1MFVA

Probing the role of a mobile loop in human slaivary amylase: structural studies on the loop-deleted enzyme
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords alpha-amylase, salivary
publication title Probing the role of a mobile loop in substrate binding and enzyme activity of human salivary amylase.
pubmed doi rcsb
source organism Homo sapiens
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mfvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mfvA01
1BTCA 3L4TA 3AIUA 4WKAA 2PWFA 1V3LA 2WMJA 3WNPA 1E56A 5A6LA 1W2VA 4UQDA 2DIEA 2NT0A 4UFMA 1UQYA 4LYRA 4CUCA 1HVQA 4W5ZA 3WMCA 1JZ2A 2DH3A 2FHCA 4NX0A 1HWWA 4PMZA 3L2MA 5CPSA 1H4PA 4PUDA 4W7WA 3VVGA 3BAWA 3ZJ6A 4PMXA 1L8NA 4U5IA 4XUYA 1HN1A 5AYIA 3WEMA 2J7HA 4TTGA 4W86A 3W28A 3NSNA 2F61A 2X09A 5IDIA 3W24A 3UR8A 1HTYA 3M07A 2VCAA 1EDQA 1UR0A 2BY0A 1L0PA 1KCKA 4FNSA 1W3JA 2EABA 2V5DA 4JCMA 4MNLA 1OBAA 1QOXA 3CZNA 4KWUA 4P7NA 1UA7A 7A3HA 3J7HA 2BY2A 1H2JA 2D73A 2EQDA 3TOPA 2D0GA 4QP0A 4D6CA 1GQLA 1FH7A 4GO8A 2RGMA 1GOWA 2BY3A 1UHVA 4GQQA 3CZSA 4ZENA 4CD4A 1E4IA 4U2ZA 4FLRA 1UD5A 1E4LA 4QLLA 3WN6A 4ZEPA 4NXKA 4PTXA 4GI8A 2XM2A 4ATLA 2VT0A 3MI6A 5CG0A 2W61A 3AMGA 2EAEA 3AIQA 3BVXA 4U3CA 1V3MA 4NRSA 1BVZA 1UG6A 3EJTA 5A8PA 2QHAA 1DTUA 4M24A 4M82A 4WKFA 1E1EA 3FNDA 3F4VA 4MJ2A 3T08A 1OB0A 1QHZA 1RPKA 1C8XA 1V03A 4QLJA 1W3KA 3UESA 3HG2A 3WD0A 4Z2HA 3SCRA 4U3AA 1E5NA 1GJWA 3WQWA 1LL6A 1V6VA 4JZ5A 3VIKA 3W82A 2ZUSA 2PBOA 1Q6GA 1BAGA 1HKIA 1V0NA 1W91A 1CGUA 1IV8A 5BRPA 3SEPA 4UOZA 4DWSA 4D6IA 1CENA 4DM1A 1AQ0A 4PTWA 2JEQA 3AZTA 1G9HA 1QI0A 2CBIA 2DSZA 4KRTA 4W7VA 3GXNA 3HG4A 2UY4A 2VRJA 2WZEA 3RIKA 3VNZA 1E5JA 3THDA 3F5JA 1XCXA 2YA2A 5A6BD 4V2XA 3GXIA 3O9NA 2XN1A 2WZHA 1V6UA 4LGXA 3VGDA 4OJYA 2GFTA 2D3NA 4UZUA 3CZJA 2OWWA 3B8SA 1B90A 2ESCA 2BV9A 5HPOA 3OZOA 2F1AA 4KGJA 1TMQA 3SCNA 3BLKA 1N82A 5HNNA 2PWGA 2J79A 3ALFA 5LA2A 3OZPA 4JKKA 3M6DA 1IZKA 3N15A 1Q6FA 2OLHA 3TTYA 4W88A 2QMKA 1C7SA 1QNOA 4D72A 4TOQA 1LL4A 4MB1A 1WDPA 3W53A 1M53A 5A8QA 3VIMA 4OBRA 1JZ7A 3BUDA 1B3WA 4CCCA 2X2HA 2WAGA 4LQ1A 4JL2A 4D6DA 1CXKA 1H0IA 1V3HA 4UCFA 3WH8A 3ARUA 4MB5A 4OBSA 1JYNA 1EQCA 1VEPA 3QOMA 4N0RA 3VTRA 4GINA 2EPLX 1QW8A 2YDRA 1VEMA 5GNYA 4Q22A 3MS8A 1TQVA 3WH5A 3WH9A 4W7UA 1S46A 3H55A 3UETA 4PSPA 3AQUA 4W84A 3CMGA 1C92A 2XGIA 1MXDA 3ARRA 3K4DA 2A3BA 2JF6A 4D1IA 5DEZA 4QCFA 2DIJA 4PTVA 1BSIA 2BY1A 4C7FA 3IK2A 4WSJA 3K8LA 3AHTA 3N18A 2ZUNA 5KZ6A 1ZBWA 5DMYA 3WD3A 3DX0A 4L4OA 4FK9A 2IXUA 4OOZA 4CD8A 4GIAA 4AMXA 2PWEA 5D8WA 3T0AA 1CTNA 1E0WA 1VJSA 3NCOA 4P7LA 3WDJA 1J0KA 1EH9A 3OGSA 3VO0A 4WKHA 2XSBA 3WF0A 2WC4A 1K9DA 1HKMA 2QF8A 4B9YA 5A8MA 3WUEA 3MV11 3AS2A 3G6LA 5M03A 1BVNP 5ABHA 4S3KA 3HN3A 2OSXA 3W38A 3MO4A 1QW9A 3BMWA 5CGMA 1YQ2A 3S2CA 4QLKA 1WKYA 3AROA 2YIHA 3D5HA 3AIVA 3QGVA 3IGUA 4NZJA 2CEQA 3CZ8A 4H04A 1XYZA 5C8BB 4UFHA 1XRVA 1V0KA 2YL9A 2VC9A 4EE9A 3CBWA 1QPKA 1DWFM 1R7AA 3WUGA 2PB1A 3U5UA 3N17A 3AIBA 5M17A 3HU7A 4CU8A 4AEEA 3LXAA 1GJUA 4D6JA 3VIHA 2XIBA 2VRQA 2ZIDA 5BCAA 3WF3A 4AZ6A 1W9XA 1UH4A 4WSKA 3WNOA 3TA9A 4K68A 3I3BA 4H8VA 3CO4A 3CGTA 4HU0A 3W29A 1QNSA 4QAWA 1UWRA 3PZNA 2CKSA 4P8XA 5FOOA 4H8HA 3SUWA 3PZOA 4F9DA 3KLKA 4UFIA 1B3VA 3D51A 4DUWA 5EB8A 3L4UA 3M7SA 4IPNB 1FHLA 4P7RA 3DX2A 2BNJA 2E9BA 3NIYA 4Q7NA 1WCGA 1WE5A 3TTOA 4Z2IA 2VI0A 1C3FA 2OYKA 1XD0A 3U57A 4MNJA 3EJPA 3LPOA 1NWUA 2GK1A 2WHLA 1C91A 1GHRA 1W2PA 4AXNA 2XVKA 4RE3A 3VIPA 3MU7A 5DT5A 2VZTA 1GONA 2G8ZA 1NWRA 1LQ0A 2PI6A 3WMBA 1UR4A 2XPKA 1UH3A 2G3IA 1V6WA 2J4GA 9CGTA 4GPNA 1OGSA 1E9LA 5IHRA 1XSIA 2CIPA 5ABFA 2D0FA 4X0NA 2WSPA 3VX1A 1U2YA 1UA3A 1LJYA 3A22A 5GNXA 1UH2A 4WIWA 1V02E 4D6EA 1FH8A 1OD0A 1CLXA 3AXIA 1K9EA 3UEQA 2CETA 1EA9C 4AMCA 2CNCA 3OB8A 4PBGA 5A6AA 3VD3A 1XSJA 2GK1B 3U7VA 3MKKA 1HX0A 1WP6A 2VVSA 4MADA 4E4PA 4HOZA 2WWDA 2NT1A 5A94A 1E73M 1OWQA 1QWUA 2E9MA 2XVGA 2F1BA 2YBUA 2JE8A 1DHKA 4QCEA 1NARA 2XFFA 4MJ4A 1FFQA 1LF1A 3SUTA 5ABFB 1KGUA 5I0DA 4J3WA 2F2HA 3WY4A 3WL0A 2J8FA 2ZUUA 2VVNA 3CZLA 2XVNA 4M1RA 2WKLA 1LG2A 3PZMA 1A3HA 1DWGM 3CTTA 5BRQA 3O6AA 1E6ZA 3JUGA 3T0DA 2X1IA 4LXFA 1XGZA 2GDVA 4JKMA 1MW1A 1UUQA 2CCRA 4BA0A 1VAHA 3DX3A 5A2AA 2CERA 1TUXA 2CITA 1DWHM 3N1AA 4HA1A 1BYDA 1VRXA 3CUJA 2OSYA 3WUBA 3TONA 4PCSA 4UTFA 3VSTA 2FH8A 1V0MA 4Z2GA 3D52A 1CWYA 1J0JA 4AYGA 1E6NA 5E6YA 2E4TA 3EJSA 1VENA 1BGGA 4PTMA 2PBGA 3WY1A 5IXEA 1I75A 4F8XA 1RH9A 2FE0A 3GBDA 3AXXA 3BVWA 4ACZA 3NDYA 1JIBA 3HG3A 2E3ZA 2JF7A 1ZB5A 4ACYA 2XN2A 3CZGA 1KTCA 5CPTA 3POCA 1G0CA 5GPRA 4ZXLA 2AMGA 1QI4A 3BC9A 3WQ8A 1PX4A 5CJ5A 1UR1A 3RM4A 2ALWA 3D4YA 3N13A 3QR3A 4P7QA 3BAIA 3SCTA 1KXHA 1HL8A 1WAWA 1VFOA 2JIEA 3S5YA 3PTKA 4ML4A 2Y24A 6TAAA 1E6XM 3MSGA 5TD4A 4OZOA 2O9RA 4NZFA 3WENA 4AIUA 3BVTA 2XVPA 2CPUA 4IISA 4XZBA 5JBEA 2XFYA 3AYRA 3O2LA 1HXJA 3CUGA 3RMEA 2PF0A 2X2YA 4ACZB 2FH6A 3EDKA 5JBFA 1ISXA 4MDPA 4TVCA 1PPIA 2V3DA 2D1ZA 1VB9A 1VJZA 2BXYA 4ZE5A 1CXIA 3WEZA 4MAZA 3DHPA 3WY2A 4X0VA 5E9AA 3PZUA 2W4XA 4JFUA 3AYSA 3VGFA 4PMNA 1E0VA 4E8DA 3NSMA 1NQ6A 3QHNA 1PAMA 4AC1X 2WLZA 1WDQA 1ZU8A 3T2QA 3WFLA 4AW7A 1KGWA 2OWXA 2EBNA 1KWKA 