1C90A

Endo-beta-n-acetylglucosaminidase h, e132q mutant
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
265
structure length
265
Chain Sequence
KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFDDQYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H
publication title Mutations of endo-beta-N-acetylglucosaminidase H active site residues Assp130 and Glu132: activities and conformations.
pubmed rcsb
source organism Streptomyces plicatus
total genus 95
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1999-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1c90A00
2WZHA 2A3HA 3EBVA 2V38A 3OGSA 3SIMA 1AQHA 3ZQ9A 4PMRA 5E6YA 2J7BA 2WXDM 4JL1A 3BMVA 3N12A 1JZ7A 1ODUA 4LYRA 4QLJA 4UFHA 3SCPA 2VZUA 1CGYA 3K8MA 1QPKA 4Q22A 1W1PA 1BF2A 1J0IA 1HP4A 3KE0A 5FL0A 1SMDA 2FH8A 1HF6A 3AMCA 3IJ8A 3SCWA 1UZ4A 4F66A 1XRVA 3QOMA 3CGTA 2BVYA 3B9DA 3BAKA 4CVWA 4Z2IA 3N04A 5E70A 3WH9A 2D0FA 3W53A 2UWFA 1RH9A 1QI4A 1CPUA 3N18A 1H11A 2IXVA 2GUYA 3AICA 4JHZA 1UYQA 4KMQA 3W37A 1EA9C 1BG9A 1IT0A 5I23A 2VUYA 4YHEA 3RJXA 1ZL1A 2NT1A 4BZYA 2ZOXA 1E71M 3CHFA 3WEZA 4W87A 1E4LA 8A3HA 3VUPA 3DHUA 4HTYA 1HKKA 3ZJKA 3ZJ7A 2QLYA 5FKYA 2CBUA 4UR9A 3VX1A 1EH9A 4OUEA 2X8RA 1UZ1A 1KBKA 2BVDA 2A3AA 1MXGA 1FHLA 2X0YA 4MB3A 3OGVA 4ZXOA 3SCOA 4MB4A 3EYPA 5DEZA 3LPFA 2OWWA 3W25A 1U30A 3GTNA 1YHTA 1H09A 3IAPA 4UFLA 4CD5A 3RM8A 4BQ5A 5ABFB 1D7FA 3WEOA 2ZX8A 1CNVA 3RPMA 4W84A 3DECA 2QHAA 3OZPA 1NWTA 5JBDA 4A3HA 3WQWA 3WN6A 2WPGA 3UG4A 2J7DA 1W1YA 4JCMA 1HJWA 4TVUA 4RL3A 2WKGA 5A2AA 3W27A 2G3MA 3AS0A 4AXNA 1GORA 3T2PA 4ATLA 3AZSA 1B90A 1E40A 1UWTA 1HJUA 1PEZA 1KCLA 3MUIA 5FOOA 1P6WA 1B0IA 1KQZA 1U2YA 4D72A 1W9UA 1OINA 1ISZA 3AMDA 5BXTA 3HU7A 2JALA 1XCXA 2J7HA 3PZVA 6A3HA 5AY7A 2PC8A 4OOUA 4PUEA 3WNOA 1PBGA 1W9XA 3W81A 2WVVB 2Y4SA 3N11A 1LL7A 4U33A 2JF6A 3FW6A 1MYRA 1X1NA 2BHYA 2PWEA 1K6AA 2ESCA 2ZWZA 3T0DA 5GNXA 5AC5A 5D9PA 1J01A 4W85A 2CBJA 3OGRA 1I1XA 3FHAA 2WBKA 5CSYA 1HVXA 4WJXA 3BC9A 2QPSA 3WQ8A 1UR2A 2YLLA 4OKDA 1M03A 1J9YA 4CD8A 5FD0A 2X05A 1EXPA 1E15A 1HJQA 3IJ7A 5C70A 3BSGA 3CHCA 2XFYA 4M81A 2VJXA 5A3HA 3NYDA 2OYMA 4FLRA 3MMUA 4GKLA 4J3VA 3WMSA 2RGMA 5CGTA 5I79A 3SUUA 4WKFA 3CLWA 5HPCA 4PMVA 5E0CA 1V3MA 3UETA 4DWSD 5I3DA 4GO9A 4B15A 1FFRA 4D71A 2D24A 4NZCA 2VX6A 4BS0A 2IUZA 1BYBA 1E0VA 1V03A 2OSYA 1UG6A 3SUSA 1GUVA 3WH7A 3VGFA 1KR1A 3ARQA 4BA0A 3GXFA 2WCSA 1UH3A 1XSIA 1V3LA 3AIWA 2F2HA 3PZGA 4AD2A 4DM2A 1CZ1A 4BF7A 2DGAA 1NP2A 2G8ZA 4W8LA 5FIPA 3FAWA 4PSRA 4MNJA 1WAWA 4JFTA 4PTMA 3DYMA 4YPJA 1GQIA 1QNOA 1UD3A 1KGXA 1LWJA 3BCDA 4LQ1A 1B3VA 1XSKA 2YBUA 1W32A 3W29A 1CWYA 3MUAA 3A4WA 1GOKA 3GM8A 3K8LA 1UD8A 2X1IA 2ZXBA 1PZ2A 4MNLA 1GONA 1ISXA 3VM7A 2XM1A 4UFKA 1E70M 2WLYA 3L4VA 5I5RA 4H2CA 4RE2A 3U5YA 4F79A 1US3A 5I6SA 4W5UA 3L4YA 1ISWA 3WQVA 5CPQA 3AS3A 3CZGA 3IANA 4NSBA 4P7LA 5CG0A 1UKTA 1R87A 1E4NA 3ECQA 3MKKA 4DWSB 1XHGA 3VINA 1G0CA 1UHVA 5IDIA 4HA1A 3CZLA 3OLDA 4HA3A 4N42A 2JIEA 4HU8A 2TAAA 2YA2A 1OT1A 2VTFA 3AMGA 3BLPX 1TCMA 3MU7A 1O7AA 2NW0A 3OG2A 1Y7VA 1DWAM 4M1RA 1XYZA 2W92A 1UQYA 2J79A 3MS8A 5E0FA 1QW8A 1VF8A 4AMCA 2DSZA 1VEMA 4AD3A 2WC3A 1LLOA 5E09A 1KB3A 4P7QA 3APGA 4MJ4A 4XV0A 3PBGA 4Y7EA 4GZJA 6TAAA 3THCA 3QOKA 1CXEA 3SCUA 1QI2A 2CBIA 3D5HA 1AQMA 1EQCA 1GVIA 1VB9A 3NSMA 3WQ4A 4PTVA 3S6TA 1AVAA 1PIGA 1JZ3A 1EQPA 1X6NA 5EFDA 5EBAA 1BQCA 4ACZB 4Q7NA 1W9DM 1LF1A 1WCGA 3ZR6A 1W91A 2WVSA 4AZHA 2V5DA 4Z2JA 4U5KA 3VO0A 3CZJA 3GH5A 1YQ2A 5A6SA 4CN1A 3FN9A 3LPPA 1J0KA 2J7FA 5BWFA 1PPIA 3F5LA 3ARSA 2VX7A 2W63A 2Z1SA 3W28A 3ZM8A 4MDPA 1JD7A 4JHOA 2WVUA 1HJXA 4W7VA 2DSVA 1VENA 2CEQA 3RMEA 2ZUNA 3BAYA 3TTYA 2JEPA 3VIIA 4PTWA 1Z32X 2QV4A 3CMGA 4AZGA 1V0LA 4V27A 5A6JA 1WZKA 4D1IA 1GOIA 1TVPA 4DWSC 1KCKA 3A6OA 4PTXA 4QP0A 1ZJBA 4J3WA 3ALGA 5M17A 1V0MA 4XZWA 1QHPA 1JAEA 1E4IA 1JDCA 1JF5A 3WD2A 4AZCA 3F5JA 4Z2HA 3B9AA 4MB1A 4W5ZA 3BXWA 2BNJA 1FA2A 3VU2A 4AZ7A 1GOQA 2VMFA 2WYSA 1K9TA 2XG9A 5CLWA 3MSDA 2WNWA 3T2QA 2YDSA 3ARYA 3A3HA 4M24A 4X9YA 2FHCA 4KRTA 4HOXA 2GJXB 2YDRA 3PZTA 1E0XA 2ZX6A 5BCAA 1CENA 2W67A 2RGLA 4D6HA 3U57A 1UKQA 1VRXA 2UY2A 1XH0A 2YL8A 4HZ8A 3T09A 2Y24A 4P8VA 2UY5A 5ABEA 1H3GA 4UOZA 5BXSA 3EDJA 2V5CA 3ZOAA 3TA9A 4UFMA 2D23A 4S3JA 3VKKA 2YIHA 1C7SA 4PMQA 1B2YA 3WNPA 3TOPA 5JBFA 2JF7A 1I1WA 1J11A 1XV8A 1J10A 1E72M 4CVUA 2WHLA 3FXYA 3TTOA 3K8KA 3WBEA 3VPLA 2G3NA 5BYWA 3VD9A 3M07A 1V6XA 2VC9A 2O9TA 2VQUA 1R7OA 4CGTA 4CU8A 1HL8A 1EDQA 1HJSA 1JXKA 1KBBA 1UWIA 4PMYA 1BTCA 3GH4A 3D3AA 4AIOA 1JZ8A 4HOZA 1RP8A 5GPRA 1VAHA 1XD0A 2VI0A 1R8LA 4M56A 3SUTA 2E3ZA 1FP9A 2D22A 8CGTA 3WDPP 4PRWA 4PMDA 3U5UA 1J0ZA 3UR7A 3BLKA 2J74A 2WVTA 1TUXA 1C93A 3UCQA 4TXEA 1JNEA 3AHTA 4A3YA 5HPOA 3EDFA 1XCWA 4U2YA 1FP8A 1E6ZA 4Z2KA 1E6NA 4WK9A 1KWKA 1WDRA 1W1VA 1MVYA 3VILA 1UWQA 1N82A 3BAIA 2PI6A 5C8BB 3VDCA 5EB8A 3ZT5A 2XGBA 1HN1A 4WKHA 2VVNA 1UR8A 2YL5A 2WBGA 4H8HA 1QI5A 3TTQA 2EPNA 4D6GA 4ML4A 2WMJA 5DT5A 1GOWA 4MPKA 3RM9A 3EDDA 2ZUWA 4N0RA 2J25A 1W9BM 4C7FA 4TOQA 5CPSA 2WM0A 4HPHA 3WNMA 2YL6A 4U2ZA 1US2A 1W3HA 2EJ1A 1IZJA 4DUXA 4KRUA 3G6MA 5HXMA 1V02E 3GYCA 1WPCA 4CU7A 4FLOA 