1VP5A

Crystal structure of 2,5-diketo-d-gluconic acid reductase (tm1009) from thermotoga maritima at 2.40 a resolution
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
284
structure length
284
Chain Sequence
b'QVPKVTLNNGVEMPILGYGVFQIPPEKTEECVYEAIKVGYRLIDTAASYMNEEGVGRAIKRAIDEGIVRREELFVTTKLWVSDVGYESTKKAFEKSLKKLQLEYIDLYLIHQPFGDVHCAWKAMEEMYKDGLVRAIGVSNFYPDRLMDLMVHHEIVPAVNQIEIHPFYQRQEEIEFMRNYNIQPEAWGPFAEGRKNIFQNGVLRSIAEKYGKTVAQVILRWLTQKGIVAIPKTVRRERMKENISIFDFELTQEDMEKIATLDEGQSAFFSHRDPEVVKWICSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,5-diketo-D-gluconic acid reductase
publication title Crystal structure of 2,5-diketo-D-gluconic acid reductase (TM1009) from Thermotoga maritima at 2.40 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Oxidoreductase
total genus 108
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 1.1.1.274: 2,5-didehydrogluconate reductase (2-dehydro-D-gluconate-forming).
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1vp5A00
1XJBA 2F38A 2HEJA 2PDYA 3LQGA 1YNQA 2FZ9A 2PDIA 1XGDA 4R9OA 3QKZA 3NTYA 1RY8A 1US0A 2FZ8A 2ACQA 4XVEA 4L1XA 5AZ0A 4WDTA 2HV5A 3WBWA 3UZZA 3LBOA 3M4HA 2C91A 2HE8A 2PDBA 3UYIA 4HMNA 4FZIA 1EF3A 4Q3MA 1ZQ5A 1SM9A 1S2AA 2HDJA 3MB9A 3COTA 3R43A 2FZBA 3M64A 5JH2A 2PEVA 2PF8A 4DZ5A 2R24A 4GCAA 1OG6A 1J96A 3WG6A 1PWLA 4LB4A 4QR6A 2INEA 4G5DA 4GA8A 4LAZA 5LIYX 4PR4A 3R94A 4L1WA 2IKJA 1Z9AA 3UWEA 4ZFCA 2IPWA 3H4GA 5HA7A 1ADSA 3BCJA 5DANA 4JQAA 1VBJA 1EXBA 4YVVA 3LZ3A 2PD5A 5M2FX 4GQGA 3V0TA 1PZ0A 3RX3A 4ICCX 3LQLA 2PD9A 2I17A 4XZNX 2NVDA 1YNPA 1RY0A 1AZ2A 3RX2A 2PDWA 2J8TA 1YE4A 2DUXA 1Z89A 1QRQA 3GUGA 3G1RA 1HW6A 2CLPA 3P2VA 3G5EA 4IGSA 3LD5A 2PDGA 1FRBA 4H8NA 4PRRA 4QX4A 2HVOA 2PDQA 1AFSA 2PDNA 1Q5MA 3H7RA 4JIIX 1UR3M 3N2TA 3LEPA 3WCZA 5AZ1A 3T42A 4FALA 4XVDA 5LIXX 3GHTA 3B3DA 3BUVA 4GQ0A 4PUUA 1Z3NA 5JH1A 3N6QA 1AH3A 2IKHA 3R8GA 5HNUA 1AH0A 4XO6A 2ISFA 3ONCA 4PUWA 3UG8A 4QXIA 2IPGA 5LIWX 3GHUA 2WZTA 4XZMX 3V35A 1XF0A 2FGBA 4GIEA 3UZYA 4NKCA 4WDWA 1X98A 2AGTA 2VDGA 3EAUA 2IQDA 3V0UA 4IJCA 4IJRA 4MHBA 4GACA 1M9HA 2I16A 3CASA 2A79A 3Q67A 4FAMA 3R6IA 3H7UA 4LBSA 2IPFA 4JTCA 4WGHA 1AZ1A 3UP8A 4FA3A 4DBUA 2DUZA 2PDLA 4HBKA 4JIHA 4YU1A 4LAUA 3RX4A 3BURA 4JQ3A 2PDUA 4WDUA 3CAVA 1Q13A 4RPQA 3LENA 2PDKA 3CMFA 4OTKA 3R8HA 4AUBA 3V0SA 2PDCA 4EXBA 2ALRA 1ZUAX 3C3UA 3Q65A 1ZSXA 3DN5A 2IKIA 4YVPA 4LBRA 5KETA 2PDHA 2PDMA 3BV7A 2PDPA 4XZIA 2HVNA 3CAQA 3O3RA 3D3FA 4JQ4A 2PFHA 2INZA 4I5XA 1YE6A 1RALA 2ACUA 2QXWA 1EL3A 1MRQA 1QWKA 2HE5A 3M0IA 3V36A 2IPJA 1LQAA 2P5NA 4XK2A 1JEZA 4XZLX 2FZDA 3F7JA 4DBWA 3CV7A 4QBXA 1LWIA 1R38A 2PDJA 3LZ5A 1T41A 3UGRA 1C9WA 4XZHA 3KRBA 4LB3A 3S3GA 3FJNA 3EB3A 1GVEA 2F2KA 4JQ2A 3DOPA 1PYFA 4Q7BA 4EXAA 2R9RA 1A80A 4JQ1A 4JTRA 2BGQA 2ACSA 1X97A 1EKOA 4WRHA 2FVLA 1IEIA 2IKGA 2DV0A 1S1RA 4XO7A 1S2CA 2IS7A 4YVXA 3EB4A 3R58A 3CV6A 4PMJA 5C7HA 2BP1A 3U2CA 4H7CA 1K8CA 4WEVX 1MZRA 1ZGDA 2PDFA 1T40A 3WBXA 3MC5A 4GABA 2PZNA 4F40A 2BGSA 3WBYA 1PWMA 3ONBA 3GHRA 3UZXA 4JTQA 1AH4A 1MI3A 2WZMA 3LUTA 4WDXA 3FX4A 2ACRA 1PZ1A 5LIUX 3LN3A 4DBSA 1Z8AA 4ASTA 4JIRA 4JTDA 4JTAA 1X96A 2NVCA 2IQ0A 2PDXA 1HQTA 1VP5A 3UZWA 1IHIA 3R7MA 3O0KA 4PRTA 5HNTA 3VXGA 3LNMA 3ERPA 3UFYA 5LIKX 3GHSA 1S1PA 4YS1A 4XAPA
chains in the Genus database with same CATH superfamily
1I2QA 3OHIA 3DI0A 1GJUA 2OSYA 3RRXA 1U5VA 1XBVA 3KBNA 3RO8A 4F0HA 5HJXA 3LG3A 2XGIA 3MP5A 2J25A 3CUHA 4HA4A 4V1XA 3BAIA 4I6VA 4ML9A 1W2PA 3U2EA 5LNSA 4Z1YA 2CBIA 2X0HA 4R7OA 4FNQA 4DO6A 4AVOA 4GNJA 1BRLA 3UY8A 3S8HA 4B9YA 3GY1A 4FZIA 1TWSA 4HMDA 4L4LA 5G1MA 4IFOA 3NQ8A 1PKNA 4NI8A 4OECA 1E6NA 3H21A 3TMLA 4QTGA 1IGSA 3IGUA 4ZTXA 3EDJA 4W87A 1LLZA 5CXPA 5HQLA 3T40A 4QR6A 3M16A 3N15A 2QCEA 4P7QA 2A3HA 5DBUA 3MSDA 1H2JA 8A3HA 1MUMA 4O12A 4RE0A 1RCOB 3GXFA 1GTEA 4KGJA 3NQEA 3OU8A 3G0XA 4FXJA 8CGTA 5K7JA 1V7YA 4QLJA 1OGBA 2CLFA 3AJ7A 4TVCA 3M46A 1LBMA 1W1B1 1GZJA 2PD5A 5M2FX 2CIPA 3TSBA 4Z2IA 3EX2A 1S5VA 3EWUA 4ATLA 5CPLA 1MEWA 3KWSA 4MZ1A 4ZCWA 2PMQA 2PD9A 3L9CA 4LALA 2WJZA 5HXMA 2DEPA 2FPVA 4LV4A 5A2AA 2O7SA 1CLXA 2NZLA 1R3RA 1WDRA 3E38A 5A5WA 1FCUA 1JUEA 1LT8A 1RUSA 3MW7A 5HOSA 2H3DA 2CLPA 2VR4A 2YDSA 5FJRA 5FF4A 3MP4A 3B9EA 3E0LA 8RUCA 5I03A 4NNBA 3PF3A 1R47A 2PDQA 3C5QA 4XZ9A 4R53A 5HR7A 2EPKX 3E0VA 4JX4A 4MTVA 3VKKA 4LGXA 1M03A 3LCFA 1QTWA 3SR7A 5HMEA 2IXUA 1ISXA 5ABFB 1T6MA 4E3VA 1P48A 1W0MA 6ALDA 1J10A 1AH3A 2I14A 5HNUA 2E5CA 3G0SA 3AISA 4UTFA 3MUZ1 5FA5A 2G4JA 4FB7A 1AD4A 3BLPX 3MQTA 4AMAA 2YYUA 2YA1A 4JL1A 2V38A 2YFNA 1W37A 3DYPA 4J3VA 2V30A 3KUMA 1KLZA 2FGBA 4O15A 4C91A 2FHFA 4DPPA 3W53A 4F8XA 1CGYA 4DZAA 1GG0A 3KVJA 4KCTA 4YTSA 1HO1A 1VQTA 2EPOA 3KLLA 3I3DA 3PZUA 3UPBA 3IANA 4OOUA 4CNNA 5JVLA 4UOQA 5AHFA 2WOQA 4QRNA 3W1UA 4U2YA 3I6TA 1OSEA 1QPKA 3HV8A 3ATYA 3KZSA 3NZ1A 4D1JA 2E77A 3OB8A 1PX4A 1QI5A 4N6FA 1QHZA 1WKFA 4AC7C 1AJZA 5LGXA 3LHTA 3OYZA 1LUCB 3G6LA 4PL2A 2OODA 1CBGA 4JTCA 3K8KA 3UP8A 4L7ZA 3ZJKA 2PDLA 1ZZMA 2QAFA 4Q8OA 4NNAA 2Z1KA 3SY5A 4WDUA 1US3A 2HNEA 5D38A 1JDFA 1KR0A 1OABA 1UD8A 2CYGA 1AQFA 3GU9A 1VJSA 1NQ6A 1V6XA 3NJ3A 1WDSA 2Y5SA 2YCKX 4AWTA 4IIBA 3APTA 3H24A 1OCJA 