3APGA 2VX7A 2ZXQA 3DX1A 2A3EA 5AY7A 5CXPA 2W91A 4B3LA 2ZUMA 4DWSD 3GNOA 4GI6A 1HNYA 2QLYA 5EMYA 1MQRA 3SCVA 1M04A 5E1QA 2ZX6A 4J3XA 1ZBKA 2VO5A 4AZ5A 2J77A 1NH6A 1ECEA 1KWGA 2OYMA 4B15A 5LA1A 1MXGA 3LPGA 1WPCA 1JFXA 2XJ7A 3WF2A 5E70A 1KXTA 3MUZ1 5HPCA 3SIMA 3L4ZA 1E4MM 1EDGA 2FYVA 2BS9A 4AZ7A 2A3CA 1NOUA 3A23A 3OA5A 1KCLA 4W8BA 1BYBA 1TA3A 3WFZA 2D20A 4RE2A 1Q6DA 1CXFA 2QV4A 3BCFA 4JFWA 1ISZA 5F7UA 2DSUA 3AICA 3ZIZA 4NZCA 3ZQ9A 1EGZA 3TV8A 1QX1A 1O6IA 4IM4A 4W8AA 3IAQA 1UKQA 4W93A 4J7RA 4CN6A 2TAAA 1GVYA 3GXDA 3L4YA 2YFOA 2W5FA 1HJUA 2G4FA 4PRWA 3WELA 3BUBA 3VGGA 1UYQA 2V38A 3MMDA 1TQUA 1R33A 1QHOA 2ZX5A 4DO4A 2WZIA 3MMUA 5CSUA 1WB0A 2DT0A 1SZNA 1V3KA 3ARXA 3EMQA 2XFRA 3KL3A 1K9TA 4BS0A 1W9UA 1W3LA 1FH9A 5HOSA 3GXTA 1PBGA 2EPNA 1GQKA 1TA3B 3AMLA 1MFVA 1KB3A 1WZMA 5E0CA 4MNKA 3ZT6A 1BF2A 1JNEA 1EOKA 4HZ6A 5DO8A 2WK2A 1U30A 3GXPA 2VQTA 3ZM8A 1QI5A 5I5RA 2J7CA 5IFTA 1VF8A 4P8UA 1W1VA 2WMFA 5A3HA 3BCDA 1PIGA 1LL7A 4UQCA 4D1JA 3ZO9A 4CCDA 2Y2WA 5A2BA 2W67A 3NJ3A 1E0XA 4AWEA 2WCSA 3WDQA 4M29A 3ZMRA 4OKDA 4AISA 2D24A 5A6KA 1Q4NX 2FHBA 4W8LA 2D3LA 2YOCA 2DSVA 4WJXA 3ARWA 4IPLA 5EBAA 4AZBA 3N04A 1JXJA 3GXFA 1E71M 3DC0A 2G3JA 1TZ7A 3CUIA 3VDCA 3RPMA 4CN4A 4DWSB 1J01A 2YL6A 3I3DA 4ZFMA 4D6HA 4M8UA 5I78A 4FMVA 3LPFA 4GZEA 8CGTA 3D4ZA 2JEPA 1UR8A 1CLVA 2Q8XA 1QHPA 4KMQA 2GJXA 3VOCA 5D4YA 1KR0A 2ZXBA 3K46A 2XTKA 1XCWA 1GW1A 1UKOA 3VMNA 3OLDA 1WZKA 4MDOA 2XVLA 4TX8A 2J25A 3QHOA 1BG4A 3EJRA 2NSXA 4F66A 3W81A 1J10A 4W5UA 6CGTA 1E6RA 1UR9A 1F4HA 3DYPA 2XHYA 3KEHA 3W25A 5BXTA 3WDRA 1R85A 4XB3A 4JHZA 4PMRA 1WO2A 3VD5A 2QPSA 1EXPA 5BROA 5KEZA 2WHKA 1HIZA 4Z2JA 2O92A 3M46A 5A8OA 3OBAA 2X2JA 1X1NA 2VL4A 4ZXOA 3B9AA 2VJXA 4AZGA 1NWTA 1JDDA 3OIHA 2YL8A 1B2YA 1JI2A 1HJSA 4GKLA 2WSKA 1UWQA 3UG5A 3GNRA 2F7QA 5HBFA 4AD0A 5ECUA 3VNYA 3CUHA 4A4AA 5CZKA 5A6SA 4J3TA 1VFFA 3VU2A 3FY1A 4PSRA 4CD5A 1KBBA 1HJWA 2YDSA 2WANA 2WVSA 1SYTA 4OIFA 1JYVA 5D9PA 1E15A 3RILA 1TVPA 4LYQA 1UKTA 3ZJKA 4HPGA 1R75A 3MSDA 5IFPA 1BYCA 4JKLA 1GNXA 4CD6A 2DH2A 1OCQA 3BAYA 1GOOA 5ABEA 3CMJA 3CUFA 3SURA 4H8UA 1C90A 3SUUA 1HJVA 3IJ7A 2ZXDA 3AJ7A 5D9NA 1SR0A 3VSUA 2C0HA 2C7FA 2ZXAA 3EBVA 3OLGA 3A47A 5BYWA 1CXEA 1WZLA 1CEOA 2VZUA 3HJEA 4YHEA 5FCZA 3VM5A 4KH2A 3BSGA 3VILA 3IAPA 2YLAA 5I2UA 3CHEA 2ZE0A 1B31A 4B9ZA 4KRUA 5EFFA 4CU6A 1DEDA 1E6PA 2VX5A 1O7AA 3AS3A 5D9OA 1OGBA 1Z32X 2WCGA 1MFUA 3WEOA 1X6LA 2CBVA 1G94A 2QMJA 1BPLB 2C8NA 3VGEA 3FHQA 2VCBA 4HA4A 4FNUA 1BHGA 1VEOA 5CGTA 2E9LA 3ARPA 2HVMA 4H41A 5DFAA 3RDKA 1JG9A 3VM7A 3WUFA 1ODZA 2J62A 3A4WA 1UD3A 1HP4A 2F8QA 4L4PA 1GPFA 4FLOA 4ATWA 1E1FA 1KQYA 3A21A 1OINA 4HTYA 1K9FA 1GORA 5AC5A 2UY2A 2O9PA 1E43A 1ZBVA 1JI1A 1RD6A 3AIEA 4F9JA 3ARVA 4BZYA 4D71A 3AXHA 3CH9A 4DO6A 1PIFA 4P8VA 1JZ8A 4AY1A 4DO5A 4JIEA 1FOBA 2EPOA 2WWCA 1MWOA 3U7BA 3W27A 3VMOA 4RL3A 4UFKA 4HMCA 1OIMA 4RE4A 1TFVA 1E4NA 5M5DA 1J0ZA 3RJYA 2GJPA 3UR7A 4LYPA 1KFWA 3BLBA 1QNPA 4WK9A 4AD1A 1C7TA 3KE0A 4AD4A 1PEZA 2DSWA 3WNKA 1J0YA 3WQ6A 3BUIA 1CXLA 3TTSA 4BCEA 1RP8A 1UOKA 1MVYA 2E8YA 3AMCA 5DF0A 2ZUTA 1BYAA 1H49A 4U5KA 3ARQA 1XC6A 4H2CA 3T09A 4WLCA 2X2IA 3SCQA 3A24A 2OWCA 2XN0A 1XH0A 4B3KA 3RCNA 3AZSA 4PCTA 1GQIA 1BQCA 2FDMA 2V3FA 2UWFA 2F7PA 3WL1A 1OT2A 1UD6A 7CGTA 4NF7A 1C8YA 1HVXA 3A3HA 2WW5A 3VGHA 3ZJ8A 2VNCA 4IUGA 4UFLA 2JFEX 1JYWA 1V02A 1JZ4A 2VMFA 1DWIM 1HF6A 1US2A 1B30A 5HDRA 1E72M 1IZJA 3W0KA 1D3CA 3WH7A 2Y4SA 4TUFA 1J18A 4R27A 2VX6A 2XG9A 4D6FA 4HP5A 2GJRA 2J7BA 2V3GA 2OSWA 4W89A 3ZT7A 1EQPA 4MB3A 2DT2A 4PMYA 2CHNA 3QOKA 1B3ZA 1M7XA 3AI0A 2WC3A 4BQ2A 5AC4A 2D22A 2WC7A 2PWHA 3ZJ7A 1GOKA 3DYOA 2WVUA 1GOMA 3WIJA 3L4XA 2CESA 1JXKA 3W37A 3IJ9A 1HT6A 4UFJA 3BAJA 2RGLA 3II1A 3LXCA 3T2OA 2J74A 1KBKA 4UOQA 4XV0A 1E6QM 4P7OA 4GQRA 3BMVA 4B16A 2IXVA 3FHAA 5AYBA 5I3DA 3ZR6A 3T0BA 5LA0A 1HKKA 3E1F1 3WD1A 3PZQA 1CBGA 4WF7A 1BLIA 3ECQA 2OYLA 3CHDA 1OM0A 2WMIA 4BQ4A 2YL5A 3W26A 1EO5A 2W63A 4S3JA 2Y5EA 3VMPA 3AMKA 1R87A 4CN1A 4OOUA 1G5AA 1TQTA 1M03A 3DHUA 3AHZA 2WBKA 3VSVA 3PN8A 4UQAA 1W1PA 4A3YA 4W87A 1EOMA 1DP0A 1ZBCA 3CHCA 1XD1A 1EHAA 1JNDA 3I3EA 4CGTA 1CPUA 1NWSA 2EO7A 3MUY1 1JZ5A 1GOQA 3VINA 5FD0A 3A4XA 3G6MA 2BHZA 4TVUA 2VZVA 3VX0A 2D23A 3MMWA 3H54A 4AD2A 4DM2A 2YBTA 1ESWA 4EK7A 3AMDA 1ITCA 3SCOA 1CGXA 4UNIA 1WNOA 2WMIB 5I77A 1UWIA 1GUVA 2XGBA 3BSHA 4CCEA 1LG1A 1RP9A 1KR1A 3WNMA 3THCA 2F7OA 3FAXA 2ZWZA 3VGBA 4U33A 1AQHA 2J47A 2DPEA 3WBAA 3GZAA 3F5KA 5CLWA 4W85A 1ISYA 3SCSA 1SMDA 1NP0A 4BF7A 1K6AA 3MANA 1B1YA 2HISA 1R86A 1C93A 4HMEA 1JZ6A 2VOTA 5A8NA 1TCMA 1OD8A 1ISWA 1QI3A 3VIJA 1EIBA 2WMHA 4HZ8A 1TQWA 3EJUA 3S6TA 4GXPA 1H11A 3RM8A 2DEPA 2XWDA 3DX4A 3GH5A 1AVAA 2E40A 4J28A 1UWSA 4GO9A 4ZE4A 3PZ9A 1VFMA 3AIWA 5E0FA 3S5ZA 1J0HA 1AQMA 3LRKA 1V6XA 5BXRA 1UD8A 3EDEA 4LPCA 2WCAA 3L4VA 4HMDA 3ZOAA 4F79A 1H0GA 3AS0A 3AZRA 3PHAA 1W9PA 3LPPA 2J78A 1BGAA 2ZX8A 1J11A 3IJ8A 5E6ZA 1W3HA 4TXEA 1J0IA 1PZ2A 2A3HA 1W9BM 1QBBA 2J7FA 1JGIA 1MW3A 2EADA 3LMYA 4HPHA 1EO7A 1B0IA 3WY3A 2VR4A 5JIWA 4TTUA 1UASA 1JL8A 1ZJAA 3W6MA 3CC1A 3KLLA 2BHYA 3OGVA 1E6SM 2VTFA 1OIFA 5JBDA 1MQQA 2YKKA 3VIFA 3MUAA 