1VP5A

Crystal structure of 2,5-diketo-d-gluconic acid reductase (tm1009) from thermotoga maritima at 2.40 a resolution
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
284
structure length
284
Chain Sequence
QVPKVTLNNGVEMPILGYGVFQIPPEKTEECVYEAIKVGYRLIDTAASYMNEEGVGRAIKRAIDEGIVRREELFVTTKLWVSDVGYESTKKAFEKSLKKLQLEYIDLYLIHQPFGDVHCAWKAMEEMYKDGLVRAIGVSNFYPDRLMDLMVHHEIVPAVNQIEIHPFYQRQEEIEFMRNYNIQPEAWGPFAEGRKNIFQNGVLRSIAEKYGKTVAQVILRWLTQKGIVAIPKTVRRERMKENISIFDFELTQEDMEKIATLDEGQSAFFSHRDPEVVKWICSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,5-diketo-D-gluconic acid reductase
publication title Crystal structure of 2,5-diketo-D-gluconic acid reductase (TM1009) from Thermotoga maritima at 2.40 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Oxidoreductase
total genus 108
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 1.1.1.274: 2,5-didehydrogluconate reductase (2-dehydro-D-gluconate-forming).
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1vp5A00
3R6IA 3LD5A 4YVVA 3G5EA 4JQAA 4QBXA 2IPWA 4RPQA 3H7UA 3LZ3A 1AH4A 5C7HA 2ISFA 4OTKA 2IKIA 4L1XA 3VXGA 4WDUA 2PDMA 4JTQA 3COTA 4I5XA 2PFHA 4IGSA 2HV5A 1X97A 3CV6A 1C9WA 1JEZA 1AH0A 1HQTA 2HE8A 4FZIA 1EKOA 3UZXA 4YVPA 4QXIA 1X98A 4HMNA 3B3DA 1ZGDA 2PDBA 3O3RA 4ICCX 3KRBA 1Q5MA 2F38A 1OG6A 2PDHA 2PDNA 2BGSA 3ONCA 2INZA 2ACRA 4FA3A 3UGRA 1RY8A 1GVEA 2HVNA 2PDLA 3EAUA 2HVOA 1M9HA 3DN5A 3CAQA 2DUXA 2FZDA 1YE4A 1S1PA 2FZ9A 3CASA 1AZ1A 1XJBA 4EXAA 1VBJA 4WDTA 4JTDA 4JIIX 3RX2A 1MI3A 2PDPA 1SM9A 2BGQA 2BP1A 4XZMX 3V0TA 3U2CA 4QX4A 2HEJA 2IKJA 3N6QA 3BURA 2PD5A 5JH2A 2CLPA 4JTCA 3ERPA 3Q65A 1ADSA 3UZWA 1QWKA 3CV7A 2QXWA 3BUVA 3R58A 4JTAA 3LQLA 1Z89A 3V0SA 2FVLA 3MB9A 3GHSA 4QR6A 3WBWA 3V36A 3H4GA 2IKHA 4PUUA 1EXBA 3UZZA 2FZBA 4JIRA 1S1RA 5HNTA 3DOPA 2C91A 4GQ0A 4JIHA 5AZ1A 1YE6A 4FALA 2HDJA 5HNUA 2DV0A 1Z8AA 3CMFA 3EB3A 4PUWA 3G1RA 4XO6A 1MRQA 5DANA 2ACQA 2WZTA 4H7CA 3D3FA 2F2KA 4PR4A 1ZSXA 4Q3MA 3NTYA 4DBUA 4XVEA 2IPGA 3GHRA 5M2FX 1T41A 4XZLX 2PDJA 3QKZA 4IJRA 4WRHA 5KETA 5LIKX 2J8TA 3R43A 2IPFA 3GHUA 1Z9AA 3FJNA 2PEVA 4WEVX 1QRQA 3LNMA 3M0IA 4MHBA 4WGHA 4L1WA 4FAMA 4JQ2A 1AH3A 3S3GA 3FX4A 1EF3A 4JQ4A 2I16A 3RX3A 1J96A 2PDCA 2ALRA 3UFYA 3UG8A 4LAUA 3R8GA 2INEA 2VDGA 1K8CA 4EXBA 2FGBA 2DUZA 2PD9A 1IHIA 2PDFA 2FZ8A 4F40A 3LZ5A 2IKGA 4IJCA 1PWMA 1PZ1A 1LWIA 3V0UA 4PRRA 1S2CA 2PDXA 3BCJA 3UYIA 3N2TA 3UP8A 5LIWX 4H8NA 4LB3A 2PDUA 4XK2A 3UZYA 1PYFA 4G5DA 4XZIA 5HA7A 2R9RA 3LUTA 1R38A 1S2AA 1IEIA 1T40A 4ZFCA 3BV7A 4LB4A 3H7RA 4JQ1A 1A80A 2PDQA 3Q67A 2AGTA 4XZHA 1YNPA 1US0A 3WG6A 2PDIA 4DZ5A 4NKCA 3CAVA 4GCAA 2PF8A 4PMJA 1VP5A 3MC5A 2ACSA 2HE5A 3WBYA 2NVCA 3RX4A 1XGDA 1Z3NA 4WDXA 4GQGA 2P5NA 2PDGA 5AZ0A 3R94A 4YVXA 2R24A 2I17A 5JH1A 3ONBA 3M4HA 1PZ0A 3LBOA 2IQ0A 5LIXX 3C3UA 3R7MA 3P2VA 1PWLA 4DBSA 4LAZA 2IS7A 4PRTA 1EL3A 4ASTA 4WDWA 4JTRA 1HW6A 1LQAA 1FRBA 1YNQA 1AZ2A 1Q13A 4GACA 3F7JA 2NVDA 2IPJA 2ACUA 4Q7BA 3LEPA 4YS1A 4XAPA 3V35A 1ZQ5A 3GUGA 2A79A 1UR3M 5LIUX 4YU1A 1AFSA 4R9OA 3O0KA 3GHTA 4GABA 2PDKA 4AUBA 4XO7A 3LN3A 1XF0A 4GA8A 4DBWA 4HBKA 3LQGA 2PDWA 4XVDA 3UWEA 5LIYX 2WZMA 3LENA 4XZNX 2PDYA 1ZUAX 3WBXA 3M64A 4JQ3A 2IQDA 4LBSA 1MZRA 1RY0A 4GIEA 3WCZA 1RALA 3EB4A 3T42A 4LBRA 3R8HA 1X96A 2PZNA
chains in the Genus database with same CATH superfamily
4CVWA 2WM1A 3RG6A 4JNYA 2GYIA 3GDKA 4GZJA 4Z42C 3ALFA 4PCNA 2Z7GA 4L1XA 3GR8A 3LB0A 4AD1A 3I65A 2QV4A 3N19B 2B7QA 3MI6A 5A6BD 2Y8UA 1FWWA 2GJPA 1X97A 4Q4MA 4O0ZA 2ZRYA 4ILSA 4NY2A 4GJJA 1FH8A 4LAKA 4YVPA 3C56A 1I75A 3GXIA 4PEKA 4HK6A 4R7WA 2A3EA 3V1PA 3R0KA 3VNIA 2ZX7A 3APGA 1SMAA 1JUKA 2YYUA 3KRBA 3RPTA 4U5KA 1DJGA 3KBNA 4PGLA 3FS2A 3L2LA 1NOWA 1EDTA 1XRFA 2ZXBA 3HFYA 2GFTA 2QHAA 1CLVA 1RY8A 5A8NA 3BV4A 4O1AA 1EWDA 1H7OA 1EGMA 1DJYA 4C6BA 5LXEA 1W1VA 2ZIDA 1ISWA 3H4XA 3K1GA 4EXAA 4P61A 1MRAA 3U9IA 2OX4A 1GQKA 4Y9PA 1TMLA 4HYVA 4XWUA 1QW9A 4E2OA 4GNVA 3ARPA 3U2CA 2D1ZA 3NGJA 4B92A 1HL9A 1PKLA 1F6PA 1SFSA 4OU1A 4GYPC 2CLPA 2Y5JA 4ZXOA 1GZJA 1SSDA 3N3MA 3ARZA 1DJHA 4IIBA 4GVIA 1QNOA 2EKCA 1Z89A 4DWSA 3PBGA 3A9BA 1OD0A 4LU0A 3IK4A 4A21A 1KKRA 3V36A 2DZTA 2IKHA 3LERA 3R2GA 2PMQA 2XFYA 4KMQA 4JIRA 1JPKA 1JAEA 5HMSA 2NQZA 1F73A 3ABRA 1W56A 4JIHA 4JICA 3TMLA 1F3WA 4E2VA 4LC8A 3SADA 1GW1A 5SWUA 4JX4A 5CBBA 2FHFA 4DAFA 5A6AA 2GUYA 1U1JA 4Y9OA 1EPVA 3UY8A 4XO6A 1HP4A 2E09A 1ZALA 2ZADA 5AECA 4N9BA 4L64A 2HK0A 1JZ8A 1ZNNA 4AZGA 6ALDA 4RE2A 3GK0A 5F4SA 4PZVA 3GHRA 3WQ8A 1OHLA 3GNPA 1DKWA 1E70M 3WDIA 4IF2A 3QXBA 1V8EA 2EPKX 1XPYA 3KL0A 3B8SA 3L67A 3K8LA 2CXEA 3WFLA 1QRQA 3AWOA 3CYJA 4NQ1A 4UB9A 1UD2A 4B90A 3W38A 5HAOA 3B9OA 3WJXA 1M41A 2V63A 4NZ4A 4ZZ9A 1IIGA 4IPNB 3ES8A 3CV1A 4ATLA 3NQGA 2PBOA 1XBYA 2HCVA 1R85A 4F9DA 4EWJA 4QSFA 3S5SA 3VX1A 2DUZA 3P80A 4MLRA 3EX1A 1V3JA 1Q8AA 1DIKA 1E4LA 1FDJA 4JTFA 4E5TA 3WLIA 4HJFA 5REQB 2BVYA 4C91A 5LNSA 4H04A 1UD3A 3CHDA 1ICQA 1YNYA 3L23A 3W25A 2KZHA 3TTSA 4PULA 3EMZA 3JW7A 2GK1A 1UUMA 1OT1A 4P7RA 3L5LA 3OYXA 2J8GA 1IEIA 3L2MA 1LJYA 3BV7A 2VUNA 3SRHA 1Q66A 2XGZA 4XZHA 1FY6A 2ZZ2A 5TQLA 2G3FA 3DFSA 2UV8G 3SO7A 3ZR5A 3H54A 1D8CA 3AYSA 4MMWA 5CH9A 3T7VA 4CKQA 4O10A 