5DBTA

Crystal structure of c-terminal truncated 2-deoxyribose-5-phosphate aldolase (1-201) from streptococcus suis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
201
structure length
201
Chain Sequence
MKLNKYIDHTILKPETTQEQVEKILAEAKEYDFASVCVNPTWVALAAESLKDSDVKVCTVIGFPLGANTPAVKAFETKDAISNGADEIDMVINIGALKTGNYDLVLEDIKAVVAASGDKLVKVIIEACLLTDDEKVKACQLSQEAGADYVKTSTGFSTGGATVADVALMRKTVGPDMGVKASGGARSYEDAIAFIEAGASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Deoxyribose-phosphate aldolase
publication title Structural insight for substrate tolerance to 2-deoxyribose-5-phosphate aldolase from the pathogen Streptococcus suis
pubmed doi rcsb
source organism Streptococcus suis gz1
total genus 71
structure length 201
sequence length 201
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2015-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5dbtA00
4EF9A 2CLIA 2VEIA 3W73A 2BZNA 1R2TA 2R91A 1UASA 2ZFAA 1ML1A 3EXRA 1OFAA 3W7MA 2WV8A 1LP6A 5G2WA 3EWWA 3MI3A 1OX4A 1BWKA 4JDYA 2JKEA 4GWEA 2E6AA 4GBUA 3G24A 4ICNA 4JY8A 4N4PA 4JYFA 4NJKA 3D0CA 4MVAA 1XC4A 3L5MA 3M43A 4O1DA 1H1ZA 3U2OA 3PVFA 3W88A 2RKXA 4BFAA 5TBOA 1G69A 4UNKA 2E6YA 2P10A 4A29A 3R13A 3W71A 3UZJA 4DF0A 1B4EA 1OX6A 1RD5A 1K8XA 4NQ1A 5BMXA 2Z6JA 3G8EA 1JCLA 5LZLA 2OMAA 2ZZ2A 5G1TA 2QAFA 4FXSA 4O0ZA 3SJ3A 3MP3A 3DKLA 4JNMA 3Q37A 2BX7A 1LOQA 3HQ1A 1DJQA 3DZ1A 4R33A 4PCFA 3T7VA 5HINA 2NV2A 3LHUA 3WJZA 3W3OA 4Z0SA 2A2IA 5I3IA 3IGUA 4GJ1A 4X2RA 1QPRA 3HJZA 5DY2A 4ADUA 2EGZA 1G4PA 4ONVA 3KXQA 2B7QA 2VKZG 1H5YA 2Y89A 2ZRZA 4UTIA 1P0KA 1I2QA 1LORA 2E6DA 4OBTA 3QPYA 4M6PA 3T44A 2E09A 1YTEA 3DFNA 1XM3A 1JUBA 4L4MA 1XBZA 2CWNA 3N9SA 4O28A 1F7BA 5CZTA 2J27A 3KOFA 1H60A 4AWSA 4O13A 2OT0A 3GXPA 2CLEA 3F03K 4QM1A 4LUJA 3G1DA 4DO4A 1GYNA 2JKAA 1A53A 1DHPA 3EWXA 4LRSA 3JR2A 1FWTA 2P0OA 3KFTA 4UC5A 3H54A 4FF7A 3TW7A 5K2ZA 2G95A 4O17A 3H53A 1JUKA 3P84A 3THAA 2QCFA 3G3MA 4WQ6A 4UTWA 3GXNA 1ICSA 1FQ0A 2WQPA 3PULA 3W7GA 4RX0A 3M16A 1NEYA 3QH2A 1TIMA 2CLMA 2YSWA 3NQ8A 4ZZ9A 3BG9A 2B4GA 3GR7A 2C6QA 3VFLA 1XBYA 4N9CA 2QCLA 1I45A 3M5ZA 4HN4A 4NX5A 5D2YA 4NJIA 2NUXA 3RK8A 4ORMA 3L5AA 1XBVA 2AAMA 1HO4A 5C5YA 3T4CA 4K7YA 4O14A 6ALDA 1FY6A 1PV8A 3EX4A 3MBFA 1JULA 1K7EA 5DBTA 1YTDA 1TRIA 4R53A 1QR7A 1P0NA 3WJSA 3HOJA 3WK3A 5HUOA 3W1MA 3W7CA 3TNOA 4XUGA 2CW6A 3A21A 3EX2A 4LVGA 2C0AA 1H7RA 1UUMA 1I2RA 4JYDA 1HTIA 4NT0A 3QW4B 3S5ZA 3ZR4A 5EMUA 1TPFA 3TROA 1QO2A 3SIZA 3UNDA 4LY8A 1ZAIA 2V2HA 3S42A 4IPIA 1LRNA 2FLIA 3IIOA 1WAUA 4XZ9A 4O54A 4NZFA 4DF2A 1RQBA 3EXSA 2FPTA 2Y88A 4MFDA 1EEPA 5D2TA 2Y63A 2XN2A 1KTNA 1H7NA 3QSRA 5KITA 2VFEA 5EKYA 1H1YA 4UFJA 3TQVA 1I2OA 3G0XA 4EWND 1G4TA 3SR7A 5AHIA 1OX4B 2QCMA 3W86A 1H7WA 3PG8A 4MYAA 4YLWA 5F4WA 1J2WA 5AHNA 3CQ0A 3F4NA 4PL1A 5FF7A 3HO8A 1K7FA 4LTSA 1SW7A 2WOQA 3DXIA 2ZZ1A 2Q3OA 4UTWC 3GDKA 4H6KA 3TUUA 3QZEA 5LKYA 5D38A 3HG3A 3TK7A 4AVFA 1QO5A 1SO6A 4GUHA 2VFGA 5I3HA 2YR1A 3UY8A 1XUZA 1AW1A 1MSSA 4NXSA 4AHPA 4MJMA 1JCXA 2ALDA 3LHVA 2H3DA 1OFQA 3GKFA 3HMJG 4JXCA 1ME7A 1ZAJA 4UTKA 4BI5A 2NUWA 3DFOA 5H2ZA 3VE9A 4DEFA 5F2IA 3W1AA 1WX0A 4ZQMA 2BXVA 3LI0A 1DVJA 4YXGA 5HJLA 1N7KA 1QPNA 1VH7A 1FXQA 4WJEA 1E51A 2OCZA 3TFXA 2ZBTA 3QMTA 4Z1DA 3BLIA 4MY1A 3BW2A 3G8RA 3QQ1A 4H3DA 1JCJA 1D9EA 2HTMA 3MWAA 4UTHA 4X22A 2VFDA 3A23A 1EUNA 1S3HA 5F2LA 1DKWA 1W0MA 3A5VA 1I4NA 5AN7A 3O06A 2ATMA 4A2RA 1KA9F 2R14A 3C52A 2Y6ZA 2YXGA 3NQMA 4JTKA 1AL8A 3WK2A 1R2RA 3S6DA 3NQCA 4W9TA 4P61A 1ADOA 1BWLA 1L2UA 1R46A 1TMHA 5D2XA 1C9DA 2E1DA 4GC4A 1MZHA 3NZ1A 4JTGA 1P1XA 1CW2A 1L6WA 4RXFA 3QPZA 1OVDA 4UIOA 5D33A 2G96A 1MEHA 3NQVA 5AOUA 1JRCA 3OVRA 4M6QA 3W6YA 3E0IA 3IRDA 1EB3A 5AC8A 3VI2A 3MUXA 3E49A 1WBJA 1V7YA 2HMCA 3P8JA 3PUOA 1FDZA 1GVOA 1TTPA 4ML9A 2Z2UA 4Q32A 3UPWA 2JGQA 1LCOA 1G67A 5FF0A 4N6FA 4O4WA 2PURA 3O07A 1F76A 3BW4A 1W5QA 2DJLA 1WXJA 5CPOA 3W1UA 2X30A 5HUPA 2YYTA 3CB8A 1KM6A 3EWBX 4NNAA 4XWUA 4UFIA 3A9IA 2NLIA 3M6YA 2JKPA 4M6VA 1TQXA 4JIPA 1K8ZA 4DO6A 3HGRA 4IXHA 2QJGA 4WY0A 4LV9A 5HR7A 3DBPA 5F4XA 3NZRA 1Y0EA 4NX0A 3LTYA 4S2CA 3KX6A 3W87A 5AC6A 3RLUA 3LXBA 4YL2A 4JX6A 1HG3A 4AXKA 1Q6RA 1H62A 8TIMA 4N9EA 1IXQA 4BF9A 1N55A 4Q33A 5F2GA 4DQWA 1K7XA 1KM0A 1GVQA 2NUYA 2YDAA 3L0GA 5IBXA 1F5ZA 3GXTA 2V0TA 1FUYA 4IX2A 1C8VA 3RF9A 4PTNA 4L4LA 1OG0A 3YPIA 1YXYA 1QOQA 3C61A 3S0CA 3RLVA 1QPOA 3W1XA 4UR8A 4OHQA 2JGYA 3B0VC 1IXPA 4O50A 4LW7A 1LRTA 1YPFA 2RHGA 1W3IA 4O4VA 4PA8A 1MO0A 3LM7A 1M5WA 4JS3A 3BO9A 4CCDA 2ZZ3A 2VFFA 1K02A 2Y61A 1KFKA 5TIMA 2QKFA 3UWZA 4AWTA 3W2MA 4FNRA 2WNQA 5HMSA 5D09A 5CZSA 3MI2A 3CC1A 4FX6M 3M0ZA 2TYSA 2VOMA 3P80A 1V5XA 4UMCA 1W5NA 3N3MA 1WA3A 3TJXA 3B0UX 4LC8A 3VCRA 3S1WA 3NPXA 1O95A 1GQNA 3FEMA 2CLHA 1KLYA 2V5BA 5L9FA 5FF2A 2ZTJA 4HHPA 2ATSA 3UWWA 4CNPA 1KM4A 3LB0A 3STCA 3C2OA 3LCFA 1R30A 4RR4A 4DPQA 4LNYA 5AHLA 3GDRA 5HWNA 5I3JA 3GNDA 3IV3A 1JVNA 1LRQA 2Z1BA 3MW7A 4UFKA 3PWAA 4CCEA 1X8FA 1N8FA 5E93A 3C2FA 3IIXA 4BI6A 2FTPA 2TPSA 1XDLA 4UTTA 3VNDA 1PCKA 5IBXC 3W84A 5DELA 1XFBA 3TU9A 5KTLA 1GTHA 5L6UA 3DFQA 1CX9A 1JJKA 4N2YA 3O05A 4CCCA 4MJZA 1YPIA 4O16A 3AJXA 2QEZA 4JTIA 3DFSA 3PB2A 4K7VA 1P5BA 3P82A 4N6EA 4FB7A 