1MFVA

Probing the role of a mobile loop in human slaivary amylase: structural studies on the loop-deleted enzyme
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-amylase, salivary
publication title Probing the role of a mobile loop in substrate binding and enzyme activity of human salivary amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mfvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mfvA01
1J0HA 3BCDA 1TR1A 3W82A 3FAWA 2AAAA 1H41A 4PMOA 2VR5A 5A1AA 4NI3A 4UNIA 1QHOA 2D20A 2FHCA 1J12A 5D8WA 1VAHA 5IFPA 2WCSA 2J4GA 4OBRA 1V0MA 5AYIA 3B8SA 3T2QA 2OSYA 4GO9A 1G9HA 1OGGA 4H41A 1QBBA 4M80A 1UKOA 5D9OA 3WH6A 4JHOA 2PWHA 1J01A 1E72M 4P8WA 1H3GA 5D9MA 3PZNA 1XH2A 4EANA 2YBTA 1HVQA 4PRWA 1CLVA 3J7HA 3CUJA 5ABFB 1EQCA 1OM0A 2E0PA 1AQMA 2BHYA 3UETA 5HPOA 1A47A 3PBGA 3BMWA 3GH7A 1E6XM 5CGTA 5EFDA 1NP0A 4U5KA 4OJYA 4NSBA 1W3JA 2Y4SA 4P7QA 1GUVA 1WPCA 3THDA 4W5ZA 3LPPA 3RJYA 3N13A 4IM4A 4DM1A 4CD8A 3OLDA 2CXGA 1FHDA 2EO7A 2EJ1A 4U3CA 1M7XA 3UG3A 4H8HA 1E3ZA 3PN8A 3U5UA 1V3LA 4W7WA 1ITCA 1E4NA 1KBKA 2XYLA 2EEXA 1UQYA 1PAMA 2YL8A 1TUXA 3IAPA 1XGZA 3OGVA 1OD8A 3UERA 2G41A 5BXTA 1A3HA 3WUFA 3VPLA 2HVMA 2OLHA 3BUPA 1WZMA 1B30A 4FLSA 4UFJA 2VO5A 1KQYA 4HU0A 4W8BA 3SCQA 1GNXA 1PX4A 3L4ZA 3WMBA 2ZX7A 3AFBA 1UWRA 5I0DA 2WANA 2WW5A 2XVGA 3AOFA 3H55A 1V0LA 3WENA 2ESCA 2GJXA 2YJQA 2D73A 2RGMA 1HXJA 3VMNA 3RPMA 2UY4A 5BXRA 1GOMA 2CYGA 2XJ7A 3WDRA 3AIRA 3K4AA 1BG9A 5I79A 3II1A 2EXOA 4MJ4A 1QNPA 4AC1X 1PZ3A 1BYAA 2VRQA 1LJYA 4LQ1A 2IGTA 1W1VA 4UQEA 1OINA 2O9RA 4GQQA 3ARUA 4JL2A 1L8NA 1WAWA 3VD7A 1KGXA 2DGAA 5EBAA 3CUGA 1LL4A 4UZUA 1UD8A 5GNYA 2WVVB 5A2CA 1PEZA 2VVSA 4H8UA 2A3HA 4HZ7A 1HKKA 2V3GA 1B3VA 1C7SA 2W5FA 4MADA 4QDMA 2ALWA 2WSPA 4PUEA 1W91A 4PMVA 1ISVA 3D5HA 3TTOA 2J79A 4BQ4A 4PTMA 1K9EA 2GFTA 2YA2A 1DTUA 4M56A 1F4AA 4M1RA 1WB0A 5CXPA 1ZBVA 3IGUA 3OGRA 4LYPA 1J10A 3FHAA 1PIFA 4WKHA 3AIEA 1TQSA 3M7SA 1MVYA 3TTYA 2BNJA 3IJ8A 2BY0A 1OB0A 3ARWA 2PB1A 1SMAA 2FDMA 2PBGA 4ZXLA 1R7AA 4Z2LA 1CXIA 3ZJ7A 4HTYA 3VNYA 2PWEA 1VENA 5I2UA 1JZ8A 2BVDA 1QW9A 1CGYA 4V28A 1GJUA 4CD7A 2FHFA 1CGUA 3O2LA 2VZUA 1PX8A 2CCRA 4PMUA 1M01A 4TUFA 2XVKA 4NRRA 1QNOA 3ZJ6A 3MV11 3AMKA 4W8LA 1XSIA 3CHCA 1W9XA 3WNKA 5A8QA 3CZGA 4FLOA 2QPSA 4OOZA 2GVYA 5JIPA 1OGSA 1XH0A 1HJUA 4P7OA 2WLZA 2YDSA 4CD5A 1D7FA 1KXVA 5CG0A 1GOIA 1MYRA 4GI8A 1YQ2A 4MDPA 1UWTA 4AD1A 4PMNA 2V3FA 5JBDA 3MMDA 3VIFA 1CGVA 1HP5A 2X05A 5BCAA 1VIWA 4GINA 6A3HA 5HDRA 2J62A 3A4XA 4CVWA 1VF8A 2JF7A 1HXKA 2ZXAA 1JNDA 4PCSA 2EBNA 4ZE4A 3MO4A 1UOKA 2XN1A 4QCFA 3A5VA 1KXQA 3UR7A 3A4WA 4CGTA 3SCUA 5DFAA 3VGEA 1HJXA 1HKIA 5LA2A 2WMFA 1CXLA 5CQ1A 4ACYA 1KWKA 1SYTA 3GM8A 4X9YA 1MW1A 3IANA 4HPHA 1E6NA 2WVTA 1FP9A 3WDJA 5HXMA 1GJWA 3AXXA 2QHAA 3ZT6A 1ZS2A 4QLKA 4AZ7A 3O6AA 1KCKA 2QPUA 1ZBWA 2CNCA 3GZAA 5A8PA 1OT2A 1IV8A 5A6AA 1GHRA 1KQZA 1C7TA 2E9LA 3EMZA 1MW0A 3SCRA 2W66A 1VRXA 2VCBA 1QX1A 1BYDA 1QWUA 3VKKA 3U7VA 2DPEA 2JALA 2F1BA 3NSMA 3AS0A 3NSNA 1XRVA 4W7UA 1V3JA 4NZJA 4A3YA 1JYVA 3MV01 4GZEA 2IUZA 4BS0A 1QI4A 3K8MA 4PN2A 5LA0A 1TQWA 5A2BA 1LLOA 2DSVA 1W9BM 5AC4A 5E1QA 1B3YA 4PTVA 1M53A 3VO0A 2CBJA 4OUEA 3TONA 4NF7A 2F1AA 4AZBA 2NW0A 4JZ5A 2WYSA 3KL5A 3JUGA 2J25A 5D8ZA 4BZYA 1OT1A 4H8VA 4H2CA 3ZOAA 4WIWA 1MFUA 2VCCA 2X8RA 5IHSA 3ARVA 4TTUA 4HZ6A 5A8NA 1TQTA 5CZKA 1E6ZA 4M8UA 3VINA 1HJVA 1KB3A 3CZEA 4MAZA 1V6YA 1OIFA 2WNWA 4YN5A 4PMYA 3PTQA 1OD0A 1B31A 3AMGA 3K8LA 4FLRA 1BVZA 5M5DA 2J8GA 4KGJA 4CN4A 3POCA 1HKMA 2WZIA 3WH5A 4ACZA 4HOXA 1UR9A 1EQPA 3ZR5A 2W67A 2YLLA 4UQBA 2CBIA 7TAAA 3M46A 3GXFA 2V3EA 3N18A 2VL4A 2G3IA 2GK1B 2CKRA 1VFMA 1E73M 4KGLA 4V27A 1KGUA 4WF7A 5D9PA 1JI2A 1BPLB 3MUY1 3N15A 3L4VA 3VGGA 2WSKA 1KR0A 3D4YA 1ESWA 3ARSA 5KEZA 2EPMX 2WHKA 3AIQA 5ABEA 2JEQA 4UOQA 3WF1A 3DYPA 1LWHA 2CKSA 4FK9A 3WMCA 3NYDA 3WD0A 3ZM8A 3S5ZA 2YLAA 3N04A 4S3JA 1VEMA 2VRKA 4RE3A 3VDAA 3AZSA 2F7QA 1J18A 2GDVA 5E6YA 2JF6A 3MSGA 2YDQA 4TXEA 1XCXA 2BHUA 1BSIA 4J28A 1W3KA 4B16A 1GORA 4EE9A 1WO2A 1HL8A 4S3KA 3FXYA 4H7VA 5LA1A 3SCOA 3HN3A 3W53A 3BCFA 3AHXA 1PIGA 1NH6A 1BFNA 1JNEA 3WFLA 4D1IA 5LYRA 1H2JA 1W1PA 3BAXA 4MNLA 3PTKA 4JAWA 3ZO9A 2WMIA 3ZSSA 3AZRA 5CPTA 4D6EA 4UZSA 4ZENA 4E2OA 2F8QA 4U33A 3CO4A 2DT3A 2DQXA 2XM2A 4PSRA 4KMQA 4AWEA 4AZIA 3ZJKA 4CN6A 1BYBA 3VVGA 3T0AA 5DF0A 2XGBA 3GYCA 4WKAA 1Y7VA 3A22A 4GI6A 1K6AA 4GZIA 4FNRA 5C71A 4Z2HA 1UD2A 3VX1A 3OLIA 1IZJA 4PCTA 3NDYA 2O9PA 3WIJA 4J3WA 2X1IA 1LG1A 4MB3A 1KCLA 1C8YA 3AZTA 1V6WA 3PZUA 1JL8A 3BSHA 3BUQA 1UASA 2PWFA 5A8OA 3N9KA 1OGBA 5DEZA 1IT0A 2XG9A 5GPRA 4OKDA 3GXNA 2XHYA 1ODZA 4F66A 3GH4A 4D1JA 4QAWA 2JIWA 1R8LA 1V02A 3EMCA 4MNMA 1PS3A 1ZB5A 1VBUA 2ZUUA 3A6OA 3OIHA 2OW6A 2C0HA 1H11A 2EAEA 1RPKA 3LX9A 2BY2A 4DWSC 5BROA 4C7FA 1BAGA 3T2PA 2E9BA 3SUUA 1R47A 1GPFA 1FP8A 4U2ZA 4UQDA 3VSTA 2F2HA 1DWFM 1DHKA 1PPIA 3DYMA 5CPSA 1V6VA 3LRLA 3QOMA 3BSGA 4WLCA 3AIVA 2A3AA 1TCMA 4ZXOA 3T2OA 4B3KA 1UD4A 5I5RA 2VX4A 3W25A 4MNKA 4ZEPA 1UZ4A 2WMGA 5HNNA 1GCYA 4AEFA 1KXTA 3U7BA 2ZIDA 1C8QA 2Y24A 3WBEA 4J3UA 3EDDA 3SUTA 1DWGM 1HWWA 7A3HA 1GVYA 3CLWA 1AQ0A 3D50A 2UY2A 