1BTMA

Triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
251
structure length
251
Chain Sequence
RKPIIAGNWKMHKTLAEAVQFVEDVKGHVPPADEVISVVCAPFLFLDRLVQAADGTDLKIGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAGQTNAVVASQVEKALAGLTPEQVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRLFGPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGPLVGGASLEPASFLQLVEAGRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords TRIOSEPHOSPHATE ISOMERASE
publication title Crystal structure of recombinant triosephosphate isomerase from Bacillus stearothermophilus. An analysis of potential thermostability factors in six isomerases with known three-dimensional structures points to the importance of hydrophobic interactions.
pubmed rcsb
source organism Geobacillus stearothermophilus
total genus 91
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 1995-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1btmA00
5DY2A 3UZ5A 4HKPA 1Q6LA 3C2EA 3O06A 1H5YA 5LHFA 3NR0A 2GJLA 4CQ9A 5D30A 4TX9A 5GVJA 2J9YA 4YL2A 2V30A 4K37A 4WXYA 3S1UA 4Q33A 2AQWA 3S8HA 1VYSX 4MYAA 4UNLA 3A5FA 4UCGA 1OK4A 4K6AA 5CSRA 3IV3A 3TSMA 4TIMA 3QW4B 1H7OA 2VEPA 3QEZA 2C0AA 1MEWA 1AMKA 4IPJA 3BG3A 3FLUA 4KFPA 1OHLA 3NQVA 1J2WA 4FNRA 8TIMA 3L9CA 4FIQA 4GE8A 3IEBA 4UTWC 1SR9A 1NF0A 4XUGA 3ATZA 4RX0A 3G18A 3LLDA 2R91A 4K8HA 2FTPA 3CC1A 1JCMP 3E49A 3LHTA 3UZJA 5F2IA 3TROA 4JDBA 3HF3A 4YMZA 4O19A 4O1CA 2Y7DA 2E6FA 3HGOA 1S3HA 3PG9A 3W1UA 1DORA 3ZS4A 4QIUA 1P0NA 3L65A 2QDHA 5AOUA 3UY8A 5EL1A 4UUIA 4RK8A 3PUOA 2HTMA 5D04C 1QDSA 2WO5A 2RH9A 3NM1A 1TPVA 2FB2A 1N8FA 3O6DA 3R5EA 3W1XA 3MMTA 5J5RA 1M6JA 1LRQA 5D05A 5FF4A 1DQWA 1R2RA 3O6YX 5AC7A 5K4ZA 5DN1A 3BGGA 3LTSA 2Y7FA 3GB6A 3IGXA 1P0KA 2YGYA 3NPVA 1MEIA 1RPXA 5CZ0A 2HS6A 2D73A 3KRSA 4WUIA 1D3GA 3BARA 3BPWA 3G8RA 1F2JA 3RMJA 4PEKA 3WK2A 1I2RA 1Z41A 2C1HA 2VENA 3N9SA 2A2IA 3LERA 4K36A 1TRDA 1SQ7A 4BI7A 5AHIA 3W83A 2X1RA 1WXJA 2VOMA 2F7FA 4XTDA 4UTJA 1I2OA 3LRKA 1VR6A 3NA8A 3DHFA 4X22A 1H63A 4X3ZA 2A1YA 4LUIA 4N9BA 3M47A 4Y8FA 3DFNA 4ZQMA 3HIJA 3LCXA 3NQ6A 2JK2A 3I7SA 3LCIA 2B0MA 2CWNA 1QOPA 1TQXA 1TTIA 2ISSA 2P10A 4TU1A 4TMBA 1Z44A 2VFGA 3EKZA 4KFOA 2A5HA 5K9DA 3M5ZA 2Y89A 4C1LA 3VFLA 3PSWA 1IIHA 4NX0A 1LBFA 3B04A 3DFTA 1W5QA 5CZJA 1H62A 2B7PA 3VCRA 1SSGA 5D32A 1VCGA 2A6LA 3NQMA 1ZAIA 2VFEA 1SZGA 1S5TA 3KHJA 5D38A 5FEZA 1QAPA 2QCLA 3NGJA 3OEXA 5DXXA 4L4LA 1TPB1 3R13A 1IXQA 3OVQA 3C61A 3W9ZA 1VHCA 1F73A 2WQPA 5KINA 4HIBA 3FYPA 5E93A 3L67A 3CQ0A 4LOCA 3UQNA 3H55A 3TX9A 2NX9A 4XWUA 5I3GA 1KFEA 3UXDA 4LS1A 1I2QA 3L66A 2E77A 1EPXA 4RZ4A 1NFBA 5DCBA 3W71A 2WSQA 2QUTA 3M43A 3NPWA 3C8FA 3DENA 3CIWA 3RLVA 4UR8A 5I3HA 4AMAA 3FKKA 3LHWA 1TTQA 3KRUA 4WY0A 4A2RA 3GDRA 1XL9A 2ALDA 3SSJA 5LHEA 3O07A 4Y96A 5KZMA 4UR7A 1A5BA 4TR9A 4KKXA 3W7NA 2EF9A 1EWEA 1DKWA 5F1UA 3E96A 2E6YA 3LHUA 1YYAA 1YDVA 1VZWA 3S0CA 3QSTA 3LRLA 4AF0B 1JR1A 2DJLA 4E2DA 2JGQA 4O16A 4GC4A 3EX3A 1XBYA 1SW3A 3LM7A 3O15A 2OJPA 2E6DA 3M41A 2NUWA 1YXDA 1WV2A 1KM5A 1RV8A 2R8WA 1K7XA 3W2KA 5HMSA 3W7IA 4O8RA 2EGZA 3TDFA 4UC5A 2I1OA 3NZRA 2VEIA 2E5DA 1F6KA 3CWOX 1QCWA 4GUHA 5D09A 1H7WA 1OYAA 1QO5A 1F5ZA 3DI1A 4RV8A 2WJZA 2NWRA 4AAJA 4IWWA 1EP1A 1FDJA 3W7MA 1A53A 4BK9A 3TXVA 2BX7A 3KVJA 3PM6A 3OBKA 4BI6A 3QQ1A 4S2BA 5DLCA 1FDZA 3G0XA 2GVLA 3LDVA 3CLMA 3GVGA 4OGZA 1XBVA 3LCLA 1W56A 1EUAA 3IIVA 3GAYA 3HO8A 4NNBA 3EWYA 3W1MA 1WBHA 3EWXA 3WJZA 2YFOA 3B03A 2ZZ3A 3O8AA 4WZHA 3HPXA 3RLUA 2Y62A 4UTLA 3MBFA 2FLIA 3P74A 5CSSA 5D2YA 2XFWA 3R2GA 2V8ZA 2ZFAA 2CU0A 1TV8A 1EP2A 3G3DA 3PULA 3IIOA 3M9YA 5BNKA 1UASA 3S6DA 3M5YA 1KFBA 4XKYA 3HPZA 4ZQNA 4AHPA 1DJNA 4NNCA 4HNTA 1LOQA 2WV8A 1X1ZA 4NJKA 4YXGA 5DBTA 4EF8A 1OX5A 3BW4A 3I68A 1W37A 3GR8A 4H3DA 3EWUA 1JUEA 3EXSA 1OVDA 3WK1A 1JQXA 4RJEA 4UTTC 2E09A 4N9DA 1J4EA 1R46A 5H2ZA 4HNUA 3QMTA 3BGJA 3LBCA 3BLEA 3ZR4A 3LXBA 3EWBX 3W72A 3PBWA 3LHZA 1DHPA 3QC3A 4GFSA 5HR7A 1K8YA 2FJKA 1A5AA 1KLZA 4O18A 1LM1A 1EP3A 3TAOA 1P1XA 1DQXA 3G1XA 5HWMA 4JNMA 3ZWSA 1PVNA 1YLVA 3LTYA 2A85A 3W7CA 3W7EA 3S5ZA 1J5TA 3BVJA 4O28A 2C13A 3O6CA 3VKJA 1YDNA 3DFPA 4QJ1A 4PL1A 1OFDA 3DAQA 1EIXA 1ZENA 1NF7A 2FDSA 3MI2A 1PS9A 1GVFA 1ML1A 4EWND 1W3IA 2DZVA 3TQ0A 1PE1A 3CIXA 3S5YA 3GKAA 2JKEA 2WNNA 5F2GA 4CLMA 1XXXA 3TCEA 3PUDA 5AHEA 1Q45A 3V75A 3W3OA 1I2NA 3PC0A 5AHNA 4O4WA 1OFOA 4Z08A 3NPUA 3THQA 2GPTA 1KV5A 1SO5A 1ZFJA 4NVTA 3ABQA 2JBMA 1RVGA 5AHLA 1V5XA 2ZRYA 4N9CA 1LOLA 4QNWA 1JCNA 4PCFA 2I14A 3QJAA 3T78A 3GYEA 1JVNA 5KITA 4JTTA 4CCCA 5HQEA 1ZJIA 3G0UA 1P4CA 4I9AA 4LC6A 1ME9A 5J5DA 1GYNA 3R8RA 5LNSA 4BF9A 4Z0SA 1L9WA 4ML9A 5EY5A 3DGRA 1W8SA 3T40A 2PE4A 4FX7A 1GTHA 2FB3A 4JX6A 1VRDA 2FQIA 4KFNA 3Q94A 3KFTA 5T26A 4P2VA 1XUUA 1F05A 1JUKA 3B8DA 1YTDA 1VC4A 1LORA 4YWIA 2E1DA 4IMDA 5HUPA 4DPPA 3OIXA 4AWTA 1MZHA 2G97A 1CW2A 3W74A 4XZ9A 1R2SA 1KLYA 3B05A 2E68A 1LCOA 3W70A 4UFHA 4LRSA 2PURA 1KBIA 3ZWTA 1ZY9A 2QCNA 4LVGA 4Q32A 3UPBA 4IMFA 1F76A 3NL2A 3NQ2A 2WNQA 1SW0A 3QF0A 2NUYA 2Q3RA 1XDLA 3TJLA 4ZZ9A 4LS2A 3PBVA 4JTFA 4OT7A 3C6CA 3HJZA 3MUXA 5CG7A 3IRDA 3LLFA 1HO1A 4UMAA 1GEQA 1TTPA 3LB0A 2OZ0A 1M7OA 2E5CA 2H90A 5TBOA 