4WCJA

Structure of icab from ammonifex degensii
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
233
structure length
233
Chain Sequence
THLQGDGLVVLCYHRVLPSSRYAISRREFAQQLDYLRQVGVRFVTPQEAEDYLAGRIHLPGKLVLVTFDDGDLSVYRHAFPVLKKRKIPFLFFVIAGQVGRKWEGFSMCSWEQIKEMVASGLCVVGLHTYDLHYWDSQAKKPVFLLPGRERLFAEDTARGTACLKEHLGLKTRYFAYPYGFGTPTTDEILRTQGFSLVFTLRAKVNRPGDAPFVGRVLVTPDSWPQVAAWAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polysaccharide deacetylase
publication title Structural Basis for the De-N-acetylation of Poly-beta-1,6-N-acetyl-d-glucosamine in Gram-positive Bacteria.
pubmed doi rcsb
source organism Ammonifex degensii
molecule tags Hydrolase
total genus 80
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4wcjA00
3CL7A 2NLYA 2C71A 4NZ3A 5BU6A 2C1IA 2C79A 1Z7AA 3WX7A 3RXZA 3CL6A 4M1BA 2J13A 4F9DA 2IW0A 4L1GA 4NZ4A 4NZ5A 4NYYA 3HFTA 1W1A1 4V33A 4NY2A 2C1GA 2E67A 4OUIA 3S6OA 1W1B1 2VYOA 3VUSA 1NY1A 4LY4A 4F9JA 1W17A 1V6TA 2DFAA 2W3ZA 2QV5A 2XU2A 2I5IA 4HD5A 4NZ1A 3QBUA 3CL8A 4NYUA 4WCJA 4U10A 1XW8A 2CC0A 2Y8UA 5JMUA
chains in the Genus database with same CATH superfamily
3P8IA 1E9ZB 3JRKA 4A35A 3AS3A 3FEQA 4H41A 3EDJA 5HWMA 3FFSA 1CXHA 1DBTA 5AVHA 2PGWA 2OX4A 1ME7A 5GNZA 2R1MA 5HATA 3A4JA 1VFUA 3QLLA 5D4YA 4I8YA 1QNPA 1E6NA 5I07A 4DAFA 4P8UA 4LSBA 2VGGA 3L4VA 3M7SA 3P80A 4BEUA 3BAXA 4WJXA 1V0KA 3CNYA 3F1QA 1SJAA 4B92A 4X22A 4Q22A 3HOJA 3FDGA 5LA2A 1S2WA 2E8ZA 1LOSA 2OZ8A 1H1ZA 4CNSA 4HPHA 1HF6A 3NZGA 1FHLA 2Z1WA 4M1BA 4WVXA 3K4DA 3GC5A 3UG3A 4IFKA 3MMUA 2OKTA 1J96A 4AD3A 3V4BA 5M1TA 1YTDA 3SY8A 4IMCA 1BG4A 2Y89A 1KM4A 2D20A 2J6VA 3L4TA 1UR4A 1ADOA 2A7PA 2RHGA 3THAA 3FS2A 2BMBA 3SFKA 1W5PA 3AYSA 4YN5A 3CU2A 2NUYA 2NQJA 4WDTA 4BWLC 4JKMA 2QCCA 1DJNA 2C7FA 3GNRA 3WK3A 1TIWA 4HCHA 5G4EA 3RX4A 3TIMA 2HVNA 3WLJA 4GG9A 1HJWA 1HKMA 2PC8A 3NPVA 1SFTA 3FXGA 1YYAA 3UT0A 1JIBA 2YLAA 2YW4A 2AQWA 5L9FA 4NQ1A 3VIIA 3GXTA 3HPXA 4CCDA 1VCGA 3C2VA 1BSIA 1XYAA 1FDZA 3H7RA 1TG7A 4M7SA 5LIWX 5BCAA 3SRKA 3AU2A 3GG0A 1U5HA 3E0FA 4JIPA 4Q8QA 1V79A 1RVKA 3O3RA 2Z1SA 3WNPA 4TVDA 4V15A 1DL3A 4HYVA 4WQ6A 3GG1A 3W7OA 4GRSA 3GU1A 2OTDA 1IXNA 1I2QA 1JUKA 3LLFA 3W7QA 3OZYA 1H61A 4XZBA 1WNOA 1MXSA 5HNUA 1B3WA 4K8GA 3WELA 4EE9A 4WJEA 3VNKA 4AVFA 2XFFA 4M3PA 3AYVA 5EBAA 2X1IA 3RHGA 5HMSA 3KXQA 3WY1A 2BHYA 1BPLB 2QAPA 3UZJA 2ZDRA 4GJIA 1QPRA 3ICJA 4CNUA 2O9RA 1P1XA 1YNPA 4RZ6A 1PX8A 1X8FA 1GCYA 4GY7A 1UG6A 4HA4A 4C6CA 2J13A 1AW2A 1KCXA 4E4FA 1DQXA 3ZM8A 9XIMA 3DAQA 3HPSA 4AZIA 3S5OA 4N9CA 4DUVA 4HU4A 3Q58A 2ADAA 3GAKA 4P7LA 2POZA 2HWGA 4D2JA 3SUUA 1LTDA 1OFBA 1Q7MA 3RF9A 3DFNA 1SFSA 1F61A 3OBEA 4O10A 3RK8A 1HTIA 4KBXA 2VENA 4JQ2A 3TCSA 3GIYA 2FZ8A 3BGGA 4LV4A 2P5NA 1AG1O 4PBEA 4V1YA 3MBDA 3E02A 1DIOA 1ZAJA 3SCWA 4K6AA 5CJNA 1EX1A 1P0DA 5K4ZA 4AZCA 4NJHA 4ZTXA 1TPEA 3UETA 3M6YA 4Y90A 1FCVA 3KX6A 4RV3A 4BR1A 1J11A 3MCOA 1VQTA 3LI1A 1BYBA 1R2SA 3W24A 3JZEA 3OYXA 3QKEA 3PUGA 4GWEA 3UZ5A 2O56A 1ZAIA 1JFXA 3CASA 4GGBA 5FKYA 2AKZA 4EXQA 1I4NA 5A8MA 3AS2A 3O06A 2HZGA 2WYSA 2D23A 3P0XA 3GZ3A 3PSVA 1AD4A 1E4LA 7REQB 1QVBA 1E1CB 3AIBA 5DT5A 4AD5A 3VINA 3LS9A 4JD4A 5HR7A 3RAOA 4F0KA 3IGSA 5EKYA 3SAZA 2ZIDA 4Q4QA 3PUOA 2EF9A 3QPEA 3WJSA 3KOWA 1JYXA 4DRSA 4BHYA 2Q71A 3QW3A 3F4NA 3QHOA 4UTMA 1H1YA 5E0CA 1WQ5A 3CO8A 3P93A 1TR1A 2TODA 2ZRXA 4A05A 2AL2A 2C79A 3GXNA 1C91A 1WZAA 5I3GA 3R0UA 1V0NA 1GQJA 4FNSA 4KWUA 4BJHA 1UWAA 1GQNA 4B15A 5I3IA 2DUZA 3PBGA 1TA3A 2AOSA 5HK4A 4US5A 2YZRA 4GPNA 4XBKA 1H7XA 2I5QA 3G77A 1M6JA 3WLOA 5KZDA 2C1GA 1SJCA 2DZTA 3CO4A 2EHHA 3PUEA 2XIOA 2O4MA 3EWWA 2TAAA 4R7JA 4E38A 4F0HA 2ALRA 4DWDA 2C19A 4NJJA 4Y9PA 3HG4A 4QLLA 4FNRA 3FVMA 2WLZA 2Z28A 1AL7A 1VBRA 1ITUA 2PDJA 1BXNA 1YE6A 4JN7A 3LB0A 4ZO8A 1JUEA 1XC6A 3ZIZA 2HDJA 3IARA 1RV8A 1CGWA 3NL5A 1S5TA 4HCDA 3O6YX 2D73A 3NQEA 1J18A 3P82A 3SQLA 4MDPA 4Q7NA 2Y88A 3MWCA 1US0A 1V3MA 3LV6A 4UNKA 3BSGA 4OHQA 4HNCA 3N2BA 3POCA 1VBHA 2QZRA 1DKWA 2FZNA 2ZX5A 3LGEA 1E56A 2CNCA 5HWNA 3RITA 1QTWA 2G41A 1A5UA 4C7FA 5A6KA 1JI2A 5IFPA 1J5TA 3BGJA 4WR3A 1CECA 3BUVA 3URQA 5I78A 1V5XA 2J62A 3F2DA 3V3WA 4FLOA 1NWRA 3T07A 4C6PA 4S3GA 1S46A 1W1TA 4OBTA 3VD7A 4U10A 3BANA 1HP4A 2J74A 5D2TA 1KKOA 3A21A 5AVNA 3WG6A 3BVJA 3T81A 3CV2A 3ZLHA 1DWJM 3TC3A 2PDBA 2WSPA 3OW1A 3VOJA 2YBVA 4JYEA 4GNJA 4E3VA 3W82A 1JZ8A 4HA3A 4GINA 3RPMA 3TROA 5G1TA 5E93A 4TTGA 1W3KA 3OO2A 4XZLX 4L6HA 4TX9A 3GIQA 3Q45A 2C13A 1BQGA 2PLMA 1P43A 4GVGA 4Z2IA 4EX4A 3T4WA 4MKSA 2IKJA 2ACRA 4AY1A 3UVIA 3WLHA 3A4WA 5M3WA 4FF7A 1KKRA 3WJWA 4G56A 3QXBA 1JI1A 4NASA 4QS5A 4UCGA 4Q8NA 4R53A 3SR7A 4TR9A 5KZMA 4EWND 3C0SA 1EO7A 2XFRA 3DC8A 4EWJA 4URIA 3NQGA 2XH4A 4MKNA 1U1UA 3W1AA 3R0KA 5HULA 3N6HA 4ONVA 2YXGA 1Q6LA 3DESA 2HBVA 3PC0A 2FHBA 5IBXA 2Y8VA 1QMLA 3TH6A 3IVSA 2BS9A 5CZKA 4AZGA 3WENA 2FFIA 4XQ6A 4GE8A 4KERA 4RLIA 1XR2A 3VKKA 1QDSA 2ODOA 1ENUA 4XTIA 1P7TA 2WMGA 2ICSA 3DENA 2WMHA 3PZOA 4R9OA 3D6NA 3UWZA 1KFBA 2VC5A 4N42A 4O8AA 3H2EA 1IXOA 3AMDA 5HDRA 7A3HA 1RZMA 5L6UA 4QJ5B 1XLBA 4ZSUA 2OLAA 1W3TA 4N0RA 1T6MA 3LCFA 1PSCA 1CTNA 1HKIA 4GI4A 4UMAA 3LRKA 3WJXA 3W4RA 2TRSA 1UROA 1JPHA 2AAMA 