1BTMA

Triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
251
structure length
251
Chain Sequence
RKPIIAGNWKMHKTLAEAVQFVEDVKGHVPPADEVISVVCAPFLFLDRLVQAADGTDLKIGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAGQTNAVVASQVEKALAGLTPEQVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRLFGPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGPLVGGASLEPASFLQLVEAGRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIOSEPHOSPHATE ISOMERASE
publication title Crystal structure of recombinant triosephosphate isomerase from Bacillus stearothermophilus. An analysis of potential thermostability factors in six isomerases with known three-dimensional structures points to the importance of hydrophobic interactions.
pubmed rcsb
source organism Geobacillus stearothermophilus
molecule tags Isomerase
total genus 91
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 1995-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1btmA00
2Y7GA 5I3KA 2I9EA 2YDAA 4IX2A 4UTIA 1W5MA 3L67A 3B04A 3K30A 4PL1A 1TMHA 3DHFA 2Y7EA 4DEFA 1DKWA 3RNDA 1IXNA 2ZDRA 4N2YA 1L6SA 1TB3A 4OWGA 1HTIA 2Y85A 4CQ8A 3NQ7A 3Q58A 3P8IA 3HBLA 4M7SA 3TCEA 3UWUA 1F2JA 3TQKA 3S1WA 3NQ6A 3P84A 2QCLA 1C9DA 2X1SA 4LVGA 3WJWA 2OX1A 5K4ZA 4JN6A 2G5WA 2QCEA 4JDBA 4WZHA 5K7JA 2YYTA 3BG3A 1O60A 3CC1A 2XN1A 4POCA 2CLOA 2C6QA 2HSAA 5FF2A 3B0UX 5HMSA 5G2IA 2H8XA 1RPXA 1THFD 2FTPA 4FXSA 1IXOA 3F03K 4MUZA 2F7FA 3NZRA 4JTJA 1JCXA 3GNDA 2EPHA 3W07A 2NV2A 1SZNA 3C8FA 2JBMA 1YYAA 4LC8A 1XDMA 5F4XA 1KLZA 3NVTA 2V0TA 4FNRA 1QNVA 4O54A 1K8ZA 1V5XA 3CLMA 4JTHA 4FNPA 2QCFA 2BZNA 1PIIA 2E5DA 2XN2A 2YW3A 1JVNA 1QPRA 1ZHAA 3WJYA 1I4NA 3NL6A 2NLIA 1H1ZA 1XBZA 3L0NA 1JCMP 3O63A 2ZRXA 2J27A 3L66A 3GVGA 3PULA 1MSSA 3UZ5A 3DI0A 1PV8A 2VEMA 2ZFAA 1EUNA 4JXCA 4LWWA 2JKPA 3MI2A 4M5PA 1VH7A 1T96A 1WV2A 4RJEA 2NX1A 5DY2A 5CZJA 3L68A 5EMUA 1LRNA 1NSJA 2FB3A 4BI6A 4O8RA 1R2SA 3HJZA 5IM51 4BR1A 4HT3A 1KLYA 5D09A 3G1DA 3GYEA 2ISWA 2QCGA 5AYXA 1VJIA 3O05A 4IWWA 1LLZA 1K7XA 3IVSA 2GQ9A 5D2TA 1QMLA 5F1VA 4GUGA 1OYCA 1DQWA 2VXNA 2HMCA 2QJHA 4P61A 4GXMA 4BFAA 2YGYA 2NWRA 4ZZ9A 1PVNA 5FF4A 3NPVA 3N2XA 1SZFA 1Q6RA 3STEA 1TREA 3W23A 2RKXA 1A53A 2C14A 4X22A 1FWSA 4K39A 4I7WA 3G0SA 4ZQPA 1K03A 1XDLA 1D3GA 3BLIA 3SGZA 2OT1A 1F7BA 2RDTA 2V2CA 4GE8A 2WO5A 4MFEA 1JUEA 4A2SA 4N4PA 3P5YA 3G3DA 1QAPA 4HSNA 5U4NA 1K7FA 2EHHA 4N9EA 2BLEA 2V2HA 3FOKA 5MHBA 2YFNA 1QWGA 2BX7A 3G0XA 1DV7A 3MP5A 3SIZA 1R2TA 3G1SA 5KITA 4FO4A 3PS7A 3T7VA 3W1TA 3PM6A 4O10A 4K37A 5C55A 3W7LA 1HUVA 2CLIA 2ZRUA 5CZ0A 3DU0A 1ZAJA 1KV8A 1FCVA 1GTEA 4MZYA 1TPH1 4IOTA 4DO4A 5AHLA 4XBKA 1XBYA 2OJPA 3TE9A 2ZRZA 4R33A 5T26A 3NG3A 2WKJA 4LUJA 2HS8A 3FEMA 3E12A 3LTYA 4RZ6A 3LB0A 1G4EA 1FCUA 1GQNA 5D2VA 3O16A 1FWNA 2DJXA 4EF9A 3HQ1A 3W75A 1AL7A 3PB2A 1Q45A 4XKYA 3HPSA 4I7VA 3HGJA 2AGKA 3F1QA 4FF7A 1KBJA 3S42A 4OV4A 3IGXA 3GAKA 4ORIA 3QYQA 4OT7A 3V1PA 2FLIA 3GXTA 1J5TA 4LOCA 2FPYA 5D2WA 3NPWA 3W7KA 4MLRA 1QO5A 4O13A 3HIJA 3EB2A 4UC5A 3QQ1A 1NVMA 4XQ6A 3P7YA 4JIQA 5GVJA 4R34A 4GUJA 1RQHA 3FJ6A 4JY8A 4GUHA 4ZQCA 3DFTA 3PY2A 3I7SA 3EWWA 4O53A 1SFLA 3KRSA 5K9CA 2RH9A 4O1DA 4QITA 2FIQA 1MO0A 4FEZA 3UWVA 1P1XA 4ALDA 1FUYA 4DF0A 2I14A 3CHVA 3LXBA 4HNVA 1XI3A 4Z1BA 4Y6GA 1IIGA 2QR6A 3GXPA 3RF9A 4BWLC 3TX9A 4NJKA 5D38A 3O15A 1O5XA 3UY8A 4PODA 1JCJA 2Y7DA 1OFOA 4Q32A 3W7GA 5G4WA 2NXGA 3OEXA 3TKFA 3A5VA 5F2MA 3U2OA 2E6YA 2F84A 4UNLA 5CPNA 1OABA 4IXXA 2NUYA 3L5MA 5A5WA 3GR8A 1MZHA 1TIMA 2AAMA 3QEZA 3NXFA 5AC8A 4WD0A 3W86A 5U7SA 3P60A 2ZQ0A 3TNOA 1NEYA 2ABBA 3KVKA 3TH6A 1WDWA 1G67A 1YADA 3S9YA 4TR9A 4O19A 2QCDA 4FXRA 4QIUA 1ICPA 4MY1A 1E51A 2Q3OA 5F2LA 4YL2A 3W3OA 4UMBA 3M5ZA 3P80A 3WJXA 1KTBA 4ZQRA 1C8VA 2WNZA 5LGXA 1FWRA 3BK0A 3BVJA 3V75A 1H5YA 1VLIA 1BWKA 5K4XA 2EF9A 1EP2A 2J88A 4XTIA 3C2VA 2QJIA 4J9JA 5KZDA 3M47A 1BWLA 3CEUA 2ZZ4A 2JGQA 1G69A 4L4LA 3LCXA 2ZZ3A 1RV8A 3EKZA 4O0KA 1S5WA 4NNAA 3S5OA 5CZSA 3UY7A 1I2RA 2O7SA 3EXRA 1QCWA 1O4UA 5HJLA 3NZ1A 3NNTA 1GZGA 2WSQA 3N34A 4LS1A 3UNDA 4AAJA 4JX6A 3QQ0A 5CG7A 3RLVA 1OF6A 3LXCA 3TSDA 1CI1A 1Y0EA 2ZTKA 1OFRA 3THQA 1ICSA 3QC3A 1VHCA 1T0OA 1FBAA 3MJYA 3NL3A 3BG9A 1KW1A 5DBTA 4DPQA 3G1YA 1N55A 1ALDA 3W83A 1PL9A 4NX0A 4UTUA 3UXDA 1U83A 1F05A 4OHQA 2TPSA 5CPMA 4L4MA 1YXYA 1ZAHA 4GWEA 5DCEA 3STFA 4BF9A 3B06A 1H7NA 3TA6A 4AHPA 4FNQA 5HWJA 2J9ZA 1TO3A 4AWTA 1RQEA 5K9DA 2BSLA 1JJKA 3L5LA 4O16A 5BNKA 2ZCGA 4H6KA 2FFCA 4Z08A 3PB0A 3STGA 4O28A 4XUGA 3EWZA 1ZAIA 2X1TA 3TQVA 4AHOA 4KFOA 5LZLA 1TPVA 4O17A 5LKYA 5DCBA 3NM1A 1TV5A 1LDCA 4MKNA 4S2BA 3EWYA 5IBXC 1ONRA 4JGDA 3M7WA 5F1UA 1SW7A 4O1AA 4PFMA 3C2OA 1F73A 4WY0B 2ATMA 1TTQA 3CU2A 4CNPA 3UPWA 4PTNA 2ZZ5A 4C1LA 3W7DA 4U4MA 1H7XA 3L65A 1TYGA 1YTKA 3MP4A 2XN0A 3G1VA 3QMSA 1JQXA 4UR7A 4UTTC 2QCMA 5FF0A 5I3FA 1SO5A 1WBHA 4ADUA 2W0UA 1XUUA 3N19B 4YWIA 1VYPX 2I1OA 2V2DA 5I3IA 2B4GA 4K38A 4NJJA 3W7EA 4NJHA 1ICQA 1GG0A 3CIWA 3LCLA 4CNNA 4BWLA 2A7PA 3L5AA 3WK2A 1W0MA 2A1YA 1LOLA 2GQAA 2DZPA 3W1MA 4ZL1A 1H62A 3G1FA 2DZTA 3G1XA 2OCZA 1FDYA 3LM7A 4E0CA 3GK0A 1J4EA 3W1LA 2Y89A 4MY9A 1OF8A 2R14A 4O4WA 3TV8A 4S2CA 1SW0A 4UCGA 3W88A 1LROA 3FIGA 3UQNA 