1IXNA

Enzyme-substrate complex of pyridoxine 5'-phosphate synthase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
242
structure length
242
Chain Sequence
AELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDACKRLADAGIQVSLFIDADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQELARIAKAATFAASLGLKVNAGHGLTYHNVKAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKRLMLEARG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzyme-ligand complexes of pyridoxine 5'-phosphate synthase: implications for substrate binding and catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
molecule keywords Pyridoxine 5'-Phosphate Synthase
total genus 95
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 2.6.99.2: Pyridoxine 5'-phosphate synthase.
pdb deposition date 2002-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ixnA00
2OT0A 3W7DA 1C29A 4GE8A 3B0PA 3KXQA 4XTIA 2VFGA 4AXKA 4LVDA 4FIQA 5EKYA 4FEZA 5HWNA 2YW4A 1GVQA 1I4NA 3W7KA 2RKXA 4IX2A 1EP1A 7TIMA 3CU2A 5G4WA 4CQ8A 1H7NA 1QOPA 3Q37A 4A2SA 5DXXA 1F76A 2ZRVA 3PM6A 1YTEA 1OF8A 4O13A 5LZLA 3GK0A 4B5NA 3WJSA 2A2IA 4EWND 4Y6GA 1H50A 3C61A 4P61A 3MO7A 2V2CA 2QDGA 1KFBA 3QZEA 4AWTA 2A7RA 2QCDB 4JR5A 5LGZA 2WV8A 4GUJA 3EKZA 4NXSA 5LNSA 1O95A 1QWGA 3NO5A 3LV6A 4NXKA 3W73A 3IIXA 1OJXA 2AAMA 4C1KA 1LRTA 1LBMA 3IIPA 1IIGA 3G22A 3MP4A 1LRQA 4N6EA 5LGXA 4YCOA 4HSNA 3W1AA 3PBWA 4WY0A 1QFEA 1WOBA 2LLEA 1OFPA 1XBZA 1TPVA 2R8WA 1Z44A 4JX5A 1PS9A 4TMCA 4O0ZA 4R34A 5KMYA 1KFKA 5G2IA 4K39A 1DHPA 1XDMA 3HGSA 1JCMP 2YDAA 3P5ZA 4KWVA 3PULA 3B04A 3W7LA 3LLFA 3LCXA 3MUXA 4ZQPA 2J6XA 3O63A 1Q6RA 3C2EA 3O07A 4OT7A 5F1UA 4HPJA 2ZZ7A 3M5YA 3NQMA 3P8JA 4NZJA 2ALDA 2A85A 2O7SA 1N7KA 2CWNA 4UR7A 3IGXA 3W88A 3FS2A 3TA6A 2A4AA 3RU6A 4JDBA 5HWJA 3S0CA 2C0AA 4UFIA 3DZ1A 4O10A 1K7XA 1JCXA 2CZDA 4D2JA 4GFSA 4FO4A 1GYNA 4O1DA 3NXFA 1HTIA 3MP3A 5LNUA 1TTPA 4N2YA 5BNKA 5AHFA 3G8EA 3R5EA 3HG2A 3UD6A 4JICA 1W8SA 2GVGA 2DJLA 4EVZA 4WZHA 2EGZA 4N9EA 3O6YX 2H6RA 3NQ2A 4PCFA 2DP3A 4UTWA 3EXTA 3W7IA 4Z1CA 4BK9A 2YZRA 1W3IA 3DFPA 3WK3A 2ZDRA 2Q8LA 3HF3A 2PRMA 4OQVA 5HUPA 3EWYA 4HHPA 3SFKA 3S8HA 3L68A 3CIXA 1EWEA 1ZHAA 3W1UA 4GJ1A 4K7VA 1AW2A 3VFLA 3PF3A 1Q3NA 2C14A 4Y9AA 4LS1A 3L0NA 1RPXA 4Q4KA 3JRKA 1VZWA 4X3ZA 3MYOA 1OFEA 4UFHA 1AL7A 5DY3A 4NQ1A 4LU0A 5BOOA 3O1NA 3VE9A 2QCEA 3O6CA 5G2WA 3LXAA 3EWUA 2E6YA 3I6RA 2NXGA 1X6UA 4RR4A 3TXVA 2WSRA 2QKFA 5FEZA 5HMSA 3W7EA 4RCXA 4QQ3A 4WXYA 2Q3RA 1TTIA 3NGJA 2DJXA 1TJRA 4E2BA 3S5OA 1TPDA 3TK7A 4UNKA 4K38A 4LRSA 2P10A 4FNTA 3TQKA 4O1BA 2ZTKA 3CEPA 4ONVA 3EXSA 3A9IA 4IGHA 5HULA 4ADUA 2ZZ2A 2QCCA 3VI2A 5E1QA 2QCLA 2E6FA 3RLUA 1RD5A 4QNEA 4R7JA 5AC7A 4TU1A 3PWAA 2NXHA 4O1AA 4NVTA 1R2SA 1W54A 2QUVA 4YL2A 2YGYA 4O12A 4UMBA 4IMGA 1RV8A 1MEIA 2DZVA 2V9DA 5D04C 2FDSA 4JS3A 3FEMA 3A5FA 1ZFJA 3TXZA 1LBFA 1TCDA 2I1OA 3BW3A 4YXGA 1SUXA 3C6CA 2Q3OA 3QC3A 3P67A 1GQNA 4QAIA 1SZEA 3OVPA 1H51A 3GR8A 1GVOA 3PG8A 2WOQA 4NUWA 2FJKA 1M6JA 1H7PA 4CLMA 1G4SA 4Y8FA 3CB8A 2YXGA 2A7PA 4CCCA 3PS7A 3U6WA 1H7OA 2XN0A 2R14A 4Q33A 3IRDA 4K8HA 3W1XA 4AVFA 3GXNA 1KV5A 5BW6A 4MFEA 2VFEA 4O50A 1EUAA 3M5ZA 1A5AA 1MEHA 1LROA 1XI3A 1XCFA 1LDCA 4QSHA 4IMFA 5G2HA 4U4MA 1O5KA 4JD4A 5K9CA 3V1PA 3M16A 4O19A 1KFJA 2ZRWA 2NX1A 2B7QA 3ABSA 3PUDA 1KBIA 1X7FA 1H5YA 5H2ZA 3NL6A 3EX2A 5D2XA 3AJXA 3G1YA 4DPPA 3MI2A 4IUOA 1GTHA 1T99A 2VEKA 4EOUA 4LS0A 1DL3A 4M6QA 3TW7A 1DVJA 4DO5A 3BGGA 3TU9A 3P74A 1K8XA 1SSDA 3W74A 1HO4A 3W1RA 1OK6A 2CLLA 5AHIA 5G1TA 1RR2A 5EY5A 1R47A 4JTEA 1PCWA 3LCIA 4MZ1A 3MW7A 3TSMA 1TPEA 1OYBA 1TSIA 1NSJA 4PODA 5LNRA 3NR0A 1ICSA 4N9DA 3W2NA 1QNVA 4JX4A 4I7UA 3W1TA 3ZFHA 2VOMA 2A7NA 3FYOA 1FX6A 2EPHA 1W37A 3LERA 4ZVJA 1ZJIA 1CW2A 4FNPA 5AHMA 3GDMA 1H7XA 4JY8A 1TV7A 4BFAA 4EIVA 2CLKA 1VHCA 1OX6A 4O4WA 3SECA 3N9RA 3T7VA 3DBPA 1YADA 5E0KA 3RMJA 4UFLA 1VS1A 3EX3A 1TPC1 3IIVA 3W7PA 1Q6LA 2NV1A 5LNWA 2BTMA 1Z48A 1G4PA 2J9ZA 1C8VA 3NZ1A 1HL2A 2E6DA 4CCDA 1TRIA 3IGSA 4A3UA 4NZFA 1NVMA 5TQLA 5BRBA 4MJZA 2ZYFA 3STEA 1JUEA 4Z1AA 4FNUA 3FLUA 1TJPA 3MMTA 4ML9A 1OG0A 3QMRA 1FUYA 1N55A 1L2UA 4R53A 2WPBA 4LTSA 4JY9A 2KZHA 2AQWA 3HG3A 3L67A 3DHDA 5KTLA 3JR2A 4OU1A 3HBLA 1FWSA 2X1UA 4O14A 3UZJA 2E77A 3UZ5A 5C54A 2PC4A 1A5SA 3PSWA 4LV9A 1TV8A 4UMAA 2H90A 1GT8A 3O05A 1SU5A 1SO6A 2WSQA 3PBVA 4K7YA 4WOZA 4UTKA 3EWBX 1FXPA 2NZLA 2JGQA 3A24A 3LTSA 4CNOA 2P0OA 3NQ8A 3TJXA 3LRLA 5AB3A 1TO3A 4OV9A 1G6CA 4UR8A 2TSYA 1PCKA 4HNTA 2ZRUA 1OF6A 3SY5A 4MYXA 1X1OA 3S9YA 3NEVA 2G97A 3UYCA 4RX0A 1EP3A 4XUGA 5AFDA 3LBMA 1DORA 2V0TA 3SJ3A 3W7NA 4KKXA 3BPWA 3KHJA 2B7OA 2WO5A 4YMZA 3W7RA 3NVTA 3O16A 1LOQA 3QPYA 3EX4A 1O4UA 4MY8A 3S5YA 3L65A 2YFOA 3MI3A 4UFMA 4MKNA 3RNDA 3EWZA 4A21A 1KFEA 3TH6A 4CQAA 5DN1A 1VRDA 3W2JA 4ADSA 3HMJG 2C18A 4S2BA 2ATSA 2GVLA 5J5DA 2X2GA 3DFTA 2YYTA 4UC5A 4I7VA 2ZTJA 3KVJA 2W6RA 5HR6A 3F4WA 1B4KA 4IQLA 1GG1A 2X1TA 1QPNA 1WOAA 2FIQA 1TTJA 2QAFA 1T96A 1ME8A 4YWIA 2J88A 3L0KA 1G7UA 1R2RA 2VFDA 1KM1A 2Y61A 3MHFA 3WJXA 2YR1A 5F4WA 4ADTA 3QSRA 1U5JA 4MJMA 1S3HA 3EKLA 1CI1A 2QDHA 1YPFA 4JNMA 1SQ7A 3UWWA 1QPOA 1FWWA 4XKYA 5SWUA 4M5PA 3NQ7A 3TAKA 1MXSA 4JTJA 1DQWA 