4AHOA 3EKZA 2RDWA 1ME8A 1PVNA 3UPBA 4O53A 1OF6A 3TW6A 3O15A 3LTSA 3QQ0A 4FNPA 1QCWA 4ALDA 3LXCA 3CEPA 2O7SA 2NX9A 3HF3A 5EYWA 4BI7A 4Z1AA 1BEUA 5F1UA 5IM51 2PRLA 1GOXA 1VYRA 4IMCA 3W2LA 3T40A 3TIMA 3LV6A 2J9ZA 4FX7A 1IF2A 5ABTA 3TR2A 3STEA 5D05A 1H7OA 1R2SA 1WV2A 2P1FA 3S1UA 1OFBA 3LDVA 3UXAA 2B7PA 5H91A 2ZZ4A 4MLRA 3L0KA 2BWGA 2LLEA 2VXNA 4N02A 5EL1A 2E5BA 3CT7A 1U5JA 4X3ZA 3GDTA 2C3ZA 3P5YA 2GJNA 2WO5A 2AQWA 5KZEA 4JX4A 2WJZA 3G1VA 1F74A 1OJXA 1X1OA 4C1LA 5DY3A 1T96A 3LCWA 1X1ZA 2ABBA 3W1LA 3WFAA 2CFFA 3K30A 1KBJA 5F4SA 3N2XA 4HPXA 1RQHA 5C6MA 4WY0B 1KM2A 5K9CA 4QNWA 4K36A 4LVAA 5FEWA 3EKLA 3TX9A 4O15A 4JTSA 4UNLA 4IJBA 3SGZA 2QDGA 4ZMGA 1KW1A 1TPVA 3W75A 4O19A 3Q58A 3C6CA 2DU2A 5LHEA 3HPZA 4QNEA 5T26A 4UTTC 3DGRA 4A2SA 1W8SA 4Q4KA 3IIVA 1HO1A 5I3FA 2CZFA 3O6YX 3W7PA 4LRTA 2NZLA 1JCNA 1XCFA 1RPXA 1KLZA 3RMJA 5D03A 3WK1A 3S1XA 3GR8A 2D73A 4CQ8A 4NXKA 4WOQA 5E0KA 1TPC1 3KVJA 5C2XA 3TAKA 1EUAA 5D04C 1IGSA 3W1QA 1I8JA 3LHYA 2HS6A 3MBDA 3PAJA 4RZ6A 4GXMA 4JR5A 2Y7GA 4XTIA 4UUIA 4JN6A 4YWIA 2GOUA 4NNBA 4QITA 3HPXA 1W54A 1XUUA 3HGSA 3UYCA 4A21A 5FF4A 3CWOX 4JTHA 1O4UA 2YW4A 1QMLA 3GX9A 3TSMA 4UTJA 1H50A 1VHNA 1JQXA 2X1TA 1OYBA 4IMGA 4HNNA 5AYZA 4HKPA 5AC7A 4MLJA 2NX1A 3W2NA 3R2GA 2GVJA 1TPUA 3B4UA 3GK0A 4G1KA 3N73A 3CEUA 3C8FA 3NL3A 1ZENA 4AF0B 2QCDA 4UMBA 3Q94A 3P62A 4UTLA 4K38A 4FHAA 5CZJA 2JK2A 1KFBA 3STFA 4K8HA 3C2EA 3NL6A 4UTUA 3P8IA 3DH7A 4Z1CA 2VEKA 3O16A 2X1SA 1EP3A 3UY7A 1XDMA 2KZHA 4QQ3A 3PM6A 1Q6OA 4E2DA 3RU6A 3PBVA 3W74A 3L67A 2NXHA 4NJJA 2QCHA 1W1ZA 2V2CA 1VRDA 3ZS4A 2DORA 4Z0JA 3BG3A 4MZ1A 1GEQA 1TTIA 1YDNA 2UV8G 3NVTA 3QM3A 2QR6A 5K9XA 3V1PA 4UR7A 3G1FA 1PE1A 5BW6A 4RJEA 4NNCA 1IXNA 1JCMP 5E1QA 2W0UA 3LCGA 4ADTA 2VEMA 4DBDA 4OT7A 1B9BA 1OABA 3TDFA 1L9WA 1VR6A 4WXYA 4TO8A 5BRBA 4TIMA 3DI1A 3KVKA 1VYPX 4M7SA 1K3UA 3NM1A 5HULA 3ZFHA 2ZA3A 4OGZA 4DF1A 1W31A 3M7WA 2VEPA 1A50A 4NJGA 3N9RA 3I7RA 5DCDA 5TQLA 4EOUA 5G2IA 3O6CA 4IWWA 2RDTA 1ME9A 3LCLA 2RDUA 3B03A 3BGJA 1KV5A 3W1TA 1PS9A 3G18A 1ICPA 1LBLA 4PODA 3MJYA 1U83A 2QF7A 5AHFA 1WQ5A 2ZYFA 1XBXA 3FJ6A 1B4KA 3MHGA 4A22A 3OVPA 3B05A 1TPEA 3OVQA 2XN1A 1TO3A 4J9JA 1NVMA 3QFEA 4EVZA 3NPWA 1ZY9A 3ELFA 3O8AA 2GUUA 1LDCA 4FNUA 1RQEA 5EPDA 1S5WA 1LM1A 4FO4A 5D2WA 3NQDA 3QEZA 3E9AA 2ZZ7A 5HWJA 3M44A 1AG1O 3NEVA 4I7WA 3FIGA 2ZRWA 5D2VA 3PSVA 4I7UA 1TTQA 5D32A 3O1NA 4HNVA 5HNRA 2WSYA 2ZCGA 4OE7A 3I65A 1VPXA 2YYUA 5HR6A 1FWWA 3KVMA 3PB0A 2E77A 4ORIA 2BTMA 4GRSA 3FFSA 3G1YA 3M9YA 3OHIA 1GPWA 3NR0A 3FYOA 1QWGA 1Q6QA 4WZHA 4MOZA 3HG2A 3SSJA 1B3OA 1LROA 2PRMA 3MYOA 5CPLA 1EX5A 3MO7A 4FIQA 1F6PA 1OK4A 3OA3A 4DELA 4FIRA 4IUOA 4EF8A 3PBUA 4O11A 2GJLA 1GJPA 1R47A 1HFBA 4AAJA 1GWJA 3W7LA 1SSDA 3G1SA 4AB4A 1TV8A 1TV7A 2CZDA 3P5ZA 1W5OA 3W7JA 3HG5A 1G4SA 3EB2A 1DQXA 5G5IA 3PSWA 3SZ8A 5J5DA 5G1YA 2BSLA 4Y6GA 4RZ5A 1LYXA 2OT1A 4WXZA 4IMDA 2GQ9A 3DKJA 3NYZA 4JTEA 3P60A 1T0OA 4RXGA 1AL7A 3NA8A 2PRHA 4Y9AA 4TMBA 3LRKA 3UWYA 3W7NA 1OFPA 1QDSA 1K8YA 5BNKA 3KVLA 2QCDB 2OZ0A 1H7XA 2QUVA 3TSBA 3PC0A 3TFCA 1YDVA 2G5WA 4MYXA 2ISWA 1OFEA 4CQ9A 1FX6A 4XBSA 4RCXA 4BK9A 4U4MA 3GAKA 3L9CA 3G1AA 1WYIA 1NAL1 4M7TA 5AHMA 3OBKA 1TPDA 4I9AA 5D02A 2A6NA 1LBMA 3ABSA 2X16A 1JR1A 3S1VA 1EP2A 3P81A 2NX3A 4JY9A 1X7FA 3E12A 4WY0F 3LHTA 3NPVA 4HNTA 4PFMA 4LS0A 2ZTKA 1WOBA 3EX3A 3NDOA 3ATYA 2ZRYA 4AWUA 2DP3A 4LVBA 3OG3A 3S8HA 1FCQA 3NM3A 1FCBA 4XBKA 3V75A 5LNVA 4RKAA 2HS8A 2AGKA 3PG9A 1ONRA 3TA6A 5K7JA 4JD4A 2QCCA 4LOCA 3EWUA 3LTPA 4EIVA 3BK0A 1MEWA 1SO5A 1KFLA 1RVGA 2B7OA 2GPTA 4Y96A 3PY2A 2YPIA 2OJPA 1SU5A 3IIPA 3N2MA 1D3HA 1W5MA 4GE8A 4HPJA 2I9EA 5J5RA 1H63A 3CM4A 1VCFA 2EPHA 3FYPA 1IIGA 1TSIA 1WBHA 1THFD 2BLEA 3NOEA 5D30A 4QIUA 1UUOA 3NPUA 1TTJA 1SZGA 3TH6A 4ZVJA 4O57A 1BKSA 4GFSA 4O12A 3WJYA 4YCOA 3QMSA 1A5SA 5FEZA 1GVFA 2Z6IA 3LLDA 3PBYA 3SGUA 1ZHAA 5CG7A 4R7JA 5U7SA 5BOOA 3G0SA 3LCHA 5FEXA 1QOPA 3QF0A 3PUEA 5LHFA 4Y8FA 4MUZA 4FX8A 4JEQA 2W6RA 3R89A 4S2BA 2PCQA 2QCGA 3EX6A 1OFDA 3DI0A 4JTFA 5K9DA 1J4EA 3LXAA 1LBFA 1UJPA 2VFHA 3SY5A 5LGZA 5EBUA 1G7VA 4S1FA 1ZALA 4GUIA 4OV9A 2EKCA 4B5NA 4O10A 2NV1A 1K03A 2QUTA 4AH7A 3PR2A 1AMKA 3BGGA 2J6XA 2WSRA 3WJWA 3GDMA 2GQ8A 2DZSA 3EX1A 3B8DA 4KFNA 3G0UA 3W2JA 3S5OA 2FFCA 4FNSA 4XTDA 3UXDA 3FA5A 2CLLA 1SW3A 4D2JA 2DZUA 3B0PA 3WK0A 1Z48A 4MFEA 4HT3A 1TPH1 3IEBA 3IVTA 3W07A 4DPPA 2V9DA 5KZDA 1OHLA 2F84A 1OK6A 4N4QA 3MYPA 5FEPA 3W2KA 3TE9A 3M5VA 1Q45A 3FKKA 5HWMA 1KBIA 3QMRA 3OIXA 3BLFA 3PUDA 4LWWA 4DO5A 1W3NA 1LTDA 3GIYA 2VENA 3P67A 1JQVA 3GLCA 1O94A 3TQKA 4LT9A 3MP4A 3A24A 1QAPA 2DZVA 3QJAA 1KFEA 5A5WA 2A1YA 3NQ7A 1BTMA 1EP1A 4ZQPA 5CGQA 2CLOA 2V81A 2Y7DA 1HUVA 3I6RA 3MHFA 3TQ0A 4DXVA 4AHQA 3HGOA 3W2UA 2TRSA 5G4WA 1TCDA 5C54A 3CLMA 3W7EA 1NF0A 3S5YA 3NGJA 1TPWA 2Q8ZA 4LUIA 2C16A 3LRMA 4KFOA 4M19A 2EHHA 2WSQA 1ZCOA 1GVSA 3BV4A 2I14A 3DFPA 5LNRA 4YCPA 3SECA 1SO3A 5CSRA 2QUUA 3HPSA 3ZWSA 5LNUA 1OX5A 2DJXA 1L6YA 3W85A 3HIJA 3MP5A 4P2VA 2E5CA 2FPYA 1SUXA 1SR9A 2A0NA 4A3UA 3MHUA 3PBWA 1DBTA 2FB2A 3M5XA 1TRDA 3ABOA 1G4EA 4JX5A 1LLWA 4MZ8A 1VYSX 2CZEA 3KAOA 4GNJA 4ZQCA 3U6WA 3DU0A 1C29A 2E68A 4RZ4A 5LNSA 4DBEA 2O7QA 2R8WA 1F6KA 