1MFVA

Probing the role of a mobile loop in human slaivary amylase: structural studies on the loop-deleted enzyme
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
b'EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-amylase, salivary
molecule tags Hydrolase
source organism Homo sapiens
publication title Probing the role of a mobile loop in substrate binding and enzyme activity of human salivary amylase.
pubmed doi rcsb
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mfvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mfvA01
4PTXA 2FHFA 1GOIA 4HP5A 1GOWA 4J3WA 5BWFA 2VUYA 2ZX7A 2WVVB 4BS0A 1U30A 1TVPA 3DDFA 4UCFA 2BS9A 5A2AA 2DDXA 4CVUA 2O92A 4QFUA 2J75A 2D3LA 5I5RA 5ECUA 2JEPA 5JUVA 4JFWA 2EPMX 3OZOA 3WKZA 1J0YA 2X2JA 4PMRA 2BV9A 1HP4A 4F9DA 2F1AA 3FN9A 3CIVA 2WMGA 4J3SA 1XD1A 1XRVA 2F7OA 1D7FA 3ARQA 4AD2A 1BSIA 1CXFA 3AI0A 3K46A 1HKIA 3CLWA 4PBGA 5HDRA 5A94A 4FNRA 4OUEA 2W66A 1KQYA 4AEEA 2J7EA 4OOZA 3ZQ9A 1MYRA 3GH5A 4LX4A 3UG5A 5DMYA 4D6FA 5BRQA 1EOMA 2E40A 3AXHA 2E9MA 5M17A 1U33A 3MI6A 5ABFA 3PTMA 2E9LA 4JFUA 3PBGA 3ARZA 1HL8A 1J10A 3AXIA 1MFUA 3RJXA 1GUVA 1W1PA 3W81A 2FGLA 4PRWA 4UFMA 4ATLA 4NX0A 2NSXA 2CBJA 1UR4A 4R27A 5D9NA 4J28A 1TVNA 3MUZ1 2YA2A 3QHOA 3TTSA 4U31A 4AZ7A 1T0OA 2EPOA 3PZOA 3MUIA 1R47A 4WKHA 3OLEA 1JZ6A 1W2PA 4AZCA 5DF0A 3RILA 3ARPA 1LL7A 5TD4A 1XC6A 1HJSA 4BQ4A 1JFHA 4AMWA 1JYNA 3ZT5A 1UR2A 3WNLA 2EAEA 4DUVA 1PZ2A 2PB1A 2WWDA 2UY4A 1D2KA 4UOJA 3FHQA 3L4ZA 3WUEA 2GUYA 3WF4A 2E8YA 4FLSA 5E1QA 4JHOA 3AHZA 2ALWA 5D9MA 3JUGA 1OINA 3VM5A 2W4XA 4WF7A 4UFHA 3ZOAA 3EDJA 2WBKA 4H8HA 4MB3A 4J3XA 3WNKA 2WYSA 2DH3A 1IT0A 2XG9A 2ESCA 2CKRA 1V3HA 3CUGA 3CUIA 3RO8A 3KL3A 1MW0A 1ZJAA 4DM2A 2VO5A 1UR0A 2CEQA 1ISWA 1BTCA 2G4FA 2D0GA 4UQBA 1SMDA 4BA0A 3OIHA 4Z2IA 1ODUA 3HJEA 4OJYA 4M80A 4P7QA 1LG2A 3VGHA 4NRSA 3HG4A 1HKMA 4ATWA 3EDKA 1E43A 5DT5A 1OGGA 2YL5A 3HG5A 4C7GA 1ISVA 2HVMA 2VL4A 2JF7A 4P7NA 2QPUA 1ZBKA 1HNYA 4LYQA 3WEZA 1KGUA 4JZ5A 4PUEA 2DSVA 2GJXB 1JZ7A 1BHGA 5A6KA 1FFQA 1Y7VA 4H04A 3QHMA 3LXCA 3HMCA 3VU2A 4URIA 3N1AA 4HZ6A 3MMUA 1C8QA 3J7HA 4PSRA 1OBAA 3AOFA 2WW5A 1B3VA 1UZ1A 1EHAA 1QHOA 4WKAA 3VDHA 1VBUA 2J47A 3ARSA 3WQ6A 1JGIA 5F7UA 1HN1A 4OZOA 3RCNA 4AIEA 4B3KA 2E8ZA 2PBGA 1MQRA 1EHNA 4CCDA 1FA2A 1W9VA 1CXKA 4AC1X 2WKLA 4XB3A 3VGFA 1MW1A 2DT2A 3WNOA 3L4YA 2OWXA 4P7RA 4HPGA 3PZMA 2G3JA 2EQDA 4AZGA 1F4HA 2D22A 5EFFA 1BYDA 2JF6A 2VRQA 1W9XA 2DPEA 3AHVA 4GKLA 2WK2A 3AXXA 2VVSA 1C7SA 3VSVA 3WY2A 1WDRA 4GZIA 4Z2KA 1JF6A 5LA2A 1KWGA 5IHSA 1E6QM 2C7FA 3L4UA 3O2LA 2BVYA 1H0IA 4F8XA 4S3KA 2XWDA 1PBGA 1J9YA 3SUWA 4HA4A 3PZNA 4MB1A 2XWEA 2B31A 1XCWA 2BY1A 1JI2A 1DWAM 2O9PA 1E5NA 2V3EA 3LXAA 3HG2A 1WDPA 3WH6A 2XN0A 3VX1A 2WSKA 3GXFA 4PSPA 3WDJA 1ZU8A 3DYMA 3SUTA 1H0GA 1L8NA 4KGLA 2EBNA 3MANA 2WVUA 2VCBA 1QHPA 5D8WA 1PEZA 2DT0A 1J0JA 1W1VA 1TQVA 1KWKA 3IAQA 3MSGA 2QPSA 3VIKA 5E09A 1UQYA 5A6MA 1HJUA 1WDSA 2W63A 3BLKA 3WH9A 5A8MA 1GQIA 2XVPA 5C71A 4FMVA 1JI1A 1WZMA 3MUAA 2VOTA 2BVTA 3CZ8A 2DT1A 3MUY1 2WC7A 1OT1A 5A1AA 3PZ9A 3VD5A 5CGMA 2JIEA 1V0LA 1WDQA 2CYGA 4E8CA 4YHEA 1NWTA 3UESA 4GIAA 3TTOA 4HOWA 3WF2A 4Z2LA 2WSPA 4UTFA 4R5EA 2ZUWA 4P7OA 4PMOA 4D71A 2XPKA 3ZSTA 1HJXA 4FK9A 1K9DA 1SMAA 3PZUA 4PMZA 1QI5A 3MKKA 4HZ8A 1XSIA 3WFLA 4IISA 3VSUA 5BXPA 5JBDA 2Y4SA 1KR0A 1LL4A 2IXUA 1WAWA 4RE2A 1E6PA 4UQEA 2VC9A 1ISXA 1L0PA 1JNEA 3O9NA 3A4XA 3SCUA 2DEPA 5CLTA 2XSAA 2OW7A 4FF5A 1VEMA 2BY0A 1WKYA 2J77A 4J7RA 4ZE4A 5KZ6A 1JAEA 3OLGA 2GDUA 2V5DA 5D8ZA 2VT0A 1H2JA 2OLHA 3A6OA 1GHRA 3WNNA 3F4VA 2WXDM 1DHKA 1GJUA 4AZHA 3OGSA 5DEZA 1JD9A 3PZVA 2Y24A 1ZBVA 3BVXA 4OIFA 3BAJA 3U57A 4MPKA 4PMUA 1GZJA 3QOKA 1IZKA 3FW6A 1HIZA 2F7PA 2X2IA 1QNOA 5GNZA 4XZBA 1CLXA 1JYWA 1X6LA 5A8NA 3EMZA 4PCTA 3A21A 3UEQA 5CQ1A 2GK1A 3WELA 3A5VA 2BHUA 2CHOA 4KGJA 2G3IA 2X0YA 1ZL1A 2XM2A 3NSMA 1VFOA 3CHCA 2VCAA 2X2YA 3BXWA 2QMJA 3BSGA 1VAHA 2FE0A 1DEDA 3CGTA 1QNSA 3D51A 3L4WA 2DSWA 1HL9A 4Z2HA 1H41A 2DH2A 1QI4A 3II1A 2A3BA 3T0DA 3LRLA 2F61A 1XH0A 2PI6A 1DWHM 3WSUA 2ZX5A 1QNPA 2VURA 4PMVA 2ZXBA 2ZWYA 4HMDA 4ACZA 1CXEA 1B3WA 2XFYA 5CPQA 2VRKA 4PYSA 3VM7A 1E6NA 2OYLA 5CPSA 3BLPX 1R33A 3BMWA 2W67A 3F5KA 4AYSA 6TAAA 3E1F1 1AQMA 1E3XA 1ECEA 3A3HA 4F9JA 2XHYA 3CUFA 5GNXA 1NP2A 1XV8A 3VIGA 3DX0A 3AJ7A 5C70A 1CENA 1NQ6A 3PTQA 3VIOA 1KQZA 3RIKA 4F79A 4JL1A 2FH6A 1OIMA 2ZOXA 2J79A 4P8XA 3DYPA 2GJPA 4HMCA 1UKQA 1OWQA 4QAWA 4BQ3A 4Y7EA 1UWTA 1MFVA 3BSHA 4J3UA 3SCVA 5D4YA 1KGWA 4M81A 1R8LA 4M29A 3FY1A 3ZM8A 2VR4A 1WB0A 1EDGA 2UY3A 3ZJ7A 3WQ4A 3NSXA 3WDPP 3K4AA 2WZIA 1G94A 3CZKA 5FCZA 4U5IA 3OBAA 3WDQA 4TTGA 3WQWA 1BGGA 3VDCA 2OYMA 3BLBA 4UNIA 3WDIA 2VQUA 5BXRA 1GCYA 1O7DC 4W85A 4JAWA 1OCQA 1LF1A 4HPHA 4AWEA 2DSUA 3VGEA 1VENA 2DT3A 2XSBA 7TAAA 4W7VA 3SCPA 4AD5A 2UY2A 1V3KA 2EACA 3S5ZA 5FD0A 2RGLA 2Z1KA 5I77A 1OD0A 1BYCA 2WMIB 1JZ2A 4DO4A 3WMBA 2DSZA 1QW8A 1HTYA 3F5LA 2WZEA 1B9ZA 5GQBA 2GJXA 4M82A 3MU7A 1EDQA 3K1DA 4PTWA 4UQDA 1E6XM 5EBAA 4M8UA 3HZ3A 5CSYA 1FHDA 3CV5A 2AOSA 2X09A 1ZS2A 1E0XA 4DWSC 3WH7A 4KMQA 4V28A 4XUYA 1R7AA 3KLLA 4U2ZA 7A3HA 1C7TA 1HKJA 1UD4A 3W27A 1KTCA 