4WCJA

Structure of icab from ammonifex degensii
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
233
structure length
233
Chain Sequence
THLQGDGLVVLCYHRVLPSSRYAISRREFAQQLDYLRQVGVRFVTPQEAEDYLAGRIHLPGKLVLVTFDDGDLSVYRHAFPVLKKRKIPFLFFVIAGQVGRKWEGFSMCSWEQIKEMVASGLCVVGLHTYDLHYWDSQAKKPVFLLPGRERLFAEDTARGTACLKEHLGLKTRYFAYPYGFGTPTTDEILRTQGFSLVFTLRAKVNRPGDAPFVGRVLVTPDSWPQVAAWAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Polysaccharide deacetylase
publication title Structural Basis for the De-N-acetylation of Poly-beta-1,6-N-acetyl-d-glucosamine in Gram-positive Bacteria.
pubmed doi rcsb
source organism Ammonifex degensii
total genus 80
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4wcjA00
4NYUA 2C1IA 4OUIA 3CL7A 2J13A 4M1BA 3S6OA 3CL8A 4NYYA 4U10A 1Z7AA 1W1B1 2DFAA 4L1GA 4V33A 4NY2A 2QV5A 4NZ4A 2I5IA 5BU6A 3VUSA 4F9DA 2IW0A 2E67A 2W3ZA 1XW8A 3RXZA 4NZ1A 3QBUA 2C71A 1W1A1 3WX7A 1V6TA 4NZ5A 2Y8UA 2CC0A 4LY4A 2C79A 2C1GA 4WCJA 4NZ3A 5JMUA 2NLYA 4F9JA 2XU2A 2VYOA 3HFTA 4HD5A 3CL6A 1W17A 1NY1A
chains in the Genus database with same CATH superfamily
5BCAA 1YNYA 2RFGA 3CM4A 2BB0A 3ZVHA 5FF2A 5FACA 1FWBC 2GQ9A 4HIBA 1J93A 2P0IA 3ZJ8A 1BGGA 3O05A 3NQMA 1S39A 1NFGA 4DWSC 2WYSA 3ZS4A 3T0DA 4DPQA 3KBMA 2CZVA 3ZIZA 4ZQCA 2AQWA 2E0PA 4A8RA 4DAIA 2ADAA 1DJZA 1ISZA 4JDYA 1F2JA 3U2ZA 5I23A 3K8LA 3E2QA 3HMJG 4ATLA 1UWIA 1H5YA 2V69A 1KFWA 3F4CA 4B9ZA 1IWAA 3KOZA 1MWOA 4GJJA 8A3HA 4P8XA 4GNVA 1IXOA 4F0KA 3R0DA 5CZTA 1DPMA 3OO2A 4QJ4B 3WF4A 3IACA 1A5OC 4IIHA 1OX4A 1RBOB 3E9AA 1XR2A 3TN3A 1VF8A 4D2JA 3BAIA 4KEZA 2OR2A 4JIRA 1LM1A 5AYZA 3UYCA 4QG8A 4PBGA 2NSOA 1W5OA 2Z7KA 5EKYA 5BMWA 4WOZA 3LBCA 4QM1A 4A4AA 2BGQA 3BZGA 4JICA 3LLXA 3MHGA 4JAWA 5I7GA 3T78A 4LGXA 1WE5A 1E1FA 4M82A 1EZ2A 4JFSA 4LOCA 3VNDA 3ITOA 1EIBA 1A0CA 3H2NA 4HNTA 5KEZA 2QUNA 4EKJA 1Q65A 1EC7A 2Z7GA 3VCRA 1WZKA 1V3IA 1V6XA 1YYAA 4Z2IA 2GOUA 1CXKA 4O19A 1VBHA 5AVNA 3N15A 1HW6A 1QK2A 4GQBA 4XK2A 1RV8A 1UH3A 1G4EA 2QJHA 3GUWA 4R85A 4F2UA 4LVDA 3TYEA 1J0IA 1MDRA 4UZSA 3IVSA 2CIPA 5IBXA 4GXWA 2Q01A 2X0SA 4BFAA 2YW3A 3BV7A 1XGDA 2VOMA 4X63A 3A4XA 4QEEA 4PMOA 3QSRA 4JTUA 4KWOA 2Q8ZA 2BMBA 2BSLA 1IZCA 3EKLA 3GDBA 1Y7VA 2WWDA 1D3HA 5JUVA 3KDOA 3PTKA 4UTIA 3M5VA 4B3ZA 1AZ1A 2NX9A 3M07A 5C55A 4V15A 1JULA 5T91A 3ZO9A 3UCQA 4YN5A 3MCMA 1DQUA 4CNOA 4CCDA 1QPRA 3BICA 4CU7A 1H51A 4HHHA 2IPJA 4LB3A 1R3QA 2CEQA 3SI9A 5CJ5A 3IRSA 3N34A 3PB2A 3GBDA 1B1YA 3SCQA 1CXEA 1NOWA 4O1AA 1MDLA 2I5IA 4O0QA 3FS2A 3KM8A 4LVBA 2NX3A 2X1TA 4PCPA 4RE0A 1JPKA 4PMYA 2ACRA 2WZTA 1UYQA 1NQKA 1VRDA 3OHMB 3BLDA 4LS0A 2PE4A 1H2JA 5BRBA 3C5QA 4XZ9A 1J2WA 1TWZA 1CB2A 4QQ3A 4LNCA 2JF7A 5AB3A 1TIWA 5FAGA 2CERA 4QP0A 4PB5A 3W81A 2EG8A 1TR1A 2ZDRA 1ECQA 1W1TA 3TROA 3TTYA 3C0JA 1W1VA 3B8IA 4GI9A 5FJPA 1H7WA 2Q3OA 1JXJA 3EX2A 3N2CA 3LHZA 3EMQA 2V5JA 2XDFA 2QDHA 2WJZA 4E2DA 3QLLA 4HGXA 4Y8FA 5JQ9A 4UFHA 1AQMA 1OVDA 1PZ3A 3ISIX 2ZFAA 5DN1A 4M3PA 4M6QA 1NSJA 3PPCA 1OCJA 4AYSA 4K38A 4S1FA 3APYA 1GKQA 4CQ9A 3P74A 2PRMA 3UP8A 3IJIA 3LSBA 1GG1A 1OFRA 3RLGA 5A6BD 3G77A 4G6CA 5JH1A 3GS6A 4F0LA 5AC4A 3G1DA 2GOKA 1KCLA 1QNSA 1PDYA 3XIMA 3IK4A 4P61A 2NW0A 1JPMA 1LWIA 1QFEA 2JALA 1ZAJA 4ZVJA 4IIDA 3D6NA 4XD5A 2FYMA 4ZEPA 3FAWA 2J7HA 1RY0A 4FX7A 4UTFA 2H9AA 4U4MA 4P7RA 2GSEA 4J28A 2VJXA 5CBIA 3HU7A 1XIIA 3EOOA 4WIWA 1EF2A 4K36A 2A0NA 1FWGC 4I5RA 3W6LA 3DUGA 3SN0A 1V02A 1GKRA 2ZWYA 3VD9A 5I3HA 1ZQ5A 3PBGA 4S23A 1DE5A 2PA6A 2VRKA 3IVTA 1AFSA 2HBVA 1DJYA 4HMCA 2ZADA 4UTKA 1P1MA 5C5YA 3SCTA 4LB4A 3ARPA 3LXBA 3H4WA 4PTVA 1QNVA 3N11A 2DVUA 1XBVA 5H8UA 1J8VA 4NKCA 3URAA 2W27A 2QCMA 2CPUA 2DZWA 1PX4A 2ZOXA 3AALA 4JIQA 4UUIA 4YLWA 1NDZA 1LT8A 2GGGA 2PDYA 3LY0A 5C70A 3M0LA 5DANA 2ZA3A 3WO8A 3NDZA 3LB0A 3EEGA 4AYGA 2Y7EA 4Z1DA 4ZQOA 4HYWA 5B7ZA 4A8NA 3LTYA 1V0NA 4Y8EA 2CZDA 2IKJA 1IIGA 4M56A 1XCXA 2DH3A 2R9RA 3AZSA 4A21A 1JCXA 2BODX 3ECQA 5HMDA 2C71A 3WNOA 4LYRA 3QV9A 4GQ0A 3JW7A 3CT7A 5IFTA 2YCIX 3OBKA 4IJCA 1P6BA 3A9IA 2NXIA 4PBFA 5C9WA 3N4AA 4MNKA 3UG4A 1DJWA 1EF3A 4HU0A 3CPRA 1I2QA 4UIOA 5BWFA 1KFKA 3CK5A 3OLDA 1R2TA 1M01A 1OADA 3M0HA 2ICSA 2BY0A 3PB0A 1QAPA 2O9PA 3GE7A 3N18A 3S9IA 3VILA 1R2RA 3W2MA 5I3DA 4AEEA 4J9JA 3U4FA 3AXHA 2FJKA 4ZB0A 4IFOA 4KCWA 4LEFA 3ITGA 1HO1A 1K4GA 3LNMA 3NTYA 1XBYA 1T99A 5HXMA 1AJ2A 3VM5A 4NSBA 4JTQA 2QCLA 4HPJA 3DFOA 4XZMX 1LRQA 1ZLPA 2OPJA 1KFLA 1H62A 2R1LA 3TJIA 4XUYA 1V7AA 2GSJA 4HNLA 1AVAA 3RR1A 3VX0A 1JPIA 3E02A 3FDKA 4DHGA 2G0WA 3PZOA 1X98A 4Z1YA 4H8VA 3PJXA 2ZZ6A 1C8YA 1XYLA 3DESA 3C2YA 4N9BA 2ZZ2A 1GJPA 1E3XA 3CAQA 4CQBA 2ZUMA 1JIBA 1AODA 4W8AA 1X6UA 2Z2AA 3LCXA 1PJ9A 1ZPTA 2DT0A 1WNOA 2UY3A 4QLJA 4HCHA 1F4AA 4M7SA 1AQFA 3U4AA 5AHIA 3T2OA 5FJUA 3L4YA 3LPFA 5D38A 4UTTA 1M53A 3WQ6A 4H00A 1J0ZA 2XFRA 3R0KA 3W2UA 1Z42A 2KZHA 3KHDA 1DJIA 2VCAA 3MTWA 1NWRA 1N2VA 5CC7A 3MKVA 4UQEA 4FZIA 2A3HA 1P0DA 4GQRA 4NYYA 4ZMGA 2HWGA 2FZNA 4WZHA 3NSNA 3REQA 3H2AA 1GUVA 4G1KA 2ZX9A 3N2BA 4N4PA 1XG4A 4AZ5A 3MBDA 3HG5A 1G7VA 2ZIDA 1TPB1 4H9UA 3M0YA 3VZZA 2YXOA 4J3SA 4LC6A 4M6PA 1BSIA 5FEXA 5L6UA 1KBKA 1CENA 3TTSA 1UD8A 2YDAA 4XIAA 1CWYA 1DIEA 4GISA 