3TTOA 3UR7A 3TNOA 3GIQA 2R1LA 3RO6A 4AG0A 2X16A 2ZVRA 2Y62A 5D30A 4XX6A 4ZXLA 3TR2A 3MTWA 4RW5A 2E3ZA 4AD3A 1GKPA 2Y2WA 1JFHA 2DVTA 1ZBCA 1W31A 4YYFA 3SRDA 4LALA 4RNJA 4DJDA 2HROA 4DVOA 1EJXC 3F4CA 4GQGA 2J62A 3DCPA 2DZVA 1BSLA 3CYVA 4P8XA 1E6QM 3NGFA 1B5TA 1FQ0A 3DIPA 2J8FA 4Y90A 3IUHA 4NYUA 2E8ZA 3MUY1 2DORA 1U33A 3WD3A 1J6PA 5HUOA 3ARTA 1W3LA 2X0HA 3W75A 2R1PA 1YNQA 1A5NC 1V3KA 4U2YA 3T4WA 1QI0A 4JHMA 3WY1A 1UC5A 1CX9A 1NAL1 3SUUA 4D6HA 3A4XA 4B5SA 5CXPA 4JTTA 3QLDA 4WOZA 3WD1A 1N82A 3MKVA 4QFUA 1ECQA 4NAFB 2OFJA 1XIHA 3U4FA 2J7FA 2AL2B 3CUIA 3TFXA 3SY8A 2NV9A 3HG5A 1BQGA 4GA8A 5FIPA 2BHYA 1W1IE 4B3ZA 1QOXA 4DEFA 4GCXA 1KXTA 1X8FA 2XDFA 3AOFA 4UQBA 3HQ1A 3P0WA 2E9LA 4MG4A 1DE6A 1RCXB 4D6DA 1J5SA 3VTRA 3ZO9A 3SCQA 4HP5A 5CGQA 4NZFA 2ZZ3A 1KFWA 1ADDA 1VHNA 4DRSA 2PZNA 3LHWA 3A3WA 1EQCA 1NP0A 4IISA 2DY3A 3DGRA 1MW2A 5C7HA 3M0MA 1U1HA 1KLZA 4NASA 4JTQA 1V0MA 3WYZA 1NDZA 4X2PA 2YXOA 4IP5A 3AUOA 1TRDA 4LT9A 1ZAIA 1H7XA 2NW0A 4HHHA 1HJSA 3T0AA 3DBPA 1ITCA 4FMVA 4IMGA 4POCA 1TE1A 3D3AA 4L61A 4C6FA 4NP7A 5EFDA 1E6SM 4JS3A 3KDOA 1EO5A 2C6QA 2JIWA 4XQ6A 5ABTA 1A0DA 3BQ5A 1A4MA 3BAWA 3P14A 3T4CA 3EYPA 1RD5A 3W1XA 4Z17A 2O9PA 3UPWA 2Q3RA 1VH7A 1H50A 1TJ0A 2DUXA 3PPGA 3DYMA 1JPHA 4MNMA 1X6LA 1PTDA 4ZSUA 3IJ8A 3RYSA 4CNTA 2NLIA 1M7OA 2VGGA 3LSCA 4WY0A 4J28A 4F2TA 1FWHC 5LHFA 3KRUA 1BFNA 3VIHA 1KRAC 2QPXA 3RM9A 3FAWA 3A12A 1M5WA 3J7HA 2XZ9A 1G4PA 5FF2A 5CJ5A 4L6OA 1QWKA 4ZSTA 1CT5A 4G7FA 3U7VA 4DI8A 3GIPA 3V0SA 3P7YA 4H9XA 3VKDA 3MB9A 3VNYA 3GHSA 4S23A 1GZ1A 3PAJA 3UR5A 3M5ZA 2HSAA 1RH9A 3H2NA 3W7IA 3QHMA 4E38A 4AH7A 5F4XA 2J9YA 1GKQA 5EYWA 5C9RA 2ZC8A 1Q6CA 4ZQPA 2ZUMA 1MYRA 4BKNA 1BXNA 1OFEA 3FAXA 4V1XA 4IM4A 2VNCA 2GOUA 2YCLA 2ISWA 3DC0A 3H2CA 4JIQA 4E8GA 3CH0A 3GY1A 3I3EA 2J7GA 1PTGA 3VI2A 4JL2A 3HGJA 1GVFA 1AQ0A 2ZDRA 1A0CA 2BVTA 4S1FA 1NWTA 3UJSA 1TIWA 5FACA 1W2PA 4IJRA 3B8WA 3PTDA 5DBTA 1TIMA 2OGJA 2YBUA 2O4MA 3B06A 2V2DA 3EX3A 1K02A 4UBPC 3W72A 1PCWA 1EF3A 3KDNA 4ZQOA 1GOOA 4GVFA 1K4HA 4MDOA 3TZNA 3PTQA 2HWGA 4IMCA 3FW6A 4DYEA 2G4FA 4YTUA 1W54A 4HTBA 4NI8A 2SFPA 1QI5A 1VLIA 3KVKA 2IW0A 1OZQA 3C2VA 4HMEA 1Z6KA 2PDFA 4LYKA 1MW3A 3BE7A 4FLQA 1NH6A 2CPUA 4CQAA 5EY5A 2A5HA 1TSIA 1PZ1A 1LWIA 2VEMA 5K4ZA 4J1OA 4B91A 4NI3A 4G1NA 3EDEA 1FBAA 5JBDA 4IP7A 4BZYA 3GFYA 2OQYA 3BCJA 3GBEA 4J4KA 2Y7GA 1PAMA 3HPXA 2QCMA 1LM1A 1SZGA 3UZYA 1ZS2A 3LCIA 5K9DA 4JYDA 1AJ2A 1V0NA 1ZB5A 3FEMA 2VFFA 3FHAA 4GZIA 2CLFA 1XC4A 1HO4A 1XUZA 3O06A 1DIOA 2Z27A 5JXQA 4GISA 1Z44A 4IGMA 1US2A 3W2JA 2VOMA 5DO8A 4JGDA 4X61A 1T96A 4NZ5A 5MHBA 1V51A 2O7QA 3BLDA 2W0UA 4B3KA 1ITXA 1RA0A 2QPSA 5F1VA 3WNPA 3NZQA 1PV8A 1JDEA 3EGJA 4HZ6A 1E6ZA 3DI1A 4ES4A 4HNNA 2W79A 3G1DA 2OEMA 3WKZA 1DXFA 2FTPA 3PBMA 1V5XA 2GQ3A 5HOSA 4RE4A 1SJBA 1UP2A 2RDXA 3ARXA 1XGDA 3W2NA 5G4EA 1E5JA 4S3DA 4LW7A 2VKZG 3W87A 5CCZA 1Q6FA 3OVPA 3BOFA 1R86A 3B4YA 3NZGA 5FEPA 2R24A 1BVZA 4Y8EA 4Q8PA 4XKMA 4L56A 4LYPA 3LV5A 3VU2A 3M7SA 3BOXA 1VFHA 4M56A 1KCLA 4HYWA 2DSWA 4W93A 3AS3A 2E67A 1LQAA 3K2GA 1OK6A 3NOEA 3K13A 3MMWA 3MMUA 5E9XA 4LVBA 4PTMA 4OOZA 2VVNA 1M03A 1XRSA 4ZB0A 5LIUX 3LHTA 2A2IA 2BBFA 1H1ZA 1OEPA 2EQDA 4YU1A 1MWOA 3CM4A 4FNUA 4ZO9A 1CXLA 3HG3A 1V02A 2GZXA 4O11A 3SM0A 1BKHA 4LJ3A 1U5HA 2A6NA 4BWLC 4FPSA 3RR4A 1OFDA 2GVEA 3ZSTA 4NVTA 4GNJA 1DWGM 1EGVA 1QO5A 4LYQA 2RDUA 3UG5A 3LENA 4Q33A 3N73A 4AIBA 1OGGA 2VMFA 1TA3B 3M64A 1VYPX 4IMAA 1K7EA 2PC4A 2BG5A 3GR7A 2OEJA 1T8XA 4RKAA 1P6BA 3WJWA 3HG2A 1RLCL 4UTIA 4BQ3A 3FHQA 3P62A 2HXUA 3EB4A 3OYZA 4M80A 4U4MA 2J7DA 1KKOA 2EEXA 4LBUA 1XBZA 5CPTA 1OQFA 3RUBL 4CQ8A 3UVIA 1M04A 1BYBA 1Q4NX 4CCDA 1YW1A 3PB2A 1VIZA 5EB8A 1TX0A 4J5NA 4YJ5A 2G97A 1GHSA 3UD6A 1DE5A 1OB0A 1XKYA 1IV8A 2A3AA 5HINA 1B3VA 1FHVA 4QXIA 4XUYA 4AZ6A 3O3RA 4C5ZA 4EK7A 2GQ9A 2JFEX 1PDYA 5BOFA 4GK8A 3N04A 3UESA 1MDLA 4D6JA 1SFJA 3PZVA 3MDWA 3B9EA 1K6WA 3CLMA 3WQCA 3II1A 4PUMA 5G2HA 4N6EA 4OJYA 4IUGA 5CEWA 4K7VA 3UGRA 7ODCA 4MDPA 4O18A 1I2OA 3KL3A 3NM3A 3QN3A 2E6AA 2CWXA 3NQVA 5FJUA 3DESA 1Y5VA 2VCAA 3PZQA 2H9AA 3GTHA 4L80A 4WKFA 3RX2A 4L6DA 2IQTA 1BQCA 4DZHA 2X7VA 5FI8A 5C9ZA 2VC6A 2RDWA 4LUSA 2XYLA 4PUKA 2HEJA 1RVGA 3NO5A 5A8OA 2MUCA 4PB5A 3KZSA 4IQEA 1IF2A 3QSRA 4FK9A 1C91A 3O2LA 3CUGA 3QEZA 4Q4SA 4O57A 2DP3A 3EWYA 2VC5A 1B9BA 1GQLA 4M82A 5EFFA 4E4PA 3LY0A 3QV8A 1LRNA 1EJSC 2VFHA 4LUTB 4S3CA 3DI0A 3A4JA 4GZEA 4GIAA 3N11A 5A1AA 4JIEA 4L1GA 3UJFA 3IRDA 1U83A 3CBWA 4MY1A 5HNTA 1EQPA 5G1MA 1TQXA 2WMFA 3BANA 1TZ7A 4AXNA 4YTRA 4IMEA 3PTKA 4JN6A 4NRRA 3AHYA 2DDXA 3BLLA 5AN7A 2CZDA 3WMCA 3GH7A 4MWAC 3WF3A 4TVUA 4C60A 5HWJA 3IGUA 4HZ7A 4PUWA 2EAWA 2GQAA 3EOOA 1FWTA 3BSHA 2WZTA 5LA1A 1GPFA 4ATWA 4GBUA 4GE8A 2J13A 3OGSA 3W1MA 4LF2A 3EDKA 4FLRA 1UH4A 4ADTA 4XVEA 5FJJA 2NQLA 4KFOA 4JFWA 5CPNA 1W3IA 1QNSA 4Y9AA 4Q7IA 4B9YA 1E1CB 8TIMA 2TODA 4WSJA 4XZLX 1XYMA 1TR9A 3IWPA 4EF8A 4W85A 2ZX9A 3QKZA 5CSYA 3VD5A 1HKKA 5F7UA 4JN7A 5E09A 2O9RA 3E5PA 1D7FA 3OLDA 3VM5A 4QGCA 3VOIA 3VCRA 1AQMA 2QCDA 4C6QA 4WGHA 5ABGA 4GXMA 4L1WA 4FAMA 5KZDA 1WPCA 3VC6A 5GNZA 3GAKA 1PL9A 3IJ7A 1J96A 5EMYA 1G94A 4FXSA 3R8GA 1OCNA 4CQ9A 1TKKA 1E1EA 3IK2A 2GDUA 4QEHA 3MUCA 1A49A 3VGFA 3BLFA 