3VO0A 2E3ZA 1XD0A 4W5ZA 3VGBA 4M24A 3FXYA 2WKGA 2D23A 4P8UA 4D6HA 3VGGA 3VIIA 1E40A 1GQLA 4NZJA 3CHFA 2VMFA 1EOKA 3VX0A 4AD1A 3LPFA 2RGMA 1NOFA 3AZTA 3QGVA 3NSNA 1WZAA 5KEZA 2GDVA 3SUUA 1JAKA 2J62A 3LMYA 4UR9A 3D4YA 1DWJM 1TG7A 3WMCA 2E9BA 5IDIA 1H5VA 3BUPA 4W7WA 5A2CA 3QHNA 4RE3A 4YHGA 4QCEA 1J0HA 3A24A 5A2BA 3ALGA 2J7DA 1D3CA 4MNLA 2OWWA 4M56A 1JG9A 4W8AA 4D6IA 1KXTA 2QF8A 3S6TA 3UCQA 2G8ZA 3PN8A 3GNPA 1H49A 4W5UA 3VINA 3GZAA 2WHJA 1JNDA 1M01A 1BG4A 5CG0A 1C90A 2AAAA 3SEPA 1HJQA 1E4LA 1HXJA 3HU7A 1QWNA 1QVBA 2CBVA 5LYRA 2PWFA 2Y2WA 1W1TA 5A6JA 4JKLA 3KEHA 1UYQA 1DWGM 4PEEA 1JZ4A 2WMFA 1EH9A 2J25A 2ZXAA 1Q4NX 3ARUA 3WL0A 4WK9A 3T09A 4FLOA 2JALA 3VD7A 1H3GA 1BAGA 3W4RA 1A3HA 1I1WA 4U3AA 3LRMA 3ZIZA 8A3HA 4AW7A 4H7VA 1E6SM 5D9OA 2V3GA 3EYPA 1K9EA 1W9DM 2YL8A 5D9PA 2ZX6A 2YJQA 5HNNA 1QWUA 1FH8A 2V38A 3VD9A 2BXZA 2X2HA 4KH2A 5JIPA 1HKKA 2EXOA 4C7FA 3BUBA 4MDPA 3VVGA 3IJ9A 1GQJA 2F1BA 2E4TA 1UD3A 3D4ZA 3TV8A 3VIJA 3N15A 1B90A 3W28A 3MMWA 3LXBA 3AQUA 3CPUA 1F4AA 3POHA 1WE5A 4AIOA 1DWFM 1JDAA 4Q7NA 1J12A 4TVCA 1GORA 4MAVA 1CGVA 4MB4A 4ML4A 1KGXA 2BY2A 2FGZA 2OYKA 2VZVA 4CD4A 8CGTA 3W26A 4JHZA 3SCOA 1V3LA 3KE0A 2A3AA 3WQ8A 3H55A 3BVVA 1NWSA 5I2UA 4BQ5A 1H11A 1VBRA 3BAXA 5BXSA 1Q6FA 4PN2A 3AHXA 4NSBA 3ZMRA 4EANA 2VI0A 1UD2A 4GINA 2ZUSA 3A47A 1NH6A 1ITXA 4WJXA 3VD3A 3GXDA 2CNCA 4HZ7A 1JZ5A 1V0MA 4B9YA 3WEMA 2EPLX 2QV4A 4PUDA 3N11A 3G6LA 2D24A 1M04A 5ABFB 1E70M 5A3HA 2FDMA 5M03A 4A3YA 2EADA 1UWSA 4EKJA 1NOUA 1PZ3A 2YDRA 2VNCA 4CKQA 1CLVA 5EMYA 2EPKX 1B0IA 2PWHA 2IXVA 3ZT6A 1O6IA 2XIIA 1GHSA 2GK1B 4Z2JA 1RPKA 3M7SA 4X9YA 4UFKA 4AMXA 3CTTA 3OGRA 1UOKA 3ZJ6A 5HOSA 4W7UA 1GONA 2FYVA 1B3YA 3MMDA 4AZCB 1OGBA 4UZSA 3CUJA 1ZBWA 4ACYA 3EJSA 4CD5A 2YFNA 4J27A 4TX8A 1QPKA 4TVUA 2VZUA 4A4AA 4P8VA 5A8PA 3BCDA 3NYDA 1WNOA 2VX6A 5CLWA 1V6WA 2XVNA 1WZKA 1UA3A 1AQHA 4ACZB 1S46A 2C0HA 2VZTA 1ITCA 2O9RA 1C93A 2YA0A 4QP0A 3WUFA 3D52A 3WFZA 5AYIA 4GXPA 4D6JA 3SCNA 4PMYA 2D0HA 3OB8A 2F7QA 2QLYA 4MB5A 2YA1A 3VIHA 1UD8A 2BXYA 3CZLA 4V2XA 1TFVA 4PMQA 1B2YA 3EJPA 1CTNA 4WLCA 4QLLA 3PZIA 4H41A 1KCLA 3N17A 3MSDA 1ZB5A 3VMOA 5E9AA 1CYGA 5DFAA 3ZO9A 5DO8A 4P7LA 1CGUA 3OA5A 3VKKA 2QHAA 2D20A 4W88A 3ZJ8A 3EDDA 4TXEA 1LJYA 1PAMA 1KXHA 3AYSA 1V6XA 1W1YA 1NWRA 3AFBA 1QNRA 4QCFA 2AMGA 3VILA 5BCAA 1RP8A 3TA9A 3GBEA 3MV01 3UERA 1DWIM 2CBUA 4GO8A 1KBBA 1Z32X 3K8LA 3DECA 3DHPA 1PIFA 1CGXA 1VJSA 1GOMA 2W91A 3MS8A 3PHAA 1JYVA 3KWXA 1PX8A 3WQ5A 4PMDA 1WPCA 4WKFA 1ZBCA 3AIEA 1E71M 1VFFA 2HISA 3AHTA 3N13A 4CU8A 3WY3A 2ZUNA 1V6UA 2WMJA 3S5YA 9CGTA 4AMCA 1HP5A 2YDQA 1UQZA 1EIBA 3EDEA 4MADA 5E0CA 4EAMA 2WHMA 4NXSA 4Z2GA 5A8QA 1ISYA 3WF3A 1JZ8A 2ZE0A 5I23A 2J8FA 1W32A 3EDFA 1VFMA 1R7OA 1OT2A 2BY3A 2XTKA 1E4IA 1UKSA 1CWYA 3SCTA 4W93A 4CCEA 4HA1A 1UWQA 4UFLA 1GVIA 1BFNA 2EEXA 3RDKA 1MQPA 4NZCA 2ZUUA 1KXQA 1E0VA 1HX0A 1EO5A 1US3A 1JXJA 5I79A 2WLYA 2X0HA 1ODZA 3KL0A 1UG6A 1OGSA 2UY5A 1UD6A 4NRRA 2XGBA 3NDYA 1ESWA 3AS1A 1BGAA 1C8XA 1SYTA 1V3JA 2YKKA 2XFRA 3AMCA 1MWOA 3UG4A 1R85A 4DUXA 1OD8A 1V0KA 3IANA 1JFXA 1NOWA 4L4PA 4AZBA 4JFTA 2J8GA 1E0WA 5EFDA 1CNVA 3W0KA 3BVWA 3VMNA 1GOQA 1B30A 1UR8A 1R34A 3ZR5A 2NT1A 4FLRA 4H8VA 3LPOA 3CUHA 1TA3B 4B15A 3WUGA 4B9ZA 1V3IA 1BG9A 2NW0A 1FFRA 2YBTA 1NWUA 3EJRA 3APGA 3NDZA 3B9EA 5CXPA 4BZYA 4RE4A 4A3HA 4OBRA 3G6MA 3CZNA 3OLIA 3WEOA 2MANA 1BLIA 2XYLA 2CCRA 3VD4A 4FNPA 3VGDA 1C92A 3BUDA 3NJ3A 4HMEA 3WNPA 3ARVA 4KRUA 4HU8A 2JIWA 1V0NA 1X6NA 3WD1A 4XZWA 5BYWA 3DX4A 2O9OA 1WP6A 1EGZA 4FNTA 3K4DA 1GOKA 4D1JA 4UQCA 4DWSD 2J78A 4IPNB 4MNMA 4GPNA 1KXVA 5HPOA 3OZPA 1WZLA 2WVVA 2VQTA 3LX9A 3BUQA 5E6YA 3WD3A 1VFUA 4D6CA 1HWWA 5I3DA 1WO2A 1CEOA 1QOXA 3AZRA 3U7BA 5IHRA 4L4OA 1PIGA 2G3NA 1C91A 4K68A 1JZ3A 3GM8A 3BAYA 1RH9A 6CGTA 1JDCA 3NIYA 3D5HA 1V08A 3WH5A 4BQ2A 2PWEA 3MV11 3D50A 3WF0A 4X0VA 1U2YA 1UR9A 5BRPA 3PZGA 1O7AA 1X1NA 3CMGA 1GJWA 1QI2A 1E15A 1BYBA 3BC9A 4U33A 4CU6A 1Q6EA 1YQ2A 3FAXA 2XM1A 5FL1A 1E72M 1V03A 3ARWA 3H54A 3T2PA 2VZSA 4DUWA 1PS3A 3IJ8A 2Z1SA 1SR0A 1W3KA 1WCGA 3RMEA 1JIBA 5A6BA 1A47A 2D0FA 2VZOA 3DC0A 1TR1A 4B3LA 2FH8A 4NZFA 1XHGA 2WC4A 3POCA 3W82A 1E73M 2XGIA 3VIPA 4E8DA 3CZGA 1XH2A 2WCAA 2J74A 3U7VA 3EJQA 4D72A 2WNWA 3RPMA 2D3NA 3WD2A 1IZJA 2W5FA 3FNDA 4UFJA 3CMJA 1CIUA 4AIUA 1V02E 2YL6A 4CN1A 2WC3A 2XVKA 1K9FA 1BVZA 3K8KA 1M7XA 4AD4A 4ZEPA 4ZENA 5BXTA 5A6BD 1NP0A 1R87A 1TQWA 1PJ9A 2J7CA 2F7RA 4U2YA 4CN6A 3PZQA 2XVLA 3BGAA 3PZTA 1EQPA 1J18A 1B3XA 3WDHA 3AHYA 4CCCA 1QW9A 3VNYA 3GYCA 3IAPA 2J7FA 2YL9A 4J3TA 3VIMA 3LPPA 1FH9A 4ATDA 3BAIA 3GH4A 1UZ4A 1OIFA 2DIEA 1TQTA 3CZSA 2YDSA 3UR8A 4LQ1A 2WPGA 1UA7A 4FLQA 1UR1A 1SFSA 3VPLA 5HXMA 1DTUA 1MW3A 4CN4A 4AZ5A 2OWCA 2CXGA 3U5YA 5HBFA 3W6MA 1CZ1A 3S2CA 1J01A 3ARRA 4J3VA 2VX4A 1M03A 1OM0A 3T2QA 2ZXQA 4LPCA 3EJTA 2ZX9A 5E70A 4IM4A 2DGAA 5A69A 2JE8A 4MDOA 2XJ7A 4TTUA 1FH7A 2W61A 5GNYA 5JBEA 2GVYA 3VSTA 3SCWA 3VIFA 3GXTA 4Q22A 2WCGA 3EMCA 4ZXOA 4JKMA 2W62A 3GNOA 3U5UA 3AROA 3WQVA 3AS0A 1HF6A 1EXPA 4NF7A 4YPJA 3QOMA 1J0ZA 1TE1A 2YOCA 3AMGA 1KTBA 4DO6A 4LYPA 3HG3A 4DWSB 3T2OA 5DT7A 1CPUA 1G5AA 4ZE5A 2WZHA 3THCA 3WBAA 