3GDRA

Crystal structure of the d91n mutant of the orotidine 5'-monophosphate decarboxylase from saccharomyces cerevisiae
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
260
structure length
260
Chain Sequence
KATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFENRKFADIGNTVKLQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLATGEYTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Lyase
total genus 102
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3gdrA00
5CG7A 5C54A 3NQGA 1LTDA 3ANYA 3RLUA 1LBFA 3SY5A 1DKWA 3W7MA 1XUUA 3KRZA 3NQ7A 3C2FA 5A8GA 3EX1A 3QQ1A 3KX6A 1MXSA 2B7NA 1OFAA 2GQ9A 3I6RA 5G2WA 3TUUA 5EYWA 1TREA 1IXQA 2QUTA 2BZNA 3G8EA 3QPYA 3HPZA 1R30A 3KVJA 4FXSA 4KFPA 3AJXA 3BG9A 3IEBA 1XI3A 4HNVA 1QPQA 1VYPX 2H8XA 1ZHAA 3O07A 3INPA 3LM7A 3EKLA 2RH9A 4O0KA 1FUYA 1L9WA 5AC6A 2GPTA 2QJGA 3T40A 3LCFA 2PE4A 4EIVA 5KITA 2Z2UA 2J9XA 4QIUA 1T0OA 1VRDA 3L65A 3R13A 1EEPA 2QR6A 4UFLA 2C13A 2C19A 1H1YA 3PSVA 4N9EA 2VEMA 3NVTA 3UWZA 1BTMA 3LHTA 3C2OA 5ABTA 4QM1A 3W1LA 4DPQA 4K6AA 3Q37A 4GC4A 4Z0JA 4JXCA 3C2VA 4RZ6A 3W7DA 2J27A 4Y6GA 4ZL1A 3RFAA 1IF2A 3K30A 3PULA 1ZAHA 1C29A 3N73A 1O4UA 2E5DA 3HGOA 3A22A 4DO4A 1BEUA 3QM3A 4UTWC 2QDGA 3NDOA 3B4UA 3SSJA 1X8FA 2E09A 2V30A 4GJ1A 3E96A 3N9SA 4N2YA 2ZA2A 2DJXA 1DBTA 3L21A 3LCIA 3H53A 3I7QA 2YCEA 3M16A 3P5ZA 3UWVA 4JTIA 4PODA 3DXIA 4WOQA 3P8JA 5I3FA 2AAMA 1TYGA 4FNSA 1LORA 1KFKA 4ZQRA 4YCPA 3QJAA 2QUVA 3IGSA 5G4EA 1PE1A 4AHOA 2V5LA 2F7FA 3W7HA 2CLIA 4RK8A 4WX2A 3LHWA 2KZHA 4HHPA 2RKXA 4A2RA 5U4NA 2QCMA 3IIOA 1YDOA 3NZRA 1GYNA 4PA8A 1RPXA 1EPXA 5KSWA 4XUGA 2RFGA 5LHEA 5J5RA 1TPFA 2V2DA 4LW7A 4TIMA 4YCOA 1KTCA 2YW3A 2BLEA 1AW2A 1K8XA 2NUXA 4BI5A 4UCGA 5FEPA 2TSYA 2E77A 3HGSA 3ABQA 4IXHA 1Q6QA 1MSSA 2WNNA 3U2OA 3KRSA 4NX0A 1Y0EA 4EVZA 3N14A 3GIYA 3NQMA 2PCQA 5D2VA 5KMYA 4JX4A 3NAVA 2WNQA 1E51A 2C0AA 5FF0A 2VC6A 4MFDA 3LRKA 3PBVA 4GUIA 3HPSA 1FQ0A 1K8YA 5G5IA 1XBXA 2QCDA 3UPWA 1G4TA 4AHPA 2CLOA 3LCHA 1TPWA 1PIIA 3G8RA 4X9SA 5DBUA 1EUNA 3L67A 3QC3A 4ONVA 4ZQCA 4NJIA 1DORA 4NX5A 3W2KA 2EF9A 3CPRA 4YWIA 2R91A 4LVAA 5KZDA 4RV8A 1L2UA 4LV9A 2WO5A 3NQ8A 1NSJA 2RDUA 3TMLA 2CZFA 4JNMA 1JJKA 2C15A 1OX6A 2X1UA 4DELA 5AC7A 2Y7EA 3NL3A 3M47A 2QCCA 4LU0A 3B04A 3DH7A 5LGZA 1VR6A 4XQ6A 2GVJA 3QPZA 4IPJA 2J9YA 3B0PA 2ABAA 5E93A 1QR7A 3NG3A 4AVFA 3CLMA 4GRSA 4O4VA 4NT0A 1FCVA 3TXVA 2QDHA 4AF0A 2QAPA 2CLEA 3FEMA 3OEXA 3TW7A 3W7QA 4IPIA 2YFOA 4Q4KA 4CLMA 5CSRA 2YZRA 5D2XA 1H7PA 4LT9A 1JUBA 3UWYA 2VFHA 1ME9A 4A29A 2ZA3A 2O7QA 4JD4A 2A21A 1L6SA 2DORA 4UTLA 2NWRA 5DY3A 1PCWA 1GYLA 1WQ5A 3GAYA 2QCFA 3M5YA 3G0SA 1SZGA 5EY5A 4S1FA 2R8WA 2A4AA 3WK1A 4K7YA 2QEZA 2B7OA 1F2JA 5DXXA 1VC4A 4JTUA 2CU0A 4ALDA 2RHGA 4C1LA 3LHVA 3W83A 3UY7A 4E0CA 3EEGA 5K4XA 3MP3A 4JYFA 3IGUA 4O15A 2B7PA 1NVMA 1J5TA 3NOEA 1HFBA 2Y6ZA 2H6RA 4I7WA 2ISSA 3S6DA 1JUEA 2Z6IA 3LXAA 5C5YA 3BGJA 3TSDA 4OWGA 4A2SA 2Q8LA 1ONRA 2J24A 4X3ZA 3JRKA 3W7OA 4RXFA 2ZYFA 2CLLA 3NEVA 4UTMA 3G24A 2NUWA 1SQ7A 3W1MA 4YXGA 3SGZA 1PCKA 2XN2A 1W5NA 4K39A 4XTDA 4YMZA 4FNTA 1DV7A 2ZBTA 4FEZA 4QSHA 2YFNA 3UZJA 5HQEA 2UV8G 2NLIA 3MP5A 4MOZA 1ADOA 1SUXA 4QAIA 1EB3A 3P60A 5I3JA 3W1QA 1TTQA 4AWUA 4OE7A 1G6CA 4LVBA 2ATSA 3JR2A 5FI8A 1GVFA 3T44A 3ABSA 4PC8A 1H7OA 1A5CA 3CEPA 3TQKA 5EKYA 4CNOA 4PL2A 1OYCA 1FDZA 3DU0A 1I2RA 3KRUA 2C14A 3CC1A 1LROA 1R46A 4ADTA 3GAKA 5DBTA 4LUJA 3O06A 3L68A 3EX4A 3PB0A 4NZJA 2YDAA 1FCUA 4O4WA 1XBYA 1K3UA 2ZRXA 1TTIA 3HGRA 2V5BA 1RVGA 5D30A 4HPJA 4A22A 2E5CA 1F6PA 3GXNA 1JULA 2CLKA 2OMAA 1OFBA 2P10A 4XTIA 1JQVA 2NUYA 3EXSA 3QRHA 3OVPA 4FX6M 3T55A 3TMQA 4N6FA 3BK0A 4LWWA 1FDJA 1QMLA 1VQTA 2WQPA 2PRLA 4HIBA 4NJKA 3WK3A 2GVGA 3DHFA 4BR1A 1ZNNA 4KFOA 3L9CA 4Z1CA 3G1XA 1HO4A 1KTBA 4N4PA 2PRHA 1AK5A 1VZWA 2V9DA 5CPOA 4O1DA 2NX3A 1PVNA 2V82A 1UB3A 4LVFA 2E6DA 3QSTA 2B7QA 4UFHA 1B9BA 2FLIA 3P82A 3USBA 5HINA 2ZZ2A 2Y62A 1F76A 3A23A 3LRLA 3I65A 1UCWA 3ZFHA 3HQ1A 4JN6A 1F6KA 4BI6A 1CX9A 4E2DA 4R33A 3EWWA 1IXNA 4MY8A 1TV7A 2GJNA 1LLWA 3S1VA 3UD6A 5FEZA 3NPVA 5IBXC 1XDLA 1WAUA 3BW4A 1T99A 4GNJA 2Q8ZA 5D09A 1IXOA 4X2RA 1SZFA 2WNZA 1P4CA 1WXJA 1F7BA 1RQBA 2G95A 4K36A 1QWGA 4MPQA 1GEQA 3NQAA 1TV8A 4M19A 3MI6A 3LV6A 3NO5A 3R12A 3C3NA 2X30A 1EWDA 5BMXA 2FJKA 3FFSA 3FYPA 3GDKA 3HIJA 4QNWA 3IIZA 4NJHA 3W7EA 3W71A 1YTKA 2C16A 3LXBA 1KLZA 1L6YA 3HG5A 1P1XA 4MFEA 2B4GA 1GJPA 5LGXA 3QMRA 3C4UA 3LV5A 3TNOA 3SZ8A 1VCVA 4IMCA 4MYXA 2PC4A 2Y7GA 3GR7A 3DI0A 4R7JA 3M6YA 1A5BA 1L6WA 1TCDA 2GQ8A 4M6QA 3UWUA 2H3DA 4XKYB 3TSBA 1OX4B 3O1NA 3IVSA 3KFTA 3MYOA 5AYZA 5I3KA 2ABBA 4RLIA 2CZ5A 4MY1A 4RXGA 3EX2A 4UFKA 2DU2A 4N4QA 2V2HA 3Q94A 4OV9A 4H6KA 4TMBA 1XDMA 3FYOA 4ADUA 3NQCA 1TPB1 2W0UA 2Z6JA 2X2GA 4CCDA 5HUPA 4AH7A 1SPQA 5K2ZA 3JS3A 3BLEA 4JX5A 3GK0A 4JYDA 4QJ1A 1UASA 4WXYA 4AB4A 2ZZ5A 1CW2A 1W3TA 2XFWA 4MLRA 2A0NA 3UXDA 2CFFA 2OCZA 4FIRA 4LOCA 4DF1A 3TDFA 3NGJA 1SSGA 3TQ0A 3IIVA 1SZEA 4O54A 4P2VA 1SW3A 2VEKA 3UZ5A 1Z42A 1KLYA 4O10A 3LB0A 2G5WA 3EWZA 1X1ZA 2WSQA 1RR2A 1DJQA 1Z48A 2ZFAA 4JTHA 5CPMA 3HGJA 1GTHA 3R5EA 3TR2A 1OFQA 4O19A 1W8SA 1EWEA 4NJJA 2A7NA 