1C90A

Endo-beta-n-acetylglucosaminidase h, e132q mutant
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
265
structure length
265
Chain Sequence
b'KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFDDQYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H
publication title Mutations of endo-beta-N-acetylglucosaminidase H active site residues Assp130 and Glu132: activities and conformations.
pubmed rcsb
source organism Streptomyces plicatus
molecule tags Hydrolase
total genus 95
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1999-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1c90A00
4JL2A 2Y24A 4D6HA 4IPLA 1EOKA 1C7TA 4RE2A 1GOMA 3S6TA 3EDKA 2D2OA 5DF0A 4GI6A 1C7SA 1G94A 3NYDA 5I6SA 2XFRA 2VVSA 1CGXA 4AWEA 1NARA 2BY2A 2WZIA 3M6DA 3SCSA 4R5EA 3T08A 3AJ7A 3L4XA 1UKPA 2EPLX 4LQ1A 3A47A 3WF2A 2EQDA 4PUDA 4DUXA 5CPSA 2J7GA 2YBUA 1DWGM 1KGUA 3AS1A 3VD7A 3B9DA 4XB3A 4UFIA 4X0NA 2GDVA 3AMDA 1ISXA 8CGTA 2GJXB 1MFUA 3CLWA 4YHGA 1KR1A 3WH6A 5HPOA 3WBEA 1HJQA 2ZXDA 2E4TA 3TTOA 4AD4A 3CHEA 4HOXA 5A69A 3VGHA 3GXMA 2YA0A 1HNYA 1HVQA 3QR3A 3MUZ1 2A3EA 3O2LA 4HMDA 1K9FA 1E70M 4CD4A 2J8FA 1MWOA 1Q6EA 3L2MA 4KWUA 1QHZA 3QHNA 1JF6A 4AXNA 4M29A 4MADA 1W3LA 3WNNA 1XSKA 3CUHA 3OLIA 2WMJA 4AW7A 1B30A 1PBGA 4PSRA 1H09A 6A3HA 1BTCA 1U2YA 1E6ZA 4UOJA 1ZBVA 1HL8A 3B8SA 3KL0A 2QV4A 2J7HA 3POCA 5CXPA 3SUWA 2CESA 2PF0A 3GZAA 5I0DA 3VD9A 3VTRA 3ALGA 3ARWA 2EPOA 2O9PA 4ATDA 4DWSA 5I3DA 3AS3A 2XVPA 1V3KA 1W2VA 3L4ZA 1FFRA 2G41A 1EDQA 2VCBA 1V3IA 3AHVA 2ZICA 5D8ZA 1CGWA 1HJUA 1ZBKA 3WSUA 1QVBA 1AQHA 3OBAA 3WQ4A 2VOTA 1UH2A 3AHXA 3WMBA 5CPTA 4CD5A 3QGVA 3T0BA 1PIFA 2ZX7A 5IXEA 5JBDA 3VIJA 5BCAA 1X1NA 4QDMA 3MANA 4D1JA 1GJWA 1VF8A 1JXJA 2JE8A 2VTFA 1V6VA 1DTUA 2GDUA 2WBGA 1WDPA 1B31A 1DWHM 3VM5A 1E40A 1BG4A 2JF7A 2XWEA 2CERA 4FLOA 3AYRA 2D22A 4CN1A 1WZLA 2GK1B 2XVLA 1GOIA 4BZYA 3NDYA 3SCTA 2X0YA 5DEZA 5E0FA 4JKMA 4HOZA 1FP8A 1WZKA 4Z2JA 1MXGA 5ABGA 2W4XA 3PTKA 1W3JA 5A95A 4UFLA 5FIPA 1E6PA 3GXDA 4D1IA 1J10A 1L0PA 2JEQA 2YBTA 1OGGA 2XPKA 1H4PA 4P8WA 4XZWA 2E9LA 2O9OA 3KL3A 1NP2A 5ECUA 4E8CA 1NWRA 1QHPA 3J7HA 1MQRA 1WDSA 3T09A 2BY1A 5A1AA 2VZTA 4ZXLA 1M53A 2VR5A 3FY1A 2PI6A 4QCFA 1OD8A 1CXIA 3CH9A 4AZIA 3CZKA 5I78A 2J4GA 3EDDA 1BYDA 2CIPA 1CLXA 1XYZA 4U3AA 5IHRA 3WEMA 1HIZA 5BRQA 3M7SA 4IISA 3W24A 3WNLA 3FHQA 5DT7A 3WF1A 3BMWA 3WH8A 1KCKA 1ZU8A 1GNXA 5E70A 3VIHA 4H41A 1JF5A 3PN8A 3GBDA 1GVIA 1EHAA 5A8QA 4UQDA 1E71M 2CBVA 3PTMA 4CCEA 3NUKA 2XM2A 3QOMA 1SYTA 2WVUA 4E4PA 1J0HA 3I3BA 3EDEA 4Z2GA 3IANA 1VBUA 2WPGA 1VJSA 5BXTA 4KH2A 3QHMA 2JIWA 4D72A 4AEFA 1E55A 5D9MA 3KE0A 3A4XA 2VJXA 1JDCA 3EMZA 1MYRA 1J0IA 3UCQA 4M82A 4PMOA 1OD0A 1GW1A 1TVPA 2GJPA 1CIUA 2W66A 2X0HA 2OYKA 2VX6A 3CZGA 2ZE0A 1JD7A 2QPUA 1XC6A 1OT2A 4C7DA 1EHNA 5E0CA 1CTNA 3CZEA 4PUEA 5JBEA 4HU0A 4OBSA 3VMNA 5HXMA 1W2PA 2J47A 3N11A 3VGBA 4RL3A 3CHFA 4P8UA 1VAHA 5BROA 1JFHA 4P7NA 4W84A 4FF5A 3NSMA 4JZ5A 4KMQA 3OLDA 4PTMA 1WZAA 5A6BD 3MO4A 3K4AA 2Y8KA 5DT5A 2DDXA 2A3HA 2WZEA 3SCQA 4PMXA 2VZUA 1LL4A 1VB9A 2W91A 2CKRA 1W32A 5AYIA 2WK2A 3LPPA 4L4OA 2NT1A 1E3ZA 1XCXA 1Q4NX 1E6SM 1JZ5A 1GCYA 2BVTA 2YDRA 4W86A 1MFVA 3EDFA 1JGIA 3ZQ9A 1JZ2A 1NH6A 5I2UA 1C90A 1W1PA 1WB0A 5GPRA 1PX3A 5CPQA 3T2OA 4BA0A 1S46A 3CZJA 4CKQA 2E9MA 1TCMA 5I23A 1ISZA 1R87A 5HPCA 3U7BA 2XIIA 3NDZA 3B9AA 4M81A 2NSXA 4LXFA 1DEDA 3DHUA 3BMVA 3FW6A 1TVNA 5LA1A 4NRRA 5A8OA 4AZ7A 2XGBA 3VD5A 2DEPA 4FK9A 8A3HA 3K8MA 2G3MA 4MDOA 2EBNA 2Y4SA 3OLEA 1HKIA 4BS0A 1UZ4A 3TONA 2BVYA 1LWJA 3VIOA 5A8NA 3TOPA 2WB5A 1E4LA 1MQQA 2PWGA 4W8LA 4JFWA 1KQZA 3WL1A 4J3XA 1VIWA 2WMKA 5E9AA 4XUYA 3AROA 3WF4A 4P7LA 5A3HA 3WDQA 1H0IA 3VD3A 3O9NA 1JNEA 1GQLA 5D4YA 2QPSA 2OSYA 3NIYA 4MB4A 1VEPA 2WWCA 5BXSA 2O92A 4DWSD 1RD6A 2CPUA 1HVXA 2EPNA 1PAMA 3VO0A 4WF7A 1CLVA 2CNCA 1I1XA 1MW0A 3WDHA 1HL9A 1V6XA 4Z2IA 5A8MA 1B2YA 4R27A 1W9UA 3T2QA 3RIKA 1DHKA 2J62A 1C3FA 5GNYA 4BF7A 1V03A 4IPNB 4NRSA 1V6YA 2PWDA 1E9LA 4J27A 4PYSA 4HPHA 1BQCA 2JALA 2ZX5A 3AXIA 2UY5A 2XGIA 3RCNA 1VENA 2XSAA 2DSZA 2VT0A 1E1FA 1CXHA 1YHTA 1JYVA 5ABHA 2W63A 3WDJA 3AIVA 3WN6A 3MV01 1JL8A 2IUZA 3WD1A 1EQCA 5A6JA 3SUTA 3VMPA 2G4FA 1G9HA 2OYMA 4JIEA 1HKJA 3WFLA 3MU7A 3SCRA 2XYLA 3PZTA 2WVVA 3VM7A 1GQJA 1BVNP 3N18A 1NWUA 1E6XM 1ZS2A 1M7XA 4PMZA 1ZL1A 2WCSA 2D24A 3ZT6A 3SUVA 3MKKA 5CSUA 4U2ZA 4J3UA 4UNIA 3ARXA 2YKKA 1XGZA 3W27A 3WQ5A 4MAVA 3OIHA 2YOCA 1GJUA 1MW3A 1FFQA 1SR0A 2VO5A 2EPMX 3VX1A 2VNCA 3RILA 2BY0A 1HJWA 4JFUA 2J7DA 1H11A 3AMKA 1L8NA 1C92A 3WD2A 5IFPA 3VDAA 2W67A 3KEHA 1D7FA 4AD0A 1MXDA 1HKKA 2E40A 2HISA 4UZSA 4MB5A 1FOBA 1GHSA 2ZUSA 2XSBA 2UY4A 3APGA 4CCDA 1QI0A 1UH4A 1QNPA 3RPMA 1UD2A 5AC4A 4TUFA 2UY2A 3WH9A 4QCEA 1M01A 4ACZA 2D3NA 4TTUA 4D6GA 1KBKA 1CPUA 4GKLA 2JEPA 3W53A 1US2A 2ZUNA 2WYSA 3AIWA 1LF1A 1J18A 1CBGA 3ZSSA 1CGTA 3KWXA 3CZ8A 2CBUA 2ZOXA 6CGTA 5F7UA 3GTNA 3ZOAA 3EMQA 2PC8A 4WLCA 1KWGA 1BSIA 4TXEA 3AHYA 2J8GA 3EBVA 4UOZA 2CETA 4JFSA 3N12A 4LYRA 4V2XA 3WNPA 4OJYA 5LYRA 2VRKA 5I5RA 2YJQA 3HMCA 2GJXA 4GZEA 3W37A 3WL0A 4DUWA 2DH2A 1EXPA 5A6AA 1UZ1A 3WNOA 2FHCA 2DT1A 3RJYA 3WD0A 