3GDRA

Crystal structure of the d91n mutant of the orotidine 5'-monophosphate decarboxylase from saccharomyces cerevisiae
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
260
structure length
260
Chain Sequence
b'KATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFENRKFADIGNTVKLQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLATGEYTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
molecule tags Lyase
source organism Saccharomyces cerevisiae
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
total genus 102
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3gdrA00
3HPXA 4JICA 3W23A 3MO7A 1PV8A 3P5YA 3PAJA 4NZFA 3W9ZA 3WJXA 4XUGA 3LHVA 3T44A 4K36A 3SI9A 2CLHA 3TK7A 1FCQA 5EKYA 2NV2A 5MHBA 4IOTA 2A6LA 2TPSA 3MP4A 4N9CA 4K38A 2BWGA 4PEKA 3TSMA 3S1XA 3B05A 4UTHA 2P10A 2Q3OA 3NEVA 5D30A 2CLLA 1G4SA 3GDLA 5CZ0A 2AQWA 5E1QA 3HO8A 3WK3A 5D32A 4RKAA 4GUJA 4PL2A 3CC1A 1HO4A 5DELA 2WO5A 3M6YA 3GDTA 3DFQA 2WSYA 1PE1A 1OFRA 1SO6A 3RU6A 4M6QA 2WOQA 2A2IA 1TMHA 3LTPA 3W1AA 4LV4A 2YFNA 1HFBA 3LV6A 3QJAA 3W7NA 3STFA 1GYNA 1KBJA 1KFKA 4LNYA 7TIMA 4HT3A 1T99A 2V9DA 3BARA 4IXXA 2ZZ1A 3W2LA 4K7YA 3UWWA 1H7WA 1JCLA 5K4XA 5FF3A 3M7WA 1W3NA 1SO4A 1TV7A 1KM3A 3NQCA 4MFDA 4H4IA 3LI1A 4E0CA 4RXGA 3HGOA 4QISA 3W1TA 1KBIA 5J5DA 3M9YA 3HIJA 1LM1A 4M19A 1EP2A 3EX1A 1W56A 4IMGA 3C3NA 1TREA 1OX4A 3FKRA 1VHCA 5AB3A 3W86A 4KFNA 1V7YA 5LKYA 1VQTA 4M6PA 1GG1A 4BI5A 5AHLA 1G4EA 4JX4A 2ATMA 4OBTA 1YTKA 3FOKA 5FI8A 5AHNA 1H1YA 1SZGA 4JTIA 2ZZ4A 4JTTA 3BW2A 2BZNA 2C16A 4LUIA 5J5RA 1SZFA 3TV8A 4BF9A 3SECA 1VHNA 3GB6A 3R2GA 4MY9A 4KWVA 4Z0JA 5D02A 3CLMA 1BWKA 3BW4A 2QDHA 4MY8A 5I3GA 4XBSA 1AK5A 4RZ4A 3N73A 5F2MA 5D2TA 2HMCA 1KM1A 3DFSA 1TJPA 4YXGA 2OMAA 1FDYA 1G4TA 1SO3A 2C1HA 4QITA 2BLEA 3YPIA 4FHAA 4Q4KA 3F03K 4U4MA 4NJHA 2JKPA 1SQ7A 3W1LA 1JR1A 1F7BA 2ZRVA 1W5OA 3NL5A 4OGZA 3ANYA 4JEQA 2VKZG 3OEXA 2V82A 3F4NA 3FEMA 2YYTA 2H3DA 5FF0A 4O11A 3TW6A 2DU2A 3MI6A 2X1SA 3E96A 3NO5A 1MEWA 4GE8A 4WXYA 3WK2A 3LDVA 3PG9A 4N4QA 4XTIA 3E12A 5EYWA 2QEZA 1YLVA 2QCFA 4YCPA 1KM6A 3JRKA 2Y63A 3IGUA 4JNMA 5EL1A 1BKSA 3MJYA 4O14A 5K9DA 1YPIA 3IV3A 3PSVA 3S1WA 3ABQA 4UTMA 4I7VA 5D09A 2RHGA 2NX1A 3HJZA 3PBWA 1OVDA 1LBLA 3ABOA 4HKPA 3KVJA 1LCOA 2TMDA 4UMBA 3W72A 1K7XA 4WX2A 2Y6ZA 4Z0SA 1KTCA 2YDAA 3S42A 1LBMA 4MIMA 4JTLA 3TC7A 1UASA 4ORIA 1TRIA 1M7OA 3PBVA 1UJPA 3DH7A 4IPJA 2GQ9A 1VCFA 1R2SA 1QCWA 5D38A 2QUUA 2W79A 2QAPA 3BW3A 3OVQA 3W75A 3TMLA 4XTDA 4J9JA 3G8EA 4H3DA 2R14A 1TPUA 2HS8A 3NQ6A 3W7MA 3GXPA 4C1LA 1I2NA 2C19A 3L68A 1SW0A 1KLZA 3M5VA 5LNUA 3C0JA 1KFEA 1B4EA 3MI3A 1CI1A 2A6NA 3L5AA 4FEZA 4R53A 1W3IA 2A7NA 3FLUA 5C6MA 1O4UA 1GEQA 3EXTA 1EPXA 5CG7A 3UD6A 1GT8A 1XCFA 4MZ8A 4I7UA 3IVTA 2J9XA 2FFCA 1WAUA 2YFOA 2ISVA 3P74A 3N14A 4M6VA 1TTQA 2B7PA 1F6KA 3L66A 4JDBA 3GK0A 4JY8A 4ZQOA 3LHWA 1GWJA 1LOSA 1W5NA 3GKFA 4AB4A 2X30A 1Q3NA 4KWWA 1VLIA 1QO2A 1EB3A 1KTNA 2I1OA 2Y7FA 1LBFA 2B4GA 4O4WA 3D0CA 4UMCA 4FNRA 1Q6LA 3W76A 3B0VC 2QCDB 5LNRA 3IVUA 2J27A 4MJZA 4IX2A 3NZ1A 3I7RA 1NSJA 3LERA 4GBUA 3GAYA 3NL3A 5F4XA 1LP6A 3TQVA 1XL9A 1XBXA 1W54A 4NU7A 4QNEA 2W0UA 4UTTC 1H61A 1K8XA 2WJZA 2QUTA 2Z0IA 3S9YA 2NX3A 1AMKA 3EX6A 3KOFA 4JYFA 5H91A 3TJXA 1CX9A 3WJWA 4KFOA 2DZSA 2A7RA 1FDZA 4WOQA 3LCWA 3MW7A 3PG8A 2ZRWA 2ZFAA 3LRMA 2VENA 3UXDA 2A7PA 4L4MA 5HULA 3QH2A 5A8GA 4E38A 3CWNA 3Q37A 5G5IA 4AH7A 1RQBA 2NUYA 3UWYA 1A5CA 1GYLA 4X3ZA 5DBUA 4UTKA 3NQDA 3W1QA 3N34A 2CLMA 3ZWSA 2OJPA 2J88A 1GVRA 4YWIA 2ZZ3A 1F6PA 1ZNNA 2XN1A 1EIXA 3S8HA 3G0XA 1SO5A 1SFJA 3E0IA 3FJ6A 1MEIA 2HS6A 1ZY9A 3CWOX 3INPA 3IGXA 1HUVA 3FIGA 5D33A 4BWLA 2CU0A 4P2VA 3BGJA 4CQ9A 3G1SA 4LVFA 1VJIA 4FX6M 3LOTA 3FYPA 4JX6A 3T40A 3T4CA 2ZQ0A 3LHUA 3USBA 4GRSA 4Z08A 3BLIA 2XFWA 3B06A 4B5NA 3NYZA 5HNRA 2FLIA 2RDWA 2ZTKA 5AYZA 5CZJA 2ISSA 5L9FA 4CCEA 4CQAA 4K39A 2B7NA 1D3HA 5DCBA 3TW7A 3P62A 3TCEA 3UWUA 1VYRA 2R91A 3PS7A 3GNDA 3OVPA 3F4WA 1QOPA 1O5KA 2B0MA 1VYSX 1QNVA 5DN1A 1I8JA 1LOLA 1MEHA 1TO3A 3W2UA 4FX7A 4P61A 2Y7GA 2QCHA 1QOQA 5DBTA 1TTJA 4GUGA 1XBYA 2FB2A 3L0GA 1K8YA 2Y88A 1JQXA 4O4VA 3QPZA 3SFKA 1AL7A 5EPDA 3G18A 1QFEA 3ELFA 1H50A 2EKCA 4A21A 4A2RA 3W1XA 4ZQRA 2C15A 3N3MA 3W07A 3LM7A 3P8JA 3E49A 3GKAA 2B7OA 3GAKA 3ZS4A 5AHMA 4PFMA 1IGSA 1X7FA 4EF8A 3G1FA 3GVGA 1YTDA 3O16A 2QDGA 1KLYA 2OT1A 3W7KA 4DPQA 1E51A 1TPFA 3G1VA 4R7JA 3DI0A 4K6AA 3EB2A 4JTGA 4A22A 2NLIA 3NA8A 1GOXA 3HMJG 4MYXA 2GUUA 1QPRA 4N2YA 3L0NA 4DO5A 2KZHA 4LRTA 1JUBA 3ZR4A 5DY3A 3NQ8A 1TSIA 4W9TA 5KINA 3G1HA 4QM1A 1LDCA 3TXZA 3BV4A 5KSWA 4K8EA 3EX3A 1DBTA 2G95A 1VZWA 1KW1A 3A5VA 3NQVA 1P0KA 3P61A 4MZYA 4PL1A 4GUFA 3DKLA 2Z1BA 4KKXA 1PHWA 2CLKA 1ZALA 3FJLA 1GZGA 3ZWTA 1VYPX 1QDSA 4ZL1A 3KVLA 5LNWA 3G1AA 2AAMA 4UMAA 3W7LA 3TQ0A 1TJRA 1HG3A 4A29A 1RPXA 4DEFA 4Z1BA 5FEPA 3TH6A 1TPC1 1QMLA 3L9CA 1GJPA 3W7PA 4E2BA 5IBXC 2GQ8A 3GDRA 3KAOA 3KXQA 3WJYA 4CCCA 3QQ1A 2EAWA 3HG3A 1SW3A 4TX9A 3M41A 5BW6A 2F7FA 4JN6A 4O8RA 1FDJA 3EKLA 2FPTA 1GVSA 2LLEA 2NXGA 3IIZA 3LCHA 3S1UA 3TA6A 3HF3A 3RMJA 2YYUA 1IXPA 5BMWA 2Y62A 3L5MA 2YGYA 3IEBA 4O0ZA 3NM1A 3PULA 3EWZA 5KZMA 