6A 2G5WA 2AQOA 2BVTA 2OO0A 3VGDA 4GI4A 4N9BA 3SN1A 3W1RA 3H22A 2ZZ6A 1J0KA 1DJYA 4HK6A 3WNLA 3WUBA 1RJRA 1Z6KA 1SJBA 2R91A 2HWGA 4IJBA 1WZLA 2DZTA 1EDQA 2DUAA 4O8AA 3VKBA 1V93A 3KLKA 1F2JA 4ICCX 4E2VA 3SN4A 4UR8A 4B2DD 2Y5JA 2TMDA 5CZJA 1VFOA 3GC4A 5AC6A 2J79A 4W93A 4IGSA 4JYFA 8CGTA 3HURA 2EG7A 2ZVIA 3VE7A 3MI2A 4RDYA 5G1MA 4AX7A 3EDDA 4MYXA 4V28A 5AYYA 1O68A 3GFXA 1QTWA 3B8IA 1W1YA 2VENA 3GVRA 3S1UA 3IUDA 1TZ9A 2BY1A 2NLYA 2ZBTA 3IJDA 3APGA 1XXXA 1OIFA 1HKIA 2QV4A 2C15A 4E4PA 3RR4A 1QXLA 1JCYA 1EXPA 1GNXA 2Y88A 4XD5A 3VOCA 1N2VA 1K9EA 4LYRA 4D1JA 3KL5A 1ZRQA 3ABRA 1QOQA 1RQBA 2JE8A 1XX1A 1RV8A 3NQMA 1QU4A 2VM8A 1KNWA 2W27A 1RHCA 1F7BA 1KXTA 2JALA 2VFIA 1R7OA 2X30A 3MV01 3TYZA 5BXRA 3CZ8A 2RDUA 2PURA 2YW4A 1W1TA 4F9DA 3R79A 2V2CA 4LS1A 2ZX9A 4PMNA 3TR2A 3VIOA 1QNVA 2YDAA 2PGRA 1WOAA 2E3ZA 2JKAA 3BICA 1K1DA 2HPMA 2ZVRA 4HA4A 1GQLA 1I6NA 3MUZ1 3LXBA 1SO3A 3BV7A 1P6WA 1F05A 2CBJA 3IGXA 5DXYA 3G1RA 4J2PA 3ELFA 3H54A 3P81A 4CU7A 3VNZA 2Y62A 3U3HA 2CETA 1O4UA 3BJTA 1XIMA 3HPXA 1UA7A 1TSIA 4JKKA 3S5OA 2GGJA 3WLQA 3L5MA 3VYLA 4AY1A 2PRMA 4TU1A 4CCZA 3BSGA 1XQKA 5AYZA 2FPYA 3W84A 1TCDA 2HVMA 3BLLA 3KBWA 3V18A 5EBAA 1R8LA 3IGHX 1XLHA 3NYZA 1TKKA 1ZP3A 4KH2A 4BEUA 1DPMA 4EVZA 4FLSA 4WY0F 4GISA 1POKA 1Y8BA 4R85A 2PWGA 4FIQA 2FDMA 2C19A 2GJXB 1OIMA 1VIZA 4Y9PA 2P8CA 1LUCB 4AX6A 4PMRA 1X97A 1UUOA 4A35A 4RXGA 1YADA 4DZ5A 2A5HA 3TN5A 3RITA 1WUFA 4AEEA 4QEHA 2X42A 2Q09A 3MMWA 1M5WA 2RDTA 3TFXA 3TN3A 4G7EA 2VCBA 2VO5A 3GG1A 4LAKA 4AHOA 4OBSA 3BLDA 2X2YA 4CQ9A 1RALA 3URNA 2ZUTA 3B9DA 4LCRA 1MDLA 4V2XA 2VQTA 3KBNA 1QNRA 1EJ7L 2IPGA 4CNPA 1TWWA 4PMDA 3AMCA 4YYCA 2JQXA 3DZ1A 3EKZA 3KCJA 3SY8A 2WSPA 1U83A 1XLLA 2YCLB 2DJXA 4QEEA 1DOSA 3PZUA 2ZE0A 1PAMA 1DJHA 5L9FA 4J9JA 2I57A 3F7JA 1V3HA 3QYSA 3K4DA 4R9OA 1V3MA 2C3ZA 2YL9A 5C0QA 2DW6A 4QIUA 3FGCA 1UZHA 3ALGA 3IJIA 1VF8A 4KIRA 1BG4A 4KWWA 1C92A 4QJ4B 2QS8A 3DC0A 3R13A 1W3NA 2YDQA 2OCZA 2QUTA 1KM4A 3EWWA 3BAYA 3VGEA 4B5SA 2WCGA 3UESA 3OLGA 3WMBA 2AGTA 1Q63A 1ZNNA 5HWJA 4UTWA 3W1NA 1BTMA 3EOOA 3FCPA 2EGZA 5K4ZA 1E4NA 2Y7FA 2G8ZA 5CSSA 1JRCA 4I3GA 1UD3A 2Y70A 2FZDA 4RDVA 1AH0A 4H2HA 1JFHA 3WH6A 3S5ZA 3TFCA 3GKAA 4ZOEA 4Q4PA 1EF2A 4UTHA 3NM3A 3KRSA 4YIWA 1TUFA 3AOFA 2BDQA 3I7SA 1VHCA 3HIJA 4NX5A 4XZBA 2WMIB 4OBTA 3H2CA 3P80A 4DBDA 3F4NA 1AQFA 3WDPP 3MZNA 2HDJA 5DRIA 3RM8A 3M7SA 3VKCA 2J74A 1PX3A 2E7FA 3VNJA 4B2DA 4ZVJA 2FH8A 1H7RA 3P8IA 3PNZA 3SZ8A 3UNTA 1Q7QA 3WJSA 4X22A 4NXKA 4U31A 1DJNA 4C6QA 2WANA 3DH7A 2O4QA 2HJPA 3H4XA 3MW7A 1X1ZA 1XLMA 4J3SA 5AC7A 1KR1A 2JF7A <