2FJUB 1KCKA 3AYTA 1KFEA 2Y70A 2GWGA 2D3NA 2BVDA 3R0DA 3A3HA 5CC3A 1FCQA 2DSWA 3NXLA 4ICCX 3BMXA 1RK5A 4W5UA 4OKDA 2FB2A 1NU5A 5TAOA 3HZ3A 4E3TA 3H53A 3W27A 4DO7A 3MP5A 4HVXA 1ODZA 4S2CA 5FJIA 1K6WA 4CD6A 4B5NA 3P60A 2XVLA 2O9OA 1DOSA 3L9CA 2XM1A 1VCVA 3KP0A 3T40A 2J25A 2CITA 1ZBVA 3GY1A 5D33A 3WH7A 2OGJA 4C6MA 4AWTA 1ISWA 4IF2A 3G3DA 1SW7A 4O14A 1P5BA 5A8GA 5M2FX 4Q6XA 4MGGA 5D38A 3ES8A 4H00A 4RNFA 1TPUA 1W6TA 3H7VA 5XINA 2W3ZA 3PN8A 1WZLA 2G4JA 2VT0A 3NSNA 3R2GA 4PBGA 4FEZA 5AZ0A 1QI0A 4IIEA 2WCSA 1UP3A 3GTNA 3RCNA 2VD9A 3W02A 6CGTA 3T9PA 3EWBX 3MYPA 5D2YA 1XXXA 3THCA 2H9AA 1F9CA 3QQ1A 3D0CA 4YTRA 2OQHA 3GTIA 4AWUA 4FF5A 3DI0A 1MUMA 1T8XA 3NG3A 1LJYA 4ADTA 1F76A 2XH7A 1KM1A 1EB3A 2A3LA 3A3WA 3GQYA 3T8QA 1FWFC 1DJWA 1HVQA 4JTUA 2DVXA 4KFNA 1PDZA 1WKFA 1OFDA 3N1AA 2HE5A 2OG9A 3EKZA 1PTDA 5G5IA 2E5DA 5C7VA 2HCVA 2H3DA 2YDSA 4JHOA 1U30A 4M6QA 5DEZA 4KWVA 1QUMA 1G1YA 1UR2A 2D2OA 3CH0A 3E96A 1I9CB 5CEWA 1V51A 3MVIA 3H2MA 1NJJA 1LQ0A 2X2GA 3VNLA 4J2PA 2YR1A 2C71A 4FMVA 1KM0A 3GYEA 3CMGA 1ONEA 1N8FA 4O0KA 4ZB2A 3GS6A 1F6YA 1OD0A 4GO8A 4QJ4B 3ECQA 3LHTA 4HPNA 3MI3A 2XU2A 3DERA 1E6RA 3FLUA 4WSHA 2ISSA 2WVTA 3IUHA 3AIWA 1ZNNA 1J8VA 1FWSA 3W29A 4NZ4A 2BHUA 4HZ7A 2QDGA 4JTKA 2GGIA 1MDLA 3MP3A 3S5YA 2J7BA 3GW3A 1LBLA 2P76A 2Z6IA 1ZUAX 2YA0A 2FZBA 3VXGA 5KEZA 3QHNA 4MYXA 1A5NC 2FIQA 2NT0A 3TZFA 1K8CA 4G6CA 4AISA 4BK9A 2DT3A 3G0SA 3ZYZA 1E40A 4HBKA 1A5LC 2GK1B 4FALA 3PJTA 2VDIA 2QPSA 3WDRA 4CU7A 2FZ9A 2A3EA 3U2EA 1WP6A 1DEDA 1WYIA 1FCUA 3B8UA 3KRBA 4IIFA 4PN2A 2J47A 1GPWA 3PULA 1EBHA 3W2UA 4IQEA 1V6XA 1XP3A 3VPLA 3W1UA 3EPMA 2ZTKA 3DFOA 4PC8A 1EJVC 4ZODA 1GYMA 4A3HA 1KB3A 3NXFA 2WQDA 1WV2A 2GJLA 3C8NA 3P6LA 1UJQA 3N34A 2ZZ4A 3LCLA 3QZ6A 1FWIC 5AYIA 1E4NA 1WXZA 3CZ8A 3W76A 3A22A 5I03A 4NJIA 4XZMX 4IX2A 4MJ2A 3WNOA 3M0LA 4ZA0A 1T7LA 3GNDA 4MJ4A 3BAIA 3DH7A 2R9RA 4KFPA 1FRBA 1WUEA 3DG3A 1B30A 4GUGA 3C4UA 1RCOB 3CH9A 2BTMA 3MBFA 2HQAA 4JBRA 4K36A 3E2RA 3WD1A 3CAVA 4Q7BA 2ACUA 4H6KA 1Z89A 4A21A 3MUIA 5H1WA 3WIJA 2EG6A 1BYDA 5DXYA 4LAOA 1CIUA 3OLGA 3SBFA 4JICA 2VHLA 3CWNA 2PDFA 3TSMA 2XUCA 1JD9A 1PO9A 3BV4A 2Z7KA 3L65A 3W53A 1DJIA 4XSMA 3W7KA 3VOHA 3GH4A 1XCXA 3ZQ9A 2VJXA 3GK0A 3PFRA 2F84A 4MNJA 3BSHA 3HU7A 2W92A 3PAOA 3HPAA 3AALA 4JNYA 2FGLA 4PYSA 2PF8A 3SUTA 3S1GA 4L4PA 2UBPC 3AJ7A 1XRVA 1AZ2A 2VC6A 4Q7IA 2XVPA 2PBOA 3UQNA 3VDGA 2GVEA 4IPJA 3AXMA 2J7GA 2DH3A 2DY3A 4EF9A 2GQ9A 1TWZA 1C8VA 1BWKA 3EDEA 2A21A 2GQ3A 2QJIA 5AECA 1OT1A 1E4MM 2E68A 5BNKA 4UFMA 3TYBA 3W7HA 4LYKA 3TAKA 1E9YB 1DTNA 1E1CA 3O7UA 1H5YA 1QBBA 5BRQA 1ZJIA 2I7GA 2OX1A 4NNCA 1I0DA 2E1WA 4IWWA 2XJ7A 1JDAA 3H4XA 5CGQA 5HNNA 2GVYA 4RNJA 1G4EA 5CCZA 5TIMA 3WJZA 3S8HA 2Y8UA 1PZ1A 2OT1A 4GUJA 2KAUC 1TTIA 2JF7A 3ONBA 1EGMA 3AQUA 1A5OC 1LDCA 2VI0A 3VK5A 2VDGA 4GIEA 1PIIA 3DECA 4L1XA 3EA3A 4O1DA 3RU8X 5C5YA 2Z00A 4IUGA 2WKJA 4IHCA 5FF3A 3PZNA 5B80A 5CAKA 1XI3A 1DHPA 2R1LA 1S3TC 4L4MA 4DLMA 2O92A 4HTBA 3ABOA 1QWKA 4ZR8A 5CJMA 2R6OA 3WF1A 1CGYA 3ARQA 3M41A 2FKPA 1I60A 3GDRA 1XFCA 3GH5A 1M65A 4ICMA 4JDBA 3PB0A 5K9XA 1TV7A 3N19B 3S2CA 3CZKA 1XLCA 3Q94A 3V35A 2XIQA 3WMSA 5IBXC 4JIIX 2GYIA 1PZ0A 1W2PA 2WC3A 5KZEA 2C0AA 5AC8A 1L6GA 1UQZA 1POKA 4G8TA 3RUBL 3DHDA 4ES4A 2A85A 2AKMA 4I7VA 4K7VA 4XX6A 4HK5A 1TZ7A 3SJNA 5E0FA 4KRZA 5C9UA 3EB3A 3W1NA 1ONXA 1R30A 5CPOA 3S6DA 3OVPA 2HXTA 3AFBA 2BG5A 2YFOA 3GFYA 1RBLA 3WQ4A 1BTMA 3ATYA 3L12A 4NZ3A 4IQLA 3AWNA 5A6TC 4LWWA 4UQDA 5MHBA 2YCJA 1Y5WA 2JKEA 3N14A 4DM1A 4XD3A 1R86A 3IGHX 3LRLA 1IHIA 4CD4A 5H8MA 4UZSA 3O15A 1OBAA 1PIGA 4DJDA 3Q37A 2WNNA 3ELFA 3PG9A 3VGDA 1Z8AA 3IGUA 4FPSA 3VAVA 4YU1A 1VR6A 1OQFA 2VDHA 3M5ZA 4LAUA 2ZZ2A 3KS5A 1JZ6A 1BYAA 4H2CA 2QCGA 4M19A 3CUGA 2XDFA 3SCPA 4HJWA 4HSOA 3S2MA 2YSWA 2W67A 2E9MA 3S2JA 1V02A 4FOUA 4AAJA 4IPLA 1GGOA 2Z4GA 4R7OA 1A47A 1P0NA 1XWYA 3TJLA 2YB1A 4G1KA 1EX5A 3LDVA 2QNEA 1DQWA 4Y8EA 3MZ2A 1R9XA 4K39A 1BGAA 2CBJA 1SO6A 2GPTA 2OQLA 4O4VA 4E4PA 2WNZA 1E0VA 4C1NB 3N3MA 1FHDA 4EPDC 3BW4A 4NIRA 1WCGA 3TQ0A 3T0TA 4D6FA 4H2HA 1F3XA 1FHVA 4UFJA 1EJWC 4CVWA 1LUCB 3QN3A 3WFLA 5CBBA 1OIMA 1W9UA 1GORA 4DPPA 4ECLA 5K3VA 1JCTA 4C6DA 1H7WA 4CKQA 3VIFA 2FTYA 1JFHA 2WHJA 4Q6JA 5LXEA 4P5UA 1XC4A 3OQ8A 5E9AA 4M1RA 3BG9A 1Q2SA 2UV8G 3KOFA 4Z08A 1UZ1A 1ZCOA 1WDSA 2ZUUA 4PB3A 4GFSA 3L66A 4DX3A 1LT8A 4H9XA 1Q7QA 1K7EA 1US2A 1TCMA 3BAJA 5C0QA 4JS3A 4N7QA 1X7FA 4INFA 1ZL1A 2JFEX 1RBAA 4JIRA 2Z1KA 3CEUA 2P53A 1RCXB 4GUFA 3QVQA 3VD9A 3BLDA 3P5YA 1XLHA 1XLMA 3MCNA 4QQUA 1OYBA 9RUBA 1PZ2A 3WD3A 3MQTA 4ADUA 5EL1A 5HUPA 1LOQA 2YLLA 1GZGA 4IGMA 4JCMA 5A6AA 1XSJA 4HIBA 3CWHA 3EPNA 4BCEA 3IIVA 3N18A 4YPJA 2PCQA 3KFTA 3TFCA 1LYXA 3MSRA 1UIOA 1CZ1A 2V5LA 3VMPA 2INFA 4GZJA 1TE1A 1XIMA 3OA5A 3SECA 3EPOA 3TYEA 2JGYA 3N6QA 3IJQA 2ZC8A 3IK2A 3WN6A 4QG9A 3EWZA 1U5JA 2ZRYA 2E6YA 3I3BA 4HMNA 1I8JA 4G9PA 4MIMA 1A0DA 3UR2A 3LCHA 4LVDA 4JXCA 4XAYA 4UTWA 1JRBA 3ZS4A 4FI4A 1W1ZA 1B3OA 1H7NA 1R47A 1NVMA 2BY3A 1GTEA 1NAL1 4Q8MA 2VOMA 4Y96A 4ATLA 2XGBA 2GJPA 4PZVA 2NV9A 4WGHA 5CZSA 1L6YA 3EOLA 2OZTA 1QPQA 2O0TA 4MMWA 1H7RA 3R13A 1KFKA 2J78A 4H1ZA 4XKYA 4IP7A 1TQJA 4NAEB 4A3UA 4D71A 4LVAA 