4WCJA

Structure of icab from ammonifex degensii
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
233
structure length
233
Chain Sequence
THLQGDGLVVLCYHRVLPSSRYAISRREFAQQLDYLRQVGVRFVTPQEAEDYLAGRIHLPGKLVLVTFDDGDLSVYRHAFPVLKKRKIPFLFFVIAGQVGRKWEGFSMCSWEQIKEMVASGLCVVGLHTYDLHYWDSQAKKPVFLLPGRERLFAEDTARGTACLKEHLGLKTRYFAYPYGFGTPTTDEILRTQGFSLVFTLRAKVNRPGDAPFVGRVLVTPDSWPQVAAWAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polysaccharide deacetylase
publication title Structural Basis for the De-N-acetylation of Poly-beta-1,6-N-acetyl-d-glucosamine in Gram-positive Bacteria.
pubmed doi rcsb
source organism Ammonifex degensii
molecule tags Hydrolase
total genus 80
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4wcjA00
5JMUA 4NZ4A 2I5IA 2J13A 4WCJA 5BU6A 2C1GA 3HFTA 2IW0A 4M1BA 2Y8UA 4NZ1A 2XU2A 1Z7AA 4NZ5A 2W3ZA 4OUIA 3CL7A 4NYYA 3CL6A 2C1IA 4LY4A 3QBUA 2C71A 4V33A 3S6OA 4NZ3A 2NLYA 1W1A1 2C79A 4NYUA 3WX7A 1NY1A 1W17A 4F9JA 4U10A 3RXZA 2E67A 1V6TA 2CC0A 2VYOA 1XW8A 4F9DA 1W1B1 3CL8A 4HD5A 2DFAA 3VUSA 4L1GA 2QV5A 4NY2A
chains in the Genus database with same CATH superfamily
4TTUA 2CCRA 4XD4A 1FWIC 1TE6A 4FNTA 3TTEA 3N2CA 3G6LA 2PLCA 2CW6A 3CT7A 3RO6A 1NDWA 1PIGA 3GTHA 4DXXA 1YXCA 3W0KA 4V1YA 3UT0A 3WMSA 3SCTA 5HQEA 4B92A 2WSYA 1TZZA 1O66A 3H4GA 2JIWA 2GOUA 2X1UA 4GZIA 3AS2A 1XLMA 2OWCA 4J3TA 4DYJA 4M0XA 1OT1A 1O95A 3B97A 3VDBA 4S3AA 4ZB0A 3R13A 4QG9A 3SSZA 2D24A 5AKQA 2Q09A 1XLDA 2Y0FA 3DFYA 3EKGA 1TMQA 2C0AA 2XVPA 3HG5A 3F2DA 5F2LA 2FJUB 4KFNA 3F5KA 3MBDA 2YW4A 1H60A 1PX3A 3W01A 2FGBA 5CC7A 3ISIX 3BQ6A 4DI8A 1UWRA 1TMLA 4LWWA 3I7RA 1ZBKA 4Z08A 1OIFA 3OA5A 3CT2A 4UUIA 1XH1A 5IBXA 4ZOAA 3PZOA 3CZLA 3VD5A 1R6WA 4ORIA 3CLMA 1QHPA 3LCXA 3NL6A 4US5D 2DU2A 5IM51 4PTDA 3WQWA 2VEKA 3EDKA 4Q3MA 3NQCA 3C2RA 2PDQA 3ZT7A 3LERA 4QLLA 1LOSA 3LCGA 4DZAA 1H7RA 4MB3A 4CQCA 3HPSA 1UJPA 4DF2A 1XWYA 1GW1A 3QKEA 1B5TA 4JL1A 1DIKA 5U4NA 1ITCA 4XB3A 3TYAA 4UFLA 4OWGA 4C7FA 4K1GA 2C1GA 1XV8A 4GY7A 1POKA 3WK3A 3ES8A 1ECQA 4LY4A 1B30A 2WHMA 1E71M 1S5WA 1QI3A 1WKDA 4ZO8A 2IPJA 4AHPA 2DP3A 2O56A 5D2WA 5A6MA 4YCPA 1AW5A 2XFWA 4ERGA 1TTQA 5ABFB 4ECLA 1CXIA 1XIEA 1ONEA 2FVLA 3UZYA 1TPC1 1XLGA 2YYUA 4IISA 2AQWA 4PCPA 2HZGA 1FWWA 1N7KA 1F6YA 5AHNA 2WNZA 4GYKA 4JKMA 4F0MA 1G67A 2NUYA 4ZL1A 1GCYA 1DV7A 1PHQA 4OTKA 4CD6A 5BW6A 1CDGA 4BF7A 2ZRUA 3KRUA 3FOKA 2FGZA 1CT5A 2PU0A 3LSCA 4GJJA 1A5OC 2QJJA 4AISA 3QV9A 4RE4A 4L6OA 2QDHA 1FFRA 3U48A 3H7RA 3LGEA 2ALRA 3LHYA 3BCFA 1E4LA 5GQBA 3SY5A 4FPSA 4JQ4A 4R7JA 1K4GA 4XZMX 4DUWA 4I8DA 2PPGA 5DMYA 3VAVA 4N9EA 4GHRA 2XN0A 1TCMA 1LWHA 2C1IA 1US0A 2YPIA 3MVTA 4NF7A 3K13A 3OVQA 3QTGA 3JR2A 3GC2A 2ZFAA 1IQ8A 1LL7A 3TU9A 4XWUA 1XIFA 3IANA 4ACZB 1X6NA 3FEQA 1RPKA 4GXMA 1R8LA 2WK2A 1IZCA 1HJSA 1S39A 4UQDA 4FXJA 1IXQA 3BK0A 4I6VA 4N2YA 2H9AA 4DLFA 1U5JA 3UY8A 3V4BA 5D32A 4AUBA 3N17A 5H1WA 2O55A 1K03A 2XIIA 1BYCA 3AYRA 3GY1A 3LI1A 1MRQA 3PTQA 2BNJA 3B8UA 1OZQA 1XXXA 1B3XA 4I6KA 3B0UX 1Q6OA 3TH6A 1A4MA 1Q65A 1OC6A 1XHGA 5DX7A 2FKPA 2A3EA 2FMNA 1XDLA 3W7LA 2NWSA 1JUBA 1VIZA 4Q8VA 2VZOA 5FL0A 4QS6A 3MS8A 3UP8A 4HOXA 3OOQA 1G4TA 2OCZA 2Q6ZA 3K46A 2V5BA 3LB0A 3LCHA 1PV8A 4P7QA 1YTEA 4LBSA 4US5A 1MNSA 4Y7EA 3SAZA 1MQQA 1TV7A 2C8NA 1R2RA 1NH6A 2ISWA 4DBWA 3CXOA 2ZZ3A 3HIJA 3GX9A 1MZHA 1R7AA 1VQTA 1B3YA 3IIZA 3NDOA 2C0HA 1A5KC 1GG0A 1DQXA 3WF2A 5LYRA 1L2QA 4TMCA 2QF7A 3ID7A 4MADA 2FIQA 1HW6A 3LU2A 2E6AA 1J12A 2OZ8A 4B90A 4MZ8A 4L61A 1X7IA 2VJXA 2POZA 4UC5A 3VKCA 1WXYA 3LDVA 2VDGA 2J7CA 3QZAA 1IYXA 2JBMA 1KRMA 4X2RA 1TPEA 1X1NA 4HVXA 1VCVA 1RCOB 2FFCA 3CGTA 4W84A 4XSLA 3F4WA 3KHJA 2W91A 4MKSA 1LG1A 3WH7A 2HPMA 2GJRA 1NOUA 1JZ7A 3VNKA 1FWGC 3I3EA 3AMCA 1HP4A 2R24A 4KWVA 1KM2A 1YPXA 4IXXA 2PLKA 3ARQA 4DB7A 3VX1A 1OINA 5RUBA 4X2PA 1X7FA 3UCDA 2VFIA 4GQGA 2WB5A 3BG3A 4GACA 5FF4A 4PB4A 3C2YA 4GX8A 2RKXA 2PZNA 1NDZA 1OEPA 4BF5A 3LZ3A 2WQDA 1O6IA 3SRDA 1OJXA 5KEZA 2ZZ6A 2IXUA 1H7XA 1SFSA 1E1CB 1AG1O 3BLPX 2WJFA 4IIFA 4XV0A 4HB7A 4XIMA 3KX6A 4H41A 3CS2A 4OE7A 4WSJA 2JK2A 4TTGA 1XSJA 1K9TA 2BDQA 3AZTA 2VEFA 4EIVA 2Q8XA 4A3QA 4O1BA 3FJ4A 1EQCA 2Z7GA 2H3DA 1TA3A 1OBAA 1SFTA 4NILA 3DUGA 3LV6A 5IXEA 2ON3A 3OIHA 4ZA0A 2PTDA 4J3ZA 4JAWA 4XZIA 1JCLA 4V1XA 4J28A 1R3SA 4E5TA 2QCLA 1UR4A 3QC0A 3AMLA 4IFKA 3OHMB 5ABGA 2X41A 4PBEA 1H63A 3EA2A 2RDXA 3F4DA 4A8LA 4H6RA 3THQA 2HCVA 1TWWA 1TVPA 2X8RA 2TODA 3GHRA 3SCUA 1ZGDA 2PMQA 4NUWA 1J9YA 3C86A 3QGVA 1W91A 2CLLA 2ZBTA 4FOUA 4UTJA 4FX6M 1TPFA 2BVDA 4AZHA 1E4IA 4HU3A 4C60A 3VTRA 3SR7A 2QCDA 4QRNA 1RA0A 1AH0A 3PBVA 4UR9A 1A0DA 3ARPA 2F2KA 3W23A 3SRHA 2W61A 4FX8A 1AFSA 1R46A 2PODA 3WD2A 4AVFA 2WCGA 1WZKA 2O4MA 3K1DA 3C3NA 3KWXA 1V5XA 2Y7GA 3UWYA 2CLOA 4MSSA 1EDQA 2CYGA 1M04A 4AW7A 4REQA 4UZUA 2QIWA 3NDYA 4UNLA 2ZC1A 4WIWA 3GKFA 3WO8A 1FWJC 3B8DA 4PL1A 2VEMA 1D3CA 5EA9A 4PTMA 4GNVA 2DVXA 3SCPA 3M7SA 2ZUWA 3HMCA 4AIUA 1O7AA 4DJDD 4KRTA 1RALA 3RLVA 1MWOA 3MANA 1S2UA 1OC7A 1XG3A 1R30A 1LOLA 3QMRA 5KZEA 1DP0A 3POHA 3B0PA 1E72M 3SO7A 3DESA 3ZT6A 3RCYA 2QCEA 3AXXA 4CQDA 3VDAA 4UQCA 3R6IA 1V0MA 1AW2A 2PUZA 5C5YA 2AL2B 1EOKA 3VOHA 1IR1A 3OBAA 1WXZA 