5I3KA 3ATZA 3NZRA 3QSTA 2BX7A 3HGSA 5HR6A 5DXYA 3CTLA 3SJ3A 3LHZA 3HG2A 4N9EA 4ZQPA 1T0OA 2Y61A 4UFKA 3DKJA 3W84A 1CW2A 1R30A 4ZQNA 4O18A 2EGZA 4Y90A 3G3MA 1EEPA 3L67A 1OFPA 3FFSA 1LYXA 2JGQA 2G97A 5I3JA 2WSQA 5F1UA 4DBEA 4RK8A 4XZ9A 2GVGA 4FNUA 3W7DA 3MWAA 3TROA 2A21A 4Z1DA 4MJMA 4O19A 1W1ZA 3MBDA 4TU1A 4FNQA 4O50A 3S5OA 1JCJA 3C2RA 1KA9F 2UV8G 5D2VA 4NXSA 5LHEA 5LSMA 1XKYA 5HUOA 2H90A 2ZA2A 3OVRA 3BLEA 3TIMA 4JTUA 1YXCA 1T8XA 3FS2A 1FWTA 5FESA 1WDWA 3BPWA 1OJXA 4MLRA 2DZUA 1ADOA 2VFEA 1FCVA 1TV8A 1C8VA 5G1YA 1OX4B 5F4WA 1W5MA 2QJGA 3P60A 5CGQA 5U7SA 4AXKA 1J2WA 4UTJA 4FXRA 1QWGA 3G0SA 1YXDA 3IVSA 4HNUA 3E9AA 3IIOA 4GJ1A 3NOEA 4MOZA 1O5XA 3TU9A 1TPDA 2W6RA 2E09A 1IXQA 4O52A 4CNNA 3NM3A 3GDKA 3B8DA 5U4NA 2ZRUA 3W83A 2V81A 3QPYA 2V0TA 2QCGA 5LHFA 6ALDA 3WJZA 3LHYA 5CSSA 3HBLA 1KFJA 5AYYA 4UR7A 5CPOA 3FKKA 1EX5A 4FF7A 5D2XA 3MYPA 1DOSA 3KRUA 3HOJA 4S1FA 5F2LA 3SY5A 5TIMA 2ZCGA 3THQA 3V1PA 3OG3A 1FWNA 1JCYA 3RFAA 3JR2A 5LNVA 3O15A 1NEYA 4M7SA 3L2IA 3CT7A 2PRHA 3H54A 5F2GA 3DU0A 4OT7A 2NXHA 2R94A 5BMXA 4JX5A 4MPQA 5GVJA 2BSLA 3GYEA 4HHPA 3P67A 2E68A 3MI2A 3LB0A 1S5TA 1Q45A 1B57A 3TAOA 1H7OA 4FIQA 3BG3A 5I3HA 1BEUA 4O1DA 4I7WA 4PODA 1LLWA 4CLMA 4ONVA 1W8SA 2ZZ5A 5AC7A 3P7YA 5F1VA 3LBMA 5HQEA 6TIMA 1ALDA 4QIUA 1SW7A 4OWGA 2BXVA 4KFPA 1O60A 2FB3A 2RFGA 4OQVA 4AHPA 1WOAA 1SSGA 4IMFA 3DHFA 4Q32A 1K03A 1KM4A 1J5TA 1XM3A 1G67A 3PUOA 3N9SA 5C2XA 3M0ZA 2Z6IA 3Q2DA 1TV5A 3G22A 5HMSA 3QMTA 1G7UA 5A5WA 3TFXA 3IGSA 1SFLA 2CLFA 3PBUA 4ICNA 3R5EA 3W74A 1EWEA 1BWLA 2J9YA 4UFHA 2VELA 4RZ6A 5C5YA 1SSDA 1LTDA 3M47A 5AFDA 5EMUA 1EP1A 5CZSA 3QYQA 1SZEA 2E6YA 4O28A 5LZLA 2VEPA 3NNTA 4ADSA 4AVFA 3ABSA 5DLCA 1RZMA 1NFBA 5FEXA 3P82A 3W6YA 1MZHA 2YW4A 1KM2A 3BLFA 3UZJA 1VPXA 3TSDA 4UNLA 3C52A 1EUAA 3C2EA 3NPUA 1ZFJA 3M43A 3NPXA 4LW7A 3HGJA 4JIPA 2VEIA 1OK6A 2V2DA 4BK9A 3TFCA 3G0UA 3QFEA 4MUZA 4UFMA 3VE7A 3W7EA 4O15A 2WQPA 4DO4A 4WQ6A 1IXOA 3Q58A 2X1UA 1FWRA 1G4PA 2GVLA 2NXIA 4FXSA 4LS1A 1FBAA 3W71A 3S6DA 1F74A 5AHEA 4R34A 3TDFA 2EF9A 4IJBA 2DZPA 1C9DA 4UC5A 5AC8A 1H7NA 4NJKA 2CZ5A 1FY6A 4GUHA 1UUOA 3QW4B 1W0MA 4K37A 3LTYA 1JCXA 1Z42A 3KFTA 2OT0A 3W7CA 3DGRA 1QPNA 3CEPA 3LRKA 3TJLA 1JQVA 3UWQA 1LRTA 5DCDA 4GXMA 3I7SA 3S5NA 5HR7A 4O17A 4UTLA 4OE7A 2H8ZA 1WOBA 1HTIA 3L65A 3LHTA 1XDLA 3SGZA 1H7PA 4Z1CA 3UY7A 2VFGA 2C14A 3HQ1A 4G1KA 1TB3A 4MKNA 1K7EA 4WY0A 3BGGA 3NL6A 5CZTA 1TQXA 1FX6A 2E5BA 4HPJA 3O6DA 3PY2A 1YDOA 3W3OA 1UBSA 2DORA 1P5BA 3TE9A 1TPH1 4UUIA 4N9DA 3I6RA 2J24A 4RCXA 4Y8FA 1ML1A 2ZZ2A 2ZZ6A 3HPZA 3S1VA 3OBKA 1YDNA 2NV1A 1SPQA 1I45A 3MMTA 4JR5A 1S3HA 4MYAA 1ZAHA 5AN7A 3EWUA 2OZ0A 3W1PA 4GC4A 2TSYA 1IIHA 2V5LA 5BNKA 1I4NA 1W5PA 1JULA 3T78A 1DJNA 3GR8A 3VNDA 5CPNA 3PM6A 1H7XA 2QCDA 4FNPA 1OG0A 1SZNA 1GG0A 2ZRZA 3KRSA 3NQMA 1JUEA 1M7PA 3G1DA 1GVFA 2CZDA 2A0NA 4O57A 2X2GA 3IIXA 4TR9A 3PR2A 1Y0EA 1R2TA 3B04A 5TQLA 3W2JA 1FWSA 3U6WA 4IUOA 4DBDA 3C2VA 2Z2UA 1ME7A 3NXFA 4DF1A 4GWEA 1V5XA 3IIPA 1EP3A 3P80A 1PCWA 4ADTA 3TNOA 5HWJA 4E2DA 3ZFHA 5D37A 1LROA 4Z1AA 5D2YA 3SIZA 1QAPA 2VOMA 2CFFA 3A22A 1O95A 1H5YA 3QEZA 1TTPA 3QF0A 3MP5A 2JKAA 4UCGA 5D03A 1UB3A 4UFLA 3NAVA 4QQ3A 4HPXA 1X8FA 2X1TA 5AYXA 2V2CA 3UZ5A 1TYGA 2YW3A 5C55A 4UTWC 5D04C 5LGXA 2PRLA 1YXYA 4LT9A 2TRSA 3PSWA 4ALDA 2EHHA 3C4UA 3MHFA 2QCEA 2D73A 3SGUA 1RD5A 4IMCA 3KVKA 4M5PA 1R47A 3NDOA 3LLDA 1P4CA 1XUZA 3BG5A 4RV8A 4ZQCA 4AWSA 4LU0A 1RVGA 2QAFA 3M5YA 3DENA 1AG1O 3WFAA 3UPWA 1DL3A 3M44A 2RH9A 2VEKA 4JY9A 4LVDA 5LNSA 1GQNA 5H2ZA 2YPIA 4CCDA 3O1NA 2QJHA 1EUNA 3QQ0A 4O12A 1DQWA 1G7VA 1VLWA 2ATSA 4DF0A 1QR7A 3M1ZA 3QRHA 3MBFA 2V2HA 2G5WA 1ONRA 4HNNA 4JYEA 3RLUA 4UTUA 3W1RA 2C0AA 4C1KA 2E6DA 4DO6A 2YSWA 4LWWA 2VFDA 1T96A 3CU2A 2CZFA 5AC6A 2PCQA 1RV8A 3W70A 5I3FA 3EEGA 2E6AA 3LTSA 3TX9A 4FX8A 5G2IA 2O7SA 3PUDA 3W1MA 2GJNA 4AEOA 3O6YX 4DQWA 1Z48A 3GZ3A 2FIQA 3W7OA 3C56A 4O1CA 3UWZA 1JRCA 1VCGA 3M5XA 5G2HA 3V75A 5FF2A 3MP3A 2VFFA 1XUUA 2QR6A 3W7GA 4NT0A 2I9EA 1W37A 2BTMA 2NZLA 3A24A 3CIXA 1THFD 2J9ZA 1FXPA 3NG3A 1FCBA 3W73A 2DJXA 4HNVA 5KZDA 1I2RA 4LUJA 1M5WA 2OCZA 3P8IA 4LV9A 3R8RA 3M5ZA 2PE4A 5HUPA 3CEUA 4ZMGA 3LXAA 5CKSA 4IMDA 1X6UA 1SR9A 4XKYA 4WY0B 1RQEA 3EX2A 3GXNA 3S5YA 3W7QA 2ISWA 3JS3A 3O07A 4S2BA 5FF7A 4A3UA 5F4SA 3P81A 3HG4A 4O1AA 1WYIA 4U28A 3NR0A 3MUXA 1YDVA 3MHUA 3B03A 4EOUA 3QMRA 1OX5A 1I2QA 1TCDA 1ZAJA 3O8AA 4NVTA 3TQKA 4MLJA 1TQJA 1XFBA 2Y70A 3THAA 5KITA 1TTIA 2Y85A 1PL9A 4YL2A 1Q6RA 1B9BA 3TXVA 4MZ1A 2WV8A 1ICSA 4JDYA 2QF7A 3TUUA 1NAL1 2IQTA 4NJIA 1UCWA 1XBZA 3EXSA 4HSNA 3LRLA 1JRBA 3QW3A 4N6FA 5K7JA 3ATYA 3W7HA 4XKYB 3UY8A 3NQ7A 4HIBA 3LCIA 4EIVA 4L4LA 1O94A 4I9AA 4LY8A 3N2XA 2YCEA 3O06A 4JIQA 1XI3A 2FPYA 3L21A 3DFTA 1DV7A 4JTEA 5IM51 2YZRA 2Q8LA 1GVOA 2QCNA 1FQ0A 2J6XA 3BVJA 1HO1A 1ZCOA 2DP3A 5LGZA 1K3UA 1HL2A 4M7TA 2NX9A 1OABA 4RR4A 2QCCA 3BO9A 1XXXA 3GX9A 2E5CA 3S0CA 4TIMA 3W22A 1YYAA 1PVNA 1MO0A 3QSRA 1OF6A 3DHDA 1ME8A 2ZTJA 2DZTA 3G24A 3B4UA 2WSRA 4ZZ9A 4RX0A 4JTKA 1N7KA 3B0PA 3NQEA 2WPBA 3U8GA 5CPLA 2H8XA 1Q6OA 3OA3A 4Y96A 5AHIA 2G96A 3NQFA 3IIVA 4PTNA 3UXAA 4AAJA 4PCFA 4IX0A 1IIGA 4X9SA 