1MFVA

Probing the role of a mobile loop in human slaivary amylase: structural studies on the loop-deleted enzyme
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Probing the role of a mobile loop in substrate binding and enzyme activity of human salivary amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords alpha-amylase, salivary
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mfvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mfvA01
4P7LA 3AIVA 4AZIA 4Z2LA 3N1AA 4WSKA 4JKKA 4D6JA 1R33A 1EHNA 3VIOA 2W92A 1VEMA 1JZ3A 3II1A 4P7NA 1I1WA 2A3HA 2WLZA 4ZE4A 1GJWA 3QOMA 3RM9A 1UWTA 1GOWA 4MDPA 4WLCA 2DH3A 3BLBA 3VU2A 5CZKA 1EDQA 1CXEA 1VFFA 3ALFA 2V3EA 3FW6A 2WAGA 2VX5A 1C8QA 1HJUA 4DO5A 1GJUA 4GXPA 1W1VA 3LPFA 4M80A 1CZ1A 4GO8A 2WMKA 4NX0A 4FLOA 3S2CA 2EJ1A 1ISWA 1JYVA 2V5CA 1W9PA 1UWIA 1H3GA 1C7TA 4F66A 1E40A 3AHXA 1HTYA 1D2KA 2D24A 2WCSA 3WDJA 5C71A 3MUZ1 6TAAA 4LYQA 1V6VA 4AISA 2GJRA 2WZHA 2VR4A 3VTRA 4IPNB 2FDMA 1XSJA 3MS8A 4P8VA 3SCQA 1PEZA 3D50A 3WUGA 2ZX7A 2G3JA 2G8ZA 1WDQA 3B9DA 3CO4A 3TONA 3DX2A 1NARA 3MANA 3T09A 2DT1A 1H09A 2X1IA 2J25A 3LXAA 2VCAA 2VC9A 4C7GA 5CSUA 3ARRA 3VMOA 4JFVA 4NRRA 4P7QA 1UH4A 3WF2A 3WN6A 3FXYA 5JBEA 4YHEA 5FKYA 4P7OA 1WZMA 4BQ2A 1V08A 1CENA 2ZOXA 2WVVB 2XYLA 2ZXDA 2W66A 1BGGA 4UFKA 1Q6GA 3ZR5A 1UZ4A 4NRSA 2CEQA 3WQ8A 1HJXA 1MXGA 2CCRA 3M7SA 4LXFA 1EH9A 2Y8VA 2FH8A 3SURA 4A3YA 1W2VA 3DC0A 3CZJA 1W1TA 4BS0A 3TTYA 3CPUA 4HOZA 5AYIA 3SCSA 2C7FA 5A2AA 4MAVA 2WBGA 3KLLA 4OKDA 2E9LA 3NDYA 1GOMA 1UR8A 3ARVA 1UQZA 5ABFB 1NWTA 1DWAM 4AD5A 4UR9A 4AY1A 1BTCA 2GK1A 1A3HA 4QLLA 3ZJ6A 4MNLA 1KGWA 1V6UA 4ATWA 1BSIA 1EIBA 4W93A 3WEZA 4ZXOA 1M01A 2VT0A 1JIBA 1CGTA 4FNPA 4PRWA 1HX0A 3SCVA 3QHNA 4PUEA 1L8NA 1KR0A 1E15A 3WEMA 1L0PA 3ZJKA 1ZBWA 5JIPA 2E8YA 3WFZA 3MUY1 4UFLA 1CPUA 2J47A 3VIJA 3MMWA 4LYRA 4WKHA 4EANA 4UQDA 3EJRA 1LG2A 5BXSA 1CXKA 1WCGA 3EDKA 1M03A 1TG7A 5AY7A 3TV8A 9CGTA 3UG4A 3AXXA 5D8ZA 3BSGA 1R7AA 3WY1A 2PI6A 3SCOA 4NZCA 3T0DA 2Y8KA 5D9PA 1B3WA 3MUIA 4J3SA 3GNPA 2ZXAA 1V6WA 1K9EA 2C0HA 2XSAA 2PF0A 1NOFA 3AJ7A 3W82A 2OYLA 1CLXA 3VDHA 2EO7A 3A23A 1XYFA 3S5YA 1GQLA 1HXJA 4GI8A 5HNNA 3IJ8A 1SR0A 4Q22A 3GNRA 4GKLA 2YL9A 1KXHA 2ALWA 1B3YA 2O9PA 2ZE0A 1XHGA 5EB8A 1JZ7A 4AD2A 4WF7A 2VQTA 2DIEA 5IHRA 4IISA 4MADA 3IANA 3OGSA 4KGJA 4OJYA 1OIMA 4JZ5A 3A24A 1Y7VA 4H04A 2GUYA 5I0DA 3VIFA 1HVQA 1E3XA 3AICA 1BQCA 3TTQA 3QGVA 2E40A 3L4XA 1ECEA 5FL0A 2V38A 1PJ9A 1CNVA 3VSTA 5CPTA 3W38A 4QP0A 1FFRA 4JL1A 2BVDA 2WBKA 3W26A 4AIUA 5FCZA 5LA0A 2FH6A 2B31A 5JIWA 3A47A 3RIKA 3WENA 4AZ7A 1G1YA 2ZUSA 2DT2A 4U5KA 4DUVA 1WAWA 4YPJA 2E8ZA 1EXPA 4LYPA 1E5NA 1JXKA 3BAYA 3EDJA 4JHOA 3BVWA 2XGBA 5DT5A 2V3DA 2EPNA 2W91A 2ZUNA 3KZSA 4PTMA 1J0YA 3WDIA 4D1JA 4Q7NA 5BRQA 3CHDA 5BXPA 5BXTA 1RH9A 3RM4A 1QI0A 2Y24A 4Z2HA 3BAKA 1U33A 4UOZA 5IXEA 4RE4A 2BS9A 1KCKA 2XVKA 2XM2A 1WDSA 1XYZA 1JI2A 4PEEA 3OZOA 4CD7A 2XIBA 2VR5A 3CIVA 1RPKA 4PMOA 4IM4A 4CN4A 5A6BD 3EJUA 3VX0A 3PHAA 4CGTA 2XM1A 1BYBA 3D51A 2XN1A 4AZCA 1GVYA 2E4TA 4W88A 5D9MA 3M07A 2NSXA 1G9HA 3DECA 3AIEA 2YKKA 4FNTA 4B3KA 3NYDA 3L4TA 4U2ZA 1JD9A 2WVSA 3QHMA 4TVCA 3RO8A 2QPUA 3BUPA 1TQVA 5IHSA 3IGUA 1JFXA 3SUVA 1UYQA 3WMCA 1VRXA 1QNOA 1ISYA 3M46A 4Y7EA 4FNQA 4W85A 3F4VA 3BVUA 1W3JA 5JBDA 3QR3A 2WSPA 4PCSA 5I24A 3VNZA 4PMZA 4V2XA 2WANA 4JFWA 4HOWA 1B31A 3PTMA 2WMHA 5I78A 2OYMA 5ABFA 2UY5A 3GXNA 5KZ6A 4RE3A 1Q6CA 3CZSA 2ZUWA 2WVVA 1UOKA 3F5LA 1GOQA 3MMDA 1KTCA 1QI5A 2O9TA 1LL7A 2YBTA 1UKPA 3THCA 3JUGA 4S3KA 1FP9A 4KWUA 6CGTA 4P8XA 1TQWA 1E70M 3PZOA 3W25A 3KE0A 2J7HA 4AD3A 4PMXA 1K9FA 3N12A 3VX1A 1FP8A 2D3NA 1C3FA 1FA2A 1XH1A 3AIQA 2WYSA 5ECUA 5TD4A 1K6AA 5CLWA 4CD8A 2J8FA 4ZXLA 2CBJA 4ZEPA 4MPKA 5A6LA 3PN8A 3OA5A 3CLWA 2DSKA 5CPSA 2E3ZA 1UG6A 4U2YA 3FHAA 3NJ3A 2X8RA 4MTVA 3WUEA 2X09A 4NI3A 1QI2A 4FLRA 1WKYA 4TXEA 1OGGA 2YL8A 1W9XA 3WEOA 3W27A 1UD5A 2FHFA 2VNCA 5HDRA 1OGBA 3WDQA 2JE8A 4AZ5A 1CXHA 1XSKA 3ZJ7A 3WUFA 1TA3B 2J7GA 2PWEA 1E71M 3GZAA 3KL5A 1V0LA 1Q6EA 2J7EA 3OIHA 2X0YA 1CLVA 1E6ZA 1JDDA 3UETA 4AEEA 4PMVA 1WDRA 2BFGA 2G3IA 2BY3A 2VOTA 4B16A 1G94A 3CH9A 1FH8A 5A2CA 4D71A 3G6MA 3BVTA 2ZX8A 4AW7A 4NSBA 1UR2A 4NZJA 2GVYA 3D4YA 1O6IA 4JCLA 1V6YA 1PIGA 1EGZA 1E0VA 1QWNA 4GO9A 3OLEA 4HPHA 2XPKA 4U3CA 3BUBA 4BZYA 3I3BA 2IUZA 3W6LA 3BGAA 1Z32X 4HTYA 3SCTA 2DEPA 4ATLA 2VURA 1W9VA 3GM8A 1UD6A 3LXBA 4DWSC 3IJ7A 1QW8A 3GTNA 3BXWA 1QBAA 7A3HA 4JFTA 5CJ5A 1OD0A 1EHAA 2GDVA 4W5ZA 4TVDA 5CPQA 4CVUA 2WHMA 5CQ1A 1H1NA 4ACZB 1HVXA 4AZBA 3VOCA 1TVPA 2F18A 3VGGA 3VIPA 3EMQA 2BXYA 1ISVA 3WY2A 3HN3A 3VINA 1DWJM 4QAWA 4RL3A 1UH3A 2V5DA 4MB3A 2OWCA 1UWQA 4H7VA 3T2QA 1E0WA 3WDPP 3DHUA 2JEQA 1J12A 3DX4A 4EKJA 4MDOA 5D8WA 3WQ4A 2CKRA 3MKKA 1H0IA 2NW0A 3WD4A 3WNNA 5LA1A 1ZU8A 2VVNA 1RD6A 2V3GA 2ZUUA 3WNOA 1H41A 5GNXA 2ZWZA 1C90A 2QMKA 3WH8A 3TTOA 1KXTA 2XJ7A 1W3KA 3SUSA 3SUUA 4CD4A 3WD2A 3NSNA 1FHDA 4D6DA 2MANA 1J9YA 1FH9A 5A8NA 2W63A 1KXQA 5A69A 3AOFA 4NXKA 1OT1A 2J62A 2CBVA 3UR7A 2EBNA 4JKLA 3OLGA 2CHOA 1R34A 1OINA 1ZS2A 2A3EA 1ODZA 3WSUA 2X2IA 3A4XA 5DF0A 3UCQA 3ARSA 3I3DA 3UG3A 