3EWBX 4GWEA 3S9IA 3KOYA 4H9TA 4CCDA 5CEWA 3WK2A 3W87A 2IMRA 3SQMA 3L5AA 5DCDA 2CXEA 3NFUA 3UG8A 4RNJA 1B3OA 4YL2A 3MKCA 2VFDA 4L4OA 1Q3NA 7PTDA 3PULA 3VGGA 1DIDA 1YMYA 3T08A 1D8CA 1KKOA 2Y62A 3NQMA 4R88A 3QSTA 1TVNA 5FJRA 3USZA 1FDYA 1UIPA 2G3FA 1HUVA 2QNEA 3PANA 4WHBA 4XK2A 3G0UA 2FB3A 1RQHA 3UWZA 4ALDA 1E5NA 4EF8A 3IGUA 2QEZA 2QAPA 4R7WA 3T1GA 5E0KA 3TA9A 4G7FA 1OYBA 2CC0A 1Q13A 4PB3A 4IG2B 3UWVA 4J2MA 3THAA 5AHLA 5HNUA 4S3KA 1JAKA 2OYKA 3WQEA 1UD3A 2ZUUA 1K8ZA 3MUIA 2A7NA 5CPNA 4UTTA 5A8GA 2Q8ZA 5ABFA 4XISA 3TC3A 4QGCA 4F9JA 3FW6A 1JZ2A 3WLLA 1QNSA 2ZX6A 1EJRC 4DWSB 2ZXAA 2Y5JA 3DFTA 1GT8A 3W26A 1OY0A 3W7OA 1K70A 1W6TA 4AZ7A 2V3DA 5B80A 1GVEA 4IWWA 4PR4A 5A8OA 3CU2A 4PODA 3LUTA 4U31A 3GG8A 4L6DA 2V67A 4DO6A 4WLCA 3BCJA 4ZQCA 1KM5A 1UKQA 2RJGA 2OYLA 4LYKA 4HA1A 4EXBA 3LD5A 1V0LA 1KCXA 3AHZA 2QUUA 4GX9A 4GO9A 3FVMA 3BGGA 1TUXA 2OO0A 3SUSA 3S8HA 4WF7A 3KTCA 4HZ8A 4AG0A 4E3TA 4DJEC 3EX4A 4DWSC 3CZEA 1X1ZA 2OKOA 1GVIA 5FAJA 4OT7A 2INEA 1EWEA 3T8LA 3WLRA 4B2DD 4MY9A 1L9WA 1TMHA 1J6OA 4JFUA 1DHKA 4FNRA 2R9RA 1G94A 4GINA 2QYGA 1TELA 3VDHA 1TV8A 2GK1B 2YFOA 3S1GA 4TVUA 3XINA 5KZDA 3UQNA 4DAFA 4MKNA 1I6NA 2BLEA 1AODA 2YX0A 3OA3A 1YEYA 1E40A 1UMLA 4Y8EA 3NJ3A 4LW7A 2WBGA 4D6EA 5CBIA 4DJDA 5FEWA 1FCBA 4JN6A 3VM7A 1J5SA 1XIBA 4FOJA 3OODA 4MKVA 3EB3A 2GGHA 3ONCA 3Q94A 3GFYA 1DVJA 3S4TA 1KFBA 4GUFA 1SZEA 1QOPA 3MBFA 3QMTA 3B05A 2HMCA 3H54A 4O15A 2WNQA 1AZ2A 1DORA 3B03A 5KSWA 1OX4B 4MWAE 1SYTA 4WGXA 4JQ2A 3H2EA 1LLOA 2YSWA 1M01A 5AVNA 1L0PA 4I9JA 3TR2A 3O3RA 4L9ZA 1EB3A 4BZYA 3H7VA 5E09A 1PZ0A 3U4FA 4U2ZA 4J4KA 3S5SA 4ORMA 3N14A 2V9DA 2YDAA 4AC7C 4IMEA 3AUOA 4JDYA 3BGJA 1PKMA 2FJKA 2XH0A 1JCNA 2XJ7A 4X9YA 2WO5A 3C2FA 4PRRA 4AYSA 3R0KA 1WB0A 3AMKA 3O06A 5CJMA 4MG4A 2WC3A 1TPVA 3PJXA 3N4EA 4LUTB 2YBUA 3W07A 1EJSC 2D1ZA 3ABXA 4W9TA 5TNVA 3RU8X 1DJYA 4UOQA 1DHPA 2WJZA 2R14A 5F1UA 4CU7A 3TX9A 1JFHA 1W1YA 4XZHA 3DENA 3FYYA 3TYZA 3U5YA 4EF9A 5LA0A 1WBHA 3BSHA 3SIZA 3LHVA 2V3EA 5LNUA 5BXRA 4JR5A 1A5CA 1N8WA 1WDQA 1TYGA 4EP8C 3PTMA 4XAFA 1IIGA 2ZA3A 3RM4A 2V5DA 1XLLA 6ENLA 3MY9A 3JZEA 1HJXA 4GK8A 2PI6A 4QQ3A 3WMBA 1D7KA 4GPNA 4YTSA 1G9HA 2VDIA 3B8IA 4H3DA 3S5YA 3BQ5A 3FCPA 2E9BA 5CGQA 3H7UA 4Q4RA 2HQAA 2Y8KA 3NURA 4DZIA 1Y8BA 3E74A 2KAUC 2GJLA 1E1CA 2ZZ1A 4LAOA 1GQLA 2B4GA 3WD4A 1H41A 1B9BA 2F38A 2R1KA 3UBPC 1K9EA 4HNTA 4Z0SA 1AJ0A 3S5OA 4O28A 5MKGA 4UNIA 3BZJA 2V82A 3W76A 4B2DA 1QW9A 1FHVA 1M7PA 2QGYA 1YNYA 1MDRA 3AHVA 2VCAA 3UFYA 4W89A 4HSHA 2A6NA 3WMCA 4XZ9A 1F76A 2QAFA 1QBBA 2B0MA 3C3UA 4I5UA 3PWGA 5G2WA 1TV3A 3LEPA 4ZQRA 1SVDA 1C9WA 1OC5A 5DT7A 5CZKA 1ADDA 1ZBCA 2XYLA 4GQ0A 1GJWA 3GXNA 1EUNA 4FLOA 1XBZA 3PN8A 2E5BA 1FBAA 1PS9A 3RFAA 1K6AA 1YRRA 3PFRA 3S2JA 2DZVA 3WELA 4GZ7A 2G96A 1Z48A 1QI2A 1ZHAA 2VC7A 1E56A 3CMGA 3W1QA 4PUUA 4GKLA 5A6TC 4LGXA 3ZM8A 3L23A 5AHFA 1VYSX 4MYAA 2OGJA 1U1HA 3B04A 3QSRA 4CKQA 4HHPA 3PAJA 2NV2A 3GDMA 4FLQA 3CQKA 3BO9A 3TEVA 1IWAA 5CBBA 1UD6A 2DPEA 3U9IA 4UTIA 2PAJA 2FHBA 3R0DA 3BAIA 4YS1A 1CZ1A 2OQHA 1R2SA 3IEBA 3CQ0A 3GXTA 4X60A 4AY1A 2B7NA 2V3FA 8A3HA 1EBGA 1LDCA 3TMLA 3FYOA 1CECA 3FA3A 2CITA 3REQB 2WW5A 2ISVA 4QITA 3O6YX 3L0NA 2FPVA 2V5KA 3P5YA 3H21A 1XG4A 1KM6A 4AX6A 1VEOA 5BWAA 3RRAA 1GHRA 4W85A 1PO9A 1F3XA 3G22A 4XSMA 1S3TC 2J9XA 4O12A 1NF7A 2AL2A 4XVDA 4M1BA 4XZLX 3KE0A 4HIBA 3AYTA 3BCDA 4EXAA 3NO5A 3KOXA 4IGMA 4PMUA 4AD2A 2OMAA 4UB9A 1SZFA 3ITYA 3W71A 4NSBA 4ZMGA 3D46A 1B3VA 5C54A 1GYMA 4M82A 3WQDA 4H00A 2VRQA 3E0WA 1DJWA 3WQOA 3ABQA 3K2GA 4E2VA 1LJYA 3WH6A 2E1WA 2CKSA 2ESCA 2DZAA 3FXYA 4HZ7A 2E67A 1AD4A 5AHIA 3N2XA 3UA4A 3CV6A 5D30A 5I3KA 4NNCA 2IQTA 4AC1X 1Q6DA 2D22A 1BQCA 1WKYA 4EVZA 4LRSA 3CIXA 6PTDA 4TX8A 4IG2A 1W2VA 5CSSA 5E1QA 3IVTA 1XW8A 5T9CE 4PTVA 4K2SA 3K5XA 1I4NA 3LPPA 1HKIA 4C65A 3IACA 2AKZA 4AH7A 1AD1A 4Z1AA 2NVAA 1BGGA 4EWND 2VX5A 4LB3A 3LRLA 4FXRA 3L5LA 1EEPA 5FACA 2W9MA 2CZ5A 1GPFA 4DLMA 3ATZA 3L7RA 3BLLA 3OO2A 3CWOX 3ZLHA 1J0HA 3RK8A 3KBVA 1M7JA 3XIMA 4I90A 3ES7A 3OZMA 3O9NA 1UBPC 4YTRA 4XAZA 3AQUA 1C93A 4HN8A 1GEQA 4XG1A 4LVGA 2WSQA 4HP5A 1NFPA 2GZXA 5DCBA 3IJDA 3FJNA 1NOWA 5E0CA 1R47A 4LT9A 2G95A 4CN4A 5EKYA 3KW3A 2PLJA 2FQIA 3HOJA 2DT1A 3PPGA 3A4JA 1DJZA 2Y7FA 4L4MA 3GDLA 3LXBA 5CSUA 3KOZA 4CNTA 1SPQA 2B81A 3HGJA 4LUSB 2F7FA 5AC7A 4EANA 5HXMA 1SFJA 5EB8A 1IZJA 5A69A 5BMWA 1LG2A 5FJIA 1QOQA 4W93A 3MUCA 4KWOA 3QV6A 4CNUA 3RILA 3OG2A 3RIKA 4Q33A 4N0RA 1Q6EA 5T9BG 3LGDA 3W1MA 1IT0A 1MZRA 1SQ7A 4JHOA 4U4MA 2DIKA 4KMQA 4IP5A 3MWAA 3PM6A 2GK1A 3WCZA 3VD3A 3C61A 1UR0A 1VAHA 3IRDA 3TW7A 4L80A 2VC9A 3CQHA 3UYCA 1J0KA 2J88A 3H26A 3PWAA 3G1SA 3HPZA 4ZOBA 4MVAA 1TSIA 3UXDA 1ZAIA 3FYPA 2RDTA 3ZLFA 1RZMA 3NYZA 3UZWA 4LJ3A 3EKLA 3GVQA 4RUBA 3VNZA 3USBA 2DQWA 1WDDA 1I2PA 3KS5A 3SJNA 5A6AA 1JDDA 4WX2A 4JYDA 2R82A 3SFWA 2Y89A 4JCMA 3QPEA 1ZZMA 4PTNA 2I16A 4YTQA 2EG8A 4OBSA 2XSBA 1PZ3A 3EX6A 5BROA 2ZX7A 3V5OA 2PRHA 4DPPA 3QBUA 5E6YA 1B9ZA 2PFHA 3O16A 1JYNA 2GGEA 2BVWA 5D33A 5LNSA 1CB2A 3T07A 2D2GA 3EWCA 5D37A 4FEZA 1LTDA 5CC3A 3L0GA 3RLGA 3VNLA 1O1HA 3TMQA 1FCUA 4LVAA 1W9XA 1KV5A 4MB1A 3NOYA 4GXWA 5A8QA 1NEYA 1HKVA 1W1PA 4JFVA 1WA3A 