1IXNA

Enzyme-substrate complex of pyridoxine 5'-phosphate synthase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
242
structure length
242
Chain Sequence
AELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDACKRLADAGIQVSLFIDADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQELARIAKAATFAASLGLKVNAGHGLTYHNVKAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKRLMLEARG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Pyridoxine 5'-Phosphate Synthase
publication title Enzyme-ligand complexes of pyridoxine 5'-phosphate synthase: implications for substrate binding and catalysis
pubmed doi rcsb
source organism Escherichia coli
total genus 95
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 2.6.99.2: Pyridoxine 5'-phosphate synthase.
pdb deposition date 2002-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ixnA00
2DP3A 4HNTA 2NUXA 2H3BA 1ME8A 4GUHA 2QCMA 3NQVA 4JTJA 3UXDA 4DF1A 5K4XA 3O6DA 2E77A 1S5TA 3NQCA 2FTPA 3HPZA 3UY8A 1YTEA 3WJZA 1XKYA 3GYEA 5K9DA 2Y61A 3L68A 4N9CA 3O06A 1W5PA 4QISA 3NZ1A 2G97A 3CHVA 5LSMA 1OG0A 3NDOA 1S3HA 3BLFA 3WFAA 4IX2A 3DU0A 4NUWA 4HT3A 5DCEA 3S5YA 1TRIA 1IXQA 1BWLA 2BX7A 5D30A 4KWWA 2H8XA 4UTKA 1GPWA 1KFJA 1R30A 2Y89A 4NNCA 3IGUA 2VFIA 4JNMA 3TH6A 2V8ZA 4UR7A 1MEIA 4BWLA 1LYXA 1TV8A 3HG4A 4BI5A 4OV4A 5LGZA 1EWEA 5IBXA 2Y63A 5BMXA 4EF9A 3HMJG 4PL1A 2G5WA 3V1PA 4JS3A 4LC8A 4O1AA 3H53A 3TSDA 3CTLA 3R12A 3FFSA 3NPUA 3NQGA 4LNYA 4DO4A 3L0KA 4WXZA 4R34A 5F2IA 1DL3A 1FWTA 1FX6A 2VC6A 4CCEA 3NL6A 2CLMA 1Q3NA 4CNOA 3R2GA 4E2BA 5BW6A 4MPQA 5AYYA 2J88A 1TYGA 1F5ZA 2QCGA 3PC0A 4NZFA 4HKPA 4H3DA 3W9ZA 2JK2A 3EX2A 1MEHA 5AN7A 4K7YA 2QCNA 1WOAA 3W71A 3VKJA 3N2MA 4JYEA 4XWUA 1HO4A 4JTLA 1Y0EA 1K7EA 4AHOA 4Z1BA 3IIXA 2DZVA 3G1HA 3TC6A 4BF9A 1LP6A 2F84A 2J9YA 5FF3A 3HO8A 3WK2A 4IMCA 4P2VA 1HO1A 3LBMA 3WJWA 2I1OA 1XDMA 3W7DA 1SZGA 5I3IA 3NA8A 3BO9A 4QIUA 1LOSA 1CX9A 4LS2A 2FB3A 3CT7A 1UUMA 3GR7A 2QCDA 1AW1A 2YFNA 2E5DA 3LV6A 2OJPA 4LTSA 2X1UA 1JCYA 2ZZ2A 3CM4A 2CW6A 4UMCA 1RV8A 2GQAA 2VFDA 5SWUA 1I2RA 4UTWC 3B8DA 3MYPA 3LM7A 1ADOA 2BXVA 1FDYA 3FEMA 5HINA 4ZQPA 4NXSA 5CPNA 4E2DA 4IMGA 5LNWA 1N55A 4EIVA 2GVJA 3QW3A 1ZAJA 5AC6A 1TTPA 3R13A 1TPFA 4UFKA 4HHPA 4RK8A 1ZNNA 1F6KA 1KV8A 3R89A 1JVNA 2A0NA 3I65A 4R33A 2GJLA 2NXIA 4O12A 3G1DA 3LOTA 3UWWA 1XL9A 2NUWA 3PS7A 3W2LA 1PL9A 3TKFA 1JRCA 1TREA 5K3VA 3DKLA 2CZFA 3BK0A 3W2UA 5KTLA 2E6DA 1Q6LA 2RKXA 1F7BA 4LS0A 2O7SA 2YR1A 3EWXA 1TB3A 2I14A 1AW2A 3W7MA 4KKXA 3MI6A 1BTMA 5GVJA 1F6PA 1OX6A 4CCCA 5D2XA 2DZWA 5LKYA 3R8RA 1A5SA 2Y7GA 3C0JA 2GPTA 4A29A 3IIPA 3ZFHA 2DU2A 5G2HA 1H50A 1QWGA 3N19B 1JQXA 2CZEA 2ATSA 3A5VA 1P5BA 4NT0A 1WXJA 1JCXA 4NNBA 1CI1A 5EA9A 4K6AA 3STGA 4W9TA 3MHGA 1GYNA 1QOQA 3D0CA 3QW4B 3MW7A 5HWNA 3I7QA 5K2ZA 4MVAA 1OF6A 3IRDA 4O15A 3LGEA 2DORA 1NSJA 3QC3A 2OZ0A 3JS3A 1XCFA 2J27A 4GJ1A 4RXFA 3W7NA 4M5PA 2H90A 1NFBA 5AB3A 5ABTA 3I7RA 4OBTA 2BZNA 4GFSA 1RZMA 4K36A 5U7SA 3MJYA 3LHUA 5EYWA 3UNDA 3ZR4A 4CQAA 2VEKA 2OX1A 3CPRA 5DY3A 3PG9A 4FHAA 3O6CA 1EIXA 4Z1CA 3GLCA 1IXOA 3NPWA 4MFDA 4CNPA 1W54A 1GVRA 2ZZ3A 3BLIA 1KM1A 1H7XA 1BEUA 2EKCA 4JTKA 3GKAA 1SR9A 3PAJA 2J24A 1G4SA 2QCFA 3G0UA 2FB2A 2QUVA 4JTTA 4O1CA 1PHQA 3GXNA 4LVGA 3TQ0A 1RR2A 3R5EA 4RJEA 1W5QA 5HR6A 5HUOA 1ZY9A 1OF8A 3W75A 3P60A 3SSJA 1RD5A 3KOFA 3N14A 4LV9A 1OHLA 3S1VA 4UMBA 3DI0A 1HL2A 1KM5A 1R2RA 3GZ3A 4FNQA 2FPVA 5KZDA 3NOEA 4MY9A 5DCBA 3N34A 4CNNA 3P67A 1XI3A 4S1FA 4ZQCA 2ZTJA 3L0GA 3PBVA 7TIMA 2TYSA 2B7NA 3OVPA 4I9AA 5I3KA 4NJIA 1F74A 2NWSA 4WOQA 1GG1A 1SU5A 3LRMA 4JTUA 4MYAA 3GIYA 3O05A 4EVZA 4S2CA 2NV1A 4LUIA 2HS8A 4X22A 2ZRVA 4UTJA 3LLDA 4O52A 5F2GA 3IGSA 1FXQA 1FWSA 3NQ6A 4NQ1A 1WBJA 2A7NA 5D38A 2Z0IA 3NQFA 2A2IA 2J9ZA 1TPH1 3W1NA 1HG3A 4ZVJA 5A5WA 2C3ZA 3FA5A 2CLIA 2C13A 4QQ3A 2CLOA 4O10A 5I3FA 3S8HA 3Q2DA 4YXGA 4RXGA 1YTDA 1YTKA 2ZQ0A 1K7XA 2CLEA 3HG2A 4DF0A 1KTNA 5FF7A 1VYSX 4JEQA 2R94A 3EB2A 4FX6M 4PODA 4Y8FA 5CGQA 4K39A 3B06A 1R2TA 4GC4A 1MO0A 2A7RA 3IIOA 3EWYA 4GUIA 4U28A 4WQ6A 1I8JA 4Y90A 3ATYA 3L2IA 2A6NA 5CPLA 3PUOA 5DN1A 1DORA 4UTIA 4AWTA 4RLIA 3QMSA 5BRBA 4ADTA 3MBDA 3MUXA 1VH7A 1OVDA 4A2RA 1SZEA 3N9SA 2CWNA 1UJPA 2EGZA 3A5FA 1VRDA 1O94A 3G0XA 1G67A 5EKYA 4O16A 2QJGA 3G1VA 5F1UA 1W0MA 5EPDA 4MLJA 4JDYA 3NPVA 3AJXA 2JKPA 1GQNA 4D2JA 4UXDA 5IM51 3TE9A 4MZYA 1P0NA 3QF0A 2HS6A 4IWWA 4DBEA 4O57A 3TX9A 3HOJA 3TW6A 3W72A 1IXPA 4UIOA 1ZAIA 4DF2A 1ZAHA 3BW4A 4MOZA 2QAPA 2VENA 3NQDA 4I7WA 1YYAA 3LB0A 1A5AA 1OYBA 3HQ1A 3UWZA 5DBUA 4UTHA 4QAIA 3W7QA 3MP4A 1JJKA 3OVQA 4O19A 1W56A 1G4PA 3GAYA 4QJ1A 1C9DA 1FY6A 4L4MA 3JRKA 1UB3A 3OG3A 2YX0A 4LT9A 3M7WA 2V2CA 3GDKA 4G1KA 4A22A 3PY2A 5FF4A 2PCQA 4AH7A 2QKFA 4AF0B 4ZQRA 3U8GA 3T7VA 3BG3A 1DVJA 1UBSA 2CFFA 3TV8A 4UTMA 4HNNA 5BMWA 1XUUA 2CLFA 1H7PA 3W86A 4PEKA 5D02A 5AHNA 4ICNA 5CKSA 2ZRWA 2A7PA 3Q58A 1VC4A 2QUUA 2XFWA 3M9YA 5D33A 3S9YA 4GUJA 1GVFA 2H6RA 3BV4A 5K9XA 4UTWA 3FYPA 4O4VA 4IJBA 3USBA 4LRSA 2OMAA 1EP3A 4I7UA 1TJRA 5TBOA 1ME7A 1NF7A 3QMTA 1L6WA 5C2XA 3TJLA 3CU2A 1KFKA 2ZRYA 2Z6JA 2Y88A 4BK9A 5LGXA 3WK1A 3NR0A 3NYZA 3BGJA 3ANYA 3LHWA 5U4NA 3T4CA 4YL2A 2QEZA 