5DBTA

Crystal structure of c-terminal truncated 2-deoxyribose-5-phosphate aldolase (1-201) from streptococcus suis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
201
structure length
201
Chain Sequence
MKLNKYIDHTILKPETTQEQVEKILAEAKEYDFASVCVNPTWVALAAESLKDSDVKVCTVIGFPLGANTPAVKAFETKDAISNGADEIDMVINIGALKTGNYDLVLEDIKAVVAASGDKLVKVIIEACLLTDDEKVKACQLSQEAGADYVKTSTGFSTGGATVADVALMRKTVGPDMGVKASGGARSYEDAIAFIEAGASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxyribose-phosphate aldolase
publication title Structural insight for substrate tolerance to 2-deoxyribose-5-phosphate aldolase from the pathogen Streptococcus suis
pubmed doi rcsb
source organism Streptococcus suis gz1
molecule tags Lyase
total genus 71
structure length 201
sequence length 201
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2015-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5dbtA00
3W07A 3NQVA 5K7JA 5FF3A 2H8XA 2JKPA 1I2RA 4ZQPA 1W37A 2PRHA 4FNPA 3HQ1A 4R7JA 3L5AA 2Y7GA 3NDOA 4NXKA 1ZAHA 2FLIA 3P81A 1E51A 2FPTA 4HNUA 1YADA 3H54A 7TIMA 4DO4A 3LCHA 3HGJA 3W7KA 3TQKA 4XZ9A 3JRKA 4AWUA 4OWGA 4OQVA 2KZHA 3EB2A 3TC6A 4N4QA 3WK1A 1FDYA 5DCDA 2V5BA 2B0MA 3DU0A 3K30A 3W1NA 3CQ0A 1T96A 4Y9AA 2CLEA 3LX9A 3KRSA 1AK5A 3NPXA 2WKJA 2Z6JA 4RR4A 3KRZA 3IGXA 4IMCA 1JCLA 3NOEA 4YLWA 4DBDA 3S1UA 2HMCA 1KV5A 4BFAA 4AHPA 2E6DA 2NUXA 1OJXA 1A5CA 3DI1A 4GFSA 2WOQA 2FJKA 4HIBA 5BRBA 3GKAA 3PVFA 1VQTA 1LBMA 3NGJA 2QCLA 3RMJA 1TJRA 2J24A 4O4WA 1FQ0A 2BWGA 2P1FA 5KITA 3DFSA 4O50A 3VCRA 2A1YA 2ZRWA 1PCKA 3FYOA 4MZYA 1H7NA 3OHIA 3G3MA 4ADTA 2ZA1A 3LI0A 3PSVA 3KFTA 1KM1A 4MLRA 4WOZA 5CGQA 1N8FA 2VFGA 1OX4A 3L9CA 2C15A 1S5WA 5D05A 4Y6GA 3NL5A 3P82A 4NJKA 3G18A 4UTWA 3BG5A 5HINA 2ZTKA 1I2OA 1HTIA 4XTDA 4IQLA 3HPXA 4JTEA 1VHNA 2BXVA 1QO2A 1XC4A 3R12A 4I7WA 3WJWA 2CLIA 3OIXA 4HNNA 4AEOA 3QMRA 3M5XA 4AXKA 2GPTA 3H53A 4EF9A 5G1TA 2H3DA 3WFAA 5FEWA 4LV4A 4O57A 3W74A 1UBSA 1YXYA 4MZ8A 5EPDA 2VKZG 1DORA 1JRBA 1YXDA 4E2DA 3ABOA 3S5NA 3FOKA 1G69A 3M6YA 1A53A 2C1HA 4TR9A 1J2WA 4UTIA 2J88A 2NZLA 4UNKA 4FIQA 1TRIA 4PA8A 1IXNA 1GYLA 1XBVA 3TA6A 4IXXA 3W1MA 1NAL1 1ZAIA 5LHFA 1FDJA 5CG7A 3ANYA 3PS7A 1HL2A 3M43A 5CPOA 2A6NA 1EA0A 1O4UA 3SJ3A 3WK3A 4MYAA 3TFCA 2E09A 1I45A 2ABBA 3HB9A 3UZ5A 3CT7A 5CPNA 4E0CA 4UFHA 3P67A 1G4SA 3MBFA 3YPIA 1P4CA 1PHWA 3UPWA 2NUYA 3C61A 4IWWA 1VH7A 4Z1CA 3NPVA 1GYNA 4MZ1A 2Y85A 4Z08A 2PRLA 1TPC1 2G96A 3CPRA 1FUYA 4FNQA 4C1KA 4FNSA 3RLVA 1GJPA 3TJXA 2B7OA 4O14A 3PC0A 1DHPA 3ZWSA 4E38A 3C2VA 4W9TA 1H7RA 3UY8A 2O7QA 3O1NA 5EBUA 1LLZA 2OT0A 2G97A 4UTLA 3LTPA 3MP4A 5FF4A 1PS9A 3M44A 1N55A 4UTTC 1LBLA 4UFMA 3PWAA 4ZQMA 4FB7A 1TPB1 4JD4A 1DVJA 4YL2A 5G4WA 1H5YA 3G1DA 1QFEA 2YSWA 5D2WA 1Q6RA 2FTPA 4XBKA 4A21A 3PB0A 1RV8A 3W23A 3EX3A 1UJPA 3CEUA 5LGXA 5HUOA 5F4XA 2ZZ1A 2A0NA 4AB4A 2E68A 5L6UA 4A2SA 1K8YA 1PHQA 1BWKA 3GIYA 4ZL1A 5AOUA 1OFEA 3C4UA 4BWLA 4GUHA 1LYXA 1VR6A 2YX0A 1YPIA 3T7VA 4PC8A 2X2GA 1OYAA 2OCZA 4NZFA 1SSDA 4MOZA 5CZJA 1LM1A 1P5BA 1QDSA 2Q8ZA 2XN0A 3STFA 3NEVA 4NJIA 3W76A 1QNVA 1J5TA 4JTIA 1W31A 4PODA 3TAKA 2ZZ6A 4RXGA 1RQEA 5IM51 3L0NA 2X1RA 3UWZA 1CW2A 3L0GA 3MI2A 4DPQA 1SZGA 1K7FA 3IEBA 1KM6A 1OG0A 1Q6OA 3L5LA 5G5IA 1F2JA 5K4XA 3KRUA 4UTMA 3W1TA 1DJQA 2QDHA 3HF3A 4KFOA 4MVAA 1TQJA 1EWDA 2ATMA 3NZRA 1H60A 4JEQA 2DZXA 2OJPA 3W7PA 5DN1A 3E96A 2QJHA 3PUOA 4K7YA 1YDVA 3W2NA 5DLCA 1LP6A 1QOPA 3IIXA 1KFEA 2DORA 5AFDA 2QJIA 1A50A 1S5TA 3S6DA 5AYYA 3M5YA 3PULA 3UQNA 4MY1A 5IBXA 5D09A 2OMAA 3UD6A 1H51A 1W3NA 4TX9A 4FHAA 1FWNA 3PF3A 2CLOA 3NQEA 3TV8A 2WO5A 4O52A 1PCWA 3LCWA 1T99A 1V5XA 4O1CA 3QJAA 4AMAA 3U2OA 3O16A 4PH6A 1RQBA 1XCFA 3R8RA 3PG9A 3NPWA 2VOMA 1F5ZA 2ISVA 5LKYA 4YCOA 4HNTA 1W0MA 3F4NA 3MWAA 4NXSA 3S1VA 1W5PA 4XWUA 3S5ZA 4S1FA 4JY9A 3U8GA 4KKXA 5DXXA 1VZWA 3GZ3A 3W1UA 4IPIA 3GAYA 3UXAA 1M6JA 3S5YA 2WV8A 3UNDA 3FKKA 3OVPA 1NVMA 3PSWA 4CCDA 3EXSA 2CU0A 2ZFAA 3FYPA 3DKLA 5CZ0A 1VCFA 2C14A 4MJMA 1XUZA 2V82A 5HR7A 5U4NA 3C52A 4Z1AA 1SW0A 3LTSA 1I4NA 3M5VA 2ZQ0A 5K2ZA 3LRLA 3TSBA 2TRSA 3IRDA 4QISA 5L9FA 1FBAA 3BLEA 5FEZA 1JRCA 4JY8A 1LDCA 1KTBA 4QSHA 2QDGA 1R46A 2OX1A 2QCDA 2V2DA 4Y8FA 3BLIA 1FWRA 3QQ0A 4GUJA 1O5KA 5G2IA 4DF2A 1SZNA 4ORIA 1LLWA 2JGYA 3GR8A 1EX5A 3IVSA 3IIOA 3CWOX 4RLIA 5J5RA 3B04A 5T26A 3P5YA 4UTKA 3GDKA 5I3KA 2JK2A 3T4CA 2QJGA 4POCA 4IUOA 3TU9A 4X3ZA 2NV2A 2GQ8A 1X1OA 4GBUA 4HPXA 1LOQA 2AAMA 5DCEA 3CIXA 2JKAA 1JCMP 1BTMA 3M7WA 2YGYA 1FX6A 1DOSA 2J27A 6ALDA 4GC4A 3S42A 3E02A 3W7OA 1JCXA 3M5ZA 3GK0A 3QMTA 4B5NA 1VYPX 1VYSX 4OGZA 1FCUA 1FCVA 5CSSA 2C19A 3W88A 3O07A 4FEZA 1GT8A 3QM3A 1S5VA 1O60A 4LUJA 3P74A 3LBMA 3W7IA 3EWWA 2B7QA 4UR7A 3TH6A 1VLIA 1TREA 1IGSA 3UWUA 2D73A 3GDRA 4FNUA 3HMJG 4ONVA 3MO7A 1DJNA 3DFOA 4WJEA 4A2RA 1O95A 1RVGA 1FY6A 3F1QA 3O06A 3STEA 3TIMA 4RX0A 2VFIA 4IJBA 3E12A 2I1OA 3M0ZA 2WQPA 5LNSA 2ZZ3A 3SECA 2BZNA 1ZFJA 3B8DA 2Z6IA 4N2YA 4Z0SA 3N34A 1M5WA 2DJLA 3WJXA 4MY8A 3QRHA 3DHFA 3CB8A 4UUIA 5DY2A 3R2GA 1R47A 4S2BA 5D2TA 3FEMA 2EKCA 3B4UA 1XM3A 2ZA2A 3T55A 3W2JA 4WUIA 2WNNA 4M6QA 3DFPA 4X22A 1IXPA 5TIMA 4OBTA 1EEPA 2JBMA 4O16A 5U7SA 3SR7A 2Y61A 3LRKA 3P8JA 1M7OA 3P7YA 