5DBTA

Crystal structure of c-terminal truncated 2-deoxyribose-5-phosphate aldolase (1-201) from streptococcus suis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
201
structure length
201
Chain Sequence
MKLNKYIDHTILKPETTQEQVEKILAEAKEYDFASVCVNPTWVALAAESLKDSDVKVCTVIGFPLGANTPAVKAFETKDAISNGADEIDMVINIGALKTGNYDLVLEDIKAVVAASGDKLVKVIIEACLLTDDEKVKACQLSQEAGADYVKTSTGFSTGGATVADVALMRKTVGPDMGVKASGGARSYEDAIAFIEAGASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight for substrate tolerance to 2-deoxyribose-5-phosphate aldolase from the pathogen Streptococcus suis
pubmed doi rcsb
source organism Streptococcus suis gz1
molecule tags Lyase
molecule keywords Deoxyribose-phosphate aldolase
total genus 71
structure length 201
sequence length 201
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2015-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5dbtA00
3STEA 3Q58A 4PCFA 1NF0A 3S1XA 2W6RA 1ZCOA 3C4UA 3PG9A 4GUFA 1K3UA 2NLIA 1DQXA 4MVAA 1C8VA 3CIXA 4O11A 5D2YA 1L6YA 3N2MA 3YPIA 3DKLA 1VLIA 4ZQRA 3B0VC 1I8JA 2X1RA 4O28A 5D09A 4MLRA 1FDJA 4S1FA 3PSWA 3UXDA 2YZRA 1OFDA 4UFIA 4ZQMA 5EPDA 5HQEA 4O14A 4ICNA 3W88A 1V5XA 3FEMA 3UQNA 1HG3A 1TCDA 3N19B 3KX6A 5AYZA 4RZ5A 2VENA 4O12A 1IIGA 4IQLA 4UMBA 3I7SA 3TSDA 1TV5A 3G0UA 3S5NA 2V2HA 2Z1BA 3ZWSA 3P80A 4MY1A 3L0NA 4R7JA 4GUJA 3NQMA 2IQTA 1BWLA 2EGZA 3LTYA 3DFQA 4RLIA 4JXCA 4FEZA 3C2RA 2ZA1A 4N6EA 1R47A 2YDAA 5EKYA 3Q2DA 4OV4A 3BW2A 2CLMA 3RF9A 2ZZ3A 4QNEA 3S5OA 1HO4A 3IIPA 3LBCA 4HNUA 1TTJA 4QQ3A 4IXHA 5BW6A 2A21A 4MYAA 3SFKA 5U4NA 1XBXA 2QUUA 4R34A 3SJ3A 3T55A 2ZRUA 4A3UA 3HG3A 3IVSA 4HNVA 5DCEA 2NXIA 2ALDA 3HPXA 3TQ0A 1J2WA 4CNPA 4O18A 3USBA 1H63A 3HGOA 3QW3A 2CZEA 3LXBA 3QC3A 5D30A 2ZYFA 4BK9A 2I14A 4MOZA 1UUOA 1KLYA 4BI6A 5LGXA 3DU0A 1XL9A 2FPTA 3M41A 1PCKA 1Z48A 4N4QA 3ABOA 3W1MA 1VZWA 2V82A 5FEXA 5L6UA 3A9IA 5I3JA 4MZ8A 5HUPA 1W54A 1B57A 3G3DA 1KBIA 3N14A 4NZJA 1ZY9A 4M6QA 4OBTA 1HTIA 1XBVA 4TX9A 3TAKA 3I65A 4O1AA 3QPYA 3RLVA 3OIXA 4R33A 2WQPA 2YCEA 1TRDA 2R14A 3GR8A 4ZQOA 1GT8A 3JS3A 3DENA 1QO2A 3NL6A 4MY8A 4FIQA 4JIQA 4OU1A 3W87A 4YWIA 3TU9A 4LC6A 3LCXA 1DJNA 4JEQA 3L9CA 2WSRA 2QCHA 2CLHA 4GUIA 2X30A 3M5YA 3UPWA 3W7LA 4U28A 3UZ5A 2CZFA 4HN4A 3STGA 4Y8FA 3NNTA 3G1YA 3THQA 2VFEA 3L0GA 3TUUA 1Z42A 5IM51 1A5CA 3EWXA 1P0NA 3TCEA 1EB3A 5K4XA 1OABA 3NQVA 2QKFA 1W56A 1ZALA 1MSSA 4JTFA 2UV8G 3NOEA 3W9ZA 5BMWA 1ONRA 3LI1A 3LLFA 4JTLA 3RNDA 3EWZA 4WOQA 3CIWA 2NWRA 5I3FA 3NL5A 4UTKA 3EX4A 2GVJA 1ZAIA 1VHNA 2EAWA 1A5SA 3LERA 1OX5A 4DBEA 3BG9A 4C1LA 3DFSA 2H90A 3WK1A 3OEXA 2VFFA 4UTWC 3HBLA 2ZRWA 3NA8A 4RJEA 3TROA 5HWMA 1H60A 3GKFA 3NAVA 3EKLA 1KFEA 1SR9A 3V75A 2C15A 3GAKA 4X9SA 2AGKA 3ZFHA 1FWNA 1YADA 2RH9A 4JTGA 3MHGA 4PL1A 5HULA 4BI7A 2YFOA 3WK2A 4JTIA 2P1FA 1F73A 3CC1A 1VC4A 2VFGA 3DI0A 5K3VA 4O50A 3ZS4A 1LLWA 1TRIA 5CKSA 3TX9A 1LBMA 1T96A 4JR5A 2ISSA 5AHEA 4GUGA 2QDHA 4O1BA 3P8JA 4CQ9A 3P74A 4OE7A 4K7VA 4KWVA 3LHWA 1EP3A 2A7PA 5F1VA 5D2XA 4JTHA 1BWKA 2DZPA 1Q6RA 3MW7A 4XBSA 3U2OA 1KFKA 4O0ZA 1G4TA 4Q4KA 4N9CA 5AYYA 4DF2A 3SGZA 2ZRYA 4Z1AA 3W70A 1FX6A 4ALDA 1TREA 1E51A 4DELA 3L65A 1TSIA 5LGZA 5KZDA 3HPSA 2B7PA 5HWNA 3C8FA 3NM1A 3F4WA 4DPPA 5I3KA 2XN1A 2ZTKA 3HGJA 2V9DA 4DO6A 2X1UA 2X16A 4DEFA 4N6FA 2JKEA 3IIOA 1DKWA 3M16A 3O16A 3CQ0A 4IPJA 3UWWA 3UWVA 1VYPX 1WA3A 4OHQA 4GFSA 4ZL1A 5SWUA 1OF6A 1T99A 1AMKA 1VYRA 3NPWA 5KZMA 1XFBA 3LTPA 4QNWA 2DZVA 1GEQA 4O54A 2DZXA 3OHIA 3PAJA 3MBFA 1L9WA 2VXNA 1HO1A 4NUWA 1AW2A 1THFD 4NVTA 3T7VA 2HS8A 4MIMA 2BLEA 5K9XA 4LS0A 4NZFA 1PE1A 3GX9A 3NR0A 1KFCA 1JRCA 3NDOA 1J4EA 3CWNA 1JUKA 3W07A 4ZQNA 1KTCA 1O5XA 1VCGA 1GYLA 2Z0IA 3M47A 4JD4A 2ZZ2A 2DZSA 1XCFA 3MBDA 4NU7A 3EXRA 1FDZA 4PL2A 3G18A 1VLWA 2Y7EA 1TYGA 2YYUA 2YW3A 5TIMA 3NQEA 3I7RA 7TIMA 4UTHA 3UWZA 5AHIA 4LVBA 1I2PA 3I7QA 3CLMA 2JGQA 1YLVA 3W7QA 1SQ7A 1SW3A 3UXAA 4M19A 3NQ2A 4MFDA 3O6YX 1WOAA 1VS1A 3NPUA 3C0JA 3HG4A 3LBMA 2WV8A 3GLCA 4W9TA 1QMLA 2BWGA 3LV5A 3WFAA 4JYDA 3LI0A 3F03K 5K4ZA 1WYIA 1TPH1 5DY2A 1RR2A 5HNRA 5F4XA 3BO9A 3C2FA 4HIBA 3BLIA 3G1XA 3HB9A 4UFMA 3TKFA 1T0OA 3W2LA 1LP6A 3CB8A 2J9YA 3QZEA 1GG0A 5D05A 3S9YA 4ZVJA 5TBOA 3QMSA 4NNBA 5DY3A 1NVMA 3FLUA 4OWGA 5J5DA 1OFEA 3LCGA 2QEZA 2JK2A 4JN6A 1R2SA 1K7EA 1WXJA 4JY8A 5G1TA 2VC6A 2V0TA 4NXSA 3MO7A 2WJZA 2LLEA 4KFNA 1RV8A 2QCEA 5KINA 2R8WA 1GTEA 1XC4A 4DXVA 1X8FA 3QRHA 3FA5A 3TA6A 2H8ZA 2HSAA 2C0AA 4NJKA 1LRQA 5DCBA 3G8RA 2X2GA 3PBUA 4O57A 2E5BA 2GQ9A 3QQ0A 1JQVA 2WO5A 2GQAA 2ZA3A 3PG8A 1G7VA 4O0KA 3P62A 1KM0A 1Q6QA 3CEUA 2QAFA 4JTSA 1H7NA 1TPFA 3TR2A 1L6WA 1JCLA 3A5VA 1M7OA 1X1ZA 5LNSA 5LSMA 2CLOA 4EIVA 1OFAA 3C56A 2R94A 2A6LA 5IBXC 3PF3A 5T26A 4QITA 1GVQA 3Q37A 2V5BA 1FQ0A 1S5WA 4CQ8A 4A2RA 4GC4A 3G24A 3MP3A 4IPIA 4JX5A 3DBPA 4CQAA 2XN2A 4O4WA 4B5NA 2Y61A 4WXYA 1H5YA 3LHUA 3KFTA 3EWWA 2GVGA 4K37A 5KMYA 2P0OA 3BPWA 3FYOA 1FWTA 4GBUA 3PR2A 2V81A 3R13A 1YDOA 4ZZ9A 4NNCA 1ME7A 5DLCA 2C18A 1MEWA 1TQJA 1ML1A 1YDNA 3S42A 3TDFA 1L2UA 1KM6A 3O07A 2Y6ZA 5EA9A 3G1HA 2TYSA 4DPQA 1A53A 1AW5A 2F7FA 1WDWA 1EWEA 5HMSA 3PC0A 3CTLA 3LM7A 1D3GA 3FIGA 1LZOA 3ELFA 3RMJA 1M7PA 3A5FA 3W7RA 3PUOA 1YDVA 2DJXA 