3GDRA

Crystal structure of the d91n mutant of the orotidine 5'-monophosphate decarboxylase from saccharomyces cerevisiae
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
260
structure length
260
Chain Sequence
KATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFENRKFADIGNTVKLQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLATGEYTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 102
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3gdrA00
4L4MA 1O95A 3QH2A 4JTHA 1W5NA 3NXFA 4TIMA 3C0JA 1QNVA 3VKJA 3DXIA 2FQIA 2VXNA 1HL2A 3H55A 5EA9A 4JTTA 4MY9A 3W1LA 2H8XA 3W7GA 3LGEA 3A21A 3NQ7A 1LOQA 4RJEA 2O7QA 1TB3A 1IXNA 3W7EA 3GVGA 4RZ6A 4CQAA 3QW3A 3LHTA 1F05A 1YTDA 3E96A 3ZS4A 5BOOA 4I7WA 3CM4A 4UFJA 1M6JA 1ZCOA 1U5JA 1OX4A 3A23A 2VFIA 1LDCA 3GAKA 3WJWA 4WY0A 5E1QA 5I3HA 1SO3A 2YFNA 4AAJA 1B9BA 3P74A 2Z0IA 3JR2A 4K37A 4O19A 2E6FA 4A21A 5D05A 3W7CA 1N7KA 1RR2A 3RU6A 1KV5A 4Q4KA 2Z6JA 3WK2A 4QM1A 2PC4A 2VFDA 3TFCA 3M9YA 2E5DA 1JUKA 2YYUA 5FI8A 1LZOA 1LORA 4CNOA 3O8AA 1SPQA 3BW4A 4IPJA 5G2WA 2GJLA 2A5HA 1SW7A 4O1AA 3FOKA 5K9DA 1VS1A 5KZMA 2QCHA 5HR6A 4AWSA 3I7RA 4MIMA 1A5SA 2ZRVA 4X9SA 2QCLA 3CHVA 2J9XA 5AYYA 5FF7A 5T26A 1OK4A 1J4EA 3KRZA 3TU9A 4MLRA 4CNPA 3M5YA 3TMLA 4A2SA 1XBVA 1TPWA 3MYOA 4EF8A 3WJSA 3RLUA 1AW1A 8TIMA 1MZHA 3G8RA 3W23A 4DQWA 3FKRA 4ZQRA 1JCMP 3IIOA 3INPA 4FIQA 5EY5A 3WJZA 4OWGA 5K4ZA 2YDAA 3PG9A 2VFGA 3EX6A 1OFBA 3CWOX 1QMLA 4HNUA 4S2BA 1SUXA 4UMBA 4TMCA 2DORA 4EIVA 4LVBA 4DF2A 1F74A 1HO4A 3DFSA 4M6VA 3U8GA 4RX0A 1OYBA 4IGHA 2C3ZA 4NX0A 1AW2A 6ALDA 4MZYA 1VR6A 3G3DA 3A9IA 3E49A 4UMAA 3PBVA 3GNNA 3G1SA 5FF4A 4KWWA 3FIGA 2FLIA 1OF8A 1TV5A 1DKWA 1AW5A 4H6KA 1IIGA 2C6QA 2J24A 2QCCA 3G3MA 3NL3A 3BLIA 1TTPA 4XTIA 1X1OA 3NPWA 1F2JA 3UWYA 3E02A 3GLCA 1SSGA 3TSBA 1O94A 3T4CA 2Q3RA 2ZZ5A 2CU0A 4HNVA 3B0PA 1TYGA 1S5TA 3KRSA 3EEGA 2P1FA 1UUOA 2FIQA 3W7KA 3G1DA 3KFTA 3CEPA 3L9CA 5CPLA 1YXDA 4NJJA 1OFOA 3FJ6A 1IXPA 2EPHA 2NXGA 3THAA 4JYEA 2QCDB 3L21A 1OYAA 2Q8LA 1DV7A 3NVTA 3BPWA 2DZSA 3RK8A 3LDVA 4E38A 2BSLA 1VJIA 3LB0A 2YW4A 1H62A 3BW3A 3BG5A 4JY9A 3R12A 5LZLA 4UMCA 2QDHA 4JY8A 2WV8A 4LVDA 3W7NA 1XC4A 1LOSA 1OFAA 2GQ9A 4NZJA 5BRBA 4O4WA 3RMJA 5CGQA 2Y63A 3STGA 4AB4A 3EX3A 5LNSA 1G69A 1Z42A 5CPNA 1OFEA 3S1WA 2ZTKA 4JEQA 4UR8A 5IBXA 3PULA 3PVFA 4H4IA 2QCEA 2VELA 5D37A 2WO5A 3NM1A 2V81A 3LBMA 1H61A 1LCOA 2TRSA 1XI3A 3L5AA 3M16A 3TX9A 4E2BA 1G67A 4ZZ9A 4PCFA 5FF0A 3UD6A 2DZWA 1JCXA 1OX6A 3H53A 4AWUA 3MUXA 2G5WA 1QOQA 2QCFA 3W84A 4UTJA 3LI1A 3PB2A 3TW6A 5G1YA 3F1QA 4N9EA 2OT1A 4LRTA 2QDGA 2VENA 1VC4A 2GPTA 1NAL1 4KWVA 5LHFA 1GYNA 5DXYA 4NT0A 3G1HA 1I2NA 1XUZA 1WOAA 1EPXA 1OFDA 1I8JA 4O16A 4UTWC 2NUYA 1EEPA 1LBFA 2EAWA 1U83A 2GVGA 1GQNA 3CPRA 2WOQA 1UJPA 3NL5A 5ABTA 1R2TA 3PF3A 1KBJA 3TA6A 1Z44A 4O13A 1C9DA 4M6PA 1Q6RA 5U7SA 4WXZA 3LCFA 1RQEA 3PB0A 4Z1DA 3W2MA 3W75A 4JIPA 2DZVA 3HF3A 3S6DA 1UBSA 3FA5A 3O63A 4UTMA 3EWXA 1JCYA 1WQ5A 2ZA3A 4UTLA 4GUJA 3TH6A 1HFBA 3GDMA 2PRLA 4YL2A 1LBMA 2VKZG 1GTEA 3M47A 5AHMA 1KFBA 3TKFA 1KV8A 5D33A 4AHQA 3QQ0A 3W7QA 1W5PA 3G1AA 3BGJA 3KVKA 3LTPA 1SR9A 4UFIA 4EWND 4LTSA 1E51A 5CKSA 2BTMA 4A22A 4LS0A 1JUBA 3T40A 3P80A 2FJKA 1P0KA 1OYCA 4N4PA 3NPUA 3KVMA 4Z1CA 1TPEA 5HR7A 4R53A 3MMTA 1Q6LA 4AH7A 1DORA 3O16A 3P82A 4M5PA 1FCVA 5CZTA 3SY5A 1TCDA 4ZQMA 5F2GA 3MW7A 4GNJA 1EP1A 4JNMA 1DJQA 3L2IA 1S5VA 1X1ZA 1A5AA 1B4KA 2VFEA 2X16A 3QZEA 2XFWA 3PSVA 5D30A 1HUVA 3MHGA 1GEQA 2J9ZA 3UWWA 4O57A 1KA9F 3QJAA 1PIIA 3I6RA 1ICSA 4L4LA 4PODA 2C0AA 4Z1BA 1VGAA 2Y7EA 1FWSA 3A24A 5D32A 1I2QA 3MO7A 2DZUA 2Y7FA 3UZJA 3UYCA 2JKEA 4UC5A 5A8GA 4JX6A 3EWWA 3GYEA 4C1KA 1TRIA 5H91A 3W2NA 4BI6A 4HNNA 4QQ3A 2ALDA 4WJEA 3TE9A 4Z1AA 2ZCGA 3N73A 4JDBA 2OT0A 1AL8A 1TIMA 1SO4A 2WJZA 4O1BA 1QR7A 3GR8A 3SR7A 1M5WA 3Q2DA 3IV3A 2ZBTA 2UV8G 4O1DA 4YWIA 3RF9A 1RZMA 1ICQA 3TROA 1FDJA 3LCLA 3CB8A 5DLCA 5C6MA 2RHGA 3O6CA 1MXSA 1ICPA 4IQLA 4IXHA 4IX0A 1QPRA 1TO3A 4R33A 1TRDA 3DI0A 5KTLA 3OA3A 4N9BA 1QDSA 5CPOA 3CWNA 3MYPA 3G22A 1L6SA 1OFRA 3N3MA 4RCXA 2B7OA 2Z2UA 3QSTA 4LW7A 3B05A 4IPIA 1NEYA 5DCEA 4UFHA 5AHFA 3QEZA 3FJLA 2X1UA 1XDMA 5EMUA 5CSSA 1LYXA 3DKJA 3LCGA 3R5EA 2GQ8A 3TUUA 4JTJA 4JR5A 2NXIA 4LV4A 3LTYA 4QJ1A 2OJPA 3MI3A 5FEWA 4TU1A 2C13A 3KVJA 1LOLA 1GTHA 4ZMGA 2F7FA 1DVJA 2X2GA 1R47A 4C1LA 3HPZA 3LRLA 2Y6ZA 3EXRA 2NUWA 1OFQA 1H63A 5D04C 3THQA 1SQ7A 3W85A 2JK2A 1SO5A 2R8WA 1PCWA 2FTPA 5I3IA 5F1VA 4GRSA 3BGGA 3PS7A 1EWDA 1TV8A 3UPWA 3TV8A 1CX9A 3PBYA 1LRNA 1SSDA 4MOZA 1O60A 3G1VA 1W54A 1SW3A 3M6YA 3HG5A 1EWEA 3MWAA 3NAVA 3O07A 3IIPA 2ZTJA 4Y9AA 2NX1A 2BZNA 3UWQA 1KM0A 3SJ3A 4IUOA 1LLZA 4BI7A 4N2YA 4OBTA 1K8ZA 3SECA 1EP2A 4WXYA 2QJGA 4OU1A 4JYFA 5HNRA 1K7FA 1SO6A 1VYRA 4WD0A 3PR2A 4K39A 3JRKA 4O0KA 3SGZA 1R46A 5G2HA 3CIXA 4E2DA 3G18A 1P1XA 1XM3A 2IQTA 2Z1BA 4UTUA 3WK1A 3P8JA 1J5TA 3P5YA 3UWUA 2JGQA 4NJGA 1JR1A 4AXKA 5AC8A 2J27A 5K9CA 3HG2A 1K7XA 3IVSA 3O6YX 3OIXA 4KFPA 3SSJA 3C3NA 3VCRA 2B7NA 3W2KA 1SFJA 3CTLA 3G0SA 1MEHA 3MP3A 2QR6A 3W71A 3TC6A 3NQAA 4RK8A 2CLMA 2B0MA 5TIMA 4IMGA 4NXSA 2A4AA 4DO6A 4IMEA 4FNQA 