1MFVA

Probing the role of a mobile loop in human slaivary amylase: structural studies on the loop-deleted enzyme
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
b'EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-amylase, salivary
publication title Probing the role of a mobile loop in substrate binding and enzyme activity of human salivary amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mfvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mfvA01
1CDGA 3A4XA 4LYRA 3WMSA 2V5DA 2X8RA 4AZHA 5EFDA 3WENA 1HKKA 1W9VA 3D4ZA 1CGVA 3VTRA 4ZE4A 1BYBA 2VX4A 4AIUA 3CZNA 3H55A 2J79A 4W7WA 1FH9A 1CECA 3WF3A 1E6XM 1CBGA 4Z2HA 4IPNB 2BVYA 1KXHA 1S46A 2NSXA 3DX2A 4D6DA 1E3ZA 1JIBA 1ITCA 1E0VA 3TA9A 3DX1A 4AIEA 2GVYA 4CCCA 1PX8A 4RE4A 2ZWYA 3GXTA 3WKZA 4GKLA 1MQPA 3WEZA 4CD6A 4GINA 4JL2A 3J7HA 3NJ3A 4BQ2A 4M82A 4QCFA 4IPLA 2WSPA 4PEEA 1CEOA 3LRMA 3AHXA 4MADA 1B3YA 3ARTA 3VNYA 1CXEA 2EPLX 3ARSA 4OIFA 2XN1A 1ECEA 5GQBA 2ZXAA 5ABFB 1BPLB 4NZJA 4GZJA 1XSKA 3VPLA 3TOPA 2ZOXA 3LPOA 2WHLA 5I78A 4LQ1A 3CUFA 1AQ0A 3MMWA 1UKSA 3HJEA 5BRQA 2XGIA 5A8NA 2YBTA 4PSPA 1GPFA 1CPUA 5DT7A 4HMDA 1UD6A 3GBEA 4OZOA 3F4VA 1M01A 4H8HA 2CBIA 5GNZA 4AYGA 2V5CA 1NWTA 2IGTA 2D2OA 1R86A 2ZUMA 1UR4A 1QW9A 1J01A 1UOKA 2DT1A 2X09A 3RM8A 3EJQA 1GVIA 1E43A 3H53A 3RPMA 3VIFA 3AXIA 2GDUA 1AVAA 3CGTA 3EDEA 3T0DA 3AMCA 1TR1A 5GNXA 3OZPA 2GSJA 2OSXA 1GZJA 4AMWA 1EDQA 4ATLA 1XD0A 3OLIA 1CXLA 2BY3A 2WWDA 3O2LA 5A6BA 2FHBA 4WSKA 3RCNA 5A69A 5A6JA 3B9AA 1UWSA 2D0HA 1BAGA 1H4PA 3T2QA 8CGTA 2WZIA 3VSVA 3OGVA 1QHZA 1MQRA 1LL7A 1BQCA 1B3VA 2V3EA 3FAWA 2VUYA 4DWSA 2J8GA 3SCVA 3WY2A 4UOZA 4MJ2A 4MNKA 4ACZA 5I79A 1VIWA 4U33A 3CTTA 4IM4A 4ZXLA 3AHTA 3IAQA 2BV9A 5D9NA 1R47A 2ZIDA 3UG5A 1KGXA 1EH9A 5A6SA 1UR9A 3NUKA 1IT0A 3VD3A 1E70M 3WBEA 2PWDA 1E6QM 3WQ5A 3ARPA 2F61A 1B1YA 1GQJA 4W8AA 1R33A 5A2BA 1OIFA 3WDIA 1BGGA 1KTBA 3CHDA 3AMDA 3VIMA 3CPUA 4WSJA 1MW2A 4DM2A 2JFEX 3CZGA 1PIFA 2W62A 1UKPA 5CG0A 2J62A 4Z2JA 5M17A 5DMYA 3AIBA 3BUPA 4B9YA 3QHOA 3MO4A 3FY1A 4IISA 4A3YA 1C91A 3EBVA 3L4YA 4U3CA 1FFQA 3T2OA 4H04A 3VDBA 2VVNA 3EMCA 1LWHA 2CPUA 4BQ4A 5IHRA 3VGBA 4PTVA 1VJZA 1G5AA 1E6PA 4JIEA 1OGSA 4CN1A 3QGVA 2OSYA 2D3NA 1O7DC 3ZT5A 2X05A 3BC9A 1E72M 2J4GA 4TVUA 2O9OA 1K9DA 3DC0A 4UOJA 4UR9A 3S5YA 3PTMA 3OLGA 3SCRA 4BS0A 3HG3A 1GOKA 3BAKA 4YN5A 3AJ7A 2WZHA 1JYWA 4PN2A 1MQQA 4JFSA 1JFXA 3CZ8A 1ZBCA 3PZVA 2XTKA 1OBAA 3WD2A 2OW6A 2J7BA 1CWYA 5BYWA 2C8NA 1MFUA 2G3MA 1ODZA 3MMDA 3QR3A 4HOXA 3ARZA 2XJ7A 4JFUA 3NSMA 4DUVA 4ATDA 3W29A 4OJYA 2WAGA 4KMQA 3WDHA 4R27A 2E9BA 2YA1A 3AZRA 1WDRA 5FL0A 1ZJBA 3ECQA 2WCGA 3BAIA 4J7RA 2JIWA 4XV0A 4ZFMA 3KL5A 1UD2A 3BCFA 2YLAA 3PN8A 4WIWA 3WNOA 1GQIA 2A3BA 3ZM8A 1J18A 3CZKA 4MAVA 3PZQA 3N9KA 3VDCA 2WKLA 2WANA 5A6BD 5BXSA 1KXTA 2BNJA 2CERA 3LPGA 3GNRA 3WY3A 4HU8A 3IAPA 4JHOA 3LXBA 3VIKA 2J7GA 1U30A 1HIZA 4CVWA 3GDBA 3KL3A 2ALWA 3UG3A 1HP5A 3U7VA 1RH9A 2XUCA 1E0WA 1HJXA 5DO8A 1MWOA 1UASA 4OOUA 4DWSD 4X0VA 1NQ6A 1ISXA 4GI6A 3CZLA 3MUIA 3VIOA 1UZ1A 3M7SA 4W85A 2EAEA 1QVBA 2ZUVA 2ZX7A 2F7OA 2QLYA 3UCQA 2VC9A 4J3SA 4W5UA 1HXKA 2G8ZA 2PBOA 1QBAA 4TTUA 1MXDA 2GJXA 3OBAA 5A3HA 1PS3A 1ITXA 2PWGA 3DHPA 2FHFA 2DSVA 2EO7A 3CH9A 4AD4A 5D8WA 2E9LA 4W86A 3BVWA 3RM4A 3WQ4A 1E6SM 3AYSA 3PHAA 5FCZA 5M03A 3WF1A 1TQWA 3A6OA 2F1BA 3OA5A 2BHUA 2A3HA 1BYDA 3WDQA 4CD5A 3CBWA 1DP0A 1HVXA 3L4ZA 1ZBKA 3ARYA 3FAXA 3PZNA 2WMKA 2WVSA 1B30A 1EHAA 3AHVA 5BCAA 1QNQA 1JZ5A 1B90A 5A1AA 2CKRA 5A8OA 1TQSA 3SCNA 1BGAA 3WQ6A 1E71M 2VJXA 3BUDA 3JUGA 3VX1A 5CSYA 2WC4A 3MS8A 3OGRA 1I75A 2UWFA 2FH8A 5KZ6A 4PYSA 4AD2A 1XSIA 3NIYA 4NXSA 1K6AA 2PC8A 3W81A 4AZCA 2YL5A 1G94A 2XSBA 4XZBA 4N0RA 3FHQA 5KEZA 1QNOA 2VNCA 1XH0A 2ZXDA 2ZXQA 3BVXA 2D20A 5ABGA 1B31A 1ISWA 2GJRA 2AAAA 3FN9A 3L2MA 3K46A 2WW5A 1BYCA 3THDA 1VJSA 2FE0A 3SUWA 4NF7A 3W53A 3BLKA 1KCLA 4WKFA 1Q6DA 2V3FA 2CEQA 1TG7A 3ZJKA 1VAHA 3W26A 2WVVB 1WP6A 1TQVA 2QMKA 3ZSSA 1IZKA 3W6LA 3SUTA 5CPQA 4AMCA 4H8VA 3L4XA 1H3GA 1TZ7A 5ABEA 1PJ9A 2F8QA 3CZEA 3W6MA 3GNPA 1TE1A 2OWCA 3WF4A 5E6ZA 1OCQA 3ZR6A 7CGTA 3WH6A 2ZX8A 1TCMA 1V3JA 4YHEA 1KB3A 4UQAA 3HG2A 2RGLA 5GPRA 2WSKA 1KGWA 5BRPA 3ZJ7A 3WUBA 1SYTA 4U3AA 3L4TA 1PZ2A 2DSZA 4B15A 3GYCA 1DEDA 3GXIA 3LXCA 1V6UA 4PTMA 3HG5A 2ZUWA 1P6WA 1KXQA 5D8ZA 1GCYA 1H1NA 1R7AA 3N18A 1OINA 4PMZA 3GBDA 2CESA 4PCTA 2J7DA 4E8DA 2WHJA 2OSWA 2JE8A 1NH6A 4PMUA 3ZQ9A 1B2YA 1QI5A 1PAMA 2JF7A 3BUQA 4ML4A 1FOBA 4W7UA 3K1DA 1R8LA 1QNSA 3BAXA 2CBUA 1IZJA 1RPKA 1W9UA 1W3LA 3WELA 3LMYA 4K68A 2ZUNA 1E1EA 2FGLA 3THCA 1WDPA 3ZT7A 3WUGA 3O6AA 4PMOA 4JZ5A 3LRLA 3E1F1 1GONA 2D24A 5EBAA 5E1QA 2EQDA 4WK9A 3N17A 5A2CA 2DSKA 1OGBA 1ODUA 1TQTA 3EJTA 2WLYA 3VD9A 2CHOA 5A6MA 2C7FA 3IANA 2CXGA 3WY1A 2J7HA 2DEPA 4FNSA 5E0FA 1R85A 1C7SA 1BVNP 3ARXA 2AMGA 5IFPA 1JAKA 3VGFA 4U5KA 3MU7A 4PUEA 1UWTA 2G41A 1XCWA 1X6NA 2XWDA 2VR4A 1HKIA 2J74A 3OGSA 1W1TA 1EO7A 1G9HA 2WBGA 1CTNA 3SCPA 5ECUA 1WDSA 3GH7A 4IUGA 1GNXA 1EO5A 1V6WA 4DWSB 3WD4A 2F7RA 4ACZB 1ZS2A 3AIUA 1UKQA 3M46A 4EE9A 4AD3A 2EPOA 4UZUA 1XCXA 1SR0A 1CGTA 1KWKA 1W2VA 4BA0A 2CNCA 1B3WA 1HN1A 