4CD8A 3OGVA 3W25A 3L4TA 2WWCA 1E6ZA 3BCFA 3ARYA 2C8NA 4WSKA 1V3MA 4MNJA 2WLZA 1E6RA 2GSJA 3RM9A 4N42A 1EA9C 2PWGA 3IK2A 2YIHA 1UWRA 1KBKA 4FNUA 5AC4A 5A8OA 5JIWA 5I0DA 1CECA 2G3MA 4DM1A 3AIRA 1G0CA 3B8SA 4GO9A 2WMIA 3SURA 1CGTA 1KCKA 1G01A 4GZJA 1TQSA 4KWUA 3AIBA 1NARA 2ZUTA 3GXMA 3L2LA 3DHUA 2YLLA 3FHAA 1UUQA 1KFWA 3TTYA 2ZWZA 3WIJA 2TAAA 3TONA 3RM8A 2ZXDA 2VTFA 1MVYA 2WBGA 2BNJA 3CZJA 4IUGA 2IGTA 4PMNA 3GXIA 4U5KA 2VX5A 3WL1A 4BF7A 1V6VA 4JCLA 1Q6GA 3ZJKA 2DQXA 2BHYA 2A3HA 4AZ6A 2NT0A 1BQCA 2IUZA 4OOUA 1G9HA 1H09A 3CC1A 1BVNP 1EDTA 4GI6A 5AYBA 1XYFA 1XSKA 5HPCA 1UH3A 2J4GA 2O9TA 4NI3A 3FAWA 1VJZA 2BVDA 1UD5A 1BPLB 3AICA 3LRKA 1E4MM 1HJWA 2VCCA 3WMSA 1R75A 2WM0A 3B9DA 4F66A 2J7BA 4OBSA 1UH4A 4AY1A 4JL2A 4E4PA 3W6LA 3IGUA 4JFVA 3F5JA 4PCSA 3I3EA 1CBGA 3NCOA 4UOQA 3VMPA 5AC5A 1SZNA 4UZUA 3N04A 1XH1A 3UG3A 3ZR6A 1N82A 1UWUA 3A4AA 1HJVA 3BAWA 1RD6A 3WD0A 1G1YA 4D6DA 1KR1A 1JD7A 2CITA 3L4XA 1K6AA 1LL6A 4QLJA 2JFEX 3AS2A 4AEFA 1VB9A 1AMYA 1W3HA 4MNKA 3KL5A 1ZJBA 6A3HA 5JBFA 1PPIA 5CPTA 1QI0A 3SIMA 4CUCA 1R46A 4DO5A 3DYOA 4LYRA 3GH7A 4AISA 1XGZA 3WH8A 5AY7A 1TA3A 3VOCA 2Y8KA 2VJXA 4XV0A 3GDBA 1MXGA 2A3EA 4CD7A 5ABHA 1E3ZA 1MW2A 2DIJA 1CXIA 1LG1A 2YBUA 3AMLA 4MJ4A 5FKYA 5BROA 5FIPA 1QNQA 1VEOA 3CO4A 3N12A 2GJRA 4ZXLA 1LQ0A 1JDDA 3HN3A 1K9TA 4B16A 3ALFA 2YFOA 3WY1A 4TOQA 3A22A 3SCQA 1HXKA 2BHZA 1GW1A 5ABEA 2J7GA 3BH4A 2VX7A 3AZSA 5IFPA 2OW6A 1H1NA 4WSJA 1UKOA 2VR5A 2EABA 2PBOA 4OGZA 1MQQA 3VUPA 4H2CA 2VRJA 5C8BB 1QHZA 3ZT7A 5CSUA 2X1IA 4GI9A 2XN1A 3BMVA 1LLOA 5I6SA 3CH9A 3M6DA 3TP4A 3W29A 4HU0A 5LA1A 3L2MA 4CU7A 4JIEA 2ZX8A 4JFSA 3KZSA 2ZUMA 2YLAA 4S3JA 4AD0A 4JCMA 1QBAA 1UKPA 3DDGA 1V6YA 1FOBA 4D6EA 3AIUA 2QMKA 1QBBA 4W8LA 1CGWA 4P8WA 5A6SA 5IFTA 7CGTA 4W89A 1W91A 1W9BM 2D1ZA 1TCMA 4EK7A 3VDBA 4RL3A 1OB0A 1R86A 3GXPA 1YHTA 5CJ5A 1FP9A 1UKTA 1B1YA 4AZIA 1I1XA 1GQKA 2F2HA 1E55A 3WF1A 1GNXA 3DX3A 3VTRA 2V3DA 2CBIA 4HA3A 1E1EA 2XFFA 3DX1A 4D6GA 4AD3A 3TOPA 1HT6A 1W3LA 1W9PA 5A6AA 3BVTA 4W8BA 2WANA 1ISZA 3ARTA 5M3WA 3PTKA 2D73A 3KLKA 1BYAA 1UHVA 1OSEA 3T0AA 3WBEA 3LPGA 1TUXA 1E9LA 3W53A 4NXKA 5IXEA 4GQQA 3CBWA 3BAKA 2FHCA 3EBVA 3BVUA 5EB8A 5GPRA 3CZEA 4QDMA 2XVGA 3L4VA 2UWFA 3O6AA 2PWDA 4TVDA 3OLDA 1AVAA 4WIWA 1Q6CA 2XIBA 1W3JA 4ZFMA 2WCSA 4LXFA 2V3FA 4D1IA 2DSKA 3N9KA 4N0RA 3AMKA 3DX2A 4UQAA 2BFGA 1HVXA 2EJ1A 2CIPA 3BUIA 4YN5A 2OSXA 2WAGA 4TUFA 2OSWA 1XCXA 1CDGA 2ZUVA 1I75A 2WVTA 4CVWA 2OSYA 5A95A 3UR7A 4EE9A 1QX1A 4MAZA 3SUVA 1MXDA 1J0KA 1JXKA 1P6WA 2WHKA 4LGXA 4XX6A 4M1RA 2G41A 3UETA 2CKSA 3QR3A 4HOXA 3AYRA 1E5JA 1E4NA 2EPNA 3WNMA 4MTVA 4OKDA 5E6ZA 3EMQA 1VIWA 4W86A 2J7HA 1GPFA 1PX3A 2F8QA 4FNSA 5CGTA 3W38A 2CHNA 4TX6A 1E1FA 2CERA 1V02A 3WY4A 1W2VA 4IPLA 1C3FA 5M5DA 5FL0A 3GNRA 4BCEA 3T08A 4C7DA 1TQUA 2WMHA 2Y5EA 2ZIDA 1J11A 3K8MA 3WDRA 4FNQA 2PF0A 2XN2A 2D2OA 3VNZA 3W37A 4DWSA 2Q8XA 3W24A 3T0BA 3A4WA 1Q6DA 1UWIA 1CXLA 1M53A 2W92A 3D3AA 5ABGA 2X05A 4HTYA 2A3CA 1W9UA 4X0NA 2XUCA 2ZICA 3MO4A 1B3ZA 3AIVA 2Y8VA 3M07A 4HOZA 4MJ2A 5CZKA 3AISA 1UASA 5E0FA 4W87A 3NUKA 3WN6A 2CPUA 3I3DA 2X8RA 3WD4A 2E0PA 3A23A 3AS3A 3OG2A 1IV8A 3CHDA 1TZ7A 4CD6A 1C8YA 4QLKA 1XSJA 2V5CA 4PTVA 3WENA 2F18A 1AQ0A 3CHEA 4GI8A 1VF8A 4JKKA 4UQ9A 4AYGA 1J0IA 1KB3A 3THDA 4AXNA 3RJYA 2WHLA 4E2OA 4V27A 1E56A 3GTNA 3AMDA 4UOZA 4GZEA 2PC8A 1B31A 1FP8A 3SCSA 3AIWA 1EO7A 2CESA 1VEPA 3AIQA 5LA0A 3IJ7A 1QI3A 2WMKA 1BF2A 4CGTA 1UH2A 3EJUA 1GOOA 3RM4A 4PMXA 3ZSSA 2JEQA 1CGYA 1VRXA 1FHLA 1JL8A 3H53A 1HVQA 3VDAA 3SCRA 2FHBA 4H8UA 3TTQA 5I78A 3B9AA 2EO7A 3ECQA 4U3CA 1JYXA 5A6LA 1LWJA 1PX4A 1XYZA 1H4PA 3ARXA 3I3BA 3WUBA 2WVSA 1EQCA 4KRTA 3N18A 2VVNA 5FOOA 1TMQA 2GFTA 1GVYA 1RP9A 4PTMA 3SUSA 4UFIA 1US2A 2WB5A 3GBDA 5I24A 1DP0A 1JF5A 2CETA 4W84A 3GXNA 1LWHA 1NM9A 4GQRA 1CXHA 3M46A
chains in the Genus database with same CATH superfamily
5INDB 5C0IB 3SDCC 2FHFA 4DF2A 4HLEA 3AU0A 4A22A 2IQ9H 3LHPL 5HJ3A 3GDTA 1N64H 4L8DA 5AB2A 1ZVYA 1ZLVK 1YMMB 3WO4B 5FIEA 1LLWA 2OO6A 5AWNH 2WJDA 4BS0A 4MFHA 1NCCL 3WTTA 1D2OA 2DDXA 5HHMB 4BH8A 4KMTH 1BECA 3ECBA 1SLUA 4WCJA 3RPKA 2V67A 1CFQA 3GC4A 4AC2A 1PCKA 2D3LA 2J75A 3OTRA 1JCLA 3OVQA 1OZUA 2J21A 1IWBA 4XO3A 2YPKB 12E8H 2VL5B 3WJJA 2P5ED 3Q2VA 4S0SD 3WS6C 1KN2H 3KM2A 3JXAA 2GT9A 5EU6E 5CWSB 5T1DL 4EF8A 1Q0YL 3EFOA 1ICTA 3M47A 1NCHA 3KR3H 1J0YA 5DURB 4G9FB 3ZLQC 1D8WA 4KEZA 5GRJL 4Q8NA 1Q7ZA 1KJMA 4I89A 2BV9A 1HP4A 3SO3B 3T81A 4P0DA 4ZW5A 4JQIA 1QLFA 1SZEA 3NOEA 3U4AA 4M19A 4XXDA 4J3SA 1XD1A 1XRVA 4E8DA 1CBVL 1WS7A 4XMKL 2V5JA 4JZOB 3LZFH 2I1OA 3TS8A 5H37H 3VDGA 3VKJA 4OD3L 1XF4B 2XN9A 1K03A 1EO8H 3G5EA 32C2A 3BEWA 2PDPA 4ZAKB 4QXUH 4XCEB 1MFDL 4PTTB 4ZUVA 1P4IL 1F7BA 3QH3B 4X8CA 5TDOB 2R1NA 5DXXA 1FNFA 4JFQA 1ADWA 1FHVA 4PV8A 1U8JA 5JPNC 3E74A 2IH9A 1XYCA 7REQB 3E6FA 1KQYA 3F04A 5HHNA 2EIZB 4AEEA 4PL1A 3LQLA 1JWUB 5IHWA 3QSTA 4WXZA 1T7XA 3OPZL 3TBSA 1M56B 3SFKA 4F0SA 4LX4A 4KV5F 1L7IH 4KFZC 2YGNA 4H9TA 3V0DA 1ETA1 3QG6A 3J8F7 5GIRA 5ADOL 2FT7A 3RAJL 3RX4A 1K6QH 1LUCA 1Y0LA 3FU3A 3P11L 3CBKB 1TVHB 2EIBA 3ORWA 2E7CA 3AXHA 4C5YA 4AKOA 2YLHA 3Q2NA 3MV7E 1LLZA 