1VP5A

Crystal structure of 2,5-diketo-d-gluconic acid reductase (tm1009) from thermotoga maritima at 2.40 a resolution
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
284
structure length
284
Chain Sequence
QVPKVTLNNGVEMPILGYGVFQIPPEKTEECVYEAIKVGYRLIDTAASYMNEEGVGRAIKRAIDEGIVRREELFVTTKLWVSDVGYESTKKAFEKSLKKLQLEYIDLYLIHQPFGDVHCAWKAMEEMYKDGLVRAIGVSNFYPDRLMDLMVHHEIVPAVNQIEIHPFYQRQEEIEFMRNYNIQPEAWGPFAEGRKNIFQNGVLRSIAEKYGKTVAQVILRWLTQKGIVAIPKTVRRERMKENISIFDFELTQEDMEKIATLDEGQSAFFSHRDPEVVKWICSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 2,5-diketo-D-gluconic acid reductase (TM1009) from Thermotoga maritima at 2.40 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Oxidoreductase
molecule keywords 2,5-diketo-D-gluconic acid reductase
total genus 108
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 1.1.1.274: 2,5-didehydrogluconate reductase (2-dehydro-D-gluconate-forming).
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1vp5A00
4GIEA 4RPQA 5JH2A 2IPJA 3BUVA 2PDJA 3B3DA 4H8NA 3ONBA 3UG8A 5LIWX 2FZ8A 2PDCA 4LBSA 2PDIA 2IKIA 1XGDA 4WDUA 2FGBA 4HMNA 1T40A 3UFYA 3G1RA 4ZFCA 3CV7A 2IPFA 1OG6A 5LIKX 2IKHA 4QBXA 1RY8A 1QRQA 1R38A 1PZ1A 1AZ1A 2F2KA 4FAMA 3H7UA 3UP8A 3NTYA 3V0UA 4YVPA 1YNPA 4LB4A 3RX3A 1RY0A 1MRQA 3H7RA 3R94A 1LWIA 2PDNA 3GHSA 2PF8A 2PDUA 2R24A 4GABA 3V35A 2I17A 3H4GA 2A79A 1J96A 2HV5A 4XVEA 1ZSXA 5AZ0A 4JIHA 2BP1A 4HBKA 2PDLA 2PDXA 1MI3A 3N6QA 4H7CA 5C7HA 4QR6A 5AZ1A 2NVDA 2FZBA 3KRBA 3M4HA 4PUWA 1MZRA 1PYFA 5HA7A 4PR4A 1X96A 3LUTA 4XO7A 1HW6A 2DUZA 4YVXA 4L1WA 4XZNX 4JTDA 2ACSA 2PDQA 3DN5A 4LB3A 5DANA 1M9HA 2HE8A 3R7MA 2IKJA 4JQ2A 3WBWA 3Q65A 3P2VA 3EB4A 2DV0A 4DBSA 5M2FX 1AZ2A 1US0A 3LEPA 4GA8A 2P5NA 4OTKA 4LBRA 2PDGA 1S2AA 3LZ3A 2PDBA 4JTRA 3CAQA 1S1RA 2ISFA 5HNTA 3T42A 1SM9A 3LENA 1PWMA 4JTQA 3R58A 2IS7A 5LIUX 3CV6A 3V36A 2PEVA 2NVCA 1X97A 3UZWA 1AH3A 3UZZA 4LAUA 4YU1A 2HVOA 3MC5A 4WDWA 4IGSA 1S1PA 4GACA 1EL3A 4R9OA 2HDJA 4XK2A 2INZA 1XJBA 4XZLX 3GUGA 2PDKA 2IPGA 3RX4A 1X98A 1GVEA 4EXBA 4WDXA 1JEZA 4JTCA 1HQTA 2AGTA 2IPWA 2HEJA 4LAZA 3BCJA 1C9WA 3FX4A 2QXWA 4WGHA 2ACQA 1EF3A 1IHIA 3MB9A 1Q13A 2PDMA 3UZYA 1A80A 1S2CA 3LD5A 4L1XA 3UGRA 1ZUAX 4PRTA 2J8TA 3M0IA 2PZNA 2WZTA 3M64A 4XZMX 4GQGA 3LQGA 3LN3A 2CLPA 5KETA 3WBXA 3G5EA 4MHBA 1Z9AA 3DOPA 2PDHA 3WBYA 4WDTA 4GQ0A 4XAPA 2WZMA 3R8HA 4NKCA 4JIIX 3Q67A 1IEIA 4PUUA 4YS1A 3R8GA 2PDPA 1T41A 4DBUA 1VP5A 3GHRA 3R43A 5HNUA 1YE6A 4GCAA 1ZQ5A 3WCZA 1Z8AA 2PDYA 3O3RA 4Q7BA 1ADSA 2F38A 3LNMA 2FZDA 2PFHA 4ICCX 1YNQA 3O0KA 5LIXX 1AFSA 4EXAA 3N2TA 4JQAA 1Z89A 2FZ9A 2PD5A 3BURA 4IJCA 2PDWA 3CMFA 1AH4A 4F40A 2BGQA 3EB3A 4WEVX 2C91A 4WRHA 1K8CA 2R9RA 4FA3A 4DZ5A 1FRBA 2ALRA 3R6IA 3S3GA 1AH0A 4XZIA 3UZXA 4FZIA 2ACUA 1UR3M 4JIRA 4DBWA 3LQLA 4XO6A 2PDFA 4YVVA 1Z3NA 3EAUA 3FJNA 3D3FA 1LQAA 4JQ4A 3GHUA 4AUBA 3QKZA 1PZ0A 4FALA 3LBOA 1EXBA 3BV7A 3CAVA 3CASA 3VXGA 3F7JA 4Q3MA 2ACRA 3GHTA 2BGSA 3V0TA 3U2CA 3V0SA 2VDGA 1RALA 2IQDA 3LZ5A 3RX2A 5LIYX 4I5XA 1QWKA 2INEA 4PMJA 1ZGDA 4IJRA 2HVNA 4JTAA 4ASTA 3COTA 3ERPA 2IKGA 2PD9A 4G5DA 1Q5MA 2IQ0A 3UWEA 4XZHA 5JH1A 4QX4A 2DUXA 1YE4A 3ONCA 4QXIA 1XF0A 2FVLA 3UYIA 4PRRA 3C3UA 1VBJA 2I16A 3WG6A 4JQ3A 4XVDA 1PWLA 1EKOA 2HE5A 4JQ1A
chains in the Genus database with same CATH superfamily
1RCOB 4M51A 1OYCA 1WBJA 2C0HA 2WSRA 1EQCA 2C18A 3FVMA 1UQYA 4Y9OA 2R82A 4YN5A 2DPEA 3M7SA 2YPIA 2QJJA 2NWRA 4UQCA 3W1PA 1FFQA 2GJRA 2R14A 5G2WA 3ABSA 1OFPA 4N2YA 3NPVA 3C8FA 1AZ1A 2PF0A 2XVNA 4LYKA 3NTYA 1AQFA 4GK8A 4RE2A 4LB4A 4ZQMA 2VD8A 2ZX6A 1QPNA 4RNIA 3NZRA 1XI3A 1H41A 3HJZA 4RXGA 5E70A 5E6YA 1G1YA 2JBMA 5D2XA 2QDHA 4C60A 1TPVA 4OE7A 3NQ2A 3BXWA 4QS5A 4C1NB 1XIDA 4HA4A 4RDVA 3I6EA 4QLJA 2BVDA 4M56A 1C8QA 3TOYA 2VFGA 4XKMA 1THFD 1NIUA 3UJ2A 3EKZA 3T0DA 1FKWA 3BPWA 4QG9A 3DYPA 5HQLA 4NZ5A 1FDJA 3CT7A 3H2OA 1E6SM 5G1YA 1JD7A 4EPBC 1I2QA 4LWWA 3GIYA 4S38A 1JYWA 2RUSA 1UOKA 5DO8A 2YR1A 3S2MA 4H2CA 5A8OA 1A4MA 3O05A 4Z2HA 3BLKA 4XUYA 2RDXA 3USBA 3GB6A 3GU2A 3DGRA 2DSUA 1Q2RA 3N6JA 2NW0A 2OLSA 3VK5A 4IIEA 4LC6A 2OT0A 2YGYA 5ABFA 1OGSA 1ZNNA 4L5ZA 2OSWA 3MUZ1 4IICA 1XP3A 5CC6A 4DWSC 5HPOA 3ZLFA 4RNJA 3SRFA 3PUDA 1BAGA 4JTRA 1ZAHA 3WX7A 3WKZA 1GT8A 3WK2A 2IS7A 2VEPA 3K8KA 3VC6A 4OGZA 4JICA 4NZJA 1HNYA 1UD2A 1XR2A 3EWUA 4UTKA 4H19A 2X2YA 1FCQA 3NPXA 4D6FA 3WH6A 4UFIA 1JI1A 3UVAA 1DV7A 3CUGA 3LCGA 3VIMA 2E1WA 4OOUA 4GVFA 2YCEA 3UA3A 4HMDA 4ZL1A 3W7QA 3CUJA 4DO7A 3CL8A 5GPRA 4RLIA 4L80A 1EUAA 5AYXA 4P7LA 3RLHA 1KW1A 2DEPA 3VIFA 2NVAA 1W3IA 3SCOA 3A3WA 1GW9A 1Q45A 3UG3A 2OJPA 3S9IA 4H04A 2J7BA 5D9NA 3HPAA 4HTYA 3ZZ1A 2TPSA 2W79A 2WBGA 4ENLA 2VO5A 1NARA 2PZNA 3WQFA 4CN1A 2WZTA 1QXLA 1DE6A 5D9PA 4CNNA 4QJ4B 5AOUA 1WUEA 4O11A 4S3GA 4JHZA 2MANA 3L66A 1FBAA 3TYAA 4QQUA 5LA0A 3C0JA 5D37A 1GPWA 2PDHA 1E1EA 2HS8A 3R8RA 4GQ0A 3MHFA 2FPYA 4XAPA 4WF7A 4NRRA 3M6YA 3S8HA 1EBGA 3T1GA 2J27A 3MSRA 2HXTA 4R85A 4LVDA 3BV4A 2DJLA 3ITTA 3A5FA 3L4TA 3BLLA 2OO0A 3P14A 3TZNA 1EUNA 4PC8A 3ZT6A 1YE6A 2ONEA 3WCZA 3CC1A 4N9DA 2X42A 3NDYA 3AIBA 1F2JA 5J5RA 5C2CA 3CMJA 3AXXA 2JEQA 4LYRA 1O5QA 1BGAA 3D5HA 3O6AA 4D71A 1HKWA 1KV8A 2F7FA 2OB3A 