3C61A 1I2PA 1SQ7A 2ATSA 3UPBA 2QDHA 1OX6A 3B03A 4YCOA 3TIMA 5LNUA 1M5WA 3VCRA 4LVDA 4MVAA 2A0NA 5G5IA 3ZR4A 4JY9A 1K7EA 2X2GA 3GDKA 4UFLA 1KM1A 3LLDA 3TMQA 2A6NA 2PRLA 2WJZA 3C0JA 5G4EA 1FCBA 5I3HA 1LBLA 3DGRA 3R2GA 2GOUA 2J24A 5C5YA 2EGZA 1YDVA 3TSMA 3GB6A 4FIRA 2V30A 4CQAA 4O0ZA 3LCIA 3P67A 3C2EA 3W2UA 3SR7A 3T40A 4A3UA 2NX9A 3A21A 2CLLA 4HN4A 3W1RA 1ME9A 3ELFA 3KOFA 1CX9A 5EKYA 3E02A 2P0OA 4TO8A 3GKFA 3CIXA 3Q37A 1SPQA 3E0IA 1WX0A 1B9BA 1KFEA 4K6AA 1DL3A 3GDRA 3PBVA 1QO2A 3TSBA 3NPUA 4MIMA 2QJGA 3OIXA 3QH2A 4LT9A 1TJRA 1R47A 3EXSA 5KZMA 2ZZ2A 5EYWA 3TAOA 1X6UA 1VYRA 5HINA 2YZRA 5AHEA 1QOPA 3N3MA 5D30A 3P61A 4LU0A 3HG2A 5K3VA 2V9DA 3NGJA 1H50A 4RXFA 4Y96A 2YXGA 4ZMGA 3NQFA 2PRHA 1IXQA 3P74A 3MI6A 4MYXA 3M5XA 2VEKA 5EL1A 3LHTA 1GVFA 3NR0A 3FA5A 2CLMA 1R30A 2DZXA 3W70A 1OFQA 4IPIA 2C13A 3NQ8A 5IBXA 1I2NA 4AXKA 4FHAA 5D32A 1SR9A 2A21A 4XZ9A 4EWND 3PG8A 1RD5A 1IF2A 1VLWA 3LXAA 1R46A 4DELA 3NQDA 3TUUA 3NQGA 3B8DA 2FQIA 3D0CA 2VENA 2VELA 2QAFA 2A6LA 3EXTA 3M44A 3IVTA 3ZWSA 3SJ3A 2YPIA 2ZA1A 4TIMA 3SECA 5FF3A 2Y61A 4N6FA 1AK5A 4UTTA 5HQEA 5AFDA 1B57A 4LV4A 3CT7A 4KKXA 3TW7A 5G2WA 1LBFA 1OG0A 1W3NA 5D05A 3U6WA 3GKAA 3LI1A 3IVUA 3W7OA 3RFAA 3BLFA 4WOQA 3M9YA 5TIMA 3NL2A 2QUTA 3GAYA 1W31A 1KM5A 1N7KA 3TK7A 1TSIA 3W87A 3DI1A 1G6CA 3TW6A 1AG1O 1EP3A 5AHFA 5HR6A 1LBMA 3W2KA 3TROA 3HPZA 4GBUA 1W37A 3BGJA 6ALDA 2Q8LA 3LRKA 5DLCA 4X3ZA 4N4QA 3KRUA 1X7FA 4OBTA 3E96A 1L6WA 1S5VA 3TQ0A 4D2JA 4XKYB 2NXHA 1H7WA 2QCNA 2A7RA 1TPDA 1XM3A 2V81A 4H3DA 3RMJA 3LCGA 4IUOA 3HOJA 3LV5A 3W22A 1SFJA 1VZWA 1VCGA 1UASA 3LHZA 4IMFA 3GDTA 1EIXA 1A5AA 1N8FA 2V82A 2DORA 1W5OA 3SI9A 3GR7A 5I3JA 4IMGA 3TDFA 4NX5A 3W7RA 3WFAA 1QPQA 5CSSA 4AWUA 4O52A 4JTUA 2VFGA 1TRIA 3HG4A 2Y6ZA 1AW1A 4BI5A 3ABRA 1Z44A 3TR2A 5A8GA 2FPVA 4JNMA 3OVRA 3STCA 1WAUA 3LOTA 1JCNA 5BMWA 1JULA 1VR6A 3M5YA 1IXPA 1ZY9A 2B7QA 4LS2A 1HO1A 3A22A 2A4AA 1GVQA 3W7CA 3NOEA 1Z48A 4AB4A 5EPDA 4HKPA 2P10A 5HWNA 5FEXA 1EP1A 3W1NA 4WOZA 2PCQA 4QSHA 3MBDA 2ISVA 1G4TA 1SW3A 3QF0A 5CPOA 2CLEA 1W1ZA 1H7OA 1P5BA 4WUIA 3KFTA 4K8HA 4R53A 4KWWA 1EB3A 3EX3A 4GFSA 4LTSA 4A21A 4QQ3A 3BW3A 3Q94A 3QFEA 1I2OA 5HULA 1KTNA 3CPRA 5CZTA 3R12A 3FJLA 4PEKA 4UTHA 1SO6A 3W84A 1LRTA 5D04C 2VKZG 3QRHA 3TXZA 3CWNA 3G24A 3VKJA 3PSWA 3W7MA 3W7IA 3LHYA 2QEZA 2TYSA 3CWOX 3M5VA 2WSYA 3HPXA 2TRSA 1VGAA 3Q2DA 4PA8A 1YXCA 4KFNA 2QCDB 1DJQA 5AN7A 2VFEA 1VYSX 2E6DA 4NXKA 1XUZA 4UMAA 1ME7A 1H7RA 2E68A 4FX7A 5AOUA 3C52A 4MOZA 3ANYA 3YPIA 4A22A 3GZ3A 4O1CA 1KFJA 5KZEA 4OV9A 3E49A 2G96A 1TTIA 2ZRYA 8TIMA 4HNNA 2CZ5A 5D03A 3W72A 1KM0A 4N9CA 4E2DA 5E0KA 4W9TA 1H1YA 5AC6A 4RR4A 2H90A 4WXYA 1Z41A 3S1XA 3L21A 4ORMA 3MWAA 3PR2A 5FEWA 2H8ZA 2FB2A 4HSOA 3QZEA 4AH7A 4ML9A 4GRSA 4NUWA 4HIBA 4Z1AA 1OX5A 4QJ1A 2ZBTA 1KM6A 2NX3A 3GXNA 4FNSA 5AHMA 1YPFA 4AMAA 5J5RA 4IX0A 3O6CA 1BEUA 1WOAA 5D02A 5DXYA 3LBCA 1GOXA 1F76A 2C18A 4JTLA 1GPWA 1FCQA 3LRMA 5CPLA 4Y9AA 3NQCA 4O12A 1RR2A 3DAQA 4EOUA 1EA0A 5LHEA 4IPJA 1TV7A 1FX6A 3INPA 4GUFA 3ABOA 3SZ8A 5LGZA 1YTEA 3FYOA 1YTDA 3UWZA 4AF0A 1O5KA 4UFIA 3IIVA 3MMTA 1DOSA 1W8SA 2UV8G 4NJGA 3BV4A 4OGZA 2CW6A 3MUXA 4JS3A 1T99A 2VEIA 4JX4A 2ZTJA 3QPZA 3LCFA 4QAIA 1A5BA 4ZQMA 4RLIA 1FQ0A 4ZVJA 2Z6IA 1LM1A 3W7PA 1TQJA 3DH7A 3CTLA 4JDYA 1HFBA 5HNRA 1AMKA 3MI3A 1SU5A 1JRBA 3MYOA 4IJBA 1UJPA 3FS2A 3PBWA 5ABTA 1SO4A 3PAJA 5AHIA 2O7QA 3IIXA 2E09A 3S1VA 2HTMA 5BW6A 1GVRA 3PSVA 3DXIA 1H61A 2E5CA 1X1OA 3C3NA 3M43A 2CLKA 1P0NA 4DBDA 3QSTA 1WBJA 5D2YA 2Y62A 5KSWA 2ZRWA 1Q6QA 3T44A 2H3DA 4RK8A 3NPXA 3UWQA 4RZ5A 1I45A 4UTKA 2Z6JA 4DQWA 4I9AA 3DFOA 3I7RA 1FY6A 3BGGA 1O95A 4ONVA 3WJSA 4JX5A 2GQ8A 3B4UA 2NWSA 2A2IA 3OG3A 2H3BA 2JKEA 2Q8ZA 4CCCA 3QMTA 4QNWA 3VE7A 4TMCA 1L6YA 3HG3A 5DBUA 2Z0IA 4PCFA 2E6FA 3OA3A 4Z0JA 5TQLA 3ZFHA 1HL2A 3A5FA 2JGYA 1VPXA 2FPTA 3KVJA 1F6PA 1FDJA 2NXIA 7TIMA 3ATZA 5F2IA 3IIOA 2Z1BA 1LP6A 1W5QA 4UTMA 4PH6A 1HO4A 4IGHA 4YLWA 1L9WA 5G2HA 5KMYA 2DZVA 2WOQA 3CEPA 2C1HA 4WY0F 2ZRVA 1L2UA 1AW2A 1FWTA 1F6KA 1LOSA 3A23A 3WK0A 3I6RA 3LLFA 3QPYA 4N02A 3S5ZA 4UTWC 2Q3RA 3LERA 4MJMA 1XCFA 4MJZA 1NFBA 1YDNA 4LS0A 3ZWTA 3R8RA 2JKAA 3MO7A 4JR5A 2CFFA 3L9CA 3NM3A 3VE9A 1VQTA 2X16A 2ABAA 2CU0A 2WV8A 4UFMA 1PHWA 1XL9A 4BK9A 3SSJA 6TIMA 1R2RA 3UWWA 3W1QA 3BW2A 4LRTA 3S5YA 1EWEA 4AHQA 4MLJA 2Y7FA 3QJAA 3DZ1A 4R7JA 1AL8A 4FX6M 3LRLA 2QCHA 3MYPA 3HG5A 3KVLA 3N9SA 4Z1DA 5HWMA 2QF7A 3ZS4A 4K36A 3W2NA 3RU6A 3I65A 5EY5A 2X30A 3TU9A 4Y8FA 4EVZA 1XBVA 4AWSA 1WXJA 2A5HA 3DFSA 3TJXA 4CLMA 1OK4A 1KBIA 1M6JA 3U8GA 4E2BA 1TCDA 1DBTA 1MXSA 2BTMA 3NQ2A 1F74A 3SY5A 4MZ1A 3W73A 1DJNA 1NAL1 3HGOA 4RXGA 2VFHA 3LBMA 4NNCA 2C3ZA 2V8ZA 4MYAA 2J9YA 3LX9A 3F4NA 5BMXA 1NF7A 5DXXA 3W74A 2A85A 5KINA 2TMDA 2C16A 2FDSA 4DO6A 3R89A 2JK2A 2C15A 3TMLA 4DF1A 1H51A 1DORA 2QDGA 1ZENA 1TRDA 1OFPA 1OFDA 3L0GA 3DFQA 1EWDA 4PL2A 1TPEA 1W3IA 3SFKA 3KRZA 4N9DA 1ME8A 1GVOA 1SUXA 2NUXA 5DN1A 3HO8A 3LV6A 1OHLA 1VHNA 2QKFA 3G8EA 3LI0A 2CLFA 1ADOA 4NU7A 3IEBA 4DF2A 4QNEA 4KWVA 4GJ1A 4JTTA 4I7UA 2B7OA 3CQ0A 2OT0A 5D37A 1LLWA 1DHPA 4JTGA 1SZGA 4WXZA 1TJPA 3P62A 5I3GA 1VCFA 3CB8A 5FI8A 3MBFA 3H53A 1PCWA 4CCEA 2H6RA 4O4VA 2V5BA 3M1ZA 