5DBTA

Crystal structure of c-terminal truncated 2-deoxyribose-5-phosphate aldolase (1-201) from streptococcus suis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
201
structure length
201
Chain Sequence
MKLNKYIDHTILKPETTQEQVEKILAEAKEYDFASVCVNPTWVALAAESLKDSDVKVCTVIGFPLGANTPAVKAFETKDAISNGADEIDMVINIGALKTGNYDLVLEDIKAVVAASGDKLVKVIIEACLLTDDEKVKACQLSQEAGADYVKTSTGFSTGGATVADVALMRKTVGPDMGVKASGGARSYEDAIAFIEAGASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxyribose-phosphate aldolase
publication title Structural insight for substrate tolerance to 2-deoxyribose-5-phosphate aldolase from the pathogen Streptococcus suis
pubmed doi rcsb
source organism Streptococcus suis gz1
molecule tags Lyase
total genus 71
structure length 201
sequence length 201
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2015-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5dbtA00
1SO6A 1TO3A 2ISWA 1VYPX 2A21A 5HJLA 2WNZA 2WSRA 2H3BA 2RH9A 1UJPA 1G4SA 1LROA 4MLJA 1JUKA 4BI7A 1S5VA 3NL6A 5K9DA 3F4WA 1R2TA 4NJGA 3BG9A 1FWNA 4BF9A 3N9SA 3E0IA 4LNYA 1W5PA 3IIXA 3FS2A 1TSIA 1H61A 2C18A 3TAOA 1H7RA 3M5VA 5CZTA 2WO5A 2JK2A 3EX2A 3UQNA 4POCA 1ZNNA 3LHUA 3B05A 1YTEA 2DZXA 4BWLC 4GNJA 4WX2A 5G1YA 1OJXA 3GIYA 1ICPA 1PHQA 3GXPA 3G0SA 3UY8A 4FX6M 3INPA 1FDZA 1XBXA 4MIMA 4JTUA 1KLZA 3C2RA 2OT1A 1GQNA 2H6RA 3W71A 1MXSA 3MP5A 3NPXA 1GTEA 4LV9A 3DKJA 5E93A 3C3NA 3NYZA 3QZEA 2DU2A 4YMZA 3A22A 3UNDA 1U5JA 2Y6ZA 1IF2A 1V5XA 2DZTA 2Q3OA 4ADTA 1W5NA 3Q2DA 1H51A 5LGXA 2BX7A 5L9FA 2NUYA 3B04A 4Z0JA 3DH7A 3N3MA 4AWUA 3B8DA 1QOPA 4CCDA 3NQ2A 2VFFA 2X16A 4IQLA 4XKYA 1UCWA 1NFBA 1PCKA 3NL5A 2P1FA 4Q32A 5FEZA 3TMLA 4Z1BA 1O5KA 3QMRA 4ZQPA 5DY2A 3I68A 4KFOA 2Y7EA 5CKSA 4LVAA 1OFOA 3UWZA 3P62A 3BK0A 3W88A 1KM4A 5H2ZA 4JX5A 1TTJA 2QUTA 5AC8A 2XN0A 4UTWA 2J9ZA 2GQ9A 1TRDA 3A23A 4N4QA 4JTGA 4UTHA 1QPNA 5BRBA 5AC7A 1T99A 2YFOA 3V75A 1QO5A 3WK1A 4O19A 3A9IA 3M41A 6ALDA 3W1RA 1RQHA 4LV4A 1VCVA 2R94A 1ADOA 3BW4A 1QDSA 3I65A 3QC3A 1DOSA 2NX9A 3EX3A 4N02A 4O53A 4FB7A 2B7PA 1HO4A 4K7VA 2J9XA 3WJSA 2I9EA 2A4AA 3LRLA 3NVTA 1TPH1 3TK7A 1WQ5A 1Z48A 3HIJA 2C15A 2Q3RA 3S5YA 2DZUA 3G3MA 3YPIA 4GFSA 4MFDA 1LORA 1SFLA 1I8JA 3EEGA 4RX0A 2G97A 2JKPA 5D33A 3L67A 1X1OA 1OFPA 4O16A 3A24A 3IEBA 1VLWA 2VELA 3OVPA 2C6QA 1TTIA 2J27A 1TPEA 3THQA 4FXSA 1XCFA 2A7NA 3QM3A 4UTIA 3F1QA 5AN7A 3A5VA 1TV8A 3NQGA 4M5PA 3C2VA 2W6RA 3EKZA 1FCQA 3NQDA 4JGDA 2CLIA 4FHAA 4CLMA 3LBCA 3BVJA 3NG3A 2Y70A 3TQKA 4IX2A 1J4EA 1SO4A 3C8FA 4HNNA 1N8FA 4WJEA 3P60A 3LHZA 1AK5A 5FF7A 3W2UA 3W75A 3N73A 4MYXA 4O52A 1HTIA 2FB3A 1FCBA 1EWDA 4NZFA 3U8GA 5K4ZA 3W7QA 1ME9A 1FWWA 3L5MA 1TTQA 3LV5A 4PCFA 1QCWA 1PHWA 3SJ3A 3UZJA 4JTSA 4PL2A 1JCMP 1PS9A 1LRTA 3DFPA 4GRSA 1RZMA 1OX4B 4FNSA 5G4EA 2VFHA 3TXZA 1BKSA 1QAPA 3W1MA 1T0OA 4HSNA 3GDLA 3GAKA 2YFNA 3M43A 3P67A 4JDBA 3TUUA 1JJKA 4QNEA 4ZVJA 3HG4A 3P81A 4AEOA 2EGZA 1JVNA 3C0JA 2X1TA 3AO0A 3W70A 4NVTA 4GUGA 4BI6A 2Y62A 3DFSA 4IJBA 1Q6RA 1F2JA 2QF7A 3NOEA 2GPTA 5HULA 4OV9A 3MYPA 1SFJA 1Q6QA 1GPWA 5KZEA 3ANYA 2QCDA 4JICA 1EX5A 5C2XA 1OG0A 3UWUA 1IGSA 2C14A 1F76A 2A2IA 4CNPA 1GJPA 1ZAIA 2NWRA 1EP2A 4UNKA 1OFBA 1G7VA 3W1AA 1L6SA 1SW3A 4FF7A 3W1XA 4O18A 5A5WA 1AW2A 3GXNA 1W56A 1IIHA 2J24A 2TYSA 1GZGA 3OIXA 4Y96A 4LOCA 3W1PA 4L4MA 5LNUA 2ISVA 5I3FA 1JCJA 3CTLA 5K4XA 4O12A 1FWRA 1X6UA 4QITA 3N34A 1O4UA 3RU6A 3ABQA 3JS3A 4XTIA 3E02A 1H1YA 4NJJA 3GB6A 2BZNA 4Z08A 3P8IA 1F5ZA 1WAUA 1T8XA 4NJKA 3W7MA 2D73A 1ZFJA 1X8FA 3PG8A 5I3IA 2YYTA 3HPZA 5G2HA 3C52A 4OBTA 3S8HA 2E6AA 3JRKA 3WFAA 4LC6A 1RQEA 2R8WA 3HPXA 4JEQA 4JTHA 4LVGA 3O6YX 2DORA 3TA6A 2A6NA 4UC5A 5EMUA 4UXDA 1WXJA 1TIMA 5LNRA 1QWGA 2ATMA 3R8RA 1XBYA 4M6PA 5TQLA 3NO5A 1OVDA 1ZJIA 3EXRA 4N2YA 4NUWA 3T44A 3DI0A 1KW1A 4WOZA 2X30A 3BGJA 4UMAA 3KX6A 4RXFA 3G1AA 3TDFA 4J9JA 2FB2A 4KWVA 1JRBA 1VYSX 4GUJA 5KITA 3KVJA 5AYYA 4YWIA 3JR2A 4AWTA 1T96A 3CB8A 4K36A 1LOQA 5HINA 3S5NA 4IMFA 2C19A 4WY0A 3DFQA 3DBPA 5D04C 2DZSA 1TJPA 4QISA 4UFJA 2XFWA 4IMCA 1VRDA 2ZTKA 4CQ8A 4K8EA 2VEIA 3BLIA 2QAPA 4S2BA 1KLYA 3FA5A 3LB0A 1GVRA 3W83A 1M5WA 4O11A 1PE1A 3LBMA 5T26A 2WNNA 4RR4A 1HO1A 4CQAA 4RKAA 1DBTA 3T40A 1KTBA 4CCCA 4IOTA 3QH2A 4KKXA 1Z42A 2GUUA 3QSRA 1EPXA 1NSJA 5K9CA 3PC0A 5IBXC 5D02A 2QUUA 3LXBA 1KFCA 3MUXA 4TO8A 2VKZG 2CU0A 3HB9A 4N9DA 5CZ0A 2ZZ3A 1ME8A 3LCXA 1F05A 4MVAA 1K7EA 3ATZA 2GQAA 1QPRA 5KTLA 4NNCA 3W1TA 2HSAA 3E12A 5MHBA 2QCGA 2KZHA 3TXVA 1O5XA 2VFDA 4RJEA 3FIGA 2CW6A 3MYOA 1RV8A 4UFMA 3B0PA 3EX4A 5TIMA 2Z2UA 4IMGA 1NVMA 1EWEA 4JTIA 1H7OA 5D03A 3Q94A 3G8RA 3MI2A 5IM51 3W7PA 3NQ8A 3WJZA 5DLCA 1K03A 4QAIA 1FXPA 5FESA 4UR7A 2Y7GA 1LP6A 1MEWA 1Q6LA 5BMXA 2QCNA 1NF0A 4R53A 3UWQA 3HOJA 1G69A 2DZPA 3W3OA 5DBUA 4CQ9A 3ATYA 3ZWTA 3BV4A 3P80A 1G67A 4K38A 3UXAA 3PM6A 2C16A 3PWAA 3IVSA 3W72A 2Y85A 4HNTA 1HUVA 1D3HA 3GNNA 1MO0A 4DPQA 5U7SA 5HR7A 3R89A 2H8XA 4RZ4A 1XUZA 4N4PA 4ZMGA 1B9BA 3W7HA 5AHMA 4OGZA 3VNDA 3G8EA 4YCPA 2Y89A 3QYQA 4X9SA 3T78A 2TSYA 3U2OA 3H54A 3S1XA 3PUOA 4O1BA 3GR7A 1SW7A 2A6LA 2V30A 4PEKA 4FO4A 1KM3A 1SZEA 4GUIA 3STCA 2R14A 3PBWA 4MFEA 1GYLA 1V7YA 2V2CA 3B06A 1FX6A 1W5QA 4O4WA 3M0ZA 