1VP5A

Crystal structure of 2,5-diketo-d-gluconic acid reductase (tm1009) from thermotoga maritima at 2.40 a resolution
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
284
structure length
284
Chain Sequence
QVPKVTLNNGVEMPILGYGVFQIPPEKTEECVYEAIKVGYRLIDTAASYMNEEGVGRAIKRAIDEGIVRREELFVTTKLWVSDVGYESTKKAFEKSLKKLQLEYIDLYLIHQPFGDVHCAWKAMEEMYKDGLVRAIGVSNFYPDRLMDLMVHHEIVPAVNQIEIHPFYQRQEEIEFMRNYNIQPEAWGPFAEGRKNIFQNGVLRSIAEKYGKTVAQVILRWLTQKGIVAIPKTVRRERMKENISIFDFELTQEDMEKIATLDEGQSAFFSHRDPEVVKWICSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2,5-diketo-D-gluconic acid reductase
publication title Crystal structure of 2,5-diketo-D-gluconic acid reductase (TM1009) from Thermotoga maritima at 2.40 A resolution
rcsb
source organism Thermotoga maritima
total genus 108
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 1.1.1.274: 2,5-didehydrogluconate reductase (2-dehydro-D-gluconate-forming).
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1vp5A00
3CASA 4GIEA 5LIYX 3R7MA 3ONCA 1ZUAX 3R43A 4R9OA 3UG8A 4LAUA 1T41A 1QRQA 1M9HA 3C3UA 2DUZA 2INEA 4XVEA 3LUTA 1VP5A 1A80A 2PDKA 1Q5MA 3ERPA 4F40A 4XVDA 1XGDA 1GVEA 2IQ0A 3V0TA 2C91A 2PEVA 2BGQA 1RALA 3LD5A 1PWMA 3GUGA 1LQAA 2HEJA 4IGSA 2ACSA 4QX4A 3LQLA 2FZ9A 1X98A 5AZ1A 2PDHA 3UGRA 5HNUA 2F38A 3Q67A 3Q65A 2PFHA 4XO7A 3WBWA 3RX4A 4I5XA 3R8GA 3LN3A 3WBXA 4DZ5A 3GHTA 2P5NA 4HMNA 3KRBA 3WCZA 1Z9AA 4WDUA 1AH3A 3UYIA 2WZMA 2FZDA 1Q13A 1YNQA 3R58A 4WDWA 3EB4A 3FX4A 2AGTA 1HW6A 3COTA 2IPJA 2ISFA 2HVNA 4XZMX 4DBUA 3M0IA 2ACRA 2J8TA 1C9WA 2PDBA 4DBSA 1ADSA 4JIIX 1J96A 1OG6A 3LZ5A 3N2TA 1YE4A 4IJRA 3G1RA 4PUUA 3M4HA 4AUBA 4LB3A 3WBYA 4G5DA 1S2CA 2I16A 4WGHA 1RY8A 3D3FA 3CAQA 1S1RA 4GQ0A 1ZSXA 4QR6A 3WG6A 5JH1A 2BP1A 3FJNA 2FVLA 4HBKA 4H8NA 2PDCA 3NTYA 3O0KA 2ALRA 3UZYA 2IKGA 1EXBA 4LAZA 5LIKX 2HE5A 3B3DA 3MC5A 1QWKA 1AZ2A 2ACUA 3P2VA 2PDPA 4L1WA 5JH2A 4GA8A 3GHSA 3S3GA 3CAVA 1Z3NA 5HNTA 2PDMA 2PD9A 4JTDA 4PMJA 3H4GA 2HV5A 4YVVA 3DN5A 2HDJA 4DBWA 2R24A 4JTRA 3V0UA 3GHRA 2VDGA 4GACA 1R38A 3UZWA 1MZRA 4OTKA 2DUXA 4JQ1A 2BGSA 2PDGA 4WEVX 4YVPA 1IHIA 2IKJA 1YE6A 5M2FX 1AH4A 1EKOA 2PF8A 5AZ0A 3BUVA 1T40A 4JQAA 4YU1A 4XK2A 1X97A 4WDXA 1FRBA 1S2AA 3LQGA 4FALA 5DANA 2CLPA 4LBRA 1X96A 4ZFCA 3QKZA 2IKHA 2FZ8A 3UZXA 1EL3A 2I17A 4QBXA 1AFSA 1IEIA 3MB9A 4FZIA 1LWIA 4PRRA 2PDJA 2NVCA 3H7UA 2R9RA 3EAUA 3BV7A 4JTAA 1K8CA 2F2KA 4YVXA 2WZTA 4PUWA 1S1PA 2PDXA 1AZ1A 2PDYA 2PDWA 2A79A 4GQGA 4JQ4A 2HE8A 1Z8AA 3LENA 3LEPA 4GCAA 5LIUX 2INZA 2NVDA 3R6IA 4JIHA 4Q3MA 2FZBA 3CV6A 4WRHA 1HQTA 4GABA 2PDNA 2IS7A 1ZQ5A 4EXAA 4PRTA 3VXGA 4JIRA 1Z89A 1UR3M 1XF0A 4MHBA 3T42A 2PDUA 1PWLA 5KETA 1US0A 3G5EA 1RY0A 4PR4A 2ACQA 4FAMA 2PZNA 1JEZA 3V0SA 1XJBA 3UFYA 2PDLA 3CV7A 3LNMA 4XZHA 3LBOA 4QXIA 3RX2A 1PZ1A 4XZIA 3ONBA 5LIWX 1MRQA 3UZZA 2IQDA 4NKCA 2PD5A 2DV0A 3V36A 4WDTA 4ASTA 5HA7A 3U2CA 1YNPA 3H7RA 4Q7BA 1PYFA 4XO6A 5C7HA 3UP8A 4YS1A 2PDIA 3N6QA 4EXBA 2HVOA 1SM9A 3EB3A 3UWEA 3V35A 4JQ2A 1AH0A 3CMFA 4FA3A 4JQ3A 4IJCA 4JTQA 2IPWA 1ZGDA 3M64A 3R94A 3RX3A 1VBJA 3F7JA 3BURA 1MI3A 2IKIA 4L1XA 4XZLX 2QXWA 1PZ0A 4LB4A 2IPGA 4ICCX 3R8HA 1EF3A 2IPFA 2PDFA 4RPQA 2PDQA 3LZ3A 4JTCA 3O3RA 4H7CA 4LBSA 5LIXX 2FGBA 4XAPA 3GHUA 3BCJA 3DOPA 4XZNX
chains in the Genus database with same CATH superfamily
1AL7A 1JF5A 4RNJA 1REQA 1ONEA 1W3LA 2W5FA 3P0WA 3S6DA 3R43A 1IQ8A 2O7SA 3UWVA 3LTSA 4IH3A 1BD0A 4OE7A 4BWLA 4KERA 5HMSA 2IQTA 3M46A 3TWBA 1Z6KA 5LHFA 1XYBA 1Q5MA 5BXPA 4UFLA 1JYNA 4DYKA 4GJ1A 3MVTA 1NQ6A 2C91A 1R3VA 3AIRA 1KR1A 1R85A 4JL1A 2VCBA 3A47A 4M7TA 3L0NA 1OIFA 3IK2A 4Y7EA 4GCXA 1GONA 1JFHA 1VR6A 3GG0A 2WZHA 1RA0A 5H8MA 5TF0A 3TQVA 4KIRA 3FOKA 3BLDA 1XCWA 5REQB 3WEOA 2V2HA 3QVQA 4MJZA 3APYA 3KOZA 4H1ZA 1A5UA 3LN3A 4YWIA 3RCNA 3WBXA 5JMUA 1XV8A 3GHTA 1PBGA 2VVSA 1MEHA 1UD6A 3NQEA 3GVWA 2PE4A 1C93A 3KRBA 1DQUA 2OKOA 4WDUA 5A95A 1DIOA 3M16A 2F2HA 4NJKA 3ZJKA 4C91A 3SIMA 2NUWA 3DC0A 1RA5A 2CYGA 3W76A 3COTA 3AMKA 5CPNA 4EPEC 2DJLA 2J9YA 2Y7EA 1MO0A 2GGGA 3NFUA 4C6PA 5LNSA 4QJ4B 1LRQA 2ZX8A 2WM1A 4AYSA 2QJMA 2ASHA 3HGRA 4PB3A 2RDXA 2G3MA 4GXWA 2UZ9A 1DJQA 5EYWA 4Z1DA 1TJ1A 3FY1A 3NQGA 2D2OA 4B5TA 1W9DM 4EPKA 5GPRA 3MBDA 3NZGA 3L66A 1H2JA 3LG3A 3NA8A 1ZALA 3EKZA 1LBFA 3B3DA 1Q85A 1K6AA 4EP8C 3QW4B 3RPTA 6ENLA 1UHVA 4L1WA 4GA8A 2P53A 3TN3A 2Y85A 3OEXA 4R5EA 1K8XA 4Z1BA 3O63A 3XIMA 3QZ6A 4AWTA 2WC7A 3KOFA 4GLEA 8A3HA 4MZYA 5CPTA 3TR2A 4W7WA 3RR1A 4GYJA 1I1XA 3C2EA 3B0PA 3ES7A 4AVOA 1GPWA 5CBBA 3O9NA 3GHRA 1J0ZA 2DSVA 3PPGA 3FXGA 4LC6A 1HKWA 5E9AA 1BLIA 1XHGA 1TMQA 2ALDA 2BHYA 2PDGA 1KCXA 1MWOA 1YX1A 5DF0A 4JFWA 4QE5A 2Y8KA 1IHIA 3G0UA 4O19A 4PUKA 2QCFA 4Q32A 2YPIA 3SGZA 2NV9A 4NASA 1T40A 2TODA 2REQA 4HPNA 4XQ6A 2QUMA 4FALA 1V79A 1KXVA 2V0TA 5F1UA 3C2OA 1A5LC 4DI9A 2IKHA 2HK1A 1J0JA 5I7GA 3UZXA 1B3YA 1B4EA 2ZX9A 3LGGA 4K1WA 3BSHA 4CGTA 3CZJA 1ZNNA 3H2FA 3R5EA 4C6CA 3MB9A 3M7WA 4HHPA 1IZKA 1JYWA 1XKJA 1NF7A 3LCIA 4K6AA 3K13A 5XINA 3FSTA 3OYZA 4NZJA 5CSSA 3C2RA 1DJWA 4PUWA 2JKAA 1AW1A 1QNOA 4K7VA 4JKLA 4N9BA 3LV6A 4IHCA 2E6AA 4UCFA 5C9RA 3NL6A 2QJGA 1GQJA 4GQGA 1PKMA 2HE8A 3TMLA 2R1PA 2BDQA 2INZA 1KTCA 