3N13A 1J01A 1H2JA 2DT0A 3IK2A 4OOZA 4GINA 2Q8XA 3DC0A 5A2CA 5BXPA 2BXYA 1K9TA 1JZ8A 1MQPA 4OOUA 3G6LA 3PHAA 4W93A 4CCCA 3WUBA 2G3NA 3WBAA 3AXXA 4J28A 1BAGA 2NT0A 1KR0A 1XSIA 4GO9A 1UD5A 4A3HA 5CLTA 3LMYA 4HOWA 2WC4A 3BAKA 2NW0A 2FDMA 2WHKA 3O6AA 3ZIZA 3UR8A 4JFTA 4UFMA 3AZTA 3VUPA 2GSJA 4QLKA 4AZGA 3RMEA 2CCRA 4XV0A 3KL5A 2D0GA 4AZ6A 1JNDA 4QLLA 1UA3A 3AIBA 4B9YA 3VIMA 4PRWA 2FHFA 3F4VA 2VRJA 3VGGA 4GQQA 1UD6A 4UQ9A 3A4WA 3IAQA 4W89A 4PMYA 4HA1A 4AZCB 3I3EA 1SMAA 4TX8A 4Z2HA 2AOSA 1HP4A 1WDRA 1X6NA 3GBEA 2A3BA 5AC5A 1BPLB 1E4IA 2QMKA 2DT2A 4AZ5A 4GZIA 3PBGA 1UWIA 4WSJA 4U2YA 3T2PA 1I75A 3MMUA 1J12A 1JZ3A 1DP0A 4MTVA 2VCAA 1EH9A 2D0FA 4GO8A 2WSKA 2BNJA 3K1DA 1FHLA 1E4NA 2DSVA 2VX4A 2WHJA 4M80A 4CVUA 1V02A 1VBRA 3RM9A 2EEXA 4GI9A 2ZUVA 1OB0A 1M03A 2A3CA 2YA1A 4OZOA 3WF3A 1EDGA 4HU8A 1QOXA 3SIMA 4ZE4A 1AQ0A 3EDJA 4MJ4A 3AS0A 4ZXOA 1CXFA 1GOWA 2F8QA 4A3YA 4Q22A 1E73M 1UWSA 1FA2A 2DSKA 2GK1A 5I77A 3U5YA 1J9YA 1ITXA 1WE5A 3NSNA 4W88A 2FHBA 4HPGA 2YIHA 1V3LA 3WELA 1VEMA 4J3TA 1AQMA 3BSGA 3CUJA 1VFMA 1I1WA 3HU7A 2ZXBA 3W4RA 1ESWA 3F5JA 3WQWA 1RP9A 2WZHA 3UG3A 5FL0A 3ARTA 3ARVA 1CNVA 1UHVA 4F79A 2X1IA 1XRVA 2A3AA 2FH8A 1K6AA 1TE1A 1CGUA 1XH2A 3IJ9A 4MJ2A 3GXIA 1NWSA 1CYGA 2DT3A 2WHLA 2CBJA 1WCGA 2J74A 4HTYA 1DWJM 1B1YA 1FP9A 1Q6GA 3GNRA 4URIA 3LPFA 4RE3A 4AZHA 3GH4A 2GFTA 2WKGA 4M56A 1BGAA 1V3HA 3WKZA 2XVGA 1F4AA 3L4WA 3OGVA 1GQIA 4ML4A 4JAWA 1E6RA 3MUY1 4MAZA 3AHTA 2V3FA 1W1TA 5LA0A 5E6YA 1K9EA 2ZWYA 4OUEA 1FHDA 4M24A 1R7OA 3VINA 1E43A 2RGLA 4H2CA 4PMDA 4OIFA 1JD9A 4B15A 1HT6A 5M17A 3ZR6A 2JFEX 4NZCA 1KFWA 1BYCA 1KXVA 5HNNA 4W7VA 1QI4A 1Q6CA 2DQXA 3SUSA 5A6MA 1HF6A 2CHOA 2E0PA 4LX4A 4UR9A 3AIRA 3VOCA 3ZMRA 3MMDA 4H8UA 1QNOA 2YLLA 2F2HA 4OKDA 2YLAA 1JDDA 3OLGA 2DPEA 2OWCA 4PTWA 3UG5A 1UR1A 2J78A 4P7QA 2PBOA 1J0ZA 1ZBWA 4P8VA 3MSGA 3AIEA 1UYQA 1CXKA 4JCMA 3VD4A 2E9BA 5GNXA 2ESCA 2JIEA 2J7CA 1UR9A 3ZJKA 1V08A 2WW5A 3VDCA 2WC7A 4MB1A 4WK9A 3THCA 4TOQA 4JKLA 3F5LA 4CU7A 3U5UA 4E2OA 1OCQA 2G3IA 3N15A 1CGYA 3BSHA 4ATLA 4HA3A 2WANA 4OBRA 4CD6A 1FH8A 3VGFA 3FAWA 3ZJ8A 3PZGA 4ACYA 3BGAA 4TVDA 5A2AA 3WNMA 1MW2A 1W9XA 2CKSA 1ODZA 4JHOA 1V6WA 2D20A 4C7GA 3OA5A 3OZOA 1J0JA 1QBBA 3CUFA 4FLSA 2F61A 4FMVA 1UH3A 4PEEA 1UWQA 3RM8A 1VRXA 5BRPA 1H41A 2J77A 1HP5A 4ZEPA 2G3JA 4J7RA 4D71A 4H7VA 1V02E 1ZB5A 4KGLA 1KQYA 4DM2A 1UKQA 1PZ3A 4KRUA 2BHUA 4D6CA 3BAJA 2ZXQA 1JYWA 1QW8A 3ARRA 4P7OA 1EA9C 3VMOA 1HJSA 2VURA 1KWKA 1EDTA 2OSWA 4M1RA 3W26A 2XHYA 3K8LA 1DWAM 3BC9A 1JYNA 4J3VA 5EFFA 3M07A 2E8YA 3WUEA 3GH5A 1KXHA 5CJ5A 1K9DA 1EO5A 4HZ8A 3VIKA 1Q6FA 1NP0A 3WDIA 2FGZA 4CN6A 2PWFA 1E4MM 3ZJ6A 2C7FA 2WLZA 2IXUA 1YQ2A 5ABFB 1UOKA 3T0DA 2YL6A 2ZXAA 3AXHA 1OWQA 3DECA 1IZKA 4HMCA 5M5DA 1JG9A 1UR4A 3RJXA 2WMFA 3LPGA 3NJ3A 1UQZA 1O6IA 3RDKA 2WCAA 5ABFA 4TTGA 3THDA 3ARQA 1F4HA 1PEZA 2VX5A 2BY3A 2W61A 3VNYA 5E6ZA 3PZOA 2V5DA 1TZ7A 1OT1A 4UQBA 5BYWA 2XTKA 1UA7A 4DM1A 2GJRA 3WENA 4F66A 3N04A 1N82A 2YDSA 1XYFA 3L4TA 4PN2A 1VEOA 2EJ1A 4PTVA 3S2CA 4U5IA 3PZMA 1W91A 2OSXA 1IV8A 1IZJA 1JI1A 2YA2A 4X9YA 4C7FA 3VU2A 4W7UA 4PMRA 3AZSA 1KBBA 1KXQA 1B3VA 3CMJA 1BYBA 2X8RA 1J11A 5EMYA 5CGMA 1GOKA 4W85A 4K68A 3K8KA 4MPKA 4AMCA 1BG9A 2OWWA 5IHSA 4UQCA 3ARUA 1EO7A 1JAEA 2V3DA 2XWDA 2C0HA 5JIPA 4CN4A 2WBKA 5ABEA 3W28A 1C91A 1WKYA 4CGTA 4NSBA 4YPJA 1KGWA 1MVYA 1ZBCA 2WXDM 1NM9A 1TG7A 2WLYA 4JHZA 3PZIA 4H8VA 1SMDA 4PMVA 2ZX9A 1XHGA 1FH9A 4QLJA 5A8PA 3IAPA 1W9DM 2OLHA 5CQ1A 2B31A 3RO8A 4AD1A 3AQUA 4M8UA 1LWHA 1WO2A 1QPKA 2BXZA 4N42A 2YDQA 4EK7A 3W38A 1BHGA 3CIVA 2AAAA 1WPCA 4PCTA 4U31A 3LPOA 1H5VA 3DYOA 4EE9A 3A4AA 1V6UA 4QAWA 4HZ6A 1CECA 4A4AA 1TA3B 3SCOA 4TVCA 1TR1A 1GONA 3ARZA 1H3GA 1US3A 3VKKA 1VFOA 3BAWA 1ISVA 1HX0A 3WQ8A 1QNRA 4MNMA 1R86A 1E5NA 5D9PA 1LQ0A 2WMIB 4J3SA 4HMEA 5M03A 3KZSA 4S3KA 2DSUA 3AHZA 4AD2A 1AMYA 3MV11 5D9NA 4LPCA 5CGTA 1G1YA 3WUGA 3OGSA 2DIEA 4W7WA 2EXOA 1C93A 2WVTA 3OGRA 1U30A 1ECEA 2OWXA 1E72M 3NSXA 5A94A 1UWRA 1UUQA 1CENA 4AIUA 3AIUA 3SCPA 1VJZA 2WAGA 1BGGA 3I3DA 1GOQA 4GIAA 2XFFA 1R7AA 1OSEA 1J0KA 2Z1KA 3WQ6A 3WDRA 1C8YA 1BFNA 3SUUA 1JZ6A 1E15A 5JUVA 1OIMA 4H04A 3PZVA 4UCFA 3W6MA 3G6MA 3OZPA 4AZBA 5A6BA 3BAYA 5FD0A 2V3EA 1PPIA 1H1NA 2UWFA 1UWUA 2XIBA 1Q6DA 3CZLA 1IT0A 3AICA 3BLPX 3WNKA 3GH7A 3AOFA 2VUYA 1GPFA 2PB1A 3MS8A 1XSJA 1LL7A 2V5CA 4WIWA 3WEOA 3II1A 4WJXA 5FOOA 4MDPA 4GQRA 4PCSA 2J25A 4W8BA 3CPUA 5LA2A 1E0VA 1KXTA 5FCZA 1C8XA 4W5ZA 7A3HA 1CGVA 2WNWA 1UQYA 5KZ6A 1PJ9A 1LJYA 1CWYA 4UFKA 4Z2KA 1A3HA 3AISA 1B3YA 4B16A 3W0KA 1B3ZA 3SURA 1CXLA 3FXYA 4RE4A 2WCGA 2VQUA 4MNLA 6TAAA 2X2YA 2XJ7A 1G5AA 5HBFA 4BQ5A 1QNQA 3UESA 4TX6A 2G8ZA 3BLKA 4Z2LA 4YHEA 5BWFA 1D3CA 1VFUA 4V27A 5JIWA 2QHAA 4QFUA 3WQVA 3PTQA 3SCWA 2EO7A 4DWSB 3W25A 4V28A 3PZ9A 1E3XA 2AMGA 3WUFA 1V0KA 3ZJ7A 2BFGA 3ZM8A 5HDRA 3T0AA 3GM8A 1RH9A 5A6SA 4W5UA 4CU8A 3BCDA 2C8NA 4CVWA 2XM1A 2PWEA 3GNPA 3AS2A 1JIBA 1CDGA 4GI8A 9CGTA 3ZT7A 3D5HA 3VGDA 4WKAA 4P7RA 2VQTA 4EANA 3VDHA 4U33A 4F9JA 2FGLA 5BXRA 1UD4A 5CZKA 4QP0A 4IM4A 4AIEA 4PMUA 1KCLA 3VGEA 1R85A 5C70A 1TUXA 1PX4A 2VZOA 1H0GA 3BAIA 2ZUWA 1RPKA 4AZCA 4LYPA 