1IXNA

Enzyme-substrate complex of pyridoxine 5'-phosphate synthase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
242
structure length
242
Chain Sequence
AELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDACKRLADAGIQVSLFIDADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQELARIAKAATFAASLGLKVNAGHGLTYHNVKAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKRLMLEARG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyridoxine 5'-Phosphate Synthase
publication title Enzyme-ligand complexes of pyridoxine 5'-phosphate synthase: implications for substrate binding and catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
total genus 95
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 2.6.99.2: Pyridoxine 5'-phosphate synthase.
pdb deposition date 2002-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ixnA00
2JGYA 1RR2A 4IQLA 4K36A 1PV8A 1XCFA 3G8EA 1X1OA 5LNSA 2CZEA 1W8SA 4N9DA 3L68A 3TW7A 1KLZA 2J27A 1QWGA 4E0CA 4MFDA 4OV4A 4CQAA 3B0VC 1OYAA 3W86A 1YDNA 4TO8A 5F4XA 1F2JA 1K8YA 4DBEA 2OZ0A 2ZRYA 3OEXA 3I65A 4HKPA 3QEZA 3V75A 1F6KA 3NAVA 3O6YX 3VI2A 1TPH1 2Z2UA 3GIYA 2LLEA 2XN2A 1ME8A 3M7WA 4RKAA 1F74A 3PBYA 3QPZA 4S2BA 5H2ZA 1H5YA 4OBTA 4NNAA 2EPHA 1UASA 4GUJA 3SFKA 1YXDA 3UPWA 4IPJA 4DPQA 3RMJA 2QJGA 3LCLA 3NM3A 2V2CA 4RV8A 1X8FA 4R53A 2X1TA 2GVJA 3N9SA 4DF0A 1YYAA 5DBUA 2CWNA 3CC1A 4MYXA 2ZFAA 1FCUA 3LHZA 4FX8A 1H60A 4LC6A 4O1AA 3FYPA 2A0NA 4TU1A 3GK0A 4AXKA 1JRBA 3FKKA 1H61A 5K9DA 1XBZA 3N73A 1NVMA 1KFBA 3FOKA 3ABQA 4ORMA 3NQGA 1X1ZA 4A3UA 5F4SA 1SSGA 1WAUA 2ISWA 3T4CA 3G1SA 3UYCA 4C1LA 3CHVA 3KOFA 4RCXA 1SR9A 3OIXA 4RK8A 1KFKA 1XM3A 3SGUA 4FEZA 4GWEA 3LM7A 2JBMA 4PEKA 3TQKA 4AMAA 4ZQOA 3SI9A 5KINA 4UTUA 2G97A 3GB6A 1LRNA 3QYQA 4MY9A 4ORIA 2W79A 5HR7A 2NV1A 4Y96A 3P62A 1YDOA 1ZNNA 1H7NA 5BNKA 1M5WA 1TB3A 1FUYA 3I7SA 1K03A 4MJZA 2BZNA 4PCFA 2GPTA 1KV5A 3UQNA 4A22A 5H91A 3PWAA 2QUUA 1HL2A 3O05A 4RX0A 3T40A 3S1XA 3JRKA 4RZ6A 2J6XA 4Z0SA 3FKRA 1Z41A 3KX6A 2Q8LA 4GC4A 3NNTA 3OVRA 4K6AA 5EMUA 5G2HA 3E12A 3W23A 2DZWA 1D3GA 1R46A 3PSWA 2VFDA 4A2SA 3C2FA 1VH7A 2ZZ7A 1R2TA 1J4EA 4O1DA 2WNZA 4ICNA 4OWGA 5AC6A 1JUKA 1GVOA 3AJXA 3E9AA 4LS1A 4YCPA 4IMEA 2NX9A 2I14A 4XKYB 3T78A 1KV8A 3TSMA 1F05A 1TPB1 4ONVA 3KHJA 3EXSA 3G1YA 3WK2A 4Z1DA 1WYIA 5C54A 1OFDA 1KTBA 4GFSA 1FWTA 5D03A 5CZSA 1LORA 3CWNA 4XTDA 3VE9A 3FEMA 4LUJA 3TAOA 5HMSA 4ZMGA 2H6RA 4UTTC 4R34A 5D37A 3W22A 3NQ7A 3LHUA 4Z1CA 2IQTA 4GBUA 1S3HA 1GQNA 3UNDA 1OG0A 5HWMA 3M5YA 2NUYA 3F03K 3CT7A 3HGJA 1XC4A 4UTWC 3S42A 4FXRA 4EIVA 4XTIA 3QZEA 4U28A 3W1PA 5AOUA 3EX4A 3GR7A 3NOEA 2E77A 1IGSA 1UB3A 2CLMA 3LHVA 3USBA 5HINA 3STEA 5CPLA 1LP6A 2Z6JA 1T96A 4Y6GA 5HUPA 5IBXA 1XBYA 1TPUA 2QCFA 4LVBA 4EF8A 1VC4A 1FXPA 1SZEA 1XDMA 2WNQA 2Y6ZA 3TDFA 1XXXA 1OABA 3W07A 1ONRA 3MWAA 1QMLA 5LKYA 3L0NA 1FX6A 2CW6A 2A85A 5FF2A 2H3DA 4AAJA 3I6RA 2FTPA 3PM6A 4AVFA 4NT0A 4A29A 1O5KA 3M44A 1EA0A 5KZMA 4CQ8A 4M19A 1G69A 1RQEA 2B7PA 4JXCA 4PL1A 4NNCA 3MO7A 3NVTA 3O6DA 2E5BA 4NXSA 1P1XA 2DJLA 1H7XA 4TX9A 3TU9A 5CZTA 3GNNA 3W6YA 3EWWA 3LXBA 4DF1A 4NX5A 3GVGA 4JTLA 2X2GA 2ZRZA 3NL2A 2ZA2A 4PC8A 1FDYA 3RNDA 1LM1A 5AC7A 5G1YA 4LV4A 5D2WA 1G4TA 2OCZA 2Y7DA 5F1UA 1EP3A 2C13A 1MEWA 4I7UA 1OFRA 5E93A 3W2LA 1I2PA 1T99A 2EAWA 4UTKA 3M0ZA 5G4WA 1I45A 1H62A 2ZTJA 4JX5A 3HB9A 3OVPA 3LHWA 4QAIA 1ZAHA 4O57A 3RF9A 3W7JA 4TMBA 3U6WA 3V1PA 4NUWA 5F2MA 3R2GA 2GVGA 3TFXA 1OJXA 1GOXA 5DCEA 4JTSA 3H54A 2D73A 4EWND 4FX7A 1VCFA 5DXYA 3PR2A 3IVSA 4FF7A 5J5RA 3M47A 3L21A 3PG9A 1KFEA 1ZY9A 1W56A 4BR1A 1K8ZA 4RZ4A 3NQMA 3GAKA 5DBTA 2A4AA 1QPOA 4QQ3A 1MXSA 4JTUA 1Q6RA 2EKCA 2FB3A 4UR7A 3LLFA 4MPQA 3R89A 1WOBA 3NG3A 3MBDA 2RKXA 3QW3A 1S5WA 3W7EA 1D9EA 2GQAA 4XKYA 4JN6A 2QCLA 2V2HA 4K8HA 1TV5A 2VEIA 4JTEA 3S1VA 2TYSA 3HG5A 2QF7A 3N3MA 3WJWA 4AF0A 1CW2A 4YXGA 3NQ2A 2B7NA 3C56A 3EX2A 3A21A 2TRSA 3O07A 2DORA 3VKJA 3HPSA 2WNNA 3LCXA 5AHFA 3W7MA 4MZ8A 4ADTA 1VYRA 3E96A 1DBTA 3PB0A 1T8XA 4NU7A 5AHEA 2NX3A 4JEQA 1LYXA 3TJLA 1OX6A 5AC8A 1TREA 4MIMA 3DHDA 1OHLA 5C2XA 3PSVA 5D09A 4DF2A 1KM2A 4AHPA 2E68A 2QJHA 5F2GA 5F2LA 4DQWA 4K38A 3E0IA 2DP3A 1YDVA 3N14A 3G1DA 4O18A 4NQ1A 2G5WA 3LCIA 2F84A 1K3UA 3STGA 4MKNA 4ZQPA 4DO4A 4FB7A 4YMZA 3T7VA 3F4WA 3DFPA 1KTCA 3MI6A 3EX3A 2RHGA 1X6UA 4P61A 4OGZA 2KZHA 2JKAA 5AYZA 4LWWA 1OFPA 5J5DA 2ATSA 1W5OA 1SZGA 4JY9A 4KFOA 1WV2A 1TYGA 4Q32A 4UMCA 2R14A 5D33A 3MBFA 4Y9AA 4OQVA 1DQWA 4AWTA 4QJ1A 5CKSA 1O60A 2Z1BA 1FWNA 4ALDA 3LBMA 1H7WA 4AH7A 3TH6A 4LVDA 3UY7A 1S5TA 1Y0EA 4JX6A 4CNNA 1JUBA 2NXIA 5E1QA 1LRTA 4QISA 3TQVA 3OBKA 5FF0A 3C8FA 1PIIA 2ZTKA 3W7CA 2B7QA 3IIXA 5FF3A 3PG8A 4N4QA 2XN0A 4I7WA 1DHPA 2V81A 3BW3A 1GPWA 2X1SA 1VCVA 4MZYA 4GUGA 2A7PA 4UFLA 2VFHA 3DI1A 2FIQA 1UUOA 5K2ZA 1L6WA 3P81A 1G4EA 2NWRA 3BO9A 1B4EA 3B04A 4O28A 1SW7A 4GXMA 4LVFA 5L6UA 2HS8A 2QR6A 3TSDA 2BXVA 2Y61A 1OX4B 1TPVA 4I9AA 3PC0A 1YTDA 1EWDA 3IVUA 3LLDA 1TJRA 3NPUA 4HNTA 4MLJA 1DOSA 4M7TA 3DFSA 3RLUA 2V9DA 1W31A 1V5XA 3CPRA 2E09A 3ABSA 5AFDA 4QSHA 5F4WA 3TIMA 4UNLA 4HSNA 1TRDA 3BPWA 5SWUA 2CFFA 4HPXA 2JK2A 2Y63A 2PCQA 4BI7A 4UTTA 1VGAA 2YFOA 3MP3A 4DPPA 