2XU2A

Crystal structure of the hypothetical protein pa4511 from pseudomonas aeruginosa
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
241
structure length
241
Chain Sequence
RILLNCDMGESFGAWRMGDDVHSMPLVDQANLACGFHAGDPLTMRRAVELAVRHGVSIGAHPAYPDLSGFGRRSLACSAEEVHAMVLYQIGALDAFCRSLGTQVAYVKPHGALYNDLVGDDELLRAVLDACAAYRKGLPLMVLALADNGRELELADEADVPLLFEAFADRAYLPDGRLAPRRLGGAVHHDPQRIIEQALAIARGEAFPDYDGNPLRLTADSLCVHGDNPQSLAVLRRLRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0271 PROTEIN PA4511
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Unknown function
total genus 86
structure length 241
sequence length 241
ec nomenclature ec 3.5.2.9: 5-oxoprolinase (ATP-hydrolyzing).
pdb deposition date 2010-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03746 LamB_YcsF LamB/YcsF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 2xu2A00
2J13A 4HD5A 1V6TA 4WCJA 2DFAA 4F9JA 2E67A 2NLYA 2QV5A 1Z7AA 2C1GA 1NY1A 4NYYA 4NZ4A 3CL8A 2VYOA 4F9DA 4NZ5A 2IW0A 4NZ3A 5BU6A 2W3ZA 2Y8UA 3HFTA 2C1IA 2C79A 2I5IA 2CC0A 4U10A 3RXZA 2XU2A 4OUIA 4V33A 3VUSA 4NYUA 1W1B1 1XW8A 3CL7A 4L1GA 4NZ1A 2C71A 5JMUA 4M1BA 3S6OA 1W17A 3CL6A 4LY4A 3WX7A 3QBUA 1W1A1 4NY2A
chains in the Genus database with same CATH superfamily
3GNRA 4X22A 3WLNA 2OQYA 5GQBA 1E56A 4RZ4A 3OOQA 4WQ6A 1UA7A 4BI5A 4AISA 4B5TA 4O1EA 1NAL1 2WM0A 3ISIX 1W9DM 1J5TA 4UTJA 1EWDA 3BXWA 3MPGA 3P80A 3P3BA 3V5FA 3ZLGA 4NJGA 1I2PA 3PJUA 3SB0A 3UWEA 1UC4A 1D3CA 1QXLA 1XRTA 4MNKA 2BASA 2X16A 3FSUA 1TJPA 2DJLA 1XLDA 2RHGA 4R9XA 1DTNA 4OU1A 1R38A 1H41A 3OA3A 3TQVA 2GOKA 2FB2A 3A22A 3KZPA 5HNNA 3CLWA 3W7RA 1THFD 5LHEA 5EMKA 3F5KA 1A0EA 3MI3A 3SY5A 4PULA 1J8VA 4C6LA 1CT5A 3GZ3A 3L0NA 1KR0A 2QV4A 1T8XA 4GJ1A 1XRFA 4K68A 4GA8A 1MW2A 1L0PA 3V4BA 1IR2A 4M6UA 1XF0A 1IF2A 4OTKA 4AVOA 1KWGA 4PB5A 4XZWA 2WC3A 