3C61A 3RO8A 3PPHA 2OX1A 2XVKA 2HJPA 1RAKA 2WWDA 2JKAA 2X8RA 4PODA 3VKAA 3UF9A 4LEQA 2OSYA 1XLHA 3IIVA 3URAA 6PTDA 5HNRA 3H12A 2X05A 4QNEA 2ZXQA 5K7JA 3NM1A 4MADA 3W7NA 2WBKA 2CLEA 4WSHA 2QDGA 3W86A 3I7QA 3LTPA 3B9NA 1R38A 3OPSA 3NURA 2Z1SA 1GOMA 1TPB1 4OOUA 1WZLA 1TPH1 2C13A 3BC9A 4UFLA 3L21A 1QI2A 1W37A 3CPUA 1JUBA 1PJ9A 4QM1A 3UT0A 3POHA 1V6WA 4ORMA 2WJZA 1EX5A 3CMGA 3GFXA 3HQNA 3E0FA 3QKEA 4HNOA 4F0RA 3INPA 3CAVA 5C71A 1Q63A 2QVHA 3W2LA 1AW1A 4TV6A 3VNLA 3QTPA 1E6PA 4DB7A 1K9DA 4PMJA 2BXZA 2ISVA 3WD2A 3R13A 3IGHX 2I9EA 1VCVA 2W66A 3W70A 3BLPX 4DO6A 1IZCA 1F9CA 2E28A 1JJKA 3OG3A 1YTEA 3ZVIA 5D8ZA 1W1B1 1G4SA 3WK2A 3MU7A 4S39A 3N2MA 3MBDA 4Y8FA 3VGHA 4PRWA 5JH1A 2QULA 1FWEC 3CUFA 3LA4A 4UFKA 3WUEA 3P2VA 1GVQA 1F3XA 4JCLA 1K6AA 1C7TA 2FJKA 2G4JA 1OX4B 4DLMA 1QPKA 1LP6A 1HW6A 1JCYA 4C90A 3SCNA 3B0PA 3E2VA 4AMCA 4OHQA 1ZQ5A 3G8RA 1P4CA 1R8LA 3OW1A 4DJED 2ZVIA 2WJDA 1XLFA 5BWFA 1W17A 3TYZA 4R9OA 3UNDA 5AYYA 2D2GA 5C0QA 4NSBA 4DUVA 3Q4DA 3ITLA 1T8QA 3LCFA 1ZBKA 1DL3A 2WAGA 3ZOAA 1HJXA 2WSQA 3MP3A 1T6MA 5A6BA 4WIWA 2PP3A 1G0CA 1ONXA 4LV9A 1O66A 4AZ5A 1XQLA 4OV9A 1AMKA 1ZUAX 4LUYA 3LRLA 1ZBVA 3EWWA 1XH1A 2IQDA 3NSMA 2XIOA 4Z2LA 4O0QA 2GVYA 3W26A 2JGYA 3TZFA 1UD8A 3TJLA 3S1GA 5E1QA 4H1ZA 1GYLA 1ME7A 3LD5A 2P0OA 5AC6A 1NDWA 3Q37A 2OR2A 3CB8A 1U1UA 1Z69A 1OC5A 3JZEA 1WDRA 5E6ZA 1H62A 2XJ7A 2FB3A 5AVHA 3VXGA 1YPFA 1VPYA 2G95A 1F3EA 5CJMA 5LGZA 1DWFM 4ZB5A 5I78A 2E7FA 2GGJA 3T0TA 2AKMA 5D38A 3BAIA 6REQA 2V69A 1XS2A 3ZFHA 2HE8A 3FSUA 3WIJA 3B9AA 3S8HA 5BRBA 1H7RA 1VC4A 4S38A 3KWSA 4MB4A 3SGUA 4LQ1A 3LXBA 2ZZ1A 1EJTC 1Q5MA 3MSGA 1OG6A 3CH9A 1DV7A 3P61A 3KLKA 4UFIA 3GD6A 4K2SA 3ITOA 3T8LA 4ONVA 2I9UA 4XAZA 1KTCA 3SCSA 1XIIA 4H2HA 4Y2WA 2E5BA 2XFRA 1QK0A 4J40A 4J2PA 2QMKA 3B8DA 2P88A 4PBEA 3EPNA 4UTHA 1XDLA 1FWRA 4Z0SA 5JUVA 2A4AA 2FZNA 4O17A 5EPDA 4M6UA 4KWOA 4WF7A 1MZHA 3PZNA 2E4TA 1RV8A 1XUUA 1FVPA 3W53A 4LAMA 3WEZA 1HKWA 3LDVA 4JTCA 3AS1A 4C6OA 4AISA 1IE7C 4BEUA 4BR1A 1MW0A 1JD7A 1OYCA 4EANA 1P7TA 4H8HA 3ATZA 3WQ6A 1O4UA 4D6EA 2EXOA 3GDRA 2WNWA 3KAOA 1HUVA 3L0GA 3U3HA 3CIWA 3GNXA 4WCJA 2OZ3A 5A6JA 3EOUA 1S1RA 1US3A 3TYAA 3FA4A 3DAQA 2WVUA 4GC3A 1VFTA 1KM2A 4IIGA 4C1NA 4QRNA 3HMCA 4KRUA 5MKGB 3TTQA 4A3HA 1T7LA 5CC5A 1UP3A 3S9IA 5K9XA 2NWRA 4IG2B 1CNVA 1KLYA 2F6UA 3LTYA 2OLHA 1WCGA 3WLOA 3I6EA 3HBLA 1UWRA 4F79A 5HDRA 4J7RA 3L0KA 2GJLA 4CGTA 1EEPA 1K3UA 5JU6A 2ACQA 5I09A 4DJFC 4C7GA 3C8NA 4HZMA 3N14A 1XIBA 4NAEB 1BVWA 2B81A 3H2EA 4Q8MA 1M3UA 1TPDA 3DGBA 1ME8A 4C5YA 1ML1A 1M01A 1F61A 4C6JA 4LGXA 3WL0A 2PCEA 1X1ZA 3IJ6A 4KESA 3RITA 1XD1A 1SFLA 2PRHA 1N7KA 1OT2A 4JHZA 1F7BA 3MJYA 2XVPA 3L5AA 1OFPA 4CCCA 4PMRA 4QQUA 5FEWA 5G1YA 3N4EA 2PWDA 1FXQA 2PAJA 3CWHA 2QPUA 2ZUNA 5FJOA 1VFMA 4Q4PA 2PDCA 3U8GA 4YCOA 4IXHA 1NVMA 1VR6A 3AYVA 5E93A 1O7AA 1OFQA 4K39A 1K8CA 3QFEA 4LVDA 5C2XA 1XLIA 1RSCA 3GVGA 1UQZA 3O07A 1HL2A 3QVQA 3GWQA 3H4WA 3GTXA 3QC0A 3P8JA 1ICSA 4G1KA 5D4YA 2C14A 2QDEA 3NO1A 1CECA 1JCNA 1VYSX 3PZIA 3UP8A 4J35A 2FTWA 3FYPA 3GVVA 3NG3A 3OQEA 3MHFA 1YPXA 1X6UA 1G6CA 4AZCB 2GVGA 1BRLA 5CLTA 3STGA 4LC6A 1FWCC 2Y8KA 3O0FA 2XIIA 1QUMA 4WKAA 4DM2A 3A5VA 4AD4A 2CLLA 3VPLA 1OK4A 3AWNA 3O63A 2ATSA 1WDQA 2B0MA 1OWQA 1FOBA 3ZSSA 3UPMA 4NKCA 2Z25A 1W5QA 3MJMA 3GXDA 3GW0A 3NA8A 1P1XA 4YCPA 2QJIA 3FDKA 1F6KA 5AYBA 1TV4A 2P50A 5I3IA 1TQJA 1VCGA 1FTXA 4WJ8A 4L4MA 4ADUA 3EX4A 1WE5A 4IL2A 3NUKA 4F9JA 3S83A 1I2NA 4GY7A 4GX8A 5ABFB 3LI0A 3DFOA 3PBWA 1UIOA 3VX0A 1TPUA 3BAKA 2OYLA 2ABBA 2ONEA 1ZTVA 2E1WA 1XLJA 2F84A 2ISDA 4HN4A 4G7EA 3BGAA 3CUHA 1XDJA 4RE3A 2Y89A 1V4YA 2X30A 1TV8A 4ZMGA 3LMYA 4HU0A 3TJ4A 1NDYA 1N55A 3C0SA 3QY8A 5HULA 3SEPA 1FCQA 1E73M 2JE8A 4O1DA 2OG9A 3RM4A 2W61A 4XZBA 3F7JA 4Q8UA 2IXUA 4CCZA 4CNSA 4JKMA 4QDPA 3LK6A 3G0UA 3DKJA 3WBEA 4H9MA 2FYMA 5AC8A 5XIMA 3GXPA 4H00A 3NIYA 1FP9A 1IXQA 1TJ1A 4TO8A 4LRSA 1D2KA 1W5PA 2X09A 4NL1A 1HKMA 4AIEA 3H2MA 3NXLA 1UZ4A 2OTDA 2A0NA 2C1GA 4GKLA 2PUZA 4M51A 3JS3A 3PAOA 4JQ3A 2X1TA 2V30A 3WK3A 1UA7A 1UMLA 1LG2A 1NELA 3PSVA 1EUAA 1PEZA 4RNHA 1TJPA 2DW7A 3QV6A 1KB3A 4JQAA 5A6TC 4QBXA 5JQ9A 1UKPA 3W7OA 3AU6A 3VNDA 5GPRA 4PCTA 1JF5A 1A3HA 1UZ1A 3CL8A 4J3UA 4FNTA 4WDUA 4TMBA 2A3HA 1XD0A 2V3EA 2UWFA 1R7AA 2VWTA 4O4WA 2W67A 3CTLA 3OG2A 1HKJA 3PBVA 4GJ1A 4JIPA 3BLIA 3PM6A 3LPGA 3OO2A 2BY2A 4QAWA 3E02A 1CXIA 4MAZA 3TW7A 4PB4A 2V5DA 2V3DA 4J3WA 1CB7B 1NEYA 1MXSA 1P0NA 1A0EA 1F05A 5CC6A 3KHJA 3M41A 1XR2A 4AVOA 1BYDA 2OT0A 1DJNA 4D8LA 1W9DM 5ABEA 1DQWA 4Q4OA 1JPMA 3HGOA 1MEIA 4LFYA 2FKPA 3PUOA 2BWGA 1S1PA 2FZ9A 4D72A 2VGFA 3KOFA 2BTMA 1VFSA 1UWAA 2HISA 4Q8NA 1XIFA 3LCWA 2FFCA 2BGQA 5LA2A 3W7GA 5E9AA 3WQDA 3VKJA 2ZUSA 4JAWA 2GQ8A 3QGKC 5HATA 1GPWA 4AWTA 4DUXA 2W27A 4XKYA 4P8UA 3WLMA 3Q65A 3U4AA 4LCRA 2XH2A 1C8XA 3RLHA 1CGXA 1HJVA 2QXWA 3B03A 5D2YA 4M24A 1JDAA 3VMNA 2OQLA 2QDHA 1W9VA 2VRJA 2HK1A 3XINA 1KGUA 3RGTA 1B0IA 2DZXA 4UTWA 3C2YA 1RPXA 3P5ZA 3EWBX 3FJ4A 3ZT7A 5MF5A 5CGMA 4MM1A 2DV0A 2XSXA 3CMFA 2D69A 5C9UA 4PUNA 3OIHA 1MRQA 1IWAA 2W4XA 4GIRA 3M5XA 1Z32X 4H7CA 4KWUA 1W6TA 4D9PA 4A35A 4V28A 1KW1A 5T26A 3GX9A 3L5MA 3AIEA 1PX8A 4NNAA 4Q3MA 1C3FA 1WP6A 5DMYA 5C55A 2YA1A 1A5KC 