3DU0A

E. coli dihydrodipicolinate synthase with first substrate, pyruvate, bound in active site
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
292
structure length
291
Chain Sequence
b'MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate synthase
publication title The high-resolution structure of dihydrodipicolinate synthase from Escherichia coli bound to its first substrate, pyruvate
doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 109
structure length 291
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2008-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3du0A00
3VNDA 3W1AA 1F05A 2PCQA 4JTEA 1WA3A 3OVPA 4LVBA 2ZRVA 4HHPA 2NLIA 4AHQA 3S42A 2Y7GA 4O18A 1G4PA 4C1LA 1B3OA 2ISVA 4FO4A 1UUMA 2CW6A 3E49A 3O07A 1YDNA 3FEMA 3DFSA 4X22A 4AHOA 3GKAA 3KXQA 3GAYA 1WYIA 3LHVA 3MHGA 1DBTA 2FDSA 3CU2A 4WD0A 4DELA 2QCDB 3QW4B 3KRUA 4TMCA 1TSIA 8TIMA 3UXAA 3VE7A 3CT7A 3N73A 3V1PA 5CZSA 2V2DA 1X6UA 5KZDA 3THAA 1W5MA 1PE1A 5CZTA 2FFCA 1XBZA 4KWVA 3W7CA 3CQ0A 1EEPA 3G1XA 1NVMA 2Q3OA 4NUWA 2E5CA 3T78A 2ABBA 1BTMA 3QM3A 1L6WA 3W3OA 4NZJA 4UFIA 4GXMA 3I7QA 3DHDA 3IVTA 4N2YA 1DKWA 5C5YA 4CQAA 3W71A 1L2UA 2VFIA 3FS2A 4ADTA 2GJLA 4LRSA 3W76A 2QUVA 3GR8A 4O1DA 3C0JA 4LWWA 2QCNA 3O16A 3L0GA 4IJBA 2NX9A 1W31A 5CZ0A 3TCEA 1XKYA 2ABAA 3TQ0A 1OX6A 2GJNA 4K6AA 3N9RA 2ALDA 1W0MA 2H3DA 3DI0A 3P8IA 4OHQA 1FWRA 3RNDA 4FNSA 1PHQA 3LTSA 4M7TA 5L6UA 3N3MA 2B4GA 4JR5A 4ZVJA 3MI3A 4HNUA 1ICPA 5CGQA 3A5FA 4K7YA 3HG5A 3PULA 3TE9A 3WJXA 4O13A 2YFNA 4OV4A 1G69A 2NUYA 4WXYA 4UTMA 1KM0A 1TJPA 4H6KA 1QO2A 1ZENA 2W6RA 4JTIA 5E0KA 5DCEA 1OFBA 5CPNA 1FCQA 1PVNA 3FKKA 4WXZA 4AWSA 2JGYA 3L66A 3IV3A 3R8RA 1XUUA 2RH9A 5EL1A 3C2EA 4RZ6A 3NQAA 1EA0A 2BTMA 4ML9A 1SW3A 2C14A 5DELA 1H5YA 2QJIA 3U8GA 4N9DA 2DZUA 3W7MA 3MP4A 5EA9A 2ZZ1A 3G1VA 3PAJA 3OEXA 5DBUA 2VEIA 1FX6A 4RZ5A 2V82A 1UASA 2CU0A 2RDTA 4X2RA 5LNUA 4BR1A 1LM1A 4LTSA 2YCEA 3C8FA 3TA6A 1JUEA 1WV2A 2C15A 4WUIA 4KFOA 1YXCA 2J6XA 4OGZA 3TQKA 4M6QA 2JK2A 1O5XA 4O57A 5LKYA 3W1LA 3L68A 5K4ZA 4G1KA 2H8ZA 3OIXA 1W5QA 3CTLA 5K2ZA 2Z2UA 3DFOA 5D03A 3W7RA 3GAKA 5K7JA 3EEGA 3MBFA 1LZOA 4GJ1A 3W7JA 3QZEA 1ZFJA 1IXQA 4C1KA 4UTWA 2Q3RA 3STCA 3G3DA 4NNCA 1GT8A 4BF9A 5C55A 2C1HA 2E6FA 1HG3A 3ZWTA 3N2MA 1SO4A 3W2MA 1NEYA 4UR8A 4Z0SA 1KM6A 2ZA2A 3QPYA 1KM4A 3KVLA 2DZSA 3NQ7A 3O6YX 1JCJA 3IVUA 1TV8A 4QAIA 3Q94A 1AG1O 3GDTA 2OT1A 4ZQNA 3STFA 1ME7A 2TMDA 1YADA 4PTNA 5FF4A 3G0SA 1HTIA 1W8SA 1G4TA 2HMCA 1GPWA 2BSLA 3HF3A 4QJ1A 5EKYA 3CEUA 1VGAA 4MY1A 5U4NA 4UTUA 2TSYA 6TIMA 1QPRA 3NQVA 4DO4A 4R34A 3EWYA 4HSOA 1PIIA 5G5IA 4MY8A 1S3HA 4RJEA 3W1RA 4H4IA 4DXVA 4LVGA 2NUXA 1FY6A 1UCWA 2DZXA 2RDWA 4O4WA 5AOUA 3NQ2A 3KX6A 3DZ1A 3IIZA 2Y88A 1GWJA 3CWOX 3SIZA 2VEMA 3NM3A 2ZTJA 4JX5A 2EHHA 1EP2A 1AL8A 3BLEA 2ZCGA 5E1QA 2CFFA 3GX9A 3WK3A 2OZ0A 3M41A 1H63A 2CLOA 4IMFA 5EYWA 2VFGA 4O19A 2X1RA 1RVGA 3UPWA 3QYQA 5ABTA 4LU0A 4HIBA 5AHIA 1WBHA 5F4XA 4O17A 1JQVA 1K8XA 4JNMA 1EUNA 3NYZA 5CZJA 1FWSA 5LHEA 4JTLA 2QCFA 1A5SA 4TO8A 5FF0A 4O12A 3NL2A 3SGUA 3W1UA 1GG1A 1I2PA 3VCRA 1THFD 4EOUA 2WSYA 4O8RA 1FXQA 1JCXA 4GUGA 4HNNA 3C56A 1SW7A 1R46A 2PRLA 3W6YA 4O15A 4XWUA 1QAPA 4GUFA 1SZNA 4ICNA 2JKPA 1SQ7A 4A22A 3EXSA 4XBSA 4UXDA 5L9FA 1OF6A 3DXIA 4UTJA 3OBKA 4QITA 1LRQA 2TRSA 4HSNA 1F6PA 3W83A 1KLYA 1OVDA 1UBSA 4LS2A 1DL3A 1A5AA 1TV7A 1VRDA 1VR6A 4A2SA 1WQ5A 3IGSA 3KVKA 1TRDA 1BWKA 2FQIA 5HULA 3ZFHA 3B05A 3GNDA 1KV5A 4K37A 3LOTA 5LNWA 2ATMA 5D2XA 1JRCA 1PV8A 3W70A 3TC7A 3C61A 1B4KA 1TYGA 4JICA 4E2BA 2CLLA 3B0PA 3T55A 2Q8LA 1ZAHA 3IGUA 5F1VA 3RLUA 3GXPA 4LVFA 1YPFA 1KM3A 3A22A 4EF9A 3B03A 4AF0A 3LM7A 3LV6A 2A4AA 3M5VA 4LT9A 3SJ3A 2ISWA 3MW7A 1W5PA 1MZHA 3NPXA 3IIXA 3GK0A 1JUKA 4YWIA 2ZRWA 2ZRXA 4PH6A 5HUPA 4MYAA 1KTCA 1XI3A 2WSQA 5CKSA 1KTNA 4QQ3A 1H50A 1VCGA 2EAWA 2R94A 4GRSA 1M7PA 1OHLA 4O11A 3TQVA 3O06A 1NAL1 2E77A 1I2OA 4MOZA 3BLFA 4PFMA 5HWJA 4FIRA 2DJXA 1QOPA 4JY8A 3JR2A 3P80A 4LRTA 5F4SA 1EWDA 3JRKA 1K8YA 4YL2A 3S9YA 5K9XA 1OFOA 2RKXA 3NXFA 3LCLA 5I3FA 1RQHA 4JYDA 2HTMA 2E6YA 5G1YA 3THQA 4S2BA 1SO5A 4DF1A 5D38A 3P81A 3TIMA 1F73A 2QCEA 1KBIA 4M19A 1A50A 1GYLA 1Q6RA 4NJJA 1PHWA 5I3KA 2JGQA 3PVFA 5FEWA 4ZMGA 1CW2A 2AGKA 1TMHA 5IBXC 2UV8G 2WNNA 4R33A 1Y0EA 3W7DA 4E2DA 3MI2A 4A21A 1TV5A 2E6DA 2ISSA 2FB2A 1IGSA 2CLHA 4BI7A 2G96A 1Q45A 2R91A 2ZZ4A 3NR0A 2J9XA 1LRNA 3G22A 3BGJA 4YMZA 3T7VA 3L65A 3CWNA 4K8HA 3QW3A 2YW3A 1H1YA 5SWUA 2E5DA 3I7RA 2CLMA 3B8DA 1MSSA 2VOMA 4IMDA 5AHMA 3M9YA 1S5TA 2A1YA 4JTKA 4JTUA 3DU0A 3PBYA 3W7QA 2ZRUA 4LVAA 2YYUA 4OE7A 2CZ5A 4OU1A 4UFMA 4RR4A 5KINA 1KBJA 4UMAA 3OVQA 3HGRA 3M6YA 1DJNA 1XCFA 3PR2A 3W75A 4CNOA 3TJLA 1HO4A 2B7PA 1XL9A 4JXCA 2G97A 4WY0B 3BARA 3KRSA 3HJZA 4EWND 4QNWA 4NQ1A 2FB3A 4IMCA 1AW2A 1KLZA 2I14A 3P5YA 4O1CA 1SZEA 1JQXA 4MZ8A 1W5OA 3W86A 1OYCA 5C54A 4M6PA 3WJYA 4ZL1A 1HO1A 2CLIA 5AFDA 3H53A 2Y7EA 3DAQA 3LHWA 3W1XA 1LOLA 1JULA 4MKNA 2NZLA 4JIPA 3NQ6A 2I1OA 1F2JA 3E12A 3PM6A 4B5NA 3NPWA 2ZZ7A 1LCOA 4FNPA 4IQLA 4O0ZA 3I7SA 2C6QA 3P62A 4RX0A 4O1BA 4IMEA 1H7WA 1OFEA 2E5BA 3IEBA 4XQ6A 1UUOA 4FX8A 4AMAA 2V5LA 1W56A 