1BTMA

Triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
251
structure length
251
Chain Sequence
b'RKPIIAGNWKMHKTLAEAVQFVEDVKGHVPPADEVISVVCAPFLFLDRLVQAADGTDLKIGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAGQTNAVVASQVEKALAGLTPEQVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRLFGPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGPLVGGASLEPASFLQLVEAGRH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIOSEPHOSPHATE ISOMERASE
publication title Crystal structure of recombinant triosephosphate isomerase from Bacillus stearothermophilus. An analysis of potential thermostability factors in six isomerases with known three-dimensional structures points to the importance of hydrophobic interactions.
pubmed rcsb
source organism Geobacillus stearothermophilus
molecule tags Isomerase
total genus 91
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 1995-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1btmA00
4KFNA 4Y6GA 2WSQA 3EX3A 4R34A 5LNVA 3PB2A 1IXQA 1JUEA 2V5BA 1O60A 2JGQA 3JR2A 4JDYA 3S9YA 1OHLA 4PODA 1B4EA 4LVFA 1FCQA 2YGYA 4UMAA 5DY3A 1GG1A 5I3JA 2CLKA 2C6QA 1YXDA 4AHPA 1ICQA 2YYUA 4Z1BA 2CLEA 3MP5A 3O06A 1LORA 1WA3A 1OYBA 3EWZA 2VFIA 1XXXA 4O1CA 1H60A 4UC5A 3PY2A 1AK5A 1LBMA 1H7NA 1GQNA 3PSWA 1I2PA 1JRBA 1FWNA 3PS7A 1B57A 1HUVA 1FQ0A 2VKZG 1CX9A 2F7FA 3EXRA 4ICNA 6TIMA 1FWRA 4YXGA 1VQTA 5KINA 3NGJA 4OV9A 2OJPA 2Y61A 4MUZA 2RDWA 3S1UA 3IVUA 1T8XA 1KFKA 1KBIA 1CI1A 3P61A 1H1ZA 2E6FA 4PTNA 4HSOA 1QNVA 3W1MA 1I2RA 1PVNA 3LHTA 3INPA 2ZFAA 7TIMA 5LKYA 4QM1A 4QITA 1LROA 3GNNA 6ALDA 5FEXA 2DORA 1MEWA 3TFXA 1PHQA 4S1FA 5AHFA 1WV2A 2CLFA 3VKJA 3ATYA 3DKJA 2HTMA 1G4SA 1R30A 1H51A 4GUFA 2NUXA 1GG0A 1EWEA 3G1SA 1S5TA 5HWNA 3SZ8A 3HG4A 1W1ZA 4PA8A 4RZ5A 3WFAA 3L0KA 2J27A 4OHQA 2WKJA 4CCCA 1SFLA 3NOEA 4O19A 1FWSA 2VEPA 3OIXA 2RKXA 2Z0IA 1R46A 5F2IA 5C2XA 2JGYA 2CZFA 4JTTA 1W0MA 5K4XA 3RMJA 4GUGA 4IPJA 3LTPA 2ZTKA 2FPTA 3NQMA 4Y90A 5DCDA 2AQWA 4U28A 4FIRA 1LRQA 2BWGA 3QSRA 4KWWA 2YYTA 3FKKA 1E51A 1JCMP 3S8HA 1DQXA 2QKFA 3EWUA 3MYPA 4DXVA 3W84A 2QCCA 3CEPA 2C15A 2QCDA 3W07A 2ABAA 1QCWA 4NJIA 2FB3A 3CWOX 3RU6A 1KM6A 1I45A 4FXSA 3STCA 4MIMA 4JTFA 1VJIA 2Y89A 1W31A 2ZZ5A 1FWTA 2OMAA 5AC8A 1ME8A 1OFEA 4RJEA 3R5EA 2QCHA 3W7RA 3JS3A 1OX4A 1MEIA 1QPNA 4PL1A 3C2EA 3TDFA 3STEA 3NEVA 1C29A 1OG0A 3GX9A 3SECA 2VFHA 3ABOA 4AHOA 3BW4A 4LY8A 4GUJA 1MXSA 2Y7DA 2X1UA 2QCFA 3M44A 4IPIA 4OWGA 4XZ9A 3QMTA 2ZZ4A 4IMCA 1XUZA 4O50A 2J88A 4BWLC 4N6FA 1DKWA 2E1DA 5LNUA 2ISVA 3NM1A 4R33A 3TU9A 3EXSA 4QNWA 1KLZA 2B7PA 2QUUA 1KLYA 3Q58A 3HPSA 1A5CA 2W6RA 3HGSA 5DBTA 3IV3A 4CQAA 3NL6A 1KM0A 3S42A 5KZMA 2Q3OA 2XN1A 1TTPA 1ML1A 1WBHA 5LGZA 4YCPA 5CPOA 3W1AA 4ZQOA 3NZ1A 1H7PA 3ABQA 1PCWA 4EF9A 4O10A 1XM3A 4ONVA 2Y88A 4L4LA 1GTEA 5DXXA 2VFGA 5LNRA 4UTHA 5SWUA 4M19A 4MZYA 3NVTA 1XBYA 1FDJA 4GUIA 2AAMA 1GTHA 5DCBA 3W7EA 4MYAA 1W54A 3G3DA 3S1VA 1SO6A 1QAPA 5LSMA 4DO4A 1J5TA 3TX9A 3PM6A 1IF2A 1P0NA 3I65A 3GLCA 3MP4A 4MJZA 3C6CA 4QSHA 3W1NA 4E38A 1LOLA 1TPB1 4MKNA 1RQHA 3QQ1A 4RCXA 4I9AA 4NX5A 1TV8A 2NUWA 3TSBA 4DO5A 5EL1A 4XKYB 2J24A 2CLMA 3A23A 2B0MA 4JEQA 2CLLA 1D3GA 3W7HA 3LV6A 2OX1A 1XCFA 1H63A 3GXTA 4AF0A 2ISSA 4IQLA 4W9TA 4JTJA 3UWWA 5AYXA 3HO8A 3G1HA 1LRTA 1H7WA 1EUNA 2GVJA 4MY8A 1TPH1 3RK8A 4YMZA 4XWUA 3IGSA 5C54A 1FXQA 2CWNA 2H3DA 4AXKA 3G8RA 3CB8A 1WAUA 5LHFA 4DBDA 3G1XA 1QR7A 2YW4A 3BW3A 3LERA 2X1RA 3T7VA 4K8EA 3CC1A 2Q3RA 2VFDA 2VELA 1G69A 4NXSA 1KFCA 4O1DA 3VCRA 3L2IA 2GPTA 4O16A 4PC8A 5GVJA 3IIZA 4X9SA 2V8ZA 5U7SA 2QJGA 2Y7GA 1WOBA 3NQDA 3N34A 4LT9A 1VLIA 4WY0F 3SIZA 1MZHA 4TO8A 4DO6A 1SW0A 4LV9A 5AHMA 5F4SA 1T0OA 1QDSA 4UFLA 5FF0A 2R91A 4NZFA 5AHLA 3W1LA 3EX1A 3B06A 1EB3A 4RKAA 1KBJA 4JDBA 3UWQA 2YR1A 2Y7EA 1O94A 5J5RA 4JIPA 3KX6A 3QW4B 1VH7A 4I7UA 4WY0B 4O14A 1X7FA 2A7PA 1O4UA 4JYDA 1TTIA 3A24A 3HGOA 4FNSA 4AWSA 2BTMA 4HHPA 1U5JA 1G7UA 5D04C 3BG5A 2DP3A 1VC4A 4LTSA 1FCVA 3H53A 2ZRZA 1TO3A 1VZWA 3DHDA 4UTTA 1EUAA 4M7SA 1OF8A 1JQVA 1LLWA 1H5YA 1ZALA 3GDLA 4O13A 3GDKA 2ZA3A 3DXIA 3O8AA 1UBSA 3WJYA 1L9WA 1TYGA 8TIMA 4OV4A 1YPFA 4H3DA 4MJMA 4P2VA 3FJ6A 1AW5A 4NJGA 3L66A 2PURA 2B7NA 3IIXA 3LLDA 3NQ6A 3HPXA 3HBLA 1RQBA 5F4WA 4HPJA 3BV4A 4JICA 1ICPA 4X3ZA 3P62A 4IJBA 3C0JA 4K38A 3P74A 1VYRA 4DPQA 3PVFA 3B05A 3TMQA 2C16A 1SW3A 2E09A 4CNNA 3P67A 3LDVA 3MHUA 4NX0A 5HJLA 1VGAA 3DKLA 4CQ8A 1D3HA 4FX6M 3M41A 2O7QA 3B4UA 1LBLA 1SZGA 1G67A 4GNJA 2GJLA 5IBXA 3GK0A 3W2UA 1Z48A 3L0GA 3W6YA 1DQWA 4QQ3A 3BO9A 1FCUA 3NQ7A 1THFD 2ZZ1A 2V82A 4UXDA 3GR7A 3VE9A 4LUJA 3EX4A 4JIQA 1EP2A 3O6CA 5AHEA 3NZRA 1Q3NA 3W88A 4GFSA 4BFAA 2ZRVA 4EOUA 2RFGA 2ZRYA 3DENA 4MPQA 4K7YA 5KTLA 3W7MA 1W8SA 3UPWA 3IEBA 1EIXA 1OVDA 4UMCA 4IMDA 2GQ8A 5LZLA 3C4UA 3NQGA 2I9EA 3O07A 3CT7A 3LCLA 1Z41A 4O52A 1X1ZA 4B5NA 3W86A 3SGUA 5D33A 2VEIA 3PB0A 1FX6A 3C3NA 2LLEA 1GVSA 3EWBX 1RV8A 1G7VA 2EF9A 2ZRWA 4YLWA 1L6YA 3NR0A 3TCEA 1FXPA 3P82A 5D2WA 4FEZA 3STFA 1Z42A 3QPYA 3L67A 2R8WA 1BKSA 3PG8A 1GWJA 3G1FA 2QCMA 4LVAA 3PUOA 2A0NA 4UTJA 2ZZ3A 2Y62A 3EKZA 2ZRUA 2BLEA 2A7NA 3FS2A 5D30A 3N9SA 1OX5A 3BK0A 2DZXA 3ZS4A 3FJLA 2EPHA 2W79A 1AL7A 1RQEA 