4W5ZA 1HFBA 4H9YA 4MOZA 1E0XA 3LU2A 2PZ0A 1VEOA 3VNJA 4DNMA 1CLXA 2Q02A 3L4XA 1CZ1A 4WRHA 4R7JA 2X1RA 1XLBA 3W6LA 4I6KA 1S2TA 2O9TA 3ITGA 5HMEA 5RUBA 3E0WA 4MYXA 3B0XA 3B8VA 1KWKA 4U28A 2W92A 5DXXA 3GDLA 1V7YA 3PWIA 3H6OA 4S3EA 3DFNA 3C0QA 4QG6A 5BXRA 3GTFA 1M65A 1TTQA 1H5YA 2CBIA 3FA5A 4JKKA 4LCSA 3MHUA 3IEBA 4PCFA 4WZHA 3QW3A 3S2LA 2G50A 1EEXA 3BJSA 3E1F1 9CGTA 4JCMA 3THCA 4DJDD 1WA3A 2ZTKA 1K8ZA 2BGNE 4H6KA 3VDCA 3VKKA 2ZRWA 1KGWA 1S2CA 1XYFA 3UYIA 1J9YA 1MMFA 3SQMA 4KRTA 4LB3A 3F2DA 2PB1A 5AFDA 1O94A 1TX2A 3GC4A 5BW6A 4HA3A 3AIUA 2FZMA 2P53A 3DC8A 1TJ2A 2EHHA 2NX1A 3IJIA 3IRSA 4K8GA 3F5KA 5CLWA 5HJLA 2DSVA 4KGLA 3RN6A 4Y96A 5E0CA 4TVCA 1FUYA 1BHGA 1XSJA 1V3IA 1RVKA 5CPOA 1TZZA 3SJNA 3CUZA 3G24A 4DZ5A 3NZPA 2YYTA 1JVNA 3WSUA 3N17A 3WQVA 1MUCA 5LNRA 4GYJA 4NNCA 4C7FA 1RHCA 3MCMA 4M0XA 3MA8A 4N0RA 3W3OA 3MC5A 3VE9A 4INFA 5IDIA 4AFYA 3NYDA 4AVNA 2W6RA 3CZGA 1LOLA 3QH2A 1FWFC 2DJLA 1CI1A 2OYMA 2MANA 4DWSB 4MYAA 1UHVA 4W87A 2P5NA 5G5IA 2EJAA 4ADSA 2HBXA 3MBFA 4O8AA 2FHCA 4ZVJA 1RCOB 3VILA 5I06A 1FXPA 3CHEA 3QW4B 3ONBA 3OLIA 2VUYA 5GQBA 1W9BM 4DO7A 1CWYA 1O6IA 5IDZA 3N2BA 2OXNA 4XAFA 1Q85A 4CD5A 2WXDM 3VO0A 5CGTA 2X0SA 4KT2A 2HQAA 1XHGA 1RLDA 1VJZA 4H9TA 1WDSA 5C70A 1R2RA 2PTZA 3GXTA 2EO7A 2JBMA 2BMBA 1EPXA 3PG8A 1RQBA 4HSHA 1AD1A 2ZRXA 4MB3A 5K4XA 1XFBA 2FIQA 1KXHA 3DG3A 3R11A 3IVTA 3P74A 1YPIA 8CGTA 3AO0A 3UWQA 3E2SA 1B2YA 3ORWA 1LLZA 3M16A 3QQWA 3PBYA 2QUUA 2XN2A 1DYSA 3ZM8A 2OO6A 4FR1A 4LBSA 1WXYA 4IGNA 4D6GA 4C6MA 4M6PA 4DI9A 4W5UA 4Z2JA 1K03A 3ZJ8A 3ARUA 1HNYA 1HJUA 1JZ7A 3EKZA 3AS2A 4M3PA 1AH4A 2WQDA 3BGGA 2ZX8A 2ODOA 3CO8A 3AHXA 2REQA 1JXJA 3ZS4A 3LCGA 3T0CA 1Y5XA 2V3GA 1HQTA 1NOUA 1OIFA 3AXHA 3C52A 1H4PA 3LGEA 3WJYA 1B30A 5DF0A 3ZVHA 3CJPA 2WWCA 5KSWA 2PWVA 3B3DA 4FXFA 3I7RA 3VDBA 1XIGA 2R94A 4I5UA 2F38A 1SZNA 1SZRA 2VFDA 1RR2A 2DUAA 1JAKA 2WKLA 3VKCA 1XLEA 3VGBA 4HCDA 2A6LA 4CVUA 1TVLA 2GK1B 4MPKA 2ACRA 3LV6A 3N2XA 4ZTXA 4AF0A 3BZJA 5HJYA 4D2JA 4YMZA 3ANYA 1VJIA 6TAAA 3BG9A 5FKYA 1Z42A 2AOSA 2CCRA 2D23A 3LI1A 3C6CA 1VB9A 4K68A 4HN8A 4WDTA 1DIDA 4JIIX 2DT1A 4GKTA 2PU1A 3E0IA 4FNQA 3V0TA 4GHRA 4QX4A 1PIFA 1OF8A 3HPAA 4HK5A 5I24A 1K7XA 1XCFA 1LL6A 2AKZA 3SI9A 5GVJA 5HMFA 4OFCA 1XDMA 3OA5A 3ERPA 1ZY9A 4JFSA 4CEXC 3KTSA 5I3JA 1EC8A 1XH0A 3CPRA 3E6EA 3UWVA 3VOJA 3VC5A 1LWJA 3WBWA 1PO9A 3APYA 1JZ5A 1WO2A 2X2YA 3STPA 3W6YA 3IV3A 1GG1A 5BMXA 4PCSA 3WN6A 1NF7A 2Z2AA 3MWCA 3AROA 1ZHAA 4G6CA 2E0PA 3CNYA 2OLAA 2JEQA 4AMAA 2XIBA 3O1NA 1YE6A 4LNYA 2QV5A 3KS5A 1UQYA 5G1TA 2BNJA 1DQXA 2D20A 2J9XA 3IIXA 3LGGA 2AQWA 1QR7A 3TAKA 1I1WA 5KITA 1XIEA 2PP0A 2Q8ZA 2DSZA 3TC3A 5GNYA 4A05A 3TCSA 3GC5A 3RIKA 3TQPA 2CXGA 4CEUC 1QT1A 2Y0FA 4MZYA 1R3SA 4NX0A 4PR4A 1U5VA 3HO8A 5CBIA 2CU0A 5A5WA 5DMNA 4DXXA 1E0WA 1Q2SA 1RQEA 1PX3A 3TW6A 3CB3A 3NQAA 3VM7A 2ZZ7A 3SW6A 3GH4A 3BJTA 2DJXA 3CQJA 5KETA 2X1UA 3T6CA 4ORIA 3VMOA 2NV1A 3HTWA 4HTYA 3F1QA 4MPQA 3MPGA 4IX2A 3N29A 1C8YA 1KFJA 4BEQA 5G4WA 1L6FA 1C93A 4GY1A 4Y9NA 4CUCA 5FF4A 2VFIA 1I0DA 1M7XA 3MQTA 2BZNA 2ASHA 4JX5A 1H5VA 2FQIA 4E4FA 3DBNA 5JBFA 2XSAA 4F40A 1F07A 4UUIA 3AUJA 4GVGA 3UWZA 4Q22A 4EIVA 3GG0A 3L12A 3W1NA 5FAJA 1J2BA 1GOQA 3W7HA 1YXDA 3SUTA 5AVNA 3E2QA 3FNDA 4GYFA 1Q65A 1B3ZA 3H8AA 4UXDA 2Y70A 3H22A 3N2TA 3WMSA 3CT7A 5AHEA 2F7FA 1XP3A 3AHZA 1FX6A 1PYFA 4K8HA 4R9XA 1UWSA 2HS8A 1KFBA 3W1QA 1UKSA 4DF0A 3CWNA 4LXFA 1MO0A 5CSRA 1W1PA 3NFUA 2NZLA 3O6DA 4URIA 1VF8A 1JGIA 3WQEA 1VFOA 3GVRA 3NPXA 4DYKA 1Q2RA 3EEGA 1KR1A 4HCLA 1LUCA 4WY0B 1R5YA 1S2VA 3KVJA 4EWND 1OCBA 3WBAA 3VOGA 4DM1A 3NDZA 3WLQA 1QI3A 3K4DA 4JYEA 4QITA 2PF8A 4QQ3A 1VP5A 3BVJA 2CW6A 3HQOA 4B5VA 4DBEA 3GTNA 3KVLA 4O4VA 1UR8A 4GI4A 2GWNA 3AU2A 3BW2A 3V1HA 3W7DA 3RFAA 2DT0A 3UJRA 4HHMA 2CZFA 5I6SA 1SW3A 1TPFA 3CIXA 4EPKA 1DHPA 4YVXA 3SUSA 3PUEA 1ADOA 3WQ5A 2OKOA 1DTNA 2QJJA 4V1YA 5EKYA 1B90A 4HHPA 3L65A 4M6VA 5D2TA 4PA8A 2YCLB 2Y5SA 2A79A 2JK2A 4P7LA 1OFAA 1VBGA 2FPTA 5FOOA 1SW7A 4AX7A 2GLKA 3KBJA 2Z1WA 3CS2A 3GNDA 3ARVA 3C0LA 5I7GA 4A8RA 4HOZA 1GG0A 3WLLA 3B4UA 1PSCA 3LBCA 3MUXA 1SR9A 2P8CA 1J0IA 3S2MA 3W7JA 5HBFA 2C8NA 4R53A 2E6FA 5EU9A 4CQBA 1DWHM 2WSKA 1E6RA 1L6SA 3SURA 1IYXA 3L9CA 4PTXA 3MP5A 1FFQA 3SCWA 3WO8A 2XTKA 3WH5A 3ZMRA 5BOEA 1K9FA 4KWWA 4B9ZA 1MQQA 1SR0A 1SMDA 4IIFA 3NQBA 3XISA 2RDTA 1R6WA 2B7OA 3BL3A 3BMXA 4AB4A 2XN0A 4MNJA 5CPQA 3TJIA 1W3TA 4PMUA 5JMUA 3HFTA 4UQ9A 3N9SA 1E3XA 5FSEC 1IEWA 2IPWA 1BSIA 3LZ3A 3G77A 2WVSA 3WQFA 3OBKA 5BNKA 1KGXA 3F4DA 1SQ7A 4GUGA 3COTA 2PFHA 3WUFA 5A2AA 4A22A 1M6JA 1LT8A 2RJGA 1MW1A 4DN1A 2P8BA 1KA9F 1AH0A 1WB0A 2EPHA 4QROA 1EKOA 2V3FA 4Z1BA 3FYOA 4B2DA 4JTSA 3G1VA 3LHVA 1LORA 3O7UA 3VAVA 2BASA 3RU8X 1Q7ZA 2WHMA 2Z1VA 4X3ZA 2W91A 5C6MA 3DENA 3UWYA 4X60A 3VDGA 2WKJA 1LL4A 5BXTA 4U2ZA 3M6YA 3RR1A 3O9NA 3W76A 1I8JA 1WV2A 3SQSA 4KETA 5AKQA 1UH3A 4AZHA 3L4TA 2ZICA 3M07A 2PDLA 1RBAA 3IUDA 4GUHA 1GVSA 4JY8A 1E6XM 1W5OA 3CAQA 3OTRA 3TUUA 2OT1A 4EPDC 4DIAA 3TV8A 2PDPA 3WUGA 3OZPA 1DPMA 4RXGA 3SIZA 3W1LA 1S38A 2EGZA 4W89A 5F2GA 2J66A 4LWWA 4IMDA 2G0WA 2C0HA 4MJ4A 1LWHA 3N6QA 1KQYA 3Q2DA 1ODZA 4PMNA 3IV8A 1UWTA 1KBJA 4V15A 4C7DA 3WK0A 3NXFA 4MIMA 3PJXA 4YNGA 