2QV5A

Crystal structure of uncharacterized protein atu2773 from agrobacterium tumefaciens c58
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
246
structure length
246
Chain Sequence
LGQLPVVGADGLRPMEQYARPWSGARGTRVAIVVGGLGLSQTGSQKAIRDLPPEVTLGFAASGNSLQRWMQDARREGHEILLQIPLEPFGYPGTNPGPDTLLAGDPAKVNIDRLHRSMAKITNYTGVMNYLGGRFLAEQSALEPVMRDIGKRGLLFLDDGSSAQSLSGGIAKAISAPQGFADVLLDGEVTEASILRKLDDLERIARRNGQAIGVASAFDESIAAISKWSREAGGRGIEIVGVSALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein Atu2773
publication title Crystal Structure of Uncharacterized Protein Atu2773 from Agrobacterium Tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 89
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04748 Polysacc_deac_2 Divergent polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 2qv5A01
2I5IA 2QV5A 2C79A 4M1BA 2DFAA 2E67A 2C1GA 1W1A1 3CL6A 1XW8A 3S6OA 4HD5A 4NYUA 4L1GA 4NYYA 5JMUA 4NZ5A 3CL7A 2J13A 1W17A 2C71A 5BU6A 2VYOA 3WX7A 2NLYA 4F9JA 4F9DA 2Y8UA 1Z7AA 4OUIA 3HFTA 4LY4A 2CC0A 4WCJA 4V33A 3VUSA 3CL8A 2IW0A 4U10A 4NZ1A 3RXZA 2XU2A 1V6TA 3QBUA 2C1IA 1NY1A 4NZ3A 4NY2A 4NZ4A 1W1B1 2W3ZA
chains in the Genus database with same CATH superfamily
5DXXA 2ZXDA 1KRBC 1U30A 1R7OA 1JPIA 1RHCA 3V0TA 2GLKA 1CI1A 5CSUA 4DZAA 3QR0A 1KC7A 3B05A 4YTQA 3QZAA 4ZQPA 5T8GA 3BMWA 4LAKA 4XAFA 3AIBA 3MKKA 1XW8A 3PN8A 4DUWA 4CVWA 1RD6A 3BAKA 3MKCA 5A6KA 4AZHA 2BHZA 5HPOA 2H9AA 2ZICA 5DQPA 1SFJA 4Q8VA 1I6NA 3UZZA 1QFEA 4FX8A 4MWAE 2WWDA 3HGOA 3TTSA 4RXFA 1XD0A 4A35A 3BLKA 3BGGA 4I6KA 3TR9A 2YL6A 2X16A 1SZEA 4I3GA 4QE4A 3LMYA 3AIRA 4RNJA 4MNKA 3MI2A 2EG8A 1J6PA 2G95A 3K4DA 3VOJA 4NNCA 4GZIA 3A4JA 4JNZA 4JPGA 4XWUA 3WEOA 4AG0A 3MUCA 2NUYA 4MY1A 1JPDX 4GYKA 3T40A 1OB0A 4QDMA 2Y5SA 1MMFA 1B3ZA 3MBFA 4FLQA 2Z1KA 1PIGA 2V2CA 3I4EA 4DJEA 1MQRA 1HO4A 2AKZA 4GMEA 4UFHA 1GG1A 3O0KA 5D32A 3AWOA 3TYBA 1MVYA 3LPFA 1XYBA 2AL2A 3B8VA 1YDNA 1MXGA 3N2BA 2YB1A 4RDYA 4K37A 3WD0A 2Z6JA 1ICQA 4KFPA 4UTJA 1Q7MA 1W8GA 1OT1A 1UD3A 3IJ6A 4WGHA 4OQVA 1CZ1A 3H24A 1UUMA 2CZFA 3UR7A 1YPFA 3A5FA 4OHQA 4Y9PA 4F79A 2OGYA 1E9IA 3HOJA 1O68A 3UXKA 1DKWA 2J6VA 4AIOA 3OP2A 3H70A 4C6DA 2YFNA 1XLLA 1MW2A 2Z2UA 1ISYA 3IS4A 4KWWA 4J28A 1XRSA 2ZUVA 3VIHA 4QGCA 4UQCA 5C9RA 4EACA 3BOFA 4XZMX 1FUYA 5F1UA 3GBEA 4P7RA 4MOZA 3R1ZA 5GNZA 3BGAA 3H7RA 3R0KA 5CG7A 2QPUA 5FF4A 3QC0A 4O52A 1YE4A 4XUGA 2G97A 2F2KA 2Y6ZA 2IUZA 1PBGA 2CZ5A 4XVEA 3TIMA 3O6YX 3VM5A 5B7YA 3FNDA 5IFPA 3SN4A 2ASHA 1DQWA 2NLYA 2J9YA 4BEUA 1UKPA 4IL2A 3WQ8A 5KMYA 5XINA 3VFLA 3RM9A 2V3GA 3DUGA 2XWDA 3QV9A 1ZU8A 4RNIA 3B97A 3UESA 1BD0A 4MWAD 3AYTA 3ZSSA 3LNPA 1PVNA 2BY1A 2GVYA 1T41A 3GDTA 4HHMA 4A3QA 5D4YA 3ME3A 4GX8A 1WA3A 5AHEA 1WAWA 2I16A 3WQ5A 1TWWA 3CUIA 4WJEA 1UKQA 4DF1A 1ISZA 4DJFC 3KBVA 3TFXA 4ATLA 4LYQA 4Z08A 5HNNA 1P4CA 1B9ZA 3SUUA 3KL5A 1EJUC 4HPHA 3LRLA 1QTWA 3WQVA 3ZFHA 3PUGA 2JKAA 5LNSA 3NQ8A 2IKIA 5LA0A 3QW4B 1UR9A 2DSKA 3DFOA 2DZWA 1DJQA 1QNSA 1NFPA 2G3FA 3ARXA 2ZZ2A 4AYGA 3R8HA 4M0XA 4H04A 2OYMA 4YPJA 3E96A 3FSTA 2ZZ3A 1LWIA 4V1XA 2CBVA 1QPQA 1JCXA 1GZGA 3SY1A 1JD9A 5F2GA 4JD4A 2QKFA 2VOTA 2PTXA 4CNTA 4HA1A 2ODOA 4DXKA 1TE6A 1Y5VA 4PSRA 3GG7A 3NDYA 4FIRA 4H9YA 4KCTA 2G3IA 2ZRYA 1FCUA 5A94A 2WVVB 2Z7KA 3RGTA 3IRSA 1TWSA 3C5QA 2GWNA 3NTYA 2FJUB 1FDJA 1EO5A 3Q4DA 3F4NA 2NQZA 3GZ3A 2YA0A 3EOSA 1E15A 1A5AA 3LUTA 2WNNA 3C52A 1WKDA 3QV7A 1CCWB 3LQLA 2PP3A 1VIZA 1NWRA 3QW3A 3CZJA 3TAOA 3LCHA 2INEA 4LUSA 4IGHA 3THUA 3VNIA 1T8QA 4C6IA 1VFHA 3VPLA 4LH8A 2CLMA 1S2AA 3VMNA 1OZQA 3GRIA 3GYEA 1UPPA 2WQDA 2YCKX 4YCOA 5I24A 2ONEA 3UWVA 1AW1A 3CQHA 4H7CA 3N1AA 4C6LA 1C7TA 3MT1A 2PGEA 4CD8A 3CHDA 3FXYA 4O1AA 3W7QA 4UTFA 4FNQA 4UTTA 1VFUA 2VFEA 4QROA 3L0GA 3OBAA 3W83A 1TTIA 4HTYA 3URAA 3VNZA 1V02A 4WDXA 3G1AA 4DO5A 3S46A 1VCFA 1ALDA 4NJKA 3G22A 3WLHA 3KVMA 4O4VA 4DELA 2F84A 4N9EA 3N2OA 7XIMA 3CS2A 1NY1A 3WDJA 4AZIA 1IGSA 1Q7ZA 3GXTA 1IR1A 5KZDA 1F6KA 1IEIA 1W3IA 1MO0A 3CM4A 2P10A 3CMGA 1BYCA 4AEEA 2E0PA 1WDSA 1YE6A 3O63A 3R2GA 3KCLA 2X0YA 1NQ6A 5FCZA 1Q6EA 4HCHA 2ZRUA 1M04A 3VGEA 1ZBCA 1IIHA 1K4GA 3II1A 1QWKA 1UQYA 2ZUNA 3ZOAA 4TIMA 4DBWA 1G94A 1UH3A 3AHTA 1PX4A 1W1B1 3DYMA 1HZYA 1UR8A 4C6KA 4HOXA 4YTUA 1GJWA 4P8XA 1EXBA 2HPMA 2NZLA 3LV6A 5FAJA 3W76A 4D8LA 1VJSA 2OLHA 1G4TA 2OX1A 3WQEA 1ICSA 1G6CA 3U4AA 4O4WA 4BWLC 2QCGA 2FDMA 4JX6A 1C9WA 3RU6A 2X1UA 1JZ2A 1HP5A 1HXJA 4Y96A 3FGCA 3GDRA 3LS9A 1NARA 3GK0A 5DCBA 4Z17A 4B15A 1SO6A 4AD0A 1F5ZA 3ABSA 5D2XA 2FVLA 2X0SA 4O11A 3MC5A 3T0BA 1NM9A 1YIXA 3GHTA 4IMAA 5JMUA 4KERA 1U2YA 2TYSA 5CQ1A 1FWJC 1KM1A 4RV3A 3K1GA 2OZTA 4DJDD 4XD6A 2QIIA 3G0UA 1W3KA 3QQWA 4HVXA 1NWSA 2XIJA 2AL1A 4GBUA 5BRQA 1AJ0A 1EDTA 3REQB 2CLLA 4RDWA 3SCRA 2OVLA 1POKA 1EP3A 1RP9A 4I90A 4QG8A 2WMHA 3W86A 3ZVHB 2ISVA 4L1WA 1PB0A 2D22A 3PG8A 3BG3A 2QJIA 4DX3A 3OTRA 3W72A 5HJYA 1S39A 4GPNA 5BWAA 1VHNA 4DWSD 3CZGA 3EDDA 1PO9A 1LZOA 4U4MA 2D69A 4LTSA 1ELSA 3V16A 1LORA 3LHTA 3TONA 2X09A 2PAJA 3U2OA 1YNPA 5AHNA 1SW0A 3VE7A 1ONRA 1X1OA 5AN7A 3FEMA 2H3DA 4XIAA 5H1WA 4B92A 3QXBA 4W88A 4GE8A 9CGTA 2E5DA 3DOPA 3WFLA 2R8WA 2YCJA 1JFHA 2EHHA 3QVQA 4IP5A 5CC5A 3UXAA 2P8CA 