1DWIM 4JKLA 1EHAA 2CPUA 1B9ZA 1CGWA 2J74A 3WSUA 3WEZA 1ZJBA 3ZT5A 4W8AA 3T08A 1V6XA 3WN6A 1JZ4A 1NOWA 3CHFA 2VQTA 1UG6A 5IDIA 5TD4A 4PMZA 5A8MA 2WPGA 1HVXA 1NOFA 4JIEA 2OSXA 3VDHA 4P8VA 4AZCA 2ZUWA 4MAVA 3WNLA 1ODUA 3TV8A 2WMKA 1W9UA 1I75A 3QHMA 1E40A 2YL6A 1E43A 3AYSA 2D0GA 1CWYA 4E8CA 2PF0A 1FA2A 1QNRA 2QF8A 2WHMA 4GI9A 5E70A 1QBAA 3DX0A 2PWGA 2X0HA 4WKFA 2QMJA 4U2YA 4AMXA 3BVTA 2EADA 2O92A 2OYMA 1ECEA 1NWRA 1JDAA 1BGGA 4W85A 3BH4A 4PTWA 3RM4A 1MXGA 3I3BA 3RM8A 2WC4A 3BAYA 3WDIA 3VM5A 1R87A 5BYWA 2J47A 1XD1A 1LQ0A 2CBVA 3VSVA 2XSBA 1W9DM 2BY3A 3CZLA 1U30A 2E9MA 3G6LA 3CIVA 1I1WA 3CHDA 4AY1A 1HJSA 3NDZA 4FNTA 3FNDA 3ZJ8A 1UH4A 2JIEA 4GZJA 4AZGA 1CPUA 3SCPA 1K9DA 3VX0A 5BRPA 1DWHM 3W28A 1E5JA 2YL5A 3F5KA 5A6JA 2J7CA 4JFWA 1M03A 3AIBA 1V3HA 4BA0A 1H09A 1W1TA 3FAXA 1KBBA 2WBGA 2AMGA 4MNJA 1JYXA 3WD1A 2XUCA 4DWSB 3WUBA 4XV0A 2BY1A 1W32A 3CTTA 3WMSA 3LPOA 1EA9C 5CJ5A 1GOWA 1NOUA 3VD5A 2A3EA 1P6WA 4ATWA 1WDPA 3AMLA 3A23A 4AXNA 4LGXA 4XZWA 5KZ6A 2FYVA 1UQZA 1WE5A 1J9YA 3CH9A 4BF7A 1UUQA 2VT0A 3BLPX 3VMOA 2WCAA 4NRSA 2XPKA 5M17A 1CECA 1AQHA 2W61A 1JXKA 5FKYA 3AS3A 5JBEA 4PMDA 4PBGA 4NXSA 1UWQA 5FD0A 4NZCA 1C8XA 2VX7A 3NSXA 3NIYA 3SUVA 3WUGA 3ARZA 3DX2A 1VEOA 3VDCA 1MWOA 3WDQA 3RO8A 3MMUA 2BVTA 1QW8A 1GQIA 1L0PA 3T09A 1CNVA 4TVUA 4ML4A 5I23A 1TQUA 1MQRA 3TTQA 1LF1A 2XTKA 3F4VA 1JD9A 1JIBA 4P8UA 1QPKA 2E4TA 5E0FA 2F18A 1GZJA 1UWSA 2G4FA 4F79A 4F9DA 2B31A 2HISA 4PMRA 3PZVA 1ISYA 5BWFA 2DSKA 1MFVA 5I24A 3VIJA 1WZKA 3CGTA 2J7FA 4M24A 5DT5A 3VIIA 3T0BA 2VZTA 4ATLA 3GNPA 5F7UA 3W24A 5IXEA 1GOKA 3AS2A 3O9NA 3HG3A 1JXJA 2F61A 2OWCA 3W81A 2DIEA 4HOZA 3ARQA 3G6MA 1QHPA 3AQUA 3WF0A 2VR4A 3L4XA 2XVNA 3WEMA 1XD0A 2CESA 1E6QM 1XSKA 3WD4A 1XH1A 3SCVA 3AJ7A 3BAKA 1BLIA 5DO8A 3RM9A 3K4DA 3VIHA 4UFKA 2V3DA 4J27A 8A3HA 1UKPA 1PBGA 4JKMA 4A4AA 2JEPA 4AIUA 4N0RA 1K9TA 3SCNA 1WNOA 1XSJA 5IHRA 1E0WA 4J3VA 1PJ9A 2WVUA 4JCMA 2GJXB 4TVCA 1G1YA 3VMPA 5FL0A 3W27A 5A6SA 3CZNA 1YHTA 4PUDA 1CYGA 3ARPA 4CU6A 1JF6A 1H0IA 4CCEA 3KE0A 2WKGA 3HJEA 3CZ8A 3VU2A 1W3HA 3RCNA 1V3IA 2EPLX 3CMJA 1E3XA 4TX6A 4P7NA 2DT1A 3GXPA 5GNXA 3AHVA 3WQ5A 4B3LA 1WDRA 3UG5A 1H1NA 1EGZA 1KXHA 4ATDA 2VX5A 4Z2IA 3PZTA 3AMCA 3OZPA 1JD7A 1VEPA 1ITXA 3VD4A 3DX4A 3VM7A 2YA0A 3WH9A 3VTRA 2DH3A 1K9FA 1WZAA 2FH8A 1TQVA 1KGWA 4D71A 1CXFA 2VZVA 3L4UA 2Z1SA 3W4RA 3NJ3A 1SZNA 3KLLA 4CD6A 5CSYA 2WZEA 4HZ8A 4JHZA 2J77A 3DECA 5GNZA 1JI1A 3WNPA 1UR1A 1MW3A 3KLKA 4N42A 2WVSA 1KFWA 3NUKA 3DX3A 3GDBA 2ZX6A 3U5YA 1J0JA 4QP0A 5EMYA 1GQKA 1R86A 2A3BA 4DUWA 1UHVA 1CXKA 3AICA 1KTCA 1JZ6A 5ECUA 1NWTA 3WQ8A 2E8ZA 4FNSA 5AYBA 5CPQA 1E1FA 2J7EA 2VTFA 3CZKA 2EACA 4D6FA 3AIUA 2XSAA 3BC9A 1HNYA 1EO7A 1EDQA 1JYNA 1JG9A 1NWSA 3ZSTA 2J7GA 1D3CA 3VIGA 1OCQA 3AROA 3L2MA 3SURA 3H54A 1B1YA 3CBWA 2WHJA 2BV9A 3BAIA 1H49A 1ZL1A 1RD6A 1VFOA 1MQQA 5HOSA 1QI0A 2F7PA 3EDFA 5C70A 4NXKA 4E4PA 1HJWA 4QLLA 2VC9A 3VD9A 3GXIA 5M3WA 2Y5EA 4EK7A 2EPNA 1VJSA 5E9AA 4KH2A 1NWUA 2CERA 1D2KA 2WM0A 1V3KA 2OW7A 2NSXA 2XFFA 1Q6CA 2CBUA 2QLYA 1JZ3A 1GOQA 4D6DA 1HP4A 3BUIA 4LX4A 5A6BD 4UR9A 2JFEX 3L4YA 5EFFA 4C7DA 2ZX5A 3TOPA 3UG4A 3TTSA 4AZ5A 3GBEA 1X6NA 2CIPA 3K8KA 5FIPA 2VUYA 2ZUNA 3F5JA 4PYSA 1FFQA 2YBUA 3L4TA 1C90A 5ABFA 3SUWA 3WEOA 3FN9A 2GJRA 1F4HA 3ARYA 3ALFA 1US2A 3PHAA 5A94A 3CUIA 5A2AA 4CCDA 5E09A 1IZKA 5A6BA 4KRTA 4W93A 4OGZA 2NT0A 4UFHA 2WWDA 1E4LA 3VGFA 5ABGA 4OBSA 1GOOA 8CGTA 1FH9A 4GO8A 3TP4A 4H04A 4DO4A 1E0VA 1TA3B 1AMYA 2WB5A 4FNQA 4JFSA 4V2XA 1QNQA 5CLTA 1CZ1A 3EBVA 3RJXA 5JIWA 4B9ZA 4QFUA 4W5UA 4CVUA 1GW1A 2XFYA 3UESA 2J8FA 4TOQA 3QR3A 5A6MA 1G0CA 3VIPA 3WNNA 4AZ6A 4KRUA 3M07A 2WC7A 1UKTA 2XIIA 2DSWA 4CUCA 1UR0A 2XIBA 3IJ9A 2GSJA 2DSUA 4XX6A 3FW6A 5GQBA 3W38A 1TFVA 1W3LA 4RE2A 4X0VA 4UFIA 3DX1A 5BXSA 2YDRA 5DT7A 3WH7A 1BGAA 3HMCA 1QVBA 3CPUA 1XYZA 3WL0A 4U3AA 3BVWA 1EXPA 1EHNA 1B3XA 4UOZA 3WF4A 1GONA 3QOKA 4NZFA 4FF5A 4UQ9A 1BVNP 4DUVA 3B9DA 4GQRA 1NQ6A 1EOMA 3BUDA 4D6IA 2XVPA 1E0XA 3WBAA 2G3JA 3CHEA 1BYCA 1Q6DA 3S2CA 3GNRA 1XCWA 2ZXBA 1W9VA 1XC6A 2YFNA 2EQDA 1UKSA 4M82A 2YA1A 1H5VA 2J7DA 2J7HA 4D6JA 4UCFA 1EDTA 3WD3A 1JFHA 3AS1A 2X0YA 4MB1A 1SFSA 4LPCA 1EOKA 3A3HA 5E6ZA 2JE8A 2VNCA 4XZBA 4P7RA 2TAAA 4BCEA 3OB8A 4W88A 3SUSA 2FH6A 1R75A 1RP8A 4YHEA 2WVVA 4IUGA 1JZ5A 2AOSA 1H0GA 1W1YA 2XWDA 4GPNA 5FOOA 2F7RA 1C93A 3ZIZA 1C92A 3WKZA 1E6RA 1G94A 3KL3A 4HOWA 4ACZB 2W63A 4JFVA 4PEEA 3WFZA 1GHSA 2YOCA 3W37A 2BFGA 1HX0A 2W91A 1AVAA 4Y7EA 3KZSA 2BXZA 2DT2A 1V02E 2DIJA 1V6UA 2WCGA 3SCWA 4BQ2A 1V3MA 4IISA 4RL3A 4J3SA 3FHQA 1JAKA 3KWXA 4MDOA 1X6LA 1ZJAA 2D2OA 2OYLA 1G01A 4U5IA 1B2YA 2ZXDA 4B9YA 7CGTA 4JFUA 5ABHA 5IFTA 3AHTA 2G8ZA 2IXUA 3GH5A 3T0DA 1CBGA 1UH3A 4MB5A 3GBDA 3U57A 1T0OA 3VNZA 4BQ3A 1WP6A 3IK2A 1OWQA 1QI3A 3CV5A 4AD4A 2VJXA 3BVUA 2D1ZA 4D6GA 1KR1A 1V03A 3RIKA 4HA3A 1J0ZA 5A3HA 1UA7A 4JCLA 1FHLA 3OG2A 1TG7A 2X2HA 2BHZA 3EJTA 2X2JA 1NARA 1C91A 2YFOA 4W89A 2ZWYA 3UEQA 4URIA 4FNPA 4LYRA 1I1XA 3AI0A 3LMYA 1E6PA 2G3MA 2NT1A 1UR4A 1UZ1A 3BLBA 2XGIA 1O7DC 2PWDA 3AXHA 3BXWA 3HG2A 3EDKA 4WK9A 1FH7A 1B0IA 1EIBA 2C8NA 2WMIB 2VCAA 3NCOA 