2HNHA 2PDIA 3BZGA 4WSKA 2VX6A 4ZQPA 3AISA 5LIKX 3E0FA 4B5SA 4LUTA 3HTWA 3M41A 1A47A 3T2PA 4C6JA 2W3ZA 1AUSL 2YLLA 2YFNA 1NWTA 4BHYA 3SCSA 1UC5A 3LPGA 3KVJA 1HTIA 2HE8A 4PCSA 4UQEA 2VELA 4PEEA 2Z24A 4RCXA 3PZNA 1UUOA 1HGYA 1VZWA 3TZNA 4NI3A 1BD0A 4EACA 4MLRA 4MIMA 2ACRA 5A6KA 3T7VA 5CZJA 3E5PA 1J79A 1T5AA 2PWEA 3ITGA 2CZDA 3W1UA 1ZTVA 4UTLA 4K68A 2BXYA 3G0XA 1SW3A 4PUJA 5CAKA 5DRCA 3CNYA 2HK0A 1AJZA 4PTXA 2QV5A 3EBVA 4HA4A 4PMJA 3ORWA 1E3XA 4HCDA 3UZXA 5AC4A 2DORA 2E09A 1F05A 4FR6A 1KGXA 2VOTA 1U5HA 2E6FA 1CLVA 3VOJA 3CL8A 3T44A 1MQPA 3WLSA 3L2MA 2OZ3A 4YTUA 5AYIA 4JCLA 1BXCA 4AHQA 1KFKA 3U4AA 5EFDA 3AWNA 1JD7A 1TQXA 3C52A 3DZ1A 4RZ5A 1KO0A 2PDPA 3W02A 4ZEPA 3I7SA 2FVMA 1W9PA 3IV3A 3M5VA 1T41A 1YADA 3TDFA 1RK5A 1ME7A 3M46A 1Q2SA 4WZHA 4AY7A 2FTPA 5CZTA 3A24A 4MUPA 2PDJA 3CM4A 4BR1A 4IQEA 4ACYA 2WVVB 2YCEA 2EG6A 1D3HA 3IJ7A 4HMEA 2EEXA 3QC3A 1P6BA 1I0BA 4I9AA 1DYSA 1Q7ZA 1VBRA 2ODOA 5LHFA 3FSUA 4OUIA 4EK7A 7A3HA 1G4EA 3IAPA 2BOFX 3BURA 1DJNA 1AH3A 3VNIA 1F07A 2GUBA 2QXWA 3SECA 1Y5WA 2OU4A 2J9ZA 3AOFA 4KQNA 2IS7A 3C8NA 3IJLA 1XIIA 2VQUA 3BTNA 3UY7A 1F6PA 3IGSA 1B4EA 1P6CA 5AC6A 3OIXA 2I17A 3EDFA 2J7BA 3E49A 3WUEA 3THUA 3F5JA 3HA1A 2KX9A 3PBUA 2HS8A 4A3RA 4M1RA 2QVHA 4AEFA 4L7ZA 2CBIA 4FSAA 1P0KA 4MOZA 2BY0A 1P5BA 2XVGA 4ZTXA 3WNMA 4WOZA 3TJ4A 3BOLA 1PIIA 4YVPA 1LZOA 5HJYA 1A4LA 4UR7A 1RXOB 3TOYA 1A5SA 1YW1A 1BYAA 2OR2A 4L4PA 4M24A 5CC6A 1LT8A 3XISA 4S3JA 2V5CA 2ZZ4A 4O4VA 1E1FA 5IFTA 4JFSA 4O53A 4QHRA 1SM9A 4IOTA 5BOFA 5REQA 2XZ9A 1I8JA 1ZP3A 4PGLA 3B3DA 2REQB 4NRSA 7REQB 3BSGA 2EGZA 4UCGA 4I5RA 1I60A 1ONWA 2I14A 1EBHA 1F4AA 3W73A 1IHIA 3P5ZA 4AY8A 2GVEA 2A7RA 2HDJA 2F8QA 1MDLA 1DIOA 3L4UA 2GJXA 2VEGA 5A8NA 3QR0A 1V3LA 2YB1A 3STFA 3BAYA 1D2KA 1CYGA 1ICQA 3T42A 1HJVA 3GIQA 3NOEA 3WBYA 2OQLA 3PZIA 1R85A 4GGBA 2QCGA 4K36A 1TR9A 3TOPA 4MFEA 1WUFA 3VKJA 1ZNNA 1RH9A 2PA6A 2Z1WA 5FEZA 4ADTA 2YR1A 5F1VA 4OGZA 3IIOA 2E68A 1Q8JA 2BY2A 1U33A 3W85A 8XIMA 4UTKA 1E0XA 3W81A 5BZAA 3GYCA 3CQIA 1O5RA 4KCWA 3HF3A 3TJIA 2J75A 3VKKA 1SO4A 2A2IA 1JXJA 4Q8QA 3NEVA 3TYUA 1RP8A 1LQ0A 6TAAA 3QGAC 3UZZA 4GIRA 1POJA 3TNOA 3TSBA 3W28A 3B0VC 2OODA 2WLYA 3RN6A 2J74A 1QWKA 2PGRA 3KL0A 4W7VA 3NZQA 4AZ6A 3TFXA 5J04A 3L67A 2NXHA 3AXIA 3UJ2A 4OV9A 3DFSA 1JYVA 2IPFA 3GNNA 1K1DA 4DNHA 1XYAA 3NVDA 3UEQA 3GXFA 4JFTA 3FGCB 1BLIA 3UJRA 1QRQA 4DYKA 4CQ8A 1XIGA 1W3HA 4ZQOA 1E3ZA 4P7NA 3URAA 2BS9A 1QO5A 3AFBA 2I56A 1VFLA 1DWGM 3ZXWA 2DV0A 3ABSA 1GTEA 3S1XA 3EDJA 2DZWA 2DUXA 4M6QA 4MUZA 5CSRA 2ASHA 4L65A 2A21A 4JYEA 4NKCA 3I10A 3N04A 4EKJA 3ZJKA 4G6CA 2HS6A 3HQPA 4C6FA 1B2YA 2VRJA 5FF0A 2W62A 4O14A 2ZX9A 3KTXA 4LUSA 1EP3A 3VUPA 4DHGA 4EPBC 1B54A 2MNRA 5LNWA 4ZE4A 3EXSA 2WXDM 4Y9OA 4DO5A 1R7OA 4G5DA 1SJBA 3MT1A 4Z17A 3SGZA 1FWSA 3GDBA 3VIMA 2R6OA 1OYAA 1B0IA 3DCPA 1VJSA 2DSWA 4H7ZA 4MDPA 4IPIA 1RK6A 3EWXA 4IIBA 3E5BA 3P60A 2W4XA 3U7VA 4YCOA 4KW2A 5C55A 1UR9A 3VPLA 3N1AA 1JNEA 3MUXA 2D23A 4GOAA 1V6VA 3AC0A 2J8GA 3GUGA 1LBLA 2E28A 3QH2A 2ZX8A 1V3MA 1UR8A 3RM8A 1QPRA 3LZ5A 5LIWX 5C6MA 1DKWA 2OTDA 2TRSA 1XSIA 5CXPA 3TROA 4PUWA 2E1DA 3F7JA 3TAKA 1YE6A 1HJUA 3QEZA 1QO2A 3H2FA 5BXSA 3AYSA 3B9AA 1CXKA 2Y6ZA 3CL6A 4MAVA 3V16A 2PDHA 3Q37A 4V33A 1QOXA 7TAAA 1UROA 1OFQA 4HZ6A 1XLIA 1DWIM 4AF0B 4DJFC 1UZDA 3BLIA 4Q6XA 3WDJA 4Y9PA 1F4HA 2ZRXA 1O5XA 2OGYA 3GXIA 4I8YA 3RPMA 3O0FA 2F61A 3HURA 4DBDA 3UGVA 4H6KA 3E2VA 3NQ7A 4WSHA 5F2MA 3NZRA 3UVIA 3B8SA 4H01A 1BTMA 4YHEA 4IJBA 3LK6A 1UPPA 5JMUA 3HQNA 2UY4A 1YKWA 3GIPA 3WBXA 1JD9A 3WEOA 1JYXA 3CPUA 4FB7A 2O9RA 4LYQA 4EWJA 3C0SA 5MHBA 5D2YA 1WO2A 3EWWA 3DH7A 5HPCA 3KLLA 2VC5A 4DPQA 3TTOA 3HFTA 3GU9A 2ZC8A 4HOZA 4BY3A 4O18A 1VRDA 2DZBA 4ZXOA 4QM1A 3BDKA 1KTNA 2QMJA 4L9XA 3T05A 3U3HA 5K4ZA 1NTHA 3GB6A 5M3WA 3LSBA 1N8IA 4JNZA 4E8CA 4C1NA 4UMCA 1CWYA 3T40A 3K4AA 2QQ6A 1HZYA 3TONA 4ERAA 3R79A 1MUMA 1V0NA 4IMCA 4NJHA 2GVLA 2E9LA 4UTHA 1KLYA 2C6QA 4Z1DA 1OFPA 1XBVA 4H2HA 2ATMA 4IMFA 2PURA 4BQ5A 3N6HA 1XYCA 1V8EA 4IPNB 2R94A 5D9OA 4GIEA 4S3FA 3EGJA 3L12A 4HYRA 4YJ5A 3WLPA 4HD5A 1YYAA 3TN4A 2BSLA 4WKFA 1QVBA 3N13A 2PWVA 3TWBA 4ZSUA 1BHGA 4H8VA 3B9OA 4GBDA 1ISYA 3MZ2A 1VFSA 3R11A 3R58A 3AI0A 1M53A 3GK0A 4K38A 5LKYA 2HWGA 1KWGA 1SZGA 3ZOAA 5C7HA 2RDUA 5CPMA 1D9EA 4IICA 1H4PA 4YN5A 5KETA 2WSRA 2VEIA 1E4NA 4WY0F 2PDFA 3EMQA 1E0WA 2ZTKA 3E12A 4BWLC 1OWQA 2GYIA 4QE5A 1TCDA 2X09A 5HDRA 3MPGA 4LQ1A 2GGIA 2H8ZA 3GO2A 1TKKA 3ABOA 3SCNA 4NZ1A 2ATSA 3GU1A 3UZJA 1IXOA 4ZZ9A 2WVVA 4CLMA 1JCMP 1EP2A 4AQLA 1YDNA 3INPA 4WQ6A 2JF6A 2XGIA 4HSOA 1KCLA 1F3TA 3EWDA 4LAUA 1KFLA 1HKMA 4OBRA 3QZ6A 4J27A 4JTIA 1QATA 5CPLA 3LPFA 3HG3A 4XZNX 2VO5A 2OSYA 4WVXA 3PTKA 2E0PA 2BHUA 2V5JA 4GRSA 2A4AA 1A5AA 4ROQA 3NVTA 4YWIA 1Q66A 4IUOA 2YA0A 4CQBA 3ITCA 1ICSA 3BLEA 3UWWA 3AHXA 3HM7A 3TTSA 3UR5A 2WMHA 1S1PA 5M2FX 4H6EA 1QI0A 1QNOA 4WDTA 4DJFD 1LLZA 1M1BA 4GG9A 2QT3A 2DVTA 1LCOA 4PBFA 2HVMA 2R1LA 4GYJA 3QQ0A 5FEXA 1WOBA 4OU1A 4K7VA 5CZSA 1ZJBA 4RZ6A 1YDVA 1V6TA 3GD6A 1EA0A 1QFEA 3DYPA 4MB4A 2FZDA 4FLRA 3UESA 4XD6A 1RPXA 1X6UA 5EMUA 2VKZG 1AMYA 3GNDA 3MYPA 4KGJA 3HQ1A 3WLJA 1RV8A 4PFHA 1YLVA 3K4WA 1GQIA 3DFHA 1ZU8A 