3GDRA

Crystal structure of the d91n mutant of the orotidine 5'-monophosphate decarboxylase from saccharomyces cerevisiae
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
260
structure length
260
Chain Sequence
KATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFENRKFADIGNTVKLQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLATGEYTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 102
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3gdrA00
2Y89A 3PF3A 2H90A 1NSJA 1H7NA 1H7PA 5SWUA 4Z0SA 2YR1A 3DI0A 1JRBA 3GB6A 1ZCOA 4OGZA 1OK4A 4NXKA 1TPFA 4IMFA 3RK8A 1ZJIA 3DHFA 1FCUA 4RR4A 3W1XA 1LRTA 4AWUA 1Q6RA 5F4WA 4MZYA 1NF0A 4A29A 3RF9A 3OEXA 3P82A 1MZHA 4UFMA 3KVJA 4QQ3A 1XI3A 2HS6A 2QR6A 5HINA 1OYAA 3GNDA 3EXRA 4OV9A 1TMHA 1TRIA 4IQLA 1EP1A 4NJIA 1SZFA 2CZ5A 3E0IA 1UCWA 2A6NA 2PE4A 4FHAA 4ZQPA 5DY3A 4UXDA 2Y7DA 2TPSA 3LXAA 3M7WA 4AXKA 3CTLA 3NQ8A 1OFBA 1UJPA 2A7PA 2Y70A 2G95A 4JTKA 2ZZ3A 1EEPA 3ATZA 1CW2A 3LCFA 3DFSA 4NX0A 3GKAA 3P7YA 1VLWA 4O17A 2FDSA 4AEOA 3A21A 2Y63A 2BXVA 2VEIA 3V1PA 3PUEA 3BLFA 1IXOA 5EPDA 4E38A 4X2RA 3W85A 1LLWA 3NQGA 1PS9A 1HG3A 3F03K 3BK0A 4I7UA 1BEUA 2CWNA 3EX6A 1TPC1 4KFPA 3P8IA 3TH6A 1TJPA 4WOZA 3S0CA 3C4UA 4ICNA 2CLEA 3DZ1A 2Y88A 4L4LA 1HO1A 1TV7A 2B0MA 3L9CA 4OBTA 4FNTA 2V5LA 5FEPA 1QPQA 1KTCA 3O8AA 3H55A 2ZQ0A 3MP3A 4K37A 2V2CA 3CWNA 2Q8LA 1UBSA 3W7EA 3SI9A 3STGA 1B4EA 5F1UA 2R14A 1GZGA 3DENA 4K6AA 3RLVA 3GIYA 1B4KA 4QSHA 5AHNA 3STEA 5BMXA 4AWTA 3GKFA 4M19A 1IIGA 4O53A 3MHFA 5KZMA 4UMBA 4KFNA 5HMSA 1HUVA 1O95A 4GFSA 3P5ZA 1FDJA 1OABA 4EWND 1K8XA 4WJEA 3O07A 1ZAJA 1CI1A 1EUNA 3L0GA 1KM0A 2CLKA 4BWLA 2ZA1A 1GTEA 2CU0A 1SZNA 3BO9A 4FIRA 5D05A 3STFA 3UWWA 3OVRA 3S1XA 2DP3A 3NR0A 3AJXA 1N55A 2FPVA 3MO7A 2V81A 5DXYA 5FESA 1XL9A 2GVGA 2VENA 3E49A 2W79A 1OYBA 2V30A 4HPJA 4ZVJA 3PSWA 1KM4A 3EX4A 3LI0A 4Z0JA 4RCXA 5EMUA 4FIQA 2NX9A 3PR2A 1SW0A 1GVRA 3IIXA 2HSAA 1OX6A 3CPRA 4ADSA 5DCEA 3NYZA 1PCWA 3HPZA 4M6QA 5E0KA 1YYAA 5G2IA 1Q6LA 5KMYA 4UNLA 3PVFA 1KM1A 2QCLA 4FO4A 2AQWA 4FNQA 4YCOA 5HR7A 4JICA 1C9DA 4CCDA 2Z6IA 1F6PA 3P8JA 1KM5A 1WBHA 3FYPA 1I2RA 3DXIA 1IXQA 4K38A 1AL8A 3ZFHA 3W87A 1UASA 2ZA2A 3WK2A 3BV4A 2WNZA 4UTIA 1FXQA 4LW7A 3W7QA 1F6KA 5FF2A 5LNUA 3A5FA 3G8EA 3L21A 4HHPA 4MIMA 3B0UX 1U83A 3G3MA 2GQ8A 3MI2A 5I3FA 5K9CA 3LLFA 2EAWA 4IJBA 4P2VA 1ME9A 2J9YA 1K03A 2AAMA 5D2WA 3NL2A 5FEZA 4NJJA 3KVLA 5J5RA 2X1SA 3MI3A 4M7SA 2NXGA 1MEIA 3LHWA 3QSRA 3DFNA 3MYPA 4RXGA 3FA5A 4PCFA 2VC6A 1YXYA 1H63A 3G3DA 1D9EA 1RD5A 5DCDA 5U7SA 2E6DA 3G18A 2FPYA 4R7JA 1TTJA 3S5OA 3VNDA 5D38A 4K7VA 2R94A 1TPDA 4Y90A 4FF7A 3ELFA 1A5BA 3G1SA 4ZZ9A 2ZRZA 3M47A 1G4SA 4E2DA 2E5DA 3MJYA 5D33A 3M5YA 3UPWA 1FCQA 4FX8A 4GC4A 2NX1A 3DU0A 4CQAA 4JY8A 3BVJA 5D2VA 4HNVA 2ZZ2A 3W2NA 1ZAIA 2YDAA 4O0ZA 1XBZA 2ZYFA 4RXFA 3NQDA 3N14A 3KXQA 4BWLC 4ZL1A 3HB9A 3SIZA 1GVSA 3M0ZA 1H5YA 2NWSA 5AN7A 5D03A 1PHQA 3LBCA 1LBMA 3CQ0A 4O12A 1PIIA 1TRDA 1QPRA 3EWWA 1UUMA 1RPXA 2NXIA 2FB3A 2YGYA 1HL2A 5K9DA 4XQ6A 1NVMA 3NGJA 1XBYA 2ZRYA 4LVFA 4DBEA 3E9AA 5HUPA 3N34A 3G1AA 1KV5A 5FF7A 1WA3A 1PV8A 3G24A 4PODA 4ML9A 3W74A 1MXSA 4FB7A 3Q94A 2CLLA 3DHDA 1OG0A 4RX0A 1ICPA 3HG3A 4NX5A 3DH7A 3BG3A 3NG3A 5AYXA 5AHLA 5F2GA 1QAPA 1ICQA 4PA8A 2PRHA 4MJZA 1Q6OA 4GBUA 2Y7EA 2PURA 4AHQA 2ALDA 4PL1A 3O15A 3BLIA 4UMCA 3M41A 4KWWA 1VGAA 4IMCA 3BW2A 3PULA 3TR2A 4ZQNA 1LZOA 2WSRA 3W1LA 2G5WA 3LHZA 2A7NA 1VYRA 2E6YA 1VYPX 2C16A 5LGZA 2C1HA 2J88A 1F73A 1TTQA 3QF0A 3QW3A 5DN1A 3HG5A 3TQVA 4QAIA 5LNRA 4LT9A 1F2JA 4LVAA 1TV8A 3NQMA 4IXXA 3A22A 3M44A 3LOTA 4O1DA 2NZLA 1G4EA 3TJXA 3LRLA 1TQJA 3BPWA 1SFJA 3GDLA 4MY1A 1VH7A 1F74A 2BTMA 6TIMA 1K7EA 4U4MA 4Z08A 2IQTA 4UFKA 3B0PA 3MBFA 4NZFA 1TPB1 1ZY9A 1PHWA 4BFAA 3GDKA 4LNYA 4NT0A 2VEMA 1FX6A 2CFFA 2X16A 3QQ1A 1KM3A 1OJXA 4D2JA 4NJGA 2TSYA 3NQVA 4MYXA 3W7IA 4LWWA 2F84A 1N8FA 4IWWA 3FLUA 2HMCA 2Y6ZA 2C3ZA 4R53A 3B03A 3EWZA 3L0NA 3NPVA 3W1MA 1LTDA 4JEQA 1TPWA 3CIWA 3W7LA 4JYFA 4LS1A 4JNMA 1FXPA 3W2LA 3CT7A 1L2UA 4Z1CA 1HTIA 3BGGA 2ATMA 3S5ZA 1HO4A 3NDOA 3DKJA 3DFOA 1AMKA 1UUOA 2X1UA 5DBUA 4O19A 1FDYA 3W07A 3W71A 3L66A 3HQ1A 1OHLA 2FJKA 4M7TA 4NJHA 4H6KA 1TCDA 5C55A 3CEPA 1DJNA 3C61A 2ZDRA 1VZWA 1OFQA 4RV8A 3FKRA 1EP2A 3KHJA 3QJAA 4PC8A 1KTNA 3GXTA 1WOAA 3INPA 4DQWA 3LI1A 3LLDA 3QM3A 4Z1BA 3TSMA 4TX9A 3C8FA 2CZFA 1LROA 4O52A 3L67A 4MKNA 3DAQA 5BMWA 3C56A 3TXVA 2JGQA 1AL7A 3UD6A 3LDVA 1JCXA 3LRKA 4JTIA 1YDNA 3E12A 3O6DA 1S5VA 4JX5A 1LRNA 4IMGA 1XBXA 1HFBA 3A9IA 3TIMA 5EKYA 4KWVA 3N9RA 4LS0A 3NQCA 2JBMA 4ORMA 2Y7GA 4FXSA 4CCEA 2NLIA 4FNRA 4UTUA 3O6YX 1O4UA 1IXPA 5IBXC 4O10A 1YLVA 2CLOA 1VCVA 1F7BA 2V2HA 4JX6A 3G1FA 3MHUA 1SSGA 2QCFA 2XFWA 2VFHA 2C6QA 3OIXA 2A6LA 1DKWA 1W56A 4JYDA 3TSBA 4DF1A 4B5NA 4LV9A 1GT8A 1TYGA 3PM6A 4OQVA 2H3DA 1Q3NA 3VE9A 1PE1A 4MFEA 3WJZA 2YZRA 3UWVA 4OE7A 1KLYA 4POCA 1W3IA 4K36A 1EB3A 1O5KA 3NZRA 3I7RA 5LKYA 2YXGA 3NL6A 3NQFA 3I7SA 3QPZA 4GRSA 4UTJA 1G69A 3TFXA 1G67A 4O8RA 1KFLA 1X1OA 1L6WA 1TPVA 3W75A 5BRBA 1JRCA 4TMBA 4N9BA 2E6AA 3TV8A 3CHVA 4A2RA 3U6WA 1WAUA 3W83A 1EWEA 2J9XA 4IUOA 3TAOA 