3P84A 4JGDA 2NWSA 1H7RA 5G4WA 1QOQA 3G1DA 1THFD 4ZMGA 3HMJG 3TK7A 1OJXA 5TIMA 4O1DA 1YTEA 1T0OA 5LNRA 1LOSA 1VH7A 4ZL1A 2WPBA 4JYDA 3P67A 3HG5A 1Q6QA 3W7JA 1Q6OA 1C9DA 1FWTA 3IIPA 4MIMA 2RDUA 5MHBA 4MLRA 3G1YA 1XFBA 2GUUA 4O53A 1DOSA 3QPYA 1B3OA 1FCBA 4LW7A 4M6QA 4NX5A 5FEPA 2NZLA 1KFLA 2ZA2A 4LVFA 3DH7A 4MZ1A 1WX0A 3W75A 2Y61A 5BMXA 1VQTA 3U8GA 4GUJA 3P61A 2DP3A 2GQ9A 3W7RA 3LV6A 2PC4A 3A22A 4GUFA 3QYQA 4N6FA 1L2UA 4NZFA 4QNEA 1TRIA 2CW6A 3W2LA 3L0KA 2CLIA 3C2RA 1RR2A 4LVBA 5KSWA 4PA8A 1FWNA 3PB0A 4XQ6A 3NQDA 5I3JA 1C8VA 2B4GA 4OHQA 3M5XA 1TPC1 4ORMA 4K38A 1JJKA 1FCVA 3SR7A 5G2HA 4AVFA 3A9IA 2OCZA 2IQTA 5D2XA 2QUUA 2QEZA 1VGAA 3QRHA 3P80A 1OYCA 2H6RA 5CPMA 3W2UA 4FHAA 2V81A 1OFQA 4NZJA 3I7RA 3DU0A 5EA9A 3HB9A 3W23A 2X1UA 3TFCA 5SWUA 2YW4A 4O14A 2DZTA 5IBXA 3UWWA 1GVSA 4AB4A 1OX4A 5A8GA 5CPLA 5H91A 5EKYA 2YXGA 1L6WA 3JRKA 1V7YA 1H50A 3BW3A 5AC6A 2ZYFA 3TW7A 5EYWA 4NT0A 1WA3A 1TV5A 3C3NA 4MY8A 3JR2A 3P7YA 2ISWA 3NG3A 1EA0A 1SZNA 2E5BA 4AHQA 4JY8A 4XTIA 2NXGA 2C15A 1TMHA 4WJEA 1ME8A 4LTSA 3G1FA 3SGUA 1A5SA 3HQ1A 2ATSA 3LRMA 3DHDA 2FFCA 2NLIA 4CQ8A 3NQ8A 2ZRXA 3W2NA 2YFNA 4AF0A 1TPEA 4JD4A 2C16A 1EB3A 2O7QA 2GQ8A 3HG2A 2WSRA 3DZ1A 3WJSA 4DELA 4EVZA 1Y0EA 1D3HA 2P0OA 3NYZA 4HPJA 1GVQA 5DBUA 1KTNA 4TO8A 2BLEA 1H51A 2FIQA 2A7NA 4U4MA 2E6AA 3C4UA 3W7LA 4EOUA 3R12A 2NXHA 1O94A 3W1AA 4QSHA 5EPDA 1JCJA 1Z42A 1NEYA 4MVAA 3C0JA 3LI1A 2QR6A 2YDAA 4DO5A 3QM3A 2G95A 4D2JA 1BEUA 1B4EA 1FCUA 3GNDA 3KVLA 1JUBA 2B7NA 4DBEA 4MKNA 2J6XA 1JCYA 3ATYA 3MHFA 5F2LA 3WFAA 3MW7A 4UNKA 4O11A 1E51A 4OV9A 2DZPA 3S42A 1QO2A 1A50A 4NQ1A 2C19A 1EWDA 4BR1A 3TMQA 3W07A 3M6YA 1TPFA 3N9RA 3A5VA 4MFEA 5C2XA 3GDKA 2ZA1A 1OF6A 4G1KA 4UTWA 4EF9A 4J9JA 5K7JA 3C56A 3TKFA 3TQKA 4O4VA 3CB8A 3MYOA 4XBKA 5HWJA 4LUJA 3PB2A 3TFXA 2Z1BA 5CZSA 1TPWA 3HGJA 4O12A 2BXVA 4QAIA 4YLWA 1WOAA 3W7OA 3THAA 1LBLA 2DJXA 4CNNA 4DF1A 4UTMA 2AAMA 2BTMA 3NQEA 5AB3A 4JEQA 3A21A 5D37A 3W85A 3LHYA 1L6YA 1R47A 4JTGA 2X1SA 1A5CA 1F6PA 4FNUA 5FF2A 3EXTA 3LXCA 4R33A 1AW2A 4R34A 1M5WA 3TV8A 3FS2A 3F4NA 2CLMA 3KVKA 3W1TA 4WD0A 4HN4A 2W79A 3P8JA 4UFIA 4IXHA 3G1SA 3BK0A 1PV8A 3IVTA 4RZ5A 1VPXA 3UWZA 3UNDA 3EB2A 1VHNA 5CKSA 2CZFA 5D2TA 3S9YA 2JGYA 1D9EA 3OVRA 3PSVA 4WXZA 1TV7A 1X1OA 2NXIA 4JX5A 1QPQA 3NEVA 1LBMA 1W1ZA 1FUYA 3HGRA 1WAUA 3WK0A 1JCXA 4DBDA 1SO6A 4M7SA 2RFGA 2Z6JA 1ONRA 4ZQCA 1GWJA 4JTSA 1KM3A 5AFDA 1ZNNA 3W84A 3GR7A 1FDYA 3MI3A 4WX2A 2ISVA 5HULA 4JIPA 4LV4A 3SW6A 2QUVA 2Z6IA 4FX6M 4C1KA 4OBTA 4JTLA 3K30A 4WOZA 3B4UA 2QCGA 1AK5A 4Q4KA 2ZRZA 3W7KA 1RQBA 1LRTA 1SFLA 2VKZG 3UWVA 4ALDA 3KRZA 4NJJA 3DFQA 4Z1DA 1G67A 3UD6A 2GVGA 5CGQA 1TO3A 4FNPA 3A24A 1KV8A 4KWWA 2A4AA 2RKXA 3TH6A 4IX0A 1H7XA 1VLWA 3F03K 4CQAA 2QCHA 1H1YA 2DU2A 3FEMA 3Q58A 4RR4A 2A7PA 1TYGA 1VS1A 1UUOA 2ZA3A 4HNVA 4A21A 2QCDA 4TMCA 2VFFA 1N55A 3CWNA 4JY9A 1GYLA 2G5WA 1OFPA 1FWRA 1DBTA 1H7PA 3B0VC 4MLJA 3GLCA 4JTJA 1I2PA 5L6UA 1TB3A 3GXNA 4MFDA 1P5BA 3NL6A 1GTEA 1TQJA 1WOBA 3M44A 3BG5A 3SFKA 3FJLA 4GNJA 3W1NA 2VXNA 1G6CA 1GT8A 1WQ5A 2V2HA 1YADA 1TSIA 3GXPA 4WY0B 3FOKA 3DXIA 2OT0A 1GG0A 3LCGA 3NXFA 4E2BA 3EXRA 4S2CA 3W1PA 4IGHA 2ZRWA 1Q3NA 1W0MA 2CLOA 2QAPA 2WNZA 4HSOA 2QJGA 1LP6A 5AYYA 1RD5A 3BG9A 3MBDA 2H3BA 2RHGA 3TW6A 3NPXA 4MY9A 5HWNA 2CZDA 1W5OA 3QFEA 1BKSA 1ICQA 1YPIA 3C2VA 3G8EA 1S5VA 3IVSA 4MJMA 1ICSA 1HL2A 3PBYA 3LCFA 3LOTA 4BWLC 1SU5A 4YCPA 3MYPA 4XBSA 3PY2A 2H8XA 6TIMA 1O4UA 3PVFA 4HT3A 1LDCA 3HG3A 1F74A 5CPNA 2NX3A 5G2WA 5FF3A 2BWGA 3L5AA 4DF0A 3DBPA 3GXTA 4ZQPA 2C14A 2DORA 3O16A 3LCWA 3KXQA 3T7VA 1X7FA 4ONVA 2AGKA 2QDGA 4O10A 3STGA 4O1BA 2Q3OA 4IOTA 4NNAA 1WDWA 1XDMA 2Y7GA 4LU0A 2VELA 5A5WA 2A7RA 5ABTA 1KM6A 1UCWA 1ALDA 3QH2A 1RQHA 3TAKA 4K7YA 2KZHA 2YYUA 4OV4A 1SO3A 4NUWA 4HPXA 3TSDA 1H1ZA 3QSRA 4NU7A 3GZ3A 3BLIA 1X8FA 4R7JA 1GG1A 1SO4A 1ZAJA 4LY8A 1SFJA 3FYOA 1OG0A 3W73A 1OFBA 2J24A 3G24A 4Z1AA 4GUIA 1TPUA 2ZDRA 2Z2UA 3DKLA 3VI2A 1XBZA 1IXPA 1LRNA 5BOOA 3UWUA 3P82A 2NV1A 2OMAA 3FIGA 3L5LA 5BMWA 3C2OA 2YZRA 1C29A 5D33A 1B9BA 3N3MA 2DZUA 1H7NA 5AHFA 1OYBA 4XKYB 2J9XA 2WSYA 4AHOA 4IX2A 4AWSA 3PUEA 4M7TA 1YTKA 2ZZ5A 5DCDA 3C2FA 3P8IA 1GVOA 1F7BA 1AL7A 3ABRA 3LHVA 4N02A 4UMBA 4FIRA 3L68A 3PG8A 3E02A 4RXGA 3C52A 1DJQA 1K8ZA 3CEUA 2PRMA 5F4WA 5LKYA 3TXZA 3I7QA 2A0NA 4CNPA 5DXYA 1KBJA 1WBJA 1KM1A 2C18A 3EX1A 3W1QA 4FNSA 2B7QA 2JKAA 3NL3A 5K3VA 2ZQ0A 2ZZ2A 3SIZA 3QMRA 4K8EA 5AYZA 1ADOA 3B06A 2TYSA 4QM1A 1MO0A 4W9TA 4ADTA 1FQ0A 4FEZA 2Q8LA 3O05A 1PIIA 1NAL1 4ICNA 4IMEA 1QMLA 1ME7A 1XC4A 3EX6A 3HGSA 3JS3A 5F4XA 2ABBA 3OHIA 1XUZA 4WQ6A 3S1WA 4JIQA 2J27A 4AEOA 1ZALA 4CCDA 5HNRA 3EKLA 2EPHA 1FCQA 3ANYA 4UTIA 1DV7A 4FXSA 1SW7A 1VJIA 4QQ3A 1B57A 1NVMA 1KA9F 4E0CA 4BFAA 1G7VA 4PFMA 3LX9A 4GRSA 2R14A 3N2MA 2O7SA 5EBUA 4HSNA 1WYIA 4LVAA 4N9EA 4WY0F 4IMCA 2VFIA 4IQLA 5FESA 2X1TA 4QISA 1K3UA 3EWWA 4GXMA 3TMLA 3W7HA 2GJNA 4AWUA 4JN6A 3MP3A 3MHGA 4NXSA 4JTKA 4O13A 4H6KA 3VE7A 1B4KA 3EX2A 3W7QA 3W86A 4IPIA 4MPQA 5LNVA 3W87A 1K7FA 3M5VA 1HTIA 5K9XA 5AHMA 5BW6A 1GPWA 4MJZA 2VEKA 4E38A 1KFJA 3H54A 3T55A 4RKAA 2PRHA 3I65A 5FEXA 5KMYA 2Y7EA 1W5NA 4I7WA 2ZRVA 4RXFA 2VEMA 4DF2A 1DVJA 3N19B 3NM3A 