1VP5A

Crystal structure of 2,5-diketo-d-gluconic acid reductase (tm1009) from thermotoga maritima at 2.40 a resolution
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
284
structure length
284
Chain Sequence
QVPKVTLNNGVEMPILGYGVFQIPPEKTEECVYEAIKVGYRLIDTAASYMNEEGVGRAIKRAIDEGIVRREELFVTTKLWVSDVGYESTKKAFEKSLKKLQLEYIDLYLIHQPFGDVHCAWKAMEEMYKDGLVRAIGVSNFYPDRLMDLMVHHEIVPAVNQIEIHPFYQRQEEIEFMRNYNIQPEAWGPFAEGRKNIFQNGVLRSIAEKYGKTVAQVILRWLTQKGIVAIPKTVRRERMKENISIFDFELTQEDMEKIATLDEGQSAFFSHRDPEVVKWICSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,5-diketo-D-gluconic acid reductase
publication title Crystal structure of 2,5-diketo-D-gluconic acid reductase (TM1009) from Thermotoga maritima at 2.40 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Oxidoreductase
total genus 108
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 1.1.1.274: 2,5-didehydrogluconate reductase (2-dehydro-D-gluconate-forming).
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1vp5A00
4NKCA 4WDUA 4XZIA 4ASTA 4GA8A 5AZ1A 1HW6A 5M2FX 3GUGA 3T42A 1PWLA 2PDJA 4JQ3A 4HBKA 4F40A 1EKOA 1ZGDA 2ALRA 1FRBA 3DN5A 3LN3A 4DZ5A 3UYIA 1XGDA 2ISFA 3COTA 3UZXA 2PF8A 3BV7A 2PD9A 3R6IA 1RY8A 3M64A 1M9HA 1X96A 3MC5A 3WG6A 1EL3A 2AGTA 3H7RA 1C9WA 4FAMA 2ACUA 3EAUA 1ZQ5A 1SM9A 2BP1A 3RX3A 4XO7A 4DBWA 3UWEA 2F38A 2WZMA 3MB9A 1RALA 4QX4A 5AZ0A 3R43A 2PDQA 1Z3NA 1OG6A 1ADSA 1VBJA 4IJRA 2PDKA 1JEZA 4EXAA 5C7HA 2DV0A 2WZTA 2ACRA 1AFSA 3N6QA 4HMNA 3FJNA 1EF3A 2PD5A 3WCZA 2INZA 5DANA 3GHRA 1ZSXA 2IQ0A 3LZ3A 3NTYA 1ZUAX 4JTAA 4LAUA 2IQDA 4IGSA 3EB3A 2IPFA 2PFHA 3C3UA 4L1WA 4EXBA 4JTQA 4QXIA 4JIHA 1X98A 4PR4A 1Q5MA 4R9OA 2R9RA 1MRQA 2PDXA 4JQ2A 4JQ1A 2NVDA 1AZ1A 1Q13A 3UP8A 3CV7A 3V0TA 3UG8A 2PDMA 4PRTA 3LENA 4LB3A 4JTDA 3V0SA 2DUXA 4WDXA 3M4HA 4XZNX 3LZ5A 2HDJA 3FX4A 3DOPA 1R38A 3D3FA 2BGQA 3V36A 1XJBA 2CLPA 5LIUX 4FA3A 3QKZA 2IKIA 1UR3M 3UFYA 5LIKX 2IPWA 4JTCA 1XF0A 4GQGA 2IKGA 4XZLX 1A80A 4WGHA 5LIWX 5HA7A 4I5XA 1S1RA 1T40A 3BCJA 4L1XA 1GVEA 4IJCA 2NVCA 3O3RA 1MZRA 2IPJA 3UZZA 3U2CA 2F2KA 2PDHA 1LQAA 2PDYA 2ACQA 3H4GA 1IHIA 3O0KA 4QR6A 3Q67A 3V35A 1QWKA 2DUZA 4GABA 2INEA 2PDNA 2VDGA 4GACA 4Q7BA 1YE6A 4XVDA 3R94A 3M0IA 2PDGA 1IEIA 4JQ4A 2BGSA 1Z89A 2PEVA 2HE8A 3CMFA 1S2AA 2FZDA 2HE5A 4AUBA 1HQTA 4PUUA 1PYFA 2IKJA 2IS7A 3LBOA 4XO6A 3LQGA 2PDWA 4ZFCA 2PDUA 4JIRA 1AZ2A 1PWMA 1Z9AA 4XZMX 5LIXX 2PDIA 4XAPA 4XZHA 5LIYX 4RPQA 3ONCA 1RY0A 3F7JA 3UZYA 3GHUA 4LBRA 5JH2A 3LD5A 4WDWA 3R8HA 2A79A 3WBYA 3V0UA 3G5EA 4DBSA 1US0A 1K8CA 2J8TA 4GCAA 3B3DA 1MI3A 1YE4A 1EXBA 3UZWA 4OTKA 4YVXA 1AH4A 1AH0A 4YVPA 3CV6A 3GHTA 1YNPA 4WEVX 2FVLA 3G1RA 3EB4A 3LNMA 4FALA 4ICCX 1AH3A 4H7CA 3ONBA 1S2CA 3RX4A 4FZIA 4DBUA 1LWIA 3R7MA 4XK2A 4PUWA 3UGRA 4G5DA 3S3GA 1QRQA 3LEPA 4XVEA 1J96A 2FZ9A 2PDBA 4H8NA 2PDFA 4GQ0A 2ACSA 2PDLA 3Q65A 2HVNA 1T41A 3H7UA 3KRBA 2PZNA 2HVOA 2P5NA 2C91A 4JTRA 1VP5A 5HNUA 2I16A 4LB4A 1S1PA 4WRHA 4YVVA 2PDPA 4JQAA 4LAZA 5HNTA 3GHSA 4Q3MA 2HEJA 3P2VA 2I17A 4QBXA 3N2TA 2FGBA 3WBXA 3CASA 2R24A 3CAQA 2FZBA 5JH1A 3LUTA 4PMJA 4LBSA 1Z8AA 1X97A 2HV5A 3R58A 2FZ8A 3WBWA 3RX2A 2PDCA 3BUVA 1YNQA 3LQLA 4JIIX 3CAVA 3ERPA 4GIEA 1PZ0A 2IKHA 2IPGA 4PRRA 4YS1A 3BURA 4YU1A 5KETA 3R8GA 2QXWA 3VXGA 4MHBA 1PZ1A 4WDTA
chains in the Genus database with same CATH superfamily
3TYCA 3FKKA 1XLEA 1C7TA 1ZTVA 1B4EA 3GUGA 4JQ3A 4Q8PA 5EFDA 2ALRA 5ECUA 4O0QA 1FRBA 5FAJA 1V79A 3MI3A 2H9AA 4O13A 1V6VA 1ZBVA 3E12A 3UY7A 4X63A 5KINA 1M9HA 3EWCA 5LZLA 3BOFA 1QNRA 2ZZ5A 1PDZA 8XIMA 3EA3A 3G8EA 1Q4WA 4NY2A 5PTDA 1Q6RA 2GJPA 1RALA 1HNYA 4DM1A 3K4DA 3E02A 2FH8A 2G3FA 2CBVA 4NX0A 3AZTA 1HP5A 2EEXA 2B81A 3APGA 5IOBA 4NXKA 1EC9A 2OR2A 3RCYA 1D3GA 1RBLA 1JULA 5KZMA 1KNWA 4Z0SA 2ZXBA 3FLUA 3WMSA 5FL0A 4QQ3A 3H6OA 4HNVA 3MO7A 5LGZA 3TTOA 1UIOA 4ZGYA 5BXPA 3UNDA 3OLDA 3AMCA 2A3BA 4A05A 1QTWA 4PMOA 3ALFA 3VCNA 3GG0A 2O7SA 3SCQA 5FESA 4JTQA 3FV9A 1CXKA 4O0ZA 3GQYA 7XIMA 3CB8A 1VIWA 1L2QA 4ACYA 3BCFA 5DMYA 3P5YA 3TTEA 4W89A 1NFBA 1QPQA 1E5NA 3W7JA 1D8CA 5EMJA 2X41A 4GY0A 4UIOA 3DEQA 4LB3A 2W4XA 3H23A 2DIKA 1AG1O 5CC6A 4DJDC 3PZIA 4N4QA 4CCZA 4QEHA 3S1XA 5FF4A 1A0CA 5CSYA 1H50A 3F5LA 3AMLA 1SFTA 2HXUA 3OGVA 2E4TA 4J3XA 3OG3A 4HK6A 1CGXA 5LIUX 1VFOA 2ONEA 2ISDA 4HNLA 3SUVA 1OGBA 4I5RA 3ITVA 2OGJA 2YOCA 3VZXA 3KVJA 4NAFB 1J01A 1CECA 1O4UA 4JTUA 4IGNA 3NZQA 2EJAA 3TEVA 1KXHA 5M5DA 1FP9A 3VCCA 5FL1A 1ZNNA 2TYSA 2W62A 4LQ1A 4IFKB 3TSBA 2P76A 4AC7C 4PGLA 1B1YA 3HPXA 1CW2A 2PDYA 3KBVA 3P82A 4Z2IA 4GUIA 5I02A 4BI5A 5KTLA 1QWKA 1VHNA 2E9LA 2R8WA 1B3WA 5FF0A 4UBPC 1LG2A 2VVNA 3WJWA 1OYBA 4LCSA 3N9SA 4B5SA 1XUUA 3IWPA 1L6FA 5A8NA 3N3MA 1UZ1A 3T8QA 4QQUA 2VX7A 3CT2A 3O2LA 5E1QA 1IEIA 2C0HA 4RV3A 3V5OA 4W8BA 1E0VA 4AUBA 3QLDA 3QY8A 1VBHA 3W74A 1OX4B 3LM3A 1FUYA 3V1HA 8RUCA 1AK5A 3T9PA 1EP2A 2OQLA 5K7JA 3N14A 4HA4A 1HKWA 5CPSA 3NFUA 2E6FA 5HAOA 1F8MA 1CGYA 3HG2A 1REQA 4RXGA 1B54A 1VPYA 3DFNA 3V4BA 3AIQA 4PC8A 1LLWA 3DI0A 3LGDA 3ONCA 2P10A 1T7LA 2OWXA 4PA8A 4GHRA 1K3UA 3VGGA 5DT7A 2P3EA 1FTXA 2V38A 1BYCA 4A8RA 3BQ5A 3FDKA 3NXFA 2WMHA 1Q45A 3SCRA 1YHTA 1XCWA 3H2EA 3UJEA 3GR4A 1PS9A 4S3FA 3G5EA 1MXGA 