2F6XA 1PKNA 3UXDA 3VOFA 1OC6A 2VQTA 5I6SA 5ABFB 4L9YA 3LTSA 3LEPA 4BZYA 2PDLA 4NRSA 4IIHA 5GVJA 1GPFA 3G0UA 3PZGA 1J6OA 2G3IA 1UA7A 3T0CA 4LAMA 4AHPA 3MMWA 3S83A 3WH9A 2QQ6A 3L7RA 3GE7A 5JXQA 1E6ZA 1D7KA 1JXJA 5BMXA 4U28A 1GG1A 1WBHA 4MNMA 4XUGA 5C9XA 5I09A 1WB0A 3GR7A 2V69A 1MFVA 4NYUA 3LXBA 2GDQA 1V6YA 3CIWA 1VEMA 3KBSA 1G7VA 2B7QA 3WKZA 4AIUA 4WHBA 4JQ3A 3VZZA 4UFIA 2CEQA 2WK2A 2OXNA 2CKRA 4XD6A 3VD5A 3A9IA 1LF1A 1WXJA 3H2CA 1OFPA 5CPSA 1TRDA 1DWIM 4HT3A 4WCJA 1FWHC 1KBLA 3NQMA 1RHCA 4I9JA 1UOZA 1KGWA 5LNSA 2G3MA 4AC7C 3IJ7A 3K1GA 4Q8OA 4MNLA 1EF2A 2PGEA 1E0WA 3V16A 1SZGA 3U7VA 3S4TA 2PTYA 2I17A 3OZOA 1AJ2A 2PWEA 4MUPA 4GUHA 2NX3A 1EF3A 1SJDA 2WJZA 1XYFA 4Y6GA 3HM7A 1SO5A 4LS0A 5EMLA 2VZTA 3C2RA 4GABA 1SU5A 3JR2A 4ZE4A 3ZJ6A 1FKWA 1I0BA 2OT0A 3MKCA 2W63A 2BGQA 4EK7A 3T55A 4J3VA 4X2PA 3ZSTA 3W7RA 3NDYA 2DT0A 2QULA 4US6A 3W70A 5I5RA 1ZY9A 5DY2A 1U5VA 1JPMA 3QR0A 4POCA 1KO0A 1K03A 4R34A 1KCLA 1SJBA 4ASTA 3QFWA 2GK1A 4MVAA 3LPOA 4IMGA 1VEPA 3LNMA 2A4AA 1GYNA 4YTSA 4MJMA 3DKJA 1EOMA 4HN8A 1OWQA 4H9VA 2XM2A 3BGAA 1ZQ5A 3W9ZA 3WUEA 6TAAA 1UC5A 3ABQA 1XIFA 5AHFA 2G3FA 4DM2A 2OGYA 3OHIA 3WBWA 1JAKA 2QUVA 5C8BB 3OP2A 3PUDA 4Y2WA 5F2MA 3UU0A 2PDIA 5AY7A 3S46A 1NFBA 3OQEA 1V4YA 3QYQA 2FVLA 2G50A 3GNNA 3A64A 4BKNA 3REQB 1LOLA 2XVGA 3LQGA 1HJSA 1IWBA 5CSYA 4L4LA 2J6XA 1PS9A 1YADA 4DBWA 6PTDA 3S42A 5CPLA 2C14A 1Q8AA 1U2YA 5A2CA 1NELA 2F9RA 4QCFA 1WOAA 1I6NA 1G4PA 4B5WA 3SCNA 4F3HA 3QOMA 3E5BA 4JIQA 1OGSA 1VHCA 3EXTA 3PNZA 3GZAA 2V81A 3AICA 2FPYA 5LKYA 2TMDA 3A23A 5FJRA 5G1YA 1EQCA 2DORA 4X9SA 1I1WA 1NM9A 4GQGA 4MJZA 5CPMA 4PMNA 2OEJA 6A3HA 4YNGA 1A50A 2BHZA 1UD3A 3EMCA 4PCNA 1EGZA 4GC4A 2HVOA 3E49A 4IXHA 3P74A 1UHVA 4H19A 1CXLA 1E15A 3IS4A 4EAMA 4H4IA 1XLIA 4PGLA 3ZWTA 4GIAA 4J1OA 4X0VA 2GSEA 4R27A 3D47A 3SB0A 4AG0A 2DQXA 2ZADA 1RA0A 4HHHA 2Z25A 4EP8C 3USZA 2QGYA 2VC7A 1MUCA 3OG3A 1R3WA 2PWGA 4ML4A 5LIYX 1H63A 1EC9A 3KP1A 4PSRA 3M0HA 1KWKA 4H9UA 4AZ7A 4QSHA 4DJDC 1O60A 3S5NA 4ML9A 4IGNA 1PYMA 1MNSA 4IP4A 4HOWA 1V93A 3BJSA 3B4YA 2XFWA 4HNLA 4KWWA 4PMXA 1ESWA 1TYGA 4JHMA 3IAPA 4XO6A 2ZX6A 4UTIA 1TPB1 4ZMGA 3DHFA 4AMCA 1C92A 1FH8A 1OFRA 1EPXA 1LL6A 4A3QA 1NWTA 4OQVA 3B97A 3VIHA 4ZBCA 1TVLA 4PA8A 3MA8A 2RDWA 1B54A 3NGJA 3DIPA 4TUFA 1S38A 3FCPA 1EGVA 1OIFA 3THUA 3WQWA 3ANYA 5A95A 3PG8A 1UBSA 3R79A 3BOLA 1EP1A 1V02E 1E5JA 1VF8A 2Z1VA 2V5CA 4AW7A 4Y7EA 3TP4A 3T8LA 2WJDA 4U33A 1CGVA 3AXKA 1OX4B 2X2YA 3KRUA 3CAWA 4GCAA 5M03A 1JDEA 1XQKA 3SUVA 1CW2A 3FSUA 1REQB 1RLCL 1RR2A 4QNWA 3S3GA 1IZCA 1G9HA 4BA0A 4QR6A 2ZUTA 3FHAA 2NXHA 1E6QM 4FNUA 3PZMA 3TDFA 4KCWA 3AIEA 4GIYA 2OSYA 1UMLA 1TJ0A 1Y65A 1PUDA 5D9MA 1T41A 1PWMA 2NXIA 1JRCA 3IJLA 3NIYA 3D3FA 3TYUA 3CPUA 2AQOA 1Q45A 1WDDA 1XGEA 1NIUA 1HN1A 2YDQA 1KM6A 4CNPA 3TN4A 2E5CA 2GOKA 3GWQA 3PY2A 3CYVA 2OOFA 3W00A 2RGLA 2QIWA 2WCAA 2QAFA 1BLIA 2G0WA 4RPPA 4XAFA 1XBXA 3SSJA 3PPGA 2EEXA 5HNRA 4I3GA 3MI6A 1SO4A 3STFA 1FBAA 4MY9A 1I2OA 1S5NA 3VA8A 5XIMA 1UWTA 4MM1A 5MF5A 1DJZA 2QYGA 3SADA 4J27A 3CQIA 3SDOA 4CU6A 3UD6A 6REQB 1Q2RA 4QJ1A 4RXGA 1XQLA 1AQHA 3HTWA 3LYEA 2TPSA 4I8DA 1QFEA 2NSXA 4UOJA 4FB7A 5K9DA 2PD9A 4EOUA 4NF7A 2FZDA 1XPGA 3SZ8A 4Y9OA 4UTWC 2WMIA 4H6RA 4E2OA 3H55A 4ZFMA 5AYXA 3G8EA 3DC0A 4X63A 3UF9A 1XLDA 3PHAA 1OFEA 3ZR6A 2YX0A 1QOXA 3IRSA 2OOGA 1IZJA 2UY2A 3CV7A 1EP2A 2VFGA 3PTQA 1HJXA 3N2MA 4YCOA 3R43A 1EQPA 3E2QA 2X1RA 3ARYA 4B4FA 5IHRA 2VEPA 4C1NA 4NUWA 4IPPA 1J10A 1YDNA 3PB2A 2XH2A 1T8QA 3LXAA 4LF2A 3VM7A 4O1CA 3TXVA 4BS0A 1RPKA 2VM8A 1O7AA 1BYCA 3TX9A 4JQAA 4C6NA 3E0VA 3T44A 3H8AA 1JF6A 4NU7A 1IEIA 1N8IA 3NZQA 1AQ0A 4GVFA 4OUIA 2V5BA 3M47A 3U2ZA 1BSLA 2Y63A 1WPCA 3A4AA 1W32A 1UR1A 3EMZA 1KTCA 3OB8A 4GX8A 4O1BA 4LT9A 3NR0A 3LD5A 2GDUA 2F61A 2ZXBA 1P48A 3IIXA 3WMCA 1UH2A 1FWCC 4W4QA 4NY2A 1HFBA 1VKFA 1R3YA 5DQPA 2VFDA 2CBUA 4QQ3A 1W54A 3WQVA 1EDQA 3SEPA 3MSYA 2FMOA 4L9XA 1O68A 3UYCA 5JIPA 1TZZA 4RPQA 3TMQA 3C2YA 1KFCA 3P61A 3RJXA 1TTJA 4HOZA 5DO8A 4K38A 3ZO9A 3SQMA 1FXQA 4E8CA 4DBEA 1CENA 4UMCA 4QG6A 1X98A 1NEYA 4QBXA 1GZJA 4U31A 4UTTA 1XINA 2ZOXA 1O66A 4M7TA 4REQA 3GXIA 4MLJA 3A9BA 4YXGA 4YTTA 2JGQA 1I2PA 1GT8A 2VP8A 2AGKA 2VXNA 1OGGA 1TKKA 3O9NA 1YKWA 5EYWA 1V08A 3VMNA 2E9BA 2J9ZA 2Y7GA 2BNJA 1MW0A 4K2SA 2BB0A 8CGTA 1E0UA 1TWDA 2QJGA 3B0VC 3S9YA 4G7FA 1C7SA 4JNZA 4P8VA 1UD5A 2VX6A 4S3BA 4DB7A 1K8XA 4QROA 2CKSA 4WKAA 3PPFA 1AW1A 3QEZA 1ADDA 4ZFCA 3GXFA 3L23A 4N9DA 3LU2A 4A8IA 3I7SA 1VFFA 3KRSA 4NAEA 4F40A 2EG8A 3W2NA 1F4HA 4GI8A 1TJ1A 3WQ5A 4HCLA 3T42A 4RDYA 1TJ2A 3QV7A 4F2BA 4PMZA 4OGZA 2J7CA 2MANA 2WOQA 1U33A 1GOIA 2YJQA 1V8EA 4RZ4A 1S2CA 2IW0A 3KDOA 4LUJA 1LL4A 3VUSA 3VOCA 2ZA2A 3QLDA 1ZLPA 1EXPA 4JY9A 1UQYA 1RCQA 4H8NA 2BBFA 3A13A 5D9OA 1KA9F 1QR7A 5KTLA 1F07A 4RW3A 2VZOA 4ZQCA 1W0MA 4GYFA 1W3NA 5AYBA 2GVGA 2R8WA 1W56A 4C6BA 4YCPA 1PL9A 1B3XA 4V28A 3IAQA 3QM3A 4R85A 3N4EA 2E6FA 2TYSA 4GXMA 3K4WA 4LW7A 1D8CA 1IQ8A 3CHDA 4LVGA 3B8SA 2H3BA 2AMGA 3T05A 2VGBA 3H21A 5LIXX 5CGMA 1UKSA 4I9TA 2XSBA 3M5YA 4AU0A 3G6MA 3H7UA 5D32A 3VUPA 5PTDA 4C6QA 2GZXA 4NYYA 2PTXA 1PHQA 4XIMA 1SFJA 1W5NA 5D09A 2HRWA 4DBSA 1K9EA 1V3JA 3W2MA 