3MI6A 4WWNA 5MHBA 3PTMA 2E9LA 1N6QH 4NQEB 2HTLD 4HVXA 3F2CA 1BM3H 1HL8A 3TBVB 2OODA 3WIJA 5HSFA 3AXIA 1Z7JA 2R6OA 1BXBA 3D2TA 1X6UA 4NI6A 4TRPL 4DEFA 1S38A 2IDFA 1K70A 1AQDA 2ESVD 1KPUA 4R27A 2EILB 4M3PA 4UTWC 1BQRA 4FFZL 1A3LL 1WAAE 2I26N 2WXOA 1N8WA 2FLRT 2PTWA 3L81A 1I0DA 4P2QD 5FSDC 1KB5B 2QQLH 2GJJA 3UBXB 1WD8A 1JRBA 2IADB 3QHOA 2AL2A 1LP9F 5IWLC 4AZ7A 4E9WA 5I02A 2DTSA 1T0OA 4BE6A 4MMZA 1TZHA 3T2NL 2GLKA 1UCBL 4G5ZL 3ZK0A 3MZNA 1ODAA 1ZLWH 5KW9H 5INDA 1YYMH 4HSQA 5DRNA 5KS9B 1UFUA 3B2UD 4PJHE 5HY9A 3V1HA 3LAFA 4DJFC 1RZJC 1W2PA 1EWHA 4YC2C 4AZCA 4TLUA 3ARPA 5IEKB 2ARJA 1M65A 1AD9B 4WWKB 5TD4A 1FZJA 2GZXA 2D7PA 2W3ZA 4QJ1A 3MLUL 4BQ4A 1VFBB 3AFLA 4JO3H 1QRKA 1JYNA 3ULVE 3L3KB 1SW0A 1EZLA 1ZSHA 5DS2A 3WNLA 2NUYA 2APTA 2ZRXA 4KIEA 1A2YB 1FCBA 4R96B 3MYZA 3CL7A 1AKPA 4TVPH 1NEPA 3C08H 3D3VD 1M9SA 4HC1H 4IJTA 2PB1A 3RE0A 3UF9A 2V7HB 4HNCA 5I76A 3EYOA 4F7CA 3DV4A 3NQ6A 4NJGA 1NGXB 1T4KB 2R7EB 4ZMWA 1DQUA 1J05A 2NCMA 4GRWH 4LCYB 3AHZA 4NB7A 3ERPA 4F5CE 4WFHE 2PTVA 2WXRA 4EZJA 4JJHA 3T0EC 2ICCA 1TTJA 4ODWB 4AV4A 4X22A 4A67A 4UFHA 3FJ6A 2ADGA 3GHRA 5LB1A 5I18H 5I1DA 5EKYA 2WBKA 3T4YB 1TVBB 1A3XA 1OJXA 4X7SH 4Q9QL 2FZDA 4QWWC 1XF5B 1DANT 1EPXA 4IMAA 5FYJE 3SFWA 1OEZW 3WIHH 4PV8B 3PWVB 1IT0A 1JCTA 1ZQ5A 3PFRA 7REQA 1SEQL 2XWTB 2A4EA 2BOFX 3CUGA 3CUIA 1VQTA 4H2HA 3RO8A 1PB0A 1IUZA 3KPOA 4OT1H 1ZJAA 4NPYA 2FL5A 1QD0A 4C83A 1J5TA 2ZWKA 3KPPA 3UO1H 2CEQA 4Y1AD 4S2CA 4HUMB 3F12A 4UQ2A 4FL4B 2G5UA 3MLWL 1AFSA 2DEYX 2PRHA 2P76A 2LVEA 2MCPH 5GIRB 1SMDA 4P59H 1T5XB 4LCVA 5C92A 4WI8A 1EERB 4YSDA 2J6VA 3QIBA 4LALA 1OAUH 2BP8B 1TQCC 2EICA 5L8LB 1N4XL 1RBAA 1MLBA 1ZGLM 2VDGA 2ODHA 3N25A 4IHBA 3VGHA 4NRSA 2ZYSA 4GKNA 5HGAA 3HG4A 3L7EB 2PDYA 3W1AA 3ZLFA 2NX5D 1GC1L 1RVFL 3EDKA 3QZNA 3QBTB 1NGPL 1UB6A 2JELL 4HPYH 4MJMA 1TF4A 2O4MA 3KYMB 4NVTA 2WXHA 3P3RA 3ZE0E 4F9PA 2C3ZA 2XIOA 1E9QA 1VGEL 1MFEL 3EHBC 1ISVA 2HVMA 5HHXL 2C6QA 4P7NA 4HALA 1QATA 2W0KA 4OM0L 5MHSE 4Z08A 3CPLA 1S9XB 3U1PA 1NLDH 3WKML 4UMBA 4DBUA 2DKSA 3Q0HA 4PUEA 1EUAA 4HHAA 4N9EA 3X11A 3GIVB 3CSFA 2FIRT 1QFUL 5C6TH 2IDUA 3UGEA 4QNEA 4ZCWA 5A6KA 1Y7VA 5ALBH 1AH4A 5K9KB 5EEWA 1NEUA 3HBQA 4TKWA 3I4EA 1T03L 3LXCA 1F3EA 1ADQA 2X4NB 2FZMA 2PDWA 2AQTA 5C0AD 3LSOA 4TVPE 4WTZG 4Y4KA 4LVNB 1I2NA 1C8QA 5JHDD 3J7HA 1VPYA 3BQ6A 4PSRA 1A3RH 1OB1B 1UEYA 2DBLH 5IBXA 4YXLL 3RWHB 3LKSA 3IXAB 4N24A 2DWDB 5HAOA 4ZPVA 3VDHA 2Z35A 1WUNT 1AKJD 1AFVL 1ASOA 1RV6X 4WO4D 5D70L 5DC4B 3UZQA 4AM0B 1TJ2A 3BH9A 2PLTA 3K6IA 4DGYL 1KM2A 1X96A 3RCNA 4EXKA 2PPDA 4AIEA 2F2KA 2NUPA 2XOTA 3WK1A 4BFJA 4PUUA 3HG1E 2R2BA 3T0EB 1MQRA 3VYLA 5D30A 1PYFA 1RBOB 1CXKA 4JY6A 4K5PA 4ELMB 1DXIA 3OKDB 3OKNB 1ACXA 4L29B 2L7UA 5ICXB 3GVVA 1NGWB 1TKWB 1OFBA 4PJHA 4XE0A 4XB3A 3KLDA 3SDAD 1MW1A 4HZ1A 4PY7A 2DT2A 2OT0A 2OT1A 3OXRA 3WNOA 1U9KA 2X2GA 5HNTA 2V4LA 2BSTA 4RVBA 3BZEA 3TH6A 5EZLA 4KDVA 4LCYA 3E6HA 3TC9A 3ZDXE 1AXTH 4S3EA 1Z8AA 1O5KA 3MC5A 4BK4A 1XGYH 4FA3A 4H7CA 3T0VA 1MCJA 2Y5QA 1MJ7L 4HJ0D 4HWEH 3PQYD 1HHJA 3HV8A 2R69L 3HHRB 4IRJA 5KOMC 5DFVC 1RHFA 1BYDA 4XHQA 2ICSA 1OF6A 1UM6H 4HSOA 1HEHC 2I60L 2YLKA 3ITCA 4ERAA 1XGDA 2WQVA 1BM7A 4UT6A 3PGFH 2N0KA 3W2DH 5I8KH 4RKAA 1XO8A 1XDMA 1UA6L 3K74B 1QUPA 3WGUB 2VDPH 5C7VA 3KWVA 1XUUA 3GGWB 4KI5D 3W56A 3F7YB 1FIGH 3RLUA 1CCWB 1B0WA 5PAZA 1EHLL 1GSKA 3URBA 4MNHA 2AFNA 4HCRA 5DCCA 1H3XA 4NAQA 3IU3B 3MCKA 4KAQL 4CADB 1E6QM 3UXLA 1PKOA 1SNRA 3E9UA 3SY1A 2WOYA 3F62A 1W56A 4P57A 2HE5A 4GY1A 2IPKB 2F54A 5F7WC 3GXUB 5DJ0B 3NCMA 4KO5A 1YEHL 3L3DB 1SXCA 3FTYA 4GKNB 5HGAB 3AGVA 1EFXA 1U3HB 2XWDA 3PJSB 3TT3H 4S3KA 1XAUA 1ONRA 3G77A 1WFUA 5HDLA 5HYIA 5HJGA 5E1HB 2BB0A 4YHYB 5E2TH 1FWSA 2V6AA 3I6KA 5D2LB 3TEWA 1O9WA 2JJSC 4CNSA 5GJMA 1JI2A 1GS6X 1DWAM 3QQ0A 3KWWA 1TTRA 4MG4A 1CT8A 1C29A 1E5NA 2V3EA 1RUSA 3QKZA 1WDPA 3BUYB 4HKZA 1S9XA 1EEQA 4CVXA 1BWVA 4E41D 3VTTA 4IJCA 4O8AA 2YQGA 1DJXA 3WDJA 2EYSB 4I1RA 2XNAB 4OD1L 4Y16B 1H0GA 3DVNB 2ILLA 2BWDA 2GHWB 3EBAA 4N0CC 4YHLH 5ID0B 2WVUA 3LV3B 2Q20A 5EO0B 4LAKA 3UGVA 5D8WA 2O1AA 2QT3A 3TT1L 2Y3NA 3QLLA 4YDNA 2H6RA 1NDGA 4JS3A 1K4DA 1LRNA 2KAUC 4GUGA 4CSSA 2VDQH 1JMXA 3K71A 3W0WE 1W1VA 1DANU 1TQVA 2J8OA 2HX7A 4JY8A 3ZYJA 4NJKA 4ONHB 2QPSA 1XIFA 3LKSB 4N0UE 4CBPA 3PQYB 3VUAA 3W1NA 3GVQA 3DOIA 3CFDB 2XY1A 4YSPA 2X3CA 1HJUA 2ZDRA 3BLKA 1MJJA 1YNKH 3N0PB 1GQIA 1Q9LA 5C71A 1LBMA 5FF2A 1A5AA 2B59A 4IRSD 5EU5B 2XA8L 4X60A 2FWUA 7ODCA 5KMYA 1I1YB 1ZXQA 1I8UA 2HX9A 3HE7B 2VOTA 3MU3A 4NENA 4RDQF 5FUOL 4ELMA 4OIAA 5ICZB 1EXHA 2HPIA 2PN5A 2Y1VA 2XIMA 3MV9D 1OT1A 2P8MA 2CIKA 2JCWA 3DOHA 2HMIC 1EJSC 2GJNA 2H90A 5A1AA 1AO7A 4F3HA 4UWMA 3HS0C 5F2FA 1K02A 1KBJA 2JIEA 4JY5H 3NAVA 4WDWA 4ODTL 3BZFA 2B1AH 4L3EE 4APQA 1R30A 4P2YA 4C58B 1H7PA 2DDQH 2ENJA 4YE4L 3WZ0E 4LC8A 4HIXL 1BGXH 1IGML 4A7UA 1NWTA 1QCWA 1BMGA 1L7IL 3M9YA 3FU8A 5B39A 5ALCH 3UWEA 3HFYA 3LVTA 3TA6A 3BT0A 1HHJB 4U1SA 1W54A 4R7WA 2CHWA 3MNWA 4FQHA 1CS6A 5KVEE 3NZSA 5FF0A 4UMSA 5HGBA 3HE6C 3FCGA 3MBWA 1A7NH 2Z6IA 1LM8V 2FEEI 4OF8A 4M6QA 4PODA 3V9CA 4PJ7E 4QS6A 2VN4A 4TV6A 1F58H 5I1HH 4D71A 1HJXA 2D9QB 2R1WB 4QSHA 3FOLB 5TDNB 