1ZB5A 3V16A 1RQBA 3W7EA 5CZ0A 4DZ5A 2PDIA 3EDFA 1UG6A 1FOBA 1QUMA 2ZA1A 4LAMA 3EOSA 4I6KA 3BW4A 3ITVA 1VPYA 1KV8A 1YADA 2X0HA 4JXCA 4BHYA 3W7CA 1P0KA 5A95A 3BMXA 1S1PA 3C3NA 4DY1A 1H5VA 4F8XA 4JFVA 3BGAA 2ZQ0A 9RUBA 4S3GA 5LNUA 3Q45A 3B04A 4JX6A 3WNMA 1WYIA 4S3KA 4TQTA 2ABBA 5M2FX 5GJPA 1O6IA 1BD0A 4M51A 4WKAA 1O1ZA 1XSJA 3H53A 2XZ9A 2EPHA 1KM5A 3SFWA 1W3JA 1JNEA 3FXYA 2W91A 5JU6A 2BOEX 2WNQA 3N2MA 3O9NA 2Y1HA 1PAMA 4MMWA 3GR8A 4GE8A 1JCTA 2YFNA 3R4IA 2QDEA 3WK0A 4HCDA 1X8FA 1UB3A 1SMAA 4DWSB 1JPHA 3WX7A 4PCSA 2VDGA 3BAYA 1BWVA 1UIPA 3CH0A 4Z17A 1XLGA 2UZ9A 3QOMA 4DNHA 3ITTA 5KMYA 1ONEA 4QAWA 3P62A 1SO4A 3EBVA 3HV9A 3I7SA 4DRSA 1HNYA 3L5AA 3CYJA 4I9TA 5T9CE 4V27A 1UOZA 2P8BA 2I1OA 2VEIA 1SZRA 4NJHA 3I4KA 3OZOA 3GC5A 3L0GA 3VVGA 3P7YA 3DKJA 3QQWA 1X97A 2PDKA 1TV8A 4HNCA 2X8RA 1JF6A 3G1YA 4HK6A 1PCWA 3I3EA 1LUCA 3W7LA 3R0UA 2V68A 5G5IA 1EUAA 3WJSA 1UWTA 3AU6A 3P5YA 4HP5A 3A6OA 3F7JA 5F2IA 1IEXA 4XD6A 3GTIA 3SN4A 1DP0A 3VAVA 4UOQA 4AZIA 4DUWA 3SURA 4DI9A 1TPC1 1VKFA 1WCGA 1GKPA 3RDKA 5CG0A 1IXPA 1BWLA 2BXZA 2CLIA 3S8HA 4YTRA 3VIPA 5DCBA 4NZ1A 4YHEA 3S5YA 3BZJA 4Q8WA 4GZJA 1RJQA 4FXRA 3LZ3A 1A4MA 3GX9A 3SCOA 3ZLFA 3EB3A 3LTPA 4O15A 3VMPA 4G1NA 4DAFA 2PRLA 3CB3A 2XN1A 3BSGA 3N1AA 1A0EA 2PDPA 2JEQA 3UVAA 2FGBA 2XG9A 3TLQA 2FDSA 1O1HA 4M6VA 5JBEA 3WDPP 5F4WA 2IQDA 1PIGA 4XVEA 3ZOAA 1W17A 2VX6A 3QHMA 2CKSA 2QEZA 1X39A 4WD0A 4H4IA 1UA3A 1EXPA 1QBBA 1VEMA 2NSXA 1CYGA 1FFQA 4XX6A 2NZLA 4CCZA 4LVGA 4AVOA 2CESA 2C79A 4UTWC 1TPUA 3G1SA 2OOGA 1JCJA 1GPFA 2GJRA 4ROQA 2QPUA 2XH0A 1Y65A 4FNTA 3GVWA 4R34A 4ICCX 4XZWA 3AUOA 2CWNA 4H2CA 1GOKA 2CBJA 3V35A 4GA8A 3SRKA 1HJQA 1XJBA 1JZ6A 1JPDX 1T8QA 3VXGA 1VFUA 1ML1A 1C9WA 3EEZA 4O53A 3QGKC 5F1UA 1EYWA 1PIFA 1E4IA 3N4EA 3T09A 4L4MA 1UQZA 3KS6A 2VX7A 5CZKA 5GNZA 4F0RA 2ATSA 2CKRA 4ILSA 2PS2A 1QHPA 3R2GA 3COTA 1UWRA 1OT2A 1AMYA 1L9WA 4F3HA 1T6MA 1AW1A 2R24A 1LRNA 3M44A 1V8EA 2WPBA 4KW2A 4IIFA 5DT5A 4ZO6A 4Z2KA 1IEIA 1WB0A 3CZLA 1Z8AA 3MB9A 3QVQA 3W72A 2R94A 1Z3NA 3JUGA 1OIMA 2J7CA 3WLLA 1X8CA 2YXGA 4E5TA 4H9TA 5JIWA 3ABOA 1GOOA 1HO4A 3UZWA 4Y9AA 2RJHA 2X1UA 4Y2WA 3IIZA 4OU1A 2R1PA 3T2PA 3UA3A 4CD4A 2YCKX 3B06A 3EMCA 1XG3A 4MLJA 1YMYA 2HK0A 2W62A 2PLJA 1LRTA 4ZO8A 1HKKA 3EWUA 2VTFA 1TRIA 1P0NA 3B9AA 4WDXA 1P0EA 3U2OA 3LLDA 3UJRA 3N3MA 1MQQA 1A80A 1UH4A 1WAWA 2DZAA 4G9PA 1WO2A 5CPMA 1TZ9A 1XC6A 4PE8A 4ROPA 3MZ2A 2J25A 3EDKA 4OTKA 2NV1A 2VGFA 3CL8A 1ECEA 4Y6GA 4E38A 2R91A 3Q2DA 1XIGA 3VNYA 1R3WA 4XQ6A 3SM0A 4MB1A 4MWAC 4O28A 3RITA 3KOFA 4O1CA 1QO5A 3QHNA 3UXIA 5E6YA 3T0AA 1XRSA 3ERPA 4OHQA 3SGGA 3IWPA 4C1KA 3UNDA 3PPHA 1ZBWA 4PC8A 5LIXX 1V0LA 1PYMA 4JIPA 4V1XA 3DG6A 4ONVA 2EKCA 2P88A 1JUKA 2C0HA 1EFZA 5A2AA 2VT0A 1XINA 4UTHA 4XWUA 3KBNA 5MF5A 3S1WA 1XV8A 3URNA 3E0FA 1XD1A 3C2VA 2GWNA 7TIMA 5AN7A 3VGBA 5IM51 2O7QA 2WMIA 4S3JA 3WD1A 2WMGA 3UG3A 3DOPA 3S1VA 1DV7A 1KM1A 3Q37A 2VHLA 3MHUA 5HNRA 4C6FA 1IXNA 4ZCWA 3HPXA 4LUTB 3E96A 1PX3A 2HE8A 2P3EA 1SZFA 2Z1VA 3M7WA 4NNBA 4CVWA 3GG8A 4D6EA 2GUYA 2YGYA 3CZ8A 4W8LA 3B05A 2GK1A 2F2HA 2C14A 1UPMB 3VGFA 1HVQA 2WM0A 2ABAA 2O9RA 5JBFA 2B31A 1DJXA 1E55A 4H04A 3A47A 4YMZA 4AMAA 4EF9A 4RUBA 4Q33A 4UBPC 4A29A 2OZ3A 3TCSA 1UQYA 3KWSA 3CUZA 3L21A 2ZUUA 5LXXA 2XIQA 4PMDA 2CZEA 2BP1A 4MKVA 4XD4A 3THCA 3A13A 4RDZA 4WOQA 3AS1A 3O3RA 3VKAA 4QQUA 1SPQA 1Y5XA 3G22A 4TMBA 2BX7A 3GK0A 3LI1A 2RDWA 3T44A 5TAOA 2J74A 4OIFA 4FEZA 3EPMA 4QISA 5I3FA 4Y9MA 3WKZA 3N14A 3WH8A 3V1PA 5C71A 2IMRA 4IIGA 1ME7A 3MMTA 1JXKA 3N73A 5ENLA 1E1CB 3F1QA 3LBOA 3VK5A 3QYQA 4IUOA 2ANUA 3VOGA 3MUAA 4DEFA 2CITA 4O18A 3DC0A 4TTGA 1LQ2A 2AAMA 3DC8A 2J75A 3WUEA 3TW9A 3TUUA 1KCKA 4NX0A 2WW5A 4UNIA 3ZR4A 3WBWA 1OABA 2Q02A 3B3DA 2O92A 4U28A 1Z48A 1EHAA 4PRRA 3SRFA 1KBIA 4S39A 4XAYA 1FBAA 3LHVA 4ERIA 4GFIA 4AWSA 2QUTA 2JKAA 1V7YA 4TX9A 4UR7A 3R12A 4ZSUA 4FXFA 4DM2A 1QW8A 3VKDA 2PSNA 4NI3A 3LCGA 2QGYA 3QYSA 1NVMA 3WK2A 2NV2A 3DH7A 2DSKA 1JZ5A 2NXGA 3G8RA 2NUWA 3CUIA 2G4JA 5G2IA 2YDQA 1J96A 3TTOA 1XCWA 2Y0FA 5GVJA 3WBAA 2PZNA 3O6AA 2WM1A 1Q2RA 4IX2A 3GC2A 1BXNA 2AKZA 4D6HA 1Q8AA 2Q71A 3EPOA 5EA9A 1W3TA 4YYCA 3L7RA 4MUZA 3WENA 3PR2A 5LSMA 4WXYA 3ONCA 3WNKA 1E0XA 2IXVA 3VKKA 3AYTA 3WBEA 4QHRA 3GG1A 1V5XA 1TB3A 2WVVB 5IDZA 3BURA 4RZ5A 2EG7A 3N2XA 4BF5A 1RCXB 2DQWA 1W32A 3RAOA 1NDVA 1WA3A 4FNQA 2J7BA 4UZUA 1WOBA 2V8ZA 4B90A 3VCNA 3G18A 4IQDA 3NQEA 3ZLHA 2PBGA 1XDMA 2I5QA 3MW7A 3TTQA 3I68A 4W7WA 3TTEA 4ML9A 2V63A 1RP9A 2ZDSA 3P80A 4P2VA 1W3LA 1CDGA 1KRMA 2BFGA 2XH4A 4JTHA 1CZ1A 3DU0A 5DRCA 2BXYA 4LC8A 2QHAA 1F73A 3U8GA 3T2QA 1LL4A 2OZ8A 3MJYA 3WF1A 5HR7A 1A5AA 1YDOA 4LUSA 2X05A 4KCUA 3H8AA 1UW9A 2DIKA 2Y24A 1K8XA 1ZP4A 3RU8X 1M7PA 4QS6A 5J5DA 1R5YA 2D3NA 4PUEA 1XYMA 4RDYA 4MVAA 2Z6JA 2ACUA 3OTRA 3T4WA 3MSRA 3RM4A 4J7RA 2E9BA 3UESA 4BF9A 4TXEA 1Q7MA 1K8ZA 3Q4DA 3EX6A 4C6QA 1NTHA 2WCSA 4J3VA 2PTWA 3O0FA 2OO0A 4OKDA 1E71M 3G0XA 4CQCA 3WH5A 1US0A 2JFEX 4TU1A 2B81A 1ISWA 4CEUC 4WX2A 3MUXA 3GIQA 4ACYA 3UPWA 3IUDA 1W5PA 3DHPA 1VENA 3BLOA 5AYYA 4H9YA 3PZNA 4J27A 3N4FA 3QC0A 3S0CA 3TE9A 3CB8A 1R3YA 2GLKA 4QROA 4DBDA 2WCGA 3V1HA 4PEKA 3RIKA 4AISA 4BS0A 3W7MA 