1D3HA

Human dihydroorotate dehydrogenase complexed with antiproliferative agent a771726
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
367
structure length
364
Chain Sequence
MATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE
publication title Structures of human dihydroorotate dehydrogenase in complex with antiproliferative agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 136
structure length 364
sequence length 367
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 1999-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1d3hA00
1SW7A 1H1ZA 1HO1A 1LZOA 1BTMA 5F2GA 3NOEA 1GVOA 5D05A 4BI7A 5EY5A 3W22A 2QCHA 4O14A 3ABOA 4IPJA 6ALDA 4CQAA 1K7XA 3G22A 1M5WA 3FJLA 1W37A 2Z6IA 3G0XA 4L4LA 2X1UA 5HJLA 2BZNA 1H5YA 5L9FA 1U5JA 4X3ZA 4NJJA 2B0MA 4PCFA 1KFJA 1FWTA 3W2NA 1J4EA 4BI6A 1O5XA 1R47A 4BF9A 4ZQMA 1PE1A 4K8HA 1ZALA 5TBOA 4UNKA 3IIVA 3P5YA 2ZZ2A 2X1SA 4Z08A 1KV5A 3QJAA 3U2OA 4Z1BA 3W7IA 1SPQA 4JN6A 4UTJA 3T40A 4FNPA 1FDYA 1R30A 1VLIA 1FWNA 2NX1A 3DHDA 1YTKA 4JTSA 3W7KA 3Q2DA 4XQ6A 4JTKA 1OX5A 4DF0A 1ZCOA 3YPIA 1D3GA 1KFCA 3QMSA 3UWZA 4K8EA 1SFJA 1K3UA 4IUOA 3EX3A 3BVJA 4LVAA 4KFOA 3W84A 1I2RA 1T99A 1UB3A 2A7NA 3HOJA 4RCXA 4DF2A 3VE9A 1XCFA 3GDKA 1XBYA 4JD4A 4DELA 1NSJA 4LOCA 4ADTA 1W3IA 3DFTA 1H7WA 4FNQA 1OFDA 3QQ1A 5LNWA 1PV8A 5K4XA 3R89A 1F76A 1I8JA 3TFCA 2BLEA 2DZVA 5D09A 2O7SA 4S2CA 1WAUA 2PCQA 1G4SA 4EOUA 5KZDA 4MYAA 1VYRA 1B57A 3PR2A 4GUGA 3MI3A 2BX7A 3NR0A 2F7FA 5BMXA 2X1RA 3C61A 4ML9A 1SZFA 3GR7A 4UMCA 1MZHA 3M7WA 3HGOA 1WBHA 4ZVJA 4YLWA 1XDMA 1C8VA 4LUJA 4UFJA 3DFQA 2NZLA 1EUNA 3M47A 3S8HA 2J6XA 1AK5A 1VC4A 2Z6JA 3N14A 1H7PA 1VJIA 4DBEA 5E1QA 3EXTA 3BPWA 2P1FA 1IXOA 4N6FA 2A4AA 3EWZA 3Q94A 3GAKA 1THFD 2RDUA 3LHWA 4XBSA 4DPPA 4FO4A 3QF0A 3TQKA 4OE7A 3IRDA 4NJIA 3QQ0A 1NEYA 1VHCA 5KITA 2CZDA 3HGRA 5LZLA 2A6LA 5D37A 5EKYA 3N3MA 3PULA 3S5NA 1TSIA 1ADOA 1F05A 4OGZA 5CPLA 1NF7A 1R2SA 1H51A 5HMSA 3KRUA 2H90A 3NM1A 4HSOA 2ISVA 2QUUA 2ZFAA 5AHIA 5J5RA 3EB2A 2ZYFA 4UNLA 3PUDA 5CSRA 4U28A 4QITA 4PEKA 1R46A 4YWIA 3G1XA 4HT3A 3U6WA 1LLWA 2YXGA 3MP4A 1SZGA 1G4TA 2A85A 4UXDA 4ALDA 4A21A 1OFOA 1FDZA 4NJHA 1YADA 3L65A 5D30A 1W5MA 1MSSA 4UMAA 4O52A 1DQWA 4GUHA 1FWSA 3WK3A 1OFAA 1WXJA 2E6AA 1SUXA 2X2GA 3VFLA 2NX9A 3H54A 1T0OA 1SZEA 3A23A 4A2SA 4DPQA 2B7PA 4JICA 2IQTA 2W6RA 4JTFA 3S0CA 2C0AA 3W2KA 3DH7A 4FB7A 3EWBX 3HJZA 3G0SA 4ZQOA 1ZENA 4UFIA 1DOSA 1KM0A 5EPDA 3NAVA 1UUOA 3TH6A 3GYEA 3N2XA 2ZZ4A 3GR8A 1TV7A 1KFEA 2RFGA 5MHBA 4XTDA 2X1TA 1O5KA 3W83A 5LKYA 1ICSA 4Z1DA 1X7FA 1S3HA 5AC7A 1WBJA 5GVJA 3A24A 3WFAA 2YX0A 3H53A 2DZTA 3SI9A 1LDCA 1ZAIA 1KW1A 2A2IA 2XN0A 3VI2A 4W9TA 5A5WA 5DXYA 2A0NA 5FESA 3KVLA 5FF0A 3W7PA 4LC8A 4JIQA 3WK1A 4NNCA 3P60A 1FCQA 3M44A 4IXHA 1ME9A 5CZTA 3INPA 3W73A 1K8XA 3L0GA 4HNTA 1OYCA 3BV4A 3NQVA 5BMWA 4OHQA 3DFPA 3PC0A 3UQNA 4JGDA 4AF0B 4TR9A 4Y8FA 4LV9A 4MZ1A 3W1UA 1L6WA 3CM4A 2QCCA 1OG0A 5L6UA 4S2BA 3LTPA 3EWWA 3KRZA 2YDAA 3S1UA 5TQLA 2DZXA 5D32A 3LHYA 1VCGA 1ZFJA 3PVFA 3UWUA 5EYWA 4R33A 3LV5A 3N9SA 1Z42A 3BW4A 4KWVA 1I2PA 1XKYA 3BLFA 3NQCA 3E96A 1HL2A 4GE8A 2YGYA 3RMJA 1VYPX 2NV1A 2QCGA 2NUXA 3P8JA 3S42A 3MHGA 5DELA 4LVBA 3HB9A 1MXSA 3OG3A 3TSMA 4P2VA 1SSDA 2C6QA 1LM1A 3FYPA 3ZWTA 3P8IA 3TU9A 4ONVA 2WSRA 2VFDA 1VGAA 1TPDA 3U8GA 5F2IA 4RXFA 4E38A 5F4SA 3O1NA 4QISA 3GNNA 4K38A 5EL1A 3UWQA 4A29A 3PBVA 4FNUA 4ZQNA 2ZQ0A 4UTLA 1XBZA 2QEZA 2FPYA 4IMCA 4LT9A 3CB8A 4FF7A 2EHHA 1DQXA 3GDMA 5ABTA 4GXMA 4XWUA 5FF3A 3E02A 3W7NA 5CGQA 1RV8A 4FX7A 2GVLA 3TDFA 3GAYA 1JCXA 1JULA 1RZMA 4O12A 4O1CA 3TMQA 1HUVA 1JVNA 3L5LA 1ZJIA 3P82A 1N8FA 1K02A 1SO4A 1G6CA 3Q37A 3IEBA 2QR6A 4UC5A 3C2RA 3O07A 4EF8A 2C19A 4NJGA 1FQ0A 3QM3A 2R14A 3S1WA 2C13A 2EPHA 1AW1A 5SWUA 4LVDA 4UUIA 5CG7A 1KBIA 3DXIA 1UCWA 4TU1A 3TQVA 1X1OA 2YW4A 1DV7A 4OV4A 2B7QA 4N4PA 3IV3A 4TMBA 3M16A 5AHLA 3HBLA 1PHQA 3SGUA 2ZRXA 2JKAA 3LI1A 1T8XA 2OT0A 1U83A 4GNJA 5BRBA 3W7GA 4O16A 3UZJA 4K39A 4CLMA 1E51A 2ABBA 3TR2A 4IGHA 2J9XA 4N9DA 3UXDA 3THAA 2OJPA 1DKWA 2E1DA 2V2DA 5F2LA 1GOXA 4CCEA 2CZ5A 2VFGA 4IPIA 2DZPA 3L68A 2A5HA 5CZJA 1LOQA 3PBWA 4JTLA 4O18A 3G3DA 1ALDA 3NL5A 1H7NA 2OT1A 2JKEA 1FDJA 4LTSA 3NQ2A 3VCRA 3ZWSA 3OHIA 1GPWA 2PURA 2OCZA 3M0ZA 3V75A 5FEPA 4JTHA 1KM3A 1VR6A 4AMAA 3HIJA 2YFOA 3B8DA 4PODA 2FFCA 3W85A 3PG8A 1HTIA 4O19A 5AB3A 2JBMA 2QKFA 4X9SA 3P67A 4YMZA 3BW3A 3CHVA 3TW7A 3GDLA 4O8RA 3CIWA 1UASA 2ZTJA 4U4MA 4ICNA 1TTJA 1JCLA 1GVSA 1TJRA 1CX9A 1YTDA 3NL6A 4PTNA 4QM1A 3LXAA 4JEQA 4LVFA 1JCMP 1GYNA 2ZZ3A 1K7FA 3LV6A 3B04A 3BO9A 5HQEA 1DJNA 4BWLC 2FJKA 4GUFA 4ZZ9A 4LV4A 3WJWA 3W1QA 4ZMGA 1V5XA 1EWEA 2CLOA 2BXVA 4NVTA 4MUZA 4QIUA 2Y7EA 1Q6RA 4OWGA 2PE4A 1F6KA 3ANYA 3MBFA 4WOZA 3TIMA 1G67A 1YTEA 4AHQA 2QJGA 3TE9A 3CWOX 3LDVA 3C2EA 4GUJA 5HUPA 4TMCA 2Y62A 1M7PA 3G1DA 5I3FA 3BLIA 2CWNA 3EX4A 1I45A 5J5DA 1MEWA 1S5TA 1R2RA 2JK2A 1VLWA 2TMDA 1EX5A 1I2QA 2QUVA 7TIMA 3MP5A 3GXTA 3RFAA 1J2WA 1OK6A 1A5CA 3F4WA 1VH7A 4AF0A 2WSYA 3CTLA 3NNTA 5AHNA 1F2JA 1W56A 3G1FA 3PY2A 5LNVA 1YXDA 2HTMA 1YDVA 1LCOA 3TX9A 1Q45A 4WD0A 4PC8A 1O60A 3MYOA 2PRLA 4R7JA 4LC6A 