1VP5A

Crystal structure of 2,5-diketo-d-gluconic acid reductase (tm1009) from thermotoga maritima at 2.40 a resolution
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
284
structure length
284
Chain Sequence
QVPKVTLNNGVEMPILGYGVFQIPPEKTEECVYEAIKVGYRLIDTAASYMNEEGVGRAIKRAIDEGIVRREELFVTTKLWVSDVGYESTKKAFEKSLKKLQLEYIDLYLIHQPFGDVHCAWKAMEEMYKDGLVRAIGVSNFYPDRLMDLMVHHEIVPAVNQIEIHPFYQRQEEIEFMRNYNIQPEAWGPFAEGRKNIFQNGVLRSIAEKYGKTVAQVILRWLTQKGIVAIPKTVRRERMKENISIFDFELTQEDMEKIATLDEGQSAFFSHRDPEVVKWICSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 2,5-diketo-D-gluconic acid reductase (TM1009) from Thermotoga maritima at 2.40 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Oxidoreductase
molecule keywords 2,5-diketo-D-gluconic acid reductase
total genus 108
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 1.1.1.274: 2,5-didehydrogluconate reductase (2-dehydro-D-gluconate-forming).
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1vp5A00
4LBSA 4LBRA 5JH1A 2PDHA 1ZSXA 3CAQA 3CASA 3FX4A 4XVDA 5LIXX 1T41A 3ONCA 3R94A 2HDJA 3M64A 2PDFA 4YS1A 4XZLX 1A80A 5LIYX 1XGDA 1AZ1A 2PDIA 4FZIA 2ACSA 2P5NA 3RX2A 2IKGA 4XVEA 2HEJA 4FALA 1ZUAX 4JQAA 1FRBA 3LENA 4QBXA 3DOPA 5LIWX 2QXWA 4JIIX 3GHRA 4XO6A 1XF0A 3V0UA 1S2AA 2PD5A 3R8GA 2HVOA 3UP8A 1X96A 1RY0A 4L1XA 4GQ0A 4JIHA 4DBSA 3LBOA 3BCJA 2ALRA 3H7RA 3LEPA 2PD9A 3V0SA 3UZYA 3LNMA 3MB9A 1AH4A 1Q5MA 5M2FX 3BURA 1Z89A 5AZ1A 4QXIA 4XZHA 4WRHA 2PDPA 2ACRA 2PDLA 4ASTA 3WCZA 3GHTA 3V0TA 1YNPA 4JQ4A 1X97A 4I5XA 4FA3A 4H7CA 3M4HA 1EF3A 2FZ8A 4WEVX 1US0A 3Q67A 1JEZA 2PFHA 4GQGA 3FJNA 2IS7A 2FZBA 2ISFA 2PDXA 5AZ0A 3S3GA 3D3FA 2IPWA 4IJCA 4NKCA 1UR3M 3KRBA 1HQTA 2HVNA 2PDYA 4JQ1A 4JTAA 1IEIA 2F2KA 4YU1A 2DUZA 1YE4A 3O3RA 1ZQ5A 3UZZA 3UZWA 1QWKA 4AUBA 3LZ3A 4PRTA 3QKZA 1S1PA 3NTYA 4LB3A 3R8HA 3UGRA 3UG8A 3N2TA 1MI3A 3R6IA 2C91A 4YVXA 3M0IA 4GCAA 2IKHA 1S2CA 1S1RA 4WGHA 4XO7A 1R38A 1YE6A 1EL3A 3MC5A 2PDGA 4JTQA 4IGSA 4XZMX 4WDWA 1PYFA 2PEVA 1AFSA 2PDCA 3RX3A 3EB3A 1GVEA 2IQ0A 3EAUA 3T42A 3C3UA 3G5EA 3GUGA 2CLPA 2HE5A 3EB4A 3CV6A 3P2VA 4ICCX 5HA7A 4L1WA 3GHUA 3UZXA 3U2CA 1QRQA 3WG6A 1RALA 4JIRA 4JTDA 4Q3MA 3N6QA 2PDNA 4RPQA 4GACA 1AH3A 3V36A 2J8TA 1Z3NA 1ZGDA 2WZTA 4JQ2A 1XJBA 1Z8AA 4WDUA 1VP5A 3GHSA 1HW6A 4YVPA 2FZDA 3ONBA 3CAVA 1LQAA 1EKOA 3Q65A 3WBXA 1AH0A 4OTKA 1Z9AA 3WBYA 1Q13A 3LQLA 1M9HA 4DBWA 3LUTA 1X98A 4WDTA 2PDJA 2R24A 1MZRA 3ERPA 2FVLA 3V35A 2F38A 4PMJA 2BGSA 2IKIA 3UFYA 3R43A 2BGQA 2HE8A 3VXGA 4LAZA 4XAPA 3UWEA 4DBUA 2DV0A 2HV5A 4PUUA 3DN5A 3H7UA 2NVDA 2DUXA 1C9WA 2PF8A 2PDKA 3COTA 4PUWA 3BUVA 4EXAA 4MHBA 2IPFA 4JQ3A 1YNQA 3F7JA 3LZ5A 4HMNA 1PZ0A 3CV7A 4GABA 5C7HA 2NVCA 3RX4A 3UYIA 1PWLA 2VDGA 3BV7A 2PDQA 1LWIA 2PDMA 2AGTA 4JTCA 2A79A 4DZ5A 5HNUA 4XK2A 4ZFCA 5JH2A 4R9OA 5KETA 3B3DA 3LN3A 2WZMA 2PDUA 2INZA 3G1RA 4XZIA 3WBWA 4YVVA 4LAUA 5DANA 1VBJA 1SM9A 4QR6A 4Q7BA 3R58A 1RY8A 4HBKA 1J96A 2I17A 2IPJA 3O0KA 3H4GA 2BP1A 4JTRA 4XZNX 5LIKX 2FZ9A 1MRQA 5LIUX 2IQDA 4GA8A 1ADSA 1IHIA 4FAMA 4LB4A 3LD5A 1AZ2A 1EXBA 2IPGA 2ACUA 1T40A 4PR4A 2I16A 4G5DA 2FGBA 1PWMA 2PDWA 4WDXA 1K8CA 2PDBA 4QX4A 2PZNA 2R9RA 1OG6A 3CMFA 4F40A 2IKJA 4PRRA 4H8NA 4IJRA 4GIEA 5HNTA 1PZ1A 3LQGA 2INEA 4EXBA 3R7MA 2ACQA
chains in the Genus database with same CATH superfamily
2YBVA 2V68A 2VR4A 1M41A 4J2MA 4NG3A 3GK0A 1TZZA 2QZRA 1WNOA 3ZVIA 1CGYA 2PF0A 2VRKA 4HMCA 2XDFA 3QOMA 3WIJA 4AHQA 4RV3A 2BY2A 3WQ6A 2YOCA 1LBFA 3MI3A 3OLGA 3SRFA 3BW2A 4I9AA 5I03A 3B9NA 5LNWA 4LW7A 5E9AA 2RJHA 1PO9A 5FCZA 2VQUA 5A2BA 1FKXA 3NWRA 4FMVA 3MJMA 3E2QA 3W7KA 3LX9A 2GK1B 2PWEA 1XIDA 3PBUA 5U4NA 3ZIZA 1XS2A 3WDJA 2H8ZA 3ZM8A 1UUOA 4MY9A 2E6FA 5LIWX 3E0VA 2X40A 1KR0A 1YYAA 3VIIA 2WJFA 5A95A 2ZTJA 1W9XA 3FKKA 3V0UA 4MZYA 3RPTA 3WJZA 3PFRA 3MHFA 1X1ZA 4Y9OA 1TWSA 3E1F1 1WP6A 1SSDA 3U0HA 3GTXA 4WUIA 4O8RA 4DBSA 4AXKA 3OHIA 3H7RA 4GVFA 3V0SA 3UZYA 1MUMA 1WDSA 3W72A 4V1XA 1PKMA 3S9YA 4QXIA 4Q4SA 5MKGB 1W0MA 3VIPA 3GHTA 1D3CA 4QAIA 5HINA 4JX6A 2PTZA 3TJIA 4OV9A 4YXGA 5AVNA 1M6JA 2J7FA 3B0YA 4ZE4A 4UOZA 4FP1A 4NYYA 4L6DA 3TQKA 5IDIA 4GJ1A 5AHNA 3GR8A 1H11A 1HVQA 1HIZA 2CZEA 2ZIDA 3S5SA 1SFLA 2HVNA 3UWWA 5EMJA 2DH2A 3BLDA 4PBEA 2QMJA 5F2IA 3NYZA 4FLRA 5F4SA 1F6KA 1YE4A 2PCEA 4O1BA 3SDOA 4JL2A 2V3GA 3MBDA 1TO3A 4XAYA 1O6IA 3BLIA 1TE1A 4PRTA 3SGGA 1UKQA 3DBPA 1HP4A 1W3TA 4X2RA 2H9AA 1FWIC 1K6AA 1MI3A 3R6IA 4GWEA 5I24A 5A5WA 4QNWA 5JQ9A 5FF7A 3MP3A 1OCJA 1DWGM 4S3JA 3O16A 1SJCA 3THDA 4YIWA 3UJ2A 2Z1XA 1V6VA 1GHRA 4LS0A 2R82A 2BGNE 2XJ7A 3E12A 4EP8C 3MC5A 3R11A 3ABSA 2INFA 2Z2AA 3MDUA 2OQYA 4IPLA 2OLSA 5TF0A 3AJ7A 4DO5A 3EAUA 1P7TB 5K7JA 2FHCA 5BZAA 3RRXA 4C6CA 2ZZ1A 1NTHA 3EX1A 5FA5A 1NEYA 3IIVA 3M5VA 3IJQA 3CZJA 2W66A 5I79A 3UZXA 3WG6A 5E6ZA 1LZOA 4CQCA 1E6SM 3FYOA 2G97A 3LCIA 4KESA 3CQ0A 3ZWSA 1AH3A 4GFIA 1JJKA 5D9PA 4FSAA 2XISA 2E3ZA 4EPBC 4XX6A 1DHPA 4L6OA 3TOYA 1Q7ZA 2DVUA 5IFTA 3NQ7A 3EX4A 3PPHA 3MANA 2VQTA 4CKQA 1VRXA 4W89A 2QDEA 3OZOA 1FP8A 1DWHM 1JAEA 4C1LA 3RO8A 1KD0A 4AIBA 3VNKA 4M7TA 4D6DA 1AH0A 2QR6A 1Q13A 1OC7A 4H83A 5DMNA 7REQA 3CL6A 3QY7A 3RAOA 4MGGA 2DEPA 2E8ZA 1ZJHA 1F3TA 1KXQA 3ITTA 4LQ1A 