4U28A 1W5MA 2ZZ6A 1NF0A 2ZA1A 2NLIA 2ISWA 1CX9A 2ZZ3A 3G1HA 4ZQNA 3W2UA 4DXVA 4UFKA 1DJQA 5DXYA 1ME9A 1ALDA 3OA3A 3EX1A 4KFPA 4DBEA 3O15A 1DQXA 2QCMA 4DBDA 3NZRA 1S5TA 3IGUA 1SZNA 5G4EA 1ME7A 4TO8A 4JX6A 3NG3A 5J5RA 2RHGA 4E38A 1FCVA 3TX9A 1QO2A 1W3TA 2CZFA 3MHGA 2H8XA 4BI7A 2GJNA 1W5OA 3TQVA 1KW1A 1K3UA 4WY0F 3QSTA 3BG9A 2RDUA 4Z0JA 5K2ZA 3S1WA 1W31A 1P0KA 1KM4A 1XC4A 2EF9A 3HQ1A 4UFJA 1TPFA 3HGJA 4IJBA 3PBYA 1HUVA 3BVJA 1JQXA 1KM6A 3BO9A 4OV4A 4FHAA 4RZ5A 3BK0A 1LP6A 2W0UA 4RKAA 4S2CA 4IXXA 1QMLA 3GVGA 4JTUA 1L6SA 2YW3A 5DBTA 1OFAA 4LW7A 3I7QA 3L5MA 3KRUA 3W2LA 3CWNA 4PL2A 2PRHA 4GUHA 4FNRA 3W7HA 2VEIA 4GWEA 4NJJA 1K02A 2XN2A 1VLIA 3GIYA 2VFIA 3B8DA 4DO6A 4ZL1A 4QM1A 2R94A 2FQIA 1FWTA 1RZMA 4NJIA 3QQ1A 1GVSA 5FF2A 4AHPA 3E9AA 3GDLA 2B7NA 3OVQA 4UTJA 1TIMA 2C16A 4JIQA 4LV4A 5CPNA 2DZSA 4XZ9A 3A21A 1WBJA 3LDVA 2NX3A 1J2WA 5K7JA 3SGUA 3C56A 3W1PA 1S5VA 3SW6A 1JRCA 2BXVA 3DKLA 4DPQA 3E02A 3Q58A 2C6QA 5IBXA 3GYEA 2CLHA 2F7FA 1F2JA 3LXCA 1OFRA 2A21A 3QW3A 2CLEA 2NUYA 4LY8A 1ZCOA 4MIMA 3NA8A 4UNLA 5EMUA 3NQ6A 2PCQA 3TROA 1G69A 4NNCA 1UJPA 3UY7A 1GEQA 4RXGA 1NF7A 2NUWA 5IM51 5CPOA 3ZWTA 5FESA 4AWUA 3PVFA 1WDWA 3N2MA 1OFBA 3N9SA 4PC8A 1LLZA 3UWZA 4FF7A 3FIGA 2QCNA 5AC8A 3I7RA 1GTEA 1AL8A 3STCA 1EPXA 3LV5A 2QR6A 1A5BA 2G5WA 3C4UA 5FEPA 1WBHA 4FIRA 1UBSA 2J9YA 3ANYA 3CM4A 2ZZ5A 4XBSA 5FF7A 5FEWA 4NJKA 2ZA2A 2JGYA 4AB4A 4OGZA 3M43A 4JTKA 3LTPA 5D37A 3DFSA 3PG9A 1W5PA 1WX0A 5CSSA 1LYXA 4X9SA 2Y7FA 3DFOA 1GZGA 3N73A 2YSWA 5LHEA 1XUUA 1XL9A 1D3HA 4LC6A 5D2YA 2FPYA 3R89A 4PTNA 1LRNA 2ZFAA 5K9DA 3LB0A 3FKRA 3SZ8A 3WK1A 1TQXA 1UASA 3OBKA 4QITA 3LBCA 3TJLA 4AWSA 1ZALA 3T78A 1FDZA 5G5IA 3W2MA 3DHFA 1QCWA 4O17A 3M9YA 5CZTA 3EWWA 3LM7A 3V75A 4UTTC 3TKFA 4RK8A 1F6KA 1VGAA 2TRSA 2XN1A 5EBUA 1FWNA 1GOXA 4JTIA 4WOQA 4O57A 3G0UA 3MHUA 5I3HA 2TMDA 3NNTA 5DBUA 1BWLA 3NPVA 1DKWA 1O5XA 1TB3A 3L9CA 4IMDA 5CPLA 1QPQA 3BARA 1TPB1 5KINA 3LTYA 3N19B 1KM0A 4LVAA 3HG5A 4I7WA 4O53A 2Y89A 3BW2A 1YDVA 1Z42A 4IPJA 4NU7A 5BMWA 1OYCA 5EA9A 4I9AA 1XFBA 4LT9A 4UCGA 5AYYA 2BSLA 4DO4A 3FJ6A 1FBAA 3HO8A 4KFNA 3M0ZA 3G1VA 2Z0IA 3LCHA 1L6YA 3TSBA 3W86A 3DFQA 2FLIA 2GQAA 1MSSA 3PUOA 3QH2A 2NX9A 3SR7A 5BMXA 2ISVA 3TDFA 3NYZA 1H1YA 3NQEA 3TW6A 1GPWA 1GJPA 3QMSA 1VLWA 4BF9A 3W1QA 1BKSA 1VQTA 5D03A 2DZTA 1U83A 5D09A 4MPQA 1XBXA 4WXZA 2ZZ4A 5KZDA 5T26A 1YDNA 3FA5A 1RVGA 1WQ5A 2JBMA 3UPWA 3W9ZA 1R30A 3NDOA 3HG4A 3QMTA 1GWJA 2VFFA 4LVGA 3Q94A 5I3JA 3TC6A 2QCDA 1ZAJA 3DI1A 4LUJA 4CCEA 3NQAA 5DCBA 1S5WA 4N4PA 5LSMA 4EF8A 2V8ZA 4AEOA 4PFMA 4E0CA 1RQEA 4NJGA 3EX6A 3CEUA 1WA3A 5CGQA 5U7SA 3DAQA 3LHUA 5CZSA 4JYEA 2C15A 2PURA 3NL3A 1PVNA 2V2DA 2JKPA 4MYAA 1XKYA 2ZCGA 3GX9A 1OX5A 2GUUA 3RLVA 2ABBA 3NQDA 3M6YA 4Z0SA 4HT3A 1MEWA 1XXXA 1NAL1 1OHLA 1P1XA 2CU0A 3LRKA 1UUOA 4UMCA 4GUFA 3L66A 1YTDA 4TIMA 5MHBA 1KTBA 4UTLA 2VENA 3CQ0A 3QFEA 4IOTA 1VCFA 1KLZA 4JGDA 3WK0A 3NQGA 3FYPA 4OWGA 4P2VA 3M1ZA 4O8RA 1I2PA 5DCEA 3BLIA 1R2TA 4GRSA 4XBKA 4JTFA 3HOJA 1LOSA 4OHQA 3G0XA 2DZPA 4ZMGA 3K30A 2VEPA 1YXCA 4O18A 1VCVA 1JJKA 2W79A 1OFQA 4M19A 2FPVA 4HN4A 2OMAA 2A1YA 3W7OA 3LI1A 4TR9A 1FY6A 4J9JA 4YCPA 4X2RA 4AAJA 3S5ZA 3STGA 1SW3A 3KVLA 3DU0A 4JN6A 4NNBA 1EIXA 3EB2A 3KRSA 3ZS4A 1Q45A 5L9FA 2IQTA 3LHZA 4CNPA 5I3KA 3KOFA 5K4ZA 2O7QA 3G3MA 2FTPA 1OX4B 1SFLA 3A5VA 3CLMA 1Y0EA 1NFBA 2Y70A 4LRTA 3F1QA 4IXHA 3RK8A 3THAA 1VYSX 5HR7A 1HG3A 5CSRA 1LTDA 3A22A 3O8AA 1DOSA 5KITA 3UPBA 3ZR4A 2OZ0A 1VPXA 1V5XA 5FEXA 1DBTA 4OBTA 3C2RA 4UTIA 2CLOA 3W1NA 1XM3A 2GVJA 3W7JA 1OVDA 1ML1A 3G1AA 1VYRA 4HNNA 3W2KA 1JQVA 3M5VA 2E68A 2JK2A 3W83A 3C2OA 1QPRA 1TMHA 1SPQA 2WNQA 4HSOA 2ZRZA 3B03A 1VJIA 3TMLA 3W23A 3P84A 1K03A 4GNJA 1LLWA 4IX0A 2YCEA 2VFHA 4ZQCA 5F4XA 2YPIA 1B57A 4MFDA 3B0VC 4WX2A 1A50A 2X1RA 4HNUA 5D33A 5D38A 5GVJA 2RFGA 2ABAA 3TE9A 3SSJA 1VR6A 4WD0A 3PC0A 4O52A 1KM3A 2X16A 1Q6QA 4RLIA 5C2XA 1SFJA 3HPZA 4FXRA 5I3FA 2QF7A 2AGKA 3PY2A 1WV2A 1BEUA 4N02A 5CG7A 1TREA 4AMAA 3CTLA 3QYQA 3LHYA 3CC1A 5G1YA 3HB9A 5KSWA 2ZQ0A 2E5DA 1RQBA 1BTMA 3NOEA 3Q2DA 1JCLA 3OIXA 4DF0A 3PB0A 6ALDA 4AHOA 2V30A 3G3DA 1YDOA 3MP5A 3GKFA 2BLEA 3LCFA 3MYPA 1P4CA 2NWSA 3L5LA 4NX0A 4PH6A 5FF4A 1F7BA 1EEPA 1TYGA 3QQ0A 4XKYB 3DKJA 3UY8A 4UUIA 3VCRA 3VNDA 3QW4B 3PSVA 1XBVA 4FX6M 3TIMA 4AHQA 2DORA 4FNQA 4N4QA 3UQNA 3SI9A 4JTLA 1WAUA 3DFNA 3B05A 1J4EA 3GDRA 2V81A 1FWRA 4WQ6A 3TCEA 3IVSA 3PUEA 2WQPA 4Y90A 6TIMA 5CPMA 3W07A 1LORA 4JIPA 4BWLA 2RH9A 4Z1DA 4A22A 5HINA 2FB2A 1DV7A 1XUZA 3EEGA 5FF0A 2GOUA 3INPA 3T44A 3P82A 4L4LA 5AYXA 3PR2A 1FQ0A 2GPTA 5H91A 3IV3A 2CZEA 3LHWA 3OG3A 5F1VA 2ZRXA 2QEZA 4O11A 4M6VA 3T55A 2DU2A 1I2QA 1FDJA 4Z08A 4H3DA 4IMEA 3TUUA 4G1KA 1KBJA 3QM3A 2QAPA 2DZWA 2BZNA 5D30A 3W6YA 2WJZA 1VHNA 4K6AA 3P7YA 3W72A 1VH7A 3NQFA 2OJPA 1P0NA 3W87A 5HNRA 3KRZA 4MY1A 2FFCA 4WJEA 2GJLA 2Y62A 1GG0A 3LHVA 3LOTA 1FCUA 4BI5A 4XWUA 1TRDA 3UXAA 5C5YA 4NT0A 5DELA 4A29A 3FOKA 5TIMA 4AH7A 2CZ5A 1H61A 2BWGA 3P80A 1J5TA 1IXNA 2H3DA 5KZEA 3W75A 2X1SA 4FXSA 4ZQRA 4R33A 3E49A 4K37A 1THFD 3BW4A 4UTMA 1TPH1 3H54A 1QAPA 8TIMA 4N9CA 3QF0A 5AYZA 1OFDA 4K8EA 1IXQA 2J27A 2EKCA 4XQ6A 4C1LA 4MVAA 1I8JA 2C13A 