4TTUA 3BCFA 3W0KA 4MB4A 2ZUVA 3POCA 4GQRA 1BYDA 2VO5A 5A3HA 3EJTA 3ZJ8A 1HP4A 1EO7A 1PX4A 2JIEA 2A3BA 1I1XA 1UKOA 2EACA 2QPSA 3VIHA 3ZSTA 3WF1A 2YA1A 4PMRA 4B9ZA 1JNDA 3WDHA 2WVTA 2IXUA 3KL0A 2VZUA 3WMSA 5A8OA 1BF2A 1UR4A 2AOSA 4JL2A 3HG5A 7TAAA 3WL0A 3D3AA 5HPCA 1UR1A 2QF8A 4OUEA 2UY4A 4MNJA 5A1AA 1GONA 1KBBA 5CGTA 5ABHA 1E1EA 1KBKA 2G3NA 2XTKA 4H2CA 3ARUA 6A3HA 3MI6A 2OLHA 4D6GA 2WM0A 1HP5A 2F61A 4BA0A 5F7UA 1UKQA 1V3KA 4KRTA 3AHVA 4UZSA 1E6QM 1H11A 4MB1A 3AS1A 1IZKA 1MFVA 2F1AA 1XD1A 4GZIA 4XV0A 4AZHA 5M17A 3UERA 4DO4A 4FF5A 2G3MA 4CCDA 1OT2A 2OSXA 1TMQA 3PZGA 4W87A 1KR1A 3B8SA 3BCDA 2WPGA 2D0HA 2VZOA 1F4AA 4M29A 5CG0A 1ZBCA 1B0IA 1UQYA 1JZ8A 1E1FA 3N04A 5D9NA 4UQAA 2WXDM 1GQJA 4EK7A 3DX3A 1MXDA 1WE5A 4ML4A 1HIZA 3ZO9A 1JD7A 1CXFA 2OYKA 2EPLX 2WLYA 1JYWA 1NWRA 2XIIA 1CWYA 4W8LA 1O7DC 3CZEA 3BUIA 4DO6A 3HJEA 1GOKA 4UTFA 3K4DA 4C7FA 4YN5A 1VEPA 4OOZA 4AWEA 3L4WA 2EADA 2ZX6A 1HKJA 1G0CA 5IFTA 3QHOA 1UHVA 1UWUA 2Y5EA 4AMCA 4CN6A 2F8QA 3CZNA 3SCPA 1BGAA 3UEQA 2YFOA 2FHBA 3FAWA 1RP8A 4WSJA 3ARQA 4OIFA 3AIUA 1HKKA 1UA7A 1MQQA 1TQTA 1GUVA 3PBGA 1JAKA 1LJYA 3AS3A 3CUIA 1BG9A 1R87A 5A8PA 1K9DA 1GOOA 1CGVA 3AIWA 3VGBA 1M04A 5CLTA 1XSIA 2BV9A 1JZ5A 5KEZA 2WWCA 4JCMA 1QPKA 1H5VA 3VDBA 1E4NA 1UASA 1OB0A 2J77A 1JDAA 3KWXA 3UESA 2PWGA 1J10A 2DSVA 2BY0A 4JFUA 2TAAA 3SCWA 4NZFA 2VI0A 4HA1A 4MAZA 2DGAA 4GQQA 1V0NA 4E8CA 4ZE5A 4NF7A 2F7QA 1GOIA 4HU0A 2XFFA 2WMIB 1ITXA 1E6RA 3LMYA 3AROA 2J74A 1KXVA 1E5JA 4Z2GA 3CUJA 5M03A 3NUKA 2BXZA 1JAEA 4HOXA 1JFHA 1MVYA 4PMUA 2UY2A 3KEHA 3D5HA 3U57A 2PBOA 5BROA 1X1NA 3OLIA 3AHZA 1JI1A 2IXVA 1TFVA 3A4AA 3VNYA 4W5UA 2DT0A 2HVMA 5E6YA 3A3HA 4GI6A 4XZBA 3TP4A 3WNPA 1SMAA 1HF6A 1B90A 3IAPA 1JF5A 1AMYA 2UWFA 1HKMA 4OOUA 2XN2A 4AMXA 3PZQA 4QCFA 5I6SA 2O9OA 4KGLA 2CESA 4UZUA 4UQBA 1V3HA 3VVGA 1F4HA 5A6MA 4CD5A 4AZGA 2BHZA 1IV8A 1LF1A 4W7VA 5A6AA 2GFTA 1VJZA 3TTSA 3T2OA 4F8XA 3CZKA 1KQZA 3ZIZA 2ZXQA 2VZSA 1PZ2A 4CCEA 4UFJA 1QHZA 1DHKA 4U3AA 1R46A 2DSZA 1BYCA 3CZ8A 1B3XA 1V3IA 4R27A 2YFNA 2VVSA 2CIPA 4WJXA 3EDDA 3LRKA 2DT3A 2YDSA 1MQPA 3SCRA 1W3LA 1P6WA 3WUBA 3ECQA 2X0HA 5HXMA 3OZPA 1Q6FA 3WKZA 3VMPA 2W5FA 4MB5A 5FOOA 3VIIA 1LLOA 2RGMA 1C91A 2FGZA 5GQBA 4B9YA 2CPUA 1J0HA 3BAJA 3SCNA 1HJVA 1WO2A 3AHTA 1XRVA 2J78A 5A8QA 1DWIM 1R47A 4AXNA 1GORA 3VD5A 3GBEA 3L4UA 1FHLA 1UZ1A 1AVAA 5AYBA 4W7WA 4P8UA 2EAEA 1VJSA 3WF4A 3WD3A 5HPOA 1MW2A 1CXIA 3LPPA 2E0PA 3ZSSA 4PMQA 1QHOA 4TX6A 1UA3A 3OGVA 1ZBVA 3LPGA 1QW9A 1WPCA 3VD7A 4BQ3A 3LPOA 4R5EA 2WWDA 5A6SA 2J7DA 1J0KA 3A6OA 2BVYA 4CD6A 1W9UA 1VB9A 1TR1A 2X2JA 3U5YA 1ZB5A 1QOXA 3J7HA 1E4MM 2QLYA 2EQDA 3EBVA 5E09A 2YL5A 1DWHM 3BUQA 1HL8A 3RCNA 1SMDA 4PSRA 4CU6A 1SZNA 2F7RA 2EPOA 3BAWA 3N9KA 3SIMA 1BLIA 2J7FA 1NM9A 2WZEA 1QVBA 4IUGA 3AQUA 2YBUA 4DWSA 2A3CA 4CCCA 2CBUA 1BG4A 4K68A 3AXIA 5FIPA 4TOQA 3PZ9A 3N18A 3ARPA 4TTGA 4GPNA 4F79A 1NH6A 3S6TA 1UUQA 3PZUA 1MQRA 4D6FA 4Z2KA 2WMFA 3DDGA 1GPFA 5I2UA 2XWDA 3U5UA 5DO8A 1EOKA 5CGMA 4UFMA 3FAXA 1KCLA 1VFMA 1EQPA 1US3A 2XG9A 2CITA 2VUYA 3WQVA 2J4GA 1KWKA 2XHYA 3VIMA 3WNMA 4LX4A 4UFIA 2UY3A 2VZTA 2DPEA 3BH4A 1QNPA 1MYRA 4YHGA 3L2MA 1JYNA 4DWSB 3SEPA 3FN9A 3WF3A 1CTNA 1OSEA 3ARYA 4OBRA 3EDFA 3WNKA 1FH7A 1GZJA 2JALA 2XWEA 3MMUA 3F5KA 1B3ZA 2ZICA 3TOPA 3CUFA 3CTTA 1M53A 1CGWA 3BVXA 4UOQA 3THDA 1XD0A 2FYVA 1E56A 3CGTA 5LA2A 1BFNA 3K46A 4PUDA 3ZOAA 3IK2A 2WC3A 3MSDA 5EFFA 1E72M 4F9JA 4GZEA 4V28A 2YOCA 3K4AA 5GNYA 1J18A 4AYGA 4EE9A 4ACZA 4J28A 2XVGA 2VCBA 4HU8A 1C7SA 3WMBA 2VL4A 3VD9A 3NSXA 2CHNA 3DDFA 4GZJA 1EA9C 2ZWYA 1ZBKA 2J7CA 5D9OA 1AQHA 2QHAA 3VKKA 4KMQA 5BRPA 1EO5A 3VDAA 1CXLA 1C8XA 1JL8A 5ABGA 1ISXA 2WB5A 3VIGA 2VRJA 4NXSA 3FNDA 1MWOA 2Y4SA 1IT0A 2VMFA 3CHEA 4LGXA 1XV8A 3KL3A 1J0IA 2D22A 1CIUA 2PWDA 1R86A 3GH7A 2YIHA 1BYAA 4DUWA 2WK2A 1PX3A 3W24A 2ZUTA 2V3FA 3WL1A 2GJXB 1E4IA 4GINA 1E73M 1BVNP 2ZIDA 2WCAA 2YLLA 4JHZA 4V27A 3VM7A 2FHCA 1W2PA 1W32A 4PSPA 2XVPA 4FK9A 3PZTA 3D52A 3PZNA 1HN1A 5IFPA 3HG3A 1C93A 5E1QA 3PZVA 3VIKA 1EOMA 1ZJBA 1H49A 3GXFA 3WBEA 1E3ZA 1BPLB 1UD4A 2RGLA 2W61A 3VD3A 2VCCA 1TCMA 1W9DM 1G01A 4UQEA 4UNIA 4M81A 2WZIA 1DP0A 5JBFA 3GH4A 2J7BA 4U33A 3AIBA 2ZX5A 2CBIA 4D72A 1US2A 3WQWA 4FMVA 1V0KA 1MW3A 1EDTA 1LQ0A 2OSWA 4PTXA 3WNLA 3WF0A 1B1YA 1PX8A 3IAQA 3ZT6A 3HU7A 4FNSA 1ZL1A 1NWSA 4H41A 3W81A 1QNSA 3ARTA 2VRKA 5M3WA 3W53A 1CECA 3WFLA 4PMNA 4D6EA 4LQ1A 3AXHA 3CV5A 3QOKA 4FLSA 4UQCA 4M8UA 4GI9A 2E9BA 1YQ2A 4HA4A 5FD0A 7CGTA 3BLPX 4WIWA 3VDCA 1OD8A 3WQ6A 4OZOA 4ACYA 1UD2A 2BHUA 3WIJA 1QWUA 2D3LA 3N13A 3OLDA 1W3HA 3RILA 2WKGA 2VTFA 2WHLA 3VUPA 2FGLA 3CMGA 3GNOA 2O92A 4PCTA 4AD0A 4AZCB 3BLKA 4QCEA 3ZQ9A 1TUXA 5M5DA 2EPKX 1VENA 1X6LA 1XH2A 3DYPA 2BY2A 5HOSA 3WD0A 5E0FA 1QNQA 5E70A 1WP6A 4L4OA 4HMDA 3ZM8A 3NDZA 3BAIA 3ZT5A 5E6ZA 1JG9A 3AI0A 2J75A 1V0MA 4QDMA 2OW7A 3HMCA 1HXKA 3EJQA 2CNCA 1TVNA 5DT7A 2G4FA 3WY4A 4E2OA 4P7RA 5D4YA 5E0CA 5A2BA 3MSGA 1R75A 3W29A 4MNMA 1E9LA 3B9AA 2WCGA 3N15A 3BVVA 4W89A 4ZENA 3WELA 2OSYA 3WY3A 2C8NA 3GH5A 3K8KA 4ATDA 1JF6A 3NCOA 4AZ6A 1CDGA 3IJ9A 2W67A 1WZLA 5HBFA 3HG4A 4WKAA 1FFQA 3MUAA 1PAMA 1JYXA 