4HZ8A 4MDOA 1F3WA 3W7PA 1EC9A 1YHTA 3OU8A 4WSJA 2OO0A 1FCBA 3S8HA 4ML4A 2VWSA 3W7KA 4X61A 2G3NA 4XZHA 3W07A 4KT2A 1WOBA 1WUEA 3NJ3A 4PH6A 3E02A 3L23A 1U5HA 1G1YA 3GH7A 1T5AA 3WQWA 1VLWA 3T8LA 3WBAA 3U7BA 1V4YA 3M7SA 1Y7VA 4B90A 4PL2A 1Q6GA 3V35A 5MKGA 1WAUA 3E2QA 4Z1CA 4WEVX 4PBGA 3V4BA 3OBEA 4ZCWA 4OOZA 4WR3A 3CUHA 1US3A 2C18A 1I45A 3CC1A 4F48A 5FF3A 2X41A 3OZPA 2PDHA 3TXZA 1ZBKA 3WO8A 2BGNE 4NI3A 5KSWA 4Z42C 2ABBA 2X0HA 2VX5A 3IJQA 3HU7A 3DBNA 4PMDA 4CQ8A 2KZHA 1MEWA 4NILA 4HSNA 3PK7A 2QCDA 2PDMA 1UH4A 1V0KA 4OUEA 4YWSA 4F0KA 4PB5A 5DBUA 5I3HA 3ITOA 3TJLA 1Q85A 4DEFA 1TG7A 2VEIA 2YBUA 3O1NA 5BU6A 3ZJ8A 4PMVA 1V6YA 3I68A 4LW7A 4LT9A 3ZQ9A 3QSTA 3KCJA 2HBXA 1N2VA 2O7QA 2ZUWA 3U0HA 2G3MA 3VGGA 3MPGA 3WLJA 4FNTA 2PSNA 2IPJA 5FESA 2GOKA 2HJPA 1AJZA 5DMNA 1WUFA 1PTAA 5E9AA 4C6CA 2ZA1A 4LJ3A 3G6LA 1W31A 4AAJA 4P7OA 4P8UA 3VNJA 2HXTA 4KESA 2VRQA 3PP7A 5JVLA 1V3HA 3M0JA 1YNYA 1B3XA 3HQPA 1W5QA 4QEHA 3IVSA 1P7TB 2X1TA 3CBWA 2QS8A 1KBLA 1OG0A 2WVSA 3SQLA 2XH0A 3FAWA 3ZLHA 4H8UA 3M1ZA 1VEMA 1NF0A 1I60A 1UJQA 3THCA 2I57A 1XWYA 1EQCA 3WG6A 3IUDA 3H55A 4FOUA 3XIMA 4NZ1A 1EYWA 4XTDA 1C8XA 1ENUA 5LNWA 3GXFA 3HG3A 1XUUA 3EPMA 3HGJA 1MNSA 3FJ6A 1W1A1 2I7GA 4EF9A 1FTXA 3N12A 4QDPA 3PBWA 1OGBA 1BHGA 2VFHA 1P0KA 2A3CA 1R9ZA 1WDRA 5C7HA 4MB4A 1KRCC 1AQFA 3LZ5A 4H19A 3HG5A 1XDMA 1O60A 3MI6A 1FKWA 4KRZA 5AYYA 4BF9A 4H8NA 4F0HA 4JTEA 3N04A 3CYJA 1TZ7A 2J7EA 4M24A 2QUMA 1I4NA 3RITA 4JTCA 1E9YB 5EMLA 3D0CA 5IOBA 2OCZA 5A6AA 6TAAA 5HMSA 2VGGA 4UTLA 4BQ2A 1OX4B 4M19A 4I6VA 5FI8A 1GVEA 2PWUA 4JTRA 5IRPA 3E74A 2WMIB 2EG6A 3SY5A 4GYJA 3FVDA 5HAOA 1P1MA 1ZNNA 3A64A 1OFRA 1QW8A 2B7NA 3GU1A 4NU7A 1W9VA 3WMBA 4BF5A 3P74A 3EX3A 1HN1A 3E2VA 3MQTA 3HTWA 4MIMA 2WSPA 4B91A 2YPIA 5HXMA 2BB0A 1XG3A 1IEVA 2X1RA 4H7VA 1XLCA 4OU1A 1R3YA 3OLEA 3H2MA 1RJRA 2CETA 1IEXA 1MW0A 1E6ZA 2EGZA 5FF2A 5DN1A 1RLDA 5BRBA 4IISA 2V6AA 4EKJA 4L4MA 3M64A 3VDCA 3WQOA 1IZCA 4KWUA 1DWIM 4CQ9A 2H8XA 4LC8A 1W5OA 3TA9A 1XLAA 1PV8A 4E2DA 4GLEA 4W4QA 4JTLA 1SVDA 1TPEA 4RX0A 1W1PA 3ONCA 4B5XA 2OYKA 3VOIA 4AD3A 5LNUA 4BFAA 2G4JA 3BANA 2QXWA 4UTWC 4QLKA 4MLJA 3GNXA 1PYMA 4NY2A 1UR0A 2PDWA 1UOZA 5CPLA 5IM51 3PC0A 3WDIA 2NT1A 2ISSA 4JFTA 2P88A 3M16A 4GVFA 2J9XA 1TRDA 2ACSA 1R2RA 1TJRA 2OSYA 1E0XA 2R9RA 4HHHA 3LV5A 2GSEA 1Q65A 1KBKA 1XLEA 3E49A 1QNVA 1V51A 1L9WA 4ERAA 3PTQA 3GC4A 4EIVA 1DWHM 1FWAC 3K2GA 4IICA 1LUCA 1ZB5A 4IGSA 4D6CA 3PTKA 3U5YA 3G3DA 3IV8A 2E7FA 1XSIA 5K4ZA 3BJSA 3QMSA 1GOOA 1EL3A 2B31A 4JY9A 1JZ4A 4IIEA 1ISWA 2XIBA 1YTEA 3N9SA 1GYLA 3N2MA 4E4PA 4XSLA 1JUEA 3E6EA 4PC8A 4FXJA 2UV8G 3HJEA 1GG0A 5G4HC 2YOCA 1TYGA 3QV8A 5EFFA 4HMCA 1S5WA 2X2YA 2GGJA 2PDIA 1X97A 1EPXA 3PBGA 1A3XA 1EJTC 3HFYA 3ABZA 3BLFA 3GNRA 4Z2KA 2W63A 5FAGA 2Y63A 2PDQA 2DVTA 4LYKA 2Y8VA 4PMYA 3P82A 3EB3A 3GE7A 1KWGA 2E5CA 2E9LA 4R34A 1KTNA 5M3WA 2AQOA 5KINA 2X8RA 5CC3A 4DUVA 1SPQA 3ARZA 2ZZ6A 4UR7A 1VFTA 5DLCA 3GWQA 2WC3A 3EKZA 3GAKA 1LF1A 1U33A 1G4EA 2TODA 1NFBA 2ICSA 2INFA 2FGBA 3MA8A 4CQDA 4Z0JA 5A6SA 2AOSA 1E0WA 1I9CB 3C2RA 1TWDA 1H1YA 2ANUA 2XDFA 2V5LA 4TO8A 2BP1A 5CSYA 4FO4A 1Q6FA 3MSYA 3S5SA 3B9NA 3WF4A 4GVHA 2VL4A 1MDLA 1E6PA 1B54A 1RK6A 1Z6KA 3NQAA 4TMBA 3EA2A 1XBYA 4QSHA 2VHLA 5D09A 1EDQA 1VP5A 3HF3A 1UYQA 1ESWA 4ATWA 2OEKA 3S6DA 4C91A 1GVSA 2AGTA 3BLPX 4RJEA 3SAZA 4UQ9A 1ONEA 3UGVA 4QJ4B 3UW6A 1ZJAA 4OZOA 4O16A 4XVDA 4PODA 3O3RA 1F4HA 2WPGA 4G5DA 3UNTA 2ZXQA 1TPH1 4QFUA 2VQTA 4PA8A 1B3VA 4Q6JA 3PSVA 3TW6A 3WLSA 4FALA 1EFZA 2I9UA 1L6FA 4D9PA 2NQHA 3KLKA 4A05A 5GNYA 4JQ4A 3TLLA 3K4WA 4G56A 3S5NA 4QCEA 3S1UA 3T08A 4HNCA 4Z2JA 4WIWA 5DEZA 1A5KC 5E93A 2WAGA 3CO8A 3UR2A 1GPFA 2I14A 3PNUA 3LENA 3F4CA 1VFOA 3PB2A 3QTGA 3T78A 1V0NA 3WMSA 3RX3A 3P5YA 4J3SA 5L9FA 3BSMA 2GFTA 3QZ6A 5AVHA 3BZJA 5HA7A 1ICPA 1EUAA 2VKZG 4M1BA 1W2VA 3M44A 3PUDA 2EO7A 3V75A 7ODCA 3QHOA 5TF0A 1BRLB 4NRRA 3W6YA 1MFUA 3MJYA 4XB3A 4NKCA 2HZGA 2DZPA 3WQDA 4NZFA 1W3TA 3EXTA 4Q4PA 2C3ZA 3VKKA 2BY0A 3OIHA 4CQBA 2FGZA 4UOJA 3WNNA 3G5EA 4S3BA 5A5WA 4MWAA 1Z7AA 4S3FA 1R3WA 4GQQA 2TMDA 4KCUA 1V0LA 2YA1A 3RR1A 3KOWA 5MHBA 4JTGA 4N2YA 4MYAA 3M0KA 1HL9A 4I7UA 3S9ZA 3G0SA 3J7HA 2E09A 3M5ZA 4XD4A 1IYXA 2ZWZA 3UY8A 5AKQA 2NUXA 5ABHA 3OIXA 4DNMA 4OUIA 1FWDC 2ZXBA 1VPQA 1BAGA 3H2OA 4AZ6A 1KV5A 4JTHA 1KM5A 1V03A 1BFNA 3DG7A 3RJYA 4EPEC 3QLDA 1PPIA 1JI1A 4GCAA 2QCMA 2XGBA 1DORA 4J27A 1X98A 1YXCA 3LPOA 1MSSA 3P0XA 1XCFA 1J0ZA 3AIVA 4DYEA 5FEWA 5T9CE 4GKTA 3W2UA 4N0RA 1EZ2A 4KEMA 4C7GA 4WKAA 4DPPA 3B0UX 2ZTJA 3R58A 4R9XA 2VDGA 3G8EA 2OU4A 1RCOB 3GUWA 1CWYA 1EB3A 3R5EA 5A2AA 4GNKB 3VUPA 3VDHA 5M5DA 1LYXA 1H62A 3C4UA 3T0DA 4R7WA 3WF0A 2OQLA 4HZ7A 3N4FA 3BGJA 2PF8A 3ITTA 4L80A 2QJGA 5AHFA 1J2BA 2CKRA 7REQA 4W7UA 1KBJA 3B3DA 1QPOA 4RZ5A 3A24A 2D2OA 4JFSA 4C65A 2FVMA 3DHFA 2WNWA 3UXIA 2NQ9A 3HG2A 2XIOA 5KTLA 1FWWA 1R5YA 3UCCA 1XYCA 4NSBA 3M4HA 1HVXA 4L4OA 1BTMA 4HPNA 2OR2A 1SZNA 2TSYA 3G1XA 3LCFA 4NAFA 4LV4A 3EOUA 2PTDA 2ZVRA 2B7QA 1C93A 4OV4A 5I07A 3ZIZA 4OJYA 2QGHA 1C3FA 4LWWA 4FHAA 1Q45A 4AVOA 3GUGA 1H7PA 3IEBA 2XSBA 3WLIA 1D9EA 1XCXA 1L6GA 3GVQA 3GB6A 1DJWA 5K9DA 5H8MA 1AQHA 1QMLA 3APTA 4M1RA 4O10A 1KQYA 