3IJ9A 3LY0A 3PPFA 4DJED 2E9LA 2YXGA 2D2JA 4FOUA 3SJNA 1A5SA 3NGJA 4NAFA 3BO9A 4W8LA 3A24A 1QNRA 2PD5A 3BURA 2PDWA 4EANA 3QM3A 4F40A 5AC7A 1A5OC 3NZPA 4R53A 1EP1A 4J1OA 1JZ3A 1X38A 2Y7DA 1TMLA 1O5XA 1SZFA 1TYGA 3E0VA 1W56A 3KHJA 1X7IA 3P5YA 2BMBA 2WM1A 4LVAA 3M7WA 4AW7A 1ITQA 5ABEA 4XIAA 4LS1A 3HQPA 3ZWSA 4NF7A 3WH7A 1VEMA 1HF6A 1TV2A 1VLIA 5D2WA 3TYEA 3UBPC 3SADA 2A6NA 2DSKA 4Q4QA 3I7QA 4ML4A 2VFHA 3OZOA 1GVOA 1L8PA 1V3JA 4ERIA 1IGWA 3AI0A 2D23A 3CUIA 1ZAIA 2ACRA 4X61A 2OT1A 3ZSSA 2VZOA 3KZSA 1C8XA 3IGXA 5DF0A 1XWYA 5K7JA 1KM4A 3DX5A 4CQBA 3H8AA 5CGTA 1GJWA 3RJXA 4S2BA 4D2JA 5A5WA 4CD8A 2BXZA 4JYFA 4N9BA 3LYEA 3UWEA 6XIAA 4DJFC 3KS6A 4QE5A 3K1DA 2WW5A 2YXXA 3GVWA 3ITXA 2A2IA 2DUXA 2FTWA 1VFMA 3ONCA 5J04A 2GGGA 2PPGA 4IJBA 2OX1A 4QCFA 1A5CA 3LMYA 1JYXA 1TQJA 1RVGA 3IJLA 4BS0A 1W1PA 5F1UA 3PP7A 2QYGA 4JQ1A 4PGLA 1MSSA 3P8JA 3QY7A 3W0KA 3REQB 1WZKA 3RFAA 1IEQA 2IPJA 1SR0A 1ONRA 2QPUA 2GGJA 2Y7GA 4NAEB 2VC6A 4QISA 1WP6A 1A53A 4LBSA 4TV5A 3MV11 1OG0A 1CNVA 4AAJA 4A3RA 3AS3A 4DJDC 3T0TA 3CPUA 1JUEA 2ZCGA 1OG6A 4D8ZA 4XSMA 1J0JA 4WXYA 1S2UA 3C2VA 1XISA 2DU2A 4ZXOA 1ME9A 5CC7A 1DJXA 4HU0A 2ISVA 3U7VA 3PTQA 2CETA 3VUSA 5CZJA 7XIMA 1UH4A 2PGFA 4DYEA 2QQ6A 1B3OA 4L4OA 2Y70A 2G5WA 2BLEA 4UTJA 2V3FA 3A12A 4GFSA 2G50A 1HL8A 4A35A 2XGZA 1W9BM 4Q8WA 2CWXA 2HSAA 2GOUA 3CZGA 3N2OA 4M6VA 1MI3A 4Q8OA 2ATSA 3EOLA 4B91A 1EJXC 3GDMA 1FHDA 1ZHAA 4TXEA 2BNJA 3LLDA 4PCPA 1F07A 4EACA 3GNRA 1KCZA 3AWOA 1RCQA 2Z29A 4AU0A 3RM8A 2DUZA 3F2DA 2YL6A 3O63A 4IMCA 5A95A 1J18A 3CUFA 3NFUA 1IZJA 3QJAA 1Y8BA 4XZNX 3JUGA 4QJ3B 4DVOA 1ZENA 3C0LA 1J5TA 3LU2A 4L4MA 1VPYA 1M7PA 5M2FX 1K3UA 3AAMA 2UY2A 3LPFA 4TTUA 3S6DA 3Q37A 3T81A 1JG9A 1EC8A 1IXNA 4D6GA 1FXQA 4DI9A 4R7WA 3WH9A 2Q6ZA 1JCJA 1MXDA 5HWJA 4RL3A 4L64A 4W85A 3WF0A 1V93A 2HRWA 1OINA 4YJ5A 4ZO6A 1H51A 2OZTA 3GTNA 1A5BA 4H9VA 4Q4SA 2E68A 4B5TA 2EKGA 4DO4A 1LOSA 4WSHA 3DFQA 5H91A 5AKQA 3SAZA 1J79A 3SN0A 1C90A 2OX4A 1KXTA 4MB5A 4WDWA 3CLMA 4YYFA 1GKPA 3UGVA 3EDDA 4R9OA 4DF2A 3HN3A 4DPQA 2Y7FA 1DEDA 3GUWA 3K4DA 4HT3A 3A21A 4UR8A 3XINA 4JTCA 3L9CA 1SZEA 5CXPA 3LPOA 3CQHA 1BXBA 2VNCA 2PWFA 3BCJA 1FDZA 4MY1A 1MXSA 1NAL1 3NYDA 2XTKA 3F2CA 3AS1A 1QWGA 2DP3A 1DP0A 1F3XA 1T8QA 3KCJA 4O18A 1W54A 3R25A 3M0IA 1OGBA 3TW6A 2V67A 1M65A 3CZLA 2VTFA 3UR8A 4HNCA 5JVLA 4GKLA 3LQGA 1C7TA 5IFTA 4RE4A 5EMJA 4A8RA 3TYUA 4LBUA 1HJWA 4JN6A 3F03K 3PSVA 4W93A 4FLSA 3ARUA 1F76A 2Z00A 3SQLA 1R3TA 3SIMA 2AKZA 3GFXA 4GIAA 2YA2A 1RQHA 1VH7A 4WQ6A 3N3TA 2BHZA 3EOEA 3GYCA 1MXGA 2Z1VA 3GC5A 2OGYA 2VYOA 1IEIA 4LXFA 1VCFA 1DWAM 2XN1A 1Q6EA 1GG0A 3PAJA 3GR4A 3G2GA 1HKIA 3PWAA 1W1VA 4JTJA 2XZ7A 4MUPA 1JJKA 4DWDA 2HROA 1CXFA 3K4AA 4CQDA 1J2WA 4G7EB 2V5BA 1SO6A 3E38A 2WNZA 4D6JA 4US5A 4Q7BA 2XDFA 4L9XA 4AMAA 3K8MA 2PLCA 1UUMA 3EX3A 1TPB1 4OQVA 4S23A 2CNCA 1MW0A 3DC0A 3SM0A 4FXRA 5HANA 2BGQA 3CV2A 1BVZA 1A0EA 1PIFA 3H2MA 4X0NA 3W28A 1R3WA 4U28A 3AWNA 4H8UA 4NI8A 5T9BG 3WQ5A 1R3SA 3CHCA 1A47A 3LRKA 3AUOA 1E9YB 2HPMA 4DBWA 1MW1A 5BRPA 2VGGA 1F6YA 3QSRA 1SJDA 1T5AA 2AL2B 1JQXA 3TJLA 2GZXA 4F2TA 4PL1A 1EXPA 4K8HA 4LF2A 4BJHA 3W2NA 1PZ0A 4PCSA 1R3VA 2YZ5A 4I9AA 1NP2A 3CAVA 2JF7A 3H2FA 5LZLA 1DIKA 1HL2A 3DESA 3FGCA 3FS2A 4TMBA 1QI3A 3V0SA 3LOTA 4ICMA 1E1CA 1SU5A 4E2VA 1KQZA 3VZZA 2VX7A 3LZ5A 4KFNA 3MV01 1QWKA 4PFHA 2PI6A 1W8SA 5AYIA 4AEFA 2QCMA 1Q5MA 2YCLA 4GWEA 4JNZA 2PB1A 4FLQA 3TN4A 4MVAA 1VRDA 3VOCA 1TZZA 4IHCA 4B2DD 5EMUA 3CHFA 1Q7QA 4KGLA 1A3WA 4GXWA 4GZIA 4J2MA 3A64A 1CLKA 3UYIA 2R1LA 4HNLA 3USZA 3VNMA 2QVHA 2ZTKA 5AC4A 4LUIA 3CZJA 4C90A 1SZNA 4GGHA 3UJFA 3W2JA 4A8LA 1Z6KA 3KBMA 3T0BA 1ONWA 2EPLX 3NDOA 1TPC1 2Y24A 4H8NA 3UG8A 3TJIA 1S2VA 3HG4A 3P74A 3MA8A 2ZX8A 1E9LA 2C13A 1CGXA 5BWFA 3ATZA 3PPCA 3S9ZA 1XD0A 1H1YA 3W87A 3QQ0A 4LAOA 4LT9A 1XYBA 3ES7A 3NSNA 2GVJA 3W7IA 4LCQA 4AB4A 5JBEA 1H61A 3EWDA 3MMDA 1YNPA 3RX3A 2DVTA 2CZFA 1RA0A 2CW6A 1KFKA 2Y8KA 1SJCA 3W7RA 3EDEA 3ZXWA 2R24A 5BOFA 1O1ZA 3NQEA 4EKJA 1NEYA 4N0RA 4P7QA 1W3HA 2QCFA 1GVSA 2NUYA 1GVFA 3POHA 2XZ9A 2WWCA 2HS6A 1XG3A 4KWWA 1D8CA 2ISDA 2F6KA 5REQB 1OFDA 1PSCA 1FKXA 1XYCA 3U7BA 4BCEA 2BG5A 3F4NA 1PYFA 5FAGA 1BWVA 4H3DA 4IPNB 4AHOA 1KR1A 2GGIA 1H1ZA 3LSBA 3NVTA 2VDHA 1EB3A 3AMLA 2FQIA 3PZIA 4JN7A 2ZRUA 4NXSA 3QSTA 5CKSA 5BOEA 1XDMA 3PN8A 5BRBA 4YXGA 5FSEC 3W7HA 3SGZA 2J77A 1EX5A 3EXSA 1E40A 3TMLA 3ZVHA 4RR4A 4EWJA 3LEPA 2GSHA 1QI2A 1T6MA 4AVNA 1O60A 3LBMA 3JZEA 4UTHA 3TH6A 4WJXA 2G3MA 4YCOA 3FK4A 2Z1SA 4L4LA 1XLMA 3IIOA 1SQ7A 4GVGA 3BANA 1VRXA 3A6OA 3O6DA 4ML9A 3M0XA 4JTQA 3MVTA 4RK8A 1U33A 1G9HA 3WNNA 3BWWA 1IR2A 3KM8A 3U48A 1TB3A 1X97A 1OF6A 1NOWA 1UP2A 4BEQA 1XG4A 4XZWA 1MZHA 2G3JA 1S1PA 1X8FA 3GUGA 2QJGA 3W01A 2TODA 4DJFD 4OV9A 3U4AA 2I5GA 4CD5A 1B30A 2VCBA 4WDXA 1JCNA 1HQTA 2PU1A 4GINA 3BSHA 3W7CA 4MZ1A 3W7MA 5F2LA 4OUIA 3W71A 4PCTA 4PUMA 2J8GA 1J0KA 2FGLA 3DFSA 4WOQA 1PS9A 4F0MA 2FTYA 5DQPA 3GYEA 4PMUA 1DIOA 4MPKA 1HTIA 1UB3A 1S5TA 2G37A 2E5BA 3LN3A 4HK7A 3DERA 3IUDA 3GK0A 3W27A 1JRCA 1XLKA 3CL7A 3IRDA 3AIVA 3ALFA 2Q3OA 5FCZA 2EXOA 5CJ5A 2WANA 3UW6A 4ZB0A 1UBPC 1CGWA 2QCNA 4Y9MA 1Q6GA 1XPGA 4RE3A 1XYAA 2A6LA 3Q67A 3GU1A 1MUMA 3TTSA 3SCNA 2KX9A 