2NV2A 2H8ZA 3TAOA 4JDYA 1F73A 4IWWA 2A6LA 1T0OA 4HNVA 4ZQOA 4TX9A 3BG3A 3WJYA 4OE7A 5EL1A 1MO0A 5C55A 1W0MA 3NQVA 4PL1A 1B3OA 3OHIA 5F2LA 2VC6A 3GNDA 1C9DA 3VE7A 3TMQA 1W1ZA 3LLDA 4UTUA 3QPZA 4FX7A 5LNVA 1TQJA 3L2IA 1L6WA 5CZ0A 3HPXA 1NEYA 4WY0B 3WFAA 4RZ6A 1K8ZA 4H6KA 1L9WA 1EWDA 1I2OA 5D2WA 1KTNA 4E2DA 3NL5A 1GYLA 2QJHA 2CLFA 4LC8A 4Z1BA 1OFOA 4UTTA 1YXDA 3PBUA 4TMBA 1JCJA 3RFAA 3SIZA 1FCBA 3P61A 1PE1A 2TPSA 3HIJA 1XDLA 1KA9F 3JS3A 2DZXA 1A53A 1KM2A 1W56A 4JEQA 4O28A 3G1DA 4KFOA 4LWWA 3GAYA 4UXDA 1Z41A 5LKYA 1FDYA 2OT1A 3ABRA 1EX5A 1K7EA 2F84A 1PIIA 2Z6JA 1RQHA 1MZHA 2E6AA 3UWYA 5DCDA 2A6NA 3S1UA 1R46A 4GUGA 1KLYA 4PA8A 1H60A 1YYAA 2C3ZA 4DELA 4W9TA 3S1XA 5F4SA 1AW1A 1JULA 5D2TA 3R13A 1LZOA 3G1SA 4JTHA 4L4MA 1TPUA 4MLRA 2ZRYA 1QR7A 3M41A 3P5YA 4XTDA 4BWLC 1JUBA 2Z1BA 1ZY9A 3BV4A 4AF0A 1KTCA 3BLEA 3W84A 1F6PA 2QCHA 1SO3A 3ABQA 2CW6A 4FB7A 3UWVA 1X1ZA 2QCFA 2HMCA 4Y96A 3G8RA 4UTHA 1Q6OA 2WNZA 3OEXA 4O0KA 3LX9A 1PHQA 3F4NA 4PEKA 3W85A 2OCZA 3I65A 3IVTA 3S1VA 1ICPA 3KVMA 3CPRA 1O60A 3L5AA 3TR2A 3GAKA 1WXJA 2C19A 2C1HA 3WJWA 1IIHA 4BI6A 2ATMA 1F05A 3ZWSA 1SZGA 1ONRA 2Z2UA 1AW5A 3NPXA 1W5QA 4DEFA 1KFLA 4O16A 2BX7A 2E5CA 3C2VA 3S5NA 4JYFA 4MY9A 1T8XA 4MUZA 1YXYA 4LNYA 3GZ3A 3R2GA 1JR1A 1FXQA 4DQWA 4JTGA 2QJGA 3CIWA 3GXPA 3DH7A 4QISA 3IIZA 2VELA 1IXPA 2G96A 2NWRA 1UCWA 1M7PA 1SW0A 3TSDA 1TTQA 2A5HA 1M5WA 4O1CA 4DF1A 5AOUA 1GVRA 2V82A 4EF9A 2Q8ZA 2YYUA 1QDSA 2CLMA 2Y85A 3GNNA 3G0SA 1YPIA 2Y88A 3NPUA 1F5ZA 5I3GA 2J9XA 2NUXA 1JCNA 1FCQA 2XFWA 5CZJA 3HGOA 5HQEA 3P62A 1LM1A 3B0UX 3P8IA 5C6MA 4HKPA 4CNNA 2Y6ZA 3OVRA 1W5NA 3DXIA 3DI0A 3GKAA 3C0JA 3NQCA 3LRMA 1ICQA 3R8RA 2FB3A 3M47A 1H63A 3C2FA 1D3GA 3W1LA 3DGRA 1A5CA 3LCGA 2VKZG 1XBYA 1V7YA 3BGJA 3IIOA 2X30A 3N2XA 4LOCA 5LHFA 4HIBA 3FFSA 3O06A 1KFCA 1ADOA 1YTKA 4HPXA 4GUIA 3BG5A 3U8GA 3M5XA 5K3VA 1ZAIA 5F2GA 3W7GA 4JYDA 2UV8G 2YX0A 4NJHA 3QRHA 1OABA 1TPWA 2Y7GA 3ATYA 3IEBA 3MJYA 5ABTA 1OX4A 4NX5A 1AMKA 3I68A 2QUTA 3W22A 2FPTA 1H1ZA 4O54A 1ZNNA 2E5BA 3BLFA 3L0GA 3E96A 3EWXA 1VC4A 5FF3A 1ZAHA 2D73A 4ALDA 2QUUA 1SSGA 1JRBA 4RXFA 2TYSA 3M44A 1VCGA 2Y7DA 4Q32A 4M6PA 4QIUA 3C3NA 1IF2A 1YLVA 1X8FA 4RV8A 3LHTA 1H7RA 3CWOX 1SO5A 5HUOA 2WSYA 1JCYA 1OK4A 3G1FA 3IVUA 5K4XA 2ZA3A 1EUNA 4RJEA 1G4TA 2B0MA 3PB2A 1PL9A 2V5LA 3MWAA 2RDTA 1H62A 3CT7A 3NL2A 4N9BA 3SGZA 3FJLA 4ICNA 5F2MA 2DZUA 1IXOA 1K7FA 2GQ8A 4GXMA 3TFCA 4QNWA 3LCLA 1OYAA 1G7VA 2VEMA 5AHNA 1F74A 3LXBA 3P60A 5A8GA 4BR1A 5FI8A 3CHVA 1PV8A 3E0IA 3A23A 4LS2A 3ELFA 1EP2A 3HPSA 2HSAA 3AO0A 1E51A 2HS6A 3ABOA 5CKSA 3C8FA 5D02A 4UIOA 4LVFA 4YLWA 3M7WA 5AHLA 2JKEA 5IBXC 3W1MA 1D9EA 3WK2A 4UTWC 5DY2A 1O94A 5D05A 3QEZA 3NM3A 4O15A 1P5BA 5KZMA 3UXDA 3NAVA 1DJNA 3DENA 3MI6A 1K8YA 3E12A 4A2RA 3GDKA 1GVFA 3H55A 2G95A 4ORMA 4CQ9A 2H3BA 3P81A 4IPIA 1IGSA 3PAJA 4NNAA 3TNOA 4ZZ9A 1UUMA 4JXCA 1M7OA 3THQA 1BWKA 5AHEA 1AG1O 1W3NA 3KAOA 1LCOA 1SR9A 3O6DA 4JTTA 5D2VA 2PRLA 2A0NA 3UWQA 2V2HA 3W7QA 3UWUA 5K9XA 1I45A 2WNNA 4IMCA 3W71A 1TV5A 4LUIA 5TBOA 2CFFA 2E09A 4AF0B 1I2RA 3UNDA 4H4IA 3USBA 4LVBA 1KV8A 3GXTA 1HO1A 2B7PA 3QJAA 2V5BA 5F2IA 4GBUA 4GC4A 3HGRA 3F03K 3LCWA 4DF2A 1ZENA 4FNSA 2I9EA 4K36A 2Y63A 2JKAA 2B4GA 4MZYA 5DLCA 4QJ1A 3GLCA 3T40A 1SZFA 2J24A 5AN7A 2I14A 4FX8A 3KX6A 2Y7EA 3LGEA 1SW7A 2P1FA 1QO5A 5EPDA 3TC7A 2CLIA 1AK5A 1N8FA 3G24A 5D32A 3TV8A 4M7SA 5E93A 3T4CA 3HJZA 3U2OA 4JTSA 3GR7A 2PE4A 2VXNA 2QJIA 4S1FA 1UB3A 3W76A 3LI0A 5I3IA 1B4EA 4MLJA 3NM1A 4MZ8A 4N6FA 1KM5A 1HFBA 1EB3A 2HS8A 2HTMA 2E1DA 3ATZA 3VKJA 2ISSA 3RF9A 3W70A 3EXRA 4X22A 4ORIA 3N34A 3NPWA 1LBLA 3C52A 4O4VA 2RDWA 4ZQMA 1B9BA 3B4UA 2YFNA 1WYIA 3W7MA 1SO4A 1EA0A 1H7WA 3W3OA 1JUKA 3N3MA 2ZZ1A 4KWWA 3G18A 2EHHA 1QOQA 5L6UA 2R91A 3R12A 1I2NA 4WUIA 3GB6A 2WKJA 3H53A 5HJLA 3I7SA 3G1XA 3TFXA 3FKKA 4RZ4A 3KFTA 3TQ0A 1VYPX 4MOZA 3N14A 2ZBTA 5AC6A 3D0CA 3YPIA 2QCGA 2NXIA 1PHWA 3STFA 2EAWA 3W7CA 5HWMA 3KVKA 5A5WA 3MBDA 3L21A 1G4EA 3MBFA 3B06A 5EYWA 2GQ9A 2Z6IA 3GDTA 1G67A 4M7TA 3WJZA 1JVNA 3S42A 1LOLA 2OX1A 4POCA 5U4NA 3S6DA
chains in the Genus database with same CATH superfamily
6PTDA 1C29A 1V03A 4GE8A 4XG1A 3ZXWA 3KXQA 3M0XA 1HJQA 4IMAA 2PDUA 3ZLFA 4D72A 3E74A 4KWOA 2PDGA 2YW4A 1MUWA 3OZOA 4IX2A 1Z69A 1OCJA 3A64A 3FVDA 4HMNA 3VNYA 3KP0A 4GLEA 1R7OA 3AI0A 4MJ2A 3ABXA 2ZADA 1H50A 3R8HA 3MO7A 1BYAA 2V2CA 3SRFA 1W3LA 2QDGA 5I09A 3RRXA 4JR5A 1WUFA 5LGZA 4AD4A 3HTWA 3EKZA 5LNSA 1O95A 1QWGA 4JHMA 4LF2A 4XSMA 3PP7A 2RUSA 2X05A 2E1WA 2ODOA 1IIGA 3G22A 5LGXA 3K8KA 4HSNA 3PBWA 1QFEA 4F0HA 3BXWA 4G7EA 3UGRA 2GGEA 2MUCA 2ZVRA 3GHSA 2R8WA 1Z44A 3UCDA 4JX5A 1OGSA 3VK5A 5G2IA 4HHHA 1DHPA 1LQAA 1JZ7A 4BQ2A 2VOTA 3UXKA 3PZOA 2FHBA 3WF2A 3EB4A 3B04A 3NUKA 2J6XA 3O63A 1V3LA 4B3ZA 4E8GA 4DJFA 3ZMRA 3C2EA 3M0YA 3BH4A 1KO0A 3O07A 5DX7A 4HK7A 3UBPC 1ITQA 4NZJA 4DYKA 5I79A 4RE2A 2A85A 2GDVA 1JAKA 2DT1A 3DHPA 2CWNA 4UR7A 1ECEA 4GIYA 1TKKA 1V3IA 1EBHA 1QUMA 3I6TA 2C0AA 1RY8A 3DZ1A 4O10A 2DSVA 5DMNA 1X6NA 1I0BA 3MP3A 4GGHA 2QV5A 4N2YA 5LNUA 4ZFMA 4EVZA 3UU0A 3QKZA 2EGZA 3FK4A 3BAJA 3O6YX 4FR1A 4GY1A 3CZKA 4WKFA 3EXTA 3W7IA 4HZ6A 2CXEA 1A5KC 4D71A 2F6XA 4HU3A 