5T91A 1N7KA 5BRPA 3E49A 1L8PA 2VRQA 3TA9A 1BYAA 3OEXA 1XRVA 2ZRYA 4PTWA 3KTCA 1FXQA 2XH7A 4QG6A 2WMIB 3C86A 1TA3A 1Z41A 1ZTVA 1RJRA 3IAPA 3BC9A 6TAAA 3MV11 3QFWA 3IJLA 1HL8A 3IIPA 1E3XA 1BKHA 3AMLA 4K8EA 4W86A 3ALGA 1G4EA 5FACA 2PODA 4DX3A 3MO7A 3TR2A 5TD4A 2TYSA 1E4NA 3G2GA 4JKKA 1JYXA 2YXGA 3NGJA 4GK8A 1AODA 3W00A 4L64A 4HD5A 1GZ1A 1TV4A 2Y1HA 5E1QA 2YW3A 2WJEA 1QNQA 3GYCA 1GVEA 3DZ1A 1OX4B 1B3WA 2Z29A 1SQ7A 4KCVA 2YCJA 3PHAA 4JQ1A 1LDCA 2OJPA 3U7VA 3O05A 4AIOA 5IFPA 1CX9A 4PULA 4PMJA 3T7VA 2TPSA 4AY8A 4CU8A 1EO5A 3SAZA 3ZT6A 4DZHA 2OMAA 3PFRA 4O54A 4RE2A 3GDKA 3GXMA 3M7WA 4DQWA 1TZ9A 4TMCA 2AL2A 1T40A 1FWDC 1OYAA 2BDQA 1OGGA 1E55A 1YTKA 1QI3A 1ZBCA 2BGSA 2WCGA 2OWXA 1U30A 1RZMA 4AY1A 4MDOA 1I45A 2ZQ0A 2FIQA 4ACZA 1MO0A 3C0LA 4IL2A 1MYRA 5CZJA 4MNMA 1CI1A 3W6LA 4GQBA 2QDEA 1BRLB 1P1XA 2ICSA 1GNXA 2QCCA 3ABSA 2FPTA 3VIPA 2OZ8A 3ZJ6A 3CH0A 2QT3A 1TSIA 1RQEA 4OJYA 3LQGA 3CO4A 3PM6A 1BWVA 1Q6RA 3W76A 4Z42C 1FHLA 1LRQA 1VPQA 1HKIA 5JBDA 2WWDA 1H7XA 2FVMA 3P5YA 3BXWA 2WM1A 4UQDA 1V3MA 4YL2A 4B5VA 2BHYA 5AYYA 1F76A 4WZHA 4RPPA 2OKOA 3FGCA 3W27A 3EOSA 3PBYA 1H62A 1FVPA 2EBNA 4AQLA 3MMUA 1ZAIA 4RUBA 1GTHA 4H9ZA 2AL1A 4DWDA 4L1GA 3SFKA 3L7RA 5HMDA 4G5DA 1KKRA 2ZXAA 3OQ8A 1NDVA 4X3ZA 4YPJA 2IKJA 5FOOA 1KR1A 4F2TA 1LBFA 3UJEA 5C7VA 2ZZ6A 2WHKA 4W5UA 1XIGA 5DCBA 1KXHA 3VPLA 1ADSA 1CECA 3TN5A 2GDVA 2VEFA 3TONA 4QM1A 4HPGA 5CPTA 4UCFA 1QW8A 5I3HA 1GCYA 1H60A 3WFAA 2E8YA 3LHZA 4XUYA 1NWSA 3GVQA 4B4FA 3WFLA 3IGHX 2J7HA 3AHZA 2FVKA 3DX5A 3TUUA 4J28A 2ZTJA 2HZGA 4GI8A 2FLIA 1JZ8A 4ADUA 4MNLA 1TV7A 2J8TA 3UR2A 1WO2A 2YLLA 1HX0A 1CXIA 3G1RA 4LVGA 1L6SA 3MBDA 3WQGA 3NURA 3GDMA 1G4SA 1T99A 5BWAA 4RE4A 3QGAC 4OZOA 2HVOA 3FDKA 4DJDD 3TJ4A 1I0DA 3H7RA 1XD0A 2ZUSA 4Q32A 1NWTA 3WCZA 4EANA 5J5RA 4XVDA 5G2WA 2F6KA 4Q33A 1EX1A 1E73M 1U1JA 2ZRUA 4JFUA 4MVAA 3DHPA 1XH1A 1Z3NA 3VOIA 1RCXB 3N6QA 1RK6A 1RLCL 4KBXA 3N2BA 3XIMA 2CESA 1VEOA 1V6VA 2BOEX 4MWAD 2O4QA 4Z1BA 5FF7A 3M6DA 2JGYA 3CU2A 3ATZA 3SGGA 4ROPA 3ZLFA 2GYIA 4UB9A 1XF0A 3L66A 4XD3A 1TR9A 5FJPA 1V77A 1REQA 3VDBA 3H8AA 1KBJA 3KBJA 2WMHA 5AC5A 1BYBA 2YA2A 4TR9A 3GNDA 3WD2A 3BGGA 1A49A 3EPNA 3PTDA 5E09A 2JEQA 1KM1A 3OZMA 3S9ZA 1ALDA 1XIBA 3RDKA 3RF9A 2V2DA 4DO7A 3HMJG 4A3RA 4AMCA 1Q8AA 3QY7A 1UKOA 3CWNA 5A6SA 3TN4A 2CBUA 1MVYA 3RO6A 2CWXA 3R6IA 5CPMA 1E72M 1ZHAA 3ITLA 4R85A 3HJEA 3N29A 4BK9A 4WSJA 3L5AA 1TA3B 3BLOA 1DJQA 1RPKA 1S5MA 2J8GA 3GZAA 4R3UA 2PDUA 3QQ0A 4PTVA 3ELFA 5EMJA 3BSMA 1W8SA 4OTKA 4JTHA 2G5WA 1UQYA 1UD2A 1XLGA 2QKFA 3KP1A 3GBDA 5BWFA 1KW1A 3M0LA 3T0DA 2R1MA 1E0UA 1MW0A 4PCFA 3LRLA 1ZUAX 3C3UA 1ECQA 1TQXA 3B8TA 1KBIA 3DC0A 3K5XA 2WHMA 4ES4A 3F5KA 2V5JA 3URAA 4V28A 3AXIA 4O1EA 1DJZA 3SUWA 4JQ4A 2PFHA 1FY6A 4Q8MA 3C2YA 1YE6A 4MKSA 2YIHA 1L0PA 1SW3A 3M0IA 1L9WA 4GZJA 4S3DA 1XIMA 3L4WA 1SW7A 1LTDA 3F7JA 5AYXA 3C3NA 4U10A 1YTDA 3MHFA 4RKAA 1OQFA 1TVPA 3W2LA 2XN2A 1BGGA 2CHNA 2DJXA 1DJWA 3FEQA 1B3OA 3N2CA 3UGRA 4CNPA 5AOUA 5DELA 2AL2B 1G9HA 4HK6A 2BBFA 1GKRA 1D3GA 4IXHA 4RXFA 3MKVA 3SQSA 3N6HA 1U33A 1R9XA 1Y0EA 2V2CA 3DENA 1U1UA 3G1VA 2J62A 3C4UA 2CLOA 1FDJA 3WQPA 4CVUA 4ACZB 4ECLA 4CUCA 4IL0A 3SCOA 3UJ2A 2VDIA 2PE4A 2OWWA 2DP3A 4JNYA 3VCRA 4DM1A 3NNTA 3TSMA 2OYKA 1UOZA 4PTDA 3MSGA 1DJNA 3ZSSA 2W0UA 4E4PA 4HN8A 3UNDA 3N1AA 1JZ6A 3WY1A 5JBFA 3AUOA 2VC9A 1O68A 2JF6A 3QN3A 5CGQA 4Y9NA 3QHMA 3EWYA 1H11A 1NFGA 1CWYA 1NU5A 1UWRA 3P8JA 3C8FA 2AQOA 4C6KA 1HQTA 1ESWA 3I65A 4K68A 4QE1A 2H9AA 3W82A 1BXBA 1NELA 3DFQA 3WK3A 2HISA 2VCBA 3W70A 2MUCA 3IEBA 4ZOAA 1YPIA 3FCPA 4WKHA 1NFBA 3NYZA 4U31A 3KCLA 3DHFA 3QKZA 1I1WA 3MMDA 2BY2A 2FZ8A 2FTYA 3T0TA 4E5TA 1E1EA 1E1CA 3PTKA 4L1XA 3RN6A 3LXCA 1PYMA 1WXZA 3WH6A 2CBVA 1TQJA 5MF5A 5I5RA 3LCLA 1L6WA 2D23A 4HU8A 1KXVA 3L2LA 4MAVA 3B40A 2REQA 3NQ6A 1XFCA 4GWEA 3WL1A 2CHRA 2FJUB 2I5QA 3HPAA 2WSQA 3CJPA 1DWHM 3TXVA 1B3YA 4RJEA 4QAWA 4HPHA 1TWZA 3BTNA 5G4WA 4D6FA 5ABHA 1XBZA 2V81A 3P3BA 2XVLA 3GDBA 1F74A 2RDWA 2VO5A 1SSGA 4JL2A 3P80A 5D33A 1UD3A 2OEJA 2Y7GA 4ZB0A 1J5SA 3A4JA 5JBEA 3LXAA 4GYKA 4HNLA 1BWLA 2HNHA 3ZT7A 3L4TA 2VXNA 1I60A 4XISA 4MJ4A 4EAMA 3DDMA 5FCZA 1X1NA 4MIMA 3HU7A 1MQPA 4NZFA 3J7HA 3NO3A 1XLFA 1S2WA 1ZJHA 4A2SA 2VFDA 1EEXA 5IHSA 1PB0A 3IJQA 3OZOA 4OBSA 3AI0A 3MDUA 1F3WA 1AZ2A 5BYWA 3VGFA 3T0BA 3DBPA 1V03A 3BLDA 2XVNA 2VUYA 4GNVA 2EPNA 3OO2A 2NLYA 4DUVA 3WH5A 2AOSA 1H49A 1ZNNA 1AL7A 2X8RA 2QDGA 3OG2A 4WKAA 4TIMA 3ARSA 3S2JA 4O18A 3UEQA 1AFSA 1WDWA 2DSZA 3AALA 4GY0A 3TFXA 4J27A 1BQCA 1UJQA 4F9DA 1A4MA 1R6WA 1EF2A 3AYRA 4PE8A 3IRSA 1REQB 5KEZA 4D8AA 1L2QA 4H00A 3W7CA 3A12A 2V3EA 1Q63A 4GIRA 3BE7A 4O0ZA 4ZOBA 3VD9A 4AZIA 4Z2LA 3R8GA 1ZPTA 2VFHA 3CXOA 3IJ7A 2P8BA 4IMCA 4PUNA 4KFNA 3KRUA 3MV01 5BXPA 3KVLA 1FWEC 1FWIC 1E9YB 1YKWA 3ABXA 1E9IA 5G4EA 1TX2A 1HN1A 2Z1XA 2Y88A 3MT1A 1B31A 4XB3A 1GOQA 1CYGA 3BK0A 1NH6A 5HNNA 1KCLA 4L9YA 3JUGA 5M3WA 4CNTA 4KKXA 4EE9A 1Q7QA 1EPVA 4F2UA 1E0TA 1WXJA 2XFRA 3T2PA 4KQNA 1WZKA 1KM2A 4LFYA 4NZ1A 4Q4RA 2YDRA 3QZ6A 2CZFA 5REQA 3KHJA 2I16A 3VGHA 4GHRA 3MUY1 1TMHA 2EG6A 4H9MA 4HU3A 4TXEA 3QVQA 1KM6A 1F6YA 2WBGA 2J74A 5ABTA 3TVAA 1UR1A 3W6MA 2BVTA 4Q4MA 4LBSA 1JZ4A 2Q3RA 1CB7B 3KBSA 