3QN3A 5E0CA 5DMLA 4EE9A 4GUFA 1XLDA 3UY7A 2G4FA 1Q4WA 4W8BA 4CNPA 3FY1A 4Z2GA 4I9MA 3FXGA 2WHKA 2TSYA 1DWHM 3LPPA 4GFSA 3UFYA 5FJTA 3P82A 1KM3A 3AJXA 4NL1A 3OP2A 3TOPA 2IQTA 1RJRA 1CECA 1KM6A 3SRHA 4EANA 4XZHA 1HXJA 1R3RA 3VO0A 2ZICA 1UD4A 1EX1A 5HINA 5CJNA 3E5PA 1FH8A 2NVDA 4PUUA 2Z1XA 2BY1A 3B4YA 1BG9A 3QMSA 5CGTA 2FHFA 4XISA 3I3DA 4ECLA 4OV4A 5A8GA 4UMBA 4JY9A 3UXKA 3BCFA 3M0IA 4A2RA 3FOKA 4HA4A 4AH7A 4S3BA 1QT1A 3GYCA 3B0XA 5KETA 1R47A 3TNBA 4AF0A 4Z2JA 4TVDA 2EKGA 4UB9A 3T1GA 3WD2A 1OCNA 1E6XM 3W23A 1A3WA 2TODA 3AXMA 3MDUA 1W56A 1TE1A 3HQPA 4MZ8A 1NOFA 5HDRA 4AWUA 2E6AA 1V3JA 3M5YA 3UBPC 1K1DA 3VNLA 1DTUA 1V6VA 2YYTA 1DWGM 3CEUA 2Y4SA 4RPPA 1LL6A 5CBJA 4N9DA 3ARTA 2XFFA 5CG7A 2WQDA 2X1SA 3AMCA 1PUDA 1OF6A 3BAKA 4RKAA 1W91A 4GY7A 4GYKA 2VGIA 4IJBA 1EYEA 2C1HA 2OODA 1J9YA 4RDWA 4GI6A 5A6JA 3FX4A 5LHFA 3CV2A 1K9FA 1SM9A 2QGHA 1Q45A 2E40A 4Q8QA 1DTNA 1K6WA 3CMGA 4H6RA 5D02A 5AYIA 4GYPA 4A05A 5A2CA 1S46A 3LXAA 4B5WA 4EF8A 2Z1KA 3AHYA 3UWUA 4GKLA 4REQA 3CGTA 3VGDA 1IZJA 1F3EA 4PUDA 1EDTA 1W1IE 3BV4A 2QCDB 3RX4A 2CLFA 4J1OA 2XGZA 1TKKA 4AIEA 3WUBA 1OGBA 3GXDA 1SZEA 3TXZA 3GDRA 2RDXA 2QUMA 4C1NA 4PFHA 1R7OA 1E6NA 4HPXA 4GKTA 4KPLA 5EFFA 2AQVA 1TWWA 3I7QA 5BU9A 1E5NA 1SFJA 1JCNA 3WLHA 4LAUA 1OFBA 1NEYA 3E12A 1JAKA 4HYRA 3C86A 1F7BA 2V3FA 4CD7A 3A5VA 2VNCA 4BQ5A 3EDJA 4WF7A 2PTXA 4XO6A 1DVJA 3EA3A 3Q58A 3CHCA 4ZQRA 3C0SA 4FOKA 2OOFA 3N04A 4W9TA 1W2VA 3KEHA 3GXTA 3DFPA 1JF5A 1Q6LA 3GFYA 1W0MA 3TYCA 3N19B 3GIYA 5B80A 8TIMA 1QPNA 4O1FA 2WANA 5DMMA 1IR1A 1XRTA 3TYDA 3OZYA 1P4CA 4NG3A 3UWWA 4Q8TA 5LIYX 2QJMA 4AZCA 1HTIA 3ZJ7A 1GQJA 2HVMA 4MWAB 5AC8A 1SR0A 2XIIA 3TQPA 4IX0A 3NGJA 2FIQA 2O56A 2JK2A 1E6QM 4KESA 1NOUA 1VFSA 1UR3M 1BYDA 3FYYA 4Q3MA 1I0DA 1SMDA 2W6RA 3GVRA 3MANA 1Q8JA 1G0CA 1HL8A 1WUEA 3STPA 4GJ1A 4W86A 4WSKA 1QPKA 2J7EA 3T4CA 5AOUA 3P6LA 3NAVA 1GVIA 4MB4A 4JKMA 1VFLA 1K6AA 3O6DA 5HUOA 4TIMA 1QI2A 5FJRA 3K30A 2H3BA 1F6PA 5AZ0A 3T07A 2WBKA 5FI8A 4CN4A 4FR6A 1UPPA 3QPYA 1WDPA 1QI4A 1OFDA 2EEXA 4H8HA 5ABFA 1VFHA 3ITYA 3EWYA 4IG2B 4WY0B 5CPSA 2HTMA 5FIPA 2RUSA 1HT6A 3OU8A 3LI0A 3TSMA 1RPXA 2V5DA 4J2MA 3AWNA 1CT5A 1CGTA 1A5MC 1EO5A 4ZODA 3UG5A 3C52A 3T08A 3RM8A 3KWXA 3PBUA 3P8IA 3ZT5A 3WNLA 3BANA 3TK7A 4BI6A 4PMQA 3RU6A 5D05A 4B5NA 4MNLA 5H91A 1RVKA 4B5UA 3OZPA 4GD0A 4HSOA 1DJNA 4OGZA 4HT3A 4PODA 3ABXA 3K8MA 1FWJC 5C9XA 2EJAA 4W84A 1WDDA 3DCPA 1H11A 2B7PA 3UWEA 3W75A 1K9TA 5CPNA 1KO0A 4YNGA 2TYSA 1IT8A 2J47A 4LT9A 4S3AA 2PLCA 3BMVA 3CQKA 4PEEA 1XF0A 4MM1A 2V82A 5HR6A 1UUMA 4J2PA 4C6BA 3IK2A 4ERAA 3GDLA 1Q6CA 1ME9A 2PTYA 2VP8A 3D5HA 5DY2A 1M9HA 5DXXA 1CGWA 4ADTA 5C8BB 2QCFA 4D6GA 4IQEA 5IBXC 5GNXA 5TD4A 1A3XA 4LYKA 1YPXA 1FWTA 3BLEA 4KGLA 1K7FA 5CZSA 2CLLA 1UR1A 1Z69A 2VX5A 4S2BA 1VFTA 4IICA 4FALA 1TX0A 4W89A 4M1BA 3RLUA 3W82A 1ONWA 2FJUB 1LLZA 2O9OA 1KFCA 2EBNA 3LMYA 3UJSA 3QGVA 4J5NA 2VFEA 4PTDA 3ITXA 2FVMA 3WUFA 4D6DA 2HS6A 4IQLA 1SR9A 1REQB 3LGDA 3ARRA 2FMOA 4Y96A 5PTDA 3U3HA 4XBKA 3QF0A 3KLLA 1V6TA 1T96A 2CETA 2ZZ5A 3IS4A 2PU0A 3R6IA 4UOZA 3TH6A 2XPKA 4Q4SA 4M7TA 2RGMA 1W31A 3BPWA 1GHSA 5K2ZA 1FDYA 3R43A 2V5CA 5JH2A 4F4RA 1VAHA 4GCXA 4GABA 4NJIA 3IJ8A 4C7FA 4G5DA 2NWRA 1K70A 3AZTA 4MJ2A 4KIEA 4TO8A 1Z7AA 3WLTA 1TQXA 2V2HA 4TVCA 3NO5A 1RBLA 3ZJKA 4NIRA 3ZMRA 3MWCA 3A12A 3IARA 3HIJA 3M6DA 4F66A 2GGIA 3BLFA 2J24A 5BRPA 3HN3A 1K4HA 5CSRA 1TR9A 3IJ7A 3GDTA 2DIEA 1S38A 5A6MA 3N6QA 2D2HA 1UMYA 2XHYA 1N55A 1XKYA 2YL9A 4L56A 1O94A 3HJEA 3LPOA 3CNYA 3CV7A 3MCOA 1UASA 3LN3A 2GZXA 4GOAA 1OFAA 3SFKA 3DI0A 4OT7A 3NQ6A 2B7OA 3BJTA 3TOYA 1XGZA 4NXSA 1FQ0A 4L9YA 4OJYA 1KM0A 2WQPA 4B16A 4AU0A 3A22A 2ZVIA 2EXOA 3S5OA 1E6SM 1LG2A 3DDMA 4LSBA 4NASA 4PZVA 3SW6A 1KXHA 2DT3A 3VFCA 3L2MA 3PBYA 3LLFA 4E2OA 2HE5A 3RG6A 1PEZA 1TELA 3NA8A 4XVDA 3EWXA 1K7EA 1W9XA 3SCRA 4RR4A 5BWAA 1RUSA 3EWCA 3L4UA 4XSMA 5HPCA 3O1NA 1ZJAA 1E0TA 3NQAA 1B3WA 1BAGA 1W3HA 2ZRZA 2NV9A 7ENLA 3QXBA 5EL1A 3QOKA 3R8HA 4FX6M 1VIZA 2QKFA 1GYNA 5ABGA 4GC3A 4XTDA 1R6WA 2A3EA 3LV5A 4R3UA 3WK3A 3AYRA 4R7JA 4EP8C 3QR3A 6XIAA 1G01A 3HPSA 3GY1A 2F6XA 3P81A 1XFBA 3EA1A 1H7NA 4WJEA 4C65A 2Y7DA 5A3HA 2WKGA 4ZBCA 3NZGA 6ALDA 1O60A 5I78A 3G1AA 2Z26A 1ADOA 4E3TA 5GPRA 4MYAA 3VDAA 5C54A 4MNMA 4Q22A 4ZFCA 5HA7A 4NAEB 1FWSA 3W25A 4HSHA 1F8IA 1RQEA 3LU2A 3FVDA 2J7GA 3V0TA 4H83A 3K13A 1Q3NA 5KZEA 2W0UA 3OIHA 3ZQ9A 1DOSA 4Q7IA 1FHLA 5M17A 2D1ZA 2MNRA 3IGXA 1VCVA 1PIIA 2DQXA 3DXIA 5C9RA 1AL7A 1ZU8A 3WG6A 1A5SA 1NP0A 9CGTA 3MBFA 4H7VA 3MUCA 1SJBA 4AXNA 3VX1A 4ZQPA 3ES7A 3OVPA 2R1NA 5AVHA 1FCQA 1XH0A 3JRKA 3E1F1 4DZHA 3TU9A 1RLCL 1MEIA 2D3LA 4GG9A 3W01A 1EEPA 2V5LA 2VEPA 3N29A 2WZMA 4PUMA 1VEPA 2VUYA 4F0HA 2YIHA 3H2OA 2V0TA 3CWOX 2FPTA 3TLLA 3IEBA 1EQCA 5CQ1A 1V3LA 1XX1A 4HCLA 1NAL1 4XBSA 2XGBA 3CO8A 3SSZA 2ZX7A 3GR4A 1XLCA 3G24A 5F2MA 2ISFA 2ZE0A 1KXTA 2ZXDA 3TQ0A 4PA8A 3LSCA 2IQ0A 1BGAA 4BEQA 1AK5A 2CFFA 5A94A 3FK4A 4DJDA 3RLHA 3W86A 4G2DA 5CC5A 3NYDA 2X7VA 3QW4B 4LYPA 1JQVA 1HJVA 4QR6A 1XUUA 2NT0A 1FWWA 3OPSA 5BROA 4Q4QA 3VOFA 1Q6EA 2VZSA 4A6GA 3IV8A 3NNTA 2WSKA 1J10A 4GVFA 3M43A 4HJWA 1MEWA 4N02A 4U2ZA 1YNQA 1Q85A 2POZA 1W1A1 