3GR7A 4LV4A 2P1FA 2A5HA 4YMZA 5CSRA 3M1ZA 5F4SA 2YCEA 1LP6A 2ZZ6A 2DJXA 3GK0A 3PG8A 4JTTA 5I3GA 3HG2A 4WY0B 4IPJA 2GOUA 3ANYA 3S5NA 3G1YA 2GUUA 3PG9A 1YDVA 4MVAA 4ZQCA 1EX5A 1MO0A 2QF7A 2DORA 2E1DA 3N9SA 5AYZA 2QJGA 1JUEA 2E68A 4Q4KA 4KKXA 4WY0A 3RMJA 1GYLA 1U5JA 3NM3A 1M7PA 1KFJA 4U28A 4WY0F 5G5IA 3KRUA 1QDSA 3S1UA 3I6RA 2XN0A 2QCEA 4QISA 2NX3A 4OT7A 3WJSA 4MZ1A 1Z41A 3R13A 2EF9A 4N4PA 3EEGA 1W5MA 3DFQA 3USBA 3W72A 1T0OA 1ZENA 1K02A 1S5TA 2CLIA 2JK2A 4GUJA 3MHGA 1GJPA 1OFAA 3GAKA 1FWTA 2GJNA 1EWDA 1IF2A 3M16A 5I3IA 1R2SA 2V8ZA 5DLCA 4UR8A 3GNNA 1XM3A 3IRDA 4ZQRA 2J9ZA 3VE7A 4O4WA 3IVSA 5AB3A 4BK9A 4OHQA 4JTUA 1RVGA 1C8VA 4ORIA 3OVPA 2PRLA 3TMLA 2KZHA 4AF0B 2P10A 3P62A 4KFOA 1QFEA 5D02A 1P0KA 4O0KA 2R8WA 3I68A 3R8RA 3UNDA 1OFOA 4OU1A 1ALDA 2OT1A 4R34A 1KM2A 4AF0A 3W7DA 1VJIA 3NPUA 3TNOA 3ZWTA 3I7QA 2HTMA 5D2XA 4BI7A 1TREA 2G96A 5F2MA 4UTMA 1F05A 1FWWA 5HULA 2QCDB 3GZ3A 4LVDA 1FBAA 5EBUA 3LTPA 2RKXA 5I3KA 2DZUA 4UFLA 4AB4A 4O4VA 3C52A 2QCDA 1SU5A 1QOPA 5EL1A 3W9ZA 3W7RA 4GJ1A 3PUOA 5D04C 4JTLA 2XN1A 3QQ0A 3UWZA 5BNKA 3SJ3A 6ALDA 4MUZA 2TYSA 2OMAA 4Z1DA 1I8JA 2VFEA 1QPNA 3C2RA 1WOBA 3LCWA 5C5YA 2ISVA 2WJZA 3L2IA 3GX9A 5L9FA 3O06A 1JCNA 5CSSA 1L6YA 5ABTA 2BWGA 2D73A 2Z1BA 2VELA 5DELA 5FF0A 1LOQA 3B8DA 4FEZA 1GVFA 1LYXA 5TIMA 2B7PA 3N2XA 3NPWA 2C0AA 3SGZA 1VRDA 4HPXA 1CX9A 5CZSA 3S8HA 1FCVA 3W1AA 3LTYA 2B7OA 3L5MA 3GVGA 5TQLA 4X9SA 3HBLA 5H91A 3F4WA 4N9DA 5K2ZA 3A5VA 4NQ1A 2QUUA 2BZNA 3TDFA 5DXXA 1OX4B 5K4ZA 2O7QA 4X22A 3T40A 3LRMA 4UFHA 2TMDA 4Z1AA 1YTDA 4JIQA 3VI2A 4LVBA 1AW2A 2Y85A 2ATSA 1SZGA 2RH9A 1GVOA 1OX4A 1I2PA 1TQXA 3EX1A 1YXCA 3BLEA 3IIVA 3W7HA 4XTDA 3UY7A 1B3OA 4O16A 3FS2A 5HJLA 3KRZA 2FPTA 4ZQMA 5H2ZA 3IGXA 2XN2A 1FUYA 2A85A 5C54A 2YFNA 5DBTA 3ABOA 4XBKA 1W31A 4M6PA 3TFCA 3L0KA 3MUXA 3W7JA 4RLIA 2ZRUA 2QCNA 3DBPA 1SUXA 5MHBA 3MP5A 4O1BA 4ONVA 4TR9A 3L68A 3YPIA 4K39A 3OHIA 3UY8A 1LM1A 2A1YA 3W76A 4MJMA 1FWRA 1Y0EA 4WXYA 2P0OA 1NFBA 1TPH1 3FOKA 3NEVA 2YPIA 1IGSA 1KFKA 2ABBA 4NXSA 4GUIA 3IGSA 2J6XA 3BW4A 4CQ9A 1SO3A 3LXBA 1WXJA 5FF3A 3TSDA 2FFCA 3NQAA 3LM7A 3Q37A 4HNUA 1JCMP 2J24A 3S42A 4LC8A 2RDWA 1I45A 7TIMA 3WJXA 4JTEA 2Z0IA 3W7KA 1LBLA 1R47A 1KA9F 1JUBA 4N2YA 1T96A 2ZRXA 3ATYA 2TRSA 1DVJA 3QMSA 3PBVA 3FYOA 3W7GA 1SW3A 4YWIA 4QNEA 2DZTA 1TPUA 1DL3A 3TMQA 4JGDA 1ZNNA 1T8XA 1JCJA 2QUTA 5G4EA 3UPBA 4Y8FA 2CLMA 3W70A 1NAL1 3D0CA 1MEWA 4BF9A 4PTNA 4LTSA 3QC3A 3UYCA 2QCHA 3NQ2A 4XWUA 1RR2A 3MMTA 4N6FA 4TMCA 1M7OA 2G97A 4O18A 1EA0A 3R5EA 3NXFA 3W2KA 3EKLA 2ISWA 1JQXA 3HGJA 5D2YA 3NAVA 3KOFA 2QCCA 3THAA 4UCGA 1YXDA 3O05A 3BG9A 2E5BA 4DPPA 3DFTA 4Q32A 3SR7A 1VR6A 2ZFAA 3EWUA 3P5YA 4ZQOA 1TV5A 3W7MA 4LC6A 2QUVA 3LTSA 4LUIA 3IVUA 2A4AA 3EXSA 2W6RA 3BGJA 1ZAHA 3GXNA 4N9CA 3MWAA 4NNCA 1W3TA 4XZ9A 2EKCA 3G0UA 1ZALA 2ZRVA 3NOEA 5D2TA 3IIZA 1BTMA 5KSWA 5FI8A 3ABSA 1WBJA 2OX1A 1DOSA 3G0SA 3L65A 3EXTA 4O11A 3B0VC 4A22A 2E5CA 4UTKA 2NV2A 4O14A 2B4GA 5AC7A 1JCLA 2WOQA 1ICSA 3W1TA 5KZDA 1KW1A 3ZS4A 3P81A 4UR7A 3UWUA 3WK0A 3NM1A 4JTSA 4UTHA 3THQA 5G1YA 1W37A 4DPQA 4Y96A 4IGHA 1VQTA 3R89A 3GAYA 1G4PA 1SSDA 5AHMA 4X3ZA 4BR1A 4WX2A 4S1FA 5DCBA 1P1XA 1KFEA 1A5CA 5HWNA 2RFGA 1R2TA 4IMDA 1S3HA 3C3NA 4XTIA 1SZEA 1OK6A 3G1VA 2QJIA 2ZA3A 2QJHA 4O13A 1THFD 1G7UA 1M5WA 2NUYA 3IEBA 2QKFA 3CLMA 2FIQA 4UTWA 1GQNA 1DHPA 4JTHA 3N3MA 2Q8ZA 2VFFA 4JDBA 2QAFA 4DO6A 3IGUA 2QAPA 3TAKA 1W3NA 3B04A 4H4IA 3WK1A 1GG0A 3HJZA 4BI5A 1KLZA 5K4XA 4FXRA 4ADUA 3NNTA 1XDLA 1H62A 5KINA 3CB8A 3TCEA 1J5TA 4GNJA 5G2HA 5IM51 2H3BA 2F7FA 2ZRWA 1A5AA 1RZMA 3UZ5A 3CU2A 1K8YA 8TIMA 3TKFA 3KFTA 2CZEA 1JUKA 3GDRA 4A3UA 3M5ZA 2W0UA 5AHEA 1WX0A 4IOTA 1Z44A 1JVNA 2PRMA 2ZZ5A 3VKJA 4Q33A 1W5OA 4UNKA 3GDTA 4LVGA 2CLFA 5F1VA 3HIJA 5A8GA 4M6VA 4WD0A 2GQ9A 3NVTA 2JGYA 3O6CA 3TE9A 2CLHA 1GOXA 3SSJA 4RKAA 2ABAA 3I65A 5U4NA 1GTHA 1R2RA 5AHIA 4EIVA 2WKJA 3W1PA 3NQ6A 1TPEA 4MY8A 4JR5A 1O60A 2DZXA 2FQIA 1KV8A 1Q6QA 3W23A 1YPFA 4LU0A 3IIPA 3QYQA 1SQ7A 5CZJA 3DFPA 3FFSA 4S2BA 1GPWA 4ALDA 4N4QA 4LY8A 2O7SA 1ME7A 3NL5A 3NPXA 2A21A 2VXNA 4HIBA 3W7PA 1QPOA 1TTIA 2V9DA 1IIHA 2J27A 3MI6A 4LUJA 2GPTA 3HO8A 4EF8A 2GVJA 2ZZ7A 3QEZA 4CQ8A 3R12A 3PUDA 2CZDA 2VEKA 1SO5A 1QO5A 2R91A 4NUWA 4OV4A 4EF9A 1W54A 3SZ8A 5CZ0A 3FJ6A 1PL9A 4CLMA 4DEFA 2I14A 1H7OA 4AAJA 2H8XA 3V75A 1TJRA 2FTPA 1O94A 3A23A 3P84A 3P61A 1FWSA 4RK8A 4OWGA 5K9XA 4UTTA 5CG7A 1W5NA 4A2SA 5D30A 3W1UA 4TIMA 4PL2A 4JX4A 3SW6A 2AGKA 1N7KA 5EY5A 1LDCA 5AYYA 3Q58A 1P5BA 1NF7A 3BW3A 1WV2A 4CNOA 1RV8A 4AWSA 1F5ZA 2HS8A 4L4MA 4NJKA 1KBJA 1A53A 1K3UA 3PB2A 4JTFA 5EA9A 3KAOA 3PBUA 1H7XA 3S6DA 2ZBTA 2YW4A 4J9JA 4Y9AA 4GE8A 3EWXA 1E51A 1H50A 1SFLA 3S5YA 2FB2A 1VLIA 1C29A 1P4CA 2VEPA 4LOCA 2Z2UA 1WQ5A 3HGSA 4JY9A 2H8ZA 5BOOA 4WZHA 3A24A 2QEZA 3MYOA 5I3JA 3C2EA 4M5PA 2YYTA 1T99A 4EOUA 1K7FA 3LBMA 3TC7A 3B4UA 3UZJA 3PAJA 1XKYA 3M5XA 1S5WA 3LHYA 2Q3RA 3TROA 4GXMA 1I2QA 1VC4A 1MSSA 5L6UA 3C2VA 2V82A 4O15A 5T26A 3C6CA 4HKPA 2E09A 4AMAA 4CNNA 1OFRA 3NL3A 4HNNA 3UWYA 4G1KA 3PWAA 1ZHAA 1D3GA 1X8FA 4DELA 1SPQA 3T4CA 3FIGA 4JS3A 4UC5A 3LB0A 3TA6A 5FEXA 3W84A 