4DPQA 1SO4A 3ABQA 3BW2A 1GYLA 5AYZA 3ZWSA 3W7CA 3HGJA 1XBVA 2NLIA 3SJ3A 2GVLA 3CWOX 5J5DA 4DO5A 1TPDA 1FCBA 1BWKA 5D2YA 2BLEA 2ZTKA 5FF0A 1JULA 4LVDA 2BWGA 1GTHA 3UWYA 3OHIA 2QDHA 5EBUA 1A5BA 1LOLA 3EX3A 4IOTA 1TJPA 1WV2A 3L67A 2NX9A 3QM3A 1EUAA 1OFEA 3G3MA 2DJXA 4EOUA 3VFLA 5AHLA 1ZCOA 1VGAA 3S6DA 1QNVA 1D3HA 3NGJA 1S5WA 4MUZA 1AK5A 3QPZA 4HPJA 1L6SA 1JCJA 2B7PA 1H1YA 3DXIA 1FDJA 1Q45A 3MBFA 1I2NA 3GXTA 5MHBA 3BW3A 4E38A 5CG7A 4N4QA 2A5HA 4N9DA 2ALDA 4M6VA 4M7SA 1J5TA 1SSDA 3UZ5A 2UV8G 1Q6QA 3LLFA 5FI8A 1YXDA 3CQ0A 2XN0A 3STFA 2C15A 3UYCA 4BFAA 1TO3A 2X1RA 1KTBA 3W88A 3F03K 3INPA 2Y7FA 3GR8A 1HUVA 2HTMA 2PRHA 3W7LA 3S0CA 4WJEA 1UASA 3EEGA 4JTEA 3IVTA 4XQ6A 2FPTA 5I3HA 5H2ZA 2Q3RA 4FB7A 1LRNA 2QCDB 1ALDA 3FKKA 3DFSA 4Z1DA 1Z41A 3ABSA 4JD4A 3UWVA 1W5MA 1MZHA 1ML1A 4ALDA 2ZCGA 2CZDA 3EXTA 4XKYA 3N73A 2WSRA 2PRLA 3F4WA 1SO3A 2W6RA 1TIMA 1WA3A 1C29A 3OVRA 4PH6A 2FDSA 4IMDA 4BI7A 3FYOA 1Q6RA 1W5OA 1EPXA 1K8XA 2FPYA 3MMTA 4ZL1A 4MYXA 2ZFAA 4DQWA 4P61A 5LNRA 3TNOA 3VNDA 3HPXA 1VZWA 5LHEA 1OFDA 3KHJA 1A50A 2Y7EA 3DBPA 4TX9A 3FJLA 1QAPA 1H7OA 3M16A 4ORMA 3W1PA 3W07A 3NAVA 1O60A 3TROA 3KAOA 3VE9A 3SY5A 2Z2UA 4IX0A 5BNKA 1E51A 1TCDA 1X1ZA 1ZHAA 3W7IA 2B7OA 2ZZ1A 3DAQA 4O54A 3PULA 3NM3A 2DZXA 5AFDA 4RX0A 1XBZA 4NX5A 2B7QA 3B0PA 3C2OA 1N7KA 1K7FA 1FQ0A 3G0SA 1MSSA 1FWWA 4TU1A 1H7NA 4UNKA 3FS2A 5HQEA 4IMEA 1XBXA 1C8VA 1ZALA 3QFEA 3LI1A 1H5YA 2EPHA 3E02A 1JUBA 1LOQA 1H60A 5D05A 5CPMA 3QZEA 4A21A 2ISSA 1VQTA 1TPB1 4N4PA 1JUKA 3C61A 4UTTC 2E1DA 1VHNA 4FIQA 3M41A 1KLZA 1OK6A 2NX1A 4ZMGA 2A4AA 4E0CA 2R14A 4A3UA 3NM1A 2YGYA 1PV8A 3E49A 1TRDA 3NXFA 1KBIA 5I3GA 2E09A 2CU0A 3W70A 3RLUA 4LU0A 5AC7A 1VCGA 3TA6A 1G6CA 1LRTA 3LX9A 4TR9A 4JTSA 1QR7A 3W1RA 2G96A 4LVAA 3QSRA 5D32A 2B4GA 3C2EA 3GNDA 4IQLA 1YPFA 3GAKA 4POCA 5FEZA 1D9EA 4QNWA 4JX5A 3H54A 2ZZ4A 2QDGA 4CLMA 3I68A 3VE7A 1H62A 4ML9A 4JIPA 4JTIA 5TIMA 1ZENA 3NZRA 3EX6A 4O53A 5G2WA 1VYPX 5D37A 4GWEA 4HNUA 4N6FA 5D2TA 2QCEA 3KX6A 1SSGA 1JR1A 1SZFA 2QUTA 1LTDA 3TK7A 1T99A 1K8ZA 4O0KA 3MP3A 2V0TA 3P81A 3IIVA 4KFPA 4C1LA 2DZSA 1T8XA 1VCVA 3G8EA 4JICA 4NJHA 1YXYA 4LVFA 1GVSA 3W2KA 2GQ8A 2OT0A 4FX7A 4ADSA 3DH7A 3PF3A 1TV5A 2ZA1A 2AGKA 1U5JA 3GDLA 5EL1A 1ONRA 3P80A 3QSTA 3NO5A 3ELFA 4OU1A 5E0KA 1FCVA 3BG9A 3G1YA 5KSWA 4UTLA 3PVFA 5HUPA 3M47A 5AOUA 3NL3A 3B05A 4ZQNA 4NXKA 5CSSA 1VR6A 1R2SA 2VFFA 3P5YA 5C55A 2A85A 3SFKA 3HB9A 4AWSA 2ZA3A 5D09A 4IPIA 3W1MA 3G1XA 5G1TA 2Z1BA 3CLMA 4BWLC 2Q8LA 3Q37A 3LXAA 3MP5A 1QOPA 4GE8A 4OGZA 1QCWA 3IV3A 3LTYA 3RK8A 1H1ZA 1GJPA 3TDFA 3W73A 3MYOA 3LRKA 2A21A 1DV7A 3L5LA 4UFIA 3RNDA 4JY9A 3WJYA 1MEWA 1GVOA 5C54A 3LHTA 2F7FA 3ZS4A 1K3UA 4Q33A 2GOUA 4RZ4A 4H4IA 4O0ZA 1O4UA 3V75A 2JKAA 3TXVA 2P0OA 3O15A 3OA3A 5HNRA 1ICSA 1QPQA 4XZ9A 1PCWA 3FKRA 5LZLA 1LDCA 5EMUA 4AMAA 2WO5A 3ABOA 4QM1A 3CB8A 3CEPA 3DKJA 4M6PA 5DXXA 2ZZ7A 5FF2A 1DJNA 1KM4A 5H91A 1W5NA 5CPOA 5LNUA 1VLIA 3LBCA 3H55A 3S5NA 2JGQA 2IQTA 4PFMA 4Z0SA 4XUGA 3AO0A 3M5XA 1RVGA 4O14A 2DJLA 3PB0A 1WBHA 3GK0A 2QAFA 3C52A 2VFHA 4YCOA 1IIHA 1Z48A 4N9EA 3LTPA 2RDWA 5AC8A 1KTCA 4CQ8A 1VJIA 1NVMA 4O28A 5F4SA 2WNQA 3E96A 3BG5A 1TQXA 3HGSA 3DFOA 3P5ZA 3T44A 3TCEA 3LHYA 4UUIA 1P1XA 1IIGA 1LCOA 3DFTA 4PC8A 3W23A 3W2MA 3EKLA 3W22A 3OEXA 1K02A 1LM1A 3O1NA 1QMLA 3M0ZA 2Q3OA 1PIIA 1EWDA 3UWUA 2Y62A 1P0KA 3W87A 3LTSA 4GUFA 4IXHA 4R53A 3N3MA 3KVJA 3W1XA 2C14A 3UQNA 3E0IA 3SECA 2X2GA 3I7SA 3QEZA 1W1ZA 1ICPA 2P1FA 2GQ9A 3W7PA 4WZHA 3L66A 3KRSA 1G4EA 4XTIA 1SUXA 1X8FA 3BARA 2ZYFA 3L5MA 3OBKA 5K7JA 1J4EA 3DI1A 2FJKA 4PCFA 1LLZA 2AQWA 2NZLA 4NNAA 1SZNA 3EKZA 4WOZA 3G22A 3WK0A 4FNRA 1G7VA 3G1AA 2DZUA 2VEPA 5LHFA 4XBKA 4MZ1A 3LERA 5E1QA 2YYTA 2WNNA 3QJAA 3LCLA 1OK4A 1OFBA 2W0UA 1FBAA 1PCKA 4OHQA 2ZBTA 1VCFA 1DOSA 1JCMP 3LV5A 1QPRA 3GNNA 2VFEA 4BI6A 5AHIA 3SZ8A 4TMCA 4LY8A 4QNEA 2C0AA 1OFRA 2WOQA 2QCHA 2E6AA 5FEPA 1RQHA 3TW7A 3NQ8A 4ZZ9A 4UFJA 2ZRXA 1S5VA 2EF9A 2NWRA 3L65A 2NX3A 4U4MA 1MXSA 5C5YA 3FJ6A 3O8AA 3RU6A 3LCWA 4AWUA 2ISWA 1TTIA 1UUOA 3TSBA 3W85A 3NNTA 5AYXA 2YDAA 3DGRA 4DBDA 2VFGA 3CWNA 2E6FA 4XBSA 3PUEA 2VEIA 3LCGA 2WSYA 4M7TA 2D73A 3QH2A 2WPBA 3G1SA 4O17A 4CCDA 3RF9A 5CZTA 2QCCA 3C8FA 1ME9A 2E5CA 5E93A 4IPJA 5DXYA 2X1TA 5A8GA 3KRZA 2ABAA 5KZEA 5EY5A 4WX2A 2A1YA 2VELA 3N9RA 4UTTA 2ZRZA 1X1OA 1V5XA 3GVGA 5HMSA 3HPSA 4O1DA 1N8FA 2V5BA 3VCRA 1F05A 3KFTA 1H51A 1OX4A 2ATMA 4RR4A 4FF7A 3YPIA 1FCUA 2WKJA 3S1XA 3LHVA 4N02A 2J6XA 1VLWA 3U2OA 3EXRA 3SGUA 3UXAA 3F4NA 3JR2A 3EXSA 2PURA 4FX8A 3QQ1A 3P7YA 1KM6A 4DELA 3P82A 2JKEA 2V82A 1L9WA 2PE4A 4ADUA 4GUGA 4IGHA 1GEQA 3O16A 2TPSA 3W7EA 3TQVA 3EWUA 1THFD 4DXVA 4XKYB 2Z6IA 1I4NA 1OFPA 3NL2A 5T26A 3P62A 3MO7A 1DJQA 3L9CA 1W31A 3W7GA 1SW7A 2TMDA 4ZQMA 5KITA 3RMJA 1H63A 1YDNA 1EP2A 5CZJA 2VOMA 3NQ7A 4JY8A 2RDTA 3LXBA 4RCXA 1YLVA 4HNVA 1O95A 2NXHA 3W2NA 2CLHA 2YSWA 3S5OA 4AAJA 1FXPA 4NJJA 5HWJA 1OFQA 5HWMA 1QPOA 2B0MA 2WV8A 3SI9A 1GOXA 2E6YA 4GRSA 1FDZA 4OT7A 1QFEA 3THAA 1SO6A 1V7YA 3NG3A 1DKWA 4RV8A 4WY0A 3OIXA 5F4XA 2CZ5A 4H6KA 4LW7A 3A9IA 2XN2A 2NXGA 2C1HA 3KRUA 3W7RA 2JGYA 3DFNA 4Z1AA 3W74A 3SIZA 2E68A 4L4LA 3P84A 1EUNA 4A2SA 4FNTA 3O6YX 