2GPTA 2PC4A 1YADA 2H3BA 5CPMA 2HTMA 3N9RA 4POCA 3T55A 5HWMA 1LZOA 1YTEA 4FIRA 4LVAA 3P5ZA 2JGYA 3O6CA 1DJQA 2A1YA 5I3IA 4IGHA 1H51A 1WA3A 1XC4A 1FUYA 1VR6A 1DHPA 1MSSA 5BRBA 3W2KA 4LS0A 4UXDA 1AW1A 2GOUA 2FJKA 3NQAA 3DBPA 3DZ1A 2WNZA 1WBHA 2QJIA 3KHJA 1B4KA 3PB2A 2ZA1A 4N02A 4AHQA 4RJEA 4NXKA 4EWND 3A21A 5EBUA 3W2MA 1DVJA 1VH7A 3N2MA 3W2NA 3STGA 4BI7A 3GXTA 4FNSA 4MFEA 3A9IA 3H53A 5F2IA 3LXCA 5DCEA 2YXGA 3ABRA 4AF0A 1H7RA 1OFBA 1OFEA 2V5BA 4LC6A 4PA8A 3HGRA 3QC3A 1F73A 5K3VA 2VXNA 3C8FA 1KFBA 5BOOA 4WD0A 3C61A 2O7QA 1JUKA 4OV4A 5AHFA 1OFQA 5FEZA 3I65A 3EWWA 1ICPA 2Y89A 1ICQA 1KM5A 1OK4A 3W7RA 3LXBA 4DELA 1K7FA 1VGAA 2JK2A 1U5JA 3M16A 4JGDA 1IF2A 4YLWA 1P1XA 5SWUA 1IXNA 1X1OA 4BI6A 4MVAA 1L6YA 4IXHA 1AW2A 3DFNA 4OV9A 3VE9A 3PC0A 2PRMA 3N19B 4EVZA 3CPRA 1LOQA 4OU1A 2PURA 4QSHA 3RK8A 4O1BA 4ADUA 2Y7DA 3NQGA 4FNTA 3F1QA 1FCUA 2R8WA 4N4PA 1A5AA 4H6KA 1Z41A 5CSRA 4NQ1A 3AJXA 4YCOA 1JJKA 4HN4A 1SUXA 2C18A 4LTSA 2X16A 3PUEA 2ALDA 2V8ZA 5K4ZA 3I7QA 1U83A 3KVMA 2C3ZA 3C2OA 4IQLA 1N55A 3CQ0A 5K9XA 4BR1A 4LRSA 1TPEA 2EPHA 4LVBA 4AWUA 1LRNA 5DY2A 4GUIA 4ML9A 3NPWA 2E1DA 2FDSA 3DXIA 4ORMA 2X1RA 1R46A 2CLIA 3PWAA 3UYCA 4NJGA 2NWRA 1H63A 1W31A 1P0NA 5KZEA 1JVNA 2I14A 1Z44A 4TMCA 4GFSA 4X22A 2NUWA 2CZEA 4N9BA 4XBKA 3DAQA 5KTLA 3STEA 2VFHA 1KFLA 1KTBA 3BG9A 5E93A 1WBJA 4UNKA 1VRDA 3SSJA 4R33A 1G69A 1YPFA 1DORA 3BK0A 4Y9AA 1X1ZA 3KX6A 3SZ8A 4EF9A 2OX1A 3L0KA 3LCFA 4YMZA 1FWWA 1R2RA 3O05A 4WJEA 4QNWA 1RQHA 2B7QA 1H62A 4LVGA 4UFJA 3PVFA 5EY5A 3E02A 2GQAA 3S5ZA 4LC8A 3NVTA 4WXZA 1XBVA 1OHLA 2JKEA 3PBYA 3VKJA 4BFAA 2FQIA 1I2OA 1KV8A 3O63A 2E77A 4UFIA 1ZJIA 3W7JA 4O54A 1VC4A 5G4EA 4O16A 3TAKA 4NZJA 4JTHA 4IPIA 3EKZA 4WY0F 3DFPA 1J4EA 3NGJA 1KFCA 2AGKA 4WZHA 1ZENA 1C29A 1TPVA 2XN0A 1F76A 2TYSA 1OFOA 4XWUA 3I68A 3K30A 4NX5A 3LX9A 1LORA 1TPWA 2QCMA 4RZ5A 4Y6GA 3VCRA 3GIYA 2YR1A 1TIMA 2QCLA 4O0KA 2C13A 1L9WA 2YX0A 1F5ZA 1GTEA 2CW6A 3LCLA 1S5WA 4ZQMA 4XQ6A 4PC8A 3B0UX 1JCNA 3HB9A 1Q6QA 4K8HA 3NQ2A 3EX4A 3UQNA 3CB8A 3SR7A 1EWDA 3TC6A 4JTFA 3C2FA 5DXXA 3DFOA 3KRZA 5G1TA 4UIOA 1F05A 2ZDRA 1TPB1 5G4WA 4A2SA 1BTMA 4MY1A 3QM3A 4NNCA 2DZVA 3UWVA 2FPVA 4S2CA 3W87A 5HWNA 4O10A 1H60A 3GDMA 1K8ZA 2WNNA 1K02A 3OHIA 3EXRA 4CNOA 4BWLC 2VFIA 1SU5A 4WOZA 4AMAA 3R89A 3QZEA 2FTPA 3C6CA 3U2OA 1WX0A 4NNAA 2ZRYA 2A5HA 1L6WA 3MHGA 1PHQA 1TRDA 1W3TA 4JTSA 4AF0B 3CM4A 5KMYA 1I2PA 1VS1A 3R12A 5C54A 3G1YA 2ABAA 2ZRXA 4FO4A 1GTHA 3GLCA 2A85A 3NL2A 1DQXA 4UTWA 2H6RA 4TMBA 3LV5A 1RR2A 1S5VA 3CHVA 4RLIA 4HSOA 3STCA 3A5FA 1UUMA 3FA5A 3W7IA 2ZZ7A 3RLVA 2Q3RA 3W1UA 1ZAIA 5HINA 2VEMA 4UTIA 5T26A 5EA9A 5TBOA 5HJLA 1EA0A 3OIXA 4ZVJA 4LS2A 1OFDA 5FEWA 1QPQA 1VCVA 2RDUA 1D9EA 3HPSA 4IMEA 1N8FA 3G1XA 3WK0A 4UTTA 4WUIA 1WV2A 2P0OA 1OYBA 2CLEA 3GNNA 3LBCA 4RXFA 2XN2A 2ABBA 5G2WA 5D05A 3MYOA 1LLZA 2V30A 1W5QA 2GJLA 1AL8A 4NUWA 3WJSA 2ZYFA 4IWWA 5K9CA 1FXQA 2NUXA 2DZXA 2DJLA 3SW6A 5ABTA 4O13A 3T7VA 1OF8A 3LCXA 3W1NA 3HG5A 4OHQA 3IRDA 1QPOA 4NNBA 1GVQA 5IBXA 3NPVA 3P84A 3TSBA 2E6FA 1LRQA 4CNPA 3CIWA 2WKJA 3W85A 3A23A 3RNDA 1ZHAA 3TKFA 2NWSA 3G3DA 3L5LA 3EWXA 4UR8A 1MXSA 2ZBTA 4D2JA 1B3OA 4JS3A 2Z6JA 1L2UA 1OFAA 1JCMP 1PCKA 3TMQA 4LOCA 4DXVA 5E0KA 5AOUA 4FB7A 1NF0A 3LI0A 4DPPA 3LLFA 1NF7A 2DZWA 4NX0A 1PIIA 4N6EA 2A4AA 4TO8A 3WK1A 4NJJA 2CWNA 1A53A 3GR7A 1OYCA 2GVJA 5K2ZA 4O53A 3RF9A 1AW5A 1F2JA 4X2RA 4K7VA 3UNDA 3VI2A 4CQ8A 2JBMA 1XDMA 1GPWA 2Q8ZA 1A50A 3PB0A 5L6UA 4QAIA 3DI1A 1OYAA 1ME9A 1M6JA 1WXJA 2F84A 3LCGA 2C6QA 3EWBX 2E5DA 2VC6A 2RKXA 3EWYA 2HSAA 3LGEA 3PF3A 3H55A 1D3GA 2QKFA 1H1ZA 4DF2A 2CLOA 5D2WA 4JD4A 1DKWA 4JTJA 4HNTA 4GNJA 2QUVA 1L6SA 3UPBA 4AHOA 1KM0A 3W88A 2ZA3A 1A5BA 8TIMA 3Q94A 1OX6A 4JYDA 4Q33A 1A5SA 3G8RA 4QJ1A 1QO5A 3R13A 3QMSA 3TR2A 4AWTA 2Y7EA 3FYOA 2WNQA 5FF4A 2P1FA 1PS9A 4PH6A 1WQ5A 4JXCA 3VFLA 1NVMA 1G6CA 1KV5A 2RDTA 3AO0A
chains in the Genus database with same CATH superfamily
3HPXA 4XSMA 3W23A 2PTXA 2JIWA 1P1MA 4WDWA 5C9UA 1PV8A 2Z1VA 1OC7A 3CQHA 3H4GA 3LHVA 3T44A 3SI9A 3LN3A 4IOTA 3FX4A 4HCDA 3CQIA 3MP4A 4N9CA 4YVVA 1R3YA 3LNMA 1EBGA 3BOLA 3TSMA 5ABFB 3E2RA 3JVAA 4JHZA 1XLBA 2HXUA 2P10A 2CERA 2JALA 4L4PA 3WLOA 1G4SA 2OKTA 3FGCB 1C7SA 2AQWA 4YIWA 5D32A 4RKAA 4PL2A 3CC1A 1HO4A 1XKJA 2Z00A 3WUFA 3M6YA 3GDTA 3WBEA 4BQ2A 2V6AA 1OFRA 2WOQA 4YJ5A 4REQA 2Z1KA 1TMHA 1TJ2A 3W4RA 1E6NA 3CYJA 2YFNA 3FJNA 3W7NA 3STFA 4I90A 3U2ZA 1KFKA 4LNYA 3ONBA 3VYLA 1YNQA 2YB1A 4HT3A 1T99A 2V9DA 2OG9A 3G77A 3UEQA 2A3BA 2V38A 4K7YA 3UWWA 3ZSSA 1B2YA 1ZL1A 5FF3A 4G8TA 1W3NA 1DJZA 3NQCA 3W28A 1X1NA 3SCOA 3HGOA 3W1TA 4GH3A 2O0TA 4KGJA 4RNJA 4ATDA 3M9YA 1HL9A 3P14A 5EMYA 2I7GA 3DG6A 4WLCA 2ZUWA 1W1YA 1CECA 5AYIA 2OPJA 1OX4A 4EAYA 1YE4A 2G3IA 1V7YA 4MG4A 4W8BA 1VQTA 4J5NA 3K5XA 4IGMA 2OKOA 2D2GA 5AHLA 3BMVA 1G4EA 2ATMA 4LUSA 5FI8A 1H1YA 2VTFA 4F0KA 1EJVC 5FJTA 5AZ1A 3BV7A 3LUTA 4JTIA 4JTTA 1K8CA 3CH0A 1GQLA 1I9CB 2Z7GA 4BF9A 3RO6A 3SECA 2IPGA 4QAWA 1KFWA 4NZ1A 4XBSA 4IFKA 4WJXA 2ZKMX 3U0HA 3DFSA 1TJPA 2FMOA 1OZQA 2OMAA 3PNUA 1FDYA 1FHUA 4UQBA 2C1HA 3TJ4A 3YPIA 2CZVA 4Q4KA 3ZVIA 3DIPA 3RUBL 3MU7A 3UVAA 1F7BA 