3MJYA 1AG1O 1BWLA 2EAWA 1B9BA 3E9AA 5BW6A 1H61A 1TREA 4RX0A 5DN1A 4O15A 1PCWA 1QPRA 4AB4A 1IXQA 4WZHA 1X8FA 2BSLA 2VFIA 2Y7GA 4DBDA 5KZEA 3KRSA 3NQAA 4PFMA 1OFPA 4UR7A 3QSTA 2VFEA 2ZBTA 5KSWA 3LERA 1EP3A 2H6RA 1XUUA 2WKJA 1JJKA 1YYAA 1BKSA 1P0NA 3R12A 4BWLA 5EMUA 1JUKA 4XTIA 5K9XA 2C16A 3I65A 3W7MA 3RK8A 1TRIA 3P81A 4L4MA 3MP3A 4HNUA 4G1KA 5U4NA 3NA8A 2G96A 4H3DA 2OMAA 1ZNNA 3DFSA 1VQTA 2E68A 4NUWA 5AN7A 3O6YX 1F73A 4MY8A 2UV8G 3N73A 3G3MA 2CZEA 2VEMA 3MHFA 3CU2A 5D2YA 1SW3A 4ZQPA 3O63A 3JR2A 1Q6OA 3IIZA 1P5BA 1VCFA 3OVQA 4UFLA 4WY0B 1D9EA 3P80A 2Y7FA 2Y63A 3W87A 2HMCA 4TX9A 4I7UA 5K3VA 3TXZA 4ORMA 4IX2A 5G4WA 3N19B 1JRCA 5C2XA 1GZGA 4RJEA 2X30A 1GYLA 3W1NA 3G18A 1GVFA 3W7HA 3QZEA 1FXPA 4YL2A 1RVGA 3CC1A 3T7VA 1LRNA 3A9IA 2EGZA 1S5WA 4M7TA 4UTMA 3M5XA 5AFDA 3USBA 3LLDA 1XBXA 2YSWA 1TO3A 4NNAA 4N9EA 3NQ7A 5AHMA 3WK2A 4N9BA 3IGXA 1QMLA 3WJZA 3P84A 2Y70A 5LHFA 3TCEA 2OX1A 2A7PA 4Q33A 3L0NA 3LOTA 4DF1A 3W74A 3W7CA 4GC4A 2E5DA 3TJXA 3THQA 1DL3A 2NXIA 3TXVA 3S1XA 3UNDA 3W07A 2ABAA 4GJ1A 4WXYA 1SO3A 3GB6A 3JRKA 3OA3A 3LCFA 5LGZA 3NPWA 4Q4KA 1C9DA 1TV8A 1X1ZA 4Y96A 2ZA3A 1AMKA 1WQ5A 3G1YA 2DZSA 3T78A 3E0IA 3W7DA 3SZ8A 2YCEA 4PA8A 3W75A 5K4ZA 2Y7DA 3P74A 3HQ1A 3WJYA 3PM6A 1TQXA 5KINA 3LB0A 1RPXA 3B0VC 1TRDA 1JCNA 3G1SA 4AXKA 2CFFA 3M1ZA 3KX6A 1W1ZA 4RXGA 1OFRA 5F4WA 2QCDB 3NVTA 1G4PA 4O0ZA 1ICQA 3HF3A 1QFEA 5G1TA 1VRDA 4LWWA 2VEPA 5DY3A 5G1YA 1PIIA 3C4UA 1GWJA 3KOFA 4RZ6A 3O15A 1JQVA 1PVNA 3BARA 3R2GA 3SW6A 2B7OA 4K6AA 4K36A 4DO6A 4CNPA 4AAJA 2ZRUA 2WPBA 4KFNA 1XDLA 3M9YA 4GWEA 8TIMA 4NZFA 2Q3RA 3GIYA 1B3OA 5FF2A 4AEOA 5HWJA 2ZZ6A 2CU0A 1MEHA 2FPVA 2DZUA 2DJXA 2ZTKA 3QEZA 5DCBA 5D03A 4JX6A 4EF9A 1H60A 1G7UA 4Z0SA 2GQ8A 3DENA 3GNDA 4OBTA 1LOLA 1XXXA 5HR7A 1LORA 2FQIA 2QAFA 2QAPA 1NFBA 1W8SA 3LXCA 4DO4A 3C2VA 3UWYA 2VC6A 4HNNA 4JY8A 3TC6A 1OF6A 3KVKA 3CIXA 3JS3A 1KA9F 1Q3NA 3L21A 1W3TA 1GTEA 2Z1BA 1TMHA 3CQ0A 3KFTA 4UTUA 3GDRA 1QDSA 4R34A 1RR2A 3QMTA 2NV2A 3EXSA 5F4XA 1DHPA 3NQMA 1PL9A 3WJSA 2YPIA 3STEA 3FA5A 1TQJA 4MPQA 3EX1A 1K7EA 3UZ5A 1W5PA 4I7VA 3B0UX 1GVQA 4IWWA 2GQ9A 3V1PA 1G69A 4FNTA 4FNRA 2WNNA 2HS6A 3Q58A 5E0KA 2GJLA 5DBUA 2QJIA 3NL3A 2C18A 1LRTA 1GG1A 4UTHA 3UXAA 1NF0A 1KM4A 1ONRA 2QDGA 3W1PA 2ZA2A 3FYOA 4UTKA 4NZJA 4IMFA 5D38A 1F6PA 2FLIA 2QF7A 3NXFA 1IIHA 2C14A 3SJ3A 1TTPA 2Y85A 1OFEA 1IXNA 3PSVA 4MY1A 4DO5A 1YXYA 3BK0A 4M7SA 1ME7A 1A5BA 3TAKA 4OU1A 1EP2A 3MWAA 2DU2A 4A3UA 5FF7A 3HPXA 2H8ZA 3W2MA 2FB2A 3OBKA 2VFFA 2QCMA 4ADSA 4TO8A 4S1FA 3M5ZA 1KV8A 4IQLA 4C1KA 3ATYA 3PB2A 2CLHA 5FF4A 4RZ4A 1RQEA 4UR8A 4WY0A 5I3GA 2F84A 4YXGA 1XFBA 4M6PA 4NJKA 4JR5A 4LW7A 4WJEA 5CPMA 2FPTA 2V30A 1KTCA 3PUEA 3I6RA 1EUAA 4A22A 4LU0A 2WNZA 4HSNA 1GVRA 3TUUA 1KLYA 2CLLA 4LS2A 4UIOA 3G1VA 1I4NA 4JX4A 4MJMA 3L5MA 3ABQA 3KAOA 3TSDA 1FX6A 3MYPA 2V0TA 2E77A 2J9YA 2EF9A 4YCOA 2ZA1A 5CZ0A 1OVDA 2ZDRA 1QNVA 6TIMA 4BI5A 1PCKA 4LUIA 5K7JA 4MVAA 2RDTA 3QPZA 3I7SA 1TTQA 1OX4B 2GVJA 3QMRA 5HWNA 3HMJG 4M6QA 2WSQA 1Z48A 2V2HA 3MO7A 3MW7A 2YR1A 3LRMA 4ORIA 5D2WA 1LBLA 3S1VA 4HPXA 3QYQA 1ZAHA 5G2WA 3T4CA 5D2XA 4ZL1A 4GRSA 1OX6A 3G8RA 3DZ1A 3NZ1A 3MBDA 2ZRVA 3S6DA 2WQPA 2C3ZA 4UTWC 3C2OA 2C15A 5T26A 3HO8A 1P0KA 1W54A 3IIXA 1QAPA 4HKPA 2J88A 4X22A 4JYEA 5DY2A 5DCEA 5K2ZA 2VFHA 2JGQA 3LCWA 1F74A 1V7YA 1KFKA 2C1HA 4TIMA 3W7LA 3GXNA 2G5WA 1GJPA 3W23A 3W7QA 1OYAA 3W70A 2QCDA 3M41A 5CSSA 2QUTA 4QSHA 3LGEA 4O53A 1KM5A 3W1MA 3N9RA 4LRTA 2WJZA 2A7RA 3NEVA 1LP6A 2AGKA 2JKPA 5EBUA 3C2FA 4IMDA 3W7JA 1UBSA 4NT0A 4JY9A 3DGRA 1QWGA 3B05A 1I2NA 3FLUA 3MMTA 3TQ0A 1LROA 2NUWA 2CZFA 2G95A 3QSRA 2DP3A 5EA9A 3W72A 3DFOA 1R2TA 1L2UA 2H3BA 1TPFA 4LRSA 3EEGA 3ZR4A 3QPYA 1OYBA 3L5AA 3EX2A 1A50A 5FEZA 3NPXA 3L2IA 3G0UA 4PH6A 1SQ7A 2PRHA 3SR7A 4AHPA 3NQGA 1OJXA 4UTWA 1EA0A 3UWWA 3B0PA 3S5ZA 4M19A 1IF2A 1WA3A 1D3HA 1O94A 2AAMA 4JTUA 3W1AA 4O1AA 4MLRA 1PHWA 1Z44A 1TPWA 3ZFHA 4I9AA 1KM2A 4O13A 2RH9A 3W2JA 1GEQA 4FIRA 4JX5A 1P1XA 3DBPA 4HNVA 4MKNA 3A22A 5FEWA 3PBUA 3LCXA 5F1UA 4UFMA 2QJHA 3MUXA 5U7SA 1O4UA 1QPQA 3VKJA 3SFKA 3W1LA 2CLKA 4CNNA 1WV2A 3OIXA 2ISWA 1VYSX 3GKAA 1O95A 3NPUA 1TTIA 3NO5A 1H1YA 2ZZ5A 3NQ8A 3H55A 3DI0A 3TMLA 3PBYA 3CLMA 3M43A 3ATZA 3FJ6A 2YZRA 4JTIA 1QCWA 3HG3A 4O28A 3OVRA 1LRQA 2W0UA 4CQ8A 3NG3A 3LRKA 1B4KA 3F4NA 1CI1A 5LSMA 4JDBA 1AL8A 2V5LA 1ICPA 1ZY9A 3DU0A 2RKXA 1SU5A 4UTIA 3E12A 3C3NA 1DBTA 2VELA 2VEIA 4ZQRA 5HULA 2NUYA 3MI2A 2FDSA 2PRMA 1A5SA 3KHJA 1LOSA 4AWSA 2XN2A 2O7QA 3TKFA 5LGXA 2TRSA 5H2ZA 3RU6A 1W31A 1N7KA 3EKZA 2V5BA 4O1BA 5CPOA 3QW3A 1FXQA 1YPIA 3LRLA 1T96A 4HHPA 3L0KA 1JQXA 1OABA 3BW2A 3FEMA 5G5IA 1FY6A 3W6YA 1UJPA 4C1LA 5HNRA 3C0JA 3PSWA 3OEXA 4M5PA 1WOBA 1W5NA 4NQ1A 1KFBA 4RLIA 1XL9A 1OK4A 3C52A 3TC7A 2CLMA 3W7EA 4JXCA 4DQWA 5BOOA 3EWYA 3GK0A 1HFBA 1KM6A 2V9DA 3CEUA 4JTEA 3DFNA 3PWAA 4FX8A 4K7YA 4Q32A 2ZRZA 1OX4A 1L6SA 4N4QA 3S5YA 5KZMA 2GQAA 1ZAJA 2J27A 3TAOA 5G4EA 5CZSA 2KZHA 2BWGA 1ML1A 2VXNA 3KVJA 3DAQA 3HPZA 2J9ZA 1YDNA 2FIQA 3CEPA 5HUOA 5AOUA 3KVMA 5HR6A 1BWKA 2A21A 4OQVA 1DORA 1GQNA 2LLEA 4LS0A 4O54A 3FS2A 1JRBA 5CPNA 1QR7A 1RQHA 1PS9A 3BLEA 3LHTA 