3MLUH 2FX9L 3VCLB 2G60H 3NZQA 2V7NB 3S35H 3AAZB 4S2BA 1NBYB 1Q94B 3TH4T 3L3HA 2DQJL 1N7KA 5T33L 3RITA 3EZJB 2HFEB 2P1FA 4IISA 3M45A 2QUNA 4PWKA 2PGEA 2EUXA 3C08L 3NO3A 5IBXC 1LK3H 4BKLA 3KJ4B 1PEWA 4BYHA 3I9IA 2OYPA 1LL4A 2CXEA 3IDGA 1F9CA 2OELA 4ZMLA 3D4GA 4LVEA 5EC2B 4ZQTA 2DYPD 4XMUA 1S39A 4Q9RH 1SFTA 1TZ9A 5ENLA 4NGHH 8PAZA 2Y7OA 4ZE5A 1SEBA 1JXGA 1D5BB 3L2NA 3QDJD 1JNEA 2DZPA 3BQUA 2AJZA 3S2MA 3GU2A 2XSAA 4KQ3H 3STBA 1FWGC 2VR6A 4RZ5A 5FECA 3RDTB 4GBDA 2PCXA 1VEMA 4JKPH 4I5XA 4NPKA 4YVNA 1N6QL 1QOKA 1AGBA 2J77A 4J7RA 1GOFA 4F3FA 4XVDA 5KZ6A 4WFHD 1A1NB 4B3VA 2YMXL 4Z7AA 1JULA 5FI8A 3UJTH 1H2JA 3IJ6A 1YECL 1DO5A 1U8MA 4Y1AB 4ETQB 1X38A 3RWDB 5ABDE 3A6OA 2OLHA 1JHKL 4O1BA 2AI0L 5ID0A 3S36X 3W9ZA 1LXMA 3ARED 3F4VA 1XH3B 2WAQA 4A3RA 1PTDA 1QLRB 4QUOA 1YMHB 2V9TA 3T2LA 5DEZA 4KXCA 2ACSA 4QXGL 4JTJA 4UT9L 3RVWD 4GG6B 2YQ3A 4JN2A 5FUZH 2J6EH 4M6MH 4P5SA 3MRLB 4KXAA 4CBZA 1L2UA 2FJFA 1Z44A 4YL4A 3FU0A 1GZJA 1HOCB 2A74B 3NRPA 3TLRA 1JERA 3KPLA 2X4UB 1N4XH 2NNAB 1MJJB 3PV6A 4WI2A 1QUMA 4MM1A 1UZGA 3D69A 3E80A 3H2QA 5D93C 1QNOA 3RWGA 2E75C 2O5NA 4YAQB 5D8JH 3A64A 3GC2A 4OTXL 4NIRA 5GNZA 4JM2D 3TJHC 1OGAE 5E99L 3QB7C 5DUPH 2B7PA 3KTCA 2ALAA 4R4NC 5ETUA 2OEMA 1K2DB 3VXUD 1CTMA 3FTGB 2ATSA 2CGRH 3QCTH 3S3BB 4HUVB 2Z2AA 2EEBA 3N6JA 1MDLA 3MZTA 4LASH 1AO7B 4IBLT 3CU2A 3VXSA 5AB9A 3EGJA 4DBWA 4GYFA 1XGTB 3WO3B 3MA9H 1OZMA 3TTEA 4H9YA 4B5XA 4AOFA 1PKQE 2GBAA 3LMJH 4FZ8L 1R5IB 3T65B 1T7LA 4PWHA 4RAVB 4GYBA 4XMWA 1FH5L 1ZL1A 2X0YA 2E76C 3SIKA 3DGRA 5GSVB 3KYKH 4FQLH 5BRBA 3S5OA 2ARJQ 4XZ4A 4WK4B 4GRMB 4RMRA 4PI2A 1U6AL 4U0RC 3BXWA 3M5YA 3S9ZA 4P9MH 5FO9B 2FE0A 1DEDA 3UZEA 2AXGA 4OF7A 5IVXF 3CGTA 2ADFH 3MOAH 4C47A 3US1A 1LE9A 1I9RH 5HHQA 4E0RB 1YKWA 2EG6A 3S34L 5K4XA 3MRNB 5C0FB 4XPBL 3MCMA 4X7SL 4Q9QH 1P5UA 2DSWA 4Z2HA 1SRDA 2DH2A 1QI4A 1K3IA 2VM9A 3II1A 3G6JF 4DGYH 4F5CA 1U8LA 4HLZH 2QCDA 1NAKL 3ZL4L 1AR1C 4HSAC 2YLLA 1IXPA 2PI6A 1NMCB 4YHZH 1CTOA 4IZGA 3ILQC 4Y2LA 3CVBA 3E6EA 2Q9OA 1TB3A 1JPTL 2Y06L 3GT6A 4LLYA 4V1DB 2UY6A 3UC2A 3PAJA 3QZ6A 2ZWYA 4JO4L 5CSGA 1ACYH 4G5AA 2ZC1A 3BV7A 3SGKA 1AJZA 2NTFB 3BWSA 3UTOA 5D7JD 2MUCA 1PY4A 1WQVT 3KPSD 3Q1SH 4HUWB 5F96H 1B3WA 2XFYA 2AJUL 2BIOA 1V7YA 4O1FA 3W9DB 1Q5MA 3TAOA 4IOIA 1AXTL 4PYSA 5LNSA 1IARB 1L9PA 3VM7A 1RQ5A 4ZFZB 1AD4A 2AEQH 2KH2B 5EO1B 4QT5A 4NFCA 3RDTA 4DXVA 3RWJA 5F3BA 3BMWA 3W7IA 2OTUB 5BZZA 2FPYA 4GRLA 3PSWA 4I5UA 2JB6A 3BSZH 4HS8H 3TYCA 2YXGA 4FABL 3FEQA 1VGEH 5GGRY 4MXQD 2BP3A 3E1F1 2GB2A 1ECEA 4L1BA 3TO2B 1EB3A 1B4EA 4LRSA 4NC1E 3MUGA 3UWZA 4QE1A 4DEUA 1JGEB 2Z3FA 4F9JA 1BVLB 1NMAL 3JRKA 1B9BA 3RTQB 2J73A 2XHYA 3NCCB 2XIDA 2Q71A 4BELD 3L54A 1IJ9A 1WWBX 3P4OB 3VFPB 1XV8A 3VIGA 3EUDA 3SO5A 1U5HA 3DX0A 1XFCA 2DW7A 3VXRA 3N42B 1AKJB 4Y16C 1CENA 3KPLB 3M17B 1NQ6A 4G1NA 5B38G 3K13A 5B7ZA 4AMAA 3RWGB 4Z1PA 2PCEA 3PUDA 2ED9A 4OLYH 1PNDA 2CLZA 1Y0EA 2X70A 2Y70A 3QJHB 3FKRA 3M0IA 4KTDL 3FN3A 1UCWA 2X3BA 4QRAA 5T1KA 3KYNB 3ORJA 2AV1A 1ZFJA 4IQDA 5J3HD 1MNUL 2FT8A 4MMYB 2NDFA 3GS6A 1BX2B 1UKQA 2EE2A 1SHWA 4M3KB 5CAYB 2YAFA 1OWQA 3K72B 1IAII 1HSBB 1N8FA 4HNOA 5AN7A 1M6UA 3O6ML 5FWRA 4Z6AT 2WHVA 4XWGL 3HEIB 3QFDA 1ME9A 3NQBA 3JTSA 3OJGA 3MROB 2VDPL 4ZVJA 1J1XL 1RUQL 4N5UA 4RBPK 3V6ZB 1EC9A 4LANA 4Z7VE 2C3WA 3LKPB 4IH3A 3UEZA 2KZBA 1ZLSL 4QHRA 1H15A 2FEDC 4ZR8A 3KW7A 4KHTL 4LHUB 1FZMA 1EDGA 3M5VA 1NL0H 4OJFH 5I26A 4FXTA 1ADQL 2BRRH 2Y1HA 3K4AA 1GR7A 2R0KH 3IMTA 2QSCL 4M4RB 3IGLA 2AGKA 1DCLA 1YXCA 4PB0H 2EE9A 1LO5A 4OCLC 1G94A 2XY2A 5DCEA 5FAJA 4QRUA 5FEXA 5HHQB 1KTRL 4JUTA 3ZL1A 3U0WH 1C5DA 3RQ3A 1E1CB 1GGIH 2W95A 1YJDL 3ULUL 1IC0A 4BFBD 3RGVC 3DBNA 2BNQE 2CLPA 3V0SA 5AHLA 1GVEA 4KCWA 4C54A 5LIWX 3ATYA 2NQJA 2GJ6D 4EIBA 1PE1A 4C6LA 4UILH 2Y2TA 2Q5BA 1RJYB 3CMOH 1UA6H 1KDJA 1SDYA 2QLVB 2OYMA 4MYPA 5T1MA 3VDCA 1BGGA 4UNIA 3WDIA 1OAKL 4UTTC 2VQUA 3BKCH 1FIGL 1K8CA 2RB8A 1QPQA 3K2MC 4WY0B 4G80A 1OCQA 1LF1A 2G2PA 3H8NA 4GXVL 3WJLA 3SDCD 4YHLL 4Z18A 5C0DB 4XMZA 5CBEB 1FLRL 4FQQB 3AQZA 1CQKA 3MV9E 1VENA 2DDQL 4YE4H 1CFSA 3TT1H 2DT3A 4E9YA 1YEHH 1AANA 1SXBA 3P0YL 4B91A 2A77L 2PLJA 3VAEA 2UY2A 1FWEC 4HNLA 3B4NA 5HJ3B 3DJRA 4N5EC 35C8H 1KW1A 5K9JL 5FD0A 4NFDA 5AVZB 4P07A 4KK5C 2YBRA 4L4TB 3KBWA 5AHFA 3I6RA 3E02A 3MJ9L 1FWFC 4U1IB 2QHLA 3VG0L 1IGCH 1XPYA 1CFNB 4XMPH 5BMWA 1FRGL 1CU4H 4LIQH 5AL0A 2YPKA 3T71A 4DPCX 3FNKA 3REWA 3DG7A 1RAMA 1A4KA 5DDHA 5K93A 4GG6E 1IO4C 3F5LA 3NQMA 5LNRA 1E2VA 2DLEA 2GJXA 1ED3A 4FG0A 4WDIB 4XNMB 4WWPA 4TSBL 4BQ6A 3SJVA 4QPEA 2FTPA 1EDQA 2Z8SA 3MU7A 5CC6A 3APFA 3D7PA 3N43B 4UQDA 4J5NA 2IH1A 4M8UA 2XWJA 2XJKA 3GFYA 4YXHH 1YEEL 3U9PH 3ISIX 4ZTPL 1GPOL 1P5UC 1PCSA 1IM3D 2AQQA 1J5CA 4AB4A 1DPMA 4R90L 3HPZA 1P6AB 2X09A 2X70B 1E0XA 1FF5A 5AYTA 2I9UA 5ES4B 3WH7A 4KMQA 3HPJB 2AV1B 2XZAL 2WO2B 4KY2A 1JUKA 2Z65C 3G5VB 4FG6C 4X5RA 4GY0A 4G7SB 4H0IA 4BA8A 1JV5B 4X4XB 4L1SA 3TYFA 5BOJA 3NL2A 3ZWTA 3KPNA 4PUBL 1NZRA 4KRPC 3VO0A 4BZ1A 3WQGA 2IMRA 3GSRB 2HV5A 5DZJA 5E6SB 5JXEA 3RN6A 3NCJL 5TGBA 3V55A 4B5TA 4D6HA 4PGCB 4IP7A 3PDOA 1QT1A 2FRGP 3QUZA 3UGRA 3LN3A 3DX9A 2QTVA 4G8GE 5HJBA 4YBLB 3L0GA 2ASHA 