1MUCA 1TZ9A 4GQQA 1RCQA 4GABA 1TX0A 4H00A 3OVPA 3O15A 2V8ZA 1H11A 4POCA 1POKA 3L7RA 4W93A 1A5MC 4L4OA 1WB0A 3LHZA 4OHQA 1Q6CA 3IPWA 4NAFA 4O1BA 2A3LA 4QNEA 1CECA 1GK8A 2B81A 1BHGA 3POCA 1PB0A 5JBDA 2Z1VA 3ARWA 4A22A 3AQUA 2R82A 1FWRA 2Z6IA 3L2IA 3HZ3A 2WCSA 4MWAD 4DF2A 1ZCOA 2PDLA 4R27A 4O8AA 1J93A 3VNIA 4IP5A 3SFKA 3DI1A 4AC1X 3KL0A 3L4TA 3IAPA 3CL7A 3TSDA 1KXHA 2A6NA 3UZJA 2BV9A 4A21A 2CKRA 2R91A 1RJRA 2R1KA 1WDDA 2E77A 4FO4A 2GK1B 1SYTA 3QKEA 4V1YA 4ATWA 4ASTA 1XUUA 1XIDA 1GOOA 5LNRA 4C6QA 1JCMP 1YDOA 5C2GA 4WKHA 5HQLA 3UZ5A 3I6EA 4UNKA 2HVOA 1UZHA 3KRZA 4R7WA 4Z17A 4MY9A 4FA3A 4Y8EA 4K37A 1GEHA 1JUBA 3QSRA 3FV9A 1IXOA 2VD9A 2ZUMA 5E0CA 3NGFA 5EGRA 4S2BA 1RV8A 2FB3A 1BWLA 4US5D 3M0XA 3STEA 3NQCA 4XX6A 3TLLA 4MNJA 4CN4A 2FH8A 2QXWA 2QIIA 4LB4A 6XIMA 4AYGA 2EG6A 4F0KA 2WBGA 3I7SA 1XICA 1QXLA 2GQ3A 5DT7A 2GJXA 2Z1SA 2PDQA 3F03K 3S2CA 3FJLA 3K2GA 3T78A 2D1ZA 4H7CA 1HNYA 1FWAC 3TYZA 2J77A 4AISA 4I3GA 4KRZA 1GORA 3ZJ7A 3WL0A 4KWUA 4HNCA 3LV5A 3E2VA 3VNYA 2GVYA 4Q22A 1OGGA 1BF2A 1ZY9A 2Y5EA 3PUGA 1T5AA 1H7XA 1IZJA 1NDVA 4JIEA 1M01A 1Y8BA 1VJSA 3PP7A 4LAUA 3NZ1A 3C86A 3M6YA 4FI4A 4XKMA 2OO6A 3DZ1A 3TQPA 4J35A 3HPFA 2PDKA 2DSWA 4Q4KA 8CGTA 1QW9A 2WSQA 1MW3A 1JDDA 3EA2A 4QNWA 2IQ0A 3MKKA 2PEVA 2BGQA 2YLAA 2Z00A 4J3TA 4KGJA 4BEUA 3VC5A 4AZ7A 3QM3A 3NVTA 4H9ZA 1I9CB 4FLQA 3UGRA 3Q67A 3Q65A 4NAEA 1LUCB 4XB3A 4MPQA 3VUPA 1JZ4A 3IANA 3IACA 4L5ZA 1DL3A 4Z0JA 5A3HA 1DKWA 3SI9A 2Q6ZA 3DECA 5EMUA 3M44A 1EEPA 4DZ5A 1SJCA 1TCMA 2OT0A 3QPYA 1IE7C 2X2YA 2P0OA 2XGBA 2C79A 3QMRA 2UBPC 3VIMA 1UCWA 3WIJA 3N2XA 3T8LA 5AY7A 1A5NC 3EKGA 1TWSA 1VCFA 1HXJA 3QRHA 5J5RA 4E4PA 3W1TA 1YE4A 3E3HA 3K8LA 4DWSB 1J11A 5LNWA 2DIEA 4TOQA 4DUOA 4WY0F 2OWCA 2Z24A 1H1ZA 1T7LA 4QR6A 4PYSA 1QW7A 1VZWA 4HOZA 2SFPA 2VZTA 2XN2A 4GUFA 3GXDA 4HBKA 4C6FA 1WDWA 3S5SA 2GOUA 4H41A 2HSAA 4LVBA 2VTFA 1YNYA 3STFA 3HG2A 4ZODA 2HPIA 3VDGA 4UOJA 2CZDA 2X40A 3DAQA 5JUVA 5ABHA 3BAIA 3S1WA 3H53A 5BROA 3R12A 2FTWA 3CAVA 5EBAA 7CGTA 2ONEA 1CZ1A 3CZ8A 4P7QA 3UWZA 2EKGA 5T9BG 1GUVA 2C8NA 3AYSA 2VOMA 3W1AA 3CQHA 4BHYA 1JCXA 2W0UA 3V0UA 3PUDA 1R3TA 2BOEX 1YHTA 1RVKA 2VX7A 3W7LA 3O05A 1MYRA 2D2GA 1KFJA 4YVPA 3FXYA 3NZQA 4K68A 2I7GA 4JTTA 2GPTA 3ZS4A 1OGBA 3C0SA 1MUWA 4C6BA 3VFCA 5AHMA 3XINA 1NDZA 4WDXA 3LX9A 1FRBA 3E0IA 3PG8A 1Q63A 3VILA 5EPDA 3VNDA 1X1ZA 4AXKA 1E71M 5BMXA 1ZFJA 4IGHA 1RD6A 1GZJA 1V7YA 3T9PA 3RHGA 4NL1A 4JFSA 1SO5A 4XKYA 3DYOA 3ICJA 2BNJA 3PWAA 3W2KA 3APTA 2VFDA 1I0DA 3CH0A 1EA9C 3NXFA 1D8WA 3UG4A 1EOMA 3BV7A 3O16A 3VMPA 1DHPA 1H49A 4ZO8A 4ALDA 1EJRC 3GZAA 3HV8A 4ZO6A 2FGZA 4O13A 3G18A 3I68A 2XU2A 1DE5A 4DM1A 3PBYA 5T8GA 4B5SA 4BFAA 2BLEA 4J3SA 1CGWA 3C0QA 4BK9A 3CYVA 1G4SA 3TN4A 3C5QA 3SCPA 5I3DA 3H55A 1EJXC 5LYRA 4IQDA 1J01A 2CETA 1HGYA 5ENLA 1EP2A 3E2QA 3WMLA 3PSWA 4JYFA 1XYAA 3EWZA 3BL3A 2VR2A 1UR3M 2D23A 1YDNA 3PAOA 2NQHA 2DJXA 2VZOA 3GO2A 5KZMA 3QHNA 3T40A 3A22A 2D24A 3W07A 2VENA 1EZ2A 1NWSA 1NP0A 3OYXA 3CQKA 1OEPA 1P6CA 4G7EB 3SCSA 4PTWA 1Q6LA 5AYXA 3GXFA 4J3VA 1EA0A 3VC6A 3E5PA 4PRWA 1A53A 2J7EA 1S5MA 4HK5A 1W2PA 1JYXA 2IQDA 5L6UA 3VD7A 1TPWA 5BNKA 1OZMA 4I7UA 3PFRA 1ZBCA 2BXYA 5IRPA 3THUA 1OB0A 1O6IA 4I5UA 1HT6A 3DC8A 1R2RA 4GO8A 4WOQA 4B15A 2VR5A 4JQ2A 4OU1A 4XBKA 3M0VA 4Q4PA 4IPPA 3USZA 3O07A 5DCBA 3VIOA 4HPHA 4B4HA 5BYWA 3RN6A 4EVZA 4DJEA 1G67A 4QISA 2TPSA 3UYCA 3M64A 3V5FA 3W7HA 1S39A 3R94A 2VGIA 3VE7A 3GE7A 3F7JA 4H7ZA 1M04A 4QRNA 2EEXA 2RJGA 3XISA 2ICSA 1OFRA 2WVTA 5BZAA 4IMGA 3CZEA 1P7TB 3U8GA 1OJXA 2J7CA 1VHCA 4L4LA 3SQMA 4E2DA 3NVDA 3RILA 5BWAA 1K9TA 3LZ3A 3UA3A 5HJYA 2J7GA 1H7RA 2PP1A 2QMKA 8XIMA 1I75A 1KFLA 1ZPTA 2J7DA 2JALA 1OF8A 2Y89A 5IBXC 1EBGA 2PWHA 1KQYA 3SR7A 1VFTA 3UR2A 3FYPA 4JHMA 1E9YB 1O94A 1H3GA 3ARYA 1A5OC 3A4JA 3AIBA 3LUTA 3VM5A 3LM3A 1Q6QA 3UPBA 1PL9A 3ERPA 1ZHAA 4P8WA 3T4CA 1V93A 4WGXA 4TTGA 1XYMA 1P6BA 1O60A 3EXSA 2ZVIA 3N9RA 1W1A1 2PRHA 5D30A 2XTKA 1WKYA 4JHZA 2CBIA 2CESA 1BYAA 2GVEA 4CKQA 3WBWA 1VB9A 3MKVA 1FHVA 3G1VA 2W67A 1W3HA 1JUEA 1US2A 1RH9A 5AYBA 2X1UA 4P7OA 1AD4A 1JI1A 3AS2A 3DHUA 1VPXA 5CSYA 4R3UA 3F1QA 1XRVA 2PCQA 2QT3A 3KFTA 2WZMA 5SWUA 1GJWA 2WWCA 3MT1A 3AWNA 2VGFA 5BXRA 4NNAA 3KBVA 3W1LA 3CWNA 1XLFA 3L4WA 1C9WA 1LL4A 3AHZA 3U3HA 2PC8A 3E2SA 3VA8A 5KZ6A 1Y65A 4AZ5A 9RUBA 3SJ3A 1FDZA 1LOSA 3NQVA 1S2CA 2PSNA 4N9DA 2EHHA 1OGSA 3AXMA 1E6PA 4LV4A 4QCEA 2BOFX 3U2EA 3QC3A 5DELA 1K7FA 3MSYA 3RDKA 1QI2A 2ALRA 4JY9A 3O8AA 3WQ5A 1E6NA 3GFYA 1QK0A 1RHCA 4QJ3B 1XLDA 1H4PA 4HOWA 4UTKA 1SJAA 3VOFA 1M41A 3P2VA 1EJSC 1B3WA 4KWSA 2PDPA 2J6VA 3G22A 1ME7A 1MXDA 4XAGA 4M1RA 5E5CA 5TIMA 1MVYA 3M0ZA 4QEHA 1KKRA 1BYCA 3V5OA 3NQDA 3H24A 1P0NA 1N8WA 4ZOEA 3U0HA 1DPMA 3VGBA 4R7JA 5REQA 4GRSA 4EAMA 5IDIA 3NUKA 4RCXA 4LYPA 4ZOBA 1L2UA 4PMNA 1GT8A 4OTKA 3A64A 3ABZA 3MSDA 3TW9A 2GUUA 1FWHC 1C92A 1L0PA 3ZM8A 2MUCA 1OK4A 2Q3OA 3E02A 2PF8A 2WNNA 3SQLA 4J3XA 4RX0A 1YADA 1X97A 5HULA 4Q33A 2PBGA 3DFPA 1IYXA 3U48A 3B05A 4X9SA 4DLMA 2ZZ2A 3K4DA 3VIGA 3LRLA 2DGAA 4AZIA 3HN3A 1TE1A 3IGUA 4F8XA 4O0QA 3A4WA 1CIUA 3S47A 4MGGA 4PUDA 3SUWA 4JX6A 1FP8A 3RIKA 3TZFA 1ZL1A 5ABFB 3AZSA 3AIVA 1H41A 1MDRA 1SO6A 1TR9A 5AYIA 4DXVA 3W2MA 