5DXXA 2V2CA 1XI3A 1H50A 1NVMA 2E5CA 3NL2A 2A1YA 2ZRWA 4HN4A 3SECA 1TV5A 3IGSA 1W5QA 5G2IA 2B4GA 2XN1A 4JNMA 2B7NA 4FXRA 1YLVA 5DBTA 5FI8A 2YFNA 2J24A 3W1RA 5D04C 2WV8A 4AH7A 3EKLA 3IIPA 2ZCGA 5LNSA 2A6NA 2I1OA 4QJ1A 5K9DA 3HG5A 1EIXA 3S5OA 1ZHAA 5FEXA 3C8FA 1FCVA 2BTMA 4EWND 3PB0A 4BK9A 1FCBA 2TSYA 3L67A 1WYIA 5D33A 4P61A 4RKAA 3NPVA 1DVJA 3STGA 3QRHA 1K8ZA 5A8GA 1KTBA 3K30A 2H3DA 5D2TA 3EWXA 3TROA 4UMBA 2GVGA 3LI0A 2WOQA 4RR4A 4MYXA 4XKYB 1EWDA 3FKRA 2ATSA 1G7VA 4H4IA 3EWUA 2X16A 3SSJA 1FWWA 1VHNA 3I7RA 4FNSA 3BG9A 1GG0A 2GUUA 4O0KA 2DJLA 3W86A 1TJPA 4Z0JA 3LBMA 3W2LA 1W3NA 1YDOA 5F1VA 3HGSA 5AC8A 3EX6A 1MEIA 3BG3A 1DJQA 4Z1CA 5C55A 3R13A 3TA6A 1UUMA 3PAJA 5D2VA 5AYZA 1XC4A 4JS3A 4Y9AA 4IX0A 2ISSA 1OHLA 2P0OA 1Z41A 4E0CA 3NQEA 3EXRA 2QCLA 3A21A 1JUEA 4IXXA 3P61A 5C54A 2ALDA 2VENA 1S5VA 3LM7A 1I2OA 2VKZG 3GZ3A 4Z1AA 3HPSA 3W88A 5CKSA 2XFWA 4N6EA 4POCA 1H7OA 3ZS4A 4LY8A 2NXGA 4FEZA 1FUYA 2Y89A 4NU7A 1YXCA 3G8EA 3ELFA 3HGJA 3ABSA 3CT7A 3TNOA 1GT8A 4LNYA 5IBXC 3AO0A 1TCDA 1QPNA 3HG4A 2TPSA 3LHVA 4K37A 2GPTA 4X2RA 3N2MA 4NNBA 3UY7A 2V8ZA 1QO2A 2Y6ZA 4ADUA 3IVUA 1LTDA 2W79A 1XBVA 4B5NA 4FIQA 5AC6A 5I3IA 2WO5A 1Q6LA 1QOPA 4MLJA 2RHGA 4DXVA 3NGJA 3A5FA 3QFEA 1IIGA 4IMEA 3P5ZA 5AHEA 3R5EA 1FWRA 1F5ZA 1KLZA 5BNKA 3LTSA 1TPEA 4WUIA 3LCLA 3UPBA 3P7YA 1RQBA 4IMGA 4PL1A 4O50A 4CCDA 3W3OA 3SIZA 3GVGA 5LNRA 1H62A 3O8AA 1BEUA 2E5BA 2QCFA 3T55A 5KTLA 1GTHA 2H8XA 3LCHA 4BR1A 4XUGA 3O6CA 3I68A 2VEKA 1SO5A 1P4CA 3F1QA 2PC4A 3GDTA 5DLCA 4NXSA 4EVZA 3SY5A 4UTTC 2NXHA 3DI1A 4FHAA 4H6KA 5I3JA 4BFAA 4D2JA 1FCUA 3LBCA 4RV8A 3RLVA 3FOKA 4EIVA 3MI6A 1XUZA 3PG9A 2ZRYA 3BGGA 3WJXA 4MZYA 1QPOA 2EKCA 1TPH1 4MJZA 3C56A 4WOQA 4I7WA 4N9CA 1K03A 5IBXA 2RDWA 4MIMA 1OF8A 2YYTA 4RK8A 1X6UA 4PL2A 3TV8A 3FIGA 3W2UA 1JUBA 2DORA 1B4EA 3PS7A 2G97A 3LCGA 3I7QA 3LLFA 4AWTA 3E49A 4E2DA 4A2RA 1TPC1 4AWUA 2V81A 3M6YA 5G2HA 3NYZA 3NQ6A 3S9YA 1N55A 2WNQA 3CPRA 2E6YA 4O11A 4CCCA 3M5VA 3LXBA 4NX0A 1L9WA 2NX3A 3KXQA 2OZ0A 3M5YA 4O57A 3FKKA 3A5VA 2R94A 4MFEA 3O05A 1SO6A 1SR9A 4JTJA 1SZNA 3B03A 3TJLA 3R8RA 3LHZA 4AHOA 3B06A 3CWNA 4LVGA 2VOMA 5D02A 1KFLA 4UTTA 2NWRA 4JTGA 4GBUA 2Q3OA 4JYFA 4R53A 2QCEA 2YW3A 4XZ9A 1L6YA 1TPUA 2R91A 2DZWA 3TK7A 3UD6A 3LCIA 3NM3A 3L66A 1HO4A 4UFKA 1VS1A 2NWSA 1CW2A 3SGZA 4K7VA 1M7OA 1MO0A 1TB3A 5C5YA 3TFXA 1TIMA 3OVPA 1J5TA 4JDYA 3QH2A 4MY9A 3G24A 4HIBA 4N2YA 2HS8A 3P62A 4LS1A 3GLCA 1A53A 4XKYA 1K8YA 5H91A 2Q8ZA 2GOUA 1RD5A 5F2MA 4QNEA 1JCYA 2CLFA 3GX9A 4JIPA 4HPJA 4WY0F 1ME8A 2Y88A 4CNOA 2ATMA 3W76A 2V82A 3UPWA 1EEPA 1AL7A 1SFLA 3PUOA 3VE7A 4KKXA 4O17A 3DHFA 5I3HA 3VNDA 4JTTA 3IGUA 4KFPA 1VCVA 3PF3A 1XM3A 1KBJA 1OFQA 1Q6QA 4UCGA 1QO5A 1H7RA 3N34A 4E2BA 3HG2A 3GKFA 3W1XA 3WK0A 4YCPA 1YPFA 1Y0EA 5AYYA 3L9CA 3STFA 5HWMA 2QDHA 2I14A 3G1AA 1TPVA 2D73A 2Z2UA 4MOZA 5DCDA 4O1DA 3O06A 4OV9A 1G4EA 1QOQA 5K9CA 1KTNA 1HG3A 2YYUA 4J9JA 3DKJA 4Y90A 3LHUA 5LHEA 5C6MA 2Z0IA 4XBKA 1LBFA 1EB3A 1SW0A 3TSBA 3BGJA 1FBAA 1NAL1 4O10A 4OT7A 3GXPA 4UFHA 1H7XA 1M6JA 4JYDA 3LTYA 1JR1A 3BG5A 4MZ8A 1IXPA 4IJBA 1TPB1 3C6CA 2FB3A 3RLUA 3QW4B 1TYGA 4KWWA 3RNDA 3NQDA 3IVSA 3IVTA 1IGSA 3TW6A 5AHFA 4FX6M 1VZWA 4O4WA 5TIMA 5LNUA 1A5AA 3W1TA 3W7OA 3NZRA 4MFDA 1OFBA 2I9EA 4WQ6A 5I3KA 4QNWA 1WOAA 3B4UA 4NX5A 2NLIA 1SSGA 4FXSA 1LLZA 4NXKA 3FFSA 2JGYA 4IOTA 1F7BA 2HSAA 1AW5A 3D0CA 2Y61A 1AW2A 2ZZ7A 1EPXA 4AVFA 2R8WA 2GJNA 3RF9A 3W9ZA 2QCNA 3G1HA 4M6VA 4Y6GA 3UYCA 1KM1A 3IIOA 2CLIA 4GFSA 3STCA 3NQFA 1VPXA 1W0MA 2E6FA 4ZQCA 4QAIA 5IM51 3T44A 5AYXA 3O16A 2TYSA 2ZZ1A 3DKLA 3NDOA 4N02A 2AQWA 5E93A 4QQ3A 3UWVA 1W5OA 3W71A 4DEFA 4WX2A 3UY8A 1WX0A 1LBMA 4WXZA 1EP1A 3AJXA 3W7RA 3ABRA 3LX9A 2E6DA 1LYXA 3MHUA 3O6DA 2E09A 5HINA 3F03K 3QC3A 4RZ5A 2Q8LA 4GUIA 2CW6A 4CQ9A 4O4VA 2P10A 1WDWA 2FTPA 5KMYA 1C29A 1H63A 1JCJA 2CLEA
chains in the Genus database with same CATH superfamily
4DWSA 1MQPA 5E70A 1L6GA 4F9DA 1US3A 1BTMA 3WQEA 1X6LA 5JBFA 4IPJA 2P8CA 2Z1XA 3K8KA 4F48A 5AZ1A 2HBXA 3BQ5A 4I9MA 3G22A 2CERA 1YE6A 3G0XA 5HJLA 4HGXA 2A3HA 3BAYA 4EAYA 4H9UA 2F6XA 4W8LA 1O5XA 4BHYA 3PHAA 5HMDA 1ZALA 3GW3A 5DRIA 1DHKA 3OLIA 3BMWA 1V08A 3QJAA 4Z1BA 4HHMA 4FNPA 3FHQA 2GJXB 4J3TA 2PUZA 1FWNA 2NX1A 2YCKX 3DHDA 3I6EA 2FZBA 1VEPA 4H9VA 4BCEA 1KFCA 3QMSA 2DQWA 4J3VA 3UWZA 2WM0A 3FA3A 1T41A 4QDWA 4RCXA 3HOJA 1XBYA 4JD4A 1B3XA 2DV0A 1NSJA 4BQ2A 3HFTA 3UFYA 1W3IA 4FNQA 1OFDA 1DJYA 3BANA 3UJFA 3R89A 1I8JA 3KEHA 4D6CA 2BLEA 4G2DA 2X42A 4AQLA 5JIPA 3KBWA 2QMJA 1NTHA 4I6KA 1QUMA 3ALFA 1NARA 4CU6A 4JFSA 3WF3A 1X98A 3B0XA 4JHZA 2VC9A 3WSUA 4LUTA 3SY8A 1B57A 1HJWA 1XPGA 4GQGA 2BX7A 1ECQA 3LEPA 2F7FA 1OT1A 3APTA 3UZXA 3OGSA 4WGXA 4ML9A 2GSHA 4UMCA 1MZHA 3HGOA 5B7ZA 4YLWA 1HVXA 4LUJA 3DFQA 2NZLA 3M47A 2J6XA 2DW6A 2DSKA 1TR9A 5XIMA 1A3HA 1VC4A 3NIYA 2ZX8A 3VPLA 3PPGA 3WEOA 5E1QA 3EXTA 2XVLA 2P1FA 4JFVA 1BXCA 3Q94A 3PZNA 3U4FA 3QF0A 3EB3A 1UD5A 1GW9A 2BFGA 1AQFA 4JQ1A 1XYCA 1TJ0A 5LZLA 2CBVA 2E28A 5GQBA 2WHKA 3ARQA 2VX5A 2DEPA 4J3ZA 3H8AA 5CAHA 3NM1A 2ISVA 4Q6XA 4AD0A 2ZFAA 1W8GA 1RPKA 4UNLA 4NAFA 3CHCA 3PUDA 4Z2JA 5CSRA 3GG8A 4QITA 1ISVA 