2QV5A

Crystal structure of uncharacterized protein atu2773 from agrobacterium tumefaciens c58
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
246
structure length
246
Chain Sequence
LGQLPVVGADGLRPMEQYARPWSGARGTRVAIVVGGLGLSQTGSQKAIRDLPPEVTLGFAASGNSLQRWMQDARREGHEILLQIPLEPFGYPGTNPGPDTLLAGDPAKVNIDRLHRSMAKITNYTGVMNYLGGRFLAEQSALEPVMRDIGKRGLLFLDDGSSAQSLSGGIAKAISAPQGFADVLLDGEVTEASILRKLDDLERIARRNGQAIGVASAFDESIAAISKWSREAGGRGIEIVGVSALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein Atu2773
publication title Crystal Structure of Uncharacterized Protein Atu2773 from Agrobacterium Tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
total genus 89
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04748 Polysacc_deac_2 Divergent polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 2qv5A01
5JMUA 1W1A1 2I5IA 2XU2A 4HD5A 4NYUA 4M1BA 4NYYA 4NZ4A 4NZ5A 2C79A 2VYOA 1NY1A 2NLYA 1W1B1 2E67A 2QV5A 1W17A 2CC0A 3VUSA 1V6TA 3WX7A 3CL6A 4U10A 4LY4A 2C71A 4NY2A 4L1GA 3S6OA 2DFAA 1Z7AA 2C1GA 2Y8UA 3QBUA 4V33A 2J13A 3RXZA 4F9JA 3CL8A 4OUIA 4NZ3A 4NZ1A 2W3ZA 4WCJA 1XW8A 2IW0A 4F9DA 2C1IA 3CL7A 5BU6A 3HFTA
chains in the Genus database with same CATH superfamily
3PJTA 4WRHA 1YXDA 4NRSA 1XLLA 2QGYA 3BARA 4CU6A 3STGA 1FP8A 3ITOA 1PX3A 3NOYA 3VGDA 1R2RA 4BFAA 4GVIA 4AZCB 1EJVC 3NURA 1GOWA 1R9ZA 5CPSA 1BQGA 1EPVA 1L8PA 3SFWA 3CQ0A 2ZE3A 1YPIA 1XDLA 2QJIA 4OKDA 1EJWC 3TP4A 1HXJA 3BOFA 2YDAA 1WDWA 3K30A 5AHLA 1TYGA 5A2AA 3QOKA 5LIYX 5LIWX 1SFTA 4W87A 1RUSA 5I3HA 3HPZA 1JI1A 3IGUA 1SQ7A 4GA8A 3ZT5A 2ISWA 4IZGA 4PA8A 1BTMA 1KFJA 1RBAA 1X39A 4FS9A 4PL1A 3UXKA 3C8FA 2V2CA 1FDZA 4GXPA 4KEMA 1JRBA 1KM6A 4B2DA 1TQJA 3C2EA 2WPGA 1MW2A 1VFTA 3I4EA 3VU2A 1JDDA 3VOGA 3KOWA 4EPBC 3UJEA 1FRBA 1Y8BA 1KCKA 3O6YX 4QXIA 3RM8A 1QO5A 2C1GA 4LY8A 3VD9A 2A6NA 4AZHA 4J4KA 4U5KA 4GIEA 4WSKA 4LT9A 1MSSA 5A1AA 1TIMA 3SUUA 4Z08A 3OGVA 3H24A 1VFUA 1TFVA 3HBLA 4CCEA 4C6PA 4H9ZA 1UZ4A 4NU7A 5TNVA 3RILA 3CZLA 3DXIA 2XFWA 4AD4A 1AQFA 4TTGA 2GVLA 3TTOA 1V03A 3T78A 4Q7BA 2J74A 3CQHA 2OQHA 3VDAA 2BVYA 3NFUA 3WLOA 5I79A 4YL2A 2GJXB 3LB0A 3SUVA 2HBVA 4AMCA 3UG8A 4QFUA 4GFIA 2VGFA 4F79A 1GGOA 1BEUA 3ZOAA 1Q5MA 4C6DA 1R7AA 3DFSA 5J04A 3ZVHB 1CTNA 4JCLA 2D1ZA 3R11A 1CWYA 1KQZA 3WK1A 1FH8A 2EG6A 3LERA 4CVUA 4JTJA 1JCXA 7REQA 3T8LA 1BYCA 3TROA 3H2AA 5AC6A 1F3WA 4ZFMA 3OA3A 1EIBA 2OCZA 4RPPA 1GJWA 3EMZA 2WW5A 1XKYA 2GGGA 2G8ZA 4R3UA 4GQRA 2YBVA 3NIYA 2CBUA 1VCVA 3KCJA 4B3KA 1EA9C 2RJHA 4JS3A 1BAGA 3S0CA 2WOQA 4M0XA 1YXYA 3NO1A 1G4PA 1EC7A 5CGQA 3H21A 4O52A 5FF4A 4MHBA 3W00A 1TMQA 5CSUA 3WJWA 1UQZA 4AY1A 4XZBA 1UPPA 1TE1A 4IG2A 5IHRA 3IUHA 4I5UA 2ZUWA 3WX7A 2VOMA 3MJYA 4W9TA 9XIMA 3GC5A 2PDWA 4TTUA 4GFSA 2GFTA 1JCLA 3IK2A 1HQTA 1QCWA 3BSMA 4JTDA 2VM8A 4QLKA 1VBGA 1J2WA 1GTHA 3ELFA 2DZXA 2WKGA 3F5KA 4HNCA 4F3HA 3F2CA 3O9NA 4K8GA 2JGQA 3XIMA 3C2OA 3P80A 1FKWA 4URIA 4TUFA 2Y8VA 3NVTA 2XJ7A 4FEZA 3GG7A 3VDBA 1GEQA 3THCA 4HU4A 3LTYA 4ROQA 3QZAA 3T6CA 3MYOA 1KBLA 4ZTYA 3EGJA 4IPNB 4XTIA 5E5CA 1KQYA 2YJQA 5CZSA 2RUSA 2OKTA 4GG9A 5D38A 1JZ8A 3F4CA 1R3RA 2G3MA 3VX0A 4FP1A 4GQ0A 4AH7A 4XKMA 1OD8A 2A3BA 2V0TA 3DU0A 1IZKA 1K1DA 2OT1A 1QWKA 1HW6A 1UR4A 1F4AA 3G0UA 3ATYA 2Z1WA 4Y9AA 2RKXA 3PBGA 1OX5A 5D30A 3QV9A 3FVDA 2R8WA 5FKYA 1C9WA 3WL0A 1JZ6A 4J1OA 3NOEA 2O56A 1W9UA 2R91A 3TQKA 3R6IA 2REQA 2V3FA 1X38A 2QLYA 2WHMA 4AD0A 1FDJA 4OUIA 3R94A 4RR4A 1OD0A 1ZL1A 3OLEA 4C6EA 2A3EA 2WVTA 3AO0A 4H7ZA 3BSHA 4PFMA 4Y7EA 3MMUA 2CEQA 1W5NA 3I65A 4Q8NA 4CNNA 1OZQA 2OSYA 4WLCA 3GWQA 4HA3A 1FHDA 1K7FA 2G5WA 3DI0A 1S3HA 3OZOA 4LGXA 1W32A 1S5VA 2VFHA 1TWZA 1EHNA 1GHSA 1TUXA 2D23A 3I6EA 1BYBA 1JYWA 3THQA 2O7QA 1KCZA 4AZGA 4R85A 1WB0A 3TH6A 5XINA 1ZRQA 1U83A 4GHRA 3CIXA 1W8SA 3DG6A 1Y7VA 1A4LA 1KRAC 2YGYA 3DBNA 3G24A 2EAWA 3L2LA 3OVPA 4Q8MA 2QS8A 3FN9A 3MVTA 1EYEA 3G1XA 5KZEA 2ZX7A 1B30A 3LLFA 3LPPA 1UD4A 5CZJA 4CCZA 1OX4A 3MUXA 4DQWA 2VX5A 4UZSA 1Q63A 1U22A 3HTWA 1VP5A 1HKMA 3RM9A 3AHYA 3U0HA 1KXTA 2QCHA 3RCYA 4X0NA 4CQAA 1TB3A 1VFMA 3O15A 5HOSA 3KUMA 4W88A 4YMZA 4AHQA 3ARYA 1WUEA 4IPPA 1UHVA 5IXEA 3OPSA 3EDEA 3W29A 3L65A 1E1FA 2Y70A 2XH2A 3OGRA 2XINA 2HWGA 3GTFA 1GVEA 2JKAA 2V82A 4QISA 4OE7A 4IMAA 1GOXA 3TYZA 2O92A 1RPKA 1Z8AA 4RJEA 3H70A 2D0GA 3BLLA 2W79A 3TSDA 3WNKA 2X09A 4OBTA 3WMCA 3Q67A 3ONBA 1Z69A 4GIRA 3AYRA 1A4MA 5DCDA 3GC2A 1PIIA 4EF9A 2WMKA 1XM3A 3W2JA 3PVFA 1ZTVA 1PE1A 1A5BA 1R3TA 2CLHA 3NDZA 2ATSA 1UWRA 2HEJA 1OGBA 2CWXA 3ZSSA 4INFA 4O13A 1OYBA 2VO5A 3NL2A 4UR7A 3NQ8A 1E5NA 2WBGA 4J40A 2YPIA 4GYJA 4X2PA 4FALA 2FB3A 2HK0A 3CL6A 3NZ1A 3T09A 4NASA 4AD3A 1OSEA 2FJUB 3TSBA 3V1HA 1AMYA 2ZTJA 3ARQA 1W3KA 1H49A 4ASTA 5BOFA 4QS5A 1M65A 3CHEA 1B90A 1MUWA 2BHUA 3L0GA 1GCYA 4ML9A 2V30A 3ARZA 3EKZA 3M5YA 4FX7A 2I5QA 3P7YA 4H8HA 4JTTA 4GQGA 4DI9A 4BJHA 1VC4A 1DHPA 5EMKA 1IIHA 2CC0A 1JPIA 5L6UA 2WO5A 3MBFA 1E9ZB 4HMEA 4YTRA 5CG0A 4HPXA 3GK0A 3RJYA 3AWOA 1Q6QA 4M6VA 1FFRA 2NT0A 1PHWA 1NDYA 4HJFA 4J2MA 1CCWB 2RH9A 4MMWA 1TPH1 2EG7A 1I9CB 4HK6A 2HVNA 1TWWA 4DO5A 4PTDA 4AEOA 3N4FA 4QEEA 4Q22A 2I56A 2Z26A 2FZDA 1C8YA 1FWDC 2QCCA 3RN6A 2DSUA 4FR6A 3GBEA 3UPMA 