1EIXA 1JQXA 3VI2A 1VCGA 1TQJA 2VOMA 1OX4B 2ZZ4A 2ZA2A 4WX2A 5CZJA 2V30A 5DCBA 4DPPA 1KM6A 2OX1A 2PCQA 2RDTA 2WKJA 1FUYA 1ZAJA 5AYXA 4AHPA 1YDOA 1TPFA 1MSSA 3GDKA 3L5LA 4JTGA 3KX6A 2NX9A 4WOQA 4N6EA 2ZRWA 4BF9A 5CZ0A 2HSAA 2H6RA 1T8XA 3OVRA 1B3OA 1XL9A 1P0NA 5G4WA 3PUOA 2CZEA 3L0GA 1D3HA 4I7UA 3HG4A 3CLMA 1RD5A 1JVNA 2ABBA 4TX9A 1BTMA 2Y70A 4OE7A 4PA8A 1O4UA 2GOUA 1HO1A 1IIHA 1TPUA 2QUUA 1GG1A 3W7LA 1KTNA 4WZHA 2ZZ3A 4XKYA 1SW0A 2AQWA 1WXJA 3UY7A 5F4WA 1EP3A 3CT7A 2V9DA 1VHNA 3I65A 4JTKA 3H54A 3A5FA 3LERA 5DY2A 4O52A 1XFBA 5CSRA 4KFNA 1MO0A 2X1RA 4NNBA 4QISA 4E0CA 4HHPA 3G8EA 3QC3A 4CCCA 2DU2A 5KMYA 1ZHAA 2KZHA 3RLVA 2EHHA 2RDWA 2X30A 1IXQA 2DJXA 3DFNA 3M44A 1FDZA 3SFKA 1VHCA 4JN6A 4CNNA 1QPQA 2ZFAA 3CU2A 1RV8A 4O0ZA 4TMBA 2BWGA 3B03A 4X2RA 5HWNA 2C14A 3EWZA 1XCFA 4IJBA 4AF0B 3NQMA 2YXGA 4K7YA 4UR7A 4ADUA 3OEXA 3SW6A 1H7PA 1H7XA 2EF9A 2E6YA 2YPIA 5L9FA 1GVOA 1OG0A 3QMRA 3GKAA 1XBYA 2YSWA 2A6LA 2VFHA 3LRMA 2WPBA 1JULA 5D2WA 3W83A 3QFEA 1FWRA 2P10A 4ZQPA 2G97A 1YXYA 1RQBA 2CFFA 1ONRA 5FEZA 5AC7A 3LV5A 3W1AA 4UNKA 4LS2A 3LLDA 4EVZA 2H3DA 1TPC1 3STEA 3EKLA 5AC6A 3OG3A 5EL1A 3BW2A 4X3ZA 3GX9A 3NQDA 1BWLA 4D2JA 1JCLA 5F2LA 4GUFA 5G5IA 3RFAA 3O1NA 5LSMA 5AHIA 3EX1A 4DO4A 4Z0JA 3MHFA 4JDYA 1TTJA 1X7FA 2VEIA 5DCDA 1DHPA 4M7SA 2CLIA 3PG8A 1EUNA 4K38A 3HGRA 1NSJA 4JS3A 2H3BA 2CLFA 3F4NA 3UXDA 3FYOA 1LM1A 1DL3A 2CZFA 1XBZA 1YLVA 3BV4A 3MP5A 1C29A 3E9AA 3TXZA 4I9AA 1DOSA 4I7VA 2J6XA 2H90A 3R8RA 1GG0A 2XN2A 3TC7A 1QFEA 1F6PA 3TQVA 1S5WA 1CI1A 2NWSA 3EKZA 4MLJA 1T96A 2ZZ7A 2QCNA 3PAJA 3G0XA 4FNRA 1TMHA 3L67A 2NX3A 3M1ZA 1Z41A 2VC6A 3USBA 3HPXA 2CLKA 3W2JA 1HTIA 3MI6A 1WBJA 1G4TA 1UASA 4GE8A 3S5NA 4GXMA 1W5OA 3KVLA 3W1UA 3DENA 1KM3A 4BK9A 5HUOA 1K8YA 3TSMA 3OVPA 5LKYA 1H1ZA 3TAOA 4XUGA 4Q32A 4ORMA 2QF7A 3PUDA 1N55A 1H7RA 1JRBA 3NO5A 2G96A 4FHAA 3VE9A 1A5BA 3UPBA 3QPYA 1W56A 2W6RA 3PSWA 1B4EA 4N9CA 1T99A 3TK7A 2RFGA 1FWWA 1ADOA 3QF0A 1VZWA 4IX2A 4N9DA 3W7RA 1XBXA 3BLEA 3M41A 4AF0A 4NJKA 4CQ9A 2TPSA 3S5YA 5AHNA 1QWGA 3TQKA 3IGXA 2NXHA 1PS9A 4LV9A 4O15A 4FO4A 3FLUA 1F7BA 1KM4A 2WSQA 4JTIA 3YPIA 3W2LA 2RKXA 4JTUA 1KFJA 4JGDA 1K3UA 2VFFA 1GYLA 3GR7A 5DY3A 4FB7A 1NFBA 4DEFA 4DBDA 2EKCA 3WK3A 1VRDA 3TXVA 3W74A 5HWJA 5FEXA 2ISVA 4S2CA 3S1XA 1J2WA 4LUIA 4P61A 1I45A 2I1OA 1YDNA 4TO8A 1G6CA 3LM7A 4HSOA 3ELFA 1SZGA 3U6WA 4UCGA 4TR9A 4WY0F 4PC8A 3NR0A 2HS6A 1L2UA 3F03K 2FPVA 2YFOA 4R34A 4A3UA 1Q45A 1WDWA 5KITA 4AMAA 3MJYA 3C2RA 1OJXA 1FCQA 5C5YA 4IMCA 5HWMA 3B8DA 2VEPA 4K36A 1TJRA 4CQ8A 4GBUA 3PUEA 3W2UA 2JGYA 1VYSX 3W7IA 1L9WA 5D09A 3P61A 1FQ0A 1YPFA 1YTKA 1YDVA 1I2PA 2ZA1A 2ZRYA 4A2RA 2VEMA 1ZAIA 1JCJA 2TMDA 4XZ9A 3LCWA 2JKAA 2NV1A 3P84A 5HINA 5D03A 3S1VA 1OABA 2YW3A 2V5BA 1EX5A 5K4XA 1C8VA 1BEUA 3W1XA 2FPTA 5FEPA 5L6UA 4OQVA 2XN1A 4H3DA 2ZZ1A 2NWRA 1GT8A 3U2OA 2ZRUA 3DFOA 1SZNA 4WQ6A 1IF2A 4NVTA 3W87A 1FCUA 1G7UA 4GFSA 2YZRA 1O5XA 1H50A 2YGYA 3L66A 3SZ8A 3PBWA 1F73A 1OVDA 3TR2A 5EYWA 1OF6A 5CPMA 4IOTA 5KINA 2YR1A 3SGUA 1NF0A 2ZRZA 1SU5A 4UFKA 2ZQ0A 3N19B 4XBSA 2QKFA 3EX4A 3QRHA 1H60A 5J5DA 4MJMA 3NNTA 2JBMA 3C4UA 4DPQA 3V1PA 4EF9A 3W07A 4QIUA 2A1YA 4HKPA 4R7JA 1KM1A 1FBAA 1PHQA 3HQ1A 3ABQA 3NQVA 1TSIA 2WSRA 3ZWSA 4GWEA 4ZL1A 4U28A 2QAPA 5AB3A 2GJNA 3IGSA 3D0CA 1AG1O 1YYAA 1S3HA 2GQAA 2F84A 2H8ZA 2J9YA 5TBOA 4Q33A 3BLFA 1ZJIA 3ABOA 2NUXA 1BKSA 1Y0EA 2E6AA 5G2IA 2QAFA 1ALDA 1K8XA 2QUVA 3IIZA 4NUWA 3MHUA 2FB2A 3LX9A 1MEIA 1LBLA 1F5ZA 2R94A 1TPDA 3I68A 3TJLA 1QPOA 5AN7A 1SZFA 4GUIA 4OV9A 3NEVA 4OHQA 4ICNA 4X22A 4BWLA 3GB6A 3LBCA 3VFLA 4HSNA 4EOUA 3O06A 3M5ZA 3LHYA 1RQHA 1W31A 1GVQA 1WA3A 2FDSA 3N2XA 3EWUA 1QO5A 3HGJA 3KHJA 3Q37A 1LLWA 1KFKA 2QCGA 3M0ZA 4MKNA 2WNZA 4LVGA 4LUJA 2DZXA 2R91A 2QCDA 3K30A 4UTIA 1ZALA 5LHEA 3E12A 1WOBA 3W6YA 4QAIA 3G1YA 3N9RA 2ZZ6A 3S5ZA 1FWNA 1R30A 2JKPA 3CIWA 2E6DA 4UXDA 2ATMA 3GIYA 2FB3A 3SI9A 2ZYFA 4POCA 4U4MA 1GOXA 3BO9A 1FXPA 4CCDA 3C6CA 3DKLA 3IVUA 3ANYA 3MBFA 3O6DA 4RZ4A 4XQ6A 1A5CA 3P81A 3JS3A 4FX8A 2YYTA 1H7NA 2CLOA 5HUPA 1FCBA 3TMQA 3NZ1A 1K7EA 3S42A 3R89A 1Z48A 3NPXA 3UY8A 3OVQA 4LVFA 3ZFHA 4FIRA 4B5NA 2Y7GA 1KTBA 3DBPA 4NNCA 3DFQA 1F76A 2WNNA 3BG9A 3QMSA 4RZ5A 1FWTA 3C52A 4RXGA 1TQXA 1YADA 1SFLA 5BMXA 1KFLA 5BMWA 2ZRXA 3GAYA 1KM5A 4PL2A 1PV8A 1OX5A 4K6AA 4IXXA 4Y8FA 3T55A 1VYPX 1V5XA 5DN1A 4PFMA 4MY1A 4AEOA 1KFCA 1LTDA 2Y89A 4O18A 3LXAA 3STFA 2ABAA 2A7RA 4NZFA 1ME7A 2NZLA 3LHUA 2FFCA 4DF0A 3EXSA 3IIVA 3NQFA 3FEMA 4KFOA 3LTSA 1WBHA 4JYDA 3W70A 4LWWA 1YTEA 1DQXA 2AAMA 2I14A 5LGXA 3ZWTA 4XKYB 4K7VA 3TCEA 1OHLA 4ADTA 1DJNA 1I2OA 4ORIA 4O10A 3ATZA 5LNUA 3P5ZA 3FKKA 3M7WA 3QMTA 1D3GA 4MFDA 2DZPA 4A29A 5KZDA 4ML9A 3E0IA 4XBKA 2W79A 2YX0A 1KLZA 4JICA 2B7PA 2Y88A 5AHLA 2XN0A 3RNDA 3TSDA 2TSYA 2VEKA 1WAUA 3AO0A 5I3JA 1H51A 3L0NA 4QNWA 1ZFJA 3NQ2A 4K8HA 3DGRA 3W7MA 4ZQOA 3PWAA 5K9XA 1GVSA 3C2FA 3LV6A 1KM2A 4O1CA 3NQ6A 4ZVJA 4WY0B 4AWTA 3GNDA 2BXVA 2CZ5A 2V2HA 3HG3A 4QITA 1WV2A 2I9EA 5DBTA 3IRDA 4UNLA 3NQ8A 2V0TA 3LLFA 1FX6A 3LRKA 5K3VA 3NYZA 3NPVA 5F2IA 5AHEA 2W0UA 4O50A 4IWWA 3BG3A 4OGZA 4LS1A 4GUGA 1EA0A 3EB2A 4PTNA 