1MFVA

Probing the role of a mobile loop in human slaivary amylase: structural studies on the loop-deleted enzyme
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Probing the role of a mobile loop in substrate binding and enzyme activity of human salivary amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords alpha-amylase, salivary
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mfvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mfvA01
1JDAA 1I1XA 4D6HA 3B9EA 2E8YA 1UR1A 5HNNA 1E5NA 1HXJA 2WZHA 4AZ7A 1HTYA 2X0HA 3VGEA 2B31A 4P7QA 3WNMA 2W92A 5TD4A 1TFVA 1G9HA 3CUHA 5ABFA 4DUXA 3N15A 4UFKA 5EFFA 3TA9A 4UFIA 4HZ8A 4FNTA 3QGVA 1V02A 2ESCA 1TQUA 3S2CA 3PTKA 2ZUNA 2D73A 3AROA 2WLYA 2GDUA 1EIBA 3S5ZA 3TTSA 3HG2A 3MKKA 4TXEA 2ZXQA 3SCNA 2WHJA 4J3WA 3S5YA 3W81A 1K9EA 3KL0A 2ZUVA 1DWGM 2HISA 3N13A 3BCDA 1J0ZA 5IFTA 1VB9A 4W84A 1UH2A 4FMVA 1JDCA 1TVPA 3PZQA 3TOPA 2VCBA 3WNOA 1E1EA 3CHDA 4F8XA 1UA3A 4S3JA 3VMPA 4AZBA 2YLLA 1TE1A 4RE2A 3VIPA 4AEFA 3VGFA 1CTNA 1XYFA 2YFNA 3HMCA 1Q6FA 1NP2A 2X2YA 3CUFA 3WMBA 4BCEA 3VMOA 5I77A 4WKAA 1MFUA 2XFFA 2DSVA 3AXHA 1ZB5A 3L4WA 2QHAA 3SURA 4A3YA 2JEPA 3PZIA 3MSGA 1E15A 5CSYA 3TP4A 4M29A 1C91A 2GUYA 1OD8A 2WMHA 1PPIA 2X09A 2F7OA 3W38A 5BXRA 1S46A 1XH1A 3BLKA 5E0FA 2G3JA 2F61A 2OYKA 3AHTA 4HA1A 3RILA 3WQVA 1C7SA 1K9TA 4BZYA 3KL5A 5ECUA 2AOSA 1C3FA 1NQ6A 1BYDA 1CLVA 3AISA 2WBGA 4D6FA 3II1A 1UWTA 3ARZA 4DM2A 1HL9A 1KR1A 1WZLA 1VBUA 1B90A 3WDJA 2BY2A 2WXDM 4W89A 1UYQA 3WIJA 1V03A 4DWSB 3EDKA 2XM2A 2G3IA 2VVNA 2YKKA 3AYSA 2XIIA 3VDHA 5A6KA 5D9PA 5CPQA 3SIMA 3A4WA 5EB8A 2VI0A 2GJXA 2XWEA 4TUFA 1OSEA 4Z2HA 2O9RA 3ZOAA 3CUIA 4AMXA 4P7NA 1DWHM 1C8YA 1U30A 1CNVA 1VIWA 2W62A 1TMQA 1FH7A 2Y8KA 4Q22A 3WBEA 3WY2A 4N42A 3GXTA 3GBEA 3EJRA 1GOQA 1MVYA 2W91A 3OGVA 3K1DA 4YN5A 1RD6A 5CLWA 3AICA 4AD4A 5DMYA 2F7QA 4WIWA 1UASA 2ZWZA 3T09A 3WMCA 4FLRA 1UR8A 2UY4A 2ZX7A 4B3LA 2DEPA 1KWGA 2YL8A 1CEOA 1XHGA 5BWFA 3AFBA 2EXOA 3ZM8A 5A6BA 1BG9A 3A23A 4C7FA 2GK1B 1CZ1A 3L4TA 1BYAA 2WHMA 3TV8A 1SFSA 2XGBA 2EEXA 3AS1A 1LL4A 1ZBCA 4PMDA 2NSXA 3CZ8A 3SCOA 1V6XA 4V2XA 4ACZA 2WMFA 4KH2A 1ODUA 4PCSA 1ZBWA 2VR4A 3BVUA 1QNRA 1KFWA 4XZBA 1D3CA 3PZGA 5A1AA 1CGTA 1SMDA 4MDPA 2V3EA 4LGXA 3H53A 4MB4A 1C8QA 1GOKA 3KEHA 2XIBA 1HT6A 2V38A 1FP8A 1MQPA 3POCA 1QHPA 1SR0A 3WY3A 2A3EA 2OSYA 2XVPA 3WL1A 3A24A 1JFHA 3K46A 2EJ1A 4E8DA 4MNMA 2WWCA 3E1F1 3F5KA 4MDOA 5A2BA 2J75A 4WK9A 1PX4A 3T2PA 3OZPA 3D5HA 1E70M 1UR9A 5ABGA 1HKMA 5HBFA 3WDRA 3CHFA 4KRTA 4Z2JA 1PS3A 3D4ZA 1GQLA 2VNCA 3CZLA 2FHCA 3ARVA 3ECQA 3WD3A 5FCZA 4BS0A 1VF8A 2BXZA 4D1IA 1XSKA 1GPFA 1KXVA 3TTOA 4ZXOA 3VKKA 3UG5A 3OA5A 5ABEA 4N0RA 1QWUA 3MMWA 2MANA 4NF7A 2E3ZA 1FFQA 2CXGA 3SCTA 4GXPA 3ZT6A 2VZOA 3O2LA 3MI6A 5I2UA 4J27A 2WVUA 3VIMA 4OIFA 3FW6A 2YLAA 3QR3A 1G94A 3DECA 3BVTA 2BS9A 1TA3A 4A3HA 1UKPA 4CN6A 3WUGA 1EO5A 1BFNA 1CBGA 3U57A 4UQCA 1M04A 4D6DA 3GYCA 3DHPA 5FL0A 3PZNA 2CNCA 4M24A 3AIWA 3L2MA 1GOOA 1UR4A 1EHNA 2VT0A 3AXXA 3DDFA 1R85A 2IGTA 2IXVA 4GZEA 4AD2A 3MUAA 3VM7A 2YBTA 3LPGA 3BSHA 2WCAA 1KGWA 3WH8A 1UD6A 1KQYA 3AHVA 3NDZA 2O92A 1VFFA 4PYSA 3CZKA 2D3LA 2PWHA 3LX9A 3BMVA 1UWIA 3VGGA 2XHYA 2J7GA 3L4XA 1TQVA 1KGXA 1U33A 3T2QA 1QI2A 3DYOA 2ZX9A 2VRKA 5A8QA 3BH4A 4PMNA 4D6EA 1KTCA 3AJ7A 5A6MA 3BGAA 2OWCA 1ESWA 1E55A 3DYPA 3BUIA 2XTKA 3AZTA 4MB1A 2CESA 1K6AA 2EACA 3HU7A 3O6AA 4F9JA 3AXIA 3G6LA 1FHLA 2XSBA 1VAHA 2F2HA 5E6YA 2DIEA 1WDSA 2DT1A 4QCEA 1X6LA 3M46A 1F4AA 3UCQA 1PEZA 3BAXA 2C7FA 1D7FA 3WSUA 4PSRA 2OYLA 3MU7A 1XD1A 2WB5A 4D6JA 3THCA 5M3WA 1Q4NX 1GJUA 3UG3A 3VGHA 3AIUA 1UQZA 6TAAA 2ZUUA 2VZUA 2WZEA 3NCOA 3RM8A 5A2AA 1K9DA 1TZ7A 3EJQA 2J8FA 3WQ5A 2WHLA 1UR0A 3A22A 4W8BA 1ZBKA 1MW2A 1E6QM 1JZ3A 1BGGA 3EJPA 2GK1A 4GIAA 4U3AA 4GI9A 3DX1A 4LYRA 1XGZA 3ZSSA 1B30A 2G4FA 1VJSA 4UZUA 4MB3A 3ZJ8A 4BQ5A 1XSIA 4DUVA 3NSMA 5IFPA 2WANA 4IISA 1TR1A 4NRSA 3RPMA 4M8UA 1UG6A 4MJ4A 3KWXA 2E8ZA 3PZ9A 3SUVA 3WD2A 3MUZ1 1KBKA 4FK9A 4LYQA 4R27A 2WBKA 2JF7A 1GOMA 4JCLA 3LPFA 2EQDA 4ZXLA 3BC9A 4R5EA 1W9DM 4NI3A 3A3HA 5I24A 3CMGA 4H04A 3A4XA 1AQMA 5A8PA 2VMFA 3EBVA 4UQ9A 4MJ2A 2XVLA 3BVWA 3VNZA 2QV4A 2G3MA 4J3SA 4AYGA 1W1PA 3QOMA 5CPSA 3AQUA 2WCGA 1VEMA 2XUCA 3QHNA 3WQ6A 4QP0A 1VEPA 1NWRA 1W3HA 5A3HA 1PJ9A 1B3VA 3CLWA 2X8RA 5FIPA 5GNZA 5JIPA 4B16A 1VFMA 5I0DA 1L8NA 4UTFA 3BAYA 3HG3A 4ML4A 5IXEA 1TA3B 2GFTA 2CBUA 1U2YA 3VDAA 5E6ZA 4UNIA 3AHYA 1QW9A 3I3DA 2Y24A 4LX4A 1LL7A 3ARPA 4MNJA 5A8MA 1W32A 3LXAA 3CH9A 3AS2A 4F79A 5KEZA 1B31A 1R34A 2AAAA 2Y8VA 2C8NA 1B3YA 5I6SA 1XCXA 2JALA 3ZR5A 3RM9A 1LWHA 1V3KA 3ALFA 3ARQA 1JYVA 5AY7A 1FA2A 2V5CA 1VFOA 1XC6A 2X0YA 4EE9A 3AZRA 1E73M 4HA4A 4MNKA 3ARUA 3GXDA 1MXDA 4S3KA 4W8AA 3WL0A 3EDEA 1NOWA 1WDQA 1IZJA 1JAKA 2Q8XA 3WD0A 2EAEA 5IHRA 3ALGA 1CXKA 2DH3A 4OBSA 3VOCA 1V6YA 1RP9A 2CBVA 1E0VA 3MSDA 1J10A 4WJXA 4CU7A 1F4HA 3CZJA 5KZ6A 3IAQA 3WH7A 3AS0A 1X1NA 5CGMA 1ZBVA 2GDVA 3H55A 1R75A 1SMAA 3VMNA 2EABA 2NT0A 1HXKA 3GNPA 3VM5A 2IUZA 3W82A 1O6IA 4AIOA 4OOZA 1LG1A 4AZ5A 3VSUA 5AC5A 5DO8A 3O9NA 1KXTA 4GO9A 1OT2A 3AIVA 3EJUA 3WNKA 3F5JA 3CZEA 3GNRA 