4PEKA 1KV8A 1WXJA 5BOOA 1D3GA 3HB9A 4Q4KA 4O1AA 5AHEA 2DU2A 3S5YA 3FJ6A 2ZRYA 3TK7A 3A24A 1QFEA 5C6MA 3DI1A 3ZS4A 3NZRA 3O05A 4ADUA 3GDLA 2X1SA 3PC0A 3DFNA 2OJPA 4NJHA 3UWWA 2QAPA 2YW4A 1X7FA 1ZAJA 3R2GA 1OABA 4UFKA 1IF2A 2HS6A 1Q3NA 2R14A 4JTHA 3FFSA 2CZDA 3LHYA 2PRHA 2QJGA 3DH7A 5FESA 4JTFA 4MZYA 3GDKA 4Z1CA 4K39A 2Y63A 4UTWC 1QNVA 3M7WA 3NQGA 1J2WA 2HS8A 3SY5A 1AW1A 1YPIA 3UYCA 3TAOA 2QCDA 2BZNA 1F7BA 1AW5A 5IBXA 2TPSA 5D04C 1IXNA 4LC8A 3FJLA 3PUOA 3CM4A 3CEPA 4WQ6A 3TSBA 3EWBX 2DZWA 1ADOA 2A7NA 3RU6A 3G8EA 1EP3A 3NGJA 3GDRA 2FTPA 3NQMA 4HN4A 2Y7DA 1OFAA 1LLZA 4Y6GA 3HG2A 5D2TA 3B04A 2GQ8A 1SSGA 3UY8A 1W1ZA 2Z6IA 4BFAA 1FDJA 5HJLA 3RK8A 4RLIA 5F2IA 1PCKA 2YFOA 3Q58A 4ZQCA 3NL5A 2ZYFA 3UZ5A 5D2WA 5KITA 2V2CA 4N9CA 1ICSA 1F6KA 3EXTA 3P8JA 1HFBA 3N9SA 5AC8A 4GE8A 1H1ZA 4RK8A 4D2JA 3R5EA 4DO5A 3PUEA 3ATZA 4HPJA 4UFHA 3WJZA 3LLDA 1F74A 3C2RA 3S5OA 4M7SA 1EIXA 4A3UA 5HINA 5K9DA 3F1QA 4MLJA 1L9WA 3W7LA 5J5RA 4O53A 4L4MA 3W84A 3QPZA 1K3UA 2VENA 1HL2A 2A7PA 1FQ0A 2QCHA 3PBVA 2DORA 3L0NA 3PB2A 4NU7A 7TIMA 2QUTA 5CG7A 1BEUA 5DY2A 5AYYA 1N7KA 1OYBA 3TSDA 2A2IA 3RFAA 4DF2A 3GYEA 1NFBA 3HIJA 1N55A 1VLWA 5TBOA 3TH6A 3TKFA 4CNNA 2X1TA 3TMLA 1WAUA 4UTIA 1YXDA 1H7PA 4P2VA 1R2TA 4DF0A 3PSVA 1KFCA 4ZQRA 3STGA 2DP3A 3E96A 4GC4A 3IGXA 3HMJG 1RZMA 3P74A 3HG4A 2AQWA 1W54A 2G5WA 3QFEA 2Y7FA 3MYOA 5E93A 2Z1BA 3L0KA 1B9BA 1HUVA 4GFSA 3NVTA 3NPUA 1LORA 2G95A 5MHBA 5LNVA 4NXKA 5AHFA 2ZRZA 2GVJA 5DCBA 3HG3A 3O6CA 1K7XA 2C19A 2QDGA 2GUUA 2O7QA 4LC6A 3W2LA 2FJKA 5FF7A 1TPB1 3PB0A 3C6CA 1XXXA 1Z41A 2B7QA 3UWZA 2ZZ2A 3UWYA 2YPIA 3EX3A 2P0OA 2ZA1A 3NAVA 4M6VA 3BG5A 3PG8A 3HGJA 4CQ9A 1S5WA 4YXGA 3LBCA 3W2NA 3UD6A 2OT0A 1VCVA 3W7GA 1V7YA 4S1FA 4PL2A 3STEA 6ALDA 1G6CA 3UWUA 3FYPA 4Q33A 1I2NA 4RV8A 4K8EA 1QOQA 1TJRA 3Q2DA 4AWUA 3LCIA 3SSJA 2WNZA 2VKZG 4QM1A 1G4SA 3M44A 3CB8A 1XUZA 4NX0A 1I45A 2YXGA 1SFJA 2Y85A 2VEPA 1KFLA 4YCOA 2C18A 2F7FA 3NDOA 1Z42A 3G1FA 4I9AA 4MFDA 1D3HA 1JRBA 3PS7A 1GJPA 3P67A 4NX5A 3S0CA 3PBUA 2WQPA 3DHFA 3S8HA 2V5BA 5AB3A 3LRLA 1UB3A 1XBYA 4FIQA 3DFPA 3WK0A 4PODA 3L21A 1L6YA 1SUXA 3TMQA 1B4EA 4JY9A 4NJGA 5BMWA 1YDOA 1TPDA 3U6WA 1TPWA 3W7NA 1KFJA 4AVFA 4FNUA 3BO9A 3S1XA 2F84A 2ATSA 2GPTA 4BI6A 2E09A 3PBWA 4FX6M 4JDYA 3LCGA 3W9ZA 3LCHA 3GXNA 2RDUA 1ZNNA 4RZ4A 1TPEA 4IXHA 1UJPA 3W2JA 3ATYA 3LCXA 4IOTA 2X1UA 1M7OA 1YYAA 4Y96A 3LXBA 4GUIA 1OK6A 4LVDA 4Z08A 3I65A 5DY3A 3C2OA 4I7WA 3FKRA 3VI2A 2VELA 1M6JA 1KA9F 1VYRA 3HBLA 3QQ1A 1R2SA 4RXGA 4XZ9A 3TC6A 1GG0A 3W73A 4QSHA 5CPLA 2FPYA 3KRZA 1A5CA 3IVSA 3KOFA 4JEQA 2YSWA 3WJSA 1VQTA 3G8RA 3W74A 5EY5A 5DBTA 4IXXA 1C9DA 2EPHA 3EWXA 4IUOA 2QAFA 3ZR4A 1H7OA 1SZFA 1OG0A 3W2UA 5KZEA 1MXSA 3M0ZA 4WY0F 4BI5A 1TPH1 3O63A 3O8AA 1A5BA 5AYZA 5D2YA 1G7UA 3FIGA 2QF7A 3A23A 3QC3A 1FDYA 2DJLA 4IPIA 2NX3A 1TPUA 4IMGA 1LROA 2C0AA 3P84A 4A2RA 3EWWA 1H51A 1TIMA 4AH7A 4K36A 5K9CA 4JTJA 1OFPA 1O94A 5FF2A 4L4LA 5I3HA 1LBFA 1OX4B 1XFBA 2GQAA 2EF9A 1ICQA 5LZLA 4GUJA 4ADSA 3OVRA 2QCLA 2XN0A 3TXVA 3AJXA 5G1TA 4UTKA 4XKYB 5H91A 4UFLA 2A85A 1LBLA 1ALDA 3LERA 3CIWA 3LHTA 3WK2A 4QISA 1N8FA 1AMKA 2H6RA 2QKFA 1OF8A 4LS1A 2Z0IA 1QR7A 1SR9A 3LBMA 5D02A 2B0MA 3SI9A 3IRDA 3V75A 1WBJA 3O6DA 5D05A 1OYAA 4HT3A 1PCWA 1SPQA 4QIUA 4ZZ9A 1E51A 2QUUA 2FLIA 5LNSA 1U5JA 2A0NA 3NQDA 1IXOA 1FBAA 2EKCA 1FCVA 3NL3A 5FEPA 1LOQA 1P0KA 3LDVA 1RPXA 3ELFA 4N9EA 3W1NA 4WZHA 2OCZA 4Y9AA 2O7SA 3B0UX 5BMXA 4DQWA 1GTHA 1SZGA 4TU1A 2H3BA 4PA8A 2WPBA 3QMSA 4LY8A 5HR6A 2KZHA 2NUWA 4HKPA 2J27A 3O15A 5D33A 1R47A 2QCMA 2XFWA 2FPVA 4DBEA 3FOKA 4ORMA 1LLWA 4OWGA 4XTIA 3IIOA 5KTLA 3NQ8A 3LX9A 4U4MA 1OFRA 4I7UA 2AAMA 1I8JA 1DOSA 1X1ZA 3W1PA 4NNAA 5D2VA 3BW2A 3G24A 3BGGA 1H7XA 1O5KA 1Z44A 2E68A 4CCEA 3M5YA 2PRMA 3IIVA 5A5WA 3KFTA 4O50A 1VH7A 1VYSX 2A21A 1FCBA 1XBXA 3P7YA 2C16A 2ZZ6A 1I2RA 1O4UA 3SR7A 1F5ZA 4NJKA 2QDHA 3M1ZA 1K7FA 1GVFA 2NX1A 3N34A 4I7VA 1W3TA 4TMBA 2YGYA 3GR7A 5HQEA 4FNTA 1FWNA 3L5MA 4JYFA 1R30A 5D32A 3UZJA 2WSRA 5I3IA 1TQXA 1EWEA 4K38A 3EXRA 3ABQA 3CHVA 5KZMA 1KTBA 1KFEA 2J88A 3TFCA 3FLUA 2DZVA 4ONVA 5DLCA 5CPOA 2J9ZA 4XBKA 3GIYA 3QEZA 3OHIA 3S1UA 3W1MA 4GNJA 1SU5A 3TROA 1LRTA 5CSSA 4JIQA 5F4WA 3G18A 2X16A 3TV8A 3W22A 3GDMA 3UWVA 5BNKA 4YCPA 2VEKA 3LHUA 4EF8A 4JDBA 1LP6A 1VHNA 1DQWA 4IGHA 3TUUA 4P61A 3G0XA 3CPRA 1Q6OA 3NA8A 2WO5A 5AYXA 4DEFA 3P5ZA 2FIQA 4KWWA 3F4NA 3BW4A 2Y6ZA 3G3MA 4DPQA 1TPVA 2CZFA 3W7IA 4O0KA 4UIOA 3HGSA 1DORA 1KFBA 2NXHA 5BW6A 2BX7A 2ZTKA 2NXIA 2FPTA 5DXYA 2OMAA 2WOQA 4YLWA 1TO3A 4JTGA 5BRBA 2CWNA 3GB6A 2JKAA 1T99A 4POCA 4E38A 3W7OA 3BVJA 3NM1A 3MP5A 1K03A 2CLEA 4GWEA 1RV8A 3M43A 5D30A 1VPXA 3EX4A 2PC4A 4M5PA 1X1OA 2YR1A 1P1XA 3BPWA 3TW6A 1ML1A 1X8FA 4MIMA 2H8XA 1VZWA 1DVJA 3SFKA 3KVMA 3LI0A 3PY2A 4MLRA 4NJIA 2YYTA 4N4PA 1T96A 1WX0A 4ZQPA 2QCCA 1EB3A 3A9IA 2ZA3A 3E0IA 1JJKA 3LLFA 3DFTA 3HGOA 5CPMA 2J24A 2ZZ5A 1GVSA 3I6RA 5AC7A 4OQVA 3FYOA 3CLMA 3LV5A 4Z0JA 1FWWA 2JKEA 4CCDA 4N02A 4UUIA 3MUXA 1TQJA 3DFQA 4AB4A 3VKJA 2A7RA 2C3ZA 2QJHA 4J9JA 3R13A 2YZRA 2NWRA 4FXSA 1VS1A 5DCDA 1SO3A 1OK4A 3NL6A 1GVQA 2R8WA 3KHJA 1RQBA 1L6SA 3TW7A 2V81A 4R7JA 