3GDRA

Crystal structure of the d91n mutant of the orotidine 5'-monophosphate decarboxylase from saccharomyces cerevisiae
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
260
structure length
260
Chain Sequence
KATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFENRKFADIGNTVKLQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLATGEYTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Lyase
total genus 102
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3gdrA00
3LHTA 3W3OA 4JDBA 1RZMA 3L66A 2GJNA 3TC6A 2B7OA 2Y7DA 5D2TA 3WK0A 3PC0A 5DELA 1W56A 2VEMA 5J5DA 3UWYA 4HNNA 2ISVA 3BPWA 2WV8A 3RFAA 1EB3A 2QUUA 4JTFA 3LXBA 5LGZA 2WPBA 4RX0A 4NVTA 4BK9A 3QM3A 3DZ1A 3W2MA 1QOQA 1SW7A 4UFKA 1DJNA 3F4NA 3BGJA 4LVFA 3Q58A 4LU0A 2ZBTA 3G22A 1ZJIA 3O07A 2DZSA 1TQXA 4A22A 1G6CA 3A9IA 1Q3NA 4NX5A 2YR1A 2E5BA 3UWVA 3PUEA 3N19B 1HO4A 3STCA 2CLEA 4WY0A 3U2OA 4WQ6A 4YCOA 1QPQA 4MFEA 1FBAA 3NQGA 3LHUA 2W79A 3DI0A 2WNZA 2JKAA 3NXFA 4AHOA 4MLRA 2DZUA 3MBDA 4JIPA 3USBA 2CLFA 3NPUA 4IOTA 4RXFA 3W7IA 5F1VA 3SGUA 3I65A 4Y90A 4HN4A 4BI7A 2DZVA 4OQVA 3IVSA 4YWIA 4R7JA 5FF3A 3RMJA 3NQMA 3M1ZA 4UNLA 1SSDA 4KFOA 1TV7A 3GVGA 3KVKA 1LLZA 3EXRA 3NL3A 4PC8A 1SO3A 1H1YA 1ZNNA 3L5AA 2PE4A 2Z0IA 2QF7A 1KM6A 5CZ0A 1O94A 3MYPA 1I2PA 1TRIA 3PB2A 3QJAA 5K9CA 3GDKA 3STGA 2Y88A 1TPC1 2OT0A 1KW1A 4ONVA 1VYRA 1C9DA 2VFEA 2I9EA 4O4VA 5BRBA 3P5YA 3LXAA 4QM1A 4QJ1A 1JJKA 4GRSA 3N2MA 1NEYA 4O10A 1HL2A 2CLLA 1EEPA 4TR9A 3VNDA 4K38A 3TR2A 2FLIA 1NSJA 1F6KA 4AHQA 1GG1A 2HTMA 3ABRA 1F73A 1R46A 2FFCA 4GUJA 4O13A 1U5JA 4BWLC 3KXQA 4DBEA 4P61A 1JQVA 3NL2A 3E02A 1R47A 4FNSA 1A50A 2C14A 2Y6ZA 4FHAA 4O54A 1AL8A 1G7VA 1EWDA 4FNQA 3UQNA 2GQAA 4WUIA 5HINA 4UFMA 1K8XA 2NV1A 3LHWA 5AYXA 3HIJA 1DV7A 3H55A 3BW4A 4JGDA 3W1UA 4UTWC 5HMSA 3W7HA 4WXZA 3HG4A 3QPYA 2C16A 3W1TA 2VEIA 2OX1A 3CWOX 1PCWA 2Y7FA 1ZALA 5DN1A 2ZZ1A 5C54A 1OABA 2X30A 3C2RA 3IVUA 3M7WA 4K36A 1KFJA 3KVMA 4FNTA 4TU1A 4RZ6A 1FWTA 4YL2A 3W86A 2A6LA 3U8GA 2LLEA 3FS2A 3QH2A 2A5HA 4LV9A 1KLZA 4O28A 4FNUA 1PCKA 3R8RA 3IGSA 2KZHA 1AMKA 3W1LA 2ZYFA 1MXSA 4UFHA 1IXOA 5DLCA 3EWXA 3UZJA 2PRLA 4N6EA 2W0UA 3FFSA 5LKYA 2ZFAA 3WJYA 3SJ3A 3LERA 5CZTA 4QITA 1QPRA 4BI6A 5HR7A 4RR4A 4UTJA 3NOEA 3O16A 4I9AA 4WXYA 2RDTA 1H7OA 3SFKA 3I7QA 5J5RA 4MVAA 2B4GA 3DFNA 4TMCA 1EUNA 2A0NA 4WOQA 4HNUA 1G67A 1A5BA 3MHGA 4XQ6A 5EPDA 3GNNA 1TJPA 1XFBA 1FCBA 4O18A 3EB2A 3FOKA 2GVJA 3L65A 5BOOA 2O7SA 4HSNA 4K7VA 3UPBA 3NPVA 5D2VA 1UCWA 4CNPA 2YSWA 1YDOA 3SW6A 1IIHA 2ZCGA 4JX5A 4DPQA 4XKYA 4POCA 1SW3A 5GVJA 3NYZA 4LW7A 3FJ6A 3QW4B 3NL5A 5DCEA 5AYZA 2V8ZA 4Z0JA 1BWLA 2WOQA 4TX9A 5AN7A 2Y62A 1XUZA 1NF0A 3EWBX 4HNVA 5LHFA 3LBMA 4AHPA 1EUAA 2DZXA 5D2YA 1KBJA 2VELA 4GUHA 5G4WA 4I7VA 5C55A 1FWSA 5FEZA 1OX5A 1X7FA 3LCGA 1OYBA 4LVDA 4Y96A 2IQTA 4Z0SA 1FCVA 4AF0B 3GDMA 1XDMA 3AO0A 1TPEA 5D33A 3LTSA 3TKFA 1NAL1 3STFA 2Q3RA 5HNRA 3W1XA 1FX6A 5K4XA 3B06A 1YXYA 5BNKA 3FKKA 3TXVA 4O57A 3WJZA 4AVFA 2CLIA 1MEIA 2ZTKA 3W6YA 3MP5A 5K2ZA 2J9XA 3ATZA 3NQ6A 2E5CA 2ZRXA 5AHLA 5K7JA 3GXNA 4O4WA 4OV9A 2E6FA 3W1RA 2PRMA 2YCEA 3N73A 4O12A 1PL9A 4O1AA 1YXDA 3B4UA 2A7NA 3F4WA 3B8DA 3QSRA 3N9RA 4ADTA 3TH6A 3UWQA 4CCCA 4MYXA 4AWUA 1PHWA 3C6CA 2YW3A 3MI3A 4DO5A 2A2IA 4JEQA 1GTEA 1MZHA 2ZZ6A 4IX0A 2CFFA 3ATYA 5H91A 1SU5A 3NO5A 4HKPA 1H61A 3RK8A 1VS1A 2A7PA 4UNKA 5I3KA 1VCVA 3DKLA 3MJYA 3MI6A 1KM2A 1TPH1 1SQ7A 4JNMA 2B7PA 4ZQMA 1LBLA 2NLIA 4OU1A 2G5WA 1AK5A 2NUYA 1RQHA 1VHNA 1K03A 3L67A 5LHEA 1DVJA 3DI1A 1WBJA 4S2BA 3I68A 1LLWA 2BLEA 4N02A 6ALDA 2A21A 3G3DA 3SR7A 2QCMA 1T0OA 5G5IA 4AWSA 5HWMA 1KFLA 1SO6A 4O17A 1HG3A 1JCMP 4BF9A 1JULA 1FCUA 1I2QA 2E77A 3CEUA 4N9CA 3DFSA 1A53A 5CZJA 3CIXA 1H7WA 2F7FA 3WFAA 1W3TA 3WJSA 3BLFA 2EPHA 3INPA 3SY5A 5AC8A 4RV8A 1OHLA 3W7EA 4RZ4A 5K9DA 3G0SA 3R89A 4RKAA 2J9ZA 3UXAA 2YFOA 3AJXA 1LOLA 1JRCA 2QUTA 5CSRA 3LTPA 1N8FA 1WBHA 2JKPA 3HG2A 1W5QA 5IM51 3GIYA 1I2OA 4XUGA 4GFSA 4NNAA 2ZRWA 1M7OA 1L6SA 4MY8A 4IMGA 1GYNA 2Y7EA 3HPSA 3W7LA 3ZWTA 3CTLA 4K8HA 3R2GA 5MHBA 3IIVA 4MY1A 2RKXA 2R94A 5DBUA 3W2KA 1NF7A 3HG3A 1ONRA 4KWVA 1OF6A 1QFEA 1DOSA 3O63A 4QAIA 3UY8A 4NNCA 3FIGA 4GUGA 3O6DA 2PRHA 3S8HA 4KFNA 3HGSA 4ORIA 3C61A 4MZYA 1Q45A 4ZVJA 1KTCA 4YXGA 2C0AA 3NVTA 3RU6A 3G8RA 4H6KA 1K3UA 2JKEA 3EX4A 5DY3A 1FXQA 4YLWA 2HSAA 1XM3A 1ZCOA 1ME8A 5ABTA 2DZPA 1ME9A 1KM4A 4PEKA 1QDSA 2I14A 3TSBA 1DQXA 4M7TA 1K7XA 3LTYA 4IJBA 3K30A 3GDRA 1RV8A 3NM3A 3C56A 3DHFA 2UV8G 1IXNA 2CLKA 3DU0A 3W7JA 1AW1A 5KZMA 5AHIA 1V7YA 4LC6A 2ZDRA 3PSVA 1NVMA 4EOUA 1ZY9A 1OX6A 5AC6A 1UJPA 2NUXA 3EX1A 2I1OA 4A2SA 3GDLA 5HUPA 3QQ1A 3MBFA 4MFDA 1SSGA 5F4XA 4R34A 5CPLA 4K7YA 3GK0A 4IXHA 4M6VA 3FEMA 2E68A 3ELFA 3UY7A 4NJHA 4OT7A 2E1DA 5HWJA 4HNTA 1RR2A 4MZ1A 4OWGA 1KTNA 1U83A 3P7YA 1MEHA 1GZGA 3LDVA 1SFJA 3O6CA 3DENA 2CZDA 2ZA2A 3NL6A 3TK7A 1UB3A 1SPQA 2ZRUA 3GR7A 1DJQA 1XL9A 5FESA 4QNWA 2V5LA 3NR0A 3L21A 5H2ZA 2BSLA 4BI5A 5G2HA 2DZWA 4UMBA 5F2MA 4GBUA 5AHNA 3SZ8A 1QMLA 1XBVA 4MY9A 4BWLA 1ZHAA 2EHHA 2VC6A 1XC4A 2V5BA 3VE9A 3FKRA 3W2JA 1TCDA 5HJLA 1JCLA 3NQDA 3CPRA 1I8JA 3HBLA 2H3BA 1CI1A 