5A6JA 1A0CA 3VDCA 1OHLA 5AY7A 1OFAA 2DGAA 1VJIA 2PDGA 3AU2A 3CHFA 4YMZA 1KCKA 1WZAA 3OG3A 3W38A 5LSMA 3N4FA 6REQB 1G4PA 3B8TA 2ZDRA 4OUEA 1T7LA 2DW6A 3K1GA 4V15A 3QFEA 1KBBA 1GQNA 4RJEA 4D6DA 4IGSA 2Z6JA 3TVAA 2CZFA 4PYSA 4H19A 2YGYA 2AAAA 4EXQA 1PKLA 4HBKA 4JTFA 3N9RA 1HN1A 3OP2A 3M0ZA 3GG7A 4Q6JA 1US3A 1X8CA 4X0NA 1RLCL 8XIAA 5D8ZA 3H70A 1XR2A 4HPJA 4F79A 3R94A 2HNEA 1HKKA 1N8FA 4B4HA 3E2QA 3QF0A 4MF4A 1VFFA 2CWXA 2YL8A 3UR7A 2VQTA 5JH1A 4MYXA 1VGAA 1TV2A 4MWAB 1ME8A 1L8NA 3F03K 2FPTA 2Z1KA 2PTYA 1RJRA 2YCLB 3P61A 5AYYA 3FAWA 3UGRA 2CIPA 3LTPA 4YWSA 2RJHA 5TD4A 3MV11 4JTHA 3U2OA 4MPKA 2Q3OA 2Y8VA 1S3HA 2CLHA 1E6ZA 1E43A 3SBFA 2D69A 3SCWA 3OQ8A 3QY8A 3EDEA 1A50A 2VX4A 4UTFA 4NASA 1IEVA 1W3LA 4ZCWA 3VD9A 3VFLA 1TX2A 1X8FA 2PE4A 4N42A 4W7UA 3WEMA 1OSEA 2ZYFA 2XM2A 2X40A 4Z2LA 2ZXBA 3WH8A 1H7PA 2QMKA 3V5FA 2DT2A 3NPWA 4MWAC 2ZQ0A 4WD0A 5I07A 4MPQA 5B7YA 4NJKA 1EDTA 2J9YA 1KXHA 1FHUA 2P53A 1H51A 5LZLA 3RF9A 1TJRA 2VZUA 1UWTA 5LA1A 3TK7A 3RG6A 1FH8A 2NT1A 4C6BA 4DUOA 2OEJA 5C2GA 5AZ1A 3GS6A 1XRTA 4XAGA 1YBQA 3OBKA 3W7RA 4XBSA 3GAYA 2OLSA 5BRPA 5HINA 1V4YA 4A22A 2XH4A 4RDVA 5I0DA 5LGXA 1MW2A 3T0DA 3WNLA 4S3BA 1O1ZA 3KRBA 5DRIA 1YXYA 2YCKX 2PDMA 4QX4A 4B5UA 4E6MA 4JIIX 2ZUSA 2L5HA 4OVXA 4QEEA 4MM1A 4X22A 4DF1A 4BQ3A 3MI2A 3UJSA 2GL5A 4OQVA 3I6RA 3BE7A 3NYDA 5FJUA 4TXEA 3VILA 1J01A 5JH2A 4GJIA 4DJFA 2D2JA 2A5HA 2P3ZA 2I9EA 2GVYA 4QSFA 1ONXA 3GRIA 4O54A 3CAKA 2J8TA 1V93A 3A4AA 2G3JA 4WDUA 2FZBA 3MSDA 3QVQA 4A35A 2QDGA 3NQAA 3P93A 1ZFJA 1K7EA 1FWNA 4XX6A 1DWFM 1XKJA 1PJ9A 1VIWA 1XC6A 2HTMA 1OK4A 4M8UA 2YBTA 3Q2DA 4FF7A 3VOIA 3L0KA 3VMPA 2WKLA 1VPQA 3SADA 1XRSA 2EPLX 3M16A 3RJYA 4AF0A 3B9NA 3MP5A 3E02A 5H8MA 3WBAA 4LVFA 1B57A 1ODZA 1GPWA 3W1AA 3IAQA 3WLMA 4IH3A 2WNWA 1VFUA 3CMJA 3VIIA 4UOZA 3BJTA 1J96A 4RPQA 5FSEC 1IE7C 1GUVA 2DZTA 1C90A 4MJ4A 4I7WA 1NF0A 1OFOA 3QW3A 2GQ9A 4JQ1A 1S46A 3S46A 3WJWA 2O9OA 4WUIA 3P80A 4GE8A 1WZLA 3C0LA 3GH4A 4EAMA 3KM8A 5I3HA 3AHYA 2VENA 1UD5A 1I1WA 4X3ZA 1FWBC 4NXSA 3TP4A 3WJSA 4P2VA 2QVNA 5F4SA 3W7DA 3ITLA 2XU2A 4KERA 3MVIA 3VA8A 4R7OA 3W88A 4ZO7A 3NSXA 4Y2WA 4EOUA 1FHDA 5I3JA 1AQFA 4GI8A 3F4VA 1XGZA 1JQXA 4BI7A 3PZMA 4XD5A 2PB1A 4LH8A 1HP5A 3G1FA 5BMXA 2FH8A 3I65A 1BSLA 1QNRA 3DBPA 2G37A 3M07A 1RVGA 5KMYA 1TE1A 1V0KA 3KUMA 2OT1A 2AGKA 3WNPA 1KNWA 3L68A 1XYBA 4AD4A 4TVDA 2XIOA 3R7MA 2DZXA 4NVTA 4IT1A 5AVHA 2XVKA 4ZR8A 3RMEA 2QLYA 3A5VA 1QI5A 2PD9A 4MNMA 4Y96A 3L4ZA 3CK5A 2XIMA 3FDGA 1W56A 3R25A 2VVSA 1GYLA 3WD0A 4Q7NA 3S9ZA 5G1MA 4ICCX 2X2YA 4CQAA 2YKKA 4D6FA 3J7HA 2WQPA 3BC9A 4IIHA 3ZR6A 5EY5A 4UTWC 4Z2GA 3AIBA 4CU8A 2FZ9A 1UUQA 1GJPA 3M1ZA 1ZL1A 3NPXA 3IVSA 1LYXA 3UWEA 2WYSA 1JPHA 4KRZA 2G0WA 3SQLA 3MCMA 1GOKA 4KFOA 2EF9A 5CPOA 5IFPA 4KFPA 3ANUA 3GNOA 1KQZA 3S42A 5DO8A 3T2QA 1YDYA 1M03A 1BYBA 1C92A 3AIQA 3OLGA 3OBEA 2AOSA 1GHSA 1XDMA 2Y2WA 3KHDA 5HMFA 1REQB 5I79A 5BCAA 2VZTA 3PBWA 4HN4A 1GGOA 3CUXA 2B7OA 3PC0A 2YJQA 4N7QA 2XH7A 4PSPA 2DZPA 2QUTA 1RBLA 3QY7A 1ITQA 1FCQA 2YIHA 4O16A 2RGMA 4NYYA 5JIWA 2WMJA 1GNXA 5AOUA 1QPQA 2QDEA 2PWFA 3UU0A 4WJEA 3M5XA 4ROPA 4RE3A 1VHNA 4PMVA 3BG9A 2X42A 3WBWA 3E96A 2NLIA 3O6AA 4MLJA 3ITXA 4F0RA 1PTGA 3II1A 4FIQA 1M3UA 3WBEA 3W27A 1ESWA 3W82A 4C6LA 3GXPA 4PMXA 4R27A 2JGYA 3ATYA 1CPUA 3WQ5A 1DXEA 3H6OA 4F8XA 2EJAA 2WHLA 4GISA 1SJAA 4H04A 4HCHA 3MUZ1 2QS8A 2W67A 1RR2A 5GNXA 1X38A 5A5WA 3DG6A 4EAYA 2BOEX 4LTSA 4RR4A 4AIOA 3BMXA 4O11A 3S6OA 4S2BA 2WJDA 1MQRA 5I23A 2F6UA 1RD6A 3LTYA 1XGDA 2Q71A 5EYWA 3ZR4A 5FESA 2G50A 1V08A 3W2JA 4DUVA 2XHYA 4RPPA 4L64A 2VC6A 3IGHX 1JG9A 4IL0A 1OD0A 3QLDA 1HGWA 1C8VA 4U3AA 1XPGA 3G1XA 1KW1A 4HNNA 1UD8A 1JCYA 3LG3A 4HU4A 1BQGA 3N9KA 1NARA 1RY0A 1PX4A 5LIXX 3P81A 4IIDA 3GH7A 4Z2IA 2R1PA 1DJQA 4ICMA 4PB5A 4AWTA 2DSVA 4AZCB 1P6WA 2A7PA 2FFIA 4O19A 2PGFA 5C8BB 3WG6A 5LNVA 3TC6A 1MUCA 3WQFA 4LALA 5KZMA 4H9VA 3GNXA 2EXOA 1E0VA 1JQVA 4PE8A 2ZCGA 3F4CA 1SU5A 2DUZA 3E9AA 4G9PA 4HSNA 3AUJA 1MI3A 4KRUA 1TJPA 5DCEA 1R3YA 3IK4A 2CBJA 4JTRA 3QXBA 5EBUA 3TJXA 2FMOA 2J7HA 4U5KA 4JNMA 5HWNA 1KR0A 4Q4MA 1E0UA 3EXTA 1IT7A 4QBXA 4IFOA 2VGBA 2QJNA 4NAFA 4JY8A 4OV4A 1PUDA 1V3IA 3BW4A 4F9DA 1S5VA 3SQSA 5D03A 1RQEA 5FF7A 4FR1A 3WH9A 3EWUA 3NQBA 1EJWC 3ARTA 3FEMA 4WJ8A 1ISVA 2YL9A 1WP6A 1HNYA 3ABRA 1MXGA 2X16A 3ABZA 3M5ZA 2CXGA 1QDSA 1RA5A 3PNZA 1WCGA 1AJ2A 1W9VA 1GONA 3TLQA 1G6CA 1GQKA 3UERA 1IF2A 4I7VA 4PMYA 4NJGA 4C1KA 3T8QA 3WD3A 1V3HA 2ZE3A 6ALDA 5GVJA 2FZ8A 2YZ5A 4C7GA 4QLJA 4Z2JA 3OZOA 1UWAA 2J77A 2E6DA 4LBRA 4K1WA 3FNDA 1BVNP 1OFRA 3WFLA 2Y24A 3SN1A 5C9ZA 3R10A 3P0XA 4BS0A 3NZ1A 2CLPA 1TZ9A 4NZCA 5HNRA 1S2WA 1Q6QA 3NZGA 4AB4A 1EX1A 2OB3A 5M17A 1TJ0A 4QDMA 3IGXA 4HMDA 1W9DM 1HVQA 4KH2A 3W29A 1KXQA 2AGTA 1CXFA 4P8VA 5ECVA 1H5VA 1KTBA 4H7VA 2P50A 3L21A 3NCOA 5E5CA 3EOEA 2YDQA 3CHDA 2DZUA 1WV2A 3SDOA 2VHLA 3RITA 3G8RA 1EJTC 3H2AA 2J7DA 3LCWA 1DE6A 3WDIA 3T9PA 4C6QA 2RGLA 2UBPC 5C2CA 5BXPA 1T6MA 3WK0A 5HATA 2FVKA 4IPPA 1JZ6A 5I3IA 3NA8A 1Q7MA 4C6IA 3VXGA 3Q67A 1W31A 4RNIA 2DUAA 4JNYA 3G1RA 2QGHA 3S1UA 2PWGA 3WJXA 1EZWA 1RHCA 1J0ZA 4QROA 3R8GA 5BNKA 2OFJA 3TYCA 3AWOA 4GQQA 3KOWA 3NXLA 3W7JA 1EYEA 