4AWTA 5F2GA 3S1VA 1RR2A 3LHZA 5U7SA 1B57A 4HNTA 3W7HA 5LHFA 4W9TA 5LGZA 1Q6QA 4HNVA 2QEZA 1T0OA 1EP1A 2DZTA 1VJIA 4NVTA 1JUBA 4U28A 3H54A 4WOZA 2GVGA 3RLVA 1G7VA 2WJZA 4Z1DA 3GVGA 1GQNA 1JCMP 2VFHA 1VHCA 4UNKA 3BW3A 2H90A 1JCLA 4UR7A 4DBDA 3B06A 1H61A 4EIVA 3TAKA 1M5WA 2W0UA 3NOEA 3QJAA 1EPXA 1ZY9A 2QR6A 3W87A 2A5HA 2ZZ3A 1XM3A 3EKZA 3K30A 3GXTA 1KFKA 2X30A 4FX7A 3W72A 5TIMA 1SO6A 2BXVA 3W23A 3LXCA 5HMSA 3RMJA 3LTPA 4DO6A 1OJXA 1AK5A 4UTTC 2XN2A 1XDMA 1LBMA 1QMLA 4UMCA 1RD5A 4AAJA 1DJQA 4LOCA 2CLKA 1TCDA 4EVZA 3BG3A 2E1DA 3G1DA 3BK0A 1I2QA 3EWZA 3P60A 3ABSA 1V5XA 3T44A 3PUDA 3EKLA 4MVAA 4O10A 2Y89A 3KVJA 5G4EA 4PCFA 3G1SA 4JTSA 4H3DA 4UNLA 4JN6A 1FUYA 3C2VA 5K4XA 5DXXA 3USBA 4AHPA 5HR7A 1TTIA 4JX6A 5LGXA 3MWAA 1QPQA 1QWGA 1W5NA 3L2IA 4FHAA 4XUGA 1EX5A 1YDVA 4TR9A 3DKJA 4DPPA 4CNPA 4JD4A 2V2HA 3C2FA 1C29A 5EBUA 3LB0A 2ZDRA 3UWQA 2V8ZA 1YTDA 4GUHA 5F2MA 1C8VA 4PL1A 5D37A 4A29A 5AC6A 3WJWA 2DZPA 3G0UA 4IPJA 4N6EA 4TIMA 1QPOA 4NZFA 3GLCA 2OX1A 1IXPA 4LUJA 4E0CA 1OX5A 4Y90A 1BWLA 1GEQA 1D9EA 2WNQA 1O60A 2A6NA 4O16A 1PL9A 3DGRA 3TR2A 4QNEA 5A8GA 1K8ZA 2P10A 5FF3A 3W1TA 4N6FA 3HOJA 5FEXA 5F1UA 1AL7A 3HQ1A 3F03K 3C52A 4GBUA 1JR1A 3ANYA 1YLVA 1TREA 3B4UA 2B7OA 4UTLA 2C13A 4K7VA 4O28A 4OV9A 1ME8A 2VFFA 3E9AA 4IX0A 3W7KA 3PF3A 1K7EA 3HPXA 4AEOA 4N9BA 1TTQA 3G1AA 5EMUA 1Q6LA 3QSTA 1O95A 2J9YA 3M5XA 4BWLC 3F4WA 4NXSA 2E6AA 1DHPA 1ZALA 4FNRA 3BG9A 1NF7A 1GOXA 1GYNA 2VXNA 4KFNA 1WOBA 3S1WA 4UMBA 3R12A 2VFEA 4UCGA 3H55A 3QMRA 3PWAA 4LS0A 1QO5A 3LRMA 3UQNA 3G1HA 4CQ8A 3AO0A 3BLIA 2Y62A 1QCWA 3UXDA 1Z48A 5F2LA 2W79A 3FA5A 4UTTA 4R53A 3M5ZA 4Y8FA 2RHGA 3LRKA 4MJZA 3NG3A 4FNQA 1J5TA 2P1FA 3NO5A 3QRHA 3LGEA 3TX9A 1WOAA 4OBTA 1ONRA 1GZGA 1FDZA 1W37A 1P5BA 2GQ9A 1PS9A 4ZQOA 4CCCA 5AHNA 2QCGA 3NZ1A 5HUOA 1FCUA 1R2RA 4AXKA 5AHLA 3N14A 4LV4A 1GTEA 3SZ8A 3ABOA 1LDCA 5LNRA 1IIHA 3NEVA 1TPFA 5T26A 2V30A 4MFEA 5G2HA 3QF0A 3EWUA 2PURA 4Z1BA 3UY7A 3LTYA 4UC5A 2GVLA 5G2IA 1ZHAA 1ME9A 3JS3A 1H7RA 1YTEA 3EX1A 4NNBA 4MZ1A 4FB7A 1MEIA 1KW1A 4IX2A 3LI1A 3W1QA 3HPSA 1TRIA 2NWSA 3SGZA 1K02A 3OA3A 3INPA 1S5VA 3T4CA 3N19B 2V0TA 1XDLA 4XTDA 5H2ZA 1LTDA 2D73A 1P0NA 1P4CA 1TTPA 3TDFA 1F76A 3TXZA 5IM51 3HO8A 1CI1A 2IQTA 3LCFA 2EGZA 3L5AA 3S5ZA 1W3NA 1OX4A 3UNDA 3KAOA 4AF0B 3MHUA 1YTKA 3W85A 3GKFA 4XKYA 4S2CA 1WDWA 4Z1AA 4N4QA 5DN1A 3DBPA 2VC6A 1RQEA 2A6LA 2Y70A 2B7NA 1G4EA 3PSWA 4JX4A 5FEZA 3QSRA 2LLEA 5D09A 3W88A 3EX2A 3SW6A 3MMTA 2GOUA 4O4VA 1TTJA 3DKLA 4JTTA 5C2XA 3M16A 3IIPA 4MJMA 2TYSA 3UPBA 4BWLA 3B0VC 4X3ZA 4KFPA 2ZBTA 3S5NA 1KM5A 3ABRA 3ZWSA 1YXYA 4FXRA 2BLEA 1VYPX 2NV2A 4JS3A 2HSAA 3G1YA 3DENA 1U83A 2RFGA 3YPIA 3MJYA 3W7EA 3NPVA 2YDAA 3R89A 5HWMA 3BV4A 3EB2A 3NNTA 4WX2A 4X9SA 5LSMA 3O1NA 4TX9A 2X2GA 1CX9A 1A53A 1XC4A 4ALDA 5I3GA 3TSMA 2WKJA 1MEHA 3HPZA 1G67A 4ZQMA 1ZAIA 3S6DA 3C4UA 4CLMA 1TB3A 1NF0A 4RCXA 5I3JA 2Z6JA 2NV1A 4NT0A 3NQCA 4HPXA 3W07A 4WOQA 1J4EA 2BWGA 2VFDA 4MPQA 2YX0A 1QPNA 4RXFA 3N2XA 1ZCOA 2CZEA 3VFLA 4IWWA 2Q8ZA 1GVOA 3GNNA 2PE4A 5FI8A 2NXGA 4OT7A 1H7NA 3TJXA 1SFLA 4LUIA 3LCWA 3P61A 3MYPA 2CLFA 4MY9A 3EX6A 3MI6A 1XBVA 1JVNA 1VCFA 1MO0A 3TFXA 3L67A 3CC1A 2JBMA 4JGDA 4LW7A 1OFDA 3D0CA 5TQLA 3W2KA 3I68A 5K3VA 1DQXA 4O54A 3MBDA 4PC8A 3W7PA 4WY0A 4LV9A 4UTHA 5EPDA 3MHFA 5GVJA 1VLIA 1NSJA 1EUAA 2ZQ0A 2I9EA 3E02A 3C3NA 3U2OA 1OFQA 2Y61A 1DV7A 3NQFA 5AN7A 3QQ0A 4O14A 1T8XA 1TPC1 2V9DA 3A21A 4MUZA 3WK1A 1LYXA 4O52A 5HWNA 5KSWA 3PG9A 4LNYA 5G2WA 2ZFAA 1SSDA 1H62A 1BKSA 3M47A 5KMYA 5J5DA 3TU9A 3SECA 4FEZA 5HNRA 1SW0A 3VE9A 1VC4A 1GVRA 3MO7A 1KM2A 4UFJA 3LXAA 1JCNA 4RKAA 3Q37A 1LOSA 3A5VA 5CSRA 1QDSA 3QH2A 4FF7A 3TNOA 4BK9A 3MP3A 1H60A 3NQEA 4KKXA 4JYEA 3L9CA 3P82A 3WFAA 1ZJIA 1I4NA 1W3IA 3RF9A 1JCYA 1FWTA 1MEWA 4Q32A 3L5LA 2XN1A 3QMTA 3GZ3A 3OG3A 4WJEA 3T40A 2WV8A 1IIGA 1FXPA 1KM1A 3CIXA 5G4WA 4ORIA 4MYXA
chains in the Genus database with same CATH superfamily
3VNDA 1XLMA 5CBBA 2NQ5A 2Y7GA 4C1LA 3WF3A 1J0JA 4X22A 1ZJHA 3A4WA 1XSIA 1XIDA 2WC4A 1REQB 3LHVA 3PNUA 4QXIA 4RDYA 3QW4B 3REQB 5DEZA 1YEYA 4TMCA 1TSIA 3VE7A 3UXKA 3N73A 3UW6A 2V2DA 3QN3A 1X6UA 1PE1A 5CZTA 1NFGA 2FFCA 1A3HA 1GEHA 5A69A 2PLKA 1NVMA 2Q3OA 2D3LA 1QTWA 5E70A 4QE4A 4GXMA 2XWDA 4FLQA 3FSUA 1B3YA 1L2UA 2VFIA 4UTFA 2IPWA 4E4FA 4ZTXA 4IJBA 3O6AA 1CGUA 1W31A 3TCEA 1XKYA 4PEEA 3Q4DA 3TQ0A 2I7GA 2GJNA 3BANA 1GJWA 1QI0A 3DI0A 2H3DA 3VVGA 4CD4A 4AD0A 1JAKA 1PHQA 4B4HA 2B4GA 1BWVA 4TVDA 4YU1A 4CQDA 4D9PA 3A5FA 2OSYA 4INFA 3HG5A 3PULA 3FA3A 4O13A 4OV4A 1PXGA 1XQKA 4C6DA 4G8TA 4XSLA 3QR0A 2QUMA 3TJ4A 1KM0A 1ZENA 1FCQA 4QG6A 3FKKA 4AWSA 3GY1A 2FHCA 5JIPA 3TP4A 3FW6A 3IV3A 4GI8A 1XS2A 3PFRA 1UROA 2R1KA 5CBIA 2PSNA 5EBAA 4PCPA 1MFUA 3T0DA 1EA0A 2BTMA 4XZBA 2QJIA 3GVQA 1XSJA 4ZSUA 5EA9A 2VEIA 3BL3A 1FX6A 3WFZA 1IT8A 1CNVA 1UASA 2CU0A 3QLLA 5GPRA 5A6AA 2C15A 4WUIA 3CGTA 3H2MA 1OCBA 4KFOA 3AIUA 1XLLA 3TQKA 1OB0A 4M6QA 3W1LA 3L68A 4HPNA 3BMWA 1EJSC 2PDBA 2XZ9A 3N2BA 4XIAA 3W7RA 5K7JA 4Q4SA 1TMQA 2WHJA 2OEJA 5CSUA 4HOZA 2Q6ZA 1IXQA 3RAOA 2BBFA 5IRPA 2PZ0A 5CXPA 2Q3RA 4N0RA 2ONEA 3TZFA 1GT8A 4GOAA 4AZ6A 3CUXA 2P76A 