3LV5A 1JCYA 3I6RA 5A5WA 3UPWA 1TJRA 1VRDA 2QJHA 4O15A 1L6WA 1S5VA 5EL1A 2WSYA 2JBMA 2R8WA 1R30A 2VENA 2FIQA 4UTWA 4C1LA 3LI0A 8TIMA 4S1FA 1DQWA 2B0MA 4JX4A 4MZ8A 1TPB1 3RF9A 3W83A 5F2IA 1OFAA 1LROA 2VOMA 3M44A 3G1FA 1K8ZA 2XN0A 4PL1A 2V2DA 3LB0A 5D05A 1TV8A 3W1QA 4XWUA 3W73A 4TMBA 4PH6A 1B4KA 3TFCA 3ZFHA 1TPVA 2EF9A 1YADA 2F84A 4AEOA 1H1ZA 3EX2A 4N2YA 3O06A 1JRBA 4MYAA 3S5NA 2WSRA 1YDVA 3NZRA 5E93A 3IRDA 2RDWA 3VKJA 3EKLA 4KFPA 1WA3A 2Q8ZA 2ISSA 5KITA 1IF2A 5EYWA 3BW3A 4UTTA 1YXCA 3NM1A 3HPXA 5DY2A 1SO4A 3FLUA 3LLFA 1KA9F 3OIXA 1ICPA 4MLJA 3GDTA 4CCEA 3PB0A 4JTLA 4HSOA 5LNVA 4N6FA 3S1UA 1FY6A 3I7SA 4N9DA 4RJEA 3SECA 1PVNA 5LZLA 2FQIA 3NQAA 4QIUA 4GUFA 1XXXA 2J6XA 4NUWA 4FEZA 5EKYA 2ZRYA 3P80A 3TC7A 1L2UA 3N9SA 3PM6A 5TQLA 4UR7A 4L4LA 2GVLA 3W7CA 1FWNA 3A21A 2PCQA 1TPDA 4KWWA 7TIMA 1W0MA 2ZZ5A 3GR8A 3OVRA 4J9JA 3NZ1A 1GT8A 1OFDA 1BKSA 3BARA 4EF8A 1SFLA 2O7QA 5HWNA 4JICA 1XBZA 1N7KA 3QMSA 3S5YA 1ME7A 3L5MA 2QCCA 2E6YA 4RK8A 2PC4A 3M5XA 1JQXA 1G4TA 1YLVA 2BWGA 4H4IA 4X3ZA 1FCQA 5DCDA 2RHGA 2CW6A 1HO1A 1VYPX 4FX6M 5F1UA 3UZ5A 3MP3A 3UWUA 4O1CA 3L0NA 3EEGA 1OYAA 4CLMA 4ML9A 2CZ5A 3LGEA 2ATMA 1OF8A 1JR1A 1H63A 4NJJA 1R2SA 3E96A 1UBSA 2OMAA 3TU9A 1UASA 5KZDA 2FB3A 4LS0A 1AW2A 2X2GA 1YPIA 2VEPA 5HQEA 4HIBA 5KSWA 4LS1A 1K02A 4AF0A 1M5WA 1X1OA 1EPXA 2ZTJA 1MO0A 1KV5A 3G0UA 3LBCA 1P5BA 5K3VA 5HR6A 4FO4A 3TW7A 1KM1A 3TW6A 3TX9A 4HPJA 1AW5A 1K8YA 3BLEA 4UTTC 1Q6QA 2ZA1A 4JIQA 3O8AA 3NEVA 3WJXA 2RH9A 1OYCA 3A23A 4UTUA 2ABBA 4NZJA 4H3DA 1SZNA 2QCLA 1E51A 4R33A 3GB6A 4WJEA 3SSJA 2ZA3A 2YYUA 1OVDA 3M6YA 2EGZA 3N14A 5LNWA 3IEBA 4NXKA 5D2XA 3QRHA 4QSHA 4ZMGA 1XUUA 4NJGA 1EA0A 3BG5A 3EWZA 5DXYA 2C1HA 4O14A 3BV4A 1VCGA 3PBYA 2QCHA 3DFTA 3OA3A 4ZQOA 3HOJA 1X6UA 5SWUA 4Z1AA 5AFDA 1AL7A 2BXVA 1GVFA 2AQWA 2YGYA 2EKCA 3D0CA 3NQCA 4ADSA 1JCNA 3W75A 4CCDA 1Y0EA 3MMTA 1OX4A 3IIXA 1J4EA 3P8JA 1GQNA 4JR5A 5G4EA 1W5OA 4FF7A 1A5AA 2R91A 3IGXA 3P61A 4A3UA 3EKZA 2DJLA 3LCFA 2WNNA 4UFLA 3ZWSA 1VHCA 3JS3A 1A5SA 3LM7A 2WNQA 4NXSA 3DKJA 3QSTA 3P74A 1PV8A 1ZAHA 4HHPA 4LWWA 5D02A 3M5ZA 3VCRA 3DXIA 2FPYA 2W6RA 2TPSA 2YFNA 3LRLA 4O1DA 2VFFA 1TV5A 3TJLA 1TB3A 1TTJA 3G1DA 4ZL1A 5EMUA 1P1XA 3LHVA 3R12A 1GVRA 3BK0A 4IMCA 3CU2A 1YTDA 4NU7A 4O11A 3L5LA 4OE7A 4JYFA 2QCNA 3GYEA 3QMTA 1JUEA 5CG7A 3SIZA 5LSMA 1KFEA 2NWSA 4IMFA 3V1PA 5FF0A 3I7RA 4U28A 1I2RA 4ALDA 1QR7A 2XN2A 2B7QA 2ALDA 3LX9A 4A2RA 2HS6A 1TO3A 3W74A 4DPPA 1W54A 4LVBA 2CLMA 2ZZ4A 4EF9A 5G1YA 1W3NA 3MHUA 1LOQA 5L6UA 3TNOA 1SZGA 1EIXA 3S9YA 1WQ5A 3HGOA 2ZRZA 3O1NA 4AH7A 3OG3A 3NPWA 5TBOA 2AGKA 3B04A 3BVJA 3GX9A 3U6WA 3ZR4A 2RFGA 4ORMA 3CWNA 1FXPA 4RLIA 2QDHA 2GJLA 4LNYA 2GOUA 2TRSA 2DJXA 4UFIA 1SUXA 3DFOA 4Z1CA 2C19A 1F6PA 4RCXA 4JXCA 4UTIA 3SI9A 3ANYA 2VKZG 2X1UA 5C6MA 3W7GA 1DORA 2R14A 5FF7A 3MHFA 3HGRA 2FDSA 3FYOA 2ZZ7A 3QZEA 4JX6A 2X1SA 1KTBA 1OFBA 2NXHA 3C52A 1H50A 2QAPA 3W88A 1LZOA 3L68A 3JRKA 4FX8A 1QWGA 4GNJA 1PHQA 3KOFA 3MP4A 4LVGA 4K8EA 3TFXA 2OCZA 1OFQA 1LP6A 2WSQA 3G1YA 2J9YA 3CB8A 2PURA 1KFBA 3QMRA 3NQ8A 2Y85A 3A5FA 3F03K 2Z6JA 1SO5A 3B0PA 1LM1A 4ZQPA 4HPXA 1Z42A 4DF0A 1ZAIA 1TPFA 5LNUA 2P10A 3W2UA 1T99A 5FEWA 1GVOA 2WKJA 3M16A 1WOAA 4CQ9A 2TSYA 1WDWA 3W1NA 1OK6A 4UC5A 1QPNA 4OBTA 3NA8A 1O5XA 3MI2A 1GWJA 2HS8A 3GAKA 1SZFA 1CX9A 2JK2A 3W22A 1RQEA 3EWYA 1WYIA 4UXDA 3STEA 1Z48A 3PBWA 4O50A 4FB7A 5G2IA 3OVPA 1H7RA 4BFAA 2X16A 4NJIA 2VFGA 3L0KA 3HQ1A 3IVTA 2QCDB 3B0UX 1W31A 3CHVA 3W84A 2ZQ0A 1OG0A 2Y89A 3JR2A 4WX2A 3NAVA 4JDYA 4O19A 4UUIA 2NX9A 1QNVA 2YDAA 3QW3A 3O6YX 3S5ZA 3G0XA 2NX3A 1M6JA 3LCHA 3W76A 3LXCA 4O16A 4PTNA 3T55A 5L9FA 4DO6A 3LCLA 1ZENA 4O1BA 1VR6A 3QPZA 1KFKA 3OEXA 4R53A 5LGXA 3BO9A 1RPXA 3Q2DA 5IBXC 3LRMA 1QO5A 4N9EA 1H7PA 3BG9A 3KVLA 1O60A 2CLOA 1X8FA 3DGRA 4CQ8A 4WD0A 3PVFA 1YYAA 2CZEA 3O15A 4MPQA 2Z1BA 1LTDA 1JCXA 5AYYA 5FI8A 4JY8A 3NNTA 4ZQRA 4ZQNA 4LUIA 4Z08A 4GXMA 3QFEA 1XCFA 3WK3A 4LTSA 1W1ZA 4LV4A 5BW6A 2JGQA 3CIWA 3LRKA 2DP3A 2C6QA 1DHPA 1OFPA 4KKXA 4Q32A 3LHYA 4MIMA 2E6AA 3G1XA 5G2WA 1VH7A 4E2DA 4GE8A 4C1KA 1EX5A 4LT9A 4TO8A 3HGJA 3N2XA 3VE7A 1H7NA 5A8GA 2A7RA 3UXDA 3IGUA 3M0ZA 4S2CA 3LI1A 4UMAA 4Y6GA 2J27A 2V2CA 3HMJG 3C2EA 1KV8A 4JY9A 1LBFA 2V2HA 1TMHA 4AAJA 1BEUA 4LC8A 5EY5A 3P67A 2VXNA 3W2NA 4G1KA 4L4MA 3DHDA 1GYLA 5I3GA 2FB2A 3EWUA 3TROA 2G97A 4X2RA 3VFLA 3KRSA 4CNNA 4NJKA 4PA8A 1JUKA 3Q37A 3W7MA 3C2VA 3TSMA 3TCEA 1KBIA 4XTIA 5U7SA 4YMZA 1ZFJA 4PODA 1BTMA 3QF0A 1TSIA 1LDCA 1WXJA 4FNPA 5AOUA 4O0ZA 5FEXA 4AWTA 1XI3A 3PBVA 1OFEA 2QUVA 1HTIA 3R13A 4MOZA 5DXXA 1P4CA 1WAUA 1LRQA 4YCPA 4EIVA 2H8XA 3ABQA 3TE9A 1JUBA 1SR9A 1R2TA 3PR2A 1VZWA 4JTTA 1LOSA 2TMDA 3DFQA 3KVJA 1WOBA 2QCGA 3M47A 4JYDA 4K37A 3UD6A 2P1FA 5EBUA 4MJMA 3KX6A 2V9DA 1F76A 3PY2A 3G18A 5AHFA 4UTHA 3P8IA 4UMCA 4M6PA 3S1WA 3DH7A 2V0TA 4Y8FA 4GWEA 1JCJA 4N4PA 1QCWA 1VCFA 2BX7A 1G4SA 5D2WA 3G1VA 1ML1A 2QEZA 1WX0A 3H54A 3YPIA 4XTDA 1XKYA 5I3IA 1IXQA 1MSSA 3OHIA 3TAKA 2H8ZA 3MYOA 2YZRA 4UCGA 3QYQA 3G1SA 5CZSA 4XBKA 3E49A 2YX0A 3MO7A 4PCFA 3BG3A 4GUIA 4Q4KA 2GQ9A 1VJIA 2NWRA 4K39A 2QJIA 3S1VA 2A4AA 2QAFA 1EP1A 3S42A 