3HGOA 1KWGA 2QCGA 3EKGA 2ZUNA 5G1MA 1ZJHA 1MQRA 4RXGA 3HA1A 1TMHA 4GNKB 3UZJA 3VKCA 8RUCA 2O9TA 1H49A 4AC7C 1FCBA 5EFDA 3VIOA 1QNQA 1GTHA 3W29A 5D2YA 4GUJA 2XVPA 1X6LA 2UY4A 1IEVA 5FF7A 3IUHA 4LV4A 2PDGA 1U5VA 1MVYA 5D03A 4E8CA 4R7OA 2A7NA 4RL3A 5DMYA 4NAFA 1XLMA 4CUCA 3MCNA 1RALA 2D24A 4Z2HA 1GVEA 1P7TB 1NU5A 3I65A 2WMJA 2OLSA 4ZB2A 3L65A 3FGCB 3M16A 4RJEA 5EPDA 4JBRA 4E3VA 5FJOA 1CLVA 1OC5A 1XPYA 3K8KA 1YDVA 4G8TA 3KAOA 4PRTA 5I3KA 1KC7A 4Q4KA 3GTXA 5IOBA 1U1UA 2J13A 4F40A 5BYWA 5CAKA 2DSWA 3KRUA 3SADA 3P0XA 4KFPA 3RMEA 3RJYA 4KIRA 4AEOA 5LA1A 3QSTA 2WAGA 2BV9A 2O0TA 1J6OA 2DSUA 2J27A 3QH2A 3E0WA 4WK9A 4F9DA 1WV2A 3CAKA 4M1RA 1BXCA 2OU4A 1DE6A 3N9KA 1W3NA 4HA1A 1ZFJA 1O5KA 3KVJA 4US5D 3S6DA 3MU7A 4XAFA 1U30A 2QW5A 1GYLA 4WSJA 4MPKA 2X16A 1VJIA 1BFNA 4UTJA 2GDQA 1SW3A 3VIJA 5A8MA 4NZ4A 2PP0A 1L6GA 4GYFA 3WH6A 3S6TA 1KM2A 1TUFA 1C91A 3UT0A 3AXKA 1HIZA 4WCJA 1G67A 1EEXA 2GQ3A 3IIVA 4DX3A 1HJSA 1FH9A 3KTCA 2ACSA 3N6HA 2P5NA 1TJ2A 2VMFA 1IWPA 3D46A 2OEMA 1UR0A 4GJIA 1W5MA 4BCEA 1IYXA 1M04A 2IPGA 1FVPA 3QKEA 2Y89A 4JKLA 1XL9A 3TYAA 1R3VA 1VZWA 3BO9A 3UCDA 3VI2A 3VNKA 4GMEA 4W88A 3BLLA 2VYOA 3DYMA 2D0HA 4R27A 4HQVA 5FEPA 3BQ6A 4FLOA 4WR3A 4DJFA 1UZ1A 4AIBA 2QVNA 2P50A 1JUBA 4JS3A 1G4SA 1H0IA 3HZ3A 4DO7A 5LXEA 5IHRA 1I8JA 2ZC1A 4LVAA 2G8ZA 1UBPC 3WLPA 4D8AA 2PMQA 4JEQA 3OG2A 1J79A 3RK8A 1ELSA 3S1GA 1UKTA 4CKQA 5D9MA 1AD4A 4CCCA 4H9VA 1V08A 2DUAA 4F2TA 2V81A 1SO3A 5BOFA 1CGYA 1ISXA 2HROA 4U3CA 4XSLA 4R7WA 3NSXA 3LGGA 3ABZA 5D9OA 2Z25A 2HNHA 5JBDA 4N2YA 5D2TA 4UOJA 3I6TA 4GHRA 1A5UA 2CLOA 2Z6IA 2E68A 4HOWA 2V9DA 1P48A 2GFTA 4X0VA 4HK5A 2PWEA 4W93A 3W83A 1M7OA 4GUHA 4B4FA 3P3BA 2VEKA 1TTJA 3MJMA 3F2CA 3CYVA 2NQHA 1UP2A 4QJ1A 2ODOA 3CQHA 3N9SA 1HN1A 3CHVA 1EGVA 3MP4A 2VEFA 5CGQA 4ZZ9A 2XWDA 1GVQA 3RF9A 2CWXA 4MADA 3BH4A 3QR1A 4YPJA 3DI1A 1KBJA 4PUWA 2BLEA 2VGGA 3S3GA 1LQ0A 3U48A 3S5NA 1C7SA 1EJRC 2XVLA 3WEOA 1U33A 2ZXQA 4J3UA 3IGUA 2QDGA 2HPMA 4Y90A 1VH7A 5I06A 2GGEA 2VWSA 4HZMA 4ICNA 4L6DA 4EX4A 1OFQA 1PL9A 3W07A 3CZEA 2GUBA 1WOAA 4IQJA 1B4EA 2FB3A 3DYOA 2XWEA 4B3KA 5FJIA 5EMLA 3MP3A 1C93A 5EGRA 3E2VA 5T9BG 4O1EA 4PFMA 3T9PA 3CTLA 3PM6A 3AYVA 4JTEA 4W7UA 2E1WA 2AMXA 4KCTA 1Z6KA 1SSDA 3WLMA 3AJ7A 3D3FA 4UFMA 3MSDA 3W02A 3NQCA 3ID7A 4KRUA 1E4MM 3HG4A 3CWNA 2CBVA 1L2QA 3E74A 2UV8G 2GDVA 4LYQA 3V5OA 2P8CA 3FFSA 2F38A 1L6YA 3V5CA 3CL6A 2G3MA 1YDNA 1UA7A 3B97A 4RX0A 1KB3A 4QG6A 3W7GA 4IP7A 4CNTA 2B7NA 2W3ZA 3CPUA 4KKXA 1KBBA 3K1DA 2Y8UA 3MY9A 1A50A 4LALA 3R11A 4AY1A 3KBWA 1GQLA 3CLMA 3WLRA 3GDMA 3E0IA 3V7PA 1S2VA 4XAZA 1PO9A 5FEWA 4JQ3A 3WH7A 3PUDA 2D69A 1EHNA 5E0FA 3NEHA 3C2FA 4LY4A 3VM7A 3HGJA 3H2EA 1LROA 4NXKA 3GXMA 4E8DA 5RUBA 5BW6A 1F6KA 1XHGA 3WJZA 4L6HA 2DT2A 4IHCA 3W7JA 2YB1A 3GM8A 4BEUA 4IFKA 1V79A 1W6TA 5I3JA 2Y6ZA 1GOQA 2PP1A 3IJDA 1QVBA 3NZPA 2H9AB 1JG9A 2DGAA 4OV9A 3HPFA 1NDWA 2WVSA 4K37A 1B30A 2G3NA 3GZAA 5D32A 4C91A 3ZSTA 1HJXA 2A3AA 1R38A 5K3VA 1QW7A 4JIIX 4BWLA 4RNFA 1S5TA 5U4NA 1BSLA 1IT0A 3RCYA 1R87A 3LYEA 3HF3A 1GGOA 3ABRA 3W1LA 2FHCA 2QCHA 5FSDC 2DZSA 4WKFA 4IOTA 1J12A 1X7IA 2QT3A 3LEPA 5G2WA 1EOKA 4GIRA 1EJXC 2QPSA 3LBMA 1SO5A 5C2GA 3FSTA 3VYLA 3B8VA 1FDZA 4JTSA 1JDFA 3VABA 5HBFA 3TSDA 5REQA 3TKFA 4BY3A 2UY5A 1SGJA 2DVXA 4LJ3A 3DAQA 3AQUA 4K1WA 2ZA2A 3PS7A 4DNMA 2Y8KA 1GVFA 2Y7FA 1SO6A 4CNSA 4O8AA 1TCMA 5JMUA 5F1VA 3RN6A 2PZ0A 4DXKA 1ZCCA 1W5QA 4JX5A 4DQWA 5FEZA 3TMLA 4J35A 4CQAA 3TC7A 4L1GA 4YIWA 3O7UA 1XKJA 4CCEA 1E9LA 1ICQA 4DXVA 1RBAA 1FWCC 4IXHA 3I4EA 3ZWTA 2NQLA 4OWGA 3B9OA 2ZCGA 2OZTA 3GHRA 3AS0A 4KRTA 3DGBA 1LTDA 1FX6A 3VIMA 2PDCA 1H09A 3H7RA 4JR5A 3KBJA 1WDRA 2PU1A 1QCWA 2GGHA 2YXXA 1JJKA 1G7UA 2WSQA 4L5ZA 1QI0A 2PLMA 5JXQA 1DXEA 3EGJA 4GO9A 4TX6A 1FFRA 3UZ5A 4IIBA 2QCEA 3UZXA 2WLYA 3N12A 3W1XA 3NFUA 4JTGA 3SY1A 1E15A 1EDQA 1AZ2A 2IXUA 5H6HA 4AZGA 1BTCA 1FTXA 1VD6A 2FB2A 3PPGA 3L0KA 1BF6A 1G6CA 2DZPA 2PGWA 3MVTA 1KFBA 4LPCA 1VP5A 3TAOA 4Q7BA 4UMCA 4B2DD 1KKRA 1WKEA 4GBUA 2AOSA 3PF3A 2VFFA 1D3CA 4C6CA 2OQLA 3SRDA 3TQKA 2P1FA 1PE1A 1ISYA 3PZQA 3UETA 1B3OA 1VPQA 3I6EA 3DX5A 1AH4A 1HJUA 2OKOA 2JBMA 1KRAC 5IHSA 2JF6A 3PTDA 1IXQA 1PCKA 3ANVA 3GVVA 2A3BA 1ESWA 1PXGA 2FZBA 4ZQMA 4C6DA 4V33A 5AHMA 2PP3A 3AHTA 2XTKA 3VIKA 1WX0A 5C6MA 1Q6DA 1S5WA 4URIA 3WBYA 1KM4A 4EACA 1WPCA 1VJSA 2YR1A 2VFHA 4MHBA 2RAGA 1Z44A 2EHHA 3W4RA 3OLEA 3TDFA 3REQB 4AWEA 1C7TA 3BCDA 1XISA 3W88A 1O5XA 4LWWA 1XICA 4NNCA 1GW9A 2VFDA 1XIJA 5CEWA 3ZT7A 1MUCA 4I7UA 2F2KA 5FKYA 3UA4A 1EUNA 4NT0A 1KXVA 3V18A 1XBZA 4O0KA 1EXBA 3DHDA 3HMCA 1UCWA 2G37A 4JDBA 3H4XA 3SR7A 4ZENA 2NQJA 2QCCA 3GFZA 5C9ZA 4OBRA 4LY8A 3L23A 4FXJA 4NQ1A 2RKXA 4DBSA 3KL3A 2FZ9A 2B7QA 3ITLA 3RX2A 3UCCA 3I3BA 4K8HA 1D8WA 5FA5A 1UZHA 3GAYA 1TPVA 2O7SA 4GWEA 3G1RA 2OTDA 3E38A 2C19A 4EPBC 2E8YA 4IMAA 4HU3A 3KUMA 5T26A 4DO6A 5I03A 2FKPA 1EA0A 1K8YA 3TJLA 1ZBCA 2VURA 2EJ1A 3N17A 5HANA 3WELA 1TVPA 4E2BA 1LBFA 5A6TC 2BG5A 3Q94A 2OYMA 5A6BA 2W92A 3MWAA 5E9AA 3SGUA 2QVHA 5E09A 4LVFA 3A4WA 4XB3A 4IMFA 2OSYA 2EQDA 1EA9C 5A1AA 1E9IA 3W2NA 3BG9A 1VBJA 2DW6A 3VD4A 3WD4A 4YVVA 3W9ZA 3GG7A 3H2FA 4UFLA 2VR4A 3NQ7A 4X60A 1Z32X 