4ZCWA 4IP4A 1IR2A 2QYGA 1NEYA 2F9RA 4AVOA 5BOEA 2P53A 3FHAA 3F7JA 4KCVA 4CD5A 3MCMA 3IV8A 3KVLA 1Y5XA 3Q94A 1AG1O 1NWRA 4NIRA 3QOMA 2CXEA 4PBFA 1TJ1A 1YADA 3UJSA 2PGRA 3APGA 5FF4A 3P93A 4AY8A 3G0SA 1OGGA 1G4TA 1MUMA 2HMCA 4XAZA 3MUIA 5U4NA 1HVQA 2TSYA 1WAWA 2QJNA 3D3FA 3KEHA 4FF5A 1PIFA 3OBAA 3TWBA 4HOXA 4HSOA 3GU1A 1K6AA 4MY8A 1QUMA 1UPPA 1W9VA 4LVGA 1UCWA 2DZXA 4E3VA 5LA0A 1NIUA 4O4WA 2F38A 4Q4RA 1XIMA 3EYPA 2FDMA 2GSEA 1XLJA 1EPVA 2Y88A 4H9VA 1GWJA 1W9PA 3SIZA 1FWFC 2ZTJA 3AHVA 1EP2A 3BLEA 3H2NA 2CFFA 3R0KA 1CECA 3WK3A 1XH2A 2I5GA 2BGNE 2OZ0A 2WC3A 1AQ0A 3QGAC 1NOFA 3RG6A 1W9XA 3M4HA 1WBHA 2YBTA 5F4XA 3UR5A 3FJNA 1JQVA 4JNMA 1VBGA 1J18A 4UQAA 3TYAA 3NL2A 1HZYA 3BLKA 1GG1A 4EOUA 3DIPA 4S38A 4HNNA 4CU8A 3C56A 5BU9A 1XRVA 2YJQA 3W6YA 3OZMA 4O15A 3LUTA 4XWUA 1DJZA 4ICNA 4B3LA 1FVPA 3EXSA 1XYFA 4UXDA 1W1TA 2YCIX 4OBSA 2W9MA 1MWOA 3CZGA 3HN3A 4HSNA 4HVXA 1F6PA 1KLYA 1UBSA 4LS2A 4ZOBA 1DL3A 1HL9A 1A5AA 1VRDA 1VR6A 4A2SA 4JIEA 5FSEC 3KVKA 1TRDA 5DRCA 3B9NA 5HULA 2CHOA 5LNWA 1XV8A 1PV8A 1TG7A 4FMVA 2CLLA 4C6KA 1HL8A 3T55A 1TJ0A 1ZAHA 4DJDD 2YCLB 3ZVHA 3GNRA 3HTWA 3AC0A 3RILA 3E1F1 3UGRA 5CC6A 2ISWA 3AMDA 3C0LA 4CD6A 4DAFA 4J7RA 3RN6A 2VCBA 2Z2BA 1JUKA 1KTCA 5CKSA 1KTNA 4IPPA 3W28A 4J3SA 1H50A 1M7PA 1OHLA 2BODX 1RLCL 4V1XA 1XDJA 4C6QA 1CXKA 2E77A 4HZ7A 4M29A 4LAZA 1DJIA 3M0HA 1QOPA 4LEQA 3P80A 4LRTA 4Q22A 4GCXA 1OFOA 4L64A 2RKXA 1OSEA 5I3FA 2HTMA 5G1YA 3H6OA 2A3CA 4DF1A 3VNJA 5LXEA 3P81A 2QCEA 3TNBA 3VC5A 1GYLA 5FEWA 1LT7A 3OLIA 3ECQA 2OLSA 1Y0EA 4HU4A 4LCRA 4E2DA 3VOCA 2ISSA 4BI7A 1Q45A 2R91A 2ZZ4A 3ITVA 2J9XA 1MW2A 1XPGA 5DMMA 4RZBA 4TV6A 2YW3A 3RGTA 1DWHM 5KETA 5SWUA 1J2BA 1SR0A 2PDKA 2AL1A 4JTKA 2WM0A 3W7QA 2C71A 4LVAA 2CZ5A 3WQCA 3DGBA 3CYVA 4OU1A 4WK9A 3HGRA 4UOQA 1XCFA 1WDRA 2W62A 3AIEA 2E40A 1V02E 4WY0B 3KWXA 3BARA 2OEKA 4PN2A 4Q8TA 5A6KA 3UYIA 3W24A 1O5QA 2PTXA 1JQXA 3G5EA 1JIBA 4S3CA 4KETA 1W5OA 4LNCA 1OYCA 5C54A 4LYPA 2PAJA 1DTNA 3CHDA 3H53A 3DAQA 1LOLA 2PB1A 2NZLA 1HJVA 4GA8A 5HMFA 2P3EA 4S3JA 1F2JA 3E12A 3R43A 1A49A 4FNPA 1VFOA 4Q7BA 5ECUA 4DUWA 4AWEA 4IFKB 3AOFA 3RU8X 1OFEA 2E5BA 4FX8A 4K2SA 9CGTA 1KV8A 1WXJA 1UR4A 1I1WA 3TLQA 3CHCA 1Q66A 3S5YA 4M1BA 3OU8A 5C6MA 3OZOA 1GVIA 3ZS4A 3O05A 4ADUA 3GDLA 3PC0A 6PTDA 3L4XA 5FJUA 2Y8KA 1S5NA 3DBNA 2YW4A 5M5DA 1J0IA 2OVLA 4UFKA 3KLLA 1Q4NX 4KWOA 3FFSA 2F6UA 4S3DA 3DH7A 4MZYA 3CAQA 2GYIA 5B7ZA 3APTA 4Z1CA 5E0CA 4BCEA 1QNVA 5CC7A 1E6QM 4XD5A 3SY5A 3UYCA 3K2GA 3H7VA 4HU0A 2IQ0A 4XZIA 5AZ0A 4EP8C 3MJMA 1QW8A 4D8ZA 2QQ6A 2PTZA 3CUFA 4E5TA 3NGJA 5IHRA 3NQMA 4J2MA 5A8PA 4GH1A 1U1JA 2XHYA 1FFRA 2V5JA 4LUSA 4BFAA 5CG0A 2DSZA 1TA3B 1JYXA 4ATLA 5KITA 3Q58A 3ZYZA 1JDAA 1ECQA 1F6KA 2GZXA 1HFBA 2GUYA 3VC6A 5C9UA 4OTKA 1GGOA 5I2UA 4D2JA 5REQA 3DESA 3R5EA 3P6LA 5D4YA 3PUEA 2D20A 4HPJA 4B5WA 2VR5A 3LLDA 3C2RA 1UHVA 4A3UA 4W5UA 3VCNA 2OO6A 4F2BA 5J5RA 1R5YA 3GS6A 1AD1A 1QT1A 2G3MA 3QPZA 3RJYA 3VTRA 4M0XA 1HL2A 2A7PA 1FQ0A 4H19A 2QDEA 4I8DA 4W7UA 2DORA 3L0NA 5CH9A 3PB2A 3T08A 2ZVIA 4ZB0A 5DY2A 3ARRA 3C2YA 4GINA 1OYBA 1XIJA 3E74A 3TSDA 1FWAC 2OKOA 3UU0A 2UY5A 2ZC1A 4DJED 3GYEA 1YPXA 1K9DA 5CC3A 5JU6A 4HP5A 4G7FA 1YBQB 2EG8A 4L9ZA 1VFTA 2GGGA 3L7RA 4S3AA 3TKFA 4M56A 2X1TA 3FAXA 3OGVA 3ME3A 1IYXA 1OM0A 3KS5A 2Z1WA 1R2TA 5ABGA 2DP3A 1G94A 1RSCA 1WKFA 4D71A 4PCNA 3SCVA 2Z1BA 4W5ZA 4GFSA 3OLEA 1LORA 1QNPA 3PPHA 4AG0A 2PU1A 3VA8A 3RCNA 3AZRA 1H0GA 4K1WA 3H8AA 2C19A 2GUUA 1GQIA 5CBJA 5C2GA 3PB0A 1IWAA 2PC8A 1XXXA 4C6FA 2DUZA 2DVTA 5E5CA 2R1NA 3CPGA 2ZA1A 3EX3A 4LPCA 1E0XA 3NAVA 4YTQA 3PG8A 4CQ9A 2PU0A 4LYRA 3N15A 2FKPA 3W2NA 3UD6A 2OT0A 2UY3A 1PUDA 3AIQA 4GBDA 4GLEA 1ADDA 2GVEA 4Q33A 2GJPA 4RV8A 1X38A 2V68A 3WEZA 4K8EA 2GOKA 3U9IA 4AWUA 1CT5A 2WNZA 3WBWA 4UQ9A 4WEVX 1IEXA 3WLTA 3CB8A 2WKLA 4NX0A 2ANUA 1MW1A 2VEPA 1KFLA 4AZGA 5IDZA 4I9AA 4C6PA 1EJXC 3P67A 4D6IA 1MDRA 2V5BA 4J4KA 3VYLA 3AIVA 1XCWA 1DJXA 2D0GA 3VOHA 1FHDA 1DWIM 1AH4A 4J40A 3WK0A 4PODA 1SUXA 4JY9A 4NJGA 5BMWA 1KFJA 3ORWA 1Z89A 1KWKA 5T8GA 1XR2A 2E09A 4HQVA 2YBUA 4AD1A 4J3UA 2TAAA 3LCHA 5CPSA 2RDUA 1ZNNA 1FHLA 3TYDA 3ATYA 1JZ8A 3LD5A 5TF0A 1M7OA 3ZLFA 3LXBA 4GUIA 3URBA 1BQGA 5DY3A 3VNZA 4HJWA 1RAKA 3VI2A 4JTDA 4UWMA 2VELA 3QR3A 5FJPA 1VYRA 3WZ0E 4XZ9A 3POHA 3F2CA 4F3HA 3VGBA 1GG0A 3W73A 3SBFA 3S2MA 4JEQA 1VP5A 5JVLA 2ZE0A 1FKXA 1C9DA 5EGRA 3VX0A 3ZR4A 1SZFA 2QS8A 3M0ZA 3O63A 1EJ7L 2PDPA 5AYZA 5D2YA 3OODA 3QC3A 4IPIA 1LROA 4A2RA 3EWWA 1CYGA 2FVLA 5K9CA 4H8NA 4OFCA 3AYRA 2KX9A 5HMEA 1KQZA 3H4GA 1LBFA 1OX4B 1XFBA 4LAMA 1EC7A 3F5KA 4LAUA 1ICQA 2QCLA 3JW7A 5IOBA 3AJXA 1VD6A 2A85A 1LBLA 3STPA 1GQLA 5B80A 1VKFA 1XLBA 1N8FA 1AMKA 3COTA 4C1NB 3MWCA 1ADSA 1RD6A 5DO8A 1SR9A 5D02A 1FHUA 3LPGA 1HKMA 5AYBA 1K6WA 4J35A 1PSCA 1DHKA 3BUVA 1OYAA 2XSAA 3NJ3A 1PCWA 3CH9A 1TWWA 2OX4A 2QUUA 2HNHA 2XSXA 2R9RA 2A0NA 3NQDA 2BP1A 1IXOA 2EKCA 3MMDA 4D6GA 3HA1A 4HA1A 1VPQA 4AC7C 4C6BA 3LDVA 4GC3A 4F9DA 3B3DA 4N9EA 4GGBA 1TX2A 4Y9AA 2J7HA 4DQWA 4GI4A 3BZGA 1US0A 5FSDC 4YNGA 2OEMA 3O15A 3T4WA 3QZ6A 2VT0A 3UERA 4ORMA 4OWGA 4XTIA 3WUGA 3CQJA 5FAJA 2W4XA 4QE1A 4W88A 2FZ8A 1DOSA 1X1ZA 