5E1QA 3S0CA 4FXRA 1SPQA 3NO5A 1KTBA 4PFMA 1AG1O 2D73A 3TV8A 3G0XA 1S5VA 4JTUA 4AB4A 4GNJA 4UIOA 3H55A 2V8ZA 4A22A 5AC7A 3DGRA 1KM2A 1LLZA 4Z1DA 3STFA 1U5JA 1OK6A 1I45A 2O7QA 3KOFA 2ZA2A 1X7FA 1GQNA 4CLMA 1N7KA 2V2CA 3G1FA 3IIXA 3OVRA 4MLJA 3O05A 4X2RA 3G1DA 5DN1A 5CGQA 5H91A 3M43A 4DO4A 3W7IA 4AH7A 5F4SA 2NX3A 1IXPA 2VFHA 4O4VA 3IGSA 2A7RA 1QPRA 1G4SA 4TO8A 3QSRA 4JY9A 4UFKA 4Z08A 3G1VA 4XBKA 4HNNA 4ONVA 2G95A 2WKJA 5EY5A 1NFBA 1SUXA 4TMBA 1OYBA 4H4IA 1PL9A 2Y89A 4IMDA 2GQ8A 3W86A 4LS1A 3JR2A 1F6PA 3NQ6A 4LNYA 4UTWA 3C2OA 3PY2A 1YTKA 1OFQA 2ZCGA 4I7VA 1F7BA 3LGEA 1KM4A 2GUUA 1AW1A 2Q3RA 3L67A 1VR6A 2E68A 3ATZA 1SU5A 4UTIA 1JULA 3LCHA 3W84A 3W2UA 1DVJA 1VPXA 2HMCA 3L5AA 1LBLA 2ZBTA 3S1VA 1DOSA 2OZ0A 3W75A 3W1UA 5D37A 5D38A 5CSRA 2ZZ5A 4BR1A 3ABQA 2TPSA 4RCXA 3PUEA 3DI1A 3W1TA 3VFLA 1W5OA 4WX2A 3EX3A 5F4WA 3IRDA 4UMAA 1QOPA 1EEPA 5D2WA 3GDKA 1FY6A 1DL3A 4DBDA 3KXQA 2ZRVA 3P60A 5CPLA 4AWTA 3S5ZA 2A85A 3LHZA 5LNVA 4XQ6A 3E12A 4PODA 1ICQA 3CPRA 4TMCA 2FIQA 2ZDRA 4IMFA 4CCCA 3O8AA 1AL7A 3FFSA 1ZAHA 3IIZA 3W7MA 1N8FA 1SZNA 3GNDA 4IWWA 4JYEA 3A23A 5G2HA 3W1PA 2QJHA 3QJAA 3LCLA 1KBJA 4Z0JA 4AAJA 4YCPA 6TIMA 1IXOA 1FWWA 3LX9A 2NV2A 3LCIA 3P82A 4YCOA 4LTSA 5TQLA 3LRMA 1W5NA 4Y96A 1TPDA 4HHPA 3LB0A 1ICSA 1GG1A 3HF3A 3TC7A 2F84A 3S6DA 2Y62A 3M1ZA 3A21A 4U4MA 3EWBX 2I1OA 1NAL1 1W1ZA 4JYFA 1KA9F 4AF0B 1JCMP 1RD5A 4UTMA 2TMDA 1HL2A 1MXSA 3GIYA 4HNTA 4PC8A 4R53A 3LRKA 1RQHA 4FHAA 3AO0A 4AHQA 1CI1A 2I9EA 3E0IA 4CCDA 5C54A 1K03A 4HPJA 2VEKA 5DBTA 2H8XA 3GDLA 1TQXA 1VCVA 3FYPA 3EX6A 1PV8A 3W71A 1K7FA 1TB3A 5G4WA 2QDGA 3VE7A 4LVFA 3ZWTA 3N2XA 4JTTA 4WOZA 1H7OA 1T8XA 2OT1A 4YL2A 2QCCA 5BNKA 3PVFA 4HT3A 1JJKA 2VEIA 3IIVA 5D32A 2E09A 2FPYA 2Z6JA 3SZ8A 3PBYA 4N02A 3OBKA 3VE9A 1TTIA 1H1ZA 4UCGA 1KM3A 1OJXA 1SFJA 2ZQ0A 4E2DA 5I3IA 4LRTA 4NX5A 5CG7A 4FNSA 4LY8A 1WAUA 3GZ3A 3OG3A 1VRDA 1IIHA 2CZ5A 3AJXA 1NSJA 2CLIA 2NX9A 1D3HA 2HS6A 3HJZA 1WOBA 3LXCA 2AQWA 1FCVA 1H7RA 1KFBA 1PVNA 5KZEA 3LOTA 3NZ1A 2W79A 2C1HA 1RZMA 2E6YA 3O1NA 3S8HA 4UNLA 4K8EA 2Z2UA 4JTKA 2B0MA 1PCWA 4NT0A 5A5WA 5AC8A 4HSOA 1H1YA 2RKXA 1U83A 4FX8A 3M7WA 4GWEA 4JTEA 1G4PA 4LT9A 1LOLA 4IMGA 1R2TA 1AL8A 2CLKA 4YLWA 1W0MA 4DO5A 3LRLA 1MO0A 4QISA 2E6AA 5BOOA 1WX0A 3FOKA 4EOUA 3MYPA 2FDSA 4I7WA 3C61A 3SIZA 1ME8A 3NQ7A 1W8SA 3V1PA 3W2NA 4A29A 2EPHA 1P1XA 4PTNA 4RXFA 1ZJIA 3EB2A 5CPNA 5K7JA 1H7PA 1VHCA 1K7XA 3N3MA 2ABAA 2G97A 2NUXA 5CPOA 3B05A 2CLEA 4K7YA 5FEPA 3L66A 3UPBA 4IMCA 3EXSA 3OVQA 2RDUA 5G4EA 3CEPA 1OYAA 2J9ZA 4IXXA 3ZR4A 2TSYA 2YFNA 5C55A 2DZTA 1JCXA 4KKXA 1GWJA 3NM3A 4NX0A 4XUGA 4JDBA 4UR8A 1TMHA 3CM4A 4ORIA 4BWLC 3DXIA 3QM3A 1PIIA 3WJSA 2Y63A 3PB2A 4WUIA 5AHLA 1KV8A 2ATSA 2R91A 1GVSA 4Y9AA 1CW2A 3W1XA 2ATMA 1LRTA 4E38A 1D9EA 4DQWA 4MJZA 2YX0A 4ADTA 4CNOA 3DH7A 1H61A 2PURA 5FF4A 3I6RA 3SGUA 3NVTA 3TW6A 1SW7A 4J9JA 2Y85A 2QCDB 2ISVA 1DORA 1LTDA 2ZZ1A 1J5TA 4LC8A 1C29A 5LHEA 3W3OA 2NUWA 2ABBA 3NPVA 3QMTA 1F6KA 1Y0EA 4ZQCA 3EX2A 3W7NA 2A1YA 5LZLA 1DHPA 4O1DA 3TMLA 3KRUA 3UYCA 4KWWA 5ABTA 1SZGA 1W37A 5HJLA 4NJGA 4N9EA 3C52A 3W7EA 4FNRA 5HR7A 4CCEA 2NZLA 3PS7A 5F2MA 3DZ1A 3T40A 1IGSA 3RU6A 1SW0A 4IGHA 4QAIA 4OQVA 2VEPA 3G0SA 3QMRA 3F4NA 3NQCA 4MJMA 4N9DA 4YMZA 4BFAA 3R2GA 3RK8A 3P61A 2ZTJA 3UWQA 1OFBA 4UXDA 1GPWA 2E5CA 1LBFA 3L21A 2WSQA 1Z41A 4IOTA 4BF9A 1P0KA 1GYNA 1A5BA 1EA0A 3L68A 3QQ1A 4LWWA 5CPMA 2JBMA 3G1AA 1LOSA 2V2DA 4FO4A 1PHQA 2AAMA 3W1NA 4RX0A 1FUYA 2E6DA 4RKAA 3EWYA 4UFHA 1S5TA 3E02A 3SW6A 1TPWA 3BK0A 1XKYA 4JIPA 3SI9A 3LHYA 1UASA 2ZRXA 2CW6A 2CLFA 2TRSA 1YPIA 4BI5A 3GNNA 4UNKA 3P8IA 5BMXA 3PBWA 3W1RA 3E49A 1B9BA 4UMCA 5G2WA 4QIUA 4UFJA 4JICA 4NNAA 3W1QA 3H54A 1I2OA 3MHFA 3NYZA 4Z1BA 3LHTA 1XM3A 1QCWA 3DHFA 5AB3A 1JUBA 1VGAA 1MEIA 1EUNA 4IX0A 4G1KA 3W7JA 5K2ZA 1G69A 3KRZA 2B7QA 4CNNA 1EP2A 3FJLA 3IVTA 1AK5A 3HO8A 2H6RA 3NL2A 2O7SA 1A50A 4PEKA 4MY9A 2G96A 4GUHA 3MYOA 5EYWA 3NGJA 1GJPA 2JKPA 1FDYA 4MPQA 4K38A 5F1UA 1QNVA 1FBAA 3DFTA 1F05A 3EXTA 3BW4A 1SO6A 5DBUA 1O60A 5IBXA 1WQ5A 5C2XA 3R12A 1NEYA 3SSJA 3TXVA 3HGSA 5D04C 3H53A 1W3NA 4MZYA 3O6CA 3B03A 3INPA 1YTDA 4OV9A 2BXVA 1Q6LA 1OHLA 3GDRA 3BLEA 4H6KA 1UJPA 2WPBA 3DHDA 3IGXA 2WNNA 3P67A 5HUOA 3MHUA 1IF2A 3B0PA 2DORA 3KVJA 1JUEA 4HSNA 2WOQA 3M6YA 1R46A 8TIMA 3N73A 1QFEA 3HIJA 1XI3A 1SO3A 3W7DA 2WNQA 1GVOA 4M5PA 2QJIA 2PC4A 4Z0SA 3S1WA 5E93A 3E96A 5GVJA 1SFLA 4X22A 3VCRA 1XUUA 1MEHA 3BG5A 3FKKA 2A5HA 1JR1A 2GJNA 3E9AA 3T44A 1OFOA 1OYCA 4ML9A 3G8EA 4UR7A 2NXGA 3TNOA 3EX1A 5LKYA 5LNRA 3HGRA 3P81A 2RHGA 2Z6IA 1TPEA 3B04A 4L4MA 4K39A 1G67A 2YYTA 2RDTA 3DFNA 1XDMA 1GZGA 1W3IA 3UZJA 5CSSA 1EIXA 1TPUA 4EF9A 4WQ6A 5AC6A 4RV8A 3PWAA 4FB7A 3C6CA 5AHFA 1B4EA 3GXPA 1BTMA 3W7CA 1EX5A 3TQVA 4GJ1A 1BKSA 2GPTA 2OX1A 3BARA 5H2ZA 3TSBA 4UUIA 1K8XA 5D2VA 1SSGA 1W5QA 5C6MA 4YXGA 1W3TA 1VJIA 3HQ1A 2DU2A 2YXGA 2X1TA 3BG3A 3O63A 4MYXA 4MUZA 2J88A 3R8RA 3U8GA 1B4KA 1SSDA 3P5ZA 3W72A 1EPXA 2YSWA 3DFPA 1C9DA 1H51A 4DF1A 2RFGA 3LV6A 1NF7A 1F74A 3G1SA 3PSVA 3IGUA 3ABRA 1LYXA 3QW4B 1BEUA 2PCQA 4WD0A 3UNDA 2DJLA 5EMUA 1W5PA 2C16A 1LORA 3ANYA 3QYQA 5F2GA 2E5DA 3GXNA 5KITA 3LDVA 3GDMA 1LCOA 2Q8ZA 4EVZA 