4URIA 1JXJA 3WD1A 1J11A 2WC4A 3VILA 5DFAA 4J3XA 3POHA 5BYWA 1PS3A 2W62A 3KLKA 1H2JA 4PTVA 3ZMRA 4S3JA 3L2LA 1HJWA 1UKTA 4D6HA 5JUVA 3ZT7A 2VX4A 1JZ4A 3PTQA 5BCAA 2D73A 3OG2A 4X0NA 2GJPA 3APGA 4DUXA 3O9NA 3PZIA 1IZJA 2JIWA 4CKQA 1HNYA 1J0JA 3S5ZA 4XX6A 3W28A 2JF6A 3N11A 3WDRA 3RMEA 1V03A 2XGIA 2D20A 1HKIA 4TX8A 1VAHA 4Z2JA 5I3DA 3U7VA 5I5RA 1DWGM 3L4VA 2WVUA 2IGTA 4HP5A 3LRMA 4C7DA 1V3MA 3H55A 3GXMA 1KFWA 1V3JA 3PTKA 3MU7A 3GXTA 1V6XA 1NQ6A 3HZ3A 4MJ2A 4WKFA 3EMZA 4AMWA 4BQ5A 1Q6DA 1XC6A 4QLJA 3ARWA 3M6DA 3T2PA 5BXRA 5EFDA 4JKMA 1S46A 5BWFA 4XB3A 3SUTA 2VZVA 3WBAA 3BAXA 4XZWA 1NWUA 2WHJA 1ZJAA 2BVTA 3AYRA 3W4RA 2XVNA 1HWWA 3OGRA 4AEFA 1GHSA 1C8YA 4KRUA 2X05A 1D3CA 4W84A 2D0GA 5AC5A 3WH5A 1N82A 1OWQA 2WC7A 2DIJA 3CZLA 1ITCA 1W91A 4H8VA 3GBDA 1MW1A 4CN1A 3T0AA 3U7BA 2BNJA 4Z2IA 1KGXA 3MV01 1UH2A 1HL9A 1VFUA 2CKSA 2GDUA 1JZ6A 2D23A 4CUCA 1AQ0A 4P8WA 2VQUA 2ESCA 3VPLA 1CEOA 1HJQA 4D6CA 1E4LA 1E43A 3LX9A 1ESWA 4EAMA 4PN2A 1PBGA 1U2YA 1E6SM 2OWWA 3L4YA 8A3HA 4TUFA 3AYSA 4HMCA 2WKLA 5C70A 1BVZA 1DWFM 4RE2A 1E6PA 4M82A 1R8LA 1Q4NX 2CXGA 3RPMA 1SFSA 1CYGA 1QI3A 3SUWA 2D2OA 4KH2A 1XCXA 1UD8A 1DTUA 3FHQA 3FY1A 4AD4A 2YA2A 2PB1A 5A6JA 1TA3A 3CMJA 3AHYA 2WMIA 1HT6A 2PC8A 2Y2WA 3DHPA 3CZGA 4W86A 3GXDA 4CVWA 4AIOA 2NT1A 4PMYA 5A95A 4AIEA 3BMVA 3T08A 3CC1A 3EDEA 2WMGA 1KTBA 3UG5A 4BCEA 3K1DA 1OCQA 1NP0A 1X6NA 3O6AA 4H8UA 4UQ9A 4J3UA 3AISA 1GQKA 3F5JA 2YL6A 2BHYA 2DSWA 2EXOA 5DMYA 4U5IA 1QX1A 1MFUA 2WSKA 3K8MA 4DM2A 3WH9A 1ISZA 2VX7A 1B2YA 3RJXA 1LL4A 2F2HA 5LYRA 4E4PA 4B15A 1VF8A 1E55A 3BUDA 2HISA 1K9TA 2FE0A 1GHRA 2JFEX 3HG2A 5C8BB 2PWHA 3VGHA 2DSUA 3UR8A 2JF7A 4HA3A 1C92A 2D1ZA 1JGIA 4AYSA 1XGZA 2VRQA 4FNUA 5GPRA 1EQCA 1CGUA 3VSVA 1V3LA 1D7FA 1OGSA 2F7PA 3EJSA 4QLKA 2GJXA 5ABEA 4MJ4A 4J3TA 4B3LA 1WZKA 3N17A 3DX0A 1GNXA 2YDQA 4MNKA 8CGTA 2DH2A 5IDIA 1GQIA 4TVUA 2XFRA 1TQUA 3A4WA 2YDRA 2X2YA 5EBAA 4J3WA 2QV4A 3W37A 4E8DA 2F7OA 5A6KA 1J0ZA 2VJXA 2QMJA 3MV11 1QBBA 3A5VA 5E9AA 2W4XA 1MW0A 4HPGA 2BY1A 1ODUA 3DYMA 2NT0A 3RJYA 2ZX9A 1DEDA 1V02A 3AMGA 1KWGA 2AAAA 1NOWA 3ARZA 3H54A 1WB0A 1RP9A 1VBUA 3T0BA 4IPLA 4BF7A 3DYOA 2WHKA 1YHTA 1KGUA 1LWJA 2XN0A 3NSMA 1JNEA 1OBAA 2JEPA 1WNOA 1OM0A 4D6IA 4LPCA 1WDPA 4BQ4A 2WNWA 4PTWA 1U30A 5I77A 4H8HA 5CXPA 3LXCA 1H4PA 1GW1A 3ZR6A 4HMEA 1UWSA 4AC1X 3VM5A 2XSBA 4PYSA 1GCYA 1BAGA 3H53A 3AS0A 4OGZA 2YA0A 1B9ZA 3EMCA 4A3HA 1R7OA 3G6LA 5DEZA 3E1F1 4PBGA 4JIEA 4UOJA 1VIWA 4HZ7A 1W1PA 2XFYA 3I3EA 4UCFA 4J3VA 3BSHA 2O9RA 1VFOA 3PZMA 2Q8XA 2WMJA 2EEXA 1CGXA 5I79A 2AMGA 4CU7A 2Z1SA 3GXPA 3AMKA 2J79A 2XVLA 3VSUA 4QFUA 4W7UA 4CU8A 4W8BA 4M24A 1LG1A 2F1BA 4J7RA 4GIAA 1JDCA 5A94A 2J8GA 3AMLA 3AZTA 1QI4A 1EDGA 2Z1KA 1G5AA 3B9EA 1SYTA 2PBGA 3TA9A 2EABA 1E0XA 3L4ZA 1QNRA 1A47A 3EYPA 4N42A 5FL1A 3GYCA 3SCUA 3VGEA 1WZAA 4JFSA 2CERA 1W1YA 3CHFA 3CHCA 5EMYA 1TQSA 4WK9A 2DDXA 2YJQA 3AZSA 3WQ5A 1V02E 3DX1A 4D1IA 1JZ2A 1UD3A 4HZ6A 1LWHA 1HJSA 1H0GA 1R85A 3AIRA 2A3AA 1FOBA 2GK1B 1I75A 3CBWA 3A22A 5A8MA 3EJPA 4XUYA 3AS2A 5I23A 2D0FA 1UWRA 2ZUMA 3VMNA 4M56A 1KB3A 1J01A 3AFBA 4A4AA 3AZRA 5A6BA 1T0OA 3ARXA 3CUHA 2OWXA 4J27A 3A21A 1KQYA 1TZ7A 4DWSD 1E6NA 4JAWA 1LL6A 3GDBA 3NIYA 2EPMX 1PZ3A 3VO0A 3ALGA 3OB8A 2XUCA 2G41A 4FNRA 3WH7A 1B3VA 3AMDA 1E6XM 4L4PA 1VEOA 4W8AA 2CYGA 4ZFMA 3VD4A 1QHPA 1AQMA 4DM1A 1GVIA 2GSJA 1VBRA 1PPIA 4X0VA 3CUGA 3D4ZA 3LRLA 1W9BM 3AMCA 3BC9A 5AC4A 1NOUA 1CGYA 3MO4A 2X2HA 3RDKA 3RM8A 2WW5A 1XCWA 4HZ8A 4U31A 3O2LA 4PMDA 4FLQA 2CETA 2DQXA 3K8LA 2VX6A 3OBAA 1TE1A 1UR9A 1M7XA 4F9DA 4UFHA 1OIFA 4X9YA 3WH6A 1B30A 2YLAA 5CSYA 1UR0A 2E9MA 1XH0A 1PIFA 4M1RA 3VGFA 1O7AA 2PWFA 1UKSA 1NP2A 1BHGA 2OW6A 4OBSA 3W6MA 5GNZA 3GXIA 3VGDA 1CBGA 4N0RA 4AD1A 2ZXBA 3BMWA
chains in the Genus database with same CATH superfamily
3C8FA 5ESQB 2ITCA 4K7FB 1AH3A 2YGOA 1OC6A 3GQFA 3I6LD 5CJXA 2XBDA 3FB6B 3FTSA 3BK0A 4P7LA 2ZRZA 1LHZA 4JIQA 1M1XB 3IDUA 4G8IB 3RNQA 1JEZA 3IEBA 4OB5H 4P5KA 2W9MA 1G9NL 4WU5B 2EYSB 1U8IB 2XH7A 4KKBD 1QU4A 4HWZB 5DY3A 1JCLA 1XRFA 4YHIA 4PH6A 3VIOA 1SBSL 4N1HB 5LNEA 3QV7A 1I1WA 3VYOA 1QK2A 3D85A 4ZE4A 1GJWA 4DX3A 2HFFA 3IMUA 2QVHA 3I10A 5ADOH 1V27A 4JMXA 1GOWA 2QDHA 3N2CA 1D5XA 1OGAE 4RDYA 2A4ZA 2ONEA 4J2QA 3BVNB 4MDPA 2J9ZA 5EPMA 4W4OC 3UZEC 5JXAH 3TQPA 1SXBA 1TJXA 4XODA 4F7MA 2DH3A 4OT7A 1ZLVK 1DTNA 1QNZL 2J20A 1SW7A 2Y7DA 1NBVH 4YVUA 1TMCB 2CDFB 2EINB 1OFDA 4LFHD 4QHMA 1XF2A 3B3IB 4F8QA 2E09A 4HNUA 3P3RA 4IGHA 3C08L 4GZ7A 3CX2A 4IS6B 5F96L 1VC4A 4XBJA 5F0PB 3LZLA 4PWKA 1N3NA 1MPAH 2ALAA 3FW6A 2H3BA 4TTDD 4LCUB 3T4WA 4C6JA 2WAGA 1IGYB 2IKIA 1M7PA 4XXCC 3LNFA 2E6YA 3L16A 3RG6A 4NVTA 3EEZA 5D70H 3OR6A 1W1VA 1AQFA 2I17A 3ZYIA 1R5IA 1ZQ5A 3QM3A 4M80A 3HFML 3MRDA 3W39A 3RZCD 1YLBB 1WICA 5KVFH 2ATKA 1CZ1A 2OTPA 3GUWA 3WEXB 3QG6B 2UV8G 1VZGA 4AJWA 2R7EB 3D0AA 4PTTB 1AFVL 1DLHB 2XIQA 4KCTA 2XWRA 3L81A 4OV4A 1JYWA 3QO1A 3WAKA 4PJGB 1UWIA 4C6LA 1I7TB 1E40A 1U91B 4LF3B 4OJDH 3LKSB 3PAVA 3PS6A 1X5GA 3FONB 2WCSA 4KX9A 5DZJA 3V8CA 1MRDH 3EH1A 5TDPB 3IGXA 1A1OB 2H1LM 4XNQB 2Y0FA 1LO5A 1LNUB 2AV7A 4DP1X 2GJRA 5TQ2L 2WZHA 2IAMC 