1UZHA 2DDXA 3B8UA 3AU2A 1AZ1A 2HXTA 1IZKA 4LUSA 3KOFA 2V3GA 4O0QA 3KWXA 1VFMA 1XSKA 1VEMA 2GJLA 4LAUA 3OIHA 4WR3A 3FA3A 1VFLA 1LORA 4KFOA 4FF5A 1YADA 3H26A 1HL2A 4MB3A 4E2BA 3WLKX 3Q65A 1FWWA 3GD6A 1C29A 4ZQCA 4HB7A 1TZZA 4DXXA 2PWHA 5I09A 2QCDA 1ECEA 3BV7A 3RITA 2PDPA 4PCNA 2FHBA 2HVNA 3N2XA 1TV3A 3CAQA 2XG9A 2O92A 4WGXA 4YLWA 3MDWA 4K1WA 3G24A 5U7SA 2XSXA 3HOJA 1P0EA 5C2CA 1JNEA 3BG9A 1QATA 1O5KA 2GPTA 1CXLA 1Q2SA 1VBHA 3V7PA 5HATA 4XD6A 4UNLA 3DXIA 1YYAA 3NXLA 1ONXA 1EO7A 2VOMA 4ZQRA 1TVLA 1W32A 5A8PA 1R2RA 1FFRA 4WXYA 3M41A 3KAOA 5E9AA 1X8FA 3U8GA 3ZZ1A 3EDEA 4JIPA 1DQWA 1UYQA 3VM5A 4UNKA 1ZP3A 3AIRA 2VC5A 3W2MA 3M0YA 3UT0A 2E9MA 3CT2A 2RAGA 1U22A 4JICA 4MLJA 1W1YA 1JZ3A 2H9AB 1K8CA 2KZHA 1M7OA 5K9CA 3CZJA 1HKKA 1RR2A 1QDSA 3BLLA 1AA1B 2I9UA 3AXKA 1ODZA 2PWGA 3AS3A 3GWQA 4IUOA 3BLEA 1WBHA 2YPIA 4LUIA 3MSYA 1V0KA 3WF2A 1X1OA 3AC0A 4TX9A 4HT3A 3ARWA 1GVIA 1E1CB 2WKJA 1OM0A 4JIRA 4LY8A 1LOSA 3TH6A 1PE1A 2BY0A 2J27A 3S1XA 1VBGA 3WLNA 3MUCA 2ZUNA 1S2UA 2GVEA 4BEQA 4Y9OA 2ZICA 1IZJA 2YSWA 3AOFA 3LCWA 2BNJA 1ME8A 2PPGA 2REQB 3VUPA 2DW6A 5GNZA 2BZNA 3KOXA 3NA8A 3K4AA 1YNQA 2FZ9A 2QHAA 1NOWA 4C6LA 2DSVA 1H61A 2J6VA 1CLVA 3LMZA 1OHLA 2YBTA 4DELA 1CENA 1LZOA 4TOQA 2EQDA 2QJJA 1AMYA 1ITQA 2ZXDA 1GVQA 1R2TA 1PO9A 4GIAA 8XIAA 2V2HA 1J0JA 4IIDA 1AVAA 3IIZA 3N2OA 4Q3MA 4HSHA 4ADTA 2E6AA 4WJXA 2PF8A 3E96A 3MMTA 1O6IA 4YNGA 3A5FA 1UMYA 5H2ZA 3WG6A 4K3ZA 2Q6ZA 2I9EA 4E3TA 1AW2A 3VD5A 1OFOA 1Q7MA 1NF0A 3ZR4A 2G96A 4MWAC 3SUSA 2OTDA 5D30A 2ZA1A 2IPWA 4DWSC 3RNDA 1QW7A 3SDOA 3WDPP 2EO7A 3W7IA 3N14A 2QF8A 1V7AA 3U5UA 1VBJA 2NVAA 3S2MA 4NZ4A 4UMBA 3ZYZA 2BTMA 5C9XA 3H4XA 1KQYA 2FFCA 1VJZA 1UWUA 3VIHA 4O4VA 3VOGA 1Q8JA 2YCIX 2VD9A 5A6KA 4FS9A 3RX3A 2F6XA 1FWGC 4ICCX 2A4AA 3B4UA 1HGYA 4AFYA 3LQLA 4C1KA 3A5VA 3F03K 4ZSTA 2RH9A 2HRWA 3PWGA 1HKJA 1IWBA 2J7GA 1XRFA 4QJ4B 2PDWA 1YE4A 1Z89A 1QRQA 1IEWA 1BXCA 1YIXA 3U4AA 4BFAA 1ZAHA 3KBWA 4IICA 3C52A 1E71M 3UJFA 2WNWA 3APYA 4R7JA 2QCFA 4N9DA 3BPWA 1K6AA 2VM8A 4N9EA 2G97A 2FDMA 5TBOA 2DIJA 4DBDA 1KCXA 1IQ8A 1JI2A 8XIMA 1E6QM 1AJ2A 4XZBA 3SCVA 4W4QA 3DFYA 1H41A 4LUTA 4FPSA 5K3VA 1ZS2A 1PS9A 2ZFAA 3A64A 4ZXLA 3AMCA 4GQ0A 4HSNA 3MUAA 4LANA 4Q22A 1OVDA 2UY2A 3EX1A 4N2YA 3WLQA 1AH0A 2Z25A 1F07A 5F4SA 3NYDA 3SUTA 5GVJA 3UZJA 5HAOA 1XM3A 2VFEA 2WQDA 1XYBA 1TWIA 2GQ9A 3FJLA 5REQB 4XZMX 3VKCA 2NX1A 4QP0A 2XINA 3QV7A 3B05A 1KWGA 1GQNA 1XICA 1XDLA 4D6GA 1R3SA 4JKLA 2NXIA 4CQ8A 3SBFA 2JKEA 2PS2A 3HPXA 4LUSB 3NSNA 5CLWA 1M7JA 1V6TA 4QDWA 1LYXA 3SCUA 1F73A 2F7FA 4CNSA 3HJZA 1XG3A 3LV5A 2OGJA 1MUWA 3RPDA 1BSLA 3K1DA 2VWTA 3DESA 2QUMA 2DH2A 3WUEA 5CAHA 4C6CA 1IR2A 2QCDB 4UZUA 2XGZA 5E6ZA 1GVOA 4HOZA 4GPNA 4JQ3A 4WXZA 2XH4A 2BODX 3TE9A 1X7FA 2PDCA 2XIBA 1NTHA 4C6FA 3Q2DA 3RAOA 2V67A 3B8DA 4IJBA 3VMNA 3DN5A 5I07A 4EKJA 3GNRA 3WD3A 4US5A 3AS2A 4WQ6A 2J77A 1WBJA 3PBWA 3O6DA 4AVNA 3FJ4A 2RKXA 1UR0A 1RALA 5HPCA 1QW9A 4LUYA 1NWRA 1PV8A 4LCRA 3UGVA 3SIMA 1EGVA 4IH3A 2GUUA 2Q3OA 3K1GA 2QPXA 1UASA 3GDRA 1BEUA 1VYRA 3ZFHA 3POHA 3NWRA 4GNKB 3URBA 2X2YA 3T0CA 1PAMA 1EB3A 4FXSA 2XIOA 4PODA 3VE9A 1LRNA 3MUIA 5D9PA 3WUBA 5BCAA 1VAHA 3NQBA 1K8ZA 1K9TA 3UPWA 1HF6A 1VS1A 1UD5A 1KV5A 3BV4A 3OHMB 1FXPA 1XIJA 3EWWA 4UTTC 1JYNA 1Q6FA 1A3HA 3SSJA 4X61A 5A6AA 4C90A 2WVSA 1PDZA 5A1AA 3C2EA 4YVXA 3SY1A 2WHJA 4D6IA 5KZ6A 2W61A 2PP3A 3QY8A 3GVGA 4QIUA 3CIWA 4QNEA 3IK4A 2XIIA 4JHMA 5EPDA 3SGUA 4LV9A 2PDFA 2VRJA 4UR9A 3SCTA 4CN1A 3WBXA 1SFLA 2HPMA 4Q7NA 1K4GA 1VCVA 5DCDA 3TKFA 1J01A 2ZVRA 1T7LA 4AX6A 4EK7A 1RBLA 3FW6A 1XDMA 4HNNA 1H0GA 4ZEPA 1L2UA 5IFTA 1P7TA 3VIGA 4QJ5B 3CHCA 4HMCA 3ZLGA 3H53A 3E5PA 3SI9A 3SADA 3BMWA 1WV2A 3I3BA 3AROA 2PTYA 3EOOA 3GNOA 1VFOA 4FOKA 4LVDA 2VL4A 3PG8A 4FI4A 3MBFA 4TU1A 1EHNA 3WF0A 4C7FA 1UKQA 2C3ZA 4AYGA 1B3VA 4JY8A 6ENLA 1W9BM 4FSAA 1S3TC 3AMDA 1FKXA 5E93A 4G2DA 2OCZA 3GK0A 3M4HA 3CYVA 2GQAA 2PDBA 4JOMA 1P1MA 4PMDA 4X0VA 3IVUA 1EF3A 2Z6IA 3FAXA 1HJWA 4ILSA 1ELSA 1UA7A 2ZZ7A 1A4LA 3VNZA 3LMYA 3MB9A 3QSTA 3R43A 5JH2A 5BXRA 3C56A 4JYEA 3TW6A 1UBSA 4A2RA 3C0QA 1OX5A 4IZGA 3G1FA 3SJNA 1Q85A 5C9UA 3PBUA 2PP0A 4LB4A 4PBGA 3NQFA 1GQKA 1DBTA 4RNHA 3S0CA 4MMWA 5EBAA 1GVRA 2UZ9A 2YGYA 5A6TC 3UWEA 3MMWA 2YBUA 3RGTA 4J5NA 2E0PA 1A5OC 3EXTA 3IUIA 3H4GA 3DECA 4A22A 4LAMA 3VD7A 4LU0A 2PRLA 1WXYA 1V08A 4KFPA 5D2VA 3V1HA 3TZNA 4GUJA 3TEVA 2Y8VA 5D2WA 4DAIA 2BS9A 3HGOA 2HQAA 3NEVA 4IP7A 2J7EA 1RD5A 3NUKA 5CPQA 4ZXOA 3ZIZA 3BAWA 4O0KA 4C65A 4MPQA 2I17A 1FQ0A 3CPUA 3K8MA 4W8AA 4LUTB 3QOMA 1BTCA 4Z2JA 2ZZ3A 4ZZ9A 1BF6A 2DUXA 3S1VA 4JNZA 1QMLA 2PCQA 5IOBA 2X1RA 2P53A 3THAA 4EPBC 4NAFA 1K4HA 4IGSA 3ZS4A 4HPXA 7ENLA 4S3KA 3B9NA 1QNRA 3G3MA 4JYFA 1ONRA 1TPDA 2X7WA 4NZCA 1LL4A 3U4FA 3ARTA 3BLFA 1B90A 5I23A 3H7VA 1D2KA 1GJPA 1VFSA 3THCA 3A13A 1XRSA 1HVQA 2E7FA 3OLDA 2OG9A 2J88A 1H1YA 2YZRA 3LTSA 2C79A 4S2CA 4AZCA 3LCGA 3WDIA 3P5ZA 1Q65A 1J8VA 1DTUA 1GK8A 3W02A 1C90A 1MNSA 1DXFA 3GXIA 3L4VA 4DB7A 3NG3A 2YL9A 3BAYA 1OZQA 4ADSA 3GXPA 1AMKA 2Y7DA 4M82A 4AB4A 3FOKA 4HPNA 2CHOA 3HGJA 5EMKA 2OB3A 5AHMA 4GUFA 5AVNA 4XZWA 4GVIA 4FXRA 1MDLA 2VT0A 1PXGA 3VABA 1OK4A 1AL8A 3MI2A 3N13A 2R91A 2Y4SA 3QC0A 2VFFA 3LSBA 