1UBSA 3G22A 1QPNA 4B5NA 1LTDA 3TC7A 4FXRA 1IGSA 3P60A 1KTBA 1MSSA 2C3ZA 3KX6A 2X2GA 1MXSA 4GBUA 2CLLA 4MOZA 3Q2DA 1KM2A 1H61A 1SSDA 1TCDA 2QCFA 4LWWA 3TNOA 1IXNA 1G4SA 2OT1A 3IIXA 4LS0A 4H4IA 3USBA 4JXCA 1K8XA 3MHUA 1T8XA 4UXDA 5D03A 2P1FA 2V0TA 3NO5A 3BO9A 1T96A 4IMGA 3CEPA 1TPDA 1CX9A 3P62A 5D2WA 3S1VA 4A22A 3L5MA 5D02A 3PAJA 1I4NA 3NQAA 3NNTA 4ADUA 1GVRA 2B7OA 3GDTA 3U6WA 3UPWA 5F4SA 4JTEA 2ABAA 3PF3A 3GX9A 1LLWA 3L2IA 3WJYA 4MZ8A 1GZGA 2YR1A 2Z0IA 3Q37A 3BV4A 1HUVA 2ATMA 3MO7A 1MEHA 1UJPA 1OK6A 2RDTA 3R89A 4U28A 1QR7A 4FF7A 3S5NA 2Y88A 3M0ZA 1ICPA 4RCXA 3CM4A 1NSJA 4Y6GA 4DEFA 3MP5A 1U83A 2F84A 3E0IA 1W3NA 4N4QA 4CNOA 5U7SA 1FWSA 3OG3A 4Z1BA 3SI9A 3DI0A 3QW3A 5AC8A 1U5JA 1KTCA 3TSBA 4UTUA 4BI5A 3MJYA 5C55A 1T99A 5FF0A 2QAFA 4L4MA 1UB3A 2XN2A 4UIOA 1HO4A 1AL8A 3NAVA 1FY6A 4PTNA 3FFSA 4PC8A 3TU9A 1OFRA 2CZEA 1W31A 3W2JA 4PL2A 5IM51 5HUOA 4O15A 3B0UX 2DZWA 1KFCA 4M19A 4ORIA 4I7VA 5AN7A 1QPRA 4JTIA 2YW3A 3W7GA 4ADSA 3SY5A 1RQEA 4OE7A 2YCEA 3G1VA 3M16A 1G4TA 2BSLA 3MWAA 4OU1A 1YXYA 1H60A 5D2VA 1LLZA 4PODA 1KW1A 4N4PA 2ZZ7A 4K7VA 1TREA 5F2MA 4OWGA 2J9ZA 3S5OA 3TJXA 2NX1A 3KAOA 1BWKA 4UFLA 1OX4B 4GJ1A 2GQAA 1ZAHA 3AJXA 3TQVA 1K7EA 5G4EA 3P5ZA 3W88A 4RLIA 4Y9AA 1BWLA 1TPH1 4JDYA 1QNVA 4FNQA 4IUOA 3NZ1A 4ZQOA 3F1QA 3N14A 3PS7A 3T44A 1BTMA 4O0ZA 4LT9A 4CCEA 5CPOA 5HR6A 2PCQA 3V1PA 1IF2A 3IIZA 3HG4A 3OVPA 1TIMA 4X2RA 2Y6ZA 4O52A 1M7PA 5I3KA 3RF9A 3EWZA 4MYXA 4A3UA 1IIGA 3PR2A 2VFDA 3G0SA 3W7PA 3M7WA 5KTLA 4N6EA 2TPSA 3NVTA 3YPIA 3VNDA 3NQ7A 1PCKA 2VFHA 3TC6A 4ZQRA 1Q6RA 3PWAA 3QZEA 4DPQA 3W22A 3W1RA 2V2DA 3RFAA 3HOJA 3KOFA 4O54A 5G1YA 3W1LA 3PBUA 2C6QA 1LZOA 2G96A 1TJRA 2ZZ4A 3NQGA 4M5PA 4MZYA 2XN0A 3RNDA 4QITA 3NOEA 4YCOA 4K39A 3LXAA 3CT7A 3N73A 5CZTA 2HS8A 5LZLA 6ALDA 1XM3A 3GKFA 3ABOA 5I3FA 1Z48A 3G1HA 4AXKA 3WK3A 4A29A 5FI8A 1AG1O 4UFKA 5C54A 2NUXA 3SZ8A 1PHWA 1VCFA 4FO4A 1XBXA 1SZFA 3QMSA 2YPIA 4JTUA 3IGSA 5L9FA 1DL3A 3OA3A 3SJ3A 2A21A 1JRCA 1PHQA 2V82A 3FJ6A 5HINA 2TMDA 4LRTA 3TR2A 1XI3A 1G7UA 3H53A 3LCHA 2GVJA 3RU6A 3LTPA 3DKJA 3IGUA 1AW1A 3T4CA 3W76A 3IVUA 4RZ6A 1OFEA 4IJBA 4DO6A 1O5XA 4O17A 5LGXA 2GOUA 4ZVJA 2DZSA 3BW2A 2BZNA 4JTHA 3SECA 3N2XA 2WOQA 5F1VA 3ABSA 3L21A 3RK8A 1VYPX 1SUXA 3ELFA 4JYEA 3GIYA 2R94A 2XN1A 1VLIA 2LLEA 3GDLA 5DY3A 3QQ0A 2W6RA 2QCCA 1LROA 4DO4A 2ZCGA 3BLFA 3MP4A 1AW5A 5G1TA 2ZTKA 3EX4A 5G5IA 4GUGA 4IXXA 3B0PA 3STCA 3L0GA 1R2TA 5EMUA 1G4EA 1K02A 3SGZA 1EEPA 5KZEA 1TTJA 3P5YA 5C6MA 5BRBA 3HPSA 1HFBA 1O5KA 1X6UA 2H8ZA 5K4XA 1YPFA 5DCEA 3AO0A 2QJHA 3WJWA 3NQCA 3TA6A 3STEA 1K03A 1KM0A 4NJIA 2Q8ZA 3D0CA 1FBAA 1KM4A 2Y63A 3CPRA 4O1AA 3CTLA 1XKYA 1CI1A 2I9EA 1EUNA 2EKCA 3CU2A 3FKRA 5FF7A 3G3MA 2PRLA 4Y90A 1XCFA 3LBMA 3W7DA 1W5MA 3VE9A 3MI6A 3GNNA 1GJPA 1JULA 5K2ZA 3LV5A 1O60A 5G2IA 5AYXA 1ZCOA 1PL9A 3INPA 4MUZA 1I45A 1G69A 3NQFA 2QJIA 1L6SA 3TUUA 2DZXA 4DQWA 4JYFA 1HG3A 5TQLA 5LNUA 1OABA 3STFA 1QWGA 2ZZ1A 5E0KA 3O63A 2VC6A 4HHPA 1OX6A 2A6NA 4O0KA 1FWWA 1W54A 1JRBA 2CFFA 4JS3A 3GDMA 3LI0A 4I7UA 4UMCA 2Y85A 4Z1CA 1PCWA 1YDOA 3DFSA 4FNTA 2TRSA 4DXVA 2V2CA 2OX1A 4PH6A 4JICA 3E9AA 1W3TA 2FPVA 3FA5A 4O50A 1JQVA 3CHVA 4JR5A 4FB7A 3U2OA 2X16A 3UWYA 2YSWA 1QPOA 1ZHAA 5I3IA 2QCEA 4OQVA 1R30A 5KZDA 2QKFA 1GOXA 3UY7A 5DELA 4EIVA 1OFAA 1N7KA 4UTKA 3GAKA 4HNNA 5LGZA 3EEGA 4FX8A 2JKPA 2V5BA 2QCMA 1OF8A 4S1FA 3UYCA 4A2SA 2QCDB 3F4WA 2J88A 2RDWA 5U4NA 1FX6A 2W0UA 2HMCA 5FEWA 4P61A 4MY1A 2EAWA 4UTTA 3WJXA 1LYXA 1SZEA 4LV9A 3QPZA 2TSYA 3UWQA 4LC8A 4GWEA 3HBLA 4JX4A 2H3DA 1O95A 3NDOA 1KFKA 3O1NA 5HJLA 2Y70A 2CLKA 3GK0A 3W6YA 5K9CA 2FPYA 4UFJA 4WOQA 3S1XA 4POCA 4NJGA 1FXPA 5IBXC 1QFEA 4Z0JA 3TIMA 2CLHA 1UUMA 1IXOA 1VYRA 4LVDA 1W5PA 3W2MA 1G4PA 5LSMA 2CLFA 4BWLA 3E12A 3KVMA 1JCLA 4UTHA 4M6PA 7TIMA 2ZZ6A 3P81A 1RZMA 1S5WA 2QF7A 2YX0A 5E1QA 4O57A 4KWVA 3DFOA 1EX5A 4LNYA 3TE9A 2YYTA 2WKJA 3UXAA 3NL5A 2ZRUA 5LNWA 3LGEA 4AH7A 4NXKA 1I8JA 1TJPA 3I6RA 1GQNA 4R53A 4NJHA 3L0NA 3ZFHA 3G1AA 3M1ZA 1YXCA 2ZTJA 2V5LA 2X30A 2NV2A 4X9SA 3A23A 4M6VA 5C5YA 2CLEA 2V9DA 2ZBTA 2UV8G 3N34A 2EHHA 2CZ5A 4N2YA 2HSAA 1FXQA 1VCVA 4UFMA 1SPQA 2FPTA
chains in the Genus database with same CATH superfamily
3WO8A 1K9DA 3S2CA 5DY2A 4BEUA 3NZGA 3C2EA 5KETA 3SUTA 4DXKA 1PYMA 4AZGA 3NR0A 4HNCA 4CQ9A 5AKQA 3GE7A 4TX9A 6XIMA 4GVFA 5GVJA 3AU6A 4YL2A 2WMIA 2OSYA 5EGRA 4A6GA 3PWIA 4PUUA 4CN6A 1VYSX 2YXOA 2YBVA 3A5FA 3NUKA 1HJWA 1KR0A 3VD3A 1S2UA 2G37A 2J7DA 3BE7A 3UBPC 1S2AA 4AYSA 1ZJHA 3QW4B 4XO6A 2C0AA 4TTGA 4R88A 4AZ5A 1AMKA 3FLUA 4YVPA 4KFPA 1UROA 4I3GA 4GE8A 1QBBA 2Z1SA 3BAKA 4UTWC 4Z2JA 3P0WA 1X7IA 7PTDA 4M81A 4R3UA 3G18A 3LLDA 3H12A 5JBFA 4XZNX 4K3ZA 3E49A 3KOXA 5CZKA 4C6OA 4EK7A 1A5NC 1VKFA 2CEQA 2VGFA 3TROA 3M46A 4YMZA 4O1CA 2Y7DA 3GM8A 2CNCA 1TJ1A 3UY8A 1EEXA 5EL1A 1EZ2A 4QXIA 3AI0A 3EA2A 5D04C 1QDSA 1PPIA 2WO5A 4NYYA 2XIJA 3NZPA 4GZIA 3O6DA 1TFVA 2ZDSA 1UH2A 3K13A 1CENA 1DQWA 1Q2SA 3O6YX 5DN1A 3LTSA 4FOJA 2Y7FA 3IGXA 4XAYA 1LLOA 2YGYA 5IOBA 1RPXA 5CZ0A 2XFFA 2D73A 4QG6A 1W9VA 4UWMA 3BPWA 3EOLA 1W2PA 4PEKA 3W00A 2DT1A 2VENA 3N9SA 3D3FA 2A2IA 5H6HA 2PDNA 1XLHA 4BI7A 1EJWC 5AHIA 2X1RA 1WXJA 4U2YA 3WLSA 3ITLA 