4IGHA 5EA9A 4DEFA 3SGZA 1TPWA 1YDNA 2DZTA 5CPNA 3TUUA 4ZZ9A 1HUVA 5LNSA 2DORA 5D09A 3RNDA 4TIMA 2FPVA 4UIOA 3UNDA 1W5MA 4M19A 2GUUA 1JVNA 3ABSA 1FWWA 1VYSX 2CZFA 3Q94A 3TSDA 1GEQA 1L9WA 1M7PA 2NUWA 1KM3A 1KM0A 5D32A 2CLHA 3GKFA 2C15A 4X9SA 4Y9AA 1THFD 5CGQA 4P2VA 3QC3A 1GG0A 5D04C 1VLWA 4AXKA 3PWAA 3R5EA 2E6DA 2WO5A 1EWEA 1QOPA 1ZAJA 2E5DA 3EWWA 4IPJA 4QISA 5CSSA 4GC4A 4GJ1A 1Z44A 3TQ0A 3TXZA 1F2JA 1G69A 5CPMA 1TQJA 1PS9A 3CLMA 4CNOA 1YPFA 3G1HA 3NDOA 4LVAA 4DXVA 2HMCA 3M5VA 5I3JA 1S3HA 5D03A 2ATSA 1W8SA 3HB9A 2BZNA 1ADOA 4JTKA 4PFMA 2E09A 5D37A 1TREA 1XBXA 2X1TA 3S6DA 2V81A 4W9TA 2BTMA 2J88A 1VGAA 5FEPA 4LOCA 3LOTA 1FWRA 3M43A 2CU0A 5TIMA 1F74A 3OVQA 3W85A 4WY0B 2G96A 1QO2A 2RDUA 4JTHA 1VC4A 4NT0A 3M5YA 4JYEA 4JTUA 3PF3A 4DF1A 4JD4A 2OZ0A 5I3HA 3W70A 5K4ZA 5C2XA 4WOZA 3W23A 1D3GA 2Y7GA 2CWNA 2WJZA 4XBSA 3L2IA 3E9AA 3W71A 1FDZA 4JS3A 4LRTA 3P62A 4JN6A 2A6NA 3DAQA 2VFHA 3G3MA 1X1ZA 4UTKA 1NFBA 5T26A 3W87A 1XDLA 3GKAA 1TPUA 4I7WA 2NXGA 2EAWA 5G1TA 1F7BA 1GVQA 3T44A 3W07A 5F4SA 2JGYA 2C13A 3M41A 4OHQA 1SW0A 3F1QA 3TMLA 2QDGA 4LS2A 1D3HA 3TAOA 1KM5A 4ICNA 4MKNA 4Z1BA 4O0KA 4AB4A 5BMWA 3LLDA 3PSWA 3W9ZA 1VPXA 3KRUA 1I45A 3UWWA 2FTPA 3H53A 4ZQCA 1TYGA 1O5KA 3CT7A 1VQTA 2Y63A 1D9EA 2VFIA 1QAPA 2ZZ2A 4O53A 2P0OA 1Z41A 1F05A 3EXSA 3WJWA 3S0CA 5HUOA 4N4QA 4X22A 1UUOA 3EX3A 1W5NA 3O05A 3TQKA 3G1AA 2OJPA 5BMXA 1DKWA 4FXRA 5DCBA 4QQ3A 1KFCA 3P82A 5D38A 5AHMA 1W3IA 4N9BA 3PUOA 1J5TA 2GVGA 3HF3A 1Q6LA 2Z6IA 4JTIA 3P81A 3KAOA 3EXTA 3HO8A 4E38A 2WQPA 2Y61A 4UTLA 2QKFA 3NGJA 4B5NA 3C2OA 3LCIA 1TTQA 2NX1A 5DBTA 3T40A 4O52A 2NV2A 4MUZA 4Z1DA 3NG3A 1BWKA 4M6QA 5K9XA 1LORA 1H51A 3KRZA 2XN1A 3G24A 5KMYA 1MEWA 2NZLA 3PAJA 1EP3A 4JTSA 3W7PA 1B4EA 1G7UA 2A85A 4A29A 3IIOA 1K7EA 3RLUA 1TTPA 3GLCA 3MUXA 3W7OA 3HG5A 3N34A 2VFDA 1VLIA 2X1RA 4JTEA 3NQEA 5KINA 1FDJA 3W72A 1WV2A 2AAMA 4M7SA 4O8RA 3UYCA 3E12A 4LUJA 2QCDA 3GAYA 2OT1A 2ZRVA 1W5PA 1GTHA 3MW7A 1Q6RA 1Q6OA 1QPOA 3PG9A 1RD5A 3DFPA 4LY8A 3PUDA 4WZHA 1OFOA 3W7DA 1P0KA 3ABOA 5AB3A 1C8VA 3PULA 4RXGA 1J2WA 2YYTA 5IBXA 1IIGA 3N3MA 4D2JA 1YTKA 3TDFA 2DU2A 1XBYA 3TQVA 3L9CA 3BGGA 3GXPA 1YTEA 4OV4A 1LRNA 1HFBA 2Q3OA 3LCXA 3LHZA 3W1AA 1I4NA 3NQ2A 1GOXA 1ICQA 5AC7A 4MJZA 1G4PA 1P0NA 3TIMA 2ZZ3A 1IXPA 4EWND 3ZS4A 4NX0A 5KZEA 1W37A 1SZEA 3L0GA 4XKYB 1V5XA 3C3NA 1LYXA 5KTLA 1O4UA 4QNEA 1EP2A 1LRTA 1C29A 4IXXA 1OX4B 4IUOA 4LRSA 3M9YA 3WK1A 2FJKA 3CM4A 1R2RA 3IV3A 3DBPA 1TIMA 4RZ5A 1ICSA 2NXIA 1DBTA 1H60A 2G95A 2V30A 3QQ0A 3S5OA 3TV8A 5FF2A 1AG1O 1RQBA 3B03A 3TMQA 3THQA 1ALDA 4IX2A 3S1XA 1FQ0A 1A5CA 4NNBA 4UR8A 4Q33A 1H7XA 2QR6A 2C18A 2H90A 3V75A 3OBKA 3WK2A 3E0IA 2ISWA 1PIIA 3IIPA 5CPOA 3LCWA 5D30A 3W2LA 4ADUA 2B7NA 1FUYA 4A21A 2C3ZA 3NQ7A 5LNRA 4UTMA 2GQ8A 3FYPA 3NPXA 3NQFA 4U4MA 1L6YA 3BLIA 1PE1A 4DBDA 2Q8LA 4NQ1A 1B57A 1S5TA 3A24A 3HPZA 4FXSA 1N55A 5E1QA 3B05A 3CEPA 2QJGA 3C0JA 5I3FA 1H62A 3T7VA 2Z2UA 4E0CA 3QEZA 3EX6A 4FIRA 4OGZA 3C4UA 4FNRA 4K6AA 3HJZA 3TA6A 4M5PA 3W7QA 1GVSA 3LV6A 4DF2A 1LBMA 2XFWA 2D73A 5FF4A 3A22A 1CW2A 4XZ9A 2FPTA 5F2LA 3W7NA 4AMAA 3PG8A 2Y70A 1G4EA 2QCEA 5CKSA 2VEKA 1H5YA 4JTJA 2A1YA 2V82A 3CQ0A 1I2NA 3W1PA 1T96A 2YXGA 1K7FA 4BR1A 3T4CA 2H6RA 3T78A 4IWWA 3P60A 3VI2A 4CQAA 4PL2A 3GNDA 4FX7A 3KHJA 3THAA 3FJLA 2GPTA 2YPIA 1S5WA 1RVGA 3UWZA 3P5ZA 1F5ZA 4FIQA 4DQWA 1IGSA 3W1MA 3NQVA 1OFRA 4IMDA 5HULA 3W7KA 3BW2A 1TTIA 3G8EA 3FA5A 3PS7A 1TRDA 5AHEA 3B0VC 5U4NA 3IIZA 4DELA 3RLVA 4HT3A 6TIMA 2TYSA 1LCOA 4IQLA 4DO4A 3C8FA 1OK4A 1B3OA 4E2BA 1UUMA 5E0KA 3C2FA 2YW4A 5F2GA 1B9BA 3CC1A 1OJXA 4UFJA 1DL3A 3TJXA 3W7RA 1GPWA 2H3DA 4I7UA 1O95A 3KFTA 5C5YA 5F4WA 2ABAA 3MWAA 3GXTA 4IMEA 3P84A 1FDYA 3A5VA 2QCFA 4EVZA 3PBUA 4NZFA 4JTGA 1GJPA 1KLYA 4IPIA 3GZ3A 4WY0F 1T8XA 2J24A
chains in the Genus database with same CATH superfamily
3LHTA 5I07A 4JDBA 2OOGA 3L66A 3DHPA 3ZZ1A 2P0IA 3UCCA 3QOMA 1WKYA 2Y7DA 3PC0A 1V3KA 4RDVA 5A95A 3UWYA 3L4ZA 4P5UA 3RFAA 4JTFA 2QUUA 3LXBA 4RX0A 3DX5A 4PSPA 3QM3A 3LLXA 4P7OA 5I06A 3UR7A 4PR4A 1XG4A 2FMNA 4UFKA 2P88A 1DJNA 3BGJA 3RGTA 3G22A 4LFYA 2XISA 5FL0A 4B5VA 3RUBL 5XIAA 3PUEA 5CEWA 2D2HA 3JZUA 1FFRA 4EPEC 5BRQA 3U2OA 4YCOA 4OUEA 1OGGA 1PXGA 5CLWA 3UVAA 2PGEA 2WNZA 5CC3A 4KEZA 3GG0A 2WW5A 3USBA 4A8IA 4RXFA 2J8FA 5F1VA 2PFHA 4OQVA 2OGJA 3MDUA 3UGRA 5TAOA 3UG8A 3VXGA 4R7JA 2DSZA 5DMNA 1PYMA 3NQMA 1SSDA 1TV7A 3GVGA 1GVIA 3FDKA 4XSMA 1LLZA 4HD5A 4B5SA 4GI9A 2PE4A 3W25A 2QF7A 3IAQA 3VOIA 1ONXA 1O94A 4L56A 3MYPA 3PB2A 3JU2A 5FJJA 4GC3A 1TPC1 2OT0A 1KW1A 4PUJA 1M1BA 1VYRA 1C9DA 2VFEA 4R7WA 4O4VA 1GCYA 5BRBA 3LXAA 3E3HA 4H1ZA 4AD1A 1JJKA 1W9BM 3ONBA 1QI2A 1T5AA 2CLLA 4L6DA 4TR9A 3VNDA 1F6KA 4ZA0A 1XIFA 1ODZA 1U5JA 1FHUA 1JQVA 2JF7A 2V5CA 1RVKA 3J7HA 1EWDA 2GQAA 3BUVA 4Q8OA 2W27A 3H26A 2PWUA 3BW4A 4JGDA 1GKRA 3MUY1 4IJRA 3VZYA 1M7JA 3HG4A 4ZOAA 4F8XA 3RJYA 2Y7FA 1ZALA 5DN1A 4C6NA 4K36A 1KFJA 4RZ6A 3V3WA 1EL3A 5I0DA 3BAJA 4H7VA 4CN1A 4A3QA 2LLEA 1XW8A 2YBUA 3VOCA 4LV9A 4QLJA 3IGSA 1BVWA 2KZHA 1AMKA 3W1LA 1CENA 1YBQA 2YKKA 1IXOA 3VIPA 1MI3A 4GI8A 3UZJA 5HQMA 3P3BA 4S3DA 2ZFAA 3S2NA 