4DXVA 5LHFA 2RFGA 2C0AA 2VFDA 4LC6A 4KFPA 2ZZ1A 3N14A 4NJIA 3FKKA 2DZUA 1X1ZA 1OFAA 2R94A 1KM2A 1SZEA 2WSRA 4DO5A 5CGQA 4DBEA 1FXQA 1G4SA 2CWNA 3PF3A 1A50A 3EWXA 1Z42A 2WNNA 1LTDA 2ZA2A 1G7VA 1PHQA 1UB3A 2YYUA 3LGEA 3EX4A 3JR2A 2ISSA 2E5BA 2GJNA 1PE1A 3I7QA 3PG9A 4U28A 1WYIA 1OX4A 4QM1A 4TMBA 4LY8A 1ZNNA 3DENA 3G8RA 3C6CA 1S3HA 2Y88A 4YXGA 1TPFA 1YPIA 2Y63A 5LNSA 2FJKA 1DVJA 3S6DA 1Q3NA 3NEVA 1QR7A 4LVFA 5DELA 3BARA 1B4KA 3BLEA 3S8HA 1D9EA 3KAOA 3LTPA 3FLUA 3LHUA 1VCVA 4UTWA 5G1TA 3OHIA 1PCKA 1UCWA 4IQLA 3WK1A 5AB3A 1Q6LA 3B0PA 3P5ZA 3M0ZA 3NA8A 3VFLA 2VEPA 3S1UA 4N6EA 4DPPA 3G1HA 3KX6A 5L9FA 5F4WA 5FESA 4UUIA 3F4WA 1KFBA 4XBSA 4A29A 3NDOA 1VC4A 3W76A 1JCLA 4UFHA 1UBSA 2W6RA 4WJEA 3T4CA 1TPC1 2VOMA 4JEQA 1VRDA 3W7HA 2VFFA 1GTHA 3BPWA 1XC4A 3CM4A 3TJLA 4JD4A 1OYAA 3T78A 3C56A 3UXAA 2QUUA 4WQ6A 3NQEA 3TC6A 4X9SA 2BXVA 5HUPA 3H55A 3W1UA 4ADSA 4LVAA 3NQVA 1F5ZA 5HR7A 4M6VA 2NUWA 1TV8A 4GNJA 1KA9F 1C29A 3PBUA 5FF7A 3EWBX 2DZWA 1X8FA 3C2FA 4RKAA 3OBKA 5TBOA 1QPNA 4ZQNA 2PC4A 1A5CA 1YDOA 3NQMA 4JTIA 3OVQA 4LW7A 3AJXA 3A9IA 5G1YA 1LYXA 4Q33A 2D73A 4HNUA 1SO3A 1H63A 1KFCA 1D3HA 1W3TA 2PRMA 3W85A 5CSRA 1JUKA 1GVSA 3MHUA 1UUOA 3PUEA 4O11A 3KXQA 4QISA 2QAPA 1B4EA 3UWYA 1GJPA 4B5NA 4O18A 1XKYA 1YLVA 3L2IA 3W2LA 4M6PA 3O8AA 4A2RA 4NNBA 2B0MA 3VNDA 2CZFA 4GUIA 1AW5A 1LRQA 4JTKA 3P8JA 2RDWA 1KM3A 1EX5A 2GVLA 4HPXA 3O06A 2LLEA 2G95A 4LNYA 3FFSA 1TPB1 3LCWA 5E93A 3TAKA 2OZ0A 4MZ8A 3DHDA 2DJLA 4M7TA 2P1FA 4TX9A 2A7NA 4K7YA 5H91A 3TFCA 4X2RA 3W7JA 1QOQA 2CLHA 4NT0A 1JR1A 3ABQA 1ZALA 2PE4A 5LSMA 5EBUA 1OYBA 1H7PA 1VS1A 4NXSA 2B7PA 1B3OA 5CKSA 2ZA3A 2CZDA 1FXPA 2YX0A 4K7VA 1WA3A 4UFKA 4H4IA 4EF8A 4JTFA 3HGSA 1QFEA 4O1BA 3TXVA 2BWGA 1UUMA 1BKSA 2KZHA 3MHFA 4FNUA 4FIQA 4Z0SA 3W1AA 1XBXA 3N73A 2Z2UA 1XFBA 5D2XA 4AEOA 1I8JA 4UR8A 3QSRA 1J2WA 3W71A 3O6DA 4JTEA 5HUOA 1LOQA 1GT8A 3G22A 4E38A 4NVTA 4AF0B 4YMZA 2G97A 1QPOA 1GWJA 3HMJG 1SSGA 4OU1A 1M7PA 3W9ZA 4CCDA 4FB7A 2J9XA 3W6YA 3NL5A 2QUVA 2GUUA 3E9AA 2EAWA 4YCPA 5J5DA 5K2ZA 3QW3A 1WOBA 1JRCA 3UYCA 5DY3A 1P4CA 2NZLA 1KM4A 2X1RA 2Y70A 2TSYA 5AYZA 2OMAA 4Z1CA 3EWUA 3G1AA 2W79A 2QCCA 2E77A 3NO5A 2HS6A 1W5PA 1IGSA 2RHGA 3PUDA 3L0KA 2WQPA 2WPBA 1ZCOA 1KTCA 3UZJA 2NV1A 3USBA 3KVMA 3BO9A 3I68A 3DKLA 4RCXA 5C2XA 1JQVA 1S5TA 1W5NA 3P82A 4ZQOA 3QMRA 1K02A 5FEPA 3GDMA 4M6QA 4GC4A 4Y90A 5AYYA 5EA9A 1XXXA 1JCYA 2E6AA 4K8EA 2YSWA 3S0CA 5AHNA 4MFDA 1K8YA 2R91A 2X1UA 1RVGA 4UNKA 4OQVA 3A24A 3VI2A 2XFWA 3M6YA 3WK3A 3MW7A 5F4SA 5BOOA 4BI7A 1QDSA 3SW6A 1M7OA 3IIZA 1T8XA 4RX0A 4UTLA 3GLCA 4UFJA 1ZFJA 4HPJA 1V7YA 1KFLA 2VC6A 3W2JA 3N2MA 5KTLA 3G18A 1MEIA 2R8WA 2YW4A 3W1XA 4S1FA 4XWUA 1KV5A 4WX2A 3O6YX 3NAVA 4FNTA 2YFOA 4JIPA 4LVBA 2AQWA 3O07A 1I2QA 1LZOA 3AO0A 5DCDA 2CZEA 3UD6A 3GNNA 4NZFA 4AVFA 1GG1A 4PC8A 1OVDA 2YR1A 2E1DA 1O94A 1RZMA 3IGUA 1G7UA 3QM3A 2ZYFA 4TU1A 3PVFA 1EPXA 2V5LA 1TTPA 3HGRA 4IXHA 1PS9A 4RZ4A 3EX6A 3GDLA 1FDZA 3DKJA 3EKLA 2GPTA 5AC7A 1NF0A 2VFIA 3B0VC 4JYFA 1OJXA 3TFXA 2C19A 1OFEA 5E1QA 5H2ZA 1MEWA 1CW2A 2PURA 3NQAA 3LTSA 5F2GA 3IGSA 4CQ9A 1MEHA 3P81A 4IMCA 4C1KA 3PUOA 3LCHA 3NYZA 3O1NA 4UXDA 4IMEA 3MHGA 1DQXA 3BW4A 3ABSA 1TPUA 4N9BA 2ALDA 1KFKA 3PC0A 3FKRA 5LNWA 1EUAA 3IIPA 4LV9A 1TQXA 1JUBA 1H60A 4NQ1A 5K9XA 2RDUA 1EEPA 3W7NA 1A5SA 3IRDA 5D33A 1ML1A 4LRSA 3THAA 4UIOA 2B7NA 3LHWA 4HNTA 3C4UA 3LDVA 1U5JA 4ADTA 1K8XA 3EX2A 1WQ5A 2YCEA 3JS3A 3G0UA 1SSDA 3GIYA 3OVPA 3JRKA 4RV8A 2GVGA 4EIVA 3GX9A 1W56A 1LCOA 4Q4KA 2WNQA 1TPWA 1FWWA 2IQTA 4NZJA 1TTJA 4JICA 4LUIA 1BTMA 4JYDA 1GYLA 3DFNA 1P0KA 3KHJA 1OFBA 2GVJA 1IIHA 3DFPA 4UTJA 2ZZ6A 3W1PA 3S5NA 4HHPA 3WJZA 3C2RA 3R13A 4P2VA 3MP3A 1K3UA 3BG5A 4JYEA 3QW4B 3HB9A 3ATYA 3B05A 5C6MA 3M16A 4JTSA 4IMDA 3EX1A 3DBPA 1GYNA 2EKCA 4G1KA 3IV3A 3G3MA 5LNRA 4O57A 4ICNA 2J6XA 3M41A 2DZSA 4OE7A 1HG3A 4FX8A 1LORA 1RQBA 3LHVA 3W2MA 5SWUA 4MPQA 4CNOA 5L6UA 3RK8A 3TC7A 2ZZ7A 1OK6A 3PBYA 3N9RA 4WY0A 4O15A 4O14A 2DU2A 3R5EA 4XTDA 3FYPA 5LNVA 3RLUA 4O50A 1W54A 4UMCA 5C54A 1OX4B 3T55A 1ZJIA 1YXDA 3W7QA 3EEGA 1G4PA 1GEQA 4M19A 3HF3A 1Q6OA 2GJLA 3SGUA 5FEZA 5BRBA 2DP3A 4MY8A 3H54A 3PWAA
chains in the Genus database with same CATH superfamily
2Y7GA 5I3KA 3ERPA 5HDRA 3M7SA 2WVVB 3B04A 1EYEA 2EEXA 3VIFA 3ID7A 3V5OA 1A5MC 4E4FA 3RNDA 4M8UA 3VX1A 1TB3A 1H49A 4DZAA 1UW9A 3BCFA 5CBIA 4JIEA 3P8IA 4B5UA 4IF2A 3OBEA 4XZIA 1F2JA 3NQ6A 1J0HA 1HJXA 2OX1A 4JN6A 4XBJA 3MWCA 4LYRA 4WZHA 3CC1A 1O60A 4YN5A 5I24A 4UZUA 4HU8A 3SADA 3B0UX 3EZ4A 3L7RA 4V27A 2OO0A 5E5CA 1IXOA 3FSUA 3KZPA 4MUZA 4WDTA 4JTJA 1JCXA 1FP9A 2EPHA 4CVWA 4JQ4A 3IPWA 3KHDA 3WF0A 2WZIA 4I5XA 1ZQ5A 4DJED 2DIEA 2VWTA 4FLSA 3VZYA 4NYYA 5AZ1A 5F4XA 1AQMA 1KLZA 2AL1A 3NVTA 4DZHA 4P8VA 3LN3A 4GX8A 4O54A 3CLMA 5BXTA 4M82A 1XLCA 2QCFA 5EMJA 1QPRA 2NLIA 3R94A 1H1ZA 3L0NA 1D7KA 3R8HA 1GVYA 3L66A 3UVIA 4CD4A 3PULA 3UZ5A 1PV8A 1HX0A 1R3YA 2VEMA 2ZFAA 5DFAA 1IGWA 3AS1A 4M5PA 3H21A 5DY2A 5CZJA 3VA8A 1BLIA 4O8RA 5XINA 2A3CA 4A6GA 2GGEA 1XRSA 2NT1A 1MYRA 3QR0A 5ABHA 1M3UA 2OELA 5H8PA 3O05A 1HL8A 1JAEA 1EXPA 3RITA 4D1IA 3IVSA 1JDDA 1K70A 4HOWA 5D2TA 4NG3A 4IIEA 1GVEA 1DQWA 3R0UA 4D8AA 1E1FA 4IP7A 3N2XA 