2WNZA 3ZWTA 1EJXC 2TSYA 4MVAA 5DXXA 2J79A 4IJBA 2ZA3A 4KMQA 1DKWA 2DH3A 5GJPA 3UZWA 4GJJA 5DCEA 5DFAA 2WB5A 3E5BA 2DZBA 3T78A 2NQZA 3ZWSA 2X7VA 1KM4A 2VXNA 4DJFA 3KOZA 5AY7A 1ITXA 1MRAA 3ITYA 1EPXA 4L9XA 1UCWA 3TMLA 5K2ZA 3RLUA 2BY1A 1Q4NX 2C1IA 1REQB 1K4GA 4JZ5A 2QCEA 4QEEA 1F4HA 4D1IA 1XLBA 2PPGA 3WF4A 4Q7IA 2WWDA 3IPWA 3GU2A 3LEPA 3N6HA 3ABQA 5U7SA 2YLLA 5I3FA 3PZOA 5EGRA 3HG4A 3ZLHA 4H9XA 2VRJA 3N6JA 3LCXA 1QBAA 2OVLA 1XIMA 4AZCB 1L8NA 3CPGA 3G0UA 4LEFA 4AIUA 1TRDA 1GZJA 1XSJA 4Q3MA 1G01A 3GVRA 4MAZA 2RAGA 3N2TA 1WQ5A 1EBHA 1VD6A 3WBXA 4Q32A 3VNDA 1OF6A 3LUTA 5E0CA 2Z6IA 2Q09A 2QCNA 5J8LA 4B3KA 4BWLA 3STPA 1M03A 2ZDSA 4XZ9A 3PM6A 4WSHA 4AIOA 2XISA 2WZHA 1B3YA 1TUXA 5ABTA 1X6UA 2BASA 2QUNA 3N3TA 4U2YA 1D7KA 1GJPA 4QE4A 4AC1X 1S38A 4HA1A 3GTNA 4NUWA 2NUWA 1AW2A 5EA9A 3P74A 1R87A 4YTSA 3VX1A 2J8FA 1BWKA 3WK1A 1EUAA 1GJWA 1ENUA 1KO0A 3DN5A 4P8UA 3BGJA 1BF2A 1P48A 4DZAA 1R8LA 1IQ8A 2PWGA 1YXYA 1KFEA 1XKYA 3NZ1A 5JMUA 3WLPA 3G1XA 1K7FA 1J0IA 1AL7A 3EAUA 5HWNA 1OIFA 1QHPA 4XO7A 1ME7A 3MI2A 4FLOA 2NSXA 4LXFA 3CS2A 3R43A 2KAUC 1MFVA 1Z3NA 3P93A 2HBXA 3SRFA 3VC6A 2Y5JA 1O5XA 4UCFA 3OGRA 1OC7A 2PDKA 4DO5A 3SECA 4UQDA 4EXAA 1J5SA 1XS2A 5C7HA 6XIMA 3LV6A 3N19B 3G0SA 3KHJA 3PJTA 4HPXA 2DORA 4H9VA 3NG3A 1ZALA 4H7VA 3NM1A 3GHRA 4MWAA 4FF7A 1TR9A 1XIIA 4MKNA 4DUXA 1XIHA 4LWWA 3AS0A 3CAKA 1UIPA 3NA8A 3HB9A 4GIAA 4HQVA 3W2MA 4LEQA 3FA4A 4IG2A 1BQGA 4L1WA 4GISA 4B3ZA 4Z0JA 1TPEA 4IP5A 4UZSA 1MRQA 3K46A 4JQ2A 4GFIA 2WVVB 1WP6A 4S3BA 2NVDA 1EJTC 3CJPA 2OSWA 2PDMA 1TA3A 1LQ0A 1ICPA 3CMJA 4QISA 2VUNA 1F3XA 4US6A 3S9IA 2TPSA 3H2AA 3I6TA 2RJHA 4UR7A 1LG1A 4GINA 2PRMA 3G6MA 3WF0A 4LAMA 1VCGA 4RNFA 3GDLA 2NQHA 2BFGA 3DOPA 3TXVA 1TMLA 2VR2A 2NV2A 4KIEA 1MQRA 9XIMA 4AYSA 4KKXA 3E38A 4D9PA 5HULA 2ZXQA 1CCWB 4NJIA 3ZT6A 7TIMA 4C6EA 1BXCA 2CBJA 3EB2A 4PTWA 1YDOA 4Q6JA 4TX9A 3TFCA 3BAWA 3BW3A 3PFRA 4GNVA 3PANA 1C3FA 4DYKA 5I3KA 4QNEA 4BF9A 1ODUA 1J0YA 2R91A 3BG3A 3LYEA 3NWRA 3HN3A 3PK7A 1GVEA 4IJCA 1FWAC 2WC3A 3LCHA 2DUAA 2PDHA 5EMLA 4JTKA 3FA3A 3KZSA 2CU0A 1AODA 1FCVA 3B0XA 2B7NA 4BA0A 4TX6A 2PC8A 4IMFA 4YJ5A 2OZ3A 5AC6A 1K70A 1J4EA 5LKYA 1V0MA 3PWAA 4LANA 5ABFA 3B4YA 3W00A 4PCSA 3W75A 1OHLA 2BBFA 4TVCA 2OT1A 1US2A 4MFEA 1RVKA 1YE6A 4MYXA 5CBJA 4C6KA 1WDSA 3DYMA 4HZ7A 3M0IA 3S1GA 4B4FA 5A6KA 4DAIA 3DU0A 1BKHA 1P0EA 2VGFA 1Q65A 1PHWA 1FOBA 4JXCA 2OCZA 3L21A 1ONXA 1EZWA 4P2VA 2PWFA 2FHFA 1E3ZA 2Z24A 3OYZA 4MWAD 1R9XA 4AMCA 1DJQA 3UD6A 3TMQA 3PBGA 1HKMA 1DQWA 1EHNA 4ICMA 4U10A 1JD7A 4NZCA 3B9EA 3NQVA 4HNOA 3W6YA 5ABFB 3TN6A 1WZMA 3GHUA 4LBRA 1GG1A 2BB0A 1QWGA 3WNPA 1Q2SA 4E5TA 5C9ZA 4DXVA 5CG0A 3VKJA 1EBGA 2CBIA 4MDOA 4D6JA 3P62A 4Q8TA 1ODZA 1EXBA 5J5DA 4L56A 1UKPA 1V6XA 2VCCA 2V3GA 1SFJA 5C6MA 3BMXA 3EMCA 3GHTA 2FTPA 3S1UA 2FZMA 3QV7A 4FALA 2XH7A 3FS2A 1YMYA 3OP2A 2QAPA 2PTZA 3WUFA 2E28A 1BGGA 1ZAJA 3NPVA 4W87A 3DGRA 3UGRA 1FBAA 3OVGA 1EWEA 2DT3A 2QLYA 1BYDA 1MEHA 4P61A 1FQ0A 3WK2A 3S3GA 1JFHA 4Q8WA 1YNYA 1GVIA 3SCOA 2WM0A 1KFKA 2QDEA 1UZDA 1F7BA 2OKOA 5FI8A 2JF6A 4IMGA 4GKTA 3KRBA 2R1KA 1VP5A 3DERA 2GQ3A 4WIWA 2KX9A 2FB2A 2YA1A 2RJGA 3PF3A 1UWTA 4X60A 3ITGA 3LHUA 3ANUA 4PH6A 3SM0A 4J1OA 1DJWA 1QBBA 4GFSA 3AHZA 1UR1A 3QFWA 1G69A 4YWIA 3MU7A 3WF2A 2EG7A 1UYQA 1R3VA 1UKQA 5D2TA 1FHLA 1MNZA 2PTDA 4KCTA 1KTCA 3USZA 3BC9A 3UA3A 1XRSA 5GQBA 4ZQRA 5TF0A 1EO5A 3OB8A 4PRRA 1P1XA 1TPVA 4RNHA 2CETA 5I5RA 4A4AA 1RD6A 3RN6A 3WBEA 4D72A 5K9DA 5AHMA 3N9KA 1O5KA 1OSEA 4DI8A 2D2JA 3AJ7A 3AIUA 3ARTA 4NZJA 1Z41A 1RCXB 5C2GA 1OGSA 3HPFA 1HW6A 3MJYA 3SCUA 3BXWA 1R3RA 5E9AA 3A24A 1V93A 3AYSA 4JOMA 1W3HA 1W0MA 3H7VA 2BX7A 3W26A 3CK5A 4JBRA 1SVDA 5C8BB 3LTSA 3RJYA 2VM8A 1OEPA 1PKNA 2HPMA 5E0FA 3WY1A 3GC5A 2VO5A 1K9TA 4FK9A 1OFDA 1NWRA 1PCWA 1NELA 1P5BA 4F2BA 5AHNA 4PB4A 1ZCCA 5TQLA 3G2GA 2PTYA 3CQHA 4LC8A 1ELSA 2J6XA 3N13A 3KOYA 1YDNA 3O6DA 3KBWA 4CNNA 5C71A 3PTKA 1IEQA 5C55A 3LLDA 2IUZA 3WJZA 4YNGA 1TJ0A 3CL7A 3VYLA 3LZ3A 4N6FA 2DVXA 3UWUA 1DWHM 3RR1A 3TLQA 2QCLA 2ISWA 3TYEA 4LYPA 1Q8JA 2B31A 3IJ6A 2D2GA 3VC5A 2ZX5A 3ABZA 1NP0A 4F0HA 4JNYA 3UWWA 5LNRA 3CUJA 1X39A 3W82A 1AJ2A 2PWVA 3CIWA 1XYZA 5CGTA 1O6IA 1OC6A 2QCHA 1AZ1A 2RUSA 3GK0A 4KERA 1YDVA 4HU4A 2GQ8A 4LF1A 3RPDA 2QCCA 5EMMA 3UG3A 8A3HA 3A4JA 2VFFA 3OQ8A 2OU4A 3RU6A 3PUEA 3LPGA 4B90A 4WDXA 4B92A 3RG6A 4V33A 3UWZA 1ITQA 1Q63A 4RZBA 3LNPA 3LLXA 1B31A 4M81A 3A21A 4H9MA 5F7UA 3QV9A 5LXEA 3BOXA 3XINA 1UUMA 2QIWA 1OFQA 4L6OA 4YCOA 1MEIA 5H8UA 1NQ6A 1JCYA 4QIUA 2ESCA 2WJFA 1DL3A 4X3ZA 4CNTA 1BG4A 3LV5A 4UQAA 1SU5A 1H4PA 4PE8A 4O57A 4ZOAA 4G7FA 2C79A 1B3VA 2PLCA 1Z6KA 2YL9A 2J7FA 1KCXA 4PFMA 1H7RA 1V6WA 3HTWA 3R0UA 1T8QA 5I00A 1XRTA 1QCWA 4I5UA 3BZJA 3TP4A 2VHLA 2DGAA 1MW1A 1TTPA 3AOFA 1B2YA 1JPMA 1UUQA 2D24A 4HOXA 3H4GA 5LNWA 3HG3A 1W5PA 3CHCA 2J74A 1DIDA 4H2HA 3STCA 2Z25A 3V35A 2D3LA 3RITA 3AS2A 4ZOCA 3QSTA 3QHNA 3W3OA 3SQMA 3W83A 3S0CA 4R33A 4B5WA 4HZMA 1FWBC 3MI6A 1SO6A 3W86A 3EMZA 4LPCA 3OZYA 1TZZA 4HHPA 3WLSA 4J28A 1GTEA 1S2VA 3H22A 2YCKX 2V5JA 3KOXA 1TJPA 4H00A 1UOZA 3SRKA 3LI0A 2E9BA 2E67A 4XO6A 2GK1B 3TJIA 3VPLA 3ZQ9A 2JIEA 5E09A 4UQ9A 1JYNA 3B97A 4O4WA 2IQTA 2ZWZA 4AWEA 1DIOA 