3HB9A 4WQ6A 3T44A 3HG5A 2HS8A 1NVMA 5I3KA 4C1KA 3QZEA 3E9AA 5CZSA 1QPOA 3GZ3A 1N55A 1OYAA 4ADUA 3N14A 4S2BA 4ORIA 3W3OA 1UJPA 3MUXA 1AG1O 2NWRA 3W2NA 4AEOA 4JY8A 3FYPA 3PG9A 3KHJA 2XN2A 1GEQA 3HJZA 3O6YX 1TPVA 4KKXA 3B0VC 3GR8A 2E5DA 3DI1A 2TSYA 1YTDA 2G97A 2ZCGA 4QAIA 5AYZA 1KW1A 3IGXA 4UCGA 2EGZA 3GNDA 4PL2A 1PS9A 4EVZA 3CU2A 4IMGA 3GDTA 4AAJA 5FF2A 3NQ8A 3O1NA 2X2GA 2I14A 3C56A 3P60A 2VFEA 3BARA 1M6JA 1JCNA 4AF0B 1KTNA 3FLUA 1GYLA 5F1UA 3OVQA 3EWXA 1BTMA 1RPXA 1H7OA 1JR1A 3TKFA 1K8YA 2FFCA 3TA6A 3GIYA 3NXFA 3MW7A 4MFDA 3NPWA 3SR7A 2V5LA 5CSRA 3UWVA 1A5SA 2WJZA 3TSDA 2JKEA 2HSAA 2KZHA 4UFIA 4Q33A 3NL2A 3OA3A 2C0AA 3LCXA 3F4NA 1W5NA 4CCDA 4EWND 5FI8A 1GVOA 1L6WA 1Q6RA 1Z44A 4X22A 4ZQCA 1ZAHA 1YTKA 3RLUA 3PUEA 1SZFA 1KM4A 4OGZA 5ABTA 5DELA 3IIPA 5CSSA 1QPQA 3C2VA 2A2IA 1JCLA 4JY9A 5DCEA 3D0CA 4CLMA 2ZA2A 5F4XA 3LBMA 4RZ4A 3DFTA 2QJIA 1W5OA 1PCKA 3NO5A 1XBVA 5DY2A 3FYOA 3W76A 4Y9AA 5D03A 3SI9A 4M5PA 1LLZA 1SO4A 3EWWA 1R2RA 3LI1A 1EP3A 2PCQA 1VCVA 2WO5A 2DZVA 1TV5A 3LM7A 3T4CA 1V7YA 1W5QA 4E0CA 4DF1A 5CZ0A 1C8VA 1W5MA 1XDMA 3W2MA 5J5DA 1Q6QA 1I2NA 2ZZ2A 4UR8A 3U8GA 3UNDA 1RD5A 2A21A 3MBDA 3WK2A 2X30A 1T96A 2GOUA 4K37A 1TRIA 2V2DA 5KMYA 4UNLA 2P10A 3M0ZA 1ME7A 4N2YA 1T99A 1R47A 5I3GA 5AHNA 3FKRA 2FJKA 4XUGA 1OK6A 1TPDA 4JX5A 4O57A 1PV8A 3E49A 2P1FA 1YPIA 2YW3A 4IMFA 3W70A 4UTWC 3G1AA 4EIVA 4N4QA 2C13A 4R7JA 3TNOA 5CPNA 4E2DA 3TUUA 4O4VA 4DPPA 4FIQA 1ZFJA 4FNRA 3I6RA 2Q8LA 1ZCOA 1OYCA 3OG3A 3CEUA 1XBXA 3BLEA 3E96A 1S5VA 4QIUA 4O53A 3NPUA 2ZBTA 4CNPA 1JCYA 2CLHA 3G22A 4A3UA 4LWWA 1F6KA 1TJRA 2FQIA 2FDSA 1X6UA 3ZFHA 4JTKA 3MP3A 2NX3A 5FESA 3VI2A 4D2JA 2ZRXA 1S5WA 4TMBA 4O11A 5FEZA 3V75A 3WJWA 3W7CA 5K4ZA 4Q32A 1JUBA 2BXVA 1UCWA 3IIVA 1QOQA 1HG3A 1IXNA 3W75A 5K9CA 3N3MA 3UWYA 1U83A 5HQEA 4C1LA 5MHBA 1EEPA 2XN0A 1H50A 3W7JA 2QF7A 4RK8A 5EMUA 3UY8A 4LUIA 3W85A 3PBWA 5KITA 3R89A 5HMSA 1OFDA 1K03A 1MEHA 4DELA 2PRLA 4XTIA 3BPWA 1OFBA 3PBUA 3LHZA 1O95A 3S5OA 3TJLA 1TPC1 5LGXA 2FIQA 4HNTA 5TIMA 5BMXA 4UUIA 1A53A 2H8ZA 5I3IA 3LXCA 1ZHAA 2WSYA 1GZGA 3RLVA 1WX0A 4JTIA 5I3FA 2ZYFA 3S1XA 1KV8A 4RXGA 3SW6A 1DVJA 3HIJA 3PBYA 3VE7A 3UY7A 1JRCA 4TIMA 3C2FA 4A2SA 3W2JA 1QO5A 2C18A 4O54A 4H4IA 1NAL1 3MWAA 2GQ9A 1W3IA 1OFAA 3QW3A 1SZNA 5I3HA 1YDOA 2WPBA 4NXKA 3W2KA 3LHWA 2E6DA 4WD0A 1MSSA 4MZ1A 1XBZA 3A5VA 3MI2A 4LRSA 4QISA 1BWKA 3U6WA 4JD4A 4R53A 3VFLA 1M7PA 1F05A 1VS1A 5F2MA 2VXNA 1SR9A 5AHIA 1TREA 1F2JA 3CIXA 2CZDA 3P8JA 2VEMA 1SPQA 3PR2A 2YCEA 2R94A 3DAQA 1L2UA 1QWGA 4M6QA 4O4WA 1VLWA 3WJXA 3SY5A 3TAOA 5BOOA 1TQXA 3THQA 2R14A 3DGRA 3IGUA 4WJEA 1EPXA 1P1XA 5L9FA 1HTIA 4LS0A 1AL8A 4H6KA 5HUPA 1FDZA 3ATZA 4FF7A 4UTTC 3MO7A 1R2SA 1WYIA 5CGQA 2QUVA 1KFEA 4HNVA 2FTPA 4OU1A 1FUYA 2O7SA 1ZJIA 3NYZA 3O63A 4L4MA 2DJXA 3OEXA 4NU7A 3MBFA 3TXVA 1VR6A 2DJLA 4JTEA 3GVGA 4I7WA 2IQTA 2C1HA 5HR7A 2FPVA 3W87A 4UMBA 4UFKA 5LHEA 5D2YA 5C55A 2Q8ZA 3W2LA 3OVRA 3W7KA 3KRUA 3H54A 3UWZA 3SJ3A 4UFMA 4ADTA 1GYNA 4Z1CA 3KVMA 4LC6A 2B4GA 2CLOA 3QRHA 1TSIA 3LBCA 1G4TA 4ZQPA 3ZWSA 2PRHA 4DF2A 5HR6A 1EP1A 1VCFA 1DOSA 3NNTA 4NZJA 5IBXC 3DFQA 3LHVA 4FNPA 2TPSA 3NQEA 5F1VA 5FEWA 4UFJA 3BLIA 5FF3A 3N2XA 1Q6OA 1NEYA 3MHFA 1TIMA 3QC3A 5L6UA 5CG7A 3TMLA 2VFFA 3EKLA 4IUOA 3W7QA 1DHPA 5AN7A 2HMCA 1TTQA 3W7IA 4UTMA 4QJ1A 1TMHA 1TJPA 5KZEA 1TV7A 3PC0A 1SFJA 3IIOA 2H3BA 2D73A 1DBTA 4ADSA 1RVGA 1K3UA 3TE9A 3E02A 1TCDA 3F1QA 3PBVA 3P5ZA 3GKAA 3O16A 2J9YA 3C61A 2NWSA 3GB6A 3TIMA 1SU5A 4KFOA 3MMTA 1G6CA 3PWAA 1RR2A 1SW7A 3CQ0A 5G4EA 4O8RA 4GC4A 2V30A 3HPZA 2QEZA 2DZSA 2WNZA 3NG3A 1X8FA 2V81A 1M7OA 3M5VA 1QOPA 2J9ZA 3C2OA 3LLFA 4Z0JA 4YL2A 3L65A 4NJKA 3H55A 3EB2A 4MYXA 1DORA 2QCDB 3T40A 1LP6A 2FLIA 1XC4A 5G2IA 4N9DA 2GVGA 2J9XA 2X1TA 4ZQRA 3DH7A 1IXOA 1XFBA 2HS6A 1K7EA 3P5YA 1J2WA 1SSGA 4IGHA 4IWWA 3P8IA 5D05A 3WJZA 2RH9A 2YDAA 4O17A 4QNEA 1N7KA 5K9DA 1OX4B 3DFNA 3LGEA 1A5AA 4JN6A 5D2XA 1PE1A 3DFOA 2EHHA 1XUUA 4K39A 2RDUA 3B0PA 3M16A 2X1SA 3B03A 3E12A 3T55A 4UNKA 5DN1A 3W73A 2JBMA 2CZ5A 5D37A 3W72A 3G0XA 1HO1A 1D9EA 3F4WA 3L68A 1WQ5A 4NNAA 1TB3A 1KM3A 2G95A 3UZ5A 3DI0A 4XTDA 1UUMA 1ZAIA 1ZNNA 3LTSA 1EWDA 3PAJA 4ORMA 2V2HA 4GXMA 3TC6A 1BWLA 1W37A 3KFTA 4TX9A 4MVAA 1JULA 1W56A 2ZZ6A 1PL9A 4I7VA 4XBSA 1KM5A 2OT1A 3S6DA 5IM51 3N73A 3S0CA 1W5PA 3HGRA 3MI6A 4NQ1A 4EF8A 3HMJG 1EX5A 1LOQA 1P5BA 3EWYA 1YYAA 1LOSA 4ZVJA 5EPDA 2CLIA 5CZTA 2QJHA 4OQVA 5HWMA 3BG9A 3ZR4A 3QQ0A 4X2RA 3I68A 3NQCA 1A50A 4FNTA 1LYXA 2AGKA 2DZUA 2H8XA 3L21A 4A22A 3LCIA 5KZDA 2YXGA 5H91A 5E1QA 4HNUA 4XBKA 2QAFA 3R12A 4O15A 3NAVA 4RLIA 3W7GA 5G2HA 4JTHA 1F76A 4GBUA 3W7LA 3LXBA 4FXRA 1FY6A 3W22A 3WK1A 3TV8A 2W0UA 4NT0A 4Z1DA 3QFEA 2QCNA 3OHIA 3R2GA 4MY1A 1SUXA 1K7XA 1IXPA 2ALDA 2WOQA 3NA8A 3CPRA 1P0KA 1NF7A 2Z1BA 1KFJA 3DZ1A 5HUOA 3NPVA 1WDWA 2YSWA 1K02A 1P4CA 4ZQMA 1JJKA 2NXGA 1F5ZA 5AC7A 1AW1A 4LVDA 4ZQNA 4ML9A 3Q94A 2NV2A 2Y63A 4UTIA 3K30A 4CCEA 5G5IA 3W1XA 3LX9A 3TQ0A 5DXYA 4WUIA 1VHCA 5BW6A 3MHGA 4RR4A 5TBOA 3P80A 1J4EA 4CNOA 1WOAA 3GXPA 1G4PA 2CZEA 5BMWA 3ELFA 1ME9A 4MOZA 3G24A 3HF3A 1VYSX 3BGJA 3Q2DA 2G5WA 4OT7A 4IXHA 3CM4A 4LS2A 1I2OA 3EXTA 5KSWA 2A6LA 2YFOA 3DU0A 4YWIA 2PE4A 