1RBAA 3QPZA 5CLWA 5FACA 3OZOA 4ZSUA 1BVZA 3SB0A 3GIQA 4EACA 4H2CA 2XH2A 2I5GA 1BRLA 3HPSA 4I9TA 1JZ7A 3LHWA 2O55A 3UJRA 3BG5A 3PTKA 5RUBA 4BZYA 1VEPA 3KL5A 4MADA 5AOUA 1K7EA 1QOXA 2VUYA 1R2TA 3OG2A 3VIFA 3WSUA 3WK1A 4AZ6A 4OT7A 3EOEA 3CV6A 1IV8A 3WKZA 2PU0A 3WLJA 2WHMA 4JTEA 3C0LA 4HZ6A 4DJDC 3PS7A 2YW3A 5DMMA 3ZZ1A 3BJSA 4OZOA 3EOOA 1US0A 3CLMA 3LNPA 4MB1A 4Z42C 3NPWA 3G5EA 2QV5A 1XIIA 5DLCA 2H6RA 2VZSA 4LAOA 2G96A 1EIBA 1KO0A 1EGVA 2WPBA 2XN1A 3WMSA 4O52A 3PPHA 2QCEA 2Q09A 3UFYA 2G5WA 2CIPA 2BVDA 3CV7A 1V6YA 2UV8G 4I8DA 3LU2A 4AX6A 4MWAB 4R33A 5HPOA 4I7VA 1MRQA 3UZZA 4RZ4A 2WQDA 4GY0A 3ZR5A 2PD5A 3GU2A 3UF9A 5F2MA 2J7HA 3OVRA 2NX9A 4F0SA 4IUOA 2JEQA 1VIWA 2ZE0A 4LSBA 3PTMA 4S3BA 5FJJA 2O4QA 3SURA 1XD1A 4AD2A 4PCPA 3SUUA 4AW7A 1CDGA 4YS1A 1Q8JA 2VVNA 3N3MA 5HWNA 5JIPA 1J6OA 2DUAA 3LK6A 4G56A 1KRMA 3EEZA 1SM9A 2E9MA 4P7LA 2FZNA 2EQDA 2POTA 4IT1A 3NQMA 3AMDA 3GDBA 1XXXA 1W56A 3W27A 5JBEA 1RJQA 2C1GA 3B03A 4ZOCA 1F9CA 1V7AA 3RO8A 4DUWA 2G37A 5C7VA 3W22A 1ZGDA 3HQOA 2Q8ZA 1CGVA 2WOQA 3OOQA 4AAJA 2IKIA 4F4RA 3G2GA 4HZ8A 4LVGA 2DT0A 3WQDA 1RP9A 5FJTA 5PTDA 5D9PA 2Z7GA 1L6SA 4LS2A 3LCWA 4I6KA 2XN0A 4JNYA 3NJ3A 3MU7A 1Q2SA 3S1UA 4GZJA 3DGRA 7TAAA 2GWNA 2D3LA 5AHLA 3UQNA 1IF2A 3PFMA 4JTGA 3WY1A 4NNCA 3WQ4A 3EXRA 3RM9A 3GHUA 4GZ7A 3DOPA 4U10A 2J13A 4UOQA 1UKPA 4PH6A 4GYPA 3RXZA 1I6NA 3F4NA 1TE6A 4M6UA 1TUXA 2IUZA 4TR9A 4AVNA 1E1EA 4XVEA 1WXJA 5BOEA 1DEDA 2ZA1A 4AWEA 5LA1A 3NQAA 4LWWA 3BICA 4AQLA 2CWXA 3CUFA 1PPIA 3UR7A 2GK1A 4YTTA 1ODUA 1A47A 2RAGA 2FZ9A 4C5ZA 1S2WA 4XO7A 4ZQOA 1S2TA 1YTDA 3NOEA 1OX6A 2FFIA 5EFDA 3PBUA 3TOYA 4RLIA 1CT5A 2G41A 5AYZA 3TA6A 3WCZA 2JGQA 1VF8A 1XQLA 3UYIA 1PO9A 1ONRA 3VYLA 4IMDA 3FX4A 3TJ4A 4PL1A 2PAJA 3MQTA 2ZCGA 4YNGA 2V63A 2DVUA 1ADSA 3PUEA 1D8CA 3IEBA 4AWSA 4Z0SA 2PTDA 4PUUA 2YA0A 4JL2A 3TXZA 1XIGA 3MP4A 3MPGA 1DJIA 5FEWA 1R5YA 5A8PA 3EEGA 4O11A 4WJEA 1KFWA 1ZRQA 5U4NA 1KA9F 1MXSA 3I3DA 4NX5A 1S1RA 1ZSXA 1Z41A 4NY2A 4HU8A 1J6PA 2CBJA 2J74A 3CU2A 1K70A 3CZKA 3QY7A 3W1PA 3GKAA 3FA3A 4MJ2A 2X7WA 1B1YA 4LRTA 1G7UA 1RQBA 1O66A 4QG6A 4W5UA 5A8QA 3GHSA 4PC8A 4AZBA 3AOFA 1J0YA 4ZEPA 1ZCCA 3BW3A 1VH7A 3UERA 2G50A 2QAFA 1LL6A 3EPMA 1IT8A 1W3NA 3CUXA 4K8HA 1LUCA 4UR7A 1TIWA 4OIFA 4I9MA 1TSIA 4JTRA 1X7IA 4NF7A 1R2SA 3FCPA 2X2GA 1YDYA 2VC6A 1UWSA 2Z1WA 3M1ZA 2NQ9A 1L6GA 5I77A 1V02A 3T09A 3T8QA 2J78A 1I45A 2BTMA 1XC6A 4UOZA 2WMFA 3VGHA 3L23A 3O06A 1FHUA 3MZNA 4FXJA 1DJHA 4DI8A 4DZHA 1EYEA 1TRDA 3KDNA 4IZGA 3HU7A 4CQBA 3B06A 4LVAA 3QLDA 1ZBKA 1GOKA 1AODA 3ZJ6A 3MP3A 5I79A 2E6YA 5KSWA 2YW4A 4CEXC 5A94A 4RNIA 3S6TA 3T0AA 4DWSA 1PVNA 1OX5A 3GXMA 1O68A 1FWFC 3H2EA 4IGNA 5CJNA 4IXHA 3TE9A 4MVAA 1KRAC 2XH7A 1U1HA 3EAUA 2YL8A 2QUTA 3PC0A 3I3BA 2PWUA 1K8CA 4GX8A 3KP0A 2ZTJA 3HGSA 4N0RA 3JVAA 4A05A 1UP0A 2GYIA 1OCQA 1KRCC 1JD7A 3WMBA 4K8EA 1KFKA 1ZAIA 3AUJA 4D8LA 4M6VA 1A5CA 2PU1A 3EX6A 1DV7A 1Z8AA 2VDHA 1V02E 5K9CA 4AZCB 1UWQA 1XG4A 1BF6A 2PTYA 4CUCA 4IOTA 2R6OA 5LHEA 1EJWC 3J7HA 4D6EA 4DVOA 1BWKA 3W86A 4NXSA 3A9IA 2ZUVA 3IJDA 3RAOA 3WF1A 4PA8A 3W83A 1O12A 1IEQA 3KM8A 2BGNE 1CXLA 1BKHA 1G5AA 5E1QA 4GOAA 2P76A 2WJDA 4H9TA 3CHDA 2CBUA 2DW7A 1XCFA 3SCNA 1ONWA 1U5JA 2ZDSA 2JGYA 3GTHA 1D2KA 1FA2A 4PTVA 4LW7A 4B2DD 3BAKA 2CLKA 3TYAA 2OZ0A 2ESCA 5GNYA 1QOPA 1UOKA 1UP2A 2FVKA 4ZOAA 1O1HA 4XZIA 4JYDA 4UQ9A 3P0XA 4WQ6A 4CD6A 1UJPA 3ZO9A 2DV0A 1ICQA 1E4NA 5D4YA 3S46A 2WSYA 2XUCA 1MQPA 2TRSA 2GJLA 3LLDA 3VIKA 1NWTA 5FAJA 3WJYA 2CHOA 3UP8A 3WFZA 2B31A 4QFUA 3WEMA 2E25A 2OPJA 3AYRA 4LYQA 1XLJA 1ICPA 2DZUA 1QK2A 2V5JA 1DJGA 1R0MA 4IQLA 3TYUA 3NL3A 6TIMA 4DO5A 2Y62A 5FSDC 2PPGA 1VRDA 2C3ZA 3OLGA 4WKFA 5EMMA 3WEZA 1E43A 4MSSA 2PGWA 2F6KA 4Y9OA 3BURA 4HP5A 4F0LA 3PZ9A 4K2SA 3DKJA 1K03A 2P8BA 2E5DA 3VK5A 3M6DA 4DEFA 5HOSA 3GC2A 4FIQA 5EMLA 2X30A 5C55A 3SN0A 2WYSA 2B4GA 1UG6A 3H2NA 4Z2KA 4KFOA 1PZ2A 4CN6A 1UQZA 5A2BA 3WLRA 2QVHA 1EWEA 3CASA 1XWYA 3WNKA 2W66A 3E0FA 4HCLA 1O5RA 5IXEA 3ONCA 4ZB2A 3QR1A 3E38A 3UG8A 2EO7A 4J3UA 4J40A 1EUNA 1W9UA 3U2OA 5A6JA 2ZUWA 1KFBA 3S0CA 3WLLA 4E8CA 1GG0A 2XIJA 1AD1A 4L6DA 3ATZA 2BY1A 3MMDA 4F48A 1WO2A 1K3UA 2Z6JA 4BQ4A 4GPNA 2Z7KA 3I3EA 3POHA 3WH7A 2PLJA 2OJPA 1X98A 3CMJA 3BWWA 3S8HA 4JZ5A 3TNOA 3D3AA 1XGZA 1RCXB 4H4IA 1IXNA 4H2HA 2QCLA 5FF7A 4DB7A 4R9XA 3TFCA 4GH3A 5MKGB 3TXVA 3R8GA 2PGRA 2YOCA 4A35A 4GVFA 4OFCA 3U2ZA 4WR3A 1TVLA 1TB3A 2J62A 5T91A 1DJXA 4IXXA 4JFVA 3IUDA 4MAZA 3SEPA 5C9UA 1HKIA 2OVLA 2AGTA 4C6MA 1VC4A 1P7TA 3WQOA 1GQIA 3CGTA 1EDQA 4Y9NA 1SO3A 5DXYA 3S42A 2CW6A 1RP8A 1J96A 1OT1A 4KH2A 3N2TA 3NPUA 2OYMA 4WD0A 2HWGA 1OWQA 5D2WA 3GWQA 3V75A 5DT5A 3SCWA 1DWHM 4DELA 5CPMA 3AU6A 4Q8WA 4Y96A 3PZNA 2BP1A 3ZIZA 4H8NA 4F79A 4FS9A 5U7SA 4RZ6A 3G77A 1CXEA 2NQZA 3BJTA 1P0BA 3P67A 1ZJAA 1QAPA 3TK7A 4F0RA 5JIWA 4DBDA 5DCDA 1TVPA 3URBA 3BLOA 2OKTA 3IJ8A 3IIXA 1TJ2A 2QPSA 4NUWA 5AHEA 3FN9A 3W1UA 2DIJA 4DNHA 2X0SA 3OA3A 1VFFA 4YVVA 1LT7A 1WE5A 1YPXA 5BOFA 2VJXA 5J8LA 4UQEA 4AHOA 3GC4A 1ALDA 1VYSX 3P62A 4BR1A 4UBPC 2PGEA 2V67A 4DZIA 4JAWA 1X6NA 2PTXA 2G8ZA 1U1UA 2EPLX 2E8YA 4GI9A 1GW9A 2Q3RA 5IDZA 4KT2A 1EKOA 3TC3A 2AQWA 1XBXA 1UMLA 3A23A 3BMXA 4FF5A 3AC0A 3T4WA 2CLPA 