1UKSA 6REQB 1Q6RA 3STEA 3W23A 1A53A 3U5UA 3MSGA 2XIIA 1CB2A 4K39A 2FJUB 3BSHA 2Y0FA 1BYDA 1K03A 2WO5A 3G3DA 4HSNA 2YCLB 2BLEA 3MMDA 1OT1A 3GNXA 1DV7A 3SIZA 1VBHA 5KITA 3UA4A 4GZEA 4FO4A 4HZ8A 5CGMA 3PS7A 3T7VA 3GFXA 2QULA 3NZQA 4RW5A 2CLIA 5C9RA 2ZRUA 3CV2A 2G4JA 4Q8PA 4MZYA 4DO4A 2GSJA 4XBKA 3TE9A 2R1PA 1Y8BA 2UY4A 3M0JA 3UXLA 1JGIA 4JCMA 1FCUA 3VOJA 3CHCA 1GQNA 3O16A 4LF1A 3VM5A 7REQB 3URQA 4XKYA 2FTWA 4I7VA 2D24A 1XGDA 1KBJA 1WKEA 1BG9A 4K1WA 4OT7A 4IJRA 1MFUA 2ZXBA 3B9OA 3EB2A 4AISA 3OP2A 1JXJA 1J0KA 1F3XA 3P7YA 4HJWA 1LQ2A 4JIQA 5GVJA 3OU8A 4HCDA 3SRFA 3FJ6A 4GUHA 2DT2A 3GO2A 1OIMA 3WF3A 1BG4A 3L4XA 4O53A 2QIIA 2BY0A 2RH9A 1F4AA 4O1DA 2J7DA 1MO0A 1V3LA 3BMXA 1NWSA 4C65A 5AC5A 4ZENA 1FUYA 4QQUA 3HURA 4L1WA 3AYTA 1XS2A 1HJQA 4V1XA 4I6KA 4ZOCA 5I03A 4Q32A 4J2PA 3WBAA 3OJGA 1LT7A 4M6UA 5F2MA 2E6YA 2OLSA 3WDQA 1OABA 1E6PA 5DT7A 3ARVA 1JI2A 4MDOA 1MZHA 1TIMA 3KE0A 5AC8A 4WD0A 2XISA 2Y5JA 1AZ2A 5U7SA 1NEYA 1V6TA 2ABBA 1G67A 1ZPTA 3PJUA 2G8ZA 3BC9A 5FKYA 2QCDA 4I90A 3CPUA 2JALA 3CGTA 5E9AA 5LIKX 3VNYA 1F3EA 2CBVA 5F2LA 4YL2A 1UIOA 3R8GA 2IXUA 3GTNA 1KTBA 5D9OA 3U3HA 4KGJA 2WNZA 3AMLA 1MW1A 4AZHA 1VKFA 1X96A 1US0A 1P7TB 5K4XA 2EF9A 1EP2A 4IHCA 4J9JA 1BWLA 4HPHA 3ARXA 2ZZ4A 3MY9A 2JGQA 5HMFA 1R9YA 3F2CA 1HW6A 4P7NA 1QCWA 2I57A 1F61A 1RJQA 3NZ1A 1X97A 3ITCA 1F3WA 4U2YA 4AAJA 3W37A 4GC3A 1Z9AA 1FWHC 1VFSA 1HKIA 1OF6A 3AICA 3NUKA 1CI1A 3WLMA 3NTYA 1OFRA 1VFTA 5PTDA 1ICSA 3VKCA 2W66A 1T0OA 3NL3A 4AZ6A 4TVCA 3SUSA 3KLLA 4DPQA 1ALDA 2MNRA 2W27A 4P7LA 2Y5SA 4NX0A 1DJXA 1ZB5A 3UXDA 1YKWA 4OHQA 4QXIA 1VFLA 2OKTA 1OIFA 3DYOA 4L4MA 4XSMA 4GWEA 1ZAHA 4PFHA 1U1UA 1H7NA 3TA6A 3RPMA 4AHPA 2OGYA 1D8WA 2PDJA 1JJKA 4O16A 1EQPA 4MTVA 2ZCGA 1SVDA 3STGA 4O28A 4PTMA 3HFYA 2XFYA 4XUGA 2NVAA 2FVLA 1XLFA 3EWZA 3REQB 1ZAIA 3DCPA 3TQVA 1GGOA 3FXGA 1TPVA 5LKYA 1VBJA 5DCBA 3NM1A 4W89A 2NVDA 1TV5A 4S2BA 3EWYA 4DZIA 4ICCX 4JGDA 4X2PA 5A2BA 3AU6A 4Z42C 3C2OA 1F73A 1TMLA 3OGRA 1PZ0A 3KUMA 2GL5A 4CNPA 3PJWA 3POCA 4C1LA 1H7XA 3MP4A 1RPKA 1TV3A 4GPNA 2XN0A 3G1VA 3QMSA 3QR1A 2BY1A 5HAOA 3GE7A 2QCMA 2ACUA 1P1MA 1VYPX 2ZOXA 4E5TA 1J8VA 3UT0A 4CCZA 4HA4A 1W3HA 2B4GA 5A6MA 3CIWA 1GCYA 4J5NA 3SN4A 3BAJA 3LCLA 3CZ8A 2A1YA 4MG4A 2G4FA 3W1MA 4ZL1A 4CD8A 3G1FA 5AY7A 4LEQA 2OEJA 4A8LA 2WZMA 1MUWA 5A2AA 1NTHA 3TV8A 3VCCA 3W88A 3QC0A 4ASTA 3UQNA 3W38A 3GXFA 3VCNA 3QZAA 2DW6A 3GD6A 3FAWA 1R8LA 5I00A 1KR1A 1SZRA 3B03A 3TIMA 1VEPA 4GIEA 4LVDA 3BLKA 5A8PA 2WJFA 1IEQA 4AIBA 1K7EA 2X2GA 2BXYA 3LLDA 1ZJBA 2PBGA 4REQA 1TUFA 3MA8A 2A6NA 2WJZA 3C0JA 2CBJA 3RYSA 1J0IA 3DGRA 3RPTA 2I9UA 2J24A 2EGZA 2CITA 5E70A 3GB6A 4J2MA 3MCOA 3WIJA 1O12A 2YL5A 4RE2A 2G41A 1EOMA 3C2EA 1MMFA 1BVNP 2DEPA 3KOFA 3UG4A 1SGJA 4W7WA 5EKYA 4GVGA 2P0OA 4TO8A 2HDJA 3WLNA 4Q8OA 1XIDA 3ZR6A 3T05A 1WUEA 1YW1A 2PP1A 3GDRA 1QO2A 2ICSA 3TSBA 4MIMA 3OIXA 1JPIA 3SCOA 3TAOA 1S46A 1VYRA 4NP7A 2YZRA 4JTCA 1QOPA 3KBJA 2BHZA 1PYFA 1JZ4A 3D5HA 3T9PA 3LENA 2V9DA 2GWNA 1H50A 3POHA 2J66A 4IH3A 1GUVA 4ZMGA 3A3XA 1IXQA 3MI6A 5FJPA 2VEKA 2VGBA 1TV2A 5E6ZA 3JZEA 1R30A 3MS8A 5CJNA 3DN5A 3WO8A 2HVNA 1ECQA 2PWFA 3TTQA 2C13A 5M2FX 4ZSUA 4MNLA 2AQOA 4C90A 2L5HA 4L4PA 3RG6A 4M51A 1SR9A 2Y8UA 3NGFA 1RD5A 4ZE4A 1R46A 3V0SA 5CXPA 3S2LA 3BDKA 3D0CA 2VENA 4EPDC 4AZBA 5JBDA 3K4WA 3M44A 4ZOAA 3ZWSA 2YPIA 4GVHA 2ZIDA 2VJXA 3MANA 4Q6JA 3ZT5A 3ES8A 4L64A 9CGTA 1OG0A 2W62A 5D05A 3LI1A 4FZIA 2I7GA 4ZBCA 3MUY1 3M0IA 3M9YA 4GINA 3QV9A 1X98A 4J7RA 2DSZA 1W31A 5I2UA 5M03A 1HKWA 1MRAA 3HPZA 3CL6A 2QVNA 3APYA 4I9MA 3LRKA 4IZGA 2DIJA 1XLDA 5DX7A 4WHBA 4ZCWA 1L6WA 1MW2A 4QBXA 4IQDA 2QCNA 2A7RA 1TPDA 2WB5A 4H3DA 3LCGA 4XUYA 3LHZA 2OSYA 1A5AA 2DORA 3E2QA 3EDFA 3W7RA 1EC8A 1KXTA 4JFSA 4QEHA 5CSSA 1ZSXA 1E1CB 3LEPA 3ABRA 4LYQA 4JNMA 3ARSA 3M5YA 1VFOA 4W85A 3URNA 1A5NC 4WKAA 1UWAA 1ZZMA 4CN6A 1GVQA 1PTAA 1Z48A 4AB4A 5EPDA 4HKPA 2P10A 5FEXA 1IZJA 3B9AA 3VZZA 3W1NA 4CN4A 2QGYA 4P7RA 4OOUA 3H22A 4LX4A 3MBDA 4Q8QA 3WSUA 3SCWA 3JUGA 4AD5A 3EBVA 3QF0A 2RJGA 3CHEA 3ALGA 1W1ZA 1H7OA 1P5BA 3WN6A 4WUIA 4R53A 4KWWA 2PTZA 5FL1A 1EB3A 4GO8A 3QFEA 5CZTA 3LZ3A 3FJLA 4PEKA 3FJNA 1IHIA 3QRHA 2PU0A 2F6UA 3GQYA 3MTWA 1WZAA 4CU7A 4GI6A 1OC5A 3VKJA 4TVDA 3W7IA 2W63A 3N2BA 3LHYA 2QEZA 3LPGA 2TYSA 4NKCA 1RJRA 5CJMA 2PTXA 3O6AA 4R27A 3B3DA 1JFXA 4KFNA 4XVEA 5IXEA 5AN7A 2VFEA 1VYSX 3DFHA 3ZVHA 4WEVX 4WRHA 3VGFA 1H7RA 3GW0A 1F9CA 3C52A 4JL2A 4URIA 4MOZA 5MKGA 3CL7A 4AZ5A 2D2JA 2WZTA 3E49A 3GFZA 4W9TA 3ITTA 4WXYA 1AH4A 1W9BM 2YJQA 2FB2A 1V3IA 4HSOA 4BEUA 1ZU8A 1JDCA 5E6YA 4Z1AA 4QJ1A 4V33A 3WLIA 1VBGA 1V8EA 5ABFA 5J5RA 5D02A 3VDAA 3KP1A 1XYAA 3LRMA 1B3VA 4GGHA 4M0XA 5CPLA 3XISA 2VEGA 1RLDA 5LHEA 1GOQA 2VDIA 2MANA 4N0RA 4AIUA 3TWAA 2CLPA 3SZ8A 2NV9A 3TYZA 4GK8A 4UFIA 3IIVA 3CBWA 3B9DA 3RM9A 4OGZA 2ZX8A 4UNIA 5B7ZA 4JS3A 5BYWA 4ATLA 2BGSA 4J3UA 2DGAA 1W3KA 1YNPA 4FMVA 1FQ0A 1U1HA 2V68A 1E1EA 3CHFA 2EG7A 3WLRA 2G37A 1AFSA 2BVTA 4JDYA 3OYZA 1HFBA 1NIUA 3FHAA 5HNRA 2B31A 2IKHA 2E3ZA 3KOXA 1SU5A 4GGBA 2OSWA 3KL3A 3AU2A 3C2YA 1L6GA 1UJPA 2IUZA 4GZ7A 3WDPP 5ABTA 1SO4A 2VC7A 2E09A 2HTMA 1JF6A 2VMFA 2CLKA 3GHUA 1Q6QA 3T44A 3GH7A 4RK8A 3NPXA 4RZ5A 1I45A 