1PDYA 2VXNA 2YZ5A 4JQ3A 1ZY9A 2BHYA 5CBJA 2Z2BA 2W4XA 1CLXA 2VZUA 3KDOA 1JXJA 3QEZA 3S2JA 4EXQA 4C6EA 2WM0A 5HMDA 1U5VA 1UWIA 3CASA 4IZGA 3BH4A 3R43A 1DP0A 2P76A 2B7PA 1IT8A 1CT5A 3L4TA 3B4UA 5DY2A 4RE4A 1H3GA 3DG6A 3LRMA 3W87A 1DIEA 4GABA 4JBRA 1P48A 1XLFA 4LB3A 1V77A 3KDNA 3VNLA 1B4KA 1AH0A 4ICCX 1MDRA 3MMTA 4CNSA 3R11A 2QF8A 1CTNA 4JTIA 1JQVA 3ATZA 1YYAA 4DN1A 1E1CB 1UWSA 5BOFA 3L21A 4LUTA 3SUSA 1G4SA 2FYMA 4IIDA 4QM1A 3M0ZA 4J3XA 3VA8A 3CZ8A 3PTDA 3AHYA 2Y7GA 3TE9A 1B0IA 3N6HA 1JZ5A 1YADA 3CUJA 3NA8A 1UD5A 3CL7A 1CPUA 1GVFA 1ZP3A 3N6QA 4GA8A 1CGYA 1WKEA 3GXNA 4C1KA 3M6DA 5ECVA 1EJRC 2Q8LA 2NV1A 3TJ4A 5LNRA 3TN5A 3R0DA 2OYLA 2ZYFA 1XBZA 4O28A 1QW7A 5FSDC 4DI8A 4IPNB 1UMYA 5EBUA 2E9BA 3SRDA 1WV2A 2VYOA 3N4AA 3UWZA 1K77A 3AXKA 2DPEA 3TSMA 3COTA 1MEIA 5D33A 1I1XA 4GRSA 2HTMA 2ACRA 4DBSA 3VIMA 2X05A 1UASA 1ECEA 3H4GA 2FGLA 2ZZ1A 1U83A 3VNYA 3FDGA 3GG8A 2CLPA 5IXEA 4HK5A 4UMAA 3H2FA 5I3KA 4X2PA 1HKMA 4GIAA 1S2VA 4QJ1A 4GZJA 4W93A 3G24A 4QBXA 3RR4A 1AZ1A 1H1ZA 1FHVA 1WDWA 1EEXA 4NJJA 2RKXA 4CNOA 3PR2A 1REQA 1PZ1A 3TMQA 4E5TA 5CC7A 4IIHA 3BZGA 3IJ9A 5E0CA 4PB4A 4XK2A 4YMZA 3PZGA 1TPVA 3W2KA 2Q8XA 3YPIA 4AXNA 2DIEA 3BLDA 3EB4A 1KRAC 4AZ7A 1BLIA 3CAKA 3PZQA 4ZTXA 3DCPA 3IAQA 1AMKA 3EWWA 3IK4A 4FPSA 4L4PA 3B4YA 4L1GA 2PDNA 4IGMA 2A7PA 1LRNA 1AUSL 3CL8A 1HKVA 3V0UA 5C71A 3ARVA 3MS8A 4B3KA 3ARPA 3NL5A 2V5DA 5CLTA 1IIGA 4FF7A 3C2VA 3R6IA 3S6OA 1Q7QA 4U31A 4X9YA 3W1MA 4CD4A 4D6JA 4AW7A 3I7SA 4W7VA 1OFQA 4KS0A 3T0TA 1RQBA 3KW3A 4O8AA 3TU9A 4Y9MA 2Y5JA 2A79A 6A3HA 4N7QA 4C1LA 3AMCA 1E6RA 2RJHA 5J5RA 4Q8QA 3OB8A 4F2BA 4UTWA 3ZR4A 3QYQA 2F38A 1S3HA 2PD9A 3FYYA 3HGSA 1OX5A 3SI9A 2QVHA 6XIAA 5I23A 3DESA 4PCPA 3QPZA 2PODA 3E0FA 2EF9A 3CIVA 2OMAA 2XGIA 1E43A 3CAQA 3CB3A 4DBDA 4GXPA 4R33A 4Z2IA 1TREA 4K1WA 4C60A 2QCLA 3CWNA 1NDWA 2VEKA 5FJOA 3W01A 4W8LA 3USZA 4PEEA 3LCIA 3H26A 4KQNA 5EYWA 3JUGA 5T26A 4Y90A 2HDJA 1E55A 3KCOA 3IWPA 1N55A 3LXCA 3O05A 4KRUA 3VZYA 3R94A 4UOZA 1HGYA 2FTYA 3W38A 5D04C 1A0DA 3FHAA 2HE5A 4GJIA 3UG4A 1UZ4A 1XYZA 3F7JA 1A53A 3RILA 4CGTA 3BJTA 1KFWA 2E6FA 4ML9A 4YYFA 5IHRA 3HURA 2QHAA 5FJTA 4NZ4A 1EJWC 1UWTA 4PYSA 3FS2A 3STCA 4PE8A 3CU2A 2WV8A 1UD4A 3G0XA 3HQ1A 1W9XA 1IEWA 1B1YA 4I9MA 3OHIA 1WE5A 3VIJA 1SR0A 4B5TA 2WLZA 4IF2A 2CNCA 3AZRA 1H50A 3STGA 1K4HA 2BY2A 3IUIA 1F9CA 3KTSA 4J3WA 1ADDA 1MW3A 4CVUA 2GGEA 4RNHA 1V3IA 4WXYA 2GDVA 3DXIA 1M68A 2EQDA 1J01A 3AXHA 5E9XA 3R7MA 3SCNA 1Q6DA 3AS1A 1OIFA 1Z41A 4ZXLA 1G67A 3PPCA 1JF6A 4HJFA 4JTAA 3AI0A 3MYPA 4S3JA 1Q66A 3KZSA 3PZVA 1W5MA 4XKYA 1Y5XA 4PCNA 3ARTA 4DM1A 1LRQA 3G8RA 1Q5MA 1GWJA 2Q02A 4LS0A 3CQJA 3QPYA 3OA3A 4NNBA 3L4WA 1XC4A 3AZTA 4IMDA 1Q3NA 2IXVA 4YNGA 3TMLA 1QW9A 2L5HA 4QEEA 4A2SA 4DUXA 2EJ1A 1HO1A 1EX1A 2J8FA 3A3WA 4V15A 3A22A 2ZX9A 1EH9A 3E5PA 3GU9A 4ROQA 3OQEA 2NQJA 5AHMA 5I3GA 4AU0A 3GIQA 5LHEA 1L2UA 1CYGA 4H7ZA 3L65A 3W4RA 3VDGA 3BMVA 4ZSTA 3BLOA 4FIQA 1Y8BA 1WDPA 3XISA 1J11A 4B3ZA 5D30A 1W9PA 4D2JA 4HT3A 1NEYA 3D3FA 3WUBA 3UPWA 4QAWA 4A6GA 3QYSA 3GZAA 4K8GA 2F6KA 2DZVA 4K39A 3RU8X 5FF0A 2DZXA 2VEPA 3EDEA 2PU1A 5CJ5A 4D71A 1S5VA 2NXGA 3TR2A 3PBMA 4MJZA 4F66A 3EB2A 4MGGA 5EMUA 1XM3A 4CKQA 2OELA 5XIMA 1L6YA 5E09A 2V5BA 3UWEA 3N2XA 1NWTA 3DHDA 2I5QA 3GKFA 3JRKA 3P80A 1OFDA 1UMLA 2YXOA 2J4GA 4H9ZA 1ODUA 2ZQ0A 1FHUA 1PWLA 3AALA 4KGLA 3AZSA 4HJWA 4ATDA 1TMHA 2AGKA 2E1DA 3VD7A 2Z1BA 2IPFA 1A3WA 3CAVA 2QNEA 3RPMA 2YX0A 3CV7A 1UWQA 2DUAA 1BSIA 1NWUA 4DLFA 3WLPA 4B9YA 2PMQA 3ATYA 1WKYA 4E3VA 3UJRA 4FXRA 2YYUA 1GVRA 4PMXA 1S2UA 1MYRA 3ZVIA 3WELA 2IS7A 3H54A 1ZAHA 4LU0A 4M6QA 4MDPA 3VGHA 2BY3A 2VD9A 2BNJA 2O4MA 4LAZA 5A8NA 2CZEA 3GG0A 2WNQA 3AMLA 5ABEA 1C8VA 1JR1A 4GVGA 2CBJA 1AH4A 4ZZ9A 2ZX8A 3Q45A 2OZ3A 3GVRA 2B7OA 1FOBA 1QI2A 1VBJA 3MCMA 1LRTA 4XV0A 1PZ3A 3TTYA 1CGUA 4AMCA 4AZBA 3BCDA 1PIIA 2GQ8A 2WC7A 2OT0A 3U2CA 4HD5A 5A6JA 3FA3A 1SSGA 2QV5A 1CW2A 2Z1XA 3VIFA 2A4AA 4GC3A 2BTMA 1DJYA 2PS2A 4BI6A 1M41A 1QHZA 1J9YA 4ZOEA 3PULA 2ZZ5A 2O56A 4YHGA 4ZOCA 1SO4A 3BK0A 2OZ0A 3W7CA 3W23A 1YW1A 3M0IA 4PSPA 3TW7A 3LHZA 4H6KA 4QXIA 4O54A 3B0PA 3SDOA 4XO7A 3CT7A 1TFVA 2D3NA 2R1KA 1C7SA 4GI8A 2DT1A 1I2RA 2DZTA 4PRRA 2GGIA 4MB1A 4LYRA 4XQ6A 4UIOA 1XRTA 3U7VA 3NO1A 3P14A 3CZLA 4HK6A 1E0UA 2ZKMX 4A22A 3CV1A 3W71A 6CGTA 4IXXA 4ADTA 1TVPA 1UP2A 1KM6A 1P1XA 1J18A 4AXKA 3A13A 1XGDA 3B06A 2YCIX 2Q01A 3K30A 4UQEA 1QO2A 5CPMA 5ECUA 1LDCA 4B5UA 3CK5A 1LL4A 3QQ1A 1Y0EA 4O57A 2RDUA 3NGJA 1PEZA 4MMWA 2AKMA 2PDXA 3LZ3A 4GQBA 1L6SA 3BC9A 4CD6A 1XQKA 1FWRA 2NVCA 3LERA 3M9YA 1IXPA 1VRXA 4I5XA 3W1LA 1LL6A 3W1TA 1PCKA 1VFFA 2Y61A 4AZGA 1BXBA 4IPPA 3GHUA 2PRHA 1FWNA 3KM8A 2CLEA 5CC6A 1RH9A 3PPGA 3TJIA 3AIWA 1FFQA 4V33A 5CSSA 4DJEC 4DPQA 1GW9A 1KXTA 4XSMA 4TTUA 6REQA 4ZB2A 3NM3A 4H83A 1P6WA 1ZUAX 2DVXA 2IKJA 4DZ5A 1GKQA 3KWSA 1XFCA 8A3HA 3P60A 1BWLA 5T9BG 4MAVA 4AH7A 2XYLA 1RJPA 3CL6A 2GVLA 3OW1A 4A8RA 5GQBA 1OGSA 1F6PA 3MV11 4ES4A 2FLIA 3O6AA 3CZEA 3Q37A 1EOKA 4ENLA 1ZALA 5FSEC 4AYSA 2ZZ7A 1WB0A 1H7XA 4K68A 4DYJA 6TIMA 5CJNA 1CB7B 3OQ8A 4P2VA 4POCA 2XZ7A 1T99A 4MADA 4J3TA 4WY0F 3NEVA 5F7UA 3VD5A 3VKDA 4GCXA 1UWAA 2OKTA 5AOUA 4KEZA 3H23A 