2VYOA 2PWEA 1AH3A 4HK7A 3U3HA 1UD2A 4IJBA 3EB4A 3BLFA 4PEKA 3TJIA 2GWGA 1EC9A 2X0SA 5HMDA 4QAIA 1YE4A 1DVJA 2V2HA 3BLDA 1SU5A 4LB3A 3TK7A 5JBDA 3TKFA 5EU9A 3RX3A 1DQWA 3WBWA 1W2PA 3U8GA 1J6PA 4WHBA 1EYWA 1FH9A 1JEZA 2YW3A 4JTEA 3K13A 5A5WA 2E8ZA 3WMSA 5FF3A 2XGIA 1MMFA 1B54A 3QLDA 4Q4MA 5G4EA 3A3WA 3SEPA 3EDDA 3UNTA 5A6KA 3QY6A 3PHAA 1N7KA 3TXZA 3ITYA 2WCAA 3QPYA 4N7QA 3UCDA 3L9CA 3PTKA 3CLMA 4LALA 4QQ3A 5A8QA 1GPFA 1KXQA 2ZZ6A 3FJ4A 4CD5A 1E15A 3WY1A 3HQOA 3ECQA 2X1TA 5BRQA 1OFOA 2Z7GA 4UC5A 3AS0A 2R14A 4LBSA 4O1EA 3I7QA 3W27A 3N17A 4W7WA 5A8PA 1XGZA 5LIXX 1PIGA 1UWSA 5D03A 4KBXA 3A12A 3SY1A 5DEZA 3W25A 1P0KA 1I2RA 3I6RA 4JNMA 2FZNA 5LIKX 1OINA 1JYVA 1OT1A 3G0XA 5A95A 1QOPA 4LYPA 4QSFA 1VAHA 1XC6A 3BOXA 3TC6A 3CO4A 1C7SA 3PULA 5AHEA 3WQ6A 2FVLA 4R88A 5E70A 1QW9A 5H91A 1XLHA 5JU6A 4PZVA 3LSCA 3S6DA 2DIKA 1YRRA 4J3UA 2DDXA 4PMUA 4H41A 2VR2A 4WDXA 3N15A 2QQ6A 4K1GA 4FNSA 1HF6A 1CX9A 1J93A 2W4XA 4G2DA 1UKOA 4JN6A 1EOMA 4LSBA 1R8LA 3TW9A 5TQLA 2OWXA 2FJKA 1YTKA 4XV0A 5A8GA 3BG3A 1XINA 4HOZA 1QHOA 4J3ZA 5D37A 3VDHA 4C1NB 4IIDA 1QWGA 2V5CA 3WQ5A 4UOZA 4FIQA 1IXQA 2FTYA 3QPEA 3HV8A 3TYEA 2GL5A 3W1MA 1QPRA 1NEYA 3CU2A 4P8VA 2DORA 3VNIA 3W75A 1OYCA 3UVIA 5DMNA 5H1WA 1O1ZA 2YA0A 2DW6A 3T0CA 1NY1A 1K8CA 4AWEA 2QPSA 5HPOA 3E0FA 3OP2A 5U4NA 1K6WA 3ABRA 2ON3A 3C56A 4L56A 3W02A 1YNQA 4CVWA 4NAEB 3N29A 2XPKA 2R1LA 1Q85A 2WHLA 1PXGA 3GUGA 3GO2A 4B5SA 3T0TA 4O28A 2FPYA 5E6YA 1L9WA 1DJIA 4J3XA 3TZNA 2QJMA 3TW6A 2J75A 4HSOA 2VX7A 5FD0A 2ZE0A 4H19A 4LANA 4WJXA 3HB9A 1G1YA 4AQLA 5XIAA 1NP0A 4G56A 2J7BA 1ZSXA 1EKOA 4X2RA 3T2PA 2P3EA 3O05A 3GDTA 3LTPA 1C90A 1CGVA 5CBIA 3E1F1 4UTTC 1CENA 4UMBA 4KWOA 1YTEA 1DTNA 1VBUA 3GIPA 1KGUA 3AROA 1F3XA 1EDTA 4HA0A 3QC0A 4X3ZA 3QSRA 4LV9A 1RHCA 4KEZA 1WX0A 5DY3A 2P8BA 1BXCA 3Q2DA 1HL9A 2DIJA 5AC5A 2HCVA 1ICSA 2ISSA 3MV01 1W1A1 3P67A 4U3CA 1KFBA 6XIMA 1TTPA 2WBKA 4UTLA 1HKJA 1J79A 1PSCA 4NI8A 4D9PA 4TU1A 4JQ1A 3PBUA 2WAGA 2YL8A 3HG4A 3VILA 3N9RA 1AH0A 1UA3A 3GH5A 4Q4PA 1AVAA 1DJZA 5CH9A 1TVPA 5HINA 3M7WA 4B3ZA 4I9AA 3H22A 3CH9A 4AHOA 4QDMA 4LU0A 1XYAA 4HTYA 4WIWA 3SQMA 1RJRA 2QJGA 2CPUA 2DT2A 2XISA 3M0KA 3BUVA 3AFBA 3LMYA 4FLRA 3UPBA 1EJUC 1R86A 3RU6A 1K02A 3HQNA 3QBUA 5JUVA 3MB9A 3I4KA 1RCQA 3VGBA 4YHEA 3WH7A 3QYQA 2CLPA 1UH4A 4Y6GA 2VGGA 1OFBA 2PZ0A 5I03A 1JZ5A 3QTGA 2DUZA 3TU9A 1XIEA 3IANA 1AA1B 3N13A 1JAEA 3MU7A 3RFAA 1IEIA 2GQ8A 5FEWA 3KS6A 3KTXA 5HXMA 1BKSA 1F7BA 2C79A 4NAFB 3TWBA 1JUBA 4AIUA 3RNDA 2IS7A 1PL9A 3WDQA 4AB4A 3S9YA 3QR1A 1O95A 2ZUVA 2QEZA 3EWBX 1E4MM 3AMLA 2CBIA 3K8LA 4PB3A 1V3LA 4OOZA 1EUAA 3I3BA 4AVNA 2YCIX 4JIEA 2X7VA 5BXRA 3OZYA 1E3ZA 3GYEA 3H2FA 4L6HA 2VEFA 4LC8A 2ZXAA 5D02A 4V27A 3TJXA 3HPFA 4NHVA 2Z27A 3N73A 1UB3A 4UQCA 4GVGA 5CC7A 3NCOA 1DQXA 3ZT7A 2GQ3A 3R8RA 4RUBA 5CJNA 4YYFA 2PFHA 4FPSA 1TELA 3KL3A 3PZUA 1P6BA 1XBYA 1MXDA 1J96A 3BGAA 4PTNA 4D8LA 1B0IA 4MFDA 4MJMA 5TAOA 3CL7A 1Q6CA 2ZXBA 1OFDA 4KEVA 3SCOA 3O6AA 4H9XA 5LA0A 1KA9F 2VR4A 4YIWA 3EMCA 3A3HA 2OZ0A 4TXEA 3A22A 3WJYA 2WNWA 1BYDA 2OFJA 3ERPA 3IJ9A 3LOTA 2EQDA 2GK1A 4ZE4A 4GYKA 2ONEA 8XIAA 3D3FA 4C6BA 3H55A 2DUXA 2C15A 3TTEA 5I00A 1EGMA 4EPDC 3SR7A 3CK5A 3GW3A 1QPKA 2C16A 4ZSTA 3QKZA 1HKKA 1OY0A 3NGJA 1B57A 4HSNA 4ORIA 1JFXA 1T8XA 3PZTA 1A47A 3W87A 3AIBA 1H0IA 2G37A 1BPLB 4AIEA 4RNFA 5J5DA 4UFLA 1W1TA 1BWLA 4IIBA 3U6WA 3WMBA 4PRWA 4DWDA 1A5NC 4E3TA 4A8LA 4CLMA 2VGBA 1YNYA 4F0KA 4GY1A 1K03A 1TCDA 4LAMA 3TYCA 3E49A 3H53A 1LJYA 5DCEA 1FWTA 4N0RA 1PCKA 4I7VA 7CGTA 2EPHA 4N9DA 4TVUA 4O57A 3GVRA 2REQB 2EKGA 3GFYA 2EPLX 1AL7A 4IFOA 3DESA 4JTIA 3W37A 5ABFB 1LBLA 1XBZA 4AG0A 3AICA 3PZMA 1U5JA 3WO8A 3RR1A 3WLKX 1LG1A 2C1HA 4RXFA 4PGLA 2FYMA 3M6YA 5IBXA 3IEBA 3W7JA 2WMHA 4KCTA 1WXJA 3W28A 1JQXA 4M56A 2FVKA 3RX4A 1NFPA 2I57A 2DW7A 3KOYA 4QCFA 4LCRA 4F0SA 2PLJA 1ZLPA 3W88A 4N6FA 1TQXA 1YPXA 2A5HA 6TIMA 3MZNA 1EA0A 1IR2A 2JALA 3W6LA 3S2MA 2J6VA 1L6SA 1OHLA 3S1VA 2CBJA 1DEDA 1VR6A 2H9AA 3NUKA 4ZL1A 4LQ1A 5REQB 3UBPC 3NL6A 1W31A 3WQ4A 3MCNA 3M0XA 1PWMA 4US5D 3OHMB 2UBPC 2PDLA 1B2YA 2TSYA 1SMDA 4LYKA 2ATMA 2FGBA 4KIRA 4GY7A 5BXSA 1WYIA 3P84A 4HYWA 4B5XA 3E74A 3EKGA 3SRHA 2FLIA 4WGXA 3ZQ9A 4ZXOA 3WNMA 4O12A 4KWVA 2PA6A 2ZA2A 3NM1A 3F4NA 3R8HA 3IJ8A 3NR0A 4RE3A 2B7PA 4M1RA 2NZLA 3NQFA 4UTJA 2WNNA 1M7OA 3BLIA 4J5NA 3WD3A 5K9XA 4AD2A 4W5UA 1QPOA 1ZCOA 3LHZA 3ITVA 3WNPA 2CU0A 3VGGA 1A49A 3VD5A 4ZE5A 3HQ1A 3IGHX 2CLIA 5DMLA 5FJOA 3DFYA 2X1UA 1ISVA 4H7CA 5AC7A 1F73A 1V77A 5FL0A 4OV4A 1WO2A 3HO8A 3M0ZA 4P61A 1QR7A 4P8WA 1UIOA 4AVOA 4AAJA 4L64A 2NXGA 4YVXA 4ZODA 5HJXA 3KDNA 3SCVA 4Q33A 1QO2A 4NYUA 2YOCA 2BY3A 4UMCA 4CGTA 1PX4A 3FAXA 4NY2A 4A3QA 4WX2A 2BY1A 4HU8A 4EWJA 4J7RA 5HULA 3N6QA 1JR1A 5HQLA 3EAUA 3AXXA 3W71A 3W53A 1H60A 1UP2A 2FGLA 3LN3A 1QI4A 2WK2A 1ZGDA 4WF7A 3QY7A 3GXIA 3EXSA 3CZ8A 3CMJA 4CN1A 4JTUA 2GUBA 4NT0A 2NXIA 4GC3A 2ACRA 2AQVA 4UTWA 3LRKA 3GAKA 3DENA 1RJPA 1F3TA 1RA5A 1B9BA 3NZRA 4KWSA 1JCMP 1BSIA 2C6QA 1HJUA 1DIKA 2ABAA 2V68A 5H8MA 4D6EA 4MYAA 1YDYA 1OABA 4XD5A 1NSJA 3E38A 4JFWA 2PLKA 1X96A 4AIBA 3Q65A 4NZ4A 3EEGA 2JIEA 5DN1A 1KM1A 1VB9A 2XIOA 3GTXA 3W23A 4PTVA 3VKAA 