2FB3A 4IIHA 2LLEA 2PDPA 4HKPA 4ZSTA 3GDRA 2VEMA 3LI0A 3N25A 3Q2DA 5IFPA 2H3DA 2BXVA 4H6EA 1IWBA 4H41A 2ZBTA 3N12A 1OFEA 1E6PA 3VIHA 4NYYA 5F4XA 3RU6A 1D7FA 3LNMA 1YNQA 4KMQA 3IK4A 4IWWA 3AOFA 3V5CA 2W5FA 2GDQA 4NVTA 2ZICA 3WJXA 3GSMA 3WLSA 1UQZA 4CVWA 3NSXA 1XCFA 2PLMA 4CCCA 3W1LA 2X09A 2V8ZA 3MKVA 3SRDA 3T2QA 2ZXDA 1YDOA 3S1WA 3MMWA 2R9RA 1KKOA 1LWJA 2OZ3A 4QLLA 2X0SA 2Z4GA 4HHHA 6ENLA 5EL1A 4JDYA 2O0TA 1V6TA 1UIPA 3MI2A 1LQ2A 3SW6A 2ACUA 2VEKA 1P48A 4GLEA 1F74A 3KS5A 1QOXA 1H7WA 4G2DA 4MWAB 3WFZA 2R1KA 1JPKA 3EAUA 3PFMA 1W31A 4DWSD 4ZQCA 3QV6A 3N29A 3ITOA 1V03A 4PMOA 3AMKA 4IQDA 1W3NA 4FALA 1TA3B 3FA5A 3SUUA 4DX3A 3ARRA 3CWNA 5CAKA 3WF4A 3QLLA 2E0PA 3WDQA 1LOQA 4ZZ9A 3UNTA 2E09A 1XXXA 1NQKA 3HZ3A 3HG3A 4HCDA 1DTNA 3TJXA 4YLWA 4JTAA 5TBOA 3HF3A 2IKGA 2PD9A 4WOZA 3I3EA 4AHQA 3PG8A 1R7AA 1DWIM 3AYRA 5AC8A 3SRHA 1EBHA 2CC0A 2VT0A 4R7OA 2XJ7A 1MEIA 3N4EA 1RLCL 4FR6A 1E6XM 4XIMA 3N9SA 3AYTA 3JS3A 3QZEA 1YEYA 4KFPA 1YE4A 4B90A 1W2PA 1H5YA 2XISA 3C3UA 1AQHA 1VBJA 3WBAA 3TTYA 3CJPA 4JQ3A 1FWFC 3WD4A 1IT8A 1S3HA 4XVDA 3UY8A 2P0IA 3LX9A 4OU1A 5KITA 2DFAA 2PDJA 7ODCA 4O28A 4G8TA 1XPYA 4GD0A 4I7VA 6CGTA 2C71A 2WM0A 3P7YA 4FR1A 4AY8A 2VGIA 1S5VA 2B31A 2NT1A 3STPA 8TIMA 1KXQA 3W6LA 4G56A 1VBRA 1H0GA 3NNTA 5D30A 4RDYA 4W9TA 5I3HA 3TA9A 3R0DA 4Y6GA 2WVUA 1M7JA 3G6LA 4GI6A 1QVBA 3AYVA 4GRSA 4LX4A 4O15A 3VNYA 2NX1A 3DUGA 1EOKA 3PZGA 4M7TA 4UIOA 1ELSA 3W4RA 3N11A 3EWZA 2BWGA 3TCEA 1IXOA 5T8GA 1XYZA 1PV8A 3BAYA 3KRBA 1WNOA 3KRSA 1P0KA 3TW9A 1P1MA 2NZLA 1WDSA 4U3AA 3A3XA 4AYGA 5HNRA 3CQJA 3T0CA 4ZO9A 3GG1A 5H8UA 3WY1A 1J01A 4LCSA 1V7AA 4P7RA 5A6BA 2PDQA 1RAKA 3AMGA 1V02E 4X0VA 1DL3A 2DT1A 3W73A 2PBOA 1LT7A 2F84A 4V15A 5AVHA 4S1FA 4GC3A 2AQVA 1GKRA 4AD2A 4DZHA 5MF5A 1TVPA 2J88A 2V81A 4DBSA 1TTIA 3W07A 4AZCA 1XD1A 1WAWA 3SJ3A 1AQ0A 4C5ZA 2P5NA 1S2TA 2ZOXA 3N9RA 4J3UA 3WLIA 2DZPA 1I2OA 2ISFA 1W9PA 2EQDA 1EWDA 1HUVA 3TX9A 2WSYA 2Y88A 3WF1A 5A69A 3S2CA 9RUBA 3ZOAA 4GQRA 4BF7A 4Q7NA 1QMLA 1XLBA 1FFRA 3WLOA 5HJLA 4JTFA 5AYZA 2RGLA 1LRTA 6ALDA 1CIUA 3MC5A 2DT3A 4GACA 4YTRA 3CT2A 4RUBA 4S3KA 4XZLX 4LUTB 5TQLA 4JCMA 1X98A 2FVKA 2WQPA 1GVIA 5CSUA 3KOZA 4A3YA 4UXDA 3E2QA 2B7OA 3G0UA 4NZCA 1BKHA 1GQJA 2C1GA 3LRMA 4DUVA 5F2IA 4AZ6A 4IXHA 4DNHA 4RNFA 3FX4A 3QXBA 3QQ1A 4NP7A 2WC4A 1H7RA 3HQNA 1UZHA 3S1VA 2EPMX 4X60A 3MSDA 1R6WA 1GW1A 1QW9A 4V1YA 4IPJA 2EJAA 5CZ0A 3W83A 3N19B 4HMEA 2PURA 2ATMA 2D0HA 4DQWA 1TZ9A 3IPWA 3SN1A 5CBJA 7PTDA 4DF0A 3S2NA 4OOZA 4HSHA 1ZB5A 3ZJ8A 1QW8A 2Q09A 3TYZA 1JYNA 4KGJA 1W37A 1Q8JA 5T26A 1CB2A 2Y6ZA 5A2CA 1F4HA 3C2OA 1PB0A 1SMAA 4UC5A 3RGTA 2OQHA 4WDTA 4QJ5B 1O5RA 4FI4A 1VBUA 3TNBA 1XBZA 1GONA 4MFDA 5D2YA 3ZO9A 1C3FA 2E6AA 1XH1A 3LHWA 1AVAA 4JS3A 1Q6LA 2QF8A 4P61A 1M41A 2OWCA 1GOKA 4XQ6A 3F2BA 2V82A 1ZJIA 5F4WA 4OECA 1Y65A 2YYTA 3AQUA 1KFEA 5ECUA 2FTPA 2F6XA 3L2LA 4K8EA 5FSDC 5KZEA 1WE5A 2PFHA 3B04A 5BXTA 1IYXA 1GYLA 5LXEA 3N2MA 4OWGA 3EKLA 4XB3A 3VE9A 1W91A 4B2DA 3WBEA 3CMFA 3CIVA 1Q66A 1ME8A 1FH7A 1XIHA 4IIGA 3WELA 1PO9A 5G1TA 3WQWA 3W7NA 3NQFA 3GRIA 4PMZA 5FD0A 3H70A 3L5AA 4O1BA 4ROQA 3KCOA 4YVVA 1VBHA 2QULA 3VD5A 2NLIA 2W91A 3IARA 1SW0A 4KIRA 5A6LA 3TK7A 1LBMA 2WZHA 4NASA 3R10A 3MCOA 3GNNA 3GNPA 3V5OA 2YB4A 3JU2A 4ES4A 4Q3MA 4G9PA 2Z2BA 1XLDA 1IIGA 1O94A 3RX2A 1PIGA 3NQGA 4UUIA 2GYIA 1BVWA 4QP0A 2E5DA 3T4WA 4H8HA 3H2EA 4IJRA 1RD5A 3TMQA 2HVNA 4H9MA 1KM3A 1GGOA 3T08A 1JZ4A 1OQFA 4N4PA 1Q85A 3K13A 3B0XA 1I2PA 3O9NA 1W3TA 2ZRVA 4RZ6A 4B3KA 1YX1A 5C70A 5K2ZA 4XBKA 3M0KA 4TOQA 1YBQA 4GBDA 3IK2A 2NT0A 2HXUA 1XF0A 4ACYA 1EIBA 4FX6M 1PAMA 2Z1XA 2VWTA 3MSYA 4E38A 1FHUA 2CZDA 1CCWB 5I3FA 1E56A 1IT7A 3S6TA 4Q8VA 1Z44A 1B5TA 2UZ9A 2O9RA 4FIRA 3THDA 2V5CA 4BWLA 3S1UA 5CC5A 4BQ5A 2NQZA 3AS2A 3V75A 5D8ZA 3II1A 1XICA 1UKQA 3GC2A 1TIMA 1XGDA 1GNXA 3PJWA 2J62A 4Q4PA 5FEZA 5GNYA 3D6NA 1K7XA 3EOUA 4DJEC 5IDZA 3F1QA 1W5PA 4Q8QA 4O0ZA 2VP8A 4IOTA 1EDQA 4QTGA 7TAAA 3V0UA 3E5PA 5EY5A 1JUKA 4V33A 1RY0A 4XD6A 2AAAA 4K36A 2JE8A 1KV5A 5AVNA 1KC7A 1JIBA 3GDKA 3A9IA 3VIPA 1Q6FA 4RZBA 3KP1A 1EO5A 4MNJA 4ATWA 4H4IA 3RNDA 2WPBA 1UZDA 1DJQA 1J10A 4CCZA 4HBKA 2UY4A 1AODA 3G6MA 1D8WA 3VM5A 3W74A 3W37A 4QFUA 4CQAA 1ISZA 4TTGA 3BMWA 1C7SA 1US3A 2CITA 2E7FA 1K8ZA 1K02A 4PR4A 4JZ5A 3GXDA 2OSXA 4KERA 1I6NA 2YOCA 3GTXA 3RK8A 3OP2A 3LB0A 3KLLA 4DM1A 1OM0A 4JTDA 4K3ZA 4A3UA 3CB3A 4LB3A 4EF9A 3MQTA 3TN6A 1HP4A 4WKFA 4NILA 4IPIA 1ZLPA 3CU2A 3WJYA 8XIAA 3LCWA 4JQ2A 4QM1A 4GI4A 1A5MC 1QPQA 1NDVA 4YTSA 2CBVA 3KDOA 3XIMA 3EPOA 1GHSA 4JHOA 4DPPA 4MKNA 3H53A 2XU2A 2W62A 4IPPA 1F4AA 2PDGA 2XM2A 3R2GA 3TOPA 1K8YA 5AHLA 3WQPA 3MP4A 3SECA 2ZXAA 1S1RA 1HZYA 4UR7A 4ORMA 4UWMA 4N9EA 3MUY1 2WSQA 4HPXA 2XIBA 1T0OA 5C5YA 3WD2A 3GFYA 2IUZA 4KF1A 3WNMA 2EG8A 3Q58A 3SN4A 4X2RA 4A05A 3HG2A 3LV6A 2Y5SA 2NX9A 1EPXA 1XHGA 5DX7A 3VGBA 1RV8A 1OYAA 3VVGA 3ZT5A 4IGSA 3P0WA 1EL3A 4DJDD 1WUFA 3CQKA 3DXIA 3BG5A 3FAWA 3VIKA 3PFRA 4RNHA 2ZRZA 4O57A 2QPXA 3IJ6A 3PK7A 5TAOA 3W84A 4MWAD 5F7UA 4C7FA 1C9WA 2V30A 3LDVA 1EFZA 3BK0A 5C2GA 1EF3A 1DXIA 1W5QA 4JKLA 3QY6A 1GKQA 3UWUA 2VEGA 4GJIA 4ZA0A 1ZL1A 3FXYA 1FWHC 5I7GA 1S2CA 2O7SA 2AAMA 2P88A 4GC4A 4YPJA 1I0BA 6A3HA 