3N6HA 3HOJA 4KFPA 1OC6A 3WQGA 1I0BA 1YTDA 3GR4A 3TN5A 4QP0A 4GUJA 3PJUA 1NFPA 1UROA 1YEYA 1WQ5A 4L9YA 1TTPA 3WF4A 1Z7AA 5BWAA 3DFYA 2BVWA 1WAWA 4MJZA 4GI8A 5BZAA 3PG9A 1JZ3A 3DYPA 1BTCA 3M7WA 2EPOA 1MXDA 4WK9A 5LHEA 1HGWA 1EIXA 4DUWA 1E4IA 1H1NA 4XD4A 2QUTA 4IXXA 4N42A 3N3TA 1NDVA 2WNNA 3NTYA 3MVTA 4HD5A 2BB0A 1NWSA 5M2FX 4TV5A 2H90A 1BEUA 2PLKA 1NU5A 4Q4RA 2NXHA 3I6RA 1AL8A 2RGMA 3KHDA 2OWWA 5LIKX 1LOQA 3W0KA 1JI2A 1KCXA 2PEVA 2GJNA 5C7VA 1TPWA 1ONWA 3MZ2A 4GC4A 3IAQA 3VABA 2NX9A 2EG7A 3TLQA 2J75A 4HSNA 3K1DA 4LS2A 3BW4A 1EP2A 3CT2A 2XFFA 3PVFA 2D3LA 3WQOA 4O54A 3KBSA 7TAAA 1EWEA 4AHPA 1EZ2A 3PUGA 4QJ3B 1T0OA 4D1JA 1PBGA 2FFIA 4ZO6A 4Z2HA 5DRIA 1BGGA 2Q8XA 5KZ6A 1OSEA 3F4WA 2RH9A 1FCBA 2WK2A 1WZMA 3E49A 3T81A 4ROPA 3UR2A 5IBXA 3S5OA 1MVYA 1OX5A 1G9HA 4UTTC 2DQWA 2NUWA 3S9YA 1XBVA 4OGZA 3AMLA 5HR7A 3QM3A 5I79A 4A3UA 8RUCA 5DXYA 2ZUUA 3QOMA 3PWAA 4IHCA 2PDQA 4QCEA 4W9TA 2WJEA 3VUSA 5DQPA 1AJZA 2H9AB 4QE1A 2V82A 3KOWA 2XPKA 1E0VA 1FDZA 4LUSB 1EJWC 3XIMA 2G3MA 2V2CA 3KTCA 1WXJA 3S5YA 3W83A 4GI9A 2AMGA 1YKWA 3QJAA 2NVCA 5A95A 1C9DA 4JR5A 2J77A 2DVXA 1J10A 3CHFA 3PZTA 4ML9A 2WQPA 4UZSA 3R94A 3QF0A 3VA8A 1UA3A 4TUFA 1FWNA 3W22A 3AICA 3RCMA 1C92A 4DF1A 3R7MA 3AXMA 4LAZA 1E6NA 1Q6DA 3WNMA 4LANA 2W5FA 1QXLA 3GZAA 3G1HA 3U5YA 1XCXA 1UPPA 5A2BA 3TCEA 5BU6A 2F8QA 5D32A 4XAPA 1KV8A 2A7RA 1GVRA 3M5VA 4IPPA 3QR3A 1FKXA 4JN8A 2VL4A 5CAHA 2PDKA 5KZEA 1HO1A 2GJRA 3PP7A 2E68A 3W37A 2YXGA 3STFA 3IACA 4HJWA 4ZFMA 3ZXWA 4F66A 1KTBA 3TQ0A 2PRLA 2X1SA 5EMKA 3TP4A 9XIAA 3DEQA 5F4WA 1KWGA 1GKRA 3PPFA 2WZHA 1CBGA 2QCDB 3W74A 1V3MA 1ZU8A 3GRIA 3JVAA 4QNWA 2VEKA 1J0KA 3F5LA 2V9DA 4YIWA 1TPVA 4F0HA 2WNZA 2DEPA 5BXSA 1JD9A 1FHDA 2NUYA 4UTFA 2VFEA 2QDDA 2YR1A 3LCXA 5TF0A 4Y9MA 5CBJA 4FNSA 2XGIA 2PDMA 3SCPA 3SZ8A 1OG0A 4ML4A 3ZT5A 3LXAA 3S1WA 1J8VA 3CXOA 5LA0A 4EXQA 1OINA 2ATMA 3BMWA 4KIEA 4HMNA 4AU0A 3M1ZA 1DWJM 3AFBA 2PSNA 3UZ5A 4MWAD 3GG1A 4AD0A 1L6YA 2WSRA 1B3OA 2BGSA 2YCKX 1GQJA 4I7VA 1UYQA 5CZTA 1XBXA 2YL6A 1VPXA 1D8WA 1K4GA 2A1YA 2DZBA 5I02A 1AD4A 4JNZA 4OE7A 1VEPA 4XZ9A 3GB6A 4H9UA 3TH6A 5BRPA 1M9HA 1KBLA 1SSGA 2X0YA 2CLKA 3E5BA 3NPVA 2BVDA 3KCLA 3KTXA 1AZ1A 5FF7A 4AD2A 1ZP4A 1JCMP 1VBUA 3CEUA 3CWOX 1WOBA 4Y6GA 4ZOBA 3N18A 1P0KA 4D6IA 4P2VA 5I3HA 1DVJA 4MNLA 3G2GA 2FMNA 8XIMA 4RZBA 1QI4A 3DDMA 1S3TC 4WQ6A 2UY2A 2BXYA 4LUJA 4WSKA 3UXKA 1KBBA 1XGZA 3SBFA 2NQ9A 2CZVA 4HU3A 2G96A 1PHQA 4S3KA 2G8ZA 3ECQA 2Z2BA 3EB2A 1K9EA 4A2SA 3SFWA 5DX7A 3UZZA 1A5UA 1ODUA 3UW6A 1SGJA 2QF8A 2YL8A 1UB3A 1TWWA 4K3ZA 1F2JA 4QSHA 4RDVA 4DAIA 5LXXA 5HNUA 1V02E 3LM7A 1YBQA 1JULA 4UFJA 2UBPC 1J6OA 3SDOA 4XAYA 1JUEA 1RK5A 4BCEA 1VIWA 4L9XA 1FCUA 3NSNA 1HX0A 2J9ZA 1R3TA 1JCXA 4JFUA 4IJBA 3GXFA 2GSEA 3BOLA 3W1PA 3GYCA 2XIJA 3AHVA 6XIAA 3WD0A 4DBUA 5EMMA 3Q45A 3BSMA 5AY7A 2PDJA 6ENLA 3S6TA 2VD9A 4YTQA 4PUEA 4DJEC 1CCWB 2IPFA 1FWAC 3S2CA 4C6CA 2YDAA 1JYVA 4GRSA 2ZA3A 1O12A 5TIMA 1GEHA 3E74A 3OLGA 4KGJA 1MUWA 2R1MA 3FX4A 1RQHA 4RPPA 4HOXA 4R34A 4BK9A 1UPMB 3M5YA 2YBVA 4XG1A 1AK5A 3TROA 4IQLA 1XL9A 5A6KA 4JBRA 1VHCA 2YCEA 1GVOA 2FHBA 4L4OA 3VD3A 1Q3NA 2D2OA 1IWPA 4H2CA 2W3ZA 4UTLA 4IFKA 4AZ7A 1IHIA 6REQB 3SN0A 3V75A 5FJPA 4GQQA 5CAKA 4XBKA 9XIMA 4XIAA 4MFEA 3WQPA 1J18A 3V0UA 2WANA 5ECUA 2OJPA 4TTGA 4FNPA 4AYSA 3SN1A 1UD4A 5DELA 2PDUA 1QW8A 4XK2A 1N8FA 2YW4A 5HA7A 1NY1A 2H8XA 3QYSA 3FK4A 1F4HA 1QBAA 1R9XA 4HA4A 2VX5A 4W8BA 4IPLA 3LMZA 3T1GA 1DTUA 3R0DA 1YNPA 4HU4A 4PFHA 1US0A 3ABXA 3W1AA 3CU2A 3VOCA 2EPNA 4XD3A 4GCAA 3SRFA 1E9YB 4XV0A 4IQJA 1QU4A 3SCOA 2DZWA 5AHMA 3TN6A 3GKFA 2OZ8A 1A3XA 1A5OC 3NPWA 3WMBA 1LYXA 1JQXA 4QISA 3LCHA 3BZGA 1QCWA 1P7TB 1XYLA 1KO0A 2PGFA 1XIMA 4K1GA 1GZGA 2Q6ZA 3WX7A 1ZCCA 2GVLA 3V16A 1S2WA 1EDGA 2PDGA 3BK0A 1OADA 1H61A 3VFCA 3DHFA 2Z29A 5HXMA 1GHRA 3ZWSA 3M4HA 4CN4A 4O8RA 4C1NB 4ACZA 2DU2A 1PX4A 2VRKA 2WW5A 3G0SA 1W9XA 3LBMA 1EL3A 4AIUA 3AYTA 4JTRA 5GJPA 5KTLA 5TNVA 4GY0A 4GACA 3ITXA 1V7AA 1X39A 2AAMA 2BOEX 1GYNA 3ES7A 3WH9A 3KL5A 4GYPA 2V38A 4Q7BA 1PYMA 4FXRA 3GUGA 4C6KA 4XTDA 1UR1A 1F6YA 1G67A 1E0TA 3B04A 1MDRA 3W7LA 4LCQA 3O0KA 2CFFA 5IOBA 1XLKA 3OBAA 1EXPA 3W7RA 3GU2A 1KFLA 1WDPA 1VRDA 2V8ZA 3HF3A 1W32A 4AYGA 2FVKA 2HRWA 2WZMA 4H19A 4LY8A 3SECA 4AEOA 2CYGA 3WMLA 3IIOA 3ITTA 4LS1A 2H6RA 2VP8A 1RY0A 2YL9A 5FAGA 3N9KA 3IVSA 1VEMA 3S42A 3F4NA 2R91A 2VURA 3V5FA 3EDDA 4MVAA 4UTMA 1TR1A 1TG7A 1W3KA 3S1VA 3A13A 2DZSA 3B0YA 3T2OA 5BXPA 5HWNA 1DHKA 1KM1A 5CZJA 3TNBA 5CZKA 2UY5A 5CZSA 1LOSA 1TB3A 3GAYA 4Z1YA 1JR1A 1ZP3A 4NNBA 2D0HA 3EWCA 5D9PA 2NSXA 2IUZA 1BRLB 4DJFD 1WKEA 5FJIA 1XG3A 3GXMA 4KEVA 3IIZA 3A21A 4V27A 2B31A 2Y1HA 1PB0A 2HVNA 1TYGA 1XINA 1BLIA 3UA4A 3P67A 2F2HA 4ZBCA 1CXFA 1WOAA 3RF9A 3PFRA 5JVLA 3DN5A 2FZDA 1FWIC 1YE4A 3CASA 4JTUA 3P3BA 1F8IA 3P84A 2WMHA 4I8DA 2F61A 2XVGA 4XZMX 1QNPA 2OO0A 2VR4A 5K2ZA 4QCFA 2NUXA 1XPGA 5LKYA 2AMXA 2PWGA 3E12A 2WHLA 4NAEA 3WDQA 3O05A 3GDTA 4HCHA 4UCGA 3VIJA 5FSDC 3TA9A 4M1RA 4ZOEA 3UZWA 3R4IA 5A6SA 3QZAA 4QJ5B 3RK8A 2DVUA 1PHWA 2WMJA 3TK7A 2QCHA 2PPGA 4IPIA 4I90A 1TO3A 3QTGA 2FVLA 1LCOA 1M53A 3T55A 2QJHA 4G7EB 1F74A 3VCCA 3M9YA 2TYSA 1MQRA 3CMJA 1IR1A 2OODA 3TC7A 3OU8A 3U48A 