1C8QA 1R7AA 2WAGA 2J8FA 3T2OA 2WANA 2CKRA 4M29A 4TVDA 1UH2A 3ZIZA 1GQJA 4D6JA 3HN3A 5HOSA 3AJ7A 3ZJ8A 1OD8A 2GSJA 4GQRA 1UD6A 1TFVA 2GK1A 3VD5A 2BY0A 5A8NA 4J3XA 3ARWA 3EDKA 3SCTA 1B3YA 3U7VA 5GQBA 1BGGA 3MSGA 1Q6CA 1MFUA 5D9OA 2DIEA 2J62A 3WNNA 2BXZA 2AMGA 4P7OA 4YN5A 1Q4NX 5LA1A 2CPUA 1J0HA 1U33A 1KXTA 1B3WA 3M6DA 4QDMA 2CHNA 3VIMA 1EDGA 5ABGA 2QMJA 2W5FA 5M03A 4CKQA 4JL2A 2XGIA 4XUYA 2FGZA 2XWDA 4PMOA 3BGAA 1NWUA 3WF0A 4URIA 3CZ8A 3WBAA 3VIGA 4AZ6A 3VD7A 2EEXA 1MW2A 3VM5A 3AXIA 1UKOA 2J4GA 4RE4A 2PBOA 4XX6A 1E6XM 3JUGA 4W7UA 2A3CA 3L4ZA 5CSUA 2PBGA 3BMWA 1E3ZA 1MW0A 2EBNA 5CPTA 1ZBWA 3NCOA 1B31A 2W62A 2J7GA 5A6BA 4NRSA 5I77A 3RO8A 4D6EA 4WIWA 1QNQA 3WF3A 1TVNA 2ZUUA 2DH3A 4GZIA 2D2OA 2CHOA 1HL9A 2PB1A 5AC4A 1NQ6A 3RIKA 1V6YA 2ZXDA 3CHEA 1WDSA 2EQDA 4AZBA 4B3LA 2ZIDA 5A2BA 2YL9A 4U3AA 3W6MA 3BAWA 4Z2LA 1PJ9A 4GO8A 3PZOA 2A3EA 4U31A 3A4AA 1C3FA 2ZWYA 3A47A 3OBAA 4OOZA 3WDHA 3SCQA 3WDRA 1EIBA 4FLSA 2YOCA 3KL3A 3EMQA 4HU0A 1ZBKA 4M80A 4AZ5A 1JZ2A 3LPOA 3WD3A 1V02A 2DH2A 3RILA 1VFMA 3DYOA 3WELA 1EOKA 1TA3B 1Q6EA 2VZOA 2VX5A 5M5DA 1JYVA 2CKSA 3GBEA 1GW1A 1J18A 4CN6A 3WH6A 3K1DA 1NOFA 1F4AA 3SCSA 3AMLA 2WMIA 3DYPA 1FH9A 1DWGM 3KZSA 2BHUA 4CCCA 1E5NA 4LGXA 5A94A 3L2LA 1GHRA 1W3LA 1C91A 2Y2WA 2ZUTA 1UWUA 3UEQA 2IXUA 4K68A 3WF4A 1FOBA 1R86A 1EHNA 1BGAA 4ACYA 4FMVA 1MQQA 3VX0A 1H41A 1CXHA 5GNZA 2QPUA 5A6KA 2XYLA 3CO4A 4L4PA 4GI8A 2X2YA 4U5IA 4QLKA 2V3FA 1HKIA 4CUCA 1GQKA 2XUCA 1TR1A 2XVLA 2EPMX 4UOJA 2E8ZA 3CUFA 1BAGA 4FK9A 3O9NA 4MTVA 1C7TA 5A6MA 1CGUA 1QW9A 2D3NA 5HNNA 1QHOA 3O2LA 1BFNA 1WZMA 1UWRA 2W91A 1L0PA 2GFTA 2DQXA 1ZJAA 1F4HA 1ODZA 3PZQA 3MO4A 5D4YA 3BAJA 3L4UA 4GINA 3VD4A 3W82A 3VDBA 2Y5EA 2V3GA 3THDA 2E40A 2WZIA 1R85A 3WL0A 4MJ2A 4M8UA 4AEEA 2WCGA 4DM1A 4P7NA 3POHA 3WL1A 2A3BA 2NSXA 1OWQA 4PYSA 5I0DA 4MB5A 4HZ7A 3W0KA 2WLZA 3M7SA 2CIPA 3VGHA 1JGIA 1C8XA 4D6DA 2XVNA 1JYWA 3AIEA 4P8XA 1JFHA 2OWXA 1B1YA 1CXIA 3VMOA 3DHPA 3AHYA 2G3IA 1V3HA 6CGTA 1NOUA 3OLGA 1UKSA 2OSWA 3N9KA 3SCVA 2X0HA 2W66A 4EAMA 1TE1A 3AIUA 4GQQA 2J7EA 3VMNA 4JFSA 1KGWA 2O9PA 1UOKA 4UTFA 3ZR5A 3T0AA 4WLCA 2O92A 3SCRA 3K4DA 3WUFA 1M7XA 4DUVA 1X6LA 1ZB5A 2VO5A 5DO8A 4PMUA 2XIIA 3OIHA 3MMWA 2XFFA 4MAZA 3VVGA 2HISA 4ATWA 2WC7A 3CTTA 4KH2A 3RCNA 1EGZA 1CLVA 3UERA 2GDUA 3NSXA 3ZO9A 1SMAA 2YJQA 1E43A 2XVGA 3WUGA 1CGVA 4YHGA 4F9DA 1E3XA 1XD1A 3AOFA 1QOXA 2DT3A 3WD4A 4J3SA 2WHMA 1UD5A 2OYLA 1W9PA 4TUFA 4AIEA 5DMYA 2XSAA 2ZUVA 4CN4A 3AFBA 3I3DA 1H4PA 4AEFA 5ABFA 1E55A 3B8SA 1UD2A 2DSWA 1EO5A 3CIVA 5ABHA 1CDGA 3CUHA 4BQ2A 1VBRA 1OBAA 5BRPA 3J7HA 1UA3A 1NWSA 3AHVA 1JF6A 4P8WA 2VVSA 1NWRA 3QGVA 2BVTA 2PWHA 1RP9A 3FNDA 2CITA 4GPNA 4OIFA 2PWFA 3PZIA 3QHOA 1NARA 2AOSA 2J77A 5A8PA 1EO7A 3M46A 4R27A 3K4AA 4TX8A 4WKAA 1E6PA 2G3JA 1VEOA 1KWGA 1JAKA 2WWDA 3KL0A 1E1EA 3WQ6A 3A4XA 3IK2A 4UQ9A 5ECUA 2NT0A 1GJUA 1ISVA 4UQAA 3T0BA 1I75A 4UCFA 5TD4A 7A3HA 2VQTA 4AD5A 1VJZA 4CCDA 5A1AA 4PCSA 1G5AA 1V3IA 1HKMA 3W6LA 1CGWA 2F61A 2BS9A 2DIJA 3OA5A 1PZ3A 3TONA 3ZJ6A 1CYGA 1OSEA 5A95A 1VFUA 2C8NA 2V3EA 3VIOA 5CGMA 4JZ5A 4HZ6A 1FFQA 1W3KA 2WWCA 1E9LA 1WNOA 3II1A 4JAWA 4D6CA 5DF0A 3PZMA 4CD7A 2UY4A 3RM4A 1JNDA 3AZRA 5LA0A 4KWUA 1J0JA 2E8YA 3WSUA 1HVQA 1Q6GA 2WKLA 1BYCA 1GQLA 2EPOA 3WQ5A 2VCCA 4AIUA 1L8NA 4Z2GA 3VGEA 5D9NA 2WMGA 1PX3A 1WZLA 2G41A 1QNSA 1NOWA 3WMBA 4ATDA 5JUVA 4TX6A 4TVCA 4IUGA 1GHSA 5C71A 4U3CA 3VGBA 4WSJA 2EO7A 5IXEA 2BY3A 3NDYA 4EKJA 3W38A 2DSUA 4UQDA 1H0IA 1V6UA 4GIAA 3G6LA 4J27A 3VIHA 4NF7A 3W26A 2E9MA 5A8OA 4IM4A 3PTQA 3W24A 5I24A 1SYTA 3N15A 2CXGA 4HPGA 1W2PA 1MFVA 4PMNA 4UQEA 1EHAA 2EPLX 3RDKA 1AQ0A 3QHNA 4J3TA 1BYAA 2FHFA 3SUVA 4QCEA 1PIFA 4NRRA 2VT0A 2WMFA 3RJYA 1KQYA 4F9JA 4H8UA 4F8XA 1BPLB 5CZKA 4JKMA 2GVYA 4QFUA 3QR3A 5DFAA 5AYIA 1OM0A 5KEZA 2CYGA 3OZOA 4HMEA 2D0GA 4LXFA 3LPGA 3UR8A 2E9LA 2XJ7A 1M53A 5FCZA 1B30A 3WUBA 1K9EA 1JYXA 1V0NA 1O6IA 5BXRA 3AIVA 3BH4A 2E0PA 3FY1A 5EMYA 4AYSA 1JD9A 3ARRA 3VOCA 4KGLA 1UKPA 3NJ3A 1C90A 1MQRA 2EXOA 3OB8A 3VNYA 5A2CA 1MW1A 4GI6A 2BHZA 4ZEPA 1FH8A 5FL1A 3GNOA 4DWSA 2ZUSA 3WEMA 5KZ6A 1A3HA 1HKJA 1CLXA 1FHDA 2WSPA 3VDHA 3FAXA 1W2VA 3O6AA 2YA0A 4PMZA 3WUEA 1M04A 3GZAA 1RD6A 4LPCA 4JCLA 1CXLA 1ZS2A 4OBSA 1JI2A 2ZE0A 5A6LA 2YDQA 4AISA 1GPFA 3CPUA 1K9DA 3N13A 1DTUA 1CGXA 5M3WA 2UY3A 5D8WA 3WENA 4W88A 3ARPA 1PX8A 2XTKA 4NI3A 4W7WA 4X0NA 1JL8A 2WMHA 4X0VA 2XVPA 4J3UA 1B3ZA 3WFLA 1H2JA 4KGJA 1KGUA 1IZKA 1XC6A 3AS1A 4ACZA 3CUIA 2DT1A 1JFXA 2PWGA 3UG3A 1V0KA 2DEPA 2WCAA 3MMDA 4AWEA 1UD4A 4QLLA 1B3XA 1V6WA 1XYFA 3PHAA 1E6SM 4MNMA 1DWIM 2D20A 5CLTA 4AD1A 2VRQA 1Q6FA 4MAVA 1BVZA 3N1AA 1SFSA 3WFZA 4ZFMA 4B9YA 2DPEA 1D2KA 1WO2A 3WF1A 2J7CA 3AXXA 5I2UA 2DT2A 2VNCA 1WZAA 3EMCA 1TG7A 3PTMA 1HXJA 1UR1A 3I3BA 3VD3A 3AQUA 1QHZA 1HJVA 2OLHA 5LYRA 4AY1A 1IV8A 3HJEA 3VIFA 1JIBA 1NH6A 5JIPA 2GDVA 4DUWA 3AYRA 3HMCA 1UQZA 5IHSA 3AYSA 1H1NA 2WC4A 1Q6DA 4IISA 2W61A 2OYKA 4CD4A 5JIWA 7CGTA 3K46A 3MV01 2D3LA 3ARZA 3WDIA 4ZENA 3EMZA 4HMDA 1CBGA 1S46A 1HIZA 3GXIA 2V3DA 3GH7A 4OBRA 4RE3A 3OLIA 3WNKA 4HMCA 3WD1A 3WMCA 1LQ0A 2QMKA 2JIWA 3GXMA 2VRKA 4W93A 3PZUA 1GJWA 4AZCB 