1KBIA 1NF0A 3ZS4A 2R14A 2A7NA 3PBYA 5AYZA 3BW3A 2G95A 1OX4B 5CPMA 4H3DA 1W3TA 2RHGA 2XN1A 3ZR4A 4O54A 2A7RA 1VJIA 3INPA 1HFBA 2X16A 5C55A 3TFXA 2RFGA 5DBTA 3T40A 3O63A 1OX5A 4BF9A 3TW6A 3CIWA 2A7PA 3NXFA 4OT7A 5HQEA 4UFKA 1OFDA 4UTJA 5MHBA 3USBA 3ZFHA 5BMXA 2IQTA 1H1YA 1KBJA 3B03A 4LC8A 4QIUA 4HNVA 1OFBA 4FXRA 3B0VC 1WXJA 4IX0A 3MYOA 4QNEA 2VC6A 1DBTA 1X8FA 2TPSA 1SPQA 1OK4A 1J4EA 3S5OA 3HG5A 3NQCA 4HSOA 1TCDA 1S3HA 3GLCA 1JUEA 4HKPA 4IXHA 1W56A 2FB2A 1GVSA 2E5DA 1JVNA 3BV4A 3WK2A 1JR1A 4FNRA 1UB3A 1TPH1 1W3IA 2CLHA 3LHWA 4RKAA 4LV9A 1JUBA 2WPBA 2H6RA 3EXTA 2ZZ2A 3ELFA 3DKJA 2QR6A 4WX2A 5FEPA 4PFMA 2V81A 1SO5A 3L67A 5I3JA 1MZHA 4K8EA 3P84A 1BEUA 4C1LA 2ZYFA 1VCGA 1X1ZA 4QNWA 5HWMA 1XBZA 4QITA 4Z1BA 3GXTA 4P61A 1NEYA 3HGOA 3TMLA 3VE7A 3C2RA 5BMWA 3TSDA 3BARA 3ABQA 3W1AA 1ICPA 2GVGA 3LB0A 5G1YA 4ML9A 2ZTJA 1FWWA 1XUUA 1I2PA 4O10A 5D2XA 4JX5A 5EYWA 5I3GA 1NSJA 3T78A 3SFKA 4JNMA 1OFQA 3TCEA 1H7PA 2V2HA 1SFLA 1P1XA 1P0NA 3DENA 1ME7A 4GRSA 1NF7A 1UUOA 3C56A 3NQ2A 2CWNA 3W3OA 3GNNA 4AVFA 5FF7A 3LOTA 3P62A 3W2LA 4ADUA 3EEGA 4M6VA 1IIHA 4AHQA 1TV5A 4JIQA 3KOFA 2W79A 5KZDA 4AAJA 1ICSA 5AHNA 4JIPA 4EVZA 3CM4A 3GDMA 2OT1A 3G1AA 1GVRA 4IMFA 3TSMA 4YXGA 1FDZA 2YFOA 2CZFA 2JKEA 1SQ7A 3BG3A 1AMKA 1EWEA 3TUUA 1VC4A 5FEXA 1WQ5A 5D32A 1T8XA 3HO8A 2B7PA 3HG4A 2NX1A 4XQ6A 4RZ6A 3RK8A 4BI6A 3O6CA 3OVRA 5CZTA 2FQIA 5AHMA 2VENA 3QPZA 4ORMA 1H61A 5G2WA 2VEPA 3PR2A 3KVMA 3V75A 1IF2A 1EUNA 2RDTA 4JTTA 1VYRA 4IX2A 1GWJA 4RXFA 1RD5A 4OE7A 3NM1A 3LV5A 1TTQA 2HTMA 1RR2A 2B7NA 3O05A 3GNDA 4LTSA 2ZRZA 1VHCA 2E6AA 3JR2A 5EY5A 4BK9A 2X1SA 3BW4A 3CHVA 3TW7A 1YTEA 4ZMGA 3MP5A 4N4PA 1ZAJA 4LVGA 3NM3A 4K37A 4O18A 1F74A 3W84A 1K3UA 4Q32A 4FX7A 2C13A 1OYCA 3G22A 4JTUA 3VNDA 4UTHA 3FFSA 3W73A 4LS2A 2DU2A 3BPWA 2NWRA 3ABSA 3NL2A 4TIMA 4OV9A 5KSWA 4I9AA 5H2ZA 4CNPA 2VEIA 1XDMA 5HMSA 5HUPA 4WQ6A 3O6YX 3LHYA 1WBJA 1JCJA 2TYSA 3E9AA 3WK0A 1XXXA 3GVGA 4AH7A 3TAOA 1KV8A 4MYXA 1LTDA 2C3ZA 4NNBA 1GEQA 1SSGA 2A21A 2YYTA 3MI6A 1SUXA 3QSRA 4CCEA 2GQAA 1TPVA 3IIZA 3G1VA 1XI3A 2ABAA 1K02A 1KLYA 3MYPA 2RDUA 1KM3A 1TV8A 4IOTA 3HGRA 3R89A 1C8VA 4DQWA 5DY3A 3W9ZA 3OG3A 3EWXA 2V30A 2HS8A 1ZENA 4G1KA 2F84A 1A5BA 1OVDA 3QH2A 1JJKA 2ZBTA 1KFKA 1Z41A 3N9RA 3HIJA 4O1AA 2CLKA 4GWEA 2YPIA 4HSNA 4DEFA 3C6CA 4JYFA 4FNTA 4UMAA 3HOJA 3UYCA 2ISSA 3C3NA 3FLUA 3NAVA 1IIGA 3RU6A 4LW7A 5K3VA 5AHFA 1KM0A 3OA3A 3D0CA 4MPQA 5K4ZA 4FXSA 4TU1A 3ATZA 4J9JA 1SZFA 4O19A 2VFFA 4QAIA 5F2IA 1JUKA 3UWYA 1VRDA 4GNJA 3MUXA 5I3IA 4KWWA 3C2OA 3W7NA 2E5BA 3TXVA 3DAQA 2QCFA 4AWTA 3TXZA 3NQMA 2QAPA 1QPOA 4PEKA 3W85A 5G2HA 4NZJA 3IGUA 1WOBA 1W5MA 4WD0A 3O15A 4LC6A 4X9SA 2Y7EA 3GX9A 2WNZA 3N14A 3W1PA 4JTGA 1AW2A 2QCDB 4N02A 1F6KA 3W22A 1QAPA 1U83A 2Y6ZA 4O0ZA 4TO8A 1LCOA 1Y0EA 3CLMA 1LORA 3BGJA 5CZSA 3GDTA 5EMUA 5CPLA 1CX9A 3W1XA 3C8FA 3P8IA 2QF7A 4ZQOA 3TQ0A 3MW7A 1H62A 1MEHA 4DXVA 2GJLA 4LOCA 4BWLC 1TTJA 2A2IA 1W54A 3BK0A 3DH7A 2Z2UA 2Q8LA 1B57A 3ATYA 2B4GA 2NXGA 4MUZA 1VPXA 3TK7A 4IGHA 1PIIA 4L4MA 3UZJA 1K7XA 4EOUA 4M5PA 3PUEA 1YDNA 1SW7A 1DQWA 1UASA 3A22A 4X2RA 2QCGA 3DGRA 3W7RA 4ZZ9A 3N2XA 2CLLA 1GQNA 3LXBA 2ZZ4A 4PL1A 1K7EA 5D02A 4KFPA 1FWTA 3GAKA 3NA8A 1QPRA 1UUMA 3NQDA 2NX3A 4N6FA 4WXYA 3UWQA 4AHOA 5ABTA 2ISWA 2J9YA 2J9ZA 3KVKA 2OZ0A 3L2IA 5A8GA 4TMBA 2Z1BA 4EF8A 3KXQA 3G1FA 2E6YA 1LOLA 3MP3A 4LU0A 3B0PA 4UCGA 3B06A 1LROA 3U6WA 5D04C 4LS1A 3A21A 2QCEA 4XKYA 1TSIA 1AW1A 4DPPA 3PBWA 5IBXC 3W1LA 1OYBA 4DO6A 5KTLA 3SZ8A 1JQVA 2QCHA 3LCXA 4EWND 4Q4KA 5LNWA 3TE9A 1L6SA 3HPSA 1IXOA 1SO6A 1YTDA 2ALDA 5F4SA 1EP3A 1JCNA 1FWSA 2NX9A 3SY5A 3S9YA 2A6LA 5HJLA 5LGZA 4R53A 3PBUA 5AB3A 3F4WA 1Z44A 2ZRVA 5J5DA 5BOOA 1ZJIA 3QPYA 3Q37A 3EWZA 1TV7A 1I2QA 3ABRA 3I7RA 4O8RA 4I7UA 5K9XA 1A5AA 2BSLA 3W2UA 1R2SA 3LI1A 3G1XA 2ATSA 5LSMA 3W72A 1XBXA 1KTNA 2R91A 1QWGA 1FCBA 2QCNA 3S1XA 3LTYA 4A3UA 3O8AA 3DI0A 3LXCA 3SW6A 3N19B 2GUUA 3I65A 1W5QA 4O15A 5A5WA 1BKSA 2EGZA 3LM7A 5I3HA 3W7LA 4JN6A 1OFOA 1QR7A 2PRMA 3LHUA 1EB3A 4RCXA 2H8ZA 3P80A 6TIMA 1Z48A 3I6RA 3P60A 1U5JA 4MIMA 1QMLA 2V5LA 3LBCA 5LZLA 1UCWA 1TPDA 1H7WA 4M19A 5LHEA 3G8RA 2V2CA 1F05A 1XKYA 1Q3NA 3TX9A 3FJLA 3THQA 8TIMA 4BI7A 3CC1A 4R34A 4DF0A 1TTPA 3HBLA 3QSTA 4NNAA 4I7VA 3KVJA 1G7UA 2YYUA 3V1PA 3NL6A 3EKLA 1ZHAA 5E0KA 2ZA3A 2WSRA 1KLZA 4LRSA 4CQAA 1BWLA 3W7MA 3B05A 4CQ9A 1GVOA 4NJGA 3GKFA 2P10A 2ZDRA 4MY9A 3RF9A 3RFAA 1O94A 2YCEA 3OBKA 3W2MA 1TPUA 1V7YA 4K8HA 1EUAA 4GXMA 3NQ8A 1G4TA 3T44A 1TMHA 4AF0A 3H55A 4LY8A 2Y7FA 3KAOA 2QUTA 3TNOA 3MMTA 4O12A 5AHIA 3IGSA 3W7GA 5CSRA 1H7OA 4ADSA 1GVFA 3DFQA 4WY0A 2WSYA 4M7SA 5D2VA 1I8JA 2CZ5A 3M16A 4LT9A 1PV8A 4GUGA 5D03A 3P61A 3KVLA 3OVQA 4O0KA 1OABA 4OHQA 4O4VA 3L0KA 2BX7A 2NXHA 3W1RA 3N9SA 1SW3A 3PUDA 1PE1A 1K03A 3N73A 4JICA 3EKZA 3GR7A 5KZEA 2E5CA 3TR2A 1OF6A 1QPNA 1YDOA 4LVAA 1B4KA 1EP2A 1ALDA 3EX6A 1TJPA 5FF0A 1R30A 1TPWA 4RZ4A 2UV8G 3QYQA 4UXDA 1LZOA 3LHTA 3UY7A 5EKYA 3HGSA 5HNRA 1WV2A 3LLDA 2H90A 2Y7DA 2WJZA 4A29A 4PTNA 1VS1A 4MFDA 3FA5A 4Z1DA 1G4PA 1EP1A 2EHHA 1KFCA 1TQXA 1XFBA 4PL2A 3WJYA 3STCA 4Y90A 4MLJA 2DZVA 3E0IA 3G0XA 3EXRA 2AGKA 2VFHA 3EWBX 3P5ZA 3VKJA 3O6DA 3NQ6A 5LNUA 