4NJKA 4NX0A 1JCNA 2R8WA 2Y70A 3BVJA 3UPBA 4MKNA 2V30A 1DQXA 3HG5A 3M6YA 2V5LA 1VYRA 2XN1A 5KZMA 4WD0A 1O5KA 1TPEA 3U6WA 4X3ZA 2OT1A 3TFXA 3VI2A 1SQ7A 1QO2A 3N2XA 1LBFA 1GTEA 4C1KA 5G1YA 3LHZA 4FXRA 4JYFA 5DLCA 3MI3A 1LBMA 4TMBA 2HSAA 3ZWTA 3PB2A 4R7JA 1G69A 3HGOA 2KZHA 3W7KA 2Y7DA 3EWZA 4AXKA 3S1UA 1QO5A 3C4UA 1AL7A 4PTNA 1T0OA 3TJXA 3GX9A 2YZRA 2C18A 3WK3A 1IGSA 1YDVA 3QPYA 5C6MA 1GZGA 5D2VA 4MJZA 3G3DA 1DQWA 4IXXA 3CIWA 3MWAA 3PG8A 4JYDA 2E5BA 3TMLA 5I3JA 1K03A 1AMKA 2HMCA 3WJXA 1AG1O 1G4TA 1ICQA 1PVNA 4FO4A 3GB6A 4DEFA 1UCWA 1FWRA 3E12A 3W84A 2FFCA 1OABA 3TAKA 4RZ6A 1B4KA 2C16A 1XUZA 3EX4A 1YADA 2RH9A 2CLKA 4O1BA 2TSYA 1WQ5A 4O11A 1D3GA 4LVBA 2RFGA 4Y9AA 3PSVA 3W3OA 4EF8A 3MHUA 4KWVA 1WDWA 1GT8A 2R91A 1FWNA 3LRLA 3PBYA 4HN4A 2LLEA 3HIJA 3DFQA 4UR8A 2YW3A 3MI2A 2X1SA 2GVGA 1OX5A 3TXZA 1DBTA 3WJSA 1OJXA 3IIZA 3GDRA 1KLYA 5LNSA 1YXCA 4AHPA 4YWIA 1KV5A 1FUYA 3FIGA 1SW3A 1TPC1 3PSWA 4ZQOA 1X6UA 3CEUA 3C2RA 3S1WA 1F76A 3L21A 2WQPA 1KFCA 2YPIA 1TMHA 1A53A 1W3IA 4HIBA 4Z08A 3LCXA 3DFPA 1Z44A 3NQAA 4K37A 5BOOA 1SO5A 1W8SA 2FLIA 2CLLA 1OYAA 1U83A 1X7FA 3GDTA 3BPWA 3W83A 2JBMA 5F2LA 5L6UA 3DENA 1Q6OA 1KM3A 5G2IA 1LLWA 5K9CA 3PR2A 1EEPA 3LI0A 2I9EA 4LC6A 3NQEA 2TRSA 4JR5A 2OCZA 4HSNA 3B03A 2C6QA 3PUDA 4BR1A 1I2OA 1PHWA 3P8JA 1B3OA 3TU9A 3GXPA 1L2UA 3NQMA 2FIQA 1R47A 3S42A 5D03A 3F1QA 3RFAA 5HULA 2ISVA 1ZJIA 4JX6A 4LOCA 3TIMA 4YCPA 3QRHA 4WY0F 3M5ZA 4Y96A 3IEBA 5HR7A 5J5RA 4GXMA 4MLRA 2Y6ZA 2YXGA 5DY2A 3QYQA 5DELA 4Q4KA 3C2FA 1VHCA 3CIXA 1TSIA 4YMZA 5G5IA 3TUUA 3HG3A 3M44A 4OQVA 4JTGA 3E9AA 3TMQA 2WJZA 3T40A 4K8HA 4LS1A 1AL8A 5HJLA 1SFLA 1K8YA 4UFLA 1WOBA 2J9XA 4MY1A 3Q94A 3W76A 3W7JA 2YFOA 1GWJA 3BGGA 3M5VA 1G7UA 4UCGA 5IBXC 1SFJA 2ZRUA 2QJIA 4O8RA 1OFAA 4JN6A 4JGDA 3UWQA 1TQJA 4MY8A 1F2JA 4PL2A 1WX0A 2DZTA 3EX1A 1GVQA 5F4WA 3NPXA 5F2MA 4JTFA 4RZ5A 3L5AA 4DPPA 1PS9A 4S2BA 4FIRA 3FLUA 1J2WA 1QPNA 4O50A 2V2DA 2W79A 4UFHA 4MZ8A 4N6EA 2ZZ6A 3B0UX 3DHDA 4UC5A 2A6LA 3S5ZA 3KVKA 2VEMA 1AW5A 1JCLA 4OWGA 5K4ZA 2BTMA 3TAOA 4DO6A 3GKFA 1LORA 3QQ0A 1F73A 1KM2A 5KMYA 5FEXA 3LCFA 3W1AA 3C56A 4O13A 3G8RA 4Q32A 4NVTA 1JQVA 4M19A 8TIMA 3K30A 4B5NA 4K7VA 4MIMA 2GJNA 4JX4A 1YPIA 5FEWA 4FNSA 3NEVA 2GUUA 1I45A 4NZJA 1M7OA 3TC7A 4X9SA 1CW2A 1XM3A 3IVUA 4K8EA 3IVSA 5DCDA 2NV2A 1VS1A 1TPUA 2FQIA 4Z0JA 4WUIA 3TSMA 1OYCA 3SGZA 1H7WA 1SPQA 2P10A 1HTIA 2X16A 2AAMA 4JIQA 4YLWA 1TPWA 1IXNA 1VPXA 4FNUA 3HF3A 4FNPA 1LROA 4OV9A 4AB4A 3NL5A 3C3NA 1M7PA 1YDOA 4M6QA 1I2QA 3FOKA 3LDVA 1KFEA 3KVLA 5DBTA 5D2WA 4GBUA 4UNLA 3LCHA 3NVTA 4HPXA 1H7RA 3W2JA 3HBLA 3NQ2A 3M5YA 4FXSA 2X30A 1JRBA 3PBUA 3P74A 4QITA 1KFBA 4Y6GA 1EB3A 2PRMA 2YW4A 3O07A 3STEA 3W1UA 2PC4A 4LUJA 1B57A 1KA9F 1EA0A 4OE7A 3W6YA 1PE1A 1NEYA 1W3TA 4I7VA 3A21A 4MFEA 4JDBA 2Q8ZA 1A5CA 3G18A 3TQKA 4N2YA 4IMFA 4AHQA 4TIMA 2QCLA 1KM0A 2C19A 3I6RA 2EAWA 5KINA 3THQA 1DHPA 4KFOA 3PBWA 5CSRA 1OX4B 2ZDRA 1WAUA 4AVFA 2NUYA 3DHFA 4ONVA 2WNZA 4XTDA 6ALDA 5L9FA 4WXYA 5LNVA 1TV7A 1T96A 2ZZ5A 3B04A 4NJGA 1M6JA 2VKZG 3UPWA 1R46A 5AHFA 4KFNA 1XC4A 1ZFJA 2YYUA 3T55A 1LZOA 1L6YA 4N9BA 3SR7A 2BSLA 2O7QA 1BKSA 4IUOA 3TFCA 2Y85A 3W7OA 2QR6A 4CQ9A 5AHEA 1XDLA 3C6CA 1XBYA 3P8IA 1Z42A 6TIMA 3M1ZA 3A23A 1KBJA 5TQLA 1B9BA 3A22A 3MHFA 1XFBA 3PWAA 2VXNA 2ABBA 4O18A 3UY7A 4MJMA 2QJHA 3W1QA 1HFBA 1TTQA 1WYIA 5D04C 3EWBX 4GNJA 1H61A 3PM6A 3SW6A 1LRQA 3TR2A 1FCQA 4EWND 3M43A 3C2VA 5G4WA 3B4UA 3KVMA 1KFLA 1NAL1 2V81A 3ATZA 4UFMA 3UZJA 3CC1A 3GDMA 4K38A 4LRTA 4AEOA 5CZSA 4FEZA 3UD6A 3DZ1A 3RLVA 3G24A 3B0VC 1IF2A 3QMRA 5F1VA 4J9JA 4WY0B 1B4EA 4PA8A 3LXCA 2ZA2A 3P61A 1TTJA 3A24A 4X2RA 1KW1A 2QF7A 5CZ0A 1M5WA 2H8ZA 5AHMA 2WSQA 4O4WA 1P4CA 3W7HA 3BLEA 3T78A 2RHGA 3HJZA 1XXXA 4LWWA 2G95A 3STCA 4TO8A 1O5XA 1RPXA 3W1LA 3L0NA 1GG0A 1RQBA 2YCEA 3W1TA 4UTUA 3LCIA 1NF0A 1SW0A 4QSHA 4HSOA 1OFOA 4ORIA 3EWWA 2EHHA 1EX5A 2DZPA 4NU7A 4UMAA 4JTHA 3HGRA 1QDSA 2V2HA 3ABRA 1W3NA 2RDUA 1TPVA 3KXQA 2H3DA 4LV4A 1I2PA 4AF0A 1EP1A 3O63A 5G4EA 1W37A 5FESA 2V9DA 4JXCA 1JUEA 3G1FA 1LBLA 3IGXA 4RKAA 1RQEA
chains in the Genus database with same CATH superfamily
3M0XA 4HNTA 1ITQA 2H3BA 2XG9A 1CT5A 5FJUA 4H8UA 2F8QA 4CD7A 1A5UA 5K4XA 2E77A 4AU0A 2QVNA 3CASA 1E73M 4PSPA 1NP2A 2OZTA 3TOPA 1W5PA 1RBLA 4QISA 3VCCA 5BXPA 4PMXA 2GJXB 3NDOA 1S3HA 4ZE4A 3DU0A 4NUWA 3GC2A 2D23A 1ZZMA 1ONEA 2BX7A 2Z28A 2CLPA 3SUUA 3THCA 4GY1A 4UTKA 3QY8A 2Q6ZA 1GPWA 1R30A 2Y89A 1IE7C 1V02E 3IGUA 2VFIA 3S1GA 3COTA 2MUCA 4OV4A 3FX4A 1EWEA 3KLLA 5CBIA 2Y63A 2PZNA 2Z25A 4HMEA 3XISA 2GK1A 2G5WA 5A6BA 5D4YA 3V1PA 1K6WA 4RDYA 1H5VA 1RK6A 3UR2A 1F8IA 2O9RA 3CTLA 3R12A 2WLZA 3FFSA 3NPUA 3NQGA 3BAIA 4LNYA 4DWDA 3L0KA 2QIIA 5F2IA 4CQBA 4CCEA 3NL6A 2G3FA 1XWYA 5BW6A 5TNVA 5AYYA 1F5ZA 3IK4A 3T9PA 3WEMA 1JFHA 4HGXA 3GE7A 1T5AA 1MFUA 1TE6A 2QCNA 3UBPC 3RM4A 3CWHA 3W82A 4P8VA 2OOGA 1Y0EA 1UH3A 4Z1BA 3IIXA 4KMQA 2WPGA 3SURA 4CD6A 1JCTA 1LP6A 2F84A 3W26A 2NSXA 3P2VA 4IMCA 4P2VA 2WC7A 3LBMA 3WJWA 2VT0A 3PPHA 1AD4A 1A0DA 1SZGA 2VYOA 1LOSA 4JQAA 1UUMA 2E28A 3GR7A 2V63A 3BTNA 1U5HA 2HPMA 2D0HA 3CM4A 4PTVA 4IG2A 2G41A 1DWAM 2OQYA 4D6FA 3MYPA 2XGIA 3LM7A 4R9XA 