2X1TA 3FIGA 3DHDA 2WSRA 4DF2A 3G1SA 5AHIA 2QUUA 4YL2A 4FNUA 3B06A 3FS2A 1GVQA 2FB3A 2CLHA 3MW7A 4Z08A 3LTPA 3IVTA 3L0KA 4GXMA 3I7SA 2F84A 4K8EA 4O14A 1OF6A 4HKPA 1GPWA 1WOBA 1HL2A 2R14A 4LS2A 1G69A 3SFKA 3P84A 4JX6A 1B3OA 3CIXA 5F1VA 2EAWA 3OVQA 4LS1A 5D02A 1VLIA 3G1AA 3OG3A 1MO0A 3G22A 2Y63A 1A50A 1TPVA 2HS8A 1JRCA 2VEIA 3KVLA 3QMSA 4M7TA 1OJXA 2YR1A 2AQWA 1ZCOA 3OVRA 4O28A 2DP3A 4Y8FA 4UR7A 3DGRA 5EBUA 1QO2A 1TMHA 2HTMA 4O52A 4MY9A 5FEXA 5H2ZA 3TSMA 1QFEA 1W1ZA 3EWYA 4KWWA 1YPFA 1I45A 1I2OA 3MI3A 1FX6A 4AWTA 1SR9A 3R89A 4I9AA 3BVJA 5F2LA 4HPXA 3DFSA 3DFNA 4LC6A 1K8ZA 4O57A 2YX0A 3STFA 5C55A 4UFJA 3VI2A 3UWWA 2A1YA 4D2JA 3P7YA 1O94A 4AWSA 1OK4A 3GB6A 4JEQA 4O16A 3S5NA 2P0OA 3G0XA 4Z0SA 4HNNA 1I2QA 1W0MA 5C2XA 4UTWA 1P5BA 5DCBA 3DI1A 1VPXA 2Q3RA 4MIMA 3A21A 3O8AA 3TROA 4UTUA 3CEUA 4N9BA 3SECA 2BWGA 3THQA 4OBTA 1NF0A 4PH6A 1GTEA 4YLWA 4M6PA 1XM3A 1JUKA 2NXHA 2CWNA 1Q6LA 3A9IA 3V75A 3M43A 4NU7A 1JCXA 2BX7A 5LKYA 3DFQA 3F4WA 3C8FA 1LBLA 3W2JA 3NPUA 3O6CA 5D2YA 4MZ1A 1SFLA 2R94A 2J88A 1KFLA 4HNUA 3KVMA 1H7XA 4ZQNA 4E38A 3TAKA 1X1OA 1QPOA 3R2GA 5F1UA 3C2EA 3D0CA 6ALDA 1I4NA 3HB9A 3TJLA 5D37A 1GWJA 4S2BA 1U5JA 2OX1A 3LCGA 1VGAA 1F74A 4JY8A 1VS1A 3HG4A 1W3IA 1RZMA 3CB8A 4DO5A 3G1FA 1A5SA 1U83A 3LTSA 1BKSA 5F2GA 3EXRA 4FO4A 4LRTA 1AG1O 1TV5A 3W1PA 3ELFA 4BWLC 2ZTJA 2CZDA 3N34A 2GQAA 2ISWA 1K7EA 4C1KA 1DHPA 5G2IA 1PV8A 1VYRA 4I7UA 1Z41A 4JTTA 1H61A 1TPH1 4P61A 4BWLA 2O7SA 2GJLA 3L66A 1FXPA 2D73A 4WJEA 1XBZA 3GKAA 1G4EA 3KVKA 4OHQA 2FTPA 4IJBA 4Z1BA 2A85A 3BW2A 3S42A 3QF0A 4GWEA 1R2RA 2NV2A 4UR8A 4FNRA 3QW3A 5LNRA 3PF3A 1HUVA 3BO9A 3QQ0A 3GDRA 2JBMA 3CM4A 5AHFA 1OVDA 3DKJA 1QPNA 2DZVA 4LY8A 1BWKA 3IGXA 5AHEA 3MHUA 2Y7DA 3HF3A 2I14A 1JRBA 2V0TA 3P81A 4RZ5A 5BOOA 1JQXA 4LC8A 4M6VA 3B0VC 1J4EA 1FWTA 3PG8A 1H1ZA 1KV8A 3GDTA 3F1QA 3SJ3A 1PS9A 3W70A 4FNPA 4ZQOA 1JCYA 2DZWA 3DAQA 1LRNA 1D3HA 3W7RA 4I7VA 1W31A 2YYUA 3CU2A 3L5AA 3NL6A 3NR0A 1J2WA 1ALDA 1TO3A 1CI1A 1FWRA 5AHLA 1NAL1 3VE9A 2E6YA 3VKJA 1QAPA 2Z0IA 3UQNA 2QAFA 3W86A 4ADSA 1SW0A 3G0UA 3PBYA 3WJSA 1T8XA 3W7CA 3BLIA 1LM1A 3EWBX 1Q6OA 3PUOA 4AXKA 4O12A 5K9DA 1OK6A 4JDYA 1JCNA 4TU1A 4FX7A 4PEKA 3BW3A 3PVFA 3GYEA 2NXGA 4JIQA 5AYXA 3BLFA 2WOQA 8TIMA 2BSLA 4LVGA 4CCCA 4JS3A 4ML9A 4OT7A 3VNDA 3TAOA 3W1RA 3PWAA 3W7GA 1JCJA 3P62A 4AEOA 4Y96A 3TC6A 5AFDA 4CQAA 2A2IA 3FJLA 2Y85A 3RMJA 2GUUA 4MVAA 1JCLA 1KFEA 4OV4A 4MJZA 2E6FA 5LNVA 4NZFA 3W3OA 3PUDA 2ZCGA 3N2XA 2C6QA 3NQ2A 1F5ZA 1ZALA 4GFSA 1DVJA 4JTGA 1G67A 4DBDA 2H8ZA 3LTYA 5K3VA 4JTSA 4K7VA 4WY0B 2NV1A 2TYSA 1XFBA 5HMSA 2YXGA 4WUIA 1LLZA 3MBFA 7TIMA 4UTKA 4IMEA 3HO8A 3NM1A 3MP4A 1WBJA 4XBKA 1THFD 1FCBA 1MEIA 2FFCA 5D05A 1GVRA 3E02A 2ZZ3A 4KWVA 3FLUA 1XBVA 2JGQA 3KAOA 3T4CA 4FX8A 1KM4A 2QJIA 3LHUA 1LOLA 5CZ0A 1AW5A 2C3ZA 5TBOA 2HSAA 4UXDA 2DZPA 4O53A 2HMCA 5CZSA 1W56A 1SW7A 1Q3NA 2WV8A 4IGHA 4MYAA 1TQJA 4WD0A 3W7LA 2QCLA 1KM5A 1ZAJA 3UY8A 1YDNA 3L2IA 1K7XA 5G1TA 3S8HA 2Q3OA 1LZOA 3C6CA 3H54A 4BFAA 4O0ZA 3AO0A 1SO5A 1S5VA 3STCA 4R34A 3WJXA 2W79A 2JK2A 1W5QA 2VXNA 4O13A 1EP1A 3L5MA 1OYAA 1XXXA 3M7WA 3NA8A 3B0UX 1HTIA 4JDBA 4X22A 3PAJA 4A21A 4L4LA 1EP3A 4FXRA 1OF8A 3LGEA 3W22A 3P61A 1AL7A 3SIZA 2J9ZA 4CNNA 2LLEA 4LTSA 2ZQ0A 5EA9A 1KFCA 5K7JA 3FKRA 1FCQA 5C6MA 1ZFJA 1I8JA 5F4XA 2JGYA 3LRMA 4MJMA 3MMTA 3M44A 3PY2A 2X1RA 4JTFA 3M5VA 5HJLA 3PUEA 1KTNA 5J5DA 1X7FA 4UTJA 3Q58A 1R2TA 2OZ0A 2W6RA 2A7PA 1WV2A 2I1OA 4HT3A 3TH6A 4EF9A 1ZAIA 3EX3A 3P5YA 1ME8A 5D2WA 3G18A 1TB3A 4CCEA 5FESA 3LERA 4PL1A 1VHNA 4XBSA 1QO5A 1XUZA 5LSMA 4E2BA 2ZDRA 4POCA 3VCRA 3HMJG 5L6UA 3M5XA 3LCXA 1TIMA 3L5LA 2JKEA 3UNDA 1KW1A 3KHJA 4O18A 4IX0A 1YTEA 5D03A 1DL3A 1M5WA 3QH2A 4EWND 4IX2A 4HSOA 1GG1A 4UTTC 3W9ZA 3F03K 2A6LA 2ZZ6A 3GXTA 3Q2DA 3GDMA 4Y90A 4BF9A 1TPDA 1PHWA 1EX5A 5HUOA 5LZLA 3LBMA 5IBXA 1YTDA 3LBCA 4O1CA 4XKYA 2VFIA 2NZLA 4UTTA 3B03A 1I2NA 2P1FA 1OX4A 2YSWA 2E68A 1H62A 1KFBA 2NX9A 3P74A 3G1DA 2EGZA 4OU1A 3DZ1A 1FY6A 4WOZA 3W1UA 4LRSA 1LOSA 3W2MA 3S1WA 1YLVA 3B05A 5CPLA 3EKZA 3G1HA 1YPIA 1EP2A 3NQVA 1TJPA 3S5YA 1ME7A 1VCGA 1MZHA 3STGA 3WFAA 1ZJIA 3M5ZA 1SZNA 4MUZA 4ZVJA 3QMTA 2NWSA 2ZZ7A 1P0KA 1N7KA 5I3GA 1BWLA 3M1ZA 4OGZA 2B0MA 3NQ6A 3TFXA 3W6YA 1DOSA 1KM6A 4BI7A 1WA3A 3PM6A 1VCFA 4N6EA 4TMCA 4RKAA 2PURA 3SGUA 2JKAA 1B57A 4WY0F 5E1QA 1V7YA 1W3NA 4K38A 3C52A 2GOUA 4FNQA 3PC0A 4EOUA 4DXVA 3W7PA 3PG9A 3QEZA 3NQDA 5F2MA 1SU5A 3NQEA 1PL9A 5CSSA 1KV5A 2TPSA 3GZ3A 1KFJA 3OHIA 1XCFA 5U7SA 5TQLA 1Z44A 1GVOA 4JGDA 4U4MA 1K03A 4IXXA 5E0KA 2ZZ4A 4ZMGA 2VENA 4GUHA 4MLJA 1TQXA 2EPHA 1K7FA 4UMAA 3O6YX 1D9EA 3BPWA 3GX9A 1TRIA 2YGYA 1H7NA 3B8DA 3L0NA 4FIQA 3KOFA 3LX9A 2WJZA 1LOQA 1A5AA 1TPUA 2PRMA 3PSWA 4NVTA 5DN1A 5GVJA 3M41A 4XWUA 4GE8A 2FDSA 3GDLA 4WXZA 3LCWA 2HS6A 1WOAA 1GZGA 3UYCA 4QNEA 4XZ9A 3DFTA 4ORMA 2ISVA 3HOJA 2XN1A 1VLWA 1NF7A 2Y70A 1SO6A 4JY9A 1OABA 2VKZG 5DLCA 2V2CA 2VFDA 2OT1A 3LLFA 3MWAA 4UUIA 1P0NA 3IRDA 3E0IA 3W73A 3MBDA 3GXPA 1FWNA 3IIPA 4RJEA 1T96A 3C0JA 5K9XA 4WZHA 5DY2A 2BXVA 4DO6A 4PCFA 4DPPA 1RQHA 5CZTA 2FPYA 1VJIA 4H3DA 5HWJA 1O95A 4UTHA 5KTLA 4JTEA 