3D3AA 3N1AA 3VIGA 3CBWA 1QI5A 1HJXA 4F9DA 3IJ8A 2YL8A 1GVYA 3N17A 4PTXA 3WIJA 1NOWA 3PZQA 1Z32X 3TTYA 1FH7A 3MMWA 1QHOA 1NWTA 3BCFA 3U57A 2RGMA 1OGSA 4MNJA 5C71A 3POHA 4JKKA 4D6EA 2CEQA 3CGTA 4UQEA 4N0RA 4U3CA 2WVSA 3DYPA 3TTSA 3WH5A 3ZT5A 2W62A 3GDBA 3SCVA 1BVZA 1PZ2A 2VL4A 2WWDA 1E1EA 5CSYA 4B9ZA 4AY1A 1E6NA 2E3ZA 3VNZA 1QBAA 2VR4A 4LGXA 1HJVA 5KEZA 2WSPA 2BV9A 1UKTA 1XV8A 3CO4A 3L2LA 2BHYA 2VMFA 5FL1A 4D6FA 1Y7VA 3W82A 1EOMA 1A47A 2VVNA 1B3XA 3EMCA 4FLRA 3SCNA 3FNDA 4GZJA 4GXPA 5CG0A 1GHRA 3VIIA 3UERA 3AIQA 3FN9A 2VX7A 2BHZA 2IXVA 3FHAA 2J7FA 1BYAA 5GNZA 1WAWA 4UFHA 1ODUA 1HXJA 1UR0A 4DUVA 5M3WA 4PMNA 1C8QA 3SCUA 5I79A 2J75A 4D6IA 3ZSTA 1JXKA 1JZ7A 2J79A 3AZRA 5AY7A 5DFAA 2FH6A 1B90A 2ZUMA 5AYBA 2V3GA 3WMSA 1V3JA 2O9RA 4CU6A 1OBAA 1U33A 4ZFMA 4ZENA 2VC9A 3TA9A 5EBAA 1RP8A 4S3JA 1E0XA 4H8HA 4AC1X 4UTFA 2XVKA 2ZX6A 4HA4A 4ZE5A 2GUYA 3QHOA 2WC3A 1OINA 4UFJA 4Y7EA 1UKSA 3WDPP 3SEPA 1KGXA 1NOFA 1W9VA 1HN1A 3CHCA 4BQ2A 7TAAA 4LYQA 1QNSA 3UEQA 3AMGA 1V0NA 3GXFA 1CZ1A 2CITA 3VDBA 3F5KA 1ITCA 4MB3A 3ARYA 2CBIA 2V38A 1JFXA 3AYSA 3BH4A 1H49A 1LG1A 1E0WA 4WKFA 4ATWA 2OYLA 4W87A 4CD8A 4AEEA 1B3WA 2EPKX 1JDAA 1ZJAA 1V3MA 5A6KA 4X0VA 3WY1A 1M04A 5IFTA 3CMGA 1W1YA 2O9TA 1UKOA 3CHDA 2X05A 4B3LA 1ISYA 2D0HA 4HZ7A 3GNOA 1UG6A 1X6LA 4CD7A 1W1VA 1AVAA 4AD5A 1E56A 3VILA 1UWTA 3AMLA 4UOQA 3ZO9A 5A2BA 3CUIA 1XD1A 2Z1SA 2W92A 4BQ3A 5I24A 1W3KA 2BVDA 3OB8A 4NI3A 1TMQA 3W29A 2CYGA 2E8ZA 4P8XA 4B3KA 3K46A 1UR8A 4J3WA 3FAXA 1V0LA 1D2KA 1TFVA 5IDIA 1B0IA 5FKYA 2ZX8A 4HP5A 4PBGA 3WF0A 1XH0A 1E5JA 3HN3A 2VI0A 4JL1A 1NOUA 5TD4A 1JYXA 3DYMA 2ZWZA 3L4UA 1QI2A 1UD8A 1VFFA 4DWSC 5CLWA 1UR2A 4JFVA 3CUGA 3U7VA 4NF7A 3DHPA 4JCLA 4Q7NA 4E8DA 1WZMA 2DSWA 3IJ7A 3BAXA 3ARSA 1GORA 2J7EA 1KB3A 1B9ZA 2HVMA 4D6DA 4XX6A 1CEOA 4BCEA 5A6LA 2Y5EA 3WFZA 5D8WA 4AYSA 3B9EA 3N9KA 3NCOA 2QMJA 4KRTA 3QOKA 5D9OA 1J0YA 4KGJA 1JAKA 3ECQA 2VRQA 3UETA 1JI2A 3TTQA 3E1F1 1EIBA 3WEZA 1OM0A 5JBFA 3L4VA 3WD4A 2MANA 2WM0A 1GUVA 3UR7A 2XVNA 5C8BB 2ZUUA 1OIFA 3A3HA 2YL9A 2XUCA 3L4YA 3MUIA 4EKJA 5EFDA 1GZJA 1EGZA 4MNKA 3ARPA 4BQ4A 2GVYA 2D23A 4U5KA 1XH1A 2VZSA 3AI0A 1WDQA 1NQ6A 3K4DA 2DIJA 1UD3A 1ZJBA 2CHNA 1SFSA 1XD0A 2PBGA 3OG2A 1GQKA 4UZUA 5GQBA 4FLQA 3GYCA 2JF6A 2BS9A 4AD3A 1G01A 1V0MA 2CXGA 1O7AA 1E6QM 2VZVA 3UG4A 4XZBA 3WD3A 5DMYA 4UQAA 3VIFA 1PIGA 4D6JA 4PMQA 3BXWA 2DGAA 2QLYA 1LG2A 3PZUA 7CGTA 1CXEA 2Y2WA 3M46A 5HOSA 3CTTA 2WVVB 4EAMA 2D1ZA 3ALFA 4W8AA 2UY3A 1DWIM 1WP6A 3VX0A 3JUGA 2WMGA 2QF8A 1JZ4A 5DO8A 1BF2A 2D3LA 4CUCA 2DH3A 2WKLA 2J7BA 1DWFM 1MW1A 3W6LA 1W3HA 3AMCA 1LL6A 3HJEA 1WNOA 2TAAA 2W5FA 3AFBA 3A6OA 1BLIA 1G0CA 1QI3A 2X09A 2VCCA 3ZR5A 2WHMA 4AISA 1PX8A 2YL5A 1EQPA 5EB8A 1P6WA 3MUAA 1LLOA 5E09A 4AIOA 1TA3A 3WH7A 1XCWA 4GPNA 3PZNA 3VVGA 4WKHA 3VPLA 4PSPA 3VIPA 1GOOA 1W9BM 3W81A 2PWHA 3WMCA 4L4PA 1HKMA 3MSDA 4IUGA 2WMIA 4YN5A 2XG9A 2ZUTA 1QW9A 3RM4A 1OGBA 4TVUA 2ZIDA 3TP4A 4WSKA 2Y8VA 2WMHA 1R8LA 4F8XA 1W9PA 1ISWA 2XFYA 3EYPA 4ACZB
chains in the Genus database with same CATH superfamily
2YB1A 4D6HA 1TMLA 1C7SA 1JPDX 3NYDA 3BW2A 1ZP3A 2VVSA 2O0TA 4HSNA 4AWEA 1NARA 4MYXA 4FIQA 5ABTA 1J6OA 2GGHA 3OHIA 4GVGA 2QUMA 4QS6A 4ZQRA 5D04C 3C3UA 3T78A 1PV8A 4EWJA 1DWGM 2NV1A 1VFSA 3AS1A 3QV8A 3B9DA 4XB3A 2Z7GA 2GDVA 3AMDA 1ISXA 8CGTA 2GJXB 2Q6ZA 2C0AA 4YHGA 1KR1A 1LROA 4INFA 1RY8A 3CHEA 3Q65A 4GX8A 3RU6A 1G4TA 1YDOA 1HVQA 2Z6IA 1RQBA 4HMDA 1KKOA 2J8FA 1MWOA 1Q6EA 2CLIA 2OLSA 1UPPA 4Q8NA 3QHNA 1NIUA 4M29A 4LNYA 1W3LA 3KTXA 2I14A 3GW0A 2R9RA 1EYEA 4ERAA 2I5QA 1B30A 3CQKA 5M1TA 1CLKA 4EPKA 2B7OA 2DFAA 1UCWA 1L6GA 2QJNA 3BTNA 3CV1A 4LAOA 3UXLA 3PBVA 3JU2A 3KL0A 4N4PA 1WKFA 5CXPA 2CESA 2QIIA 3TWBA 1G4PA 3ALGA 1OJXA 2O4QA 2O9PA 2OKOA 3V5OA 4FF7A 4ATDA 3NQEA 4DWSA 3T05A 1W6TA 1FFRA 3NZGA 2G41A 3ABOA 3GYEA 5D8ZA 2DVXA 4GABA 1QVBA 4E4FA 3TYDA 1AQHA 3O6CA 2F2KA 1VPQA 4S3GA 1QOQA 3QGVA 1TZ9A 2ZX7A 5IXEA 4ZOBA 3C0SA 5RUBA 3VIJA 5BCAA 1X1NA 4QDMA 3NWRA 4UTUA 1VF8A 3DIPA 3S1UA 3NO1A 4O16A 1DWHM 4B2DD 4R34A 1JPIA 1UZDA 2B7NA 2FPYA 4BKNA 4L65A 3GC4A 3W7LA 4CN1A 3PSVA 3PFRA 2W27A 4H01A 2XVLA 4DAFA 1X8FA 4BZYA 1VBHA 2ONEA 2X0YA 4JKMA 2QCMA 4KWWA 2R82A 3HFYA 5DRCA 1JPKA 4UFLA 3E38A 5FIPA 1IYXA 1J10A 2JEQA 3R0UA 1H4PA 2OT0A 3KL3A 3Q58A 5T8GA 3J7HA 1WDSA 3VZZA 2FIQA 1W1ZA 3FEMA 1JCMP 2PI6A 2X1SA 3NQAA 3H26A 1OD8A 2VC6A 8XIAA 1D3HA 1GOXA 1ZGDA 4R7WA 3VCRA 1FCUA 5I78A 2J4GA 3EDDA 3NTYA 1SUXA 2CIPA 1CLXA 3PWGA 4A35A 3MW7A 3BANA 3OP2A 4TV6A 5IHRA 3WEMA 1I0BA 3FX4A 1AZ1A 1H51A 5BRQA 2WKJA 3RLUA 4NNCA 5EA9A 4QG8A 2QV5A 5LGXA 2VDIA 3VIHA 1ML1A 3GBDA 2CBVA 3EOOA 2CLOA 4PGLA 2NVDA 3QLLA 2PDGA 1SYTA 3GG1A 3C5QA 4AY7A 4Z2GA 3LNMA 2VGIA 1FWFC 3VCNA 5CBJA 4HPJA 4GBDA 3N9SA 3A9IA 4GQBA 1YE6A 4OV9A 2GOKA 2QJMA 3DXIA 5D9MA 1ME9A 1VLWA 3UXIA 3M0KA 3N14A 1MYRA 1RVKA 1GEQA 2X16A 3WJWA 4ALDA 3L7RA 2X0HA 2OYKA 2QPUA 1OT2A 4KBXA 1VBGA 5E0CA 5EGRA 3B05A 4PUEA 4Y96A 3TAKA 2WPBA 3M6YA 3UPMA 2C18A 2P8CA 1SFLA 4NXSA 3T0CA 1JFHA 1I8JA 1TE6A 1Z3NA 2HEJA 2PTDA 2TMDA 4RDYA 2Y89A 2E5BA 3SFWA 5A6BD 3OW1A 5DT5A 1AH4A 4PMXA 4C6FA 5C55A 4JTTA 1IT8A 1VB9A 