3T8LA 4KIEA 1SJAA 1B2YA 3SCRA 2CZ5A 4P8UA 2AAAA 4F48A 3UU0A 2CU0A 2ZRXA 3OG3A 3PZ9A 3U0HA 1EOKA 3GW0A 1XWYA 3TC6A 3A21A 4HK7A 3WLLA 1KTNA 3EOEA 1P6CA 3W37A 5DRIA 5A69A 1QFEA 4Z1DA 3MJMA 1HKVA 1MWOA 3CMGA 4AU0A 1TELA 1JUKA 1SW0A 4QFUA 4KMQA 1AK5A 3QW4B 4JY9A 2V3DA 1HXJA 1JGIA 4YTQA 4BR1A 1QNVA 2FMOA 3F2DA 1CCWB 4FLOA 1OY0A 5CG7A 4S3GA 3SCSA 5KETA 3QPZA 3W71A 4KH2A 3R4IA 5TF0A 2D22A 3RR4A 3D3FA 3ENLA 2INZA 3SCWA 2GLKA 3WD0A 3HIJA 1LQAA 1PTDA 4Z08A 2A0NA 2X1IA 3AU6A 1NDWA 3TYZA 4QBXA 4QITA 1UH2A 3FSTA 4H6KA 2XWEA 4Q4PA 2E09A 3PUGA 3PR2A 1Y5WA 4C6MA 2E4TA 5ECVA 3P6LA 4BHYA 3WQCA 4D8LA 2DU2A 1NSJA 1PL9A 1PYFA 4UTLA 3BL3A 2B7QA 3RCYA 1RK5A 2PB1A 3L0NA 2G37A 5LGZA 1KRBC 1KCKA 3S2LA 1S1RA 3TTQA 2IS7A 4RNJA 4FR6A 1E5JA 1OFBA 3DHUA 3EB4A 1M53A 1P7TB 1QT1A 3QW3A 4NASA 4IMAA 1XRTA 3CV6A 4UFLA 2HPIA 4CEXC 4UTJA 4N4PA 3JS3A 1MQQA 4PBFA 4L9ZA 4YXGA 1JUBA 2Q71A 2YW4A 5T26A 4AZBA 4U2ZA 1EC7A 1EJUC 4FR1A 4M0XA 2PZNA 2EKCA 1EIBA 3QYQA 3N73A 5FJJA 4S38A 3ONBA 4EF8A 1QOPA 3HV9A 1JG9A 3FFSA 1XC4A 2GFTA 3MWCA 3GG1A 1W3LA 4DRSA 3FS2A 5LIUX 4RXGA 1CXFA 2NUYA 3B4YA 1RLDA 1J2BA 3HG2A 2GGJA 4QJ1A 1GEQA 4HCDA 4I8DA 2O9TA 5I3JA 1VCFA 1V3HA 2E1DA 1EEPA 4AG0A 3VIKA 1QCWA 2PDYA 4O11A 4C5ZA 1PVNA 2QLYA 3STPA 4NJJA 3B0PA 4LEFA 3AJXA 4XQ6A 1UR8A 9CGTA 4DJDA 2D0HA 4B3LA 1K03A 3GDTA 5EA9A 2EXOA 5AY7A 3LBOA 3PFMA 3GRIA 3EBVA 4EOUA 4H01A 5M03A 3NDOA 3EKGA 4YIWA 2XFYA 1CDGA 2PLCA 4WVXA 6CGTA 3S47A 4PN2A 4MWAA 1KM4A 4GVGA 3PPGA 2RDXA 4QS6A 2WC7A 2OVLA 3HO8A 4PMNA 1KFWA 4H2CA 4GMEA 1ZL1A 1VFFA 3NQCA 1XLEA 3S42A 3TDFA 2PGWA 1DOSA 5CQ1A 3GVVA 4M3PA 3CEUA 4CQBA 2G3JA 3ANYA 2ZWZA 2DPEA 5DANA 3TN6A 4MJZA 3TQ0A 2C16A 4LNYA 3LSCA 3THQA 3HQNA 2ISDA 5CZSA 3VOFA 2A3AA 2Y62A 1BXNA 5K4XA 1UH3A 4R33A 4NAFB 4PL1A 5JMUA 3RJYA 3TYBA 3TTOA 4I5RA 3KX6A 1PCWA 3H2AA 1QK0A 9XIAA 1UOKA 4O16A 1BVWA 4BQ5A 1FH8A 1VBUA 1GKQA 2XYLA 4F9JA 4GZEA 4PUEA 4JTTA 1W6TA 4F0SA 4R88A 3QR0A 3WNLA 3GDLA 2V6AA 2GJNA 4QEHA 3B8SA 5B7YA 1VPXA 1FHVA 2OQYA 5DXYA 1LWJA 2JIEA 4NXSA 4PMZA 1DXEA 2VD8A 4P5UA 4N7QA 1M01A 4AZCB 4JHOA 3PZOA 5JIWA 3U9IA 4DY1A 1WPCA 4PA8A 5C5YA 3AZSA 3A4AA 1C93A 3F4DA 2WHLA 5CJNA 2NLIA 1BFNA 4BEUA 1OEPA 1YDYA 5CEWA 4JTJA 2VX7A 4A3HA 1H7NA 3TQKA 1FWFC 3BUVA 1QOQA 2DVTA 4Z1AA 4IISA 1FWCC 1X7IA 3Q45A 1K8XA 3VIIA 4E6MA 3HN3A 4L61A 1F6PA 1LJYA 5E0KA 2QUVA 1DE6A 4N02A 5EY5A 1ICQA 1DV7A 3DEQA 1TFVA 3HGRA 1E1FA 4LYRA 3G18A 1SZGA 4GYPC 1SYTA 3BJTA 1XBXA 2ZE0A 3BMVA 4B9ZA 4BKNA 2CXEA 1YQ2A 3FYYA 1S2VA 1EX5A 4HKPA 4MJ2A 4O57A 5HMFA 2C6QA 2YA0A 5HULA 5I06A 3CV2A 2H8ZA 3TTEA 1RQBA 1XR2A 1P43A 1UUOA 4ZO6A 2VDHA 1V4YA 1FHUA 3IACA 3NL6A 3APGA 5E9XA 2GJRA 3BW3A 2QMJA 3EMCA 2OSXA 2CLHA 2VTFA 2BVDA 1SGJA 3LV6A 3BOFA 3TX9A 3CWOX 2GJPA 3GU1A 1TPC1 1X6LA 1Y65A 4IMDA 5T9BG 4LBUA 3PG9A 3UJSA 3C8NA 1IT7A 4OOZA 4DJFC 5C55A 3I6RA 3ORWA 1Z48A 2D69A 2VGBA 3BDKA 3LS9A 2XVGA 5A8NA 3VGBA 3NQGA 3VZYA 2PWUA 4O17A 2QR6A 5DQPA 2P88A 2WB5A 1FWJC 4XZIA 3ZWSA 1ZJAA 4TTGA 4N9BA 1FDZA 2BWGA 3W7OA 4WLCA 1DQUA 3THDA 5J5DA 3W1AA 3M44A 4PC8A 1FCQA 3GVRA 3KRSA 4UNIA 1EP1A 3OZPA 5F2LA 4CD7A 2NSXA 4JX6A 3KP0A 4DI8A 4B2DD 3NDYA 1DL3A 2XIJA 1RD6A 2VZVA 1A5KC 4D6EA 1RJQA 2QULA 1VENA 3G1XA 4FOJA 2XH2A 3UWVA 3OA5A 1GGOA 5I79A 4MNJA 3GC4A 3AYVA 3TOPA 3GIPA 1X97A 4O28A 1MW1A 1F4AA 2F9RA 4NU7A 1SZEA 4LCSA 3CUGA 2QZRA 3WMSA 2O9PA 4K39A 5TIMA 2C14A 1I0BA 3P93A 3CPRA 3GKAA 5FJOA 2AMXA 4AIBA 1D3CA 1P0BA 4IG2A 4Z0SA 4OV4A 5AECA 1XLJA 2ZUMA 4LC6A 3W07A 1SJBA 5CSYA 3PUEA 3PJTA 4PFHA 2C1IA 2I5IA 1G94A 1HVXA 2ACRA 2WNQA 3WF3A 2J4GA 5FJIA 1B57A 1U5JA 5IM51 1TV5A 1K7XA 1RBOB 2JKAA 2ZRWA 2NVCA 4ZO9A 3WLIA 3PZTA 1CEOA 3GO2A 5HWJA 2E9LA 1C9DA 2X05A 2WLZA 1WNOA 3TAOA 3W1XA 3ZSTA 2G3NA 1OD8A 2F38A 3G6MA 2J66A 3E74A 1NDZA 4RK8A 1DIDA 4KRZA 4MWAB 4C7GA 1EJTC 4ZQMA 1UZ1A 1WZAA 4FP1A 5CZTA 4AF0B 4E2VA 1T8XA 4BZYA 1PHWA 4GD0A 4US6A 3SQMA 2BLEA 4GJ1A 4S2BA 3DH7A 4CQ9A 1O7AA 3F2CA 3KL5A 3WF4A 4YWIA 1MFVA 3SGZA 5K2ZA 5I3FA 3PAOA 3GC2A 4OFCA 1QNOA 2EPLX 1IXNA 2DZVA 2MANA 4JNMA 1KA9F 3FVMA 5A6BD 1BG4A 3LGDA 2DY3A 4GA8A 1RP8A 3DFTA 4JPGA 4EXQA 2G41A 2DT2A 4UFHA 3SEPA 3MWAA 3UXKA 4BI6A 4A3QA 4GVHA 3WIJA 4RV3A 4IHCA 5A6JA 3BCFA 3K13A 3MVTA 3USZA 2ZDRA 2P1FA 2V9DA 3ABQA 1UWIA 3Q94A 2DJLA 4CEUC 3W86A 3GH5A 1D7FA 3P60A 1XYMA 2GSJA 3E5BA 1HJVA 1RQHA 1WP6A 3ES8A 2X09A 2WW5A 3M0HA 5A95A 3GIYA 2QAPA 1JFHA 1XUZA 3H2OA 4I9AA 4DVOA 3LYEA 2Z1WA 2FMNA 1ZBWA 3O6AA 1OIMA 1ADDA 4XKMA 1E3ZA 4KEZA 1VF8A 3HFYA 3M0KA 3GX9A 3R89A 2MNRA 3C61A 3DG6A 3GUGA 1KC7A 1OF8A 2X42A 1HW6A 1OIFA 4MGGA 1RA5A 1B3ZA 3PNZA 4OWGA 1PJ9A 3H55A 3ARRA 4HNCA 5LXXA 1TJ0A 1CGXA 1K9DA 3AMKA 1XPGA 1UH4A 2HS8A 3BARA 3WQ6A 2Y85A 4C6BA 4KS0A 4D6JA 2V5LA 1Z32X 2PDNA 4GKLA 1TR1A 4K37A 2ZUVA 3K4WA 4JIIX 3YPIA 1LLOA 3R79A 5H8PA 4ZL1A 4NX5A 2GZXA 1DJIA 3W23A 2FTPA 5BU6A 1Z7AA 3HPZA 3UVAA 3W4RA 1QO2A 1ITUA 1B9ZA 1XQLA 1OT1A 1UROA 3N4AA 3CAWA 3FV9A 4LRTA 1TWDA 4EWJA 3SRKA 3E0FA 2WZTA 4F79A 4K6AA 2XM2A 3EDFA 2V68A 3ARPA 4J40A 5FL0A 1HTIA 3SO7A 1ITXA 5LA2A 2WMIA 3L65A 2A3LA 5BRBA 3W7JA 1HUVA 4KETA 3BANA 2DQXA 2B31A 2BOFX 1G4PA 1UP0A 2J13A 3MCMA 3TCSA 3VOJA 1AJ0A 3AHVA 2W79A 2PA6A 3L0GA 