5AOUA 3T0CA 2IKIA 5C9RA 1UA7A 1JZ6A 2L5HA 4J7RA 5FSEC 2DQWA 2R14A 1UC4A 1EUNA 5E93A 5FACA 3V1PA 1IZCA 2DVTA 4L4LA 1YPFA 3KP0A 1XM3A 4XKYA 3QQ0A 1C8XA 3H21A 2XSXA 1OWQA 2RGMA 3KZPA 3CQKA 2IPFA 2Q3OA 1MW3A 4NJKA 3UWUA 3ARTA 2ATSA 3EWXA 2DZPA 1KM1A 2JKPA 1PZ0A 1HJWA 1E70M 2EPMX 3T05A 4Q8NA 2NVCA 3QW3A 3WLOA 4E8CA 2C1GA 3CMJA 2PDMA 2VURA 3SFWA 2QLYA 2YA2A 2FFCA 3VD3A 3KVLA 4ZFCA 1QBBA 3B3DA 2YFNA 3RJYA 1XLKA 3D6NA 2PURA 4AG0A 1HO4A 3NGFA 4P7LA 4H4IA 3IIZA 3H54A 1VBJA 1ELSA 4QR6A 1ZALA 2R1PA 4J3SA 2IPJA 5G4EA 2YCEA 2X1SA 3DG3A 4LCSA 4M8UA 4XB3A 3W29A 1VPQA 3E38A 4LUSB 2PS2A 3AFBA 3PBMA 4FAMA 1P6BA 1L6SA 4Z0SA 1KM5A 4EF9A 4LB4A 1W3NA 4X3ZA 1MFUA 5HWJA 2A3BA 4GBDA 3V5FA 1OCBA 3G0XA 1HNYA 3HG2A 3MSRA 5E9XA 2EG6A 4G5DA 3G6MA 2B7NA 4Y9AA 2OZ0A 1OFPA 1W5OA 5EMMA 1RQEA 1MEIA 1X6NA 3PZGA 4GIRA 4Z42C 3G6LA 5KZMA 5TAOA 4ZOAA 4L6HA 2YLAA 1QHOA 1UQZA 4Z2KA 4Q32A 1CWYA 1YQ2A 3M0YA 4IIHA 2NV1A 3AUOA 5CPLA 4BQ5A 1WKDA 4TVDA 4MUZA 3JVAA 1HKJA 2QJNA 2HCVA 4IP4A 4UFLA 5GVJA 2V0TA 4YYFA 2PDIA 1VENA 3WQDA 4S38A 2IKGA 1QNQA 3RGTA 4FO4A 1SJBA 1JFXA 1F61A 1NJJA 1ZUAX 5DY2A 3MCOA 5D32A 3QHMA 3HBLA 2VUNA 1HTIA 2X16A 3PS7A 5HR7A 4D6HA 1AA1B 3DH7A 1D8CA 3L23A 4XD4A 3M0HA 2FJUB 1SW3A 4IPJA 1W5QA 2HRWA 1UWSA 4GYJA 5KZDA 2VFHA 4LUTA 3GG7A 4JIHA 3LBOA 3GG1A 4BHYA 1JVNA 2E4TA 1NSJA 2PP3A 3DKJA 1RK6A 5FJJA 2WOQA 2QCLA 1QU4A 4O10A 4I5UA 4GX9A 2JEPA 1V5XA 2DZWA 3GTIA 4JYDA 4DM2A 1X97A 3MCNA 4BY3A 1W1A1 4FA3A 1VEMA 2XWEA 1J18A 1BG4A 1BD0A 4H7CA 3TQPA 3AMDA 2HPMA 4WF7A 4MWAC 4NVTA 3MCMA 1QOXA 3LXBA 3F4VA 2HXUA 1FFRA 1GZJA 2PDXA 2PWGA 1K9DA 3IIOA 5F2MA 1ODUA 3F5KA 1DJHA 3AXXA 2J88A 3L5LA 1RSCA 1Y5WA 3LV5A 3TZFA 3WLRA 1Q66A 4MOZA 5DX7A 3W1TA 1UD5A 3DFTA 4JEQA 5LZLA 4HB7A 1RH9A 3CU2A 1X39A 3ZLHA 3UWVA 4P8VA 1CW2A 3AHYA 3FGCA 3SY1A 1ZQ5A 3QLLA 1YXCA 1JXKA 4F0MA 2FB2A 1QWKA 5HQEA 1F74A 3STGA 3WMCA 1F3WA 1IEXA 3FJ4A 2VCBA 5GJNA 2WQPA 3EX3A 5CZKA 3B04A 2OEMA 1JCTA 4GYKA 3FIGA 1G5AA 3P82A 2GDQA 2AGKA 3MUAA 5BWFA 4XD5A 4OECA 3CL7A 3O6CA 1L8NA 2UZ9A 3KRSA 1UH3A 2HK0A 5LYRA 1YE6A 5C2GA 1JUKA 1Q63A 3CEUA 3M0LA 2D2GA 3BLOA 2BVYA 2XN2A 1PDYA 4J3VA 4QEEA 2Y5SA 4KFOA 1UPMB 4AU0A 1E9ZB 1XINA 3ZJ8A 2UY5A 1KO0A 1UASA 4UTWA 3TSDA 5TBOA 1ZJBA 4GVGA 1PYMA 3P8JA 1KM4A 1MQRA 5KINA 4IMFA 3F4WA 1EHNA 5HJXA 5T8GA 2WZEA 1QHPA 3QHNA 3GZAA 3STEA 3FGCB 3R12A 1DIOA 2BXYA 3H23A 2VL4A 3WEMA 4X61A 2VR5A 3UPBA 1G4PA 4LV4A 2NV2A 5HUOA 2GDUA 3ITOA 2CETA 3NPVA 2VNCA 1FCUA 2VC9A 4TVUA 2WM1A 3WUFA 3M07A 3BICA 1YEYA 2VC5A 5M3WA 2ZC8A 4TV5A 4JPGA 3VYLA 3BV4A 3WEOA 1F05A 3AIQA 2Q8LA 3WBXA 1I45A 3UWZA 3ZXWA 7XIMA 3B97A 1P1XA 4HYVA 4UNLA 4DBWA 4UIOA 3V35A 2Q8XA 2QCDA 1I1XA 2X7VA 2PA6A 2XIIA 3B4UA 2OYKA 1TVNA 2BGSA 2CERA 3GNRA 4LFYA 4DUOA 2NX1A 3UFYA 1SGJA 3OLEA 4C6NA 3CHCA 2GVEA 3CIXA 3NDYA 3R2GA 5G1TA 5FD0A 2DV0A 1RLDA 4PMYA 3C3NA 5A2AA 4H6EA 1KFLA 5TNVA 5HWNA 1FWGC 2J79A 1JZ2A 4JTUA 1ZPTA 4PMQA 1K6WA 2DT0A 3VNMA 1YNQA 2XU2A 2X0HA 1OFBA 2DGAA 3SURA 1FX6A 2RH9A 4JCMA 4K8EA 1GORA 3KRZA 3CV7A 4LNCA 1GT8A 3W24A 2ATMA 2WVTA 3R8RA 2F9RA 3N4EA 3UJSA 3B8SA 2VC7A 3AS2A 4MNKA 5GNZA 4IIGA 3G2GA 1TB3A 2ZICA 2P3EA 1CLKA 4S2CA 4C6LA 1DKWA 2PDUA 1XBXA 4PBGA 3O6AA 1H4PA 3S1WA 1W3JA 1VKFA 2AQWA 1LLWA 1SJDA 2V3FA 4R7WA 1XKYA 3ZMRA 3CUHA 2ZE3A 2EEXA 1V08A 2QCNA 3VGHA 1TR9A 3S1VA 5CC7A 4KW2A 1XRTA 5KMYA 2CLOA 2QJGA 3ZS4A 4RPPA 3JZUA 1B30A 1QI4A 3QGAC 2X30A 3MHUA 4F40A 3U57A 3WK1A 1JL8A 5REQB 2VENA 4LVFA 1Z7AA 4FOUA 4PRRA 1GZ1A 1LLZA 1EBGA 4M29A 1A53A 4HZ8A 1DQWA 1IV8A 2H90A 4QJ5B 1PZ1A 3UU0A 1NM9A 3LCLA 4WXYA 2J78A 4I6KA 3B40A 4UOJA 3OBEA 1EP1A 3CLMA 1M03A 1J12A 3W1MA 3P3BA 4O54A 2JEQA 2XGBA 3VGGA 1EDTA 2ZX6A 4O28A 4AIOA 3U5YA 2FLIA 2YCKX 1UC5A 3DX5A 3R94A 3NYDA 2PC4A 2VC6A 1W54A 4UFHA 3RX2A 1YTDA 3GNDA 5D05A 3OZMA 4FALA 5IHRA 2VMFA 2ZVRA 2PC8A 4RE3A 1PIIA 3SJ3A 2YX0A 4GVIA 2R1LA 4LT9A 3PZQA 3IGXA 4LBUA 1OSEA 3GNNA 1OT2A 2DIEA 2J8GA 4MFEA 2YFOA 1G9HA 1XF0A 4NJHA 1QASA 5FEPA 4DZHA 3ARYA 4M56A 3NQVA 3RRAA 5IXEA 3HF3A 4WCJA 3UP8A 4IX0A 3TC3A 3G3DA 1L6FA 3HJEA 1J0ZA 3JW7A 2OLAA 5D2TA 3VC5A 2W91A 1QW7A 1GJUA 3VFCA 4XWUA 4Q6JA 1JQXA 1IGWA 3GU2A 2VDHA 4XZHA 3IVSA 3SUSA 5CBIA 3I6RA 3T0BA 2WVVB 3TKFA 3PANA 2HPIA 1HO1A 3AJXA 2QUTA 2ZC1A 5D03A 1PTDA 3N2MA 1M7XA 1HP5A 1EF3A 3GVQA 1JRBA 2WVSA 4L65A 4RW3A 4J9JA 4QQUA 4X2PA 1DQUA 3FJNA 5K9DA 2YW3A 5HK4A 3B06A 1D8WA 2IPWA 3D3FA 4PMNA 3E0WA 3KRBA 2NQ9A 2VM8A 3EEZA 1AJ0A 1QNOA 5A8QA 4S39A 4MWAA 4JQ1A 1H7RA 3GO2A 4UCGA 3LGDA 3LHWA 5H8MA 4FLQA 2QKFA 2OKOA 3NQGA 3O3RA 4DO4A 4B91A 1GOQA 1PJ9A 5AECA 4LYQA 1RXOB 4PB3A 1NOUA 3A23A 1RZMA 2NXGA 6ENLA 2XG9A 4KWSA 4N42A 3FOKA 5DY3A 3BL3A 4ONVA 4YVXA 4OOZA 2YBTA 3FEMA 4PCNA 1B0IA 3NA8A 1S2CA 7CGTA 5BW6A 1EGVA 4A8RA 4GGBA 3M0ZA 1YXYA 3STFA 2OSYA 5GJPA 3OGSA 2PE4A 1AFSA 3FSTA 5FI8A 3HMJG 4RE4A 3EB3A 3AUJA 2VXNA 3BH4A 4I5RA 4K8HA 2FJKA 4PMRA 3GYEA 3PJUA 3GDTA 5LA0A 1LWJA 3PAOA 1P4CA 1KNWA 4FNSA 3IJ7A 2GWGA 1RALA 3GC4A 2G4JA 3T08A 2JIEA 4FXSA 1XBYA 2QAPA 2XIJA 5D2YA 1K03A 1EJWC 3IJ8A 5FL1A 1PIFA 1R9ZA 3N2BA 2VVNA 1XIJA 4NZ3A 2D24A 4F66A 1Z8AA 4WJEA 3O63A 3ZFHA 4Q8PA 1P7TA 4JIQA 3OHMB 3ONBA 1L0PA 1CYGA 4GQRA 1Q7MA 3BAKA 