3AHYA 1JYWA 2Z6JA 3TN3A 4AZCB 4Q4PA 2JKEA 2Q8ZA 2Z25A 1PKYA 1T41A 1JZ8A 4TMCA 1S39A 3M0LA 3HG3A 1R6WA 5DF0A 2Z0IA 4R3UA 3ZFHA 3DC8A 1HL2A 4U33A 2JGYA 2FPTA 2NXIA 3R1ZA 3AWNA 7TIMA 3ATZA 3KOZA 1CLKA 2Z1BA 3WF2A 2PTYA 2PMQA 1Z69A 3WLPA 5JUVA 1ONEA 4B16A 4YLWA 3AIVA 3RAOA 4DVOA 3HN3A 1VB9A 4BEQA 2ZRVA 1CXIA 1F6YA 1LOSA 1F6KA 1KXQA 1KRCC 3WK0A 3I6RA 2HK0A 4UTWC 3KRBA 4J3XA 3WUEA 5JXQA 1KWGA 5H8MA 2JKAA 3S5SA 4F9DA 4C6PA 1PHWA 3KTXA 3SSJA 4FSAA 3MV11 3DOPA 2F61A 5IHSA 3OO2A 3W1QA 3GYCA 3UG5A 2PWUA 2FMNA 2HVOA 3QJAA 2J79A 4CGTA 3UR8A 3LRLA 2QCHA 3KVLA 4YS1A 3N9SA 5HWMA 3ZS4A 3RU6A 2ZX5A 4QAWA 2PWHA 3I65A 1IWPA 5EY5A 3TU9A 1WNOA 4Y8FA 4AMCA 4AWSA 4XB3A 3VXGA 3WYZA 4NY2A 4KEZA 2V69A 3V35A 1M6JA 2O4QA 3U8GA 4E2BA 1A3XA 1TCDA 1V6WA 2QDDA 1K77A 2BTMA 4W7VA 1T6MA 1F74A 3SY5A 1KGXA 3T0BA 3VILA 1QI0A 3TNBA 5EFFA 3W73A 1DJNA 1NAL1 2QQ6A 4RXGA 2XVPA 5DT5A 1A0CA 4JKMA 1JNDA 1TV4A 4MKVA 3F4NA 5BMXA 5DXXA 2A85A 3PFRA 3VKAA 3CIVA 2FDSA 3WEOA 3PTMA 3R89A 3AZRA 4ZTYA 2C15A 4PR4A 5LA2A 1WP6A 1B2YA 1H51A 4HK5A 2QDGA 2X0SA 4LPCA 4FI4A 1TRDA 3SB0A 2D2OA 2YL9A 5A8OA 1EWDA 4PL2A 1W3IA 3SFKA 4DWSC 4N9DA 1SUXA 2NUXA 2PCEA 5DN1A 2CXGA 3M07A 1AJ0A 2CLFA 4DF2A 4NI8A 3MSDA 4GJ1A 3UP8A 2B7OA 2FHCA 3H2CA 3OYXA 4C6LA 3LU2A 4JTGA 3WDIA 1VCFA 5JBFA 3MBFA 1DE6A 3VGBA 4BQ3A 3URBA 3M1ZA 3ORWA 3FK4A 2RFGA 3MUAA 1SM9A 5A8NA 2VFDA 3CO4A 2EG6A 4AQLA 3FHQA 1ADSA 4KFPA 3N14A 2DZUA 4HK7A 2ODOA 1OFAA 3EGJA 1KM2A 4QG9A 4GQQA 1NQ6A 1AMYA 4IFRA 4HMEA 3NDZA 3VNLA 4GVIA 3BAKA 1UB3A 2YYUA 3VIPA 4B92A 5CAKA 4PUNA 3IARA 3WLLA 5HJXA 1PE1A 3PG9A 3E6EA 1OX4A 2I5GA 4LY8A 3VOIA 1E40A 3GHRA 3TTSA 5LNSA 4DIAA 4ZEPA 3NEVA 3N11A 5DELA 1B4KA 3CH9A 3TOPA 1DJZA 5CQ1A 4ES4A 3KAOA 3LTPA 3FLUA 2WVVA 1WDQA 4FOJA 1ISYA 2X7VA 5G1TA 2PA6A 4G1NA 4DNHA 2B81A 5FJOA 2VWSA 3WK1A 3AMKA 2WCSA 3EPNA 3P5ZA 3M0ZA 2G3JA 4MMWA 3NA8A 3KOYA 1UR2A 1KGUA 1GJUA 1R3WA 3R25A 3OG2A 1G1YA 1TWWA 3G1HA 1CXLA 5L9FA 1BQCA 1KFBA 3CWHA 3VNMA 1YQ2A 3W76A 4UFHA 1CZ1A 3FA4A 1UOZA 2VZVA 2BY3A 3H70A 3A6OA 4WJEA 1N8WA 3VKKA 4LANA 3T4CA 2AL2B 1W17A 1VRDA 2VFFA 2YKKA 3BPWA 5REQB 3TJLA 3UXAA 2KAUC 4X9SA 3SRDA 4NAEB 3SBFA 4CEUC 3H55A 3ZM8A 3E2VA 1V6UA 3ANVA 2NUWA 1KCKA 1VJSA 5LIWX 1LT8A 4Y8EA 5FF7A 3WEMA 5I3DA 1X8FA 5I06A 2ZE0A 1K9DA 4JTAA 2PC4A 1FWCC 4JTIA 2P88A 1I1XA 2ZE3A 3A9IA 3OHMB 3QQWA 4H8VA 2DQWA 1LYXA 4H7VA 1KFCA 3G1RA 1NP0A 3W85A 1RA0A 1S2AA 2VVSA 1C7SA 3SN0A 1UUOA 4O11A 3KXQA 5IDIA 4HQVA 1H0IA 3GXMA 2A3AA 2PDNA 3W2LA 3GC4A 5BOFA 3O8AA 4GQGA 3GTFA 2B0MA 4DJDA 2J7FA 1LRQA 1O1ZA 1KM3A 1EX5A 2GVLA 4Q8NA 3O06A 4EPBC 1T7LA 2LLEA 2HK1A 3EDDA 4JQ1A 1IZCA 1OWQA 2VZOA 1DEDA 1CGXA 4TX9A 3W7JA 2CLHA 4NT0A 3S9IA 1ZALA 6REQA 1VS1A 3TZNA 2B7PA 1B3OA 3IJQA 5CKSA 1ITCA 1J93A 3DG7A 4K7VA 2BMBA 3MMWA 1R7AA 4H4IA 1FWBC 5IHRA 1JPHA 3VX0A 5FJIA 3HGSA 4F3HA 3UCCA 1BKSA 2KZHA 2WMHA 4FNUA 4Z2KA 4Z0SA 3W1AA 5GQBA 2Z2UA 1I8JA 5CC3A 1J2WA 5DMMA 3O6DA 2YCLA 1WPCA 4JTEA 5HUOA 4KCVA 1WKYA 2YBVA 4B5TA 4AF0B 2G97A 4OU1A 1EBGA 3W9ZA 2J9XA 3W6YA 2VOTA 4PGLA 1C92A 1MDRA 1BF2A 5K2ZA 3VOFA 3QW3A 4Y9MA 4XD4A 2X09A 4C6EA 4C7GA 4PUWA 5DY3A 1O7AA 3IJIA 4MWAB 2Y70A 2TSYA 2OMAA 2VDHA 3OA5A 3ARQA 3QLLA 3EWUA 2XSAA 1A3HA 1ZTVA 2QCCA 3NSXA 4A05A 3WH5A 3NO5A 2Z00A 4HMNA 2RHGA 3PUDA 3MKKA 1RH9A 4TOQA 1EGVA 7REQA 4KIEA 1MQPA 3KVMA 1EJUC 4ZO7A 3WQ6A 3Q67A 2ZUNA 2VX4A 1U2YA 1CXHA 3QMRA 5FEPA 4M6QA 1QU4A 2FVKA 4Y90A 3BMVA 5EA9A 4K8EA 2VUYA 1K8YA 2R91A 1TE1A 4OQVA 3M6YA 1JG9A 1AJ2A 1S5NA 4QE5A 1L8PA 4YTRA 2RJHA 3ITLA 1ZRQA 3MMUA 1TZZA 3QZ6A 4UFJA 1ZFJA 4W84A 3WF4A 4F2TA 3EOEA 3CS2A 3QGVA 2YW4A 3P0WA 3W1XA 4L9YA 3W26A 4XWUA 4AIOA 3O6YX 3AIUA 3O0KA 3N4FA 4JIPA 2AQWA 1G9HA 8CGTA 3GNNA 3FV9A 5TF0A 1FH7A 1GG1A 4DM2A 3FX4A 2YR1A 5JIWA 3WUBA 2E1DA 4XV0A 4EK7A 1OY0A 5M5DA 3WH7A 4S23A 3HGRA 4IXHA 5FJJA 3BANA 1NWTA 4RZ4A 4D6DA 5XIMA 3RX3A 1NF0A 2BFGA 2VFIA 1YRRA 2GFTA 3MV01 2QXWA 3QYSA 3VOCA 2C19A 3WELA 5E1QA 3ZR5A 5H2ZA 1CW2A 2PURA 3NQAA 4C6MA 3VNIA 3OODA 1MEHA 4IMCA 4DO7A 2EG8A 4W8AA 2QW5A 4N9BA 5C0QA 1P7TA 1EUAA 3IIPA 3RR1A 3LM3A 1TQXA 1EJ7L 1VJZA 4LQ1A 4NQ1A 5K9XA 5CLTA 3CQJA 1W9XA 1A5SA 1M9HA 3N9KA 4QJ5B 1I0DA 4D8LA 1IWBA 3QPEA 2GUBA 5I7GA 4V1YA 4Q8UA 4C6FA 3JU2A 4ADTA 1R3VA 7XIMA 1IR2A 3G0UA 2VX7A 3VGHA 1V93A 2O4MA 4EANA 3A4JA 3CH0A 1UH3A 3GX9A 3ZLGA 2CKSA 3ARTA 1VENA 3ZJ7A 4JOMA 4NZJA 4ROQA 4CQDA 1R5YA 1GYLA 3DFNA 2YCJA 4B5WA 1IIHA 4PB3A 3DFPA 1ZUAX 2ZZ6A 3NFUA 2PDBA 4CD6A 5ENLA 5BCAA 1CNVA 4HA1A 3ENLA 1K3UA 1DJHA 2ZDSA 3OLDA 1LUCB 2I5IA 3REQA 3UPMA 3RX2A 4PMNA 4DX3A 4DJDD 3OBAA 3M16A 4JTSA 1E4LA 2EKCA 4RE4A 4ZODA 1XD0A 4RNIA 2E28A 1QASA 5JQ9A 4ICNA 1TVPA 1GKPA 3WFLA 2DZSA 4S3GA 4ERIA 3LHVA 1D8CA 3W2MA 3ZYZA 7A3HA 4FLQA 4OOZA 2DT0A 4QP0A 3QY6A 3N9RA 5G4HC 4O15A 2HEJA 4O14A 5FAGA 3VD5A 1MQRA 2DU2A 1E71M 3OQ8A 1I60A 1UD8A 3FYPA 3EPMA 1SMAA 2XWDA 4JTDA 1W9DM 5C54A 5I5RA 4ZSTA 3W7QA 3TN5A 4L1GA 4BF7A 5CPSA 2GJPA 3SGUA 5BRBA 5CC6A 2Y2WA 4MY8A 3H54A 1VEOA 4PULA 1ZBKA 3KLKA 1W5MA 3RU8X 1TMHA 2OU4A 4ZGYA 4DEFA 1IXNA 4N2YA 1VFMA 4XD6A 4YTTA 1HTIA 4EAMA 2Y85A 3NQ7A 4C6CA 3CTTA 2GDVA 2ZADA 3TCEA 3UZYA 4ZO9A 4KEMA 3AYSA 3TQKA 4GFIA 4C7FA 3S1WA 