1IEXA 4D8AA 2PRLA 1UBPC 4M24A 4UTLA 1XDMA 2Z4GA 5ABFB 4GXPA 3NXFA 1D7KA 1XP3A 1CWYA 1B5TA 1M7XA 2B81A 3WFAA 4IIBA 1EC8A 2Y85A 3C61A 1A3WA 3O6CA 3UWWA 2XYLA 3LPGA 4O1DA 5HQLA 4W85A 4YJ5A 1FVPA 4XBKA 5F2GA 1V7YA 1GKPA 1E1EA 1Q45A 5I3GA 3RCNA 4IJBA 5REQB 1O12A 1H50A 4QBXA 1EF3A 3N4FA 5CSYA 1U33A 2TAAA 5HINA 4F0RA 3WLHA 3G1XA 4MKSA 4IXXA 1S2CA 2OSYA 3QFEA 1V77A 1ECQA 5LHFA 1Q6RA 3EDEA 5DELA 3ARQA 3CQHA 3UR2A 3AOFA 3G8RA 4GOAA 1WDWA 4G56A 2ZWYA 3THAA 4ERAA 3PR2A 3PTMA 1NDYA 4HMEA 5CC3A 2WCGA 3LX9A 1Z89A 2NLIA 1JJKA 1IEQA 3WUFA 1UD3A 2ACRA 4B3KA 3FIGA 1KXTA 4HYVA 1ZZMA 4ERIA 3URBA 5LIUX 1FA2A 5M17A 1TE6A 2VZVA 5H8MA 9CGTA 2TMDA 2DVUA 5CG0A 3O9NA 2O7QA 1R2TA 4QHRA 1U22A 2VCBA 1PTDA 3PFMA 3CU2A 1UH4A 2CFFA 2QMJA 1PJ9A 4D6JA 2CZDA 4ZO8A 8XIMA 3QR3A 1VBHA 3AUJA 2W3ZA 3MJMA 3EDDA 1W32A 3L5LA 1RZMA 1V6VA 3ANYA 4P5UA 2J25A 3A9BA 3PTKA 4XKYA 2UV8G 2QUNA 4J3SA 5D02A 1NFGA 4S3EA 1K03A 1NU5A 3RDKA 2TPSA 2WHMA 4C1NB 1FFQA 4ZB5A 3B06A 4QGCA 4Q22A 3WK0A 2ZQ0A 1MO0A 3BAWA 1XC6A 1HJXA 1OX4B 4ZBCA 2Y1HA 4U4MA 4MTVA 3ARPA 1ICPA 3WY1A 3H7VA 2ACQA 2O7SA 3VM5A 2QDEA 4K7YA 2HXTA 4WXYA 4CD7A 4ZZ9A 5C9ZA 2Q8LA 4XBSA 3H2FA 5FF7A 4MZ8A 1XV8A 1OSEA 4AVFA 3EZ4A 1G0CA 4RNIA 3VO0A 4XAFA 4YVVA 3BV4A 2QQ6A 2XG9A 2P1FA 4TVCA 4FX7A 3TYEA 1XBZA 3PZVA 3C4UA 3L5AA 3WF3A 1V6XA 4B4FA 1RH9A 1HG3A 1YDNA 1XCXA 3KDNA 5TIMA 4F0LA 1KRAC 4CNPA 4FNTA 3ZJKA 5FL0A 2QCEA 2WQDA 4EKJA 2PP3A 3JU2A 3FK4A 4ORIA 2A7PA 3KP0A 2E5DA 3N17A 4JTQA 7PTDA 3WQ6A 3F7JA 1UQZA 2PGRA 2D23A 4FS9A 3BMVA 3T4CA 3WH5A 1JAEA 2A4AA 2B7QA 2RJGA 1LBMA 3VKJA 1L6WA 2G4JA 2UY2A 3A23A 2V2CA 3CUJA 4JKKA 4S1FA 1JI1A 1KM6A 3K8MA 4L1XA 3KBJA 3AC0A 3UXAA 1XKYA 1KBIA 4JFSA 5G2WA 1XYFA 2CHRA 4M56A 1G1YA 2FPVA 4AHOA 2JF7A 3MKKA 3GDMA 5AZ0A 1AD1A 2ODOA 3PBYA 4XZHA 4QDWA 4NG3A 3KAOA 4J27A 1K8XA 4MJ4A 4JTKA 4MNLA 4EANA 