3WJYA 3SJ3A 4QITA 3AALA 3TTSA 3PWGA 3P14A 4H2HA 4RE2A 5J5RA 1XS2A 1NQKA 3BQ6A 3DFNA 3AFBA 5HK4A 1XGDA 3FA4A 1OGSA 4XQ6A 3P2VA 3SQLA 2Z4GA 2XIBA 3SQSA 3A9BA 3FOKA 4MB4A 2W4XA 4GLEA 4H8NA 3UPBA 1B30A 4QS6A 2D1ZA 3V0UA 4LX4A 1ENUA 2YSWA 2YA1A 3CTTA 2ZCGA 4OZOA 3NYZA 4LW7A 2PWDA 4LGXA 1EC7A 4Z0JA 1UOKA 1BWLA 2WOQA 2BY0A 3CZLA 4HGXA 4TX9A 3WCZA 2Y62A 1NF0A 1EDQA 2VCBA 2HNHA 1V7AA 3TYEA 2F6KA 4BS0A 1NWRA 1I1WA 5C55A 5FEZA 1T7LA 2OR2A 3KOXA 4LVDA 5JBFA 2IQTA 3WLTA 4Z0SA 5TD4A 2GJXB 3XISA 1LWJA 3TOPA 5JMUA 3TJ4A 1RY0A 4DRSA 1W1VA 3AO0A 3LTSA 5D9MA 1FHDA 5HNRA 5K4XA 1YXYA 1EHNA 5BNKA 3FKKA 3GH5A 4I6VA 4O57A 4E6MA 1EGVA 3AHXA 2QUNA 4FXFA 3GHRA 2CLIA 1NIUA 4J4KA 1TIWA 2ZTKA 3MMUA 2F6UA 1LUCA 3ATZA 3R0KA 3WMSA 4RNFA 2ZRXA 1A3WA 3KDNA 1VPQA 3ZSTA 5JQ9A 4XAPA 1W3LA 2PDKA 2YCEA 2C8NA 4IIBA 1PX8A 1PL9A 5GNYA 4O1AA 3RU8X 4D6DA 2CETA 4ADTA 4C65A 4XSLA 1XLBA 3THDA 3F5KA 3N04A 1ISYA 3DG7A 4UZSA 1NWTA 3C6CA 2ZZ6A 5H91A 3ATYA 2JFEX 3VX0A 5GNXA 2A7PA 4UNKA 3KBJA 1LWHA 1VCVA 2AMGA 1P7TA 4JNMA 2B7PA 4Y9NA 2G5WA 3QYSA 3WQFA 2NUYA 1VHNA 1K03A 3L67A 4GXWA 3DI1A 4S2BA 1R3YA 3O9NA 1G5AA 2WLZA 4WDUA 2BLEA 5CPSA 3CH0A 6ALDA 3G3DA 2PDWA 3TLQA 3OGSA 3SR7A 1UD8A 4R7OA 5HWMA 4OKDA 1OG6A 1TJ1A 1SO6A 3WMLA 2WC3A 1XQKA 1I2QA 4D6JA 4IPPA 2EPHA 3N11A 4ZFMA 1OHLA 3G0SA 3LGDA 2Z29A 4AIBA 1MVYA 2J9ZA 3GUGA 1NOFA 1LOLA 4QX4A 3FHQA 5CSRA 3CZGA 4PB4A 1N8FA 5I09A 1W5QA 5IM51 3GIYA 3MUCA 3IJ6A 1H09A 1E3XA 4HK6A 3WMCA 2Y7EA 1BGGA 4GQ0A 2IXVA 3CTLA 1S46A 4RDWA 5MHBA 2WJDA 1E55A 1YX1A 4MY1A 5GJMA 3EWCA 5AKQA 3U7VA 1FWHC 1Z9AA 3VOFA 2XM1A 1QFEA 3WF3A 1FH7A 6PTDA 1RLCL 1S2AA 4JQ3A 3UY8A 3OBEA 1EJTC 4EK7A 3O6DA 1YW1A 1HGYA 2Z2BA 4OUIA 3C61A 3FJ4A 1Q45A 1KTCA 2EPNA 1D2KA 3PZVA 2C0AA 3NVTA 3RU6A 5DY3A 3KE0A 4IUGA 2HSAA 5I5RA 1XSIA 4H01A 2YIHA 5AZ1A 3T0DA 1ME9A 1KM4A 4PEKA 2UZ9A 4DJFC 1AQMA 4HYRA 3ABXA 1XIGA 1YPXA 3T2QA 4GVFA 4HK5A 4KW2A 4LC6A 3NTYA 1NP2A 1XSJA 1V03A 4C5YA 1ZY9A 5AC6A 3KEHA 1IZKA 2NUXA 1VD6A 3AS0A 2I1OA 4JN7A 4A2SA 2JE8A 5HUPA 1P6WA 4MFDA 2A3HA 1BQGA 2C0HA 3KWXA 2VGGA 3CUXA 2D3LA 4PZVA 3VIJA 4B5TA 4GGBA 1UD2A 4IXHA 5EMYA 4ZODA 2E68A 3ELFA 1CBGA 1V6WA 4NJHA 5T91A 3ZJ6A 2HPMA 4AMCA 1PKLA 1V3JA 4GCAA 1MW1A 2VX5A 3P7YA 3OJGA 1GZGA 1C91A 3U4AA 2EJAA 2CZDA 2ZA2A 1E73M 1MZRA 3V0TA 2EJ1A 2ZRUA 3GR7A 4BKNA 3K1DA 3WDRA 3RM4A 2H9AB 1XL9A 4I3GA 3B9EA 3B97A 1VFFA 4QGCA 3L21A 2XU2A 5H2ZA 1K9DA 2OLSA 4PMZA 4IQJA 4KH2A 1JYWA 3T1GA 4GBUA 5AHNA 2Y4SA 4GYJA 4YTRA 1GUVA 4EXBA 1ZHAA 2EHHA 2VYOA 2DSWA 2V5BA 1TCDA 4IP4A 3CPRA 3R25A 1JAKA 3LV5A 3PTKA 2ZICA 1WNOA 1JCYA 4WSHA 2PDMA 4HZMA 4QROA 1TJRA 2EBNA 1VRDA 5EU9A 3MVTA 2R8WA 1POKA 2JALA 3LI0A 4S1FA 2OVLA 2Y8VA 3ANVA 2IKGA 1TV3A 3GH4A 2NQLA 5C70A 4YN5A 1EIBA 2HRWA 1K8ZA 2BGNE 5D05A 3CB3A 4HU4A 1UOZA 1IEVA 2FGLA 3TFCA 1VENA 1XIDA 3O2LA 1QBBA 1C7SA 3RRXA 3VX1A 3NZRA 5E93A 3BLDA 2QV4A 2RDWA 3VKJA 1DP0A 1WA3A 5KITA 1IF2A 3VNLA 1K9FA 3BW3A 3MUIA 3O0KA 5MF5A 3BMWA 5DY2A 1OEPA 1KA9F 1ICPA 5H8MA 4M29A 5EFFA 4HSOA 3CZJA 4R9OA 3I7SA 3SECA 1PVNA 3ARXA 1TX2A 1D8CA 3NQAA 4QIUA 2OQYA 4EWJA 2Y8UA 1O5RA 5EKYA 1Q66A 2ZRYA 4LF2A 1HQTA 3AAMA 2GVLA 3H2CA 3BDKA 1FWNA 1DTUA 3A21A 3GR4A 4PTMA 7TIMA 4Z2KA 4BQ2A 2VX7A 3OVRA 1YNQA 4J9JA 4A3HA 1OFDA 3C0QA 3U9IA 3UJSA 3ALFA 3F4VA 1BG4A 4PMUA 3NURA 2FFIA 2OKOA 2OZ3A 3T0CA 1ONWA 4UQAA 4RK8A 1F8IA 1IE7C 3M5XA 1V79A 3TYAA 3UA3A 2WB5A 3AMLA 2WVTA 1HKVA 1U1HA 1MDLA 3UYIA 3KS6A 1HO1A 4E2VA 3WNMA 1E1CB 3POCA 1OYAA 4GMEA 1VP5A 4FXJA 4X0VA 1OF8A 2J7DA 4NJJA 1TE1A 3GBDA 4ZTYA 3IK4A 2PZ0A 4LS0A 1AW2A 4QRNA 1FKWA 5HQEA 3WLKX 4LS1A 1TVLA 4IISA 1X1OA 4J1OA 3UNTA 4AEFA 1BWVA 4IP7A 1KFWA 5EGRA 3ITVA 4ZTXA 3G77A 2PDGA 2VWSA 4JBRA 2OSXA 3KTSA 2GGEA 2E8ZA 1JEZA 1F61A 4M1BA 3TX9A 3R1ZA 3B8TA 2OLHA 1AW5A 3VKDA 2XVPA 3LNPA 4OTKA 4YYFA 2D0FA 4ZXOA 2RH9A 3QHMA 4H3DA 1EJ7L 5A2CA 4R33A 4YS1A 4XZHA 1OVDA 1BVNP 2EGZA 1EC8A 1UH2A 3AOFA 4NXKA 2D20A 4ZMGA 5C7VA 1ITUA 4CD4A 1VAHA 1SJDA 4B3KA 4TVDA 1VCGA 3PBYA 4MB5A 3VDHA 4IPLA 1HVXA 1FOBA 1TMLA 5EMLA 1PTGA 1V0MA 4GJJA 2PF8A 4AVNA 3SCOA 3TA9A 3PJUA 2HE8A 4WF7A 5CG0A 4FK9A 1TZ7A 2BHYA 1HKMA 1W5OA 1J6OA 2WM1A 4FF7A 3R8GA 2WSPA 4A3UA 5HATA 3EKZA 1QUMA 3LCFA 3I3DA 3JS3A 3P74A 4DLMA 1ZAHA 6A3HA 3M5ZA 2WKLA 1E56A 4H19A 2FPYA 3SCUA 2YFNA 4O1DA 3OB8A 1TV5A 4GVHA 1MNSA 3P0XA 1TB3A 3G1DA 4J2MA 2XZ9A 3UT0A 3LHVA 5ABHA 2I16A 4XBJA 4ACYA 3VK5A 4OE7A 3FN9A 3QMTA 3N1AA 4M1RA 1T6MA 3LPPA 4FPSA 3R58A 2AL2A 1DXIA 4PB5A 1CT5A 4YTUA 1XJBA 4U28A 5A3HA 2DH2A 1YQ2A 1P0DA 4F0LA 1X98A 3W74A 2ZZ4A 4EF9A 2F38A 1H4PA 4P7QA 3OLDA 5L6UA 3LA4A 3VKCA 5HPOA 4FSAA 3S9YA 1WQ5A 1OD8A 2ZRZA 3BTNA 2PD5A 4XZLX 3U6WA 1QNRA 1NDYA 1FXPA 3WF0A 3L4YA 4QXIA 5BU6A 3M46A 4B9ZA 1NU5A 2PAJA 4RCXA 1CGTA 4DJFA 3ANYA 4NAFA 1W91A 3EOLA 1DORA 3W7GA 5A1AA 1R38A 2Z1SA 2NQZA 2IW0A 3ZJ8A 4D6FA 4M51A 4FLQA 2ZZ7A 1OD0A 4JX6A 5CC5A 3NVDA 2QAPA 1CCWB 3L68A 2VM8A 3T42A 3DC8A 4GNJA 5EBAA 1SYTA 5FJTA 3G1YA 2J9YA 3QMRA 4JTRA 2VHLA 2Y85A 3A5FA 4Q8PA 3B0PA 1SO5A 2GLKA 3GVRA 4IIFA 1GVOA 2WKJA 3M16A 4CQ9A 2TSYA 3W1NA 2HWGA 2QLYA 3NA8A 1UZHA 3S46A 3MI2A 3B3DA 