5TBOA 4KWVA 4JTFA 4NUWA 1KM2A 3QZEA 1RQHA 2YXGA 2X1TA 5AHLA 2RDWA 3IIPA 1HO1A 4IPJA 3SGZA 5F1VA 3TDFA 1KFBA 5D2YA 4RJEA 1OFRA 3FKRA 5KZMA 3NQFA 1LBFA 5C2XA 5F2MA 1L2UA 3EX4A 3G24A 3QFEA 3WJSA 3LLFA 4JDYA 3FIGA 1FXQA 3W7JA 1DQXA 1Q6QA 4JDBA 1L6YA 4LNYA 2AQWA 3TC7A 3BG9A 2Q3RA 4FX6M 2DZWA 1EIXA 1TYGA 5KMYA 2A4AA 4GE8A 2CZEA 3MI3A 1D9EA 1MEIA 3DHDA 1D3HA 3LXAA 3GB6A 4WZHA 2H3BA 3OEXA 4KFNA 4OV4A 5D33A 3SGUA 2BTMA 1G6CA 4BI5A 1WYIA 5H91A 5EA9A 3UWWA 3HJZA 1Z42A 4UNLA 3RLUA 1K8ZA 5HR6A 2Y63A 5D30A 4UTTA 2V0TA 2CW6A 3PY2A 1O5XA 3A24A 1OFAA 1LOSA 3QF0A 4HPJA 3S8HA 4UFIA 3Q2DA 5F2LA 2Y62A 3R5EA 3NG3A 1ONRA 4GUIA 2E77A 4GJ1A 3I7SA 1C29A 1A5SA 1SU5A 4ALDA 3IVTA 2GVJA 2YR1A 3CTLA 1OFPA 3CU2A 1GG1A 3PG8A 3LHVA 1MO0A 3NQAA 2F7FA 3NNTA 3PB2A 2VFDA 4Q33A 3W1QA 3W7CA 2Q3OA 3FJ6A 4R33A 4NJJA 3QMSA 1G4EA 2YDAA 2W0UA 5FF2A 3TQVA 1QPQA 2CFFA 2TMDA 4WY0F 3L68A 1X6UA 1TB3A 4JX6A 5I3FA 4QJ1A 3A9IA 1I2NA 2V8ZA 3W6YA 4L4LA 1ICQA 1AL8A 3EX2A 3DXIA 2W6RA 3GXPA 2GOUA 5AN7A 3MJYA 2QUUA 2NXIA 2X1UA 3R13A 3BGGA 1LRTA 1YYAA 4JX4A 4NJHA 3HPZA 5C6MA 1W8SA 4UTWC 4P2VA 3NPUA 2I9EA 3M41A 2P0OA 5E93A 3DFTA 4JR5A 4LVFA 1NFBA 4NT0A 4CLMA 3AO0A 3L21A 1QOQA 1THFD 2RKXA 1G67A 3N2MA 1PL9A 3W87A 1LRNA 5AC8A 3QEZA 2C0AA 4DO5A 4UMBA 1ML1A 4N9BA 4RK8A 2Z0IA 4QM1A 3WJZA 3LCGA 3LCIA 3ZWTA 4XUGA 3QW4B 5CKSA 3PBVA 2C16A 3M47A 4N9CA 3G0UA 4IMGA 2BLEA 3VFLA 4ZQCA 5K9DA 3G0SA 1KM4A 3W7HA 3L65A 2NLIA 3STGA 2ZZ7A 4O11A 3N3MA 3Q94A 1B9BA 2CLFA 1XDLA 1ME9A 1SR9A 1SFJA 4O28A 3G1SA 1C9DA 1HO4A 3SI9A 2QKFA 3M1ZA 5AC7A 1OF8A 3THAA 3I7QA 2FDSA 1HUVA 1KA9F 5G4EA 3PAJA 3LHZA 2LLEA 4NU7A 1XL9A 3KHJA 3C0JA 3F03K 3G8EA 4NNCA 5TQLA 2ZRYA 3W83A 2QUVA 4ZVJA 1ZALA 3MHUA 2GQ9A 3S1WA 3E49A 4RV8A 3GDLA 1D3GA 1OHLA 1TIMA 2YW3A 1JCYA 3AJXA 4UTUA 1PVNA 3HG3A 5BNKA 3G3DA 3G1YA 2A85A 3VI2A 2GVLA 4HT3A 3L66A 4NQ1A 1L6WA 3NQ7A 1DKWA 5HWNA 4O1BA 1XBYA 1HG3A 4LVDA 4WOQA 3W7QA 4DF1A 3LERA 2FPVA 2WNQA 5SWUA 2O7SA 1AG1O 2ZCGA 1GOXA 2WSQA 5LNVA 3JS3A 1KFLA 4CCCA 4O1DA 1VLWA 1ME8A 3PM6A 3LCLA 1SO4A 3NVTA 4U4MA 1WDWA 2PC4A 4JGDA 4LVBA 4E2BA 2ZZ5A 3LGEA 5DELA 3W86A 2XN2A 1MSSA 1ZNNA 1AL7A 1DV7A 2NWSA 2QCMA 4UIOA 4FF7A 4CNNA 2EF9A 4U28A 4AWSA 2C6QA 2JGQA 4GUFA 1IXQA 4YCPA 3UPBA 3G1HA 3NR0A 4IMDA 3MBDA 4NX0A 2R8WA 1YLVA 1GPWA 5F1UA 1VGAA 4JTKA 4JS3A 5GVJA 3W7EA 4LRTA 1M7PA 4XKYB 4WXZA 3RNDA 1H63A 1K8XA 2YFNA 1B3OA 1LRQA 4D2JA 4JYDA 1MXSA 5AHEA 4M7TA 5FI8A 3IV3A 4LS0A 4Z0JA 2QAFA 3W70A 3L5MA 1OK6A 3B0UX 4CQ8A 4EIVA 3CWNA 3NQGA 5C5YA 2FFCA 1JULA 5D37A 4PCFA 2FPYA 1DL3A 1FXPA 1JQXA 3EWUA 3MHFA 2I14A 1RZMA 2FB3A 1VCVA 1WBHA 4OU1A 1GTHA 3NO5A 1YTKA 1FCQA 2VFEA 2ZRXA 2VXNA 4ZQNA 2DZPA 2Y89A 1W5NA 3M9YA 2EPHA 3DZ1A 1QCWA 3UWVA 4NX5A 4HN4A 1YPFA 1GG0A 4YWIA 3UXDA 5EL1A 5FESA 2J6XA 3IVUA 4K38A 1TPFA 2Y70A 1WX0A 1F76A 2VEMA 1N7KA 1WA3A 3FS2A 5HULA 3W7DA 1L9WA 3TMQA 2R94A 1P0KA 2J9XA 5D38A 4UFJA 4JTJA 4MKNA 4XTIA 1Q45A 1F73A 1TPEA 2PE4A 3NYZA 2YW4A 4TMCA 4FX8A 2X30A 2DZUA 1WOAA 3I68A 1H50A 3HG2A 2CZDA 4H4IA 5E1QA 2G5WA 4K6AA 4UFLA 4K36A 3BVJA 2NV1A 4M6PA 4UC5A 1CI1A 4XBSA 4UMCA 1ADOA 4LUIA 4DELA 4K7VA 1F6PA 1B4EA 2TSYA 4A22A 1R2RA 5K9CA 4JTSA 3EWYA 2E1DA 1SO3A 1KTCA 2XFWA 4AF0B 2HS6A 3SSJA 1KFJA 3QW3A 1GZGA 2E6FA 1F7BA 3BO9A 3A23A 2ZRUA 2Y88A 1TO3A 1Q6LA 4H6KA 5F4WA 3BW2A 4WY0B 1H1ZA 3W2KA 5KINA 1W5OA 2DP3A 3LCFA 3QC3A 3KX6A 2HSAA 2FIQA 1KW1A 3EX1A 4JTHA 3SIZA 3TKFA 4O53A 5DXYA 1R2TA 4JXCA 1GTEA 4NVTA 3A5VA 4MJZA 1EPXA 5BW6A 1ZCOA 3LDVA 2DZSA 2PCQA 3W75A 2QEZA 5HWJA 1TTIA 3LRMA 4IMEA 2A5HA 2C18A 4UR8A 5DBUA 4N9DA 4ICNA 1ZY9A 2VEKA 4S2CA 1QO5A 3TJLA 3QQ1A 3TROA 3C2EA 4FO4A 5F2GA 3NZ1A 4MFEA 2YZRA 4O13A 4YMZA 4ZQRA 5LNRA 2NUWA 2QCCA 4RZ5A 1OX6A 1RPXA 3GYEA 2EAWA 2VELA 1T0OA 5AYXA 4Y96A 3VE9A 2DZTA 4FIRA 1X7FA 4HHPA 1YXCA 3IIVA 4O17A 3Q58A 3MHGA 4N6EA 4K39A 2V9DA 1KM5A 4QQ3A 3DBPA 1TRDA 1W1ZA 4BR1A 3NL3A 1WAUA 5AC6A 3DFNA 2CLMA 3LV6A 2RH9A 5C54A 1AW5A 1H7XA 1SZEA 3GXNA 5DCBA 4DBEA 1GVQA 4JTLA 4LWWA 2PURA 4CNOA 1G7VA 2DJXA 3BLFA 3C2FA 1MEWA 3W71A 3S0CA 4JYEA 2GJNA 3A5FA 4N9EA 3CEPA
chains in the Genus database with same CATH superfamily
1P6CA 5K7JA 3BGAA 3WQOA 5A8MA 4DRSA 2JKPA 4A6GA 2PRHA 4FNPA 2VZSA 1TELA 5FSDC 1MVYA 3NDOA 4U2YA 3ZOAA 1YX1A 5FAGA 4AZBA 1GZ1A 3VD5A 1F3WA 4XZ9A 2PD9A 4M56A 1ZP3A 3TC6A 4C6CA 4N4QA 4PMJA 4F79A 5HK4A 1XIBA 1I75A 3ITYA 1DIKA 2W4XA 4GXPA 2J47A 2PDUA 2UWFA 3E6EA 7TAAA 2D3LA 2QHAA 2BY2A 4JHZA 2DFAA 1US3A 4DI8A 1RAKA 4BFAA 1U2YA 2Q02A 2NUXA 3EAUA 2VURA 1LBMA 4NP7A 5HMEA 3R0DA 1NDWA 3OLGA 3B97A 2QW5A 3B0XA 1PCKA 4F40A 3QKEA 2FH8A 4YVPA 4ADTA 2D0GA 2PTWA 3P6LA 2W9MA 3KFTA 1KM1A 4GPNA 1EBHA 5CGQA 5A6MA 2HXTA 2C15A 3G18A 1BWVA 4L56A 2ZTKA 4XD3A 3N4FA 3ANUA 2BXVA 3WJWA 2J13A 5FAJA 2X40A 4L9XA 4ILSA 2GPTA 3GTFA 5G1TA 3N12A 4LV4A 1XYMA 4AYGA 1CXEA 4MZ8A 5EPDA 4GJJA 4C1NA 2PD5A 1YXDA 4K2SA 4HPHA 1G69A 3M6YA 4TR9A 4M29A 3JVAA 1J2WA 2WKGA 4OUIA 3RAOA 3DEQA 3RUBL 1XLJA 1NP0A 1XBVA 4IXXA 5LHFA 5CG7A 1V0KA 4WGHA 3GXMA 3K8KA 1KC7A 3AMGA 3P0XA 4HZ6A 3TFCA 3GC4A 1QI3A 2E09A 4KESA 3VNJA 3FDKA 1FWDC 3MBFA 3KZPA 4JCMA 3YPIA 1B31A 1XW8A 1Y65A 4NSBA 3UPWA 1HP5A 1S2UA 3PZOA 