1OGGA 1QBBA 3FV9A 3ANYA 4JEQA 1RLDA 2GVEA 2VKZG 3OEXA 3FEMA 2YYTA 2QGHA 3TW6A 1HKVA 3MUY1 2X1SA 3E96A 3NO5A 1BG9A 1VB9A 1PPIA 3HURA 1IR2A 1QNRA 5EYWA 1VF8A 4YCPA 5FSEC 3VKKA 3MJYA 2WK2A 5K9DA 1V93A 3PSVA 3S1WA 3BLDA 1A5LC 3ABQA 4UTMA 5D09A 2RHGA 2NX1A 2DIEA 4HKPA 1LF1A 3S6TA 4JCMA 3MO4A 4PR4A 1LCOA 1M68A 2TMDA 1RD6A 3B9DA 4OUIA 1ZGDA 4Q7NA 3N6JA 3ALGA 1EGVA 2YDAA 2PLJA 4JTLA 3KTSA 3UG8A 1UASA 4ORIA 1M7OA 1UJPA 4QBXA 3VMPA 2EPOA 1TPUA 1B31A 3W7MA 2C19A 3UR7A 3HN3A 3C0JA 1KFEA 9XIMA 1CI1A 3MCOA 3SCNA 3TOPA 3UR8A 4R53A 4MB3A 2A7NA 1J93A 3GH7A 2WBKA 3UD6A 1GT8A 2HE8A 2FZBA 3MZ2A 4R5EA 1G5AA 2VT0A 3V0UA 2FFCA 1DE6A 4ACZB 4AC7C 2YFOA 2ISVA 3E0VA 3P74A 1R38A 1TTQA 1P6BA 4FPSA 4ZQOA 2OEMA 1XR2A 3GKFA 2MNRA 5LA0A 1XYZA 4CNUA 3AIQA 1EL3A 4UMCA 4FNRA 3W76A 3AUJA 5AC4A 4LJ3A 2QCDB 4DJEC 1XLLA 3WD4A 3WN6A 4S3CA 3NZ1A 3PFMA 4NI3A 1XRFA 4LX4A 5D8ZA 4JIHA 5A6KA 3NYDA 1XL9A 1XBXA 3L23A 4NU7A 5CPTA 2KAUC 4PBEA 1K8XA 4AY7A 5CGMA 3N13A 4F48A 4U5IA 4J3UA 1AJ2A 3WJWA 2DZSA 8CGTA 1FDZA 1ONXA 5M03A 2C7FA 3PG8A 2ZRWA 3MSGA 3SN1A 3LRMA 3I3BA 3VIHA 2Q01A 3H7RA 2A7PA 4AQLA 3TW9A 5A8GA 1N8WA 4DY1A 5G5IA 1XGDA 3WFZA 1A5CA 5DBUA 3NQDA 3N34A 1ONEA 2I5GA 3N29A 4YWIA 4H2HA 1F6PA 1ZNNA 4B90A 4OIFA 3LS9A 2DY3A 1EIXA 1JDAA 2AAAA 2NT1A 4QLKA 4O1FA 3WL1A 3CWOX 3INPA 4LCSA 5D33A 3FIGA 5TD4A 3BGJA 3G1SA 1L0PA 2GGJA 4W89A 1QNOA 4Q8TA 3O6AA 3GWQA 3BLIA 3RPTA 5HNRA 1B3WA 3ZJ7A 4JFVA 3NSXA 5AYZA 2ISSA 5L9FA 1W1A1 2B7NA 3EEZA 2OTDA 2R91A 2PTYA 3PS7A 3L4VA 5HNNA 2ZADA 1XC6A 1FHVA 3OVPA 3ARPA 3C0LA 2PI6A 1PUDA 1AD1A 3WQPA 3OZYA 1TO3A 2VDGA 3GE7A 4FX7A 4P61A 2WKGA 4GUGA 3GNPA 3HV8A 3CLWA 2PDWA 4CD5A 3URAA 4J35A 2QPUA 2VURA 4O4VA 3U9IA 5CBJA 5EPDA 4AU0A 2EKCA 4A2RA 3SCUA 4UQDA 1IE7C 4W85A 1XRTA 3TTOA 4K1WA 3WDPP 1CXIA 3GSMA 1J8VA 1NDVA 3UXLA 2ZDSA 3GAKA 2DGAA 1X7FA 1XLCA 4EF8A 3EA2A 3WLQA 2QDGA 3W7KA 4JN7A 5FIPA 2FGZA 2Z25A 3T0AA 2WNWA 4A22A 4EKJA 5JMUA 3VK5A 1KKOA 4G7EA 2QT3A 3WNLA 2VGFA 4F0LA 4GNKB 4H6RA 1TSIA 4W9TA 4MKVA 3DHUA 4XSLA 1LDCA 3TXZA 3BV4A 2VVSA 4DHGA 2FFIA 3WBYA 5KSWA 4P7QA 3H2OA 1KR1A 1DBTA 2PODA 3NQVA 4FA3A 5JQ9A 5LIXX 3P61A 3DKLA 3I6TA 3NXLA 4AW7A 5J04A 1ITUA 2QVNA 5HQLA 2CLKA 1ZALA 4JKLA 1QDSA 1HXJA 4ZL1A 3G1AA 4EXBA 4G1NA 2WSKA 1CWYA 1HG3A 4GYKA 4C6JA 1PWLA 3LSBA 3IK4A 1QHOA 5CQ1A 3BURA 3WO8A 3SN0A 3TYEA 4Z1BA 5FOOA 1EDQA 5FEPA 3VGBA 3L9CA 1MDRA 4E2BA 2GQ8A 1V6VA 3GDRA 4PTXA 3WJYA 1E6XM 3QQ1A 3HG3A 4TX9A 5BW6A 2F7FA 1G9HA 4F3HA 1BYAA 3EKLA 2BB0A 4INFA 3QY6A 4IP5A 4NILA 3IIZA 2ZC8A 4FSAA 1SZRA 5JBEA 1SYTA 4ENLA 3RMJA 1XYBA 4LYKA 2G3JA 2WW5A 2YBVA 1BLIA 4V2XA 3LQLA 4Q8VA 4C6OA 3ANVA 3NM1A 3PULA 1E9LA 5KZMA 3ATZA 2FJUB 1KNWA 1RALA 3U4AA 5A6BD 4B3KA 4AZ5A 5DXYA 4L9XA 2Y61A 3N9KA 3DKJA 1R30A 4WRHA 1GOOA 1XH1A 5BXRA 5BU9A 4ES4A 2Y2WA 1UROA 1Q65A 3N18A 5I07A 3KHDA 4I5XA 2GSHA 3N11A 2JGQA 2G97A 5I3JA 2BXZA 1L6FA 2FTYA 1UWIA 2GVGA 4XZ9A 3R8HA 3W7DA 3TROA 4RNHA 2PDUA 1W1ZA 1YEYA 4IGNA 4D8LA 3FXGA 1KA9F 2UV8G 1GK8A 4NXSA 1TV3A 1J12A 2TODA 1XKYA 2ZE3A 4DAFA 2ZA2A 4X61A 2VJXA 4JTUA 4XAYA 1H49A 2OX4A 1WDWA 1VEOA 1QK2A 2VFEA 2V5DA 3BCJA 5GJNA 5G1YA 5F4WA 1W5MA 5AZ0A 2PZNA 4H7VA 4UTJA 2YJQA 4HNUA 3KRBA 4YTRA 3E9AA 3IIOA 4PCSA 3CHCA 2PDMA 1PSCA 4O1EA 1IXQA 3CZ8A 1E5NA 3B8DA 2ZRUA 2V0TA 2G3FA 4Q4SA 1KFJA 4UR7A 1OT2A 3FKKA 1QBAA 2E25A 2FZ9A 3VABA 3GNXA 2WJEA 3WF0A 4GIEA 3ITTA 4GQRA 3THQA 3V1PA 1R9ZA 3OG3A 1IV8A 3O15A 3LLXA 3L2IA 4F40A 3CT7A 3LEPA 5GVJA 4HHPA 2CHNA 3G1RA 4US5A 3MI2A 5HK4A 1Q2SA 3LB0A 5HMDA 5T9CE 1S5TA 1Z3NA 4G56A 4IJCA 1J0IA 1Q45A 4L1WA 3S2JA 5I3HA 2DT2A 2XVLA 4I7WA 3VD3A 4CLMA 4ONVA 1W8SA 2WMIB 3P7YA 1PZ0A 1IWAA 4XIMA 1ALDA 4QIUA 1SW7A 4OWGA 2BXVA 4KFPA 2FZDA 1O60A 2FB3A 3BAXA 4AHPA 5DRCA 1KRCC 2JEQA 1XLKA 3H2FA 4M80A 3KZPA 5HBFA 1XLIA 1H1NA 1K03A 2I17A 5HANA 1J5TA 1UZDA 1FWJC 1CXKA 5E6ZA 3XIMA 4ZE5A 4W86A 5M1TA 1F3TA 3Q2DA 1E6RA 1TVNA 1K70A 2YZ5A 3IPWA 2OWXA 3VOGA 2PDFA 1XF0A 3TYUA 1WUFA 3CH9A 3W74A 5GNYA 2W61A 2J77A 4JIEA 1LTDA 3M47A 5EMUA 2E6YA 1JNDA 4ATLA 3BSMA 5FEXA 1MZHA 1VPXA 4IHCA 3SCTA 3C52A 1ZFJA 2VEIA 3DERA 1VFHA 4XAFA 2WVVA 3VDHA 3GZAA 3IV8A 4HNOA 2WQPA 4MWAD 3PNZA 4DO4A 2WC7A 1IXOA 3Q58A 1G4PA 3WNMA 3W71A 1K6WA 2PA6A 3S6DA 2VHLA 3QPEA 3WLNA 2EF9A 4ICCX 1WDDA 2DZPA 4I5RA 5C70A 4BEQA 1H7NA 4NJKA 2D69A 1UUOA 1EXPA 1JCXA 1JCTA 2OT0A 3KFTA 4LUSB 4H1ZA 3P0XA 2FVMA 4ZXLA 1RPKA 3I3EA 2AKZA 4W7UA 4B9ZA 2ZUUA 2QIWA 3EDEA 4Z1CA 3UY7A 2VFGA 2C14A 5CC3A 5BOFA 3HQ1A 4P5UA 1R85A 3S47A 4GISA 2OB3A 1V3KA 3FVMA 1IZCA 2VNCA 2ZX6A 1TQXA 5JUVA 2E5BA 4HPJA 3O6DA 3MS8A 1W9DM 1YDOA 1FH7A 3W3OA 3LA4A 4UUIA 4PBGA 2J24A 4FLSA 1V3LA 4RUBA 2NV1A 1I45A 3MMTA 4HZMA 4NKCA 1HKIA 4GC4A 1S2TA 1IIHA 1I4NA 2Y4SA 4PUMA 4BY3A 4UOQA 4F0HA 5JIWA 1V79A 1WDRA 4HCHA 1OG0A 3WG6A 3MQTA 1Y7VA 2G37A 3D46A 3WQDA 3G1DA 2CZDA 3KBMA 4HMCA 3IIXA 3SQLA 4F0RA 1FWSA 3GR4A 2R6OA 3U6WA 4IUOA 2VZTA 1EZ2A 1US0A 1Q7MA 3GFXA 1ME7A 4HOWA 1UWAA 4GWEA 1V5XA 3UETA 4DBWA 1SJCA 3P80A 1PCWA 3GHUA 3STPA 1TWIA 1LROA 4RPQA 2YDRA 1XD0A 2XIOA 2X05A 1Z8AA 1QW8A 2CFFA 3ZIZA 1EJWC 3QEZA 1MWOA 2Y0FA 3FSTA 3MPGA 3GXFA 4RDWA 3NAVA 