2PDIA 5G5IA 3O1NA 1A5UA 4XZHA 4ZFMA 4PUNA 1CBGA 3I3EA 1XIEA 4Q4RA 1ZY9A 2OWWA 3EEGA 4AY1A 2VX5A 3R12A 4KGJA 1KRAC 2JKAA 3E0IA 2XH2A 3OLGA 2OZTA 2P0IA 1WZLA 4DWSA 2QAFA 3L2IA 5HBFA 1VGAA 3C2RA 1WKYA 3RM9A 3WFLA 2DZAA 5I07A 1JCLA 3EWZA 4G1NA 3VA8A 1IZCA 4Q33A 3LXAA 3N15A 4UC5A 3GNDA 3LGEA 4IIBA 3OEXA 4M80A 4M82A 3TE9A 2CW6A 4XAZA 3A64A 4JFVA 3LCFA 1FCBA 2PGRA 5D9OA 3A4WA 4CGTA 3FEMA 7ENLA 4JN7A 2A2IA 3IIPA 3NL3A 2VZOA 1E5JA 5CH9A 3LHZA 5I3IA 4PUWA 3HGRA 4XAFA 2QCMA 4KT2A 4C90A 4RE2A 1OCBA 4WLCA 1F73A 1JR1A 3LU2A 1GGOA 4NRRA 1A5OC 3IK4A 1V3JA 1L0PA 4H01A 4EWND 3KLKA 3WQOA 2H90A 2VWSA 3UWVA 1R0MA 4UQEA 2R14A 4INFA 4RR4A 4S2CA 3SY1A 3GHSA 5H91A 2HEJA 2I17A 1L6GA 1QO2A 5HNNA 1ICQA 2FHBA 1LF1A 2PP1A 3KCLA 4F0KA 4MKSA 3NVTA 4IFRA 4B15A 4M1RA 4XBSA 3FFSA 2V2DA 2X8RA 3R58A 2XG9A 1GPWA 3DFSA 2J6VA 1AW5A 4REQB 1BVWA 1IGWA 3MMTA 5A8PA 3W7PA 1O68A 3TN5A 1OFBA 4PFHA 1RK6A 5AYYA 3WQVA 1DWFM 4FLSA 1OCNA 3QHMA 1F3EA 3P7YA 4R7WA 4MUZA 4GZEA 2XINA 4MB4A 4EACA 5D37A 4JNMA 1ME8A 1E9YB 1UH3A 3HQOA 5SWUA 2Z28A 3PZGA 2BHZA 5FD0A 2C3ZA 3P0XA 1LM1A 1TZ9A 1PBGA 3UJFA 1UR2A 2HZGA 2PTXA 2HS8A 1Z69A 1RY8A 1XLJA 2GVYA 3ARUA 4C6PA 1D7FA 5HDRA 5G4EA 3XISA 1M68A 4FOJA 4KRTA 4DWSD 1OINA 2VVSA 3T8LA 3RX3A 1RJRA 3UG4A 1TV5A 3MW7A 3MKVA 4S3AA 3M0VA 3CV2A 5CPMA 1UC4A 4N6EA 1BG9A 2D23A 4LSBA 3EKLA 1JEZA 3M46A 1F3WA 1AD1A 2OLAA 1QDSA 3AWNA 4CEXC 2DP3A 4IP7A 3BJFA 1EUNA 4GGHA 3O63A 1LL7A 3OYXA 3E5PA 5FKYA 4HOWA 4GZIA 1WDPA 2HROA 3UCQA 3FVDA 3W7CA 4E6MA 3VAVA 4M29A 1HJXA 1I75A 5DANA 4IMAA 3H12A 3R8RA 1SMDA 4O12A 2V68A 4KETA 4UTFA 1E1CA 5HQLA 4MZYA 3G1VA 5KSWA 3UR2A 4Z1AA 4WK9A 3GZ3A 1V3KA 3WQ4A 5K4XA 5FJOA 3W72A 4QROA 5LHFA 4C6BA 4ZB2A 5C0QA 4GYJA 1DQUA 2Y0FA 2W61A 1WKEA 1NJJA 2CFFA 5I7GA 3VX0A 4OBRA 3Q2DA 3G1FA 2HQAA 1F9CA 3CV7A 3PWIA 4ZCWA 5T26A 3BG5A 4Z1BA 4Q22A 1C29A 4FO4A 1GQKA 3GZAA 3FA5A 3NQFA 2ABBA 2X40A 2Z1WA 4MB1A 4NXSA 3W02A 2VZSA 2Q8ZA 1UR0A 3VIHA 4HU3A 3Q37A 5XIAA 1A0EA 2YL8A 1XPGA 3LRMA 1PTAA 1YTKA 2F8QA 3GBEA 1N55A 1E1CB 3AALA 3GH5A 3XIMA 1VBRA 4EK7A 2BZNA 3LHWA 4U2ZA 3ZLGA 4UCGA 3D3FA 1NH6A 3UNTA 3CHEA 1WZKA 2V3EA 2HXTA 4PMQA 4MUPA 2O4MA 3SUSA 2E5DA 3K2GA 1XYLA 3WL0A 2JKEA 2ZTKA 1XF0A 3PZMA 1LDCA 2YBVA 2FMNA 1E55A 4Y9PA 4MJ2A 4N9BA 4GX9A 2DSZA 2DT2A 2R94A 4I5XA 4JN8A 3BCJA 4GY1A 2EPHA 4H2CA 3T08A 1MZRA 4PTNA 3U2CA 1UZHA 1OX5A 1VFSA 1BF6A 2WBKA 3VNYA 2QJHA 2JGQA 1KA9F 4CN4A 3AIWA 1IWAA 1Q6OA 4EX4A 2WPGA 4W86A 4DJDD 3H4WA 1FKXA 3G1AA 3ABSA 5HMDA 2A6LA 5LHEA 4O8AA 1U5HA 3VD5A 1U2YA 3GS6A 1NF0A 4BI6A 5CPQA 5IM51 3S2LA 1E9ZB 2A3LA 2V8ZA 3M0XA 1YQ2A 3UR8A 4Z1DA 4FR1A 3CPRA 3ARRA 3UPMA 3QR0A 4J3TA 1GCYA 1LUCB 2E6YA 2ZRWA 2IXUA 3BLEA 4W7WA 4KEMA 4UTTA 1PYFA 1S46A 2QJGA 3LBOA 3CQIA 3NO5A 3E0LA 3S47A 4TU1A 5C5YA 2C16A 3FJ6A 4Y9AA 3TFXA 3ELFA 1R3WA 5FAGA 3R4IA 5GNZA 3LRKA 4MNLA 4NSBA 3WD4A 3VDBA 3WD0A 3RUBL 2WLYA 1PSCA 1KGUA 4EOUA 4PN2A 2FQIA 2V30A 3ENLA 3S5YA 3BCDA 3TCEA 4F0LA 4PSRA 1VFFA 5D8ZA 2BXZA 3CC1A 2D22A 1WYIA 1XISA 1WO2A 2WHKA 1UH2A 3Q45A 2YJQA 2EAWA 3ZSTA 3VNLA 3SI9A 3A5VA 4A2RA 3BWWA 4RKAA 3H26A 4XZBA 1WBHA 3HQPA 5T9CE 3FDGA 1FHDA 4YVXA 4TO8A 1SFLA 1UR9A 1FCUA 2YCIX 3I7SA 3ICJA 3LCWA 1BWLA 2H3DA 4QS6A 4EE9A 3JS3A 4GO8A 2XIOA 1HFBA 4O1EA 2UWFA 2ABAA 1W1ZA 3FIGA 3SZ8A 3UR5A 1S2CA 3RX4A 2VGGA 1J18A 1ESWA 1XINA 1POJA 3PG8A 1VZWA 4FX7A 1WDWA 3LBCA 3GKFA 2VR4A 4NQ1A 5KZDA 1EJRC 2V0TA 3MUXA 3LLFA 1IGSA 3TAOA 2POZA 5AYZA 1XLLA 5F2GA 3GVVA 4GYPC 3RAOA 3CUIA 2Y2WA 1XYMA 3NEVA 4O1CA 2C13A 3QZ6A 2FIQA 4JL1A 5CZ0A 1KM6A 4L4OA 1BQCA 2YA2A 1PHQA 3PUDA 4JDBA 1Y65A 2VEGA 2NQLA 3GLCA 5T8GA 5A1AA 4MJZA 3SAZA 4WY0B 4GZJA 2EPNA 3MP3A 3I4EA 4ZA0A 4QCEA 3WL1A 4PMJA 4J3UA 1KFCA 4IIGA 3M9YA 3GAYA 4DLFA 2HV5A 2XIMA 3WBWA 3SGZA 4DEFA 3L5LA 3N9RA 2CIPA 2J66A 4NF7A 3BLFA 2FJKA 1E71M 1KKOA 3DG6A 5D9NA 1GZGA 3NDOA 3NL6A 4M6UA 1G1YA 1W3KA 4YS1A 4UTUA 1F3TA 1JF5A 1S5TA 3R8GA 1EJUC 4L9ZA 4F2UA 5JUVA 2DU2A 5BXSA 4CKQA 1A5MC 4ECLA 1ZL1A 4BK9A 1UQYA 2OFJA 5BOFA 1A53A 3BTNA 2E0PA 1UW9A 1XD0A 4AY8A 4EPDC 4HOZA 3CUFA 2Z1BA 1KRMA 3AUOA 1QPKA 2MUCA 3IK2A 2Z2UA 3W24A 1OZMA 2PDJA 3M7WA 1H1NA 4QSHA 1DWJM 1GORA 1PIGA 1RK5A 4PEKA 3TW6A 1I2NA 1WAWA 4FX6M 5BU6A 3COTA 2XU2A 2Z1VA 3B4UA 4A35A 2X2GA 1OFAA 4N0RA 5A6BD 3H7RA 2CZDA 3E2VA 5M3WA 1ZQ5A 4UTLA 2F9RA 4HSHA 4C1NB 4GG9A 4WJ8A 1B9ZA 1U33A 3MQTA 6ENLA 1TJ1A 5CAKA 1VBJA 4TX8A 3AU6A 5I24A 2DEPA 4JY8A 3W85A 3ZVIA 2FDSA 4GOAA 4LTSA 4OT7A 2DZUA 3BG9A 4IICA 4MZ8A 1XH0A 4NVTA 1KM2A 1ZSXA 3O6AA 3U7VA 4HT3A 5F1UA 1ZLPA 5ABEA 3SCSA 1A5CA 3G24A 3ES8A 3F5JA 4L5ZA 1UHVA 5AN7A 4GVGA 4PZVA 3SGUA 2BY2A 1UD3A 2P8CA 2V3FA 4JIHA 2FTWA 3A3WA 3B04A 3VNMA 3DFHA 2AKMA 4F4RA 4G6CA 4GVFA 4LV4A 4RUBA 1WNOA 4CN1A 4PTMA 3TSDA 2VEIA 4JTDA 3AIEA 3DHFA 4XAYA 3TVAA 4UFLA 1BYBA 2WSQA 1NWTA 2DT1A 4XUYA 3FHAA 2PMQA 3PZNA 2YGYA 4I7VA 1N8FA 4XZWA 4U3AA 3UCDA 3TIMA 2XFYA 2NWRA 2X30A 4Z17A 3KVLA 3DKJA 3FXGA 3U2EA 4WQ6A 5DRCA 3EX4A 3GFZA 3PPHA 2TMDA 4FA3A 3DI1A 1P0DA 2ZZ1A 2VDIA 2Y1HA 4B5VA 5E9XA 3V5CA 3N73A 2ZUMA 3GTHA 5AB3A 2GDUA 2GJXB 3U3HA 4X0NA 1BEUA 1CXHA 1R7AA 2AL2A 4L1XA 1WOAA 4I8YA 3OGSA 2ZE0A 4NASA 1PIIA 4YWSA 2TAAA 2BMBA 3SCNA 2UY5A 