1MO0A 3IVTA 3C61A 3TSBA 3CIWA 3CIXA 3T44A 1WA3A 3HJZA 1FDJA 4UTWA 3KXQA 1GG0A 4Y90A 2VFIA 3FLUA 3LXAA 4E2DA 3MUXA 5EBUA 3TW6A 1G6CA 1BEUA 2DZUA 3W7HA 1LBLA 5KSWA 4JY8A 3UWYA 4NJGA 3CQ0A 4S1FA 2QAPA 5EL1A 3S6DA 1UBSA 1QR7A 4O12A 3ZWSA 4LTSA 4E2BA 3TQ0A 2FPVA 1QNVA 2A7RA 3IRDA 2V0TA 2X1UA 3R13A 3DBPA 1LBMA 2QCDB 3W1QA 3LRMA 5TIMA 5CPNA 1TCDA 1K7EA 1GYLA 1RV8A 1FWRA 3Q94A 4JYFA 4EVZA 3GDTA 4WZHA 4JTKA 1K02A 3M6YA 2YPIA 1R2SA 4IUOA 3KRZA 4Z1BA 3I7QA 3C6CA 4RXGA 3EWUA 4FNPA 1SUXA 4WD0A 3DKJA 4JIPA 1UUMA 1TV7A 1YXCA 1DORA 2B0MA 3M5VA 3W1TA 2J9XA 3UZJA 4OE7A 3HPZA 3LCFA 3IIOA 3KVKA 5LHFA 4LVGA 1SFJA 3BVJA 1SZFA 3BG9A 4EF9A 2R91A 1ZAJA 1OFEA 2QDGA 2Y7FA 3W72A 4O16A 1Q6LA 3LHTA 1ME9A 1SSDA 3MI3A 4PTNA 1OF6A 3NQ8A 4UCGA 4FO4A 1EUAA 3BARA 3A24A 4K8EA 3G24A 4U4MA 4DO6A 3UXAA 5FEWA 4HPJA 3IV3A 3QRHA 5DCBA 1ZCOA 3DFNA 2H3BA 3TK7A 4NJIA 1SO5A 3L0KA 2RDTA 4NZFA 3TJXA 2YXGA 4YL2A 1KM5A 3QQ1A 4IX0A 3TCEA 4X22A 3MI2A 3TROA 1I4NA 2HMCA 2YFNA 3G18A 3QQ0A 5AHMA 1G7UA 1KM4A 3P60A 4DEFA 1JJKA 1HO1A 2CZDA 1C9DA 2TPSA 4E38A 1HG3A 1QPRA 3TX9A 1TQXA 1WXJA 1FQ0A 1W5NA 3L66A 3Q2DA 3F4NA 1PHWA 1Z42A 2WQPA 1BWKA 5LNUA 3GZ3A 3IIZA 4JIQA 4IMDA 3EWYA 2I1OA 3UWZA 4RZ5A 3P5ZA 4IGHA 1H63A 1NF0A 3LTPA 4C1KA 4ZQNA 3HOJA 5CZ0A 4WJEA 3G22A 3NL5A 5T26A 5U7SA 3D0CA 3ELFA 4XUGA 1KLYA 3C2EA 3W76A 8TIMA 3LERA 1NEYA 1O95A 3M43A 1KW1A 1TPC1 4O50A 4O1CA 2Q3RA 1SZNA 3TC6A 5KZEA 1YPFA 1XKYA 1PHQA 1WX0A 2QCGA 2GOUA 2WOQA 3S8HA 2RFGA 2E6DA 4K37A 3SJ3A 5LNRA 3DFQA 3BW2A 3DKLA 3BG5A 4LS0A 5HWJA 1F6PA 4O19A 1O5XA 3WFAA 1FCQA 1GVFA 1W5QA 3C2OA 3Q58A 3DAQA 2NWSA 4HSOA 3JR2A 5AN7A 3THQA 5FEZA 2FQIA 2Z0IA 3P80A 1OVDA 4HN4A 2DU2A 3GNDA 3O6CA 1OFOA 2QCDA 4IX2A 5CG7A 3W1AA 1DVJA 3M41A 2A6LA 1OFBA 2YW3A 3G1XA 4NX0A 3NZRA 3CLMA 4WXYA 4FHAA 2AAMA 2Y70A 5HULA 5DY2A 4JICA 4IMGA 2J9ZA 4JR5A 3CM4A 3PAJA 1GT8A 6TIMA 2ZA1A 3HG2A 1W3IA 3O63A 1L6YA 1OFAA 1EIXA 2CZ5A 5KMYA 1XUUA 1QOPA 5K4ZA 3G3DA 5U4NA 4W9TA 3C2VA 2CLHA 1LDCA 4PA8A 1H7RA 5I3HA 4AWSA 5AYXA 2B4GA 1TO3A 3LRKA 4O52A 5I3IA 2NXHA 3ANYA 4H6KA 3UWUA 1E51A 1I2NA 4N9BA 2E5CA 5DY3A 1VYPX 3CWOX 5I3KA 3R8RA 3VNDA 3L65A 2ZYFA 4LY8A 4WY0B 3VCRA 1KM1A 1MZHA 3HG4A 3KRUA 3GYEA 1W1ZA 2PC4A 3L9CA 4PH6A 4RLIA 4O0ZA 4JTGA 4LNYA 1YPIA 3GDMA 5HUOA 2J9YA 3THAA 1KTNA 4HIBA 1DJNA 3MHFA 2QAFA 4O4VA 1W37A 3LCHA 3W1MA 3L0GA 3NL6A 4UTLA 1TPDA 1UCWA 3NR0A 3W1RA 3LI0A 4O1BA 3ZWTA 3C3NA 1GJPA 5AHNA 5HQEA 4HT3A 1O4UA 4MJMA 5D04C 5F2IA 4BWLC 2C1HA 5CSRA 2CLOA 4GUHA 4JTJA 3LXCA 5LNVA 3EX6A 3W1UA 2VENA 1AG1O 3LDVA 2ZCGA 2NUWA 4M6QA 4WUIA 2CLKA 5D05A 2G95A 2YGYA 1JRCA 1GTHA 1Q45A 3O15A 3EEGA 4DO5A 4UC5A 4MLRA 4GUIA 3G1AA 4WX2A 4UXDA 3JS3A 4ADUA 1Q3NA 1R30A 3EB2A 4TMCA 3EWBX 4FX6M 4AHQA 4FNSA 2AGKA 1M7PA 4OT7A 3TV8A 3UWQA 4O53A 3A9IA 3FFSA 1KBJA 3SY5A 3NPXA 1ADOA 3W2MA 4H3DA 4CNOA 4MOZA 1OFQA 5BMXA 4QM1A 4KKXA 3W7LA 2CLFA 3AO0A 5CSSA 3KFTA 1P4CA 2YCEA 5I3GA 4LRSA 1JR1A 2V5BA 3MHUA 2ZZ6A 4RXFA 2QCEA 1S5VA 3BGJA 1ZHAA 3MJYA 2ZRVA 3HBLA 3MP5A 3T55A 4FIRA 4AB4A 4PODA 4ZQMA 2Q8ZA 1U83A 4WXZA 1LLZA 4JX4A 3RK8A 5IM51 3BK0A 1YTKA 3P82A 3S5OA 3LCWA 1I2QA 3LTYA 3NYZA 3QM3A 3ZR4A 2DZTA 3R12A 5HNRA 1A5BA 2FPYA 3N34A 3GDLA 1GEQA 3SECA 1YXYA 4J9JA 4NVTA 3QJAA 2I9EA 1VHCA 1I2OA 2PE4A 2XFWA 2WV8A 2CZFA 3S1WA 4YLWA 4LC8A 2OX1A 1ICPA 1XBVA 1F7BA 1XUZA 3W7NA 3TXZA 3W7IA 3WJZA 1AW2A 2P1FA 2Y85A 1W3NA 1W3TA 3GXNA 1V7YA 3DGRA 4O14A 5FF4A 1LCOA 4FNRA 5D2XA 4I7VA 3QC3A 4JTHA 3NO5A 2E1DA 3MW7A 3K30A 3M1ZA 2VELA 5CPOA 5D38A 1BWLA 4MZ1A 4N6EA 2ZZ3A 4ZQCA 2P10A 3BGGA 3W85A 1G67A 2JKPA 5D2VA 3W2UA 4N4PA 1ZENA 3LRLA 1GVRA 3SSJA 4GNJA 4O8RA 1JCMP 2A2IA 1B9BA 1KM3A 3WK0A 2VEMA 3R5EA 5HJLA 3QMTA 2O7QA 1ZFJA 5K4XA 1IIHA 4MUZA 1OK6A 1G4SA 3P84A 4M7SA 1WDWA 1TTPA 4QNWA 2ZQ0A 3TFCA 2GJNA 1VQTA 3G0SA 2YW4A 1MEHA 2V5LA 4N9CA 1TIMA 2YDAA 5K3VA 2BX7A 3BLIA 1EB3A 2X30A 1HUVA 5TQLA 4AWUA 4B5NA 3LOTA 4JGDA 3C4UA 2H8ZA 5F1VA 4QITA 1A53A 3H53A 5FI8A 2V30A 2AQWA 3N19B 3B03A 2VEPA 2V82A 1EWEA 5FF7A 3A23A 5BMWA 1H7PA 3M16A 1VR6A 4HHPA 1EP2A 3BW4A 1JQVA 3WJYA 4M6VA 1JCJA 4MYAA 1QOQA 4LUIA 4UUIA 1OF8A 2YYUA 2UV8G 3PB2A 4LOCA 3W3OA 2WSQA 3QW4B 4DXVA 3W71A 2NLIA 1ALDA 1FWWA 3BG3A 2NV2A 1FCBA 3KVMA 2JKEA 3GX9A 4FXSA 3QPYA 2DZSA 1LOLA 3DI0A 2C16A 1A50A 4GE8A 2PRMA 3PUDA 1OX5A 2QJIA 2HTMA 3L67A 5E0KA 4YCOA 3SZ8A 4UR8A 1N55A 1PVNA 4PFMA 3S5YA 3NEVA 2VKZG 3OVQA 4MY1A 3HO8A 4RJEA 3NQFA 1RZMA 3QH2A 3W7KA 2QCMA 2QUTA 5EPDA 2GJLA 2QUVA 1MEIA 4N6FA 3W9ZA 3IGXA 1IF2A 1RQBA 1VPXA 3MYOA 4O0KA 5LZLA 3EX1A 2CLLA 3EWZA 1GYNA 3NA8A 1P0KA 4OV9A 5D02A 2YYTA 4KFPA 3W2KA 4BI5A 7TIMA 3UZ5A 3W1LA 1JULA 2QCHA 3I68A 1QCWA 2PRLA 3OG3A 3NXFA 3A5FA 3KVLA 1B4KA 3ZFHA 4NZJA 2OMAA 1BTMA 2E5DA 2EF9A 4X3ZA 4Z1AA 1OYCA 3LV6A 3PVFA 3NQCA 2E6YA 2W0UA 3TNOA 3CB8A 1RQHA 2B7OA 3F1QA 2RH9A 1L9WA 5G1TA 4S2CA 2F7FA 3B06A 2OT0A 5FEPA 4K39A 1W5MA 3NZ1A 3ATYA 3DENA 4FNQA 1J2WA 1YLVA 1NF7A 3EKZA 4UMBA 3WK1A 2FLIA 3KVJA 4BWLA 3LHYA 2R8WA 3HGRA 1QAPA 6ALDA 3HGSA 1VLIA 2E6AA 2EGZA 4Y8FA 3TAKA 3W7DA 4UTMA 5G2IA 4NJKA 3S9YA 2ABBA 2A7NA 4O54A 3W2NA 3QMSA 1YTEA 3W84A 2CLEA 4MVAA 1GTEA 4WY0F 1LRQA 4TIMA 2VOMA 3GR8A 