2DDXA 3F5KA 2VZSA 5FOOA 1WZLA 3BMWA 1BTCA 2OYKA 3MSGA 4HPHA 4UFIA 1W9XA 4MJ4A 3WH8A 3HZ3A 1H09A 3WIJA 1LQ0A 3UR7A 2V38A 4A4AA 3EDJA 5JBDA 3POHA 2G3JA 1FHDA 4UZSA 3PZTA 1M03A 3W0KA 2EACA 2NT0A 1GOWA 1V3HA 5A8QA 2QV4A 3ZMRA 1XHGA 2XFYA 4J3TA 1FH8A 3NSNA 4AW7A 1J10A 3UESA 3MUY1 2QPUA 4U2ZA 1JXKA 3IGUA 1BHGA 1TA3A 3EDDA 3ZO9A 1OB0A 3GH5A 1XYFA 4NZFA 1L0PA 3M07A 4UFJA 2WPGA 3QHNA 2WMFA 3PTKA 1CXHA 3DX4A 2WYSA 1MFVA 1QHOA 5E70A 1JDCA 4Q7NA 1C90A 4EAMA 5BXRA 4D71A 1GHRA 1EQCA 1EXPA 4MAZA 2V3DA 2BXZA 2CETA 5C70A 5CSUA 3AZTA 4AXNA 3BSHA 1CGUA 1VEOA 1U2YA 1J0HA 2E3ZA 3DHUA 3F5LA 5CPTA 3DYOA 2J77A 2W91A 4NRSA 2PI6A 3BUBA 2YA0A 3K4DA 2YKKA 2YFOA 3VMOA 5DT5A 3CC1A 3K8LA 3B9EA 2FDMA 2EPNA 5A6LA 1V0KA 2Y24A 1OGGA 2IXVA 2VRKA 1E55A 3WQVA 3WUFA 4D72A 1UUQA 1WPCA 3SUVA 1C8YA 1VENA 1LG1A 3BAJA 5A6AA 1V0MA 3W4RA 3VU2A 4LYQA 4URIA 5CGMA 2YDSA 1LL4A 4P7LA 5M3WA 4PSRA 2WM0A 2ZWZA 4KRUA 4P7QA 5DF0A 3WF0A 1H2JA 1UH3A 3CIVA 3EJRA 1CXFA 4HTYA 5E6YA 4OBRA 2EPKX 1CXIA 1UZ4A 3POCA 3VIGA 2WHKA 4NRRA 2XN0A 5FD0A 5IDIA 1E40A 1UD5A 2YIHA 1JZ2A 1VEMA 3K8KA 4P7RA 2BFGA 3VO0A 1UQYA 4HZ6A 2CKSA 3T0BA 1J0JA 1A3HA 5IFTA 2WKGA 4TXEA 6A3HA 2YL6A 3KLLA 1UR8A 4E2OA 4AD0A 2DPEA 2YFNA 2Y4SA 1I1WA 1UR1A 5EMYA 4C7DA 5JBFA 2AOSA 3WFZA 1M7XA 4D1JA 5ABHA 2XVNA 4W87A 3DECA 2VURA 2DH2A 1VFMA 3AQUA 2XFFA 3H54A 2BVDA 4AY1A 2NT1A 1QW8A 4J3VA 2GJXB 2VRQA 1OWQA 2WCAA 4GZIA 2WMIA 5A94A 2C0HA 4GI9A 1FP8A 1V02A 1BF2A 3ARQA 2F7PA 5I2UA 4W89A 1FHLA 1JI1A 1AQMA 1BG4A 3B8SA 1E6ZA 3WL0A 2G4FA 4OGZA 2WMHA 3WNLA 2PB1A 4CUCA 2ZXBA 4AZ7A 1QOXA 4ZXOA 4DUXA 3A5VA 4CKQA 4W84A 2YBUA 5AYBA 4JFTA 3AOFA 3EDKA 5HPOA 4J3WA 4HU0A 5FL1A 1TFVA 4QDMA 3BAYA 1GHSA 3OLEA 2GJPA 4MDPA 1XYZA 3CZJA 4PMXA 4JAWA 2BY2A 3LPPA 4JFVA 1DWFM 2W67A 5HOSA 8A3HA 1NOFA 1JXJA 1O7AA 2BY0A 1KCKA 3WQWA 3A23A 2WCSA 4AZCB 1OD8A 3VGDA 3SCQA 1W1VA 1AQHA 2VQTA 4HA1A 3N12A 2FGZA 1KXVA 2DT0A 1NM9A 3ZOAA 1JDAA 4OBSA 5AY7A 3U7BA 1SMDA 1JD9A 1VF8A 1Q6FA 2CBVA 1M04A 3AIWA 2EXOA 1UD4A 3KLKA 2UY2A 1NWRA 4CVUA 2A3AA 3A47A 1FFRA 1CGWA 3AIEA 3VMNA 4WLCA 4RE2A 2XGBA 1W1PA 4RL3A 4UFHA 3SCSA 1UR2A 1SMAA 2VT0A 1VFFA 3N15A 3CV5A 7TAAA 3W27A 3EYPA 3RILA 3S6TA 1C7TA 1OSEA 2FYVA 3WNKA 3ARUA 3BVVA 1TVNA 1B3ZA 2HVMA 2VCAA 1TQUA 1MYRA 3VSUA 3PBGA 1EQPA 2W66A 1BSIA 1JL8A 5CXPA 4PMNA 4CD8A 5JIWA 3T09A 5BXTA 1C8QA 3VIPA 3VGEA 2W61A 3CUJA 1WE5A 1DWHM 3MUZ1 3F5JA 3PZMA 3NCOA 1FA2A 1GOIA 1YQ2A 3TTYA 1JZ3A 1BLIA 4FK9A 1JAEA 4PMVA 3WD1A 1KQZA 3AMGA 1WDQA 4AC1X 4BF7A 2O92A 2W5FA 1AMYA 2QHAA 4DM1A 4Z2LA 1B0IA 5CLWA 2XVLA 1VBRA 3VVGA 1UH4A 2WXDM 1CIUA 1V3LA 2Z1SA 3A21A 4EKJA 1WKYA 3D50A 2WBKA 4PMDA 3D51A 4P8UA 1CENA 2X2IA 5A6KA 1E0XA 2J7EA 4JKLA 1HKJA 5DEZA 2XM2A 3NDYA 4MPKA 3I3DA 4M8UA 3AZSA 4MNMA 1NP2A 1O6IA 2EADA 2CIPA 3WSUA 3N1AA 4TUFA 4F9DA 4CU7A 1H0IA 3OLDA 3TV8A 5GNYA 3WH9A 4DWSC 2XVPA 1PEZA 3TTQA 1NP0A 2X1IA 4QLJA 3AS0A 3VOCA 5I23A 4NSBA 3VX0A 3W82A 3U57A 2VZUA 2VCBA 3WBAA 4CU8A 4EK7A 1J0YA 4AZ6A 4AEEA 3AICA 3IK2A 3W37A 1W91A 1HXJA 1HNYA 1GOOA 5LA0A 3RIKA 1CXKA 3WF2A 3VNZA 4QLKA 1Q6EA 5FIPA 3WD0A 3WUEA 5HPCA 3PZUA 3WMBA 3VD5A 1VB9A 4XUYA 3K4AA 3KE0A 4JKMA 1CLVA 4H41A 2WC7A 2DT2A 4XX6A 4UFMA 2J25A 3ARWA 5CZKA 2HISA 2WMGA 1H49A 5LA2A 5CJ5A 1V6XA 1DWAM 2QPSA 2DT3A 2TAAA 3U5UA 1MW0A 4JFWA 4W8BA 2YDRA 4D6GA 4OUEA 1WAWA 1Y7VA 5E09A 3KWXA 3UG4A 1R46A 2XFRA 3BSGA 4S3KA 4BQ5A 4PMQA 4EANA 1MXGA 1LL6A 2F18A 3VGGA 1V02E 3BXWA 4B3KA 1BG9A 2NW0A 3VIIA 3CUHA 3TONA 1JNEA 3WL1A 1VBUA 4TX6A 1YHTA 4PBGA 2ZX5A 2G3NA 2E4TA 2YL8A 3AS3A 1CGXA 1TA3B 3VD4A 1UQZA 3WNMA 1ISYA 2DGAA 2CCRA 3I3BA 4HOWA 1EOMA 4GQRA 3L4UA 1JYXA 4PTWA 1F4AA 3QHMA 5HDRA 9CGTA 3VIHA 3GXFA 2EABA 3DYPA 5A2AA 1F4HA 3A24A 1UWUA 2PF0A 2CHNA 2VR5A 3A22A 1XGZA 1W9DM 3VMPA 1FH7A 3KZSA 2EPMX 1NWUA 4DO4A 3QOKA 1GQKA 2VMFA 1UKTA 2J75A 4WKAA 3ZIZA 3D3AA 2GDVA 1W2PA 4BCEA 2ZUSA 1HJQA 1VEPA 4M24A 1H41A 3D5HA 2X2HA 4CN6A 3EDFA 4HZ7A 5AYIA 5JUVA 4HMCA 3SCOA 3SCWA 3EJPA 1DHKA 2DSUA 1PZ3A 3AXHA 3RM9A 1GQLA 2J47A 3BVUA 3MSDA 1OIMA 4OKDA 2ESCA 1XH2A 3I3EA 3HN3A 4E8CA 3VM7A 5HNNA 3AIRA 3AXXA 3D52A 1HTYA 4AWEA 3L2LA 4AD1A 4KGJA 4N42A 2X2YA 4S3JA 2XG9A 2OYMA 1E4LA 1QHPA 2E9MA 2Y8KA 4BQ3A 3SIMA 3PZ9A 1HL9A 4NX0A 3VDHA 3L4VA 1QX1A 1JF5A 1LG2A 3N04A 2XVKA 1N82A 3AS1A 4U31A 3UETA 2W92A 4X9YA 4A3HA 2YOCA 1KR0A 1UHVA 4F79A 2GK1A 3BAWA 4P8XA 4BZYA 1QNPA 1W1YA 2WVTA 1DWIM 2YA2A 1GJUA 4KRTA 3BLPX 1HT6A 3OZOA 1OM0A 3AHZA 4FNQA 3ZSTA 3WNPA 3MUAA 3KEHA 1D7FA 2IXUA 3AIQA 3W28A 3GXNA 3CLWA 3AROA 3VILA 4H7VA 4MTVA 2WMIB 3DDFA 3BMVA 5EFFA 4LPCA 4YHGA 3AI0A 3ARRA 2OWWA 4FLSA 1C92A 7A3HA 3GXPA 1B9ZA 4AZBA 5JBEA 2OW7A 1XSJA 4B16A 4D1IA 3LRKA 4WJXA 1L8NA 2Q8XA 2XIIA 3MANA 4QFUA 2E0PA 3BH4A 5LA1A 1UA7A 4QAWA 1UWQA 1E5JA 4GO9A 1Q6CA 1QI2A 3AIVA 2VZTA 4Q22A 1V6VA 3FXYA 4PUDA 1MVYA 4PRWA 3RJXA 3A4AA 5A8MA 2JALA 4GXPA 1QBBA 5C8BB 3W24A 1QNRA 2DQXA 3FHAA 1EIBA 5BWFA 4D6EA 4DO6A 4LXFA 1E4NA 5CLTA 1UWRA 3CZSA 2ZUTA 2X0HA 1QPKA 2O9RA 1E6RA 4UQCA 1RP9A 4PMYA 4HP5A 1J0ZA 1GUVA 1IV8A 1BVZA 4ACYA 1I1XA 1V3KA 1JYNA 2ZX9A 2CITA 4M29A 1WCGA 1G1YA 5AC5A 3RO8A 4TOQA 