1HIZA 4OOUA 3TA9A 3OZOA 1HJQA 2WZHA 4MB4A 1J11A 1WKYA 1GVIA 3VGDA 2G3NA 2VRJA 3BVXA 1Q6GA 3EMQA 2UY3A 2ZOXA 3KEHA 1DP0A 5FCZA 2QV4A 3SCTA 3DDFA 5EB8A 1W2VA 2VURA 3B9EA 2WK2A 4W84A 1J0KA 3WELA 1E6SM 2YKKA 3WY3A 2ZUVA 4PTXA 1C3FA 1QWNA 4CN1A 2WMHA 2WWCA 1HKJA 3POHA 1J0IA 4UFLA 1UH2A 3FY1A 4UQCA 3HU7A 6CGTA 3EDEA 3PZQA 4HMEA 3WH8A 1RP9A 3WQ6A 3W6MA 3CZSA 2E3ZA 2VI0A 1KTBA 4A3HA 1WDQA 5A6LA 1US3A 1TE1A 4JKKA 3WY4A 3LXBA 1E4MM 3WQVA 2VZOA 3MUZ1 5FL1A 3I3DA 1SMDA 3RILA 5CLWA 3HZ3A 3A24A 2VQUA 2WAGA 4AYSA 2FHBA 3UCQA 1NM9A 3S5YA 3D51A 2DH2A 3VUPA 1HT6A 2VMFA 3K46A 2E8YA 1H4PA 1GQJA 3WQWA 3AXIA 4HPGA 2VVNA 3AHYA 5BXPA 1UA3A 3D52A 5D4YA 1R46A 1WDSA 3VSUA 1SR0A 2EPOA 3DHPA 3VGHA 3PZMA 4AYGA 1CXHA 1R85A 3F5LA 2Y2WA 3LRMA 1CLXA 1E55A 2XFRA 1DWAM 2A3CA 3KL0A 5JBFA 4FLQA 1O6IA 1CXEA 1XV8A 4E8DA 4AMCA 3CMGA 1B3ZA 3E1F1 1E5NA 3LXAA 1JGIA 4AEEA 3MUAA 4J3TA 2RGLA 4DO5A 1UKQA 3PZIA 6TAAA 3PZGA 4TX8A 4AIOA 4MTVA 1S46A 9CGTA 3CZJA 2O9OA 1QI5A 4YHGA 4Z2GA 2J75A 3GNOA 4CKQA 1MW2A 4L4PA 4M81A 2PC8A 4B15A 5M03A 4P8XA 3THCA 2ZUMA 2CETA 2VX6A 4J7RA 1XHGA 4AZCB 1W2PA 2F7OA 4D6CA 4MPKA 2GK1A 1FOBA 3AISA 3OLGA 4UTFA 5A95A 1KWGA 3RMEA 2GUYA 3B9AA 3QHOA 1ISZA 1E1EA 3W6LA 3GXTA 4AD3A 4W7VA 4HA4A 2ZUTA 2YL9A 1NP2A 1MQPA 3L4WA 4WSJA 2XN0A 2GDUA 1UR8A 4Q22A 4P7LA 1DEDA 1QOXA 4LXFA 1CGTA 3HG5A 2ZUSA 1HTYA 3D3AA 1WCGA 1LWJA 1BHGA 2ZICA 2ZWZA 1JDDA 4CU7A 3L2LA 1QNSA 4GIAA 4HMDA 4F9JA 2WC3A 3APGA 2J7BA 3IAQA 3WY2A 1ZBCA 3WDPP 4XB3A 5I6SA 1PZ2A 3RDKA 1TA3A 3EJPA 3VGBA 5C8BB 4QLJA 4AZHA 1UD6A 1R33A 2D3NA 2J78A 3DYOA 1JZ2A 3MUIA 4AD5A 3DC0A 3MU7A 5CSUA 3ZQ9A 4L4OA 4HU8A 1CGXA 2ZX9A 3EJSA 1E70M 2W92A 2Z1KA 3GXDA 1Q4NX 2VOTA 4W86A 1UWUA 3EDJA 1FFRA 2UWFA 1CDGA 5I78A 1TMQA 3ARXA 1JZ7A 4PMXA 3CUFA 2V38A 1BG4A 2D0HA 1LG2A 4CCCA 4Z2JA 3D4ZA 1HF6A 1CENA 3LXCA 5JUVA 2D3LA 2XN2A 5BRQA 4FMVA 4TVDA 2Y8VA 3A4AA 1UR2A 4J3XA 4XUYA 3BVVA 1VBRA 1UWIA 3ALGA 3SIMA 3N11A 1HN1A 1RH9A 2ZX8A 2OWWA 1V0KA 1WZLA 4AMWA 4QCEA 2DDXA 1ZBKA 2BS9A 2X2YA 5I77A 4X0NA 3WNOA 4CD4A 2EABA 3MKKA 4OIFA 1BQCA 3OLEA 3WQ4A 4F8XA 2D0FA 5CGMA 3MMWA 2GJPA 2ZXQA 3GTNA 2PBOA 4W87A 3WY1A 2WMJA 3VIMA 2FGLA 3ZR6A 3MSDA 1U2YA 1FH8A 1OBAA 3CC1A 1PX3A 4CU8A 2CEQA 1JFXA 4LYQA 3BLKA 1GQLA 3PZOA 3VDBA 2DSZA 4TTGA 4DUXA 2CHNA 1TVPA 4ZFMA 1ISXA 2IXVA 4NX0A 3WL1A 2QMKA 1OIMA 2D24A 3ZT7A 2XM1A 2BXYA 4HA1A 1E9LA 3W26A 5A69A 3WF2A 1HL9A 3MS8A 1R34A 2OSWA 1G5AA 1N82A 4DM2A 2VZSA 1EH9A 5DMYA 3BMVA 4FNUA 1X1NA 2FE0A 3VILA 1E71M 4JFTA 1TVNA 3H53A 1LL6A 4K68A 2WBKA 3N1AA 1E15A 3M6DA 3CUHA 3EJQA 3EYPA 4RE4A 5I3DA 2YIHA 2D22A 2Y8KA 2UY5A 3A21A 2CITA 1UYQA 1B90A 1UD5A 2OYKA 4AW7A 5HPCA 3BGAA 4M29A 1XYFA 3A47A 2FGZA 4WJXA 4GKLA 3VD3A 1J0YA 4U31A 2W4XA 4BQ5A 4OZOA 3QGVA 1ISWA 4AISA 4IPNB 2WXDM 2V5CA 3W29A 2W62A 3AYRA 4R5EA 3SCSA 3WNMA 2DT0A 3S6TA 4PMQA 1DWJM 1VB9A 2PI6A 5AC5A 3BAJA 1VFFA 2MANA 4UOJA 1EDGA 2XVLA 1Q6FA 1TZ7A 4GXPA 1JAEA 4AD2A 4PSPA 4JL1A 1U33A 3MANA 5E0CA 1QHZA 4Z2KA 4HMCA 2E40A 1E56A 1V0NA 2EPKX 3UR8A 2OWXA 4YPJA 3BAWA 1VJZA 5AY7A 2Q8XA 3I3EA 3W0KA 2XWEA 3AMDA 1OSEA 2DEPA 1VFUA 3BUBA 5HBFA 3WDHA 3ECQA 4UFMA 1MXDA 3DHUA 2WLYA 1M04A 3LPFA 3WD2A 4WSKA 1B3WA 3LRKA 3DDGA 4D6HA 3QHNA 5A6KA 3ARRA 2X09A 1CEOA 2ZE0A 1UD3A 4KWUA 3ZMRA 2O9TA 3WUEA 3AHZA 1ZU8A 2CHOA 1BTCA 1V08A 4UQAA 2WHLA 3ARTA 5D9NA 1Z32X 3N12A 4C7GA 1W9PA 3EJRA 3OBAA 2C7FA 4R27A 3N17A 3VIKA 4AD0A 3MI6A 3HG4A 4MJ2A 1JDCA 4DO6A 1CIUA 3PTMA 1LL7A 1O7AA 4EAMA 1BF2A 3EJUA 4DWSD 3AIWA 1CTNA 3LPGA 1JF5A 3K1DA 3SEPA 3GXMA 4EKJA 2V5DA 1EO5A 2X2IA 2BVYA 4ZE5A 3WF3A 4AIEA 4HP5A 3PZ9A 1Q6EA 3IJ7A 3OA5A 1QI2A 4IPLA 4Q7NA 3VIOA 4D72A 2WKLA 3VOCA 1E4IA 3OGSA 1JYWA 4DWSA 2D23A 1R7OA
chains in the Genus database with same CATH superfamily
5GRJH 3MJGX 1KCUL 3GHRA 2WYZA 2Q5BA 1I9RH 5IFPA 3AXMA 3TCLA 3DO7A 1G9HA 1A8ZA 2P26A 1OGGA 5BZWB 1LDCA 1R19A 4G9DA 3QP3A 1BVKB 1RHCA 3QORD 2JJWA 1DZBA 4Z1DA 2F58H 1PCWA 3PZNA 3SY1A 3BD3A 2H3BA 3FFSA 1E5AA 2FZBA 3W11C 1AQMA 5KVEL 5CIPH 3UETA 4QXUL 1GW0A 4ES9A 3MLZL 3G1YA 4GLRI 1D2OA 5DS2A 2A9MH 2HLEB 2Z25A 4YFLF 4FC3E 3CHXA 2CXGA 4DEPC 2IQAA 4NT6B 4AL8C 5HY9A 2Q8ZA 3UJ2A 3KYMB 4RMSA 2VGFA 3PABA 4FD0A 2D7QA 5E5MA 3T3PF 4OW6A 3QK0A 3CUZA 2NY1D 1TUXA 1TSIA 4M3KB 3JZYA 3P4MA 3BE1L 3LKOA 5JNYA 3PJSB 2WPBA 2D3VA 1DN0B 4UFJA 2QUVA 1KQYA 2F5BH 4JPSA 4JFFB 4PTTB 4AYFA 1I8MB 3ZXWA 2R29A 3ITGA 3AOFA 2VIRB 3LI1A 4HUWB 3DKJA 2D73A 1AGEA 1XIWA 3BW9B 4QRPD 5I79A 3D18A 4JM0A 3OPSA 5JPNC 3C60D 1QR4A 1LJYA 4K3EL 5K3VA 2IGTA 1I9JH 4RW3A 4RNIA 4LCQA 1A6UL 4AJ0A 2YEZB 5EG6C 2B20A 3KCPA 2X10A 3LXUX 3UGVA 2PAJA 4YHIB 5GNYA 3B2XA 2NQ9A 1YTEA 3QJZA 3DI0A 1TENA 3TH3T 4LFHG 4BQ4A 1CI5A 3JTSB 2PUZA 3HQ1A 1EEYB 4OD2B 3RE0A 2ZRXA 3PYCA 1II4E 3CK5A 4S23A 2W79A 4GVGA 1S7RA 3JUZA 4DEPB 1J86A 1GS8A 4AB4A 2I5YH 1AR1C 3DU0A 4NZUH 4L1XA 1A4LA 2J20A 4Q2ZA 1OGTA 5BVJB 3CFDA 4RRPG 5H4ZA 2VZUA 1OFEA 3EEZA 4RZCB 4U7MA 3O6MH 3ZJ6A 2EUXA 4EI5C 4MZYA 2XINA 3MBEC 4MWAB 2CDGA 2FGBA 3KM2A 4X5WA 2WLZA 1LO0L 2VDMB 1KBLA 3VI3B 2GSMB 25C8L 4A05A 2X16A 4RNRB 5JBDA 1T7ZA 4MJIA 4MLJA 4S1RH 1RZMA 