1J0JA 5I23A 1V6UA 4H7VA 4JFTA 2J7EA 4F66A 2O9OA 3CUJA 4QLLA 4AZGA 3GXIA 3WNLA 3FAXA 3WBAA 5GPRA 1DTUA 3EMZA 2PWFA 1SYTA 2QLYA 2WPGA 1MYRA 5HPCA 4DO4A 1OD0A 4AD5A 1MW1A 4M80A 5CG0A 3OIHA 5AYIA 5M03A 1QNOA 1LQ0A 1IT0A 1MWOA 2OYMA 1EDGA 1DEDA 3PZUA 4PTWA 3TTYA 1AMYA 1GW1A 4L4PA 3ZSTA 2WAGA 2YDSA 5DEZA 3U7VA 5A69A 2YIHA 3BUPA 1E4MM 3OBAA 1NM9A 3WD1A 1IZKA 3VO0A 4WSJA 3SEPA 4AZCB 1W3JA 4PTXA 3WKZA 1DWFM 4JFWA 2BNJA 1CGYA 2D2OA 4HU8A 1IV8A 1HF6A 2XVNA 3AMKA 2YDRA 2X2IA 3K4DA 4B15A 3NUKA 3DX2A 3CHEA 1US2A 3GH7A 3WEOA 4HZ7A 4UOJA 1XCWA 4EK7A 3VD9A 3HG5A 3DX3A 4JKLA 5FL1A 2PI6A 4FNPA 4GZIA 3BLPX 4PMYA 3RMEA 1GJWA 4D1JA 4CVUA 3SCVA 2VRQA 1KGUA 4W86A 4CUCA 3AI0A 3ARYA 2XYLA 4X9YA 1RPKA 2PB1A 3T0BA 3UETA 4L4OA 3FXYA 1BF2A 1BVNP 1QI3A 3WN6A 4TX6A 2D0HA 4OZOA 5I78A 2ZXBA 2D22A 3VSTA 5E09A 1MW3A 5DT7A 3D4YA 4JZ5A 3CTTA 5JBFA 2J25A 1WDPA 1TQSA 2VC9A 4AZCA 2WW5A 4RL3A 1VBRA 3AZSA 4CD7A 4UQEA 2CPUA 3T2OA 1GQKA 5BRQA 1GHRA 2EPLX 4AY1A 1LJYA 4PMZA 4AEEA 2JIWA 3GXMA 5EBAA 3PZVA 1DHKA 1H3GA 1QNSA 1NH6A 2WK2A 4ZE4A 1E6SM 1OGSA 5DF0A 2PC8A 4AD3A 1HVXA 2ZUWA 3WY1A 2FGLA 3SCPA 5CXPA 2VJXA 4U31A 4M81A 1OB0A 5D9NA 2VTFA 3EYPA 4M1RA 1KR0A 3CZNA 1WZKA 1JL8A 4J3VA 4PMQA 1W3KA 3A21A 2EPKX 5CLTA 3LXCA 3CZGA 3EJTA 4LQ1A 7TAAA 1DWAM 2YOCA 3CPUA 2BVTA 5BROA 4QLJA 5JBEA 1GHSA 3BUDA 4F9DA 3ZMRA 3MS8A 2BHUA 4MAZA 3WDIA 5A6SA 4AYSA 2Z1KA 3WUFA 2A3BA 1EHAA 1QHOA 2GVYA 1EXPA 1W2VA 1EDTA 3W26A 1E4NA 4WKHA 1PIGA 2XPKA 4TTUA 4HMCA 3W0KA 1VEOA 3WQ4A 3VU2A 2OW6A 2PBOA 1ITXA 2NW0A 1E3XA 5E70A 1UWRA 1UKQA 1JI1A 4TVUA 1OIMA 4HOZA 2ZX6A 4E4PA 1J0YA 2PWEA 1W3LA 4U5IA 1CXIA 1MW0A 1BAGA 1O7DC 3IANA 8A3HA 1MXGA 4EAMA 5HXMA 3BAJA 4W93A 4MNLA 3W29A 1ISYA 1NARA 1EGZA 4CN4A 1W9VA 2EBNA 5C70A 2J77A 2X2HA 1JZ5A 3ARTA 1BSIA 3F4VA 2HVMA 3VPLA 1UUQA 3CIVA 1QI5A 5CJ5A 2D0FA 1OT1A 1QOXA 2XWDA 2E9MA 1HN1A 4EKJA 2FH6A 3N17A 1JZ7A 4H41A 1H41A 2ZWYA 1J11A 1WP6A 3K4AA 1HP4A 4HMDA 1H1NA 4BF7A 3WELA 1JGIA 3QHMA 3MV01 4YPJA 3W6LA 2VR5A 1BTCA 3PBGA 3CO4A 2OWWA 4OUEA 1E5JA 1KB3A 1L0PA 4HZ6A 2CKRA 4XB3A 1KTBA 4AISA 4X0VA 4KGJA 1O7AA 3TTQA 3DYMA 5JUVA 1YHTA 4AD1A 1UHVA 3PZOA 1CGVA 1A3HA 1QBAA 1W2PA 4FNRA 1LLOA 3ZT7A 1JZ4A 4QAWA 4FNUA 2EPOA 5CGTA 1HJWA 1WKYA 5A6JA 3GH4A 2ZICA 1W9PA 4EANA 1HWWA 5FKYA 4JFSA 3WMSA 5C71A 4D71A 1R7OA 1H0IA 1FHDA 1H5VA 2J79A 3NDYA 1CYGA 2NT1A 2YFOA 1CLXA 3EMQA 3HJEA 3OLDA 4U2YA 3J7HA 4GZJA 3CHCA 3VIKA 4LPCA 4W8LA 1TQTA 3UG4A 1E6XM 3ZJ6A 4CD8A 1I75A 1QNPA 2XSAA 4DO6A 1V3IA 2WMKA 2Z1SA 1PBGA 4W5ZA 1Q6CA 4AD0A 1E0WA 1CENA 4KGLA 2YL6A 3NSXA 2J7FA 3DX0A 2VRJA 3ARWA 2VO5A 2WZIA 4KRUA 4W88A 1WB0A 4CCCA 3IGUA 4ATWA 2WKGA 4DWSA 2Y5EA 2ZUMA 3ZJ7A 4HU0A 5I5RA 1W9XA 1R33A 1DP0A 2XGIA 2YBUA 2WCSA 1AQHA 2V3FA 4DM1A 4B3KA 1W9UA 1B0IA 3EDJA 2JIEA 1VJZA 2WMIA 3WQ8A 1UOKA 3VIJA 3A5VA 3ZT5A 4UQBA 1J12A 1BYCA 1QVBA 3HG4A 1QI4A 1H4PA 4OJYA 2F7PA 3U5YA 1C7TA 1G01A 1C90A 2XM1A 4TVDA 2FH8A 2BVDA 1CIUA 3GBDA 1HKJA 3WNNA 1TCMA 3VIIA 1UA7A 5A6LA 3N04A 4GINA 1UKOA 5DT5A 1QNQA 1CECA 5A6AA 4HP5A 4NZJA 2W63A 3LRKA 2J74A 2ZUTA 5BRPA 2DT0A 3T0DA 3WFLA 2GJRA 4AW7A 3WFZA 1ISXA 1VENA 3AYRA 3T08A 2DDXA 4CU8A 2F8QA 1CGWA 4E2OA 5AC4A 4Y7EA 1M53A 4J28A 4UQAA 1XRVA 3FAWA 4M56A 2WC4A 3AOFA 3NIYA 5F7UA 2WM0A 2E4TA 1H2JA 1J0HA 1G1YA 3VGDA 2F1AA 1E56A 3B9AA 3OGRA 1V3HA 1B1YA 4PSPA 2EPNA 1E1FA 4JHZA 3W24A 1ISZA 3SCQA 4X0NA 2BFGA 1TUXA 3WH9A 2WNWA 1JAEA 4XZWA 3WENA 3HN3A 2VZVA 1J9YA 1ODZA 8CGTA 4H8UA 4JAWA 3MUY1 3W27A 4C7DA 3WEZA 2VX6A 2DSZA 4U33A 1CXFA 1BQCA 3BCFA 2CCRA 3AMDA 2VL4A 5D9MA 3WUEA 3PN8A 1HX0A 1ZU8A 3WH5A 3OZOA 2WMGA 4Z2IA 1BYBA 1OBAA 1M7XA 2A3AA 2OLHA 3D51A 4JHOA 4DWSC 4J3XA 1R47A 3WDQA 2XG9A 2WYSA 2YL5A 4P8UA 3W53A 1EQCA 5BYWA 4Q7NA 5FD0A 7CGTA 2E40A 4UFJA 5A8NA 2D3NA 4DUWA 4W5UA 2WC3A 4ZEPA 3RJXA 3VIGA 3KE0A 4PRWA 4AIEA 2D0GA 1JFXA 3W28A 2VOTA 4CD4A 3POHA 3VVGA 1JYWA 1UZ1A 2WMJA 3VX0A 3I3EA 1RP8A 3TONA 4AZIA 4DWSD 3NYDA 4P8VA 2BV9A 3L4ZA 5ABHA 1BG4A 3VGBA 1BGAA 2DSUA 5D4YA 1E43A 2PF0A 3SUTA 2ZOXA 3GH5A 3W25A 1GNXA 4XX6A 1JF6A 1B3XA 4P8XA 1NP0A 1ISWA 2G8ZA 1JG9A 3RIKA 2CHNA 2D1ZA 2VX5A 3IAPA 2AMGA 4W7VA 4MTVA 2UY3A 3LRLA 2DGAA 4HPHA 5JBDA 4CD6A 3VD7A 1UH4A 2DSWA 2WVSA 2DH2A 4PUEA 4IPLA 1HJSA 5E1QA 1C93A 1EH9A 2ALWA 3ARXA 1ZJAA 4QDMA 3APGA 2XVGA 3JUGA 1OM0A 3B9DA 1GCYA 4FNQA 3KZSA 4BA0A 2VZTA 3LMYA 3ZO9A 1W91A 1GVIA 1X6NA 4QFUA 4RE4A 3A6OA 1JF5A 2YA0A 2D23A 3GM8A 2FGZA 3D50A 3RDKA 1HNYA 3PTMA 4XV0A 1OIFA 1J18A 1M03A 2O9TA 2D24A 1EOMA 1V0MA 1GOWA 4PTMA 2VCAA 3RM4A 1HKIA 4P7LA 4IM4A 1Z32X 1PAMA 1C92A 1RH9A 5ABFB 1ISVA 3ZIZA 3UEQA 5I79A 1OINA 1SZNA 1JNDA 2XN1A 4D72A 5E9AA 1JYNA 1V3LA 4YHEA 1CXEA 3AMLA 1H0GA 3KL3A 1WCGA 3AS3A 2UWFA 4PEEA 4WSKA 1WDRA 1WNOA 3VIOA 2E9LA 1E6ZA 3NJ3A 1YQ2A 4CVWA 1P6WA 2BY3A 2JEQA 1V6VA 4NSBA 4AIUA 1EOKA 1XYZA 4B9ZA 3WH6A 3DX4A 3CGTA 2F1BA 3EDFA 5HDRA 2XJ7A 4AMWA 1R87A 3VUPA 1KCKA 1V6WA 4UFHA 3OB8A 2WKLA 4NZCA 1KCLA 2CKSA 4D6IA 3IK2A 1HJVA 1GOIA 3AHZA 3IJ9A 2ZUSA 3ARSA 1ECEA 1KQZA 1R8LA 2J7CA 3RJYA 3WQWA 3IJ7A 3ARRA 1HL8A 2ZXDA 2YA1A 5LA1A 3MMUA 1BVZA 3W37A 2BHZA 1C8XA 3RCNA 2VZSA 1A47A 