1QI3A 1MW3A 4Y7EA 1LWJA 4UFLA 4UCFA 1JZ4A 2J7FA 2XN2A 2OYLA 1VFUA 2F1AA 2X2JA 3EMQA 3GZAA 3T2PA 1EDTA 1D2KA 1QI4A 3U5YA 5C71A 3SCUA 4MB3A 2JEPA 2XWEA 1VFOA 2DIJA 4ZENA 3BVTA 3TP4A 2UY3A 1J9YA 2Z1KA 3K8MA 1H0GA 3QOMA 1E6NA 2XIBA 3VIJA 2J7CA 2WHMA 4DO5A 5HXMA 1CNVA 1KWGA 4AISA 1PX3A 2MANA 4TVCA 1C8XA 3S5ZA 2VRJA 4KH2A 4CD7A 2FH6A 1EDGA 5JIPA 3A3HA 2D3LA 3APGA 2JEQA 3AS2A 1WB0A 2EBNA 2YDQA 1UA3A 2EEXA 4GI8A 3BLBA 1HX0A 2VO5A 4M56A 2Y5EA 2XM1A 2YJQA 2D73A 1X1NA 3AFBA 4W88A 3BGAA 3WMCA 3DX0A 1V0NA 1H11A 2IUZA 1WZMA 2UY4A 1JI2A 2QMJA 1UR0A 2VL4A 3GNOA 2D0GA 1W9BM 4Z2IA 1UD8A 1ZB5A 1R7OA 1JG9A 1E9LA 4HA3A 4H2CA 2FHCA 4C7FA 3SUUA 3MMUA 4ZEPA 4JCMA 3HG4A 1JD7A 1CZ1A 5CGTA 3RDKA 3WQ8A 5I0DA 1K9FA 5M5DA 2D1ZA 4Z2KA 1W3HA 4CN4A 3HU7A 4MNJA 4C7GA 4F8XA 5ABFA 3B9DA 1BYAA 3WD3A 1H5VA 4JL1A 3G6MA 1HJVA 4U5IA 1W3KA 1QWUA 4W8LA 1Q6GA 3SEPA 4FLOA 4UQDA 1NOUA 1PX4A 2G3IA 3EMZA 2BVTA 2B31A 1EHNA 4UTFA 2Y2WA 2F7QA 4W93A 2BHZA 4KWUA 4M80A 2DIEA 3WDJA 2UY5A 4R5EA 3ZJ6A 4JHZA 2VTFA 3T0AA 4P8WA 4AD5A 2RGMA 2V3GA 1JGIA 3L4WA 1KBKA 4HPGA 2PWHA 3CMJA 5CQ1A 4TTGA 2DSWA 5DFAA 1E73M 4CCDA 1KR1A 1D3CA 2VOTA 1KTCA 4CCEA 3LX9A 4ZE5A 2JIEA 4CD4A 1JFHA 4MNLA 3VD7A 4OOZA 3NDZA 4PTXA 2WNWA 3AISA 6CGTA 1R75A 1GJWA 3IJ9A 2WC3A 2WLZA 2D22A 2WWCA 4LGXA 4MDOA 3RMEA 1E1FA 3N11A 1X6LA 3O9NA 4TX8A 6TAAA 1T0OA 1PBGA 3WNNA 1HVQA 1UYQA 4FLRA 3LPFA 2E40A 4HA4A 2VZVA 4F66A 2BXYA 4FMVA 1R34A 3ARVA 3NYDA 2WB5A 4QLLA 3WEOA 2VVSA 1EOKA 5BXPA 2CBJA 1XV8A 3HMCA 4V2XA 4FLQA 5A95A 1V3IA 5A8PA 4D6CA 4L4OA 3WY4A 1ISZA 1RD6A 4CGTA 2X0YA 4B9ZA 1K9TA 1JNDA 2GFTA 4MB5A 1CYGA 1OT2A 2PWFA 1HJWA 2D0FA 4GQQA 2J8FA 4NZCA 2D23A 3CHFA 5F7UA 4KGLA 3IJ7A 3GXDA 3TTSA 4V27A 1NARA 1QWNA 4GZEA 1JZ8A 3SUSA 3WH7A 2E8ZA 1QI0A 4J27A 1DWGM 1HF6A 1EGZA 2VQUA 3VGHA 1E15A 1ESWA 1G0CA 3MV11 1HJUA 4CU6A 3D4YA 4PCSA 4LX4A 4JCLA 4XZWA 1JZ7A 1C93A 3PTQA 2VX5A 3WDPP 3CUGA 3UERA 3SCTA 3DX3A 3G6LA 1J12A 5EB8A 5D9PA 1ZL1A 4FNPA 2A3CA 3ZT6A 3MKKA 1R87A 1GORA 1DTUA 5E0CA 1NOWA 1E5NA 4UFKA 3WEMA 1GVYA 3WH5A 1CGYA 4D6FA 1ZJAA 2VX7A 1K9EA 4HZ8A 1Z32X 1UH2A 2OLHA 4E4PA 2YLLA 1US2A 2O9TA 2WK2A 3CO4A 2VZOA 1CLXA 1JYVA 4NI3A 1G01A 1J11A 4J3UA 5IHSA 2F2HA 5LYRA 4AZGA 3VM5A 2BHYA 3VSTA 1UG6A 2ZX6A 3VINA 2XVGA 1C3FA 1TMQA 4MB1A 2VI0A 2WZEA 1VRXA 1W9PA 4Z2GA 4TVDA 3ZR5A 1PPIA 1XH1A 1XC6A 3IJ8A 4H8UA 4WF7A 2XPKA 3CUIA 4RE3A 5D4YA 5D9OA 1SFSA 4ATWA 3VDAA 3ALFA 1UD3A 4J28A 1ZBVA 2GK1B 2ZICA 3FNDA 2DH3A 4UQEA 4WKHA 3MI6A 3DDGA 4MB4A 3MV01 3OB8A 4D6JA 3BUIA 1W3JA 2Y8VA 2WVUA 4UOQA 1GW1A 4QP0A 1JZ6A 4NXKA 1HKMA 4GIAA 3N13A 5E9AA 2EJ1A 1HJSA 3CHEA 1HWWA 3GTNA 4D6HA 4XB3A 4AIOA 1J0IA 2ZUUA 1RP8A 3II1A 5I6SA 3WFLA 4DUWA 1KGUA 3AMLA 4UQ9A 5AC4A 1US3A 2O9PA 2XHYA 2VCCA 1E3XA 1W32A 3LXAA 4X0NA 1XD1A 4D6IA 5I5RA 3OG2A 3T08A 1UWIA 3BCDA 5D9MA 5FKYA 4W5ZA 1LJYA 2WMJA 5IXEA 4P8VA 1WZAA 1HP4A 1JF6A 2YL9A 3WN6A 3A4WA 2XYLA 1OT1A 1ISVA 3AHYA 1A47A 4F9JA 1KQYA 4FNTA 3GM8A 5BROA 4YPJA 3RJYA 4AMXA 1HL8A 3CMGA 3AMKA 4HMEA 1EA9C 3TTOA 1V3MA 1V03A 4JKKA 1U33A 4PMRA 2GUYA 2W4XA 4LYPA 3PZIA 2PBGA 3AYRA 1LF1A 4GPNA 1BFNA 1DWJM 1MW1A 4AEFA 2OWXA 4U2YA 4GO8A 2A3EA 1E4MM 2W63A 3SURA 1PIGA 2ZE0A 3KL0A 4QCEA 1WZKA 1TUXA 3ZJ8A 3GXMA 4L4PA 3PZGA 1J0KA 3CHCA 3EJSA 4P7OA 1E56A 2J78A 3M6DA 4B3LA 3FW6A 5CPSA 1KBBA 3W38A 3GH4A 3VKKA 1SZNA 4J3XA 1NWSA 4V28A 1V6YA 4FNUA 3EJUA 4FF5A 5I24A 4UQBA 1ZU8A 3UEQA 1B3XA 4AYSA 2E8YA 1OD0A 3DYMA 4P7NA 2XSAA 1V0LA 1ZBWA 4UNIA 1V08A 4W7VA 3VUPA 1FP9A 1GOQA 1WNOA 2BS9A 5TD4A 1WO2A 1TVPA 2JF6A 2VX6A 1Q4NX 2WVVA 3W25A 4AZ5A 3WDRA 3ALGA 1XRVA 2PWEA 1KFWA 2CYGA 5I77A 4M81A 1LLOA 4HOZA 1GOMA 1JDDA 3PZOA 3S2CA 5HBFA 3NSXA 1E4IA 2QF8A 4AZIA 4FNRA 3OIHA 1M53A 2BY1A 5I3DA 1UKOA 3UR8A 4M1RA
chains in the Genus database with same CATH superfamily
4RGNE 3GWJA 5EFIA 2X8RA 4HZ1A 3W1PA 3V4PA 4UT9L 5EFDA 4A6YL 2VXQH 1CECA 2F9BT 2YD9A 1JIBA 3DBNA 1M5WA 1E4XH 4Z7VA 1UXSB 3VA8A 3D2UD 5CILH 2OCJA 5BOOA 1S38A 5IMMB 4PEEA 1CEOA 5ICXA 1TWSA 2ZRXA 5AW2B 3LTYA 2GUOA 2BX7A 4LNRB 5G4WA 5BRQA 3RL1B 4O17A 1P4CA 4MHHG 4WNJA 4MFDA 1OPGH 4MQSB 2YZ8A 4MQ7B 4Y90A 3X14A 3MCLH 3ZHKA 2V7NB 3DG3A 3OV6A 3ATZA 2LGNA 3CCHB 2AJYH 1CDHA 4XE5B 1I8UA 1Q2SA 2GSJA 2OYPA 1IC5H 3DTUB 5EN2A 3HZMA 3RCNA 1U0QA 3B9AA 3P30L 1RPXA 4BELD 3O4LA 1OFOA 1LL7A 1OAQH 1A6WH 3G1XA 1QR4A 4DJDC 1RBOB 4D7BA 1I7UA 2R23B 3MHFA 4OF6A 1ZNNA 5D7SH 2WWMC 1XF4A 2ESVA 4O2EA 3BLFA 1A7RH 3TNNA 1PIIA 2YW4A 1MEWA 3GBML 1VADB 5TGBB 5L88H 2J3SA 4WSJA 1MW2A 2ID5A 4KHXL 3ZZLA 3KXQA 4P2QB 3VFTB 3HR6A 3VA2C 2HTKC 5EO0B 3EYUL 3D18B 1BZ9A 3T3PB 4A3YA 3L4YA 3ERPA 1LWHA 2RCSH 1GKRA 4J2XA 3VGBA 1OGSA 6TIMA 2B1HH 3B9VA 4OFKA 4LP4A 1Q1JL 4XI5D 3THUA 3PHOA 1PKYA 3RWJA 3VXUD 3DC0A 4HJFA 3IDUA 4B5XA 3VWKB 2WZHA 1BX2B 5AC8A 4KVNH 2XTKA 2D03L 2FPTA 2J7BA 1MFUA 4NNBA 2G3MA 4WGWB 2IKHA 3DG7A 3VQ1C 2ZSWB 4DPRA 5IBXA 3GDMA 3ECQA 5B39B 1M3UA 4MWAE 5DJZB 4H0HB 4R2GD 3F4CA 5IHZA 1Q8AA 5EZOL 3HKFA 3LPGA 4LVDA 3NO1A 1OAUL 4HCIA 2A74A 5GXBB 3JWNC 2GPZA 2WP3T 2WQRA 4OLVL 3RU8H 2VEPA 4LQFH 3C6SB 1F90H 1FFOB 1YRRA 4LVHB 1NGPL 2SEBA 4GI6A 2VYOA 