2PDLA 4I5XA 4ZQPA 4NXSA 4PB5A 3GQYA 4IMGA 2WCGA 1V6VA 4UOJA 4IGMA 1JF5A 4HU4A 3FDKA 1TPFA 1Z3NA 4HHPA 4RK8A 2CHOA 5LIYX 1KV8A 3R89A 3I65A 2PDIA 3MQTA 4J1OA 3UWEA 5C7HA 5JBFA 1XIEA 1UZ1A 1E1CB 3FA4A 1XIIA 1XL9A 3VDCA 3PBMA 5K3VA 2O55A 4AYGA 2O92A 3W2UA 1P7TA 3VMPA 2OU4A 2I14A 3QV9A 3MI6A 2OPJA 2DZWA 2B31A 1DJYA 3IIPA 3T81A 2DU2A 1H50A 3HPAA 4C7DA 5GNXA 1JQXA 3KM8A 3CJPA 1J93A 4JOMA 3D3AA 3KP0A 1N8IA 3STGA 5ENLA 2Q01A 3MHGA 1UWUA 5GJNA 3MW7A 2EPKX 4W8AA 1R8LA 1EDQA 4GI9A 1OIMA 2Z4GA 4EPBC 4GJ1A 2OWCA 3ITVA 3V4BA 1JZ5A 3KWSA 4J3WA 1XPYA 2WJFA 2QT3A 5U7SA 1FVPA 3RR1A 1V6YA 4IPLA 4DVOA 3GLCA 4MFDA 3BOLA 1H7XA 4JZ5A 5FL1A 4M6UA 2GWNA 1VPQA 2ZE0A 1HKKA 4O1CA 5I06A 5FAGA 1Q63A 3TQ0A 1RR2A 4IIDA 1PWLA 3TWBA 4HOXA 1O12A 2AAAA 3P60A 4HZMA 5BU6A 1JZ2A 1HL2A 1MRQA 2GGJA 4FNQA 5KZDA 5LIWX 3LQLA 4JTDA 3F4CA 3N34A 3PTQA 1SFSA 3PBVA 1NFPA 2AQVA 1Q2RA 4JQ3A 3BE7A 2ZADA 3ITTA 3WZ0E 2Z00A 1X1NA 1TJ1A 4IH3A 3GU9A 2PGEA 3OTRA 2BOGX 5I3KA 3LRMA 1SU5A 3BSGA 1JYWA 3GIYA 3O05A 4PR4A 5I0DA 4QLLA 1Q65A 2HS8A 4GXWA 3QVQA 4IIBA 5BXRA 3U2ZA 4TV5A 2DGAA 2DSZA 2YCJA 3IGSA 4W85A 1FWSA 3FAXA 1NIUA 3NQ6A 4PMJA 6XIAA 3W27A 5DX7A 1TPH1 4RV3A 3DOPA 1GOKA 3R0KA 1J12A 4I6VA 4OUIA 3WLMA 3QR3A 1H0IA 1HKWA 4YXGA 1YTDA 5C70A 2XFRA 2O9PA 1E4LA 3PJTA 2HEJA 3N1AA 4LF2A 3ZLFA 5FF7A 1NDZA 4FA3A 3H26A 1GKRA 4K39A 4GC4A 2V67A 1MO0A 3UERA 4WF7A 5A2BA 4PCPA 3L2IA 4QP0A 5CPLA 4M0XA 3RHGA 4CEXC 1DORA 3VOGA 3QMSA 1XCWA 3MUXA 1UPMB 4XZBA 1SZEA 3N9SA 3I10A 1UJPA 1VRDA 3G0XA 4O16A 1IV8A 2QJGA 1Q5MA 5F1UA 4J4KA 5EPDA 4P7OA 4HPHA 1UOKA 4D2JA 3I3DA 7CGTA 1VB9A 3SY1A 1GGOA 3BURA 2HS6A 4IWWA 4O57A 2XSAA 3T8LA 5KZ6A 3VD4A 4H9ZA 3TX9A 4M3PA 1ZAHA 1A4MA 2J47A 3ZYZA 4MOZA 1M68A 1NDYA 3TLQA 3RLHA 1WZLA 3HQ1A 4QAIA 1Y5VA 1LL4A 3GAYA 1VFTA 1FY6A 3I4KA 2IPJA 3VNKA 4NF7A 3DG7A 3AC0A 4LT9A 4U5KA 1VBGA 4RDWA 3GDKA 2D24A 4W8LA 3UXKA 2QKFA 4AF0B 4ZQRA 3U8GA 3CBWA 3JZEA 1DVJA 2GFTA 1UBSA 2CFFA 2XSBA 1UD2A 1XUUA 2CLFA 3AALA 1H7PA 3G1RA 1FWIC 5D02A 1DXEA 1EJUC 1PSCA 4ICNA 5CKSA 2PF8A 1TA3A 3K1DA 2A7PA 4DJDA 2QUUA 1UIOA 2XFWA 5D33A 1DE5A 2VZUA 2H6RA 3POHA 4UTWA 3ALGA 5BWFA 1Q85A 4IJBA 3USBA 3UYIA 4LRSA 2OMAA 4B2DA 2F6XA 2PWFA 1TJRA 3H4WA 4ZENA 1ME7A 3QMTA 3TJLA 1TUXA 5LGXA 2PWDA 3K46A 3UG3A 4L65A 3H12A 2XPKA 4GJJA 3GC4A 2QEZA 3UR5A 4DPQA 5I79A 3BW2A 3HGJA 1XBVA 2ESCA 2UY2A 1FCBA 3CIVA 2ZTKA 5FF0A 1R9ZA 2MNRA 2ACRA 4PUMA 2BWGA 1GTHA 3AFBA 1OD8A 3GIPA 5EBUA 1LL6A 3L2MA 3K8LA 2NX9A 3G3MA 3IRSA 4ICCX 3GTXA 1PZ1A 3S6DA 1QNVA 1D3HA 1TV4A 3DUGA 1AD1A 4TV6A 4H2CA 1RP8A 1JCJA 2PWGA 1H1YA 3DXIA 1I2NA 5MHBA 4C6IA 2VQTA 3F5LA 1QXLA 4TX6A 1HVQA 5DANA 2X40A 1SSDA 1KBBA 1Q6QA 5FI8A 3W6MA 2XN0A 5CEWA 1J10A 1KTBA 3A3XA 4GISA 5HNUA 3INPA 2DDXA 4QHRA 1HUVA 2HTMA 2AKMA 3S0CA 1UASA 3EEGA 5IHSA 5I3HA 5H2ZA 1GOOA 2HE8A 2QCDB 4QJ4B 1Z41A 4W7VA 4PN2A 3VKCA 1MZHA 1QI2A 4BQ3A 1PTDA 3L2LA 2VWTA 3B3DA 3XINA 5ECVA 3CV2A 3CHFA 2BXYA 3RUBL 4DBUA 4D71A 4PUJA 4LQ1A 4CU7A 3E5PA 1AQFA 4PH6A 2FDSA 2YXOA 4BI7A 4JFWA 4GH1A 4NAEB 3FYOA 4H2HA 4B2DD 1W5OA 3MMTA 1HIZA 1Q8JA 4O1EA 4MYXA 2PBOA 2ZFAA 2ZX5A 2H9AA 1S2CA 4JBRA 3I6TA 3VNZA 1NDVA 3FJLA 4QFUA 3OQ8A 1EFZA 1QAPA 4HZ7A 3V3WA 5HMEA 2EJ1A 3O0KA 1U1HA 4IX0A 3UJRA 4WDXA 1X1ZA 1ZHAA 2B7OA 2BY0A 4FOJA 4D9PA 1XBZA 8CGTA 3NQBA 1PIGA 1FWWA 3DC8A 4TU1A 4S3EA 5F7UA 4IIGA 2PA6A 4PUDA 1US3A 3QBUA 1V8EA 3CQKA 3AIBA 3I3EA 3FXYA 2DSUA 2V5KA 4GFIA 4PMOA 1UW9A 1KLZA 4PRRA 4D6EA 2A4AA 3CGTA 2R14A 1E0XA 2PLJA 2HROA 4WSJA 4F4RA 1BD0A 3W70A 4C5ZA 1B3VA 7TAAA 4C65A 3T42A 2ZWYA 1G6CA 1LRTA 2YIHA 1BRLB 4DNHA 3W1RA 5JH1A 1AMYA 4IQLA 1PYFA 3O6AA 4QNWA 3H54A 1RH9A 4CLMA 4HP5A 3I68A 3VE7A 4RE4A 1JAEA 1H62A 5TIMA 1YNYA 4I8YA 3NZRA 1MNZA 4XD6A 3VZXA 2OXNA 3E6EA 2R1MA 4ACZB 3KX6A 3MT1A 4WHBA 2GSEA 3OG2A 2PDXA 4CNUA 1JR1A 3B4YA 1R3QA 2V5DA 3AXHA 1ZL1A 2V0TA 2J7EA 4DB7A 4KFPA 4PCTA 1T8XA 5FJOA 1VCVA 5JU6A 3K4DA 3DFHA 3T0AA 2FTYA 3MMWA 1BQCA 2Z1SA 3SRKA 1FH7A 3T0CA 3GDLA 1EOMA 5FJPA 3P80A 5CC7A 3NO5A 4HYRA 5ABFB 1J8VA 3TLLA 3G1YA 5KSWA 5CAHA 1G94A 3EKGA 3PVFA 3T05A 3M47A 5AOUA 1WKEA 2QZRA 2OSXA 3B05A 3BCJA 4NXKA 1VR6A 3VC6A 1W91A 1E6RA 4IIFA 3HB9A 4AWSA 3SIMA 3G1XA 2AQOA 3MC5A 2Q8LA 3MP5A 4MMWA 4MHBA 2DSVA 1Z8AA 4OGZA 1W3LA 4A3QA 3IV3A 4REQA 1GJPA 3W73A 4AVOA 1DV7A 1CPUA 3O7UA 4ZA0A 3JVAA 3E38A 4LUSA 1GVOA 5C54A 3LHTA 3ZS4A 1FTXA 4RNFA 3SM0A 1RCQA 3TXVA 3APYA 2NSOA 3VFCA 2QMJA 4KGJA 3F4DA 3W4RA 4GNKB 1KCLA 2WANA 1Q13A 3FSTA 3WENA 1OM0A 4AMAA 2WO5A 4QM1A 3REQA 3DKJA 4Q6XA 4M6PA 5DXXA 2ZZ7A 1M01A 2FZMA 3HZ3A 3OZMA 5H91A 1V7AA 4NZCA 1VLIA 3LBCA 4N42A 4PFMA 4XUGA 1K4HA 1W17A 1PBGA 4H8NA 4WGHA 4O14A 1WBHA 1DIDA 2QLYA 1Z48A 4N9EA 3UG5A 1J01A 3K2GA 1KTCA 4XZNX 9CGTA 3HJEA 5F4SA 2WMIA 4UB9A 3BG5A 3ZJKA 3A4WA 4E4PA 3DFOA 5BYWA 3VGBA 1VFLA 3H2MA 2YKKA 3M64A 1IIGA 3EKLA 1SJAA 4HD5A 3W22A 1MFVA 2UY5A 3M0ZA 1W3KA 1PIIA 3TN3A 2NQLA 1Y5WA 3GTIA 4Q4MA 4TQTA 3T6CA 4IXHA 4ZTYA 2Z7KA 4F0KA 1KRCC 2J6VA 3BQ5A 3E0IA 4CU8A 4AY7A 3VM7A 1UH2A 3N2CA 3SB0A 1ICPA 7ODCA 2E7FA 1IEXA 1G4EA 2PODA 3CV7A 4XTIA 1SUXA 1X8FA 4UQ9A 4MWAA 1SZNA 4WOZA 1EJSC 2X0YA 4FNRA 4Q8MA 3WQFA 2QPXA 2FYMA 4FAMA 4FALA 