5SWUA 2Y85A 3S9YA 2Y62A 4RR4A 3TIMA 3W1MA 1QOPA 1TREA 3MBDA 1JRCA 4OV4A 1W1ZA 3LCXA 1PE1A 3AJXA 4Z0SA 5A5WA 3NA8A 3BVJA 3W3OA 1G4SA 1KBIA 4JTFA 3IVTA 3S0CA 1JJKA 1XUUA 4FXRA 2Y61A 1TTQA 5C2XA 2C15A 3W1NA 4QNEA 1XXXA 3B06A 3L5MA 3TJXA 5U4NA 1JUEA 4JTLA 4P2VA 4ALDA 3HGOA 4UTTC 4CLMA 5D2YA 5KZEA 1WX0A 3DFTA 4G1KA 4O4VA 1ML1A 2A0NA 4Z08A 1N8FA 1H7OA 5E0KA 3WFAA 2C18A 4O14A 1VCVA 1RPXA 3KAOA 2ZZ2A 2WNQA 5D2VA 4WUIA 1AK5A 4UIOA 3QYQA 3P60A 1EUAA 1W37A 1X6UA 3LHVA 1W5QA 3UZ5A 3QQ1A 4JD4A 5AYZA 5D2XA 3L0KA 3FS2A 2CLLA 4LC6A 5C54A 3W9ZA 2QJHA 3W7PA 3B04A 4BWLC 4UTTA 3W88A 3HJZA 5AOUA 4GJ1A 1IXOA 3A22A 3M43A 5J5RA 3N2MA 2WSYA 4FNUA 3W1RA 3NZRA 3O15A 4JTEA 1B57A 4K8EA 1GJPA 1YPIA 3CQ0A 4FX7A 4JX5A 4NJIA 1FY6A 3LHWA 2WQPA 2CW6A 2YCEA 1THFD 3T44A 3B4UA 3QW4B 4W9TA 1TPH1 1EB3A 5AFDA 5TQLA 3DU0A 3DI1A 3LCIA 4MPQA 4O28A 3HGSA 1V7YA 3QSRA 4N02A 4YXGA 3C8FA 1VCFA 3CC1A 3QPZA 4YMZA 5HULA 4QSHA 1Q3NA 4NJHA 1UCWA 1YXCA 4M6QA 4BI5A 4LVAA 1LRTA 2C1HA 4UTWA 4UTKA 1PCKA 3P62A 2PURA 4BFAA 2ATSA 2E5CA 1LROA 3DAQA 2B4GA 3NQEA 4HIBA 3Q58A 4O54A 5F1UA 5G4EA 4NNAA 1KW1A 1TTIA 1LP6A 3G1XA 2J88A 4LT9A 4FF7A 5F2MA 3PM6A 2ISSA 3UWVA 4NU7A 4MJZA 3G24A 1K03A 4ZQNA 5G1TA 3F4WA 4UTHA 3IGUA 1L6WA 2GVJA 4MYAA 4PL1A 1KLYA 1P5BA 4WOZA 2OMAA 5CG7A 2HTMA 4RXFA 1OK6A 5MHBA 1ZENA 4AHOA 3N14A 1X8FA 1H1YA 3GXPA 1VLWA 4FNTA 4Y6GA 1G7VA 2A7NA 3LXCA 3NQCA 4YLWA 4LRSA 5EKYA 2HMCA 2E77A 1H5YA 1L6YA 3G1FA 5HMSA 1GVRA 4OT7A 3TQ0A 5D02A 3WJYA 2PRMA 5BW6A 3MP4A 3NG3A 2DP3A 1FXQA 2DZTA 4O8RA 1ZY9A 3NM3A 3BARA 4JXCA 2GVLA 3CEUA 3ATYA 1LRQA 3HO8A 4O53A 3W72A 3W7DA 3G0UA 5HQEA 1R2RA 3IIXA 3S8HA 2NV2A 1ME8A 1ZAHA 4DELA 2V5LA 5E93A 4FNPA 3HIJA 2A85A 3EX2A 2Q3OA 5GVJA 1TV7A 2A7PA 1D9EA 3VE7A 1P4CA 3W1QA 3P67A 1DQWA 3P8IA 4IMFA 3C56A 5I3FA 3KXQA 4BR1A 1M7OA 5D38A 4FXSA 4HNTA 4MUZA 4ONVA 5EBUA 3W1TA 3WK0A 2RDUA 3C2EA 4JIQA 3A5VA 3NL6A 1BWKA 4LU0A 4O12A 1VH7A 1QPNA 3HMJG 3KRUA 1KFEA 5LNRA 2AGKA 1PHWA 3OBKA 3GDTA 3S1UA 2QEZA 3TW7A 1FDYA 2Q8ZA 4YCPA 3Q94A 5CZSA 4DF1A 4MZ8A 2GUUA 4FX6M 3TDFA 3LHZA 5IBXC 3R13A 4S1FA 4DXVA 1W8SA 3S5OA 4HPXA 3C2VA 2PRHA 4N6FA 4YCOA 1AL7A 3LOTA 3FFSA 3GKFA 3SIZA 3ZR4A 5DBUA 1QCWA 1A53A 2DJLA 5HJLA 5EPDA 4ZQCA 3NQGA 3ABRA 1JQVA 1R2SA 4CCEA 1RVGA 3BK0A 3M5XA 1NF7A 4FEZA 1JCNA 4IMDA 3W22A 4RV8A 2A2IA 5K7JA 3NL2A 1ZNNA 3MI2A 4UFMA 3N9SA 4M19A 2A6NA 2FPYA 4MZ1A 5DXXA 3PY2A 4UFLA 4N4QA 2E09A 3W1PA 3DFPA 5LGZA 1W3TA 4MYXA 5FF3A 4XTDA 3LI0A 1GPWA 5I3GA 2O7SA 2RH9A 2CZDA 3I7SA 4Y96A 2P0OA 2E68A 3EXTA 1MEWA 3T78A 2BX7A 2ISWA 5F4SA 3UNDA 3W7OA 4Y90A 2QUTA 3KOFA 1F6KA 2QJIA 7TIMA 1H7WA 3NGJA 1I4NA 1O5KA 2BLEA 5I3KA 3O05A 1M7PA 1SZEA 5H2ZA 1KTCA 4LNYA 3WJXA 3T7VA 1NVMA 2OCZA 4RKAA 2C16A 4JX4A 3I7QA 4J9JA 3M5VA 1IGSA 5BNKA 1UUMA 2TYSA 3W7JA 2CLEA 2OZ0A 4NQ1A 2PE4A 2V2DA 3DH7A 1QO2A 1VLIA 3GXTA 2LLEA 2D73A 4HPJA 4M7TA 4MY8A 3TNOA 3QM3A 3UQNA 3LXBA 5IM51 3DHFA 2ZDRA 2V8ZA 3DZ1A 1QAPA 4HT3A 1OFPA 3EWBX 2B7QA 3UXAA 1HG3A 4NXKA 3TAKA 5KSWA 1T0OA 4PH6A 3GDRA 3HPSA 2QCMA 1PL9A 3HBLA 1W3IA 5K2ZA 3B0UX 1G4PA 3B0VC 2E1DA 3VNDA 3P7YA 2Z6IA 4LOCA 4GUHA 4NX5A 3LCHA 5D2TA 2V82A 3IEBA 4XWUA 3PBUA 3PC0A 3NOEA 4MVAA 2EGZA 3STCA 4MFEA 3TFXA 4UUIA 1W0MA 4DO5A 3DHDA 2V2CA 4HN4A 3ABSA 1TPVA 5LNVA 4FNSA 2NLIA 2E5BA 5C55A 2HS8A 3GZ3A 1Q6QA 5FF2A 2X1TA 1UB3A 4LY8A 3UWZA 1I2RA 1GWJA 1WYIA 5F4XA 4JTSA 4AVFA 1GVFA 1ME9A 2X1SA 3GXNA 2G95A 3HOJA 3L65A 2R14A 1TJPA 1XDLA 3N34A 1XKYA 5LNWA 1A50A 3C61A 3L68A 2C19A 3C2OA 5DELA 4ADSA 5FESA 1VPXA 2Y7DA 3GDLA 3W86A 6TIMA 3OHIA 4O17A 1VQTA 1DBTA 1Q6OA 4PEKA 3R2GA 3V75A 3EWYA 2CWNA 3NDOA 4DBEA 3W7HA 1W3NA 4RLIA 3W76A 1W5MA 1K02A 3GK0A 1TPB1 4KKXA 2A21A 1PVNA 1G4EA 1GZGA 4GC4A 1CW2A 3HB9A 3FYPA 1AMKA 3W73A 2CLHA 4O11A 4LC8A
chains in the Genus database with same CATH superfamily
4L4MA 1O95A 1FRBA 5HK4A 4KIEA 4FALA 1R6WA 4PCTA 4TIMA 3VDAA 1IZKA 1QNVA 4IQJA 4JCMA 2WHMA 2VXNA 2J7GA 3GBDA 4FR1A 1JL8A 2H8XA 1VRXA 2PI6A 3A21A 4RJEA 3IGHX 1H41A 2QJJA 3PZMA 1Q6DA 3GVGA 2CZVA 2EG8A 3SRFA 2UY5A 1WPCA 1U5JA 1OX4A 3A23A 2VFIA 3WDQA 4F0HA 1E6SM 3GAKA 3SRKA 2NV9A 2ZX7A 5E1QA 1SO3A 4DNHA 4A21A 4GY1A 5I06A 3B0YA 2BHUA 1W91A 4QM1A 5RUBA 5FI8A 1YE4A 2XH4A 3B8IA 2GJLA 2XWEA 1WO2A 3CB3A 5I07A 4H01A 5REQB 2NQLA 1SW7A 1OQFA 4GLEA 4MUPA 4W5ZA 3VKBA 1VS1A 4AWSA 4X9SA 3P93A 1J8VA 1C92A 4X9YA 4ZXLA 5FF7A 2R1KA 5DT5A 1EH9A 4CNPA 1TPWA 2DVXA 1BRLB 3RLUA 4PBGA 2HCVA 2HEJA 1AW1A 3WNKA 8TIMA 4FXJA 3HTWA 6CGTA 1JZ6A 4EXQA 5EY5A 3I4EA 3INPA 4NI3A 4BHYA 1CNVA 4H2CA 4ZODA 2G41A 4XV0A 2ZC1A 1OFBA 4TMCA 3WNLA 3LYEA 4LVBA 4DRSA 1MZRA 4RX0A 4IGHA 4NX0A 3HPAA 5HQMA 2NT0A 2ONEA 1CGUA 1JDFA 4UMAA 1WKEA 2DIEA 5FF4A 3B8UA 1VAHA 2JF6A 2OR2A 4MWAB 4TV5A 4ZO6A 1HN1A 3G3MA 4XD3A 3BLIA 4CD4A 3NPWA 1V8EA 5EMMA 3MB9A 4WKFA 5IHSA 3T4CA 1Q6GA 4JCLA 3VVGA 2ZZ5A 5A6BD 2INEA 3ITTA 3AQUA 3KRSA 3EEGA 2P1FA 1TA3A 2FIQA 3RCMA 2QIWA 3OG2A 2JFEX 1QHOA 1YXDA 3P0WA 2BG5A 3WLRA 4DBWA 4JYEA 1D7KA 5JBFA 2VX4A 2Q8LA 3BAWA 1QW8A 1LUCA 1OEPA 2PGEA 3BJFA 3FX4A 3I3BA 3ARVA 3GBEA 3WFZA 4UMCA 1P6BA 3VC5A 1HF6A 1OFAA 2XUCA 5BRBA 4JQAA 