1H1ZA 1JUEA 3PS7A 5KITA 3PF3A 1XI3A 2Q3OA 5LHEA 4NXKA 3RLVA 2ZZ5A 2X16A 4GRSA 4O4WA 2VXNA 3NQAA 2ZDRA 5D2TA 3S5ZA 1PCWA 2Y88A 1TTIA 2W6RA 4D2JA 4UTJA 3NGJA 4IOTA 1LOQA 4ZZ9A 5TBOA 4KFNA 4WOQA 3PBWA 5EKYA 4GUFA 3P5YA 4MFEA 1I8JA 2C19A 2WO5A 1RD5A 2X1RA 5LGZA 3G3MA 3LGEA 1AMKA 5AHIA 1P0NA 3EWXA 3FJ6A 3VE7A 3FS2A 3N2XA 1B3OA 1OX4A 4WQ6A 5EYWA 1AL7A 3NDOA 3PUEA 1H50A 2HS6A 2DZVA 3L2IA 3LV5A 1TPWA 2DZPA 4N9EA 5AHLA 3NL3A 2PURA 1QDSA 3L5MA 5D30A 5G4EA 3DH7A 3C0JA 1Z48A 3TMQA 5G5IA 1K8XA 2TMDA 1BKSA 4O10A 4UTIA 1HO4A 1EPXA 5DCDA 2Y89A 4X2RA 2C6QA 1A5SA 3L5LA 1VYSX 3W7QA 3TMLA 1PS9A 3YPIA 4TR9A 4WOZA 3ATZA 1XL9A 5I3JA 4AEOA 3UPBA 1FDZA 4Z08A 3B0UX 1H1YA 5K9CA 3G1VA 1TV8A 3B05A 1F5ZA 2ZZ1A 2CU0A 1EUNA 5BRBA 2FFCA 4JTTA 1RVGA 1GG1A 1M7OA 2BWGA 5CZJA 5KZDA 2HSAA 3O16A 5DLCA 4M5PA 2NX1A 4FNTA 1EX5A 1G4PA 3W7OA 2JGQA 2ZA3A 3WK3A 3FIGA 1LBFA 4H4IA 4KWVA 3BLEA 1KFLA 1VHNA 4AF0B 2QCNA 1LROA 1VLWA 3DFOA 3ABRA 2GUUA 2VC6A 1ICSA 3O06A 5A5WA 5FEXA 3BLFA 1MSSA 3LTSA 3IGSA 3O8AA 3SGZA 1A5AA 3NM1A 4JNMA 3TE9A 4JYDA 1VRDA 4UFIA 1DJQA 1GWJA 2DJXA 5FESA 3IGUA 5MHBA 1Z44A 3A22A 4CLMA 1KM6A 3B8DA 1LTDA 2ALDA 3CTLA 1KM0A 5I3FA 1F76A 4OHQA 3S1UA 3ABOA 1JCNA 2CLIA 1DL3A 2A1YA 3G0UA 3TXVA 2ZZ4A 3E49A 3DFTA 3W1XA 3G1FA 4LU0A 3DU0A 5D2YA 3W87A 1TPFA 3LCGA 1TQJA 1C8VA 4ZQRA 3WJXA 1A5CA 1EP1A 3UWWA 3UD6A 5BOOA 2QCCA 3GKAA 3M9YA 3OHIA 4P2VA 4EOUA 2Y7GA 3I7RA 5D32A 5K7JA 4IXXA 2XN1A 1XFBA 2C0AA 4JDBA 2WSYA 3VFLA 2PRHA 5LGXA 4UNKA 1OK4A 1P5BA 3LBCA 2C3ZA 1FWSA 4XBKA 3EXRA 4K7VA 1SW3A 3P8IA 2QKFA 1VS1A 4IWWA 3DXIA 1VZWA 1AK5A 3C2RA 3P61A 1TRIA 1AL8A 1JQXA 2C18A 3CEPA 1IXPA 1WQ5A 5BW6A 4UFMA 2BLEA 3NQVA 4YWIA 3PULA 2E6FA 3LX9A 1LZOA 1ZAIA 2ZBTA 3RU6A 3NQ6A 3GXPA 1SW0A 2O7SA 3SR7A 1TTJA 2J24A 4R7JA 5LNWA 4LW7A 3WJSA 2H90A 3GDRA 3NQDA 1IXNA 3CU2A 1IXQA 3BV4A 1KFCA 3U8GA 2WKJA 4XWUA 4X9SA 3E02A 1GVQA 3HPXA 3W7RA 3B0PA 5AB3A 1TTQA 4CCDA 1KFJA 3QFEA 3N2MA 1AW1A 1NFBA 4JD4A 3NQEA 4BK9A 4IPIA 1SO4A 4MY8A 5HWNA 3TKFA 3G0XA 3MHGA 4UMAA 5G2WA 3P74A 3KAOA 3SIZA 3GDKA 4G1KA 2VFFA 4O17A 5DXXA 3GAYA 1SPQA 3HIJA 2ZRWA 1ZALA 2Z6IA 4DBDA 4ZL1A 3TA6A 4L4MA 3MYPA 3SW6A 2ISVA 5DN1A 1CI1A 2TSYA 4ADSA 3GXTA 2ZZ2A 1W54A 2ZRUA 1ML1A 1W5PA 3W70A 5HR6A 1KBIA 1RPXA 3G8RA 1LOSA 4NJHA 4HNUA 4ML9A 5EA9A 4JTIA 1D3HA 3NPWA 3W83A 1IXOA 2VFGA 3DHFA 2R94A 3HQ1A 3FJLA 2RDWA 2YX0A 3PY2A 1SO6A 1QO2A 3P67A 1QFEA 1U5JA 1DV7A 1UJPA 2ABAA 1X7FA 3O1NA 2Y7EA 4R33A 4JTFA 3W1NA 3QF0A 4A2RA 4HNNA 1QPNA 3M5XA 1K7FA 3ZS4A 3W88A 1GVSA 4LV9A 4ZVJA 3KRSA 2C15A 3UXDA 4XBSA 1SU5A 3A5VA 3RFAA 1W0MA 2C14A 1FXQA 2YZRA 1XDLA 4LS2A 3LB0A 1TSIA 1J5TA 3PUOA 3B4UA 5LSMA 4AHOA 1C29A 4WY0A 3G1HA 4RR4A 4BFAA 2OT1A 4L4LA 3INPA 3TR2A 1R47A 1N8FA 2ATMA 3W2JA 4XZ9A 2OJPA 3DZ1A 2NZLA 5L9FA 1VJIA 4IXHA 4FNUA 1IIGA 1LLWA 2VEKA 1SFLA 3U2OA 2P0OA 3OA3A 5CGQA 4Q33A 1TMHA 4BF9A 1DQXA 4CQ9A 1DKWA 1WOAA 2G96A 1PCKA 4O15A 1EEPA 5C5YA 3Q37A 2YR1A 2RDUA 3HGOA 1AW5A 4O11A 3FA5A 3W7PA 2BSLA 3GKFA 1ICQA 3H55A 4OU1A 4M6PA 2QEZA 3N9RA 1NSJA 2NUXA 1N7KA 4UIOA 1JCLA 2Y62A 1ME7A 1Q6OA 1SQ7A 1I2RA 4LVAA 1JCXA 1PE1A 3C52A 3MMTA 4LT9A 1FBAA 5ABTA 3QSTA 1THFD 2NXGA 1PL9A 4JYEA 3W73A 1M6JA 3W75A 1FY6A 1YADA 3QSRA 3MP4A 4NNBA 2EHHA 4UFHA 3NPVA 2H8XA 1L6SA 1TPEA 4XQ6A 1R2RA 4IJBA 5IBXC 2FJKA 2A6NA 5AYYA 1G7VA 2ISSA 1L2UA 1KA9F 1TJPA 5EY5A 1JVNA 4JDYA 4UFJA 2VFEA 5KTLA 3S0CA 4PL2A 1CX9A 4K7YA 3EKLA 4IMFA 4UFKA 1VCGA 4GJ1A 1QO5A 5A8GA 3IIPA 2ZRXA 4IMCA 1WBHA 4Q4KA 5GVJA 3UWVA 4HNVA 4UTHA 2A21A 3HF3A 2GVLA 2GQ9A 1JCYA 2V8ZA 5C6MA 1Q6QA 4LRTA 3P8JA 4POCA 3CEUA 3M5ZA 4A21A 1K7XA 1SO3A 5K9XA 3W74A 3QMRA 1HTIA 3TC7A 3IEBA 4FIQA 3P7YA 2FB2A 4Z0JA 1FCVA 1GZGA 4BI6A 1ZJIA 1NAL1 2A5HA 3UY8A 3TUUA 1H7OA 3STCA 3FYOA 3PBVA 3L5AA 5CPMA 4QIUA 4N2YA 2DZXA 3IIVA 3STFA 2BTMA 4CCEA 4CCCA 1QPQA 1OYBA 3HG3A 3W7GA 2J88A 3LI1A 3S5NA 4KWWA 1XBXA 2V2DA 1H51A 4NJJA 4O13A 5C55A 2GQ8A 3EXTA 1F73A 1HFBA 2WPBA 5DELA 2FDSA 4N02A 3GLCA 2FPTA 2WSRA 2YSWA 4JS3A 1O94A 4CNPA 3HMJG 1T0OA 2WJZA 3PBUA 1WBJA 2QDHA 1B57A 4QNEA 4DELA
chains in the Genus database with same CATH superfamily
4RDYA 2D1ZA 2JGYA 1RR2A 4IQLA 2I16A 1J0IA 1N8WA 6XIMA 1KD0A 2J27A 2F2HA 4W84A 4PULA 4TO8A 4DBEA 2OZ0A 2ZRYA 4HKPA 3I65A 3NAVA 1TR9A 2EPKX 2LLEA 4IL2A 1JCTA 2BY3A 3MSDA 4XAZA 2P0IA 1JPHA 3ANVA 1UASA 4A4AA 2F8QA 2QJGA 1S5NA 2QVHA 3LCLA 5CC7A 4DF0A 1YYAA 2CWNA 1UJQA 1QTWA 4GY7A 1H60A 1TWWA 3GK0A 4AXKA 4XUYA 3A9BA 5I5RA 1TWSA 5K9DA 4DWSA 1PDZA 3NWRA 2J8TA 1KXVA 1KBKA 4ORMA 5A2AA 3NQGA 4J27A 7REQB 3C2YA 3OVGA 4GIRA 4QCFA 4RCXA 1HJVA 1FWBC 1MVYA 2ZUWA 4W85A 1KFKA 1XM3A 2J7CA 1PXGA 4JTQA 1Q4NX 3WH8A 4ZQOA 1F8MA 1TJ0A 3CUHA 3TLQA 1JZ7A 1UKOA 3URNA 3GB6A 4H9YA 4RPPA 3L2MA 3SM0A 2QUMA 5CBIA 1OCBA 5JUVA 2W27A 5BNKA 1FUYA 3ZVIA 1K03A 1KV5A 3H4GA 3PWAA 2OGYA 5AECA 4QJ4B 4XKMA 3VIKA 1XW8A 4ILSA 2WYSA 2ACRA 1IEXA 5T8GA 1XLJA 2IKGA 5CLWA 4GH3A 4QLJA 2DZWA 2VFDA 3G5EA 4GY0A 3VOIA 1WKFA 5E5CA 2J47A 1DTUA 1GVIA 4H6RA 1GVOA 1EC9A 3W81A 3B9DA 4CD8A 4XKYB 4Z2GA 2VR5A 4GO9A 4DRSA 3OO2A 3G1YA 3WK2A 4U2YA 2UZ9A 1MI3A 1LORA 3UGVA 1NQ6A 3A3HA 5HMSA 2J7BA 1OT1A 2H6RA 3RO8A 2PDQA 4UTTC 