3MUXA 4DO6A 3F5KA 4S3CA 4O17A 4E4FA 2HRWA 2DT1A 4ZO7A 3AXHA 2NQLA 3MO4A 2NXGA 2OEMA 2FZ8A 1TYGA 5FEPA 2O9TA 3S4TA 3LDVA 4NZFA 5I3IA 2ABAA 4U3AA 3L4VA 3WQGA 5I3FA 2WHJA 2O7QA 4JN6A 3G1DA 1KM1A 1ONXA 3H8AA 2YDAA 2XHYA 4JD4A 4C7FA 3D5HA 3KLKA 1AQMA 2NUYA 3QR0A 3BMWA 2EG8A 4CCDA 3MCMA 1KBBA 2ZA3A 1Q6DA 2F2KA 4YVXA 2IXUA 4ICMA 2QUUA 2Z4GA 2C0HA 3TH6A 1CGYA 3B8IA 4AZHA 3TC7A 4PN2A 2A79A 4UTMA 1MFVA 4C7GA 4JQ4A 1UROA 5FKYA 1CTNA 3U5UA 5HJLA 3IGSA 3LEPA 4LUYA 1CXKA 3THDA 1EC9A 4KF1A 3LRKA 3O1NA 3HA1A 3WUGA 4NJJA 1E0UA 2IS7A 1ECQA 1EJ7L 3IS4A 3NDZA 4J9JA 1TQJA 4V1XA 5G2IA 5BCAA 3E0WA 1CGTA 1B2YA 3W7PA 3VCCA 4JIRA 3B0UX 2HTMA 2Y1HA 1OABA 3OVGA 1WDPA 3N15A 4JGDA 4Z2IA 3UY7A 2HNEA 1OFPA 1GJPA 1LQ2A 1IGWA 4YPJA 4LS0A 2OTDA 4RR4A 4ZR8A 2VNCA 4C1LA 3DFSA 1UA7A 1J4EA 3EWDA 1R3YA 2Y0FA 3LBOA 3QGKC 3TTOA 1KQZA 4HN8A 1Z7AA 3ONBA 1C90A 4WVXA 3N6HA 1OCBA 3ITTA 3T81A 3U9IA 1FUYA 3AIQA 4HSNA 4BA0A 5C71A 2WNQA 3V36A 3E1F1 4GINA 1EB3A 3G1SA 3EX3A 5AC8A 3IRDA 3GR4A 3LXCA 4NIRA 1V51A 3I4KA 4DF1A 2Z0IA 5C7HA 2V3FA 5G1MA 1A3HA 5DX7A 1L8NA 5ABFA 1KFCA 1BXNA 4ROPA 1ITXA 2G0WA 1E6SM 4HYRA 4LBUA 3I10A 1B57A 1BG4A 4DJDD 3G3DA 4DN1A 4JQ3A 3L67A 2FHFA 2XVNA 3VTRA 3A4AA 1SW7A 2AL1A 4RXFA 1QPOA 1YXYA 3BCDA 3QOMA 2DFAA 1ICSA 4D8AA 1POJA 4K36A 2V2CA 3JRKA 5KEZA 1R30A 1EF2A 2AKMA 3QBUA 1EXPA 5ECVA 1CLKA 3E74A 4R85A 1JF6A 2VOTA 5CC3A 4MYXA 1ISXA 2A1YA 5CKSA 3TAKA 1VBRA 1KKOA 4O53A 2WHKA 4X22A 2TSYA 4YCOA 2JEPA 3Q58A 1XKYA 3M0HA 2ZZ1A 3PN8A 2DZSA 3EB2A 4XAPA 1DBTA 3QYQA 4M0XA 4HJWA 1U22A 1R3WA 3GNXA 4Z2GA 1NOUA 4RNFA 1EUAA 3R7MA 3KP1A 4AFYA 4S1FA 4L9XA 3VX0A 1H50A 1W0MA 4GXMA 4R9OA 2QPXA 4RZ5A 4W4QA 2RDTA 3EA3A 2ZDRA 3RLGA 3BQ5A 4GY1A 3RCMA 3O2LA 3SCVA 1CB7B 1HJQA 1XGDA 1WDQA 3F2BA 1DORA 4YN5A 4CU8A 4RE0A 3DFNA 5I3HA 4RUBA 3IJ7A 4B9YA 3LPOA 4TX6A 1OFEA 4AD3A 4KKXA 2GZXA 5C54A 1XQKA 3CBWA 1N82A 1UH2A 3AU2A 1GOMA 4GI6A 4OVXA 1KM6A 2WJEA 4ZQCA 3W71A 3E0VA 1J0KA 2A7RA 4ZE5A 5C2XA 3TNBA 3FYOA 3GTXA 1UD8A 1FFQA 4P61A 4JTHA 1WOBA 2EXOA 5A8OA 4QLJA 3SADA 3KVKA 1R87A 1AUSL 2JKPA 4ML4A 1CGXA 3PPFA 3N6JA 4H6KA 2V6AA 3H21A 4US5A 1RXOB 2J8TA 3BAJA 2Z26A 4B4FA 3VX1A 5GJNA 5ABEA 4KEVA 1RBLA 2YSWA 3BDKA 4A3RA 2EPKX 4HHLA 3P3BA 1TTQA 1GQLA 4JBRA 2JQXA 2J75A 1VD6A 3K8MA 3RFAA 1OINA 4QEEA 3W7IA 2B7NA 2FTYA 3HGOA 4R7OA 2YCIX 3P84A 2P3ZA 4M81A 4UTTA 1FWCC 1JCYA 3C8NA 2VGBA 4LVFA 1J5TA 5E6ZA 1L6WA 2QDHA 2HE5A 3TSMA 2VFFA 3GIYA 4HJFA 5HR7A 1F8IA 4FLSA 2VC9A 3ME3A 3OODA 4LJ3A 1ML1A 3WJWA 3EWUA 1KXQA 3RLVA 1H7WA 2Z2BA 1IIGA 5HNTA 1XDLA 2W63A 1DXFA 2PODA 1PZ3A 4U2YA 3AXKA 2DVTA 3S1GA 1F73A 1KCKA 3LSBA 1N8FA 2XFYA 4HNLA 4TMBA 2H3DA 1YMYA 1J8VA 3ZT6A 4QJ1A 2F6UA 4JIPA 4AD1A 3U4AA 3JZUA 1KTBA 5LZLA 2NQJA 3TVAA 2J8GA 7TIMA 2V82A 4E5TA 4Y8FA 1TTIA 4RV8A 1TKKA 4CNUA 2A5HA 1QHOA 2YZRA 3CNYA 3VAVA 3WF0A 2JE8A 3B9AA 1HVXA 2WAGA 1JPDX 1JFXA 3N25A 1O5XA 3VKKA 1NARA 1SSGA 3OZYA 4CNPA 4P7NA 3MA8A 1QU4A 1EL3A 3N29A 2D2JA 2I17A 3H54A 3E2RA 3EX2A 3VU2A 5M03A 3FYYA 3NDOA 4E2OA 1JVNA 2OEJA 2CBVA 1LWIA 4L1GA 3ANYA 3THCA 3PY2A 4RDZA 4F66A 3NQFA 2XM1A 4QAIA 1VFOA 4B5NA 1X1OA 3PPCA 1OYAA 3IVTA 2WKGA 2ZE3A 3P82A 1PDYA 1B54A 5LXEA 4NZ3A 1JJKA 2VFGA 3QJAA 4X63A 4GIRA 3NEVA 1WA3A 3UJEA 1XRTA 1TTJA 2ISSA 2Y5JA 1F5ZA 1QASA 5C9XA 1FHLA 2NVDA 3AHVA 5GJPA 1BQCA 2QR6A 4Q3MA 1I0BA 4RE2A 3IWPA 2CC0A 2OX4A 5EY5A 1AMKA 3KVLA 1XLMA 2VO5A 3G0SA 1JCTA 3GB6A 1A5SA 1F61A 2XVLA 1XUZA 3VIIA 4GH1A 4F9JA 1TIMA 2ZKMX 1VQTA 2R94A 4P7RA 1W1B1 3CIXA 1KGWA 3H23A 2X16A 4DNMA 1G4EA 3ITOA 1YIXA 1WUFA 3SQSA 2VXNA 2ACQA 3ZQ9A 3QV9A 2J79A 1NY1A 1DQXA 1C3FA 1JEZA 3CV1A 4AC7C 1PDZA 4US6A 4J3WA 1PIIA 3KCJA 3BZGA 4UZUA 1T96A 5IHSA 1E5NA 4UFJA 3HQ1A 2HS6A 3VCRA 4EOUA 3QYSA 4O28A 1QCWA 5AN7A 1WP6A 2EPNA 3UR8A 1UKTA 3C4UA 3CAWA 4MKSA 2XIMA 4WDTA 1P0DA 1W5PA 1Q4NX 2RHGA 1UASA 4RDVA 5D9OA 4DY1A 3EA1A 3N18A 1BG9A 3FJ4A 2D2HA 1HFBA 4Q7BA 1YQ2A 2YL9A 1SJDA 3C61A 1WKEA 4LRSA 4EXBA 3V35A 2Q8LA 4GUHA 2OG9A 4JEQA 2CPUA 3QV7A 1PAMA 3W1XA 1OYBA 3VOIA 2CLLA 3W4RA 1UUOA 1VYPX 2KAUC 4JTQA 5CXPA 3CPRA 4ECLA 3RX3A 2NXHA 1AG1O 3U57A 3L4XA 2A85A 1R3QA 4L1XA 4NYUA 4PB5A 3WDIA 1NAL1 1JZ8A 3VVGA 4OOUA 4AZCA 1C8VA 2PLMA 5CGQA 4Z1AA 3K5XA 1XL9A 5C9WA 2YFOA 3V4BA 1V0KA 1W5OA 4C7DA 4B5UA 3MJYA 1CWYA 1TVNA 3NPXA 4WKAA 3BLEA 2X1TA 4GUIA 3HGJA 1LOQA 4FP1A 5CQ1A 3S5ZA 2XH0A 1ODZA 4P5UA 4QCFA 4TMCA 1XDMA 3NL5A 1FWSA 4E2BA 5CZTA 4JICA 1GPFA 1Q6EA 3BAWA 1VKFA 2DQXA 2PB1A 4FNUA 1KWKA 1OM0A 1QRQA 1K77A 1M9HA 3S9YA 4HSHA 4NI8A 1M65A 2FFCA 3OBEA 3U7BA 4W5ZA 2OYKA 3P80A 4QROA 1XYLA 4W89A 4JS3A 1H0GA 4IISA 1IT7A 1QI3A 5E9XA 1UWRA 4XVDA 1U5HA 4RZBA 1RALA 5F4XA 1YBQB 3LD5A 2QVNA 2FIQA 1GW1A 1HKVA 4QX4A 5C2CA 3OLIA 1VPQA 2I57A 4M56A 4PE8A 4OECA 4AY1A 1UR8A 5I03A 2XFRA 2QF8A 1E40A 4LUJA 3RX4A 5FCZA 4D72A 3TDFA 2EKCA 1UR9A 3FLUA 2YYUA 1XRSA 3N12A 4XIAA 5FF4A 3PM6A 3V1HA 1BYBA 2CLHA 1L9WA 1H63A 1SZRA 4MKNA 1XSJA 3KAOA 4HCHA 1Q13A 4M6QA 5KMYA 1WDSA 3S5OA 4JOMA 4QJ5B 1CGUA 3C0JA 4LEQA 1FWEC 3KL3A 2E5CA 4N42A 3M0IA 2JIWA 3L65A 3CZLA 4Q8PA 3L4ZA 1XS2A 1C7SA 1EHNA 3HTWA 1XPGA 3G1RA 2NW0A 3IV3A 4AUBA 4LB3A 4OUIA 1Q7MA 4I8YA 5L9FA 1SZNA 4FR6A 1SPQA 3RYSA 