1XC4A 3W22A 1J4EA 3HG4A 1RQEA 3M6YA 3C2OA 1X7FA 3M9YA 5E1QA 3FEMA 3TJLA 4WQ6A 2LLEA 4MOZA 2E77A 3TQKA 4IMEA 1KBIA 2YX0A 5D09A 3M5VA 5CPLA 3HF3A 3C0JA 3IVTA 1EUAA 3LERA 2DZSA 2Y62A 1GG1A 3TX9A 3T44A 3U2OA 1VYSX 2Y7FA 5LZLA 4RZ4A 3G0XA 4HN4A 3G1HA 1TO3A 3EWBX 3GLCA 3CM4A 4TO8A 2NXHA 1Z48A 3B05A 1KTBA 5CPNA 3EX2A 2YW3A 4WUIA 4N6EA 3DKLA 5HNRA 2RDUA 4NNAA 4XUGA 4WOQA 2GQAA 3GR8A 4LRSA 5CZTA 3GDMA 1OYCA 3PY2A 4JD4A 1WDWA 3CWOX 1JQVA 3W1RA 1PVNA 4K7YA 2RDTA 2DZWA 1FWNA 2A7RA 1KFBA 4GWEA 1ME8A 1V5XA 3P74A 4N9EA 4DO5A 3QPYA 5CPMA 2ZZ1A 5CKSA 1YADA 2X30A 4UMAA 4S2CA 1VHNA 4UTTC 4O54A 2C19A 1R46A 2BX7A 1H7RA 5F2LA 2FLIA 1H7WA 4YLWA 1XFBA 5LHFA 5I3HA 2WV8A 4UUIA 4TU1A 3W7CA 1UB3A 4DF0A 3HMJG 4QIUA 4C1LA 3SECA 4IX0A 3L5LA 3H53A 5DY2A 3TUUA 3UWQA 3W2UA 1VS1A 1ADOA 3LHTA 2V0TA 2QCGA 1K7XA 4MY9A 3W2MA 2X1TA 4K8HA 3LHUA 1SO4A 2DJLA 1TSIA 5LGXA 2C18A 4FNSA 3E96A 3PBWA 1W8SA 3Q2DA 3T78A 2NUXA 1O5XA 3STCA 4AH7A 3FKKA 1OVDA 2H6RA 3HGOA 5C2XA 2X1RA 1H1YA 5KTLA 4ADTA 1DORA 1XUUA 1JJKA 1P0NA 3T55A 4C1KA 2A2IA 4A21A 3QMRA 4XKYB 4HSNA 3W2JA 3DI1A 1XXXA 3WJWA 4DBDA 5LHEA 3MW7A 1MEHA 1GVQA 3LGEA 2B7QA 2ISSA 1W5PA 3EKZA 1SR9A 2V5BA 1YTKA 3PC0A 4R33A 4JTGA 3UQNA 3CEUA 3LV5A 3HPSA 3G22A 3PSVA 4Y6GA 3RLUA 4QJ1A 4XKYA 3TC6A 3QFEA 1QO2A 4O1CA 3QW4B 3W1NA 1OFPA 5D32A 3RFAA 3GXPA 1IXNA 1VHCA 4BI6A 5LNWA 2WSYA 2C14A 3O1NA 3OVQA 2YSWA 3LCHA 3MBDA 3UXDA 1I2NA 1D3HA 4NNBA 5LNSA 5AFDA 3FJLA 4GUGA 2ZTKA 3W6YA 1QOQA 3P67A 2RHGA 2BSLA 1G7VA 4PFMA 2I9EA 4E0CA 3NQ7A 3TQ0A 4UIOA 5FEWA 4AVFA 4UFIA 3TK7A 4IXHA 1YPIA 4MLRA 3S1WA 2OJPA 5HWJA 3ZWSA 4AHOA 3AO0A 1OFEA 5KITA 1L9WA 3G1DA 3PS7A 4LRTA 5HWMA 1KFCA 2UV8G 1OX5A 3CC1A 1EP3A 5D37A 5C6MA 2JKAA 1K8ZA 1LOSA 4MPQA 3W7NA 3GYEA 1PCKA 2NV1A 3QH2A 3PB0A 2C15A 4JDYA 3WK3A 1SW7A 2WO5A 4UFJA 2WPBA 1L6SA 3NO5A 1LBFA 1DJQA 1FDZA 5FF4A 1SO6A 5HUOA 4RZ6A 1G6CA 1X1ZA 4UTLA 2EGZA 2VFIA 5K7JA 4WXZA 2DZPA 3VFLA 4YXGA 2JKEA 2V2DA 3HOJA 3KX6A 3N73A 3T7VA 1W5QA 3LCGA 1A5SA 3UXAA 1RQBA 3LXCA 1KM6A 5F2IA 3EB2A 4P61A 4PEKA 4RZ5A 3W3OA 3ABRA 3O16A 3IIOA 3F4NA 5HQEA 4E2BA 1EPXA 3RNDA 4O1AA 2QCMA 3QZEA 5EYWA 2WNQA 2B7NA 2OT0A 4IPIA 2ZZ4A 2VFGA 3TU9A 2GVLA 1WYIA 1J2WA 1H60A 1AG1O 1A50A 3QSTA 1LORA 1LOLA 3E02A 1FQ0A 5CGQA 3KVKA 4GUFA 4GUHA 4JIPA 3WJYA 2VKZG 1VCGA 4FNUA 1AK5A 3OA3A 4H3DA 5K3VA 5AC6A 2NUWA 1ML1A 1F76A 1XBVA 5LNVA 5BW6A 2WSQA 4PH6A 3ABQA 4FX6M 4JTJA 1FY6A 3SY5A 2C13A 1LRQA 4RJEA 3OBKA 1JULA 3LV6A 1QMLA 3W86A 3F1QA 4N02A 3JRKA 4EVZA 2A0NA 5GVJA 4O28A 2EPHA 2BLEA 3L5AA 1GEQA 4HSOA 5AHFA 1V7YA 5IBXA 3EWYA 1G4TA 3NZ1A 3VCRA 5TBOA 3NQEA 2X2GA 2Z6JA 2PC4A 3TW7A 4FX7A 1I4NA 1W0MA 2DU2A 5J5DA 4YCPA 5G4WA 2PCQA 2DZVA 1FCBA 4JXCA 3HGRA 2Y61A 1TIMA 3K30A 3N2MA 3CIXA 2Q3OA 3O63A 4HT3A 3JR2A 3LCXA 1ZFJA 1JR1A 2OCZA 4DXVA 1AW5A 3QRHA 1XCFA 5CPOA 1H51A 2EHHA 5G1TA 3W7OA 4MFDA 4NU7A 4ZMGA 1LLZA 4K8EA 4QITA 1BWKA 4I7WA 1B57A 3BG5A 4MZ8A 1QR7A 3S1VA 1LCOA 2QDGA 3PBYA 4LS2A 3W1QA 3G1XA 2WQPA 4QNWA 1XUZA 4NVTA 1GWJA 2CW6A 5F4XA 4QM1A 4JN6A 3SFKA 5A5WA 1VCFA 5G2WA 2E6FA 3RU6A 1QCWA 1OF6A 1I2OA 3G8RA 3IV3A 1DQWA 3P60A 2ZTJA 3QMTA 4HNTA 1DBTA 4YL2A 3EX3A 1BKSA 4AHPA 3U8GA 3LCLA 1DQXA 1VPXA 2I1OA 5HR6A 3LCIA 4I7VA 1M6JA 4I9AA 3OG3A 4FNPA 1BWLA 3LX9A 3B06A 4CNPA 3NA8A 2NWRA 1R30A 3M43A 4DF2A 2QDHA 1ONRA 3SGUA 5AC8A 1TB3A 3W88A 1JCYA 3LHVA 1RQHA 2ZCGA 1H61A 1YDOA 2VFDA 2YFOA 1GYNA 2YYUA 2JKPA 1OFDA 1OF8A 4O57A 1XDMA 4MLJA 3MP4A 4MYAA 1DV7A 4CCCA 1YTEA 3N19B 3ZR4A 1Q45A 3C2FA 2VOMA 5KZEA 5AOUA 1QWGA 3TW6A 4DO4A 4W9TA 3HPXA 1W1ZA 1H1ZA 4NZJA 1X6UA 2OZ0A 3W73A 4XBSA 3BARA 3H54A 3P80A 2WNNA 5E93A 1NEYA 1QNVA 1TTPA 3DGRA 1EIXA 1B9BA 4IX2A 3WFAA 3JS3A 1AW1A 3KRSA 4O50A 1Z42A 3TXZA 5LSMA 3S9YA 4UTWC 3R2GA 3KVMA 2GJLA 4JYEA
chains in the Genus database with same CATH superfamily
2Y89A 4M81A 4XZWA 3BXWA 1J18A 2XFYA 4YIWA 3W27A 4Z0SA 4J40A 3WNOA 2FZNA 3AYTA 2OWWA 1JZ6A 2OZ3A 3RK8A 3VO0A 1Z6KA 3VIMA 1XDJA 3VMNA 4DN1A 1LWHA 4FZIA 4L1WA 1UYQA 4MZYA 1NF0A 2PDQA 4PUKA 1UHVA 4ZXLA 4PBGA 3A9BA 3VIFA 4UFMA 1REQB 2PDYA 2QHAA 2YIHA 5HINA 4QJ3B 1EP1A 4KBXA 1REQA 2PGEA 2CZ5A 3E0IA 4F3HA 1S5MA 4ZQPA 4M56A 5C9RA 5DY3A 4UXDA 1DXFA 2TPSA 2PZNA 1H09A 2YA2A 3CTLA 1CW2A 3LCFA 2PWVA 4NX0A 3GKAA 5JBDA 3AMKA 2ESCA 4O17A 3VXGA 3GU1A 1DWJM 4PUMA 3Q4DA 3BLFA 1XSJA 1IXOA 4X2RA 3NQGA 1PS9A 3CXOA 4B91A 5LXXA 2CWNA 4Z1YA 4A35A 1C93A 3P8IA 3TH6A 2ZUVA 3PWIA 4WOZA 4ICNA 2CLEA 3CASA 2ASHA 4LEFA 2CKSA 4L4LA 1SGJA 1TV7A 4OBTA 1FWBC 2V5LA 5AC5A 5FEPA 2PWHA 1KTCA 5HDRA 2V2CA 3DIPA 3SI9A 3EOEA 3STGA 3WBWA 3QLLA 4GBDA 3DENA 4LEQA 1E4NA 3GIYA 1B4KA 5JXQA 1E6ZA 4M19A 1IIGA 4O53A 1NU5A 5KZMA 2EBNA 4M1RA 5G1MA 3T0BA 4D6EA 3AHZA 2BOFX 2P3EA 3CMJA 4DNMA 5I6SA 1ZAJA 1CI1A 3WDQA 4BWLA 4DJFA 1S38A 2CU0A 4IF2A 3QXBA 4FIRA 1SR0A 5D05A 3UWWA 1RCOB 1NFPA 3NR0A 2V81A 2OWXA 5DXYA 1WZLA 1XL9A 2GVGA 2VWTA 2VENA 2W79A 4HPJA 4ZVJA 3V0UA 2Z7KA 3P0XA 3SCSA 3O3RA 3CQKA 1PKLA 2XM1A 1F6YA 4G9PA 5JU6A 4ADSA 2WJDA 1KQZA 1AMYA 3HPZA 1YIXA 5CPSA 5ABFB 2YXOA 2QULA 3H2OA 4UCFA 3I3DA 2QCLA 4MM1A 2AQWA 1VBHA 4YCOA 5HR7A 4CCDA 4UQBA 