4AQLA 3UJFA 3AXHA 3SCPA 4QG8A 3W1UA 1Q85A 3VKAA 1AW2A 3VFLA 2C14A 3R8GA 2EPNA 4Q4KA 3JRKA 1XLKA 2Z25A 4PUDA 3CQHA 4NAFA 1ZZMA 2V5KA 2DZAA 4LU0A 5C9RA 3IAQA 5BOOA 3O1NA 3S6OA 3O6CA 1GEHA 5CPTA 4MPKA 2OSWA 3EYPA 5ABHA 1XLDA 3DFHA 3I6RA 2NXGA 1X6UA 3THUA 3MKVA 2QKFA 3W7EA 1OD8A 4LCSA 4RCXA 4WXYA 3AIQA 3ARWA 4RNFA 4KIEA 4TVUA 2J8FA 3MU7A 2HNHA 4Y9PA 4LRSA 4QCEA 4H19A 1CGXA 4Q8VA 5EMJA 4OZOA 2YA2A 4NI3A 2QCCA 2W9MA 1PZ2A 5I3DA 4QE4A 4Q4SA 2NXHA 1W54A 2HEJA 2YGYA 3SGGA 5D04C 3WUBA 4DUOA 4JS3A 2VUNA 4F79A 3A5FA 5A6AA 1IZKA 4YTRA 3N2BA 3BW3A 2E8YA 1O5QA 4YXGA 3UG4A 3E2SA 1OC5A 1Y5WA 3GR8A 3GH4A 1OIFA 4AX7A 4MWAA 4HNCA 3E0FA 2XIBA 1H7PA 4CLMA 1G4SA 3CB8A 2A7PA 4CCCA 3U6WA 1H7OA 3E2QA 1KV5A 3BMVA 1TR9A 2BB0A 3B8SA 3AALA 1DQUA 1EBGA 3M5ZA 1MEHA 4H9YA 3TTSA 1LROA 3IJ6A 1MFVA 2XM2A 1XIGA 1B30A 6REQA 1O5KA 4QJ4B 1EDGA 3KOZA 1S38A 1NOFA 1KBIA 4GQ0A 3NL6A 3ALFA 3ARYA 3MI2A 3CAVA 3RLHA 1X6LA 1DL3A 3E2VA 3FX4A 4LS0A 4N0RA 4GI4A 4LJ3A 2VD9A 1K8XA 2CLLA 5G1TA 1PCWA 3LCIA 1HJSA 3MW7A 3LD5A 2Z1KA 4ACZB 4CNTA 1ICSA 4N9DA 2EKGA 3J7HA 1GQJA 4D6GA 4C6QA 3BMXA 2HK1A 5ABGA 2QXWA 1UW9A 3VMNA 1F4AA 3LERA 3V0UA 1CW2A 4YIWA 2OSXA 1TV7A 3R11A 4BFAA 4EIVA 3KBWA 1W1IE 1YHTA 3IK2A 4GG9A 3T7VA 3BCDA 1YADA 3RMJA 1JPKA 3EX3A 1OCBA 1TPC1 3F2DA 1E4MM 5A2AA 4XVEA 2BTMA 3B4YA 1Z48A 7TAAA 1DJZA 1C8VA 5LYRA 3SRDA 1T40A 5HBFA 4NZFA 1NVMA 2FH6A 5TQLA 1JZ4A 4TQTA 1CLXA 4LEFA 5BRBA 1JUEA 2CCRA 4GH3A 3KRBA 2XIOA 4MSSA 4ML9A 1N55A 1U33A 2PGWA 2WPBA 4JY9A 2V5CA 1QHPA 2QMKA 2W3ZA 2DW7A 4L7ZA 3JR2A 3EOSA 3FXGA 1NU5A 3E5PA 2X1UA 1MVYA 1QK0A 3UZZA 4CD4A 5C54A 2E77A 4ZO7A 3VOFA 2PU1A 4ACYA 2OLSA 1GT8A 3TTQA 1SU5A 1SO6A 3K4AA 3RX3A 4E3TA 4K7YA 4UTKA 3RPDA 1FXPA 3FN9A 2QS8A 4U31A 4AG0A 1QK2A 4WVXA 2CITA 4B92A 5T9CE 5AB3A 2BVWA 1G6CA 5FACA 2TSYA 4MYXA 1X1OA 1EP3A 2WZMA 5AFDA 1H0IA 4NY2A 4J27A 1L6GA 4KKXA 3SY1A 2VDGA 3QPYA 3S5YA 1VEMA 4FLSA 1QOXA 3WEMA 3LQGA 4G6CA 1V6UA 5DN1A 2VC9A 5A8MA 3HMJG 2H9AA 4S2BA 2OYMA 3TYEA 3DFTA 1EZ2A 1FKXA 3MTWA 4C6OA 1O6IA 3UG8A 1CXIA 3AHYA 5HR6A 4INFA 4UZUA 4CN6A 4IQLA 2X1TA 2PLKA 4CQDA 4QJ5B 2BASA 4LX4A 3AS2A 2QAFA 1J2BA 4M1BA 4MJ4A 1G7UA 3XINA 2BMBA 3N1AA 3F5KA 2YR1A 5F4WA 1CGTA 4ADTA 2EXOA 4V1YA 1HL9A 1E3ZA 1S3HA 3EKLA 1CI1A 4ES4A 1YPFA 5C71A 4Z2IA 1SQ7A 4XKYA 3M0KA 5SWUA 1AFSA 2HDJA 3JUGA 2ZZ6A 2P3ZA 1FH9A 4Q22A 1EH9A 1DJQA 2V3FA 1ME9A 3WLNA 2PF0A 3CHEA 3A4JA 3I6EA 1DTNA 1RHCA 3D47A 4BQ4A 1VKFA 3B8UA 4PSPA 1DQXA 1CGWA 3NZRA 4LUSA 3WLPA 1XIDA 1SZNA 1ME7A 1LT7A 4TO8A 4X9YA 4JX6A 2RHGA 1AH4A 1QO2A 1W3TA 2H8XA 1W5OA 1KW1A 2DSUA 4AD3A 4DJDD 3WBEA 3KBNA 3OU8A 4NHVA 2WVUA 4IFRA 1VP5A 1SVDA 4QAWA 5IXEA 1DEDA 5K2ZA 3S1WA 1W31A 4H6EA 1KWGA 1XX1A 1XC4A 4B90A 4M24A 3PNUA 3HQ1A 5FKYA 2JF7A 1TPFA 3HGJA 4NAEA 3BAIA 1QASA 3DC8A 1E6NA 1ZJBA 4OV4A 4FHAA 2WC4A 4DXKA 3BK0A 4DUXA 1I1XA 3WLJA 3GVGA 2DVTA 4JTUA 1C7TA 1L6SA 5DBTA 4L6HA 1Q2SA 3GXFA 3W7HA 3AQUA 4DWSD 1XRFA 3S2MA 4AZCA 4NILA 1VLIA 3GIYA 3PPFA 5IFTA 3ABZA 3FSTA 1TWIA 4HA3A 4IUGA 4N7QA 3QQ1A 3UJRA 4PBFA 3E9AA 1TCMA 4L9ZA 4UTJA 5BOFA 3LZ5A 1VFTA 4JIQA 3T08A 2DZSA 4XZ9A 3LDVA 3U9IA 3MUZ1 2A3CA 3DFYA 3TOYA 4DPQA 3WQ6A 3WL1A 1FHUA 2J62A 3VNJA 3GYEA 1MW0A 5JUVA 4ZB2A 1NJJA 4LY8A 1ZCOA 3DX5A 4GZIA 3NQ6A 2D69A 2Z4GA 5F7UA 3ES7A 4GXWA 2D24A 4A3RA 1NF7A 3SIMA 5CPOA 1UKSA 5JMUA 3CV6A 5FESA 4TTUA 1WDWA 3N2MA 3CZGA 3N9SA 3TC3A 3NZGA 1LLZA 2O4MA 2PWVA 1V3MA 3M0IA 4PC8A 5GNXA 2DFAA 3QOMA 2OODA 2QCNA 4O0QA 4M29A 4PUJA 4IH3A 1IWAA 3GIQA 1B3WA 3TTOA 1EPXA 2QR6A 2Z29A 2XINA 4IIEA 4AW7A 3C4UA 1JF5A 4HA0A 4XD6A 3SUTA 2UY3A 8RUCA 4P7RA 3MSGA 2JGYA 3W28A 1PBGA 3FVMA 3M43A 1OD0A 4AD1A 4QBXA 4GPNA 3DFSA 1XINA 3PG9A 2WLZA 3LY0A 2Y7FA 3DFOA 5BXSA 1GZGA 5CC6A 2YSWA 1XL9A 4LC6A 2FPYA 2HVNA 1LRNA 2ZFAA 2YBTA 3BC9A 1PTAA 3UXLA 1Q6CA 4R85A 2D1ZA 3QN3A 1TMLA 2VC5A 1MNSA 4FOUA 3WUEA 3WQVA 1JGMA 4I6VA 3T78A 1FDZA 3W2MA 4QLLA 1SJBA 3DHFA 5JXQA 2VR5A 4O17A 1UMLA 3GD6A 5HDRA 3TKFA 3APTA 4HB7A 1W2PA 2VYOA 4AZIA 1UIPA 4GYKA 2PDKA 3T05A 1BQGA 1FHDA 3QV6A 1TPB1 5KINA 5IHRA 2X0YA 4QRNA 4IPLA 2Y89A 3BW2A 1W9XA 5BXPA 1Z42A 2BDQA 3K1GA 1KCZA 4IPJA 4NU7A 5EA9A 1XFBA 3GXIA 3WQ8A 4J2MA 2BXZA 5E6ZA 3FJ6A 5FL1A 1XSJA 4MDPA 1JDCA 1W1PA 3OO2A 1Y65A 2F9RA 2FLIA 1MSSA 3QH2A 1ZSXA 1SJCA 4U3AA 3TDFA 1H1YA 3NQEA 1GPWA 2GJPA 1GJPA 3R0DA 2VZTA 1QRQA 1U83A 1GOMA 2REQA 4H41A 5KZDA 2VM8A 3M07A 2INEA 1Z7AA 1RD6A 3KTCA 2JBMA 3W9ZA 3A3HA 4Q4PA 3Q94A 3TC6A 2ZE0A 2ZDSA 3NQAA 3LK6A 5DCBA 5LSMA 4HGXA 4XAZA 4UQDA 3HM7A 3EX6A 3CEUA 2F61A 2PTYA 2Y8KA 3LHUA 4FMVA 3V0SA 2PFHA 2PURA 1V6XA 1RAKA 2YA1A 2ASHA 4J3ZA 2V2DA 1XP3A 1LG1A 1XKYA 3UZXA 1UH2A 3U0HA 3UR8A 1XXXA 2O9TA 2CU0A 3CMGA 2DQXA 3MCNA 3W27A 1R3VA 3BICA 4AIUA 2PZ0A 2DIKA 4JNYA 3PZNA 2JE8A 3M1ZA 3H4GA 4O8RA 3W6LA 2QVNA 2DZBA 1AVAA 2CKSA 4V28A 3WMSA 1HGWA 5E0CA 2XPKA 1HT6A 2DZPA 4H83A 4ZMGA 4CU6A 7ENLA 2W79A 1A5UA 2F6KA 2BXYA 2OMAA 2PDHA 4S3AA 3LI1A 1BG4A 4G2DA 4AAJA 2INZA 1S5MA 3B8IA 1DWGM 2PDPA 5JBEA 2VQUA 4NNBA 2CKRA 1EIXA 3EB2A 5L9FA 4CNPA 1UZDA 4RE4A 3KOFA 3GXMA 3W02A 3MZNA 4EP8C 1SFLA 4DWSA 3MVIA 3CLMA 4C90A 5BU6A 3FAXA 3VOIA 3VIJA 1NFBA 2XM1A 3F1QA 2O92A 1A5OC 