3LRLA 2CKSA 1IIHA 1NDZA 4OTKA 1Z9AA 3ICJA 2CBJA 1OX4B 3B8VA 3ZJ7A 3W1UA 4MFDA 1PX3A 1OD0A 3F5JA 3ALGA 2Z2UA 3M5YA 3QMRA 2DY3A 3N17A 1WDRA 3K46A 1XICA 3IK4A 3K1DA 3QQ1A 3DXIA 3GU1A 1NOWA 4U2YA 2I9UA 1W9BM 5E0CA 1LBMA 2OU4A 1UCWA 3RIKA 2XVNA 4WQ6A 3SCSA 3W2JA 4Q8QA 4H7ZA 3PBYA 4JBRA 2HV5A 4YHEA 2W6RA 4NL1A 3ISIX 3UJEA 2DT2A 1YMYA 2OYMA 2PTDA 4EXAA 3W7GA 3NXLA 2CLHA 4JHMA 3CYVA 4MYXA 3FY1A 1AD1A 1DJNA 4F0KA 1J0YA 2O9OA 3SIMA 4XZWA 3T0DA 1XLGA 1E0VA 4HMDA 4JTCA 4P7NA 2O0TA 4KRTA 4C91A 1GVRA 3WQEA 3CPGA 4G9PA 5C9WA 2P53A 4HCDA 3TWAA 3CQJA 3RXZA 4MF4A 5J5RA 1PEZA 5CGMA 5AHEA 1EC9A 2INZA 4XZBA 4CNNA 3DYPA 4Y2WA 1W91A 3FA5A 2ZUSA 3GR4A 1KTNA 4UZSA 2OG9A 2I17A 4DUWA 3CHEA 4O1DA 2DZUA 2ANUA 1GOOA 4DUXA 1C29A 1BF2A 1OX4A 3QYQA 3WJSA 4BEUA 2Y70A 2G41A 5A69A 2BNJA 2VEFA 2ZA2A 4AC1X 3QPZA 3RU8X 4C6JA 1R30A 3NURA 3T4CA 3UVAA 2HS8A 1KQZA 4R7OA 4AD5A 1R3VA 3A4XA 1TJ2A 3OBKA 3PR2A 2KZHA 2OTDA 2OSWA 2CXGA 2OEKA 1Q45A 3B9EA 3VMOA 1Q6CA 4CNTA 2FTYA 3WDIA 2OEJA 3GLCA 5IBXA 1GOIA 3KBMA 4DY1A 4X0VA 2GK1A 3O9NA 1E3ZA 4BQ2A 3AIVA 4NJJA 4DNHA 3LSBA 5DCBA 4PTMA 3N13A 2Y5EA 2CHOA 3G22A 4QG9A 2FTPA 4NNBA 3MSYA 1K7EA 3W2LA 1SVDA 2BOEX 1XLDA 5LNSA 2PDFA 4YS1A 5G4HC 3W22A 3WYZA 1JCJA 1J10A 2OODA 1AUSL 4HHMA 1TG7A 1TMQA 1GQKA 2Z1WA 2R6OA 4GZEA 1DXIA 5DXYA 3BCFA 3IS4A 4FX6M 1O5XA 1W31A 2CC0A 3AYSA 1VFHA 4CD4A 4AX7A 4JXCA 1JQVA 2AAMA 1E72M 5GJMA 4JFWA 5EL1A 5BCAA 3MSGA 2RKXA 1EX1A 3PZIA 4DF0A 4H9YA 4R33A 1RY0A 3TIMA 1EJXC 2A6NA 2WMGA 2J9XA 1C8VA 4RDZA 3LEPA 3SUUA 4HN8A 1SMDA 2A0NA 3W07A 4IXXA 1TJ1A 3BURA 1Z89A 3RM4A 4QG6A 2XH2A 1AQHA 4Z1CA 3MYPA 3BO9A 3Q4DA 4QDMA 1S2WA 4ECLA 3V0TA 9RUBA 3KL0A 3LPGA 1WXYA 2JALA 5I77A 1LT8A 3MZ2A 3NEHA 4CQDA 3SRHA 1JUEA 1DIEA 3P8IA 4NI8A 3NSXA 2WBGA 2Y8VA 3UXAA 5D2WA 1UR3M 3BVJA 5HNRA 2ZXBA 2WVVA 1VIZA 1U5VA 4PMXA 3VA8A 5BXSA 3WD1A 4QISA 2PDYA 1FH8A 1JNDA 2DU2A 4Q4MA 4LU0A 4O0ZA 1E4NA 3O8AA 3UZWA 4I7VA 3NZ1A 2ZZ5A 1VCGA 1HKVA 3CL8A 3N25A 4N9DA 1E1CB 1H7PA 4K38A 4F9JA 2ZRXA 3UG8A 2PODA 5BXPA 2JKAA 4G8TA 2ZOXA 5A6MA 1ZU8A 4M3PA 4EWJA 1QBAA 4O53A 3UEQA 2GJNA 4M80A 1R46A 3WNKA 1H62A 4DZIA 2CBUA 3GM8A 4AZIA 3DFSA 3FFSA 2QDDA 1HKKA 3GXPA 5KZ6A 1ZENA 1AODA 4R34A 2OWWA 1AMYA 3GFZA 3A9IA 1A5LC 1X1NA 3LA4A 4YWSA 2HXTA 2C7FA 1GPWA 2AL2A 4IH3A 5BRQA 1W8GA 3DERA 3H55A 3TYUA 5PTDA 4C6PA 2P0IA 2WQDA 3QZ6A 2BWGA 4D8AA 1G7UA 2ZRZA 1KM2A 1K3UA 2OVLA 1O5KA 3BSHA 3OVQA 4ATLA 2GGIA 3Q37A 3S2MA 4OKDA 3TLQA 3VIHA 1VHNA 2PAJA 2XIMA 5BOFA 1H7OA 3D3AA 2EHHA 4D6EA 3VNYA 2J8TA 1Z3NA 1OC5A 2B7PA 1F4AA 4LOCA 3BARA 1MUCA 4CGTA 3HJZA 1RCQA 3UR5A 4QSHA 3UA4A 3I7SA 1YDOA 1V3HA 2E6DA 4UTFA 1F6YA 3UERA 4HU8A 4AVOA 3BZJA 3B8TA 4AWSA 3WH9A 1GK8A 3CC1A 3GAYA 4Y96A 5FJPA 4DJDC 2WPBA 3ZZ1A 1GJPA 5B80A 1ISWA 4FNPA 1R3QA 1CGVA 5I0DA 1LDCA 1DTUA 2HVMA 3L12A 3AS1A 1ZY9A 3HZ3A 3VXGA 1JG9A 2O56A 1B9ZA 3BJTA 4ZXLA 1WV2A 3TCEA 4DLMA 2Y2WA 1ZHAA 1C9WA 4K7VA 4QAWA 3EOUA 2WPGA 5A8PA 3NQMA 2VCAA 3QY6A 3NZQA 1CDGA 5A8MA 2XVLA 3N9KA 1BG9A 3M0XA 4GABA 4NT0A 3WJXA 8XIAA 1GNXA 3NQCA 2ONEA 4J3UA 5AHLA 2PDQA 2CU0A 4HP5A 2WCSA 1WZLA 3WQ4A 3HO8A 1BAGA 2CWXA 4GUFA 4PMUA 4YL2A 1RPKA 1IEQA 1IGSA 1TMHA 2JF6A 2PU1A 3QZAA 3WLQA 2FDSA 3GUWA 4AZCA 2CZDA 1SM9A 4H3DA 1GOMA 1U2YA 3KL5A 4E5TA 3XISA 4YCOA 3VAVA 3UCCA 5AC6A 3FXYA 3O6YX 5CPTA 4C6FA 1J6OA 2BP1A 1CLVA 3A64A 4ZOBA 1MXGA 2ASHA 4OGZA 3AOFA 2WNQA 3AXMA 5LIUX 2GVGA 5MHBA 2ODOA 5XINA 3N15A 3WMLA 2B0MA 1TWZA 3GBDA 2E77A 3R79A 2PRMA 3FV9A 3VOJA 2YIHA 3LV6A 3C8NA 4IQLA 1RBLA 1YDYA 4HMEA 4TMBA 2J6VA 3CLWA 1UWUA 4KCTA 1ZNNA 4HYRA 3QPYA 2YDSA 4R85A 4KRZA 2X2GA 1TV3A 1FUYA 3W74A 1P48A 4HHHA 3BG5A 4IJRA 3UWQA 1VFLA 4PODA 4NUWA 2VGIA 4AIEA 5AC5A 1MWOA 4F9DA 2KX9A 4H6QA 5JIWA 3LHTA 2OO6A 4MY1A 1DXEA 1J0IA 1WZMA 3WY1A 1W1B1 3SFKA 2P8CA 3PNUA 4ZA0A 4HPJA 1KM6A 3N73A 4IMEA 3OTRA 2XFYA 4MJ4A 1DIKA 3A3XA 1V02A 4UTHA 1OX5A 5F1UA 3EKGA 5HPOA 5E70A 1KGUA 1SW0A 3CQHA 2EPNA 4PE8A 1FXQA 3HFYA 1KCXA 1CBGA 5AHFA 1FCQA 3VM5A 1UR1A 1FKWA 4XO6A 3ZYZA 3CUJA 2PD5A 4U5IA 1DJIA 5MF5A 3OVRA 2OT0A 3VKBA 4Q6XA 1VBRA 3BCJA 4JYFA 4NILA 4JFTA 4LUTB 3AROA 3R0DA 3I4EA 2GGGA 3UYCA 1ZZMA 1GOKA 4CCCA 2VYOA 3W26A 3NVDA 2WHLA 3DI1A 4JDYA 4H6KA 4LVDA 1TUXA 1TQXA 3GDRA 2PDPA 5JMUA 1EJRC 1I75A 3CK5A 3W6MA 2WMHA 4DBDA 1VRDA 1EX5A 1SFSA 4K6AA 1H63A 3EA3A 3A13A 1UD2A 4GO8A 4IGNA 4ADTA 2JGYA 1F7BA 4K3ZA 3ZLGA 1DJWA 3V16A 3NJ3A 3F03K 1O95A 3VD7A 1US0A 1OD8A 1R3TA 3OVGA 3SCWA 3SECA 4C1KA 5AC7A 4GQGA 2D2HA 4BQ3A 3TJ4A 4TX9A 4HCLA 4LV9A 3ZVHB 5IFPA 1PPIA 3URAA 2X05A 3VUPA 4DVOA 1NP2A 1Q4NX 1HQTA 3IIPA 2O4MA 1HJQA 2MANA 2QCHA 3A5VA 3BJSA 3M6DA 1MW2A 5HULA 1W8SA 3QF0A 1EUAA 4DF2A 3BWWA 3WUEA 1KXVA 1S5NA 1JFHA 4EPEC 2OOGA 3PZOA 3VX0A 4NAFA 1B1YA 3B8IA 2E9LA 1J6PA 4JR5A 4KERA 3PUEA 3T78A 3N19B 3WLPA 1FWSA 2YZRA 3W2NA 4NXKA 1JCLA 1KFJA 2I56A 3MA8A 3R5EA 3QMTA 3IK2A 4S3DA 3W1LA 2G8ZA 3UZ5A 2V3DA 1XFBA 3K8LA 3QTGA 4HQVA 4JCLA 1IXOA 3ZWTA 4JN7A 4MLJA 3WLHA 5BOOA 4EKJA 4J27A 3LI1A 1JI2A 4AY7A 3B0PA 5LHEA 4HU0A 4DX3A 2GVYA 3OYXA 1GQNA 2VFEA 1Q85A 5I09A 4QEHA 3E5BA 3R10A 2Y4SA 4B3KA 2RHGA 5I23A 3C2VA 2PPGA 3U4FA 1EOKA 4BF9A 2VEIA 4ZENA 4ZOCA 4WX2A 4IICA 4D6FA 2CITA 