4XTDA 1PHWA 1W5MA 3MJYA 2EHHA 3NG3A 1ZAJA 1ZNNA 1O4UA 1KW1A 1ALDA 1H62A 1TO3A 4AWSA 3OVPA 4LV9A 4K8HA 1H50A 2ZZ4A 1ADOA 1H7XA 1I2RA 1G6CA 2CFFA 1O95A 1XBYA 3TFCA 1X1OA 1OG0A 4P2VA 4S2BA 2ZZ6A 2BTMA 3RLUA 5LNUA 1SZEA 3PULA 3UY7A 1TTQA 3TXZA 5CZJA 2FJKA 2BX7A 4UFLA 3P7YA 4UTLA 3K30A 1GOXA 1JCNA 1LDCA 3N34A 3PBVA 5MHBA 1I4NA 2B4GA 3QEZA 3NQAA 1YXYA 2QCMA 2OT0A 3L5LA 1FCUA 1V7YA 5HR6A 1F5ZA 3DAQA 3GVGA 3W7KA 2QF7A 3PB0A 4HPXA 1ICPA 3W76A 1UCWA 5K9DA 1WV2A 1N55A 3DKJA 1DJQA 2RDWA 3BGJA 3STCA 5FEZA 3M5XA 1ME9A 1SO4A 3GR7A 5L9FA 2P10A 4JGDA 3C2EA 3W2MA 4N9BA 3NXFA 4C1KA 3W22A 3KAOA 3BGGA 3C3NA 3M5ZA 4MZ1A 2PRHA 3R5EA 5FF7A 4P61A 2QUTA 3F1QA 3JRKA 5EL1A 3BLFA 4FX6M 3QSTA 3MI6A 3GK0A 4QJ1A 5AHMA 3CHVA 3N9SA 2ZFAA 3TW7A 2J27A 2QUVA 2QAPA 5AOUA 1XDLA 3MUXA 1K8ZA 4X3ZA 3O6DA 3TJLA 3MP4A 3CU2A 3KVKA 2QCDA 4FXSA 3T78A 5FEWA 3LCFA 2E1DA 2FPVA 4NJJA 3LXAA 2FB3A 1FXQA 1Q6OA 1O5KA 2DZUA 2CWNA 5D03A 3W7OA 2OMAA 4ZMGA 3KVLA 3MWAA 4ZQPA 5I3GA 2JKAA 4M7TA 2V30A 4Q33A 4MKNA 1LRNA 2BSLA 3W2JA 3ATYA 1RQEA 2VELA 4RXGA 3MMTA 4UTTA 3G22A 3B4UA 4AMAA 4WY0A 4Z1CA 1GTHA 3VI2A 2NWSA 2FQIA 3KVMA 1ZFJA 5LNWA 4PA8A 5F2IA 1JVNA 2Y7GA 1GVFA 3QF0A 1IXQA 1TJPA 3M44A 4H3DA 4O17A 1W31A 4GRSA 1OFRA 3UWYA 4LVGA 3A22A 3W74A 1L6SA 1XBZA 3QFEA 3GDTA 2GJLA 5HINA 4M7SA 3W85A 1ZHAA 3GB6A 2YR1A 1EP1A 2KZHA 3HMJG 4UTTC 3TFXA 1F76A 3FKRA 5AYXA 1TIMA 3L0KA 4POCA 2A7NA 2FLIA 3TJXA 1SO5A 1UBSA 4WXZA 2XN0A 5FF2A 2EF9A 1YXDA 1OK4A 1PS9A 5G1YA 4UC5A 2VOMA 1OX6A 1UUMA 1Z44A 3GAYA 4Q32A 4AF0A 2NV1A 2GVLA 3WK3A 4PH6A 1YPFA 3FS2A 2DP3A 3MP5A 3O15A 2CLLA 4JDYA 3P5YA 1TV8A 4IJBA 4WJEA 3W7GA 2PRLA 4NQ1A 2C6QA 1TTPA 3W83A 3NEVA 1OX4B 3M9YA 3UD6A 4FF7A 3LLDA 1MZHA 4LS2A 1I2NA 2A6NA 3N9RA 2A0NA 4A21A 3FJ6A 4LUJA 1IXNA 3MI3A 4AHPA 4M6PA 3KHJA 1QOQA 2ZRZA 3RFAA 2QR6A 4XWUA 1KLZA 5G2IA 1UB3A 4GE8A 4I9AA 3NQ8A 2FTPA 3BV4A 3SR7A 1QDSA 1OF8A 2EKCA 4LU0A 3LTSA 1I2QA 1TPB1 5G5IA 3LHVA 3W73A 4GXMA 2FB2A 2CZDA 4JNMA 1YTEA 4A2SA 4LUIA 3WJYA 5C5YA 2OJPA 3W1AA 3TE9A 2QCFA 5HWJA 2ISWA 1X6UA 4WY0F 1DV7A 3NL3A 4RR4A 4KFPA 3W7HA 4O15A 3PM6A 3SECA 1VQTA 3VKJA 1XXXA 1KM5A 4LW7A 4OT7A 3QPZA 4O10A 1YYAA 3QH2A 2J24A 3SY5A 4LVDA 1KFJA 5K9CA 5CZTA 2Q3OA 2HTMA 2Y7DA 3IVUA 5E0KA 1JRBA 4RK8A 1DBTA 3TQKA 2CU0A 2OCZA 3NQFA 5AHNA 4ADUA 4LVAA 1G4EA 3T4CA 2ZZ7A 3D0CA 3THAA 3OA3A 1B3OA 3W23A 3M5VA 1FWSA 3EEGA 4WZHA 3UY8A 1TPVA 3TIMA 1R30A 3BW3A 1FXPA 3HOJA 3PUDA 2Q8LA 1EWDA 2A4AA 2NXHA 1TPC1 2XFWA 5U7SA 4FX7A 4K6AA 4XKYA 4E0CA 2X1SA 4FNTA 4IX2A 1QPQA 2FFCA 2H3BA 1HUVA 2VFIA 3WJWA 1JCYA 1QO5A 1RQBA 1XUZA 2J6XA 4XKYB 4K36A 3GKAA 4Y90A 3WK0A 1KTNA 3TSMA 4E2BA 1F2JA 5AFDA 3NZRA 2A2IA 1JCJA 2PRMA 4TR9A 3ABSA 1FCBA 1WBJA 2B7NA 5CZ0A 1OVDA 4JTJA 1QR7A 4IMEA 1HFBA 1O94A 4XZ9A 1RVGA 1VH7A 4N4PA 3S1UA 4UTUA 4BWLA 1H7WA 5CZSA 1LROA 4O53A 2E6FA 2WSYA 4O16A 4LRSA 5EBUA 4AVFA 2YW4A 3I68A 1TV7A 4TU1A 3KRSA 4HKPA 3UWUA 4FNPA 3B0UX 2H3DA 4O19A 4FIRA 1FWRA 2C3ZA 5D33A 5J5RA 4O13A 3LCWA 4QM1A 1JQXA 5FI8A 5I3HA 4M6VA 1KFLA 3BVJA 1QPNA 3IEBA 3C2VA 4TIMA 2GOUA 4AWUA 4D2JA 1OFPA 3CT7A 4N2YA 2C19A 4KFOA 4WY0B 5DELA 1GVRA 1P4CA 3HPZA 1CX9A 3B06A 2Y7FA 2E77A 4DF0A 5A8GA 5DXXA 4L4LA 3GXTA 1FCQA 4MFEA 4OGZA 3NQDA 4NXKA 4LV4A 3TAOA 1KM1A 3W6YA 4UTJA 4EF8A 1KV5A 4AXKA 3M0ZA 1P5BA 3IV3A 5FF0A 5D02A 4EWND 1WBHA 5FESA 1K8YA 3EKZA 5DCDA 3R89A 2G5WA 2QCNA 1M6JA 3P84A 2Y70A 3TK7A 3GYEA 3NPXA 5KSWA 3B8DA 4XTIA 2YPIA 2BZNA 5AN7A 4NJIA 4S2CA 3L5MA 3U6WA 5KTLA 4O1CA 1S3HA 1R2RA 1G7UA 5BRBA 2C13A 2B7OA 1K02A 2QCLA 5F2LA 4JS3A 1Q3NA 3Q94A 4I7UA 1YXCA 4O52A 2C14A 1LOQA 3O06A 3TH6A 3MI2A 5DXYA 1A5AA 3TMQA 2DZWA 5D2TA 1LM1A 1M5WA 1QAPA 3NQGA 1TJRA 5FF3A 2VFDA 4FNUA 3L2IA 1DQWA 1OX4A 2QJGA 1Q45A 4FNQA 2VEMA 2W0UA 3CWOX 2NX1A 4IUOA 6ALDA 3WJZA 3W2KA 2J9XA 5LHFA 2QCGA 1QWGA 4ORMA 1SZFA 4NJHA 2JGYA 3TC6A 2NUYA 4LOCA 4QSHA 2YGYA 3G3MA 2VKZG 4JX4A 2WNZA 1EUAA 4AEOA 3W1LA 3W7PA 1ZENA 4Y6GA 3HG2A 4ADSA 3WJXA 1RPXA 2Y88A 3VNDA 3A24A 4RZ4A 1QPOA 3HG5A 4RZ6A 4AHOA 4O8RA 2PE4A 3S5YA 3DFOA 3EWUA 1VCFA 4JX6A 1VYSX 2V5LA
chains in the Genus database with same CATH superfamily
3STEA 3ZLHA 3Q58A 3AYSA 3CT2A 4TVDA 4O11A 1U1HA 3NXLA 2ON3A 1XJBA 1I8JA 2CWXA 4O28A 4NILA 1FDJA 1OZMA 4S1FA 2OYMA 3A64A 4NG3A 5EPDA 2BP1A 4G5DA 3SFWA 3VOIA 3E2SA 3AS3A 4LB3A 1V5XA 3UQNA 9CGTA 3AOFA 3N19B 4HMNA 4O12A 2PGRA 3VUPA 3GVRA 3B9DA 1EEXA 2D69A 3TN6A 4F40A 1ZPTA 3PBGA 3P80A 3THCA 3GUGA 4L64A 4IH3A 3TTYA 4GZJA 1UWSA 2EGZA 2BB0A 3UNTA 3GHSA 3NTYA 4RLIA 4FEZA 2JFEX 2ZA1A 3PZOA 1V4YA 3AISA 1BVZA 2ESCA 1DWFM 3BW2A 4QNEA 5DF0A 2HEJA 3LBCA 4B9ZA 1TTJA 4QQ3A 1D8WA 2A21A 3SFKA 3UW6A 1KCXA 1US0A 1IGWA 3C3UA 2ZRUA 2PDHA 3KE0A 3HG3A 1W1B1 2C0HA 4HNVA 1P7TA 1DP0A 3TQ0A 3H2NA 3USBA 4CNPA 3WNLA 2VC5A 3HGOA 3LA4A 2CZEA 1HVQA 3MUAA 3W00A 2I14A 3KBWA 4BI6A 3LSBA 2WNWA 2V82A 5L6UA 2HVNA 1FWBC 4CU6A 3N14A 1ZY9A 4M6QA 3OOQA 2RJHA 3TAKA 2WHMA 2FGZA 1TVPA 1GW1A 2QIWA 4H8UA 4A3YA 3CMFA 3BDKA 3RGTA 1CGVA 2YCEA 2INFA 5GJPA 2FTYA 3OLEA 3AYRA 1QO2A 1JG9A 4U2ZA 1M03A 4PSPA 4IUGA 1BQCA 1BRLA 3PUGA 4AD5A 2WSRA 2P8BA 3GH5A 3Q45A 4U28A 1C93A 2E3ZA 2CZFA 4TV6A 3QLLA 1UKOA 3G1YA 4GXPA 