3LENA 3HMJG 3FKKA 4QGCA 2WJFA 2Q8LA 3ZVHB 4EIVA 1Q13A 2X7WA 3E0LA 4BQ5A 5D9PA 4ZOAA 3SCTA 4Z1AA 4C6JA 5LHFA 2XSXA 3BLLA 3GVQA 5DN1A 3K4AA 3KCJA 1B2YA 1UB3A 1TVPA 5G2IA 4AZ5A 3R5EA 1Q6CA 3NDZA 1EUAA 2HISA 4NG3A 2GVJA 4C7DA 5ABGA 3PF3A 1E4IA 3LXCA 1KR0A 3VNIA 2VR5A 1Q6QA 1AMKA 2W79A 5FF7A 2ZVIA 5A5WA 1O5RA 4LUYA 3RLHA 1J9YA 1VFLA 4NKCA 4QCEA 2NLIA 5FJPA 1IIHA 1W1YA 4V33A 3WLRA 3AUOA 2E4TA 3HN3A 1PKYA 4L4OA 1TPDA 5J8LA 1Q5MA 4NVTA 3TNBA 3SRDA 1DE5A 2NUXA 4QLJA 2DIKA 2WBKA 3LZ5A 3VNZA 2OWCA 1EO5A 4MTVA 5F2IA 2DSUA 1UKTA 3QHMA 8RUCA 2DZAA 4AZCB 4AC1X 1CWYA 1K02A 1CXFA 3TMLA 4NZ1A 2DT1A 3TTQA 4FNPA 1WDQA 2ANUA 3NCOA 4HNTA 3H2AA 4B9ZA 3REQA 3BARA 1PYFA 3NYZA 1OABA 2AGTA 2TSYA 1GHRA 4L1GA 2PLJA 3EOSA 2QDEA 4XAZA 1MEHA 3G5EA 3BLPX 3WLPA 4M80A 3NNTA 2E9LA 3SGZA 3WYZA 1IGSA 3L4XA 7TAAA 1TV5A 3GIPA 4PTVA 2RJHA 2IUZA 2WQPA 4AD2A 1XLGA 1EP3A 1WKYA 3EWDA 5G4WA 4BF5A 1F7BA 1L8PA 3G1SA 1IXPA 1AVAA 5TNVA 4ERIA 2XZ7A 5FJUA 3GH7A 5I2UA 2E77A 3EDFA 5I77A 1HL2A 3CQHA 2WHLA 4AIOA 3LRMA 4ATWA 2YYTA 4L61A 1QK2A 5CQ1A 2AL2B 3GYCA 1GKPA 1W3HA 3UNTA 4P8XA 4DI9A 3BCFA 3W26A 2X05A 1M7XA 1YPFA 2C6QA 3GLCA 2I9EA 2QPXA 2NVCA 1THFD 4PTXA 1E55A 1K3UA 5JUVA 2QF8A 3C2EA 5K7JA 1UIPA 2ZRUA 3LCIA 3GVRA 5JBEA 1VPQA 3FXYA 3VKDA 3N2TA 4IFOA 4QXIA 1D2KA 3N11A 4NL1A 1Q85A 1SO3A 3CQJA 2FH8A 1S1RA 3OEXA 3STPA 1OINA 2ZE0A 5CLTA 1R6WA 2VEGA 4GJJA 4HNNA 5BROA 1OSEA 3OZMA 3T0BA 1WO2A 1ZBCA 2G8ZA 3ALFA 3MB9A 3WH6A 3E0IA 3PWGA 5I7GA 1TR9A 4DVOA 3T7VA 2CZDA 2PC4A 3NFUA 1XV8A 3A4XA 2DW6A 4Q32A 2GLKA 1ITQA 2ZXQA 2OFJA 3C2OA 3LV5A 1MRAA 4J3SA 4AWSA 4QTGA 3N9RA 3JZUA 1DXEA 4HU3A 1E1EA 4LH8A 4XBJA 2I1OA 4AIBA 2Z27A 2CXGA 3KRZA 4XZWA 2V67A 2ZYFA 2VO5A 4DQWA 3E3HA 4LS1A 4PCFA 2QJJA 2VVNA 3QR1A 3FX4A 3GAYA 2POTA 4X0NA 2WLYA 2Y5JA 1EHAA 2PDNA 3RO8A 3VFCA 1EZ2A 4PUMA 4JTJA 1SW3A 4BI5A 3S2LA 4B5SA 3IV8A 4UQCA 4JIEA 2PDCA 4D6DA 3TJ4A 1OCNA 4O0QA 2WWCA 4YJ5A 3EB2A 1REQA 3DYMA 3UVAA 1LRQA 3PBMA 3O63A 3N9SA 4ERGA 4MWAE 4HD5A 1LQAA 4K8HA 1JQXA 4MY8A 1WAWA 4Z2HA 2ON3A 4W87A 5I00A 4O1EA 1ZS2A 2NXGA 2QR6A 2YCLB 3C0JA 1HT6A 1TRIA 3U9IA 1KV5A 1R2TA 3FDKA 2GUBA 5BXTA 4LC6A 5AC4A 3URNA 4ZL1A 2QT3A 4DEFA 3HGJA 2XHYA 2YL5A 3BLKA 4NHVA 3MANA 3V18A 2IXVA 1XHGA 1R3VA 1MSSA 4M29A 4JZ5A 3QRHA 3ZJ8A 2XN0A 1O12A 1WZMA 3K8MA 2PDKA 2R91A 1TB3A 3C61A 4LUSB 2GGJA 2NX9A 4QE1A 4UTTC 4Z1CA 5ECVA 2PCEA 3WUFA 3VIPA 1M01A 2XTKA 4CN4A 1J0HA 2BX7A 6REQA 4ZQOA 1GW9A 3U4AA 5AOUA 2W62A 3GVGA 4AWEA 3NQ7A 4WSKA 1ZTVA 3VO0A 1JCXA 3DYOA 5A6MA 4AY8A 1V3KA 4K68A 1KBJA 1VFHA 1HW6A 3HFTA 2WNWA 3P81A 3GKFA 4QNEA 5A6BA 3U5YA 4X61A 1XBZA 3DFYA 1Q6EA 3RFAA 2DUXA 4OU1A 1TWWA 3DX5A 4LEQA 3LY0A 1P7TB 3ES7A 2PDPA 1V0MA 3IRDA 4C1LA 2ZUMA 5LYRA 4L6OA 3TN5A 1VRXA 3SY1A 1N2VA 3WMLA 2PFHA 4DXXA 3C0QA 1DIEA 3MCMA 1TPVA 3S2NA 3IWPA 2PRHA 3LLXA 5A2BA 4PUJA 1KR1A 4LAKA 1WDWA 3V0UA 1AJ0A 1OCJA 1FWGC 3KHJA 1S5VA 1EJ7L 3WFAA 3WH5A 4ZQNA 1JF5A 1ICPA 4LU0A 4CUCA 2YGYA 5AHMA 3TJIA 2RH9A 3KCOA 1KRBC 2ISVA 1FFRA 1EIXA 1QJWA 1X6UA 2E28A 1K9TA 1OADA 3B05A 3M46A 2F8QA 1KLYA 1VYSX 4O28A 3B3DA 3BC9A 4RZ5A 3G6LA 1DJHA 1SUXA 5A1AA 2QF7A 1E0XA 5D04C 1K4GA 1ZP4A 4RL3A 4CQ8A 4A6GA 8A3HA 3CUJA 1LG2A 2CZ5A 5D9NA 4OT7A 4DI8A 2EBNA 3HG5A 4WIWA 3ARVA 1DHKA 4MB5A 3HV9A 1G69A 1I2RA 1XG3A 2B81A 2WMKA 2EPNA 3S9ZA 1TPH1 4YS1A 1A49A 1EZWA 1RBOB 1M68A 4IIDA 4DJED 2AAAA 1XH0A 3W81A 1FKXA 1K8YA 1RD6A 1VB9A 4YWSA 3KVLA 4IGSA 1GVOA 1TUXA 2XN1A 2F6UA 2WZHA 4ACYA 1BXBA 2D22A 2WHKA 9CGTA 1JPDX 4XZ9A 1HJQA 3N15A 3I6TA 2RDTA 3SSZA 5IDZA 2HJPA 4WDWA 1SZRA 2AMXA 1GEQA 1RA5A 2H9AB 1F6KA 2MNRA 3N17A 1GVQA 4YVXA 1H7PA 2HNEA 3PWIA 4S1FA 3DGBA 4MKVA 3DBPA 2X8RA 2BVWA 4HNVA 5GQBA 1V77A 3QFEA 1MMFA 2ABAA 1FP8A 2PD5A 4NZJA 4EXBA 1GTHA 3N13A 2XN2A 2D3LA 1NFPA 4ORMA 2O4QA 4PBFA 1XYBA 5BWFA 3KBVA 2ASHA 4DJDD 3IJDA 4FXJA 3AIRA 1KM5A 2V3GA 1LP6A 4M24A 3ITXA 4GUIA 3GHSA 3HGSA 3Q65A 1ME9A 4KETA 1NY1A 5JBDA 3AXIA 4P2VA 3OOQA 5DXXA 5GNXA 3KAOA 1A5MC 1CCWB 3SRFA 2X1UA 5C9WA 2VNCA 3W25A 3B9OA 4FO4A 2Y61A 3P84A 3QGAC 2ZUWA 3TWAA 1XIEA 1PPIA 2NVAA 3L4WA 3CYJA 3GFXA 3BPWA 3AOFA 2DZUA 4JR5A 1UOKA 3H6OA 4IQJA 2J9YA 3LPFA 4IIGA 1VC4A 4S3DA 1FWDC 4MHBA 1R3QA 2WNQA 4W8LA 4RR4A 4YYFA 1BWLA 4QM1A 5A6LA 2BFGA 2Q3OA 2PDGA 2RDUA 4JTRA 3KZSA 4ACZB 3IIZA 4GLEA 4ZOEA 1EEXA 1EJTC 2UY4A 3RIKA 3R6IA 2BSLA 1P0BA 3BMWA 1YW1A 4PFHA 2DH2A 3G1FA 3WLTA 2XIBA 2DW7A 3GXDA 3SM0A 1NP2A 1ONRA 5T8GA 5BZAA 2GQAA 1BQCA 1MW3A 1M9HA 3LLDA 1LL7A 4PMDA 1WDRA 1ME8A 4HHLA 1W8SA 3IJ6A 1H1NA 5EB8A 1XRTA 3NSMA 2E8YA 1F74A 4NXSA 3W72A 1R87A 5HXMA 1DE6A 2VEFA 4B5XA 3ZVHA 3VTRA 4F9JA 2OELA 1TPC1 2PTDA 3LHUA 3PBYA 4H9MA 3NURA 2O7SA 1LORA 4QAIA 4KRTA 4MUZA 1DQUA 3VKAA 4OBSA 2A3AA 1Z69A 4TVUA 4FNQA 3IV3A 1R38A 2YFNA 3G2GA 4RE2A 3UCCA 4I7UA 3GXPA 2NQLA 3MZNA 4PODA 1B0IA 4CD8A 4AHOA 5CZJA 2LLEA 1XD1A 2PGRA 5C55A 2G96A 4M51A 3LHWA 4H9TA 3UY8A 1H3GA 3LPPA 3FV9A 1OT2A 4TX8A 2J7FA 1AZ1A 2UY3A 4WX2A 4UR7A 1GJPA 2YIHA 1RAKA 4H9YA 1QHZA 4MAVA 1GEHA 3UJRA 3V7PA 1O5QA 3P3BA 4CNOA 4GYJA 5HMDA 4AVOA 4R33A 1F8IA 2IXUA 1TIMA 3QSRA 4LYRA 4PRWA 4E4UA 4Q4KA 7XIMA 2C18A 4J3ZA 4DLFA 3OBAA 2CLPA 2CHOA 1K4HA 