5ABFA 1RA0A 1KM5A 2PI6A 4GD0A 3FYPA 4JAWA 1JAEA 3KHDA 4K38A 2PU1A 3MCMA 2I7GA 4U3AA 4UTIA 4HTBA 1F6KA 2FZ9A 1CDGA 3VMPA 3GU9A 2CEQA 1MI3A 3BCFA 4MIMA 1U83A 3ONCA 5K9CA 1UMYA 3URNA 1ME9A 2J9YA 4YU1A 2AAMA 1ZTVA 5D2WA 4WGHA 1CXKA 4U31A 3UXLA 3KVLA 2X1SA 1I60A 3MI3A 1BD0A 4JL1A 4PCFA 1MDRA 3RN6A 3WNNA 3G5EA 3P14A 1D9EA 3PJUA 1S1RA 2FPYA 3EGJA 3BDKA 1KCLA 2OSXA 4RDWA 3EOLA 3EBVA 4ZEPA 1TPDA 4Y90A 4FF7A 1FP8A 2A79A 3ELFA 4FLSA 5A6SA 4H83A 3RIKA 3MJYA 4OIFA 2NX1A 2W63A 4ES4A 2YDQA 4JN7A 4PMNA 4XK2A 3BVJA 4HNVA 2ZZ2A 3N6JA 2VGGA 3ZJKA 1PZ0A 3OYZA 3ISIX 2YDAA 3GTHA 4O0ZA 1IT8A 2ZYFA 1ZBVA 3N14A 5A6LA 2QJJA 1CGVA 4BWLC 1LG2A 3M0ZA 3CYJA 4H8HA 4L64A 2NWSA 2D2OA 3T0CA 1LBMA 3CQ0A 4O12A 1QPRA 4L1XA 4CU6A 2V69A 3T1GA 1KR0A 1V3JA 3CLWA 3ZYZA 3NGJA 4YTQA 1EGMA 4K2SA 4DBEA 1ZBCA 1NQ6A 3RX2A 3G1AA 5FF7A 1WA3A 3VOJA 3TN4A 3W74A 1MXSA 3G6MA 4HCHA 3O0FA 3UG5A 2MUCA 3KOXA 4WDUA 3NG3A 5AHLA 4DXXA 3TTEA 3XISA 1ICQA 3HFYA 4NL1A 1Q6OA 2Y7EA 2PURA 4DVOA 3KLLA 3IK2A 3ID7A 2P8BA 3BSMA 4RNIA 3M41A 3SUTA 3U4AA 4KWWA 4IMCA 5CAHA 3N9KA 1GORA 3VVGA 3TR2A 1P0EA 4B5TA 2D0HA 2P5NA 3P0WA 1VYRA 2E6YA 2C16A 2OQLA 1TTQA 1V03A 3QF0A 3MJMA 3TQVA 3MUAA 4HOXA 5LNRA 4J28A 3VNJA 3M44A 4GJIA 2Z1SA 3LRLA 1JPHA 1TQJA 5EMYA 4V15A 2HROA 3CUFA 1DJYA 3V5FA 1F74A 3DHUA 4PULA 6TIMA 2IQTA 3C0QA 4C6BA 2DIEA 3B0PA 3HQPA 4BFAA 2QNEA 1A80A 3NUKA 2W66A 2DW7A 3A64A 2D20A 2CFFA 2X16A 3AISA 3QQ1A 4L6DA 4D2JA 2QGHA 2TSYA 3PJXA 1TJ2A 4MYXA 3XINA 1Q2SA 4AY8A 4LWWA 2XH4A 3R10A 1JPKA 1VFTA 5H8MA 1PJ9A 3EWZA 2EG8A 1FHDA 3KLKA 4CNUA 3CIWA 4DWDA 3KS5A 2GSJA 4L7ZA 2CHOA 3CT7A 1BQGA 5F7UA 1CIUA 3S5ZA 3ZR6A 1JF6A 1YMYA 3NDOA 1PDYA 1K9EA 1UUOA 1FDYA 5HOSA 3W07A 3HQ1A 3GXIA 3R43A 1JGIA 3AS2A 1XISA 2Z25A 3AS3A 2J13A 5FJTA 4JZ5A 1TCDA 3DX5A 4GOAA 2BASA 3VD7A 1VZWA 1OFQA 4RV8A 5CXPA 3FKRA 3KHJA 3V36A 1XF0A 1OT1A 4K1WA 1UZDA 2XDFA 4TX9A 2CZFA 3GTFA 1LT7A 2DUZA 2YDRA 3K8KA 1H5VA 3WF2A 4Z2KA 3TXVA 1DWHM 3E12A 5CBBA 4ZO9A 1CZ1A 1XBXA 2G37A 4DHGA 4W86A 2WMHA 4F2BA 3NGFA 5FIPA 3H4GA 4QEEA 1J93A 3LSBA 5HJXA 2BNJA 2O9TA 3WUFA 1XINA 4E8DA 1HT6A 4ROQA 1O4UA 1FH9A 4O10A 2CLOA 5TF0A 1VCVA 2V2HA 4JX6A 3G1FA 3MHUA 2QCFA 1OGSA 4MF4A 1DKWA 5HJYA 3T8LA 4LV9A 1GT8A 1V6WA 2WWCA 1EJTC 3WNLA 2BDQA 1Q3NA 1XPYA 3VE9A 3WLHA 4QCFA 1B5TA 2DZBA 4OE7A 4JL2A 1W3IA 1DE6A 1EB3A 1RCXB 1O5KA 3NZRA 1U1HA 2QDEA 1LG1A 3POCA 3I7SA 3WDJA 1JEZA 3BMXA 1KFLA 4XB3A 3H2AA 3AIBA 3TV8A 3R94A 5CPTA 2W92A 3T42A 2P1FA 2OOFA 1DWAM 4L61A 1LP6A 3SRHA 4HU4A 5I3GA 3WD3A 3WH5A 4MNMA 4Z2LA 3W25A 4ZQCA 2MNRA 1UJQA 2QJGA 3ZO9A 2E68A 4Q4KA 3D47A 5FJOA 2Z1WA 4U5KA 5CBIA 4DY1A 5BWFA 2CC0A 4HU3A 1QT1A 3N2OA 1W5MA 4X9YA 3RHGA 2QIWA 2CLIA 1CXFA 3AS1A 3MHGA 1XIDA 1EWDA 3RU8X 5I3IA 4UR8A 2QYGA 1OZQA 5I00A 2JF7A 4AC1X 3VE7A 3IVSA 5C8BB 5HNUA 5AB3A 2OLHA 4JTUA 3L7RA 4GIEA 2PRLA 2KZHA 3CYVA 1FOBA 5IXEA 1R87A 3TJIA 3SY1A 1UKPA 1E0UA 1ALDA 1JZ7A 4C6FA 4AW7A 1VJIA 3T6CA 4AZCB 3AQUA 5HMDA 4BI7A 2G96A 2WAGA 4UTMA 2PU0A 1UWUA 5A6JA 3A4AA 3IJ6A 4LVDA 3JUGA 2J4GA 4AZCA 1FBAA 3VIJA 3TYDA 4E2VA 3LTPA 3T05A 4DUVA 3KCOA 2WCSA 1EGZA 1SU5A 3GE7A 2C79A 5D04C 3CB3A 2DQWA 5BNKA 4B90A 1Q6FA 3M7SA 4DM1A 4MUZA 5A3HA 3A3HA 3C2RA 3LCWA 5C5YA 2ISVA 2X2YA 4U5IA 1XLGA 4F0KA 4BQ2A 2PTXA 2BWGA 4ERIA 2D73A 2QPUA 1G0CA 3U4FA 2FGBA 2VELA 3RRAA 3F5LA 3E2VA 3GU2A 3NPWA 2C0AA 1VRDA 4HPXA 1VENA 3O7UA 1FCVA 1K4HA 3AUJA 1KCXA 2G3MA 4QEHA 4EPDC 3F4WA 4N9DA 1F3WA 4V1YA 2DUAA 4KRTA 3GNXA 2BZNA 4CGTA 4Z2JA 2O7QA 4X22A 3T40A 3LRMA 1PSCA 1E6QM 4LVBA 3U57A 1OCQA 5EMLA 1GVOA 3WKZA 3BUVA 1Q7QA 3ITXA 3W7HA 3EOSA 3FS2A 3KRZA 2WLYA 1QK2A 4WR3A 2DT2A 3WNKA 1DJHA 1W31A 1E6RA 2ZRUA 5A2BA 3A13A 5MHBA 2NQJA 2EPKX 3ANVA 3MP5A 4O1BA 3CAQA 1WUEA 4ONVA 2WNWA 3L68A 1GOOA 3LGDA 1LM1A 2A1YA 3OBEA 4W85A 4HB7A 3FOKA 1BF2A 3UCQA 4CNTA 1IGSA 2ABBA 3IGSA 3BW4A 1E0TA 3VNLA 2PDKA 2FFCA 2X1IA 3LM7A 3Q37A 1JCMP 3UCDA 2J24A 3S42A 4LC8A 2QLYA 4D6DA 1Q8AA 3WJXA 1X1NA 3W7KA 1XSKA 2PF0A 1KA9F 1NY1A 2VO5A 4YHEA 3ITOA 3NXLA 3QMSA 4MKVA 1HVQA 5I24A 2DZTA 2Z1KA 2WZEA 3VDBA 5G4EA 3H8AA 5HMEA 3GC4A 3PZMA 2CBJA 4JKKA 3NZGA 4LTSA 4PUNA 3EB4A 4UNIA 4AX7A 3UYCA 2QCHA 4GG9A 4N6FA 1XIFA 1M7OA 4O18A 3SURA 3KZSA 3EKLA 2A3HA 1EC9A 2BGQA 3SCRA 2WMIB 2VR4A 4S3KA 3HGJA 4BA0A 5D2YA 4HU8A 3KOFA 4M3PA 2W61A 3BSGA 1BSIA 3UG3A 1CCWB 2WMIA 3H6OA 4DPPA 3DFHA 3SR7A 1VR6A 1Y5WA 3FHQA 3EWUA 1Z32X 1CGWA 3G2GA 3P5YA 1GW1A 3VILA 3PFRA 4IMAA 3UW6A 4M80A 1C3FA 1TUXA 3JZUA 3WNPA 1GOWA 1EJ7L 3GXNA 4N9CA 4FXJA 4NNCA 1B3WA 1NWRA 5LA2A 1OCJA 1ZALA 3NOEA 5D9NA 5D2TA 4A3QA 1HW6A 4R88A 2NQ5A 1E9YB 2R82A 3WQOA 4EWJA 4CCZA 1WBJA 2DIKA 4DWSD 4O11A 4QBXA 1AQFA 2B31A 1GONA 4A22A 4G7EB 2NV2A 1JCLA 2J7HA 3OBAA 1ICSA 3W1TA 5CPQA 2J7FA 3QV6A 4RNJA 2O0TA 1RBLA 3P81A 3SDOA 3VU2A 3NM1A 4G7EA 4UTHA 5HMFA 4YHGA 5G1YA 1L6GA 5A8OA 1W37A 2DPEA 4Y96A 1VQTA 4Y7EA 3UT0A 1XX1A 2Y0FA 1US2A 1S1PA 4S1FA 3GHRA 2AKZA 3MPGA 1N8IA 4WF7A 1FRBA 2QJIA 2ZA3A 1THFD 3SCTA 1M5WA 2NUYA 3IEBA 3F7JA 1XR2A 4HZ7A 2QKFA 4K3ZA 4UTWA 1ZLPA 1DHPA 3A4WA 2Q8ZA 4JDBA 4JQ4A 4DO6A 2YCLB 3WK1A 1GG0A 3EPNA 3HJZA 1TR1A 2VX7A 