4Q3MA 2YXXA 2NLYA 3KS6A 3EDEA 1E9YB 1REQA 5FEXA 1LLOA 2HBXA 1UC5A 2QDDA 3C2RA 2GVJA 2XVGA 2E67A 4GO9A 4S3CA 1NOWA 4C91A 5GNYA 4KETA 3MKCA 3P6LA 2ZRZA 3GU9A 1P1MA 1DWAM 4QFUA 3W23A 3P84A 3ZSTA 4IX0A 1J18A 4MFDA 4QEEA 4HNUA 3MUY1 2Z28A 3RO6A 4WD0A 3UJ2A 3E6EA 1MQPA 4RLIA 3HPZA 3SCOA 1PKNA 4LCRA 1WV2A 1HJXA 4AMAA 3QYQA 3HB9A 3K1DA 3AMDA 4RDZA 3VXGA 1E0VA 5CJMA 1KXQA 2E5DA 3IUDA 1RQBA 1BTMA 1JCLA 3OIXA 4DF0A 3PB0A 2R1KA 1XDJA 4ZTYA 2V30A 4JFTA 3UETA 1YDOA 3GKFA 1NM9A 3WFLA 3KZPA 1VENA 1O7AA 4XKYB 3DKJA 4UUIA 4PYSA 4XIAA 4UQAA 4Z17A 4AHQA 2W91A 4O8AA 2VX4A 3R25A 3B8VA 1ADDA 3SI9A 5CJ5A 4EX4A 1WAUA 3B05A 1J4EA 3GDRA 3WELA 3HV8A 5A6BA 1EFZA 1E73M 4EWJA 2XUCA 2WQPA 4XZIA 4Y90A 3GG7A 2DH3A 1RK6A 1LORA 1FP8A 1GW1A 4UCFA 3CASA 4BWLA 5TD4A 4Z1DA 5HINA 2FB2A 4I6KA 4PCNA 5FF0A 3INPA 4Z42C 1RUSA 2Y5EA 1EJSC 4WK9A 1TWSA 2GPTA 4S23A 5H91A 4JHOA 2CZEA 5F1VA 4H04A 4GQQA 4M6VA 5AECA 2XIMA 2PDQA 5LIXX 3CZJA 4G1KA 4J3UA 1KBJA 2QAPA 3QM3A 4LSBA 2WJZA 1VHNA 4K6AA 4JIIX 2P0IA 2UY4A 2J4GA 1OINA 2PLCA 3Q45A 2Y62A 2GJRA 3CT2A 3LOTA 4BI5A 1TRDA 1GYMA 3BAYA 4A29A 3FOKA 2CZ5A 2QHAA 3URBA 1J5TA 3TYAA 4FP1A 5KZEA 3WMLA 3W75A 2HRWA 4MB5A 4ZQRA 4HZMA 3ITVA 1OB0A 4WDUA 3M0VA 3BW4A 4UTMA 3LYEA 3H54A 2OLAA 3SN4A 4LUTB 1IXQA 4Q7BA 3ZJ7A 2NV2A 3W24A 4AU0A 3TAOA 4JDYA 5CSUA 1JAEA 2DIJA 4ZQOA 1T41A 1JXKA 5EL1A 3WUGA 3NQVA 4PUKA 3N4EA 3I3DA 1B3OA 3GNDA 4F66A 1EJTC 1VBGA 1RBLA 1W1ZA 2VGIA 4EAMA 1TQJA 3L2IA 3W81A 3ZM8A 3VPLA 4W8LA 2O0TA 3THDA 1K8ZA 1TG7A 3ZT6A 2GK1B 4TVDA 1EEXA 3N6JA 1KR0A 3NL5A 1GYLA 2CLFA 1MNZA 1OFOA 1BTCA 1FFQA 1XQLA 1YXDA 1HIZA 1IE7C 3PBUA 4TMBA 3RFAA 1FCBA 1E6QM 2WHLA 3VKBA 4JKKA 2CBIA 4AVNA 4CUCA 1XLFA 1Y7VA 2EJAA 3L4WA 3URQA 4MWAD 4NG3A 2WMKA 2GUBA 1N8WA 4KFOA 4LWWA 4JPGA 1FDYA 2D0HA 2OT1A 3GE7A 4L9YA 2F84A 1TJ2A 2HZGA 2Z6JA 1R3SA 2NVDA 5DCDA 5FJOA 1E1CB 6XIMA 1YYAA 1A0EA 4C5ZA 4H7ZA 4W9TA 1A3WA 4OTKA 1K1DA 5D2TA 4EXQA 3TJIA 3GTIA 1V08A 1XIJA 3M0LA 3EMZA 3N25A 2DVXA 4QROA 2ZRYA 1QR7A 3M6DA 4XTDA 1JUBA 4IIHA 3BV4A 4AF0A 1BSIA 1UUQA 2GWNA 4AY8A 1JZ3A 2HMCA 5DT5A 2OWWA 1QT1A 2OFJA 1J0IA 3GBEA 3LX9A 2PZNA 3RJYA 4PEKA 3NXLA 3W85A 3T4WA 3KVMA 3SCVA 2VC7A 3K8LA 4PTWA 4EXAA 1WXJA 2C1HA 2WBKA 1K77A 3VC5A 1F05A 3PZTA 1W5QA 3S5NA 3A47A 4LNYA 3NDZA 3R2GA 1MFUA 3TJ4A 3GRIA 5DRCA 4YPJA 4KESA 3U57A 4MM1A 3CIWA 1ZP3A 3IIZA 2VELA 1IXPA 3UG3A 2BY3A 2G96A 3OLIA 2NWRA 4A35A 4MB1A 3UJSA 3CB3A 4QXIA 4C6IA 2PDCA 2I16A 3CUJA 4CQBA 3O9NA 4EF9A 4CEUC 3AHXA 2Q8ZA 4LUSB 3CIVA 1QDSA 1PXGA 2Y85A 1YPIA 2ZVIA 2E9BA 1JCNA 1FCQA 5CZJA 3MPGA 2VZOA 4AWEA 4EXBA 4CN1A 3P8IA 2G3IA 3WH5A 5FIPA 1Q8JA 2Y6ZA 2DSWA 3OVRA 3WLIA 3DDMA 1WE5A 1ICQA 4NRRA 2FB3A 3M47A 1H63A 2ADAA 3AHTA 1I75A 2Z24A 4REQA 2HPIA 2VKZG 5D9OA 1V7YA 1X96A 4QS5A 4L1GA 3N2XA 3O06A 3EMQA 3BQ5A 1AZ1A 4US5D 4QE5A 3R7MA 3M64A 2DT0A 1B9ZA 3OP2A 4S39A 4CCZA 3ARPA 3N2CA 3IJLA 2W63A 3QRHA 1OABA 3SQMA 5I77A 1TPWA 1CB2A 2VVNA 1AMKA 1QW9A 1BHGA 1A4LA 1XIIA 4O54A 1HKIA 1BVWA 2E5BA 3BLFA 2XSAA 3VDBA 1R9YA 3QY6A 3E96A 1UWAA 4K1WA 3LSCA 1ZAHA 2QUUA 3OIHA 3CUIA 4RXFA 1JD9A 1DE6A 4QIUA 3C3NA 3SRKA 1J12A 5CBJA 1EC7A 1H7RA 2DSZA 4B9ZA 3SDOA 1PKMA 3QV7A 2WSYA 1JCYA 4P7QA 2TODA 3IVUA 1PTDA 5K4XA 1GQIA 1EUNA 1G4TA 2YL9A 2B0MA 3A13A 3PB2A 2PDFA 2X09A 2V5LA 1HW6A 3LENA 2ZX8A 2J7BA 2CBJA 5MKGA 3CT7A 3NL2A 4N9BA 3ITGA 3NWRA 3DECA 4DM2A 3TFCA 4G56A 3M0JA 4NZ3A 4DBWA 2QZRA 1G7VA 2VEMA 3LXBA 1Q65A 1PV8A 2YCKX 3A23A 1EP2A 4C1NA 4WLCA 2E9LA 2HS6A 2IKJA 2E8ZA 4UOJA 1L8NA 5CKSA 5D02A 3W1MA 3HMCA 1D9EA 3RN6A 2D23A 1Q6GA 4UTWC 4B2DA 3NM3A 1P5BA 5KZMA 1XH1A 3NAVA 3UXDA 3MI6A 4FALA 5HK4A 5A3HA 1KNWA 4RW5A 5HQLA 5KETA 4PCTA 2ACSA 4AZCB 3SO7A 1UKOA 4NF7A 1LCOA 2A0NA 4YTUA 1KBLA 3UWQA 1NQKA 3W7QA 4IMCA 4TV5A 4ZA0A 1GHRA 2CFFA 5MKGB 8CGTA 2ZOXA 4JTDA 4L1XA 4UTFA 1E0XA 1QU4A 3QJAA 4GBUA 4GC4A 3HGRA 3F03K 3QVQA 1S2WA 3L4VA 2JKAA 2UZ9A 4KWUA 3VKDA 4MZYA 5DLCA 1V51A 3GLCA 4PTDA 4W8BA 2J24A 5AN7A 2P1FA 1AK5A 3W0KA 4X2PA 3U2OA 4AY1A 1IT0A 2PLMA 2PE4A 1JYWA 4B5SA 4S1FA 3BAWA 2WBGA 1QPKA 4YHGA 3W76A 1B4EA 4GXPA 3NM1A 2BBFA 3CMJA 2VRQA 5E0FA 3OZPA 4C6DA 3PFMA 2HTMA 2ISSA 2PF8A 4DYJA 4ATDA 1WZAA 4PTMA 4ORIA 1KRAC 4W93A 2PDJA 2X0HA 2GWGA 3NPWA 3C52A 4O4VA 2RDWA 4ZQMA 1B9BA 2YFNA 4MWAC 2GVEA 1G01A 1E1CA 3W37A 4ML4A 4KWWA 3G18A 2EHHA 3BURA 3LPGA 4V15A 3TYZA 5LXEA 4WUIA 1OZMA 3GB6A 2WKJA 3H53A 5HJLA 1VIWA 3TFXA 3PJUA 3GTHA 3R58A 1PUDA 2FMNA 3LMYA 2Q01A 3TQ0A 5I2UA 1FA2A 2ZBTA 4M3PA 3KUMA 3YPIA 4MAVA 4D6HA 1NWUA 2HVOA 5HWMA 1M04A 4PMVA 3GDTA 3QLLA 1V8EA 3E3HA 2YDSA 4ZENA 1IV8A 3LGGA 5HOSA 4EAYA 2OX1A 4BQ3A 1BF6A 3S6DA 1WKYA 2OT0A 4HYVA 3UYIA 4I90A 4HVXA 2C7FA 3MQTA 4FIQA 2GL5A 5HWNA 5A6BD 1GVQA 5E6YA 3TQPA 2BY0A 3CU2A 2FMOA 3VDAA 3Q37A 4A2SA 5DXXA 1XG3A 4GFIA 4XZBA 3STPA 3GM8A 3VMPA 1R8LA 4DX3A 1FWBC 3T0TA 1XD0A 4O13A 4B5NA 3VAVA 4Q4MA 1EHAA 1V77A 1KFBA 5I00A 1IR1A 1U1UA 2WV8A 3GVVA 1JEZA 4NXKA 4D8AA 3ID7A 3W73A 3SCRA 3IIXA 3PK7A 3GVRA 3VNIA 3WBXA 4GKTA 1LRQA 2NQZA 1IR2A 1BVZA 1C90A 4US6A 3R79A 3BSGA 1DIEA 2LLEA 1J6OA 3IJDA 2DT3A 2R1MA 3T1GA 2O9OA 3UFYA 3RYSA 1XV8A 3CNYA 4DZIA 2FH8A 3DHUA 3LCXA 3GU2A 1UROA 3OBEA 