3W22A 2IMRA 2B31A 3EMZA 4C6MA 2IQTA 2W61A 1F3XA 4A8IA 1GQNA 4A3RA 5C8BB 1OG0A 2NUYA 3JVAA 4UTWC 1UZDA 3C8NA 2WZHA 3E3HA 3S42A 3WF4A 4EIVA 5DEZA 4LPCA 2FTYA 1A5MC 2C71A 4DLFA 4H7ZA 4OECA 1B1YA 1BFNA 3EX4A 5FJUA 2J4GA 3NVDA 4FAMA 3H2FA 3WQVA 4UNIA 3STEA 2Z6JA 1UPMB 4HB7A 5FSEC 1T96A 4Y6GA 5IBXA 1ITUA 3L7RA 4LVBA 4EF8A 1VC4A 4AEFA 3TDFA 1XXXA 5FJPA 3W07A 3L0NA 2Z1SA 3RCMA 1QHZA 3I6RA 1CZ1A 4IH3A 3WLKX 2PBGA 2B7PA 4IJRA 4PL1A 3CUJA 3NVTA 3O6DA 7REQA 4L9ZA 2DJLA 2VEFA 4MWAE 1Y5XA 1ISYA 2AMGA 1L6GA 2ZXAA 4WR3A 3GNNA 3D46A 1XH1A 2Z7KA 1DPMA 3MMDA 4OUIA 3QTPA 4AIOA 3GNOA 3RNDA 1DHKA 5G1YA 2QT3A 4ES4A 2Y7DA 2PDFA 5DO8A 3PZVA 3W2LA 3QZAA 2PFHA 3ITVA 3Q4DA 1I45A 2C0HA 5CZKA 3A4WA 1DWJM 2P50A 2PWHA 1XS2A 3SY1A 1QHOA 1ZAHA 3RF9A 4TXEA 3V1PA 1LLOA 2QZRA 1XRVA 5JBDA 2Q71A 3R2GA 1E1CB 3TFXA 1OJXA 1F8IA 1Q6FA 1YEYA 5DCEA 4JTSA 1JYWA 1V6UA 4EWND 5DXYA 3PR2A 2CXEA 4C6FA 5HXMA 5J5RA 3VNKA 1ZY9A 5M1TA 3KOYA 4RZ4A 3QV9A 4RPQA 3BLPX 2F38A 4BEUA 3RM4A 1GZ1A 3U2EA 3ISIX 1JNDA 1WOBA 4B4FA 2XGIA 3QW3A 4LJ3A 3OJGA 5A69A 2W63A 1HT6A 4XKYA 1QXLA 4JTEA 1Z69A 3WJWA 4YXGA 4B5VA 4K68A 1BKHA 3C56A 1RLCL 2YXOA 3O07A 2DORA 1E9YB 2JFEX 3TN3A 5AHFA 3MVIA 3QR3A 2VD9A 2D24A 1XC6A 5BOFA 3QKEA 4JEQA 5CH9A 4NAEA 3TJLA 2NQ5A 1H4PA 1OGGA 1TREA 4MIMA 3DHDA 4FLRA 3W0KA 1KM2A 2E67A 5EU9A 4AHPA 4DQWA 1OIMA 4K38A 3VGHA 3G1DA 3K4DA 3V4BA 4TQTA 2XFFA 4XVEA 4Q6XA 4ZCWA 4H9MA 1HKIA 3WMBA 3BMXA 3WLQA 1O68A 2O9RA 3TN5A 3HTWA 1UMYA 3EX3A 2RHGA 3M0VA 5TD4A 1OFPA 2XINA 1CT5A 1SZGA 4F4RA 2PTXA 2OTDA 4JY9A 1JDFA 5D33A 3MV01 1F3WA 4AWTA 1VIZA 2Z1BA 3WQ6A 1R85A 4ALDA 1V93A 2PDLA 3ECQA 4PSRA 3UY7A 5AYBA 1J0HA 8A3HA 4NKCA 1TE6A 3GTIA 5E1QA 3TQVA 3OBKA 3VZXA 4DWSD 1PIIA 1EJWC 1UP3A 5EMMA 2XN0A 2AL1A 4ROQA 1MRAA 3BW3A 4JN8A 4G5DA 4GUGA 1L6WA 3P81A 1G4EA 2NWRA 1P0BA 1B4EA 4EAMA 1SW7A 3PTKA 4GXMA 5L6UA 2HS8A 2QR6A 2VUNA 3FCPA 3BSHA 1GHRA 1OX4B 1MW0A 1YTDA 4G7EB 3OLEA 1E1CA 3MCMA 4PB3A 1W31A 1XKJA 1UKQA 4JFWA 3ABSA 4UBPC 2C7FA 3RYSA 2XYLA 1Q63A 4UNLA 3AYSA 4U5IA 3T07A 4HPXA 4R9XA 4S38A 2JK2A 3VKDA 3RU8X 4BI7A 1VGAA 1JPMA 4ZXOA 1QW9A 3MP3A 3MVTA 3HJZA 2CNCA 1FDJA 5IFTA 5H6HA 1V6WA 3MUXA 1UWTA 3W7HA 3W6MA 1LBLA 2YL8A 5KSWA 4D6JA 1W1A1 5GNZA 1YNPA 2OYKA 3LA4A 3LM3A 3M0XA 4S1FA 1RBLA 5EL1A 4JQ2A 3S6DA 3H2CA 4YIWA 4O12A 3KCLA 2EXOA 3TQ0A 2DSWA 4Y9MA 1R3WA 3R13A 2QCDB 3PJTA 3LRMA 4O8AA 1K7EA 1GYLA 1PO9A 2VGBA 4CD7A 2X2YA 3WLLA 3WDHA 4HYVA 3BANA 3S6OA 1UG6A 2E9MA 1R3TA 5HNUA 3BGAA 1IQ8A 4RXGA 1VFOA 4FNPA 4PB5A 2YBVA 4PUNA 4WD0A 6XIAA 1MW3A 4GABA 1W1TA 1TV7A 1YXCA 2VP8A 2J9XA 2WW5A 4NIRA 4OE7A 3HPZA 3N6QA 2C8NA 1K9DA 2R24A 1SFJA 4EF9A 2QDGA 2Y7FA 3W72A 2PDIA 4O16A 1Q6LA 3LHTA 1SSDA 3LPOA 4WVXA 2QDDA 3NOYA 4K8EA 2QPUA 4CGTA 4DO6A 4C6OA 4HPJA 4XZBA 3WLOA 5DCBA 2WK2A 3SURA 4DHGA 2TAAA 1GK8A 3RHGA 2GK1B 2YXGA 3OBAA 1K9EA 3GVRA 4KBXA 1KM5A 4GYJA 3KBNA 3TCEA 4X22A 4AVNA 3EA3A 2VR4A 2BVWA 5DMMA 3FEQA 1KM4A 4EACA 4DEFA 4OBRA 4XK2A 2PLMA 2QV4A 1K4HA 1U5VA 5GQBA 3F4VA 4E38A 4GA8A 3UXKA 3TX9A 3MMUA 4YN5A 3UVAA 3Q2DA 1TV2A 5LNUA 2ALRA 2O4QA 1NWTA 1H49A 3GH4A 4GQQA 4D6CA 3AZTA 2OO0A 3RX4A 3IRSA 4IGHA 3JU2A 2FGZA 5CZ0A 4G7EA 5T26A 2MANA 1Q7MA 2BOGX 4XUGA 2D3LA 3AMGA 1WDSA 4LH8A 1O95A 3P14A 4O50A 4O1CA 3M6DA 2Q3RA 4DN1A 2GDUA 3ZIZA 3TC6A 1RY0A 1XKYA 2GOUA 1B0IA 2I5GA 5D4YA 2RFGA 3ITXA 2Z7GA 4DJEC 1ZCCA 4C6EA 1OT2A 4HGXA 1M68A 2ZICA 4TV5A 5M03A 3MSGA 4O19A 3M4HA 3WBXA 4AC7C 3DAQA 3KS5A 5AN7A 3AXHA 3ARZA 4WCJA 5FEZA 4Y2WA 3SRFA 1OFOA 2QCDA 4IX2A 1DVJA 5HNTA 3GC4A 4PSPA 1UR3M 2WMIB 3M41A 2YW3A 2GSHA 3CLMA 3SN0A 3KCOA 4JICA 5I06A 1DQUA 2J9ZA 3CM4A 3PZMA 5TNVA 4F48A 2PGFA 1L6YA 4S39A 4ENLA 5KMYA 5K4ZA 3G3DA 3SGGA 1CGWA 1XISA 5U4NA 3WL0A 1W9PA 4GMEA 4J35A 4H6KA 2E5CA 2OQYA 1VYPX 3CWOX 5BROA 3R8RA 1O1HA 4KIEA 5A8NA 2ZVIA 1CXFA 1KM1A 1QASA 3U3HA 3HG4A 1KFWA 3L9CA 3H2MA 4O0ZA 3APGA 1P6WA 1OSEA 5HUOA 4W7UA 2R1LA 2QF8A 2C79A 4O4VA 1H41A 3HFYA 4CUCA 1J9YA 4UTLA 1TPDA 2PDBA 3NR0A 1M1BA 3C3NA 4JNYA 4LEQA 4HT3A 5IXEA 2OO6A 4GUHA 4JTJA 1ZU8A 3LXCA 1UH4A 1GOKA 1KWGA 1K6WA 4M6QA 1BXCA 2G95A 2YGYA 1HL8A 3F5JA 3SB0A 4I9MA 4LX4A 4WX2A 4ADUA 2DUXA 1G5AA 3FXYA 3EWBX 3CQHA 1HKJA 1M7PA 3QXBA 3UWQA 3KOZA 1V6XA 1DJIA 3SY5A 4D6EA 3VD3A 4H3DA 2YKKA 4DJED 4QLLA 3AO0A 4IP7A 5CSSA 1HQTA 2VR2A 1P4CA 4I3GA 4QHRA 2YCEA 1RSCA 5M2FX 4RXFA 2QCEA 1S5VA 2FTWA 3MJYA 4GBDA 4RDZA 4AB4A 1LT8A 2Q09A 4DAFA 4PODA 2WHKA 3CV7A 2Q8ZA 4H8NA 3BH4A 3RK8A 1JZ2A 1BSIA 1I6NA 6CGTA 2PDHA 4G8TA 1OC5A 3LTYA 2OU4A 2HRWA 3QM3A 2XIQA 2DW6A 1Q65A 2FPYA 3GDLA 2NT1A 1GEQA 1YXYA 4US6A 4J9JA 3HQPA 2I9EA 4B5XA 3W38A 1I2OA 1E9LA 1HNYA 4NRRA 1K9TA 2XFWA 5LIUX 4PB4A 3BMVA 3S1WA 4R7OA 1AUSL 4YLWA 5CG0A 5EMYA 1XG4A 1CTNA 3RG6A 1AW2A 1W3NA 1V7YA 4HCLA 4E4FA 5D2XA 2WC7A 3TYAA 4CVWA 3QC3A 3BAYA 5CSUA 1GOWA 3M0YA 3VKAA 5LIYX 3BLDA 1G0CA 5CPOA 3WD0A 1BWLA 1I75A 4U2ZA 3GXDA 3HZ3A 2OFJA 2Z1WA 1G9HA 3BGGA 3W85A 2JKPA 4E8GA 4OOZA 4Z42C 2E7FA 3NCOA 1GUVA 4DY1A 3LRLA 1A4LA 2MUCA 3BXWA 4L7ZA 4GNJA 4YTRA 1Z89A 1KM3A 3WK0A 3REQB 3NO1A 2VEMA 3O0FA 4P7RA 3QMTA 4DZHA 4F0HA 3NZGA 5CC5A 2A3EA 3QVQA 1EGMA 2V6AA 4YYCA 3UCQA 4MNJA 3TFCA 3BOLA 3LQLA 