1SZNA 2C14A 3IGSA 1W3TA 3R5EA 1FWSA 1TPB1 3TV8A 3LHZA 1JRBA 1CI1A 1D3GA 3TJLA 3FKRA 3N34A 1M7OA 1MXSA 1OFRA 3FS2A 5I3KA 4CLMA 1Z42A 3ATZA 3TCEA 2YGYA 5DCBA 1FBAA 1VZWA 1PL9A 5U4NA 4E2BA 4IMEA 2A4AA 3W1NA 4PH6A 3ABRA 4ZQOA 1S5VA 2C15A 3LCXA 3QSTA 3BLEA 3W9ZA 3IVUA 1F2JA 2EAWA 3L21A 1FDYA 3P61A 1AW5A 2A85A 1YTKA 1SPQA 3E96A 4WX2A 4U28A 5CPNA 3G22A 1YXCA 3F1QA 1XXXA 2DZTA 4HSNA 1UCWA 2NWRA 5BMWA 2B0MA 3W1PA 4JICA 2Q8LA 5HQEA 4ZQNA 4LV4A 3LBMA 6TIMA 1EA0A 3TXVA 1KTCA 3B04A 1PHWA 3AO0A 2QCNA 3CIWA 3CU2A 1SFJA 2ZZ6A 4IMFA 3L2IA 3I68A 2IQTA 5K4ZA 4JDBA 5SWUA 3IVSA 5K4XA 3LOTA 2I1OA 2ZA2A 1DL3A 5AHEA 4UTMA 2FDSA 4NJHA 2FIQA 3HG4A 1AK5A 2V2DA 2NXGA 2RFGA 2W79A 4OWGA 2PE4A 5G4EA 2Y7EA 1PIIA 3LX9A 2V82A 3TMQA 4TX9A 1DQWA 3CTLA 3LERA 3Q2DA 2C1HA 2Y7FA 4N9DA 1KV8A 4PL2A 3A22A 3I7QA 3C2RA 2C18A 4O52A 4RV8A 1H51A 5F2MA 2ISVA 3SI9A 2YFOA 3LBCA 7TIMA 3QC3A 1TB3A 1FWRA 4TU1A 4POCA 3NQ6A 4O1CA 1JUEA 1HL2A 3FJLA 1G6CA 1GVRA 2V30A 3LLFA 4BWLA 3IIZA 4TR9A 4CNOA 5GVJA 1L6SA 2YCEA 1NF7A 3LRLA 3FLUA 3H55A 4O0KA 4HSOA 1ALDA 2CZ5A 3BARA 3L65A 2OX1A 1EIXA 4GUGA 3STGA 3DHDA 1O60A 4FNQA 2J88A 4MIMA 3TC6A 2ZQ0A 3QW3A 1SQ7A 2QDHA 2V5LA 2CLKA 3C2VA 3QYQA 1GTEA 2Q3RA 3EWYA 3ZWTA 2YFNA 1IXOA 3C3NA 3GVGA 4MPQA 3R8RA 4JYEA 3UWVA 2WPBA 3NAVA 4OV4A 1VGAA 5K3VA 1OFOA 1ZFJA 4Z1BA 1F05A 3NQFA 2YZRA 4O18A 2GVLA 1OYAA 3W7HA 4LVFA 3KRSA 2X1UA 3INPA 4FEZA 4MY8A 4JTTA 1O5KA 2QJHA 5DN1A 1VCGA 2RH9A 4I7VA 4ZL1A 3BPWA 4HNUA 1SZEA 4NZJA 1KM5A 4QAIA 2X1RA 5DBUA 3GB6A 1QPQA 1KFJA 2VC6A 1PHQA 3P7YA 3C4UA 2A7PA 1YXDA 1NFBA 2EF9A 2XN0A 1EWDA 3BG5A 4LS1A 5DXXA 1SO4A 2C19A 5C55A 1MEIA 1FXPA 4R34A 2J9YA 4CNNA 3NQEA 2NWSA 2A21A 3P74A 5DLCA 1VC4A 1S5TA 1TQJA 1TYGA 3PS7A 4NU7A 4PEKA 1O5XA 2DZWA 2ZRUA 5KSWA 3NQGA 4XKYA 4UMAA 4AMAA 3CIXA 1YDOA 4NVTA 5I3GA 1B57A 2DZPA 5FF3A 4BWLC 3USBA 4GUJA 2Y85A 1SZFA 3NQAA 1TREA 4OQVA 3W7DA 1EWEA 1SFLA 3SW6A 1A5CA 4O1AA 1IIHA 3W1RA 1TJPA 2G97A 4WUIA 1LLZA 3SFKA 1W37A 1GG0A 3VE7A 1GG1A 3NL5A 3HGJA 3UWQA 1ZJIA 2ZRVA 4HIBA 3E02A 2X2GA 3W7QA 3UD6A 3O63A 4K37A 3W76A 1A5BA 4BR1A 2PC4A 3F4WA 3LHWA 5EA9A 3HBLA 4JGDA 2WNNA 3W83A 3M41A 2H8ZA 1UB3A 2V8ZA 2VELA 4KFPA 3TMLA 3MMTA 1RR2A 3CHVA 4OU1A 3TAOA 3W22A 3C0JA 1VLWA 5MHBA 1LOLA 3VKJA 5CSSA 4PC8A 1XI3A 3MI6A 1W5PA 4JTJA 5CPMA 1KM1A 3G1XA 2TSYA 3QRHA 2QCEA 3WJXA 1G7UA 4IOTA 1OYCA 3M47A 1ZAHA 4LU0A 5A8GA 4O1BA 4M5PA 2E6FA 3G3DA 4K6AA 3DHFA 1VQTA 1SSGA 1GYLA 1FDJA 3GZ3A 1JCYA 3TXZA 5CKSA 3W7KA 2A7RA 4LC6A 3U8GA 1RV8A 1NSJA 3JS3A 2ISSA 3W72A 1A5AA 2WNZA 3DAQA 4X9SA 3L0NA 1SW0A 3ABQA 4UFHA 3FOKA 4MY9A 3RNDA 2FB3A 4GUFA 2GVGA 1EPXA 1LZOA 2YW3A 3LI1A 1YLVA 3O6DA 3KHJA 2E5DA 1LOSA 1WDWA 1UBSA 3W70A 1XKYA 3NQ2A 3LV5A 1P4CA 4N9BA 4QSHA 1F73A 2ZZ5A 4IX0A 3UQNA 4H4IA 1PCWA 4WD0A 5LSMA 1I2PA 4E38A 2FJKA 3TKFA 3LGEA 3EEGA 5CZ0A 4KWVA 3IGXA 1YADA 2ZRXA 5LGXA 3EXTA 4MKNA 4C1KA 1J5TA 3S5NA 4Y90A 1DJNA 3L66A 2FQIA 3BVJA 3I7SA 1VS1A 2H6RA 1ICQA 3DENA 1DORA 3CWNA 2GQAA 1I2NA 1GZGA 2R94A 4RK8A 3N14A 3M5YA 3GYEA 1Q6LA 2DZXA 1KFCA 1VJIA 2VFIA 5AB3A 2J24A 2A5HA 1KM3A 2J9XA 2JBMA 3R12A 2Y62A 4UCGA 2ZDRA 3GKAA 3LCIA 5KINA 1X6UA 1H7PA 5D37A 3UZ5A 3W7OA 3A5FA 1TV5A 4JTUA 5G2HA 2H3BA 5DCEA 2Y70A 1Z41A 4K8EA 2YX0A 3GNNA 2ZA1A 2H90A 4JTLA 2F7FA 4IPJA 1XL9A 2QAPA 1VLIA 3JRKA 2CLFA 3GDLA 3T55A 5LNWA 4KWWA 4UXDA 2HSAA 3PF3A 1M7PA 4LVDA 1AW2A 1QFEA 1YYAA 5KMYA 1DV7A 4MZYA 2NXIA 4WOZA 2Z0IA 3NG3A 4E0CA 4FNTA 1GT8A 4CQAA 3CPRA 3C56A 1H61A 4RLIA 3HB9A 1FCVA 4QJ1A 4NUWA 1DOSA 3NL2A 4AF0A 3B06A 3KRUA 4QISA 2B7NA 3TC7A 3L68A 1T99A 3G1HA 4XKYB 5KZMA 1OF8A 3ANYA 2ABAA 4O8RA 5FI8A 2CU0A 5EY5A 1W56A 3TSDA 3S9YA 1Q3NA 2H8XA 4FXRA 4UFMA 2A7NA 1VCVA 4Z08A 4AEOA 3NXFA 1M6JA 1FCUA 1ZNNA 3NO5A 3W7IA 1Z44A 4IQLA 1WOAA 4IGHA 4LS2A 2A6LA 3BW3A 3THQA 1QNVA 1RZMA 3GAYA 2XFWA 4K39A 2TMDA 3RFAA 5AFDA 4YMZA 1TJRA 3EWZA 3W23A 5DXYA 3UWUA 3OEXA 5AYYA 5F1VA 2QJIA 2WKJA 4ZQRA 3T78A 3L5LA 1FWNA 1T8XA 3DFTA 1VHCA 3KRZA 3W7RA 2C13A 4TMCA 3NNTA 4IXXA 5AYXA 4XQ6A 1KTBA 3N19B 5FESA 3M1ZA 4KKXA 4ADSA 4JIQA 4UFLA 2FPVA
chains in the Genus database with same CATH superfamily
2BZNA 2R91A 1UASA 2O9OA 2OVLA 4Y9MA 4YWSA 5E0CA 4Q7BA 4YIWA 4CEUC 1LP6A 3D3AA 1RD6A 3R0DA 5CJ5A 4JY8A 2IKHA 1UUQA 4AMCA 2BGQA 2XTKA 3MMUA 2V3DA 5DFAA 3HA1A 3RX4A 4C6LA 3TCSA 4MVAA 3MB9A 2AQOA 1XYZA 1H1ZA 4J3VA 2EPLX 5B80A 4BFAA 5TBOA 1G69A 3H7UA 1UD3A 1EDTA 3U3HA 3HM7A 1OX6A 3DUGA 3A4WA 5BRPA 3ZVHB 3G8EA 4H9VA 2X41A 1R3VA 3TA9A 5LZLA 3ARTA 4XSMA 5G1TA 2DGAA 3DKLA 4CVUA 3Q37A 2BX7A 1XLHA 3F2CA 2PFHA 3DZ1A 1PIGA 5CAHA 5AYBA 4NY2A 1W1IE 3LHUA 3WJZA 2A2IA 5I3IA 4A05A 4GJ1A 4MJ4A 3HJZA 2PCEA 3B8SA 2VD9A 2EGZA 1XLMA 2VKZG 3UZWA 2Y89A 4UTIA 2Z7GA 2BHZA 2QVNA 4M6PA 1O5RA 1YTEA 1C8YA 3DFNA 1JUBA 4L4MA 2DDXA 4CQDA 1XBZA 3E0VA 4O28A 1F7BA 1S2UA 2X7VA 2RGLA 4A35A 3F03K 3BWWA 4QM1A 5HK4A 4DBUA 4RW3A 4B4FA 4NIRA 5ECUA 3KOYA 4ZTXA 5LIXX 3WLOA 4QG9A 5I06A 3FXYA 5K2ZA 4GJJA 1FTXA 2G95A 5C2CA 5I0DA 4M6UA 4US5A 3UG4A 3THAA 5LIKX 3G3MA 2POTA 3GXNA 1MDRA 1NEYA 2CLMA 3AIWA 2VQUA 1Q6CA 3HU7A 4N9CA 3M5ZA 3VD5A 3CV2A 4NX5A 3CAVA 2GUYA 1J10A 3UVIA 3L5AA 1XBVA 3CS2A 2CHRA 1ONEA 3T4CA 