4G5DA 2G3MA 3TWBA 5F1UA 4HPJA 2ZZ7A 1JPIA 4PGLA 2OQHA 4Q4OA 4ZB0A 3TWAA 3VNMA 3ZJ8A 1I1WA 3AUJA 3IGXA 3V3WA 1F6YA 3TA6A 2A4AA 3ISIX 3RU6A 5HWJA 3IJ9A 5A2CA 4UFIA 4E5TA 4P7OA 3WG6A 2CZDA 3ICJA 3GBDA 5CGTA 2G3NA 4WSKA 3NXFA 3WEZA 2W62A 1TX0A 4IIFA 2J77A 1RLDA 1GQLA 5FJIA 3RDKA 4JICA 1W8SA 2GVGA 4UQ9A 3H4WA 4WZHA 2AOSA 2QPUA 3QTGA 1JNEA 2H6RA 4PCFA 2CIPA 2DEPA 1V6VA 2WNWA 4Z1CA 3IACA 4BK9A 3EPOA 3RPMA 3DFPA 1HKWA 4F0LA 3WZ0E 2Q8LA 2PRMA 1MUCA 5HUPA 2JIWA 4ZCWA 4ICCX 3EPMA 1ZHAA 4K7VA 2GLKA 3W29A 3PPCA 1E6SM 4C6KA 3PPGA 3MYOA 1AL7A 5G2WA 2WLYA 3H7RA 2E6YA 1F3XA 2XH0A 1EHNA 1FFRA 2Y4SA 5HMSA 2HQAA 3QFWA 2VD8A 2XJ7A 3T2QA 2Q3RA 1TTIA 3NGJA 2DJXA 5HNUA 2XWEA 3TA9A 4PUEA 4XZMX 3KBJA 3TLQA 3CUFA 3RMEA 5C0QA 1EXBA 4ONVA 3A9IA 4IGHA 2ZUVA 3VGDA 3VI2A 3RLUA 4R7JA 3LLXA 4NAFB 4LUYA 4YL2A 1K8CA 1RV8A 1MEIA 2V9DA 3MSRA 2OEMA 1QBBA 1H0GA 3FEMA 1S2CA 1ZCCA 3VYLA 2I1OA 3G6LA 1SUXA 2Q3OA 3P67A 1XLGA 3F4CA 4YVXA 3N4AA 3WNLA 4C6EA 5T8GA 3CHCA 3BCJA 3BCFA 3TVAA 3H21A 2YXGA 1XSKA 5BXRA 1W1TA 2JFEX 1UR1A 1OY0A 4IIBA 2VT0A 3W1XA 5E9AA 3GXNA 3RUBL 4O50A 2EG7A 4FI4A 1EUAA 1XLIA 1A5AA 1PYFA 3T8LA 2J13A 3QR0A 3WNMA 3DGBA 4U4MA 2AKMA 4JD4A 5K9CA 3WX7A 2OSYA 1LQ0A 1IEXA 1TWZA 1CDGA 1X7FA 5D2XA 1U1JA 3G1YA 3LG3A 4IUOA 4PMUA 4W89A 3TW7A 4C6JA 3HU7A 3P74A 1SSDA 3TONA 3FYYA 1CGVA 5AHIA 4GJJA 1P0EA 1E4NA 4B5WA 3BSMA 2BODX 2IW0A 1NSJA 1DJYA 1G9HA 5LNRA 1TZZA 1SFSA 3A4WA 3S9ZA 4BF7A 3W2NA 4DRSA 2NQLA 2P8CA 4I7UA 3CV1A 3W1TA 5EMYA 4RDWA 3PZUA 3NGFA 3S83A 1C7SA 2IKHA 3L4XA 5EMLA 5A8QA 3GDMA 1V6TA 3OG2A 4XZWA 3MDWA 2CLKA 1OX6A 4M8UA 4O4WA 3SECA 3ZJ6A 3SUUA 1VS1A 1S39A 2UY5A 3IIVA 3GHRA 1WZKA 5A6SA 5PTDA 1FHVA 1UWTA 3KTSA 4BKNA 3WFZA 2QQ6A 1UYQA 4RPQA 1HL2A 3K4WA 4PBGA 1R3YA 4A3UA 4C6MA 4H2HA 2CPUA 4MJZA 3STEA 1CGYA 3REQA 3N18A 4W85A 1OG0A 1WXYA 4QCFA 1L2UA 4OECA 3HG3A 3DHDA 5KTLA 4DO7A 4OU1A 1FWSA 4D6FA 2BY2A 2VMFA 3PZGA 5LA1A 1JL8A 3UP8A 4TUFA 2PC4A 3NTYA 1ITCA 4E2OA 3OQEA 3O05A 1C8XA 3EOOA 5BWFA 1XHGA 4PN2A 4WOZA 1BFNA 3EWBX 3GNPA 2XVPA 2NZLA 1QJWA 4WJXA 3VIMA 2JGQA 3LTSA 2P0OA 3TJXA 3VDGA 3ANVA 1PCKA 4HNTA 2WK2A 2ZRUA 3S9YA 2IXVA 2G97A 3UYCA 4XUGA 3KOYA 3EWDA 4HMCA 1DIOA 3C2YA 5FAJA 3SJ3A 3GZAA 2WSPA 2VVSA 3VIGA 3BPWA 2XFFA 4S3GA 2B7OA 2WO5A 1DTUA 3W7RA 1LOQA 4LEQA 1DP0A 2QLYA 1ZRQA 3MI3A 4MKNA 3EWZA 5BOEA 3DESA 3KWXA 1UG6A 3PZIA 4OVXA 4CQAA 1VRDA 3W2JA 1EIBA 1AH3A 3EGJA 4A3YA 3ARRA 3D5HA 2YCIX 2PLJA 2C18A 2GVLA 1AD1A 2GUYA 3GQYA 5E9XA 4UC5A 3AS3A 2WWDA 3KVJA 3EZ4A 3PUGA 5FJTA 3F4WA 4L80A 5EB8A 3PWGA 1B4KA 1XYAA 4L5ZA 4CKQA 2Q8XA 4YWIA 4CU7A 3L0KA 1GW9A 3GHTA 3KE0A 4IGSA 1QHOA 2XZ9A 4D1JA 1SR0A 5A95A 4ASTA 4OIFA 2GJXA 4NYYA 3A9BA 2I5QA 3AYRA 1XG4A 4JNMA 3GTNA 3UXIA 4M5PA 3NQ7A 4ZSTA 3NZPA 1W5MA 2HVMA 2ZA1A 4ZE4A 1CX9A 4ZQNA 3W2UA 3UPMA 1Q4WA 5DXYA 1UD4A 1TA3B 2EQDA 3CHFA 4IG2A 4KFPA 4DBEA 1KXVA 1XYBA 3AMGA 2QCMA 4J40A 3IUIA 2VZUA 3WF0A 1S5TA 5C8BB 3P2VA 1J0KA 3TX9A 2QW5A 4GZJA 2GJNA 1J5SA 1HP4A 2DT2A 3FNDA 3V35A 5CEWA 1K3UA 3RGTA 5C70A 5CG0A 3NO3A 1FHLA 1PX8A 3O6AA 2XHYA 2WC3A 3BG9A 4MMWA 1BGAA 2RDUA 4Z0JA 1GJUA 4FLQA 4WGXA 4B5TA 4UFJA 4IJBA 3WDPP 1IEIA 3PBYA 4IZGA 4IFKB 4F2UA 1EZWA 1KM6A 2GDUA 1LP6A 4F0MA 2WJDA 1M7JA 3CQIA 3WCZA 3BLDA 3BOLA 3I10A 1BRLB 4JOMA 3AXKA 1OFAA 3TEVA 3KRUA 4I9TA 3CWNA 1MDRA 1UWIA 3F2CA 3GG0A 1IYXA 2VEIA 3CLWA 4M81A 3VIIA 4NJJA 1W2VA 2XN2A 2R1LA 4GIRA 2XGIA 4DO6A 4C5YA 4W5UA 2WMFA 4JCMA 1UPPA 1NELA 1GCYA 4NJIA 2I9UA 1CZ1A 3RO8A 3VINA 5FF2A 4BA0A 3T07A 3OVQA 1TIMA 3WDHA 3SJNA 1F4HA 4LV4A 1W1B1 4TVCA 2FZMA 3SN1A 1WBJA 1VFSA 4GIEA 1J2WA 4HU4A 3C56A 5I23A 2PP0A 1D7KA 3NSXA 8XIMA 2C6QA 3QHMA 5IBXA 3FV9A 4ZOCA 4C6PA 8XIAA 1F2JA 2CLEA 2P76A 3AYVA 3L7RA 3DG3A 1XGDA 4PTXA 2PCQA 2ZC1A 3MA8A 3WDIA 1UJPA 1JYNA 2NUWA 3H23A 3ZWTA 4OBRA 3LEPA 2XH4A 1OFBA 3FY1A 5XINA 3MJMA 3V4BA 1XYZA 3H2MA 5AC8A 1GTEA 3STCA 1NWRA 2YB4A 1GOWA 1HN1A 3OHMB 1DJIA 4HD5A 1KR1A 5FEPA 2J7FA 3U7BA 2JALA 3ANYA 2J7GA 1LQ2A 2FHCA 4GCXA 1YKWA 3LTPA 2IKIA 2WMIB 3VKKA 1W5PA 1KCLA 4FLRA 4XUYA 3VVGA 2EBNA 1GZ1A 4JTRA 1D3HA 3GC2A 5D2YA 2PTZA 4PTNA 3VD5A 4XV0A 3OVGA 4FLOA 4MKSA 3WK1A 1DHKA 1ZJAA 1TQXA 3BLKA 4QITA 4PMOA 3TJLA 1ZALA 2WMJA 1J0ZA 4QX4A 3BZJA 1QCWA 4QG6A 5JU6A 3M9YA 5CZTA 1JYXA 3EWWA 3LM7A 4UTTC 3EKGA 5CBBA 1VGAA 2TRSA 2EPMX 3RM4A 1GOXA 4JTIA 3LPOA 3MHUA 5I3HA 2TMDA 5DBUA 1BWLA 3NPVA 3L12A 3N29A 4IMDA 4GVHA 3BARA 5BCAA 4LVAA 4RW3A 2P5NA 1LWHA 2MANA 4UCGA 3MY9A 3TN6A 2SFPA 3AXIA 1RSCA 3AWNA 2OYKA 1FBAA 3AMLA 4KFNA 1W1YA 3G1VA 2ZXQA 2Z0IA 4M56A 1J79A 2VP8A 3LCHA 3KLLA 1H5VA 1L6YA 2PU0A 3N17A 3TSBA 4YN5A 1UD8A 1GUVA 4RL3A 3SR7A 3PBMA 1YDYA 4UB9A 3CS2A 3W1QA 1Z89A 1BKSA 4W84A 4GNVA 4D6JA 4MPQA 4WXZA 4MKVA 1UH3A 3UPWA 1B3YA 2R6OA 3PPHA 3NDOA 1V02E 1M53A 4A8IA 1GWJA 4ZOEA 3WD0A 5I3JA 1UBPC 3IRSA 1O5RA 3OA5A 2QUMA 4CQCA 2V3GA 4N4PA 5I78A 4XISA 1M01A 4DJEC 3S2LA 3VUSA 2XISA 1TMQA 4WIWA 1HJVA 4GY7A 2C15A 3H2EA 2ZKMX 1WKFA 3MB9A 3F5JA 2EPOA 4MYAA 3H12A 5B7YA 3W53A 5AC5A 3GX9A 2WHJA 3M6YA 4E6MA 4HT3A 2G8ZA 1SMAA 3LRKA 3PANA 4UMCA 5JIPA 4GUFA 2NV9A 1N8IA 1YTDA 4TIMA 5MHBA 2CYGA 4UTLA 4GQGA 1CXKA 1VCFA 3FGCA 2AQVA 4Q7IA 4H2CA 