4N9CA 1TIMA 2YDAA 4R3UA 5TQLA 1DWFM 3A3XA 5DT5A 3CUXA 1RJRA 5F1VA 4QITA 5JBFA 1A53A 3PJWA 2V30A 2AQWA 3B03A 2C1IA 1UKTA 5A2BA 1KRMA 1H7PA 3AWOA 4JTRA 1B2YA 4HHPA 1SGJA 2ON3A 3Q67A 2X40A 1JCJA 4MYAA 4DJDC 2YYUA 2WSQA 4DXVA 2EJ1A 4Q7IA 1HJWA 3V3WA 1FWWA 1FWIC 4HHMA 1FCBA 1PIGA 1RJPA 2C16A 4GE8A 2CWXA 3PUDA 1OX5A 3B8UA 2HTMA 4YCOA 3SZ8A 4UR8A 1UZ1A 5B80A 3W82A 3BAKA 2A3CA 4MY1A 3HO8A 1RZMA 3W7KA 1L8NA 2QCMA 2QUTA 2QYGA 2QUVA 3D47A 4N6FA 3KS6A 2FGLA 2WZTA 5A2CA 1E70M 4S3GA 3NSNA 5LZLA 4YHGA 2J66A 1AH3A 4JKKA 1BVZA 3NA8A 5C2CA 1PJ9A 2YDQA 2YYTA 1XIBA 4JAWA 5EMJA 5HMDA 2E3ZA 1JULA 3I68A 4CN4A 3GXIA 4H6QA 3WDPP 4JQ4A 1C92A 2E5DA 1Y7VA 4KCTA 2WC4A 3CASA 1ZBKA 5KETA 4OIFA 4HD5A 2B7OA 2F7FA 2Z2AA 5FEPA 3URBA 4J1OA 3ATYA 2WHLA 3EKZA 3OZYA 1MXDA 4EPBC 1XGDA 3LHYA 3VM7A 4XAGA 4HU4A 4HVXA 3AUOA 1XWYA 4Y8FA 5J04A 3W7DA 1QNOA 1YTEA 3CV1A 4TIMA 3EGJA 3PS7A 5KITA 1YE4A 1S2CA 2RDXA 4GINA 2D0HA 3UR2A 4O4WA 2HXUA 5D2TA 1ELSA 1PCWA 1TTIA 1Q66A 2CPUA 2FHCA 1LOQA 1XH0A 2W66A 5PTDA 4J3UA 3AMCA 5ECUA 1A0EA 1UR0A 2VYOA 1AMKA 4P7OA 4DJDD 3WH6A 3SCSA 3FJ6A 4WQ6A 3P2VA 1EJRC 3PUEA 1U1HA 2AL2A 1Z3NA 4H8HA 4ROPA 1HP5A 2WVVA 3OLGA 5CGTA 1YNQA 2QVNA 4P5UA 2PURA 6A3HA 3MKKA 1RK5A 5DFAA 1JYVA 1EIBA 1M65A 4MNLA 1IZKA 3C0JA 1WZKA 2HZGA 4TOQA 1XG3A 5GNXA 3S1GA 3WBEA 1HO4A 1P6BA 2Y89A 2PLCA 4GIAA 2C6QA 4FS9A 5CBJA 4AY7A 1VYSX 1CENA 3YPIA 4IT1A 4RDWA 4TR9A 3TCSA 4QBXA 4ZEPA 1XL9A 4AEOA 4L6OA 5B7YA 1TV8A 1TCMA 3P0WA 2J7HA 1RVGA 2W9MA 4F0LA 1KKOA 4GZJA 4E4UA 3PWIA 4FNTA 1EX5A 2HXTA 4JIEA 3SN4A 4WF7A 1UP2A 4GJJA 1AFSA 3EPNA 3WK3A 1LBFA 3WZ0E 5AC4A 3KLKA 2VCBA 3VNYA 4WGHA 2FDMA 1AJ2A 1ISVA 4F8XA 1PKLA 1W9VA 1H2JA 1K8CA 2YXXA 4GQRA 3IK4A 3XINA 1WDPA 5HNNA 1IR1A 1ICSA 1UWUA 4JNMA 3G77A 4ICMA 1NFPA 3VIHA 2D3NA 5JU6A 1DJQA 1GWJA 1MDLA 2D2JA 5MHBA 3BL3A 1VPYA 1YE6A 1KM6A 3AISA 2NSOA 3U7BA 5I3FA 1F76A 2VGGA 1JDDA 1U30A 5T9CE 5E9XA 1GKRA 1JF5A 1OC7A 3DFTA 1TIWA 5BXRA 3BQ5A 4AISA 1S38A 3W87A 1TPFA 4ZQRA 3TWAA 3R11A 1A5CA 1XF0A 1EP1A 4NHVA 6PTDA 1PX3A 3UWWA 1TJ2A 2QCCA 2Y7GA 3FYYA 1E4LA 2XN1A 4H01A 3E5BA 4UNKA 2GWGA 4PYSA 4GI8A 4AUBA 2FHFA 4TVDA 4ZOBA 4IWWA 2Y8UA 3TYCA 1NELA 1C3FA 3DXIA 3C2RA 3WQDA 4DYJA 2BDQA 1B3XA 3WLTA 1ISXA 1IXPA 3AFBA 3ZR5A 4UFMA 3S9IA 1EDGA 1WUEA 3AYVA 2HV5A 1SW0A 2O7SA 1BXBA 1UBPC 4S3EA 3V1HA 3S2JA 1TTJA 4RE4A 3CTTA 3WJSA 3M0HA 2ZX6A 2AKZA 1QHPA 3BLKA 5HMFA 1WUFA 4XWUA 3W02A 1J96A 4IGSA 8XIMA 2BY2A 1KFJA 3N2MA 4BK9A 3QOKA 1KCXA 3H2AA 3MHGA 2VUYA 3GDKA 1V0NA 4MGGA 5LXEA 3LD5A 1FFRA 3GAYA 3ITLA 2IPFA 4RE3A 4DBDA 3HPFA 2ISVA 4FR1A 1GKPA 1VD6A 2VJXA 4R88A 3H21A 3LPGA 4G7FA 4ADSA 3VABA 2ZRUA 3T2OA 2E4TA 1JNEA 1KBIA 1RPXA 1PB0A 3L12A 4UQ9A 5CQ1A 4NJHA 4JTIA 1JD7A 1O66A 4P7QA 3VIIA 1SO6A 4W4QA 4CD5A 1R87A 1DIDA 2DEPA 1QO2A 3P67A 3Q45A 5I23A 2WMFA 1UJPA 3JUGA 4A3HA 2ABAA 2PLJA 4DUWA 3QF0A 3B9EA 3EDFA 3M5XA 2P53A 1F4HA 3KCJA 1GVSA 1EH9A 4LV9A 3DESA 1FP8A 2CBJA 1SU5A 3SSZA 1Q85A 4LXFA 1WKDA 3K5XA 4FXFA 2VC5A 4RR4A 4L4LA 3QR0A 3WIJA 4GXPA 3TR2A 2A3HA 4QEEA 3CAQA 1HKMA 3AYRA 3VFCA 3AS2A 5L9FA 1VJIA 4IXHA 4FNUA 1IIGA 1LLWA 2VEKA 4D9PA 3U2OA 4K3ZA 4NZ5A 2Y8KA 3M0KA 3MZ2A 2VQUA 2BHZA 2PC8A 2PWGA 1DKWA 3SJNA 5IOBA 3DG3A 1KRCC 3IJQA 3VMPA 1XIIA 1EKOA 3NSMA 2BVDA 1N2VA 1J6PA 3RR1A 2RDUA 1JZ3A 2VWTA 2BSLA 3GKFA 4A8LA 4JCLA 5GPRA 5JH2A 3H55A 2XZ7A 1W3LA 1GZJA 4KIRA 3VDHA 4ZTYA 6REQB 3KL0A 1TUXA 3PZOA 5MF5A 1QW8A 1I2RA 2OX4A 4LVAA 5ABTA 1ZJBA 3QSTA 1CXEA 2CLPA 1PL9A 3EDDA 3OGVA 2PCEA 7XIMA 1YADA 4P8UA 4S23A 2YBUA 1UPPA 2OLSA 2EHHA 4UFHA 3NPVA 1QJWA 3CHDA 2FJKA 2A6NA 1G7VA 5EY5A 4XB3A 2VOTA 2AMXA 4Q8QA 1CWYA 1H1NA 9XIMA 4KQNA 1CX9A 4K7YA 2PDWA 1FHLA 1VCGA 5A8GA 5FJTA 4AZ6A 1AQ0A 5GVJA 4Q4KA 5A6BA 2DSKA 2GVLA 2GQ9A 2V8ZA 1LQAA 4YYFA 3VD7A 3CEUA 1W3JA 2HEJA 4DZ5A 4CQCA 2OOFA 1QATA 4IF2A 3EBVA 2FB2A 3FDKA 1PYFA 1FCVA 1GZGA 3VDBA 1OG6A 3WD4A 4AEEA 1H7OA 3TUUA 4XSLA 4HA1A 1MFUA 5KZ6A 5FACA 4QIUA 4N2YA 5FJRA 4CCCA 4ZBCA 3MKVA 1OYBA 3W7GA 2J88A 2D69A 5HPCA 4KWWA 1H51A 4NJJA 2HE5A 5C55A 3DYMA 3L4YA 3S4TA 1KCLA 3I3DA 2WSRA 3R0UA 3UR8A 2ICSA 2GJRA 2WJZA 3PBUA 2QDHA 1B57A 1GQIA 1O1ZA 2VRQA 1XJBA 4Q4QA 1PV8A 1MW2A 1X1OA 4Z2LA 1FOBA 1W8SA 4PTVA 4N9DA 3CIVA 2PWEA 4E0CA 3AXMA 1A5KC 4OV4A 3PPGA 1YDNA 5F4XA 1K8YA 3V75A 3QEZA 3GIYA 4QE4A 1ME8A 4RKAA 3PBYA 4QS6A 5H2ZA 2J13A 3GNRA 4OBTA 3N12A 4FZIA 1UMLA 1E43A 1EZWA 4LCQA 4JFSA 4IPJA 1UR8A 4C6QA 1FWHC 2OB3A 5D9OA 1BXNA 4RV8A 1X8FA 2GVJA 2YBTA 3EA2A 3U0HA 4MYXA 3U9IA 2ZFAA 1FCUA 3CZLA 4FX8A 4RV3A 1RJQA 3FYPA 4PTXA 3E0LA 2DT2A 3VUSA 5LA2A 4ATWA 3LSCA 3POHA 2E28A 1NVMA 2DDXA 6REQA 4L1GA 1WNOA 3UERA 4GYPC 5EMLA 5F4SA 3R79A 2ISWA 1C91A 4LB4A 3GS6A 4GYKA 4C1LA 3KOFA 2IKJA 1JF6A 1S3TC 4RK8A 1NH6A 4IQEA 2BGQA 4FEZA 2IPGA 2JBMA 2O4MA 3SI9A 4J28A 3BZGA 1B90A 1LRNA 4MY9A 1MNSA 4ORIA 2R82A 1KQZA 3MSRA 3GC5A 1ZNNA 2OQHA 4D6IA 1TB3A 3G6LA 4C7DA 4MJZA 4PCFA 1F07A 4C65A 3VIMA 2QUUA 4RX0A 4AY1A 3ICJA 1L2QA 3T40A 1DJGA 2WM1A 1MQQA 2AAAA 2POTA 4FSAA 4LUSB 3S1XA 3BAIA 5BRPA 2J6XA 3FKRA 2INZA 1Z41A 2PDXA 3B9OA 3KX6A 2Q8LA 4CD6A 4JZ5A 1DIOA 3NNTA 3OVRA 2WCAA 4BZYA 5CSYA 3W23A 1D3GA 1W17A 1XIJA 4KEZA 4A2SA 