1FY6A 3GYCA 3MBFA 4S3KA 1Z6KA 4ICCX 1TZZA 4PRTA 4Q8NA 2E9BA 4R53A 1P0NA 3HFTA 3WJSA 3LEPA 3W7CA 1YIXA 2CW6A 3UU0A 4DWSC 4LVGA 1FFQA 2C0AA 3NFUA 3FYYA 1BG9A 4JYDA 1P6WA 3QW4B 1XYCA 3ZR4A 3LU2A 3TROA 5EB8A 4BZYA 4GYPA 3CH0A 4P8UA 5AVNA 5H1WA 3EPNA 2DUAA 1LRNA 4XZ9A 4DF2A 4ZO7A 2Y88A 3AXKA 1EEPA 1Q65A 1E0VA 1ESWA 4HHLA 4HHMA 3DX5A 5JMUA 3GH5A 2JQXA 4ZENA 5JQ9A 1H1YA 3TQVA 3G0XA 2QW5A 1G4TA 5E9XA 3H22A 3WBXA 1JNEA 2J47A 3WH6A 1J2WA 3C0QA 1V6UA 3F4NA 4C60A 2GYIA 1JPHA 4PL1A 1UYQA 1K7FA 5E6YA 1SW7A 2WOQA 3DXIA 2ZZ1A 4UTWC 3GDKA 2WZMA 4BF7A 3GY1A 1XLJA 5LKYA 5D38A 2PWGA 4LAUA 3HG3A 4AVFA 4GUHA 3CUIA 2PB1A 1E40A 1UR2A 2WSPA 4E4UA 2ALDA 3MS8A 1XYAA 1DIEA 2W9MA 4QLLA 4XZIA 4BI5A 1DTNA 2NVDA 3DFOA 4B2DD 4MNJA 3VE9A 4KEVA 3W1AA 1WX0A 3W4RA 4YXGA 4Q22A 5HJLA 4CU6A 1K6AA 3K8MA 1W8GA 2Y24A 2CEQA 1E51A 2OCZA 3NQBA 5HA7A 1XV8A 4Z1DA 1JZ2A 1U2YA 1NFPA 3BLIA 4GYKA 1Z3NA 3BW2A 4PFHA 3O9NA 1D9EA 4E8DA 3MWAA 1GONA 4LEFA 5ECVA 1R85A 1F3WA 4L7ZA 3BCFA 2E25A 1W0MA 1A5LC 4DWDA 2ATMA 5HBFA 1MRQA 2R14A 3CPUA 3C52A 5C70A 1BF6A 1W6TA 2DQXA 3GW3A 3WK2A 2DSWA 2OGYA 4P61A 1R46A 1C9DA 2OYMA 3MMWA 3ZR5A 3UG3A 5C9ZA 2PD5A 1CW2A 1F3TA 3KDOA 5D33A 4LUSA 4GVGA 1XPGA 2BDQA 4WDXA 3OLEA 1H4PA 2P76A 4WGXA 1J6OA 1JIBA 2DT1A 4K2SA 2HMCA 4IFKA 5JIWA 1TTPA 5C7HA 3TYUA 3UPWA 5A8PA 5T91A 3FDKA 1B0IA 4N6FA 3O07A 5BZAA 1MW3A 3ZJ6A 4C6NA 3TTQA 2IPJA 4TTGA 1A0DA 4NNAA 2NLIA 3M6YA 3JVAA 4M6VA 1TQXA 3AYVA 4JIPA 4DO6A 2QPXA 3H7RA 1BSLA 4IXHA 2Z1WA 3PANA 2IW0A 1GZJA 4LUTA 2VX4A 3DBPA 5F4XA 1PTGA 1KQZA 4S2CA 3W87A 3POCA 5AC6A 1R9ZA 1Q6RA 2GJXA 5JIPA 4N9EA 1IXQA 3ARWA 3TN5A 3DYOA 3L0GA 2CESA 4NHVA 4HU0A 4A6GA 1H2JA 1OY0A 3OQ8A 3PNUA 4IX2A 4OUIA 2OWCA 1W1VA 3RF9A 1GHRA 1OG0A 3YPIA 1DPMA 1YXYA 1OADA 1I1XA 4UR8A 1NOWA 4OHQA 2JGYA 3B0VC 4OOUA 4LW7A 3CUZA 3GU2A 4LNCA 1X97A 4DZHA 2RHGA 3M0HA 4GJIA 4LAOA 3CUFA 4PA8A 4H2CA 3NZQA 5BROA 1J5SA 2V5DA 1W2VA 2DT2A 3GSMA 3O6AA 3T9PA 5D09A 4FI4A 5CZSA 1BFNA 3MI2A 3IANA 3CL7A 2TYSA 1EYEA 3R25A 3R11A 1GQLA 5IXEA 3VCRA 4UQBA 5E9AA 3BQ6A 3O3RA 2YZ5A 2YIHA 4YYFA 2CLHA 3L4VA 2V5BA 5E09A 3NO1A 4Q8WA 2XPKA 4CNPA 3FJ4A 3C2OA 4R7WA 4RR4A 5AHLA 3E38A 3GNDA 1JVNA 3VM7A 4R9XA 4C5ZA 3UW6A 3E0WA 3PWAA 4PCTA 3N6HA 4Q4PA 4W7WA 1FWCC 1CTNA 4PR4A 4UTTA 5JVLA 5IBXC 3HURA 1TFVA 5DELA 2V5JA 4GYJA 2GOKA 3IK2A 3DFQA 1CX9A 4WLCA 3SRHA 5HDRA 1UZDA 3AJXA 1PDZA 3PB2A 4RW5A 1P5BA 4ZSUA 1J2BA 2W3ZA 4QJ5B 4D1IA 1LUCA 1PVNA 2G3NA 1Q2RA 3GDBA 1KKRA 2QDEA 3TW6A 3O15A 4IH3A 3OO2A 4XISA 4DRSA 1FFRA 1P1MA 3HF3A 3VMPA 2VQTA 2I56A 2PRLA 2E7FA 5A6AA 5A8QA 1XQKA 3W2LA 2F6KA 3T40A 2WC3A 3LV6A 2J9ZA 3P0WA 3NEHA 3CQKA 2VC5A 3TR2A 5HPCA 5D05A 1R2SA 1Z7AA 2HK1A 3S1UA 1Y65A 3PBMA 3B4YA 4OBSA 4HHHA 3AQUA 3S9ZA 2E5BA 3KLLA 4PMUA 1NU5A 1FWDC 3GDTA 2WO5A 1S39A 1D8CA 1OC5A 2J7GA 1X1OA 2CXEA 4AX7A 1MUWA 1T96A 3LCWA 3MSDA 3CV1A 3WFAA 5KETA 3K30A 1KBJA 8A3HA 3H2EA 1S3TC 3ES7A 1K1DA 4GKLA 4QNWA 4QQUA 4LVAA 3NIYA 1ZB5A 4F2UA 1PTAA 4IJBA 1BXNA 3QQWA 1U22A 3W75A 4O19A 3S5SA 1ZQ5A 1E1FA 2W4XA 2P8CA 3DGRA 4A2SA 4JFWA 3H4WA 3O6YX 4LF2A 4QS5A 2ESCA 3WLHA 3DN5A 1W3LA 1XX1A 4C6JA 1QNRA 2Z7KA 2F6XA 3SCUA 4K8GA 1OC7A 3CL8A 3KZPA 3DIPA 2D73A 2HQAA 1JDFA 3BLKA 1E0WA 4C7DA 4DYEA 3VFCA 4E2VA 5FSEC 2PWDA 3ES8A 4M1RA 3WH5A 2YCLB 1GW9A 1QHPA 2PDIA 1EUAA 1QJWA 1I8JA 3LHYA 5BYWA 3QC0A 1M01A 3SQLA 1O66A 4UUIA 4IP4A 5DANA 3U2ZA 3HPXA 1W54A 1XUUA 3BXWA 4F79A 5FF4A 2NQLA 3VIHA 2WMGA 1BWVA 3TSMA 3VTRA 1J0KA 5LIWX 1FH9A 4FZIA 1FHDA 1OYBA 2XISA 1EBGA 4GA8A 4HNNA 1UWTA 3OBAA 4HOZA 2NX1A 3GK0A 3C8FA 1ZENA 2EBNA 3Q94A 4HPNA 3P62A 4UTLA 5FOOA 4K38A 5I78A 5CZJA 3NL6A 1VBRA 1VEOA 3P8IA 4FXJA 3TZNA 5FJUA 4E3TA 4KF1A 1B31A 2VEKA 3O16A 3BANA 1WDSA 1EP3A 3RX2A 4QQ3A 3PM6A 3ZLHA 4PUEA 5HAOA 3SCRA 4E2DA 2J8TA 4QFUA 3PBVA 3L67A 4NJJA 2FTYA 2QCHA 1JDAA 4Z0JA 2DUXA 5A8MA 3BG3A 2HNHA 4MZ1A 1GEQA 2OODA 1RBOB 1RBAA 3NVTA 1EGZA 5FCZA 4AD1A 3IUIA 1XGDA 2Q6ZA 3M0VA 2ODOA 4F0SA 4EK7A 3LCGA 4ADTA 4LX4A 1FKXA 2J8FA 4WXYA 4TO8A 1EJ7L 3WY1A 1Q5MA 3ARYA 4YPJA 4ZB5A 4TIMA 4BQ4A 3DI1A 5CAKA 3VZXA 1F9CA 1VYPX 2CIPA 4A3HA 3EB3A 3R4IA 2ADAA 3VIJA 4DO7A 2WJFA 4HMDA 1A50A 1MXDA 3CK5A 1E6RA 3NOYA 3SDOA 3PWIA 1L6GA 2E0PA 3RGTA 3N11A 1PS9A 1WQ5A 3CZ8A 4C6DA 1US3A 3V0SA 5B7ZA 3MHGA 4A22A 1WDRA 3B05A 3XISA 3OVQA 3IGHX 3R8GA 2I16A 4C91A 2YLLA 2NT0A 3BOLA 4IGSA 5D9MA 3WCZA 3R8HA 1QPKA 3F4CA 3QFEA 1YX1A 2CYGA 4PBFA 2GUUA 1EH9A 5EPDA 1S5WA 4W8BA 5HNTA 1XP3A 2GSHA 3SFWA 1US0A 4ZA0A 3FIGA 4I7UA 4HNVA 5XINA 5HNRA 1E9LA 4OE7A 3I65A 5HR6A 2BHUA 3PB0A 3GU9A 1O1ZA 3FFSA 3NTYA 3G1YA 3M9YA 1G01A 3OHIA 3QR1A 4RL3A 1GPWA 3FYOA 1Q6QA 4MOZA 4IUGA 3CMJA 3SSJA 4A3YA 2PWHA 2PRMA 5T9BG 1ZL1A 5CGMA 3MO7A 4KEMA 5A6KA 4DELA 2F9RA 2G50A 4LSBA 1Q85A 3PBUA 4O11A 2GJLA 5FL0A 3VOGA 1R47A 3W7LA 5PTDA 4K1GA 1UH2A 4AB4A 3P5ZA 3RYSA 2XFFA 4U5KA 1NFGA 4U3AA 2WM1A 5G1YA 2O0TA 3S46A 2OT1A 4EPEC 2X0YA 2GQ9A 1KGXA 3OW1A 1EXPA 3VNIA 4XD5A 2PRHA 1OFPA 1OSEA 3HV9A 5AECA 2QCDB 3VNYA 4F8XA 3PC0A 3TFCA 2D2GA 2INFA 4F4RA 3GAKA 4GBDA 3W38A 1WYIA 1AVAA 1NAL1 4M7TA 5AHMA 3OBKA 4NRSA 1LT7A 3B8IA 1XLIA 4GOAA 4XZNX 2A6NA 2Z25A 3S1VA 4UNIA 2FMNA 1Q7ZA 1X7FA 4LS0A 