3OSKA 3FA5A 4NKOB 3TN0D 4ENEC 1TPB1 5CBIA 1G7IB 1VCAA 2HUHA 1NCAH 4ODVH 4R96A 1ZE3C 5EBLB 2B59A 3C6EA 4XBEH 3MS8A 3QJHA 3GSOB 3F7KA 3SRHA 1GYCA 3O8XB 1K5WA 5DJDA 1YPZB 3GSUB 4I9WD 2BP3A 2G8ZA 2Z0UA 2DMGA 4NQSA 1WDQA 2QVFB 3G6JE 3ULAB 2FO1A 4K39A 3LKQB 3CO4A 1KIPA 3MANA 1MI5E 3SQMA 3T09A 3VXNA 2R9RA 4IFOA 2QQNH 2NY1D 3LXAA 2WHVA 5GGTA 4X80H 1GSKA 4ZFOB 5KYNA 4V1XA 2RCSH 4KU1A 2BGSA 4JFVA 5CILL 2MOQA 4GRWH 1KPVA 2C1PB 5DHMC 5FPIA 1XIDA 3PPHA 3CQKA 3QJZA 3G1SA 5JHAA 3GD6A 3FXYA 4F3FA 4X7DC 1NANI 4YHEA 1V6TA 3LZFH 4QJ4B 5FKYA 3VFUA 2DRUA 1BXNA 3UXIA 2BC4A 4NO0B 2APFA 1DVTA 3P4OB 3JWDL 4ROQA 3ARGD 4X9GA 5DMNA 1MHPH 5J06A 5DWPA 2EXWC 2V2XB 2J27A 5C07E 4UFKA 4C6OA 3QIUC 1Q6GA 4JRYD 2VFGA 5D04C 5EU6E 3TH2T 5SWQB 5E6ID 1TQXA 4H26B 2VC2B 4ETQB 1MJ7L 1XL9A 1VFBA 4IU2B 2R14A 3L8QA 5CD5D 5K9KB 1CD8A 3NSCA 2IH3B 4WKZA 4UTUA 3N14A 3BICA 5K39B 3B0YA 1KEGL 2LT9A 3CDGB 4MWFA 1FWWA 3SURA 3K71A 3QB7C 2UXFA 1HK6A 4S1DD 1XISA 4A3YA 3CZJA 2GSIB 1X44A 4X6BA 4CMMB 4PCKA 3SIKA 3TTYA 3CPUA 5MEND 1UCTA 1OX6A 1SZGA 3L9EA 3GZQA 1RUKH 1J9TA 2PKDA 4TUJA 3SCSA 2P48B 3KPNA 3KLLA 4XH2B 4JY9A 1JV2B 3D25B 2A74B 2AXFB 1A0EA 2A1WH 1Q45A 1SW0A 5D2TA 3IEAA 4Z17A 4WCJA 2P5WB 4MQ7B 1IAKA 4AD5A 6XIMA 4WO0A 3T5WA 3WL9A 1WIUA 3LHYA 2QDEA 4LLUA 3IF1B 1VIZA 1G4MA 4P23C 4AY1A 5HY9A 1LBFA 3G0XA 3STLB 4N0FB 3P73B 3DHFA 1OZMA 3L66A 5IB2A 1A6ZB 2P5EE 1A3HA 3F58L 3S0CA 5AOJA 4BEIA 1KGWA 3LCLA 1X5YA 2XQYA 3MJ7A 1BF6A 5JW4Q 1BD2D 4P5KB 1JIBA 1MRAA 2NY4B 3GIVA 4FKHA 4PR5B 4R3SA 3M0YA 3QZ6A 3QWOB 4I3SH 1O94A 4GJ1A 3NQDA 4PRWA 1BMZA 4KDVA 1IQWH 5TTRA 5F0MB 3ULUL 2P80D 2RHEA 2ZCLL 3SCVA 2EKCA 2CUMA 5AB2A 5I6XC 4DVRH 2QUUA 3FB5A 3O3AA 3ZDXF 1W0WA 4J1UB 4LHUA 3VH8B 5KVGE 4X9FA 3U4KA 1E1CA 5JIPA 1XFCA 1WD8A 1ZBWA 4PJBA 3HPJA 4LVNC 5AHFA 3CWNA 5KS9F 3QPQD 1UM5H 4GP4B 5TK2A 3W1MA 4M6PA 5DGQA 2J47A 1LDPH 5JIKA 2LFGA 2I7OA 4U1JB 5D1QD 1UC5A 4FQLL 4UQDA 1I8KA 2EDRA 2P8LA 4HUCA 3X1BA 2L5HA 4R7NA 4O5LH 5F2GA 1CXKA 1UWYA 5ENWA 3E49A 3E9TA 3TCXA 1WCGA 4XVDA 1U8QA 4GX9A 1M03A 3Q94A 1U2HA 1QABA 1S5IL 1XAUA 2YRPA 3BUYA 4WFED 9CGTA 3GW0A 2JB6B 3GJFH 1OAJA 3KPTA 3AXXA 3GSWB 5I2IB 3BZ4A 1Y0EA 2PPGA 5CN1A 2PI6A 1SGKA 1GCFA 3RZCA 1RJPA 3MKCA 4ZQTA 4XMLL 4MLRA 4O14A 4PGBB 4TULL 4GG6B 3RRXA 1NUFA 4Q9RL 3T0DA 2OT0A 2CGRH 4L8SB 3QMSA 4HC1A 3DOSB 4J3SA 1Q6QA 3MUIA 3WIFA 3G8EA 1GWJA 3UYPB 5KBKA 4DBSA 3E12A 1CT8A 5CD5C 1LNUA 2AV7B 2ORBH 1IXNA 1K9EA 2F7FA 2XSAA 2OTWB 3EX3A 4AIBA 3HC0B 3DIPA 3R5EA 5IEHA 2VR9A 1FZMB 1HEZA 1NOFA 2ZUYA 4HAKA 3VDHA 3SPCA 1LUCA 1XYFA 3S5YA 4GIPD 2DWDA 4ZO6A 4ZD3L 3AWFA 1UA6H 2Q3XA 1YNTB 2HRGA 4FP8L 3GS0A 4BKTC 4DGYH 3KZ8A 4FTVB 4Q4KA 5IB4A 1H1ZA 1SR0A 1TVLA 2P88A 2DYPB 4ODSL 2AQTA 4GKLA 5HVFB 4FR1A 3LMJH 5BRZB 3MUXA 4QG9A 1AZ2A 1RPXA 1KTNA 2YCJA 2VITB 3AWNA 3KXQA 3KYOA 2NXZC 3ETTA 5LHEA 5HYJE 3IMWA 3G0SA 1ETZA 1QEWB 3CNKA 4OFKA 2GJ6A 4C56D 2UZXB 4MBOA 2O9PA 1UP0A 4JAWA 3OJDB 4R4FH 2JGQA 2EP6A 1CW2A 2YMXH 4U1KB 4YHIB 2BINA 3FT2A 4GSXA 4UV4L 5MEPA 1ITQA 2VC7A 2IF7A 5KOVC 4WF7A 1KM2A 4O1BA 4WKFA 5CCJA 2DIEA 4K3ZA 1YNPA 3Q7JA 1TYEB 3RUGF 4N6QA 3S3SA 5E8EB 4ENLA 4A21A 4OJYA 1SHSA 4LSDA 5EBWA 4JPWH 2OU4A 3AACA 2V68A 4GNVA 3TZVC 3RNDA 3IDNB 5A7EA 2G3ZA 5KBDA 3W1XA 1K5NA 3U7AA 4PV8B 3VIFA 2D7NA 4W70A 4X2UA 1BQCA 2FDBP 2FTPA 3AICA 4J3ZA 3SO7A 4A55A 4Z3FA 3VRIA 4X6FA 1MWAB 4XVTL 5KZDA 3VFLA 2AJXH 1A7NL 4TSCH 1A7PH 1E9QA 3ZMEA 4IOIA 2K6ZA 2V38A 3QCVH 4HN4A 1DVJA 3H21A 4RGMB 3W38A 1AA1B 2EKJA 1PCKA 2QCCA 2XH0A 2FAUA 1UM5L 2Z4TA 3B8YA 4HKBB 1UACL 4FG6D 1L5GB 2AXHA 4JMNA 1S7SB 3F7YB 1BZ7B 4JY5L 2ZUSA 3PWJB 4Z9KB 4QJ5B 3S5NA 4U5KA 3TFXA 1M1XA 1WAWA 4YPJA 3FT3B 4LYPA 1DVFC 1SM3L 3IJSB 2FX9L 4C56A 1S3TC 4NILA 3GU2A 4ERGA 2JCCA 1VBJA 4HQQH 4MYXA 1J8HE 1NEPA 4K2UL 1NF0A 2ZC8A 3NXFA 3UZWA 4AQ8C 3DMMB 2OZ4A 4G71B 2FZMA 4ZYKB 3F7LA 3VFRB 5KVFL 3C5SB 4M6MH 2YQGA 3I9IA 3BRFA 3CV2A 2XU9A 3ZIYA 2CBMA 1L6FA 2DUXA 2INEA 4JHOA 3MACL 5EULV 1ADQA 2HKHL 5G4MA 3GTXA 3ZJAA 4Q8WA 1G67A 4LCIL 4XNZC 2XGBA 1KYOK 3LQZB 2WWMC 3V18A 1FUNA 2VC2L 4JTAA 1JGDB 1BXBA 1YJDH 3FTXA 3KZSA 1D5MB 5EOTB 2PMQA 2B59B 1LEGB 1WFJA 4J3BA 2R8SL 3OD3A 4IU3B 3H1ZA 3CNYA 5T26A 2H32A 3PWPA 5AUMB 4YS4A 4ZDHA 2OODA 1QFWH 4RWYL 4ZX4A 3WN5C 2VDKH 5JTWA 4N9GB 1H6TA 3I6GA 4KZDL 5D1ZI 4AYFB 4AZ8B 2E7DA 1XO8A 2X3AA 4KBXA 4LEQA 1F05A 3U0PA 2R1MA 2VWSA 4NRZA 2XIDA 3FB5B 4YSQA 3B05A 2XM2A 3FQRA 1PEWA 1XYZA 3E0LA 4FXRA 1JI2A 3MJ8A 3W0WE 4AQ1C 5HGHB 3BX7C 1JNJA 2FB2A 2DZTA 2F9BT 2J8UA 3P93A 4IX2A 5TFSH 1WWBX 4M3KB 3V0VB 1TWDA 5HULA 1V51A 1E5YA 5E5MA 1RPKA 5F4XA 1JPGA 3UMNA 3EJUA 2A21A 3D51A 3IJLA 1JWSB 3HI1A 2G5BA 3IS0X 4AZCA 3NQFA 1R2SA 2FVLA 2WZMA 4MS6A 2KS0A 2E4TA 4K9EH 4YDMA 3M07A 5DHVH 4Z7WF 5D9MA 2QVKA 3ISIX 4Y19B 2AJXL 2NSXA 1JFQH 1P4IL 3AIEA 2YKKA 4HKZB 2BJML 3B9VA 1IEHA 5LGJA 2R94A 3NYDA 3LZPA 1SZFA 2DIBA 3PWVB 3QHMA 3RO8A 2GC7C 1I85C 3QY7A 1QSFB 2HX8A 5EIIG 2EVGA 1QT1A 1WBYA 3BUPA 2AJZA 2YD2A 4JD4A 4JPGA 3IGUA 2UBPC 3CFKB 1TTGA 3E3QE 4LSQH 3CIXA 1A6WH 1DE4A 2QNEA 2WLLB 1PSCA 3ZVIA 3SOTA 3EOTH 4PVLA 5IW6B 1QNOA 1ISYA 3QKEA 5DSCB 1QSVA 3IB4A 4PMFA 