4Z2HA 4IP4A 1WCGA 1V8EA 1OCBA 3JVAA 4DX3A 5JMUA 2V3EA 2BSLA 3BAJA 1V3MA 1DPMA 2I17A 4FK9A 5I3FA 2B31A 4KW2A 3K8KA 3GHRA 1DIOA 5LIUX 3WJZA 2X05A 1OC7A 3VC6A 3USBA 3W1NA 2XYLA 3MQTA 2HISA 4YTTA 5LNUA 3ARWA 1R46A 3BAXA 1Y65A 1SJCA 3N11A 3NL5A 1UMLA 5A6BA 3G5EA 2V6AA 2VFIA 1IWBA 1H5YA 1PV8A 5AYYA 3DG3A 1XBVA 2YCJA 1VQTA 4JFVA 1RVGA 3I3DA 4JN8A 2PGFA 2PBGA 3VOCA 4F48A 3U2CA 1JJKA 1W3LA 2G96A 4F9DA 1MO0A 7A3HA 4PTXA 1EIXA 1E40A 1AQ0A 3EZ4A 1SFSA 3CUZA 2YA1A 4PMYA 1V6TA 4JD4A 5A8MA 1G4EA 1X1OA 4AZIA 2J8FA 4GZ7A 4MWAA 1S46A 1XUZA 2PWUA 3N18A 2JEQA 4YNGA 1GW1A 2H90A 4DYJA 1XL9A 1XKJA 4GNVA 3SIMA 2VQUA 4BF7A 5CJMA 1KV8A 3VMOA 2ZUSA 4L1GA 2Y8UA 2CW6A 3FA3A 4Z2IA 4DJFD 2WMIA 4AX7A 4PRTA 4JCMA 4H9TA 1H1ZA 3HFYA 2X8RA 5HMEA 1R85A 1D9EA 2QV4A 1UUOA 4KF1A 4MLJA 3MKKA 1JPMA 3OZPA 3U48A 5D8ZA 1FWAC 2PTWA 1KBJA 5H6HA 1TJ0A 4PEEA 1Y5VA 3NZQA 3TA6A 3VIFA 5G1MA 2IQDA 2A7PA 3NQCA 4D2JA 3R12A 4ATDA 1X6UA 3MO7A 3BICA 4TV6A 1W17A 2J9ZA 3OBKA 3HPAA 2QULA 1XPYA 1WKEA 3LCFA 2FMNA 3CQIA 4ADSA 3E12A 2AL1A 3OZMA 4ATLA 4O18A 2GGEA 2H8XA 2J24A 2Z24A 5KMYA 1NOWA 4DIAA 3A4WA 3W82A 1SR9A 4M1BA 1KM2A 1TJPA 3QGAC 1ZCCA 1MUCA 5I09A 2YXGA 3IIPA 1JZ3A 2A3LA 2PRLA 5A8NA 1XCXA 1Q6DA 4G1KA 4LW7A 1NVMA 2WMGA 1KBKA 4IGMA 4LEQA 4R7JA 4RX0A 3FY1A 4AWUA 3BZJA 3NYDA 1UR2A 2HDJA 1Q8AA 1WDQA 3S1WA 1ME8A 4RE0A 3IACA 3IIOA 3LYEA 1D2KA 4YLWA 2AAAA 5EPDA 5FJRA 1DXFA 1XFBA 3NTYA 3U4AA 1DYSA 2FHCA 1EGZA 2OLAA 4ZOCA 4TQTA 3VE7A 4B92A 3ARSA 2CETA 4ML4A 4ZR8A 4Q4RA 2BWGA 1FHUA 1ZNNA 1HP4A 4RW5A 2VGIA 3VVGA 4AX6A 4GX8A 1E56A 3EWYA 1JYNA 1LWJA 3E3HA 4A6GA 3WLPA 2R94A 1KBBA 3MWAA 3DC0A 5BNKA 1AL8A 2WZHA 1IT0A 4NG3A 4XZIA 2WSQA 1O94A 2Y89A 4QJ4B 1TPVA 2QAPA 1QNSA 1PYMA 2PRHA 3B0VC 3QH2A 1KGXA 2OYLA 3BCDA 3VD7A 3WELA 5KINA 3NQEA 4DVOA 3QW4B 3ZR4A 2HQAA 2YZRA 4PUUA 5MKGA 3SCWA 4UQ9A 3I7RA 4HT3A 2J7GA 3DBPA 3PZIA 2KAUC 3BZGA 4QG8A 2HXUA 4RDVA 3W72A 3F5JA 4ZZ9A 4O17A 1PZ1A 5HJYA 2D2HA 3GBDA 4M6PA 3QXBA 4BA0A 3S42A 4M6QA 1AMKA 3HJZA 2DVUA 2B7NA 4W8BA 2XHYA 3T7VA 3A9BA 3Q37A 3SAZA 3V5FA 3PZVA 4P5UA 1ONXA 1O12A 5HWMA 2WSRA 3SCPA 3S5NA 3QHOA 4Y8EA 3TJ4A 2FFCA 5JIWA 2ZDSA 1UCWA 1VIZA 4B9YA 4Q4QA 2VI0A 1I2PA 3M5VA 5AZ0A 3V35A 4DZAA 1OC6A 1JDCA 3VUPA 1AUSL 3GZ3A 7ENLA 3C2YA 3QMRA 4ZQCA 2A7RA 1W37A 3MYPA 3CMGA 3GIQA 1US2A 1YMYA 2A4AA 3DG7A 4GKTA 1TV4A 2OEKA 3CUGA 3B9OA 3UR7A 3L0KA 5HNUA 1ZHAA 4MAVA 1OK6A 2FTPA 2X1IA 3LS9A 4CQCA 4QTGA 2ADAA 4LAUA 2UY4A 3CGTA 1SVDA 1H7WA 1EJTC 4WDTA 3SN1A 4GYPA 3UWUA 2CYGA 1NFBA 1J0IA 3OTRA 4TMCA 1IWPA 1E71M 1L6YA 3D5HA 2PDQA 3ME3A 3DHUA 1KGWA 1O5KA 2GUUA 2WZEA 2ZRVA 2ODOA 1PTGA 3CLWA 1H61A 3N2MA 3R7MA 4Q8OA 1IWAA 4AC7C 3MHFA 5I02A 3PZNA 5DBUA 3A21A 1QVBA 1JAKA 2OLHA 3EBVA 1DORA 3WK2A 5DX7A 1DJHA 4WCJA 2DZBA 1A5MC 5TD4A 1V5XA 3GYCA 4MNJA 3O1NA 1FCVA 4L1WA 4DBWA 1PTDA 1WDSA 3UZZA 3EA3A 1ISWA 3KDOA 2L5HA 1N82A 5U7SA 3GAYA 1W9DM 2WQPA 3BSGA 1G67A 4ROPA 3A4JA 4HZ7A 5M3WA 4LS2A 1HVXA 1NFGA 1G01A 1ML1A 3L4TA 3W24A 3AYVA 4R9XA 5K2ZA 3M44A 2XN1A 4LXFA 2J4GA 3GHTA 2RJGA 4BEUA 4MM1A 2NVDA 2J6XA 3B8SA 4GXWA 4PMOA 1XH1A 3XISA 1CGWA 1JCNA 3NYZA 5FESA 4QP0A 4IGSA 2D22A 1YDNA 4MF4A 3W7CA 1WKFA 3L4VA 4WSHA 2G4FA 1VRDA 3FKRA 2I14A 1X7FA 2GJLA 4DUOA 3BC9A 2V3DA 3CHFA 4UQEA 2WC4A 2ACUA 1PTAA 2GJNA 3KRZA 4POCA 4QROA 4IX2A 4IMEA 1OIFA 4OQVA 3QFEA 4O16A 1UMYA 4CEXC 2VELA 4GZEA 2XIQA 5EGRA 3KVJA 2V5DA 3IJ7A 1RLDA 3CUJA 5CZ0A 3H26A 3PSWA 3W2MA 3EOOA 3UCCA 4F0HA 3BXWA 3AALA 3LHVA 4DWSD 4E2VA 8RUCA 2E28A 5EA9A 3R0DA 4OU1A 1XIHA 2WC3A 2OOGA 4PCFA 2VXNA 1P0BA 1FH7A 3F2BA 3FJLA 4WKFA 2PGWA 1VBJA 5T91A 1Z41A 5DY2A 4Y9MA 2WQDA 4Z1BA 1P6WA 4OBRA 3LENA 1DWFM 2DPEA 1KM0A 2OO6A 4J3VA 3BWWA 5CPQA 4V15A 1H2JA 3W0KA 1D3CA 4RZ5A 4ACZB 3KS5A 2V9DA 1I2QA 1FXQA 1J11A 1OG6A 3AWNA 1EUNA 2OZ3A 1VBRA 1W3IA 5K9DA 3ZIZA 4S23A 3U2OA 3CUIA 3OVGA 4IJCA 2QCDB 1SFLA 4PMRA 2Z1SA 2DZAA 4O19A 1EQCA 3G8EA 3M4HA 1JDEA 1VJIA 1NWSA 3GQYA 3HGJA 3VOJA 2MANA 1DV7A 2EXOA 2XGZA 3P81A 4P7QA 4HCLA 2VFDA 2DQXA 3H7VA 2NQHA 2VC9A 2DJLA 4NJIA 3TMQA 4YPJA 5BCAA 3ABSA 2EBNA 3ATZA 1XJBA 3GX9A 3TNOA 3O6CA 5AKQA 1CBGA 3GDMA 1JI2A 3DKLA 3NQ7A 2NX1A 3VI2A 3T08A 3C61A 2FZ9A 4QE4A 2VD8A 3G1FA 1XLFA 4HK5A 3GB6A 1QHPA 3S3GA 1QNRA 4LVAA 1E6SM 3AISA 1CXFA 3RLUA 2VEPA 3G8RA 4IGHA 3ITTA 3WDPP 3WNLA 1D7FA 3PAOA 3NEVA 3JUGA 1CXHA 3DAQA 4PMQA 2VEKA 3GNPA 2O7SA 3LLDA 3NQ2A 1K4GA 1DBTA 1WOBA 3ANUA 1UD3A 3ENLA 3AXIA 4LUTA 5I77A 1GHRA 1BF6A 3CZEA 1QBAA 2X7WA 4OGZA 4A8NA 1ITXA 1KLZA 4OBSA 2O0TA 3WEMA 2NWSA 3D46A 1MQQA 5HUOA 5CQ1A 4C6KA 4V1YA 1FWJC 2VZTA 3E2QA 1GYLA 1KW1A 4MYXA 1RH9A 3WD4A 3IVUA 2BS9A 3UJFA 3DIPA 1VYPX 4IL0A 5FSEC 3KAOA 3QHMA 3S2CA 4AF0A 4J3TA 2CNCA 3JZUA 4P8UA 4MB3A 3SQSA 1SZRA 1OADA 1B3XA 1Z3NA 2I9UA 4IMDA 5TF0A 3VOIA 5F4XA 4DNHA 4XB3A 5CAKA 3W22A 5HUPA 1LT7A 1OFAA 5EMUA 2PCEA 8XIMA 4Z17A 2CCRA 2W3ZA 3SCNA 2E5DA 2Y4SA 4LVBA 2Z29A 1V3IA 5IFPA 4JIIX 1R38A 1N8WA 1W5PA 1M7PA 5BOOA 1E6QM 4QJ5B 2Y0FA 5FJIA 3TN5A 2E67A 1UUQA 3TFXA 3TQ0A 1IEWA 4LUIA 4LAKA 1VD6A 1W54A 1JD7A 1D3GA 3QYSA 4JGDA 4Y8FA 4UTKA 1S1PA 5JH1A 1XW8A 5M5DA 4XKYA 2W27A 4RK8A 4B5WA 4K3ZA 1XRTA 3BH4A 3AQUA 1TV8A 1ZJHA 4HD5A 