3U6WA 1LL4A 4RDYA 4GGHA 1SZGA 3DOPA 4NJHA 2ZKMX 2EBNA 1CDGA 1MSSA 3N9KA 4GUHA 1NELA 1OFAA 2BGNE 1WXJA 2JF6A 1A0DA 1O5QA 2QV4A 2NX9A 3RILA 1JEZA 4TVUA 4MTVA 4DPQA 2I5IA 2OZ8A 1JI2A 1MQQA 4JTFA 1KXHA 1ONXA 4FB7A 1V3HA 4ES4A 2VZUA 4ZQOA 2XG9A 4QP0A 1S1RA 1DOSA 3TH6A 1UR4A 4C65A 3MJMA 3N2XA 2ZZ4A 3QYSA 2XGZA 9CGTA 1O5KA 1X7FA 3O0KA 2OZ3A 1ZQ5A 1S3HA 2HZGA 4ZO9A 1L0PA 5A6MA 1TZ9A 2YBUA 5DT7A 3GTFA 4OJYA 4OZOA 1UWTA 4Z2IA 4H8VA 2BXYA 1A5OC 3OQ8A 3VZXA 1LDCA 2PAJA 4LFYA 3VO0A 3RO8A 2A2IA 2XN0A 2ZWZA 1GYMA 2C1GA 3ISIX 4W9TA 5BXPA 1QI2A 2JQXA 4LC8A 4JIQA 3WK1A 3M44A 5CZTA 1K8XA 2EG6A 4JTDA 1QU4A 5BU9A 5BMWA 2VR5A 3CQJA 3UQNA 3PZVA 4DUWA 1O1HA 3JW7A 3QLLA 2DIJA 2HK0A 1TWIA 1CB2A 2GVEA 3V16A 2ZUSA 2NVCA 4LBRA 1FFRA 4HTYA 2E9LA 5ABFA 5EYWA 3WLJA 4QE1A 1YMYA 3N9SA 4ZB0A 2Y4SA 1XINA 4QE5A 1XKYA 2WC4A 4KIRA 3E96A 1HL2A 1XS2A 3GG1A 4RE3A 4FLRA 1YNYA 4KRZA 1WXZA 1QBAA 3D46A 2AKMA 3MKVA 4XBJA 5CPSA 1MXSA 3OG3A 2C6QA 1LM1A 3FYPA 3A4JA 3THCA 3ZWTA 3EOLA 5EMMA 3WF4A 3VGHA 1VGAA 3RJXA 3BGAA 3HV8A 3EEZA 4ZQNA 2V67A 3IWPA 2AGTA 3N25A 4GABA 1TVLA 5JVLA 1QW9A 3OGVA 4GXMA 3UXKA 5FF3A 1Y65A 5CGQA 1RV8A 3VIFA 2FMOA 1NWUA 3SCNA 3ZJ7A 4CUCA 2C71A 2D0HA 3O0FA 1NOUA 4JNZA 4O1CA 3TMQA 1ESWA 1N8FA 1IWPA 3TJIA 1O1ZA 3POCA 4GCXA 1ISYA 4PE8A 4UC5A 4W8BA 1W9UA 4EF8A 3T0TA 4CD5A 1FQ0A 3UJ2A 2ALRA 2E8ZA 2EPHA 3GVWA 4C6JA 3IJDA 2NQZA 3DXIA 1UCWA 4BEQA 4CQCA 2YW4A 2Z28A 5IFPA 4TMBA 3HBLA 2XWDA 3TN5A 1XF0A 5DF0A 3W7GA 1US2A 1J0ZA 2J9XA 5A6TC 2V2DA 4GIEA 3AROA 2ZUVA 2FH6A 1PXGA 3UEQA 4JTLA 4NG3A 3WUEA 4MWAE 2XFFA 3WLMA 1RSCA 4IQDA 1FDJA 1C7TA 4IFOA 4LTSA 3EDFA 3NQ2A 4HMCA 2XJ7A 3OHIA 3ZWSA 2DSWA 4CD8A 1CXKA 3M0ZA 5IRPA 3V75A 4MNKA 1E9IA 3UESA 2EG7A 1GZJA 4XD6A 3NO3A 1ZTVA 5C9ZA 2YFOA 4MNMA 1M41A 1QW7A 1DIKA 4ERAA 4LUSA 1IV8A 4PODA 5JBDA 3DEQA 3PG8A 5HOSA 4AUBA 4JIHA 3AS1A 5C8BB 4O8RA 4WVXA 1UASA 1A3WA 5H1WA 4CNSA 2BG5A 2AAAA 1JCLA 4K68A 5IHSA 4P8XA 4GJJA 3OQEA 1E3ZA 3WD0A 5HATA 1JCMP 1GYNA 4YJ5A 4C5YA 4GUFA 3ZT7A 4ZZ9A 2A79A 3QHNA 1H41A 2WCSA 4MUZA 4OWGA 3ANYA 1TA3A 4WOZA 2BHZA 2VUNA 3GC4A 3VGEA 3LDVA 5HUPA 3BLIA 1KB3A 2PLKA 4AISA 5EMYA 1UIOA 4AZ7A 1YEYA 4F2UA 1VLWA 1EX5A 1CXFA 1I2QA 3MP5A 3RFAA 2IQDA 4YYFA 2BY0A 2NT1A 2V5CA 1VB9A 2UY4A 1VH7A 2JEPA 4AF0A 2WSYA 2WM1A 5AZ0A 1LCOA 1Q45A 4WD0A 2OWCA 1Q6DA 1RA0A 2PRLA 2VNCA 4LC6A 2VCAA 4J3UA 3BV7A 1H61A 4U33A 1QPRA 3SUSA 4AB4A 1IXQA 4WZHA 4KETA 2BSLA 2VDHA 1MW2A 4FLOA 4I8DA 1YPXA 2ZBTA 3OTRA 2WZHA 3LERA 3LM3A 2H6RA 2WKJA 3FJNA 3N13A 1ODUA 3DGBA 3UGVA 5K9XA 3WBAA 3GTIA 3RK8A 5HBFA 3P81A 1JDFA 4L4MA 3MP3A 3EOEA 4HNUA 3SCPA 4D6DA 1EGVA 2OMAA 1VQTA 4KMQA 5ABHA 3ANUA 3C3UA 4MY8A 2OVLA 1P43A 2UV8G 4ERGA 4RE0A 2GUYA 2VEMA 1QHOA 3WLQA 3EDEA 3JR2A 1F4AA 3H2AA 4WY0B 4XIAA 1EHAA 1L8NA 3G77A 1MRAA 1CEOA 3ZXWA 3FVMA 3W87A 4TX9A 4ORMA 4IX2A 2TODA 3HZ3A 3W7HA 3QZEA 3CO8A 1KQZA 1FXPA 1RVGA 3CC1A 5C7VA 4TV5A 1WKYA 4DX3A 1S5WA 4XO7A 1CT5A 2NQJA 1UWQA 3QGAC 3UYIA 4WK9A 1XLKA 3LLDA 4NNAA 1MZRA 1UC4A 3NQ7A 2JEQA 3IGXA 4BF5A 3OZMA 3W74A 3W7CA 1EC7A 4GC4A 3CZLA 3TJXA 5XINA 2DY3A 1BF2A 3LY0A 3CUIA 2NXIA 2E0PA 3EKGA 4LYKA 1SO3A 4QS6A 3JRKA 3LCFA 3V1HA 2Z1VA 1X1ZA 1UG6A 2ZA3A 4LAMA 4HVXA 3PJWA 3T78A 3E0IA 3SZ8A 4AY8A 2PMQA 2YLAA 3VIGA 1XKJA 1HNYA 4DZIA 3B0VC 5JXQA 2CFFA 3M1ZA 2YDSA 3KX6A 3RIKA 3NEHA 3WO8A 1IEWA 3OU8A 3CMGA 2F9RA 1RBLA 4EK7A 3IAQA 4ECLA 1A49A 4ILSA 2VEPA 4LXFA 3MS8A 3SQLA 1BG4A 3O15A 3ES7A 1PVNA 5C2GA 2OEJA 3BARA 3BMXA 1E9YB 2Y5EA 4GWEA 1A5NC 4IISA 5EGRA 4NZFA 4E8DA 8TIMA 2ZX9A 1RY8A 3GIYA 3UZWA 3DC8A 5FF2A 4AEOA 2J7DA 5HWJA 2CU0A 1MEHA 5DCBA 2DZUA 5D03A 4JX6A 1CLXA 2C91A 3WDHA 4HPNA 4W86A 3CHEA 4OBTA 2QAFA 1SYTA 5HPCA 3WFLA 1NFBA 3LXCA 2YA2A 4DO4A 3UWYA 3VIKA 3TC6A 3KVKA 1IQ8A 1XISA 4Y9NA 2QF8A 3JS3A 5CCZA 1FVPA 1Q3NA 3L21A 4PCTA 1TJ1A 2ISDA 1TMHA 1E0TA 1EJ7L 3W29A 3POHA 4YVPA 2PGWA 2YPIA 4D9PA 4AVOA 2XFYA 1UOZA 3EX1A 1K7EA 2Y8VA 3KBSA 3TQPA 3GXDA 1U5VA 2ZWYA 1LL7A 2WMHA 1JZ4A 2X0HA 2GJLA 2OQHA 4E3VA 1NF0A 4KS0A 3ZR5A 3W1PA 4JHMA 1K1DA 4GC3A 4WDWA 1XR2A 3WEMA 1F6PA 4Z17A 4UB9A 3NXFA 5FL0A 4B5UA 3M4HA 2BHUA 4L9ZA 3LS9A 4MY1A 4IIFA 1YXYA 4M7SA 3CTTA 1IEQA 3OW1A 4INFA 4QGCA 4KF1A 2HJPA 1K4HA 1WB0A 2WW5A 3MWAA 2PWVA 2REQA 4A3UA 4GZEA 3HPXA 2H8ZA 3P93A 3IAPA 2EJAA 1J2BA 3TW9A 3OBKA 4Q8MA 7XIMA 4ADSA 4F2BA 2FGZA 4QE4A 1DWFM 2D2JA 3MB9A 3BJSA 3W6LA 7TAAA 2YA0A 3AI0A 4C1KA 3ATYA 4RZ4A 2GWGA 4AD2A 2PDIA 1Z9AA 1EC9A 4LW7A 4WJEA 2GZXA 2VWSA 6REQA 3RCMA 1KTCA 2EPKX 3QQWA 4F40A 4YTSA 5A69A 1GVYA 2A3AA 3ZM8A 2XWEA 1GVRA 3EZ4A 3N2TA 3LENA 3CNYA 1DIEA 3QY8A 4LS2A 4MSSA 2BY3A 2INEA 3ZVHA 5MKGB 4MJ4A 1LLOA 2V0TA 2E77A 2XH7A 1QNVA 2V5KA 2XH4A 3GY1A 1RXOB 4LUIA 1Q6GA 1BFNA 2P88A 3CWHA 3QMRA 2MNRA 5EU9A 1TMLA 1QTWA 1Z48A 3MO7A 4F66A 5TF0A 1RLDA 1ZAHA 4XUYA 4HJFA 5G2WA 3ITOA 2XPKA 3T4CA 3AIBA 1UD4A 1OX6A 2WHLA 1OG6A 3NZ1A 2WMFA 2ZRVA 3E5BA 3W24A 1WDSA 2C3ZA 1V3MA 3C2OA 4RDVA 1P0KA 3IIXA 1J8VA 4HNCA 3MQTA 4GXPA 4Q8QA 3EDKA 1OIFA 3E6EA 1KFKA 1BWVA 4TIMA 1GPFA 3OLDA 4B3LA 4YN5A 1BQCA 5I09A 3GXNA 5REQA 4GNKB 2QCDA 4LX4A 3AIQA 4NAEB 2PI6A 5CJNA 2WC7A 2A7RA 3E74A 