3CV5A 1U33A 1PZ3A 2DQXA 3BUQA 1XSKA 3BH4A 4JFVA 5LYRA 2WVTA 4AD5A 2YA1A 4GI9A 2WM0A 3OLEA 3D50A 4JCLA 3SUSA 2O9TA 1NOFA 4JAWA 2X8RA 1FFRA 2WNWA 1A47A 1GQJA 3ZR5A 2DSKA 2WPGA 3WQVA 3UERA 3AIRA 1PJ9A 2WKGA 3BVVA 2D0HA 1HJQA 2GDUA 3ARYA 4AZCA 2VCCA 1QWNA 5I23A 3KWXA 4PMVA 4QDMA 4M81A 3BXWA 4KGLA 2WVVA 3BUPA 3VDBA 3KZSA 4EAMA 4PMDA 2J8GA 3K1DA 1LLOA 3PZTA 5JUVA 3VD9A 3LXBA 4J3SA 1KQZA 1CZ1A 4AZHA 5BWFA 2FGZA 3ALGA 2YFNA 2WB5A 1CGYA 2BHUA 3AHXA 2WYSA 3CHFA 1JFHA 1OGGA 2WXDM 4MB4A 4DUVA 1BFNA 3UCQA 3NDZA 1GZJA 1Q6CA 5FIPA 3CIVA 1WDSA 2V3EA 3GTNA 1GOIA 4MNMA 4HOXA 1HJXA 2G3MA 3AOFA 1H5VA 1V0LA 3NSXA 1CDGA 1B3XA 2EPKX 2D2OA 5IHSA 4DWSC 2GSJA 4V28A 4AZCB 4JL1A 3AHVA 2YJQA 3W4RA 3BVUA 2BXZA 1UKSA 2F7RA 3PZGA 1H41A 3U5YA 3K8KA 2VZSA 2WVVB 1TE1A 4EKJA 5CQ1A 3EJQA 2EACA 2DDXA 5FL0A 2W62A 1VIWA 4ATDA 3EDFA 3NYDA 3FAWA 3WDPP 2XIIA 5D8ZA 1R7OA 1J12A 1NP2A 5I24A 3D3AA 1D2KA 4MAVA 4CU7A 1JAEA 3GYCA 3LX9A 2G41A 2J7GA 3KL0A 2BFGA 1UWUA 2JALA 3RO8A 3VD7A 4EANA 1B9ZA 3K8MA 3HZ3A 2DGAA 1BG9A 1W1TA 2Z1KA 3SCPA 3OLIA 1QI2A 4NI3A 4X9YA 4FF5A 1UZ4A 2ZX7A 1VFUA 4J27A 2VX4A 3RJXA 2J7DA 4UQ9A 2O9OA 3BLPX 7TAAA 2CYGA 1NOWA 2QPUA 1ODUA 3B9EA 3B9DA 3PZVA 1XH1A 5M3WA 2IGTA 4AD3A 3WNLA 1X6NA 1GCYA 1E70M 1HKJA 3GM8A 4HA3A 2W92A 1US3A 1V6YA 4U2YA 4MTVA 3OGRA 3PZIA 4V27A 4TX6A 4AIEA 1WDRA 2GJXB 3SUVA 5GQBA 1CGWA 1JZ3A 4CVWA 1MYRA 2XM1A 3L4WA 5A6BA 1I1XA 5EFDA 3CLWA 4PMOA 2AAAA 1AMYA 4FNPA 3SCUA 3VIGA 5BXPA 4J3UA 3AISA 2VZOA 3DDFA 2WMKA 2WHMA 3GDBA 4XX6A 2ZUVA 1QNQA 5C71A 4YHGA 1Y7VA 4YN5A 4AYSA 4AEFA 2Y8KA 2X05A 3QHMA 3BGAA 3WKZA 3EDJA 1E55A 4GZIA 4AMWA 3WH6A 4DUXA 1W1YA 1D7FA 4H7VA 4UQEA 1XH2A 2WLYA 2IUZA 4CVUA 1H3GA 2ZUWA 5A2CA 1SFSA 1IT0A 1JAKA 1LWJA 3BAKA 5GNZA 4M56A 2BVYA 4HZ7A 1ZJBA 1H09A 1B3YA 4E8CA 5DT7A 3A5VA 3KL5A 1UWTA 1XV8A 1R46A 4U31A 2E8ZA 4UOJA 3T2PA 1V3JA 3N12A 1PX8A 3UG4A 4C7DA 4GZJA 3EYPA 1TQSA 1UKPA 2CBJA 3AHYA 2E0PA 3L2LA 2CKRA 5JIPA 3WDIA 5CLTA 3SCWA 4UZSA 3MUIA 3RM9A 1W9VA 1UD2A 3PTQA 3WNNA 4OUEA 1CGTA 1E3ZA 4TVDA 1W32A 1QVBA 4FNTA 4FLQA 4FNQA 2WHJA 1CXHA 3ARSA 3WF1A 1UQZA 3AS1A 1E40A 3TTQA 1H1NA 1J9YA 1FP8A 2EPMX 1XYFA 1G1YA 3ARTA 3HG5A 2CHOA 5FKYA 4PMUA 2UY3A 1YHTA 2PWDA 2ZX9A 4Z2KA 3LRLA 1V08A 1Q6EA 2BVDA 1E3XA 3WDHA 1TVNA 3BAXA 3VKKA 2AOSA 3WSUA 3FW6A 1MW2A 2FHFA 2A3AA 1JD9A 3CZKA 1P6WA 3GBEA 3DECA 2GUYA 1GHSA 2Z1SA 4E2OA 3EDDA 3WD2A 3N11A 5BXSA 3VDAA 3ZSSA 2VR5A 2OW6A 4CKQA 4UR9A 2YA0A 1PX3A 5CPQA 2YDQA 1QBAA 2EXOA 4FNRA 4JHOA 3WD4A 4BQ3A 3GH7A 2XSAA 3TP4A 1M01A 1OSEA 1KGXA 2F18A 1CIUA 1FP9A 2X0HA 3A4AA 4HU8A 3WBEA 4PMQA 1G01A 1TR1A 1JYXA 6A3HA 1KXVA 2X0YA 1JDAA 5I79A 2MANA 4A3HA 4P8WA 2V5CA 2W66A 1F4AA 1R8LA 1QNRA 4JFTA 4PN2A 4HOWA 2G3NA 2WMGA 3UG3A 4FLSA 2BVTA 5I6SA 2VURA 1FHDA 4R5EA 1O7DC 1ZS2A 2VQUA 1PS3A 1UD4A 1JF5A 2XWEA 4CD7A 1NM9A 4BQ5A 2YLLA 1C8QA 3OG2A 4NSBA 4XZWA 4YPJA 1W9DM 2CXGA 1JD7A 1EDTA 3PBGA 3ZSTA 1ZL1A 3VDHA 2FGLA 4JFSA 3IANA 3DDGA 4AZIA 3VIOA 1UZ1A 2ZICA 1ITXA 3WMSA 3DYMA 1VBRA 4J3VA 4N42A 3H53A 1R47A 4QFUA 3WQ5A 3PTMA 2ZOXA 3CPUA 1EHNA 2JIWA 3WQ4A 5CSYA 2GVYA 3GH4A 5FL1A 3MV01 4C7GA 1HXKA 8A3HA 1CYGA 3WF4A 1CNVA 3ZT5A 3VUPA 3VPLA 2DT3A 4M80A 2DT1A 1GVIA 4PEEA 1WZAA 2XUCA 1UR2A 2B31A 1SMAA 1DWJM 2VRKA 1XHGA 3W6LA 4Y7EA 1T0OA 2UY5A 5E09A 1LWHA 2NW0A 4MPKA 4NXSA 4URIA 2CBUA 2PC8A 2OW7A 1MW0A 1HL9A 2J75A 5A6JA 3FN9A 1KTBA 1R34A 5HXMA 5ABGA 1JF6A 4PYSA 2XYLA 1ISVA 2EEXA 1HP5A 1JDCA 3A6OA 3GNPA 5D9MA 5A6MA 3GXMA 3VIIA 3K4AA 1OT1A 3AFBA 1KXQA 3LRMA 4Z2LA 2J7EA 4LX4A 4NRRA 3POHA 3VD4A 4PUEA 5A95A 1I1WA 1MQPA 3N9KA 3F5LA 1VBUA 2EJ1A 1FA2A 1DWAM 2Y8VA 5A1AA 3NUKA 1CECA 3HMCA 2ZWYA 1TG7A 3CZEA 3ARZA 4AIOA 3FXYA 2WBGA 4D6GA 3EMZA 5A69A 2VUYA 4UQBA 3EMCA 1V3IA 1CGVA 5C70A 4OGZA
chains in the Genus database with same CATH superfamily
5J57B 4JY9A 2GIMA 1DVFA 2YD6A 4UQDA 2DQCH 5F3FA 3C5QA 1OIOA 2WLLB 2FHCA 3VXTA 3L2MA 1TZ8A 2E5EA 4JO2L 4N0FA 4GMTH 1XIWB 2OKMA 4ZXBB 4P61A 5AQ0A 4HLEA 2A7RA 5B1KA 4HXBL 5MI0B 3CU2A 3OKLA 3W24A 3O3AA 3M07A 4O58L 4ONVA 1ETZA 2Z29A 1OBAA 2BG5A 1U93A 1LK3H 3TO2B 4ZMWA 2BY3A 4IRJD 1F05A 3ES7A 1EP3A 3H56A 2OP4H 1JJKA 4OZHA 1GIGL 2HXTA 3KP1A 4DP0X 1SVDA 3ETBJ 4K7PX 2BVWA 1JPGA 1AQFA 1UG6A 4HNLA 1KCVH 5GJMA 4DP5X 3UXLA 4MJ2A 3BEVB 4REQA 4P2QD 1KV3A 1BD2D 3GSQB 4M43H 5C0CE 1HOEA 1RZ8A 5K9XA 1SXNA 2VR3A 2HSAA 4XBGB 4KVCH 4BKSC 3EFOA 5BRPA 3S37X 2GC7C 4B96A 4PRAA 3NFNB 4D6IA 3ZE0B 2WQDA 1ASPA 1AQ0A 1KB5H 5SWQB 3GXNA 4TMBA 2Q76B 1RUAL 3F5JA 2H1PL 4I90A 2A2IA 3ZDYE 5A6BD 1LD9A 2EEDA 1XXDC 1TE6A 1B54A 2E6YA 1NMAH 4UZUA 2CRMA 4PG9A 3WIIL 3PP7A 5DSCB 3TN5A 3TN0B 3SPVB 3QUYB 4L1WA 1ZWIA 4AWJC 1BZ9B 1FBAA 1IZKA 3PAZA 3RA7H 4X4ZA 5AOKA 1NCCH 4N2HA 4QRPD 4P07A 2Q3ZA 1N18A 4JX5A 5KSUB 2FSEA 3QGAC 4JKPH 3EXJA 2B3RA 4CLMA 3CYJA 1S7VA 4LB3A 4TV3A 4DGUA 4ETYA 3DMMA 4LSSH 1GC1C 1XR9B 2WKOA 1AJ2A 4XE0A 3QF0A 4LKXB 4GQ9H 4KXCA 3VXQA 5BOOA 1CC3A 4W84A 1IAII 1XF4B 2A3BA 4KAQL 1CCWB 3V0VB 2EICA 4YHIB 5BRZB 4GXVH 2G37A 1V79A 1L6YA 2JB6A 5F2IA 4B60A 3C9NA 1I9IH 3HOJA 3FVDA 3O0FA 8FABB 1ZHLA 1OGTA 3Q3GB 1GSMA 2ZXEB 2VLKA 4ZUVB 1RHFA 4HFUL 