5D9MA 1GOOA 1E73M 2GJXA 4JFWA 3SUWA 1CIUA 1UA7A 1H49A 3ZMRA 1UH4A 1ITXA 4JIEA 3L4TA 5A8QA 2VZSA 4ZE4A 2JEQA 4ZXLA 5IFTA 1KFWA 2CBVA 3AHZA 1KXVA 1PAMA 5IFPA 1JDAA 4XZBA 1GOMA 2VL4A 4JKLA 1WDQA 1C92A 2BY1A 2GJPA 4B16A 3AISA 1OD0A 2E4TA 1NP0A 2O9RA 1WKYA 2MANA 2XHYA 2VRJA 4HOWA 4PCTA 4UNIA 3QHMA 2WW5A 1V3JA 1H5VA 1RPKA 2XM2A 2ZX7A 3MUY1 4R5EA 1DEDA 2W4XA 2VOTA 4QCFA 1QBBA 3NDZA 5BRQA 3AXHA 1GNXA 2CCRA 2VCBA 1E6RA 3NSNA 3PN8A 3ARTA 4EE9A 2VURA 1VEPA 1WDPA 3CUGA 3SEPA 4LYQA 4BQ4A 4PBGA 3NIYA 4HP5A 3VIKA 2WMKA 1HX0A 4C7GA 2D0HA 3ARVA 4UQCA 3WF2A 1VJSA 5BROA 3ZSTA 3KL5A 3TP4A 2FHBA 4EK7A 4TTGA 2GJRA 3AROA 3CHDA 4UZSA 4UFJA 4ZE5A 3AI0A 3ALFA 2HVMA 1MW3A 4E8DA 1H0GA 5GNYA 3VIPA 3BCFA 4BCEA 1E6QM 1V6VA 2ZX5A 2ZX9A 2Q8XA 1QI0A 4XB3A 1OIMA 2J78A 1J12A 1LJYA 1WE5A 3VGDA 4D6IA 1HP5A 4GZEA 1W1TA 2OWCA 4PMXA 2CESA 4E4PA 2VZVA 4J7RA 1WB0A 2FH6A 3F5KA 4E2OA 3GDBA 3WY1A 1LL4A 2PWDA 4H7VA 1G94A 2DT0A 2DDXA 4JKKA 1JG9A 1V3KA 2BV9A 3U7BA 4GI9A 2C7FA 4PEEA 3MANA 1NM9A 1A47A 3ARXA 2VZTA 1JYNA 1ZBCA 3PTKA 2XVKA 1BSIA 2XFRA 2VX4A 3IJ9A 4D6FA 1CXFA 4AW7A 1OT2A 4CD6A 1CEOA 1VFOA 3POCA 3MV11 1W9VA 3KEHA 9CGTA 3LMYA 3PZ9A 5A6BD 3VMPA 3WDQA 3ZT6A 1UR0A 3AHXA 2Z1KA 1G01A 2WSKA 1HT6A 1XH1A 4JFVA 3BSHA 3WKZA 1OIFA 5D8ZA 2O9OA 2GK1B 4IPLA 2XSBA 3KWXA 4H41A 4IPNB 4V2XA 1ZBVA 1QNPA 4CU6A 5A6AA 1OGBA 3CMJA 1CGTA 2CETA 1DWFM 2ZXAA 1DP0A 1DHKA 2YBTA 4D1JA 4C7DA 2CERA 2XIBA 2AAAA 3AMKA 1K9FA 4OJYA 3WDJA 1QBAA 4W86A 4B9ZA 3B9EA 5E6ZA 1OB0A 1EOMA 3GNPA 1G9HA 2DSKA 5DT7A 2FDMA 2YA1A 3AIBA 1UWSA 3DC0A 3VIJA 4AZIA 1ECEA 3CH9A 1BYDA 1E1FA 4PUDA 7TAAA 1SR0A 1G1YA 1UR4A 5HBFA 3PZNA 1MXDA 3CBWA 3GNRA 2ZUMA 1JDDA 5I78A 1KR0A 4MDOA 2VR4A 3CUJA 3VNZA 2G4FA 3AZTA 1D3CA 2WB5A 1LWHA 3L4WA 1CECA 2ZXQA 1JI1A 2WK2A 4UOQA 1BG4A 2YKKA 1KXQA 2WVVA 3TTSA 1XH2A 1CTNA 1JZ5A 1GZJA 4H04A 4H8VA 3UG5A 4UQBA 4AC1X 1FH7A 1GCYA 2WHJA 5AYBA 3W4RA 4W8AA 1JZ6A 2J75A 2BFGA 3T08A 1M01A 4PSPA 2JE8A 1W3JA 3AS2A 1GVYA 5CQ1A 3AIQA 1UR9A 4LYPA 3CZKA 1VBUA 4J28A 4UZUA 4TTUA 3WH5A 1WP6A 5IHRA 2D1ZA 1TA3A 2XPKA 2J47A 3WH8A 1JXJA 3MUZ1 4AD4A 2OSXA 3L2MA 4FF5A 1QVBA 3L4XA 1ESWA 2F8QA 1KXHA 1XGZA 1ISYA 4FLQA 3BAXA 3N17A 4HA4A 4EANA 4P7RA 2Y8KA 4LX4A 1BHGA 3FHQA 4PN2A 3WD0A 1EDTA 1XSJA 1AMYA 3WNLA 3VGGA 4V28A 4A4AA 1J0YA 2CNCA 2JFEX 1OGSA 2YLAA 1B9ZA 2WMIB 1OGGA 4P8UA 1E0WA 1QNRA 3ARUA 3ZSSA 3VTRA 5A8MA 5F7UA 5BXPA 2ZICA 3OLEA 1V08A 4MNKA 3SCNA 4W89A 4S3KA 4QAWA 3EDEA 4JFUA 1E56A 4CCEA 2EPKX 1E5JA 1C8YA 1E4MM 3VDAA 5E9AA 1VFFA 2C0HA 5LA2A 3GXDA 3F4VA 2Y8VA 1HNYA 3IAQA 2X09A 1TZ7A 3ZT7A 3AIRA 2VCAA 3CZEA 5JBEA 5CXPA 4MADA 3S2CA 4W8BA 4UFIA 1BLIA 3UESA 1JZ4A 3NUKA 1DWHM 5A69A 4B3KA 1LG2A 4WSKA 1ZU8A 1UUQA 2XWEA 2E9BA 4BQ3A 1MWOA 4M82A 1BVNP 2BY2A 4GXPA 1MQPA 3GBDA 2BXYA 2QF8A 2FGLA 4AD0A 1OCQA 1PX4A 5EFFA 2B31A 2PF0A 1LL6A 3I3EA 2WZEA 4WF7A 4L4OA 5HDRA 3WIJA 5CJ5A 1VIWA 1LG1A 1DWJM 1ITCA 1CXKA 2VR5A 4E8CA 2J8GA 2WHKA 1TMQA 3SURA 3E1F1 4OZOA 1QI3A
chains in the Genus database with same CATH superfamily
3SR7A 4DNHA 3AXMA 1RK6A 1JJKA 3BW2A 2RUSA 3OGSA 3SIMA 4ZMGA 4IJCA 5JH1A 3KBSA 2YCEA 5E6YA 1LRQA 4N6FA 2J7BA 4E2VA 1BWVA 2WXDM 3N12A 2VEMA 4XSMA 3MYOA 4LYRA 2VFGA 4UTWA 1A5BA 3K8MA 1QPKA 4C6JA 4XD4A 1HP4A 5FL0A 4HYVA 3IJ8A 3AMCA 4V15A 4F66A 3CGTA 1DXFA 3T40A 4F0SA 2OFJA 1P0KA 3W2UA 3B9DA 3GKAA 5DCDA 4CVWA 5E70A 2UWFA 4XD5A 1RH9A 1XLLA 1H50A 4JBRA 1QI4A 1CPUA 2G50A 3E2VA 3MW7A 3HGRA 4JHZA 3C4UA 1BEUA 4KMQA 3HQNA 2PURA 1J93A 4G56A 3KBMA 1ZL1A 5HNTA 2YXOA 1KTCA 4QDPA 4BZYA 1E71M 4Q8WA 1VZWA 4GUFA 1R9XA 4W87A 1SSDA 2F6UA 1OZMA 3RMJA 1VHNA 4HA0A 5AHMA 3VX1A 1PSCA 2X8RA 2A3AA 1MXGA 1EEPA 3P0XA 4TX9A 3OGVA 2HCVA 4H9XA 4ZXOA 1E1CA 4IJRA 1XLJA 2OWWA 3W25A 1H09A 3L9CA 3VCRA 1I2RA 3S0CA 3E2QA 2ZX8A 3CUZA 2QHAA 3OZPA 5BU6A 2WPGA 3C61A 2HXUA 2J7DA 1UASA 4AHQA 1XFBA 3VUSA 1W1YA 4O19A 5FJIA 1HJWA 1V5XA 4RL3A 1TTPA 1IWPA 5CGQA 2ZRUA 3ANVA 3MKVA 3KBVA 1C9WA 5CZTA 3GS6A 1HJUA 4V1YA 3V16A 4GLEA 1QFEA 5G2WA 3MY9A 5FOOA 5C9RA 1P6WA 4FI4A 1UP2A 1PWMA 4OU1A 1S5NA 2J7HA 4KETA 1ZALA 5AY7A 4H9VA 4PUEA 3MDUA 1PBGA 3T9PA 1A5MC 3N11A 4U33A 1SFLA 3H12A 1I0BA 4ZA0A 2ZBTA 2PWEA 3XINA 5C9UA 3D0CA 3KBWA 4W85A 1OFDA 2E25A 2YLLA 1M7OA 4YTSA 4FZIA 2YFNA 3LXBA 2X05A 3S5NA 1E15A 3IJ7A 5C70A 4TQTA 5IDZA 2XFYA 3S3GA 4M81A 1LCOA 3NYDA 2OYMA 4FLRA 3GHUA 4QE5A 5CGTA 2B7NA 4PL1A 1EYWA 4WJ8A 3T44A 3CLWA 5BOOA 1QW7A 4DWSD 4Q8UA 4GO9A 4B15A 1FFRA 2D24A 4XG1A 3KLLA 3E3HA 4EX4A 2VX6A 1Z3NA 4BS0A 2IUZA 4PBEA 3SUSA 4JTQA 3EX6A 3WH7A 1KR1A 2YXXA 2DUZA 4OGZA 4AD2A 2F2HA 5KINA 1CZ1A 3CWOX 2PD5A 3SQSA 2G8ZA 2ZFAA 2QJJA 2AGTA 4IIBA 4XVEA 2Z7KA 4EWJA 2AAMA 3C3NA 1GQIA 2NV2A 3ITCA 1LWJA 2J13A 2IKIA 1GYNA 3PAJA 4QDWA 4LTSA 2VP8A 4LQ1A 2OTDA 2WZTA 9XIMA 1TWWA 2YX0A 4LAOA 1YNQA 3W29A 3MUAA 1NDVA 4AHPA 3A4WA 1GOKA 3PSVA 1UJPA 2DZXA 2D2JA 1K70A 2OGJA 1M3UA 2PWUA 1NSJA 2ZXBA 3LGEA 4YTRA 2PDWA 2QR6A 4UFKA 1E70M 2H9AB 2WLYA 5I5RA 3E5PA 4H2CA 3MTWA 2GQ3A 3EOUA 3QFWA 1UR3M 4H9TA 4F79A 4IX2A 2AKMA 4DO4A 4MLJA 4H6KA 4HCLA 2J24A 3D47A 1XHGA 2XZ9A 4OVXA 4CNSA 3Q58A 3CZLA 1OT1A 3LK6A 1TCMA 1XRFA 