3GHTA 3V1HA 1VEMA 4IIEA 4HHHA 1CX9A 2JK2A 3TYCA 3QR0A 1ZBWA 4B5WA 1V3MA 3LN3A 1WYIA 4J3TA 3ES8A 4O50A 1HL9A 3OVPA 1UR0A 4BFAA 4NJIA 5GQBA 3L0KA 1S3TC 3WLJA 3IVTA 3DUGA 3CO8A 2ZUVA 2DVXA 4HA1A 3CHVA 3JR2A 3CYJA 4O19A 3ITGA 4W4QA 1Z69A 3QW3A 1NARA 3EOUA 3LCHA 5L9FA 2NT1A 3OGVA 2W66A 4UBPC 3QPZA 5FSEC 2VUYA 2OEJA 3OEXA 3MVIA 5LGXA 1RPXA 1OWQA 1Y5VA 1QO5A 4N9EA 1O60A 4AU0A 2CLOA 4CQ8A 4XV0A 4IJCA 1LL4A 4WD0A 2CZEA 4ZQNA 4HNCA 4LUIA 4Z08A 3WK3A 4LTSA 1W1ZA 4LV4A 2JGQA 3G6MA 3LRKA 4IG2A 2DP3A 4HOZA 1SJAA 1BSIA 1CXHA 4MUPA 3RXZA 5G2WA 3W02A 4LBRA 1M41A 4GE8A 4C1KA 3N2XA 1D7FA 1H7NA 5A8GA 1E6PA 5XINA 2QGHA 4UMAA 4Y6GA 2V2CA 3KOWA 1KV8A 2ZUSA 5E6ZA 5LIUX 4G1KA 4L4MA 1G94A 3TROA 3GDBA 3VFLA 5BU9A 1GW1A 4PA8A 4F0RA 4GVIA 3HQPA 3VNMA 3TYUA 3C2VA 2VEGA 4K3ZA 2WC4A 2PGFA 3ARQA 3DC0A 3S1GA 4L61A 1PZ0A 2QJMA 4YMZA 2ESCA 1H3GA 4CU6A 1SFSA 4NAEA 4TVCA 4IFKB 1LDCA 3WBWA 4FNPA 3OO2A 4XK2A 4O0ZA 3NOYA 1CYGA 4AWTA 3NSMA 3PBVA 1SMAA 5DXXA 1F9CA 3LUTA 4YCPA 1UMYA 3PFMA 1GJWA 3ABQA 4E8CA 3KVJA 2F6XA 4BEQA 1UR2A 4IF2A 4YHEA 3QY8A 2V9DA 2ICSA 2VDHA 3PY2A 1QATA 3NO3A 1MUWA 5AHFA 3P8IA 1R87A 3DG3A 1QOXA 2DW7A 2PDCA 4F0HA 3N4FA 1QCWA 3CT2A 3EOEA 1VCFA 2XIQA 1GGOA 3G1VA 2QEZA 3YPIA 4QS5A 4UR9A 2VTFA 1XKYA 5I3IA 1IXQA 1XF0A 1W3HA 4EACA 1C8XA 4JIHA 2IMRA 3G1SA 2PSNA 3TTQA 4PCFA 3CBWA 4GUIA 4Q4KA 1S2UA 1VJIA 4K39A 1XP3A 3S1VA 4E4UA 1EP1A 3NDYA 3S42A 1H41A 2O55A 5EA9A 4DEFA 1YDNA 1BRLB 5D09A 1I0BA 3RNDA 2QGYA 3TVAA 4U3AA 3UNDA 1HKWA 2PD9A 3ABSA 1VYSX 3ITOA 4WK9A 4TX8A 4JFUA 2Y8KA 1OC6A 1M7PA 4O1FA 4X0NA 1KM0A 5D8ZA 2VRQA 1DE5A 4P7LA 4GBDA 3TP4A 2C15A 2D3NA 3KM8A 2OO0A 3KBMA 4X9SA 4CU8A 4MKSA 2CITA 3QC3A 3CUZA 1IEIA 2PBOA 2P8CA 2E6DA 5AVHA 1EWEA 4AZBA 2GOKA 2E5DA 1EJVC 4PRWA 2OEMA 4GJ1A 5IFPA 1JDDA 3TQ0A 3KL0A 6ENLA 3TXZA 5ENLA 3CLMA 1ZJBA 5BWFA 3VD9A 1KR0A 2FTYA 3G1HA 3E0FA 4LVAA 4DXVA 1BPLB 5I3JA 1FHVA 1V02E 1U1UA 4FF5A 1W8SA 3HB9A 5FAJA 2BZNA 3UESA 1TREA 4WGXA 1CGWA 2X1TA 2GDUA 3S6DA 3CL6A 4YVXA 4C1NB 4GISA 1BYAA 2FZDA 2RJGA 3VNKA 5IXEA 2EO7A 3GC4A 3OVQA 4UOZA 2BNJA 3GE7A 2RDUA 3DYMA 4WR3A 4JTUA 2YDRA 1QJWA 2DSUA 3W70A 1KGWA 4WOZA 2XG9A 1QXLA 3BL3A 1IEQA 1A5KC 1D3GA 2CWNA 3ICJA 2WJZA 4JNZA 5C9RA 1M04A 3GNXA 5C0QA 4MMWA 4CVWA 3T8LA 3AYSA 1WXYA 5T26A 3W87A 2ZE3A 3ZR5A 4RPQA 2GWNA 1O1ZA 4HSHA 1TPUA 3BSMA 4C6BA 2EAWA 4H8UA 3QGAC 5G1TA 4AY8A 1F7BA 3T44A 3N6HA 4PUUA 5F4SA 2JGYA 1S2TA 3TMLA 2QDGA 1LL7A 2Q6ZA 4FZIA 1KXHA 1D3HA 4GJIA 4ICNA 4Z1BA 3R6IA 4O0KA 3PSWA 1EZWA 1F8MA 3UWWA 2FTPA 4OBSA 1WE5A 4DUWA 3CT7A 3EPOA 1D9EA 2BASA 2VFIA 3Q67A 1R9XA 2FZMA 1EDTA 1F3EA 3G1RA 2IKHA 3EX3A 4MWAC 2ONEA 3CAVA 3TQKA 1DKWA 4E2OA 2CXGA 3S9ZA 2HVMA 4NRRA 2XGZA 4IH3A 1J5TA 4ZBCA 4GYFA 2X0YA 5CLTA 2XIOA 3WD0A 3GYCA 1PDZA 1OADA 3SADA 1D7KA 1LG1A 4ROPA 4E38A 2WQPA 4QFUA 3C2OA 2FHFA 4J3UA 4HU0A 5DBTA 5ABGA 1DJXA 4WGHA 3BURA 4CEXC 4Z1DA 3MT1A 5AVNA 4IT1A 1BWKA 4HJFA 5KMYA 3PAJA 1EP3A 2W63A 3DCPA 2A85A 3TQPA 3BH4A 1J11A 4A29A 4N42A 4W8BA 1K7EA 5CJNA 3RLUA 2D69A 4U10A 2VQUA 1J6PA 2O9OA 1I60A 4OIFA 1WV2A 3E12A 3GAYA 2IS7A 3S2CA 1GTHA 1UR3M 3ZVHB 4A6GA 2HZGA 2VD8A 4W89A 1RD5A 3DFPA 4LY8A 3PUDA 4WZHA 1EQCA 4RXGA 1IIGA 3MWCA 3N3MA 1SGJA 1RXOB 3QGKC 3TDFA 1XBYA 3LG3A 4OV4A 5FJPA 1I4NA 3NQ2A 5AC7A 3H70A 1J93A 1RCXB 4MJZA 3PPHA 3WLOA 1P0NA 3TIMA 2VEFA 1IXPA 1Q7MA 3U2ZA 2PP3A 3SBFA 1C8YA 4FLRA 4QG6A 3A4WA 3W0KA 4XKYB 1V5XA 3A4JA 3C3NA 5KTLA 1CGYA 1O4UA 4Z17A 2O9RA 3EEZA 5AYIA 3M9YA 1WPCA 2XH4A 3N4AA 3WUEA 1ZP4A 2FJKA 1R2RA 2WMKA 3IV3A 3PBGA 4EPKA 3PZQA 1IR1A 4ICCX 1TIMA 2X42A 4RZ5A 4ACZA 3QN3A 3ONCA 2NXIA 1WUEA 3AIQA 3OPSA 4IGSA 2Z7GA 4RZBA 2RJHA 1JFXA 5FF2A 1AG1O 3WELA 4PMNA 3TMQA 2UY3A 2D24A 1A5CA 5JVLA 4UR8A 3CV1A 3LZ3A 4TVUA 3S2LA 2H90A 3H12A 3OBKA 1MQQA 1A80A 2ZXDA 4Q8TA 2Z2AA 1XC6A 3W2LA 2VJXA 2B7NA 5I78A 3K8MA 4AZHA 4A21A 4US5D 3AMDA 1PSCA 4UTMA 1OBAA 3GXIA 2AL2B 2BHUA 1ZP3A 3LEPA 4PTXA 3VD3A 2JEQA 2PZNA 5T9CE 4NQ1A 1B57A 2Y0FA 3HPZA 3N9KA 1PB0A 1N55A 4GQBA 4DO7A 5E1QA 3PJWA 3QEZA 1ZZMA 4FIRA 2BGSA 4PMQA 1YIXA 4YTQA 1R3WA 3DERA 3TA6A 1KBLA 4M5PA 1A4MA 3PZ9A 2W9MA 1EJUC 3AZTA 3W7NA 4AEEA 3MB9A 2VRKA 4JKLA 1XLGA 3VD4A 3S6TA 4O8AA 1B3VA 3CQ0A 1I2NA 3T0TA 3W1PA 3LPFA 3N29A 1MFVA 1K7FA 2YXGA 1QI3A 1J2BA 1EJRC 4P8WA 4HZ8A 3W37A 4R88A 4GNVA 5B80A 1XSKA 4PL2A 4IIHA 1TUFA 1MW3A 3GNDA 3KHJA 1K77A 3THAA 2KAUC 1F5ZA 4FIQA 4S3KA 4ZCWA 4LJ3A 1ZBVA 4WDTA 1J9YA 3NQVA 2WCSA 2ZADA 3PPGA 3VKAA 4IFRA 1TTIA 3ITCA 1RJRA 3B0VC 5AHEA 3IIZA 1GQKA 4CNUA 4HT3A 4DO4A 1LCOA 3ERPA 4L7ZA 2ZX5A 1OJXA 3TN5A 2H3DA 2FJUB 1VIZA 3KFTA 5C5YA 1AQHA 1O68A 3W29A 3WDHA 3A5VA 1O5QA 1GW9A 4H7ZA 3FW6A 5C9WA 1V51A 3PBUA 4K1GA 3CQJA 4MNJA 2G3NA 3E38A 2DT3A 2OQHA 3GZ3A 2WWDA 2PWFA 4B92A 3UFYA 1UR4A 1QTWA 2ZXBA 1C8QA 2C7FA 4HHLA 1UZ1A 2X8RA 1W56A 1IWBA 1HW6A 1FH9A 2VEMA 5IRPA 1BKHA 4ZEPA 4QR6A 2ISVA 1S38A 2GGIA 5LGZA 2WPBA 3GZAA 3W2MA 2J7FA 2V3EA 3UU0A 3V7PA 4YPJA 2HROA 2WZTA 4DXXA 4H8HA 2ZBTA 4Z42C 3E1F1 3O07A 3R10A 1TQXA 3MUZ1 4A22A 4Q4SA 1G6CA 1XHGA 3A9IA 1Q3NA 4NX5A 1GOIA 3AZSA 2YR1A 3SN4A 3STCA 1M68A 1UD4A 5JH2A 4GIEA 4WQ6A 2DDXA 