3MKVA 5I24A 5IRPA 1NP0A 3G5EA 3CV1A 1XUZA 1T0OA 4I5XA 4C6PA 4CQ9A 2DSZA 2DIEA 5D38A 5FI8A 3VOGA 3MMUA 4DZHA 1VRXA 1VCGA 1VF8A 4PCTA 4Q8UA 4QNEA 1AZ1A 1FWRA 1B1YA 1BSIA 3W6MA 4EPDC 4YU1A 4P7OA 5KITA 1GG1A 1XLJA 4QNWA 4FALA 1MFVA 4H9ZA 4DWDA 2PS2A 3AU6A 4GY1A 3G1YA 3DG3A 1QASA 5U7SA 3KEHA 5GJPA 3IJIA 4UMAA 2SFPA 4JZ5A 2DVUA 4TV5A 2A3HA 2QJIA 1KM3A 2INFA 6XIAA 1W1VA 4FZIA 3EMZA 6A3HA 1AMKA 1NVMA 2NUXA 4ICNA 3AICA 1ALDA 4KEUA 2EPKX 3LHUA 4A3YA 2H6RA 3BJSA 1DPMA 3QHNA 3GVVA 4B3KA 1N2VA 4QDWA 2KZHA 1ITUA 3F4NA 4JIEA 2HISA 3DDMA 1FFQA 5ABEA 4Q4OA 3N34A 3ZJ8A 1OM0A 4BJHA 1PCKA 1EIBA 1T99A 3STGA 3OHIA 1OIMA 5I02A 1SO3A 2W92A 1YHTA 1UH4A 2EHHA 1P48A 3SGUA 2ZRZA 4A4AA 2J66A 3KTSA 4CNPA 4M19A 5HK4A 4FF5A 2Z4GA 1FH9A 1OGSA 2QPXA 3CTLA 4H7CA 1E6NA 3TYDA 3GVWA 3D47A 5CQ1A 3NQGA 1QMLA 1OF8A 3CAQA 2XIQA 1WKFA 2EPNA 5PTDA 5AYBA 1K4HA 1HFBA 1Q5MA 1XINA 4HMCA 7ENLA 4NX5A 3GR4A 4CCEA 5BOEA 3HO8A 3F2CA 2CKRA 2HROA 4O4WA 4OKDA 2VOMA 5HUOA 3PVFA 2D0GA 2Y5SA 1PVNA 3S0CA 2AMGA 3NL5A 4G2DA 1MNZA 1XIMA 3LENA 4G1NA 4AIEA 3L2IA 1JFXA 3S47A 3CWHA 1EX5A 5C70A 2AQVA 2HXUA 3W7NA 1ADSA 4GI4A 1W1A1 3E2SA 3B06A 3PPCA 1MFUA 1LLWA 2OZTA 1YTDA 3WNKA 4D6CA 2D3NA 3U8GA 2PEVA 2XGBA 3COTA 2G8ZA 2FH6A 1GOMA 3BAWA 4AMCA 3PZVA 1XH0A 3C0QA 3L4TA 2VMFA 4LANA 3EKZA 3R2GA 4FA3A 3AROA 5BOOA 3WIJA 3M9YA 4QFUA 2UV8G 5A8PA 4IXHA 3EX1A 3CUHA 2Q01A 3MJMA 4N9DA 4H83A 3NQEA 4HKPA 4NZ5A 1C8YA 2XN1A 4RNHA 2A6LA 3IUDA 4TMBA 1BKHA 2O4QA 1E6PA 1FCVA 1BG4A 2WWCA 2Z6IA 1FP9A 3GM8A 1QNVA 2WMIA 5TQLA 3SZ8A 4O10A 4WDWA 4AD5A 5BU9A 4JTTA 3PZUA 3U5UA 3OZYA 3TAOA 1GVFA 2W66A 4JTDA 3KDNA 1FDZA 1VKFA 1GOQA 4C7DA 4GGHA 4L4LA 2O7QA 2VVNA 2NXGA 2TMDA 3CHEA 3WFZA 1LL4A 3N4AA 2Z0IA 2XTKA 1X39A 3I4KA 3PFMA 5BRBA 3W9ZA 4DAIA 1WUEA 4QLKA 3S5NA 5SWUA 1H1NA 3N6JA 1IXPA 4UFKA 4ZGYA 1XCWA 5EFFA 4GI9A 5F2IA 4AZGA 4QJ3B 1M68A 1Z3NA 2J6XA 3DHPA 3E2RA 4H8NA 3WL0A 1TWDA 3PAOA 2C14A 1MEIA 1NDYA 5FIPA 3CAWA 3A13A 1PEZA 5HAOA 5C9RA 1VD6A 5DLCA 1GORA 4QIUA 2OJPA 3R8HA 3SSJA 3PBYA 3KCOA 4LYPA 5I06A 4TU1A 3KOFA 4UFJA 2W79A 5DY3A 3W4RA 4Z1BA 2VEPA 1JDFA 1LQAA 5JQ9A 4DQWA 1W9BM 3LBCA 4M7SA 4A21A 1W54A 1L8PA 2OOGA 4WOQA 3VNMA 4V27A 3UXLA 4O8AA 4PMQA 3ARVA 1J93A 5DMNA 1F9CA 4UIOA 3DGRA 3WY1A 1R3WA 4GO8A 3EA1A 2G3NA 3O07A 5DFAA 2H90A 3D3AA 3NAVA 3B8VA 5HANA 2VNCA 1Z7AA 1DQUA 2BZNA 1QPOA 1ZCOA 4QQUA 3MO4A 5G2HA 5DQPA 5H8PA 2GOKA 4O1AA 3TCEA 3PF3A 3CYJA 1GW9A 4K37A 2UZ9A 4LV9A 1H62A 1MEWA 4M80A 2E5DA 1BFNA 3P6LA 1I45A 5JBDA 1IWBA 4GYPC 1ZENA 3CUIA 3OTRA 2FYMA 2QDDA 2F6KA 5A94A 5D2VA 4IL2A 5FCZA 5AZ0A 3W7PA 1UP3A 5GPRA 4A29A 4XD3A 3CZJA 3SCOA 4PH6A 2Z26A 5AC5A 4O52A 4CU6A 3WH5A 1J18A 3VE7A 4NJIA 1G5AA 1CGTA 2PGEA 4H2CA 3E0IA 4S1FA 3DI1A 3EOOA 4F48A 3VGHA 3VCCA 3ZT5A 3RDKA 1CXEA 1LBMA 3C2EA 3UG3A 4R34A 4UFHA 1UWUA 3AZSA 5IHSA 1DJHA 3LV5A 3U7BA 2G5WA 2E8ZA 1ENUA 2QULA 3IPWA 4K8GA 1UH2A 2QCNA 5LXXA 3OLEA 3CV7A 2V2HA 1FXPA 1O68A 2CU0A 1ZAJA 2YL6A 1XYZA 1UW9A 4P5UA 2XIJA 1W3NA 3UR8A 1KRAC 2VWSA 2I57A 2CLIA 4A8NA 3SEPA 1PX8A 5FD0A 2I9UA 4G56A 1QK0A 4JX5A 3QQWA 4LB4A 3M0MA 4A8IA 2DDXA 4CD7A 2ZUNA 1OT2A 1R3VA 4JOMA 1VYRA 4GD0A 3G24A 4MMWA 3H2NA 4C6DA 1IT8A 4C6MA 2V68A 3GHUA 4Q8TA 2XVLA 2QHAA 4ZQNA 3C5QA 5HR6A 3LCFA 3T78A 1X96A 4MJMA 5FAGA 3WLHA 1F8MA 1F8IA 3CHCA 1Z89A 3VCNA 4CEXC 2X0HA 3KBWA 2BGSA 1KFJA 5G1YA 5IBXC 1DJXA 1GVYA 5DN1A 3LGGA 3AALA 4AVOA 1H1YA 2YL5A 1FWHC 1JZ5A 3PTDA 2V6AA 2OWWA 5F2GA 2GSHA 5EMYA 2J25A 3GC4A 3P7YA 4P8WA 5JIPA 1YTKA 4ES4A 1O94A 1CW2A 2XWEA 4LAMA 4BA0A 5C0QA 1P1XA 1PCWA 3SURA 1CLXA 4B9ZA 3M0YA 4HYVA 1SJCA 5C9WA 1JF5A 4AAJA 1KM4A 1V6UA 2FLIA 5HNNA 3UW6A 4HA3A 1M6JA 1KM0A 1R9YA 1EO5A 3BARA 4K6AA 4PMZA 3NM1A 3V0UA 1QNQA 2FZNA 4IFRA 2RFGA 1C29A 4QXIA 4ACZA 3NL2A 4NX0A 4S39A 1E6RA 1PL9A 3GQYA 4EPKA 4RNFA 5E9AA 4M6PA 3TW6A 3T0TA 2X2GA 2VI0A 3ZVIA 1Z6KA 3CL7A 3KL5A 3PUGA 3BLDA 1H50A 3N12A 3N19B 3KBMA 4H9YA 3TV8A 3M5YA 4L56A 3ZVHB 3NDZA 2QJHA 2YXOA 3ARSA 2ALDA 1DE5A 1Z8AA 3TQPA 1W37A 1OFDA 1GOWA 4R9OA 1OX5A 3G2GA 3LCLA 3ZSTA 2CBVA 2H9AB 4JQ3A 1KR1A 4W8AA 3DN5A 4DO7A 2ZVIA 3ZWTA 2CPUA 2NX1A 3KL3A 5HMEA 1TPH1 1HIZA 4LFYA 3H2OA 1CX9A 2WWDA 4DY1A 5AC8A 1PXGA 4C6CA 7ODCA 2BVTA 5EU9A 1A5LC 4LX4A 4W8BA 2B7QA 5FKYA 1PHWA 2C71A 4JTLA 3LMZA 4GIYA 2X05A 1EPVA 4IGNA 3WLIA 1A5UA 1O12A 1DEDA 1EH9A 4RKAA 3VE9A 3AIWA 4FNPA 2BASA 3VZYA 3P74A 3CB3A 4ERIA 3WN6A 1WE5A 3AIEA 3GR7A 3PZ9A 1UA7A 5FEPA 4D8AA 5G2IA 4UOJA 2FPYA 3GIYA 2EAWA 2BVYA 4OBTA 2V30A 2VZVA 3KBJA 1MW0A 1BAGA 3MHUA 3PNUA 1XSKA 2XSAA 1FXQA 3CASA 3O0KA 3PUDA 1U83A 3PSVA 5A8MA 3LRMA 2PF8A 2EJ1A 4INFA 3ZFHA 5LGZA 1JPKA 1TVLA 2YA2A 2WMFA 4LF1A 5K3VA 2NQHA 2P0OA 3R5EA 4GUGA 3M0IA 4KIEA 3LS9A 2G97A 1VFTA 3G0SA 4LVBA 1VBHA 2IKGA 2VR5A 3DHFA 3LQLA 4S3EA 1IIHA 4JTJA 1UOKA 4DX3A 3UVAA 4U10A 3RXZA 3SRKA 1ZQ5A 2QCCA 1PDZA 2GJNA 4JIHA 4Z2HA 1E6SM 2RUSA 1RVKA 5DXYA 1OFBA 2X30A 3VINA 3CJPA 2QJGA 2J8FA 2PU1A 3M0HA 1FDJA 1KFWA 3LM3A 3A23A 3CQJA 1Y7VA 5GNZA 1E70M 2ACQA 4CN6A 1S2VA 2PWUA 4TX9A 3WFAA 2BY3A 1CLKA 2WC7A 4NIRA 1FWFC 2P76A 2J13A 3A9IA 5LXEA 1B31A 1TTPA 2ABAA 3L66A 1T96A 3EDDA 1KBJA 1UR2A 4GI6A 1XIHA 4GVFA 