3IAPA 4ERIA 2I5GA 4Y9MA 1FBAA 4FPSA 1VBRA 3VX0A 2XH0A 3GNNA 1WDRA 4Q8WA 3WDHA 3MY9A 4QNEA 2C0AA 1IZJA 2QS8A 2E6AA 3ZSSA 3ITOA 4UFJA 1EA9C 2ZRXA 5M17A 3L65A 3O8AA 2ISWA 4GY7A 2BGSA 1V0KA 2HNEA 1CGWA 3CK5A 3UFYA 2ON3A 1TIWA 3HQOA 2E6FA 3T4WA 3BOFA 1CLXA 4M7TA 2D73A 4P7QA 3WKZA 1U30A 3KZPA 3W00A 4O17A 1A4LA 3KBNA 1UKQA 2Z29A 2PTXA 5CZTA 1ME9A 1UD3A 2E5CA 5E93A 3GFXA 2QJJA 5EY5A 3QR0A 3VABA 5ABEA 2VELA 3N9RA 4S3DA 3LZ3A 2VZTA 2ZRZA 3RRAA 4OJYA 1N8FA 1XLEA 1V3JA 4AZ5A 1GJWA 4RR4A 4FF7A 1FCUA 3G77A 2WKJA 3T07A 4DZ5A 2J6XA 1O1ZA 4GYPC 3SGUA 2GGHA 2GVEA 3EXSA 3TYAA 1HT6A 4HJWA 1VIWA 4DELA 1GVEA 3CL6A 2JKEA 1S5MA 4LUTA 2PE4A 1HKVA 2P0IA 3WLKX 2EJAA 4GUGA 4ADUA 3NGFA 4LYQA 2A3HA 3W7EA 1VFSA 4DXVA 3MB9A 2Z6IA 3WLNA 1OFPA 3NL2A 5T26A 5CBBA 3MO7A 3W7GA 4ZQMA 1BTCA 1SR0A 1H63A 4S3JA 4F0MA 2YDRA 3F5JA 2EKGA 2NVAA 2QJNA 1ODZA 4HNVA 2OGJA 3RCMA 3SCTA 4K1GA 4P5UA 1QPOA 5CJ5A 3ZZ1A 3SI9A 1GOXA 4GRSA 3B9NA 4P8UA 1XV8A 3TCSA 4W4QA 3PZUA 1QFEA 1V7YA 1DKWA 1R87A 4RV8A 4ZTXA 3OIXA 1DJZA 4X61A 1Z32X 3NO1A 3VGFA 2P88A 3ZMRA 3LQGA 2C1HA 3IJLA 3L7RA 3QFWA 3S2LA 3BC9A 4QJ3B 3QY7A 4QEHA 2JGYA 4Z1AA 3W74A 1JD9A 1TR1A 3P84A 1BVWA 1QNQA 2Y1HA 1SYTA 4NJKA 5IHRA 1QHPA 4H9XA 2V30A 3WLOA 1U33A 1DQXA 3M6YA 1VYRA 2AGTA 5KZMA 4WD0A 3CQIA 3T2QA 3B8UA 1K77A 2RGMA 4NZ1A 1NWTA 1LBFA 4KESA 1PTAA 3LHZA 1O66A 4AC7C 5CCZA 1LBMA 5EMMA 4R7JA 1G69A 1Z9AA 3TQPA 1BYAA 3W7KA 3PZGA 4F9JA 2NW0A 4OTKA 3VDBA 4OOZA 1AL7A 4E3TA 2INFA 4G7EA 4PTNA 2WCSA 2EEXA 1T0OA 1P48A 3TJXA 4U31A 3H2EA 3L4TA 3GX9A 1ZSXA 1GZGA 3SO7A 3MWAA 4HA0A 4JYDA 1HGWA 1OC7A 1CB7B 1G4TA 3GB6A 4DEFA 4DLFA 4JIEA 3KTXA 3WQEA 1B4KA 2QYGA 2R1KA 1AJ2A 3E74A 5M03A 1WZKA 4C6QA 3CMJA 1D2KA 1WQ5A 4O11A 3PSVA 3MHUA 4QX4A 3K8KA 4A3HA 2R91A 1L2QA 1ZJAA 1AZ1A 4V27A 3MO4A 3PBYA 3LU2A 5HBFA 3UR8A 1GZJA 3PZMA 1OX5A 3TXZA 4AIBA 1A3XA 2Y2WA 2D2GA 4DWSB 1YXCA 1RHCA 3H23A 4KWSA 3IPWA 4WDWA 2D3LA 3DCPA 4XIMA 4ZQOA 1X6UA 2VX7A 1JPKA 3LGGA 4GQ0A 5C9XA 4IZGA 4PCSA 3KDNA 3E0WA 5FCZA 3LS9A 2VRJA 1REQB 1JDAA 2WQPA 1KFCA 1TMHA 1ZJHA 1LWIA 4XK2A 2PWVA 3DFPA 1Z44A 3NQAA 4Y2WA 3LPFA 2GL5A 2FLIA 1OYAA 1U83A 1X7FA 4Q8TA 3W83A 2F61A 2JBMA 2E1WA 5XIMA 5F2LA 1KM3A 1LLWA 3KTCA 5I5RA 1CGXA 4LC6A 4MNJA 4NAFB 1EKOA 2FGLA 4B90A 3WIJA 1I2OA 3SQMA 4GZIA 1OCQA 4XBJA 1R47A 2OQHA 4F0HA 3KCJA 3HV9A 5HULA 3LEPA 3PZVA 3M0LA 3E1F1 3TIMA 2VDGA 4YCPA 5KETA 3QRHA 3CPUA 3QHNA 5HR7A 5J5RA 2Y6ZA 2YXGA 5DY2A 4QLKA 5DELA 1J0YA 4Q4KA 1U22A 4YTSA 4MPKA 3P0XA 2NVDA 3TUUA 3WQDA 3PPGA 2BY1A 4HMNA 1SFLA 3VDAA 1UR3M 3FDGA 4MY1A 2DFAA 2YFOA 1MYRA 2Y4SA 1TE1A 2VZOA 4A05A 1G7UA 2DZAA 3FA3A 1SFJA 1U1JA 2ZRUA 2DT3A 3CO8A 4JN6A 3GFYA 4MY8A 1E5NA 3AIEA 4PL2A 3AU6A 4QCFA 3WQ8A 4RNJA 3IJ6A 3NPXA 4JTFA 4DPPA 1PS9A 1E1FA 1IT8A 1ONWA 2NQHA 3FLUA 2NLYA 3AMLA 3HTWA 3ZJ6A 3BV7A 3B8VA 4LB4A 4MZ8A 4N6EA 3VAVA 3DHDA 4UC5A 3S5ZA 1IEVA 2EO7A 3KVKA 2XTKA 4P8WA 5K4ZA 3TAOA 3GKFA 3S3GA 1F73A 3A3HA 4ZO7A 3C56A 4HK5A 4Q32A 4NVTA 3TTQA 8TIMA 3POCA 2X0SA 3AU2A 4FNSA 3NEVA 2GUUA 1I45A 2E40A 1A47A 4AZ7A 2QMKA 4BQ5A 2FH6A 3M7SA 1BG9A 3IVUA 2FZ9A 3R8GA 2WZIA 2NV2A 4M82A 3RYSA 2FQIA 3T08A 2Z7GA 4WUIA 4J35A 1BF2A 3SGZA 4LYRA 1Q6GA 2CZVA 3C2YA 3OGRA 1TPWA 5ECUA 1IXNA 4Q3MA 3HF3A 4FNPA 1UZHA 1M41A 3SADA 1M7PA 1ECEA 4M6QA 4LALA 3FOKA 3MSRA 4WVXA 1W9DM 4IT1A 3VIFA 1ISVA 4UNLA 4PYSA 3W2JA 4AEEA 3UCCA 3PBUA 4HNLA 3NSNA 4QITA 3FGCB 4CNSA 1EB3A 2OKTA 2PRMA 1QNPA 2FVLA 3W1UA 2PC4A 1GCYA 1BAGA 1EQCA 1PE1A 1J18A 4B16A 1C8YA 4IQJA 1A5CA 1FKXA 2W92A 3O2LA 2EQDA 1F3XA 3PTDA 2OLSA 2GDQA 4F0SA 3RM8A 1K8CA 1BPLB 3CUXA 1FWEC 3HQNA 1E0TA 5LIUX 4D6IA 3WH6A 3ZLHA 1DHKA 3PBWA 4GPNA 2E0PA 5CSRA 2R82A 5AYIA 1Q8AA 3DHFA 2G0WA 4XTDA 4X2PA 2GUYA 1A3WA 2WSKA 2DUAA 2QXWA 3OZPA 1M6JA 3DYPA 1J0IA 4YPJA 4YN5A 1BXNA 4N9BA 2BSLA 2J8FA 1BKSA 1XQKA 4M81A 5GPRA 4L6HA 2Y85A 1XIFA 4AD1A 1PXGA 2HQAA 1LJYA 3A23A 5TQLA 1XSJA 1B9BA 3MHFA 5HMFA 1GVIA 3GG8A 1V79A 3CZEA 4UCFA 3LYEA 1NWRA 5D04C 4JQ4A 1XLMA 3MTWA 3ARSA 3EWBX 2DVUA 3PM6A 3SW6A 4XISA 3TR2A 3TR9A 3AYTA 4EWND 4YTTA 3M43A 3C2VA 1JGIA 3UXLA 4YNGA 1OCNA 3S47A 1JEZA 3EBVA 4AUBA 3OP2A 1ZU8A 2FMNA 3KBJA 3UD6A 4HZ8A 3RLVA 1EL3A 2CHNA 3B0VC 4YHEA 3LXCA 1IWAA 4PRTA 1F6YA 3PFMA 5CZ0A 2P5NA 4KCVA 3GG0A 4UQBA 4O4WA 7REQB 3BDKA 3T78A 4DM2A 3HJZA 1XYAA 2G95A 3STCA 4FXFA 5DMNA 3W1LA 3L0NA 4BF5A 4C90A 3MCMA 1YHTA 3LCIA 2FH8A 2PFHA 4RE0A 2UBPC 1DJHA 1OGSA 2DZPA 2QQ6A 4JTHA 1VEOA 4HMCA 3QR1A 1QDSA 3QV8A 2IKGA 3LPPA 2RDUA 1TPVA 2WC3A 3O63A 5G4EA 1W37A 3WG6A 5FESA 2I56A 1RQEA 2PB1A 3WSUA 4INFA 4AY1A 1QI5A 5EMJA 1OG6A 4IPPA 4YU1A 2WVUA 2NUXA 4GUHA 3WMSA 3WF3A 1TFVA 4JTJA 4LX4A 1UPPA 4F9DA 4UNIA 4URIA 3O6DA 3PP7A 3FEQA 4PSRA 3HPZA 3QN3A 4C6MA 4N9CA 4ICMA 3FJNA 4XAPA 2PDKA 5FIPA 1DTNA 3WF0A 5JVLA 2NV9A 3NO3A 3CUIA 4PULA 3BLFA 1POJA 4IX2A 2J66A 1J0KA 2NT0A 3P3BA 4N7QA 1QI4A 2UZ9A 3QOMA 1LL7A 2YL6A 1RJPA 2REQB 2V8ZA 4UR7A 1MUCA 1V0NA 1MEIA 2CNCA 3MDWA 4L6OA 3HG4A 1JDDA 1TV8A 4C1NB 5LGZA 1JNDA 4EF9A 3B0XA 3QHMA 1PKLA 1RJQA 4L56A 4YYCA 4GD0A 2PDPA 3H53A 2IXVA 4HNOA 4NIRA 4HNCA 4WXZA 4R34A 1AH3A 3DHPA 1DL3A 1FWTA 2IPGA 2CLMA 4E2BA 5BU9A 1TYGA 1T40A 1GVYA 2QCGA 