2VENA 1RZMA 3USBA 4XQ6A 3IVSA 3KVKA 2NLIA 2ATSA 2VC6A 4ALDA 2E5BA 4N02A 1YLVA 3S5NA 3QJAA 4PFMA 3ABRA 4RZ6A 4M6VA 3U2OA 3E0IA 3P84A 3G3MA 3M5YA 4NJJA 1H1YA 3G18A 2ZDRA 3LCWA 4PH6A 3SGZA 4BI7A 4NNCA 1ADOA 4N6EA 4N9CA 4WY0A 3TJXA 2TMDA 3L5MA 2NX1A 1HFBA 1MO0A 3I7RA 5F2GA 5D38A 2P0OA 3TSMA 3NL3A 3BGGA 1YXCA 4IOTA 1LZOA 3O6DA 3O05A 1QMLA 3NL5A 2QDGA 1K7FA 3NQ2A 1ICSA 1PHWA 1QPRA 2BZNA 2DZPA 1EA0A 2VOMA 1YTEA 4WX2A 4MY9A 4JTGA 5H2ZA 3LCFA 4O28A 2V2CA 2E77A 2QCEA 3I7SA 5BNKA 3TR2A 3WJSA 3R13A 3DBPA 4M6PA 1LM1A 1HO4A 1LRNA 2EKCA 3SFKA 3W83A 5AC6A 2PC4A 3UQNA 1I2QA 2NUYA 1DL3A 1OFQA 4ZMGA 4LVGA 5K9XA 3RFAA 4N4PA 1OFOA 3KRSA 3W1TA 4N9EA 1NF0A 2H90A 2CU0A 3STGA 2OZ0A 2E6YA 3AO0A 1AW2A 4BF9A 3L5AA 2NXIA 3GDRA 1VCGA 3VNDA 4O1BA 3KVJA 1OFRA 1B3OA 3KAOA 4FX8A 3UWUA 4GJ1A 1SO5A 4O12A 4IX2A 4NNBA 3CTLA 4O1AA 4JR5A 3QH2A 1KM2A 3B8DA 4K6AA 4GRSA 3CWNA 5D02A 5EY5A 1OX6A 1JVNA 3OBKA 4KWVA 4JTSA 3B0UX 1SSDA 3GYEA 3EX6A 1OK4A 4BI5A 4GE8A 4FHAA 1R2TA 1UB3A 4J9JA 5G1TA 3RF9A 1TRDA 3AJXA 3W7NA 1LTDA 4NUWA 2QCGA 3R8RA 5EYWA 3W7OA 3NQAA 5EBUA 4MLRA 3UPBA 3UD6A 3MI3A 5HULA 1DJQA 3LRMA 3QMRA 4OBTA 3M7WA 3BVJA 4RXFA 3DHFA 3NPXA 4AWUA 3GDMA 4FO4A 3LRKA 4LVBA 1FBAA 2FPYA 2Z2UA 5EKYA 1I4NA 3QPZA 1CW2A 2YFNA 4K7VA 1ALDA 1IIHA 2YZRA 3IRDA 3LXAA 4UTWA 1AMKA 4WOZA 4FX7A 4Z08A 4Q4KA 1K8ZA 3EEGA 2JK2A 1TTJA 5EA9A 3PUDA 4JS3A 1H61A 3G0UA 3M47A 5HINA 3YPIA 3A21A 1WBJA 4MFEA 2Y85A 4A21A 2TYSA 3O15A 2NV1A 2A1YA 4JGDA 4O0KA 3W1UA 1GVRA 5D32A 1NFBA 1YDNA 3HQ1A 3M6YA 3TQVA 1OJXA 1I8JA 1LCOA 4JX4A 2EAWA 4BK9A 3GXNA 1Y0EA 2A4AA 4P61A 3GAYA 3LRLA 1NSJA 4DQWA 3JRKA 4PEKA 3GAKA 2QCLA 1DV7A 4LC8A 1BEUA 3WK3A 2GUUA 1SQ7A 5G4WA 4JYFA 3TW7A 2BX7A 4A29A 3TFCA 1KFBA 4FB7A 3MYOA 5AOUA 4RV8A 3NQVA 5CKSA 4LNYA 1O5KA 4LOCA 4BWLA 2QDHA 3KOFA 4TU1A 4UTLA 4RX0A 1YDVA 1GT8A 5K7JA 3P7YA 4BR1A 2Y6ZA 3N2MA 5G2WA 3A9IA 3M43A 2Y7FA 5G1YA 1F7BA 2GQAA 1KM1A 3G8EA 2GVLA 3NM3A 2C19A 2ATMA 1JCXA 2XFWA 4TR9A 1ZY9A 3C52A 3QEZA 1KTCA 5AFDA 1C9DA 2YPIA 5A5WA 3B04A 5U4NA 3TAKA 2WV8A 3QSTA 3CIWA 3ABSA 3ZWTA 1IGSA 5LNWA 1A5BA 4WOQA 1JQXA 3DFSA 4JYEA 3LCHA 1H7RA 4AH7A 3P81A 4HNNA 1XI3A 3NDOA 4JNMA 1VHNA 3M9YA 3QYQA 4POCA 2C14A 3LOTA 1GVFA 1TPUA 4NJHA 3QF0A 4LS1A 2H6RA 1JUKA 2OT0A 3RNDA 1KFLA 1OFPA 3LHYA 3S1WA 5AB3A 3LV5A 2F84A 3W1RA 2DZWA 4AVFA 3TXZA 1LBFA 3FOKA 3DFPA 1XDLA 3M5ZA 4K36A 1F73A 1ZENA 1GPWA 5DBUA 1VPXA 4N9BA 1TPEA 3G0SA 3N9RA 5E93A 3S5ZA 3C2RA 4BI6A 3TW6A 3NQFA 1LDCA 2ZZ7A 4FNUA 1GJPA 4E2BA 2JKAA 1N8FA 3FIGA 3M1ZA 3W23A 4MZ8A 4WXYA 4NVTA 3W1PA 3W71A 5FF7A 3UXAA 3FEMA 3G1VA 4HSNA 3G1DA 1OF6A 3W7DA 1W3NA 4Z0SA 1YXYA 3HG3A 3QM3A 4JXCA 1V5XA 1VRDA 4WZHA 2PRMA 3A22A 4DF0A 2YX0A 4JTUA 4AMAA 1FCBA 2A5HA 3ANYA 5FF4A 3W9ZA 4S2CA 5K3VA 1KV5A 3HOJA 4K8HA 1FDYA 1GVQA 1QFEA 4UR7A 2E68A 4HKPA 1H7XA 2NZLA 2ISWA 2WNQA 5CPMA 4YCOA 1GOXA 4Y96A 3I7QA 1FWWA 2B7QA 3BLFA 4DBEA 1O5XA 3W7PA 1HL2A 3GKFA 3T78A 2WQPA 3PULA 2QAPA 4Y8FA 1UUOA 3FA5A 4FNQA 1ONRA 3S5YA 4AWTA 4LV4A 3TH6A 1DJNA 1Q6LA 2G96A 4LRTA 1PIIA 3IVTA 4ZL1A 4M7TA 1K8XA 3WK0A 5CPLA 3QMSA 1TQJA 3PSVA 1TPWA 4IX0A 4LU0A 3MJYA 2A7RA 5BRBA 3KVLA 3HGJA 3TROA 4AB4A 5F2LA 5T26A 1S3HA 3OVPA 4CQ9A 4U4MA 2ZQ0A 3W1QA 5AYYA 3HG2A 3W74A 3TK7A 2Y70A 3M5XA 4O0ZA 2UV8G 2X16A 5E0KA 3TQKA 4UIOA 2WSRA 2I1OA 1B4KA 1IIGA 2V0TA 5DLCA 1XL9A 4GWEA 4KFPA 1W3TA 2BSLA 3LB0A 3KXQA 5D2TA 3FFSA 3G1YA 5CZJA 2QUTA 3LI0A 4O18A 2WNNA 5FEPA 4TMCA 3BW2A 4A2RA 2NX9A 2JKPA 1JCJA 1F6PA 2E6AA 4PCFA 1QO2A 4DEFA 3EX2A 4HT3A 3L9CA 4OE7A 3UYCA 4JX6A 1WXJA 2ZA1A 3L5LA 1H62A 1KTBA 4HIBA 3LHUA 3BG3A 4UTKA 2Z6IA 3L0NA 2DU2A 5HNRA 1Q45A 4GUHA 4JTLA 1KA9F 2NXHA 4WXZA 1SZEA 4IMEA 2GJNA 2Z6JA 1B9BA 4AHQA 2E5CA 2ABBA 5A8GA 4UTUA 2DZTA 5D09A 3A5FA 2OCZA 5C6MA 5C5YA 3C8FA 3UXDA 2B7OA 5K2ZA 1G4EA 3THAA 4UFHA 4XKYA 2A85A 2RDTA 1TPFA 2VEKA 2RHGA 4HN4A 2V9DA 3PF3A 4IXXA 1M5WA 4Z1AA 3TC7A 2J6XA 2ZTJA 5LNSA 3CLMA 4HPXA 1X1OA 3LCGA 1YADA 1OABA 4LW7A 5TQLA 1ZAJA 4ZZ9A 4MLJA 2A6NA 3V1PA 3KRZA 3N19B 1F74A 1L6SA 2CW6A 3CHVA 4G1KA 5D2VA 1UASA 1VYPX 2QR6A 3F03K 2CFFA 2C3ZA 1SO3A 3UZJA 2FB2A 3LTYA 3SSJA 1XKYA 3Q37A 5HWJA 2TRSA
chains in the Genus database with same CATH superfamily
2FJUB 2CBIA 3PB2A 1IXQA 1JUEA 2XSXA 3WF4A 2JGQA 6A3HA 3S9YA 5C9RA 1OHLA 1VJZA 1XLCA 1E0UA 1FCQA 2HK0A 4LVFA 4UMAA 4JTQA 4GC3A 4LYKA 5GPRA 4KMQA 3U5UA 1YXDA 2VCCA 2CLEA 4H8HA 1WA3A 1OYBA 2VFIA 5C7VA 1EC7A 1H60A 1LBMA 3AZTA 3CAQA 4F0KA 3DECA 4E8GA 1CX9A 4WKFA 6TIMA 1FWRA 4YXGA 2ZXBA 1JYWA 1R6WA 4OV9A 4K3ZA 4IM4A 3NDZA 1QW8A 3UFYA 1T8XA 1KFKA 3P61A 5F7UA 1PB0A 1YRRA 2WJFA 1DWIM 1E6NA 1I2RA 4KF1A 3WLTA 1SGJA 3IJDA 3WQCA 3KM8A 3ITTA 4XB3A 4B3LA 3VAVA 5AYBA 2ZFAA 3TR9A 3LZ5A 1KKRA 1R7AA 3V5FA 2Z1XA 5FEXA 2DORA 4AVOA 5AHFA 1WV2A 4GXWA 1W32A 1G4SA 2HTMA 3AYTA 4RW3A 1GG0A 3UG4A 1W9BM 3G1SA 2ZE0A 1ZBKA 3UXKA 3MZ2A 4D72A 4RZ5A 3WFAA 3L0KA 1SFLA 1G0CA 2OTDA 2HZGA 3K4DA 4O19A 4S38A 1E0WA 1AQ0A 3OIXA 3QVQA 4IPPA 2RKXA 2Z0IA 5C2XA 2CZFA 4JTTA 1W0MA 1KCKA 1RP9A 2QZRA 1M53A 2ZTKA 3NFUA 2FPTA 3KBSA 3NQMA 2AOSA 4GGBA 4GKLA 3WQVA 3CZLA 1PYMA 3FKKA 3G5EA 1QXLA 1XIDA 4Q4QA 1DQXA 3LENA 3MYPA 7CGTA 4HZ7A 1FOBA 1UKPA 