4BI5A 5K4XA 3ZQ9A 1X97A 1UD3A 3UNTA 4B3KA 4W5ZA 2YCLA 3TYZA 3TCEA 1UR0A 4LNCA 5ABHA 2H3BA 6XIAA 3R25A 1R0MA 1RD6A 1Q5MA 3UZ5A 1XS2A 1ZL1A 3TKFA 3MQTA 3GDRA 3M5ZA 1DIOA 1Z8AA 1KD0A 1OG6A 2IKIA 3HPAA 4UNKA 3WG6A 1V79A 4LCSA 4GXWA 1AJ2A 3PPGA 1NWSA 2VX5A 3WD1A 2WVTA 3EOUA 3O6CA 4RKAA 3I65A 1J12A 4RW3A 4Y9NA 1R2RA 3NQ6A 1WO2A 4DRSA 5GJNA 1TPEA 1IYXA 3BQ6A 2D23A 2DZXA 2ZX5A 2PDUA 3W29A 3OQEA 1KV8A 3W23A 4EXAA 3QYQA 1SQ7A 3H7UA 2NQZA 3FFSA 4S2BA 1RAKA 1RH9A 1PYFA 4LY8A 3NL5A 2XFFA 2VXNA 3DYPA 1QPOA 2XVPA 1TTIA 1OINA 1IIHA 2J7CA 3MI6A 2GPTA 1GVIA 1J01A 1GGOA 2YCIX 3PUDA 1M01A 4S3DA 2VEKA 4Y9OA 1W54A 5I79A 5CZ0A 1OD8A 3GDBA 5E0CA 3KBJA 5J04A 4AAJA 2H8XA 3V75A 3W6MA 1PX4A 3ARRA 4G56A 2VVSA 4EP8C 3RLGA 3ZZ1A 2VYOA 3K4DA 2ACRA 3HZ3A 1RK5A 4G5DA 2PTZA 4KT2A 4JX4A 2VCCA 1PAMA 2AGKA 4LB4A 1QPKA 1MUMA 1C8XA 3URBA 3BW3A 4MAVA 1POJA 4A3RA 1RV8A 4NJKA 4JTCA 3LPGA 2YBTA 1FWAC 3PBUA 1XH0A 2D2GA 1GK8A 2ZBTA 3PPHA 3GS6A 4GACA 4W7WA 1CGTA 3EWXA 1D3CA 1H50A 3S5YA 3W00A 1P4CA 4URIA 3KEHA 2Z2UA 2XYLA 4A8NA 3HGSA 3G6LA 1Q6CA 3C2EA 2PEVA 4HZ8A 1DE5A 1EHAA 5JBEA 3SRFA 4H41A 1PTGA 3GNOA 3B4UA 3UZJA 4U2ZA 3LHYA 2WZMA 3TROA 3VFCA 4LQ1A 5T26A 3V16A 5HANA 5BXSA 2IQDA 2VDGA 2XWDA 1ZBKA 3PWAA 1D3GA 1X8FA 5AZ0A 2OELA 4DJDC 3N04A 3TA6A 4HCLA 3BAKA 3VKKA 4K68A 4YTRA 4A8IA 5CC7A 4PBFA 3KZPA 5DF0A 3M9YA 4Y9MA 5E1QA 3FEMA 2LLEA 5LIXX 2E77A 4Y8EA 4IMEA 2J75A 2VI0A 5CZKA 2YX0A 3VA8A 3E0WA 3GR4A 2OU4A 2OVLA 3LERA 3TX9A 3T44A 5JH2A 3U2OA 2P88A 2YA1A 2Y7FA 3RCYA 4RZ4A 3G0XA 4LBSA 3EWBX 3M46A 1ISWA 5I0DA 4TO8A 2NXHA 1FH8A 3B05A 1A4LA 2VRKA 5E0FA 1KTBA 3PTQA 5A94A 4WUIA 3DKLA 5HNRA 2RDUA 4B9YA 4LRSA 2R1MA 1J0JA 4QTGA 4GI4A 4JD4A 4NILA 4UQCA 1Z7AA 2RGMA 3LG3A 3WLNA 1BVNP 7A3HA 2A7RA 3P74A 3IUDA 1B3ZA 4W7VA 1XIJA 4D8ZA 1F3EA 2C19A 3APYA 1H3GA 5B7YA 2Y24A 4Q8VA 1PYMA 5DMLA 4ZR8A 3UZXA 3RX4A 3ECQA 4QDWA 3F2BA 3OOQA 4TU1A 4NP7A 3AU2A 4H9VA 4C1NB 1UZHA 3WBAA 4INFA 4C1LA 2W9MA 2Q8XA 2DT1A 2V0TA 3ARWA 1UH3A 3VGGA 2BOEX 1JDEA 4C1NA 2X1TA 3E0FA 3FHAA 3LHUA 3IJ8A 3BL3A 4H04A 2OEMA 4FNSA 5A8NA 1P6WA 1HKIA 1W8SA 1LL7A 3R0KA 3H7VA 4AH7A 1EDGA 1OVDA 4J4KA 1TX0A 4ADTA 1XP3A 1XUUA 4C7GA 1BRLB 4GKTA 7TAAA 4X0VA 5D9PA 3CV6A 1AD4A 2X05A 4E4FA 1UIPA 1BRLA 2NT1A 2ISSA 2FH6A 4MWAE 4P7LA 4D6HA 1SR9A 3UQNA 3CEUA 3TC6A 3HPSA 3RLUA 4HN8A 3KOYA 3QFEA 1J10A 2C8NA 3QW4B 1IXNA 1VHCA 4M8UA 3TN6A 1IT0A 4B92A 1W9XA 1TZZA 1SFSA 2HEJA 1D3HA 4P7NA 2QQ6A 2ALRA 4NNBA 5LNSA 5T9BG 4LYKA 2ZC1A 4IGNA 1VP5A 3W6YA 5DQPA 4NKCA 4WRHA 4ATWA 5IDIA 4PFMA 2I9EA 4WDWA 5FEWA 4AVFA 1B2YA 3WD4A 4MLRA 2IQ0A 5D4YA 4M1BA 2J7GA 2OJPA 5HWJA 3KTCA 3M0MA 3G1DA 1WDPA 3I10A 4QP0A 3PZ9A 3UJRA 1K70A 1IQ8A 2GVEA 5HWMA 5EFDA 2L5HA 1VFMA 2G41A 2J79A 1HVXA 1EP3A 2C0HA 4D71A 2JKAA 4ASTA 4G6CA 4O1FA 1KRCC 3GWQA 1PCKA 2NV1A 3QH2A 3PB0A 2WO5A 2WPBA 1LBFA 4QE1A 3RO6A 4PSPA 2CZVA 1EJVC 1E0VA 1G6CA 1X1ZA 3W01A 4WXZA 3VFLA 5LYRA 2JKEA 3KX6A 4RUBA 2WXDM 1KM6A 5F2IA 3IJ9A 4P61A 3ZT7A 1E4LA 3W3OA 5BROA 4DZ5A 1KBLA 4H01A 4LXFA 4XKMA 3LUTA 2QCMA 2V5CA 1HZYA 3FSUA 3I6TA 1JNEA 3DBNA 3M0IA 4IZGA 3C0SA 2XH2A 2OT0A 4PMUA 2ZZ4A 4WSHA 3QV7A 5AC4A 1W9VA 1A50A 2FVKA 1LORA 2RAGA 3E02A 4Q8NA 3KVKA 4GUFA 2WZHA 4GUHA 3WJYA 2VKZG 4FNUA 3URQA 4H3DA 4RDZA 1ML1A 1F76A 1V7AA 4NZ5A 1VPQA 3VC6A 4FX6M 2NT0A 4F0RA 2C13A 3WO8A 4NRRA 3VD4A 5CJMA 4BEUA 1UZ4A 3F1QA 2GDQA 2A0NA 5GVJA 4WGXA 3PJTA 3CH0A 3L5AA 2XZ9A 5AHFA 2HDJA 1XCWA 4GVGA 4CN4A 3BQ5A 3EWYA 2WSPA 1G4TA 1B9ZA 1B90A 1GOMA 1SJCA 4RDYA 4D8LA 2X2GA 1RCQA 4FX7A 2VUNA 4XUYA 3AS0A 3UU0A 1W0MA 1E3ZA 4YCPA 5G4WA 3AIUA 5LIKX 4PGLA 4AIEA 1TIMA 1EL3A 4P7RA 2AQOA 1P6BA 3DUGA 3LBOA 3WQ6A 2PC8A 2GLKA 3K30A 3K1GA 5XIMA 3LCXA 4QJ5B 2OSYA 1JR1A 5EGRA 4DZAA 4C6QA 4HHHA 4HJFA 5IFTA 3ABZA 2RJGA 2WC4A 3W7OA 1A0CA 3PZTA 2VQTA 4XVDA 4I9TA 1W1TA 4F66A 1B57A 1QR7A 3WF0A 4JQ3A 2WQPA 1RJQA 3AYSA 3LYEA 2CW6A 3RM4A 1HX0A 3MO4A 4QM1A 4DUOA 5G2WA 4AIUA 4AYSA 1C7TA 1JL8A 4XD4A 3MB9A 4YL2A 3AXHA 4CEUC 3DGBA 1QI5A 3N13A 1A3HA 1DQXA 1EO7A 1QI3A 3LQGA 3P93A 4QLJA 1NARA 1EBGA 1XLAA 3FVMA 4I9AA 2ZWZA 1RY0A 2G0WA 1TE6A 3TP4A 5IHSA 4DF2A 1AQ0A 1PWMA 3N17A 3W88A 4DWSB 3LHVA 2PGRA 2ZCGA 1H61A 4Q4RA 2YYUA 1GKQA 4O57A 4XVEA 4IFRA 5IDZA 3I6EA 3WEMA 2Z1XA 4Q8UA 1C92A 2VOMA 3WF3A 1QVBA 3VD9A 4GZ7A 1EQPA 2ZIDA 1J0HA 3KP1A 3V5CA 3OZOA 5FOOA 1KBKA 3W73A 1CXEA 3P80A 2WNNA 1BVWA 4CQBA 1NEYA 1EIXA 2OEKA 5BRQA 1AW1A 1AZ1A 3S9YA 4K8GA 3R2GA 3S47A 2GJLA 4W87A 1JYXA 3VIHA 3PF3A 5HXMA 1HJUA 2D0GA 1X96A 2H90A 4JTRA 1H7NA 1PZ2A 3IJQA 4YTSA 5SWUA 2YR1A 3DI0A 2WMJA 1ZCOA 1TPFA 1YKWA 2CITA 2FZMA 2E0PA 3DHFA 3S2NA 4R5EA 1KFWA 3MUY1 4MTVA 2OQHA 1XD0A 5F4WA 4ACYA 1AH3A 1XI3A 2QR6A 3WUBA 5C7HA 1R3VA 3ZT6A 1VFUA 1UCWA 2WB5A 2ZC8A 2Y7DA 4BS0A 3WUEA 4PRRA 3M7WA 1H1NA 2A7PA 4F79A 1UJPA 4WCJA 4ACZA 2Y70A 2ZZ3A 1JXJA 3GO2A 3ATZA 3SY8A 1IHIA 3DFSA 3P7YA 3OYXA 2W4XA 2Z1VA 4NHVA 4AEOA 2XWEA 3WNMA 1W3HA 1JZ5A 3W28A 2FFIA 1MQRA 5B80A 3FSTA 4HYRA 1LLWA 2XIQA 3WBYA 4XD3A 1HG3A 2OKTA 2CERA 4O1EA 3H2EA 1TPC1 1TJPA 3KBSA 3C4UA 5DO8A 3RGTA 3VDCA 4EAYA 2Y88A 1HO1A 2BGNE 3M0XA 5A2AA 4IL0A 4FNTA 