3VINA 2J7HA 2QPUA 1E4IA 3W6MA 1QPKA 1JXKA 3WF4A 4W85A 3OLGA 2V3DA 1DWJM 2YL9A 4NRRA 4FLOA 1Q6GA 1UKTA 2FHBA 2UY5A 3SUWA 4LXFA 1ZL1A 3SCWA 3HZ3A 4GQRA 1AVAA 3L4VA 4NXSA 3ZR6A 1MQQA 1V0KA 3BAWA 1V02E 1E6RA 5GNYA 2FE0A 1CGXA 3VD4A 3N1AA 1V0NA 4V27A 3CBWA 4K68A 4UFMA 1M01A 1GVYA 1AQ0A 1T0OA 5A2CA 1W9BM 1QWNA 7A3HA 4FF5A 2V3GA 1UWSA 2WVVA 1E6PA 4AWEA 4XUYA 2E0PA 2X2JA 4CU6A 3FHAA 4IPNB 4Z2GA 3A47A 2DSKA 4OOUA 3K8LA 4HMEA 2WSKA 4ZE5A 4AMCA 1QX1A 4CCDA 3G6MA 1VRXA 3ZJKA 1WZMA 1HIZA 3GTNA 2ZX5A 1HJUA 4ACYA 3FN9A 1EO7A 5M17A 3T0AA 1CWYA 2BXYA 1J0KA 3BXWA 1GONA 3N18A 3PZMA 3VSVA 5C8BB 1UWQA 5E0CA 4CCEA 4H8VA 1QW8A 2W4XA 1UD5A 4KWUA 4GO8A 3WNPA 3CMJA 5CZKA 1E4LA 2F18A 1E40A 4B9YA 1QI0A 2WMIB 3QOKA 3BAKA 3K8KA 3VIFA 3LPOA 1WAWA 2VVSA 1OGGA 1J01A 4TTGA 4HTYA 2X1IA 4NX0A 2W5FA 4PN2A 2FDMA 1UKSA 2CIPA 2GSJA 4PMRA 2J47A 2XN2A 2W66A 4KMQA 4JIEA 2YDQA 3BLBA 4RE3A 4M82A 2DQXA 3B8SA 4CN1A 5HPOA 2VURA 5JIWA 5LA2A 1B3ZA 3CUGA 4MB5A 3GXFA 3DHUA 1JD9A 1BPLB 3MMDA 2EPMX 4J7RA 3AIRA 6CGTA 2PWDA 2O9PA 2JF6A 1UWUA 2J7DA 2CBIA 3QHOA 4JFVA 3UESA 2BY0A 2FYVA 4HA3A 1J0IA 2V5DA 1WZAA 2QF8A 4QCFA 3WF0A 1NWTA 3OG2A 4QLKA 3BMWA 1B9ZA 3M07A 1W1YA 5EMYA 2DPEA 2OSXA 2VQTA 1XD0A 4MPKA 1UR2A 5BCAA 5BXPA 3N9KA 2CYGA 2YJQA 2OWXA 5I3DA 3CC1A 3KLLA 3WF2A 2F7RA 2CERA 1E0XA 4FLSA 4PBGA 3N12A 1EDQA 2G41A 1UH3A 3KLKA 4PCTA 4OKDA 5CPTA 3VX1A 1QBBA 3SUUA 1JD7A 3RO8A 1MFVA 3PZTA 1JYXA 3PHAA 2VQUA 1FP9A 4PMXA 3LRMA 3SCSA 2CBJA 1PZ2A 1PZ3A 4JL1A 4A4AA 3EJSA 3AMGA 1E3ZA 3GDBA 6A3HA 1WE5A 3VILA 3BUQA 4CD5A 4HOWA 2Y2WA 1D2KA 4MAVA 4UCFA 2WVTA 2XN0A 5GNXA 2ZIDA 1K9FA 2WLZA 3W4RA 4UFLA 1JZ2A 1CGUA 1E6NA 1KBBA 3EMCA 1TVNA 9CGTA 4FLQA 3FNDA 4URIA 5GQBA 2D20A 3ZQ9A 3THDA 4OBRA 1OGBA 3VDBA 4AZHA 4JCMA 4J3TA 4UR9A 4U3CA 4AXNA 2J78A 4HPGA 2EO7A 4HOXA 3NSNA 5A95A 1VFUA 2DT2A 4ZFMA 4JFUA 3L2LA 3VTRA 3L4UA 2WC7A 3K8MA 4J3UA 4CKQA 1FFRA 5D8WA 3M7SA 1HJXA 1PX8A 2Y4SA 2J8GA 5IDIA 1WO2A 1V0LA 2RGMA 4ACZB 1LL6A 1OWQA 4GQQA 1G5AA 3AIBA 1HVQA 3BVXA 3A4AA 3U5UA 4BQ2A 2PWGA 2EADA 2WWDA 4PMUA 3LPPA 2QPSA 1Q6EA 3SCRA 1W1VA 4UOQA 4GPNA 1BLIA 5BXTA 2ZX8A 3F5LA 1JXJA 2W67A 2CEQA 2FHFA 1E9LA 1GQIA 1XV8A 3U7BA 1LWJA 2E9BA 2CETA 4TOQA 1E71M 2WHKA 1US3A 2A3HA 1GORA 1XH2A 3WDHA 2OSWA 1I1WA 3VD3A 2QMKA 1Y7VA 2BHYA 3BUBA 1UD3A 3OGSA 3AIEA 4JL2A 1EA9C 3OLEA 3WUBA 1B3WA 3MO4A 4PMOA 5LYRA 1R86A 4BQ3A 3BVVA 1UQYA 5FOOA 3N11A 1OCQA 1KXQA 2VUYA 3DC0A 2G3NA 3L4YA 2A3CA 3H54A 1LF1A 4PTVA 3MANA 2BY1A 2UY2A 4UQDA 1TG7A 5M5DA 2XFRA 4W7UA 3MV11 3LXBA 4OGZA 1H09A 2VX7A 4H2CA 3M6DA 4ZENA 4ATDA 3VIHA 2JFEX 5DFAA 3SUSA 4WLCA 4AC1X 1CXHA 2WVVB 2IXUA 3WEMA 3FHQA 2QMJA 1NOFA 1XH0A 4V28A 2CITA 4W87A 4YHGA 1ZS2A 1MQRA 2VCCA 1GQJA 2GJPA 4ATLA 1LG2A 3PTQA 2BVYA 1UD8A 3D3AA 4UOZA 5A8OA 1CDGA 4GKLA 4H8HA 4UZSA 1HP5A 4NXKA 5A94A 3AIQA 5D8ZA 5BXSA 2J4GA 5A6BD 5CSUA 4IUGA 2J62A 3BAIA 3FY1A 1TQWA 1NWUA 4NZFA 3BSGA 3WY4A 4Z2LA 1R46A 1H11A 1CXLA 2C0HA 2YA2A 1JIBA 3UR7A 4D6GA 2ZXAA 1UD4A 4JKMA 1NWSA 2W61A 4AZ6A 3GXPA 4P8WA 3GNOA 1V08A 2XVKA 2VX4A 3OLIA 1JDDA 1W1TA 4GI8A 4DO5A 1HJQA 1JZ8A 4JKKA 1H49A 4Z2KA 5HOSA 5LA0A 3CZSA 1FH9A 1PIFA 1GZJA 4P7OA 4U2ZA 2GJXB 4U5KA 4PUDA 1PX3A 3IJ8A 1HKKA 1WPCA 4E8CA 5CQ1A 1JI2A 3WF3A 3GZAA 4MADA 4WKFA 4P7RA 1G0CA 1KWKA 5AYBA 3MUIA 4PMVA 4FNSA 1XSJA 3CV5A 3AMCA 2OW7A 3AHXA 4TVCA 2DIJA 1JNEA 3SCUA 2TAAA 1UD2A 5EFDA 4TX8A 3S6TA 2JE8A 1UZ4A 4GI6A 2RGLA 1BHGA 1DWIM 2CHOA 1ITCA 1E72M 1QHZA 3VNYA 3VDCA 3WDPP 3WF1A 1NOUA 1FH8A 1GUVA 3VD5A 3WD4A 4WF7A 2DT3A 2XFYA 3UERA 4C7GA 1Q6DA 2X05A 4CGTA 1R7AA 3D52A 1V3MA 2PBGA 3I3BA 4LYPA 1FOBA 2J7BA 3UR8A 3EDDA 4D6CA 2ZE0A 3GXNA 4BQ4A 1V3JA 1KXHA 3DDGA 1EQPA 5D9OA 1B2YA 1ZJBA 1JZ6A 1N82A 1CPUA 5IHSA 2WSPA 4W7WA
chains in the Genus database with same CATH superfamily
3QO1A 1KCSH 3U4KA 5D32A 1EVTC 3LEVL 5TBOA 1E5NA 4MJIA 4P57B 1D6VL 3INOA 3N42F 4WHCA 5IBTL 5C0EB 2XXFA 4TSAH 3PNWB 4Y1SA 3CN2A 4M7LH 1TJMA 5KWYC 3ARFB 4D0CA 4U1KB 1Q72L 1HTYA 3VTTA 2BRRL 3W57A 2X0HA 2HFFA 1ETJA 3O06A 4C5YA 5F2GA 1ADQA 3WNMA 2QAPA 1NQBA 4GXVH 2W92A 1Z9PA 5IIEB 3QYQA 2R2EB 2P48B 3N15A 1NWPA 5DJ0B 1IB5A 4FXGA 3S2NA 4HPYL 1Q8AA 3UTTB 5L2KB 3NSDA 4FNTA 3QGVA 5IWLC 2RDXA 3S2CA 2Z26A 4FQHA 3RVUC 3AROA 3K6SB 3X12B 1O1ZA 3B9VA 5GRZA 4Q9QH 2ACRA 3E8UL 1JK8A 4X8CA 3GIPA 3IFOB 1Z9SA 2GLKA 3F4CA 1NBYB 4K7FB 4XZUB 2HP4A 4LF2A 1WHOA 2EVHA 3BRDA 3MRLA 2YXWA 1HH9B 3L3KB 4UIOA 2XTJE 1OAZL 1AZCA 3HG2A 3O9WB 3QO0B 1DVSA 3BIKA 1DQDL 3IFLL 3MKKA 2XWBB 2DZWA 2ZXQA 4M5ZL 3M8OH 1DJGA 4RFNC 3SO5A 1MQKH 1E5UI 2QGHA 1NANI 2D31A 2NTSP 3S34L 1UM4H 1B3OA 5EBWA 1J96A 3MJ7B 8PAZA 3EBGA 3S5YA 4C6BA 4NKCA 1F42A 1FH5H 2HISA 1NMAL 1NC2D 1YC8A 5DQDH 5EU7E 4GP5B 5F3HA 5EEVA 3NZ8A 1HQRB 2R83A 3CK0H 3BQUA 5GZND 1AJ2A 1SFDA 2E6QA 3PPSA 5T3ZL 4ZZFA 3H9ZA 4ZB5A 3OX8B 2GAZA 2IQTA 4JVUA 1ZHBB 3TWYA 3TOPA 1RZGB 4K5PA 1GXEA 5E99H 4AKQA 1TPEA 3FA3A 5E9DA 5HGBA 4ZMNA 2W0UA 4NX5A 3APDA 1A7OL 4JX5A 4F8XA 1WOAA 1QWGA 4IRJB 2L04A 2DWEA 2CBTA 2KDGA 3CYJA 4RGOL 1WBZB 2DVXA 4J8RA 4QOKE 2DQIL 2XXCB 1WD9A 3D07A 1ZHLA 5EZJB 4F15B 5C0EA 1UUNA 3TEYA 4ZSUA 