2ONEA 3VINA 2AGKA 5JU6A 2JKPA 5CC3A 1NWSA 4MF4A 3W81A 4OKDA 4XSMA 3WBYA 1AD4A 4QLKA 3LU2A 3TYCA 2CZFA 2XIJA 1TV4A 3ONCA 3ZSTA 2IPWA 4HU3A 1L2UA 1TPFA 3WQ5A 3HQPA 3ZR4A 5FCZA 2UY3A 1OYBA 3L5AA 3EX2A 1A50A 3T0DA 3NPXA 3G0UA 1ZP4A 4PH6A 2PRHA 2XDFA 3UWWA 4RZBA 1ZBCA 3N4AA 3TTSA 1QNPA 4M19A 3QZAA 2KAUC 3W1AA 4X0VA 3ZFHA 3VYLA 3MSYA 4J5NA 5C9WA 4JX5A 4XAZA 3DBPA 4WDXA 4B3KA 3A22A 3VDCA 5F1UA 1NY1A 4IH3A 3VKJA 1JYNA 1Z6KA 4CNNA 1WV2A 5CC5A 2W67A 1SMAA 2FZDA 2IQ0A 1AA1B 2XIIA 1XJBA 1XX1A 1WZKA 1H1YA 1XHGA 2V3FA 3MDUA 3U0HA 3CT2A 4RDZA 2NQ9A 4ZGYA 2YZRA 1UKPA 1XYLA 3OBAA 3HG3A 3OVRA 1LRQA 5CBIA 3WYZA 2ISFA 5HMEA 1ZU8A 2VT0A 1J0IA 4DNMA 4EXQA 5LSMA 1TX0A 2RKXA 4UTIA 3UW6A 3E12A 1XIEA 2ESCA 5HULA 2O0TA 4L6HA 5JMUA 2CBIA 4DBWA 4GVFA 2RJHA 1SJAA 4NASA 1PKMA 3EKZA 2V5BA 4DUVA 3TWBA 4EPKA 1T96A 3GU1A 5FAJA 1B2YA 2O9PA 3UR7A 4RPQA 4IP7A 4GH1A 1OD0A 1ZJHA 3W6YA 2PTXA 1ISXA 1KGUA 1D7FA 3GRIA 3OEXA 4IM4A 1R3QA 1E5NA 2VURA 3KL5A 1JF5A 1RK5A 3K5XA 3ZLHA 4DQWA 3EWYA 3GK0A 1HFBA 4FP1A 4C1NA 3GFZA 1V3JA 1ZBKA 4JTEA 3WNKA 1S2WA 3RJYA 2R1PA 4Q32A 1OX4A 3S5YA 5C70A 1X1NA 2VC7A 1XW8A 4EPBC 3CASA 4CQBA 1GGOA 2HE8A 5G4EA 5CZSA 2GGGA 4ZO7A 4WKAA 2VXNA 4YNGA 1EO7A 3HPZA 3CEPA 3H2OA 3VNJA 3NUKA 1E0WA 3ZIZA 4LS0A 2LLEA 3VKAA 4O54A 3FS2A 1GCYA 4W85A 1F07A 3LHTA 1H50A 3H70A 1S5MA 2E5CA 3NL2A 3S2MA 1CBGA 3WLKX 2IXVA 5DBTA 1YLVA 4UOQA 2PD9A 2YFNA 2WBGA 2PDQA 4DZAA 5LNSA 2FJUB 3U5YA 2OO6A 1TMQA 5FEXA 1NJJA 3EPNA 1J0KA 1FCBA 2Z1KA 3VNLA 2WQDA 5FJRA 5IHRA 3L67A 4RKAA 1DVJA 2GLKA 3FA4A 3GTNA 5BROA 5ABGA 4GY1A 2OTDA 3LI0A 4RR4A 2DT1A 2A3EA 1MFVA 1JFXA 2VUYA 4B4FA 3QBUA 2EPNA 1GQJA 1Q6EA 4LUYA 1G7VA 4H4IA 1IYXA 5KEZA 2OLAA 4UQ9A 2X7VA 4P8WA 1SJBA 1GQIA 1FWWA 3UWEA 7A3HA 1JIBA 4FSAA 2GUUA 3O6AA 3EOSA 3WF1A 3HGSA 5AC8A 3R58A 5IXEA 1W2PA 1XC4A 2XUCA 2CEQA 3GHRA 4A3YA 2ISSA 1OHLA 1Z41A 4HNOA 2QCLA 8CGTA 1I6NA 3SCOA 1XLEA 1NM9A 4B5XA 3HPSA 5J04A 1EXPA 3NZGA 3N6QA 1CPUA 4M82A 1EDTA 1B90A 2NXGA 3G6LA 1FUYA 2Y89A 1YXCA 3PWIA 1SGJA 2DVXA 2HVOA 3S83A 3TNOA 3IJ6A 5IBXC 3CAVA 1S2AA 3FGCA 3LHVA 2GPTA 4DVOA 2XVPA 3N2MA 4A05A 4NNBA 2D3NA 4M81A 3UY7A 1UKOA 3VKBA 1ZPTA 3BE7A 1JF6A 2Y6ZA 5CLWA 4B5NA 4R3UA 1QOPA 1OC5A 3NGJA 4YTRA 9RUBA 4MJ2A 4PBGA 5GNXA 1GNXA 1AJ0A 1F5ZA 3WBEA 5BNKA 3LTSA 1TPEA 1DTNA 1CCWB 1CTNA 3UPBA 2QPUA 1CLKA 1LWHA 2WANA 4PL1A 1HKKA 4L64A 3W3OA 3VIHA 5LNRA 3TN3A 1BEUA 5LIKX 4N0RA 2OPJA 3M0HA 2VM8A 3LCHA 3VX1A 3ZVIA 3O6CA 3I68A 2X05A 1Q5MA 3SN1A 3F1QA 4EVZA 4NXSA 1UUQA 1EOMA 4J3SA 4FK9A 3DI1A 1IEIA 3LPFA 1NWRA 3LBCA 3MI6A 3WY1A 3EDDA 2BNJA 3KUMA 4J7RA 5JBEA 4I7WA 4N9CA 4P7OA 1OY0A 2BOEX 1VFTA 4GCAA 3OA5A 4PL2A 3W2UA 3V7PA 3LCGA 3I7QA 3HJEA 3LLFA 4Q4SA 3AYTA 4LB4A 4E2DA 4A2RA 3N2CA 4O11A 2BXZA 2XSXA 3LXBA 2QXWA 1F8MA 4NX0A 5D8ZA 4I90A 3H26A 3KXQA 3L4VA 3ICJA 6ENLA 3A5VA 4MFEA 1YX1A 1XGEA 1MNZA 1SZNA 1B1YA 1VAHA 4LY4A 1XYZA 1Z3NA 2OQYA 8XIMA 3B06A 2QGHA 1UJQA 3HN3A 3C2YA 4UTTA 1XH0A 2D2OA 4NKCA 4J28A 4AZ5A 2Q3OA 1MXGA 4ZCWA 4JKKA 1W3JA 4XZLX 4DWDA 4AWEA 3BOFA 1TPUA 3TK7A 2I16A 3LCIA 1ENUA 1LUCA 5H6HA 1VS1A 1ZJAA 2NWSA 3TOYA 3VNMA 1CW2A 1BQGA 1UA7A 1XD0A 3SGZA 2VZTA 2SFPA 3RPTA 5C5YA 4LEQA 3QVQA 5DFAA 5XIAA 1RK6A 4HIBA 1A53A 1ZUAX 1K8YA 4U10A 5H91A 5C0QA 1HW6A 1EC8A 3U9IA 4QNEA 3QKZA 4ZA0A 5CSUA 1W9XA 4JIPA 4HPJA 3E0LA 1ME8A 1WKEA 3L4UA 2ATMA 3W76A 1SFLA 3VNZA 3AIWA 3U4AA 1XLFA 5I3HA 2WVUA 1VENA 3IJLA 3R25A 1TG7A 1QO5A 4AXNA 3PTMA 4NZ5A 4C6PA 1UR8A 1MDRA 4GIRA 3MSRA 4FR1A 2I14A 1TPVA 3Q65A 4O1DA 1PEZA 4OV9A 2ACRA 1G4EA 3GU9A 4R7WA 2P8BA 1FKXA 3DKJA 1DJZA 5LHEA 5C6MA 1T5AA 1KBKA 2OKOA 1PWLA 4QS5A 4TVDA 4IHCA 4KQNA 2VR2A 2VD8A 1UROA 3R8HA 3DUGA 4OT7A 4LGXA 4JYDA 3EA3A 1W1B1 4J3XA 4X60A 4GH3A 1IXPA 3SUTA 1WZMA 3RNDA 2Y5JA 2DT3A 3IVSA 5KZ6A 4WJ8A 3TW6A 2BY1A 4O4WA 1UKTA 3W7OA 4AZCA 4ACZA 3NZRA 1VIZA 1J0YA 3SUWA 2I9EA 4YTTA 4V27A 5I3KA 4LALA 2NLIA 1VEOA 3W37A 2XVGA 1LQ2A 1F7BA 4M1BA 3D0CA 3EAUA 4H7CA 4AVFA 2GJNA 3RLHA 4LCQA 4HU8A 4A3RA 4GFSA 4HA1A 3UVIA 3NQFA 4YYCA 2WXDM 4V28A 1J12A 4QAIA 4HMDA 3EOOA 1VBRA 4N42A 2TYSA 2ZZ1A 1PZ3A 4ZOEA 4QQ3A 3TWAA 3W71A 4WX2A 3CV2A 1LBMA 1JD7A 3W7RA 1M7XA 3ABRA 3LX9A 3AS2A 4Y8EA 2HV5A 1LYXA 2ASHA 4XAYA 3MHUA 5HINA 2F2HA 3QC3A 2YZ5A 5A1AA 3WMSA 4GUIA 4HOWA 3TN4A 2DPEA 2CW6A 3RPDA 3GH5A 1C29A 2PODA 3L4WA 1H1ZA 5F2GA 1J01A 1GVOA 5CC6A 3QY7A 3MMDA 1K7XA 1VJZA 2B81A 4AC7C 3FAWA 1W37A 2J66A 2W27A 3KWSA 3LGGA 1UR0A 1BXBA 2R6OA 4NL1A 1H5YA 2B0MA 2UY2A 4PCFA 1BYBA 1KFJA 1OCNA 1FWTA 1LT7A 4BF9A 3BC9A 2WAGA 3AMLA 1PE1A 5TBOA 4UNKA 2ZZ2A 4A4AA 1KV5A 1IR1A 1R5YA 5FJPA 3T40A 1FDYA 1R30A 3VIPA 2DDXA 4MB4A 1F61A 4JTSA 4NP7A 3KOXA 3H7UA 4JTKA 5EB8A 3OPSA 1ZCOA 4AW7A 1SFJA 3WH5A 2O4QA 2Z7KA 3I10A 4KFOA 1ITQA 4WKHA 3W84A 6XIAA 1HX0A 4DF2A 4I5UA 4D6HA 4WEVX 2Q6ZA 3DFTA 1T7LA 5I23A 1XSIA 2EKGA 3QQ1A 4PMRA 4J2MA 5LNWA 1JPDX 5D9NA 2OSYA 3TFCA 2DZVA 2XVNA 1JNDA 1OCJA 2O7SA 4S2CA 2PS2A 3DBNA 1PAMA 4GINA 4GUGA 3MI3A 1V93A 4F3HA 1M03A 3B8VA 4RDWA 5BMXA 3WNNA 1FHDA 5HANA 2FZ9A 1SJCA 3UNTA 1WBHA 1V6TA 1XG4A 3UZYA 5FAGA 2OO0A 1C8VA 1EUNA 4IG2B 2J8GA 5I3DA 4YS1A 3PANA 5F7UA 2IKGA 