3UERA 3MCNA 3B8TA 2E25A 1C8VA 1O1HA 3FYOA 1JI2A 2E6FA 2WC3A 3HPFA 2FMNA 1ZPTA 3V18A 1ZU8A 1BFNA 2NUXA 1FTXA 2EJ1A 3W24A 3PWIA 2VRKA 4E4PA 4JTLA 1G01A 4ZO7A 3VINA 1YPIA 1N55A 4U31A 5F1VA 2YW3A 4BZYA 2CWNA 2H90A 3WBYA 4RE0A 3RO8A 2FHBA 1H49A 1JDDA 1ADOA 1DQUA 1F3TA 1XINA 4DYJA 2W67A 2XGIA 3S6OA 1OSEA 3FXGA 1TWIA 2VC9A 4TQTA 3SCSA 1JFHA 5GVJA 4YTUA 1KM1A 2NXHA 3NZGA 4W7WA 2QMJA 3W6YA 3ANYA 3L21A 3CAKA 5LA2A 5DLCA 1XRTA 1AJ2A 4ZOBA 4QIUA 5BOOA 4GCAA 3LLFA 4E8CA 4PBGA 4DF1A 3EWWA 3BLOA 2J25A 5I07A 2ZUSA 4IFKB 2DZWA 3SCTA 3ZLHA 4XD3A 1D7KA 3SZ8A 1MWOA 1Q6CA 2FHFA 5EFDA 3TEVA 3CPGA 1VB9A 1OCBA 1WA3A 3SFKA 1R3YA 3HQ1A 3FCPA 3SR7A 4GO9A 4X22A 1Q4WA 1KGWA 4ZEPA 3EEZA 3R79A 5CLTA 1U2YA 4JHMA 3SO7A 3MUCA 3GE7A 3YPIA 4GQBA 4W88A 1QCWA 3QHNA 3UG5A 3INPA 2DZXA 1C92A 2XIOA 1OY0A 1AH0A 1B90A 1H11A 5LGXA 1VAHA 4O4VA 3WK0A 4GZEA 2OMAA 3NDZA 5DCEA 5EBUA 2WK2A 1NOFA 2GWNA 5C9ZA 2E6DA 3AUJA 1JDCA 1PE1A 3LI1A 3MZ2A 4V27A 1OADA 3T78A 3WF2A 4UTFA 3S5ZA 2I9UA 1UYQA 1EXBA 2YKKA 3O0FA 3REQA 4HNOA 2XPKA 1BRLA 1SJBA 3C56A 3H22A 4DELA 4ZR8A 1D3HA 1IWPA 1IZCA 3PM6A 4I5XA 4QG6A 4PMJA 3WZ0E 2VENA 1TUFA 1WXZA 5C6MA 2NXGA 3KXQA 4IX2A 4O16A 1FCVA 1MEWA 1KCLA 1GEQA 3BSGA 4Y8FA 2WHKA 3QPYA 1I2RA 2C8NA 4ECLA 4UQDA 3GW0A 1R47A 3DFHA 1KFJA 4BR1A 1WBHA 4ZOEA 3VKBA 1E3ZA 2D0GA 2OU4A 1G6CA 1W3JA 1XSKA 2Z24A 1J5SA 3SCQA 3ABZA 4WY0A 1N2VA 3VZXA 4HYRA 2XINA 1NM9A 3HGRA 2PTZA 1FWBC 5M1TA 4D6HA 2QCCA 4UOZA 3UPWA 3LS9A 2WVVA 1GPFA 3GNOA 1MW3A 2P8CA 5BXPA 3GO2A 4H01A 4U4MA 1Y0EA 4HHPA 1UP3A 2SFPA 4UCGA 1T40A 1RHCA 1TPDA 1TZ7A 3FSTA 4ZQRA 3P81A 4PN2A 4AIOA 2WLYA 1PHWA 2QIWA 3EPMA 5D38A 2IPFA 1LWHA 2WVSA 5IHRA 3N4AA 1QO5A 3GG8A 4FSAA 3OEXA 4BK9A 2C14A 3GX9A 4U2ZA 1GQIA 4BFAA 4GZJA 1JNDA 3JRKA 1PX4A 2DW6A 3IJQA 4NUWA 5D03A 3FHAA 2WLZA 3N2BA 3A9BA 1MRQA 4PUEA 3OVRA 4YIWA 3LM7A 3H26A 4GISA 2R1MA 2G96A 3K2GA 2FZNA 5JXQA 4HP5A 4Y9AA 1GQLA 2V2CA 2WMHA 3MWAA 4CD4A 2J7GA 3D47A 3GIPA 1AK5A 3QZ6A 2JQXA 4WK9A 2VFDA 4PTWA 3CS2A 4KEZA 2Q8LA 1IXPA 2PDLA 3UXKA 3ZJ7A 4QNWA 4AD4A 3W7JA 3NVDA 3AXIA 3AXMA 4KCVA 4J5NA 5HA7A 3LV5A 3TLLA 2AMXA 2Y7EA 1CTNA 3AYSA 1OX5A 3GBDA 2VFEA 2ZQ0A 3OBEA 1B4KA 2YDSA 2VR5A 4AVFA 3F4CA 1V6YA 3UXIA 1DHPA 1ZALA 1V6UA 3F4VA 3E74A 2HE8A 1XW8A 4Z2KA 4Z0SA 3R7MA 3E9AA 4LPCA 2V63A 3MP5A 1LUCA 4IP5A 4D6DA 2J8FA 2GQAA 4HNNA 2G4FA 2YCLB 1IZKA 5D8WA 1RK6A 4OTKA 1MMFA 1SO3A 4P7NA 4JFVA 3TU9A 1BPLB 4MSSA 3G22A 1R2TA 4TX6A 3ITYA 1PTGA 3P93A 2XFRA 4K2SA 4MY9A 4MG4A 1GWJA 1QNOA 3V7PA 1DYSA 3TSBA 2NVCA 2V5DA 4KETA 1YKWA 1AH3A 1EIXA 1A5UA 1B4EA 4MTVA 4JGDA 2A7PA 4J28A 2HVOA 1DIDA 3EMQA 1QHOA 2WMKA 3UYCA 3M0LA 2ZFAA 2GVGA 2QV4A 1QHPA 1BYCA 3RPDA 2IPWA 1H62A 4AD0A 3W86A 2OWWA 5U7SA 3RM9A 2HVMA 2ESCA 3KWXA 1VFHA 2GUYA 4MY8A 1EEPA 2KAUC 1RJQA 4UQBA 1DJNA 3RMJA 1ZUAX 4K39A 1FXPA 4KKXA 3WQ4A 3ZIZA 3SUVA 1K9EA 3M46A 3FKRA 3A23A 4RPPA 4E4FA 3PZQA 2EPHA 3QRHA 5JBDA 3PPHA 1NDZA 2E8YA 2FKPA 2CHOA 1HJXA 4Y9PA 2YBTA 1F3WA 1F8IA 3DFOA 4C1NA 3ARTA 1XBVA 1GYMA 3H54A 1UWUA 3DOPA 2GJPA 3M0MA 1UKPA 3BOFA 3VPLA 5HBFA 5FF4A 4DUXA 2DSVA 1AJZA 4A3QA 2VZVA 2B4GA 3R8GA 1IF2A 4B92A 3LHTA 4HOZA 4C6BA 1XBXA 5I03A 2X2GA 1KWKA 1LT8A 3AJ7A 3G3MA 4GIYA 1VP5A 3GHRA 3NQBA 3R43A 3IGHX 2G4JA 4H6RA 4PB5A 2OO6A 3O2LA 3UESA 1MNZA 3WL1A 4YHGA 4EWND 2GDUA 7REQB 3CBWA 3K8LA 3N2CA 2A3HA 3VUPA 2YBUA 5F2GA 4H2HA 5FF3A 3WENA 4I6VA 3VMPA 3P6LA 1UH3A 3CZ8A 4UTTA 3ENLA 3RJYA 1OK6A 2FZDA 2Y89A 4I6KA 4UMBA 4W89A 4Z1AA 1TPEA 3PBYA 2INFA 1W17A 4KWUA 4L9YA 1L6SA 1DXFA 3NQCA 2PWVA 1KCKA 4FLOA 4HPJA 3EA1A 4C1KA 3G1AA 3VO0A 1TV4A 2VFFA 1JZ2A 4K1GA 5FA5A 1T7LA 3CH0A 2P3ZA 3BMVA 3W2LA 9CGTA 3ZYZA 2V0TA 2TMDA 3IV3A 1SMDA 3ITLA 1KLYA 1EJUC 2Y61A 4S3DA 4JIRA 3OW1A 1ODZA 1TPUA 5G4HC 6PTDA 1QHZA 3P61A 4FNRA 4MYAA 2PDFA 1A5LC 1XIGA 3CUZA 5H6HA 1CYGA 3D3FA 2YCIX 5G2HA 3K46A 3G24A 2VR2A 2WOQA 4HU3A 4NZ4A 3GKAA 1I9CB 1LBLA 5CZKA 4AEOA 5CPSA 1SSGA 4JN8A 4AZGA 3OG3A 2BFGA 4IL0A 5TF0A 3L4XA 2ZDRA 2YDQA 4NJHA 1UR8A 4GCXA 4O13A 2Z26A 3CTLA 3ZR5A 4LRTA 1XLFA 3COTA 4XISA 5AHMA 3UCDA 3SI9A 2WZEA 3GD6A 1OVDA 3VFCA 1R7OA 4U10A 4BY3A 1HO4A 2XVKA 4J3TA 2CU0A 1QPRA 3LGDA 4J9JA 3R0KA 3EWCA 3EZ4A 3VTRA 5BCAA 1LROA 1TX2A 3NIYA 1I1WA 1ALDA 4PTVA 1P6WA 4MDOA 3KAOA 4WKAA 2I5IA 3W82A 3NO1A 5HR6A 4YYCA 4O1EA 1SO5A 1GOXA 3GDBA 2GGEA 1PWLA 3WK1A 4ZE5A 4QSFA 3BOXA 3TYDA 4RPQA 3AIUA 5DMMA 2ZUMA 4E2OA 3B3DA 4YTTA 1FUYA 4IMGA 2WMGA 1J0ZA 3OZPA 3PWGA 1GZ1A 3QYSA 5AHEA 3BH4A 3LXAA 3KP0A 1S5MA 3G1RA 3NUKA 3BJTA 4HN4A 4LUSB 9XIMA 4ALDA 2BODX 4UTLA 4ACZA 1G4PA 1BXNA 3TV8A 5C7VA 5FJIA 4Y9NA 2ZUTA 4YVPA 1QR7A 3QYQA 3W1UA 2PP3A 4BF9A 3BAKA 5LSMA 2PDNA 1VKFA 3TROA 3AISA 3O7UA 1W9UA 1TE6A 3VNDA 5C8BB 2R94A 2WKJA 5I3GA 1TV5A 3V35A 2RDWA 1CXKA 5HATA 2BY1A 4GUHA 3U9IA 1JZ5A 4XAGA 3W02A 5ECVA 4FS9A 1OD8A 2V5KA 2VC7A 5I2UA 3MW7A 4D6EA 1GZJA 2WBKA 4M3PA 2NVDA 4DAIA 3PZUA 5B80A 1N8IA 3SRKA 1IE7C 2GDVA 4MWAA 2QF7A 3C2EA 5HNNA 2CZVA 3ZQ9A 2J9XA 1YDNA 1OT2A 5DEZA 4DBEA 4J7RA 3WDHA 1D3CA 2CHNA 1C91A 5A8GA 3WO8A 4DWSB 2G95A 5HAOA 4YTQA 1PKYA 4CEXC 1VCGA 3T07A 1TUXA 1OZQA 4WCJA 1SJAA 2YLLA 3QV9A 4EF8A 5EU9A 3QTPA 4KPLA 2A4AA 2XH7A 1FY6A 4IGHA 1EC7A 