3CEPA 1KRMA 4H9MA 2C15A 3W07A 4NJIA 1UR2A 2FB3A 1I45A 3B9EA 1REQB 4IGMA 2ZZ5A 3B8WA 4KEZA 5AC8A 3VDGA 3BICA 4X60A 1X98A 4PL1A 2Y2WA 4Z2GA 3TDFA 4L65A 1NU5A 1YE4A 2I5GA 5BROA 1ZLPA 1OG0A 3GX9A 3ABOA 5EGRA 4P8XA 4AHOA 1MXSA 1XSIA 3UA3A 2WAGA 4W7WA 3SGGA 1J0JA 3HPAA 4IMCA 4IQDA 3MUIA 4US5D 4O50A 1A5MC 1J6PA 1DKWA 3NM1A 1KLZA 2QUUA 3T1GA 1KLYA 4L1GA 1A5CA 4F0RA 1L8PA 2PZNA 1V02A 5LA2A 2DFAA 2F6UA 5LGZA 1QHOA 1QJWA 3W1AA 1TV2A 3NZ1A 1H7PA 4IGNA 5BU6A 2VNCA 3AAMA 1XM3A 2Y88A 1FWGC 3UZXA 5LNRA 3NVTA 1C7SA 1FDJA 2HNHA 4YIWA 2ISDA 5DCBA 4MYAA 2Y1HA 3G3DA 3WENA 1SO6A 1QAPA 3PN8A 1IEXA 4AX7A 1ECQA 4NRRA 3I65A 3WEOA 1EJVC 1J93A 4QSHA 4QE4A 2DPEA 3A3WA 1UR9A 1TV8A 3TSBA 4I90A 2VZVA 1E6ZA 1WNOA 5EL1A 4Q7NA 4MAZA 3RMEA 3L4ZA 2DT1A 5I09A 3RJXA 4FF5A 2OX1A 3L2MA 2VI0A 2PGWA 3U2EA 4W9TA 3EOLA 3K46A 5AYXA 3HO8A 3C2YA 5IXEA 2WCAA 4LUSA 5AVHA 5A8MA 2H3DA 4AXKA 1H2JA 3AMKA 3T9PA 1WAUA 3UU0A 5LHFA 4KQNA 1DWAM 1DJWA 3BW3A 1W2VA 4C65A 4K8EA 1VBUA 2PTZA 1TJ2A 3MA8A 3FAXA 1KFCA 4O1DA 3L2IA 2GPTA 3T07A 2V8ZA 4DAFA 1WOBA 1GVYA 4WY0F 2V3DA 2FGZA 1QK0A 1U1HA 3TYAA 1IT8A 3WLSA 2DSVA 4LYRA 2NT0A 2R91A 3U57A 5AHLA 1WKDA 3WUBA 2ZUVA 3M0KA 2C91A 3EX1A 2X7VA 4JFTA 4XIMA 3UJRA 1ZSXA 4RKAA 5CAKA 1KBJA 2W66A 2YR1A 1A0EA 2Y7EA 5B7YA 3B4YA 3AWNA 4DWDA 3KX6A 6CGTA 2O9RA 1X7FA 1L8NA 4XUYA 3CYVA 3D6NA 2DGAA 1ZBCA 1A5LC 3M0MA 3JUGA 4PBGA 1FCVA 4PULA 1JDFA 1HJXA 1TO3A 1EUAA 5DT5A 1JQVA 2WCGA 1E6PA 1VEMA 4OECA 3PFRA 1TMLA 3GDLA 1XLKA 1ZZMA 1AZ2A 4KWSA 4H3DA 3VIKA 4PSRA 2YL9A 4ES4A 3UXLA 3LLDA 4NSBA 4YTUA 4S3KA 3WQDA 3APGA 1N8WA 5F4WA 3P62A 1UQZA 3NSXA 3PVFA 3TMQA 1SW3A 1AJ2A 4YTQA 5HMFA 3P67A 4E8DA 3MO4A 3DKLA 3WQ8A 3CAVA 4PB4A 1GZ1A 5G1MA 3GK0A 4U5KA 3ITXA 1Z48A 4IZGA 1DQWA 4QQ3A 4IIFA 3UXIA 1B3ZA 1KRAC 2J78A 2I57A 4UXDA 3ARQA 4DNHA 4JIQA 1S46A 3O6CA 1OB0A 3W88A 4ERGA 5AY7A 3C86A 3CH0A 4EOUA 2DVUA 3DENA 3RCYA 4P8WA 3QV6A 2XFYA 1V3MA 3W7MA 3PZGA 1I6NA 3UPWA 3IEBA 1EIXA 3VC5A 2XH2A 4IMDA 4NAFA 5EMYA 2PB1A 1Z41A 1EO5A 3W86A 4S3CA 4AG0A 2LLEA 1OIFA 4PRTA 1RV8A 3OG2A 3E3HA 2EF9A 2PFHA 2ZRWA 2WVSA 3L12A 4OBRA 1L6YA 1BYAA 4HU4A 2ZX9A 5D2WA 1ZP4A 3QPYA 5ECVA 1OD0A 1L6GA 3GFXA 4J27A 2Z7KA 5DQPA 3ZIZA 1XYLA 2A0NA 2XDFA 1XF0A 5DRIA 3EKZA 2ZVRA 1JGIA 2VP8A 2GL5A 3N9SA 3ZS4A 1DIEA 4UR9A 2OZTA 1AD4A 2J7BA 4C6OA 3V36A 3HB9A 2DH3A 4MPKA 5FJJA 5T9CE 3WNNA 2ZC1A 2HS8A 4IFKB 1NVMA 4RE2A 2NVDA 1ZS2A 3E9AA 5CZSA 2I16A 1OYAA 2J66A 4S2BA 1Q8JA 3AISA 2OOFA 2G3FA 1AG1O 2NWRA 4NYYA 3PG9A 3KHJA 4H9ZA 3I6EA 4DX3A 4BS0A 1XIEA 3CIVA 5FCZA 3B9DA 2E5DA 3DI1A 3E0WA 5AYZA 1KXHA 1FWEC 2V3GA 2WZEA 4AYSA 3IGXA 4PTDA 5C9XA 1TX0A 4PL2A 1IGWA 1X1NA 1BGAA 3GDTA 2OODA 4XK2A 7PTDA 3NQ8A 4LFYA 3O1NA 4C6EA 1JCNA 3SSZA 4AF0B 2CESA 4D8LA 1RPXA 3SCPA 1JR1A 1T5AA 1K8YA 2FFCA 3U9IA 3BC9A 3GIYA 1F4AA 3UWVA 2CHRA 2YB1A 4RW5A 1D3CA 1ODUA 1IEWA 1AD1A 3LCXA 3F4NA 1ZPTA 1W5NA 5FI8A 1GJWA 1MW3A 1A3HA 1SZRA 1YTKA 3RLUA 1SZFA 3WQ5A 3VNLA 4GYFA 2OX4A 3EEZA 1V0LA 3ECQA 5CBIA 2WMJA 3C2VA 2OEKA 1C8YA 2O0TA 1US0A 4UCFA 3SCVA 4WGXA 3DFTA 4DUOA 3SCTA 3N15A 2IPFA 1Z69A 3NTYA 3W76A 5CQ1A 4GIAA 4M5PA 1LLZA 3GO2A 4QTGA 2OKOA 5CLWA 4J3SA 3LI1A 3WDQA 1EP3A 3M46A 2DZVA 3AXKA 4E0CA 3W2MA 4F8XA 3S3GA 4HK6A 3MBDA 2XIQA 2X30A 3VZYA 3UJFA 4CD8A 1GZJA 1KGUA 1EBGA 1WZMA 3ZR6A 2R1NA 5DO8A 3POHA 1DYSA 4JX5A 5C9WA 4W8AA 2EG8A 2PGEA 2YW3A 4ZOAA 2C1IA 2C13A 1Y5XA 3PZ9A 3LLXA 2EO7A 4GI4A 4H8VA 3F5JA 4FIQA 1ZFJA 5BRPA 3WLHA 4GZIA 4XZNX 2V67A 4OUEA 3VGHA 1FFQA 4CNPA 2W92A 1JCYA 1UPPA 3G22A 1M68A 1F6KA 4INFA 1TUFA 5FEZA 3W24A 3V75A 3WJWA 2BY3A 4DLFA 5AKQA 5HOSA 2D69A 1DJGA 1E55A 1QOQA 1HG3A 3S2JA 3H2AA 3GG7A 5K9CA 5HQEA 2R1KA 4J3TA 4LBRA 4RK8A 2DSZA 1FHDA 1UWAA 5KITA 4XAGA 1XIIA 1IT7A 3R89A 2HWGA 1OFDA 4NI3A 1MEHA 3A6OA 4GGHA 4W87A 3VNJA 1KC7A 1DIOA 3V4BA 4JPGA 5BMXA 3WX7A 4D6DA 5A95A 4FZIA 4FOUA 4PMRA 5XIAA 4FMVA 3LQGA 2WSYA 3E2VA 1CXFA 3RLVA 1R5YA 4EE9A 3M0HA 4KWOA 4ZBCA 4DYKA 1UWRA 3VE7A 4GYKA 4TIMA 4AEFA 1K8CA 3R8HA 4A2SA 4GIYA 1KQZA 2C18A 4H4IA 1XRFA 4ZO9A 1W3IA 2WM1A 1SZNA 1SM9A 4X9YA 1DE5A 4F2UA 4AY1A 4LRSA 4QISA 1O66A 3U6WA 1YHTA 4JD4A 2EXOA 4LPCA 1JIBA 4G1NA 2W27A 3VFLA 4G7EB 1CWYA 2VXNA 4QG6A 1T7LA 3EDDA 5AHIA 3CIXA 3UCQA 2VL4A 3PR2A 4Y9NA 1PKLA 4L9XA 3WJXA 5GJNA 4HJWA 3WQGA 3U2ZA 2DZBA 5BU9A 4HA1A 2R14A 3DGRA 4IP5A 2WHKA 5J04A 1EPXA 3U7BA 3IAQA 3EDJA 1FDZA 3ABXA 1C90A 4A6GA 2QUVA 1KFEA 1Q6EA 3H4WA 4HNVA 3SJNA 1NWSA 3AFBA 4L4MA 3ZT6A 3OEXA 3H2MA 2Y5EA 1CGVA 1BAGA 3CUIA 2OSWA 1Z32X 5HR7A 2XGBA 1C3FA 3E5BA 3W2LA 1CENA 1U2YA 3AS2A 2CYGA 4PRWA 4KERA 4UFMA 4ADTA 3QV8A 3THUA 4Z1CA 3KVMA 3QRHA 1RA5A 1J0IA 3WFZA 2AAAA 3PPCA 1UD2A 3KS5A 3SCWA 3DFQA 3LHVA 3P93A 5F1VA 4LBSA 3H22A 5FF3A 1T40A 1NEYA 1LUCB 3TMLA 1UKSA 2YA0A 3VZXA 4FLOA 4E2VA 1XIFA 3T0AA 4GNKB 3WMBA 1XKJA 4HP5A 1VRXA 1TMHA 3VCNA 2Q09A 5KZEA 3PC0A 1PIFA 4B3KA 2H3BA 3KP0A 2X05A 1GOIA 4ADSA 2P8BA 1XD1A 1V3KA 2E7FA 1RVGA 3NO3A 5JVLA 1M01A 1K3UA 4U10A 3F1QA 5IRPA 2OR2A 2AGTA 3CUHA 5HJXA 3N2OA 2ICSA 3WKZA 3BJTA 2BY2A 4ERIA 3GYCA 2VGBA 4HVXA 2BG5A 2CKRA 3FN9A 2VEFA 3K1GA 1SU5A 3UA4A 3W81A 2OG9A 2OWCA 2DW7A 4FAMA 4O8RA 4GC4A 3BLLA 3HPZA 2Q6ZA 2ANUA 2DZSA 