5JPNB 3QUML 3VSQA 3A6CH 5C3TA 1CXLA 2F19H 4JFEE 4ANXA 3S8WA 4AXWB 1SYTA 4JTHA 5SWZD 1KRCC 3U7YL 5CEZH 1E4XL 4OZ4A 3WDJA 4P5UA 4LL1A 3YPIA 1WVZA 4RWYH 3GSRA 3EMZA 4NNYA 2NQ3A 1HJBC 2B8OT 3MOAH 2PDHA 1RZGA 4XAYA 4WHYG 2WGNB 4N2EA 1W1IE 4WFEE 1LUCB 3U7VA 1JJUA 2DPEA 1L9SA 2OQJA 5I17B 1OARH 3DC8A 4W7UA 1I1FB 4QR7A 1POKA 5DUJA 2ODHA 2PDGA 3VXSE 4OD3H 4DTGH 4AG4L 3Q37A 1LLOA 2DSVA 1ZVHA 1AR1B 1PY0A 5EFIA 1B3YA 4RPQA 5KAQG 1Q4WA 3L3GA 4LF3A 1WFOA 3HA0A 5LXXA 1OT1A 3ZOAA 1RERA 2G2PA 4EI5B 4M7JH 5IHSA 3D85D 2QKSA 5A8NA 5CZKA 5DELA 4X9BA 2BG5A 2XPYA 3NFNA 4XK2A 5E8NB 1A3LH 1V6TA 3T8XA 3TC9A 1F58H 2XQBL 4X2UA 1LDSA 2PDBA 1XC4A 4V1YA 4CRPA 4WTZG 1NDGB 5H1WA 1ZCRA 1F8TL 4ZTPH 3N44F 4NDMA 1SO6A 4ZAKA 3CVHL 7TAAA 3ARFC 3MUGA 4R5XA 5L6YH 4AI7A 2CNYA 3LV3B 1KGUA 1T4WA 5D9PA 4LW7A 1Z3GH 2FVMA 2AXJA 3D4YA 3UIZA 5KEZA 2HAZA 1F6PA 1LWHA 3K6NA 3EHBC 3M45A 3JWDH 4OI9A 3EA2A 1A25A 4TQHA 1I3RB 1MJ7L 1QLEH 4ZQRA 2VRKA 2W95A 2NY2C 1AXTH 4JYFA 1GTEA 3DIPA 3GRWA 1JGLL 2YDQA 3NT0A 1GK8A 1GIGH 3N42F 5IBTL 3LHUA 5D7KD 1HE8A 4TVPL 2BZDA 4UI2A 4Y4KA 1NH6A 3WG7B 3EOEA 4M61A 4B2DD 5LYRA 1C08A 4S1SH 4MNLA 1CFTB 2V5RA 5HVHC 4MZ1A 2A6DB 3I4EA 2P8MA 1J1PL 3RNDA 5CPTA 2ZSVA 3OZ9L 3EEGA 3UPAA 2W0LA 2AEQH 1SR9A 4Y1AA 5E5CA 3DUSB 1NFKA 5H4YA 4M19A 3GDTA 1DSFH 3BGMB 3B7TA 3O2WL 4ODHH 5CM1A 1XRFA 4UDTB 4QHKJ 3BV4A 4YQXL 4TIMA 4UYQA 2O9PA 4HH9B 3ARFB 3B8WA 3Q8AA 5E5UB 5TDPA 3E74A 2B0SL 4XD3A 2QJNA 4B27A 4ZSTA 5AOMA 2BO0A 4GRMA 1MIEL 2ZRVA 4ZMAT 3H6OA 2C0HA 2V0TA 2OJEB 2VMEA 3EHBB 4ICNA 3BZJA 2FB4L 1CFSA 4S1DD 4C7FA 4PJDB 2OTUB 1R47A 2KI6A 4DYJA 4EIVA 5IF0A 2OMNA 5I82A 3S35L 2A4ZA 3R13A 3CJJA 1DUYA 1UD4A 4F40A 4ZEPA 3FTWA 4XWOC 2H3DA 1SJEA 2FJHA 1E6JH 1IM3A 5F70A 5F1IA 5DQ9A 2FEEL 4GFIA 3QE5A 4X6CF 3BGJA 3P4OB 4FJZA 2J74A 2BGQA 1T8XA 3DFHA 3WN6A 3GO1L 5HVHB 2XA8L 2FTWA 3OKDB 3DX7A 1NMBH 3WNLA 4L4TE 2WMKA 1S7VA 5C0NC 3VXOA 4W9GC 1JPEA 7PTDA 5HVWA 1UXSB 3F4WA 3QUHA 3FGCB 3REVB 5H35B 4LCVA 4HLZG 5DUML 2XU9A 3RB7A 4I4WA 3W7HA 5AHLA 3LLFA 1LMKA 2EC9U 4YYCA 5BYWA 3S5LA 4XC1L 5MEQA 1DVTA 3FHEA 1UM4L 3PUOA 1F5ZA 3RX3A 5CGYC 1SJVA 2A7NA 3RQ3A 4DF0A 3DDMA 3LDBC 4U3SA 4X5XB 4Q4KA 5GJNA 4HK3J 2Y7SA 2IQ9H 2FECL 3CXFA 2XZQH 2G5BB 3JYBA 3T6XA 2KPNA 4OIIH 1ROWA 2YRPA 4JANA 4FQPA 1TWSA 3CFNA 3G5WA 3HAEA 3W0WE 3A23A 3OMNB 3LN5A 1D5BA 4XZWA 5KZ6A 3CH9A 5L88H 4JG9A 3DTXB 1KM1A 4IL0A 5FHAH 3G0UA 2VXSL 2DTMH 5J9PA 4X6DA 4BFRA 1N6QL 1Z1WA 3VCLA 5JIQA 43C9A 1IC4L 1VCBC 4ZL1A 3MFFA 1AHKA 1YY8B 4LVGA 2Y89A 1CNVA 3MRKB 4EE2A 4M4PA 5E0FA 1WBXA 3H7BB 1E9OA 3RL1B 1Q90A 4BINA 4MMXC 3NEEA 4TX9A 1FVCB 4FNLH 1MHHB 3OR7A 4IQHA 3DFOA 3EOAB 2D7NA 1MWAA 1WICA 3VTTA 2DQJH 4PRHA 1L2QA 1B0WA 2BDQA 2ZUQC 5FF4A 2PP3A 5L8KB 1D6VL 2UZXA 2IMNA 3KCOA 2W80C 3KR3H 5HYJD 2B14A 2BM3A 1EO8H 3FH5A 4Z7UE 1JGEA 1A65A 3K2MC 4S3DA 2CK2A 3PFQA 4PS4L 4XVJL 5IHRA 3LDBB 1S1RA 4IM8A 1GPOH 2XH2A 3ARPA 4PJGB 4HD9A 5KYYB 5FO8B 1F76A 3RA7L 5EO1A 3VU2A 1FNSH 2X41A 3JWNC 4JM2A 3GMOB 4TULL 3TBVA 3FQ4A 4JQVA 3QQ9C 1HIMH 1L7IL 3CFBB 1GAFL 4AL8H 1UQSB 2BSCA 3G6AB 2XZAH 4LQFH 3OSVA 3TYGL 2YA0A 4H2HA 4F9LC 1K9FA 4NRZA 3OV6A 5BS0A 3L4UA 2EJAA 4H9XA 5KMYA 1FZKB 3NL6A 1RMFH 5CP3H 5C08E 1YMHA 4ZQCA 3HHSB 3ECWA 3VFSB 4G2DA 8XIMA 7ODCA 4WK0B 2PO6B 3OZMA 4MMXB 4E5XG 2ILLA 2VDMH 3MRJB 3NXFA 2IDUA 3ZGIA 4G1NA 2EACA 3P9MA 5F7KC 3D08A 4R26L 1ES0A 2RACA 2ZUQB 3MACL 3RI5K 3GU2A 1DVFD 5IB2A 3Q48A 1QSEE 3NYZA 2B15A 5D2LE 1K02A 2OMWB 4TOYL 1S9KC 1LP9F 4L8DA 1TZIB 1ME9A 1CBJA 1BXUA 4NKMA 5ANHA 4EK7A 3ITOA 4FR1A 5T3XL 3NQ7A 4PJ9C 1M1XA 1JZ3A 1HP4A 3NJLA 1W5MA 4FQJH 4U1MA 2HK1A 4OLZH 5KSUA 3KEDA 2QUNA 1MDTA 3F5JA 3BP4A 5ALBH 4LPUA 3G6JF 4YZFE 1GZHC 3VFPA 3V7AG 5A94A 3CUIA 1WUFA 1HEJC 2WWDA 5CZXC 4FFYA 2D7TH 1OAJA 1LD9A 1BZ8A 1NFGA 4K3DH 2GJJA 5GGSB 5ITBL 2NXZD 3UCDA 1AMYA 1B0RB 1N4XL 2C3HA 1AE6H 3H3PL 1DJGA 1EC9A 4GVHA 2ED9A 1XEUA 1IQWL 2QGCA 4GW4B 4ZQKA 2WC7A 1LLZA 1W8SA 2XJLA 3GZQA 3IJSB 3GIQA 4LTSA 4Q8UA 1FAIL 4GEIA 3W1RA 3SDAC 3V5KA 3BVWA 4LPYA 1E27A 3KVMA 1S9XB 2DI8A 5BVPL 1NMAL 1P7TA 2E9JA 2ZUYA 2DLFL 3V0EA 3WLJA 1BVNP 3QIBD 2BINA 2XV6B 4LAUA 3PB2A 5IG7B 1XF3A 3DZ1A 4LDOB 4DJED 1BQKA 5DEGB 4OJCA 4UCFA 4PJ9B 3FO2A 3KH3A 5FJOA 2DLEA 3KYNB 5EUOB 2AC0A 3W71A 5GS1B 2ZBTA 4PB0L 3TW6A 1JQVA 2A2QT 3MA9L 1A0CA 1BAWA 2XG4A 4OZHE 4I3RL 5CP7A 3ZO0A 4P2QB 3W37A 2BFGA 5DXYA 4FEIA 3F7VA 2D2HA 4QG9A 2ZCGA 4NO2B 1RPQA 3M1CA 2PD9A 4GH7B 5AVYB 3WNJA 4RH4A 1OY3B 5GJMA 2D2OA 3ATEA 4CQBA 3FNKA 2Y69B 1KFAL 1PHWA 3SO3C 3CMFA 4G8FB 3L9RA 1XQKA 4YHMH 3VNZA 3NJNA 1XLJA 4XBMA 3IK2A 4ATTA 4BQCA 3PPGA 3ILDA 3GZOA 2OR9H 3OVUB 1J0ZA 3SDAB 5DTFA 5HHVH 3R8RA 3MUJA 4L4TA 1E1CB 1I7UB 1FVDA 2HH0H 1C91A 5D6CB 4FNPA 3Q01A 2WYHA 2EXYD 3MRCA 1UR4A 2PWDA 2CXEA 4XBPB 4RVBA 1Q94A 5FIEA 4FMKA 3MRBA 1R0AH 2KZHA 3TEYA 1R3WA 1A9EA 3LZFL 2KHAA 3RI5F 3WQFA 3UYOD 2FO4B 3RUGE 4HUXB 4JS7A 3ME3A 2Q87A 5HHOB 2ZUVA 5DJDA 4ZTOL 3M0IA 4UQCA 3IJYB 2ZOWA 3EDEA 3OAUH 3PY2A 2AP2A 4K7PL 1WOBA 3ZKND 3PXJA 4XVTL 1Y07A 1SVZA 1XL6A 2J6VA 5LXVA 2V5KA 1NM9A 2DYPD 4XKYB 3SO3B 1KEML 1R9XA 1H0DA 4IZGA 3CFCL 2H9AA 3AHYA 