4ENZA 3U46B 1LRTA 4ONVA 1SN2A 4TTUA 4FQIL 5CJQH 5KSVA 3DX8A 3IB4A 2PF8A 2CDFA 4PMFA 2BSDA 3GI9L 2AXHA 4AENA 2NX5D 4Z7VE 3PL6B 2V2XA 5IMOA 2LVCA 2Q3ZA 1LWIA 4KRLB 4ZTPH 3QZPA 4YQXH 1CI1A 1WWWX 3PZNA 1TTFA 3N2OA 2AL2A 3O15A 5A1AA 4DKEL 1CGSH 3O2VH 1MDTA 4KXZH 2CFFA 4KKCD 2ENJA 5CSYA 2AJUH 1B57A 2FZMA 2I26N 5EBGA 3DVFA 4UQ3A 4NPKA 4M7ZC 3MJYA 4M1DL 5SWZD 1UMYA 4CQDA 2VJ8A 4KI5C 3ZKMD 5D1QC 4N8VA 2YCIX 4QRRB 5GISL 3O4LE 2I5GA 4GUFA 3VCCA 5C3LD 3BLKA 3S0CA 2BJML 3LY0A 4KDTA 4NQED 4F57L 3HCVB 4US5A 4WO4A 2ESVE 1JBJA 2YBRA 4XD6A 1FG2B 3S9YA 1AQDB 4KWVA 4G5AA 1F73A 1V5JA 1I8JA 1WBXA 3BQUB 1QUMA 1ZRQA 3NO3A 4WDIA 2RUSA 3J27A 1FH5H 1P6WA 1ZGDA 4HUVB 3P3YA 4NP4L 4YU1A 2DBLH 1M1SA 3IMSA 3OC8A 3VC6A 5D37A 4JY4B 3NZUA 4OJDH 1R8LA 5DR5L 1MF2L 4OZIF 4I3RH 3FCTB 1XICA 1Q0XH 1NCDL 2HT2D 3LMYA 3QSRA 3CIQA 1UWXH 2BSSB 4JQAA 3ESOA 4N9CA 4NJ9L 3SJVB 3LKRA 2BFVL 2ED7A 3NK4A 5FEBA 4WUUD 2CXGA 3D0LB 4S1QL 1NCIA 1FL5A 1OANA 3DVGA 4TSAH 2AJSH 5DS1A 5J3HC 3VGFA 3C2VA 4OCXH 1QASA 4ZFOB 3MO1A 5AOZA 3LCLA 1FNSL 4C5ZA 5IIEB 3HHSA 3QN3A 3MA7A 5DJXA 1Y6MR 2O30A 3QFDA 3U4EA 2A0LC 2NY6D 1P7QD 4ML9A 1DKWA 2XX0A 1XGPA 4WW1B 1FDZA 5CPMA 2Z6IA 2DQIL 5JQ9A 5DRWB 4JBRA 3CXFA 5E1AB 1XCXA 3OODA 3S2AA 3MJGX 3E5PA 3DMMA 4C1NB 3CL7A 1CN4A 4QF1A 4PW4A 1ADSA 4PJCA 1V54B 2WIMA 3BMWA 4WJ5A 2XWCA 1ZGLB 1KTKE 3ILDA 3D85B 2PF6A 1EF3A 1US0A 1DCLA 2F9RA 4F7PB 2ZWNA 1W8NA 3GI8L 5T8IA 3N1MC 2G5RA 4JN8A 1ZHBA 3KVQA 5L6YH 5CEXA 1CXHA 1HXYA 4U10A 2DLHA 4UZGA 5JYLA 3C5SB 1TTQA 1MAJA 3FJ6A 5CSUA 3PSVA 1AG0A 3VWJC 1T4WA 3LI1A 1KCSL 4ES9A 1OP9A 2E7DA 4AAJA 4R3SA 3K4DA 4I3SH 1LO4L 2XV6B 4KK9C 3BZDA 2H8PA 4KI5F 3DBSA 3KYKH 2OB3A 3QXUA 1XPYA 3ATAA 4JYFA 2UXGA 3WUFA 3C9NA 5F7NC 4TPRH 4D72A 2RDUA 3WJLA 2A6KA 1WPCA 1UB5A 5K9KA 2C13A 1RJYA 3VU2A 3A67H 3Q9PA 1HHHA 3GXUB 4KV5F 3DU0A 1WH0A 4XP1H 1UZ4A 3UAJA 2OKTA 1P7KB 5E08H 2VSKB 1E40A 3LVEA 4RGOH 4HZ6A 2YKLH 4AGOA 1W72L 1NAMB 2EEBA 4A37A 4JM4H 1MFEH 4PYGA 3CAKA 4G1MA 5H8PA 3LMZA 4DP1X 4XAZA 5LXEA 4D1JA 3KAAA 4PODA 3KPQB 1RIUL 1QW8A 2B3RA 4Y1TA 3M1BB 3T0EA 5T1DL 1OX6A 2YQGA 2ZJSL 1AGEB 1BBJA 1JNLH 1AIFA 3P3RA 5GGTH 2X4RB 1BF2A 1CE1L 2CMRL 4M61B 1FNGA 5DK0B 1UB3A 1IEBB 4UBPC 5IEHA 1XLMA 5E8PA 3QTPA 2QV5A 1PFCA 2YBUA 4C6FA 4PW3A 2QGCA 1XIWB 1NFGA 1R5YA 5E5RB 5F0JB 1DQDL 2Q6WB 2CGRH 2WSDA 4WY0F 2QPXA 2GHWB 3EIFA 4TNEA 3QKEA 4ANXA 2CBMA 3URBA 1EPFA 3V5HB 4DYEA 3AXLA 1JGVH 3VI2A 2I7GA 1QPOA 4WJKB 4PJGA 4WW2A 3L2IA 5ACZB 3S4TA 1VF8A 3BEVA 2CBVA 3L3HB 2MHAA 1EHXA 5HPMB 5K9OA 4D3CL 3PVFA 3AIEA 3UYPA 4FIRA 3NRQA 2IDQA 2V2TA 4EAYA 5JOPD 3TVMA 3IBEA 1EB3A 4PJCE 3EYPA 2BVUA 4KJYA 3S6TA 4HGKC 3ARUA 3PCYA 3PNWA 4Q4KA 1TQUA 4JJHA 4S1DC 3PWNB 4I77H 4YE4H 1JRHL 1PCSA 3E49A 1YPXA 1FDJA 1PCWA 4E9LA 4JKPH 4PMVA 4L5ZA 1A5KC 4MMXA 1VZIA 4LF2A 4FE9A 2LU4A 4X5XB 2JK5A 2WXDM 3QIBD 1CURA 2PTXA 2O4MA 4NRZB 4WAFA 5KSAB 3FFDB 5ADOH 4Y8DC 2XXCB 2X2IA 1R0AL 2J7EA 4TQIA 3G5XA 3R06A 4BFOA 1FHUA 2Q8ZA 4WGHA 4GS7B 3MRNA 1I8IB 2AP2A 2YLHA 2G3ZA 5DC4B 3FTGA 2WD0A 1KFGA 5JA8B 2X1TA 4WI2A 4F0HA 3DXIA 3TTQA 2R91A 4JXCA 2ZRWA 2FZNA 1NEPA 1ONEA 4OT1L 2CLKA 3ZYZA 4XMLL 3GDCA 5JLZA 5CZVL 3B97A 5K5YA 4ENEC 3WJMB 1HXJA 1W3NA 4TULL 2YXXA 4NQTA 3HG1A 5D1ZA 1F6AB 2Q8BH 5F1KC 5E6ID 3DJ9A 3W7OA 3FB5A 4ZXBA 2QDGA 3FSTA 1H49A 1B0WA 1AI1L 3Q43A 2DT3A 3APDA 4ELMF 2WUBL 4RRPM 4FAMA 4JK0D 3VXTA 1IE4A 1KM1A 2HQAA 5MI0C 3UZEC 4W9KC 3T0EE 2HRLA 1HGYA 1OVDA 4W9HC 1NMAH 4EANA 3DHFA 3TWCH 3DUGA 3V4LA 4HKBB 5ISZD 3IDXL 3MDWA 4AGLA 4YPGB 5TH2A 4XAPA 3KS5A 1HQRA 1KULA 4IEFA 4Z18A 5C2BH 3B1TA 4PGDA 1IGML 4JFXB 1FY6A 5A2KH 1EOMA 3CAFA 3L66A 1RZGB 3QHMA 5FW7A 4XO7A 2HT4C 2XA3A 4GRLB 5A2AA 3RX5A 5KSUB 4IPPA 3PWPB 2CWXA 2VDOB 4NJAH 5F1NB 3U1SH 5CWSB 2J75A 3D3AA 4Y1SA 3TASA 3OXRB 4O2CA 1VEPA 2QQ6A 5AYIA 1S7VB 2EIBA 2WKJA 5AB0A 1NPJA 4YHKH 4AUJA 5EA9A 1DBKL 4PJGE 4HMNA 4HK3J 4F7TA 1N0LB 3TMQA 3FA4A 1QKZL 2Y36L 3IJLA 3N2BA 4JFOB 4UMBA 1Q65A 2IANB 2XG9A 2HH0H 2CGYA 2OL3A 3AG3B 4UTBA 3RWEA 1CDYA 3IGAA 1JF5A 4KRPB 3CFNA 1MJ8L 1KA9F 4FQQB 4NQSB 5ECJE 3EH3B 1UHVA 1QA9A 3KLHC 3BLPX 4XNZB 3ES7A 4AE1A 5ESQA 1KRMA 1TCRB 1FXPA 4AV0A 2EJAA 4H7VA 4RX4A 1UM6H 4YVPA 1XQLA 3QP3A 3BMVA 1R3HB 4RAHA 4N5UA 4UAOB 1AD9B 3BRFA 3DJRA 4NZ5A 4A7GA 5H35B 4POCA 1U5HA 1FPTH 1XSJA 5CPLA 1U58A 4EVZA 4LRNH 1KB9J 3OGCA 2FYYB 5BZAA 4MXWL 1KM3A 2P43B 2VO8A 4GXPA 5T1MA 3MLYL 4YHLH 3V6OA 4D6EA 3P3TA 4ZUSB 4QRUB 3BSZL 4ZOBA 1E4NA 4IU3A 1QTWA 1GUVA 2RFXB 3MLRL 5DRZB 5LGKA 5EOCJ 4LCCC 5D70L 5LXGH 3SECA 4WV1B 4N0FB 1S3HA 3WKQA 5C6MA 2YC1B 2JMRA 1H63A 4KROB 5TK4A 1FHVA 3CH8A 3HG1E 5BOFA 1FQ9C 2N1TE 2GIXA 3ZKXC 3DUHA 3PHQA 2BOCA 3HBQA 2FVLA 1YY8B 1G7VA 5AOUA 5E4EC 4N90D 5E2UL 1S2CA 1HQ4A 1MIMH 2ALRA 1K03A 2MNUA 3QJHB 4KRNA 4RISH 1BQUA 4LCUB 4QOKB 4NSKB 2NMSA 4E5XG 5FO7B 5CFHA 4I0PB 4JTRA 1E9QB 1ETA1 4ZNCD 3GZ3A 4HK0B 1A3RH 4MD0B 2ZOTA 5KAQG 4G83A 3P0YH 4ZQCA 3IJEA 1ZPLA 1N2RB 4JTIA 3D2TA 1JD7A 5GRVK 2A73A 2IGFH 1W3HA 2A38A 4LFYA 3LSOA 3B9DA 3MOAH 1J48A 3QR2A 2NQCA 4ZB0A 1D6EA 2V8LA 2YPLD 4HUWB 1EDHA 4F7MA 3UXIA 1GZPA 4NYLA 1DL7H 4FFZH 5C0ND 3W01A 3F6JA 2RAMA 