5LNUA 3NIYA 2PS2A 1Q6RA 1E55A 4GUGA 3IIPA 3HPZA 1KCLA 2QCNA 1J10A 3W84A 3QFWA 4HTYA 5A6TC 3BLFA 1QMLA 4IX2A 4B91A 2WCGA 1QJWA 2F61A 3W23A 3ZWTA 4Q4SA 3OHMB 4GI8A 3MUIA 3W7CA 2VELA 3Q4DA 3D6NA 4XAZA 4IQEA 3LSCA 1MW2A 3NEHA 1TFVA 3TP4A 5D2VA 3UCCA 1IEWA 3ZSTA 3PZUA 1US3A 3SRFA 2OB3A 4ONVA 1PIFA 3N4EA 1G1YA 3NWRA 4GK8A 4J27A 2FHBA 4UNIA 2FYMA 2HBXA 1SW0A 4RKAA 5MKGA 3RU8X 1UQYA 3W7QA 2YBTA 4F0MA 4DZAA 5IFPA 4PZVA 1MZRA 1VYRA 2FDSA 3P8JA 5KINA 3M5YA 2BGSA 2V81A 4WEVX 1UUQA 4HB7A 5E0KA 2WZEA 3PANA 4MUPA 3GSMA 4GJJA 4XD6A 2EGZA 2Q8XA 3MUY1 4IG2B 4N2YA 2QYGA 4KPLA 3PBGA 1QDSA 2WPGA 2NV1A 1TV7A 2J7BA 2AL2B 3BLIA 5A6KA 3WYZA 1TO3A 4IPJA 1QNSA 1YDVA 3OHIA 2KZHA 4KWVA 3AS1A 4XISA 3MMUA 2QCDA 4F2UA 3OP2A 4Y9AA 3KVJA 1DVJA 2Y2WA 1NP2A 3MCOA 3AMCA 1KM4A 1UYQA 2DZXA 1WKDA 2OSXA 3FFSA 1SO4A 4O54A 2HPMA 3M43A 5FAGA 1W1YA 1TA3A 3B0YA 3FJ6A 3B04A 5A6BD 1V3MA 1DWAM 3AZRA 2XDFA 3GVGA 4WSHA 1V77A 5H2ZA 3KVMA 4CQAA 2G95A 2XZ9A 3M0YA 4CVUA 1V3HA 2UY5A 3T44A 4Q8OA 2XWDA 4FX6M 1G9HA 2Y70A 2PMQA 3GTNA 3N11A 4H9XA 3AROA 4GNJA 2ZX6A 1C7TA 2PP3A 3T05A 1W2VA 3T08A 2XFWA 4DPPA 4O18A 4MZ8A 3WUFA 2VC5A 4B92A 4C6NA 1F6YA 3HQNA 2C1IA 1XF0A 3CL8A 3W1NA 4PUJA 1PWLA 1XFBA 2ISWA 3HMJG 2VUNA 3M07A 1RY0A 5F4WA 1FH7A 1UZDA 4RW3A 3BZJA 1VFLA 3RM4A 1PXGA 2BASA 3UNDA 4UQBA 4KS0A 4KEUA 2C6QA 3ZLGA 3W72A 2YB4A 1I2OA 3F5LA 3KX6A 3LPPA 1PZ1A 1QOQA 1NOFA 3ARQA 3FK4A 3BAXA 2FMOA 3MV11 1I2PA 4NKCA 5D04C 2ZZ3A 4M7SA 1XIBA 3TYDA 5GVJA 3WN6A 4UMAA 6TAAA 5I78A 4MM1A 3CL6A 2P1FA 4A8RA 1K7XA 1W32A 4XO6A 1AQ0A 2ANUA 1KBLA 1LJYA 2R1LA 3ZMRA 4EX4A 4KWWA 3UNTA 2CCRA 3LRMA 4W85A 3M5ZA 3R13A 1DTUA 1GOQA 2ZXQA 3FGCB 1O5KA 3OU8A 1VBJA 4LU0A 4X60A 3LOTA 4UTHA 1NDYA 2XYLA 4IJBA 4QSHA 3CTTA 5G2WA 2P0IA 1XIMA 3MTWA 5HJXA 3R8HA 1FVPA 1HL9A 2DH3A 1BVWA 3P5YA 1M5WA 3ARZA 3TOPA 1V4YA 3CH9A 5DRCA 5LIXX 3NCOA 3M5VA 4PGLA 3WLPA 3UXDA 1Z32X 5I5RA 4ZQNA 4GC3A 4QAWA 1LF1A 5I3KA 4C6DA 3PB2A 4GGBA 1SZGA 3WJSA 3WELA 5LIYX 3N2CA 3NO1A 3WQCA 1DIDA 2H90A 4DJFA 1JGMA 3UEQA 1ZUAX 1OFQA 3W00A 3IJIA 3R0UA 5BOOA 2Y8UA 2W3ZA 3SSJA 1W9BM 4DXXA 3C3UA 2DUZA 2INEA 2CHNA 1VP5A 4DRSA 5D02A 2V5DA 4MLJA 3VNJA 1KRBC 4PTXA 4GY7A 5ECUA 4FXFA 1G69A 2XVKA 2WKJA 1PWMA 1QHPA 2VFHA 4C6IA 3H2MA 5I07A 4M82A 4V33A 4E38A 4MB3A 1PSCA 3E49A 2VRKA 2ZZ6A 4BY3A 1BAGA 3W37A 2PDHA 4CU6A 2WJZA 3PK7A 1HUVA 4V28A 2WKLA 4HGXA 1JULA 2WVUA 3T0DA 5I24A 2AOSA 3C56A 1LTDA 1WZLA 3I65A 4D2JA 4OGZA 4LNCA 4PEEA 3GIPA 4HNNA 3I7RA 4RDYA 2XSAA 2EAWA 3KBSA 1B3ZA 1SFLA 4ENLA 4Q8UA 5A6SA 1G01A 3EB4A 3CIVA 3V3WA 2X7VA 3PTQA 1UPPA 2I1OA 3TN5A 2OWXA 3STPA 3ANUA 4IMFA 4XZMX 3VDCA 2E09A 5LSMA 3EMZA 2MANA 1GJUA 2FHCA 4L4PA 4LAKA 1VBGA 3WNLA 3WLIA 3WBAA 1NFPA 2E28A 2YX0A 1V3JA 3LLFA 4NJGA 2JIEA 1B31A 4MKVA 1PEZA 2I16A 3R8RA 1NWRA 1B3OA 1P0KA 1ZP4A 4Y9PA 3TKFA 3AXXA 3GXIA 2OEKA 1NJJA 1E3ZA 4LANA 3BGGA 3FJNA 1BPLB 3PZOA 1E73M 1GZGA 2BODX 2DEPA 3VD5A 3NTYA 2X42A 3MW7A 1EDGA 1GVOA 3R0KA 3W25A 1LLZA 3CQJA 1F6KA 3O6AA 4WSKA 3ITCA 4CNTA 1EX1A 4C6JA 3B8VA 3TSBA 2FKPA 1KV8A 3NQ8A 4BQ5A 3W29A 2BVYA 4HHMA 4HQVA 2X0HA 4PB4A 3A12A 3N4FA 3KXQA 1ITUA 2QCHA 4JDYA 1LYXA 5E70A 2DZAA 1OFOA 4DBEA 1B9ZA 1ESWA 3PG9A 3ITVA 1XINA 1OVDA 4DF0A 1WOAA 4F3HA 4I7WA 1TQXA 3AJ7A 2VEMA 2ZIDA 4WY0B 3GX9A 2C14A 1UUMA 3W2LA 2J88A 2VEFA 4M24A 3DEQA 5AC6A 2ON3A 1UC4A 5HATA 3LBMA 4GI4A 4H9UA 2DT2A 4ILSA 3TROA 4U4MA 4YU1A 3MUCA 1R7AA 4QM1A 3GNNA 1KD0A 1TV3A 3LQGA 5K4XA 1T6MA 3IIZA 2YBVA 2G3NA 4V15A 1PX4A 3GVQA 2IW0A 2BMBA 4UR9A 4H8VA 4ROQA 2YA1A 1E72M 1MEIA 4HPJA 1EP1A 1XW8A 1JNDA 1NVMA 1XFCA 1CPUA 1TPC1 2NLYA 5CBIA 2BXZA 4DIAA 3GBEA 1SZEA 3QY8A 5DO8A 5K9DA 1CYGA 4PODA 1Q66A 1RLDA 1W3IA 2VFEA 4S3JA 2H8XA 1B4KA 4QLLA 2ZBTA 1U5VA 4IWWA 2XIIA 4O50A 3W24A 2PDYA 3F4DA 1J2BA 1DJYA 3R1ZA 1NH6A 3RRAA 2Y6ZA 1SQ7A 4UR8A 2QAPA 4D9PA 2CLEA 4MTVA 4YTQA 1RK5A 1HQTA 5G4WA 4H7VA 4M51A 3UJSA 4JNZA 1PIGA 2J27A 5MF5A 1TJ0A 3MP5A 1EOKA 1Y0EA 2A0NA 3FDKA 2PRLA 3VOJA 5DMNA 3W38A 1EPVA 3GFXA 4GD0A 4Q8NA 3BSGA 4UZSA 4AMCA 2QUVA 3IGXA 3E5BA 2V3DA 4NZCA 5D32A 2OWWA 1FWWA 1E6ZA 4UFKA 3TZNA 1Z44A 2EPHA 4GNVA 1E4LA 4P8XA 3MUAA 3VKJA 3ARPA 4IIGA 3TEVA 2FJKA 3RMJA 3WH5A 3N1AA 3QV8A 5J5DA 1VAHA 1KB3A 2PGFA 3GNOA 4HNVA 1KC7A 4JKKA 1XX1A 4UWMA 5HNRA 3NNTA 1I2NA 1RPXA 3MWCA 5TBOA 2OZTA 3M7SA 1N8IA 4U5KA 3UJFA 4HNTA 3W53A 5CC7A 1XLCA 3W6MA 1FWTA 5AYYA 5I09A 2QW5A 2Q01A 2XWEA 1NSJA 1WCGA 3SO7A 3W7DA 1C8QA 2YDSA 1UW9A 2BY3A 4EE9A 1E1CB 3TFXA 4PMYA 3G1HA 4KFNA 4PMOA 1ENUA 3RITA 4BCEA 1K8YA 2VRQA 2J9XA 1PCWA 3UU0A 2PI6A 3B4UA 5AVNA 4UUIA 4BF7A 5AHFA 3UY8A 1C9DA 4WCJA 2X41A 1W17A 4B5VA 2OGJA 4UMBA 3MZ2A 4UXDA 3VGFA 1KTNA 1P6WA 3WD2A 1FCUA 3GBDA 4XBSA 1NOWA 4JTLA 1XH0A 1K6WA 4LQ1A 1ZB5A 4KESA 4B2DA 1KGUA 5D37A 3HG5A 3ID7A 2HXTA 1JDCA 4NX0A 1CBGA 3RPDA 2OX1A 1YTKA 1D9EA 3REQB 2YDQA 3HG4A 3K1GA 4MLRA 1ITQA 1EGZA 1DXEA 5FI8A 4GFIA 3SY8A 4UTUA 1I1WA 2PFHA 3GZ3A 4CN1A 4ORMA 3QW3A 4O15A 4RPPA 4LCRA 1OD0A 3A3HA 3FA4A 3F4CA 3W28A 2W62A 1HO4A 1DHKA 2RGLA 4N02A 1HKMA 3RJXA 1GOIA 1XYCA 3NSMA 2OSYA 4AIOA 1KR0A 4I9JA 4NP7A 3CV2A 4KFPA 1K9FA 4MNKA 1JI2A 4GIYA 2G3JA 4WF7A 2XG9A 3A5VA 4A29A 3QY6A 4AX7A 1TWIA 5EFFA 1KCZA 