1H7OA 3I7QA 4IT1A 3VZZA 1IHIA 2X7WA 4RLIA 2ZCGA 1EP1A 5CGMA 1SGJA 5AKQA 1JZ6A 1XRVA 3VDGA 5J5RA 4BR1A 2FVMA 3TH6A 1EA0A 1KTBA 4M7TA 3VUPA 1OFOA 3GXPA 4A6GA 4A29A 1DJHA 3GAKA 2NW0A 2G8ZA 1JUKA 3B8IA 1G6CA 1ZS2A 4ZVJA 3R94A 3V3WA 2AOSA 2FPYA 4M8UA 1JCTA 3S5ZA 4JIEA 3MP4A 2VX6A 4MY1A 1OD8A 4A8LA 3CMFA 4GIYA 1PE1A 4E8DA 2VNCA 3CO8A 1E73M 4EVZA 4GUFA 1O95A 1CENA 1HKJA 2AAAA 3FYOA 2IS7A 1QW8A 1XLDA 1V08A 4UTWA 2PDWA 5GNYA 1VBUA 4MJ4A 3QC0A 3W1QA 2ZTJA 4JFTA 1VR6A 3GG8A 2W79A 3F4VA 3MSDA 1J6OA 1P0KA 3G1HA 1OWQA 4H6KA 5C9XA 2PRHA 4WD0A 3W2JA 4ZODA 4B9YA 5EMKA 3MVIA 4V1XA 5JQ9A 3IJLA 2GOKA 3W7NA 1LL4A 4RCXA 4DJFC 1RP9A 3U8GA 3TC6A 3SUWA 1ZJHA 3BSGA 1JVNA 2VC9A 3FXYA 1MO0A 1MI3A 4GY7A 1OBAA 2F6XA 1OQFA 2WC4A 5G1YA 4E38A 2G5WA 3G22A 5H6HA 3EB4A 1Y5XA 2A3EA 3VFLA 3RLGA 1WPCA 2PI6A 2WNWA 4ENLA 2BOFX 5M17A 4JTEA 3NDZA 4GBUA 2BG5A 4JICA 3N2XA 1BTCA 3ONBA 1EPVA 2ZRVA 3P84A 3NQCA 4JTJA 1TPWA 1XYFA 1D2KA 3A22A 2NX3A 3BMWA 2YIHA 5CZTA 4FSAA 1W31A 1XG4A 3DHDA 4V28A 3AXKA 3DX5A 3KLLA 5BRQA 3OPSA 1XW8A 3M1ZA 4FNTA 3W37A 2Q6ZA 3P67A 4KIRA 2GUBA 1EC8A 1UKTA 4L4MA 3GXNA 1VKFA 4Z2HA 3K8LA 2PZNA 4A22A 4IPJA 2YZ5A 4JTRA 5HNUA 3WKZA 1TFVA 3C2YA 1TJ2A 5I03A 2G37A 4F0SA 5HNTA 1F5ZA 1RUSA 1V03A 3IVUA 3T55A 4Z1CA 1XR2A 1UD5A 4G8TA 3PB0A 2WCSA 5M1TA 1XSIA 4XB3A 3W1AA 3KUMA 4JYEA 2VENA 4JTLA 4GJ1A 2Q71A 3KE0A 4J7RA 1GK8A 3IIOA 3QYQA 1TIWA 1QPRA 6REQB 1H5YA 2EGZA 4OBTA 5F1VA 4OV4A 3WD1A 3K30A 2AMGA 3VD3A 4NJGA 1I8JA 4YYFA 3STFA 4FMVA 4QP0A 4HD5A 1FFRA 1FKWA 4MMWA 1XC6A 4J2PA 5A5WA 1ZRQA 3CWOX 2VC6A 4FNRA 4RZ5A 4TR9A 2G95A 3HMJG 3T42A 2BODX 5F2LA 2I7GA 2E40A 3QZEA 5AC8A 2JEQA 1FWTA 3NZRA 2VI0A 3WQDA 3HOJA 3T05A 4IWWA 2HK0A 1TCDA 2HCVA 1SUXA 3HPAA 1XDJA 5LA2A 5L6UA 1ITCA 1T8XA 3DFPA 1PZ3A 3NDYA 1LWHA 3FN9A 1GHRA 3BV4A 3MC5A 2C1HA 4LT9A 2WJDA 3L0GA 3NQAA 4Z2GA 3W22A 2ACUA 2CLMA 3MUY1 2X2YA 3UF9A 4PTDA 1RD5A 4H04A 3PSVA 5AZ0A 1P7TB 2PDQA 3P61A 4QCFA 4XBKA 2Q01A 4IJRA 1OX6A 3MZNA 4S3DA 3M5VA 3GTXA 5FCZA 1NDZA 1WDRA 4PBGA 3VABA 5C9RA 3BGGA 4GK8A 1TV3A 3MBDA 1H3GA 1ZJAA 2QUUA 3VNJA 3W1NA 4AHOA 3BAJA 3GR8A 1ICSA 4ZTYA 2IQDA 3VNZA 2HNHA 5TAOA 1U83A 4G9PA 1GKQA 5D30A 1TPB1 4NNAA 4S38A 4NP7A 4WVXA 3O05A 2FFIA 4S3KA 2X16A 5C9WA 3K8MA 3EPNA 1POKA 3IJDA 3VOJA 2D73A 4PSPA 4JTFA 1FWWA 1O1ZA 4ADSA 4GJIA 5ABGA 1M01A 3QMRA 1EDQA 3RFAA 4EP8C 3GTFA 1FWRA 1TV8A 1DBTA 1GOWA 1J0KA 2QCDB 1E1EA 5FJTA 2ZUTA 4F8XA 1HIZA 4RDVA 3W2UA 2F6KA 4MY8A 1FVPA 4OE7A 3PVFA 5F4SA 2Y7DA 4XUGA 1ZB5A 4BQ3A 5HPCA 2WHMA 1RH9A 1KCKA 3LDVA 2ICSA 3E0WA 1JYXA 5FJUA 3DAQA 4HPHA 1UR3M 2DY3A 3K8KA 1JFXA 2GSHA 2J77A 2IKGA 4GQGA 3WH6A 1Z32X 3VKKA 4MM1A 1QATA 4PCTA 4FEZA 4LNCA 3VOFA 1KCLA 1BVNP 3GFXA 1S1RA 2XHYA 1XIBA 3ZVHA 4Y90A 4A2SA 3GTIA 1TELA 5XIMA 1JPIA 3T0BA 1IIGA 3KRUA 4FX8A 3IJ8A 5HJLA 2ZVRA 3ZS4A 4S39A 1FWCC 2FZNA 4E0CA 1HJVA 3W4RA 4W85A 1ZBKA 5CZSA 4DJED 4I6VA 1F07A 4P7LA 2YZRA 5CXPA 1F8IA 3MCOA 3BSHA 4MOZA 5DRIA 3W29A 2J25A 4XD3A 2C0AA 4XVDA 1VCVA 1M6JA 2V2CA 3LOTA 4Q6XA 2Z00A 1PTDA 4XX6A 2WC7A 5A6JA 3CEPA 3DFOA 3NQMA 4J3ZA 4ZBCA 1PDYA 1OT1A 4PUJA 2HE5A 4HKPA 2PC4A 3I6RA 2J8GA 1GG0A 2VQTA 2CXEA 2D2OA 2Z29A 3GNPA 3ZVHB 2ATMA 4W9TA 5IFTA 3BW4A 3R2GA 2JQXA 3M6DA 4YYCA 4DNHA 3MMUA 1ME9A 3BK0A 4XZMX 4KCWA 1MMFA 1CGWA 3IGSA 1R86A 4XAPA 1IWPA 1Q8AA 3EDDA 3N17A 3BPWA 4NIRA 1WUEA 1G67A 4GH1A 2QPUA 3ALGA 2PGEA 1H2JA 4UQBA 3KBMA 3IIVA 4IL2A 4ERIA 1GWJA 4JTSA 3WBYA 1LWJA 2A21A 1SO3A 4D6EA 4AMAA 2WK2A 4KWWA 4PL2A 3SCVA 4LOCA 3VKBA 1QPOA 3NSXA 2OG9A 5BNKA 1A5AA 2QDHA 4GXWA 3GYEA 3WD3A 1SFSA 4N9DA 5CSUA 4NZ1A 3SDOA 1YNPA 2FVLA 4F0MA 3UYCA 1Q6GA 3LNMA 4QJ3B 3QGVA 3GFYA 4G56A 2V6AA 1V6TA 1JZ8A 3RRAA 3SCTA 3IRSA 4B2DD 1K6WA 2P50A 2QHAA 3DFQA 4LVAA 4ZOBA 3THAA 3WQ8A 4N42A 2E09A 3M0MA 3EWDA 5EBUA 3C0SA 3GH7A 1IV8A 3C52A 3HO8A 1VEPA 5A2CA 3ATZA 5IHSA 3LA4A 4S3JA 2D3NA 2OTDA 3TYBA 2E9MA 3VIIA 1PXGA 4FS9A 2W67A 3KL0A 2XFFA 2WCAA 4DM2A 4ROPA 1EOKA 5AVHA 1I9CB 2GVLA 2G4JA 3UPBA 1BSLA 3ZT5A 4MNJA 4RV8A 3CUHA 4X9SA 3CMGA 4XBJA 4D71A 2XZ7A 2MNRA 3EDEA 1G94A 3AYVA 3CZGA 3W7DA 2FZBA 1QNSA 1W8SA 2UZ9A 1B5TA 3ARYA 3HV9A 4AW7A 2BHYA 1J2BA 4RNIA 4LCRA 3KX6A 2ZC8A 3IJQA 1X8CA 3BQ6A 4I7WA 1XLFA 2BOGX 2Z2AA 3PC0A 2G96A 2ZZ3A 3RR4A 4QGCA 1VPXA 2QXWA 4JFSA 3TUUA 4PODA 3ARZA 3RU8X 1U30A 3DIPA 4W7VA 4JYFA 2P3ZA 2DZVA 1R3SA 5HANA 4YTQA 4UNKA 4ZZ9A 3RRXA 4K8EA 4NI3A 3K13A 1GYNA 1MW2A 3WNNA 3SEPA 2WZIA 1PTGA 3RJXA 1CB7B 1AJ0A 5A8QA 4XIAA 4JX6A 5D2WA 3IIXA 1PJ9A 2DDXA 2FDMA 4L1GA 3FGCA 2PCEA 5DBTA 5BWFA 1RZMA 1VQTA 3NGFA 1XYBA 1R3YA 5TBOA 2RGLA 3C2VA 3H2FA 3WF1A 2A7RA 4S3CA 4UMBA 4FNPA 4S23A 4JL2A 1JYVA 1WCGA 4H19A 1XIJA 4CQCA 5GJNA 1KQYA 1CIUA 4KFOA 1TIMA 3DXIA 7REQB 3D46A 3T2QA 3RPTA 4K8HA 3ORWA 4KRZA 4XTIA 1O7AA 4Q4KA 1KWGA 1K03A 1BHGA 2F6UA 5JBFA 5HOSA 5D04C 3TLLA 3W7RA 1UG6A 5BMWA 1ZUAX 3RGTA 3ITTA 1V0LA 3FGCB 4O18A 3W81A 2Y61A 2NVAA 1JGMA 1TJRA 4K2SA 4ZQCA 4QXIA 4JX4A 3F2DA 3GDKA 5JU6A 2PODA 1XH1A 4AX6A 4R9OA 2R9RA 3D3AA 4AIBA 3BVJA 2IW0A 3MUZ1 1W6TA 3WLRA 3C2EA 3QYSA 4EF8A 1A3HA 2ZADA 2GGEA 4U28A 8TIMA 3GDTA 4DO6A 2CZEA 1H7XA 5E5CA 1UWIA 1XQLA 2DUXA 3HV8A 3PR2A 1MVYA 4P7RA 3KOWA 4TVUA 2PWHA 2PF0A 