3ARUA 1DP0A 3MO4A 3TW7A 2SFPA 2QPUA 1JVNA 2DH2A 1DXIA 4MADA 2F38A 3CAWA 2D2OA 3AI0A 2XVPA 3SZ8A 3SRDA 4H1ZA 4PRRA 3DI1A 3W1TA 1KRMA 3JR2A 4IJRA 4OV9A 2WNZA 3H7RA 4G9PA 4N6EA 1C29A 3AMDA 2ZRUA 2F9RA 1JRCA 1V79A 2VD9A 3IUDA 4QIUA 3C6CA 2ZZ3A 3LEPA 3KX6A 1TPFA 1P7TB 3WF2A 1FWFC 4Z2LA 3UGVA 3E2VA 5CCZA 1PJ9A 1SZGA 1VIWA 4A3HA 4K7YA 3MSRA 1UWUA 3FV9A 1DJGA 1LRQA 2VURA 2AGTA 5FEPA 3TNBA 5C2GA 4MB4A 4MZYA 3LXAA 4GVFA 1JUKA 1EF3A 3O16A 4G7EA 4GBDA 4FOUA 1TA3B 3U4FA 2ZX8A 4JYDA 2PGEA 4U4MA 2HV5A 1TX0A 3EB2A 3CV1A 3CWHA 1LOQA 3GTNA 4ZB5A 1B3OA 4AY7A 2JGYA 4KERA 3GXPA 1OGSA 3VIKA 2J25A 1UOKA 3LGGA 5G2WA 5DFAA 3CUFA 3E6EA 2BVWA 2NQ9A 2JKEA 3HV9A 4E6MA 2WMJA 4U10A 3GR7A 4EXBA 4DUWA 4K8EA 4DJEC 3WL1A 1VYRA 4I7UA 2PDPA 4GO8A 3VGFA 1W3NA 1RD6A 4UQAA 2DU2A 3O6DA 1VFHA 1Q45A 4PUJA 1Z6KA 3O3RA 1LBMA 4CCCA 4RV8A 4UCGA 1PS9A 5CGTA 2Q3OA 2P0OA 4Z1CA 4RNIA 1E0VA 2O9RA 3M46A 4A35A 4IUGA 4JAWA 2QR6A 3CUXA 3WENA 4X61A 4B5VA 3BURA 4PODA 5F2IA 4E2BA 2IQ0A 3Q4DA 3GTIA 1KB3A 1HJQA 3T4WA 1FXPA 3RIKA 2RDUA 5E0KA 3HG5A 3LPOA 1R2SA 3MCMA 1CIUA 4NP7A 2IKIA 4UWMA 3U5YA 1S38A 3CQKA 1K8YA 2CHRA 4HSHA 5T8GA 1V93A 5I6SA 2YA2A 3N2XA 3VNMA 4D8ZA 1XLBA 1K9DA 1TWSA 1L2QA 2OSXA 2YB4A 3FKKA 2WXDM 2A0NA 2YFOA 4P2VA 3FW6A 2Y7FA 3W7DA 2Y5EA 4RLIA 2RDTA 2ANUA 2QJJA 4BEQA 3F4VA 1LQ2A 1Q4NX 2WSPA 3QRHA 5FCZA 4WZHA 1SZFA 3G1HA 1VPQA 5AZ1A 2WZIA 3AZRA 3W3OA 1F76A 2Y2WA 5IOBA 5C7HA 1FWNA 2J8TA 3PWIA 4NILA 4NZFA 2XDFA 1GVQA 4L9YA 4PMXA 4RCXA 4F4RA 3EPNA 1MYRA 4XIMA 3IS4A 5BU9A 4Z2GA 4Q6XA 3ABOA 1XXXA 3WH6A 3L4YA 3OLGA 1LT8A 3H7UA 4ICNA 1JXJA 4AXKA 3EOUA 3M0VA 1ZUAX 1KRBC 1JULA 4D6DA 3PJUA 4GD0A 3WQPA 1RAKA 2YCKX 1JCYA 5C7VA 1PVNA 3TYBA 1UJQA 3ES8A 3TAOA 1ALDA 2ZQ0A 1YYAA 1QI3A 3WF1A 3CM4A 5H8UA 3GNXA 2F6UA 3D0CA 3T0BA 1L8NA 1Q65A 2A7NA 4WDWA 1TO3A 3HJEA 1ZQ5A 3VIIA 1XD0A 1U1HA 1RVKA 3MUZ1 1V3JA 1JF6A 1RSCA 5D09A 3W7LA 4E38A 1LOSA 3ORWA 5I24A 1KFEA 1KR1A 4JPGA 4KH2A 3B9DA 1LYXA 3HM7A 2XG9A 3CUHA 3UW6A 1M53A 1JCTA 2QF8A 2F2KA 1KD0A 4GOAA 3GH7A 4O8AA 1SW0A 4NYYA 4PMJA 1P48A 4TX6A 3WLMA 2GWNA 1IEVA 5AB3A 3GNOA 3P2VA 4L80A 4TO8A 2P50A 4LB4A 1M5WA 1DHKA 1V6VA 2W6RA 3PBMA 2VNCA 4GI6A 4G6CA 4JNZA 2ISDA 2XVLA 4O1DA 3SADA 5GJPA 3W01A 3ARPA 1TVLA 3M07A 1YBQA 3NJ3A 3UWWA 3P14A 4OFCA 2A85A 4JR5A 2Z1KA 3II1A 4H7VA 1GOOA 4DF0A 1QU4A 3NQVA 1QATA 1T40A 1XIJA 1ZAJA 1UASA 3ZXWA 1F2JA 4S38A 3A13A 1KNWA 1UPMB 3KP1A 4EIVA 2Y6ZA 3KM8A 1OGGA 4EXAA 4PCNA 2NX3A 3PBYA 3SY8A 1Z44A 3GS6A 2GPTA 3W7HA 3N14A 2ZXQA 5I23A 1TZZA 1XGDA 1PAMA 2XFYA 1H0GA 5FJTA 5C6MA 2NQLA 2ZUMA 2BOFX 3NO5A 1RY8A 3W6YA 2A1YA 3RPDA 2OG9A 3NL3A 3WH5A 3W81A 4MFEA 1W5QA 4JYEA 3S2NA 1Q2SA 3TUUA 1O5XA 3B03A 1E43A 3U2ZA 3BLEA 3WDIA 2V2DA 1JZ4A 5HWJA 2GVJA 2NLYA 2XM2A 3T55A 1M68A 2WWCA 1BVNP 1I1WA 3UWEA 4CUCA 5EFDA 1N2VA 2PD5A 2WB5A 3SGUA 3GG1A 2X0YA 5FJUA 3VZZA 1W56A 5CPMA 1S5TA 5D4YA 4QLLA 1VKFA 3G2GA 1XSKA 2AKMA 3UXLA 4Q8VA 1NDZA 3MCOA 1RR2A 3REQA 7TIMA 2VC6A 3ANVA 4QQUA 1J12A 1R30A 2QCLA 1QK2A 2PDKA 4Q7IA 1U1JA 5CEWA 4HZ6A 3LV6A 5DRIA 3BE7A 2YCLA 3RXZA 3UXDA 4ZSUA 4EK7A 4X0VA 4Y9NA 7PTDA 5C5YA 1AK5A 3FNDA 1M1BA 3EX6A 1FWSA 4EXQA 3TIMA 4G7FA 2ZUUA 2A3CA 2WKLA 1SO3A 3W26A 2IKGA 3N3TA 3GFXA 2GOUA 1E1CA 3NO3A 3OQEA 4BF5A 1U33A 4JICA 4CN4A 1GVRA 3KOFA 1EO5A 4KCUA 1H62A 4ACYA 3C0SA 4L4PA 3RO8A 1K8ZA 8TIMA 4M24A 4M7TA 5EMLA 3E2RA 4HA1A 4NQ1A 3WDJA 5KZ6A 3AIWA 3PZGA 3WEZA 4XZHA 1EEPA 3GZAA 3G1SA 3VDGA 1Q7MA 1X97A 2OEJA 4GXMA 3AZTA 1JQVA 1E9IA 2DZTA 5LNVA 4RW3A 1OF8A 2O9PA 3PZOA 3D6NA 5J8LA 3SW6A 4IQDA 1KFWA 3PWAA 4R34A 5CZKA 2ZUTA 2VWTA 4HNOA 4JHZA 3PBWA 3BK0A 3KZSA 4YVVA 4NJHA 1EFZA 2DEPA 4P8XA 1SO5A 4QG9A 4K8HA 1F07A 4UZUA 1KWKA 1NAL1 5I5RA 3K1DA 4JDYA 4U3AA 3UZ5A 4F2UA 4UMAA 2AL2A 3LCHA 4S3EA 4A2RA 1M3UA 4C6JA 4YTSA 2R1MA 3WLJA 1DKWA 2GVGA 5CBBA 4JQAA 1XV8A 2INZA 3L0NA 4UTTA 1ZB5A 1TPWA 3T2OA 1G6CA 1ME7A 5C2CA 4C7GA 2QW5A 2F2HA 3CTLA 2VWSA 3O2LA 1B1YA 3DZ1A 3T4CA 3WLSA 2E4TA 4AC1X 2QDHA 3FDGA 4GI8A 3GRIA 4ZO6A 3AHTA 3FGCB 1Z7AA 3FVMA 2NV9A 1UROA 4E4PA 2EPKX 2QYGA 5IDZA 5AECA 3LI1A 2OB3A 2QJHA 3MTWA 3RRAA 4HJWA 1YE6A 3B3DA 2O4MA 3ZJ7A 1XLAA 3SM0A 1FA2A 1PB0A 4ORMA 4XZWA 4FXSA 5IM51 3QOMA 4GPNA 3MUAA 1C7TA 4Q8UA 3WQVA 5EKYA 1RXOB 1PO9A 3PS7A 1ECQA 3WUEA 1NIUA 5LHEA 5KETA 4H9YA 1ZBKA 3SUSA 2Z1VA 1WV2A 2CERA 4XSMA 1W1VA 4PE8A 1JF5A 2Y7DA 2E09A 5DXYA 3L5LA 4O0QA 4XZLX 3S1XA 3WDHA 2PDBA 4FHAA 2PDYA 1MEWA 2WLYA 5BROA 3SRFA 1YX1A 3PZ9A 4JHMA 1X1ZA 5ABGA 2TRSA 3HZ3A 2NVAA 1WAWA 4UTIA 3ANYA 4IIFA 2VR5A 5G4HC 1Q3NA 1QJWA 4REQB 3B9AA 4DRSA 3MZ2A 2I7GA 1OM0A 2HZGA 3LDVA 1W3JA 3W83A 3VFLA 2EEXA 1VF8A 3MI3A 3W86A 2CWNA 3AYSA 1U2YA 1Y5XA 2PEVA 4DAIA 3M5ZA 5ECUA 3ABQA 2INEA 1H7NA 4QDWA 3WK3A 1NQ6A 1GW9A 2YFNA 3S4TA 1UR0A 2XN0A 1G69A 2WKJA 2HJPA 3KEHA 3NQBA 2ZRXA 4S39A 4O1CA 1VH7A 4H04A 3PTMA 1WKYA 3WUFA 2PDCA 2OR2A 2ZX5A 4R5EA 3BMVA 3EWXA 2OLSA 4BZYA 3W7EA 4PR4A 4W8AA 1BD0A 4C91A 5CC6A 3NQGA 3AHXA 1AODA 4JTRA 4MLRA 1L6FA 4EPKA 3MSYA 4UBPC 1Z42A 2J7FA 3IVTA 2E9BA 3LUTA 2XTKA 3AS2A 3TTYA 1P43A 3VD3A 3STPA 3L68A 4MGGA 3FS2A 4NSBA 5A6LA 1RQHA 1OWQA 1A5KC 5FIPA 1K8XA 4AY8A 4A2SA 2QDDA 2IXVA 3MKCA 3IJQA 