3LHYA 3PUDA 3HGSA 1IXPA 3DU0A 3I7SA 1PV8A 2DZVA 4R33A 3NQAA 1SW0A 4MUZA 1J5TA 5AB3A 4Z1DA 1FBAA 4KFNA 3GDRA 1XI3A 4X22A 3OA3A 4PTNA 3EXSA 4FNRA 1GG1A 5FEWA 3O07A 4GE8A 3S9YA 4FNQA 6TIMA 1K7FA 5EKYA 1SO3A 4M7SA 3EWZA 4DBEA 1L2UA 5DXYA 5E0KA 3CEPA 3STGA 1Q6OA 1VCFA 3W1QA 3DHFA 2RDWA 2ZYFA 3N2MA 3G1DA 4NU7A 3T55A 1XBZA 3FKRA 3CU2A 4QIUA 4PODA 3P8JA 4LWWA 2QCLA 4G1KA 1FUYA 3DHDA 4HIBA 2G95A 2ZZ5A 3QQ0A 5CZSA 4NQ1A 3C4UA 1RPXA 3G0UA 3M16A 2ZDRA 3P5ZA 4MLRA 3SGZA 5DELA 1ICQA 3O6CA 4OT7A 2FFCA 5FEPA 1VS1A 4MZ1A 3MW7A 1NF7A 4N6EA 4ADSA 5EL1A 1OX5A 1K8ZA 1ML1A 1WYIA 1RQBA 3P5YA 1KFLA 2EAWA 3LLDA 2RDTA 1FCVA 1K02A 1LLWA 2QCFA 4Q33A 4NJIA 5C5YA 1YADA 2A7PA 5U4NA 3AJXA 1CX9A 5F4WA 4UFIA 1D9EA 1XKYA 1B3OA 2RHGA 3N2XA 2JKEA 1D3GA 1TPFA 5CZJA 3RMJA 2BLEA 5J5RA 2TRSA 1AL8A 3HGOA 3PSWA 4ZL1A 4OWGA 2E09A 3S5ZA 1GT8A 4IGHA 2EPHA 1WOAA 4RCXA 4ONVA 4HNUA 1JUEA 1SQ7A 1TV7A 4WXYA 2FDSA 5D38A 4TIMA 1W54A 1X7FA 2ATSA 4HN4A 5F4SA 1I4NA 4AF0A 5E1QA 3THAA 3IIPA 3A5FA 1YDNA 3OVRA 3P82A 4HNVA 4OU1A 2Z6IA 4AXKA 3QEZA 5AC6A 3FOKA 2Q8LA 4ZQRA 5I3KA 2I1OA 2CLEA 4UTWC 3LGEA 5HWJA 3C56A 5KZDA 5DN1A 2DJLA 4RV8A 4DO6A 1UB3A 2P10A 3W86A 2PCQA 3UD6A 3IGXA 5DCBA 5GVJA 3WJYA 2A0NA 1OFAA 3GAYA 3H55A 1B4EA 3CC1A 2RDUA 3ABRA 3GDTA 3UWVA 4NXSA 2PRMA 4O1CA 4O0KA 4DO5A 1H7NA 3PVFA 3KVMA 1ME7A 2WJZA 1ALDA 2G5WA 3MBFA 3C2FA 3EWBX 2Y63A 5LKYA 4OV4A 5FI8A 3LI0A 5EY5A 3CLMA 3NQ6A 1AW5A 2DP3A 4M7TA 2A1YA 1THFD 1VGAA 4JTJA 3TE9A 3B0VC 4S1FA 4FIRA 2NLIA 5FF4A 4ICNA 3LHTA 1MZHA 3GK0A 1H63A 2FPTA 4UCGA 1KTCA 2V8ZA 2ZRYA 1CW2A 4UMCA 3PB0A 3TW7A 3EXTA 1C29A 1DVJA 1RR2A 1W3NA 1GVOA 2CLMA 3NGJA 1TRIA 4ORIA 4PC8A 4IWWA 5AHEA 4I9AA 3CHVA 4A3UA 3L68A 3DFNA 4UTTC 4N9EA 4FNPA 2OX1A 3LXCA 1SSDA 2NX3A 4JNMA 1I2QA 4OHQA 2FTPA 3QJAA 3PSVA 1GWJA 1JQVA 1EUNA 2CZ5A 2V5LA 3TROA 1W1ZA 1H7PA 4AB4A 5HQEA 2YPIA 3MHFA 3TFXA 3O06A 3QSTA 4PL1A 3IIOA 4LUJA 4A29A 1AG1O 3G1HA 3NXFA 3G22A 3N19B 3R2GA 4Z1AA 3LI1A 4O54A 3LLFA 4O13A 1H60A 2IQTA 2VEPA 4JTKA 3VI2A 2AGKA 5FF2A 1L6YA 1LOSA 1DQWA 1S5TA 2PURA 1YLVA 1LM1A 3O63A 5C55A 3R5EA 4BFAA 5AYZA 3ZS4A 4X2RA 5H91A 1TPC1 3W7RA 3NM3A 5EBUA 3QPYA 2W0UA 2OCZA 4XZ9A 2B7OA 4UFKA 4A21A 2ZRXA 5C54A 4YLWA 3NDOA 2ABAA 3DENA 1A5AA 4BR1A 3NM1A 3R13A 4JR5A 1QFEA 2BXVA 1VCGA 3L9CA 3OBKA 3SW6A 4XQ6A 2CLOA 4LUIA 4QJ1A 3P7YA 4WXZA 3LTSA 3K30A 4Y8FA 2YW4A 1JRCA 4A22A 2QCHA 3NQCA 3IRDA 1DQXA 3SY5A 4I7WA 4UTMA 2ZQ0A 2CLKA 4QSHA 3O6DA 3R12A 3DKLA 2WOQA 5BOOA 2CZFA 4LY8A 2QJIA 3BARA 2Y88A 1JULA 3VE9A 4JTLA 1KFJA 3M6YA 4I7VA 4MJMA 1SSGA 1MEHA 2C3ZA 3S1VA 3L5LA 1BWKA 4LVBA 3TSBA 4AHQA 1K8XA 2ABBA 3STEA 1F7BA 1TQJA 4XKYB 1M6JA 3KRUA 1FDJA 3ELFA 5FF0A 5F2GA 4N9BA 4XWUA 4JYEA 3BLEA 3SFKA 4NNAA 4U28A 3I7QA 2ISSA 2QR6A 3EWXA 3G24A 4JIQA 3TV8A 1K8YA 5A8GA 4IPJA 3N9RA 4MZYA 1LZOA 1JR1A 1ZAHA 1W5OA 4XUGA 5DCEA 1SPQA 1TTPA 4UIOA 4JTEA 4KWWA 5ABTA 4FX7A 3TJLA 3KOFA 2NV2A 2CLLA 5G1TA 3W7KA 1YXCA 2NXIA 2FLIA 3FFSA 1FWTA 3WK3A 5FEXA 3UZ5A 4S2CA 4NZJA 2RKXA 5D2WA 2YX0A 3QPZA 3USBA 5D2YA 4HPJA 2E77A 3NNTA 4DXVA 3PB2A 3HF3A 1E51A 1GVQA 3GYEA 2EKCA 2E6YA 1ZENA 1DJQA 1ZALA 3BGGA 1C9DA 1J2WA 1A5SA 1DL3A 2WPBA 4JD4A 4EOUA 4AWSA 3BW2A 5F2IA 2ZA2A 1IXOA 7TIMA 5F4XA 2ZA1A 5D30A 2BSLA 2OT0A 2H90A 2FPYA 4MZ8A 1UUOA 4MKNA 4O8RA 1PIIA 4IPIA 5DBTA 1LLZA 4MJZA 1W0MA 2YZRA 3HG5A 4EF8A 3IGUA 2ZA3A 1VC4A 1DHPA 2ZZ4A 4DF1A 2CLHA 2OJPA 4LS1A 5CG7A 4FIQA 3HJZA 4JY8A 1YYAA 3W7CA 5LSMA 1TJRA 1TPDA 1VYRA 3CWOX 4E2DA 4FNTA 1ICSA 4Y9AA 1FQ0A 3ABSA 2OZ0A 4QNWA 4H3DA 3PUEA 2G96A 3CM4A 4AHOA 4AAJA 3LCWA 5DXXA 5D05A 5AHNA 2NZLA 5KMYA 2JKAA 1MSSA 3RK8A 3W7LA 3QMSA 4WUIA 3L0GA 4ORMA 4O1DA 5D2VA 1GG0A 2QCMA 3W22A 5C6MA 3QF0A 1OYBA 1N7KA 1TYGA 3GR8A 4FXRA 3P84A 2VENA 3G1VA 4C1KA 2PRHA 1VQTA 3T7VA 4O50A 2QDGA 3UYCA 1TPVA 3TW6A 4LS2A 1DKWA 1SO5A 2E5CA 4N6FA 3EX1A 1SUXA 1WA3A 2X1RA 3NZRA 2Y7FA 4NX5A 3LCIA 4ZQOA 1EB3A 2HMCA 3GZ3A 3LOTA 4NX0A 4UFLA 2QJHA 1EIXA 2ZFAA 2ZRUA 3S5OA 1GOXA 5HR6A 1MEIA 1VJIA 4H4IA 5EA9A 2WSYA 1JCXA 5DCDA 2VXNA 1R47A 2ZZ7A 1LRQA 4NJHA 3G1XA 4RZ6A 1R2SA 2Y61A 2YCEA 3L65A 1LBLA 3TC6A 5G5IA 5LNWA 2ZCGA 2ZZ6A 2QCDB 2QAFA 1TPUA 3W2JA 3BG5A 3F4NA 3HGJA 3L0NA 3P61A 2GVGA 5G2IA 1Z44A 3VCRA 3S0CA 3TFCA 4A2SA 1SR9A 3EX6A 3LTPA 3DZ1A 3MHGA 4JY9A 1LRNA 4O1AA 4LRTA 4MYAA 1I2PA 1OK4A 2E5DA 2GJLA 1FWSA 3FKKA 2V0TA 1LTDA 1FCUA 4ML9A 3E96A 4LC8A 3Q37A 3SI9A 2VFEA 1W37A 5AHIA 3W6YA 1QOQA 3CWNA 4O14A 5G2WA 4GXMA 4EF9A 5K3VA 3CQ0A 4L4LA 2EF9A 3WJXA 4DPPA 4UTUA 1TCDA 4PH6A 4KFPA 1TREA 1O60A 4IMEA 1EUAA 3BO9A 3I6RA 1S5WA 3OEXA 4NNBA 1GEQA 1WOBA 3IVTA 3S1WA 5J5DA 3W7JA 2JGQA 1EEPA 1XDMA 4GBUA 3RF9A 3MHUA 3O15A 1F74A 3IIZA 4MY9A 5KSWA 3ZFHA 3HBLA 3KAOA 4OE7A 3D0CA 4O10A 1TPB1 3LM7A 1Y0EA 1QPQA 3F03K 3LCHA 1OX4A 3M7WA 3S1UA 5HNRA 2O7SA 3HO8A 2GQ8A 1WBHA 4CNNA 3W76A 5LHFA 1NEYA 2YGYA 5I3GA 1XM3A 1OYAA 2OMAA 5AFDA 3LCLA 5CPOA 4UTKA 2JBMA 1UASA 3TC7A 4WY0B 5LHEA 1BWLA 2NWSA 1KM6A 2HTMA 2YYUA 1OFQA 2VOMA 3SR7A 4AH7A 5K2ZA 4BK9A 3UWWA 4JX4A 4QQ3A 4O17A 2UV8G 3G18A 1R30A 1W8SA 4NT0A 4BWLA 1F73A 3Q58A 1AMKA 4OQVA 2C1HA 2V5BA 5F1VA 1BTMA 2GVLA 3W7DA 3VKJA 3I7RA 3O05A 1KM1A 4FEZA 1OHLA 3W7IA 