5C7VA 3UFYA 4YTQA 3HV8A 4H83A 1R2TA 1J4EA 2WNZA 3GFYA 1TR1A 4ICNA 5AC6A 3O3RA 1X7IA 3C86A 1M53A 2PZNA 4H9VA 1IZCA 3PZTA 2ZUNA 1FKXA 1UHVA 2GOKA 1TPB1 3KHJA 1E6NA 5C54A 3AS1A 1OFDA 1F6YA 4TTUA 3I6EA 5CZSA 3T9PA 5C71A 1DJWA 4ZMGA 1YX1A 3LHUA 4GBUA 1NIUA 4OFCA 1S3HA 1QW7A 2EPNA 5HWMA 3M5YA 3T2QA 2J7FA 2AQOA 1OADA 4XIMA 3TWBA 4DXKA 1ISWA 1GOQA 2JIEA 2WB5A 4FXRA 1REQB 3KDNA 2ZADA 4ZSTA 3LZ5A 3T81A 1VKFA 1IGSA 4GFIA 4KCWA 2QCFA 1K70A 2VQTA 3THUA 3SUSA 2Y6ZA 4EK7A 2Z1VA 4BQ2A 1ONRA 2D2OA 1QI5A 5LKYA 3EPOA 1FX6A 1XLMA 2DVUA 3A6OA 5FF2A 2H3DA 3PM6A 1E71M 4GIEA 1XSJA 4AVFA 1JAEA 3M44A 3GG0A 1EA0A 1PWLA 3GIPA 1PTGA 3BE7A 3ARWA 1QNRA 4DWDA 4NNCA 3MO7A 2E5BA 4BS0A 1EGZA 4NXSA 2E40A 3W6YA 4HA0A 4NX5A 3GVGA 5LYRA 5LXXA 1YNYA 4JTLA 3GTNA 3O6AA 1I1WA 4MADA 2G4FA 2ZA2A 1FDYA 1KR1A 3KOXA 4LY4A 2AGTA 3NIYA 4C90A 2WZIA 5F1UA 4I7UA 1OFRA 4D8ZA 3S47A 1X1NA 1I2PA 4HCHA 3EDKA 3SO7A 2GGEA 3EPMA 4US5A 3IAPA 3TOPA 4JX5A 3AOFA 1BHGA 3HB9A 2DH2A 4PZVA 3CNYA 3LHWA 1E3ZA 1BG9A 4O57A 1BF6A 3S3GA 2XVPA 2QJJA 1FA2A 2NQZA 3WG6A 2VX5A 4ZR8A 4LUSA 3H54A 2D73A 5ABHA 4FX7A 1POJA 4A6GA 3L21A 1KFEA 1W56A 4BR1A 1K8ZA 2YCJA 3NQMA 3GAKA 2GVEA 2EPMX 4QQ3A 3GU9A 4JTUA 1Q6RA 3PP7A 2EKCA 2JF7A 4UR7A 3R89A 5CJ5A 5FSDC 1UR1A 1OQFA 3L23A 2GQAA 3F2DA 1JI2A 3AQUA 1TV5A 3S1VA 2TYSA 1EC8A 1CW2A 1M3UA 3ABZA 2B7NA 1US2A 3VKJA 2WNNA 1N8IA 2FGBA 2VDGA 3W7MA 4ADTA 3QY7A 1R9ZA 1DBTA 4NU7A 1V3IA 3WFZA 1OX6A 5AC8A 3TTEA 4DJFC 3MO4A 1TVPA 2EEXA 1UR4A 2VI0A 1T6MA 4ERIA 2QJHA 3TZFA 3PBMA 1REQA 4B2DA 4O18A 5FA5A 2G5WA 3LCIA 1K3UA 1QVBA 4DO4A 3QV7A 4H9ZA 3V0SA 1EPVA 4D8AA 3KP0A 3ZMRA 3GH7A 3F4WA 3HQNA 3M0LA 3MI6A 3CUZA 3GFXA 4QDWA 4P61A 3DX5A 3L4VA 5DT7A 3MCNA 2V5DA 4UB9A 1JIBA 4LWWA 1ADDA 4K1WA 1J5SA 3V36A 3P3BA 2IPJA 2ATSA 1W5OA 4KFOA 5C9UA 2P3EA 3WBWA 1TYGA 3A4AA 3H70A 2R14A 4QLKA 2Y5EA 4OQVA 4Q4SA 1ONWA 5CKSA 4F79A 1FWNA 4UQCA 3G1RA 3BV7A 4AH7A 4LVDA 4JX6A 2ZE3A 4CNNA 2CKSA 3D5HA 1P7TA 3UA3A 1LRTA 1Z32X 1JGIA 1P0EA 1CGYA 2C91A 2QUNA 2PWFA 3FVDA 2ZTKA 4YTUA 1RY8A 3C0QA 5FF3A 4N4QA 5TAOA 5CAKA 2YB1A 1TA3A 2V81A 5FJIA 1GPWA 3GBEA 1VCVA 3GVVA 4LCSA 4MZYA 3LMZA 2A7PA 1NWUA 2VZTA 9CGTA 2UY4A 2FIQA 4HNOA 3UJSA 5K2ZA 1A0CA 4Q8WA 1O5QA 2BXVA 1HW6A 1TPVA 4I9AA 4E2OA 3PC0A 4DVOA 4JQ1A 2RGLA 3NTYA 3IVUA 1TJRA 3NPUA 4V2XA 4IP5A 4MLJA 1FWJC 4HSHA 1H11A 3SAZA 3CPRA 3PPFA 3AXXA 3IV8A 1TVNA 4QSHA 4PUKA 3TIMA 4HSNA 3KZSA 5I00A 5SWUA 1VPQA 2Y63A 4EP8C 1QI2A 2P8CA 3IVTA 3TSBA 1VIWA 3CIWA 3CIXA 4KT2A 4UOZA 3KXQA 4ZB0A 1GG0A 1DTNA 2HQAA 3LXAA 1QBAA 5EBUA 2DZUA 1QK2A 4KPLA 3VZYA 1VEPA 3RPDA 1XIHA 2W92A 3UWYA 3WX7A 4NJGA 1RAKA 2OSYA 2QAPA 2YLLA 4FALA 4DJFD 3DECA 1QR7A 4LUTB 3BLOA 3ENLA 2XZ9A 2FPVA 3D3AA 3IRDA 2NQLA 5TIMA 4GIYA 4GVGA 5BCAA 1K02A 3IJ7A 3G2GA 4Q4PA 4U33A 1X6NA 2XHYA 4BCEA 5BWFA 1PIFA 1ONEA 4NP7A 3C6CA 2V63A 2YOCA 4KWUA 5C70A 2X0HA 1PSCA 1XRFA 1XLEA 2PDYA 1UUMA 4ZO7A 3TOYA 3K4WA 4B5SA 3M5VA 3W1TA 5HJXA 1J8VA 4ZENA 3GHRA 4LFYA 3UZJA 4MWAC 1EO5A 5LHFA 4LVGA 1JD9A 3MT1A 1Z9AA 3EKGA 1MUMA 1ZAJA 5D9NA 2P5NA 1A5NC 4DZAA 5D8WA 3LEPA 2XM2A 1OF6A 2VL4A 1CGTA 3A24A 3QLDA 3G24A 3UXAA 4PTDA 1WDRA 5A6LA 4GG9A 4Q8NA 1SO5A 3FAXA 4L6DA 4NZFA 3TJXA 1S39A 3F7JA 1OD8A 3V7PA 3S5SA 4JKLA 3RPMA 3WUBA 4JIRA 3R25A 1IT0A 3AMDA 1JG9A 3G18A 3QQ0A 2XUCA 2ZOXA 1G7UA 3P60A 1K77A 2I7GA 1JJKA 4C6LA 1AQFA 3N15A 1QPRA 1YDYA 3RX3A 3F4NA 4LF2A 4PMYA 3QKZA 3WUFA 1EOKA 1CIUA 4JIQA 4I8DA 3EWYA 3VIOA 3UWZA 4RZ5A 3P5ZA 1TWZA 1H63A 3QY8A 4EANA 1XDJA 3G22A 4IQJA 3CMGA 5U7SA 3D0CA 3ELFA 2BGNE 5CPTA 4GISA 2Y1HA 1KLYA 2FZ9A 3C2EA 1KO0A 4UQBA 8TIMA 3M43A 4ZB2A 5LIXX 1SZNA 2G3NA 2E6DA 1DJYA 3SJ3A 5LNRA 5CJNA 2ZX5A 3H8AA 3L4WA 3M0MA 3THCA 4C7GA 3BW2A 3CJPA 1XD0A 3WQ5A 4KCUA 4J2PA 3T6CA 5HWJA 3SADA 1F6PA 3GVWA 4C91A 1E4IA 1GVFA 3Q58A 1RP8A 3C2OA 3RX2A 1LL6A 3RRXA 4HSOA 3GU1A 3VX0A 1KNWA 1OVDA 8CGTA 5CG7A 1R3VA 3VM5A 4O1EA 2AAMA 3GHUA 3SIMA 2HK1A 2EKGA 3E1F1 2Z2BA 1W3IA 3MUZ1 3KLLA 3R0DA 1V6VA 3PANA 4MWAD 2PGWA 3AZSA 2BOFX 1XUUA 2RAGA 1QOPA 2CESA 1POKA 4I9TA 2J62A 4IFKB 2CLHA 3LS9A 4GI9A 5I3HA 2VC9A 5FD0A 1TO3A 2NSXA 3LRKA 4FA3A 2NXHA 2GSJA 4LSBA 5I3KA 4XZIA 2EJAA 4UQEA 4NRSA 3L65A 2YL6A 2ZYFA 4WY0B 5AVHA 2VTFA 3FA4A 3GYEA 2PLKA 1W1ZA 4PH6A 1R3YA 2NLYA 1RLDA 4JTGA 4ACZB 4PEEA 1YPIA 3GDMA 4HIBA 2VVNA 3WQEA 3N9KA 3MHFA 4KWOA 3CPGA 3WD3A 1W37A 4IP4A 4OTKA 3LCHA 3W1MA 4LGXA 1ODUA 3TTOA 4KWSA 1UZ4A 3NL6A 1UCWA 3EOSA 3LI0A 3PTQA 4O1BA 3ZWTA 4LALA 1O4UA 4MJMA 4BWLC 2C1HA 5CEWA 1XRTA 4UQDA 4HA3A 3HPAA 3WMCA 2VVSA 2VDIA 4YTTA 4WUIA 1JRCA 1R8LA 2JEPA 3O15A 3EEGA 5M5DA 3R7MA 1E3XA 2V3FA 4Q6JA 3G1AA 1R30A 4HNLA 2NV9A 1KBLA 4AD0A 4QP0A 4PTMA 4FX6M 1WDQA 4AHQA 3TV8A 1U22A 4D1JA 3FFSA 1KBJA 3V0UA 3H12A 5EMKA 1BYBA 5BMXA 4GCXA 3S2LA 1E0TA 3W7LA 3HU7A 1AMYA 5BOEA 2G3FA 3U5UA 1HGYA 2VURA 1BLIA 2Z29A 1JR1A 3EDEA 1Y5VA 2V5BA 3MHUA 3EB3A 1V4YA 1ZHAA 1SR0A 1XSKA 5LA0A 2XVLA 3GNPA 4JTAA 1UOKA 4C60A 3AI0A 1NWRA 2DT1A 4ZQMA 3PNZA 3MCOA 1WCGA 1PZ0A 1W9UA 4F2BA 3P82A 4HMEA 3LCWA 1AZ2A 3AU6A 1KB3A 3CHCA 1ZP3A 3GUWA 1XPYA 3R12A 3FN9A 3QGVA 1A5BA 4GZ7A 5C9XA 4HNCA 2VC7A 2GSEA 2H9AA 3VTRA 1W9DM 1RUSA 2G37A 4HHLA 2VCCA 