2VX4A 3UJSA 3FN9A 4AFYA 4DBUA 3BPWA 1IXOA 3EWZA 1Q2RA 2O92A 3PBGA 5JIWA 3LHWA 1THFD 1XCXA 2RDUA 3MC5A 5M2FX 4C6LA 4DPPA 5EMKA 4OE7A 4PMJA 4NJIA 4E4UA 5A2AA 1YDYA 1NEYA 1OGGA 1VHCA 3HGRA 5D37A 3KCLA 3BOXA 3PULA 5T91A 1ADOA 4HSHA 3WL0A 1R2SA 4R27A 3MMWA 5HMSA 5HNUA 3FDGA 1LG2A 3MKKA 4B5VA 4REQB 4MHBA 4PFHA 5AHIA 2DT2A 3EB2A 2PBOA 1QNOA 2RAGA 3AICA 4OUIA 3REQA 4U28A 1NFPA 4GA8A 3B8UA 2A85A 1OFOA 1FDZA 3SQMA 3S2CA 3L65A 3BWWA 3V18A 4DRSA 1W5MA 2E7FA 1WDDA 4YTQA 2J7CA 3IRSA 3UP8A 3Q45A 4O52A 1DQWA 3HPAA 3WK3A 3F5LA 2X2GA 2GDQA 3GHTA 1SZEA 5BU6A 1YRRA 5CPQA 2B7PA 1ISZA 3S0CA 3U2CA 2C0AA 3W2KA 1P0DA 3DH7A 3HJZA 4DXKA 1KM0A 4H9ZA 4B91A 1XQLA 3NAVA 3DG3A 1Z32X 3GR8A 4M8UA 1ICSA 2OR2A 4Z1DA 3WD2A 3KRBA 3W02A 1WBJA 5GVJA 3IJ9A 3A24A 3H53A 3ARYA 5TNVA 1RD6A 3LNMA 2DZTA 2X09A 1ZAIA 1KW1A 4KERA 5A5WA 5DXYA 2J6VA 4QBXA 3KVLA 3B8WA 5FF0A 2JALA 1GEHA 4CEXC 4NNCA 1FCQA 1ME9A 3INPA 3W73A 1FP8A 4QG6A 1OYCA 3MUCA 1PYMA 4DM2A 3NQVA 3PC0A 4L4OA 3VFCA 3EPOA 4JGDA 4E8CA 1C90A 3V5CA 1TWSA 3W1UA 3CM4A 3AZTA 4LAKA 1HZYA 3V0TA 3LTPA 1XQKA 4HK5A 2OOGA 1D8CA 3KRZA 2YDAA 4O0QA 4A3QA 2GJXA 2OYKA 4MADA 5TQLA 3CS2A 4J3WA 2DZXA 3LHYA 4QFUA 1UP0A 3E2RA 4LJ3A 3VDBA 3WNPA 4ATLA 3WQFA 4AX7A 4Z2LA 1Z42A 1LL6A 4KWVA 1MI3A 3APYA 3EBVA 3R0UA 3NQCA 4Q8WA 4GE8A 4Q3MA 1JL8A 1VYPX 4QJ4B 2FVLA 3NSXA 4JQ2A 2IPGA 1PKNA 3MHGA 1ZGDA 4LVBA 1WP6A 3TSMA 2WCGA 1SSDA 1XP3A 3AMKA 2E40A 4QR6A 1JZ2A 3P8IA 4ONVA 2W62A 2QLYA 2VFDA 1POJA 1VIWA 1TR1A 4RXFA 3PUGA 5F4SA 4E38A 3GNNA 4YU1A 3PBVA 2ZX7A 1Q63A 1HJUA 2HQAA 4X63A 3W53A 4UTLA 2WHJA 1KQYA 1EJTC 4PTWA 1UWAA 4FF7A 4KEVA 3W82A 2G0WA 4XWUA 5CC7A 1W2VA 2F38A 3W7NA 2WWCA 2GVLA 1JCXA 1RZMA 4RNJA 4HQVA 3LZ3A 3EGJA 4A8NA 4O12A 6A3HA 4S23A 5EMLA 1HUVA 3L5LA 1TWDA 2QIWA 3HMCA 4UWMA 1R9ZA 4FZIA 1M3UA 3Q37A 3C2RA 3GFXA 3O07A 4NJGA 3QM3A 2R14A 3ANVA 4QDPA 2ODOA 3S1WA 1PZ2A 5BYWA 4J35A 5SWUA 3L4TA 4LVDA 4M29A 3NVDA 3BJFA 3WF2A 4XISA 4GX8A 3IV3A 3OIHA 4H9MA 5AHLA 2BDQA 3LI1A 2JKAA 3MKCA 1I0BA 2OT0A 4GNJA 5BRBA 3VMOA 4K39A 1KGXA 2ABBA 3TR2A 3VC6A 4N9DA 3UXDA 1DKWA 2E1DA 3ENLA 5F2LA 1YHTA 2VDGA 2CZ5A 1X38A 2OWWA 2BHYA 3L68A 3THUA 2XGBA 4I5XA 2PDNA 4QJ3B 1MWOA 1C3FA 3VX0A 3HTWA 2JF7A 3BLKA 2OCZA 1C91A 3WLNA 2DUZA 3FEQA 3OLEA 4G7EB 4QXIA 3CJPA 1KM3A 5BXRA 1VR6A 3NZPA 3WLSA 1DYSA 1XLBA 2PDYA 3HIJA 1QK2A 4K1WA 3W85A 1IT0A 1EHNA 5AB3A 2OEKA 4JN7A 3BW3A 3CHVA 3GDLA 3CIWA 3DG6A 3KL3A 4H00A 1BVZA 1TTJA 3ZO9A 5C9RA 4HNLA 1A4MA 1ADDA 3LXAA 1A3XA 4JEQA 4S3FA 3BOLA 1K7FA 4GI6A 3B04A 4DJDC 1DJNA 2FJKA 4Q6JA 2ZXQA 3W1QA 4ZMGA 4BY3A 2XGIA 1V5XA 2CLOA 4ACYA 3VDGA 1VPQA 2BXVA 2Y7EA 1Q6RA 1F6KA 4XZIA 3MBFA 2NT0A 1S2UA 1H2JA 1G67A 1YTEA 4AHQA 5AC5A 1O7AA 4IMAA 3C2EA 4TMCA 1M7PA 3FJ4A 4LEFA 2VO5A 3EX4A 4QHRA 1I45A 4GNVA 1Z69A 4GQ0A 1S5TA 1R2RA 1W91A 2GQ3A 1NFGA 2D3LA 3GXTA 2Z7GA 1XLGA 3FSUA 3IUHA 3F4WA 4GKLA 1XGDA 1E6PA 4Q4PA 1F2JA 2FVKA 5LNVA 3PY2A 1YXDA 3RX3A 1V6UA 3EWCA 2VZOA 4JAWA 4JQ4A 3CUJA 5HJYA 1O60A 1BXNA 4CU7A 3OZYA 4R7JA 4TXEA 4B2DA 1BWLA 3E9AA 1TREA 1PCWA 5AC4A 2ANUA 3VCCA 2Y7GA 4DBDA 2VX7A 3KRSA 3RRXA 3A6OA 1OFPA 4UR7A 4M1RA 2VFEA 5KSWA 3GD6A 1ONEA 3DESA 3QKEA 1DWGM 1V6XA 2YL8A 4HN8A 1P0NA 4XVDA 4JQAA 1UZDA 4XTIA 3O7UA 1HJVA 1OEPA 3AYRA 3PPCA 3UA4A 3W27A 1TRIA 3K13A 3RPMA 3OB8A 3WLIA 3KLLA 1ZNNA 5EMJA 2E68A 2UWFA 2B31A 5FSEC 2PEVA 3L12A 1J10A 3MHFA 3CU2A 4GO8A 4H9XA 4PTMA 4JTQA 4WHBA 4QCEA 1D9EA 4L1GA 4WDUA 4IGNA 2VP8A 4DJDD 1SZRA 1CXIA 1JGIA 3TXZA 1QJWA 4FPSA 1GOWA 1JRCA 4PSPA 5C2XA 4MNJA 4W93A 4B9YA 1GYLA 3G18A 4YL2A 4CN1A 2DT0A 3T7VA 1AH0A 1LRNA 2EGZA 1YNQA 4QLJA 3M5XA 3WLTA 5BXSA 4KCVA 1OWQA 1OQFA 3RX2A 3FDKA 3B3DA 2YSWA 1TO3A 4N9EA 1ITCA 3WK2A 4DUOA 1XLMA 1SM9A 3TN6A 2W5FA 3LOTA 2IKIA 1X8CA 2E5DA 4PGLA 2XZ7A 3R94A 3TXVA 2PDPA 3EA2A 3S1XA 1V79A 2FGBA 2ABAA 4WXYA 4WKFA 3RM4A 3M0YA 1C9DA 4MDPA 4W87A 4Y96A 1AMKA 3G1YA 3GNRA 2R1LA 1KKRA 2E25A 3QV6A 3G1RA 5K4ZA 4IGSA 2GDUA 5D4YA 3WNOA 4EPEC 3LB0A 1RPXA 1TV2A 4NY2A 1TJ2A 3TONA 3ID7A 3KCOA 1EF3A 4PTDA 1G4PA 3VM7A 4O0ZA 1PIGA 1ICQA 1V6WA 1QFEA 5G1TA 3HQOA 3MTWA 2GK1B 4PRTA 5G1YA 2PLCA 2FMNA 1GWJA 3KOFA 4RZ6A 1JQVA 3MVTA 4URIA 4CNPA 4KFNA 1XDLA 1S1PA 5DEZA 5LIXX 4B4HA 4F4RA 1QXLA 2ZZ6A 3QEZA 2DIKA 5H8PA 1M68A 3VOIA 1H60A 1A47A 3MUAA 3E0FA 4Z0SA 1W17A 2C1IA 1O5RA 3DENA 3GNDA 2HISA 2V69A 3PZ9A 1LOLA 5HR7A 1XLDA 1LORA 3A64A 1A5LC 1DE6A 1W8SA 2QMKA 2FZMA 2ZXBA 4IICA 1OF6A 3H22A 4QSFA 3MWCA 5E5CA 3IS4A 3W38A 1W3TA 1GTEA 4AZ6A 2BVDA 3CQ0A 1EH9A 4UTUA 1WDPA 4R34A 5DO8A 4ACZB 3EXSA 4HYVA 1XLCA 3NQMA 4Q7NA 1Z89A 3STEA 2PDUA 4GVGA 1S3TC 2VRJA 3TTEA 3WZ0E 1GVQA 3NO1A 4IWWA 3LGDA 3P6LA 3V1PA 3ORWA 2QDDA 3UETA 5AVNA 3Q58A 5DBUA 2IPJA 1HXJA 3NL3A 1FRBA 2R82A 4D1JA 2C18A 4UTHA 1R86A 3SN4A 1H4PA 2DSVA 2ZA2A 1UR3M 3FYOA 3MCOA 4IMFA 5D38A 2C14A 3BICA 3VGDA 1P0BA 2WNWA 1TTPA 4HOZA 3OZOA 3BK0A 5I06A 1ME7A 4AMCA 5A3HA 3TAKA 4WR3A 4W7VA 2W66A 1EP2A 3FCPA 4L65A 3PN8A 2DU2A 5FF7A 1GKRA 2FH8A 4DO7A 2CPUA 2FB2A 1B9ZA 1WDQA 3M5ZA 4IQLA 1MNSA 3GHSA 4JFWA 1K9TA 1JD9A 2PWUA 1WDRA 4MGGA 4WY0A 5I3GA 2F84A 4PB4A 4NJKA 2V30A 3PUEA 3I6RA 3NYDA 1HKJA 