3OZOA 1WOBA 3EX3A 2YBVA 2VDGA 3ATYA 3VABA 3V36A 4D6EA 5HJXA 1FCBA 4A8RA 2VURA 3UR2A 3FW6A 4RKAA 3PG9A 4LFYA 2QCCA 3EWUA 3BK0A 1SO5A 4O1FA 4U31A 2GPTA 3MKVA 3PY2A 3G6MA 5FIPA 4IQJA 3AZSA 6TAAA 1UMYA 2WYSA 2B31A 1TWWA 2OR2A 3KOZA 4GE8A 5J5RA 3CM4A 3AJ7A 4WHBA 1OT1A 2BVWA 1WBHA 2BLEA 4L4PA 1THFD 3UR8A 4DJED 1N8IA 4MADA 3NPUA 2ZDSA 1TTJA 4O57A 3CV6A 1A5KC 1H1NA 2E1WA 4O12A 2NT1A 3GXIA 4CCZA 1MW1A 2VNCA 1US2A 3WNOA 2A3LA 3RCYA 4HNOA 4AZCA 1CB7B 1U33A 3DC0A 2Z2BA 1R3WA 1REQA 1ZHAA 3ZLGA 4Y8EA 5IHSA 1MQQA 1UMLA 4R7JA 5BOOA 3W82A 1OGSA 3LCHA 2CERA 4HSHA 4IMAA 3UCDA 4JEQA 3U2EA 6XIMA 2QCGA 3OOQA 4TV5A 3DI0A 1FRBA 4JTFA 2C0HA 4QXIA 1LBFA 1UJPA 4DJFD 4OZOA 1PX4A 2GGGA 3QLLA 5LGZA 5EBUA 1ZLPA 8XIMA 4XAPA 2AMGA 2QUTA 3EPOA 3MU7A 3PR2A 2PP0A 2J6XA 2WSRA 3ZSTA 4KERA 4W4QA 2GQ8A 1T5AA 2Y0FA 4DJDA 3E1F1 4M80A 4B5SA 3S5OA 1PPIA 3WLLA 3S2NA 1SW3A 2VZSA 2YDQA 1DJXA 3WDJA 3T09A 4W7UA 4MDOA 3B0PA 1Y5XA 2CWXA 3GC2A 1UBPC 3VOHA 1DP0A 4MWAE 3IRSA 3KBNA 1EZ2A 3W07A 4DPPA 5KZDA 4GNKB 4FOJA 2F84A 1W1TA 3MYPA 3W2KA 5JBDA 5T9CE 3FKKA 4Q8VA 2PLCA 5HWMA 1GEHA 2J74A 4J28A 5A8OA 2BB0A 4ZOCA 4LB3A 4LUSB 1V77A 2GLKA 1RCXB 3P67A 4PRRA 2VP8A 2DZVA 1NOUA 4IFKB 4N0RA 4ZQPA 2Y7DA 1QATA 2GDUA 3ARPA 1ECEA 3MV11 4DXVA 4AHQA 1K4HA 3HGOA 2DSZA 2X2YA 2QZRA 3CLMA 3MVIA 4RNFA 3BAIA 1NWSA 2MNRA 1TPWA 3MPGA 4GVHA 4HA4A 1GVSA 2F61A 2PDCA 1TE6A 3BV4A 4Z17A 5LNRA 1PKMA 2QUUA 3P93A 2PSNA 3V0TA 3AAMA 4MWAD 4H9UA 2DJXA 4TV6A 4D1JA 3MP5A 4LUTB 4GZJA 2VTFA 1HKVA 3S9IA 1XYBA 2UBPC 4KGJA 3MUY1 1Z89A 3PBWA 4W85A 1TRDA 4MF4A 4MZ8A 2CZEA 3KAOA 4GNJA 4LGXA 2QDDA 3EDJA 3DU0A 1JDEA 1C29A 4RZ4A 1EO7A 4PN2A 3AICA 3R5EA 1OC6A 4IICA 3TV8A 4QHRA 4Q6XA 4B5UA 3TJLA 3N34A 1MXSA 1OFRA 3CIVA 3WLNA 1SFSA 1V0KA 1Z42A 4L9ZA 1XSJA 4FK9A 1IE7C 2WZHA 4IMEA 2A4AA 4NL1A 3ABRA 3LCXA 4D8LA 2W62A 2VYOA 3IVUA 3U57A 4C6MA 3UGRA 3P61A 1SPQA 3E96A 1M65A 4U28A 1VJZA 1XXXA 1UCWA 1MW2A 1E0XA 4R27A 4MB5A 2Q8LA 4FMVA 4B90A 1EA0A 4CVWA 4JAWA 3BMWA 3RX3A 2XJ7A 1PHWA 2GSEA 2YKKA 3AO0A 3CU2A 4PUJA 4IMFA 2D2JA 2VR5A 3L2IA 1R6WA 3NVDA 5DO8A 4R88A 2WBGA 5K4ZA 1U30A 4XIAA 2UY4A 2I1OA 2ZA2A 3TLQA 2AAAA 1QT1A 4GZ7A 2EEXA 4Q4SA 3E74A 4ZOEA 2ZE0A 5KEZA 3BAKA 2NW0A 4PTDA 3ONBA 3P14A 1KV8A 4PL2A 4ZE4A 3USZA 3I7QA 3L4UA 4O52A 2NQ5A 4HD5A 3CZKA 4LJ3A 1YPXA 1TMQA 1KCLA 7TIMA 1JI2A 3EMCA 4DYKA 4ATDA 4O1CA 3M6DA 3CO8A 3SRDA 3T6CA 1BSIA 1KQYA 1CLVA 1G6CA 4QEHA 5GVJA 2YCEA 2PD9A 3H55A 4HSOA 1VFMA 2OX1A 1RP8A 4GUGA 3ZVIA 3DHDA 1O60A 3DG6A 3EDEA 3TC6A 3DOPA 2QHAA 3VGHA 3WBWA 2FH8A 1E1CA 2Q3RA 3D3FA 1TWZA 2Y5SA 2CZVA 3GVGA 4H9YA 4MPQA 3UWVA 3EWDA 1OFOA 1JPDX 3KL3A 1Q6DA 1QK2A 4GXPA 2X1UA 4J27A 3S6OA 4IIGA 4JTTA 2WZTA 4DLFA 3V1HA 2PF8A 3AHXA 3A3HA 5A6SA 1XIMA 3GB6A 2DIJA 4EX4A 1QPQA 1BXCA 2VC6A 3P7YA 4A8NA 4GLEA 1OT2A 3D6NA 3KWXA 3QY8A 2EF9A 2XN0A 2I7GA 1ZP3A 1M41A 4CN6A 1SO4A 1W9BM 1MEIA 1E71M 1ZUAX 4PUNA 4REQA 4PEEA 4R34A 1PZ0A 4MB4A 4MGGA 5LYRA 2A21A 4RE4A 3P74A 1VC4A 3UA3A 3CASA 3ITXA 4D6HA 1S5TA 4OJYA 1M03A 3WF3A 5KSWA 3NQGA 4XKYA 1RA0A 3CIXA 1YDOA 5D8ZA 4ZFMA 4E2OA 1H09A 1WZLA 3CBWA 1UD6A 1T7LA 1SVDA 4ERGA 2Y85A 4HCHA 3GTNA 1TX2A 3SFKA 1GNXA 3FHAA 3NL5A 1A47A 3BURA 2X2GA 4K37A 3W76A 3EYPA 4DNMA 4AIUA 2YL9A 1DWGM 4EXBA 3AS2A 4PTMA 3HBLA 4JGDA 4Q4RA 3TMLA 3JW7A 3MMTA 1UW9A 3TAOA 2XIIA 5MHBA 1LOLA 4M56A 3N13A 4GO8A 4JTJA 3KTXA 3H8AA 4Q7NA 1RK6A 1SJDA 3M0XA 4HA1A 1ZAHA 5A8GA 3MUCA 4JQAA 3W0KA 1SM9A 3EEZA 3G3DA 5LA2A 3DHFA 3N18A 4WJ8A 1GYLA 3WG6A 2RAGA 4IFOA 4AIOA 3HTWA 2DW7A 2VDHA 1E55A 3GD6A 2WNZA 4YTQA 1W2PA 4OKDA 4CUCA 3KBVA 3AMGA 4MY9A 3VGFA 2GVGA 1EPXA 1LZOA 4C6IA 2YW3A 3O6DA 1IT7A 2V3EA 1WDWA 1R5YA 1XKYA 3Q67A 2DY3A 3NQ2A 5TNVA 4CD6A 4PBEA 1DXFA 3S4TA 4QSHA 1F73A 3SUTA 2X0SA 2ZZ5A 4IX0A 4RDYA 3UQNA 1F8IA 4H4IA 3SCSA 2FJKA 3EZ4A 4YJ5A 4FSAA 2HRWA 2JIWA 5CZ0A 5E5CA 1YADA 2ZRXA 5LGXA 1EX1A 3EXTA 1J5TA 1KCKA 5I23A 1E4IA 3KOXA 5CPTA 2R1KA 1AJ2A 3DENA 2POZA 5D4YA 1I2NA 1A0CA 3M5YA 3N14A 2VFIA 4J35A 5MKGB 1XW8A 1KM3A 2Y62A 4UCGA 5KINA 1FWFC 1TE1A 3A5FA 5IDIA 3AMCA 3PJWA 1UA7A 2Y70A 2ZA1A 3S6TA 4P5UA 4XKMA 4IPJA 1XL9A 3F2DA 4YNGA 1HJQA 4C6PA 3VKKA 4DZ5A 1DJHA 5M1TA 3PF3A 4EANA 5KMYA 1QI3A 2NXIA 2OQYA 2WZEA 2DT0A 3R0UA 4E0CA 1GT8A 3CPRA 3WUFA 1NP2A 3SCNA 3W81A 1FHLA 1V6WA 1KR1A 1R86A 4UQEA 1DOSA 2C7FA 2UY2A 3B06A 3TC7A 5KZMA 1NDYA 2ABAA 4O8RA 5FI8A 1W56A 1VBGA 2P50A 1T6MA 1VCVA 2BVTA 4Z08A 1BTCA 9XIMA 2XIJA 3T0DA 1Z44A 1HKJA 4ES4A 4ZEPA 3BW3A 3HFYA 1W32A 4GHRA 2TMDA 5AFDA 3MSRA 1P0BA 3EMZA 3BJTA 3W23A 1M3UA 4ZOAA 4DYJA 3OEXA 3FA4A 3L5LA 1V8EA 2VM8A 1M7XA 3UCCA 2IXVA 1E72M 4IXXA 3VDHA 2Q8XA 1UD8A 4UFLA 4EF9A 2CLIA 4I5RA 2CHNA 4S3FA 3UVAA 4D6CA 1OFAA 1BPLB 1OGGA 3DGBA 3TJ4A 5A1AA 3WH8A 4GWEA 2E6AA 4GBUA 4N4PA 4ICNA 4GCAA 4NJKA 1EQCA 1XLAA 3HPAA 3HPFA 5CSUA 3M43A 3H24A 3PVFA 3W88A 2WWCA 5AYIA 2FGBA 4PGLA 3LZ3A 2VCBA 3RU8X 1FWIC 2E6YA 1R3RA 3T2OA 4HK6A 4CD5A 8XIAA 3QV7A 4WR3A 1YQ2A 3RJYA 5BMXA 1XIDA 1JCLA 2X7WA 1F3XA 3T8QA 4IP5A 3C2YA 3T42A 1SJAA 2QAFA 4UZUA 4DZIA 4O0ZA 3MP3A 2CNCA 3CAKA 2AL2A 3HQ1A 4R33A 3GIQA 4PCFA 5I00A 3T7VA 5HINA 4FLSA 4ZXLA 2FHFA 2NV2A 3IGUA 3IUHA 1QPRA 3TVAA 4ACZB 