1X6NA 2CPUA 3U9IA 1TPDA 2ZUWA 1CGUA 3M43A 3BE7A 5I3JA 3POCA 3JZUA 2VL4A 5C2CA 1TV7A 5DXYA 1RPXA 1UWAA 4QJ1A 3PJUA 1QAPA 2D0HA 4AD1A 1J6PA 3KW3A 1KFJA 1H7WA 2CWXA 1PUDA 4MNKA 1CYGA 4WSJA 4P7OA 2UY3A 1OM0A 1O60A 4TTGA 3VFCA 3O3RA 4HCDA 3SIZA 1RA0A 3WLTA 4AX7A 4LJ3A 2GQ9A 1LQAA 5FF3A 4EIVA 2Q8XA 4ML9A 5FIPA 2W63A 3AICA 4UOJA 4DB7A 1QASA 2GWGA 1DHKA 3GG7A 3LGGA 3VDHA 1M65A 1EIXA 3ZR4A 1GPFA 3L9CA 4Q8VA 1EDGA 1KV8A 4Y8FA 4S1FA 4BEUA 3REQB 4EPEC 2ZRZA 4EPBC 4QDWA 5BWAA 2WSYA 2FYMA 1TVPA 3T2PA 5K4ZA 5A3HA 2RHGA 4ILSA 4DN1A 1EOMA 1XXXA 4NJKA 3MDWA 2FZDA 4GYPA 1XC4A 3N25A 4N2YA 1OK4A 3EGJA 3A13A 4R34A 2I9EA 4XKYB 1P1MA 3E0FA 3AS1A 1KGWA 4QDMA 2PDUA 1XLHA 1PPIA 1QHZA 4D8LA 4IX2A 3C8NA 4LFYA 4RPQA 2C19A 3C56A 5D03A 3G0XA 1NOFA 5DMLA 1OG0A 1U1UA 3UR7A 1RY0A 3L4VA 4ERGA 4UFKA 2CZ5A 3S5OA 3UZYA 1X38A 3VKDA 3ITOA 3LPOA 4F2TA 2CHOA 2VFIA 4QLLA 5A2AA 3G8RA 2E77A 1GQIA 5CZKA 4YVPA 7ODCA 1XRFA 4A8NA 3NGJA 3VVGA 2X0HA 3ZSSA 4PMDA 1BLIA 1XYAA 4FF5A 1W37A 1W1A1 4AIEA 1ISWA 5FSDC 4G2DA 3AU2A 1J8VA 3G77A 3N2BA 3MVTA 3LSBA 4J3VA 1A3XA 1XKJA 2EBNA 4R27A 5HUOA 3GWQA 3QTPA 4NAEB 4G5DA 1CLVA 1YXDA 3QH2A 2VC7A 5JBDA 1GNXA 4D6GA 4ADTA 1TPFA 1QNQA 2HK1A 3I4KA 3B8TA 4Q8QA 4DZHA 1H5VA 4MAVA 4LS1A 2G41A 2G0WA 3B0VC 1E4MM 4US5A 4AY7A 2AL1A 1IEWA 3ABXA 5H1WA 1HJWA 5JXQA 1VFHA 4LAZA 5BRPA 3TTYA 3TW7A 4QTGA 1K1DA 3FSUA 1TMQA 2W5FA 1SSGA 3CASA 5T91A 1JQVA 4MFDA 3PZUA 3RM4A 3WDRA 2CZVA 4ZE5A 3N18A 4MLJA 3CHVA 5AECA 1EGMA 3Q58A 1M7XA 1VLIA 4CEUC 4NAFA 3QSRA 3MSRA 5CGQA 3ERPA 4M6VA 2WO5A 3G1DA 1R30A 2XM2A 2YDAA 4IFKA 1E4LA 1ZPTA 2ZXDA 5G1MA 2GVJA 3NSMA 3OVPA 3ISIX 3NR0A 1KM3A 5REQA 1RP8A 1KFWA 4ASTA 4RL3A 1JYWA 1UJQA 4IQEA 1B9BA 2Y7FA 2NQJA 1KD0A 3UXKA 3W7IA 4F40A 1IT8A 1XGEA 2RDTA 3AS3A 5E0KA 3AI0A 1JUEA 4L64A 2C18A 2AGKA 3LPPA 4K1GA 3RCMA 1TCMA 4ZB0A 2Y8VA 3HPZA 1EL3A 7A3HA 1OY0A 4H9UA 1R85A 1A5LC 4C7DA 4KS0A 3CB3A 3UBPC 1CPUA 1UWRA 2F38A 3MB9A 2B4GA 1OX4A 3M0JA 3E2SA 4R7OA 2XH4A 3ZT7A 4LALA 3BGAA 2I5GA 1HVXA 1SJAA 5REQB 3RO6A 2ATSA 4PUDA 3S9ZA 1UKOA 3SUUA 1R3QA 2QCGA 2R6OA 3IGHX 3PN8A 3FYYA 1MDRA 5KMYA 1S3TC 3KVKA 2CLHA 4JTGA 1M53A 4QHRA 3NQ6A 4IM4A 3TWAA 1W9DM 2DQWA 1V5XA 3EOSA 2YXOA 4KF1A 2FPTA 2CCRA 3VOCA 4QE5A 3N2OA 3IAPA 4PMNA 3LCLA 1PKLA 1DWGM 2GVGA 3P80A 3WLNA 4MWAE 1FWGC 3UVAA 4CNUA 4GYFA 4US5D 4OV9A 4Y2WA 2R82A 4AD3A 4C6LA 1AL8A 1NFPA 1J0HA 2A3CA 2WWCA 1BVZA 1NWSA 2C7FA 4XZNX 1AA1B 3DCPA 3CZJA 5I79A 3U57A 3UESA 2HDJA 2QVHA 3VGHA 3VO0A 4C6DA 3CGTA 4FXRA 4C6QA 3TU9A 4KGLA 5D9PA 1DORA 3N04A 4GX8A 2J9ZA 2JK2A 3NPWA 1PKMA 3M5YA 3SRDA 1XJBA 1NFGA 3L5AA 2CLPA 1H41A 4FOKA 1W3JA 5FJJA 4AZCA 5LIKX 1I2RA 3KHDA 1QHOA 4AD2A 2Y7EA 3WLOA 2CYGA 4QJ5B 1KXTA 3F4DA 4K39A 1W17A 4W84A 3UXAA 4ZOEA 3VD7A 3C3NA 3A5FA 4KWOA 1FWIC 2CLOA 2NVCA 3EX3A 4O53A 1YADA 4JD4A 1TVLA 2V5BA 1GUVA 4GMEA 1YLVA 3KAOA 3W7OA 2CC0A 2OEMA 3AQUA 4QR6A 4QE1A 1B3ZA 3GSMA 3B8WA 1KR0A 3PJWA 3S1VA 2PDNA 4UTJA 3MS8A 3NQBA 4Y96A 5LNSA 1XUZA 4UTTC 1OYCA 3PPFA 4IZGA 4UB9A 3VI2A 2CLIA 4RX0A 1CWYA 4ZR8A 3UVIA 1K8XA 4HZ8A 5EMYA 4C7GA 3CPUA 5AYIA 2E6DA 4KW2A 3G3DA 2PP0A 4PUUA 3C4UA 3WJXA 1KRBC 3W2LA 3IV3A 3ES7A 5EL1A 1D3CA 4GPNA 1GQLA 3A47A 3SCWA 3NPUA 3HMCA 2NQ5A 4ZE4A 3T0CA 4LAKA 1CXEA 3SB0A 1E70M 2LLEA 5A69A 4E8GA 1NOUA 4TXEA 3V16A 4IFOA 4D6DA 2BY3A 5HWMA 4CLMA 2V82A 3T44A 2CLEA 1HXJA 5JH2A 1EC7A 3F4CA 2VRQA 5JVLA 3V0UA 5HUPA 2FB3A 4IPIA 2J8TA 2OMAA 4AVFA 4QAIA 1FP8A 3ZYZA 1YE4A 2A4AA 3QQ0A 5CC3A 4O16A 4IP4A 2YCEA 4WEVX 4HNCA 4W5UA 3MMWA 2ASHA 2J47A 1W9PA 5F2IA 4H4IA 2DSKA 5C9UA 1A50A 3UPWA 5BXRA 3M0KA 3V1PA 5AHEA 1M04A 4R85A 4M0XA 1L9WA 4ZO9A 2WVVA 1SZRA 4RE0A 3UY8A 3M47A 1ZCOA 3IJ9A 1QRQA 5A6MA 4OJYA 3W23A 4DYEA 4L7ZA 2WMIB 4B4HA 3JZEA 4XG1A 3LRLA 3TN4A 1RQEA 2WNNA 3GR7A 3WBAA 4DJFD 1TSIA 3NYDA 2DH2A 3S6OA 3A12A 3B9DA 3PBMA 3CQKA 4YVVA 2PDPA 3IGXA 5I09A 3NSNA 4PL1A 1TUFA 4IXXA 4IXHA 5EMUA 4IHCA 3OG2A 4C6NA 4AYGA 4D6HA 4FXJA 1H61A 4KWSA 2Z26A 1KLYA 1G4PA 2FZ8A 3WLJA 4ZEPA 4PTVA 4KEZA 3BAXA 2NUYA 2QUMA 3OJGA 3BURA 1PKYA 1UMLA 4YU1A 3UXLA 4QRNA 3KRSA 3W7KA 3EDFA 2Z1KA 1XCFA 2IXVA 3H21A 6TIMA 2E5CA 2REQA 3W71A 1R2SA 2OZ0A 5IDZA 1XDLA 4ZTXA 3PBYA 5AYXA 2CESA 3LTYA 3R79A 4F9JA 3WH8A 3M7SA 2ISFA 4ACZA 1GW1A 4YMZA 1UUOA 3A6OA 3H54A 1VS1A 3APYA 3ZFHA 1BFNA 2PURA 3MT1A 1X96A 4JYDA 2BY0A 1I0DA 1MXSA 5G4WA 4LF2A 3W70A 4NZ3A 4NYUA 3S2MA 3I65A 4DLMA 4H6RA 2NT1A 2A7PA 1PVNA 3MV11 2QYGA 1JGIA 3CYJA 1EF2A 2QJNA 4TV5A 4EWJA 2DV0A 5D05A 5F4WA 3T2OA 4W5ZA 2XIIA 4XKMA 2O4QA 3GO2A 3PULA 1UB3A 2AMXA 1QT1A 1RPKA 2REQB 1LOSA 3KS6A 3BICA 1UROA 3NOEA 4LYRA 4X0VA 2XUCA 3LI1A 3RILA 4GUGA 1LJYA 2HNEA 3H24A 4OVXA 4GI8A 4JEQA 5EPDA 3AHTA 4MZ1A 4ACZB 1TWWA 4JTAA 4LAUA 1HT6A 3LM7A 3PTQA 1KCZA 1KBKA 3IRDA 3TYDA 4AVOA 2Y63A 3RMEA 1EYEA 3VNKA 4LCQA 2C71A 1J9YA 4ZO6A 4TVDA 4L65A 1E4NA 1X98A 4C7FA 3WO8A 1Q5MA 4IX0A 4TMCA 5E6YA 3E49A 1TO3A 3RMJA 3EWUA 1D9EA 1UD2A 2Y5EA 3V0TA 3UG8A 1DXEA 5FEPA 3DZ1A 3WDJA 4MPQA 2DIJA 3MCMA 3DHUA 2EXOA 4DVOA 1PZ2A 4R3UA 3SIMA 1BTMA 3G6LA 1QK0A 2FLIA 4HA0A 4WJEA 4JR5A 1V3HA 1V02A 3W1MA 3R0DA 1EXPA 1QVBA 1YKWA 4HCLA 1AQHA 3TYUA 3SJ3A 5DMMA 2J7EA 5IFPA 4NRSA 4E2DA 4UNLA 4L9YA 