2CZVA 3GC5A 2VFEA 4EE9A 3L0GA 3TUUA 5IM51 4R7OA 3ITOA 4XD6A 1MSSA 2UV8G 3PJWA 2VZVA 4JTLA 1BSIA 1G1YA 1XPYA 5M2FX 3TYEA 4GI6A 2PDJA 3AMGA 2GGHA 2VEGA 4B9YA 4OZOA 3CLWA 3LERA 1TA3A 4M29A 3BG9A 4PB5A 3M0XA 3KM8A 2H90A 1HKVA 4UTWC 3HBLA 3BV7A 1YNQA 3NA8A 3WQVA 4B5XA 1H60A 3GKFA 4J2PA 4X9SA 2AGKA 4GZEA 1YADA 4JTGA 3MHGA 5HULA 2YFOA 4GO9A 3LK6A 3XIMA 3CC1A 5K3VA 1F4AA 4CEUC 2OR2A 3UXKA 2RGLA 4J28A 3COTA 3TX9A 3T8QA 5JH2A 1A3HA 4JR5A 4PUJA 1F07A 4QROA 3BOXA 1DWAM 1GOKA 3K1GA 4OE7A 4K7VA 4L4PA 4PCSA 5BRPA 1UR3M 1Q6RA 4MWAA 2J77A 4Z1AA 4DF2A 3SGZA 2ZRYA 3WEOA 4DZ5A 4DRSA 3L65A 2PDKA 3GS6A 2VOTA 4QEEA 5HWNA 1EHAA 1I75A 2E9BA 4A3RA 3BMWA 3F4WA 3GU9A 2KX9A 3EOLA 3MQTA 5TAOA 5I3KA 1DIEA 3RO6A 2V9DA 2X1UA 4V2XA 2X16A 1QI4A 3ITYA 4W7UA 5GNYA 1JYWA 4Q6XA 5HQMA 5DFAA 4IPJA 4W7WA 3UWVA 3IUHA 3WDHA 4OHQA 2FH8A 4GFSA 2GVYA 1OF6A 1QU4A 1AMKA 1XH2A 1KR1A 5KZMA 5A6BA 2OGJA 1GEQA 1L9WA 1RBOB 4A8IA 4B5SA 3V16A 1IZCA 4DX3A 3NVDA 4TOQA 1ONEA 3IJIA 4MIMA 5K9XA 4LS0A 2ADAA 3BAYA 2NSOA 3H70A 3TN3A 1EXPA 1X6LA 1KFCA 1J4EA 3CWNA 2F38A 1F8MA 1GYLA 1XCFA 1N82A 4AYGA 4LGXA 4PL2A 3WD0A 2YYUA 3PZMA 1A5KC 1EFZA 5AHIA 4J35A 2JGQA 3DOPA 4EPEC 3VFCA 4ZFMA 4J2MA 2Z2AA 1GOQA 2OSXA 1K6AA 3AZRA 2Z1WA 4U5IA 2WXDM 1QMLA 4GQGA 3G5EA 3LI0A 1RK6A 5DRIA 4GO8A 2YLLA 4QDMA 4LUTA 2J13A 5HNRA 3BO9A 3CH9A 3BTNA 4IJRA 4D6DA 3G1XA 3HB9A 4CD4A 2W66A 3TKFA 4GVGA 2HXUA 1UYQA 3N2TA 3IWPA 3CB8A 1V0MA 3B8SA 2VEFA 1QHPA 3QLDA 3S9YA 4FMVA 4Z2LA 1NWSA 1CNVA 3I10A 4OWGA 2XVLA 4JN6A 1R2SA 4JY8A 1RV8A 2V5DA 2A3BA 4TX6A 5KINA 2MANA 3B40A 4DXVA 1FWIC 3QRHA 3FA5A 1TVNA 5HAOA 4FS9A 1Q6DA 2HSAA 2ZE3A 2WMGA 5DCBA 3G8RA 2E5BA 3QQ0A 4PMVA 4BA0A 2WHLA 4JTSA 1TPFA 1L6WA 4LSBA 3CHCA 4GIAA 1B3ZA 3A5VA 3CMJA 2IKHA 1X1ZA 3IACA 5LNSA 3MCMA 4O1EA 2CLOA 2A6LA 4F8XA 1Q85A 3S2JA 4DYJA 2Z24A 4N7QA 1GVQA 1NQ6A 4CQ8A 3KBSA 4HMDA 4QAWA 3GXMA 3WENA 4UCFA 3UA3A 3GH4A 4HMCA 2Z7KA 1PEZA 8RUCA 1P43A 2Z00A 4V1YA 1XSIA 3LHUA 3FAWA 3KFTA 4ZO6A 2VGFA 3BPWA 1V3HA 4ACZB 3R13A 4ZZ9A 1JPIA 1YHTA 4NNCA 3L2LA 4HOZA 3GSMA 1PIGA 2VX6A 4D8ZA 1YDNA 2Y6ZA 5A3HA 3U5YA 1L6GA 4PFHA 1EWEA 3AWOA 3WDQA 3O9NA 1CDGA 1D3GA 4JNYA 3FIGA 4L80A 1R38A 2OKTA 3LGGA 4Q8PA 3H4GA 3NO5A 4AVNA 1B5TA 2F6UA 1X38A 3G0XA 4W86A 4QLJA 1QNSA 2NQJA 4AB4A 4B3KA 3H55A 3NOYA 3TN4A 1KGWA 1JXKA 3GM8A 5I02A 4UQBA 3DGRA 1KM2A 1FWFC 3STFA 4BF5A 3UZWA 5EB8A 4YTTA 1VFUA 1HKWA 3G1FA 1A80A 4MLJA 1OADA 3OVRA 2VRJA 5ABFA 4X2RA 5DN1A 1EX1A 4AQLA 3APGA 5F4SA 2VFHA 4O4VA 3IGSA 2A7RA 3CZKA 4WDUA 4D6FA 4RW3A 4M0XA 4I3GA 3TOYA 2ZX8A 2BVTA 4J3TA 3URNA 2WKJA 1SUXA 4TMBA 3LU2A 3Q67A 3WLSA 1PL9A 2Y89A 4F2BA 1FOBA 1TZ7A 3W86A 1V79A 3DIPA 1UWTA 1YTKA 5HNUA 2ZCGA 4I7VA 4H19A 1F7BA 4U3AA 3ZJ7A 3VOCA 4LNCA 1PDYA 1UBPC 3KTXA 4UTIA 4ZXOA 5DT7A 3LCHA 2PLMA 3W2UA 3WQFA 2QYGA 4DLMA 3S1VA 3W75A 1QNPA 4AU0A 5HPCA 3VX0A 2P5NA 3BE7A 1JCTA 3ABQA 4ZB2A 1Q4NX 5DRCA 2YIHA 3PUEA 3QV8A 3SQMA 2QUMA 3A3WA 5DT5A 4WX2A 3KOYA 1AVAA 1JD7A 4IHCA 1DL3A 1XYBA 3P60A 4LANA 4XO7A 3S5ZA 4JBRA 1YE4A 4B3LA 2DH2A 1K4GA 3CPRA 4XZMX 4JL2A 3N4EA 3B9EA 2VQUA 1V8EA 1DQUA 4B91A 4IWWA 4JYEA 4FPSA 1OCNA 3QJAA 2VO5A 1IXOA 7ODCA 3SJNA 3AMLA 4YCOA 3GTFA 1W5NA 5LIUX 3FW6A 4HHPA 1HP5A 5IXEA 5EMJA 2YBTA 1ICSA 3HF3A 1QVBA 2F84A 4AZ5A 4DJED 3A21A 4X0VA 1NAL1 4RZBA 2BOFX 3BSHA 2EQDA 4F2UA 1OGBA 4Y9OA 1R8LA 4IJCA 4ES4A 5CH9A 3GIYA 4HNTA 4US6A 4ZCWA 4O1FA 4PC8A 4WKHA 1RCOB 7A3HA 5CJNA 1CI1A 3ZLGA 3E0IA 4CCDA 3LPFA 2CYGA 4HPJA 1G01A 5DBTA 3GDLA 4NZ4A 1JZ4A 2Y8VA 5I78A 1PV8A 3VOFA 3ME3A 1K7FA 1TB3A 5G4WA 3VE7A 3DERA 4OTKA 4B4FA 4WOZA 3N4FA 2XSAA 1T8XA 1PKNA 1HGWA 3V0UA 3QHNA 3WD2A 7REQB 3OBKA 3WLTA 1XC6A 1H1ZA 3UU0A 1Q7ZA 1PZ2A 1SFJA 2ZQ0A 4GACA 4GVFA 1WAUA 1VRDA 2OLSA 4GY1A 1D3HA 1ITQA 1VFOA 2HS6A 1PVNA 3LOTA 2W79A 4ZE4A 2TODA 3JZEA 2Z2UA 4JTKA 2GK1B 1U83A 2V5CA 3M7WA 4PMOA 3ZSSA 3BURA 4DJDD 4LT9A 3TZNA 1VF8A 3RCYA 4JIHA 4YLWA 3UYIA 4U10A 1MO0A 1K4HA 4YVVA 3SIZA 3WLKX 4B4HA 2V69A 4G7FA 4F0LA 4S3BA 3RPDA 3FN9A 4PMUA 1H7PA 1VHCA 1K7XA 5A6MA 5FJUA 2NUXA 4J3XA 4ZSTA 3EGJA 1UOKA 5A1AA 2D24A 3TC3A 1V51A 3FK4A 4KW2A 4Z2KA 3ALGA 1VBRA 2RDUA 5G4EA 2CXGA 1CGTA 3CEPA 5ABFB 2TSYA 3SCRA 1JCXA 4HZ8A 2FGBA 3CM4A 4UR8A 4X9YA 1SJDA 4K68A 2J4GA 3OGVA 2R91A 4WCJA 1CW2A 4LXFA 4GGBA 2ATMA 4QRNA 3IANA 1D9EA 4MJZA 4DJEA 4XG1A 5FF4A 3I6RA 1JDEA 1SW7A 2YA2A 4J9JA 4DIAA 4GQRA 2TAAA 2W5FA 2ISVA 3CUIA 4W8AA 4JN8A 4LC8A 4ZTYA 1LQ2A 3W3OA 3AU2A 1UZHA 3NPVA 1F6KA 4MDOA 4PCPA 4O1DA 3KRUA 3UYCA 1Q65A 2PWGA 4P8VA 2GQ3A 3S2CA 4CCEA 2NZLA 3PS7A 5B7YA 4ROQA 1GORA 1EJUC 1YPXA 3WUGA 1SW0A 3BMXA 3CBWA 1GQKA 3SCQA 3QMRA 1EGVA 4MJMA 1E4IA 1CLKA 3BCFA 5JQ9A 1EC9A 4P7LA 3DYOA 4UXDA 3AFBA 1FTXA 3DBNA 3TJIA 3BAWA 4IOTA 4KESA 2CBVA 1GYNA 1JF6A 4GKLA 1FA2A 1EA0A 3L68A 4LWWA 5CPMA 2V2DA 4BQ5A 2Z28A 2Z2BA 1WUFA 4RX0A 4MPKA 5LIYX 2OG9A 3CQIA 1WZMA 4JHMA 1P0DA 1S5TA 2XJ7A 3BK0A 4JIPA 3CHEA 3LHYA 1PKLA 3K4DA 1WDQA 3ZVIA 3LPOA 3GNNA 1SMDA 1HL9A 1R87A 4C1NA 1MW1A 3ZLFA 1LG1A 3BAXA 4Z1BA 3FVDA 3LHTA 3EWCA 2OQLA 4RW5A 4PZVA 4RNHA 1AJ0A 1JUBA 1Q2SA 3JVAA 1BWVA 4GJIA 2PZ0A 1US2A 4G1KA 1G69A 1E0XA 1DTUA 4ICCX 2QV5A 2VUNA 3NL2A 3LQGA 2WWCA 3IJ8A 