1YADA 4Y7EA 3KCJA 2QCNA 4DELA 3WDJA 1JYNA 2HDJA 2YFOA 3FKRA 4H9VA 4O15A 1GOKA 2G3IA 4GXWA 4P7NA 3BG5A 1XICA 4GVHA 4P7OA 5E6YA 4Q7NA 4ZE4A 4KCVA 2FGLA 4MY8A 2D3NA 5K9CA 1YRRA 3BSGA 1O95A 3HV8A 3TYBA 2I7GA 4I7WA 1A5BA 1GCYA 1W3HA 3UWUA 4Q8QA 2GVJA 4KRZA 3QV7A 2YDRA 1J0ZA 3B8TA 2Q09A 3C2FA 4GFIA 3G1AA 3TSBA 2QAPA 1PE1A 5HANA 1RPKA 1Q6OA 3R43A 3KBMA 4MJMA 1CEOA 4MHBA 3T78A 2PLJA 3SGZA 2V5CA 1X38A 2WMIA 3VGEA 3OZYA 4JFTA 3UNTA 3QY7A 2QF7A 5J5RA 3N25A 4NUWA 5B7YA 4WX2A 4FX7A 3IGXA 4PFMA 4FNRA 1RUSA 3UG8A 4RUBA 2YCIX 3BAJA 1I6NA 3MS8A 2IMRA 3BLKA 2PWEA 2QLYA 2VTFA 2PWHA 3NSXA 3MWAA 2FZ8A 3OA3A 1QATA 3GYEA 2WZEA 4M6QA 2J24A 4PRRA 4D6CA 4MAVA 3OP2A 3V7PA 1IWBA 2OOGA 1TTJA 4REQA 4H8NA 2V67A 3MSDA 2J4GA 4UFMA 2E40A 3TYCA 2XM2A 4DWSC 2QIIA 5C9XA 2DSUA 1OCJA 4KCWA 3W02A 5CPMA 4FLSA 5CKSA 4WR3A 1ELSA 4UCFA 3VNZA 3OQ8A 3I3BA 4GBDA 2J25A 1QHOA 1DORA 3H2OA 5KMYA 2BS9A 3DHDA 4UC5A 3UCDA 2C16A 1FWBC 4H3DA 3K46A 4BFAA 4F4RA 4YLWA 4XKYB 4EPEC 2OCZA 4PTDA 4EAYA 1S39A 1YXYA 3MCOA 1BF6A 4B3LA 4J3SA 1UKOA 3G0XA 2XUCA 3AIRA 3O8AA 4R3UA 4A2RA 2CIPA 3QBUA 3THUA 4ZR8A 1WUEA 1OIMA 2I5QA 1GWJA 3KE0A 1G1YA 1WX0A 1PWLA 3ABSA 3WH6A 3CZKA 3W4RA 1JZ4A 1CIUA 4BI5A 3MI2A 3VNKA 2X7WA 4F8XA 3BG3A 4B5NA 4WJEA 1W8SA 3EXSA 1JF6A 2IPJA 4KQNA 1H2JA 3V35A 3HJZA 1QW7A 3TYUA 3W88A 5FD0A 3TFCA 3C2RA 3UGVA 3EOEA 3P5YA 3NQCA 4GABA 1UBSA 1WZAA 3UYCA 1E9ZB 2AQVA 1UKQA 4XSMA 4XO7A 3CQIA 5LZLA 3E38A 4L6HA 1R3QA 4Z08A 1EJVC 2VM8A 3LHYA 1TV5A 4PH6A 2ZYFA 5D09A 1K9TA 2A7NA 3USZA 4FX6M 1KFKA 1KM0A 4LH8A 3WDPP 1GTEA 1BGAA 3ABQA 3VINA 1V3LA 4ERAA 2OKTA 3U2ZA 1IR2A 4XAGA 3K4AA 3CHCA 4KERA 1V0LA 4IH3A 3GQYA 1UUOA 4TXEA 1WKFA 3MMDA 5AYXA 5I3DA 2VFGA 2Z26A 5GNXA 4A3RA 6TIMA 4QIUA 1X96A 2R82A 2WSPA 3UCCA 1LQ2A 3G5EA 1RXOB 2VCBA 1CLKA 4RZ5A 2ANUA 1V6YA 1NWRA 4A3QA 3WD4A 2B7PA 4I5XA 3AIQA 1DJIA 2DZAA 3B9DA 4N7QA 3R79A 2YFNA 2QCCA 2VGBA 5J8LA 3QRHA 2Y24A 3NDYA 2PS2A 2OWCA 3PUDA 5U7SA 3SUWA 3BW3A 5KEZA 1YX1A 5HJXA 4CU8A 3ATYA 4G56A 3CZ8A 1U22A 4J27A 2CC0A 5TD4A 3NO3A 1OJXA 4DJDC 1L9WA 1VRXA 2EPMX 2ESCA 2CHNA 5IM51 3AI0A 5G4HC 3EAUA 1GORA 4H8VA 2VXNA 1I1XA 4XSLA 3E0VA 2XH0A 1J79A 3TN3A 2G3NA 4JY9A 2XVNA 3VZXA 1X6NA 1HZYA 3LPPA 1TVNA 4LYRA 3H2FA 2ZRVA 3M0LA 5I07A 3ARWA 3QFWA 3FXGA 1FP8A 2WHKA 1XW8A 3BURA 3GG8A 5JH2A 3VIOA 2IXVA 4GINA 4J9JA 3ARSA 4ZCWA 1CGWA 3PZMA 5BROA 3HPZA 1VCFA 4U3CA 4HA0A 3QMSA 3QPEA 1CYGA 3R12A 1R30A 2BXVA 4FX8A 4GQRA 4JEJA 3LXCA 5T91A 2FVMA 2V5KA 3GBDA 1QPNA 3FJLA 3PJWA 1NQKA 1JCLA 3M0XA 1X8CA 4WY0F 3RMJA 3KOZA 4E8DA 2ZUVA 2INFA 3FN9A 1REQA 3TE9A 4CLMA 4KCUA 3P0XA 1D3HA 3VIMA 1Q7QA 5D05A 1A47A 1MUMA 3TONA 4C6PA 3RMEA 4JX6A 1OGBA 1IXNA 3GIYA 3TN4A 3WJSA 3PB0A 2F2KA 3H7VA 5CJNA 3ID7A 1WBJA 4O0KA 4PEEA 4Q8WA 8A3HA 5CSSA 4QEEA 1IQ8A 1JG9A 3PF3A 2ZWZA 3DXIA 3P81A 4FF7A 4Q4KA 3FV9A 2WZIA 1Y65A 4RNIA 4B5TA 3D5HA 2NXIA 1ICPA 1CTNA 3T09A 4LS0A 3ZLHA 3VCNA 3VFLA 1R9YA 2CKSA 7ENLA 3BAXA 2ICSA 3QPYA 2VZSA 2I56A 4D8ZA 1D7KA 3GU1A 1KFEA 2TAAA 2O4QA 4AQLA 3M0JA 2ALRA 4A6GA 4RV8A 1TJRA 3TQKA 4JDBA 3DG6A 5I23A 3AIVA 1I2PA 3NEVA 3EOSA 3ZQ9A 3TA6A 3V3WA 2QEZA 1LF1A 2REQB 3RM8A 3MUAA 1MNZA 1E5NA 1WDDA 1KCZA 4BWLA 3HURA 4JTIA 4XISA 4UFHA 2IKGA 1GONA 4IJCA 4PC8A 1O1HA 1PWMA 3ZVHB 2GSJA 3TMQA 4AZBA 4PUJA 5AB3A 1EF2A 4I8YA 1IZKA 3CQKA 3KOXA 1ONEA 2BY1A 3ABOA 2PTYA 1R7OA 1DJXA 5K3VA 3MKCA 3M46A 3EZ4A 1XISA 3DECA 2VJXA 4AF0B 3W2KA 3UXLA 3MYOA 4P8WA 2OYKA 1AODA 4LB4A 2CZEA 2GGHA 3MO7A 4BHYA 1A80A 1Z48A 1KTNA 4WXZA 4QHRA 1ZLPA 1T5AA 4QLKA 3F03K 3EWZA 3WQ4A 1VZWA 4WVXA 4ZE5A 1FKWA 1EDQA 1HXJA 3ARYA 4AXKA 2CETA 4FB7A 1NP2A 3ZJ6A 2ZE3A 5GJMA 2ZRUA 3UG3A 2RKXA 1XCWA 3EXRA 3GO2A 3SRKA 3PSWA 3B0VC 2R8WA 4JKLA 4AC7C 3G3DA 3L68A 1NWUA 3K8KA 1VAHA 2D0GA 2DT2A 2YSWA 3P6LA 3U0HA 1BAGA 3WLJA 3EOLA 1EOKA 3NL3A 4WDXA 4H6EA 4S3BA 2W9MA 3KUMA 4MLJA 2TMDA 4YHGA 3VD4A 4C1KA 1JCJA 1BXBA 1ITUA 3LBOA 3REQA 4L9ZA 5FL1A 1RJQA 2JEPA 4DBSA 2J7CA 3MCNA 3RPMA 1QVBA 3AIWA 3R10A 5B7ZA 5HR6A 2HVMA 1E0UA 4Q8TA 4XD6A 2PC8A 3LTSA 4YXGA 2E8YA 3BJFA 1YDOA 4YS1A 3IUIA 3CQ0A 4B2DD 4MTVA 3HJEA 1HGYA 1TRIA 3HMJG 3JU2A 1ISXA 3ZT6A 4PMVA 4Q32A 1PIIA 3VZZA 1TUFA 4O14A 3P8IA 3NPUA 1W1TA 1XQKA 3UR8A 1GUVA 1P6CA 4MZ1A 3HPSA 1J4EA 4UQEA 4XVDA 4TVDA 1DBTA 2QCLA 4GUFA 2VC7A 2QIWA 4LVFA 4KBXA 2NWSA 5JIPA 3TW9A 2FH6A 4QJ4B 3W2UA 2CESA 5D2VA 2HNEA 1FWJC 3DX5A 1BPLB 4HPJA 4GIEA 4HNUA 4MWAA 1QMLA 4MGGA 2VEGA 3M0HA 4IICA 4OKDA 1KRCC 1RCQA 1HIZA 3W28A 2C15A 4RPQA 4DXVA 5FJRA 3RRXA 1UOKA 2R1KA 3AS0A 3EEZA 5C2GA 2WLZA 4HU8A 4PTWA 2Y6ZA 3PHAA 2HPIA 2YZRA 4L4PA 1JZ2A 2EPLX 1CGYA 2F6XA 2OPJA 2ZA1A 3T9PA 4GO9A 5H8UA 1N2VA 4ERIA 3DKLA 4UTUA 3GFZA 4DNHA 3GSMA 4RJEA 1E40A 1VS1A 5A8GA 1HF6A 2CBUA 3G6LA 4S3GA 2PDNA 4CD7A 5FL0A 3EPOA 3MSYA 4HPHA 2I1OA 3PJTA 3SGGA 1P43A 1OABA 4DY1A 4FA3A 3MZNA 3OBEA 3AZRA 4HIBA 3F2BA 4HPNA 4I9MA 3FGCA 2OWXA 1SU5A 2GOKA 2G37A 1XJBA 1VBJA 4H01A 4CU7A 3A23A 5A2CA 2V5BA 3BICA 1LUCB 4DZIA 1SFTA 4IFOA 4NX5A 3S9ZA 3ITYA 4WXYA 2J74A 1QWGA 2PD5A 4J3ZA 4X63A 3E96A 4RCXA 2VZOA 1XSKA 4I9AA 3N1AA 4KWSA 4ZENA 4Q8VA 4I6VA 3LQLA 4KEUA 3C86A 1YXCA 4Z1DA 2EBNA 5DRCA 3ZR4A 3M0KA 2I5IA 3SSJA 2G5WA 1JDFA 1G4EA 