5XIMA 4H6EA 4AD3A 4MDOA 1RD6A 4I9JA 3SUWA 2WV8A 3N6HA 3ZJ7A 3MV11 2EBNA 4GQBA 4L9XA 4IFKA 1CXHA 3VU2A 2VZOA 4D72A 1DJHA 2PWDA 2QQ6A 3TXZA 1MZRA 3MC5A 1CXIA 1X96A 5I3DA 3ORWA 3F5KA 4O14A 1LCOA 1F9CA 1VAHA 4I7VA 2E1DA 3MW7A 2VELA 1PKYA 5I02A 5D38A 3AUJA 4MZ1A 1EDTA 1TMLA 5H8UA 3KBSA 2ISDA 4ZQCA 3ZJKA 5T91A 2P10A 1RCXB 1G67A 4BF7A 2WLZA 1XR2A 3AHZA 4H7CA 3UZYA 3RPTA 1GVRA 4MB3A 3SSJA 4O8RA 1XIEA 4PCPA 1B9BA 4NF7A 3R5EA 3CZJA 4YVXA 1ZFJA 3FVMA 4UQAA 3U5YA 4DB7A 3P84A 4QNWA 3U4AA 3CHFA 3W00A 1VQTA 1MEHA 4U3AA 5I77A 3EEZA 4NSBA 1EB3A 2X30A 3GE7A 3EOEA 3RLHA 4JGDA 3C4UA 1MYRA 2PDNA 2ZWYA 3H53A 2VEPA 3CWHA 2OEJA 4REQB 1RA5A 5FF7A 5G4HC 2DUZA 5BMWA 3TQPA 5HAOA 2J8FA 3QV6A 1TWIA 3WJYA 2GWNA 4M6VA 4LUIA 5JVLA 1OF8A 2UV8G 4LOCA 5A94A 1WXZA 3PUGA 4GVIA 4Q3MA 2NV2A 3KVMA 2JKEA 3GX9A 3VNMA 3QPYA 3HQOA 4QS5A 3DI0A 1EGVA 5D8ZA 2PRMA 3WDJA 4LAUA 2OWXA 3BMWA 3TA9A 5E0KA 4Z2IA 4W5ZA 5DMYA 1UR2A 1PVNA 3NEVA 3GG7A 4LB3A 3GTHA 3NQFA 4G1NA 5EPDA 4OOUA 3FHAA 3IARA 1AH0A 3IGXA 3IUIA 1IF2A 1VPXA 3MYOA 3EX1A 4QJ5B 3UF9A 4ML4A 1LJYA 1P0KA 1FP9A 4Z2JA 3QY6A 1D2KA 4BI5A 3UZ5A 3A64A 1B3VA 2FH8A 1QCWA 1DXIA 1B4KA 2G50A 1TMQA 2PTYA 1BTMA 3OGRA 4M29A 1US3A 3LV6A 4UTFA 3PVFA 3CB8A 4HZ6A 4GCAA 5G1TA 4S2CA 3B06A 2OT0A 4IISA 4K39A 4ZE5A 3NZ1A 3DERA 4PMZA 4FNQA 1J2WA 1YLVA 4UMBA 2FLIA 3KVJA 1YMYA 1AZ1A 2Q02A 2VNCA 3EAUA 4F66A 2D22A 2GLKA 4MNKA 2R8WA 1XH2A 2WJDA 1J93A 1RK6A 4EE9A 4I5XA 2E6AA 4W5UA 1V0KA 1EF2A 2ZIDA 5G2IA 4NJKA 4WDUA 2A7NA 4O54A 4FLOA 3R8GA 2CLEA 1E1EA 1GTEA 4WKFA 4WY0F 3OQEA 2QIWA 2ACSA 1BGGA 4NYUA 3GR8A 1JUEA 2DW7A 1IWBA 4WDWA 3RLVA 2PA6A 2X16A 3K2GA 1UA3A 3MTWA 2VXNA 4M3PA 3K13A 1IHIA 4ZOCA 3NO3A 2W6RA 4WEVX 3NGJA 4IOTA 4HCDA 5TBOA 3MS8A 1LQ2A 2BXZA 4WOQA 4Y9OA 3VDAA 2V5CA 4FI4A 5EKYA 4HZ7A 4J4KA 1BVNP 4GUFA 3CL8A 2UWFA 3VKCA 2WO5A 1GW9A 2CHOA 3PZ9A 3EWXA 2WSKA 4REQA 3AZRA 4IPLA 2ACQA 5H8MA 3BTNA 2VMFA 1B3WA 5EYWA 4MAZA 1H50A 2HS6A 3TYUA 3FXGA 2DZVA 3TONA 3L2IA 5AHLA 3T2PA 2VZVA 3KWXA 3L5MA 3DH7A 2R9RA 2XIMA 3TMQA 3LK6A 1BKSA 4O10A 4B5TA 3VA8A 2EG8A 1E1FA 4X2RA 3IACA 3W7QA 3N6JA 2VGFA 4F2TA 1HKKA 3ATZA 3UPBA 1XLGA 4A05A 4PCNA 4Z08A 5K9CA 3G1VA 1MFVA 4DI9A 3B05A 2BG5A 2CU0A 1EUNA 2CKRA 1OM0A 5DLCA 3E38A 3N4FA 1VP5A 1OINA 3W7OA 2UY2A 3VOJA 3CQKA 3GW0A 3B8TA 4I8YA 4KWVA 4PBEA 4PUMA 2GJPA 5G1MA 4XAPA 2PDGA 4OBSA 1LROA 1N82A 3DFOA 3ZLGA 1JXJA 3E2QA 2UY5A 1VJZA 5A5WA 3LTSA 2WQDA 2C1GA 3UG4A 4CNSA 1V0LA 3SCQA 4UOJA 3TE9A 1XHGA 1VRDA 2PGEA 4J3TA 2DJXA 4NAEB 2OEKA 4NG3A 3WEOA 4CLMA 3B8DA 3CTLA 4BEQA 3SRKA 2QW5A 3ABOA 5GJMA 1BRLB 2CLIA 2PWVA 1OCJA 2A1YA 1TVLA 4XZLX 3G0UA 1XFCA 2OPJA 1R6WA 3TXVA 2ZZ4A 1V0MA 3UETA 2W5FA 1DE6A 4L6HA 3GHSA 3LCGA 4PCSA 4GHRA 3VIPA 3UD6A 3LZ3A 1IEVA 5C9RA 2EO7A 2VRJA 3OHIA 4P2VA 4JHMA 4EOUA 3I7RA 4IXXA 1YPXA 3CL6A 2Q01A 2J79A 1XFBA 2XVNA 1XX1A 1EO7A 4JDBA 3OA5A 4R27A 1S1RA 4GQGA 1KKRA 2C3ZA 2WMKA 4K7VA 3WQGA 1VS1A 3NDYA 1AK5A 4XD5A 2DGAA 1TRIA 4L61A 3LSBA 4IIDA 1JQXA 3AMLA 4AWEA 1B3YA 4NZ3A 2BLEA 4YWIA 2E1WA 3PULA 2E6FA 2HROA 2ZBTA 2FJUB 5DMLA 3RU6A 1J01A 3NQ6A 3GXPA 3VAVA 3A4XA 3UWEA 1V7AA 1Q6CA 2FMOA 4O1FA 4LW7A 2POZA 2H90A 3NQDA 1IXNA 3H4XA 3AIWA 1JGMA 1SZRA 4DWSC 4X9SA 2WAGA 3B0PA 4CCDA 3ZLHA 4JD4A 3SUTA 1VFMA 4B3LA 1SO4A 5BWAA 1VFUA 4QCEA 1YIXA 3G0XA 4H8VA 4KRTA 1UIOA 1FWAC 1X98A 2Z6IA 4ZL1A 3OZOA 2IUZA 3RXZA 2D23A 4Q4MA 3ZJ6A 1CI1A 1JZ6A 3ES7A 1W5PA 3G8RA 1VBUA 2HPIA 3ARXA 4HNUA 2BODX 1A3WA 1D3HA 1ZQ5A 3W83A 1IXOA 3IANA 3DHFA 1TV3A 3HQ1A 2O56A 2ONEA 3C0LA 1XQKA 2CEQA 1DV7A 1LWJA 2QMKA 1F3TA 3C0SA 3DYPA 4HNNA 2XIOA 3ARPA 4DXXA 2GGJA 4LBSA 2QGHA 3KZPA 4M1BA 3DFYA 4AD5A 3GXFA 2PF8A 1W0MA 1EZ2A 2VX6A 3NDZA 1Q5MA 1RHCA 2Y2WA 3DBNA 2VWSA 3URAA 2I5IA 3GWQA 3G1HA 1DWGM 1BRLA 4XO7A 4B3ZA 3DZ1A 2FVKA 3DC8A 2NZLA 4DNMA 2P0OA 1YRRA 5CGQA 1BAGA 3MUIA 3OODA 1FTXA 3CQJA 1DXEA 2IXUA 3B8IA 3II1A 1TMHA 2PTZA 4IICA 3VNIA 1R0MA 1FHVA 4KCVA 4RL3A 4J3VA 2WKLA 4DYKA 2Z00A 1HVXA 1EEPA 3GXMA 2YR1A 3BDKA 4H9TA 4MKVA 1NFGA 2DFAA 1IEIA 1AW5A 3FA5A 4ZGYA 4ZA0A 2QDEA 4OU1A 4TVCA 2QEZA 1N7KA 2Y62A 1ME7A 1Q6OA 1SQ7A 4CU6A 3S9ZA 1FBAA 3A13A 4BJHA 1JYNA 3ME3A 4XSMA 1M6JA 3UA4A 3KTCA 4NNBA 3VNLA 2E0PA 2VCAA 2JE8A 1L6SA 1IEQA 3TYEA 5IBXC 1T41A 4NAFB 2PMQA 1EHNA 1JZ8A 1ZBCA 4DUVA 1JVNA 4G2DA 3S0CA 3K8KA 3WQCA 1E4NA 2OOGA 4UFKA 1MQPA 3DFHA 3TTQA 4J3XA 4GJ1A 3W53A 5I2UA 1ZPTA 4PMXA 4UTHA 2A21A 1JCYA 1Q6QA 2F6KA 4LRTA 2XFYA 3P8JA 4POCA 7TAAA 5E6YA 3M5ZA 3PJXA 1HF6A 4W7VA 1C7SA 4S3AA 1PKNA 3MMWA 1CB2A 3EOLA 3ID7A 3W74A 1HTIA 4AVOA 4FIQA 3P7YA 1AD4A 4Z0JA 1ZJIA 1NAL1 2A5HA 4X61A 1F61A 4JHOA 3STCA 3UJFA 3PBVA 2X7VA 1E6QM 2L5HA 2DZXA 3STFA 1C8XA 4CCEA 1TE1A 1ZS2A 4RNHA 3S5NA 1XBXA 1H3GA 4O13A 3QC0A 3EXTA 1F73A 5DELA 2FDSA 3IJDA 4N02A 3GLCA 4ZXLA 2FPTA 1R86A 3WL1A 4JS3A 1O94A 4DNHA 2BBFA 3HMJG 2FZMA 1WBJA 4QNEA 4FOUA 4P8XA 1V8EA 2WNWA 1XCFA 4QQUA 5GJNA 3SDOA 3CZGA 5LNSA 2CZEA 2P8BA 3AXKA 1XYAA 3L68A 3TW7A 3K4AA 1KLZA 2HE8A 4MFDA 3MWCA 3CZKA 4F40A 1OYAA 3W86A 3OEXA 3WH7A 1QOXA 1F6KA 1TPH1 2Z2UA 3STPA 3M7WA 1F74A 3WQ8A 3N4EA 4S2BA 3EB4A 1XLCA 2PDUA 3UPWA 3SFKA 1YXDA 3RMJA 4N42A 1XGZA 1NP2A 3NM3A 1AJ0A 2I56A 