3C2FA 3LMYA 2OMAA 1YRRA 1YW1A 2CZ5A 2IPJA 3P7YA 3RU6A 4AG0A 4DBUA 3V18A 3FHQA 3GH5A 1HKJA 3PHAA 5BRPA 4GVHA 3AALA 5CSRA 1PUDA 1DOSA 1GVRA 4TX8A 3V1PA 3G6MA 4E3VA 1XLAA 1XDJA 5JVLA 3LPGA 1HP5A 3CB8A 1RAKA 4HYWA 3G3MA 4WXZA 4F9DA 1THFD 2J4GA 1QWGA 3SGGA 3LTPA 2P10A 2V5KA 3OB8A 5BXSA 3T2OA 2DZVA 1Y7VA 4D6IA 4Q4RA 4YTRA 1P4CA 2OLSA 1TPB1 4KMQA 5LGXA 3C6CA 2L5HA 4MG4A 4LAZA 4G9PA 2ZYFA 1MMFA 4MOZA 4LVDA 1KWGA 2BBFA 2PBOA 1FBAA 4Y2WA 3NQ7A 4IP7A 1W5MA 3O6YX 2VL4A 4L80A 4GZEA 1FWGC 1SR9A 3SCOA 1YBQA 5D33A 1Z3NA 5I06A 1EO5A 2VURA 3OTRA 2PD9A 1ZJHA 3TLQA 1BWVA 3WUEA 3SIZA 4UFMA 1O1ZA 1EFZA 3LS9A 2CU0A 3TN6A 3HJEA 4O57A 3W85A 4KW2A 4FPSA 3B8SA 4G7FA 4Z08A 1L2QA 2C16A 5AKQA 2W61A 3R4IA 3DCPA 3QH2A 2BXVA 4IIEA 1AQHA 1W3KA 4E2VA 2IKJA 3AS0A 2C18A 7REQA 2OLHA 2ZICA 3LCHA 4QDMA 2Y8VA 3BUVA 4LCSA 5IBXA 4PSPA 3K46A 1GKPA 3LCFA 1X96A 4ZCWA 3KZSA 4MNMA 3WL1A 2WVVB 3DBNA 3OQ8A 5G4HC 2GDUA 3C52A 5FL1A 2A3AA 5IOBA 3NO3A 2DSKA 2OXNA 5AVHA 3R79A 2H3BA 2AQVA 2PDJA 3H7UA 1Q3NA 2R9RA 4WJXA 2WLZA 3VI2A 4ZBCA 4XKYB 5DBUA 4Y90A 1F3XA 5I23A 1LWHA 4RL3A 4FX7A 4JN8A 4S2CA 2PWGA 2WZTA 4GXPA 4W88A 4GHRA 3CM4A 1HIZA 2WMIB 3PZIA 1TMHA 1Y5WA 4XG1A 3IJ9A 2JF6A 2ZUNA 2PC4A 4LUSB 3DX5A 3VO0A 3G6LA 3LXAA 4MFDA 3CLWA 4OV4A 1NFBA 3ZXWA 1AW5A 4OKDA 3A3WA 4E4UA 3BLPX 3SUSA 1GVIA 4QQUA 4DAFA 1MQRA 2FZMA 4TXEA 2QEZA 1OC6A 4PTDA 4PMQA 1OIMA 2PDNA 1HF6A 4AIEA 1RR2A 4JDBA 3TX9A 3G1AA 4WHBA 1JG9A 4K39A 4X3ZA 4J2MA 4A8IA 2DZBA 3UBPC 1JNEA 3N14A 1OT2A 1GCYA 1Z89A 4XD4A 3ZT5A 3MYOA 4GQRA 1ITCA 3SCUA 4RXGA 4DUXA 3UWWA 4FB7A 1S5VA 2EPMX 4B90A 2A21A 3LERA 1CNVA 5DY3A 4K38A 2ZUUA 3LA4A 1I4NA 2G4FA 1GYLA 3EOLA 1EC7A 1IR1A 4IG2A 2W9MA 1G4TA 4XZHA 4JN7A 4MY1A 5F2IA 1E0XA 2EJ1A 3AO0A 2ZRXA 2GJPA 4V2XA 5K9XA 5EMKA 2CLIA 2AL2A 2GQ8A 4AWUA 4L6OA 4MZ1A 2CKSA 2CXGA 5CPLA 3EDKA 3QMTA 2E67A 3W75A 2PP0A 1OADA 3VDAA 2QGHA 1UH3A 2WSKA 1WDRA 3KWXA 1V08A 3HV9A 3DKLA 3MANA 3NR0A 3GDRA 4U5IA 3EWXA 2Y61A 2X1IA 3Q94A 1XP3A 1I8JA 3CTLA 3S2NA 3TJLA 1TPVA 1V6VA 4C90A 5K2ZA 5CZJA 3WQ8A 2FLIA 3BOFA 5BMWA 3THQA 1MI3A 4DAIA 4CD5A 1VPYA 1ISZA 1F2JA 1LLWA 2VCAA 4ZMGA 4ICCX 1UR2A 2XSXA 3NG3A 5KTLA 3LCLA 3H2CA 2W92A 2PDFA 1O95A 3KDOA 4HT3A 1F7BA 1VBUA 2E0PA 1UWIA 2QCCA 1BSIA 5D2YA 2ODOA 4YTSA 3A6OA 5E93A 3THAA 3OBKA 4FNSA 2NXIA 3PZTA 1TG7A 5D05A 1TWZA 4IM4A 3W7OA 2OSWA 5F4SA 3EOUA 2EF9A 3T0TA 4F2TA 4PCTA 2PWEA 1RBOB 1NU5A 1K02A 4S38A 1L8PA 1V6UA 5FEZA 1BTCA 2G3IA 4L64A 2VC7A 2OU4A 1GQNA 4NXKA 1VLIA 2GUBA 1Q7ZA 4YL2A 3W3OA 4ATDA 1HJVA 5DQPA 1HL8A 2ZXDA 5FEXA 3OZPA 1UWTA 2B7OA 1TWDA 3ZLHA 3ZWSA 1LP6A 1R9YA 4A8NA 1P5BA 1SFTA 2QUNA 3GK0A 3GYEA 3OA5A 4OOZA 2BVWA 3H26A 3S9IA 4UTJA 1MXGA 5HBFA 3SAZA 3UXLA 3N2OA 2QF7A 4O1EA 1TMLA 4O1DA 4J3ZA 1TJRA 3WF2A 5CLTA 1Z9AA 3WQWA 2DVXA 3FA5A 4WXYA 2GL5A 4DJDA 3FGCA 3CEPA 4IIDA 4F2BA 4M8UA 1FWBC 1UR4A 1XI3A 4B5XA 3DFHA 4UTIA 3USBA 1UKSA 1ME8A 5CC5A 3N4AA 2R14A 2HVNA 1JPIA 4IPNB 2O4MA 2ACRA 2J25A 1LWJA 2FVMA 4JIIX 3LZ5A 4IJRA 1JPMA 4YJ5A 3H2AA 2A6LA 1Q6FA 3QF0A 2XGIA 3W1RA 2GWGA 3GU1A 4FMVA 4S3EA 3CAQA 1X8CA 5CCZA 1FHDA 3KCLA 1AJ2A 4FR1A 2DU2A 3RRXA 1VEMA 3BOXA 2WW5A 1BFNA 2IKGA 2A2IA 1GTHA 4NSBA 3EX1A 4JNMA 1E9IA 3ABXA 3NXLA 4IFKB 2GSJA 5D03A 3B97A 2Y5SA 3RNDA 3HFTA 3VZYA 3BLLA 4QGCA 2YBUA 4M6PA 4MFEA 2PDMA 3G8RA 4MNLA 3VNMA 2XJ7A 3LTYA 4Q4OA 2FGLA 4I9AA 4UQAA 4JTDA 1BYDA 3CB3A 2HV5A 4UMCA 3FAXA 3KLLA 2GFTA 1K1DA 1V03A 3GG7A 4CNSA 4WLCA 5BRBA 2XGZA 1DQWA 4MUZA 4GACA 3RM8A 1UD3A 1WPCA 2PRMA 2O9OA 1SMDA 1VFSA 5I00A 3VNLA 1F76A 1W9PA 3A5FA 3STGA 1QVBA 1YE6A 1ZBWA 4KRTA 1R9XA 2J66A 4PTMA 4EF8A 3W2NA 3N2MA 4U31A 4XK2A 1S2AA 1W1VA 4LF2A 1N55A 4HOXA 1QO2A 1IXPA 4KCTA 4LBRA 2O0TA 5HPCA 2ZX7A 3PJWA 2FMNA 1TUFA 4XAYA 3PJXA 3VGEA 1AQFA 3GW3A 4XTIA 4BWLC 1FH8A 2D3NA 2VKZG 4AVFA 2VI0A 1WXYA 1SVDA 3AMLA 1V0NA 4NVTA 1B0IA 1C8YA 3PR2A 1JXKA 4ADSA 2BX7A 3KHJA 2EG7A 5EA9A 3VDBA 4MYAA 3HURA 3L4UA 1GVSA 1KGXA 3WF3A 4YWSA 3W2JA 2PDWA 5AHNA 1U33A 3TAOA 5BXTA 1IT0A 5HK4A 1X8FA 2QJJA 2GOKA 4RW5A 3UESA 4CNNA 1XLGA 3QHOA 1BRLB 2NSXA 5A6MA 2VEIA 1AMYA 2XM2A 5T26A 1WYIA 3N19B 3MV01 2FPYA 4C65A 3VPLA 2YCJA 1S5NA 2CHRA 3W82A 3W7GA 2PA6A 3VXGA 4OQVA 5AFDA 4JPGA 4WY0A 3BPWA 4EWND 2J8FA 1ECEA 1C8XA 3MHUA 2YDRA 3VGDA 4KBXA 4FAMA 4UFHA 4BQ2A 4H3DA 3M5XA 3B8DA 2E68A 3QSTA 3BO9A 1PHQA 1Q4WA 3TIMA 3I6TA 2D0GA 1NM9A 2YCLB 3CUIA 5LIWX 2VWTA 4DM2A 1FXPA 2WHLA 1MEWA 1GWJA 3JUGA 1W1ZA 4ICNA 4BF5A 2WNZA 1CLXA 4FIRA 1ZENA 5HA7A 1A0DA 3GLCA 1DIEA 5KZEA 2V3GA 4PMZA 3ARTA 1QNVA 3ZVHB 4DJFC 5BRQA 1WV2A 4YHEA 5CAKA 4IQJA 1H7PA 3EB3A 4HU3A 3CJPA 1KM5A 3SUVA 3ENLA 2NUXA 4FLRA 1K4HA 4ERIA 3AIWA 4IJCA 3RLHA 3EWBX 2IPWA 1VJIA 3OGRA 3WQEA 2NT1A 1QNPA 2RUSA 1HL2A 3FW6A 1FCVA 2WWDA 3N34A 3NM3A 3EZ4A 1ISWA 1GKRA 1TV5A 1EF3A 1JDAA 2IPFA 4O16A 3HF3A 5IFTA 2NZLA 3KHDA 3MJMA 4ZZ9A 1VRXA 4ZB5A 1E6XM 4GBDA 4CCCA 2X05A 3O3RA 4MY8A 5KITA 4AY7A 4W9TA 5D2TA 4A3UA 3N3TA 5I2UA 3W7EA 3CK5A 2ADAA 3GG8A 4EPBC 2DPEA 3B9EA 5IHRA 6REQB 2ZC1A 1EP3A 2QIWA 2C0AA 3EWYA 1B90A 3GU9A 2I5IA 1M1BA 3CWOX 3GTFA 3B8WA 2HCVA 2D20A 1H61A 3UPMA 3D0CA 3GXPA 3CAKA 3SRKA 1KLZA 2Z27A 1GVEA 1RK6A 4FOKA 3EMCA 4MPKA 1LQAA 1UA3A 1DWGM 