3F2DA 5D03A 5CBBA 3OG2A 3TMQA 4WCJA 4NZ1A 2W92A 2OX1A 3UF9A 2HVOA 3MS8A 5E0FA 1VF8A 1AH0A 4Z1DA 1ZJHA 4AMCA 4CQ9A 1TWSA 2QJIA 1PHWA 4AD3A 4JIRA 4Q8OA 5E09A 2DORA 4L7ZA 1MNSA 2KX9A 2E6YA 6TAAA 3THCA 3QOKA 1CXEA 3MI2A 3B8WA 3D5HA 4DXXA 5C5YA 1GVIA 3WQ4A 3FJ6A 3TCEA 2NQ9A 4KCUA 1DOSA 1X6NA 4A8RA 1IR1A 5MF5A 1TWDA 4Q7NA 2IMRA 4WXYA 1QOQA 1IGSA 1HO4A 2E7FA 1TUFA 3DBNA 2VGGA 4ES4A 3P81A 1YMYA 5KTLA 5A6SA 4CN1A 3LPPA 2J7FA 3O15A 3OO2A 3CV7A 3N25A 3M41A 4O0KA 4IPJA 3ZM8A 3OVPA 4MDPA 3FXGA 3I6TA 4HNNA 4W7VA 2DSVA 1OZQA 2PODA 3RMEA 1X7FA 3BAYA 4Z1YA 2QUUA 1PKMA 1VH7A 3WLMA 1LUCB 1Z32X 4AZGA 4V27A 1WZKA 1GOIA 3DX5A 5KSWA 4O52A 3DC8A 2LLEA 1TVPA 4PTXA 4QP0A 2IKGA 3KOYA 1E9YB 1P6CA 2Y70A 2CW6A 3ALGA 2NLIA 3G1YA 4AF0B 1QHPA 4LUJA 1JAEA 3M4HA 1JDCA 1DORA 2QJNA 3B9AA 4AVNA 1OG6A 1IZCA 4IG2B 2Q01A 2OQYA 3VU2A 2HRWA 1R3WA 1K9TA 1FDYA 4ZZ9A 2DUAA 3TQPA 2I16A 4IUOA 5HNUA 4AEOA 2YDSA 3A3HA 1W5PA 5EYWA 1UPPA 1XYAA 3P8JA 4MYAA 3GIQA 1XPYA 1CENA 4KBXA 5T8GA 2W67A 2ZDRA 2RGLA 1EWDA 4D6HA 3RITA 3ABQA 4YTTA 1VRXA 2YL8A 3A9BA 3UW6A 2J27A 3HIJA 3T09A 3TW6A 2BTMA 9RUBA 2UY5A 2ZVIA 5ABEA 3V1HA 4JQAA 2V5CA 4MIMA 2OPJA 3KTXA 2D23A 4WSHA 2DP3A 5FA5A 1YE4A 5KMYA 5LNRA 1I1WA 4L6DA 1J11A 2J88A 3LCFA 3FXYA 3W7EA 1F3TA 3WBEA 4DBUA 4PC8A 2Y0FA 2OB3A 3ZFHA 4O16A 3R89A 2O9TA 1HJSA 1UWIA 1XLKA 1BTCA 1XIDA 3D3AA 2OQLA 4AIOA 1JZ8A 2VUNA 3UJRA 3QY6A 2IPWA 3OQ8A 3ERPA 3LNPA 1DJQA 2RHGA 1XLAA 1LBLA 1R8LA 5EA9A 4F2TA 3AUJA 3UWYA 2V30A 3TC3A 1X8FA 4PRWA 3U5UA 1TPH1 2WVTA 1C93A 1PKYA 5AHEA 1JPDX 1JNEA 2Q8ZA 1S2AA 2TRSA 4Z2KA 2EJAA 1E6NA 1LQAA 1KWKA 4B5UA 1W1VA 3IGXA 3ATYA 4DBSA 3PFMA 1WUFA 2PEVA 1JCTA 5C8BB 3TJ4A 4WDWA 3MYPA 4RV8A 3NYZA 2XGBA 5U7SA 4WKHA 5M2FX 2WBGA 4ZQOA 4D6GA 3GLCA 3PBVA 1N8IA 2QUTA 3NDOA 1GOWA 3RRXA 4MPKA 2WJEA 3KHJA 2IPGA 2J25A 4ZTYA 4FIRA 4B2DA 4TOQA 4S3DA 5CPSA 4HPHA 4K7YA 4DUXA 2Y89A 1V02E 1WPCA 4CU7A 3W1TA 1R7AA 4C1NA 4KWWA 1UH2A 3G8RA 3ZIZA 4D6JA 5B7YA 3S5ZA 1W1B1 2GLKA 3AJ7A 4LSBA 1W1ZA 3C2FA 2GK1A 1FKWA 1GJPA 3BVJA 4E8GA 5CZJA 1EUNA 2P50A 3V5OA 4HNOA 2DZWA 2CLOA 2ZADA 1BGGA 1Q6CA 2V5KA 2RJHA 1TB3A 2J62A 3W74A 3WNNA 6REQB 3WLRA 2OR2A 3CT7A 1Q4NX 4A8NA 3OPSA 1AODA 5LA1A 4M6QA 3REQB 2CPUA 2AL2A 4KEVA 4GC3A 4EIVA 1B3WA 4QDMA 3TX9A 3VIMA 1XLBA 2QMJA 4CKQA 4IXHA 4JL2A 3GVQA 1UC4A 3T42A 3VNJA 3CMFA 2AQWA 2FGZA 2XWDA 4XUYA 3KW3A 4Q8MA 3WBAA 1QPOA 3VD7A 1RVGA 3AXIA 4RE4A 1BSLA 2E09A 1O66A 3M0ZA 2WQDA 3BMWA 2EBNA 3GYEA 3DESA 3CQHA 5CPTA 1H51A 1DJWA 1ZBWA 4ZSTA 2J7GA 4NRSA 4FF7A 1XRTA 4D6EA 4LB4A 2W0UA 3RF9A 1A5KC 2OKOA 2HROA 3WF3A 1T41A 5BMXA 2D2OA 2PD9A 2CHOA 1KNWA 4XKYB 1UMLA 4RUBA 1V6YA 1ZJIA 1YX1A 5FF3A 2PTWA 4NILA 1MSSA 4JNZA 4AZBA 4CNTA 2ZIDA 2YL9A 3UPBA 3IS4A 4CQAA 4DELA 1W8GA 3TNBA 3A4AA 4DJEC 3OBAA 5KZDA 1ADSA 4FLSA 2YOCA 3WK2A 4M80A 3GDRA 5LNSA 3WD3A 5HK4A 1H62A 4JIHA 3S1VA 4ERAA 4RR4A 5BU9A 1OFQA 3FEQA 1EOKA 1Q6EA 5EU9A 2VEFA 4OWGA 4LS0A 3TYAA 3DBPA 3WH6A 3UZYA 1NOFA 1XF0A 3W7HA 3VNLA 1WXJA 3QLDA 2PU1A 3SCSA 2WMIA 3LLFA 1TPB1 1OX5A 1KM3A 3ELFA 2BBFA 1DWGM 3PY2A 3KZSA 2BHUA 4LGXA 1GHRA 1C91A 3E0LA 2ZUTA 4QM1A 4K68A 4TU1A 2OEKA 1EHNA 4ACYA 4ZVJA 2VD9A 1MQQA 3VX0A 1CXHA 5GNZA 5TF0A 4JX4A 2QPUA 4M1BA 1I2NA 2XYLA 5BRBA 3KVMA 3KOZA 2V3FA 5BW6A 1HKIA 2R8WA 1GQKA 4R3UA 1FWFC 2GPTA 3KCOA 2EPMX 1KV5A 3CUFA 4FK9A 4MTVA 4FOJA 4I3GA 1CGUA 3BQ6A 2JGQA 3BUVA 2MUCA 5HNNA 4YVPA 1QHOA 4JIPA 1WZMA 2VXNA 4XZIA 1L0PA 2GFTA 1F61A 1ICQA 3BAJA 3L4UA 2NV9A 4GINA 3P80A 2WZMA 3FGCB 2V3GA 3THDA 4TV5A 1MO0A 1R85A 4MJ2A 4DM1A 4P7NA 4NHVA 4LALA 4YNGA 2NSXA 4K1GA 1EF3A 2WLZA 4C90A 4UXDA 4CNUA 1DJGA 4IQDA 3F1QA 2XVNA 1JYWA 1VKFA 4EVZA 4P8XA 1ME7A 3M0LA 1K8ZA 3VCNA 4XWUA 5LIUX 3A64A 3URBA 3LZ5A 1IIHA 1W5OA 2FDSA 2O9PA 4I6VA 1UOKA 8XIAA 3ZR5A 4WLCA 3P5ZA 2O92A 5C2GA 3PP7A 1ZB5A 2J9XA 4PMUA 3QGKC 3MMWA 2XN2A 4MAZA 1AMKA 4LAMA 3G0SA 5EMKA 3DU0A 3VVGA 4ATWA 1RQBA 4KH2A 3RCNA 4WQ6A 1VP5A 1CLVA 3VE9A 3NSXA 4NJKA 4Q8PA 1EJXC 3TIMA 1IE7C 3HTWA 1Z89A 4YHGA 3BLOA 1E3XA 1LLZA 5BWAA 1AL8A 3SY8A 3UJFA 4ROPA 2DT3A 2PU0A 1W9PA 4TUFA 5DMYA 1RLDA 3N9RA 2XSAA 3CC1A 3L5LA 1YXCA 4GC4A 3QGAC 5F4XA 4XSLA 1H4PA 4QSFA 4R9OA 5ABFA 4NX5A 2DSWA 1CDGA 3S5OA 3CUHA 2KZHA 4MWAB 4MZ8A 1VBRA 3J7HA 3TFXA 1ZPTA 1EZWA 1TRDA 1U83A 3AHVA 1JF6A 1NWRA 3S83A 1TCDA 2FMOA 2PWFA 2W6RA 3W1MA 3PZIA 4KIEA 5A8PA 2VDIA 2B0MA 3WK1A 4WKAA 3HM7A 4QIUA 3BGGA 4FHAA 4MJMA 4LBUA 1E1EA 2OZTA 3WQ6A 2RDXA 4IP7A 3A4XA 5HWJA 4RZBA 1H1YA 1ISVA 1UP0A 1I75A 7A3HA 1I9CB 4IFKA 1R38A 3O0FA 3CS2A 4UTWC 3OVRA 4CCDA 2FFIA 1IEWA 5A1AA 4PCSA 3QFEA 1V3IA 3MPGA 1SZRA 3W6LA 2QDGA 1YDOA 2BS9A 2DIJA 1W54A 1PZ3A 3ZJ6A 3EOSA 4LY4A 4BI7A 1OSEA 2E6DA 3T0TA 1A5SA 1VFUA 2V3EA 3UPMA 2ZA3A 4ZSUA 4TO8A 4HZ6A 1W3KA 1FWSA 4GA8A 2FKPA 4XAFA 3OODA 2QKFA 3PZMA 2UY4A 3PNUA 1J0JA 3MBDA 3MI6A 4O8AA 1ZRQA 1Q6GA 2WKLA 2F6KA 1BYCA 1GQLA 2EPOA 1D7KA 5FAJA 2VCCA 3H2MA 4F3HA 2DZTA 1L8NA 1VFHA 2Z7GA 1NOWA 3WMBA 4DJDD 1BWKA 4TX6A 3R0UA 3ZYZA 1U1JA 2RFGA 3VGBA 1QASA 5T91A 4O1DA 2A0NA 3W38A 3RU8X 3KUMA 3V0UA 1Q85A 3NQCA 3OBEA 6XIAA 2DZAA 4BI5A 3VIHA 4GUJA 2DW6A 5A8OA 3PTQA 2E28A 1SYTA 3G18A 