3MUCA 2WNZA 3WLIA 1U33A 1UWIA 4QBXA 1DWJM 1M7OA 5HJYA 4IJCA 4BQ5A 2J9ZA 3VNZA 2XVGA 3L65A 1REQA 3KE0A 4NJKA 3H55A 1UMLA 2QCDB 1LP6A 3DDMA 5D8ZA 3CQHA 5M2FX 1M1BA 2J9XA 4IQJA 1PEZA 1WZAA 2I7GA 2J77A 2X1TA 4ZQRA 1MXDA 2DIKA 2HS6A 1J2WA 4IGHA 1ZP3A 1OM0A 1OX4B 3DFNA 4ZOEA 1TVNA 2H9AA 2V6AA 3EA1A 5ABHA 3T42A 3B03A 4KRTA 3T55A 3EB4A 4UNKA 5D37A 4A8LA 2QPSA 3VKCA 3L68A 1WQ5A 3GW0A 1TB3A 2Y4SA 1Z6KA 3DI0A 1UUMA 1ZAIA 2FVLA 3T6CA 4JCMA 1WXYA 3E2RA 4M51A 2X40A 2YOCA 5FKYA 3KFTA 4AUBA 4MVAA 2ZZ6A 3GWQA 3UVIA 4I6KA 3MVTA 4YWSA 4PMVA 3HA1A 4P8UA 1LOSA 3GHRA 3HTWA 5I23A 4MSSA 3BG9A 3ZR4A 4DJDA 1X6NA 1LQ0A 3G77A 3QQ0A 4HU3A 3USZA 2DZUA 3ITOA 4CNUA 2MANA 2YXGA 5H91A 2YBTA 5E1QA 5HNTA 2XM2A 3DC8A 4U31A 3R12A 3NAVA 1TG7A 1O5QA 4JTHA 4JIRA 3FA4A 1KO0A 3VNMA 3W7LA 1YE6A 3LXBA 4C1NA 3BSGA 3MDWA 4ICMA 2ESCA 1C91A 1M65A 1H5VA 2QYGA 4AISA 1P0KA 2Z1BA 1A5NC 1KFJA 3DZ1A 4R3UA 5I02A 2PBGA 3SADA 1M9HA 1ZCCA 1NTHA 3KLLA 1F5ZA 1AW1A 5I00A 4W85A 5HK4A 2PWDA 1XJBA 2PC8A 3LX9A 5REQB 3VKKA 5DXYA 1VHCA 2D24A 3IJ6A 2VO5A 4AMCA 4REQA 1VYSX 4HYRA 4IXHA 1V02E 1NM9A 1X6LA 3CM4A 4LS2A 3WF1A 5KSWA 2A6LA 2VR5A 1RZMA 2F61A 1V77A 3USBA 3LGGA 1AH3A 4NI8A 2ATSA 5FJIA 2Y8KA 3GU9A 2E5BA 1W9DM 2NVCA 5G4HC 3OPSA 3ABRA 3CO4A 1K9DA 1RAKA 3E0IA 1XGDA 3KBWA 4Y9OA 1H1YA 3SUUA 2FTWA 3RCMA 5CPTA 3VTRA 2ZDRA 4A3HA 2Y5SA 4LF1A 4N6EA 1UZ1A 3CUGA 2VX5A 1JEZA 4FLRA 3L5MA 3DEQA 1MO0A 5F2GA 5C0QA 5D38A 3PNUA 4B90A 3NL3A 2ACSA 4IOTA 1NOUA 3O6DA 3H2FA 4US6A 2OU4A 5I2UA 1K7FA 3ZO9A 1YTEA 4PTVA 5TD4A 4ZO8A 3TTYA 3F7JA 3I7SA 2PMQA 4BZYA 3DBPA 2Y8VA 1LRNA 3NO1A 1Y65A 4UQDA 4J3VA 3UQNA 3T05A 2E3ZA 5A6BA 3T2PA 4KIEA 4JQAA 4LVGA 3RFAA 2R82A 1NF0A 4N9EA 1TELA 2H90A 4JHOA 3STGA 4FI4A 3UT0A 4B5UA 3NCOA 3K4WA 4GKTA 3KCOA 3WQOA 1R3RA 3GDRA 3RX2A 3VNDA 4BQ4A 1OFRA 3KAOA 4O1EA 2EPLX 3IV8A 3CTLA 2FZMA 1E6RA 7XIMA 3B8DA 4K6AA 4GRSA 3CWNA 1OX6A 1HW6A 4KS0A 3VD5A 3GYEA 1DWGM 1HJVA 3EX6A 1S3TC 4BI5A 4GE8A 1R2TA 4Q6XA 1TRDA 1CB2A 3AALA 3N17A 3ZOAA 3O6AA 4D6JA 1DJQA 1B31A 3QMRA 4RXFA 3DHFA 2Z27A 4BQ2A 1UKQA 3CGTA 2P3ZA 3GVQA 1ISWA 3QPZA 5DT7A 1VAHA 1ALDA 1IIHA 1W3KA 3COTA 3IRDA 1CZ1A 2QIWA 3EEGA 2O9TA 5EA9A 3PUDA 3R0UA 4JS3A 1H61A 2DIJA 5HINA 3A21A 3PHAA 3FXGA 3NZPA 4CGTA 2Y85A 6ENLA 3AMDA 3BLOA 2NV1A 4JBRA 2G3NA 1CDGA 4JGDA 3W1UA 3CS2A 1GVRA 2GUBA 4ASTA 1NFBA 1OSEA 3M6YA 3OHMB 2PCEA 4BK9A 3GXNA 4ZR8A 2UBPC 4P61A 1NSJA 4P7NA 1MYRA 4B5XA 3EAUA 3JRKA 4PUMA 4PEKA 1GKQA 1G94A 3MCOA 3B8VA 4BCEA 4CU6A 4MMWA 4LQ1A 2QT3A 1LWJA 3E38A 4RPQA 4V27A 4A29A 2BX7A 2P0IA 4LB4A 3AIWA 4F79A 4RV8A 3LPGA 1O5KA 3PNZA 3VIPA 1PWLA 3KOFA 4D6GA 4TU1A 3DYOA 2V68A 3WQWA 3K13A 2ACRA 5A6TC 1E9LA 4HTYA 2OO0A 2WHLA 2Y7FA 5G1YA 1F7BA 1KM1A 2GVLA 4PFHA 4TR9A 1QI3A 1R9XA 3C52A 3ZYZA 4MM1A 1C9DA 2YPIA 3VMOA 2HDJA 3ZWTA 5LNWA 3DFSA 4GG9A 4H6EA 3A3XA 3BV7A 1H0IA 3LCHA 4AH7A 1IZCA 2CPUA 4PBEA 3KTSA 3NDOA 3ZSSA 4B9ZA 4JKKA 1IR2A 4PMDA 2CNCA 3LHYA 5HNNA 3UESA 1AQHA 4MDPA 3J7HA 2DZWA 4AVFA 3QOKA 1BF2A 3BLPX 2Q02A 1JXKA 3S46A 1UROA 3DFPA 1E72M 3M5ZA 4YHEA 1F73A 1A49A 1W8GA 2Z1VA 3WD1A 1TPEA 5LIKX 3N9RA 3GVVA 1F61A 1U22A 2PTDA 1IR1A 4FNUA 1DJHA 4WXYA 4NVTA 1LJYA 2VVSA 2HPIA 3S6TA 3W1PA 5FA5A 1YDYA 2Z29A 4BHYA 3G1DA 2XIBA 3W7DA 1W3NA 4Z0SA 4PUNA 2Z2BA 1NELA 1VRDA 1XX1A 1MVYA 4WZHA 3ZLHA 3TP4A 5I0DA 5JH2A 1EOKA 2XH7A 4DF0A 4AMAA 4DI9A 3ES8A 3HQPA 3ANYA 5FF4A 3SCSA 3W9ZA 5K3VA 3HOJA 4EP8C 1PTAA 1W1IE 3THDA 4H2HA 5C71A 1QNPA 4CKQA 1XICA 4P7RA 3CMFA 3WBYA 4IL0A 1JPDX 4IICA 2GZXA 5ABFB 1M41A 4G7FA 2BGNE 4FK9A 3PTQA 1HL2A 1E56A 4RUBA 3PULA 3FA5A 3S5YA 1ONRA 4AWTA 4W8LA 2ZUTA 3ZJKA 4HK5A 3VGEA 3IVTA 5FJUA 3RJYA 3MMDA 2O92A 3PSVA 1TPWA 3AHVA 2B81A 2OLHA 5BRBA 3DC0A 4LAMA 1UWQA 4AB4A 4GO8A 4OOZA 1A4LA 4IJRA 2CZVA 2OFJA 2E67A 1I60A 2Z1WA 1QBBA 2PD9A 2F8QA 2NQZA 3G2GA 4DJED 4O0ZA 3NSMA 2VTFA 3F4DA 4GIEA 2GSHA 4UIOA 3KCJA 1JFHA 2OYLA 1IIGA 2V0TA 3GD6A 3VD4A 4HMDA 1W3TA 4MG4A 1L0PA 2W5FA 5CZJA 4YYCA 4O18A 1VFFA 2XWEA 1LG2A 1UHVA 3BW2A 3U4FA 4A2RA 3OP2A 5GNXA 4GI6A 1JCJA 1V3JA 2D22A 4HT3A 4OE7A 3UYCA 1UWUA 3QOMA 4GZEA 4HIBA 1A5UA 4EPBC 3L0NA 5ABGA 1Q45A 4GUHA 4GNVA 4JTLA 5JH1A 2NXHA 5I07A 1R3SA 2INZA 3PBMA 4LEFA 1KGXA 4XD5A 3QR0A 4OZOA 1AJ0A 3ALFA 2ABBA 5C2GA 5CJ5A 1G5AA 2WVVB 4KCTA 2GWGA 5C6MA 2YL6A 3NURA 5C5YA 2QPXA 4QDWA 1R3QA 1XIJA 3C8FA 4KT2A 3WNOA 2B7OA 4G7EA 2PLKA 1I0DA 5KEZA 2RDTA 1TPFA 2VEKA 3IWPA 3HMCA 4UNIA 1X38A 2ONEA 3CLMA 4QHRA 1QI5A 4LW7A 5TQLA 1ZAJA 3KRZA 4GQQA 1L6SA 1HP5A 3AMGA 1NOFA 2JIWA 3CHVA 2IKIA 1S2UA 1RY8A 4IQEA 2WMFA 5A94A 3UZJA 4DXXA 2FB2A 5CCZA 1YMYA 1FWIC 3GDBA 2YDQA 4KFNA 4Y6GA 4HHMA 2WSQA 3GXDA 2YJQA 2V5BA 5M17A 1D8WA 1O60A 5XINA 4NRSA 3V18A 4PODA 3CMGA 4B91A 2OYMA 4MWAA 5DY3A 1JZ6A 3T81A 4FPSA 2CLKA 3ARZA 4AHPA 1ICQA 3VMPA 4H9YA 3UNTA 2FYMA 3MP5A 3QZ6A 1XLEA 3O06A 1LORA 3AYRA 3EWZA 4Z2LA 4ATDA 4UC5A 1AK5A 4H7ZA 2VD9A 4A3QA 2P53A 3UCCA 5C2CA 1IHIA 1S1RA 1NDWA 4CNSA 4JQ2A 2ZUUA 1HUVA 1FQ0A 1H3GA 2OGJA 1W9PA 1POKA 2HBVA 1VQTA 4L9ZA 1BYCA 2OJPA 4JQ1A 2RDWA 3DGBA 4OIFA 4J28A 1CI1A 1LUCA 4MB1A 1YW1A 3W1MA 3LHTA 2ZOXA 2PI6A 1A0DA 1CIUA 2PWVA 7TIMA 3NXLA 1UC5A 5LKYA 2DDXA 3ITCA 2WLZA 4QITA 3HZ3A 2FHFA 