3H7RA 4IWWA 1VH7A 5G1MA 4IFKB 3NPVA 3QC0A 3OLEA 1M03A 1WDSA 2PRLA 4FLSA 3KLLA 1FUYA 1IZJA 1FH8A 2A3CA 4BEQA 4DAFA 4O14A 3PC0A 4HK6A 3OOQA 4KIEA 3ZWSA 2ACRA 4E38A 4QG8A 1H7RA 3BE7A 1V08A 2O7QA 4KEVA 5C9UA 3UERA 1J0IA 1LLZA 3VVGA 3I3EA 4XG1A 1Z8AA 2EO7A 2G97A 4IG2A 3WBWA 3T4WA 3LTPA 5FF4A 1N55A 1LBLA 1Y8BA 4NRRA 1V8EA 4JD4A 1EYWA 3D6NA 2BP1A 3AFBA 2ZE0A 4C6IA 2YSWA 4HN8A 5D2WA 3WYZA 4HOZA 2EPOA 9CGTA 4GH1A 5XIMA 3EX3A 2R1PA 5LGXA 2GGIA 3PAOA 2ZZ1A 2A0NA 4AB4A 4DNMA 1JXKA 3RIKA 1OFEA 3GXIA 4BWLA 5DFAA 3CUGA 1Y7VA 5D9NA 3ID7A 3T7VA 2X2GA 4KW2A 1OYAA 1GHSA 4WSJA 3SQLA 3UJ2A 3FNDA 1LM1A 1QDSA 5T9CE 2PDJA 4NJIA 1QNVA 4AXNA 1BRLA 4JTIA 1W31A 3TAKA 2ZZ6A 1RQEA 5A6JA 5IM51 2X1RA 3CHDA 1EDGA 3L0GA 1VJSA 3NFUA 4LB3A 1K7FA 1OCQA 4IPLA 1P1MA 1Q6OA 1F2JA 4UTMA 3CXOA 1H60A 3G2GA 3AHTA 3W7PA 3WLKX 2WNWA 2BV9A 3E38A 3URNA 2PB1A 3MS8A 4TXEA 3RRAA 1KGXA 1XQLA 2DORA 5BRPA 4J3UA 2NSXA 5BXSA 1AODA 2QJIA 3PBGA 3S46A 2V3GA 5CAHA 3NJ3A 5AYYA 3M5YA 3HMCA 4MY1A 4GISA 1JPIA 2O55A 2PCEA 1RP8A 1W3NA 1UR8A 4TX9A 1TMLA 3PF3A 2HBXA 3B8UA 2RGMA 3NQEA 3TV8A 5IHRA 4O52A 3A47A 3LCWA 2IPFA 4O1CA 3ZXWA 3WBAA 5C7HA 2ONEA 3O16A 2QGYA 1LUCB 1SMDA 3H22A 4MJ4A 3NPWA 4LBRA 5LKYA 4HNTA 1L8PA 1W0MA 3F4NA 3MWAA 1W5PA 2QQ6A 4TV6A 2QPSA 4KKXA 3PHAA 3HTWA 1VZWA 2RGLA 3JZEA 2PLKA 2WV8A 4WSHA 1NVMA 3PSWA 3IAPA 4QS6A 2ZICA 4F0HA 3QV6A 2CU0A 1CNVA 3BJTA 2C14A 3VX1A 2OLHA 4JQ1A 4LF2A 3BOLA 3KCLA 4DHGA 4CD7A 1I4NA 1UKPA 2X7VA 2UBPC 1IWAA 4MAZA 3SCPA 4PUEA 3V7PA 1C3FA 1BXCA 1XLCA 3EZ4A 2ZXBA 4JY8A 3IACA 5BWFA 1NQ6A 1KTBA 4WVXA 5E9AA 2QV4A 5IFPA 4NAFA 2V2DA 4Y8FA 3P14A 2AQOA 1SZNA 1HJWA 3MSYA 1UH2A 2HPIA 1EX5A 3CWOX 5J5RA 4PTWA 5M3WA 2BOEX 3GDKA 3T4CA 2QJGA 3AXHA 2VMFA 2W92A 1SJBA 3TU9A 1ITXA 2I16A 3TA9A 4GBUA 1MRQA 4W5UA 5DCEA 3CIXA 5D9PA 1JCMP 1FX6A 4OJYA 2J27A 6ALDA 4GC4A 4GYPC 3E02A 3GFZA 1J0JA 1ONWA 3OPSA 4RW3A 4OGZA 1K8CA 5CSSA 3O07A 1KRCC 5DMLA 4Q4OA 2QPXA 5JXQA 4GMEA 3W7IA 5I23A 4AWEA 3MZNA 1IGSA 4AZ5A 3GDRA 2DSVA 1E4LA 3R7MA 1DJNA 4WJEA 4PTDA 2Z7GA 5CXPA 4KT2A 2PZ0A 4P8VA 3BSMA 4IJBA 1DYSA 1LL7A 3M0ZA 2WQPA 5LNSA 4PUWA 4CNUA 3DC0A 2CITA 3B8DA 1J9YA 1M5WA 2DSWA 3DHFA 4UUIA 5DY2A 2ON3A 1O1HA 4R3UA 4C60A 1R47A 3FEMA 2HBVA 5I06A 3B4UA 2ZKMX 3TONA 4C6MA 3T55A 2XYLA 4WUIA 4Q8PA 1NWSA 5LIYX 1EEPA 3SR7A 2VX4A 3P8JA 1AJZA 3CZKA 4GXWA 3CUHA 4PUDA 5FSEC 3CASA 3PBYA 4XAGA 2REQA 1ZBVA 4CNSA 2RHGA 4O54A 2A7RA 2QJJA 2FYMA 2ZE3A 5C55A 3UZZA 3O63A 2YLLA 4M51A 3NXFA 3R0UA 3JUGA 4PCTA 4S39A 4UTJA 1H1YA 2G4JA 1CIUA 2XFYA 3VUSA 4JTRA 2P88A 2WMGA 5BXRA 2YIHA 4QDMA 4IX0A 3RITA 3MYOA 2XVPA 5MF5A 1BF2A 1X6LA 3QTGA 1OK4A 3S5OA 3NQCA 1TCDA 4UTFA 1GOIA 3GLCA 3UG3A 2HJPA 3GU2A 3ZSTA 3NVDA 4IXHA 2FB2A 2VD8A 1TUXA 4HPGA 2CLPA 2QGHA 1A5UA 1W3IA 3LHWA 5E9XA 3IK2A 2WZIA 4PFMA 3L67A 1R3TA 3UCQA 4QHRA 1MZHA 4F0RA 5CC5A 3DHUA 3UGRA 2FH6A 1XBZA 4Z1BA 1NEYA 4XISA 3VE7A 2D69A 1WUFA 3QLDA 4IPNB 3W1AA 6PTDA 3NTYA 2GVGA 4OTKA 3LB0A 5G1YA 4ML9A 4D6FA 1FWWA 3WDRA 1YEYA 3VD3A 3N9KA 4JX5A 1NSJA 3ZR6A 4JNMA 3BC9A 1J0ZA 3BL3A 2V2HA 3ARYA 2HDJA 3Q67A 1M7JA 2ZWYA 1UWRA 3SCWA 4PRWA 3C56A 2J75A 3WELA 3NQ2A 3W3OA 3GNNA 4QE1A 1TCMA 3LOTA 4ECLA 3BMWA 3HN3A 1NIUA 2WVUA 5KZDA 1PIFA 3CM4A 2OT1A 4RNHA 1T6MA 4IMFA 4ZENA 2YFOA 4HU0A 2CZFA 3WBYA 2DSKA 3TZNA 3HV8A 2EJ1A 1AMKA 1W91A 3F5LA 4Y9PA 1VC4A 1ZU8A 5FEXA 1TZZA 2B81A 3HO8A 3HG4A 4QJ5B 4BI6A 4LQ1A 4U31A 4YVXA 2O4QA 4NZ4A 4IFRA 3CK5A 1JYWA 1PX8A 3V75A 1IF2A 1VB9A 3TW9A 1VYRA 3H24A 2J7HA 3RMEA 2CETA 4RXFA 4PMZA 4RNIA 1RR2A 1LG2A 2B7NA 1VHCA 2E6AA 3TWBA 3NO1A 5EY5A 2X1SA 3VKDA 4HCDA 1JIBA 3SSZA 4MNLA 4LVGA 3NM3A 4P8WA 1F74A 3W84A 1XD0A 3FV9A 4Q32A 1M01A 1OYCA 1M9HA 1E6PA 2CESA 4TIMA 1C91A 4I9JA 3F2BA 4I9AA 4LBUA 2Z1WA 3WO8A 3LHYA 1TVNA 2ACQA 3CIVA 1JCJA 1UD3A 1FWGC 3GVGA 2HCVA 3TAOA 1KV8A 2C7FA 2ZDSA 2WPGA 3GO2A 3R4IA 3SN0A 3WLHA 1FH7A 1C7SA 1GEQA 2A21A 1WO2A 3MI6A 3QSRA 1MNZA 2GQAA 2WVVA 3IIZA 4D8ZA 3G1VA 1XI3A 1K02A 4AIOA 2ZADA 4EP8C 4IOTA 3R89A 3IJ9A 3OG3A 4Y9MA 2DZBA 3EWXA 4H7VA 1HIZA 3CUIA 2F84A 3QH2A 5HNUA 2GWNA 4O1AA 4F2UA 3VMNA 4GWEA 2YPIA 1A4LA 4EPBC 4DEFA 2NSOA 3VO0A 2WM1A 6CGTA 3FLUA 3NAVA 5AHFA 1KM0A 1R6WA 4J2MA 3D0CA 4E2VA 1M04A 3O7UA 3AIQA 4FOUA 3WUEA 4TU1A 3ATZA 3RG6A 1GQIA 4J9JA 2JE8A 3CHFA 4KH2A 2VFFA 4A35A 5F2IA 5IFTA 4GNJA 4H9ZA 1DWAM 3LEPA 2F38A 4KWWA 3W7NA 5GJNA 3TXVA 1ZQ5A 3DG3A 3DAQA 4HU4A 4AWTA 3TXZA 1DHKA 4PEKA 1DEDA 1GQLA 1NM9A 4WD0A 2PAJA 3CHCA 3GX9A 2WNZA 1R3SA 4IH3A 3EYPA 4XO6A 5A6KA 2CBUA 2PDQA 3UNTA 2Y6ZA 2XVGA 3KP0A 3ONBA 1PEZA 1VP5A 3BGJA 2R1MA 4JN7A 5CPLA 3USZA 2E4TA 3U7BA 3H4GA 3MT1A 2QF7A 1PWMA 4E6MA 3TQ0A 4DBWA 1QNSA 3SCRA 1H62A 1YMYA 4S3DA 2A2IA 3AMCA 1W54A 1NARA 3U9IA 2Q8LA 2W3ZA 2B4GA 4HTYA 1XCXA 3MO4A 2NXGA 1VPXA 4IGHA 3MWCA 1OSEA 1ZBKA 4EOUA 1K7XA 1K77A 3PUEA 3FSUA 3GZAA 4GYPA 2Y5JA 1UW9A 4ZZ9A 3N2XA 2CLLA 5EFDA 3WMBA 1K7EA 2ACSA 4OBSA 4ZE4A 1BXBA 4S23A 3GAKA 3MSRA 3NA8A 4RPQA 1UUMA 4WXYA 4N6FA 1DXFA 4B16A 1XLLA 3IPWA 3KXQA 1JI1A 2E6YA 1C8YA 3WENA 1ONEA 4FK9A 3ZMRA 4QCEA 5C9XA 2XIJA 3B0PA 3PTMA 4FLRA 2GFTA 2R6OA 4FI4A 1LROA 1CDGA 4W88A 3A21A 4JHOA 3QVQA 1DWFM 4XKYA 4DPPA 1E70M 5IBXC 1RD6A 4LCSA 