6TIMA 1AL8A 2E1DA 4NUWA 4UNLA 3PR2A 3V1PA 3EWXA 1AMKA 1IXPA 5HR7A 3NL5A 2DZXA 4ORIA 1F05A 1O5XA 3ZWTA 3U6WA 2NXIA 3C2RA 4DBEA 4DQWA 3CHVA 3MJYA 3NPXA 2CLFA 1D3GA 1ICSA 4ICNA 1O60A 2WSYA 2H90A 2VFGA 4K37A 1MEWA 2WPBA 2JKPA 1SO4A 5D2TA 4GBUA 4GUJA 1OFDA 3DENA 3W87A 5BMWA 2X1SA 3DFOA 1V5XA 3O16A 5HNRA 3S5OA 1PHQA 3G3DA 4B5NA 4RX0A 4ZQPA 4HNTA 1QDSA 3UWQA 1DQXA 5FF2A 3T78A 2BTMA 3GNDA 1OFPA 4TO8A 3W7IA 3FA5A 5K4ZA 3TW6A 3TV8A 5SWUA 1W5OA 4O50A 1ML1A 4EF8A 5DCEA 1H60A 1OYBA 1W54A 5FF3A 2VFFA 3RNDA 4NNAA 3LI1A 3PS7A 1S3HA 4NQ1A 5AHNA 5MHBA 5AB3A 3A5FA 1FWSA 5CGQA 1S5TA 5HULA 4Y9AA 5L9FA 5LNWA 1TRDA 1DJNA 3IV3A 1A53A 3DBPA 3S5ZA 1XL9A 4KKXA 3W1XA 1H7WA 5TIMA 5CZJA 3KXQA 1WYIA 5D38A 4JIPA 3S0CA 3TQVA 3GLCA 1LRQA 1GOXA 2ZRWA 5F4SA 2ZZ1A 3MHGA 3W76A 4WQ6A 5AOUA 4UMCA 3M9YA 1WDWA 3TFCA 3RF9A 1B4EA 2OJPA 1FDYA 1R47A 2RDWA 3LOTA 1AW1A 4H4IA 3NQFA 3H55A 4JTLA 4NXSA 1H51A 3PBUA 3G3MA 5KINA 4HSNA 5AC8A 1I2PA 3STEA 5FF7A 4JTKA 2QF7A 4IMDA 1YXCA 4Z1AA 2C1HA 1LDCA 3TA6A 1H5YA 3LHYA 3P8IA 4CQ9A 1O5KA 5I3IA 2E6AA 3CWNA 4ZQMA 1FXQA 2ZRZA 3YPIA 2AGKA 1N8FA 5G2HA 3I7RA 3W07A 5FEWA 1R2SA 3HG3A 5D33A 1EIXA 5KZMA 4JYEA 2ZRVA 4UIOA 1JVNA 4AAJA 2FB2A 3W1TA 2G96A 2I9EA 4K8HA 4PTNA 3CTLA 1OFEA 1YXYA 1OFOA 1SO3A 3GNNA 2QJHA 3M0ZA 4DF0A 2QCDB 4UFMA 1EUAA 2DJLA 1RD5A 3MUXA 3U8GA 2ZA1A 4PFMA 4LVDA 2DZSA 1W5PA 1YXDA 3OA3A 1UBSA 2QCGA 5CKSA 1RV8A 1TTPA 3E12A 3S1UA 1M7PA 5T26A 5AYYA 1QNVA 1M7OA 4LS0A 3PB2A 2EKCA 4U28A 3WJWA 3R8RA 4NNCA 5LNUA 5IM51 3NPWA 4MZ8A 3P67A 2TMDA 2WKJA 4WY0A 4KFNA 3TCEA 3W2NA 1C9DA 4O1AA 5AHMA 3EXTA 5LHFA 5DELA 4M7SA 3LLDA 1YADA 3TC7A 2QCHA 4NXKA 1KM0A 1XC4A 1OHLA 1LRTA 2QCNA 5I3HA 1M6JA 3CWOX 4N9DA 3HBLA 3QZEA 4AHQA 4AMAA 3CQ0A 4RR4A 3W7KA 2DZUA 4AF0B 2EHHA 3BG5A 5G4WA 3A5VA 5BNKA 3NNTA 1XKYA 3LI0A 1UJPA 4UFIA 1EA0A 2E5BA 1YDVA 3O15A 1ICQA 3GVGA 2IQTA 3IIXA 3W7NA 2CZEA 3OIXA 5D32A 1HO1A 2YW4A 5DCDA 2DZTA 4NNBA 4TR9A 1VHCA 3WJZA 1LBMA 2YYTA 4BK9A 1JR1A 1H7RA 3W74A 3ABRA 1B4KA 1H63A 3P80A 1QOPA 3VFLA 4ZZ9A 5AN7A 1FWWA 1UUOA 3WK0A 3N2MA 1TSIA 3T7VA 2FPVA 4UTIA 4L4MA 3N9RA 2FIQA 3ZWSA 4FB7A 1G4SA 2V8ZA 2FPTA 3CIWA 1N55A 3RK8A 5EL1A 3C56A 2A5HA 1WX0A 2ATMA 2Y89A 3NM3A 1OFRA 1QOQA 3A24A 3QSRA 1SFJA 4IUOA 3C61A 3NZ1A 5EMUA 3G1YA 1Q6RA 3W75A 4GUGA 3W88A 1Q45A 3O6DA 3UXAA 4N02A 1GT8A 5HR6A 5HWNA 2YPIA 4IMGA 4GUFA 4FF7A 2A7RA 5A5WA 3QYQA 4RZ4A 5F2IA 1OX5A 4MKNA 5BRBA 3EWUA 2VFEA 2TRSA 5H91A 3CT7A 1NFBA 3LCLA 4CNPA 4W9TA 3G1VA 2ZTKA 3ZR4A 2NX1A 2FQIA 3TK7A 3I68A 5HWMA 1ICPA 1KM2A 4O11A 3F4NA 3TKFA 3NXFA 2QCEA 3LHZA 4HN4A 1W5MA 4LV4A 4JTJA 4Q32A 3EB2A 4O8RA 3WJYA 3UPBA 1H50A 3ATYA 5F4WA 3BGGA 3FOKA 4TX9A 4S2CA 4Z1DA 1NEYA 1IIGA 3E9AA 3BARA 2VELA 3O05A 2H3BA 1DQWA 4RCXA 1WBHA 3S1XA 4QISA 4LUIA 1FBAA 1IGSA 5G1YA 3OBKA 4IOTA 3FKKA 2J6XA 2X16A 3GR8A 3TJXA 3BG3A 3RLVA 1JCMP 3NYZA 1G7UA 1GG0A 1GQNA 1KBIA 1S5WA 3ABOA 3W1AA 3LXCA 4O1BA 1G7VA 3TE9A 3DFPA 3W7JA 3ATZA 3MI2A 3VE7A 1LYXA 4G1KA 2C18A 4UNKA 3NL2A 3O63A 4FHAA 3ZS4A 3W72A 1TPEA 3PBWA 3W84A 3MO7A 4IMFA 1TPC1 1UUMA 3WK2A 1KA9F 4IWWA 4M5PA 1GVSA 3QW4B 4JICA 2VOMA 3QFEA 3HG2A 3IVUA 1IIHA 2ZRYA 3E49A 1QPRA 1W37A 3W85A 4CQ8A 4J9JA 1KBJA 4R53A 3TIMA 4Q33A 1K02A 2ALDA 2CW6A 2CLMA 4JR5A 5EPDA 3MYPA 2A6NA 3S9YA 5CPNA 2Z1BA 3EX6A 3THAA 2XN0A 3W23A 3L0GA 3HPXA 3SW6A 4QQ3A 4N9CA 2OT0A 4UMBA 3SI9A 3N3MA 5D04C 2Y7FA 4UC5A 1LP6A 1OG0A 2V81A 3GKFA 1ZENA 2ZRUA 2G97A 3TU9A 4LNYA 1HG3A 1KM1A 1TTJA 2GVLA 1KM3A 1SSDA 1X6UA 3FJ6A 3MHFA 5KZEA 4QITA 2Y61A 1F73A 4O17A 1LCOA 1QCWA 3SR7A 3DKLA 3TX9A 3W2LA 1TJRA 1ZY9A 3W1NA 5DXYA 1MEHA 4MZYA 1VYSX 4A3UA 1YYAA 4DEFA 2RDTA 3TXZA 3BV4A 3LDVA 4IQLA 4OQVA 5K9CA 3W2UA 5BW6A 5FF4A 3RU6A 1G4PA 3HJZA 2VEPA 1C8VA 1RQEA 4NJGA 2QKFA 1VH7A 3N19B 5LNSA 2Y88A
chains in the Genus database with same CATH superfamily
2Z27A 3TJIA 3RLUA 3SY5A 1DKWA 2DUXA 2AQOA 1XUUA 3KRZA 5DQPA 3C2FA 5A8GA 4MTVA 1A0DA 1B30A 1DWHM 1S2WA 3BGAA 5J04A 3TUUA 5EYWA 1XIBA 4P5UA 1CENA 3G8EA 3QPYA 2PP3A 1R30A 3EDDA 4I9MA 4U2ZA 4CD7A 3AJXA 5CC3A 4HNVA 3K46A 5MF5A 3CB3A 4O0KA 2QJGA 2Z2UA 2J9XA 1IEQA 2FDMA 3ES8A 3MPGA 3R13A 4Z2KA 4H9TA 1SJCA 4H9YA 2C19A 2Z1WA 1H1YA 3MDUA 4QRNA 1QK2A 1CNVA 1XW8A 3LHTA 3ARWA 4IIEA 4QM1A 5B80A 4U10A 2EG8A 3C2VA 1V6TA 2YDSA 4WKAA 4ZL1A 2NV9A 4UWMA 4EPDC 3PULA 1ZAHA 3IJLA 4H8VA 3N73A 2E5DA 3HGOA 3BUVA 3QM3A 4UTWC 1E6XM 1KFWA 3B4UA 3CT2A 2E09A 3CUHA 5DEZA 4F79A 3N04A 4ZXLA 5CGMA 1MQQA 3R94A 2DJXA 5BU6A 3I7QA 1UG6A 3M16A 4PODA 3T05A 4Q8VA 4V15A 2RJGA 2YL5A 4ZQRA 4YCPA 3UT0A 4MWAD 2UY4A 5G4EA 1PE1A 4RK8A 4FA3A 3VVGA 3WL0A 5U4NA 3MO4A 4AWEA 1E0VA 4IIFA 3WH9A 1JD7A 3GTHA 3R11A 3MCMA 1M03A 1QNPA 5KSWA 4REQA 3T4WA 2RFGA 3AMDA 3BXWA 1OC7A 3S6TA 1TPFA 2V2DA 4LW7A 4P7RA 2GWGA 1AW2A 3TYDA 4JPGA 3AU2A 2NUXA 3LNPA 4IIGA 4BI5A 3WQCA 2BVYA 4GZJA 3IUIA 4H6EA 4AD0A 2WNNA 2BOFX 3KRSA 1UD5A 4NX0A 3CHFA 3N14A 4G2DA 5KMYA 2PF8A 3D5HA 3XIMA 2VC6A 3PJUA 4DJEC 1M53A 3ZMRA 4MADA 4GUIA 3HPSA 3ICJA 1XBXA 3VUPA 4ZOCA 3UPWA 3H2FA 1XHGA 3ME3A 2CLOA 5DBUA 3S5SA 3VOCA 1EUNA 4JFVA 3BAWA 2ZX5A 1UKOA 3QC3A 3THCA 3EDKA 1U5VA 