1T40A 1HN1A 2QXWA 4HU4A 3IJ6A 1GJPA 3KP1A 2JKPA 2V63A 3UG4A 1FBAA 3MUIA 3EXTA 2OWWA 2HV5A 5IBXA 1RY0A 3VABA 2G0WA 1DJZA 3SSJA 3TXVA 3SDOA 2ACUA 2O9TA 3S4TA 4H01A 1CXLA 1WZAA 3CXOA 3LYEA 2WPBA 3DHDA 2O9RA 2VDHA 5C7HA 5J8LA 3BWWA 1IF2A 3ITVA 5FJTA 2DORA 1JUEA 1XWYA 1UWAA 1S38A 2GSHA 3M6YA 3ARWA 2VC7A 3HIJA 4E6MA 1XI3A 5DQPA 3W7DA 1GVOA 4GKTA 2QJIA 4WJ8A 3FVMA 2V6AA 5E93A 3P3BA 1UWUA 3VCRA 4GIEA 4W89A 7CGTA 4D8LA 3SCWA 3BG5A 4D6EA 2GJNA 1JR1A 1OFOA 2YZ5A 4ML9A 3G8EA 3KTSA 2J7BA 4QCEA 5HMEA 3HMCA 3P81A 2Z6IA 4L4MA 2X09A 4NY2A 3SQLA 1AFSA 3ZR5A 1E0VA 1XDMA 1GZGA 1W3IA 1XSJA 3UZJA 1UC5A 1TELA 4FB7A 3C6CA 5AHFA 3TYZA 6XIMA 4M1BA 2GOKA 3GXPA 1BTMA 3A3HA 4AD2A 4KIEA 2REQA 1GZ1A 4G8TA 3EDJA 4YXGA 2ICSA 1W3TA 3DGBA 3MC5A 4HVXA 3O63A 2DSUA 1XD1A 1UC4A 2JIWA 1SSDA 3DDMA 3WNNA 1EPXA 1HJSA 2YSWA 1C9DA 3LV6A 1NF7A 1ELSA 3LN3A 3N17A 2R6OA 1CCWB 1Y7VA 2OQHA 3QW4B 3I4EA 2PCQA 3XISA 1A5UA 1DJHA 3UNDA 2C16A 3H2OA 1XDJA 3QYQA 3H4XA 2E5DA 1X1NA 3GXNA 2HROA 5KITA 1Q8AA 4F48A 1DWHM 4E2VA 4HPNA 4CU8A 4F79A 4AFYA 2Q71A 1CGXA 3DESA 3MJYA 3NG3A 4A05A 1REQB 2WZTA 3QVQA 4RDWA 3OVPA 4LV9A 2NVDA 4K8HA 4OJYA 3N18A 1H7XA 1O1ZA 1XBYA 3IARA 2QPXA 3AXMA 1OG0A 4B5WA 2OSYA 4MJ2A 4Z2HA 1AUSL 2FJKA 2BX7A 1R3VA 2FZ8A 5E09A 4UTLA 3K30A 1GOXA 3GTNA 4PE8A 1F3EA 5REQB 5MHBA 1I4NA 2B4GA 1FHVA 4KT2A 4YPJA 4HYRA 5I5RA 3L5LA 1RP8A 2ZUWA 3GW0A 1XIIA 1XIHA 4FOUA 2OGYA 5K9DA 5CSYA 4A6GA 2P76A 2RDWA 3AZSA 4I5UA 1WKFA 3GR7A 1CYGA 3M0IA 2Z29A 4QTGA 4HQVA 5L9FA 5XIMA 4N9BA 3F5JA 3EOOA 3CZ8A 3TP4A 3EA2A 5H8PA 2NT1A 3NO1A 4YNGA 3AMDA 3E0LA 1V3KA 3CZGA 5E0FA 4HB7A 2QUTA 1E1FA 3M46A 3BLFA 4Q8WA 4QJ1A 3GO2A 3CHVA 4MB1A 1XIMA 1S3TC 3ZIZA 1IT7A 1JPDX 3MP4A 1BHGA 2Q02A 2QS8A 3KVKA 2QCDA 4N42A 2YB4A 4ZOCA 2KAUC 3WUEA 2FPVA 2E0PA 4GH3A 2CWNA 5D03A 4ZMGA 1PO9A 5C7VA 3QFWA 4ZQPA 2JKAA 4L1XA 4M7TA 2V30A 1EPVA 1LRNA 3R11A 3W2JA 3MVIA 2EG7A 2VELA 3G22A 4AMAA 1NDZA 4BQ2A 3VI2A 2DIKA 2FQIA 4IG2B 4J40A 5LNWA 4PA8A 5F2IA 1JVNA 1B54A 3VZZA 2BHUA 4DAIA 2GVEA 3WBYA 3WH8A 4RE4A 2UBPC 5DEZA 1XBZA 1ZUAX 1WZKA 3GDTA 3NCOA 1IZJA 2YR1A 4NI3A 2HVMA 2KZHA 3RM4A 1RCXB 1F76A 2YL8A 5AYXA 5H8MA 1TIMA 4KRUA 3T1GA 1SO5A 2XN0A 2IPWA 3AIBA 1ZGDA 1MXDA 4ACYA 1JL8A 2OOGA 3AU6A 4AIBA 1UZ1A 4QGCA 3IJ9A 2WC7A 3FS2A 3MP5A 1FHDA 4JDYA 3P5YA 3TLQA 5I23A 3P0XA 1V0KA 2INEA 4F0MA 1TTPA 4JAWA 2ONEA 5FJIA 3ABXA 2DY3A 2IKJA 4LS2A 1I2NA 1Z6KA 1JXJA 1KWGA 2GGJA 2XM1A 4LH8A 3N9RA 2A0NA 3FXGA 3MANA 1E6NA 3KHJA 3SCOA 3RFAA 5BWAA 4CQCA 4IQEA 3RAOA 1UB3A 4ATDA 4I9AA 1E6QM 4LAKA 3LEPA 4IFOA 3LTSA 1I2QA 4Q4QA 4LF1A 3MMUA 5FD0A 4UOZA 2VCAA 2FB2A 1JIBA 3GTXA 2CZDA 1V6XA 3CWHA 3D6NA 3EMQA 1N8IA 4A2SA 4LUIA 4IIEA 4M6UA 4W8BA 4YN5A 4KFPA 3W7HA 3MT1A 3SECA 1B3WA 4KERA 5CG0A 3VKJA 4PCNA 4CGTA 1ONWA 4CQDA 1P6WA 3S1GA 1J0JA 1NDWA 1KFJA 2PTDA 5CZTA 4RK8A 2MUCA 2PSNA 5BOEA 2YDQA 3EMCA 1B3OA 1MW2A 1FWSA 2REQB 3FSUA 1OM0A 2OO6A 1R30A 2ZXQA 3WD1A 2XIOA 3WLRA 3OYZA 4R5EA 3K2GA 4DBSA 5U7SA 4HNLA 4FX7A 3U3HA 4K6AA 4MUPA 3GIPA 2H3BA 1HUVA 4UQDA 1DWGM 3OYXA 1QO5A 2PTXA 3KWSA 2OZ3A 4QG9A 3GKAA 4Y90A 1HT6A 2J78A 4MF4A 3QGAC 1NELA 3GW3A 2IPGA 3WUBA 1JCJA 1V3IA 3TYUA 1TJ0A 4HP5A 1FWHC 4RPPA 1UW9A 3ARUA 1O94A 4UTUA 2D23A 1QBBA 4HD5A 1H7WA 1A0CA 4PYSA 2W61A 2E6FA 4IIHA 1GKPA 3GHUA 1K1DA 2YW4A 4HHLA 1E6ZA 4TU1A 4HKPA 4FNPA 2H3DA 1UR4A 1FFRA 4JFSA 1VJSA 3LCWA 3MKCA 3T8LA 2I5IA 3F4DA 4QM1A 1JAKA 1R3RA 5I3HA 3BVJA 3WD3A 5A6SA 3C2VA 4N2YA 2C19A 3PTQA 1GVRA 1BD0A 1C8YA 5A8GA 3SO7A 1BXCA 1FCQA 4OBRA 1M68A 3FNDA 2C91A 3I3BA 3R94A 3T6CA 4EF8A 1KV5A 1GONA 5C8BB 5LA0A 1H1NA 4YJ5A 4IG2A 1FVPA 5EFDA 1WBHA 2GJXB 1K8YA 3EKZA 5DCDA 2G5WA 2WC3A 2GGIA 2Y70A 3MDUA 2P3EA 4J5NA 3GYEA 5KSWA 2Z4GA 3WH7A 1UG6A 2ZXDA 3BJSA 3DG6A 2CEQA 4NJIA 2J25A 2PDQA 4S2CA 4W4QA 4FP1A 2FKPA 4G6CA 4XX6A 4BZYA 3K8LA 2C13A 3W02A 4C1NB 5F2LA 4HK7A 3ICJA 4I7UA 4LFYA 2PLCA 5E9XA 5DXYA 1A5AA 4C6OA 4DXKA 5D2TA 2E1WA 3SIMA 4B90A 1TJRA 1C91A 2QJGA 1Q63A 2VEMA 1U33A 3CWOX 4IUOA 3TVAA 6ALDA 4GVHA 4BQ4A 1SYTA 2J9XA 5LHFA 2QCGA 1O66A 2HXTA 1E6XM 3OB8A 2PCEA 2JGYA 4QSHA 2VKZG 2J66A 3W1LA 3W7PA 1ZENA 4L6HA 4ADSA 1H3GA 2VZUA 2Y88A 3A24A 4RZ4A 3U4FA 4RE0A 2VNCA 3CAKA 4L6OA 4L5ZA 2GWGA 1VYSX 3WH9A 4PCFA 1NF0A 5I07A 1TX2A 1ZCOA 3C4UA 1EYWA 2Y5EA 1DQXA 3LG3A 2WLYA 5D2YA 4LUTB 2QT3A 3VIFA 4ZQRA 3OLIA 1OC7A 4MLRA 3ARZA 3UXDA 3HFYA 3GYCA 1OFDA 3T9PA 3ZT6A 4QG6A 4ATWA 3FEMA 1HG3A 3PJUA 5I09A 2H9AB 2VENA 1O5QA 4QG8A 3I7SA 4U5KA 2ZUMA 2V2HA 3UR5A 1AODA 4EACA 4MY1A 4J3UA 3L0NA 4R7JA 1JD9A 1EJRC 1EJVC 4IZGA 3VINA 2OEMA 3EA1A 3RO8A 3MZNA 3LTYA 2V38A 4JXCA 1QXLA 4N6EA 1R47A 2VR4A 3CZJA 2NV9A 1EJWC 3QBUA 3T42A 3V35A 1XSKA 3RF9A 1KCZA 3M07A 1XLLA 3TTOA 3S5OA 2JALA 1GK8A 2PTWA 2BOGX 4MYAA 5U4NA 1UD8A 4ZEPA 1XBXA 2QUUA 3QV9A 3IVSA 2HZGA 1U2YA 3EDFA 2ALDA 4RNJA 4O18A 1H63A 4AXNA 3QC3A 3LXBA 3ITXA 4BK9A 5MKGB 1UMYA 1YRRA 1M9HA 5LGXA 1XL9A 3W1MA 4BEQA 3UR8A 1EDTA 1V08A 2JQXA 5I3JA 5AVNA 1W54A 3G3DA 1HTIA 1OQFA 5BRQA 5DO8A 3WNMA 4IT1A 5LXEA 3RLVA 4AY7A 4H7CA 4R33A 1V3MA 4LCQA 2R14A 8CGTA 2PLJA 1O7AA 1GT8A 2ZX6A 2GWNA 3NL6A 2E28A 2F2HA 3WFLA 2CKSA 4DJFA 3W87A 4PBEA 4DUVA 1NY1A 1DJNA 4JEQA 