1KBIA 3KFTA 1CI1A 2AQWA 1B57A 3IVUA 4W9TA 4Z0SA 5D32A 4M6QA 2B0MA 5F2MA 1P4CA 3LRKA 3W7OA 3NQVA 3L2IA 2DZWA 1G4PA 4WZHA 3IGSA 3NL2A 4DO4A 4NXKA 2Y7DA 4IX0A 4B5NA 3PULA 3PBVA 1PVNA 3M44A 4K39A 2YDAA 4JN6A 3C2OA 2YW3A 8TIMA 1XUUA 4YL2A 4O28A 1LDCA 2B7NA 4DBDA 4HPXA 3PAJA 1LBFA 1YPFA 3IIVA 3VE7A 1VZWA 4DF0A 2P0OA 4DF2A 3B0UX 1ZCOA 4Q4KA 2DJXA 3SZ8A 2NXHA 4LRSA 1TB3A 3UPBA 4M6VA 2XN2A 3B03A 1F6KA 4D2JA 5AHFA 2C13A 5CSRA 2VC6A 3W73A 2TMDA 3ZR4A 5KZMA 1H50A 1TV5A 3L66A 1KFKA 3CIXA 4AVFA 3L21A 2NX1A 1IIGA 1IXQA 3QW3A 2B7QA 2NUXA 4IMDA 1OFRA 4K37A 4ZQNA 5HWNA 1C8VA 4O4VA 2FPVA 2VEMA 4FX8A 4BI5A 1QPOA 4XTDA 1G6CA 3LV6A 1G7UA 2EHHA 3O1NA 3W23A 5LNVA 5F1UA 3C6CA 3OG3A 4LS0A 3NQFA 3FLUA 3LXAA 1SU5A 2ZZ1A 3TR2A 4Z1CA 3QW4B 2O7QA 3BPWA 3L0KA 4GWEA 5F2LA 3B4UA 3G1SA 3FYPA 1ZY9A 3TKFA 5HMSA 3M9YA 1HFBA 3SIZA 4RXGA 2WV8A 1EP3A 3LCGA 4Y90A 1JCNA 1QMLA 2HS6A 4A2RA 2E6DA 4AMAA 1G4TA 3TNOA 2CFFA 4UTTA 3RFAA 1P5BA 3NQ7A 1K7XA 3TSMA 3UWYA 1S3HA 3PBYA 2Z1BA 1W5MA 1QO2A 3TX9A 3DFTA 3A21A 2QKFA 5CPLA 2PC4A 2GVJA 3ABOA 3H53A 3PF3A 1PCWA 1OX6A 2J9YA 1KBJA 3V1PA 1A5BA 1P0KA 4P61A 4JTTA 1H5YA 2VEKA 2ZBTA 3LRMA 2Q8ZA 2CZEA 1FXQA 1U83A 4O15A 2B4GA 4GJ1A 1WX0A 1KM2A 4R34A 2E68A 1TMHA 4CNOA 1OFDA 2QCEA 1W31A 3MO7A 3T4CA 3PG9A 1TQXA 5D37A 1QR7A 1KM5A 3TMQA 3TCEA 4I7UA 3W2NA 5HWMA 1G4EA 1OF8A 2R91A 5G4WA 2BWGA 4TMBA 4XBSA 1LOLA 4UTJA 5LNSA 4MPQA 4LU0A 2ZTJA 3W85A 3TJXA 1B4KA 1KV8A 1OK6A 2C0AA 4GUHA 4TMCA 2NXGA 5K7JA 4WQ6A 2YSWA 1VH7A 2HS8A 3WJWA 3O8AA 2FJKA 3LCFA 1HL2A 1JCLA 3WK0A 1QNVA 2WNQA 3LX9A 3QRHA 3NAVA 4X3ZA 3HQ1A 2V2HA 4GC4A 3DI1A 4ALDA 1W3IA 4RZ5A 3FJLA 4CCEA 3W9ZA 2FIQA 2WQPA 5D09A 1H62A 3M1ZA 2JGYA 4UNLA 4ADUA 3W84A 4JX6A 3W1UA 1XDLA 1JCYA 3TIMA 3FJ6A 3MI6A 3CEUA 2V81A 1XC4A 3EB2A 2GOUA 2PE4A 4LW7A 4E2BA 3FEMA 4EVZA 1UUMA 2X1SA 1YPIA 5KINA 1FY6A 4JDYA 3E9AA 3W7NA 3M5YA 3GX9A 1P1XA 4AF0B 4MOZA 1JQXA 5HUPA 5L6UA 1DJNA 1L6WA 2CWNA 4AHPA 1H7XA 2QEZA 1KM0A 4GUFA 1KA9F 4RLIA 3W07A 3HG2A 3NPWA 4JYFA 1GVFA 2J88A 2F7FA 4XBKA 2VFGA 3UY7A 1VR6A 5DY3A 3W2MA 4TX9A 3SGUA 4R7JA 3M5XA 5CPMA 2PRLA 4UUIA 2X1UA 2E5BA 1OFEA 4HKPA 3U6WA 4U4MA 4ZQCA 1ZHAA 3BW3A 3MWAA 4EWND 3IV3A 3G3DA 5CPNA 5TBOA 3M5ZA 3M47A 3LTYA 3QQ1A 5AYXA 3TH6A 3UPWA 4HT3A 3W2LA 1WDWA 2Z6JA 2TPSA 3QMTA 3HGRA 4MY1A 1YTDA 1I2OA 2NV1A 1TPWA 2ALDA 3PBUA 4TU1A 1UBSA 1H1ZA 1N55A 3KHJA 3C61A 3GLCA 5AOUA 2WSQA 5HUOA 2E6FA 3P74A 1RD5A 2CZDA 2ZRWA 1WV2A 1F6PA 1VPXA 1OYCA 2VFIA 3TSDA 5SWUA 3BLFA 1ONRA 1X1ZA 1XL9A 1YXYA 4RK8A 2QDHA 4H6KA 3UXDA 2H8ZA 2X2GA 3NZ1A 5BNKA 1XFBA 3DAQA 1GYNA 2YXGA 2F84A 3STFA 1YDVA 2ZRZA 1SZNA 1Q45A 2GJNA 2QJGA 1OABA 1SZGA 3G1YA 4IXHA 2AAMA 1PL9A 2WKJA 4DEFA 3SECA 1KV5A 3LHVA 3LERA 4O57A 2ZRVA 2NUWA 5LGZA 1OF6A 3DFOA 3NPVA 4ZQMA 1NAL1 4JYDA 5AHLA 1DV7A 4PA8A 1YTKA 1LYXA 4DQWA 3W1NA 3GDMA 1BEUA 4QM1A 5FF3A 2A7RA 1W3TA 3C2EA 3KRSA 4JS3A 4E38A 1A50A 4LVDA 1O94A 3TQ0A 4JTFA 4HHPA 5IBXA 3PR2A 3VFLA 3WK2A 2H3DA 3EWWA 3GKAA 1IXNA 3LDVA 3TAKA 1SZFA 3L5AA 3MBDA 1R46A 2ZZ2A 1Q3NA 4C1LA 1VHNA 4K6AA 3CIWA 3MJYA 4K7YA 2A5HA 3KRZA 4LT9A 1P0NA 1XXXA 4O0ZA 4UFHA 4UTLA 2CLFA 1XBVA 3OHIA 2J6XA 4N9CA 1H7WA 3GVGA 3HMJG 3W7GA 2FQIA 1DORA 1KTNA 2XN1A 4JIPA 4MY8A 3GXTA 3GDKA 3TU9A 2BTMA 3HPSA 2Z0IA 2YR1A 1EA0A 3RNDA 2I14A 3NA8A 4YXGA 3SSJA 1FDYA 3N14A 4PFMA 3NR0A 3W1LA 4ZZ9A 1A53A 1A5CA 2A85A 1YDOA 3O16A 3QFEA 4UMBA 2V9DA 3EKLA 4HSOA 4WOQA 3G1FA 1ZAJA 1EP1A 1JUBA 4DELA 3RLUA 1RVGA 3W7EA 2W79A 5D2XA 1Z41A 4Y6GA 3PS7A 3RLVA 3KXQA 1R2RA 3MI3A 3NPUA 3GNDA 3KVLA 3PY2A 5I3HA 5BMWA 4YCOA 4P2VA 1VHCA 3NQEA 3LHWA 3DXIA 3MP4A 4K8HA 4WD0A 2V82A 4EIVA 3GKFA 3EWYA 3NL3A 3FYOA 3TQVA 2QCCA 4UR8A 1M7PA 1AW1A 1YXDA 3BG3A 3KVKA 1WBJA 5CGQA 3HG3A 1K3UA 1I2NA 5I3JA 5BW6A 2E1DA 5LZLA 1KFBA 1LCOA 3DGRA 3CT7A 1VLIA 1I2RA 4WY0F 5CSSA 1GVSA 3W87A 3EWUA 5EYWA 2V2DA 5EPDA 4FNUA 4LTSA 1HG3A 1O95A 3E49A 4LVFA 3CPRA 3W2KA 3NEVA 3ZWSA 4IUOA 1KFEA 3MP3A 1I45A 4E0CA 1M7OA 1L9WA 3S42A 4TR9A 5K9XA 3OVQA 1LBMA 1GTHA 3NQMA 3MMTA 2QUVA 2RFGA 3S6DA 3W74A 4JXCA 2LLEA 5D2TA 4IXXA 3G0XA 1AL7A 4M19A
chains in the Genus database with same CATH superfamily
3UF9A 1KGXA 1SO6A 1TO3A 5A6TC 2V5JA 3NZGA 4LF2A 3N04A 3RM8A 4Y9MA 2F2KA 1JPKA 3F4WA 2XTKA 5HQMA 3DC8A 3BG9A 3E0IA 4WR3A 1W5PA 3IIXA 2WW5A 1H61A 2C18A 3GG7A 3EPMA 1JPIA 2WO5A 3EX2A 1UWSA 4POCA 4REQB 5JBDA 3B05A 3VGBA 2WMGA 1E4IA 1OQFA 3GIYA 1K6WA 3G5EA 1J93A 3K46A 4L4PA 1E9LA 3GFYA 3TN4A 3SCOA 1C7SA 1XBXA 4BCEA 3O6AA 3MP5A 3SUWA 4U31A 2ICSA 3DKJA 4IIDA 1JYVA 4YMZA 2VC5A 1Q2SA 1U5JA 2YCJA 1V5XA 2DZTA 3ONCA 1S46A 3WF1A 2ACRA 4ADTA 1NWTA 4CN6A 3Q2DA 1H51A 3AYRA 3WNMA 2BX7A 4NG3A 3B04A 1XINA 1CT5A 4CU8A 3V1HA 3NQ2A 2FGBA 1UJQA 3ES8A 3W0KA 4J2PA 1XLAA 4XKYA 1UCWA 1NFBA 1C8XA 4JIIX 4Q32A 2O55A 1JL8A 3QMRA 5DY2A 3ERPA 3I68A 3QV9A 3ZZ1A 5CKSA 2E8ZA 3UWZA 2WANA 3WFLA 3KP1A 3MZNA 1WKFA 4US6A 4U2YA 4P7NA 2J9ZA 3D3AA 2GQ3A 2GQ9A 3UZXA 3UW6A 3S4TA 3UA3A 1PZ3A 2VGFA 4HTBA 4H7CA 3ZJ6A 4IPLA 3W1RA 4LV4A 1VCVA 2VI0A 1ADOA 3BW4A 2XFRA 3QC3A 2Q71A 2NX9A 3DGBA 1ZBCA 3WNPA 3SUTA 1HT6A 4FB7A 2BHUA 1DJGA 4K7VA 3UZYA 5CBJA 3NVTA 2YCLB 1CGXA 1WQ5A 1CB7B 3RAOA 3U7BA 4EPDC 