3FCPA 3VD7A 1I2PA 2F2KA 4F48A 3FDKA 2Q71A 1R2TA 4XBKA 5RUBA 3C0LA 3UF9A 3CH9A 3HZ3A 3GY1A 3HOJA 3G0XA 2J79A 3B9NA 3R94A 3WLRA 2VEPA 1YXCA 1VCVA 3KLKA 2NQ5A 2FPVA 4HN4A 4TR9A 4YVVA 4YCPA 4Q8PA 1SW3A 4FOJA 4YWSA 3HQPA 2WW5A 1LL6A 3ZS4A 1T6MA 3BJTA 3LHZA 4GY0A 5K4ZA 2O7QA 2D22A 4AD2A 3A5VA 4LQ1A 4XAGA 1K4HA 1YNQA 1DWJM 4X0NA 2NVAA 4W7UA 4CGTA 2Z2AA 4DZAA 1CTNA 2Y70A 1V7AA 1JZ8A 1HG3A 3ZT5A 5CSRA 5KITA 1QI4A 2OZ0A 3LGDA 4LALA 2GDQA 1I0DA 1V5XA 1DBTA 5D9PA 2HWGA 4IQJA 2ZUUA 3QBUA 2CLOA 4G8TA 1E6PA 4ZR8A 3W7JA 4ZO9A 3WQ5A 3ENLA 3W2KA 3M5VA 4D6DA 3W83A 4ENLA 2VGBA 2QPXA 4IIGA 3C2OA 1WP6A 3I4EA 1TMHA 3AXXA 5FOOA 2IS7A 1CXEA 3APYA 1YX1A 5F4XA 4GNJA 2XVNA 2YCEA 5MF5A 2YPIA 1B57A 3KDNA 4WX2A 4KBXA 5D33A 3DG7A 5GVJA 2RFGA 4H1ZA 1JD7A 4DY1A 3SSJA 1J10A 1KGXA 3CHDA 1VR6A 2RJGA 1UQZA 1Y5VA 5BROA 3PC0A 4IQDA 6ENLA 3K2GA 1BYBA 3O7UA 1J0JA 1UKQA 2AQOA 2GSJA 2QF7A 4KIRA 2AGKA 4DJFC 2FKPA 1BEUA 1BSLA 4N02A 3U5YA 3LUTA 1EJRC 3MCMA 5CAKA 3LHYA 5G1YA 5KSWA 5IOBA 4L65A 3Q2DA 4XBJA 2G3JA 2AMGA 4XZLX 3BWWA 3WBWA 2BLEA 1V4YA 1LL4A 1P4CA 5FF4A 1F7BA 1EEPA 1TYGA 4GZEA 3QQ0A 3UY8A 1E9IA 3WNOA 2BV9A 3AMCA 1UR2A 3UQNA 1V6WA 3A4AA 3MZ2A 4TV6A 3DFNA 1FVPA 1HJUA 2HE5A 2DPEA 1FWRA 4WQ6A 3TCEA 4PMYA 4ZO8A 4URIA 5CPMA 1QNRA 3A12A 3OGRA 4JIPA 4X63A 4A22A 3QC0A 2Y1HA 5EFDA 1D3CA 3KZSA 3CZLA 3P82A 4L4LA 3GXDA 3CBWA 3IV3A 4H9ZA 4MHBA 3LHWA 2QEZA 3SCTA 4O11A 1AJZA 2DU2A 1I2QA 2RAGA 1FDJA 4Z08A 2P3EA 4DN1A 4IMEA 3LN3A 2DZWA 2BZNA 1M65A 3W6YA 3P7YA 3W72A 1VH7A 4W87A 2FFCA 4WJEA 1JDFA 2E28A 2GJLA 3BJFA 5I06A 3UXAA 4NT0A 3CUGA 4PB3A 4IM4A 4AH7A 1H61A 3BDKA 1X1NA 2DUAA 3DUGA 2X1SA 1E72M 4FXSA 3E49A 2VQTA 1C8YA 4QQUA 1THFD 4EKJA 1TPH1 8TIMA 1OFDA 4K8EA 2J27A 4XQ6A 4MVAA 2C13A 5I7GA 1MRQA 4HNVA 1KC7A 3WJYA 5CC5A 1CXHA 2J25A 3VNZA 1LWJA 2W66A 1W0MA 3LU2A 1VJZA 3OHIA 5D9NA 3XIMA 1B1YA 2Z00A 3KS5A 3RX2A 3VE7A 1BYCA 3TMQA 1JNDA 4XVDA 4NZ5A 1VFLA 3QPZA 2HV5A 2J47A 5CZ0A 3CAQA 3HPXA 1NEYA 1MXGA 3WFAA 4QHRA 1JFHA 3AS0A 1XIBA 1L9WA 3APGA 3M46A 5C9UA 1A5LC 1XRTA 4E2DA 1X39A 3FGCB 3GYCA 1QWKA 4I5UA 2E9MA 4DXXA 1JCJA 3P61A 4XD4A 1NWTA 3HIJA 4DYEA 3PNZA 1KM2A 2OYLA 5A8NA 4NAEB 4O28A 5KZ6A 1IWPA 3G1DA 3GAYA 5ENLA 3GDBA 3V1HA 1K70A 4ICMA 1E55A 3G6MA 3D3AA 1R3TA 1DYSA 4DZ5A 4HN8A 2Y5SA 4PA8A 5C9ZA 1H60A 1OGBA 3WEOA 3C8NA 3PZVA 3EPNA 1DWIM 4QSFA 3VOHA 1P0DA 1L6FA 4Z1YA 1GVIA 4AC7C 1LF1A 1B0IA 4Y9NA 4MLRA 3P5YA 1E4IA 4BWLC 3MDUA 4R7OA 3BLEA 2PODA 1F6PA 3EWCA 3VDHA 3ABQA 2CW6A 5CC7A 3DEQA 2JIEA 1X1ZA 4C6NA 1XJBA 3GFZA 2WNZA 2FTYA 1Q7MA 4H9MA 2OCZA 3KOWA 3GIPA 3IVTA 1O60A 3TR2A 4RZBA 4JFWA 3GAKA 2C19A 3H22A 1IIHA 1WCGA 2IQDA 4BEQA 3TYCA 1SZGA 1ONRA 1H4PA 2WQDA 1XF0A 1KFLA 1ELSA 2BX7A 1R9XA 3C2VA 1FKWA 1QHZA 1T8XA 4MUZA 2OGYA 3C0QA 1W3KA 1XFCA 3WBYA 2W4XA 4H01A 4GMEA 1FXQA 4OUIA 1TIWA 1KRBC 4O1EA 3OYXA 4HU8A 4AIBA 3D46A 5IRPA 2A5HA 3BE7A 2ZICA 5HPCA 3WQGA 4MF4A 1V0LA 3S9IA 1Q4NX 4HCLA 1JDDA 1MQRA 3SCSA 2R9RA 1O1ZA 3A4XA 2Y88A 4MB3A 3WH7A 1FWJC 1KCXA 2P50A 4DUVA 3CZEA 2IPGA 3HGOA 1LM1A 4LAMA 3B0UX 3OLEA 3AIWA 3VOJA 3EEZA 4HKPA 4KH2A 3BOXA 2R24A 3DI0A 5EMKA 2V67A 3ZIZA 4JQ4A 2WVVB 4F0SA 3DGRA 3LCGA 5A6JA 1O68A 1E71M 1Q6FA 1NH6A 3BGJA 1ENUA 1W1VA 4LOCA 2BOEX 4QG9A 3UT0A 3FFSA 1BG9A 1EOKA 4JIRA 3U8GA 1ZAIA 3F5LA 4JYDA 4KEUA 3R6IA 1ADSA 1R3RA 2I5IA 3W4RA 4NZ1A 1M03A 5EMMA 5ABTA 3DC0A 2PAJA 3I68A 1QW8A 4S38A 5H8UA 4YTTA 2FPTA 4I8YA 4EPKA 5GJPA 3UA4A 5FF3A 4ALDA 3SCWA 2V38A 2TYSA 3BAXA 4M6PA 1IF2A 2FVKA 4GYJA 3RM8A 4JNZA 1X8FA 4RV8A 3LHTA 4UQBA 3VCCA 1C8QA 3CWOX 1SO5A 2PDNA 5HUOA 3EA3A 4HYWA 2BHUA 4YU1A 4IJCA 1VB9A 4RJEA 2E3ZA 3MWAA 4AMCA 3WYZA 3FJLA 4ICNA 3CUXA 3CYVA 3SM0A 3GC5A 4QNWA 4QS6A 3U3HA 5A6MA 1OYAA 4B4HA 2O55A 4KCTA 5FI8A 2OO0A 5JBFA 2VCCA 1A80A 3CO8A 3HPSA 3OTRA 1W3HA 4IP4A 2XFRA 4UIOA 1GK8A 4PMQA 4LVFA 3WLLA 5DO8A 2JKEA 3URNA 3IARA 1ONEA 5TNVA 3L4ZA 2HCVA 6TAAA 4O15A 4XK2A 1K8YA 4TX8A 3GDKA 4BF5A 2QPSA 3N13A 4CQ9A 1EGZA 3PAJA 4NNAA 2PDMA 4ZZ9A 2QGHA 3BL3A 4JXCA 4U2YA 3THQA 1BWKA 1U5HA 4PTVA 5AHEA 3CV7A 3SCNA 3KAOA 5IHSA 3O6DA 2DGAA 2PTDA 2PRLA 1XPYA 1DIDA 4DBSA 2V2HA 3QV9A 5K9XA 3W71A 1TV5A 5TBOA 1XLAA 3AWOA 3GH7A 3EMCA 2E09A 3FW6A 4H4IA 4LVBA 1HGYA 4MADA 3VIPA 2EPLX 3GXTA 2B7PA 5F2IA 4DF2A 3D3FA 3BTNA 4Z2HA 2I9EA 4K36A 2Y63A 3OLGA 2B4GA 2V5JA 1VFFA 3WN6A 3IJIA 1XICA 3N15A 2I14A 3KX6A 3LGEA 3U4AA 3TC7A 2CLIA 3G24A 2O9PA 4AISA 5D32A 1JGIA 1KKRA 3GH5A 4K68A 2Y8UA 5E93A 3A3WA 4DUWA 5HATA 5H1WA 3T8QA 1EB3A 3OQ8A 3VFCA 4PMZA 2L5HA 3ATZA 3VKJA 3VTRA 4LBUA 4L6DA 3CK5A 5ABFA 3N34A 1J11A 2VI0A 3HFTA 3D6NA 1TELA 2JF6A 4Z2GA 1H7WA 4JIHA 3ITOA 1JUKA 3N3MA 1GKRA 2FHFA 5L6UA 3R12A 1EXPA 3AIVA 1UP0A 3QXBA 1O12A 3WL0A 4RZ4A 2GK1A 2PS2A 4QLJA 4LANA 1S1RA 1VYPX 4WCJA 5XIAA 4MGGA 4PULA 3VO0A 4J5NA 3TW9A 4GHRA 3STFA 4S3EA 3KVKA 5HPOA 1Z9AA 1G4EA 3QGVA 4ZO6A 4DAFA 5EYWA 2GQ9A 3FJ4A 4KRTA 1CIUA 3BQ6A 3B3DA 3WJZA 2ACRA 1JVNA 3S42A 4R5EA 2NVCA 3W7DA 4LYRA 3B0PA 4QEHA 1ECQA 2VFGA 4AXKA 4LVDA 1KFWA 3CQKA 5EKYA 4FEZA 1S46A 1I4NA 1PZ1A 1EL3A 1EP1A 3DIPA 7TIMA 1NOUA 1F3WA 5G4WA 1H7NA 1F76A 3PM6A 4H9XA 1YTEA 1OF8A 3LNPA 1TE6A 3PJTA 3WJSA 4Y6GA 4P61A 4PMXA 