3LY0A 2G3NA 2GDUA 3BTNA 4DBUA 5JH2A 5GPRA 2HS6A 1OFPA 1K9FA 4OHQA 5DBTA 3N1AA 1XFCA 2J7DA 5G1TA 3UG3A 1R2TA 2CKSA 3VK5A 3M0JA 4LBRA 4JTAA 1WDRA 1EF2A 1ISZA 2DSKA 1AZ2A 2OPJA 5MHBA 1DOSA 4UOQA 4LUYA 4UFKA 5FAGA 4QCEA 1JNDA 4JYFA 3CWOX 1OIMA 3AXMA 4DUXA 1J18A 4XAPA 1TSIA 3U7VA 1FY6A 1S2UA 4U2ZA 1A5UA 2OYMA 2NQJA 3VIPA 4ECLA 2PMQA 4JBRA 3UP8A 2QUNA 5JXQA 1EX5A 2NX9A 1KTBA 1KXHA 4GUHA 4DPQA 3CL8A 4XKYB 3GDBA 4IMGA 4AZCA 3SFKA 3KVMA 4MOZA 4NNBA 1AJ0A 2VKZG 5AOUA 3SBFA 4P7LA 3EWWA 2C0HA 4LUSB 5C9WA 4CD4A 4L9XA 1XIMA 3SGGA 1FCUA 2VEGA 1VFFA 2QUUA 4UXDA 4WY0A 1BG4A 2V5BA 1OC5A 3PPGA 2IMRA 1KBIA 3LSBA 3W85A 2BTMA 2V81A 1XLEA 3A5VA 1E0XA 3N04A 3WQ8A 1XP3A 3C3NA 4MKNA 2DY3A 2YSWA 3N6HA 3UWZA 2PC4A 1S3TC 1O68A 3PG8A 3RX2A 2GDVA 4AWSA 2XZ9A 3V36A 1MZHA 1K9EA 4S1FA 5GJNA 3HMCA 3ZSTA 1DWAM 3HQPA 1KKOA 3GD6A 4D72A 4ERGA 3N34A 3E9AA 3C52A 3O06A 3AIEA 3NQMA 4Q7NA 4Q4SA 3LHTA 4JEQA 3URAA 3G0SA 4I9TA 1WZKA 3M0HA 1GVYA 1HO1A 4JNYA 1ZPTA 3WQWA 1VS1A 1GKPA 3QQ0A 4B90A 1RALA 1TJ2A 4BF9A 4LV4A 1B31A 1V0MA 4UIOA 5BRBA 4DBSA 3OO2A 1IXOA 4CCDA 4ZO7A 3C0QA 4CQ9A 2JE8A 2IKHA 2E68A 3QZ6A 4P7NA 2Z7KA 2EJAA 4FI4A 3EDFA 4MPQA 3LBOA 1BSLA 4GE8A 5C8BB 3NWRA 1S2WA 3MDWA 2OQLA 2X2YA 4C1LA 3GDLA 3WBXA 3BW4A 1UKQA 4H2HA 1QTWA 3E0IA 2FHBA 4HGXA 3W1XA 3KBJA 2XFRA 2GJXA 2QZRA 2WJDA 3WYZA 4C1KA 5D2WA 1V6XA 2QVNA 3QPZA 3ZVHA 4IFKB 3N2BA 1ENUA 1XG4A 1XIGA 2Q3RA 3M16A 4EPEC 4AXNA 2ZBTA 4V33A 1Q8JA 2E9MA 3CS2A 3UA3A 4AZ7A 5DANA 1LL4A 1HZYA 3KRSA 3USZA 3M47A 1FCQA 1A5AA 1TV5A 1SFJA 1Y5WA 5AY7A 1V3HA 4IQEA 3HPXA 4A21A 2ZA3A 1EOKA 4O54A 2EPNA 1DXEA 5T9BG 3GFZA 4GGHA 1MW0A 1U5HA 3LQGA 3WQDA 4IP5A 2GSJA 2OGJA 2EKCA 3UGRA 1LWHA 3SECA 1IEXA 1PX8A 3WFAA 6PTDA 2NV1A 1WAUA 4HA4A 2CZFA 2DVTA 5T26A 3W2KA 4CNSA 3DFNA 3WDRA 2CZDA 2VT0A 1KFCA 4ONVA 3CV2A 4K38A 2GVYA 4Z0SA 3NM3A 5C71A 2XSXA 4MJ2A 4PH6A 2DVXA 2UY3A 3TX9A 3RO6A 4B5UA 1K7XA 3HGRA 4KESA 1XBXA 2CITA 2QMJA 4UQBA 2E5BA 1GVFA 1YPFA 1RK6A 4MB1A 2NUYA 3EKLA 3WBEA 1FCBA 2VRJA 4OTKA 1E9YB 4C65A 2BDQA 1IT8A 2FZMA 1TPB1 2OQYA 3FJ6A 1GOMA 1OYAA 2VVSA 5DO8A 2DSZA 4L7ZA 2CZ5A 1Z9AA 4J3SA 1W1YA 5K4ZA 3QN3A 2Z25A 2Q8XA 3B4YA 4GY0A 3BO9A 1BG9A 1V0LA 4RDZA 1RCOB 3VABA 3EDKA 3SB0A 3WKZA 5AVNA 3GR8A 4MSSA 1PZ3A 3QTPA 3NQDA 2DT0A 2VCCA 4Q3MA 1KCXA 3B8IA 3WG6A 2VZOA 2E77A 3J7HA 5FAJA 3TC3A 1MQRA 1KXVA 4WK9A 3TLQA 1MWOA 5M03A 1VJSA 4Z42C 4KRTA 4OUEA 1W9PA 4HVXA 3FOKA 4JFUA 4LYQA 5D9PA 5D2TA 2QT3A 4GO9A 1LCOA 3DFOA 3BVJA 2D73A 3A5FA 4N42A 5ABEA 1U30A 4YJ5A 2DV0A 1NP2A 3P5ZA 1K77A 1O4UA 4ZQNA 3W1PA 4GJ1A 3HN3A 5I0DA 2A79A 5CSYA 2Y24A 3AXHA 3SJNA 3C0LA 1CT5A 1UWAA 3C86A 4LF1A 2ZZ2A 1YTDA 2H6RA 6ENLA 2C14A 3L5MA 1XYFA 2DGAA 2ZFAA 1MW1A 4IIEA 4JIPA 4TMBA 2J7HA 1CW2A 5BWFA 2HPIA 3WMLA 1ODZA 3IRDA 3FA4A 4BWLA 1HJSA 1BWVA 3PP7A 1P1XA 2I9EA 2IPJA 5DQPA 3LXCA 4GI4A 4I3GA 1EJRC 3NG3A 4OOUA 3PR2A 2YDSA 4DJDA 3CO8A 3DDMA 3OBAA 3ZT6A 3WLQA 4H00A 3MVIA 3ALGA 3SQLA 1BLIA 4ZEPA 2J13A 3VX1A 3QMTA 2TPSA 1BRLB 2ZWZA 4FMVA 2GJRA 4ILSA 3AXKA 5EYWA 3UYCA 4IXXA 1SZEA 3IAPA 4N9CA 2OWWA 4JKMA 3FIGA 4G5DA 5D04C 1I0BA 4MY8A 3EMQA 4GUIA 1LUCB 1JGMA 1GWJA 4XVDA 1OX6A 3W7KA 5FJJA 4Y96A 1HKIA 1REQB 1ZAHA 5C54A 3EXTA 4WXYA 1EP3A 2J9YA 1BHGA 4HN4A 1RD5A 4HKPA 2J8GA 4MY1A 3O0KA 1YHTA 2VP8A 2CLFA 2W0UA 2XWDA 1B4KA 1UWIA 4UB9A 4M6UA 2BP1A 1WPCA 1GQJA 3MI6A 1D8CA 4GMEA 3L4WA 4ZB0A 2PAJA 3GXDA 1DQUA 2QPXA 1LLOA 2OGYA 4WXZA 3CT7A 2VFEA 1H11A 3P74A 3E0VA 4KFPA 2A3HA 4GZJA 2Z2AA 3LCXA 3S2LA 5A6BD 2OXNA 3IGXA 4MJZA 4QAWA 3LGDA 4J28A 5KTLA 2ZICA 1XLDA 1KV5A 4K37A 1HT6A 4LEFA 3ZJ8A 4UR9A 2E0PA 3TDFA 1S5NA 3ZM8A 4MWAC 3W2UA 2G41A 2QV5A 3K4WA 2YCLB 1C8QA 2XH7A 3MUY1 3UT0A 4Z1YA 1QUMA 3CAQA 3MW7A 1AJZA 2GGHA 4GACA 4KMQA 1ONWA 1J8VA 4MWAD 3BMXA 2YB1A 4XVEA 3F4WA 4LAZA 2XVKA 1JG9A 2DQWA 4L4LA 1J6OA 1M01A 4I9MA 4C5ZA 4LYRA 3VXGA 4CU8A 4LCQA 2Y7GA 4DF1A 1PWLA 3LM7A 1CECA 3A23A 2E6DA 4YTUA 1UKTA 3LGEA 2W92A 1EBHA 1NU5A 2QUTA 4DLFA 4MAZA 1PKLA 4DWSB 2X2GA 3RLVA 3NPUA 1MZRA 1F6KA 3VYLA 4H6RA 1LQ0A 3B0XA 4FX6M 4UFIA 3QZEA 1EDQA 1YDOA 3CHDA 4K39A 1J4EA 3WF3A 3W1AA 2FZBA 3C4UA 3NGFA 2DSVA 3VIHA 2RAGA 4MNMA 5E0CA 3B8UA 1T0OA 1NJJA 3EA1A 4MG4A 5CSSA 4QDPA 3CMFA 1H7XA 3ITGA 4DO4A 4NJGA 3W4RA 1VFLA 3ABZA 3CZJA 1RPXA 2XH4A 5F7UA 5HNRA 2HVMA 2C18A 3KLKA 4JTSA 5FF0A 4HB7A 1XRSA 3UYIA 3NQAA 4XAGA 1TV7A 1ZENA 4CNUA 3RR4A 1HL2A 1HJVA 1O5QA 3WF4A 3QJAA 2BFGA 2WZMA 3QV6A 2F6KA 3L67A 1QT1A 1HGYA 1O1HA 3HOJA 1Q6FA 1EJXC 1RV8A 4HCHA 1J5TA 3FDKA 3CZKA 4HZMA 4WKHA 5EY5A 5HMSA 3AHVA 3TQPA 4IPLA 1VEPA 4R7WA 3IAQA 3A64A 4MUPA 3UXIA 5EB8A 1XYCA 1M7XA 3URQA 5EMMA 1OFEA 4NJJA 2FHFA 1RP8A 2YCEA 1SSGA 5A3HA 5F4WA 4LJ3A 3UEQA 1I0DA 7ODCA 1U5VA 4AFYA 1IEQA 3M1ZA 3R0UA 1BFNA 4Q6JA 2BHZA 4D6GA 2BGNE 2DZUA 2G3JA 4XBKA 3MI2A 3B06A 2DFAA 1ZFJA 1XWYA 2D0HA 3DHPA 1T7LA 1CXEA 3KCOA 2OKOA 2DT3A 2BODX 3A4XA 3K4AA 3UCQA 3PTDA 1H51A 1W9VA 1YQ2A 1V0KA 4D1JA 3DHDA 5BZAA 1H1NA 1WDPA 2FMOA 5AFDA 1LLZA 2KZHA 1FP9A 2UWFA 3ID7A 4ICCX 4PSRA 2HNEA 2NXHA 1AQHA 2Z00A 3L2MA 2QUVA 5LXXA 4QJ3B 3R2GA 2ZRZA 3EX4A 1MFUA 3KWSA 2PRMA 2ICSA 3OA5A 4K2SA 4TX8A 1AW5A 4E3VA 3UERA 3O63A 2VZVA 2YDQA 1GVSA 