2G9HB 1S3RA 3WJLC 1MZRA 5TH2B 4NRXA 3BKYL 4KAQH 4LCIH 2WIIB 5CSRA 4XCFL 4BCYA 2Y2WA 2XSXA 3TH4T 3M0HA 3BI9X 1OAXL 3LZQA 4J3ZA 3ZZ1A 3AU2A 3ZWTA 3KPQB 5LG6A 2Y88A 4M1CC 3NESA 2I9TB 2W0KA 3GS0A 3D2UA 1ZTXE 4DJFA 4GOAA 3ARDD 1U95B 4M81A 1L6PA 2WTRA 3PNRB 3NCBB 3WIIH 4WJKB 5DI8A 4H2AA 5DXWA 4HKJB 1TTRA 4OV4A 3FUFA 3WUZA 2JKAA 5CZVH 5C2BL 5H2BB 3VOIA 3OBKA 3L6FB 1UR8A 2JCCA 3IXAB 4MIMA 3NQVA 2JJVA 3O2VL 1JDDA 1IKNA 1DQKA 3QAQA 3RU6A 3QQDB 4MAYA 3BLEA 3O45B 5C8BB 1FORL 2J78A 4YSEA 1ZNNA 2X4UA 3MU7A 4QBXA 2AAMA 7REQA 2VDIA 2JELL 3W22A 3R19A 4EDXA 3TROA 1UWUA 5I75C 3V6FA 2R56L 4JTTA 4LL9A 5C08A 1VFTA 3ECBA 3O06A 4LBEB 3EWBX 1ZY9A 1Z6JT 4XOEA 1O1ZA 3B2UC 2AJZB 4PB5A 2FEDC 2WNGA 1TETL 1O9VA 3MKKA 1XLGA 2HVJB 1BCIA 5JOFB 2QELA 2YGOA 2EXSA 1OBAA 1X3DA 4GKSA 1KUMA 5DMGD 2QMKA 3BLFA 4S2BA 1ITBB 1YC8A 3LKRA 4OM0H 1R34A 2VHLA 5DMYA 3WLKX 1RJZB 5EWIH 2GAZB 1MH5A 2HT4D 1JPST 1OCNA 1OFOA 2R15A 1K8YA 2IPKA 1UYQA 1J5OL 4MNQB 1RXOB 2GSEA 5FFOA 3GMLB 3MN8A 5DJXB 2W62A 4UTBA 2H2PD 2ESVD 2GUOB 2PXYC 1NLBL 5HHNA 4PMQA 3LN4A 2E1WA 3BZFA 4WUKH 3PPSA 4RK8A 3JV5A 2OGJA 3LQZB 4YZWA 4K1WA 2GHZA 4HMCA 1VHPA 1MHEA 5B4MC 35C8L 1NBYB 4RETB 3QPQD 1Y0EA 2XWEA 1E4HA 4XCEA 2XQ0A 2W9DH 2GITB 2MQCA 3FFDB 4UFMA 4R9XA 3NP3A 4MX7B 1AHMA 1FJ1B 2WBJA 5D7IF 1ZSXA 2ZE0A 1BVLA 1AQDA 3MB9A 4FA8A 3QYQA 1BTCA 3NIDE 2O4QA 2DQDL 3ARTA 4F1ZA 2CW6A 1KTDA 1GYMA 1XLHA 4JRYD 5HHXL 4WHTA 4OZIF 4H9ZA 3AIWA 2KLRA 5FEXA 3BOXA 3B97A 4N68A 1B4JL 4AIEA 1LL1A 2F54E 5FM5M 5EU6A 3H0TB 4X5PA 4HIQA 4GXFA 3ZE0F 1RJYB 1COBA 4YJ5A 1W54A 2VC5A 2FKPA 1J0HA 2J88H 1EJVC 3BP6B 1NIFA 1U8MB 2ITEA 4KWVA 1RV8A 4HT3A 5DD3L 4TUKH 4R4FL 2EIDA 3OHMB 2PXYB 4MQ7A 2GGHA 1ZSDA 4LC8A 1DTNA 1WT5A 3MR9B 1BXXA 4A7SA 1BQHB 3KG5A 3UXIA 1KN4L 2Q20A 4EX4A 5IJKC 3BP5A 3QCTH 3ZHDA 5J89A 2OXGB 4HAKA 4DKTA 2O7SA 1QYGL 3QVQA 2DUAA 5AVWB 1AZ2A 2B3IA 1OK0A 1VFBA 3JV4B 3BLOA 4AGMA 3W1LA 1MZHA 1ZVYA 3FTSA 3UG3A 4HB7A 1AD0A 4E2VA 2NUWA 4W7WA 4YXLL 4U0RC 2WUCL 4HTBA 3QF0A 3H56A 4IMCA 3CLMA 3O9WA 3WFAA 3MP5A 1DQUA 4PJXF 1LK2A 1J8HE 1A3HA 3WUFA 4EVZA 1WJ3A 1MQKH 5HGHB 5CAHA 3G77A 4F15B 4R9HA 5GRZA 3IGSA 1XB8A 1TTAA 3PGFH 1LO3H 3UG8A 4NUJA 5SV4A 3PF3A 4JAMA 1ZJIA 1HQTA 4AC7C 2YK1H 3WDRA 3AIRA 2HTLD 2R2EB 1XUUA 5LIKX 2BBFA 2HCVA 4XNUH 4XZNX 2E25A 2J13A 3T3PB 5K9XA 3JVGC 3PJTA 1NFIA 4JL2A 1WAWA 4ENEC 4R0LC 5EBAA 3CUGA 4MDJA 4XVEA 4ZMQA 2A6JA 2WVVB 1A6TB 3BCJA 5AVQB 1HKKA 1UROA 4HCHA 2V7HA 2G4EA 2IFGA 2WSPA 2CPCA 1YJDC 1V7YA 2OCFD 1GTHA 1AS6A 1TJ2A 4OU1A 3EWYA 4C1NB 4DP0X 4XMTA 1TQSA 3RKPA 1CTOA 4NZ8A 1NGPH 5C0EA 1OB0A 1OP9A 1R7AA 4IDLA 5ISZB 1W6LA 4V15A 4PGDA 4LBRA 3V35A 3PFUA 3HHRB 1IMHC 1IAIM 3EPMA 4XPHH 4B5EA 1PG7L 5EZIH 1J8RA 4K23H 3KYOB 2BVDA 4L4VE 1S2WA 1GJUA 1Z5YD 1AH4A 4M3JA 1ZK5A 1IGFL 2G4GA 2XVKA 4PJEE 5DT1L 4F2FA 3MV11 3LKQA 3NN8A 1Q9WB 4FB7A 2GVYA 4OQTL 4NJJA 2XT1B 1UBSA 1K6QH 5I1EL 3TUUA 3V0AC 6REQB 3KHQA 5LAXB 4GI8A 3FT4B 2X05A 5BCAA 3QY6A 6A3HA 2J62A 3TWCH 3QUXC 2Q01A 3V52L 4CGTA 2FAUA 1F3TA 1Q9LA 4WV1C 2V5SA 4R0LB 3W76A 4DOHE 5HXMA 3AXXA 5ABZA 2IW0A 3KBNA 4BRJA 3O6AA 3TX9A 3NIGB 1FY6A 4A7GA 4N86A 2YPIA 3WJJA 1IF2A 5ILTL 1VRXA 2B81A 3LGEA 4P2OD 1MCEA 3ILQC 4ZX4A 1NBZA 1EGJL 4NO3A 1M2VB 5DLML 3SJVE 2FQEA 4P4KA 3X3FH 2QAFA 1RCQA 3B9KC 4ZK8A 3IJIA 2VW6A 3AJXA 3US9A 4FI8A 3L1EA 3QUYC 7TIMA 2EEDA 2FIKB 2XN9B 1KLZA 4YIQA 2J25A 2HFGL 1M65A 2V2HA 4MA8H 3BUYB 3TGXA 5FFLA 1EJFA 1Z48A 3V4VL 2Y23A 4KF1A 1KB3A 2ZONA 1IIIA 1NFAA 4TMCA 1RV6X 3HUJE 5DEJA 3KXQA 1B31A 3N1GC 1R3IL 1I7ZB 2VC2B 1UCWA 5I1GH 2Y5SA 5EN2B 5A7BA 4X7SH 2Y7LA 5FJPA 3NPSC 4MDIB 4LOUD 4HAGA 4ANVA 5D2NC 1N55A 2Z0UA 1SBSL 2DI9A 4WV1B 5IESH 4EIZC 1L2UA 4V27A 4PFEA 4HNCA 5DMIH 1PFOA 1YX1A 3R06A 4R3SB 2VXTL 4DGIH 2MPAL 1SVBA 5XIMA 5FYJH 2DMGA 4HF5H 4AF0B 3V95A 1KTLB 4NJ9H 4O17A 2E7DA 2YLAA 4X63A 5FSEC 4DAFA 2UZ9A 3T6WA 1RVGA 5FECB 1KGCD 2FQIA 5EIQA 3V5CA 3B9KB 2ROXA 4CVXA 3RGVA 4A8IA 4MYAA 1S7WB 3QUYB 1Q0EA 3T0EE 4JX4A 4ZS6D 1JEZA 3UTZB 4JTFA 4UT7L 3WFLA 1BWWA 3MLWH 5D7LB 5CIPB 1L8PA 3FT1A 4QUOA 3ZSSA 3I4KA 4I48A 3VQMA 1I4FA 2DM4A 4ZENA 1E3FA 3FBKA 4RNFA 2F8QA 1TX0A 1PTAA 3QFGA 5IEKB 3P30L 3DVGA 1WBJA 1ERNA 3ZJKA 4XMLL 5DF0A 1UB3A 1ACYL 5HAOA 1YDOA 3KBJA 3N42B 5INCA 2WO2B 2XCMC 1QOKA 2VLJB 1IZJA 3NPSB 4PCTA 2IAMA 2E6AA 5D2NB 2BWQA 3WIJA 2X1IA 4HFUL 4J3WA 4OM1H 4IL2A 3KDNA 3IPWA 2V2CA 2DBLL 3FN3A 4WTWA 4E3TA 2YKLL 1XF5A 4OGAC 1F42A 1CBVL 4W9DC 1PS3A 4NCC1 2HVNA 4HSCX 1LP6A 2PPCA 5A7EA 3ET9F 5A40E 3ABXA 1TCRB 4TN9A 1AXSA 4RZ4A 4KK5C 4Q9RL 4I6VA 1SHXA 4Z6AT 2DKSA 4C6QA 4UTHA 3G04B 1XIHA 4P9MH 1NGQH 1FIGL 2WNKA 2Z91B 1FWAC 3E9UA 3S1GA 1TUFA 2ZZ2A 5TE6L 4K1GA 2L0DA 3H4HA 3CHFA 2VEKA 2HZGA 4IKKA 1HVXA 1IEAA 3NTCL 3IGXA 2L4OA 4N2YA 4MAVA 5IKCB 3MJMA 1N7MH 1Z9LA 2IG2L 2CKBL 2ORBL 5K1JA 4N2LA 3C2VA 2QF8A 4K15A 3P82A 2C1IA 5T1KD 3I84A 1NWRA 1K5NB 4C90A 4E36A 2XDHA 1E65A 4MJ5B 5E6RB 3TBWB 4IIEA 5BRBA 1OAZH 4X6CB 3VSVA 5DYFA 3CHDA 4PJ7A 3KM1A 5IQ7H 3FNDA 4FULA 1NC4D 3O2DH 5LNVA 4LLWA 3D05A 2IH8A 5H37G 2EDDA 5ID1A 2XQYK 1H09A 4JTDA 3I75B 4YAQA 1FTXA 5BOOA 3KYAA 2X1WL 4M1GL 2XUCA 