3EX3A 1LQAA 3GVVA 1XYCA 2EKGA 1FHDA 1B3XA 2ZTKA 4JEQA 4H4IA 1UWSA 2QCEA 2WO5A 3WENA 4LBSA 3FVMA 2V81A 3KBSA 3LBMA 1H61A 1JZ7A 2TRSA 2VVNA 3L5AA 1C7SA 3M16A 1CBGA 4E2BA 2DT3A 2DZWA 3T8LA 2DT0A 2GWGA 1OX6A 3LS9A 3CGTA 3WYZA 3K1DA 3VGBA 1E43A 3DOPA 4XB3A 2D22A 3F1QA 1EHNA 2GYIA 4N9EA 3DERA 2OT1A 2QDGA 2GPTA 2VZUA 4HTYA 4XG1A 4NT0A 4WK9A 1XUZA 2RJGA 4YYFA 1OFDA 1I8JA 1UW9A 1KC7A 1MQPA 3HN3A 1U83A 1GQNA 3CPRA 1U33A 2WOQA 3MKVA 3HA1A 3GNOA 3Q67A 5U7SA 1RQEA 3GW0A 3W75A 2PWHA 4C6MA 3WMBA 3S6DA 1Q66A 1XIFA 2CWXA 2OOGA 2ZA3A 3LQGA 3G6LA 4GUJA 3UA4A 5AZ1A 2PRLA 1LBMA 3E2RA 1GTEA 2PGWA 1KFBA 3TKFA 4YTQA 3QQ0A 1W5PA 4XX6A 4HMCA 1E51A 5CKSA 3VZZA 5EMYA 2QT3A 4IGNA 2VZOA 1HKMA 3LGGA 3P80A 2WLYA 3AFBA 4Z1CA 2IW0A 4R53A 4V28A 2IPWA 4EK7A 4AH7A 2GGIA 3P82A 2Z1VA 3MSDA 4M51A 1A49A 1TCDA 3BJSA 1Q85A 4AZGA 4PMUA 3BL3A 1DJQA 3P6LA 2VFEA 2INFA 2X16A 3V5FA 4V1YA 1H0GA 3EEZA 1I0DA 1T5AA 3MHGA 3UWWA 1JD7A 2EEXA 4O57A 4AIBA 3M7SA 1KA9F 3QJAA 4DJDA 4BZYA 1MDLA 1PIIA 4PUNA 1YX1A 4PR4A 4Z1BA 4H6RA 1VGAA 2Y7EA 5D32A 1OY0A 4R85A 3MWCA 3WF2A 1JPKA 1EJXC 3RPDA 5A8GA 4CEUC 4R9XA 2PLMA 3ONCA 2NLYA 2WBGA 3GE7A 1RBLA 1J9YA 4C1KA 5H91A 4WDWA 1FWCC 4GI6A 2YIHA 5CZKA 3PFRA 4O1BA 4H83A 2C0HA 4QDPA 1KQYA 3SCUA 4YWIA 3RF9A 1RZMA 3TROA 4M1RA 3EOOA 3M4HA 4Q8MA 2WMHA 4IX0A 4F8XA 3VKDA 3DI0A 5XINA 4GGHA 4YNGA 2VYOA 2HQAA 1L6GA 1UHVA 2OQLA 3CWNA 3MYPA 4KIRA 5HXMA 4CD8A 5DCEA 3EPOA 2BVTA 3AXMA 3QEZA 1W17A 4LAUA 1GOQA 3AMGA 1XDMA 1JFHA 1XLAA 3DKJA 4S3KA 3MSGA 3W27A 4JTJA 2YLLA 4P7OA 3LTYA 8XIAA 2OJPA 3VNIA 2HJPA 3RPMA 5CLTA 3NFUA 1NM9A 1R47A 4HJWA 1H63A 1VFHA 3A4WA 4H9UA 4KMQA 1SQ7A 1NDWA 4L6HA 3SCWA 2R8WA 4LYRA 2FTPA 3VNZA 1RCQA 4CD6A 4IP5A 4JNYA 4EAMA 1P0BA 4JHOA 1LRNA 4MOZA 2R82A 3QXBA 2PP0A 3EDKA 4BQ4A 2ZTJA 2Z2AA 4S38A 4WKAA 1KM0A 3HZ3A 4H9VA 4OBTA 1S46A 4GK8A 1SO6A 2DGAA 4WD0A 1VYRA 2ACUA 3AC0A 3PR2A 2BY1A 4K39A 4WR3A 3JRKA 3SGZA 1R46A 4US5D 1J5TA 2JGQA 1JR1A 5DMNA 5AC8A 2J27A 1CXLA 3OIXA 3AWOA 1VFTA 2DPEA 4MTVA 3GG1A 3C3NA 1CB7B 3SQSA 2B7NA 1WP6A 3OZMA 1SFJA 2CXEA 2RDXA 3NVDA 1YMYA 3WUFA 3NQAA 2WCGA 4AYGA 2I7GA 1J01A 4W7UA 4BA0A 3ES8A 2A4AA 3N2OA 5A69A 3CK5A 1EIXA 4D6IA 5C0QA 1VCGA 2HWGA 3ARYA 1BVWA 4WX2A 3BE7A 3W02A 1XYBA 2PCQA 2RDTA 2PWFA 2VTFA 1L6FA 5AYXA 3OZPA 1MSSA 3MANA 3KX6A 1XH2A 3WDPP 3UERA 5CZ0A 3SCNA 4HN8A 1BSLA 1B3OA 4PBFA 1P0NA 1AA1B 1KKRA 3TTEA 3U2CA 4OE7A 3KCOA 4PA8A 1TPUA 2V5CA 1GG1A 2AMXA 3N6QA 5A2BA 4NZ5A 4H9ZA 1EIBA 4XKYA 1BG9A 1SW0A 3UY7A 2D23A 3FGCA 1VHNA 3H54A 3IUDA 3RO6A 4IIEA 2F8QA 4KFNA 4LCRA 4E0CA 2J7DA 3WH5A 1UR2A 1LWIA 4CNSA 1ZHAA 2NVAA 2KZHA 3RLVA 3UFYA 2X30A 3QOKA 1IGWA 1E6ZA 1UKQA 1VHCA 5LA2A 1J0YA 1RV8A 2C14A 5FJRA 4IJBA 4ZTXA 3WLHA 4AF0B 1JAEA 1H7PA 2EF9A 2E6YA 2PZ0A 1BQCA 1EO5A 1XLKA 2XIQA 5L9FA 3GKAA 4YHGA 4H7VA 3VOIA 2A6LA 1JULA 3N3TA 1FVPA 4IPNB 3W83A 1FWRA 3LMYA 3LV5A 1CWYA 3K1GA 4UNKA 4E2VA 4LS2A 5D9OA 1TV2A 4PULA 4IJCA 3TQPA 2AL2A 2Q02A 4NF7A 4X3ZA 5CBBA 3BQ5A 1BWLA 3EB3A 3BURA 4L61A 1EYEA 4D2JA 4EE9A 4MNKA 2ZKMX 2QGYA 1TCMA 3WQPA 1PJ9A 2QMKA 3ES7A 4GZ7A 1UZ4A 1VKFA 1TJ1A 4Z0JA 3WF0A 1BYBA 1X7FA 4GH1A 4WJ8A 1HW6A 4K38A 2JEQA 3URNA 3ZT5A 2CLFA 3W0KA 4UCFA 2YL8A 1DL3A 3VGGA 4Q7IA 3BMVA 1XBZA 1YLVA 3WL0A 3N2CA 3S2CA 5DT7A 1K6WA 1E1EA 1UR4A 3TC7A 3G2GA 1DWHM 3TQVA 1ONEA 1E5NA 3BOXA 3QLDA 2ZVRA 2ZZ7A 3PJUA 3PAJA 3G0XA 4GKLA 5GNZA 5ENLA 3CUHA 2EBNA 1VEPA 1CCWB 4XIMA 3QGKC 4OBSA 1HVQA 4B4HA 1G4TA 1UASA 4GE8A 3GIQA 4GXMA 1EC7A 3RCNA 5BCAA 3DENA 4XZHA 1KM3A 4GJIA 3RU8X 1K8YA 2D2OA 4PSPA 2QF7A 4JN8A 1N55A 4C6IA 2GQ3A 1NIUA 1KB3A 3VE9A 1A5BA 3WDHA 3UPBA 1TIWA 4B5TA 4AZ6A 2GGEA 2J13A 1PX4A 1W1A1 4IX2A 5JIPA 3UCDA 3W7RA 2WB5A 1S1RA 3U48A 1Q8JA 4CQ9A 1IEWA 1RK5A 1JDAA 3S5YA 1MUCA 2QDDA 2WZMA 4O15A 3ANVA 4Q8OA 1M01A 3YPIA 4W85A 1RJQA 2RKXA 2QXWA 3MV01 1KFJA 4RNHA 4JGDA 1GYLA 2FZDA 3GR7A 1NH6A 4FB7A 4HTBA 4QG6A 3W74A 3RO8A 2HV5A 1UR0A 3FK4A 4P61A 2O9TA 3PNZA 4TO8A 1G6CA 1OZMA 4ZBCA 1JDCA 3U6WA 4UCGA 2PTDA 1QXLA 2VZSA 4O8AA 3H2OA 2D2JA 3F03K 2FPVA 2YFOA 1V6VA 4NYUA 1BTCA 3MJYA 4QBXA 3T0BA 1F3EA 1OJXA 2A3HA 5DRCA 3ZOAA 2VEPA 3FY1A 3CH0A 4Q4OA 4CQ8A 4GBUA 3BANA 3KL0A 3E1F1 3LNPA 1PDZA 1J79A 3W2UA 3M0KA 3P61A 1YPFA 5T9CE 3RX2A 4DHGA 3I4KA 2TMDA 1JCJA 4CCZA 2YB1A 4S3FA 1VF8A 3WD3A 1OABA 2V5BA 5K4XA 1A3XA 3TR9A 1SR0A 4NASA 1R7AA 3VOHA 1GEHA 2ZZ1A 4IIHA 1KKOA 1GT8A 1RHCA 2ZRUA 4JFTA 1FCUA 1MQQA 4GFSA 2YZRA 1H50A 2ZWZA 3PBWA 2WMGA 4MJ4A 1WKYA 4HU4A 2J7CA 4IOTA 2YR1A 4CNTA 3EDEA 2DW6A 1NWSA 2ZDSA 1DHKA 1TKKA 3ISIX 3QRHA 3WQFA 5J5DA 4MJMA 4JNZA 5HQLA 3W28A 4ZCWA 3VM7A 3TYUA 3V1PA 2ZXAA 3TCSA 5I3DA 2FZBA 4ZXOA 4IPLA 2A1YA 3T05A 2DSUA 4HKPA 4R7JA 1FBAA 1ISXA 2WSRA 3WLTA 3P2VA 3S2LA 4ZL1A 4U28A 5AB3A 3T09A 1CGVA 3S2JA 5FJPA 3LBOA 1YYAA 1S3HA 3KCLA 4JTRA 4PUKA 1DJGA 1PSCA 2F84A 3MCMA 2H8ZA 3GTHA 2WKLA 4Q33A 3S46A 1ZJIA 1FWAC 1K6AA 1PTGA 4D8AA 3GYCA 4QHRA 5IXEA 2NT1A 2PFHA 1LBLA 2R94A 1QPOA 2E28A 3RR4A 4GUIA 4OV9A 4OHQA 4BWLA 3LBCA 4H00A 3GG8A 1Q6FA 1RQHA 1W31A 1WA3A 2D69A 3AZRA 2AMGA 3MMUA 2VNCA 4PMDA 3KHJA 3Q37A 3WX7A 1WKDA 1A5UA 4LVGA 4LUJA 2DZXA 