2PMQA 4QTGA 4JZ5A 4Z1AA 1Z41A 2H3DA 3ARZA 1VGAA 3FHAA 4ZR8A 2EQDA 4MB5A 2GDVA 4MUPA 2CFFA 1UR9A 3GXDA 4B5XA 3UESA 1V02E 1M9HA 3PVFA 4Q8VA 3H24A 1QPOA 3R4IA 2G3FA 1G6CA 4MLRA 2D0FA 4CQ8A 3W85A 4QG8A 5C0QA 1FCBA 5H2ZA 3PNZA 4I3GA 5E09A 1E0TA 1RLCL 4HK7A 3CHDA 2Z1BA 2XVGA 2NQLA 1DWAM 4IIDA 7REQB 1E0UA 3AAMA 3FVMA 1TTIA 4PUUA 3EDFA 2NVDA 1M7PA 4ZFMA 3S2LA 4B5UA 4UFKA 4Z17A 1JZ3A 3DZ1A 2OSXA 3BUVA 4J35A 1BXBA 2C71A 4AZBA 4PFMA 5AC8A 5A6BD 3LERA 4GXPA 3VMPA 5G2WA 1B3VA 4RZ5A 3EOOA 3U8GA 1XDMA 1J0KA 3A12A 1G4SA 4PTWA 2BSLA 4Y6GA 3T2OA 3GXFA 1JUBA 3WK0A 4REQA 5HBFA 4MAVA 2DDXA 5ENLA 3WF3A 3LXAA 4CU6A 3HGOA 3UWYA 4AF0B 1PKNA 3ARSA 1Z42A 3FEQA 4PH6A 3GQYA 4EE9A 5CG7A 1REQA 3CPRA 1H1NA 1BVNP 3M5ZA 1ZBVA 4P5UA 4B5VA 2UY4A 4RV8A 5BRPA 1GHSA 5K4XA 5CH9A 3H70A 2PWVA 9CGTA 2IQDA 2UV8G 2ISWA 3MWCA 5HPCA 4XD3A 3B0XA 1HKWA 3NO1A 4LX4A 4YMZA 2CNCA 3AIUA 3PTDA 4UTMA 5D4YA 2I14A 1BSLA 1U33A 1PWMA 6XIAA 2PDWA 2X0SA 4W88A 1LRQA 3PTKA 3CV2A 1ADOA 3T0TA 1NQKA 2B31A 1G0CA 5C2XA 3PSWA 3K8MA 4C7FA 3PWAA 1LYXA 1VFUA 3L4UA 3N04A 2YXOA 4PMZA 3VCRA 1E1EA 4B9YA 2ZKMX 5D30A 1A5MC 3BLEA 4JTFA 1RQBA 3VKKA 3W53A 4ZQRA 3H2CA 5EMKA 1W3IA 2VI0A 4ES4A 2WSRA 4A3RA 4XBJA 3NO3A 3FS2A 2OMAA 5CKSA 3P80A 2WM0A 1UKSA 1GQJA 1YDVA 3TC7A 3BANA 4BQ4A 2ZYFA 1WAUA 4JQAA 2OLHA 4M1RA 3S5YA 1IYXA 3QHOA 1GVQA 4Z2JA 5LA1A 1FBAA 2CEQA 1MSSA 3VNJA 4LYRA 1EPXA 4L9YA 2QPUA 3C0QA 1M7JA 2V5LA 1AJ2A 2ZWZA 2P0OA 4BCEA 5BMXA 2OXNA 5MKGA 2BVTA 2E28A 1VD6A 2FMNA 3NL2A 1KXTA 4IMDA 1NFPA 3GDKA 2OJPA 2H8XA 4QLLA 3RG6A 1XLHA 4HHPA 5FF4A 5FEWA 1DWJM 1RBOB 5BOEA 1QPRA 2W79A 1X7FA 4LSBA 4AVFA 2W3ZA 2XTKA 3WQVA 3QLDA 2V5DA 4C5YA 3AWNA 3TSBA 5LNUA 1HN1A 2CXEA 2W9MA 3TAKA 2WXDM 4PUKA 4EPDC 3W3OA 4LALA 2Y5JA 3E3HA 1GWJA 5J04A 1EJSC 4ZBCA 3NSMA 3ITLA 4TMCA 4OIFA 3GD6A 4L61A 1DPMA 5G2HA 3ENLA 3N1AA 3T8LA 2DZVA 4IP7A 3SO7A 4F2UA 2GGHA 5FJOA 1TCMA 3CB3A 1N82A 4QDPA 2QDGA 1O94A 3EX2A 4ZODA 2X1IA 3FK4A 4IUOA 3NQEA 3G1HA 5EKYA 2DT3A 2ZDSA 1JYNA 4G56A 1H51A 3N6HA 1JIBA 4JTAA 2R1KA 5AYYA 4MKSA 1ZAIA 4N6FA 3QGVA 3SCVA 1KBIA 1JZ8A 1NOFA 1UZ4A 1US3A 3RYSA 3TN4A 1HJVA 5I06A 3L9CA 3T9PA 1X6UA 3VDCA 1V03A 5H91A 4H9VA 2C91A 1M3UA 4DPPA 1O66A 1GJWA 3AISA 2BY0A 2Y88A 3GW3A 3KOYA 1S1RA 3OYZA 3RPMA 3EBVA 3SQSA 3IRDA 1PAMA 3SBFA 2H3BA 4XZMX 2PEVA 1D9EA 4UNKA 4TOQA 1LUCA 3TNBA 3DECA 2OKTA 1NDWA 3XINA 1SU5A 8TIMA 3NPUA 4C6IA 2C13A 2R91A 4FR1A 4PMOA 1Z32X 3R89A 2BASA 2J27A 4NF7A 2DW6A 2JF7A 2NVAA 3P7YA 1VH7A 2WKJA 2NXIA 1NH6A 1TPVA 2BBFA 1OFDA 1V93A 1QXLA 3SGZA 4R53A 1V6WA 3IJIA 1QDSA 4WXZA 3SSZA 1JF6A 4ZB0A 2WZTA 2OWCA 1T8QA 2NX3A 2YW4A 5HR6A 2ZUWA 2VD9A 3L5MA 3ARQA 1C8QA 2J74A 1VP5A 4WK9A 3GDLA 4XZ9A 4IG2A 2FZDA 4JTGA 3W7IA 3A9BA 4C65A 1I2NA 4QE4A 1ECEA 3D47A 4HZ7A 4NSBA 3FYYA 1C7TA 1GEHA 3ERPA 2HJPA 3VC6A 6XIMA 4OOUA 3BPWA 2VR2A 2HISA 4DWSA 4E2BA 1CIUA 1XH2A 2GQAA 3WH7A 4MB4A 3W28A 1BKHA 5AYBA 3QQWA 5K3VA 1JPIA 5DEZA 1R2TA 4UQEA 3IWPA 1AL7A 4ACZA 2YZ5A 2HNEA 5EB8A 1UBPC 1CXFA 3SRKA 2VKZG 5D2VA 3W7DA 3HB9A 2E25A 4LF2A 1VYRA 3OEXA 4RXFA 1CXLA 1S3TC 4QGCA 2WC7A 5I3KA 1OHLA 4UTWC 3J7HA 2ZTKA 4CEXC 1WDPA 5DQPA 4NXSA 1B54A 3RX4A 2Q71A 4O14A 4Z1BA 4LTSA 3M43A 5T91A 3TU9A 1VYPX 3GB6A 4GXWA 3W86A 2WHMA 4ACZB 3REQB 1OVDA 2VWTA 3WLIA 3M5XA 1K9TA 4CVWA 1VFTA 3CQIA 4GO9A 4KCVA 2Z28A 3W7HA 2ZDRA 4GISA 5DCDA 1E4MM 2FFIA 3URNA 1U5JA 4LC8A 4WD0A 3BOLA 3VNLA 2A7NA 3H6OA 1WDWA 2FH6A 3PZ9A 2AMGA 3WFZA 4DWSB 2X1RA 1KLYA 2YDRA 3SUTA 5AYXA 2I9EA 3W7OA 4XIAA 3MS8A 1WE5A 5LXEA 5HAOA 1Q6QA 5JIPA 4RLIA 4EANA 5DELA 3L21A 4TR9A 4FX8A 2XH4A 3A21A 1OIMA 3AIBA 3V1HA 3H7VA 2Y63A 3CUXA 2IPGA 4J3ZA 2A3EA 4PR4A 1SR0A 3G1YA 4DJEA 3HA1A 1TPH1 1POJA 3IVTA 3KTCA 4MJZA 3AXKA 1E6RA 3UXLA 4NZ5A 1LL7A 5BXRA 3LCGA 1FQ0A 2GQ3A 1H7XA 1EO5A 3KLKA 5CZ0A 5HNTA 1TV8A 2INEA 2DSUA 2J47A 2PTYA 4K39A 2NV9A 3GFYA 4ERIA 1EBHA 2HBXA 1GW1A 3NG3A 3LMYA 1LROA 1BKSA 1O1HA 4WGXA 3SCOA 1BFNA 4ZXOA 1LT7A 3DIPA 2DT1A 5CQ1A 1QNPA 5CPMA 3CIVA 1UUMA 3WF2A 4JN8A 1XIMA 4NZ4A 3BCDA 1YIXA 2HEJA 4Z2IA 4A05A 1BQGA 3W4RA 2VFIA 2EKCA 2QF8A 3HURA 1TWDA 4FIQA 4J4KA 5FF2A 3UXKA 1XX1A 1ZBWA 1US2A 4JIIX 3CWHA 3GHRA 4M51A 5C5YA 3ABQA 5E0FA 1UD8A 4ORIA 3CHVA 3ITYA 4J3WA 1I2RA 3KLLA 3FCPA 2D0GA 3PAJA 3SN1A 3NQ6A 4E2DA 3IJDA 3JR2A 3N9SA 1NWRA 4ROQA 5CAKA 5LXXA 1BHGA 4MB1A 3AU2A 1HJUA 4PYSA 5HMSA 3E9AA 3K4WA 4MJ2A 3RMEA 3SZ8A 3S83A 2J7HA 2J7BA 4O18A 3T4WA 5GNXA 1E15A 3TW7A 2PLKA 1XRVA 3I3BA 1T99A 2Z24A 4B4HA 3QYSA 4GNVA 1D7KA 1Q6FA 5A94A 2VTFA 1ZL1A 1SQ7A 2XN1A 1WXJA 4WJ8A 1RVGA 3WKZA 1P0EA 3QTPA 1W1PA 1A5SA 3M6YA 1G4EA 4O0QA 5HDRA 4WIWA 2XM1A 1XYAA 4GQBA 3A6OA 2G0WA 3GH5A 1F5ZA 4A2SA 1V3KA 3G3MA 2ZQ0A 1M68A 4JFVA 5IM51 3H8AA 4GI9A 3SW6A 3W6LA 5J8LA 1GVIA 3VVGA 1B90A 3L7RA 4PB5A 3DDMA 1DORA 3QV8A 2QYGA 1VFOA 3QZEA 3QRHA 4GUIA 1KWGA 3ABRA 1SZRA 4YTRA 2UWFA 4IMGA 3WZ0E 4HA1A 4PZVA 3OQ8A 3M0IA 1OYCA 2IKHA 3WQCA 1EFZA 1WX0A 4ZE5A 4XO7A 2GOKA 3C8FA 4HT3A 3N9RA 3WBEA 3M16A 4ORMA 1KB3A 4ZB5A 1R38A 4RUBA 5I02A 3AMKA 3ZR6A 4RE0A 3UGVA 1N8WA 2ZE0A 4KFNA 1FH9A 3GVVA 1JI1A 3DC8A 1OY0A 5CC5A 4W4QA 4JOMA 3GXNA 2GZXA 1KBJA 1XIEA 4MYAA 3RCYA 1JYVA 4HNOA 2PWDA 2E6YA 4LRTA 4GI6A 