3GBDA 1HIZA 4K8EA 1E6XM 3CL6A 4G7EA 2ZC1A 3QMTA 1AK5A 3G1YA 3B04A 3RJYA 3CQ0A 4JFVA 5MKGB 4JFWA 3O0KA 1MXDA 2PWFA 3MS8A 3ITVA 3TQVA 3ORWA 2XVNA 1YDYA 2A1YA 4IMEA 4W86A 3MV01 5BXPA 1XUZA 4NZCA 3RM4A 4NRRA 1TUFA 2WMFA 2QMKA 2OU4A 4EACA 5E70A 2EAWA 4PMUA 2Z1BA 3EWCA 5D03A 3MU7A 4D8AA 4UBPC 3GDBA 3MUCA 1J12A 3QBUA 3HFYA 4WOZA 1XLAA 1M7OA 1JAEA 6XIAA 5FEPA 4KH2A 1NDZA 3GXMA 4PEKA 2YBTA 4KW2A 3K13A 4F2UA 3NO1A 1W3IA 4NILA 3SIMA 3PZTA 1B3VA 1C90A 1ZJHA 4PUNA 2A3BA 4FP1A 3VZXA 5C70A 1GQIA 4P7OA 1HJUA 1HZYA 3C3UA 1G7UA 4NSBA 1I45A 2R24A 1VBJA 3H4GA 3OZPA 1WXYA 4GI9A 3P0WA 3GKAA 1XJBA 2VRQA 1SR9A 2I14A 3ITTA 2YCIX 4XD4A 1C8YA 2Y0FA 3W3OA 3S5SA 1W5QA 3U5UA 4RE4A 3V0SA 1EH9A 1TMHA 1XLJA 1QOPA 4N9BA 2X1SA 5LXXA 2XGIA 5HNTA 3VNYA 5EBUA 2DEPA 3C86A 4J3XA 5JH2A 1EIBA 2OZ3A 2X1TA 3J7HA 1E6PA 2E3ZA 4QFUA 3C8FA 3VGHA 2W9MA 3POHA 2VC9A 4E6MA 4JPGA 4LOCA 2GOUA 1OK6A 3ANUA 1Z42A 2ACSA 4HMEA 3H23A 4N6FA 4JTAA 3HIJA 4WKFA 2R1NA 3FGCB 2X09A 3TZNA 3GTXA 1J2WA 2Y1HA 4PRRA 4D8ZA 3WDQA 1OK4A 4ZQPA 2DGAA 4IUOA 4Q8WA 3NQ6A 1QO5A 3N25A 3VNJA 1W1IE 5EU9A 1CLXA 1VFSA 1TMLA 4D6EA 2WVVA 3UJEA 3BZJA 4D1JA 4B16A 1C9DA 3T08A 4XISA 3WJYA 2QV4A 1XCFA 1B9ZA 4UC5A 2PA6A 5FL1A 4LNYA 3W1TA 4UNLA 4MF4A 4M0XA 1A80A 1NOFA 1PV8A 2YBUA 2Z2AA 4IM4A 2EKCA 7TIMA 3O0FA 3FAXA 1TE6A 3TCEA 1PWLA 3W74A 1RY0A 4UR8A 3OG2A 3WK1A 4S39A 3MUXA 4UTLA 4E2VA 3T0AA 1TPWA 1HNYA 3LGGA 2JQXA 1JG9A 1E6SM 3VD3A 4NNBA 5K9CA 4LCSA 1A3XA 4B2DA 2GDVA 4H9ZA 3W01A 3SCVA 4HB7A 6ALDA 3BMVA 3G18A 4MADA 1KWGA 1DTUA 4HSNA 1C93A 4O52A 5CGTA 2BVYA 1TWSA 2INEA 5E1QA 2PGFA 4RJEA 4FS9A 3SUSA 4XG1A 3WBEA 5GJNA 3NQ8A 3TYAA 1G0CA 1R3TA 3LBOA 1RALA 4DF2A 1XSKA 1IYXA 4PMRA 2HROA 2I5IA 2PP1A 3UG5A 3WBXA 1FQ0A 2YCLA 4AHQA 1BD0A 2VEMA 4DNMA 5GPRA 3GNPA 3W85A 2YW3A 2OYKA 2ZRVA 4N2YA 3VIGA 1XLKA 3VVGA 3UA4A 1EUNA 3F03K 1XBYA 2IQ0A 2FTPA 4MB1A 4ROPA 2ZX8A 2Y8KA 4TQTA 2BOGX 3AHVA 1YEYA 4UTUA 3OPSA 5AB3A 1HO4A 2V5KA 2V38A 4F0MA 2FZMA 1E3ZA 2QCNA 2A2IA 1QASA 1FH9A 1OZMA 3DZ1A 1JYNA 3NQFA 5HQMA 4N9EA 3M0KA 3BQ5A 1E72M 3BTNA 2IPWA 1UD8A 4ENLA 4E8GA 1AFSA 4D6CA 4Z1DA 4LUSA 2P3ZA 3I7RA 4F48A 4DNHA 3JUGA 1J0JA 1SGJA 2B4GA 3EX1A 3RLGA 3RR1A 3K8KA 4OFCA 1MEIA 3WD4A 1FWEC 4UQAA 3U8GA 1H41A 2E7FA 3LERA 4ZEPA 3FAWA 1F3WA 2VFEA 1QNQA 1XLEA 3E9AA 3PWAA 2OQYA 2J8GA 1LM1A 1QNRA 5FEZA 1YNQA 3WMBA 2Z7GA 1XDJA 4LJ3A 4QRNA 4DXKA 5C6MA 2PF0A 1DJYA 2OSXA 2BGNE 2CW6A 3W75A 2REQA 3SJ3A 4Z1BA 4I9AA 4LUTA 1U22A 1KQYA 4P7NA 3AIVA 2FH6A 4ZO7A 5HJXA 2QCDA 3WEOA 3HG3A 9XIAA 2PDUA 3W88A 4XIAA 1H0GA 1YX1A 3M0YA 4KQNA 1HVXA 2G37A 3LM3A 5EMKA 1U1JA 4PMYA 5IFTA 1ZP3A 3EZ4A 1PAMA 3IIPA 4WSJA 4O1FA 3B8WA 4MFDA 4CU8A 4JDYA 1RP8A 4FX7A 1DJGA 2GL5A 2ISFA 2WSQA 4UMBA 2J79A 3DG7A 3W1RA 3WQ8A 2X0HA 3GTFA 4FLRA 1DXIA 1Q6RA 1S39A 1ZJBA 3MY9A 1ELSA 1OFQA 2YOCA 1KGXA 1Q6FA 4DZIA 4ZQRA 3TN3A 3EKLA 3UERA 1J01A 4DXVA 4LBSA 1BEUA 3ITLA 5LZLA 4UIOA 4RUBA 1QPNA 1OG0A 1TTPA 2J8FA 3SW6A 1EXBA 1IWAA 4I90A 1K6AA 3E74A 3ERPA 4LCQA 1VIWA 3UWQA 4Z2GA 4DELA 4KFOA 4PTNA 1M41A 3PZVA 4XKYB 3GG7A 1AUSL 4HZMA 4I6VA 2ISDA 5JQ9A 3XINA 4A22A 4I5UA 3A24A 3S1VA 4Q8PA 1RH9A 3RPTA 4TX6A 5FACA 5DFAA 2BVTA 1T5AA 2GGHA 4LNCA 1JNEA 1PJ9A 3CT7A 1FX6A 1ADSA 1IR2A 2WM0A 4H7VA 4WF7A 6XIMA 4HMCA 4LV9A 1QWGA 5E5CA 4GFIA 3KM8A 1A4LA 3FKRA 3GD6A 2XG9A 3DI1A 4F2TA 3M64A 1F05A 4MB4A 1B31A 2V3DA 3W1XA 1G67A 4M82A 3MHUA 3HGOA 3CHFA 2QIIA 2QJHA 5F4XA 3TEVA 1EL3A 3FYOA 1A5KC 1VJZA 3CS2A 4UFLA 3U57A 3W6YA 3E2VA 2A6LA 1W1VA 3XIMA 2CBVA 4B3ZA 1UUMA 3BG3A 4MLRA 3M16A 5I24A 4UWMA 1FWJC 3CTLA 4FXRA 1EFZA 2F2HA 1YMYA 1XX1A 2CLKA 2Y7FA 1W9BM 3RDKA 3OLEA 1GOKA 2PODA 1QHPA 4OIFA 4O13A 5F1UA 3GB6A 4JKLA 4A2RA 2JEPA 1R85A 3VDHA 3AO0A 3OJGA 5BXSA 3B06A 3NL6A 5BOEA 4FZIA 4R7WA 3QY8A 1Q6GA 3PTDA 1RJRA 2GJRA 1ZFJA 5TF0A 3OGRA 4QDWA 3V1PA 3PAJA 2WB5A 4H7ZA 4GX9A 1KRAC 2OZ0A 3TWBA 3L2IA 1ML1A 1GKRA 1N7KA 2BOFX 2B0MA 2NQ5A 5M5DA 3N4AA 3NUKA 3KBMA 4IJBA 3W7JA 3IJ8A 2PSNA 4RX0A 4PTDA 2DP3A 3CZLA 1AH4A 4GBDA 4H01A 3GNXA 1G01A 2JALA 4XV0A 3GNOA 3DKLA 2ZQ0A 4ACZA 1JZ3A 3F7JA 1VRDA 3STGA 1SSGA 1K70A 1W91A 1BKSA 2PDHA 2Z1XA 4ZENA 3HO8A 4WK9A 1W5OA 4QITA 3S1UA 1ODUA 4G2DA 1KGUA 3MDUA 4FX8A 1JYVA 2BODX 3KW3A 5BOFA 2WC4A 2DZXA 5DCBA 3T4CA 1VBGA 1VLWA 3FJLA 3RM9A 4H04A 4P61A 1PCKA 4YTQA 1H49A 3UESA 4O19A 3MVTA 1ZHAA 5IXEA 4HK7A 1JXKA 1IV8A 2E6DA 2ZX9A 2HXUA 1RUSA 1UKOA 3RX3A 3JVAA 3FJ6A 4C6LA 1D3CA 3PK7A 2H90A 4GXPA 1A4MA 2OWXA 3ZLFA 1P1MA 1C8XA 2OB3A 3KBNA 1L2QA 1KTNA 1OD8A 3WCZA 5CSRA 4QHRA 2E1DA 2Q8ZA 3B4UA 4UQEA 4WLCA 1CI1A 1JCMP 4FXSA 4XZIA 5G2WA 4QE5A 3SQSA 5FESA 3WLIA 5HUOA 4C6KA 4K37A 1A0EA 1CBGA 3PZQA 2CLHA 1CB2A 1XG4A 3QQ0A 2C16A 5T9CE 2GJNA 4UNIA 1EA9C 2WM1A 3N2XA 1UR3M 3UFYA 2CU0A 3DHPA 2QCEA 1HX0A 3P5ZA 3QW4B 1VP5A 1MDRA 2ZICA 1EJXC 4HZ8A 5FJJA 3LOTA 3W73A 3EB4A 5GJMA 1HXJA 4NXKA 3N6JA 3ZVIA 1SMDA 2YDAA 4LAZA 2HPIA 1BVNP 2QJMA 3LGDA 3SGGA 2ATMA 4HQVA 3UW6A 2PDWA 4LALA 2F38A 1VYRA 2OYMA 3WH8A 2WZIA 3KOXA 3T2PA 5MKGA 5HA7A 4GZ7A 3WUBA 5FAJA 1R0MA 4CNTA 1Y5XA 2WWDA 3TV8A 3A47A 4J3WA 4W7WA 2V63A 1PIFA 3W2KA 5HR6A 2VEKA 2GJXB 2PDMA 4YLWA 3G1VA 1XIHA 3VC6A 3AUJA 