2Z1WA 4F15C 2BVPA 4X6EA 5DJAB 2C1PA 5EZOL 3TM6A 1FP5A 4WFED 1BG1A 2EH8H 2IVFC 3UPRA 2HDJA 4Q9RL 1NOFA 3W5NA 4BUGA 3AZTA 3QGVA 4ODHL 1YDPA 3CL8A 1EZSA 2NY4C 3DOSA 4ZSOE 4I7WA 4ZK8A 1WKDA 1S2EA 3D4YA 2ZQ0A 1MKFA 9XIAA 1TG7A 3FU9A 1KBIA 3G1DA 2Z91B 3B9KD 2X44D 3FCBA 2H6OA 1QLEH 4KKBD 4KKQA 4DKAA 5C0CD 3EF7A 3OVGA 4G1KA 5KZMA 5DUPL 4OKVB 2IAMD 3EOUA 5CPLA 4P5TC 1ADDA 3IJYB 5AVSB 1ZTVA 1N0LB 2XPGA 4G6ML 4HGWA 4XOAA 3SKMA 1AS7A 5D71H 1XFBA 2EPHA 3E0VA 3QHNA 5EIIA 1MREL 4GY7A 3ALGA 4OV6F 5LXGL 3TFBA 2X4RB 4GW5A 2P5EE 5CBEA 3B8YA 2OWWA 2G75B 4W8AA 1MJUL 3GAKA 1S7XB 3ZE0B 2FBRA 1MEHA 2B0MA 3QR0A 4JO8A 2W9EL 3UCQA 1F8MA 4ZSOB 4OUUB 5F7NC 3FC8A 5KUKA 4GVIA 4R3SA 3GNPA 1XLEA 1NFPA 2CDGB 3FB6B 4C1NA 1LORA 1LGVA 1JJUA 5FX3A 1LDCA 2AJXH 3KRZA 4H9ZA 3IKKA 4ASTA 3VINA 4LSSL 1FWCC 1G84A 1G9MH 4HIQA 3LKNA 4L4TA 5E8DL 1QUNB 1XISA 1T04B 3WO8A 4FXSA 5IIEA 3HS0A 3IF1B 1OKEA 1YPZE 2QPEB 4N6QA 1KGJA 3ARFD 3G6JA 3VXUE 2IKGA 1JPGB 1OTSD 3X1GA 2B9BA 2Y88A 1IC7H 2LT9A 1T6VN 1NFIB 4UINL 3HPLA 4FNLL 1P6CA 3B8IA 2WIIA 4U6VH 4TVPD 1E4LA 3C2RA 2WWOA 3RPDA 1JZFA 3GMNA 2ZXGA 5LBVA 1L9WA 5KG9B 1QWNA 3HU7A 4H9MA 2OMWB 5LYRA 2BSED 1D9KB 4C6DA 4XX1G 5CBJA 3H9SA 5DWUL 2AK4E 4UXDA 2WZ5A 5A6JA 2P52A 2KKQA 1MCEA 5F6IB 1INEH 3RX5A 4JDTL 1JZJA 4WWID 1BZDA 2PTTB 3K0YA 4JRXA 3QUMA 1JZ4A 4PVMA 4X5XB 3WN5A 4H00A 1QSFD 5HWMA 1C8VA 3WLIA 3TEVA 1JV2A 3TO4B 2D03L 1S1PA 4WV1A 2GPTA 4W9GC 4RCAA 4WK9A 4FLOA 4KK9C 2GEEA 4LCUA 3Q9PA 4KI1A 4PJ9A 3VD7A 4I0KA 5TQ0H 3SPJA 3W4RA 5EBWA 1G7VA 4OWGA 1RZFL 4O14A 2FO8A 2ZD0A 4DETA 2ENYA 1BYPA 5BS0E 1I1WA 3LRMA 3EB4A 2FKPA 4MA3A 4U3AA 8A3HA 3ETBF 1JK9A 4XVOA 4H7VA 1LK2A 3QRLA 3EGSA 1IFHL 4LHUG 1NDZA 2I5YH 3K2KA 4RGOH 4LASL 4YGAB 3V4BA 3KPPB 2IEPA 5G1YA 5CC3A 3OGCB 5EUKB 4K3ZA 3M1CA 1GHFL 1FH8A 2M8XA 3MLSL 1Q9OB 4JJ5A 1CLYL 1U92B 5AYQA 5JO5B 3GHTA 1J9CT 5DCDA 2Z6JA 4L8BA 4K8RD 4BWTA 2WGXA 2VXVL 4HX1B 5I74B 2F1BA 1MSPA 1NY1A 4LWWA 2E4TA 3HBGA 1ZAIA 1FL6A 5F96L 3L7EA 5CEYA 2HWZL 4HIEA 5DK2B 5AZ2L 3SDXE 4J6RL 4N1HB 3N15A 1DJQA 3PJNA 1UB6B 3W28A 2QDVA 3VE0A 4ALAC 3AQUA 3HC4L 1BOGB 2HT3C 5ITBL 1WE5A 4FGMA 1XRFA 3GSWB 3SGJA 3UC0H 4MJZA 2HFFB 4AIOA 5D1XB 3MRPB 1KO0A 2JFCA 5BS0A 1NCJA 1R3YA 3B03A 4ML4A 2CO7A 4ANKA 2CO6A 4E5XG 4HULB 5HVGB 4Z7UB 2CKBH 3ABSA 1BWMA 4PJXA 3CVIH 4CD4A 2HCVA 4DUOA 4OLVH 4U6HA 3BGMB 4YQXH 5I66A 3BDBA 3P3BA 2IV9A 3TBTB 3W26A 2VDOL 4AC4A 4AVJA 3O11A 2D7NA 1DL7L 3K3QA 2QQNL 3D47A 3VFRB 1O12A 4DIAA 3DUHA 4YIQA 4LVOB 5JXEC 5KWYC 1JCJA 3NR0A 5SWUA 3ESUF 3EYSL 3SW6A 2OQYA 4OV5B 4BQ5A 2V5KA 4HV8B 2QV5A 3BP4B 1A65A 1RLWA 2XKSA 3NPSB 1IVTA 5CGBA 3MKCA 3VOIA 1FHUA 3W73A 3WK0A 2E28A 1XXFC 4N6RA 2FSEA 3BAXA 4U7SA 2FVKA 2QADD 3IWUA 3OR7B 1ZK5A 1Q6FA 3AHXA 2XJLA 3OKNA 2FR4B 2WBJC 1QFWL 4TULL 5TQ2L 1LQSR 1UD2A 4M3HA 4N9GA 2Z00A 2ZUSA 4PS4H 3SE8H 2CLIA 1BJ1H 3DJTA 3ULSA 2OXGB 2UUDH 4HZ7A 1NUNB 5DHEA 1U58B 3Q44A 1H62A 1MHHB 3WEMA 3NEHA 4FXKB 2DM3A 3DDMA 3KBFA 4Z3IA 1XLKA 5GRXG 5LNDA 1TSIA 3K4WA 1P69B 3S88L 3SBQA 1DJHA 2D24A 3AQYA 3F01A 1M04A 4QIUA 1TLMA 3MCG1 1Q0XH 2CJUH 3ZW3A 4GRWB 4I5RA 4XBKA 3FONA 5CEZD 4AQLA 1CFTA 1K7XA 2VLJA 1Z3NA 5AKRA 1Q8AA 4A3YA 4Q6IA 4X61A 1S2UA 4MFDA 2NXHA 4ORMA 4IOTA 2VR8A 5CGYC 5HI4D 1QA9A 4EKJA 1RD5A 1HKLH 1LTDA 2QUUA 2YDRA 4TIMA 4XKMA 5E6ID 5T1KD 2P49B 3PWLA 4YNYB 4CMMB 3MLXH 4CGUB 1CF1A 1G9MC 2AAVA 3ZT6A 2XIIA 1IGCL 1ANUA 4I5BB 4JFPA 4KFMA 4UOW0 3OZMA 1XG4A 4YBHA 4K7PY 1WK0A 2DI8A 4KK6C 5DJZA 3FV9A 2EYTB 1TPEA 3UTTD 3MCKB 4MA8H 4Z2JA 1CFVH 2Z7UA 4QKTA 1PWMA 3LQMA 3PB0A 2PXYB 1YEGH 5GGQL 2XBZA 2ATMA 1RK5A 4PFEA 1R3QA 3CTTA 4LU5L 4YUEL 4U7MA 5C55A 1UOKA 2D31A 2QVFB 4OZIE 3ZJ6A 1UQSA 3NQVA 1EEXA 3D3VA 2YMOA 5CF3A 3CBRA 2POTA 4D7PA 1VPOH 3V5DA 3T42A 1GPOH 1ADQH 3B56A 1N3NB 2QSCH 5DUJA 2FYYA 4J2PA 3MRCA 1ZBWA 2VLJE 5F70A 1C9WA 5HNRA 3S1UA 1WBZA 3PNZA 2BVQA 1Q0YH 3MLRL 3BKMH 1NINA 3GSWA 4HJTA 3U83A 3O6FD 2HFFA 2XQYK 3KS0H 5GGSB 3TASA 3LTPA 1EJVC 2HJKB 3P60A 2A3LA 4M3JA 1ZP4A 4YL2A 1YYAA 3GLDA 1YUHB 4FR6A 4P8VA 4Y16A 3QEQE 4X4MA 5E4EB 5CLWA 1XQKA 2XVNA 2VAAA 1V7NL 5F1OB 1MEXH 5EMKA 4Z7OE 5KVFE 4NNPL 3SQRA 1AQHA 1IBFA 3BGMA 2C0HA 4X98A 1OYCA 4YGVA 1ITCA 3BO9A 4JFYA 3UWQA 4NWTH 1GZ1A 1JCYA 2EDBA 1F2JA 1T3FA 3THAA 2QHRL 1KJ2L 4XOEA 2NUTA 1IAKA 1J8RA 1YNTB 2OMZB 3D52A 5IOKA 5IR1A 4ELKA 3I6TA 1FX6A 4KKPA 3WXVH 4D6JA 4AU0A 3ZTJG 1WUEA 2HNHA 4FQXB 1G4RA 3FJTA 4FCHA 1I8MB 2PGWA 3IGXA 2N0MA 1ZHBB 3PWJB 4MB5A 2EP6A 3FB5B 5LKNA 4P05A 2YA1A 2WXLA 1U22A 3VFLA 5MF5A 5DJCA 5L2JA 1LVEA 1QLEL 4U0QB 1I7TA 2BXYA 1MEIA 4ZSTA 4V2XA 3W07A 2YMTA 2VXTL 4NLHA 2WLIA 1RK1B 3O6DA 3JZUA 1MCPL 4GUFA 2PW1B 4TS6A 1VGKB 4D94A 1S5NA 3CAVA 3CH8A 4ADGA 3CYJA 4XIAA 4KKCD 4QLLA 5HUOA 2OMTA 4NYUA 3DETC 1RUAL 3HTWA 1KCLA 3N17A 1TZOA 4LAQH 3EZ4A 4H6KA 2PP8A 1N68A 3KHQA 4WK0B 3RZCD 1ASQA 5E9AA 1B4JL 4YXHL 1OCBA 1QBLH 2LABA 2EECA 4JANB 3I7SA 2H3NB 1CYGA 4J23A 1S5VA 4W81A 2YD7A 2QHAA 2EDMA 4W88A 3TNNB 3HZMB 1HYSC 1Y5WA 4HS6A 2WINB 4RZCA 1PLCA 1PAMA 3NCYP 3Q3GA 2BZCA 4PS7A 3SKNB 4F9PC 3MFGB 4EI6B 1I9JL 2QCNA 3RJDA 1W1YA 1QA9B 1BRLA 1WH0A 2Y23A 1D5RA 2QQLL 3NYKA 1NWRA 2GUOB 