1JZ6A 4LF1A 2VQTA 2HCVA 2PD5A 2C1GA 4UR9A 2ONEA 1UG6A 6XIMA 3SQSA 3WLPA 5LGXA 5HXMA 3PSWA 4ALDA 6CGTA 1Q85A 2RAGA 3LZ3A 4CQCA 2Y24A 4HD5A 2D73A 4I9MA 4M5PA 4DJFA 3N4FA 1JDCA 4ZQCA 4DJDA 4QJ4B 2KX9A 5CG0A 1LWIA 2QAFA 1QI3A 1AG1O 2VWTA 2PDIA 2EPKX 4I6KA 1DL3A 4KIEA 1QHZA 3E3HA 1POJA 1E71M 4LVDA 4U3AA 4S3JA 3KCJA 1CXFA 3Q67A 3UR2A 4UB9A 1W1IE 3LGGA 3WDIA 3H26A 1BG4A 3QQ0A 1DQWA 4LAKA 2OSXA 4UQ9A 5A69A 4FLQA 4OFCA 3QRHA 2O4QA 4JQAA 4JYEA 1YNPA 2UWFA 4UCFA 4DO6A 4MWAE 3R4IA 4A8IA 6TAAA 4LWWA 3CU2A 4LBUA 2QVHA 5AC6A 3W70A 3OA5A 2E6AA 3LTSA 1G0CA 5G2IA 3RAOA 2O7SA 3RX3A 4AEOA 2DDXA 4MPKA 4DQWA 2YA0A 4EANA 1XHGA 3GO2A 4BF5A 1R3SA 2HPMA 3UWZA 1VCGA 3GIQA 4HZ7A 5G2HA 3V75A 4JQ1A 4HTYA 4LYRA 2VFFA 4GYFA 4YVXA 1THFD 1FXPA 1O66A 2YXXA 3WYZA 1KWGA 4JFWA 4C60A 4WKHA 4S3BA 3SO7A 4HK6A 2XDFA 2DJXA 3LNPA 5KZDA 4PMVA 2O56A 3KW3A 3P8IA 1XV8A 2PE4A 5HUPA 1GZJA 3WY1A 4GY1A 4YU1A 1PEZA 1NM9A 1XPYA 3EX2A 4B5WA 2XVKA 1Q6GA 3JS3A 2HDJA 4PMQA 4FK9A 5FF7A 4A3UA 3HG4A 4H7ZA 1S2AA 1CXLA 3VIPA 1WYIA 3NR0A 3MUXA 3B03A 1NDYA 3QMRA 3GTNA 3QKEA 1ZAJA 3B8TA 3QGVA 4YL2A 1B9BA 3TXVA 4MZ1A 2WV8A 2QF7A 1W91A 1W32A 2IQTA 1UCWA 2PB1A 1XLJA 3QW3A 4FOUA 4N6FA 4B5VA 4HK7A 4ZCWA 4IM4A 3UCCA 4HIBA 4B91A 3LCIA 2BGQA 4L65A 4L4LA 3FHAA 3SUWA 1UR0A 4I9AA 3JU2A 4LY8A 3O06A 2FPYA 3VX0A 3OYZA 1MMFA 2L5HA 3DFTA 3B9NA 3EB3A 2YL8A 3IJQA 1IT7A 1A0EA 4YTQA 2J6XA 2ZICA 2QCCA 3VX1A 5ENLA 3VIOA 5CZKA 1Q6DA 3V5FA 1PVNA 1RK6A 1OF6A 4GK8A 4RX0A 1EIBA 1JZ4A 1EGZA 2I5IA 1HF6A 3PWGA 2YOCA 3U8GA 4HN8A 2VD9A 3VCCA 3OA3A 3OZMA 4Y96A 5AHIA 4MNLA 4HMEA 3UXAA 5IDZA 1ZSXA 4H7CA 2HVMA 1YADA 4B5SA 1UJQA 5HWMA 1LZOA 1D2KA 1GJWA 1U2YA 4XISA 3QY8A 5TAOA 3P5ZA 4L6OA 2JGYA 3O6CA 1H51A 1WA3A 3O0FA 4AISA 1A5MC 4A3YA 3FA4A 3B8UA 1MSSA 5BRBA 3EMCA 2GGGA 1AW1A 3WLLA 4XZNX 3NQAA 3DZ1A 4MWAB 2WNZA 4ROQA 4R7WA 2PCEA 4V28A 4EWND 5LIWX 2X7WA 2C79A 2J7DA 1VH7A 4MF4A 3GXTA 2OLHA 4MFEA 3H53A 4K3ZA 4AF0A 1H7RA 4AY8A 3K4WA 5AC5A 4E4FA 3P3BA 1F73A 3F4CA 2QMJA 1DPMA 2VXNA 3W02A 1KFBA 5BOOA 4JTCA 1R3RA 4OV4A 1OFQA 3I65A 4LPCA 2VQUA 3NDYA 1ICPA 1UWTA 1ICQA 1KM5A 1OK4A 3UU0A 3W7RA 3SB0A 4QJ3B 2VC7A 4JGDA 3IARA 1P1XA 3WLKX 2DT0A 1K4HA 5SWUA 4BI6A 1QNPA 1EJRC 1RP9A 1AW2A 4OV9A 3VE9A 3ERPA 2PRMA 5LIKX 3VNIA 3RK8A 1MXGA 4ADUA 2Y7DA 3N04A 1FCUA 1QI5A 3LMZA 3SCPA 5E9XA 2R9RA 4NQ1A 5C0QA 1ZU8A 2VEFA 2DIKA 7ODCA 2V8ZA 4MNJA 4PMYA 3M4HA 2V67A 3SADA 1WKDA 3CQ0A 1E56A 2PDCA 3OOQA 2OYKA 4HJWA 4AWUA 3NQBA 1OM0A 1S1RA 3GHTA 7PTDA 4ML9A 2G41A 1RCOB 4GBDA 2FDSA 4Q4RA 1US3A 2YL6A 1CGTA 1XICA 2PGEA 1X98A 4NJGA 1W31A 3FNDA 1JVNA 2CBUA 2I14A 3AMDA 1Z44A 3H4XA 2NUWA 2WAGA 5KTLA 2BBFA 1LLOA 3ITOA 1ZBVA 3AS1A 4Q6JA 1WBJA 3GTIA 3K1GA 4UNKA 1DORA 3BK0A 3LK6A 1BGGA 1IHIA 4Y9AA 3SZ8A 5E6YA 2HPIA 4Y9OA 3NGFA 1ZB5A 3PVFA 4WXZA 4BFAA 2JKEA 3VKJA 2MANA 1KV8A 3O63A 4UQCA 1DWAM 1OEPA 2UBPC 4DWSC 1VC4A 3SCRA 2CXEA 2YCJA 3TAKA 4IPIA 4RE4A 3THUA 3EKZA 4WY0F 1RCQA 4IQJA 3QY7A 2AGKA 5I00A 1ZENA 4XWUA 3K30A 1MXDA 2QCMA 2F6XA 2QCLA 2Z28A 4XZLX 4D6JA 2C13A 1L9WA 1F5ZA 3EPNA 4Z2LA 2CW6A 5HDRA 1EZWA 1JCNA 3HB9A 2ZUMA 4IICA 1B30A 2J25A 3KWSA 1EWDA 3TC6A 3V0SA 4H9UA 1R7AA 3DFOA 5IFPA 3JZEA 5C71A 4A2SA 1XRVA 1EX1A 4ZFCA 1F07A 1VP5A 3CTTA 4NASA 2P53A 5HWNA 3TYBA 3GRIA 4JHMA 3KL3A 4CNOA 4IPLA 4WOZA 3S2MA 1B1YA 1HP5A 4OKDA 3R89A 4NHVA 3QGKC 4WR3A 1WX0A 2ZRYA 4GPNA 5KMYA 4JTSA 4AF0B 3A6OA 3G1YA 4FO4A 3WQFA 2H9AB 2VUNA 4E2VA 3PTDA 4CVWA 3BLKA 3DN5A 3OBAA 4TMBA 5FAGA 4JN8A 4FLRA 6REQA 4F0MA 3A5FA 5M2FX 1UR3M 3R79A 2GJXB 5BWFA 2ZZ7A 3RLVA 4UTIA 3MCMA 2HBVA 4LS2A 4Q8PA 2WVSA 1QPQA 4IMEA 1KGUA 1WV2A 1T40A 1OYBA 3BXWA 4L4OA 4RXFA 3WUGA 4K8GA 3NOYA 4LEQA 1Q6CA 5D05A 3MYOA 1LLZA 1X96A 4WCJA 4AZ7A 3UA3A 2ZYFA 5GJPA 4C65A 4D6FA 5K9CA 1XRSA 2DJLA 3SW6A 3GG8A 4O13A 2NW0A 2HRWA 5E0FA 3VNLA 2D0HA 4DJDD 3LCXA 4JTDA 1JD9A 3W1NA 3BE7A 3HG5A 4S39A 4JCLA 4OHQA 2PDNA 1QPOA 1CEOA 1A3WA 4ZGYA 1XIFA 2E6FA 3KDNA 1NIUA 2PGFA 4GI8A 3CIWA 1O6IA 4OOUA 1CENA 3JW7A 2ZIDA 3VGDA 5HPOA 2VZVA 1E3ZA 4MMWA 4WVXA 3L5LA 2ZBTA 4D2JA 5LIUX 4KBXA 1OFAA 4Q4PA 4C1NA 1Q8JA 4LOCA 4DWSB 5E0KA 4E3VA 5AOUA 4AC1X 1J0HA 3PJUA 2X42A 3M0MA 2ZOXA 4HA4A 1KRBC 3T0BA 4N6EA 4W84A 1QUMA 4TO8A 3WK1A 3PZGA 2CWNA 5DF0A 5D9PA 2WKLA 1PKNA 1H4PA 1AH0A 5GPRA 3UW6A 5K2ZA 3RF9A 2W3ZA 1K77A 3V5CA 2VI0A 4NY2A 4W7WA 4CQ8A 2ZUVA 1XDMA 4UZUA 4DBSA 3UZXA 1M6JA 3LCGA 3EWBX 1HN1A 4LCRA 3IRSA 3GW0A 3T0TA 4P8UA 4W8AA 2CC0A 4Q4QA 4B16A 3LYEA 1D3GA 4B5UA 2P0IA 4DF2A 3PZNA 3A13A 4Z2GA 4AD2A 1E55A 4XZIA 5FD0A 3DEQA 1WZAA 3ONCA 3W88A 1OGBA 5HJYA 1OX6A 3Q94A 3R13A 3T1GA 4AWTA 2VCBA 2Y7EA 3FYOA 4WK9A 3GUGA 1RA0A 3F4VA 4MUPA 3GTXA 1QNSA 3VFLA 1JPKA 1OCJA 2RDTA 5BXSA 3AO0A 1BXBA 4JICA 4RE0A 4RE2A 3MO7A 1Q2RA 2XSXA 1XWYA 3T2PA 4NZFA 3W9ZA 7XIMA 1NTHA 2YDSA 4BQ4A 3VZZA 2CLHA 2Y5JA 2NV2A 3IJLA 4GIYA 1XLGA 2BVYA 1K6AA 1J9YA 3DGBA 4PEKA 1V3MA 3RJXA 3B05A 3VKBA 4UTHA 2G3NA 3SCSA 3NEVA 2CLLA 3C86A 2X7VA 5CZ0A 3HO8A 3NZPA 1S46A 1EJ7L 5DELA 3CV2A 3BLOA 1KWKA 2BODX 2IKHA 4DX3A 3UJSA 2YCKX 1PE1A 2WSPA 1SO6A 1IEWA 3ZJKA 4M6QA 3LPGA 5FL1A 1IEXA 1W1B1 4LV4A 4R85A 2XUCA 2HVNA 2W63A 