3S5YA 3G3MA 1PYMA 1I8JA 4JL1A 1ONXA 3S2NA 2G97A 1X1OA 1IGWA 1YDYA 5D9OA 1E0TA 2VELA 4AIEA 1HP4A 1FWHC 4YIWA 1TPEA 2A7NA 2PFHA 4IQJA 1X98A 1XLCA 3F1QA 1W9PA 2PP0A 1TA3A 4M5PA 3TOYA 1FCQA 4JGDA 2PDNA 3NG3A 1A3XA 2Y8KA 1WZLA 1EQCA 5BWAA 5LIYX 4DJDA 4HNNA 3MUAA 3P60A 2WMHA 5FF7A 2BVTA 2KAUC 3SRDA 2PU0A 4MYXA 5IRPA 2GSHA 4DZAA 1HTIA 1QXLA 3CK5A 4RW3A 1EWDA 1N8IA 1XLFA 2CBVA 2X05A 1FWWA 4M81A 3E1F1 3GQYA 4H6QA 4JTSA 4PUWA 2GJXA 3VIHA 1NH6A 5I00A 1J6PA 2P88A 2VFHA 1XYCA 5EFDA 4GQRA 2MANA 1UH2A 3HU7A 1OGGA 4IFKB 2YFNA 2VNCA 1AA1B 3U4FA 3E6EA 4AEOA 4H9YA 4ERAA 4UTFA 1TR9A 2J7CA 3AO0A 2ZXQA 3LGGA 1SJDA 2PBGA 4XZIA 5ABGA 2ZOXA 4XZNX 3ZVHB 3U5UA 5HULA 3WD0A 4OZOA 4MHBA 3EPNA 5GJNA 5KZEA 3H2OA 2REQB 3H2NA 4YVVA 2XDFA 4F40A 1EX5A 1OG0A 2GWGA 1H4PA 1ZAIA 1O1HA 4XBJA 2Y5JA 2D23A 4NAFA 1NOFA 1VJSA 3QV8A 3W1XA 3UFYA 3GXNA 4XISA 2TYSA 4Y96A 3W1PA 5LNUA 1JCJA 2JE8A 4U3AA 4KEZA 3AS2A 3N34A 3CASA 3AWOA 3JS3A 3N1AA 4V2XA 1D3CA 1H5VA 4MB4A 3P8IA 1F5ZA 1WAUA 4NJKA 4B9YA 1IT8A 5XIAA 3PN8A 1ZFJA 1P1MA 3PG8A 2YYTA 5G2HA 1EF2A 4DNHA 3WFAA 2YLLA 4JTHA 1W9BM 2BV9A 4B91A 4YTUA 4M8UA 3WENA 3O6YX 3C0SA 1H2JA 2A6NA 2QZRA 5EMUA 4UXDA 2ATMA 4GQGA 4EKJA 5TQLA 1NDZA 4JIHA 3ZO9A 4DUOA 3DI0A 4O1EA 5CCZA 1K9FA 3KBMA 4UMAA 1XYAA 4G6CA 3G1AA 4F8XA 1W1VA 1JRBA 1XLIA 4GUJA 1W1B1 3W01A 1LT7A 4AIBA 5AYYA 2FMOA 4YWIA 3WDIA 4Q8UA 1AH3A 1LOQA 2OGYA 4JL2A 4WY0A 4FPSA 3DFQA 3CTTA 4A3QA 3F5KA 3BAXA 2X0SA 4AD5A 4BJHA 1JPMA 1TJPA 2ZTKA 4CQ8A 2QAPA 4IQEA 2VWSA 3LB0A 3LBMA 4GNKB 4UQDA 4E4UA 3QZ6A 2XYLA 2OFJA 1WDQA 4CCCA 3OQ8A 2EJAA 4KKXA 1UWAA 1NSJA 3VDHA 3PC0A 5D02A 2QUUA 4RNHA 3VM7A 3CL6A 2YB4A 2VKZG 1EGZA 2G3MA 4LBRA 1ME8A 3LCXA 1F05A 3BLKA 1K7EA 2BOGX 5KTLA 3DX5A 4H6EA 3W1TA 2HSAA 3PK7A 2QCGA 3IANA 1OD0A 2VFDA 2GZXA 1O5RA 3OZMA 3VUSA 3RXZA 3SGGA 3VUPA 2OLSA 4JTIA 1H7OA 1RH9A 7XIMA 3ME3A 5DLCA 3BCDA 4C1NB 1FXPA 5FESA 4W89A 2MNRA 4GKTA 3PWIA 1Q6LA 1NF0A 1OCJA 2X0YA 2XUCA 1GQIA 3SN4A 2R1MA 4RE3A 1V79A 3ZWTA 4UQ9A 1W9UA 4DJDD 5KEZA 4DJEC 1E70M 3SBFA 3PM6A 4H7VA 3PWAA 4M3PA 4FK9A 4U3CA 1QI2A 4G7EB 2CWXA 3QGAC 2HNEA 3PTMA 3RRAA 3WMLA 4N4PA 1IR2A 1XF0A 4ZMGA 1XLEA 1VP5A 3WDRA 3J7HA 3EDDA 3S1XA 3PUOA 3W38A 5FACA 2Q8XA 1XLLA 5XIMA 1SZEA 2Z1SA 2POTA 3DHUA 3KW3A 2HCVA 4QQUA 1KD0A 1W5QA 4GJIA 4L9ZA 3M0ZA 3FY1A 3LHYA 4JN7A 4U2ZA 3PUDA 4D6GA 2D22A 3DU0A 3I7SA 4A4AA 3EZ4A 4PCSA 4I8DA 4R33A 5BU6A 3NQAA 3CH9A 2EG6A 1EOKA 1G01A 1J5TA 1ZPTA 2ZUUA 2F8QA 3OA3A 4J3UA 3ID7A 2BXZA 3O07A 4GE8A 4XD3A 4FNQA 1K7FA 5EKYA 3UG5A 5E0KA 1XRVA 1QHPA 2V68A 3STGA 4GX8A 1VCFA 2Y2WA 3DHFA 4NU7A 3FKRA 1XLGA 1QK2A 3CU2A 4QIUA 1US3A 5M17A 4HIBA 3DHDA 3UWEA 2ZZ5A 3QQ0A 4X2PA 3G0UA 1YPXA 2DY3A 4UR9A 1EHNA 1HKMA 4HZMA 3EDKA 1UR1A 4OT7A 4V1XA 3CIVA 1VS1A 4MZ1A 1NF7A 1Z32X 4N6EA 1L2QA 2OELA 2EAWA 4IF2A 3V0TA 3GXIA 4XZBA 5C5YA 1Z69A 3GY1A 3AJXA 3BH4A 3TYAA 3WH7A 3MSRA 4QDWA 4XG1A 4IGSA 1IEVA 1XKYA 4GYKA 1B3OA 1YQ2A 5JH2A 2E67A 4XVEA 1XR2A 2RHGA 1RD6A 1G0CA 2IPJA 1NWUA 3R6IA 3RM9A 5M3WA 3HGOA 3Q65A 1GT8A 4LAZA 2EPHA 1E15A 4HNUA 1JUEA 4WXYA 3AXIA 1KBLA 2OYKA 3UJRA 4GY1A 2QQ6A 3C0QA 4HNVA 1V0NA 3EMQA 3QEZA 5AC6A 4GIYA 2Q8LA 2I1OA 2CLEA 3H7VA 3MMUA 4A8IA 1XICA 6PTDA 3S2CA 1I6NA 1LL4A 4DWSB 3C56A 3EGJA 1OM0A 3RGTA 2P10A 5LYRA 3OP2A 2QGHA 4PMYA 5DCBA 1OFAA 3CUGA 3H55A 2CLPA 3GDTA 4DI8A 3PVFA 3KVMA 2O92A 1SJBA 2Z00A 1ALDA 1R38A 3MBFA 1QI0A 1X6LA 4MADA 2NQLA 1FWGC 2A1YA 1VGAA 2R1PA 1NFPA 4HCHA 4PB5A 1V02A 4ICNA 3GK0A 3GHSA 4WLCA 3CHEA 2EBNA 1CW2A 4UMCA 3EXTA 1XCWA 3LSBA 4PR4A 1GVOA 2G3FA 4WF7A 4PC8A 1PWMA 4A3UA 4Z1YA 3DFNA 1BVZA 2PDCA 3DHPA 4TV5A 3AQUA 3EB3A 1I2QA 2W62A 4RDVA 3PSVA 1GWJA 3M0KA 4JOMA 3VZXA 4JKKA 4C6QA 4S3CA 2WZTA 1YNYA 4AB4A 1EJVC 4MGGA 4TX8A 2YPIA 2CESA 3F4VA 3TFXA 2QIWA 1BYBA 5CPQA 3K5XA 5M1TA 5KZ6A 4CVUA 4Z1AA 2O9OA 2ACUA 1F8IA 3NTYA 2IQTA 2VEPA 4JTKA 2AGKA 5FF2A 1P0BA 5A8PA 3K8MA 4WGXA 1VB9A 4Z2LA 4YTTA 3ZS4A 4IIEA 1P43A 1WB0A 2PLCA 5A6BA 2PUZA 1QTWA 3CS2A 3NM3A 5CAHA 1T7LA 3KE0A 3RX3A 3M7SA 2V3EA 2ZRXA 4D6CA 5C54A 3T81A 3VNKA 2ABAA 4HHLA 3GTXA 3WF3A 3WG6A 1M9HA 1YW1A 4N42A 3I6TA 1U22A 3RCMA 4LYRA 4XQ6A 4M0XA 4QJ1A 3A12A 3BLOA 3K30A 4B3LA 3KBNA 2PLKA 3R7MA 3WYZA 3HJEA 3SY5A 3WLSA 4UTMA 5HPCA 2ZQ0A 2CC0A 1KRAC 3O6DA 4QSHA 4S3AA 3E0VA 3HZ3A 3LPFA 1J0ZA 1GQKA 1L8NA 3I4KA 2VX6A 3WLRA 1SSGA 1MEHA 2VUYA 2J74A 1BWKA 1PEZA 2ABBA 1M6JA 3KRUA 1FDJA 3ELFA 5FF0A 3BC9A 1PZ2A 3VGEA 4U28A 3WLJA 4V28A 5E0FA 1Q5MA 2B31A 4K1WA 2ISSA 2X09A 3EWXA 3G24A 3GRIA 4BEQA 1FWAC 3TV8A 1K8YA 1U1HA 4MB3A 3IUHA 1UMYA 4N7QA 3CMJA 4AYGA 2OSYA 3N9RA 2XH7A 4XUGA 1B3XA 1HJXA 1SPQA 1TTPA 3QY8A 4NZ5A 4KWWA 4FX7A 3KOFA 2WC3A 4KWOA 5G1TA 3W7KA 3C0LA 4F66A 2V3DA 1FWTA 3UZ5A 5D2WA 1AZ2A 3QPZA 3USBA 3BTNA 3RM4A 3PP7A 3ZOAA 4QEHA 1GVQA 3FJ4A 3QKZA 4WGHA 2E6YA 1WKYA 3T2OA 1DJQA 1ZALA 1J0YA 1C9DA 2RJHA 1CECA 2F6KA 1P0DA 4JD4A 1A0EA 4AWSA 3BW2A 5F2IA 2ZA2A 2BGQA 3SY8A 5FD0A 5F4XA 1RCXB 4MKNA 3TNBA 2W5FA 4O8RA 4DBWA 1FOBA 3KBWA 3HG5A 1J12A 3WLMA 3IGUA 4DN1A 1DHPA 2ZZ4A 3VMOA 2OJPA 1XH1A 4LS1A 5CG7A 4JY8A 2XFFA 3W7CA 2CITA 5LSMA 1E0WA 4XO7A 2FVMA 1VYRA 4FNTA 4KT2A 2OZ0A 4QNWA 3UZZA 2QF8A 2G96A 3CM4A 4J3WA 1O7AA 