5E5CA 3N15A 4IICA 3WBYA 4PMNA 4JN6A 4UQEA 3B8TA 3W1UA 1AQ0A 3FA3A 3W7PA 1F7BA 5FI8A 1ECQA 4QCEA 4O0ZA 1PIFA 3EEGA 4NRRA 4ZOCA 1ZNNA 3RJYA 3LBMA 1XQKA 4F9JA 1W0MA 1BPLB 2H3BA 3A23A 4JKMA 3LCWA 2CWNA 4UIOA 2NQZA 3OZOA 1NF0A 4HYWA 1VFTA 2O4QA 1H7XA 1O6IA 3E6EA 2JQXA 4AYSA 4CEXC 3SRDA 1R2SA 3T78A 4ZEPA 1TJPA 4DWSA 2HNEA 4Z42C 5TAOA 3FAXA 4JD4A 1MUWA 3MZ2A 1P1MA 2QS8A 4BWLA 1EC9A 4U28A 1T7LA 1LOLA 4LJ3A 5EGRA 3GZAA 2HWGA 2XIOA 4Y6GA 1EJWC 2DJLA 2YDQA 1E0TA 3CPUA 3N13A 1DTUA 1CGXA 3RAOA 5M3WA 3L67A 3LU2A 4W88A 3LEPA 3DFHA 4O4WA 4BHYA 4C6CA 2OLSA 3ID7A 3S8HA 1ICPA 1KGUA 1XC6A 1FXQA 3CUIA 2PGRA 3O1NA 3KRUA 2NVAA 5D30A 3GNDA 3MMDA 2X7WA 2BVWA 5KITA 3DN5A 3U0HA 4L9XA 4A35A 2QCHA 2C1IA 5DXXA 4D8ZA 4MAVA 2OEMA 3WFZA 1FCUA 1LP6A 3H55A 1X97A 3IV8A 2J7CA 4HNTA 3W07A 3ZVIA 4HIBA 5FJTA 1RCXB 3TYCA 1HXJA 3C2EA 3AQUA 1DXIA 1QHZA 1HJVA 2OLHA 2YPIA 3STFA 2A79A 3E9AA 4K3ZA 3NA8A 3HMCA 4IZGA 5IHSA 5FF4A 3CIWA 1Q6DA 4CD4A 2PGEA 4RDYA 3K46A 3MV01 3ARZA 3CPRA 4OHQA 3EEZA 4HMDA 1XKJA 4PCFA 3RO6A 3GH7A 4OBRA 4RE3A 1YBQB 3LLDA 1TZZA 1LQ0A 4UMCA 5E9XA 2JIWA 4GOAA 2V5LA 3VNKA 4W93A 3PZUA 1RAKA 1GJWA 1JCXA 4AZCB 4XISA 4ZQNA 2DW7A 3KVJA 3A5VA 4O1FA 2I1OA 2QYGA 3ZLGA 4P2VA 5A8QA 3TQ0A 3AHZA 4BEQA 2ALRA 1KXVA 3DZ1A 3H6OA 4RDVA 1EZ2A 1NAL1 4G7EB 4KT2A 1C92A 1M6JA 1UIOA 2AQVA 1GW9A 2X16A 4POCA 4UNIA 4XQ6A 4F0RA 1XKYA 3CHVA 4R5EA 3UJ2A 5J5DA 2VOTA 2PDKA 4GFSA 3NDZA 5DCEA 3LDVA 3AXHA 4LS1A 5IRPA 2Z26A 2DQWA 5CZ0A 2CCRA 1E6RA 1RLCL 3PN8A 2Z29A 1Q7MA 3CUGA 1ZLPA 2FJUB 3PULA 3H7RA 3ARVA 4UQCA 5BROA 3ZSTA 3QKZA 3MP4A 3B05A 3V75A 3WLQA 3C0QA 3SB0A 3EZ4A 3UZ5A 1JCNA 3AROA 4WGHA 3S9ZA 1FHVA 3AI0A 2HNHA 2VEGA 3A21A 3S2MA 3NEVA 4E8DA 4NNCA 3LM3A 2HDJA 3CT2A 2PLKA 3VCCA 3VIPA 1KBJA 1QCWA 1XLMA 1WKDA 3W85A 1ZUAX 3KDNA 4XB3A 5LNUA 4GRSA 2J78A 5FAGA 1J12A 1HP5A 1S5WA 2QJGA 2CESA 4E4PA 4E2OA 2IS7A 1F3XA 4KFPA 3AWNA 3M0IA 1NDWA 1B9BA 4H9YA 1UWAA 2QCDA 4H7VA 3QZEA 1ZFJA 4LVAA 3GVVA 2P53A 3IUDA 3FLUA 3VOGA 4JQ4A 4NJJA 2C7FA 1NM9A 2P88A 4NNAA 1JYNA 2PE4A 3S47A 5CBIA 1ZBCA 3VC6A 3QYSA 3R6IA 2XFRA 2VX4A 3MP5A 4JQ3A 1CXFA 4AW7A 5JXQA 2ICSA 1BKHA 1RBOB 1EX5A 4MZ1A 1W9VA 3LMYA 3HBLA 4AB4A 2NQHA 1Y0EA 1YNPA 2PCEA 2BGNE 5DX7A 3TWAA 3AHXA 4C5YA 5H8MA 4QNEA 3W22A 2WSKA 3C5QA 1XH1A 3TR2A 4ZTXA 4IT1A 1PCWA 3BSHA 1OIFA 4Q32A 5D8ZA 1MZHA 3KWSA 3T4CA 1JGMA 1XLHA 4Q4SA 3W7IA 3O0KA 5A6AA 1CGTA 3AXKA 1EJTC 1DWFM 4IQEA 2JGYA 1SO5A 1DHKA 2YBTA 3NNTA 2CERA 2XIBA 4YCOA 5HJXA 1VLIA 3EPNA 2EG6A 1Q7QA 1BRLB 4HHMA 4O11A 3FJNA 4YVVA 1EOMA 3GNPA 3MHFA 4KS0A 1YDYA 2YA1A 3WJWA 3RFAA 2PDHA 3URQA 3SQMA 5TNVA 4AZIA 3W7KA 1Z8AA 1ENUA 3CH9A 2CLPA 1OFBA 3T6CA 2QCCA 1VHCA 3QQWA 3GNRA 3B8DA 2PSNA 5I78A 2YGYA 2AL1A 3VKAA 4TR9A 1YDNA 1GYMA 4MUPA 3BW4A 5CSSA 2NV1A 1D3CA 2WB5A 3L4WA 3EWZA 1NDZA 2XGZA 1MRQA 1XS2A 2Y88A 1IT8A 1CTNA 1D9EA 1ONRA 3MBFA 3R8HA 3KRSA 1JEZA 3DI0A 1GZJA 3UG5A 3LXCA 4I5RA 3H24A 3BGJA 3PC0A 3QMRA 1F05A 1GVYA 5REQA 4LYPA 4C1KA 2NQJA 3LG3A 4UZUA 3UGVA 1RK5A 1WP6A 1DL3A 2V68A 4G1KA 4DJFA 1U5HA 3SRKA 4S3BA 1OCBA 5CJNA 4AYGA 4GCAA 4C65A 3WH8A 6XIMA 3GHTA 1KFCA 2XH0A 3ABXA 2F8QA 1KXHA 3GTHA 1OK6A 1TV4A 3S4TA 2VDGA 5DBUA 4CQ8A 4LX4A 4M6VA 2YW4A 3EWDA 4PN2A 4US6A 2H3DA 4QITA 2UZ9A 3WNLA 4JR5A 1EDTA 1IXQA 1O12A 3WLKX 4A4AA 1JCYA 1JR1A 2CNCA 4DBWA 1KM0A 1OEPA 3GVGA 1E0WA 2YYUA 3UR2A 1T0OA 1H61A 4PEKA 1V08A 3UNDA 3SCNA 3G22A 1UZDA 2SFPA 4S3KA 4QTGA 1E56A 4RNJA 1C8YA 1A3WA 3K1GA 3BJSA 4GE8A 1KTBA 3VDAA 2C0HA 1U1UA 3GXPA 2Z25A 1YXYA 2PDIA 3NWRA 5D2TA 5DQPA 3LHYA 2X09A 1FQ0A 1KFLA 5I3FA 3ZT7A 1EEXA 4I9AA 3NZQA 3B04A 1EUAA 4H6QA 4W8BA 4UFIA 3UESA 1DWHM 3EB4A 4B3KA 1TPFA 4BQ3A 5J8LA 1WYIA 3P8IA 3BDKA 3T7VA 1WAUA 2BY2A 2ZCGA 3P14A 1W56A 3FYOA 4GXPA 2QF8A 5DN1A 2FGLA 4BR1A 2XN1A 3M64A 5CCZA 3W2KA 2D69A 2QCNA 4WHBA 3NQVA 3FVDA 1CXKA 1RJQA 2VR5A 2J8GA 4Y90A 1POJA 3DHDA 3LRMA 3E1F1 2WZHA 4UNKA 3OZMA 5LIYX 1S38A 2A3HA 2R1NA 3MSYA 3S6OA 2V38A 4BEUA 2A2IA 1IEQA 2YBVA 4WXZA 1XBZA 4AH7A 3E0IA 3SCPA 1KO0A 3KXQA 4Q22A 1J0IA 1SMDA 2FH8A 1RVKA 3SCWA 1XRVA 2C3ZA 1XW8A 4IMGA 4XBKA 2A3LA 1HGWA 2E6FA 2BVYA 3BAKA 4C6NA 3AALA 3H21A 3N04A 4NZ4A 4LNCA 1A4LA 2ZE3A 3W7OA 3N18A 4LBSA 3VKCA 3AICA 3EOEA 1UYQA 2C14A 4HNCA 1TPVA 3BCJA 3I7SA 2EHHA 3LCXA 4QRNA 3V1PA 4B91A 1EA9C 2I7GA 5I23A 1TJ2A 2HBXA 2PF8A 2NT1A 3KM8A 3RJXA 2DVTA 8A3HA 5DLCA 5AOUA 4HTYA 2W3ZA 2ODOA 3ZJ7A 1L6YA 1EH9A 5FJPA 1FWNA 2XIMA 2BVDA 4MB3A 2X0YA 2Q02A 3G3MA 2HEJA 1TPDA 3LPFA 3O16A 4IFRA 2INFA 1TJRA 3CL7A 3W1AA 4CNPA 4UFLA 4CD5A 4BQ5A 1P0BA 2I5GA 1LT8A 3M0HA 4A3HA 3WN6A 3HGSA 3EWWA 3GC2A 4DPPA 3BO9A 1AD4A 2PDNA 3EPMA 4AF0A 1XPGA 4TVUA 5DXYA 3R79A 2PRHA 3NXFA 4AXNA 1GORA 1Q4WA 4WOQA 2R1PA 1GVSA 3CB3A 1JUKA 3NQEA 1YADA 3EKLA 3NM1A 4IGMA 3W73A 7REQA 4MFEA 4M0XA 4D72A 4GJJA 1ISZA 5BXTA 3HU7A 3CAWA 3W75A 4JYEA 2JK2A 4OOUA 3URNA 2WVVB 1XIHA 3WFAA 2JF6A 4IGSA 2J6XA 2V2CA 1I4NA 1X1NA 3OOQA 4ZQCA 2CZFA 3T0DA 2ZWZA 5GNXA 3DFPA 3W2JA 5D38A 5AC5A 3NL2A 4U4MA 3V3WA 1I1XA 3N14A 1P5BA 5CSYA 3ZZ1A 2FB3A 3WQ8A 1UR2A 5HINA 1KFBA 2E5CA 4CD8A 2FVLA 2FTPA 3SN1A 5K7JA 2QAPA 1EXPA 1HJQA 3C3UA 1DPMA 1F8MA 