3N9SA 1WZLA 5DBUA 1E15A 1HJSA 4DUXA 2XIBA 1WP6A 4GI4A 4W8BA 2PPGA 4O1AA 4D6FA 2A0NA 1AVAA 2R1PA 1WB0A 3BSMA 1YQ2A 3FKKA 4QG9A 3KTSA 1H61A 4AD1A 3FOKA 1YBQB 3HN3A 2PP0A 4CQDA 4F0MA 5TF0A 2Y24A 1ZSXA 5HK4A 1WAUA 4ICCX 4L1XA 3UYCA 4EPKA 3O9NA 2FZDA 4A8RA 3VIGA 3CHVA 3VZZA 1I9CB 2CZVA 1C9WA 2EPLX 1SR9A 3OIXA 1A5LC 1MUCA 2OELA 3ITOA 4GWEA 3SGUA 4NAFA 4AMAA 4CU8A 4UTUA 2G97A 1I0DA 1WPCA 3OG2A 3QYQA 4GK8A 4PUDA 3AWNA 3N13A 4PTWA 2W79A 5ABGA 2NV1A 4Y96A 3P62A 2Z26A 1ODZA 3MZNA 1WE5A 1UWRA 1W6TA 3VGFA 1H7NA 1M5WA 3I7SA 1GQJA 4W88A 4A22A 2HJPA 2ZUMA 1HL2A 5A95A 3GR4A 1Y8BA 3MPGA 4HTYA 4L1WA 3N2CA 3JRKA 4Z0SA 3OLIA 3W26A 4QGCA 3QPEA 1XIGA 5EMUA 5G2HA 3E12A 4JIHA 1QPKA 3C2FA 4W89A 1VH7A 1EJXC 4L9YA 4C6IA 3N2OA 5CPSA 1LT7A 4B5WA 3AJXA 3E9AA 4C6NA 4YCPA 4Q7NA 2YA0A 3TR9A 3AC0A 1S2UA 5EB8A 4JN7A 1KV8A 4CN1A 3TSMA 4P7LA 1MW1A 4ONVA 3SQSA 2ZVRA 3EXSA 2E8ZA 1WYIA 4GFSA 3VOFA 1S2VA 4XTDA 3VE9A 3AIBA 3FEMA 3F4CA 5CCZA 3UYIA 4XX6A 1M03A 1Q8JA 3QTGA 1XQLA 2BV9A 2E8YA 1BQCA 3UNDA 1E55A 1V03A 4QSFA 2XWDA 3HGJA 3PZNA 3VKKA 3KTXA 3CAKA 1XC4A 1UD2A 2OWCA 3JW7A 4YHEA 4U28A 3TP4A 4JQAA 2XH2A 3GR7A 2Z27A 3NOEA 2E77A 2G8ZA 1UB3A 4JL2A 2CLMA 3LHVA 4DAIA 3USBA 3OOQA 1I1XA 1BQGA 1K9FA 5HINA 4XAFA 4G56A 4NILA 5HUPA 4S3FA 1TPUA 2FMNA 1FXPA 2WNQA 4PGLA 1OABA 1S5MA 4M1RA 1QMLA 5HA7A 3DG6A 1W32A 4GVHA 4P7NA 1UD3A 1YBQA 4BQ5A 3AALA 5KZMA 1TJ1A 3MUAA 4HU3A 3EDJA 1RQEA 1PTDA 2ZXBA 1GONA 1HZYA 2G3IA 1H7XA 3M0IA 5CZTA 3HURA 4KH2A 1DP0A 3VYLA 3VXGA 3EWWA 1Z7AA 2X2GA 1XD1A 2ZRZA 3NL2A 1EJSC 4PC8A 1LM1A 1WZMA 2XPKA 1J6OA 5D2WA 1G4TA 3RAOA 3W24A 2OCZA 3WF3A 1EP3A 1XV8A 1E5JA 5E93A 1T99A 4ATDA 3M0ZA 5G4WA 1IV8A 3ZYZA 4Q4RA 4OJYA 1E6ZA 3VOCA 4JBRA 3U2CA 2I17A 1V02E 1A5OC 1QBBA 4TMBA 2TODA 4RNFA 2GVGA 3VKBA 1VBJA 1XLAA 1U33A 3HMCA 3D6NA 3IVSA 4FF7A 2VX4A 2OZTA 3PG9A 1J12A 1ENUA 2PB1A 1BVWA 1L0PA 5DBTA 2A4AA 4WJXA 1QPOA 5HBFA 2EPOA 2F6UA 1MXSA 4KESA 2ZWZA 3GZAA 2FB3A 4MPQA 1TG7A 3NG3A 1DWHM 3MBDA 1S5WA 3WNMA 4JN6A 2QCLA 2V2HA 4K8HA 4MF4A 5EBAA 1SFTA 1GQKA 2VEIA 5A8OA 3HG5A 1FH9A 4AF0A 5CAHA 3V5OA 3NQ2A 4XZHA 3SCNA 3ZT5A 2O92A 1ZBVA 5J8LA 3A21A 2TRSA 3UBPC 3HPSA 3LCXA 1PX4A 3CV6A 3WUEA 3PZGA 1IWPA 3PB0A 1T8XA 5AHEA 2W4XA 4LYKA 1CB7B 3VCNA 2ZXQA 1OHLA 5C2XA 2HBXA 3PSVA 4PUUA 2WPGA 5D09A 4PRRA 3FGCA 5F2GA 4XBJA 3E0IA 3B0YA 1YDVA 3N14A 5C0QA 3WELA 2JF6A 2F84A 3UVIA 1MXGA 4QXIA 1Q7QA 4ZQPA 3CT2A 4HMDA 3GQYA 2IQDA 4HOXA 4YMZA 4ATLA 3VNJA 4PUWA 4R7WA 3WF2A 3DFPA 2R1MA 1JXKA 3MY9A 4DYEA 3TYBA 1WXYA 2BHYA 3SFWA 3SN1A 3SCWA 5ABEA 4HK6A 3CZEA 2ASHA 4ZOEA 1UOZA 1WV2A 4UMCA 2J6VA 4HP5A 1V3MA 1DQWA 3MANA 1H7WA 3PHAA 2DVXA 4WLCA 4YJ5A 3WMLA 1JUBA 4DX3A 3ANUA 4F0RA 1J18A 1JDEA 3WLHA 4WGXA 3DN5A 3C8FA 3RILA 2GUYA 3T4WA 1HKVA 1BYCA 4ZB5A 2HVNA 4NYYA 3PG8A 5E0FA 1AJZA 4GKTA 4I7WA 1HL9A 2X1SA 4J7RA 1MUWA 3B0XA 4HK5A 2VFHA 3GUGA 1GEHA 4JPGA 3BO9A 4HPHA 1QRQA 1FH8A 4JOMA 5RUBA 4W93A 3TSDA 3AROA 4FK9A 1VEMA 2J8GA 1EWDA 4GYFA 2AL2B 3UJEA 4HNTA 4S3DA 1E40A 3AICA 2WVVB 1DEDA 1DOSA 3E2SA 3B8VA 2V9DA 3WLPA 5AFDA 1U1JA 1Q2SA 3UG8A 3R0KA 4BA0A 1C90A 2CFFA 2PCQA 4UTTA 3B40A 1PBGA 3H6OA 2YFOA 3M07A 1UYQA 1MO0A 4WJ8A 3C61A 4AZCA 3T44A 3EMCA 4UTWA 4Y90A 1X8CA 4E2DA 4GLEA 3TW6A 4LNCA 2NW0A 2V5KA 4W7WA 3GU2A 4B90A 3I3BA 4WDXA 3ZWSA 4LTSA 4E2BA 2CIPA 1NQKA 2CBUA 1G01A 1QNVA 2A7RA 4E6MA 2V0TA 3DBPA 4FF5A 2ACUA 5CPNA 4X9YA 1JL8A 4MJ4A 1RV8A 2F9RA 1FWRA 3CUGA 4JYFA 3M0JA 4WZHA 4JTKA 1I0BA 1XLDA 1W1PA 3FHQA 2P88A 4DM1A 3DKJA 4QDMA 4M56A 4DIAA 4IIFA 1JPKA 2B0MA 3WFLA 2P76A 3OZMA 1U2YA 3N11A 3LCFA 3IIOA 3KVKA 4Q8MA 3BVJA 1SZFA 3BG9A 5AYIA 4R9OA 3SCUA 1H5VA 3OHMB 5AZ1A 1ME9A 1ECQA 3MI3A 2RUSA 3NQ8A 4EPDC 3OZPA 2HWGA 4FO4A 3BARA 4U4MA 5FEWA 1XCWA 2PUZA 1ZCOA 3H24A 1RBOB 1GQLA 4NJIA 2RDTA 5F7UA 4YL2A 2HDJA 2CERA 4DLMA 3MDWA 1TZ7A 3P6LA 4W8LA 4IMAA 2YFNA 5AHMA 4D6GA 1UWSA 1JYXA 1HO1A 1HG3A 5E6ZA 4IIEA 1W5NA 3L66A 3VC5A 1PHWA 1Z42A 1TV4A 2WQPA 3GZ3A 5BXTA 3AXIA 3IJ6A 3LPFA 4GC3A 1D8CA 2I1OA 2PDPA 4AZGA 1W8GA 7CGTA 3O0KA 3FX4A 3PAOA 3WDRA 4C1KA 4MAVA 3WQPA 5EGRA 3MB9A 4WJEA 4M0XA 1DIEA 2F6XA 1BGAA 1NEYA 1SJAA 1KW1A 1TPC1 3HM7A 3POCA 3HA1A 5KZEA 4HPGA 1WX0A 2QCGA 1S1PA 1IYXA 4PUEA 2A3LA 1SYTA 4K37A 3AHXA 3DHPA 1PWMA 3DUGA 3BG5A 3LPPA 4BY3A 5I0DA 3R43A 1EC7A 4LS0A 3U4FA 3WFAA 4X60A 3N3TA 4AW7A 2NWSA 3JR2A 3PJUA 5DANA 3N2TA 2V38A 3THQA 3VK5A 2Z0IA 3L4XA 1V3KA 3O6CA 5GJPA 3G1XA 4NX0A 4IJCA 5HULA 2Y70A 4U10A 5DY2A 1DJZA 3AIEA 3PAJA 1GT8A 6TIMA 1D3CA 4NL1A 3O63A 1OZQA 4NZ1A 1NP0A 1KRAC 1EIXA 2CZ5A 4G6CA 1EL3A 3P93A 1HIZA 4W9TA 1EHAA 2V67A 3C2VA 1LDCA 4QE1A 4PA8A 1H7RA 4U31A 5AYXA 2B4GA 4AC1X 3C5QA 2DSZA 4O52A 3ANYA 1GVYA 1C7TA 4JCMA 1E51A 4N9BA 5DY3A 3U48A 1QI0A 1R7AA 4NZ4A 5A8QA 4LY8A 3VCRA 1MZHA 3FY1A 4V1XA 3CYVA 4RLIA 2PWUA 4AD4A 1XLFA 3OP2A 1V3LA 3VUPA 4LNYA 3LYEA 3H23A 4PMUA 4ZO6A 1VENA 2J9YA 4RZBA 1KTNA 3KBJA 4AQLA 2VHLA 4I90A 4D6DA 3L0GA 4IM4A 5HATA 3TJIA 1MMFA 4QR6A 3NZQA 1CDGA 4H04A 2DIEA 5HQEA 4HOZA 2R1NA 5D04C 5CSRA 2HVMA 3UU0A 2VGIA 1UH3A 5C7HA 1NOFA 2VENA 4HYWA 1M04A 1AG1O 1R9XA 3LDVA 2ZCGA 4CU7A 2CLKA 5D05A 3A47A 2WJEA 2WBGA 3GM8A 2QULA 1Q45A 4J3ZA 3BSG