1OFPA 4F0SA 3TC6A 1UC5A 3EEGA 4PUJA 3JR2A 4FR1A 4K7YA 1E3ZA 1Q4NX 2PDMA 4M1BA 5C2GA 4MZ1A 1Z42A 1JZ5A 3URNA 1YTDA 1MFVA 1RY0A 5B7ZA 1NH6A 2E25A 3W70A 1RCQA 3KHDA 1DORA 5FEXA 2HS8A 4ECLA 1K8YA 4FB7A 1GK8A 1ISZA 2Y61A 1H63A 1IEQA 1DE5A 3EA3A 3IVTA 1Q2RA 3RPTA 3BCJA 4DBDA 3E2QA 1XX1A 1JVNA 3FVMA 3K8MA 5XIAA 2XISA 4MDOA 4IXHA 2TYSA 1HKIA 3KBNA 1EL3A 3NEVA 1UZ4A 3TONA 1IEVA 3VIOA 1I0DA 3NL3A 2PDQA 3V5FA 5D2WA 3QYQA 3AROA 1E9YB 3UVIA 3GHUA 1J4EA 3O9NA 3W7MA 3EX3A 3HF3A 3KVLA 2YGYA 3CAQA 3P80A 2QPSA 1RD5A 3H23A 4IMDA 2XN1A 4KW2A 4JYDA 5LIYX 1JEZA 2OZTA 2E6YA 2IQDA 3KBVA 3LBOA 3O63A 1PIIA 1HL9A 2BP1A 5A8MA 1W9UA 3T2QA 2WOQA 4QXIA 1V03A 3TJLA 3EWBX 3DI0A 4D9PA 1EGMA 3K1GA 4J27A 4WZHA 2RDTA 2PA6A 3AYTA 1EP3A 4OUIA 2UY5A 3RCNA 4WUIA 2DSZA 3PAJA 1CXHA 1S1PA 1YHTA 3MCOA 4ROPA 4RZ4A 3AIVA 3ELFA 2R24A 7XIMA 1XI3A 3MV01 3REQB 1K1DA 1PCKA 2GUBA 5FJOA 4JIEA 4XG1A 5AYXA 1EKOA 4O52A 2DVTA 3VM7A 1GQJA 1K03A 1BVNP 5JH2A 4GZ7A 1IGWA 3W83A 4DYKA 4LSBA 1M7XA 3O07A 1AZ2A 2WCSA 2D24A 3ZT6A 5CSUA 4JYEA 5DX7A 3ARXA 1T7LA 4F2UA 3OIHA 3VA8A 1FFQA 3TQPA 1QOPA 4UXDA 4HCLA 1QPRA 3ITTA 1IT7A 5IFPA 3H22A 1D7FA 1EJVC 1MXDA 3WQPA 1QAPA 3WLIA 2HISA 5LSMA 1VH7A 1DJXA 1IF2A 3S9IA 1FOBA 3MZ2A 3CV2A 1UIPA 4UTJA 1QWGA 2ISFA 4CCDA 1QI0A 1U1JA 3EKZA 4GRSA 4IGMA 1I2QA 2I17A 3JRKA 1QNPA 3HURA 4TUFA 3WH9A 1M01A 4PULA 3H2CA 5D02A 4P61A 1H5YA 1KBKA 4BJHA 3SN0A 1US2A 1AD1A 2ZKMX 1NEYA 2CZFA 3HJZA 2WYSA 4MM1A 3EGJA 2PPGA 2ASHA 4GMEA 5AHNA 4IMEA 4WX2A 3CZ8A 4H9ZA 3W07A 2CBUA 6CGTA 2ZA2A 3GTNA 2PC8A 1M6JA 4IJBA 4TXEA 1EJTC 3L68A 4QNWA 5G4HC 1K8XA 1A53A 4WR3A 1VPYA 4FNSA 5BWAA 1TSIA 3N2TA 2V68A 3RHGA 2VRKA 1EWEA 3LERA 4LS2A 1Q63A 1LOSA 1UUMA 1TPUA 3ANUA 4IXXA 1EXPA 1XLHA 3GK0A 4RUBA 4I7UA 5HNRA 2OG9A 2OO6A 2DT0A 1DXIA 3LCWA 5KZMA 4HNNA 2DJLA 3LGDA 4BI7A 5A2CA 3NZRA 1MQPA 2F84A 3G6LA 4L6OA 4A8RA 4W93A 2PTXA 3WBAA 3LI1A 4DPQA 4J28A 1BAGA 2NT0A 4HB7A 2CZDA 1KR0A 1E51A 3NZPA 4GO9A 1UD5A 5CLTA 5D09A 1LDCA 2FDMA 2WHKA 1JUKA 2ZRXA 4UFMA 1ZTVA 3DENA 3LZ5A 3TTEA 3VUPA 1KM2A 3PPHA 4XV0A 3RR4A 2D0GA 1F05A 3MJMA 4B9YA 4HYRA 1X38A 2HNEA 3GQYA 3VGGA 4UTWC 4O54A 3A4WA 4MY8A 4J5NA 3E0IA 4ZMGA 4PMYA 1P0BA 4AZCB 2OCZA 4ZTXA 1DQWA 4ZQPA 1X6NA 1WQ5A 4RXFA 1TREA 1ZAJA 3WBXA 5AC5A 4WY0A 1BPLB 2W3ZA 4UTMA 1A80A 4GZIA 3CPRA 4U2YA 2PURA 3T2PA 4FNUA 1J12A 1S5TA 1DP0A 4MTVA 2VCAA 4G6CA 2OQHA 1R3VA 2ICSA 2E1DA 4PB4A 2BNJA 2GSHA 3S2LA 5HJYA 3R89A 3V36A 2EEXA 4GI9A 4OZOA 2A3CA 3WF3A 4PCNA 2P50A 4ZE4A 1AQ0A 4A3YA 1E73M 5K7JA 4YTUA 3DFYA 1ZCCA 3CASA 2EJAA 5CC7A 3W7RA 2FHBA 3AWOA 4J3TA 4QEEA 1ESWA 2AL2B 1RP9A 4GA8A 5FL0A 1JRBA 3ARTA 1CNVA 3ARVA 3N2MA 1QR7A 3QW3A 3K5XA 4QJ3B 1CGUA 2WHLA 2ZZ4A 1UUOA 3WLOA 3V4BA 1DWJM 5FSDC 4LALA 1FP9A 4URIA 4RE3A 3GH4A 2GFTA 3HGJA 4M56A 5AC6A 3WKZA 4C6LA 4N2YA 5D05A 3PWIA 2FTYA 1GQIA 4XD4A 2X1TA 3E5BA 4JAWA 2A79A 2QUNA 3OOQA 3MUY1 1K8CA 1EJSC 3LZ3A 3VINA 4DUOA 2HS6A 4Y9MA 1XRTA 1FTXA 4B15A 4KEVA 3KM8A 1PUDA 4GE8A 5BZAA 3UYIA 3R8GA 4S38A 5CBBA 2DQXA 2CHOA 4TQTA 2W6RA 4LX4A 3PY2A 3AIRA 3QY8A 4OKDA 1X1ZA 2O7SA 2OWCA 4FI4A 3V0TA 3EX4A 4YVPA 2J78A 2PBOA 1GW9A 2CLLA 2NXIA 1XLEA 1CXKA 3I68A 3L12A 1UR9A 1XBVA 4LV9A 3I4KA 4UIOA 4MPQA 3THCA 1KNWA 2ZTJA 2O4MA 1OCQA 3N15A 1RJQA 3TR2A 4DLFA 1Q8AA 3EB2A 2NLIA 1KM0A 2WANA 1ECQA 3FYYA 1I2PA 4ZQMA 4CD6A 2E6AA 3ZJ8A 3UXDA 3PZGA 1KRBC 3W2JA 3W3OA 4KEZA 4C7GA 3OZOA 1J0JA 5C7HA 5KMYA 3QBUA 3CM4A 3N3MA 4L6HA 3TN3A 3N3TA 4PEEA 3CYVA 3MYOA 1XBYA 1VRXA 4F0RA 4WD0A 2G3JA 4H7VA 1ZB5A 5CZTA 3B0PA 4DM2A 1UKQA 4Q4PA 2BHUA 4HHLA 4UMAA 4NAFB 3BAJA 1Y65A 4O4VA 1JYWA 4JY9A 4P7OA 1EA9C 3OVGA 1OX6A 1VYRA 2P3ZA 1HJSA 4WY0F 1KWKA 1F9CA 1MMFA 3K8LA 3BC9A 1Q7QA 3TUUA 1XYLA 4YVVA 4J3VA 4E0CA 3LQGA 3QYSA 1KXHA 3I7SA 1K9DA 1K7FA 4HZ8A 4RR4A 3L23A 1Q6FA 1NP0A 2FGZA 4MY9A 3TZFA 3PR2A 5EMKA 3ZJ6A 2WLZA 4RDZA 1UOKA 5FF3A 5K4ZA 2GDQA 1OWQA 5KZDA 2QZRA 4Z17A 7REQA 4IPJA 4GYPA 4O19A 5CGQA 2HPMA 1V8EA 1D9EA 4RZ6A 3RDKA 2WCAA 1OC6A 4LUJA 5HATA 3ABZA 1JRCA 2VFIA 2VX5A 3S4TA 5F4SA 4UC5A 2V5DA 1GZ1A 1J5SA 1OT1A 2ZC8A 2DQWA 1JUEA 3CUXA 3WENA 3B8VA 1N82A 3LS9A 4XO7A 4YTQA 3W84A 2PF8A 3T81A 3S2CA 4FOKA 5C9XA 2HWGA 2PU0A 1W91A 3A64A 1FWSA 4XSLA 4KT2A 4JTEA 4E38A 1KFLA 4C7FA 2W79A 1KBBA 2Q71A 2X8RA 3NZ1A 5EMYA 1KM4A 1K6WA 3SSJA 4IP4A 1GOKA 4FAMA 2J9ZA 5HWNA 1R2TA 4AMCA 1BG9A 2C3ZA 4NG3A 4UQCA 1EO7A 5EMLA 3CQ0A 4CN4A 3W28A 1QU4A 1JR1A 4JTDA 4O13A 3UWZA 4YPJA 2WXDM 3P6LA 1NM9A 3XISA 1P1MA 5FACA 2ZX9A 1ZZMA 2WNNA 1JDFA 4QLJA 5A8PA 5CQ1A 2OLHA 4GY0A 5J04A 3W38A 3CIVA 1XR2A 3OQ8A 3DYOA 1W3TA 4GD0A 2W9MA 3WLJA 1TA3B 1H7WA 3SCOA 2CFFA 2UBPC 1TR1A 3NO5A 4TVCA 1H3GA 1A4MA 4LEFA 3WQ8A 1EYWA 4JN6A 5D9PA 4BI6A 1S39A 2GQAA 1KFEA 3W73A 5K3VA 4XZIA 1AMYA 3WLRA 3IV8A 1NAL1 2XIJA 3MJYA 4IZGA 1FBAA 2G37A 2DIEA 4ENLA 1EXBA 1F76A 1ECEA 3P84A 1E72M 1OYBA 3MDUA 2IW0A 2PDFA 3BUVA 5T9BG 1CENA 4AIUA 3AIUA 1RV8A 2R1LA 2WAGA 3QV6A 2NX9A 2PDWA 4C6JA 1J0KA 2Z1KA 4JTRA 3NEHA 2J66A 1C8YA 1JZ6A 1AW2A 4CNUA 3UY8A 2VELA 4UTTA 3W6MA 3G6MA 3OZPA 1GG0A 4AZBA 3LQLA 3W00A 2VEMA 3O7UA 1H1NA 2XIBA 3QPZA 3CZLA 1PVNA 3P7YA 4MY1A 1F7BA 3CAVA 3AOFA 