2O61A 2PURA 3DERA 3F4VA 3RNQB 2PA6A 2C7UB 4OLWL 4PCSA 2A7BA 5I24A 1XIFA 4PMZA 4N5EC 3HG1E 4LNRB 5EU3A 2OK0H 5IW1A 3Q2NA 4JFWA 4HOWA 4IP7A 1EC8A 4AHQA 3NVQA 5D8JL 5DA0B 3SDCD 3C60A 3U82B 3LNDA 4W4QA 3MBFA 2WJFA 5CPNA 5D38A 3QY8A 4Y5VA 5I78A 3CVIL 4N5ED 2P5WA 3APYA 3D09A 5J13B 7REQA 3TNNB 2J6VA 3GXNA 3NR0A 2QIWA 3CHRA 4QISA 4MA1C 4Y88A 5C92A 4DNLA 4PW9A 5C0IB 5IFHL 1FDYA 1GR7A 3FBKA 3WS3B 5B3NA 4S3EA 1N8ZB 4NJ9H 2Z1BA 1F4YH 1S3KH 2EDTA 1G7PA 3FOMA 4F7MB 1YEGL 1SFJA 5BQDA 1AD9B 1KTCA 1FIEA 3U36B 2O9TA 5CLYA 4Z5RB 4J1OA 3CK0H 5DGRA 1UKPA 3G08A 4NKIL 3TKFA 3TM6A 5JHDB 2CUAA 3OVRA 3EJYD 3WTWA 4JTFA 1IGCH 25C8H 1M05B 2G5RA 4KFZC 3HC3H 5LGKA 1CG9A 4Y8FA 3W25A 2TYSA 2J7HA 3Q3GB 4H1LA 4UQ3A 1WBZB 5FOBA 1GOGA 1D9KB 4UT9L 2E74C 4XZUB 1AFVH 1HYSD 5DLCA 4Z1CA 1S7RB 1K03A 3JUYA 1NBYA 4GRWE 5FF7A 3GRWH 1DQWA 3M1OA 4WEVX 3AIQA 4J6RH 5GZOD 4LOCA 5TD4A 3MU3A 5J9PB 5CLWA 4I87A 4I3GA 4MLIA 5CN3A 2CBJA 1BWLA 1QPRA 4ZEPA 4MPKA 1P2CA 3QP3A 4R5XA 5BNXD 3H85A 3V5DB 3OA5A 3ZTDC 3CLWA 1NEYA 4GBDA 4ORIA 5CPSA 2IADB 4MTVA 4GW1A 3HOJA 3WUEA 2X8RA 3E2RA 1LP6A 3EYFB 2P0OA 1JHKH 2LLGA 1M3JA 1PD0A 4OCYH 4ZFZA 1I9EA 1QI2A 3BOLA 5C0GA 4TXEA 3EOAA 3TJEL 4GSUA 3WMQA 3L1EA 4W9FC 5TGBB 2UXTA 5HI5D 5FO2A 2X4SB 4QQ3A 1UD5A 3MV7E 3VKKA 2FHFA 2F6UA 2BSRA 1QTYT 2JE8A 3L3JB 1ZENA 2IMMA 2VDPH 4RAVB 2A1YA 1SLWA 1X5MA 3WUFA 3EOBA 3D69A 4M6NL 4XP9H 3SCMC 2FWOB 3HC3L 4Q3MA 1CCZA 3MLVL 4XO8A 3V4UH 1BZ9B 3OO2A 3AREB 1AKJA 5DRIA 4XNYH 3WK1A 3BKJL 1G7JA 1E42A 2DQCL 1TELA 5KUKA 3WSQL 5EF1A 5I6XB 1CMOA 1V0LA 1EX0A 1I9IL 4OKVB 1Q6EA 1RK5A 3OIHA 3Q8CA 1UJPA 1AS6A 1CLVA 3VB8A 1E6ZA 2BW5A 1OG0A 5HJLA 3UETA 2OEMA 3N4AA 5CP7A 2QQKH 3ZTEA 3ZR4A 1PG7H 2VLJD 2KMWA 1AH0A 2D8KA 4MNGA 4LUTA 1IYXA 3C6SA 4LDEB 1KYAA 2MCPL 1DSFL 2W5PA 3GVVA 3PF3A 2ADJB 2Z92B 1XFBA 2G2NA 4M1CD 4HWNA 1RHHB 1Y5WA 4TUOB 4OCYL 3V5HA 2Y7QB 5F7AA 3V4VL 1RSYA 3FPYA 5SWSE 2X1RA 4NSBA 5AW5B 2OK0L 1EXUB 2V17H 2SEBA 4RGNE 3JZUA 3AU1A 5DQJA 3MHFA 4Y96A 1AG6A 2XWJA 3KPQA 1PIGA 4AKQA 3S88L 3WQPA 3WLHA 4NAQA 1AGCA 4QHUB 3QZPA 3OLEA 3H7BA 2WXNA 4JFFA 1K3IA 4F58H 3PBYA 4OFCA 2OG9A 1P69B 2FEEI 4RDBA 5IMKA 1HZYA 4DO7A 5BNKA 1PSKL 2A6IB 1AJ0A 3I3BA 1XBVA 2IUZA 1W8OA 3CH1A 2UWEB 2I9TB 3MJ9L 3EKGA 3P6LA 1PDKB 4DY1A 5MERB 4DHGA 3KM2A 3K71B 1YRRA 4FXGC 4ATLA 4PGBA 3QDMB 2P7TA 1BF5A 3E0IA 2NVDA 1UD6A 1G0YR 4Z7IA 2QDGA 1MZYA 4DWSC 4PYHA 3IJ7A 5KAQG 3C5ZA 4ZSOE 1QW8A 3ZLQC 3BAEL 5H8MA 4G5ZH 3BXWA 1JZGA 1QBAA 1T22A 1XQLA 2J13A 3O6YX 3IGHX 3RWCA 2QBWA 2MJWA 1ZXKA 4RW5A 2Z0IA 2AL2B 4W5ZA 5EO1A 2V2WA 5DQDL 4KI5F 1K8DB 3N40F 4UYQA 3GO2A 4UMAA 3VOCA 1IKOP 4PJIA 1SVDA 3MREA 4HSQA 1HHHA 5AW4B 3Q2CA 4D7BA 2Y5SA 5IJVB 1IJ9A 5I8CB 3BT2L 1CDHA 1IEVA 2E68A 4XTIA 1BBDH 4HS6B 1KZQA 4PG2A 4U1HB 4GUJA 4YHLH 3CQQA 2PODA 4KWOA 5GRWA 5L2KB 1NC2B 2JEQA 4PJ8B 2VWTA 2DN7A 2F6AA 2Y7MA 4MZ2A 3DX4A 1MCKA 3T7VA 4XHJD 3MKKA 2CKRA 2E6PA 3C5SA 2GWNA 2GSHA 4OCXH 5FM5O 2W9LA 3S5SA 1ZU8A 3SDAA 1J1OH 2ZUUA 4LSTH 2WLMA 4ZRGA 3IMSA 4WWPA 5BZWB 1BTMA 2QZRA 3AU0A 3QMRA 4N4PA 3PJNA 3U46A 5ILTL 3PUOA 1KXTA 4B5WA 1FO0H 2J1ZA 1DN0B 4BZ2H 1D5MA 2JI1A 5EOTA 3RBSA 1KB9J 4KNTA 3ZKMD 3SUUA 4WFGE 4EUPA 4MVBC 3CL7A 1MCOL 1BBJA 1TV4A 5I1HH 3UBXA 3GNXA 2C71A 2Y7SA 3RA7L 3SGEI 2QEJA 3BVDB 2P3EA 2YXOA 3LKRA 4X6CA 1FH9A 4BJHA 5LBSH 5ISZD 5F9WB 4G9FE 1GC1H 1E9QB 1ZLWH 4KERA 1NCIA 2WWNA 4MKMA 4L1SA 3JSSA 4CVZB 1BZ8A 1NDZA 3R0KA 2DV6A 5C6MA 3KGRA 1AR2A 3QAZB 3FCGA 1TPH1 3TBTB 4NXKA 4B92A 1FWFC 4IGBA 3BXNB 1BXVA 3S6CA 4AQEA 1JCJA 1S7TB 1JK8B 1SY6H 1IE4A 4W9CC 4F1ZA 3U0TB 1S2UA 3CU2A 4E5TA 3C5JA 3P9LB 5C0AB 4NAJA 5BRZA 2CZEA 2J71A 5I6LA 1ZS2A 5DVKA 5C0CB 1KBVA 4UTTC 5CZTA 3TA3B 3IJQA 3WSUA 2WTPA 1OF2A 4NDMA 3CC5B 1Q65A 3DFSA 3A4XA 2WZ0A 5D70L 5E8DL 2NZ9C 1I3GH 3M1CA 1M71A 3GHBL 5KUMA 1SGJA 1J1XH 3HMWL 3BHBB 1PAZA 4F7EB 1XGUA 5JPMB 2NVAA 2WKJA 4LPTA 3ARSA 5REQA 5K2ZA 4UOW0 5JU6A 2CNZA 1NAMA 2K78A 2OZ4H 3QO0B 4P5TD 4PS4L 2R91A 2BS71 3FFCD 4GVIA 4D6CA 2PTYA 1CT8B 2ZUVA 1CFSB 2XPGB 1MHEB 3ZVHB 4PTUA 1BYDA 3LA4A 3IJ6A 3RU6A 2HRPH 1M42A 4JHBA 4M4PA 3ZJ8A 1EVUA 5EZOL 1EO7A 1PX4A 1QA9B 1ZSDB 3E0FA 2AJZB 2GGGA 1WS7A 3BURA 3IDNA 4MD5B 1I1XA 4ACTA 4BFOA 4R4BB 2DOCA 3EYQD 3GSVB 5DD6A 1BBDL 4ZDHB 3S96B 4LIQH 2YA1A 4L8CA 3G6DH 3ENLA 1Q1JL 1ETA1 5HGDB 5IQNA 4ZG1A 4AZ8A 1KB5L 5F7DA 3KPPB 4RQQB 1VRDA 4C6CA 2CIKB 2P1YA 4KMTH 3QQDA 4DW2H 1IL1B 2AOSA 1A0QH 3HG5A 4KK6D 4X99A 3L3IB 5EU3B 3WTVA 1KCXA 3L5XH 4RNFA 3KHDA 3OHIA 1DQLL 2D31A 4M8RA 3WL0A 3TF4A 4D9PA 1HH9A 5T3ZD 2W0UA 2DI7A 4J5NA 2VDRH 3QWNA 1G1OA 5HPCA 2CHZA 5FO8A 3UYRL 3RDTA 2P8MB 1QHQA 2EYRA 1JPGB 1GZPB 1X5XA 2W59A 1A7QH 3GM0A 4KXCA 4NQDA 5ERWA 4AX3A 3TYUA 1EJWC 3BYTA 1OM3H 4HUKB 3O41A 3NMEA 4LBSA 2E7LC 5H4ZA 2CFFA 1KBKA 4LPVA 4XRCA 4N2LA 3S3DB 3MRQA 2G3NA 4LP8A 1S9KC 1S7QA 5GGVY 5IOBA 4QEGA 5I30H 3V4PH 2DP3A 2OLHA 3U30B 5HK4A 3DAQA 5HHPA 1BQHG 2WOYA 5F7UA 4U6XA 4BA0A 4J23A 3VVWA 5GS1A 2AQOA 4KRTA 3C3UA 1H11A 1PIIA 2WZTA 4NQCE 4PRIA 5M7QA 4DZBB 2WN3A 4LCSA 2F1AA 4AWJC 1DJZA 1J9SA 1XD1A 2AF2A 1KULA 1CFVH 4GRLA 2VWEC 1CVRA 3P4MB 2V7NB 4PGCB 4IRSD 4LPUA 1BJ1H 4PRDA 