2R14A 3GKFA 1ZL1A 4HHMA 9XIAA 4HMEA 3HPZA 4DYJA 3SCPA 3NQVA 1H7XA 3BMWA 2J8TA 3GW0A 3VOJA 1QHZA 3W76A 2JGQA 1JZ3A 3W7RA 1JFHA 1UC4A 1WXYA 3WDIA 2VC7A 3C4UA 3SCWA 1OHLA 4EPKA 3M0KA 3RPDA 3AIWA 4L64A 3I6RA 1UR2A 1WKYA 2PLKA 2ZXBA 4X61A 1FWFC 2E28A 3VDCA 1LUCB 3DERA 3GNOA 3KVLA 1NFBA 3PBVA 3E49A 5G1YA 4DYKA 3RUBL 5T8GA 2HQAA 4YL2A 5LGXA 1E40A 1CBGA 4YXGA 3W74A 4ATDA 1J6PA 1F05A 4IPNB 1EP1A 2WWCA 3LRMA 3VC5A 5D2WA 1UWUA 2WPGA 3SY5A 3GDKA 1DHKA 4I5UA 1XH2A 2XUCA 3SUVA 4JOMA 2V2DA 3ALGA 3DECA 2CCRA 4LV9A 1YX1A 1OJXA 1J11A 2EG6A 5D9PA 3AIBA 1VYPX 5C9UA 2VEMA 2QMJA 1OWQA 3N25A 4BK9A 1S2CA 1SFTA 3GR7A 3MMWA 4RE2A 3GW3A 4LBRA 3SCNA 1WUFA 1VYSX 4UTLA 2DZTA 1TX2A 4GQGA 3WQFA 4RV3A 4FNPA 3P5ZA 1XSIA 4C6MA 2CLKA 4O8RA 2PFHA 4DELA 4JQAA 5E9XA 3LMZA 4XZNX 2BY2A 1MEHA 3NL3A 5I00A 3AHZA 4MDPA 3W6MA 4QE1A 4R53A 5M5DA 3RXZA 2WB5A 2Y7GA 3EMZA 3PWIA 3RRXA 1MQPA 2NLIA 1NJJA 3LUTA 1NDYA 1T40A 4NVTA 3ZR6A 3NGFA 2PWHA 3CMJA 5DRIA 2UWFA 3T40A 2XU2A 1OFOA 3ANYA 2W5FA 3S2CA 3OQ8A 1T7LA 1OSEA 6CGTA 1I1XA 3OBAA 1KKOA 3TWAA 5FOOA 3UY8A 4WLCA 3P84A 1S2WA 1I75A 4XKYA 4JYDA 5LIKX 4GYPC 3HFTA 4F48A 3QZEA 1AJ0A 4AY7A 1PHWA 1N7KA 1M7XA 4ACZA 4R9OA 1QHOA 2VRJA 3AROA 2C13A 1XLFA 1RPKA 2GVLA 3T55A 1EIXA 1SJDA 2RH9A 3RCMA 3WL0A 1W9PA 5AC6A 2VRQA 3RCNA 2H8ZA 2X42A 3GKAA 1B4KA 3NQFA 4H6KA 3U2EA 1W9UA 2OQHA 3F4WA 2Z24A 1S3TC 2C1GA 1O95A 2F6UA 3BXWA 2G41A 4EK7A 1V6WA 4EXAA 1KCZA 1SJAA 1O5RA 3S2JA 4IL0A 4AD0A 4IWWA 2HJPA 2PUZA 2Q3RA 3JS3A 3TIMA 2QS8A 3H6OA 3GVQA 1E70M 3UWYA 4DPPA 1QDSA 5A8PA 7REQA 3OZMA 1D9EA 3MS8A 3CHDA 4ZGYA 3TEVA 1KGWA 4KMQA 3N13A 1KLYA 4C6EA 1CGUA 3ZFHA 2A7RA 4NX5A 4D8ZA 3WQCA 4JZ5A 3WDQA 4ZTYA 3PUEA 5AECA 4ADUA 4JN6A 1E0UA 3AIQA 3M64A 5CZJA 2V2CA 4GXPA 1XYBA 1VEOA 2OELA 1VFMA 1BVNP 1MW0A 3OEXA 3CZGA 5LIWX 4O11A 3WQ8A 4YTUA 2ZX5A 3ARQA 1SZGA 2ZUWA 4IGHA 4ZOAA 1HX0A 3VNJA 1TJ0A 5DX7A 3ZVIA 3S5SA 2ISDA 4DUXA 4DJEA 1ZSXA 2FGZA 1IZKA 2GQ8A 3H12A 5MHBA 3RO8A 2VQTA 4DF1A 5HQLA 4GIEA 4UFKA 3GXFA 4XG1A 4QS5A 4JTLA 2AQOA 4JTTA 1YW1A 4ZO7A 2WMIB 2YPIA 2VC6A 4P8VA 3EB4A 2FPYA 3VOCA 1PWMA 4AFYA 2D2JA 1KXQA 4UR8A 1PZ2A 2WSYA 1IGWA 5ECVA 5HK4A 2WOQA 4MB5A 5GJMA 3K4DA 3QPEA 3XISA 1UR9A 1TYGA 4PTWA 1W9BM 1WXZA 3GXPA 1MYRA 3NURA 2V38A 3J7HA 3GQYA 1RD5A 1SUXA 1B3XA 3RJXA 3AXXA 1G5AA 4RW5A 4QDMA 3W38A 4MDOA 4ZR8A 2JKPA 3LS9A 1H61A 3JU2A 4FXSA 3G1VA 2VD8A 3SGZA 1QPOA 3R89A 4Q7NA 4K2SA 4LS1A 2A7PA 1R7AA 2YSWA 4CGTA 3UEQA 3BW2A 3G6MA 3FEQA 2WJFA 1A4LA 1JYNA 1V03A 3M5ZA 2C16A 2XJ7A 1KFEA 3V3WA 3GVGA 2BVYA 2G50A 1A0DA 3PFRA 1W5NA 3NVDA 1R0MA 1RY8A 5FL1A 1F6YA 3T42A 2J77A 3DHFA 4OOUA 5CSSA 3TJXA 4YTTA 5I5RA 4PTMA 1AH0A 3HQNA 3SUUA 4JY8A 1MRQA 4CNUA 2HMCA 3U7VA 2QMKA 1FP8A 1XP3A 5I0DA 1ICPA 4QSHA 4TV5A 1QXLA 2X30A 1KA9F 3PNZA 1I2OA 4K1GA 1HF6A 5LZLA 4WKHA 3ZLGA 4V1YA 3W24A 5F2LA 4YYFA 4IL2A 1FWHC 3BAXA 4GI8A 3USZA 3WQPA 4TX8A 1VB9A 1B54A 1VQTA 4MWAD 4MB3A 4L9ZA 3AIRA 2GVYA 4KEMA 2XVGA 4V28A 2OWWA 4FB7A 5KITA 3W7NA 4RCXA 1REQA 3WL1A 1EKOA 2AKMA 1JYVA 3B9EA 3RPMA 1BEUA 3P8JA 3P0WA 3RGTA 8CGTA 3KTXA 2EAWA 2HK1A 4LBSA 3G1FA 3BL3A 1US2A 1V3HA 1PHQA 2QF7A 4O13A 3KCLA 4G7FA 2KX9A 5FAJA 2XIJA 3C0LA 3NOYA 4HTBA 1H7PA 5HNUA 4AHQA 5DO8A 4W4QA 4D6IA 1PKMA 3M7SA 2PDQA 1L6SA 3MUZ1 5IXEA 4I6VA 1U1HA 3WQVA 1RCOB 1S3HA 1W1B1 4DYEA 2J6XA 3PK7A 5BU6A 1NF7A 4JTIA 4H19A 3MA8A 2CLEA 4YWIA 2V3EA 1LOSA 4FIRA 2Z00A 2JQXA 3GIPA 1K77A 4O52A 3V36A 4PB3A 1K8CA 3LDVA 4H3DA 2FLIA 1R85A 4IH3A 3BW3A 4MFDA 3MPGA 3SUSA 5TNVA 2XH2A 1OF8A 4GY1A 3NJ3A 3PANA 3EX1A 3T7VA 1O68A 3EWZA 4HHPA 2YOCA 3TVAA 1VRXA 3N3TA 4MKNA 3W00A 4R9XA 2IPFA 2J7FA 4WDWA 4C6IA 2C18A 1HKJA 1XLEA 2I9UA 1HGYA 3VKBA 2D2GA 2VOTA 1MW1A 4LUSB 4B5VA 5HJLA 3F2BA 3KZSA 4GZIA 1GJUA 4ML4A 4ZL1A 3FA3A 2EPMX 1DORA 4AG0A 4C6PA 1X1OA 3W70A 3H2MA 2DSZA 2ZTKA 5BRQA 2YCEA 3UPMA 2CHNA 3WBXA 1FKWA 3FJ4A 4CD8A 1F4HA 2BZNA 3AMLA 3VZYA 2Q8XA 4UCFA 3WYZA 1ZHAA 3ZT6A 1KR1A 1V6YA 1ADDA 4P7LA 1Q5MA 2C0AA 4GC4A 5KINA 1MNSA 4FNRA 5CPQA 2X09A 2XIOA 5IFPA 1Z9AA 3RPTA 5DCEA 3FIGA 3AYSA 3L9CA 4QAIA 3B8DA 4AHPA 1XRVA 4FLQA 1CXLA 2VC5A 4JIEA 5HWNA 5GQBA 3QV7A 1YPFA 3IANA 2WZIA 1X6NA 4GUGA 4RW3A 5CLTA 3LV6A 3KRSA 2HXUA 2WC4A 1U83A 5DELA 3NQDA 3FKKA 4MJZA 4WHBA 2HDJA 2PB1A 1UP3A 4PTXA 1F5ZA 3OYZA 4JCLA 3H22A 4HN8A 2YBUA 1C9DA 4O17A 7XIMA 2INZA 3NO1A 3XINA 3SEPA 1P6CA 4E2VA 4WEVX 3TJ4A 5E1QA 3O16A 3MC5A 2DORA 3OJGA 3VIIA 4RNIA 2DU2A 1TRDA 3E5BA 5LA2A 5A8OA 3RO6A 4PMNA 2VZVA 2P76A 1DQWA 3BVJA 2VC9A 4WJ8A 2OX4A 2VZTA 2HCVA 4IP5A 1GWJA 3LCFA 3UYIA 5DMNA 2VZUA 4PCTA 1DJHA 3AMDA 5F4SA 1XC4A 3G8EA 1TWSA 2BVDA 4RLIA 3IGSA 5DQPA 5BMXA 1OC7A 3BOLA 4YVXA 2QULA 4Z1AA 2J4GA 1YXYA 1RR2A 1DJGA 2QAFA 4AF0B 2VI0A 1I60A 1UWSA 4WRHA 2BS9A 3BTNA 3M1ZA 2GYIA 1J0HA 1Q4NX 1KBLA 1G9HA 5XINA 3H7VA 3QQ0A 4N6EA 4NJJA 1HUVA 3GYEA 4O16A 4EWND 4H9MA 4RZ6A 4O10A 4DJDC 3KOXA 2CW6A 1TTQA 1WAUA 4UXDA 1JI1A 2OYKA 2BY3A 3MHFA 1M03A 4MY8A 1GZ1A 2D73A 1UR8A 3GZ3A 3IJ6A 1SQ7A 3F2DA 3BGJA 5IDIA 3BOXA 4AY8A 1TPEA 4GY0A 1E1EA 3S1UA 3HBLA 1C92A 5D8WA 1AQ0A 5A5WA 2E25A 2XINA 3RM9A 2FFCA 3PNUA 2E4TA 4L1XA 1E6RA 2QUVA 2FTYA 2BBFA 4XKMA 3WLIA 4IP4A 