3QJAA 4KBXA 5AB3A 2WZEA 3M7WA 8XIMA 1JVNA 5FL1A 2WSQA 4KWOA 3PTMA 4WLCA 1F07A 2ATSA 1M7XA 1M3UA 1PDZA 1X6UA 3EYPA 2WZMA 3F2DA 1H41A 3SGUA 1ZJIA 4JQAA 3SB0A 3IIPA 2C13A 2O7SA 1GQIA 1I75A 2FVKA 3WDRA 1RBAA 2J13A 3PJXA 3TN6A 3ANYA 5HR6A 2CZVA 4Y9OA 2JQXA 2XGZA 3BCFA 2Z6IA 3TC3A 4J3VA 5CZTA 5AC6A 1W3HA 2WVTA 1OBAA 1ODZA 2XN1A 2JK2A 4NHVA 3S5OA 2B4GA 3TH6A 3MUXA 3JVAA 3G1SA 1WZMA 4GFIA 3VOHA 2FKPA 1VD6A 3TAKA 5CZKA 1OC7A 1N8IA 1SO5A 1NFGA 4QSFA 1F05A 4EOUA 4AHOA 3UZXA 4DXVA 1X6LA 2BMBA 1KCKA 1IE7C 5D2YA 3OZMA 4AWUA 5JIPA 2VWTA 4X22A 2WK2A 1GHRA 3IIXA 4MB3A 3F1QA 3C86A 4KMQA 1V6UA 2WO5A 1L6WA 1CX9A 1RV8A 5G1TA 1SYTA 3TZFA 3PZ9A 4HNVA 3BARA 3POHA 1XIHA 2VCAA 1TZZA 1PYFA 2KX9A 3JS3A 1GOKA 3GTFA 2O9PA 1L0PA 5CZJA 3UXLA 3QQ0A 1BGGA 3EX4A 1UUQA 4CN1A 1VC4A 3UF9A 2WCSA 4N9BA 3RG6A 3LCGA 4GD0A 3UG3A 1PKLA 1XLJA 1ZZMA 3GNOA 4MNJA 2PGWA 3TN4A 5AHLA 3CB8A 1X8CA 4PUKA 4RNFA 4LYPA 4KETA 3KBSA 3AISA 3S1XA 3S1GA 1W0MA 3AOFA 4WVXA 2XFYA 2F9RA 4RCXA 2GQAA 3VGDA 3CHVA 2O92A 1X7IA 4JTKA 1V7YA 4MF4A 1R8LA 2QUUA 4YYCA 4YWIA 4C6MA 1QPRA 1QI3A 4NAEA 4G7FA 3N13A 1B3YA 1JDFA 1W8SA 4GINA 1DWGM 4LF1A 4UTTC 2J7GA 3BAXA 1KXVA 3BLLA 3AXXA 3OVPA 4JNMA 2GSHA 4L6OA 1B4EA 3DN5A 1OFOA 1ITQA 4ALDA 3VKBA 2ZBTA 2RH9A 2IKGA 3MSGA 1PHWA 2E9MA 1QATA 2EBNA 1TIWA 1XDJA 3LDVA 2VFIA 4DVOA 4JYDA 5A8PA 1XH0A 3GBDA 1FWFC 1SFSA 4G2DA 2Y89A 3ZVHA 3TOYA 3ITXA 4KW2A 4LVGA 2BLEA 4W9TA 5LXXA 3PPHA 3SCTA 3UR5A 2WBGA 3FGCB 4JL2A 1P0EA 1GTEA 2QJJA 3CHCA 3H12A 1JF5A 1VCVA 2OWXA 3POCA 3UA3A 2PZNA 3DC0A 2CC0A 3FEQA 2ZCGA 3VUSA 3NQ2A 4JHMA 3W0KA 1VFSA 1B3OA 1OFAA 1TPC1 3N9RA 4MJMA 1P0DA 3WLTA 3PZUA 1G0CA 4H3DA 2DIJA 2WQPA 2VR4A 5C9UA 4XBSA 1ISXA 4N9DA 2VZOA 4FS9A 3B04A 1N8FA 4IMCA 3PZTA 2E4TA 2HVNA 1SJCA 4DLMA 1FWEC 1K9DA 3OVQA 4MJ4A 1XIJA 1F8MA 1PZ0A 1RA0A 5D37A 4NJGA 1A5OC 5D9NA 3WQ6A 2C79A 2FFCA 5EPDA 1NAL1 4HNTA 3KE0A 1PS9A 1QDSA 2WJEA 4DAFA 3WX7A 3WH8A 1JZ8A 3IJ7A 2Z25A 4AX6A 1IWAA 2QDEA 4MM1A 4JTDA 3SCOA 2VOMA 3ZXWA 3LI1A 4YCPA 1TQXA 4ZB5A 1K03A 3IVUA 1UBSA 3FY1A 1TPUA 4H6EA 1F4AA 4L64A 5BROA 3MZNA 4ACZB 2DZAA 1PWMA 4BEQA 4LS2A 4GI4A 1G01A 3GO2A 1O66A 1DWFM 1K7EA 1QRQA 1UR3M 2GGHA 2ZX7A 2EPNA 3GNNA 3DFSA 3FYPA 3WQCA 2AQWA 3OJGA 3VC6A 2BSLA 4ZQRA 3AU2A 2P1FA 4DY1A 1GOWA 3T9PA 4JKLA 3PUEA 4XIMA 3IACA 3P5ZA 2Q71A 5DRCA 4QX4A 3O15A 3N9KA 2F6XA 4H6QA 1H5VA 3GTHA 1E4MM 3ZLFA 1TTJA 2WNZA 1SUXA 1WZLA 3PBUA 4R7OA 1CB2A 2QPSA 3LOTA 5IBXC 3NYDA 4JICA 3RJXA 1DJGA 1F7BA 3FKRA 4EPBC 3AYSA 2XG9A 3DX5A 4NXSA 3I3EA 3DDMA 1QI0A 1UBPC 5JH2A 4LEFA 1TIMA 3RCNA 5BNKA 4BR1A 2X7WA 4RK8A 4DF0A 2J8TA 4E8GA 3GH5A 1YDYA 1VB9A 3SCWA 3N2CA 2W0UA 1HW6A 1QBAA 3KOZA 1S38A 3SRFA 4YTTA 3ERPA 3GM8A 4R9OA 5DCDA 3CMJA 5C8BB 4IJBA 2QJMA 5D8ZA 1BEUA 1EQPA 4A3RA 1UZHA 3P93A 3RDKA 3TC7A 2OB3A 3MP3A 3G1VA 4L56A 4DWDA 4GZ7A 3S5YA 1CLVA 4QR6A 2E28A 3GDKA 3KLLA 4Q4RA 2HRWA 5KEZA 3EWCA 1OM0A 1A5LC 2VMFA 3NOEA 1VEOA 4LUJA 5F2MA 1ZJBA 1LT7A 1R0MA 5H8PA 1E4NA 2UZ9A 2QUTA 3WNLA 1W1ZA 2V5KA 5REQA 4U5KA 4AIUA 2P3ZA 4AF0B 3ABXA 3DYOA 1PKYA 2V2HA 3T1GA 1OGGA 5BOOA 1M9HA 1OFEA 4I7VA 4GNVA 1XRFA 4R7JA 1EDGA 2IPWA 1TRIA 3LXAA 4US5D 4EE9A 4O1DA 1H7RA 2O4QA 3Q2DA 2DH2A 1XLBA 2R14A 3W1RA 4RKAA 3LRKA 4ICMA 2CW6A 3VM7A 2DJLA 4OBRA 3WMCA 5BXRA 5CCZA 1GEQA 4Z1BA 4K7YA 4MG4A 3EMQA 3WBWA 3L7RA 1JD7A 3INPA 4ZSUA 4W85A 2R91A 4UNLA 4XAPA 1T6MA 1YMYA 3JU2A 4R3UA 1UHVA 2OZ8A 1ZBVA 4HZMA 3LYEA 2R24A 2C6QA 5BRPA 5M03A 1GNXA 1SJBA 1V7AA 4R27A 2EPOA 4WX2A 5ENLA 2NW0A 3KP0A 1VLIA 2J74A 1H5YA 1DJHA 3AAMA 2EJAA 2W5FA 5I03A 4IH3A 2ISDA 3W85A 5AY7A 2Y2WA 4AEFA 2DW6A 4JQ2A 3N17A 2Y1HA 5I5RA 4WXZA 2GDUA 5GPRA 4ZQCA 4QITA 3S2NA 4DYKA 1TELA 3BLEA 4JEJA 3PJTA 2QW5A 1MRAA 1UKOA 2PWVA 4PR4A 4AQLA 3GXMA 4F0MA 2WANA 1UC4A 2EPHA 1A5BA 2ZIDA 3LG3A 4DNHA 4RXGA 3VIOA 1ONXA 5CXPA 3HPZA 5JH1A 3VMOA 4L1XA 3G6MA 1JNDA 2A3AA 1GYNA 1UG6A 3TNBA 4UTUA 3A9IA 3LX9A 4QAIA 2Z24A 1D3HA 1O5XA 3I7QA 2ZUUA 4GOAA 3DIPA 1W37A 3FJLA 4ZOAA 1T7LA 5G4EA 2GVGA 1KFBA 3QHMA 2FZMA 3T8QA 4D6IA 4XO6A 4YHEA 2HNEA 2PUZA 4KWSA 3WDHA 3S2CA 3ITVA 1ZAIA 4C5ZA 2Q3OA 2E6DA 2WC4A 3AYRA 3VIKA 5H6HA 3N73A 2JFEX 4HQVA 5K7JA 3HG4A 1BYDA 1EGVA 3A6OA 1I0BA 4EF8A 2O9TA 4MUPA 3ITGA 2Z28A 3P84A 2VEGA 3W7NA 5A2CA 1Q4WA 3N19B 2XTKA 4TV6A 1XX1A 1F2JA 1JYXA 3HQNA 4WDUA 4GIYA 4JX5A 3UZ5A 1GZJA 4H01A 1YRRA 2Z7GA 4AUBA 3QY6A 4CCCA 7PTDA 1VBRA 3L67A 1I2OA 3IVTA 2OODA 5HANA 1DJXA 3HPSA 1NVMA 3PS7A 3K8KA 3W7HA 2PFHA 2YIHA 4HU8A 4HB7A 3NYZA 4CCEA 3W7LA 5BMXA 4O15A 4Q6XA 4BS0A 3TWBA 4A21A 1GQJA 2WKGA 3W53A 2A1YA 4F8XA 3NURA 2C0AA 4E6MA 1OG6A 1XG4A 1UR1A 2HVOA 3TYCA 4RDVA 3C0SA 1QUMA 3KTCA 2Y24A 3TTOA 5I79A 2NVAA 3W22A 3W7MA 4S1FA 3UNDA 3RM8A 1DJZA 3LCWA 3GY1A 5HPCA 4UZSA 3GVGA 3G77A 3M41A 5LKYA 5H8UA 2OLAA 1MXSA 4YLWA 2V8ZA 4S38A 1TVNA 4B2DA 4OIFA 3USBA 3TQKA 3FYOA 3W00A 4AVFA 4G7EB 3OZYA 1YNQA 3SR7A 3V18A 2XIQA 3TTEA 3E0VA 3TW9A 3ANVA 3WENA 1DV7A 2GJNA 3W2MA 3ABRA 2GZXA 2PDCA 1LUCB 4X0NA 1WCGA 5GJPA 2GYIA 2PDKA 2XZ9A 5F4WA 4G6CA 2Y8UA 3NAVA 4Q8PA 4PFHA 1OYCA 5BXPA 1J79A 4UXDA 4OKDA 1L2QA 5I02A 3VCRA 3M0MA 2YSWA 3FK4A 4X0VA 4WF7A 3KXQA 4PMJA 4WKFA 3QGKC 3M5YA 1I8JA 4L9XA 