4NZFA 3WD0A 5FKYA 4HKPA 4H3DA 2JK2A 2XIJA 3ZM8A 4MUPA 1QK0A 1MEHA 1FA2A 1WOAA 3LUTA 4ILSA 3W71A 3VKJA 3LA4A 3RLGA 1HO4A 1W9XA 3VTRA 1YIXA 3G1HA 4Z2KA 2PDMA 2J9YA 3UNTA 2F2HA 1HO1A 5J8LA 1QATA 5J04A 4KEVA 1XDMA 4RW3A 4D6JA 3W7DA 3NA8A 4QIUA 1YNPA 4LS2A 1OGGA 1SJCA 3N04A 3ZR6A 2IPWA 1AW1A 4IQDA 3LV6A 3M0JA 2OJPA 4LTSA 3CZKA 4G7FA 3STPA 3XIMA 3ARWA 1NWUA 5SWUA 1I2RA 5H8UA 4B9ZA 1WO2A 1N2VA 1IEWA 1XISA 4LAZA 2XVKA 5CPNA 4E2DA 4V28A 3QQWA 2FHFA 2FGBA 1ZAJA 2R9RA 3DHUA 3SCUA 3R13A 4UFKA 1ZNNA 4X60A 1IEIA 4R33A 1KBKA 1OBAA 2BG5A 3CAWA 3FNDA 2IUZA 3AMDA 3CV6A 2BFGA 4A3RA 1KKOA 4NRSA 2YCLB 4HCLA 3UWWA 3AOFA 2A3CA 3PS7A 5EFFA 1CXHA 1JRCA 2ZC1A 3QLLA 3GM8A 1AA1B 2PDQA 1WNOA 3BK0A 3AMCA 1CLKA 5KTLA 2E6DA 5DMLA 1Q6LA 4TUFA 8A3HA 2J4GA 2OFJA 2YR1A 1TB3A 4KPLA 1HJSA 3ITCA 5GVJA 3VNYA 3WELA 3BAWA 2GPTA 1OT2A 3GNRA 3N19B 1G01A 2CZEA 3HFYA 2ATSA 2OB3A 4NT0A 3R6IA 1DIOA 2X41A 1GQKA 2DVXA 1ZQ5A 1I1XA 4HA3A 3CT2A 1CIUA 1S5NA 6A3HA 1QOQA 3D0CA 3QW4B 5HWNA 2FFIA 4DM1A 1I6NA 2UY3A 3IRDA 4O15A 1QRQA 3LGEA 2DORA 1XD1A 2PTDA 1PAMA 1JDFA 4RXFA 4JFVA 2WK2A 3C86A 2H90A 1B54A 3A12A 1RZMA 4OOUA 2PDHA 5EYWA 1GQLA 3A9BA 4WSKA 3ZR4A 4MJ2A 2VEKA 3E0VA 4CKQA 1HJXA 5DY3A 2QW5A 3PG9A 1FFRA 3O6CA 1IXOA 4CNPA 1GHSA 1BEUA 1PTGA 3Q45A 2J24A 1JYVA 4YTQA 1G4SA 2BGQA 4JTTA 1CXFA 3EOSA 2UY4A 3HM7A 4LVGA 3L23A 2G50A 4RJEA 1W5QA 5HR6A 3V5FA 1KWKA 5A2AA 1RD5A 3N14A 3L4UA 3S1VA 4UMBA 4Y9PA 3FHAA 3V35A 2FPVA 3NOEA 1IQ8A 4CNNA 5RUBA 3P67A 3RPTA 1XI3A 3E2VA 2ZTJA 2WVVA 2PDUA 3WD1A 7TIMA 3F2BA 3OVPA 4I9AA 4XB3A 4ZFCA 2NWSA 3NZGA 3II1A 1GG1A 2E4TA 4MYAA 2J7BA 4YVPA 2VD8A 2X05A 4XZMX 2ZUWA 3H4XA 4X22A 1JG9A 2V68A 4UTJA 3LLDA 2E8ZA 4IP5A 2PCEA 4J7RA 1EO7A 3U0HA 3D46A 2QJMA 4LAMA 1DYSA 2X09A 3LBOA 3NQFA 2A2IA 4ROPA 3MDUA 1UC4A 1HG3A 3EOEA 4ZVJA 5A5WA 2C3ZA 5EGRA 2ZUUA 2C13A 3WQ4A 2WQDA 4GINA 4O10A 3DG6A 5I3FA 2HV5A 3DERA 7XIMA 4LB3A 3Q2DA 3A4XA 2X2YA 4MDOA 3GO2A 4HVXA 3EAUA 3OPSA 3WQWA 3ICJA 5HPCA 2FZNA 2XIOA 3E5BA 4D8AA 4L9XA 4LYPA 2OYMA 3EZ4A 1VYSX 4XD3A 4JEQA 1GEHA 3EB2A 2PD9A 3MJMA 4Y8FA 4E6MA 3B06A 4JN8A 1H09A 1E9LA 3E2SA 1S1PA 3IIOA 1I8JA 2A6NA 4B5UA 3EA2A 1E9ZB 5BXSA 4ADTA 3MBDA 2CYGA 3L12A 2CWNA 3KCLA 4JKLA 3GXFA 3G1VA 3TYBA 3K1GA 3S6OA 3AJXA 1XRVA 3TN5A 4DRSA 5IM51 4GCXA 3TE9A 1KBLA 3TYCA 2C91A 3WDQA 3QF0A 4DBEA 1FWDC 3R11A 1E55A 1K9EA 4JTQA 3TW6A 2DIKA 4JFSA 4BEUA 1ZAIA 3SN0A 4HZ6A 1XX1A 2QAPA 1N82A 1FHUA 3UCDA 2F6UA 5DBUA 4UTHA 4QJ1A 1W56A 5E0CA 4DWSC 3JRKA 1UB3A 2PF0A 4XIAA 5BOEA 1V03A 1F61A 1Q4NX 2WLYA 4A22A 5FJJA 2YL8A 5FF4A 2PLMA 4J2MA 3RDKA 1X98A 2E67A 3VKAA 1GKQA 3TV8A 2ADAA 3K4AA 4HNNA 5PTDA 3W86A 4PEKA 4HTBA 4LJ3A 5AHNA 5H1WA 2HK0A 2ZRWA 1VC4A 3VGDA 3EMCA 4F0RA 1M53A 5K9XA 2CXGA 1U5VA 3R58A 1UC5A 3FYPA 2VM8A 4AD5A 4GYKA 3VMOA 4QS5A 4W87A 3WD3A 1WKDA 3HU7A 3W0KA 3CU2A 4BK9A 3WK1A 2PWHA 1OQFA 1SMDA 4ZFMA 3LMYA 1UQYA 3QPEA 2DZBA 3VK5A 4LSBA 1GYLA 5AYZA 3ZWSA 3W7CA 4B92A 5J5DA 3NSMA 3A4JA 5D2YA 2GK1B 2BLEA 2E9BA 1JULA 3TA9A 3VNMA 1JXKA 1GUVA 2J78A 4GIAA 3UWYA 1SMAA 4B4HA 4KETA 3DEQA 1R3YA 1LOLA 1JI2A 1VEPA 3QM3A 1OFEA 2DJXA 1RY8A 4EOUA 3VFLA 1KCZA 4J3VA 1SFTA 2PEVA 3GHRA 1PJ9A 3QPZA 1UD5A 1FDJA 2ZUVA 1Q45A 3GXTA 3RN6A 4E38A 4I3GA 5CG7A 5FJRA 4N9DA 2YBVA 1PDYA 5C71A 4JQ2A 1J5TA 4H9VA 3IGHX 3AQUA 1V08A 5IXEA 4KWOA 3VVGA 1YXDA 4M8UA 4EK7A 3UYCA 4BFAA 1TO3A 4Z42C 3CZ8A 2Y7FA 1DWFM 1TELA 4GHRA 4HPGA 2PRHA 3AMKA 2V69A 4WJEA 3MSYA 4JTEA 3AISA 4XQ6A 2FPTA 1JDCA 1MWOA 4QCEA 3TN4A 4LBRA 2PP3A 4JD4A 2EPOA 3APGA 1W5MA 1HX0A 1ITUA 2BGNE 4IG2B 4E4UA 4W89A 2RUSA 4ALDA 2W62A 3EXTA 4XKYA 4GNVA 4EX4A 2XH2A 3F4WA 3I4EA 2I57A 2QV5A 4Q7NA 1E70M 1XIDA 3OVRA 3BLDA 5JQ9A 4IMDA 3UZYA 1TZ9A 6PTDA 1Q6RA 1EPXA 4YS1A 1E6PA 3UZZA 4ZL1A 4ZOAA 4DQWA 2E9LA 1NDWA 3GIQA 5LNRA 3UG4A 3UGRA 1E0UA 2YJQA 3M07A 1LT7A 3TTEA 1XLKA 3AXKA 2Y7EA 4TXEA 4MB3A 3ARPA 3HPFA 3H2AA 4XX6A 1PO9A 4S3FA 3UPMA 3W07A 3NAVA 4GA8A 1O60A 3KAOA 5BNKA 1E51A 2IW0A 3KLKA 5CC6A 3W7IA 1BGAA 1IR1A 3DAQA 3ZVHA 5BRPA 3MV01 1P7TB 3PULA 2CC0A 3NM3A 5AC5A 4PMVA 1UD8A 3S2CA 3GH4A 1DXIA 3C2OA 1LLOA 2XDFA 1XD0A 2G37A 1X6LA 2IXUA 3T0TA 1MRAA 3WUBA 4UNKA 5HQEA 1XBXA 3ZLGA 1AVAA 2DW6A 3CYJA 2V38A 3SCPA 1JUBA 1L8PA 1LOQA 5D05A 3VIOA 5CPMA 4A21A 2ISSA 3LNPA 1E6QM 4N4PA 3MA8A 2E1DA 4WKHA 3WY1A 3GU1A 1T7LA 3MUAA 2BP1A 2YGYA 1KBIA 2E09A 3IACA 3RLUA 1TJ0A 4GZJA 1VCGA 3D47A 1PKMA 3LX9A 4JTSA 2G96A 3OOQA 3GNDA 4POCA 5FEZA 1D9EA 1A5OC 2QDGA 2WZHA 2OOFA 1GNXA 4AISA 3ARXA 4X0NA 4O53A 1VYPX 3GNXA 4B5TA 2BVTA 2JFEX 4HNUA 2QCEA 4JCMA 1SSGA 4AD2A 5HATA 1RALA 3RITA 1T99A 1K8ZA 2XM1A 3MP3A 1F3EA 4RDVA 2DZSA 4P8XA 4NZ5A 1YXYA 4LVFA 3I3BA 1JAKA 1NWSA 2OT0A 4FX7A 4Y8EA 1KXTA 3PF3A 1TV5A 2GUBA 5EL1A 5DT7A 2R6OA 1IHIA 3QSTA 3BJFA 2HVMA 1ZB5A 3ELFA 5E0KA 1FCVA 4NILA 3BG9A 2OYLA 3N15A 2OWXA 4DJEC 3V5CA 2OELA 4G1NA 2VFFA 4MKSA 5C55A 3CUFA 1IWBA 2YCIX 1NM9A 4WCJA 5EU9A 1XHGA 4GVGA 3W1MA 3WBAA 1KB3A 2WZMA 2Z1BA 3CLMA 4BWLC 3RPDA 1QOPA 4GE8A 3P14A 1EC9A 3RK8A 4NZ3A 3MYOA 2Y5EA 3U7VA 4KRUA 1JYXA 3B9DA 1DWHM 3L5LA 4PTWA 3RNDA 4JY9A 1MEWA 3R0DA 2OO6A 1C92A 4Q33A 4RZ4A 4H4IA 3IANA 4EACA 4O0ZA 4GQBA 3V75A 1BLIA 2VDHA 