3ECQA 5LHFA 3WLJA 1K02A 1TJPA 1QRQA 3NL5A 3TTSA 2Y1HA 2ZA1A 3TJXA 3GX9A 3KBWA 2QCEA 4P61A 2HROA 4ENLA 2V5CA 3IJLA 3G1FA 3IVUA 4DPQA 4JNMA 1V0NA 2DSZA 2GUYA 2EPLX 2O7SA 1EA0A 4HTYA 1ZCCA 4QCFA 1Y5VA 4LVGA 3OGVA 2CBVA 4NJIA 3O7UA 4PTNA 1SSGA 4IT1A 4GNKB 3ZJKA 4D6JA 4EX4A 3EA2A 3LNPA 3QR3A 5CPSA 2QJJA 3RJXA 4MTVA 4E3VA 5EMUA 3QH2A 3C61A 1N55A 5A8NA 2H6RA 3IJ9A 2RJGA 5E0KA 3UJRA 3VE9A 3E02A 2HE8A 3CWNA 3GG8A 1P6CA 3GU9A 3KOXA 1J4EA 2X2YA 3UWEA 4AF0A 1AW5A 2XGIA 1LOSA 1OK6A 1HFBA 3H7UA 2CZ5A 2W5FA 2J7EA 3WQPA 2JFEX 4PUWA 4RNJA 5D9OA 2BOFX 2VHLA 4MKNA 2BX7A 3C2OA 4JFSA 4JQ3A 3GDMA 2OR2A 4YYCA 1H1ZA 3W7CA 1O60A 2B81A 3EWDA 1ZJAA 1ICQA 3ORWA 1YHTA 2A3HA 4IIBA 1LWIA 1CXIA 1A3XA 4H8VA 3BAIA 4M6VA 5G1MA 3TMQA 3NUKA 1A5AA 2J75A 3SADA 2D73A 5RUBA 3R25A 3RN6A 1ISXA 2VRQA 1X38A 4B15A 1MDLA 1KC7A 3B8DA 2YYUA 3BAYA 2GLKA 1HGYA 4O1CA 1U5HA 4JYEA 4U33A 3LGGA 3MU7A 4UTTA 1YBQB 4CUCA 4US5D 1RQHA 3UG4A 1DJYA 1CNVA 4M82A 2QUMA 2ALDA 3WD0A 4ZTYA 1EP2A 3QC0A 3W1PA 2FVMA 1N7KA 5D9NA 3SUWA 2I16A 3KDOA 3EWYA 4DO7A 4GKTA 1K8CA 2QNEA 3DKLA 4QX4A 1XCXA 3KBVA 2Y62A 4Z2LA 5IOBA 1EF2A 4ATWA 3D5HA 4JFUA 1EZ2A 2A3AA 1V3MA 3LQGA 1E0WA 2D22A 1T7LA 4LBSA 4LBRA 3BGGA 5EBUA 2AQOA 1R8LA 1ZSXA 5T26A 2D2JA 4L5ZA 3TX9A 3A22A 1WA3A 3AICA 1G4TA 1YKWA 3W1NA 2WSKA 1DWIM 1I2QA 1E1CA 4XSMA 3GIQA 2XIBA 4BFAA 1M04A 2WCGA 1A80A 4OU1A 4TIMA 4YN5A 4CNOA 5FSDC 3EMZA 3ZT5A 4O17A 4FPSA 2J4GA 2ZADA 4WKHA 3P81A 4QDWA 3FA3A 1XC6A 4LJ3A 5D04C 1R2SA 2C15A 4GJJA 1D3GA 3USZA 3H26A 4CCDA 2BY3A 2E8YA 2WV8A 3GXTA 3W87A 4L4MA 3W7MA 1JZ4A 3PWIA 3PTQA 1W1VA 3VNIA 3W83A 1WUEA 2Z1VA 4IPPA 3CIWA 3KCLA 4I7WA 3IAQA 3MO7A 5M2FX 1L8PA 2P1FA 3QY8A 1GONA 3S2NA 3D0CA 3ID7A 3TYAA 3SY8A 3VGDA 4PTXA 1JDDA 4S3BA 3WD4A 5C7VA 1J11A 4UQDA 5A6LA 3APGA 3AZRA 1ICPA 4GY7A 1ZJIA 1B31A 1EJTC 4BK9A 1XYCA 1SFJA 3U6WA 3GNOA 2WNNA 3F4CA 1UUQA 5AZ0A 4NKCA 2HQAA 4IIFA 3Q45A 4A3YA 3LM3A 4CCEA 1DHKA 1FHVA 2F2KA 3AMLA 4YU1A 4H9MA 1A5OC 3CUZA 1S38A 1LF1A 2V38A 4GOAA 3UZZA 4D2JA 4RR4A 4MM1A 3W25A 1FWEC 2E5BA 4C1NB 1P0NA 4UTIA 1UOZA 4KGJA 4LEQA 4GD0A 2G96A 3W6YA 4F2BA 2QT3A 1ME7A 1TTPA 4C5ZA 2YA0A 4EVZA 3TTYA 3RCNA 2HK1A 2J62A 3V5OA 3SCNA 3W7QA 1GQIA 1C92A 3PUGA 2PGWA 3ITVA 4WY0F 3KBNA 4HHLA 1H5YA 2F7FA 4GE8A 2ABAA 2DSVA 3LBMA 2ZUMA 4N4PA 5C70A 3AQUA 3DI0A 4FK9A 2A5HA 1J79A 3OOQA 4KKXA 3ELFA 1UZ1A 2WHJA 2VGFA 3THQA 3VOCA 4ZO6A 2HE5A 1TPC1 5HUPA 1IEWA 1GYNA 1KRCC 2WHKA 5KEZA 2NQHA 2J7CA 2YL6A 2NW0A 5A6JA 3WSUA 1MEHA 5CJNA 4AIUA 3TLLA 2CLIA 2PDNA 5HNNA 3N6JA 4LH8A 1KBKA 1X6LA 1JAKA 2E6AA 2NWSA 1MYRA 4IL2A 1GEQA 5C71A 5BXTA 2CLMA 4NHVA 3GDBA 2WMKA 1DJZA 3G1AA 3N18A 3QXBA 1JDCA 2WYSA 3PG8A 2VZTA 2O9PA 4JKLA 1EKOA 4LAOA 3Q65A 4K1GA 1UKTA 3NSNA 2HTMA 1H3GA 2VOMA 2PLMA 3LHUA 1GG1A 4NNCA 3LUTA 2UY2A 3HV9A 2FDMA 3GC2A 3T55A 2R94A 4PEKA 4AD1A 3GRIA 1R87A 4H1ZA 5BNKA 1F8IA 3QV9A 3V5CA 5F2LA 2NQZA 4WOZA 4AW7A 4DNMA 4X22A 1LL6A 4Q8WA 3AHZA 2BXZA 4I8DA 2ICSA 1FTXA 3U2OA 2E5DA 3RHGA 4O4WA 2W4XA 4A8NA 2C18A 1W2PA 1CXHA 4DI9A 2YL8A 3EXRA 3M9YA 1XLBA 5CEWA 1UP0A 4Q8UA 3HQ1A 3CH0A 3SY5A 4JS3A 1K7FA 2YJQA 3KP1A 1GCYA 3EYPA 3QOKA 4PL1A 3JRKA 3W71A 2WMFA 1EYEA 5D09A 7A3HA 2NQJA 3O07A 3SQLA 5ABGA 2RAGA 3MMTA 2V6AA 4OV4A 2YDAA 5K9XA 3URQA 3QMSA 4J40A 3UYIA 2VDGA 1JDEA 7ODCA 5D9MA 1HKMA 3L65A 1XC4A 1E40A 3WF4A 2A79A 3E74A 3L4WA 2BG5A 1XXXA 4FOJA 3VX1A 5JH2A 3UETA 1TKKA 4ILSA 2WZMA 3AZTA 4V15A 4PRWA 1TV4A 1VEOA 3E6EA 2ESCA 3O2LA 4Q7NA 3UPMA 5M1TA 2V3EA 1PXGA 3L2IA 4LPCA 4AB4A 3W01A 5LGZA 1DE5A 4HA4A 2D3NA 2IUZA 3H4GA 1TV2A 2OGYA 1FOBA 1XI3A 4BR1A 2FZ9A 4CCZA 5CC6A 4F0HA 2ZX8A 4MKVA 3C0JA 1WYIA 4UOQA 4GA8A 3G8RA 3BQ5A 4WKAA 1E9IA 5K4ZA 2QCGA 4C6OA 2GJXB 2NUXA 4Q4QA 3EWUA 1I60A 1T40A 2WLZA 2CPUA 5A6TC 3WUBA 3CBWA 2SFPA 4KWUA 1WKYA 2GQ9A 1UWQA 3P5ZA 3P62A 1Q6EA 2WC3A 2E0PA 1CB2A 4ZB2A 1DBTA 3SEPA 4GIEA 1NWTA 4M19A 2P76A 3BDKA 3C4UA 4AWEA 3GC5A 2V67A 1SYTA 4Q4PA 2GGJA 2ZBTA 3DFHA 1DIDA 3JUGA 3UT0A 5I00A 3OZYA 3CHFA 3NIYA 1UQYA 4HZ6A 2VEKA 2Q3RA 2AL2B 3NXFA 4DJFA 5LIXX 1ISVA 3EKLA 3ONCA 1ML1A 3BLKA 4XZLX 1C93A 3N14A 1Q8AA 1XISA 4DYJA 3ZOAA 3W2MA 4P8XA 5HMDA 3VKJA 3PB2A 2I57A 4KT2A 5JVLA 3DOPA 4L80A 5H8PA 3W27A 3H2AA 4HPNA 4BI5A 3K30A 1E6QM 4UTKA 1QI0A 3O0FA 6CGTA 1OZMA 4XAGA 3F4DA 4UBPC 1TJRA 2HVOA 3TZNA 2JGQA 4ZVJA 4QSFA 1JD7A 4H9ZA 1HKIA 1UD3A 3W75A 4FOKA 4LUSA 1CENA 3IIXA 4Q4RA 1HZYA 2VZUA 3F2DA 3EB2A 4UR9A 5L6UA 1FXPA 1JXJA 5DCEA 3MVTA 4XTIA 3CO4A 3WCZA 2JBMA 4MDPA 1V3LA 5I3HA 3A3HA 4QIUA 5CZSA 4FB7A 4M7SA 4LS1A 1KTBA 3SCTA 5EFFA 3NFUA 4ZCWA 4A8IA 1OINA 3TTOA 5TD4A 4L1GA 4YJ5A 1NVMA 2XVKA 5BMWA 2ZXAA 4KETA 3VDGA 4DWSD 2WAGA 3U4AA 2TODA 5HQMA 1XIBA 1XHGA 3PZNA 4NZJA 4G2DA 4O57A 2YPIA 3APYA 3UG3A 1LBLA 2Y89A 3OLIA 3ES8A 4DQWA 3OO2A 2D20A 5GPRA 4XKYB 1BXNA 2FPYA 1VJIA 4IMAA 1YXDA 3U9IA 3SQMA 1H5VA 3C52A 1E4LA 2OZTA 2ZUUA 4ZQCA 4UFJA 3QKZA 3ZT6A 1W3HA 1PBGA 4FF5A 3A47A 3AZSA 4KQNA 6TAAA 4GCAA 3FHQA 4LCQA 1A0DA 3MYOA 2V2CA 3H2MA 1M7OA 3USBA 1TWWA 5AYIA 4UWMA 3T2PA 3MV11 3GNXA 4PL2A 2ZX9A 1ZP3A 1E51A 4N9EA 4IM4A 5LNRA 1TX2A 5G4WA 4WDWA 2PDCA 1R9YA 5REQA 3ZSSA 1AQFA 3C3UA 1W17A 3Q2DA 2CLPA 4O11A 9XIAA 3H2FA 5EY5A 3DFPA 