1FO0L 2Z6JA 1A9BA 5ABHA 3VXME 4WAFA 2PW1B 4JRLA 2QULA 5SWSE 4X0KB 2DQIH 4ZFFA 5D04C 2DQHL 3VXOB 4K37A 5C8BB 1V0KA 5IESH 3ZTJH 4B53A 4XVUD 3NXLA 1M1XB 3ZYJA 4CQAA 4D8LA 4NOBA 2XUWA 4CVXB 5HAOA 4Z7VE 3FBQA 5JDSB 2P5WD 4ZX4A 2CHZA 2OJZL 2ISSA 1D3HA 4O9HH 2YUXA 1MG2C 3W29A 2DWEA 3RURA 4F9DA 3HPJB 3LNDA 1JPSH 4N2CA 3WAJA 4Z7WB 5EB8A 3L3OA 5C6TL 4LNRB 2E9BA 5CIPA 4KI5F 3WJXA 5AC6A 4R0LC 3I74A 2AKZA 4FQPA 4JIRA 1ZHKB 2DM4A 2GVEA 1HHHB 4X5PA 1U8OA 3MJ7A 4J1UB 5D7SH 4PJ5E 2G3IA 3G6JB 4JFPB 2J4GA 2FIQA 2Z00A 4I87A 2NX5A 4L5FL 3VCNA 4QLWA 4WOZA 3FU9A 3B8WA 1LJYA 2DQJH 3N4EA 3WLBA 1CLXA 1TZZA 3W76A 4KROD 2CETA 3QXDA 1E9YB 5K5YA 4WWKB 3QUHA 1XC4A 1XSJA 2GK1B 1WP6A 2G5WA 3HMXH 2QR6A 3VDGA 2CFFA 1AAJA 4B3VA 1E73M 4GAAA 3P84A 4IIBA 1KXVC 1NBVL 2GCYB 3S2AA 3O05A 4UINH 4X6DF 5D1XB 4F37K 1HW6A 3CBJB 4PUNA 4XRCA 2VXUL 4R4FL 3O6AA 1E6ZA 4F15C 1U8NB 1KSRA 7XIMA 2A74B 4RRPG 3IS1X 3OKMB 5ACZA 2VC5A 4BA0A 4LHJB 4P2OD 4HQQH 1UC5A 1G4SA 1TUXA 3WMLA 2B7DT 1H19A 5GHWH 4EN3C 4PJIB 3WS6A 1AFVH 3EJSA 5F6IB 3G1AA 5I1AA 1XRSA 4NRXA 4RGOH 1UOVA 3CMOH 1OPGL 2WHVA 4ACZA 3QNYB 4XBPA 2VD8A 5JORB 4MTMA 3BZDA 3QJTB 3F58H 4BFKA 2B9AA 3DK0A 5HYSB 5GPRA 4JY6B 3EG9A 2AMGA 3WQ8A 5FHAH 5AWNH 2NZLA 2W0PA 3RM4A 4TUJB 1IXOA 2I56A 3ZK0A 3TQPA 1AR1D 3BAIA 5IJVA 4QQUA 4J4PC 3INUL 3MT1A 2BLEA 3WENA 1FRBA 3SDAD 4GFTB 1N0LA 2R2HB 1KULA 2YD3A 4L6DA 3D08A 1VCAA 4UB0H 4KV5F 4KK8C 5CLZA 1XIWC 1KPVB 3M44A 4ZXBC 1CXIA 4H6QA 4A6GA 2FR4A 5MI0C 1YY9D 5B39B 2GJNA 2DWSA 4LVDA 2Y7MA 5FI8A 1J5OL 1NEYA 3O16A 1OAKL 3T2QA 1ZS8A 5FF6A 3PJUA 1KGWA 3OAUL 1US0A 1UOLA 4B5TA 3GZOA 5MEPB 2V17L 2COQA 4APQB 2VGLM 1ID2A 2F5BH 1L3WA 1EX5A 4OZIB 4X9GA 4AQ1B 1OZMA 4PP2B 4UT9L 4Z17A 1J79A 2ED8A 3WFZA 2D20A 4V1DD 1HUVA 3MJ6A 5A2IH 1T0PB 4MGGA 1H0DB 3NABL 4UBDC 3SE4C 3LI1A 4OZGF 4M6PA 3DI2B 5SX5K 1MUWA 4JFHE 2IWEA 4QAIA 1LQSR 2IAMD 2OT0A 3VRJA 1W8OA 2XV2A 3IJEA 4JQIA 1W9UA 3W85A 3OB0K 1KB3A 1LDPL 3WD5L 5XINA 1PNCA 3T1FA 2Y36L 3ZM8A 5I5RA 4TVPD 3PVFA 4L1GA 1LHZA 1M3IA 3ZO9A 3C56A 4NO0B 3MLZL 1P4LA 3K4ZA 2R0KL 2WZ0A 4HG4K 3TF4A 1F02I 3P69A 3TN0C 3QUYC 2OL3A 4KFZC 3E38A 1F11B 3GRWA 2G3JA 3CQ0A 1NPNA 3CHOA 1HTIA 1RK0B 2QJGA 3KZPA 2NUPB 2YL6A 1T1YB 4H0IA 2ARJQ 4FMVA 1UADC 1OF2A 3IF1B 1I60A 3N29A 2ZXBA 2Q0ZX 3BUTA 4IKKA 4KNSA 1NCBH 2HKHL 4BFNA 3K91A 4F2FA 5D38A 1WTLA 4V33A 1E6RA 3UYPB 4B0MM 4XPBH 2J8UE 1I4FB 2FX7H 2VXVH 3MRFB 4AVJA 5KVEL 5KJ7E 5KEZA 1RK7A 4WTQA 5GGUB 1L8PA 3Q2CA 1NWTA 4FQXA 3T1WA 1UWQA 1P7QB 4AXKA 4LT9A 3RG6A 4PCFA 1F3EA 1JR1A 3OVQA 5IVXB 2OOFA 5J6GB 1A3QA 5IM51 2A5UA 3REVA 3TO4D 4LYQA 3ESNA 2DH2A 4PRHE 2YCIX 3CMJA 3CUFA 1G7VA 4Z77A 3EWYA 5LAXB 3U2SB 3UXKA 3UBXI 5BYWA 2P7TA 5AUMA 2QCNA 5IBTH 1OZQA 1YKWA 3IFLH 4R7LA 1DQLH 2QS8A 1WGOA 3MV8D 2WWOA 5IB3A 2WCGA 3Q2VA 3TEUA 2PETA 4JO1L 4LS2A 3LENA 3MTXA 4PWJA 3VGEA 4XAGA 4HKXB 2BSRB 5KSAD 5D7IF 4A55A 3E74A 1YTEA 4LSUH 4G3YH 4OM1L 5K9JH 2W3ZA 2O9PA 3OVRA 2Y1ZA 5DUPH 5D93B 2I17A 1KIUA 3KPTA 3IDNA 4D8ZA 1KCRH 4HK0B 4FTVA 4NKIH 3DFOA 3SDDA 2H3DA 2D7MA 4P4RB 3EX4A 1J0ZA 4LYPA 3MJ8B 1TWWA 1BMZA 3QQ0A 4WK9A 1O0VA 2R9HD 2VEKA 1NFDE 2V5SA 2DSWA 1M5WA 4JTJA 4XKYB 4O2EB 4FE9A 1FZOA 1IIKA 3UXFA 4QGTA 1T89A 1YXYA 4ICMA 1D5MA 2HE5A 3R89A 4Y2DA 2VL5B 4WWKC 2R1NA 2FT6A 1WKDA 3NRFA 5IOPB 3CLEH 1HXYA 2D7QA 2BNRA 3D33A 4YL9A 1O66A 1NSNH 4GYPA 4FA6A 5HJLA 5DUBA 1OW0A 4BGDA 2KZ1B 4IK7A 3R6IA 5D1XC 4JTHA 2WLIA 3H4GA 3DBPA 3UJRA 1A4LA 4L8SA 5C08D 5SV3A 3NACH 1BVOA 2A74C 1DANT 3RWGB 5JW5A 1JUFA 3P11H 4BFEA 1WBZA 5C07D 3T2OA 1KBKA 4BFOA 3FO1B 1KOAA 3B8UA 2SEBA 1SYSA 5KS9E 4BQ4A 1TZIA 3PJSB 3QQDB 3VMPA 5T3XH 3QW3A 2RDTA 1ZIBA 3D46A 1HQRB 3D48R 5ESAB 3FQRA 1F2QA 3DBXB 1WFMA 4FCAA 1FFPA 1EHAA 2X53A 4Q8VA 1NWSA 5GRZA 1DN2A 1JZ5A 5EU7E 3JWNG 5FD0A 5CBJA 3A4XA 5I19L 2MPAH 1R9XA 2XQYK 1JCYA 5FO9B 5DVMA 2CM6A 3DV4A 2ROXA 1A8ZA 5E2JA 1WNOA 2WMIB 2F15A 4AQAA 1SEQL 3HS9A 4GRLA 2EIZB 3GDTA 4PZVA 1V93A 4CW1B 4U33A 4JFYA 4HNTA 3NESA 3SSJA 4PJEE 2L7EA 1A7RH 1C93A 1IUZA 1J8VA 1YN7B 3MKVA 4AIZA 4US5A 3WLRA 5M1TA 3SRDA 4H26B 2VAAA 1NAMB 1ZANH 5T1KA 3MBEA 4APQC 5H2BA 3QUMH 1TETL 3OL2A 1WT5C 1AQMA 4Q6IB 5D5MA 2ODIA 3L65A 5AW0B 2X0UA 2ZTKA 4HWNA 4AQ1C 1AW2A 4ZFGL 3BFWA 2PDFA 1FNEA 2JIXA 1R24B 3PIQA 1JDEA 5GS1B 2A6DB 4ZZFA 3KLLA 4FF7A 5JBDA 2GJ6A 4JFQB 4WR3A 4PA8A 5EV7A 3NO3A 1I1FA 5I3GA 2NLJA 1PZAA 4FHAA 3KCWA 3AIRA 3MTWA 2Q8ZA 3K71B 4XWOD 5GRUH 2Y06H 5D7LD 2UZXA 4OZFA 4MD4A 1QKZL 5TBOA 3UWZA 4GY4A 3LCHA 4Z1BA 5ENWB 1TNNA 4Z7NF 4CDHA 3H2AA 4CVZA 4QHKI 2VSMB 4Q0XL 4A3UA 2BW5A 3CFCL 4XI5C 2PDKA 4N2IA 2FJHB 3M0VA 1B3XA 3D09A 2D3VA 1JPDX 1GHFL 1HILA 1ITQA 5MEOB 4IX0A 1Z2KA 1H41A 3WL9B 3NCCB 3O6DA 2CHWA 2GOKA 2C34A 4OLYL 5IIEA 2ATPA 4CC4C 5I24A 4UM8B 4CU7A 2G41A 3KL0A 3HZ3A 3W75A 4FZIA 2ALRA 3RVXC 1KEML 2ZX7A 4F3HA 5C0DA 1YYLL 2VH5H 2ISDA 4ADSA 1DQDL 4PGZA 3O11A 4ETQA 4ZI8A 4G82A 3PZIA 1UGNA 3OEXA 1U8HA 2GQ8A 4ICCX 2H1LM 3T44A 2GJXB 2P46B 1KFJA 4OCWH 4P3WA 4FMKA 4NQED 3ARFA 1NLDL 1ZKAA 3KM8A 1H8NA 3BGMB 5E1AB 3VOGA 4LO9A 1EMTH 4CL7A 1E9QB 2C18A 1XBZA 5LNUA 5DT1L 5T8IA 3UC0H 3X11A 5IZ7A 4XXWC 1FV1B 1JF1B 