4AZBA 3ES6B 4F2BA 2R1PA 5AB1A 3VIPA 1QAPA 4C6MA 4MM1A 1CTNA 5IB4B 4ERIA 1K6QL 1HCYA 4PGCB 4A7UA 5FKAA 1XYFA 3QUMH 2B7PA 5GGUB 2HMID 2X1UA 3SPIA 1HCVA 4BCEA 3PHQA 1J05A 3TA3B 3IDJA 5KANI 1A6WH 2CBOA 5D2TA 3AXHA 3GHBL 2IQAA 3UWUA 1R9XA 3SURA 4OLXH 4JN1H 4JRYD 4CMHC 1LLWA 1JPTH 3MSGA 4XD6A 1OWRM 1IEWA 4NOFA 4S3CA 3JWNE 1AZZC 5E2VH 3BKCH 3FQWB 4M8RA 3RI5K 1NC2B 2ENJA 4H9TA 3UJIH 1T1WA 4Q4IA 5EIQA 5LUMA 1K85A 1C91A 1A3XA 5HGDA 4U1MA 5INCA 1SFHA 5BXRA 3N2XA 4DN1A 2DJ4A 2X4QB 3O6KL 1NAL1 1HEZB 4XNAA 1COBA 2AXFA 5BS0B 2QCFA 2CAKA 3GHUA 3FQRA 2O6CA 4IRZH 2HYMA 5E0FA 2F61A 4QYOB 3JZUA 5HJLA 2QDGA 1N59A 1Q0YH 4WSHA 3RILA 3FMGL 1UZHA 4EQ3A 1PTGA 2NNCA 4M8QA 3SIKA 1SN2A 3PDDA 4WEVX 3ZQWA 1AKJA 5ECUA 2AOSA 1N70A 1EUNA 1C3FA 3VYPA 2Z0BA 2FTAA 4O0KA 4RNIA 5I8KL 5C55A 2QF7A 3TN5A 2WBGA 1TPH1 4A22A 3DMMD 3FJTA 2H8ZA 1G7UA 4HHLA 2HMIC 5ANHA 2VKZG 3PUGA 4D6FA 1FG2B 4K0OA 3DPBB 3SPJA 5KVFL 1UWTA 3ARZA 5A2KH 2Q3RA 3M1BB 4PJHE 4ANVA 4LF1A 2DQGL 2AANA 3QDMB 4O51A 1YPFA 4AE0A 2ZRXA 3E38A 2GQHA 1DN2A 4EIUA 3BOLA 3LCLA 5I16A 3QIUB 3BKYH 5DQ9A 1UYQA 2DMGA 3CSGA 4DWSB 3EDKA 4JTEA 1YJDC 2PXYB 1PLCA 3ZL2A 1BOGA 1VGEL 3RAOA 3R1GL 2VVNA 2BFVL 4F2UA 3QLLA 1HYSC 1UUOA 5BQDA 4WVXA 1H15A 4HPOH 3BW9A 3QDAA 3LHTA 5A6KA 1DORA 1XISA 4Z0BH 2YO3A 5EB8A 2VI0A 3QCUL 3N44F 2PPGA 3M5XA 3VTAA 1PIIA 2GJXA 1MZYA 1T4KA 4JMXA 1OSEA 4TUFA 3URQA 3VKCA 4UAOC 1EGJH 5KJ4A 2BOLA 4IQEA 3P80A 3CUIA 3FU3A 4ZPVB 2ZXEB 1FSKC 4MS8D 4NO0B 1SW7A 4I90A 3PG2A 5CCZA 3SJ3A 4JJ5B 3SDAA 2P0OA 1O5PA 3U25A 3Q48A 4DJFA 3OB0K 2AKRB 3NJIA 4N8VG 4CNPA 1W3TA 1LEIA 4R53A 1VIWA 2R8SH 2GSMB 1FH7A 3C0QA 1X5AA 5DJ6B 4Q22A 2MHAA 4AUUA 2P24A 2AQWA 4KCVA 2BNUB 4PUKA 5CBBA 3FONB 3QZMA 1OF6A 3QQ3B 4FABH 3QWOB 2HRLA 3BP5B 3FK3A 3KM2A 4UV4H 4F58H 3W5MA 4YN5A 4G6JL 5C0AB 1FAIL 4NSKB 4YEEA 1GPOL 3NSCA 1A0EA 3AICA 2F54E 3PL6A 4FXFA 1VERA 2XN9E 1NFIA 2AEQL 1ME9A 5D2YA 3T09A 2C4FT 4OIBA 2WJ5A 4FLRA 1NDYA 3A5FA 2K4AA 1YEFH 5I28A 3BQVA 4QRUB 3LMJL 1DJZA 3EEGA 1BZDA 1KWGA 1TSHA 2K3HA 4KX9A 5E6UB 1I3RB 1HYSD 1XR2A 3V8CA 2OA9A 3CDGA 1PKOA 4WVRA 2QL1A 5HHXL 3L4TA 5HYSG 5JIMA 1IGIL 4KKNA 4WWKA 4O28A 3PQYE 1TFPA 2VZ1A 4C55A 3DOIA 2AJZA 2C1OA 2L7UA 3EGSA 4JHWL 1L4IA 5HHOD 4AGOA 1WYJA 2WQUA 2WHMA 2JI1A 2EEXA 2PLCA 4QXTB 4GIOA 3QORD 3KD4A 5DGRA 3U48A 2KZBA 1ZBCA 4Y4HD 2QPXA 2JJSC 5I17A 1V6XA 3LLDA 1CVSC 3USBA 1HILB 3EFFA 4LIQE 2L7QA 2BCMA 5AVSB 4Q56A 3TA3C 1KD0A 1S6NA 4TVSa 4KH2A 1TCDA 2P42B 3UAJC 3G22A 5C2CA 3OPUA 4IHOB 3UX9B 2Z1XA 1GG1A 5T1KD 3LEYH 4QTFA 5F7YC 4HUNB 5IBLC 3VGAC 1VDGA 1UP0A 3F12B 4GY4A 3R4IA 3VC6A 2E7LA 3GJFB 3L5XH 4B5ZA 1PV8A 4X61A 1KFAH 5DCCA 4NYLA 2V3EA 5TDNB 5BXFA 3D3VA 3TIEB 4LGXA 1LO5B 2G0LA 4PJEF 2HLFD 5G5DB 3UJTL 3TDFA 1L6GA 3RRXA 4F20A 1GOKA 4LUJA 3O2DH 4APXA 2XIBA 4Q89A 2Z4QA 4PY7A 1PCKA 1HGYA 3AREA 3PM6A 4PUMA 4EN3C 2JELL 2I5GA 1QHPA 3OXRA 3NFSL 4FD0A 2GJZB 5HDLA 2X7WA 1S5IL 2NYKA 3N55A 3TXAA 5IW1A 1FFNA 2IJ0C 4JM0A 1JRHL 2PU1A 2XVPA 4PJ9C 1YEEH 4E8DA 1SN0A 1H3PH 4D9QD 3ALWA 3OZ9L 4N2FA 2V67A 1G87A 1HQ4A 3KW3A 2QJGA 2KH2B 4IRSC 5A2BA 4WK9A 5DUBB 3KLDA 3QUZA 3CN0A 3IGXA 4OJFH 2QCGA 1R85A 2TYSA 5JQ9A 4K3EH 5MEQA 2NLIA 4TQEH 1ZA6A 3L81A 1A6AA 1OF2B 4XOCA 5LGHL 1UR9A 3QPXH 2DQUL 3OPZL 5ABGA 2ACUA 4PG9A 3KYOB 1MI5A 1BVWA 3JYCA 4MQXC 4HV8B 4YBHA 4N90E 1JFQH 1FNHA 3IGLA 1WWAX 3G5XA 2VC7A 1L6ZA 4I77H 2FZ8A 2TMDA 3R12A 5B3NA 1FVPA 2PLKA 1BIIB 3FH8A 1TSRA 1T20A 1E8XA 3WTWA 3L5AA 4BS0A 2ADGB 4OZFH 4NHVA 2BXZA 2DQWA 4ZQCA 5HYQB 5HJYA 4R4BA 4NJJA 1GPFA 2ZZ5A 4LMQI 1W1ZA 1D9KC 3IK4A 3KDPB 4G1MA 3CLFH 2Q7YB 2X6MA 2HFTA 3OKNB 3WJWA 3BIBX 4HWZA 4E42B 2MANA 4NF7A 2DWEB 3WOVA 4D9RD 2I69A 1OP5H 3MJ8B 4UMCA 4NPJA 4GXPA 3QORA 3TH2T 4LNCA 5F7EH 2VZOA 4P07A 3E2SA 3D5OF 3JTTB 3MBXL 4J27A 4OCNC 2OFQA 3QJVB 4P2QA 2AZAA 5GZNA 4MNGA 3A4EA 1JZEA 4P5KB 3DTDA 5TE7L 3AM8A 3QR3A 2DQTH 3BSZL 2BS9A 5JMUA 1AR1B 1NGYB 5FAAA 4FAMA 1NCAL 3I50H 1XIJA 3I6RA 5CSBA 1L8PA 3GNDA 4QAMB 2CJUL 1PEWA 3I6KB 4CW1A 1KLZA 2INZA 3N3MA 3GJFK 4E4PA 1MCNA 2YRBA 2WIMA 4PH8A 4CN6A 4JRYE 3WIHH 1EO5A 3U82B 1NFBA 4KQ4H 5IHWA 1CBGA 5EMJA 1M04A 3GKAA 2HRHA 2OMTB 4D6DA 3PC0A 3N4FA 3K5RA 1ADOA 2CO7A 3NA9L 4IJ3B 5FL0A 4NNAA 1YDNA 1F5WA 3QDJE 3FQNA 1U22A 1ED3A 2XWTA 3D39E 2IFGA 1HIML 4GJIA 5DS8A 3TESA 1VP5A 2VFEA 4GY7A 3W73A 4BEIA 4ZXBB 3SY6A 3W7OA 1BQHB 3ATDA 1ZUAX 1JWMB 1MNUH 2ITDA 2I16A 1UC6A 4G9FD 3WGUB 1ZLWK 5BW7A 1UA6H 1OADA 2ALRA 2FIQA 2OR2A 4HHGA 4K73A 2MOVA 4ODXA 4X5PA 3VM7A 2YBTA 3S5NA 1YEDB 4FOMA 4EUPB 3GIVB 3H3PL 1KN2L 1EJOL 1QPXA 4WI3A 3WH8A 1L2UA 1KQYA 4JDTL 1AS8A 5D38A 4NC0B 1F56A 2BVQA 4DAGH 2C3ZA 4AYID 4C56A 1YEHL 1VFFA 1Q6OA 2PYEB 2K3TA 1PQZA 2BSED 4OM0L 3SE9L 5KYNA 2D3LA 4HF5H 4D7PA 1ICQA 4Q6IC 2CXKA 5HYSA 3L1FA 2I7GA 2VLJD 2DM3A 4IDJL 1UWIA 4OZ4A 2AMXA 3VGGA 2NY0C 3HG1B 4WU5B 1XRSA 1O95A 3B8DA 4WGHA 2CLOA 3OZMA 1XLFA 4L4TB 5ICUA 1W5PA 4OFDA 4LLWB 4DNLA 1QUMA 4FX6M 4BI6A 2NZ1A 4PS4H 4PRPD 4REQB 3FFCE 4W4OC 1JTTA 2VUOA 4NQCB 1EXGA 1VBHA 1YMHA 3JTSB 4GYKA 4EDWH 1ZHKB 5EOQL 4DP8X 3AWEA 3NL3A 4D6EA 4Q9QL 1B4EA 2W6RA 4XN8A 4LF3A 3AJ7A 1RA5A 4X9SA 3MUJA 