1U33A 4X22A 5GQBA 4X3ZA 1RLDA 4LUIA 4IFKB 4BS0A 5FJRA 3M47A 4HPGA 4DN1A 4Y8FA 1W9UA 4ZQMA 1EJSC 3IPWA 3LCXA 2JK2A 3NQ6A 3I7SA 5BYWA 1XS2A 1QOPA 2HNEA 2ISSA 2P10A 1R9XA 2PWEA 3GR4A 1MFUA 3ZJ6A 1QJWA 1UUQA 3M5ZA 4GISA 4XZIA 2Y89A 3VFLA 4CQCA 4BF7A 1JZ6A 3B04A 5BU6A 4ZEPA 3R4IA 5ABHA 1W5QA 1V3KA 2QULA 2B7PA 3VCRA 1ZAIA 4ZO7A 1SZGA 3KHJA 5D38A 1VENA 1QAPA 2QCLA 1RY0A 1TPB1 5AYIA 2OR2A 1LQAA 1F73A 1KXVA 3A4XA 5E93A 4QRNA 4JQ4A 3L67A 2Q8XA 4LOCA 3UQNA 3Q4DA 4GZJA 4JN8A 4GNKB 4L5ZA 5E09A 4BEQA 1DJIA 4QJ4B 3CL8A 3WLPA 1Q7ZA 3SQLA 1NFBA 1VBGA 4XK2A 2XSAA 1GONA 3C8FA 3DENA 3RLVA 3NIYA 4GINA 4HA3A 1AJ0A 2ALDA 3O07A 1ITCA 1BTCA 1IYXA 1Z8AA 1A5BA 1XRTA 5BXSA 3REQA 5F1UA 2GFTA 3UFYA 1V6XA 3N13A 1YDVA 3S0CA 3QSTA 3LRLA 1JR1A 2DJLA 1CGUA 2JGQA 4P7LA 3HZ3A 2DT3A 2NUWA 3TONA 4CGTA 1RV8A 1EDQA 1K7XA 1E1FA 4JFTA 5IFTA 2EGZA 3WQOA 1UC5A 1P1MA 4DJDC 4KIEA 2NQ5A 1GHSA 3UG5A 2E5DA 3AIBA 2J62A 2VGGA 3ZJ8A 5IHSA 1V02A 5A2BA 4PRTA 3ARTA 1YBQB 1OYAA 3IJ9A 1QO5A 2VC7A 4DY1A 1F8MA 2WJZA 1M01A 2NWRA 4AAJA 4IWWA 1FDJA 4YYCA 4ACZB 3W7MA 1A53A 2GK1A 3S9IA 3PM6A 1CB7B 2F38A 2GVLA 3LDVA 3FA4A 4NRRA 2GSEA 1R3TA 3CZ8A 3GVGA 3BCDA 1XBVA 3GTHA 3QY6A 3UERA 1EUAA 3GAYA 1EC9A 2EBNA 1E6XM 3W1MA 3R11A 2ZE3A 1TWZA 3EWXA 2C7FA 2YFOA 2ZZ3A 4W7VA 4UTLA 2FLIA 2D2GA 5CSSA 4GQGA 2ZFAA 2CU0A 2ZUNA 2J7CA 3HV8A 4W88A 3M5YA 1QNQA 1KFBA 2P50A 4HGXA 4FZIA 1DJNA 4NNCA 4HNTA 2WV8A 4NJKA 2JFEX 1OX5A 3BW4A 1XRFA 3GR8A 4H3DA 3ARUA 4ZOBA 4RJEA 4UTTC 4RNFA 3GHRA 1J4EA 2F6XA 4OFCA 1R46A 3OQ8A 4HNUA 3PZ9A 3PZIA 2R1KA 3BUVA 1LWIA 3H24A 3PBWA 3PTMA 3LHZA 4L64A 1BVZA 3F4VA 3D5HA 3N3TA 2JF6A 1T5AA 3AJ7A 1EP3A 5CPTA 1P1XA 3H21A 5HWMA 2AL2A 4AW7A 4QS6A 3HFYA 3LTYA 4GQ0A 1BYDA 3BVJA 3DFPA 3UGRA 4LAUA 1ZENA 1V0KA 3MI2A 4OIFA 1GVFA 2D2OA 2CHOA 1W3IA 2DDXA 3S5YA 3GKAA 2JKEA 1XXXA 3CQIA 4J3TA 4FF5A 3PUDA 3WDHA 2HNHA 4H6EA 1Q45A 2J75A 3V75A 1JI1A 1I2NA 1OFOA 2Z4GA 1JZ2A 2D23A 4BCEA 1KV5A 1SO5A 3ABQA 2JBMA 3POCA 1GVYA 4PUDA 5HMFA 1E9ZB 3MUIA 1REQB 3KBWA 1LOLA 4UQCA 4PSRA 2I14A 2PB1A 3QJAA 3GYEA 3WDIA 1PO9A 1R3SA 2YBUA 4CCCA 3C86A 1HKWA 5HQEA 5LA2A 3G0UA 4W7WA 1XLKA 5AY7A 4YPJA 4HCHA 1CGXA 4DZAA 5LNSA 4U33A 5I7GA 1S3TC 2J7EA 4ML9A 1H49A 1B54A 4AMCA 1JDCA 1N82A 2XZ7A 2FQIA 3Q94A 3K8LA 2POTA 3DYPA 3KFTA 5T26A 3GD6A 2J4GA 4HQVA 4HK7A 4V28A 1LORA 1TX0A 2XSBA 3OIXA 4AWTA 3W74A 4XZ9A 1R2SA 1FWIC 1KLYA 1FWHC 1JPMA 2PD5A 4B5TA 3AUOA 4UFHA 1AH4A 1QI4A 1RY8A 3CPUA 3HN3A 3KLKA 4H00A 4CUCA 4DXXA 4LVGA 3UPBA 4IMFA 1F76A 2R6OA 1EC7A 2DSZA 3QGKC 1XDLA 3TJLA 2G0WA 5LIWX 1KWKA 4JTFA 1V0NA 3LPOA 1UP3A 2QLYA 3LLFA 1GEQA 3LB0A 1M7OA 3P84A 1B2YA 4MTVA 1J6PA 3WQCA 1QOQA 4LUTA 3G1DA 4IG2B 4NZ3A 5M03A 3TN3A 5LNRA 3V4BA 4GNVA 4E6MA 4ZL1A 1CDGA 1XR2A 2R24A 3U7VA 5FOOA 3W7JA 1R86A 4Q7NA 4MIMA 2YCKX 3S5SA 3WD4A 4M6QA 5I2UA 2YA0A 2NZLA 1KFLA 3DH7A 4JTCA 4YHEA 3G1RA 4C1NA 2VRQA 2OO6A 5FAJA 3AXXA 1IR1A 4JQ1A 2OWWA 4GUJA 3W24A 2DP3A 2GQ9A 2QGHA 3QYQA 4XX6A 4IGNA 1D2KA 3GSMA 2QT3A 1J0IA 3AYRA 3PB0A 4HK6A 4C7FA 4DZ5A 4AD4A 3ABZA 1R7OA 3M7SA 2RGLA 3QXBA 3NQDA 4HP5A 5I3JA 1C8VA 4E5TA 3PTKA 1TPC1 4DO7A 3SR7A 2OZ8A 3MQTA 4UQDA 4DI9A 2OCZA 1CCWB 2V3DA 2OEKA 4HYVA 4ZB0A 1OYCA 3CUIA 1R7AA 4US6A 1DEDA 3RRAA 2WC4A 4AZCB 2I17A 1OFQA 3I7RA 3DU0A 3OIHA 3W23A 2YW4A 1PDZA 2DZTA 3UWWA 6TAAA 1GVSA 1CYGA 4ZO9A 1FP8A 4P7RA 2E8ZA 2YXGA 3HQPA 1TR1A 1TV5A 3C3NA 5ECUA 2WMFA 4H83A 4LUSA 2WC3A 3G1FA 3SGUA 3LRMA 4QTGA 3DHDA 4QX4A 3WF1A 4HOZA 3W2NA 1CPUA 2VGIA 3OLIA 2O7QA 2DPEA 2GQ8A 5GJPA 3HG2A 3DZ1A 3WJSA 3SRKA 4EVZA 1D3HA 5TD4A 3CS2A 3NYZA 3CGTA 2ACSA 5CC5A 4NI3A 2P53A 1KTNA 2QIWA 2FIQA 1XV8A 3T2PA 2G41A 2E6AA 5HNUA 3N2OA 1E3XA 3RM9A 4B5XA 4AZ6A 3DUGA 3WBAA 2QDDA 4V2XA 3WUBA 5AVHA 2V67A 3M0YA 1HJSA 1JZ4A 3C0JA 2PD9A 4UB9A 4DO5A 4CD6A 2XPKA 3QM3A 4NRSA 4D2JA 2VWTA 4P8VA 1HW6A 1NFGA 2B7NA 1XH2A 3BLPX 1ITQA 4MKNA 3B9AA 2BOEX 1XGDA 2AMGA 2OO0A 3ATYA 4CVUA 5F2LA 3BAWA 4UNKA 4B4HA 1TMQA 1D7FA 1R3QA 3LSBA 3PFMA 3MUZ1 3S42A 4NZ1A 1MNSA 1AJ2A 4NQ1A 2BY0A 1E15A 2WM0A 3W07A 3M6YA 4U10A 3ZVHB 4G1KA 4PBGA 4ATDA 3EDKA 2OYKA 2JIEA 2WWCA 9RUBA 2HXUA 3T8LA 3VM5A 2WZMA 1E3ZA 5HWJA 3TFXA 4O12A 2ZWYA 1J79A 4QAIA 3EWDA 1NOFA 1JYWA 3U4FA 1WOAA 3GH4A 3THAA 4UZUA 4DF1A 5AC4A 1X6NA 3GW0A 1XJBA 4W8AA 5D37A 3LHYA 3OQEA 5DMLA 4JTGA 3CQJA 3F2DA 3VA8A 5A2AA 4H19A 4GLEA 5FF2A 3U5YA 2RJGA 1XQKA 3F4NA 3KS5A 3W1TA 4TX6A 4S3AA 3P8JA 4IXHA 3UG3A 4AZIA 2IPFA 3IVTA 4M1RA 2VJXA 1NWSA 3UNDA 4B5VA 1VHNA 3T1GA 4WGXA 2CZFA 1IEVA 5D2TA 1D9EA 4IIFA 3IAPA 4WXZA 1F6YA 3SIMA 3TNBA 2W5FA 1QPQA 4QR6A 1XH1A 3MPGA 3WLHA 1F3TA 2PMQA 1JZ8A 1SO6A 4E2VA 1K9EA 4M7SA 2RFGA 1ONRA 4XVEA 1KM3A 3WF2A 3KZSA 3GR7A 1FDYA 3IV8A 4GPNA 3THDA 3GXFA 2QUVA 4C1KA 4OBTA 5A6SA 2FGLA 3K30A 3SY8A 3QVQA 2EEXA 5HPCA 3EGJA 2OOFA 2WC7A 2VKZG 1VEOA 1IGWA 4ALDA 3KRZA 4NJJA 3AISA 3DFQA 3K1GA 3PPFA 4BA0A 4FNPA 1Q6GA 1DPMA 2XGZA 3JZUA 3N6HA 1PWLA 2A4AA 1XGEA 2PTXA 5EFDA 3TH6A 5XINA 1MVYA 1H7XA 3TJIA 1Y5VA 3MV11 3T81A 3MUY1 1PZ0A 2OSWA 1TYGA 2ZA3A 4A21A 4AVNA 4TMCA 1JPHA 2WJEA 1Y5WA 1GYLA 1XYBA 2G5WA 5BXRA 1OFPA 1M7JA 5A8MA 3B0VC 3NWRA 1VB9A 1LG2A 3ANVA 4AY7A 4LAMA 1S5NA 4MFDA 1P5BA 1GTEA 1TQJA 