2QJJA 2QSVA 3FDKA 4JQAA 2X4RB 4XOCA 4YR6B 4YLWA 2A77L 2NQJA 5FKPB 4A37A 3HBLA 4GAYB 5E2JA 1TWZA 1A4AA 3KJ4C 3RVTC 1TNNA 2AGJL 2BNQD 3CFBA 1AP2A 4HBCL 4KPHL 1Q3NA 1AE6L 1VYRA 2DUZA 4N7QA 3QTPA 1T6VN 1ZPUA 3W87A 2X4QB 3BH8B 3B8SA 3EADA 4MDIB 3OP2A 4K7PL 2HB0A 3FT4B 3PBVA 3VFRA 4GW4B 4YHZL 2QADB 1ZPLA 2OBGA 2WPGA 5DJZA 5TE7H 1F3DH 1PB0A 3L4CA 3O2DL 1DJIA 2DWSA 4O54A 4KQ3L 2AV1A 4G7VH 3S4SB 1JZ8A 5HINA 1E1FA 4FCHA 1RY7B 1EJ8A 3EFFB 4GAFB 4IK6A 4NNPL 3CSTA 3TN4A 4KWVA 1OAQH 1PKQE 3KDMA 4JFED 2HP4A 2E9WA 3VFPA 4YGAB 3UTSB 1TKWB 1SF5A 1AD9A 4HUXA 3D0VB 3DX3A 4LKXB 3RGVB 3S34L 1KFBA 4C1KA 4EK7A 4F0KA 4Z78B 1J05A 1S4IA 1QLRA 3JBG7 1ZTXH 1N6UA 2EICA 2KLTA 4WNJA 2X6VA 3F2CA 1WE5A 5E9DD 1BG1A 3QQWA 4LSPL 4K7VA 3I4EA 2EIEA 4JX4A 1KENL 2UYLA 3SOBL 4BK9A 2EPLX 2YX0A 4A05A 4M5ZL 5HVWA 3FFCA 4IZGA 3CZEA 3O6LL 5HI3D 5I0XA 3CQ0A 2R56L 4Y4KD 4Z1BA 3HJEA 4Q8MA 2Z4GA 5SWZA 1FGNH 1T5WB 3K4DA 3C6SB 3TA3D 3THQA 4C7FA 1PU0A 4UTFA 3FDGA 2QT6A 4ORMA 5SWZE 2PCXA 3FN3A 2R2BB 1IT9L 1DVQA 1VS1A 1DQTA 2ZX6A 2IQAA 3LDBB 3B9KD 3CN1A 3P2BA 4CADB 2IPUG 4I8DA 4WDIB 5DEFA 5DUBB 1YDNA 5IUSA 1FWRA 4AMCA 2XPYA 3W75A 5DQJB 3SCPA 2I85A 2CR3A 4FTDA 2BOGX 4HA0A 2ZNWA 2VN4A 3AB0C 3OZYA 1BGAA 1Z0MA 1UM6L 5GRXG 3UEQA 5LNWA 4X98B 2YUZA 4WSJA 2BNRB 3JWOL 1PBYA 1U22A 3T55A 4MIMA 4OLXH 4WQOA 5C08D 3FCTA 5C0FB 4P23D 4PJ5A 2UWEA 4OF0A 5CU9A 3U2SB 1UB6A 5ANMB 4XVEA 3DJZA 4OLUL 1GW9A 3LNMA 5GJTL 1LJYA 3FU5A 5BMFH 3MV7B 2MQCA 1OYAA 4BI6A 3PWUA 1NQKA 1BG9A 5DR5L 1CG9B 1Y6MR 4IIQC 4XCNA 4NQED 3UZQA 3HURA 4EN3D 5A8PA 1HHGB 3WAJA 3C09B 3FO9A 1KIRA 1JZDC 1BM3L 5HJBA 1M04A 4DJED 1FVEB 3ARED 1SLUA 5KAQF 2PRHA 3MSRA 3P62A 3BG9A 1ODAA 3PXLA 4HIJA 1G7QA 1X4ZA 4LDLB 5CKAA 4MXQC 3R6IA 4H88L 1HNGA 3IU3A 3B2DC 4JCMA 3BW9B 4XC3L 4CJ1A 1QPKA 2B4CC 3D2TA 1RD5A 5LSMA 3DESA 4EVNA 4HHGA 3QV6A 4LUYA 1IAMA 3QPQC 1GGUA 1YDVA 1MDLA 4MRCA 3KWXA 5DC4B 3H26A 3UESA 4AF0A 2PWGA 3KPSE 1FJ1A 3QAQA 2VN5A 2BY0A 5CBAB 5C0GB 5T8IA 3FCPA 4WI7A 3U6WA 3TJXA 4G9PA 3DVIA 5AC6A 2G60L 3SCWA 1NFGA 4JHVA 5JHDA 4YK4C 3RVTD 2OQLA 5I3GA 1F0LA 2QSQA 4JR9L 4JTQA 2AJSL 4LOUD 4CNIB 2F19L 3Q6FA 3CUPB 2HLAA 1V0NA 3GG1A 4GG8B 4TQTA 3VFMB 2APWA 4C90A 3WHE1 2UY6A 1HZHH 2F7QA 2Y85A 4MNGE 2EYRB 5BRZD 3U9UA 3HPFA 5GISL 2EVHA 4PJGA 2CO1A 2D2JA 5BZWA 2OMUB 3MTRA 2HT4C 1N8FA 2C91A 1Q9KB 4GSDH 2ZYHA 2OO0A 4HIXL 3LS5L 5JO5B 2DU2A 3LCHA 1JAEA 1NM4A 2Y72A 4HOXA 3C5ZB 1XLDA 4YTUA 1A8JH 5DJ0B 4Y8EA 3TBVB 1IXPA 2EVIA 1X7QB 5G4OA 4ERSH 1SN5A 4MTMA 3CH0A 2WXQA 5JHDD 4MMXC 2RJMA 1Z9PA 1OVZA 1BQSA 3B34A 1N6VA 2V9QA 1UM6H 3OLIA 5HHQA 1JRBA 4M7ZB 2IXVA 1MREH 5JHLH 1H6UA 1Q0YL 2OL3L 3O4OC 2LU5A 5T3XE 1GS6X 2BP1A 4RZ6A 3NEVA 4LT9A 3S3PA 2HVMA 5DMMA 1TO4A 3BW2A 3GSUA 4Z7VF 3TJ4A 3C5JB 4LU5H 4L3CB 3RWJA 1YQVH 3V9CA 3LHUA 5C0NC 1HF6A 2Q0ZX 4HUMB 4KK5D 2XGZA 2UWFA 4N20A 1F3EA 1HHJA 4IGNA 2XKNA 1ZVSA 4KNUA 2HFEA 2C3HA 4KQ4H 5CJBA 3I4KA 1NGWA 4EF8A 3X3FH 5C97A 3BLDA 3PZQA 4IXXA 4QCFA 3BHBA 4KK5C 5T33H 4QRNA 5REQB 2EG8A 5I6SA 5CH9A 1NAMB 3KYAA 3OR7A 4LS0A 2GBAA 4U1SA 4OZIB 1LF1A 4AZGA 5KYUA 3CAVA 5A6AA 2H8PA 3VXGA 1QBLL 4Z1PA 4ZUTA 4Z7OB 1VGEL 3T2OA 3TTSA 4F8XA 2H7WA 1KQZA 5IVOA 3H4FA 2F68X 4HCGA 4LOUC 4ZPVB 3NSDA 4MD5A 3TS8A 2GT9A 1ME8A 2A9MH 4KROD 1WCQA 1QHZA 4QY8B 1JZFA 3MRIB 3PDDA 1FCGA 4C6QA 1I9JH 4H26A 4OJCA 5ID1A 4L8CB 4MAYB 5IROC 4PMJA 3EKCA 3V4UL 2PYED 2VE6B 4Y19E 4EUPH 4HOMA 1BYCA 4G6FD 1BVKB 5GGRA 1OCBA 2YO3A 2COVD 3WJSA 3CZ8A 4WVRA 4JFYA 1RMFL 5HDQH 3HGSA 1LE5A 1DIDA 2VVSA 2FR4B 4HAGA 5E08L 2VGIA 3D9AL 4E41D 4NL1A 1TO3A 3VACA 4WO4A 2NY0C 4MQTB 4TSBL 4A7UA 2Z8WC 1H8LA 3NPUA 2Q76A 3FT9A 2AI0H 4IFRA 3TA3A 1WA0X 4X2RA 1P1ZB 5FACA 2BVWA 1IT9H 2OEJA 4W6YB 2JJSA 4FFZA 4PP1D 4JFFD 4O51A 5JPMC 4LNCA 1Z9NA 5C0RL 2FBJL 2W5FA 2WXLA 2B3IA 2RA1A 1I4NA 4NUWA 4FKEA 2WP3O 1VLXA 3FONA 3VXUE 2AEPL 4NZ4A 1V5XA 4QE5A 1FNSH 4K4KA 4RMWA 1P7TA 3P0GB 3QI9B 4KKLD 4LQFH 5IHUL 4PL1A 3SW6A 1OGTB 1YEKL 4MM1A 2NXGA 5HJYA 2XWZA 4O1CA 5L6UA 5C9KA 2XTJC 3L08A 1BD2A 4NGHH 4A04A 2J78A 1INDH 1G7IA 4R96B 1R47A 3MNWB 5IESL 3MJ7B 1I8MA 4AXNA 4PRIB 3T8MA 2DLTA 2GWGA 1TPFA 3LM3A 3NYZA 2PDQA 5HJXA 2J4WH 4V1YA 3NCYS 4EXBA 1HHHB 2VZ3A 2WUBH 1JSYA 4O1EA 4W7WA 1BIHA 1GRWA 1UWGL 3GSNB 1T20B 2OXHB 2CO7A 4OT1H 1WWAX 4P8UA 3MLZL 4A8NA 3SKJH 2JKNA 5F7DB 4O1FA 2DZAA 2QJDA 3GINA 1HHKA 1BGXL 3O3DA 1PG7X 4P2QB 4JY5H 4H6EA 2Q86B 5F93C 2PP9A 4OLYL 3W7PA 4J1UA 1J8HB 4LHUB 4BGLA 1S39A 1UA3A 3OGVA 1TCRB 2J5WA 1ZBVA 3B0PA 3SFKA 1QW9A 1WFNA 4WI0A 1DVFB 2BOCB 3CWHA 1DLHA 4C4UA 4RMQA 4HH8A 4WNSA 2P24B 2Y23A 4FXLA 4YBHA 2O55A 8XIMA 5PTDA 1E9IA 2XBTA 5A6SA 2Z7YA 3QEGH 3ZPDA 5MENA 3SE9L 1BKSA 3A6OA 2WOBA 3N1PC 5ALBL 3MXVL 3MKGA 3S0PA 1EZWA 2H9AA 2BVYA 4AXKA 3SD2A 4D0BB 4O19A 5KTEL 1MFBH 1VB9A 4I0KA 3H4XA 4HK5A 3C2OA 1PUDA 1TR1A 4GVFA 3FO0L 3PG2A 3EWDA 4R7OA 2YD7A 1LO3L 2NLYA 1YEKH 4OY9A 4AXWB 3PULA 2OS7A 4L1BA 4HHHA 3FSAA 2YXXA 1NEUA 4OQVA 2OPCA 1R3JB 2QLYA 4Y2DA 4AVNA 2IALA 4PI0A 3Q37A 2H9GB 4M6QA 2WQDA 4A3QA 1J9QA 4HS8L 3VH8A 1JK8A 4DQWA 1X96A 3AY4C 4HJJH 3RPBA 1NCTA 2H3NA 1Z42A 1TLMA 3QTGA 4NWTL 3PGDA 4ELDA 3RDTD 