4NILA 3CK5A 4J3ZA 5REQA 1FBAA 2VX4A 3LHUA 1REQA 3MO4A 1X38A 2V5JA 4IGMA 2DZUA 3NPUA 4IOTA 2HCVA 1R3SA 3SGUA 2X05A 4BI7A 3WO8A 3M1ZA 4ERIA 3PWIA 3KVKA 4KWUA 3EXRA 3NL3A 3TWBA 2Z0IA 4BQ5A 1KM6A 5CGTA 3QJAA 3VMNA 2ISFA 3F5JA 1MNZA 1WKDA 2Y88A 5CBIA 5A2AA 2AQVA 4ONVA 4ATLA 2CBVA 2Y1HA 3P5YA 1JI2A 1PX4A 4Q4QA 2QJJA 7A3HA 1FH8A 1NEYA 4O10A 4MWAA 5D4YA 1BXNA 2HTMA 4CD8A 1R46A 4O13A 5M5DA 2INZA 3L7RA 4DBWA 3KXQA 3WNNA 4DBEA 4EPDC 1A50A 1TV2A 1G7VA 3WBEA 4WUIA 1F07A 1N82A 3O6AA 2NV1A 1EOKA 3LHWA 5AYXA 3E2RA 1FP8A 3W7HA 4WXZA 3QPYA 2WVUA 2C16A 3W1TA 2VEIA 2OX1A 1IT8A 3M0JA 3LU2A 2X30A 2CPUA 3NQBA 3ENLA 3WLSA 3KOYA 3WUGA 3KVMA 3REQA 4FNTA 1OM0A 4YL2A 1UBPC 1A3XA 3FJNA 3QH2A 4ZOCA 3VCNA 5FA5A 1E6SM 4AZIA 2CKRA 2ZVRA 3MKKA 2ZYFA 1MXSA 5M2FX 3T6CA 4AQLA 4N6EA 2W0UA 3EKGA 2E4TA 5CZTA 1QPRA 1XIIA 4BI6A 4RR4A 3O16A 4I9AA 4UQCA 4WXYA 5LA0A 3FVMA 3N15A 3SFKA 3I7QA 3QHOA 1NDWA 2WAGA 4GYPC 4TMCA 1EUNA 4WOQA 1XYCA 1G67A 1XYFA 4QTGA 3GNNA 4GG9A 4HU3A 1FCBA 1TWSA 1RH9A 4O18A 2PDPA 4HBKA 3W6LA 1RBAA 3HN3A 3GQYA 2EPOA 4GIAA 1JZ4A 1KRAC 2OO6A 3DIPA 4AFYA 3TN4A 4L9XA 2FH6A 5D2VA 3KP1A 3SW6A 2BVDA 4JX5A 2INFA 1V6VA 4RUBA 2BGQA 1R9ZA 3QW4B 1S1RA 3BZJA 3OOQA 3AU6A 3H4GA 3PZIA 1XUZA 3EMQA 3EWBX 1NM9A 2R1NA 1PPIA 1QNSA 3MSGA 5D2YA 5FCZA 1KWKA 4I7VA 1OX5A 3U2EA 1OYBA 4Y96A 3F5LA 3AMGA 4S3BA 4DX3A 3WX7A 1AJZA 4AF0B 4PMVA 1EH9A 1NQ6A 3I6EA 4B3ZA 2HXUA 5HMEA 1QW8A 2Q3RA 3W1XA 2UY4A 4HZ7A 3CUFA 4MNLA 3ZXWA 2GDVA 3WJZA 1MEIA 3MP5A 2YLAA 2WCAA 2J9XA 3NQ6A 4I9TA 3GXNA 4O4WA 2E6FA 4YHGA 4EXQA 3SAZA 3R0UA 3W1RA 3VGFA 5G1MA 3N73A 4LBSA 1G0CA 4O12A 3VTRA 5LIXX 3QSRA 4LNCA 3VOJA 3A3WA 1K70A 2Y5SA 1XRSA 4PTDA 1PDYA 5HXMA 4MYXA 4AWUA 5C7HA 1FFQA 3MI3A 2A2IA 4JEQA 4IX0A 1SU5A 2E8YA 2C71A 3VO0A 3F7JA 4W8AA 3IJ9A 2G3MA 3IS4A 2DQWA 1A5UA 2E9MA 3MI6A 3FNDA 5A6SA 3KCLA 4ZQMA 1VIWA 2NLIA 1JD7A 4ICMA 4OU1A 3CAQA 3S4TA 1WBJA 3B8IA 1HT6A 4DM2A 1CZ1A 3THCA 3N2OA 2A21A 3WLLA 1ELSA 3KZSA 1DIDA 4XG1A 3B8SA 1KFLA 3BAWA 1JCMP 2DFAA 3WFAA 3NSNA 3INPA 3SY5A 4GQGA 4RV8A 4DJDC 4XVDA 3UJ2A 1V77A 1TVNA 2C1GA 1EQPA 2D23A 2JKPA 3AIVA 1V0LA 5AECA 4NNAA 1NTHA 1L6SA 1P48A 3UW6A 2GSJA 3T07A 3R2GA 1Q6GA 1AH3A 2RKXA 4ZO9A 2ZUTA 2YBVA 3HG3A 1UWTA 4K1WA 1IT7A 3BCDA 4ZB2A 3BXWA 3OW1A 1C92A 1MWOA 4AY7A 4B5XA 3S8HA 3HGSA 1JIBA 1K4HA 4ZVJA 4YXGA 2P50A 3HFYA 2JKEA 2PPGA 1E0WA 3POHA 2PGRA 1XM3A 1ZCOA 1ME8A 1V6YA 2D0GA 5ABTA 3UF9A 1K7XA 4EAYA 4IJBA 1XGEA 4LXFA 3GDRA 5FD0A 1A0CA 3WYZA 1RV8A 3C56A 3DHFA 2UV8G 1H2JA 3DU0A 3AS3A 1AW1A 3U57A 4AZ6A 5AHIA 3SCNA 2V3DA 4HCLA 3WD2A 2OXNA 3IGHX 3QZ6A 1OX6A 1UR9A 3WENA 3GDLA 3ZJ7A 3QQ1A 1JYVA 4JKMA 1SSGA 4DWSB 4ACZB 4DNHA 1W9UA 2A3BA 1DIEA 5F4XA 1R85A 5CPLA 2INEA 3H8AA 3R0DA 3GK0A 3MU7A 1E43A 4LH8A 4M6UA 3WDPP 2VZOA 5HWJA 3SJNA 1XRTA 2DUXA 4HNTA 1A5MC 1U83A 1MEHA 4XISA 1FVPA 1XCXA 2F9RA 4US5A 2WWCA 1EDGA 3D46A 4PBEA 1RK5A 4X9YA 2WVVA 3L4VA 5FESA 4QNWA 3NR0A 4CD5A 2VCCA 1VPYA 5G2HA 2Z1XA 3SZ8A 4AY1A 1XBVA 4MY9A 3GIQA 1CIUA 3FKRA 5HJLA 3QV7A 2DEPA 5A2BA 4QJ5B 3PZUA 3I6RA 3N4EA 5A5WA 1VBJA 3D3AA 1O6IA 2HPIA 4O15A 4CU7A 1S5VA 2E67A 2VENA 3SRDA 2XGBA 4C7GA 2NSOA 4MM1A 4JX4A 1KCZA 4H7CA 3GG8A 3UCQA 3W83A 3AUOA 1OFAA 1LROA 4L1WA 3M44A 3G1FA 4H83A 2XN0A 3AZRA 3UCDA 4CEUC 4PL1A 2MNRA 2V2DA 3KDOA 2I17A 2CESA 3W1QA 3W73A 1IT0A 4V28A 2FYMA 1B4KA 2PDLA 1GORA 3WQ6A 5JU6A 1TPVA 2PC8A 2O9PA 3V0SA 1H1ZA 4C6OA 4LUTB 1GKQA 4B4FA 3A64A 1V02A 1OCQA 5EYWA 1UUQA 3VNYA 4UTTA 1W1A1 3H23A 4FR6A 3VKKA 3OIXA 5CCZA 1XRVA 4MLJA 3RM8A 1RLDA 5LNVA 2QULA 4N6FA 3S1UA 4GYPA 2YA0A 3QV8A 3NZPA 4EANA 2FQIA 3D6NA 2YL9A 3PBMA 1W1B1 1WDQA 4NUWA 5D9NA 4FA3A 4L4LA 1W9VA 1XX1A 3CMGA 2PCQA 1TPDA 4KWWA 1FKXA 1W0MA 4EE9A 4JFTA 4HCDA 2PTDA 1BKSA 4ML4A 1TWWA 1N7KA 2HNEA 3QMSA 1ME7A 3AHVA 5E9XA 3AHTA 2Y2WA 3SUVA 2PC4A 4W5ZA 1JQXA 2BWGA 4X3ZA 1FCQA 2BY2A 5DCDA 2O4MA 2ZKMX 4FX6M 3UZ5A 4CLMA 3AMKA 4ML9A 1QK2A 2FHCA 1PO9A 1JR1A 4DZIA 1NP0A 4NYUA 1JPDX 2ACSA 1YPIA 2VEPA 5KSWA 3W26A 1SJBA 1E40A 4OECA 2GJXA 3TONA 3OU8A 4LYKA 2ZTJA 3E2VA 2GDQA 1MO0A 6XIMA 4HOXA 3CQIA 3PK7A 3CLWA 5ECUA 5REQB 5K3VA 1AMYA 3GHSA 1E1EA 3WQ4A 1REQB 4EKJA 2GJRA 3RITA 4HPJA 4NI3A 1K8YA 4CCZA 3BLEA 1E4LA 4CD7A 1XWYA 4ZENA 2WZEA 4GKLA 1Y65A 3VMOA 3OYZA 5A8OA 2ABBA 4NZJA 3LNMA 2QCLA 1E51A 4NG3A 4WJEA 3SSJA 3HFTA 5BRPA 4MADA 3GXMA 1CDGA 3M6YA 3N14A 3AWOA 4I90A 3CXOA 3IEBA 1UG6A 4M8UA 1EJXC 3WQEA 1KXQA 1XUUA 1RJQA 2XINA 5DXYA 2C1HA 4G2DA 1GVEA 4YVVA 3QTPA 5G4HC 3HOJA 3HJEA 1YEYA 5SWUA 4Z1AA 1AL7A 2BXVA 1GVFA 1UWUA 2AQWA 1QW7A 3WLRA 4GK8A 3GVQA 4YNGA 3JUGA 1Y0EA 3WH8A 3IIXA 1XPYA 1E72M 3C0SA 3P8JA 2XIIA 3M07A 3S9IA 3V36A 1EF3A 2R91A 4V33A 3MSRA 2DJLA 3ARUA 4MJ2A 4G1NA 1Y5WA 4PSRA 4UQEA 1B54A 4DBUA 3QC0A 5FAGA 1VHCA 3LM7A 3QSTA 2IKIA 4ZR8A 4AIOA 1NOUA 1LWIA 4DJDA 2QZRA 2W6RA 1JAEA 2TPSA 4WHBA 3LRLA 4TTUA 2DT2A 1TTJA 2ZC8A 4ZL1A 5EMUA 4IMCA 1GVRA 1PZ3A 3BK0A 3CU2A 4NU7A 2J7GA 4JYFA 1BF2A 2XTKA 1K9TA 5CG7A 5LSMA 4EPBC 1XIMA 4IMFA 4HMCA 1B3ZA 1UROA 3LD5A 1I2RA 2XN2A 1Q6DA 2B7QA 4A2RA 1WDSA 1TO3A 3B8WA 1V6TA 2E9BA 3E2SA 1W3NA 3MHUA 3WFZA 1SZGA 3RRAA 3ANUA 