1ZGDA 4I9JA 4GNJA 2ZX8A 2VXNA 3W1NA 2V2HA 5PTDA 4WY0B 5I79A 3QLLA 4E2BA 1W0MA 1DJYA 3LGDA 5AYYA 3GTFA 1RD5A 3MBDA 1QW9A 3NPXA 4GIRA 4D6GA 2CZDA 3G6MA 2CXGA 3QFEA 2VX6A 3GG1A 1S5VA 1O6IA 4HA4A 3SY1A 1JDEA 5IXEA 4FPSA 1UWIA 3MYPA 5E9AA 4RE2A 4HT3A 1F74A 3S9ZA 1C92A 5G2WA 5FF3A 3BL3A 2HZGA 1RJPA 5E5CA 5HMEA 3RR1A 1XLIA 2F6KA 2PDIA 3N4AA 1H3GA 3LCWA 3T7VA 1X7FA 4ONVA 4O1BA 2Q3OA 2AKZA 2V3FA 3ZJ7A 1CBGA 1V3LA 2XVLA 2FVKA 4ICCX 5ABTA 3B9EA 3WQGA 2YCLB 3TAKA 4K7YA 1JDFA 1O12A 3ERPA 4QS5A 3ZR5A 3OOQA 4HPXA 4YYFA 3GZ3A 4B9YA 3EA3A 1V6WA 5E0CA 4GBDA 2VX5A 1SO4A 1TIWA 1QK2A 1E1CA 4JTRA 2O9TA 2OB3A 3BOLA 2DFAA 4Z1AA 1B5TA 1H0GA 1MW3A 4FI4A 3GHTA 2WXDM 3LD5A 3VI2A 1XBZA 1IXPA 5XIMA 3I6TA 1K9TA 2OMAA 5BMWA 3C2OA 2YZRA 1C29A 2YZ5A 5D33A 5T9BG 1KO0A 2WVTA 1B9BA 3N3MA 1OWQA 1H7NA 5AHFA 4XKYB 3IGHX 2OPJA 2WSYA 2E4TA 5E6ZA 3SGGA 1LL6A 5A6TC 1H09A 5GJNA 3ABRA 5C9XA 3BJSA 3PZVA 6XIAA 2ZUSA 1FHDA 4H2HA 1E4MM 5HNNA 4U5IA 4RXGA 4IGMA 3TZNA 4XZMX 3Q67A 1O5QA 1WB0A 3WD1A 1NDWA 4PGLA 4WSJA 4A4AA 4G56A 3GUGA 2C18A 3R0DA 3EX1A 3W1QA 1MYRA 2HBXA 5AECA 4GD0A 3M07A 3QMRA 3HPAA 1JG9A 1ADOA 4QM1A 1EOMA 4AUBA 1MO0A 4ADTA 4ICNA 1ME7A 3TLLA 1XC4A 5F4XA 1AH0A 1XUZA 1W3HA 2HVMA 3VZYA 1FWJC 1ZALA 4CCDA 5HNRA 3EKLA 3ANYA 2HE5A 3VTRA 3AZSA 4KW2A 1SGJA 2WCAA 4IFKA 4BHYA 4E0CA 4HA1A 1G7VA 4MDOA 4PFMA 4BFAA 3RMEA 1UMLA 1D3CA 3N2MA 2FVMA 3RLHA 1WYIA 1Z89A 4IMCA 3UXLA 3WCZA 2VFIA 3ARYA 3W01A 4GXMA 2FH8A 1IT0A 2YL6A 1EJTC 4JQ3A 3W29A 4CVWA 3W86A 1K7FA 3AUJA 3M5VA 3VMNA 3WH6A 3VCNA 1GPWA 3C0QA 2DV0A 2V5KA 3T55A 1L6FA 3DX5A 1W5NA 3KCOA 3FXGA 4DF2A 3M0HA 1O68A 1V6YA 4QG8A 4M82A 1SM9A 4D8ZA 4B5NA 1LTDA 4LCRA 1KTBA 1MSSA 1JYNA 1V8EA 2OYLA 3LNMA 1KM2A 3WF3A 3AAMA 2ZVIA 4LS0A 3APGA 3MU7A 4IIGA 4BQ2A 3SJNA 4KEUA 1T8XA 4UQ9A 2YB4A 1T96A 4IMGA 3P62A 5D2WA 3KBSA 3L5MA 5D02A 1T7LA 1XIHA 4C6BA 4E4FA 5JMUA 3U6WA 3UPWA 3PF3A 3WJYA 3M64A 4MZ8A 3QC0A 1GZGA 3ARQA 2YR1A 3BV4A 1HUVA 1MEHA 1UZ1A 1PKLA 5I5RA 1OK6A 1JD7A 1X98A 2A3CA 2J74A 1YBQA 1EYWA 2VRJA 1Q7MA 3L2LA 2BXZA 3CM4A 4Q6JA 3E0IA 1VFMA 1FWSA 2GSHA 4B3ZA 3V0UA 4ZB2A 4AG0A 1U5JA 4UTUA 4H01A 4QSFA 5C55A 2PU0A 3EMQA 1U30A 1BXCA 4UIOA 4K1GA 3NAVA 5DF0A 1NP2A 1R6WA 3MCNA 2CZEA 3N29A 3W2JA 4PUNA 1IT8A 3KDNA 4O15A 2V6AA 4I5XA 3UU0A 3B0UX 2DZWA 1KFCA 2EXOA 3WQVA 1OQFA 2YW3A 1AQHA 1YE6A 4RDZA 1BSLA 2BS9A 4HMEA 1E6QM 1XIBA 1FH9A 1VP5A 2BSLA 1YXYA 1I1XA 2XGIA 4WDWA 1GCYA 4LYRA 1LLZA 3N6QA 5LXEA 1X39A 3Q65A 6A3HA 4K7VA 1TREA 1J0HA 4OWGA 2J13A 3S5OA 4N42A 2NX1A 3G6LA 3FDGA 3KAOA 1H41A 1VFOA 2QYGA 2GQAA 1ZAHA 3AJXA 1OGBA 3P5ZA 2XHYA 3WH8A 4G6CA 4J27A 1EJVC 1FRBA 1RALA 1QNVA 3H2NA 4FNQA 1YKWA 3NZ1A 4LCSA 1VEMA 3N14A 1BTMA 1OINA 5HR6A 3PNUA 2PCQA 4N0RA 3IIZA 3WDJA 3AU2A 3HG4A 4X2RA 2XH0A 2Y6ZA 1M7PA 1E4NA 4HBKA 4A8IA 2DT2A 3G0SA 3PZUA 2Z1VA 1YMYA 3I10A 1ENUA 3IJIA 3VINA 2VFHA 3PWAA 4NL1A 3KOFA 4O54A 1PTAA 1JIBA 4MNMA 1XCWA 4F66A 4IL0A 1P7TB 3NQGA 3ARWA 5BRQA 4JZ5A 4GI8A 4HOWA 2OYMA 3NOEA 3NURA 5DANA 3VGEA 4QDWA 4EPEC 5A6LA 2HQAA 4ZR8A 3ABOA 5I3FA 3G1HA 4AXKA 1R87A 3WK3A 4KIRA 4UFKA 2O56A 5C54A 3ABXA 3F5KA 2A3BA 4G1NA 1UR1A 4JTUA 1CIUA 1JRCA 1PHQA 2YDSA 2XVGA 1FOBA 4IP5A 4DM1A 1XI3A 3TYDA 3RU6A 3GG0A 3LTPA 3ID7A 3IGUA 3LPPA 4ZBCA 4RZ6A 4IJBA 4FA3A 5EMLA 2CIPA 2BZNA 3POHA 3SECA 3N2XA 2WOQA 5F1VA 4U31A 3K5XA 3ABSA 1XGZA 3RK8A 4LANA 1SUXA 4JYEA 2R94A 2PDLA 2PLCA 2GUBA 4PMDA 7CGTA 4J2MA 1E56A 2QCCA 2ACRA 3WL0A 2Q09A 3AYTA 4GGBA 3J7HA 5G5IA 4J35A 3AIRA 1UR0A 4HVXA 1K02A 1EEPA 5KZEA 1TTJA 4L7ZA 3MCOA 4HZ8A 5K4XA 1ODUA 1A3XA 3ARZA 1VPYA 2YB1A 2GJXB 3AS0A 2PDQA 3PNZA 3VO0A 2Q8ZA 1NWTA 2ZUMA 1Q8JA 2XFRA 4B5SA 2Y63A 1OZQA 1VFHA 1J0JA 3SRHA 1V7AA 3CTLA 1XKYA 4BY3A 3O6AA 1CI1A 3CU2A 3GNOA 3QN3A 4DJDA 4L61A 4Y90A 4XZBA 3C5QA 1XCFA 4OOZA 1W5MA 4W86A 1UW9A 1CECA 3LV5A 4IG2A 1O60A 1UA7A 1W8GA 3H6OA 4PCTA 3KCJA 2F61A 1DJWA 2FZMA 3VKKA 3CO8A 3NQFA 3TUUA 4DQWA 5M2FX 3C8NA 1HGWA 5LNUA 1OABA 3STFA 2ZZ1A 4HN8A 5E0KA 3WIJA 3ZO9A 3O63A 2WJDA 1BWVA 3KHDA 4HHPA 1OX6A 4PTVA 3MZ2A 4ZCWA 1FWWA 2PF8A 3GS6A 4Z1CA 4YNGA 3IUDA 1YDOA 3GDBA 3CV2A 2OX1A 1V4YA 4PH6A 4O50A 2ZX6A 3CHVA 4JR5A 2X16A 4H6QA 1QPOA 2QCEA 3ENLA 1IV8A 2IUZA 4EIVA 3WF4A 4UTKA 5LGZA 3MA8A 1T40A 3UYCA 2W0UA 1RAKA 2HMCA 4W8LA 3SN4A 3BZJA 2VX7A 1KD0A 3QYSA 5EMMA 2VZTA 4UTTA 3UR7A 1A3HA 3CNYA 3QPZA 4AZ7A 4ASTA 4JX4A 3VNYA 2H3DA 4PMZA 3R79A 3VOJA 5B7YA 4AZCA 5MKGB 4D6JA 1KFKA 1Q6FA 3LG3A 2DGAA 1MRQA 3O1NA 4O0QA 2Y70A 2A3HA 1CGWA 3GFYA 3S1XA 4PUKA 4H9ZA 4NJGA 5IBXC 3CUHA 4GA8A 1UKOA 3ZIZA 5CC3A 1W5PA 5DRCA 1EC8A 4BWLA 3E12A 3KVMA 5FSDC 1DP0A 3P81A 2QF7A 3A64A 5E1QA 1IE7C 1R3YA 1RUSA 4HMDA 4B15A 1XPGA 1C93A 3QKZA 2IXVA 3NL5A 4J3XA 3NO1A 4GABA 2ON3A 4YWSA 1H11A 3I6RA 1GQNA 3AHTA 4PBFA 3EOUA 3TTYA 1OC5A 2Z24A 1PWMA 1YXCA 2ZKMX 3CUGA 1RCXB 3EPMA 4XAPA 2CLEA 2D20A 2ZBTA 1TJ0A 3UNTA 3T07A 4GYKA 2FPTA 1TZ7A 4GXPA 3UZ5A 1Q6LA 1M68A 1KRAC 3UXIA 2QVHA 4C90A 5LHFA 1JD9A 2EPOA 4IFOA 3UCDA 4I5UA 2D1ZA 3P0XA 1PIGA 1W2VA 1GVEA 3V35A 1BQCA 1SZRA 4Q3MA 5HPOA 4WXYA 1I0BA 5GNYA 5ABFA 3S8HA 4UNLA 3CMFA 3FK4A 3IJ7A 5CSRA 3IV3A 4JBRA 4Q8TA 3PN8A 4LY4A 3B8VA 3LMZA 2VEPA 3QQWA 6REQA 1MEWA 2W67A 