2VEFA 2EF9A 3GM8A 3R25A 4RV8A 4LV9A 1MI3A 5BXSA 2INEA 5GJNA 3ZO9A 4J27A 5LGZA 3WL1A 4FPSA 3MKVA 4XQ6A 3EWCA 2GVJA 3E0LA 3QPZA 3A4JA 4DJFD 2J9YA 2GGEA 3B0PA 4MAZA 4PR4A 2ABAA 3WLIA 3ECQA 2DT2A 3O2LA 5CLWA 2VP8A 3NG3A 4AX7A 3CLMA 4PULA 3LZ5A 4GRSA 4O4VA 3U9IA 1FCVA 4XB3A 4JN7A 2CLEA 3DYMA 5CSRA 1LL4A 1HL8A 2I7GA 4A29A 4YIWA 1EC9A 2R82A 4CNTA 1FHLA 1UD3A 1PCWA 3CYJA 3GAYA 4KETA 4QR6A 3LPPA 4S1FA 2A4AA 2QVHA 2B7OA 2I5QA 3FHQA 1P0BA 5AC5A 3EOUA 2WXDM 2AL2A 3TYAA 3W83A 1QT1A 2GGGA 2WHLA 4O15A 1J5TA 3WQWA 2Y6ZA 4DLMA 2Z6IA 2DH3A 2PZ0A 2Q8LA 1WDPA 3W7OA 3W53A 3NZGA 1BSIA 3JZUA 3QLLA 3G24A 3W1MA 1E6PA 3WSUA 3SGZA 5BOFA 1TVNA 4K39A 2VX6A 3UZJA 2NLIA 3QY8A 1EB3A 5LXEA 2P76A 5FI8A 1OCQA 1RLDA 5CG0A 1W1TA 4F9JA 3DOPA 4E4PA 3CEPA 3TQKA 1R3TA 3CZ8A 2WHKA 2QDDA 4GQBA 1FDZA 1I2RA 3KRUA 3KS5A 3DDMA 2CESA 3CGTA 1Y5VA 3GIQA 1LROA 4ADTA 4DXKA 2XVKA 4LUYA 3EX4A 3PB0A 1FCUA 4O4WA 4EPKA 1HZYA 4DYEA 1DJHA 3LYEA 3U3HA 3V36A 4DJED 4GYPA 2J8GA 2VEGA 5HATA 3FA3A 1OFBA 4ZE4A 2XTKA 1JQVA 3QRHA 4FX6M 3KWXA 3DERA 3TMQA 4LWWA 4OVXA 1NFGA 1E4NA 1XWYA 4WSHA 3GU9A 2AL1A 4N4PA 3RYSA 4C5YA 4INFA 3LSCA 1AK5A 3VINA 2V9DA 5CPOA 4MNJA 4DYJA 3SCRA 2EG7A 5M3WA 3H7UA 3QSTA 1UD8A 2F2HA 3KBNA 3USBA 2J7GA 2CHOA 3E74A 2ZZ2A 3USZA 3ZT6A 4ZEPA 4JKMA 3A23A 3LRLA 3I65A 4JZ5A 1UCWA 4A3RA 2X0HA 1TCMA 2Z7KA 4OOUA 1K4GA 3GC2A 4NZ5A 1J6PA 1IXNA 1EIBA 1TV7A 4PCPA 5IBXC 1XDLA 3RHGA 5D09A 2FZMA 2W62A 4M6UA 4NYYA 3ZZ1A 3CQKA 4CEXC 2FGLA 1GEQA 2QPXA 4M19A 3GFYA 3AC0A 1YNYA 4H8NA 2MNRA 3AHVA 5BMXA 3FYPA 1CIUA 3N6HA 1GW9A 3CQJA 1GOOA 3LSBA 3R79A 1KLZA 4CD5A 3HG5A 1EDGA 4MFEA 4NASA 4IGNA 3TNOA 3LV5A 3IWPA 3FHAA 4JQ1A 4MYXA 1V02E 4MJ2A 3DI0A 4F0LA 3M0IA 4EX4A 3N12A 3FSTA 3UWUA 4N0RA 2YKKA 1B2YA 1JYWA 3IVSA 3KFTA 5AYZA 2X0SA 5I3KA 4LB3A 3ERPA 3E0FA 4OV9A 4H6KA 4TMBA 3C0QA 1XDMA 4YPJA 3NQCA 1FWJC 1TPB1 3QTGA 3CUFA 1NWRA 5AVNA 5HUPA 4FLSA 4AH7A 1SPQA 5K2ZA 2CXGA 3U0HA 4QJ1A 2VGBA 1CW2A 1PKLA 1IHIA 3AXMA 3R58A 4MLRA 4LOCA 4EACA 3NGJA 3W82A 1LWIA 1WUEA 3IIVA 1SZEA 1B3YA 1SW3A 2VEKA 1Z42A 1Y8BA 3GC5A 1KLYA 3RG6A 3REQA 1BWVA 3WQDA 2GJXB 3N4FA 1V8EA 2WSQA 1Z8AA 3RU8X 2VUYA 2XWDA 4NIRA 5CPMA 3HGJA 4GI4A 4L9ZA 2VQTA 1FOBA 1ISZA 4GISA 4KRUA 1V51A 3FIGA 4DF2A 1NDYA 4FNUA 2A3BA 1KRCC 3FS2A 5DMNA 1GVEA 2XFRA 3GVWA 4W8BA 3KM8A 3MW7A 3IVTA 3I7SA 3L4XA 3VNYA 4D9PA 5HK4A 1GPWA 1RHCA 3QVQA 4OUEA 1HL2A 2R14A 3SFKA 3CMJA 1GVYA 2ONEA 1V3HA 2EAWA 4NZCA 4Q8NA 3LQGA 5FJRA 5D02A 3OG3A 1MO0A 1XPGA 4B2DD 1JRCA 3PZNA 2VEIA 3KVLA 3U4FA 1ZCOA 2O9TA 3KZSA 4UR7A 2Y0FA 1JPIA 1TMHA 4AEFA 2F6XA 1W1ZA 2POTA 4KWWA 1I2OA 5H1WA 4AWTA 5I5RA 1SR9A 3BVJA 4NAFA 3BV7A 1LUCA 4LC6A 5C55A 3TN5A 4JL2A 3LMYA 4D2JA 5C8BB 3MUAA 2P0OA 3G0XA 3WH7A 4JTQA 5CBBA 1XYLA 4ZR8A 5C2XA 2BGNE 4UQEA 3DFYA 3DI1A 1VPXA 2Q3RA 4MIMA 3GG8A 2BVWA 8XIMA 1E0UA 1QXLA 3PHAA 3CEUA 3V0UA 4J7RA 4Y9PA 3FX4A 1NF0A 3ENLA 3WBEA 1XM3A 2PWGA 1XLAA 4AIUA 5HBFA 1XLLA 3BLLA 5LKYA 5M17A 1LBLA 4ZODA 3FXYA 1EH9A 3AZTA 5F7UA 2R94A 1FWFC 1KFLA 4E38A 3UP8A 3TAKA 1X1OA 2PP1A 5F1UA 3C2EA 3D0CA 4J3ZA 1FH9A 3TJLA 5D37A 3H24A 3G1RA 1XRSA 3LCGA 2D20A 3MY9A 1F74A 1W3IA 2F38A 3WUFA 1M68A 4GYKA 3WFZA 3LTSA 2VDHA 5F2GA 2BHYA 4PUUA 2CXEA 2YBUA 3CV1A 3OVGA 3ELFA 4QEEA 3H2CA 3N34A 4RDYA 3MVTA 1B0IA 3OGSA 1TMQA 1PV8A 1VYRA 4PYSA 1EXPA 3CAVA 2V63A 2X2YA 4BWLA 4AZHA 1DQUA 1OB0A 3L66A 1PB0A 1R3QA 2D73A 2EEXA 3GG0A 3N4EA 4IJBA 2IUZA 1UZ4A 2A85A 5DT7A 1F9CA 3E3HA 3M0KA 4HCLA 3DFHA 2NV2A 4UR8A 4FNRA 2V5DA 4XZBA 4CNUA 2DZVA 4W5ZA 4LY8A 1NWUA 5AHEA 4FMVA 3AHZA 3MHUA 3P81A 4LC8A 5BZAA 4TVUA 4L56A 2BY2A 4C1NB 4UQ9A 3GDTA 3F1QA 4WGHA 4FNPA 1LRNA 3VD9A 3W7RA 3ONBA 3ARZA 3WD0A 1HJWA 3CU2A 1XIGA 4GX9A 1CI1A 2EXOA 3T0DA 3CUIA 3N1AA 2I16A 5JBDA 3VKJA 3W86A 2PLKA 3G0UA 2CC0A 2Y8UA 3I10A 3W7CA 4XZIA 3BLIA 2BY0A 3PUOA 5T9BG 3TYEA 1VENA 1DYSA 3FCPA 4JHOA 3NZPA 4AYSA 3BW3A 1JYXA 3PZOA 1W9BM 4B5UA 1T40A 1H0GA 5DT5A 1UMLA 2BSLA 4M29A 4CCCA 2BB0A 1JCJA 5A6KA 2G3NA 3TC6A 4FS9A 5EB8A 2A2IA 3S47A 3OLIA 4MJZA 4EXAA 1CPUA 3H22A 4NZFA 2E8YA 4LCRA 3O6AA 4TV6A 1ZALA 4JTSA 4Q4PA 1F8IA 1PAMA 3GNPA 2J7EA 4G6CA 4NRRA 3MBFA 7TIMA 4IMEA 3B0XA 2OQHA 3HO8A 1WBJA 3H2AA 3GDBA 1MEIA 3A12A 4IFKA 1KR1A 2ZZ3A 1RH9A 1J93A 1XBVA 3WNKA 2YB1A 7PTDA 1ZUAX 2CKSA 3BC9A 4FX8A 4XBJA 2OX4A 3H2EA 2HSAA 1IR1A 4XZWA 5CZSA 1W56A 2PLJA 4D8ZA 5LIYX 4MYAA 1TQJA 4FOKA 3NYDA 1XYAA 2OWXA 3VIMA 4OJYA 3QFWA 1YDNA 3BOFA 3L2IA 4KESA 5G1TA 6REQB 1ONWA 1ODUA 2GVYA 3NO1A 2X41A 4BFAA 4PRWA 3AO0A 2DH2A 1HIZA 4DHGA 3OB8A 3NA8A 1OYAA 1RVKA 4PMOA 3B0UX 1B3ZA 1HTIA 3EKGA 4X22A 4A21A 1DIKA 1J5SA 1AD4A 2HVNA 1TIWA 2YBTA 3R7MA 4LTSA 5CSYA 1N82A 4GNVA 2JGYA 3LRMA 4MJMA 4L65A 3MMTA 5B7ZA 5HJLA 3OJGA 3PUEA 2BOEX 3PTMA 2YDRA 1OGGA 4FALA 2W6RA 1WV2A 2GDUA 2I1OA 3BICA 4HT3A 4EF9A 2BASA 1ZAIA 3E0VA 1TB3A 4B5XA 3SY1A 1A3HA 4F0MA 2J74A 2VCCA 3WLOA 4H00A 4XBSA 3VCRA 3TZNA 3GC4A 2O4MA 4Q8MA 3LCXA 4KS0A 4IX0A 1YTEA 3E2QA 1XLBA 1GK8A 1JPMA 3M0LA 2HZGA 3RITA 4UTTC 3W9ZA 4KEVA 2A6LA 3Q2DA 3GFXA 3GD6A 1TPDA 5FJTA 3WDHA 4C6NA 3RX2A 3LBCA 4GGBA 4XKYA 2NZLA 2P1FA 1OX4A 2OQLA 2BHZA 4F8XA 