3RAOA 1A0EA 1RZMA 3AMDA 4PMNA 4WDTA 3UPBA 3GYCA 4C6QA 4CEXC 1UP3A 1ZFJA 4I8DA 1EWDA 4ORMA 4JKMA 4AZCA 3KBNA 4FR1A 1OD0A 4NYUA 4H00A 3GNDA 1KCXA 3MDWA 3W29A 3LEPA 1HT6A 4Z1YA 3LD5A 3RRXA 4KFOA 5I2UA 3FDKA 3OZOA 1EC8A 3UU0A 2ABAA 3P6LA 2J7HA 3GD6A 3CQIA 3T2PA 1WDQA 3M43A 1GOMA 1B90A 3WLRA 1V3KA 1RK5A 1UA7A 4G9PA 2H3BA 1KV8A 2AMGA 4LALA 2QDHA 5DELA 3R8GA 3M46A 3VCNA 1KKOA 4JHZA 1SJAA 5G1YA 2O9OA 1KFEA 1QOQA 3BTNA 2OFJA 3BG5A 3E3HA 2V3EA 1TV3A 4S3CA 3NZRA 4PTXA 4CU8A 3W27A 1DVJA 1VF8A 1BWKA 4W84A 3ZLGA 2RJGA 3R4IA 1ADSA 4ORIA 4ZB0A 2PCEA 1WQ5A 3R25A 4DZHA 3OHMB 3UCDA 2E3ZA 1W1TA 1W1YA 4E8DA 5A8OA 3KVJA 4BI5A 3WF3A 3ZT5A 4FP1A 2ZC8A 2CFFA 3DFQA 4QNWA 2PURA 1VS1A 2WXDM 4HNUA 2CXEA 1PKNA 3EA3A 3L4VA 4LF2A 2NQLA 1XSJA 3AXIA 3ARRA 3MUAA 3BAWA 1Q6RA 3KS6A 1OCJA 3P67A 4IGNA 1TJ2A 4C6PA 4L65A 3SCPA 3MW7A 3WIJA 2HPIA 2QJHA 1VYRA 1IXQA 4K2SA 3NR0A 4O0QA 1K9TA 2CLFA 1PUDA 1H63A 3R8RA 1YDVA 1OK4A 3HFTA 2Q09A 4CD5A 3C3NA 5CKSA 1TV8A 2RHGA 3A23A 1FP9A 3L0NA 1EJSC 5C55A 2D73A 1KXQA 5A8QA 2G37A 3RHGA 1EHNA 3VD9A 1DQXA 5BZAA 4ZL1A 4K36A 4Q7NA 4Q3MA 4R53A 4GQ0A 3WQFA 4F0RA 4JIIX 5HNTA 1HKJA 4W89A 2C7FA 3PFMA 8CGTA 1LBLA 5CPNA 1T0OA 4EXAA 3TXVA 1F3XA 4EVZA 1MRQA 4LCQA 3W70A 2A7NA 2ACUA 3R13A 3MHFA 5E6ZA 3GG1A 3T0AA 1A3HA 5J04A 4PCTA 1H0IA 1JCTA 4EAMA 3O06A 4QISA 5AYXA 5DX7A 4AHPA 4Q32A 1HKIA 4LX4A 2PTWA 3DU0A 3MY9A 3SURA 1FDZA 4IQDA 5D2TA 4GIEA 3QRHA 2BGQA 3VILA 5HNUA 1QU4A 1JUKA 4GZEA 2WWCA 4BKNA 3W6MA 1AK5A 3VZZA 4LAOA 4OBSA 1UC5A 1U1UA 3EWUA 4QS5A 5EL1A 1LCOA 4DBEA 2EXOA 4P7LA 1RQEA 4Q8TA 1AZ2A 1EJ7L 4NYYA 4XD3A 3BICA 3BG9A 3G1DA 3WFZA 4TVCA 1HX0A 4XAYA 2A3BA 5HMEA 1DBTA 2OOFA 3KOXA 3I10A 4Y9NA 3W82A 3WDQA 2E25A 3EOLA 1BVWA 2ZZ4A 3HZ3A 4KGJA 3NZ1A 4ZO9A 4Z2GA 3VKCA 4M81A 3DFNA 3W1XA 5M17A 4TX9A 1UJPA 3MMUA 4G8TA 1A5NC 1A80A 4HP5A 2YDQA 2CLHA 3ISIX 2P8BA 3Q58A 4ZEPA 3QN3A 1U5JA 3EOEA 2PPGA 4KFNA 5EMYA 2R6OA 4GJJA 6XIMA 3DKLA 2GK1B 4FXFA 4UR9A 4MY8A 3MU7A 1GYMA 3IRDA 1TV7A 2VO5A 1H51A 1XLMA 5EB8A 2CWNA 3ALGA 1DXFA 2CHNA 2NX1A 2ZRXA 2PGFA 1XKJA 4GUJA 4MWAC 2D2HA 3SY8A 2HS8A 3O07A 1UR2A 5CZ0A 2DT0A 3VABA 3TQVA 3D47A 4B5VA 5I3JA 3C0LA 3TYAA 2DUZA 1DHKA 3ARYA 3ORWA 3S0CA 5IBXA 5C9WA 4LEQA 1ITCA 3UERA 4BI7A 4JIHA 5HATA 2GJXB 3BOXA 4WY0B 1O1ZA 1TJ1A 5CJMA 5AECA 2JALA 1RXOB 5LA1A 1PKMA 1VFLA 2PP0A 5F1VA 2WJFA 1EKOA 2F7FA 4NAFB 4JZ5A 4BCEA 3HPAA 4HKPA 3NVTA 3T7VA 1J10A 2OLSA 3TX9A 4AWSA 3K5XA 3ZT7A 4GIRA 3BAIA 1OZMA 1TPDA 2O55A 2V30A 2WKJA 5HUPA 4ACYA 4GH3A 1V3LA 3NXLA 5GNXA 3QGVA 1KXHA 3M47A 4C90A 3SW6A 5SWUA 2I56A 1ME8A 2VC7A 8TIMA 1XS2A 4QP0A 1JRCA 1XKYA 3B8DA 4WUIA 1CIUA 4JS3A 4J3ZA 3TSDA 3W1AA 1K02A 3RN6A 3L5LA 3SBFA 4EANA 4MKSA 1UH2A 3CGTA 3F2CA 3KOYA 2QR6A 1A4MA 2CLKA 4N6EA 5LNVA 4AY1A 5G4WA 1R87A 2VGFA 3Q67A 3Q94A 4FZIA 4WGXA 5D38A 3K1DA 4C6OA 1JQXA 3B8IA 4UTKA 4RUBA 5LXEA 1O4UA 2NSOA 3FOKA 2CYGA 1E6NA 2D2JA 3EMCA 2YYTA 1DIKA 1RY8A 3MHUA 5F4SA 3SM0A 3L2MA 2WOQA 3PANA 2GOUA 4NZJA 3KP1A 5LSMA 4HTBA 3C8NA 5DFAA 2F8QA 4LUTB 2WPBA 1E71M 2YXXA 2WMFA 4XX6A 4LY4A 4NX5A 3R12A 3GTXA 3VMPA 1XSKA 4ZO8A 3SJNA 2YJQA 2VDHA 1EA9C 4RPQA 5E1QA 4CCZA 2W67A 2E40A 3RLVA 4RPPA 1MZHA 2VR2A 3PWGA 4IL0A 2HQAA 4AMAA 1A5CA 4PUJA 1E70M 5FKYA 3HA1A 4UFIA 3UYIA 1EF2A 2YA2A 2Y62A 3N2TA 4U5IA 3HV8A 4JDYA 1FCQA 4DM2A 1YTKA 3VNMA 2J27A 1RCXB 1XLKA 1TR9A 2QMJA 1Q6LA 4DQWA 4J7RA 3S6TA 4Q33A 5GJMA 1PZ2A 3W7DA 2BODX 3W9ZA 1KFLA 2G4FA 2W9MA 4KEVA 1R85A 5E5CA 5A8MA 3UJSA 3BCJA 2ZVIA 4PCFA 1KO0A 3NEHA 4O1FA 1CECA 4JAWA 3W88A 3WLKX 1J96A 1LQ0A 4IFRA 2E8YA 4CNUA 2YL8A 2CWXA 3WJYA 1E5NA 4P8WA 4YS1A 3CHFA 3S4TA 4H9XA 4NF7A 3QSRA 3VTRA 3RMEA 2W62A 1AA1B 2QYGA 4LPCA 3VDBA 1DIDA 1MXDA 1NDZA 1QCWA 1CNVA 1FXQA 2HV5A 1ZAJA 4WJXA 4QE5A 4UUIA 2W3ZA 1S2CA 1K8CA 3QC3A 3UR8A 1C91A 4ZO6A 1WZAA 2GDQA 3MANA 1E9ZB 3T2QA 5HR7A 4JTFA 1SMAA 3N3TA 2BASA 7ENLA 2PLJA 1T96A 1XL9A 2PC4A 2B0MA 1J0HA 1VHCA 3O16A 3UA4A 2W61A 4DJDC 4B5SA 3WH9A 1DPMA 2ZC1A 3UT0A 3W7RA 1FVPA 3TV8A 5CBIA 4LY8A 4OV9A 3P61A 1VYSX 5AC4A 2ESCA 1BKSA 1JCYA 4WSKA 3S1WA 3TJXA 1RCQA 2WYSA 3QTPA 4ADUA 3LSCA 4WRHA 1B30A 5CPOA 1FH8A 5GVJA 1Q8AA 2GGGA 4H6RA 4DWSC 1FRBA 1NOWA 2HS6A 3CUGA 3OG2A 4I9JA 2OOGA 5I06A 2FH8A 1WZKA 2EKCA 4P7NA 4NASA 1JDDA 3L0KA 2NV9A 3ZJ6A 1R30A 5E0FA 1JPMA 1XBVA 3W7EA 4F2UA 2NXIA 4M7TA 2PGRA 2PP1A 4UFMA 3NQBA 2VUYA 1QASA 4S23A 2BDQA 3LM7A 1WXYA 3RX4A 2NXHA 2VJXA 3FIGA 4FEZA 4ADSA 1LOLA 1GONA 4UTHA 1JULA 3NSXA 2ZWYA 3RIKA 2YL5A 1RR2A 2XWEA 4EAYA 4K1GA 4CU7A 3B8SA 1V3MA 4GWEA 4HMNA 3ZM8A 2GVEA 1TV5A 1W6TA 3LPGA 3H4WA 5AC5A 2E5BA 1TB3A 1VYPX 1Z48A 3NIYA 3T05A 4YTRA 3H8AA 3BLIA 3SUWA 3DHUA 4FLSA 2OPJA 1RJQA 4UQAA 2PC8A 4M6VA 4JDBA 1HJUA 3WJSA 3FX4A 2V67A 3GR4A 1OHLA 1A5MC 3CTLA 1OWQA 4L6DA 3OYZA 4NJHA 1OEPA 4ZE4A 3IANA 1AL7A 3MO7A 4FNRA 1BSLA 2E6AA 3E1F1 2VT0A 3T44A 3LGGA 4M6UA 3A9BA 1X96A 3SJ3A 3VNDA 4IP7A 4LCRA 3KBMA 5FEZA 1OINA 5AFDA 3LBOA 3SSZA 4Y6GA 4XD5A 2VQUA 5CH9A 3KRBA 2XH2A 3UBPC 4OVXA 1CGTA 1RLCL 3L12A 4XKYB 2X40A 3U57A 4UR8A 4Z2LA 3NL3A 1QT1A 5DRIA 4UQDA 3E38A 3SRHA 2BOFX 1ITUA 4B5WA 5FJRA 2Y5EA 4W86A 1LG1A 3BJFA 1M7OA 1US2A 4Z0SA 3AQUA 4M82A 1LQ2A 