1CXIA 1VFHA 1Q7QA 3QFEA 2AMGA 2YCKX 1JQXA 3S6OA 3KEHA 4WX2A 3PJTA 3P8IA 1EGMA 4Q8MA 1DJNA 5LA2A 2ISDA 4UB9A 4HZ7A 4UTWA 1W91A 4XUYA 4QE1A 1FH9A 5HQEA 1PTDA 1A49A 4QLKA 3IJ6A 1JL8A 3DI0A 3TTEA 4A8LA 5A8NA 1R8LA 2BB0A 4AEOA 1JCLA 4WDWA 1E1CA 4WK9A 2WM0A 3CO8A 4LV9A 1QNQA 2WC3A 1FCBA 3BG3A 2PZ0A 1ISYA 4AF0B 2PDBA 1V0MA 1HO1A 3PZVA 3N2BA 3LY0A 1IZCA 1CCWB 3W7NA 1XC4A 5FD0A 5FOOA 5D9NA 2E40A 4G5DA 1BXCA 3JZEA 3CO4A 4GISA 1Y5XA 4BQ3A 4GQ0A 3W70A 1FXQA 3GFZA 3TV8A 6PTDA 3VMOA 2BOGX 4GO9A 3WF4A 3OIHA 3LCGA 1GVYA 3B0VC 2YR1A 3P6LA 4Z2LA 3VINA 4NU7A 4CD4A 5I6SA 4HKPA 2FQIA 5F1VA 1R3RA 1XGEA 2OT1A 1B3XA 3F5JA 4XUGA 5B7YA 3QQ1A 3GDTA 1I2QA 3REQA 2TAAA 2QKFA 3I6RA 1IXQA 2DH2A 1RLCL 3AICA 3N73A 3YPIA 4FK9A 4PMJA 3SY1A 1LRNA 1SSDA 3DN5A 4CVWA 8RUCA 1E6RA 4FXSA 3M0LA 3ABOA 4EK7A 4D6DA 1MNSA 2J7FA 4HYVA 5A6AA 2VT0A 3I7QA 4JQ1A 3GAYA 1LORA 2PWFA 1QW8A 1Z42A 2CFFA 3WZ0E 2OFJA 3MHGA 4EKJA 1JGIA 3ZSSA 2CERA 5CGMA 2QV4A 2Y7FA 1LLOA 2Z2AA 2PUZA 2GLKA 4JX4A 2QGYA 2Z2UA 1V0LA 3ARSA 1T0OA 3CWHA 3QGAC 2GGJA 3QKZA 1J2WA 5HQMA 3SJNA 2I9UA 2VRJA 1O4UA 3KRUA 3GAKA 1W3TA 1WKFA 4Z2JA 4A3YA 1FTXA 5IM51 3ARRA 5D8ZA 3AIUA 1ME9A 4HZMA 1L6FA 3TJXA 1RZMA 2E8ZA 5FA5A 4FF7A 4IMEA 5I02A 1NELA 4XWUA 1FWIC 2C1HA 1TTPA 3N9KA 2HJPA 3P60A 4NJHA 5HWJA 1KW1A 4MDOA 3OLDA 4LX4A 2HBVA 3AHXA 1QTWA 4LF1A 1XPYA 2FH6A 3ITLA 1E4IA 1HJUA 4XIMA 4C6LA 2WZIA 1W31A 3WFLA 3SY5A 3W7JA 2WC4A 3DERA 3EGJA 3CHCA 8TIMA 1TJPA 2IMRA 3T0BA 1JZ5A 4FHAA 2R8WA 1EQPA 1XIFA 3D47A 1TX2A 4G7EA 1UP3A 3BE7A 2NX1A 3IVUA 3LPFA 2XIBA 1W8GA 1AL8A 1C91A 2AQOA 2ZRVA 4K8GA 4XSMA 4NG3A 4UQDA 4X2PA 5JQ9A 4IMAA 5D09A 1HJSA 3RMEA 4PCSA 3S5NA 3WQPA 1HJWA 1LT8A 5AHIA 4BI7A 4CD7A 1K9DA 4GKLA 5I3GA 4PTNA 2WVVA 3MKCA 1UZ1A 3GDKA 3UETA 3EDJA 3WK2A 1JUKA 1FY6A 2X1SA 2OQYA 2ZRUA 1JAKA 3SZ8A 1FP9A 3N6QA 4LOCA 4A3HA 1EPXA 4NZ5A 3W6LA 3G1XA 4GC4A 5A8GA 4S3KA 2O92A 2YXOA 3CZGA 2YB1A 4G1NA 2WMIA 4NJIA 5GNXA 4FNRA 3AUOA 4LUSA 3PBVA 8XIAA 3SDOA 2YKKA 2V5LA 1UBSA 3VZZA 2YL5A 5A6BA 4BS0A 3HIJA 3TYBA 1TRIA 4C1NB 2WMGA 1FKXA 4IIFA 3U4FA 4Q8QA 1GOWA 4DO7A 3L0KA 5DY2A 3V7PA 3M0KA 3MS8A 3WENA 1S2VA 5G1TA 2AMXA 3UVAA 3PZQA 6XIAA 1M7OA 5LKYA 1QI4A 2VMFA 1W1IE 2FGBA 2QDEA 1ZP3A 2DQWA 1R9ZA 4HIBA 4ZA0A 3WBEA 2VYOA 4GIEA 1ZAJA 1QNRA 3GDMA 1Q2RA 3WDHA 5C8BB 4AMAA 3DFTA 2LLEA 2R1NA 3UWYA 3BAYA 4GE8A 4NI3A 1YPIA 3P61A 2E1WA 4IUGA 1TELA 2E9LA 2ZRZA 1CLVA 4PFMA 5C6MA 2E9BA 3CUGA 3P93A 2BVTA 3PWGA 1MSSA 1EEXA 4LYKA 3TONA 1VENA 4N9EA 3LGEA 1PS9A 3TCSA 5HNUA 2WO5A 3HQPA 4TVUA 1AJZA 4PEKA 5C70A 1MRAA 2UY4A 2WBKA 3MHFA 3NAVA 3PUOA 1NDWA 3VD3A 3ZYZA 3GNPA 2PF0A 5CZSA 2JKEA 4KCVA 4JY8A 3G0XA 1OCNA 2XVGA 1VBHA 3MBFA 2Y7DA 4D6GA 1X6LA 4O1CA 3FIGA 1D3HA 4KRUA 4J28A 4WSJA 1PX3A 3PULA 5H6HA 1HGWA 2NV2A 4GX9A 2V9DA 3C2VA 4XD5A 5XIMA 1ADOA 1V6TA 3GY1A 3BGAA 3ATYA 4OWGA 4INFA 2WMKA 1OK6A 2G4JA 5JBFA 2D0FA 4LUTB 2J6XA 3GTIA 1OG6A 4PMRA 1IEVA 5HANA 2Z1XA 2H9AB 2X8RA 3IK4A 3KBMA 4PMDA 4KEZA 4BI5A 2BSLA 4PSRA 1E51A 4L6HA 3KBJA 3D3FA 3FSUA 3QEZA 5JH1A 1TCDA 2EPOA 5HMDA 3IRSA 1UBPC 1W3JA 3M47A 3KOYA 1UKOA 1EBHA 1KM0A 3VNKA 3UZYA 5XIAA 2VZVA 4L56A 2HQAA 2D0HA 3F4WA 4TVCA 4UCGA 1AZ2A 3KOXA 4UFIA 5JH2A 5A69A 4HMEA 3WLOA 1WBJA 1SJBA 4LY8A 2ATSA 2YL6A 4NYYA 3SSZA 3L5LA 3EMQA 1EIXA 2GJNA 1JPHA 3SCTA 3V16A 4DJEC 1ZBVA 4ZVJA 3OZMA 4K3ZA 3S83A 3N13A 4AD4A 3I4EA 3ALFA 3EOSA 3AISA 3SUTA 3LGDA 2P8CA 2POZA 3KOWA 2VZUA 5CAHA 3IAQA 2DUXA 3VIJA 4DYJA 2Z1KA 4MDPA 4KCUA 1SUXA 5AZ0A 4GKTA 3NQ2A 2V5BA 1DWIM 3BTNA 4GG9A 3WK0A 3BG9A 1NQKA 4YXGA 4ZGYA 4AHQA 2E4TA 3FVMA 4PL2A 2VD8A 1VEOA 3T2PA 3WFAA 4M19A 4DUVA 5H8PA 2Y7GA 2D73A 4O0ZA 4OJYA 3GR8A 3HOJA 4DWDA 3T2QA 4JTJA 2Q71A 5EKYA 1IGSA 4HN4A 1UIPA 1FDYA 3VKDA 3IARA 3UWUA 1OFDA 4O8RA 2RKXA 1V8EA 4IFKA 3TW7A 5FSEC 1KBIA 3A4XA 1DIKA 3STCA 1RJPA 3R6IA 4S3DA 4LYRA 2CLMA 4FSAA 1XYZA 1GZ1A 4LCQA 4ML9A 4M5PA 4NNBA 3UJ2A 2VM8A 3MYPA 4LPCA 3ABSA 4EXAA 4PRTA 5CC6A 2DY3A 3MI2A 3W7RA 3AHYA 2DP3A 3T42A 2OZ3A 1OZQA 4YYCA 2VEGA 2P3EA 2VEKA 2IXVA 4N4PA 3VOCA 5A8MA 2GQAA 5HUOA 5EL1A 4MWAA 3V0SA 4JCMA 1A4MA 1A4LA 3U5YA 2I9EA 3VOGA 1SFSA 1QBAA 3ORWA 1VCVA 5F7UA 3QZEA 2J24A 4YLWA 3WH9A 1BXBA 1FWJC 2ZWZA 4CEUC 1G6CA 5BU9A 4ATLA 4PUNA 4MB4A 1YKWA 4IICA 4XAFA 4G1KA 3H7RA 1OSEA 4Y6GA 1XD0A 1DYSA 3GKFA 3QGVA 1WAUA 4WUIA 4W7UA 4A6GA 4ACZB 3TC6A 4HSOA 3HMCA 4YTUA 3T6CA 2XZ7A 5E0FA 3NOYA 1GHRA 1UJQA 2QDGA 2V30A 3W88A 2CZVA 3UCQA 3FHAA 2HZGA 3FDGA 1T99A 1S38A 1JCNA 3EYPA 1EYWA 3GC5A 3TWAA 3H2OA 2F84A 4IPLA 3HG3A 4JFUA 3H4XA 3TR9A 3A13A 2IPGA 1OFAA 4MWAE 1A5KC 3QPEA 3QZAA 4W7VA 1HX0A 2VCCA 5DCEA 5DFAA 1H7NA 3DG6A 1QPNA 4CQ8A 3ZLFA 3OQEA 4LBSA 3MDUA 2INFA 4MJ4A 3NQ6A 3VM7A 4D6JA 3WDQA 2QJIA 3HPAA 4TTUA 4QG9A 1J9YA 3BXWA 3LHTA 4D71A 2GGEA 4JKMA 5AECA 3BVJA 1AJ0A 2TYSA 5BU6A 1HG3A 1E3XA 1H09A 2AGKA 4DJFD 2BHZA 2X0YA 1T41A 4XZWA 2YIHA 4Q6JA 4EPDC 1WUEA 4QQ3A 2YCLA 5HXMA 1RQEA 3F2CA 3E9AA 1WQ5A 2UWFA 3DH7A 2ZRWA 1YEYA 4YHGA 2DSUA 3NURA 3EPOA 2E6FA 4JTKA 1V3KA 3L9CA 4ZL1A 4S39A 2ACSA 5GQBA 1XBVA 2ZOXA 4JX5A 2F38A 1JYVA 3GW0A 1U30A 4ZB0A 3WO8A 1S2UA 6CGTA 3PAJA 3ZVHA 4OV9A 3OLEA 3WLMA 2DSZA 4IIBA 3NM1A 1VGAA 3A3XA 1KM3A 4DPQA 