1MXGA 4LBRA 4Y8EA 2GL5A 1Z6KA 4J4KA 3P74A 2EGZA 3DZ1A 1RP8A 3UFYA 1JDEA 1XLFA 1ZGDA 3HM7A 4ATLA 1FY6A 4UZUA 1LOSA 4PTMA 3UEQA 1PZ2A 2G41A 4P8XA 6XIAA 4NZ4A 1XDJA 1XP3A 3STGA 2ZC1A 2KX9A 4V2XA 3J7HA 4TOQA 2ZZ7A 1J79A 1LG2A 2OEKA 4OGZA 1OY0A 1S2UA 1DOSA 4DRSA 1V93A 4E8GA 1VCFA 3QGAC 4Y7EA 5JU6A 4Q4RA 3SGUA 4GYFA 5FJIA 4DJDC 4WY0F 1V7YA 1BF6A 4K38A 2GOUA 4FNQA 2PTZA 4LSBA 3W7PA 3PG9A 1XH0A 1UP2A 3NQEA 5CSSA 1ZBKA 3FK4A 2MANA 3GZ3A 1QNQA 3BLOA 4IP5A 1OINA 1UIPA 1M65A 1SGJA 1A5LC 2P0IA 4IXXA 4PTXA 1V6VA 3IV8A 2PDBA 2J7DA 3GZAA 3HURA 3RAOA 3WELA 3IUHA 2WQDA 3BPWA 4QXIA 4Q4QA 3QZAA 3FGCA 1LOQA 1A5AA 2PRMA 4XD4A 3PSWA 5DN1A 3M41A 3WN6A 3GNOA 3IK4A 4WXZA 4R85A 4LH8A 3UYCA 4XAPA 1FP9A 4GO8A 3K13A 5GQBA 2Y70A 3NJ3A 1OABA 2VKZG 4L61A 4LBSA 4W89A 3WLMA 7XIMA 2XH7A 4C6QA 3URBA 5AVHA 3GNRA 2FJUB 3W73A 1FWNA 4RJEA 5K9XA 3C0JA 1H0IA 3NTYA 2F61A 4DPPA 1RQHA 3I3BA 4V28A 4HPNA 1VJIA 1V0MA 2PODA 4H3DA 4DNMA 8RUCA 2FYMA 4JTEA 4KF1A 5M5DA 6TIMA 1AL8A 4NUWA 5A8NA 2BODX 1EJVC 5HR7A 3NL5A 3WQ6A 4DBEA 3JZEA 4DQWA 3CHVA 3SCPA 1WDDA 3W28A 2ACQA 4ZSUA 4YTSA 2O9RA 2CHNA 4ICNA 3WDRA 1AD1A 2PDJA 2PDUA 2H90A 1X7IA 2VFGA 4RZBA 2PGEA 2WPBA 3SGGA 2JKPA 2V67A 1SO4A 1XRVA 4GBUA 4ICCX 4DY1A 1V6XA 3MU7A 4YN5A 3AISA 4LCSA 1W2PA 3W87A 3CASA 1QHOA 3AUOA 2BNJA 3EB4A 3LZ3A 1PHQA 4US6A 4RX0A 1UZ1A 3H21A 4GIEA 3CBWA 3WF3A 1DWAM 2DVTA 5I03A 3VIGA 3M0YA 3TA9A 4WIWA 5C9WA 1ZU8A 3ARRA 3T78A 4B5WA 1OFPA 4TO8A 3FA5A 2WW5A 2PWDA 1W5OA 2WC7A 5CJ5A 1QBBA 4LAKA 3CL7A 1OYBA 4KIEA 4NNAA 3VGFA 4RE2A 3PS7A 4Y2WA 5CGQA 5HULA 5L9FA 5LNWA 2XINA 5A2CA 3KE0A 1VBGA 1Z3NA 1H7WA 4TX6A 1TA3A 1WYIA 3MB9A 2VWTA 1OCNA 4I6KA 3U4AA 2ZRWA 5F4SA 2ZZ1A 1RSCA 1TELA 4Q22A 4WQ6A 2GJRA 4UMCA 1WDWA 4N7QA 3THUA 1E1FA 3WLSA 2PLMA 2QULA 3AMCA 2RDWA 2CWXA 4BQ5A 1AW1A 1ZP3A 1T5AA 3GWQA 3M64A 3PBUA 4EPEC 2CLPA 3CZJA 3AWOA 2E1WA 4IMDA 3RLHA 1DE5A 2C79A 4D72A 3ARQA 1O5KA 3TCSA 1NWSA 1EOMA 1AJ2A 2VZOA 2VMFA 1QTWA 1QI2A 3W07A 1FWHC 2HV5A 2WCGA 4KBXA 5REQB 3HG3A 3IJ8A 5KZMA 4UTFA 4JYEA 1T41A 2ZRVA 1LT7A 3NQBA 2FB2A 4DZIA 4HQVA 1CYGA 3W1TA 2G96A 3JUGA 2I9EA 4K8HA 3VCNA 4PTNA 1OFOA 5EGRA 2R1PA 1SO3A 5AZ0A 1BPLB 2PU1A 2QCDB 4W8LA 3L2LA 1RD5A 1E9IA 1NELA 1LQAA 1YXDA 3OA3A 3ZLHA 2VJXA 2PWHA 3CO4A 4F2TA 2QCGA 4ICMA 3UCQA 1A3XA 1RV8A 3S1UA 3VDHA 1M7PA 5MKGB 4DO7A 3EOOA 4C6FA 4P8VA 1QI0A 4GJJA 1JF5A 4KEMA 5LNUA 1MUMA 1WO2A 1L6GA 3KOZA 3NPWA 4BCEA 3CUXA 3B8UA 2TMDA 3E2SA 2WKJA 4LUTA 4U3CA 3W2NA 5AHMA 2OWCA 5C71A 4M7SA 3ITTA 2QCHA 1V79A 1ZTVA 1SMDA 2QCNA 5I79A 1J0KA 1OCJA 4N9DA 3CWOX 3HJEA 3PFRA 4AHQA 1CCWB 1RALA 4MWAE 3W7KA 1YE4A 5A2AA 2FTYA 1J01A 3UR8A 1XKYA 5I00A 2QGHA 2FHBA 1ICQA 3GVGA 4EK7A 4WCJA 1UKTA 3W00A 2J7FA 4BJHA 4HZMA 1LL7A 2X09A 1LBMA 1U5HA 3NURA 3W74A 2CZVA 3K8LA 3K8MA 3VC6A 4ZZ9A 4GY0A 2G50A 1TSIA 3T7VA 3POHA 4DBWA 3HMCA 1NQKA 3H70A 3GHTA 2OR2A 1N55A 4HK5A 3BMVA 1C7TA 5A6BA 1WX0A 3SUUA 3K2GA 5GPRA 3NM3A 4AZBA 2XIOA 3A24A 2J4GA 4JCLA 1Q8AA 3A64A 1W1B1 4IUOA 3WQEA 1FRBA 1HJXA 4K3ZA 4RW5A 3W88A 2VC9A 2Y5EA 3O6DA 2AMGA 4FF7A 4H6QA 4RZ4A 5F2IA 3ANVA 4MKNA 1BRLB 3KDNA 1NDZA 2UY2A 3G1VA 2IW0A 4EWJA 3CJPA 1CXKA 1PTGA 4O11A 1P6CA 3NXFA 3LS9A 1XYCA 3LHZA 4FSAA 3F5KA 4GY1A 4LV4A 4Q32A 4O8RA 4IG2B 3SM0A 3AYTA 3BARA 4P8UA 3VGHA 2QPUA 4LAMA 3S1XA 3EPNA 4QISA 5HA7A 1FBAA 4M8UA 3VCCA 1IGSA 1IT7A 5G1YA 3OBKA 2J6XA 1XIDA 1FWCC 2WPGA 3KBWA 4DWSC 3RLVA 2DUAA 1GW1A 4A05A 3ABOA 2J78A 4XO7A 3W1AA 1HKMA 4O1BA 1G7VA 1JYNA 2W3ZA 3TE9A 1AJ0A 3W7JA 4RNJA 4ERGA 4GIYA 1RK5A 4QGCA 4KWSA 1MXDA 4JIHA 6PTDA 4Q6JA 4FHAA 3W72A 3PBWA 3W84A 3MO7A 1A49A 3QW4B 4JICA 1IIHA 3TR9A 3W85A 4CQ8A 1V3IA 1DJIA 2ANUA 4ZFMA 3GBEA 4G7EB 4R53A 1L6FA 4L9XA 4JR5A 3L4ZA 4JHZA 2I56A 4W7WA 2AMXA 1E6ZA 3L0GA 3SW6A 2WMJA 4QQ3A 3H8AA 4HNLA 2YCKX 5FL0A 4UMBA 1O1ZA 1PIFA 4JQAA 3N3MA 4D8AA 1EZWA 1IR2A 2PDGA 4AUBA 4CU7A 1UWUA 3T42A 1IEIA 3ZT7A 1KM1A 4LEFA 4JHMA 1KM3A 4R7OA 1ZP4A 4MNKA 4GI6A 5A6MA 2NVCA 5KZEA 2Y61A 4XD5A 4O17A 2VT0A 1LCOA 4U5KA 1GHSA 2P8BA 3W1NA 3ARYA 4M81A 5DXYA 4PRRA 1S2CA 5GJPA 4S3CA 5IRPA 5D8WA 3UCDA 1YHTA 2GSJA 1F07A 1KRMA 5K9CA 5BW6A 3CK5A 1MNSA 3A3WA 3VIJA 2CPUA 1G4PA 2CCRA 4NJGA 4Q8WA 3UXKA 3BLDA 3VGEA 2QKFA 3N19B 4FOJA 2Y88A 4AD3A 5CG7A 1JXKA 5C54A 3NQGA 1YEYA 3TYCA 1BHGA 3RX3A 2VURA 2FZNA 4X63A 3W7MA 3LY0A 1OWQA 4Z2LA 3MUZ1 3HTWA 4U31A 2YXXA 3EX1A 2WYSA 2VDIA 3KX6A 2ISFA 1JEZA 1OFAA 2GQ9A 4M80A 3DHUA 4ACZB 2BZNA 1OEPA 1XLDA 4QFUA 3IANA 3KVJA 4KFPA 2QNEA 4KMQA 3QKEA 5HXMA 1VYPX 1ZHAA 2VVSA 3STPA 1FUYA 3BZGA 2OSYA 5HAOA 5AC6A 2PE4A 1ZZMA 1T0OA 3RR1A 5JQ9A 5DRIA 4UFLA 3PSVA 2XSXA 4N9EA 3IUDA 1UOKA 4YTUA 5EMYA 3C2OA 4JTCA 3UYIA 3Q37A 4RZ6A 4PB5A 3RFAA 3UJ2A 4JFWA 1UWQA 1IF2A 4GK8A 4AZGA 1A47A 1XYBA 4AD2A 1C29A 3NFUA 3WH6A 1BEUA 2ZE0A 2FTWA 2IKGA 2G4JA 2V30A 4GJ1A 4B5TA 1YNPA 3BQ5A 3MS8A 3RXZA 3LCIA 3P5ZA 4YWSA 2Y8VA 4WSKA 4RNFA 3LG3A 4WOQA 2AAMA 1TYGA 1LORA 1MDRA 1A5KC 4HP5A 3VD7A 3SRDA 2ZXQA 4UZSA 2F7FA 3W7HA 2CLIA 2KZHA 2RKXA 1S1RA 3IIOA 1YDOA 3NZRA 4GOAA 4MKVA 2H9AA 1SFSA 3OZOA 1Z7AA 5LHEA 5A3HA 4YCOA 1LT8A 1M41A 2D0GA 4D6FA 1RBAA 1W3JA 5CAHA 5FEPA 