3V1HA 1L9QA 3OVPA 3BAWA 5C2BH 1FWEC 3H8AA 3G5XA 3UAFA 1NM9A 3HE7D 3T2LA 1JCKA 1R0AH 2IQAB 2EYSA 3KW8A 5ANME 3KPMA 1J5IA 4LVNB 2YBUA 4JYEA 3C2AH 5C0ND 4PRTA 3LRSA 4NQCA 3WLWD 1QTSA 4AGNA 1I0BA 1VGKA 4CCCA 3ABKB 4S11A 2CBUA 1X6UA 1UP2A 3KVKA 3EGXB 2NQ9A 2VLMD 4K68A 2J8UE 3AXIA 4UTBA 4R8WH 5DJ8B 1F1GA 5FF6B 4HH9A 4TOQA 3R25A 3MNZA 5H8PA 2DYPA 2J4WL 2XVBA 3FRUB 4TTGA 2FTWA 3UTSA 2BGNE 4W9IC 4JM2F 4GPNA 2IOOA 3ZWTA 1NH6A 2NY0D 3OG4B 3S6TA 4DN3H 1HZKA 1MCOH 2G5UA 3B97A 3GI8L 3MLWL 4Z2KA 3Q0HA 3FUJA 1FA4A 3NA9H 3QEHA 2FQFA 2OOFA 4J8QA 1GPFA 2WMFA 5AHIA 4HNVA 4S39A 1FWIC 4E0RB 4ZMZA 3C61A 3EB3A 4P2RA 1EOKA 3QDGA 3WLKX 4XUGA 3EFDL 4I1NB 3AAZB 1FN4A 1U41A 1UUSA 3RVXC 4ZNEA 1KRMA 3MV9E 1M7JA 2NWSA 3WLOA 4DNMA 3S46A 3Q44A 4ZJ9A 4CVXA 1EGJL 4O18A 2CUHA 4OM0L 2QJGA 3R4DA 3T9PA 1NGQL 1US3A 3SY0A 5E9DB 3ME0B 4H0HB 1F07A 4AX7A 2XG9A 2I9LA 5IMMB 4DZIA 2QFRA 5I82A 2VUYA 4LVBA 4OCRL 1G7QB 5FKPA 5KVDE 3MR9A 4GW5B 4NFDA 3RIAF 2YD6A 1KLGB 2ICWJ 3BW9A 3V0EA 3WNMA 4LX4A 2GZXA 4AQOA 3FVMA 4DEFA 4ZQOA 2WQSA 5KSBA 2Z34A 4EBQL 1KNWA 1LROA 3TYGL 5CSRA 4BYHA 5TDOB 3U7YH 1JYNA 1U42A 2K8QA 1QLFB 3PTDA 4JB9H 1XM3A 3IKCA 1CTNA 4ZPTB 3L9CA 2DL9A 3ABZA 4FNLL 3L0KA 4EF9A 2QR0B 1I9CB 3DHDA 3ASNB 4RKAA 4Z7WB 2X0SA 3UPRA 2XWEA 4IQHA 4NIKB 5JZ7D 2C79A 3JTBA 4N8VB 2CHXA 4JE4B 3K1KC 2CRYA 2J6EH 5IY5B 3O3EA 1O6VA 3GHUA 1VGEH 2QGBA 3DRQB 1ZWIB 1UT9A 3LCIA 1XD0A 4X8JB 2BIPA 3N0AA 3VWKB 1QO3B 1RSCA 4HNTA 5HMSA 2D4FA 4YHOL 1KFCA 1RVFL 2VEMA 3MP5A 3QFJA 4UT9A 1FKWA 1ESOA 3ZOAA 3TIDB 2I27N 1RZIA 4G7RB 3GSQA 2CU0A 3GFUA 4WJ8A 3NDZE 4J2MA 4UTJA 5EFFA 4UTMA 1W5QA 4AYMC 2UWEE 2XQBH 2R2HB 5CILH 2XZAL 4HK3N 3IWUA 3NZHL 2CE6A 3GDLA 4DQAA 4V28A 4PULA 3K4AA 5GNYA 2XX0A 4EE9A 2E7CA 5LIXX 3NG3A 4OZHA 1YE6A 4HKBA 4ROPA 1PL3A 4GG6F 3E0GA 4EI5A 3M5VA 4ZGYA 1OFPA 2VCBA 1C7SA 3SIZA 1UEMA 3T0CA 2DMCA 4EN2A 2ZOKB 4RBPH 3VD9A 3DETD 1YYLH 3FU7B 2YCLB 3DLQR 3QQ3B 2YAQA 3QNXA 3NSXA 2QCHA 5C09E 3O2VH 4ZTPL 1G1CA 1QLRB 1R3TA 4I1RA 2ZWYA 3A3WA 3G1YA 3BARA 4M48H 3G5ZB 4HTBA 2J7CA 1AQHA 3O6FB 4AG4L 5ID0B 2XA3A 3H3PH 3J2PA 4KMQA 1BOGB 1GZQB 3MRHA 4NNYA 3PR2A 2UY6B 3MRCA 5AYQA 1CXLA 5HP5A 4MNQA 1C8XA 1JL8A 1FE8L 4PD4J 4F20A 1AG1O 5I71C 3HN8A 2AKRA 4NXSA 3FNDA 2B7QA 1RIVH 3NL3A 1IT0A 2NW2B 3KVDD 4D0CA 1HDMB 3WNJA 3KL3A 1J0IA 4JM2A 3IFOB 1CIUA 3TBYB 2VDNB 4DVBA 4ELKA 3FUNA 5KMYA 1BYAA 1ZRQA 3KVPA 1UTDA 2B5IB 4FZIA 4JDEB 2QQ6A 4DRSA 1YEWA 1V7ML 4JEQA 3G6JF 2WJZA 5T1DH 5FA3A 1A3LL 2FWLB 1BV8A 4WY7H 3U0PB 2WXFA 4O13A 5K9XA 1XF1A 4NM8H 2JKEA 4XKYB 1NGPL 5D05A 2KZBA 4FTVA 1TV3A 3VVVA 3VKJA 4RX0A 2Z7WA 1ZZMA 4B41A 4JJOA 2E9JA 4GINA 2LE9A 2V2TA 3DV6A 3BZ5A 3IJYB 2WCAA 1QEXA 4WEBL 3G1HA 4EIBA 3VC5A 4EWND 4V27A 2M8XA 3FOLB 1W32A 4WUUE 1X5IA 4EZJA 3L1OH 4GBXA 1M6JA 1P0BA 5IFPA 2AEWA 4LCIH 1AO7B 4KVNH 4YFEA 5E1QA 3HPLB 3E0WA 4HSHA 4ZYKA 4TSBH 1KPUB 3O0KA 5JXAL 4P5SA 2XLLA 3PAOA 4US5D 5AVSB 4WSGA 1H49A 4DKEH 3QCTH 1SEBA 4B6ZA 5ISZB 5FF6A 2RGLA 1BPLB 5GXBB 2W61A 3SN0A 3C6LA 3W3OA 3P11H 3ZKND 2M2DA 4N8UA 4R85A 5EBWB 4NLAA 3ZE2F 1OTTC 4Q4MA 4Q4QA 3W7LA 5FF2A 1GZGA 1XIHA 1PLAA 1MRFH 1M6OA 3Q2VA 4UQEA 2IWEA 3P0VH 5JOFB 2GVLA 1INQB 1DP0A 4XP9L 2JKLA 4NT6A 3W57A 5D6CB 5BOZG 2CLEA 4HJSA 3Q2DA 3TZNA 4U33A 5KSWA 1M05A 1CLOH 3IVUA 1TSHA 3RL1A 2DJUA 3NSJA 3PC0A 4HEMA 2DQUH 5AW1B 1LQ0A 1N0LA 2Q7AA 4I5BB 6PTDA 1DL7L 1NDYA 1MH5B 2FWUA 3FYOA 3US0A 4MAYD 3CVHH 3TT3L 1UZ8A 3IAQA 3TROA 3QPKA 4UQ2A 1A7RL 4FNSA 4K8GA 4DT2A 4O1DA 2UZPA 4DPAX 3OJMB 1CJYA 2X0VA 4LU0A 3ISWA 5M3WA 2DQGL 1QQDB 1GG0A 5AOLA 4I6KA 4HCFA 3AXHA 3CV5A 4DK5A 3GK8H 3V8OA 3QOKA 1P4CA 2HKFL 4PG9A 4YSSA 4FLSA 1WTLA 4QHKJ 2Y63A 1BOYA 2F5AH 4H0GA 4DP4X 4OD1H 2FBRA 1DQUA 4P2YA 4GC3A 4LSQL 7CGTA 2A6NA 3ATZA 5FD0A 3B9KA 4PE8A 1T2JA 4PQXA 2EH7H 1TTCA 2R0WH 1IBBA 4DP8X 2OQJB 1RUML 2W9EH 1IU1A 3HFFA 2WQUA 1VFLA 2HTKD 3D07A 5E00B 4GUFA 4K5PA 1RJLA 1UD2A 3MBWA 1IGCL 3CEPA 3D5OF 4GBUA 1S5TA 2JKXA 1UXWA 1QSFE 3VXOA 5A2FA 4XAZA 1L6XA 4Y4KA 1MEXL 1QWUA 2F58H 3R18A 3WJLC 2D3LA 2V7HA 4XCEB 1YDOA 2QCDB 3I7QA 1I8AA 3AG4B 1AKJB 1S9XB 3CN4A 5I0ZA 5TAOA 5KYXA 5CIPH 3Q06A 4QTIH 2Y1YA 1LRNA 3RILA 1SFDA 2WKGA 1NSNL 3ZKNC 2VTFA 1F6PA 5D1XB 2WHLA 4L9LB 3GAYA 3VUPA 1R3QA 3N2MA 1ZHNA 2F58L 2JCCF 3PWGA 4GISA 2BSSB 1ILUA 2WY3B 2XACC 3JTTB 3G7TA 5C09A 1ICTA 3VKAA 3LZ5A 2HFGL 4ZOBA 1PHQA 1E2VA 1RAKA 3ARFC 1TPEA 3MI2A 3N2JA 3EOAB 1X6LA 1AMXA 4UNTA 3G6DL 1X5AA 1W1ZA 3RB5A 4BSWB 3GI9H 4M1GH 4AJYV 3FCSB 2EE2A 2PDUA 4C83B 3WD0A 5E0FA 1KMGA 1Z89A 3WS3A 1QNQA 1AC6A 4FI7A 2WZPD 1BYOA 3RI5F 4KS0A 5E70A 3CFCH 2M83A 3UO1L 1P6FA 1OFAA 3JVAA 2R4RH 3GMNA 4L4OA 1KCUL 3NDZA 4YPGB 4X6CE 1R9FA 1FZJB 1RUAH 3FH8A 5E6ZA 3ZT5A 1JG9A 2QKIC 4DQOH 5A2KH 4I2XA 2GDQA 2J75A 1SXCA 4OVVA 2IAMA 3FT1A 4R0LA 1FX6A 3KG5A 3TN0A 1V0MA 5JNYA 5I3HA 4L3ED 3STZA 1JJUA 2WQRA 3ZL2A 5E6SB 5EZLB 2PR4L 2CNCA 5IBUB 2TRSA 1XGRB 1BIIA 4N8CL 1IBHA 5IJKC 2BVPA 4TF4A 3U25A 3BJLA 1YEEH 4O58H 1XICA 3GG0A 5E0CA 5EBUA 1CGSL 4P4KD 2RJHA 2G2PA 1N2RA 1RVGA 3TBBA 4KOBA 3SDXA 1FC2D 1TJ0A 1RK0B 1R75A 1W6LA 2WINB 5IJDC 4IMAA 4TQIA 5LBVA 2AJVH 4AQAA 4TLUA 2YXFA 