4KEZA 3QZEA 3H7UA 3N2OA 4AWTA 2A7RA 2QCDB 4KPLA 3NO5A 3LV6A 4JFUA 5E09A 1E0UA 4C1KA 2QNEA 3ITCA 1LBMA 4KGJA 3WF4A 3MP4A 3MUCA 2FJUB 1HKVA 5HJXA 3W1AA 2OKOA 5AZ1A 1WOBA 4GVIA 4RE3A 4DAIA 1PS9A 1KCKA 4O0ZA 4R34A 3N11A 5KMYA 4K39A 2YIHA 1XDMA 2Y0FA 3HGSA 1F3TA 1JCMP 2YDAA 4KWVA 3T0DA 3U4FA 3LLFA 1UR0A 3MUXA 3LPFA 4ZQPA 1HQTA 5M1TA 3WDRA 4MNLA 4OT7A 3NQMA 3P8JA 4JL2A 4CU8A 2WYSA 2ALDA 4DWSB 3ONBA 2O7SA 2XU2A 4F8XA 4F2TA 1MXDA 3W88A 3FS2A 4IHCA 1CB7B 4HPGA 4JDBA 2YCLB 1SM9A 2Y24A 4OJYA 6CGTA 1K7XA 3ITTA 4HNOA 1UOKA 4GFSA 4FO4A 1GYNA 4O1DA 4IFOA 1J0HA 5AHFA 1C3FA 3G8EA 3R5EA 3HG2A 3UD6A 2PP1A 1W3JA 1XD1A 4UTWA 2ZUNA 3PJWA 2E40A 3EA1A 3R0UA 2PI6A 1D2KA 1MZRA 3WK3A 2FZ9A 3HF3A 3R4IA 4OQVA 3SFKA 3COTA 3ZO9A 1RCQA 5C9WA 2ZUTA 4ZOBA 1EWEA 3GNRA 3ANUA 4GJ1A 3PF3A 4Y9AA 4KF1A 1R3QA 4PRTA 4WRHA 5C7VA 4H8HA 1OFEA 4E2VA 2XDFA 3TR9A 4NQ1A 3WSUA 1CBGA 5HNTA 3VE9A 1HP5A 3ZLHA 3WQFA 1WDSA 3JW7A 4RR4A 5DMMA 3TXVA 2WSRA 4J3TA 2G4FA 1IEVA 4B16A 4HJWA 4ERIA 1LG2A 1TJRA 4E2BA 1A47A 2WM0A 1YRRA 3S5OA 2E25A 1GKQA 3NIYA 2INFA 4J35A 4K38A 4FNTA 1FWAC 4O1BA 3VGGA 4L4OA 2YL5A 5HULA 3UR7A 2ZZ2A 4AYSA 5E1QA 1VBHA 2P88A 1NFGA 2E6FA 4EPEC 3B9AA 1J8VA 5AC7A 4TU1A 5KEZA 1V3KA 2PPGA 4FK9A 2QUVA 4O12A 4UMBA 3S2NA 3OJGA 5BYWA 5HMFA 1ZFJA 3AIUA 3TXZA 1LBFA 2C8NA 4IQEA 3UA3A 5B7ZA 3C6CA 3QC3A 2A3HA 1SZEA 4GC3A 1XQKA 3OVPA 3UR2A 1GVOA 2HE8A 2WOQA 2FJKA 1EGMA 1J96A 4Y8FA 4ROPA 3PS7A 2FTWA 2R14A 4C65A 2J66A 3H70A 4Q33A 4K8HA 4IPNB 1P0BA 4MFEA 2VFEA 1IZJA 2AL2B 3H2AA 4CNSA 1EQCA 1LDCA 1VFOA 2XGBA 1V0NA 4IMFA 4D8ZA 4S3DA 1VAHA 3V1PA 2HNEA 2W92A 2Z26A 3AJ7A 4O19A 1KFJA 3U2CA 2NX1A 5DMYA 2B7QA 4CNUA 4Z2JA 4I9JA 4WHBA 3PUDA 5G1MA 1H5YA 3NFUA 3AJXA 3WLHA 1XRVA 4H9VA 3LPPA 2GVYA 4EOUA 2PP3A 1DVJA 3T42A 3BGGA 3TU9A 3SB0A 1S5NA 3GO2A 1OK6A 3UJEA 5EY5A 1OT1A 1T7LA 2WVVA 4MZ1A 3AU2A 1TPEA 1OYBA 4OKDA 3NR0A 1VFUA 1QNVA 1DXEA 1UZ1A 5LIWX 1A3HA 3ZFHA 2A7NA 3VCNA 3WQDA 3FYOA 2CLPA 1PIGA 1FX6A 4HHLA 2EPHA 4N42A 5AHMA 2DIEA 3SN0A 1FTXA 1TFVA 1VHCA 1OGGA 2WM1A 3N2TA 3N9RA 4U33A 3DYOA 4UFLA 2V3DA 1Q6LA 4CEXC 2NV1A 4Q8WA 5LNWA 5HANA 4MNMA 3ZQ9A 2FZBA 4CCDA 4CD8A 3IGSA 2VRJA 4AX6A 3OGSA 3UVAA 3WNNA 2ZYFA 5CGMA 4YHEA 4Z1AA 1VBJA 1UD5A 3JZEA 4PB4A 3MMTA 1TJPA 1FUYA 2XVKA 2AGTA 1KXTA 4R53A 4H6QA 1CLVA 2AQWA 3L67A 1RP9A 5A94A 4JFSA 3SCQA 3HBLA 3VNKA 2PDXA 2NW0A 3WD1A 2QDEA 3UZJA 2ESCA 1BF2A 2RGLA 4UMAA 4YVPA 2PCEA 4H6RA 4DWDA 3PZQA 2ANUA 3PBVA 3THCA 1FWFC 4DHGA 3ARXA 4CNOA 4LXFA 4WF7A 1CXLA 1BRLA 1E6XM 2D3NA 4WJ8A 3SY5A 1CYGA 4LNCA 4DNMA 4DI8A 1B3ZA 3LBMA 1DORA 4HPNA 2V0TA 2F2HA 3W7NA 4IISA 1MDLA 2X42A 2ZUWA 3KBMA 3FJNA 4NIRA 2BHYA 4YMZA 1YBQB 3MSYA 4MY8A 2YFOA 4UFMA 3W82A 2J7EA 3WMCA 4C6LA 1KFEA 3TH6A 3VA8A 1PKLA 1J93A 5I03A 1CECA 3BLLA 3ZJKA 1QI3A 4ADSA 3A3XA 1JCTA 2D2OA 2HROA 1H3GA 3SSZA 2OU4A 3II1A 3AYSA 2YYTA 3WF1A 4AEFA 3KDOA 2D0FA 1WOAA 1R5YA 2FIQA 4HPHA 1TTJA 1ME8A 2J88A 3S46A 2JQXA 2WVTA 3UCQA 1R2RA 2VFDA 3VX1A 1KM1A 3MHFA 2O56A 3CL6A 2E4TA 3QSRA 1U5JA 3BMWA 3KEHA 2QDHA 4DJDC 1X98A 2GGJA 1OCQA 2ZUMA 3FHQA 3DBNA 1L2QA 3QKEA 3TAKA 3KOXA 1MXSA 1UPMB 4U28A 2V63A 1E1FA 2Q6ZA 3SURA 4LBRA 4MWAE 3M7SA 2PWDA 5T9BG 4C6BA 4DXVA 2VZSA 1EF2A 3OA3A 1JIBA 1MRAA 4Q8TA 2PD9A 1WXZA 1F61A 5REQB 4ZOAA 1P7TB 2CNCA 1JPDX 3ONCA 3IGUA 1Z3NA 4LCQA 3A6OA 3NG3A 5J5RA 4E38A 1K9EA 2OB3A 3MHGA 3TQVA 3MO4A 3GC4A 4YNGA 3UNTA 2VGGA 4FF5A 5HXMA 1HJWA 1PSCA 6A3HA 1P0KA 1KM4A 2EF9A 1TVLA 1H11A 4GISA 3KW3A 1HUVA 3BVJA 1J9YA 2J8GA 3WQCA 1JQXA 2I5GA 1Q6EA 2W0UA 1XLJA 4S2CA 2BGSA 4IXXA 3MUAA 3SQLA 1QMLA 2X1IA 1EGVA 3GTXA 2QMJA 5CLWA 2YW3A 4I8DA 2OPJA 4R9OA 3I7QA 2PEVA 2HBVA 3QOKA 4GO8A 4GUHA 2J8TA 4FNRA 1EOMA 4GWEA 1I9CB 2G37A 4K3ZA 3B0YA 2VFIA 3B8DA 4S3BA 4OBSA 2R94A 3HQNA 3KWSA 4MG4A 1GVSA 3M0MA 5FSEC 5H8MA 3BZGA 4U2ZA 4AHPA 3LNMA 2B7NA 3RCYA 2C16A 4DLFA 3AIEA 3POCA 1M9HA 3OLDA 1WDQA 1EO5A 3VGFA 5K7JA 3E2RA 4X60A 3SGUA 4XZHA 3W1PA 1S5VA 3SW6A 4P8WA 3ECQA 3MUIA 1UWQA 1YNPA 2AMXA 3DKLA 4B91A 1WDPA 1W9UA 4NL1A 3MWCA 3QW3A 2A21A 4R3UA 4UNLA 3P3BA 2PTXA 5EMUA 3H24A 2KAUC 3SRHA 1MUMA 1G69A 4PMDA 2CBUA 4NNCA 3HFYA 2ZWZA 4FOKA 3V7PA 4UBPC 3UY7A 1GEQA 4RXGA 4D6EA 2Y5JA 3PVFA 3SY8A 4E4FA 1EA9C 1R86A 2CETA 4AVOA 3CZ8A 1WNOA 5A6TC 3FIGA 1RJRA 1GJWA 4M1RA 1OT2A 2WZHA 3I7RA 1AL8A 1UR4A 1YPXA 1FWGC 3H2CA 1F9CA 4FIRA 2Z7GA 4KS0A 1UOZA 2E7FA 4AZHA 5FEWA 4NJKA 4AB4A 1YIXA 4OGZA 5ECUA 5H8PA 4DLMA 4I9MA 1QVBA 5D37A 3SEPA 3VGEA 3K8MA 1WX0A 4X9SA 1AZ2A 4YTSA 4IT1A 1NFPA 2FGZA 1XUUA 1NDWA 3R89A 3ZLGA 3MS8A 3RR1A 4Q8MA 5K9DA 1U22A 1EJXC 5DRIA 4RE0A 5FA5A 1UASA 3OBKA 4AWSA 1VIZA 5IFPA 4U5IA 4KCVA 1H49A 3GW0A 2GOKA 5G5IA 1IZCA 2VX7A 4V2XA 3V75A 3HPAA 4NI8A 4BS0A 2ZX6A 4E4PA 1KGWA 4XAYA 3G0UA 2CESA 3P93A 3NNTA 4PMNA 1O5XA 2C79A 5CPLA 4BY3A 4F9DA 4UOZA 2WKGA 1W32A 4E4UA 3N19B 3HG5A 2NT1A 4XIMA 5BRPA 1AQMA 4P8VA 3AICA 3BANA 1OYCA 4I9AA 4LT9A 5AYYA 4GX8A 4L6OA 1VFHA 4DO4A 1K6AA 3HO8A 3M0HA 5TAOA 1XYFA 5FAGA 3W86A 3EOEA 2GQAA 1P48A 4NP7A 1XCWA 5BMXA 2BGNE 2ISVA 4JL1A 4KWSA 3QMSA 3KCLA 4BF9A 1VQTA 4I5RA 2DZTA 2BVYA 5D09A 2ZZ4A 3FA5A 2OEKA 1JDEA 1WQ5A 3WD2A 2VRKA 2OOFA 2J7DA 1K9DA 3HG4A 3AIBA