3CHCA 5LXXA 4LUTB 2NXHA 2VJXA 5AFDA 3UZZA 3TVAA 3MMUA 4ZO9A 2NLYA 3GTXA 3C6CA 1RZMA 4LUIA 4IJBA 3N3MA 1YW1A 4PMVA 2YCLB 3Q2DA 5I3DA 4XZ9A 1T8QA 4HNLA 3G3DA 3L5MA 1TPUA 1E0VA 1UG6A 3GFZA 3WQEA 1AA1B 5HANA 2Z4GA 3ARQA 3V5FA 4BA0A 4HPXA 2WCSA 4DZ5A 1VGAA 1WKFA 3PZGA 4DM2A 1P0NA 8XIMA 2DGAA 1OC5A 1QATA 3FAWA 3M6YA 1E51A 4UCGA 1I0DA 1G4TA 3FJ4A 3A4JA 3CU2A 1US0A 2ACRA 4S2CA 3STEA 3G1RA 3QVQA 4E3TA 2YBUA 3WQPA 3T55A 1CWYA 3FK4A 4S3FA 1UD8A 1PZ2A 4MNLA 1ISXA 2BOGX 4JX5A 2OELA 3LGGA 4RE2A 2ZC1A 4HN8A 4YYFA 4DJDA 2FZ8A 1US3A 4W5UA 3DGRA 3IANA 4NSBA 5A8GA 1QK2A 3LN3A 3SSJA 3QTGA 4HA1A 1PKNA 1F73A 4MOZA 4RW3A 3WLTA 4Q4QA 4HU8A 5CC5A 4FNRA 3C2VA 2V63A 3VZYA 3C8FA 2ISFA 2DZVA 4H2HA 3MU7A 1WDDA 2NW0A 5D05A 1DWAM 3MT1A 2E5DA 4M1RA 4C6KA 4ML9A 1Q8JA 5I3HA 3VNMA 2P0IA 4Y9OA 4R53A 4A2SA 3ONBA 5K9CA 4RE0A 1FWBC 1VEMA 4QISA 5PTDA 3ABSA 3APGA 3PBGA 1Y5XA 4JQ2A 3SCUA 2CBIA 1AQMA 4MZYA 1VB9A 4PTVA 1JZ3A 1EQPA 1T40A 5EBAA 4HVXA 3GD6A 5K4XA 1Q2RA 1EKOA 4AZHA 3NURA 3MVTA 1KA9F 2V5DA 3CZJA 4H01A 5D09A 1J0KA 3KTSA 4XTDA 1YTDA 2V82A 3F5LA 4E4UA 4XZHA 1JD7A 3PB2A 1Q8AA 1HJXA 5F2IA 1R2RA 1VENA 2ZUNA 3C2RA 3TTYA 4HK5A 1X7IA 2JEPA 3VIIA 3A3WA 1WDWA 2V9DA 1A0DA 4PTWA 4S3EA 3CMGA 4N02A 4ZQPA 3DGBA 4PMJA 3IIZA 4LVFA 3PNZA 4K6AA 3S1WA 2FJKA 4DWSC 1KCKA 3HPAA 4J3WA 1YPFA 2R91A 3M7WA 1O5RA 1NEYA 5M17A 1KBLA 3CXOA 4XZWA 3WBWA 4RX0A 3LOTA 1SJDA 1E4IA 4BWLC 3F5JA 4Z2HA 3N2BA 3BXWA 2BNJA 3LCHA 5D2WA 3DG6A 3H70A 1GOQA 2WYSA 4PH6A 5CLWA 4V33A 4D8AA 2E67A 4DX3A 1W8SA 3SFWA 3EKZA 3HGJA 4X9YA 4HSHA 3ANUA 2PDFA 4DQWA 3UQNA 2YDRA 4DBEA 3NL6A 5LSMA 4Y8EA 3G77A 4FSAA 1HL2A 4XIAA 1LBFA 4HZ8A 4EXQA 4LF2A 3W87A 2Y24A 4P8VA 4AFYA 3R1ZA 1WX0A 2I14A 5C9XA 3TA9A 4UFMA 3KS6A 4B90A 4PMQA 1C7SA 2IPFA 3IVUA 2WV8A 5IBXA 3S2JA 3NQGA 5DELA 1UJQA 1OK4A 5F1VA 2WHLA 2B4GA 2CZDA 5BYWA 4ZO6A 3GNNA 5EPDA 1V79A 1RSCA 2ACQA 1HL8A 1KBBA 3PVFA 3UZXA 3GH4A 2NUYA 4CCZA 2ZQ0A 3V5CA 3DUGA 2POZA 1VAHA 1XD0A 1Z7AA 3FKRA 4MHBA 2VI0A 3MJYA 4WJEA 4Z1CA 3SUTA 2E3ZA 3HB9A 4H3DA 2ZC8A 4GNJA 2GSEA 5JMUA 1J0ZA 1W17A 4N4PA 1OADA 1TUXA 5LNWA 3GO2A 4TXEA 1XCWA 3TH6A 1FP8A 4LWWA 4WK9A 1WDRA 2Y5JA 2QEZA 4FIQA 4LAZA 1EBGA 3VILA 4LCSA 4IQLA 3CYJA 4PUMA 5EB8A 5FEZA 3CASA 2VVNA 2D2HA 5I3IA 4NL1A 4K8GA 2R14A 4J2MA 4PBFA 3RPTA 1QPNA 4ML4A 4NAEA 3LD5A 3GG7A 3FCPA 4PUUA 2ZUWA 1D8WA 3KCLA 3M0KA 1GKPA 3RX4A 3TDFA 3GG1A 4Y96A 3RG6A 3WNMA 5AC7A 1OX4A 5HXMA 1IZJA 3TU9A 5CJMA 4GYKA 3IGHX 1FDZA 2J8FA 3UWWA 1VJIA 2WANA 2CKRA 1JQXA 3GVWA 2ZDSA 2DV0A 1XDLA 3RRAA 1OD8A 2GSJA 3TYEA 3EDKA 4J40A 4R33A 4B3ZA 3WJZA 1LOQA 4WY0B 3U7VA 3MSGA 3H54A 1SZEA 2QUVA 4GJ1A 4HT3A 4F40A 1J0HA 2VDHA 2DFAA 3FYYA 3M6DA 3QC3A 1BXNA 5M03A 2R94A 2XN0A 3T07A 4GIRA 2R1MA 2XGIA 3OQEA 1VBJA 1UIPA 1KW1A 3WF0A 4URIA 3H26A 3BW3A 2EEXA 3DKJA 1MW2A 1OQFA 3O07A 3VM5A 1UKOA 2PBOA 3JUGA 1R0MA 2A3CA 3L4ZA 5CSUA 1XFCA 3O7UA 2PBGA 2MNRA 1MW0A 3WQDA 2A1YA 2EG7A 4OV4A 3TE9A 4JDYA 2X41A 3DAQA 1R6WA 1JQVA 5MKGB 4M5PA 1JDFA 3DOPA 3NCOA 2W62A 4B5XA 1K7EA 3W7QA 3EWUA 1N8FA 4WIWA 1SO6A 3I10A 4WUIA 4LVDA 4GYPA 2V5JA 3PUOA 3BLDA 4XAZA 5AC4A 4N9DA 4GXWA 4EPKA 1NQ6A 1X98A 1WDSA 2GOUA 4QXIA 1BTMA 2EQDA 1ONXA 5A2BA 4U3AA 1XI3A 1GT8A 4GUIA 1R47A 2X2GA 2VC5A 3VC5A 1C3FA 4B4HA 3EWYA 1PV8A 1GQNA 1EIBA 4HK7A 2RDUA 1ZBKA 4AZ5A 2VWTA 2WO5A 3JRKA 4C6BA 5F2LA 3H2NA 1VPQA 1VFMA 3DYOA 4N7QA 3K2GA 3UWEA 4UTIA 1MDLA 4WEVX 2VX5A 3LB0A 2CKSA 1GW1A 3VNIA 3RGTA 1J18A 4CN6A 4DLMA 4LEFA 3K1DA 3G24A 2GQ8A 2BODX 1RUSA 1F4AA 2P3ZA 3DYPA 4RNFA 3KTCA 5D02A 1K4GA 4IL0A 3MCMA 1F74A 3L2LA 1LLWA 5EMLA 3HG2A 1HG3A 4JTEA 2NXGA 1R86A 2GGIA 3OU8A 3GDKA 4FMVA 1H7WA 3O05A 5KZMA 1VC4A 5FF7A 5A6KA 3N19B 4HHLA 4U5IA 2QVHA 4IGNA 4Q6JA 2GQAA 4C6LA 4CUCA 4IMCA 4UOJA 1DIDA 2E8ZA 4MF4A 1AUSL 4HZMA 1TWZA 1QW9A 4FB7A 4IIHA 4CNNA 1BFNA 4XAPA 1UWRA 2B7QA 2DQXA 1JRCA 3N2TA 4WDTA 5C9ZA 1ZJAA 3PZQA 1EGMA 1ELSA 3MO4A 2FVMA 1UBSA 4PCNA 4BY3A 2Y5EA 1FRBA 4DEFA 2W79A 5J04A 2WZIA 5HQEA 1P7TA 4G1NA 5AHIA 5TIMA 3N29A 2IQTA 3WL1A 3N4FA 1PZ1A 2FYMA 4NI8A 4MB5A 3RK8A 4HZ7A 3W0KA 3EB2A 2HS6A 3VGHA 1RJRA 4DJFC 3A9IA 4PR4A 2OT1A 4QX4A 4GI4A 3M0VA 3TA6A 1JFHA 4M51A 3MWCA 1CXIA 3VMOA 1XIFA 4DXVA 3AHYA 4JICA 3N34A 2G3IA 1UMYA 5G5IA 6CGTA 1JUBA 2X0SA 3OLGA 4ICMA 4HHHA 3FDKA 1J6OA 2EF9A 2GGJA 1NQKA 3AIUA 1XIIA 4C1LA 1JCJA 4DZHA 1KGWA 3TEVA 4F48A 3NXLA 4Q7BA 4Q3MA 4DUVA 3PK7A 3CAQA 4G2DA 3PPCA 1DJZA 3MUCA 2HISA 1FCQA 4XZMX 2WC7A 1ZAJA 1EGZA 1F5ZA 1NFPA 2GDUA 3ZO9A 1KFKA 4ICNA 3LCGA 3QQ0A 3T05A 1BVWA 2XZ7A 3TXZA 3M16A 4F9DA 2IQ0A 3LRLA 3B9NA 3Q45A 4GY7A 5C9WA 3WD4A 1SO4A 4DB7A 1UD5A 3IACA 4AG0A 3A13A 4MVAA 5FEXA 2C13A 3AFBA 3I3DA 4GCXA 4QR6A 3VOJA 3PJWA 4AEFA 1B54A 2R82A 3AC0A 5ABHA 2VWSA 3QZAA 4BQ2A 2PTDA 4M6UA 3CJPA 2G95A 4P8WA 1OG0A 4AQLA 2BP1A 3QGVA 1TE6A 2BVTA 2CITA 1QWGA 2KAUC 1NARA 2J77A 3OYZA 3KDOA 4AWUA 1EO7A 1EF2A 3M46A 4O53A 4R27A 1E6PA 2G3JA 3GHRA 4L1GA 4UBPC 4YCPA 2BGSA 3MC5A 4LYKA 1KM4A 2NT0A 1GJUA 2OEJA 2CZ5A 4Q4MA 4UQAA 1S39A 4I5XA 2VQTA 1VJZA 1K3UA 2Z6IA 2L5HA 5AZ1A 1HKMA 3R0KA 3L2IA 3EA2A 3T4WA 1DIOA 4G7EA 5CGMA 2RH9A 3P2VA 3APYA 4JZ5A 4QJ3B 