3JYCA 3T0AA 4MJ6B 1OGAA 4OW6A 4Q6IC 4YDKH 3LQMA 3TA3D 4WI6A 3B6SA 1BPVA 1D3CA 5EYWA 3F01A 2I5YL 4Z42C 3A9IA 6CGTA 3GSOA 2X4SB 1Q90A 3GHPA 4GUPA 2CW6A 1FFPA 2Y6SD 4E4UA 4GACA 3SKUD 4FP8H 2R29A 4JO4L 2EGZA 3WK3A 1SJMA 2DQUH 5C0AB 4LEXH 4C4KO 5D71H 4JTFA 1EOKA 1OQFA 3CN3A 3PXJA 1XV8A 5TAOA 4FLQA 5A95A 3ZE2B 2UY6A 1DDHB 3AUOA 1FVDB 4HWBL 5C8JB 1KJMA 2PLCA 3INUL 1WDAA 2P7TA 2GGJA 5IJBC 4JZNB 2AJXH 3VH8A 4JDTL 2G5WA 3JWDH 5AWNL 3NQKA 3BHBA 4KGLA 3U2OA 3GXDA 5LAXA 3X1FA 2RHEA 2KAUC 3BDKA 1OY0A 1DQIA 4GG6F 1E15A 2Z3FA 3V6OE 1GHFL 4P2RB 3HO8A 3U7WH 4UV7L 3PTQA 1X5AA 4RAUA 2APVA 3TBYA 1BDYA 4GMEA 4K3GA 2AQWA 1QRNA 3CS2A 1V7NL 3JYBA 1RZIB 5JHLL 1XBRA 4DXXA 5C0GA 4ZPVA 2YLLA 1TFHA 1US2A 2WK2A 1E4WH 4R4FL 1RIHL 3FCUB 3K4ZA 3HLAA 1TTCA 2V37A 3E6EA 1ONQA 1C3FA 2VI0A 3I6LE 5CUSL 3QUYA 4YDVA 5BQDA 1X4XA 2Z1XA 2ADAA 2R2BA 4H6EA 3ZVVA 3UP1A 1YEEL 2H7WA 3H8NA 3QHFH 1XYMA 3BYTA 5DFVC 3MI6A 5GGVH 3FXIC 5EU9A 3OB8A 1E5ZA 1JGUL 2AK1L 3T9PA 4NXKA 1M3JA 5I19L 1AQKH 1XIHA 3GTNA 4H8PA 3EA1A 3TT3L 5I6SA 3U25A 2EKCA 4P2QD 3V1HA 2H4EA 5KBKA 1CFMA 4E9VA 4MNHB 1KV7A 2B39A 3CFBB 1HAUA 5D9MA 3QRGH 3BO8B 2HRPL 2QUTA 3SY1A 1A47A 1PZUB 3HNTH 2Y7MA 1IL1B 32C2B 2K8MA 3FSWA 3HEIB 1T7YA 5EU5A 2EKSA 4P46B 1ROWA 4DQOH 3VWKD 3EX6A 1AACA 1M65A 4K3EL 3RY5A 1OGAE 2CCVA 5GRWA 3P4OA 1GY1A 4CDHA 4DEFA 3QUML 1POKA 4OD1H 4W6WB 5LNSA 2MH4A 4OFPA 3AT9A 5MERB 3OPSA 3W5MA 1FFNB 5I1AA 3LRSB 1D3GA 5F3HB 4OE7A 4GW4B 4JPKL 1V0LA 4UNIA 1SW3A 1YYAA 1WO2A 4BKSC 3PM6A 5I2IA 4NOBA 3ETSA 2X1XR 1MY5A 3S2MA 3CXDL 2BGSA 1ZEAH 4EN3B 4GOAA 3OHXC 1BM3H 3HI6L 4X6EA 1S6NA 3E0WA 4AZHA 4WCYL 5HI3D 3OKMA 1XDJA 2IADA 1CIDA 4O8RA 3E9UA 2Q1EA 4C60A 1F6PA 3BKCH 4GAYB 2BSBA 5F89A 4PY7A 3RR4A 4F3HA 3PL6D 1XGUA 3AY4C 1KM6A 4X8CA 1BD2A 2FGWL 3LZLA 4EF3A 3V75A 3AHXA 3KLSA 2DL2A 3T0WA 1B3YA 3F7YA 4KXCA 1ECEA 1FL3B 1KM4A 1E42A 3ECUA 5ABFB 4KCWA 3TOPA 4BZ2H 1WUEA 4LLMA 4ZFGH 4H8WC 2PTDA 3UVAA 1EBGA 1UKSA 4B9IA 1UYWH 1WCQA 1HSBA 4H8HA 1TJMA 2ZDRA 2F15A 1FV1B 4PJDB 1QRNE 3GUTB 1NWTA 3STEA 4JHAH 4QWWC 5K9CA 3C08H 3CFCL 2OMXB 4XWGL 5G5DA 4C56B 3CGTA 3C0JA 4NAQA 3ABXA 1GZJA 1U8NB 2NY4B 1XZ0B 4P4RA 1DXIA 4DRSA 4Y16C 1TJGH 3GC3A 3OAZH 3BICA 4YNYA 2V3EA 4U1GC 4TMCA 4MJ2A 5I8EB 4F8QA 2XFGB 4DGUA 5JIMA 3QWOA 3MJ9L 3OZYA 3IRDA 2ADFL 2XT1B 4XCNB 3HPJA 4JFEB 5D6DA 4K71B 4RX0A 5DBTA 3KPLA 5EMUA 3D39A 1FHNA 3DETD 2EDDA 3BQUD 1LYQA 1UQSB 1KN4L 2ZYIA 4ZSUA 5JR1L 4C4BA 1E9ZB 3L9EA 4ORGB 3FRUB 1IWAA 4XNDA 3UWQA 3T1GA 4JIIX 4HYRA 1OX5A 4DN4L 3D08A 2RAGA 1FLTX 3HR5A 1CT5A 4DKFH 1KB5L 4PGEA 2ENYA 3OKYA 4E5XB 4U1MA 3Q94A 4PN2A 1UM5H 3DVNB 3SJVD 1MSSA 2VLJD 5F1IB 4X2PA 2ASHA 4QDPA 1BVLA 1I7RB 2HXTA 1Y65A 1XGDA 2CCWA 3GVQA 1P7QB 2BH0A 5LBSL 4Y5XB 1D5ZB 1IBYA 4HU8A 4AJVA 4DGIH 1OB1B 4RPQA 2EDKA 3N6YA 3KDMB 4PLNC 5D2TA 1VGAA 4MDIB 1UASA 4Q14A 2DM3A 3W7DA 5FV1L 3WEXA 1DZBA 1MLCB 1E4XL 1AS7A 3S46A 4LVEA 2PBOA 2O61B 1QLRA 4Q4PA 1FCCA 5CILL 5IEKA 3U9WA 1H6EA 3L7RA 1DBML 1EJRC 5AVRB 2ZRUA 3CH9A 3KPRA 1JTTA 3D85D 1KEGH 5M03A 2DEWX 1BD2E 3RY6A 1LE9A 2IPTH 3A6OA 1W2KT 3IPWA 4YWGH 3SSZA 3CBWA 3UYRL 3IFOB 3DC8A 1OPGL 3QQ3B 3JSSA 3MGOA 1JZJA 1URIA 4GRMA 1BKHA 2XWTA 3MCLL 2QVIA 4NASA 2EYSA 3RITA 3IDYC 2VYRE 2O5ZH 4Y1AA 3DUSA 2EDFA 4JFZH 4NO2A 3KM1A 1UB6A 1IC5L 3M17B 1HKVA 3B8YA 3HGRA 4RSVA 1KLZA 5I3IA 2XG4B 2YRZA 5FA3A 1NFDF 5LZLA 3DA0A 1RY8A 4N0RA 3FHQA 4KY2A 1XH0A 4ZTXA 2ZXDA 4IJ3B 1C12B 3TCEA 1A6WL 5L0QB 5KG9B 1QG3A 3SOBL 2NRDA 4IRJB 3HS8A 3OD3A 4K07A 1VJSA 1A7RL 1HHIB 3TIMA 3ZJKA 1CT8B 4I9XA 4NRXA 5IG7B 4XMTA 2OX4A 1DQWA 5CPQA 4PJFA 5L88L 3W6MA 4HIPA 1QWKA 1HW6A 2A4EA 2JKPA 5DQPA 4DLMA 1ALDA 5KW9H 2XZ7A 1CF8H 1HESA 4XNMB 1KGWA 2AFNA 3TBVB 3D39E 4XOAA 2PO6C 3ZTCC 3OAUH 5DRXB 3V5OA 2LLLA 2RCSL 3N73A 4K94H 4EE2A 3WI9A 1U8OA 2B1HL 5F0MB 3QQDA 1LQ2A 1DZ0A 1SJEA 3ZKNC 2CESA 4HHLA 4E8DA 1Y8BA 1XX1A 4X6DF 3BUQA 4KUZH 4I1NB 1XIGA 1EJFA 4MJJA 2P8MB 1A9EA 2XV2A 2Y6ZA 2QVHA 4Z7QE 3NEOA 3IARA 3BVJA 1YXDA 3WQOA 5DT1H 5GHWL 4DJFA 2MKWA 2FBRA 3IANA 3T42A 3W7PA 2UV8G 2APWA 4ZFFB 1G9MC 1W1ZA 1IWBA 4MCMA 1F11A 4U5KA 3MU7A 3CH1B 2VL5A 4ADJA 4FGMA 3LHUA 4RV3A 5DLMH 5IJCC 1F05A 4MYXA 1EO7A 3ONCA 4LQFL 3GU1A 3VUSA 2Y5TB 1F90L 4UINH 4NRYB 4O1CA 1SY6H 3APMA 1JUEA 1CTMA 5FJIA 5CJQL 1HEZB 2TSYA 3ULVE 4MA1C 3EUUA 5BXFA 1HOEA 3WHE1 1MFNA 5JW5B 1QFWM 2YAEA 3WLWD 1BYPA 4AQ1B 4MRBA 4R7JA 1KCWA 1TJIH 3B0UX 1X44A 4XO4A 3WTWA 2G0KA 1S5MA 3KPRE 1TR9A 2F74B 4LSUH 2V9UA 2XZAH 1CGSL 3O2VL 3EDDA 3UA4A 2GAZA 3MRGB 5GGSY 3PTKA 1QHOA 3X13A 3B56A 3WO3B 5ALBL 4FABH 1P4LB 3FUFA 3W7NA 1ICPA 1CGUA 5L8LB 3LYEA 1PYMA 5KSAD 4Y1AE 3VKBA 1N6QH 2ISVA 3OG6B 1TPXC 1BRLB 4OD2A 3DIPA 4E4FA 2B5IB 4N1CA 2FJHB 1E55A 3B43A 4RMTA 2DF3A 4Y2DA 4O1DA 4ALAH 1QT1A 2YDSA 4HPNA 1V4YA 3T6CA 1UH3A 3ZTEA 3RUGF 4OBRA 4X5WA 3V8CA 1KG0A 5T9BG 5GGUB 2ZKMX 4PJFE 1KRBC 4KNQA 3QMTA 3Q45A 2OX5A 3KJ6H 3VQMA 4TXEA 3ROOB 1ECZA 4RFNC 2DBLL 2W0KA 3QDAA 1WEJL 1T3FB 5J12C 3W39B 3F7LA 3FRPA 3CLFL 4R34A 4EKXA 2XFFA 5IUSA 1RCXB 5EMLA 3F4NA 3F84A 3FB6B 3U2SB 4MAYC 4I3RL 3HBGA 2A9MH 3BQ5A 1Q0XL 2CIIA 3I84A 2OELA 4ZQKA 3LTSA 2YS4A 3O9WC 4IP7A 