4ADUA 1SZRA 2R1LA 5CGTA 1QHZA 4PULA 2B7QA 2GFTA 1H5YA 4IIEA 1JNDA 1P0KA 1I2QA 3QPYA 3BL3A 2I57A 3T44A 4DIAA 2E09A 3WSUA 4S3CA 3N9SA 3QZ6A 4B16A 2W61A 1JYXA 1V3HA 1OBAA 4AWSA 4PMRA 4PMNA 2OT0A 2PS2A 1IZCA 2PDNA 3LD5A 2NVAA 3TONA 3S47A 2BXYA 2PGFA 4MSSA 2TAAA 2JIEA 1GYNA 3BOFA 2JKAA 1UWIA 2OZ8A 4LRSA 1FWTA 2P0OA 3H54A 5H6HA 4FF7A 2VUYA 4AQLA 1E4MM 3H53A 5AVHA 1JUKA 2ZOXA 4JNYA 1OM0A 4JNZA 2XYLA 2QCFA 3WNNA 1Z9AA 1ICSA 5LIYX 3PULA 2GDQA 1BYAA 2O9PA 1XF0A 4XAYA 2C6QA 3GU1A 1XBYA 3URNA 2QCLA 2PLMA 1I45A 2P53A 4E8CA 4R7OA 1QHOA 3VKAA 1PV8A 1W91A 1VPQA 4H6QA 2PWFA 1K7EA 1SMDA 1ODUA 2ZUMA 9RUBA 3CNYA 2A3HA 2BVYA 3HOJA 4HQVA 5HUOA 1WKEA 4RPQA 4XUGA 5I24A 1L2QA 4DBWA 3BOXA 1UKPA 1CBGA 3REQB 1MZRA 1I2RA 1HTIA 3CV7A 5EMUA 4QDPA 1W1B1 3SIZA 1JZ6A 1OG6A 4L65A 2HXUA 1ZAIA 5FACA 4YVVA 4OUEA 3F5KA 2FLIA 2OQHA 4NZFA 2D0HA 2QYGA 3FXGA 3EXSA 4MFDA 3CPGA 2Y63A 3CUJA 3KOWA 4DAIA 1KB3A 3OIHA 3PJUA 1GORA 1ONWA 4DI8A 3H2CA 1WKDA 2CITA 1ZJBA 3SR7A 5AHIA 1XCWA 1OX4B 4JIIX 1A49A 1GPFA 3PG8A 4MYAA 4YLWA 2F2KA 1UZ1A 4V1XA 2O55A 1W17A 2XG9A 2BXZA 4F0HA 3U7VA 4G1NA 2Q3OA 4RNIA 2BGSA 2QUNA 4NZ4A 2O4MA 3QZEA 1HX0A 1CPUA 4AY8A 4NXSA 4AHPA 6CGTA 4MJMA 1ISZA 1UWQA 4ZSTA 3HMJG 1ME7A 1ZAJA 2ON3A 2EKGA 3N2BA 5CBBA 1F61A 2BS9A 3PZVA 4Z2LA 3N4EA 1N2VA 3RILA 4XG1A 4DEFA 5F2IA 2WMIA 4U5IA 3LI0A 3ERPA 3TW9A 5G1MA 1EDQA 3B9DA 1FXQA 4AZIA 4DWSB 2OSXA 3QMTA 4HU8A 3E5BA 3OVGA 2XZ7A 3SY8A 3G8RA 1JCJA 3MUAA 1FWBC 2XIOA 1YW1A 4NZ3A 3WEMA 1U5HA 1JDCA 2V38A 1IR1A 1A5OC 1CLXA 1J93A 1KNWA 4FLRA 3O06A 4W8AA 3UPMA 1KA9F 3NQMA 5CZKA 1AL8A 4ZB2A 3L7RA 2E67A 1R2RA 3GG1A 3BAWA 3GR4A 3A12A 3N1AA 3NQCA 4W9TA 3BGAA 3ITLA 2GJPA 1I0DA 2E1DA 3OGSA 4DWSD 3L2LA 4GC4A 1MZHA 3NZ1A 1P1XA 1L6WA 4RXFA 5XIAA 3QPZA 2BASA 3OVRA 4M6QA 3IRDA 1W1PA 5AC8A 3WQCA 3BE7A 2D2HA 3ZOAA 3GC4A 3SADA 1WBJA 1CECA 3T2PA 1XINA 3V3WA 1HVXA 4J3XA 2VMFA 2Z2UA 1P43A 1XYLA 4W84A 1LCOA 1G67A 1R9XA 1VIZA 4NAEB 1B3ZA 3W26A 3UJ2A 1WXJA 3W1UA 5HUPA 1UKTA 3EWBX 3CB8A 1KM6A 1AZ1A 4HZ7A 1QNQA 2CKRA 3A9IA 1B1YA 4FOKA 4NG3A 2JKPA 1K8ZA 1RK5A 3N25A 3PZNA 4D6JA 1Q7QA 3NGFA 4J1OA 4LV9A 1Y0EA 2OZ3A 4NX0A 1HGWA 2PBGA 3KX6A 4HPHA 1UD4A 1ITXA 3UG5A 4MG4A 4JX6A 4RE0A 5D8WA 1CT5A 1N55A 5F2GA 1EBHA 1GVQA 2NUYA 2CCRA 4I8DA 5D9NA 1F5ZA 2FZDA 3GXTA 3WQDA 3KCJA 1E1CB 1BQCA 5CC3A 6XIAA 3TWAA 1OQFA 1VFTA 3LM3A 1YBQA 1PWMA 4MNLA 1E3XA 3WQ6A 1PTDA 4PRWA 3L23A 3C61A 3S0CA 3E3HA 3PHAA 1MNSA 4JQ3A 1GOMA 3VNKA 4UWMA 2Z1SA 7TAAA 1MO0A 4NRRA 1KXHA 2ZZ3A 2ACSA 4IGMA 1AFSA 1KFKA 1RJRA 3PJXA 2WNQA 1OEPA 1MMFA 2GGEA 4HMEA 4XO7A 1V5XA 1W5NA 2X09A 3N3MA 4KQNA 2PLKA 3B0UX 2HWGA 3PZQA 4LC8A 4CQCA 3S1WA 1O95A 3MUIA 2XGZA 2ZXQA 3FEMA 3RCMA 5L9FA 2OLSA 3UG8A 2I17A 1KM4A 3STCA 3PP7A 1Y5WA 3W28A 1UA3A 1TELA 3GZAA 5I3JA 3MW7A 4UFKA 2EPNA 3POHA 3GHSA 3P6LA 1EKOA 1X8FA 4MNKA 4L6OA 1L0PA 1XDLA 3ZO9A 4CN4A 3TU9A 2FYMA 4DUVA 2FVLA 3THCA 1X6LA 3LGGA 4F0LA 4CCCA 3VILA 4GI9A 3D47A 3VKCA 3EKZA 2HVOA 1ME8A 3UPBA 1G9HA 3TTYA 3VAVA 5EMYA 1C8XA 1PX8A 2EG8A 1QCWA 3UYIA 4ALDA 3CEPA 3P2VA 4M1BA 1IEIA 3RO8A 2SFPA 3PTKA 4C5YA 1LT8A 1VYRA 3WL1A 3TIMA 2J78A 5JUVA 1ZBVA 3LG3A 2YA0A 2CBJA 4ATWA 3LDVA 1R7AA 2B7PA 5H91A 2ZZ4A 3PNZA 3L0KA 2LLEA 2VXNA 3A13A 3CT7A 3KCOA 2ASHA 1YEYA 2YJQA 4X3ZA 1EA9C 4X60A 1WXZA 3VIPA 2HZGA 2AQWA 3G1VA 3E6EA 1GHSA 1NIUA 2ABBA 2D69A 3G2GA 5F4SA 4E8GA 4HPXA 3B3DA 3AMDA 3KTCA 1D7FA 4WY0B 1KM2A 1FOBA 4JFUA 3QV9A 2O9TA 3GVVA 3E0FA 2PWVA 3U0HA 3EKLA 1LL4A 3ZJKA 3TX9A 4UNLA 4ZMGA 1KW1A 4TVDA 5LHEA 4QNEA 1F07A 4UTTC 2FZNA 2ZUVA 3IIVA 1C7TA 5A6BD 3W7PA 4P8XA 1LL7A 4LRTA 2NZLA 2P88A 1XRVA 3DYMA 2P3EA 4RE3A 1HJWA 3I3BA 1KKOA 3S1XA 1V6XA 3OZPA 3QKZA 4MB3A 4NXKA 3BUVA 2OEJA 4PYSA 1UQYA 4WOQA 3MKCA 3W53A 3F5LA 1ITQA 4M24A 5C2XA 3V5OA 1EL3A 2UWFA 4Q7IA 5D04C 5H8PA 4O8AA 1IGWA 4V33A 2HS6A 3MBDA 3PAJA 4GXMA 4NI8A 2Y7GA 2V3GA 4FXFA 3VNJA 2GOUA 4CNUA 4HGXA 2IXUA 1UR4A 1XGZA 1QMLA 4JFTA 5TF0A 1HZYA 2WXDM 4GINA 4NZ1A 3DEQA 4Z1YA 3CHEA 1JQXA 2X1TA 3BICA 1MUMA 3SBFA 5AYZA 4L64A 1UH3A 4P7OA 3R2GA 1B2YA 1TPUA 3B4UA 3V7PA 1XH2A 3N73A 1DWAM 1H3GA 4HU3A 3ABXA 1X7IA 1KFWA 4UMBA 4G56A 2OWXA 5DX7A 1KFBA 3VIGA 4EKJA 4K8HA 3WDQA 4UTUA 5M5DA 3VYLA 2BY2A 5LXEA 3B8VA 1TCMA 3LPFA 4GKTA 1K4GA 3GNPA 3VMNA 1ZS2A 4Q4OA 3UY7A 3V4BA 3BDKA 3IJLA 4RDZA 4I9JA 3M0MA 4IJRA 5C7VA 4RV3A 4W5UA 2NXHA 3M4HA 2OOGA 3ZS4A 2DORA 1NQ6A 2RUSA 1J96A 5BWAA 1O12A 3T0TA 4PMJA 1TTIA 1YDNA 5I6SA 2VEFA 1V6VA 4BF5A 1D7KA 5K9XA 1QASA 2J7DA 1PE1A 5BW6A 1CIUA 4W89A 4Y9NA 3STPA 1JCMP 1UIPA 2W0UA 4GQGA 3GFYA 1OABA 3TDFA 2Y5EA 1L9WA 3SAZA 1SJCA 4X63A 5FJIA 4TTUA 2MUCA 1YHTA 3KVKA 7PTDA 1VD6A 3ZFHA 2G0WA 1VP5A 3M7WA 4CD4A 1EGVA 5DCDA 5TQLA 4EOUA 3O6CA 4IWWA 2RDTA 2E9MA 4GY7A 1JZ3A 2QV5A 2ZXBA 1DXIA 1U83A 3GH4A 1XBXA 2WKLA 4DBSA 2DVTA 2AL1A 7REQA 3GHTA 2Z2AA 2QNEA 3NJ3A 3OBEA 2XVNA 3RMEA 3TYAA 2Y8KA 2XN1A 1NVMA 1T40A 1MFUA 2XVKA 1MQPA 3NZPA 1ZY9A 3ELFA 3O8AA 1LDCA 4FNUA 2IMRA 1A0EA 1AQFA 1K9DA 4F9JA 4PMZA 3WUBA 3QEZA 3GTHA 2QIWA 2O4QA 4QROA 3NEVA 4I7WA 1X6NA 2ZRWA 4GZIA 5D2VA 1CYGA 2WSYA 4S3GA 1JGMA 5HPOA 1FHVA 5FJOA 4GQQA 2E77A 3IJQA 4ORIA 5I79A 1HJXA 2ACRA 2PDMA 3AMLA 5JH1A 4WRHA 