1BYBA 4H01A 3FA3A 2Z26A 1KCLA 1GORA 1EHNA 1ADSA 3W2LA 5A6JA 3MTWA 4W88A 1JCLA 3R0UA 3WD2A 5I79A 1SO4A 1GOKA 1KM3A 2X40A 1FWGC 4TQTA 3LI1A 4QISA 2OLAA 3OU8A 1KBIA 1EP2A 1W1PA 3EX1A 1S2CA 3B40A 4GKLA 3W29A 3GU2A 4WKAA 1EQPA 3HJEA 3H70A 1VHCA 5AB3A 3W86A 2PF8A 4M6PA 4AD5A 1J18A 4BI5A 4NZ3A 4CU7A 3OPSA 5BRPA 4OBTA 3FAWA 1YTKA 3F4DA 4RNIA 5AHNA 3AYRA 2BZNA 1XPGA 5J5RA 1SZFA 2F9RA 3TV8A 1H41A 2X0SA 4XAGA 2BP1A 3FK4A 1BYCA 3R2GA 4MY9A 4Z0JA 3CLMA 5D02A 1YKWA 3BW4A 1CB7B 4PCPA 5I3DA 3R43A 2HMCA 1Q66A 1IEIA 4US6A 4YXGA 3GVQA 3C8NA 1BXNA 2BLEA 3WF3A 2QPSA 5CC6A 2JKPA 3TZFA 2I9UA 1QTWA 4AX7A 5AY7A 5A2AA 4MNKA 1NY1A 2E8YA 3W1LA 1JR1A 4PTVA 2D3NA 3UT0A 3NL5A 2V82A 2I16A 2D2HA 4O11A 3R6IA 1ZBKA 4WGXA 1XIDA 2DSZA 4GIRA 4GE8A 3VUPA 3CAWA 3VDGA 3VGHA 1XJBA 1Q6FA 1UOKA 3VOHA 3E12A 3FAXA 1YLVA 5HATA 1TELA 3OQ8A 2Z29A 3JRKA 1JGIA 2Y63A 4JNMA 1BYDA 3IV3A 3WH5A 2J6VA 1XW8A 4I7VA 3K8MA 4ZBCA 3MT1A 1IWBA 1VBRA 3PBWA 3ABOA 1R9XA 3KVJA 4S38A 1BQGA 4WX2A 2Y6ZA 3UFYA 3S42A 1UMYA 4MIMA 2IPFA 3ARZA 3TC7A 3KL5A 3BH4A 1TRIA 4IPJA 2OQYA 2GQ9A 5D38A 2QUUA 3T6CA 4GQQA 3AWOA 3BW3A 1I0BA 4XTDA 4J9JA 3G8EA 2HS8A 1DYSA 3A4AA 3NQ6A 3PFRA 5I24A 1W17A 1I2NA 3L68A 1FFQA 2FDMA 1SW0A 3L4TA 4HK5A 4QFUA 3PZOA 4J2PA 2ZXDA 2ZXAA 1WPCA 3WQCA 2A6NA 1BVWA 3ITXA 3UCQA 3L4WA 4J3WA 2J8TA 1W3IA 4ZENA 3RLGA 3FLUA 2J13A 1NQKA 1GEQA 4XB3A 3WELA 5CG7A 2BMBA 1XCFA 1I1WA 1K9DA 4AYSA 3WEOA 4AZ6A 3N14A 1FHLA 1Q8AA 1PBGA 1PZ2A 5BWAA 3VOFA 3GK0A 2YA1A 4JY8A 4XZWA 3LHWA 3WKZA 1W5NA 2CITA 3WSUA 4AB4A 2X30A 3AIBA 2IXUA 4ZOAA 1KTNA 3KP0A 2OFJA 3B0YA 2Y7FA 1LBFA 2OZ8A 3BCDA 4O4WA 4LQ1A 1Q6EA 3OJGA 1CLVA 1RA5A 2J27A 4PMUA 1KR0A 2ODOA 2PDGA 4D8AA 1UKSA 3UNTA 1BRLA 3QLLA 2OXNA 5F4XA 1M01A 1DXIA 1LP6A 3WUBA 4D1IA 4UTTC 2VDIA 3AUOA 1XSJA 2J66A 4DZIA 1AMKA 1VJZA 3KOFA 4JYFA 1EF2A 1A3HA 2O55A 3ICJA 4AG0A 1E0TA 3T0DA 1DTNA 3RLHA 1QVBA 2YCIX 2QJNA 3DYOA 1EDGA 4C6QA 3AYTA 3AXMA 4IIEA 4MAVA 1E4NA 4AH7A 1X8CA 2NUYA 3QC0A 3E0LA 4X3ZA 3XINA 2XISA 3W1QA 4E8GA 4XZHA 3ZWSA 1HJVA 3E38A 2XN1A 1XLFA 5JBDA 1H0GA 1O5QA 4US5D 5I02A 1SFJA 3E0IA 1MRQA 3FJ6A 2CU0A 4RV3A 1W2PA 4LVFA 4FX6M 4JX6A 4LF2A 5CXPA 4LUTA 3TN5A 1NDZA 1PIGA 1UHVA 4H04A 3USBA 3U3HA 4Z08A 3RN6A 3OLEA 2XFWA 3WQ4A 1B54A 2QW5A 2PPGA 2VZUA 1XDJA 3MV11 4CCEA 4B4FA 3TCEA 4C5ZA 2X2YA 3UWUA 4GQBA 2VGIA 3GNDA 1YE6A 3FDKA 3RCYA 3VNMA 1QNVA 5LA1A 6PTDA 5DBTA 4FLOA 1ZBWA 1XBYA 3L0GA 2D1ZA 2Y88A 1JQXA 3QPZA 2D0GA 1C7TA 3G18A 5C9ZA 2RGLA 4DNMA 2C15A 3W26A 1UW9A 3RPMA 2XGZA 4KERA 3ZS4A 4WJ8A 3MMUA 1WUEA 3G1FA 2QS8A 1UR9A 1GQIA 4DPQA 3IS4A 1TPFA 3G1VA 3VXGA 4PBFA 2NLIA 4XZMX 3PAOA 4GOAA 1EO5A 3HMJG 2OGJA 3EKGA 4LRTA 3ZR4A 1AODA 5KINA 1Y65A 4EWJA 3BDKA 4QM1A 1M3UA 3FSUA 3CS2A 4LYPA 4HNLA 2G95A 1VZWA 1KW1A 1P0KA 1IEVA 4DM2A 5T91A 3GC2A 3V18A 4I5UA 1PHWA 2OWWA 2CHOA 2BHYA 3NJ3A 3KVLA 5LNWA 4GA8A 4GFIA 3PTQA 4TVDA 1JI1A 3W7LA 1TJRA 4E4PA 4PZVA 1RPXA 4DEFA 3PBMA 4KGLA 4YN5A 4EXQA 3TA9A 4W5ZA 4YYFA 3MCNA 5IFTA 3W7PA 6REQB 5IBXC 2W4XA 1P6WA 1ZCCA 4Z17A 4PUNA 1NQ6A 3VA8A 2VP8A 1V6YA 3T08A 2Z27A 2REQA 2PLCA 3ZOAA 3FY1A 3SCVA 2NXGA 2J8FA 3S1UA 4ZR8A 4CQDA 3GD6A 2YYUA 5D9NA 1PIFA 3L5MA 3M07A 4DNHA 3QSTA 4DRSA 1V3HA 1KC7A 1ECEA 4GLEA 5HR6A 1EA9C 3CTLA 4KETA 1S3TC 1F3XA 1T0OA 2YCLB 2WMFA 1E1CB 2F8QA 2EGZA 1TMLA 4PUJA 1Y5VA 3L67A 4FF5A 4DBEA 7REQB 2DUZA 1R87A 7TAAA 3GFYA 4NAFA 2GJRA 4TU1A 4O50A 3S5OA 1JCJA 3BOXA 4L7ZA 5D2VA 3VIKA 1CGUA 5LSMA 2H90A 4AEEA 1TX0A 1D7KA 3BLEA 2HBXA 4I8YA 1NFPA 1YXCA 3CMFA 3WNKA 3BAKA 3FS2A 2QMKA 3BPWA 4GI4A 1OC6A 1ADOA 2EBNA 2R24A 4IUGA 4Y7EA 4LBRA 2QJGA 3AXKA 4CN6A 4DYKA 4QEEA 5U7SA 5CLWA 2WHLA 3SGGA 5BCAA 2ZWYA 1GW1A 3G0SA 1LQAA 2BXYA 1FFRA 1CTNA 3B8IA 3NOEA 1UR2A 1O5XA 2E09A 3WD0A 1IR1A 4WEVX 1TWZA 4UZSA 1K9FA 5LHFA 3WJZA 3LHYA 1EJUC 3LZ5A 3TWBA 3DG3A 3QOMA 1B5TA 3Q4DA 4FF7A 2CETA 4QLJA 3ZT7A 4PMXA 2J47A 1DOSA 3KRUA 4B2DD 1P0EA 3A4JA 5TIMA 3QV8A 4HZ6A 4GYPC 4AEFA 5EMLA 3JR2A 1MVYA 4M7SA 2NSOA 4GZJA 4M6UA 2NXHA 5D4YA 4MPQA 3GYEA 2YB4A 3P67A 3POHA 4ERIA 1WKEA 1S2VA 1R3TA 5BXTA 2ISFA 1B57A 4GVIA 2BVWA 1H7OA 2QJMA 1MQQA 1SVDA 4FIQA 1E4IA 2ZUNA 5AVHA 3TN4A 5A94A 3KBSA 1A0DA 3AMLA 2ZZ5A 3LENA 5AC7A 4C6KA 1Z7AA 4GXPA 3T42A 5F1VA 2XVNA 4E6MA 4V1XA 5HQEA 2INEA 4J3SA 3BTNA 6TIMA 1KBLA 3ARQA 2HVOA 4LY4A 3PUGA 4XK2A 2J62A 3T05A 4YTTA 3ZQ9A 3BCFA 4DUWA 1SSGA 3DHFA 1U5HA 4Q32A 4DN1A 1KM4A 5A6BA 1P7TB 3PUOA 1V6TA 3S9IA 1P0BA 3M0ZA 3OBEA 2DVXA 1TV5A 3KUMA 3OGRA 3K2GA 2XIJA 3BQ6A 2CLFA 4WHBA 4YHGA 1BWLA 2GSJA 4TVCA 2J9YA 2NQ9A 2RGMA 5A6AA 3N15A 5C5YA 4JAWA 1SSDA 3CB3A 1UH2A 5CZSA 1SZEA 4O28A 2VEPA 1CDGA 1PKMA 2HXTA 1FWCC 1NFBA 4C6IA 3NSNA 2IS7A 2VL4A 4P7LA 2YW4A 1KM2A 1TWSA 4UNLA 4DI9A 1IQ8A 1E6SM 3M43A 4LW7A 4JIPA 9XIAA 1W9UA 3VD7A 4UFMA 3AS3A 5CPQA 3VE7A 3TR9A 2AOSA 1E1CA 4QG8A 2X1UA 4LS1A 2WCGA 4B3ZA 1JPDX 5AHEA 3CUHA 4R34A 3TDFA 2QLYA 4IJBA 7REQA 5CJNA 4LXFA 5A8OA 1C9DA 3AJ7A 3ARYA 3W0KA 3QW4B 1W0MA 5DO8A 5BU6A 2WANA 3LBOA 2VR4A 2GWNA 3NWRA 1Z42A 3CEPA 2PBGA 3S9ZA 1E0XA 3I10A 5HR7A 3VGGA 1M04A 4UTLA 4OE7A 2H8ZA 1KO0A 4JNZA 2QV5A 1MFVA 3AAMA 1H7PA 1CB2A 3F5KA 3WMCA 