3UXDA 1XCFA 1UUOA 5BXPA 1VFOA 4PMUA 1KW1A 2PEVA 4NRRA 1VLIA 4HBKA 3F5LA 3KBVA 1M5WA 4JN7A 3TC6A 1C3FA 2F6KA 1M1BA 1TWDA 1H3GA 1JDCA 1RXOB 4Z1BA 3G1XA 3VOIA 3B0YA 5EYWA 1NFPA 2OJPA 4REQB 1OG6A 1Q2SA 1CGXA 2PBOA 4H41A 2HXTA 5CGMA 2R1KA 3L12A 3RHGA 2TAAA 4O57A 5EU9A 1LORA 4ORIA 1GTEA 3UU0A 3W7QA 4CN6A 2VX4A 3WN6A 1S2TA 3HGSA 4L65A 4C1NB 1EGZA 1K9EA 2QZRA 2HRWA 2CLPA 3NPVA 3GC4A 2OSWA 2YDSA 1XI3A 2OWXA 4HU4A 5AFDA 3DFQA 4DIAA 3FGCA 3WDRA 3ONBA 3ARXA 3S9YA 1TSIA 2PTDA 2H90A 4Q4RA 3LG3A 4ATWA 6A3HA 2G97A 2DJXA 3BLPX 4FK9A 3TZNA 4PL1A 4DLMA 1OGSA 1UWAA 1HL2A 1EWDA 3NEVA 4CN1A 4HNNA 3EOLA 4A3QA 2DZVA 1IE7C 4H8UA 3R58A 4F2BA 4QDPA 4MG4A 1BRLA 2OSXA 4P7OA 4AZCB 1NQ6A 1H41A 5LNRA 3UWQA 5K4XA 1YHTA 2HVNA 3PULA 4X2RA 1HVXA 3MDWA 2Y63A 1JGMA 4U5KA 4JFTA 2XGIA 2Y70A 2F61A 4O0ZA 1H1NA 2VD9A 1PTDA 3V0SA 3CUGA 4U5IA 4M29A 1KTCA 3ARYA 2WHMA 2ESCA 2DIJA 1KGXA 1VJZA 4LTSA 2DZXA 3LPGA 1GPWA 4R33A 1OFEA 3L4XA 5AHEA 2PDMA 4UTUA 6XIMA 2OGJA 5TQLA 3MSYA 3QTGA 1A49A 4AXKA 4FF5A 5A69A 1ZZMA 4Q8VA 2X1RA 3AICA 1UZDA 3GAKA 4P8WA 1VC4A 4YCOA 2QJJA 3W1NA 2IS7A 5EMUA 4DZIA 4DJFC 4C1LA 5C0QA 3WJXA 1FA2A 4ALDA 3NXFA 2MANA 1E72M 2D23A 2E1DA 2VGBA 1LZOA 4LRSA 3W7PA 3NL6A 5ABFB 1GZGA 2NUYA 3W3OA 4A8IA 4IGSA 1GYMA 2VR2A 1UKOA 1EH9A 4JD4A 4IFRA 5G4EA 4UQAA 3VMNA 3D0CA 1D7FA 1JCYA 3ZZ1A 4LF1A 3TFXA 3IAQA 5E6ZA 3HPAA 1ZGDA 1RH9A 2J9XA 4KEUA 4EWJA 3M5XA 1C8VA 1FXPA 1TA3A 2OWCA 4I7WA 1ZALA 3IIXA 1XLKA 1NF0A 4HMNA 3T6CA 3TN5A 4BZYA 3T0BA 4Q6JA 2Z1WA 4DBWA 2Z1SA 1ZTVA 4YHGA 2VEGA 1XLBA 4OOZA 1GQKA 2GQAA 4S38A 2A5HA 2RGLA 4Q32A 3ZSSA 4OUIA 2REQA 3BJSA 3DYPA 1H63A 3GNXA 4KWSA 3APGA 2WXDM 4EXBA 1E3ZA 3ABQA 5BZAA 4M6UA 2WV8A 3T05A 2GDUA 4H1ZA 3DFYA 4IPIA 3IRDA 2PC4A 3A3XA 4Z08A 3TYBA 4KETA 1A5LC 2NLYA 1MO0A 2RHGA 3KLKA 1W9VA 3VGEA 5BXTA 2Z0IA 2F84A 1MZHA 2Q09A 2VM8A 4PYSA 4X0NA 1XLLA 2MUCA 5J8LA 3WQDA 4JQ2A 4OZOA 3H21A 1QPQA 2NQ9A 4PB4A 3WLKX 2INEA 3LM7A 1ADSA 4G7EB 3EWDA 3S2MA 3EOEA 5HPOA 1J0KA 2QAPA 3LENA 5BXRA 5BXSA 3PAOA 2H3DA 1DWAM 3GLCA 4Z0SA 4JHZA 2XZ7A 4CVUA 4LFYA 2V6AA 2YFOA 2OG9A 2YW4A 4NHVA 1JDEA 4IPLA 1HKIA 2BVTA 1NWSA 1I6NA 2Z4GA 3ATYA 3T8QA 1UC5A 4HKPA 3M9YA 4NZJA 3UWZA 2V67A 2D22A 3SCSA 2HNEA 1Q7QA 2EPLX 3KL5A 1AL8A 1G4TA 2IW0A 4E6MA 4O12A 2WHLA 1MW2A 1PTGA 2O4QA 1Y0EA 3QV8A 4C60A 4MSSA 3PUGA 4EAMA 5J5RA 1A5CA 3RX3A 4DWDA 4HPNA 1GOWA 2ZKMX 3CUXA 1FCUA 3UJEA 1YXCA 1KTBA 4GQQA 4CU8A 4IZGA 3O15A 1UD2A 5I2UA 4K68A 1UHVA 2AMGA 2PWGA 3MV11 3GU1A 2OO6A 1CGVA 2DT1A 1PZ0A 4WDTA 3U6WA 5EMKA 3BAWA 4GINA 4EOUA 3FJLA 3WDJA 1V93A 4DZAA 2VR5A 4UQCA 4LANA 3L68A 3S2NA 2XSBA 1XYFA 1OZQA 2PF8A 4UWMA 2XIBA 1XW8A 1IT7A 1JL8A 5HQMA 2ZUTA 4WQ6A 3B40A 3FA5A 4Z2LA 4YWSA 3TQVA 2BNJA 2ZVRA 2INFA 3NIYA 1YXDA 1Z89A 3ANUA 3UD6A 1S2UA 2I17A 1JCMP 4AW7A 4JTCA 1TFVA 1JR1A 3BARA 3NG3A 1FCVA 1M3UA 1JAEA 4MPQA 2NVAA 2NWSA 5AHFA 4KWWA 3WMBA 3CS2A 2C7FA 2E3ZA 3E2RA 3PZTA 4XAGA 4TVUA 3MP5A 5LA0A 4TOQA 3QKZA 5EBUA 1G69A 3GUGA 2ZZ7A 1GHRA 1PSCA 2W61A 4JTKA 1FHVA 1FWAC 4JNYA 3UVIA 4A3HA 1JDAA 2TRSA 3IJQA 4HZ7A 4ZA0A 4MYXA 4UFJA 4H9ZA 3DG7A 5K9XA 4B9YA 3A4JA 1A53A 2GVEA 3TX9A 3RILA 4BWLC 5I6SA 4QGCA 3PZVA 4TV6A 3DFNA 3SN1A 2VFIA 2QCNA 1W2PA 1GQNA 1BPLB 1KTNA 1QJWA 3CAVA 2GJXA 4S3FA 1OK4A 4YVPA 1OINA 4ZSTA 3DEQA 3II1A 2PCQA 3KZPA 4BQ3A 1JCLA 3W1PA 2BVWA 1DWJM 1R9XA 4FR1A 4LNYA 4FA3A 4HNVA 1EO7A 1E5JA 1TCDA 2I56A 3QV6A 3LNPA 3N9RA 4B15A 1OZMA 4FX8A 5F4XA 1DHPA 1UP0A 3C2RA 1FRBA 4I5XA 3ARZA 3AS3A 3S6OA 1CW2A 3DENA 4MAZA 1QOQA 4OVXA 1EL3A 2QV5A 2AAAA 3CLWA 2AL2A 2I7GA 2CBIA 2R6OA 3P60A 4KRZA 2BHZA 3F5JA 1KLZA 1ITXA 3R8RA 4D1IA 5CCZA 2WO5A 4MAVA 4AHOA 4WDUA 3BSMA 4GH3A 4N0RA 4BJHA 2DFAA 2EPKX 1LLOA 3OGRA 2WHJA 4DB7A 4W5UA 3BC9A 4A22A 1ODUA 1MZRA 4L1WA 3CBWA 1QATA 3A64A 3NQBA 2NQZA 1MNZA 2YA0A 5FL0A 4BR1A 2A4AA 3O0KA 1YE6A 3B0VC 1VBUA 3LD5A 1W3IA 5FSEC 4PMRA 1QOPA 4S3CA 3PJTA 1MI3A 1HQTA 3OODA 3SBFA 3LCHA 4IPJA 4JL1A 3I7RA 5ECUA 2GGJA 1UKPA 4P5UA 4HPHA 4QJ3B 1B57A 1EWEA 3DZ1A 1RA0A 3WEMA 3WMCA 1I0BA 3MKKA 3W87A 5I79A 3LXCA 1AJZA 1VS1A 2WNWA 1ZS2A 1G1YA 3KHJA 1GOXA 3EXSA 2G3IA 1VR6A 4PN2A 3SJ3A 4AIOA 5E70A 3S46A 1OK6A 3UGRA 3LQLA 1D7KA 3POCA 3UW6A 1ODZA 4PMXA 1N8WA 2A85A 4ICMA 1ITQA 1Q63A 2BGNE 2JIWA 3EXRA 6REQA 3POHA 2YL5A 4MY1A 1GNXA 3VGGA 4A3RA 3PTQA 3OLIA 5C2XA 1H1YA 2A3LA 4RDVA 1THFD 1X38A 5K7JA 2IPWA 2YLAA 3QM3A 1AA1B 3QY7A 2PRHA 2Q8LA 4MKSA 3VUSA 3SB0A 4C6JA 3HTWA 1OIFA 1EPXA 3GTFA 1WBHA 4IUGA 3VUPA 4JTDA 3NL5A 4LEQA 2FZMA 3VFLA 2A6LA 3GH4A 1AG1O 3IUIA 4X9SA 2Z29A 3CASA 6TIMA 1J2BA 2QNEA 1ZBKA 1ZBVA 4PH6A 2WZEA 2EF9A 4AQLA 4JTFA 5HOSA 2A21A 3OQEA 4LUIA 1VBRA 4X9YA 1Q6QA 1X1NA 5EY5A 4NAFB 1OGGA 5D8ZA 4ZB5A 2HV5A 5AYXA 1T8XA 5J04A 3B9NA 3MO4A 1GZJA 1F74A 3THAA 2BOGX 5XIAA 3KX6A 1QOXA 2G95A 1JGIA 3FLUA 3SIMA 1TPDA 5HMFA 3O8AA 3DN5A 3S2LA 1SFLA 1PV8A 3NR0A 2G5WA 1PPIA 2VCBA 2YLLA 3V75A 2PDNA 4Q4OA 1LJYA 3QC3A 4C7DA 2PDBA 4AZBA 2WNZA 4AC1X 2CLMA 1FKXA 3RRAA 2CC0A 3G6LA 2DP3A 5FESA 1C29A 3APTA 1QR7A 4HOZA 1WZLA 3OA3A 2Z1BA 3PSVA 1JI2A 1S5MA 1J4EA 3NOEA 3L5LA 3P93A 4DJED 1ONXA 4AD1A 3HURA 1J0YA 1LLWA 2PTZA 3M0ZA 4CLMA 4Q8UA 2I5GA 