1EIXA 3WN6A 4CKQA 3ZJKA 3HGOA 1IWAA 3WQ8A 3O1NA 3OG3A 3NPWA 5TBOA 2AGKA 1BXCA 3QVQA 3GX9A 3RAOA 5JUVA 3TWAA 3DG6A 3S5SA 5D9PA 3CH9A 2DJXA 3RO8A 4UFIA 1SUXA 4GABA 2DH3A 2C19A 4CVUA 3VIGA 2ZX9A 2C91A 3SI9A 3KUMA 1E0VA 1HIZA 2NVDA 2PDHA 2W92A 3CZEA 2FDSA 3FYOA 3QZEA 2X1SA 1YKWA 3W88A 1H50A 2L5HA 1QWGA 3RYSA 1PHQA 1IZCA 3KOFA 4JNYA 3S3GA 1X97A 4LVGA 4B9YA 3TFXA 1HKIA 4GXPA 1KFBA 3U7BA 1LM1A 4HPXA 1ZAIA 2P10A 5CAHA 3W2UA 1T99A 2C1IA 3M6DA 4KRUA 5F7UA 4WSKA 4E3VA 1W9PA 3W22A 3BC9A 3AIRA 2ZXAA 3EWYA 3LY0A 3STEA 3PBWA 5D8WA 3H24A 2I5QA 2H9AA 5KEZA 3WFLA 3HQ1A 3GTNA 3K4AA 4WKFA 3B0UX 1W31A 3W84A 1OG0A 4XVEA 4WX2A 3NAVA 1DXEA 1QNVA 3VIMA 4AIUA 1SR0A 2HE5A 1QHOA 3DGBA 1H0IA 1A5LC 1HJXA 3T55A 4ATWA 4DO6A 1J8VA 1ZENA 2XIMA 3SCVA 2QPUA 1KFKA 1WXZA 2HVOA 1HF6A 2Y5EA 4PUMA 4R53A 4QP0A 3BO9A 5IBXC 2JF6A 1NWSA 1H7PA 3KVLA 2QPXA 4CN6A 4DY1A 1QASA 4QE4A 1YYAA 1F3WA 1JCXA 3MCMA 4RL3A 4GCXA 3NNTA 4ZQRA 1BYDA 3WH9A 5H6HA 3H4XA 3CO4A 4ENLA 4DYKA 4KESA 4S23A 2XIJA 1TFVA 4XAGA 2C6QA 4D1IA 2CHNA 4DHGA 3A4AA 3BQ5A 4XB3A 3LHYA 5A69A 3GHUA 4DJED 5C2CA 2XSXA 3VE7A 1UKSA 4D71A 1K6WA 3C2EA 4LAMA 1GOMA 3UEQA 2O0TA 3EDJA 1BEUA 1IV8A 4LC8A 3P67A 2VXNA 3K8KA 3DHDA 1GYLA 2FB2A 2OFJA 4BQ3A 3AQUA 1YRRA 4CNNA 1E4IA 4QAWA 1UC5A 1PBGA 2V6AA 5LYRA 3W7MA 2AAAA 4PMDA 3TSMA 3TCEA 1KBIA 3AIUA 1HP4A 2VGBA 3WF4A 2ZWYA 1YMYA 3H4WA 1BTMA 1TSIA 2PF0A 4B2DA 4F2UA 3VIFA 1ZUAX 1C93A 1RP8A 4AX7A 3T09A 1EXBA 3K46A 5FEXA 1XI3A 2G50A 1OFEA 4OVXA 1SM9A 2QUVA 3R13A 4MOZA 3WF2A 3WEMA 1P4CA 4UWMA 4H41A 1LRQA 3UZXA 4ES4A 2FZ9A 1UP0A 4EIVA 2H8XA 3E0LA 3TE9A 1JUBA 3PR2A 3N12A 1LOSA 3DFQA 2QCGA 3M47A 1E1CA 2ODOA 3HPAA 4JHMA 3VGGA 1HN1A 2P1FA 3IAPA 4JCLA 4J40A 5I79A 5IOBA 2REQB 1Q13A 4D6IA 1F76A 3VVGA 4JTDA 1UKOA 4UMCA 4M6PA 3MV01 4UCFA 2D2JA 3FSTA 3ME3A 4N4PA 1UPPA 1G4SA 4H9VA 1OB0A 2XVKA 1XICA 2G3FA 3K1GA 1ONEA 3OHIA 3TAKA 4Q22A 2H8ZA 4UCGA 4XBKA 4XD5A 4XUYA 2QJIA 5AC4A 3EB3A 1P0BA 4ZO6A 2V69A 1TPWA 4DI9A 1B3XA 2DORA 1I6NA 4LCQA 3ARTA 3CUJA 2EPMX 2NQ9A 1W5MA 4CNTA 2QIWA 1JVNA 5A6LA 4C5ZA 3TSDA 4DAFA 1UPMB 4JTCA 3GNOA 2ALRA 1TWZA 2WVVB 2G41A 3R4IA 3KHDA 4JTQA 1XLDA 4W88A 5CGQA 3THUA 1GG0A 3EOOA 3ITLA 4RDZA 3GS6A 2NSXA 5HQLA 3D5HA 3UG4A 1TG7A 4MF4A 1PIGA 3KL5A 4IPJA 4QISA 3A4XA 4ZB0A 1UA7A 1Z44A 1F2JA 1G69A 4GY1A 1XH0A 1PS9A 3S83A 4CNOA 3QXBA 4PGLA 3NDOA 5JIPA 2R24A 5D03A 1ADOA 1JDAA 4PFMA 2E09A 1HL8A 1CB2A 4S3JA 2V81A 3URNA 4L6OA 6REQB 1VGAA 3GG7A 3MPGA 3M43A 2XVNA 4WY0B 3CS2A 3SRHA 3H7RA 3GTHA 1BD0A 4H9ZA 4JTHA 2DY3A 4NT0A 1T8QA 2POZA 3BANA 4DF1A 4JD4A 3BJTA 4DJEC 4XBSA 3L2IA 3W71A 4JFVA 1BYCA 4WVXA 2AGTA 3P62A 3DAQA 3D3FA 4UTKA 1NFBA 2OX4A 3GKAA 4DUXA 1HZYA 4I7WA 1AQ0A 4C60A 1GVQA 3A12A 3W07A 3SSZA 2C13A 3M41A 4OHQA 5JXQA 1M53A 1E5NA 4INFA 1QI0A 3G2GA 2FHBA 1OT2A 4LYQA 3SGGA 3KRUA 1OIMA 3A13A 3H53A 4HYVA 3UP8A 2V5KA 2Z26A 1VFLA 4ZQCA 1TYGA 3RPMA 4L6HA 3V4BA 5I24A 4GZJA 2ZZ2A 1A3HA 1Z41A 4H9UA 1VRXA 1EFZA 5I6SA 1UUOA 3SN0A 1BXBA 1SZRA 3G1AA 2OJPA 3OHMB 4GI4A 4GIYA 4FXRA 4DJFD 4FMVA 1PTDA 1KCXA 3GXDA 2OYMA 1W3IA 5AHMA 4LUYA 3HF3A 1Q6LA 2Z6IA 4JTIA 3KAOA 3AC0A 3UWEA 1Q2RA 1JFHA 3NGJA 4ZO7A 3LCIA 2NX1A 4BY3A 4IL2A 2R82A 2WMIA 3T40A 3IUDA 1WKFA 1NJJA 3NG3A 3SURA 4S3AA 3SM0A 4F9JA 1LORA 3LSBA 3B9NA 2XN1A 3I10A 4NZ5A 4S39A 1HJWA 1GJUA 1ZU8A 1E4MM 1MEWA 4JTSA 3W7PA 3H2NA 2WC7A 2OODA 1OC5A 4HK7A 1UP3A 2IPWA 1GEHA 3B9AA 2VFDA 1VLIA 3PANA 2J25A 1C9WA 4JTEA 1R3TA 3W72A 2B31A 3WNPA 1ADDA 1TJ2A 1WO2A 3PZGA 2ZRVA 3PTMA 1Q6RA 4I6KA 1AH4A 1TZZA 5AZ0A 1OFOA 3QLLA 3QKEA 1C8VA 5BYWA 3PULA 2YYTA 4JQ2A 1ZLPA 5IBXA 3ZT5A 1UWAA 1XLLA 3L9CA 3E2QA 3LHZA 1GOXA 4WJXA 4J2PA 4FAMA 3AS1A 4DAIA 3U0HA 5FKYA 4YTSA 3APGA 3PPFA 1UH3A 4EX4A 2J47A 1VFTA 1FRBA 3L0GA 2PODA 3FYYA 1GKPA 1LYXA 1XYMA 3ZR6A 4U2ZA 1LRTA 4OJYA 4IXXA 2PDBA 4ZB5A 2OEKA 4IUOA 1EBGA 4B91A 1B5TA 4AWEA 1XLCA 2TAAA 2OU4A 1DJZA 3DBPA 1EEXA 3TV8A 1ALDA 4CN4A 2WBKA 3OLIA 2BXZA 4BJHA 3GG1A 1AJ0A 3QPEA 2ISWA 2G4FA 4KGLA 5EB8A 3LCWA 3QY6A 1MDRA 4ADUA 1Z3NA 3NFUA 2ASHA 3AI0A 2C3ZA 3NQ7A 3WF1A 1DJGA 4LF1A 5CC7A 1DTNA 1K4GA 4U4MA 3BLIA 4LEQA 4IFKA 2QVHA 1PE1A 4DBDA 5ECVA 3DESA 4G7EB 3A24A 5HJYA 4AX6A 3CEPA 4F48A 2QJGA 2V67A 3C0JA 2XYLA 2NQ5A 2Z2UA 1B0IA 2WK2A 1V3HA 3LQGA 7REQA 2FTWA 5I2UA 1MYRA 4KMQA 1KRMA 2X0HA 2E25A 2XFWA 5CC6A 4XZ9A 4PCTA 2FPTA 5F2LA 3HMCA 1B31A 5CKSA 4UZUA 4JTJA 3UZZA 4G5DA 1T96A 4J3WA 3VKBA 1Y8BA 3T4CA 3UR2A 1RK6A 3T78A 3GNPA 1WDRA 7XIMA 3KCOA 3W27A 3FJLA 1RVGA 1LJYA 3CAKA 3E74A 3K2GA 4P7NA 3W7KA 3MZNA 4TV6A 1L8PA 4LAZA 1DJIA 3G8EA 4PMJA 4W7UA 5CXPA 4IQDA 5U4NA 1WP6A 2V38A 5A8NA 1FWDC 3STPA 4IQLA 3C8FA 1OK4A 1VBGA 4E2BA 1J12A 4Y9PA 4PUWA 5E0KA 1XQLA 5LXEA 1BRLA 1WUFA 1NDVA 3CC1A 3BSHA 4R3UA 1UWRA 2F61A 1G1YA 1OCJA 3RILA 4U5KA 2ABAA 1JXJA 1RD6A 3P84A 5GNZA 2QCFA 1CPUA 4EVZA 2G37A 3EB4A 1B90A 1WZLA 1X7IA 1GJPA 4PB3A 3IARA 3KCJA 3AIWA 3W3OA 1RZMA 5BZAA 2GJNA 1DHKA 2GGJA 4Y9OA 2B7OA 5D2TA 5EMMA 4CQDA 4F66A 3WK0A 1BG9A 5DELA 1LQ0A 5J5DA 1JPIA 2R9RA 3GFXA 4HNNA 3USZA 3BPWA 2WV8A 1EB3A 3E5PA 4D6HA 3DYOA 4BK9A 1W9DM 2CHRA 1QOQA 1BSLA 1SW7A 2QHAA 