2MANA 1JIBA 2VZUA 4GIRA 1QPQA 3NSMA 3O8AA 3H55A 2ZQ0A 4PCSA 3W7EA 1UBSA 1TV2A 5F1UA 4D6CA 3NO1A 4XX6A 3RITA 2F6XA 4QSHA 2IPFA 1J0KA 3VKBA 3RX3A 4AD0A 4CD6A 3MHFA 4UMBA 2F38A 1D7KA 4MDPA 2V38A 3OODA 5CEWA 2PWUA 4DBSA 1K8XA 3EDEA 2Y8KA 3L0GA 1E1EA 5GJMA 5FAGA 1SZNA 3STFA 2OYMA 1QOXA 1WKYA 2CHNA 1F07A 2J62A 2KAUC 1YE4A 2HBVA 4R3UA 5FESA 1OYBA 2V30A 4XAGA 3NZPA 2ZXQA 3EX4A 4QQUA 1Y65A 2NX9A 4ILSA 1R8LA 4LF1A 2WW5A 3PR2A 1SW0A 1GVRA 3IIXA 3EDKA 1RLCL 3GY1A 3S2CA 6TAAA 4J7RA 3QTGA 1TVPA 5DCEA 3LN3A 5HNNA 1YYAA 5G2IA 4Q3MA 2INZA 3GH4A 1KM1A 4GO9A 2D24A 2Y4SA 4FO4A 4JICA 1C9DA 3AHVA 2C1GA 1GNXA 1T7LA 3P8JA 1WBHA 3IPWA 1HGWA 1A5UA 3B9DA 3DESA 3ZFHA 3KE0A 3WK2A 3WSUA 1FXQA 1AJ0A 4HHLA 5FF2A 5LNUA 3A5FA 3H23A 3L21A 3GD6A 2EPOA 2VWSA 5MF5A 4W7UA 4WJXA 2CIPA 4HHPA 5E09A 4ZXOA 1F8MA 2GQ8A 3MI2A 2EAWA 4UOQA 2XIMA 1ONWA 5J5RA 3E2SA 1TMLA 4L56A 3LHWA 3QSRA 4KRUA 3MYPA 1EJXC 1FWEC 1H63A 2PP1A 3N15A 5DCDA 5U7SA 4HP5A 1LL6A 4MKSA 1TTJA 3S5OA 2B81A 5FD0A 3SM0A 3PAOA 4PN2A 4RE0A 2ICSA 4K7VA 3OLIA 3TYUA 4IPNB 4B5WA 4DBWA 1NP0A 2ZRZA 1JYWA 4E2DA 2E5DA 4GC4A 4AMCA 1MNZA 5AYIA 4C6OA 1YHTA 4S3EA 4I8DA 1I6NA 1DJXA 1WCGA 4GLEA 3U9IA 4ZL1A 3SIZA 1LLOA 1EC7A 1GVSA 1H5YA 4JQ1A 4OVXA 3FGCA 4U10A 4GA8A 3VTRA 3LBCA 5DRCA 1QWKA 4PMOA 1UUMA 1RPXA 3I3EA 4C6DA 2NXIA 3WLKX 3VOGA 5K9DA 2WM1A 5I09A 4IHCA 5JQ9A 2ZRYA 4UQEA 3G24A 4E3VA 4ML9A 4FB7A 1XFCA 1OG0A 1XKJA 1S2TA 3IGHX 5JIWA 1JDAA 3HG3A 2WLZA 1NP2A 4DJEA 4DAFA 1QAPA 1L2QA 2HBXA 4DYEA 2PRHA 4H9TA 3UERA 1I0DA 3H22A 4GBUA 3NURA 1VAHA 4AHQA 2RDXA 3T2QA 2ALDA 3GHSA 1MUCA 3GVQA 4PR4A 3RLHA 1VGAA 1ZJHA 1VD6A 2BVTA 2OB3A 3SRKA 4GZIA 1GOQA 4CD5A 2C1IA 2G5WA 2A7NA 3IS4A 2OWCA 5LGZA 1VYPX 4DUXA 3QW3A 1MFUA 4QAIA 3MWCA 2GOKA 3L2MA 1TV8A 3A22A 3UXIA 3ERPA 3LOTA 1XYAA 2OO6A 3M4HA 4F48A 4GQ0A 4EAMA 1QHZA 2BG5A 4WKHA 4LAZA 3GDLA 4MY1A 1EC8A 1UBPC 3CHEA 1ECQA 4YYCA 3WQ5A 4UFKA 3HQNA 3CAVA 1ZY9A 3NCOA 4NT0A 4KGLA 2D2HA 1FX6A 1KM3A 1OJXA 1UROA 3CS2A 3EMQA 1B30A 3W7IA 2F84A 3WDPP 4ZSUA 4PMZA 1BPLB 4IFOA 2Y6ZA 3STPA 4NG3A 2ZVIA 4R53A 3B03A 3W1MA 4JEQA 1GHSA 1TPWA 4C6LA 3W7LA 5FSEC 4KEVA 4Q7NA 3W2LA 5C9ZA 2EQDA 4AWEA 4Z1CA 1FKWA 3PK7A 2ATMA 3DKJA 3DFOA 1GQIA 3W71A 2ZKMX 1OHLA 2FJKA 3VUSA 1U2YA 1J0IA 3KBWA 3MMWA 1S2WA 1KCKA 3CEPA 2WSKA 2PDFA 2ZDRA 4UTFA 1CGXA 3F2CA 3GXFA 2Z28A 2FGZA 1PTAA 2ZX9A 5C71A 1QUMA 4Z1BA 3C8FA 4MADA 1VKFA 2PWGA 1V08A 5FCZA 4DJEC 2EKGA 3DAQA 1AL7A 1JCXA 4UR9A 1CWYA 3O6DA 4B3ZA 2KX9A 3BOFA 1OCBA 1PIGA 3QKZA 5EKYA 1HJQA 3NQCA 2Y7GA 2NLIA 4FNRA 1TG7A 1DP0A 1HKWA 3THUA 1XIMA 3U3HA 1IXPA 5IBXC 1YLVA 3NO3A 4ZA0A 1RALA 2XFWA 2A6LA 5C9UA 2BOGX 1E70M 2YBUA 3BV7A 3PM6A 4I8YA 4OQVA 3WJZA 2HISA 2DY3A 5FJRA 4HA1A 1TV4A 5LIYX 4V28A 1H0GA 1OBAA 3BGAA 1W9BM 2J66A 3A3XA 4KS0A 4DJFD 2YXGA 1QJWA 1T41A 2PB1A 3NL6A 3POHA 4JFWA 4MHBA 4UTJA 1EYWA 1G69A 2OXNA 1G67A 1X1OA 4KEUA 3VD3A 3TTSA 2PZ0A 4V1XA 2E6AA 3IK4A 3CHVA 2VGFA 4A2RA 3U6WA 1WAUA 3W83A 2I56A 1EWEA 2J9XA 2A5HA 1MYRA 2FHFA 5F4SA 3E0LA 2YCJA 3TTQA 2DJXA 2Z00A 1Q63A 4JTTA 2P50A 4W93A 1JZ2A 3R11A 1QW8A 3QR3A 3H2NA 4IPJA 2BMBA 3G1YA 4WVXA 1YDVA 2QF7A 1MO0A 1BYAA 1ITXA 2DORA 1JUEA 3AXIA 3M0HA 1GYLA 3F4VA 1GEHA 1KFJA 4U28A 4C91A 1QDSA 1TVNA 4KGJA 4QISA 3WJSA 2R1KA 4F9JA 2EF9A 1JF5A 3USBA 1UZ1A 4MWAB 4OBSA 3M6DA 3W72A 1T0OA 1ZENA 1NOUA 1S5TA 3G1RA 4GUJA 3W26A 1FWTA 1W2VA 2GJNA 1V02E 3CWHA 3M16A 3HV9A 4J2PA 4MWAA 5HQMA 3GNNA 1XM3A 1YDYA 2ZOXA 4Q4MA 2J9ZA 3WF1A 5I03A 4B5VA 5C9XA 4AF0B 2P10A 3II1A 1IEQA 4KFOA 2OLSA 4O0KA 3AC0A 3SCQA 4I5RA 3UNDA 4FF5A 1OFOA 4S39A 4TVUA 3WX7A 4AF0A 4EXQA 4MB1A 1TREA 2G4JA 4PE8A 1GQKA 3VZZA 1M41A 4DUWA 2OQYA 1CECA 1UD4A 4KCVA 1J11A 1RJPA 3RMEA 3LZ5A 1V0KA 5BU9A 4RZBA 2IMRA 1J96A 1R3WA 2RKXA 4AB4A 3RILA 3C52A 5TAOA 4AY7A 1T5AA 3W7RA 4L9ZA 4GJ1A 4IIBA 5DMMA 1P0DA 1CENA 6ALDA 2O9PA 2TYSA 2EG7A 2OMAA 4Z1DA 2J8TA 1I8JA 4JTAA 3VDGA 1WOBA 2WJZA 3L2IA 2J7DA 1DJWA 1LWIA 5CSSA 3N4AA 1V51A 1VEPA 1US0A 2ZXAA 4JKMA 5FF0A 3R6IA 3H4WA 4FEZA 1GVFA 1IEXA 2B7PA 3N2XA 2HCVA 3TOYA 4GPNA 3S8HA 4OZOA 5HPCA 2B7OA 2YA0A 5TQLA 3HBLA 3CUIA 1EOKA 5K2ZA 3LLXA 2PWEA 2VR2A 5K4ZA 3V0TA 1EZ2A 1YTDA 4JFSA 3M0VA 3VI2A 1FWGC 1EJUC 3EX1A 2OODA 3UGVA 6ENLA 4ECLA 5HJLA 2XN2A 3S1GA 5C54A 4UWMA 5DBTA 2ZVRA 2ISFA 3ABOA 4XBKA 3A4XA 1DIKA 3L0KA 4IFKB 4J3SA 2QCNA 3GHTA 1D8CA 3OJGA 1JXKA 3KOWA 4QR6A 4IFKA 4MWAC 2BY2A 3OP2A 3AWOA 4K39A 2Q71A 3H26A 1V0MA 1UIOA 4YVVA 3U2CA 1ELSA 5DRIA 1Y0EA 3L4UA 2P0OA 3MCOA 3NEVA 1KFKA 4EANA 3AFBA 1UR2A 1WXJA 4I90A 4ZO8A 3MC5A 3TSDA 4G7FA 2X7VA 3NQAA 1JYNA 4HNUA 2G3FA 3K46A 7TIMA 1ECEA 2WHJA 1LBLA 4IJRA 3RM8A 2W5FA 5I02A 1JUBA 4IIHA 2ZRXA 1IT7A 4L9YA 4GINA 2TRSA 4XAPA 2DEPA 1TWDA 1TPUA 1DL3A 5M3WA 5C70A 1ZNNA 2GFTA 1T8XA 1JCJA 3UPBA 5CBJA 2CLMA 3W70A 3CHCA 5C7VA 4MB5A 4BF9A 3QC3A 4HMNA 1IWPA 1RR2A 4IISA 4TMCA 1GOIA 1TVLA 2QF8A 1RY8A 3UG4A 1FA2A 4IIGA 2YLAA 4HU0A 4J35A 3GG7A 3NAVA 3SAZA 4RPQA 4HZMA 1XYCA 3O05A 1JDFA 2E5BA 4W88A 4CQDA 3DFTA 2R1NA 5AVNA 5H6HA 3ZVIA 3QY8A 3MV01 3WQWA 2JQXA 3NEHA 3W7MA 1CLKA 3BMWA 4LC6A 2QUVA 1HL8A 2OZ8A 3LTSA 4LUIA 5D8WA 2VVNA 