3V7PA 4NAFB 1WZAA 3L4TA 4MZ1A 2GVLA 2GJXA 1AQ0A 5ABFB 4UQ9A 1IIGA 2BVWA 3TONA 1BQCA 2QVHA 4Q3MA 1ESWA 4D1IA 4RPQA 4LAMA 5FF3A 3FJ6A 3HGSA 1BGGA 2XSBA 4ALDA 1S2TA 4NNAA 2BHYA 4XIMA 1HJXA 3BXWA 4GK8A 1T6MA 4L9ZA 4LRSA 1ZAHA 2FQIA 2EBNA 4LUIA 3W1QA 5I2UA 1XJBA 1QK0A 3TSMA 3VIMA 4WDUA 4IQJA 4RE2A 3BTNA 4B9ZA 4EF8A 3PK7A 2EG8A 5SWUA 3YPIA 1UR2A 4YVPA 4AMCA 3SN4A 3FLUA 3R0KA 2D0HA 2VX7A 6REQB 1TMLA 5B7ZA 1M01A 3THAA 2Z1KA 3LQLA 4Q8TA 1PZ3A 1ZBKA 4E0CA 1BF6A 3GKFA 3HTWA 1E0XA 2XUCA 3PSVA 3RILA 3EZ4A 3I4KA 4FX7A 3TR9A 1CXKA 2P8BA 2A6LA 1ONXA 4GZ7A 1QATA 2H9AB 3E5PA 3M0VA 5AY7A 4BA0A 3NVTA 4M6QA 4YPJA 2BGQA 1KTCA 4BWLA 1DL3A 3FAXA 1D7FA 1UB3A 2I5GA 3VM7A 4JNYA 2WMIA 3GG0A 3P6LA 1OBAA 4KPLA 3GNPA 1H61A 4P8UA 3MUZ1 3AS0A 3HV8A 5C2CA 1B57A 1KW1A 5CC3A 3L4YA 3B9AA 1PVNA 1XGZA 1W1IE 1JR1A 1EIBA 1W5PA 1IT0A 1QPKA 4AWTA 1UKOA 3OW1A 2OZ8A 3I7RA 4Q7IA 4OUEA 3GZ3A 4FXRA 4F0LA 3AYTA 3RF9A 1W3LA 4CNSA 2JE8A 4AISA 4TV6A 1ME9A 4D8ZA 4LAKA 4LEFA 4DJFD 1R6WA 4N2YA 3C5QA 1XG4A 2VX4A 2YYTA 1U1JA 1GUVA 4H6RA 4DN1A 4WHBA 5C6MA 5C54A 3S1XA 3WENA 3MKKA 2WSQA 3GIPA 4HBKA 1ICSA 4F0SA 3KTXA 1TV7A 2DPEA 5GNYA 3TVAA 5LIKX 4W7WA 5G5IA 3SSJA 3AYRA 3GTFA 3UCDA 2HSAA 4CLMA 3AXHA 1ITQA 5CLWA 3I7QA 2ZRVA 3UJFA 1UH4A 4AC7C 1LCOA 2XM2A 4J28A 4P2VA 1UMLA 4HPHA 2FGBA 1KGXA 4K68A 4NU7A 2PDBA 5LA2A 5EPDA 1HGWA 1E55A 2IKJA 3B4YA 4DXKA 1EC7A 2WNZA 1ODZA 4UTUA 3QSTA 1WDQA 1VC4A 1A5CA 1E56A 3AU6A 3UZJA 1JDFA 2X1UA 5IRPA 3NR0A 1H7NA 1P6WA 2ACQA 2DVXA 5FEZA 1MQQA 3CAQA 5DMYA 1H2JA 3PN8A 4LUYA 1U1UA 3WD2A 1E6PA 3FX4A 2O55A 1CGTA 2NZLA 4N02A 4V28A 3CUFA 2RUSA 2XHYA 2WSPA 3LTYA 4EWND 1H41A 7TIMA 4Q8MA 1HVXA 1KFWA 4EACA 5I3FA 2E7FA 2GSEA 2J7GA 4OZOA 4Z2GA 3MPGA 4I8YA 1O5QA 4Z08A 1XP3A 5FESA 3WNPA 4BI7A 2Z4GA 2YCLA 3TE9A 3RR1A 1X1OA 4C6BA 1ZAJA 1ONWA 4QM1A 2GYIA 3KZSA 1CLXA 4H2HA 1OC6A 3MSDA 4PBFA 2YDQA 2A21A 4JKKA 1B9BA 3QVQA 3WLTA 3U7VA 3C86A 3MKVA 4GQ0A 4AQLA 3C2YA 6REQA 1EDGA 1SR9A 3SB0A 1QNSA 3G8EA 3KHJA 1SW7A 1XQKA 3MB9A 5EMYA 3G77A 3VK5A 3P67A 2EAWA 3MP4A 3OLDA 4PUJA 4MWAB 3NDZA 3LTPA 2C8NA 2O4QA 3S2JA 1EA9C 4WSKA 3WL0A 1QNRA 4HNUA 2ZZ4A 3WF1A 3JU2A 2D1ZA 3V4BA 1UOKA 3BMWA 4YNGA 1EYWA 3H4WA 1QOPA 1RP8A 1V4YA 3KCJA 6A3HA 3HPZA 4IIEA 1POKA 2ABBA 4RDYA 2GOUA 1S2UA 1Y7VA 3OPSA 3N2CA 1ADDA 2FZBA 2VT0A 3VIKA 5KTLA 3WX7A 2TYSA 4LVBA 4LS2A 4LY4A 3VILA 2MUCA 4RDVA 4ZSUA 4DJEC 2J13A 1LG1A 2G37A 1E71M 3PBWA 2E09A 1Q6RA 1KFCA 3ABZA 2QGYA 3T2QA 2J66A 3W9ZA 2W63A 1Y5XA 2EJAA 3AHTA 4R88A 3AHVA 4IXHA 1OGBA 4M0XA 1AK5A 4BJHA 1IWPA 3E96A 1R3WA 9XIMA 4ZQMA 3E0LA 1TPWA 3IGSA 3NQAA 3S5ZA 1MO0A 4R27A 2FPTA 4GMEA 4WGHA 2ZX5A 4LCRA 4DJDD 4UZUA 3DHFA 3RK8A 1FCVA 2OELA 3UBPC 1FDYA 1W9VA 3FJLA 2G3JA 3T07A 1ENUA 1JCMP 3KTSA 5F4XA 3GUGA 1M53A 1IR1A 3CB8A 1TVPA 3P2VA 4UMAA 2NUYA 3CMGA 1E43A 3AYVA 3F1QA 5D38A 3WLNA 3U2CA 4UR8A 1TVLA 3ATYA 2V63A 1H60A 3CJPA 5DLCA 4DWSC 1W56A 4IQDA 4C6DA 1B5TA 1XLJA 5DT7A 1K4GA 4ADUA 1NY1A 3BE7A 1DJXA 4TXEA 2UY3A 3ES7A 2FHBA 3RNDA 1TJ0A 3VCNA 2Y7EA 3LS9A 3FDGA 1V77A 2JK2A 5U7SA 4AEEA 1UWRA 1UA3A 2WZIA 3WBYA 1KXHA 1T96A 4FLOA 2PBGA 4W7UA 1M65A 3N4FA 3VKCA 4RZ6A 4K7YA 3IV8A 1GG0A 1WPCA 1DE6A 4ZO7A 2F38A 4N9BA 1EWEA 1LRNA 4PN2A 5AB3A 1QFEA 1JZ7A 2XH7A 1YLVA 4AD3A 3VNZA 2C6QA 3KDNA 2QV4A 4LAZA 2V2HA 5FEXA 1SO5A 1QJWA 4V27A 1E5NA 3EOSA 2PTXA 4GYFA 2PDKA 2PP1A 2QCFA 2FH8A 4IPNB 3TCSA 3DHUA 3KXQA 1PX8A 3TFCA 1XCWA 3LRKA 1WZKA 1B3XA 3ARXA 4P7QA 1TR1A 4OHQA 3SR7A 5C7HA 3V75A 2VP8A 5CGTA 2Q6ZA 4OUIA 4M5PA 1CGUA 1JD9A 3NZGA 2EPHA 1W6TA 3H12A 2DIKA 4UFIA 3IRSA 4G7EA 1S3HA 5DFAA 2E9MA 4B92A 2OGJA 5CXPA 3P60A 3IGHX 1CGXA 4MMWA 1TRDA 1VAHA 3LTSA 3TC6A 1AJZA 3VGBA 3MUY1 2WZHA 4GC4A 1UKPA 2C0AA 5CPQA 1LUCB 4R9XA 4KWOA 3VZYA 4ZGYA 4MJMA 1QMLA 4JTRA 1P1MA 4DYEA 4I9MA 5D37A 1TFVA 4IHCA 4GUJA 2PRLA 1WKFA 1RJRA 3VDHA 2C19A 3AIWA 2CCRA 3KX6A 1BYBA 4WDXA 3ZO9A 3NOEA 4N6EA 3DG6A 5AC4A 3RLVA 3MQTA 1EOMA 5FF0A 4AXNA 1OYAA 3G0UA 1AD4A 4CN4A 4WSJA 1Q65A 3I68A 2BZNA 3TYZA 1H0IA 2NSXA 3PWGA 2QF7A 4EXBA 1BLIA 1GVSA 2QUNA 2RDXA 1RD6A 3GBEA 1FVPA 3TA6A 3GVGA 1L9WA 4RX0A 1VPYA 5F2GA 2Q01A 1QNVA 1V3JA 2X41A 1T41A 3LCXA 5LKYA 1A5KC 3DGRA 1ZCOA 2PWUA 1MEWA 3ARVA 1TREA 4OBRA 2QV5A 2J6XA 2CBIA 4U3CA 1BTCA 4DIAA 2VO5A 3AO0A 4BEQA 1TPDA 4QP0A 1I2OA 2BFGA 3ANUA 4GZJA 3K13A 4FR6A 3RDKA 2Z1SA 3EMCA 4C6QA 4NX0A 4GY1A 2QXWA 2CHRA 1KM0A 2D69A 3G1SA 1J0HA 1CPUA 3W81A 1EXPA 3AXIA 2QHAA 4O1AA 2VFFA 3EXSA 3BLFA 5JBFA 4K2SA 5CPNA 4C6MA 7ENLA 3WEZA 3KBSA 1XYBA 4J1OA 1MW0A 3BOFA 3OU8A 4S3FA 1TTJA 1N8IA 3TYEA 3PY2A 7TAAA 2ALRA 1K1DA 4RW5A 3M7WA 3AI0A 5ECUA 3GVWA 4FNUA 1V0LA 3ABXA 1GQLA 3NPXA 2QDHA 1OYBA 1EB3A 2GJPA 1CZ1A 2TPSA 4OFCA 2EG7A 2WCAA 3BGAA 4O19A 3OB8A 4JTEA 1XRFA 4AAJA 4A4AA 1W2VA 3KVJA 3BAXA 1W9DM 4QE1A 1XH0A 4DAFA 2P3ZA 3QJAA 4KIEA 1L2QA 4WEVX 4ZQPA 1FHUA 3W88A 3B8UA 4L64A 2G4FA 4L9XA 1G01A 3LU2A 3SCQA 5H6HA 1U1HA 1FWCC 1RP9A 1W3KA 1CX9A 1ZP4A 5AFDA 2XINA 1QW9A 1PB0A 1BWVA 1A5BA 1E9YB 1DV7A 1JF5A 1J9YA 3CNYA 3LRMA 3WK3A 4YHGA 1KRAC 1TX0A 3P0WA 2WWCA 5LSMA 1ZS2A 1ME8A 2EF9A 4AX6A 4AUBA 1QO5A 1S46A 4W9TA 5BRBA 1LOLA 1BWLA 1PTGA 3MW7A 1S1PA 3MTWA 2VZVA 3AMGA 3I6EA 3QFWA 3VOIA 