4DO6A 1JQVA 2QCHA 4JNYA 4GCAA 4Q4KA 3UCDA 3HPSA 2ALDA 4IL0A 3S9YA 2A6LA 5HJLA 3PBUA 5AB3A 3F4WA 1GW1A 3IJIA 1MDRA 1TV7A 3I7RA 3L4TA 4HYVA 1Y5VA 6TAAA 2BSLA 1XIHA 1XG3A 3ME3A 1S46A 3W4RA 3LI1A 3NWRA 3AUOA 3II1A 4QSFA 1V6UA 5LSMA 3GE7A 2XIMA 5XIAA 2OELA 3IJ7A 3LXCA 2VDIA 1W5QA 1BKSA 2YKKA 4JN6A 1QR7A 1FWHC 2BHYA 1E6XM 2H8ZA 4RCXA 1BFNA 3P60A 1TR9A 5LZLA 2GJNA 1F6YA 1D8CA 2D2OA 5IHSA 4HVXA 4M19A 1F05A 1I1WA 4WF7A 1Q13A 3CS2A 3TX9A 3GH4A 5KEZA 2V5DA 2CKSA 4ML4A 4J28A 3MVIA 3QY8A 2AMXA 4NNAA 1G7UA 2H9AA 3L4UA 2XM2A 1A80A 1BGAA 2WSRA 1JFHA 4LRSA 3U5UA 3W7MA 5FJPA 2VGGA 3N18A 2OSYA 1XF0A 2JEPA 5IOBA 4RL3A 1O94A 4DB7A 2XUCA 3OBKA 4K8HA 2QF8A 3GD6A 1V3KA 4IP5A 4AF0A 3HM7A 3T05A 4LY8A 4BJHA 3R43A 3U2EA 3VDGA 1H7OA 3RX2A 5BU9A 4ATWA 3DFQA 1GKQA 2WSYA 4M7SA 2JF6A 2OOFA 5D2VA 4LT9A 3IARA 6A3HA 1PV8A 2DSUA 4FMVA 4B9ZA 3JU2A 3OVQA 4XSLA 3MJMA 3WD2A 3KBSA 2D23A 3ZT7A 1R7AA 3W1RA 4HMDA 1RP9A 1Q7MA 3SRKA 3BOXA 1PE1A 1QW8A 4Q4RA 3A9BA 2BHZA 2WXDM 1ZP4A 3ICJA 4IGSA 3T09A 3EKZA 3GR7A 2QUMA 2OLAA 3PZNA 4Z2LA 5BYWA 3Q45A 2V5KA 1TJPA 2WMHA 1LT7A 3QYQA 4UXDA 1LZOA 4C65A 2ZVRA 3GU1A 1B3VA 5EKYA 2ALRA 1WV2A 3AS0A 2YXOA 3TCSA 2NVAA 5A3HA 4KETA 3FA5A 4MKSA 1S3TC 2E3ZA 4LFYA 2YLAA 1CGVA 2F9RA 5EGRA 1HW6A 2XGIA 4ZO6A 4LUTB 1W1A1 3G0XA 4Q4SA 3ARZA 3EWBX 3P5ZA 4ZOBA 3O6DA 4C6JA 5PTDA 1OWQA 3NQ6A 3WLLA 3WQFA 1V7AA 2F2KA 2PDGA 5TBOA 4QROA 1UPMB 1RQHA 1B3YA 2X1TA 2RDWA 2W91A 4KEUA 4HTBA 3NQFA 3PZUA 5F2MA 1L2UA 1ESWA 4H8NA 3FEQA 1OG6A 5ABEA 2F8QA 4JDYA 1FXQA 2AQWA 3B8VA 2DZWA 1REQB 2A4AA 4GE8A 3SURA 1JYNA 1D9EA 1FWBC 5KZ6A 1TZ7A 3LXAA 1D3HA 3GB6A 4PCNA 4WZHA 4ZFCA 3OEXA 4DWSB 2VEFA 4LYPA 1Q5MA 3WLOA 2GDUA 1HZYA 4JN8A 3RLUA 2CYGA 3QR0A 1Q6DA 4MTVA 3RCNA 2WVSA 4MNKA 2YJQA 3TTYA 3VM7A 3TZFA 4UFIA 2Q8XA 3BZJA 3CPGA 3Q2DA 5F2LA 2WANA 4CKQA 1FWAC 1ONRA 3BCFA 4QR6A 2YR1A 1US0A 3FGCB 3MMDA 7REQA 1OD8A 3T0BA 2HVMA 2F7FA 1EKOA 3BJSA 4E5TA 3W7CA 1DJZA 2Q3OA 1YHTA 4PMOA 1DP0A 4ZODA 1VIZA 4Y9OA 3UXLA 3VOGA 3KL0A 3WSUA 3TN3A 3TQVA 1QPQA 4Y2WA 3K2GA 5KETA 2BY1A 2TMDA 3OBAA 3KOXA 3QGVA 1GKRA 3IUIA 3MANA 1I2NA 4J3ZA 1RK6A 2GOUA 3MJYA 1PUDA 2X1UA 2P8CA 4NJHA 4MB5A 3WBXA 4LALA 4P2VA 3ARTA 3NPUA 2I9EA 4M81A 3W27A 2P50A 3V35A 5E93A 1GORA 4JR5A 4CLMA 2GK1A 1R5YA 4RW5A 1QOQA 2GL5A 1THFD 3RCYA 1C8XA 4L6DA 2C0AA 4ZOEA 1HX0A 2R1NA 1GVIA 2BB0A 3K8LA 2PLCA 4RK8A 1QHPA 4W7WA 1FWFC 4B4FA 2UY2A 3M47A 3G0UA 3B9DA 1KCKA 3QOMA 3QV9A 1AQFA 2GJXB 3ERPA 3RJXA 3R8HA 3REQB 4JOMA 1MFUA 3PBMA 4A8IA 2YCJA 1VBJA 1OZMA 3SI9A 2VTFA 4MWAD 2G37A 1EBGA 3BLKA 3QR1A 4AX7A 1HUVA 1IQ8A 1N82A 3BICA 2HROA 1XL9A 3KHJA 4Q22A 4F9JA 3F03K 2DUAA 3KW3A 4H9XA 3V0SA 4J5NA 1NTHA 5CPQA 4ZVJA 3MHUA 2GQ9A 5DEZA 2EG7A 4U33A 1D3GA 3SUUA 3OJGA 3VD4A 3SQMA 3UZXA 1H4PA 2YW3A 1QI2A 3ITCA 3VIOA 4ROPA 4DJDA 5FJIA 3HG3A 3N15A 3ARPA 2INZA 2GVLA 1A5KC 1F07A 2WSKA 3PJTA 3KUMA 4GX8A 4H41A 4R9XA 3NQ7A 3B9NA 3GVQA 1Q8AA 1B9ZA 5CH9A 3W7QA 4DF1A 3LERA 5SWUA 2ZCGA 3VNMA 1PAMA 1K1DA 1OY0A 5I24A 3JS3A 4J27A 4DWSC 4O1DA 2YCIX 4MSSA 1VLWA 1ME8A 4L64A 3JW7A 3CBWA 3WLJA 4B92A 3GNXA 2XN2A 3F2CA 3MY9A 2YA1A 2IXVA 2EF9A 2HWGA 3EGJA 3EMCA 5EMMA 2JGQA 1IXQA 4YCPA 3MU7A 4NG3A 1LJYA 2OPJA 2P5NA 4IMDA 4KRUA 4WDUA 2VJXA 4CN6A 2GWGA 1GPWA 1J0YA 4CVUA 1M53A 3C86A 1VGAA 4JTKA 3F2DA 3WH9A 1T40A 1K8XA 3T2PA 1XP3A 4OVXA 1H3GA 5A8NA 1HNYA 6REQA 3VUPA 1VPYA 4LS0A 4Z0JA 2QAFA 3W70A 3L5MA 3B0UX 1U30A 3VABA 3C8NA 2FGLA 3PJWA 5FCZA 3ZJ7A 2VEGA 1JULA 4UOZA 3PP7A 3LSCA 1WCGA 1E6ZA 3SDOA 1R86A 3MHFA 3S6TA 4ZB5A 5CC6A 2PP1A 1VCVA 4D8AA 1WBHA 1UWTA 4OU1A 1GTHA 4HOXA 1DTNA 2NT1A 2VFEA 2ZRXA 4AZ6A 2I5GA 2V5JA 1PTDA 2Y89A 3SCOA 3LZ3A 1KXVA 1GG0A 4YWIA 3UXDA 1DWGM 1MFVA 4FLOA 4K38A 1WX0A 1F76A 1L9WA 3BJFA 3TMQA 1PB0A 4MJ2A 4UFJA 3WLIA 1ODUA 1AFSA 3ABZA 3GDBA 4XTIA 3CT2A 3LBOA 3ZVHA 5LYRA 1F73A 3NYZA 1XLKA 2YW4A 4TMCA 3AROA 4FX8A 4US6A 2DZUA 4GY0A 5H1WA 3HG2A 2V67A 4ERAA 2ZUNA 3MSGA 1XX1A 1ZUAX 3HURA 1UZDA 4IM4A 1U1JA 1GUVA 1EOKA 4R85A 1T8QA 3MCMA 4M6PA 1XV8A 1ADOA 3GUWA 4DELA 5I02A 1KBLA 4LEQA 5K9CA 4PTMA 2E1DA 3AHYA 5HANA 5AC4A 1Q4WA 3SSJA 3QW3A 2P3ZA 3ARVA 2ZRUA 2Y88A 3UA3A 1EX1A 3QFWA 4I6VA 3BW2A 4HNOA 4WY0B 1MQPA 3SCTA 4PMUA 3QC3A 1XLHA 4U5KA 4GA8A 1HKKA 3TKFA 3KE0A 1IWPA 2BVDA 3ITTA 2QUNA 5BOEA 1VBUA 3A5VA 1KBKA 1GOMA 2PCQA 3B9AA 1XRFA 1ECQA 1P6BA 3LRMA 4IMEA 4UZUA 5DBUA 1NFPA 3IJLA 3VNLA 4ICNA 1IGWA 3TJLA 3LYEA 1B3XA 3TNBA 1AQMA 2JALA 4MFEA 5E0CA 4KRZA 3WH8A 4L1GA 2QCCA 4OECA 1L8NA 4NZ1A 3GYEA 2D0FA 1T0OA 4EAYA 1YXCA 3QGKC 3Q58A 4N6EA 1KM5A 2XDFA 3QOKA 4JFVA 2E9BA 1W1ZA 5CGTA 4LCRA 3LV6A 5EMYA 5DCBA 1SZRA 4D6JA 1VFTA 1FHLA 2QMKA 4LCQA 4HCLA 4CNOA 3WQWA 1MEWA 4R27A 3A6OA 4FALA 3NQVA 3NCOA 4Z42C 1I2RA 5C9RA 4ZQPA 4F2BA 1XIDA 4R7JA 5AZ0A 5DRCA 2YBUA 3T1GA 4QRNA 2BOGX 3U2CA 4NXKA 1KKOA 1ZAHA 1E51A 7TIMA 3H54A 4DO4A 1PDYA 3ZJ6A 4B90A 4Z1YA 1XYZA 3HGJA 3RX4A 4AVOA 3TQKA 4BZYA 1UOKA 4AWUA 1VD6A 3W24A 2I56A 2VRJA 3GTXA 3PNZA 2IPWA 1ISZA 1DIDA 3VGEA 3ITGA 1FDYA 4K1GA 3MUIA 3I4KA 3K30A 1VFOA 3LX9A 3KRSA 4QP0A 1PWLA 3LG3A 1UH4A 3ALFA 4N0RA 2Z6JA 4RR4A 3KRZA 2XFFA 3HA1A 1NWTA 1EL3A 2W5FA 3PZVA 4R7WA 3VKCA 1AMYA 3MSDA 1KR0A 3DI1A 