1NPUA 1ZPUA 3M7WA 2E9GA 5GZOC 4ZO8A 1XIEA 5B39G 1U3HA 2OZNA 1MUCA 4GRLD 4G1NA 4TSAL 3C5XA 3PWPD 3V52H 4OCXL 5I6OA 3W2JA 3W2NA 1BWMA 3WQWA 1NEZA 3GD6A 1QQDB 1RZKC 2DMHA 3DFHA 1IAKA 4JTTA 4NI8A 2Y7LA 1IE7C 2ATSA 1D5XA 4I6VA 1GEHA 1NM9A 1JDAA 1EAQA 1THCA 2C9SA 4D8ZA 3Q2NA 1HG3A 3CH0A 2EXOA 3GS7A 4MDJA 3KLKA 5GGQH 1GSKA 2ZXGA 3L65A 2IAND 4UIMA 4CC1A 3ML8A 1KFBA 2IAMC 2QUUA 1P1MA 5HQEA 1KYUA 2VT0A 4UTTC 3UTQA 4IBUA 1CLZH 2RIKA 4WFGE 3AQDA 3EYVA 3EXTA 3WNKA 4OF3A 3BVVA 3H2FA 1FNEB 4ZW6A 2E74C 2R24A 1ANUA 4FL4C 1LO2L 1OTUD 3OSVA 3LQLA 4FFWC 1JVNA 3CNYA 1Y18A 1YEDA 2IALA 3F5WB 4PJ8B 4FSAA 5HNUA 5F7YC 4OGAD 2X1RA 3NZ1A 1TOXA 1JZ3A 4XP4H 3M64A 3H4GA 5ESAB 3DJZA 1BXXA 1PSCA 3GDTA 3NL5A 5CD3A 5F7BA 1XBYA 2HFEA 4V11A 1PKNA 2QDDA 4I1RA 4I3SL 1V3LA 3C6LA 3EKZA 2X6BA 4X4XA 1RA5A 3KYKL 3P9MA 3RGVB 3GYEA 2CIKA 3GMPA 4NO5A 3C4UA 4TPRL 4NQVB 4FXRA 4S3FA 2XRAH 1ERNA 3QZWA 4M8UA 1V05A 3A67L 3AB0B 2AV1B 1FH2A 3OLDA 4TTDD 3TV8A 2ALDA 1XRSA 3KVLA 3MC5A 4BDVB 4XP1L 2AAMA 2I24N 5E08L 4YHYC 2A2QT 3QIWC 4CRPA 3CNKA 4F0SA 3NSFA 4RGOL 4G3YL 4P57B 1CFSB 5AVHA 2YKLL 5K7JA 1R24A 4KROD 3USZA 1A9BA 4JM4L 2YB1A 4DZBA 3EJJX 2WXFA 2J25A 2FIRT 1SMOA 3SPVB 2B9BA 1XKJA 1IC4H 3Q5OA 2CQVA 2ACQA 3EOAA 4YLCA 5AOLA 5GGTL 3E2VA 3UG4A 4QOKD 4A22A 4ZZFA 1WBHA 4INFA 1I8LC 4I0PD 4BR1A 2YBGA 5EUOF 3S34H 5DRNA 1U2HA 5AOJA 2DGAA 1A6PA 4HOWA 5C9KA 3TW9A 3IPEA 1TMLA 1DVFB 4A66A 3CEPA 3D6NA 2X7VA 3GTHA 1W9DM 4JDVB 1JGVL 1ZSDB 1Y0LB 5M1TA 1GQKA 1W6TA 1JN6A 4CN6A 1DHKA 2NYZA 2J47A 5IOKA 3FFSA 3GMOB 5IQ7L 2W0FA 2XWZA 3TA3B 2BWQA 4OLZH 5KYXB 3HN3A 1J2BA 3ZDZB 4A7GF 4OLWH 5B8CA 3PGDB 5IKCA 3LEXA 4OQTA 4PGBA 4F37F 3CN1A 1YQVH 1Q72H 3CPLB 4YHMH 1UZHA 1J5OH 2X40A 3V0DA 2OFQA 3V5DA 1N9PA 4J4PA 4KTDL 3AS1A 4XKYB 2ZCGA 4BXVA 1ITUA 1IIKA 4ROQA 4OV6F 2J73A 4WHYG 3ULSB 5IVXA 4JY8A 5GS0C 4I77L 4MSWA 2J56A 5C0AD 2H2PC 3QUXD 3H9YA 4GRWB 2BNRB 3EAKA 1D7FA 1V77A 4JKPL 4DO7A 5E5MA 4MYWB 1B4KA 2JJUA 3BWWA 3NJMA 2CLRA 3ELFA 4R84A 5ADOL 4IU2B 3FQUA 4FYQA 3LRKA 5HMDA 4JCWA 4ESKA 1LRNA 2ENPA 3APYA 4JD4A 2R27A 3BH9B 5IB4A 4TMBA 3WK1A 3MHGA 2PMQA 4FX6M 2QHRH 4XB7A 2QIWA 2L5HA 5BWFA 1A0QH 4LXFA 4RA3A 1QWHA 2ZUTA 4L29B 1SXCA 3EOLA 4P2RD 5TDPA 4PMYA 3VAEA 1RJQA 1YSOA 4JAMB 5CCHE 4LHUB 1LLZA 4M29A 2Q8BL 4FB7A 3FT1A 3TCXA 3SDCA 3RMJA 1HHJB 4ZRGA 1MW3A 2FJFB 3P74A 4X9FA 5GGRA 5J04A 3KAOA 2V8MA 4N4QA 8RUCA 3J8F7 2QR0B 5B21A 2XC8A 3K8MA 4OF5A 1Z3NA 1NMAL 1PX3A 3TWCL 3H7LA 3K1GA 4LGRB 1TU2B 1A1MB 2ANUA 4MLJA 4Y9GA 3VG9C 5JIPA 5IUCA 1RXLA 2EBNA 5CCZA 6PCYA 5C2BL 1ZCCA 5CLZA 1L9NA 5K9JH 4L7ZA 5IBLD 3BFWA 2D0GA 4A6YB 4LSBA 2BCMA 1UD8A 1MIEL 5AQ0A 4NJAL 3NIFE 1XHHA 1UWYA 4JJ5A 3U1SL 1T2QH 3ULUD 2YPIA 5CGTA 4QYOB 3BFOA 3G24A 1R5VA 1YEFH 4F8XA 4NO3A 1GYWA 4YHKL 4F2UA 3G7TA 3G6MA 5DQ9A 3ZE0B 4U5IA 1OAKH 1T5KA 2BZCA 4P46D 2XIQA 4KWUA 2UY5A 3FYIB 2VTFA 2HH0L 3JTSB 3M0YA 3CX5J 2J6WA 2VCOA 4BI5A 3GC2A 3B7TA 2P3EA 1EXHA 1YECL 3RG6A 1GOGA 1DYZA 1FL6A 1CG9A 3N06B 1XR8A 4GW5B 4MY9A 3VFOA 3P4MA 1UM6L 5IVXE 5K39A 1OP4A 4HA4A 3IMVA 3V3WA 1UZGA 2EDBA 4GVIA 1FPTL 3QXAA 4PJ9A 4EN3D 5LKYA 4HXAH 1G6CA 5D93C 4MFEA 1ISZA 4B9ZA 5HDOA 3FBKA 2KQNA 1ZAJA 3IIPA 1OT2A 3RO6A 3BN3B 2J55A 1E65A 1YY9D 3G6JF 1T96A 4QRPA 2BPBA 4L4LA 4YHLL 2HG5B 2O4EA 5CPOA 1X5HA 3ABKB 1JZ8A 3X1BA 1YAZA 2E8ZA 1SZRA 1FUYA 5AG8A 2KLTA 2HVOA 3V0HA 7FABH 3C61A 1HJUA 4CU6A 3RP1A 4N6RB 3TLLA 5LXGL 5I3FA 1E2ZA 4JY6B 1J8SA 4QDWA 2YGPA 5KWYC 1MELA 1CVSC 3E6FB 3WEMA 3WH5A 1ZJAA 2FQFA 2WINA 2JJVA 1F42A 2QBWA 3D46A 4R4ND 2CHXA 1PKLA 3S3DB 4JM2A 2VZOA 3C5JA 4C56D 3QIUC 2P42B 4PRTA 1J11A 4G70B 4JZOB 1RULH 3BZ4B 2NY4D 4JRYA 1OIOA 3VINA 4PRPA 1WJ3A 3TO4D 5BRZB 2EH8H 4PP2B 3FDWA 3GF8A 1HNFA 1A6VH 3LZPA 4PLJC 1CD8A 3PDOB 4TNWK 4X99B 5LXXA 3SY0A 4P5TB 3UGRA 2H32B 4LBAA 2Y8VA 4YL4A 4AK2A 4MJIA 3FDKA 4I5UA 3SRKA 5GS2D 3RIFK 3WGVB 4JFED 1OW0A 5T3XE 1JQVA 5IY5B 4UQ9A 2IGFL 3MOAL 2Z2AA 2QAPA 1JGLH 4HSCX 3N43F 1IGWA 1ZLWK 5IXEA 4NAEB 2Z6FA 2IVFC 3A4WA 3T8XA 2WXQA 5FCUH 5FM4A 2VERA 1Z6JT 4FFZL 3MCOA 3P73A 3ZYOA 3WIFB 5ID0B 2R94A 1TXKA 4S39A 4YDKL 1U33A 4PMRA 3EO0A 5IM7B 2IMRA 2VLJB 1UT9A 3LN4B 4AEFA 3H4HA 2GKIA 2HPIA 1B54A 4F0MA 1DQTA 3RK8A 1FWNA 3CQJA 5CPSA 2CDEB 4ZTOH 4FP8L 2WO2B 1NWSA 3I9PA 1GAFH 4LEXL 5D71L 1MWAA 1XGQA 4BCZA 3MRBA 5CU9A 1OD0A 3SQSA 3DYMA 1UJ3B 4HYTB 4WO0A 4CNOA 3AXMA 2JIXA 2V82A 2GC4C 5DK3A 4OZGA 1ET8A 1E8YA 1QFOA 3NJIA 4P2CG 4GFSA 4TS6A 4TNVF 5MHBA 5ACMA 1BA9A 3G5ZB 5TTRA 2AJXL 1T6VN 3JWDL 4W9EC 3GRWA 4ZE4A 2PCQA 4AIUA 5IFAH 3FPXA 1TKKA 1FYHB 1CBGA 3MRCA 3UTOA 1V10A 4QXUH 5K93A 4QRPE 3TA9A 3QWRD 2WXJA 1OPOA 4RE4A 1ILUA 1KGYE 3U7WL 2PRHA 4IPLA 4NT6A 3R7QA 2MQCA 3WIHH 3O8XB 3IV8A 2YARA 1GC1C 2DWDA 3APFA 2DW5A 3BV4A 5CEYB 4QUOA 4X4KA 5A8NA 3S36H 3B3DA 4CQ8A 1GPFA 4IJCA 3GBEA 3S98A 1E4WL 2CBIA 2V8ZA 5EU6A 4LV4A 4AVOA 1CE6B 2UBPC 1E43A 4NKQB 1EJ6A 3EDEA 5F70A 4DQAA 4HEPG 5TDNB 1TJ2A 4AMWA 4JRYE 4ZO9A 4ZYKA 3QHFL 5GGVL 4PRPE 8CGTA 4IRJD 4PRNA 4O4WA 1GYLA 1D8WA 3NJLA 3TNBA 1AQKL 3IAQA 3L5WB 1R47A 2I85A 1IFHH 5KBDA 1A4LA 3NPSB 1I9RH 3P02A 3WBEA 4MJIE 1L9PA 3A4JA 4O8AA 4ZMGA 4LDEB 