3TZNA 3IIZA 2VTFA 3WMLA 1UP0A 5GJNA 1RPXA 2G8ZA 4GI6A 1G7VA 4ICNA 3IAPA 2YLAA 4REQA 5F2LA 2QAFA 2YCLA 2Y0FA 4A3HA 1YBQB 3MV01 4TUFA 3WK0A 4DJFD 4UZUA 1D8CA 3BV7A 4FA3A 1EA0A 2VNCA 3GXPA 3MSRA 1JGIA 1WBHA 3BXWA 2PBGA 4WZHA 3WL1A 4E2OA 4HK7A 2UY5A 1R47A 2DY3A 1FHLA 5LA2A 1XR2A 3CUXA 2JGYA 3GH4A 3UQNA 1AJ2A 4EXBA 4NL1A 4JHOA 3T42A 3NCOA 4PGLA 3W75A 4TX8A 1JCMP 1TUFA 1MQPA 2AAAA 1JPHA 3RXZA 2ZTKA 4OBTA 1X39A 4QHRA 4IP4A 3TYEA 3OLGA 2XFRA 5A3HA 3MMDA 4FI4A 2JKPA 1KWKA 1EGZA 1CGVA 2VVNA 3DEQA 3F5JA 2PDFA 3CLMA 5TIMA 3VE9A 4L61A 1IWBA 5D2WA 3BW2A 2FZ8A 4XZIA 3P81A 1KFJA 3KTXA 3KX6A 1ZPTA 2FTWA 1OCQA 2JIEA 3UYCA 2GQ9A 1OJXA 4X2RA 1R38A 4MY9A 4KIRA 4IFKA 1EX5A 1GVYA 1K1DA 5F4XA 5BWFA 1LWHA 3IJ8A 1DJIA 2VFFA 2B81A 2JF7A 4E38A 3W73A 1S2WA 3MI3A 4FB7A 5E0KA 2R1LA 2WM1A 3ES7A 2HK1A 1C90A 3TDFA 1FCVA 2XH4A 5HK4A 1JAEA 4O1CA 3CV2A 4L7ZA 3SRKA 5FACA 2Q6ZA 3BAJA 1ZLPA 3L4ZA 2YGYA 3MHGA 1GGOA 3TQPA 5C2CA 4RR4A 2R1PA 3BV4A 3B8WA 2OX4A 5JU6A 3LU2A 1HJXA 1SU5A 1W2PA 4M6PA 2DT2A 3VD3A 3B8TA 3VYLA 1H49A 5PTDA 4UFLA 4MUZA 2BXVA 4C1NB 5G2HA 1JDCA 2PA6A 1TR1A 4TV5A 3VVGA 2G0WA 3QMTA 3CO4A 4WK9A 3EWZA 1BYBA 4HCLA 2GPTA 4PTMA 1NELA 1ITXA 4PRTA 2V3FA 4PBEA 1EO7A 3PAJA 1ML1A 5G1MA 4JL1A 3VIPA 3FJ4A 4N4QA 4WQ6A 3ZR5A 2QULA 2I5IA 3KVKA 3DG3A 3NQ7A 3KOFA 1LM1A 1O94A 3QY7A 1C8QA 4A29A 4PRWA 4LQ1A 1TPWA 1VRDA 4RZ4A 1KW1A 2NWSA 1UQZA 5HNRA 2HSAA 1NU5A 3NNTA 2NVDA 1QNQA 1ZHAA 3F4WA 3P62A 4I5RA 3H7VA 3QGAC 5J8LA 1F3TA 2PLKA 3GQYA 2RAGA 1CDGA 3VO0A 3OBKA 1J4EA 3FN9A 3PG9A 3NWRA 2PB1A 3I6EA 1HP4A 1RBOB 2DQWA 5LIYX 1HTIA 4HCDA 1KQZA 1OK6A 4Q8OA 2A0NA 3W81A 1FWBC 2REQB 2NX9A 3NPUA 1O95A 4H8HA 3UCQA 2QDDA 1VFMA 1SQ7A 5KETA 1P0NA 3OGSA 3R0UA 2IQDA 2F61A 4US6A 4UFJA 1EP2A 4JFVA 3RF9A 2EPKX 1FWHC 2YBTA 4F0LA 3W37A 4U2ZA 4FLRA 2CXGA 3RO6A 3LXBA 4JN8A 4HN4A 1XIBA 2W6RA 4GVIA 2DGAA 2CESA 3LTSA 3PY2A 3AROA 2PDPA 3KAOA 3FKKA 1XC6A 5I3FA 4XBKA 3CJPA 3VKAA 2OQYA 3ZS4A 2YLLA 4ZOBA 1GHSA 5A2BA 3S9IA 2WHMA 2O9RA 3L4YA 5D9PA 4IPJA 3FHQA 4QLLA 1J93A 4CN6A 3RCMA 4IMFA 1PTGA 2PTZA 1V5XA 3QV6A 4GQRA 1BXCA 3NO3A 4Q4SA 1TTPA 1XV8A 4ZMGA 2TRSA 4JGDA 6REQB 5K3VA 4RZ6A 1S2TA 3H6OA 2V82A 1XIFA 3MP4A 3C2OA 3APYA 2HCVA 2CHOA 2NT0A 1HFBA 3GFXA 2XFFA 4HSHA 1EBHA 3TROA 3I7RA 3H22A 1XIIA 4K7VA 3N3MA 1KLZA 2DVUA 3EKGA 2ZXAA 3C3UA 4PUMA 2V0TA 4AIEA 1E0TA 3WEZA 1C8YA 2WHKA 3OYXA 2XH7A 1DE6A 2FHCA 1I0DA 5EGRA 1UROA 2JF6A 4LNYA 3PHAA 1FH9A 2BV9A 4WSHA 4S3DA 1CXEA 1W17A 1TCMA 1TJ0A 2BWGA 1MZRA 2BG5A 4YIWA 3LGDA 5AHIA 4MFEA 4WDWA 1QBBA 2VZTA 4WJ8A 2HROA 5BOEA 2X2GA 4S3KA 2JE8A 3MUY1 3GKAA 3PB0A 3QR1A 2PDGA 3B8UA 1XH1A 9XIAA 5I77A 3CH9A 1OC6A 1PCWA 3V3WA 1QHPA 2J9ZA 5XIAA 1RQHA 3AU6A 3BSHA 1YKWA 3QY8A 1MUCA 1OYAA 2GJRA 4XBJA 4JCLA 4BQ5A 3O7UA 3UWQA 1S1RA 5ABFA 2WZTA 5HQMA 1SM9A 1ECQA 3WF2A 5C9XA 3P3BA 3OLDA 4J2MA 1HGWA 2BBFA 4TTGA 1DE5A 2YL9A 5LIUX 2DSWA 1P6BA 1H1NA 1JCJA 4V2XA 3OEXA 1E9LA 3SN0A 4O1BA 3VOFA 1G5AA 3A5VA 4QDWA 1VPXA 1GQKA 3LBMA 4J3UA 4LBSA 3W1UA 2XM2A 1IR2A 4N02A 3NPXA 5HOSA 3EA1A 3LGEA 3ZWSA 4ZODA 3BQ5A 3K8LA 3TUUA 1XYFA 5FEPA 2FTPA 3W84A 3NM1A 2C15A 1TKKA 1N8WA 2RDWA 1XIEA 4K3ZA 2OXNA 2UY3A 3CT2A 4J5NA 3WLLA 2GUYA 2Y85A 3RCYA 1WOAA 3ABQA 5TQLA 4S3AA 3PPFA 3EKLA 4O0KA 4QJ3B 3QZEA 4JYEA 3NG3A 1PX8A 4FF5A 3SFKA 3PZNA 5KZ6A 1SJDA 1W1VA 1W3JA 4GK8A 2HEJA 2E6YA 4OTKA 1Q6CA 5DANA 4BZYA 1KKRA 4NIRA 1ZP4A 2VC6A 2ZUSA 4HPJA 1M5WA 1H60A 1BQGA 2R94A 2R82A 4Q4QA 2J8GA 1KR1A 3UVIA 4RLIA 1WX0A 2XUCA 1BGAA 1UPMB 3K8MA 4C5YA 3DKJA 3NDOA 3W7OA 4AHQA 4Y8EA 3THQA 8RUCA 1WPCA 3E0IA 3WCZA 4ZGYA 4M7SA 3D3AA 1DWAM 1F74A 2Y7FA 3O8AA 1FHDA 2VX7A 5I0DA 5D03A 2MNRA 2XIIA 2QGYA 5D02A 2G3JA 4DJDA 3LCLA 2BS9A 3U3HA 5HINA 3HGRA 5D9MA 3LNMA 3KFTA 3N15A 4DO4A 3NZGA 1OY0A 4J35A 2OEMA 1UA3A 3LBCA 4MNMA 3S83A 1Z3NA 4KIEA 3CYVA 4AIBA 3GIPA 3I6RA 1OD8A 3E2RA 1OFPA 1YXDA 2BVDA 2INZA 4DWSA 2CIPA 3VINA 4DUOA 4NAEB 1EF3A 4MNLA 3RUBL 2QDGA 1TPB1 1DXEA 4PL1A 1EUNA 3LN3A 1ZTVA 2YFOA 2PLCA 3E0WA 3SGGA 2FMNA 4ECLA 4IUOA 3GTNA 2HE8A 3SEPA 3SUVA 2QAPA 1EOMA 1H0GA 5BXTA 4N4PA 4AD1A 4DF2A 3SIZA 2C1IA 5ABGA 3S9YA 4UC5A 1LOSA 3WNMA 2E77A 2QEZA 4TVDA 1RA5A 1XPYA 3GS6A 1TQJA 3B0YA 2CHRA 4ONVA 3ONBA 3BO9A 1AH3A 2YW4A 3W2NA 3TVAA 3U4FA 4LV9A 1IQ8A 5FJUA 1W3NA 5LZLA 4EPKA 3K13A 2D23A 2PCQA 1XIGA 2XJ7A 1QR7A 3UVAA 1TA3A 3CWHA 4YVVA 3GHRA 4O50A 4S2BA 5J5DA 7A3HA 2Z2AA 2OO6A 1R3RA 4O14A 4AC7C 5I3IA 3ABOA 4H9TA 2QCCA 3ARSA 3DI1A 4ACZA 1FKXA 1RY0A 3QOKA 1XBXA 3CAWA 3NZQA 5AYIA 3OO2A 1A4LA 4MYXA 3WKZA 1POJA 4GBDA 3LA4A 2V5JA 4QIUA 3C6CA 1LWJA 1SZFA 2PRLA 3ARWA 1OSEA 2EPMX 1P43A 3T4WA 1JZ3A 1VJZA 2GSJA 4IT1A 4P7QA 1XD1A 2DQXA 4HGXA 1VQTA 1M7PA 1R7AA 1UR4A 3BQ6A 1D7KA 4GXWA 4UFKA 1JZ6A 2XM1A 2A5HA 2YDSA 1RPKA 2A21A 2EEXA 4CNPA 1GKPA 4UCGA 1H2JA 3IUHA 2PWGA 2ZOXA 3LB0A 3N34A 4FK9A 1OT2A 3G1HA 1XJBA 3VU2A 1J6OA 2H90A 2YW3A 3VDAA 3TN3A 3O0FA 4GG9A 3FA4A 3C2YA 3TCSA 4FOJA 3VCCA 3TK7A 3CXOA 3OG3A 4XZNX 4M29A 2Z00A 3GAYA 1UD6A 4UCFA 4NJIA 2A85A 4CQCA 4MVAA 2Z1SA 2E1WA 3UFYA 1JYWA 3TLQA 4IG2A 1BG9A 4HU3A 2PDJA 3TCEA 1I1WA 3I3BA 1R6WA 2ZUMA 4H41A 2W79A 5FJIA 1HL8A 3VIGA 1ISVA 1S3TC 2C8NA 1JJKA 1L8NA 