3GM8A 3SIMA 4MFDA 3LPFA 3G18A 4W8LA 2V6AA 3K30A 2C0AA 5EMLA 1X7FA 1EJUC 4HNCA 5AC7A 1AVAA 3IVUA 5L9FA 5C2CA 2I5GA 3CUXA 1EJRC 4FO4A 1R2SA 1R3WA 2QW5A 4GQBA 4LSBA 2QT3A 3NQ8A 4FALA 3FEQA 2RUSA 1KM3A 4Z0JA 1GJPA 4X9SA 3AJXA 3LHUA 2XWDA 4UMAA 4UQAA 3ELFA 4PUDA 4AY7A 4HNTA 4DPQA 2BLEA 1CGUA 3S46A 2BHUA 4C6EA 1Q4WA 2QCFA 3HIJA 1OCQA 1EFZA 1PCKA 3NJ3A 4GUIA 4JL1A 2XZ7A 2VX6A 1XM3A 4ACYA 1EGZA 4OV4A 1UKTA 1W2VA 1ZSXA 3W85A 3TAOA 3I4EA 4N6FA 1OC7A 2G41A 3HU7A 4QAIA 3AC0A 1OGSA 1H7PA 4R5EA 1BF2A 2O9OA 2ZZ4A 2JF6A 1LZOA 1YMYA 4DZAA 2XH4A 1PKYA 1UMYA 3KOYA 4US5A 2GJXA 2PLMA 5IRPA 2XM1A 1L6GA 1L0PA 3N12A 1UZHA 4RNFA 3FJNA 4L5ZA 3M0VA 1ZJAA 2QCGA 3OHIA 3VE7A 4H6QA 1SZFA 2WVVA 4F3HA 3OZOA 3UETA 4UOJA 4JTJA 4GLEA 2ZZ5A 4LY4A 3EMQA 4RV3A 3TXVA 1EP1A 1J11A 3KP0A 8XIAA 1VENA 2J6VA 3C5QA 1ALDA 4NJGA 5D33A 4YYCA 3T2QA 3V4BA 2W62A 3W01A 2Z7KA 1SZEA 5G2IA 4RX0A 4KPLA 3PTMA 1FH7A 1JDCA 1EYWA 3SUVA 3R5EA 3LNPA 1PZ2A 2Z1XA 3IGSA 1I2RA 4X22A 2XU2A 4I7UA 1K7FA 5DY2A 1J0HA 3G22A 3K8MA 3DH7A 4KCTA 1EHAA 4D8AA 3EPMA 1YQ2A 4R88A 3VZYA 4D1IA 2DIEA 3S2JA 1DQUA 1V0KA 2OGYA 3PWGA 3QR1A 4S2CA 5KINA 3OOQA 2V81A 1DXEA 2ADAA 3WLNA 1W3NA 1WDWA 1Y8BA 2AGTA 4PL1A 3VKBA 1OFBA 4GYKA 4KFNA 1R2TA 3PZOA 3CZJA 5BU9A 3VIFA 1J0YA 2FTYA 2WVTA 2ACSA 3S2NA 1TREA 1TCMA 3SR7A 1XYZA 1X1NA 4BQ5A 1K8XA 2VOTA 2ZCGA 1P0EA 3PULA 2ALDA 4QG9A 5D04C 4QE5A 2BV9A 4PSPA 3V5CA 1HL8A 2HXTA 4NZ3A 4O13A 3T0BA 5DN1A 4HPXA 1E43A 1JXKA 3QPZA 5C5YA 1VFUA 2NX3A 4QJ1A 2YOCA 3CZEA 4CN1A 4JD4A 3RHGA 4M1BA 1ECEA 1F5ZA 7TIMA 1AZ2A 1H09A 3NR0A 3WEMA 1QK2A 2ZRZA 1MQPA 4TOQA 3IANA 4BF9A 2E77A 4NRSA 3ITCA 3C8FA 3TWBA 2WCAA 5M3WA 1YDVA 3WNNA 1TMQA 2BY0A 4AUBA 1OM0A 3VNMA 1J01A 1EZWA 3CHVA 3EDJA 4R7OA 4G8TA 1A5LC 2YGYA 3G6MA 3WLRA 3AMCA 4B5WA 3WEOA 1GW9A 3USBA 2DT3A 4FOUA 4ZTYA 4CNUA 1XC6A 2QUMA 1YDYA 4M5PA 3D46A 1MZRA 4RZ6A 2GL5A 1I9CB 3AZSA 3I4KA 4KW2A 4F2BA 1E15A 1EBGA 1Q7MA 1RALA 3THDA 3T42A 3G1FA 1XH2A 2Y5EA 1FFRA 1FWSA 1LLOA 2VX7A 3MV01 4RDYA 3CGTA 4JYFA 1OZMA 2DSKA 4DJFA 3VMPA 4PMYA 3ZJKA 2ISFA 2QCEA 5DT5A 2IKIA 1C7SA 5AYZA 3K5XA 4JTKA 4Z1AA 4MKNA 4IGSA 2HZGA 4ZO8A 3BO9A 1R3RA 3S5ZA 4IT1A 2OZTA 4ZGYA 4FF5A 2GGGA 3FA3A 3GVWA 5EBAA 4UOQA 4WJXA 3TDFA 2Q3OA 3A5FA 3WF2A 3ONCA 5HNNA 4N2YA 3KP1A 4HVXA 2WOQA 3BARA 1E3ZA 2V2HA 1WZKA 1TWZA 1H49A 3MUIA 2UY3A 3LLFA 4KKXA 1GOXA 3B40A 2E5CA 1HKVA 2Y7DA 1DOSA 1W1ZA 1H0GA 3WF1A 3I10A 2QS8A 3W00A 2X2GA 4JTDA 3NQ7A 1TWDA 1RP9A 3H53A 3PNZA 2VD8A 4WD0A 4G2DA 3MVIA 1E55A 1AW2A 4AW7A 4PMOA 1WYIA 3FIGA 2CHRA 3PN8A 5M03A 4HA1A 1KBKA 4QS6A 4OQVA 3VIKA 4B5UA 7REQA 1ADSA 1Q45A 1W1YA 3KBVA 1AG1O 1YDNA 3TWAA 4JXCA 1OVDA 4Z2KA 4HHLA 3QZEA 3BUVA 3R58A 4JTAA 1X1OA 4YPJA 3WNOA 3H2AA 3BLEA 4DX3A 3HZ3A 3EA2A 4H7VA 3RPDA 1S5WA 3I3DA 1Q8JA 4H83A 1DIEA 2PURA 1QJWA 2ZX6A 5AHNA 1VJSA 3AXIA 3O15A 1I4NA 4HGXA 1UWIA 3TQVA 2WHJA 1JIBA 2KX9A 2E9BA 3KW3A 3PFMA 2OEKA 3TR9A 1EO7A 1ZL1A 3KFTA 3PZ9A 4AD5A 4IOTA 5AHIA 2FH8A 1Z8AA 1J12A 3JR2A 1B1YA 1IT0A 1GQIA 3CAWA 4UMBA 3G1RA 4MZ8A 2BSLA 1UIPA 3IJDA 4U10A 4P7QA 1P48A 1QPOA 2V5JA 1ZCOA 2E6YA 2YA2A 5T9CE 2Q01A 2GUBA 1A50A 1O1ZA 4N9CA 3VOHA 2NSOA 3NVTA 3ABZA 1VQTA 5LYRA 4TU1A 2JQXA 1XXXA 1T41A 3PS7A 3TIMA 1B54A 4U5IA 4UR9A 6CGTA 1KC7A 3A4AA 2X42A 4ALDA 4YTSA 2Z0IA 5I2UA 4C6IA 4CD4A 1HT6A 2J7EA 1W1A1 3MSRA 1M7PA 4RW3A 3GDMA 3WH8A 2J47A 1Z9AA 3W7EA 3EKGA 3GZ3A 1HJQA 2XINA 3M0IA 1H41A 4JQ2A 4W7UA 1AH3A 3W9ZA 3DYOA 4B4FA 3W7CA 3CK5A 5C8BB 3DHPA 4K1WA 1IEXA 4Z2GA 4BI6A 1R46A 2MNRA 1UR2A 1ME9A 3M0ZA 1QO2A 2WNQA 2ZX5A 3UERA 1YIXA 4KH2A 3AXXA 1GNXA 1RD6A 3A22A 2INEA 4PMXA 4US6A 4V33A 3QMTA 1W0MA 1XFCA 3GC2A 3A47A 1IEVA 4OUIA 4ICMA 4B16A 4DQWA 3ENLA 2ZBTA 3WQWA 4NXKA 4MB1A 1AQHA 2E25A 4FI4A 2XG9A 1NARA 4XBSA 2WJFA 1XYCA 4W84A 2PDXA 3SN4A 2AAAA 3WLHA 2GGEA 3HN3A 4S2BA 5LIWX 4PE8A 9RUBA 3MW7A 3KWXA 1UD5A 1BG4A 3PPCA 3L4ZA 1CXHA 2O92A 4NJKA 4RE0A 4XB3A 3S1UA 4U33A 1T40A 4A3YA 1ONRA 5I3GA 4DPPA 2Z2UA 1G7VA 4CCEA 5FJTA 3N2OA 3OLEA 3S5NA 2YL5A 2BODX 5DCDA 3WG6A 1JZ6A 4DF2A 3WLPA 1UP0A 2CLHA 5EL1A 5DCBA 5GJNA 5A8QA 1DXIA 4MUPA 1XSIA 2L5HA 1UUQA 4B15A 1EC9A 3ME3A 4CQDA 3S1XA 2HE5A 3TSDA 1OFOA 3L66A 1TV2A 3WBYA 3D47A 3IPWA 4UQDA 4PTVA 2VDIA 5FCZA 3RX4A 2NT0A 5HQMA 3LYEA 2HPMA 3TKFA 3UJEA 1XGEA 1JL8A 2C79A 1R3VA 1ZJHA 2I17A 1HVXA 4FR6A 3PY2A 3OODA 2WBGA 2WC4A 1PZ0A 2J7BA 4IWWA 3AYRA 1KQZA 3W84A 1KFCA 2RHGA 4E3VA 2YXXA 4WDWA 5HPCA 2C18A 3UCQA 3YPIA 1IXOA 3UXAA 3IJLA 1YBQB 1K8YA 4EACA 4QLJA 3IJQA 2NVDA 4MB5A 5E0FA 1ISYA 1W91A 1WKDA 5M5DA 4DXKA 4PTNA 4NHVA 1B57A 2Y61A 3ISIX 4GH1A 1KV5A 3T07A 1TWSA 3GG7A 1XX1A 5FA5A 3SAZA 4TMCA 2CHOA 2GUUA 1RJPA 4Z1CA 4K36A 3SY1A 4O28A 1TTIA 1A4LA 1EA9C 1CGTA 2CKRA 1UJPA 4R85A 2OZ0A 3RNDA 5ECVA 2GGIA 3LHZA 1NJJA 4M7SA 1S5MA 5DMLA 5TBOA 3WBXA 5D8WA 4MJ2A 1K1DA 5HK4A 4JTGA 2OQHA 5M1TA 4BF5A 3MI3A 4FEZA 4IFRA 4LBRA 3LCLA 4FHAA 2J78A 1NIUA 2PWUA 4HMDA 1DJZA 3GKAA 5T8GA 1FA2A 3LG3A 3QHOA 3SCTA 2Z28A 3MKKA 4CNPA 1GJWA 3B97A 4KIRA 2P0IA 4IFKB 1LTDA 1BXCA 3TOYA 3OIXA 4GOAA 1T99A 3W1RA 1W5MA 3WZ0E 4PMZA 1DWIM 1QAPA 2E5DA 2QUNA 1KBIA 5REQA 2D24A 1ZGDA 1ZAJA 3PC0A 3ZYZA 1KRMA 1TFVA 2PDHA 1XLMA 3MP4A 3SB0A 1G69A 