1LL6A 3GNNA 1GKPA 1PHQA 4S1FA 2V69A 2CLFA 5HPOA 3ATYA 4EAYA 3WLKX 4BKNA 3G6LA 3BWWA 1DE6A 2NUXA 2QPUA 4ROQA 3FAWA 1S5TA 5HWNA 1GW1A 1QUMA 2PAJA 3HG4A 5I03A 4OHQA 2WKJA 1GHSA 1I1XA 2EJAA 3H12A 1P43A 3EGJA 3IUDA 4I5RA 1R46A 1E4MM 1KCZA 2E25A 2OB3A 2JGYA 3GY1A 4G9PA 5K4XA 3I3DA 3GG0A 2SFPA 1B3YA 1KNWA 4Y90A 5DCDA 3D3AA 3C8NA 3MMUA 4U28A 3OIHA 4BA0A 4EWJA 5CC7A 5EFDA 5JBFA 4EX4A 1WE5A 2Z1KA 4PTWA 2BWGA 3QSRA 3MSYA 2YYTA 2AKMA 2BFGA 3GXIA 3EWUA 4DXVA 3NYDA 2WMIA 1I1WA 2QCCA 2VDIA 5BOFA 1OQFA 2QCDA 1S2AA 2Z4GA 2EG6A 4DIAA 1JG9A 2RJHA 5D9OA 1KM6A 4FXSA 1VJIA 1EHAA 1FWTA 2NT1A 2YLAA 1OFEA 2UY2A 3R5EA 1RY0A 3AHXA 2QCHA 4GVFA 3W7RA 1XW8A 1OX4A 3N4FA 1MEIA 2RJGA 3CZEA 1IZKA 2GOKA 1FP9A 3UG8A 1OCQA 3NEVA 4EKJA 4J2PA 4RDZA 3SECA 3SBFA 4LY8A 4GUJA 2Y7DA 4IPIA 2QCFA 3M0YA 1EYEA 3LK6A 2VX7A 1W1PA 4W84A 4IF2A 5E6YA 3IUHA 4ACZB 2J88A 5EMMA 4BWLC 4M1RA 1M7XA 4R33A 3TU9A 3I4EA 3BAJA 4QNWA 4AY7A 4PMNA 4Q8TA 4KESA 3URAA 4GQ0A 5DBTA 2DIEA 3NZGA 2Q3OA 1TTPA 3NGFA 1E0TA 1GNXA 4YCPA 1QNOA 2HQAA 4XO7A 2FH6A 3KL0A 2BOEX 3JZUA 1PCWA 4O10A 4ONVA 3TN4A 1DP0A 5DXXA 2VFGA 1R9ZA 4B4FA 4UTHA 4H6QA 3CHCA 3UR5A 4MZYA 1XBYA 3N1AA 4U3CA 1NH6A 3AJ7A 3KBVA 4BQ3A 1F8MA 3S1VA 5LSMA 2QGYA 3PM6A 3ICJA 1NWRA 1O1ZA 3GLCA 3MKCA 4MKSA 1NQ6A 4MJZA 1X8CA 4WVXA 1LOLA 1TPB1 3TA9A 4Q8MA 3QQ1A 4ZSTA 1BGGA 4DO5A 2ZDSA 4XKYB 2B0MA 3GHSA 4ZTXA 3LV6A 2HVMA 1XCFA 3EPNA 1H63A 3GTNA 3UZZA 3GHUA 3STPA 4JNYA 1CLKA 1F07A 3A3HA 1EUNA 5REQA 4WJXA 3T09A 1JYXA 1WXZA 4XWUA 3HFTA 3GU1A 3ZJ7A 2J62A 3ZZ1A 3RPTA 3G8RA 4CNTA 3CB8A 2DUAA 4NF7A 4R85A 5CLTA 3LERA 4MB5A 3DFYA 3EMQA 1XH0A 3SUVA 3CC1A 1ITCA 3UETA 2VFDA 2VELA 1E15A 2YBVA 2CETA 1S5NA 1EGZA 1XIGA 2Y8UA 1WDQA 4O16A 4PC8A 3UZYA 3VPLA 4YS1A 3PPHA 4LT9A 2BODX 3SIZA 4Z2JA 4XSLA 4TO8A 4HOWA 3ARXA 4Q4RA 1VFUA 1DJYA 3AI0A 2ZUNA 4R7OA 1T0OA 1QDSA 4H2CA 3W27A 1BTCA 4NZFA 3BTNA 4NP7A 1VP5A 3PZVA 1LQAA 4GACA 1L6FA 5FJRA 4MNJA 4N0RA 3O7UA 4H9XA 4JIPA 3IGHX 2WC3A 3QW4B 2UZ9A 4XZMX 4O14A 3VIMA 4JYDA 1ISVA 2P8CA 3A24A 3HGOA 4L6OA 2BTMA 4DWSA 1FWDC 1SR0A 4B9YA 5D04C 3SN1A 2DP3A 4LTSA 3E5PA 2V38A 1P7TB 1JAEA 3LA4A 4JQ4A 3ZT5A 1VZWA 4GMEA 3WLLA 4WJ8A 1E9ZB 4IFRA 3MVIA 3DXIA 3WNKA 4JTCA 2ZKMX 1EPVA 1QNSA 1OZQA 4MJMA 1VENA 4NJGA 3L66A 4AX6A 4I8DA 2EPKX 2ISFA 3SN4A 2YA1A 3HPXA 4QSFA 5MF5A 4K38A 3AICA 1V6YA 2PWUA 3B05A 3TN5A 2C16A 4Q8UA 3ZXWA 5KETA 5JBDA 3LDVA 3EPOA 4GINA 4NX0A 5CC6A 4CQ8A 1BRLB 1VGAA 4FX6M 3B4UA 1SZGA 2NSXA 1G67A 3V5OA 4JN7A 1V6TA 5IBXA 3MC5A 3FV9A 3L0GA 1IWPA 3V35A 2WW5A 4XO6A 3H4GA 4A8IA 1VEPA 2ZZ1A 4G8TA 2V82A 1QOXA 3V0TA 3GR7A 4E4PA 4LCQA 1EO7A 3TZNA 5BXSA 1Q3NA 2ZRVA 4V28A 3KWXA 5CC3A 4E3TA 3A4AA 1LWHA 1E73M 1MFUA 4TVUA 1W8SA 3LPFA 1MNZA 4OUIA 3LSBA 4W86A 3AHTA 4R7WA 3BDKA 3C4UA 1ADDA 2I9EA 3VFCA 1RPKA 3O07A 2XPKA 3N25A 3WL1A 1EF2A 3VABA 4O52A 5LA1A 4B5NA 5D33A 2ADAA 3VD7A 1E9IA 1FX6A 2BB0A 4QXIA 4MUPA 4K2SA 3EWBX 1DIKA 1G7VA 2VM8A 2VVNA 3I3EA 4PGLA 1BG4A 4GY7A 3RDKA 3NR0A 1XDJA 1FXPA 2MUCA 4FEZA 2WHJA 1Z42A 4HHLA 3L67A 4V2XA 2R8WA 1XINA 3PUOA 4JEJA 2Y62A 2ZX7A 3EWCA 4DVOA 3VOCA 1S38A 1PDZA 2OPJA 2BLEA 4NZ4A 1JD7A 2A7NA 3H2OA 3WQEA 4DRSA 3FS2A 2DZXA 2BHZA 4Z2HA 2YL8A 2Y24A 1DHKA 3T44A 3HG5A 3VDHA 4Z17A 2VR2A 4C1KA 1XIHA 3VK5A 1FWBC 4AXNA 3BAWA 4BJHA 1RCXB 1N55A 1XHGA 1W9UA 2VQUA 4ORIA 3W3OA 3UG3A 3VIGA 4C91A 3B9AA 2QMJA 4J4KA 1GEQA 1C93A 3HJZA 2PBOA 1RVKA 3O6YX 1TPVA 3I6TA 2QW5A 1JZ4A 5CJNA 1YTDA 5EMKA 4QAIA 3AZSA 1KW1A 1JZ2A 4UOJA 2EGZA 2JEQA 1PS9A 5D9NA 5FACA 2DT0A 2GLKA 2O56A 3N6HA 2OOGA 3BARA 1M6JA 1TWZA 5FAGA 3KP1A 1IE7C 1KTNA 5CPQA 3EWXA 1BTMA 2IKJA 2WXDM 1H7OA 3TKFA 3BQ6A 3WD2A 3NXFA 4ERAA 4ZGYA 1PDYA 4EXAA 3H6OA 4C5ZA 4Q33A 4J2MA 3ARSA 4S3JA 5E9XA 5CC5A 1HJQA 1ZAHA 2HNEA 1G1YA 2QF8A 2E1WA 5HPCA 3AWOA 1KM4A 4A8RA 3TNBA 3IIPA 1VFLA 3VX0A 2CWXA 5CSSA 1QPQA 3T0TA 1JYVA 2A2IA 3GH5A 5DCEA 1XIMA 2O4MA 3D0CA 4HHHA 1S2VA 1W5OA 1PCKA 3NO5A 2VUNA 4Y9AA 5D03A 4AZHA 2PDMA 3F5LA 4XZHA 4F0MA 1R2RA 4FA3A 1TV3A 4WDTA 2XYLA 2XH4A 1W1YA 3L23A 1RHCA 3T4CA 1W5QA 2QNEA 1XLBA 5CZ0A 1W5MA 1XDMA 1Q6QA 1I2NA 2ZZ2A 1P0DA 3CO8A 2PWHA 1FHVA 1K6WA 2MNRA 3L4TA 3UNDA 4CVWA 1ITXA 2GSJA 3O0KA 3UEQA 1TRIA 2V2DA 1GQIA 3RM4A 1TKKA 1OT1A 2R6OA 4LUYA 4GIRA 1ME7A 4XVEA 1UD3A 3CZGA 1FWHC 3QHNA 5AHNA 3FKRA 1TZZA 2FJKA 3IK2A 3E2SA 4O57A 5CJMA 3BOLA 3T0DA 3LQLA 3IS4A 5ABFA 3DYMA 4N4QA 4R7JA 3XINA 1XPYA 1XH2A 1AH0A 5CPNA 4E2DA 4DPPA 4FNRA 1V79A 2Q8LA 5DEZA 4GI9A 3ARRA 3PZMA 4LCRA 2OLAA 1GVEA 2GUYA 3NPUA 2ZBTA 4C6MA 4DY1A 2CLHA 4PBFA 4A3UA 3W29A 4LWWA 3DOPA 4HA4A 2BASA 4O8AA 2YCIX 4NASA 4TMBA 4O11A 3VZZA 5CZKA 8A3HA 3AHZA 3W7CA 3LUTA 1V4YA 3UR8A 1X7IA 1JUBA 5IOBA 1UCWA 1XFCA 1US3A 1PYFA 3CAKA 3CMJA 5HMEA 1IXNA 3W75A 3N3MA 3LN3A 3UWYA 4XD3A 2W62A 1ZJHA 1ADSA 3R11A 4S3AA 3W7JA 2QF7A 3CUZA 2D23A 4HA3A 1MXGA 3PBWA 1B90A 2BHYA 1OGGA 2WYSA 5IHSA 3ARVA 1NP0A 4HD5A 2INFA 3BZGA 1LQ2A 3VX1A 3ARYA 1TPC1 2FGBA 2Z25A 2I5IA 2FIQA 3TYDA 4MNLA 4NAFB 4NG3A 4UUIA 1A53A 3RO8A 1CGYA 3WG6A 1JZ8A 1GZGA 3OLEA 1BXCA 5LIUX 2D0FA 2CHOA 1KV8A 4RXGA 4D6IA 2VHLA 1DVJA 3PBYA 1CGWA 3UY7A 1JRCA 1XLLA 3UZWA 4C6PA 3MWCA 3MWAA 1P6WA 2D2HA 4XZBA 2FZDA 5I3HA 1LT8A 