3GS6A 3WQ8A 3W37A 1DWIM 2XGBA 5DXXA 3WMCA 3THDA 5KMYA 1XH2A 2JKAA 1B3VA 4Q3MA 4QP0A 3L0GA 5I3DA 3BMVA 2E8YA 2QCMA 5C6MA 3GR8A 1KKOA 3RUBL 1JFHA 3BXWA 3T7VA 5A3HA 3TW6A 4LS2A 1PTDA 4GZJA 2Y7FA 3VABA 4NX5A 3O7UA 4ZQOA 3IUIA 2HMCA 3XINA 3GDBA 2ONEA 4GO9A 2ZFAA 1HKWA 1VJZA 2ZRUA 1QNSA 3KBSA 1MEIA 3S5SA 2QVNA 4U5KA 5DCDA 3TQPA 1DJZA 2ZZ7A 3WLPA 1F07A 3EOUA 3G1XA 4RZ6A 4IFOA 3WQFA 2EG7A 3WDPP 1LBLA 4PMZA 2RJGA 1NQ6A 2QCDB 1TPUA 2G37A 4MKVA 3GM8A 1TZ9A 5G2IA 3VCRA 4OOUA 3AUOA 1K77A 3EX6A 3L4ZA 4H8NA 4RE2A 5CBBA 1VIWA 1AH0A 1I2PA 3WDJA 4D1IA 4ML9A 3E96A 3NDZA 2J13A 4DM2A 3SCNA 4PMXA 3VKAA 3NO3A 1W37A 3W00A 3MJMA 4MAZA 4LY4A 1C91A 3VCCA 5K3VA 2I5IA 3AXXA 1JI1A 4IGNA 2QV4A 2XZ9A 1W3LA 4KFPA 3TTOA 2GLKA 4H01A 1TREA 4QBXA 4HGXA 2OEKA 3T09A 1EUAA 3I6RA 4C6MA 4QDPA 3OEXA 1BKHA 4S3FA 3S1WA 1NFGA 5J5DA 3VX1A 3H26A 3LENA 5BU9A 1UIOA 4ZO7A 1XDMA 4HPNA 4G5DA 2D2HA 3MHUA 3IIZA 1RJQA 3UP8A 2YCIX 4LYQA 4LF1A 4M80A 2XSBA 3KWXA 1TPB1 3VKKA 4OECA 2PDFA 3LM7A 3TYEA 3M7WA 3HO8A 4X9YA 1RP9A 5LHFA 1NEYA 2A3LA 2YGYA 3CQHA 4XZMX 2PWHA 1OCBA 3LCLA 1AFSA 2ZUVA 3CV1A 3EWDA 4CEUC 1WXYA 2NWSA 3H23A 2NLYA 3EAUA 4AH7A 4JPGA 2WMIA 3UWWA 1JDFA 3IJ8A 2UV8G 2E1WA 1M65A 4I9MA 3G18A 4B4HA 1CPUA 4NT0A 3SCSA 1V6TA 2EEXA 3ZVHA 3Q58A 4OQVA 3NVDA 3GHTA 3APYA 4EP8C 3TVAA 2IKHA 5F1VA 1BTMA 2GVLA 1E1EA 1OZQA 3I7RA 3O05A 3BE7A 1CI1A 3WFZA 1CLKA 2BBFA 4V15A 4Z0SA 4M6QA 2B0MA 1EJ7L 1P4CA 2HWGA 3LRKA 5CC7A 3NQVA 1DPMA 3W28A 1J79A 3QR0A 3N2CA 4A3YA 1X96A 1WNOA 3B0YA 1GQJA 1EJWC 2YW3A 4W8AA 2X42A 4YL2A 2HE8A 4GVIA 5AVNA 5E6ZA 1VZWA 4DF0A 4XZWA 2IKJA 1A47A 4ZB0A 4Q4KA 2NXHA 4FLSA 4M6VA 1F6KA 3T0DA 3HPAA 2TMDA 2Y0FA 4GFIA 5KZMA 3P3BA 3L66A 3QV6A 3L21A 5A6AA 3NO1A 1IIGA 1IXQA 1ZQ5A 1GORA 4IMDA 1C8VA 1HKKA 1NOUA 2DSZA 1REQA 5EMYA 2VEMA 3GBDA 4GA8A 3VIOA 1JNDA 4XTDA 4DO7A 1G6CA 3W23A 3F5LA 1UUQA 2J62A 3LSCA 3OOQA 5HANA 1U33A 4PMNA 2ZZ1A 1W1PA 2NSXA 3WBAA 3QOKA 3OZYA 3G1SA 3FYPA 4MDPA 2BVWA 1PKYA 5HMSA 3R8GA 1TWIA 2O56A 3GU1A 1SR0A 1GVEA 1L6GA 4MNMA 2WV8A 4C6DA 4C6BA 3STPA 4RZBA 4FXFA 1LQ2A 1W1TA 4A2RA 3TNOA 4KBXA 1XIDA 4JEJA 4G2DA 2WC7A 4GOAA 5I23A 3I3DA 1QO2A 1VBJA 1BG4A 3A21A 4S38A 2WLYA 2NSOA 3VOHA 4F4RA 2ANUA 4JTTA 2P53A 1ZUAX 3T1GA 4WDTA 5CC3A 3PANA 4O15A 3FGCB 2B4GA 3CL8A 3GNXA 2PB1A 3ITYA 4AD3A 1JYXA 4CQCA 2VWTA 1S2CA 4LFYA 1XD1A 3V4BA 1W31A 3VOGA 3T05A 3K8KA 1EH9A 2C1IA 3C2YA 2QPXA 1JFXA 5G4WA 4I6KA 4TMBA 2IW0A 1JYNA 4IIHA 1CLXA 2D20A 4H41A 2W67A 3TJXA 1B4KA 1KV8A 4PCTA 5K7JA 4WQ6A 2YSWA 1VH7A 2C71A 2DT1A 1E3ZA 3WK0A 1OB0A 4CGTA 2J25A 3AU2A 4G7EA 3NAVA 4X3ZA 3NURA 4ALDA 3IJ9A 2BY1A 3UG4A 1H62A 2WSPA 3A47A 1JCTA 3AOFA 4UNLA 3LA4A 4GQ0A 4ADUA 3FJNA 1MUMA 2R1LA 5MF5A 1EJRC 3IJDA 4JIRA 3FJ6A 5CAKA 3MI6A 2PLJA 4W5UA 1TKKA 1XC4A 4HK7A 1I75A 3OLDA 1UUMA 1TZ7A 1FY6A 3PZQA 4DY1A 4JDYA 1A5OC 3M5YA 3CUIA 3DCPA 5L6UA 1NARA 4Z2IA 4AHPA 1CNVA 4GUFA 1KA9F 4Z42C 1ZLPA 3NPWA 1GVFA 5EGRA 3UJ2A 2F7FA 3AHVA 2QMKA 1R7OA 1W9VA 4TX9A 2DVTA 3B9AA 4D6EA 2E5BA 4HKPA 2XH2A 3QTPA 3NZQA 4U4MA 1ZHAA 1TR1A 2AL1A 3JZEA 5A6LA 5TBOA 3QQ1A 3TH6A 2DSWA 4IJRA 3W2LA 4H7ZA 2TPSA 3RO6A 3PBUA 5DANA 1JF6A 1AQ0A 5AOUA 2WSQA 2GDQA 4ZXLA 2CZDA 4M1BA 1WV2A 2WJDA 2WMJA 3R0UA 1ONRA 1V6VA 2OSWA 2X2GA 3NZ1A 4OKDA 2PEVA 3DAQA 1GYNA 2YXGA 3WF4A 3WLTA 4C7FA 1CEOA 1SZNA 1ISWA 4M29A 2QJGA 2VYOA 3FHAA 4KIEA 3U0HA 3AIRA 3I3BA 4QGCA 4PULA 2IKGA 3LHVA 3LNPA 2HEJA 1OF6A 3DFOA 1NAL1 4C5YA 3MCMA 4PTDA 4DLFA 3WNNA 2Z25A 4DQWA 3IJQA 4MWAA 1ISYA 2BHZA 3RPMA 1W3TA 3UT0A 2BP1A 4E38A 1A50A 1ESWA 5DX7A 1QWKA 1ZSXA 1TJ1A 1V4YA 4A8NA 1Q6CA 2J8FA 3D46A 2ZX5A 3OO2A 1OC5A 3ES7A 4OJYA 2Z29A 1Q3NA 3GFZA 2VZTA 4LT9A 1P0NA 1NWSA 1VENA 2YL8A 2CLFA 3NFUA 1MRAA 2FKPA 3VOFA 1R8LA 3W7GA 2FQIA 1BHGA 3BL3A 3QLDA 5DMYA 4DWSA 1DORA 3CQKA 1K70A 3GDKA 5KETA 2PDYA 3BICA 3HPSA 1XC6A 3F5JA 3A13A 2I57A 4PFMA 3N14A 1A5CA 3O16A 4WOQA 4XAYA 1ZAJA 1Q6DA 1RVGA 3GG0A 5D2XA 1TX2A 3KXQA 2A3AA 3GNDA 3SSZA 2DUAA 3KL3A 3IPWA 3VAVA 3M64A 5JIWA 3BQ6A 4X60A 1EJUC 2V67A 4K8HA 5JXQA 2V82A 3GKFA 4AZ6A 3IUDA 3NL3A 3UXLA 1QASA 1KC7A 1PYFA 4UR8A 1M7PA 1AW1A 1G1YA 1W3KA 1WBJA 5CGQA 1Q6FA 1K3UA 1XYBA 1EJSC 5LZLA 2CYGA 3PFRA 3M0JA 3CT7A 3NJ3A 4F0LA 1VLIA 4CQBA 3W87A 3QKEA 5HAOA 1HG3A 2VT0A 3CPRA 2VZVA 2D0GA 4YVXA 4JNZA 3R79A 1M7OA 3AYVA 1J0IA 1Q13A 2NW0A 3MMTA 1R3SA 4ZB2A 3W74A 3K4DA 4TUFA 4GI8A 5H1WA 2UBPC 1IZJA 4LNCA 3L4YA 1AL7A 1KRMA 4DJFC 2VQTA 5FL0A 2BOEX 3CLWA 2ISWA 2PTWA 5HJLA 3FK4A 3QV7A 3ABXA 2XPKA 3T8LA 3WNOA 2H3BA 1UJPA 4GQQA 1VBHA 2CETA 2J7BA 5K9DA 2ON3A 1R2TA 2XIIA 1K9EA 1EZWA 1W32A 1GVIA 3M0HA 4Q4QA 3ZLGA 5FJJA 1FWNA 1XIFA 3N9SA 4UNIA 4BF9A 4YYFA 4LNYA 1F3TA 4JFWA 1TSIA 4GPNA 1H7RA 3CHFA 1UOKA 3PNZA 1W1YA 3KLLA 1PAMA 4NZ1A 4BWLC 2GYIA 4WX2A 5CPTA 5G1YA 2XGZA 1PHQA 3T0BA 4PSPA 4XAPA 1US0A 4JTUA 2VGIA 1OINA 7A3HA 1GQNA 4IIGA 1MXSA 3NPXA 1GTEA 3LG3A 3WLHA 4BF7A 4B5WA 5BYWA 3NYZA 2PWEA 2DU2A 3UNDA 2XH0A 3Q4DA 4O8AA 2Q3OA 1W5NA 1DYSA 1LL6A 1KBKA 4H2HA 4DXXA 1XIEA 3MPGA 5L9FA 3BLDA 2GGIA 2AKZA 3N3MA 4CQDA 1L0PA 1AVAA 5HK4A 4IQLA 1UKTA 1PCKA 1AH4A 3VKCA 3NL5A 4Z1BA 1H11A 1GEHA 5D9MA 2FZ9A 2Y7EA 1FP9A 2XU2A 4LVAA 3BK0A 4MMWA 3QY6A 