4REQB 3BGAA 3O0KA 4UTIA 3AHXA 2JIEA 3HFTA 3W6YA 4QAIA 1HL9A 3AIEA 2W67A 2XWDA 4I8YA 3FHAA 3IRSA 1J96A 4QX4A 4H8NA 2ZZ6A 1FWNA 2R1PA 4MHBA 2E6DA 4UXDA 4YU1A 5DEZA 1C91A 4Q6XA 2E67A 4BJHA 1HKIA 5CBJA 4POCA 4M81A 3IVUA 4HBKA 3B9DA 4YHEA 3MBFA 1Y7VA 4RZ4A 1A5CA 2PD5A 4MG4A 2YYTA 1AODA 1KRAC 3NZ1A 3VIGA 2EJ1A 3R89A 1Z48A 3NPXA 1MWOA 1DWIM 4ZA0A 1QHPA 4GJJA 1R8LA 3ZFHA 2Y7GA 1E73M 3DBPA 4NNCA 1R3WA 3DFQA 4KGJA 5AYIA 1JGIA 4R9OA 4H7ZA 3QMSA 4RZ5A 2G3MA 1R3QA 3C52A 4RXGA 1TQXA 3FJNA 1SFLA 3GAYA 4YTTA 5LIXX 1KM5A 4MB4A 1Q2SA 7A3HA 4Y8FA 3UJEA 1QHZA 1XIDA 1VYPX 5DN1A 2HK1A 1LTDA 2F38A 2BGSA 4XAFA 2Y89A 4AWEA 1K9TA 2DVUA 3EXSA 1PIGA 3NQFA 2X09A 3JZEA 5FSDC 4E4UA 3LTSA 3MKCA 3W70A 4LWWA 4RPPA 3V1HA 2BXYA 2Q6ZA 5LGXA 2Y5JA 3ZT6A 4XKYB 5T9BG 4PUEA 4ADTA 1DJNA 3HM7A 4W93A 3ATZA 5LNUA 3P5ZA 3FKKA 3WBWA 3QMTA 4IGMA 2DZPA 4L7ZA 4HYVA 2W79A 2YX0A 2REQB 2B7PA 2Y88A 5AHLA 3WBEA 2TSYA 3AO0A 3L0NA 4QNWA 1TA3B 3N13A 1TV3A 3NQ2A 3UJFA 1KCZA 4K8HA 5K9XA 4MDOA 4I5UA 4KCWA 4R88A 3GVWA 3KWXA 5ABFA 2BGNE 3VZXA 4ECLA 4ZE4A 4UNLA 3LLFA 1HGYA 5EGRA 1MRAA 1N2VA 1QBBA 2I57A 3H2AA 5AHEA 4XK2A 1EA0A 2DIJA 2Y85A 4GNKB 5C7VA 4MB5A 1GKQA 4L80A 2WVSA 3WNPA 1QJWA 3IARA 2E9LA 1Q7MA 4Z0SA 3BWWA 1P43A 4R5EA 3SIMA 3PNUA 2CHNA 3VKCA 4HMNA 1W8GA 4DWDA 1RA5A 3SN4A 4D6GA 5A3HA 1MYRA 3F2CA 3T8QA 2C15A 4WRHA 3W1NA 4QNEA 1XXXA 2W5FA 3B06A 4P2VA 5A6MA 4UTTC 1IV8A 4CLMA 1E3XA 1PKNA 1WX0A 4K3ZA 1ML1A 4C5ZA 4H6EA 2IMRA 1N8FA 1RBOB 3WFAA 2C18A 4AD3A 3KAOA 1J0JA 5D2VA 4WUIA 1ENUA 3CAKA 4AIOA 3ARWA 1FH8A 3P60A 1EUAA 2YL6A 3NXLA 1W5QA 3UZ5A 2BDQA 3VOJA 2NQ9A 1IHIA 2W62A 3FS2A 2QGHA 4PTWA 3W9ZA 3BLLA 1BYDA 3B04A 4BWLC 3OQ8A 5AOUA 1RJPA 1TX2A 1IXOA 5J5RA 1ISYA 4FNUA 5T91A 2VZTA 4PUUA 4JTEA 4GACA 1JPDX 2FMOA 4WSJA 3LHWA 5FJOA 1K9EA 2Z1WA 1J0HA 3OBAA 1UR8A 3V36A 4EACA 3AHTA 1CGWA 3DI1A 3LCIA 4MPQA 1V7YA 4N02A 1VCFA 1R3TA 2X1IA 3JUGA 3OGSA 3H24A 4UWMA 1UBPC 3SY8A 1Q3NA 4NJHA 2ANUA 4DM1A 1GKRA 1UCWA 1RCOB 4PMJA 4BI5A 4UTWA 4PUMA 2PURA 3VGFA 4BQ5A 5F1UA 4O54A 5G4EA 4NNAA 4CNUA 4KS0A 1UJQA 3A9BA 4FF7A 1RVKA 3UWVA 2NQ5A 4J28A 4MJZA 3WDIA 1G0CA 1G01A 1DIEA 1W9PA 4CEXC 4AIUA 3VYLA 1W9DM 2YXOA 1C8XA 2VC7A 4UTHA 3BCFA 3CHEA 1P5BA 2WM1A 3EOSA 5CG7A 2HTMA 1VPYA 7REQA 1OK6A 5HBFA 1BKHA 1H1YA 5LXXA 4HK7A 1QUMA 3DDMA 1WDPA 3LXCA 4YLWA 3K8MA 2E77A 1H5YA 1L6YA 2XZ7A 2IXVA 3G1FA 3GD6A 5D02A 3TQ0A 2ZOXA 2ZUSA 5BYWA 1W1TA 4YVXA 3CTTA 3EPNA 1E6PA 4J2PA 5BW6A 1OT2A 3QR0A 5HDRA 5IOBA 3CZ8A 2IUZA 3EWCA 3GHUA 4BF5A 3H6OA 2ZUUA 1OT1A 1Z9AA 2AKZA 3ZJKA 4KEMA 5HQEA 3IIXA 3R8HA 5E93A 4PRTA 2BOFX 3WH9A 4F3HA 1TV7A 2J62A 3PPCA 3T9PA 3KXQA 3C86A 3P0XA 4BR1A 1FOBA 1UD2A 2RGLA 2P8BA 1M7OA 2WXDM 1GONA 1RPKA 4JFWA 3N11A 4MUZA 5EBUA 4B92A 3UR2A 3TTQA 2UY3A 1BWKA 4LU0A 4PUJA 1JD9A 3V3WA 2AGKA 1JYNA 4Z42C 2WJDA 5IRPA 3OBKA 1AD4A 1GOIA 4GMEA 3N12A 3QV7A 5AY7A 4GABA 5JQ9A 2QEZA 4LB3A 3OLGA 1FDYA 1X8CA 5E6ZA 5BWFA 2GWNA 2NVCA 3AYVA 2BVYA 4H19A 1H4PA 5CAKA 2OWCA 3ZO9A 5CG0A 4PTDA 4AU0A 3AYSA 1YNPA 1QNOA 3H4GA 3MO4A 1AL7A 5I24A 3C3UA 3FFSA 5E9AA 3SIZA 4BS0A 2P88A 1A53A 3SN1A 2D3LA 3OA5A 3M0XA 3WBXA 1JCNA 3ZJ6A 3W22A 1N8WA 1O68A 1PZ3A 3KBVA 2A6NA 3WQ6A 1E4MM 3PY2A 1GOKA 2E09A 5LGZA 4MYXA 3RN6A 3AIWA 1S2VA 3PJXA 2XJ7A 2P0OA 4FOUA 3T78A 1ZLPA 3OHMB 3EPMA 5B80A 1G9HA 2QUTA 3BDKA 3UEQA 7TIMA 1H7WA 1I4NA 4GI9A 1M7PA 3IWPA 3TVAA 2YBUA 3CUXA 4DNMA 3VIKA 4M8UA 1WNOA 3SCPA 3OQEA 4NSBA 2J79A 4CU6A 3E38A 2PC8A 7PTDA 2BXZA 2CLEA 2OGJA 4ZOCA 4L4OA 3FA4A 1QO2A 3ONBA 1VLIA 4AZ7A 3VD7A 4H9MA 1H5VA 3EAUA 5AC4A 5AZ0A 2D73A 3DHFA 1QAPA 1VFSA 2O4MA 4HHMA 3EWBX 2B7QA 3UXAA 1XR2A 3TAKA 2J4GA 4PH6A 1JNDA 1WDSA 1PL9A 1W3IA 4LJ3A 3P7YA 2P3EA 2Z6IA 1DWAM 1BGAA 4GUHA 4NX5A 3WQWA 1D2KA 4MVAA 4Y9PA 2A3AA 2DEPA 4MGGA 1TPVA 5LNVA 1J6OA 1M65A 5C55A 4M56A 2X1TA 1UB3A 3NQBA 2J66A 4V1XA 4LY8A 2YBVA 3M64A 3UWZA 2YA2A 4HU0A 4D6EA 2FHBA 5F4XA 2XG9A 4AVFA 4C6FA 4KERA 2ESCA 1KXVA 3L65A 1ONXA 1DWFM 1XDLA 4C65A 4GZEA 4H9TA 3C61A 2VUNA 2C19A 3C2OA 5FESA 4ADSA 1VPXA 3GDLA 2OWXA 3NDYA 1TUFA 4FXFA 4O17A 5I02A 4PEKA 3R2GA 3BZGA 1JEZA 2WWCA 1BPLB 1O66A 2UZ9A 1H11A 4QJ5B 4LYKA 1TPB1 3CYVA 4P8WA 3ARSA 5DFAA 3PJWA 1GZGA 1CW2A 1WCGA 1WDDA 2FVLA 2OLAA 2Q8XA 2CLHA 1CXFA 1SVDA 3QH2A 2C71A 4MB1A 1JPIA 1K1DA 4J3SA 3C0JA 1UP2A 1FH7A 2QIIA 1HL2A 3SUUA 3O7UA 3H55A 3GTXA 5EA9A 2IKGA 2XVGA 3BMWA 3W1LA 1AH3A 2ZX8A 3RGTA 2WZTA 3ARTA 1EJUC 3AIVA 1G1YA 3AIUA 2R1NA 5GJMA 2PA6A 3NWRA 4CQAA 1F05A 2PDGA 3C5QA 5HJXA 4JIEA 4B15A 3BLOA 3SRDA 1XYZA 3MQTA 3VIJA 4FOKA 4HK5A 1BXBA 3WJWA 5I3HA 4GO8A 1B9BA 4Q4PA 5JBDA 4O19A 3TP4A 4W4QA 3RU6A 4S3AA 3MPGA 3MCNA 4GXPA 1JYXA 5FCZA 1EF3A 2PC4A 1M3UA 3T0TA 1ADSA 1XLIA 3M9YA 1UIOA 2F9RA 1QATA 1LZOA 2PU1A 4XZNX 3TYCA 3SSZA 3O8AA 1SPQA 4DJEC 1UOZA 3E2QA 4LAKA 2QZRA 2GGGA 2F6XA 3ZJ7A 1I75A 3DHUA 5E0FA 1R5YA 3NEHA 1EDGA 1VPQA 3MUZ1 4KGLA 1HNYA 4DAIA 3BAKA 5C71A 2QPSA 2VC5A 3AU6A 3AOFA 4L64A 1Y8BA 1JAKA 2Y4SA 3KRZA 2PDPA 4U10A 5FAGA 3CQJA 3M5YA 1WUEA 4WGXA 4EF8A 4C6LA 2IKHA 3VD9A 1MZHA 4DQWA 4HCDA 1G5AA 1W2PA 4PMQA 4ZQRA 1O5QA 3IIOA 4FIQA 3OLDA 4OWGA 4RUBA 3CZGA 