3TFKD 4NVTA 2I9TA 3O81A 4N8PA 1OQOA 3W2LA 3IJEB 1KIQA 5DLMH 4PGZA 3S35L 1V7ML 3EYUL 4OSUL 3JR2A 3QKZA 2N0KA 3DYPA 4FJYA 2ISDA 3BUIA 4ZB2A 4H01A 1WC7B 3VFUB 3MT1A 1M1SA 4MCMA 1X5FA 3MRNB 1A5OC 3GVRA 4K36A 3U7YH 4P61A 3QXVA 1XCTA 1XW8A 1U42A 1CFVL 2EACA 3S5LG 1EYEA 4FYRA 3EKLA 4F9JA 4MZYA 4LB4A 3DV6B 3CAFA 4GXUN 4MXQD 4W1TA 4YSSA 4MNHA 1IAOA 3E0WA 1VAHA 2F2HA 3BZFA 5DRZA 5E6YA 5FUZH 1Z6KA 1BEYL 2R69H 4FERA 3EGDB 2X0WA 2VLJB 1Q66A 4FE9A 1GZQA 3UCQA 1PEZA 5C9RA 1Y1DA 2R1YB 1NUDA 4YAQA 1JGLH 3S4TA 1DCLA 2W0KA 5GS3A 1PU0A 1XIMA 2OYLA 1UWEL 3DXAD 1LBFA 1J7VR 4HIEB 1E2VA 5AKVA 5DR5H 4YXKL 1XD1A 5FW6A 2C26A 4U4IA 1PHWA 2XICA 2XPZA 5ENWA 4JKPL 4PJXF 4QAIA 1SJVA 3MZTA 3UG3A 1JPKA 3LQLA 1SJCA 1F07A 4PCKA 1UQZA 2VFDA 2KLSA 5JO5B 3W1ZA 1FTXA 5BWAA 2WZEA 3B2VH 3WQPA 2SEBA 2GOKA 5MHBA 2DZEA 3LZ5A 5LXXA 2X1PA 5CUSL 3VWKB 1FRBA 3KS6A 5A2AA 1GKRA 4ZMOA 4YFDB 1TZ7A 2C6QA 2PTZA 4O1CA 4NP4H 4P5MB 5BVPL 5D1QB 1X38A 3PJXA 1UR0A 2X1RA 5T9BG 4QGTA 3WQ5A 3QCTL 1QPQA 4PRRA 1HKFA 1KOAA 4NHUB 4FADA 2EDQA 4NCC2 2A73B 2BIHA 4NM4H 5ADOL 1A66A 2DVTA 4O8RA 2ODOA 4AB4A 1NFDA 4X9IA 3TBTA 1QNZL 3I9GL 2QIIA 3XINA 5L8LB 4KFOA 2GK1A 4GAGH 5IRPA 4HETA 2AEIT 4GI9A 4GC4A 3SQOH 2BDQA 4LYRA 1NCWH 3S88L 4YTRA 1G6RH 4C56B 3TBSB 4ZO7A 2Q3AA 2N3JA 3UFYA 1UCTA 1XSIA 4ZQKA 2UBPC 2CCLA 2GI0A 3QQDA 4XCCH 4DKDC 1IM9D 3UGUA 2VGGA 3DRTB 3PDOA 2CLRA 4UM8B 5BOZG 4HS3B 2FX9H 3CVHH 1S5VA 5DURB 1E5BA 4OZ4B 3NSMA 4F0HA 3HZVA 2WANA 2NY5C 5E95B 4GIEA 4IISA 4CDHA 4WWNA 4NRSA 4W9DC 1M05B 1N68A 2P5WD 5C3IA 3VXQB 1Y5WA 1L7TH 1G9EA 1ONXA 5FYKU 2Y7LA 4X9BA 3T77A 4QJ4B 3MI2A 5FESA 2IGFL 4OCXH 4NOBA 3RFRA 2YB1A 5LGZA 2E8ZA 4N2BA 1SPDA 7PAZA 4Q4EA 4OW6A 5MEND 1MJ8H 2AABH 1G6VK 5C86A 4QNPF 5HP5A 5MHSD 1NL0H 5E1GA 5I06A 4PJHB 1JWSA 2WZPD 5BO0D 3QZEA 2WBKA 1JV2B 4M3KB 5AYUL 1GOMA 1RFDL 2BSTB 4JCLA 4OZFG 3D3VD 5EF2A 2AL1A 3QA3B 4ZXLA 3BC9A 4O58H 2E74C 1BQLL 4R5EA 1NGXA 3FTGB 4JTUA 4QR6A 3VOHA 2ADIA 3MMEB 4XVSH 3QEUB 2FSEB 4CL7A 4LSBA 4KI5D 1AQMA 1OGAD 3G0SA 2JVUA 4IS6A 3EBVA 4W9ZA 5IFHL 1I3VA 1RULL 4ZX6A 3T0EB 4J3ZA 3VNZA 2R23B 3BVWA 3U1QA 2A6DB 5EZOL 2G3MA 3OAWA 4J3SA 4N0UE 3CZFA 4WZHA 3TKFA 2N1KA 2DS4A 1BAFH 2Y7GA 2C0AA 4TUKL 3ZWTA 5B1KA 1EXUA 4PD4J 4Y4KC 5BS0E 3O6FA 2V2HA 3QOMA 4O16A 4NNXB 5FV2A 4N9BA 3KCPB 5AUMB 4PG2C 4I5BA 2CUIA 3GLDA 4BKLA 1CDYA 4AL8C 2WLMA 3APTA 4BFGA 4WO4B 3VWKC 4XVDA 5MKGB 3VG9B 3RWCA 3EGXA 1PLGH 5EGRA 3QPYA 1PJ9A 1B3VA 5GNZA 5FIPA 1JQVA 3V4BA 3P5ZA 4H9YA 3VNKA 5SX5H 4S11A 4D9LH 2NX3A 3FEQA 2W9DL 4PH6A 1K4DA 3MRCB 3E6FB 3L7EA 4X6CB 1SF3A 2ERJC 3HG3A 2Y06H 5DK2A 4ZSOE 4D8AA 3MSPA 1SXCA 3X13A 5HDQL 1KULA 5IXEA 3IDXH 3KPSB 3MJ8A 4L8SC 2HZHA 5DJCA 2CBUA 2W27A 3GHEH 5E6ZA 2IFFL 3BKYL 1JNLL 3BDBA 3EYSH 4A38A 1QWHA 1X7FA 1G6RL 1QW9A 1MO0A 1DYZA 1ETZA 1PYMA 5DWPA 2CH8A 2Z8SA 3NJKA 5HHMD 4MNJA 5A8MA 1S4IA 4UT9A 1K6QH 1WS8A 3L7FB 4OLYH 5EEZA 3AS2A 4BEQA 4TRPH 4WO4D 1IJNA 4BE5A 3FUNA 2Y8VA 1UJTA 5I6SA 3RITA 3PAVA 2JALA 1AGDA 1LORA 1P1XA 4TX9A 4QJ3B 3SPCA 4PMFA 4Y9GA 4KROC 3FB6B 4P2QD 4GG6F 5IHZB 2VMDA 5AY7A 1T5AA 4KFZC 1FA2A 3LTSA 3LSCA 1E5YA 5LHDA 1R5VA 3VCLA 1H7OA 3GBNL 3FYPA 2W95A 3IGAB 3LKNB 2KZWA 2V2XB 3UJJH 4G8GB 4KKAD 4NNCA 4X50A 3AZRA 2QLVB 1FWHC 1SUHA 2GY5A 2EEFA 2DQDH 1E73M 2PD9A 3KOXA 4MNKA 1V8EA 1FNGA 1WFIA 1XGPA 5FGRA 3WKMH 3B5GA 1LO2L 4F7MA 3APYA 5IV2A 1IE5A 4DIAA 1DDHA 3JQOB 4IU2A 4LARH 3TO4B 2V5BA 4HIBA 4N24A 3EDEA 4XWOC 1NOWA 4CADB 3CEPA 4NB7A 1YDOA 3WIHA 1FX6A 2X2GA 5H8UA 1M6UA 1IVTA 3B83A 3U2EA 2TSBA 2IAMC 4EZLA 3DX9A 1CK0H 4OGQC 3X13B 3OJDB 3E0VA 5I5MA 1OAXH 3FRPA 1ALDA 3V36A 2GITB 2A9AA 2P3YA 3T6VA 2RGSA 3K2MC 4I0PD 3ZBMA 5LDUA 4QHNB 3SOBH 3IWPA 5FK9B 2HPOA 5EA0H 1Q1JH 3V9EA 5IW6A 3MDJA 1KPUA 4KDTC 5IK3B 4RV3A 2WWMC 1GYCA 2R0LH 2FWOA 3GJFA 4G9FA 1E0VA 1J10A 4KHTL 3HGOA 3TJEH 4WJXA 4C6LA 5HVWA 1F4HA 1Z6JT 1UVQB 5KZ6A 4KJWD 4Y1AA 2NYZA 4M48L 4QRSA 5D55A 1YPXA 4GXMA 1XSOA 2REQA 3QNYA 3WKQA 3QA3A 2WZMA 5F7WC 3LDBC 4RFOL 1T80A 1ET8A 1R75A 1JCYA 2NT0A 2DDQL 5C0GB 1Q8JA 4PWGA 2K45A 1GKEA 1TPDA 4IS6B 3W82A 4GFSA 3T44A 1LG1A 3C8FA 5AC5A 5DO8A 1A7QL 3ZQXA 3S0CA 1KXTA 2CKNA 2D9CA 4GO9A 3ZVIA 2E1WA 1YEIH 1UG9A 4H20H 4ZS7L 3E7JA 2ADJB 3KPNB 5GRJH 3BUVA 3ZKMD 5GRUL 1CLZL 1UB6A 5LQBH 3P4MB 3D09A 3F5JA 4R85A 2QHRH 3CZEA 1ZANL 1EMTL 4GBXA 4KTYA 3U9IA 1J0JA 4Q9BA 5I23A 1JCMP 4EX4A 1A4MA 4IPPA 3V6BR 2FSDA 2J7EA 1TUPA 1EEZA 4NUJA 4U1GC 4WDWA 3VXNA 4AZGA 2I26N 3QG7H 1G9MC 4X9FA 3OHXB 3FAXA 3FS9A 3WBAA 3EMZA 5I73C 2PWFA 1J8KA 4I5XA 4QRPB 1TYRA 3HZMA 4N2HA 4I1NB 5IEHA 1B2WL 2ICEC 2B4CC 5HPCA 3C3UA 3ZYJA 1I7UB 1KW1A 3MGTA 4MA3B 3UC0H 4M80A 5J6SA 5AZ0A 5CG0A 4G8GA 1T21B 1SO4A 3ZIYA 1GYVA 2ZA3A 3PABA 3L23A 1EDGA 4AF0B 1DEDA 4KI5E 1DJYA 2MOQA 5EPDA 3ELQA 1SF5A 1MCJA 3TTYA 4O5LL 3RGVB 4ETYA 3E2HB 3JVGA 4PIBA 5FYKD 4FI6A 2ZC8A 3GDTA 5DEZA 1EKOA 3HHRB 1E27A 4G1KA 3U7VA 1BQLH 2DI9A 1S3RA 3MP3A 4Z7UF 4YK4B 1U3JA 4K23H 3OKEB 5D4IA 2WP3T 1KCRH 3FQUA 2F54A 3ARDD 4XN5A 1ET5A 1RZ7L 3R11A 3SEPA 1W3JA 4R83A 2Z7KA 4ABWA 5L7XL 5J89A 1DLHB 3S9IA 5G4HC 4PTXA 4G3YL 5KVDE 3WKZA 1MCWM 4MWAD 3TH3T 2BNJA 1PWMA 2N1TE 