3V5DA 4TSBL 2WLYA 2XTJD 4ODUB 4F37F 4JQVC 5H8MA 4HZ7A 3VXUB 3VUAA 4WUIA 4PTTA 1GZPB 1XV8A 3FUKA 1QR7A 3ZE0F 1P6AB 5DJZA 2E0PA 1OK6A 2J13A 1NOAA 5K9OA 3SCWA 5IHZB 1NCOA 5I1HL 1JNNH 5AKVA 1NSJA 5BXFA 3RUGB 1RZKL 1QVBA 2H45A 4JTIA 1FNLA 1EC8A 5GGTA 3AS1A 3BG9A 5D93C 5IJDC 3TTQA 4O57A 1V7MH 1S3TC 2D2GA 1PKYA 3W7EA 5DXXA 3PGFL 4L3EE 4JFFB 2PWDA 4RGND 4F7MA 4EN2A 1S4IA 2XN9A 1L9MA 1N4XH 2QUMA 3DV6B 5G1MA 2AJSL 3GBEA 4GH1A 3OJVC 5FO8B 2R69H 4BQ3A 3KNBA 3RWJA 6FABH 1S7TB 1FP9A 1YEKL 3SB3A 5BV7B 4L1DA 3LKNA 2MANA 3PV7A 4WDTA 4NAEB 3I75B 2Q86B 1O6SA 4ZB0A 1E2VA 3QJVB 1OFDA 1L6XA 3QV8A 5LKNA 3GKWH 1HXMB 2XWEA 4UIKL 1UFGA 2ZWLT 4WDWA 1C8QA 1W80A 1U91B 5SWUA 2FEJA 2GUOB 4AZIA 3RE0A 4BQ9A 3P3YA 3IUDA 3DRQA 2JELH 4HPJA 4X6CA 3LQAH 2WO2B 5CSYA 3LN4B 3ERXA 2BRRH 1CS6A 1F76A 3Q5OA 1ADQL 2J6VA 4DEFA 3S3JA 2NUTA 2W65A 4L80A 2KDYA 5C6MA 1XGRA 1EJFA 2B1AH 1OQXA 4JRYB 2VJ8A 3WGVB 3L2NA 4U6VH 4HKBB 2O5YL 4LQFH 2UY5A 1A50A 4HHWA 3KXFB 4PUJA 4IJRA 1KTBA 5HHOB 1ZIAA 5F1VA 3KWWB 4LSQL 2INFA 1MFDL 1LO2L 2AL2B 2ZXGA 5HYFA 4R4BB 4KH9A 2UWEB 1EWEA 1R3IH 3K2KA 4TNVK 5A95A 5TIMA 4G7YH 3BOXA 2ZOTA 4Z7WF 2Q2LA 1EIXA 4AIOA 3TBSA 2OKTA 1IAKA 1FLRH 3CBKB 2HJPA 1EXHA 3FB8B 2C91A 1MKFA 1UQYA 3HO8A 1C5CL 2BMKA 4MX7B 2QV2A 4N8VG 3S9YA 3VI3A 4NYLA 4EWJA 3G6JF 3KRSA 4XVOA 1CDBA 1TR7A 3D4CA 3W28A 4LBEA 3RHWK 3VXNB 2ALDA 2P3ZA 5IR1A 2VITB 4Q6IC 1W8EA 4YHLH 1YNLL 2K9FB 4Y8FA 2OX4A 1TJHH 1M9WA 1U1UA 2P5EB 3WS3A 5JIMA 5BZDB 1RV8A 1LRNA 2Y23A 3DU0A 3GSUA 5GS1C 1A21A 3IMTA 3C2AL 3C2OA 2VC2H 7TIMA 4U2ZA 4HSOA 2EEBA 3SPJA 3JV4A 3DHDA 4ZEPA 5AW7B 5HJ3A 4KKNA 2WSRA 4W9EC 1S5IH 5DHVA 5H4YA 1ZALA 2C6QA 1MUCA 4Q8OA 1KY7A 3N91A 1EX1A 2AGTA 4IRZH 1RPKA 4I3RL 2JJSC 1AO7B 5F0PB 3VIKA 2E7HA 3B8DA 2VDRB 3RLHA 3ZDZF 2CCLA 3BT0A 3RX8A 1CGUA 3P73B 1BIIB 4GABA 3QJXA 1YNTB 3OZ9L 5I5IA 5MENB 4PTWA 2CBIA 4W7VA 3UVAA 2H8PA 5EO0B 5C0CA 1E42A 1XYCA 5E95B 2E77A 3N1PC 2MQ0A 2J88A 4DWHA 1HHGB 5CJNA 1OE3A 2VMCA 2E27H 3URNA 1CX9A 4Q97A 2GFTA 3TYBA 2UXTA 4RRPM 3U30B 4YN3A 5CM1A 5HPOA 4GUFA 3MRQA 2Z34A 3LHZA 1ZTVA 3KPRA 3PCYA 2JK2A 1YNKL 3UZJA 1UM6L 1RZGA 3AU1B 1VHNA 3TNBA 1C7SA 4B9GA 4C59B 3B2DC 2YMOA 4U6XB 5BQDA 3VWJB 1CXKA 4F7PB 2WBXA 2XX0A 2YSSB 3H12A 1QW8A 5CHNA 3SY5A 2EC8A 1OC6A 1BEYL 2NRDA 3U2EA 4LP5A 4WGVB 3DXAA 3ILEA 3WH9A 3UETA 3CMGA 3NEHA 2DS4A 4IL0A 2C3VB 1W72B 2JF6A 4PP1C 3QFEA 1AGEA 4OZIF 4PTVA 1BSIA 2BY1A 2WWNA 5HGDB 1BYNA 2Z2BA 2ZUNA 4MMZA 2ZKHH 1OP5H 3OMIB 1W2KT 4MNHA 1S9KC 2BZDA 3KBEA 1SFJA 4NFBA 2BOFX 2AJUL 1KBLA 4LRIC 1E4WH 1HCVA 1VDGA 5DX7A 1AIFA 3QR2A 1NGPH 3HIZA 2CZ5A 4J5VA 2OSXA 2L7QA 2HKFL 3N41B 2ZG3A 4Y4HB 5DJ6B 2W94A 3IVUA 2G30A 3FU7B 4UFHA 3WNJA 3TEZA 2XKNB 3UPAA 4P2YA 4UBPC 4FD0A 5J1SC 1Q9KA 4GG9A 1LE9B 1ZHNB 2IKJA 3QQ9C 2EIDA 3VFOB 5FM4A 2J7LA 1GPOL 3LBOA 5CPLA 2PPGA 2VHLA 4KXZH 2ZWKA 3CQQA 3HHSB 3S5LG 4FTVE 5I1LB 2R0LL 5J4MA 5GGRA 5KSVB 1UPMB 3L5AA 4XN2A 3H7BA 4PTDA 4DUWA 4OV5B 3V5KA 1WC7A 4OFKA 1FHLA 4Z7VA 4ADIA 2VI0A 4IIQA 4M5YH 2HBXA 4XAFA 1HDMA 4OAWA 4FZ8H 4NO5A 1RCQA 2X4TB 3MU7A 1PG7W 5BV7C 1Z9OA 4AZ8A 1RFDH 1V6WA 2AXGB 3N06B 2DL2A 4IMLB 4URKA 2BNRE 4ICNA 3PLYA 1G7QB 2VB5A 5I73B 2VFIA 4IF2A 4Y1AB 3RR1A 1OD0A 1Z5LB 1IXQA 3S34H 2CLOA 2A3LA 1EA9C 3MYPA 2WWKT 1KRCC 4PBGA 4K3EH 2OMVA 4MAUL 4NM4L 3VD3A 5HYQA 3X1NA 2R7EA 3N6YA 5KVGL 2NDGA 5IVXF 3N1GC 1XYLA 3B9NA 4XD5A 3EB2A 2N7SA 4ZPTA 1U21A 3D3VA 4JMNA 2PPEA 2QNEA 1N6VA 4CSPA 3A12A 2GABA 4N25A 4KJYB 1QYGH 4ODVH 3HB3D 1T83C 3DNKA 1H60A 1BJ1J 4F8TA 3W83A 2DTSA 3C5ZC 4WJG3 3MGOA 3TONA 2VDLH 2FH8A 3QWQB 1RQEA 5DQ9B 4FFWD 2E7LC 1HOCA 4G8FA 1JNHA 2V82A 4M6NL 4QNEA 2JI3A 2XN2A 4L9DA 3N85L 5CZ0A 1REIA 4MWFA 1XJBA 4Y5XA 4G1EB 4N6EA 3QTPA 3QR3A 1U8CA 3RWFA 1IGJA 1V7NH 2JIEA 2IAND 4JFZL 2CLZB 1F86A 3SYOA 3MVIA 1NJ9A 3S35H 1ERNA 2GK2A 1EZ2A 4QXTA 3ARDD 4XZBA 1HXJA 1E4XI 3CUGA 4O4VA 4YSPA 3D6GA 1A6AB 4ZE5A 3FB5A 3G1DA 1EZWA 3RYMA 4OD2B 4GKZB 4NBXB 3PZUA 4JFUA 4PRDA 1XF3A 3G04B 3NSMA 2HRPH 3KEDA 1GC1L 5KSBF 3EWDA 2XNAB 5JDJA 1ZHBB 2UBPC 4OI7A 2VX7A 5EC2B 3HPZA 1XGYH 1BM7A 3S6DA 4QDPA 1UWXH 3UTSD 4K3GA 1MQRA 4MWAD 4QRUB 2CMRL 1ZBKA 2VO5A 1BFOB 4AZ5A 1RHHA 5LA1A 4GBUA 5I06A 2E6JA 4PJXB 2WB1A 4MCNA 3T4AB 3Q1SL 4KZEH 2OKOA 3HZYB 5IMLA 3ECUA 4LLQB 3IETA 3FCPA 1V5JA 4HBKA 2YGPA 2Z91B 3L4YA 2EDOA 2W5FA 1EJTC 1HJUA 1ITUA 2R4SH 4E9WA 1W17A 4BV1A 5K1VA 5DA4A 1ECYA 5AZ1A 3SAZA 5ABAA 1S5HB 3D18B 2ACQA 1PBGA 3FJ6A 3AMLA 1ACYL 3MXVH 3WXWH 5D09A 2RA1A 4K7PL 5D6CA 2Z7WA 5DO8A 1AY1H 4NFDA 2NW2B 4Q4RA 3E12A 1NIAA 3M8OH 4CCDA 5A2BA 2FLIA 2VUKA 2CO6B 3WDQA 5D7IB 2JXMB 1I82A 3DIPA 3U30C 1WFJA 4KKBD 3TBTA 3GINA 1A6PA 4LSBA 4YU1A 3W0WD 1E0OB 3IBOA 4XBEH 4YDJB 2XZ7A 4NNCA 5ICZB 4EBQH 1TTQA 4GZEA 2B7OA 2QCCA 1DL3A 3VOCA 4HU3A 3VWJC 1QA9A 3U9WA 1WZKA 2XG4B 4MASA 5DWPA 5IUCA 1XDMA 4MMYA 2LU7A 4HLJA 4F66A 5EZIL 2FK9A 1FG2A 4HF5L 1Q8MA 3FVMA 4O5LL 1R85A 4QXIA 4LSTH 5J6HA 4N6QA 5C0AB 4GY1A 4C4BA 3LVEA 1EZUA 2QPSA 4X6EA 3K6SB 2QAFA 3MI2A 3BH9A 4DKTA 3PU7A 4DPPA 4LWWA 4O12A 5B4MD 3GAYA 2EO1A 3CLFL 3TJHC 4K7PY 3UG5A 2VO8A 3CN4A 4TL5A 3HGJA 2VWTA 3M1BB 1KBBA 2WANA 2ZSWA 