4HHAA 4RMBA 5C0BD 4LVFA 4YDKL 3V5DA 4DUOA 1FWXA 4ZMTA 1J88A 3BZFA 4BA8A 3B43A 5M03A 4W89A 1YXCA 5KZCD 3APNA 1RK1A 2D7TL 7XIMA 4I4WA 2B1OA 3NSFA 1FG2A 1K6QH 4PRHB 5IB5B 3WY3A 4Y9CA 1EC9A 1XX9C 1Q85A 3GH5A 3QCTL 3O6KL 3OKOA 3S9IA 3CZUB 1NWOA 2ZNXA 3US9A 1CDGA 2ZE3A 3NCOA 1FAIH 3CHOA 4N6FA 4AZ6A 1CFTB 2R39A 4JHUA 4NWUH 4QRAA 1TTJA 4BFIA 3BLOA 3BIKA 1VH7A 5ABDE 3GRWA 3A9BA 1FCUA 3NIDB 3CJPA 2YR3A 3V5OA 5CHNA 3QEHB 2OMBA 3MUAA 1UVQB 2YPLD 4G72B 1EYWA 2WQXA 1PAMA 1FH5H 4G8GD 3Q67A 5F96H 4NNAA 3UVAA 2EZ0D 2OJPA 1I0DA 2VD9A 1DORA 3W2DL 4QNPE 4HPYL 1FWDC 1VLWA 3WD1A 1J11A 2JLPA 3FUHA 3L2IA 1ND0B 4J2PA 4XN8A 1TZGH 3MWAA 3TWAA 2P42B 4UM9D 4JPIB 4J3XA 4L4LA 5EMMA 4UV4H 1THCA 2GKIA 5I15H 4PJ7E 4US5A 2YQ3A 3UTQB 2XU2A 3IXAB 1CLCA 4PTVA 1EEZA 3VJ6B 1HJWA 3KWWA 1K8YA 4IP5A 2E5BA 5C7HA 4D6HA 4ZMVA 3RX8A 2ZKMX 3K2KA 3LHZA 4BWTA 4P8QA 5DMKB 3QBTB 1JWSA 3NNTA 4JTJA 3ZT7A 2VX4A 1JZ4A 1DJNA 4Q56A 1G7UA 3RRAA 5BCAA 4NYLA 4GIRA 4OHQA 2ODHA 5G5DB 4UIKH 4UNKA 2D73A 2ABAA 3CXHJ 3RWFB 3BI9X 4XMWA 5LBSL 2GJPA 2I14A 5ECGA 4F0SA 3GWJA 2ITCB 4K7FA 1KFAH 3K91A 1JNHB 2YCEA 3L54A 2IQ9L 1A5MC 3RFRA 4L0ZA 3SQOH 1YEEL 5JR1L 2OGYA 1OCWL 4M19A 3CL6A 2HLFC 2V5YA 2RAMA 1J0JA 4K9JA 1F97A 2E47A 4Y5YB 5LQBL 5DS2A 3KPSB 3FSTA 3BPOC 5C7XH 3CL8A 4FGMA 3R06A 4MS8D 3N11A 3THUA 4UT6A 5IK3B 1TREA 1FDZA 1XGUB 2ZWLT 5HYEA 5MP6L 4H83A 3GE7A 2XPZA 3G5XB 5I3DA 3U7VA 1M2OA 1T04B 2IWGA 5CMAB 3WJLA 2WVUA 5D7LE 4WW1A 5LWYH 1PZ5A 1MFMA 3H55A 4YSTA 5T1KB 2WNQA 3JV0A 1RALA 4MCMA 3PTKA 4QITA 2ED7A 3NSYA 3U9WA 4DBUA 1V6XA 5EWIL 1T8XA 3GSOA 4FIQA 4IGBB 4ZR8A 3ATFA 1A7RH 1XIIA 3TCEA 5DJDB 5GS2D 4EOUA 1GVOA 4Z3JA 2R1WB 3HE7C 5FCSH 1KC5L 1WAEA 5HHME 3HZ3A 1YECL 3DSNB 2ZOKA 1NEZA 3MV8D 4MJ2A 4PJHB 5DHYA 1X7FA 3ARFA 3Q2WA 2Y36H 3CIQA 3EMZA 4DP7X 4JO2L 2V82A 3K1GA 4GRWF 4AMWA 1RZQA 5E99L 4OLZL 4JAMB 4KITB 2IG2L 2DDQH 3ARWA 3GHPA 3KNBA 2I60L 5CC3A 4B95C 5JPMA 4GIOA 5BWFA 1D2PA 3T71A 4XZ4A 3QRBA 1GZQA 3MRHB 1LJMA 4GMSH 1F73A 1KM4A 2A6IA 2EIJB 2VZVA 4X4KA 5CCGE 3MOQA 3IACA 2FX8H 3IFLL 3CPGA 3NQ2A 3SDAB 3WFCH 3DX9B 4G59C 5ERWB 2HG0A 1DXIA 2XVNA 1ZVYA 1UWXH 4M6NH 3OGRA 4U0RC 2ANUA 1U6AH 4GUOA 3K6IA 1QO3A 2J43A 4TQEH 2Q8AL 4Z0SA 4I13B 4IP4A 1PFCA 1RZPA 4RMSA 1JGEA 4A7SA 4KHTL 2X05A 5TDNB 2KAUC 3WJMB 2D0GA 3O2WL 3H42L 4NJHA 4Z7OE 3LKRB 1DBJL 1N3NB 5CGBA 1W0VA 5K1VA 5D7EA 2GI7A 3CFEA 4Y4HB 1IARB 4MBRA 1FFNB 5IROA 3RR4A 3CFTA 3GBDA 3QV9A 3ORJA 3KLSA 3P8IA 3T0AA 1AHWB 1MDAA 1CI5A 1KGXA 3QJTB 3RVVD 1OIOA 1UH2A 4UNUA 5B1CA 1O7DE 3DX8A 3P9LA 5C0AA 5DMIH 2D23A 1AQ0A 1HCFX 4UM8B 1JULA 1BQUA 2VXQA 2VDQH 3QIBA 1PWMA 4JZJB 4ONGL 2NR6D 2IBBA 5D1XD 3D9AH 3LX9A 3UW6A 1OGAA 3VXSB 4G6AD 1GZ1A 1TUFA 2JCWA 1V7AA 4EAMA 3K80A 5ELIA 2N3JA 5L8JB 1ZAJA 4HIIB 4ONHA 2DI8A 1BKHA 3E9UA 1E6SM 5FGBA 1TV5A 5KVEE 2OWWA 1F00I 3W2NA 2ITDB 4UUJA 2XTJD 3MCLL 2CHRA 3IVKB 1A53A 2YRZA 4ZMLA 1EZLA 2CKBL 3VFUB 4JYDA 3PM6A 5CFAA 1A6ZA 4ZX3A 1WRFA 2QQLH 2Q02A 4S2SB 3SSGA 1R8LA 4QGCA 4FFZH 4R26H 2CXGA 3RPMA 1XC4A 3TO4A 1QI3A 4YAQA 4UT6L 1MUMA 3EAKA 5KBLA 3LN5B 2YEZB 4JO2H 3KYNB 1XCXA 1UD8A 2DQFB 3ISRA 3BN9D 3O6MH 4JHAL 4OUUB 4QT5B 1DTUA 4TLSA 4M4RA 5F1IB 4ZUVA 4ETQA 4HDIB 5DYFA 5IFAH 3FQYA 3TCTA 3UA4A 3W7GA 5GGVH 1AP2B 3FGCA 4G42A 2KDGA 2YXVA 5IBXA 5E6UB 2PC8A 1Z7AA 3HZKB 4OSUL 4W86A 2VWEE 3OXSA 3S8FB 3GGWA 3TCLB 1XZ0A 5DURD 2NT1A 4X9SA 1KLUA 4PTTA 5L4FA 3KW3A 3HG0A 3W5MA 1KF9B 4F2MB 3TJIA 3CH1B 4AIEA 3TYDA 1ZHLB 5KANG 5DEGA 5HDLA 4OF8A 1RURL 2W65B 4WI2A 1I7UA 3BMXA 4KHTH 4IFKA 3DO7A 2BRQA 1A2YB 4WSHA 3MRMA 4Q9QH 1MIEH 5D1QA 2CO6A 4X5QA 3RITA 3WO8A 2X6BA 1LVEA 2HTLC 3KXFA 3N42B 1ZANH 1URZA 4H25A 4ODUA 3N91A 4UQ9A 4XBEL 4BKNA 4J3UA 4YHNA 3P9WB 2EE3A 3UTPE 2CXEA 2PDIA 4JNZA 1IGIH 4FJZA 3L5IA 3SQOL 1UW9A 5JDSA 4DHLA 5L0QC 1OO2A 4LHUD 4NKMA 4U5IA 1EYEA 1QX1A 1VESA 3QJHB 4HCRH 2B7DT 2X87A 1OARL 4DZBA 4LSVH 1UB6B 5ANMA 4BUHA 4XD4A 3WH9A 1HE8A 3F7JA 4AH7A 1R3LA 4M43H 3TLQA 3NIFB 1RZ7L 3U4BH 3W23A 3RJXA 3P3YA 4J4PC 1YECH 3IDJB 4KV5E 2V2TB 3HMJG 1HQ4B 3ZE1F 3O2VL 1DJGA 3DXAE 2ID5A 2ZYIA 3VXNB 4JS3A 4U05A 5FESA 2VHLA 2F54B 2PTZA 4B15A 3ML9A 2HVKA 1WT5A 2ZUXA 4PGDA 43CAB 5IV2B 1JRCA 2P8CA 1GYVA 4MZ1A 4KO9A 5DUBA 3BUDA 3FKRA 1K9TA 4ONOA 4ZQMA 5JHLA 5EY5A 2Q8ZA 2A5HA 1IAKB 4OZGE 5CCKL 1GHRA 1OZUA 3QO1B 4LAJH 3SECA 2JFEX 3NQKA 1LM8V 1BQLH 2A9BA 2BW4A 1I7ZA 2OTUA 1G4RA 3VGHA 1W8NA 4QQUA 4XC3H 1RZ8A 3ZKSD 1JGIA 1J93A 4AYSA 1A02N 2D1ZA 4P5UA 5I1LA 5KOMC 2FNBA 1M2VB 2W1NA 3M0LA 4IMGA 1BBJB 4ZAKC 2AJYH 2P4AB 1OTTD 1CGUA 3HNSL 5FWQA 1GHFL 3MODH 1W1B1 3QXVA 1V3LA 1X9QA 3OJDA 3MACH 1O9WA 3V4PA 4APXA 1FNHA 1QR1A 1TKKA 2PF8A 3SQBA 3C52A 4S2CA 4F2EA 1RY0A 2GJXA 4UILL 1CL7L 3ABOA 2DWXA 2X6CA 1C12A 4FG4A 4ZXBB 1E9PB 2DZUA 4U4MA 2VLRB 2XZ7A 1BD2E 3MRBA 5EZJA 2PPAA 2FJKA 1I9IH 3HIZA 3P4MA 4YHPB 2CKBH 1YPZA 4HIJB 1GNXA 3M5ZA 3EYOA 8CGTA 3URNA 1G1KA 4YLQT 1I1AB 3T0EE 2DZEA 2NR6A 2ALRA 2G4GA 3LCFA 4XKMA 3S2AA 1CUOA 4DELA 5CU5A 1ONEA 1S9WB 4NO2B 4ZO8A 4ZODA 1OG6A 1XBZA 1WG3A 1N0XL 4LRNH 4QS6A 2X2YA 5EBAA 4J3WA 4PJDE 3MFGB 2P8LB 3UJFA 1SO6A 4MY9A 4JRYB 3C87A 4ODBD 5GGTH 3WMLA