2NUWA 4XTDA 1MNSA 1EGZA 1EEPA 4X9SA 3W7PA 1LQ2A 1CXEA 1BSIA 1VF8A 4QRNA 1XPGA 3TH6A 4QS6A 2CESA 3FKRA 1O4UA 1DTNA 2PWFA 3PBGA 2AOSA 3BOXA 1I8JA 4Q4OA 1EJ7L 1PYFA 3G1XA 3VDBA 4IX2A 1VEPA 2Q8ZA 3RX3A 3KOFA 3D46A 1KA9F 1REQB 1RV8A 1XCFA 5FJUA 2GJRA 3GS6A 3UXIA 1HL9A 1G69A 5HJYA 3QR0A 1LORA 1ITXA 4AZ6A 5I7GA 1Q8JA 1YPIA 3PM6A 4GXMA 1R7AA 1JCNA 4Y9PA 1PL9A 1TPEA 3NNTA 1Q3NA 1JPHA 4RDWA 3ZR4A 4AFYA 1MNZA 3ITGA 3NZPA 4JTDA 2Y6ZA 3PFMA 4ZTXA 3W2KA 2Q02A 3XIMA 4CD7A 5ABFA 2VVSA 3JZEA 2DFAA 2GGEA 4AYGA 3S6TA 1TA3A 4GPNA 1TSIA 4NAEB 1ZGDA 4JQ2A 1F3XA 1QK2A 3S6OA 1XUZA 4HSNA 3GHSA 3H2OA 3OJGA 3W2UA 4MPKA 4WZHA 1NF0A 3ITXA 2J7DA 1EQCA 3SIZA 4FF7A 4FXJA 4ROPA 2OPJA 5CPOA 1JRCA 2C0HA 3MHGA 2PDJA 5CGQA 4F8XA 3K2GA 4EXQA 6ALDA 1JGMA 2E1DA 3GTHA 4FNQA 3WDPP 4D9PA 4IFKA 4PMJA 1ECQA 3TOPA 3E2SA 3MV01 3R43A 3KE0A 4PMVA 2W0UA 2WWDA 1KFKA 2YLLA 5CBJA 1XIFA 4HKPA 1ONRA 2YCIX 4HOZA 5C55A 3COTA 8XIMA 2OWXA 2B7QA 2PCQA 4DZAA 3HG3A 2AAAA 4QJ1A 4E4UA 1SZFA 3EGJA 1IF2A 1LQ0A 1L2UA 1NAL1 4HMNA 3VABA 1S5WA 1XG3A 1FWWA 3UR2A 2XFFA 1I0BA 4DELA 3BLLA 1VBGA 3NQFA 4K36A 2GWNA 3ALFA 4GHRA 4QHRA 4DZ5A 5H1WA 2Z7KA 5HNUA 1I1WA 2FZNA 4I90A 4PCPA 1JYWA 4R9OA 1MW1A 3CPUA 4W86A 3VTRA 3WQFA 3OIHA 3N2OA 4XZIA 4NZ1A 4IPIA 4HU4A 2W27A 1F6PA 2V5JA 2WC4A 4WVXA 4S3KA 1Q6OA 2DUAA 4H9TA 3U48A 3PUOA 3DUGA 4UB9A 3S46A 4DHGA 4FLSA 4XZNX 2B4GA 1XIHA 3TTEA 2BODX 3CH9A 3DU0A 4QCEA 3ZQ9A 1GPFA 4MWAE 2VWSA 4DXVA 1A5NC 4DJED 1MVYA 2OB3A 3VD5A 1AZ2A 1EXBA 4J5NA 5A3HA 4DF1A 4K1WA 1ZBCA 1F4HA 1ZLPA 3ABOA 4PGLA 2ZZ7A 5DMMA 3IANA 2JQXA 3POCA 3WNLA 4NAEA 4BKNA 4RL3A 4Z1DA 1JPDX 1G1YA 4B5SA 3KW3A 3GW0A 1VCVA 1OB0A 3BSGA 3I65A 4AY8A 5HATA 3EPNA 1DJGA 3WUGA 3R7MA 1PV8A 3MBFA 5EGRA 1QPQA 3PG9A 3S9IA 1KV5A 1FWHC 1HX0A 1UWIA 4C60A 4JAWA 4HNVA 3A4WA 4C90A 2ZXQA 4F48A 4AZGA 1OZQA 4JTIA 3NQBA 4AZ5A 1W37A 4OBSA 1B3OA 2EGZA 3LHVA 5F4WA 4QLJA 5D8WA 2HDJA 1BEUA 1JCXA 2GQ8A 4F79A 5LIYX 1V6XA 1XGDA 1KGWA 3TDFA 1AZ1A 2P5NA 1OCNA 4A2RA 4TQTA 1S2VA 4XVEA 1J8VA 2PUZA 2VCCA 1QT1A 1P43A 5I3DA 1I9CB 4O15A 3BSMA 1FWNA 1FDZA 2Y7DA 1R3YA 3MDWA 3CS2A 3WLMA 4ZL1A 3TP4A 1ZTVA 1BYCA 1VJSA 4KS0A 1A3WA 2OX1A 1VCFA 2X42A 1L6YA 1YNYA 2REQB 4LNYA 3KVKA 3K5XA 1EJVC 2A3CA 4HSHA 1C91A 2V69A 2BY1A 4L1XA 1XD0A 3T40A 3SRDA 3DC0A 3KWSA 3W7RA 1NU5A 2CLLA 3HQNA 1NELA 1JCYA 4WRHA 5CJ5A 2O9RA 3W7NA 1NWUA 3L66A 3HQPA 4XISA 1GOXA 2Y7GA 1YNPA 5CBBA 1UW9A 3W0KA 2FZMA 2AL1A 3M47A 1C90A 2YXXA 5DRCA 2HMCA 4WY0B 2TAAA 5BU9A 2I7GA 2IS7A 4O16A 2EPOA 5ECVA 3TWBA 1TZ9A 1TRIA 4PTDA 1YTKA 5CJMA 1R3RA 3LY0A 1PZ2A 4LGXA 3G1VA 4KWWA 3N12A 4W87A 4W84A 1K77A 4S3CA 4JTHA 2WSYA 1R9XA 4YWIA 3SCRA 1MXSA 4IMCA 3LDVA 1XIGA 2CKRA 4NYUA 1JGIA 1BPLB 4E2OA 4QITA 3MMWA 2OYLA 1TQJA 1MDRA 3LB0A 4Y8FA 1ZFJA 3DAQA 2VX6A 4CVUA 5I78A 3OA5A 1RUSA 4IL0A 1W1ZA 1K4HA 1OFRA 1W32A 1RVKA 4HOXA 2GFTA 1XYMA 4KEUA 1FWRA 1P0KA 4E8DA 2FGLA 3BAWA 3APTA 3GR7A 2A1YA 3M46A 3DYOA 5HWMA 1MRAA 4Q22A 4B5NA 3KCOA 1UP2A 3C56A 2A7PA 1VIWA 1QR7A 1E6ZA 3CEPA 1EL3A 1I4NA 2PDGA 5HQLA 2ZA3A 1K9FA 2VFDA 3EDJA 3LOTA 3IUHA 5CZJA 4QE5A 3C2RA 3VINA 3B9OA 1HJSA 2GSJA 2IQ0A 2X09A 2J9ZA 1EJUC 1WKEA 5A8OA 2ZUTA 3KS5A 5HA7A 4H8HA 1AQMA 4UC5A 2E5CA 3GHUA 4AY1A 3KBJA 1M5WA 4IUGA 4JIRA 2CZFA 2R1NA 2ZZ3A 4RZ4A 2BVDA 3L4XA 3VKDA 2WMIB 3UF9A 2DZXA 3E49A 6PTDA 3PPFA 3EKZA 2XWDA 4HCHA 1VBHA 3EDDA 4Y90A 1MZHA 2RFGA 3HG5A 2ZRYA 4KFPA 3EWWA 3HPSA 3L2MA 1R85A 4ZOEA 2BTMA 3QEZA 2BMBA 4XSLA 1XR2A 1OX6A 3VIJA 1BYDA 4PSPA 1A5UA 3WD3A 4GZIA 5J5DA 3FNDA 4A21A 3PC0A 2BV9A 1R7OA 1LQAA 3BG3A 2QJIA 1XLAA 2GSHA 1VR6A 1E4IA 2NQ5A 3NQ8A 4XG1A 1CTNA 4M6PA 2HWGA 3NEVA 2F8QA 3UD6A 2QCCA 2XPKA 1MMFA 2FVLA 1XLLA 3DYMA 2WB5A 4H00A 3WNOA 1OQFA 4DWDA 4NJGA 3PPGA 4X0NA 4NP7A 4Z2HA 4XV0A 1ISYA 1XBZA 1F3EA 4CN1A 4DAIA 1E73M 1GTHA 3GE7A 1WCGA 4C1NA 2ISSA 3M7SA 4DBUA 4KCUA 2BXVA 1J2BA 3BG9A 3DN5A 4O0KA 1I2PA 2DUXA 2DJLA 3VCCA 3KOZA 3HQOA 2HBVA 4X63A 1SJAA 3LLFA 4W5ZA 2A85A 3VOFA 3F7JA 2WBKA 2XH0A 1K9EA 2FVKA 1E9LA 4MY8A 1XLMA 4D8LA 4ZO9A 3HOJA 1J0JA 4GUGA 4A6GA 4OJYA 4A8LA 4JTTA 4WOQA 3S2CA 3UY8A 1L6WA 4S3AA 3KRUA 4A29A 4P7OA 3FAWA 3HGRA 3IUDA 4GX8A 5KETA 1CI1A 2V5BA 3U5UA 2F6UA 2Z2BA 3BJFA 2PRHA 2X1TA 1XDLA 4CD5A 3VOHA 4QJ4B 3TEVA 2Z29A 2YR1A 2CWNA 1Q7QA 4AVNA 1A0CA 3Q58A 3UQNA 4INFA 3VIGA 4GVHA 5C9UA 5DBTA 3TXZA 4MB3A 1GZGA 3IAPA 4DYKA 4GYPA 4MDOA 2V8ZA 1IHIA 1KBBA 1KQYA 4UUIA 3GIYA 3AWOA 1V7AA 4H8UA 2VZOA 2QQ6A 4HN4A 4U31A 2PTWA 4NI3A 3NAVA 4EK7A 4UQCA 4D72A 3T81A 1BXCA 1OG6A 2EJ1A 1HT6A 3L0NA 1XYZA 1JZ5A 2E40A 3R0UA 4DBEA 4CN6A 4E2VA 1FH7A 2PZ0A 1R2RA 3REQA 4PCTA 1XLFA 4XBKA 4X9YA 2XVPA 2NX9A 1OT1A 4S23A 4YLWA 4TTGA 3KHDA 2D23A 2Z25A 1FWDC 4HNCA 4S3GA 4W8LA 2QULA 8CGTA 4OBTA 5I3JA 3UNTA 5F7UA 3ARRA 4HNNA 1LTDA 2D2OA 1Y0EA 3LSCA 1BVZA 4FZIA 1LP6A 1V7YA 1V8EA 3MUIA 3VKAA 3SN0A 1FRBA 3LENA 1LG2A 2XIQA 4O4VA 1IR2A 3ANYA 3F5LA 1EQPA 1S2AA 4JKMA 1KCKA 4HD5A 3THUA 1VJZA 3NGJA 1XFCA 1FA2A 4UNIA 2ZZ6A 4IZGA 1ALDA 3DFYA 3DFOA 7PTDA 2PSNA 2PD9A 1UIPA 4IG2B 1QI2A 4JIPA 1Q4WA 3RM8A 1YBQA 2WMJA 3BQ6A 3VE7A 2ACRA 4ASTA 4POCA 3UY7A 1IQ8A 3EPMA 2W67A 3BK0A 1XL9A 5A1AA 3T8QA 4RXGA 2NWRA 5A6BA 3HPFA 4W85A 1EP3A 