3GS6A 3DG3A 4UIOA 2RJHA 2IQDA 4H8HA 4XKYA 3UESA 2DZUA 1NY1A 1SVDA 3SCPA 3CASA 3N18A 3EEGA 2P8CA 1R5YA 1IT8A 1Q6GA 2A3EA 4UTUA 1PSCA 1QXLA 2WQPA 1H3GA 1JL8A 4C6OA 2VOTA 1TPVA 3SB0A 3PZIA 1YEYA 4O19A 1ICPA 1W1A1 4NY2A 4PB5A 2GK1A 2QIWA 4M6PA 1EOMA 3LENA 3QJAA 1WOAA 2VENA 1CPUA 8TIMA 2E9BA 4GGHA 1TB3A 2VELA 1G0CA 2BMBA 3CUZA 1YTEA 5H8MA 5DMYA 2F8QA 1OBAA 3N9KA 1W17A 1GJWA 2XM1A 5L9FA 3FK4A 5D2YA 4H9XA 4YVPA 1JXKA 4MG4A 2XDFA 1VIWA 2D2GA 4ZSUA 1A5UA 1MNZA 3URNA 4FLRA 1WAWA 1DWAM 1FUYA 3GB6A 4ICNA 1FP8A 1R3QA 1H5YA 4U33A 2ACUA 4F0RA 2QXWA 2J7FA 3UBPC 1MRQA 4PZVA 2Z7KA 3TFCA 2PBOA 1W5QA 2ATMA 1Q6DA 3B8IA 3F5JA 4M19A 1C8XA 1SFJA 1XH0A 3VTRA 1PKYA 3W7MA 1PX3A 3CAKA 4NJGA 4B3ZA 4BJHA 1VEPA 4BY3A 3L12A 4GZ7A 4XSLA 3WMBA 2R1LA 1TIWA 2VVSA 3CZLA 3PZMA 1O94A 4LB3A 3LLDA 3OYXA 1Q6EA 4IG2B 1E4IA 3T8QA 4MOZA 5LZLA 4Q7BA 4EXAA 3L5MA 1E56A 4J1OA 3BAJA 4R5EA 6XIMA 4CN6A 5KINA 3H23A 2O55A 2POTA 1ZP4A 3PBVA 4JTFA 5BW6A 3QBUA 4YMZA 4HVXA 3IVSA 4ATDA 3UXLA 4YTTA 1VFTA 3FLUA 4BF5A 2PBGA 3V18A 1MZRA 2WO5A 3KXQA 4QGCA 3VI2A 2CZEA 5DBTA 3NVDA 3ZR6A 3SM0A 3GH4A 3M5YA 4Z2KA 1I2OA 4BI5A 3TC3A 3W7KA 1WZLA 4JFSA 3CQIA 2VCAA 2PP1A 1KM5A 4MM1A 5I02A 5HINA 1UG6A 2QCGA 1OC6A 3B97A 4BQ2A 2QJMA 2XPKA 4B90A 2X1UA 1V3JA 3KM8A 3RM4A 1UQZA 3H4WA 4P2VA 2GQ8A 4I9TA 1XIEA 2ZX6A 3ERPA 4GZIA 4X2RA 3CUXA 3B03A 4MJMA 2CCRA 1IF2A 3R12A 2VQTA 1B30A 1XGDA 2ATSA 4R9OA 1TKKA 3IAQA 3RRAA 3AIUA 3AUJA 3TSDA 3G3DA 2ACQA 2HK1A 2E6FA 3GKFA 3D5HA 2C71A 2Z24A 4WDTA 4JTLA 3WBWA 5ABGA 3CHVA 2HE8A 3UYIA 4GOAA 1K6WA 4U5KA 4HGXA 5ABEA 4BWLC 1T96A 2WZEA 1M3UA 2QW5A 4GCAA 3DYMA 3MZ2A 1EUNA 3E0WA 4DYJA 1P0NA 1UWTA 3WH7A 2DQWA 3WK1A 3FY1A 2A1YA 2QJHA 1W1TA 1XP3A 2ISSA 2F61A 4L6DA 4OV9A 2YBVA 4WKFA 4GBDA 2BXVA 1UZDA 1KFEA 4ROQA 3WYZA 3AZRA 1V0MA 3GVWA 1UA3A 4WIWA 1Q4NX 2FZNA 4A8LA 1RVKA 2R14A 4LAOA 5AYBA 3E6EA 1Y8BA 3LBCA 2QDHA 1FH7A 3CL7A 3S9IA 4CCZA 1PIGA 3QXBA 2GVGA 5D4YA 2CKRA 1SR9A 4J3UA 2AKZA 3MSRA 5EMUA 1QJWA 5CH9A 1NWUA 3M1ZA 4W8BA 5FJTA 3FA5A 1HJQA 1F3EA 3MHUA 1IEQA 3CL6A 2G4FA 5HPOA 1R8LA 4JDYA 1LG2A 3B04A 1YBQA 4A8RA 3LB0A 4FXFA 3I68A 1LOLA 1A3WA 2PDGA 1OYBA 1XX1A 2ZZ2A 5EYWA 1XG4A 1EDQA 3M9YA 1EA9C 1U2YA 4ZVJA 3SN1A 4M5PA 4ZB5A 1GOWA 3UR8A 4CCDA 1EQPA 4GCXA 3R13A 1D9EA 4QLKA 3TW7A 1UR3M 4ZOCA 4HA0A 2E3ZA 4F4RA 4MUZA 2GSEA 3T42A 3PJXA 1TPWA 1UWSA 1C8YA 4UWMA 1EWEA 3EWXA 2J7DA 3DIPA 5FKYA 5DX7A 3S1GA 2AMGA 3VNDA 4W9TA 2AQVA 3RCNA 4Q4SA 4NYUA 2YZ5A 1E15A 5AHLA 3VMOA 2XSBA 4XKYB 5BOEA 2BSLA 5DMNA 4AEOA 3UZYA 1CNVA 4GRSA 4NKCA 1X1ZA 3DFHA 4DN1A 1UIOA 4O10A 2DVUA 4EIVA 1K9EA 1X98A 2BX7A 1GVYA 3G1DA 4OIFA 4DLMA 2VDGA 4MADA 3EWZA 2D2OA 3LOTA 2GK1B 3DFPA 1N8WA 3T4WA 2YCLA 1E43A 1LLWA 1YNYA 1NQKA 1KGWA 3TMQA 2QPUA 3TWBA 1M9HA 5GJMA 2Q01A 4PUMA 3Q67A 4AHOA 4EP8C 3HF3A 1S2TA 3CHEA 3A3HA 4P8XA 2ZUUA 2P3ZA 2V82A 4LYPA 4FA3A 2GDUA 1TV8A 2CPUA 1PDYA 1VR6A 1W1IE 1FA2A 4YU1A 1J5TA 4O1CA 2DW7A 1FBAA 2OGYA 4J3ZA 4IPNB 4RPQA 1KNWA 1AQ0A 2NV2A 3CMFA 3WEMA 1OB0A 1W91A 3TJLA 1SFTA 1IXOA 2DZAA 4LWWA 2WNZA 3E3HA 5T9CE 3EZ4A 1G7VA 1P6BA 4X9YA 1W5OA 3STFA 2NXGA 4LBRA 1SO6A 1TRDA 1IZCA 1D8CA 3W6YA 3ARYA 4G7FA 4OE7A 3KS5A 3CGTA 5RUBA 4J2MA 1XLLA 4ZODA 5BMWA 4R7WA 3W7HA 4JFVA 2V63A 2CKSA 1BWKA 5AC4A 3O1NA 2CC0A 1EPXA 2FPYA 3HGSA 4U28A 3SURA 3IIOA 3N19B 2XU2A 2NSOA 6TIMA 3SRDA 3M0XA 3UXIA 4E2DA 4XBKA 2PTDA 1QASA 2GUBA 1U1HA 4OT7A 3KBMA 2VURA 1T0OA 3GTIA 4TX6A 1I1XA 3BZGA 3I7RA 1KKOA 4A4AA 1IEIA 1C7TA 1U83A 1XYLA 2DV0A 1XSIA 4XO7A 1S2CA 2ONEA 3UA3A 4HZ8A 1V02A 2DZXA 3KLKA 3AYSA 3K4DA 2H3BA 5C7HA 1VD6A 3ZJ8A 3S5ZA 3DFSA 2QVNA 1ME7A 1PZ2A 1E5NA 4WEVX 1D7KA 3W01A 2RDTA 4NXKA 2Z28A 3SQLA 5EMYA 2Y5JA 4OKDA 4FK9A 5CC6A 3WQ4A 2XTKA 3WBYA 2VNCA 4MF4A 3U3HA 3VK5A 1AH4A 1XIFA 3ZM8A 2J8FA 1PZ1A 5E70A 1OADA 3TTSA 3HURA 1V8EA 4F2BA 3LPGA 2A6LA 1DJGA 1XLHA 1CGWA 3UZWA 1E4LA 3PK7A 5KITA 2OLHA 2E68A 4C5YA 3LRMA 3LNMA 4BF9A 5FSEC 3WJZA 2HMCA 2XSAA 3WX7A 1KFLA 1UR9A 4GISA 3E0IA 4H19A 4WY0A 3U2ZA 4HJWA 4JFTA 1XC6A 1FH9A 2WANA 1US0A 3WLTA 1BHGA 3A23A 3TV8A 1N8FA 1JRCA 1UHVA 5BRQA 3AIQA 3UW6A 3P0XA 3ARVA 3RMEA 1XLIA 1JPDX 4YYFA 3UWWA 1EGZA 4KIRA 1D8WA 2UWFA 2YL5A 1AQHA 3CL8A 2FZBA 2W4XA 4RCXA 1JJKA 4ATWA 4DWSD 1OG6A 3VE7A 2WKLA 4LYKA 4RNFA 4OUIA 4FIRA 3LERA 2BV9A 1OINA 5ECUA 1KFKA 2A7RA 1J4EA 2EEXA 4B5WA 4PBEA 5LIYX 4PR4A 3DHDA 5I7GA 4ZO7A 4H4IA 1GEHA 4S3BA 5BOFA 1K3UA 4M56A 5D05A 3BCJA 1RCQA 4K36A 3W1TA 4I5UA 1A0DA 4MPKA 3S5SA 3WH8A 4BF7A 3NZGA 1YBQB 3V0TA 3PSWA 3GUWA 1PZ0A 2OOGA 2RUSA 2A7NA 2ZIDA 3W74A 2IW0A 2Y6ZA 1V02E 1W3TA 1UC5A 3STCA 1KFJA 4HZ6A 1A5NC 3PULA 3WQWA 3RM8A 5D2TA 1HJSA 4XZNX 3U57A 3LM7A 4WOZA 3A24A 3MCOA 5HNRA 2V5KA 1WUEA 1B1YA 1OFRA 4FMVA 4J7RA 4LS2A 3IJ8A 1P5BA 3EXRA 4MKNA 3GNXA 3NEHA 3DG7A 4BQ4A 1SFSA 3NVTA 3QSRA 1SR0A 1Q5MA 3TTYA 3N2TA 1KQZA 3WJYA 3LCHA 5GNXA 3WD1A 4FIQA 1W1VA 3GHTA 5AC7A 2GVYA 3B3DA 4O50A 4DXKA 2C8NA 3KL0A 1CZ1A 1XBYA 5JH1A 3BG3A 3HM7A 2E6DA 3P7YA 4H6RA 3FIGA 3GW3A 3E2VA 4PUWA 1FWTA 4AH7A 2J7BA 3NQ7A 4QROA 3UERA 2AKMA 3NL2A 2Z00A 2YCLB 2VZSA 4EX4A 2NT0A 1A5MC 1JQXA 1VH7A 3FA4A 1HIZA 1E4MM 3IS4A 4LVAA 3SUUA 4UTMA 1YPFA 3ANUA 3QYSA 4GX8A 1SZFA 4L4PA 4WK9A 