5C55A 4N9EA 3E96A 5A2BA 5FL1A 2ISFA 3AC0A 3KBMA 4NNAA 2WSYA 5GNYA 3LA4A 3GE7A 5FSDC 1S1RA 5HMFA 4NZ3A 1HJXA 3POCA 3RLGA 5C9RA 1RZMA 4GABA 1K70A 1AW2A 3VCCA 4W5ZA 5CGMA 4W89A 7REQB 3G6LA 1LL6A 3PTQA 1GORA 3CQJA 4C1NA 3G1VA 5AYZA 4PL2A 5A6SA 3TVAA 1SM9A 2ACQA 3EX2A 1SPQA 3T42A 1VFSA 2G3FA 3LQLA 1AFSA 1KC7A 3M41A 4Q8WA 4M82A 1DIDA 4HHLA 3WCZA 5JBFA 1T41A 2X0HA 2FFIA 4PN2A 2XVNA 1GEHA 1SW3A 3ZMRA 3PB2A 1EGVA 3PWGA 2O55A 1FX6A 4CD6A 2FH6A 4FLQA 2EHHA 4KETA 4NAEA 1JXKA 4IG2B 5H8PA 2Q8LA 4ALDA 4WGHA 4PCSA 3DOPA 3SSZA 1IZJA 3L4XA 5K3VA 1FHVA 1X6NA 3OG3A 5G2HA 2O9TA 2D3NA 3ZO9A 3IJDA 1IXPA 5D2YA 3EA2A 4YU1A 2JQXA 4UTMA 1OFRA 1PZ0A 2WHJA 3RU8X 3VNJA 3ZWTA 3GHUA 3BG9A 3L7RA 1C8VA 3UNDA 2G95A 5FA5A 1ODUA 1QXLA 2ZZ4A 1UQYA 3C3UA 1E6NA 4HNNA 5HBFA 1IXNA 3IGSA 3JZEA 3U7BA 3QM3A 3OBEA 2NV2A 3I7SA 1A5CA 1GQNA 3WJXA 1DWGM 4MY9A 2EGZA 4HU3A 1UD8A 2VQTA 3HMJG 4WY0B 4I6KA 1F74A 3N9SA 4FNTA 3APYA 4JQ3A 4YWIA 3BCJA 3WBAA 2XWEA 3BW3A 1PBGA 4ZGYA 4PMVA 8CGTA 2V63A 3CZGA 3WQGA 1XG3A 1NF0A 2C19A 4LVGA 1ESWA 1TREA 4ZO9A 3TQVA 3WD2A 1ONEA 5F4SA 1ITQA 5DXXA 1I8JA 2FH8A 3CNYA 2PDHA 3MUIA 2CLEA 1BGGA 1UR1A 2Z6JA 3VO0A 1NELA 2F6XA 3A3XA 3MPGA 1F6YA 3DFPA 1TZ7A 5ENLA 3IK4A 4C7DA 1R3VA 1LF1A 3MA8A 5E93A 2Y88A 2AKZA 4WD0A 4F66A 2CLLA 1LZOA 1CLKA 1WOAA 1D8WA 4WY0F 1TTQA 1UA7A 2P76A 2JK2A 4YCOA 2ZVIA 1SYTA 1RK5A 2PWFA 4XO6A 2B0MA 2AGKA 2WJFA 1TWDA 2VDGA 2C7FA 3NPVA 2GLKA 1TPEA 1NDWA 3EXRA 3BOLA 1EHAA 2Z1XA 4UTUA 2OOFA 2POZA 2XH0A 3CV7A 2GQ9A 4ATWA 4NAFA 4PUMA 1O60A 4PB4A 2C71A 5JIPA 3S6OA 1DL3A 1I6NA 1W1ZA 1V02E 2V69A 5GVJA 4QSHA 2CFFA 2YLAA 2W66A 3SGZA 4NXSA 2ZX6A 3ABXA 3W84A 1MNSA 1CGYA 3G6MA 5LNRA 1W6TA 3VKKA 1OX4B 1XI3A 1HKVA 4WVXA 4U31A 1W9XA 1LM1A 2TYSA 1CDGA 2W5FA 4AYGA 2BBFA 3PUOA 3PF3A 2YW4A 5AYXA 4Z1AA 3N4EA 1HKWA 3W1QA 3WUGA 4BQ5A 3T1GA 1KRCC 4JIRA 4XBSA 5IDIA 4PUWA 3B97A 4E5TA 3F5LA 4Y9OA 3ZWSA 3GH4A 4UUIA 3FHAA 3P6LA 1WA3A 1RJQA 4ZMGA 5IHSA 2DZPA 1WP6A 3CWNA 3EOEA 3S46A 5EMJA 3WNNA 3SRKA 1PPIA 1UP3A 3UY7A 3GU1A 1FDYA 1SUXA 4D1IA 2O9OA 3KW3A 4LUJA 2JFEX 2Y5JA 3NPXA 3MMWA 3TYAA 4AW7A 4RE4A 1VCGA 3CXOA 3B05A 1QI2A 4IX0A 4FO4A 1JIBA 3OW1A 4A22A 4W93A 3BJFA 1XIIA 1ZP3A 4LNCA 4KEUA 3CHVA 2FIQA 3WN6A 1KLYA 3DC8A 1J0HA 1J5SA 3PN8A 1HO4A 3LCLA 5GJMA 2PDNA 3L23A 5HQEA 1XYLA 2D0FA 4UTHA 2W67A 3R58A 4BKNA 1QNVA 2QHAA 3K8MA 2VFFA 1VENA 1A50A 1E73M 3M5XA 3LCGA 2E6YA 3CIWA 1XLGA 1YNPA 2KX9A 2PURA 3LNPA 3MSGA 3LNMA 4EAMA 3B8WA 4BQ2A 4WR3A 1V08A 3VOHA 3DX5A 5DCBA 4FNUA 3UR8A 3VMPA 4FIRA 5HWNA 3QFWA 3KTCA 1ICPA 4ZVJA 3K46A 3TN6A 3P61A 4MB5A 2XSAA 4H6EA 2BZNA 4O1AA 4ZENA 4M80A 1SZNA 4LH8A 4ERIA 2F61A 3WFLA 4RZBA 2WVSA 1AZ1A 3CEUA 5DMMA 3UR2A 1QNOA 4A8RA 1NQKA 3N2TA 2DZWA 3QQ1A 4GUJA 2PTZA 2HRWA 4AZ6A 2CBVA 2BX7A 3DGBA 1XSJA 3O0FA 4DJEA 3B0UX 4MPKA 3PFRA 3R25A 1UD6A 4ZQRA 1VGAA 2PDFA 3R1ZA 4FR1A 5ABFA 4L65A 4PUNA 5AN7A 5I3IA 1FHLA 4WUIA 4LF2A 4KRZA 2QVHA 1UKPA 2B7OA 1E6RA 2ZYFA 3VNLA 2B81A 2PDIA 4DF2A 1A3XA 1I4NA 1RBLA 3F2DA 4OIFA 1ADSA 3KP0A 3OGSA 5B80A 4MIMA 1WQ5A 1R9XA 5LYRA 1N8FA 1HP5A 2Z2BA 2ABBA 4GIYA 4U2YA 1V3KA 9RUBA 3GVGA 3FAWA 1XGEA 4KIEA 4NKCA 4C6MA 2PP0A 4XWUA 3LXBA 3TYUA 3ISIX 3RDKA 3QC3A 3T40A 1E3XA 4JY9A 2UY5A 3KVKA 3PC0A 4IH3A 1H7RA 3RLHA 1E55A 4FOJA 1VPXA 5REQA 4DNMA 4B91A 4GK8A 3WQCA 1DJQA 4IF2A 4BCEA 1EL3A 1JD9A 1NTHA 1Z89A 1MFVA 3AMKA 3RPTA 5DELA 3H2EA 5BXTA 5AC8A 1PHQA 4OVXA 1KO0A 3PM6A 1E4NA 3TJLA 2MNRA 2EG8A 1UWQA 2PZNA 3DUGA 3QV8A 3N19B 1CEOA 2WM0A 3ARVA 1Q4WA 1HX0A 4FB7A 2J79A 3T44A 2WM1A 4EKJA 4ZQMA 4DJFC 4RZ4A 1QPNA 2YBTA 3WLTA 1MEHA 5AC4A 2GUYA 2GDQA 3GW0A 2PODA 3DECA 5LA2A 1W3HA 4F0MA 4XD4A 1DJYA 1E5JA 1US3A 1P5BA 1PUDA 1OZMA 5H2ZA 2Y62A 4WJEA 2QAFA 1SO4A 2B7QA 2IUZA 1NWUA 3BGGA 4HNVA 4HOXA 3OQ8A 4XZMX 2P3ZA 4JIQA 1FWWA 5I2UA 2PE4A 4BI7A 5PTDA 1B3ZA 3W7IA 2VENA 2QCEA 2VL4A 3ALFA 4S3AA 1KWGA 1AW1A 2WZTA 2NW0A 4JDBA 4C6NA 1I45A 3ONCA 2CXGA 1LWIA 3K5XA 3UWYA 3SCQA 3BPWA 2QDEA 3RRXA 4JKLA 1BYAA 1KTNA 1LROA 4S2CA 2I16A 3G1YA 4QE1A 1UW9A 4QR6A 1W5MA 1M6JA 1AD4A 1QHZA 1VHCA 4MKVA 3IJLA 2ZUNA 4KT2A 5D9MA 2ZOXA 4FNQA 3TCEA 2R24A 3UA4A 2D69A 1GQIA 2GGJA 2X1SA 1D3HA 1HGWA 5J5RA 1V4YA 4PFHA 3E02A 5EBUA 1F8MA 1OCJA 1CGXA 1ONRA 3O07A 3IPWA 1CXLA 3VZYA 1T6MA 3POHA 2OZTA 4EWND 1VCFA 3RITA 3TE9A 4C6IA 3FK4A 3LD5A 3HF3A 4FNRA 1XRFA 3BG5A 1XQLA 4PUEA 2C91A 4J9JA 2PS2A 2CLOA 3QKEA 3VZXA 4MNKA 4M3PA 1CXKA 1GG1A 3K4DA 5I7GA 3SDOA 4XSLA 3FEQA 4FXFA 1TJRA 1GPWA 3HPSA 2EPOA 1SJAA 1RY0A 3R0KA 3PUDA 1ELSA 2P5NA 1X6LA 3IJIA 1G5AA 1X98A 1YIXA 2J47A 3M0YA 4NX5A 1Q66A 3S47A 4HYVA 1S2CA 4B5NA 1R3WA 2ZZ5A 4I5RA 2ZCGA 4GLEA 1ZU8A 5FOOA 1POKA 3GU9A 1VZWA 3WNOA 2XUCA 1EQPA 1MUMA 4V28A 5KITA 3Q94A 3I68A 1MQPA 4BHYA 1MRQA 4PBEA 1E6PA 4IICA 1TTIA 2YKKA 2RFGA 3W76A 4GH3A 3NSMA 4KQNA 4N02A 2BY0A 1IE7C 5CLTA 1UJPA 3W70A 2QDGA 1DWIM 4V1XA 3EPOA 2NVCA 1XSIA 3DCPA 1BTCA 1JNEA 1JYXA 1MRAA 1CZ1A 2BOGX 3N2OA 2PD9A 4A4AA 3AIVA 4JX4A 3UFYA 2HSAA 1EJ7L 3E5BA 4W86A 3MY9A 3SIZA 3V1PA 3I6TA 3ITXA 3FX4A 3L4ZA 1TJ1A 3T0DA 2P88A 2PP1A 3VDCA 4OZOA 4DZHA 1GYNA 3KHJA 3AHZA 3GSMA 3DHFA 1Q6GA 3GVQA 3GNDA 3S6TA 4R27A 4ZOAA 1XLJA 3LPGA 