3UPMA 1OHLA 3NQVA 3USZA 3CHCA 1J2WA 4FIQA 1FA2A 1ZBVA 1PBGA 2QMKA 1SR9A 4XUGA 1KCXA 2R91A 2HXTA 4R27A 3AMKA 3LHTA 3UZJA 1R3RA 3EYPA 5F2IA 3HF3A 2E6FA 3PG9A 3ZS4A 1EJ7L 1OC6A 4QIUA 1V93A 1PYFA 1BVWA 4GQBA 3BOXA 1U1HA 2YA2A 1BF2A 3NM1A 3VX1A 1TPVA 1N8FA 3SM0A 3T0CA 3CT2A 3W1XA 3IAQA 4IZGA 3S47A 5J5RA 1M6JA 5D05A 3ZLHA 2C1GA 5AC7A 5K4ZA 4LCQA 1GHRA 4OECA 3GU1A 3NPVA 3LPGA 4LFYA 4WUIA 3RMJA 3WK2A 3IUHA 3H23A 1A5OC 2C1HA 3EPOA 4K36A 1V02E 1TRDA 2X40A 1FWFC 1SQ7A 2XISA 3W83A 4MB3A 3BLLA 2F7FA 4YHGA 1I2OA 3LRKA 2ISFA 4GYFA 4M51A 1VR6A 3T2OA 4DWSC 1H63A 2O9OA 4ZTXA 2FGZA 4FS9A 3OBEA 3UT0A 4N9BA 2KAUC 3DFNA 3HIJA 4KESA 4HTBA 2XTKA 2B0MA 1TTIA 3SQMA 1X6LA 3HM7A 2XIOA 4TMBA 4LBSA 2VFGA 1AD1A 3GHUA 1PTDA 2H9AB 2OWCA 4KS0A 5K9DA 1HNYA 3PSWA 1IIHA 2UWFA 1LBFA 2B31A 3SURA 1F61A 1H62A 4EAYA 1ZPTA 2A6LA 2VFEA 1XLEA 1GPFA 5FEZA 1FKXA 1GOIA 1L8PA 2E9BA 3OEXA 5DXXA 4YTQA 2OLSA 1CXHA 1GK8A 3BMWA 1O1ZA 1IXQA 3OVQA 4Q7IA 1VHCA 3CTTA 3FA3A 4HIBA 3FYPA 3CUXA 1V6VA 2DH3A 3AZTA 5FJTA 4NAEB 3H55A 3TX9A 1MQPA 4FOKA 3ONBA 5I3GA 3EZ4A 3QTGA 1XIFA 3L66A 2E77A 3H26A 1OT2A 1B90A 4S3CA 3KRBA 4GH3A 3NPWA 3O2LA 5I3HA 5D9OA 1TTQA 1IQ8A 3AIQA 4WY0A 4A2RA 4UR9A 5AYBA 4EE9A 1XL9A 2WMJA 1Q66A 1G0CA 5KZMA 4AWEA 3W7NA 2EF9A 1EWEA 1DKWA 4JKKA 3HV9A 3E3HA 3LHUA 4IPPA 1E43A 2FZDA 4AF0B 4E2DA 2IKIA 1E5NA 2OJPA 4DZHA 3T0AA 1WV2A 4MF4A 2R8WA 3EMZA 2EPMX 3TDFA 3W25A 3FHQA 4UC5A 3BLDA 4KPLA 3S6OA 2VEIA 3WLJA 2PODA 1HGYA 1F6KA 1YDYA 1DWJM 4IF2A 3XISA 1QCWA 4DHGA 5JQ9A 4XIAA 1H7WA 1F5ZA 2YCLA 2REQB 4P8XA 4Q4MA 1DXFA 3AALA 4I8DA 3ZXWA 3CZJA 5AC5A 4NY2A 3TXVA 3GNXA 2BX7A 3KVJA 1GUVA 4KBXA 1CGVA 1AQFA 2VC5A 5LXXA 3WBEA 3IJDA 5HATA 1W56A 3VPLA 4EXQA 3UP8A 3EWYA 1BHGA 5FL0A 1W9DM 1FWBC 3DG3A 2HK1A 3B03A 3O8AA 3HPXA 3NQBA 3TTSA 4S3FA 1TWDA 3UYIA 4KT2A 4Q7BA 1PXGA 2XFWA 3R2GA 2V8ZA 3ITOA 1TV8A 1EP2A 1VBUA 3G3DA 1DIDA 4X2PA 4C65A 3DESA 3LGGA 1TX2A 4XKYA 4GC3A 3HPZA 5RUBA 4ZQNA 2PSNA 1NTHA 1LOQA 1X1ZA 5DBTA 2BVYA 2Y5SA 4DZIA 4EF8A 3RPDA 4GVIA 1JUEA 1Q63A 1OVDA 3VIOA 4N9DA 3ITGA 3VOIA 4HJFA 1Q4NX 2Q6ZA 4Y9MA 5H2ZA 3PANA 3TC3A 3BGJA 3LBCA 2BODX 3ZR4A 1GEHA 4KCWA 1A5AA 2MANA 3AYVA 3PTQA 1DQXA 4EXAA 3G1XA 1C9WA 4EAMA 3ITTA 4DUWA 4PMJA 2J78A 4PMYA 3W7EA 1E70M 4DWSB 4NKCA 8CGTA 2C13A 3O6CA 3VKJA 3VDHA 4PL1A 3DAQA 3B9NA 1XD0A 1NF7A 4LYQA 3GHSA 3HFTA 2DZVA 3WDRA 3TQ0A 1PE1A 3CIXA 4UBPC 3A3XA 5A94A 2E8YA 1K4HA 1WDQA 5BRPA 4REQB 5JH2A 3W3OA 4GG9A 3GIPA 4Z08A 3NPUA 4G8TA 1BGGA 4PE8A 3GVQA 3GU9A 1V5XA 2ZRYA 2PEVA 1JCNA 4LB4A 3R7MA 1AH3A 4ZA0A 4PULA 3IACA 4Q6XA 5C9ZA 2ODOA 2DEPA 3II1A 5J5DA 3N12A 3R8RA 4AEEA 2GJPA 4HOXA 3DGRA 3WFZA 3CXOA 2VVSA 4W85A 4BJHA 4GMEA 3CIVA 1F05A 3A4JA 3B8DA 2HPIA 9XIAA 2PWHA 2ZXDA 3B8TA 1VC4A 1W9PA 2E1DA 3MKVA 3L4ZA 4PTXA 1IEQA 3RUBL 1OY0A 3AXKA 3SCQA 2WNWA 3W70A 4ERIA 4Q4QA 3VNIA 2V69A 2YA1A 1US0A 4YVVA 1ZY9A 3MMWA 3MVIA 3H4GA 4HZ7A 3FJNA 1IWBA 3NL2A 4EPDC 1SW0A 3MC5A 3QF0A 2XIIA 4ZZ9A 3WQDA 3VCCA 4KRUA 3C6CA 3O0KA 1ZB5A 4AU0A 1HO1A 2BGQA 1Z6KA 4IMAA 1SYTA 2OKOA 3RJYA 4A3YA 5BOFA 1HKMA 2E3ZA 1KCLA 7TAAA 1H7RA 5G4WA 5C8BB 4E3TA 1THFD 4ZMGA 4W93A 4LUYA 1R8LA 5TIMA 1YTEA 3GUWA 1T0OA 1XSJA 1F3WA 3TYAA 1QHZA 4XAZA 4ROPA 2NQHA 3HG5A 1J96A 3QY8A 2DVXA 1DWAM 1PX4A 4MLRA 2CHRA 4LW7A 5T91A 4NX5A 5FEPA 2ZA2A 4M8UA 4MZ1A 1WX0A 3LSCA 1DE6A 4AD5A 5BMXA 1VQTA 3I3EA 3W7RA 1MW2A 3N17A 3PZGA 4MWAD 1RA5A 1L2UA 1CLVA 1TRIA 1LT8A 2CW6A 2Z27A 3C2RA 4LVBA 2WZEA 2GYIA 5IFPA 4XQ6A 3K8MA 1KR1A 5EMYA 3V5CA 4OHQA 2P0IA 1CNVA 4LBRA 2OFJA 3M5XA 1BG9A 1MMFA 1JJKA 5C7HA 1FCVA 5G2HA 1RJRA 3A9IA 3OBAA 2IQTA 5I6SA 1VGAA 3P80A 2H6RA 2BASA 1UHVA 3WQ6A 5EA9A 3GG7A 1PZ2A 2X1UA 1JZ7A 5SWUA 4O14A 4D9PA 2ASHA 5HK4A 4AB4A 1OD8A 1OCQA 5CPLA 1L6WA 3JRKA 1V7YA 4KWSA 1H50A 3VDGA 3WEOA 3BW3A 3AHYA 2ZYFA 1WA3A 2ISWA 1EA0A 3RN6A 3RPMA 2B81A 2C15A 1UWRA 1TMHA 4WJEA 3MUAA 4LTSA 2VP8A 3HQ1A 3IJQA 2ATSA 3N6JA 4KEVA 3NQ8A 2YL5A 4G7FA 1TPEA 4KRZA 2C16A 1YHTA 1X97A 2W9MA 4NILA 2C71A 3QY7A 1SJBA 2WSRA 4DELA 1Y0EA 2P0OA 3PAOA 4H9TA 1H51A 3TA9A 4U4MA 1FP9A 4HTYA 4FOUA 1EO7A 3C4UA 1ISWA 4MAVA 2CKSA 1D8CA 1YW1A 3UEQA 3JU2A 2RDXA 1NEYA 2OKTA 3FV9A 4MVAA 1N8IA 3LI1A 2Y5JA 2YJQA 1BGAA 3E5PA 1HN1A 5M5DA 1V3MA 1B4EA 1GQKA 1JUBA 3OA5A 4IJRA 1JCYA 2O4QA 3H7RA 1TVLA 3RO8A 4Q8MA 5LIKX 1R9ZA 1MW0A 1S2TA 1QO2A 2XWDA 1EWDA 4BR1A 3TMQA 3A5VA 5C2XA 2R1PA 4EF9A 4ZE4A 3RX4A 4X9YA 3C0SA 1J6OA 1EKOA 1UOZA 3C56A 3ZSSA 3CK5A 3TQKA 3BGAA 5CZSA 1LL4A 1TPWA 3D3AA 3HGJA 2BXVA 1DTUA 4HU0A 3T0BA 2DSWA 2P8BA 2AAMA 3GNRA 2VOTA 5AB3A 4JEQA 1WAWA 4V1YA 3A21A 3UJRA 2DIJA 1L6YA 4AXNA 8XIAA 4DX3A 5IDIA 1F6PA 4S39A 3CL7A 4B16A 1P0BA 5FL1A 3LXCA 1RA0A 1AW2A 4XAGA 3FS2A 2GOKA 3KVKA 2IMRA 2GJXA 2W79A 4MHBA 1XYCA 1S38A 1OG6A 4C6MA 4RZ5A 3UWZA 2RJHA 3U4AA 1DWHM 5CKSA 3VIFA 1X1OA 4JX5A 3NXLA 4L9YA 3SCNA 3K2GA 3LS9A 1LBMA 1FUYA 1DJHA 1JCXA 3BWWA 2W63A 5E6YA 2Z6JA 5B80A 4GKTA 5J8LA 3W84A 3LZ5A 5HULA 1XLFA 2ISVA 3MMDA 2XGBA 1XG3A 4LQ1A 4FX6M 2HVNA 1RVKA 4JTLA 3WLRA 4X63A 2QCGA 3H7UA 1AK5A 3VNLA 1RBAA 4PYSA 1QNPA 2VGBA 1DXEA 3SEPA 3ZZ1A 4MUPA 1A5UA 4Z1DA 3UD6A 5CH9A 3DBNA 2UBPC 2GVGA 4D6EA 2BMBA 8A3HA 1KKRA 4KWWA 4W7UA 