7XIMA 1W1TA 4GUIA 3W7LA 3MMDA 1E9YB 4DM1A 5ABEA 3L23A 3STGA 3NNTA 1PIFA 1Z42A 1UD4A 1VBJA 1A5CA 1P0NA 3DG7A 4HHHA 1W56A 4JTFA 3OLGA 3DCPA 1TZ9A 3W9ZA 3LLFA 2QPUA 3PANA 1XV8A 2NWRA 5I3FA 3IAPA 3AYTA 3EX4A 4PUKA 2EAWA 1A5MC 5IHSA 1WDSA 4S3CA 4PTXA 3PAOA 1JPHA 3WK1A 5A6KA 3FA4A 4DJDA 5A8MA 6REQB 5HWMA 1XRSA 3EKLA 3TN5A 3EDKA 4S3FA 3LZ3A 3V75A 3GAKA 1Q13A 3ZFHA 1JDCA 4BI7A 1F73A 2BHZA 4LAOA 1ECQA 4U33A 2IQ0A 4O50A 1UH3A 3ZS4A 5CKSA 4XZWA 3ZMRA 1DYSA 1I0BA 3ZYZA 3AICA 1T96A 1LUCA 4PULA 2QDHA 3VDBA 3M0HA 3RCNA 2F6XA 1GOOA 4B2DD 4OOUA 4TQTA 5F1VA 4JTHA 5CPTA 3MW7A 3U2OA 3MSRA 4O0ZA 1YEYA 4WRHA 2X0YA 4N9CA 3C2YA 4NZ5A 5GJMA 5HPOA 4EXAA 2PU0A 4DWSB 2FGLA 1E51A 2BY3A 2DEPA 3R58A 4A8NA 1ISXA 1E5NA 5LGZA 3GTHA 1CENA 3KL5A 2WHKA 2B7PA 3NM1A 3VIOA 2VURA 5DMYA 2ZTKA 2E8YA 1KO0A 4GA8A 3AXHA 3VGFA 4DEFA 1MQRA 4WDWA 1XH0A 1DKWA 3M16A 3T05A 3O16A 3UWWA 1EO5A 1VYPX 1CBGA 1OG6A 1T99A 1Z69A 4MMWA 4YU1A 4O54A 2X0HA 4X61A 2GJPA 2ZUVA 6XIAA 2PWVA 3PAJA 4MNLA 2QIIA 3BQ6A 4GABA 2R1KA 3HFTA 4NUWA 1AW2A 2DUZA 3PN8A 3PTMA 1THFD 3T7VA 2HS8A 1J79A 1OIFA 1OBAA 4C6CA 4DYKA 4BHYA 3GC2A 1XW8A 3NR0A 5BOFA 3OZOA 4ZQNA 2X42A 1O5XA 3M0JA 3OTRA 5LA1A 4C6IA 3V7PA 2D1ZA 2ZZ2A 4JD4A 2DZSA 5BXSA 1DJWA 4NU7A 4Q3MA 4AZ6A 2EO7A 2VQTA 3U4AA 3TYBA 1EC8A 1ZP3A 2CITA 5CGTA 3UXLA 3CL7A 2VL4A 2Y7EA 1TYGA 2YW3A 3QOKA 1K8CA 3WQ6A 4H6RA 4ERGA 2RJGA 3I7RA 4QP0A 4UTHA 1OEPA 4LVBA 3CLMA 1SQ7A 3W81A 3UXAA 4M19A 2DZBA 4UB9A 4DNHA 1WOAA 1U1JA 3E0FA 1EJXC 3LBMA 1RLCL 2WV8A 4J3SA 3F03K 3L4XA 1P48A 1TPH1 5DY2A 5F4XA 3C2FA 2B31A 4FOKA 4M8UA 4UFMA 1V6TA 5J04A 3EB3A 3VKDA 1P0BA 3T2PA 4BCEA 3CV2A 1GG0A 2F6KA 5TBOA 3QMSA 3TR9A 5DY3A 4HCHA 3FLUA 1UROA 1A4LA 3N29A 3LCGA 4LPCA 2QEZA 3SAZA 5E6YA 1K7EA 5G1TA 4LAZA 2VC6A 2V0TA 2HE8A 1B3YA 1MRAA 2VZOA 3WNKA 2QCEA 2D0GA 3ITGA 2R8WA 1GTEA 3AIWA 4DJFC 3TA6A 3B8IA 4Q4RA 5LYRA 3CPGA 1BXNA 2C0AA 3PBUA 5HATA 3W0KA 1B30A 2GQ9A 3P2VA 2WO5A 4O0KA 1KM0A 1ZSXA 3CZEA 3NZQA 4CN1A 1H7NA 3H2FA 1ISYA 3VIGA 1M7OA 4NSBA 5LSMA 1QK0A 4EIVA 3C0LA 3PF3A 2A79A 3WLOA 3GG0A 2V5BA 1FQ0A 5GNXA 4A2RA 4EX4A 3MP3A 1AA1B 4L1WA 1OB0A 4IPIA 3DFHA 3CUZA 3A4JA 1FWDC 4O4WA 4LYPA 2PGFA 1XINA 3VC6A 4K37A 3VNLA 5AYBA 1W2PA 2V81A 2W9MA 3UWEA 5DLCA 4AWEA 2C18A 1K9EA 1UR0A 1DIOA 2YJQA 1MEWA 2QF8A 1NQKA 2BXYA 1L2UA 4LUYA 1KM6A 4MWAB 1Y65A 5FOOA 4E8CA 2PMQA 5EA9A 1BPLB 5BROA 1KB3A 1IEXA 2V3DA 1KXQA 3RMJA 1LZOA 3ELFA 3WH6A 2UY2A 1M7PA 3A5FA 3W7RA 3ES7A 1HJVA 4RDVA 2ISFA 3L4UA 1SPQA 4FXRA 5G1MA 4NZCA 1SJBA 1S5VA 1VFTA 1J12A 2FZBA 4GNJA 2VP8A 1QW8A 1TJ2A 4GINA 1L8NA 3FHAA 3GFXA 4DUOA 2O7QA 4C6FA 2A3LA 4IIDA 2ZA2A 4CLMA 4F9DA 3CB3A 1D7KA 1N7KA 3O05A 5FKYA 4Q8UA 1DWIM 3GBDA 2FZMA 2F2KA 4C6EA 1HW6A 1HIZA 4TO8A 1NWTA 3QSRA 2EPMX 5JXQA 3SQSA 1RH9A 3HA1A 1UPPA 4ONVA 4JCLA 2G95A 5EY5A 1H5VA 3KTCA 1DTNA 3SUVA 2PDNA 3OQ8A 5T9BG 2GQ8A 4AZIA 4LY4A 1GW9A 7ENLA 3USZA 1F6PA 2QW5A 2YXOA 3WQEA 3SN4A 4LNYA 1EOMA 3PY2A 1UA3A 3N6HA 3LGEA 3SGGA 2GUUA 1L0PA 1AW1A 4K1WA 4AMCA 3L67A 2W27A 1C7TA 1JGMA 2E68A 3W84A 3T4WA 3SCTA 1FHLA 3AS1A 1DOSA 2EPLX 3NSMA 2W92A 2DT1A 3G2GA 4NKCA 2VWTA 3VGHA 1KKOA 1EBHA 4REQA 3DI1A 4UR9A 4NASA 1W5OA 5F4WA 4UMAA 4Y9NA 1QOPA 2QGYA 1WZLA 1AH0A 5D2WA 3MMWA 1FY6A 4JIEA 4AWTA 4DHGA 5LNVA 4UQEA 3Q4DA 3GVQA 2I5QA 4TMCA 2FIQA 3EOUA 1TFVA 2A3CA 5AZ1A 3VGBA 1JFHA 1AL7A 3GC4A 1E9IA 1SZNA 3GNDA 3K4AA 4KRTA 3AHYA 4JFWA 1KBJA 3PZGA 1QW9A 4JEJA 1ZBCA 2NV2A 3P82A 3IJLA 3BLKA 3L12A 3GH7A 3CIVA 2NVCA 3LRMA 1WDPA 1TPDA 4UWMA 5AVHA 2I17A 1GG1A 1W9VA 1NWUA 4WHBA 2ZX5A 3M1ZA 5CBIA 1U5VA 3LY0A 3EWBX 4XISA 4GQQA 1KA9F 1JCMP 1E1CB 4IF2A 1RD5A 2TMDA 3HN3A 1HL2A 4U2YA 3VO0A 1HKIA 1OCJA 4NAEA 1KRAC 3IPWA 3OQEA 4R53A 4Z2JA 5DMLA 1RQHA 3ARXA 4FHAA 1FH9A 2XWEA 2H8XA 1TQXA 4HA4A 3R0DA 1VFHA 4W84A 3ZWTA 2EJAA 4JTTA 1IT8A 1U30A 2OSWA 5BNKA 1JJKA 3IIVA 1J6OA 2OZ8A 2E09A 2FPYA 1M01A 4N02A 3VE9A 1TTIA 3B0XA 1DXIA 1KM3A 1OJXA 3WDRA 5I3IA 1E4LA 5CG7A 4LEQA 2BY1A 3WLHA 1QNRA 1EGZA 9RUBA 3LD5A 1HJUA 2PDCA 1IIHA 4S23A 4S38A 2XVKA 3HJZA 1WOBA 4Q4OA 3BLOA 1FCVA 1H7RA 1KFBA 4Q4PA 2E6YA 5DX7A 2HBXA 3AIVA 2OWXA 1R86A 5AC8A 1H1YA 4FX8A 4GWEA 4KPLA 1LOLA 3KOZA 2FDMA 2CC0A 1M1BA 1AL8A 4RE2A 1TV4A 1W0MA 4XVDA 4DO5A 2E6AA 4EOUA 2FDSA 4I7WA 3C61A 3NQ7A 1W8SA 3V1PA 3MJMA 3W2NA 3GNRA 3VKBA 3HTWA 4R3UA 3W26A 1SJAA 2OXNA 2J62A 5C9WA 5K7JA 2BGNE 4DI9A 3ZJ6A 3N3MA 2HE5A 2RUSA 5CPOA 4QS5A 1PX8A 1KRMA 2UZ9A 2PEVA 2OLHA 4RDZA 2IXVA 5HQLA 3NZGA 4IXXA 3ARQA 3TTSA 5C55A 4KKXA 1GWJA 4XZBA 2OKOA 3GG8A 4JDBA 4JHZA 1TMHA 1WXYA 2YDSA 1EXBA 2PDBA 5I00A 2WCSA 1E0TA 3DXIA 2FHFA 4ZSUA 1MI3A 5AHLA 1KV8A 4AX7A 1GVSA 1TR1A 2D2OA 1ADDA 1UIPA 1UKTA 1LRTA 2YX0A 4ADTA 2BY2A 4DNMA 4I90A 1TWWA 2XFRA 3FCPA 4ZFCA 3BSGA 3TYAA 1CXEA 4C60A 5M5DA 1LTDA 1J5TA 1VAHA 3UFYA 3PZNA 4AYSA 1A0DA 4HOWA 4NHVA 3QMTA 2A1YA 4HNCA 1NOWA 1QI0A 1YMYA 4DUWA 4B3ZA 1LJYA 2BY0A 1HXJA 2Z1VA 1SZGA 4J4KA 4FNRA 3APYA 4V1XA 5HDRA 4PMJA 4PUDA 3T40A 1UH4A 4QAIA 1RLDA 4OQVA 4PGLA 3G0SA 3F4NA 3OIHA 4N9DA 1UKSA 1ODUA 4YMZA 3V1HA 2XU2A 2Y1HA 4DI8A 3UWQA 1D2KA 1UIOA 3ZT5A 1GPWA 4ZO9A 1LBFA 1PTDA 3HZ3A 3IS4A 4US5A 3ALFA 4AY1A 1A5BA 4I8DA 4JQ4A 1WXZA 4FO4A 