1E73M 1IQ8A 1QBAA 3URAA 3P2VA 2IMRA 2DV0A 1Z7AA 4JY9A 2GVEA 1KM6A 3FJLA 4H9UA 1V0MA 2W27A 2PE4A 2RAGA 3UWWA 4ATDA 1TSIA 1PPIA 4DXVA 3ANVA 3L4ZA 2WPGA 3ISIX 3U57A 1PHQA 4XAFA 3LENA 5D4YA 2EGZA 3WEMA 4JTUA 5LIUX 3FEMA 4IP7A 3B06A 1GQKA 4RW3A 3KVMA 1KLZA 2X7WA 3AO0A 1LLOA 1LQ0A 4GNVA 1U1UA 3IUIA 2REQB 1HJUA 3TQ0A 1QO2A 2O9OA 2FJKA 2GFTA 1V51A 2QCDA 4OFCA 1FQ0A 3B4YA 4NAEA 2YL5A 3AMDA 4TX9A 1NWSA 4AZHA 2XVGA 1XGZA 2IPGA 2QDDA 1FH9A 3APYA 4H6KA 5ABHA 1GVEA 1KGUA 3NQ7A 1P7TB 1JEZA 1CPUA 1EWEA 1VENA 4AXKA 2HPIA 5DT7A 1BYDA 1A3XA 4FF7A 1TTJA 2ACQA 1V3LA 4MZ8A 4FB7A 2QJNA 3MB9A 1B0IA 1XM3A 4GUJA 2ON3A 5HOSA 1XQLA 3TN3A 3KRUA 1LL7A 3UJEA 1LLWA 1AD1A 3KRZA 2GJXA 4OBRA 3OVQA 3WQGA 3C3NA 4A22A 4O14A 1M04A 2ZZ5A 4FXSA 3HV8A 1YBQB 4AYSA 1R9XA 3GH7A 2BVTA 2OYMA 5GQBA 4MHBA 4H83A 2WJZA 1H7OA 4GNKB 2ZYFA 1X8CA 4AXNA 1LL6A 3M0YA 4QLKA 3VOGA 3EKGA 4JIIX 1F5ZA 5MKGA 3SBFA 4NQ1A 4PUUA 2QR6A 4DO6A 4Z08A 3KL3A 4WSKA 1L6GA 2PA6A 5I79A 3RCYA 4B5XA 1UROA 5HNUA 3RILA 5I5RA 5E0CA 2I7GA 2R6OA 3B9DA 4MJ2A 3LHUA 1Z8AA 4M6PA 3W1AA 3DDMA 2C15A 4CN6A 1UMLA 2ZUNA 4WVXA 3N2TA 4DBDA 4CEUC 3WQDA 1B31A 1VC4A 3PG9A 4IIDA 2XWDA 2J47A 4WX2A 3PZTA 3OLGA 4LUYA 2VX6A 1JXKA 4MDPA 1J93A 2NQLA 5K9DA 2FGZA 2XH0A 4MJZA 3VYLA 2YB1A 5C9RA 4J3XA 5RUBA 2J6XA 3PHAA 6REQA 5H1WA 2FLIA 3GVVA 4Q32A 2MUCA 2NSXA 6TIMA 4AZBA 3W38A 1V79A 3KOXA 4HSNA 3QH2A 4PBFA 3HBLA 3EPNA 3WNLA 1JDAA 1FWNA 4W4QA 4F0HA 2WNNA 4NNBA 5TD4A 5BNKA 1E6QM 5LNWA 4LALA 4LW7A 2GSEA 5CPOA 1EO7A 3IACA 2HISA 1P4CA 4HVXA 1K4HA 1RBLA 1PUDA 8CGTA 2HQAA 4EIVA 3IVSA 1J6PA 3EXRA 3CUXA 4TV6A 2Z6JA 4UNLA 3F7JA 5CJMA 1IEVA 4XWUA 1TCDA 4XBJA 3CHVA 4ZFMA 4A29A 3RCMA 4NSBA 5A3HA 1LRNA 1XFBA 2ZUUA 1V4YA 2WWDA 1UMYA 1CDGA 2E6YA 2ZZ4A 1RBAA 1D2KA 1GJUA 2CESA 1OCQA 2P3EA 2QUTA 5AB3A 4JL2A 3IVUA 3P60A 3TONA 2RDUA 5JH1A 4A2SA 2VQTA 3NG3A 1XLCA 5LNVA 1O95A 2PC8A 3G1DA 4X9SA 3DFTA 1Q7MA 3VD9A 1XRFA 3CB8A 1XLIA 5CQ1A 2OYKA 3L5LA 1H60A 5EBAA 5KEZA 5C71A 4AC1X 4KS0A 4PUDA 4D72A 2C3ZA 1DE5A 5I3KA 1AW2A 4GHRA 1R2SA 1ZBCA 2OEMA 4GH3A 1JRBA 1V08A 4PMYA 4HZ8A 3MKKA 3OTRA 4HZ6A 3KE0A 4Q4KA 1E72M 3ONBA 2PGRA 2XN2A 3L0KA 1VBGA 4B5UA 2CXEA 2EPNA 4XX6A 2NX3A 4HHLA 1YYAA 4HMNA 4UFJA 1N8WA 2CLKA 3NL2A 3NJ3A 1K8XA 3TIMA 1UWIA 2MNRA 2E28A 2OLHA 4S3JA 3UXDA 2EBNA 3RMEA 3GS6A 2JFEX 2BY0A 4F0KA 3FFSA 3LSCA 1W3KA 3H7RA 4Q8TA 3TC7A 5C0QA 5I09A 1DXEA 4C6CA 1LM1A 3QW3A 4HZ7A 1EC9A 4NNAA 1CI1A 3H4GA 1W5OA 4I8DA 5E9AA 3WNPA 2Z2AA 2GWGA 1UR1A 2Z2UA 5CZSA 5AZ0A 1HXJA 4LS0A 3VKCA 1YRRA 3B9OA 2FB2A 2PDXA 3VGEA 1U5HA 2EF9A 1HFBA 2WMIA 3ICJA 4LY8A 3EX6A 4FO4A 4WD0A 4JX4A 3PZMA 1MRAA 4FNTA 2X16A 1AW5A 1HW6A 3LNPA 1VFUA 3R12A 1EHAA 4K68A 5I3DA 2ACSA 4IX0A 4E8DA 2YZRA 5CG7A 5FJTA 2I5QA 5K3VA 2YSWA 5E9XA 1I8JA 2X40A 1E1CB 1E15A 3DKLA 5AN7A 4QROA 4HB7A 1SR9A 5BZAA 4R3UA 3O1NA 3O6YX 4E6MA 1XRVA 1KM2A 3WFLA 4IF2A 2FPVA 1FP9A 2G3IA 5FF7A 4MKVA 1W1B1 1WV2A 4OBTA 5M3WA 1T96A 2FDMA 4PTMA 4Y8EA 3DHDA 4D8AA 3T7VA 1A49A 1J11A 2WHLA 3H23A 4DUOA 3PB0A 1LL4A 5MHBA 4HNTA 3MI6A 1K70A 4KCTA 4QS6A 6REQB 4LYPA 4J3SA 2NQJA 2GJNA 1A0DA 1GCYA 1HP5A 4QHRA 1J12A 1EOMA 5AECA 3WFAA 4YU1A 3KOWA 4QJ1A 3F5LA 3EWXA 4JX6A 1R46A 3PAOA 3QTGA 3M41A 3MVIA 3IGUA 1BG4A 1YXYA 2AGTA 1US2A 4HQVA 4KESA 1EP2A 3NCOA 1F6KA 4O10A 1SFJA 4ADTA 5FL0A 3LERA 3G8RA 4HSOA 1H2JA 1Y5VA 1ZS2A 4RZ5A 3SFWA 1REQA 3RLUA 4H9ZA 4WSJA 4ZENA 3FLUA 3B05A 3GFZA 1A5KC 4WJEA 2J8TA 1CXIA 4O0KA 2YIHA 4PODA 1TMHA 3HMJG 3P0XA 5D33A 3HGOA 5CPQA 2UY3A 1VPQA 1B3WA 3ARWA 3WL0A 4CNOA 1S38A 4NJIA 4AWUA 3L4YA 1VYRA 3M0ZA 3HMCA 3R8HA 1EPVA 1XC4A 1AL8A 4A3HA 3WQOA 1XKYA 3A3HA 2ZWYA 3G1YA 4LFYA 3SCVA 3OLDA 3N17A 3ZS4A 3W85A 3KOYA 5MKGB 1VIZA 1PCWA 2OFJA 1FHVA 3GAKA 1JFXA 4DBUA 2ICSA 3CIXA 3HOJA 1JZ7A 3FAXA 2DZBA 3LCHA 1ZQ5A 1LTDA 2TYSA 2BHUA 2QGHA 1H1NA 3UPBA 3QC3A 1BTCA 4ICCX 1DKWA 2R91A 4O54A 1H5VA 4GBUA 3DG6A 1EZWA 2X41A 1Q2SA 1KFCA 4AX6A 5BW6A 1QT1A 4P8VA 3B8SA 3CXOA 3QMTA 1K9FA 4NAFB 4W86A 4AEEA 2ALDA 1JD9A 2WJEA 3BAXA 1A5AA 1K1DA 1NF7A 4LJ3A 4RDZA 4Z0JA 1EJWC 3OBKA 1SZRA 3H4XA 2P10A 1P5BA 4HJFA 3WK3A 1XIJA 2Z1BA 1UR0A 1YLVA 1PKMA 3GDTA 1WOAA 4HMCA 5C54A 3SURA 1E6ZA 3RPTA 4JAWA 3RLVA 1FWJC 1XFCA 4PEKA 3EX2A 4HGXA 1A0CA 3DYMA 2WMFA 3MCMA 3TR2A 2VGFA 4HYWA 4AUBA 1NU5A 3ANUA 3N3MA 3N1AA 3TXVA 3W9ZA 3MDUA 3G3DA 4XV0A 3EXTA 3AIWA 2QCEA 2QV5A 4HA3A 2XWEA 2A7NA 4M6QA 3V0TA 4PL2A 3U2CA 1V8EA 3PZ9A 4LRSA 2VELA 2IQDA 4NT0A 1U5VA 2INEA 3E0WA 3W26A 4Z1CA 3PR2A 3WLHA 3NQ8A 2IQ0A 1U1JA 5DMNA 5I24A 4JEQA 3WDRA 2B0MA 4QX4A 3ECQA 4AD5A 1EJ7L 2FJUB 4IQLA 3VI2A 2BB0A 3E2VA 3QZAA 3S2JA 3CH9A 2A21A 3OYXA 3MYPA 3FNDA 4PRRA 2I16A 3STFA 2Y85A 3WG6A 3K1GA 3KUMA 3MUAA 4C65A 5FEXA 4JL1A 4RKAA 4IUGA 1S2WA 1I0DA 4Q4OA 1WXJA 1PIIA 4Z2IA 2DZTA 3WJZA 2P50A 1TR9A 4RW5A 3R11A 5T9CE 3VNJA 3PY2A 1M5WA 1O6IA 1XQKA 4WDUA 3OIHA 1DJZA 4A21A 3MKCA 5HDRA 2VUYA 4JOMA 1NWUA 4E5TA 5I6SA 1FOBA 3LHZA 3UP8A 3GG7A 3VDAA 2PMQA 4F9JA 1JZ6A 2CEQA 4AG0A 3UWVA 2XUCA 4KIEA 2Y5JA 2JKAA 2WQDA 3GHSA 4N6EA 2GK1B 1ADDA 3KBWA 5DMYA 2CLFA 1JAEA 1WXYA 3GKFA 4AWEA 2W66A 1TO3A 4IZGA 2QCDB 1FWWA 3WYZA 4LCRA 2DVXA 4IQEA 2PRLA 2C1HA 2XYLA 4ZQPA 5A6JA 3M4HA 4K1WA 1Q3NA 