2AMGA 2N59A 4QCFA 1L6FA 1L2QA 3NQIA 5I71B 5BCAA 4PRID 2HJFA 4IU2B 5HK4A 2ZT9C 2V37A 2O6FA 4NIYE 5HNUA 4FAAB 1EUNA 2CBUA 1CF8L 3JWNH 2BXVA 3NFNB 4GP8B 4QY8A 4JQ3A 1TZGH 4JXCA 3W2KA 5DD5L 4C5ZA 4Z7WA 4QXTA 4JFFD 3WHXB 1AZ1A 2QR6A 1NIDA 3DHPA 4E41E 2ZAIA 5C2UB 5I1AA 2YK1L 1GWJA 1K7FA 3VTRA 1PZBA 5EL1A 1KNOA 3IDGB 2I14A 5B8CC 4LB4A 1IEHA 1I4FB 1MCOL 3DK2A 4DW2L 2KUTA 3C60D 1J8VA 3I6LE 1GOMA 2Q8LA 1JS4A 1KRAC 3LRGA 4FF9A 3DGGA 2EDDA 1J5OH 1KB9J 5D72L 3L7RA 3APTA 3MV9B 4YBQD 1V7AA 2HRPL 1ZBCA 5F93C 3AIEA 3W2JA 5FJIA 2D03H 2DLHA 4HHGA 4CU8A 1VFFA 5FGCE 3T0XA 2HISA 1NAML 4UTHA 3WY3A 2IIJA 1GVSA 2ZUNA 1CZ8L 3RY6C 4F3FB 5IT2L 1V6UA 3NGFA 4WU5A 3TN0D 4E5XB 5BPPA 1SVCP 9CGTA 2BMBA 4PUNA 4REQA 1EEZB 3PWPD 4PJ9D 3TMLA 3CFJA 2UWEF 3ALPA 5SX5H 3QNZB 3NQ8A 2WHMA 5D70H 1I3GL 2K8QA 1J8HA 3JTTA 4XI5C 3LOWA 5HPMB 3DGBA 2JH2A 3DO3A 1JZ8A 4G5DA 3NK4A 3W0WB 5I18L 2QPFA 2IDSA 3E9TA 3QCUL 4LDOB 5GS2H 1QK2A 1MJUH 3QFJA 3QWRD 4DB7A 2ARWA 4C4UA 3QZAA 2Y85A 1NANI 1R3RA 3VXRE 3A5FA 1CWYA 1FUYA 2GYIA 3SCTA 2GAZB 4ILDA 3MRIA 5D05A 5EO9B 2MCPL 3IS1X 3PG9A 3L9RB 4ZW8A 4UFLA 1GVIA 5BZDB 3KMDA 2Y36H 4F0MA 4J39A 1KFAL 2YXOA 1U36A 3QIUD 3W1RA 2NY3B 3CN2A 3RDKA 1MQPA 2KBGA 1XR9A 4NZCA 1IM9A 1OFDA 1I7TB 2ZG2A 5AVUB 4I0PC 1P0DA 1MPAH 5I79A 1QEWA 1RXLA 1IC7L 2XXMB 4UINH 2ZAGA 4GP5B 3SQLA 1UADC 4MNGE 3KL0A 2VDIA 4OVVA 3FQNA 4XNQA 3ALWA 3QQ4B 2FEDD 4QI3A 1TQBC 4WWKC 3GR7A 2LLLA 5ILTH 2NZIA 4HCHA 4GH3A 1ESWA 1I3UA 3IVKA 1BQHA 5E00A 2ZYRA 3W2DL 1AD0B 5BVPH 2OAAA 1SYTA 1WKFA 5G1TA 2F19H 1W6TA 3MT1A 4F2UA 3AMCA 1S5IL 5JMOC 1KEML 1OD8A 3KVLA 1JFXA 2X1TA 4L4PA 1H5BA 4ZUSB 1XYAA 4HZMA 3LXUX 3MBDA 1J7VR 4JFTA 2AXGB 5DD0H 1XF2B 5EFDA 2MRYA 2IMNA 5IFAH 1CNVA 1HIMH 3BN9D 3BVWA 1FFNB 3DHDA 4IGBD 2XWRA 3VMNA 2ZTJA 5LGYA 1HHKB 2EC9T 3MJYA 3U9IA 1MCLA 3QPZA 1R34A 5TE4H 4DGIL 5I5MA 1R38A 4FLRA 3CV1A 2UXTA 3UZZA 3DX8B 1QNZH 2JKPA 2AZUA 1QKZL 1YC7A 3V52H 3M0XA 3SHSA 2V8ZA 4KHXL 2N56A 3G9VA 4PJFB 4PR5A 4B9ZA 4DJDA 5HDQH 1IKOP 1A7PL 3KLHD 1P7HL 2Z31B 3EX3A 2NW0A 3SRFA 4ES4A 1QPRA 2YBTA 2NTFA 3HC3L 2BP0B 4IU3A 3DGGB 3RVXD 1G1KA 4HUWA 1IGYA 5HYJB 2ZOUA 2ALDA 1I53A 2CKBL 3MV9A 4AQEA 4IK6A 5CXPA 2BTMA 4NI8A 2BSSB 1J88A 1SF5A 3M8OL 3TF7C 3BWAB 2A4AA 4C6BA 2VZ3A 1OT4A 5C0IA 4M5PA 5CD5C 4NQTA 3OLIA 1UC5A 5JR1L 3H0TB 3NQCA 4GRLB 4L8DB 3BD4A 2CCRA 3V7AG 3VGDA 3UDWA 4AL8H 1VKXB 3BPWA 3D2UD 1XZ0A 2EDEA 4HMEA 4PQXA 3GJFK 5HDWA 3NJ3A 2WXQA 1N26A 4Z7QF 3KWTA 3ZDXF 1T4WA 4CNIA 1MI3A 3N2XA 4LBEB 3IEBA 3N6YA 4Q4PA 3SE9H 4R7NB 2Y5TB 5FFGA 5BOZG 5AL8A 1KKRA 4NYLA 4HBQA 4K7YA 2WJ7A 4HQQL 2GT9B 4PJIF 4K8RL 1LWIA 3WXWH 3CJPA 4UTJA 2ITEA 3PABB 4V2CB 5FK9B 4MA8L 2E5EA 3K4DA 1G1OA 4NN5C 4JN6A 5E93A 4PUWA 4D1JA 3HPSA 1HAUA 3GQYA 3DJZA 1LRQA 2F58H 1EHLH 2KX9A 3D85D 4LB8A 5ID1A 1M5WA 2H41A 4RMBA 4EBQL 3GDMA 1UCTA 4X6DF 5SWZD 4H1LG 4N20A 1PG7X 4Y1SA 3OZPA 5B7FA 1UUSA 4K94L 5F89A 1NFGA 2DQWA 2VFDA 3TN5A 5D2NB 4ZTOL 1A3QA 4JZOA 3OL2A 2R29A 3C6LA 4NQQA 5L7XH 3BGFC 5H8PA 1AS6A 5E6YA 4FS9A 2BX5A 3SRHA 4H8WL 4YZWA 5A16B 1QEWB 4RX0A 1G6CA 1MNZA 3AZRA 4GSQA 3WLJA 5IHRA 3LKQB 2JI1A 1RJPA 2G3NA 3CLEH 3V0JA 1C91A 3ITXA 3BAYA 4C4KO 1T7ZA 5HHNB 2Z34A 2DLTA 3ME0A 4JNMA 3FXIC 1I1AD 1V10A 4YDLB 3BGGA 4UBDC 4ODSL 3WH5A 4JFED 5D7KD 3NCEB 2LV4A 3REVB 3U82B 2V5MA 3BVNA 3ZDXB 3A6CH 1JBJA 3PBYA 3PULA 4JHAL 4L65A 2H0JA 4PCNA 5JYLA 2FTWA 1W0WB 3WF0A 5CMAA 1NPJA 2Y07H 1TUPA 2C19A 1B57A 2HWGA 5BRPA 1X5GA 1AGEB 2G5RA 4MNQD 1KJ2H 4KKLD 3HQ1A 3HE7D 3DIFA 4XNUL 2G4EA 3CMGA 1GJWA 4HU3A 4PHZA 1XLAA 2B77A 3QIWD 3O2WL 1E15A 5H6HA 3D6NA 1DBAL 3N55A 3FAXA 1V03A 3ZDZE 3QJOA 3H54A 4EI0A 2IGFL 4YIWA 2PAJA 2QFPA 3T2PA 5DT1H 2CU9A 4DUWA 5A2FA 1GS7A 4NUGL 5F1IA 4X7EC 4D0CA 4DF0A 3ZL2A 4TQHA 1YQVL 3IJ8A 4NKOA 2LU5A 2ZZUT 1EUUA 3OM3B 1XLFA 1JRHH 2UZIL 4L1WA 4H1ZA 2X4OB 3KH4A 4XCNA 1E0UA 1YEGL 3V8OA 5EEYA 2AL2B 3NVTA 1JIBA 3NACL 3ES6B 2FDSA 5A6BA 2CM5A 1KCRL 5L2KD 1TR1A 4POCA 3MUJA 3EWBX 3VJ6A 2NQDA 2FH8A 4I0PD 4GYJA 4Y4FB 1QBLL 4NZFA 3HBZA 2J20A 4MJIB 3POCA 3EKZA 3VIPA 3S6DA 1UXWB 2WCAA 2J74A 3U7VA 3EJQA 3LVEA 3DO7A 3M0ZA 2WNWA 3L3OA 3ZUNC 5BMFH 3RPMA 1AD9A 2DB8A 4WWKA 4ODTH 4JGUA 1GYNA 2FZBA 3QRFM 2GPZA 4RMTA 4U1IA 4CNIB 1GQNA 5K59E 1S9KC 3MNZB 2YEZB 4G6JL 5AG9A 3N91A 1PSCA 3CMJA 1S2AA 3GTIA 4AIUA 2X7LA 1RIUH 4KKLC 3QDMA 5LDUA 4Z7VA 2C3HA 4CN1A 2HUHA 1H5BC 2NQHA 4JZNA 1M7XA 5LIXX 2J8UF 3FO9B 4D3CH 2XWJB 5IB2B 1DE5A 3ZZSA 3IGFA 3QMTA 1M6OA 1TZAA 2ICEC 4IP5A 1O7DE 1R87A 1F58L 3KEDA 5I1HL 4M5YL 4FADA 5CCHE 3SCMC 3QZPA 4OF5A 4UM8A 2OJEB 3S1GA 2C9RA 3KLAA 2WNQA 4I13B 3CFBB 2GFBA 1JPIA 2RDXA 2OMAA 1SU5A 2YXWA 3MLVH 2X12A 1G9NL 2HVKB 3V4UH 4F15B 3IPFA 4OIIH 4ZD3H 1U8KA 3BLFA 3GYCA 3Q1EA 3CN1A 1SVBA 2WNZA 4G8GA 4AGPA 4IGSA 3SYAA 5AECA 2G5WA 3CWHA 3SOBL 3SOTA 3QXUA 2YGOA 1FH9A 4N9BA 4G56A 5FYKU 4E3VA 5IJDC 2QSQA 3BAIA 4GACA 5B7MA 1UZ4A 2N7SA 2BW4A 4L8SB 3NOIA 1TQTA 4JHWH 4DP5X 1I9RL 3E8VA 4WHTA 1F5ZA 3VGAB 4H88H 1OC7A 3BE1H 4WHYG 3UJTL 3UR8A 3WK3A 2EC8A 1O60A 4F40A 1RCQA 1U4FA 2Z1PA 1UA7A 1QMLA 1UR1A 4K7FB 2BVPB 1IGJA 5DJAA 3UDWC 1TPDA 1M2OA 5B1JC 1DTUA 1MW3A 4R97C 4LNCA 3AZUA 