3N4AA 3G24A 4M1RA 1O5KA 1Z44A 1W1A1 3MMUA 1TUXA 5A5WA 3KFTA 4Q8QA 1VYSX 2EPOA 1V03A 2A21A 1FCBA 3P7YA 2ZZ6A 4F4RA 3SR7A 4LF1A 4QDPA 4FXJA 3MV01 2AKMA 3KM8A 3H70A 3GG0A 2YL8A 1W3TA 4TMBA 4U3AA 1R30A 2YDRA 1ZBKA 3UZJA 1US3A 5I3IA 3NO1A 3RJXA 5KZMA 1QW7A 1KFEA 3NSXA 3GXMA 3UNTA 1PAMA 1I1XA 1JFHA 2J25A 3GD6A 3FY1A 3LYEA 1XYAA 4XBKA 3OHIA 3AJ7A 3S1UA 1SU5A 3PTMA 3TROA 1M7JA 1LRTA 2HXUA 4R9OA 1KRCC 3G18A 1O66A 2AOSA 3TV8A 3W26A 3UWVA 5CJNA 3HPFA 3S2JA 3LHUA 4EF8A 3WLOA 3CV1A 3G0XA 4WDWA 1OINA 3P5ZA 3WUFA 2FIQA 2FHFA 3GC4A 3F4NA 3G3MA 1TPVA 3W7IA 4O0KA 1OT1A 4UIOA 2YXXA 3QQWA 2FGLA 2OMAA 4YLWA 4JTGA 3KBWA 3PWGA 2CWNA 2X05A 3BVJA 1K03A 1R38A 3B9AA 2WPGA 4M5PA 3R79A 4GKTA 3GZAA 2Q02A 3APYA 3EZ4A 1JDEA 3SFKA 3URNA 4QQUA 1TJ2A 2QCCA 1P6CA 3MV11 2ZA3A 4MADA 3LLFA 4DM2A 4W89A 3BZJA 3N6QA 3T2PA 5A8QA 3QVQA 3WDJA 2CNCA 4MTVA 4QLLA 1WUFA 4NAEB 4Z0JA 2GJXB 1AFSA 3DC0A 3VD5A 1EF2A 3WNNA 4KCWA 1TQJA 2C3ZA 2WCSA 1E0UA 3GFXA 2BVTA 1SJCA 1VJSA 3E0LA 1SO3A 2RGMA 2R8WA 1RQBA 4R7JA 1I0BA 3S1VA 2RJHA 5U7SA 1B57A 3WQ4A 2PCEA 3NO3A 4HNVA 2QEZA 3EKGA 4HNOA 3HQOA 4AVNA 3LSCA 3WD2A 3E2RA 2DV0A 1WZLA 2X42A 3THCA 4AFYA 5M03A 1WZMA 1ZB5A 4Z1DA 1V3KA 4PYSA 4W93A 2YKKA 4G9PA 4F0LA 3SO7A 4Y9OA 2OZ3A 3TAKA 3OGSA 4DNHA 2HWGA 3W87A 1P7TB 2ZZ3A 1XM3A 3GXTA 3K30A 5GJNA 2VUYA 2X30A 3AU2A 4NZCA 1F9CA 2XIBA 4NG3A 3LXCA 5HMSA 3EMCA 4DO6A 3L4TA 5CPTA 1FKWA 4UMCA 2CLKA 3EDKA 4EVZA 3W25A 2E1DA 2PZNA 5MKGA 1I2QA 3GG1A 3PUDA 2PP3A 1GHRA 2IS7A 3NZGA 5HNNA 5FJJA 3V5FA 3KVJA 4GZEA 4PCFA 1FUYA 3C2VA 1GQKA 2O56A 2J78A 1EFZA 5DXXA 1A47A 1BRLA 2OPJA 4JX6A 1ONWA 3MWAA 2Z1VA 4J3WA 5DX7A 1W3LA 5C7VA 2HEJA 2BGSA 1JZ6A 3JVAA 2WM1A 3NEHA 4DPPA 1BLIA 4MM1A 4W85A 3B40A 4GX9A 3TN4A 3T2QA 1C29A 3SUVA 3LB0A 4X0NA 3IJDA 4GYPC 3UWQA 1CDGA 5GNYA 1PYFA 3PZTA 4GUHA 1EQCA 4MDPA 4QLKA 4PL1A 1E3XA 3F4CA 5AC6A 4MF4A 2NVDA 1XG3A 3G0UA 3GO2A 1QPOA 4NZFA 3EAUA 2OX1A 3AS3A 4J28A 2POTA 3TN6A 2Z29A 1EGZA 3E2SA 1GEQA 4AZ7A 3K5XA 3MANA 3TR2A 2DY3A 1K8ZA 5FF3A 4QR6A 1M1BA 1ODZA 3TTSA 3URQA 1AMYA 4HD5A 4C7GA 3VIFA 4HCHA 5F1UA 1AL7A 4PMNA 1MXGA 4E2OA 2J75A 4GG9A 3BSMA 1JR1A 1J10A 3ANYA 3B4UA 1Q6CA 4K7VA 4JCLA 1XKJA 4IIFA 4OV9A 4IX0A 2PDMA 1PIGA 2JIWA 3L4UA 3M6DA 3W7KA 4B92A 3I10A 1JDFA 4N9BA 1AUSL 1HF6A 1DIEA 1PYMA 1YX1A 4FOUA 2J9YA 4BWLC 3F4WA 3IWPA 1MQRA 3ZOAA 2I9UA 3PZNA 3HFTA 4HPGA 3W6MA 1ZALA 1NDYA 2ZE3A 1E4LA 1GYNA 2VXNA 3NDZA 3S1WA 4UCGA 2GL5A 3UJEA 4S23A 4LS0A 1V0LA 3LRMA 4CQ8A 2Y62A 3TYZA 2DGAA 4DJFC 3N17A 1IWPA 3UXDA 5F2LA 3NGFA 2W79A 3CYJA 3RYSA 4LF2A 2CITA 1R3RA 3ZLHA 4GX8A 2XWEA 4AUBA 2NT0A 3ISIX 4FSAA 3H2EA 4BY3A 2VRQA 3BMXA 2O9TA 2VWSA 1JYVA 3LGEA 3TX9A 1WOAA 4OBTA 1ONRA 2QW5A 1GZGA 1FDZA 3QTPA 1QATA 1W37A 5A6SA 2XIJA 3W82A 3EOLA 4CCCA 4F40A 3ABOA 3IAPA 3N9KA 2P50A 2V30A 4MFEA 3OIHA 4B16A 3B8UA 1EZWA 4Q8NA 3W6LA 2GVLA 3JS3A 1QW9A 1YTEA 4NNBA 1UH3A 3GFZA 4IX2A 4KGJA 4GYPA 3MA8A 3INPA 3ZVIA 5A8OA 5FJOA 4U2ZA 2E67A 2V0TA 1XDLA 3V1HA 4H9UA 2RDXA 1P4CA 1TTPA 2XVPA 3TDFA 1SYTA 3KCJA 4DXXA 2ISDA 1Q85A 5CEWA 4HZ6A 5AZ1A 3KAOA 4REQA 3AALA 4EAMA 1VEMA 2P8CA 1TX0A 3AICA 4Z1AA 1FTXA 3EB4A 4IIHA 4QSFA 4H8UA 2XGZA 4DXKA 2B7NA 1G4EA 3GNOA 3AUJA 4JX4A 4AZIA 3A12A 1XD1A 3ABXA 5C9WA 3EX2A 3SW6A 2GOUA 2GGJA 3DKLA 4O4VA 3SCOA 3OG2A 1IHIA 2GK1A 4EXBA 1YDYA 3M16A 1CXHA 3CAKA 3EOEA 2GDVA 4BWLA 3L2MA 4TOQA 4JBRA 1KM5A 4X2PA 3UCQA 3W0KA 6A3HA 2GFTA 4JS3A 4JHMA 1OIMA 4AZHA 2QHAA 1TWZA 2RFGA 3SCNA 1VFUA 5IDIA 3NPVA 2BMBA 2ZX5A 4G5DA 3NZQA 5LIUX 3NNTA 4FK9A 2X2GA 2FZ9A 2PTDA 3GRIA 4RNJA 3AS1A 3BURA 1XC4A 2QV4A 4NZ4A 5I3GA 4HHMA 4U31A 1UC5A 3HPZA 4KEVA 2VDGA 2J7BA 4FOKA 5I3JA 4A05A 4NT0A 4H2HA 2BWGA 2VFDA 1W1VA 3RXZA 5H1WA 1IEWA 5FI8A 1AJ2A 3TJXA 4LUIA 1VAHA 2FTWA 4MY9A 3EX6A 4ZOAA 1XBVA 5JIWA 3CC1A 2EJ1A 4MMWA 1P0BA 4LW7A 1UMLA 3I68A 1H49A 4IIDA 1KRBC 1L8NA 5E9AA 5GVJA 2PDHA 4QJ4B 4X0VA 1U22A 2Y61A 5AN7A 1KKRA 1LWJA 1TPC1 3A21A 3WK1A 1LYXA 4DB7A 4LNYA 2J74A 2HNEA 1H62A 2WVVB 3M47A 1GW9A 1JXKA 5LA1A 2FTYA 4UZUA 6XIMA 1R9YA 4PMOA 2XYLA 3MO7A 5KEZA 3LXAA 3WDHA 3QV8A 3Q37A 1LOSA 1V02A 2Z1KA 3A5VA 3QH2A 4FF7A 2RJGA 3RHGA 3UESA 1W3IA 3RF9A 1RY0A 2XN1A 3OG3A 4WJEA 2WV8A 1KM1A 3CIXA 3SN1A 3GBEA 1POKA 2PFHA 4LB4A 2PCQA 3OVPA 2ZRVA 4HHPA 2NLIA 3GVRA 3FEQA 3UVAA 3UZYA 5DF0A 1GCYA 2WLZA 2ISVA 1JG9A 4FO4A 4RV3A 3E49A 3ARYA 3DFSA 2I5IA 3VZYA 3TZNA 3GKAA 3KXQA 2VWTA 1DBTA 4WD0A 4DELA 2QCDB 1E0WA 3UG5A 3VILA 3QV7A 3THAA 3U2CA 4IP7A 1UD6A 1XRTA 3JZEA 1XBZA 4KWVA 4IICA 3G1XA 2WK2A 1BTMA 3OO2A 1L6WA 1WXYA 4C5ZA 3CNYA 2UWFA 1TMLA 4DUVA 1J6PA 1NOUA 1B54A 3RCMA 1PKYA 3I7QA 4HOWA 3ABZA 3DHDA 2C8NA 5C5YA 4ECLA 1DIKA 2POZA 4CN4A 3MVIA 1XIFA 2P88A 2QUVA 2QCNA 2HVOA 1E4IA 5CZ0A 3FJ4A 3B8VA 2ABAA 3WQFA 1E71M 3E5PA 5HJXA 2ALDA 4DIAA 3A4JA 1JNEA 4IL0A 1MXDA 3NSNA 1OC5A 4A8LA 1FWRA 4PUEA 3L4YA 3GTXA 3DCPA 4GD0A 3AXIA 4GKLA 1S46A 3GR4A 1B90A 5LYRA 4I5UA 3PHAA 2ZXAA 3B8SA 3WJXA 2YFNA 1G69A 3GTHA 2NUYA 4WXYA 1LQ0A 5H8MA 3WBXA 1FH9A 4H6KA 1MRAA 4IPLA 5E0KA 5IFPA 5CPNA 1PVNA 3KBJA 4WXZA 1XG4A 4GIEA 2Z26A 5D9NA 3L66A 3KLKA 3R8RA 3AMKA 3CJPA 3F5LA 3BXWA 4GVIA 2V67A 4E4PA 