1U58B 3PF3A 3HC3H 5DRXA 3M47A 3NM1A 3QG6A 1NGZA 1LP9B 4NRZA 3ZRSA 1FV1B 1HF6A 1LL1A 3Q06A 3FYEB 1OP3K 1Q8MA 3ISWA 4OLEA 4AWJC 4CA4A 3N43F 1SDAB 4PREB 3OKOB 2YDRA 2QVNA 2X2IA 3LHVA 2FDBP 4RWHA 1VCFA 1FG9C 1EQWA 3LDBB 3DX2A 2I25N 4I2XB 4BDVA 2Z35A 3CHEA 3GH7A 1XCWA 3BZJA 4HZ7A 4HLZH 4JTAA 4RDVA 4UV7H 4DNHA 4G2DA 2WXPA 3DARA 3EYOA 4IKJA 4XPTL 2YHGA 4U0QB 4Z7WB 5IROD 2C71A 1QRKA 3ECBA 3UGXA 3K0WA 3RB7A 3UZVB 3G0UA 4L48A 4NQ1A 4X6EA 2WNNA 4LCRA 4M02A 4GZIA 1P2CB 4PJDB 1NCUA 1GJWA 4PWEA 3VAEA 1L3NA 2BXVA 2VFIA 4D1JA 2JJTC 5ESAA 3FYYA 3H1ZA 1T5KA 1E27B 4JFDA 1PHQA 2GVJA 2XIOA 4RPQA 3SCVA 4W86A 3N1FC 1UACH 1Q9WA 5DHVA 2HPTA 4A2EA 1GH7A 3X3GH 2A0LD 1HAWA 3GLEA 2BSRB 4X9YA 4BFKA 4M8QB 3V16A 1JPMA 3M17A 4ONFH 5JVLA 2LFEA 1BVNP 1NDMB 4I4WA 4Y9OA 3VNIA 3PJWA 3BD3A 2VJ0A 4GY0A 2VDKL 1RCQA 2AJYL 3VFMA 2HJLA 4MTMA 1UB3A 1MW3A 2XI9A 4OJDH 5DT7A 4FFZH 2PDXA 2XQYG 3AWFA 3CTTA 5AVWB 2ZCLH 2R7EB 4NKOB 2VXTL 3MNVA 4AZCA 1KGIA 4JGNA 3KBSA 2VGBA 2OSLA 3FQ1A 3RNKA 2WW5A 3W7HA 2ZP0T 3HG1A 1KT2B 1VBRA 3AZSA 1JCXA 5FKAB 1DFBL 2XSKA 3HI5L 5G2NA 3VFRA 1AGEA 2FVMA 2X12A 2Y5SA 4IJCA 2F84A 3R8HA 4MAYC 2EPLX 5CS7A 4PMZA 4MCYA 4HZLB 4OCRH 1EA0A 3HR6A 1IWAA 3GUGA 3S35X 6FABH 2YYTA 3AJXA 3VJ6B 2NW2B 3SDXE 4DEFA 4LRNL 5FCUH 3KPTA 1QNSA 2Y7EA 3GG0A 3LI0A 3FKUS 4KERA 4ONVA 1KBIA 3IGHX 4ZE4A 3AG1B 3IKCA 1QSFE 2JLPA 5D7LB 3DX7B 1OTTD 4JO4L 4X7TB 4KUZL 1FVDA 1ZPTA 5TF1L 5IEKB 1HNGA 1P0KA 2FGLA 3SCPA 3KP0A 1TU2B 2PGRA 2NY4B 2PW2B 5C07B 3L3DB 4NFDA 3ZMEA 1SFTA 2KDYA 2GHZA 2A1WH 2JQZA 4MWFB 4XNQA 5D9NA 1T22A 3TBSA 1KR0A 2J20A 3CZNA 3NMEA 5H37A 4DJEA 4KFPA 1P6BA 4KJYB 2HJFA 2P7TB 4PJ8A 2DZAA 1RBLA 1HH6B 3SO3C 4DRSA 4JPWH 4XCFL 4AT6A 4MWAC 4PMQA 1OK8A 1BZ7A 3TO4C 3CZGA 3WI9A 3EJTA 3RJOA 1RZ8A 4GLRI 5BQ7A 4A6YL 4DQOH 4JZOA 5LQBL 1DWAM 2YOCA 1N19A 2BVTA 4I3RL 5BROA 5JBEA 2J73A 1I9JL 1EJFA 1NFPA 3BUDA 1RVKA 5AVNA 1JF1B 4F9DA 1XL9A 5KZCB 2BHUA 4MAZA 3GBLA 3WDIA 3EOSA 1WA0X 2HTKC 3TYUA 1GYLA 3ANUA 3GDCA 5LNUA 3TVMA 5CJXC 3NIFB 2G4JA 2C9XA 3NZ8B 1EXPA 1BYOA 1K4CB 5I0YA 1TFHA 4HKBB 3UZQB 3QPZA 3FB8A 1E4NA 1PIGA 2X0UA 1OALA 1TJIL 1XIBA 3TCEA 1YUHB 3W7CA 4Q58C 5JPMB 3EX6A 4LB3A 5DXWA 1AGFB 3KCWA 5FKPB 1IAII 3IEBA 4HMCA 4PJEA 4MKSA 4KC3B 5AAPA 4DGUA 3DVGA 4XODA 2JXMB 3VXTA 1E8WA 3OQ8A 1NTDA 3HFML 2WGXA 4FQLL 3ZKSD 1BECA 3G1HA 1FI8C 1R5VB 5FOJA 2O55A 2CZFA 4JRWA 1FQ9C 1ZGLB 3SOBL 3GB6A 3EYUH 1E3XA 3EYOB 3QIUC 4KKCC 4OSUH 1GKPA 2HVOA 3UAJA 3SJNA 1XKYA 4HOZA 1M6OB 3RA7L 3WAKA 1TETH 5C9JB 4Z8FH 3KUMA 3WLIA 4GUPB 5AOKA 4O50A 1BAGA 4DBSA 5LNSA 3D39B 3AYVA 2EYTB 5B80A 3UWVA 3TNMB 1NPJA 4DZBA 3DJZA 4HT3A 3IXTA 1FVCB 2AJUH 4FFVC 1DCEA 3VFUA 1MFEH 4Z7IA 4Z7NB 2A6LA 1FGVL 5AVUB 2A7BA 5MENB 2EBNA 5A6TC 1USQA 4TUJB 3KLAA 2X2HA 1JZ5A 4OR1A 2EDWA 1J5DA 4XI5D 2J77A 4UTJA 2H3NB 1U8LA 3HC2A 4FL4C 3CN4A 4J5VA 3D0LA 2HVMA 5DJCB 1I8MA 3F4VA 3QFJD 4NPYB 3HI5H 2HJLB 5FXCH 1RL1A 3PUOA 4KZDL 3ATAA 4X4KA 4K94L 4KZCA 1XUUA 2D0FA 2E25A 4N2CA 3C6LC 4RV8A 2NWRA 3S36L 4YHIA 1T96A 2NY1B 5DTFB 4UB0L 2FH6A 2PABA 4EKJA 1JZ7A 1N7MH 3RWEB 3SRKA 4YFLF 1V7MH 4RDYA 3LCWA 5F0PB 4PJ8D 1VLIA 4KROD 2ESVA 2VXNA 5BXFB 3G8RA 2AXGA 2EIEA 2M8XA 4MD5A 1ERNA 1X44A 1ZIBA 4UQ2A 3UYPA 5IM7A 3P7YA 3QXWA 5HGHB 2PDCA 3MHGA 1DQQA 5JW4Q 2J24A 3VYLA 1NZRA 3TNNB 3FO1A 4UTCA 2R23A 5E8OB 3VXNB 1HS6A 3NEXA 4J1UB 5DEJA 5D05A 2XTJB 3APFA 2AGJL 2JJVA 3AY4C 4LCCC 2OWWA 1XEUA 4PS3A 3G6JB 4XBGB 3Q8FA 1E5JA 1KB3A 1SUJA 1TTRA 3GSMA 3N2TA 3NZQA 1PTZA 2NNXA 3CIAA 3IETA 2IV8A 3TVMD 2Y06L 2OPCA 5JHDE 3KFTA 3BE7A 4KKAC 4ZTPH 4OT7A 1YEYA 3K6FA 3OKMA 4KGJA 2Y7QB 3TNOA 1QLEH 2CD0A 2W07B 2NXYC 4L18A 4MJIE 5CINL 1ADQH 1U8HA 2AJZB 2C1OB 3EGSB 3NCYP 4E41E 3QP3A 2O93L 4K37A 2J71A 1WIOA 2ZNXA 3BT0A 2Z8RA 3QIBD 4POYA 5HYJE 2MFNA 1YYMH 3PZOA 5CSRA 4XC1L 3TW9A 1LLOA 5SWSD 3CU2A 5E9XA 1VBJA 4R9OA 4EI5B 1PMYA 4LOEA 1BF5A 4FNUA 5I5JA 2RFXA 1V5XA 1ZGDA 3O07A 3VI3B 3W0WA 3UP6A 5A43C 3P74A 1JRHH 1NDGA 1AODA 3I6LE 3T7VA 4ZR8A 2F7FA 3FJ6A 1WKYA 4CCZA 5LAXB 4BUHA 1LTXA 5IBUB 1NGYA 2ZICA 1A02N 1W9PA 4IXXA 4ZQKB 5I15H 4QG6A 2TPSA 2Z93B 5I9QC 1F3WA 1E6JH 3BH9A 1HWWA 1OGPA 2CKBB 3SDDA 3G6AA 4OF6A 5KSAC 4X6BB 2ONEA 4XZIA 5TDOA 5D7JB 5HD8D 5FO7A 3WMSA 5C71A 1G7HB 1ET7A 1I82A 4XCFH 3SPHA 4GRWE 4Y4FC 3PJNA 1YHPA 3JUZA 3SJVA 5LGKA 4O02H 3T05A 5L6YH 4U2YA 3NK4A 1WKEA 4GZJA 2Z7ZA 3CHCA 3F2CA 1GAFH 1XL4A 3BLFA 3OO2A 4LPCA 3KW8A 3MV8E 4GOSA 3B2DC 3VOFA 2JWYA 2P8MB 2WWOA 5KBKA 4MMZA 4S3EA 4XPBH 3UG4A 4CNIA 3W84A 1E6XM 4DY1A 3VXSA 1ML1A 1I4FA 4KT2A 2O6EA 1SYVA 3FBQA 4LBSA 2P9RA 3PGCA 5CF3A 3O16A 3L2NA 5B1CA 5DFVD 1ZT7B 3FOKA 3ARED 3MZGB 4RZ5A 4I88A 4P46B 3ZU8A 4ODSL 4Z0SA 1D7BA 1G9NC 5LN8A 4KTDL 2AJSL 2XWCA 3EYVB 4MMXA 1X7IA 2WZIA 3PJUA 3S2JA 3OKDB 1YEJL 2QJNA 3PB2A 2E6JA 3NJJA 5CJQL 3IGUA 3FJLA 5EKYA 2G5RA 4HS8L 2VRAA 2F9BT 2Z1PA 1B9BA 3UA4A 4HGKC 4DWSA 2HMCA 3H2NA 4PRTA 4Q8TA 1GA2A 2H1XA 2Z29A 3QUZB 2ZRVA 3O11A 4FG0A 2VN3A 4F2ME 3OVGA 1K2DB 2WCSA 5LNRA 4AX7A 4B5XA 2VIRA 3G04A 3MLUL 2WLKA 2EDOA 3QPQC 5D9SA 4BZ2A 1W9UA 1MJJB 2J5LC 3DX6A 4GY1A 4OCYH 4ZQMA 4XBGA 4HSOA 1R3LA 3W7PA 3CX5J 3EDJA 