3W73A 3WN6A 2QDDA 5BU9A 3W6MA 4H9YA 3S4TA 3K1GA 4Q8OA 3KDNA 1W1IE 1FDYA 3FY1A 4WKHA 4WGHA 3EBVA 5CBIA 2GOUA 5U4NA 1VF8A 4BF5A 4DO7A 4GLEA 1IT0A 1AMYA 4Y6GA 1J11A 3IAQA 3P6LA 1I60A 4K7YA 1XP3A 1HGWA 4GD0A 3PZ9A 1FA2A 3H8AA 4J9JA 1JAKA 2PGFA 4PMUA 1FXQA 4LBUA 4LRTA 4CQ9A 2GGIA 3LG3A 3VIJA 2A3AA 1Q6QA 4JEJA 2BVTA 1Z44A 5AVNA 1JDDA 3PAJA 3QVQA 1UQZA 1DE5A 4IIHA 2OODA 4UTWC 3VDCA 5HINA 4HMEA 1VPQA 3O7UA 3RCNA 3FJLA 3QY7A 3H2MA 1H09A 2I9UA 1TE6A 5RUBA 2J7CA 4PUKA 2PEVA 3FK4A 2VX4A 2PBGA 3NQ2A 4UZUA 4UR9A 1GVFA 4I9AA 1JG9A 2SFPA 2W0UA 3ZOAA 3CM4A 3EDKA 4D8ZA 4IPLA 5HXMA 2PLMA 3PZTA 3DFTA 3LQGA 3HG5A 4GIRA 3EPOA 4AFYA 3RHGA 5CPLA 3EOLA 5IDIA 3IUDA 1V77A 1E6PA 4JTTA 2VFEA 3EWWA 3N2MA 1QW9A 3S8HA 2PS2A 1CXFA 1OYAA 2GQAA 5AHLA 1W5NA 1XLKA 3F7JA 4U31A 2DJLA 2WV8A 3OTRA 3UXIA 4JN6A 1M41A 3LB0A 2QUTA 2QDGA 4AEOA 4W7UA 2PSNA 4GCXA 1GVYA 3QZAA 3F1QA 4MLRA 2OSXA 5IBXC 4XD6A 3FJ4A 4GCAA 4CQAA 3LXCA 4HIBA 4HHHA 1EGZA 4ICNA 3TA9A 2V5LA 3DBNA 4GI6A 1JAEA 4V1YA 3ZIZA 1U1HA 3VMOA 4HPGA 3MWCA 4LAOA 2CXGA 4M19A 5I0DA 4TTUA 3GRIA 4BJHA 5FSEC 3QBUA 5BCAA 4PUEA 3M16A 2CERA 2RDWA 3C0JA 3T0DA 1TVNA 2X1IA 1V6YA 2VFHA 1U5VA 2CEQA 6A3HA 1XWYA 2HRWA 1LYXA 1XFBA 4RZ6A 2OLSA 4QFUA 2Q02A 5CEWA 4AXNA 3P60A 1L6YA 3G3MA 1PX3A 2NV1A 3KTSA 3LTPA 2PDFA 1NAL1 4M6PA 5BZAA 2HVNA 4IMCA 5H2ZA 4X2RA 2P5NA 2C91A 2JE8A 1LQ2A 3PPGA 2XWDA 1MUWA 4WRHA 4XIMA 3DC0A 5GVJA 1DJNA 1X7IA 1E9IA 1DTUA 2XIBA 3E74A 4AZHA 4CQ8A 5HJYA 1I45A 3O0FA 3CIVA 1OVDA 4JY9A 1SJCA 3ME3A 2GJLA 5BMXA 3W7MA 3PAOA 4F9DA 3IGUA 1XYCA 3OO2A 4ZO7A 1Z8AA 2CBUA 2Y24A 3PS7A 1BRLB 1R6WA 4JAWA 2J62A 1CT5A 3BLIA 4DQWA 2PDCA 1C93A 1LOLA 2QIIA 2Z1SA 4LY8A 4LUSB 3DESA 3L4ZA 2H3BA 3T09A 4AB4A 3GC4A 3SN4A 1U1JA 1VH7A 1P6WA 3S9YA 1QO5A 3THQA 3A4AA 4XWUA 4NZ4A 3QLLA 1K4HA 1IEXA 3M6YA 1WXJA 3RIKA 3TCSA 1YTEA 3PBVA 1PWLA 4UFHA 3GXDA 1A5BA 2FTYA 5A8OA 1BGAA 1VIZA 4K7VA 2YL6A 2WXDM 3EXRA 3ANVA 1XICA 1P6CA 4HMDA 3F2BA 4UFMA 2ZZ4A 4P8XA 4WJXA 1EWDA 4MB3A 2ZA1A 2VP8A 1C90A 1M7PA 1K02A 4QG6A 2PU0A 4AVNA 5I3HA 2WZMA 2CHNA 4NZ5A 1S2WA 3KBSA 2GK1A 2J88A 4GVIA 3BAYA 3V5FA 5G2WA 2HTMA 3IIZA 2HJPA 3UJSA 1ZBWA 1BWVA 2F2HA 3WCZA 3MUCA 5IRPA 1KQZA 3AYRA 1SR0A 4HMCA 4DY1A 2VT0A 1BPLB 1LCOA 1MWOA 3VDAA 3WX7A 3BLPX 4POCA 2XIQA 3HQNA 4DUVA 4IUOA 3WQPA 1HF6A 1NQKA 2D1ZA 3OLEA 4WKFA 1XLCA 3WLLA 5CCZA 4PR4A 1OC5A 1W91A 3EOEA 2Y8KA 4YIWA 3P14A 3NUKA 3T1GA 4C6CA 5A95A 2YKKA 1Q3NA 2WKLA 3PG9A 4PMRA 3TROA 1RHCA 3B8VA 2BHUA 3C6CA 1ZZMA 1ML1A 2GGGA 3L4YA 1K7EA 2W9MA 4UWMA 2WMJA 4BEQA 4WX2A 1HKIA 4BCEA 2BNJA 3W1UA 3W7GA 4QJ4B 3OVQA 4KRUA 1LT7A 1ZP4A 3CHFA 2A1YA 1LORA 4QLJA 4NYYA 3M0ZA 2E25A 4WY0F 1VHCA 4H83A 1PEZA 3NEHA 3S2CA 3AXHA 3QW3A 2PGWA 1KC7A 1B3OA 3V36A 4OGZA 1GVQA 1B90A 1IYXA 3LY0A 2V63A 3ARPA 2Y4SA 4QS5A 2XH0A 2IKIA 1LLOA 1NDWA 3UFYA 3WMLA 4WXZA 4JFWA 4OU1A 4GI4A 4KWVA 2QPXA 4XZLX 3N11A 4PYSA 1GVOA 5LA0A 1NOWA 1N82A 3QC3A 3TK7A 1M7OA 3SJNA 3GXTA 3ARQA 2ZX9A 3EA1A 3T0AA 3NVDA 2HPIA 3QV8A 2ZA2A 2DQXA 3GM8A 2WMGA 4REQA 1J2WA 3BMVA 4RNJA 2GPTA 3WQWA 4B5UA 1GOMA 3MYOA 1NM9A 1S5WA 1J12A 1UC5A 2VDGA 3VIFA 3VINA 2H9AB 3HGJA 2DVTA 4Z42C 4U3CA 4LUJA 4EAYA 1ZP3A 5FACA 3B8UA 3WK0A 3W76A 3GDRA 3S5NA 4J4KA 3WQFA 3PSWA 4A3YA 1UP2A 4OZOA 2PDGA 3CV1A 2WANA 1QUMA 1Z89A 2J27A 2A5HA 3PY2A 1H0IA 1N2VA 3A9IA 1GOIA 2VGBA 3L23A 1I2PA 1V6UA 4N02A 4F3HA 3NL2A 5B80A 4OWGA 1E15A 1YTDA 2Y62A 4KCVA 1AW1A 3FOKA 3VTRA 4ZFCA 2NSOA 4CU6A 4NNCA 4CUCA 1R5YA 1R9YA 4UOQA 1HGYA 4O1AA 1PWMA 3VOIA 2YW4A 2ZC1A 4PCNA 1JF6A 3DENA 4DXXA 2DZWA 2DZXA 1E56A 4Q4SA 1MUMA 4I9JA 2DVUA 1EA9C 2PWUA 4H8UA 1YPFA 4MF4A 3EXSA 4HNUA 3JUGA 4B16A 2RKXA 3TZFA 4GNJA 4IIEA 5H8MA 4YXGA 1US0A 5TNVA 4C65A 1AD4A 2DSWA 4BKNA 4XSLA 1G4TA 1EB3A 3O6CA 4GE8A 2DZSA 4QSFA 4Q7NA 1P6BA 4DELA 1O66A 2EKCA 4XV0A 3G1RA 3FKRA 4HJFA 3WLIA 1JQXA 1IEVA 2E8ZA 2QV4A 4JNZA 3KL3A 5TIMA 9CGTA 1F61A 3CZ8A 3H53A 4L4PA 7CGTA 1HJSA 3L4WA 3J7HA 1C8YA 3OBAA 1DJYA 4HCHA 2XVNA 1LWIA 3WDHA 3N1AA 4FXFA 3L5MA 3EWYA 3MJMA 5DBUA 4V2XA 3HGSA 3ARVA 1A47A 3TOYA 3UU0A 1TQXA 1RXOB 5E6ZA 4HJWA 4TV6A 2YDSA 4H8NA 3VIMA 3F4WA 4X61A 4J3SA 4PB3A 4PTXA 2NX9A 4AZ5A 1RVGA 1OCJA 4LX4A 2DJXA 4JTHA 3LHTA 3H2NA 2VELA 3GKAA 3BH4A 3VD9A 2QKFA 3P2VA 2GFTA 2XVGA 5D2VA 4QBXA 1TG7A 3HA1A 1JZ2A 1PCKA 2ZE3A 4LS0A 1J79A 1GJUA 1SR9A 3U4FA 3E2RA 5DELA 1RSCA 3OHIA 4DPPA 2FFCA 4AG0A 4H9ZA 3OHMB 3BDKA 1H0GA 4GQQA 3AIVA 1QI5A 4M3PA 5MF5A 3LQLA 1HJQA 4YLWA 4C6IA 2VR5A 2DSUA 4HNTA 2EF9A 2J4GA 3SQSA 3B03A 1Q6DA 4DUWA 4MHBA 2G50A 3A9BA 4CNSA 1MYRA 4ZQPA 4WDTA 1JZ3A 1HO1A 3O6YX 4M56A 1G4SA 3UT0A 1JZ5A 4B9ZA 4K68A 1E40A 3SO7A 3NZPA 4PB5A 1ADDA 1H7NA 3AIRA 2ZBTA 1BSIA 3UZ5A 1EKOA 1MZHA 4WXYA 3OW1A 1BYAA 2GSJA 1JIBA 6ALDA 2CLLA 1FH7A 1XGDA 5D33A 3OA3A 5DX7A 1V4YA 4KPLA 5EU9A 3UWYA 3KM8A 3QF0A 4FOUA 3WG6A 3R0KA 5EBAA 2JEPA 1XLAA 1DJIA 1R2TA 4XD5A 2EO7A 1J0JA 1LUCA 1HO4A 1TWIA 1WZAA 4U5IA 4A3RA 7PTDA 2E7FA 4ATLA 1W2VA 2WSKA 3TJLA 1P4CA 3AMGA 4OUIA 1XHGA 4LH8A 3RO8A 2W66A 1VRDA 4I3GA 4PMZA 2BWGA 4H8HA 4HN8A 5CG7A 3AXXA 4V15A 2VRKA 3SFKA 1G7VA 2OPJA 3BLDA 4LRSA 4JCLA 3B05A 1T5AA 2QQ6A 3MHUA 4B3LA 1YIXA 4GUHA 1FWEC 4IGSA 5DY3A 2DT0A 1V7AA 1SJDA 