3W24A 3O6CA 5CKSA 5CPQA 3S83A 1OGGA 2XUCA 5I77A 3P8IA 3OVRA 1EPXA 1UQYA 2A1YA 3NSNA 3UPBA 2BGNE 1NFGA 4NRRA 3IJ8A 2NSXA 4DJED 4DWSD 1UH3A 2XGZA 1W1TA 2Y1HA 5TAOA 1UC4A 1MVYA 3MMTA 4NXKA 1NU5A 4RX0A 3HGRA 2FTWA 6CGTA 3V7PA 5DMLA 1HX0A 3LN3A 4F40A 4V2XA 1JUEA 3C2OA 4FIRA 2WMKA 4NU7A 4QTGA 1FH7A 2A79A 3IIVA 1EKOA 2XFYA 1KXVA 1JDCA 4UWMA 3BLOA 2WM1A 4XAYA 1PKNA 1JZ4A 3VIHA 1QPKA 1NSJA 2HBVA 4J3SA 4IFKB 3RAOA 1WAUA 2JFEX 3W7QA 2HRWA 2C1HA 3NQVA 1YNPA 2Q3RA 2P8BA 1OCQA 2VFEA 1S2TA 5G4WA 2VFHA 2VTFA 4N4PA 5C71A 2GQ8A 3MI3A 1PYFA 1V02A 1XI3A 3AXHA 1KC7A 4MHBA 3M64A 2CZVA 3IJ9A 5XINA 4W5ZA 4M6VA 1GOIA 2QCDB 2I5IA 1EF2A 1HL8A 4WDXA 3RLHA 3IIXA 3LYEA 3CMFA 3I6TA 3W37A 4TX6A 1C3FA 3WF4A 1OGBA 4Y90A 2V3GA 1L6WA 2XH2A 2J79A 3VGEA 4US6A 3R0UA 1P7TB 1UD4A 4REQB 1DL3A 4B16A 2WVSA 4UNKA 4TVCA 3W7KA 3LM7A 1EHNA 5FF2A 4QSHA 4AMAA 3KVMA 3DFNA 2R91A 3C8FA 1K8XA 3S6DA 1GZGA 4C6OA 5I5RA 1CENA 3N2OA 2E6YA 3SUVA 1KBKA 4LAKA 5K4XA 2PP1A 2H3BA 3TE9A 3GAKA 1LRQA 1F73A 4LS0A 3EYPA 1OQFA 2VCBA 3E0LA 3CUJA 9CGTA 3BWWA 4HNOA 1L2UA 5BYWA 2P3EA 3MTWA 4AEOA 3WMLA 4LUYA 1Z44A 4KT2A 4PC8A 1BWKA 2JF7A 3RGTA 3GZ3A 5F4XA 3LTSA 3M0XA 4LV4A 1V6YA 4ZE5A 3RX2A 1RBAA 1TJ2A 3DERA 2ZUTA 1E6QM 1H0IA 3O15A 3B9EA 4DBSA 2F2HA 3AS3A 3NXFA 4DNMA 2NLYA 4L1WA 3KBNA 3CIWA 1ODUA 3AS0A 1JIBA 3DFQA 3B0XA 2Z1BA 2WZEA 3V0SA 4Q8PA 1CNVA 5DMMA 4I3GA 1XC4A 1KFCA 3BH4A 3WZ0E 6XIMA 3VNYA 1XFCA 5KTLA 1XQLA 1XBYA 1UB3A 1VEMA 2GPTA 2QV4A 4DJEA 5D2TA 4DWSA 1FVPA 4TIMA 3CH9A 2C79A 1B3WA 2P1FA 2Z2UA 2VD8A 2OZ0A 1JRCA 3HB9A 4O1EA 4IMAA 1G0CA 1W8GA 4D6IA 1QPNA 1R9ZA 4D6GA 2OSXA 5XIAA 4D2JA 1R3QA 4MGGA 4Z1CA 3ALGA 3UCCA 3RJXA 1NFBA 3UG5A 3QR3A 1H11A 4F66A 4B4FA 3W22A 5HPOA 3BPWA 3BV7A 4JXCA 3GBDA 2VUNA 1C7SA 3PJUA 1LOQA 2BP1A 3PPFA 3LQGA 4XBKA 3W2LA 3TYBA 3LHWA 1TWIA 1TPB1 4UTMA 3GTNA 3H4WA 3CZGA 4BEUA 1QTWA 1OADA 4MY8A 1SFLA 1HKWA 1V77A 3AYVA 4RZBA 1YIXA 2E9MA 3PZGA 5C7VA 1V6XA 3SUUA 3UF9A 3FHAA 1K02A 4HGXA 1OCNA 1AQ0A 1DTNA 4HA0A 4RV8A 2XZ7A 3N15A 4UTTC 3QKZA 2AL1A 4ADSA 3W53A 2X7VA 2OO6A 4FAMA 1J0JA 5FJOA 4FLSA 1JF6A 2WKGA 3ARRA 3I3DA 1UUMA 3ZJ6A 4I9MA 2PRLA 2VGGA 1HVXA 5I3FA 1A0EA 1WPCA 3W7CA 2NQ5A 3RR1A 3ZVHA 4UFMA 4TR9A 2YCJA 5CZ0A 4GIAA 3L65A 3FY1A 2QUNA 4HZMA 4RV3A 5E9XA 4D1JA 1J0IA 3VNDA 4ML9A 1Y0EA 2WAGA 3JRKA 2O0TA 3C56A 4M81A 2WSKA 4C90A 2XM1A 1KGUA 4U5IA 4JTSA 4GABA 4NZ3A 2OX4A 2WV8A 4JTUA 4AD1A 2RH9A 4YHGA 1S1RA 1F3EA 4H9XA 3VGDA 5A6LA 1OX4A 2ICSA 1RUSA 3AIRA 4ZO6A 1GVSA 4B15A 3MKKA 1PPIA 2WOQA 1HKJA 3GDTA 2BX7A 3V1PA 1VFOA 3TXVA 2ZXDA 3ARZA 1N55A 4GNJA 4U28A 4CUCA 1TJ1A 5FSDC 2WHKA 3OQEA 4CCCA 3RR4A 1MW3A 2WZHA 3LXCA 2C3ZA 2QCMA 3AIUA 1WYIA 4IJCA 3BW2A 3LX9A 3WENA 3V5CA 1DWHM 5C9UA 1C8QA 1R3RA 3BW3A 1Q8AA 1UWIA 3JU2A 4XIAA 5ABHA 4WJXA 4DJDC 5L6UA 5LIUX 3QZEA 2ZRWA 1YDOA 3THCA 3P0WA 4FNQA 3W1RA 1RCQA 1FOBA 3BAJA 4B5WA 2JKEA 1JZ3A 3F1QA 1PTAA 1SUXA 4JFWA 3ARWA 2OX1A 3W7MA 3ZZ1A 3VC5A 3DFOA 4N4QA 3OLIA 5BRQA 3LA4A 4G8TA 2TAAA 1ELSA 1ZPTA 1GYNA 1X6LA 3QGKC 3DOPA 1W32A 3FS2A 1OX6A 1CB7B 1OABA 2D0HA 1OVDA 1SO5A 2DH3A 5CPTA 4JIRA 4JTAA 4Q8WA 1W1IE 5K9DA 3QLLA 3VX0A 1WQ5A 4RDWA 3FVDA 1ADOA 4JPGA 1KA9F 4OOZA 1Q4WA 2ZWYA 3HPAA 5GJNA 4LOCA 3WQ8A 4H6QA 4HTYA 5H6HA 2G41A 2Z1SA 1WOAA 4AHOA 2GGGA 2VGIA 1DXIA 2BB0A 1KLZA 4H9MA 1VH7A 5IHRA 2VD9A 1WDPA 3NQ6A 4RE0A 1SSDA 2TSYA 2AAMA 5LHEA 4PTWA 3FJ6A 2LLEA 3LBOA 4F0SA 1I2OA 4KWWA 1OB0A 3LI0A 2W63A 3ITOA 5AECA 4O0QA 5CBJA 5CG0A 3H2MA 4NY2A 3K8LA 4MB5A 5EMLA 5HR7A 1FHLA 4PMNA 3U2ZA 1R86A 2O92A 2Z27A 4B91A 3PG8A 3DECA 4NZJA 2C18A 2QCFA 4QR6A 2RAGA 1W5PA 3L2LA 3TR9A 3PG9A 1IEWA 4HHLA 3TXZA 2WPGA 1GVOA 5MKGB 1XM3A 3JS3A 1V3KA 1W9UA 3E38A 3T0AA 4GVIA 4J7RA 4CNOA 1E55A 3TQ0A 4JN7A 4POCA 4UXDA 1JL8A 1R38A 4KS0A 3BJFA 4ZBCA 2JKPA 1UQZA 1Y65A 2GQ3A 2ZADA 1XFBA 4ATWA 3CTTA 4J9JA 2R1NA 4IMGA 3H2CA 4S23A 4P61A 2Y88A 1QUMA 4HPXA 5C9XA 1DWAM 1Q63A 2V5LA 1W8SA 1UASA 5M5DA 2QJMA 1F5ZA 3L4YA 4DN1A 4CD4A 1UWSA 5A6BD 3THDA 1WX0A 3QYQA 4UBPC 3SUTA 2NQJA 1FWTA 3MW7A 3WQGA 3CPRA 2PSNA 2WLZA 1VC4A 3WLTA 3ITTA 4A8RA 4WXYA 1ZP4A 4HNUA 1S2CA 3P14A 2PD5A 1K7FA 4QCFA 3W2MA 3SM0A 1TPWA 1XP3A 3SI9A 5CJ5A 4E8DA 2NT0A 3KVKA 3LCIA 2HE5A 2PC4A 1P7TA 3LPOA 3KCJA 3DYOA 3GE7A 3REQA 4LY8A 4DYEA 2Z7KA 1F2JA 2WKJA 4FK9A 3N11A 2NZLA 4QJ5B 3WK1A 2PP3A 3GW0A 2P0IA 1XS2A 2OEKA 5AFDA 4JIPA 3FIGA 2ZX5A 1PZ1A 3TKFA 4MNLA 3EZ4A 4GFIA 3MMWA 3OJGA 1G1YA 4ZB5A 1LROA 1XIJA 4FNUA 2E25A 3LY0A 2V63A 3OVPA 2ZZ5A 1JJKA 3SIMA 3O1NA 2NXIA 3EOUA 1GQJA 1BWVA 3TWAA 3VNJA 4H8HA 1UA3A 3T4CA 5FJJA 3WDHA 4BI6A 1XICA 4ZVJA 2D0FA 4O0ZA 3F5LA 3DHUA 1KD0A 4U3CA 3LLDA 3STEA 1T8XA 3VIOA 2EBNA 1ZAHA 3PHAA 3G1AA 1M41A 4ZFCA 2WANA 2JE8A 4Z42C 3K4DA 3QPYA 2OOFA 1UR1A 4GH1A 5HWMA 1DIEA 2ZUVA 3VYLA 2J62A 4WKAA 3WQPA 2R1MA 1QT1A 1KQYA 4UR8A 2VX7A 1J4EA 2VT0A 2GJPA 4CVWA 2E5CA 2FDMA 4O17A 2ISFA 5HJXA 4DM1A 1OD8A 5HQLA 2OVLA 4JKLA 1X97A 4QJ4B 4WXZA 1KM1A 3DX5A 3OGRA 1XYMA 4ZFMA 4DXVA 3EPMA 1MXDA 1CGWA 2DJXA 2GUUA 3UPWA 3VU2A 3MWCA 2Y4SA 4J35A 4PA8A 1GTHA 2P8CA 1IEIA 2QPSA 1D8WA 5BXTA 2AMXA 1E9IA 3N9SA 2IKJA 1EF3A 4Q8OA 3UWUA 1Q6LA 3LMYA 1Z69A 1GOOA 3IJQA 4E2OA 