5J8LA 3U2EA 4GABA 5A3HA 4A3YA 4KF1A 4ML9A 5DELA 1H5YA 1XRSA 5MKGB 2DZUA 2ZZ1A 3AXKA 3G1VA 3C0SA 4H04A 4AY1A 2VX5A 4ATWA 1OBAA 4HZ8A 2VEFA 2YCEA 3TA6A 1WV2A 3D5HA 4D1IA 4QX4A 1JPMA 3BLOA 2AQVA 5C71A 1WDPA 1UMYA 2PP0A 5H8UA 3DFOA 2YLAA 3THUA 1E6RA 4R3UA 1LZOA 2X09A 1TE6A 5HOSA 3BOXA 1UWQA 3VNKA 1C8XA 2XINA 3U4AA 1UZ1A 5TAOA 3WEOA 3NQBA 1M41A 6XIAA 4BF9A 4XD6A 2CLPA 3ZWTA 1U33A 2D0HA 3MQTA 3W2MA 4MNJA 2DSVA 3T81A 3CK5A 4Z0SA 3AXMA 3VIHA 1KM6A 3QPYA 1KM4A 2J7DA 3NQ7A 1MUWA 5JH1A 1JCJA 2DEPA 4IISA 3N2TA 4RE3A 2JFEX 2OT1A 4ZQNA 4LUYA 4LBSA 2TMDA 3QHMA 1XC6A 3VZXA 5C9ZA 3SY8A 4MNKA 3D3AA 4D6EA 4W7WA 1E6ZA 3QPEA 1EYWA 3CEUA 3GSMA 1VGAA 4XD3A 1UZDA 4C6OA 2XM1A 6TIMA 4DO4A 3LG3A 2WMGA 4HHLA 5G5IA 4DXVA 4PBGA 1FY6A 2RDWA 4HYWA 3RO6A 3CV2A 3KX6A 3KDNA 1R7AA 1UQZA 3E6EA 3IIZA 2CIPA 2VL4A 3JZUA 4AX7A 3UR7A 4J3VA 2VEMA 2OSWA 3CBWA 2ZIDA 2A79A 1A0CA 4HMEA 3ZJ6A 1IT7A 5JQ9A 5E1QA 1VFMA 3M41A 4GYFA 1A3WA 1TZZA 5ABTA 4HIBA 1E4NA 1XLFA 1EUNA 3B97A 3PBMA 3WLIA 1F07A 1A5MC 5LHEA 3MSGA 4JTLA 1A5SA 5FF0A 1US2A 4DBWA 1YE4A 2QJMA 4AIOA 3VGHA 2D3NA 4H9ZA 1THFD 3GVWA 1X98A 5A6TC 1GONA 4GUGA 4Q4PA 4UOJA 1XLDA 3K1GA 1AQFA 3WNKA 4I8YA 1SW7A 4RUBA 1QAPA 1SZNA 3WLSA 3T8QA 2E8YA 1E9IA 1SQ7A 1KBKA 1KD0A 1Z69A 3DXIA 4L9YA 2GQ3A 1LRQA 1VFLA 2TRSA 3W83A 3VIIA 2Y1HA 3GDBA 2ZC8A 1TV7A 3IGSA 3CZJA 1UIOA 3RR1A 3CHEA 3GNDA 2OLHA 1BGAA 4H7ZA 3AIBA 1Q2SA 3U7BA 3TC7A 4S3GA 1TYGA 4MWAD 3LLXA 2AQOA 3SCTA 3B0PA 3AZSA 2Z1SA 2Q8LA 4LXFA 2QPXA 4QGCA 2PD9A 2QJJA 2DDXA 4LVFA 3MPGA 1YPFA 3BLLA 5GJMA 3B03A 1Q6DA 3DG3A 2A3HA 1GOOA 4WCJA 4AD4A 1W5PA 1QK0A 3GK0A 1B3VA 3B8TA 3WLJA 4A3RA 2ZRWA 2ZRXA 3M0VA 4PH6A 5HUPA 2WSQA 3VXGA 4QQ3A 5T9BG 4C6JA 3AYVA 1VCGA 2R94A 3RM9A 3H4WA 1VBRA 3A64A 1EWDA 3S9YA 3V0UA 4G7EA 3OZPA 1KKOA 4JYDA 3Q65A 4S2BA 2J47A 5HPCA 1DWAM 5D38A 4XZWA 3ARTA 1KRAC 3UXIA 1Q6RA 1ZRQA 4NJJA 1PHWA 1GOMA 2JGQA 3PVFA 1JD9A 1CW2A 2V63A 5IBXC 3BAKA 3ANUA 3CQKA 2FMNA 2UV8G 1D8CA 4PMUA 2WMFA 3WH6A 1CGVA 1OWQA 3MI2A 1E5JA 1ISXA 2E6DA 3DG6A 1IGSA 2R1PA 2BB0A 4ZO9A 4QLJA 4YMZA 4E3TA 5A2CA 2WJDA 1MVYA 5HNUA 3M0JA 4FLSA 3L65A 3T7VA 3T6CA 2VM8A 4K8HA 5JBFA 2ZX6A 3R0DA 4V1YA 4LUTA 1H1YA 1QXLA 3UCCA 3B8DA 2X0HA 3SFWA 3EBVA 4KEZA 1BG9A 4B5SA 2QIWA 1UD4A 2XSBA 2A1YA 1CCWB 2IKJA 1Y5VA 4LJ3A 4UFMA 4RR4A 5KINA 1KBJA 4UMAA 1QU4A 1TR1A 3SN4A 3CUIA 4U5IA 3W75A 4LCQA 5JXQA 4CNOA 1K1DA 3TJLA 1HO4A 2B7PA 4JXCA 1SJBA 3AS2A 1AW2A 1KLZA 2J8TA 4UQBA 3OOQA 3PFMA 3SUWA 1RUSA 2PWHA 3W86A 1E9LA 3QV6A 1OZQA 3WJYA 4CNTA 1X6LA 3SGGA 3LHWA 2VURA 3W1XA 1JULA 3NXLA 4QE5A 4JIPA 1ZBWA 3RRXA 2IKGA 3PM6A 3NPWA 2ZZ7A 1R3VA 4EXAA 2C6QA 3P62A 4RX0A 2UZ9A 3IEBA 1ZBCA 4AMAA 1U1UA 4FALA 3B9OA 3T9PA 4PUJA 2XDFA 5M3WA 5BOOA 1D3GA 1X97A 3FAWA 2A3EA 4IJRA 1DXEA 5JH2A 3FJ6A 3T1GA 3HMCA 2DW6A 4J27A 1K9FA 2X1SA 1I60A 1RLDA 1EO7A 1UOKA 3R2GA 3ONBA 1Q3NA 2R1MA 2PRHA 3CL7A 3ARXA 5FESA 2EQDA 2BY0A 4K39A 4UTWC 3XISA 3M7WA 1KWGA 3NQGA 1J2WA 4NL1A 1AW1A 3DUGA 2BZNA 3REQA 4D6JA 1F7BA 5IBXA 1SM9A 3BCFA 2V69A 3FJLA 4FLOA 1AODA 7XIMA 2DZWA 1HJWA 3SY1A 3VOFA 3ZO9A 3P14A 1B3XA 1UC4A 3ITGA 2FTPA 4R85A 4DAIA 2FGZA 2QLYA 1V7AA 4UQDA 4MKVA 1QWKA 5C9RA 1W3JA 3W27A 3BTNA 3WDIA 2R1LA 3B04A 3UJRA 2F2KA 2Z6IA 3RITA 1FDJA 5HJLA 4TX8A 5F2IA 3NL5A 3VGFA 1M9HA 3TTYA 1EDQA 4N9CA 5IXEA 3ICJA 3P8JA 5AC8A 3G6MA 3CQHA 1UA3A 3ATZA 4UFHA 2CYGA 2Y0FA 1EIXA 2R6OA 5I5RA 3F1QA 5HQLA 2PLMA 2VX4A 3CV6A 4MLJA 1L9WA 3W7LA 4DWSD 4PTWA 4Y9MA 3W84A 2QPSA 2CBJA 2QCHA 1KGWA 5BOFA 1AQHA 3BGAA 3PWIA 1A4MA 4YS1A 2BS9A 4DLMA 3QKEA 4WRHA 1UP0A 7TIMA 1AZ2A 5CG7A 4P8WA 1MW0A 1BEUA 2Y4SA 2BXZA 5AYYA 1UYQA 3IJIA 1GOIA 1KCZA 1ZSXA 4J1OA 3R10A 3CMGA 4I9TA 3FXGA 2YDSA 1VLWA 1A4LA 4Z2KA 5XIAA 2QVNA 3R94A 2X7VA 4A6GA 4CNNA 2C79A 4UQCA 1U30A 1H7PA 1ZJAA 2B31A 3CLWA 5I06A 4L4PA 1J9YA 3VKAA 4ZQRA 1BPLB 1LUCB 3L2LA 3E0FA 4PUNA 3IGXA 4IP5A 3HMJG 1RZMA 1X7IA 3L4VA 2OU4A 1LWHA 2G5WA 8XIMA 1PDZA 2Y7FA 4Q6JA 3NPUA 5MHBA 1TUFA 1Q4WA 4NXKA 5DCBA 3TW9A 1XICA 1K7XA 2QDGA 1BG4A 1T8QA 2FJKA 1TPB1 5CLTA 3C6CA 5CAKA 2ZZ2A 4DYKA 1GKRA 2P0OA 1Z7AA 1EO5A 1R3SA 3HGJA 2BXYA 5DMYA 3S3GA 3W7GA 1UKOA 1V7YA 4LB3A 4S1FA 3QKZA 5DRIA 3K8MA 4PL2A 2JALA 3G2GA 3M0LA 1TJRA 4G2DA 3AZTA 4ZGYA 2VKZG 1G4SA 4TQTA 2HK0A 4ZEPA 4ZODA 3N18A 3L4ZA 4KRZA 1K4HA 4HPHA 3S1GA 4LYKA 4TV5A 3BJFA 4JZ5A 4HK7A 4YCOA 3NDOA 3USZA 1B3WA 3G1FA 3VOJA 3WQEA 4W87A 2NQZA 1ZPTA 1NOWA 2VDIA 4JIRA 3WF4A 3FV9A 7REQB 3S8HA 2HK1A 2VP8A 4PUDA 4WKAA 5AB3A 3GC5A 5A2BA 2V3GA 2FFIA 1XD0A 4HMNA 1J79A 3TTEA 1ZTVA 1XIEA 1TPDA 5E9XA 1J12A 3GIPA 4Z2LA 3PN8A 2J62A 3BO9A 4J5NA 4G6CA 4MGGA 4FX6M 4P7LA 2HVNA 4JDYA 3W9ZA 2J8FA 3GXNA 4Q7NA 4RZ4A 2DSUA 2WW5A 1LWIA 1UJPA 2ZX7A 2XFYA 1YYAA 1MW3A 4Y96A 1OK6A 4LVDA 4WDUA 4Z08A 3I65A 4ZXLA 4OJYA 4F79A 2G3NA 3UWEA 1LQAA 4QS5A 4IG2A 2DT3A 3HBLA 2DT1A 4QBXA 3ITXA 1A0EA 5CPLA 3KRZA 1A5CA 4DUOA 1E6SM 2ON3A 5FIPA 1ZL1A 4IGMA 1EX1A 1SMDA 3CTTA 4IUOA 1OG6A 4GXPA 4KQNA 3HQPA 4WGXA 2OXNA 4WY0F 4US6A 4BI5A 1GZJA 4GIRA 4XZNX 1NM9A 3FIGA 3A23A 1FDYA 2NX3A 1TPUA 4Q8PA 3E3HA 1DXIA 2C0AA 1W3KA 1H51A 1TIMA 5LIWX 4H2CA 1S5MA 4LGXA 2V5KA 4BJHA 4L4LA 