1WGOA 3E6HA 5ERWA 1FCBA 3L5XL 3NQKA 2O26U 4KKCD 2A1WL 4R0LC 2WMIA 5F1UA 3T1GA 4LSPL 2IWKA 1DSFH 3ZT5A 1T7XA 1Z0NA 4N2KA 1J12A 4A6GA 1VCBC 1M9HA 5LBVA 5HWJA 4L4VE 1OAXL 4S3BA 4QHUA 4OJYA 2EE0A 1CI1A 2LLGA 5JXQA 4N9DA 4IOIA 4XAZA 1VHPA 1G01A 2QQKH 4X5WA 1IGFL 4IKLA 2FD6H 1R24A 1ZA3B 2LOEA 2FWLB 4X8JA 1KM6A 3T0TA 3P2DA 1PYWB 3NFSH 3GJFH 4DKFL 1CIUA 3KNBA 2BVDA 4RUBA 1T6VN 3SN1A 4ISVB 5F7BA 1W2KT 1RPUA 2E7DA 2FIKB 2FJHB 3VIIA 1Z8AA 2BOBB 2CNZA 2RD0A 4ZTXA 3VRLE 2UXVA 2XUWA 4LB8A 3SQBA 3TE9A 4H25A 4JM2F 2CG9X 3N0AA 3N04A 5CO1A 2KZHA 1P1MA 3TN3A 3PP4H 4L9ZA 2X1SA 4GMEA 4UT6H 4W4NA 4EE2A 2CCWA 1H5BB 2NX5A 1F6KA 3B7UX 4N4QA 2HJKB 5DT5A 5IM51 1F9CA 1CECA 3HPFA 4KTEL 1I9CB 4AY8A 4NZJA 2W63A 1XGTA 4MDIB 2J74A 3RAJH 5ESQB 3B04A 2E5CA 3H6OA 5BRPA 3KPQB 1VJIA 4MMZB 4AYBA 4M7ZC 3MV9B 5F88B 4Q8UA 2X41A 3I74A 3WFZA 3IV8A 2QQ6A 3HR5A 1Y6NR 3SY8A 3L0KA 3AAZB 4WNSA 2O6DA 5C0CA 2VLKE 1S2CA 5J13B 3AYRA 2NQCA 1RV8A 1S1RA 2XH7A 4G82A 3JZEA 1RXLA 2R1XB 2F8QA 4N2GA 1CGSH 2RMNA 4E2OA 3H9SA 4MKMA 4ZFOA 2AKZA 5FSDC 4PJEB 2W0FB 3LY6A 3WEBA 1NAKL 2XWTB 1ED3B 5BO1L 1ZAHA 5B1JA 2IBGA 3VWKD 4J28A 4PJGB 4ICMA 3RO6A 2UY7A 3G1YA 3WLNA 4HKBA 3QHFH 2YMXL 3AOFA 5FOBA 3R6IA 2WM0A 1DJWA 3OQEA 3FONA 2J8UF 4UV7L 2TRHA 4JTHA 3ARFD 3WJZA 3VOGA 2ZSVB 4FI8A 4BH8B 5DFTA 1XTLA 3D12B 1JPGA 1H2JA 5HVGB 1Y65A 3C5ZC 3V5DB 4TQEL 5JH2A 2CHOA 3FN3A 2F1AA 4JIIX 5K9DA 4WKXA 3FA5A 1TEYA 1QR7A 5IF0B 4LP5A 5F0LB 2C16A 1HL5A 2EDKA 3B9AA 3MBEC 3TH4T 3QUHA 3OGRA 3BSZA 4A2HA 3UPRB 1V3HA 1SQ7A 2YUZA 4LIQH 1OTSC 2R91A 3ZTNH 2OXGB 4PSPA 2WBXA 2VKXA 2G75A 2YK1H 3ARBA 3QK0A 4HKZA 4PRPA 4MLJA 3Q6GL 4IOSA 5EZIH 3VQLA 4JEQA 2XETA 3JYBA 4YHOH 5E9DE 4AJYV 4XWUA 4DN3L 2Q2EB 1Q2SA 4KXZI 3SYOA 5AOMA 3SE8H 4W9LC 2EDJA 4ZSOB 4KV5E 4FQIL 2A99A 1HJBC 4X0NA 4GW5B 1ISZA 1VFBA 2J2ZA 3KYMA 1MZRA 3SCQA 4QIRA 2H3KA 4CMMB 2ZG1A 5D1XE 2IQ9L 5E03A 2R0ZH 3Q43A 1EC7A 2Y7QA 3MODH 1ODZA 4OV4A 1U4EA 5D1ZC 4H8UA 5GGVH 4KCUA 1IC7L 5L9DL 3ZWSA 1M2OA 4MD5B 3NAVA 2C3VB 4PV8A 4F24A 3N4AA 1T1ZB 4J3OG 1RJYA 2VAJA 4DP9X 2BP8A 4WTWA 1QFUH 5EU6B 1EHXA 3UCDA 5TE7H 5KUMA 4Y2NA 1OGAB 1H3UA 3IWVA 1ZQ5A 3PDOB 4UM8A 3ZM8A 2PTVA 4HNLA 4OB5H 3TJLA 2NDFA 4MNHB 4AQEA 2IAAC 2CCRA 4PJ9A 4US6A 1MG3C 2Z34A 3PWJB 3QFGA 5IM7B 3UYPB 1KGJA 4L3EA 4R7NB 8FABA 3W1UA 1C08B 2Z7YA 4G1EA 2ZRZA 2HG0A 3MBDA 1ZVSB 4GNJA 2W81C 4WW2F 2EH8L 4MCZA 1TUFA 2W79A 1EERB 3PWPB 5JIKA 2Y70A 3CXHK 3OGOE 1M7XA 4WEMB 3OVUB 1A6WL 4QMEA 3RAJL 1XQKA 4JHOA 2AL2B 4X80L 5FEWA 1V4YA 3QIWC 4J3XA 1YDPA 3KBWA 1U8OB 2A83A 3I6SA 5EUOE 2WYSA 2P5NA 5C0AE 5C6TH 3CSPA 3NJVA 3BP7A 3OJVC 3GJEB 1KLUB 3B1UA 1O75A 2WZAA 3DUUA 3NIGE 4JZJB 3ROOA 4ZMTA 4RRPA 5BOFA 1RIUH 3O6KH 4Q7NA 4DERA 7CGTA 5EUKB 1BZEA 1PFOA 3B9KD 3Q2NA 3QDGB 1GR7A 4UM9A 4NI6A 1H5YA 2D3NA 4QI3A 1XIFA 2DQEL 1BFSA 3D85A 1Z1WA 4DVBB 4L1HA 5EMUA 2H9AB 2O4EA 3SBWC 4HJ1A 1MPAH 1IGCL 3DTXB 2VLJA 1THCA 2NMSA 1TV5A 3UPCA 4ZEPA 1O0VA 2Z8VC 2KPWA 1RURL 2G9HB 1BX2B 2W60B 2Z31A 2FZ3B 4LPWA 1ES0B 2PPDA 4OIIH 3MHZA 5E5MA 5HHOA 4OT1H 4NJAL 3S98A 1BZ9A 1UXWB 2BJMH 4NLAA 4AYFB 4XN4A 1JFXA 4WFHE 5F4SA 1U41A 1F02I 4IOSD 3QCTH 2DM4A 4CD4A 2ZOLB 3QH3A 5ANME 4BKSC 4LEFA 4G7YL 2WMJA 1H1ZA 4H83A 3R06B 5IB3A 4JIHA 5KYXA 3I3EA 4LALA 1RP8A 2WKOF 1Y6KR 1ZENA 1L9PA 4O1FA 2WXKA 5D96B 2QS8A 2AHIA 3HPJA 2CU0A 5ABHA 1QFUL 2ITCA 4L2YA 1BGAA 2DSUA 4HWUA 1VZWA 2XWZA 5H1WA 1RSCA 3SUTA 2Z92B 2EDEA 5DRIA 2R69A 2IPKA 1PZ5A 5DJZA 1FHDA 1GNXA 4HMNA 1FAKT 5BO1H 4XX6A 1QFOA 4U1NB 4A2MA 3TW6A 2HVJB 3EHBC 2N56A 3ORWA 2CR0A 2CBQA 2ZYHA 3VI4B 3U30C 4MAYD 2D1ZA 4OV5A 4JFEB 4LOCA 2OCFD 4L8BB 4N5EC 5CM1A 5HYJD 1NKRA 1KSRA 4MTVA 4BEUA 1J86A 5FO9A 3L3DA 2UY3A 1WVZA 1OEZW 4PJ9D 1JS4A 3VI4E 4J2QA 4QBXA 4MUZA 4HPHA 5JBDA 3OR7B 2EG8A 4CD6A 5K1NA 3BJFA 1CBVH 4WD0A 1S3TC 1XGDA 2PCFB 2CO2A 5BVJA 1CWVA 4DW2H 2Z7GA 3VB9A 2GQ3A 5CPNA 2HFFB 2WNGA 3CXDH 3M86A 4C6NA 3FU7B 2Z6IA 5DXXA 3K91A 3VJ6A 3TN6A 2JK5B 1DVXA 5E1QA 4GK8A 4ALAL 2HJKA 3KXFD 3INUL 1NGWB 1KN4H 3QUKB 1EX1A 4QDMA 1NAMB 5D2WA 2ZWLT 1TYGA 4DYEA 2AJVH 1I1AB 1FZKB 1H6TA 4FNQA 2G97A 5D04C 2F15A 3QE5A 4F0KA 2ZYSA 3PHSA 4P04A 1NBZB 2GBUA 5EBLB 5KETA 3QFDA 1GVIA 1X6NA 5A2JH 3A6OA 2V2DA 2VDNB 2NXZD 2XXGA 5AOIA 4OD1H 3QC5X 4X4YA 3NQ7A 2HJPA 1YEGL 1ANUA 4TSAL 3RURA 2FCBA 5B39G 4G8FA 3CFCL 4YLQT 3D50A 4GEIA 2P5PA 4LHUA 1E42A 3DV4B 3DOPA 4R26L 5D2XA 3PTMA 3KHJA 1X5MA 1E51A 1X98A 3E6EA 3CWNA 3PGDA 3KCLA 2IXQA 3IU3B 3ZZQA 2Y7FA 2YSWA 3MUGA 2CRMA 1LMIA 5CINH 1GW0A 1J18A 3KNBB 3WKPA 1M03A 4CQBA 1JHLL 4WO4C 4IK6A 2YUXA 1BLNA 1EOMA 2XYCA 5LKYA 4FJ6A 2HCVA 1FL5B 3GG1A 2GSGA 3CSBA 4KRMB 3E80A 3M0ZA 2INFA 5DA0B 2VDML 4JQIL 1JCKA 5KVFE 1HKIA 3NL2A 4P7LA 4ZMGA 3QUXA 2V6HA 4AGLA 1Z32X 3GSNH 1DQQB 5EF0A 3O4LA 3DBXB 1C92A 2DJSA 5DUML 5GS0D 2A7PA 1ISVA 2HEJA 5I79A 1NGPH 1OINA 4MDJA 3JWDC 2YZ1A 4PLKD 5CKAA 2WO4A 1X7QA 1AYRA 3RX7A 3T3PB 1R3LB 1K5WA 1XGRB 3FB7A 2XN1A 4YXLH 4O2EB 1JDFA 3K5SA 2NLYA 4NKQB 3IF1B 2HXUA 3D3VB 3QM3A 1BCIA 2WTRB 3NZPA 4YHEA 4M51A 1CXEA 3EJZD 4I9WE 3IVTA 1AXSA 4OCWL 4AHPA 1O68A 3M0IA 4E4UA 3EX3A 4I89A 1H0GA 1ZLWH 4XXCC 5SV4A 1Q9LB 