4GIEA 4DO5A 3SN4A 5G4HC 1JPHA 3RMJA 3DUGA 3GTNA 1C8VA 2OT1A 1HZYA 5CSUA 2TRSA 5K9DA 1DJHA 5BZAA 2P3EA 3CLMA 4CCEA 2JGQA 1EXPA 3VNJA 1L6GA 3WMCA 1HG3A 2J6XA 4IX2A 5FSDC 4S3EA 4J35A 3NPVA 4IJCA 1FCVA 4MHBA 1JGMA 4HNUA 4PSPA 1HNYA 4LOCA 3EMQA 4W85A 1HP5A 2D3LA 4GY1A 2WKGA 1FKWA 4UCGA 4L4MA 4XTDA 2TAAA 1ME9A 1QUMA 2OPJA 3QPEA 1C3FA 2ZX9A 4AD5A 1L6YA 4Y96A 4CD5A 2G3MA 4FEZA 5KZEA 1E6ZA 2Y8UA 3EMZA 3TYDA 1OX6A 3I4KA 2VEPA 3F1QA 4LC8A 3H2NA 4MYXA 3V0SA 4S39A 1G69A 1UUQA 1EA0A 3LK6A 3T9PA 2C1HA 3UCQA 4XSMA 4QJ3B 1W9XA 1GONA 3TYEA 4NRRA 4K8HA 2IKIA 4FNTA 4GY7A 2YJQA 2UY3A 3R0UA 1T8QA 3L4ZA 4DXVA 2PDMA 3G1YA 2DSWA 2YDAA 3O9NA 4DI9A 4Q8QA 3RHGA 1BVNP 2C13A 1X39A 5F2IA 1QBAA 3N34A 1OCQA 5CGTA 2IPJA 5HQEA 1CGTA 4LF2A 2WMKA 4EPDC 4YHEA 1R38A 3NPUA 2NV1A 3GAKA 3JW7A 5KZMA 2XFFA 4UC5A 2CLLA 4UOZA 1R3VA 4FNUA 3S3GA 1K77A 1Z69A 3MPGA 1TCDA 1ISYA 1M7XA 5MHBA 4GUIA 2ACSA 3N25A 3WJWA 1EJRC 3GC5A 4LJ3A 4IMGA 2OQHA 4DAFA 1N2VA 1S46A 3CQKA 2Y24A 5PTDA 4LS1A 4HTBA 3IJIA 4UR8A 3KCJA 3PTQA 3B0XA 4YCOA 4G1KA 1F8IA 2V69A 4INFA 2PC8A 4HU4A 2QGHA 3N12A 1TVNA 2A5HA 2E6YA 1Q2RA 2PUZA 3TIMA 3QM3A 4S3FA 1FOBA 3EA3A 2VI0A 2WMFA 9XIMA 4WY0B 2TSYA 3SZ8A 4WDXA 2WSRA 3FX4A 4MB4A 4W89A 1Y5XA 4QSHA 3LN3A 3W7GA 3PUDA 1FFQA 4ASTA 1OGSA 4IGNA 1DKWA 2O0TA 3V75A 3W81A 1DHPA 5DMMA 3W85A 5A6LA 4D6HA 1H51A 3OZYA 2DZTA 4PRTA 3RIKA 2QEZA 1Y5VA 1XIDA 3ICJA 3W7DA 4QG9A 3K2GA 1YHTA 4Q4QA 4QQ3A 1CB2A 2QUTA 4EPEC 1XJBA 1GPFA 2JKPA 2OKTA 1P4CA 3AHYA 1GOMA 2XFWA 1ZJBA 2VMFA 3NTYA 1RY8A 4B5SA 1TTPA 4XVEA 1JCLA 4NQ1A 3A3WA 1PTGA 5AHIA 1Q7ZA 3UCDA 1TREA 4P7RA 2YX0A 4FX6M 3UZZA 1H7WA 1NOFA 2C91A 2XN1A 1I2NA 3B8WA 2DIKA 2EKGA 4F0LA 1XHGA 4IPJA 2C7FA 2LLEA 1S2AA 1XLMA 5F2GA 3E2RA 7REQB 5E0FA 2O9RA 4DZ5A 3BOXA 3AWOA 1M68A 4GXWA 5K4ZA 2VCCA 2B81A 1X6NA 4E4FA 2INEA 3T2QA 1ZB5A 2ZCGA 3Q4DA 4UQ9A 3HQ1A 1O5XA 4IWWA 5LHFA 4RDVA 3V4BA 4CN4A 3N2MA 3F4WA 3LCXA 3E02A 5HMSA 3QV9A 4ZA0A 5A8QA 1DPMA 2D2JA 5CPSA 4NF7A 4A8IA 3AAMA 1UW9A 3FXGA 3IRDA 1MXGA 4JEJA 2UBPC 3NQDA 3SY8A 1DJYA 4RDYA 2D20A 1X8CA 2YB4A 4XIMA 2Y8KA 1EWDA 3EEZA 2VX5A 1F3XA 3QFEA 1IT0A 2NUWA 1TJPA 1KRMA 3CIVA 1LQ0A 2NVDA 3TLQA 1E0WA 4MLRA 3IWPA 3TNOA 1FHDA 4GH3A 4H6EA 3A22A 1R0MA 2ZTKA 4ZR8A 4MFDA 1XISA 2FHCA 3ARZA 4UTHA 5C9WA 4ERAA 3O6CA 1JPKA 3WUFA 4MB1A 3DCPA 1XGZA 4H8NA 4NT0A 4Q8WA 4ZB2A 1BLIA 2WCAA 4PRRA 3B9DA 3WLSA 1OD0A 4DIAA 4DUOA 4F0KA 4W93A 1JCMP 3VA8A 5D03A 4EWND 2HXUA 4KEMA 3LEPA 2NWSA 3CZGA 4IGMA 4JN8A 4MUPA 2F84A 1V6YA 5AYZA 1ONWA 4FNSA 4H9UA 2R1KA 3REQA 3UWZA 3M5VA 4J2PA 2QUNA 4XO6A 1HP4A 4HQVA 3QKEA 1MXDA 3CTLA 4E8GA 2Y61A 3AO0A 5BROA 4MFEA 2AQWA 2WAGA 2BFGA 4GYJA 3MANA 5LIWX 2PU0A 5D2XA 1CGVA 3AYTA 3ITTA 2VZTA 2GDQA 4IXXA 4Y90A 4Y9PA 2OSWA 4B2DA 4AYSA 4TO8A 1NARA 1J9YA 3MHGA 2P0IA 2Y7FA 4AIUA 4M29A 2AGTA 5CSRA 4KCWA 1V5XA 5LNVA 1PBGA 2B4GA 4PCPA 2QF7A 2JQXA 2DZBA 1A5AA 1R30A 2O7QA 2ISVA 1GT8A 5SWUA 1DORA 4UZSA 3VUSA 2A7PA 5DY3A 3C0SA 4MNKA 5A2CA 1WZMA 2V8ZA 5CGMA 5EU9A 4P8WA 3CQ0A 3BOLA 1SU5A 1KRCC 3W1MA 5JQ9A 4A29A 4C1LA 3RJXA 3GNPA 4X22A 2DSKA 1JZ5A 3RYSA 4Y7EA 4JIHA 5I77A 3NM1A 1TMQA 4AD0A 1QWGA 1KBLA 2CNCA 4I6KA 1W1ZA 5CSSA 1ZJIA 1CTNA 2NX9A 2W6RA 3SW6A 1R3TA 3L23A 1CXKA 4N4QA 1F9CA 1P6WA 3LXBA 5CG0A 1S5WA 3SFWA 2EG8A 1KTCA 4D8ZA 2GVLA 4LF1A 1F5ZA 1GQIA 1K8YA 5CPOA 3LPFA 4HCHA 1NAL1 2OYMA 3LTPA 1SPQA 6PTDA 1PZ3A 3MY9A 3NR0A 3S6OA 3EOLA 1KO0A 3VDAA 2G95A 1F61A 1NFPA 2BVWA 4AHPA 4ZOEA 1VB9A 2E25A 3CHFA 2QDDA 3W1PA 3WZ0E 4GX9A 4D71A 2VQUA 2RFGA 3BQ6A 1SJCA 2WXDM 3RR1A 2ZX7A 1MEIA 4EAYA 3GTHA 4A3UA 1TPUA 4RZ5A 2BHZA 3KDOA 4IP4A 4Y6GA 1C9WA 3TA6A 3VKDA 4JKMA 4AEFA 2NV9A 3SJ3A 4V27A 3T1GA 3DOPA 3ZVHA 3R25A 1WX0A 5AB3A 3LI0A 2ZVIA 2E1WA 2IKGA 5A6BA 4X63A 4G56A 3DAQA 3PJUA 4NJHA 1F8MA 1V3IA 3FN9A 3EWDA 1A0EA 1BGAA 4O1BA 3KTSA 3BICA 1OJXA 3LX9A 2FGZA 2ZKMX 1R87A 4M80A 1IR1A 4UFKA 3OVGA 1DEDA 2B0MA 4JTEA 2FQIA 2GGGA 2VX4A 3U2OA 4WSHA 3BW2A 4UXDA 2F6UA 3JU2A 3B06A 3R11A 1MI3A 2WZMA 4W88A 1H1NA 1S38A 3UCCA 5TNVA 1B0IA 3PJWA 1QHOA 1JF5A 3PNUA 4GBUA 3MKKA 1IHIA 1HJXA 3EXSA 1M1BA 3R7MA 5C6MA 2CBJA 1JZ7A 3UWQA 4JHZA 3VIMA 4H2HA 1R3YA 5EB8A 5CZKA 5LIKX 3WNPA 3G8EA 3VX1A 3OIXA 3GHSA 1XCFA 3TYCA 3NPXA 4KERA 2PDIA 2DSUA 2XZ7A 4WCJA 4O4WA 1AD1A 3ZT5A 3W2JA 2ZRZA 2VWSA 3B0VC 2POZA 5LYRA 4V2XA 4D9PA 3L0KA 3CUIA 2X2GA 4JEQA 4O14A 2Z26A 4XTIA 4IMEA 2HWGA 3H54A 3AFBA 1SO4A 3FYOA 3IJDA 5HR6A 4A6GA 1ZQ5A 4WHBA 1LQ2A 4M24A 3HG3A 4C6QA 2R24A 3HG5A 1B4EA 1MXSA 4OGZA 1B3XA 1J0HA 5HANA 2J79A 2OZTA 3M0ZA 3BLIA 2CLEA 5G2IA 2Q8XA 2CWNA 4KPLA 3R94A 3T55A 1LCOA 5F1UA 3Q58A 3O7UA 1E70M 1OFQA 1C92A 2Y7EA 3FHAA 5CAKA 2Y70A 3LZ3A 4NIRA 3CPGA 3EPMA 1RH9A 4P7LA 2OEMA 2PAJA 3R10A 7PTDA 3CBWA 3IUHA 1JNDA 3PPFA 1IE7C 1EIXA 2WBKA 4S3CA 3KE0A 4AXKA 3VNMA 4G7EA 3L4YA 1ZY9A 5F1VA 2C15A 1XLDA 4P7OA 1MUCA 5LNUA 3NXFA 1RY0A 3W24A 3WELA 4HOXA 3REQB 1GYLA 3I3EA 4JTKA 4L4OA 1VRDA 4PTXA 5G2HA 3I6EA 3AWNA 2BOGX 1ADOA 3LI1A 5FEZA 3G5EA 1ZENA 1I9CB 1GOKA 1UKPA 2EJ1A 1JIBA 1EGMA 3ZQ9A 1DXIA 2C0HA 3Q37A 4GVFA 1GW9A 3ITCA 3VILA 4HNOA 1GQJA 4GJIA 3B8VA 3KDNA 3WNNA 4DUXA 1SUXA 3FKRA 4QDPA 1YXYA 2WZIA 2NW0A 3S1WA 1ODUA 4P8VA 1BPLB 4M1BA 