3HIJA 1EH9A 5KZMA 1OYBA 2W92A 3TVAA 4MB3A 1KTNA 1B57A 4XO7A 5G4EA 1WZMA 5HMEA 3W23A 1BGGA 3PBVA 3OYZA 1F3EA 4A6GA 4K8GA 3NSMA 1OX6A 2OR2A 2QEZA 4LAKA 1B54A 3TFXA 1TTQA 4PULA 3IIZA 3U4FA 3B0VC 2DZSA 2FFCA 1Y5WA 1LUCB 4O4WA 4MJ4A 3S47A 4US6A 1SVDA 4FHAA 1MNSA 2RDTA 2VZUA 2VKZG 4NJKA 4HJWA 3R13A 3OU8A 5PTDA 3XISA 4W5UA 1K6AA 3UWQA 1BSLA 4XTIA 1OFBA 4ACZB 1NSJA 3AZSA 2GGHA 3N04A 4IGMA 3LPGA 4ZBCA 4TMCA 2A85A 4PUNA 3B4UA 3PS7A 4GX9A 3RR4A 4X2PA 5LHEA 4ZQNA 3W7DA 5I00A 4PMXA 1MQPA 4CNUA 1ML1A 3TUUA 3OJGA 1XYLA 1B9BA 1V3IA 3RPMA 2J7EA 1JF5A 2XH2A 1YTDA 2PRMA 1AMYA 2V3GA 4GUGA 3BAWA 5E0FA 1F8MA 1E0WA 2FHCA 3DENA 4ZOCA 3PUGA 2ZX5A 5AHIA 5AC6A 1IIHA 2A3BA 2VQUA 3IJ7A 2Z28A 2Z27A 4KQNA 5JBFA 5U4NA 4EXBA 5FF2A 2J66A 5C9WA 4LS2A 4NX0A 3UNDA 2OKTA 3ARPA 3W7OA 4NYUA 1DJYA 1WZLA 1EJVC 4ZVJA 3A5VA 5D05A 3HPSA 3WH5A 1LLZA 1LG1A 1MUWA 3QGKC 2W61A 3N34A 3ARXA 4JFUA 4NXKA 4QRNA 4MKSA 1XKJA 1FHLA 5D32A 2CERA 1UUOA 4B3ZA 1CGVA 2B81A 4GVHA 4REQB 3FJ6A 3QR1A 4JYDA 2VL4A 4HU8A 1K03A 4PA8A 3VDGA 4KWOA 1J0IA 3QN3A 3H4WA 4B9YA 4OT7A 2ZE3A 5C9XA 4O12A 1BLIA 2V69A 3BLPX 1U30A 1XIBA 3WMSA 1XDLA 1MDLA 5AY7A 3BICA 4Q8UA 3G1HA 3WDPP 2VDIA 4UQAA 3OB8A 3U8GA 1A5NC 1G4TA 4PH6A 4DY1A 3DEQA 4I9MA 3VOJA 2G41A 5FJJA 3RF9A 1LORA 3I3BA 5F4SA 3ZVIA 5BU9A 1S46A 3LTPA 1TX0A 2X1UA 1TV8A 3GTIA 3GWQA 4GY7A 4BQ2A 3GBEA 3OHIA 3SIZA 4HCHA 1Q6OA 3OG2A 4LUSA 1KR0A 1G69A 1RR2A 3PBMA 1J9YA 3GTFA 2VX5A 3P3BA 4EE9A 1POJA 1VJSA 1BYBA 4MWAC 2G3FA 3WQVA 1KA9F 1L6WA 3VCRA 4IL2A 3VNZA 3GXMA 1UA3A 2QAPA 3IIVA 2YFOA 3EOSA 1FVPA 1E0UA 4ZE4A 4AIBA 1G7UA 1UIOA 4MLRA 4B4HA 5I3JA 2WSPA 3WQ6A 1ICSA 4ZTYA 1VJZA 3OLIA 5LNRA 4RXFA 1IT0A 1E43A 3HB9A 5IM51 4F0RA 1HG3A 3WUBA 2C1IA 1W5NA 4GYPC 4CCEA 1Z3NA 4JQ4A 1LP6A 4L65A 1TPFA 4IG2A 3G1FA 3QKZA 2BZNA 2XFYA 3L2MA 3LBOA 3BG9A 4MOZA 3MMUA 3NL5A 4NI3A 2H8ZA 3CASA 4CNSA 4LV4A 1DTUA 1NQ6A 3ABQA 4WIWA 2QHAA 1NOUA 1RALA 4PCFA 5CCZA 5CAHA 4CNPA 2Q01A 2QUUA 5DY3A 2H8XA 1DWFM 4QE1A 4QEEA 3TWAA 3EMZA 2BVWA 3RUBL 1UH2A 3VIGA 4K7YA 2XVLA 3U5UA 3MDWA 1WDDA 1F6PA 5A8PA 2DH2A 2C19A 3OVGA 3Q45A 1LDCA 1UWQA 3W76A 4ZCWA 1XV8A 3GZ3A 3LLXA 2BS9A 2ZRYA 2NLYA 4QXIA 1UHVA 4RX0A 1C9DA 1WB0A 4GI8A 1V0KA 4GXMA 1EDTA 4JYEA 1JL8A 1UW9A 3GR8A 4CU7A 1TCMA 4LVFA 2PGWA 2XHYA 3CEUA 2ZUWA 3N73A 1P1XA 4JTSA 3KFTA 1TR1A 1JAKA 1UPMB 5LYRA 5HPCA 4M19A 5LIWX 3MS8A 2FZ8A 3B8UA 4JFTA 2IKIA 3R89A 1RQEA 3RAOA 3BGGA 1CT5A 1KFWA 1DJHA 3JW7A 3WF3A 4GOAA 3CMGA 3POCA 3S0CA 1P0BA 1RY8A 2D2HA 4TX8A 3ZWTA 3BARA 2G0WA 3W00A 4U5KA 2W63A 4B5WA 2J7FA 4DO5A 3SCUA 4DHGA 1ZJAA 1R5YA 4TUFA 4MWAE 4PEEA 3VAVA 1H0IA 1GOWA 5AYBA 3TA6A 5A6TC 4E3TA 1ITUA 1E55A 2AOSA 2O9PA 1QFEA 4S3BA 1YMYA 3HFTA 1V02A 1PTDA 2YCJA 1J2BA 3T09A 3N6QA 4TO8A 1TREA 1Z41A 3W1MA 2YBVA 2QCGA 5D9MA 1KRCC 2J74A 3D0CA 3W7EA 4Z1YA 1UP0A 1CZ1A 4JNMA 4D9PA 4KFOA 2RKXA 4DZIA 2PWEA 3LG3A 4AIUA 2BBFA 3AHXA 1UUQA 1UJQA 2QUMA 1BF6A 2WKLA 3C52A 4CQ9A 1E3XA 4UTIA 3WQ8A 5HQMA 3VNLA 2E40A 4P7OA 2Z1WA 3PBGA 4M6UA 1FWAC 1VD6A 1WQ5A 1FWSA 4B3LA 4ZODA 3BZJA 3VM7A 2VRJA 2X0HA 3FV9A 4EP8C 1F61A 3Q65A 4LVGA 3TDFA 2PLJA 3WMBA 1BYAA 4Q4MA 3AJXA 1FWCC 2ISWA 3IIPA 2ZA1A 1S2AA 4LSBA 4CN4A 2W3ZA 2I57A 4LUJA 4GVIA 2V3EA 5DY2A 3GM8A 4I5UA 3O06A 1PCKA 4M81A 2O7QA 3DBPA 4UFLA 1C29A 3STGA 2VJXA 5CZTA 3UCCA 3GVQA 4DRSA 1VJIA 1UWAA 4HK6A 3E6EA 2ISSA 1QOQA 3V16A 4BQ3A 4K6AA 3RX4A 4CLMA 1J4EA 1DWJM 1KTCA 1GHRA 2VMFA 5LNUA 2D3LA 4C7DA 4QAWA 4ADSA 3TSDA 2VVSA 1HJSA 3DFYA 1Q65A 2VWSA 5AYYA 2PDMA 3CPRA 5CSSA 2HBXA 3E0IA 4N7QA 2V9DA 3RRAA 2TRSA 3WUEA 3NGFA 5K9XA 4W7UA 4FK9A 1NF0A 2OODA 1RUSA 2WSKA 4G1NA 4GY0A 3AALA 1UBSA 3TXZA 3TC3A 3WH8A 4F2BA 1H63A 5KETA 1XUUA 3GXFA 5EMYA 1IEWA 1R86A 3EDKA 3TFCA 2IW0A 2GUBA 5G4WA 1W3LA 3H7VA 3VOIA 4NJGA 1G4EA 1Q6DA 3GVRA 2HMCA 2UBPC 3UZ5A 1H4PA 3FYPA 2QPSA 4C6LA 3QFEA 2F61A 4MPQA 3WUGA 4P8WA 1SUXA 3STCA 1B3XA 1FCUA 1V0LA 4IH3A 3P84A 4M8UA 1LRQA 2EHHA 1DORA 1E51A 2HNEA 3DHUA 4FX8A 4YWIA 1ZJHA 3R0UA 4C6FA 2QS8A 1E4IA 8XIMA 4FOJA 3UQNA 3GXTA 3UWYA 1UD5A 1UKTA 3QMRA 1JCTA 4UMCA 2DZUA 3EMCA 3N6HA 4Z1BA 4HOXA 3I10A 3PBUA 2KZHA 3QW4B 1VLWA 1AH4A 3QF0A 2DZVA 4DYKA 3UR7A 1SPQA 3AHZA 2J7CA 3L65A 1R3RA 3R6IA 1QTWA 1I4NA 3UZXA 3C0QA 5DN1A 4ZMGA 1KBLA 3GVGA 1LJYA 2GQ9A 3G1SA 4M80A 3FW6A 3BC9A 4GZ7A 3I6TA 3GH4A 1VFSA 2E67A 4EOUA 3VNIA 4L6DA 3PNZA 3MWCA 3GHUA 4CD7A 2JALA 3SQSA 1V77A 2A1YA 3FA3A 1NFPA 2OGJA 3WDIA 1VGAA 5E93A 1EEXA 1ZP3A 3M0HA 2GVLA 1F7BA 2DQXA 3GHTA 1VPXA 4IPLA 1SO4A 2VDGA 2ADAA 1ENUA 1XIFA 1PX8A 4L61A 2ZTJA 1XX1A 3N14A 2X0YA 3AHTA 4JTTA 4HYVA 4C6DA 2ZZ2A 4P2VA 2X1RA 1YPFA 3FN9A 1LOLA 1Y7VA 3Q4DA 4JIQA 1EJSC 2QJHA 2NQ5A 2WXDM 3RIKA 2V5LA 5REQA 2VR4A 4OIFA 4B4FA 3BW4A 3F5KA 1WDPA 1BKSA 1M3UA 4BA0A 2CKRA 4C6PA 3JR2A 3P82A 1E9IA 3G8EA 1WKFA 3IJIA 2PODA 2VOMA 3NZQA 3W1TA 3ARZA 2CPUA 3KTCA 2PRHA 3QKEA 3CK5A 3KX6A 1X1NA 1MQQA 5XIAA 4EAMA 2PDIA 3L67A 1SZGA 1H3GA 4M1BA 5A8QA 1T8XA 2HJPA 3CV7A 2ZVIA 4ZB2A 4QITA 1OX4B 2VOTA 5DRCA 1PZ1A 1R9YA 3BAJA 2F2KA 3H7UA 4Z2JA 3DG7A 2JEPA 2D2GA 1RP9A 3PJXA 3W7LA 2I9EA 4YL2A 2O56A 2BV9A 3APGA 3RCNA 2QMKA 3C61A 2Z0IA 3ZJ6A 1F9CA 3VX0A 2PF8A 4H8VA 4ZSUA 3SGUA 3U3HA 4G7FA 4ZTXA 