4ZO8A 4C6EA 4PMYA 2GGEA 2YA0A 5LZLA 3FGCA 4GUJA 3OVRA 2YCLA 2NQHA 4W8AA 2VGBA 4XKYB 4AYGA 2XH2A 2J79A 1Q63A 2YB1A 2O0TA 5CGMA 1IE7C 3N13A 2CWXA 2H6RA 1KGUA 1OF8A 4DNMA 4LS1A 3WLLA 1IGWA 1H0IA 3WDPP 1QR7A 3LBMA 2B0MA 4YPJA 3IRDA 3V75A 3MC5A 4HT3A 1EJUC 5FA5A 3VPLA 3KOYA 1SPQA 1E51A 2FLIA 5LNSA 1FCVA 1QBAA 3NL3A 1LOQA 4J3TA 4ZOEA 4KIRA 5FL1A 3UR8A 5G4HC 1E73M 1XINA 2WQDA 4W7VA 4M51A 1I6NA 3W1NA 2OCZA 2E1WA 2F6XA 1UWSA 5BMXA 2EPMX 2H3BA 2G4JA 3GQYA 1E5NA 1FA2A 4PA8A 4GQ0A 4LY8A 2ICSA 3ZR6A 1OGBA 1JF5A 1CLVA 4A35A 5AC5A 2NUWA 4HKPA 5I03A 2J27A 3CZLA 4PZVA 4GACA 1R47A 2FPVA 3LM3A 3O3RA 4YHGA 1DJGA 4NSBA 3D6NA 3IIOA 3WENA 3NQ8A 3FVMA 4U4MA 1OFRA 3QHOA 4I5XA 2PODA 4M24A 2NW0A 1TKKA 1I9CB 3ZT6A 3W1PA 4MDOA 3BW2A 4RDZA 3VD9A 4OUEA 3WLHA 1W1IE 1T41A 3IIVA 1O1HA 1V4YA 4O50A 1VH7A 1XBXA 2WB5A 1E43A 2VGIA 3VIPA 2CKSA 2NX1A 2OTDA 2X7WA 3N34A 3GYCA 3WMCA 2BY3A 3WG6A 5HQEA 2RGLA 4U3CA 4GZJA 4Q7IA 3CUZA 4JYFA 1FH8A 3KOXA 5D32A 2WSRA 1TQXA 1UKTA 4K38A 3PZVA 1V79A 1KTBA 4CEXC 2Y5JA 2XUCA 3CMFA 2DZVA 4PTMA 2BV9A 1WUEA 1YE6A 1YMYA 5DLCA 3H24A 3W1MA 4B9YA 5IHSA 1YNQA 3EPMA 3GDMA 2NVCA 4YCPA 3QY6A 2OSXA 1VHNA 3K8KA 1DQWA 4P61A 1H09A 4LAOA 3VDGA 4B5VA 3W00A 2H9AA 4DEFA 3H2CA 3EPOA 2INEA 2V5DA 1JYWA 3WF1A 1CGYA 3IJ9A 3HGSA 2NXHA 6ENLA 1LG2A 4Q8UA 1TO3A 1UR3M 4HYVA 2JKAA 3DDMA 1YIXA 4Z2JA 1UQYA 7A3HA 4HNLA 1J0KA 9XIMA 5D30A 1F8MA 1VPXA 3EX4A 1C7TA 3UG3A 1P1XA 3ARUA 4ZFMA 2H8XA 2OOGA 3LI0A 2QUNA 2YA2A 2D2HA 9XIAA 4ZQPA 2HROA 1XLEA 3A9IA 1PWLA 2EPLX 3T09A 2BOGX 1HP5A 1KQYA 1RP8A 1UD5A 3I6RA 1O6IA 5AC7A 4OQVA 1QHZA 3FYOA 3CLMA 3GFYA 2GWGA 3B8WA 3AAMA 3VKDA 1PX8A 2AMXA 1FWWA 4UBPC 4N02A 3TR9A 1E72M 1Q8AA 1ZU8A 4LCSA 4HJFA 5FACA 4AB4A 3VKJA 2QJHA 3V0SA 1OY0A 3R13A 2YZRA 2NWRA 4FXSA 3N6JA 1EDTA 4IHCA 3GUGA 3O7UA 3UEQA 2J77A 2V81A 3GNPA 4OIFA 1G01A 1HJUA 3DG7A 4HNTA 3W7HA 4W9TA 5LGZA 3TN5A 2I17A 4JOMA 4M6UA 2NV9A 1TA3A 2GDUA 3R8HA 1FWEC 2DZTA 1VJIA 1JUBA 1ZGDA 4U28A 3SIMA 3WUEA 2GVGA 3CUGA 3ES8A 1G7VA 4M3PA 1GQNA 1JCLA 3IUHA 4UR7A 1CLXA 4H8VA 1M5WA 3NOEA 3POCA 4EK7A 1EPXA 4QDWA 2QR6A 2NLYA 3IUIA 1KNWA 4FX7A 2FZMA 2W5FA 1SO6A 4QDMA 3W23A 1C8QA 3RMJA 3WBYA 3ALGA 4L1GA 2XN2A 4CU6A 1V0KA 1XDMA 1LBMA 1W32A 1TVLA 1DJQA 3QGVA 3BG3A 1PJ9A 4WF7A 2HE8A 1FP8A 3WKZA 2SFPA 3G1DA 5G1MA 3P60A 3EKLA 1HX0A 2Y89A 1I75A 2JQXA 3VDBA 4H3DA 1GOKA 3ARZA 4PB3A 5K4XA 2PDJA 1YBQA 3UA3A 8CGTA 5HR7A 3CO8A 1R0MA 3CZEA 1QPQA 1QWGA 3ONCA 3AROA 4F8XA 1UH2A 1HKWA 1AJ0A 3L2IA 1N8IA 1POJA 1YRRA 2W61A 7CGTA 3C2FA 5EBUA 1EOKA 3VUPA 4XZMX 3CL6A 3HM7A 4H9MA 1WZAA 2V3DA 4V28A 5XIMA 3BSGA 2FH8A 2PBOA 2GDQA 3WJWA 2DZPA 1MI3A 3GTIA 4N6EA 4IPJA 3TYCA 2D24A 1VB9A 1IXPA 4PMVA 4IGNA 2WZHA 4E0CA 4ZE5A 3GH5A 3WQ8A 3M0YA 1EQPA 1RJPA 1W1PA 5E6ZA 2FGBA 4QNEA 4HSHA 3VKBA 4AIEA 2GVYA 1XF0A 4CN1A 4PRTA 4Q6XA 4TX6A 3C52A 4EWJA 1WKYA 3QHNA 3TTOA 2VFFA 1UWRA 3PF3A 3V4BA 4P7OA 2YXOA 4AEOA 1E1CA 1TTQA 5EMUA 2J7FA 1Q6LA 3WD3A 1XWYA 3M7SA 3H12A 3QSTA 4NXSA 4DJDC 4Z1YA 1DHPA 3W53A 1XSKA 1NF7A 1GOXA 1V6TA 1OZMA 1WOBA 3BE7A 3A3HA 3QR1A 3TJIA 3PWAA 1AQMA 4GCAA 3BLIA 3U2ZA 2PGEA 3U4FA 4AZCA 2HXTA 2OFJA 3FA5A 4AZBA 2WZTA 1CIUA 3KL3A 4DWDA 4R53A 1NELA 2O9PA 3LRKA 1KBBA 4FNQA 3S46A 1J5TA 1PTGA 3QRHA 3KTCA 2XTKA 1TV2A 2G3JA 3BJTA 3DERA 1P5BA 3SCUA 3DEQA 2GQ9A 3AHYA 4P5UA 1PS9A 2VZSA 5AHNA 4IG2B 3NZ1A 1GNXA 5HUOA 1UPMB 2VZVA 1H41A 2PDXA 3N14A 2NQJA 4C60A 1LDCA 1RBOB 5LNRA 1TPFA 5T26A 4F0MA 2JE8A 3NCOA 3MDUA 5I0DA 1K9TA 3EWUA 4JQ4A 5XINA 4DHGA 3IPWA 3BWWA 2PURA 4GY1A 3UY7A 3LTYA 4E2VA 1ME9A 2J8GA 3SRKA 3EX1A 1FHVA 4GYKA 4MZ1A 5JUVA 3HPSA 2D0FA 3CAVA 1V3IA 5I77A 1DYSA 1ITQA 1S5VA 2PUZA 6CGTA 3UT0A 4U33A 2YOCA 3EMQA 3KWSA 4XTDA 4E8GA 5A6BA 4YIWA 4GI9A 4ACZB 5I02A 1F76A 3HO8A 2IQTA 1UWTA 3VGEA 1GK8A 2EGZA 3L5AA 4MNMA 3AQUA 1OX4A 4S3KA 4AF0B 1YTKA 3FGCB 2XH7A 1R9XA 4H7CA 1WDWA 1U1HA 3G1RA 3ZZ1A 5DN1A 2QDDA 1J5SA 4TUFA 4FR1A 1RQEA 2A6LA 3PZIA 3RM8A 3CB3A 3PSWA 4H01A 2VVNA 4C1NA 3AMCA 4H9XA 3W88A 1BTCA 4L80A 3U48A 4JTTA 1BGGA 3ZT5A 4F48A 2TYSA 1GVYA 3GBDA 1E1FA 3UPBA 3H4XA 3WN6A 2I5QA 4KFPA 4DJDA 3ZWSA 3TCSA 4FXRA 4AIBA 2HSAA 3AIRA 4V33A 4EXQA 4TVCA 4BQ2A 4AU0A 3MJYA 1BYAA 3UFYA 1S2UA 4FS9A 3R89A 1KGXA 3U3HA 5HWMA 2Y8UA 4S3BA 3WQDA 4X9SA 5LSMA 1TE1A 3FYYA 1A53A 2AGTA 1MEHA 4RDVA 1G67A 5I24A 1JDCA 4FXFA 3AIWA 1NQKA 4MPKA 4CLMA 1NF0A 4RCXA 4L1XA 2Z6JA 2NV1A 2WMHA 2OB3A 4GY0A 2DT2A 4MPQA 2YX0A 1RY8A 4JTCA 4RXFA 3SCWA 3PTDA 3NOYA 2Q8ZA 1GVOA 3SRHA 2NXGA 1H7NA 1SFLA 3P61A 4XKMA 2CLFA 2CBUA 3MI6A 3N11A 2OOFA 5DT7A 2Q8XA 1XQLA 5TQLA 1JNDA 5K3VA 3MBDA 3N6HA 1HP4A 5EPDA 3DC8A 1VLIA 1EUAA 3LGDA 3OHMB 1OFQA 1AJZA 3QQ0A 1UD2A 4O14A 4MUZA 1H1NA 2VRJA 4O52A 5HWNA 2EJAA 4B9ZA 3PG9A 5G2WA 2ZFAA 1BKSA 3M0IA 1TWSA 2D2OA 2ZADA 3CT2A 4PMZA 1SW0A 1G5AA 1JZ4A 3T2OA 2ZUMA 2VC5A 2W63A 2WHKA 4UFJA 4AIUA 1JCNA 4RKAA 2H9AB 4K3ZA 3TNOA 1EL3A 1H60A 4KKXA 3FSTA 4JYEA 3IK4A 3L9CA 1ZJIA 2PEVA 5HMDA 5DFAA 2DSWA 3O0FA 3L5LA 3C0QA 2GGIA 5BZAA 3GM8A 3AFBA 4ACYA 1XLIA 4FOJA 4HA4A 2RUSA 1TIWA 1F05A 5CGTA 5FD0A 1UUMA 2CW6A 3O07A 1NJJA 2E9MA 2Z28A 1HNYA 2D2GA 4S3FA 3GAYA 1TVNA 5M1TA 