4XD5A 2PDPA 5HMEA 1TB3A 3NL6A 3QQWA 1J96A 1RJQA 3BSGA 1LQ2A 1UBSA 1P5BA 4ZE4A 1RH9A 4N9DA 3VKAA 2DPEA 3POCA 3I6RA 4Y9PA 3WQOA 4RCXA 2ZZ2A 2ZZ6A 3HPZA 4L1XA 1A49A 4KRTA 4IP4A 1BQCA 4AVNA 2GJPA 2VX4A 1DXEA 4MYAA 1ZAHA 2JEPA 1UKOA 1TWWA 1CYGA 1DJYA 4QDWA 3AC0A 1W5PA 1JULA 1Z69A 1DJNA 3T78A 1XYAA 5CBIA 3UP8A 2FHCA 1PYMA 2QCDA 1GG0A 2ZRZA 3NQMA 1RBLA 1K4GA 3IJ6A 2HJPA 1GVFA 4XG1A 2A0NA 2X2GA 4ASTA 4JPGA 3RMEA 4NZ4A 2YDQA 3SM0A 1DIDA 4KWOA 2HEJA 3W2JA 3EA1A 7ENLA 3UG4A 1M65A 2WVVB 1XH2A 1FVPA 3EA3A 3KS5A 2QF8A 3WH8A 3RGTA 4DF1A 3ABXA 5JIPA 4X63A 3CV7A 4AIOA 4A8RA 1S2WA 5D37A 3ZFHA 3T09A 1VRXA 5D2YA 3SIZA 3VTRA 1MNSA 3MVIA 2VOMA 3A22A 3VM5A 3ITGA 4DLFA 1BXCA 3ZT6A 3D5HA 1MW1A 4UCGA 3KBJA 1UB3A 3DC0A 4QQ3A 3WF2A 4ZSTA 5A6MA 2X1TA 1T5AA 2XU2A 3NZQA 3NTYA 1ZBCA 4UTWC 3CASA 2E3ZA 4LT9A 2TRSA 2ESCA 3C4UA 4EACA 1R9YA 1V8EA 3MHFA 1TR1A 5C9XA 1RD5A 1KGWA 4U10A 4KRZA 3KVKA 1R47A 1E6PA 1P4CA 1XUZA 4R88A 2XWDA 1YQ2A 3EOOA 4IL0A 2X09A 3H24A 1RVGA 3M5YA 3UPWA 1VPQA 2RH9A 3CMGA 1AJ0A 4CD6A 2QJHA 4F4RA 4GY7A 3GXDA 2VEGA 3V1HA 2E1WA 2PWVA 3W6MA 1XYCA 3THDA 3HQPA 3M1ZA 3EMZA 5KZ6A 3SUSA 3RLUA 3W1RA 3K4AA 1C3FA 2C0AA 1C8QA 1DIEA 2CZFA 2PCQA 3EEGA 3TX9A 1A5OC 3PK7A 3PUDA 4ZB5A 3URBA 4XV0A 3BLPX 5FJUA 3UGRA 3W7OA 3C56A 3IJ9A 3B9OA 2O92A 3H23A 2YBTA 1E3XA 1EXBA 1Z9AA 4NT0A 3DBNA 2P88A 1VBUA 3BANA 3NUKA 3OHMB 4G7EB 3V4BA 2DT3A 1XGEA 2J74A 3W73A 2BDQA 4HNVA 4MGGA 1L2QA 3S4TA 1M5WA 4LV9A 3M5ZA 3BMWA 4MTVA 3I4EA 1SR9A 3WF4A 3VIGA 3ZJ8A 4XKYA 3S5YA 4DIAA 4BQ5A 4KW2A 2ISWA 2B81A 3P81A 1OY0A 1DXFA 4Q8WA 4PYSA 3WLJA 3ITVA 5C7VA 3N2CA 2PZ0A 3AZSA 1I2QA 4PB4A 2AMGA 2WXDM 3AHXA 3O8AA 3OGSA 1XFBA 3UG5A 2ZE0A 3CT2A 1CLKA 4NF7A 4YS1A 1E43A 4JDYA 2F61A 3N25A 3WQGA 3TZNA 4NJIA 1XBZA 4HSNA 3LRLA 1J0YA 3UY8A 4G5DA 1I6NA 3PN8A 4IIDA 3ORWA 4HHLA 2YCEA 3AICA 3W25A 1XI3A 5CEWA 1S38A 2V69A 2QCNA 2X8RA 3U2EA 1FQ0A 3RRXA 1G1YA 1HO1A 4YWSA 1ZCOA 2DP3A 2PWFA 1XXXA 2ASHA 5G1MA 1RBOB 1MO0A 2BASA 4MDPA 3F2DA 3PZVA 3B4UA 1M03A 2PWDA 4JQ4A 5C9RA 4PUDA 5KEZA 3B0PA 3NQEA 2WPBA 1NOFA 4M1RA 1DIOA 3M7SA 1IIGA 4X9SA 2GPTA 3AFBA 5AECA 3N9RA 3ARTA 4GINA 1GVYA 1YTEA 4FIRA 1FWHC 2GFTA 3GS6A 1DJQA 2A1YA 3QV6A 3BJTA 1RVKA 3R10A 3ARXA 3TCSA 1VR6A 3HFYA 3KBWA 3WF1A 3R8GA 2FJKA 7A3HA 4GJIA 3WENA 4HU0A 1WBHA 3KHJA 1UOZA 4HYVA 4AHQA 2SFPA 1VBGA 1XLAA 4M51A 3W2NA 4O8AA 3ME3A 3A9IA 1JIBA 2WJDA 3LXCA 3A9BA 5DCEA 1FWFC 1LG1A 4HTBA 2RJHA 1NWUA 3LPOA 1FWBC 4BEUA 1HL8A 2BOFX 2UY4A 3HGRA 3QC3A 1HKJA 1GQKA 4IG2B 4DB7A 1HKWA 3C8FA 4XKMA 1E4MM 3I4KA 1VPYA 3C61A 1JUKA 2HK1A 2WLZA 5AHFA 2XTKA 3KL0A 3EWWA 4JIIX 4ZOBA 3C5QA 2X0YA 1JAEA 1XP3A 3LXBA 4IGSA 4W7VA 2A3CA 3M0JA 4QCEA 4TV5A 1VGAA 2BHZA 2VMFA 2JK2A 3WDRA 7CGTA 1J11A 3SQMA 2QGYA 3URNA 4GO9A 4IFKB 2V5JA 4MVAA 1L6YA 2E0PA 2PDKA 5I06A 3N19B 4XX6A 4OU1A 3WBWA 2PURA 4QSHA 4FNTA 3WMBA 2DEPA 2QHAA 1RAKA 4M29A 2VRQA 4YCOA 1JJKA 3B8WA 4HN4A 1SUXA 2A3LA 1UR1A 4LTSA 3PUEA 2X16A 2OEKA 4TV6A 3ZMRA 2ALDA 4AD1A 1W2VA 2NQZA 5K4ZA 1ZS2A 2C71A 2PDXA 4JHOA 1U83A 1UH3A 2C3ZA 3C2OA 1V7AA 3M0HA 1N55A 2ZUSA 5K9XA 2WVTA 4GZIA 2R1MA 1M41A 4NI8A 2EPHA 1JF6A 5DY2A 2REQB 5LA2A 1AVAA 3EDFA 3N6QA 4GUIA 4XD4A 1WDSA 1WCGA 4BCEA 1XINA 2ACUA 3JZUA 3NDZA 2NWRA 1H63A 1DQUA 1MW3A 5KZEA 1RK5A 3V16A 4GFSA 2AGTA 4N9BA 4XBKA 4QE4A 5DANA 1KFLA 3S83A 1KTBA 3RXZA 3BMXA 1VRDA 3PPGA 4MAZA 1DWHM 3HQOA 4AZGA 3WEZA 4TUFA 2ZXBA 3KX6A 1T8QA 2OR2A 4EF9A 2OX1A 1NOWA 3GUWA 3L0KA 1FWWA 3O05A 2QDEA 5XINA 2B7QA 1H62A 3U2CA 1EJTC 4LVGA 3S5ZA 4LC8A 1XBVA 1F9CA 2HISA 3H2MA 4UFIA 5EGRA 5G4EA 4GQ0A 3M0IA 4IZGA 5C9WA 1LT8A 4HMDA 4DZAA 4XVDA 2TYSA 3I68A 4NX5A 1LORA 1TPWA 2D20A 1JG9A 1VBHA 2YX0A 1GTEA 3LCLA 3VDAA 4URIA 4GXWA 1KKRA 1Q6QA 3RM4A 1VFMA 3EX4A 3RR1A 1DWGM 4JFTA 2QUNA 3CB8A 5I23A 4JTFA 4AYGA 3AHYA 3PBGA 1R3WA 2BV9A 1MNZA 3NCOA 1IT8A 3QM3A 3SCQA 1Q4WA 4C6BA 1ELSA 2DZVA 3V5OA 5I78A 1HJQA 1R5YA 4CVUA 1K8ZA 2DIJA 2WNNA 1K02A 3EXRA 4BWLC 2DQWA 2VFIA 4AMAA 4K1GA 3QZEA 1BVNP 3DYPA 1XLHA 3BAIA 1L6WA 1PHQA 3MHGA 1I2PA 1VS1A 5C54A 5H6HA 2ABAA 4R9OA 1SJAA 2H6RA 2Z7KA 3CUJA 4AUBA 5LYRA 3STCA 2Q02A 1UUMA 2VDHA 4MNMA 3M46A 3E2VA 1A5KC 4GY0A 2PDQA 3GH5A 4D1JA 2PGWA 3H12A 1ZAIA 3PTMA 5ECVA 1XG4A 2VEMA 5B7ZA 2WMHA 5HJLA 1EA0A 3CL7A 3UVIA 3OIXA 3SRFA 3WNPA 2PMQA 1VCVA 1D9EA 1O1ZA 1YBQA 1N8FA 3WK0A 1UWUA 1EJXC 1YNYA 4DZ5A 1UD5A 2J7EA 1HJUA 1C90A 3UJFA 1AQMA 4MADA 2V30A 1W5QA 1EOMA 2Q6ZA 5A1AA 2VGGA 3FHQA 3LU2A 5ABTA 2OU4A 3S1GA 4CNTA 3R0KA 3S6OA 2Z24A 2E8ZA 4GKTA 1R3QA 1D3CA 4U2YA 4H6QA 5IBXA 4FR1A 2XGIA 3ES7A 3DHPA 3UR5A 3K46A 1R0MA 2WKJA 2DT1A 1FP9A 3B9AA 2EPNA 2GUYA 3RNDA 1ZHAA 3KEHA 2NWSA 1U1UA 3EWXA 1F4AA 4M82A 4JS3A 1F3EA 2Z6JA 5E5CA 4IT1A 1L2UA 4PUWA 2JQXA 1JCMP 1FKWA 1PCKA 2VGBA 4R3UA 1M7XA 3PHAA 4DPPA 2GZXA 2HK0A 5ECUA 1NF7A 3MMWA 4ZO9A 3CUGA 4L56A 1M53A 3GR7A 3HQNA 5I7GA 3F5JA 4O53A 3IJ8A 1E72M 2GDQA 5HNUA 4X2RA 4K7VA 5D9MA 1SFTA 5CH9A 2Q8ZA 3PB0A 1H0IA 4QJ5B 3USZA 4W87A 4DWDA 2Q8XA 4QAIA 1HNYA 3MUCA 3TOYA 4PMJA 1KXQA 4G2DA 2C6QA 4TX6A 2RKXA 2GWGA 1VEMA 2VCAA 3L12A 1P0DA 3SDOA 3H55A 2VX6A 4PUUA 5CAKA 3RX2A 1EBHA 4EK7A 4JD4A 1ECQA 