5BRBA 1G94A 1RY8A 4IJCA 2HE8A 3PVFA 3A4AA 1VQTA 3R6IA 3DOPA 2QCLA 3B9OA 3VK5A 2CBIA 3BAYA 1A5LC 3P2VA 4GO9A 3DFSA 3ARWA 2ZRWA 4WIWA 2J77A 3QN3A 1TKKA 4HK7A 3G3MA 3PSVA 3OZMA 3DYPA 4MLRA 1UQZA 2VFGA 4R88A 4Y6GA 1W1PA 2VQUA 3H23A 3BG5A 5HNNA 1HTIA 4JTEA 1XC4A 4I7WA 2CLIA 3RM9A 3TWAA 2ZXQA 1AZ1A 3QMRA 4UZSA 3AHXA 3W26A 4AXKA 3H53A 1CGTA 1C7TA 2WMIA 4LF1A 4DJEC 3OZOA 4ATDA 3W74A 4J3SA 1JRBA 2AL2B 2G3IA 3S5NA 3CZJA 5LIWX 1VAHA 3QV8A 4GQBA 2C1HA 4GK8A 3WG6A 1V3IA 2NZLA 4UNKA 1UP0A 1TRIA 4PA8A 1H1NA 1GYLA 3K5XA 4QJ4B 1NAL1 1ZAIA 1JDCA 2PGEA 5CPOA 6XIAA 3K1GA 1O4UA 4XIAA 3SJ3A 2VQTA 2Z24A 3HB9A 5BZAA 4WJ8A 3OYXA 3P67A 2XISA 3MUZ1 1PHWA 4N42A 2GGEA 3CV6A 1UD6A 4O1EA 4YS1A 2NVCA 3FHQA 3C61A 1X7IA 2AAAA 4Z1CA 3CPUA 3SY8A 3W02A 4GGHA 4UCFA 2G96A 2X0YA 4TVDA 4C1KA 4FNSA 3RLVA 3UP8A 3VCCA 4P8XA 1I9CB 3AWNA 2GLKA 2Q71A 1E1CA 3TJXA 1CXKA 9XIMA 1QHOA 3VILA 1HVXA 2CWXA 4E8DA 1V3JA 1XYCA 3O1NA 3CV1A 1E0WA 4JHMA 2YA2A 2IKIA 4CD4A 2OT0A 2RJGA 2YL6A 1EJWC 2BG5A 1PS9A 4UTTC 1PO9A 4UFMA 1B54A 3A12A 1CTNA 2VCAA 1JG9A 5CQ1A 5CJ5A 3S5SA 2D2GA 2ZX5A 3KBMA 4A21A 1Q8JA 3C5QA 4IP7A 3PPFA 4XZBA 2YCKX 1EC7A 5F4XA 1VEMA 3AOFA 5L6UA 4A2SA 1K8YA 5E5CA 1PHQA 1BWKA 3NOYA 3GIYA 3QQWA 3C4UA 3K1DA 3VYLA 3D5HA 4G7EA 1BQGA 2OO0A 3S83A 2YX0A 1P0DA 4NZFA 5CZJA 4E8GA 4ZGYA 1P5BA 3LGDA 3NEVA 1W2VA 3W76A 1J5TA 2D22A 4PODA 4RXGA 3L0NA 3KBVA 4DPQA 1SZGA 3IEBA 1KM6A 2J25A 3L5LA 2ATMA 4JEQA 3LQGA 1YBQA 1HKIA 2X2YA 1HGWA 5DN1A 2D24A 3HQOA 4KCTA 3W2NA 5DLCA 3ABXA 1QOPA 1WUEA 4J3TA 1WKFA 5CZKA 9XIAA 5BWAA 2EG6A 5I5RA 1TZ9A 3PPCA 3THCA 2VX6A 3GTIA 4IP4A 4FHAA 4CQCA 1UR3M 4JKKA 2FZ8A 4RE0A 4Q8WA 3TTSA 1T99A 2WHJA 2R1LA 3U2OA 2OFJA 4PH6A 4IIFA 3L7RA 4LYQA 4V15A 1JI2A 2VVSA 2O9OA 4YCOA 1KGUA 3SQSA 2OX4A 3CZLA 4B91A 3L12A 2FZNA 4MNJA 4S1FA 4JY9A 5DXXA 4REQB 3GZ3A 4IPIA 3GAYA 3UXAA 1BSLA 4RDZA 1EZ2A 3M0KA 4H6EA 1DXEA 3OVPA 4HPNA 3DG7A 1J2BA 2ZFAA 2NQJA 1VCFA 4MJMA 1W32A 1JZ7A 1XUZA 1W17A 1E6QM 5EFFA 3UR8A 1SW0A 3LTSA 5K2ZA 2PWHA 4KS0A 2YXXA 3Q4DA 1UP2A 2XPKA 3IRDA 1FBAA 3BLEA 2FVKA 4EAMA 1HL9A 2BFGA 3F4CA 1LDCA 3GU9A 3W00A 2WJEA 4QSHA 1R38A 2QDGA 5ENLA 5GNXA 2QCDA 1EGMA 4YTSA 2OB3A 4WK9A 5JMUA 3MMWA 1Z9AA 4GUJA 3WBEA 1LLWA 2G8ZA 3KOZA 3IVSA 3IIOA 4KCVA 3P5YA 2C1GA 3MUY1 2P0IA 3KTXA 4D1IA 4YVVA 1P7TB 4AD1A 4IUOA 2BDQA 4ACYA 2DVTA 2GQ8A 1X1OA 4JL1A 2F2HA 4IF2A 4H83A 4F48A 4HPXA 1LOQA 2Z7KA 3ZLHA 1Z6KA 3M7WA 3UT0A 3S42A 4H9YA 1ZJBA 3M5ZA 4W7VA 2GSEA 3OZPA 3QMTA 2XSAA 5AZ1A 5HJXA 4QFUA 2C19A 3GG1A 3MKVA 1CENA 1GT8A 2PEVA 3GHTA 1S2CA 2ZWZA 2WMFA 2WMKA 3EWWA 4X60A 3M0JA 2QIIA 3TH6A 1VLIA 1P0BA 2HNHA 2X0HA 3UJSA 3UWUA 2D73A 3COTA 3MO7A 3DFOA 3VOCA 1AUSL 1JYVA 3CQHA 4J2PA 1IV8A 1FWEC 4GBDA 3V3WA 2BZNA 3MV01 2YL8A 2ZX7A 4CVWA 3N34A 1UPPA 3UZWA 3QRHA 1FHUA 3CB8A 2ADAA 3AI0A 4S2BA 3N1AA 2F6XA 1XM3A 5HAOA 1E56A 1V0NA 5GJMA 5TIMA 2OYKA 3LRKA 4V28A 1M7OA 2OG9A 4UQAA 1H41A 3TN4A 3CH9A 3E74A 2ZC8A 3ZS4A 2A7NA 2BODX 4K68A 4H3DA 3UETA 2XN1A 4WR3A 1JF5A 5A2CA 2J62A 2NW0A 3INPA 3E0WA 3LGGA 2XIIA 3T6CA 4Z2HA 2HK0A 1OX5A 4BF9A 3TW6A 4OT7A 5HQEA 4UFKA 2WK2A 4DBSA 2IQTA 1KBJA 3GC2A 2OO6A 4C1NB 3B03A 3W0KA 4QIUA 4Z17A 4NY2A 2AOSA 3B8IA 3DYOA 2OU4A 2WLYA 2TPSA 3NO3A 1SPQA 3HG5A 3CL8A 5CG0A 2V63A 1RK5A 4GACA 1JUEA 2CBVA 3N6JA 2QJMA 4CCZA 5HOSA 4BF7A 1W56A 4WJXA 1DXIA 1ZBCA 3BV4A 3SY1A 4D72A 1JR1A 1DIOA 1XSIA 5A8QA 3T9PA 2VR5A 3EXTA 3T0DA 1E9LA 3DKJA 3UA4A 5A6SA 4K8EA 3P84A 1BEUA 4C1LA 2ZYFA 3MB9A 4MUPA 4Q8TA 4QNWA 5HWMA 3PTQA 3TMLA 4B15A 2PDLA 3AYVA 1IT0A 1A47A 2BHUA 3IRSA 1I2PA 1R9XA 5EYWA 5I3GA 2G50A 4CEXC 3SFKA 3QHOA 2QIWA 4IG2B 1P0NA 3DENA 1SMAA 4H2HA 4LYRA 2I9UA 3SIMA 2VRQA 1NF7A 1A5MC 3KDNA 5A69A 4Y9NA 4NRSA 2CWNA 4IICA 2DPEA 1OGSA 3EEGA 2O56A 4GQQA 2W79A 4EVZA 1TX2A 2P76A 2WYSA 1ISXA 2OR2A 4YXGA 4MDOA 2AMGA 1PDZA 2W61A 3LD5A 2HZGA 1M7XA 2JKEA 2DQXA 1QJWA 1SQ7A 3BG3A 1WQ5A 5D32A 4ZOAA 2NX1A 4XQ6A 4RZ6A 1TJ0A 3RCMA 3O6CA 3WF2A 3E2RA 2YCLA 4S3KA 2FQIA 1EJUC 2VENA 1FFQA 3W38A 4BQ2A 2VEPA 2WM0A 1PSCA 3H2NA 3K4DA 1BRLB 1TVPA 5FOOA 4OE7A 4PFHA 2FKPA 1NWUA 1J11A 1TTQA 3O05A 3GNDA 3LK6A 3VOJA 1OIFA 4H1ZA 1QK2A 1YTEA 4ZMGA 1EF3A 1ZAJA 3WQ6A 3A13A 3OBEA 4O18A 2CEQA 1WE5A 4PB5A 3G22A 3H4WA 4JTUA 4W8AA 3W73A 2DU2A 4ACZA 4EPKA 3OP2A 4XSMA 3PJUA 4CNPA 1XDMA 1AJ2A 3H26A 1XXXA 2F6KA 4XBJA 1R3VA 4K3ZA 4MYXA 4KEMA 5FKYA 3FJ4A 1ZTVA 1EF2A 4NNBA 1SSGA 2YYTA 3VX0A 1HKJA 3GHSA 2GUYA 3WNMA 4CCEA 3E0VA 3WMCA 1W3HA 1OADA 3HFTA 3MYPA 2RDUA 3O0KA 3HGRA 1JZ2A 4DQWA 4C5YA 5DY3A 3SCNA 1OINA 1ZENA 4FOJA 4WEVX 4JTQA 1UWUA 4KWOA 2GUBA 3EEZA 2DT1A 4P7NA 4L61A 3R25A 2ZBTA 1XRTA 3N9RA 1J79A 5I78A 3W82A 2CXEA 5LXXA 3D3AA 4FNTA 2DT2A 4UMAA 3UYCA 2ISSA 3O2LA 1BG9A 2BOFX 3OVGA 1F3XA 1XLEA 3O6AA 4FXSA 3GHRA 4XAFA 3VIHA 2Y24A 2W62A 4UWMA 1JUKA 2HVOA 3UXKA 1GK8A 3C2OA 3M7SA 2E5BA 3C0LA 4MKVA 1LWIA 2QCFA 3N2CA 2QAPA 1QPOA 4X0VA 1B5TA 1WOBA 3CZGA 1A4MA 1K9EA 4QQUA 2J7EA 4X9SA 4CU6A 3N14A 3W1PA 3UBPC 4NAFB 3N4AA 1F6KA 4NKCA 1JDAA 3SO7A 4O0ZA 2NLYA 4Q6JA 3GDTA 3E2QA 3C8FA 1JPHA 1U1UA 2ZXDA 4BWLC 1XLMA 1EH9A 3AJ7A 3PPGA 3ATYA 3U57A 3H2MA 3TK7A 3OW1A 2CHOA 1E9IA 1YDNA 1SW7A 2E40A 2BGQA 1XICA 5DMNA 