2QIIA 3IIPA 3I3BA 2HV5A 4FP1A 1IEQA 5CSYA 4F4RA 2PDLA 1QR7A 3DIPA 3FV9A 5FL1A 4CVUA 3L4XA 2WHJA 3W75A 1EJUC 3RYSA 1I2QA 4NZ4A 4Q8NA 3UYIA 5G4HC 4A3HA 4FOKA 2VM8A 4CD5A 4KWUA 4P7LA 1U1UA 3G8EA 4HJWA 2PDNA 4PSRA 3TN5A 5A6BA 3BOFA 5E6ZA 3CBWA 3MO7A 3MCOA 4E2DA 3EAUA 5D09A 5ABTA 3VIPA 3GTFA 3DC0A 3MHGA 2P88A 4MZ1A 3P8JA 4P7RA 2GGJA 2DY3A 3SY8A 1ML1A 4DELA 2VR4A 3ZIZA 2HK1A 4X61A 2E3ZA 3VGFA 1V6WA 3POCA 1EGMA 3DG7A 1XCXA 4C5YA 4IQDA 3WF0A 1AA1B 3VCRA 4YXGA 3GDKA 3VIKA 1GVRA 4M6UA 2Q8LA 1K6WA 4OJYA 3ERPA 2J7FA 1MYRA 4NNAA 4S3DA 1JVNA 2WZIA 2BXVA 3S3GA 3CO8A 2GVGA 2R8WA 3ONBA 3OZPA 4LYRA 3MCNA 3WDPP 1FQ0A 4UQBA 2PDXA 3NQ2A 1FTXA 1BYDA 1K7XA 3L9CA 3UG4A 4ZQMA 3DEQA 4LC8A 5DEZA 1ZY9A 1SO6A 2W6RA 2X1RA 3SUWA 3P62A 1H0GA 4F0KA 1GK8A 5F4WA 2Z1XA 3FHQA 3URNA 3Q58A 2VCCA 5FJPA 3EMCA 4HU8A 2RHGA 1GKQA 3A12A 4NHVA 1OF6A 3C4UA 1XD1A 1OCBA 2Y63A 4JTGA 3N29A 2C91A 3FJLA 3T0CA 4BEQA 1LL6A 3VIFA 4JGDA 3P3BA 3UXIA 2YXGA 2ZZ7A 1QU4A 1XH2A 1OG6A 4RDYA 3Q4DA 4NP7A 3FDKA 3GLCA 5HULA 3QHMA 1GEHA 3N25A 1EGZA 1UG6A 2QW5A 2NQ9A 1PIFA 3M7WA 3GSMA 4IPLA 4RK8A 5AYXA 3H12A 4GYFA 1GZ1A 3IUIA 4NG3A 2DH2A 1ECEA 3W72A 3W1NA 2EPOA 4Y9NA 3UA3A 1EOMA 2VL4A 1L6FA 4L5ZA 3LOTA 4E4FA 4MAZA 2Y8UA 4MY1A 1G01A 4UQAA 1ZLPA 5BWFA 2BXZA 4E38A 3MSYA 2Z28A 1WZMA 3W1LA 1EO7A 5FJTA 4HMNA 1G7VA 2J47A 1E15A 4BF9A 4DVOA 1EC7A 1HJWA 1JPMA 3BANA 2DT3A 4JTEA 4HT3A 4O1FA 1FY6A 2FTYA 3VOFA 2QUVA 4GCXA 2ISSA 3WQ4A 3NTYA 4Y8FA 1DJIA 1M65A 3PJWA 1XPYA 5H91A 4URIA 3G18A 4KPLA 3O2LA 1EA9C 1VPXA 1VS1A 5EPDA 3H55A 2CFFA 3TQVA 3S5ZA 3R1ZA 4MDOA 4ZOCA 1I1XA 2YCIX 5CCZA 2D3LA 3UJFA 1OZMA 1YNQA 2BWGA 4NNBA 1MMFA 1E1EA 9RUBA 4FMVA 5LNRA 1TTJA 1NIUA 1VBJA 1M9HA 4DBUA 2V81A 1MEHA 3ARUA 4AWUA 4GA8A 3QFWA 1MSSA 3ZJ7A 4K39A 5JUVA 2CHOA 4DI9A 4ZENA 3V75A 1AQMA 3TC7A 3P84A 3W86A 2ZE0A 4MJZA 1JGMA 5E70A 5FA5A 4GUIA 2GWNA 5MF5A 1XDJA 3GC5A 3YPIA 1EC9A 2WSPA 5JVLA 2ADAA 4B5NA 2NX3A 1TFVA 3TQKA 3NGJA 5HMSA 3FA5A 4GUHA 5XIMA 1YXDA 4JN8A 4MTVA 2O9TA 2GUYA 4AXKA 1UIOA 3IJ6A 3MSRA 3STPA 4JYFA 4Q4SA 2Y61A 2YA1A 2PWHA 3VZXA 3HMJG 4GNKB 3QHOA 1PYMA 4ADUA 4F2UA 2XG9A 1N82A 4QEHA 3W00A 4KGLA 4QAWA 3GW3A 1UD2A 4B5XA 3VKAA 3HV8A 1UKPA 4IMDA 2V0TA 1DXFA 2XWDA 1RBOB 1W5NA 1UYQA 1RCXB 1V03A 3I7QA 2IKIA 1H7NA 1UKSA 1LORA 1TRIA 3AMDA 3UCQA 3L5MA 4EX4A 5I2UA 2HSAA 1CI1A 2GVJA 4J2PA 1DQWA 4WY0B 4MZYA 4LEQA 1NOFA 4OOUA 1PZ2A 3VABA 1DBTA 5DXXA 1THFD 5D9MA 1NQKA 1TZ7A 3PK7A 1VCFA 4R53A 1KWKA 3OLDA 2A3AA 2Z25A 4M3PA 3W1PA 3AS1A 2F84A 2DSUA 4A3UA 4PULA 1HL2A 3H24A 1CEOA 1XGEA 1AQHA 2EPHA 4D6HA 3URQA 2I1OA 1JYWA 3S6TA 3KP1A 3EA3A 4JEJA 2AQOA 5ECUA 3QQ1A 3A4WA 1DTUA 3WF3A 4LCSA 2ZXQA 4GC3A 1SZNA 1VPYA 3N18A 2REQA 4IP4A 7REQA 5M1TA 1XLKA 3V18A 1HO4A 1J8VA 2J6VA 1NM9A 1BXBA 4LVDA 2QF8A 3FKRA 3S1WA 4QJ1A 3CUGA 5F7UA 2GQAA 3MU7A 3HPFA 4WRHA 5REQB 2WBKA 3GXMA 2O9PA 1LM1A 3W2NA 4YTTA 1RJQA 1EJ7L 3HJZA 4RW5A 3TA6A 1XL9A 3I68A 2VFGA 1TB3A 5I3GA 1BKSA 4LSBA 4GQRA 4WKHA 3DYMA 1YPFA 4KWSA 4F2TA 3MDUA 2GJXB 2NQLA 3B4YA 4PMDA 4E2BA 2ACSA 2ZIDA 4OZOA 3LLFA 2DJLA 4LBUA 2WZTA 4RZ4A 1UOZA 4ZSTA 1LRNA 1SSGA 3TFCA 2ZUMA 3CUFA 1I75A 4JD4A 3EOLA 1O60A 3WEZA 4W7WA 5FOOA 2NWRA 4AIBA 2Z2BA 3GWQA 1W2PA 2GWGA 3V36A 3PZQA 3TW9A 1TR1A 3HV9A 4M29A 4PUKA 3TTQA 3HFYA 4I9TA 4PEKA 3T6CA 1QBAA 2GSJA 4ATLA 3LXAA 2D20A 1A5MC 4JHZA 1ZUAX 1GWJA 3W7IA 3CAVA 4LPCA 3UETA 2A85A 1Q6CA 3A21A 5T8GA 2JQXA 3CB8A 2GSEA 2X7WA 2ACUA 5CAHA 2J24A 1P0DA 3VDGA 4N02A 5A3HA 3FGCA 1G7UA 4JY9A 5ENLA 1O5KA 1XD0A 4DO4A 3H53A 4FO4A 4NI8A 4HYWA 1JEZA 4AXNA 1KBLA 3VVGA 1FWEC 1TV5A 1JUKA 3PB2A 2V69A 1EYWA 3SGGA 4PBGA 3BSMA 3RUBL 3TZFA 3W7HA 5H8UA 3QRHA 3E1F1 1J0YA 2OT0A 1NWSA 1DOSA 3IUHA 4LCRA 2NV9A 1H09A 1P0NA 3OYZA 3FFSA 3TJLA 3PUEA 1KFEA 3RRXA 4OFCA 2PDUA 4IGHA 3APTA 2ZZ2A 3GTXA 4AX7A 2DSKA 4WK9A 5HUPA 1QW8A 3DFPA 3FAXA 1YX1A 4TQTA 1QJWA 3WQVA 1TRDA 3NO1A 1EFZA 3VD4A 4JICA 4XKYB 3TSDA 4J3XA 3CO4A 5I78A 3HJEA 4N6FA 3R4IA 2WZMA 3KZSA 1SW7A 4NZFA 4A2RA 1VBGA 1IGSA 3QW4B 3AMGA 1LUCB 2OLAA 2OYMA 2YDSA 1CBGA 1W1ZA 3S2MA 3L4WA 5G5IA 1US2A 1YQ2A 4OIFA 5KZ6A 4Q32A 1UZHA 4GJ1A 1JCXA 4HK7A 4IIGA 5HMDA 3MMDA 2BBFA 4U33A 3G77A 3SCVA 3B4UA 4RW3A 1FUYA 3TIMA 2IPGA 2OEMA 5D04C 2EKCA 4Q7BA 3BL3A 4JX6A 2CNCA 3PR2A 3W25A 3ZO9A 2ZWZA 3DBNA 2NVCA 4AD3A 2A0NA 3T55A 1EIXA 1TV4A 2FHFA 5L9FA 4Z2KA 2D2HA 4GQBA 1C91A 5G1TA 4O1DA 3KBSA 2VP8A 3HPXA 1R9XA 1M7OA 3ZWSA 3WYZA 5D9NA 3G6MA 4UCFA 4A2SA 4DXKA 3MHFA 1FA2A 3W74A 3IRSA 1W5MA 4B9YA 4A6GA 2FDSA 2OLHA 3WSUA 3KLKA 1GOXA 1W5OA 4H1ZA 2WCSA 4XTIA 3NPVA 3UXAA 9XIMA 3A47A 4C5ZA 4QG6A 2J7EA 1CXLA 5CGTA 3HBLA 1WXJA 3R43A 5AHEA 1A3XA 1BXNA 3M43A 3PBMA 3A64A 2E77A 3I4EA 3ANYA 1B90A 3PB0A 4AEEA 1K3UA 2CLFA 4W5UA 1QI4A 3VI2A 4O13A 4L9YA 2MANA 1XUUA 4XQ6A 4GVGA 3S2CA 3GNRA 4LS2A 5D05A 1A49A 4GUJA 1VR6A 2POTA 1S2AA 1TREA 2E4TA 3ZS4A 1PTDA 2VFFA 4GC4A 1E73M 4X9SA 4D72A 1EJVC 4PRWA 1PWMA 2RDWA 1Z42A 3SRFA 3KWSA 3GFXA 5JBFA 1X1OA 1TUFA 1O4UA 1OCJA 1V51A 4O57A 4JDBA 5GNYA 4C1NB 4BWLA 5M03A 3SB0A 4MWAD 5HWJA 3APYA 3ME3A 1EDGA 3KRZA 2ISDA 4N9BA 2UY3A 4OHQA 1TIWA 3NSMA 1VLWA 3NPUA 1MW1A 1UP0A 4HNLA 3AXMA 3CPGA 4O0KA 2A3BA 