1TREA 3EA1A 4QG6A 1EXUB 4AZ5A 1M9WA 1ZTMA 1HESA 4NDMA 1ACYL 4W68A 3LMJL 1KCUL 5CLXA 3S2CA 1SGKA 2CLOA 4HF5L 5CPNA 2PDBA 1M03A 5F7EL 2PABA 3LQZB 2ZXQA 3QPXL 3W71A 3W85A 2YQ2A 3L65A 5KITA 5AZ1A 2W0FB 2Y1YA 4NM4H 1A5MC 1ZSDA 4NAEA 4Y1AE 1RXOB 2DGAA 3SDDC 3QJFA 1LOSA 5A69A 4S1QH 1R4XA 3R0MA 4NRZA 4ZOAA 3TN6A 3TK7A 5FJTA 3WG6A 1FH7A 3OG6B 2X6VA 3EPOA 4IMEA 2MH4A 4PJ8B 2VXSH 2H26A 4ANWA 1IGWA 2A6DB 5AYUH 2UYLA 1ZV2A 5M7QA 2TRHA 1YPZA 2BP1A 3TU9A 3EMCA 4ZXOA 4IYKA 2OQHA 4WZHA 3B7YA 3U5UA 4AC7C 3DIDA 5F7KC 4U1LA 1HF6A 4DOHE 3QQ9C 2CGRL 3QCTL 2FTAA 1S2TA 2ADJB 4WX2A 4FZ8H 4UAHA 3QNFA 1P4UA 1KBPA 2YCLA 4DO6A 4YLCA 1FWNA 2EEAA 3U2IA 1JEZA 1GH7A 5AB3A 5TPWH 2VDML 5IIEB 3C2AH 1IXNA 4ZQMA 5GS1B 3G6JB 4UT6L 5DHVB 1S5HB 2AQRA 2JKTM 3PSVA 4WVRA 4BJLA 4KBXA 2X7LB 3WBAA 1DSFH 4XPAH 3OPSA 3GSVA 3TN0A 1KCWA 1OFAA 1SM3L 1PIIA 4QHPA 3GDKA 3P9LB 4NAFA 4XD6A 3W25A 3WK2A 2X9YA 4NNXA 1H3UA 2B7DT 4RQQA 4XPBH 3D46A 4PJHB 3DFHA 3ZHKA 3IGSA 4E9RA 3E12A 4GJJA 5D1QB 4IM8A 5HDQL 2PZ0A 3RU6A 4PB3A 1KPRB 1P84K 3MHFA 3X14A 3HAEB 1DN2A 2C8NA 4OFIA 1YEWA 1WOBA 1BZ7A 3NFPB 2MTAA 3F7KA 3RZCB 4GUQA 5DYOA 2Y7SA 4O00A 5D2LE 4EN3C 1NGYB 1VFLA 3RM9A 3VOHA 9RUBA 3FJLA 5F1KC 5CM1A 3N44F 4EXAA 1F6AA 4PWFA 2OXNA 3GMRB 4OCXL 4DN3H 1AK5A 3DCPA 5L4IA 4JPVH 1TNMA 3EBGA 5I6XC 1NCDL 3BUVA 4G7YH 1LBLA 4DM1A 4IIDA 1MPAL 2KMWA 5M94B 2HVJA 3T6ZA 3F3HA 4XTIA 3BSZL 1YN6A 1LP6A 4KWUA 5EFIB 1D9EA 2NX1A 4ILSA 3QUGA 3VRIA 3ET9F 1A4BA 1YEJH 5IB4A 3GVGA 4HS8L 3DARA 4PJEF 1VS1A 5IBTL 1KFWA 3DESA 4A05A 2AQOA 2EG8A 3IJDA 4WI0B 3KXFB 1I8KA 3U4KA 3RM8A 5ANMB 3KPSB 1A5UA 4WKXA 4C55A 3DSFL 4J3BA 2GJZB 4I3SH 2WBGA 4K2SA 3JWDH 3L3IB 3RL2B 3X13A 2WZ6A 4YR6B 1SXAA 2ZCHL 1U8QA 5D2LA 2ZKXA 1FNEA 3I9PA 4PRIE 4R8WL 2CSPA 5DC0A 3FZUC 1V6VA 5HHME 1Q6GA 3KWWB 4HEPG 1RJRA 4NQVB 2BHYA 3ZJKA 5E51A 2YPVA 3HG1D 2A77H 1TJXA 1AMKA 1XLBA 1KLUA 4XH2A 3T3ME 4R0LA 1V93A 3NQAA 4ODVH 4WFEE 1AIFA 2J72A 1H09A 5JHLL 2PPAA 2I9EA 1BIIB 5DU7A 2XIJA 4GI6A 3BZ4A 1XYFA 5BQDA 4WQ6A 1S5WA 2RUSA 2PR4H 1NQKA 4ZUWB 4FQPA 3RVVC 4NI3A 4MS6A 1UJ3C 3FAWA 3PS6A 3TBTA 2Z1BA 4L05A 4JTLA 4KXBA 1WISA 4LMQI 3CPGA 4N1CA 1RZJL 4L48A 5CSZB 2VCCA 1IQDB 1RY8A 2BVEA 4C56A 3AJXA 2RCSL 3TROA 2JIXB 4QEHA 1R75A 2NQ5A 1TV8A 3IGAA 3G6DH 2Y1AA 1L9TA 2ZWLT 2BS71 4AGOA 1UT1A 4CNUA 1JGVL 1KENH 4OBSA 4ZFFA 2J7BA 5F7FA 2NZ1A 3B5HA 3QXTA 4P61A 4AY1A 5K7JA 4N6RB 1R9FA 2ZCZA 3NVQA 3K6NA 4E4PA 3GMMA 4NNXB 4ELDA 3IGUA 2NXGA 1JNLL 2P45B 4RDYA 1LDPH 3BP5A 5ECGA 4JFVA 1DL3A 4UUJA 3F5JA 3UYCA 2JQZA 2IANB 4J35A 1NELA 2V9RA 3BZFB 4L3FA 3CMOL 4GXWA 4TUFA 5C07D 4RUBA 4UOQA 1MNNA 1PZ1A 1XEUA 4JTRA 5AC5A 1SZNA 3GBNH 4UZUA 1NGYA 3NACH 1Q1PA 2CKBA 2E7LA 3E3HA 1FTXA 3U1SL 4GFTB 3GMRA 5T3XD 3U7WH 4Y19B 2C9AA 3L7FB 1E9OA 1UWUA 2I85A 3IRSA 1ML1A 3CDZA 3MBWB 3BE7A 2ESVA 1KR1A 1COBA 3LUTA 4QR6A 1B2WL 3BRDA 4IFKA 3JYBA 4YNYA 5TDNA 5CEZL 2AF2A 3EXLA 4I5BA 5I0YA 1ZNNA 1T6WA 3P0YH 4LLQA 1LM1A 2HNEA 2XDHA 1TCRB 4HNNA 3MJ9H 3CVHA 3OC5A 2ITCA 4AEFA 3SJ3A 4P3WA 1VB9A 2NW2B 1U8CB 1QZ1A 4B60A 3CNYA 3ULUD 4MNKA 4N85A 4N8UA 4LL1A 4NFBA 2Y8UA 3QULB 3NG5A 3KVKA 4JHAH 4LSDA 1MG2C 3U9UA 5JBFA 3CIXA 4YHIA 1PPIA 2GJZA 1N3NA 2A9BA 3UYRH 3K30A 4GQ0A 4HU4A 2OGJA 1TTUA 3G1FA 4YR6A 4PS8A 2AJVL 2VCOA 1U8QB 4CUCA 5AEAA 1EZVX 5FO8A 1W1A1 3DYOA 3FN0H 2IKIA 3STZB 4D0DB 2WTRA 4MBRA 4HYTB 3TVMD 1KY7A 1ILUA 1I7RB 1YTEA 5KYXB 5J5EA 4PD4K 1YNQA 1YUKB 3WH8A 3J2PA 1F1GA 2WQ8A 1BIIA 1G9ML 3GSOA 3O6LL 3PNWA 2VJXA 3JZEA 3GDBA 4H6QA 1MF2H 3WAKA 2ZP9A 4D9QD 1Z9NA 4D0BB 2A3EA 4AHQA 4C6CA 1KCVL 5C0CA 3C2SA 4PCFA 2R56H 1JRHI 4OD2B 4R7VA 1TEYA 3M5ZA 5AHNA 1JVLA 3VFOA 43C9A 1LG1A 2E4FA 4DN4H 5IJKC 4WV1C 3DC8A 1T3FB 1P7QA 1EJ6A 5BROA 2CNYA 4C56B 1F3JA 4YFEA 5E5MB 2E47A 2JIXA 3VG9B 4E9QA 4EZLA 5T3XE 4GGHA 2Q8ZA 4HMNA 4HUUA 3PAZA 1LQ0A 1BXUA 5F2IA 1FC1A 3CH1B 4XMTA 4B16A 1Y5XA 1A5LC 4HTBA 2YFOA 3PDGA 3MLVL 4URTB 3V4UL 3A22A 1K6WA 4TOQA 3MRQA 4R3UA 4MZ3A 5JIDA 5JIQA 2X89D 4R7DB 2VDKB 2VERN 2WJ5A 5ETUB 1AZCA 2VLMD 4F58L 4L6OA 3FTGA 1U91B 4MQSB 1HJBC 1RK0A 2YGYA 3CT7A 4BD4A 3SOBH 4RCXA 4D7BA 5FGRA 2ISVA 2PO6D 1KCBA 2ABAA 3WNJA 4EVNB 5EF1A 2K8MA 2EABA 4ODHH 3ZE0F 3AO0A 2PBOA 1E9PA 3U6RA 5E2UL 4NUMA 3O6FB 4OJCA 3TVMC 3U36B 3P5YA 5HQLA 4UMAA 4PGBB 5I8OH 5C0CE 1NC2D 4Y9MA 3F6IA 5G1MA 5IOBA 3ZT7A 1B54A 2CRZA 3HZMA 4PZVA 3JWNE 3L7FA 5KS9F 1NCBH 1CJYA 3KXQA 1AH1A 5I6SA 3CDZB 3CH9A 2UBPC 1ZAJA 3E3QC 4MKVA 3LM3A 5CKAA 1U5JA 4UDUB 3T8XB 5IB5A 1RLCL 4FHAA 3MV7A 1FBIL 4X7DC 5JUEH 4HC1A 4ZX4A 4M1CC 5C0FA 4KH9A 4NBXB 4CU7A 3FFCE 4Q8PA 2CO2A 2D3VA 4GT0A 4ZS7H 4N68A 4UT6H 3LDBC 3QPXH 3LHYA 4LLQB 1UWEH 2B39A 1BIHA 4Z7WB 5CPOA 1NUFA 2E9WA 1TCRA 5TK2A 4L8CB 1UPPA 4OQVA 1ND0B 3SZ6A 3CVHB 1INQB 1WFOA 2NY6D 3B8DA 3CN0A 4LNRB 3DDGA 5AAMA 4HKJB 2OLDA 1GC1H 4KKZA 4L1HA 3MYOA 1C5BH 3AIUA 5ERWB 2CRMA 3QPEA 4WVXA 2J8UA 4D6EA 5DJ6A 2Q8AL 2BNRE 1MHEA 3VXPA 1VF5C 2LTQB 2Q7YB 1AQ8A 4JBRA 1OK8A 2DJSA 2ZZ7A 2BGNE 4MKNA 4ZI8A 5A6SA 2OQJA 3NJMA 1TTAA 4W89A 1W91A 2OSLA 1XX1A 4KRLB 2VMCA 4WU7B 1CB4A 3PE9A 5MHSD 1VBHA 1Z5HA 1X5HA 1GS8A 2B15A 2VDMH 3CFJB 4XI5D 1FDYA 1J2WA 2ICEA 2GSGB