1KCZA 4WY0F 1U5JA 1HQTA 3QR0A 3WK3A 1WNOA 1TMLA 3II1A 4C6QA 4HHPA 4D6CA 5DF0A 1MRAA 4XZNX 1M9HA 4GIYA 4F0LA 3RM4A 2Y62A 3AZRA 3WSUA 1HVQA 4H9UA 4RV3A 3W7RA 1RA5A 2ONEA 5LIWX 4MG4A 4Z2GA 1LRNA 2B7PA 2WNQA 4MY9A 1F6YA 5JUVA 1A49A 1W37A 1PVNA 3RLGA 3UYCA 5C71A 1Q7ZA 1GYLA 3TW9A 3I7QA 1P0EA 2PCQA 4EKJA 1HZYA 4RJEA 4DBDA 3HQOA 4UQDA 1V6UA 4GIAA 4J27A 3E74A 2G97A 4IM4A 2PRLA 2V81A 3PUEA 4ADUA 1TRIA 1PCKA 1MFVA 1IT7A 3WZ0E 4GQBA 4KFNA 3ABZA 4TV6A 4WDXA 3QHNA 3W84A 1KKRA 1GWJA 1BYAA 2FHFA 5SWUA 3W1LA 1DXEA 4F0MA 3N73A 4H8UA 3IPWA 1ZENA 4M3PA 4QFUA 5DFAA 2DUXA 2CZVA 4LXFA 3UR8A 2E9LA 3PBUA 3GTFA 4BI6A 1A5NC 4R7OA 3PFRA 4C60A 1V0NA 3CLMA 4I8DA 3BH4A 1JULA 5EMYA 3ITOA 1JD9A 1UKPA 3NJ3A 4N9EA 1C90A 3OB8A 1GG1A 3TJXA 1MW1A 5FL1A 4IX0A 3GNOA 2OMAA 1JVNA 4XAGA 4L6HA 3W2NA 1A3HA 1HKJA 3WQCA 1V6TA 2R24A 4KPLA 3F2BA 4FEZA 3O6AA 1FKXA 1V8EA 2IKHA 4IIGA 1RD6A 4LPCA 3SGUA 1YKWA 4JCLA 1IXNA 4BKNA 2GVEA 3W3OA 3NM3A 3QSTA 2I57A 4NVTA 3FA5A 5A6LA 4AISA 1GPFA 3NG3A 1K9DA 5H1WA 5EMMA 5B7ZA 1K8YA 1OF6A 3WLOA 1UOZA 4JEJA 3KCJA 5EKYA 4W7WA 4RNIA 1RA0A 1JPKA 4GG9A 1FWTA 1IZKA 3AS1A 4ACZA 4NAFA 2P10A 1UW9A 5AN7A 3TJIA 4AWEA 2QUNA 1B3XA 1V6WA 4E0CA 2UV8G 3QPZA 1E6SM 5D2VA 4X22A 2R6OA 2ABAA 2PWVA 5CLTA 1Q6FA 1BVZA 3N1AA 1FWEC 2VEIA 2DPEA 1D2KA 1WO2A 1S2CA 3UWQA 3MJMA 4PB3A 4F2BA 5I2UA 3TOYA 4YTUA 1WZAA 5FSDC 3PTMA 1UR1A 3I3BA 5K2ZA 5H8PA 4E38A 4JTGA 5D32A 1XINA 3DIPA 5LYRA 2RAGA 3K4WA 3V36A 3VIFA 1JIBA 2Q8LA 4DJDC 2PRMA 1UQZA 3AYSA 4Q4RA 1H1NA 2WC4A 2IQDA 4IISA 4X60A 7CGTA 2P0OA 2ZZ1A 3BV7A 4ZENA 3EMZA 5T9CE 1CBGA 1RPXA 1HIZA 3GXIA 2V3DA 3OLIA 2GDQA 4HMCA 4K1WA 5I07A 2QMKA 3T1GA 4Q7IA 1JPIA 3GUWA 4RPPA 1SM9A 2GJXA 4RXFA 1IEXA 4WZHA 4JFWA 3SUWA 1CIUA 1UA7A 1E9IA 1UH4A 4JTKA 4O1AA 1ITXA 4JIEA 3L4TA 5EMUA 2JEQA 2CBVA 4XD3A 3T0CA 3RCMA 4ZO7A 3PJXA 5IFPA 1JDAA 2WNNA 1GOMA 4LUYA 2VL4A 5FJJA 2CHRA 5E1QA 2BY1A 4GX8A 4J1OA 3N9SA 2G37A 3ZR4A 4E5TA 1R9ZA 1OD0A 2E4TA 1NP0A 1WKYA 2MANA 2XHYA 3OEXA 2I9EA 2VRJA 5HQMA 4GVGA 4JEQA 4PCTA 5H8UA 2WNZA 1R3SA 5DMNA 4L61A 1H5VA 1RPKA 2XM2A 2BOEX 3G0XA 2QV5A 3LTYA 2HK0A 1BD0A 1QBBA 3D3FA 2R9RA 2A5HA 1GNXA 1H63A 1SPQA 5DRCA 4Z17A 2VCBA 3NSNA 1EBHA 1VEPA 1DTNA 7TIMA 4EOUA 5D37A 1S3TC 4PBGA 3NIYA 2FB2A 1G7VA 2D0HA 3KL5A 1XGEA 2PDJA 4TTGA 1M1BA 1YTEA 1TJ0A 3BE7A 1XLGA 4A21A 3B0YA 3N2XA 4GJIA 4DO7A 1MW3A 4ZB5A 2JKPA 1XBYA 1LRTA 1PZ0A 1JRBA 1TPC1 2ZX5A 3WO8A 5D2XA 2Q8XA 1QI0A 3PPHA 1OIMA 3RLUA 2QCEA 1UUMA 1LJYA 4GZEA 4PMXA 3TWBA 2Y61A 3F5KA 5FACA 2P5NA 5LZLA 3WG6A 3WY1A 4X2PA 3QSRA 1PTAA 3U9IA 4HNUA 5I00A 2PP0A 3USZA 1LOSA 2NVCA 2BV9A 4GI9A 4PEEA 4LW7A 1A47A 1YNYA 3ARXA 4REQA 2VZTA 4UMAA 1A0CA 4L64A 1NF7A 3LS9A 3W2LA 1BSIA 4LC8A 3H8AA 4D6FA 4CD6A 3GG8A 1CEOA 1RR2A 3DFYA 4ORIA 3POCA 2X7VA 3KEHA 4H6EA 9CGTA 5A6BD 3FDGA 3VMPA 3WDQA 3ZT6A 4HKPA 5BOEA 3M9YA 2Z1KA 5IBXC 3TK7A 3V7PA 3O6YX 3TQVA 3C0JA 4C1NB 2GVLA 4X2RA 3TYUA 4GMEA 1S2TA 1REQA 1GVRA 2GK1B 1FWGC 4IPLA 2HBVA 4H41A 4JYDA 4V2XA 5K9XA 1OGBA 5G2IA 2G4JA 2R1LA 1DP0A 3QW4B 3KLKA 3SIZA 5JQ9A 4C7DA 2GJLA 1Q6LA 4UC5A 1VS1A 2AAAA 1O60A 3ABOA 4OJYA 2AL2B 3NQ2A 1KLYA 4GHRA 3EA3A 2OKTA 4MKVA 4RW5A 3SGGA 5DT7A 1KM1A 1LTDA 3DC0A 1VBHA 1ITQA 2Y6ZA 4PUDA 1SR0A 4YWSA 1G1YA 2V8ZA 3BWWA 1UR4A 3MCNA 1DJHA 3FIGA 5A6TC 1W1A1 1W31A 1QJWA 4LT9A 4LUSA 5L9FA 3UXKA 3VKBA 2VR4A 3CUJA 4JTJA 4Z1BA 5C7HA 4YS1A 4TIMA 2CLMA 1LWHA 1L2QA 3LHWA 1FCVA 1JI1A 1ZY9A 2WK2A 2YKKA 5FSEC 2WVVA 3NQBA 1SJBA 3G8EA 3RR1A 3SZ8A 3WLSA 4H04A 2F6XA 1VR6A 4AC1X 5AYBA 3W4RA 2INEA 2G3FA 1M01A 4PSPA 3TYDA 1W3JA 4R34A 3AS2A 5CQ1A 1UR9A 2DZUA 4ZO8A 4EXAA 4UR8A 2PA6A 2DIKA 3R94A 5HUPA 3HPZA 1TA3A 4GH3A 2J47A 1A0EA 5EMJA 3D6NA 3MUZ1 5HJYA 7ODCA 2H8XA 2OXNA 3L2MA 1QVBA 1IXPA 3L4XA 1ESWA 3AYVA 4FLQA 2GWNA 4LNYA 4EANA 3R8RA 2Y8KA 4DLFA 3Q37A 2NX9A 2YW3A 3WD0A 1AMYA 3L0KA 1J0YA 2JFEX 2WMIB 3W01A 3CV2A 1QNRA 4GK8A 3ARUA 2C1HA 1QU4A 4MWAC 5A8MA 3WK0A 3MHUA 4H00A 4EPDC 3L0NA 4W89A 3DFTA 4HJFA 1AJZA 4OECA 4PL2A 5E9AA 1Z42A 2A21A 1VFFA 1DQXA 2Y8VA 4A8IA 1HNYA 1LM1A 5CPMA 1MUCA 1TZ7A 4AXKA 3GIPA 3AIRA 4N9CA 3CYVA 5CXPA 1WXYA 4GYPC 1FDJA 3NUKA 4HNVA 3FX4A 2VENA 4PGLA 4AX7A 4A2RA 4GVIA 4GFIA 4LRSA 2Y1HA 4Z0SA 4KIRA 1P48A 3LHVA 2UBPC 2PF0A 3I3EA 1SFJA 3BLLA 2WZEA 4L4OA 5CJ5A 1VIWA 1DWJM 2O55A 4Y2WA 4E8CA 2Z24A 4Q6XA 4O17A 4ENLA 1TMQA 1ADDA 3EBVA 1J8VA 1V4YA 3VA8A 3BSMA 2WM1A 2QIIA 4UTJA 3C86A 1IR2A 4LV9A 1F8IA 2QIWA 1GZ1A 4JL1A 2RKXA 3KZPA 2GL5A 1WXZA 1JZ7A 3S2NA 1R3VA 4XIMA 1W3TA 4XZLX 4QLJA 3S5SA 3L66A 3SI9A 3TSMA 1CGYA 3EGJA 3BG3A 2HJPA 4A8LA 4A3RA 1SUXA 1UZ4A 2ATSA 4FX8A 1AW1A 4S3CA 2Z2AA 3LTSA 4WGXA 1XRSA 3ZVHA 2WSQA 3PJTA 2D0FA 2OZ0A 4CNOA 4GGHA 1GEQA 4I9MA 4JHMA 2Q3OA 2IXVA 1D8CA 1XQLA 3T8QA 1CB7B 3EX1A 1EA0A 3GDTA 3R11A 4C6OA 1NELA 5I02A 2EAWA 2ZOXA 3CHFA 2V67A 3EX2A 3C8NA 1E4LA 3VUPA 3TZNA 3DHUA 4NUWA 4UR7A 3VDGA 3PUGA 5FKYA 2PS2A 4DJFD 5FESA 4UR9A 3SW6A 1VBGA 3NTYA 2NQ5A 2Z1WA 1FHLA 1IGWA 4QROA 3O6DA 2A4AA 4M7TA 3KBNA 3EYPA 1U30A 1YHTA 3P5YA 1DE5A 5ABFB 1TR9A 5AHFA 3KP1A 4I5UA 1CNVA 3QW3A 3RPMA 4GD0A 3R5EA 3FFSA 4YMZA 1XDMA 1G7UA 1ADOA 4HMNA 2RJGA 3HO8A 