3CYJA 1CB2A 4IL0A 1K9EA 5A2CA 4AXNA 4E3TA 3TQ0A 3M0MA 4KQNA 3QC0A 3H22A 1E0TA 4MF4A 2OQLA 2ZUTA 3GVVA 3CMGA 3W6YA 3R58A 1RPKA 2XISA 3L5AA 4WJ8A 3C2YA 3GS6A 1N7KA 4NILA 4Z2HA 3KE0A 1OY0A 1D7FA 2O56A 1FOBA 3SM0A 4AHPA 1PTAA 1U83A 3B9DA 5F2GA 3R25A 5D9MA 3NYDA 4H9MA 4L7ZA 1MZHA 5DMLA 4NQ1A 4FNQA 1DWJM 5HMEA 3IGHX 3A21A 1W8SA 1F3WA 6REQA 3MI6A 4J5NA 5ABTA 3CS2A 1LOLA 2FVLA 1UC5A 1A0EA 1VLWA 3B8UA 1VJZA 4RK8A 3SRHA 3KW3A 5GJMA 3QOKA 2DW6A 4I6VA 1HKKA 5LIKX 2P50A 5AC4A 1QWKA 4A3QA 3T7VA 5HWMA 1XIEA 1ISVA 3UA4A 1OD8A 1E9LA 2VQTA 5I3JA 3UG3A 3W0KA 4R34A 2QS8A 1ZTVA 2XH4A 3EWWA 3MY9A 4HD5A 5LGZA 3B9NA 1B3VA 4XZBA 4HTBA 1TPEA 1JIBA 4DLFA 1YTEA 3WK3A 1LBLA 4ZXOA 3LHUA 2R24A 1CXHA 3VKBA 4PBFA 3RF9A 3UZWA 1J5SA 4QE4A 3MO7A 1NEYA 3KUMA 4UIOA 1AW2A 1SU5A 5TNVA 2C13A 5DMYA 1KBKA 1JDEA 4CCZA 4O12A 2NLIA 2QPUA 2DT3A 5M2FX 1AH4A 4YIWA 1FWDC 2GDVA 3AYVA 1PV8A 4A4AA 3NL2A 1DXIA 4REQB 4BEQA 3EDDA 3CPGA 3V5CA 4AF0A 4GYPC 4NRSA 4HCDA 3N17A 5A6LA 3IIVA 2OOFA 2H8ZA 2AKZA 3FS2A 3TMQA 2YXXA 2AAMA 2O9RA 3W7KA 4GIAA 2E7FA 1WBHA 3B0XA 3JS3A 1DP0A 3LI0A 4YYFA 4PRRA 4ZSTA 4X2RA 2CLOA 4GWEA 3R89A 4Y9MA 4N9CA 2YGYA 4PFHA 2GDQA 3VKCA 3AS3A 1XYFA 5CBJA 1XIHA 3APGA 2OGYA 3PJUA 3HM7A 4GFSA 3WD4A 1UD4A 4A2RA 2FB2A 1XISA 3CXOA 3RO6A 1AZ1A 3F2DA 6ALDA 3UXAA 1TREA 3W74A 4X0NA 4ZQMA 3WH8A 2V2DA 5K4ZA 4JIQA 1Q45A 4CQDA 3LENA 1BTMA 5LIUX 4EXQA 5J04A 2GQ9A 2JBMA 3GNDA 2BS9A 2CITA 1VFMA 3OO2A 1BQGA 1ZQ5A 2QDDA 4D1JA 3R0DA 2J9ZA 4ZO9A 1OCJA 1SGJA 1XCXA 4NT0A 4N6EA 3OPSA 2PDUA 1E0VA 2QCGA 3RK8A 1F05A 4PBGA 1QT1A 2HMCA 1UH4A 4JTSA 4M29A 5AC5A 2CZEA 2PZNA 1NWUA 2B7PA 3BK0A 1XJBA 4J7RA 4ZENA 1H0IA 1SW3A 4OBSA 5A2AA 4QXIA 3RX2A 3ARVA 3VGGA 3M9YA 5CGTA 1M3UA 2GGHA 4L65A 3ECQA 3U6WA 3ITXA 1JDFA 4L9ZA 1WXZA 5EMYA 2D69A 1J0HA 2YA2A 1VIZA 1O7AA 3U2CA 4ERGA 3BQ6A 3H70A 3KS5A 3DFQA 3LBCA 1TPDA 3L12A 4KIEA 4IP4A 3R10A 2VP8A 4GVIA 5TQLA 2ZVRA 4PCNA 3WUBA 4DHGA 2G3FA 3OGSA 2WJFA 5HNNA 2Y88A 2A7PA 1F3EA 1M68A 3QR3A 1Q8AA 5E6YA 3OGVA 1UPMB 2QMJA 1EH9A 3BGJA 3HO8A 4AD5A 5FIPA 4PMUA 1QHZA 3WLQA 3LI1A 1XLIA 4LT9A 1PZ0A 2ZXAA 3ISIX 2WXDM 3UGVA 3RG6A 1BGGA 2DIKA 5JXQA 3TA9A 3C3NA 2V3EA 5FJUA 2CLFA 3MMTA 1YXCA 3NQBA 4UTWC 1WX0A 1GGOA 4ZXLA 2OOGA 1ZAHA 3L21A 5C9ZA 4LH8A 4RDWA 4DYEA 1XG3A 1UKQA 4LGXA 3WLNA 3N9SA 1B30A 3VIHA 3SECA 4L61A 1VS1A 1WAWA 4Q6XA 2OZ8A 3LHVA 1W1TA 3EWCA 4TV5A 4LXFA 1YLVA 3CUJA 4RNHA 1MQQA 4ZFMA 3U7VA 2XINA 3VE9A 3VZXA 4DWSC 3DBPA 1A80A 1XSIA 3TJIA 5DBTA 1E1FA 3K1DA 4F40A 4H01A 5K3VA 1JZ3A 4IMCA 4K1GA 3NO5A 2BHUA 1OYCA 4FLOA 1KXTA 1OC5A 3CHEA 3F4VA 2ZX5A 3IV8A 4GQBA 1M7PA 3GUGA 4H19A 2PLKA 4LS1A 2VGGA 2DZTA 4IGMA 5D8WA 1QUMA 3UW6A 1X1NA 1P1XA 2DZWA 1PHWA 4CNOA 3GVRA 3UCDA 4CLMA 1M6JA 1W54A 2VX4A 4ZE4A 1GEQA 4HMNA 5E09A 1XR2A 2NWSA 5FJRA 1AH3A 4IFRA 3DU0A 1TZ7A 3ZJ8A 2ZZ5A 4G6CA 4C1NA 3AZTA 4P8UA 3NZPA 4XTDA 4D8ZA 1H60A 1P1MA 2ZZ4A 3ITYA 4PUMA 1UWAA 5CEWA 3LHYA 4PCFA 4HPGA 3ZOAA 4NHVA 2CEQA 4FEZA 4JYEA 4U28A 4NRRA 2X09A 4DXKA 4ERAA 3FEQA 1EJTC 3EKLA 5CZ0A 1P0EA 2W4XA 4OBRA 2GGIA 4GYFA 2B0MA 1RY8A 5ABGA 1LG2A 3KZPA 1I60A 3HBLA 2YJQA 3BV4A 1XRFA 2WVSA 4AIUA 1A5AA 3B9OA 4B3ZA 4QG8A 3O0KA 1XBZA 1KFEA 1EXBA 2JK2A 2RJHA 4TQTA 1LQ0A 3MC5A 3NDYA 4GJIA 1HJXA 3W73A 1NIUA 3ES8A 3QXBA 5DN1A 2HROA 1UZ4A 3WNPA 3BARA 3MI3A 1OX4B 1S5WA 1TR1A 4Z1CA 4MJMA 1PE1A 3GD6A 4P2VA 3P5ZA 2XSBA 1BGAA 1Z69A 3BH4A 3PBWA 3M0JA 5EU9A 4NZ1A 4X0VA 1BSLA 3S2MA 3PVFA 3ZFHA 3PBMA 2WV8A 1TPH1 3H12A 3ZR4A 3VD9A 2FPTA 3AWOA 3URQA 4Q8TA 4C5YA 1CEOA 5H91A 4QHRA 4U33A 5TAOA 1FX6A 3UG5A 2X1RA 3Q45A 5CSUA 2PCEA 3DHDA 1KM2A 1LROA 2E3ZA 3O6DA 2RH9A 2ZC8A 3TYCA 1A5BA 3S2JA 2VHLA 5EB8A 3GRIA 2Q02A 4LUTA 1QO5A 2A7NA 5MHBA 2QJHA 2DORA 2Y63A 4HMCA 5HINA 4W8BA 3WQ6A 4V27A 1KLYA 3OJGA 2H9AA 1SFJA 3K4WA 4J4KA 4N6FA 1LG1A 3EDFA 1GYMA 4PUEA 1VHNA 2C19A 4JTAA 2QCDB 4S3AA 4DJED 5BW6A 2BG5A 3HJZA 2CZFA 3W02A 2WSPA 4P8VA 4HA4A 5CZKA 2GSEA 3QTGA 3VD4A 1CX9A 1TA3B 1ZZMA 2E1DA 4AZGA 1OBAA 3CHVA 3TQKA 2AAAA 1QFEA 4OUEA 4IF2A 2WQPA 4K7YA 4BJHA 3CQ0A 4JIHA 4H9YA 1GOXA 5AC7A 4LEFA 3MSRA 4JTUA 3KBNA 2V5CA 4XV0A 4UQCA 3R11A 1LZOA 4CCEA 4UTLA 2WMJA 3RR4A 3BJFA 5CG7A 3WLHA 4HNUA 5KETA 2C71A 3WDPP 4D6HA 5CPQA 1R86A 1JRBA 1REQB 3S9ZA 3T0CA 4Q8VA 4GMEA 3WNMA 5CPOA 3KTCA 3HFYA 1QBBA 1JPKA 4LFYA 5B7ZA 4MIMA 4S3FA 4BKNA 3URNA 3P74A 2I14A 3QN3A 4HA3A 3WDJA 2ZTKA 3GDLA 2BWGA 4ZTYA 2I56A 5CPSA 4TVDA 3GG1A 3WX7A 1YXDA 4H8UA 3W26A 3RUBL 3ANVA 3D46A 3LYEA 4KEMA 4O1AA 2ZZ7A 1GVFA 4E8GA 2Z1BA 4XD3A 3QQ0A 1FQ0A 1H1YA 1JQVA 3DFOA 4IIHA 2PURA 3VOHA 1F4HA 4FXRA 3WD0A 4JTFA 2DZPA 5CG0A 1AK5A 1D3GA 3C8FA 4D6CA 1QI5A 2P88A 3L2MA 3EXTA 2XPKA 4O14A 1ADDA 4CU7A 2ZFAA 2QQ6A 2A3EA 1KBJA 2A4AA 4OBTA 3IUIA 3UWQA 1T8QA 4XZLX 2YYTA 1K8ZA 4BI6A 1IWAA 3T55A 4HU0A 3WNOA 2QJNA 1FWNA 4QDPA 2C15A 5M1TA 3H7VA 1HVQA 3E0LA 2JF7A 2NX3A 3GXTA 5G1YA 1W9XA 1HN1A 1GKQA 3NSXA 3GYCA 2RGMA 4UNLA 3CQIA 3FVDA 3DIPA 3IUHA 1IEXA 1MDLA 1S5TA 3GUWA 2A3HA 3KS6A 1TV2A 9CGTA 1W5QA 5A5WA 1XLKA 1J12A 3SW6A 4KGLA 1D7KA 1H5VA 1OF6A 1VCGA 4M80A 5HMFA 5KZDA 4QITA 5M3WA 3S1VA 4GBUA 3VNZA 3WH6A 1PTGA 1NF0A 3CT7A 3GQYA 4HK6A 1W1PA 4O10A 3BMVA 3DG7A 3BC9A 2VFIA 2HEJA