2PFHA 3LKPA 1UKTA 3BPCA 4GUIA 3SGEI 3L7EA 1SUHA 4F2TA 2Z1XA 3MCKB 4MZ8A 4PMJA 2WIIA 4HEPG 4Y4HC 2V2XA 3I50H 1ENUA 3AJ7A 5FYKH 2C7FA 4HN8A 3MX0B 2X1QA 1IGMH 3TT1L 3PQYD 2UV3A 3BSGA 4NJIA 3WLHA 6REQB 4OV9A 3KPLA 3V79C 1SFDA 3KYMA 3NZ8B 1K8CA 4NUMA 1FN4A 2O61A 1T6MA 2YW4A 5CGTA 3O6LH 4WI5A 1AJ7H 2CDEA 1M56B 2XN9E 5FJTA 4M1DH 1Y5WA 2PR9A 2YAPA 1OINA 2BO0A 1E43A 5HDQH 1DQJA 1SHXA 1SUXA 1O7DE 3E02A 2PYFB 1T5XB 4HVBA 5TE7L 2IALA 2QT3A 4M6ML 2GJZA 2F54D 1L7IH 3J2PA 3C6LB 5K93A 2LAAA 3WUWB 5G1YA 4DJED 3N2MA 4XGZB 4L9LB 4L18A 3SN1A 1QNPA 3O41B 4AIXA 1FUYA 4PD4J 2WQSA 1DZBA 2DWEB 5I73C 4K38A 1X3DA 1MVYA 3WMQA 5DF0A 5AN7A 1Q0EA 3BCJA 2G2RB 1CURA 4AENA 2A1WL 3MTRA 4XVSL 1AOZA 2XN0A 2FDBP 3RCNA 2WKJA 3U6XS 3LG3A 1A1OB 1B9KA 2QKIB 2F0CA 4I18B 3NFSH 4I9JA 4QDWA 1IC7H 1JBJA 3B4UA 4NPYA 4IUGA 2ESVE 2VMFA 1EK3A 3H3BC 4X6CE 3NJXA 5EC1A 1MJUH 2DVUA 3IDXL 4Q9RL 4OLZH 3NO5A 3SDOA 3R8QA 1ZTXL 2P26A 5E5LA 3HGOA 5IB5A 4W89A 4XR8C 4OCYL 3FTGA 2WC3A 3QGKC 1YEHL 2W6RA 1AS6A 2CESA 2PDQA 3W37A 4UFJA 3QYNA 4G71B 3LS5L 2J1KA 4ODSH 1LO5B 2XFXA 2MOQA 1FL6A 2EZ0C 4BH7B 2W95A 3WD1A 5CEZE 4EPDC 4YK4B 1TSIA 5D1QA 2FTYA 1P6FA 5DCDA 4ZW3A 9XIAA 1J2BA 1MAML 4FPSA 4ZD3H 4LF3B 1RPQA 4DP2X 3RUGF 4N0YH 1JCXA 5ACZB 4H1LA 1EUNA 2AQTA 4L65A 4G7QB 1G4TA 4FFYA 4XAWL 4XHJD 2OMXA 3DIFA 2XX1A 2H6PB 2AKMA 4DM2A 1ESWA 1NL0L 3TS8A 3GHEL 1FZKB 2JK5A 4Z3TA 3CCHB 5LXGL 3SODB 1ZK5A 2GGGA 2XQYG 3FKUS 4Q2ZA 1JZ6A 4MKMA 4OVXA 1D9KD 1EF2A 1LBFA 1YE6A 3OGOE 2WAQA 2Z35B 2DOCA 4B5EA 1MCWM 4TQPA 3BW9B 1BXNA 2GAZB 4WNJA 3TSBA 1UVQB 3W6YA 4PJEA 4ZMVA 1MHHA 1W5QA 3AIWA 2CBOA 1PKQB 2WCAA 3TEWA 3AZRA 4MNQB 4LAMA 1MEXH 4S2SB 3T4AC 5E2WH 1MDAA 1ZLUH 1AHMA 2OTPA 2X1SA 3AM8A 3IJ8A 1A5AA 4P9HH 3PBUA 4IH3A 4GNJA 1W9BM 3E0VA 2V0AA 1KM5A 5F9DC 4OV6F 2J44A 3U6RA 3EWUA 4LLUB 4PW4A 4JRXD 3A4DA 2PCXA 4ZYKB 3OGVA 3QDHA 4XPAL 4FR6A 4N9OB 2BFVL 1IHIA 3CHQA 2Q7YA 3EYQC 3BUQA 3C61A 2DYRB 3FQTB 2O1AA 1D5XA 1PGRB 2VN4A 4TIMA 3N0AA 4MSWA 1FKWA 3PYCA 4LKCA 1GQJA 4RDBA 5FGCB 3UERA 3EO0A 4A8RA 3IDIB 2UZPA 3W74A 3FUHA 2ZDRA 2EH8H 4M81A 4LOEA 3UP6A 3D0VA 4YBQD 1RY7B 2R2BB 3EKLA 3VD9A 5FO2A 3DVFA 2Q09A 5CCKH 4G8IB 4OUIA 2UWEF 2WXDM 4MB4A 2MMXA 3UCQA 3RY5A 1VZWA 5BO0D 4YCPA 3QVQA 4NAFB 5J12B 3KPRE 2GSJA 4JL1A 3TNOA 4X83A 5DZOA 3Q2LA 1XIBA 3N2BA 4WWID 3GAKA 5TDOA 4RW3A 4CQBA 4GBXD 3AUVA 2HKAA 4MAVA 2VLRE 5CJQL 1I7UA 3DXAE 1VFUA 2BCKB 4WNQA 4O18A 4YXHH 2FB2A 1A6TA 2P8LA 3IU4L 5DCCA 2DIKA 4KY1L 1XEDA 3F05A 5HANA 5DVOA 1ZENA 4IM8A 5JHLH 4PS4L 1KKOA 3QDMA 4R53A 1E7VA 4G43B 1BWMA 4F9PC 2L3BA 1JK9B 5ETUB 1R38A 1PTAA 4Y9OA 3CLWA 2AAAA 2A0NA 5F9JB 2VDMB 4M51A 2DLFH 1VLIA 4XX6A 2OXGB 1MH5A 3RL2B 1TPUA 2IPJA 5IMKB 3EOUA 1GZGA 5FYLL 1ORSA 5DD0H 4F3FA 3V4PA 3NCYP 1MDTA 5FA4A 1VD6A 3E96A 3U8GA 3D30A 1X5LA 3QIBD 4MCYA 2IDFA 3MCLH 1N8ZA 5BJTB 1ZV5A 4XC3H 2AQ3A 1A4JA 2WN3A 1N8FA 5DHMC 3W2MA 4FCHA 4X7TB 5B7YA 4R4NC 3UR5A 4KJQD 4U31A 2E8ZA 1V3JA 5H6HA 5GGSB 1YNTF 3WDIA 2CLIA 5CJXC 4YTTA 5JHBA 1EFZA 3FTUA 4N5ED 1B88A 3PWUA 4WKXA 4FLQA 3CH0A 4N3TA 5GIRB 4WI2A 4NT6B 3BESR 1F73A 4UTAL 1PYFA 2H8ZA 3F7VB 5I8KH 2Z31B 3C8KB 3IRPX 5DK0B 1OADA 1IGIL 1YQVL 5FKYA 3C6LC 2ZX9A 3SI9A 4Z7UB 4JVPA 4PRIB 1QRNB 3NCYS 4L9LC 4QXGL 4JHAL 1OD9A 5DR5L 3BKJH 2ZOLA 3QARA 2V7NB 1GHSA 3UGRA 2VR5A 4CKQA 2B8OT 2YDQA 4L3EA 4WW2B 1XLBA 1JTTA 4UOW0 4YAQB 2YSWA 3QHFL 1KGXA 1U8LA 4GSQA 3I6TA 2NR6D 2X0HA 1G01A 1MXSA 3ZTEA 2QKFA 2JB5H 4Q8MA 3GD6A 2P3YA 1VPXA 2QKIC 4I18C 4IW4C 3V7AG 1OGPA 3LEYL 3L68A 5FEZA 3ZVVA 1VR6A 3CM4A 3KGTA 3FT1A 3GSNB 1FHDA 4HPYL 4UV4L 3S4SA 4PTNA 2CQVA 3W88A 3FU5A 3UP1A 4BWLA 1OTTD 3LKSB 4ZTPH 1U1HA 3D3VE 4YHZH 2K9UA 1TQCB 3AUJA 1OGAD 2YQGA 4W6XB 1FGNL 1ACXA 1ZL1A 1TEYA 2VR7A 3E6FB 4IBTA 5FECA 4U6TA 4FKEA 2OZ4H 2P8PA 3II2A 4YX2L 4OM0L 5FL1A 1M6UA 3DJ9A 1NM4A 3HLAB 1MSPA 2KBGA 3CVBA 3GDRA 5LXXA 4CSTA 3DX7B 4C6QA 4OFYD 4YK4C 3HNVH 3N41F 2XUCA 5I30H 4H88H 4RXFA 1OV8A 2DMBA 3EPMA 2WLIB 3FTSA 3KX6A 4GB9A 2NCEA 2OMTB 2COVD 3KRUA 3UXDA 1RJLB 4PFHA 3WXVL 3VRLF 4NXSA 2PC8A 3BFOA 2OW7A 1CBVL 1MLCA 1XF5B 3AU2A 4HCRL 4GSDL 3ZDZB 3T3ME 1TT6A 4RW5A 4Z0XA 5EF2A 4JY4A 3AU0A 4W9GC 3STEA 2YYUA 2FECL 4AF0B 4ZW5A 4JR9L 2XYCA 3IDJA 5D6DC 3P4NB 3F5LA 4Y19D 1E5BA 4P8QA 1CD0A 2IDCA 4Q7DA 1IQWL 2YCJA 5FUOH 4K5OA 3LZPA 3IN2A 1NUFA 2RH0A 2EG8A 3VH8A 1GYVA 1ZNNA 5K9DA 4JM2A 2V5RA 5CJ8A 1HVQA 3CVHA 3H9SD 2PTTA 3D2UA 2YD9A 1AIZA 2NWSA 4AXWA 1FXPA 5DHYB 3DV4B 5DZVA 4Q4IA 1FFOB 3FUNA 3ZTNH 3GSMA 2WLKA 4NJ9H 1AGDB 2M8XA 3UR8A 5I7GA 5JMUA 4ACPA 5FUCE 2J6EH 3DI0A 3P80A 4NZTH 1XM3A 5DFVD 5E2VL 4GUQA 1Z0MA 4KWUA 3HAEB 5FK9B 3ZHNA 3OKEA 4I0PD 3X1GA 4KESA 4KZ0A 5TDPA 1Q1PA 2QBWA 4JHWL 3S8WA 3CFUA 2D69A 3HPLA 4QXWA 3PHOB 2LE9A 3D39A 4OGXH 4FLRA 4K9EC 1HL2A 2B4CC 4Q14A 3UAJA 4IKIA 4YVUA 4KOBA 4H6EA 4NWUH 1BVZA 1FBIH 4MA7H 4CNPA 5KVFH 5HVGB 1DTUA 3GR7A 2H2SC 2O6PA 2IOOA 1MFNA 2TODA 1ZAGA 1CK0L 1H8OA 3PL6D 3GKAA 4G6ML 3U2JA 3BSZH 3HURA 5DRXA 4M7KL 2Q5BA 1Q6GA 1CDJA 3ESPA 2V7HB 2FVMA 3SEPA 4ZNEA 1U41A 1D6EB 1CENA 1WHOA 1MIEL 4DM1A 1J6PA 3SHSA 1HH9A 5J12C 3HG4A 1GZHC 2DL9A 3ZXWA 1EJSC 4ORIA 2GZXA 2YA2A 