2CHOA 4MKSA 2NUWA 4XISA 1MVYA 3RUBL 2HMCA 2CZVA 1B4EA 4HP5A 1LOLA 4DHGA 2TMDA 1R3YA 4GWEA 4F2TA 3S9ZA 1UUMA 2GVEA 5E1QA 3WH8A 1HVQA 3V0SA 1P6CA 3W7NA 3OU8A 3AJ7A 3IARA 3KFTA 4D71A 3UJ2A 2XSBA 3STCA 1J0YA 3WQFA 5K4XA 2AMXA 3VGHA 4ENLA 2PDXA 2E7FA 1DE6A 3MP5A 1EB3A 1KKRA 4RV3A 1OCNA 1W1B1 1SMAA 3B8TA 2RGLA 3TN4A 1I60A 3NSNA 4UOJA 9XIAA 4GI9A 3BL3A 3QVQA 3VINA 4IT1A 4AIOA 2E6FA 3NZGA 5F2LA 2J9XA 2I5IA 2C3ZA 2EO7A 3MV11 4JL1A 4B3LA 3LCIA 1R3QA 3T81A 3CBWA 1BWKA 3VKCA 4W4QA 1KM4A 3EWCA 3BAYA 4MDOA 1UG6A 2IQTA 1LORA 4LOCA 4G8TA 2HPMA 2A3AA 4LS1A 4XAZA 2WVUA 2E8YA 4NF7A 3ZFHA 1M7JA 3URBA 5JVLA 1BKHA 1BQCA 4A29A 1RP9A 4MZ1A 1DJXA 4E0CA 4WQ6A 4F9JA 3VIJA 1WBHA 3GNNA 2EJ1A 4D6FA 1V6WA 3V7PA 2CESA 1F05A 1LQAA 2YXOA 3ZR6A 1FWIC 1HL8A 1TG7A 1T99A 1TRIA 2BV9A 4WDUA 4DZ5A 1S2TA 3GUWA 5E9XA 4GUGA 4AEEA 1TZ9A 3MUCA 3FJNA 3W73A 3VM7A 4L5ZA 1KFKA 4MNLA 5FF7A 4DWSC 2PCQA 1OT2A 1IQ8A 3PSVA 1H3GA 3NPWA 4HTBA 1EWEA 1E6ZA 4LVFA 3NNTA 3BLPX 4CN6A 2ZA1A 1GOIA 3EDJA 2WC7A 3N6JA 3LK6A 2AQOA 3VNDA 1UR9A 1GQLA 1LDCA 3BQ6A 2FDSA 2E40A 2GK1B 3EX1A 3CYVA 1E9LA 3GHSA 4BQ3A 4QE5A 1YKWA 3CAVA 1V7YA 3LRLA 2FPVA 3RK8A 3LI0A 2PWGA 3VNYA 3L5AA 2NT1A 3STEA 5A69A 3MC5A 3QR3A 4DY1A 1OQFA 3CIVA 3MMTA 2G4JA 3S8HA 4AMAA 4GX9A 2J66A 4KPLA 4Y9PA 2UV8G 2NWRA 2H8ZA 2FVMA 4V2XA 2NQ5A 1HG3A 1XHGA 3W38A 4DAFA 2HS8A 4D6CA 1M03A 1XF0A 4IIHA 4JN7A 5HQMA 4DXVA 2QGHA 3FHQA 1IZCA 4AISA 3V5OA 2WJZA 4EP8C 4AVFA 3F03K 2PBOA 1J10A 1R87A 1NWTA 1THFD 3GXTA 3LLXA 3WLRA 4N9BA 4DM2A 2DUAA 4WJ8A 5D9OA 5D05A 1XYZA 2YR1A 2X42A 3DGRA 5I3GA 1WZAA 2W62A 3TTQA 3AS1A 2VMFA 1E70M 2D20A 4XG1A 5LXEA 3LPFA 1XISA 2PP3A 4N2YA 1Q6EA 3FXYA 1DJNA 2F8QA 2GGIA 2X30A 3AU2A 3RPMA 3DYPA 3G1DA 2ZTKA 4W7UA 4WEVX 4O50A 1CLXA 3NXFA 1DWHM 1LL7A 1SJDA 2J7EA 2Z0IA 2DSWA 5M2FX 4HHHA 1WDDA 2VHLA 4MZ8A 4WKAA 4IUOA 1WE5A 1XCWA 3P5YA 1K4HA 4XQ6A 3ZLHA 1C3FA 3CT2A 4MUZA 1CI1A 3RG6A 2VX4A 3N4AA 3WLHA 2H3BA 4FNPA 4JHOA 2ZIDA 3EOLA 3M0MA 1J9YA 1LP6A 1F5ZA 1W1PA 4I7WA 3W9ZA 1YADA 4H83A 4QS6A 2H9AB 5HPCA 1TMLA 2G97A 4GCXA 1H41A 4IOTA 1ZBWA 3ZR5A 2PGRA 4Q32A 3W1UA 3NXLA 1FQ0A 4H6QA 3D3AA 2ZZ7A 1AJ2A 2GSEA 4GJJA 4MVAA 3V5CA 1LBFA 3U2EA 1UBSA 5G1YA 4ZTXA 3JU2A 5KZDA 4JTKA 5BMXA 3R13A 3FLUA 1FWEC 2ACSA 2FQIA 2J7CA 4NZ5A 4Z2KA 4QLJA 1PIFA 3TZFA 5C70A 3SCTA 3CB8A 5I07A 3NDYA 3ZJKA 3GLCA 1UZ1A 3VMNA 3L4UA 2QF7A 4I90A 1S39A 3V75A 1ECEA 5FI8A 4LRSA 3TSMA 3E2SA 6CGTA 1DJWA 3VUSA 2WV8A 3BAKA 2PDGA 3GDRA 1VEOA 1KCLA 2R9RA 4PTWA 4HMNA 1RBOB 2VRQA 3ES7A 3LCWA 3IUIA 2CZEA 4IFRA 4O4VA 3WUBA 5I3KA 4CKQA 2VDHA 4M19A 2R1KA 3NAVA 3QEZA 1B9ZA 2V3GA 1UR3M 1V7AA 4P7OA 1BF2A 1GG0A 3PUGA 4I9JA 4EANA 4IQJA 4KFOA 4FF7A 1WZLA 1Z48A 3UJRA 3VOFA 1VRXA 4C90A 4J27A 1GTEA 3PB0A 2FZ8A 4XAYA 1V51A 5I06A 3AIQA 4ACZA 2O4QA 4X9SA 1ZAIA 1LRNA 2AMGA 4B9ZA 1QK0A 2PTXA 2QCDA 2XVGA 3R8GA 1B3VA 1VLIA 4Z1DA 4B15A 1QNPA 1ISYA 3PY2A 2C13A 4UNIA 4Y90A 4GYFA 3N3MA 3OG2A 4HHMA 3P8JA 1QASA 5AHNA 1MNZA 1O6IA 5BRPA 2Z4GA 4U5IA 1VBHA 1BGAA 4E2DA 2V38A 2XM1A 4DO6A 1E0TA 2VZUA 2LLEA 1ADDA 2A2IA 4LC6A 4D6HA 1UYQA 4H6KA 2PDUA 2IPGA 3EX3A 2HK1A 2W9MA 2DZVA 4I8DA 4WSJA 3OB8A 5DRCA 1CYGA 5HR7A 4P7RA 4S3FA 1XQKA 3IRSA 3TWAA 4C6LA 1TX2A 4MJ4A 1X8CA 1K6AA 1GKRA 1ADOA 3KHDA 2UZ9A 4RNJA 3G1RA 1ZJBA 5E09A 3B8VA 3OOQA 4JY8A 4NZCA 4HPHA 2Q6ZA 4M8UA 2P8CA 3S9IA 4NJKA 3FSUA 3LBCA 3B40A 4GVHA 1W9BM 4KCVA 4DUVA 3LBMA 3CPRA 3PPCA 1OJXA 3G22A 4CD8A 3VFCA 5GNZA 4L4OA 1CB2A 3BCFA 1W0MA 4F40A 3HFTA 1R5YA 1EX1A 4XO7A 4K36A 3C2FA 3AUOA 4D8AA 3B04A 3BLOA 1FWRA 2DZSA 5B7YA 3N9KA 1R47A 1RCXB 2PSNA 4O10A 1Q13A 5CPNA 6REQA 3STFA 5G4WA 3R89A 4QJ1A 5E9AA 2JIWA 3UWQA 4BI6A 2QCGA 2BASA 1TV3A 3WZ0E 1NARA 3E0WA 2YBUA 3W6MA 3SN0A 3SY5A 4MWAB 3WSUA 1P0NA 3TC7A 1MXGA 1H4PA 3EYPA 4R7OA 6TAAA 3NEHA 4NXKA 4CNPA 4S3BA 3GC4A 4KCWA 4BI5A 2PPGA 5ABTA 1UOZA 4GRSA 3SUWA 3V18A 3L21A 1EP1A 2WMIB 5CSRA 3LRMA 3VM5A 2VRKA 4HNUA 3SI9A 1ICQA 1WBJA 4ZBCA 4PYSA 4CD7A 4QEHA 5RUBA 2BY2A 3TR9A 4PCPA 4NI3A 3HGSA 5DT5A 4H9UA 2VUNA 1EC8A 1GYMA 4CNOA 3OJGA 4U33A 5HR6A 1ZBVA 1XS2A 3NZPA 4DN1A 3SSJA 3URNA 4JOMA 5AYIA 3PPHA 1FBAA 3UETA 5A6JA 4AHPA 4Q8TA 2POTA 3W7MA 2X41A 4TOQA 3C2VA 2ZXDA 3UZXA 2HROA 2CHNA 2HE8A 2GOKA 2YL6A 4GBUA 4EVZA 3M6DA 1R6WA 5CPLA 4PSPA 3TV8A 1F4HA 2VC7A 4KGLA 1P7TA 4JQ4A 2CLKA 4S3JA 3BW2A 4O53A 5L9FA 4O0KA 3TOPA 3ARXA 5D8WA 5HDRA 2DP3A 2E1DA 2W91A 3PZQA 1UBPC 1WKDA 3ZZ1A 1QAPA 5LA1A 5CG7A 1O5RA 5F1UA 1JDFA 2WHKA 4ERAA 4D6IA 1UZDA 4FZIA 2NSOA 5ECVA 1OVDA 3A47A 3AOFA 1C92A 2J88A 3RHGA 3H2MA 1TA3A 4F0LA 2WPBA 1NWRA 4HPJA 3WD0A 3KL5A 3P8IA 5KEZA 2OSWA 5DLCA 1OCQA 4OWGA 2R6OA 2ZX9A 1XD1A 3RAOA 1U1UA 2NQZA 4DYEA 1R3SA 3THUA 1UC4A 5HANA 1A3HA 1W1IE 4K6AA 2PU0A 1EDGA 4LWWA 2A21A 3KOZA 5BWAA 4PCTA 1IIGA 3S5ZA 4W7VA 2QKFA 1CPUA 4FX8A 4PB5A 3VAVA 5D32A 2UY2A 4B5TA 4NVTA 3KRUA 1IYXA 2XIMA 3RJXA 3AYTA 4RDWA 3UU0A 2ZRYA 3U5UA 1KR0A 2XIBA 1GUVA 1FOBA 1R7OA 4C6CA 4PBFA 2Q8ZA 4B4FA 4BK9A 5MKGB 4K1WA 3H2NA 1EP2A 2RDWA 3CAKA 3OODA 3RCMA 3MHUA 5XIMA 1T5AA 4HNLA 4YHGA 5C2XA 3D47A 4GKLA 4C6FA 3BAIA 3PJXA 2BXVA 1E51A 3QSTA 1XC4A 3OHIA 1GVIA 3H12A 4BWLC 2IPWA 2VDIA 3TMLA 4NL1A 3IIZA 1H5VA 