1U1HA 1DTUA 1YLVA 1WDDA 2FPVA 3C61A 4LANA 3B40A 3AS3A 3M0VA 3KRZA 1RBLA 3AJ7A 1UWRA 4PMQA 4GYFA 2D2GA 4NX0A 3HPXA 1FFRA 4Q7IA 4J1OA 2QF7A 3THAA 2YZRA 1OCBA 1KGWA 3RNDA 1D2KA 4R5EA 1JDEA 1K8ZA 3ANUA 4Z2HA 4AF0A 2BVTA 1A50A 4QQ3A 3P2VA 1QXLA 1X7FA 1NDYA 4DHGA 4LXFA 3VK5A 1BKHA 1FBAA 1QNRA 1RALA 4QE1A 3U2EA 4RE0A 5LHFA 3IJIA 1UD8A 4ASTA 3DZ1A 3I65A 1VIWA 1QI5A 2QCEA 2FJKA 3D46A 3UP8A 1TE1A 3W2LA 1TZ9A 1F6YA 3MP5A 4KF1A 1FQ0A 4EWND 3WD1A 3WD4A 1A47A 5I6SA 3WDPP 3ENLA 2J78A 5C70A 4PTDA 2CBIA 3UY7A 2C1GA 3DECA 3V1HA 3WNOA 4PULA 2PZ0A 4E4UA 3AHXA 4UMBA 3EGJA 3APGA 1M03A 3F5LA 3WJWA 4GH1A 5JBFA 4LB4A 1YTDA 5REQB 2V38A 4I8YA 3ZJ7A 3TYDA 2JBMA 3QF0A 1EJXC 1TX0A 3RLGA 1W3LA 4UOQA 3U8GA 4ZQNA 4O53A 3W1NA 2ZE3A 3B03A 3O6DA 4Q8WA 5EY5A 1FX6A 3MYOA 4MZ8A 1BWVA 5AC7A 3W28A 1G9HA 5TNVA 2VELA 3MZ2A 3CWOX 4AC1X 4AZ5A 2BXYA 4JNYA 1CBGA 2X30A 2C0HA 2CPUA 3QPEA 4LBRA 3KBJA 3B9EA 2F2HA 2DH3A 2ZA3A 2PDUA 4HBKA 2XVKA 1Q8JA 4LRTA 1KD0A 4LVAA 3LI0A 3WY1A 4HYRA 3W1QA 3LLXA 2I9EA 1OIMA 4P5UA 3VFCA 3WSUA 4I5UA 3WFAA 3KRUA 1RVGA 4A3UA 2IQTA 4S2CA 3L5AA 4S3GA 2DUXA 3PVFA 5FA5A 4GI9A 4JN6A 8XIAA 3DYPA 2JEPA 2Y4SA 4GO8A 1F8IA 2TAAA 3UZJA 5FJPA 4PUDA 1XISA 1SMDA 3F5KA 1I2QA 5A6BD 5C9ZA 2EAWA 4WCJA 3FVMA 2IW0A 2FPYA 5JIWA 3CQ0A 2A7RA 4BQ3A 2H8ZA 1H09A 4PUWA 2VI0A 2PD5A 1JFXA 3S2MA 2WMGA 1M53A 1J0IA 3WLNA 1K6WA 4IIFA 4D1IA 2UY4A 5AZ0A 2Z29A 4ZENA 2ALRA 3KZPA 2FHBA 3SCUA 3DC8A 1UIOA 4JTUA 3WBYA 1JXKA 3CEPA 1HJSA 4W5ZA 1MW1A 4GACA 5EKYA 1HIZA 3N11A 2H9AB 3A3HA 4HIBA 2P50A 2VDIA 4HHLA 1S5MA 2VFDA 2FB3A 1JYVA 4IIBA 1VKFA 2DSZA 1ZBWA 4JYFA 3FAXA 3L2IA 2WCAA 3VX1A 1D3CA 5EA9A 3CUZA 3CPGA 2PBOA 3N4EA 3GR8A 3FXGA 3A4AA 2ZFAA 3W26A 1OADA 3SIMA 1I2PA 1TSIA 4MTVA 1TV4A 2XSXA 4GJ1A 1TVLA 2JIWA 5D9OA 1CXFA 3VIIA 5K2ZA 1XQLA 5HJLA 1DEDA 1ZENA 3TTQA 2XN2A 1RAKA 1V93A 4RZBA 2W66A 3NDZA 1GVIA 5DY3A 5HULA 1OX6A 4N6FA 4MKNA 4L9ZA 3TYUA 3UEQA 3H21A 3VZXA 4G1KA 1C9DA 1XDLA 4K8EA 4G7EA 4XAGA 1YPXA 1A0CA 3RMJA 4GY0A 2WSRA 1BYAA 3PJUA 1M7JA 4DJFA 3R89A 4MSSA 5IDZA 2AL2B 2XIMA 3PNZA 3LK6A 1E73M 1NIUA 4QCFA 2D0GA 3DGBA 2J62A 5CGQA 1XLIA 4C7DA 1R3TA 4HA0A 1BPLB 3GW3A 2V69A 1GEHA 3EEGA 3A4WA 5FEXA 1LBMA 2P3EA 1EIXA 3GFZA 4TMCA 1FH7A 4OECA 5A6MA 2XPKA 3LHYA 4B4FA 3SQMA 5T91A 5BCAA 4F9DA 1BF2A 4P61A 2VZSA 2DW7A 3PZMA 1P5BA 4O17A 3AICA 3T6CA 4UQBA 1GJUA 4U33A 1XH2A 3G1FA 4PTWA 1WP6A 5JQ9A 4GUFA 2VENA 3GIYA 2GVJA 1YQ2A 2DV0A 2C71A 1V3JA 1SW7A 2J66A 3IV3A 3LHUA 3EBVA 1B5TA 2BZNA 1LP6A 5CBBA 3ZJKA 4RV8A 4PBFA 3WUEA 3AYVA 2C1HA 4LVDA 3FA5A 5B7ZA 2WB5A 3CMFA 5D2VA 1QVBA 4LC6A 4YU1A 1E6XM 5HBFA 2A3LA 1XPGA 2FZNA 1R9YA 1WXJA 1UOKA 2NV2A 4I9AA 4A4AA 4ROPA 4IQJA 3UD6A 3EPNA 2G5WA 4PMRA 3VAVA 1E56A 2WJDA 4AEOA 4AWTA 1NSJA 4U3AA 4DAIA 4LUYA 2E8ZA 3T81A 3VC5A 4NT0A 1K8XA 3FFSA 4BA0A 3IGXA 3BPWA 1IZKA 1K7FA 4HNLA 1XINA 1ZJHA 4CEUC 2POTA 3NFUA 1D8WA 1T8XA 4AZCB 1CXIA 1LLWA 1NH6A 2WZHA 5EMMA 1PHQA 5TAOA 1K70A 3GC5A 4XZLX 3VD4A 3B0VC 1EP1A 4IIGA 3LCXA 2BVWA 1SW3A 1X1NA 2PI6A 2ATMA 1M65A 4QQUA 1EIBA 1Q6OA 2ISFA 4D6GA 1SFTA 2TPSA 3NQDA 5HWNA 2PWDA 2WVVA 3WLMA 1W9DM 4TR9A 2ALDA 5ABTA 3I4KA 5I78A 3G18A 5C2XA 1MFVA 1JYNA 2W92A 3QKZA 1EWEA 2CEQA 4JIEA 4LNCA 5F2IA 2PTYA 4OWGA 1Q4NX 4Z1AA 4OT7A 1AVAA 1OVDA 1UZ1A 2FDSA 2J7FA 3BW4A 2A3HA 3C2FA 1BF6A 4HA3A 4IMEA 1NOUA 3E5BA 5JXQA 3HIJA 3R10A 1FWGC 2SFPA 2BOGX 1IZJA 4H9UA 3BOLA 4MZ1A 2WMKA 1NOFA 4PUNA 5B80A 1MEHA 2GJPA 4EP8C 3RX2A 3I6TA 3NVDA 4GX9A 4WD0A 2OG9A 2J24A 4X3ZA 1GOQA 4LAMA 2FHFA 2POZA 4FNUA 3HM7A 4A8IA 1TJPA 2RUSA 1Z44A 1QAPA 3GR7A 5IDIA 3K4AA 3UPMA 3CNYA 3TNOA 4F4RA 2DORA 2XISA 3HO8A 3MB9A 2WSKA 5CSRA 4BY3A 1ME9A 7TAAA 2KAUC 3WJXA 4XAZA 3UWWA 1MUMA 4LUSB 4BWLA 2ADAA 1XXXA 1IT0A 2QCNA 1QI4A 2F6UA 4MKVA 3TSBA 3MWCA 4TOQA 4D6FA 4GQGA 3N18A 3PJWA 2PEVA 1FY6A 2DDXA 3O9NA 3L66A 4OFCA 5HQLA 3GXIA 4DO7A 3U2ZA 3EX2A 2BFGA 3NXFA 1FWTA 4URIA 3EWBX 3W24A 1O5QA 4YVPA 2YDRA 1J0YA 3QR3A 2P53A 4W8AA 2PLMA 3EXSA 4UNIA 1VBGA 2ZRVA 2A3EA 3URQA 4FOKA 2G50A 2D0HA 1F61A 1CXKA 1K9EA 4MPKA 1DIOA 4PN2A 1Z8AA 3BUVA 3EWXA 1VGAA 2VX4A 3GU2A 4QJ5B 4P8VA 3UJ2A 1QO5A 1WO2A 1VR6A 4V27A 2QLYA 2BVYA 4L6HA 5EMJA 2BXZA 3VNKA 4NRSA 5C0QA 4HYWA 1V8EA 1OF8A 2WCGA 3P8JA 2JKEA 4ZFMA 1F3EA 1H4PA 2OQHA 2VM8A 1AD4A 1DTNA 3GSMA 3EPOA 3GC2A 1ONWA 3UZYA 2GK1A 3H2NA 2RDXA 4WHBA 2ZUTA 3TA6A 4DIAA 4YJ5A 3PSWA 4C6FA 3MJMA 4YTSA 1TV2A 4A8NA 3M5VA 4B9ZA 3KL3A 3S5ZA 1QOXA 2JGQA 1N7KA 5DF0A 2HMCA 1J8VA 1MQQA 3W7GA 4JCMA 2C19A 5I09A 5HWJA 2IKHA 3U5UA 5K9CA 2CZDA 4ZVJA 4AY7A 3AO0A 2DZUA 1X1ZA 4EPDC 3QFWA 1G7UA 1LLZA 1AL8A 1QHOA 4IPIA 5KZMA 4MJ2A 3RLUA 1Q63A 1XP3A 4ILSA 2Z1WA 2V3DA 2VRKA 3MO4A 1US0A 4C7FA 3E0LA 1UKSA 3REQA 1E3ZA 2R1NA 4D6EA 2VGBA 3DERA 1SZRA 2GJXA 5BXSA 3FLUA 3T09A 4WY0A 4K38A 3WK1A 2Z26A 3VOGA 3V5FA 2D3LA 4JTQA 2XVLA 4QRNA 2ZDRA 2NUWA 1Z42A 5A95A 1RD5A 2VRJA 1DOSA 2YCEA 5EU9A 1KM0A 3S1VA 1EHAA 2FMOA 4KH2A 4NNAA 2OSWA 1SFLA 4F0SA 3TOPA 3AMGA 4H2HA 3W3OA 3UJFA 4AWEA 3WN6A 3N14A 1KTBA 4KCWA 5G5IA 3OVGA 5FL0A 1XIDA 4ERIA 5I3DA 3QOMA 1E0VA 1GW1A 4IQEA 3HBLA 1SSDA 3T55A 3KWXA 2MANA 4V1YA 4E3TA 5M1TA 4E0CA 4BF7A 4B4HA 3IJDA 1OCNA 4RW3A 