2WVSA 4PMOA 1EUAA 2X0SA 4OOZA 2DVTA 4LU0A 2QJNA 2WNZA 5DMMA 4HSNA 3TUUA 4FR6A 2A3CA 1EF2A 3PPHA 1E6XM 1XV8A 3G2GA 3G1VA 2CHRA 2PDCA 3ABQA 2BOFX 2ZX6A 3KAOA 4DI8A 2J9YA 4WGHA 4YCOA 2ZA1A 1CGXA 3FK4A 6TIMA 2G50A 1PCKA 4MVAA 2RDTA 3I7SA 4C6CA 2ZE0A 2J4GA 4M0XA 1YIXA 1MW0A 1FWHC 1R85A 3LRMA 3S1VA 3QYQA 1FP9A 5I00A 3TYUA 5D2XA 4GRSA 4MAVA 3RUBL 3T08A 2QS8A 4UQCA 4UTWC 2J77A 4WDTA 1QAPA 3B9AA 4M3PA 5DY2A 5K2ZA 2VFHA 2JGQA 4D6JA 3W00A 3ECQA 1KXTA 1P48A 3SADA 3UXLA 5FSDC 2Y8UA 3AYVA 4MB5A 3N2OA 4AYSA 5CSSA 3A3HA 3LGEA 2J7EA 3C0QA 3PJUA 4XD4A 1M65A 4LRTA 3VCNA 2WJZA 1D2KA 4UZUA 1W1IE 1XIBA 1LP6A 3T2QA 2CESA 5B80A 3W7JA 1XRTA 4HZ6A 1EFZA 4GKTA 3B05A 3MMTA 3TQ0A 1LROA 1OC6A 3NURA 3RGTA 3QSRA 2HK1A 2DSZA 4JCMA 5EA9A 3SRFA 3DFOA 2J47A 4J4KA 4HZ8A 1FWJC 4HZ7A 3URBA 3L2IA 4WJXA 3GFYA 3VOJA 3SR7A 2OYLA 3NQGA 5LXXA 3CL6A 3KDOA 4FMVA 1J0HA 1UR1A 1Q2SA 3LPGA 1IF2A 1WA3A 1D3HA 4ZTXA 1RCQA 3AAMA 4JOMA 3SCSA 3UJEA 4PR4A 4FAMA 1TPWA 4I9AA 1KM2A 3W2JA 2RH9A 4JFTA 1SMDA 4FIRA 3T42A 3U2ZA 1P7TB 1O66A 2C0HA 3WKZA 4GVIA 2WJDA 1DXIA 5FEWA 3PBUA 4LQ1A 1W1YA 4UFMA 2Z1SA 1HQTA 2E3ZA 2QJHA 1QPQA 3SFKA 3W1LA 3AU2A 2CKSA 3GXFA 3SCWA 3O9NA 4DAFA 3ITGA 4MB1A 2ISWA 3S5SA 3MY9A 4US5D 1TTIA 2ZZ5A 3SRHA 3H55A 1RALA 4GPNA 3APGA 3TMLA 3PBYA 3PP7A 4OIFA 3M43A 1T40A 5A8NA 3QPEA 4O28A 4RNHA 4DYJA 5AYIA 1MXDA 1E1EA 3A12A 3I6TA 3XISA 1E6SM 3R1ZA 3UVAA 1AL8A 4C6FA 1DWIM 4KRTA 4S3CA 1GKQA 2VEIA 3T07A 3CH0A 1C7SA 2PRMA 3SCTA 3WQ4A 2ICSA 3KHJA 1LOSA 4AWSA 3WELA 4O1FA 3WLRA 3FAXA 2TRSA 2PC8A 4O1BA 3L0KA 1JQXA 4L7ZA 1HKIA 1XLHA 3N1AA 1OABA 3BW2A 1FH7A 4L1WA 3OODA 1FY6A 3VUSA 1UZ4A 5CAKA 1UJPA 3LNPA 5M1TA 2PFHA 3C0JA 4Q8VA 1UP2A 1WOBA 1PUDA 1M04A 4P5UA 1KFBA 1XL9A 2WBKA 2ZOXA 3C52A 4P8UA 1F3EA 3RM9A 3W7EA 3VIOA 1MYRA 5MKGA 1BF6A 2VQUA 3ZOAA 3PWAA 4K7YA 2ZRZA 4F9JA 5AECA 4LBSA 3TZNA 4C6OA 5C71A 5KZMA 2KZHA 3CZGA 5FA5A 2Z26A 1ML1A 3KVJA 3DAQA 1YDNA 2VL4A 6XIMA 3BLPX 1U30A 3SCUA 4CVWA 2QV5A 4KWOA 4C90A 3TOPA 1JRBA 5CPNA 4DYEA 1HJSA 4F0SA 5DXXA 4LSBA 3VOHA 2A1YA 1TUXA 3IGSA 1W5QA 2XN1A 4FS9A 4FXRA 3W1RA 3R6IA 5D04C 3EKLA 5DT5A 2RUSA 2I1OA 5K9DA 1ZHAA 3C8FA 1A5MC 1TUFA 4NZ3A 2C79A 1JPMA 1TWWA 2BTMA 4LYRA 3PB0A 2V5JA 4NAEA 4AZHA 2TSYA 2I9UA 4BKNA 2BP1A 5D33A 3HURA 2GJRA 3QRHA 5D9PA 1ITUA 3WCZA 2H3DA 1ZLPA 1GORA 2W3ZA 1JDCA 1UMLA 3OJGA 4UMBA 2GGJA 4JL2A 2GVGA 2WOQA 2X0YA 3K1GA 4YVXA 4CNUA 4MYXA 4ZB5A 5I24A 4GZJA 1PKLA 1GZ1A 1QT1A 3ZLGA 2NSXA 5J8LA 4DHGA 2HEJA 3GYCA 4UCFA 2X16A 4G6CA 3BLOA 4O0KA 4Z0JA 1NU5A 1BHGA 1W3NA 3BG3A 2IXUA 2V3EA 3R13A 3PAJA 5AYZA 4JS3A 1RLCL 3L4XA 4IFKB 2P0OA 5LYRA 3NQEA 1UA3A 3A21A 4IXXA 2XM2A 5TAOA 2ALDA 1R3SA 1S5VA 3LM7A 1L6FA 2VKZG 3QTGA 4XZBA 3LSBA 1EDGA 3W88A 2XFWA 4N6EA 3BH4A 4POCA 3U57A 2GGEA 1J6OA 3ZS4A 4PULA 4NU7A 3ELFA 3CT7A 4KCTA 3IANA 1VFMA 4LNYA 5C9XA 2RDXA 3AO0A 1A0EA 3VKCA 1TCDA 3N4FA 1PYFA 5C2CA 2WSPA 1KXVA 4X61A 1ZS2A 2D0FA 1NP0A 5I3IA 2WO5A 1Q6LA 3URNA 2RHGA 4DXVA 3A5FA 3T2PA 3P5ZA 5AHEA 3R5EA 1FWRA 1HT6A 2OLHA 1KLZA 3HV9A 4HK7A 4MKVA 4CCDA 2BGQA 3SIZA 4PUNA 1IR2A 3MU7A 1H62A 4H6EA 4FF5A 3O8AA 3WN6A 2HXTA 1VFFA 1V77A 2JFEX 1E1CA 1GTHA 2ON3A 2AMGA 2H8XA 3UU0A 4BR1A 1JCTA 4AZGA 4XUGA 2VEKA 3T2OA 1J79A 3BSMA 4BZYA 2J13A 1P4CA 1XSJA 4FHAA 1WKFA 1AQHA 4QRNA 3FOKA 1IE7C 4B92A 1TPH1 3I3DA 1XIGA 5IBXA 1C9WA 4PTVA 4L9XA 2YYTA 3M46A 1FWAC 3TV8A 3IUDA 3RU8X 3LSCA 3IV8A 1LG1A 4AWUA 2V81A 4Z1YA 5G2HA 2HVNA 1XH2A 3R0DA 3DG7A 1N55A 2WNQA 1UR9A 3M5VA 1VFLA 1FWFC 1LT8A 1CWYA 1OBAA 1RJRA 5I02A 4O57A 1PWMA 1CYGA 1MFUA 3FKKA 3FVDA 3E2QA 1JDDA 2R94A 1SO6A 5A8OA 3ARRA 1DP0A 1SR9A 1WE5A 2PP1A 4JTJA 3NDYA 4HB7A 4UZSA 1ZCCA 4J40A 3WNMA 1XC6A 4LVGA 1TE1A 1IZKA 1KFLA 1FOBA 4AYGA 2NWRA 3O2LA 1V6YA 2WLZA 1OGSA 2VMFA 3M0IA 2QCEA 3AXHA 3PPFA 3H2EA 2VCCA 3MMUA 3CLWA 3BCDA 4XZ9A 3W6MA 1L6YA 2YDRA 3L66A 4U2YA 1EQCA 3PAOA 3RMEA 3CQKA 2IMRA 3N6HA 1MUCA 5CJ5A 2EPLX 1M7OA 1MO0A 1TB3A 4US6A 5A6LA 2PU1A 1TIMA 3OVPA 4Q7BA 3QH2A 4MY9A 3G24A 1WO2A 2HWGA 3P62A 2BODX 1UD3A 2DH3A 2WMKA 3FXGA 4U5KA 1RD5A 1SR0A 1VFUA 2CLFA 2INZA 3GX9A 2VVSA 5HPOA 5BCAA 3RCYA 2V82A 3UPWA 5GNZA 4KKXA 1QNQA 2KX9A 2GVYA 3VNDA 5A94A 1VCVA 5A8PA 5D8WA 1B5TA 4XIMA 1OFQA 1QW8A 2ZE3A 4PMZA 1H7RA 4PUUA 3N34A 3MUY1 3XINA 2V63A 1H09A 2BMBA 1KR0A 2UY5A 3EMCA 1PO9A 3W1XA 1F9CA 1E0UA 2PZNA 4YCPA 3OLGA 5AYYA 3ONBA 2XHYA 3WQDA 3MZ2A 1S39A 4MOZA 5I7GA 5DCDA 4AC1X 1QOQA 5K9CA 1HG3A 4J9JA 4N7QA 3IGHX 3BQ6A 1EB3A 1Q6CA 3BGJA 3S2LA 1V0LA 4O10A 4KEUA 1M6JA 2Z4GA 3HA1A 3LTYA 4F79A 1JR1A 1B3ZA 4IP5A 1E0XA 1R38A 4IJBA 2FB3A 4CKQA 4H7ZA 4KWWA 3IVTA 1XD1A 5AHFA 4HOXA 4FX6M 1KRMA 4HYWA 1ODZA 5E0CA 4MFDA 1OFBA 3ARXA 3N17A 4WQ6A 4GMEA 3CXOA 3CHDA 4AIUA 3BCJA 1WOAA 3B4UA 4NX5A 3WMBA 3ZJKA 3E0VA 1EKOA 1JI1A 5CQ1A 4IOTA 3SB0A 1EPXA 3D3AA 2CXGA 4BQ3A 5A6BA 4M6VA 1U22A 3F7JA 3STCA 2QULA 2CC0A 2OLSA 2DUXA 2NQ5A 4B5WA 5IM51 3RRAA 1E72M 3T44A 4KCUA 3BLLA 3QY6A 2XIOA 5E93A 2VOTA 4XX6A 1W5OA 3UY8A 3GR4A 4FLSA 1EP1A 1TX2A 4Y2WA 4EPDC 4DY1A 4M80A 3O6DA 2J8FA 4JKLA 2XINA 2XSBA 2P10A 4JIIX 2FTPA 4W7WA 1JCJA 1CGTA 2CLEA 4D72A 3I4EA 1SW7A 1VD6A 3I3EA 1XIMA 