3KL0A 1GT8A 4XZ9A 1S2AA 2Z1BA 1A0CA 1FWHC 5K9CA 1G7UA 3OVRA 4UFJA 4IHCA 4DJDC 5A6MA 4I6VA 4LVDA 1QW8A 1T8QA 3S1GA 1DTUA 1Y0EA 2Q09A 1BXBA 2PU1A 2TAAA 3PJWA 2GJPA 5A6AA 5HNTA 1JL8A 4DJDD 1OG0A 1TR1A 1X8FA 2PUZA 4GNKB 3M7SA 2BXYA 1FVPA 4XBJA 6XIAA 3WIJA 1TRDA 3B9EA 3PG9A 2PLCA 3QGKC 1H1YA 3MS8A 5DT7A 1PZ2A 3HU7A 2CXEA 3AIUA 4RPQA 2ZKMX 1G4SA 3KTSA 1G4TA 3ICJA 1H09A 4H9VA 4W85A 2DH3A 5CC5A 4O15A 4N4QA 4NZJA 2A6LA 2V5JA 2J77A 3U9IA 3UG4A 3UZJA 2BG5A 1QOXA 1TKKA 4XIAA 2PF0A 3C5QA 3UY8A 3S5YA 4IMCA 3WEOA 2QIIA 3WF0A 3VGEA 3TCSA 3GTHA 3PAJA 2P1FA 4HU0A 4LY4A 2NSXA 3KZPA 3W7RA 3HIJA 2FTWA 1K3UA 4A3UA 3H23A 2OMAA 3BLKA 5CZTA 4JXCA 5AHIA 4ZB2A 2GZXA 4PBGA 4M5PA 2E5CA 1PKMA 4Q8PA 1M04A 1ZJAA 3PPFA 3TR2A 2YYTA 4L4MA 2TODA 2V5LA 5B7ZA 2OJPA 1WNOA 1W3TA 4ZXLA 4O14A 3P93A 1UH2A 2ZC8A 3GG8A 1I75A 4FAMA 3BQ5A 1UIPA 5CPOA 3MANA 3UQNA 1YXCA 4TV5A 4CQDA 4HYRA 4DXKA 1OBAA 1FUYA 3WLLA 3BDKA 4ZOEA 1YDVA 4ZOBA 3CH0A 3CYJA 5G2IA 3GXMA 1Z32X 4YCPA 3PBVA 3QLLA 1QNQA 1B5TA 1QPQA 4NUWA 4BS0A 5GQBA 4O4WA 4I8YA 3QMSA 3A6OA 4O11A 1A0DA 1HIZA 2X1RA 3SJ3A 1EZ2A 3TXVA 4IQLA 1VFOA 4X9YA 3M0LA 5GNXA 3LG3A 3R10A 2OWCA 3RF9A 2AAMA 1L0PA 4A8IA 1XRVA 3DN5A 3TEVA 4R53A 1UP0A 4UQDA 3VPLA 3IIVA 5JQ9A 1ZJIA 3FYOA 3HA1A 3B4UA 1F61A 3W2NA 3MMDA 3B0YA 4H8VA 3PNUA 2QMKA 2ALRA 2HXTA 4QRNA 4TX9A 3UXAA 1FWGC 2WWDA 4ZQPA 2BLEA 1HN1A 3OLDA 4BR1A 3INPA 3P0XA 4KS0A 2PI6A 1AD1A 1N55A 4JIHA 5C9ZA 2V8ZA 2VFGA 1G0CA 1JFHA 4S3KA 1GK8A 5F1VA 3UZYA 4IP7A 4FOKA 4JQ2A 5C9UA 3WH9A 1CB7B 2Z2UA 1ZZMA 4W8LA 1FWCC 4O1BA 4IIGA 2Q01A 1Q6LA 1X1NA 1HUVA 3TAKA 3S1UA 4ADUA 4L6OA 4UFMA 2Y7EA 5BYWA 1XICA 3GVWA 4QHRA 1OFQA 2Q71A 4CEUC 6A3HA 2OEMA 5BMWA 3L66A 4HPNA 3S83A 3QV7A 1XIFA 4MTVA 3WBYA 1Q6RA 3CC1A 1TV2A 2OT0A 4A3RA 3EPMA 1S5MA 1ZBCA 4DB7A 2XIIA 3KBSA 4LRTA 2E25A 1G94A 3K1GA 4H8UA 3BJSA 4YN5A 4X60A 3ITLA 2NLIA 3VKDA 1XYBA 2JEPA 3MWCA 3B8DA 4DZIA 2XZ7A 5ABHA 3FSTA 1LG2A 4LX4A 4R9OA 1PYFA 2ZWYA 3V0UA 2C8NA 4GGBA 3WFZA 3TA9A 1XDJA 1ITCA 4I5XA 5LNSA 3VNKA 1NH6A 3G18A 1IHIA 5I3JA 1F6PA 1QBBA 4S3CA 3T9PA 2ASHA 1EH9A 2VCAA 1HJWA 1Q7QA 3LTSA 1JPDX 4YVPA 4LUTB 1ZALA 2WMFA 3NSXA 4QNWA 3TN3A 4XTDA 4DBEA 2EF9A 3OYXA 3AJXA 4B4HA 4PUKA 4IL2A 2VZSA 3DYMA 4DXXA 2I5GA 3TTSA 4CQBA 4GISA 3H8AA 1MEIA 1V6YA 1JPKA 2VEMA 3AMCA 3A24A 1TCMA 3S2JA 1SW7A 1H50A 1QW7A 4E4FA 4GJIA 3ITCA 2PB1A 4AD1A 5A2CA 3C0JA 3IJ6A 4JKKA 5LHFA 2PF8A 1NDVA 1UZHA 5E0FA 4AF0B 3UG5A 5KZMA 2IKJA 2YXXA 1WXZA 5IFTA 2XU2A 2QXWA 4UTFA 4Q8QA 3CEPA 3PNZA 3W07A 1VPYA 1W91A 4UNLA 3JW7A 1TWIA 4R33A 2YL5A 4NZ1A 4O8RA 3CPUA 5FJPA 4MDPA 4W84A 2XGBA 4LNYA 2JBMA 2WVVA 2JKPA 1GOKA 1W8GA 3H54A 1IGSA 3ZYZA 1V02A 3W74A 3GXFA 1JZ2A 7XIMA 3ZLFA 3H2OA 1O66A 3V4BA 2YDRA 3FGCA 3XINA 1JGIA 3VC5A 3ZVIA 3MBDA 4A05A 4AYSA 1TE6A 3M9YA 1GKQA 2YLLA 2ZADA 3BJTA 4EE9A 2YX0A 1B3WA 1A5LC 1TUFA 3EWZA 1J2BA 4JEJA 3CPGA 3H4XA 4PULA 4QX4A 3T2QA 1GOQA 1GONA 1PDZA 2CIPA 4E2OA 4TVDA 3TOYA 1FFQA 2FPTA 4RE2A 3AIRA 1GVOA 4HIBA 1BXNA 2OU4A 4JTHA 1PCWA 1L6WA 2HVOA 3HGOA 1P0DA 1IF2A 1ISXA 1TPUA 2BVTA 3UD6A 4H9MA 4RKAA 2QJNA 2ZDRA 2BOEX 1W2VA 3EEZA 4Z0JA 3Q58A 1QRQA 4M29A 5LGXA 3T05A 5HATA 1IR1A 1N8IA 4IISA 1VYSX 4REQA 1HTIA 5CLWA 4E8GA 3FYPA 2EPMX 1Q6OA 2QCNA 2AOSA 4K7VA 5LGZA 4G7EB 2W63A 3QW3A 3LX9A 1TVNA 3KBNA 4JTQA 1EPXA 4XUYA 1SSDA 4DI8A 4X22A 1M41A 4U28A 4US5A 1AQMA 2BHYA 3QF0A 4HPGA 1IV8A 2GSHA 1XX1A 3LV5A 3AMGA 2PWHA 1XCFA 4S3DA 3COTA 5SWUA 4JTGA 3E5PA 4QBXA 3CASA 4S3GA 3Q45A 1SJBA 4JTFA 1ZP4A 3B9NA 3UZWA 2VUYA 2QNEA 1C8XA 3WLNA 4ZO8A 1L6GA 3V16A 3EWDA 1WUFA 4OJYA 4J2PA 4XX6A 1XIBA 4RNHA 1VLWA 1HNYA 2D2JA 3LZ3A 1I1XA 1I2OA 1US0A 3FYYA 4H2CA 4B2DD 2IW0A 1JZ7A 1P1MA 1F9CA 2VJXA 5BU6A 2Q02A 3P82A 2PTDA 4XZNX 3UJSA 3N2CA 3FEMA 5BOEA 2XN2A 3VNZA 3UVAA 2ZRWA 5IBXC 2D24A 2G0WA 4GINA 3GM8A 4F2BA 3AU6A 4C5YA 1QOQA 3G77A 1CLVA 1UD5A 3K2GA 4E8CA 1FKXA 5A8OA 2BGQA 3F1QA 2HE5A 1UH3A 4EOUA 2ZZ1A 2DT1A 5TBOA 1KFLA 4TR9A 3VKBA 3O7UA 3IVSA 2YZ5A 1XUUA 3JS3A 3OEXA 1FWBC 1EJSC 2PWVA 5G5IA 1H7OA 1E4IA 2OX4A 2OTDA 3F7JA 6REQB 1POJA 2F7FA 4HNTA 3DEQA 3LHUA 3VTRA 3T0AA 2J78A 3RM4A 4M51A 1EO7A 1RQBA 3LHYA 3SUTA 4H4IA 4XD3A 4K68A 3UR5A 2DIEA 4DELA 2E3ZA 1E0WA 5AHMA 2D3LA 1NF7A 2YIHA 3DFHA 4S2BA 2RDXA 2CLMA 1ZS2A 3W1LA 1QI5A 3OIHA 1DE5A 3EOSA 3AS3A 4D6JA 3WQEA 2ISVA 3AUJA 1XIDA 4KKXA 3THDA 3ZLGA 3P60A 4F8XA 2PWDA 2P0IA 2PTYA 4ICMA 3VD4A 2VVNA 2E6AA 4LPCA 1NOUA 4LUSA 5CAHA 2FDMA 2QCMA 2Z28A 2AQWA 4NNCA 4XD6A 4EACA 1C9DA 3GDKA 4GNJA 2YYUA 3DKJA 2QIWA 1GNXA 5HK4A 1HFBA 4ADTA 3S5SA 1KM3A 1ITUA 2FGZA 2VEIA 5FEXA 4AU0A 3BV4A 4L6DA 4YTQA 3VE9A 3W7OA 5C0QA 4H8NA 3T07A 1LRTA 3GKFA 4JTCA 2Y63A 3M64A 4LFYA 3VA8A 1UR8A 2WANA 4UNKA 4FLOA 2IPFA 3G1AA 2OELA 4PUDA 6ALDA 3WK0A 1EBGA 4C6QA 1X7IA 3FCPA 3UF9A 4DBDA 4RZ6A 2INFA 4XAFA 4JFTA 2RHGA 1EZWA 2WJEA 1K7EA 4CQ8A 3GNRA 1QFEA 4GIAA 3U57A 2GYIA 1GZJA 4KWWA 4PTMA 2OVLA 5LKYA 2FB2A 5I3DA 3THAA 3EWUA 3YPIA 1A5SA 4B16A 2NUXA 4LCSA 5M17A 1J01A 2I1OA 2PDJA 3HG3A 3W7QA 3CJPA 5CJ5A 1A80A 3RGTA 1WXYA 3MHGA 3NVDA 3LZ5A 5AYBA 3PFMA 3VCRA 2BNJA 2Y5SA 4FXJA 4FF5A 4NX0A 4HN8A 1T96A 3VKJA 2Y85A 1C91A 1GJUA 4G1NA 1A3WA 4ZA0A 5CKSA