4JCMA 4JY9A 1CW2A 4LH8A 4I7UA 5A2AA 1AH4A 2XU2A 3EOOA 3T2PA 1OJXA 3GDLA 3I4KA 3TUUA 1E40A 3OP2A 1PEZA 1PTDA 1XIBA 3INPA 3ZLHA 1P0DA 1B0IA 1MMFA 2FZDA 3E38A 1U2YA 4PRTA 3FSUA 1QO5A 4FNTA 2OGYA 3AMDA 4B5WA 2V0TA 1K8XA 6A3HA 2PC8A 2I17A 1W9XA 4IFKB 3B8UA 2Y4SA 3QF0A 3ZLFA 1LL7A 3UXDA 5G2HA 4F4RA 4PODA 4QEHA 1MYRA 2BHYA 2ADAA 2ESCA 2F84A 2PP1A 5D9PA 1QAPA 3OGRA 3FHAA 1HVXA 3BC9A 2QPSA 4OKDA 1M03A 2FVKA 2PTYA 4PUKA 1J9YA 3E2SA 3HJZA 3PUDA 1KTNA 4DZIA 1KCXA 3BSGA 3GC4A 3APTA 4DPQA 2REQA 1D3HA 2ZZ5A 3EWCA 2NSOA 1XLFA 5C6MA 4GKLA 4J3VA 1LORA 1FTXA 3WMSA 2RGMA 9XIAA 4WKFA 5C7VA 5HPCA 1PIIA 5E0CA 1V3MA 2F2KA 4NZCA 5G4EA 3VKJA 2AQOA 1LROA 3F4NA 4BJHA 3I68A 1ME8A 3KS5A 1GUVA 1PYMA 3GXFA 3UXLA 1UH3A 1XSIA 1V3LA 4UUIA 4BF7A 3PF3A 1LZOA 4IMFA 5ECVA 3GAYA 5HMFA 1DHPA 5I03A 3LRKA 3L65A 3U8GA 2QNEA 4PSRA 3HQPA 2HXTA 4MNJA 4JFTA 4PTMA 3DYMA 4YPJA 1QNOA 1BWLA 1KGXA 5F4WA 5HMDA 3L21A 4E4FA 4IWWA 2ISWA 4DO6A 1XUUA 1AZ2A 4DAFA 3LZ3A 3S9YA 4Z1AA 4H8NA 1DJNA 3QV9A 4NY2A 4IOTA 3K8LA 1M65A 3QY7A 5IOBA 3VM7A 3S6DA 2XM1A 1QDSA 4HSNA 1J6PA 4XD6A 3W1XA 2F9RA 3LSBA 1IEIA 1XLCA 5DMLA 2EG8A 1ISWA 3TYBA 3WQVA 3AS3A 4PUJA 4G9PA 1R87A 1E4NA 3BTNA 4DWSB 5DBTA 3AWOA 2HTMA 2FIQA 1VCVA 1V7YA 3URAA 1UHVA 2YCIX 2VGBA 3OLDA 2QT3A 3BG9A 4BK9A 3H4GA 2TAAA 1GGOA 2YA2A 4JIQA 2VTFA 3AMGA 3P84A 3N6JA 2I56A 1TTQA 2V5BA 2C0AA 4WY0A 4UTMA 1O7AA 2QJHA 4IF2A 4NJGA 5EBUA 1QW8A 1EP3A 2DSZA 3S1XA 3LENA 4JQ1A 1KB3A 4P7QA 5F2GA 4XV0A 1TPWA 3W9ZA 2ACSA 4O0QA 3S6TA 2CZEA 4ZQMA 1PIGA 4DUOA 1EP1A 1W9DM 3IIXA 1WCGA 4P5UA 2WVSA 4IIDA 4Z2JA 1NU5A 2YZRA 3VO0A 3H2AA 3GH5A 3FN9A 3OZYA 1AZ1A 1Q6QA 2OO6A 2GUUA 3W1PA 2Z1SA 3LNMA 2ZRYA 4KRZA 4PA8A 5HUOA 3W28A 3ES7A 4JHOA 2PZ0A 1FWRA 2VFFA 1VYRA 2CEQA 8RUCA 2X30A 1WUEA 3PBMA 4NQ1A 3SAZA 4IMAA 2NUXA 3HF3A 3HOJA 2ZA2A 3FVMA 3HZ3A 3DH7A 4QE1A 4HYRA 3A6OA 1V0MA 1M41A 1CB2A 1S1RA 1JF5A 4W5ZA 3CWNA 4UB9A 4AZ7A 4YXGA 4DZAA 2XG9A 3MSDA 2WNWA 3ARYA 4ZOBA 4Z08A 2FHCA 4HOXA 4A3UA 3PZTA 6TIMA 4JXCA 5BCAA 3U57A 3UZJA 1XH0A 2VFHA 3QQ1A 4HBKA 3VK5A 4FPSA 2IW0A 3HQ1A 1QNVA 1AJ0A 5J5RA 4UOZA 3ZOAA 3MZNA 4IMDA 4S3JA 4EPBC 5AYZA 5LGZA 2YIHA 3WNPA 1B2YA 4JGDA 3TOPA 2JF7A 4FOKA 4J3ZA 1QPRA 1K8CA 4FXFA 3MHGA 1E72M 3TTOA 3K8KA 1GKQA 2G3NA 4I7VA 4LAUA 4S23A 1KLZA 1O1ZA 3ICJA 3M07A 2VC9A 5F1UA 4RXGA 2VQUA 4CGTA 4CU8A 1JXKA 2B7OA 3AYTA 3IWPA 5GPRA 3SJNA 1B4EA 3CV6A 4I7WA 4FXSA 3WX7A 1R9YA 4UTLA 3WCZA 1G4EA 1O68A 4YWIA 2VEKA 4L4MA 3WDPP 8CGTA 3VFLA 4PMDA 2E1WA 3BLKA 3BK0A 4X3ZA 2J74A 3P60A 3WBXA 4LFYA 1Q65A 1YE6A 2Z00A 3AHTA 4A3YA 3EDFA 5CPLA 3UCDA 1RY0A 3H2CA 4ZODA 1MVYA 1G4PA 1RXOB 1PWLA 4DAIA 1UWQA 5ENLA 5C55A 4ADSA 2PI6A 2O7QA 1TVLA 3WYZA 4NG3A 3ZT5A 4K36A 1AW2A 1HN1A 2FTYA 2GUBA 1UR8A 2QCDB 4PTDA 1QI5A 3TTQA 2EPNA 3NQAA 3P82A 3GIYA 3KOWA 1L6SA 3IGUA 5DT5A 3RM9A 3EDDA 1W9BM 4E2DA 2WM0A 2YL6A 3I4EA 4C6IA 1FX6A 4FNQA 4U2ZA 1US2A 1W3HA 4QJ1A 4KRUA 2GQ9A 1PTGA 1B57A 3GYCA 3M43A 5IM51 3U2EA 1K03A 1O5XA 4A29A 3N4AA 1C8QA 4JN7A 3T2OA 4PFMA 3NGFA 1GK8A 4GNKB 4M29A 4TVDA 1GQJA 4LANA 3M0XA 5U4NA 2QGHA 4KWVA 5AVHA 4PB5A 2BY0A 3LM7A 4FXRA 5DCBA 5K9DA 2YR1A 4J3XA 5A8NA 2DU2A 3ARWA 1B3YA 4X61A 1N7KA 4FX7A 4KEZA 5D9OA 2YSWA 2DIEA 3CK5A 3TC7A 4AUBA 3HFYA 2AMGA 4P7OA 3EB3A 4H19A 4FNPA 2ALDA 3CL6A 1U33A 1J2WA 1KXTA 2J6VA 1DKWA 3TR9A 8TIMA 2CHNA 5C2XA 4PUWA 5ABGA 2W5FA 3IJQA 3NO3A 4PMOA 5HNRA 1NWUA 3B0XA 4F0HA 3G1HA 3F03K 2PDBA 3CZ8A 5GJNA 3VIGA 1HKVA 1W1IE 2CXEA 4K8EA 2TSYA 4W7UA 2QXWA 1G69A 5AVNA 4IQJA 4KCVA 1K4HA 3GG0A 1Y5VA 1E3ZA 3U6WA 3GU9A 1SU5A 4S39A 5FEWA 1EPXA 1B31A 3C0LA 5A6BA 2CLHA 4CEUC 2XH2A 2I5QA 1QNQA 2VFIA 2ZUUA 4GZIA 2PTXA 3NZRA 2GWGA 2ZXDA 5KZEA 3TSDA 4M7SA 4N2YA 3W6MA 3BAWA 4Z2LA 1PJ9A 4LU0A 4GO8A 2A3EA 3TLLA 4A22A 4U31A 3E12A 2ZWYA 4EXBA 4YYCA 4OOZA 1A3XA 3WDHA 3IIOA 2EKCA 3EMQA 3C2YA 4HU0A 2DZSA 1JZ2A 5REQB 3GW0A 3B0PA 3SADA 3FYPA 3WLIA 2DH2A 4GYJA 3RILA 2WQPA 3WELA 3RPDA 1WBHA 2VZOA 4JTIA 2ATMA 1JYVA 2V69A 3GBEA 1VPYA 3NL5A 3IJDA 1T6MA 3RLVA 3AMLA 2HMCA 1FWCC 3IV3A 1FH9A 3GTIA 5HJLA 2GGHA 2G5WA 5A94A 1EXBA 2Y7EA 2OJPA 3UEQA 1QTWA 2H8ZA 2IXUA 2QDEA 1XCFA 3GSMA 3WF4A 1RBLA 3BOLA 2X2YA 4QLKA 4GVHA 4NX0A 2XUCA 3STGA 1TR1A 2XVLA 2PGFA 2NZLA 3O9NA 1ZZMA 1C7TA 2XISA 2D3NA 3M0MA 1TTIA 1ICSA 4N4QA 3IUHA 1J96A 3P6LA 2HS8A 3VD4A 2Y85A 1H7NA 1EC8A 4L9ZA 4B5VA 1A5UA 2VYOA 1AG1O 3WL0A 2OQHA 1DYSA 3LSCA 2ZRVA 1W3NA 4AEEA 5C54A 3RR4A 3POHA 3CM4A 1PDYA 2XIQA 3C56A 2P3EA 2OO0A 3M7SA 2CIPA 1JGIA 2TYSA 2WJZA 1C8XA 3SSZA 4DWDA 4D6DA 4JX6A 4MWAD 3AIEA 5A5WA 2OWXA 1B1YA 3TV8A 1VRDA 3TFCA 3DHPA 4QHRA 1FWWA 3DKLA 2O7SA 1NOUA 2OSWA 3N9KA 4H1ZA 4RKAA 4JTFA 1M68A 2Q3RA 2X0HA 2XDFA 3SCVA 2PDCA 3DENA 1EJRC 4IGHA 3LLXA 4GQQA 2J7EA 4JFSA 1EPVA 3CL8A 4L1WA 4UTFA 4IP5A 3T0AA 1BQGA 4U10A 5CAHA 3H53A 3K4DA 4L9YA 1M7XA 3FV9A 4QS5A 2A7NA 1X6LA 4AHOA 3QLLA 4HCHA 3OIHA 4JTUA 2XFFA 1EL3A 4R7JA 1F3WA 3E96A 5RUBA 3CTTA 4JOMA 5G4WA 3UERA 3UWZA 4S3AA 3N2OA 1CGVA 5LXEA 1VD6A 2P8CA 3QEZA 1XD1A 3AOFA 1QOXA 3ITTA 3NO5A 4GXMA 3VE7A 1WOBA 4AIEA 5CC7A 2ZUVA 3O3RA 3H7UA 5LGXA 1KRMA 1Y5WA 4V1XA 2NXIA 1E55A 3B8SA 1YYAA 1I8JA 1XBVA