3CU2A 4DJEC 4JNYA 1BVNP 4HTYA 2IW0A 5BWFA 1MRQA 1WCGA 8TIMA 3UXAA 5A95A 2ZICA 3CT7A 3KCOA 2PDQA 5CZSA 3AISA 1T7LA 3QTGA 3OLDA 5KZDA 1W5MA 4NAEA 2GJXA 4Q8WA 3A4XA 3W7CA 3LEPA 3CQ0A 1EEPA 1S39A 4NUWA 3T78A 1PWMA 3W3OA 3S6OA 4NZJA 2BVWA 2PWEA 1V93A 3NURA 4QEEA 5BRPA 4TTGA 2PWGA 4Y7EA 3AHZA 4XB3A 4N2YA 5GQBA 3B0XA 3W71A 5T9CE 4RNFA 4ADTA 3QC0A 3FN9A 2ACSA 1UWAA 3R1ZA 4O1DA 4PUKA 1R3QA 3L0GA 4RPPA 1OX6A 4ZFCA 2Z00A 4K6AA 1XIHA 2OWCA 1W0MA 3P8IA 4OHQA 3EWCA 3RNDA 2WVTA 4IH3A 3MUCA 4GQQA 3LTSA 2WLYA 3VNIA 3N3MA 3PUGA 3OLGA 2OR2A 4ZVJA 1M53A 3MI3A 4HNUA 2PLCA 4K7YA 4L1WA 2DIEA 1OCNA 1P7TA 4YVPA 4V2XA 2W6RA 2ISFA 5DCEA 2V6AA 1OFBA 1F3WA 2WBGA 3MZNA 1ZS2A 5RUBA 1CB2A 1BSLA 2D23A 4XD4A 1XUUA 4IL2A 1FP9A 3NQAA 3PNZA 4N9DA 3WBAA 3MP4A 3PAJA 5DBUA 3OEXA 3WMBA 3IRSA 2PWUA 3OBEA 2PS2A 3B9EA 2V82A 4ZBCA 1DTUA 2RDTA 4X2RA 5LNUA 2FMOA 4BR1A 1UR9A 3CL8A 3CXOA 4MHBA 2O4QA 1ZLPA 4P7NA 1YXCA 5CLWA 3VX1A 4F0KA 4DRSA 2JK2A 1O5XA 4O57A 1PZ2A 3SEPA 5LKYA 2FVKA 2H8ZA 2WMIA 1W5QA 3CTLA 5K2ZA 2YL6A 2E4TA 3WCZA 3IARA 4H6QA 3QZEA 4B91A 2HBVA 4PCTA 3H7UA 3SRFA 4DJEA 4Z42C 3MU7A 3STCA 4NNCA 4IM4A 1J11A 4QCFA 4KRTA 3T0TA 1FH7A 3CV7A 2C1HA 1HG3A 3VMPA 2OLAA 1C91A 4B5XA 1QI5A 2ZA2A 1OADA 1MDLA 1XGEA 2VI0A 3KBVA 4PULA 4H7VA 3MUAA 4QAIA 1ME7A 3WLPA 3VGDA 2O55A 1HTIA 1W8SA 3SADA 3V0TA 1TZ9A 2BSLA 4QJ1A 5EKYA 2D22A 2FHBA 4UTUA 5GNXA 1QPRA 3NQVA 4R34A 1E1CB 2VX6A 2ZDSA 2OYLA 3RMEA 4B2DD 4DVOA 4XSMA 4GJIA 5KZ6A 1ISWA 2XGBA 2OZTA 4I5RA 3W1RA 1FWGC 5BROA 3WMLA 1B31A 5AOUA 3NQ2A 3QOKA 1TFVA 3EPNA 1AH3A 1W3HA 3LBOA 1XLAA 3TLLA 4JFSA 4C6IA 2O4MA 3NM3A 2PWVA 4JX5A 2EHHA 1LL6A 2BVDA 3PPFA 3GX9A 4AZCB 4IMFA 5EYWA 2VFGA 4XG1A 1JGMA 2X1RA 2YDQA 1E9ZB 3UPWA 1KR1A 3EGJA 4LU0A 5AHIA 3IJ8A 4O17A 4JKMA 1K8XA 3NYZA 4FI4A 1R3WA 5CZJA 3U7VA 4TO8A 4O12A 1C8YA 3A9BA 2V5CA 4L65A 1K9EA 3VCRA 4UZSA 2G3FA 4O8RA 1FXQA 1XLHA 1JCXA 3SN0A 3BSHA 2WXDM 1R46A 2CKRA 4PMDA 4GUFA 1JI2A 2JKPA 1TCMA 2Y2WA 5A2AA 4A22A 4XBSA 5EFDA 2FZNA 4US5D 5I78A 4Q8OA 2BHUA 4WVXA 3RR4A 4CD7A 4O1FA 4LBRA 2WWCA 4UTJA 1TWDA 4QITA 1IZJA 2VGFA 2EEXA 4HN8A 4CGTA 4WSKA 3VO0A 3B0YA 1WQ5A 3B05A 3QBUA 3SUTA 3HZ3A 2ATMA 5D2XA 1JDDA 1JRCA 3C61A 1B4KA 4L9XA 4JICA 4EACA 1S1RA 3PZUA 4MWAE 3IGHX 3IGUA 5F1VA 2J7EA 4CN6A 3A22A 4EF9A 1B2YA 4NZ5A 3NSMA 2HE5A 3WNLA 2HRWA 3M5VA 4LT9A 3PZ9A 3WIJA 5D9MA 1ESWA 4IPNB 3MSDA 1F3EA 1XI3A 4I9JA 4X63A 4U2YA 4WKHA 3D47A 2EAWA 4GO9A 3AXXA 2B81A 3VOIA 3O06A 1E70M 1UR0A 1I2OA 3CWHA 4KEMA 4MOZA 3BLFA 5FAGA 4PFMA 1ONEA 5HWJA 2J4GA 4ZO6A 1CPUA 4JY8A 1IQ8A 2ESCA 3FX4A 5F4SA 4C6MA 3JRKA 2QNEA 1K8YA 4M81A 4YL2A 1RK5A 4ROQA 4XAYA 3LCLA 3ZT7A 3DYPA 2I57A 1C7SA 3THQA 1SO5A 4Q4MA 1F73A 2EKGA 1KBIA 3TVAA 4PGLA 5I3KA 3BLDA 5LA2A 2BASA 2AGKA 4PR4A 3E38A 2Z27A 3W7DA 1XISA 1S2VA 4YVVA 2FB2A 2G96A 2ZKMX 3NR0A 1LRNA 3G22A 3BGJA 2YA1A 3EA2A 1XCXA 3KP1A 3MY9A 4KWUA 5EMLA 1RBLA 1G0CA 5HA7A 1ISYA 3I4KA 1VIZA 3KTXA 2E5DA 3I7RA 2ZUNA 4GPNA 1MSSA 2VOMA 4JFWA 5TNVA 1S5TA 1P0DA 3LPOA 4JTUA 3DU0A 3PBYA 5I00A 2ZRUA 2WBKA 3IUDA 2JF6A 2ACQA 3OVQA 2KAUC 3M6YA 1DJNA 1EGVA 1UJQA 3PR2A 2PP1A 1X6NA 2G97A 4JL2A 3HJZA 1D3CA 3N12A 4EWND 1BXBA 4QNWA 4NQ1A 1RCXB 2FB3A 4IMCA 1V08A 2FVMA 3WLQA 4O1CA 1SZEA 4ZXOA 4MZ8A 1V0MA 4M6PA 4NRRA 4A4AA 5EMYA 1WP6A 1VFHA 1HO1A 1L0PA 1R7OA 1GVEA 2Y7EA 1W6TA 2BOEX 2C1IA 2WVVA 1DIDA 5IFTA 2VCCA 1I0DA 2I1OA 5H6HA 3H22A 4B5NA 4C5YA 1LCOA 1Y5WA 2XVLA 4O0ZA 3I7SA 5C2CA 4HA3A 1Y8BA 4O1BA 4IMEA 1H7WA 1A5LC 3OTRA 2V5LA 3BICA 5AKQA 4PEKA 4XX6A 4Q4KA 3HB9A 4O1AA 1E6PA 1S2WA 4QG9A 1MQPA 5HNTA 3VNLA 4PRRA 2ZRYA 3L23A 3TK7A 3A24A 1QFEA 1RP9A 4B5TA 1KC7A 3DI1A 3NZRA 3EDFA 3KE0A 3UWWA 1JZ5A 1OABA 1IF2A 2HS6A 2R14A 4JTHA 4GZ7A 1XFCA 2QJGA 1P6WA 4JTFA 4O1EA 4P7QA 2C91A 1B1YA 1W1B1 2HS8A 1YPIA 1O1ZA 3TAOA 1SVDA 2QCDA 1AW5A 4QEHA 4LC8A 3PUOA 3CM4A 3CEPA 4MJ4A 4H6EA 3UG4A 3TSBA 3EWBX 4JHOA 1KFWA 1ADOA 1Q6GA 2A7NA 3GG7A 3OA5A 1FWIC 1EBHA 4L56A 1RBAA 1S38A 1ZQ5A 4Q8VA 4URIA 2INZA 1WE5A 3IK2A 1J01A 2Y7DA 4GMEA 4GXWA 1OFAA 1LLZA 4Y6GA 3HG2A 5D2TA 1SSGA 3N2CA 2E9LA 1W1ZA 4FPSA 4N7QA 3RK8A 4RLIA 4PUUA 1PCKA 4GQBA 1V3HA 1NWSA 2ODOA 4HNCA 2XIMA 2QZRA 3GUWA 3L4WA 3N9SA 1FFQA 4GE8A 4BS0A 4PMQA 1R86A 3WJZA 5FL0A 3S5OA 4M7SA 1MZRA 1BYDA 2EPNA 1EF3A 5K9DA 2ZXBA 1ITCA 2OWWA 4I6KA 1MNZA 1OCQA 2PDIA 2WCGA 4L4MA 1E56A 1K3UA 2VENA 8RUCA 3SUUA 1MYRA 3LMZA 3PBVA 4PE8A 4QS6A 4V15A 4GVGA 1KRMA 3WNMA 3UVIA 4PFHA 1OD8A 2DZAA 3H23A 3R6IA 2D1ZA 2A2IA 4DF2A 2PGFA 4BEUA 3E0WA 1TZ7A 3VK5A 1CGXA 5M17A 3K4DA 3MB9A 3TMLA 3PTQA 4UTIA 4ATDA 4WR3A 3PSVA 3STGA 2WHMA 3E96A 4GC4A 2XPKA 4J3XA 1E0TA 2AQWA 1OC7A 2WMIB 2Y24A 1EJWC 2PDLA 4ZR8A 3QFEA 4Y9PA 4ZENA 5CCZA 1C9WA 3L0KA 1B9BA 1HUVA 3KS6A 3NVTA 2G95A 3MKKA 1HKKA 2YIHA 2BGQA 5AHFA 2GVJA 3K4WA 3HG3A 1VFFA 4R7OA 1A0DA 1N2VA 2ASHA 2O7QA 4BF7A 2GSJA 3W2LA 2VC7A 5FF7A 3H2AA 4MAZA 3S83A 1Z41A 3SRDA 3EA1A 2YL9A 2YPIA 2EPKX 3W81A 3BG5A 1XP3A 1S5WA 3F5JA 4YXGA 3LBCA 2ZWZA 4QG8A 1Q13A 2XFRA 1NY1A 3VMOA 3GHSA 2CESA 3UWUA 3FYPA 3GXFA 1C3FA 5EMJA 2PBGA 3FDGA 2VD9A 3NUKA 1OCJA 4JQ1A 3SSJA 1PBGA 3R11A 3VMNA 4HTBA 3ENLA 3LN3A 5BWAA 1YNYA 2C1