1MXSA 4B5TA 3TSMA 1QHOA 3MI6A 3S2NA 3WQCA 1I2RA 3UNTA 2B7PA 1BWLA 4JX4A 3T2OA 4CN1A 4DIAA 3DKLA 1AL8A 4FI4A 4KBXA 1J5TA 4IX0A 3OU8A 1BRLB 2G3MA 4LXFA 4C6NA 1MUWA 5DT5A 3V0TA 1KB3A 2Y5EA 5D9PA 1W1B1 2C19A 5TIMA 2CHRA 8RUCA 4XZWA 2G4JA 3VMNA 3R12A 1GKRA 3LBMA 1ZBWA 3QOKA 2JEQA 4YVXA 3HQOA 3APGA 3VIGA 2VUYA 3R89A 1NELA 3Q45A 1J2BA 1PWLA 4BQ4A 1V3JA 2Q02A 1ITXA 2BODX 4C6KA 2PC8A 1T8QA 1LWIA 1P0EA 1NAL1 3OEXA 1Y5VA 2D73A 3RPTA 3U2EA 3NWRA 2ANUA 1ZB5A 3OGVA 3PP7A 1IR2A 3GHSA 3NQFA 3VC6A 4G7EB 3KXQA 2YZRA 1WDRA 1PBGA 3AJ7A 3NNTA 3QMSA 4GVHA 1VYPX 1UHVA 1RSCA 4XBJA 1JULA 2B31A 5EMMA 4PFMA 5D2XA 4IQLA 3WUGA 1EC8A 2YYTA 4QDPA 4CCZA 1EEXA 4PUEA 2HJPA 4DBEA 2JKAA 3E6EA 1AW1A 3DGBA 2NW0A 3S9YA 4WY0A 3UD6A 1KRCC 1CTNA 3BAKA 1Z41A 1ZSXA 2XPKA 5DELA 2I5QA 3M0JA 5A95A 1JPIA 2ZA1A 3A3WA 3MDWA 4ENLA 4GKTA 3V1HA 4UFIA 5B7ZA 5CH9A 3BLKA 3H22A 3QV8A 4R5EA 2J4GA 4XO7A 3JVAA 1JNDA 2PP0A 4IUGA 4R85A 4J3VA 3EB2A 1K9FA 1R87A 6REQA 4AD0A 2XN2A 1E51A 1VEPA 1D7FA 4ML4A 4JQAA 2YDRA 3N2TA 1I9CB 3FLUA 4PZVA 1PAMA 3IWPA 4D9PA 3RCNA 3B40A 2D2OA 4YLWA 4HU0A 4ZXLA 1CGXA 4W88A 2P5NA 2VWTA 3ENLA 3VK5A 2PCEA 3AJXA 4A05A 2ZRVA 4JTCA 1BF2A 4WGHA 2IKHA 1KV8A 3JZUA 1J6PA 1HT6A 2PTXA 1KRBC 4HQVA 4W86A 3WUBA 2V38A 4IF2A 1J11A 1F3WA 3LNMA 4Q4PA 4K3ZA 1A3HA 1Q2RA 1XX1A 1GZJA 3MQTA 4JS3A 2A3CA 4XUYA 2PCQA 4S2CA 3BUVA 1SGJA 4RXGA 3TYEA 2C15A 2VXNA 1BG9A 4MWAA 1W17A 1XF0A 1KXTA 2VDHA 1QW7A 1OFEA 3A22A 1XLEA 4HOWA 4WCJA 4IPJA 1U1JA 2YCLA 1NJJA 3M44A 1EZ2A 1L6YA 4XO6A 1IEXA 3URBA 4XUGA 1YE4A 3CUZA 3WF1A 1XRVA 1XYLA 1W3KA 2XIBA 2G4FA 4TUFA 1M7XA 4B3LA 2QKFA 4PUNA 1XJBA 2BHYA 2VRKA 2CLMA 4BK9A 1EQPA 3AZRA 1EXBA 1W3JA 1EJXC 5DANA 2Y85A 4BQ2A 3BMVA 3M6YA 2QUMA 3W7GA 3M0KA 3NQDA 3ZMRA 2PTWA 3RX3A 4F3HA 2ZTJA 1W0MA 2Z2AA 2PDKA 2CBUA 3V35A 3N6QA 2VZSA 2PLMA 3N3MA 4S3CA 2H8XA 3D0CA 1ICPA 4O1CA 3WNNA 1X98A 1Q6GA 1TPDA 4PUDA 3GG1A 3CLWA 2ZVRA 2E8YA 3K8KA 3C0JA 3S2LA 1FKXA 5IDZA 2OELA 1W3TA 2NX9A 3GR8A 3VM5A 3W70A 2CLEA 4E3VA 3JW7A 4XTDA 3ZYZA 4J3UA 3G1DA 3GH5A 4HNVA 1I2NA 2BG5A 4GXPA 4LU0A 4QISA 3UNDA 2F6XA 3DXIA 5J5RA 5K2ZA 5A2BA 4ZOEA 1JDEA 2X1TA 3TNBA 3N2MA 4AU0A 3SW6A 2PBOA 2A3LA 4CEUC 1H49A 4ZODA 3UWQA 4QS5A 3O7UA 3GBEA 3W6LA 3SFKA 4WEVX 1TQJA 3NL3A 4RXFA 1YBQB 4GFSA 1BPLB 1XYFA 5AB3A 4XKYA 1WDWA 1EL3A 4D8LA 3VFCA 2XSXA 2CERA 5HOSA 1ISWA 3KZPA 3IARA 3E0VA 3D5HA 1AL7A 3DI0A 1BF6A 3CH0A 3DKJA 1LUCA 1RQBA 3KCLA 2FB2A 1AK5A 5CLTA 3DU0A 2J27A 3W2KA 4F2BA 3B8WA 4L1XA 3EOSA 4UZSA 5H2ZA 2XDFA 4QCEA 2VYOA 1H7OA 2UWFA 3ANVA 1KCZA 2GLKA 4E0CA 2TPSA 2WMGA 5EMJA 3O6DA 3QN3A 1EHAA 2PZ0A 3GKAA 4HHMA 2IQDA 3RU6A 1UPMB 4J40A 1E6XM 3DC8A 3P82A 5EGRA 2ZOXA 1ZJHA 1H3GA 3AAMA 4O50A 3BGAA 3F2BA 2C13A 3IS4A 2X1IA 4DUXA 3NR0A 1G4SA 4LNYA 1LQ2A 2YW3A 3BAXA 1JR1A 2VGFA 5TBOA 4HK6A 1J2WA 2WJEA 3M6DA 3W1TA 3AHTA 1A5NC 4AWEA 4S3GA 2QPUA 3FK4A 5E0FA 1XLFA 2UY5A 1IZKA 1KKRA 1BGAA 4KEMA 3TLLA 2TYSA 1E9ZB 3MSGA 3T81A 3LHZA 3DHDA 1LWJA 4FNSA 1UKOA 3A4XA 4ASTA 2EPMX 1AVAA 1NWUA 2YXXA 1TWSA 2YLAA 2XFRA 4U2YA 3WJZA 1S38A 3KAOA 2CESA 2PDBA 4H9UA 2OG9A 3A5FA 2NSOA 2IXVA 1F74A 1L6GA 3QR1A 5J8LA 3RNDA 1V02E 4LCQA 5CJNA 5I00A 1VFMA 1EWDA 2I5GA 1I0DA 5J5DA 3WD1A 1TIMA 1TPUA 4PCFA 3WNOA 5LIYX 2JIEA 4GH3A 1ZBVA 4KEZA 2W27A 8TIMA 2JALA 1IXNA 2DW7A 3MUAA 3EWZA 4FX7A 4UTWA 1OYCA 1C7TA 3GFZA 3W2UA 1VB9A 2ZRYA 4QE4A 2PRMA 1LF1A 3HU7A 4KF1A 1WKEA 4AVNA 2WM0A 3MA8A 1P4CA 4LF2A 4QAIA 3GU2A 1IWPA 5KINA 1CCWB 5DF0A 1BVZA 3SN0A 5AHMA 4NJJA 3VZZA 3WJYA 4E8GA 3OVGA 3PPHA 1A5BA 3QJAA 3NIYA 3ICJA 3CC1A 1K8CA 3GDRA 4HPNA 1UCWA 1UP2A 2BOGX 5JU6A 2IPWA 4DF0A 4S38A 3D3FA 1T40A 5HQMA 3ELFA 3UPMA 2V2CA 1R0MA 1UMYA 1ZS2A 1FWCC 2INZA 2OSWA 1XLHA 1BRLA 1HO1A 3G3MA 4GZEA 4IHCA 1QK2A 4XAPA 3RMJA 3SJ3A 1A80A 4NAEB 4QG8A 2PF0A 3WLOA 1JZ8A 2WC4A 4RDZA 1EP1A 3MUY1 1DWJM 3O05A 4J3WA 2X1SA 4R9XA 2Z00A 5I03A 3SCRA 1REQA 4AFYA 1TG7A 3GXDA 1ZCCA 3W83A 2XFFA 1QWGA 4W4QA 4UTUA 2CZEA 3MV01 3MC5A 3VMOA 1KGWA 1A3WA 3CV2A 1R5YA 3EXRA 4G7EA 2OWXA 2CETA 4FHAA 3SY1A 4D8ZA 3ZSSA 2Y7DA 5I09A 1RAKA 2GDQA 1U2YA 1JRBA 4LC6A 4ONVA 2GDUA 4AYGA 2F9RA 1TWZA 5LA2A 3CYVA 4Y9AA 4G1KA 3Q65A 1Q6RA 2HBXA 1PDYA 3LRKA 3N2BA 5JXQA 1XIDA 2V8ZA 1QCWA 1Z32X 1E9YB 3VKBA 1BTCA 3WLQA 4GZJA 4HK5A 3UR2A 3RHGA 4M56A 3U2CA 3KRSA 5A2CA 3GZAA 4R3UA 3WUFA 1VLIA 1G69A 4IM4A 4NT0A 3NUKA 1S5MA 4JL2A 3SN4A 3FX4A 2UY2A 4PRTA 3IK2A 3PBGA 3R8RA 1JAEA 1UWQA 1MO0A 1PKYA 3V3WA 1K77A 3GHTA 1Q45A 2QCHA 1ZRQA 3HGSA 2XINA 4J5NA 1SJDA 2DZSA 1FWAC 1E9LA 3K30A 4JIQA 3OYXA 3PJTA 1H2JA 2YB4A 1XLBA 5CGMA 2DQXA 9XIAA 4Z1YA 3M0VA 3MP4A 4ZTYA 4HJFA 3PS7A 3B0YA 3OGSA 4AZCA 2AKMA 1QNPA 2CHNA 2HEJA 3I6EA 2EQDA 3O8AA 2WPBA 3DAQA 4LUJA 1XLAA 3EX3A 3ARYA 2PGWA 4YNGA 2IQ0A 1XISA 4PMOA 1HG3A 5K9CA 4Z0JA 1EUAA 5BU6A 4AZBA 5DBTA 3P67A 1NWRA 3FXGA 4ZB2A 4IJRA 3BOXA 3K8MA 4I7UA 2WVTA 2NUWA 1WAWA 2JGQA 1VFHA 1QAPA 3STCA 3RM9A 5D02A 3C6CA 4YYCA 2QR6A 3W3OA 4KETA 3MZNA 5HNTA 1F6KA 3NM3A 4UMBA 3H23A 4LS1A 7TIMA 3G3DA 4O8RA 1IV8A 3UXKA 5DBUA 3GNPA 4JKKA 5I7GA 1UJQA 3RLUA 7XIMA 1JXKA 1U22A 4GBUA 4CGTA 5I6SA 2DT0A 2PDYA 2IW0A 4NAFB 4GY0A 1C8XA 4DM2A 1FWDC 4Y6GA 1ZJIA