2YCKX 2REQA 3IJ7A 4QAWA 1DWFM 3MYOA 1NDZA 4FIQA 1OK4A 4DXKA 3RRAA 1QVBA 4IUOA 4EF8A 3EBVA 1V6TA 2XM1A 1ISWA 3TYZA 1GWJA 1BF2A 3G1SA 3AISA 2WK2A 3HG5A 3EB2A 3PSWA 5ABEA 3KDNA 3SZ8A 5J5DA 5JXQA 3DG7A 2BSLA 2OYLA 4GZEA 4RZ5A 4Y6GA 2FZMA 2Y8UA 3AIRA 4IMDA 1DIOA 1TG7A 1F4AA 1NDWA 2PMQA 3NA8A 3AMKA 3G77A 4Y9AA 1QW7A 4XAZA 1B90A 2PDXA 3ITGA 5BNKA 1NP0A 2PDJA 5HOSA 2OZ0A 2QUVA 1YDVA 1Q8AA 4MYXA 4X0VA 3VOJA 2ISWA 1FX6A 1OD0A 4RCXA 3IJ9A 3BH4A 4BK9A 3M46A 1OZMA 3EAUA 3L9CA 3EOLA 3DESA 3LNMA 4HA0A 3ONCA 3S1GA 2V6AA 3UCQA 1TPDA 3MMDA 2WANA 1LBMA 2X16A 1JR1A 3P81A 2DVUA 3R6IA 1LJYA 2NX3A 3DYPA 2D24A 3E12A 4WY0F 3LHTA 4LH8A 1R3QA 3B8WA 2ZUUA 2ZTKA 2VJXA 4AWUA 3OG3A 3S8HA 4PTVA 3WLQA 2OG9A 2ZICA 1UR0A 2D23A 1ONRA 5K7JA 2OXNA 2DT3A 4LOCA 4L1GA 1RVGA 4DI9A 4BA0A 4Q8OA 3VUSA 3N2MA 3I3DA 1XSIA 4LANA 1RBLA 1PZ3A 3AXIA 4AX6A 2I9EA 3FYPA 1VCFA 4PTXA 4TVUA 1IIGA 1TSIA 1WDPA 2E3ZA 3VINA 3NOEA 3WLRA 1SZGA 4F3HA 1IT8A 4ZVJA 3S83A 3GTIA 1BKSA 4IQDA 3WMBA 3QV6A 1GK8A 4WCJA 4B9YA 3AXMA 1PAMA 4K3ZA 1PKNA 2Z6IA 5M17A 2DQWA 3SGUA 4RNHA 3FSTA 4TVCA 3ALFA 1BRLB 1QXLA 5HANA 1XC6A 4YTRA 2BVDA 5HQLA 5EMKA 4ACYA 5A69A 1QTWA 1WPCA 3AS1A 1CENA 3PUEA 2R1MA 1C90A 4Y8FA 1PSCA 4LBRA 2WLZA 4PMVA 1LLOA 3R89A 4S2BA 4H6RA 3SQSA 3SY5A 4W87A 1HJUA 1CXLA 1VFUA 7A3HA 3NWRA 4OV9A 2EKCA 4B5NA 2NV1A 1K03A 2XGBA 4AH7A 1RHCA 2Z24A 1LL6A 1OZQA 2PDHA 3WJWA 1S1RA 3G0UA 3T0CA 1S1PA 5I2UA 3GQYA 2FFCA 3UXDA 4W86A 4D2JA 2AKMA 4LQ1A 4ZBCA 2DZUA 4KEUA 2OSWA 3IVTA 3WNLA 1XD0A 1I9CB 3SUVA 3OTRA 1OHLA 4ZOBA 4N4QA 2GWNA 3M5VA 4XZMX 3H2FA 3QMRA 3OIXA 1RJPA 3BLFA 1WNOA 3PUDA 3E2VA 4DO5A 4ASTA 2VENA 2DZBA 3U48A 3VO0A 3TQKA 3HQNA 4LT9A 3W6LA 3AHTA 3LUTA 5A5WA 3NQ7A 1BTMA 1HUVA 3I6RA 3B40A 2WVUA 3MHFA 1K9FA 5G4WA 3W7EA 1IYXA 2XHYA 2WNWA 1CXIA 4GFIA 1F4HA 4HCLA 1VPYA 2WCGA 4LUIA 2C16A 3LRMA 4M19A 2WSQA 4JQ1A 3CQHA 1ZCOA 1XCXA 4YCPA 1RLCL 1SO3A 5CSRA 5LNUA 1L6YA 3W85A 5IDZA 3HIJA 1IT0A 3ZQ9A 1JAKA 4HJWA 1TWSA 3G6LA 1SR9A 2A0NA 4A3UA 3OZMA 3ZIZA 2DUZA 2Z1VA 3MHUA 1ADSA 3SUUA 1GVEA 2J79A 1E9YB 1G4EA 4U2ZA 4JX5A 1VYSX 5I5RA 3HV8A 3BTNA 4GYFA 3U6WA 4X0NA 3W29A 2D22A 1EJUC 3PZGA 2E68A 4MTVA 2C71A 2O7QA 2O9RA 2VZVA 4ERAA 3IGSA 3V35A 4AEFA 2PP1A 1GCYA 3WUEA 2P8BA 1D3GA 4F2TA 5I3KA 3EOSA 3PZIA 4CLMA 3ECQA 3ATZA 5DT5A 3CZGA 3QVQA 5DCBA 1VZWA 2BG5A 4E2BA 3EWCA 2R1PA 3WEZA 3W1NA 1PWLA 4PH6A 3KS6A 1O6IA 2PI6A 3N6QA 1YTKA 3PZ9A 5DRCA 4IP7A 1J0YA 3G22A 3UJSA 5CBJA 3F1QA 3OLDA 2H9AA 4C7FA 2GUBA 1DTUA 5BMWA 3W1PA 4QLJA 4KRUA 4JICA 1IEQA 3TYDA 1OB0A 3TXVA 1EF2A 1KTCA 3B04A 1EJXC 4S38A 4OFCA 3Q65A 3CIWA 2ZZ6A 1M68A 2BOFX 5C2GA 2IQTA 4JDBA 2EPMX 3WKZA 4C6OA 1QI5A 3SCOA 4UTMA 4H83A 4PUWA 2AMXA 2V2DA 3DG3A 4OWGA 1H49A 2YL8A 1VFSA 3B97A 1JXJA 5G4EA 2PEVA 2E4TA 3LX9A 4B91A 1DQWA 3AIVA 3LERA 3Q2DA 2WHKA 2Y7FA 5BOEA 1M53A 2DH3A 2C18A 4RV8A 1LQAA 4J3SA 4WDUA 3WQ8A 2ONEA 4AWEA 2PDGA 3F7JA 1H51A 2OFJA 1JYWA 3LBCA 4CNSA 1MI3A 1FWRA 2BP1A 4TU1A 2PTDA 4POCA 3NQ6A 3VNZA 4MHBA 1ZRQA 1EF3A 4Y2WA 1KWKA 5CC7A 2PDUA 1DJWA 3FJLA 3QGVA 1GVRA 2V30A 4BWLA 3RLHA 1L6SA 2XSXA 5IFTA 1NF7A 2OLHA 3LRLA 3VA8A 3M0LA 3BARA 2IS7A 3I6TA 1NWRA 1EIXA 3ARZA 3CMFA 3FCPA 5EMJA 2D3NA 3M7SA 2ZQ0A 1W1YA 1GTEA 5HQMA 2OO0A 1TZ7A 4NP7A 3IK4A 3FA3A 3C3NA 4JYEA 1XG4A 2HPIA 2GVLA 1OYAA 4LVFA 3KRSA 2OX4A 3KS5A 4J4KA 1BGAA 4W93A 4Z2JA 2QJHA 5T8GA 4JQ4A 4LEQA 1VCGA 3BPWA 1SZEA 4NZJA 1KM5A 3PPHA 1TA3B 3GH7A 3H4GA 4XVEA 3R10A 2YA2A 1VFLA 4IM4A 1WXYA 3RPDA 2PLJA 1EJRC 4AEEA 2A7PA 2VWTA 1JEZA 2OTDA 3BG5A 1NOFA 1S38A 4B15A 4DUWA 2C19A 1T41A 3AU6A 1FXPA 1U1JA 2VRKA 3OG2A 1KWGA 3CYJA 4JTRA 4CNNA 2NWSA 4RPPA 3GHRA 4C7GA 2J7FA 1ISVA 4NU7A 4PEKA 5FD0A 2DZWA 4EE9A 3QZAA 2GK1A 4UMAA 3WF1A 4AMAA 1B57A 2E40A 1CNVA 3USBA 4OECA 4Q8QA 1ZZMA 3AIEA 1VEMA 1TJ0A 4OQVA 1EWEA 4HTBA 3SW6A 3W1RA 2X42A 1H0IA 2I5QA 3TQPA 1LLZA 2VUNA 1W37A 4JL1A 3K46A 3VE7A 4HIBA 3E02A 2NSOA 3M0KA 3SCPA 2WBKA 4GI8A 1UJQA 3ARUA 4S3DA 3F4WA 2WVVA 1HP4A 3W83A 2AQVA 3T07A 4KFPA 3ZT6A 2J6VA 4OU1A 2J13A 5CC5A 3W22A 3C0SA 1JYVA 1VLWA 3W27A 5CSSA 4E4PA 1XI3A 4PMOA 1XIBA 5CPMA 2RDXA 1G7UA 4I5XA 4IOTA 1YRRA 3M47A 4YN5A 2VGIA 3ZT5A 2E6FA 4K6AA 1SSGA 3L4XA 3LSBA 2GVYA 2A7RA 1VF8A 2ISSA 4H9XA 3L0NA 2Y5JA 1SW0A 4UFHA 3FOKA 3WF2A 1EGMA 3RNDA 1HKMA 2FB3A 2ZVIA 1UBSA 3A47A 3GNOA 4HZMA 5GJNA 2BHYA 1P4CA 4B5WA 1CB2A 3DECA 1KXVA 4WD0A 1I2PA 3WD2A 4E38A 4AVNA 3LGEA 1XLGA 3ANVA 2QF8A 3EEGA 4XD4A 1IV8A 3UZYA 4KWVA 3C8NA 1DE5A 3K4AA 4L1XA 4E5TA 3S5NA 4O1EA 3BAJA 4Y90A 1TWIA 3N29A 5TD4A 1DORA 1OIFA 1D2KA 4M81A 1P6BA 2DZXA 1KFCA 5AB3A 3TR9A 1WCGA 2J24A 4HYWA 2J7BA 3SRKA 5A2BA 3GW0A 1U1HA 3UBPC 5G2HA 2G3JA 1Z41A 3GG7A 3WD1A 2CLPA 2FGLA 3H21A 3RR4A 4QEEA 1XH0A 2WHMA 4JTLA 3KP1A 4YVXA 2HDJA 4UB9A 3UP8A 2DZAA 2CLFA 4JN7A 3T55A 4KWWA 3F4DA 4UXDA 3GBDA 2NQZA 1KGUA 1QFEA 4MZYA 1E73M 4DUOA 1KRAC 1X39A 4JEJA 4C6QA 2FHBA 4RDWA 3AZTA 1J0ZA 1Q63A 3GUWA 1VRXA 2RJHA 3AS3A 3SCQA 4CQAA 1ZBCA 4KEZA 4HOWA 1H61A 1XSKA 3EPMA 1NWTA 2ZADA 1FCVA 1W9PA 2E28A 1T99A 3G1HA 3QOMA 1OF8A 2HISA 3S9YA 1KXQA 4FXRA 3KHDA 3WQOA 5CXPA 4ATLA 3NXFA 4N7QA 4FLQA 2Y1HA 1E3ZA 1DWIM 4RUBA 3FAWA 2J8GA 5FL1A 2EQDA 5JH2A 2J7EA 