4S38A 3WJWA 4MJ4A 2G5WA 2QCEA 4JDBA 5BROA 2VT0A 3UJ2A 1FWDC 4Y9PA 2WHMA 1WZMA 2INEA 2GGJA 2HSAA 2YL8A 3LPOA 5FF2A 1ADDA 3ZSSA 1IR1A 5HMSA 5G2IA 2UZ9A 1UD5A 2FZDA 4FXSA 3HV8A 3F03K 4JN8A 1XIHA 3CK5A 2FGZA 3WQFA 3KWSA 2Y8VA 5I6SA 3AJ7A 1V0NA 3THDA 3B0YA 1UC4A 1QNVA 2UWFA 1K8ZA 2BZNA 5E0CA 1SJBA 1ZHAA 2YOCA 1XYMA 3ZQ9A 1XH1A 2P50A 4PMZA 4L80A 1BFNA 1YNYA 1OBAA 4QCEA 4UCFA 3GVGA 3NOYA 1MSSA 3LS9A 2QS8A 3DI0A 2CXEA 4LJ3A 4KESA 4JXCA 1XLEA 4FR1A 1BXBA 4QG8A 3CAVA 5A6JA 4RJEA 2PDQA 4BI6A 1VFHA 2VVNA 3AWOA 4JCLA 4B15A 2QF8A 1KLYA 1UP0A 3VGEA 1PPIA 2ISWA 3JW7A 1XIMA 2QCGA 4GI9A 1DIEA 3U7VA 4IWWA 1XQLA 1LLZA 4B90A 4L6HA 1UZHA 3WQ8A 2GQ9A 3H24A 3D46A 3PZVA 2V5KA 2J13A 2QJHA 5FF4A 4GZJA 1E4MM 1TREA 1B1YA 2XIBA 4GXPA 3S46A 2J75A 4G8TA 2J8TA 2HCVA 1FWSA 2WM0A 3L4UA 4ERGA 1HVXA 4D72A 1XLJA 2V38A 4A35A 1UZ1A 2V2CA 1JUEA 4C91A 2D69A 3CUIA 4TV5A 4D6HA 1IE7C 3AXHA 5MHBA 3D3FA 3W6LA 1BGAA 2BX7A 2OYMA 3G0XA 5HA7A 3TOYA 1QI2A 4DWSA 3U9IA 1UKTA 3G1SA 1ZBVA 4JBRA 1OD8A 1NOWA 1QJWA 4Q4OA 3PM6A 4K37A 1LWIA 1GOOA 1FWIC 1UWIA 3F4CA 4C6KA 1FCVA 4IOTA 1Z3NA 4UQCA 4R33A 3GTHA 3ITGA 3NG3A 4QLLA 2ACRA 2WKJA 1IT7A 3KW3A 3T1GA 3LA4A 4RZ6A 1S2WA 1G4EA 2NQ9A 3N1AA 1MDLA 4DUXA 3PB2A 1PSCA 3M0MA 2WZEA 3BJFA 3HGJA 3F1QA 4FF7A 2P8BA 4OV4A 4QEEA 3B9EA 2PZ0A 3GAKA 3V1PA 3GXTA 4LOCA 2FPYA 1XLAA 4CUCA 3NPWA 3W7KA 4EACA 1OGSA 4MLRA 1E1CA 3HIJA 3SCSA 4UC5A 1WAWA 1HKKA 3RDKA 1JDFA 1NVMA 4M81A 4XQ6A 4RPPA 1RQHA 4JY8A 4H1ZA 4ZQCA 3DFTA 2Y24A 4XK2A 5A69A 1KBKA 5GNXA 4GCAA 5K9CA 1CYGA 3EDKA 4FEZA 3UWVA 1P1XA 3CYVA 1HNYA 4HNVA 1XI3A 4Y6GA 3M0YA 4Q6XA 1WKFA 1ZJAA 4BWLC 1CXFA 1I0BA 4GQ0A 3QVQA 1O5XA 2BOGX 4PZVA 3AZSA 4PODA 1JCJA 2Y7DA 4JTRA 4E8DA 5G4WA 3OEXA 3VAVA 4WSJA 3A5VA 3AIWA 3U2OA 5JBEA 3EA3A 1Y7VA 4IXXA 1I6NA 2ZUVA 3GSMA 4CKQA 2O92A 2AAMA 3NXFA 4YYCA 1PKMA 3ICJA 3W86A 3P60A 2ZQ0A 3P0XA 3TNOA 4KEUA 3SUUA 3UESA 3TH6A 2XU2A 4IL0A 1MXDA 1XJBA 3S9YA 1QATA 2RGMA 4FXRA 4QIUA 1BKHA 2V3GA 1E51A 4WJXA 3KDOA 1EH9A 2YBUA 1I9CB 4UMBA 3M5ZA 3W4RA 4YHEA 1FWRA 4JPGA 4L6DA 3V75A 2PWVA 2OZTA 1R9XA 2GYIA 4XTIA 3C2VA 5KZDA 3ARWA 2AMGA 2V63A 2OB3A 1OG6A 2Q6ZA 2VQTA 4L4LA 3LCXA 2ZZ3A 1RV8A 4YHGA 4W8LA 3WMSA 4G2DA 1NP2A 3EKZA 1S5WA 2C79A 4HCLA 2O7SA 2CKRA 4AX6A 3II1A 2PGEA 3FA3A 4IP4A 3GHTA 1HXJA 1GZGA 4LS1A 3N34A 3UNDA 1V77A 3QQ0A 4IG2B 3WLJA 5A6AA 3LXCA 3VDHA 1FBAA 1P48A 1ZS2A 2HZGA 1EXBA 5HXMA 5DBTA 3DERA 5BXSA 1N55A 1M1BA 2CYGA 3UZZA 3LLXA 3TYAA 4MB3A 1RJPA 4RE0A 2QGHA 2TPSA 1RBOB 2ZVRA 5CPMA 7TAAA 1J9YA 3IANA 4BF9A 2OR2A 2AMXA 4FNQA 4BS0A 1TO3A 3A4AA 2OPJA 4ZO6A 2OWXA 3QOKA 1TE6A 1OCQA 3LY0A 1V02E 1KCXA 2Q71A 1XYBA 4YVVA 3WLSA 2X1TA 2O0TA 2PLJA 4KFOA 3AHTA 3LSCA 1Q7MA 5M1TA 2VZTA 4MKNA 2HNEA 4JQAA 5IBXC 1ONRA 3M7WA 5F1UA 1SW7A 2Y5EA 4L65A 2NVCA 5BRPA 4GY7A 1UC5A 4H9MA 3Q45A 1RCOB 2WKLA 3CU2A 1UYQA 3UPWA 1KNWA 4AZCA 2J8GA 3W7DA 4U4MA 1TYGA 2ZX9A 1Z89A 1JQXA 4UR7A 4ERAA 4UTTC 5FF0A 1SO5A 4ADUA 3NZGA 4WLCA 3DX5A 1PBGA 2YXXA 3HFTA 4Q4RA 3W7EA 1ICQA 1XW8A 3SM0A 3CYJA 4DWSD 2A7PA 3L5AA 3WK2A 1W0MA 4FALA 5BZAA 1BVWA 1WZKA 3SQMA 2DZPA 4M80A 4JKKA 3BE7A 3KBSA 4HZ6A 2F8QA 3W1LA 2PUZA 3BSGA 4H2CA 4MY9A 4P8UA 4RZBA 1HGYA 1SW0A 4EXQA 4DJFA 3RCMA 1I2PA 1SQ7A 3PTKA 2D0FA 3UPBA 3VVGA 4MGGA 4YCOA 1MWOA 5LNUA 1N8IA 3VCRA 2GWGA 1XYLA 1DWJM 5G5IA 3ZR4A 1KM1A 2WWDA 3KM8A 4XD5A 5HQMA 3TMQA 2A3EA 1K1DA 1FCBA 3R2GA 3LG3A 3L4VA 3TN4A 2Z7GA 4NHVA 3C3UA 1OGGA 5C5YA 3MCMA 1YDVA 5A1AA 4FIRA 2V30A 3R6IA 2PDYA 4B9YA 2DUZA 3W2UA 3SR7A 3T40A 3ARZA 2NX9A 3A21A 2CLLA 3W1RA 4L5ZA 3B4YA 1XP3A 2V3DA 3CUXA 3Q37A 3TCSA 4HA3A 1EHAA 3VC5A 1B9BA 1KFEA 5FSDC 1M53A 2GDUA 3V1HA 4AEFA 3PBVA 5CCZA 1LQAA 3AXKA 3V3WA 1H09A 5KZMA 2ZZ2A 3L4TA 5EYWA 1X6UA 1NOFA 2F9RA 4KEVA 4HNOA 3N3MA 3WQCA 3HG2A 4JAWA 4XKMA 4CVUA 3BZGA 3CQKA 1HP4A 4D6EA 3VUPA 4Y96A 3UCDA 3V16A 3NQFA 4ENLA 3PZIA 4M29A 3NR0A 1F8MA 3FA5A 3U7BA 4Q4MA 1HGWA 3W70A 1EDTA 3NQ8A 2ISDA 3UU0A 2Z28A 5A95A 5GNYA 3OZOA 4J3VA 4AXKA 4FHAA 5D32A 4GLEA 4Y9NA 4F0RA 2A21A 4DUWA 4EWND 3AS0A 1UOKA 4DELA 1ZLPA 4I8YA 3SN1A 3UVAA 2QAFA 2A6LA 4D8ZA 2HXUA 3SJ3A 4TIMA 2ZA1A 4DN1A 2Y61A 3K13A 3M4HA 1B57A 4NAFB 2E40A 5G2WA 1C3FA 1LBFA 3CO8A 1ITUA 1PTGA 3W7OA 3IVUA 3AOFA 3LK6A 4X9YA 3RFAA 3UZXA 1UR1A 4WOQA 2XZ9A 5TIMA 3OGSA 2VZSA 4XZNX 1D2KA 4IFOA 3WUFA 1KM5A 1N7KA 3TK7A 1TSIA 2DT1A 3T6CA 3W87A 3VNJA 3TW6A 1AG1O 3TROA 1UQYA 3SCVA 2Q8LA 1VPYA 1JD7A 4HMDA 4OBTA 3T8LA 1S5VA 3TQ0A 3H2OA 3B8IA 1Z8AA 1EJTC 2V81A 4IUOA 4BY3A 2WC3A 4B4FA 1VZWA 4IMFA 1EIXA 2V82A 2XGBA 1W5OA 4H9ZA 3GR7A 1SJAA 5I3JA 1E15A 3VD4A 4AWUA 4A3RA 4O52A 1RBAA 4JTUA 2VFGA 4ATDA 1E3XA 3CLWA 1TRIA 3HG4A 4BI5A 1Z44A 2FPVA 3OVRA 4W7UA 1TUXA 3VGDA 1JCNA 1JULA 1I75A 4J1OA 2B7QA 1JPDX 2AL2A 4MPKA 3V7PA 3PNUA 3SUVA 5REQA 5HWNA 2XSBA 3UCQA 1OCNA 4NAEA 4WOZA 4QSHA 1GQIA 3NXLA 2PP3A 1XRTA 4M1BA 2R24A 2CLEA 1GZ1A 1UR3M 3F5LA 3KFTA 1EA9C 4UOQA 1A0EA 3PFMA 3EX3A 4LTSA 3T0AA 3CZLA 4JQ2A 5HATA 1KTNA 4UTHA 1DPMA 3ITOA 1SO6A 3W84A 1LRTA 5D04C 5IRPA 4DBUA 2X0YA 2FTYA 5EGRA 1BF6A 2VGFA 3LPFA 2WSYA 3C0LA 3HPXA 1VGAA 3D3AA 3DEQA 3DG3A 4XO6A 2E6DA 3GBEA 3R0DA 3GUWA 2E68A 4DJFD 4AY1A 1E72M 4FX7A 2PS2A 3KBVA 4WGHA 