2R14A 1SO5A 1GT8A 3NWRA 2GSHA 1POJA 2PF0A 2FDMA 3NAVA 2X1IA 3L7RA 1FDYA 3OGRA 2ISSA 2G3JA 3SCRA 3UXDA 4A8LA 3UVAA 4EF9A 1F4AA 1E51A 2XIMA 2J79A 4W7WA 1IT8A 1WKYA 1Y7VA 1YTKA 2OB3A 4BQ4A 3RLUA 3TOPA 2W63A 1MI3A 3FJ6A 3S6OA 1V77A 1KM6A 3S6DA 2RGLA 4ZEPA 3KM8A 1ISZA 2PLCA 1RJRA 4CD6A 2ZKMX 4IIHA 2ZTJA 2YPIA 1GK8A 4RLIA 4O1CA 1CXEA 4NU7A 2OLSA 1R47A 1AQFA 4NT0A 2BFGA 3CV7A 2VI0A 1W9UA 3L4UA 3RLGA 4H41A 1QNRA 4CU6A 4PUUA 1EXBA 1IGSA 2PGWA 3HV9A 2E1DA 5EGRA 4ACZB 1KCKA 1V03A 4EP8C 2C91A 2Y8VA 4ZQNA 1JYWA 2DPEA 2NQ5A 3HQPA 3HGRA 3RCYA 4HZ8A 1M68A 1OD8A 2WSYA 4ENLA 3O6CA 2Y88A 3R0UA 1ESWA 4PBGA 1OYAA 4CNOA 1P5BA 5H2ZA 1G4TA 2JIEA 4C65A 1RP8A 2D73A 3KBWA 4LNCA 4NAFA 1J0JA 3LSBA 4X9YA 2POTA 4H8UA 4MKSA 4ZQMA 2AL2A 3LLXA 1K70A 3KS6A 2OMAA 4OT7A 4JFVA 2XISA 3P93A 4MSSA 3WLTA 1O5QA 4DBDA 1A3WA 4IIDA 3G1YA 3V18A 1U30A 2VT0A 3T0DA 1O5XA 3LOTA 1VFFA 2A3CA 3NQ6A 3B0UX 3GHUA 4M19A 2PGRA 2ZUWA 4KF1A 1A5CA 1FHLA 2WPGA 4WEVX 2ZUTA 1V93A 4E2DA 5JIWA 1PXGA 4ZOCA 4PMDA 1A5MC 2QVNA 2Z6JA 5D03A 1VBHA 3AMDA 1PPIA 1UR0A 2Z1KA 3H70A 4GG9A 3Q94A 3TX9A 2PI6A 2FB2A 6XIMA 2OOFA 4EE9A 4U3AA 4W88A 4GX9A 3HB9A 2C1IA 4M7TA 1S46A 4C6LA 1HVQA 2WKGA 3L4VA 1FH9A 3MYPA 3NDOA 1UD6A 3TTEA 4GH3A 4N4QA 5H8MA 1VD6A 1EIBA 3PZUA 2VYOA 5C9WA 1DP0A 3L0NA 3OVRA 4IX0A 1LROA 4HT3A 5D9NA 1NSJA 3E9AA 4OBRA 5E70A 4G5DA 4K7YA 1FWDC 2WYSA 3KLLA 3WDHA 1THFD 2R9RA 2QJMA 3TXZA 3A64A 4JNMA 3W1TA 2DZPA 1GYMA 3KZPA 1XG4A 2BY3A 3IIPA 1GVYA 4UTWC 4DHGA 2QJGA 2YJQA 2P3ZA 3WF0A 4QE4A 4JTLA 3UBPC 5CSUA 4E4UA 2Z1BA 4AZIA 5DT7A 3H55A 4YN5A 3N15A 5CG7A 7PTDA 1PVNA 5E0KA 4GIYA 1O68A 3TU9A 4W86A 1QBBA 5CPLA 2J6XA 4OWGA 3IARA 4IP4A 1NM9A 4LRTA 3NL6A 3R1ZA 3M47A 3UY7A 2WM0A 3N6JA 5LSMA 1V6XA 2TSYA 1JI1A 1PKNA 5I5RA 5I00A 3ARRA 1H60A 3WELA 4AIOA 4PBFA 3UQNA 1UBPC 3O16A 3RU6A 3RJXA 4GZ7A 1F76A 4Q8OA 1Q6LA 4H7ZA 3S4TA 3ZJ7A 4N4PA 3EMCA 1H7NA 2OU4A 4PRTA 6A3HA 2P76A 3FLUA 2A85A 3AJ7A 3THAA 3URNA 1L2UA 3MHGA 1Q13A 4HPGA 3GW3A 3S0CA 2ACUA 2PP1A 1NFBA 4ATDA 1PKMA 3LX9A 4LV4A 3AAMA 3PK7A 3BXWA 3SSZA 2A3BA 4TX8A 1AFSA 2VRQA 1V08A 2DH2A 3KXQA 4XZWA 3GHTA 3ZIZA 1IZJA 1XF0A 2C1HA 3EWUA 1S3HA 2PDWA 2YZ5A 5DFAA 3ZWTA 5CC3A 2VEPA 2PBGA 4TX6A 2PDYA 3UA3A 4LOCA 3LRMA 5A8MA 1GGOA 4F0MA 3GS6A 3VD7A 3B8IA 5F2LA 1JPIA 1M1BA 2YX0A 2Y7EA 3G3MA 3W23A 3MANA 1CGVA 1GOIA 1SVDA 2QYGA 4LAOA 3WCZA 3DERA 4X0NA 5ABHA 2WMIB 5J04A 4FSAA 2FPVA 4AVFA 4AWEA 3K4WA 3R6IA 4RDZA 4YVVA 1N8WA 3QGAC 1AW5A 3H7UA 3WUBA 4ROQA 1OBAA 1TWIA 1WXZA 3UJ2A 3A3HA 1HKIA 4AY8A 2HV5A 3WLSA 2HNHA 1C9WA 4HNVA 1MEHA 4OECA 3JUGA 2VZUA 2J27A 1BD0A 4FZIA 1L8NA 3UZXA 1Y5WA 1AA1B 4MNKA 3G8EA 3FVDA 2PDBA 5F2MA 4WLCA 1RBOB 2PU0A 4NIRA 4ICCX 3DUGA 2CNCA 1SO3A 4REQB 3QOKA 3FDGA 1BWKA 5XIAA 1XLDA 2Y7FA 3GU9A 3C2OA 2NQJA 4GNKB 4HB7A 1XV8A 1GVEA 1QTWA 5IFPA 5DEZA 1S2UA 5A69A 1TV7A 3W73A 4RK8A 2GWGA 1CW2A 3SJ3A 4FLOA 2V0TA 3NQMA 2X41A 3QYQA 2RFGA 1LDCA 2DIJA 4EOUA 3TC6A 4C6NA 4UWMA 1JDDA 4Q6JA 4U31A 4J3XA 1NQ6A 2PTXA 1H63A 4OUEA 3IS4A 1PUDA 4O19A 3N4AA 1K77A 2PCQA 1E72M 2QZRA 3UPBA 1JRBA 3VOFA 7XIMA 3VDHA 4YHEA 1Y0EA 3DU0A 3BWWA 2C71A 1P0BA 3TLLA 1MXGA 5DMMA 5B80A 4V2XA 3LPOA 2PODA 2PRMA 3QQ0A 2AL1A 4XUGA 3ZR6A 3D0CA 3A6OA 5AHFA 4TQTA 2YCJA 2RJHA 3DOPA 3CZLA 4GQ0A 1X7IA 1TPC1 3EA3A 1F8MA 5AZ1A 3NQDA 3WLKX 5H8PA 4GD0A 4QTGA 1UH2A 3O6AA 5FF0A 4M29A 3KVMA 1TE6A 4DWSD 2POZA 4UIOA 4IPJA 2ZXAA 1EYEA 1BTMA 4C1LA 2BHZA 4EPBC 1MSSA 2YB4A 7A3HA 1J93A 1U2YA 3NEHA 4AEEA 5U4NA 2IPGA 1QPQA 2CBJA 1TCDA 5D2XA 3PNUA 5I03A 4JDYA 5CPSA 2VELA 4BY3A 1OYBA 1GOWA 2R6OA 4QDMA 3OJGA 2A21A 1TA3A 3RRAA 3N9RA 1E56A 2CBVA 4I9JA 4UR7A 5FEXA 2J88A 3LNMA 3L2IA 4ZODA 4EAMA 1RBLA 3S3GA 1AL7A 3HPFA 1NF0A 4NXSA 1ZPTA 4AWSA 1JFXA 5HPOA 2F6KA 1W3JA 1S5TA 3GUWA 4D6FA 2PGEA 4UNKA 2LLEA 2I57A 2XGBA 2O56A 4H9ZA 4YWIA 5D9OA 3AISA 1UWQA 4K38A 4AX6A 3VIIA 3F4VA 4EXBA 2PWFA 7CGTA 4ZQCA 3MV11 2QKFA 3EX2A 3ZLGA 4I3GA 1MFUA 1SYTA 4LVAA 1B31A 2BX7A 3VGDA 1H3GA 1XLAA 2Q8LA 4HNLA 4KWVA 3FSTA 3IAPA 4XZIA 4UNIA 3LM3A 1C8QA 5AC5A 1R3YA 5LNUA 2A3LA 1XLGA 1QPRA 1IEQA 5HUPA 2VQTA 1D3GA 2WV8A 3EWDA 1XYBA 2P10A 4JQ1A 3EWXA 1Q6GA 4RXFA 3Q67A 4LX4A 4UMCA 3ANUA 3EBVA 2AQOA 3BDKA 1SJAA 3QZ6A 5CZ0A 1DWAM 2XWEA 4FIRA 4QDWA 5DCEA 1XI3A 4UTKA 4MF4A 4ICNA 4L7ZA 4L65A 3KEHA 3CV2A 2VWSA 5D02A 4W8AA 4RZ4A 2O55A 4BI7A 2WMKA 1BG9A 4IQDA 1YLVA 1Z3NA 3AHTA 4C6DA 4LUTA 3CEPA 3U5UA 2X40A 3FXYA 5L6UA 2UZ9A 1CDGA 4F0LA 4HSOA 1I45A 3BMVA 1F3TA 4LUIA 1RA5A 3MY9A 3STCA 3QSTA 2XIQA 1LBFA 3NQEA 4I5RA 2YDSA 2Y4SA 1XIDA 3N34A 1FRBA 3SQLA 1REQB 1IXPA 4E6MA 3CIVA 3T44A 3BGJA 1JYXA 4WOQA 1LT7A 3TSMA 4BS0A 3QR0A 3E2RA 2YDQA 1UR3M 2XN1A 4LEFA 5A94A 5LNVA 1QOPA 3QHNA 2DGAA 2F9RA 3WK1A 3LN3A 4DUOA 3D6NA 3UG4A 3AQUA 3WJZA 4IZGA 3M6DA 3L4WA 3UWEA 1E1CA 3A9IA 2E6DA 4XZNX 5BOOA 3H23A 3FY1A 1H51A 3FFSA 4J3TA 3P82A 4CQCA 2JKPA 2ZXDA 5HWMA 3CC1A 3ARQA 3QY6A 2Z4GA 4BF7A 5I3FA 2VGIA 2QAFA 3R8HA 1JNDA 3HM7A 4K37A 3TYDA 3OGVA 4FXJA 3C2EA 1H0IA 4J2MA 3NYZA 3NNTA 4FS9A 4OTKA 3AMKA 2VEIA 3NL5A 3N2CA 5CQ1A 4I9TA 1W5NA 3V5OA 1VYRA 3N13A 1MEWA 4O52A 5T9BG 2ABAA 4S3AA 4NF7A 3ALGA 4FIQA 3R89A 3RXZA 1ZBWA 3WNKA 2OSXA 3NQFA 3EX6A 1XRTA 4F48A <