2XFWA 3QN3A 4K39A 3RFAA 4Y9OA 3UZZA 4L6DA 1TJRA 3EWZA 4LXFA 1KO0A 1DIDA 3A64A 3TZFA 3T78A 4RE2A 3VZZA 1JL8A 1FWNA 2VGFA 3DFTA 4H8UA 1GUVA 4AC1X 2PU0A 3W7RA 2C13A 1VENA 1KTBA 4L4OA 4G6CA 5FESA 4MAVA 3M1ZA 1B9ZA 2VEIA 3W73A 1LG1A 3LENA 3IAPA 5G2WA 3EWWA 4B2DA 1BWKA 4PTWA 4JDYA 2JKEA 1FA2A 4KGLA 3G24A 4Q8TA 3PFRA 2QVHA 3WD0A 1XC4A 4L9XA 4O1DA 3ZLFA 2YDRA 2DVXA 1ZP4A 2RKXA 4KRTA 5BU6A 3MWCA 4ZO6A 1XIFA 3W71A 3UZJA 4UOZA 4DF0A 1B4EA 1RD5A 1XGEA 3UT0A 1KRCC 4NQ1A 2RGMA 1VFFA 2EJ1A 3PN8A 3ZT7A 3AHVA 2OMAA 4NAFB 1TX0A 2ZZ2A 2EPKX 4X2PA 1C93A 3N6JA 3KM8A 2QIIA 1FWJC 5AY7A 4BCEA 1LOQA 5CSYA 3QYSA 1JD7A 4Z0SA 4M51A 4WVXA 2OPJA 2ICSA 4UTFA 4R85A 1H0GA 1Z32X 3VDGA 3TYCA 3GVRA 1G4PA 4ONVA 3KXQA 3OJGA 5HMFA 4HMNA 3ARQA 2XIMA 1LORA 2E6DA 4IIHA 2DSUA 2W91A 1RH9A 4IPNB 4MKSA 3KBMA 2ZC8A 1H60A 4TQTA 4O13A 4EAMA 3GXPA 3QGAC 3V16A 4N42A 3G1DA 4DO4A 1JGIA 3VNLA 1A53A 2PTYA 1PJ9A 4BJHA 1FKWA 3THDA 2ZX9A 3TW7A 1V3KA 1J9YA 1AH0A 2BBFA 5J8LA 3CAQA 3PZOA 5I77A 3SUSA 3OHMB 2CBUA 4ZE5A 4WQ6A 5BU9A 2Z27A 1FQ0A 2WQPA 3W7GA 1ISXA 1N8WA 4RX0A 3M16A 3QH2A 1TIMA 2YSWA 1A5MC 2B4GA 3GR7A 3UESA 3VFLA 4HN4A 1PZ2A 4AZ5A 4NJIA 4JCLA 3LYEA 4DB7A 2A3BA 2AAMA 5C5YA 4K7YA 4O14A 4RZBA 4I3GA 6ALDA 3EX4A 5C0QA 2DSKA 1GVIA 1YTDA 4PMYA 4B5XA 1LWJA 1TV3A 1QR7A 3CQIA 2VR4A 3WK3A 4AVOA 2WJEA 3JZUA 3CAWA 3GTXA 3II1A 3A21A 1VEPA 1H7RA 4L5ZA 4RDVA 1J0JA 2HROA 2J75A 1UUMA 2OOFA 3BSMA 3S5ZA 1HKWA 1A5UA 1QO2A 3UNDA 4AXNA 1V6YA 2OU4A 4K1WA 4IPIA 4HOXA 4O54A 4JKMA 1RQBA 3S2CA 2FPTA 1JF6A 1VB9A 5D2TA 1ISYA 1KTNA 3VX1A 1H7NA 1ZPTA 3XIMA 1W9DM 2X8RA 5KITA 3QTPA 4UFJA 3OYXA 1I2OA 1Q13A 5LIUX 4J2PA 2QCMA 3W86A 5F4WA 2HXTA 5AHNA 3WL0A 3O2LA 1WB0A 3B9EA 1G1YA 2JE8A 2AGTA 3HO8A 3ITOA 4G8TA 5CC6A 4UQCA 4H6KA 1R38A 3WZ0E 4KRZA 1RVKA 3UY8A 2VFGA 5I3HA 2YR1A 1AW1A 1MSSA 1FP8A 2X0HA 2H3DA 2QMKA 3GKFA 3MDUA 1O7AA 4JXCA 1HIZA 5FAJA 1HL8A 3RM4A 3NURA 3K4WA 2WVSA 1X8CA 4ZQMA 3NSNA 4IG2A 3BMXA 5H8UA 4HZ6A 1N7KA 1QPNA 1VH7A 3NSMA 3TFXA 4F48A 4H6EA 1UD5A 3WEOA 2QPSA 4PZVA 2ZWZA 3QQ1A 5EU9A 2HTMA 4UTHA 4OIFA 4X22A 3A23A 2ZUSA 1S3HA 1E9IA 3PBGA 3A5VA 3QLDA 1P0DA 5AN7A 5ABGA 4DXXA 4ECLA 1R9YA 5I09A 3C0LA 4NASA 1L6FA 3CTTA 1SGJA 3S6DA 1ADOA 1BWLA 1L2UA 4PMQA 1TMHA 4LF1A 2IKJA 2VCAA 4ZGYA 2EG6A 4LYKA 4D8ZA 3F2BA 4QSFA 3CZEA 3VOIA 4AIEA 4D71A 1G0CA 1Q66A 3W6YA 2WC4A 3VI2A 3ME3A 1O1HA 3MUXA 3E49A 1OCNA 1V7YA 5M2FX 1FDZA 1GVOA 1HP5A 3SCWA 4ML9A 2WMJA 2JGQA 4HJFA 4J3UA 3RITA 4H7ZA 4GGHA 4O4WA 1O68A 1F76A 4FAMA 1POJA 3FAXA 3T2QA 5CPOA 3N4AA 3VDBA 4DUXA 1UROA 4XWUA 4HU4A 3WNMA 4GC3A 3GS6A 1XICA 1JPMA 5EMLA 3HGRA 2W92A 5GPRA 1TVPA 5GQBA 1KXTA 5JBFA 4AZ7A 1JF5A 4B5TA 3NZRA 1RPKA 1RXOB 1IWBA 2VI0A 3LXBA 4YL2A 4KCWA 4IIFA 8TIMA 4MNMA 2Y2WA 3KW3A 4DQWA 1K7XA 1YE4A 2YDAA 4M8UA 4S3JA 4DY1A 1LWIA 2UY5A 6REQA 4JTDA 3VOCA 4HK7A 4PTNA 1CDGA 3R94A 3VKDA 4XV0A 2TODA 1ZBKA 1V7AA 2WW5A 3TEVA 1QOQA 1WZMA 3RLVA 2IQDA 3W1XA 5DEZA 4AYGA 1AA1B 2ZXDA 2YCLA 2G3MA 1IXPA 4O50A 1LRTA 4OOZA 1PZ1A 1XISA 4L80A 4O4VA 1UWAA 1WKFA 3MCNA 4XUYA 3BO9A 1V0NA 1UWSA 5TIMA 2QKFA 3UWZA 3V5CA 4FNRA 3H23A 5HMSA 3CGTA 2XIBA 3M0ZA 2VOMA 4UMCA 3JZEA 4XZLX 3AYSA 2QPUA 2NQHA 1WA3A 3TJXA 4QDWA 3ZSSA 5E6ZA 1GQNA 1RAKA 1KLYA 4HPGA 5FF2A 1JZ7A 3RPMA 1PDYA 2ATSA 3UWWA 4IIBA 4Z2KA 4AZGA 2GK1B 3E0LA 2PF0A 3LCFA 2B81A 2E9LA 1R30A 4DPQA 4LNYA 5HWNA 3IV3A 1LRQA 5M03A 2C1IA 2Z1BA 5HXMA 4CCEA 5E93A 3C2FA 1CGTA 3IIXA 2TPSA 4S3EA 3VNDA 5E0FA 4YTSA 1M04A 1MW0A 2WC7A 4N2YA 1CXEA 4MJZA 1EPVA 1YPIA 2QEZA 3H7VA 4JTIA 3DFSA 3H4XA 4K7VA 3WF4A 3P82A 4FB7A 2VRQA 4AIBA 2RDWA 1RLDA 3AZRA 3AYRA 1OF6A 2WWDA 3VOFA 3LTSA 3QQ0A 5HNUA 1NTHA 4HNCA 3PK7A 2NX9A 4EPBC 1UKSA 4IL2A 5FA5A 3A4JA 5EYWA 1GOWA 4Z1AA 1VBJA 4X61A 3I10A 4FX7A 1IF2A 1MUCA 5ABTA 4AUBA 1MDLA 1WV2A 1R8LA 5REQA 3ARSA 3MT1A 3NCOA 1Y5VA 5EL1A 3RIKA 2WMHA 4JTQA 5KZEA 1F74A 1TJ1A 4ML4A 1OJXA 3VC6A 3U7BA 4C1LA 3TC3A 3W1LA 1IEVA 4Z2IA 3VGBA 4BS0A 3N2XA 3UNTA 1RQHA 5C6MA 3N2TA 4WF7A 4F66A 1S2VA 4K36A 3IUDA 4O15A 4QP0A 4J3WA 3SGZA 5B7YA 1TPVA 3Q58A 4H8NA 3C6CA 1UD2A 3MCOA 4Y9PA 2DU2A 3HPZA 1BKHA 1B5TA 2GJXB 2FKPA 3SSZA 1Q4WA 3QR3A 3KRBA 4NI3A 4ROQA 3GFXA 5I3FA 2CZFA 2VZUA 3ZYZA 1KLZA 5D03A 3WK1A 4AY7A 1E9ZB 3NDZA 5E0KA 3MSYA 1TPC1 4X9YA 1CCWB 3KVJA 3H6OA 3WQFA 1C9WA 3TAKA 2PTZA 2PTWA 5ENLA 1IGSA 4JOMA 2YBTA 4ZXOA 1C92A 4IIDA 2D20A 4ZO8A 3PAOA 4JN6A 1NJJA 3SRFA 4YWIA 4NNBA 3HGSA 5CPQA 2BFGA 4A21A 2GQ3A 3CWOX 4JTHA 1O4UA 2DFAA 3GX9A 1I0BA 1E56A 1TJ2A 4IMGA 1E1EA 4HKPA 3W24A 5AC7A 1IEWA 3W2NA 2QJJA 1ZJAA 2OQLA 4J5NA 5FAGA 3CEUA 2D2OA 3NL3A 2OO6A 1YNPA 2QCDA 1BAGA 4IHCA 3UXKA 4PB4A 1UQZA 3U4AA 1HVQA 3FK4A 3VM5A 4JCMA 1TKKA 4JFSA 2VT0A 3T81A 2WSKA 2WHLA 4YTTA 5AKQA 1JAEA 2KZHA 4ZR8A 1Q6OA 4DJEA 3KTSA 1W1ZA 4YU1A 1RY0A 5A6LA 2PPGA 2CXGA 3GUGA 3FHQA 3TTEA 1GYMA 3M07A 1MVYA 2QR6A 4UR7A 1FH8A 3G1FA 1LUCB 4RJEA 4NNCA 4AD5A 2W67A 1TV2A 1IXNA 2VEMA 4DBDA 1VR6A 1WDQA 2IPWA 4WSJA 1IWPA 1CGUA 1K3UA 3OP2A 2ZA3A 3QY7A 3SQMA 4CKQA 4DF1A 3ICJA 1W31A 2QS8A 2VEPA 4RNJA 2Z1KA 4NJGA 1BQGA 3I7RA 5CJNA 4W8LA 4B92A 4DJFA 1R3YA 4F2BA 3LCLA 4HTYA 5EFDA 1KV5A 3AROA 4LUYA 7ODCA 4PODA 3G18A 3DBNA 5AHFA 3PZUA