4HNLA 3NIYA 3ANYA 5D8WA 2IPFA 3N25A 3QV6A 3YPIA 3GZ3A 4O1CA 1Q6CA 2ZVIA 1Q2SA 1XRFA 4I3GA 1EJWC 2G96A 2ZRYA 5D03A 3W72A 1RP9A 2ZWYA 1V0KA 3FVDA 4RR4A 2H90A 4ZXOA 3L21A 3MWAA 1W1TA 1PKLA 5FEWA 1OINA 2CBUA 2W3ZA 4JNYA 1T8QA 4NRSA 3QZEA 5A8MA 3WMLA 2OO6A 5AHMA 4QE4A 1YPFA 4NZ1A 4NZ3A 3LBCA 2P0IA 3N3TA 5FL0A 1F76A 3WBYA 4EX4A 3DAQA 1UH2A 3KS5A 2ADAA 1FX6A 1NY1A 1F3TA 1YTEA 4AF0A 1YTDA 3QGKC 1W8SA 4NJGA 4WDWA 3WLHA 3BCDA 3WD0A 1XLKA 4D6JA 4JX4A 2ZTJA 2BGNE 2VX6A 2XFRA 3TW9A 3W82A 2DVUA 4ZQMA 4ZVJA 2Z6IA 1EHNA 4XAPA 2D2GA 1V3MA 3DH7A 3CTLA 3L23A 4MWAA 3MI3A 4XAGA 4PMXA 4QDPA 4IJBA 1JCTA 5J04A 2BY2A 3PAJA 1EJSC 4PMRA 1JYVA 1JPKA 5BW6A 3PSVA 3U4FA 2E5CA 3GIQA 5KSWA 1H0GA 3V5FA 4GMEA 4OFCA 3DC0A 4FOUA 3H4GA 3PZGA 3CZKA 4UOJA 2P5NA 3HPFA 3DFOA 3I7RA 1US2A 1FY6A 2FZ8A 3IUIA 1JZ6A 1O95A 3WJSA 4JX5A 3B4UA 2NWSA 1XDJA 3OG3A 4U2ZA 3WF1A 4Q8WA 2W91A 1P6WA 3ABZA 3VE7A 4DI9A 3GFYA 1QNOA 1B54A 4AD2A 4XD3A 4HYWA 3H7RA 3IJ8A 4DWDA 5C70A 3KTSA 1UR0A 2WZHA 3MVTA 3N12A 3KVJA 4IGNA 3CZJA 1FDJA 5LIXX 3VIIA 1TKKA 5F2IA 4MAVA 1W5QA 3MSYA 3LQLA 1HO4A 5AYBA 1L9WA 1GVIA 1X1NA 2DZVA 3CEPA 4JZ5A 4WY0F 1ZBWA 1JXKA 4QDWA 4UTFA 3MUIA 1L2UA 3OLGA 4GYPC 4AXNA 4PUJA 1XR2A 3U2CA 4KBXA 3QPYA 2YDRA 4H83A 3GG1A 3GVQA 4MJMA 1KB3A 2HQAA 1NFBA 1YDNA 3BAXA 2C7FA 3DYMA 4JR5A 1H2JA 1RSCA 3L9CA 3N29A 3O2LA 2X16A 2ZUUA 3UWEA 1R2RA 4B9ZA 4LRTA 4P5UA 3WZ0E 2FVMA 1WDDA 4AHQA 2Y7FA 4FLRA 3GU9A 4R7JA 4FX6M 4JHMA 4PYSA 1FWJC 3MYPA 1E4NA 4K36A 3KBNA 1AJZA 2UBPC 1IT0A 2A5HA 2PBOA 3EMZA 4Q7NA 1UA7A 2VTFA 3DFSA 3N17A 3HU7A 4CLMA 4CNSA 1OK4A 1DXFA 1DBTA 1E70M 4H01A 2VRQA 4LUTB 1W3JA 3E0WA 3TEVA 1KR0A 1XD1A 1PO9A 7CGTA 3LBMA 3QHMA 3OIHA 1C9WA 4A3HA 2J9YA 4ZR8A 1NF7A 1QT1A 5CLWA 5KINA 2TMDA 1D7FA 3KL0A 4ECLA 3TJ4A 4EXBA 2QNEA 2DSWA 2JK2A 3L2MA 1TIWA 1B3ZA 1M7XA 1DORA 3RJYA 4A8NA 5BU6A 2AKZA 3M0HA 3L0GA 3M64A 3T2QA 1TVLA 4F0SA 2A3BA 4NILA 3PTDA 2VCAA 5TNVA 3LV6A 1VHNA 2AKMA 2QKFA 2Z1VA 4KWVA 2ISFA 1YBQB 3WQOA 1SFTA 3CQ0A 4C6OA 2IKGA 4A8IA 1AZ1A 2PLMA 3ZLFA 5I3GA 5FI8A 2R1NA 3H53A 4CCEA 2H6RA 1LUCA 5LHFA 4TUFA 1J0JA 4LC6A 1IEIA 1UPPA 4NJIA 1B90A 1SMDA 4DO5A 4DBEA 1FXQA 3SCUA 5C2GA 1FHVA 4PEEA 2CHNA 1GQKA 1G4SA 1IWAA 3T81A 2FHFA 3SIMA 1PHQA 2ZUWA 2C91A 4Z2GA 4H7ZA 2PDHA 4HP5A 1XIIA 2VI0A 1W1YA 1WYIA 2WVSA 4TMBA 1ZP3A 4EP8C 5FACA 2WSKA 3C6CA 1BD0A 4YXGA 1TPFA 3R58A 2Y63A 1DVJA 1FWGC 3N18A 3PZQA 1Q3NA 1ECEA 1QR7A 2YLAA 3S8HA 2XM2A 2C1GA 2J78A 3V0UA 5AYIA 1U5HA 3OHIA 1PCKA 4GIRA 1Q6LA 3NSNA 3PZOA 5A2CA 3VFLA 2VEPA 4G7EB 3S1UA 4MWAD 4LBUA 2Z2BA 2HPIA 3BQ6A 3EA2A 1VF8A 5F4WA 4IM4A 2PC8A 2WNWA 3F4WA 4Q8MA 2BS9A 4XBSA 1P0BA 1W3LA 3UXIA 4DJEC 1XLMA 3EWDA 5I77A 1TPC1 3W7HA 4U10A 3MZNA 3L4ZA 1HF6A 5D4YA 1XC4A 3CM4A 4JD4A 1EGMA 3T78A 4WQ6A 4PMUA 5HUPA 1V3KA 2D0HA 3W1UA 4LVAA 1F5ZA 4M6VA 5D9PA 1TWDA 1KA9F 1C29A 1DE5A 1XIJA 4AEEA 2DZWA 4F79A 2J25A 3GVRA 2BODX 5TBOA 1QPNA 3ZIZA 4N42A 3GHSA 4AC1X 2EPLX 1A5CA 4LB4A 4DYKA 2G3NA 3VC6A 4S3CA 3AIEA 2D73A 1W3TA 4YTUA 1JUKA 2XG9A 3MHUA 3AYRA 3MSRA 2QAPA 1XYFA 2JFEX 4O18A 1XKYA 1ZBCA 2F2HA 1YLVA 4AG0A 1ISZA 2VR5A 4M6PA 4C1NB 3PP7A 2IMRA 1XRVA 4UQBA 4NZCA 4TQTA 2XH0A 2G95A 3RM4A 1UMLA 4LNYA 4LALA 1Q5MA 4MF4A 3TAKA 5FD0A 3TFCA 1GHRA 4K7YA 4Y2WA 3ABQA 4FR6A 3SRHA 3BURA 4YVXA 2XJ7A 2R6OA 2GSHA 2WHLA 2YX0A 3W28A 1CGTA 3FGCB 3TXVA 2BWGA 3R79A 3CQIA 2HJPA 3MHFA 2PLKA 4FIQA 3BZJA 1XFBA 4YJ5A 4AEOA 1OADA 3W71A 1LOQA 1GT8A 2FHBA 4YMZA 1QOXA 1E6RA 2W92A 3L12A 1E43A 4H00A 2GUUA 3E9AA 1EQCA 1WOBA 3UYCA 4IIGA 2FZBA 1P4CA 3VDGA 1BYAA 5AYZA 4Z1CA 3BLLA 2WVUA 2W79A 1EJRC 2FMOA 4I5RA 2FDMA 1RAKA 4KT2A 1W5PA 4PSPA 3BTNA 1R9ZA 2WPBA 2NQZA 2XDFA 3UZJA 1UR9A 3I68A 5C2XA 7ODCA 3RN6A 3SCPA 4BQ5A 3VYLA 1XSKA 3P82A 4ZTXA 3OLIA 4IIFA 5HPCA 3W6MA 3T4WA 2PDKA 3S0CA 5AHNA 4MFDA 4L4OA 5A6BA 3EKGA 4UNKA 3A24A 1LWHA 4AC7C 1R38A 2PDIA 2Y4SA 2PI6A 8XIMA 3BOLA 1U22A 3CUFA 3IIZA 4B2DA 3B8WA 4G56A 3GNRA 3WLQA 3GLCA 1DXIA 3A4WA 4HPJA 1V7YA 3TC3A 2BOFX 2OEKA 5KTLA 3U5YA 2R8WA 1T40A 1YPXA 4F66A 1AD1A 2VQUA 4WX2A 3QR3A 4FNTA 4LVBA 1LZOA 3GU1A 4O0QA 1B30A 1M03A 1O94A 3BLDA 1RZMA 3IGUA 2Y8KA 4MDPA 2CCRA 2ZYFA 1EPXA 3V4BA 1JYNA 1TTPA 2GVYA 4NL1A 2OFJA 4DNMA 2NSOA 3ARUA 4HTBA 3GDLA 5AC7A 1DWFM 3SJNA 2G3FA 3MJMA 2QLYA 4HD5A 3LTSA 3IGSA 3P81A 4C1KA 3F4DA 3NYZA 4QS6A 1DIOA 3CUGA 1TPUA 3NQBA 3H12A 3FKRA 1PX8A 2OGJA 4I5UA 1W2VA 4LV9A 2XWEA 3PUGA 1H60A 3CQHA 3D47A 1OCJA 3BAIA 1UR8A 4GZIA 3KCOA 1FFRA 4OZOA 3WQ4A 3VTRA 4GI4A 3WNOA 4IG2A 3T8QA 4B3KA 4GNKB 1EDQA 1M65A 4B3LA 4K1GA 2WCAA 3JRKA 5AECA 2WNQA 1C7TA 1FWWA 5CPQA 4QTGA 4JICA 4LUIA 4IPLA 4JYDA 3WUGA 2E8ZA 3KHJA 2GVJA 1FHDA 1UBPC 1Y5WA 4UTJA 4D1JA 2FGLA 2VC5A 1Q8AA 4FAMA 1RP8A 2PDWA 4ZA0A 1QHZA 3C2RA 2D0GA 1BXCA 3R13A 4P2VA 3F4VA 4AY8A 4DUOA 3MP3A 1TJ2A 4JYEA 2VRKA 1CGVA 4QDMA 4AZIA 2J7GA 3ATYA 3B05A 2BDQA 2Z4GA 3DBPA 1VP5A 1W9PA 4A4AA 3BUVA 4KCUA 4IPNB 4PCSA 1XGEA 2J6XA 3VK5A 5JIPA 4OE7A 1WE5A 3K1GA 1HG3A 1DWIM 4FX8A 1RQBA 5SWUA 4QJ3B 5L6UA 2XM1A 2ZZ7A 1OK6A 2DFAA 1TFVA 1AVAA 4NASA 5JMUA 3RLUA 3RX4A 1EZ2A 4O50A 3SUTA 1PWLA 4UMCA 4MNKA 3T55A 4PB5A 1DTNA 1YXDA 4ROPA 3EEGA 3HF3A 1EJXC 1Q6OA 2XINA 4AZGA 3MPGA 1ODUA 