2OJEB 3WJWA 2WYTA 1SOSA 3DFOA 4B9YA 3ABGA 1QSEB 1WSST 1U8IB 2VDKH 3OKLB 1I6NA 3GMLA 1CTOA 3PNRB 2OMTB 4F20A 4MXVF 3QORC 4EIGB 5CJOH 4XNBA 3M41A 2JI1A 1O7DC 4DQOL 1QU4A 3ITYA 2APTA 5JH2A 2P24A 1VACA 5C09A 3IFPB 4OD1L 5CBEA 3MTWA 3TFKC 3DGCR 5DVKA 2AKRB 1BVKB 3L3OB 1JF1A 4UM8B 1XGTB 3TN0B 4HK6A 4LPYA 3N2JA 4C6NA 4WOQA 4JN6A 2FR4A 3FQXA 4R27A 1IKOP 5DD0L 2DZXA 3VJ6A 5IESH 1BG1A 1KEML 1F3EA 2YLAA 4CW1B 3X17A 4HJJH 2XZQH 3MVTA 3N3EA 5GGSB 5IQNA 1TDQA 3F65A 4OZGE 4PJBA 5FO2A 1BM3L 2Y3AA 4RFEA 5F7WC 2V68A 1D9KA 4R33A 2Y06L 1MAKA 3OA3A 5FFLA 1K8YA 1AH0A 4CMHB 3QZLA 3BKCL 3IACA 3I9GH 1Q94B 2UY7A 1UC6A 4IKKA 2NTFB 1GCFA 4K8RC 1W72B 4XHJC 4ZBCA 3F58H 3L23A 2WB7A 2PWGA 1F3TA 5J1SC 2QCEA 5DXYA 4DXVA 5FDWB 4J3ZA 4BZ2L 4E6MA 2ICEA 3VYLA 1LT7A 4ZFGL 5FYKD 3KCOA 1SFHA 3BT2L 2KZBA 1TJ1A 1LP9A 1DP0A 2OOFA 3P54A 5A7BA 2Q7AA 1ZY9A 2R6OA 4AC4A 4RNRA 3C08L 5C9RA 2IIJA 2VJXA 2NNXA 5BWAA 1G67A 1XIMA 4TOYL 2XPGB 3JTBA 2ITCA 3SFKA 4XBEH 5EU6E 3O3UN 5BPPA 1P43A 1FRBA 2NCMA 2VMDA 3PU7A 3T77B 3C8KB 3LZOA 3MYPA 3NCJH 4PWHA 4JRFA 5BO1H 2BRRH 2YJLA 4XZBA 3VCLB 1TJGL 2IOIA 2JTYA 4NYUA 3FU8A 4H40A 2ZXQA 1YYLH 5BOEA 5I8KL 4UM9B 5BW6A 4PJAB 3K4WA 4G11A 1WWAX 3D87B 2ICWI 4HCRH 3QAZB 2YPKB 3ARBA 4ZPTA 4A8RA 1WUNT 5F1VA 3CU7A 2GTWA 1XIJA 3BUYA 1TE1A 3QI9A 2PTYA 2WBJB 4HJ0C 1ZTXH 1EEPA 1FJ1B 2IMMA 3KH3A 1D7KA 1PZ2A 2DSZA 3S2JA 4K7PX 2Y7NA 3UZVB 3GXIA 4J6IA 2CHZA 1VGEH 4NZRH 2JQMA 1A25A 1S7RA 4K23H 1FOBA 1XSOA 3ITCA 3D06A 5DLLA 3RQ3A 1W9UA 1W3LA 4JKWA 4L18A 1A22B 2M2DA 3P60A 4G43A 5AENA 2FGLA 3LGDA 5C09E 4PGZA 3CFTA 1DN0A 2A99A 1FVPA 4GMTH 2GJZB 1L7TH 4X6BB 2A7NA 4X4YB 4BEUA 4KKLC 5BZWA 2AZUA 1PYWB 1ECQA 1CVRA 2BP0A 2OFJA 2WLYA 4JREC 3IJ6A 3TSMA 2R2HA 4H0LC 4P3WA 2EUXA 3K6SA 3KWWB 4UQIM 1G7LA 5D2LB 4GP4B 2CO4A 1A4MA 1EWDA 4DGIL 4GAJH 2CZVA 5ILTH 3HQOA 3MROA 2QQLH 4O53A 4HUUA 1ZS8B 4WTWA 4FXGC 9RUBA 3LIZA 5FACA 3U6XA 4PJBE 4XAFA 43C9A 2B4CC 5J13C 2IS7A 3MUCA 1SR0A 2IQTA 5J11C 1HHGB 4S3CA 3PB2A 3WLIA 1KEGL 3TZVA 3ENEA 4MBOA 4M8VA 2V38A 1YUKB 1LBFA 2IPTL 3PV6B 3EKGA 4PLKC 4UZSA 2RB8A 1X4YA 1WT5C 4WI4A 2P4AB 4YWGL 3Q44A 1ROCA 4YHOH 3CAWA 5T5FA 4HGWB 4MG4A 3UESA 2CZDA 4PJ8D 2VN6A 1I2PA 4XPTH 3QZEA 1LP9E 4X7SH 2O5ZL 3UBPC 4JFZL 3ARFC 3MFFB 5JNYB 3ABQA 5LQBH 1A2YA 2NZ1A 5IHLB 1L9SA 4EDXB 1R17A 5CPTA 3SO7A 3RGVD 1V5XA 1XL4A 2C1GA 3DCPA 5EO1A 4C4KT 3VMOA 2REQA 2WLJA 1OGGA 3V10A 2Y8UA 3W2KA 3WUWB 2ENQA 1OAZH 2V2DA 1NUNB 4AUBA 3W7RA 3S3BB 3HLKA 4LHJB 4JPVH 1G7PB 3TBWB 4ZAKB 1KXTB 4L1HA 1FIEA 5KW9L 2IGLA 3KBHE 4EPEC 1CF8L 3QWNA 3FJLA 1TE6A 2GWGA 4W9GC 3OAUL 2G4EA 4OAWB 3TN3A 2CKSA 2IOMA 4L2LA 2UX7A 4K94L 2OODA 4OM0H 2DPEA 2YFNA 2M1KA 4KUZL 3EPOA 2VRQA 1PKQA 2HS8A 1QHQA 4OUUA 2P8LA 4I6KA 4GI9A 3BXNA 2VR6A 3ARQA 4ZL1A 3BZEB 4WVRA 3V5FA 4LASH 2HFFB 4R7DB 3WL0A 4HLZG 5IBTH 3WNLA 5DT1L 1QOXA 4OGQC 4WKZA 4XUGA 2P26A 1DVFD 5FKPA 3EDKA 1QO3A 4S0TD 4XTRC 4O0KA 2AGJH 5G4EA 4RSYA 4B2DD 4MWAC 3IJHB 1EEUA 3R0MA 1J9TA 2BY0A 2GTZB 3CPGA 5BS0A 2UX6A 5AAMA 2DQTH 3DIDA 3RWCB 4FXFA 3VOGA 2ROYA 1AQHA 4UINL 2UZXA 3FNKA 4ZDHA 2HUEA 5BNKA 1SY6L 5F7KC 3R5EA 3W3BA 2AQRA 1JD9A 3EZ4A 2CLZB 3IVTA 1WXYA 1FGVH 1QBML 4JEGB 5E99H 4WLCA 1NFKA 2E7LA 1WRFA 4UOW1 4WQOA 4M7LT 4NN7B 5FYJD 4L3EB 4XBPA 1TJIL 5J06A 4P5MA 2EAWA 1S2UA 4ELDA 3QJUB 1VFFA 1AD0B 4Q4EA 1OSEA 4Q2ZA 1OP5H 1EXGA 3QUXB 3QPQC 4N9OB 4LSUL 2B0MA 1XLKA 2J1XA 2XZAL 2JLLA 1HH9B 1K8XA 1QPPA 2BNRD 3MRIB 2FZ3B 3RTQC 4UTWA 3VIPA 2F58H 3CFJB 1Q9KA 4OZFB 1EUAA 3ALXA 2PMZA 1GOIA 1YQ2A 4MFHA 4FABL 5DCCA 3WD1A 2ZTKA 4XAKD 3FCSA 4BF7A 4RGMC 1N6QL 2E25A 1DVUA 2QCNA 3O6DA 4IX2A 4H20L 1CIUA 1J5DA 2J1ZA 1XBXA 3GVGA 1JPFB 1X9RA 4HHAA 3X1GA 3EWBX 4QRQA 4OGYL 2BSTB 4WWOA 1CI5A 5REQB 4ALAL 4I18A 4CU7A 4FN0A 1SGJA 1AXSA 1JVKA 5EKYA 5J9PA 1OKEA 3BP7A 3II2A 2QJIA 3SD2A 3N2CA 5DHMC 2H9AA 5I23A 4DP2X 3W82A 1FP5A 1PFOA 2YO3A 4LHUD 4LSQL 2AANA 3KJ6L 1JHKH 3QCVH 4R7LA 2PPCA 2YDAA 5DDHA 1F02I 1C5CH 4M6QA 3K4AA 3VVVA 5E2WH 2D2GA 4W4OA 1MG3C 5A3ID 3ITXA 3HE7B 3SDAB 5J5EA 1D2PA 3QLDA 1YTEA 3W9EB 2A9ML 4RDZA 4GUQA 4YXLH 3CSPA 3L3KA 3V1PA 2IWFA 1RZ8B 1PKQE 4S3KA 4ZX4A 4HBCH 1RQ5A 2R1NA 2AEWA 5HMEA 3LI0A 3KFTA 1S78D 4WWKB 3B2XA 3HUJB 5FOJA 3D47A 2I9LB 1QP1A 3AQZA 4QISA 3V52L 4GQRA 1BMGA 1W5QA 4BUQA 4N9EA 9CGTA 4GBDA 3T8LA 5IBXC 2PF0A 5MHSE 4EBQH 2FGBA 3T55A 1UKTA 3D9AH 5BS0E 1WV7T 3WKNA 1SQ2N 2HJFB 3SKJH 2B9AA 3U4KA 2A74C 3WNIA 4PB9L 4X8XA 3X3FH 5GGQL 4ABWA 1MCWM 4E8CA 4X61A 3WAJA 3CUPA 3UIYA 2PWUA 1RCQA 2XNAB 3FO2B 4GKOA 5T33H 2BDQA 3VRJB 5FI8A 1CLZL 4PR5A 4Z7VF 3VXSA 3VAVA 4BQ3A 4LCRA 1P4UA 2PE4A 4LEEA 2AJ3B 2XVKA 1I3RB 4U1NB 3M0JA 4ATTA 4CGUB 2OMNA 5FA4A 2FEEI 2HVJB 3WNPA 4XP4L 1Q85A 4DKTA 3FQRA 3D3VB 4AG0A 4GNVA 4L9DA 3HOJA 3ICJA 4FLSA 4GBXC 2DVTA 3WLSA 4G8GA 4B16A 4AL8L 2Q8XA 3NH7H 3RZCA 5HHME 3WIIL 4YSUA 1G4EA 3BH4A 1KLFA 4ONHB 4ZBJA 4A68A 4PV9A 3CIWA 3CVHA 5CIPA 3GJFH 3K5XA 2ZG3A 3QVAA 3M5XA 1P53A 4XZ4A 3AAMA 3MZGB 3IWVA 1NBZB 4QY8B 1TPH1 5AKRA 4PFHA 3FHAA 1IAIM 3RLSA 4OKVA 3LCIA 4UTIA 1DQJA 4XMPH 3NACH 1B3JA 2WYHA 3ZLHA 4KDTC 2SFPA 1AZ2A 3GEFA 1KCUL 4WO4C 1WCGA 1G1YA 1PTZA 