4F79A 3F4NA 3AWNA 2CZVA 4LVFA 2PU0A 5AY7A 4LU0A 1DJYA 1ZJIA 4C1NA 1FWGC 3GWQA 3UWVA 3N19B 3RG6A 4DJEA 1EO7A 3URQA 1QPQA 3NQGA 1RCQA 3SRFA 3GVWA 2JKAA 3NXFA 2VZSA 4MLRA 1WKEA 3MBDA 4AD5A 3AIBA 3W7IA 1NELA 3I65A 2G4JA 1PKYA 4B90A 4JL1A 3V18A 4DYEA 2OWCA 1RALA 2EPLX 4OOZA 2OG9A 4KFOA 3M64A 1ISZA 3FX4A 5FSDC 5EFDA 4PC8A 2GFTA 1SO3A 2NVCA 4GINA 3L5AA 1Q6FA 3QLDA 5CZ0A 1I2PA 1PUDA 2QXWA 5JH1A 5K9CA 3GDKA 2PMQA 3U3HA 3T2OA 1X8CA 2XFFA 2OGYA 1KWGA 3H2OA 4QJ1A 1E9ZB 2BB0A 1EEPA 4HYWA 3TR2A 1F3XA 1F73A 1C3FA 1VEPA 3V16A 3K4DA 2DZAA 4P61A 1PEZA 4K8GA 1XLFA 3E02A 3VD7A 3WL0A 2C14A 4FNQA 4UFMA 3MA8A 4HHMA 3CZ8A 1ZBCA 1KBBA 2PDQA 3W1UA 4QCFA 4UTWC 3GBEA 5HMSA 3M0LA 1KC7A 1DWIM 2UBPC 1ODUA 5DFAA 3CWOX 1A49A 1POJA 1PCWA 4H9TA 3RMEA 3C2RA 4C6IA 3M7WA 1JF6A 4TU1A 1DWHM 1FWTA 4GZ7A 3W86A 2J78A 2A6LA 4G9PA 3FS2A 2A5HA 2UWFA 3QQWA 1KLZA 2Z1VA 4FNUA 4O28A 4B16A 1PCKA 3R8RA 4Q4RA 5DT5A 3CUGA 3AJ7A 4OOUA 3I3EA 3EWXA 1Q4WA 2YLLA 1O1HA 5LKYA 3FFSA 5GJNA 3LERA 3FGCA 3ZVHA 1WZMA 4UTJA 3NOEA 1YE4A 4MWAE 4X2PA 4PRRA 2RDTA 4CNSA 3OA5A 4MVAA 2B4GA 2A0NA 3CMFA 4HNUA 1I75A 1A5BA 3MHGA 3OGRA 5EPDA 5E9AA 2NW0A 4HJWA 3OQ8A 2GVJA 3L65A 3B0YA 3DOPA 5BOOA 3VIHA 4L4PA 4KGJA 2WM0A 4HSNA 3PPCA 4AZCB 3NPVA 3VAVA 1W1PA 3GTIA 4HQVA 1UCWA 4M0XA 4HPNA 4CNPA 2Z28A 1M3UA 3R7MA 4XKYA 4POCA 1OSEA 1SW3A 1UA3A 3LQLA 3DBNA 3NL5A 5AYZA 2VURA 3VC5A 3UG3A 1E71M 2BFGA 3PZOA 2XVGA 3WLHA 4HNVA 3LBMA 2DZXA 1KBJA 2VELA 2XSBA 5AC5A 1RPKA 2DUAA 3AUJA 1FWSA 1X7FA 4B4HA 1XG3A 3LCGA 1W2PA 4GFIA 5I7GA 1FCVA 4DWSD 3O0FA 8RUCA 1DYSA 3GU2A 2J8TA 5D33A 4I8YA 4QDMA 3B06A 1P6BA 3VNZA 3G5EA 4LAUA 1TA3B 1ZSXA 4BEUA 1OC7A 1VFSA 5K2ZA 3TTYA 1R7AA 2E5CA 1E9YB 5AHLA 2ANUA 1W32A 5T8GA 4OV9A 4LPCA 5E09A 2ZUNA 1XIHA 2PRMA 1QI4A 5BXTA 2VCAA 3OTRA 3F4WA 3QTGA 3N9RA 1WAWA 2FVMA 1TVPA 2PWEA 3WBYA 3LS9A 1LL6A 1JCTA 1L0PA 4CCCA 5C8BB 4PCNA 4PTWA 1HNYA 2DIKA 2YW3A 1IYXA 2I7GA 1GTEA 1MZHA 1EXPA 1M01A 3B8UA 3NO5A 4MHBA 4HKPA 4IZGA 2CYGA 2XH2A 3RK8A 4DIAA 4CGTA 1R86A 3WLQA 7CGTA 3MJYA 1KM2A 4PMYA 1TPH1 1SQ7A 1Q4NX 3A3HA 5KZ6A 1AK5A 2E28A 3QGVA 4Z1YA 1DVJA 2WQDA 3I68A 2J79A 3MKVA 4PYSA 4F0SA 4AWSA 3HQNA 5DEZA 1G9HA 4O17A 3IK2A 4BF9A 1JULA 3CEUA 4GH1A 3DFSA 5IDIA 2F8QA 2WMIB 5CZJA 4PUNA 2F7FA 2PWHA 3VUSA 4W84A 3BLFA 3ID7A 5AC8A 3W7EA 4RZ4A 1VF8A 4H2CA 3R89A 4RKAA 3ZLFA 3UXAA 4A4AA 3LTPA 3RCYA 2VR4A 3I6TA 4PUEA 4GFSA 2ZRWA 1M7OA 5IDZA 4S3EA 2GUBA 3GSMA 3UZWA 4IMGA 1JZ6A 1GYNA 3HPSA 5DO8A 1L8NA 3W7LA 1EO5A 2A3CA 4DB7A 1V3IA 3IIVA 2YA2A 4AZ7A 9XIMA 3WD1A 5DBUA 3W2KA 3NDZA 4KWVA 2VRJA 1K1DA 3FDGA 2VVNA 3LMYA 4AYGA 4QAIA 4NNCA 4XO6A 4ORIA 1GZJA 4MZYA 2I57A 4Q8QA 3FSUA 3G8RA 4H6KA 1K6AA 4I8DA 1IEWA 1FXQA 2YDSA 2PLJA 1Q2SA 3CAWA 5DMMA 4HB7A 1WDDA 1QDSA 2I14A 1DQXA 4E8GA 4WRHA 3OP2A 3K30A 3PP7A 3QBUA 4G7FA 3CQKA 3CQHA 1IXNA 4JCMA 2OKTA 4LY4A 1RJPA 2BDQA 2ZDRA 1GOWA 3L12A 1NVMA 3KZPA 4EOUA 1YDYA 3IV8A 4HOWA 4R34A 3DN5A 4YTTA 1UQZA 2XDFA 1R3QA 1M03A 4MGGA 4L80A 1KGXA 4DZHA 4M6VA 4URIA 3HU7A 1CTNA 4DWSC 3P93A 4OT7A 2YXOA 2E1DA 1US0A 4IP5A 4J28A 3B0XA 1RR2A 4MZ1A 1KTNA 4HMNA 3LDVA 1SFJA 3O6CA 4B5UA 3R94A 3RR1A 3NL6A 3TK7A 1MRQA 1SPQA 1UB3A 1N2VA 3BWWA 1VFUA 1TKKA 4P8XA 3W24A 2BSLA 3KP0A 4PBGA 4UMBA 4DYJA 5F2MA 1UD5A 4WCJA 4XO7A 1QMLA 4TXEA 3C5QA 3BJFA 4Y8EA 1XC4A 3TJIA 3VE9A 3W2JA 3Q65A 5I77A 2WNWA 1U2YA 3ZOAA 2H3BA 2CBJA 1R7OA 3H2MA 2SFPA 1GZ1A 4MWAD 3E0VA 3MS8A 1JYNA 4QG9A 1L6WA 3BZGA 4B3LA 1EHAA 5EL1A 3RLHA 4UTWA 8TIMA 1DQWA 7REQB 4MZ8A 3WG6A 3BSGA 1CEOA 2IXUA 3GY1A 3AXKA 4TOQA 2VOMA 3RN6A 3K13A 1TV8A 3EDEA 4XWUA 4U2YA 1M7XA 3ZFHA 1TE6A 2EF9A 1UZ4A 3UXKA 3VYLA 2AMXA 2F84A 2V3GA 4AEOA 2DGAA 4MYAA 4JN8A 2AOSA 3IRDA 3N2CA 5BCAA 5DQPA 2Q8ZA 2ISSA 3GO2A 1MXGA 3SRKA 4DUVA 1S2CA 4PCSA 3NZQA 4GACA 3HPXA 1SO4A 3FLUA 3LLFA 3T9PA 3GDTA 4CCEA 3PB0A 1M9HA 1VBRA 2Y5JA 2ACUA 1FY6A 5LA2A 1UIOA 4RJEA 2FVLA 5LZLA 3RM9A 4E4PA 2J6XA 4IL0A 5H8UA 4HVXA 1PWMA 5E70A 5ABFA 2WXDM 3WLNA 1L2UA 1Q8AA 5TQLA 4UR7A 5ABEA 2WCGA 3W7CA 4S38A 4IPNB 4EP8C 3GR8A 3WY1A 4NZ1A 2PDNA 5HWNA 1SFLA 2O7QA 4RV3A 1W3JA 3MV11 1XBZA 3L5MA 3DFHA 3H7VA 2QCCA 2E6YA 3OLEA 1G4TA 2PB1A 3OZPA 3TN3A 4W86A 2CW6A 3UWUA 4O1CA 2QDEA 2OWXA 4WIWA 3BCJA 3LGEA 3XINA 2ATMA 2WANA 5T9BG 3CHDA 1H63A 1R2SA 2WMHA 3GRIA 1UASA 5KZDA 2J75A 1CLVA 2FB3A 2DT0A 3PHAA 1RP9A 3CZKA 4HIBA 4IICA 4XIMA 3ARZA 3IJLA 3EPMA 1K02A 4AF0A 1UR1A 4D9PA 2E7FA 1ZRQA 4AZGA 4WKHA 1XINA 2BBFA 1JZ2A 2ACRA 1EPXA 1KV5A 5MKGB 3G0UA 3LBCA 1P5BA 1JG9A 4U33A 4FO4A 3TW7A 3EYPA 2PDIA 4M82A 3BOLA 1A5NC 3W01A 4KRZA 1Q6QA 2P3ZA 4ERGA 3XIMA 3O8AA 3NEVA 4DM1A 4DN1A 5LIYX 3A23A 4UTUA 3QFWA 5FJRA 3VIIA 3GB6A 3JW7A 2YYUA 2GSEA 1ZJAA 4GNKB 5LNWA 5D2XA 1JI1A 4GOAA 3QRHA 4QSHA 1UD3A 3M0IA 3R79A 3PFRA 1GHSA 3BG5A 3EWZA 4GX8A 4O14A 3BV4A 1KO0A 2XUCA 3OA3A 4ZQOA 1X6UA 2ZDSA 4WEVX 2WHKA 3VM5A 1RUSA 3APTA 5AFDA 3MQTA 3MUAA 2W3ZA 4JHZA 2YGYA 2EKCA 2VR5A 4PCPA 5A6TC 3NQCA 4QDWA 2BY1A 4ZE5A 1E1FA 3VUPA 3UERA 1EF2A 4JR5A 4WJ8A 5G4EA 2BVWA 3SCWA 5E5CA 2PCEA 3AYRA 2DQXA 2WNNA 2BOFX 1A5SA 2WNQA 3SIMA 4HN8A 4HHPA 4LWWA 3WKZA 5I02A 2BODX 2IPFA 3LBOA 4KCWA