2OODA 4HJFA 3PWAA 2WMFA 1TG7A 1ISVA 3SGGA 4UTIA 3L67A 4PL1A 1YX1A 2JEQA 2A3HA 2DH2A 1W9UA 2ZDRA 3IJ7A 4UQEA 3LBOA 1AUSL 3BLPX 2OSXA 4OWGA 3JVAA 2XVGA 1FHUA 3Q58A 3WNMA 1F07A 3WNNA 4AD0A 5IFTA 5ABGA 1O66A 2ON3A 2NQHA 2A79A 3RR4A 2XTKA 5K7JA 2YYTA 3BG3A 2XN1A 2PDXA 4POCA 1XYCA 4YNGA 2CLOA 1GQLA 1GONA 1EJVC 2C6QA 4KIRA 5BWFA 3UR7A 1THFD 2R1MA 1RA5A 2F7FA 2V5CA 3W25A 1SZNA 3F5JA 1W9VA 4YU1A 4LC8A 1Q63A 3T07A 2V0TA 1E0WA 5A6BD 1V5XA 4GYPA 2OYKA 4JTHA 2GDQA 4GBDA 2E5DA 2BGQA 4GVFA 5IOBA 1JVNA 2CWXA 3M0XA 3B8VA 1H1NA 3FSTA 2J4GA 1XBZA 3K8KA 4B2DD 1JCMP 3VIOA 5FJTA 1O68A 3GG7A 4IQEA 3TTYA 4R9OA 2JKPA 3MI2A 1T96A 1WV2A 2NX1A 5JH1A 1JZ2A 3L68A 1A49A 1LRNA 1JI1A 2FB3A 4NRRA 1XSJA 1V0MA 3HJZA 5IM51 4BR1A 1A5UA 5D09A 3G1DA 3KL5A 1UUQA 2OXNA 3GYEA 4DWSB 4GG9A 1XWYA 1XCXA 4ZOEA 5AYXA 1VJIA 1POKA 4CU6A 1C8YA 3DDMA 5F1VA 4GUGA 3P2VA 3SY8A 1OYCA 2HMCA 4IISA 4P61A 2XSXA 3MZ2A 2QPUA 4BFAA 4ZZ9A 1PVNA 1U1JA 3NPVA 4WSHA 1SZFA 4HTYA 1BYBA 3N04A 4S3DA 2X2YA 2RKXA 2C14A 4L61A 1Y5XA 3ECQA 4LUSB 1MUCA 4WGXA 3EMQA 4I7WA 1J96A 4GYFA 2IPWA 4JTQA 4PCNA 4PCTA 3PZ9A 1D3GA 4H9XA 1QRQA 1UKPA 3BJSA 3KBWA 1E6SM 2BVYA 2RDTA 3URAA 3P5YA 3MKVA 1XQKA 4RV3A 2E25A 5U4NA 1IT8A 3AHXA 1K7FA 4N9EA 3WNKA 4V2XA 2PODA 3BAWA 1QWGA 2QPXA 2I16A 3MP5A 1H11A 2VURA 2XVLA 3DYPA 4GHRA 4IUGA 2R9RA 4NAFA 4KWUA 4XAYA 1MVYA 4O10A 5DMYA 1CGUA 1S2VA 1EC7A 2JEPA 1ZAJA 1KV8A 1GTEA 1TPH1 3A12A 5AHLA 4Z1YA 2ZRZA 5T26A 4LUJA 3WNLA 4JIRA 3E12A 1L6FA 4QHRA 3LB0A 3V18A 3AMDA 5FA5A 4K68A 3H2AA 1FWNA 3HQ1A 2AGTA 2JQXA 1X6LA 1YNQA 2XIJA 3HPSA 2VC9A 4G6CA 5DRIA 2D20A 1Z32X 1HZYA 1JIBA 2WWCA 1KRAC 1NFGA 4ORIA 4KERA 1CWYA 2VCCA 5D2WA 4EWJA 4HZMA 3I4KA 4O13A 1QO5A 4NI3A 3QQ1A 5KETA 1RK5A 3EAUA 3PPGA 3KS6A 4R34A 2OLAA 1FHLA 3EWWA 1BHGA 1HJUA 4QITA 2FIQA 3HJEA 3A4XA 4J4KA 1XH2A 3L4YA 4W5UA 4DF0A 2I14A 2QJMA 3PJTA 4F0KA 2QR6A 3RF9A 4NJKA 8XIAA 3O15A 3UY8A 3CUZA 2ESCA 1AQFA 1OFOA 2QHAA 2W67A 1QHOA 3TKFA 4BQ2A 1P0EA 2F84A 1JZ3A 4LAMA 2O56A 5CPNA 1HKMA 3L5MA 3GR8A 3IAQA 3R0KA 4P7QA 3RLHA 1LLOA 1J18A 3KVKA 1WDWA 1TVNA 4H19A 4TR9A 4O19A 3HQPA 1L0PA 4GH3A 4MY1A 4R9XA 3BMWA 1PX3A 2W61A 3W3OA 3WLKX 1HJSA 3P80A 4I9JA 4ZQRA 3WJXA 4F40A 5LGXA 1UQZA 1N82A 1IEWA 2V5DA 1JDEA 4F2UA 2X1IA 5C7VA 1VLIA 1BWKA 1EF2A 1RXOB 4ZFCA 2QJIA 3M47A 3QOMA 3SURA 2ANUA 2W9MA 1G0CA 4BCEA 2DZBA 4O0KA 1O4UA 3TTEA 3E2SA 3VKDA 4BF5A 1BVZA 1DJWA 3USZA 1R3QA 5CG7A 3RLVA 1V0LA 1Y0EA 4Q22A 2ZTKA 3THQA 1VHCA 3AS2A 2ZX6A 3MJYA 3SDOA 2H9AB 4YTSA 5KEZA 1KW1A 3G1YA 3W83A 1PL9A 1KD0A 1GORA 3A9BA 4K2SA 1KCZA 1YXYA 2F38A 2V6AA 5DCEA 3STFA 4AVOA 1G94A 2VM8A 3B06A 4HOZA 2J9ZA 4AWTA 1KKRA 1RQEA 3PANA 1V08A 1S2CA 5DMLA 5BNKA 4H6KA 2FFCA 4Z08A 2PU1A 1XC6A 2BV9A 3KCLA 5DRCA 3LPPA 5B80A 1J79A 2JIWA 4KH2A 4AHOA 5LZLA 3CB3A 2WXDM 1K9FA 1LDCA 1V3JA 3GVVA 4O1AA 4JN7A 2OLHA 4PFMA 1XPGA 4AYGA 5HOSA 1AH3A 4WY0B 1ZL1A 2ATMA 3VNZA 4YVPA 2ZZ5A 3TJIA 3VD3A 3N2OA 4OECA 2GQ3A 4RNJA 4FA3A 1CTNA 3FN9A 1OM0A 2ACQA 4GKTA 3SO7A 1WBHA 2QYGA 5I3FA 2W0UA 4WJ8A 3IWPA 3N19B 4YWIA 1TR9A 2D1ZA 2GUYA 4Q8VA 2V2DA 4IIBA 5I3IA 3UBPC 1E5NA 3KOWA 4NJJA 1XKJA 3I6TA 4NJHA 1GG0A 3QGAC 5CZKA 4CNNA 2BHYA 2FZ9A 3UJEA 4IP5A 1FWFC 1YDYA 1M41A 1X8CA 2PDPA 2QUNA 3PNZA 2OCZA 3KP0A 3AUOA 1HP5A 1NH6A 3GK0A 1J4EA 1R3TA 2PFHA 4BKNA 5EB8A 6XIMA 1OF8A 2R14A 3CMFA 4S2CA 5EFDA 2HXTA 4PBGA 1LROA 3VPLA 1KBBA 4FOKA 3ITXA 1S2UA 1NELA 2QDHA 3LGDA 1OX6A 2EJ1A 1KQYA 1M5WA 1M68A 3CXOA 4LCSA 2A0NA 4WKHA 3PZMA 3OQEA 5TAOA 3CHDA 3VNKA 2PD9A 3TYDA 4MHBA 4DUVA 3M0VA 4JY9A 1DP0A 3GDKA 4UFLA 5CBBA 2OG9A 2PRLA 4OBSA 1EF3A 5I3HA 1UWUA 2WLZA 1R86A 1NOUA 2OZ8A 4W4QA 3B8TA 1FH9A 1JDAA 3TSMA 3E5BA 5BWAA 4CQAA 4O0ZA 3LCIA 3GY1A 1A47A 4A3UA 4HN4A 4LUTA 1ME9A 3SSZA 4AVNA 1CX9A 3E02A 2ZXAA 2Q09A 1A5OC 3MUCA 1LL6A 1SPQA 1WX0A 4K6AA 1DL3A 4XO7A 3H7UA 1CXKA 4LT9A 1R47A 3EXSA 2DVXA 1VIZA 5HNUA 5HINA 3GWQA 2VNCA 4OTKA 4E4PA 2GGHA 2EBNA 5K3VA 1W1VA 5DMNA 1J10A 1EC9A 3TR9A 4LBRA 3AFBA 2PRHA 1YBQA 3M5XA 2PTDA 1GVFA 1YMYA 5J8LA 1EGZA 3HA1A 1XLGA 4ZB0A 4B3ZA 2PB1A 2CLMA 2DZXA 3GBDA 2D3NA 3VZXA 4NYUA 2VZUA 4W8BA 3SCTA 1I2NA 3T09A 2Z26A 2QJJA 3EYPA 1XINA 1VLWA 3LXAA 3NQGA 1YE6A 2FQIA 2OQYA 3OZMA 1GOMA 1XIFA 3DFYA 3I3BA 3EXTA 1QI3A 1PDYA 2C71A 2F6KA 5FF3A 1E0XA 5HQEA 3RM8A 3TLLA 3CT7A 1XH0A 4KKXA 4LAZA 3TW7A 2VHLA 4RPQA 1W3NA 3GH4A 2Z29A 4G7FA 3N6JA 3J7HA 3RGTA 1O1HA 2QUTA 3NL2A 1DJIA 3GAYA 2EPOA 1CDGA 1HKJA 3AS3A 4H9YA 1A3WA 2FH6A 3DI1A 3ZJ6A 4N7QA 1TX0A 5AHFA 4RDVA 1LBMA 1HL9A 4HZ7A 4M1RA 1W37A 6ALDA 5DLCA 4F8XA 1XISA 4X3ZA 1QXLA 4N4QA 3XIMA 3KRUA 2WBGA 1X7FA 3AROA 1H5VA 2NXHA 4MNJA 3GZAA 2PD5A 1XM3A 2DVTA 3RMJA 4KWSA 3HOJA 1DTUA 1VCGA 2NW0A 3W02A 1XFCA 2W4XA 3ANUA 3SI9A 5ABEA 1BXNA 3RRXA 1RVKA 4G7EA 4IMGA 3TDFA 4JFUA 3WFAA 4H9TA 3CT2A 2X8RA 3R10A 3TR2A 2GOKA 3LUTA 2OQHA 1J11A 1OGBA 2R1LA 4PB4A 1WAUA 3LOTA 5BMWA 3NDYA 1YHTA 3KZSA 3A22A 2A4AA 3K1DA 3W7CA 3NOEA 4LFYA 1HIZA 2O9TA 1XLBA 1SJCA 1CCWB 4PMYA 1MRQA 3MCNA 4MUPA 3I10A 1SJDA 2ISVA 4EXAA 3PZTA 1CB7B 1SW3A 1OC6A 5I78A 5CPOA 1NWRA 3G77A 1YEYA 2HNHA 3WKZA 2PEVA 3UNTA 4A21A 1KC7A 4FLOA 3VIKA 1PIFA 3R43A 1XIEA 3Q94A 4W87A 3WEZA 2Z7KA 4ZOBA 1JPMA