2RKXA 3BJTA 1VLWA 3R8HA 1GOMA 4ERAA 4RR4A 2Y0FA 2Z1XA 1EFZA 1S2WA 4EP8C 2VFFA 3V1HA 1JPDX 1N55A 3CWNA 3SCOA 3VXGA 1WUFA 3GY1A 1FWRA 1UOKA 3WKZA 1DBTA 1R5YA 3QOMA 4JTAA 4Z2IA 1I2PA 4IIBA 4G7EA 4B9ZA 2G4JA 5MKGA 3GC2A 3QTPA 2YCJA 1X8CA 1WOBA 4ZOCA 3FJLA 3KP0A 1GT8A 3WBWA 1YADA 1E9IA 1A47A 2OT0A 3DXIA 1GG0A 3PZMA 4D1JA 4IGHA 4MB5A 2NQJA 1EZWA 4HSOA 3T0DA 3BG9A 2H3BA 2PDKA 4MY9A 2E67A 1W5OA 1HT6A 3BSMA 3SDOA 4B2DD 3C2VA 1EJXC 3IVSA 4MJMA 1ICSA 5AZ0A 2X8RA 3UJEA 3F7JA 3KWXA 2J66A 2H8XA 1O4UA 4E8CA 3PVFA 4RNJA 1UMYA 4LH8A 5CPNA 3L5AA 3DBPA 3OW1A 1XIJA 4A8NA 3W37A 3EWCA 1QXLA 4TTUA 5HMDA 1KRMA 4QDMA 2C14A 4GIYA 4KH2A 2DORA 1GORA 4R9XA 3STGA 3ZM8A 4NNAA 3PTDA 2VELA 2VR5A 5A5WA 2A7RA 4WIWA 4CNSA 1KC7A 1H2JA 3UWEA 1I75A 1RQHA 4G5DA 2KZHA 1AUSL 2YYUA 2VR2A 4AIBA 4NUWA 3TSDA 3QSRA 3BLIA 4LYPA 4C6CA 4R7JA 1GG1A 1UWTA 1YNPA 5JUVA 1LUCB 3E2VA 3FYOA 3BV7A 3W73A 1OFBA 2PCEA 1S2VA 2WBGA 4QCFA 1TPUA 2ZDRA 1UR4A 2DQWA 4ZODA 3FSUA 4RNHA 1YEYA 1LWJA 3KBNA 4JTQA 2WZIA 3UWUA 1W1A1 3P82A 4M56A 3UG8A 5EU9A 3KP1A 2HISA 5B7ZA 1N8WA 1HQTA 3P8IA 1GVOA 1AL7A 3W81A 3LHVA 2NQLA 1MI3A 1MUCA 3L68A 4FIRA 3UR8A 1XSIA 1Q6CA 2VD9A 3IJLA 4GO9A 3CEUA 4P8WA 2PRMA 2Z7GA 3ITVA 1Q6EA 3WSUA 2AOSA 1WBJA 3RHGA 5BCAA 5JVLA 5HNTA 4DRSA 2ZC8A 2ZZ2A 3SIZA 4K8EA 2VM8A 4GO8A 3B06A 1AJZA 3K46A 4W9TA 4FEZA 2Q8LA 3O05A 2NQ9A 1RPKA 3EX6A 4L6HA 4ATLA 5GNXA 2CLPA 2ABBA 3OHIA 2VDHA 4JKLA 1UKTA 4JIQA 3S1WA 3F2BA 3KOZA 1XLAA 2J27A 3VU2A 4TV5A 2EPHA 4FAMA 4UTIA 2DT0A 1ZP3A 3GRIA 3ALFA 1VJIA 2WHKA 2DVTA 3MWCA 1ECEA 4GRSA 5BU9A 3B8UA 3RILA 3WMCA 1I6NA 2HE8A 4HSNA 1X96A 2XIBA 3I3DA 1J5SA 1PKMA 4IQLA 2X1TA 5FESA 2H9AA 3EDFA 4IIEA 2EO7A 2C79A 1K3UA 3LEPA 3VD4A 2WMHA 2YOCA 3W7HA 4AWUA 4CCZA 4NXSA 1O5RA 3T09A 4O13A 1B4KA 3EX2A 3OZMA 4MPQA 5LNVA 3SFWA 5C70A 1HTIA 5K9XA 1KGXA 1P6WA 1VD6A 2J47A 2D3LA 1E4IA 2ZUUA 4MJ2A 3BCFA 4RW3A 4MSSA 4RKAA 3VNZA 1TVPA 4NAEA 2YXXA 5KMYA 1QU4A 2R9RA 3E2SA 4GY1A 3VGHA 1DVJA 3VAVA 3KE0A 4I9MA 1CLXA 3N19B 4KWOA 4DLMA 2ZOXA 3TC7A 3QR3A 1IGSA 1QATA 3P60A 2WJFA 4GBUA 1FTXA 1TJ2A 1MXSA 2X2GA 3KX6A 4KRTA 4AD2A 4MOZA 1VFUA 3Q2DA 3FVDA 1POKA 4W89A 4V33A 1H61A 1SSDA 1ISZA 2QCFA 2OT1A 1G4SA 3USBA 1GQLA 5FJOA 1FWEC 3WDPP 1M3UA 4AVOA 1K8XA 3LA4A 1WXYA 3S4TA 1XLDA 4NZ4A 4EXBA 1UWAA 4B5WA 3JVAA 4F0RA 1JCTA 1TPDA 1CX9A 4FR1A 4A22A 4Z2GA 4PB5A 3ITYA 1I4NA 3NQAA 3NNTA 3FJ4A 3VK5A 4ATWA 2B7OA 1J8VA 3GDTA 3WLMA 1Y8BA 3DYMA 3BURA 3L2IA 2INZA 4J5NA 3ZLFA 4C6LA 3B0XA 4E2OA 2XIMA 1OGSA 3M0IA 4L56A 1RXOB 2AL1A 3CHFA 2ZUVA 3N4EA 2I5GA 1A5MC 2QPSA 5IRPA 2Y88A 1ICPA 1B9ZA 4LAKA 1HL9A 3VKAA 4PCSA 3PZTA 3N25A 5FSEC 4Y6GA 4DEFA 2REQA 1U83A 2F84A 4N4QA 1W3NA 4CNOA 4Z1BA 1F07A 1EL3A 3TSBA 7XIMA 4WJ8A 3MJYA 2PLKA 1T99A 4L1GA 3QV8A 5FF0A 4QE4A 1W32A 1HO4A 2HROA 1A5KC 2AAAA 1FY6A 3FFSA 5LYRA 2ZX9A 1JEZA 1WE5A 1ZU8A 4PL2A 4ZXOA 5IM51 3QV6A 2PLMA 1NDZA 3QR1A 5LA0A 3S2JA 4ORIA 4XSMA 1QPRA 4JTIA 3W7GA 4ADSA 1ZP4A 3F4CA 3O3RA 4OE7A 2YCEA 1HP4A 1QI2A 3M16A 1W9BM 1G4TA 5DQPA 1YE4A 2QPXA 1H60A 1EGMA 1VBJA 3TYCA 4PODA 2YKKA 1KW1A 5A8OA 4HU8A 4CU7A 3A4WA 5F2MA 2J9ZA 3AXMA 3GYCA 4NYUA 4Y2WA 3T05A 1WKYA 4GHRA 2Y2WA 3STPA 1K7EA 4J3ZA 1W1B1 4Y9AA 4JHZA 2Z2BA 2VHLA 3SUVA 1V79A 5A6MA 3PS7A 4LEQA 3T44A 3UR5A 5M3WA 1ISXA 3HPFA 4DWSD 2J25A 2HVOA 3V1PA 2PWDA 1E0TA 1TIMA 5I3KA 3RF9A 3EWZA 4MYXA 3B9OA 3PR2A 1KBKA 2I5QA 2WYSA 3W7PA 5KTLA 2XH4A 1CB2A 2HV5A 3VIGA 3VNDA 2FHFA 3TC6A 4LJ3A 1KB3A 2F8QA 3WQ4A 4J3VA 3F5JA 4M1BA 4F0LA 1S1RA 2FMOA 1B3WA 3PBUA 5CSUA 1WPCA 4MZYA 3PWGA 3RNDA 1BQGA 1JXJA 2I7GA 4QITA 4YCOA 4JEJA 1EXPA 2G3JA 4REQA 1MZRA 1OIMA 2ZXAA 3KBJA 3M0XA 1H0IA 5CZTA 1AQ0A 4DYEA 1IZKA 3AC0A 4D6IA 5LZLA 4IH3A 3KTCA 1DWIM 4AD0A 4A29A 1AG1O 5KEZA 2NUXA 3SUWA 1TV4A 3SCVA 1A3WA 5L9FA 2PAJA 3OA3A 2Q02A 1JAEA 2V82A 4GXWA 2TMDA 3H53A 3UA4A 4X0VA 1I1WA 2DY3A 1ADDA 2QDEA 4JFVA 4P7NA 2OSXA 2GOUA 4ZVJA 3BW2A 3WQEA 4JTHA 4K8GA 1GGOA 3L21A 1VYPX 3AOFA 1V03A 4RE3A 1MQRA 3QV9A 5DY3A 3T2QA 3WBXA 2D0HA 2W6RA 1M03A 2WW5A 3BLFA 3MP4A 1AW5A 5G1TA 3RDKA 4IXXA 3B0PA 3AYSA 4E8DA 4OZOA 1UKSA 1R9YA 4Z1YA 2HWGA 3SGZA 3P5YA 5DMNA 3CYJA 1RP8A 3R94A 1E0UA 1HFBA 1W1YA 2XJ7A 1O5KA 1W3JA 2VZOA 2H8ZA 4WVXA 1G1YA 5DCEA 3AO0A 2OOGA 1CXFA 3B8SA 1B3VA 2QJHA 2AMXA 3STEA 1BFNA 4WK9A 1K03A 5E9XA 2OWXA 1KM0A 2VTFA 2XVPA 2GQ3A 1FBAA 4H7VA 1KM4A 1P0EA 4O1AA 2HRWA 1EUNA 1XX1A 5FF7A 5TAOA 1OCBA 1UR2A 3LBMA 1VFTA 3MI6A 1GJPA 1EJUC 3GVRA 4C91A 3BSGA 3AXHA 1V51A 1G69A 4JCLA 4GZ7A 5ABGA 4O8AA 1XHGA 2YLLA 3M6DA 5CJ5A 2DQXA 2QS8A 2VC6A 6ENLA 2GK1B 2A6NA 4O0KA 2PDMA 4WKAA 3R0KA 2CFFA 4JS3A 4UMCA 2Y85A 2EPLX 2G8ZA 1GJUA 2Y8KA 3NGFA 1WUEA 4DXVA 3WLLA 2Y8UA 3UVAA 3H4XA 1ESWA 2FPVA 4OVXA 2VC9A 3AWNA 1JQVA 2ZE0A 3VDAA 3WLOA 4H9MA 2YSWA 1YX1A 3UG4A 4RE0A 3WFLA 3WNNA 4IM4A 1GOXA 3UY7A 1N7KA 2NT1A 1P6CA 2NQZA 2Z1WA 3EEGA 5D8ZA 4FX8A 2V5BA 4S1FA 3H8AA 4A2SA 3CZLA 1JYVA 2J88A 4R9OA 1RLCL 4S3KA 5FEWA 4QAWA 2V5JA 3VD5A 3GVVA 1XIGA 4MY1A 2EAWA 4ZOAA 1A4LA 3WJXA 4LV9A 1HJVA 2YL9A 1O95A 1SR0A 2XUCA 3MKCA 1AZ1A 3FNDA 3VIJA 1OEPA 1AQMA 1EDGA 3GWQA 3KLLA 4POCA 1QFEA 2XINA 3WNLA 2UY5A 1UUMA 2VCBA 4LVDA 4GYPC 1PAMA 2MUCA 1EXBA 1RD6A 2CLFA 