2X3AA 5ISZD 2KH2B 5BS0B 3HR5B 3CPLB 1SOKA 2GTZA 4KGJA 4A7QA 4W9DC 4QIRA 2XA8L 4MXQC 2KMWA 2ZYRA 1CCZA 2W8CA 5T9CE 4TF4A 2GUUA 5IW3A 4A35A 4AUBA 2PABA 1HC1A 5F93C 4RZCA 1HAUA 4OGQC 4D8PB 5T3XD 3IDYB 1V3HA 3FFOA 5ADOH 4A67A 3ZLGA 4KUCD 5EUOA 5GJTH 1S6NA 2K70A 2AK4E 5EEUA 3UL4A 3RWIA 3H55A 2E67A 2C9RA 2ATPB 3UTTB 3QQXA 2WW8A 3HPAA 3RVUD 4GXWA 1T21B 2RDUA 3W1LA 4PJXF 1KTDA 4PH8A 4NJAL 2V2WA 3JRKA 2P4AB 4GAGL 1XL6A 2FCBA 1IGCH 1K4HA 1GYMA 4BK9A 3VFCA 4GNKB 1PYMA 3TYAA 1F2XK 4HBCL 4ZSOB 1XKJA 4L3AA 1XZ0A 1IM9A 3PREA 5IB1A 3MMEA 4ONGH 4X4XB 4ML9A 2VLMD 4IS6A 3O2VH 1JFQL 3WN5B 3IGAA 1D2OA 4BUGA 4QLKA 1WKYA 1M2VB 2CH8A 4KVNL 4NRZA 4B7LA 4OZHF 1QPKA 4IQDA 4P49A 2EYRA 3DFNA 3MFFA 2W60B 3KPSA 4DBWA 1CE6B 1KM6A 2X5PA 5J1AA 3N14A 4I2XA 2MPVA 2BP0A 4U1NA 5GRJH 2PR4L 4TMCA 2Z31C 3HCVB 5KINA 4E3VA 1XXFC 4F7CA 1EJXC 4JPIB 1XUZA 4MXVE 3D51A 1CLYH 4GQPH 3PABB 3JWDH 1RBOB 4RAUA 4Z2IA 1TTAA 2XH7A 1XS2A 2R39A 4Z0BL 1T1WB 1XIMA 3G6DL 4WW2C 1A64A 4NG3A 1J5TA 1H3VA 1JV2A 1VKXA 2BPBA 4IOSA 1NAML 4H83A 5CN1A 2FO4B 4KO6A 3HFML 4P5KA 4KUZL 4K5LA 2JCWA 3G77A 4LNCA 3H2FA 4F7MB 3DTUB 5GNXA 2AEWA 3DGBA 4JRFA 5KSBB 5MKGB 1BWKA 5DA0B 2H9GA 4LVFA 1QBML 3E5PA 3O3BA 3FOMB 1TQCC 3SJVB 5DN1A 1X5JA 1DDHB 4YSTA 3UBFA 1T89C 1TTIA 2FYMA 4DF0A 4JG1H 4F91B 1DSYA 5ABFB 5I0DA 2WZPD 4Y89A 2A9MH 4DZ8B 2DUAA 5IF0B 4BK8A 4U6HB 4WY7L 3QSKB 3WK3A 5FF2A 4DJFC 1MN4A 5DC0A 4GJJA 1TG8A 4WFEE 5D1QE 4LXFA 1LRTA 3NSDA 2UYLB 1RURH 1XH3B 3L1EA 2GDVA 3KPMB 5J06A 4JPKL 7ODCA 4ZW7A 2EDLA 5F7KC 4PCSA 2EYSB 1F0LA 3S83A 2WXRA 4OTXH 3TZVB 3BLFA 5KBDA 1YNQA 1VH7A 4FTDA 4P23A 2VSDA 3KVMA 4ZOCA 3EZ8A 3STFA 4JAMA 1EEUA 2W65B 5AKQA 4ZXLA 1PX4A 1P53A 3Q6GH 1HEZB 2FVNA 5EEVA 1KXHA 3M17B 3CSYB 5L2KB 2JKIS 3CC5B 5LIXX 1L7TL 5F3HB 4U1SB 2VKZG 3PBWA 3PSWA 4G8EB 5C7XH 1AZ2A 2XFYA 2WY3B 3O2LA 5CMAA 2HWZL 1AZCA 1ISXA 1PPIA 1MPAL 1UB5B 4WFFE 5BQ7B 4XZMX 4BR1A 5BO1H 4M61B 1YEDB 3NM1A 1FF5A 4N1HB 2I27N 2PTDA 3F84A 1YLVA 3PG8A 2YUWA 4AC1X 2QHRH 1TJXA 3H42L 4MHBA 1KBGH 1WDQA 2RBLA 1ZU8A 4NWTH 4AW7A 4U7MA 3APGA 4Q7IA 3C3NA 2EKSA 2ZUMA 4DWSD 5B3JE 5DRNB 1RIUL 5HUPA 4NP9A 3R06A 5CZXD 2A9DA 3TBYB 2DKSA 3RGTA 1R2RA 2Y88A 4OZ4B 1JGUL 3WF2A 5E70A 3SIMA 1CD9B 4XMKL 4KI1A 2DQFB 2CO3A 4HKZA 1OCCB 3WHE1 3GWJA 5AHLA 3MRNA 3MNDA 1BP3B 3MBWB 1UZ8A 4Q8PA 4R7XA 2VDKB 3WKPA 5LNGA 4UDUB 3MGTB 1YEWA 4W93A 4Q4KA 4BFBD 3WS3B 3VTMA 4GFSA 1N2RB 2RCSL 3V1HA 3WELA 2R29L 2R56L 2DY2A 5CSUA 1TUFA 5DJXA 2NXZD 5EZJB 1X7IA 3ATFA 1LJMA 4M7LT 1XDTT 4YE4L 1TA3B 4DVRL 2XWXA 3APNA 4GUHA 1I7TA 3UA3A 2F58H 3KBHE 5ABTA 4JDTH 3GJEB 4NSKA 3NCEB 2CGRL 2AQOA 2NY0C 4MYAA 2O56A 5F7BA 4UWMA 3ZMRA 4IHBA 3F7JA 4NZ3A 3WI9A 3NPVA 3AZUA 3AT0A 2J2ZB 2XXMB 4LAZA 2VGBA 2R1LA 2G9HA 1A02N 1T7LA 2N1KA 3GGWB 5BV7L 3CD4A 5LN4A 1HESA 4MA8L 1COBA 3TJEL 5AOUA 2PTZA 1KR0A 3IDYC 3FQXB 2I07B 3UPBA 3AREB 4GRWE 2WWMD 1QO3A 3WQEA 2NQHA 3QDME 1GS6X 1OF8A 3PAUA 5LN8A 3QYQA 4OFCA 5BXTA 1CB7B 3ETTA 1DVUA 1X5XA 2ADGA 3MWAA 1HIZA 2VKWA 1K72A 4Z7OF 1KJ3H 3NCJH 5JHDD 3ZDYB 3EWZA 5FIEA 2NY1D 4YWGH 2IH1A 4AZGA 2OOGA 2F19H 5JA9A 1HJSA 2V8MA 1GOGA 2ISVA 3LIZL 3VU2A 1RSCA 2Y7SA 2WVSA 1SYTA 1F4XL 4IBUA 2FJSA 4F40A 1R75A 3KCPA 2CJUL 3QT2A 4OQ1A 3WN5C 1KPRA 3SURA 1UW9A 2BWIA 5KZCD 5FM8A 2WINB 3CFDB 4ZFOA 2PUQT 1NGQL 1QLRA 4JRWA 3WJJA 1M6OA 1LWIA 4HMNA 1A5FH 5L7XL 2QT6A 4FQHB 4QJ1A 1TCRB 3AT8A 4N1EA 3WX7A 1F1AA 2IH3A 3TFKD 5AD0B 4FNUA 3MLVH 3Q5TA 2J62A 4LDLB 2QGBA 3C8NA 5AC5A 1WAUA 5IHUL 1BQKA 4DN4L 1RD6A 5F6HI 3SQBA 3AXHA 4HH9B 4KK9D 5AYYA 1IC5H 4DO5A 2FB4H 3VXMB 4A7GA 3IIXA 2F1EA 2ZG2A 1O9WA 3H3KA 1SRDA 1CICD 5SWSB 5I1GH 3P4LA 2CKBH 3TYGH 5F7AA 3SGKC 5ERWA 3GHBH 1JRHH 2NYYD 1C7TA 4AD4A 2Q6WA 4YGVB 3OBEA 1EAJA 4Y4FA 2XPZA 3BJFA 5HQMA 1H49A 2AQVA 4Z7VB 4TUKL 4S0HA 4KDVA 3VQMA 2QQQA 3C08H 3A24A 2WXNA 5IBLD 2YYTA 1H5YA 3WL1A 1OT2A 3M0LA 2A9NL 2HFEB 1HVXA 1G7MA 1KRBC 5T3ZD 4IGBD 1ONWA 4ZX3A 1JYWA 1QLEH 1DWIM 2QADB 1EVTC 1US2A 3U1PA 4FI6A 3ZBMA 5IJKA 1NTDA 1AQKL 5LGZA 3UJTH 4E9VA 4U3XA 2ZRWA 4POYA 1MHEB 4QHLA 2WQUA 2VLLB 3CHXA 1KV7A 2E28A 4PJ5B 2ESVA 2PWHA 4LPUA 4PBXA 5I6OA 4D9PA 5HYQB 2MWCA 1JK8A 4U1IB 1R5WA 3SGZA 3ZR6A 2XH4A 3PZQA 3TZVC 3JBG7 2OYLA 1TEGA 3CHDA 1OM0A 2Y61A 3UJ2A 4N6RB 3GSRA 3C5ZB 3QFDA 2HUEA 4P3CL 4FOKA 4O8AA 5BW7C 4W87A 4BE6A 3UO1H 1H6EA 1RZ7H 3G22A 4GYKA 3FN0L 1MO0A 5IK3A 4K55A 1NA8A 3PXHA 4LARH 1U42A 2VZVA 1EHLL 3MMWA 3WFEL 3L3KB 1VFAA 2Y7QB 4Z7UF 1YAZA 1UWIA 4WUUD 5ESQB 4MA3A 2IF7A 2W9EH 3SD2A 2DWDB 5A43C 4K3JL 4MAYA 1C9SA 4DP4X 4Y5XB 3NTCL 2QQNL 4HEME 4QHUB 4WW2F 3KWSA 1O9ZA 4PGEB 3BO8B 1K3ZA 3MQTA 3O9WB 3K1GA 3R19A 1H11A 3DX4A 3FYPA 1LUCA 1P69B 3TCSA 1W72L 1TMHA 1UMLA 1YMHB 4MQ7A 3PZ9A 4LCCA 4N9GA 5DC2A 4N20A 3HZVB 3D39E 3NL6A 3P40A 4TLTA 3DJSA 5FAGA 4XN4A 2XCMC 2CBQA 1V7AA 1ZP3A 4OF7A 2CRZA 2FZBA 4G6JL 4Z5RA 2J7FA 3KHOA 2MHAA 3WY3A 3G18A 1DQMH 2APTA 3H9HB 4JTCA 1VRDA 1OKEA 2HLAA 1E6SM 2P8CA 1G4PA 3CDGB 1A6VL 3IEAA 2A6LA 5KN5A 1T22B 5B8CB 4YHYB 2IV8A 4RNRB 4ZNEE 1NEUA 3WQVA 3R0KA 3CUXA 1XPGA 3ARYA 3I84A 3WK1A 2VCCA 1QWNA 4I6KA 4QDMA 3LTVA 4RMBA 4KGLA 1OAZL 5IMLB 3BUPA 3VDBA 