3WEMA 1YIXA 1FUYA 2E6DA 5IOBA 4RKAA 1JZ3A 2PP0A 1M65A 3E02A 3SW6A 4HK6A 2J7DA 3SI9A 1RA5A 1F61A 2CW6A 4BI5A 1W9UA 1IV8A 1LQ0A 3PBWA 2VZSA 4RDYA 2IPJA 4UFJA 4NNAA 3VKKA 3H54A 1I2OA 3MHFA 1BLIA 3NYZA 4YVXA 1XM3A 3AJ7A 4GISA 4AD0A 1MEIA 3KBJA 5EFFA 4IISA 4PUEA 1B1YA 1EP2A 5IFTA 1AK5A 2H6RA 3PFRA 2YCLB 2OO0A 1V3LA 3U48A 1ITUA 4WDXA 4GG9A 2CPUA 1A50A 3AHXA 1J18A 3ARPA 4MY9A 4CD8A 1XGDA 3GHRA 2G96A 1GVIA 5EYWA 3NGJA 3RILA 1OCBA 3MKKA 3BCDA 5HANA 1W1IE 2VYOA 3AALA 3DFTA 4REQB 1K9TA 1O60A 5HJYA 3SUWA 4XD3A 3VGEA 3WF4A 4DJDC 3RCMA 1Q6EA 1UKQA 3QKEA 1V93A 5CPSA 4YHEA 1W3NA 1YTDA 4OV9A 2BXVA 3D46A 5CC7A 3OGRA 4TUFA 3BLEA 2NW0A 2CIPA 3I3EA 3V5CA 1UJPA 5B80A 2V68A 3ZOAA 2D2HA 2W67A 3P67A 3B0PA 2VUYA 3EAUA 3KVJA 4HSNA 1ZBWA 1AQFA 1R46A 8TIMA 3QGVA 1CZ1A 3N73A 4EKJA 4IPPA 3STPA 2D2GA 4M5PA 3W28A 3S1WA 2PBOA 1TUFA 5GVJA 2DSVA 1LL7A 1SFLA 4BF7A 1MEHA 3UG8A 3EPMA 3UCCA 4LAUA 5LXXA 2C7FA 1Z7AA 4DBUA 1T41A 2NXGA 2ACSA 3H2AA 3TNOA 3DYPA 5LNRA 3HGRA 1KGUA 4JTCA 3XINA 1S39A 4NAEB 4WDTA 3BMVA 2YYTA 4XO6A 3JUGA 2RDTA 3DFNA 1W1VA 1J11A 5CSSA 3MB9A 1ISVA 3F7JA 4WQ6A 4RV8A 2Z1KA 3PWAA 3OZPA 2DSKA 1B4EA 3W7CA 1EQCA 1EX5A 2DT2A 5CBBA 4XZLX 1I1XA 1JYXA 2QV4A 1J8VA 1TIWA 1SSGA 1W5QA 2PZNA 2DU2A 4QE4A 4MUZA 4L9ZA 2X41A 3D5HA 1PTAA 1H51A 4DF1A 1XLGA 4C7GA 3G1SA 3MUY1 3QR0A 3VU2A 4XUYA 3AXXA 1LYXA 3M0KA 4WD0A 1V02E 3QGKC 4IP7A 3HM7A 4MB5A 3HJEA 3WG6A 3NSNA 5E70A 1LCOA 2Q8ZA 4EVZA 1PHWA 6TAAA 2FZ9A 2Z25A 4IP4A 2EHHA 1ZAJA 2FVKA 2PC8A 1O4UA 1ALDA 4AIUA 3AS2A 1H62A 1H50A 4Q8TA 3TONA 1G6CA 2CFFA 4HSHA 1X1OA 4KEUA 4OOZA 2ZICA 3P93A 3RLUA 4B15A 2VGBA 5LNUA 1MNSA 4QS6A 3EMZA 4UFLA 4AEFA 3P7YA 4J3ZA 1OD8A 4D6IA 2FHBA 4H7VA 1CXKA 5D8ZA 2HPIA 2OYKA 3CASA 1JCNA 3N34A 3F4CA 1PBGA 3PBVA 3NQAA 5ABHA 1YXYA 2QCMA 2OT0A 1JNEA 1FCUA 3EZ4A 1RSCA 1V7YA 5HR6A 3MPGA 3W76A 1UCWA 4DJFD 2Y24A 1BKHA 5FAGA 3STCA 2FH6A 2XH4A 3M5XA 2PLKA 3C2EA 3KCJA 3NXFA 3AIUA 3W22A 3RRXA 2UY5A 1JZ6A 1HQTA 3EEZA 4FX6M 1V0NA 1NU5A 2PDFA 3MI6A 3WQ5A 1E5JA 4I5RA 4WSHA 2OTDA 3GK0A 5AHMA 5FL1A 3N9SA 4HA0A 5TF0A 3WMBA 3AMCA 1HVXA 1KBLA 3ZZ1A 1E9ZB 5FJOA 3KHDA 3O6DA 3T0TA 2QJNA 3TJLA 4DLFA 1TWDA 2J75A 1H2JA 4FXSA 3G6LA 1DEDA 5JMUA 2QHAA 5FEWA 3WF3A 2E1DA 4YTSA 3LXAA 1FXQA 1O5KA 2DZUA 4I6KA 4HU8A 3M0YA 3KBVA 2GSJA 4JQ1A 2BS9A 1R9ZA 3B4YA 2BSLA 3UGVA 1EL3A 4QBXA 2GDUA 4Z1CA 1UKPA 3A3XA 3T0BA 4ASTA 3BLLA 1ZFJA 3RUBL 3AHTA 4A3HA 3URQA 3NEHA 2Y7GA 1GVFA 3QF0A 4AD4A 1TJPA 4O17A 4GRSA 1E73M 4KWOA 3UWYA 3B8UA 4LVGA 1EDGA 1RJRA 3VYLA 2X8RA 4JFUA 1FH7A 3LGDA 2O9OA 4PCTA 5C0QA 3G77A 4M7SA 3W85A 2FHCA 3OZYA 1EP1A 4AIOA 1A4MA 3GBEA 3L0KA 4AZGA 4JIIX 1MRQA 2VCBA 1UBSA 4WXZA 4AEEA 1PS9A 5G1YA 4HTBA 4ZTXA 2WM1A 2Z1XA 4UC5A 1QWKA 3DHUA 2R1MA 2SFPA 2NQZA 1UR8A 2YCLA 2D2JA 4QR6A 2NV1A 5FIPA 3WK3A 3TA9A 2WZHA 4H9ZA 3W37A 4P7OA 3SRFA 3O15A 2CLLA 1TV8A 4KCUA 4MG4A 1OCQA 3MCNA 4J27A 2C6QA 3BJTA 2VT0A 1RBLA 1P7TB 3AZTA 3M9YA 4JQ2A 3NZPA 1HGYA 4HPGA 5D9NA 7TAAA 5CC3A 4WF7A 1MDLA 3M0LA 3VIHA 5ENLA 4LUJA 2WMJA 3S2MA 2ACRA 1US3A 3GVVA 1V02A 5I0DA 4ZO8A 3GNPA 2C1GA 4PMNA 1O5RA 1XIEA 3B9NA 2FTPA 3VDGA 4D8AA 4LU0A 4PB3A 4QFUA 3D3FA 1TPB1 1EBGA 1SFTA 3VA8A 2PWHA 4INFA 3WEZA 3B0YA 3ECQA 2PA6A 3EPNA 5C5YA 5CZKA 1XLDA 2DGAA 2XIQA 1RA0A 2ISWA 4EAMA 1X6UA 2VVSA 2UWFA 4C6QA 1IYXA 4QHRA 1XXXA 3SUTA 1LWJA 4O10A 4ZBCA 1TMLA 3QH2A 2J24A 3A4AA 3VUSA 5E9AA 2OZTA 4TTGA 2P3ZA 1DHKA 2DQXA 1VJZA 1W8GA 4MADA 5E0KA 1H41A 4NF7A 2AL1A 3UGRA 4XK2A 3NQFA 4ADUA 4LVAA 1CEOA 1NOUA 2ZZ7A 3FSTA 3OA3A 3W23A 3M5VA 1PKYA 3BLPX 4WZHA 4CNTA 1DJIA 3TIMA 1FXPA 2W62A 2Q8LA 1EWDA 2BFGA 2NXHA 1TPC1 4E3VA 4E4FA 4XKYA 3T2OA 1QPQA 2QJJA 1RQBA 1XUZA 4M51A 4GYPC 4JFTA 4K36A 4IIBA 5C9XA 3WK0A 1KTNA 1BG9A 9XIAA 1Z9AA 5AFDA 1H11A 1PX4A 2G8ZA 3N2BA 1FCBA 1WBJA 1CIUA 3ZR6A 3RG6A 3RYSA 1WDRA 3AHVA 3LPPA 1VH7A 1ZRQA 1XX1A 3NO3A 1YDYA 3WBEA 3E0VA 1N8WA 1C8XA 3U2EA 2WSYA 5EBUA 3KRSA 3UWUA 1Q7QA 1FWRA 5D33A 3CV7A 4O13A 1POJA 3ZT7A 2WZEA 5JIPA 2OELA 2QQ6A 3HQNA 1Z32X 4D72A 4M6VA 1KFLA 2CETA 3IEBA 1QOXA 3NJ3A 1OFPA 2XSXA 2Z27A 4KFOA 5DELA 3CT7A 1ZJHA 4WY0B 4XAFA 3HPZA 1OT2A 4NL1A 3G1RA 1BGAA 4KIRA 2QMKA 5CAHA 3GXTA 2DZAA 4QCFA 3TAOA 3M0VA 1IQ8A 2WB5A 2GGEA 1P6CA 3M0MA 2PP1A 2FYMA 5D02A 3TOPA 3EOSA 3QQWA 3MV11 5FESA 2QCNA 1M6JA 1FWAC 3B8DA 4XV0A 3TTQA 4DJEC 2BZNA 3DC8A 3SN0A 3L5MA 1AD4A 3U6WA 4O1CA 1S3HA 1TMQA 3RX3A 3RR4A 2YBUA 5BRBA 4AZ7A 3W24A 1ZBKA 3UESA 2I5GA 4Q8MA 1Q3NA 1UWRA 1YXCA 4O52A 3DYMA 1LOQA 1TUXA 3O06A 4GYJA 4HK5A 1LUCB 3R8GA 4W8LA 4MKSA 3NQGA 3KL3A 1J01A 2DVXA 2VFDA 5A6BD 1Q45A 4IQJA 3NFUA 3WJZA 1YNPA 2XVPA 1S5MA 3E74A 4NJHA 3F2CA 4MNMA 2WBKA 3TC6A 2NUYA 4LOCA 1PZ3A 2YGYA 1JEZA 4QLKA 3OZMA 1WAWA 3VNDA 1GVYA 1QPOA 4RZ6A 3S5YA 1Y5XA 3RPTA 3VMPA 3LNMA 1YKWA 1RP9A 3REQB 4AISA 4P5UA 3QHMA 4KGLA 1VZWA 3S1XA 4Y7EA 2W6RA 3ARVA 2DUXA 4GXWA 2NLIA 4MVAA 1C8VA 3VC5A 1L6YA 3N2MA 3YPIA 3DKLA 2X1RA 4HMEA 5D09A 2ZUSA 1OGGA 2DFAA 3PSWA 2G50A 4UFIA 2VTFA 4O14A 1K77A 5JVLA 3W88A 4WLCA 5E5CA 1IIGA 1LWHA 4FR6A 4UMBA 4IPLA 4BJHA 1TV5A 1V6UA 1ISZA 3G0UA 3PZQA 1OSEA 3ZWSA 1UJQA 3P14A 4GUJA 3NQMA 3VPLA 3FHQA 3TEVA 2NSXA 1A5OC 2IQTA 1BWLA 1XLFA 3S6OA 