5I3GA 4PMYA 3RLHA 2F7FA 3W1RA 4YTRA 4ALDA 2NXHA 3MUIA 1EYWA 1JCNA 5F2MA 4BS0A 3Q94A 4MSSA 4A3UA 1Q13A 3EA2A 2I56A 2Q3OA 4UMAA 1S5VA 5A6TC 3I68A 3BAIA 3LENA 3TC3A 2P1FA 2ZUUA 3WYZA 4ZSUA 2BV9A 1W8GA 4PBEA 3G18A 3CUXA 4DBEA 3QOMA 3ARWA 1UD8A 4C5YA 1V7YA 1F05A 2YA0A 4UUIA 2BGNE 4QAWA 2BVDA 4GI9A 4C91A 4OKDA 3GDBA 3TTSA 4GGBA 3VKAA 4RW5A 1TR1A 5BOEA 4UMCA 1VFLA 2ZZ6A 3KTCA 3N34A 3QKZA 2IPWA 4JTCA 1PAMA 4AH7A 1O94A 4DNMA 3W7EA 4C6OA 2WMFA 3PBUA 4A3HA 2X1UA 4WY0A 2Z1XA 5A2BA 1LROA 1BXNA 1VFMA 2Y7GA 4W93A 1WUFA 5I78A 2OOFA 3UZZA 3KCJA 1VJSA 2WVSA 2QUVA 1WDDA 4GNKB 4WR3A 3W38A 1MQQA 3H70A 3HJZA 2INEA 2CNCA 2G3MA 2VFGA 3N4FA 3QMSA 3DHPA 4GACA 3W87A 5F4XA 3TQVA 1ZAIA 4FLRA 5HMEA 2CLKA 4M51A 3UG5A 3URQA 4I6KA 4L4LA 4GWEA 4DZIA 2BGSA 2CZFA 2X42A 5M03A 5I6SA 1DHPA 1I2QA 1S2AA 4HK7A 4KCUA 3VM5A 1A5KC 1EX5A 3A3XA 4HZ6A 4LUTA 3DYOA 1AMKA 3KZPA 8XIAA 4PCPA 2J9XA 1TV4A 1SZNA 1L6SA 2PTWA 2AKZA 4LVBA 3I7RA 1F6PA 4KEVA 3FSTA 4G7EA 3VOGA 3RNDA 3W28A 2VEPA 1AQMA 1ECEA 4C1NA 4D6CA 2D0GA 2YLAA 5I2UA 4DUOA 4MWAB 2ZX7A 1I2OA 5HATA 3K1DA 4DBDA 2X0YA 3GVGA 5ENLA 1KBLA 1VC4A 4EF9A 1WAUA 1GVRA 3I3DA 4WGXA 3UQNA 4HHMA 2L5HA 1Z48A 2VUYA 4IG2B 2DZPA 1GONA 4LY4A 4DBSA 4CCEA 2D0FA 3VIPA 3B3DA 2GWNA 3S83A 1N8WA 2Z4GA 3WDQA 3HIJA 1P43A 5AC5A 1Y5WA 1JUBA 1VRXA 3KP0A 4LUTB 1TZ7A 5I23A 1QI4A 1SZFA 3WLMA 2ZX8A 1QMLA 6XIAA 1TA3B 1XD1A 4F0RA 1JRCA 1OADA 3TZNA 3EX6A 3ABRA 4BQ4A 3THDA 4E4FA 4JTIA 4G7EB 1SQ7A 2F61A 3R7MA 1JDCA 3R25A 2Z0IA 3NPXA 4J40A 4L6DA 3QPYA 3QKEA 4H6QA 4ATWA 2ISVA 4IQJA 1VJIA 2E68A 1FWNA 3BLOA 1RBOB 1J96A 4XVEA 1JZ7A 3HF3A 3MANA 1MSSA 3NQEA 2JIWA 3ECQA 3B0YA 3T4CA 1UOKA 2VJXA 3PPCA 2ZRYA 2EJ1A 1RCOB 2INFA 3FHQA 2W6RA 3T7VA 4G1KA 1IXPA 4JQAA 1X7FA 1MW0A 4C6JA 2E8YA 3W84A 2PU1A 1SO5A 2OELA 4JIPA 1FH9A 2RGMA 1CB2A 2QEZA 2ZXAA 4AQLA 3ZJ6A 3QGAC 3U2ZA 3AC0A 2VFDA 3KBNA 5IXEA 1LZOA 1X97A 3W1LA 3THUA 1ISYA 4CD4A 4O28A 1PO9A 1L8PA 3MSGA 4QG9A 4RE3A 3KDOA 1YNQA 3TNBA 2VOMA 5CPTA 2GJXA 4GH3A 1Q85A 4QDPA 1FFQA 4D1JA 1ONEA 3CUGA 4Y9OA 5AYBA 3QHOA 3WUEA 4CVWA 4PMXA 1DQXA 2JALA 4LU0A 1I6NA 2KZHA 3AAMA 1TE1A 2XSAA 4U33A 1D3HA 4HSNA 1WKDA 1QNOA 4CVUA 1DXFA 1S3HA 3HZ3A 3CYVA 5AZ1A 5M2FX 4FLQA 2ZZ2A 1OK6A 1VYRA 2ON3A 3URNA 1DOSA 5G2IA 2NT0A 1ZGDA 4IPNB 4QLKA 5FOOA 3W2KA 1ZJBA 3OZMA 3U4AA 2GL5A 5D2YA 4W4QA 4JKLA 4UFJA 4JHMA 4CD5A 3MSYA 1VYSX 3STGA 3ZMRA 1E6XM 1SM9A 2WAGA 3PJXA 3VIOA 1KFBA 3LK6A 3ANYA 1UPMB 4MKVA 3N29A 1A4MA 3WNOA 2V81A 3CQ0A 1OG6A 1X8FA 4N4PA 4LC6A 3HM7A 4OFCA 2FKPA 2VCBA 2G4FA 3OBKA 3QMTA 4HTYA 2Z27A 4N7QA 5A94A 3MUAA 3W7QA 2WM1A 2INZA 1RLCL 3R1ZA 2O55A 1IZKA 5CQ1A 2PLJA 1GYLA 5CC7A 2I14A 1DIKA 3P8JA 3NTYA 4R88A 1H62A 1RBAA 1Y7VA 4KFPA 4D6FA 2PFHA 1MEWA 1SZEA 4AU0A 1WDQA 3ARSA 4GXPA 3VCRA 5LGXA 2YDRA 3CIXA 1UA3A 4UNIA 2NWSA 4ZQNA 3IV8A 4AD5A 4O8RA 4QNWA 4DRSA 3HBLA 2QV5A 2PUZA 3L7RA 4R7JA 2A7NA 3UP8A 2OZ8A 5BXTA 3WEMA 4LYKA 2Q8LA 4XTDA 1Q6CA 2EPOA 4IGHA 3M4HA 2OSYA 3NIYA 1QNPA 1J93A 3DG7A 3LZ5A 5FJIA 3WZ0E 5L9FA 2QZRA 2UY2A 4ZO8A 2AQVA 2WBGA 2G97A 1C92A 1QI2A 2C15A 1H51A 5K3VA 1QOXA 4CNPA 1KB3A 3AO0A 3JR2A 5D02A 1IXOA 2ISSA 3GNOA 4ADUA 1VFUA 2YR1A 3GE7A 3C0LA 1XIGA 1JCMP 2OYMA 4GZ7A 1Z42A 2YBUA 1YEYA 1TX2A 1LTDA 4UR8A 3URBA 4O54A 1H7PA 2G3IA 1E43A 3L4UA 5HQEA 2IPJA 3AWOA 5IBXA 2F2KA 2O56A 4PBFA 3TA6A 2QPSA 4H1ZA 2B7PA 5DCDA 2VZVA 6REQA 1SW0A 1B4KA 1OZQA 3CU2A 1LRTA 2J7HA 1RV8A 1XLMA 2OX4A 3TV8A 4HTBA 1WX0A 4EPKA 2W3ZA 3L2MA 2ZKMX 1EO7A 1KKRA 2EPMX 4MY9A 1XI3A 3UJ2A 3IANA 1UR4A 3GB6A 1S5MA 4Q7BA 4RXFA 1HL8A 3GX9A 3PBWA 3A23A 3PHAA 1JDEA 2YW3A 2HE8A 5A6AA 1XLIA 3R11A 2OYLA 3GNRA 2RDUA 1XGZA 1XFCA 1OGGA 1W3IA 1NSJA 1J0ZA 3VIKA 4K6AA 2FMOA 1UASA 1ZJIA 1UMYA 3UGVA 4IIDA 3WUGA 1UP0A 2AAMA 3W07A 2JFEX 3VNIA 4Y7EA 3BLLA 1P7TA 3AHXA 5CZJA 2G3JA 4DJEC 1LL6A 1TMHA 1KBJA 3SURA 2UY4A 4BFAA 1Y0EA 2GGHA 1MDLA 4NILA 4Q8NA 3PUGA 3EXTA 2B0MA 3R8HA 1K8YA 3TAKA 3T0TA 3AXMA 1JNEA 1K8CA 3EPMA 3GXMA 2ZUVA 1QW7A 1NY1A 5K9CA 4AWUA 1GW9A 2DW6A 4AF0A 2QMJA 2BTMA 1VB9A 2QS8A 1NVMA 3UXDA 5KITA 4AEFA 4JPGA 4E2VA 1AH3A 2O0TA 4LNYA 1X1OA 4O17A 3L66A 4FZIA 3L65A 4M5PA 4MADA 4DBUA 6CGTA 4GYKA 1EJ7L 3NQGA 1E6ZA 3WLKX 4DO4A 3MDUA 1OFEA 1PB0A 3M41A 3NXLA 4M1BA 5G4HC 1JDFA 3LS9A 4OBSA 3BOLA 3JU2A 3KVMA 2ACSA 3SUTA 1GTHA 1V3IA 4WCJA 2QCDA 2HVOA 1V0KA 1DJXA 3AIBA 3P3BA 4V27A 3H2OA 4LB4A 1K9FA 2CKRA 2JF7A 4Q8MA 2ZRUA 3U6WA 3IVSA 3CBWA 3VGDA 4S2BA 5HR7A 4PULA 1QU4A 1WA3A 4AF0B 2CWNA 4HP5A 5B7ZA 5GJMA 1LRNA 4Z08A 1TWSA 4LBSA 1HN1A 2UBPC 2XM1A 3ABOA 2VOTA 1JPKA 1GEHA 1KBIA 2YFNA 3RX2A 1RLDA 4AAJA 4ZQMA 2ZUNA 3DDMA 3SQLA 2OKTA 5T9BG 1PZ0A 1IE7C 2IPGA 3INPA 2QVNA 3WF3A 1XV8A 3WFAA 1Q7QA 3NQ7A 3QY6A 3VXGA 3I6EA 4LUIA 3QQ1A 2OO6A 2VCAA 5I77A 3LSCA 1PZ1A 2Q3RA 5C70A 1IR1A 3H4XA 4XZIA 2GZXA 4H6EA 4M6QA 1ISVA 1NDYA 3TQ0A 1RJPA 3E1F1 2YYTA 1SO4A 3VIGA 1TREA 1XLGA 4ROQA 4EANA 4H3DA 3IJ7A 1EGVA 1X1NA 2WW5A 2BDQA 2VZTA 3W88A 3GVWA 1US3A 1EQCA 4ZB5A 1M5WA 3UZXA 4RK8A 2CITA 4RW3A 2PF8A 1RR2A 3ZO9A 3SCPA 1NTHA 1E0TA 3R6IA 3QN3A 2GDVA 4AWTA 4K1WA 1UWQA 1DE6A 2AGTA 1C9WA 3EKGA 1W2PA 4DBWA 3N2CA 4FNUA 4QX4A 3QR3A 1ADOA 4BZYA 1Q7MA 3MBFA 2DFAA 2R1LA 2D69A 4J27A 3O06A 