1NSJA 2VUYA 2CHRA 2PB1A 4F48A 2G96A 1SSDA 3MS8A 3SQMA 4DWDA 2GQ8A 1XSJA 2C71A 3FSUA 4WIWA 3WEOA 4O0KA 1WBJA 4WJXA 2PGRA 5FOOA 4MDPA 3BWWA 2ABAA 3E96A 2GZXA 3VZXA 4LS1A 1VIZA 4GUGA 1E0VA 2WNWA 5FAGA 4M6QA 3TN6A 3SURA 4IFKA 4R7OA 1QFEA 3F4WA 1KBJA 3GAYA 3W7GA 6TAAA 2BTMA 5IBXC 4TIMA 1P0DA 3G1DA 4IUOA 1M68A 2INZA 4Z2LA 5F2MA 4EVZA 4V27A 4H6QA 1TV3A 1YW1A 1IEIA 3WLTA 3QN3A 3WQVA 3KTSA 2QCCA 3S5NA 3R94A 1FHVA 4H6KA 4L4MA 3FGCA 1V0KA 3ZJ7A 2CLKA 5FJJA 5HDRA 1EPXA 3OU8A 1R2RA 3BOLA 2XM1A 3TNOA 3NL5A 4GI8A 4QSHA 3D5HA 2VQTA 2YBVA 3VABA 2FGLA 5BXRA 5DQPA 4IM4A 5BMXA 4AIEA 1KCLA 4REQA 3FA3A 2R91A 1N2VA 5C70A 3HV9A 4JTCA 1PX4A 3ZVIA 1VR6A 3RRXA 3BAIA 2FPVA 2ZUWA 1P48A 4V1YA 5FJUA 4JGDA 3M7WA 4LYPA 2D73A 4BEQA 1S5NA 3IJ8A 2YL8A 4A8IA 1LCOA 4LC8A 3LOTA 1NOWA 3PZQA 2YYTA 1Z32X 3TTYA 1P5BA 3MMWA 1NWTA 3JZEA 1KBLA 5C71A 4MFEA 3LV5A 2CEQA 1DQUA 3CGTA 4UQEA 1LOQA 3A3XA 1TIWA 2PP1A 2W62A 1BVZA 1PZ2A 3E9AA 1QTWA 2C1IA 1E1EA 3SGZA 3ITGA 2QF7A 4CQCA 4AY1A 1E6NA 2A7RA 3PPFA 3C2VA 3L2LA 4EAYA 1LORA 2BHYA 4D6FA 3NVDA 1EOMA 2GWNA 1A47A 2VVNA 1F73A 1DJHA 6XIAA 2DW7A 5FF4A 1GHRA 3VIIA 4C6NA 1BRLA 4MOZA 3UERA 5LNUA 2NWRA 3FN9A 3M16A 3URBA 2IXVA 1GWJA 1A4LA 2ZQ0A 3FHAA 2J7FA 3E2VA 5GNZA 3TCSA 4IQLA 1HXJA 1UR0A 4YWIA 4JTHA 3STFA 1Q45A 4D6IA 3M4HA 1EIXA 3ZSTA 3KVMA 2FH6A 2BXVA 2OR2A 5AYBA 1TMHA 3MQTA 3QKZA 2FB2A 1SO4A 4GFSA 1QNVA 4DBUA 4H3DA 4R3UA 3NQCA 2VC9A 2NV2A 4S3JA 3TV8A 3LD5A 2XVKA 3VOIA 2ZX6A 4J3ZA 4IX0A 3GHRA 4B5WA 4Y7EA 3IV3A 1SZNA 1R46A 1S3HA 1RK6A 1HN1A 1WXZA 2YYUA 1EUAA 3ABSA 4IGNA 2E67A 4IFOA 1XLIA 4FXRA 1CI1A 1CZ1A 4WJ8A 1OFOA 4E3VA 1QATA 3SRDA 1Y5VA 3BLIA 4JS3A 1IZCA 3BH4A 4I5XA 4ATWA 1MSSA 2OYLA 3RRAA 4CD8A 4AEEA 1XF0A 5A6KA 4KESA 1M04A 5IFTA 4QQUA 2I7GA 5DCDA 3CMGA 1W1YA 3OG3A 1RUSA 4A21A 4OTKA 3FKRA 4N6FA 4NJGA 1I60A 3NQVA 2Y5SA 4WRHA 4CD7A 1AVAA 1B4EA 4JBRA 1DJIA 4UOQA 3G5EA 4KS0A 3EX1A 4TR9A 4B90A 1OABA 1XD1A 1OK4A 2W92A 4NVTA 4BQ3A 3B8DA 3G2GA 5AHMA 4GYKA 3TC3A 2PLJA 3GFYA 3MDWA 2E8ZA 4DXKA 4J1OA 2JKPA 3NM3A 1IIGA 3O16A 2ZX8A 2XFWA 4JTSA 4FHAA 1JPHA 1DTNA 1E5JA 4ZSTA 3UG8A 4JL1A 2A2IA 3CWHA 2ZWZA 3L4UA 4B4HA 1TPWA 1AJ0A 1AODA 4O1CA 5IBXA 4JFVA 2QJIA 3HV8A 1NTHA 1MUCA 2VP8A 3UJFA 1DL3A 2G5WA 1AH0A 1FWHC 4WDUA 1BVWA 2VENA 5AC8A 1DJZA 4C6MA 4DO6A 5A6LA 2AKMA 3QEZA 1G7VA 4Q6XA 4MWAE 4S2CA 3N9KA 4NHVA 4GNVA 2VRQA 1QK2A 3UETA 3OJGA 3A5VA 1E9IA 4AWTA 3ITXA 1EIBA 1IWBA 3WEZA 1OM0A 3BG5A 1SR9A 2PD9A 2JK2A 5IOBA 1XLJA 1JQXA 3WD4A 4LT9A 3B4YA 4NILA 4AF0B 4AHQA 3SRKA 1BKSA 2R6OA 3UR7A 5C8BB 4NZ3A 1U83A 4YYFA 3A3HA 2QPXA 2YR1A 1EGZA 1O1HA 4MNKA 3ARPA 2GVYA 1S1RA 4U5KA 2V5KA 2DIJA 3OG2A 3ZS4A 4UZUA 4DLMA 1Q6QA 2V6AA 4E5TA 1W56A 1G01A 1AJ2A 3V16A 4C6QA 3GB6A 1PIGA 4L9YA 4D6JA 1BF6A 3WG6A 4WEVX 1EB3A 2FTWA 3FJ6A 2DGAA 3MSRA 1G4EA 3KP0A 3PZUA 1F3XA 7CGTA 4MWAC 4EAMA 4DJEC 3R7MA 3SY5A 2UY3A 1DWIM 2SFPA 1I9CB 3QMTA 2QF8A 3N19B 4FXFA 2B81A 3IGXA 2NXHA 4O53A 4OBTA 5BNKA 4PL1A 4ZODA 2ISDA 2J7BA 2FZ8A 5HJXA 1MW1A 2XN0A 1DKWA 2PGWA 5BMWA 3LM3A 3F7JA 1WNOA 2Z2BA 2TAAA 2W5FA 3A6OA 1G0CA 1QI3A 2H90A 4AISA 2XSXA 2P53A 3GNXA 1EQPA 1V93A 3MUAA 4JYFA 5E09A 3NPUA 4N4QA 3VYLA 4PSPA 4QAIA 2PWHA 3A24A 3TXZA 4GXMA 5AHEA 3PUEA 3EX6A 1EX5A 4EACA 3VAVA 3RM4A 2X30A 1OGBA 1E0TA 4F8XA 5BU9A 1ISWA 2XFYA 2OXNA 3CV7A 2P0OA 3RU8X 1EOKA 1F61A 1GOMA 3TC7A 3RX2A 4GI6A 1X39A 2QCFA 1FXPA 4IOTA 4PCFA 1CGXA 1DXEA 3R79A 2BY2A 2WZIA 3CL6A 2FVKA 4R5EA 4H9VA 4FEZA 3H12A 1O5KA 2EPLX 2GGIA 4LQ1A 3EXRA 3VC5A 2E28A 3CB8A 4A3UA 3GC2A 3LMZA 5XINA 4DUXA 1Z69A 5CPSA 1DJGA 1A3XA 3WQEA 2YBUA 3QJAA 1A5MC 1KGUA 1RALA 3BLLA 2FB3A 1TJ0A 3PG8A 4AWUA 3CLWA 3E2SA 3WH6A 5HPOA 2V81A 1EBHA 3TTOA 2PCEA 2HQAA 3PF3A 1OVDA 3VGHA 1KBIA 1YX1A 4FNPA 1HNYA 3QR3A 4Q8PA 3O2LA 3NPVA 4CD4A 5HWMA 2DUAA 1ZJIA 1QHZA 3ATYA 4MKNA 1NY1A 5CG7A 1L9WA 3M41A 4MADA 3GNNA 5CBIA 1XSKA 1X7FA 4MJMA 5DMMA 3OLIA 3MBDA 4AW7A 4X3ZA 4O1EA 4PSRA 3APTA 1H09A 3DG3A 3NA8A 1E6ZA 5HNUA 3FLUA 3H7UA 4PH6A 3B8SA 4A8NA 3CIXA 2QV4A 1XLAA 2CZ5A 3C61A 5D33A 3GSMA 5I0DA 1VHCA 3G1HA 3QMRA 3GTHA 5LXXA 1RK5A 3TQKA 3BOXA 2XVPA 3DAQA 1V3KA 2VXNA 2E7FA 1MZHA 1KLYA 1EDQA 1TTPA 1PKYA 4BFAA 2RKXA 1V3IA 2OX1A 1MDLA 1CGWA 3GWQA 3MY9A 2VOTA 3AHXA 2PSNA 1K70A 4CD5A 2CW6A 1D8WA 3AO0A 4O11A 1XL9A 2TRSA 1UC4A 4ADTA 3TYAA 1GJWA 1JXJA 2WO5A 2VTFA 3MO7A 3B0UX 1DYSA 4Q8TA 2PDCA 3V1PA 4ROQA 1FY6A 4HD5A 4JIQA 2V5JA 1X98A 4Y90A 4LJ3A 3GU1A 3BJSA 3MBFA 1VD6A 1W8GA 1WZLA 2WV8A 2GK1B 1LYXA 5KINA 3NDYA 3G0XA 3SCTA 5KSWA 5E0FA 1FP8A 4N9DA 3WBWA 1RQEA 4LVBA 2OX4A 4O28A 3PTKA 1W3JA 2Z2UA 3BZGA 2YFNA 5AB3A 3L0GA 3LNPA 1EBGA 4D1IA 1L0PA 2YBTA 5REQA 2XPKA 4TMBA 4GCXA 5A8GA 3C3NA 4L61A 4XZWA 3LY0A 2O9OA 3GDKA 1NP2A 5ECUA 4R9XA 2H6RA 4E8CA 1QHPA 3LM7A 1XRSA 5HR6A 2IKIA 1YXDA 3H21A 2ZYFA 4LAZA 4ZXLA 2QCHA 2VR5A 3FY1A 2KAUC 3BDKA 3R10A 5BOOA 4MWAA 4UUIA 4DJEA 5I7GA 1HW6A 4DX3A 4U3AA 3TOYA 3O1NA 4DAIA 3VC6A 1HIZA 3H8AA 3M7SA 4IISA 1TV7A 4AHPA 3WF1A 4L9XA 3WH8A 3SI9A 1KCKA 3HMJG 3ICJA 3BE7A 4WXYA 3IACA 3HA1A 4H41A 1JF5A 1EHAA 5A8QA 4JX6A 4CCEA 3NUKA 2XM2A 5IM51 4AFYA 4E4PA 1QXLA 3PBMA 4BWLC 3OZMA 1J0HA 