1YDOA 2WPBA 5A6AA 4DJEC 2E6DA 1MSSA 1BWKA 4M0XA 3IUIA 3BSHA 4YNGA 1UA7A 2ZX8A 1M7PA 1VS1A 2G4FA 2R24A 1TREA 2CZDA 1DTNA 3P8JA 7TAAA 3DAQA 1L2UA 1BWVA 4O4WA 2XSBA 3BH4A 1TQXA 1J0ZA 1UH3A 3IGUA 4WJEA 4HNOA 1WKFA 1P1XA 3HN3A 1HTIA 4H6KA 4UTTC 4JTDA 1WYIA 3RM9A 2FTPA 1FA2A 1FUYA 1VBGA 3MBFA 3WUGA 3RPDA 1VR6A 4CU8A 1UWSA 5CSUA 2VDGA 1C9WA 2BHUA 1U1UA 2WSKA 3QLDA 3GVGA 4I7WA 2IQTA 2C1HA 2Z2AA 2FPVA 3W87A 4UMBA 4CD7A 5C55A 1MQRA 2BV9A 3H54A 1GGOA 4X63A 3UGVA 2FVMA 3PJTA 3L4WA 1TSIA 3LBCA 3R0DA 1G4TA 2X7WA 1NIUA 2ZXAA 4NZ3A 1DOSA 4NZJA 3VIJA 4UFJA 3OODA 3N2XA 3MHFA 1ONXA 5M5DA 3ZMRA 3EKLA 4QLJA 2HMCA 1TTQA 3MQTA 3L4UA 3W7IA 1TV4A 1J18A 2J7EA 1TR1A 3VU2A 1XH1A 1FH8A 3AIEA 4GFIA 3PAOA 4ROPA 1TZ7A 4Y9PA 2R1PA 4WSJA 1UIOA 3OVGA 4JFVA 1V3LA 4MWAE 3C61A 1XS2A 2NWSA 3GB6A 3TIMA 1XIBA 3MMTA 2PEVA 2D0HA 4XAYA 4G6CA 2V30A 3CK5A 3NG3A 1X8FA 2YDSA 5CAHA 1V03A 2GK1A 3M5VA 4WDWA 5C70A 3IJ9A 1E9YB 3B0YA 4MYXA 3T40A 1YX1A 1XC4A 4NZCA 1ELSA 3DERA 2XHYA 3DH7A 4UQ9A 3SUSA 2GVYA 2E9BA 4J3ZA 1K7EA 1UA3A 1IT0A 1MDLA 5GQBA 1K77A 2X0HA 4A3RA 1KQYA 3LGEA 2ZIDA 4DYJA 4JN6A 5BZAA 3CHEA 3N2CA 3PK7A 1PE1A 4GQRA 3DFOA 3B0PA 2QDDA 4GZJA 4OJYA 3E12A 1HP4A 3PPGA 3KOZA 5DN1A 4Z42C 3W73A 2YBUA 4ACZA 3UPMA 1VKFA 3G0XA 1D9EA 2GJXB 4NNAA 4JN8A 4Q4OA 3WQPA 3AU2A 4ZXLA 3UZ5A 5DMYA 3BAYA 4XTDA 1ZNNA 3LTSA 1EWDA 3G6MA 2E8ZA 1BWLA 3AXMA 4X0NA 3WH6A 3WELA 3K4AA 1JULA 1JFXA 1KM5A 2OT1A 1T41A 3DUGA 1W1TA 3BLDA 3HGRA 3MI6A 3FSTA 3HMJG 1EX5A 3RO6A 2O4QA 1CXEA 4K8GA 1BYDA 2NQHA 2ZUMA 1A47A 3M0LA 1XLMA 2QJHA 4EXBA 1ONEA 4OQVA 3NIYA 2CKSA 1B5TA 3QHOA 1ITUA 3GUWA 2DT3A 1A50A 5GNYA 4XISA 3MCMA 2WJDA 4A22A 2VJXA 3LGDA 4HNUA 3APYA 3RRAA 1UR8A 3H70A 2Z1SA 4O15A 1RLCL 3BGAA 3SCRA 3VIIA 4GBUA 2AKZA 1GVIA 1FY6A 5ECUA 4NT0A 4Q4PA 4A3YA 2QCNA 3S6OA 1PX3A 2CIPA 1SUXA 1K1DA 4IHCA 3NPVA 4E2OA 1EF3A 1ZRQA 4ZQMA 3JW7A 1JJKA 2NXGA 5JXQA 4ZQNA 3QV7A 1Q7MA 4CCEA 5AECA 3W1XA 1S39A 3BCJA 1JF6A 1V6WA 3P80A 2ZXDA 4CNOA 3CH9A 4HTBA 5B80A 3ELFA 1ME9A 4OVXA 3BGJA 2F9RA 2XVNA 4OT7A 2YFOA 3T2OA 3BCDA 1WP6A 2NLIA 2DV0A 3EA2A 2R1LA 2REQB 4N02A 1W1VA 4LEQA 3H7UA 3WN6A 2XGIA 1WUEA 4RZ6A 4M6VA 2NQ5A 3SY1A 2JEPA 3M5YA 4NJJA 3H21A 2ZWZA 4BI7A 1XRSA 3CQIA 4NNCA 1QVBA 4N9CA 1F3EA 3URQA 1TFVA 1HNYA 4ZXOA 2NX1A 3TCSA 3I7RA 1GORA 4LYQA 1TJ0A 1EGVA 4LSBA 7ENLA 1K9FA 1P7TA 3RLGA 1XG3A 5AC5A 1LZOA 2PDWA 3LM3A 5FSDC 3WD4A 2QDGA 4E3VA 3S2MA 2DZPA 1O12A 4UBPC 4I9JA 4JTGA 3VGBA 2BXZA 3LCFA 4O28A 2V2CA 3RRXA 4QDPA 1FWJC 1BQGA 5ABEA 2QCEA 1EZ2A 4QP0A 1PO9A 5BNKA 5H8PA 3P0WA 1BG9A 4M6PA 3OZPA 3EOEA 1LM1A 2EKCA 5GNZA 3A13A 1MUMA 3AS0A 1I2QA 2F2KA 1BKHA 4UOQA 4AZGA 3OW1A 5K9XA 1W3HA 3W1TA 2ZC8A 1BRLA 1O7AA 2G37A 1CLVA 5EFFA 2OZ0A 4L64A 3AO0A 2OEJA 4C6DA 1K70A 2NXIA 3VDBA 5C7HA 4FX8A 2HRWA 2O55A 4O12A 4IX2A 2AL2B 1CB7B 1CBGA 3EMCA 4TTGA 1BXBA 1XG4A 2D3LA 4URIA 3B0UX 4D8AA 1PX4A 5AVNA 1H1NA 1F4HA 3RF9A 3AJXA 2W67A 1LTDA 2QCGA 1PTDA 3R8RA 4B5SA 5EYWA 3W01A 4LBUA 1XLFA 2H9AB 5EBUA 4R27A 5IDZA 4U3AA 3M7WA 3BVJA 3WQ6A 3IJ7A 2WM0A 3R7MA 8CGTA 1K4HA 2CXGA 4FO4A 3LRKA 3SQLA 3DG3A 1XSKA 2NQ9A 3VUPA 4CN1A 1GOQA 1EDGA 4K7VA 4P7QA 2YZRA 3LXAA 2GGGA 4UTWA 2CEQA 1M04A 1EJXC 1KD0A 1QT1A 4HOXA 2A1YA 4RE0A 2KX9A 3U5YA 5D32A 2RGMA 1Q7QA 3HQ1A 5CBBA 1D7FA 3TQVA 5FIPA 2WMHA 4AEEA 1Y0EA 3TTOA 3LRLA 3C0QA 3QYSA 4DQWA 1RXOB 4GQBA 4LC8A 1DJIA 2PDCA 2JQXA 3D5HA 3WF3A 3FGCA 4QE1A 3WK3A 2GUUA 3P14A 2YB4A 5G4WA 3TW7A 3UBPC 4Q8PA 4V15A 3PTKA 4FB7A 4QAWA 5CKSA 4C1NB 1Q5MA 2QUMA 3BCFA 1O1HA 1OC5A 2NW0A 1R87A 1VBHA 4RX0A 3GSMA 1GT8A 5K7JA 1J2BA 3GIPA 4JKLA 3A9IA 4ZB5A 3VIOA 2ATMA 1JCXA 3VOGA 1KTCA 5AFDA 5U4NA 3PJXA 2WV8A 3CIWA 1IGSA 3EBVA 1HJWA 1BXNA 1DJXA 1JDDA 4HNNA 4Q8NA 3GR4A 5JMUA 3BMXA 2WKLA 3OYXA 3GQYA 2VC5A 2ZVIA 3LOTA 4REQB 1DWFM 1HKVA 4NJHA 4LS1A 1JUKA 2OT0A 3RNDA 5HQLA 3CUJA 3LV5A 2F84A 3SCQA 1E4LA 4PMZA 3QGKC 3TXZA 3T2QA 2YKKA 1IEIA 4PSPA 2OWXA 3FOKA 2G0WA 5M03A 2V5CA 2QVNA 1QI2A 3N9KA 2R1MA 5A1AA 1VPXA 3VOIA 3GXFA 3S5ZA 3C2RA 1LDCA 2QQ6A 1GJPA 1RJRA 4WLCA 3AMLA 3IARA 3AYSA 3DHUA 3OLGA 2I9UA 3FEMA 4CVUA 3G1VA 1W1A1 5D4YA 4L1WA 3HG3A 3PZIA 4JXCA 1V5XA 4E6MA 3UGRA 4FSAA 1J9YA 4ZO7A 3A22A 2DEPA 3C0LA 4LNCA 4AZ6A 2A5HA 3GBDA 4LCSA 4G5DA 1X96A 1WKYA 5FOOA 1JPKA 1XQKA 1KV5A 1TA3B 2X8RA 1DXEA 3A12A 1QFEA 4ZFCA 3LEPA 2E68A 3CV6A 1W91A 3PJWA 4HKPA 2ISWA 2VZUA 1GOXA 2BY0A 4PTXA 2VUYA 4Y96A 3UJEA 3I7QA 1FWWA 2B7QA 4A05A 1J96A 1QHZA 3F4VA 2BVWA 4HGXA 4DBEA 4ZE4A 1O5XA 2CLPA 3W7PA 3GKFA 2HK1A 2QAPA 1UUOA 3TH6A 1Q6LA 3UCDA 3TYBA 1R8LA 2QHAA 4LRTA 1PIIA 2OZ8A 4W5ZA 4AD4A 3MV11 4IX0A 2A7RA 2ACUA 3E74A 3HGJA 3TROA 2J7FA 5F2LA 1S3HA 4CQ9A 4F9JA 4LX4A 1HZYA 4U4MA 1H0GA 3W1QA 5AYYA 3W74A 4CN4A 1Q66A 4HSHA 5E0KA 2ZUSA 1PAMA 2VGIA 1B4KA 2ASHA 1TMQA 2QS8A 4KFPA 1GOMA 2BSLA 3LB0A 3FFSA 4UWMA 3ITLA 5FEPA 3T0CA 4LYPA 4YPJA 2YXXA 2NX9A 4KRZA 1BPLB 2E6AA 4YTTA 4PCFA 4C5YA 3EX2A 4JX6A 2DVTA 1WXJA 3AMCA 2ZA1A 2UY4A 1H62A 2OELA 3BG3A 3CASA 1FWFC 3ALGA 3AUOA 2AMGA 4WXZA 4IMEA 3CL8A 1NDZA 1B9BA 4HQVA 1JF5A 3RLHA 4H00A 1CLXA 4AHQA 5TAOA 1J01A 2DZTA 6XIAA 3A5FA 2FDMA 1IYXA 3LS9A 1E0VA 4RE4A 3H2NA 4UFHA 1FHUA 2BOGX 3LPOA 2A85A 1XV8A 3S5SA 