4NYUA 1AUSL 3GU2A 1E0WA 1KNWA 3HV8A 1KR0A 1QI5A 2HPIA 1R8LA 2WKLA 1XWYA 4HHLA 2WSPA 3EYPA 4GX8A 5H1WA 2CZFA 2FZ8A 1B5TA 1LDCA 3CUFA 5M1TA 5HUPA 1R2SA 4JPGA 5I3GA 1KV5A 1UJPA 1J01A 4FLRA 4Q4MA 1TO3A 1HKVA 1YRRA 4AB4A 1XIHA 2X1IA 1UBSA 1PWLA 3L2IA 4HD5A 2PPGA 1XDLA 4ZOBA 5CSUA 3D3AA 3QPZA 4JTAA 3QJAA 3GTHA 2J78A 1RK6A 5D2XA 1GCYA 4N4QA 2HSAA 2VDHA 2XIMA 5ABTA 1NWTA 3WUGA 1OCQA 2W79A 2NVCA 3LA4A 1F9CA 2FVKA 1GVOA 3TWBA 1HJWA 3AAMA 3NSMA 1V3MA 1E0VA 3FN9A 4LCSA 3BGGA 4RXFA 4KGJA 3AI0A 4BQ4A 1V4YA 4IT1A 4D6JA 1GOMA 2BWGA 3AHVA 4NNAA 2ZWZA 4PTNA 3K4AA 2IKHA 2PDLA 4RNHA 1MFVA 4IMDA 4R88A 3BG5A 3BG3A 5A6KA 4H01A 3OG3A 3DG3A 1FWNA 3UERA 3U0HA 3WF3A 2ISVA 2WMKA 4DVOA 1JZ7A 5HWMA 4MTVA 2E5CA 3GFXA 5HJXA 1SZNA 4QIUA 5CPOA 4UCGA 3WH9A 3K5XA 1OYCA 2GJNA 5HAOA 3S47A 3LCWA 2VVNA 3EAUA 3R5EA 3M46A 3NZRA 2PGFA 4JNZA 4DF2A 2POTA 3PUOA 3P14A 1BYAA 2Y5JA 4LW7A 2ZYFA 1JRBA 5G1TA 1W8SA 4QXIA 1PTAA 1E73M 5BOOA 1EBGA 4LX4A 2YCLB 3KW3A 1NWUA 3VD5A 4GI4A 4Z42C 2DJLA 2Y8VA 3AU2A 2ZBTA 1TV7A 4K7VA 1N8IA 5CC6A 2C91A 4GCAA 4O1BA 3PWAA 4WGXA 3NYZA 1L8PA 6TAAA 1XYAA 1GK8A 3ARUA 1TVLA 1OYBA 3V5FA 3WLQA 3KRBA 3STCA 4ORMA 3S4TA 1IQ8A 1XDJA 3CV6A 4NF7A 1FH7A 4FOJA 5KZMA 1G4PA 5DT7A 3FSUA 1XIEA 1UROA 1ISVA 3E0VA 1XIMA 1JZ4A 4AZ7A 4PMVA 2TPSA 2C1IA 1XXXA 2ZE3A 3R94A 4A35A 2VENA 2A3CA 3QZAA 4K8EA 5LGZA 5LIUX 1TV5A 4RK8A 2YA1A 2ZZ4A 3JR2A 3L5MA 3FJNA 1DWFM 2WC7A 1XIBA 1Y5VA 4C90A 4LCQA 4W7VA 4JQ1A 3PN8A 2PAJA 2BOFX 2EO7A 4WY0F 1TREA 1CTNA 2D0FA 4X2PA 1O4UA 3PPFA 3UZYA 1UKQA 3W22A 3W1RA 2P3ZA 2PDJA 3WCZA 1S2AA 3VINA 3FAXA 2VXNA 4WUIA 1XLJA 2JKEA 4RE3A 5CKSA 3CO4A 1WXJA 3CQJA 4EPEC 1XFCA 1EJ7L 2XFWA 1NY1A 4PSRA 4YCPA 3KFTA 1YIXA 4UTMA 2WC3A 1Z41A 5ABHA 1BHGA 5TIMA 4AD2A 2CYGA 4BI5A 3A23A 4L4PA 4ZOCA 4C6OA 3LRKA 4XZBA 4RV8A 2QIIA 4A3YA 1ZAIA 3H54A 1F07A 3THQA 3LM3A 2E7FA 2FFIA 3PJUA 1HKWA 4US6A 2XYLA 3MZNA 5AKQA 4NRSA 1RZMA 4J40A 4D6CA 1FDJA 4GNJA 1LBLA 2FMNA 4HB7A 2XM2A 1EPVA 2SFPA 4C6LA 4FIQA 5MKGB 4MNJA 1H60A 4DJEC 5LNSA 2PWUA 4IFKB 1J5SA 5U7SA 4UNKA 1UZ4A 3WLNA 1B3ZA 3L4WA 1CXIA 2PWDA 2FPVA 1UOKA 3MQTA 1TWIA 1VLWA 4JX4A 1YPIA 3Q65A 2YZRA 5LNVA 3W2JA 3MUY1 4US5A 4QE4A 2PI6A 3W1QA 4DO5A 4FI4A 1YBQB 3BLIA 4P8UA 2Y5SA 3CUJA 5I3IA 4QITA 1T0OA 3KS5A 1BLIA 1DIKA 4HZ8A 2NT1A 7CGTA 1DEDA 1I9CB 4Y7EA 2JEPA 4Y9NA 5I02A 1KWKA 1OEPA 1B9ZA 1IEQA 3WEZA 2J9ZA 1NM9A 3CIWA 4JQ4A 1F3WA 2DY3A 4PR4A 1KD0A 2AL1A 3W2LA 1UR4A 2CBUA 1ICSA 5REQB 3HQOA 1P43A 3WIJA 3STEA 2ATMA 4FNSA 5KTLA 1IR2A 3INPA 5XIMA 1V3KA 1HP5A 1AD1A 1ZRQA 1PKNA 3TFCA 4B5TA 1KRBC 2ZC8A 1HP4A 4J3TA 2X2GA 4UTTC 7A3HA 1LWJA 2Z2BA 4QDWA 1KQYA 5FJJA 3NUKA 1E56A 3AIEA 3WQ4A 3M4HA 4DXXA 5CC3A 2J9YA 3FNDA 4YTQA 3OVGA 1QRQA 5A6LA 5DY3A 3G1HA 4ZO9A 4ZXOA 3IIOA 2L5HA 3I10A 1XM3A 4CNNA 1KGUA 2FVLA 3TMQA 4F0SA 2BXVA 1KCXA 4QX4A 4S3EA 3S83A 5AHNA 3UR8A 1AMKA 1FUYA 4BQ2A 3JVAA 2Z2UA 4AMCA 2G3FA 4IJRA 4GVIA 1OG0A 4LAZA 1XS2A 3GNPA 1OBAA 3A3HA 3ZXWA 2JE8A 3KOYA 1BKSA 4E4UA 3EKZA 1J5TA 1K9DA 2GSHA 3ZWSA 1R86A 2E8ZA 3FW6A 1KRCC 3A21A 4GZEA 3WK1A 4OBTA 3TXVA 2V5KA 1TJRA 2O55A 1EC8A 4V2XA 3N2OA 2R82A 1YTKA 4O4WA 4UMAA 1EJTC 4HA3A 4D6FA 1XGEA 2J62A 1Q6OA 4FOUA 5FF3A 1VPXA 3KVMA 3NPXA 3R7MA 1LOQA 5JVLA 1TJ1A 4FP1A 5CPTA 4AUBA 2HISA 1UH2A 1QNPA 5E5CA 1SFSA 3ZVHB 2VL4A 4AD3A 3GH7A 4MY9A 2Z28A 2YDRA 4JFWA 2FHBA 3H26A 3CQIA 4UQDA 3UJ2A 1EP3A 4GX9A 4MOZA 5CLWA 4BA0A 3E6EA 4ZTXA 2ZRUA 4TMCA 3TV8A 2YJQA 4HOXA 4U2YA 4PMZA 1W3KA 4B91A 3W1UA 4HSNA 2FZDA 2ZRXA 2RDUA 1PB0A 1X7FA 3BK0A 3O2LA 2ZZ1A 3MO7A 5CXPA 1DXFA 1ZUAX 4DWSA 2OGYA 5A6AA 4NP7A 1VHCA 1SVDA 2WLZA 2ZRWA 2Q6ZA 4I3GA 4ERGA 1FY6A 4AX6A 3SQSA 3AS2A 3UR2A 1WKFA 2CNCA 3MV01 4TR9A 2HBXA 1U1JA 3M47A 4NZCA 4Z1CA 3EXTA 1GT8A 1OX4B 2DV0A 3LHUA 3ICJA 1L2UA 3WDHA 1IGSA 4FMVA 4BF7A 5CJMA 3UR5A 1ITCA 3EX3A 5HULA 4P7NA 1OB0A 3OGVA 4IGNA 3NWRA 1BXBA 1P5BA 3NZ1A 3KCJA 2VQUA 2GVGA 5LHEA 3R8GA 4MLRA 2PWFA 1HZYA 3PZIA 1D8CA 2I16A 1SW0A 4N9EA 2XM1A 4FAMA 2WNNA 3WLSA 2W4XA 1DKWA 1CLXA 2PURA 3WFAA 2J88A 1Q66A 2V3DA 3VA8A 3UPBA 3QMTA 4J3WA 3VDBA 3IV3A 1RCQA 4O1DA 4JYFA 1TTPA 1JZ8A 3MI2A 1PKLA 1M41A 2OEJA 4KQNA 3T0TA 4W87A 3OOQA 3C2EA 4NY2A 1Q13A 1CEOA 4D9PA 1W1YA 4AD5A 4C6NA 3H2CA 3AHXA 1EBHA 3CJPA 3WNPA 2Y2WA 3A3WA 4LQ1A 3FCPA 3TR9A 3W7HA 1LL7A 4LAOA 1L0PA 4MWAE 2OLHA 4LUJA 4NZ5A 1F3XA 1CI1A 1V0MA 5BNKA 4GVHA 3M0JA 2FTPA 3VIHA 1M65A 4GLEA 1A5NC 1MRAA 3ZM8A 3MMUA 3CXOA 4HNUA 1TPFA 1JDDA 5SWUA 4AX7A 4HA0A 4M24A 2C15A 2EPNA 1BF2A 5HMSA 1JVNA 2ZZ3A 1T41A 2OX1A 3S9ZA 3C8NA 2F7FA 3GHTA 3TNOA 1E6ZA 2ZRYA 1W8GA 2ON3A 3WQGA 1PVNA 3CV1A 4A2SA 3C0QA 3F5KA 3CMFA 3ATZA 2WJDA 5K4ZA 1IIHA 3NXLA 2QIWA 3HGRA 1MMFA 2FTWA 3WMLA 1H4PA 2ONEA 3RLVA 5FCZA 3H24A 3H70A 3TN6A 3VD3A 1GJWA 3WF0A 4I9JA 3LHWA 1L6FA 4RPQA 2V5BA 1OT1A 3EX4A 4GH1A 4N42A 1US3A 5F7UA 4N7QA 1CX9A 2YCJA 4EAYA 3W26A 3WLJA 3QR0A 4H6QA 4UC5A 1GVRA 1UD6A 3MMDA 3MUIA 2Y62A 3CWHA 3QTPA 1YTDA 3QEZA 3LERA 1JQXA 5C7HA 1JEZA 1XYZA 1GG0A 4E8GA 2E6FA 1BYCA 4OECA 1F76A 3PZMA 1RA5A 5C2CA 3B8WA 3VNMA 2WMFA 3TCEA 3KTSA 4H2HA 5H8PA 4EXQA 3BOFA 1AW2A 3O07A 1EOMA 1K3UA 1UD5A 1YE4A 4L7ZA 4D8LA 4NUWA 1R46A 4QLLA 