3SQMA 2TSYA 3HGSA 4IXHA 3QV8A 3U2OA 1K6AA 3EPMA 1Y0EA 2WVVA 3IK2A 3NQMA 3MMUA 4GCAA 3NAVA 4AC1X 5FF0A 1R3SA 4MFDA 2WHMA 3RMEA 3PBVA 2VD8A 4DX3A 4C91A 3UR2A 4C6EA 2O0TA 1G4TA 3LCHA 1U2YA 4W7UA 3QR0A 3MT1A 2UZ9A 3LNMA 2HBVA 2V6AA 2AKMA 1L2UA 2WO5A 4ZOBA 4MPKA 2F8QA 1CXHA 4QLKA 4DELA 5AC7A 4LU0A 1CB7B 3WBXA 1CXLA 2OZTA 3Q4DA 4HTYA 4NSBA 1H1NA 4IPJA 2CYGA 3PZQA 3URNA 4J3XA 5E93A 2DIKA 2V5JA 4PBGA 1D7KA 3UGVA 1N8WA 4DIAA 2QT3A 4NT0A 2NVAA 4Y9OA 1UWAA 1XG3A 4J5NA 3OEXA 3FSUA 2VCAA 1R0MA 3W7QA 2PGRA 4IPIA 2YFOA 4Q4KA 4LNCA 3WQVA 2OYLA 1H7PA 4LT9A 1DJWA 1UWTA 3L12A 3ABXA 5DMMA 2R1MA 3SIMA 4JD4A 2A21A 3G2GA 2DW6A 1TX2A 3AAMA 2BFGA 4UTLA 4UR9A 1I9CB 3WNLA 4QG9A 1GYLA 1WP6A 2QCFA 3OZYA 1DHKA 4LAOA 4C6PA 3GG7A 2Z26A 1L0PA 1SZGA 3LN3A 5EY5A 3OLEA 3UETA 3AU6A 3P3BA 2R8WA 1UYQA 4Z2HA 3V0TA 3WK1A 1KBKA 5DXXA 2CU0A 4GMEA 3WF1A 4C1LA 4JTRA 4E0CA 4CD4A 5A6TC 3A3HA 2Z25A 1RY0A 1RPKA 1V08A 1HFBA 2P53A 5I02A 5LIKX 3WLTA 2H6RA 1JUEA 3B0YA 1HVXA 4MB5A 5C5YA 2W61A 2FZ8A 2RJHA 3JRKA 2ZYFA 3MMDA 1VFUA 6REQA 1REQB 4TVCA 1W8GA 5A8MA 1SZRA 5ENLA 3AS0A 1PWLA 3OQ8A 4FNTA 2ZBTA 2YFNA 2WJFA 5HQEA 4MOZA 1ADOA 1ISVA 4HJFA 4QAIA 5I3JA 5A1AA 2DW7A 4OE7A 2OU4A 3A4WA 1AQ0A 4HPGA 4AQLA 2YCLA 4Z42C 1W3LA 1H7OA 2PWUA 1A5CA 1OYCA 3DU0A 3GR4A 4JIEA 2JIEA 2PTDA 4V33A 1O5QA 1H09A 1KCZA 4Q8TA 1R46A 4GYPC 5DBTA 4LUJA 1P6WA 3O06A 3P2VA 2DIJA 1EGZA 1KXVA 4NZJA 2YDAA 1F6YA 5HJXA 2ZRXA 1A5UA 1EQCA 1TTIA 3HGRA 2V5BA 4XX6A 3BQ6A 3EZ4A 1UD2A 5D30A 1F6PA 2D69A 3ITCA 1O66A 1JXJA 2OMAA 1WPCA 4DZHA 4NI8A 3WQOA 4XZLX 2NUYA 3T55A 1FDJA 4HIBA 3M07A 1YNQA 3SUSA 4KFOA 3L9CA 4Z1CA 1HO4A 5BXTA 3GFZA 1A5OC 1EO5A 2PDPA 2Z1SA 2XSBA 3OW1A 1UR2A 3DCPA 4CNSA 5EBAA 2V82A 3IPWA 3NSNA 1XRFA 2FLIA 3P82A 1FWDC 1VEMA 2Y62A 1VB9A 2QJNA 3ZFHA 1S2AA 2QDEA 4JN6A 3APTA 3PPCA 2PDQA 4E2DA 1QUMA 4R33A 3CAQA 1MYRA 1G94A 4MY8A 4JQ3A 2VZTA 4QCEA 2GJNA 2PD9A 5FEZA 4NZ1A 3NPVA 3BW4A 2Q8ZA 3H2OA 2WNZA 4IQJA 3O7UA 1F7BA 1A4LA 4Q4OA 1TV8A 3PTQA 2B81A 1JPHA 3C3NA 2X30A 4L5ZA 4DUWA 1NARA 3OGRA 3GDKA 4QNWA 4AC7C 4JEJA 1DIOA 2E7FA 1YTKA 4L9YA 4BF5A 1P1XA 2OOFA 4YVPA 3CXOA 1GJPA 2VR5A 3C4UA 3CHEA 3DHPA 3OODA 3HV8A 3VMNA 3T0CA 4IMCA 2POZA 2OZ8A 3GR7A 4MWAA 5DFAA 3M6YA 4M6QA 1TCDA 1IEWA 5D9PA 2H3DA 1LG1A 1BXBA 2QUMA 3M0VA 4TTUA 2ABBA 2JE8A 3WLQA 1DE6A 5IFPA 4RXGA 3EX2A 2DU2A 4WR3A 4N4QA 4AYGA 3OBEA 4C7FA 4OBRA 5I09A 5GNYA 2OLHA 4JX5A 4JYDA 4NY2A 4WXYA 3SCWA 3U48A 2WMIA 3GSMA 1POKA 3R0KA 2VRJA 4FIRA 1EHNA 3TDFA 2QF8A 4IICA 1BFNA 3NSXA 2Q01A 3VXGA 2UWFA 1KNWA 3UZ5A 2WC4A 2XWEA 1JI1A 3PPFA 3WDJA 3SRFA 2DUZA 4GY7A 1ECQA 4V27A 2F9RA 1I0BA 4JNYA 3TR2A 4D6CA 5EFDA 2A7NA 1IZKA 1JDCA 4AZCA 1AH0A 3DHDA 2GGJA 3ITVA 3WLPA 3G1SA 2QUUA 1T7LA 3VKAA 4CU6A 3B06A 2EO7A 4HGXA 1GVQA 3KRBA 3ZSTA 4U33A 5IHSA 4WSJA 2BBFA 3L0KA 2Z1KA 1ECEA 4N42A 4K8EA 4O14A 4HKPA 3EDEA 1YE6A 3R8GA 5DX7A 3CQIA 5E6YA 3MKCA 5F1VA 3OVQA 3WNMA 4DJFA 3G1AA 4F0SA 2Y63A 1A50A 1AODA 2HS8A 4O8AA 2REQA 4M1RA 3TYUA 5HQLA 4M7TA 2XG9A 2WLZA 4O28A 3PTDA 2CETA 2DP3A 3B3DA 1K70A 3PJWA 5EBUA 4IPNB 4O52A 2HTMA 1XX1A 3MZ2A 4MY9A 1VF8A 3E0WA 3EWYA 3VDGA 1IV8A 3MI3A 1FX6A 3H4XA 4LBUA 4US5D 4KEZA 3DFSA 1KBLA 4FLOA 4O57A 2YX0A 2PDLA 2G3JA 2PWFA 1I0DA 3WLJA 3VI2A 3UWWA 2A1YA 1OT1A 1TE6A 1O94A 4AWSA 2YL8A 4OOZA 4PUEA 3B8SA 4ILSA 1VD6A 3T9PA 4UTWA 4XZNX 1P5BA 5CZKA 4AY7A 4JL1A 3QTPA 4F4RA 2D22A 2NQHA 2WBKA 3OBAA 1AA1B 3AYRA 3IARA 3TROA 2BWGA 2OVLA 3THQA 3UZZA 3F2CA 3ZXWA 1GTEA 4M6PA 3ARUA 1JUKA 1PPIA 1RA0A 3A9IA 3QLDA 5I3DA 4B4FA 3V75A 2XZ9A 4M56A 4QTGA 5CAKA 1JCXA 3DFQA 4ATDA 2QIWA 2A3AA 3KLKA 3HPFA 1H7XA 1C8YA 2DV0A 1GWJA 3HQOA 4JY8A 1EKOA 3KUMA 1RZMA 3CB8A 5REQA 1XLCA 1H4PA 1WKYA 1A5SA 1U83A 1BKSA 1XSJA 3EXRA 3K4DA 1AG1O 5A8PA 2FGZA 3E2RA 3D46A 3IRSA 5IDIA 4BWLC 2VVNA 2CZDA 2GQAA 3WH8A 2ISWA 1XYFA 4C1KA 5G2IA 3F7JA 3OYZA 4I7UA 2I17A 3SFWA 4PMQA 4JTTA 1PKYA 1JNDA 1OIFA 2O7SA 1AFSA 3RPDA 4DJEA 4WJEA 1VBUA 3H2NA 4AVNA 4RDVA 4IH3A 4OHQA 3WUBA 2FTPA 5HQMA 1V0NA 5TF0A 3S42A 2J8FA 2C71A 1J6OA 3QYSA 4QDWA 1W9PA 5MKGA 3QF0A 1E1EA 4HN8A 3VMOA 1KR0A 2J7CA 2OPJA 5AY7A 1RCQA 5CBIA 5LNRA 3K4AA 1YW1A 2I57A 1KWKA 3MSRA 3QQ0A 3GDRA 5LIXX 3VIKA 3B8WA 1OD0A 1BWKA 1ZBVA 3PPGA 3VMPA 4IL0A 4GYJA 4S3FA 2XVLA 3WIJA 5JH2A 1PX4A 2FMOA 4RZ5A 4ES4A 5BOOA 4G7FA 3M0HA 4C7GA 2I9UA 3NIYA 1FWTA 3TOPA 1H1ZA 3SEPA 1XC6A 4IIBA 3WD3A 4ZQOA 2DZWA 1AZ1A 1VJZA 4I7VA 1W31A 3VGBA 3L5AA 3M0JA 3NR0A 5C2CA 1J2WA 1FH7A 3AFBA 4TUFA 4HA0A 1E3ZA 1VFLA 1YBQA 1J8VA 1QAPA 3AHXA 4HHMA 1SW0A 3PBYA 1LM1A 1X1NA 1Q6OA 1HP4A 5ABEA 1MUCA 1TV2A 4QHRA 1U22A 3GYEA 1V7AA 4JIQA 5AYXA 3U5UA 3VIIA 1R3WA 3BOXA 4LVGA 1UQYA 4ML9A 3TAOA 4Y96A 3K1DA 3VAVA 3S6OA 4CQAA 5AFDA 4PE8A 3FJLA 4WKHA 4E3TA 3FV9A 3S83A 2R1LA 1JCLA 3MA8A 2Y5JA 4OV4A 1WZMA 2YL9A 5LNVA 3W3OA 2Q6ZA 3WMCA 2PPGA 2VCBA 3WNOA 3EDFA 1DVJA 4JTGA 1G67A 4IHCA 3LTYA 1NOUA 5K3VA 3GE7A 3RILA 4WY0B 2NV1A 2TYSA 3KP0A 2Y2WA 5HMSA 2WZMA 4WUIA 2ALRA 2YIHA 3N18A 3TTQA 1KGXA 4ERIA 3NM1A 1THFD 1Q6DA 3RCNA 1BRLA 1GVRA 3E02A 4HZ8A 2JGQA 4E8DA 2ZUUA 4HMDA 3V16A 3LHUA 1LOLA 4I90A 2E67A 3CL8A 2ZWZA 2YA0A 