5K4ZA 2GUBA 4F0RA 2YDAA 1QMLA 1BXCA 1SUXA 4S2BA 4UMBA 4HCLA 2ZX6A 4US6A 2YKKA 2BNJA 4ILSA 3UCCA 1DTUA 4R27A 1OBAA 3KOYA 2QUNA 3PBVA 4KWWA 3FIGA 5D9PA 1TVPA 3BAJA 4EPEC 1DKWA 2C6QA 3NL3A 1TTPA 2ASHA 1TE6A 2FZ8A 1ZZMA 2V63A 2FHFA 3LPOA 4AEFA 1O94A 4X0VA 1QNSA 5C70A 2ZX5A 1DQUA 5DX7A 2CU0A 5AKQA 4JQ1A 4QP0A 9CGTA 3KS5A 2OYKA 1NFPA 3W7KA 3G1DA 4LB4A 4M82A 3EDFA 1IXPA 2V6AA 2QCDB 3L21A 1OYAA 2E8ZA 6PTDA 3NVTA 4NI8A 3KRBA 4HA4A 1VJIA 2YW4A 1H62A 4G7FA 5TD4A 4U33A 3GR4A 4JY9A 4RNJA 1CGXA 3DC0A 4F2TA 1RA0A 4ICMA 1LOSA 1A4LA 4Z2LA 5CGQA 5CPTA 3STGA 1TWDA 1IEXA 2PEVA 1IZCA 1OFEA 1EZ2A 4HZ8A 1J6PA 5A8NA 3PULA 1PWMA 1LG1A 4B2DD 3CHDA 4Q7BA 5D37A 1Y5VA 3CUGA 4D6HA 3QTPA 4IT1A 3Q65A 3VDCA 3KUMA 3PWIA 3CASA 1V77A 3HQOA 2YJQA 5FF0A 5BWAA 4IL0A 4KF1A 2L5HA 3IAQA 3W84A 1DJIA 1QU4A 1DJHA 4UTJA 3BAXA 3LI1A 4X0NA 2PDYA 2PP1A 3QFWA 1UWQA 3SUTA 1XH1A 1BG4A 3G1HA 1UD4A 3MUY1 5H8PA 4W5UA 3EA3A 4UTWC 1EEPA 1X96A 2GVGA 5ABTA 1KBJA 4M6PA 1Q6RA 4WXZA 3AISA 3VOGA 4QE4A 3FA5A 4UTMA 4FLSA 1JCYA 3N25A 3WLLA 4YL2A 2J47A 2VKZG 3RXZA 5FACA 5D33A 4AHQA 1DIOA 4KPLA 3N2BA 4UFIA 1Z7AA 3MV11 1PIFA 1V08A 9XIMA 3COTA 1JUBA 2DZAA 3F4VA 3BOFA 4AZCA 3W24A 4N4PA 3KVMA 1E6NA 2QF8A 3NZPA 3O16A 4M5PA 1FCVA 1IYXA 3VIIA 4QJ3B 4ZQMA 5F2GA 3N6HA 4JNMA 4C6KA 1X1ZA 1Q4WA 1EF2A 3VKKA 2Z26A 3NOYA 1EGVA 3VAVA 4QQUA 1QI4A 2J9ZA 2G4JA 1WE5A 4J1OA 3VKAA 3I6RA 1EGMA 4WJXA 1ICSA 4L4LA 3VMNA 4CQDA 1UQYA 1I2QA 5EBAA 5A2CA 2DZUA 1S39A 1UR3M 3UG3A 2VCAA 4K2SA 1H49A 1TVLA 1EJWC 1ADDA 2JKEA 4UC5A 2POZA 3VC6A 3EWWA 4NZ3A 1PKMA 3GYEA 1TRIA 3DYMA 5FSEC 4J5NA 4CGTA 3LZ3A 3HPFA 4NAFB 1XWYA 2A79A 1PUDA 2FZNA 2ALDA 2C79A 2ZCGA 2V3DA 4JL2A 4I3GA 1AL8A 4XKMA 2PUZA 1XG4A 3BSMA 3GR8A 3B4YA 1E0VA 3AHYA 1NFGA 3IV3A 4JFUA 4ACZB 4QAWA 3ITLA 1A5LC 4XZMX 3UG8A 5DLCA 5C6MA 1ITCA 3O0FA 1ICPA 1UOKA 4IXHA 2OQHA 1TO3A 4L1XA 4R33A 4DUVA 3QV8A 3OA3A 1V6UA 1QDSA 2VCBA 1HJWA 4RCXA 5D9MA 1JPHA 3B05A 1JDDA 3PZGA 4UFHA 4LUTB 1CGYA 4OUEA 4US5A 3SFWA 1T8QA 3FJLA 1B3YA 2X1UA 1L8NA 4PCSA 2OGYA 5EMUA 4W89A 5CSSA 1LYXA 3WLPA 1R9YA 3LCGA 5DF0A 3WQVA 3TUUA 3WLKX 4G1NA 4PE8A 4EPBC 1XCWA 3VUSA 1QT1A 2P53A 1EC8A 3DG3A 3KVJA 1LOLA 1GTHA 2ACSA 1DVJA 3LRLA 3POCA 2Y6ZA 3EXRA 4N0RA 2OEJA 1QNQA 3H22A 4WVXA 2JK2A 3NYDA 1PCWA 1TUXA 1F61A 1Y65A 5I3IA 2VRJA 5DMLA 1TV8A 3E3HA 1CX9A 4W87A 1LG2A 5KEZA 1T40A 3M6YA 4G2DA 1EWEA 3MWAA 3NAVA 1E9IA 2ZE0A 2CXGA 3RM8A 1NJJA 4FR6A 2OLSA 1D8CA 1E4LA 2GSEA 4BI7A 4A3RA 1EP2A 1PZ0A 1K70A 4WXYA 4OU1A 3WF3A 3M0MA 5T8GA 3W29A 2F61A 4O0KA 3N17A 3LMZA 3CIXA 3G18A 2DFAA 3GVRA 1XM3A 4YS1A 2Z1BA 4UTUA 3P8JA 4JTCA 3MMDA 3UWUA 2QPXA 4NJGA 4AXKA 1K7XA 3WEZA 3O6YX 3ZVHA 2HBXA 1L8PA 4KFPA 3CXOA 3SSJA 3VCRA 3R79A 4OECA 5FD0A 3E0VA 3ZMRA 3MP3A 3WD1A 3TN3A 4XD5A 4EWJA 1NWTA 2B0MA 3AXXA 4AZ5A 1O12A 1FP8A 2V3EA 2E9MA 4IZGA 1US3A 1NOWA 4B5VA 2ZVIA 3VI2A 2FTWA 5A6TC 4D9PA 3GUWA 1ZPTA 2VC9A 3WD2A 1OX4B 4LCQA 3URAA 3UETA 2V30A 5DCBA 5BRQA 2O4QA 3R94A 3GWQA 1FUYA 4AHPA 1UD5A 4A8NA 1IEIA 1NOFA 3UXKA 4JTGA 4FPSA 3WF1A 2NX9A 4N6EA 4BF9A 3NURA 1A0EA 1F8MA 4DXKA 1XL9A 5G4WA 2IPJA 1RALA 1D3HA 3CZEA 4YWSA 1IWPA 4I7UA 4FMVA 1RD5A 1JVNA 3NSNA 3KBNA 2Y70A 3GH5A 3O6AA 1I1WA 3GNRA 3R0DA 2GOUA 1HO1A 1IIHA 2DUAA 4QROA 5C2CA 1KTNA 1T41A 2AQWA 1V6XA 5F4WA 1EP3A 3WD4A 2V9DA 4HZMA 5I03A 3A5FA 2VM8A 1OSEA 2XDFA 3MSRA 3LERA 1TR9A 2OKTA 1EXPA 2NQJA 2I5IA 1KR1A 1MO0A 1IT7A 4KCUA 4CCCA 2DU2A 5KMYA 1K4GA 1V6YA 4GQRA 3DFNA 3SFKA 3A4JA 3V5OA 2FGBA 1QPQA 3R6IA 2FVMA 1J0IA 4O0ZA 3B03A 3TEVA 3TA9A 3AXHA 3EWZA 2V67A 2CEQA 3NQMA 3RHGA 3OEXA 1UR9A 4JTDA 3SCVA 1H7XA 3BOLA 4TX8A 1E40A 3RX4A 5TNVA 4YPJA 1KR0A 4V33A 3K5XA 5LA1A 3QMRA 1XBYA 4H41A 3UP8A 2P10A 1EJVC 4K8GA 3PZNA 1FP9A 3LLDA 4EVZA 2YCIX 1TPC1 3LD5A 2IPFA 2Z27A 3STEA 2XGIA 4L9YA 3VIHA 1NTHA 3BW2A 2VP8A 2O92A 5F2LA 3S83A 3L4VA 2VO5A 2WSKA 4IUGA 4PTMA 3RFAA 3O1NA 4AUBA 1QVBA 5AHIA 3ZSSA 1P6WA 4DO4A 5CSYA 1SJAA 4LBUA 1TTJA 2PDMA 4M7SA 1E70M 3ARXA 4F9JA 3UXDA 3FYOA 3AUJA 4JFSA 1QNRA 4HVXA 2VI0A 1E5JA 3TXZA 3RAOA 4I9AA 1WZKA 1PBGA 2J6XA 1GG0A 4PB3A 2QULA 1QW7A 1QFEA 4GHRA 1S5WA 3GNXA 3VDGA 4MLJA 3E6EA 3ZVIA 2OSXA 5F7UA 3MUIA 3G6MA 3GQYA 3L67A 4PB5A 2NX3A 3M1ZA 1Z41A 3USBA 3HPXA 2CLKA 4ASTA 4A35A 3W37A 1YQ2A 1FWGC 3S2MA 1HTIA 5JVLA 4BF7A 1WBJA 4ZR8A 1J10A 1M1BA 3S5NA 4DUWA 4PRWA 2OO6A 3SAZA 1FA2A 3UZXA 4QS5A 4BK9A 2OG9A 3OVPA 1WXYA 1H1ZA 1XICA 4AY8A 3PUDA 3OTRA 3VNJA 4F48A 1BWVA 4FHAA 3SBFA 4DX3A 1W56A 2W6RA 3RM4A 3REQB 4N9CA 3TK7A 2RFGA 1FWWA 3UGVA 1ADOA 4DJEA 1VZWA 3URQA 3BMXA 3BLEA 9XIAA 3L4WA 4QTGA 1QWGA 2PLCA 1XIEA 1PS9A 4LV9A 1BF2A 3FLUA 1QRQA 1PKYA 4WEVX 1KM4A 4IL2A 4LANA 1BXNA 4JTIA 2WJFA 2PTYA 2JIWA 4E5TA 4P8UA 4DBDA 1VRDA 3TXVA 3SCRA 1U22A 1YDYA 3BTNA 2WANA 1VFFA 3TW9A 1EGZA 1CDGA 3QV9A 4UQEA 4HSOA 1CXKA 1SZGA 2FHCA 2Z1XA 1QI2A 2HS6A 2PWDA 1L2UA 2GJXB 3LGDA 4HMDA 1T7LA 1GHRA 5HANA 5KITA 5ABFB 2MANA 5I23A 1XLCA 3PBGA 2WMFA 2AL1A 2O9PA 2BODX 1ZBVA 3UG4A 3B8DA 4K36A 1TJRA 4PCPA 4AYSA 1RCXB 3GXMA 2JGYA 3OYXA 2WHKA 2JEPA 1V0KA 5D09A 1W9VA 4PMYA 3PFMA 1PYFA 4Y9NA 2ZRYA 2R1LA 3MDWA 2QYGA 1W32A 4XZ9A 