3LX9A 1QK0A 1NWSA 5A94A 5K2ZA 2C1HA 4LUIA 2OPJA 1X1ZA 1FWTA 3FYYA 2CFFA 3UZYA 4GXWA 1SFLA 1CLVA 2HS6A 1UYQA 2UWFA 1KFJA 2MUCA 3NSXA 4ERAA 3OVRA 2VMFA 1NWUA 2OEMA 2VCAA 3LM7A 2WZEA 1L9WA 3EWXA 5EMJA 2E0PA 1UWQA 3MW7A 3DHUA 4KMQA 3W84A 5AHNA 1GOQA 3AS1A 4DJFA 5I23A 5ABEA 1RSCA 4RXFA 2FHFA 3GDLA 2J66A 3U0HA 4KT2A 1YNYA 4IJRA 4XZHA 1YDVA 3HF3A 3ALGA 5CG0A 4PL2A 3MHFA 3KZPA 4F79A 3ARUA 4IPNB 5TD4A 4ZB5A 1MQQA 3UGRA 3WEZA 3IVTA 1ZZMA 1POJA 3K1DA 4JN8A 4PFMA 1OB0A 3EEGA 2HK0A 4R88A 5T26A 1UD6A 4D6HA 4Z2JA 2QW5A 4HN4A 4JTDA 3QPYA 1QI3A 4DJEA 3W23A 3NDOA 3T78A 1PDYA 4O15A 1MXGA 1G6CA 3RMEA 3F4DA 1GOOA 2Y4SA 2RGMA 3GG8A 1UMYA 2EPKX 2PU0A 2VRKA 3CL7A 3QTPA 3TSBA 3CGTA 4XWUA 4TV5A 1DPMA 1X1OA 3EWYA 1F73A 3LG3A 3FGCA 3PPHA 5E0KA 3WNNA 4N4PA 4J3UA 1A5CA 4RZBA 1DWGM 1ZJAA 1VAHA 4C6EA 5ENLA 4WXYA 3WLKX 3SUWA 4O12A 4GY0A 1US3A 4FIQA 2Y24A 4O8RA 5G4HC 4PMOA 1S2VA 1CXEA 3NPXA 4PL1A 3FOKA 2JE8A 4L7ZA 4TV6A 3UPBA 2WXDM 4FLSA 1EYEA 1IE7C 2Q09A 4J5NA 3EA2A 3LI0A 3UWVA 1PVNA 1S1PA 2EXOA 1XICA 5EFDA 1T0OA 1QCWA 4M8UA 3HQPA 3AJXA 1UA3A 3XISA 4LY8A 3GU2A 4Q8VA 2CHRA 5HPOA 1IZKA 3RU6A 2E40A 1YE4A 4UFKA 2FQIA 2ZZ5A 3NQVA 1VH7A 2R1KA 5DMNA 4QDMA 3QPZA 3L4UA 4IP5A 5DMMA 1DP0A 1QNOA 1CGXA 1EKOA 4JX5A 4KEZA 2WMIB 2D1ZA 1T40A 1YLVA 3MUZ1 2B7PA 3EGJA 4OWGA 2EKGA 3ZLGA 1KXTA 1DV7A 2Q3RA 3W2LA 2CC0A 1MVYA 3MSGA 4UZUA 1AODA 3KTCA 1NQKA 3W1PA 5A3HA 1XH1A 1QT1A 1V03A 4MWAB 2DT2A 1OYAA 3UZWA 5DMLA 2YCKX 3G0XA 2PP3A 3BLEA 3UWYA 1E51A 4IL2A 3TTSA 1B1YA 5HOSA 4IZGA 3P7YA 2IPFA 5AC5A 4JEJA 2CETA 2ZWYA 1OHLA 1E9IA 5LGXA 2FVMA 4L64A 1QW8A 1HL8A 2PDXA 1J4EA 3WQOA 3F5LA 3WLSA 1KC7A 5B7YA 3QV9A 4JCLA 2PRLA 4Q4RA 2DIJA 4BY3A 3M0JA 4LF1A 4W5ZA 1J93A 1YXYA 1UKQA 3ARZA 4NX5A 1HP5A 2XINA 2PWUA 4LCRA 3S9IA 1W31A 3EX3A 1F6PA 3CM4A 3HPZA 1GVRA 1W9DM 4XTDA 3SY5A 4H83A 2ZA3A 1PKMA 3D46A 4LGXA 4H8HA 5DRCA 2PURA 2DFAA 1X96A 1YXCA 4PUDA 3SCRA 4Z1YA 4JFSA 2PU1A 2XYLA 3WF3A 2CXEA 3PJWA 3R11A 1EOKA 3R4IA 3MI2A 4DO6A 4J35A 2VOTA 4B9YA 1TSIA 1NTHA 4NAFA 3OODA 1E43A 4J40A 3ATZA 4MZ8A 4JQ1A 1MWOA 4WY0B 5J5RA 1TZ9A 2J27A 2VZUA 4WRHA 2NV2A 1UP2A 3BWWA 3TQKA 1B3YA 4CGTA 1EJRC 2VELA 5JIWA 3DFQA 4MOZA 4REQB 5DCEA 2CLIA 4I5RA 4KCTA 3OBKA 4M6PA 2EJ1A 3BAWA 3MYOA 4PSPA 1RP9A 1J6PA 1VEOA 1FH7A 3NJ3A 1M3UA 1XGZA 2GFTA 2NQHA 4XUYA 4AUBA 1UBPC 2ZVRA 3NOYA 5IDIA 2VUNA 1DWAM 3AIQA 1JCJA 5EGRA 3RRXA 1XCWA 5LIKX 2E67A 2L5HA 4LTSA 5REQA 4W85A 2WPGA 1O95A 3I7QA 4F66A 2WC7A 2J7DA 1K9DA 3CZJA 2XISA 2YXOA 2D24A 5HPCA 3CHEA 3W2JA 3QOKA 4FXFA 1X38A 4KIEA 3VOGA 3ZJKA 2QUNA 2OO0A 3WDPP 1VFTA 4PUUA 3RGTA 4CD7A 3EBVA 4PTMA 3TC6A 2NLYA 3N2CA 3W7NA 1V7AA 4GQRA 1TV8A 4JN6A 3MHGA 5CPQA 4Q4MA 3OYZA 3TC7A 1W1B1 3DUGA 1NF7A 4JIHA 4WJ8A 1XYMA 3C52A 3DG6A 4X3ZA 4W8BA 1UR8A 2B7NA 2WANA 1MFUA 2C1IA 3NZ1A 1J79A 1KBIA 3SO7A 2V5DA 1XS2A 4JTGA 3M7WA 4GYKA 4JHZA 4JFUA 1CNVA 5LNRA 2X30A 1H51A 3CMFA 4C90A 1C29A 3NGFA 4HYWA 4S3JA 4U2YA 4CEUC 3MDWA 3CZEA 3CLMA 3NVTA 3KVJA 3LNPA 4HHMA 1P6BA 3CTTA 4RCXA 4UR9A 1QI4A 1XISA 4GCXA 2OSWA 3CXOA 4N4QA 4AEFA 4TMBA 4OTKA 1UZ4A 5CBIA 3LCWA 3KUMA 3VIMA 3VMOA 4D6JA 4H8UA 1TFVA 2QDDA 1IEVA 1ZPTA 4MNKA 4CCEA 3WLLA 1UD2A 1BTCA 1KXVA 1H11A 2J7HA 2A5HA 1LWJA 5D2XA 1XYCA 3I4EA 1YHTA 4DHGA 3RNDA 3M5XA 4GC3A 5AKQA 1KXHA 3U48A 3KS6A 1QW7A 3QY7A 2D0HA 2QCHA 2ZX7A 3W38A 5A6BD 4AF0B 2PZ0A 4HKPA 3URBA 2A3HA 4C91A 2P0OA 1VYPX 1FXPA 1GVIA 2YL6A 1MQRA 2QCFA 4F9DA 5AYZA 1PTGA 1PHWA 1UASA 1FDJA 4JTHA 1RQBA 4Z42C 4PR4A 4XD5A 1FDYA 2X41A 4Y8FA 3OLDA 1BWVA 4P7RA 1M7JA 2GWNA 5A6JA 4E0CA 1OFAA 1O1HA 2KZHA 1AD1A 3U6WA 3W7EA 2FVKA 3APYA 3FN9A 4CCZA 4J4KA 1V0LA 1HG3A 3C6CA 1RXOB 1IGWA 3TK7A 2QHAA 4LX4A 5K4XA 3CL8A 3VI2A 1CXKA 3WBYA 4ICNA 4AXNA 2V82A 1DIDA 1MO0A 4NP7A 4DJFC 4FSAA 4MDOA 4LRTA 1BGGA 4RNIA 3BO9A 5FD0A 1C9WA 3HG2A 4UUIA 5IHSA 3C5QA 1FVPA 2OCZA 1C3FA 4CQCA 4DIAA 1OX5A 3TVAA 5EA9A 3RYSA 3VGBA 3IJ9A 1JGMA 3BV7A 4LVFA 3VDCA 2X0SA 1V6VA 3WEMA 2XWEA 7ODCA 4DJEC 3IACA 4FX6M 4PE8A 2ZRZA 2OMAA 3MWAA 4JY8A 4OBRA 2I5GA 4NNAA 3UWWA 2G3NA 3BOFA 5FEXA 1KW1A 5FJOA 4QS6A 3W28A 2WHMA 2J9XA 3ARXA 4DWSA 3VGFA 1ZCCA 3D3AA 2P8BA 3AZSA 3WNLA 4DY1A 1X97A 3SN0A 3KBWA 2D2GA 3PP7A 3E5PA 4J28A 5U4NA 2PEVA 2QUUA 3G8RA 1NOWA 3CZGA 3APGA 2CBIA 8XIMA 1NOUA 3A5VA 1EWDA 3L0NA 3I65A 5HMEA 4I5XA 3I6RA 5C2XA 2C91A 2PRMA 3FNDA 4QP0A 4FIRA 1QBAA 2YYUA 3LCGA 3W37A 4KPLA 1PE1A 3QJAA 1RD5A 3T1GA 4NZFA 4WDUA 2GJXA 3QR3A 3BSMA 1ISZA 2VWTA 2H8XA 3DU0A 4NJKA 3MP4A 4XVDA 3S6OA 4GOAA 5HQLA 3IJIA 3HQOA 3KBJA 5CPTA 3UPWA 3NTYA 4GZEA 4OV9A 1X1NA 4QEHA 4LYPA 4W7UA 3AMCA 3V5FA 1SZNA 3KDNA 2PWVA 3BQ6A 3LBCA 4TTUA 4GHRA 3CAKA 2YL8A 1XIJA 1GONA 4W84A 3GM8A 1FOBA 1XIGA 2QCLA 3STCA 5HINA 4DYJA 5A8QA 3W7DA 1AQFA 4ZTYA 1JL8A 3HGRA 2CZEA 1S2UA 3RO6A 4PCTA 1Z9AA 3S47A 4DF0A 5CSUA 2QXWA 1BF6A 3LZ3A 4D9PA 3CLWA 4DO4A 3TONA 2FDSA 3V75A 1P4CA 3E38A 2C8NA 3OLIA 5DMYA 1Z6KA 1NDWA 2Q6ZA 3B0UX 1EJUC 1BVWA 3UY7A 4EAYA 3T2QA 5LIUX 3IPWA 4B91A 2J75A 3UJSA 2VGIA 1DIKA 1A0CA 2V3EA 1ZRQA 1UPPA 3NAVA 2G95A 2QCMA 2R14A 2ZKMX 3Q4DA 4V2XA 3TN6A 1V3IA 1X8CA 3G1HA 3KLLA 4PMJA 2VKZG 4KF1A 3VM5A 4C6FA 4AZ6A 1TO3A 1DYSA 4QEEA 