1KM4A 1N82A 4JX5A 4UTWA 3NOYA 4MWAD 3WDQA 3VGGA 1TRDA 3PNUA 1MXDA 5BRBA 4R88A 5AC7A 1T99A 2YFOA 3V75A 3UG3A 3H2EA 3VCNA 4GLEA 3CNYA 4Q4MA 1XIIA 3BSGA 2ZUMA 2OYLA 4O19A 3APTA 1CGYA 3A9IA 4QDMA 2AKMA 5HMEA 2R94A 1F61A 2O9PA 4H2CA 2F61A 3PJXA 4JQ2A 4EWJA 1QI5A 3OZOA 1F3XA 1NQKA 4KH2A 3VMPA 1ZGDA 2J9XA 3WJSA 2I9EA 4QROA 4GZEA 2C15A 4ZOEA 1X1NA 3GSMA 2E9BA 3OODA 4GFSA 4MFDA 4GY7A 4C90A 1ONEA 1MI3A 2O0TA 1R87A 3OLIA 4FLOA 2VCBA 4XAGA 5CLWA 1OFPA 4O16A 3IEBA 1I1XA 2E9LA 2H9AB 2P76A 1E6NA 2J27A 1SJCA 4FXSA 1FHDA 3N6QA 3QM3A 1FHUA 1E3XA 2X40A 1WDSA 2W6RA 5DEZA 2CLIA 4CLMA 3LBCA 4G7FA 3WBEA 1J4EA 1E6SM 3F7JA 3WQWA 3C8FA 4FS9A 1R3TA 2XIJA 4DIAA 4CNUA 2PGRA 3TW9A 4Q8QA 5E9AA 4O52A 1VBRA 2FB3A 1R3VA 4F9JA 2FMNA 5T9CE 1ME9A 2GGJA 4C6KA 5CG0A 1TVPA 4PCFA 1QCWA 3N4FA 3UZJA 4PL2A 4AU0A 2A79A 2DVUA 3U2EA 1OX4B 4FNSA 1Q63A 2XINA 5I03A 3VKBA 4HPHA 1YEYA 4DUVA 1MNZA 1UQZA 3E2RA 3EDJA 4TTGA 3P67A 4JDBA 4QNEA 4ZVJA 3P81A 3F4DA 2X1TA 4R9OA 2VRQA 4NVTA 3PUGA 4BI6A 3DFSA 2C7FA 3S1GA 1Q6RA 3TJ4A 1F2JA 4C6CA 1BVNP 3MVIA 2ZWYA 1Q6QA 3KBJA 3ANYA 3OGVA 2HK0A 2QCDA 1ZZMA 3UWUA 1IGSA 2C14A 3WQPA 2A2IA 4ZOCA 4CNPA 2UY3A 2NWRA 1OFBA 6TAAA 1MQPA 2Z2BA 1L6SA 1SW3A 4IM4A 4KRTA 4O18A 5A5WA 4IT1A 1PUDA 1IIHA 2J24A 1GZGA 1XH0A 3B8IA 5CC6A 4HZ6A 2W63A 2ISVA 3LBOA 3CTLA 1VEMA 1X6UA 4WKFA 1ZJBA 3I3EA 3H8AA 3ABQA 3CUXA 2P8CA 3E02A 2VURA 4KIRA 2UZ9A 3KUMA 2ZE3A 3GB6A 4AZ5A 1B31A 1CXHA 5C7HA 4Z08A 2ZE0A 2JQXA 4MTVA 3LK6A 3W7MA 2PDLA 2HROA 2D73A 4PUEA 3HPZA 4OBTA 3S8HA 4LBUA 1V8EA 2DV0A 2R8WA 3HPXA 4LVGA 3AYSA 4ZBCA 4PMUA 1WXJA 1TIMA 4GI4A 3R8RA 1E40A 2EPMX 4N2YA 3T44A 3UA4A 1KW1A 4WOZA 1IV8A 4YWSA 3TCSA 1RY0A 2FB2A 1V7AA 3UEQA 1VYSX 4NI3A 1R7AA 4HA0A 5KITA 1FVPA 4AWTA 3OBAA 4IMFA 3WD4A 3DBPA 4UQEA 1P6CA 2DZSA 3PZTA 4QISA 2XFWA 1LT8A 1ZTVA 4FLQA 4S2BA 2WM0A 1KLYA 1GVRA 1E56A 1L6FA 4B5XA 4RKAA 2XSXA 3T40A 2PDMA 5D8ZA 3VNJA 1D2KA 2V38A 1KTBA 3E5BA 5HPOA 4M6UA 3TYZA 2HK1A 5HXMA 5REQB 5I09A 2BY3A 2Q01A 1DWFM 3GNOA 1QNQA 1IWPA 3QYSA 3LXBA 1KFCA 1TA3B 1WP6A 2CU0A 1RLCL 6ENLA 1U30A 4B3ZA 4E3VA 3TWAA 3E12A 1HF6A 4D6HA 3VD5A 1O5XA 1UD8A 4RJEA 3FSUA 1UKQA 4EPKA 1RV8A 2G4FA 3WMBA 4UFMA 3B0PA 5TIMA 4GISA 1TWZA 5D03A 1K4HA 5IM51 3W7PA 4PMVA 5CC5A 1FKWA 4LEFA 3VXGA 4XZLX 2J47A 1BSIA 2Y7GA 3B9NA 2GJXB 4PB4A 1G69A 2DZPA 4DYJA 2YBVA 2DFAA 3W3OA 5DBUA 1CENA 4CQ9A 1B90A 1H1NA 4DZ5A 3ZIZA 3OW1A 3HFTA 3UXAA 1FFRA 3IVSA 3FSTA 3RG6A 4RDZA 3W72A 1RPKA 1WDPA 1UKSA 1HUVA 3PZNA 1MO0A 1JPDX 1ONWA 2WK2A 3W7HA 4AC1X 4QJ4B 4YCPA 2J75A 2Y89A 4TOQA 3QYQA 2QJJA 1LJYA 3T78A 2TSYA 3LGDA 4PCPA 1OD8A 2PDXA 1NY1A 2V30A 5JVLA 2PZNA 4NRSA 3KZPA 1EJXC 1LG1A 4NAFB 4S23A 3CAWA 4MFEA 4GKLA 1ZJAA 3B06A 2WJFA 4O4WA 1I1WA 3WNLA 4A3RA 1UD3A 1SW0A 5AB3A 5JQ9A 4Z1DA 4KFNA 4IP5A 4X22A 4DUWA 4NYYA 4GIEA 1QW7A 2WZMA 6TIMA 2OTDA 1J5SA 5B7YA 3EWZA 5H8UA 3BCFA 1FWDC 3FGCA 5A2BA 3R43A 2YA0A 3U5YA 2ZYFA 3V7PA 3T55A 2HXTA 1GHRA 1EX1A 1EYWA 3P8JA 1DWHM 2QCLA 1QNPA 3C4UA 2ZDRA 4EPBC 4LAUA 1TUXA 3ITLA 3PJTA 1ICQA 2YOCA 3P0WA 1Q6GA 3A3HA 1H09A 5FEPA 4D1JA 1JD7A 3ARRA 4F0KA 3MW7A 3U2CA 3W02A 5E9XA 1OX5A 1ML1A 1I60A 1B1YA 2BB0A 2JFEX 3GH4A 1W9XA 4R85A 2QCFA 3H7RA 1IWAA 4Q33A 4G56A 1CIUA 3RX4A 3VOCA 1YADA 1MFVA 1KB3A 2VM8A 3G6LA 2GGHA 4EAMA 5EU9A 3N2XA 2JKEA 4PE8A 1D3GA 5CZJA 4Q7NA 3RMJA 2BLEA 1M01A 4KCTA 3K2GA 5MKGB 3PSWA 1YNQA 1SVDA 3S5ZA 1FWJC 1QPKA 4IGHA 1RCQA 2YDSA 3PPHA 3PJUA 1MZRA 4TIMA 2BY0A 5F4SA 2CPUA 3EDEA 2WMFA 1I4NA 4CD6A 1M7XA 1YDNA 3P82A 3WQCA 5CGMA 3F2CA 1D8WA 3EA2A 2MUCA 5EMJA 4AXKA 1OY0A 4EE9A 5AVHA 3RYSA 1YHTA 3LGEA 5KZDA 5DN1A 2DJLA 3VD9A 2CHRA 1ITUA 4RV3A 3W86A 1DJYA 4BHYA 3IGXA 3WEZA 4XIAA 4ZTXA 1S2TA 3CC1A 3ABRA 4PYSA 1EIBA 3UWVA 3E2VA 4O0KA 3ENLA 3R94A 2A3BA 2VEGA 4XD6A 1Q4WA 1J10A 4P7LA 4EAYA 3C2FA 2D69A 5LKYA 1LWIA 1UA3A 5C71A 1ECQA 2PMQA 4KRZA 3AS1A 3GBEA 3EWCA 1AW5A 1R9YA 4Q8VA 2G41A 1HL9A 5C9RA 3N11A 5DQPA 3B0VC 2IPFA 1XWYA 4S1FA 4FIRA 4QFUA 2NLIA 2IQ0A 3LHTA 1MZHA 2XIMA 1E72M 2ZRYA 2G50A 3TW7A 1SGJA 4FF5A 2EJ1A 1DVJA 1RR2A 4IWWA 1KWKA 5AHEA 4I9AA 3L68A 4FNPA 3LXCA 3IJ7A 3UR8A 1DP0A 1SSDA 1V3HA 3LNMA 1R86A 2ZXBA 1EUNA 1AODA 2CZ5A 2NQZA 4JTRA 2V63A 1BYCA 1W1ZA 1RCOB 3CHDA 4PL1A 3CO4A 3BV7A 4LUJA 4Q4PA 3W24A 4A29A 1AG1O 3G1HA 3NXFA 2OZTA 2PC8A 3BUVA 3R2GA 4WEVX 1S2WA 3WQ6A 1V3JA 4O13A 1EKOA 5D4YA 1E71M 3NZPA 1OCQA 1UZ1A 1DQWA 2PGEA 2QW5A 3R5EA 3AZRA 4GACA 4BFAA 3DG6A 4C6NA 2Z24A 2J79A 4H8UA 4HMCA 4BQ2A 2OCZA 4XZ9A 4M51A 3AIEA 4UFKA 5A2CA 1JZ4A 2OR2A 3JU2A 1A5AA 3Q67A 1OIMA 3NM1A 1NIUA 2BXVA 4HOXA 8A3HA 5CLTA 3MUZ1 4QLLA 3VK5A 4A35A 3MUIA 4HHHA 1K6AA 2J7FA 2ISFA 4Y8FA 5I79A 5JIPA 2FHBA 3N4EA 4A22A 3MC5A 3NQCA 4L9XA 3IRDA 2CLKA 1OCNA 5AYBA 3WH6A 2ZVIA 1TVNA 4LY8A 4J2MA 3SAZA 3T2PA 3TP4A 1GOWA 3BARA 5A6MA 1JG9A 3M6YA 1F4AA 3SIMA 3MKKA 3HN3A 2V69A 3RJXA 1FA2A 3L5LA 4X0NA 1F7BA 3FEQA 4N9BA 4XWUA 3MS8A 2F6XA 3SFKA 4I5RA 4K68A 4HU8A 1EYEA 2DH2A 3K4WA 3OYXA 3GR4A 4JIQA 2PDIA 4X63A 1LZOA 2PDGA 4PUMA 1NDYA 4IZGA 3U9IA 3TJLA 5RUBA 2CLLA 3B8WA 3V16A 1YXCA 2FLIA 2JF7A 4D8AA 1AJZA 4GYFA 1TWSA 3WK3A 4NZJA 2RKXA 1WCGA 1IR1A 1MW1A 4GIRA 2OB3A 3GYEA 2OWWA 3MU7A 4R7WA 1M53A 