1H7OA 1VBUA 1VJSA 5BXTA 1ZENA 1Z8AA 3QHMA 2AGKA 1LTDA 4K8GA 5HULA 4AEFA 6REQB 3EKGA 3H2OA 1AH3A 5FJIA 1E55A 4F40A 5D2TA 3A4XA 3LLFA 1J0IA 3UCQA 1FX6A 1B54A 3DZ1A 1N7KA 1GW1A 1S2TA 4RK8A 1CIUA 4ZL1A 1L2UA 5LKYA 3UP8A 2VX6A 1VC4A 2ZE0A 3GZ3A 1XC6A 1EHNA 4GQ0A 4AVNA 2FQIA 2DZTA 4HU0A 4HN8A 4OBSA 1W2PA 3N11A 3RXZA 3VGBA 1K02A 3CHFA 2QCDA 3L21A 3H7RA 4HNCA 3BLOA 5BROA 4P7NA 1FWRA 4FF5A 3S2MA 4JZ5A 4IICA 2E68A 1X1OA 3MO4A 5BRBA 2Y8KA 1OCJA 4HN4A 3SCQA 2ATSA 4KFPA 3LBCA 1Q85A 2W91A 4O57A 2CKRA 5AYIA 4L4OA 1XCXA 4GY7A 4XO6A 1E6SM 3CK5A 2YDRA 4NIRA 4W86A 3EDFA 1KFCA 1XKYA 5FI8A 1XXXA 1TV5A 2HV5A 3ZQ9A 4DQWA 3W1AA 5I2UA 1JZ2A 1WB0A 4LEQA 1W17A 4MLRA 4XKYB 1OFBA 3H4XA 3CZJA 4CKQA 2VD8A 2IPJA 1Q3NA 1TCMA 4Q6JA 5I23A 1R87A 3ONCA 3PPCA 3LDVA 4M81A 3B9AA 4A3RA 4MJZA 1YNYA 3ZR4A 2RAGA 3BMVA 4XKYA 3KOFA 2FGBA 3V0SA 1TVNA 4EPDC 5A8OA 3QR1A 4GWEA 3FKKA 1D8CA 1F6KA 2G3MA 3AU6A 5I3KA 5H8MA 4ZTYA 2Y4SA 1XIIA 1SVDA 4NYUA 4GUIA 3WQCA 3XIMA 4IMFA 3KUMA 4L9ZA 3NYZA 4MF4A 4H9UA 4JFWA 1KQZA 1XLGA 1VIWA 3M43A 3DG7A 3WF4A 3MHGA 3R13A 3WDQA 4PMJA 1H0IA 1L6YA 5CJMA 1O1ZA 3VFLA 5D4YA 5EL1A 4DY1A 4XTIA 1JCTA 5D2YA 2WWCA 1R5YA 3W76A 3IGHX 4ZQCA 3A9BA 2E6DA 2CPUA 2QJJA 3W7CA 1PAMA 5CPOA 4WF7A 1CLVA 4YWSA 2CNCA 2Y7DA 4HSOA 1F3WA 5G2IA 3KAOA 3I6EA 2OT1A 1LM1A 3I7RA 3U9IA 3LRKA 2OOFA 2I9EA 2FYMA 4L7ZA 1FKWA 3OO2A 5GNYA 3MC5A 2HRWA 4NRSA 1ITQA 2YCIX 3PTDA 3ES7A 1MEWA 5C7VA 1A5BA 2JALA 4U10A 4LH8A 4LW7A 2I5IA 3S2JA 1Q4WA 1FCVA 3YPIA 3FIGA 1E1FA 3HG4A 2YW3A 3O05A 2V2DA 4DXVA 1P7TA 5I07A 3WN6A 2ZA3A 4XAPA 1MEIA 3FVDA 4HYVA 3VMPA 1Q13A 4LWWA 2HXTA 2G4FA 3PJUA 2DZSA 4LUIA 4HCDA 4PTDA 1GVRA 2XYLA 3PZTA 4ZOAA 3LGEA 3F2DA 5U4NA 1ONXA 1ZS2A 3B0YA 3ABQA 1ZL1A 1W5QA 2IPWA 3MKKA 4U2ZA 5AECA 3TFCA 4LUTA 3DGRA 2YKKA 3W27A 4MAVA 3L66A 2YOCA 1GJUA 2VFGA 1JGMA 1G7UA 2VO5A 3QGKC 3KHJA 3RILA 3H4GA 2BY0A 4JFUA 1ZHAA 1L8NA 4XZ9A 3W1MA 4JHMA 2ISVA 1ZJHA 4M7SA 3MHFA 4AD0A 1R0MA 4B3ZA 4DF1A 2E40A 1XIHA 1XP3A 1VCVA 2RUSA 1ITUA 3IPWA 3DFPA 2NVCA 2XSBA 3APGA 4BWLA 1YIXA 1XYMA 1UH4A 5TAOA 5D32A 3RPMA 3TA6A 5G2HA 4ACZA 2D3NA 4TTUA 4S39A 2INEA 1SZEA 3ABRA 4NZ1A 3P5YA 1N8FA 3W53A 2ZUNA 4UCGA 2NX3A 2UV8G 4BR1A 1UP3A 2HZGA 1J18A 4XWUA 1CBGA 3S5ZA 3KOWA 1V77A 2YXXA 4PRTA 2A6LA 5F7UA 1TYGA 1DIKA 1DQXA 5EBUA 4WLCA 4NI8A 5LXEA 4JFSA 3N12A 4V2XA 3ZZ1A 3WNPA 3CT7A 4BF9A 5BOFA 1DIDA 4E6MA 5LYRA 4BHYA 1EF3A 2HE5A 4GZEA 4NJIA 1H1ZA 4DO7A 2E09A 3PC0A 3UBPC 5AC7A 1UZ1A 1G4SA 4Y8EA 3CWNA 4I9TA 1YPIA 2DT1A 2A1YA 3WD0A 2AAMA 1J01A 1MRAA 2O7QA 4D2JA 1H2JA 3LHUA 2VD9A 4V1XA 4Y9OA 5CH9A 1NFBA 4OOUA 4LBUA 3WUBA 2G3NA 5GJMA 4YCPA 4KCUA 3ZWSA 1XSIA 4HOWA 2PFHA 3VNKA 1KRMA 2NW0A 1TZZA 1POKA 3AZTA 2AQOA 2PRHA 2GSJA 3HZ3A 4QLKA 4AZGA 2CCRA 4QS5A 3JZUA 4D8LA 3M0JA 3C2YA 3KL5A 4AZ6A 4FO4A 4QLLA 2QAFA 2NUYA 3ANYA 4ZO8A 2FHFA 1HL2A 4MZYA 2VRJA 3CL7A 4ERIA 4UQ9A 2WJDA 3R4IA 5HANA 3UXAA 2FZDA 3EOLA 3GBEA 2A3BA 3DC8A 1E4IA 2DT2A 5MKGB 4PUMA 2YCEA 3IJDA 3PBGA 3QY6A 2X40A 1I75A 3MMUA 3TSMA 5CC3A 3BSMA 1JZ3A 1UPMB 4H00A 1KKRA 3UGVA 1E4NA 4CVUA 1T8QA 1S5WA 3EWZA 1V02A 3RM9A 4PB3A 4QE5A 4XZMX 5D38A 2DW6A 4MJ4A 2HDJA 4B5XA 1GOWA 2OEMA 5B7YA 3AU2A 4PUWA 4PUUA 3W7KA 2DSKA 2TSYA 1NJJA 3U5YA 2GYIA 1ITXA 4XISA 3ATZA 3NSNA 3N73A 4HPGA 2YIHA 3P2VA 4DJFC 2DY3A 3CUJA 1I1WA 3W4RA 2ZXBA 1TTQA 1SU5A 2WZHA 2OTDA 1SZFA 4HNUA 4JQ2A 1IWAA 1UHVA 4F79A 4GH1A 1LZOA 1KM6A 2FH8A 3BO9A 4LV4A 3TYBA 2HK0A 2Z26A 1XM3A 3H24A 2J74A 4HTYA 1O5QA 3GNRA 3LPFA 4AZHA 3G0UA 2F9RA 3TJXA 1V3HA 2PEVA 2XVGA 1F4AA 3BICA 3IJQA 4HHMA 4Q4QA 1ZUAX 4FZIA 4FR6A 1HTIA 1E6RA 1KFJA 3O8AA 3W2NA 3AHTA 4QDPA 1ME8A 3KRZA 2ZWYA 3EXSA 1FHDA 4M24A 3VKBA 4PMDA 3N2BA 2ACUA 2TODA 1HT6A 2VDHA 4NZCA 1TPEA 2HROA 2E6FA 1BYCA 2DUZA 1KXVA 3BMXA 3G0SA 2WSYA 2BOFX 2H9AB 1PTDA 2QUTA 3SUSA 4YVXA 5A6MA 4A3QA 2CLFA 3VOCA 2YLLA 1XBZA 3FA5A 2YLAA 1YADA 2DPEA 1CCWB 4C5ZA 4P7QA 1J0ZA 1VYSX 3R2GA 3AIEA 4FSAA 4NZJA 5D03A 2E9BA 3GE7A 5GNXA 2ESCA 2EGZA 2HJPA 1V08A 1SPQA 2CZVA 1VBJA 4WK9A 3F5LA 3S1XA 4CU7A 1RXOB 1TTJA 2RJGA 3LHWA 2PODA 5C2XA 4ATLA 1TWSA 2PS2A 4HA3A 4OBRA 1JPMA 4HHPA 3VGFA 5A2AA 3WNMA 4KIEA 1W9XA 3PWAA 1ODZA 4JHOA 2Y7GA 1MNZA 3OA5A 1JCNA 1WXJA 3CUFA 4FLSA 4LRTA 2F61A 1KRAC 2QYGA 1EJWC 3RM8A 2NQ5A 3GXTA 3TJIA 1M7JA 3OBEA 4XD5A 1H41A 1ZRQA 4ZEPA 2ACSA 3SW6A 1RSCA 1RCXB 1Y5XA 3BL3A 1KQYA 2FJUB 3BLFA 3GDLA 4KRUA 2VM8A 4F0KA 1QW8A 3ARRA 4IL2A 1ONEA 4J4KA 3WJSA 2RH9A 2XINA 9XIMA 2Z2AA 3HG5A 5KITA 1R38A 4M6UA 1DWAM 4FX8A 4LUYA 4WOZA 2V69A 5EFFA 2E8YA 3LTYA 3WUEA 5CJ5A 1EO5A 3QLDA 3OPSA 3RN6A 3GDTA 4CN6A 2PWFA 3RO6A 3D0CA 5T9CE 2C7FA 4E2DA 2ZXAA 3DKLA 2AQVA 2GOUA 3DECA 1IZKA 2I16A 1A5LC 4JD4A 5M5DA 4H19A 1UR4A 4RNHA 3LPGA 5HMEA 4YTRA 3IGUA 4JN7A 1PZ1A 4S3BA 4XQ6A 1O6IA 3WX7A 5C54A 3M1ZA 3ARQA 1F4HA 2PRLA 3FXGA 4KF1A 2W61A 2OVLA 5SWUA 1TZ7A 3SN1A 3OYXA 1VCFA 1UA7A 4XVDA 4F66A 3HO8A 2DJXA 4LB4A 1S5VA 1XYFA 2V63A 3TR9A 3W2LA 3G3DA 3PZMA 2Q3OA 4AVFA 1IV8A 1GVOA 4ADUA 3G77A 3GS6A 1JCXA 4W7UA 4CNOA 3TYUA 2RJHA 3NPWA 1KXQA 1B3VA 3CMJA 5LNRA 1BYBA 2EHHA 2VGGA 1E1CB 3MP3A 5CGMA 1RQHA 4IP7A 4W85A 3MMTA 2AQWA 3K8KA 3MI2A 