3VGBA 4UTHA 4PRWA 1RZMA 1S5WA 1HKJA 3TTQA 4PBEA 4X61A 3NZQA 4GY7A 4PMRA 4S38A 3RCYA 2YYTA 3UXAA 3NEHA 2ZRUA 3VOFA 4HYWA 4NXKA 1TJPA 1BG4A 4GCAA 5EMKA 3L0NA 1WXZA 3ZFHA 2V5LA 2X30A 5T9CE 2J7BA 1VFFA 2G50A 3A23A 4RPPA 4M6VA 1K70A 4AY1A 1WKEA 4QLKA 3FYYA 4DI8A 3PPGA 4N2YA 2HSAA 2W3ZA 1FXQA 3KBMA 1VCVA 5DO8A 4MG4A 2YDQA 5A8PA 5DX7A 3URQA 1EPVA 2F2HA 4F4RA 3ECQA 2QPUA 2J9YA 4LNCA 1WKDA 3S1UA 3AIEA 4OBSA 1R3VA 4Q33A 2AQWA 1JDAA 2OLHA 4MYAA 1UA3A 4K6AA 2VX4A 3TSMA 1J18A 1H7OA 5A6BD 1FHVA 4P8UA 3BG3A 1Q65A 4RUBA 4HZMA 4F2TA 4W4QA 2BBFA 4FNRA 1CXEA 3L9CA 8TIMA 4LALA 1PJ9A 3IEBA 3WLQA 3ITXA 3ZVIA 2IPWA 2PTWA 2HK0A 3C3UA 5I78A 4K8HA 2FTPA 1Z32X 1JCMP 2BDQA 3GFZA 4O19A 1W3KA 1KQZA 3HGOA 1S3HA 1KNWA 3W1UA 1DORA 3WL1A 3B3DA 1P0NA 3L65A 2QV5A 2POZA 4UUIA 2I5IA 1M65A 4Q4SA 4RK8A 3CAVA 3WMLA 2HTMA 3AHZA 3WDQA 2RH9A 3R0UA 1XDJA 4HYRA 3VIPA 2BVDA 3MMTA 4XD4A 2X05A 1V3HA 4M80A 1ZTVA 2WCGA 3GB6A 2EG8A 3CJPA 2HS6A 3KRSA 3TN6A 3SO7A 1F2JA 4HZ6A 3F2CA 2VZSA 1Z41A 1XLGA 2A3LA 2YL8A 1ISVA 2WB5A 2Q01A 3WQPA 4XTDA 4P5UA 3DHFA 1LG1A 4JIEA 2BHYA 4HNLA 3LLXA 5HJXA 4GX8A 3VIKA 2X0YA 4L9XA 3KL3A 2GVEA 3LCIA 2CWNA 3AIVA 4A8LA 1BXNA 4D6DA 1Z44A 3EKZA 3W4RA 2PF0A 4HMCA 4QLJA 3DG6A 4KFOA 5C9RA 4YTTA 1W91A 3DFTA 5CZJA 2WQDA 1SSGA 1A5LC 1VCGA 1AODA 4FLOA 1S5TA 5HQLA 2O92A 2PBOA 4CQBA 2IW0A 2GSJA 3HURA 1RCOB 2TAAA 1IEXA 2OELA 1SFSA 3HA1A 1JZ3A 1SFTA 4CEXC 1M04A 1ZBCA 2NX9A 4AISA 2G3NA 4XWUA 3OB8A 3UXDA 4A35A 4LS1A 3WYZA 1I2QA 4A3HA 4OKDA 2TODA 1JPIA 2Y8VA 4RZ4A 5DCBA 3I3BA 1EHAA 2WSQA 2QUTA 3M43A 3VNKA 2J7GA 2FKPA 3KRUA 3S2NA 4AC1X 4S3BA 1LQ2A 4H7CA 1HJUA 2WKGA 3SSJA 1S2CA 4Y96A 2WHJA 4UR7A 4KKXA 5FAGA 4I8YA 4ZXLA 1NDVA 1YYAA 2VUNA 3RPTA 3NSXA 4EACA 4CD5A 4GC4A 2ACQA 1SW3A 3LM7A 3O15A 1NH6A 3SQSA 4Y7EA 4AD1A 2D3NA 3GFXA 3CBWA 2VO5A 3W7IA 4O8RA 3DDMA 2HPMA 3VIHA 2I1OA 3F5LA 3PPCA 4XBJA 1JDDA 4GUHA 4MKSA 3B0YA 5D09A 3M0JA 3EMCA 2G3IA 5A8QA 4RV8A 4S23A 4A3RA 2CESA 5CPSA 1EP1A 1GW9A 1ZQ5A 3FN9A 4HU3A 3OBKA 4BI6A 3QQ1A 1EGVA 3OZOA 1FDZA 4R7OA 4XZLX 1V0MA 5AVNA 1JI2A 3CLMA 4OGZA 3DFHA 3WG6A 3WLTA 3H7VA 3IIVA 4QJ3B 1WBHA 3GIQA 2QF8A 3MSDA 4KF1A 5AZ1A 4ACYA 2QJNA 1C91A 1UQYA 4MADA 3RLUA 2C1IA 3AIWA 4C6NA 3T6CA 3P74A 3E38A 3GH7A 3PULA 3IIOA 3M9YA 3MVTA 1NM9A 1UASA 3S6DA 2FHBA 4ZE5A 2BHZA 3WBYA 3W26A 4X0NA 3M0MA 4NAFB 1PIFA 4YXGA 2XFYA 1W37A 4D6FA 3EWUA 3EXSA 3WK1A 1GZJA 1JQXA 2E09A 2PP0A 2ISDA 4FLSA 2CETA 3THCA 3QMTA 3DCPA 3N1AA 3LXBA 3IARA 3EWBX 4IIHA 3RXZA 3W72A 1DHPA 3G77A 1K8YA 2FVLA 2OXNA 3HMCA 4O18A 1LM1A 4DNMA 3VKCA 3ZWSA 1PVNA 5DEZA 1YLVA 2A85A 3LMYA 4U3CA 3NOYA 1J5TA 2DW6A 3BTNA 4O28A 4H9XA 2FDSA 2D0GA 1HVQA 1ML1A 4EWND 4QEEA 3K4WA 2WANA 3KBVA 4QEHA 2WNNA 1U2YA 2WHLA 3TCEA 1TV3A 3JUGA 3PC0A 5AHNA 3THQA 3ALGA 3S6TA 2VUYA 2GPTA 4MPKA 3WY1A 3CV7A 2E9MA 2WKLA 3MDUA 5JH1A 3KCLA 4PCNA 4GKLA 2BY3A 4QNWA 1WZMA 3RM4A 3F4DA 1QHOA 1XQLA 2J7FA 2R1LA 5EFFA 1E73M 1JF5A 1ZJIA 2EPNA 1P4CA 4I9AA 3D47A 4HNOA 1GYNA 4J7RA 3SAZA 4BF9A 3RGTA 3ONCA 4Z0SA 5A2CA 5EY5A 1W8SA 2JEQA 1XWYA 3E5BA 2PE4A 4FX7A 2EG7A 4PUMA 4RPQA 1CWYA 2FB3A 4JX6A 1VRDA 4KFNA 4ML4A 4W8BA 2QIIA 4P2VA 3R8GA 2BB0A 1IEIA 1YTDA 4XZWA 1ONWA 1PZ3A 4IUGA 1OCNA 3D46A 4DPPA 1MZHA 4B92A 2Z7KA 1D8WA 4Q4PA 2G97A 3B05A 3Q45A 2E68A 1LCOA 2IS7A 4MWAC 1OADA 1XG4A 4TQTA 2UY4A 3ZOAA 3DIPA 2L5HA 1FH8A 3ZWTA 2QCNA 3W53A 4Q32A 2WNQA 2Q3RA 4LS2A 2FFIA 1UD6A 1L2QA 4HMNA 3PBVA 3ZR6A 2GDQA 4OT7A 4GACA 4WEVX 1NQKA 3FGCB 3MUXA 4A8RA 3MO4A 2GUYA 4HD5A 1QOXA 5I24A 5CG7A 1DJXA 3IRDA 1TTPA 3ZJKA 2E5CA 2H90A 5TBOA 4B90A 2NWSA 4C7DA 3LY0A 1V08A 2DUAA 3TK7A 1OJXA 4OBRA 3WEZA 3ES8A 2V3EA 3MB9A 5CXPA 3S1GA 3E2RA 2WPBA 4NI8A 3W02A 4Y9NA 4BKNA 1Q6OA 1C9DA 1K8CA 2VCAA 2VNCA 1EF2A 1B3YA 2RDUA 4LF2A 1ZBKA 3CUFA 1ECQA 3G1YA 1XFBA 1TCMA 2GUUA 1DOSA 3QPYA 4Q8WA 4JFWA 1B3OA 1FCBA 2WVUA 3M4HA 2OQYA 2OQLA 4LVFA 3VOGA 2GL5A 1E1CB 1M41A 1WDDA 3W75A 4B4FA 3P61A 1NWRA 4N6FA 1XYMA 3W2LA 2VI0A 3L0KA 1XIMA 1RR2A 1Z7AA 5KSWA 4PA8A 1QI5A 1XYAA 2VT0A 5F7UA 4KERA 4N7QA 4JIIX 4EKJA 3OJGA 2ZX5A 2GGGA 3M0LA 1MQQA 1GKPA 2OTDA 4K38A 4ORMA 5DFAA 2VWSA 4DUOA 1KXQA 4ZFCA 3DGBA 5D2XA 1H4PA 1CT5A 3DECA 1UWQA 3W2UA 4FHAA 3MY9A 4NZJA 4UQBA 3HB9A 4HHMA 1E55A 1UD5A 2CITA 2E1WA 4QCEA 1KRCC 2GLKA 4CN1A 4IQJA 4PRRA 2Z00A 5A8GA 3DHPA 4J2PA 3BAYA 1NIUA 5H91A 5EKYA 3RRXA 4JCMA 3TW7A 5EYWA 3AS2A 3UESA 4MY8A 1CEOA 2WZHA 3FAWA 3H2EA 3P7YA 1M1BA 3ANUA 3A47A 1LJYA 4TVCA 1SZNA 2E5BA 1XLJA 4JY8A 4XTIA 1E1EA 3TQPA 3W38A 3GBEA 3R43A 1ME8A 3EAUA 1I9CB 1B1YA 1E6ZA 4C60A 1NJJA 3V7PA 3M0KA 3QFWA 4JD4A 1EB3A 3B8WA 2WSKA 5H1WA 4H9YA 3WH9A 1SJAA 3LPFA 4IJCA 3TJ4A 2PTDA 4ZGYA 1QVBA 1GVQA 5DBUA 3IWPA 4TO8A 2BLEA 4XG1A 2A7NA 2CERA 1G9HA 1EX1A 3R12A 1O94A 3NDZA 4MM1A 3W1AA 4AQLA 3FAXA 2IKGA 3OLGA 1Y7VA 5EPDA 1TWIA 1U1UA 1V6UA 1ZJAA 2VVNA 2IKJA 1FCUA 3GNDA 1JNDA 3KVLA 2WVVB 4ACZA 3R1ZA 1XIEA 4DWDA 2O55A 2FDMA 2J6XA 2WBKA 2BNJA 2XG9A 5D9PA 5BXTA 5FCZA 2HDJA 3WFAA 3O7UA 4S3GA 2OGYA 1E51A 4OV9A 3CPGA 3B40A 3SBFA 1A50A 3DERA 1IR2A 2C19A 6CGTA 1FWAC 3BMXA 4MFEA 1ADSA 2WHMA 3N9RA 3GDKA 4UTWA 2YIHA 4MWAB 4J9JA 5K7JA 1OT1A 4ZFMA 4LBUA 3SRFA 3WZ0E 3CWHA 3MYOA 1WZKA 4D8AA