3AS2A 1E71M 4UZSA 3BOXA 4JHOA 2J8GA 1QPKA 3OA3A 5HNRA 1QPQA 2ZE3A 4RNHA 4XZ9A 2W63A 5CJNA 4DUWA 4CD4A 1YBQA 2NQ9A 3CB8A 3ARUA 3VC5A 1B5TA 2J7GA 1KM4A 4ES4A 3WQ6A 1PB0A 1W5NA 2VVNA 4B5VA 3ZT5A 2IQTA 3KOYA 3CUHA 3AO0A 3M5XA 4F48A 1B30A 3PZ9A 4AZBA 2DJLA 2QAFA 1NY1A 4GX8A 2D2HA 2J8TA 1UWRA 4HJFA 5A6TC 3VPLA 2FVKA 2RDWA 3UGVA 5BROA 1VJIA 4ACYA 3M0KA 1IYXA 1KGWA 2W67A 2XGZA 3Q65A 3CUJA 3WD4A 3LHYA 3CYVA 3MPGA 1EQPA 1HJVA 1XRTA 2XVPA 4ZSUA 3W2MA 5ABGA 2WHJA 2C79A 4DJFA 3AS3A 4P7LA 3CMFA 1LM1A 3LNMA 1KQZA 1L0PA 3LPOA 3R10A 5CXPA 1V3IA 1EWDA 3UWUA 4YTUA 4V2XA 3WLLA 3W87A 3CNYA 1J2BA 3KVJA 3W1XA 3RXZA 3UQNA 1TA3B 1VKFA 3AUOA 4UQAA 3WLPA 3W7PA 3BJSA 3PPCA 3PAOA 3KRSA 4R7WA 5I6SA 4IL2A 3BARA 4C5YA 1E6SM 2CBUA 3S4TA 3DI1A 2AQWA 1JZ6A 3G22A 1W9BM 1G7VA 2VEPA 4GC3A 2NT1A 5E1QA 3QJAA 4XVEA 8RUCA 4G2DA 3URBA 1HQTA 2DY3A 3AYSA 1QI0A 4G56A 1TWZA 1EJRC 3ANVA 1QPRA 1XIMA 3PTKA 3CL8A 1WCGA 1XQLA 4LY8A 1OFRA 2QVHA 1XIBA 1RQHA 2C0HA 4F2UA 3NQ8A 2PDCA 1XGDA 1S5VA 1MXDA 4W7UA 1MXSA 5C5YA 3ORWA 3THUA 3LCWA 4RE2A 1UUOA 3AMGA 3TSBA 7PTDA 3W85A 3NNTA 5D9OA 2HVOA 3ARVA 3VOHA 2YDAA 1IZKA 4DBDA 4MJ4A 4PGLA 1NELA 3CWNA 1PEZA 2Y5SA 4WLCA 3PUEA 2Z1WA 4PUKA 2WSYA 3VOFA 3VNLA 1UZDA 1O7AA 3A4AA 2WPBA 3CHEA 2GQ3A 2HPIA 3RF9A 3C8FA 4GO9A 1DIEA 4MDPA 2CWXA 4PMYA 1GPFA 2CETA 3GW3A 1CBGA 4OBRA 5DXYA 2X1TA 2J7FA 3WLJA 3LZ5A 4WX2A 2BVYA 2A1YA 3H21A 3SFWA 4UTTA 1ZBKA 2VUNA 3HPSA 1XSKA 2V5BA 1H51A 2G3JA 1OX4A 2P3EA 1KQYA 5D9NA 4M24A 4WKAA 1MZRA 4JPGA 1CGTA 4N02A 3EXRA 3JR2A 1CWYA 3QQ1A 3P7YA 3FCPA 3P82A 1M9HA 3AHVA 4HB7A 2V82A 1L9WA 4FI4A 1UWIA 3KW3A 4IGHA 3D6NA 5HNNA 4FLRA 4LH8A 3TQVA 1ADDA 3UU0A 3CUGA 1THFD 4ZE5A 3NWRA 4C91A 5I3DA 1VFOA 1DJQA 3ITGA 1SGJA 1XCXA 2TMDA 5KITA 1TVLA 3N6QA 3RMJA 5GQBA 4BF7A 2ISFA 4PBFA 2RDTA 5C2GA 3LXBA 1YLVA 3UJ2A 3W2NA 4GI6A 1B9ZA 3BL3A 3DYMA 3SCSA 4A8IA 2H9AB 5I2UA 4NI3A 1OFQA 3B9OA 2B0MA 1V6TA 2WV8A 4Q8OA 4NKCA 2E6YA 3WL0A 1E0WA 1FDZA 2C1GA 2XH7A 3S2MA 4YHGA 4E4FA 4WY0A 5F4XA 1UR9A 3N2BA 4LW7A 4CUCA 3C0LA 2VGIA 5M2FX 1YKWA 5FL0A 2E68A 4FNTA 1CCWB 1QI3A 2YZ5A 3M6DA 3O6YX 4NX0A 1JCNA 1PYMA 2ZXDA 2R8WA 4MKNA 3WBYA 3NTYA 1UMYA 1XLLA 5DT5A 3GC5A 1HNYA 1JFXA 3WDJA 3PZOA 2PP1A 1TPEA 4X3ZA 2QULA 3SN4A 4QAWA 3OVGA 1BYBA 2BHUA 1IT7A 4FXRA 2BNJA 4TMBA 2HSAA 2J13A 3WEZA 3BAJA 3PB2A 5CJMA 1Z6KA 1DWGM 3HGOA 5A69A 2VUYA 4NYUA 4J3ZA 3TYEA 1QO5A 3SUTA 3GW0A 5EFDA 1SVDA 2POZA 3V0TA 2YB1A 2JE8A 4XG1A 1JD7A 1Q6DA 5FOOA 2IS7A 2VRQA 1VRXA 1QT1A 3RX4A 3EOOA 3GBDA 4IXXA 4F3HA 5BWAA 1R38A 4XD5A 3MMDA 5IFPA 4L4PA 1AMKA 2DSWA 1BKHA 3WJXA 1PVNA 2DW7A 3SEPA 1UCWA 4UOZA 1R86A 5DMYA 1FWRA 4DZAA 4M51A 1EF3A 4JIRA 3TZNA 4G6CA 3N4FA 1OABA 3TAKA 4HOWA 2HBXA 4PE8A 4RZ6A 5E0FA 2C16A 3VU2A 1S2AA 4GQQA 1YADA 1O5QA 1W9UA 3VO0A 2TSYA 5LXEA 1PX4A 3AWOA 1NARA 2VC5A 2OWWA 4AEFA 1WDWA 1BVZA 5M5DA 1FWNA 1GZ1A 2AOSA 3N3TA 2YW3A 4W8BA 1PZ3A 3WJSA 2XM2A 1V51A 1QVBA 3GDRA 1KLYA 3GSMA 4QRNA 3MKKA 1TJ2A 1FUYA 4G9PA 1KO0A 3GG1A 4JKMA 3DECA 3CEUA 1JPMA 1CXIA 4IF2A 1LQ0A 3L21A 3T0DA 2YPIA 1JGMA 3KCOA 1OSEA 3VIMA 1A53A 4HIBA 1VENA 1KWGA 3LCXA 4I9TA 3QGKC 4DLMA 3EOLA 4K37A 5BOOA 2P3ZA 1HN1A 1IWPA 1W8SA 4REQB 2ZVIA 3GDTA 3BPWA 4Z2LA 1XG3A 5IDZA 2XWDA 5G2IA 3VIKA 5K9CA 1H49A 2VL4A 2TRSA 4LUSB 3B03A 3NYDA 1Q66A 3EWCA 2PBGA 3VGGA 1E5JA 4BR1A 2D2JA 3SCRA 3TU9A 3QV6A 3GXPA 2NQ5A 1L2UA 2XIQA 3NQMA 1ZBWA 1MXGA 3F1QA 2WHLA 3N2OA 3RFAA 2ISVA 1ZBVA 3EDKA 1E1EA 1UKTA 3REQB 4RE3A 2QIWA 4GXMA 2IKJA 4GQRA 4MNLA 2EPNA 4B3KA 4OBSA 1TSIA 1BVNP 5G5IA 1E4NA 4OQVA 3T40A 3AS1A 4PMQA 3BMVA 4EP8C 1HP5A 1K8YA 1PUDA 4Z1YA 5A6MA 1WOBA 3Q94A 3VZYA 1UH4A 3SCOA 2Z2AA 3LN3A 4NSBA 3T8QA 3OU8A 4ZO8A 3MU7A 1H0GA 3UWQA 1TQJA 2J7HA 5XINA 1F2JA 2WMIB 2DZTA 4QXIA 1GVQA 4LEFA 3TEVA 3M0MA 1GQJA 4J3SA 4FOKA 1L6GA 4GY0A 3PPFA 3UG8A 2D1ZA 4GBDA 2PTZA 2DIJA 4FIRA 2V2DA 4CNTA 2ZZ6A 2QDDA 7ENLA 3WF2A 8XIAA 2GOKA 1JCLA 4Z2IA 3OGSA 2BTMA 1LORA 3ZT7A 3QQ0A 1KM2A 4O13A 1JQVA 4M19A 4K7VA 4MIMA 5FEWA 1L8NA 4ZSTA 2R1LA 2CCRA 3TC7A 2WAGA 1XJBA 1CW2A 4QBXA 1XM3A 1XRFA 2FGZA 1W9PA 1T6MA 1TPUA 4D6DA 1O1HA 4WDTA 1RLDA 3TSMA 1QNSA 4MWAB 1FHVA 1LQAA 1SPQA 2BOEX 2FKPA 2ACUA 1B31A 2FZBA 5AZ1A 3L4WA 1TZ7A 3NJ3A 4BJHA 3V7PA 3NL5A 3LENA 4KT2A 3C3NA 3GTNA 1I2QA 4GXPA 3BLOA 1KFEA 1XYLA 1XC6A 1H7RA 4M29A 2Z24A 4FXSA 2OKOA 1OZMA 4H19A 1KFBA 4Y6GA 4ZB5A 2GSJA 3AHZA 4CVWA 3W6YA 1GHRA 4XV0A 4IICA 1RSCA 1EOKA 2Z1XA 1MDLA 2WW5A 3A21A 4JDBA 2IQ0A 2Q8ZA 2V5CA 1P0BA 1DWIM 3UVAA 4N2YA 2E3ZA 3T0BA 2WVSA 2BHZA 4TIMA 2QCLA 3VUSA 3KOXA 1ZP4A 4HU8A 2XYLA 1UR0A 5KINA 2YBUA 1TWIA 1J0HA 4U5IA 2WVTA 1P0EA 4D8LA 1T96A 1ZBCA 1U1UA 1R46A 4KFNA 1ZFJA 2YYUA 1LZOA 4YWSA 4LUTB 4IUOA 4WDUA 4C6OA 4AD0A 3W7OA 2QR6A 4J3UA 2AMXA 3P8IA 1Z42A 1LWHA 3M1ZA 1MQQA 3A22A 1XFBA 2ABBA 4EXAA 3S46A 1HFBA 4L64A 1TX0A 1LRQA 2ACQA 4PUNA 2DT0A 1J0JA 3FHQA 3VILA 3TVAA 5CGTA 5HA7A 2XJ7A 1KFLA 3ABZA 1NAL1 2V81A 1AQHA 4E2OA 4UFMA 1UKPA 3MVTA 2A3AA 3BMWA 4LRTA 4I5UA 2WZEA 4FEZA 4E8CA 3IV8A 1IF2A 1G1YA 3JZUA 4GKLA 1KRMA 5I07A 3A24A 2QF7A 4CQDA 5AHMA 1XYZA 1ELSA 1FWHC 3WH7A 4HOZA 2X1IA 1XXXA 2OG9A 4LWWA 1O5XA 1RPXA 4KBXA 4IQEA 1GORA 3W01A 3RGTA 3V36A 