2DPEA 2P1FA 1PTAA 3NPWA 1ECQA 1LRTA 4GK8A 3R7MA 1DWHM 1K8ZA 3M4HA 4KEVA 4IG2B 3TW7A 3WX7A 1EJSC 4B3KA 4AIEA 1R46A 4PMVA 3BE7A 1W17A 3TE9A 2Z6JA 3TA6A 3M0VA 3F2CA 2WO5A 2QJNA 1Z44A 1A3HA 1Q4NX 2IS7A 5C9ZA 3BJFA 3EAUA 2OVLA 5C2CA 3NA8A 1D8WA 4PUWA 3UJ2A 2QVNA 5G2HA 1NSJA 2BXYA 3CWOX 4AVNA 4DUXA 2UY5A 2CCRA 2PUZA 4LC8A 3UBPC 3NEVA 3V0TA 4P7QA 1LG1A 1XW8A 2GSHA 3N2OA 4HOXA 5DBUA 3CK5A 3N12A 3M0XA 4HPXA 3S1XA 3ZFHA 1CX9A 5F2GA 3NEHA 5LGZA 1K1DA 4QAWA 1W37A 5CKSA 2OJPA 5AC6A 3FK4A 3CC1A 3QQWA 1AJZA 4FA3A 2IPGA 1JZ2A 2GSJA 5AYYA 4E2DA 4HNOA 5KITA 1J0YA 1FA2A 2DZPA 3FEMA 5I02A 3FA5A 4YHEA 3O6CA 3IVUA 5CZ0A 3BXWA 1UZHA 4AFYA 2I56A 2EQDA 4W8AA 4AZHA 4MWAA 4GISA 2DSKA 1HKVA 4LRSA 1BXCA 2VUYA 4JTFA 4WGXA 3VOIA 1SR0A 1GZ1A 4A8RA 1B4KA 4QSFA 3TQPA 3PPCA 4UB9A 5F4SA 3OGVA 2QPUA 3W7GA 2SFPA 3UXKA 1KCZA 1RJPA 3L0KA 4HGXA 1ITCA 4PTWA 3COTA 4AMAA 3W0KA 3R8GA 3ITOA 3BH4A 3ITYA 4GI6A 3MT1A 2A7NA 2EPLX 3BDKA 3DEQA 4XBSA 1CPUA 1RK6A 3P67A 1WDPA 2PWHA 1E73M 3CV6A 4ZVJA 4XAPA 4BQ3A 2ACQA 2Z24A 2A3CA 2WVSA 5CJ5A 1ONWA 4RKAA 3QZEA 3VABA 4QIUA 4ADSA 3ARWA 4OV4A 2RUSA 1SSDA 1ZSXA 1JJKA 5H8PA 3W71A 1KD0A 2BGSA 4NJGA 4DYEA 5A8NA 1XM3A 1TPFA 3D5HA 2CERA 4ZE5A 1J5SA 3HA1A 2P88A 3CHCA 1FTXA 3QV8A 3QH2A 2WSKA 1O4UA 1P0KA 4CQDA 1C7TA 4GD0A 1KM2A 1R7OA 4WY0A 4TO8A 4IQDA 3I10A 4N6EA 1U83A 3P14A 3TOPA 4CQ9A 1XKJA 1ISYA 5DCDA 4AH7A 1OG6A 1MUWA 2HBXA 2FB3A 3SCQA 3DN5A 4XVEA 1ZBWA 1OF8A 1G94A 3SCOA 3RG6A 3HV8A 3ABZA 1LQ2A 5C2GA 3QTGA 3ZXWA 3JS3A 1A5SA 1B9BA 4A3YA 2XWDA 3KL3A 4LBUA 3HB9A 4QJ3B 5H8UA 1KTBA 1Z48A 2GGEA 3H22A 5BRPA 1YRRA 3GX9A 5FCZA 1BF2A 5D8WA 3LUTA 3OVQA 1SVDA 4JTTA 5TQLA 1GOXA 2V30A 2JKAA 1AH3A 3L4YA 3GC2A 3QZAA 4B5TA 1Q6OA 1EHNA 2ZDSA 1FHUA 5C71A 3BL3A 1Q7ZA 1ICSA 2Y85A 7REQA 3NQ2A 4OUEA 5CBJA 4PCSA 3AAMA 3CAQA 2OEKA 2G97A 3RN6A 2BOEX 1QOQA 4MG4A 2VD8A 3LMZA 2RKXA 3M5VA 2PS2A 2F7FA 3PJUA 1OGBA 3PNUA 3ZSSA 1HUVA 4IGHA 4B2DD 1D3HA 2DZWA 4EPEC 1F8MA 1NH6A 2DU2A 3B8IA 3O2LA 2VYOA 2Q8XA 4R3UA 4QISA 2G4FA 1R7AA 4QE4A 3OIHA 3HJZA 1JUBA 1JPKA 3FSTA 2PAJA 3S0CA 1R9YA 2V9DA 2VEIA 1L6WA 4DZAA 1W1PA 1XDMA 3U2OA 4JTEA 4HNUA 4MYAA 1XIDA 3TLLA 1EBGA 1LLWA 2WAGA 3LTPA 3PTMA 4HU8A 2WMJA 3PZUA 1GQLA 5FF2A 4I7WA 4KIRA 3ZZ1A 3ARSA 3JU2A 5CC7A 1FCBA 4CVUA 1JCYA 2QVHA 1KQZA 5BOOA 3MV11 3CB8A 1W2VA 4DBUA 2V2CA 2WW5A 3GHRA 1B5TA 3EOUA 4J9JA 1XSIA 1H4PA 5FI8A 2EG7A 1LLOA 3O16A 4D1IA 1Q8JA 1GJWA 3SURA 4LPCA 1KV8A 5CH9A 4FR1A 1AA1B 4M5PA 1I2NA 3UWEA 3DOPA 4W93A 4B3LA 4DWSC 2VX4A 5D37A 1N82A 2KX9A 4BI7A 3TA9A 5LNUA 2QLYA 3F5JA 4GJ1A 1J0ZA 2P0IA 3TW9A 2NVDA 3ZJ7A 3HPFA 2O9PA 4FHAA 3CUIA 1VENA 5B7ZA 1H50A 4JL2A 5FAGA 1BRLB 1TREA 5GJPA 2NWSA 2O7QA 4KWOA 3UP8A 4RNHA 1IEXA 4AF0A 2V68A 1MI3A 3MMDA 3BAYA 2HVMA 2GQ8A 3V36A 3KVKA 3AS0A 1YPIA 4MPKA 4YMZA 3KEHA 1RLDA 2FFCA 3L2LA 4MZYA 4HK6A 1KBBA 4QX4A 2PB1A 4HJFA 2CHNA 2VRJA 3UR7A 1Q63A 4KEUA 5CAHA 5FF0A 2A7RA 4RE3A 2E5BA 1WOBA 4GKTA 1T99A 2C15A 2RJGA 3WL1A 2DZVA 3L5MA 3CJPA 2WJEA 1IWPA 2G5WA 4H8VA 1GHSA 2X7VA 4BI6A 1P6WA 2BDQA 4M81A 3EWUA 4H7CA 3SCUA 3MTWA 3VCCA 2X16A 3R12A 1LLZA 3ANVA 3C56A 4UOQA 2ZCGA 2CWXA 3KOZA 3BICA 4MFEA 3U7BA 5HQEA 1MQPA 3NL2A 3VILA 2VCBA 3GRIA 2NQZA 1R3RA 1IT8A 4G7EB 2IKGA 5E9XA 1T96A 1VPYA 1QO2A 3R8HA 4GYPA 5BU9A 2PTZA 1M04A 3CT2A 4HMDA 3PM6A 3BJTA 4H6QA 4EANA 3G1AA 3KHDA 5H6HA 5I79A 1QNSA 4MB3A 3DXIA 5I3KA 2WKGA 3B03A 4JL1A 4JTCA 1GG0A 2IQTA 4UOZA 1WAUA 1RQEA 1XPYA 4A4AA 2HK1A 5FJTA 1K9FA 3GC4A 3WNMA 1WX0A 5E6YA 4BQ4A 1MW1A 3BLOA 5CXPA 5I3DA 1EWEA 1XL9A 2JK2A 3RPDA 3KWXA 4N02A 3MKVA 1CEOA 2YXXA 3URAA 2ZBTA 2FLIA 1M03A 4UFHA 1HGWA 1PZ3A 2VZVA 3R10A 4K1GA 2VWSA 1LWHA 1WE5A 1JZ4A 2E6AA 1M5WA 3LPGA 2G3JA 4AX6A 4L1WA 1Y7VA 2QUTA 3CV1A 3NVDA 4U4MA 4WY0F 1A5BA 1JPIA 4OZOA 3AMKA 3HMCA 3OHMB 3TUUA 2Q01A 1LBFA 2PI6A 2YKKA 1Z3NA 3UWUA 2VFHA 4BQ2A 3AMLA 5A8OA 1OJXA 1HKJA 3LHZA 1XLLA 1E1FA 4UXDA 2PLCA 3W7MA 4PH6A 3VIOA 2GGGA 3Q67A 5C7HA 1XLFA 1XRFA 4BF7A 2W27A 4LFYA 3TJXA 3CUFA 1PX4A 4NI3A 5FEWA 4M6VA 5BU6A 1SM9A 3RX2A 3LCXA 4J2MA 3UG4A 3II1A 3GR8A 1E71M 5LNWA 2XIMA 1TELA 4EPKA 1SZFA 4GH3A 1V6TA 1GWJA 1K7FA 4WOQA 3B40A 2WVVB 2O9TA 3VX0A 1JYWA 1OYCA 2AL1A 3ZR4A 3T09A 2I57A 3EKGA 3BW3A 1OFOA 1JR1A 5D05A 5JU6A 3NWRA 3BCDA 4S3CA 1OZQA 5HJYA 3WNKA 3L67A 4AZBA 3L68A 3NQBA 3WBAA 4ZSTA 1ZBKA 4Q3MA 4PULA 3RLVA 6ENLA 2QDHA 2RDXA 4LANA 3W1QA 4D6GA 4MZ1A 2ZTJA 2D2JA 4GY1A 1OM0A 2J24A 3CBWA 4MWAC 5D2WA 2V0TA 1BKHA 3VFLA 1TX0A 2DZBA 1Y5VA 4IMAA 3IGXA 2PTWA 4L9ZA 4WDXA 3ME3A 3OIXA 3TTOA 3MMTA 3LSBA 3VYLA 4GACA 4U3CA 2J4GA 3HJEA 3TU9A 3E0WA 4Z17A 3L2MA 4Y9MA 3CMJA 2V8ZA 3PR2A 3W22A 1AQMA 3AHXA 1L2UA 4TVCA 3VDBA 1YTKA 2OYLA 3DFHA 3ONCA 2VVSA 2HEJA 1EEPA 3S1WA 5KINA 5IRPA 5GNYA 5F4WA 3DFSA 3H2FA 4O1AA 4O53A 1JCNA 5HBFA 1F5ZA 3N4FA 2X42A 4Q8UA 3FA4A 2PDYA 3FVDA 1H60A 4IG2A 1GQKA 1UCWA 1S5WA 4J3TA 1BAGA 4GIRA 4JKKA 1UWSA 1PBGA 3W6LA 3QY6A 4IL0A 5AHIA 1TQXA 4MSSA 2ZXDA 4F4RA 1M7PA 4TXEA 4BFAA 1VBUA 3QC3A 1EYWA 5CC6A 4ZZ9A 3W07A 3KWSA 1Q66A 2V3FA 5E6ZA 3QSTA 3PTKA 4JTSA 2VR4A 3FIGA 1Z32X 4XAGA 1XH2A 1SW0A 4KKXA 2F2KA 3NO5A 3W87A 3I6EA 3LTYA 4S3KA 5FF4A 4LEFA 3K2GA 1F2JA 2BLEA 