3W0KA 2W6RA 4IQEA 1G5AA 3VPLA 4XZHA 1W3TA 2EKCA 3ENLA 1VFFA 5A8PA 2GK1A 3CIVA 3FNDA 1BTMA 3DYMA 4Q4SA 1YNYA 5I78A 3G0SA 1BYDA 4MJ2A 4Q22A 1QRQA 2X8RA 1F3TA 4QG6A 3M0JA 5AY7A 4O14A 4DYKA 3CZJA 4GY1A 5KZDA 1KW1A 1K9TA 1ZJAA 4UR7A 1B31A 3WK0A 3PZGA 4HYVA 3H24A 2IXVA 1JDDA 3THQA 4IGHA 3R89A 3GAYA 3M0LA 1UUQA 5AHMA 2QV5A 4BR1A 3WD0A 5DCBA 1P1XA 1GKPA 3NIYA 2Y8UA 1KFEA 5HWNA 4XG1A 1S3HA 3H7RA 2PDNA 3UZYA 4KIRA 1SMDA 1JAKA 1OK6A 3G1VA 4IM4A 2CCRA 1KGUA 4XIAA 2E8ZA 3ARTA 2POZA 1PWLA 4KWUA 4ZSTA 3N3MA 2PUZA 3NSXA 5TNVA 4AD4A 2PA6A 2QAFA 1O1HA 4H4IA 3TN3A 3OU8A 4GQQA 4I9JA 1EH9A 3OIHA 2ZX8A 3ITCA 3MY9A 4B4HA 4NZ4A 3UA4A 5KINA 5G2HA 2V63A 3MSRA 4TV6A 2FVMA 5IM51 2ZRWA 1A5AA 1RZMA 1FFRA 3N6QA 1K8YA 8TIMA 6XIMA 1WDRA 3KFTA 1XICA 4E4PA 4D6IA 1EJSC 1DWFM 5A6AA 1JVNA 3QC0A 3VKJA 3K4AA 4Q33A 3WZ0E 3T09A 5F1VA 2CLFA 2GJRA 3T2PA 3QHOA 1DPMA 3NJ3A 4WD0A 4AZ6A 2GQ9A 2WCAA 3MU7A 1XG3A 4AXNA 2CLHA 3WL1A 2ABAA 5U4NA 4KH2A 1CNVA 1XLDA 4J3VA 3KUMA 2E9MA 4F0MA 4S3JA 1S39A 2DV0A 4LYRA 1YPXA 1V3MA 2BY3A 1KR1A 3GQYA 1YPFA 1J5SA 3IIPA 4GVFA 1GPWA 4N4QA 3C3UA 2A21A 1HKKA 2GGGA 2V9DA 1Q4NX 3BWWA 2G4FA 3HO8A 4EF8A 1C90A 4MG4A 3QZAA 1VIWA 3PZUA 3A47A 2CZDA 1QO5A 3RJYA 4RNHA 5CLTA 3WLMA 3SZ8A 3USZA 1P6CA 2OOGA 1RP9A 3GXMA 3FJ6A 1PL9A 4B15A 3WBEA 2I5QA 4KEZA 4DEFA 3NSNA 3TYAA 1TJRA 2FTPA 1O94A 3A23A 3P61A 3A3WA 7CGTA 2WVUA 3VGDA 4RK8A 4OWGA 1PX8A 5K9XA 1S46A 2GWNA 4LAKA 1RK6A 4UTTA 4B5XA 4A2SA 5D30A 3PPFA 4TIMA 3HN3A 2OZTA 4PL2A 3SW6A 1I9CB 4S23A 3VGBA 1N7KA 5EY5A 7REQB 1NF7A 1WV2A 4CNOA 2AOSA 5PTDA 3QY7A 1A53A 1TFVA 1T8QA 3LMZA 4B16A 4BQ5A 1TWZA 1DTNA 1H7XA 3BAWA 2YW4A 8RUCA 3BAYA 2HQAA 3OG2A 3WQFA 2FB2A 1C29A 2VEPA 4LOCA 4IP7A 1DJZA 5CGMA 1HJVA 5BOOA 1V0NA 2OO0A 3MYOA 5DT7A 1H0IA 5H1WA 1AZ2A 1E56A 1G1YA 3L4WA 1K7FA 3LBMA 3TC7A 2BVDA 4HMCA 3M5XA 1S5WA 4M24A 1J0ZA 4BZYA 3C2VA 4KETA 2V82A 4TVCA 1OCNA 4AMAA 4ERGA 1OFRA 4LUSA 1GQLA 1ZP4A 1QU4A 2FGLA 4G1KA 3UWYA 3SO7A 3T4CA 2ZUNA 1BXNA 3FIGA 3LB0A 2CBUA 5XIAA 2QV4A 3W84A 1XC4A 3W22A 1J4EA 4F8XA 1RQEA 3WDHA 2IW0A 1IZCA 3C2OA 3TJLA 4LUYA 4MOZA 4OFCA 3A6OA 3ZIZA 3M5VA 1AA1B 5CPLA 3VZYA 2UY3A 4JTDA 2VNCA 1S2VA 1BLIA 4CU7A 1KXVA 3AZTA 3G1HA 1XCXA 1U33A 2HWGA 2G50A 1TJ0A 1FHUA 3LA4A 1M03A 4OTKA 2YW3A 2V5DA 1CGYA 3B40A 1C8YA 4NAEA 3AXKA 3H70A 4LF2A 3UJFA 3GR8A 5CZTA 3THCA 3GDMA 3O6AA 4TX6A 1EBHA 4JIRA 1E40A 3CWOX 1MQQA 3U2EA 3SCPA 4K7YA 4HNCA 1HP4A 4M29A 5CCZA 1WB0A 2XM2A 4RE3A 4GNKB 4JNZA 2ZZ1A 5CPMA 1QI4A 2NVAA 4UTTC 4O54A 1TIWA 4HA4A 4AYGA 1XRFA 5F2LA 4TQTA 1XFBA 5LHFA 3JU2A 3QV9A 5J8LA 5I3HA 3MUIA 2BHZA 1Q7MA 5FL0A 5KZ6A 2V67A 3WFLA 4DF0A 3HMJG 1Q8JA 4LCRA 4QIUA 2EXOA 4IX0A 3ABXA 3TUUA 4GK8A 4RE4A 1PKNA 1NQKA 1PDZA 1R6WA 2E1WA 4K8HA 4E5TA 3WYZA 1SO4A 1AQMA 2DJLA 3HTWA 1TSIA 2VD9A 2C18A 3RAOA 3E96A 1F3XA 1EPVA 3Q2DA 5HBFA 5D9OA 1Q4WA 5C2XA 2X1RA 2DZAA 4P5UA 1VEMA 3GNRA 4AC7C 3TLLA 1UKOA 4WSKA 4GY0A 5I2UA 1VBUA 4C1KA 2JE8A 1U5VA 1UR3M 3DI1A 3LGEA 1GVQA 2B7QA 1W5PA 3EKZA 3AALA 3CPUA 2Z26A 4FLRA 4YTTA 3PC0A 4R33A 4OKDA 1VFOA 3OZMA 4Y6GA 3ZM8A 1GVYA 1QO2A 1Y8BA 2BHYA 3W1NA 1OFPA 3RFAA 2A3EA 2WHMA 1VFHA 2WSYA 2C14A 3KCJA 3CQJA 2G3IA 2X42A 3LCHA 3MBDA 1I2NA 3VAVA 1K9FA 3FJLA 4Q4OA 2UY5A 4DLMA 1TWIA 1QOQA 1EIBA 2PDXA 2BSLA 4IGMA 4UIOA 3PP7A 5JUVA 1UWRA 3TK7A 1ZJBA 2BODX 4IXHA 4DO7A 4ICCX 3S1WA 3ZWSA 4AHOA 2J47A 4HMDA 3T08A 3B0YA 3PS7A 4LRTA 4BJHA 2E7FA 4BQ3A 5FL1A 5ABGA 1UR1A 1XPGA 1XIEA 1J0YA 3CC1A 3GTIA 5C6MA 1HJXA 2DSVA 1OT2A 2BS9A 4MB3A 1XLMA 1E1FA 3L12A 2C15A 3NOYA 4JDYA 4H7CA 2ZX6A 4U2YA 4KERA 2DVXA 2Z2BA 1NTHA 5HUOA 2YKKA 1E71M 2EGZA 5K7JA 5EBAA 2DZPA 4YXGA 1TMQA 3SQSA 2V2DA 3QR0A 3T7VA 1JG9A 2E9BA 3LXCA 2OGJA 3FEQA 1WP6A 3EB2A 4R27A 1XIHA 3F4NA 2A3CA 5D8ZA 3UJSA 3KTXA 3QZEA 3UF9A 3GH5A 3GM8A 2WNQA 2B7NA 4F0LA 2NQLA 2VFGA 2PPGA 1BWVA 1WYIA 4PYSA 3HV8A 3QSTA 1LOLA 1IWAA 5CGQA 1O6IA 1QXLA 3KBMA 1R85A 1XBVA 4LB3A 5BW6A 2WSQA 1FY6A 1LRQA 4S3GA 1XLIA 4IIDA 2W62A 4C6EA 4N02A 3JRKA 2Q09A 1UQZA 4US5A 4G2DA 3MVIA 2OG9A 2ZUTA 1O12A 1GEQA 1EXBA 3OGSA 1V7YA 1XQLA 3AJ7A 4GIYA 4XZIA 3VCRA 3UR2A 2PC4A 1KXHA 1I4NA 3N12A 5AKQA 4LALA 1TUFA 1FCBA 1VBRA 2Y61A 3TWAA 3GG1A 2Y2WA 5BXPA 3CQIA 1HGYA 3CIXA 3JR2A 1ZFJA 2OCZA 1KBBA 2OTDA 3HPFA 4MFDA 4K8EA 2XUCA 4I7WA 5DMYA 3BG5A 3S1VA 2QDGA 4LS2A 3W1QA 5A6MA 2DDXA 3GW3A 2AAAA 4W89A 1XUZA 2INEA 1A5OC 4WIWA 3HQOA 3EMCA 1IZJA 2PTYA 3RU6A 1OF6A 1I2OA 1PTDA 2EPMX 3G8RA 3TW9A 1DQWA 3P60A 2ZTJA 4KEMA 4A8LA 4XZLX 3HURA 8XIAA 1BKSA 3U8GA 1EFZA 1OB0A 1VPXA 2I1OA 7PTDA 3WH7A 1Y5XA 2X0SA 3LCIA 4I7VA 2HE8A 3OG3A 1BWLA 3DG6A 3HA1A 3ZOAA 1TE1A 2XZ7A 3NTYA 1ONEA 3M43A 3WMSA 1ONRA 4A8RA 3SQMA 4CU8A 5AYBA 2VEGA 4GI9A 3VKAA 1RQHA 3EKGA 1YDOA 2VFDA 1GYNA 1X6NA 1KGWA 3R79A 3U5YA 3MP4A 1V02A 4MYAA 5ABEA 1DV7A 3W24A 3GRIA 3QZ6A 3AMCA 3N19B 4GZEA 5I77A 3C2FA 2P76A 5AOUA 2ZWYA 2XISA 1Q6GA 3HPXA 2F9RA 3GYCA 4AZ5A 5I7GA 4DX3A 1ZSXA 3S2MA 3GTNA 2WPGA 4HTYA 3B9EA 2OZ0A 3AZRA 4L5ZA 3ARPA 1C9WA 1UP0A 4IQJA 1ZQ5A 4XBSA 3WQ8A 1Z9AA 3H54A 3WFAA 1B9BA 4BKNA 3TXZA 1XHGA 5LSMA 4A3YA 5H8UA 3U7VA 3AAMA 1UWAA 4S38A 2YLLA 3KVMA 