1VYPX 2BASA 3L2MA 1TPB1 4N9CA 1UJPA 3ARUA 1GYNA 4UMCA 4H6QA 4F0MA 1WKEA 1XKYA 1AW5A 4O1DA 5C0QA 1TE6A 1R85A 2RGMA 4RZ4A 3NOEA 2A6NA 3WKZA 4UQAA 3RILA 3LBMA 4DZIA 5D32A 3ABRA 1EDTA 1DIKA 3BH4A 4WD0A 1AW1A 4CQCA 3RLVA 2GGIA 3UG4A 1N8IA 5EBUA 3WDJA 3EAUA 4JFWA 3TQVA 3L2IA 2JBMA 3UXAA 7TAAA 1OFEA 1IIGA 3V0UA 3VAVA 3QMTA 4RZ6A 4AD1A 1FWAC 3N3MA 4GACA 2VEIA 2EF9A 1QPRA 3P67A 1DYSA 2HK0A 2XH0A 3PC0A 3WF1A 1SMAA 4DF2A 3WQEA 2QV5A 2XVPA 4PMVA 4DJFD 3H7UA 5HBFA 3AXXA 5J8LA 4L6HA 5HDRA 3PB2A 4C1NA 3O07A 2FB3A 3NO5A 2FH8A 1XLKA 2R8WA 4LQ1A 4I8YA 4N0RA 3HQOA 2EPHA 1OCNA 1US2A 4QSFA 4LRSA 2PWDA 3W7LA 2PDKA 3ANVA 3VFLA 3S6DA 4CLMA 1TRIA 3AMGA 4YWSA 4IIEA 4Y9AA 1JULA 1OFAA 4OBRA 3WEZA 3OGVA 4D1IA 2D3NA 3JVAA 3LPPA 3OQEA 2J9ZA 1W5MA 3OBAA 3ARXA 3QZAA 4C6EA 2IUZA 4HHLA 4JDBA 2CLIA 2GQ3A 4URIA 1XYCA 5AYIA 3TYAA 3TAKA 3ITOA 4KF1A 1JCYA 4I5XA 1J11A 4GO9A 1LROA 3ZVHB 4MB5A 4XK2A 4IQJA 4NUWA 5D9NA 5HWMA 1LF1A 4RR4A 3CQJA 1HKMA 3PBMA 2ZXQA 2E8ZA 1JCTA 3HFTA 1KLYA 1Q6OA 3ABOA 5LSMA 3PANA 2R1PA 4UUIA 3WK0A 1XCWA 2PZ0A 3QF0A 1TUXA 4WSKA 4ZQPA 3PPHA 3O0FA 1JF6A 1TCMA 5D02A 2QYGA 4HZ7A 1NM9A 1XH2A 4B5NA 1GW1A 2BXZA 4GKTA 4TVUA 1K9FA 4PEKA 4ML4A 1W31A 4CGTA 2OEKA 3BLKA 4AZ6A 3BGJA 1I2PA 1ZBVA 1BYCA 5XIMA 1UWQA 4LT9A 1I6NA 2FH6A 4GLEA 5C54A 2H8XA 1BAGA 3OGSA 1T5AA 3GTXA 2OYLA 1A47A 4HZMA 3NAVA 5IBXC 4XAZA 1ZGDA 4HU0A 3MC5A 5MKGA 4W7VA 3QC3A 1BSIA 4YTUA 1PWMA 1K7EA 3VZZA 5I6SA 1W5NA 3UZXA 3W7EA 5FJUA 2PI6A 5FAGA 3TJIA 4C7DA 2W91A 2WPGA 4QCFA 4L5ZA 3G1SA 4JTDA 4YJ5A 3T05A 4CQDA 3PZNA 1XYFA 2NQJA 3TJXA 2NQLA 3KRZA 2BB0A 4GXPA 2ZC1A 3LDVA 4O8RA 5CBJA 3P14A 3W2KA 4FHAA 2ZC8A 1J6OA 1S1PA 3QTPA 4IT1A 1W3NA 4U3AA 2HBVA 4AHQA 3UVIA 1GWJA 3NZRA 1P0KA 4GC3A 3CO8A 1G7UA 3L4XA 3QLDA 1OT2A 1BYDA 4LY4A 1R9YA 5HJYA 5C2GA 3WFZA 2BVYA 4HMNA 5E6YA 4CU6A 4V1YA 1LOQA 2HDJA 3COTA 1O1ZA 1W2VA 3ITVA 1XI3A 3KW3A 3D46A 4XX6A 1PWLA 1XIIA 3V1PA 3MS8A 5JUVA 1C7SA 2YDQA 3PAJA 4NJIA 1SSDA 4HN4A 3HA1A 4FNPA 2Z6JA 4DF1A 4G7EB 1GHRA 1XYZA 3MI3A 4Y9MA 1H4PA 4ORMA 4AW7A 4OQVA 1E9LA 1B5TA 1BTMA 3LY0A 4PMQA 1V3LA 5BMXA 3II1A 3KHDA 1OFDA 4L65A 3M7SA 3WNMA 2FGLA 2GGEA 1TX0A 1XUUA 1O5RA 1MDRA 2HCVA 1HGWA 1Q4WA 1M65A 4PYSA 1JCJA 1TTIA 3VDGA 1O5QA 3UD6A 3GG8A 2QCMA 1F3TA 3T81A 1I8JA 3LCIA 3BAXA 1K1DA 2UY4A 1UIPA 3DGRA 1YLVA 2X0SA 3O16A 1OC7A 3PSVA 1Q6LA 5D9MA 4DJED 3VZXA 3BAKA 4GO8A 3UJRA 3KEHA 1THFD 3PWIA 2HROA 2D0FA 2E67A 4XG1A 3W1LA 1OWQA 1DWGM 4JCLA 4ZO8A 4UOJA 3FGCB 1L6FA 2VEMA 1KCZA 4QQUA 1IXQA 1N82A 3UA4A 2NWRA 1AG1O 3CK5A 3VNLA 4QX4A 1RXOB 4NRSA 3QZEA 2PF0A 2GWNA 4CQAA 4QAIA 2OQLA 3NQ2A 4PUKA 1W9VA 1EC9A 3AHXA 1W9DM 2I1OA 1EYWA 1MEHA 2WC4A 3QMRA 4DHGA 1BD0A 7XIMA 2UV8G 4Z2HA 2WK2A 2XWDA 5AZ1A 1RAKA 2J78A 1H7OA 2SFPA 2VC7A 5IHRA 3IIVA 3GR8A 4RX0A 1DE5A 3OA3A 3W7RA 4BA0A 4GINA 2E5BA 1Y7VA 1Q3NA 1YPXA 1DWIM 3VFCA 1F4HA 3KCOA 4RE3A 1EFZA 4J3SA 4KEVA 5C8BB 3AICA 4OVXA 2YFOA 3MCNA 2TODA 2ZZ1A 2IMRA 4KGLA 2NUXA 4QDMA 1PCKA 1H5VA 1VC4A 3W87A 1BVZA 2CERA 2QQ6A 2YCEA 3GFYA 1YRRA 2YXOA 3DGBA 1FTXA 1VLIA 5BXTA 4C1NB 3QR3A 1ISVA 3MU7A 4PRWA 4B92A 3IV8A 2PURA 3MZNA 3QPYA 4NL1A 3XINA 2D0GA 3A6OA 1UKTA 4IJRA 4TUFA 7A3HA 4O8AA 4DO4A 3EA1A 3CLWA 1G5AA 1J6PA 5FEXA 3P74A 3QY6A 4M81A 2L5HA 1JCXA 1JVNA 5AVHA 1MSSA 1S39A 4FAMA 4H1ZA 5TQLA 2VFGA 2DUAA 3ITXA 4HYVA 4H3DA 3CHDA 1J0ZA 4REQA 3O63A 1HL9A 3AZTA 3CYJA 2W3ZA 3PY2A 2YKKA 3BGAA 1E6PA 2ZDSA 4W7WA 4J4KA 3CUFA 4W7UA 4M51A 3G0UA 4H83A 2VZOA 4EACA 2H6RA 2RJGA 3GAYA 4P7NA 2ZOXA 1YMYA 1U5HA 3GZ3A 4Q6JA 4H7ZA 3N9SA 4AAJA 4UBPC 3VNYA 1NOUA 2PDHA 2FZMA 3WL0A 3RU6A 3IGXA 3W9ZA 1B54A 4RDZA 4M6QA 3W72A 1J18A 2O4MA 4J3XA 3N9RA 1QI2A 2P5NA 3OJGA 3W1QA 1IGWA 3CB8A 1VLWA 4I7WA 1JDAA 4HCLA 1GZGA 3R5EA 2A3BA 3EKLA 1O4UA 1EQCA 1LWIA 3FNDA 2Z2UA 2DZWA 1BKSA 2GL5A 4PMUA 3GFXA 1XPYA 4PMRA 4XZHA 1KXTA 3FJNA 3BQ5A 3EB3A 1XD1A 5MKGB 4DWSA 3NZPA 4AF0A 4QEEA 3U6WA 1JAEA 3HQPA 2BGQA 2VGIA 1EKOA 4WRHA 1O60A 2CEQA 3WK2A 4IX0A 2WV8A 4UQCA 3W29A 1I75A 3L4UA 3PZVA 4IQDA 4GQRA 3GQYA 3IARA 5KZDA 3GR7A 3K30A 4R9XA 5EKYA 2OLSA 2D2HA 2QJGA 5EGRA 4DLFA 3TR9A 1JI1A 1JYWA 4I7UA 2OELA 3B9OA 3OVPA 1Q6CA 3VCNA 4F40A 4MZYA 1R7OA 1C8QA 3P8IA 3GHRA 2VHLA 4JTQA 3VD3A 3LUTA 4Y8FA 5AN7A 5E0CA 4ZENA 2B7PA 4UQBA 3S1UA 3HMCA 3RUBL 3GR4A 4HPJA 1J79A 3VGDA 3WBAA 5HUPA 1VKFA 1VIZA 2ZUTA 3OLIA 4JIEA 3OLEA 2XUCA 4JGDA 1VHNA 4W5ZA 1GVFA 1X38A 5AFDA 4D2JA 5HNTA 3VNKA 3F4CA 1GOIA 3O06A 1G1YA 4X9SA 3WQFA 1CXHA 4XAPA 3ZLHA 2Z27A 2WVVA 2J9YA 2ZWYA 3UXDA 4WY0F 4LH8A 4QNWA 5I3IA 3M43A 1O1HA 3T08A 2I7GA 1DIEA 1WDDA 2HTMA 4L80A 4PMOA 1FCBA 6REQA 1A5BA 2ABAA 4H9YA 4RZBA 9RUBA 4DNMA 3S46A 3UY7A 2HV5A 3OW1A 2ZX8A 4AXNA 1QPNA 4PTNA 4HMEA 1JFXA 3TYUA 2XJ7A 4XUGA 2ADAA 2Q8LA 1K7FA 1QPOA 1W5PA 3M64A 5JU6A 2PEVA 2C1GA 2VVNA 3C2FA 3RXZA 1J96A 4ICMA 2QCLA 5A94A 5U4NA 4LXFA 3VU2A 5DXXA 2PGFA 5DEZA 3B9AA 3FYPA 4Q8NA 4WUIA 5FEPA 1IIHA 1PIFA 5CC3A 2PLJA 3WH9A 3GM8A 4ZFCA 2ZADA 1KTBA 2Y63A 4UQEA 4C6DA 2VC6A 1GPWA 3ZVIA 1NF7A 5HA7A 5LNWA 3EYPA 2KAUC 4YTRA 1GKPA 4MWAE 3RPMA 1ZCCA 2DZSA 3O15A 4PEEA 1RPXA 3AQUA 4LX4A 3PN8A 5FIPA 4JIQA 3D0CA 1ZRQA 4V33A 4C6PA 2VP8A 3QR1A 4DYKA 2HBXA 3KOWA 3VGEA 3QLLA 