4FLQA 1DWGM 1IQ8A 3D3AA 3U2CA 4PMRA 3VDCA 4UXDA 1NM9A 3U2ZA 1SW7A 1Q3NA 2RUSA 4WD0A 1KM5A 5D9MA 1ZAJA 2QJMA 1W9UA 3UY8A 1UR8A 4CVWA 1J0IA 3SCVA 5T8GA 2FFIA 3S8HA 1P1MA 4TTGA 4B91A 1TKKA 3WKZA 3JW7A 2Q3OA 1W3KA 1LZOA 1XQLA 4YYCA 3STCA 3CIVA 3H7VA 3WJXA 1EP1A 1FKWA 1XXXA 4PMJA 4P7LA 1ISXA 2BVTA 4HOXA 4D1IA 4OFCA 3W22A 2PDIA 2D0HA 2JF6A 2LLEA 2BOGX 3SO7A 5K7JA 1KFCA 1VIZA 2PAJA 1FCQA 1I8JA 2NT1A 4K2SA 4JTFA 2X1RA 5E70A 1KTNA 4WDTA 5J5DA 1X7FA 4UTJA 1UH4A 1KRAC 1B90A 1BD0A 2YJQA 4D8LA 3G18A 4CCEA 1Q66A 4WK9A 2GJPA 1VHNA 1XUZA 5ABHA 5LSMA 4GC3A 3E2VA 4BY3A 4POCA 3FDKA 3HMJG 4AU0A 3M5XA 4MG4A 2IKHA 2HK0A 5A6AA 3KHJA 4O18A 4IGMA 4PMDA 4F40A 1M5WA 3MCOA 4EWND 3FVDA 5A94A 1XLKA 2GLKA 2PDXA 4Y90A 1PHWA 1Q4WA 1WB0A 3AXHA 5LZLA 2Q71A 1JZ3A 5IBXA 1EDQA 4FR6A 1QI5A 3MSGA 1I2NA 3VIHA 2E68A 1Q6CA 1EJXC 1KFBA 3R0DA 1JYVA 5DF0A 3S1WA 1O7AA 3GG1A 4LRSA 1R86A 3W2MA 4DWSB 3FYYA 2E25A 5CPLA 3KBMA 1XQKA 5AYBA 2J47A 3G1HA 1W1YA 4ZOEA 3NQVA 1TJPA 4CCZA 3TLQA 3RUBL 1UW9A 2YB4A 3PAOA 4MUZA 3TTSA 4XVDA 2CERA 3PBGA 4UQAA 1E6QM 2R1NA 1OZMA 3PTKA 4H9ZA 1HX0A 2B0MA 2GK1A 3V5FA 1E43A 3BWWA 4FI4A 4Q8QA 4BI7A 1WA3A 1XGDA 1BYDA 1ZL1A 4RKAA 4Q8UA 3PZIA 4MNMA 1RA5A 1B57A 1DPMA 3G6LA 5E1QA 1XD1A 3S9IA 3TN3A 3AMKA 3VIOA 2NQ9A 2Q09A 4CQCA 3QEZA 1IWBA 1ZS2A 5F2MA 3SCUA 3H2MA 1PL9A 2BP1A 1X6NA 1FKXA 2TPSA 1KFJA 1H5VA 1HKJA 3BURA 4W88A 1MRAA 3MVIA 3H4GA 4I5RA 4U4MA 4MMWA 1US0A 1K03A 2BY3A 2HJPA 2DSKA 3MTWA 1TV4A 4JCMA 5CPSA 4M24A 2VENA 4GUHA 5BOEA 2HXUA 1D9EA 3IJ7A 3GX9A 1FP8A 4DZ5A 1H7NA 2WJDA 2D1ZA 1Q13A 1XLMA 2V5CA 3Q45A 2EJ1A 4FIQA 4GQRA 3BL3A 2NQJA 2XH4A 5GVJA 1E0TA 4XWUA 2FDSA 1K9FA 3N2BA 5LA1A 1OM0A 3AHYA 3H12A 3WENA 3DFTA 1C8QA 2ISVA 2BHUA 4HYWA 1VLWA 4H8UA 3LGGA 1BG9A 1SO6A 1DJYA 4WF7A 5DLCA 2V2CA 2VFDA 3AYSA 2DSZA 3OU8A 3WCZA 3RM9A 1TJ2A 3SCTA 1T96A 2BXVA 2DDXA 1K8CA 3N17A 3D47A 3EB3A 3C8NA 3W25A 5E6ZA 1GQLA 3QY7A 1Q7MA 5KTLA 5EU9A 2E1DA 3OIHA 3V1PA 1AMKA 3RJYA 4DZAA 3IJDA 1R9XA 3DG6A 1WXZA 4C6OA 4H2CA 4WJ8A 1FTXA 1ICSA 2NT0A 3AIWA 4LQ1A 5D2TA 1F3XA 1OFDA 3DENA 2WM0A 1EEXA 1E9LA 1M04A 2BMBA 5G4HC 3S3GA 1SYTA 3DFOA 4YVVA 3O16A 5HNRA 3S5OA 3G3DA 1WDQA 2CBUA 4HNTA 1QDSA 5TD4A 3I3DA 1H11A 1NDWA 3UWQA 1DQXA 3K8KA 4AG0A 5FF2A 2BTMA 3GNDA 3LM3A 3TW6A 1CB2A 2D2HA 4EF8A 1W54A 3W81A 2VFFA 4NQ1A 3MV01 4Y9AA 3KBJA 4C65A 1A53A 3DBPA 1RAKA 4KKXA 4AIBA 1F4HA 3GTFA 1W9VA 4IFOA 2J77A 4QQUA 2GZXA 1NIUA 1LRQA 4L6DA 1GOXA 3QGVA 4LGXA 4AIOA 3VZZA 3MHGA 1EBGA 1BVWA 4U2YA 3W76A 2W92A 1FH8A 5AOUA 5C9XA 3F4CA 1B4EA 3VNMA 4XAGA 2ZX8A 1FDYA 4XISA 2O9PA 3CLWA 3FJNA 1EHAA 2E8ZA 2HBXA 4JTLA 1H51A 3G3MA 1BLIA 2J7HA 1GOKA 4PSPA 2OO0A 2NSXA 2WM1A 2OEMA 4PCNA 2C1HA 1LDCA 1LL6A 3LHYA 4CQ9A 1EZ2A 1S39A 2O55A 4ZQMA 1FXQA 3YPIA 4MKSA 1N8FA 3K1GA 4AD4A 2EQDA 2JFEX 2OWWA 3QOKA 2D24A 4MNLA 4AAJA 1DXFA 1PYMA 1UH2A 4TVDA 3ZLFA 2PP0A 3CTLA 1B9ZA 1OFEA 2PDCA 3SAZA 3B97A 4XAFA 4R3UA 3GNNA 2QJHA 3M0ZA 4LANA 4DF0A 3AXKA 5JMUA 3F5LA 4UFMA 1XLGA 3RDKA 4ROPA 2DZSA 4YVXA 3LU2A 2D23A 4HA1A 1NOWA 1ZSXA 1QVBA 2BDQA 1F8MA 4F0KA 5AYYA 1Q4NX 2A79A 1S38A 4ATWA 1M7OA 2EKCA 4U28A 2E9MA 1UPMB 3VM7A 3R8RA 1UC4A 2ZKMX 3VNIA 2IPJA 4D6JA 4JAWA 5IM51 1QI3A 2PTXA 4NAEA 2YA1A 4J35A 2EPMX 3DYOA 4AZIA 4KFNA 4AD1A 1C9DA 3EXTA 5LHFA 4X9YA 3TC7A 3LENA 4NXKA 1XC4A 1OHLA 4G5DA 2G3FA 3QZEA 1V3LA 3HBLA 3UWEA 4RR4A 4PMUA 2EHHA 4ZO8A 8A3HA 4IIDA 3CQHA 1YPXA 5G4WA 4X61A 2XVGA 4GI9A 3SURA 3PNZA 3AXIA 2OXNA 2IQTA 1YDYA 3RPTA 5D32A 4H9UA 1HO1A 2YW4A 4UBPC 3DG7A 4R9OA 1MZRA 3QHNA 2YYTA 4BK9A 1H7RA 9XIMA 3NZQA 3VFLA 1O6IA 4QS5A 1QOXA 1UUOA 2QZRA 3N2MA 2AL2B 3HV9A 4JFUA 4L4MA 2FIQA 3SBFA 3MSDA 4FB7A 1G4SA 4K1WA 5CJNA 3KHDA 1Z9AA 1OIMA 5EL1A 2A5HA 2QW5A 2ATMA 1VBRA 1PX8A 2HVOA 1QOQA 1RCOB 3GO2A 2OOGA 1X97A 4ZE5A 1QW8A 4O0QA 3G1YA 4FXJA 1GT8A 5HR6A 2D3NA 2W27A 4NG3A 5HWNA 1E9YB 2A7RA 1E15A 5A5WA 1MRQA 5BRBA 2FHFA 4OIFA 2VFEA 5H91A 1CBGA 1NFBA 2CBVA 3LCLA 3WH5A 4W9TA 4TV5A 2DSWA 3UR5A 3ZR4A 5DRCA 2FQIA 4UOZA 3TK7A 3I68A 1TVPA 5HWMA 3UPMA 1ICPA 2ZICA 3F4NA 4XVEA 3AXXA 3CWHA 4JTJA 3WJYA 3UPBA 1GORA 3ATYA 4TX9A 4S2CA 4HU0A 4BA0A 1NEYA 2V3GA 4RCXA 3W38A 3KCJA 2R6OA 4K1GA 4HTBA 1XISA 1RLCL 4R9XA 4HCDA 1PKNA 3PZGA 4IMAA 5A8QA 3ZJ7A 1G7UA 1GG0A 1P7TA 3A6OA 1HP5A 3QC0A 3M4HA 1TZ9A 1Q85A 4WVXA 1K4HA 4I9JA 4HMCA 5BWAA 1PJ9A 5A6JA 3ATZA 3WDPP 3MI2A 3VE7A 1Z89A 2C18A 3SRHA 1GZ1A 4KCUA 3O63A 1YX1A 2VO5A 3ZS4A 1TPEA 4IJRA 1UA7A 1UUMA 2QXWA 1P0EA 3IVUA 2ZRYA 4H9XA 4CQDA 5CPTA 1W37A 1D2KA 1Q65A 2BS9A 3TIMA 1M01A 1JDDA 2ALDA 3CAKA 1A80A 1CGVA 2A6NA 3TYZA 1PZ1A 2R9RA 3S9YA 5CPNA 2Z1BA 3XISA 1XG4A 3ARXA 3W23A 5E09A 4I3GA 1U1JA 4C90A 3ITXA 1U30A 1E73M 1VEPA 4HYRA 4NF7A 5D04C 4MDOA 1UMYA 1LP6A 2V81A 3GKFA 4IJCA 4S3AA 2ZRUA 1XIEA 1KCLA 3UNTA 3TU9A 2J25A 1UWSA 4LNYA 2ZOXA 2GVLA 1WZKA 2IQDA 4Z2JA 1SSDA 3FJ6A 1QNOA 4GZEA 1HJQA 1N8IA 1F73A 4D6DA 3ISIX 4IL2A 3DKLA 3TX9A 2C1GA 1ZY9A 4MZYA 3HFTA 2V5KA 3GIPA 4A3UA 1PEZA 3IJQA 4CGTA 1YYAA 2VGFA 1EJWC 3TXZA 3BV4A 3BAJA 1F3EA 2EPKX 1SJAA 4C60A 3CMFA 4MB3A 5FF4A 3HJZA 3NWRA 1C8VA 4W87A 1R9YA 3T8QA 1XSIA 2W4XA 3RN6A 4DUVA 