3A22A 5I07A 5CLTA 4ZSUA 2BXYA 5A6TC 3EDDA 3DGRA 3LSBA 3W01A 4HU8A 1Q2SA 4PL1A 3WQVA 2Z4GA 5D02A 4LJ3A 1FWTA 1NQKA 2NX3A 3UWQA 2ISWA 1PZ2A 1W9BM 2NQ9A 2ZC1A 1TV4A 3G1FA 3K4AA 1XWYA 3AYTA 1LOLA 3MP3A 4MHBA 1SFTA 3UU0A 4LU0A 3POCA 1ZZMA 3PFRA 3TC3A 2QCEA 3PBWA 1UA7A 4D6GA 3CQIA 4EWND 5LNWA 3TP4A 5F4SA 3TYUA 1VKFA 3SY5A 5LGZA 2ZRVA 4UQBA 4KERA 2V3EA 4DZ5A 3AWOA 1ZJIA 3CQJA 3QPYA 3V5CA 1I2QA 3ABRA 4HNLA 4MWAC 4LSBA 4I7UA 5K9XA 2E8ZA 4ASTA 4F8XA 4FPSA 4ICMA 3WFLA 5F7UA 5JIPA 3GW0A 1L2QA 2A3LA 3W72A 2R91A 3S1XA 5CJNA 3LTYA 3O8AA 3SW6A 2REQB 2EGZA 2W63A 3LM7A 3SJNA 1AVAA 4PYSA 2PRMA 3LHUA 1EB3A 2J7GA 1UYQA 3I6RA 1U5JA 3ZJ8A 2NVDA 1CEOA 3VOHA 2J7CA 5AYBA 4YTTA 2V3FA 5A8PA 1E5NA 1Q3NA 5C2CA 5ECVA 4BI7A 2HRWA 1BLIA 3WLRA 4I7VA 3KVJA 2YYUA 3AHZA 1XIMA 1J01A 3CO8A 2F61A 4X9YA 1SJDA 2VZOA 4CQ9A 1Q6EA 4HJWA 1ZJAA 1V77A 2DVUA 3W2MA 4P8UA 5D8ZA 4GXMA 3NQ8A 1TMHA 3H55A 2QUTA 4O12A 1N2VA 3W7GA 5I6SA 1W9DM 1U5HA 5H6HA 3VTRA 3M16A 1H0IA 1N8IA 1V51A 3P61A 1QBAA 3TVAA 3EOOA 4O0KA 4OHQA 3L0KA 1JGMA 5HNTA 4ZEPA 2YBTA 4AIBA 3PUDA 5H8PA 2WWCA 1NU5A 4H04A 1XCWA 1ZJHA 1UD2A 4JICA 4CEUC 5KZEA 3TR2A 3RM8A 1B4KA 1EP2A 4W85A 4HHLA 4RZ4A 2UV8G 2A3AA 3M07A 4C91A 3B4YA 3XIMA 1DJGA 4HZMA 2JQXA 5I03A 3LLDA 2H90A 5JBEA 3FAXA 4Z1DA 7A3HA 1G4PA 3BDKA 3FY1A 1EP1A 5D4YA 5D9MA 3LQLA 1TQXA 5DT5A 4PL2A 3WJYA 1FVPA 3STCA 4JIEA 1TE1A 4MLJA 3PUGA 5C9ZA 4J40A 1SGJA 1XLAA 1ZPTA 3ALGA 1W9VA 2AGKA 1YKWA 2G3NA 4JFUA 4J3XA 1R3WA 1UC5A 4NUWA 4KBXA 2YXGA 1U1HA 2HISA 5AHLA 4ROQA 3IIPA 3VIJA 2Y8KA 4ZTXA 1KFBA 3E0LA 3I6TA 3FKRA 3LPGA 1LBFA 3WLNA 1EPVA 3EX4A 1AH3A 4GQGA 3DBNA 1GKPA 4AUBA 4JDBA 1DQXA 1Q6QA 2IS7A 2VT0A 3V0TA 1PZ1A 3TC7A 2Q3RA 1GEHA 1EIXA 2JIWA 3MI3A 3V36A 1MEIA 5CGMA 3TLQA 2IQDA 1V79A 2H3BA 4OBRA 3RPDA 1G6CA 4BI5A 3GH5A 3NSXA 3UWWA 1R3RA 3HJZA 1PTAA 1K8ZA 3I10A 4JFWA 5HR6A 3WQ5A 2OLSA 1M41A 3PNUA 2QLYA 1CGWA 4XVEA 2CW6A 1KXHA 4HPJA 2VZUA 3VDCA 3S8HA 2BGSA 3VIKA 4DXKA 4UQ9A 3M0IA 3H7VA 3NGFA 3R5EA 3NG3A 4GUIA 2HK1A 1PX3A 2E77A 2EJAA 2V68A 1A5SA 1WP6A 3L2MA 3CTLA 1QASA 2YB1A 3T0AA 3WD4A 1MZRA 2VGIA 1DJHA 3LHVA 5EBAA 3V5OA 3U4AA 1W3LA 3T08A 3WDQA 3ARRA 1HJSA 4DUVA 4Q33A 3KCOA 1M1BA 4EANA 2IW0A 3NURA 5I00A 4RE4A 3OODA 2EXOA 1Q6FA 2WVTA 5FF2A 4IIHA 1UP3A 2WVVB 1R3QA 2E9MA 4WY0F 1DJYA 3OO2A 4W86A 1TB3A 3AIWA 4J1OA 1NP2A 4LY4A 3GXFA 3CUXA 2V8ZA 2XVNA 3AIBA 1AL8A 2ZUSA 3DXIA 2W6RA 3GXPA 2PWEA 4GIEA 1RVKA 2QJNA 3R13A 1RLDA 4PUKA 1DQUA 1VENA 5CC7A 5I0DA 5C6MA 4UTWC 4HHHA 1Z89A 3RPMA 3M41A 2P0OA 3H6OA 4XAPA 1NFBA 2WZEA 2I17A 1G67A 2RKXA 1PL9A 5AC8A 2C71A 3BCJA 3QEZA 2X42A 1A5OC 2PDIA 3QXBA 1UKOA 2X41A 3LM3A 4GC3A 1FWIC 3ZWTA 3LCGA 3LCIA 3CL6A 2R1KA 4N9CA 2BLEA 4HA3A 1UC4A 3QHNA 2OQLA 1PKLA 2PDFA 1LLOA 1Q4NX 2ZZ7A 4O11A 3Q94A 2CLFA 1XDLA 3U0HA 4O28A 1WNOA 2JEQA 2X7WA 1C9DA 2OODA 2QKFA 5HDRA 5AC7A 1OF8A 2VDGA 2GVEA 4RDWA 4GX9A 2FDSA 3FAWA 1WZAA 2TAAA 2PTXA 5FJUA 4FAMA 2CZVA 4WDWA 3GNPA 3MZ2A 3CWHA 3IUDA 5EMLA 2CERA 3S1WA 4HP5A 4MNMA 3WF0A 1TIMA 5JH2A 1IEWA 4F4RA 4GH3A 4XD5A 2DY3A 3AJXA 2Z29A 4LUYA 3G3DA 4CN4A 2HPMA 3L66A 4NQ1A 1E6RA 4LNCA 1E4IA 4YHGA 1DKWA 5HWNA 4O1BA 4LVDA 4EXAA 1B1YA 2WNQA 2O7SA 1AG1O 3TJIA 1GOXA 4PUNA 1WAWA 1X6NA 4YYCA 3VU2A 1UUQA 1JZ6A 4EXBA 3O0FA 4JGDA 4LVBA 4E2BA 3LGEA 4QAWA 3VAVA 3WDHA 1ZNNA 1AL7A 4CU8A 1J6PA 2QCMA 1A0DA 4FF7A 4R7OA 2NQHA 4GUFA 4JFTA 2OEMA 3F4DA 3G1HA 1Z32X 3EOUA 4NX0A 4YHEA 1WB0A 3N2OA 2VL4A 1U5VA 1R9YA 1E0VA 2Y1HA 3W7EA 4LRTA 4W5ZA 4XKYB 4RNFA 4WXZA 3RNDA 3VNZA 1KKRA 2YFNA 1QRQA 3WZ0E 4M3PA 4AD3A 4D2JA 4A8LA 4JYDA 3EOEA 5FI8A 2VGFA 1CT5A 3NQBA 4PMQA 4ZSTA 4WHBA 1CLVA 4EIVA 2QVNA 2FFCA 3UVIA 1MW0A 4MWAA 1TV2A 1C8QA 2A3EA 4BQ4A 1J8VA 1FXPA 2FFIA 2PLMA 3EWUA 3RPTA 1RZMA 4NYUA 1UA3A 3DERA 2PDHA 1RBAA 3NO5A 1UROA 1FCQA 4LXFA 1YTKA 3CV2A 2OYMA 2DH3A 2VXNA 4ZQNA 3GH7A 2QZRA 5FJJA 3W53A 2OQHA 3M9YA 3DZ1A 3UWVA 4NX5A 3TYZA 4HN4A 5HXMA 1YPFA 4ZCWA 2X8RA 3VPLA 4C6BA 5EL1A 3IVUA 2FJUB 1ZLPA 2VEMA 1AH0A 3W7DA 2FGZA 4RNJA 2J9XA 1AD4A 2QPUA 4OZOA 7PTDA 2VHLA 4DLFA 2XSXA 2FVLA 2PE4A 3AQUA 4HB7A 2H9AB 1HXJA 4PMYA 1B2YA 4L80A 3MTWA 2ISDA 3ISIX 4D6HA 4K36A 4IQEA 2OZ3A 1XDJA 1XRVA 1SFSA 3RN6A 1VFHA 3WDIA 3PANA 2NV1A 3GS6A 4NF7A 1R7OA 2SFPA 1IR2A 3T2OA 3F5JA 1B4EA 4A22A 1QU4A 4YTUA 4UBPC 4JTSA 2PGRA 1KTCA 4AF0B 2DSZA 1GCYA 2HS6A 1GZGA 2YBVA 2WCAA 3A23A 3DESA 4XAYA 1H1ZA 5HPOA 5KINA 5XINA 4HBKA 1PZ0A 1OT2A 3KX6A 2VD9A 2HSAA 1KW1A 2X05A 4A3HA 3U48A 1H0GA 4O53A 1OC7A 4G5DA 3UXIA 1R2TA 1TVLA 4JXCA 2A3BA 1GTEA 1V6XA 4LH8A 4MJZA 3RO8A 5BOFA 1EPXA 4XZIA 4PMDA 3AICA 1ZCOA 3LDVA 2DZSA 2PF0A 3W75A 4GI9A 4DYJA 4NI8A 3WLSA 2A5HA 4DAIA 1XGEA 2VEKA 1QO5A 3QQ1A 3E3HA 3B8TA 3VOFA 2PFHA 4KGJA 3NZ1A 3KOYA 3M4HA 4NAEA 2ZUVA 1Z3NA 4YMZA 1V0LA 1X96A 1RPXA 4C5ZA 4AISA 1GNXA 2EAWA 3TYBA 4FIRA 1X7FA 2OTDA 1P0EA 3MHGA 4FSAA 4A3RA 2V9DA 4D6IA 4AIEA 1QOXA 1LG1A 1E6NA 2VC7A 1XD1A 3HV9A 1TRDA 1JYXA 3NL3A 3DFNA 2CLMA 3G6MA 1DTUA 2YL9A 2WCSA 4LWWA 3WH7A 3VZZA 2PURA 3FVDA 3BLFA 3C2FA 3W71A 4H19A 3A5FA 4N9EA 3CEPA 3S2MA 5JU6A 2KX9A 4HK5A 5FF3A 1AQHA 4DN1A 2H8XA 4AY8A 3UF9A 4GINA 4S3CA 1DWIM 3HQ1A 1V3MA 1OZQA 2WKLA 2HXUA 3NDYA 1NDYA 1KCXA 