2BY1A 3QZWB 5TK2A 1XQLA 1FWXA 3SGDI 3VCCA 4I1NB 3RWIA 4B60A 2DLIA 1C12A 5F44A 3LLXA 1TOXA 1BMZA 4PJIB 1L5GA 3U2IA 1LLWA 5T1LB 4Y19A 3WK1A 2Q71A 2E46A 3R2GA 3WQPA 3JWDC 1KM3A 3TQVA 3Q5TA 4P23A 4FA7B 4AVOA 3JTTA 2BWDA 2WWKT 1KFLA 1JIBA 2CU0A 2CHDA 2PDUA 4FF7A 3RJDA 3PZVA 3JT2A 1WZKA 4CC4C 2DWYA 4XO9A 5L7XH 2OWCA 3V7MA 3G6MA 1K8XA 1QHPA 3IFPA 4PRPB 1L0XA 4RMVA 2ACQA 5AYUL 2WLHA 3KLHC 4KRPC 2B1AH 3U46B 2ISSA 4NUMA 2GUBA 5AZ2L 2VSMB 2FPTA 1IGCL 2NSQA 3UCRA 1TEYA 5IB1B 3V4BA 4S3GA 4JKMA 3NQKA 4MJIE 3RX4A 3QDGD 4X5RA 5I2IB 4Z78B 2ZOKA 4TVCA 1LO5A 3B05A 3WTSA 2OZ4A 3F62A 2JJSC 4DZ8B 4L3FA 4PB3A 3R6IA 1N12A 4JPIA 3CT2A 3QLLA 3L95B 1W3HA 3D87B 1SF3A 2EPLX 2PDJA 2ZDRA 1FWEC 1U1UA 3TEZA 5IIEA 1INDL 4LU5L 2IWGA 5TF0A 1KIQA 5KTEH 5J8OA 5ALCH 4TQEL 5M1TA 2GIYA 3W1XA 3EKCA 3OM3B 5C0CA 3D69A 4GXMA 2OX5A 1XGQB 4HZ8A 5HATA 1NJ9A 4E41D 2OV0A 5FAGA 2BOFX 1IM9D 1PTDA 3DX3A 5JVLA 3HFML 3OQRA 1KD0A 5DMLA 3PP3K 5DGRA 5D71H 5C0JB 5CPQA 1CMOA 4GG9A 1X7QB 2PLJA 3HJ0A 2XFXA 3IXTA 1XDTT 4IGBC 4GEJA 3GW3A 3SURA 1TJMA 4BJHA 1R3LA 4KRPB 1WITA 2P9RA 1Q0XH 5LBSL 1BWLA 2L8AA 2Z1XA 5CN3A 1QSFD 4W6YB 1D2PA 3F7JA 2QGEA 4HC1H 1MCBA 3CJPA 2HV5A 2FLIA 1CI1A 2F8VA 2X70B 4LX4A 5JHLA 3MRQA 2LU5A 3L4YA 4G80B 1JDEA 1J1OL 4XAWH 2QHRH 1FFQA 1C90A 4EEEA 2WQUA 2CGYA 3ARYA 1WXYA 1EEQA 3GVRA 1TJPA 4F8TA 4CCDA 5E09A 2UXGA 3EOSA 3FN0L 1AGFA 5D7JD 2R0WL 5TQ2L 4ZGYA 1JNNH 1L0YA 1LP9B 3RTQA 1E0VA 3D0VA 5I02A 2OCCB 1RU9L 5CJQH 4B9ZA 2RIKA 5DD6A 3U0PA 4JPWL 2WSRA 4AZ6A 3S0CA 2P49B 2LLGA 3TVMA 2XA3A 3K7UA 5IR1B 5BW7A 3G6JB 1VFLA 1BGAA 1U6AH 3RGBA 1UZGA 4XN4A 3I85A 5CGBA 4MFEA 3DENA 2LGNA 4LF2A 4IGBB 1FPTL 3OKOA 3SE4C 3QUMB 1D5RA 3S2CA 1WRFA 4K9EH 3HS0B 2J8OA 2EQDA 1H5VA 4Y1AE 3MV9B 4UOW1 1JFHA 4LVDA 1X38A 1QHQA 3P0YH 3SY0A 3OB8A 4W88A 2I7SA 4P3CL 3UJEA 3VKDA 4IKIA 5CAKA 1K77A 4TVSa 4KQ4L 4XHQA 2PEVA 1YDNA 4M62H 4KMLB 2EG8A 4LK4A 4IU2B 2QCNA 4MAUH 1SJHA 2EE2A 3OVQA 1V55B 2WCGA 5FYKD 1RQBA 2PN5A 5CO1A 4ISVA 5IFTA 3GU9A 2NW3A 2N59A 4FHJA 1PKQB 3AT8A 2CUIA 3KBFA 3RJOA 3T0DA 4AGPA 2CAKA 3TNNA 4KT2A 1XL4A 2VOMA 3MZTA 4PHXA 3U3HA 2QVKA 3GHEH 2O5NA 3O6FA 2CZ5A 1ND0A 2Y36H 5JO5A 2D1ZA 1W0WB 3L3OA 1RPXA 1RVFH 2TSBA 3C2SA 1N10A 3V5FA 1JV2B 1PNCA 4C4KT 2YCLA 1M7IB 2PR4H 3MT1A 4QSFA 1UUMA 5ERWA 4G3YH 3TN0A 4K7FB 1QPQA 3CVHB 5C86A 3HOJA 5L4JA 1PKOA 3VWJD 5JMOC 5DZVA 3PV6A 4G6AC 1XI3A 4GYJA 3LIZL 2W3ZA 4MWAC 1G9NH 1JZJA 3SKNB 4ZW7A 4LLVB 1WKYA 2OP4H 3W2LA 3BVXA 1KV5A 3RX8A 2UY3A 1T2QH 3FOLA 4I18A 2VB5A 4G6KH 2I5IA 5D2VA 1G4SA 1S7QB 1U4EA 5E6IC 4NZRH 1P0EA 3POHA 4FQHA 5FF2A 1WDQA 4XNDA 3Q9QA 2VLRD 5IFJB 1ZHBB 3HE6A 3O8XC 3EPOA 2DICA 5DRZB 4U3HA 2PPAA 1VPOL 5HJ3B 2HT3D 1QUNA 5EIIG 3UCQA 3P3TA 4HNLA 3S4SA 4MS8D 4PY7A 4XP4H 4NM4H 3MPGA 4K8HA 2EPOA 1ZIBA 2A73B 1KLUA 2YN3A 3WBDA 4QRRA 3QPXH 3F01A 1DWAM 1OTTD 4X6DE 3E1F1 4XPTL 5CBEB 2RGLA 3WK3A 5EF0A 1G9EA 4MTVA 1OOAA 4PMEA 4M8RA 2X0UA 3MYPA 2P24B 3DERA 3R10A 1I7RA 4OT1H 4GHRA 4Y4FA 2PC8A 3FB5A 3LEXA 1UGKA 2OB3A 2WLNA 4DF1A 2X3BA 1QFUH 3R8BB 4PRHE 5A95A 4D8PA 3DURA 3EGDA 3OXSA 3G3LA 4LCWA 4HA4A 1MQPA 1WWAX 2AGJL 2EE6A 1EWHA 1ZCOA 1RK0B 2A6LA 1Z8AA 5TE4H 5E6IB 1AOHA 3B2VL 1HTYA 4ZSUA 5L2KD 2ZWZA 1E5BA 3QTPA 5J1SC 3SZ8A 1M9HA 4CNUA 1YNTA 1CDIA 3WY2A 4N9CA 3HIJA 3EOYG 3O8XB 1OB1B 1ZVSB 4O12A 2DMCA 3QIUC 4KMTH 3HC3H 4NPKA 4C60A 1CLOL 4QT5B 2W92A 4AMKL 1IZCA 3V6ZB 4EXBA 1Q0YL 1TMQA 1JZ7A 4XNZC 3GHBL 4R90L 1VFAA 3TF7C 2XN2A 3L5IA 2PMZA 5F1SA 3WLIA 2OZTA 5C55A 4GUOA 1RH9A 1JHKL 5BS0E 4Z1PA 2AL2B 2EVHA 4H4IA 3N14A 1KCUH 1BQCA 4R7NA 1BM3L 5DD0L 1CQKA 4KO5A 1XUZA 3PWGA 2IGFL 1OP5H 3HBZA 1IXQA 1MOEA 1X97A 4KKPA 4R53A 4DP5X 1RUSA 2FRGP 5KN5B 4LCYB 1I3UA 2Z2UA 5I1IL 3L08A 2H3XC 3VJ6A 1LO2L 5KVEH 5C97A 4QXUH 1Q2RA 1LL6A 3L54A 4E2DA 3QR1A 3MLZH 4PJCF 2WQPA 4CNIA 2WZ5A 5I3DA 3O1NA 1D8CA 2J1WA 1N8WA 2FGZA 3CE1A 3T6QC 1ORQB 3L7EB 2A77L 3RU8L 2PGRA 4C56A 5JIMA 4A3RA 3T8MA 3QIUB 3BZ5A 1LDPL 5D1QA 5FW7A 3NJIA 3BE1H 5AC5A 1UWGL 4HEPG 1YRRA 1TZ7A 5T1JA 3RWJA 4AHPA 4XNZB 4QXTB 4P5KB 4AD2A 4G9FB 3JR2A 4NNAA 5KYWB 1R3SA 1VFUA 3ZYJA 3RVXC 1BG1A 3BGGA 3WN5B 4A39A 4K3EH 4XVUC 4IMLA 4AYDC 1WD9A 3WCZA 1KB5L 3TJPA 1OX6A 1ZCCA 1A6UH 1FHVA 3VIKA 4AD0A 2JKRM 1O7AA 3BSMA 3BAEL 1EUUA 1XIEA 3RR1A 3NPZB 5KVFL 3FT0A 5JDSB 3GJEB 4HUKB 4I8YA 2POZA 4MCZB 1OW0A 1NELA 5GVJA 4DWSA 3LGDA 3FV9A 5D7IB 4I3SL 1B3JA 1PIIA 1MEHA 1M7PA 4K5LA 3ITTA 2OO6A 2D7MA 2PDMA 3G5VB 3URBA 1X5XA 1J05B 3ARGA 4GO9A 3B83A 2VKZG 4FHAA 4OZIB 4N4PA 4M8VA 5F7LB 1LE9A 2ALRA 1H8LA 1CLVA 2Q76B 2HN7A 5JH1A 1DANT 3ZE0B 4FFVC 2H5UA 3LRGA 1OF2B 4YH6A 4WW2A 1LO0H 3GFYA 5CCHE 5CGTA 25C8H 3P3BA 2QUTA 3K4ZA 1NEPA 4P7QA 4MA3A 1G1KA 1RLWA 2IDTA 4IOTA 1W0VB 4Q52A 4UBDD 2GABA 3IDUA 3R0MA 2RFGA 3D6NA 3GR4A 3PQYD 1U8OB 3QUMH 3VFRB 4P48A 3IT8D 1WSST 2Y1YA 1XAKA 1SVCP 4JHVA 1RJRA 1PAMA 1F18A 2YL8A 4XPBL 4OJFL 3U7YH 1VLWA 1E4XH 5KW9L 1CT8B 2OLHA 3MODL 4OV5B 2VWSA 4L3EA 4GKNA 1UWRA 5FK9B 3W39A 3O4LD 2YJQA 2RGMA 4IBVA 1HXJA 3RPMA 5EBMA 4GFSA 2NX3A 1E5UI 3WV0A 3ARBA 1D9EA 1M3IA 2IANB 1IILE 2VN7A 2W8CA 4AG4H 4LQ1A 2ZWKA 4KFNA 3P0GB 4S2SB 3ZU8A 