5E9AA 3ONCA 1Q7QA 1FWIC 1LBFA 3IACA 5J8LA 1OD8A 3R10A 2IPFA 1V6WA 2VYOA 1GEHA 3QQ1A 2VZUA 1FFRA 3KEHA 5BYWA 3REQB 3WUGA 3AHTA 5G2WA 1EF2A 4RPPA 4FXSA 4W86A 4ZB2A 2YCJA 1UKPA 1XI3A 1QPQA 1NU5A 4HU8A 3O07A 4L80A 1L9WA 2GPTA 3T40A 5KITA 1VRDA 3L65A 1CXFA 1EEPA 2E28A 2QR6A 5HOSA 3TZFA 3EDJA 3AUJA 1CDGA 4CN1A 1J0ZA 4W5UA 1BTMA 5ABTA 3Q67A 4GC4A 4Z0JA 2BG5A 3VGDA 3KOYA 3W7DA 3I6EA 2J27A 4Y6GA 4S3DA 2C1IA 3L4YA 4WHBA 1RD6A 4G1NA 1O4UA 3WD2A 3SUVA 4B5VA 2OQYA 4DO4A 5BRQA 3C86A 3KLLA 3SQSA 4C6BA 3SSJA 1X8FA 3ALFA 1OGBA 3L21A 2VR2A 3H53A 1NH6A 2YCEA 4JTIA 5HNTA 4RE4A 3EGJA 3P8JA 4FNSA 4NAFB 3UG3A 1LUCB 1VFMA 1JIBA 3ID7A 2GQ3A 3IGSA 4AHOA 2V5LA 3JVAA 5I06A 1VFFA 4HHPA 1J0YA 1SJDA 2QV4A 4U5IA 3BCJA 5M03A 1KGUA 4PA8A 1RPXA 3EMZA 3VD5A 4XUGA 1IEVA 4HBKA 3ALGA 1CGTA 1OBAA 3KOXA 4GINA 1G01A 2CBIA 2GGIA 4TIMA 1FWGC 3W02A 2BLEA 1K8XA 3GYCA 4C6KA 2BVDA 4UCGA 4EAYA 1MSSA 4HSHA 1E3XA 3FNDA 2IKIA 1HKVA 3GIYA 2C0HA 2RGLA 3AS2A 1ZBCA 4AD5A 1GVIA 3QXBA 1J11A 5ABFA 1VBJA 2C0AA 1KD0A 3M0MA 2E4TA 4PTDA 3U7BA 1K8YA 3R1ZA 3W26A 1A0CA 3G8RA 2HROA 1DORA 2UY3A 3MDWA 2VD9A 4PFHA 4A8NA 2PTWA 3IJ9A 1HL9A 4IQEA 1D3CA 4LVAA 3V5OA 1DTNA 4QLJA 4UB9A 3W37A 4NILA 3NQ8A 1NSJA 2XFYA 4O1EA 3TMLA 2CZFA 1JJKA 1XIFA 2Z1XA 4E2VA 3MC5A 3CHCA 1R9ZA 2Y7EA 3NL3A 2QCCA 2L5HA 3B04A 1E1CA 4DNHA 4KWOA 1VR6A 3BDKA 3GXMA 4G56A 3ZVIA 2DSUA 2XVPA 1XH1A 2Y4SA 3QZ6A 3KBVA 1GOWA 4GFIA 4W93A 5HNUA 3PN8A 2YZ5A 1AH4A 4AF0A 3FEMA 1O5RA 1CGYA 7ODCA 4UNIA 3QN3A 1VJSA 2HCVA 2YZRA 3HA1A 3N11A 5D2XA 5BCAA 1E5NA 1NDVA 1JUBA 1D7FA 3UWYA 2VFHA 4QJ5B 2ZA3A 3QBUA 4F2BA 5DY3A 2XZ7A 2WMHA 4PB3A 1XLEA 1WQ5A 7A3HA 1BQCA 5ECVA 4K7YA 1CECA 4H8HA 4P8WA 1VC4A 3VYLA 4U3AA 4MUPA 4ALDA 2EPOA 4RUBA 3UY7A 1JGIA 4JYFA 4Q3MA 3FA4A 4PMXA 4W85A 3SCSA 2B7PA 3WNNA 3S6DA 2CEQA 4QSFA 1LQ2A 3LXAA 3P0WA 3BGJA 4OWGA 1EFZA 1ONRA 2J24A 2WMFA 3VOIA 4UTMA 1XFCA 4QE4A 1PCKA 3SB0A 4DN1A 1W5NA 4XTDA 4YMZA 4HK6A 4FEZA 4QSHA 2UV8G 3MP5A 2PEVA 1ONXA 1RK6A 4NHVA 1IZJA 4IQDA 3EA3A 1G6CA 2D0FA 1V6YA 1B54A 1GVFA 1E0XA 3HZ3A 1E6RA 3ABSA 4PC8A 3QV9A 1NTHA 1ESWA 3B9EA 4GABA 5EKYA 4CNOA 1WDRA 4PL2A 3QY6A 4ZXOA 1WUFA 2PDKA 4IFKB 3SCQA 1V6UA 4LAZA 4JFTA 3UVIA 3ZR6A 3U57A 4KW2A 5AECA 4KCTA 1XBYA 3QR3A 3COTA 4Q7IA 3CZGA 4LAUA 2EPNA 2J8TA 4A22A 1JULA 2P10A 4XTIA 4J2PA 3EXSA 1QWKA 4PN2A 1PO9A 1E56A 1J0JA 4H7ZA 3ZVHA 4N6FA 3BK0A 2PRLA 2GVGA 3DHFA 4I5UA 4AEEA 1C8XA 4LUSA 2FVMA 2PRHA 1OADA 4H9MA 1VZWA 1JF6A 1XYZA 2PBOA 2NX3A 2A3CA 1UB3A 2E6DA 3M6DA 4UFHA 4IT1A 2EBNA 1B9BA 3N6QA 3QHOA 1ZJBA 1V77A 4RE0A 3SDOA 4DWSA 1F76A 4QX4A 4HYVA 3HU7A 4BI6A 4UQBA 1CX9A 5E0FA 3L4UA 2WMGA 4M1BA 3W27A 5LIUX 2ISDA 3EWWA 2HE5A 5EMJA 3AIUA 3VD3A 4LX4A 1LLWA 3S1VA 3SY8A 1HGYA 1WAUA 1B5TA 1FHDA 1T99A 1HVQA 1SZFA 2O92A 2ZXBA 1P4CA 2PI6A 1WXJA 5EFFA 1RQBA 2G95A 3NQAA 3LV6A 1BYAA 4GXPA 2X42A 4NI3A 1TG7A 3R12A 2QLYA 2IPWA 4F66A 7REQA 1GNXA 4H01A 4NJHA 4MGGA 3W71A 1Q2RA 4I8YA 2C16A 4MWAC 3LXBA 1L6YA 3OTRA 1CT5A 5CSUA 2VM8A 5LGXA 4PMNA 3SZ8A 4DBSA 1VCVA 3FW6A 4BHYA 2Y7GA 4GJIA 4FAMA 2XGBA 4LY4A 3WLRA 4R7JA 1A5BA 1L6WA 4DAFA 4XKYB 3MCNA 1QHPA 4Q4MA 4Y9MA 1OX4B 3O1NA 1H3GA 3SN1A 4RLIA 3EBVA 2CZ5A 2O4QA 3CH9A 5LXXA 2V2HA 3Q94A 4DLFA 3B8IA 2DGAA 4PSRA 4WJXA 7TAAA 1S3TC 4GXWA 3ANUA 2GFTA 4JFSA 2DQXA 3UF9A 3JS3A 1EYEA 3GK0A 1BTCA 4HCHA 2OTDA 1UASA 1TR1A 1AVAA 5I77A 2ZZ5A 3UXDA 2A0NA 2OCZA 4B5SA 5I23A 4DF1A 4ZTXA 3U5YA 1SSGA 4PRTA 1XGZA 3MUCA 2Z4GA 4P2VA 5EMLA 1RCXB 4V1YA 3OLGA 3CS2A 3A13A 3LB0A 3EWZA 4QG8A 3AALA 2FGBA 1DJQA 4R5EA 1OFQA 3BZJA 5A95A 1EWEA 1SMAA 3BAKA 3NEHA 4UOQA 2WSRA 5AHIA 1ONEA 4R7WA 3H23A 4C6LA 2FB3A 2CLHA 2CNCA 3LTPA 4D1JA 2F84A 4DJFC 1OF6A 3B40A 1TE1A 3MSYA 1EXBA 3UESA 1G69A 3P84A 4JX6A 1L8PA 1IWAA 1M1BA 1W32A 3FGCB 3G22A 1E4IA 3QMSA 1E6NA 4L64A 4XV0A 4PZVA 2YR1A 4PBEA 2YXOA 4DI9A 3OVRA 4CN6A 1XF0A 2XFFA 4Y8FA 5HPOA 2JQXA 3DGRA 1QO2A 2DSVA 5FEXA 5H2ZA 3TSMA 1QFEA 1HKKA 1YPFA 3R89A 1EJUC 4OKDA 3MANA 4HPXA 4S3KA 1K8ZA 1RY8A 4DB7A 2OODA 4B3ZA 3R4IA 3VM5A 4CD6A 1CLKA 2BXZA 2PFHA 2VZSA 2YOCA 3P7YA 4W8AA 3EOEA 1LLOA 4GIRA 3GB6A 4O16A 4JEQA 4KEUA 4X60A 4S3BA 4Z0SA 4F0RA 1X38A 1R3RA 1W0MA 1QW9A 3KL3A 3A9BA 1B31A 3A21A 4GCXA 4DWDA 4L1WA 4N9BA 4OBTA 4AX6A 1RJRA 3O3RA 4QE5A 2ZUSA 4LJ3A 2CWNA 1Q6LA 1NP2A 1FA2A 1VFOA 2QYGA 4K8GA 4NU7A 3C8FA 3VNKA 3F2BA 3NPUA 1XD0A 2G37A 3NO3A 2HWGA 4HNUA 3KVMA 4ZQNA 4XZHA 1GKPA 3THDA 5XIAA 3HB9A 6ALDA 1A0EA 1DIEA 1U5JA 1QI4A 1GUVA 2R24A 1K9DA 1VS1A 3HG4A 4DO5A 3R43A 3G1FA 3F2DA 4DJDD 1EJTC 1YKWA 4AZ6A 3EOLA 4FO4A 4LRTA 2GDVA 1EX1A 1KO0A 4XZMX 3W1PA 3LA4A 4DM2A 4ZFCA 1K7EA 1YIXA 1Z41A 1TPH1 3WYZA 1TA3B 4AY8A 4S23A 1XBZA 3GKAA 4KRTA 4XAYA 3KVKA 1ITQA 4W7VA 4Z1BA 1IEXA 2WC3A 4GVFA 2DY3A 4GWEA 3PF3A 1HUVA 4DXXA 1WKFA 3VKCA 2ZUVA 4GKLA 2C7FA 1JG9A 2D2GA 1OVDA 3DKJA 3IGXA 3CZEA 4M0XA 2FH6A 2Y7DA 3HF3A 3XINA 2V0TA 3NCOA 1JQXA 2X05A 5C2GA 1J4EA 1Q2SA 2HEJA 3F5JA 4A8RA 1UKQA 3NL6A 4XSMA 1UWRA 3FXGA 1Q63A 2OSXA 3C3UA 3RGTA 5AHLA 1RJPA 1I1XA 3VNLA 4CKQA 4ZO9A 2E6YA 2Y1HA 3N9KA 3UQNA 5I6SA 1NQ6A 1JD9A 1T8XA 3F4VA 3EWBX 4EAMA 4HK7A 4BQ4A 4AXKA 4O12A 5K9DA