1KM1A 1V3LA 1XCXA 3QFEA 1ITUA 4DWSB 4HPJA 4JIQA 1A5NC 1W3LA 1YRRA 2D2HA 2OEJA 3KOFA 1H49A 1AQ0A 4MB5A 1S2TA 3T40A 1NIUA 2HVMA 3OVRA 4M7SA 4Z1YA 1NEYA 3CWHA 2V5CA 4DIAA 2HWGA 4OIFA 1HG3A 1JCXA 4N9CA 5HK4A 3RK8A 1HUVA 1XIDA 2IPFA 3AYTA 5HMFA 3TKFA 3VILA 2G3NA 3C86A 2X1RA 4K38A 4TUFA 3F4NA 2VEKA 5HMSA 3EEZA 2FHCA 1QNVA 3AZSA 3EMQA 1W56A 3GNXA 3IS4A 4O11A 2EPLX 1ONRA 1T96A 4OECA 3MHGA 1TTJA 3PUOA 4PRTA 4A21A 3BJSA 2P53A 4O14A 1U5JA 1VBGA 3AISA 3FCPA 5FF2A 3KS5A 1QI3A 1UJPA 3MHFA 4C5ZA 2XDFA 2DPEA 3QPEA 3CH9A 4HSOA 1MW3A 1GQJA 1NF7A 1GYMA 1O5RA 3TQPA 2QGHA 2NLYA 3FAXA 4LS2A 1W5MA 3WNMA 1XDMA 2XFRA 4IMDA 3CT7A 1BKSA 3JW7A 3U7BA 5CJMA 3K5XA 4LVGA 1ISZA 3SSJA 1YX1A 4CCDA 5MKGA 3VE7A 1EIBA 2YFOA 2NZLA 4P7NA 3W25A 4DJDA 1JXKA 1GZ1A 3PTMA 1RA5A 3NOYA 1I1WA 4U5KA 4IQLA 1LP6A 3W1PA 4FIQA 4FIRA 5D09A 5LIWX 3UW6A 4P5UA 2YX0A 4IPPA 2PRLA 4MTVA 5A6LA 3B0UX 4BI7A 3SRHA 2TODA 3I10A 1UZ4A 5CLTA 2PAJA 2J24A 1W9BM 1NARA 1QOQA 2Y8UA 3W1TA 1PX4A 3PFMA 3U5UA 1E1FA 2ZZ7A 3O0KA 1A4LA 3HFYA 4XSMA 4GABA 3EX2A 4UFIA 3U48A 1O5QA 2YXXA 4LVFA 2NX1A 3DC8A 5MKGB 4L61A 4D8AA 2XZ9A 2XVKA 1A3WA 4M24A 1GKRA 3ATYA 3VMPA 2ZDRA 1DYSA 2V3DA 2O9RA 1TTIA 4F66A 1VCFA 1QFEA 5J04A 1MXDA 3ARXA 5D4YA 3TSMA 1ECQA 5HJXA 4F79A 2C1GA 1FWJC 3B0PA 3QEZA 5FEXA 1UKSA 3MCNA 4BF7A 3SFWA 3T4WA 1NU5A 5KEZA 1JI2A 1FDJA 3C61A 3Q4DA 2VD8A 2WCGA 4Y9NA 1V3MA 3WEOA 3V18A 1CLXA 3DG3A 4HB7A 1XBXA 4YL2A 1G0CA 2WLZA 3P81A 3DECA 1IIHA 2V9DA 3IUIA 3S46A 4O15A 1XBYA 5LYRA 2XGBA 2P0OA 3O15A 4JCMA 3UA4A 1WBJA 1OT2A 2H8ZA 7REQA 4OQVA 2YPIA 1HJUA 1U22A 3F5KA 4ZMGA 3IACA 1RCQA 4E8CA 5CAHA 4KBXA 5FEWA 1W5OA 4CD8A 4BQ5A 3MO4A 4YTUA 3TDFA 2XGZA 1IZJA 1AH0A 1AH4A 1FXPA 2C8NA 1DV7A 5BW6A 3GVQA 3BL3A 1X1ZA 2Y70A 4MYAA 3C2FA 3CZEA 5EB8A 1HKKA 3MV01 3RDKA 4U4MA 4IOTA 2OJPA 2YDQA 4XK2A 1E6SM 3EOUA 1JJKA 1KGXA 3MPGA 3NL5A 3UEQA 1HL2A 3MTWA 1CX9A 3OQEA 2WSPA 1DXIA 2PDBA 2FJUB 3VMNA 2WOQA 3B9NA 2WMKA 1TV2A 4UTMA 1CLKA 4LW7A 3OIXA 4Q8UA 1V51A 3NYZA 3OOQA 4YHGA 2PBOA 1WXYA 4AWSA 3GW3A 5I06A 1KFLA 1PIFA 1GOQA 2OEKA 2EQDA 4A3QA 2OLHA 2FPVA 1K9DA 4B5TA 1EJWC 1UWSA 3TYAA 1JCJA 4IGMA 3SGGA 3HJEA 3W1XA 1KLZA 1JXJA 1GQNA 6PTDA 5D2XA 3WMCA 4AXKA 2PA6A 3TWBA 3LPFA 1HP4A 2X1TA 2H8XA 4B5NA 2R1MA 5LSMA 3SY5A 2F84A 1UPPA 1UD4A 2WQPA 5JIWA 1W1TA 2VZUA 4JHZA 3SN0A 1FWDC 2EPKX 3HGOA 3HFTA 3TYZA 1IT7A 1N8IA 2VURA 3G1YA 3YPIA 4HHLA 3K4WA 3LMYA 5CJ5A 5A6BA 4CQDA 4NKCA 1P0NA 4WDUA 1HX0A 3M07A 1KWKA 3OA5A 2Y85A 3N12A 2HMCA 5C7VA 1FX6A 3LERA 2GUUA 1LBFA 1H1ZA 2ZUSA 3S5SA 3REQA 3W27A 3LN3A 3UYIA 1NDVA 1HTIA 1J10A 4JFUA 3D0CA 1V0NA 3BV7A 1KRCC 4DF1A 3KXQA 1TKKA 5FA5A 3RLVA 1Q6EA 4OOZA 3QPZA 1W1B1 4AZGA 2E3ZA 1KM5A 2GYIA 4IUGA 2PP3A 5GPRA 1E4IA 3UWEA 2V5DA 1O1HA 4CD7A 3FYPA 4JKMA 4HN4A 1GT8A 4XKYA 4C6MA 3ZLFA 3DFYA 4ONVA 4MPKA 5EFFA 4X22A 4WHBA 3WQGA 5CSRA 1DIEA 3VK5A 4ZSTA 2FGLA 3TC7A 2WZTA 4Q4QA 2DZTA 5FJPA 3NNTA 1NWUA 4HMNA 2OOGA 4WKAA 3BJTA 1JPDX 4DXKA 2NXIA 2XN0A 1CEOA 4CU8A 3GY1A 1XQKA 1KW1A 3WQ5A 2GJRA 1A5SA 1KV5A 1QJWA 1B3XA 4UOZA 1G9HA 3C3UA 4UQCA 4CN6A 3M5XA 3WH7A 2OQHA 1WKFA 1VFTA 3EOOA 4FPSA 2WYSA 4JQ1A 1XPYA 1EEXA 2EG6A 5DN1A 2CLFA 4AD4A 5LNUA 3BANA 2GUYA 5E70A 5HQMA 4RDWA 3OU8A 5DQPA 3GBDA 5XINA 1JDAA 1P0BA 3ZZ1A 4LVDA 4NX5A 2RH9A 1PYMA 3FX4A 5LNVA 3ZR6A 4NAEA 3KRZA 1MFUA 1QXLA 3FEQA 1AJZA 4AHPA 3VGBA 2XSXA 3WEZA 4Z2JA 1LT8A 4J3WA 4E2OA 3QM3A 1YPIA 3V75A 1MNSA 4BY3A 1LRQA 4I8DA 5BOOA 3FW6A 1C7SA 1G5AA 3L0KA 3W53A 1TQJA 1UBSA 2VDHA 3N4AA 1Z7AA 1XBZA 1RQBA 4R5EA 1KBBA 2GVEA 2OXNA 1A80A 1J5TA 1W1PA 2ZWYA 5CJNA 1T40A 3SY8A 4DI9A 1DJGA 1JPHA 2GJNA 3SR7A 3M5ZA 1SJBA 3H55A 5EY5A 3QR1A 1A0DA 2BXYA 2E1WA 4AEEA 4CD6A 1I4NA 3TR2A 4C6FA 2QF7A 3CNYA 3M0YA 3BZGA 2JBMA 2Y88A 1O12A 3WDIA 1JD9A 5DF0A 1S2UA 2XSBA 2DUZA 3WQEA 3UJRA 3NURA 2ADAA 4JDYA 4YN5A 2WVTA 4ML4A 2QJJA 1W9XA 2PZ0A 4NG3A 1XBVA 1ONWA 3NO1A 4QM1A 3WELA 4PEEA 1CXLA 1SPQA 2HBVA 4YPJA 4JQ4A 2GDQA 3OBEA 2OT0A 1JZ4A 5C2XA 1W3NA 3MMDA 3L2LA 1HQTA 3PB2A 4CCCA 1QI0A 2R1NA 4XISA 4E4UA 1YW1A 3RYSA 2HSAA 1DP0A 1B30A 1OJXA 1UH4A 2DW7A 4KWUA 1EJSC 2POTA 3AMDA 3MP5A 3GYCA 4MG4A 1YBQA 3TJ4A 5CKSA 4ES4A 4JKKA 3S2JA 5A8MA 2FVKA 3PTDA 3TW9A 3R89A 1WV2A 3UZJA 2V67A 3R10A 3FAWA 5DO8A 2WKJA 3S6DA 5FJRA 4LV9A 3BAKA 2VKZG 1R46A 2A79A 4E3TA 3HURA 2GSEA 1WOBA 3O07A 2Z2BA 1T0OA 4H8VA 3WD2A 2DSVA 2YXGA 1H63A 4MNMA 1CGTA 4HA3A 4LGXA 1GEQA 5GNXA 1EP3A 5FEZA 5AFDA 3AJXA 5BRBA 4YHEA 2OYKA 3BSMA 4IMEA 2O92A 2J13A 1WB0A 2QMKA 5LA1A 4H7ZA 1M7JA 7TAAA 4PRWA 1QR7A 1YBQB 1ZBCA 3GU9A 1FY6A 4FB7A 2ANUA 1R47A 3AZRA 2R1PA 3L0NA 3WLQA 1ZFJA 3QOKA 3V7PA 1UBPC 3KFTA 4NJJA 4RJEA 3U0HA 2PDLA 4HVXA 3CL8A 1W3TA 4L80A 3DGBA 1W54A 2DIEA 3WQCA 3CEUA 5I3DA 3T81A 2PE4A 2BLEA 3HU7A 1S39A 2H6RA 3KP1A 4RZ4A 2Z7GA 3EDJA 4KEUA 3LMZA 4D2JA 3CAQA 4I9TA 4WOQA 2AL2B 1DTNA 1FCQA 4EKJA 1EX1A 4BQ2A 1JRBA 2I5QA 2I5IA 2VWTA 2FH6A 3KBJA 1SSDA 2BOEX 2AQOA 4KESA 3EYPA 3AFBA 1XIFA 1C8QA 1Q6LA 3WLHA 4UTIA 1ISXA 1GKPA 2X0SA 3CAVA 2BSLA 5CPNA 3VU2A 2XJ7A 2Z7KA 1W32A 2OO0A 1TB3A 1I1XA 4KQNA 5FF7A 5KETA 3VKCA 2WVUA 3N4EA 3WDPP 3PZQA 3ITXA 1UWUA 1EFZA 1W9VA 3L4TA 3WJSA 3W9ZA 2V2HA 3NQDA 3G1SA 3ITCA 2OB3A 1YYAA <