1ZENA 2I16A 3VDBA 3LMZA 4DZHA 1UWRA 6XIMA 1DL3A 2WPBA 4EOUA 3H6OA 1BVWA 1IWBA 5D8WA 4I9JA 7TIMA 3R8HA 5D30A 1TX0A 2FH8A 2PDKA 3SCRA 4X61A 1WO2A 1CWYA 4DX3A 5DBTA 4MJZA 4QTGA 1W0MA 2YZRA 2KX9A 2PWDA 3V0UA 5I7GA 4TXEA 2WM1A 4DF1A 2ZC1A 3E3HA 4RNJA 3HJZA 4OFCA 1YYAA 4CD4A 2VR4A 3ZSTA 1XPGA 4L6HA 2O9RA 3CWHA 2D0FA 1TPDA 3CWOX 4E2DA 4Y9AA 4OUEA 1VFUA 1KCKA 2E7FA 4H3DA 1BQCA 5HBFA 4ES4A 2NZLA 5C70A 3S46A 1XSJA 3KHDA 4PTWA 1E6QM 3RHGA 3RK8A 4DWSC 1R9ZA 4HSHA 4ORMA 3AMGA 2WMKA 2ZX6A 3S2MA 4UBPC 1E4LA 1N7KA 2VDGA 8CGTA 3KTCA 4B2DA 4GYJA 3FNDA 3G1VA 1VQTA 2VGBA 4FOUA 1TPVA 2WYSA 1XDJA 2FFIA 4HHMA 1SO5A 2E5CA 3VIPA 1WA3A 3ITVA 3EPOA 4MUPA 4ACZB 1ZS2A 2ESCA 3KDNA 3GZ3A 4XKMA 5EMMA 4NX0A 2QJHA 1EIXA 1R0MA 1Y8BA 2VX5A 3S5OA 1GOXA 2WHLA 3UETA 5HATA 3NYDA 1JDEA 2Y61A 2YCEA 3L65A 3TC6A 2EXOA 1S3TC 2WKGA 3F4NA 3L0NA 1Z44A 2WCSA 1A4MA 3KLKA 1UP3A 3TFCA 4A2SA 3UXKA 3MHGA 1OC7A 3GFXA 4ATWA 1LRNA 4U5IA 4LRTA 1JYWA 3CPUA 1LTDA 1FCUA 2P5NA 3SCUA 2H9AA 5CJ5A 3RX2A 1ISXA 3CWNA 1HZYA 3M07A 4O14A 3G6MA 5G2WA 4ZTYA 2CBUA 4KCVA 3B0XA 3CQ0A 1B9ZA 4NL1A 1XYFA 1TCDA 1KR1A 1XKJA 1M04A 3UJEA 1E4MM 4IMEA 5J8LA 1GKQA 5BOEA 4W7WA 3IVTA 2BG5A 3WLIA 3U4AA 3S47A 3O15A 2VTFA 2R9RA 3AROA 3FCPA 3ZFHA 3HBLA 3KAOA 1ZJHA 1P7TB 2EPOA 3D0CA 2RAGA 1QPQA 1K9TA 1QVBA 3F03K 1RSCA 3F4CA 1OX4A 3DG3A 3S1UA 5HNRA 1WBHA 1GOIA 4CNNA 3H21A 2P50A 1BWVA 3NXLA 5CPOA 2JBMA 4LCSA 1PPIA 2WHMA 2YYUA 2VOMA 3SR7A 2OGJA 1S2UA 4CCZA 4L65A 1GOQA 5K2ZA 4JX4A 1GOMA 1W8SA 3NGFA 1VFSA 1V3MA 3PZIA 1Q65A 3BJSA 4XUYA 5CBIA 3OGRA 3ABZA 5A8OA 1XLMA 1R9XA 2V6AA 4FEZA 1J96A 2W91A 3IVUA 2R24A 4W88A 5F2MA 2PGWA 4AZBA 3L2IA 1G4PA 2PTYA 4WZHA 2R6OA 2V5CA 3IGSA 5E6YA 4AC7C 4NXKA 2Y7DA 1OGSA 4B5NA 3T0TA 3R1ZA 2PDHA 2YIHA 3M44A 4K39A 3C2OA 1XUUA 4HPXA 1EA9C 2J7GA 1YPFA 3MUY1 3SZ8A 4LRSA 2OSXA 2OEMA 4AUBA 1K9DA 1I9CB 5AHFA 2VC6A 5HMFA 4KCUA 3GG1A 4GABA 2W9MA 1HKVA 4F0RA 1T5AA 2NX1A 4GIAA 1QK0A 4K37A 5AY7A 2FPVA 3N2TA 1MQQA 4FX8A 2BDQA 3LS9A 2J7DA 1SMAA 3MB9A 1ISVA 3TN3A 4LANA 5F1UA 1MUWA 1A49A 4AD0A 3QPEA 4B2DD 3RU8X 4Z1CA 3QW4B 2O7QA 1IHIA 3BPWA 4GWEA 1GJWA 2AMGA 3UR7A 3UG8A 1EC8A 1HFBA 3VILA 3SIZA 5CJNA 4H9MA 3CAQA 4ERIA 3LCGA 2W61A 4Y90A 4W7VA 1JCNA 5I24A 1OEPA 3A9BA 3CO8A 5CSUA 3E2SA 1DIDA 1JDDA 1G4TA 4Q4OA 1K7XA 5REQA 3UWYA 1OADA 1NJJA 2Z1BA 1W5MA 1EEXA 5HNNA 3TX9A 4XIMA 5A2AA 4NP7A 2QKFA 1B3WA 4MB1A 1PX3A 1RLDA 1KCLA 3GW3A 3CBWA 3H53A 4QCFA 2J9YA 1A5BA 1P0KA 4GVHA 4P61A 3CHCA 2VEKA 2ZBTA 3LRMA 3URQA 2IMRA 1U83A 4FXJA 2FYMA 1TMQA 3RILA 4PN2A 1WX0A 4HZ8A 7CGTA 4R34A 2E68A 4K8GA 4CNOA 2DT2A 1OFDA 3MO7A 4TVUA 2J77A 3BLPX 3CL7A 5FOOA 3WUFA 2R91A 1NDVA 5A69A 4XBSA 1R3YA 1LOLA 1VFTA 4UTJA 4Y7EA 5LNSA 4Q6JA 3MMDA 4LU0A 4UQBA 2DGAA 3O0KA 4WDWA 2FZNA 1OK6A 4TMCA 4B9ZA 3UCCA 3VTRA 4XB3A 2FJKA 2O9TA 5G1MA 4XAZA 3G77A 3LX9A 3CUHA 2V2HA 2WMIB 4RZ5A 4ATLA 1XIBA 4CCEA 3W9ZA 2FIQA 4MNKA 2WQPA 5D09A 4GY0A 3OLEA 1ITXA 3CZ8A 3AYTA 3C5QA 3W84A 1PX4A 1XDLA 3KM8A 1JCYA 4YN5A 3SUUA 3GC4A 3EB2A 2GOUA 5KINA 1W3JA 5LIWX 3KCJA 3IGHX 3N13A 3E9AA 1TWWA 4BS0A 3W7NA 1P1XA 4Q6XA 1BD0A 2XIOA 3BAYA 4MSSA 1L6WA 4H1ZA 1M68A 3S6TA 1HVXA 4I5UA 3DBNA 4YTSA 1RVKA 4ZODA 3EB4A 4JYFA 3WQGA 4WVXA 2PPGA 3UY7A 1VR6A 3W2MA 3SGUA 4R7JA 3TYDA 3PPCA 1JXKA 2QT3A 5JBFA 4G9PA 4UUIA 2X1UA 1AMYA 4CNTA 3BW3A 4R3UA 3MWAA 2Y5EA 3IV3A 3M47A 5AYXA 2CCRA 4HN8A 1G9HA 4Y9OA 2IPGA 3QMTA 1PDZA 1EO7A 3HGRA 3VNMA 3QQWA 5IHSA 1REQB 1YTDA 2NV1A 2ALDA 3C61A 2E6FA 4P7QA 3IS4A 3TZNA 2PDBA 1VPXA 1VRXA 1XL9A 1MWOA 5LXXA 1LLOA 3STFA 3S3GA 2Z7KA 4BEUA 3VNYA 1Q45A 2XIBA 5I78A 2YZ5A 4L1XA 1BSLA 2ZUNA 4MJ4A 3VGHA 3G1YA 4HA4A 4IXHA 1PL9A 3SECA 5GJPA 1DJIA 5LGZA 3ZMRA 1O1ZA 4JYDA 1DV7A 2D2GA 3W1NA 3UR5A 5FF3A 4KQNA 3C2EA 4JS3A 4M24A 4XAFA 5MKGA 1OC6A 4KWSA 4HHPA 1JPHA 4DI9A 1SZFA 4ENLA 3ECQA 4PBFA 2AMXA 3BMWA 1VHNA 4K6AA 4K7YA 5C9XA 5C2GA 5ABEA 2A5HA 3KRZA 4UFHA 2Z27A 2GK1A 5M2FX 1Y65A 4GZ7A 3AS0A 3L4UA 4PUJA 2AAAA 2WZIA 3GVGA 3HMJG 1DIEA 2WC4A 1KTNA 2XN1A 3GXTA 2E28A 2VDHA 2WJEA 5A8NA 2Z0IA 2GWNA 1JF5A 3RNDA 3GYCA 2I14A 1X7IA 1RHCA 1A80A 1U1JA 4LUTA 2DUXA 4MB5A 1HJSA 1YDOA 2V9DA 1EP1A 4AYSA 5JU6A 2Z4GA 3PS7A 4DJEA 1GKPA 3MI3A 3TTQA 3UESA 2PF0A 3B9OA 4ZO9A 1Q7MA 3H2FA 5BMWA 4X0VA 2OPJA 1DJXA 4HQVA 3L2LA 3EMCA 4YCOA 1PWLA 1VHCA 4PBEA 1UROA 2AOSA 3N4AA 5E09A 3TQVA 4P7OA 3PZUA 2INZA 4TVDA 2G3NA 3DYMA 2G0WA 4UOQA 3REQB 1I2NA 4CNSA 4YHGA 1SYTA 2DH3A 4LPCA 2OKTA 1I2RA 1FRBA 4WY0F 5CSSA 4NASA 4ZGYA 4LTSA 2PDJA 3OTRA 4PSRA 1JAEA 3W2KA 3HMCA 1C90A 1KFEA 1POJA 3M0VA 1J8VA 3MP3A 3R4IA 3E0LA 3V35A 1J9YA 3NEHA 4OVXA 3ARPA 3NQMA 2DZAA 4PUDA 1O12A 1UBPC 2LLEA 4A05A 4B92A 4PMQA 3G0XA 4KGJA 3TCEA 3BOXA 2VZOA 3VD4A 3A3WA 2JF6A 1GKRA 2VCCA 2WVSA 3WBXA 2VRKA 1YBQA 1C8YA 4URIA 3AIWA 1CXEA 2WNZA 2WSRA 1JGIA 1G4SA 1LROA 1JUKA 5FAGA 3R10A 4HNLA 4D8LA 1HP5A 3NL6A 1KRBC 4H8VA 1W1IE 2O4MA 9CGTA 2I5GA 3H2AA 4S3DA 3AIBA 1KKRA 3FS2A 2WVUA 1QU4A 2G3IA 3M5VA 2JK2A 3PWGA 4Q22A 3T08A 4AY7A 5TF0A 4QE1A 3CZJA 4ROPA 4GNJA 2C79A 1OJXA 5BXSA 3VIFA 4IISA 3IV8A 1BQGA 3G0SA 3UY8A 1FDZA 4MIMA 3C2RA 2OT1A 1QI3A 2H6RA 3W71A 3FHQA 1E1CB 2XHYA 4LV9A 4L1GA 3C3NA 3QZEA 2Z28A 3MTWA 