2OWWA 1HKWA 3SBFA 2V3DA 1EJRC 2C0HA 5JIPA 4GC4A 1AA1B 5ABEA 3B3DA 3UR2A 1C91A 4AMAA 3DFNA 1VCGA 1WKYA 1KGWA 1TR9A 2V0TA 2MUCA 3MWCA 1ZBCA 4OE7A 3G3MA 1V5XA 1TG7A 2VHLA 2WLYA 3PZIA 2H8ZA 5HINA 4H7ZA 1XHGA 2VGBA 1FH9A 3IAPA 4DJFA 2WSRA 3RO8A 3AQUA 4M8UA 2BXZA 3OVQA 1MUWA 3ZXWA 1DIOA 1AL7A 3DCPA 1P4CA 1H5VA 4US5A 1YTEA 4O8AA 3IWPA 3A4AA 1V6UA 1R47A 1H1YA 1JULA 1GONA 4JTAA 1W0MA 3IUDA 2ZRUA 1ISVA 3CIWA 1E5NA 4GGHA 2WMIB 3STGA 3HQPA 4Q8UA 3AHZA 2C19A 4N9BA 3XINA 4JX5A 4AD2A 4DJED 5BOEA 3MV11 2XGZA 3WUGA 4LANA 1YXCA 2D2GA 2YCLB 2EXOA 4G1KA 3OGRA 3E3HA 2H3DA 3N34A 3PP7A 4HNTA 3NSXA 3IIXA 3QW4B 4BI5A 5A94A 3P61A 1UUQA 1L8PA 3GKAA 3BARA 3SCPA 1VJZA 3NXFA 3D6NA 3WQ6A 3WDRA 3EEZA 5JUVA 4H04A 4Y8FA 4UCFA 3BAYA 1J2BA 1XLFA 1UWUA 1AQFA 1FHUA 2A0NA 3MA8A 3KBSA 3WNKA 1RZMA 1SZGA 3GRIA 4IJCA 1IXNA 1LL7A 3V0UA 1DHPA 1IE7C 1F8IA 4ZGYA 5DBUA 2HVOA 3K2GA 2ACRA 2J25A 2X1UA 4I7WA 4W8BA 4PA8A 3WJXA 3HFTA 5LA2A 2OO0A 1EEXA 1XYBA 4S3CA 4DN1A 2Y63A 1YPXA 4W5ZA 7A3HA 3VNMA 1CGVA 5KZ6A 1GVSA 2ZZ6A 1PJ9A 3WFAA 4MMWA 4Z2KA 4CNSA 3B06A 2VKZG 4KWOA 3E0FA 4MNLA 2Q01A 2QUUA 1OZMA 4J40A 4BQ5A 1FCBA 3LX9A 2G8ZA 3BLKA 4Z1AA 2Z6JA 5BWFA 1VFUA 5JIWA 4L4LA 1TIMA 4QFUA 3PTQA 4YTTA 4DWSB 3W25A 3GFZA 3PZ9A 3QR0A 1E3XA 3BZJA 4RXGA 1F6YA 3OVPA 3LRLA 1VRDA 1RH9A 5A6SA 3BCDA 2P10A 2V5BA 2C8NA 5ECVA 4QGCA 4GG9A 3PJWA 3GVQA 5CZKA 4QP0A 1IXPA 2FMOA 3VGEA 3TYZA 4YMZA 5CPMA 1KFKA 2VZOA 3GUGA 1YKWA 1LUCB 1IR2A 1CT5A 3D3AA 1H7RA 4C5YA 3VIGA 3IVUA 1HJXA 3RK8A 4F9DA 1WDDA 1GVYA 3N17A 1LT8A 3CB3A 4DYJA 1UMYA 1FH7A 3W1LA 3ABXA 1HKVA 1LUCA 1QHOA 3FCPA 3U57A 4Q8OA 1D7KA 1UROA 2RGMA 1ZP4A 4BEUA 3G8RA 3POHA 1NF0A 3R12A 1EC8A 3SGGA 3TW6A 4D6EA 1DBTA 3RLVA 1W54A 4N0RA 3N6JA 2FFCA 3ZT5A 3P3BA 4A8LA 3B8UA 1DJYA 4QRNA 3STPA 4PEKA 2E3ZA 3H2EA 2Y8UA 5CCZA 4A29A 1HJVA 2WSPA 1Y0EA 4WHBA 2EKCA 3W82A 4PUNA 3S83A 3GTIA 2FVMA 1B3XA 3EMCA 3UJEA 4FLRA 1C9WA 5FEPA 2PCQA 1PDYA 3AIQA 1TRDA 1XIFA 1ONRA 2EAWA 3RR1A 4ORIA 4DB7A 1BYAA 4GIEA 1R2SA 4UFHA 4GYFA 5M3WA 4MFDA 3SCUA 2FZ9A 5I79A 2J75A 1YDVA 1TPC1 1TV4A 3UZJA 1DVJA 2J27A 3O0FA 3AZRA 1TX0A 5AY7A 4DBEA 4HHHA 1Z9AA 3M0ZA 1B90A 3PUOA 3WMSA 1V3JA 4LTSA 3KVKA 1R3YA 1OBAA 1ZAIA 1JCLA 4ZFMA 5EBAA 1RP8A 3ITLA 1PB0A 3MP5A 3E0VA 1QPOA 4AC1X 2FMNA 2GUYA 4HJFA 1OINA 4C1NA 1UKSA 1ZPTA 3ISIX 1NOFA 1W9VA 1PTGA 3CHCA 7TAAA 1FWGC 2BSLA 2RDUA 5EYWA 4QITA 4LYQA 3O06A 3UEQA 1EZ2A 3KRUA 3CEPA 4QEHA 3ZLGA 3VDBA 2GVGA 2OOGA 5G1YA 3G8EA 3AYSA 4F0HA 1H49A 1W5MA 1E0WA 4WKFA 4N9CA 2Z4GA 3KVJA 4C90A 2EPKX 1VFLA 1FDJA 4X0VA 3WY1A 1K8ZA 3UCCA 1RA0A 3OA3A 4ZOCA 5CC5A 1XIMA 2O9TA 4B3LA 4HZ7A 1UG6A 1X6LA 4EOUA 1W1VA 1E56A 3VILA 3I6TA 3AMLA 3FS2A 4FXSA 1BWKA 1RHCA 3CUIA 1ICPA 1W3KA 2C13A 2GSEA 3A4JA 4NI3A 4WGXA 1TPB1 1Z89A 4CCZA 2Y7EA 4P8XA 4AUBA 3F4CA 4N7QA 3E74A 1P1XA 1UR3M 2V2CA 4ZA0A 3FAXA 1D2KA 2Y5JA 1OFAA 3Q67A 1B0IA 4I9AA 5FKYA 4IIFA 5AN7A 2NQZA 3HN3A 4ZQOA 3MT1A 5TD4A 3LCHA 4G8TA 1QI2A 2QGHA 4IQDA 1WUEA 4X9SA 1P0NA 5I03A 3CL8A 1PSCA 1LLZA 3U7VA 3DHPA 1PDZA 4JCLA 4Q7NA 3L67A 3UJSA 2ACQA 3T9PA 2DSWA 3SO7A 3BAXA 1RBLA 3DBNA 2PMQA 3LEPA 1EC7A 2EKGA 5FA5A 1KB3A 1GJPA 1B9ZA 2B4GA 2HVMA 4XX6A 2Y5EA 3GO2A 1XFCA 4AYSA 2IQ0A 3UT0A 2P76A 4KRTA 3QOKA 5D9OA 4KGJA 3ECQA 3PULA 1IEWA 1JI2A 3TTQA 3TJ4A 2JBMA 4GUHA 2PTYA 4GLEA 3SRFA 2NQLA 3PK7A 3M0IA 5I3FA 2PDXA 4QG6A 3L9CA 3QSRA 5HQLA 1EJXC 3NQGA 3LI0A 3KCOA 1LQ2A 4EP8C 2WM0A 4XD6A 1IWPA 4IX2A 1UMLA 4DELA 2YL9A 2XUCA 3NQ7A 1FWDC 5EFDA 1GZJA 4M6PA 3K13A 2GWGA 1QPNA 4US6A 2ZRWA 3C2EA 1XH1A 3QGAC 3TYCA 4MLJA 4GIYA 1WDQA 1UD3A 1ZJBA 2CHNA 3URAA 3PBYA 4GYJA 5GQBA 4EF8A 1J2WA 3TW7A 4YXGA 2BS9A 4AD3A 1V0MA 1O7AA 3W1UA 3W71A 2VZVA 3WZ0E 3WD3A 4MYAA 1FWJC 2OU4A 3BXWA 1OX5A 4XVEA 3HPXA 9XIAA 4E8GA 3P5ZA 5LIXX 5HUPA 3JUGA 2WMGA 3UWWA 1JZ4A 1BF2A 2D3LA 4HVXA 2BLEA 1XUZA 3GFXA 4RNIA 1PHWA 2F38A 5E5CA 1N8IA 3AMCA 1LL6A 3HJEA 1TV2A 3H4WA 4DI8A 5AYYA 2X09A 3W6YA 4KKXA 5HWJA 2VCCA 3ZR5A 1PX8A 7PTDA 4NASA 1I4NA 4MUZA 1P6WA 1C9DA 1LLOA 2ZZ1A 2V2HA 3KCJA 1JQVA 3H55A 4WKHA 3VIPA 1YYAA 1GOOA 3WMCA 4L4PA 3UVAA 3KWSA 4IUGA 4O4WA 3M5YA 4GXWA 4IWWA 4O0QA 2ZIDA 3TP4A 1R6WA 2WMHA 2HMCA 2QT3A 4JL2A 4Z08A 4O50A 3WLQA 3S6TA 1T5AA 3EDKA 3UZZA 5DF0A 1G94A 4ZB5A 1T96A 3KP1A 3DX5A 5HJLA 3E12A 4GCAA 1ADDA 4H83A 3M6DA 3SCSA 4YYCA 3AJ7A 3L4XA 2D2HA 3GVRA 4KWVA 4F0LA 5TBOA 3A47A 2ON3A 2GL5A 4G7EA 3WF2A 1OF8A 2EQDA 4QQ3A 3O0KA 2Z25A 4AAJA 3BV4A 1V51A 1VYPX 3VD7A 4UFIA 5ENLA 4LUSA 3S47A 5DCEA 1T41A 3HQ1A 1MXSA 1DV7A 3WBEA 1NDWA 4EXQA 1HJQA 3P93A 2ZXDA 2E4TA 4AD4A 2X2GA 2IMRA 3EXTA 5MHBA 1J93A 3GXMA 2ZRYA 3MUZ1 3W1TA 1ONWA 1K9FA 4R9OA 3LXBA 3SY8A 1VLIA 1E70M 2GJLA 3B8IA 4G7FA 4AXNA 2I9UA 5CAHA 4X61A 3CUHA 2IKGA 2WMJA 1QDSA 3CH0A 6A3HA 1BTCA 3CPGA 4HT3A 4ICCX 1U2YA 3UW6A 3A21A 4UOJA 1FWWA 1FDYA 3OQEA 3UZYA 4DZHA 4AVOA 2Y7FA 3MKCA 2J7HA 4E2BA 4HU3A 3SUWA 3TMLA 4I9MA 5C6MA 3GZAA 4DNMA 3VD9A 1VGAA 3VTRA 3OHMB 2BMBA 4HMNA 2J6XA 4GYPC 5I3DA 3AS3A 3L4ZA 1KCXA 2CLMA 4LF1A 2PDKA 2ZICA 4Q32A 5AZ0A 2YSWA 4E2VA 3S1WA 3LTPA 3HM7A 3M0YA 1HJUA 1ZBKA 4WY0B 1H7XA 1UH2A 1XW8A 3WMBA 5CPTA 2PDUA 3T0BA 2ZE3A 1PIFA 2YX0A 