3MKVA 3DFQA 3DECA 3ZXWA 2IUZA 1NDYA 4OV4A 2CLMA 2ZZ3A 3GQYA 1VBUA 1HO4A 3WUFA 4HNUA 3LPGA 1K9DA 4R34A 3WL0A 2ZADA 2ZE0A 3SJ3A 3T55A 4A3UA 1NH6A 3CQKA 2NXIA 2PDWA 3HPXA 2VX5A 4ERIA 5M03A 3ENLA 1S1RA 3H7UA 5ECVA 5A94A 3QW3A 5D30A 1V03A 3CQJA 1UD3A 1UUOA 4MOZA 1DXEA 1KLYA 2GL5A 1PAMA 5I6SA 2FPTA 4D6JA 1PCKA 1Z48A 4N4QA 3ABOA 5A6TC 1IR2A 1S2AA 1YE6A 5FEXA 4AW7A 4WJXA 1B57A 1KBIA 5F7UA 3PFMA 1XBVA 3AMKA 3I65A 1GOIA 5JH1A 2VDIA 1Q6FA 3S2NA 3VNKA 1JDAA 1WCGA 2WQPA 3SUSA 1W6TA 5BWFA 1TRDA 4F0SA 4GMEA 1IT0A 4XZIA 4ZQOA 3JS3A 3DENA 4JIQA 4OU1A 4RE3A 3VNMA 4YWIA 3V5OA 2WYSA 4GYFA 3FEQA 2J7FA 2CLHA 3VD4A 3WSUA 2X30A 3M5YA 3PPCA 3UPWA 2HK1A 3UZ5A 2XINA 4IQDA 4HN4A 1NTHA 4Y8FA 3THQA 1J0KA 5D8WA 3WF1A 3EWXA 1EB3A 5BXTA 1OABA 5K4XA 3NQVA 2PD9A 2QKFA 3IUIA 3BXWA 1MW3A 1ZALA 1JAEA 3NOEA 2O56A 5BMWA 1AQ0A 4F4RA 3TJ4A 4WOQA 2IQDA 2YL9A 4UTKA 1EZWA 1ZAIA 1A5SA 4DBEA 2Y5SA 4C1LA 1W9DM 5C9ZA 5A8PA 4GNKB 2ZRWA 4RJEA 4FZIA 1F8IA 3FDGA 3WQCA 1KFEA 1SR9A 1Q6GA 3UA4A 1BGGA 1WE5A 1DJGA 4CD6A 4PL1A 2PWEA 4JTIA 1B0IA 2P1FA 2VGIA 1AZ2A 4GGHA 5LA2A 4C5YA 2VFGA 4ZR8A 1UR2A 1WKEA 1LLWA 1TRIA 2V3EA 1JZ8A 4H8VA 1D3CA 2ISSA 2J7CA 5AHEA 2IS7A 4WSJA 4O1BA 1UHVA 4NRSA 3VDAA 3LHWA 2XGZA 1HJQA 2A7PA 1KQZA 1MZRA 1E0WA 4Q6JA 1NJJA 4IIGA 1BWKA 2WMFA 2DZPA 4H1ZA 1W32A 1UQZA 4E5TA 4Q4KA 5AYYA 3ZO9A 3QY6A 1G9HA 3W70A 4ALDA 3FX4A 4DELA 3CYJA 3WMCA 5CXPA 1EZ2A 3WX7A 2IXUA 4DPPA 1GOMA 3H6OA 3HGJA 4G56A 3VM7A 4DO6A 5C2GA 2XG9A 2OVLA 5A2BA 4KF1A 4B92A 4N0RA 4N6FA 1U1UA 4MWAC 4B5UA 5SWUA 4LJ3A 1VYRA 4DZHA 3NPWA 3LTPA 4TVCA 3PZUA 1S46A 2VXNA 1HO1A 3UXIA 1J10A 4I8YA 3WFZA 4QE5A 2NT0A 4LAMA 1PTGA 4NVTA 1EDQA 3H12A 4IFRA 2GGGA 1PE1A 1HNYA 2B81A 3LS9A 1I1WA 2P8CA 4LBSA 1IHIA 3NDOA 3PZTA 1MDRA 1JUKA 1KTCA 3SRKA 4NYUA 3CJPA 2G3FA 3VCNA 4K8GA 4PTDA 4EXBA 2ZUTA 5PTDA 1ITCA 3T0AA 3MBDA 3P6LA 3KBMA 3EXRA 3AAMA 2VZTA 1FDZA 3A47A 2DPEA 3G18A 4JNZA 1J2BA 3R25A 4JPGA 2X7VA 1I2PA 3EA3A 3I7QA 1SW3A 1CGYA 3WQPA 3E1F1 4S3EA 3CGTA 3NQ2A 4XAPA 4F9JA 3O6YX 1NFGA 1VS1A 3C0JA 3GLCA 3S9IA 4W9TA 2WJFA 1KCKA 2BWGA 3LV5A 1M04A 3WN6A 4JTQA 3TNBA 3WFAA 3TTEA 2BVYA 4XSLA 4U3CA 3BLIA 3OO2A 1T0OA 3KOXA 6ENLA 1P1MA 4D6HA 3W2LA 2BGSA 3O6AA 2J9YA 3WLQA 3ID7A 3QZEA 4ZB0A 5D05A 4ZVJA 4NNBA 2DH3A 1OFEA 1BFNA 2JK2A 3UT0A 1WXJA 1Z8AA 4PMQA 2WJZA 2LLEA 1NOFA 3OBEA 4M1RA 3O2LA 1X8FA 1J0ZA 3VDCA 2H8ZA 2D0FA 1ITXA 3EBVA 2WVTA 3GFZA 4C6DA 3K46A 4NJKA 3ZM8A 2X2GA 4O57A 3QPEA 2XGBA 2P53A 4H2HA 3VOHA 2ZA3A 2ZC8A 1Q6QA 4C5ZA 3K8MA 5AY7A 1PB0A 3AWNA 4X0NA 4HU3A 1JCLA 1X6NA 3ONCA 5D9OA 2R94A 1PKMA 4EPKA 5T26A 3ZQ9A 1Y5VA 3G24A 5AC5A 6PTDA 2O55A 4JX5A 3DBPA 1W1YA 3OG2A 5A6AA 3UERA 4B5NA 2Y61A 4WXYA 4QE1A 5FACA 3URBA 3FYOA 7REQA 3ERPA 3W01A 3BAIA 1YDOA 5I03A 1JNDA 3GG7A 3QC0A 3A4XA 1ME7A 4QJ3B 1TQJA 4PMZA 1ML1A 4A8RA 3S42A 1GGOA 2OU4A 3TDFA 2CHRA 3O07A 1MUMA 3IRSA 2OOFA 3G1HA 2TYSA 1A53A 1AW5A 3U5UA 5HMSA 2ZUUA 3PC0A 1J0HA 3CTLA 4QJ4B 3PUOA 1YDVA 1BG4A 2DJXA 3JZUA 5G4HC 3THUA 3S0CA 1EQPA 4PFMA 3RDKA 2E7FA 1DE6A 2D73A 1ONXA 3TV8A 1RD6A 4YYCA 4UIOA 1KXTA 2V8ZA 3NUKA 3H21A 4A22A 2WAGA 6CGTA 5ABGA 3WLLA 1WKDA 1LLZA 1RY8A 1U5JA 1OK6A 2XHYA 2WMIB 1TV2A 1TE1A 1EHNA 1ZJBA 1GQNA 4DYEA 2V2CA 4WSKA 3GXIA 4PTWA 4W7VA 3PTDA 5A8NA 3M43A 2FZDA 1IXPA 3OW1A 3UZYA 1OT1A 1QPRA 2C1IA 4JY9A 4FOJA 4UFKA 1EC7A 5MF5A 1CTNA 3MSDA 4HNNA 2OPJA 1NFBA 3VIMA 4PUUA 4H4IA 3Q65A 4NP7A 3HV9A 2CESA 1CB7B 4JTDA 3NQ6A 1GHRA 1OFQA 4MJ4A 4V15A 4IMAA 5AYIA 1D8CA 1KM4A 1QATA 3CL8A 5CJ5A 4S3JA 1VR6A 3ATZA 1SU5A 1JULA 4WGHA 1JZ5A 4GYPA 2HMCA 1ENUA 3ANVA 1XGEA 4URIA 3ORWA 2ZBTA 2OZ0A 2DIJA 3N1AA 5D37A 5CSRA 4BR1A 5BU6A 2TPSA 4RCXA 3UJRA 5JBEA 1B3XA 3W1TA 1BTCA 3KL0A 2EPKX 1EEPA 4M81A 3GDKA 3KXQA 5CPLA 1SJCA 4G1NA 4XQ6A 2DUAA 1VEPA 3PBMA 1CPUA 3FA3A 2PS2A 4CCCA 3O8AA 3FFSA 3IIZA 3W7MA 5ECUA 3VGDA 1XGZA 5G2HA 1WP6A 3A23A 4H9VA 3W1PA 2QJHA 3LCLA 6TIMA 3MCOA 3V5FA 4RNFA 3EKGA 3LCIA 1B9ZA 4LTSA 4Y96A 2WVSA 4X2PA 3LB0A 3SCVA 2ACQA 2ZX9A 3N3TA 3BOLA 3S6DA 2Y62A 4NAFA 1VIZA 2H9AA 1MWOA 3QOMA 4AF0B 1EO7A 2AL2B 3GE7A 4GIYA 3UCQA 4A4AA 3CK5A 2JIEA 4H6QA 4MB3A 3AO0A 3VZXA 4AHQA 1DIKA 3UJEA 1K03A 3FV9A 1FP9A 2PDYA 1FWEC 2WVVA 3FYPA 4IM4A 3VVGA 2QDGA 1JDFA 1CXFA 3C0SA 3M4HA 5MKGA 3N2XA 4C6MA 3DFYA 1H7OA 1S2TA 1A5NC 3KLKA 2CHOA 2QCCA 1W3KA 1VFFA 1UWQA 2Y4SA 2Z6JA 5BU9A 3PBYA 4UCGA 3PK7A 4NX5A 1E4MM 2OEJA 3L4VA 2X1IA 4LY8A 2J7EA 4R9XA 4PBFA 2G41A 1GEHA 4GCAA 3N2CA 3I6TA 4PRTA 1ZZMA 2NX9A 1C9WA 2CLPA 2QDDA 5KZEA 3NZ1A 1RZMA 4OUEA 1LL6A 2PFHA 4E3TA 4UNLA 3WD4A 1A47A 1J96A 4K8EA 1CT5A 4GZIA 1PCWA 4NT0A 1TWSA 5A5WA 3CHDA 4GQBA 5HMFA 1Z89A 4JTEA 2HISA 2RKXA 3AUJA 1EYEA 3IGHX 3UBPC 2FMOA 1X98A 2PF0A 2ZOXA 1A5LC 1R2TA 4MHBA 1C92A 5GPRA 2CLKA 1I60A 4QISA 2WM0A 5BOOA 1GCYA 3MYPA 3H26A 3POCA 3VD7A 2EPHA 3A4WA 1PJ9A 4PTNA 4RXFA 3EB2A 5CPNA 4ENLA 5AKQA 5I7GA 1FH8A 2CNCA 2ABAA 2G97A 3WQOA 2BDQA 3IAQA 5T91A 3B05A 3IK4A 4GCXA 4K7YA 5FEPA 1MYRA 3ZJKA 4BQ3A 4Q8OA 3L66A 3KW3A 3UPBA 3RR1A 4IMCA 4YS1A 3OVQA 4L9XA 3T0CA 1OYAA 1FWCC 3ZR4A 3DC0A 1RALA 3NM3A 4NX0A 1O68A 3PPGA 3VAVA 1RVKA 4HCLA 3R4IA 3AXKA 3H2MA 4L56A 3BZJA 3WJSA 3UETA 4JFVA 3FGCA 1EJSC 5C71A