3LCWA 3QZAA 2GSHA 5A8QA 1I1XA 1EX5A 3VILA 4ERAA 2QPUA 4F2UA 1BEUA 4W8LA 2FPTA 4JQ2A 2OZTA 1W2VA 1X39A 1EJRC 2ON3A 1SZNA 1IF2A 4NVTA 2BFGA 1JI1A 2BP1A 1B54A 3MCOA 1XIBA 4AY1A 3SZ8A 1F73A 1OVDA 1XJBA 4PEEA 4Q4RA 1OF6A 5CPMA 4QR6A 4R7OA 1EZWA 3N19B 4XBSA 1JI2A 2QKFA 2GLKA 1X1NA 1H60A 2UY4A 5A8PA 2JBMA 1R87A 1Q6CA 2AQOA 1AH4A 4L9ZA 4P8VA 4Y9OA 4E8CA 3W07A 4QIUA 4V27A 2EPNA 4C6EA 3ABQA 2VGBA 1TSIA 1UA3A 3ZWSA 4PUWA 1TZZA 3CQIA 4S3DA 2QAPA 4GH3A 5LYRA 1AG1O 1XV8A 2GQAA 1P1MA 3VNYA 2J9YA 5TBOA 3BLFA 2NUXA 1BKSA 1Y0EA 5G2IA 3RUBL 3OB8A 2QUVA 4NUWA 3MHUA 2FB2A 1MEIA 1ZU8A 3E0LA 3TJLA 3WLSA 5GJNA 4Q8UA 3B9EA 4DN1A 2XPKA 3VFLA 3O06A 3M5ZA 1GKPA 1J0KA 2WPGA 3NJ3A 2W4XA 3MKKA 3EWUA 1QO5A 3AS1A 3OU8A 3HGJA 3UA3A 1LLWA 3G5EA 1KFKA 3F5LA 1XQLA 2WNZA 3F7JA 2BBFA 3MA8A 1K4HA 4Q4QA 1KFWA 1WB0A 1SFSA 5EMKA 2R1MA 1CXHA 3CIWA 3B8VA 1TWZA 3D6NA 1X6LA 4JEJA 3SI9A 3TNBA 4IHCA 3MT1A 1Z89A 1GOXA 2YCLB 4CCDA 3T08A 5B7ZA 3C6CA 3GXDA 3MUAA 3IJ9A 3LSBA 5IDIA 1OB0A 3OOQA 4RNFA 4NRRA 3GTFA 4FX8A 4JQ3A 4H1ZA 1U5VA 5HUPA 1FCBA 5A6BA 3TMQA 1J11A 3KDOA 1K7EA 3JVAA 1OINA 3UY8A 1E1CA 1B3ZA 2WZEA 3FAWA 4GISA 4LVFA 5CPQA 2D3NA 1CB2A 4B5NA 4LEFA 1KTBA 2WNNA 3SY1A 4AEEA 3BG9A 3DGBA 2VR5A 1VBUA 3CAVA 1PKLA 4F0KA 3PPFA 5BMXA 1YADA 1ZBKA 1KFLA 4IMAA 5HPOA 4PL2A 4XZWA 4IQDA 4K6AA 4GI4A 1LWJA 3T55A 4HJFA 4AEOA 1KFCA 3XINA 2EG6A 2HZGA 3QYSA 4Z2GA 2ABAA 2A7RA 2A3LA 4NZFA 3TN4A 5J04A 3T2QA 1CT5A 4DF0A 4ENLA 3VPLA 3FAXA 4D1JA 2YCLA 1MNZA 4KFOA 3VOFA 1XLHA 4RDYA 3CQKA 4GC3A 3K2GA 2XHYA 4GVIA 3W6LA 4K7VA 1I2OA 4S3EA 1O1HA 9RUBA 1KGWA 4A29A 3MTWA 2HXUA 2WW5A 1IEVA 2B81A 2VL4A 3T07A 3EYPA 1RH9A 7ENLA 2XN0A 3S6OA 3TSDA 4KRTA 4EANA 1GVEA 4LX4A 3CPGA 1DJWA 3DN5A 1W1YA 3PWAA 3C2FA 4LBRA 1EOKA 1KM2A 4QE5A 4AWTA 3GNDA 2PSNA 4B5UA 4D1IA 2V2HA 3HG3A 4QITA 1SJCA 1XKJA 5DBTA 3BZJA 4URIA 1UA7A 3TZNA 4HU8A 1TWIA 2G0WA 3M0IA 3NYZA 4E2OA 1SGJA 4C7GA 2CBIA 2F2HA 3W1MA 1QOPA 4NAFA 1TJ2A 2E7FA 1TREA 3S47A 3MBDA 4DLFA 1KO0A 1W1ZA 3CZKA 3ZZ1A 2WVVA 1G4SA 1KBIA 2PPGA 3M0JA 3WQCA 4JTFA 1HXJA 2GL5A 3S0CA 5CJMA 4XAZA 2Y61A 2I17A 5C2XA 1KNWA 3KHDA 3L5MA 5U4NA 1JUEA 4JTLA 1Y5XA 3HGOA 5KZEA 3VNMA 4G1KA 4Z08A 3RDKA 1H7OA 5E0KA 4DI8A 3LQLA 4Q3MA 4RDWA 3GC4A 4O14A 2UWFA 3SCTA 1TVNA 4UIOA 2NQZA 3QYQA 1W37A 2ZXBA 1UH2A 4XVEA 4YTUA 5AYZA 5H6HA 1S2WA 1GZ1A 2CLLA 4LC6A 5C54A 3W7PA 3GH7A 4CKQA 2Z28A 4UTTA 3VK5A 3W88A 4HCHA 1UP3A 3M43A 4Y2WA 2G4FA 2WSYA 1M68A 4GY0A 3CUIA 3S3GA 3UZYA 1F6YA 4LAMA 4E8DA 3NZRA 3O15A 1B57A 1YPIA 3CQ0A 4FX7A 4JTQA 4NJIA 1TX0A 3K4WA 1P48A 1DEDA 1THFD 3CIVA 3T44A 3DC8A 1LT8A 4W9TA 1LQ2A 1TPH1 1EB3A 5AFDA 1XFCA 3WLJA 4B5XA 5TQLA 3L4ZA 4O28A 3HGSA 4AD2A 4G7EB 3CC1A 2V69A 5C9WA 3REQA 2GGJA 2DSKA 4LVAA 2C1HA 3PP7A 1PAMA 2OSYA 1PCKA 2VDHA 5C9RA 1XGDA 1AH0A 1NU5A 1LROA 3DAQA 3NQEA 5HMEA 3BLKA 3Q58A 2XFRA 2X05A 8RUCA 3S1GA 3RYSA 1TE1A 5F2MA 3WKZA 4G7EA 4GIAA 1JIBA 4ACZA 3AYRA 3KW3A 4NU7A 5JUVA 3WQ5A 7CGTA 1D3CA 1S5NA 1HZYA 4ZQNA 4Q8QA 3PZVA 5G1TA 2YL9A 3IGUA 3DYPA 4AG0A 5EFFA 4MYAA 3KTCA 4UOQA 4GVFA 2NVDA 4WOZA 2OMAA 2BVWA 4W86A 4RXFA 4RDZA 3SQMA 3TYEA 1ZJAA 2XIJA 1MW1A 4FNTA 1A0CA 4LRSA 2HROA 2HMCA 4W7VA 4J7RA 3D47A 1SMDA 3NG3A 4TTGA 4OOZA 2DP3A 1FXQA 1KQZA 4O8RA 3CL7A 3BARA 4YN5A 3JW7A 2GVLA 3K13A 1PTAA 2DH2A 1BQGA 3AI0A 3PZTA 3T42A 4O53A 1UPMB 2NV2A 2ISFA 1ITQA 4A3YA 4DELA 4DYEA 4W8AA 4FNPA 5GVJA 2A7PA 4J3VA 4L1GA 3P67A 5MF5A 4IMFA 2CBJA 1GVYA 5G4HC 4ONVA 4HPGA 3W1TA 2G3NA 3UZZA 2RDUA 1V3HA 3C2EA 4UTFA 1OCBA 3NL6A 3WUGA 1VH7A 1QPNA 2QQ6A 5HMFA 5FOOA 1BLIA 2WHLA 3KRUA 1KFEA 3GRIA 2C7FA 2XFFA 1ZGDA 3GDTA 5JH2A 1IT8A 1C7TA 3TW7A 4FZIA 4DF1A 4FX6M 3S5SA 1HVXA 3PTKA 4S1FA 1W8SA 3AXIA 4HHLA 2E40A 3M0YA 2PRHA 3LOTA 4E3VA 4LY4A 1Q6EA 2QMJA 4NRSA 4RL3A 3M6DA 4J3TA 3U9IA 3VFCA 4KESA 1QCWA 3WNNA 5HJLA 4KH2A 3CMGA 3PZ9A 4INFA 3NQGA 5HAOA 4CCEA 1R2SA 3QHOA 2DSVA 3O2LA 1RVGA 3M5XA 1NF7A 4JHZA 4JN7A 5BROA 4RV8A 1Y5WA 2ALRA 2A2IA 5K7JA 3NL2A 2Z2BA 1ZNNA 1JGMA 4UFMA 3U7BA 2XGBA 3N9SA 4H6QA 1SZRA 2E4TA 5MKGA 4QXIA 3C2YA 5DXXA 3QHNA 1ZBWA 4QRNA 3W1PA 1J12A 1XD1A 1CEOA 1D8WA 1W3TA 4BCEA 4IIFA 1KRMA 2PDFA 1GPWA 4NG3A 3NO1A 5I3GA 2O7SA 2RH9A 3UNTA 2DV0A 4Y90A 1IQ8A 1F6KA 3H70A 1TV4A 1O5KA 4JAWA 1SZEA 2Y1HA 5H2ZA 4LNYA 1GOWA 1NVMA 3LG3A 2OCZA 3C0QA 4JX4A 5TF0A 3W26A 3TC3A 2SFPA 4NIRA 4EPDC 1NWRA 4JL1A 3GXTA 4I6KA 4HPJA 4MY8A 3K4AA 3FEQA 3V7PA 1I6NA 3KP1A 4UBPC 1UP0A 5A6LA 1OFPA 3FVDA 4NXKA 4UOZA 3E2SA 1T0OA 1UIPA 2QCMA 3HBLA 2FH8A 1G4PA 3B0VC 2EPOA 1DJZA 3PC0A 2EGZA 3STCA 4MFEA 4DBSA 4DO5A 3DHDA 2V2CA 4X2PA 4HN4A 3ABSA 2E5BA 4NP7A 3B0XA 1ZTVA 3R8GA 5FF2A 4YVPA 5CC3A 2PBOA 3W00A 4Z1YA 1I2RA 3MU7A 1VFUA 4JTSA 3AALA 4XAYA 3GHSA 2VZVA 2X1SA 5GNYA 1AQ0A 3N34A 1A50A 2E8YA 2O56A 1B31A 5DELA 5DRIA 2I5QA 3E0WA 3OHIA 5MKGB 4MNLA 4P7LA 5JMUA 1RXOB 3GU9A 2EJAA 3KP0A 2GJRA 3GH4A 1TJ0A 1UR1A 1EKOA 3AJ7A 4LPCA 3W76A 4E4PA 2XVKA 1V51A 1W5MA 5EMLA 4KKXA 2A21A 1PVNA 1EQPA 3N18A 1QK0A 4GC4A 3HB9A 1Q65A 1UZHA 3QKZA 2REQA 2Y8VA 1X6NA 4JTHA 3GC2A 4C6PA 4DB7A 5CCZA 3A64A 1F4HA 4GBDA 1KXHA 2WM0A 2FQIA 2P50A 1R38A 4JTTA 4MY9A 2HK0A 