2QJIA 3DU0A 3MPGA 1JGIA 4GYJA 4HIBA 2O4QA 3WLLA 3EOOA 1EYEA 3ZFHA 3B9EA 2A0NA 1DVJA 4I7WA 4XKYB 2BVYA 2ODOA 3TN5A 3CUHA 1S3TC 5AZ1A 2Y1HA 1XGEA 2BDQA 2FZBA 2Q8XA 4MAZA 5CGMA 1W6TA 5BU6A 5H8PA 3R4IA 3RLGA 1W9XA 3URQA 3O16A 1WOBA 1H50A 5BROA 4J3WA 3W2UA 4OBSA 2NV2A 1A50A 3WSUA 1E0TA 3KW3A 4BI5A 1OEPA 5E5CA 5CBBA 1NDYA 4MLJA 3I7SA 4L1GA 2D2OA 3MUIA 4RV3A 1X7FA 1POKA 3LCFA 2ZXBA 3M5ZA 5A6AA 4LV9A 2JKEA 3WBWA 4Q8MA 4W84A 3EA3A 1L2QA 1MW2A 1XLJA 3LMZA 1US0A 2HBVA 2EPOA 1KBBA 3DIPA 3VOFA 3BSMA 1QASA 1MDRA 4R33A 1WDRA 4C6JA 4LH8A 1GORA 1BHGA 2PTYA 2L5HA 3CAQA 1VFTA 3DHPA 3AIEA 3MP3A 3BGJA 1ZBVA 4GFIA 3SY1A 1I2NA 2O4MA 4WJ8A 4A2RA 3T42A 3S9YA 3GG0A 1PWMA 4S3AA 3A4AA 5C9UA 4C7GA 3MYOA 4Y96A 4B5VA 1KQYA 5FESA 2OLAA 3O8AA 3VCCA 3T40A 1PZ3A 4KBXA 3OIXA 2BOGX 4LAUA 4CQ8A 2XN0A 4GUFA 3PNUA 3W1XA 2P1FA 3SSJA 4UZSA 3M0VA 1XJBA 1HKJA 2PWGA 3FA4A 1KRMA 3MU7A 2J7HA 1GTHA 2YA1A 3HV9A 5I0DA 2PCEA 2OKOA 1FWEC 4RJEA 2VD9A 1CW2A 2YFNA 1E4MM 2YL9A 4I3GA 1CLXA 2Q3RA 3VZYA 3BAIA 3D3AA 4XUGA 1PJ9A 3EX4A 3LD5A 4L1XA 3M44A 3GZAA 3WEZA 1WPCA 1ICQA 4UNKA 4LNCA 3WNOA 4AQLA 2QVNA 4XZMX 4GQGA 3PPGA 1OFRA 4K7VA 1V6XA 1R8LA 4QSHA 1B9ZA 2O55A 2R1NA 1Q6QA 1OC7A 1E71M 2TSYA 4Q7IA 4KEMA 1XC6A 3T8QA 1KXVA 1Z9AA 4ICNA 3I65A 5JIPA 1NH6A 2WZMA 4C91A 4NKCA 3E1F1 4US5D 2QT3A 1WKEA 2AQOA 3VDBA 1JPHA 5TIMA 3FY1A 2D1ZA 4Z17A 2PWDA 3IJDA 3ZLGA 3DHFA 5FJOA 1U83A 2BTMA 2H9AB 3H2AA 3CO4A 3GW3A 1G5AA 1RZMA 1CXLA 3E96A 1JPMA 1BSIA 1ISWA 4GYFA 1L8NA 2JIWA 3VX1A 1ADSA 2OTDA 3LRLA 4KRUA 1XIEA 2PLKA 1ZBWA 5FJUA 3MZNA 2ANUA 1S5WA 2RHGA 3WD3A 3ZSTA 1HT6A 1OF8A 4A8IA 1QBBA 4KRZA 3CHDA 3SB0A 5BYWA 4EK7A 2XSBA 1RA5A 3QR0A 1QU4A 2C91A 3DC8A 4WRHA 5HINA 2ABBA 2VM8A 4HOWA 3IV8A 4ZB5A 3OOQA 3QEZA 4IMDA 3VMNA 3NURA 2BGNE 3KVLA 5AC5A 2GPTA 2J7DA 4XZIA 4AWTA 5E1QA 4ZGYA 4ERAA 2WHJA 4JPGA 1EGZA 2E3ZA 3VDCA 4XO6A 2XFFA 3K30A 2AL2A 1E9ZB 1WDWA 3T9PA 4OKDA 5B7ZA 1YXDA 3AHVA 2PP0A 4BI7A 2PBGA 2YW4A 2BXYA 1Z48A 2YX0A 3SCRA 3KBNA 1K7FA 3HQOA 1XCWA 3RU8X 1ZTVA 2A7RA 2V3DA 4WY0F 2AMGA 3TE9A 1EA0A 1RCXB 4TU1A 2DIEA 1GOQA 2WZIA 1SFTA 4ASTA 4Q22A 4PMDA 3ERPA 4B5SA 3M07A 1FP8A 1TRIA 1YDYA 3VIIA 4YMZA 4C5YA 4PTDA 1OD0A 3BLEA 1X39A 1IEXA 1QPKA 4L7ZA 5IXEA 5FOOA 3FEQA 2ZA3A 2P76A 2D3NA 5F2MA 2DW7A 2W4XA 3VNKA 1OB0A 2ZZ1A 1M7XA 3KBSA 1UD4A 3FOKA 2DT2A 2OOGA 3W7GA 2Y2WA 1YHTA 3HA1A 2ZZ6A 1JDFA 5A8NA 3VGDA 5I02A 1OK4A 3MBDA 1WYIA 2EPKX 4FXJA 2OVLA 1KD0A 1W9DM 3W7PA 2ZKMX 2WMIB 4OVXA 3UFYA 4Q33A 1P0DA 1OX4A 3PBWA 3ZJKA 3IAPA 1O7AA 1OCJA 4G7EA 5HR7A 5M5DA 5LIKX 3U2OA 3THQA 1YPXA 5CSRA 3T0AA 5IDIA 1GOIA 1R38A 5I23A 5HXMA 4IIFA 4CD6A 1QJWA 3B9NA 4JTKA 2Q02A 3RM4A 3F5JA 4U33A 3S5OA 3C5QA 2Q71A 5HMDA 4Z2GA 1BTMA 1UJPA 4R7JA 3W72A 4GI9A 1RVKA 1ZCOA 1EHNA 2HV5A 4XVEA 1OIMA 1X6UA 4GYPA 1NELA 3FIGA 4JIHA 1WX0A 1OFAA 2ZUVA 4H7CA 1KRAC 1D9EA 2NQ9A 1ONEA 1U1HA 4CNTA 4K38A 1HJQA 1HJVA 3VKAA 3VKDA 4NRSA 5CBIA 3RITA 2C79A 3HO8A 2JIEA 5T91A 1G67A 4Y90A 4OV4A 2OXNA 3RXZA 1JPDX 1XBYA 3ME3A 1EF2A 3B8WA 3I4KA 2QZRA 5KZDA 3I6RA 1QK2A 2WVVB 2HWGA 5M17A 3QPEA 1TIWA 3RR1A 1VF8A 1VS1A 3SCPA 3J7HA 1TJRA 4I5RA 1KGXA 5CPTA 2CIPA 4MM1A 3ZVHB 3W2MA 2VEFA 4LBRA 4NL1A 5A6SA 3JVAA 4LU0A 3PULA 3FVDA 1UR9A 4Y2WA 3C86A 2WC7A 4J3VA 5XINA 1FH8A 2TAAA 1CX9A 1J6OA 1WAUA 2PWHA 4H1ZA 1ISVA 3N18A 4EVZA 4DAFA 1G7VA 5DCBA 1DQXA 1SM9A 2J79A 4XAZA 1LG2A 5TNVA 3CV6A 3AU2A 3GXIA 5LKYA 1W1TA 3OA5A 3UZWA 4DN1A 3DFNA 1YTKA 4A4AA 3PZOA 4F0LA 3C2YA 2P53A 4X63A 5C2XA 2PDKA 3AU6A 4HZMA 1TWWA 1E1FA 3MHUA 1MFVA 2GUUA 3LBCA 2J4GA 1TJ1A 1UZ1A 3AFBA 5LHFA 5LGZA 2WYSA 4J35A 4LVBA 1TJ2A 4HN8A 1RJRA 3OA3A 1RH9A 2ZRXA 3L4WA 4IMFA 1M1BA 5HULA 5IHSA 3KVJA 1Q13A 4X3ZA 3V1PA 3LHYA 4F9DA 2QLYA 5FACA 4HPGA 1DJIA 1SFLA 4KCWA 3G0SA 3KBJA 2QAFA 3VE7A 2W9MA 4FOKA 4Q8PA 3SUTA 4PE8A 1YQ2A 5M03A 3M5YA 3AMCA 1QNPA 4TVUA 1XLGA 3WBXA 2AKMA 4GJ1A 1HVQA 2E5CA 1PKNA 1IWAA 4H00A 4GG9A 4MZYA 4DNMA 1QI0A 3DI0A 4DJEA 2RJGA 4UBPC 2Y62A 1XLHA 1ICPA 1B3ZA 2RH9A 4EX4A 5D9OA 3QBUA 4AH7A 4J4KA 4FPSA 1VZWA 1QPOA 4KW2A 2QUNA 2DDXA 3L23A 2OYLA 3L68A 4DZAA 1PVNA 1TRDA 1W8GA 3EDFA 4IUOA 5DELA 2VVNA 3G0XA 3GXNA 1A4LA 3AROA 4LUTA 2VXNA 2OOFA 1EQPA 3W2KA 2PDYA 3BJFA 3B9AA 1XIIA 5LIXX 2E1DA 1AUSL 3AXKA 1M53A 2HK0A 2B7NA 3KCLA 1ISYA 1E5NA 3NL6A 3IEBA 1Z89A 3L4UA 1JCYA 4UTTC 1HKKA 4GO8A 3P8IA 2J9ZA 4AY7A 3EB3A 3HPZA 5CPMA 2Z7KA 3A4XA 1FX6A 3WQCA 1FRBA 2YJQA 2C16A 1KBJA 3AS0A 2PCQA 3NEHA 3KDNA 3FKKA 1AMKA 1EP3A 1TG7A 3ES8A 4Q6XA 3SY5A 3SEPA 3UWZA 3VOHA 4N6FA 3T2OA 3BLDA 2C0AA 1TTPA 1KFLA 4HA1A 1LQAA 1TA3A 4B9ZA 1JYVA 1VEPA 1XYMA 2E77A 2XG9A 3NPUA 3PF3A 1M7OA 1TV7A 3VDHA 4B16A 3VXGA 2FZMA 3BVJA 1XUZA 3KHDA 4QCEA 2VC5A 3A22A 5HUOA 4L9ZA 1E5JA 1VHCA 2P0OA 5HJXA 5EMMA 4PTNA 2J75A 4DB7A 3W6MA 3FDGA 1U22A 1EDGA 4LY4A 3V1HA 4ZOAA 3CWHA 3B97A 3QLDA 3H2NA 3RO6A 3QQWA 3CLWA 5KSWA 3L12A 1V7YA 4W8BA 4TVCA 2J9YA 3RG6A 4AHPA 3ABOA 1EKOA 1IV8A 2HE5A 2OQYA 5DCDA 1RJPA 3DH7A 1W1IE 4N4QA 1Q8AA 4BHYA 4GMEA 3TW7A 5DXYA 2HTMA 4IQJA 4P8XA 1KWGA 3CIWA 1G4SA 4QQ3A 3PJTA 2XIIA 2E9BA 3E3HA 2WCSA 1O12A 4NY2A 1G94A 1OGGA 5I77A 3R1ZA 4FMVA 2IKHA 1FDYA 4MADA 2CHRA 2YDAA 2F9RA 5H8MA 3LK6A 3L2IA 5G1MA 