3TIMA 4JYEA 1GOKA 1UC5A 4JHMA 2REQB 1KNWA 1H7PA 1CB7B 1JRBA 4OGZA 1FWFC 4IMFA 2REQA 4X60A 1FWHC 5CGTA 1FCUA 1AJZA 1E43A 3W1XA 3RXZA 2PD9A 3HM7A 2WZIA 2YL9A 4XV0A 4H7ZA 4GI6A 2GUBA 4A29A 3RF9A 2WKLA 3P82A 1TX2A 1W8GA 3KVJA 4QQ3A 1WDQA 3GC2A 1OYAA 3GNDA 2C71A 4OV9A 1TMHA 2WHKA 4C60A 3DN5A 2A6NA 1S2UA 2PE4A 3EA2A 3LXAA 1K6AA 4YVPA 4Q7BA 1OFBA 4PTWA 2G95A 4JTKA 1EEPA 1SMAA 1IEWA 1XLJA 3CV7A 1XGEA 1PXGA 1R3TA 2FDSA 5CQ1A 3EA1A 2Y63A 2BXVA 2VEIA 2F61A 2FZBA 3PUEA 4LY4A 2VZOA 3AROA 1XV8A 5E6YA 4E38A 4YVXA 4GYFA 3F03K 3BK0A 4FS9A 4I7UA 4YTUA 3GFXA 1XH2A 3RPMA 3EX6A 4Z2HA 2CBIA 1W9UA 5C9WA 2EG6A 4GGBA 1XLLA 1W1YA 4KFPA 4Y2WA 4V2XA 3MS8A 4H00A 3DZ1A 1PIFA 1XG4A 2ANUA 3KRBA 4REQB 1V6YA 4LCQA 2HPMA 3ZSSA 3FN9A 4REQA 2O4QA 3WQVA 4F2TA 3MP3A 3VK5A 3OB8A 1B4EA 2R14A 2ZXBA 5IOBA 3MA8A 5AHNA 3WQEA 1MUWA 1VFLA 5BMXA 1JZ8A 4AWTA 3GKFA 4BF7A 2IPJA 4XAZA 3QKEA 4GFSA 3P5ZA 3EB3A 5BWAA 1DHKA 2BY1A 2HK0A 1FDJA 1CPUA 3APTA 1OABA 4WJEA 3O07A 3SQLA 1L6FA 2XJ7A 1KM0A 5JH1A 4P8XA 1ZGDA 1C91A 4XO7A 3CQHA 3DYOA 3OVRA 3WLTA 3W81A 3AJXA 1N55A 2FPVA 1MVYA 4H6EA 1DJGA 3E49A 4QE4A 4L6OA 1HIZA 3PSWA 3ICJA 1KM4A 4AVOA 1HN1A 4H6RA 1ONXA 4FIQA 2VOTA 5T91A 4E2OA 2HSAA 3CPRA 4GX8A 2GQ3A 3NYZA 4PCTA 3WH8A 4M6QA 2NW0A 1E73M 6A3HA 2PDHA 5KMYA 4JHOA 1EA9C 4UNLA 1J9YA 3PVFA 1ZPTA 2VD8A 4FNQA 4JIIX 2Z6IA 1F6PA 3DECA 4LH8A 1I2RA 1UASA 2ZA2A 2WNZA 3EWCA 1B3VA 3W7QA 5CH9A 3G8EA 3V7PA 5A69A 3TTYA 3VNMA 3LEPA 3TYEA 4GYJA 3ITLA 3GNPA 5IRPA 3BOXA 3B0UX 1HNYA 3BLPX 5FA5A 8A3HA 3LLFA 4IT1A 4HPHA 4IJBA 1A5MC 3NL2A 2J74A 2QZRA 4NJJA 4GVHA 8XIMA 3KDOA 4M7SA 1MEIA 4WHBA 3DFNA 3VM5A 2VC6A 1DIEA 1JPMA 1YXYA 5I06A 1L0PA 3S2LA 2W67A 1P1MA 2WJEA 4L9XA 2OEJA 3UWEA 3WMBA 2ODOA 3IJDA 4HYWA 3UG8A 3D3AA 3GFZA 2R94A 4HSHA 5BXTA 1V6TA 3OZPA 1RXOB 2AQVA 1E1CB 3G1SA 4ZZ9A 3M47A 1G4SA 2GZXA 1QASA 5D33A 2NQHA 1Q66A 3M5YA 3UPWA 4FX8A 4J27A 2D1ZA 2BV9A 1E1CA 1CYGA 1MRQA 4JY8A 3RCNA 1S3TC 4CD7A 4MUPA 3W2NA 1ZAIA 2CXEA 1UG6A 1XBZA 4MNLA 4EX4A 3NQDA 3KXQA 1EZWA 3WL0A 3HB9A 2O9OA 1M53A 1KRAC 2OLAA 3PTMA 5D03A 4JHZA 1PHQA 1R9YA 4K1GA 1PIIA 3MKVA 3EWWA 2FDMA 2V3GA 3GC5A 4GH3A 2YGYA 4XQ6A 1NVMA 2HNHA 3Q65A 1XBYA 1M7JA 3AMGA 4LVFA 4U33A 5HUPA 1PPIA 4LJ3A 1PV8A 2XVNA 2DSKA 5REQB 3SCVA 3Q94A 4RX0A 1KB3A 3OVGA 1J6PA 1LUCB 1PZ3A 2FHBA 3DH7A 1I0BA 5REQA 5AYXA 1G94A 2PDMA 3WENA 2IKGA 1LUCA 3K8MA 2QGYA 4R9XA 4PL1A 3VIPA 2TODA 3BLIA 1OGGA 4UMCA 1VPYA 4AD2A 1W6TA 3D5HA 1QNRA 4Q6JA 3UXKA 1OGBA 3TC3A 6CGTA 3UETA 4UZSA 1LZOA 1E6SM 3P6LA 4XBJA 3V4BA 3EYPA 3TYBA 1F2JA 4LVAA 3B3DA 4IXXA 1S2CA 3GUWA 5E5CA 3MKCA 9XIAA 4X63A 4JQAA 1SFJA 5A8MA 4ZBCA 5I23A 3AICA 1R9XA 2BTMA 2OSWA 3ZXWA 4XSLA 4U4MA 4Z08A 1VEOA 1E6NA 3QY6A 4NZFA 3MBFA 2WCGA 3FAWA 1PHWA 1CBGA 2VEMA 3BTNA 2DW6A 1ZRQA 4NJGA 4DAIA 4DM2A 3U48A 1GZ1A 3LU2A 1GZJA 1R3SA 1N8FA 4IWWA 2HMCA 2C3ZA 3L0NA 3BLOA 4JYFA 4LS1A 4X61A 1FXPA 4PMDA 1Y5VA 3N3TA 1L2UA 1HTIA 3BGGA 2AKMA 4E8CA 1MMFA 3ZJ8A 3CV2A 1AMKA 2R6OA 3WLQA 1F61A 4DJDA 3GHUA 2UBPC 1WZKA 2HVOA 1E72M 2CBVA 4H9UA 4GKLA 4H6KA 5C55A 1DJNA 1XLBA 4FP1A 3C61A 2ONEA 3QJAA 3H2FA 3GXTA 2RJHA 4CD4A 3INPA 4KESA 1J79A 5JMUA 3LI1A 4HD5A 3KWXA 3LLDA 2WYSA 1Z89A 3FVDA 3MUCA 3WLRA 1LROA 2FTWA 4W8LA 2DVTA 4GI8A 4O52A 2D22A 3L67A 2QDDA 2NQ9A 4MKNA 5BMWA 3C56A 4Q8MA 2JGQA 3K13A 5DX7A 3UD6A 4JX5A 1S5VA 1LRNA 4US6A 2QMJA 1TCMA 2CYGA 6REQB 3A9IA 3D3FA 4KWVA 3N9RA 4LS0A 4GC3A 2JBMA 4ORMA 1NDYA 4FXSA 2VURA 4C6JA 4CQCA 3O6YX 2O92A 3TONA 6REQA 3K4WA 1PEZA 1A5LC 1F7BA 2HRWA 4EPBC 4Q8PA 3I4KA 5C2CA 2C6QA 3OIXA 1W56A 2X0YA 4JYDA 3TSBA 3AUOA 1TYGA 2H3DA 1Q13A 4FR1A 4MFEA 2D2JA 3UWVA 1CXIA 4EE9A 1NDZA 1UPPA 1AUSL 4POCA 5CLWA 3GVWA 3K8LA 3I7RA 3W6LA 3NQFA 4GRSA 1O68A 4DZIA 3BSHA 4O8RA 3OHMB 2IKJA 1L6WA 1TPVA 3W75A 4GCAA 5BRBA 2PDJA 9XIMA 2DFAA 1G01A 2P0IA 3A12A 3TAOA 3FJNA 3GR7A 4LV4A 5CSRA 3M1ZA 2YCEA 3AWNA 3GK0A 3PG8A 3JW7A 4Q4QA 3HG2A 4ICMA 4WY0B 4XD5A 3BE7A 3DG7A 2JEQA 4S3FA 2PTWA 2ACUA 2GUUA 3PG9A 1V8EA 1EX5A 3BJFA 5AYZA 3FV9A 4KKXA 4WY0A 3N18A 3RMJA 1U5JA 1JI2A 4WY0F 5G5IA 3KRUA 1I1WA 1P0BA 4XZMX 3I6RA 2XN0A 1IGWA 4KMQA 7ODCA 4B2DA 2NX3A 2YCKX 4OT7A 2P8CA 1Z41A 2QVHA 1XYLA 2BB0A 1AH0A 5MKGB 3DFQA 3W38A 4AD5A 1FH7A 2I5IA 1OFAA 2PD5A 5KETA 3VCNA 3T9PA 3N2BA 5MKGA 1IF2A 5BOEA 5HPOA 5M03A 3ONBA 5DLCA 3XIMA 2HPIA 4CUCA 3LK6A 3IRDA 3MSYA 1PO9A 3TEVA 4O4WA 2E8YA 1PB0A 4QLLA 1GYMA 4J3TA 3LD5A 1HP5A 4BK9A 4D72A 4OHQA 3IRSA 3VOFA 1RVGA 3TMLA 3OVPA 4AEEA 2FH8A 3E6EA 4GGHA 5D02A 1P0KA 3I68A 4GCXA 1SYTA 1AVAA 4HNLA 2OT1A 2PGFA 4UQAA 3W7DA 3NPUA 3TNOA 3WMCA 3ZWTA 3I7QA 2HTMA 5D2XA 3LZ3A 1O1ZA 1AFSA 2ZUWA 2BVYA 3GZ3A 3DERA 1H41A 4JFUA 4JQ2A 5EBUA 4AX6A 1WAWA 2I5GA 1K8CA 5HATA 5I3KA 3P2VA 2BXYA 1US3A 2AGTA 1CXLA 1WNOA 3W9ZA 1EJRC 2E40A 2XFRA 3PUOA 1GVEA 1R7AA 1QBBA 2A3BA 1M1BA 2IKHA 3UWZA 1PKMA 4FOUA 5EMKA 3SJ3A 7XIMA 3UCCA 4L65A 3PZIA 2OFJA 4IL2A 2DUXA 3LMYA 1MXGA 2IUZA 2VFEA 3QFWA 3VCCA 3S83A 4AVNA 5L9FA 2V3EA 1JCNA 1L6YA 4GABA 1WZAA 1XJBA 1XLKA 2Z1BA 3AIWA 4F40A 1LOQA 3B8DA 1LYXA 5TIMA 2VC5A 3CUZA 3IV8A 1W91A 3B0XA 1C7SA 1CX9A 1KXQA 1ITQA 4Q8TA 1W1B1