2ALRA 5KETA 3S9ZA 3C86A 4LVFA 4D1JA 2JE8A 4HIBA 3BGGA 2HBXA 4B5SA 3UF9A 1DTUA 2WBGA 4CEXC 3QSTA 1SW7A 4MKSA 1BG4A 1O68A 2CERA 2C16A 4FLOA 4JTKA 1M3UA 2D22A 3NQ2A 1XGEA 2PDLA 2ALDA 2PP3A 3GDMA 2YPIA 2BX7A 2HSAA 3SADA 5DANA 1GOIA 1VHNA 1WZKA 1L2QA 5EMUA 4GVHA 4RW3A 4Z2JA 1AD4A 1M7OA 3OBKA 3TIMA 3LCFA 5ABGA 2W4XA 1LOLA 6PTDA 4QNEA 1F2JA 5A95A 3MVTA 3C2FA 3IVSA 3NQFA 3GXDA 3VOFA 4LC6A 1R9YA 1OGGA 3G24A 1NWRA 1MQRA 4Q8VA 5A1AA 3WLLA 4ORMA 4HNOA 4AEOA 4O1FA 4H4IA 1M53A 4G5DA 4QCFA 1TTIA 2OFJA 4AZIA 3CZKA 4A6GA 2WJEA 4GY1A 4PR4A 1AJZA 1I2OA 1OFEA 1BYDA 2HXUA 3P74A 1XYZA 3M9YA 4LAUA 3W7HA 4WDWA 1VP5A 2VWSA 5DT7A 3QV7A 4LCSA 1GNXA 1OG6A 3FDGA 4DJFD 5E70A 3ZFHA 3PN8A 4DZ5A 1GVIA 3P0WA 3PUDA 4GK8A 5J5RA 1EPVA 3QQWA 2WVUA 3T1GA 1B57A 4A22A 4IG2A 4P2VA 3I3BA 4US5D 3IANA 4OGZA 2WPGA 3NAVA 3GVVA 3DERA 3VKAA 3EPMA 4D72A 2XDFA 3WMLA 3GIYA 5HA7A 2I57A 1WKEA 5A6TC 4UTTC 3R0DA 2VEPA 5C5YA 3KLLA 3SQSA 3UR5A 2GJPA 2W66A 2B7QA 2GVJA 1OF6A 3CQJA 3CZGA 3ITVA 4C7DA 1C8VA 3CZEA 3SJ3A 4GUFA 4D8ZA 2FDSA 5D2XA 5EMJA 4RV8A 5BW6A 5HXMA 3U4AA 2J24A 4MUPA 1GG1A 4KWSA 1EC9A 1VAHA 1W37A 2NUWA 3KOZA 1Q2SA 4LU0A 3NSMA 1A5OC 4KMQA 1UJQA 1WZAA 5I06A 4IMGA 2I56A 3IIOA 3K4AA 1XINA 1K4HA 3THQA 2DDXA 2A3HA 2WZEA 1O12A 3LB0A 1GZGA 3QQ1A 3KZPA 3MHUA 2WK2A 2LLEA 2NT1A 3PFMA 3SM0A 4O8RA 3W87A 3LLDA 4IFRA 3SN4A 3WJZA 4KETA 1JGIA 5FF7A 4J35A 4NKCA 3IUIA 2HNHA 1R30A 4GVFA 1C90A 1J96A 3FFSA 5DMLA 4Z0JA 4OECA 3T2OA 3VKDA 4UNKA 4BA0A 4S3AA 1A5CA 3S42A 3UWVA 5K9XA 5HPCA 3U7BA 3NDZA 5C2CA 4LXFA 1DEDA 1DIEA 3DHUA 4HGXA 4C91A 1X8CA 3FW6A 1RLCL 5HK4A 4JX4A 4AZ7A 1S2CA 1MRQA 3URQA 3VD5A 3BGJA 3RLHA 4KCWA 1SJBA 1Y8BA 3SFKA 4B5NA 2GVLA 7REQB 5L6UA 4RNJA 3UU0A 4EXAA 4K1WA 4BS0A 1LWJA 5A8NA 3TOPA 2WB5A 4I6VA 1IEXA 2E5DA 5PTDA 4J3XA 3EB4A 2WMKA 4XUYA 3IJ6A 1ICQA 5A3HA 2CLHA 3KFTA 2Q8LA 3DFOA 3W01A 4QE4A 2V8ZA 1JNEA 3CAKA 1R3TA 3SY1A 4C1LA 2OSYA 3NIYA 4GGBA 2PC4A 5BXSA 2O92A 4DWSD 3CNYA 1A3WA 1RD6A 2OEKA 2YCKX 3VO0A 3VZYA 1I1XA 1MW0A 4IMAA 5H8UA 1NDVA 4AY8A 4HZMA 1V6XA 5G1MA 4Z2IA 3GNDA 3N2CA 5F2LA 3RIKA 1DHKA 2BB0A 2J62A 1REQA 1C3FA 4IPNB 5TQLA 4C6OA 3JVAA 2PWDA 4HPHA 1BQCA 3TKFA 5DN1A 4XBKA 2ABBA 1VENA 4ERGA 2VT0A 3DU0A 1JYVA 4L1GA 1TWZA 4NX0A 5FJRA 4JTGA 2QR6A 2OQYA 4ML9A 3WDJA 1NF7A 1TKKA 1JL8A 2Q02A 3WD1A 1EQCA 4F3HA 3CV6A 2DV0A 3SUTA 3W7PA 1PKMA 1G9HA 3HB9A 2OYMA 3WFLA 3ANVA 4PRRA 2WVVA 1KA9F 3N18A 3QH2A 4JQ3A 1JDEA 1NWUA 2EF9A 4U28A 3R8HA 1ZALA 1BXCA 3T44A 4PMZA 1KLZA 2IQTA 3SUVA 3ERPA 3KXQA 1GVEA 4H7CA 3W9ZA 4UNIA 3W1QA 1SZRA 1Q66A 3WQ5A 1GGOA 3OYZA 4X2PA 1SR0A 4Z42C 2EPMX 3VX1A 1HFBA 3HG3A 2PDPA 1UBPC 3QV9A 4KERA 1XPGA 1EP1A 1H11A 3W72A 3WD2A 2C15A 2OGJA 3V3WA 3K30A 3NR0A 1ZSXA 4UZSA 3W1RA 1Q7ZA 1OFDA 4MB5A 1UWAA 1TB3A 5D2VA 2UY4A 2Y6ZA 4Y2WA 4PZVA 1XQKA 2JKAA 3ZYZA 5JMUA 3CHVA 4QCEA 2EPHA 2G4JA 1DPMA 1RBOB 3W88A 2XZ7A 4D6GA 1CPUA 4GKLA 3B0VC 2JEPA 4MSSA 2QNEA 2DZPA 5AHFA 2XH7A 4IMCA 5DBTA 1ADOA 4WVXA 5LIWX 2VC7A 3BOFA 1LF1A 1CGTA 3EA2A 5HR7A 2PDBA 2ZOXA 1LBLA 2ISSA 4I7VA 5I3IA 2F6UA 1XLKA 1BSIA 4ZOEA 3AHYA 1VFTA 2J8GA 3EBVA 3B0XA 2CETA 4XD3A 4LYRA 1QK0A 1A0CA 4I90A 3OVRA 3ITYA 3VUSA 3BG9A 5I5RA 2YJQA 4IFKB 5K2ZA 4XIAA 2DZUA 2GJXA 4WOQA 3G22A 4AQLA 3W37A 4Q4RA 2BGSA 1YNQA 1ZY9A 5JXQA 4DUWA 2DH2A 1Z6KA 1RLDA 3GG8A 4KCTA 3PSWA 5DELA 1HGWA 2ATMA 4OQVA 4GINA 4UMCA 4DBSA 5G5IA 3UJ2A 5F1UA 4QTGA 2PUZA 1K9TA 3PHAA 2V82A 3MWAA 1XDJA 4WCJA 4DXXA 4Z1BA 3FGCB 3MYPA 3R25A 3LMYA 3RPDA 2WC4A 1W1B1 3BAKA 4PC8A 2VEFA 4ZBCA 3FJNA 5HNTA 4JFTA 3OIXA 1ELSA 5K9DA 1JNDA 1UA3A 4REQB 4MGGA 3G1RA 3PPGA 1XIEA 3F4VA 1UD6A 3IAQA 2NUXA 4W89A 3LENA 3I3EA 1SMAA 3ITCA 4Z2HA 5LHEA 1HP4A 1HQTA 2EG7A 4YL2A 4D8AA 3IGSA 2VFEA 4WSJA 3TN5A 4NZ5A 3T4CA 2R1MA 3PB0A 1ZAHA 4CNPA 3LK6A 1EX1A 2GQ3A 1GVQA 2NVAA 4S1FA 4PE8A 1OYAA 5FEZA 4Y6GA 4LAMA 3K1DA 3KW3A 5G2WA 2DSVA 2VX4A 3VNIA 1NU5A 5LZLA 4KFNA 3UWEA 1VBRA 1OYCA 1KFBA 5JU6A 1EDGA 4K1GA 2CXEA 1QOXA 4GIRA 4ICNA 3AS0A 4ZXOA 1CXFA 3FYOA 2F8QA 4S23A 4GFIA 5IRPA 4Q22A 2REQB 5I77A 1WE5A 3LA4A 4W88A 1V3LA 2XZ9A 3WELA 2BGQA 3NNTA 1AQMA 3TN4A 1VFMA 3IS4A 3UG3A 2PWVA 1BRLB 2REQA 1Z44A 2X1IA 3CC1A 2F7FA 1K6AA 1AMKA 5DRIA 3IJ9A 4NNAA 4MJ2A 2DUXA 1NWSA 1CYGA 3PM6A 1WCGA 4C6BA 4IGHA 3TWAA 1NFPA 1IIHA 1F74A 1GPWA 4QG9A 4J2MA 3L4WA 4PBFA 2PGEA 2D69A 2DZWA 3DBPA 2G97A 4MAZA 4M51A 1W1TA 4OWGA 2HCVA 5LA0A 2C6QA 1Q5MA 4UBPC 1E43A 2PE4A 4H2CA 4DF0A 3O3RA 5FAJA 3TX9A 2JGQA 4JQ4A 5LNSA 2O55A 1JD9A 1KFWA 3LLXA 5CZ0A 3UGRA 1XQLA 4W7VA 1QI4A 2WJFA 4HCHA 1TQXA 4MG4A 1HF6A 3Q45A 1KM1A 4UR9A 1T8XA 2BASA 4H8UA 3GIQA 2F2HA 3WCZA 5MF5A 4QE1A 3OLGA 2FLIA 3FEQA 4PTWA 3UA3A 3UG5A 4JIHA 4JNMA 4O0ZA 1I45A 3GX9A 3VD4A 1DJNA 1PE1A 3N2OA 3QRHA 2JIEA 2J7CA 2ZRZA 3LSBA 1GT8A 3G1SA 3W7JA 5FEWA 2CWNA 4TOQA 4DO5A 5HQMA 4LY8A 2G3IA 1CGYA 1XPYA 2HBVA 3BSHA 4IPPA 2NQ9A 3FAWA 3ES8A 4ACYA 2AL1A 2BDQA 2WNQA 1M7PA 3BGAA 1MW2A 3HG2A 1YEYA 2YXOA 2ZBTA 3ENLA 4B5VA 4QBXA 2D20A 4O17A 5T26A 4G56A 2QCNA 3GR4A 2I1OA 4RNFA 1FXQA 2J77A 3BG3A 1XS2A 3PB2A 3UWQA 3CEUA 3CTLA 4J7RA 3L5LA 1OFQA 3KDOA 4KGLA 2DORA 3WQFA 4D6CA 3HGSA 1J79A 3RCYA 2CLEA