2PAJA 4XZBA 1LOQA 3N4FA 2O7QA 4ZENA 1IXNA 1V0MA 3W7EA 3R0KA 4RZ6A 3LHTA 3UXIA 3E96A 3MY9A 1CECA 1RBAA 3ZS4A 2F2KA 4KCTA 3WQEA 2HPIA 1M6JA 3H21A 1ZCOA 3TJ4A 3V4BA 2FVKA 4NHVA 3U4FA 4JHMA 3A4XA 2YFNA 4AAJA 3DG7A 2Z0IA 4K37A 1JF5A 3TOPA 3H2FA 5D05A 1N7KA 4Q4KA 3WK2A 4EAYA 3AXKA 3TFCA 2E5DA 3AUOA 1OGBA 1JUKA 5H1WA 1VFLA 3H26A 1LORA 2P3ZA 1KWKA 4IPJA 5G2WA 4RDVA 3VCNA 3DG6A 4O1AA 1C3FA 1VB9A 2NSXA 3FOKA 5K9DA 4XVDA 2QCHA 2DQXA 5HR6A 1A3WA 3I7RA 5FJIA 1XP3A 4LCSA 3VDHA 4GINA 1A5SA 1BAGA 1Q5MA 1L2QA 2QCLA 2GVEA 3VMPA 3WG6A 5AYYA 1HJSA 2PMQA 1OK4A 2BASA 5AYBA 1EXBA 2X8RA 3TU9A 1PWLA 3TMLA 2PCEA 1XBVA 2PWUA 4EXAA 2WC7A 3WDRA 1V0NA 3PAOA 3G8RA 3W23A 1JZ8A 2G8ZA 2ZUNA 3FKRA 1JCMP 4D72A 4TTUA 3B40A 3LEPA 1XINA 2YL5A 4S3GA 1C8YA 4HNCA 2J74A 1CLXA 1C8QA 3EX6A 4DJED 3CWOX 4HNUA 5M17A 5CPSA 2DORA 4P5UA 4PTVA 4DF2A 1F74A 1HO4A 3TTOA 1P7TA 2C3ZA 2Q09A 4MZYA 3CUZA 3G3DA 3A9IA 4CUCA 4EKJA 3RMEA 2V5KA 1EEXA 2W92A 1OF8A 2WCAA 4GQQA 1OWQA 5JH1A 1AW5A 4H6KA 1IIGA 4JFVA 1ZJBA 1E6QM 1QPKA 1TFVA 4IFKB 3HQPA 4DVOA 1UC4A 1F2JA 3BJTA 3UWYA 3E02A 4YYCA 3GLCA 3J7HA 1W1B1 2JQXA 3L4UA 4KWSA 1F3WA 2AL2B 2WZHA 3LM3A 2Q71A 1S5TA 3B97A 1YE6A 3KFTA 2WHJA 3L9CA 2OOFA 2VMFA 4NJJA 4WDTA 3V35A 4I8DA 2W3ZA 3C0LA 4GYPA 3THAA 3WMLA 1DV7A 1F07A 2Z1KA 4C6OA 2BSLA 1SJDA 2BHYA 4FSAA 3WQOA 3OGVA 4LAZA 4C1NA 2Z1SA 5BRPA 3R12A 5LZLA 3N9KA 3VIFA 4JY8A 3AHZA 3W7NA 1XC4A 2GQ9A 2FFIA 4O4WA 3RMJA 2Y63A 4AB4A 2PF8A 5LNSA 2OLHA 1G69A 4X63A 1Z42A 5CPNA 3ITYA 4W8BA 1FHUA 3S1WA 4RE4A 4UR8A 5IBXA 4MWAD 2VELA 2BOGX 4J27A 3NM1A 1LCOA 1IWAA 3TX9A 1OADA 1G67A 4ZZ9A 4NZ1A 4ZOEA 1EO7A 4PMNA 1JCXA 1R7OA 3H53A 3MUXA 2G5WA 1QI0A 4I90A 1GUVA 1R3RA 1SMAA 1ISVA 5M2FX 4LRTA 2VENA 3ANUA 1VC4A 1NAL1 2WKGA 4KWVA 1GYNA 3KE0A 2WNWA 4J3XA 1OD8A 2PDCA 5BU9A 3WQDA 1WOAA 3ZLFA 4LXFA 4O16A 2NUYA 1LBFA 4ES4A 2VDGA 3KOZA 3H4XA 3PF3A 3FDKA 3TA6A 1Z44A 4H9XA 4O13A 1C9DA 3LCFA 3KOXA 3W2MA 3WEMA 4JIPA 2DZVA 1UBSA 3UPMA 3H2EA 3O63A 1JPMA 4A8IA 3EWXA 1IT0A 5A2AA 4NYYA 4H2HA 3TH6A 4AX6A 1NQ6A 3VX1A 3NTYA 2OKOA 4JKKA 4FK9A 2POTA 3W7QA 3KVKA 1S3TC 3LTPA 4EWND 7ODCA 1KCLA 2BTMA 4A22A 4FLQA 2OSWA 1R3YA 4GPNA 1P0KA 1R0MA 4JIHA 3VGEA 2HVMA 4U3CA 1TPEA 4H7CA 1XDJA 2XH7A 5CC7A 4DY1A 5CZTA 1FWIC 4M6UA 4L6OA 1VBHA 4IG2A 4GNJA 1EP1A 4QDWA 4I5XA 3LK6A 3L2IA 4HA3A 2D2GA 1A5AA 1AZ1A 1QW9A 2VT0A 2XFWA 3PSVA 3QZEA 5D30A 2JALA 1TMLA 2EPMX 2HNHA 1GEQA 1LWHA 4OIFA 2OODA 4NZCA 2YB4A 2C0AA 1XISA 4P7RA 1FWSA 3A24A 3VIPA 3MO7A 3W38A 2TAAA 2Y7FA 3WDJA 4MAZA 3UYCA 3CMJA 4JX6A 4U2ZA 3CV6A 5BOEA 3B8SA 3KBMA 3W2NA 4BI6A 4HNNA 1QWKA 1XQKA 4QQ3A 1XSJA 1AQMA 1C93A 4WJEA 4OVXA 2OT0A 2ZUVA 2J8TA 3SR7A 2J75A 1M5WA 4DJFA 2J78A 3CT2A 2ZBTA 2UV8G 3WLOA 3GNPA 4OTKA 3LCLA 4F4RA 4Q8TA 1HQTA 3O6CA 1B9ZA 1MXSA 4F66A 4IQLA 1QPRA 1Q7ZA 4IF2A 1TRDA 4N9BA 5CPOA 3UJ2A 4NZ4A 1NWUA 1OFRA 3N3MA 5LIYX 2B7OA 2Z2UA 3QSTA 4IPIA 1NEYA 3AIRA 3B9NA 5AHFA 3U4AA 4QLLA 3ALGA 4LEQA 3VU2A 1OIFA 2BHZA 3B3DA 3CNYA 1XLBA 3VO0A 3R5EA 4JZ5A 3SDOA 4JR5A 2NXIA 4LV4A 3UBPC 4QJ1A 2ZUTA 3MI3A 4TU1A 4YIWA 3A3HA 1FWJC 3W4RA 4ZMGA 2X2GA 4C1LA 1YRRA 3ECQA 3HPZA 1OFQA 2PODA 4QCEA 3THQA 4AX7A 1A80A 3ZJ8A 4WF7A 3MVTA 4D8ZA 4U3AA 1FWEC 3W85A 2EPLX 1SO5A 1OZQA 1R9ZA 3KBWA 4GRSA 2PP3A 3BGGA 4XUYA 3OGRA 3QVQA 3TV8A 5BXTA 1SSDA 3G1VA 1W54A 3WIJA 3O07A 4Y9AA 1AZ2A 2NX1A 2BZNA 3CJPA 2DVTA 1VFOA 3VCCA 5CAHA 1LLZA 4G9PA 1K8ZA 3SECA 1DE6A 2QJGA 4JYFA 3CMFA 4P7NA 2Y8KA 5CJNA 4Y9MA 4PTXA 1AJZA 2PDBA 5G2HA 1QI5A 3H4WA 4E2DA 3ZLHA 2IQTA 3R1ZA 1MW3A 1B2YA 3WF4A 1XIMA 2IXUA 5K9CA 3HG2A 2WMJA 3IVSA 5ABGA 2YDQA 3OYZA 3VIOA 1X38A 1LL6A 4L1WA 1WXZA 3U57A 3E0FA 2WYSA 1MEHA 3PPHA 1XLDA 3SURA 2PBGA 2WWDA 5GQBA 2VJXA 4FP1A 4CN4A 1H3GA 2PDNA 4KWUA 4DO6A 4IMEA 3WLNA 3AS3A 3IACA 3MUCA 1ODZA 4QJ4B 2ZA2A 5CZJA 1IR2A 2Q01A 2WKJA 3U3HA 3T81A 1UD6A 2OO0A 1I0BA 1YDOA 1TPFA 3HV9A 1XSKA 3GDKA 2OYMA 1CIUA 2ZRWA 3DBNA 2H6RA 2D24A 3OVRA 4I9MA 2CZEA 3UF9A 4XZLX 3F5KA 5HMDA 3HG4A 3CLMA 3GZAA 1S2UA 3IANA 3SB0A 3H2CA 2QUUA 2I5GA 3FN9A 4CU7A 3W7LA 3QN3A 4WZHA 4DJFD 1QTWA 2VCCA 3ITXA 4QS6A 1PEZA 1VJSA 3I65A 3TTYA 3WQ8A 2PDIA 1UKPA 1JZ3A 1VP5A 5DY2A 4HB7A 4AC1X 5CSRA 4NNBA 3GDBA 4HHPA 3G8EA 3QC3A 4O1FA 3I6EA 2I9UA 4MWAC 3ZIZA 1IXQA 3M44A 5A6SA 1FDZA 5I79A 4JN6A 4DLMA 1OIMA 4R7WA 5G1MA 2BWGA 3ME3A 5HWNA 3OBEA 2YXGA 4A8RA 4UR7A 2OWWA 3SW6A 3RJYA 1XIJA 2GVYA 3RIKA 1M53A 2YPIA 4D6CA 2VFHA 3LRMA 4U5IA 3QFEA 3EWDA 4ZQPA 4E4FA 3L4XA 1RQBA 2CFFA 3CS2A 2W63A 5I2UA 3V5CA 5GJPA 4LFYA 6ENLA 1WKFA 3A13A 3ABZA 3W01A 3TOYA 2VDIA 4ROQA 1C90A 4KWOA 5PTDA 4R3UA 5AC6A 3OG3A 4MKVA 5EL1A 4QG8A 1L0PA 3KZPA 4GA8A 1JCLA 3NO3A 2VD8A 5LIKX 5LSMA 1AQFA 1DE5A 3N29A 4JDYA 3TLQA 2VEIA 4KBXA 1OCQA 2CLIA 1EUNA 3HGRA 1NSJA 2P5NA 2C8NA 1V6WA 4JS3A 3AMCA 1UWTA 3F4NA 3NUKA 3TONA 2JE8A 4HMEA 1LM1A 3QY8A 1EA9C 2CZFA 3PWGA 2GZXA 3BV4A 3SADA 1DOSA 1X98A 3U5UA 2XN2A 1EDTA 4NAEA 2KX9A 1F6PA 4RE2A 1BYAA 2NWSA 1FWDC 3KEHA 4IJRA 2OXNA 2W9MA 3N04A 5C9UA 4HOXA 3EKZA 1T96A 2X0YA 2XSAA 4CN1A 4H9YA 3SO7A 2FMNA 4PRRA 3LENA 4FNRA 1TMHA 2HBVA 3CV7A 2CIPA 2B31A 2VC6A 1H2JA 3EMZA 3W2JA