5ETUB 1Q6QA 3E9TA 3VE0A 4PV9A 4CJ0A 3QXUA 3F6JA 4PJXB 5A3ID 4F7PB 4MXQC 3Q2NA 1XQ4A 3CDGB 4XVSL 1A5NC 2FX7L 3TTOA 1BECA 1K9EA 5AC7A 3LCHA 1PIFA 3CDYA 2MNWA 1XF2B 2XQBH 3IJ8A 1F8TH 2FDMA 3JZEA 4Z2LA 3K91A 4JNMA 4JYDA 4NENB 3CVHH 5IVXA 1UT1A 3MTWA 1KIRB 4IP4A 1QW9A 3CH1A 4ANKA 1GY2A 3EFFA 1UZ8A 2PO6C 2FFCA 2XIOA 3P0XA 3L5WB 2RFXB 4NRRA 1ZT1A 1TV8A 3RRQA 5I1CL 3VNDA 5JIPA 1EJOL 3QSTA 2H4EA 4XCCL 1MJ7H 3DMMD 3DXAB 5C0AA 1GOIA 4LHUB 3INPA 2V3FA 2ICWA 1X5IA 1UOWA 1JWMA 1VIWA 1JGLH 1HXKA 1JNDA 1S7SA 3VFCA 1T0PB 2XN1A 5IBTH 1KXQA 1A9VA 1SYSB 3IMVA 4WQ6A 3DHDA 3NVQA 1F45A 3W7GA 4XN5A 4TVPH 3QHFL 1DE4B 2H6PA 4MQSB 4MCNA 2JCCE 1EXBA 3MRRB 3MX0A 4DELA 4ADJA 3OKYA 4P5MA 4IIHA 3DGRA 1OWWA 3W7QA 1WWCA 1J1PH 5A6AA 2X40A 5DJZB 1MW0A 1B54A 3OMIB 2L7QA 3OZ9H 1FNEB 1BYDA 4PI0A 1GKPA 5HDLA 3RWDA 4AZUA 2BP0A 5AOIA 4A2RA 5DQJA 4GXUM 4J8QA 4DK6A 4C83A 3BD5A 1XF4A 1A6ZA 3O2WH 3E6FB 1SLVA 4LLQA 2I07B 3OBEA 4YQXH 1AH1A 2R23B 4KCWA 4AYMC 2DYSB 4OUEA 3P2TA 3V55A 1PY4A 5E2WL 5I76A 1R0MA 2B0SH 4JZ5A 1G7PA 7ENLA 3K2UL 1MIEH 4K3JL 4QDWA 3DHMA 4JY9A 3FQWB 1DYSA 4HULB 4GVIA 2FB4H 4PG2C 4FIQA 4MMWA 5F0LB 5JOPE 2A0LD 4M7ZC 3S35H 3K8LA 3O7UA 4HJSA 4JO1L 3GFZA 5DWUL 5HR6A 2AXFA 4B5ZA 5C07B 2QR6A 4ACZA 1WA1X 2O5ZL 1WA0X 3TT1L 3W1NA 1RLCL 1FNGA 1GZQB 3TM6A 2X38A 3N18A 4G83A 2AK4D 2GK1B 2Q8LA 5GS1C 3MWCA 1H9VA 1VH7A 1RHHA 1N5AA 2TSYA 4NQ1A 5EO9B 2PP1A 3GO1H 2ARJQ 2XA8H 2BK8A 3LZ3A 32C2A 4QHUA 2RB8A 4KV5E 2CKSA 2F74B 1FVEB 2EICA 1YEJL 1KT2B 5DRNA 2CLFA 1RSYA 2VMCA 43CAA 2GDVA 4AJVA 4MYPA 2BCMA 3T2NL 3FU0A 4LEEA 1GORA 3L21A 1B4RA 5DUMH 5C09A 2EUWA 3AUJA 3IJEB 3NIFE 3UJTL 4XC1H 4BF9A 1A5LC 3AHXA 1PIGA 1UM4H 2OSLB 4RV8A 2PTWA 4YSQA 3WFDL 3SJ3A 1E8WA 1VBJA 2R14A 4Y2WA 3UBPC 3LSOA 1NICA 4L9LB 5D6DA 1P6FA 3HRZA 3KTXA 5F0MB 2I85A 2XM2A 1NIUA 4M7ZB 4H7ZA 5DK0B 4AT6A 4KNQA 1AJ2A 4L6DA 1CICC 1UD2A 2WUBL 1SY6H 3MV8D 2NUPB 1OCCB 2F53B 2VXSH 2FR4B 1N6QH 3BVDB 3BSHA 5EU6E 2H9GB 3N1FC 1UASA 3W87A 5DJCB 1IC4H 1PKLA 2XG9A 3QWRD 4WGVB 4F66A 3CT7A 1D9KC 3EMCA 1V02A 3KPRB 3Q44A 1NPNA 4MLSA 1C5BL 2XZ9A 3ULSA 5DY2A 3P5YA 3O3EB 4L0YA 3QPZA 2P5EB 4RSYA 3QEGL 4S2CA 4HCIA 5GZNA 1HU8A 3QC6X 3TJXA 1D6VH 4MZRA 3F7YB 5AB9A 1P5VA 4DVRL 4DZAA 2I69A 2WV8A 2PW1A 4QRUB 4KKCD 2DZVA 1AQ8A 3H9ZA 3E0FA 1OM3L 3ZN6A 4PS4H 4JO8A 4XVJH 1UG6A 5JXAL 1CU4L 3QORC 3WBXA 4JIEA 4PJAA 3MNWB 4Y9NA 1HKFA 1ZV9A 2KDGA 4Y7OC 1I75A 5E8EB 1JZGA 2ICES 3RA7H 1AHWA 4E8CA 4JG5A 3H9HA 5MEPA 4Q8MA 1QNRA 4TULH 1MNNA 1VACA 1CICB 1RHFA 1PY9A 4HCLA 1L7IH 4FQ1L 1JDAA 2CDEB 1GAFH 2E7MA 1A1OB 3TYGH 5HYSB 4JZNA 3VM5A 4ROQA 3DKLA 4LCUA 1U1HA 2BY3A 4KDWA 4OJDH 3BRFA 2EZ0C 3G6LA 2IPUG 4XIMA 2J6EL 3LPWA 1D9KB 1LROA 1W1TA 2VSDA 2CO7A 2AMGA 1LBMA 5E2UL 3S0PA 5IHLB 1TQJA 5KBMA 2WQWA 2X87A 1P6WA 1YRKA 1AR2A 1J7VR 4YSCA 3ISWA 4R26H 1WTGT 4AXNA 2Z7KA 2IBZY 3USZA 4IMAA 1W5PA 2UYLB 3MACH 4D9QD 4KY1L 1XMEB 4D7PA 4WW1A 4TOYH 4DN4L 2W6RA 3C60C 4HPXA 2N0KA 3LRHA 3DX2A 2XH4A 4C47A 1TTUA 5T3XH 3QORB 3LS4L 1U8LB 2NY4D 4W1TA 4H6KA 2XTJD 2NXIA 3U9IA 4XZUA 4M24A 4YXHL 3QJXA 2IH3A 3AS2A 2NCMA 4PRAB 3KS5A 3MJ9A 4WU5B 1A4KB 3CSTA 1OK8A 4JQIL 1K7FA 1EPXA 4Q4RA 1KM2A 5ITBH 4RBPH 3AJ7A 1N4XH 3AM8C 4N0FA 5I26A 3CQFA 3H3PH 3IFOB 4MMYA 3LM3A 1YPZB 2RDUA 2WLIA 4OR1A 2R7EA 3WLQA 1IQWH 1XR8A 2NY1B 1RIHL 4OKVB 1LRNA 1T22A 2GJXB 3ZZQA 1G1YA 2GK0A 4D0CB 4UBPC 1R30A 2NX1A 1H0IA 1FAIH 4QHLA 3HPAA 4MUPA 2AXGB 1TREA 4BH8B 4FTVE 1ICSA 1E3XA 4K8EA 4KNTA 5BVPH 1NMAH 5C0BA 5SWQB 2DLFH 1WV7T 1H1NA 3MCKA 3IUIA 2YZ1A 2DWEA 4QRPB 1DKWA 1JZFA 2GVEA 2I32A 2P5NA 4LF1A 4PUMA 4IBWA 3C60B 2DH3A 3QNYA 3CFTA 1CXFA 2YXXA 2E1DA 3IIXA 2LV4A 5EBLA 4NUGL 4DUWA 4PB0H 3ZDYF 1UHVA 2Y1AA 3MA9H 1JZ6A 4I3RH 4FI6A 1MRCL 5HNTA 1GT8A 5MP6L 1EDQA 2ROYA 2HMCA 3SB0A 1JG9A 1CURA 2PC4A 3IDMA 3E38A 4BH7A 5EMJA 3VA2C 2BV9A 4MD4B 2VLKA 3B6SB 5FSDC 3FT9A 3FBQA 2O26U 4QY8A 3A12A 3CWOX 1BMWA 1GS7A 1KFAH 4D8OA 5C0IA 1AZRA 2B9AA 2Y06L 2EINB 1H3VA 3QQ3B 1KBGL 5CBBA 3TOYA 4WFGE 3AT9A 2VL5B 3PHQA 4ODBD 3H85A 1JGMA 3QJHB 2KC0A 3MRFA 1IGJB 2WNQA 4ZFGL 1FLRL 1GJIA 3HV9A 1DORA 5FM8A 3VH8A 3FU3A 2OFQA 2DPKA 3IDIA 3THML 3FXGA 3DETD 5SWZB 2CCWA 3U6RA 3QY7A 3LZFH 1W6WA 5DHXB 2YDRA 2QT6A 2CIKB 2ENYA 2CA3A 5AC6A 4RGND 3DX5A 4ZTOH 1GC1L 3GSNA 4HIJB 3C12A 4FZEL 2QCGA 4I5RA 2WMPB 2P80A 3UTPD 4K7PH 2RALA 1M7DA 1UZ6E 4XVTH 1F05A 3B0VC 3W7CA 3SDDA 5CFHA 4O2EA 3NWRA 2G75B 4LUTB 4ODWA 4F15C 5T3ZD 5FYKL 4Y88A 2RH0A 2YA1A 3EH2A 1KEMH 4D6JA 1EKOA 1AUSL 3CFCH 4BK8A 4ES8A 4M9OA 5E6ZA 4BZ1L 2OMBA 4HK7A 3BKYH 4XCFH 1P7KA 2H1LM 1TLMA 3FO1A 3D85B 2J9XA 4ETQB 1OAXH 4HK0A 2HRWA 5D7SL 2ZKWA 4U7SA 1QABA 3KAAA 3MGOB 3C2OA 3ESOA 3T78A 3BHBB 3DGGA 4BQ2A 1FFOA 4IISA 5HGGS 4MDOA 3QYNA 2R83A 4FXGC 1D5XA 3D47A 1GR7A 3FCSA 5AAMA 1O5RA 3AHTA 1MI5D 2DZWA 3IBEA 3EO0A 4DN1A 3F7LA 2BP8A 4C65A 5T8GA 1AL7A 4JFHE 4UQ3A 5C2BH 1RY7B 4Q7IA 4DO7A 2HRPL 3KPMA 4KW2A 3V4VB 3G8RA 4O51A 1WIPA 3RIKA 5HGAA 2AGKA 1E0TA 2FSEA 3HURA 4EN2A 2FEJA 3O0FA 4S1DC 3H2WA 3O2VH 1O7DE 4W89A 1TDQA 1K5WA 5KBNC 2P8BA 3O63A 5L4FA 2BOCA 4ML9A 3RVWD 4PGCA 2ZA2A 2WXFA 4WK9A 1FORH 2AITA 2I27N 2JELH 