4ES4A 3US9A 1WNOA 3G1FA 1UUSA 4LAKA 5A8GA 4HIXL 2FRGP 2X4PA 2E9LA 1JZGA 4L3AA 3TO2B 4F15C 3KZPA 1YQ2A 3M88A 1E65A 1EC9A 5CAHA 2EKSA 1NBZA 3CHQA 2K6WA 5T5NF 3NSFA 3NDZE 1PKLA 1SXAA 1YYML 3QUMA 4IHCA 2CLVA 3LH2L 5LCVH 1TTUA 4MYWB 5TNVA 2PO6B 3ABLB 5EUOF 4YSEA 3QXUA 2JK5A 3BKMH 4U28A 4DELA 1IGTA 2YJLA 4ZFFA 5JPNB 4QLRA 4OECA 2PGWA 5FF6B 4YX2H 1I4FB 4RAUA 3QDHA 2BRRH 5DSCA 1EJXC 1XL6A 2JSFA 1KCKA 3D4GA 1KZYA 2CK2A 1K1DA 2A3TA 3KWSA 4LVOC 3OB8A 4WI6A 4NO0D 5CZXC 1KM4A 3MA8A 1BM3H 1ZHBA 3NQBA 2VWTA 3JZYA 4ECLA 3JV4A 4JFFD 4MS6A 5HHME 3PTDA 2I9LA 1CLYL 5AAWA 5JR1L 5D7LD 3HS0A 3WIHL 1IILE 1WBJA 5F3FA 2R51A 3KPLA 4KHXH 4RBPH 5EO0B 1TJRA 2VOMA 5G2IA 4YXHL 4DVOA 4BZ1A 4LLMA 3AHZA 5LNWA 2ZUSA 3ARSA 4LCYA 3GHEL 3RP1A 3F3HA 3KDMB 2Z28A 2FUQA 4WI0A 1VA9A 2R1WB 2VISB 3QUML 4NNXA 5EN2A 4QRPA 2VEGA 4C1NB 4XIMA 5CZSA 1U8CB 1G7IA 1L3WA 4NN5C 3D0AA 1HL8A 1TZIB 1A0QL 4FXLA 3RWCB 3QUYA 2X44D 4TQPA 4ZMAT 5FJUA 2Z1WA 2EE2A 2HAZA 3QIUD 1EEZB 3E2HC 4NUJB 5D03A 3PXJA 2BTMA 3O0LA 1DVUA 4IMAA 2FSEA 3QIBA 2RDWA 3QORC 4JTIA 3VINA 3C0LA 5FM4A 2IKIA 3ESPA 1S3KH 3P4MA 2ZWNA 3QUXD 3BKCL 3FOLB 1E4IA 1Q5MA 4UTAH 3W6MA 2WNKA 3FRUB 3WUZA 1UXLA 2FL5B 4ZNCD 2VDIA 1A7RH 5I6PA 2V3DA 3GS4A 2YL9A 3OEXA 1UKTA 3H2OA 3PG8A 4OTXL 1S2UA 2UY5A 1C29A 1F45A 5T1MA 4J2PA 3VNDA 4FG4A 1IKNA 4Z3JA 2Z31B 1OFDA 4Z7OE 5JHLL 5T3XD 5FO8B 2E7FA 4NCC1 3SCWA 1OLZA 5FJTA 3VGAB 3SY5A 3C5XA 2PMQA 2GHWB 4HNVA 1AVAA 3L4VA 3EEZA 5FGSA 2EUWA 1W1A1 3O7UA 4XNXH 3BAWA 1MHEA 1E6RA 1NUGA 3TT1L 4FQQA 4YNYA 1CGXA 3NTCL 3N1AA 1V0NA 1DZBA 1NMCC 1DE4B 4X98A 5DZLA 4PLNC 1H7NA 3KHDA 3UC0L 1JHKH 3WE6A 1Q0EA 4TSBL 5CBAB 1M7OA 1UC4A 4LCCA 2J8UB 1UWFA 1OM3H 3K0YA 1M01A 1NFIB 1OFEA 3D2UD 2VXQH 5C9WA 5JOPE 3BTNA 3C5SA 5A2CA 4DP7X 3QJFB 1AO7D 4PV9B 4FKEA 5ISZE 2VMEA 4KDWA 2PDFA 3V3WA 1BWLA 3GLCA 4RGMB 4QG8A 2YCKX 3M0MA 3PV7A 2VDHA 4AGPA 4AWEA 3V0EA 4IRSB 5GJTL 4IMLA 5CGYC 4RMUA 2Z25A 4LSSH 3LV6A 4M6AA 1QA9B 2AJ3B 5AW6B 3P1VA 4N86A 1A4CA 4CU6A 2C3WA 2NXZC 2QPEB 3FHAA 3AXMA 4MQ7B 5E2WH 4IPNB 1FO0H 2IEPA 3BP6A 2NWSA 4NO0A 25C8L 2CDGA 5IKCA 5JQHC 1KRAC 5ICYB 1ELSA 2X38A 1QX1A 1U6AH 4P46C 1V05A 5J11B 4GG6A 1YBQA 4CCDA 4DVRL 2LAAA 1GVRA 3GKWH 5K9JL 3G6MA 2Z31D 1GMIA 3DHMA 3UYCA 3ZRFC 2H6RA 4WFGD 2Z3FA 5DHVB 1OE1A 3INPA 4M6VA 3ZJKA 4Y2WA 1WZMA 1YEFL 1HIZA 1WXZA 1XBYA 5SWQB 2VSKB 3UBFA 1HJUA 1PDZA 1T04A 4I0PB 4YR6A 4JQ3A 3UZ5A 3ZHLA 5KSVA 4AVNA 4RAVB 1CWYA 3MRPB 1K7FA 4YAQB 3WAJA 4D7BA 5FGBA 3L3IB 4TM9A 2NY5L 1S3KL 1HZKA 1RZKL 2NY0D 3VSVA 1UWQA 4LT9A 3VRLF 2VC6A 2QVKA 5CHNA 4FFWD 4BRJA 3CQHA 3VU1A 5IB4A 1UD5A 1UACL 2Z35B 1JP5A 43CAA 5CH9A 3VKDA 3DV6A 3P4LA 4ROPA 1CBJA 5GJMA 4KROB 4FZ8H 3OWEA 3ULVE 3WLQA 4XPTH 1U3HC 3U2CA 2HT2D 1HEJC 4MA8H 3QOKA 3MFFA 4C8XA 4G8GD 1I9EA 1QMLA 1Q94A 1IEVA 1F97A 3LZRA 1NCWL 1J01A 3AXKA 2VXTH 3T55A 2ZXGA 4PCNA 3BPCB 4JFPA 3RWGA 4BFEA 5SX5K 1SJBA 4S38A 1F3RB 3IJSA 1LDPH 1KNWA 4ELMA 1AH3A 5GS1B 3ARGC 2GSGB 2YAQA 4FTVD 1MLCA 2BB0A 4KK8C 1NIEA 1WC7A 1KFAL 2OL3A 2GSJA 1FE8L 2H9GB 3NJHA 3S3CB 4PN2A 4XTDA 1VGEH 1WWBX 2R4SL 4OZGF 4UOW0 3VFVA 2YDQA 2XWJA 3N9RA 5E24E 3KVDD 1T22B 4NGHH 5T1DL 2YXXA 3Q37A 2PDIA 2HFGH 4NKDB 1AK5A 2Q5BA 3DV4A 3D2UA 1AOHA 1ONQA 3BT2L 2OBGA 3DETC 4YZWA 5EB9A 5AAWC 3SE4C 4PJHA 5JW3L 2HNEA 1JPSH 2VURA 2LAGB 5LA2A 4AITA 3WIFB 1MCCA 3MX0A 4HH9B 2Q86B 3CUGA 3L08A 4E0CA 1OAYL 5ICZA 4X42A 3BQ6A 4AC7C 3GXFA 1Z5HA 2VLLB 3N40P 4J3OC 4H1LG 2XNAA 3DHUA 4I48B 4F8NA 4NJ9H 3N42B 2EPMX 2YGPA 5M1TA 3WLSA 4F2TA 2NW2A 5I8CB 3ULUF 1GSKA 2PWDA 4PLJD 2J9ZA 2JF6A 1UWUA 4JG1H 3UZWA 5IB1B 3L5JA 3QCUH 2EPHA 3HNSL 3GFZA 1FL3A 3IXAA 3V4VB 4LHUD 4D0BA 5JHMA 1PS9A 2PS2A 5BZDB 4R2GD 5CN1A 3P8JA 5BS0D 2R9RA 3G1AA 43C9A 3VRJB 3A4FA 1PW3A 4MAUL 2FT8A 1QXLA 4PFHA 1J0IA 4YDMA 4E41B 5IHUH 2PPFA 1T5XB 5CEXB 4Z7VE 4ERGA 4QCFA 1DN0B 1G5GA 1I8IB 4RLIA 4M7JH 3I6EA 4AVFA 1NLBL 4QEGA 3TU6A 2YCJA 4XBSA 4L37B 1QG3A 4QRBA 3NPWA 2LVEA 3R25A 3OR7A 4PJXE 1RZIB 4Y16B 3T8XB 1I8KA 4XVJL 1TWDA 3SBRA 2IIJA 1GG0A 2DPEA 2GGHA 3RWGB 5I8OL 1KY6A 4E9VA 4UTKA 5DZPA 2WUCL 4MA1B 3M7WA 1IWPA 4IGBB 2W94A 4KCTA 4PTTA 1I8LA 2QADB 5SWZA 4GT0A 1LMKA 1OT4A 2WZ0A 3N9KA 4WEUD 1HHJA 2YJQA 4LEXH 1DBAH 5EDXA 1RSYA 3RIAF 4LOVA 5AB2A 5KVEL 1VACB 5C7XL 4FF7A 5I3DA 3CC1A 3GTHA 4FOUA 3WF2A 1A0DA 2UY6A 5BUAA 4GFXA 2CERA 2VXSL 1LO3L 3CWHA 2FB4L 5CR8A 1ITUA 4MNGB 2BNRD 1RAMA 4NZ1A 3GGWA 2OEMA 3BIAX 2E9GA 2R56H 1NCCH 1RU9H 1IXOA 1OARH 1XAKA 2G41A 4JICA 2GY7B 1W0WA 4G8TA 2NXZB 3L3JB 4PJXA 3IJQA 4NY2A 3S1WA 2UUDH 2FO8A 3HZKB 3BJLA 5J57B 3IYLW 3NQDA 1QBBA 3IJSB 1H3WM 1JD7A 2K7QA 3GIZL 2DQDL 4V11A 3V4LA 3M0HA 4LTSA 4X6EB 2DYPB 4PY8I 3P40A 3JTTA 4J3OF 2Q7YA 2OLSA 1S38A 3LCYA 4ZDHB 1FWWA 2I5YL 1U8QB 4GRWH 3PHAA 4R90L 2ALAA 1NDVA 2EINB 3GWQA 3ARGD 5DCEA 1ZS8B 2A77L 4PVLA 4PMXA 4ANKA 1XJBA 3GTXA 3AFLA 4KKQA 4WY7L 5HYIA 1A6ZB 1MFDH 1GWJA 2CBJA 2DD8H 1O5RA 3NYKA 1PZ2A 4WTZA 2IG2L 2X89A 4PBXA 4W9TA 5IOBA 4A4AA 3HAEG 2ICSA 2OJZL 3AMGA 6A3HA 3NEEA 1BVKB 3K2IA 1OC6A 4NWTH 1VRDA 3V10A 4M0XA 3VILA 3WBDA 4JFQA 2H1LM 4R97B 4QTHA 3WHE1 3MLZL 5EU3B 1QACA 1CFSA 2VXVH 4CD5A 3GMQA