1IEQA 2CEQA 2Y6ZA 1IF2A 1P6BA 3C3UA 4KCWA 5FA5A 2R1KA 4MWAB 1MXGA 3N12A 3ZT7A 4J3ZA 4QG8A 3DH7A 4AWUA 3B8DA 4CCDA 4IH3A 2VFFA 3ZXWA 5LA2A 3LU2A 5A6JA 2P1FA 3WQVA 1O5KA 4ZQPA 1HIZA 2WXDM 4KFOA 4Z2GA 3P62A 3W88A 5H2ZA 3RR1A 2X1IA 1TTJA 2QUTA 3M0YA 2QUMA 1FWIC 2PWGA 3MANA 4AVNA 3H12A 3TYBA 3A23A 4L5ZA 4N4QA 3ZR5A 4JTGA 4UTHA 1QPNA 3WK1A 1KCXA 3U57A 4NYUA 3M41A 1RQHA 1QDSA 1PDYA 3RJYA 4N02A 3M46A 3AZSA 2B7PA 1HO4A 3E2QA 1D8CA 2WQDA 2QXWA 1E0UA 2Z26A 2XVLA 3MZ2A 4JFVA 3ZLHA 5C2CA 3CXOA 2QGYA 3HIJA 5C9WA 2DZUA 1CYGA 3BSHA 1HGWA 5D33A 3L67A 5FSDC 3A24A 3DOPA 2WBGA 3OIHA 4E8DA 5I5RA 2Z1KA 4GYPC 1V3KA 1TTIA 3AHXA 4IJCA 1XCFA 2NQHA 1XLBA 4DJED 3KOYA 4UTIA 3NQGA 4ZENA 1B30A 1FHVA 3C2VA 1SM9A 3EKZA 4R27A 4GGHA 4FHAA 4U33A 1US2A 4IX2A 5DFAA 1IQ8A 2C91A 4J28A 1DWGM 1N8FA 3A6OA 2ADAA 3BOLA 3LHZA 1AK5A 2HVNA 3N73A 4INFA 3M0IA 4M1RA 1U5HA 2ZUSA 4L80A 7REQA 4PMRA 1FCBA 3MUCA 5K4ZA 1CGVA 3L5MA 1TTQA 3LV5A 1PHWA 3SJ3A 1TIWA 4QE4A 4E5TA 2RGMA 3UCQA 4FR6A 1JCMP 1LRTA 3DFPA 3WLOA 1RZMA 2INEA 3TXZA 3OJGA 4YJ5A 4ACZA 3N2BA 3GDLA 3TC3A 4KMQA 4P8XA 1JJKA 4ZXOA 3WL1A 4D8ZA 3V0SA 1QHOA 4D9PA 1D7KA 3LN3A 5IOBA 2UY4A 2Y62A 3FAXA 2OKOA 4IJBA 5F7UA 2QF7A 3NOEA 2ZUTA 2GPTA 2X8RA 4QJ3B 4OV9A 3MYPA 3MT1A 3EOSA 1GCYA 1FWCC 4YS1A 4JICA 3TZFA 4AY1A 4DRSA 1F76A 2BFGA 5HQLA 5I06A 1DIKA 4ASTA 2UY5A 1EP2A 3F2BA 2DQWA 2YKKA 3D6NA 5DT5A 3OIXA 3AIQA 4LOCA 4D72A 4YHEA 1FWRA 4QITA 3CUJA 1EC9A 1QT1A 3IAQA 4XTIA 3AC0A 2HBXA 4OTKA 1BGAA 2QNEA 1X38A 1PIFA 2XG9A 1BXCA 1V3LA 3ORWA 3TEVA 4D71A 4KWUA 3EOLA 4V27A 1UC4A 4JQ1A 4F9DA 1X8FA 4HK5A 4D6DA 2PODA 3C52A 5C0QA 3USZA 1E9IA 4JEQA 2DORA 3TA6A 1P7TA 2XVGA 3NO5A 3L4TA 1OVDA 3ZJKA 3QHNA 3XISA 1ZL1A 2X30A 2PP1A 4RXFA 3TDFA 4KWVA 2GUBA 4YTRA 1UR8A 4S3EA 3ITTA 4JTCA 4HJWA 3VD3A 1T96A 4K36A 3BOFA 4KS0A 2D24A 4IMCA 3ARUA 1AQHA 1XYLA 2CXGA 2VEIA 2WSKA 4K8EA 3FA5A 3W83A 2WNNA 4RR4A 4Q8NA 1PBGA 1S2AA 4I9TA 4PB3A 4IL0A 3QH2A 1Z42A 2GUUA 3URBA 2J8TA 5K9CA 5IBXC 3H24A 1P48A 3MUXA 1FWFC 3HB9A 2ZZ3A 3QGKC 5GNZA 2ZXDA 4MVAA 1GYMA 4NNCA 3QHMA 5HOSA 5MHBA 2KZHA 1LUCA 2CW6A 1MFUA 3CYVA 4WSHA 2OWCA 3EX4A 4K2SA 3SCVA 4S3GA 4IMGA 2EPNA 2C8NA 1EWEA 2JIWA 4JIEA 3A4AA 3Q94A 3G8RA 3AALA 3MI2A 4Y9PA 3NQ8A 3WJZA 4QAIA 4W7UA 3EYPA 4UR7A 4G8TA 3MMWA 3AXMA 3N3TA 4DB7A 2QCNA 1SZRA 2QVHA 3UWQA 3AAMA 1LF1A 3P2VA 4PFHA 2HV5A 3ATYA 3R58A 3P80A 3IRSA 1MW0A 1ZP4A 3JZUA 2DEPA 1GK8A 1BTCA 2Y85A 4HNTA 4C6LA 4LBSA 3ALFA 2VO5A 2PSNA 3GNNA 3CQJA 4RZ4A 2PWVA 1PXGA 2NVDA 3FAWA 4TV6A 2FZDA 4W93A 5AKQA 1YRRA 3UR2A 1E1FA 4LCQA 4OGZA 3G8EA 5HA7A 3VNDA 1XIJA 4XD5A 3V5FA 2ASHA 4X9SA 2IXUA 1TCMA 1Y5XA 3CB3A 3U2OA 1R85A 4O1BA 2P8BA 2XJ7A 1SW7A 3QR1A 4FP1A 4FO4A 1JDAA 3L4WA 4GUIA 2ZKMX 4L6OA 3STCA 2R14A 3CV2A 4Q7IA 2V2CA 2DZBA 3EA3A 1FX6A 3OU8A 1XISA 4B90A 3UJFA 3H4WA 4XV0A 3SUVA 4E2VA 5EBAA 5CEWA 4UB9A 4UZSA 4PUUA 4HYWA 1PV8A 4D6JA 1DWJM 4RPQA 4MUZA 1FBAA 4MM1A 3GDRA 1XI3A 3EXSA 4UWMA 5FEWA 5GNXA 5CSYA 5FJIA 5FJPA 4XSLA 1UH3A 4B5TA 3H70A 1UP0A 1ZBVA 3CEPA 3CGTA 3A64A 2ISDA 3QR3A 2RDWA 3N2MA 4TTUA 2CXEA 1XBZA 4A3HA 2FGZA 4PODA 4LWWA 7ENLA 5CZSA 3WX7A 2G95A 3P5ZA 3M16A 3DFHA 3R0DA 5DELA 2VDIA 3O6CA 1IEWA 5I6SA 4FSAA 4ADSA 5EL1A 1K8ZA 4QLKA 1RQBA 3P5YA 1KFLA 1RY8A 4NZ4A 4LYPA 2RDTA 1A0CA 1ZRQA 4ATDA 4YNGA 1LLWA 2ZX8A 3WQDA 4NJIA 5DMLA 3WO8A 2YCKX 3DUGA 3OGSA 3TN6A 1B5TA 4C6OA 2E9MA 1GGOA 3GXDA 3LLXA 1CXIA 3RLHA 3P93A 3ZSSA 1XIHA 5D9NA 2TRSA 2ZX7A 3BAWA 4OWGA 1KXHA 4PCNA 2BY2A 4NIRA 4RCXA 4ONVA 4HZ7A 3T07A 5D38A 1Y5VA 2X7WA 1X7FA 4HN4A 4I5XA 1ITQA 5E1QA 2INFA 4DYEA 3IIPA 3A5FA 3OVRA 2WWDA 4RL3A 4LYKA 3N2OA 3FOKA 1JNEA 4ZQRA 5I3KA 4D6IA 4HB7A 1HJUA 3UD6A 3HTWA 2A0NA 4E3TA 3GAYA 1B4EA 2RDUA 3TLLA 3KRBA 3AXHA 4PRRA 4NXSA 2PRMA 4O1CA 5H8PA 3H22A 3VM5A 4Z2JA 4GX9A 3VU2A 1L8PA 3ARQA 3UJSA 2Y63A 1S38A 1GZ1A 5FI8A 3LI0A 3AMDA 3CLMA 2GVYA 4RUBA 3AU6A 1THFD 5TAOA 3MDUA 4AX6A 1UD5A 3TE9A 2D1ZA 1NDWA 1OWQA 2I56A 3T42A 2OQHA 3WH8A 3ANUA 3VC6A 2V8ZA 1WUFA 1C29A 1H3GA 2CHOA 4AX7A 1W3NA 1NTHA 2CLMA 3WL0A 4LXFA 3U2ZA 3WELA 3HV9A 4B16A 2QMJA 4ZO8A 5AZ0A 4N9EA 3TJIA 3FW6A 2PGFA 2OX1A 3MCNA 5FL1A 3LD5A 4ZE4A 2FTWA 3H2CA 3KP0A 3QJAA 3PAOA 4M82A 2V5LA 1AQFA 3TROA 2Z1VA 1H7PA 4KGLA 4GCXA 2F6UA 4RE4A 3O06A 1ZB5A 1UPPA 4DJDC 4IIFA 4W8BA 1MW2A 3ARZA 3BQ5A 3GH5A 4O54A 3LLFA 4D6FA 1TV4A 1LOSA 1O6IA 1S5TA 2PURA 4E4PA 1YLVA 1MW3A 5C55A 5IDZA 3GD6A 3OHMB 1DJWA 5AYZA 3FDGA 5H91A 1TPC1 5EBUA 2JEQA 3QPYA 4EXAA 3DERA 3CZLA 4H8HA 4A21A 1UZHA 4Y2WA 4YLWA 2VMFA 2BOFX 4JFTA 3MCOA 1VPYA 3R13A 3H7UA 1VCGA 3L9CA 1A5NC 1E4NA 1RA5A 5BXTA 4IL2A 3VGFA 2CLOA 1OIFA 3I10A 1WDDA 1EFZA 4WXZA 3LTSA 1HVQA 4J7RA 3O3RA 2XH4A 2YW4A 1JRCA 3KS5A 1HKIA 2QCHA 4AMCA 1S2VA 4ILSA 2YBTA 3SFWA 1DQXA 2PDQA 2FHCA 5FKYA 3R12A 1A5LC 1GUVA 3MKCA 4QLJA 1UR9A 2PLMA 5BRQA 2QJIA 2EO7A 4NHVA 3VE9A 3WUGA 3ZVIA 1KFJA 3REQA 4I7VA 3HV8A 1QATA 4V33A 1GVYA 3TSBA 1K8XA 1MNSA 1N8WA 5F2GA 3A4WA 4NNAA 4OBSA 3I7QA 2XVPA 2QR6A 1UWQA 3QGVA 2PI6A 4IPJA 4MF4A 3VIKA 1ZAHA 1W5OA 1KXTA 4W8LA 4W85A 2D2OA 1DWAM 4UIOA 5HDRA 4JTEA 3UU0A 5T91A 2NV2A 1BAGA 3O9NA 3FFSA 3OB8A 5BROA 7PTDA 2Y8UA 4S2CA 2NVCA 2YX0A 3TOPA 2PD5A 4GH3A 4OUI