3NCOA 1QA9B 1VD6A 1ORSA 1CFQA 4AJWA 3BE7A 1D7KA 2R56H 3K0YA 1KPRB 3SCTA 1EP2A 4NIRA 1TETH 4PJ7E 4O1BA 2GPZA 5HQMA 1UVQA 2ZOTA 4JKKA 4ZFOA 5F72S 5HP5A 5DFVD 1FO0L 4FXGB 1R3TA 2DH2A 2R1WB 3HPXA 4LCCC 1IC7L 1OGAD 3KHOA 3D52A 1MVUB 4UYPA 4QRQB 1WDSA 3PZMA 2AEOA 4R7VA 3D4CA 3GDKA 3LRMA 2JKNA 4Y19E 2BJML 3O0LA 4N4QA 5IV2A 2VZ3A 3OL2A 2ICWI 1FNAA 2ATMA 1J5OH 1E4JA 3PZGA 3M7FB 5BZZA 4ZDHB 4PRTA 1FN4B 1KRBC 1SN2A 4YHGA 1ZGLB 1KG0A 3S5LG 5T1MA 1UW9A 4I87A 4PI2A 3THCA 1YDPA 1NLBH 5BQ7B 2C91A 4AZCB 5TBOA 5MEOB 3CQHA 1I8IA 5E23A 2ZSWB 4W9JC 1EZWA 4L8SC 4FL4C 2GUYA 4NILA 4LKCA 3BOLA 3SYCA 3NQ8A 4LUYA 3BZ4B 3GTIA 1R9FA 2OS7A 2GDUA 4G9PA 3NL3A 5EU4A 5BRZA 35C8H 4KOCA 1TVLA 3ULUD 1DXIA 4LXFA 2ZUSA 3UBFA 3FH8A 1NUGA 1NSNL 3NVTA 1S38A 3HAEG 1F7BA 4K9EC 4FTVA 3HR6A 1QNSA 4F9JA 2ZAHA 4O28A 3AGWA 3VGBA 3WUWA 3PM6A 2DQDH 2AFNA 4GRLA 2V33A 1E9PB 1JZ2A 4LLMA 2JK2A 4LEOB 2ZX9A 3EJSA 4N6QA 5HHXH 1DQWA 4H1LA 3W56A 4LCCB 1Q7ZA 4LSPL 4E0CA 4K3HA 4GX8A 3VE7A 3T6ZA 4LAZA 4LASL 3B8VA 3MMTA 2CKBB 4HKBB 1HSBA 3VZXA 2OULB 2Y8VA 5L4MA 4KETA 1IGTA 1U3HD 2OWWA 4BSVB 5C0CE 5GSVB 3LOTA 4CD4A 4Y5YC 3EYFA 4D0BA 3FLUA 2NYKA 3C8DA 4W87A 4NNPL 5JQHC 3VWKD 1DLHB 5DD3H 4R4FH 3EOOA 1B5TA 4DYEA 4N3UA 4TTGA 3G1SA 2D24A 1PLBA 2XM1A 3W26A 4L8SB 4FL4B 4W4OC 1HL9A 2PSNA 3TIEB 4MCYB 1XH3A 1XWYA 3UAJD 1KN4H 3S97C 4NNXA 3STGA 3PWUB 4XIAA 3M6DA 4ACTA 1QYGH 4M3PA 3QIWD 5M7QA 5DHDA 3T7VA 1RZPA 1QNZL 3BGAA 1XYFA 2CRYA 1J8VA 1G87A 4U31A 4WJEA 3GU1A 3VI4A 2XZCL 3IWVA 2F6AA 1G9NC 4YXLH 1DVFC 2WUCH 3K72A 5HYJB 1P5UC 1VB9A 4P61A 4IU3A 2PCFB 4RLIA 4A8NA 1CL7I 2YQ3A 4G56A 2ISDA 4KJPC 4PSPA 3VNKA 4I0KA 2FSDA 4J23A 1CZ8L 2NTFA 2Z7YA 3DJTA 3BPCB 5FCSH 3N44B 3IF1B 3F7RA 4S39A 1NGYA 5D5MF 1UXWA 5G5IA 5JMUA 1X5HA 4Y5YB 3L45A 1KGIA 4YLBA 3PAUA 3GSVA 3ZMRA 1W37A 4NPYB 1V08A 1ACCA 4NQCA 3ANVA 3SFWA 5BOFA 4JY6A 3OBAA 3C5SA 2QUUA 2NXZC 3SRHA 1B0GA 1OEPA 1LL7A 1BAFL 1CD0A 5IOPA 4Z7OE 4ZE5A 4WVXA 4IJ3C 1RJPA 3WL9B 2VLLB 2Y61A 1X1OA 3ME0A 4L1LA 2GSGA 3UPCA 2QL1A 1WFUA 3BPWA 3BW4A 1E6OL 1H41A 3ENLA 3X12A 3D5OF 4IPJA 3UTSA 1RQ5A 1PG7H 4GUHA 1DVFB 2UX7A 4UB0L 2MCG1 4L80A 4NBZB 3L13A 2PWHA 4ZMPA 1IGFH 1P5UB 5DT1H 3AAZB 1DOSA 4PWEA 5MERB 4DJEC 1TPXC 2R2BB 2ZAGA 3ABLB 3BQ5A 3C2FA 4OQTH 2V5YA 5I1EH 1A0QL 2BOBA 4AUYA 5CC3A 2BLEA 2NVDA 3GHPA 1AODA 1NGZA 1LEGB 1HS6A 1IQDB 4DT2A 3PAZA 3QDAA 3V52H 2GEEA 4S11A 3U5UA 3OG4B 4LMQI 5E24E 3NZ8B 1X98A 2HSIA 3C09C 1BKSA 1UOLA 2NXZB 3HV8A 1SHWA 2A9DA 4RQQB 3WLTA 1A5OC 2PTTB 3D39A 2WXMA 4HIHB 4IJ3B 2WANA 2XV0A 4WVRA 5AVTB 2D7PA 5ILTH 4WY0A 4DLMA 3FFCE 2LW3A 4DPCX 3S88L 3G08A 1DIKA 1EGJH 3X2QB 3QH3A 5DLMH 3OJDA 4Q6IA 2JXMA 3TWAA 2YXWA 5D09A 2BIIA 2YAHA 2CLMA 2EXYC 3QIBB 4WU7B 2Y3NA 1A4AA 3VD7A 4I5BB 2HFGH 4H8UA 1DQML 1TPXB 4XXWC 3LQMA 1ISVA 1F74A 5AENA 4OZFH 2QDDA 3VNIA 1UOZA 4PLKD 3V4VH 3ZGHA 4IMDA 3MRDB 4EVNB 1EAPB 1ZBVA 1BQRA 4M6OL 3M7SA 4WKXA 4G1EB 1R3IH 3TTYA 2BNJA 1W16A 3FCPA 5CINL 3PGDA 5FO2A 3SQRA 2PBGA 3MBEA 3VXNB 3Q3GB 4YFDB 1FDZA 2OMYA 4LRIA 4K6AA 1DQXA 4O1FA 5AOLA 1JXGA 4QRRE 3RWFA 1SBSH 1IAII 3PWJB 4QHRA 3C09B 4FA3A 1ADQL 2CCRA 2A4CA 3MNZB 3L7FB 2R9RA 2VXTH 2MPAH 4P46C 4RR4A 3ELQA 4ELKA 3AWGA 3MO1B 3CDZB 4MXVE 3BXNB 4P7OA 2YDSA 1N3NB 4H0HB 3PUGA 3KMDA 2ALAA 1KBIA 1DJHA 2IWEA 1YQ2A 1JN6B 4JPKL 4XZLX 2YS4A 4EAEA 5FCUL 4IK7A 4CQDA 2ZXAA 3BOFA 5CJMA 3A4WA 4PP1C 3PP3H 3PWPA 4RISL 3SDCD 5HNRA 3V9CA 4LCWE 1BFTA 3SGEI 1CDCA 3DTUB 4UT7H 2X1OA 1JTPA 2QHAA 1WGVA 1ZS2A 3ARDC 3GGWA 4BZ2L 5DMKA 4N2CA 4QJ4B 2V5MA 4HWBL 3QQ1A 1C7TA 4TV3A 3DV6B 3Q4DA 5K9KB 5HPMA 3SYOA 3QEQD 2BVQB 4H1ZA 4UUIA 5GZOC 5FO7A 3P30H 5AAWA 4XMLH 1ACYH 4F7TB 3B0XA 4YC2C 3IGAB 3T81A 2DQGL 4HFUH 1WLHA 1W9BM 3MCNA 4AQ8A 3WQEA 2Z24A 2HJKB 4E9WA 2DBLH 4EZKA 4OI8A 2YKLH 1CBVH 3UA4A 2YEQA 4P46B 5T8IA 2VEFA 2GQ9A 1E6ZA 4HU2A 3NL2A 1OIFA 1MRDL 2BCKA 4JN7A 2R1YA 4V33A 3TC6A 5DVKA 5JW4Q 4Q9RH 5HGDA 1J5CA 4E38A 2X0WA 3HS0C 4WD0A 4JQ1A 3ZDWA 1FIGH 2WXIA 1UCBL 4YHZL 4CL7A 1EGVA 4DEWA 3GMRA 4ZUUA 1S5HA 4WF7A 3MLTA 4HJTA 4BK9A 3CVCA 3ARDB 1SJBA 3VGGA 5TE6H 2WSKA 2JJTA 4Y90A 3DBSA 1T89A 1KOAA 3NTCH 5DMGC 4TUUA 1OP4A 2IG2H 4FK9A 2INZA 4NPJA 2CKBH 2ORBH 3MRGA 2GTWA 4QMEA 1KJVA 4C56E 1TITA 2Y6SD 3QDMD 3AZSA 3BX7C 2YBRA 5D1QE 4YC2B 5HHMD 2HT4C 3EX1A 5PTDA 4AUUA 3S1VA 1W1ZA 4PH6A 3N55A 5HDBF 3DRQA 1JNEA 3PGCB 4KDTC 2X12A 3DFQA 4OFDA 3BDYL 1YEEL 1YC7A 3MLVL 2V6AA 2GHWB 4M1GH 3KOWA 2GJ6A 2VDQL 1PF3A 4UMGA 3M6YA 2HJFA 3QPQC 3L65A 1EZUA 2CR3A 5D37A 5C0GA 1GGIL 4Q9QL 3UC0L 2JNZA 3VD2A 1QLFB 2YUXA 2R4SL 3PJUA 1S2UA 3IUHA 2YGPA 5GRWA 1GEQA 3M88A 3OXRB 5D32A 3N9KA 1YN6B 1FRBA 2YJLA 4M51A 1K8IA 1A14L 2ARJB 1VBUA 4AVIA 1Z7AA 2YMXL 4WDWA 3ZDXF 2BSRB 3IEBA 3LX9A 2BY2A 2NLIA 1XG4A 5BROA 3O6KL 5I30L 4S3CA 3LN3A 3AU1A 3DX8B 2A3LA 4JK0D 5K59E 1JPGB 4XNMA 1SUHA 2JKPA 4LEFA 1E30A 4YLCA 2HMID 2BGNE 3A0OA 4YDVA 5G2IA 3QT2A 5AYUH 3WD5L 3MREB 3WKNA 3DOPA 2Y24A 5AZ2H 5BMXA 1EJ6A 5EC1A 4JEJA 1IGCH 3BRGC 1WBZB 4PJ5B 5ACZB 2CPUA 4IG2B 5FUCC 1KV8A 3IDXL 2DJMA 5TDNB 2IKGA 2ESVB 1MHPL 1XLFA 4GW5B 4JTLA 3MP3A 3QMRA 2XX1A 5DLLA 5F8RC 3TMLA 2Y7FA 4CW1B