3SIMA 5D05A 5EY5A 3W22A 1V3IA 2QCHA 3ABOA 4B16A 1T6MA 3FJLA 4L4LA 4AIEA 5L9FA 1U5JA 4X3ZA 2VVNA 3VOGA 1MRQA 1ZL1A 4UR9A 4GG9A 4MDOA 4PBEA 3W2NA 4B5TA 1HKMA 3C0LA 4GZ7A 1R47A 3ZSSA 1DXFA 1BVWA 4ZQMA 3NOYA 4IIHA 1AQ0A 4DJFC 3IIVA 1F6YA 2X1SA 4WSKA 3W7IA 4LAOA 2OFJA 1HKVA 3N2BA 4B90A 2OYMA 4B2DD 3CUFA 4GBDA 3PZMA 3W7KA 3Q2DA 1DJGA 5A2BA 2CETA 2CWXA 4DF0A 3YPIA 1M53A 3OYZA 4QJ5B 4AZIA 4K8EA 1K3UA 3EWDA 4IUOA 3ITVA 1EA9C 3EX3A 4D6FA 1W9PA 3BVJA 2J7GA 4V1YA 1I2RA 3UZZA 1EX1A 1T99A 4JEJA 1UB3A 2A7NA 3VE9A 1FH9A 4WSJA 2PF0A 1IWAA 4DELA 3MCMA 3VMPA 4ADTA 3UR8A 4Y9PA 1W9DM 3SEPA 1RA5A 1FFQA 2BY2A 3WLLA 1VP5A 3CZJA 1KCLA 5K4XA 3L4ZA 1F76A 1E9ZB 1MDLA 3AHXA 3KOYA 4ZR8A 3AHVA 5I03A 4ICCX 1V0MA 3N29A 4GX9A 1QVBA 4P8VA 5DRCA 2GSJA 3AIVA 4JL1A 3C61A 3VDAA 3IPWA 1SZFA 3GR7A 3CO4A 1XIFA 2PDFA 4OVXA 3KBVA 1R7AA 1XDMA 1US0A 4H9TA 3WFZA 4UFJA 2G3JA 3BAJA 3S8HA 2X41A 4H04A 3MZNA 3CL8A 4UBPC 1OADA 3GIPA 2I7GA 1H7PA 2WVVB 4EXAA 2FZ8A 3SRDA 2Q71A 2PDMA 4N6FA 2A4AA 3GAKA 4XBSA 2BGSA 3ZYZA 4FO4A 3ABZA 3UCDA 1EBGA 4AEFA 1UH4A 3GUWA 2VHLA 1Z8AA 3RG6A 3QQ0A 2OXNA 2CZDA 1JDEA 2A6LA 1OM0A 1UR2A 3N3MA 4EAMA 3H12A 4FXFA 4R5EA 3KRUA 2PTDA 4HSOA 3T0CA 2QUUA 2XSAA 4EX4A 5LA0A 5GPRA 2OG9A 4KBXA 4PMDA 4G1NA 4OBRA 3OYXA 1R46A 3ARWA 4GIYA 4JQ3A 3KTXA 4YWIA 3VIJA 4HT3A 1LLWA 3GVVA 1VEMA 3V0SA 1G4TA 1Q7QA 5BRQA 3BLDA 3QR1A 1KWKA 1FWSA 1D3CA 2E6AA 1KO0A 1SUXA 3VFLA 1F3WA 3BAIA 1T0OA 4ICMA 3A23A 4A2SA 4DJEC 1JYVA 3PWGA 3G0SA 4IPLA 4UFIA 2OOFA 3VNKA 3QGVA 3GYEA 1EZWA 3KOWA 1KFEA 2X1TA 4HD5A 4U31A 3KBJA 3W83A 1ZRQA 3LYEA 3AYSA 3OGRA 3E0WA 3AHYA 2YX0A 3RAOA 3SI9A 3GE7A 3AXIA 1DEDA 2A0NA 2FVMA 5FESA 1VKFA 1F8IA 3W7PA 4KH2A 1P6BA 2J79A 3P60A 5IFTA 3CV7A 3QHMA 4IXHA 3ARSA 3L0GA 4GISA 1E0VA 1C8QA 2Y5SA 3LZ5A 4TR9A 4Y8FA 4LV9A 3HFYA 4MZ1A 1L6WA 2QCCA 3T8LA 1OG0A 2WZEA 2WPGA 1BD0A 5L6UA 4S2BA 3II1A 4GK8A 3R4IA 3S1UA 4GVHA 2Y0FA 1GOIA 1XRSA 1Q4WA 3PVFA 3UWUA 2DQXA 4ZOAA 4U3CA 3RHGA 2QW5A 3BLFA 1EJSC 3N12A 4L5ZA 1EQPA 2PCEA 3GDBA 5I6SA 3RMJA 5BZAA 1UKQA 3V36A 1BLIA 2NUXA 4S3AA 1F3TA 5DX7A 1IZCA 3S42A 5DELA 3EB4A 1C93A 4HTBA 4JN8A 1NDVA 3QFWA 2YL6A 3GIQA 1AZ1A 2E9BA 3U8GA 5F2IA 4KGLA 3AUOA 4DJED 2XH0A 1XPYA 1H3GA 4FNUA 2VRKA 4A29A 1K6AA 1PPIA 2ZQ0A 4IMCA 1EYWA 3AHTA 3CB8A 9XIMA 2EHHA 2XISA 1DQXA 3TDFA 3GAYA 1JULA 1W1VA 4TTGA 4DNHA 4Q4OA 3AMGA 2J7BA 4H9YA 3KDNA 2XFRA 3GTHA 3S9ZA 1ZJIA 1K02A 3QOKA 4IG2A 4IQEA 1SO4A 1E55A 2P76A 1J18A 3ITYA 4QEHA 2IPFA 4JFUA 4OECA 3P14A 2NQLA 5T9BG 4KEMA 5A6SA 2C13A 4G8TA 4UUIA 1KBIA 4NI8A 1S2VA 1X1OA 1I1WA 2AMXA 4OV4A 2B7QA 2OZTA 3F2DA 4N4PA 3TYAA 1CXEA 1PHQA 3SGUA 5A6KA 1T8XA 1U83A 3DFHA 3PTQA 3UZJA 3V4BA 4CLMA 3CUGA 1XIHA 1E4LA 1QBBA 1WUEA 3THAA 2OJPA 1GOXA 5JH1A 3M0VA 4REQA 3F4DA 2A5HA 5CZJA 1LOQA 4O18A 3TVAA 3NL5A 3IJ8A 2GL5A 1H7NA 2RGLA 2OT1A 1EBHA 3GUGA 3ZT5A 3H23A 3BZGA 1GPWA 4A35A 2PURA 4DB7A 4PMXA 4GYPC 4JTCA 2D24A 2FTWA 4MPKA 3UERA 3GVRA 5FEPA 4QTGA 1FH8A 2PTYA 3SCQA 3WH8A 3ITTA 3B8DA 2FFCA 3P67A 2QJJA 4YMZA 3TW7A 4XVEA 4PCPA 1I1XA 1LWJA 2WKLA 4WF7A 4ICNA 2OSXA 1YTDA 4H8UA 4QM1A 4U2ZA 4R9XA 4B15A 1L8PA 2OEMA 2OODA 3LV6A 5HQEA 4BWLC 4XV0A 3WJWA 3NDZA 1EWEA 3GG0A 4NVTA 2PE4A 2NSOA 4QDMA 1R7OA 3GTXA 2BASA 4Q8TA 3TE9A 1RBAA 3CWOX 4L80A 4HK6A 4PUWA 3SFWA 2Y62A 2XVKA 5I3FA 1FHUA 1E4NA 2O4MA 2CBUA 5J5DA 1MEWA 2JK2A 2DGAA 4GFIA 4W7UA 1GOOA 2JIEA 7TIMA 3F2CA 4D8ZA 3EMQA 1J2WA 1OK6A 2ZXDA 3CTLA 1W56A 3G1FA 2HTMA 1YDVA 2WVTA 1NQ6A 3TX9A 1PTDA 5CJMA 4GJIA 4GGBA 4JIEA 3MYOA 3VOCA 2EAWA 2WC3A 4RX0A 5DN1A 4IJCA 4IIEA 3SBFA 2DIEA 3UCCA 2DFAA 1E1CB 2JIWA 5KZEA 3WIJA 2E4TA 4PFMA 3QSTA 1QASA 3W4RA 4DJDA 1EP3A 1XUUA 3R12A 1DWHM 1EYEA 3CB3A 2HE5A 4LNCA 5A6JA 4YWSA 2CCRA 4XAPA 2J25A 3WL1A 4NI3A 7ODCA 1UH3A 5U4NA 3NA8A 2G96A 3DECA 2G3NA 4H3DA 1HP4A 3WMLA 5AN7A 3O6YX 4XAGA 1KCKA 3N73A 3UGRA 3MT1A 1H5VA 2CZEA 3G3MA 4IL0A 5D2YA 5BXTA 1BRLB 3FSTA 2ZC1A 4ZQPA 3RO6A 2OB3A 3O63A 4IJRA 1GKPA 3OVQA 2WZIA 4PUKA 1YNPA 4K2SA 2C8NA 2G4JA 2HMCA 5K3VA 1QWKA 1H0IA 1GZGA 4RJEA 5FOOA 4R9OA 3W1NA 1GVFA 2POTA 1QNSA 1E70M 2RJGA 3A9IA 3WD1A 4M7TA 1KRAC 4UTMA 1PZ1A 2GOKA 5AFDA 2YB4A 1XBXA 3BAXA 4XZNX 4N9BA 1QMLA 4IL2A 2Y70A 4PCSA 3PZQA 5LHFA 3TCEA 3HQNA 1M9HA 2XIQA 3MDWA 1R9YA 1ZJBA 3UNDA 4ZSUA 4GJ1A 3GB6A 3OA3A 3UXIA 5LIWX 3FXYA 2POZA 7PTDA 4Q4MA 3SO7A 1UZ1A 3THDA 4U3AA 1KC7A 3F4CA 4ZODA 4HA0A 3W7DA 2YCEA 1JGMA 3W75A 2JE8A 1J96A 3HQ1A 3WJYA 3PM6A 1TQXA 1NP2A 4C91A 1K9DA 1CXLA 4Z2KA 3G1SA 2PDBA 3BAWA 5HJXA 2WMIB 4G7EA 2YIHA 3CMFA 3S6TA 1W1ZA 4AIOA 3AJ7A 2QNEA 3VD7A 3T81A 5F4WA 3NVTA 3AWOA 4PUJA 1KRCC 3HF3A 4CNTA 4S3BA 3QC0A 2P50A 4LWWA 1XCWA 3UG8A 1VJSA 1NIUA 4I9TA 3C4UA 4KCWA 1CIUA 1CGYA 2ZICA 2NQHA 3SW6A 4K36A 2J7FA 2ZRUA 3M9YA 3M07A 1HF6A 1RY0A 2Q3RA 4ZB2A 1B3OA 1HGWA 2YLLA 1FTXA 2ZTKA 4D71A 1WKDA 1G7UA 4HU0A 4UQBA 1XYMA 3CZEA 1XXXA 2DW7A 2FQIA 5M17A 2IKHA 3WLOA 3FYYA 4W5UA 1QHPA 3C2VA 3SQSA 4UTFA 4KT2A 4FALA 4H2HA 2QQ6A 2VC6A 3VIIA 1K4GA 3CIXA 1AH3A 3KS5A 1GOMA 7REQA 1GUVA 2Q02A 3KFTA 5FJUA 4H6RA 3S2NA 4MWAB 2YL9A 2PPGA 3S1GA 2R24A 1XIIA 2VD9A 4LBUA 3VD5A 4JZ5A 3MO4A 3T8QA 4I7VA 1R3RA 2VC5A