4XSLA 4W9TA 3EA1A 2E25A 1IIGA 4PUKA 3WF2A 3I3DA 3WF4A 4XK2A 2V6AA 2ZE3A 5A2AA 2Z2UA 5IOBA 1DWFM 1RVGA 4B4HA 5TBOA 3TTYA 1LZOA 3CHVA 1Q3NA 4AYSA 2VQUA 3OU8A 3F5KA 1WKEA 2EGZA 3F4WA 1ITXA 4IMDA 5AHLA 4O0ZA 3UR5A 4S2BA 4PUEA 4GQBA 3WQDA 2CPUA 2J8TA 4YIWA 3EDKA 2BXZA 6TIMA 1EC7A 5JMUA 1CXIA 1XGDA 2REQB 3PVFA 4LUTB 1RPXA 4GQQA 4YTUA 2ZUNA 1U1HA 2QCDB 2QMJA 1QU4A 3VNDA 4U3AA 4I6KA 2QGHA 2YB4A 1D3GA 2ZZ3A 1QRQA 2ALDA 4OVXA 2CZVA 4H6EA 2BV9A 4AYGA 3GDMA 1TV3A 1GVFA 3TW6A 2Y5EA 1BVZA 2PZNA 3BURA 3PS7A 5BW6A 1O6IA 1GJUA 2Z2BA 3M44A 2WV8A 5I3FA 3PFMA 4XZNX 1R8LA 4C5ZA 3R1ZA 3UCQA 3L0GA 1E9LA 1HKWA 2HE8A 2HMCA 3RXZA 3VGEA 5HANA 3BG5A 4AD4A 3UNDA 5DY3A 4DJFD 4GO9A 2ABBA 2OKOA 3VX1A 3W1MA 4MPQA 4FOKA 4WKHA 1ZENA 3KOYA 2X40A 2FMNA 4O57A 2EPMX 1CT5A 5DANA 3STEA 2A0NA 1DJQA 1ZAHA 1YIXA 4L6DA 3LQLA 2ISWA 3G24A 1Q4WA 2QS8A 1VFOA 1L6FA 3BK0A 1WZKA 3G22A 3N29A 3BOXA 4DUWA 4NZ5A 3M0IA 1OEPA 2CYGA 1TVNA 1YPXA 2PMQA 3I3EA 7PTDA 1HO1A 4HZ6A 1XF0A 1UH4A 2WCGA 1GKQA 2IQDA 3RCMA 1W3JA 4ZCWA 4F0SA 3SN1A 3MJMA 5D2VA 2PPGA 1OCBA 1XDLA 2ZUSA 3KLKA 4QLKA 1OC5A 4Y9NA 1XRSA 4AXKA 5FA5A 2IKHA 3C3NA 4HP5A 3APTA 1KRCC 3NPUA 4KCUA 3W7IA 3L21A 2XZ9A 4CLMA 2OR2A 3M1ZA 1FWNA 3LBMA 3LA4A 4AX7A 2DSVA 2FGZA 5ABTA 4LQ1A 3LK6A 3TYDA 3U4FA 3B8VA 2BWGA 2PE4A 3EOEA 5M17A 3R25A 1UH3A 1O1ZA 3QMRA 3PBUA 2XVKA 2P3EA 2FPTA 1ZGDA 1JULA 4YWIA 3B0YA 4K3ZA 4IOTA 4IIBA 2GUUA 5BXRA 1YDOA 5CSSA 3AMGA 3WQEA 1K7XA 4ZO9A 5JH1A 1A3WA 1LCOA 2EPHA 3O07A 4HA1A 4C7GA 5CC5A 4GVIA 3UPMA 4FNTA 2HV5A 3F4CA 5DBTA 3RR4A 1XUUA 3VKCA 3GUGA 3ZT7A 4WUIA 3UZZA 1C8QA 2V2DA 1EA0A 1PEZA 1L8NA 1IT7A 1MZHA 1M1BA 2FGBA 4RK8A 1I75A 4X60A 1CGUA 3VU2A 4L5ZA 4GYPC 2OODA 3VIJA 3K46A 3NYDA 1FWRA 3GU9A 3WSUA 3O05A 3AU6A 5FIPA 1O94A 1ZALA 2H8ZA 2JEQA 4JTIA 2VZSA 3JW7A 1KRMA 2VGFA 1XFBA 2VFIA 3TXZA 1H09A 3EYPA 2WZTA 5I3HA 3R89A 5CLWA 2JF6A 3KVMA 3THDA 4PEEA 1YBQB 3E1F1 3RILA 1MYRA 1QI2A 4EPBC 4O16A 3RMJA 1LROA 3KE0A 4JX6A 2QUMA 4LXFA 4WEVX 3MJYA 4K7YA 1MW2A 3PANA 3KL5A 4O4WA 1W9XA 1GVEA 1V6UA 4CNNA 2YDRA 3INPA 5T9BG 2NW0A 2Y62A 4JYFA 1BRLA 1H0IA 1JGIA 1D9EA 5J5DA 3FY1A 3CUXA 4I9MA 2CLFA 3WDHA 4EXAA 4PB4A 3R8RA 2ZZ1A 1KNWA 3ARTA 3LHVA 1J0KA 3A6OA 5BRBA 3EX2A 3ZR5A 3H2NA 1OX6A 4L65A 4W89A 1AH0A 2PLKA 2CESA 1F4AA 1XYLA 1Y8BA 3GBEA 1TV2A 3HURA 3TOYA 1B90A 2CLEA 4A29A 4ZB0A 1I1XA 2OO6A 1F3TA 3L5AA 5A69A 4OOUA 3MUAA 3QV6A 3I68A 1JDFA 2P8CA 5DRIA 3ABSA 2XGZA 3VDAA 4IT1A 3TLQA 1N55A 3AROA 2NX1A 1VIZA 2EO7A 3EXRA 1XBVA 1J0IA 1AL8A 1L0PA 1FP9A 1TV4A 2UZ9A 4LY4A 4UQBA 3W6MA 3V5CA 1CB7B 4CD5A 1V3LA 3ENLA 3A3XA 4O17A 2HS8A 3N9KA 2P10A 3P2VA 5KZ6A 4KEMA 4GBUA 1ICQA 4R9XA 3VCNA 3WD2A 4NI8A 2W5FA 1IT0A 3VNMA 5EPDA 4C60A 1NDYA 3QYSA 4FK9A 3OGSA 4ALDA 2PDQA 4AD1A 3PZIA 2CLMA 1UJPA 1UPMB 1JEZA 4K1WA 3WL0A 1LUCA 3VKBA 3FW6A 2NUWA 4KWSA 4NX0A 3QGKC 3L5LA 2VX7A 4UCFA 1P0EA 2C3ZA 4DN1A 3KCLA 1KFLA 4IICA 1H7OA 3UG8A 3B9DA 4GQ0A 2R1PA 4HTYA 2B7OA 3ABRA 2JBMA 2ZA1A 4YVVA 5LA1A 2ZFAA 4CN6A 2XIIA 4X2RA 2FPVA 5ABHA 4WD0A 1RY8A 3MO4A 2HPMA 3UJFA 3O1NA 2CWNA 5IM51 4GH1A 1DJXA 3VE7A 3WQCA 1TJRA 3KL0A 1NQ6A 2R94A 2VCCA 1RQHA 1W9PA 3AISA 1LBMA 4US5D 3AHZA 3EEZA 3ZOAA 4AB4A 1JDCA 4EKJA 4YHGA 5FL0A 2E09A 4O54A 2P50A 1PXGA 3M07A 3GTHA 4U5KA 5EMYA 3C0LA 5ECUA 4TMCA 1W5MA 4FLQA 3WO8A 1MZRA 5H2ZA 1IEWA 3QGVA 3B0XA 3ITCA 2OWWA 4D72A 2J77A 1R2RA 3E2SA 1ZU8A 7CGTA 3F2BA 2C0HA 1GOMA 1S3HA 2AQVA 5AC7A 2PWDA 3WZ0E 4ZOBA 1IR1A 1JNDA 1WKDA 3ZWSA 5I06A 5F2LA 5JBFA 2IKIA 4B5UA 5AHEA 3AZTA 1VLIA 4JFTA 4A2SA 3PSWA 1OC7A 4S3EA 3MKKA 1IEQA 5DT7A 1JQVA 4HPGA 3VCRA 3C2FA 1RJQA 4HU0A 1G4TA 2VL4A 3DGRA 4AY7A 1E70M 1SQ7A 1SPQA 2JKPA 4DZ5A 3Q2DA 3AC0A 1G5AA 1A5AA 3MPGA 3EX4A 3B8TA 3DCPA 1ISVA 2W61A 2XPKA 2ZZ6A 3GUWA 5ABFA 2BXVA 1ECEA 1QXLA 2YZ5A 4GVHA 3ZT5A 3UYIA 3LN3A 4Z0JA 1L6SA 3LSCA 1IXQA 2QEZA 3QKZA 4RW5A 3W1LA 3NZPA 2VTFA 2BY2A 3FA3A 1NDVA 1S2TA 4JOMA 4Y9AA 4IFKB 3PZ9A 3AZRA 3IANA 4S23A 4CN1A 4ORIA 4E5TA 2W0UA 4TOQA 1HQTA 2NWRA 3EX6A 4S38A 2VFFA 4E2BA 2WPBA 1GVSA 2DSZA 4DUOA 1OF6A 4DO5A 4MAZA 5A8PA 5FOOA 1KXQA 1GOWA 3H12A 1B57A 4NT0A 4CEXC 4EVZA 3VZYA 2YPIA 4BEQA 4WZHA 4V27A 3CIXA 1UWRA 1QATA 3K30A 2IMRA 1A53A 5C9RA 1UKPA 2Y7EA 3RLUA 4XB3A 3M6DA 2ZWZA 3WK0A 1PCWA 3GVVA 1X6NA 3H4WA 1WUFA 3KTXA 4GNKB 4IJCA 5FSDC 3EDDA 3W86A 1VJIA 1B3ZA 1YQ2A 2I16A 5LA0A 1VPXA 2VR2A 5BYWA 1TWIA 3GHTA 3GR4A 3HQ1A 3IK4A 2ESCA 3QMSA 3CUHA 2PBGA 4O18A 3AHYA 4ZGYA 3TR2A 1Q65A 2DQWA 1LT7A 3V5OA 5DX7A 3CEPA 2R82A 4CQAA 4WXZA 2YA2A 4P8WA 3TKFA 4A8LA 3NO3A 3OVGA 3UXLA 4DWSD 4M6UA 3OA3A 5CPNA 1V6WA 3ZT6A 4Q4PA 4IH3A 2Y6ZA 2Z26A 4CQBA 4YYCA 4LB3A 3N73A 1BG9A 3H26A 2ATSA 2ONEA 4RDVA 3ZMRA 4CCCA 3G1XA 3T2OA 2YL9A 3BLFA 2V2HA 3TR9A 4Q4OA 1TTQA 3ABXA 1VS1A 3IIOA 3CIVA 3GVWA 1E3XA 4MY1A 3NOEA 1XIBA 3DFTA 3WQFA 4NAFB 2RFGA 4RV8A 1UR0A 1O5XA 4X9YA 1W8GA 3O6DA 4QDPA 4DF1A 2W91A 1XYZA 4AEEA 4GZIA 4ZXLA 1H2JA 2QV5A 5DLCA 1FFQA 1DXFA 1JVNA 3TTEA 1KBKA 1FWWA 3K5XA 1VFMA 4H3DA 1BHGA 4GGHA 3CPGA 1ISXA 4AD0A 3G1RA 3CQKA 4Z2LA 1PX3A 5D30A 3N04A 3WUGA 3ITGA 1ALDA 5HAOA 3O6AA 1MNZA 2NT1A 4JTLA 4Q33A 3E12A 5F1VA 5G1MA 2HSAA 4F0LA 1TJPA 4BWLA 5REQB