1L6SA 2OO0A 3NEHA 1WZLA 1S5MA 2ZA3A 1A5BA 1A5SA 3G8RA 1J5SA 3MWCA 3TR2A 3A3XA 3TYZA 2G3MA 1ISZA 1UQZA 1WZKA 1G6CA 3CMJA 2Z1WA 1TX2A 1A5UA 1O12A 3V3WA 4GO8A 2E4TA 2HWGA 4GCXA 1Q63A 3R1ZA 1XIBA 3P5YA 3PAJA 4GI6A 2XPKA 4HHHA 3THCA 1OQFA 4B2DA 1MZRA 4GABA 4QCFA 2J4GA 4K36A 5C2GA 3TK7A 4DXKA 1FCQA 5EKYA 1I60A 1HVQA 2A6LA 4K38A 2BWGA 1J6OA 2WLYA 1CXEA 3BAWA 3ITLA 5D30A 4EPKA 3VIIA 3GDLA 1KXHA 1MRAA 4HP5A 3ECQA 1WP6A 2WO5A 3DFQA 2VR2A 3RJYA 3EOLA 2X1IA 3KOYA 3RU6A 2A2IA 3W1AA 5DMYA 1E6ZA 3AXXA 4Z2KA 1QRQA 1KBJA 3VM7A 3CUFA 5ABFA 4Y8EA 7TIMA 3OB8A 1SMAA 3BARA 4H9TA 2CLPA 4NZCA 1H7WA 2VX5A 4G6CA 2GDVA 3P6LA 3M7WA 1TV7A 2ACSA 4MFDA 2UY2A 4H4IA 4E0CA 4RXGA 2OGYA 1RCXB 5A2CA 2GUBA 4S3EA 5J5DA 3HIJA 4WDTA 4JFUA 4DYEA 1W56A 4IMGA 4NL1A 3C3NA 1TREA 3FKRA 1BD0A 5FACA 4DXXA 3AXHA 1WNOA 3NVDA 1LQ0A 1GG1A 2CYGA 3C0QA 4JX4A 2ZVRA 3CAQA 1SZGA 2ZZ4A 3BW2A 2GL5A 1OINA 3IJIA 4LALA 1PX8A 3GB6A 3UXIA 4AMCA 4MY8A 2V3EA 1TV4A 5I3GA 1AK5A 1S39A 1X6LA 4RZ4A 3N73A 5F2MA 2NQ5A 5D2TA 1KM1A 2D0FA 1HIZA 1QI2A 2HNEA 3AHVA 3RIKA 1ODZA 1SO3A 2PBOA 3OTRA 4FHAA 2WHMA 4CD8A 4KEZA 4HB7A 4MWAA 4U4MA 2EG8A 4M3PA 3UA4A 5CC5A 2ZRVA 1W5OA 4OGZA 3F4NA 2H3DA 3K13A 2BVDA 3MI6A 3CL6A 4IIBA 4WXYA 4J2MA 4FXJA 1FWEC 3WK2A 3LDVA 4XTIA 3LQGA 4GD0A 2QCFA 2XH2A 4PSRA 1KM6A 2E9BA 3IGUA 1GHSA 1WKYA 4O14A 1YPIA 4O0QA 5IHRA 2C0HA 3HJZA 4E8CA 3K4DA 1RBAA 4UMBA 3LG3A 5DRIA 3W72A 9CGTA 1K7XA 5MF5A 4Z0SA 2WC4A 1LBMA 2QYGA 1DWFM 3DDMA 1Z32X 3REQB 1W9PA 3AXIA 1FP8A 4NSBA 1GNXA 3DH7A 1R2SA 2W79A 2QAPA 4BQ3A 1R8LA 3CQKA 5DT5A 3H2NA 2INFA 4H3DA 2R14A 4RW5A 1RJRA 4C1LA 1A80A 3TTYA 3AZTA 4PMZA 2V3DA 1KLZA 3M5VA 5LNUA 2OZ3A 1B4EA 5XIAA 3CZKA 3MI3A 3H6OA 3IUIA 4L9YA 4FEZA 3DOPA 3KOZA 3T8LA 3UZYA 3MVTA 5C6MA 1O4UA 4YTSA 1GOWA 1EPXA 1JL8A 4Z2IA 4MZ8A 5JBFA 4C6LA 4LSBA 3BJFA 3AROA 1JNEA 3D6NA 4D71A 4LFYA 3MSRA 4C6PA 4M6VA 3LGDA 2B7PA 4JDBA 3L66A 4ZB0A 4DBUA 2WB5A 4YTUA 1GWJA 1LOSA 2Z4GA 1Q3NA 2QQ6A 3IGHX 1J0JA 1P48A 1IZKA 3LMYA 3DX5A 2I1OA 4V33A 3BGAA 2PAJA 3CPGA 3IVUA 2FZNA 4MJZA 3I7RA 1WZMA 3LERA 3TLQA 3VOCA 4GC3A 2OYLA 1JDFA 3PWIA 3GAYA 3KLKA 3P2VA 4G7FA 1YX1A 4QNEA 2W0UA 1H61A 2WJZA 1ISYA 1QU4A 3EX6A 1B3YA 2GOKA 3UJEA 2PDHA 1TZ9A 1JD7A 2A7RA 4IFOA 4OBRA 4F2UA 3LCWA 3MW7A 2ZFAA 2CXGA 2VENA 3BICA 3UXDA 1A0CA 1W3HA 2ICSA 5HULA 3QH2A 4E38A 3CWNA 4BKNA 1LWHA 4A35A 1UA3A 3UWYA 4UTKA 1QOXA 1MFUA 2CLMA 2F6UA 3TWAA 2ZZ3A 2QV4A 2I5QA 3GBEA 3H4WA 3S8HA 3AHTA 3G0XA 2E7FA 1JYNA 1XH0A 5M5DA 4BWLA 4P2VA 3TTSA 3N3TA 4CQ9A 2P8CA 4EX4A 2J75A 3LOTA 3FYPA 1RXOB 3T40A 1F8MA 4C7FA 4JKMA 2QUMA 5T8GA 5J8LA 3B06A 4B5NA 1E15A 3GFZA 3NYZA 3DYMA 4KPLA 1E40A 4DYJA 1W9BM 5CZJA 1CBGA 1TZ7A 4K39A 1D3HA 3TW7A 3P62A 5A6SA 1PZ3A 1VYRA 4LAMA 4QGCA 4QR6A 3FCPA 1GOQA 1ONWA 3F4WA 3A64A 4U5KA 2GSEA 2B0MA 1Z89A 1VYSX 2J79A 5DN1A 3WH7A 3W2UA 2Y7GA 2PTWA 3T4WA 2FB2A 1K8YA 1J10A 1W3LA 1JZ3A 3VKCA 1XS2A 3AIWA 4S3KA 2G8ZA 1QFEA 4W8LA 5XIMA 4ZQRA 1GZ1A 3BSHA 4A05A 3N3MA 3BJSA 4C6DA 3LM7A 3U57A 3ZXWA 5ABHA 4MDOA 3R7MA 2PDYA 2B7OA 1EDTA 3KTCA 5HMFA 2E28A 4S3FA 1YTDA 2Y8KA 1KLYA 3VNKA 5DEZA 4CN1A 3E2SA 2DFAA 2BOGX 3CAVA 2UY3A 4JTGA 5JH1A 4IQEA 4MYXA 2GUUA 4N2YA 4DO5A 3C3UA 1G94A 4JTAA 2DZBA 2XINA 4GX9A 5DY3A 3WLIA 1AFSA 3CUIA 3WQVA 3KOXA 3WNOA 4QE5A 1QK0A 3AMCA 3SY8A 1X97A 3A5VA 4AVOA 1GVIA 5CPSA 1BVZA 2Z1BA 4KKXA 3GU9A 1NP0A 3FJLA 4A6GA 5M17A 3ZWTA 1VYPX 1ZTVA 6A3HA 2W5FA 3TQ0A 4A29A 5E0CA 3B3DA 1PDYA 1N2VA 3DC8A 1Q4NX 4JBRA 3TH6A 1EO7A 1TPC1 3ZLHA 3UESA 3KAOA 3KXQA 4CCCA 2EAWA 1SW3A 3M41A 1UUQA 4JN6A 3URQA 1Q13A 1FDJA 3VD5A 1V3JA 1AH3A 3A47A 2FPTA 4QQUA 3LCHA 2IQ0A 4C6MA 3TA6A 5BMWA 2Y62A 3IEBA 4O0ZA 3SBFA 1DWJM 3EWZA 2XZ7A 1YBQB 2BX7A 3ZVHA 4Q22A 4C5YA 3HGSA 4I9JA 3EOEA 3SJ3A 3LHZA 2W92A 4ZQPA 3W84A 1CW2A 2FHFA 3RCNA 2D2OA 5I03A 4O18A 1JGMA 1CPUA 1EEPA 3SUTA 4REQB 1DTUA 3TQPA 4GYJA 1TE1A 4RK8A 4FNUA 1WAWA 1HZYA 3DG7A 3AISA 1AD4A 4HU3A 3S2CA 5EU9A 2OYMA 4MJMA 4O19A 3MBDA 1E1EA 1PWMA 4GHRA 3C2RA 2OOGA 2VR5A 5HUOA 4HA1A 4AZCA 4PFHA 1TKKA 3OVRA 1KQYA 1A4LA 3AIEA 4I3GA 2Q71A 4GH1A 3L4XA 3VC5A 2P76A 1T8XA 3N2TA 4FS9A 4H9YA 1B90A 4H8VA 1OJXA 4MLRA 2DZUA 1TV8A 2GYIA 4BZYA 1OWQA 1OX4B 3HPFA 5FA5A 1UP0A 3P60A 5CGQA 4AXKA 4FXRA 1QWGA 3IVSA 1N82A 1YXDA 4MWAC 1K9EA 3IACA 3UBPC 4MOZA 1ISVA 2W6RA 4B9YA 1CIUA 1UWQA 2WM1A 1E6QM 2PD9A 4AIBA 3IK2A 4O52A 4CNNA 3NM3A 3GDKA 4QP0A 1JPMA 4IP7A 1KCKA 1OT1A 3QPYA 2QCGA 4MM1A 3HBLA 5CSUA 1PJ9A 3OVGA 5AYYA 1F8IA 1EX5A 5D2XA 2XIIA 3MYPA 2POTA 4Q7IA 3HOJA 1UQYA 1XLDA 5F2LA 5H8UA 4QTGA 2ZCGA 1FWNA 1JCYA 3H54A 3AU6A 1Q5MA 3DU0A 3WEMA 1OCNA 2PS2A 3N1AA 4OT7A 3CZEA 2R94A 5BMXA 4RDVA 2EJAA 3T8QA 4ZOCA 3ZO9A 2C1IA 2E68A 3K8KA 3SSZA 4UOJA 5GQBA 2F2HA 3WDQA 4WSHA 1FA2A 3TAOA 2VRJA 4CD4A 4GGHA 4D72A 2WMJA 1BEUA 1R6WA 4O1DA 3APGA 4H00A 1LLWA 4KF1A 4PODA 4J7RA 3H7UA 4ERGA 2DV0A 5FJIA 2BG5A 1HVXA 3EGJA 4NAFB 4AX6A 5EFDA 2RFGA 3CZLA 4OQVA 5JH2A 4H8UA 4HHMA 2VM8A 2WM0A 3L2MA 4GX8A 4IMFA 3FW6A 3WMSA 4E2OA 3N9SA 5C2XA 2Z6IA 1FKXA 4DUOA 4EAMA 3G22A 5HMSA 3GH4A 1GVEA 3GU1A 3VMOA 4D8ZA 4PEEA 4DWSD 1D8WA 3PBUA 2G0WA 4ICNA 3R5EA 2DW6A 1EWEA 4UFHA 1YPXA