4N6EA 5F1SA 4TOQA 1QI3A 4Y7EA 1IILE 4NZUH 4PJEB 4UI2A 4NJJA 3EMQA 3QUMB 5EV7A 1FWFC 2X7WA 1IC4L 4Q58C 2GDQA 4ZENA 1ITBB 2Z1KA 3TO4B 3LM7A 1E6NA 1X5GA 4CAGA 3ITLA 4LCWB 5C54A 5BRZD 3BVNB 4PGCB 5U7SA 5CG7A 1XR9A 3S35X 1URZA 4CD7A 1VYRA 2D3LA 2WWOA 1KLUA 2HTLC 2BHFA 2V81A 4QSHA 3UXLA 3IJDA 3FN0H 3S34L 4G56A 3WTUA 3GFZA 2Q3RA 4AQZA 3I75A 4P5TD 4Z3FA 3H2OA 5I1JH 1V0NA 2GOKA 1AO7A 3BZFB 1UR0A 3H3BC 4M3JA 5G2WA 3RHGA 43CAB 4N2EA 1I8KA 1ZP3A 3QAQA 5HYJA 4Q0XH 1FE8H 2FX8L 5JOEA 4FAAB 2EO1A 2K9FB 3SPHA 3RDKA 5HHNA 1IXNA 5DMLA 2V0TA 2EE3A 4L8SA 4QNWA 1VD6A 5HDQH 1IGFH 3MUUA 1BYAA 1G4SA 3STLA 2CO3A 4NKIL 4Y5VB 4OLZL 3T2NL 4KIEA 4YBLB 4LC6A 4JX4A 1JGEA 2Y2WA 2VSCA 3V7AG 3OKNA 4L1XA 1EFXA 1EQWA 1YQVL 1Q72L 4YHML 1J5OL 5GSRB 3DMMC 2X38A 5AVUB 3V6FA 2OZ3A 2Y62A 4M1CC 3VXSE 3UXKA 4PTXA 3LB6D 3VK5A 1ZFJA 3V0SA 3QPXL 5D05A 3GAKA 3LV3A 3LPFA 4H1LA 2E40A 1XDLA 3NJHA 4I7WA 2YX0A 5HJ3A 5ENWB 2H6RA 2F5BH 1M2VA 3H2QA 1HEJC 2VXQL 1DVJA 5H1WA 3LRHA 5BVJA 1FFTB 4PJXA 4W81A 5JO5A 3W1AA 2Q9OA 4BGDA 1ENUA 2N56A 4ZNEA 4Q6KA 2EDXA 2P1YA 4G8GE 1ZT7B 4JM2F 4AEHH 3IDNA 4JFQB 4L3FA 1IAII 3IM1A 4NN6C 3SODB 3TTSA 3NQFA 1A0QL 3VXMB 1OABA 4QMEA 5F88B 4R3UA 1HF6A 3WJLC 3SE4C 1UURA 2MNJB 4YHIB 5I6MA 4X4ZA 3O8XD 4M00A 4U0RB 3D33A 2J27A 3G6LA 3RFZB 1KB5B 3UAJC 2AJYL 2YLKA 3KPOB 5F0PB 1T1WA 3TCLA 3FV9A 5FA5A 3RWIB 3QGAC 3GUWA 3GO1H 2HLFC 5AYZA 3L5IA 3MZNA 3HB3B 2OAAA 3IN0A 1OAQL 2PLMA 5JA9A 2F2HA 4PJ5A 4Q4OA 1UG6A 3T0EC 3MY9A 4MB1A 5D7SL 4YDJB 4Q9BA 1VRXA 5PCYA 2O56A 2JI2A 1XH1A 3GSQB 3QRHA 7ODCA 4J28A 2WLHA 5IK3B 1BCIA 3CQ0A 3VZXA 2J7LA 1P1ZA 3IKCB 2O6CA 4KDVA 2G4GA 1XFBA 1AO7E 5IM51 3BO9A 1NEUA 4OU1A 4B4FA 4HISA 1YEFL 1WHOA 5HYJE 4IRZH 1W1A1 4ZX5A 1QSED 1H15A 1LJYA 5AG9A 2X1QA 1KYDA 1D7DA 1N64H 1OT1A 1OAKL 3HI1A 5KOMC 4LAOA 3FT4A 1JQXA 1O5XA 3FQ4A 4WW2C 1O5RA 4KVNL 1FCBA 3RJYA 5ICYB 4HMEA 1HCZA 1EA9C 3ISWA 4JFHD 1V03A 3WKYA 2YCLB 2Y85A 2FNWA 1WCBB 5HHQB 1U8CA 2PBGA 1HCFX 1LF1A 4L37B 1HQTA 3DV4B 1S3KH 2PDNA 1JMXA 4PJCF 3IGFA 2KI6A 1BFOB 4ICXA 3MYOA 5D7HA 2AEOA 2J88A 1CFQB 1PIGA 4YVUA 4GUJA 2ZE0A 3TVMC 5I74C 4H9YA 4APXB 5BMXA 3TN0D 3O3BB 3TU6A 2VDPH 3GD1C 1LTXA 3BLOA 5AW5B 1CMOA 2VD8A 5CEZH 3GAYA 1F4YH 2JLPA 3RU8L 1TQCB 2VX6A 2BW4A 1PG7X 3VZZA 1H5BB 4KZEH 2EIZA 4PWEA 1CCZA 2Z0UA 3EJCA 4PV1C 4D0CB 1JNHA 3TU9A 4FNRA 4Y4KA 1A7NH 3JUYA 5K1VA 1T0MB 2QTVA 3RWHB 3ZDYB 4PJXE 4BH8B 2WO3B 4ZNEE 3H55A 4ZTPL 4EX4A 5KTEH 5D38A 1KXHA 4G6MH 3RWFA 2D2HA 4YQXL 2BVEA 7FABL 1R3TA 3BG9A 3WD5H 4XMZA 1RSYA 4JIHA 2O5NA 2WSPA 5I76A 4LUTB 3UY8A 3LCHA 3WBYA 4LHUG 3VTAA 2H3DA 3ARTA 2EPLX 2XN1A 2AJUL 2FB4H 2FX7H 5GGVY 5IBUB 4RKAA 5LGHH 5BJTB 5D1ZC 2RHGA 4H9XA 4FS0A 1M01A 4AYGA 3UP6A 1H9DA 4AY8A 1QW9A 4ZXBC 4ZSOA 1RULL 4L8CB 1UOKA 4X22A 4RESB 4G6JH 4TQPA 3E0LA 3EJQA 3IDIA 1YC8A 3T0DA 4QGCA 1SYSB 2EH8L 2C3WA 4P23B 3M0HA 1GGIH 1TVHB 4PJ5E 4NLHA 1A6VL 3MUGB 5A6JA 4IGHA 3QJOA 4G7FA 2DTMH 4UM9D 4ODXB 1MLBB 2X7LB 3MRFB 2OJ1A 1IEAB 4DWSA 4X60A 3NTCH 1P7TB 4HXBH 1UP3A 2EZ0C 4FKEA 4AKQA 4YSPA 1AZUA 1FH5L 1E70M 2CLOA 3IDMA 2WBJD 2F61A 1IT8A 3NG3A 3PWLB 3P5ZA 1JGLL 3CDZA 1W8SA 5DHVA 4NKOB 4N6FA 4LLVA 3KS6A 5FCUL 2D3JA 1QEWB 35C8H 2HT3D 1O6SA 4HWZB 4PJGF 3HPLA 4WW2F 4APQB 4D9QE 1JVOA 1JVLA 1VBJA 2XWJB 2YW3A 5IHBA 2P5WB 1ETZB 3TDFA 4KZCA 3S5YA 4LLUA 4HV8A 3AWEA 4P9HC 5K1JA 3OHMB 3NL3A 2EVHA 2AJSL 4ZTOL 4JTSA 1WFNA 1M05B 4LAKA 1GAFL 4EOWH 6XIAA 1TNNA 4L6OA 4JGNA 3HF3A 2QUNA 2W9DH 2AW2A 5TPWH 4LUIA 3WDHA 1W1IE 4Y4FA 1L3NA 3CUXA 1REIA 3US9A 4CSPA 4KBXA 1FZJB 3WNOA 5I9QC 2PYEB 3L45A 4C83B 1OD9A 1LP9F 1BZ7B 1QFWI 2P45B 2Z35B 1NJ9B 2MCPH 3MNWB 5TK2A 2GIYA 3LKSB 5H37G 4GKNA 4DW2H 3HAEA 4CQCA 3VI3A 5IFAL 1O5PA 1SLWA 1XGRB 2XZZA 4QXUL 1UZ1A 4F33A 4GSRA 1TYGA 4W5UA 1XYCA 4AGMA 2C1IA 1BGXH 3ULAB 1PS3A 2CE6A 4WTQA 5L6YL 2CLIA 3WIHL 5D8WA 2XFXA 4W86A 3G1DA 2ZOKA 1PMYA 2ZSVB 3T0CA 4ALDA 4P8QA 3S36L 4HWUA 5I02A 2AQOA 1T1YA 4JTJA 1I4FB 2WVSA 5BCAA 2AQPA 3PTDA 3R11A 4WFHE 2IH3A 4GG8B 2PURA 3MV7B 5E2VH 1KCXA 2XXGA 1CD1A 4WNQB 4X7FC 3BDBA 3SGUA 2QKSA 1I75A 4ZSOE 2VM9A 3PREA 3W81A 2BG5A 3V7PA 4E3TA 3UXAA 3LD5A 4JN7A 4AH7A 3MVIA 3T8QA 2APBA 1F07A 3QJSB 2DJMA 3BP4B 4X80H 5B7YA 1EYEA 1SOXA 4H8WH 1ICQA 5AL0A 1IFHL 4OTKA 1J5SA 1JPEA 4NBXB 3VNLA 3T07A 1I9RL 3HFMH 4Z7WB 1MFEL 4UBDC 1TQVA 2QMKA 3I6KA 4ZAKD 5C7VA 2DBJA 4H8VA 3SZKC 5H94A 4N0UA 3CD4A 4G8EA 3NXFA 1TCMA 5I71C 1S7WB 2RGLA 4C6PA 2P8PB 1JNLL 2HE5A 1MZYA 2VDKL 2Z34A 15C8H 1ADWA 1ML0A 4U3AA 2JNZA 4B15A 1A64A 3GYCA 2QJMA 4QRAA 2CBQA 4OCWH 5CJOL 1ZOXA 1XTLA 1Z8AA 4YC2C 4LNYA 3UCDA 2XBDA 2JWYA 4OGXH 1DE6A 2CGRL 2DYPA 4L1SA 3F7PC 1WDPA 4MMZA 3ZT7A 4NKDA 3FTWA 3QEUB 3B8DA 2NY0C 5LAPA 3ZYJA 4HSHA 2E75C 3LKNA 2WOBA 1YDPA 3EJTA 5DHXB 2AXGB 3TC7A 5A6MA 5IESL 1RCOB 4JJOA 1OCJA 4HJJL 2GSIB 2IJ0C 2XZQL 3O06A 2XG5B 3E1ZA 4HDIA 2APFA 4DP9X 1JV2A 2NVAA 3RX4A 2HMID 1HKIA 2J74A 3C2AH 3P3UA 1G9HA 3I9GL 2Z26A 4IUGA 1X9QA 3T4WA 1ZS2A 3UBXI 3VI3E 5H8DA 3F58L 4AD3A 1U6AH 3X11A 1LO0H 4L3ED 1HN1A 3MBWA 4QQUA 3OXSB 4AG4H 3ZL2A 1NSNH 3WH8A 4YE4L 5JORB 5JBDA 4L8DB 4A8LA 2V63A 2NR6D 3SIKA 5HQMA 1C08A 4IRSA 5A8QA