4G1NA 1PE1A 3WUFA 3WBXA 1O12A 3ZO9A 3SECA 1S5NA 3NOYA 1Q13A 1FWCC 1AG1O 3LQGA 3NGFA 4O8RA 3WK3A 3DHPA 1IHIA 4BK9A 3AHVA 3NPVA 1LTDA 4JIPA 2D20A 2OWWA 4JIQA 4UBPC 1YDOA 2J77A 5A8GA 3GFYA 1ME7A 1BTCA 3VGBA 4Y9AA 4EX4A 3GXDA 4N9CA 3C56A 4J4KA 1JGMA 4IWWA 1NTHA 2CBUA 3AIEA 2X1IA 4E8CA 1Z69A 3L5MA 3V36A 4UB9A 5TBOA 1BQCA 1WKFA 4IXHA 3F2BA 3HMJG 4IMGA 1EYEA 5TD4A 3A12A 3UZWA 4LVFA 2W91A 5CPTA 4M56A 3NUKA 1ZRQA 4I9TA 2P0OA 4Q8UA 3SSJA 3FCPA 2RGMA 2OJPA 3SUTA 1Q6QA 2E67A 2GWGA 3E9AA 3TFCA 3WD2A 3EX1A 3WUGA 3GNPA 2ISWA 4HU0A 1VEPA 1NF7A 1E1FA 3W25A 2J7CA 4GHRA 2NLIA 2FPTA 4XZBA 4PZVA 3O2LA 4GGBA 3GX9A 3ELFA 4FX7A 5DT5A 3V5CA 1RVKA 3NSNA 4FSAA 4M3PA 4CUCA 3DH7A 5MKGB 4RDZA 3M0HA 1VPYA 1W54A 3CPUA 3AMKA 1KR0A 3R79A 1OQFA 2VEFA 4Q4KA 4GYPC 1W1IE 3UG5A 1JPKA 4D1JA 1XICA 4L4LA 2VZVA 3GVWA 2I1OA 4Z1DA 1KB3A 2PDLA 3EAUA 1PXGA 5CPSA 5HQEA 2C16A 1VBHA 3E2SA 1JNEA 4L9YA 1X8FA 3P8IA 4U2YA 1HJWA 1GVOA 1J12A 4FX6M 3UGRA 1AD1A 3LHVA 3CQKA 1KBBA 1FP8A 3DFTA 4OE7A 4NXKA 1XYLA 2ON3A 2QCDB 4CN4A 2DSVA 1D3GA 2FZ9A 2NX3A 3LMZA 4U3CA 4Y8FA 1VH7A 1P7TA 3A21A 4XZ9A 1K9FA 1P6CA 1QWGA 3VI2A 1MUWA 4CNNA 2FQIA 2VC5A 3F4DA 5C7VA 3L4XA 3KHJA 3IIOA 1JCLA 1V6WA 5MF5A 3TP4A 4LVBA 5DBTA 3JZEA 2I5GA 2XINA 2DZSA 3S47A 4RW5A 3STEA 4CCDA 1XF0A 2OEJA 3QLLA 4MFDA 1HVQA 1OYBA 2CERA 5AZ1A 1Y5WA 2QV4A 3EDFA 5C54A 3OVRA 3W74A 3WYZA 4IX2A 1JUBA 4RE2A 3SO7A 3PFRA 5LIKX 1WNOA 3NO5A 4HYVA 4IM4A 1PIFA 3WLOA 2J88A 1J0KA 2X42A 1PTDA 3CIXA 4HNNA 2IPGA 2DIKA 5KITA 3RLHA 3AHZA 3NQGA 4Q22A 4AB4A 1N82A 1V0MA 4GISA 2Z4GA 4ZR8A 4GKLA 1OX4A 1GOIA 3NL2A 1WXZA 5CGTA 2WMIA 1LQAA 1THFD 4D8AA 3MUIA 1RP8A 2FFIA 2ZDSA 3HN3A 2PE4A 2XSAA 1PAMA 2WMJA 3MVIA 5G2WA 1C29A 4PB3A 4NZ3A 2IMRA 1IXNA 1O7AA 3C2EA 3NL6A 1BXNA 4HHPA 4PTNA 1E72M 4PUEA 1H7WA 4D8ZA 1LJYA 1VJIA 1S46A 3C0JA 3GTIA 3JZUA 4AD4A 4DRSA 1IWPA 1GQNA 2WSYA 4XKMA 1D7FA 2QUNA 3CIWA 3N6JA 4PMZA 4DI9A 2QPXA 3K46A 5CG0A 1ZS2A 3AJXA 1IV8A 4UTIA 3B9DA 5C6MA 3KS5A 1HJVA 3W1PA 3QM3A 1KM2A 2VR5A 5HDRA 2FZDA 2UY2A 4W87A 3ALFA 2XVGA 4D72A 2H6RA 1V6TA 3FV9A 2CLIA 3ID7A 1LLOA 2ZE0A 2XFWA 2QVNA 3QH2A 3G1RA 3QHNA 2UWFA 5FD0A 5AYBA 4PFMA 1GZ1A 5U7SA 1QNPA 1V6XA 3LSBA 4X9SA 1CXHA 1AW2A 3T4CA 4AD2A 4JTTA 1SO3A 5G2IA 1HJQA 1WYIA 1HF6A 1KFCA 3WLQA 3HV9A 3RYSA 1O5KA 3KRSA 1Z9AA 3H2EA 4X63A 3HPFA 2DT3A 1DJNA 4ZTYA 3L2LA 3CV6A 3RM4A 3SCVA 4KEUA 4BQ4A 3NQEA 1RSCA 4D6DA 3S42A 2DSUA 3JW7A 4DBUA 3OGRA 2RDTA 4H9MA 1OC5A 1XRVA 2VURA 2VUNA 1UWUA 1YX1A 3U9IA 1FA2A 1CGXA 4HPXA 3T2OA 2A2IA 1CLKA 4H4IA 5AYZA 1B57A 1X6NA 3S3GA 5L6UA 1I2NA 4MPQA 4CQAA 1IGWA 1KBIA 2Y7EA 2Q3RA 1K7XA 3CEUA 4DJED 3O6CA 3B0XA 2GUUA 2CU0A 1U1JA 4AX7A 4INFA 1ZCCA 3N29A 3WNPA 1YBQA 3WD3A 2PWEA 5LIWX 1YXYA 4JFUA 3HQOA 4U28A 3LLDA 3SZ8A 4ZXOA 4Q8MA 3WF1A 4KKXA 1Q2RA 4NG3A 1LL7A 3GDMA 4FR6A 1IF2A 3MVTA 2ZRZA 3LTPA 3AUOA 5HWMA 1EJVC 5LGZA 2G96A 1X38A 4OGZA 4B3LA 1W56A 4XZWA 1VAHA 2E68A 5LGXA 5A6BA 2J6XA 4PMOA 4QG6A 3RPTA 3DENA 2D24A 2V9DA 1A5UA 4GXMA 4JEQA 2A6LA 2BX7A 4B2DD 5DCEA 3WQ4A 1QK2A 4JIRA 4XISA 4XUYA 1P0BA 1GORA 1KRMA 5E6YA 4CLMA 2YB4A 2VEMA 3CUFA 1O1HA 4REQB 3ECQA 1NJJA 5I7GA 2YCLB 2DJXA 2WZIA 3Q65A 1LROA 2Y88A 4LGXA 2UBPC 2WLYA 3F4VA 4HU4A 3E12A 1R86A 1XLGA 4YN5A 3URBA 2FIQA 4LBUA 4U10A 1LBFA 5BMWA 1NP2A 1HKKA 3MUZ1 1Q2SA 2AAMA 3EMZA 4GUIA 4PMUA 4HMEA 3MTWA 2R1MA 3SN1A 3S2LA 1V6VA 4K8HA 3DFHA 1XYAA 2X1SA 3ES8A 3DFYA 1M1BA 1QOPA 1EZWA 1V02E 3QMRA 3H53A 3QKEA 3RK8A 2HK0A 4J9JA 3MCNA 3AFBA 2CKSA 3FW6A 4HZ6A 3WNKA 1GTHA 5IHSA 4RE3A 3EDKA 2IQ0A 4C6NA 2BHUA 3IGUA 2G41A 4UTMA 3NQMA 4JTJA 3VGFA 5KZEA 1H7NA 4GGHA 4C1NA 1NDVA 3PZOA 4IFKB 1EPVA 4AY8A 5JBDA 1JRBA 4WKHA 4EWJA 2V68A 2VCCA 1B2YA 5IFTA 4D6HA 3PUOA 3W02A 2C91A 2QT3A 4MAZA 2CCRA 1V79A 3A4XA 3GDLA 2VX6A 1GJPA 3PM6A 4GY7A 3XINA 9XIMA 2NQ5A 1AQMA 4JKKA 3A3XA 5FIPA 1QPNA 1KLYA 2BOEX 2DEPA 3EWDA 5M2FX 1GKRA 4LCSA 4O12A 4JX4A 1BRLA 1DQUA 2NSXA 4M8UA 5DT7A 3WK2A 2V63A 4KRTA 3TEVA 1J2WA 2OGJA 4AD5A 2V2DA 1TX2A 2GUBA 4R88A 1W5NA 2VCBA 3OOQA 4Y7EA 5D8WA 1QK0A 2J7DA 3LLFA 1S1PA 1EEPA 4PCSA 1UB3A 3ARQA 3AIUA 1MNZA 3BL3A 2RGLA 2REQA 3OLIA 2NWRA 3MSDA 3QBUA 2OT1A 3BW3A 4FNSA 4S39A 2QMKA 2HVMA 1HQTA 4MZYA 1FWIC 3KHDA 5DO8A 5RUBA 3B9AA 4FXSA 4PTVA 2OSXA 2JEQA 3LM3A 3PWIA 1FWSA 3M07A 5DXYA 4JY8A 4QNEA 2HXUA 1ZCOA 4E2BA 5DMMA 1OFBA 4FMVA 3DBPA 1TMLA 2FZBA 2J25A 4ZE5A 1G4PA 1XCWA 4ZBCA 2DP3A 3NQFA 4GO9A 2Z27A 4MWAB 1E4LA 4W8BA 4H1ZA 4L5ZA 2PWHA 1EXPA 4O18A 2Y7DA 5EMKA 4GUHA 1KGXA 1K8YA 1HUVA 3GVVA 3MKVA 1CENA 3EOOA 4HOWA 2J79A 2J47A 2Z0IA 3MDUA 3IIVA 2FB2A 4NZ5A 1UW9A 1JAKA 4Q4OA 1HL2A 1VZWA 3W7IA 4AFYA 2J75A 3ZYZA 3ARUA 3UJEA 3NQ6A 3G1YA 3PBYA 5E70A 1Z89A 3GDBA 3FSUA 1GVQA 1UCWA 3TKFA 3SFWA 2WHJA 4UWMA 3P7YA 1JEZA 1GT8A 3TC6A 3TWAA 2WKLA 3IK2A 3VXGA 3VKJA 4YXGA 4JOMA 3N25A 3ZSTA 3KEHA 2WHLA 3AXMA 3HB9A 2CITA 4NP7A 1H61A 1ADOA 1NP0A 2ZX6A 3LTYA 5CLWA 1TWZA 4LFYA 1AW5A 4N42A 3ZT6A 1JI2A 3T0CA 2AMXA 4HMDA 1FXPA 1E6QM 4A8LA 1U22A 3KBWA 3VX0A 3F03K 1E3XA 4M51A 4IJRA 7REQB 1GK8A 1GOXA 1PSCA 3GLCA 2CLOA 1TPFA 1KNWA 5FJJA 3OPSA 3G3MA 3PZIA 3EDJA 1BVZA 1CGWA 4S3EA 4XG1A 4JN7A 2ZX5A 5HJXA 1XFBA 1H7OA 2QZRA 5AC8A