2O92A 3TTOA 1LCOA 1TWSA 4PMVA 3URBA 3GIQA 4ILSA 3R94A 1LWIA 3GC4A 3W7KA 4PB3A 1W5MA 4XAYA 1MUCA 3WN6A 4WZHA 2Y8VA 1HKMA 3NXLA 4JCLA 1R30A 1J96A 4GE8A 3P80A 1RPXA 1L6YA 5H2ZA 3HURA 4E0CA 2E9MA 4BWLC 3SSZA 3NEVA 1N8FA 3KTSA 3NOEA 4PUWA 3LXCA 1K7EA 4MUZA 5J8LA 4O1AA 1VYPX 5ABGA 4LQ1A 2NXIA 4MF4A 1JVNA 4WR3A 4N9CA 3LXBA 4Q6JA 4S39A 1A3HA 3WIJA 3VD3A 1GJPA 4L1WA 4LNYA 2WV8A 1T99A 3C6CA 1CGUA 4CQCA 1JCMP 5K4ZA 2OELA 1QATA 3OGVA 2WKGA 3QV7A 1M9HA 1NFBA 3ZR6A 1U5JA 5KMYA 2PGEA 1J0HA 5A2BA 3QOMA 4L4PA 4IT1A 3TSMA 4V28A 2CLMA 3FDKA 3GNXA 2YYUA 1TJPA 2ABAA 4UTMA 2ZRWA 3R5EA 1TVLA 1VYSX 4URIA 4WKHA 2H3BA 3T8LA 2CLEA 3LZ3A 3UVIA 1QK0A 2GQ8A 4UCFA 4QDWA 4BKNA 3C8NA 3T55A 2X05A 2AGKA 4IXXA 1RPKA 1KM0A 2AQWA 3R58A 4NZ3A 1P43A 2PAJA 2V2HA 3SGGA 2VI0A 4QDPA 3BE7A 1OIFA 3UZZA 1V0NA 2OQLA 4UMAA 2D22A 3VU2A 4EPEC 4XK2A 2EEXA 3OGRA 7A3HA 2ZX7A 1XLLA 1EJRC 3VGFA 3W81A 1R2RA 3H24A 3PZVA 5LXXA 1BWLA 4CU8A 2DIJA 3UCQA 4LAZA 3TAKA 3TP4A 4O8RA 1H7PA 4O0QA 2QXWA 2CZEA 3THAA 2H6RA 2E8ZA 3GQYA 4IP4A 2J6VA 3OO2A 3S5NA 1E0VA 4M1RA 4FXFA 2RJHA 2Z1KA 3B0UX 2Y63A 5DT5A 3OQ8A 3M64A 1NFGA 4RDWA 4C1LA 1PDZA 3RN6A 1SYTA 4JKKA 4UFMA 1RBOB 4GPNA 1RXOB 3IVTA 4IFKA 3GAYA 5EYWA 4GUIA 3UETA 3G5EA 5A6MA 3E2RA 3IWPA 4JXCA 4H9YA 1I1XA 1IR1A 1OJXA 5DBTA 3B8DA 3NQ6A 4GQQA 4D1IA 3WLPA 3E12A 4LGXA 5DBUA 3U0HA 4FX7A 3LGGA 1X6LA 3MANA 5A6BD 2FPTA 1QOPA 4YS1A 3VABA 5AHNA 4MNKA 3UY7A 3NO5A 1UA7A 1N82A 3V4BA 7REQA 3U2ZA 4UTUA 2V6AA 3UJSA 1GQNA 4MB1A 5A1AA 2EO7A 5DRIA 3FYYA 4A8NA 2WB5A 3I4EA 4L6HA 4F3HA 2Q8ZA 4GIRA 2D69A 1JR1A 1OFQA 1SSDA 4G6CA 4ORIA 3DCPA 3RYSA 3WNKA 3WJWA 4F48A 5I3IA 4KCUA 4OHQA 3UR2A 2UV8G 2FZ9A 3A47A 4IJCA 1XIMA 2CLIA 2PU0A 2E4TA 3WUFA 5BXSA 4MGGA 2C6QA 4U3CA 1EYWA 3BGAA 1DJWA 1XSJA 3IRSA 4Y7EA 2ALRA 3WLMA 3ALGA 3LCXA 5E0KA 3T2PA 1UASA 1FWIC 2W0UA 1WO2A 1Q7ZA 1MVYA 3CNYA 5CLWA 4FNUA 1BG9A 3EEGA 5HUPA 3QV8A 3H6OA 2BOFX 2VX4A 3FJNA 5FAJA 4UTWC 4HD5A 3W75A 1BWKA 2XIMA 4DLMA 1BF2A 4PMRA 1QW7A 2HNHA 4P5UA 2XVPA 5FIPA 2BHYA 1BVNP 4XSLA 3MJYA 1DWGM 3FGCB 2CZ5A 3BTNA 2DSWA 2P8BA 1AJ0A 4W5ZA 3NR0A 4AFYA 5HK4A 3AIQA 1OHLA 3V5FA 3W1NA 4LANA 5KTLA 1R9ZA 1WKDA 2RFGA 1WCGA 4XZHA 4ZXLA 2A3LA 1JF6A 1V6WA 3E02A 2PWUA 1AG1O 3WLNA 4PYSA 1P6BA 3W70A 1VFLA 2OEKA 3DAQA 4PBEA 4HPNA 2FVLA 3WMLA 3PUEA 1UPPA 4IM4A 1BQGA 4TVDA 3AHYA 4Z42C 4GH1A 4XD5A 1PL9A 3DZ1A 4JIPA 4C6QA 5L6UA 3U2EA 3TCSA 3VMOA 1CBGA 5FEWA 4AISA 2Y5EA 2UWFA 4UOQA 3WLJA 2QGYA 4JY8A 2QCHA 3MY9A 3BMXA 3CHEA 3QOKA 4BQ4A 3S5YA 3NQAA 2PDCA 4JX5A 2F8QA 4UNIA 1ONXA 4JNYA 3BL3A 4NX5A 1PZ2A 4NZFA 3LCIA 3BQ5A 2RGMA 4EAYA 3OPSA 4ZFCA 8RUCA 1VR6A 3HTWA 1GEHA 4AZ7A 1K9TA 1JCXA 3VILA 7CGTA 2ZDSA 4AIEA 5K4XA 4FAMA 2CLOA 4FLRA 3I7RA 1UWSA 4S3EA 3LM3A 3KWSA 2NSOA 9XIAA 4UFKA 1G0CA 2JKPA 1C93A 3OBAA 4TR9A 1CECA 1X1OA 4UB9A 3TQKA 4GABA 3TR9A 5A2AA 3SUWA 1GK8A 2A79A 2B7QA 3L0NA 4REQA 4S3FA 1Y5XA 2J78A 3TQVA 4DIAA 3N4FA 1KFBA 3WEOA 3WLTA 1WDQA 3E49A 4ROPA 2HK1A 3NOYA 3M9YA 2CFFA 3M47A 3B8VA 5I78A 5IBXA 3PTDA 1QAPA 5XIMA 3NZ1A 3LHVA 1KB3A 1MZRA 1XH2A 3G77A 4UQ9A 4FNSA 1ZFJA 2CBJA 1PYMA 3LUTA 5D2VA 4ERGA 1E6NA 2QUVA 3APTA 4ZQOA 1UKOA 4YHEA 3VGGA 5EGRA 4WLCA 3NA8A 1ECEA 4GGBA 5DANA 1HKVA 5EB8A 4KEUA 4QGCA 5HJYA 2B7PA 2IKJA 1J8VA 4H7ZA 4KRTA 5IRPA 3EB4A 3S42A 4BEUA 4GNJA 3TTEA 1AZ2A 2PTWA 4H9TA 3C2RA 5CJNA 3PTMA 3AZRA 4GA8A 4O8AA 2FFIA 3FHQA 2ZADA 2NQHA 4FEZA 5HNTA 2QNEA 5L9FA 3BJSA 1UD3A 4PMNA 1NTHA 1X1ZA 4CVUA 1REQB 1RD6A 4J40A 3PTKA 2DORA 4WHBA 2W6RA 3LPPA 2Z7GA 3W53A 4MNLA 4M7SA 3S2LA 4JFWA 3HFYA 5E6ZA 4JFSA 1PXGA 3UR5A 2A3EA 1MYRA 2HDJA 1MQRA 5G5IA 2QJMA 2X7VA 3TTQA 7ENLA 1V3KA 3NQMA 4AZCB 2IQTA 1UOZA 2F2HA 2XM1A 3C0SA 4INFA 3S4TA 3SCWA 1OC5A 3ARYA 4HPHA 3WDJA 1UWTA 3NQVA 5CG0A 4WGHA 3URNA 2GOKA 1IHIA 1FCBA 2X30A 3N2XA 4DM2A 3PB2A 2YLAA 3UZYA 1A80A 4HA0A 5HWNA 3UGRA 4CU6A 4LEQA 3HU7A 4PRTA 2V2DA 4QDMA 4R88A 4E2DA 3OODA 3ZMRA 1KBIA 2G8ZA 4I7UA 5CPLA 1B1YA 1BD0A 3ID7A 1ODUA 3DG3A 4D6CA 7TIMA 1R3QA 2PZ0A 5GJMA 3A13A 3G1XA 4PRWA 1OBAA 3KL0A 1TMQA 3TC6A 5JUVA 1BQCA 2Z6IA 1CB7B 1EGMA 2YL8A 4FIQA 5JMUA 4E4UA 4F66A 5CC3A 5HQEA 2JGYA 1SW3A 1F05A 2VZTA 1W1A1 3ITVA 1E70M 1ZZMA 2QW5A 4F8XA 4AD3A 1UWRA 4JTEA 1J0YA 1B2YA 2FH8A 1Q4NX 1WKYA 3EX1A 5LNSA 4JEJA 3M1ZA 3G18A 3UA4A 4C6KA 2DUAA 3BCFA 5CH9A 4C6IA 1VCVA 3MHGA 2ZX9A 1Q6RA 4M5PA 3QGAC 1YIXA 3UZJA 3VA8A 3NYZA 1L6FA 4JQAA 5DXXA 3EGJA 4JTIA 3UEQA 1ITCA 4D1JA 2QDGA 3EWYA 4KH2A 2VCCA 4ADUA 4GY1A 2VRQA 1K9DA 4KT2A 1CEOA 4WEVX 1PBGA 1K8CA 4P8UA 2WAGA 3TWBA 4HNUA 4DZ5A 3QMSA 1CWYA 1DIEA 5GNXA 3PVFA 3SY8A 4AF0A 3NM1A 2FVMA 3S3GA 2REQA 4HU4A 2DSZA 4XTDA 1HVXA 1UR3M 4NJJA 4IISA 3D46A 1MEHA 3IAQA 1JCLA 1ISXA 3W1QA 2DZAA 1XS2A 4F4RA 1YNYA 1NJJA 3DECA 1FA2A 3UJRA 3B8IA 1DHKA 2ZC8A 2BX7A 3S1GA 3OZYA 6TAAA 2ZVRA 4H6QA 4F2UA 3C4UA 4DXKA 3U5YA 5BRQA 4J27A 4EXQA 3H2CA 1ZJBA 5EFFA 3WJSA 3BV7A 1JGMA 2DH3A 2BGSA 3HPXA 2FH6A 2POZA 1VFFA 3NQDA 3CGTA 1HX0A 4JDBA 5LIYX 2NV1A 1AD4A 4PFMA 2GK1A 1B3YA 4AF0B 3M5XA 1UG6A 4C6MA 1E4NA 3WLRA 1JUBA 2WNWA 2FMOA 2XIQA 3A4JA 3B03A 3K5XA 1DOSA 2G3NA 2DVUA 3E5BA 1XLAA 1XLEA 2PSNA 3CO8A 3KZPA 1H7NA 4JKMA 3ARVA 1ECQA 4Z1DA 4GIEA 3MI3A 3VIJA 1ZAJA