3QV6A 4D6IA 4GLEA 2FZ8A 1NARA 2C1HA 4E38A 5CSUA 2QPSA 2VUYA 3EXTA 4D71A 1QUMA 4L4PA 4YTUA 1E1FA 4WJXA 4ERGA 1TTQA 3QSRA 3S6DA 1MXDA 2CZVA 3MY9A 2QCDB 1Z6KA 3ATZA 1IEIA 3EWCA 4RK8A 1UZHA 4D6CA 1CGWA 1MQPA 2YB4A 3WQWA 3LYEA 4IFRA 4OQVA 1IT8A 4GBUA 1WBHA 2YGYA 1AW2A 1F8MA 3MKCA 4BZYA 4O13A 1ONEA 2HNHA 1H0GA 1C7SA 3UGRA 1ITCA 5DO8A 1XBVA 4U4MA 4CU8A 3K1GA 1B2YA 5CSSA 5I07A 3LI0A 1H49A 4MWAD 5IHSA 2FGZA 4PFHA 2DZAA 4IGSA 1S5VA 3TNOA 3WH5A 3STPA 4U10A 4W5UA 5GQBA 1BVWA 3L67A 4M1BA 1W9PA 2BHZA 2CHNA 1TELA 3MZNA 4F4RA 4PSRA 4CQBA 4KEVA 4GJIA 4LF1A 3MJYA 4B5WA 1KLZA 2ZVIA 5CLTA 3RFAA 4L1WA 1FWAC 1Q2SA 4S3EA 3TN5A 3NPWA 1VPXA 4M6UA 3TROA 3CUGA 3W1AA 1NDVA 5KZEA 4NZFA 3S5OA 3VZXA 1YW1A 3LK6A 4KCWA 2Y8KA 2VZSA 1XWYA 3HG4A 2EO7A 2NXHA 3PB0A 2FHFA 2W92A 1OM0A 4GNJA 3W1RA 1A47A 4AZCB 3WLSA 3RLUA 2OOFA 4KEMA 2HS6A 3V3WA 4KF1A 3WDHA 1Z44A 3NM3A 1KV8A 1PUDA 3M0KA 1HW6A 1OABA 3PZUA 2Y8UA 3JS3A 2XZ7A 3HIJA 3CAKA 1DYSA 3L2LA 4GUHA 3WQ8A 2J24A 4QNEA 2KAUC 1X98A 3VNDA 3MP5A 4IWWA 5BWAA 4O1EA 5EU9A 3N29A 2GVJA 4KEZA 1GTEA 4YTQA 1P5BA 1NFGA 4K8GA 5M03A 1I6NA 5XIAA 3IJ6A 1SO4A 2DZBA 5FAJA 4JGDA 4TTUA 3PZTA 5HJLA 1C9DA 3HFTA 1K70A 1XUUA 4YCPA 1LL4A 1UR4A 1EH9A 2QJHA 4O12A 3W7JA 3OIXA 1RD5A 4WY0A 1P0DA 3MI2A 2QJMA 3TUUA 4W8BA 5LGXA 1A50A 4GG9A 3ME3A 3MT1A 4JDBA 1KRBC 2XGZA 1TWIA 4HK5A 5A8GA 2PWHA 1GW9A 1AG1O 1QHZA 1LJYA 4FI4A 1SZGA 3MUCA 1W1TA 1FP9A 4EOUA 1PWLA 1OCQA 4DJFC 1J2WA 1GVOA 1A0EA 3PBVA 1U30A 3I6TA 4F0RA 2VX5A 3C2FA 5M17A 4GY0A 4E4PA 4NZCA 1R86A 3BLPX 2G3IA 3CZEA 1WOBA 5EA9A 3G1RA 4IJBA 2REQA 4DJDA 2WK2A 3O6DA 4YVVA 5K9CA 1UP3A 3R1ZA 3R58A 1RY8A 3TTQA 1B3ZA 1UWAA 4OT7A 3W23A 1LWHA 2VELA 3O0KA 3VGEA 4XAZA 2WANA 1V0MA 3HU7A 4GC3A 1BRLA 1FWTA 1DOSA 4ACYA 4WR3A 2QUUA 3F4NA 3P74A 4X60A 1MFVA 2PI6A 1Q2RA 1ZRQA 3E2VA 4KIRA 1C3FA 1HG3A 4H7VA 2O7QA 4W8AA 4WKFA 3SI9A 2ACUA 2XZ9A 4B5TA 2WNWA 4LWWA 3C2EA 3WF0A 4NASA 2R9RA 3CMFA 1G94A 1B3WA 1GGOA 1XPYA 3U2ZA 1OFOA 4IISA 4TU1A 2V82A 5TQLA 1VZWA 2GL5A 1SO6A 2W62A 5TIMA 1O12A 5CCZA 2V30A 4LXFA 4RKAA 5JH1A 5FL0A 1LOQA 1UHVA 1XGEA 1DQXA 3P61A 3P0XA 1SZEA 1XV8A 4O8AA 3CASA 1SUXA 3NM1A 4CD8A 4I9JA 1KBLA 3VZZA 3LGEA 3VD4A 2X8RA 4P7RA 1E6XM 1Q6LA 1TIMA 2RDUA 5CG0A 4AD4A 5I3IA 1TPB1 1MUWA 3CZLA 4UMCA 4JN6A 4JICA 1Y65A 2F2HA 4JIEA 3CTTA 1XLIA 1PCWA 4NQ1A 2F6KA 3DFNA 1RJPA 5I5RA 3OG2A 4GI4A 4QBXA 5FOOA 2G3MA 6TIMA 1TIWA 2WVUA 4K37A 2XYLA 3A24A 1QW8A 4C6KA 1V3IA 3AC0A 3DCPA 4GKLA 1PX4A 3LCWA 3S1UA 1QCWA 3K4AA 3E2RA 1NIUA 3UW6A 1X96A 4UCFA 1BWKA 2JIWA 3H22A 1RJQA 1KM3A 2CW6A 1T5AA 4BS0A 4DUVA 1B4KA 1AH4A 4NRSA 5AZ1A 1QOQA 2WLYA 3S5NA 1KFBA 5FJTA 3TQ0A 1VQTA 3PP7A 4PB4A 2WJZA 3N3TA 4L4OA 1WXZA 4JTJA 2Z26A 2NSOA 1FWBC 2AKZA 3KVMA 4IFOA 4I5XA 3O05A 1WBJA 3HMCA 3IV3A 1BTMA 4OE7A 5T9CE 2J8FA 1JEZA 3GXIA 3W38A 4HYWA 3CV1A 3VGFA 1NFBA 2TMDA 2J25A 1OF6A 3UPWA 1XW8A 2G95A 1Z69A 3CAWA 4ML9A 4QJ3B 3B0VC 3B9DA 3GVRA 4N0RA 5A6SA 4GYPC 3TV8A 1V6YA 2XIOA 1S5MA 4U28A 4RNHA 1ITUA 2DUZA 3QW4B 1H1YA 5AHMA 4NRRA 1OFAA 2DORA 2E1WA 3RUBL 2Y0FA 1S39A 1BRLB 5AYZA 1UG6A 3S4TA 1Q6GA 2IXUA 3WO8A 1VLWA 3H53A 1WOAA 3TYBA 3IARA 3ANVA 4OVXA 3L0KA 2DP3A 3CWOX 3OGRA 3NTYA 2DH3A 1AVAA 2VEGA 3DHDA 3RO6A 3T7VA 5I3GA 4JD4A 3TAOA 3VOGA 4IOTA 4AEFA 2BHUA 3B05A 4JNZA 1W5MA 1EO7A 3QM3A 5A6AA 3LLXA 3K4DA 1OK4A 5K2ZA 3S42A 1PE1A 1EPVA 1UD4A 2PLJA 2C16A 1SFTA 2PB1A 3FVDA 4R3UA 3G24A 3GFXA 1V51A 2ADAA 4MZ8A 3STCA 1OG0A 3LPOA 4J2PA 3T42A 4AHOA 3WMSA 1W5NA 3C0LA 2OCZA 4TX6A 1U22A 2GPTA 2EPKX 4V1YA 4DI8A 1OFEA 4RNIA 3IGUA 4JX5A 1KCZA 4ICCX 4H19A 3WQOA 2YL5A 2W61A 3GWQA 4RCXA 3RITA 3N6QA 2PGFA 3P93A 1KRMA 3FW6A 3WMBA 1V0KA 4G7FA 2V81A 2ON3A 4LUJA 4G1NA 4A3QA 3L0GA 3V36A 4ZZ9A 3LHZA 5HANA 4BF7A 3LPPA 2ISDA 2POZA 2YBUA 3W00A 2FYMA 3PULA 3UCQA 4Y8EA 3CUIA 3CAVA 2DJXA 4EAMA 3LCFA 3PPCA 1D2KA 3A5FA 3WQGA 5AN7A 2AQVA 1AMKA 3QFEA 1B3YA 4R7JA 2FKPA 2VEPA 3GH4A 3S1GA 4KGLA 1HXJA 4QQ3A 4U5KA 3AIEA 2VJXA 3ZSTA 3KAOA 3U3HA 5BU6A 3UVIA 2CYGA 3MVIA 4HA0A 4LVAA 1JYXA 2C3ZA 3L4VA 3VUSA 8RUCA 1GYMA 2QIWA 1E5JA 2OT1A 4O52A 5D2XA 4Z1YA 5A2CA 3CTLA 3PJXA 2DZSA 4MVAA 1EDQA 2DZTA 5JU6A 2GJLA 3SUVA 3TMLA 2BOGX 2AKMA 1V6UA 3AS3A 3UG5A 2F84A 1HUVA 3PJWA 4AD0A 2G50A 3VMNA 5BYWA 5IDZA 1VBUA 3N4AA 3TJLA 5T9BG 1O1ZA 4HNLA 3GTNA 2UBPC 1Q6DA 4ML4A 4V2XA 1D3HA 4DEFA 4A22A 3KM8A 2ISVA 4R5EA 4GINA 3EA1A 4YTTA 1RHCA 4NX5A 2A2IA 2QMKA 4MADA 4JHZA 3DG7A 3LN3A 3BMVA 2YA1A 3N11A 4C6EA 4KBXA 4HJWA 5XIMA 4UMBA 1BGAA 4US6A 3L5AA 3P84A 1S5TA 4PUEA 3DHPA 4LAUA 1FHLA 2YL9A 1NQ6A 1J96A 2PP0A 2CLEA 5G2IA 1RA5A 4O1FA 2BLEA 2BDQA 1MRQA 3QC3A 4Y9NA 1GYLA 4FHAA 2WJDA 1KCLA 3G18A 3LD5A 1UJQA 2NLYA 2YSWA 1B4EA 3WNNA 5HXMA 3URBA 4BF5A 1FY6A 3W82A 4HIBA 1IZKA 4W7VA 3WFLA 4B90A 4ZSTA 4MSSA 2CLFA 2IQTA 1YRRA 4M24A 3GH7A 3HGJA 3IACA 3B8WA 2V5KA 4F2TA 3VI2A 3ARUA 4G7EB 3WQ5A 2HZGA 3II1A 1NF7A 1EC8A 3OZPA 1SMAA 3FA4A 4B3ZA 1RK5A 2Y7FA 4UFMA 5HMEA 4AZ7A 4LANA 1KWKA 1UIOA 1V6TA 4H41A 2QVNA 3DESA 4KWVA 1XSKA 4XVDA 4LY8A 3W7LA 1DXFA 2ZWYA 2XN0A 4ZO8A 1FWJC 3F2BA 2R1MA 2ACSA 3EDEA 4GFSA 4AYSA 4MPQA 3TXVA 3LM7A 5EFDA 4PCSA 1JNEA 4REQB 2VGBA 3O15A 1YADA 4M81A 3TFXA 2YKKA 3INPA 1IXNA 3PUDA