1EGMA 2V9DA 3PF3A 4F0SA 1M5WA 2J6XA 4HPXA 3LCGA 3TWAA 3M0XA 1OABA 4ZZ9A 4AQLA 1A3XA 1UP0A 3N19B 4OBSA 1XGEA 3SEPA 2CW6A 3GH4A 3EZ4A 1AFSA 1Q6CA 3AZRA 4F9DA 4YVVA 1UASA 1VYPX 2QR6A 3F03K 2C3ZA 3URBA 3SSJA 4YJ5A 4DZ5A 5I77A 1TWWA 3EX3A 4R34A 1UR1A 1W2PA 1DXIA 3JR2A 4JDYA 3QXBA 3S2LA 1GG1A 4NAEB 5I3JA 1UD5A 2C6QA 2J75A 4Z1BA 1HGYA 4EPEC 4S3GA 3EOUA 3OBAA 4L9YA 3QLLA 4PUEA 4O1CA 2VGGA 3RITA 1XWYA 1GQNA 1I2PA 5E0CA 1NY1A 4RV3A 2W91A 2C8NA 2F7FA 4RNIA 5KINA 3NGJA 2Y5JA 4C6FA 2Y61A 3S1UA 1CGTA 2OSYA 2E6FA 4ICCX 2X0SA 2E9LA 1CGUA 1MDRA 4AYGA 4ZA0A 2J8FA 4B4HA 8XIMA 1LL4A 3MT1A 1DWHM 1EBHA 5XIMA 1LROA 5H1WA 3TFXA 4HYWA 3VKJA 7REQB 1CEOA 4QDMA 1MRQA 4GUFA 1J11A 2JE8A 2E8YA 3W37A 4Q8WA 1T8QA 3SZ8A 1YPXA 1W1ZA 2PDUA 1JAKA 2J27A 3FXYA 1FWSA 2VEPA 1XLJA 2WPGA 4YU1A 4HMCA 4X0VA 1VD6A 2QLYA 2G3IA 3TW9A 1BHGA 4KWWA 1KB3A 5BCAA 3S8HA 1EJRC 5M1TA 3W84A 2XFRA 4RNHA 1XPGA 2OGYA 4WCJA 1U5VA 3RU6A 4GISA 3STCA 4D6EA 3GU2A 1Q6GA 1UR0A 5DX7A 3NEHA 4KCVA 2OMAA 3GNRA 1G9HA 4RJEA 4HN8A 1W17A 1PKYA 4JL1A 2VX4A 2A3EA 1EZWA 3V16A 2A3BA 1SFTA 3C2EA 4PRRA 3V5CA 2F6KA 3STEA 5HAOA 4CEUC 4XV0A 2VFHA 3BURA 2X1UA 4OWGA 3M44A 3MV01 4XZ9A 2GJXA 3P0XA 1Q65A 2VRJA 2ZZ4A 2XIIA 1TE1A 3QGVA 4DM2A 1UC4A 1EKOA 4WDXA 4N6FA 2E1DA 5LNUA 1QU4A 4F0HA 2IS7A 1KRCC 1ZGDA 4FALA 2B7PA 3N13A 3Q58A 3HPSA 1FWCC 2UY5A 2ZICA 1RJQA 2W6RA 3RUBL 4CQAA 3NL6A 3TYZA 5KZMA 3FX4A 2XN1A 5LXXA 4IMAA 1ML1A 1WBHA 3ARTA 4PMUA 3UW6A 4ZQOA 2YXOA 4EF9A 3RILA 4L4LA 1GTEA 2AQVA 2VOTA 3QGAC 2OLSA 4GUIA 2I17A 1GTHA 3W7EA 5A69A 4W7UA 4DO4A 3TX9A 3WDIA 1P0NA 2CITA 2NV9A 3C6CA 2QJMA 4MKNA 5HQMA 1RQHA 1TCMA 1WZKA 2NUWA 1BYBA 2J24A 1D3GA 3W7HA 5DFAA 3FSUA 4O0QA 2CBUA 2DQWA 1CTNA 3F4CA 4OKDA 2VQTA 2YDRA 4H9UA 3BL3A 2ISSA 4J7RA 4Y9MA 4JTJA 3UWWA 4QJ5B 1R3VA 3LD5A 2IKHA 2GVJA 3RK8A 3MUY1 4YMZA 3IGSA 5C54A 4Q8VA 2WC4A 3EKGA 1UQYA 2W61A 3FEQA 1OT2A 1IWBA 4DBDA 3IACA 4H9VA 1R0MA 3P2VA 3N6JA 4CD4A 5C8BB 2Q3RA 1AQFA 4DN1A 1QTWA 1HIZA 4H19A 4MWAB 3IIZA 4X9SA 5U7SA 3SM0A 1Q8AA 2REQA 3WUFA 1VLIA 3WDJA 3E0LA 1MZHA 3QR3A 1SW0A 4LV9A 2P3EA 1XYAA 3R43A 4UFLA 1B3WA 3FW6A 1EH9A 4JKMA 1GEHA 3TYUA 4L6HA 1K4GA 4JDBA 3L4VA 1AH4A 1CECA 5A6JA 5J5RA 5BXRA 3QKZA 3WQFA 4I7UA 4LUTB 4WY0B 4NHVA 2VZSA 1O4UA 1J5SA 3Q67A 4FNSA 4AWSA 1LG1A 5BWFA 4RNFA 1VFMA 3BG5A 1VC4A 4HCDA 5CGMA 1GHRA 4JHZA 3H53A 4UOZA 2RGLA 2ZRZA 1OF8A 1H5YA 4O13A 1UBSA 3I10A 3WBEA 1L9WA 1TYGA 4JZ5A 1D2KA 1MRAA 1YPFA 2D3NA 2HCVA 2VZOA 4F66A 2WANA 2PURA 2B7NA 1EX1A 2RAGA 3NQ6A 3VOJA 1UUQA 3EYPA 4L6DA 3BV4A 4X3ZA 3SIMA 4M24A 3AXHA 1VYRA 4KEUA 1VIWA 2E09A 4AIOA 4CNNA 1E3XA 3MHUA 1MMFA 3TOYA 1WO2A 2GJPA 2GJLA 3W2UA 4WR3A 2WMIB 3W6YA 4NL1A 2AL2A 2QDEA 2XWDA 1I75A 3QKEA 1THFD 4XAFA 2D1ZA 1HVQA 3IJQA 4LUJA 1QRQA 3EX4A 4KW2A 6PTDA 4N42A 4GZ7A 4LANA 3S9ZA 2DUXA 3C3UA 2RFGA 3KZPA 3M0JA 4PN2A 3TJIA 1KFWA 4K7YA 2PDIA 3M64A 3FYYA 3SURA 3CBWA 3KBJA 1I9CB 4UMCA 2X41A 3NQGA 5A6KA 2AMXA 3KRBA 3KOXA 3ID7A 3LCLA 1CNVA 3GTIA 1Y5VA 3SGUA 4M6UA 5DF0A 3NJ3A 2ODOA 5CBJA 1MQQA 3PZOA 1MW1A 1PSCA 4HPHA 3UF9A 3OZOA 3STFA 3SRHA 1R38A 4TX6A 2CCRA 1GWJA 3FCPA 4K1GA 4LVAA 3ORWA 4UTJA 1XCWA 3POCA 1GOWA 3GC5A 5DANA 3U0HA 2ZRUA 1AMYA 1D7KA 3ZJ8A 3ISIX 3BLKA 2EPHA 3ZR5A 2OQHA 3CPGA 2W79A 4DI8A 1RQEA 3TN6A 2J8TA 4BEQA 4IP7A 5I3KA 1P6BA 4KEVA 1QASA 3QZEA 4QS5A 1QPOA 5FAJA 3GZ3A 2CC0A 3P3BA 1ITQA 1HJUA 1EJUC 4KPLA 1UJPA 1E1CA 3MUXA 4PUKA 3W2NA 3FYPA 2XN2A 3ARPA 5AYIA 4KKXA 3KW3A 3HM7A 1JDEA 4DBSA 4CQCA 2ZCGA 2G97A 1BQCA 1OGBA 1TR9A 1B30A 1ZJBA 4CUCA 2ALRA 3GNDA 4MDOA 3W38A 4EVZA 4GYJA 5HMDA 1TWIA 4IMGA 5FF2A 1XYFA 1PJ9A 3Q45A 2I14A 3C56A 3P60A 2VFEA 3MANA 3Q65A 1EIBA 4PCSA 3JZEA 5F1UA 4CEXC 1T6MA 1BSIA 2OEMA 1WUFA 2ZADA 4MFDA 1ZBWA 3MW7A 4YVXA 3NPWA 2V5LA 5CSRA 3CYJA 2WJZA 3TSDA 2JKEA 2HSAA 2KZHA 4UFIA 4WEVX 4IT1A 4LB3A 3LPPA 3NL2A 2X42A 1MW2A 3OA3A 4HB7A 1OC6A 2C0AA 3KLKA 3GBEA 3K8KA 4EWND 2G3MA 2C79A 1GVOA 1OCBA 5DMMA 1Q6RA 1Z44A 2J13A 3S47A 4GY1A 4S23A 4B5WA 1K9TA 5BOEA 4OGZA 3OA5A 5ABTA 2X1IA 2OZ3A 2GYIA 4JTRA 4K68A 4F3HA 4US5A 2ZA2A 1KBBA 5F4XA 4RZ4A 3BOFA 3E1F1 2QJIA 3AS3A 1W9XA 3PTDA 1TX2A 5DY2A 3SI9A 1H49A 1EL3A 3A9BA 4HZ6A 1SO4A 4DJDD 4L5ZA 4YHGA 1VCVA 2WO5A 4ZFMA 1TV5A 3T8QA 2VYOA 3W82A 2AL1A 1JZ5A 5J5DA 3JVAA 4TXEA 4DWSB 1JXJA 3U8GA 1RD5A 2A21A 2IUZA 2YZ5A 3WK2A 3K1DA 4X2PA 2P10A 4GX8A 3BZJA 3VD3A 4D6FA 2NSOA 1T99A 5FL1A 1TA3A 4NY2A 4MNKA 4XUGA 1TPDA 2HE8A 4A35A 5C9UA 2P1FA 1W3JA 1YPIA 2GQ3A 3W70A 6XIMA 4UTWC 3G1AA 4EIVA 3RG6A 2OWWA 3TNOA 3RU8X 3F5KA 3AXXA 3I6RA 4LAZA 2QXWA 2VRKA 2FMNA 1ZCOA 3OG3A 2B31A 1XBXA 4BF7A 4UB9A 4AD1A 3E96A 4QIUA 3F2CA 4O53A 4MAVA 4H41A 1GONA 1BVNP 1NQKA 1TJRA 4HYVA 2PP0A 1X6UA 3BSMA 4JTKA 3MP3A 1JNDA 1C8QA 2JF7A 3VI2A 4D2JA 5BXTA 3GFYA 1OY0A 1KRBC 3WLQA 3O9NA 3ITGA 1RH9A 3AQUA 4Q32A 4S3EA 3OJGA 2BXVA 3IIVA 3R79A 3WBAA 3SY8A 3KDNA 1U83A 5FJTA 4LF2A 3GE7A 1EEPA 1H50A 2PDLA 4AIUA 4B16A 3WIJA 5EMUA 3UY8A 4LUIA 3RAOA 2PDQA 4FOJA 5HMSA 1QATA 3N3TA 5HANA 1K03A 3T08A 2PRLA 4XTIA 2GGJA 3QFWA 3BPWA 3PBUA 1OFBA 1KCLA 2PS2A 1O95A 4B5TA 3TJLA 5LGXA 4DZAA 1VF8A 4RE3A 3AU6A 4HNTA 5TIMA 4QX4A 2EG7A 4P7OA 4NKCA 3AOFA 2IXVA 5I3IA 4IISA 1R9YA