4KCUA 2FLIA 3P81A 2FPTA 1E9ZB 2OVLA 3L23A 3W7KA 1VEPA 3WD1A 3JRKA 2PLJA 1JFXA 3EB2A 3UESA 3AS3A 2FZDA 4JPGA 4QLJA 4XV0A 5DCDA 2V5BA 4ZTYA 3DU0A 3W1NA 3CO4A 4EX4A 1T96A 4Y9AA 1M3UA 4DZAA 2MANA 5JQ9A 3GBEA 7REQB 5M03A 3IGXA 3EB3A 4YLWA 4JQ3A 5LIXX 4AHPA 2AKMA 2XZ7A 3OQ8A 3B40A 4GFSA 2WOQA 1UKQA 4HIBA 3OYZA 3IJQA 3U2ZA 4TX6A 1NH6A 3GKAA 1V0MA 3RMJA 2J24A 3W29A 7XIMA 4O4WA 2BWGA 1O12A 3FDGA 5KITA 4O50A 4P5UA 1KBBA 4YYFA 4RE3A 1OC6A 3FYOA 1Q6CA 4MZYA 2GDQA 4GZJA 3ORWA 2PMQA 1ZBWA 5CBBA 3OHIA 2ZA1A 4GKLA 3A4WA 4WOZA 1N8FA 3D46A 1OX4A 3L9CA 5D05A 4RDVA 3P82A 4NJKA 4UTWA 2RDXA 2DGAA 2XM1A 4B5UA 1I2OA 4PUMA 2VGBA 4XTDA 4IQLA 4LUSA 4GVHA 3R12A 1JZ3A 1FOBA 1LL4A 2GK1B 1JPDX 4HNNA 4AEOA 4A8NA 1WDQA 5C0QA 1QI0A 3WFAA 1K9TA 1WXZA 4O57A 4XB3A 5DF0A 1UBSA 1RCXB 3ZIZA 1DORA 1IEVA 2AL1A 4E2DA 1UG6A 3RGTA 2E7FA 1KRBC 4UTIA 4GKTA 4IIDA 3M6DA 3PZGA 3VZXA 1NOFA 1FWCC 1PIGA 2PWVA 3GG8A 3W1MA 4Q4MA 1FDJA 3ANYA 3PS7A 4AEEA 2WJDA 4PCSA 1HL2A 3GQYA 3GYCA 4M80A 3WK3A 3EDEA 4S3EA 3CT7A 5CPNA 3UR5A 3VXGA 3WUGA 2PPGA 1LL6A 1P4CA 5JBFA 1AD1A 4P7LA 3N29A 2Y85A 2OEKA 1KD0A 4Z08A 5CBJA 3APYA 3DDMA 1R3YA 3LN3A 4IT1A 4ZE5A 1GJPA 2GQ3A 4UOQA 3EWDA 3EWCA 2PDMA 1J0KA 1DHPA 4CU7A 1XKJA 3GVVA 3C2VA 2XTKA 3LPFA 4W9TA 1Q66A 3W6LA 4E4UA 4IIEA 1BD0A 3H21A 4UTLA 3MP4A 3POHA 3HPFA 1J5SA 1XLFA 2E0PA 3PWAA 4ZQMA 1EFZA 1NDVA 1TPB1 4YL2A 1QUMA 3G1DA 2P53A 1Y5WA 1QFEA 3PPHA 1Q6RA 1B90A 3PB0A 3W23A 2DEPA 3ARUA 1A5NC 4W8LA 3T8QA 1UJPA 1QNOA 2QYGA 4PUJA 5HUOA 1ZB5A 2VO5A 4FR1A 4CD6A 4C7FA 1UWQA 4ZL1A 6REQB 1GOKA 2FMOA 3GIPA 1LYXA 1QATA 1BTCA 1VR6A 4O1FA 4H9MA 4PC8A 4F9DA 1BXNA 1XGZA 1NOUA 1SSDA 4MOZA 4XAZA 4AZCA 1KWGA 3H8AA 2Q8ZA 3BLDA 5JUVA 3STFA 1EOMA 1SJCA 3SEPA 3TYDA 1F3EA 3EDFA 2VNCA 1CW2A 3EOSA 1VJZA 3MI2A 2VWTA 5A8OA 4DVOA 1OG0A 4U3AA 5K4XA 3KRUA 2O9RA 2QDHA 3HF3A 5ABGA 4MVAA 1TQJA 1EWDA 3S2JA 4L5ZA 4AZGA 2DIEA 2DZXA 2OJPA 4GQRA 4HJFA 1HJQA 3E96A 2QJHA 3PUOA 1WDPA 1OCJA 3IIXA 5GJPA 3ZVHB 4U3CA 2NQ5A 1E73M 1S5TA 3S6DA 4X63A 3PULA 1RH9A 3P0WA 3ITVA 1E4NA 1XISA 5D09A 2OMAA 4I9TA 3UD6A 3AXXA 3M0LA 3N4EA 2C0HA 1FWNA 2DQWA 1M65A 2CLOA 2WO5A 4CNTA 3S2LA 3OIHA 3QJAA 4DM2A 4AMAA 1RCOB 1RQBA 4QS5A 3NYDA 1P6WA 3R8RA 4AC1X 5IDZA 3FYYA 2VOMA 2ISVA 3E0FA 3NEHA 3S1VA 4BCEA 4XWUA 3QHMA 3U8GA 1CXFA 1UH3A 1K70A 1GGOA 3D47A 1JZ5A 2WC3A 4DJDC 2Z1VA 4IISA 4IGMA 4OFCA 3S5YA 3AISA 4UQEA 3UNDA 3FKKA 2OZ8A 1CYGA 4S3GA 1B0IA 4ZO9A 1S38A 3TR9A 2VM8A 1H09A 3DKLA 1JL8A 1K4HA 5CZ0A 2W27A 6ENLA 3R94A 5U4NA 2FDMA 1UWSA 3I6EA 3C52A 4HCHA 4Z1AA 3WLQA 4I3GA 2XH4A 2ZQ0A 4DXXA 2DVXA 1CCWB 3LRLA 1M68A 1HF6A 4I5RA 4EACA 4QISA 3ES8A 5HQMA 5FEZA 1JRCA 3QKZA 1KXTA 1BF6A 2J7FA 1ADDA 1R46A 2OX1A 3BLIA 1FWRA 3GHUA 3QQ0A 4H6QA 3PTKA 4DF2A 1TWDA 4ORIA 4BKNA 1QW9A 4W93A 2DDXA 3GR8A 3CAQA 3ZYZA 3B04A 4BHYA 1HKMA 5T26A 3SUTA 4UTKA 1G5AA 1UIPA 4POCA 4S3BA 2PTZA 3MQTA 5DMMA 3BUVA 2P8BA 3H2FA 3GNOA 4XX6A 2AAMA 2VR4A 2JKAA 1BTMA 3H12A 3BOFA 1V02A 1OM0A 4J35A 2NV9A 1CB2A 3S1GA 1LQ2A 3W7OA 4YTRA 2AKZA 1W9UA 4B5NA 4GI6A 1VYSX 1FCVA 3BMVA 3L2LA 3WKZA 4FEZA 3OB8A 1RHCA 3VIFA 4DO7A 3QM3A 5FJRA 4DJFD 1O60A 4LUJA 3P74A 4EKJA 2ZX8A 4W4QA 3VD9A 4NL1A 2B7QA 2DIKA 3V18A 2IKGA 5REQA 1TREA 1QHZA 5BRQA 1TJ2A 3HMJG 4GOAA 3LA4A 4A2RA 1O95A 3F1QA 1FY6A 3SM0A 3O06A 3STEA 2ZIDA 2VFIA 2I1OA 1VBHA 4JQAA 2XH7A 2BY3A 4I5UA 1EXBA 2ZZ3A 3SECA 4J3WA 3KL5A 1DWJM 4Z0SA 3WJXA 3UCCA 4JIIX 2OKOA 3GG0A 3QZ6A 5FD0A 2EKCA 3RR1A 3W2JA 2DW7A 2WNNA 3ZLFA 3VKBA 1F4AA 4OBTA 2JBMA 3OLIA 4O16A 4RPPA 5HBFA 2Y61A 2IQ0A 2J8FA 4K8GA 5FJTA 1NF0A 1UD4A 4HGXA 5AYZA 3BW3A 4ZO7A 1UQYA 5CPMA 3S4TA 3UW6A 1W3TA 1VJIA 2BY0A 1HFBA 2X16A 2RFGA 4FLQA 3CGTA 1PZ3A 3T40A 3O3RA 3SCVA 5CCZA 3CIWA 2A7PA 1PYFA 3WNLA 2WMIB 3ZT6A 3USBA 3ZFHA 1RUSA 4GNKB 4QEEA 2G4FA 5AKQA 4LC8A 4HNVA 3AMLA 1OFBA 3DHPA 4JIHA 2W67A 1NFGA 1KCZA 4PBFA 2CPUA 1DBTA 4M8UA 3ZT5A 2WMJA 4M24A 2C91A 3GVRA 4MWAE 3WLPA 5CBIA 1XH1A 2XH0A 4FP1A 5CPSA 2R82A 1S3HA 1RJPA 4TVUA 1H2JA 1QI5A 3A3WA 2OQYA 2E5DA 5GPRA 3VC6A 4FNRA 2CLHA 5TD4A 4RKAA 4XKMA 1JUBA 2D0HA 2Z27A 4MB1A 5FEPA 5HMDA 2J8GA 2V81A 4DWSD 3WUBA 1SO5A 5I3JA 1O5QA 1J10A 1VCGA 1X1ZA 1VEOA 1LWHA 1XSKA 3HGOA 5GQBA 3C2RA 3VGGA 4XK2A 3TSDA 1E1CB 3BARA 3BSHA 3B3DA 1W9PA 4ICCX 1XUUA 4G6CA 3PFMA 3PK7A 2GGHA 1OFQA 1NY1A 1QPKA 3G5EA 3TCEA 5RUBA 3MDWA 1P1XA 5M1TA 2KAUC 2QDDA 3KM8A 3LUTA 4JFSA 1TWWA 2E9LA 3NIYA 3WX7A 2G3JA 4GRSA 2Z28A 2IUZA 3ZQ9A 3UEQA 5FF7A 3BH4A 3P62A 3VOIA 4IIGA 1D8WA 4ADUA 4M6VA 4L7ZA 1TV5A 3KOFA 4AAJA 1ICSA 4RE2A 1E5JA 4JIPA 3VIIA 4AY7A 1BQCA 1O1ZA 3NZGA 4V33A 4HHMA 1T8XA 4G7EB 4L6OA 3RK8A 1E43A 5AHMA 1BYAA 1J12A 3AIVA 1OCNA 3G1RA 3QPZA 2POZA 4GY1A 4ORMA 4NILA 1EJRC 1OCBA 3PR2A 5G2WA 3KVMA 1E0TA 1DE5A 1EUNA 2RDTA 1MWOA 3CL7A 4JTTA 5M2FX 1GWJA 2I7GA 4HOWA 4GLEA 2HTMA 3QGAC 4CQDA 4LTSA 2ZRZA 3EPNA 3KS6A 3CQKA 3SUSA 4DLMA 5JVLA 4BK9A 3IWPA 3TW7A 1BKHA 1ENUA 3MP5A 4N4PA 1YBQB 1OB0A 3RX3A 2ZUMA 4K37A 3KLKA 1YDYA 3R11A 1XYLA 2C13A 3MVTA 3TEVA 2EPLX 3FFSA 1DPMA 4LS2A 4ERIA 2WB5A 3GIQA 3BPWA 2NWRA 3ABSA 4OV9A 2OEJA 2FMNA 3ZO9A 5H2ZA 3VNYA 2VEIA 5HUPA 3O6YX 3U3HA 1WBJA 1S2VA 2PWUA 1BYDA 3WK0A 3WD3A 1J96A 3TOPA 1V6T