1DCEA 2P50A 3WLOA 5JUVA 3UGVA 1HCZA 1TWDA 5INDA 1CZ1A 2B0SL 4Z7AA 3CHFA 3O6KH 4X98B 3WQPA 1QTYT 1KD0A 2BSSB 1R0MA 4AH7A 3BQVA 4FXRA 3BKYL 2VLJD 5T3ZH 4OF8A 3STLB 3UBXB 1WEJL 1NMCB 1OARH 3BVUA 4DFIA 1ECZA 2B3IA 1TJIL 2O6DA 2VZSA 1IJNA 1EEYA 1MF2H 1J8HD 1AJ0A 4Y4KD 2W62A 1OCWH 5ICXA 2A0LC 3FA4A 3AREC 4QS5A 5F72S 1EB3A 2CA4A 5EUOE 3FSTA 2O5XH 4DEPB 3RDTB 1BKSA 3RTLA 4LBAA 1ODUA 2BVPA 1E70M 2NYKA 2XZQH 3RY6C 4IOTA 1RLBA 2VLRA 1DFBL 4V27A 3EUDA 4PJ9B 3RGVD 5H37G 5MHSD 5LNRA 5C0BA 3RRQA 2ISWA 5I1EH 4UV7L 3UTPE 3F01A 3TYZA 1AMYA 3SCUA 5FV2A 1U8KB 2OJ1A 5IB4A 2ZUVA 4R7DA 2DZWA 5F7MC 1FGVL 4DEWA 1VP5A 1LO0L 4Y9FA 3GSXA 3ZYIA 4XNMA 5D5MF 2P8MA 3QHMA 3WKZA 5DD6A 3ATBA 2HT2D 2F8OA 4DGIL 5HMSA 1VBHA 2FZDA 4AJWA 3KPSE 3M0YA 3UZYA 2YZ8A 1H3TA 1H3GA 1ZLSH 2J8UB 1SFSA 1EP2A 1VFBA 2CUMA 1RZJH 2QCDB 4I2XE 1LK2B 1AH1A 1H09A 3IV3A 1DL7H 1W8NA 3H3PL 3WE1A 1PTZA 1MFAL 4NNBA 3B3BA 5HJXA 2ZCLL 4NIKB 5F7DB 1OCBA 2UZYA 2CKRA 1UD2A 2EG7A 2GY7B 4JJ5A 3FS2A 3DLQR 1Z66A 4JTUA 1BOGA 2JI2A 1H9VA 3HNSL 1OQFA 5SWZA 4UTTC 1DE6A 4S1SH 5JOFB 1I2QA 1Y1UA 3ARTA 4PRHB 4Y7MA 1TZ9A 2CHOA 4HIQA 5DU7A 3GE7A 4NHVA 4G7VL 2Q3AA 1V08A 4XP9L 3K5XA 4G42B 2RHEA 3V5OA 1T3FB 4L7ZA 1BJ1H 2Z26A 3KYAA 2GFBB 4NASA 1UCTA 4UR9A 1QSEA 4ZOBA 5DEFA 2ACSA 4ODXB 1R9FA 4ZQNA 2J1WA 4OI8A 2X0YA 3MYJB 3BGJA 3E8UL 4GKOA 2GJZB 2ZOOA 4JFTA 2Q7NA 3V0EA 3UG3A 1X1ZA 3ECBA 2VURA 1R4XA 3SPHA 2QADC 1FY6A 1M71B 2VQUA 1P4BH 4M6OH 2CDGB 4JO8A 2WXJA 2FFCA 4H19A 5T5FL 1KLFA 5CBIA 5AZEH 3VDHA 2EVIA 3DERA 1XLJA 3D87B 2FGLA 1JGEB 1KFLA 2FATL 4Y9PA 5T26A 4UMGA 3WQ4A 4ILDA 1NFDB 4PBVC 4W9FC 3KTXA 3VXRB 5CGQA 4FULA 3NQFA 4RISH 1T0MB 2ADFH 3BDKA 2B31A 1OVDA 4KWOA 3S96A 4R33A 4NLAA 2GBUA 2F53B 1LWHA 3G9AB 4DZBB 3QP3A 5A6JA 3HUJE 1S78C 4O1FA 3R8RA 4MJMA 1YEGL 4LT7A 2WQPA 3EX2A 3S98A 3F83A 1PCWA 3APDA 1MRQA 1KIQA 5C9JA 2J7EA 2XFXB 3PWVB 1FRGL 4D9QD 1P1ZB 3R0DA 4PUEA 4U6YA 1QMUA 4P3DA 3L7FA 5KYXA 4QSHA 4S1QH 4O15A 3SGDI 3NUKA 4KHXL 3SY8A 2WBGA 2G75B 5DJ8B 5C70A 5E9DD 1EJWC 2I69A 4WKAA 3EXTA 3HBGA 4Y5XC 3WNPA 5F70A 5FYKD 1JCTA 4LLYA 1LOSA 1FE8H 1BVLB 1LXMA 1HWWA 5KS9B 1ZLVK 3O9WC 2APSA 2O4MA 2DTML 5LNWA 4I6VA 4LCIL 4F48A 2ZCGA 2CPCA 1TSHA 1CG9B 3GDMA 5E8OB 4P5TB 5D7HA 3MLWL 3T04D 2F5AL 2V5DA 4U4BA 4H6RA 4RWHA 1DVFB 2EUWA 3GG1A 3IFOA 2D73A 5EEYA 3MRRA 1P7BA 3VXTB 3SKJH 4NKOA 3U1QA 4N0FB 5AHEA 2HUHA 3WN6A 3QWRA 4FXGA 5LAPA 1CYXA 3OKLB 3O3AB 5B8CC 4JQ1A 1CMOA 4YHYC 4J3ZA 1LEKA 1RUKL 1ETZB 4NRSA 1EA0A 1U93B 3MJYA 4I8DA 3FNDA 1YE4A 3F04A 3G24A 3RI5K 3OGCA 1JGVH 4Z2HA 1WKFA 1S5WA 4XMVA 4D9LH 2OO0A 4G6KL 5E6IA 2VJ0A 4GIOA 4IHOA 1ZQ5A 1IV8A 1L4IA 4OZHB 2GI7A 4PWEA 1G9HA 3WQDA 2X1OA 1JPGB 2OJEA 3NJNA 4WGKA 3X14A 3IPEA 2VW4A 3EO0B 4DK3A 1NMCC 5ADPH 1GYNA 3VJ6A 3PUCA 3VWKA 3H24A 4REQB 3W22A 4OJYA 1EZVX 3M9YA 1KN4H 1RZ8B 5T1LA 3Q7JA 4XMUA 1Q6OA 2IQAA 3NFUA 5FA5A 3EFOB 1NICA 3SCNA 4PRAB 4XZUA 1IILE 2OLHA 3KTCA 1N64L 4DEPC 2EVFA 4DB7A 3K30A 3RDTC 3NIDE 1BD2A 1OAUL 5DS8A 5I3IA 3N19B 5KYWA 4KKLC 4B95C 3RAJH 4L29A 2J55A 3DGCR 1LD9B 4MUPA 4JO3L 3UX9B 4D6DA 1WX0A 4R96A 3MSYA 4MB5A 1VGEH 4PJ9C 2QJHA 2EPLX 4PG9B 2YK1L 1QWHA 1ZCCA 5J5RA 5DVNA 3ZE2E 5JIKA 2XV0A 4M3KB 1ZWIB 1G1OA 3NNTA 1DXFA 3BAEH 3VI3F 2RQ8A 5D4JA 3N2JA 3SSZA 2ZQKA 2XI9A 4QCFA 3CN2A 3SN6N 3GBNL 1KM3A 2DBLL 2FSEB 2DW7A 3LCYA 4P5UA 1I9JL 4BI7A 5GSVA 4FK9A 2AK4A 3UAAA 3TPKA 1EH9A 1B3IA 4WKHA 1G1CA 1S7VB 3DMMB 3LB6C 2QF8A 4NQCA 1A4MA 5TDNA 3G6LA 3VXQB 4MD0A 4XB7A 1PZSA 1VACA 2YR3A 2DQMA 4IIDA 3AROA 3QNZA 3CVDA 3GMLA 2JB6B 1AYOA 3LRSA 2QDGA 4LHUD 3C9NB 2PB1A 3DX8A 1LRQA 1MNUL 3B8YA 3SYAA 2BP1A 1ZHLB 1OGTB 4I9XA 2CO2A 5HI3D 5GGVL 2VLKB 3AG2B 1N5YH 4LAOA 4LOFA 4EZKA 1K6QL 1A9BB 5HYSG 3TYDA 1YEJH 2F6AA 3C6CA 4DVOA 4ZOAA 3HFYA 5ANHA 2PP3A 4ZFFB 2PDGA 2AJVL 4XK2A 4Q8TA 2BNJA 4C4KT 2D2JA 3V4VH 1KB9K 3WKMH 1H5BA 1FDLH 4B5UA 1RJRA 2XWZA 1XPYA 4N28A 5B39G 4FG4A 3MW7A 3A22A 1YDYA 4F4RA 3EAUA 2UZIL 3L3OB 3FTXA 5CIPB 2F9BT 4CMMA 2P5WA 1I8UA 3ZDYF 4J2QA 4BI5A 1U8OB 3MJ7B 4L3EB 1VFHA 3NG5A 3LRGA 1P6BA 4L8BA 1PHWA 1IKNA 3L45A 4RAHA 1XYBA 4S0TD 1FFQA 2B4CL 5GGVY 2NX5B 3HRZA 4DN3L 3QH3A 4JNYA 4HUXA 4GVFA 1H6FA 3EA2A 3T0EA 3WLBB 3M4HA 2L8AA 1DWGM 3T0DA 3QXDB 1A4CA 3S4SB 4V11A 5I02A 2B16A 1KCWA 3ES6A 3R79A 1TQBB 2CERA 2M83A 5D7JD 4U10A 3OZKA 3FUIA 4Q8BA 1NU5A 1AZZC 3CUJA 2CWNA 4AYMC 1WFTA 5D7KD 1CWYA 2E4TA 4LGRB 3GUWA 2P8PB 4X50A 4MS8C 4XRCB 2V5LA 5CNHA 4DBUA 1G0CA 5AYZA 4NVTA 4XPGL 1H50A 1VFOA 5A2FA 1SN2A 4TL4A 3QPQD 1XF0A 5I1AB 3MFGB 3RXZA 4NRXB 1ZZMA 3LCLA 4E9YA 5EU6E 3X1FA 4AX7A 4ACZB 3BW3A 4XBPB 1OLLA 2A9AA 5DVPA 1XW8A 5E24E 1W1B1 2LLLA 1JHKL 1N7KA 3EG9B 1A14L 2CLRA 2NY6D 3LOTA 1P5UA 2IC2A 3GD1C 3GHRA 4P5TC 1AI1L 1A5MC 5IJVB 4Z7VF 4OCSH 4ADGA 5GZOC 4DTGL 3EGXA 2YQ3A 3BRGC 4ZS6D 1DVFC 2CC0A 2A3TA 5EFIA 3GNOA 1N0LB 2VDML 3HPFA 3MRMA 5I8CA 1NKRA 1M04A 1ZEAL 4MQXC 4J3XA 4Z7OB 3MWCA 1H7OA 2XG5A 2FR4B 1JFXA 2R1MA 1QSFA 1ILUA 1IXPA 1T66D 1EDGA 3OYXA 1VYRA 2VOMA 3EOBA 2RFGA 2G4JA 2ENQA 1Q4WA 4KEUA 2DSUA 1ZS8B 2DIBA 4P2AA 5FF6B 2F8XC 5K9KA 1KYUA 4HK7A 2ZP9A 1OALA 3OKEB 5EMKA 3CXHK 3DJTA 3AM8C 4PLOB 3PAJA