3WJSA 5D8ZA 1UKSA 6XIAA 3BSHA 3A4WA 3CNYA 4IOTA 4IIHA 2A21A 2J7CA 2P50A 4JTGA 1JDEA 1MW3A 1UPMB 1XW8A 4U5IA 5LA1A 4IFRA 3NOYA 3OBKA 3RU8X 3SCQA 4XBJA 1RHCA 4QCEA 2OLAA 3GIQA 1UB3A 3EWCA 3CV1A 3EGJA 3P2VA 4HYRA 4S3JA 4ORIA 4AWUA 2OZ0A 3N04A 3WD4A 3DI1A 1QNSA 5CJMA 4TVDA 3USBA 4NSBA 1B9BA 1S3HA 2VR2A 4LVBA 1LM1A 2VFIA 3H2CA 4H8VA 4C6NA 3DKLA 1LT7A 2X1TA 2PGRA 2VZUA 1P0DA 3R1ZA 1V0LA 2BY3A 2V3FA 4DJDC 2KX9A 4HHHA 3LGEA 3OLGA 3GBEA 1TJRA 4ACYA 4AD2A 3LHYA 4CVWA 1IWAA 1BF2A 3CM4A 2Y89A 4XIAA 1W54A 1TIMA 1XLCA 1UR2A 4Q7IA 2IPGA 5D09A 1MQRA 2OT0A 2Q09A 3TW9A 2G3IA 4GJJA 1OF6A 2DIEA 1UUMA 4E8CA 2ZZ5A 1LWHA 4UTTA 3IK2A 1FWNA 1YXDA 2QNEA 1KBKA 4F3HA 4WDWA 2WWCA 4IMFA 3ME3A 4REQB 4XAFA 2XZ9A 3WN6A 1KFBA 2AAMA 3QGKC 3L68A 2GWGA 4V15A 1DJXA 3BZJA 1VZWA 2E40A 3CZ8A 4GG9A 5BU9A 2OX4A 3FEMA 3INPA 5I78A 4JYDA 5AC6A 1SO3A 3TQPA 5JIPA 2RHGA 1FWRA 2CETA 1EJWC 4XWUA 2VJXA 3L21A 2PSNA 3HPSA 2OXNA 1GG1A 2IPFA 3LU2A 4TTUA 3PUOA 4WGHA 2DUZA 1VCGA 3FAWA 1MW2A 2CFFA 4YYCA 3RX4A 4JD4A 5FEWA 4FF7A 1TV2A 3R8HA 3B0YA 1XL9A 2WC3A 3L67A 3IJ9A 3JZEA 3UWUA 4AISA 2HSAA 1J0IA 2J47A 3PB0A 3AIWA 1BG9A 1FWBC 3KS6A 2YL6A 4XAGA 3HZ3A 1EH9A 5A6MA 2ALDA 2R94A 1H50A 3W75A 4R27A 4DYEA 4HNTA 5AHEA 4AC1X 2VKZG 3IGSA 4H7VA 4DWSB 1O95A 1KM0A 1XLBA 1BQGA 1M7PA 2ZYFA 4NVTA 2R82A 1NEYA 3MKCA 1KD0A 3UF9A 2W92A 2XHYA 4S23A 1KFCA 3NL3A 4KWVA 3VM7A 4GUHA 3WJXA 1H0IA 3N3TA 1R9ZA 4Q4KA 7ODCA 5CC7A 2Y2WA 3MP3A 3T4CA 1XS2A 4UTIA 3VD4A 4M7SA 3ITYA 5HJLA 2W27A 4BCEA 4PH6A 4JQ2A 4RLIA 3E9AA 4WF7A 4JN6A 2VX6A 3FVDA 4YCPA 3IIXA 1H09A 4QE5A 4IGHA 3H22A 2GSHA 2O56A 3NM3A 3VDHA 5BOOA 4HIBA 5IBXA 5LNRA 2G8ZA 4HP5A 3MTWA 3C2RA 2ZBTA 4EVZA 3FXYA 1J12A 2R1NA 1LG1A 3ID7A 3VC5A 4AD3A 2GGHA 4FX7A 3NFUA 1XV8A 4AZ7A 4CNOA 1YDVA 4ERIA 2WVVB 3G1AA 2OWCA 1XCXA 3W88A 2PGEA 3PZQA 6REQB 3LNPA 1Z8AA 5KTLA 2EJAA 3WDQA 2NQ9A 4NX0A 4BQ3A 2ASHA 1GYMA 5H1WA 4FLSA 1FWHC 2CITA 5BNKA 2QPSA 3AXHA 1EBGA 3WQDA 3GNNA 3CZEA 4CNUA 4YS1A 4S3AA 3M5ZA 4X2PA 4DJEC 2HEJA 1L8NA 3T09A 5CC5A 1YXCA 1JDCA 3OODA 3WO8A 4QLLA 1PIIA 3F4NA 3ITGA 2ABBA 5CCZA 1FX6A 1EP2A 5A8GA 5GJNA 5AZ0A 3ZJ7A 2QUUA 4PFMA 1A5SA 2XGBA 1JDDA 1ZFJA 3S5YA 1NP2A 4LPCA 4J3WA 4JR5A 4D72A 3MO4A 3I10A 4KWSA 3CTTA 5I00A 1KGXA 1EHAA 4ZMGA 1D3HA 1A0CA 1NJJA 3T0AA 4Z1CA 4TX8A 3FKKA 4CKQA 5FF0A 1XYAA 4ZQOA 1SO5A 1YX1A 4P61A 2CXGA 4M8UA 1EP3A 3WLRA 3VKBA 1EYEA 4L1WA 4QHRA 3PBGA 1JR1A 4K7YA 2WSKA 4HSOA 4MY9A 3CMJA 1VFUA 4I9JA 2QJIA 2PC4A 4IPPA 1TJ2A 4N42A 3TC7A 3M0VA 4Z17A 1FP9A 3UZ5A 3TROA 1CGUA 3RK8A 3VO0A 5I3KA 3CT7A 1ISZA 1UBPC 3EWBX 3WLOA 2X0YA 3UQNA 2FTWA 1EJVC 3GE7A 1TE1A 3FDGA 3EB2A 1SJDA 3VDCA 3N6JA 4HTYA 1PPIA 3LRKA 1IWPA 2OR2A 2A85A 3QV8A 4PB3A 4K38A 1W56A 4GFIA 1VRXA 1W9UA 4ZFMA 5GNYA 1JZ2A 2OOFA 4IFKA 2QV4A 2WSPA 4RL3A 1JCNA 3W7QA 5LHEA 4AD4A 3KZPA 4ERGA 4Q8TA 1R2SA 4KCUA 3WLPA 4DPQA 1SZRA 1DWJM 4DUWA 1DVJA 4Q8VA 5DCEA 3EKZA 1CW2A 4W8LA 1Z44A 2J9XA 1EBHA 2JEPA 5G1TA 4K7VA 1WB0A 4JTIA 1TPFA 2NT1A 4QISA 4EPKA 3AS1A 2ISFA 3V5CA 2WLYA 3UNTA 3BW4A 2R6OA 3UG8A 4AWEA 4PCTA 5B80A 5I2UA 2JFEX 1E6SM 3SRFA 2BG5A 3MYPA 1WUFA 2D24A 1WOBA 5FAJA 5DF0A 5A2BA 1W3HA 4RW3A 1MMFA 2VUNA 3VMPA 3ZXWA 5IDIA 1M5WA 4PSRA 3V35A 1Q6QA 3B0UX 1ISWA 3NIYA 1JPIA 1XGEA 3WSUA 4ZE4A 3SUVA 3M47A 5CPNA 3QGVA 1NVMA 1POJA 1IV8A 4OBTA 1LP6A 4IPLA 4PUDA 4ONVA 2BGNE 3NO1A 1DTNA 1GHSA 1ZALA 2QVHA 4ALDA 2VGFA 1WAUA 2X7VA 5FD0A 3T2OA 2A79A 1V6WA 4JTUA 2EGZA 2YL8A 1XFBA 5XIAA 3W25A 3T6CA 3NCOA 3U7BA 3D6NA 4GH1A 1N55A 3ES7A 1UPPA 1TWWA 4ZBCA 3TNBA 4HYWA 3DERA 3M07A 3WMLA 4GXMA 5HWNA 4HBKA 1PKMA 1Q13A 3TP4A 3H6OA 3RLGA 4J9JA 2GVJA 4O52A 1F6KA 2CZVA 2VRKA 3FJ6A 1R7AA 3ZO9A 5LKYA 1WCGA 5LXEA 1WDPA 1OCBA 4UTWC 4EXBA 2ALRA 3W1RA 3BSGA 3P0WA 3ZOAA 4Z2GA 1VYSX 3VIOA 1ZSXA 3O8AA 4M1RA 2PRMA 5B7ZA 1WYIA 3OVQA 3HBLA 3URQA 2BY1A 3VNIA 3IV3A 3QEZA 3W1NA 3C2OA 3GG7A 5CBIA 1C91A 2V5BA 5M17A 4FOUA 4RV8A 3O6YX 3LHUA 4KEUA 1TJ1A 2GJXA 1QAPA 3V36A 1QHPA 1UZ4A 3EX3A 3PPCA 4WX2A 3E2QA 2G0WA 3UR5A 4AEEA 3V5FA 5KSWA 4C6JA 3MVIA 1W8GA 2Q8ZA 3S4TA 1PEZA 2PDJA 2WPBA 4A21A 5F7UA 2GOKA 4NAEA 3EDDA 3LZ5A 3EX4A 4MAZA 4EF9A 2YXXA 3KRBA 3OVRA 4AZHA 2D1ZA 4B5XA 3EPOA 4GI6A 1TYGA 2R9RA 1IXPA 4JTRA 5AKQA 2FDSA 2I56A 4ZTYA 1WDQA 1JYVA 3SSZA 4G9PA 4NNCA 4K8GA 1V93A 3QHNA 2BP1A 3CWHA 2PWEA 3BJFA 4HHMA 3U2CA 3CEPA 3AIVA 4B15A 3VIJA 4H7CA 4KW2A 3UETA 3VCCA 1Z42A 1E40A 4NZJA 3H2EA 4LW7A 1EJXC 4GQQA 3PS7A 2JIWA 2WJFA 3F2BA 1VGAA 4DNHA 3WLHA 4GABA 4DBEA 4AZGA 3LLXA 2FJKA 1TTQA 3UR7A 1QU4A 3WQ5A 1UD4A 3RM9A 2DT1A 1IYXA 3LM3A 1HO4A 3BJSA 2CZDA 4DBSA 3IJ6A 1E51A 3S2CA 5IDZA 3VYLA 2PWVA 4UFMA 5C71A 4B16A 3RLHA 3U48A 4LUJA 2GOUA 3KBVA 1B4KA 4L9XA 3VGGA 4HK5A 2UY5A 2ODOA 5F2MA 3GH7A 2IQTA 2J24A 1GUVA 1ONEA 3ZWTA 2F2HA 2P76A 2VEGA 3W22A 3GU2A 1E6RA 4YHGA 3OBEA 5BXSA 2QMKA 1H63A 4CCCA 2C18A 3WLMA 4QE4A 1CT5A 2B7OA 3QHOA 5D9OA 3WENA 1PX8A 5EL1A 2Z7GA 4JTSA 4KWUA 3NQVA 1JRBA 1ZAJA 4GYPA 1I2RA 2G3FA 2XVKA 3S5NA 1PHQA 3QOKA 1H1ZA 2OO6A 3TU9A 4FLQA 1H7PA 1J2WA 1JXJA 1WKDA 4XD4A 4H9VA 1Z9AA 4E38A 4IIGA 3F5LA 3P62A 3JZUA 3DBNA 2JK2A 4IF2A 3G22A 4AWSA 1ZBKA 4G6CA 2EAWA 3IPWA 5EMMA 5DT7A 1UCWA 2W5FA 3RFAA 1RBAA 2I5GA