2L5HA 3KEHA 3OJGA 3SN1A 5CC5A 1XIGA 4QSHA 4DAIA 1OFOA 4ORIA 4UMAA 3HGRA 2V2HA 2GYIA 1W3NA 1EHAA 2QPSA 4IJCA 2D2OA 1EP1A 1EJXC 3BLKA 2V9DA 1RCXB 4JXCA 1FWCC 1AJZA 1JUEA 3IGXA 5LYRA 1B3WA 2V3EA 1ME8A 1O5RA 2QCMA 3NQVA 1JF6A 4G7EB 4D1IA 3UXDA 4LBSA 4DF1A 2OVLA 1S5TA 5A2CA 3NQCA 3WJZA 1YTEA 1XKYA 2Y61A 3L68A 2G97A 3CHVA 5LSMA 1OG0A 3WFAA 4US5A 3AXMA 1F07A 3ZIZA 4HT3A 1C7TA 4DJEA 3S5YA 1XLFA 1TRIA 1IXQA 3H8AA 1BWLA 1R3RA 3M0IA 2VEFA 4IHCA 4KWWA 3OLGA 5BCAA 2H8XA 5D8ZA 3PTMA 1GKPA 1M3UA 4JNMA 4J3TA 2Q71A 2Z1KA 4CN4A 1HJWA 4BWLA 5H6HA 5IBXA 3V0SA 5BMXA 1EXPA 3WNOA 4R7OA 3T2OA 4PL1A 1UWAA 2OEJA 4L9YA 4FOUA 5E09A 3BCDA 4JS3A 3KOWA 1YRRA 3TZFA 1J5SA 4UBPC 3JU2A 3TSDA 1YNQA 3AIRA 1TV3A 1UA7A 4DO4A 3F5KA 5D8WA 4DUXA 3DC0A 3PN8A 2JALA 2RAGA 4CNOA 4EKJA 4IIHA 4DYJA 2CBIA 3O9NA 4HK7A 4MPQA 3PC0A 4H00A 1MW1A 5DMMA 5AVHA 1BG4A 3EX2A 2PDNA 4C6KA 4QG6A 4MTVA 5FAJA 3AYVA 3N4EA 4GCAA 4MF4A 1UD4A 4JTLA 1K7EA 3SUSA 3VXGA 2DZVA 3AJ7A 3EDDA 5FF3A 3HO8A 4XAZA 1SJDA 3SQLA 3NZQA 3TYUA 1LWJA 1VD6A 1RPKA 1ZUAX 2FB3A 3CT7A 1UJQA 2X0HA 2HK1A 2YFNA 3WX7A 1CXLA 5B80A 2CW6A 1D3CA 4UMCA 4DJDC 4OKDA 3SCVA 2HBVA 5DRCA 3WN6A 1H2JA 1QOXA 1I9CB 5M3WA 4UTWC 1DJIA 1KXQA 2O9OA 2PDWA 3FEMA 5HINA 4DY1A 2WMKA 5M1TA 2WMHA 4R85A 4EE9A 1YEYA 2Q8XA 2XIIA 1RCOB 1N55A 4EIVA 2GVJA 2V3DA 5FA5A 3BLPX 5JMUA 5AC6A 3EB3A 3WDPP 4US5D 2BMBA 4DJED 1F6KA 5AZ0A 4D1JA 2CERA 4Q22A 2NXIA 3OYXA 1W1PA 3GVQA 3G1DA 3B8IA 1N8WA 3TWAA 4C6NA 5HQMA 5A1AA 3W2LA 3TKFA 1TREA 3A47A 3DKLA 3MKCA 1UD6A 4IPNB 2RKXA 1F7BA 2QDEA 1V3HA 2O7SA 2SFPA 1DPMA 2IQDA 4KKXA 1BTMA 5D2XA 3N11A 3R8RA 1A5SA 2Y7GA 3C0JA 2NQJA 3MSDA 2BY3A 4XAFA 3ZFHA 5G2HA 1P6CA 3B0YA 4H6EA 1WUEA 3A5VA 1I75A 1QU4A 4NNBA 4K6AA 4W9TA 3VGHA 1R7OA 3AZSA 5K2ZA 3NXLA 4MVAA 3E0LA 2WZTA 1E9YB 1W3HA 1NSJA 3QC3A 2OZ0A 3GTFA 3KDOA 2J27A 3OA5A 3W7NA 3SCNA 5HK4A 1LUCA 4M5PA 3OHMB 5ABTA 3I7RA 2FDMA 3ANUA 4OBTA 2BZNA 5DRIA 6CGTA 1ONXA 1K4GA 1CLVA 4E8GA 1S2UA 3LHUA 2FZ8A 2VGGA 2ZICA 1C91A 1QUMA 2D3NA 4U2YA 4LCSA 3WQOA 3EOUA 3QZAA 1GVRA 2ZZ3A 3IK2A 1KM1A 2EKCA 2OO0A 3GKAA 4ZB0A 5A3HA 4Q6JA 3G0UA 3ZJ8A 2FB2A 1BSLA 2OR2A 2QUVA 3UW6A 1WXYA 4QE5A 4MB4A 1PHQA 2PZ0A 3GXNA 1K6AA 3BLLA 4H9YA 1ZY9A 1MQRA 1M65A 4GVHA 5MKGA 1U2YA 1J6PA 3SSJA 4LV9A 1OHLA 1EH9A 3DI0A 4EPKA 1R2RA 3GNPA 2ICSA 4C6PA 4MY9A 1Y65A 5DCBA 2W91A 1CDGA 4S1FA 5CH9A 4ZQCA 3L0GA 4MSSA 4DNMA 4YIWA 3QY6A 1F74A 3ALFA 1RXOB 6XIMA 4JTUA 3O0FA 4EVZA 4S2CA 4KW2A 3BMXA 4O52A 5F2GA 3AUJA 5BXTA 3FK4A 1FXQA 3WBEA 3PBGA 1WBJA 4JL2A 3AHTA 4Y9OA 5D38A 5BOFA 3EWDA 2J9ZA 3W1NA 1G5AA 3GG7A 1ZP3A 3AICA 3Q67A 4QQ3A 2POTA 2CLOA 4H9UA 3KS5A 4BKNA 3ZJ7A 1M03A 4JNZA 4QLJA 2KX9A 3GH7A 3GS6A 4RXGA 3IUHA 1X38A 3V16A 1YTKA 3MZ2A 2ZQ0A 4E5TA 2VEGA 1UR8A 4F8XA 2CLEA 4LUYA 4DF0A 1KTNA 1MUMA 2Y5JA 4FX6M 3UZXA 4PODA 5CGQA 4F2TA 2A7RA 1JZ7A 4ZBCA 3EWYA 4GUIA 4Y90A 4KEZA 3ATYA 5DN1A 2OQLA 4UTIA 4AWTA 2P53A 1LG1A 4V1YA 1YQ2A 4WEVX 1VH7A 1X7IA 2BB0A 2EGZA 5EKYA 4HTYA 1Q6CA 4LEQA 2QF8A 1W0MA 4MLJA 2V3FA 1XSIA 4AQLA 2JKPA 4ERAA 1V6UA 4UXDA 5D9MA 2ONEA 4MZYA 1P0NA 2EG8A 4FSAA 1KGXA 3B8TA 3E0FA 3HOJA 3W72A 4UIOA 3WNLA 2VENA 1YYAA 3LB0A 1A5AA 1OYBA 1HW6A 1F3TA 3CHCA 3MP4A 1JJKA 1XRSA 1G4PA 1C9DA 1XLIA 2DVTA 4L4MA 4DIAA 4DBSA 2WWCA 2YX0A 1US2A 4JEJA 4G1KA 4ATWA 3GVVA 2PCQA 1JXJA 3T7VA 3BG3A 1CTNA 3MANA 2VO5A 3KOZA 2G3MA 4UTMA 4AZHA 5JIPA 5BMWA 4DZHA 3RX2A 2VP8A 4QDWA 3Q58A 4MKVA 5B7YA 2E25A 1KC7A 1GQIA 4GUJA 4BS0A 3GH5A 3N2TA 1RVKA 1EP3A 3BWWA 1NF7A 1L6WA 3PZNA 2OYKA 5C2XA 3QHOA 2ZRYA 2Y88A 3NR0A 3NYZA 3ANYA 4EAYA 3U9IA 1OWQA 2HCVA 3T4CA 5JUVA 4ZXLA 1ENUA 4YL2A 4FR1A 2HXUA 1SO4A 4RZBA 3ABQA 5A8OA 2NLIA 3U5UA 1RP9A 4BA0A 5EB8A 1TPDA 2OEKA 1BWKA 1WXZA 4PB3A 4AIOA 7A3HA 1WUFA 1UG6A 3OHIA 1MW0A 2C7FA 4HA1A 1WV2A 1Z89A 3TP4A 3PJUA 1IZCA 3TOYA 5AHLA 1ZCOA 3QGVA 3N25A 1S5WA 4MUZA 1L6SA 2B7PA 1V77A 5LIXX 1WDSA 5DEZA 3CV1A 3K4WA 3BW3A 1ISZA 1M04A 4N4QA 2A5HA 1XW8A 3SGGA 4M7SA 1A5NC 1UR2A 1TVPA 2UV8G 3C5QA 5FACA 1DIKA 3H7RA 2XIMA 4XUYA 4W88A 5EMYA 2GDUA 1A0EA 2X1RA 3RX3A 1V4YA 5FSDC 2Y8UA 1RLCL 3OQEA 3IJIA 4TX8A 3W7LA 2V6AA 3IVTA 4HSHA 1Q4WA 2DUXA 2MANA 4FB7A 3ITXA 2ASHA 4XZLX 3DFSA 4AG0A 4HU3A 1F9CA 1UOZA 1UP0A 3PNUA 3UWVA 2ZCGA 3NOYA 3S9ZA 2WSRA 2PRLA 4AX7A 1WPCA 1SO3A 1T41A 2WM0A 1WA3A 4GQGA 4MWAC 1C29A 3U2EA 2FPYA 4ATDA 1TMQA 4NI8A 1T8QA 3WQ5A 1NQKA 2VHLA 1H1NA 1GYMA 1XH1A 3PWGA 4J5NA 1GOMA 2GDVA 3HPXA 1VZWA 1KRAC 1CECA 3KHJA 1A50A 3V0UA 3RM9A 4TX9A 5LA1A 3VYLA 4ML4A 2QPUA 8XIMA 4LF1A 5CSUA 4S23A 1P0DA 3CHDA 3VE9A 2Z2UA 3LY0A 3WD2A 4O54A 3QC0A 4H7VA 4YYFA 2DZXA 5AFDA 4ROQA 4NX5A 1GOIA 2QGHA 1N7KA 1K7FA 3GYCA 1MSSA 3FN9A 3RIKA 5GJPA 1H7NA 1NFGA 2ZC8A 3FS2A 3NCOA 4JHMA 4IMEA 1XP3A 1J79A 1C8VA 4JIHA 4QS6A 3QFEA 3FYYA 1CYGA 3LI1A 2EPHA 1H60A 3EPNA 4Y7EA 4Q4PA 3QZEA 1W1B1 3E2RA 4WJXA 3ZO9A 1TPB1 2X8RA 5T9CE 5C8BB 5GNYA 1VHNA 4FIQA 3M41A 1OK6A 2NX1A 3OLIA 3ES7A 4ZMGA 3NM1A 1XF0A 1EGMA 1Y8BA 4PUUA 3NXFA 3PFRA 1UROA 1E0VA 5MF5A 1UWSA 4LU0A 5AC7A 3WBXA 3NVDA 4O0QA 5CPSA 2WCAA 4TR9A 4LVAA 4PMRA 3QSRA 3CMGA 3C2EA 3GAKA 3WLSA 1FP8A 2ZZ4A 1EF2A 1E6NA 4D6GA 4ML9A 5A6BD 4JIPA 2PS2A 4JTIA 2CXEA 3F7JA