1DXIA 2CLHA 3UF9A 3RNDA 4LUYA 3FVMA 3WQEA 3PZ9A 3THUA 3WQ5A 3MKCA 4WVXA 3AOFA 1AH3A 3RMJA 4XKYB 1JRCA 3QRHA 3W27A 4B5SA 3DIPA 3UQNA 4D1JA 1JNDA 1WQ5A 4QJ5B 4ACZB 2WK2A 4B2DA 3TAKA 1P0BA 1ZNNA 3WNNA 4M81A 1F3TA 2EPOA 1K7XA 2VVSA 1QWGA 4XV0A 2GPTA 1LWHA 1NH6A 3PSWA 1RJPA 4IMCA 4LRTA 5G4HC 3K4WA 3T0CA 5HMEA 2JIEA 2D20A 3AXIA 1E4NA 5EB8A 2X41A 1U22A 4LUTA 3FKRA 3B8TA 4OE7A 3QFEA 4GGBA 1FXQA 2HVOA 5I24A 2QUUA 2GUUA 2W67A 3TC3A 3F4DA 3CEPA 2QV4A 1OYAA 7REQB 2GWGA 4KERA 4MZ1A 3C2OA 1XUZA 1RVGA 1R3TA 4FHAA 3FEMA 2PD9A 4J4KA 4AZ6A 3W37A 4E0CA 2YZ5A 2X40A 2UBPC 3F4VA 1I2NA 3R25A 3URBA 1QU4A 1UMLA 4PUJA 5E0KA 3GRIA 1Y5WA 1FP9A 3SQMA 4PULA 1H0GA 3BJFA 3PWGA 2I14A 1IEWA 3K1GA 7PTDA 4F9JA 4QCFA 1XIDA 1OFPA 4B92A 1LCOA 1C8QA 1WP6A 3SCVA 1TG7A 4QBXA 1E1CA 4GBDA 1RHCA 1VCFA 2P53A 2QR6A 1KQZA 4DF0A 4XTIA 3EWWA 1U2YA 2JGYA 4FNUA 3QY8A 3LOTA 1FHDA 4JN8A 4UQ9A 4CU6A 3F03K 4GUIA 1BQCA 3BWWA 2VDIA 1QK0A 4KWVA 1ONRA 2V3GA 1QTWA 3D47A 5DF0A 4MUPA 1XLIA 2WVTA 3CZKA 1BVZA 1ZENA 4AIUA 3AFBA 4OQVA 3G3MA 3LTSA 2DEPA 3SO7A 3AIUA 2WMHA 3ARWA 1MW3A 2PD5A 5KSWA 4M80A 1NIUA 2IUZA 1CNVA 5HJYA 3SAZA 1QMLA 3NCOA 2E67A 1LBMA 4KCVA 1S5NA 5JIPA 1DL3A 1A3HA 1H50A 2H8XA 1FWRA 4GIAA 2OEKA 4A3UA 4LF2A 2VO5A 3KDNA 1Y8BA 1XPGA 3U7BA 3CH9A 4O54A 1PKYA 3W1MA 2E9LA 4C7GA 1P1XA 3BAJA 5EMMA 3W85A 4BI7A 1CCWB 3CAWA 1VYRA 3PFMA 2NXHA 4KS0A 4HYVA 1QNOA 2OXNA 4JHMA 1AW5A 1QASA 2WVVA 1S5VA 2V30A 4UR9A 1XQKA 3Q67A 5D04C 4QSFA 4YTSA 3GD6A 3HO8A 4C6KA 3UGVA 1N8FA 2PDHA 4DBUA 2OB3A 3O6CA 1W1ZA 3OA5A 1LYXA 3R79A 3C8FA 1ALDA 3TR2A 1CLKA 4POCA 3AC0A 1RD6A 1JYWA 1ZCOA 4PGLA 1SW7A 4I90A 1J0JA 3H7UA 5M3WA 2OT0A 1XBXA 4EPDC 3GH5A 2AGTA 3K2GA 3PP7A 3N2TA 3PBMA 3TYZA 3VNZA 3BE7A 5C7VA 4G7EA 4PCFA 1FWIC 4IM4A 4ZQNA 3VC6A 3G2GA 3EOUA 3UR7A 3PAJA 4JTJA 3FYOA 3SECA 1AQHA 4B3LA 3GU9A 3ITCA 4DI8A 2R1MA 2R8WA 2EGZA 4N6FA 2E09A 2WCAA 3GXNA 5I09A 1JFXA 3WLOA 1GW1A 4OFCA 2ZUSA 2HZGA 1R30A 2QPXA 3TW6A 3DHUA 3GBEA 2NX1A 3GHUA 1I2RA 4RZBA 3CPGA 1IWBA 3IVUA 3VGHA 2VZOA 2I9EA 7TAAA 1NP2A 3MI6A 4GK8A 1PZ1A 1OX6A 4GPNA 4X3ZA 2OMAA 3GG0A 2B4GA 3LK6A 4HK7A 2XVKA 3KXQA 1WDSA 1V0KA 3OW1A 4FSAA 1MXGA 2J7DA 2LLEA 3QBUA 4U3AA 1E9YB 1WDQA 2BHUA 5CBBA 2ALRA 2OT1A 4EIVA 3STFA 5DFAA 3EB2A 2H6RA 2OZ0A 4QEHA 1RAKA 3B0PA 5D37A 4JEJA 3L2LA 4HNOA 4CEXC 1EJWC 4JKKA 2OYLA 3W53A 1SSGA 2CZ5A 3O63A 4WXZA 1YDYA 3L0NA 3MYOA 2PDXA 1A5KC 2PDWA 2X2YA 3FHQA 3UWVA 6PTDA 3LZ5A 4O50A 5H8MA 4BKNA 1F61A 1JD9A 9XIMA 4FPSA 3WD3A 4Z0JA 1EB3A 7ODCA 4E4PA 4MFEA 1RSCA 2ALDA 1MXSA 4DN1A 5M03A 3O06A 4QNWA 4NILA 3LGEA 1DBTA 2HS8A 3OVRA 4K3ZA 4MZYA 4PUKA 2DH2A 1MFUA 5DEZA 5LNWA 5HWJA 3SSJA 4NZFA 3VE7A 3NDYA 3NQ8A 2CU0A 1C8XA 1VIWA 3QMRA 1T5AA 3SUWA 3N6JA 1HG3A 2ZRVA 4IXXA 4JFUA 4AWTA 4QRNA 4HPGA 1G94A 3EZ4A 5DBTA 3HOJA 3JZEA 4ZE4A 2A79A 2Z27A 3P67A 1BVWA 3KVKA 4W85A 3GTNA 3OVQA 3UJFA 3GWQA 3PZGA 3VTRA 5I77A 1EQPA 3R1ZA 4M8UA 5D30A 4L9XA 1POJA 4KFNA 4QTGA 3MSGA 3QLDA 1U5JA 3WF2A 3VCCA 3W7IA 1F8MA 1GQIA 3WD0A 1IV8A 3IJLA 1MXDA 1TZ7A 1OY0A 4PBEA 1I4NA 1I45A 3MYPA 2ZXAA 4L4LA 3M0MA 3CHEA 2VCCA 4H7ZA 1Q6RA 3EDEA 4LU0A 1LT7A 1OQFA 4PCNA 4WGHA 3GXIA 3RR4A 3SUTA 1LF1A 5D33A 3WMSA 1TV3A 4PUNA 1TJPA 1EGMA 2WKJA 5ABEA 2ISSA 2UY2A 2QQ6A 3W7KA 3W1AA 4Q8OA 4L61A 4C5ZA 4L6OA 4AZHA 2YL8A 2E5DA 3O6YX 4X22A 4AD4A 4MF4A 3H4GA 3L66A 2X7WA 3U2CA 3H55A 4FO4A 4KBXA 2DDXA 4C5YA 3STGA 5D9NA 4XUGA 4MGGA 2G3JA 2ZUVA 3R13A 1O5QA 3FDGA 4DM1A 4UTWA 3QGAC 4TTUA 3QY6A 1SU5A 4Y9PA 1XLHA 1L6WA 2X0YA 5G4WA 3IGHX 1BTMA 1CXHA 4I8YA 1O66A 3WFLA 5A8NA 2E6YA 2WSRA 4FLSA 5HATA 3DKLA 3VE9A 3ENLA 1WZMA 3BQ5A 2GJLA 3EPNA 3IPWA 3MI3A 2WJEA 3SY8A 2QJNA 1DIDA 3SDOA 3VKJA 1VGAA 2BGSA 2YYUA 3T8LA 3E0LA 3VNIA 1TQJA 4K7YA 5TBOA 4W5ZA 2QCDA 3C3UA 2FDMA 2FQIA 5A6SA 2J8GA 1Q6GA 3HG3A 3ZR5A 4TUFA 3OYXA 4XBJA 1I2PA 2YKKA 4Q8NA 3A5FA 5A8QA 2J79A 1BQGA 3U5YA 1RP8A 3OBEA 4Q8MA 4U31A 2PCEA 4ASTA 2AGKA 1GORA 1DQXA 5CPLA 1ENUA 5IRPA 3TYUA 1XIFA 2PGEA 3OGSA 3TP4A 1HL9A 3FA4A 4JTRA 4I9AA 5K9CA 5LKYA 2BDQA 2F9RA 4JHOA 1UKSA 4XD3A 2YL6A 4O4VA 3DFTA 2DSVA 4GIYA 3C56A 3NQGA 2CHRA 1FWDC 3NM3A 5FD0A 4AVFA 4LXFA 1PYFA 3DBNA 4XIMA 2DUZA 1D2KA 1A5BA 4IMGA 2Y61A 1ZP3A 5AYBA 3VZXA 1GEQA 3CTTA 2CXGA 4OBSA 3UXAA 4IISA 4QCEA 3KOWA 4PL2A 1NELA 4L80A 3BDKA 4AEFA 1Q6FA 4S3DA 4MWAA 3WFZA 4YU1A 1LG1A 4CD5A 3ORWA 1HKMA 4DLFA 4KEVA 4IPPA 2FGLA 1ITUA 3HB9A 2PF0A 3V0UA 3G0SA 2GL5A 3JZUA 3USBA 3CQ0A 2C8NA 3DFHA 2D0GA 1B3VA 3GB6A 2PC8A 2J6VA 1ZY9A 1M68A 3W1TA 4IMEA 5D2VA 4LAKA 4HJFA 3GSMA 2OKTA 3W7OA 4L4OA 3OLGA 4CQ8A 3FYPA 1V51A 1EC9A 3G3DA 1QW9A 1UJQA 3BLKA 3GHSA 3ABSA 3M6YA 2GK1B 1E43A 4M0XA 4ZE5A 2DZBA 3UG8A 3WZ0E 4IG2A 3P2VA 4WY0A 4AAJA 3C6CA 2YX0A 4ENLA 5H2ZA 3LCLA 4I8DA 1OX5A 3S42A 3SQLA 1ZJIA 4Q4PA 3CIXA 4OUEA 2OQYA 4KWUA 1E4LA 1RK5A 1OD8A 2I57A 2XISA 2VELA 1BRLB 4K8GA 3GO2A 3QZ6A 4GO8A 1SJCA 3AO0A 1HGWA 4GGHA 5K9DA 5AHLA 4D71A 5GNYA 3L4TA 3NQ2A 1C90A 4HTYA 1I1WA 2YB4A 2FH6A 1B9BA 3NPUA 1E51A 3BUVA 2G96A 1TV4A 1CXFA 4IIEA 3CHFA 1BG4A 1EP2A 3AWOA 1XD0A 2QYGA 3UNTA 4B4HA 3F4NA 4G56A 1A47A 3CL7A 1TIMA 5AZ1A 4CQDA 3WQWA 3M0VA 3L4ZA 4D72A 3B8SA 2ISWA 3VU2A 1DWIM