1UYQA 4YXGA 1TQJA 4FNRA 3FX4A 3M0IA 1H60A 1GKQA 2QEZA 2PZ0A 4ZODA 2JKEA 4ZOAA 1EEXA 4RW3A 1T99A 2OB3A 3O1NA 1KCKA 3F2DA 4O52A 3SDOA 3DAQA 2Q09A 1HVXA 3HFYA 3P5ZA 3KBVA 3OVRA 3DX5A 2DQXA 3TJLA 5HR7A 2NXGA 3H7UA 4H01A 3IGUA 2IKHA 1UD5A 2Y63A 4F48A 3LXAA 3GR4A 3FHQA 1LDCA 3KE0A 3L5MA 4DWSA 2VZOA 2ZX8A 3ARXA 3IJ7A 1Z32X 1TJ0A 1MFVA 4C6OA 4UMAA 4JX5A 2WZEA 1VEOA 3QV9A 4YLWA 4ZQCA 1B3VA 2XINA 4HYRA 3GWQA 1EX1A 3K4AA 2GFTA 3NVTA 4HNVA 2ONEA 1VQTA 2JE8A 4UNKA 1VGAA 2G3NA 2D0FA 2DW7A 3EWDA 1XYBA 3R79A 4HP5A 2CLIA 4REQA 3T6CA 2POZA 3IWPA 3A4WA 4KCUA 4N02A 1S5WA 3IIXA 2R1MA 1CBGA 1TPUA 3W1NA 3DESA 2QR6A 1S5NA 1ZP3A 2GOUA 3MCOA 3B0VC 5CPTA 2A85A 4BR1A 1TX0A 1GPFA 4MSSA 3A4XA 3FEMA 2D73A 4ZSTA 2DZAA 2O9TA 2PDUA 3T8QA 5AECA 4JICA 1KGWA 1V8EA 2GK1A 5ABTA 3GX9A 5FESA 2FVKA 3P8JA 3E0VA 4JN8A 4I5UA 1XYLA 1FHVA 5LIKX 3NSNA 4TOQA 3NQ2A 3C52A 3VKBA 1BKHA 3UYCA 3GVRA 4QDPA 5EMLA 3MA8A 1G6CA 2PD9A 1I1WA 4OOUA 2A3EA 2CBVA 1GQLA 4EIVA 2MNRA 3E2VA 1G94A 3UY8A 3OTRA 4EP8C 4JTSA 4AVNA 2QGYA 2WBKA 2OPJA 4FXJA 1M04A 2G4FA 3LV5A 4HPJA 1P0NA 3T0TA 3VGFA 2GJNA 5G4WA 1YTKA 3UJEA 3SI9A 2WW5A 4O0QA 3W24A 2ZYFA 2YA1A 3R6IA 1T96A 4FR6A 3LHTA 3BLLA 2BXZA 3LM7A 3AMDA 5E6YA 3AHTA 3H2AA 4EACA 2VDGA 4Q8OA 3UPMA 1TWZA 2J79A 3E38A 1IXOA 2QCDA 3UJSA 5KETA 1IR1A 3GSMA 1IXNA 4UCFA 3KBMA 4PUJA 1JNDA 1AJ0A 2IPFA 3BAKA 4GVFA 1W9XA 2BSLA 1JXKA 3LGDA 5EL1A 5D09A 2F38A 3FNDA 3K13A 3VZZA 1F3EA 3IIVA 4O1BA 4QR6A 2GPTA 8A3HA 2VC5A 4MB3A 1EP2A 3EA2A 5A8OA 3H53A 2J77A 3M44A 1QI2A 5AY7A 1NP2A 5BWAA 2GWNA 2AOSA 3DIPA 3BLOA 2BGQA 4KEUA 3GRIA 3BQ5A 5D9MA 3VOHA 3EX3A 3MUIA 1UMYA 3NPXA 5CPNA 3UPBA 2ZXDA 1K3UA 2WNNA 3DFOA 3U0HA 1YPFA 2C0AA 4JTDA 1AMYA 2X09A 4R33A 3WEOA 4XZIA 2P8CA 2XVNA 3AS3A 4S23A 3NZRA 3RR4A 2H90A 4AZBA 4ICMA 4MM1A 2IUZA 1V93A 4O14A 9XIMA 4KWWA 2GGGA 3QKEA 3ZOAA 3BLIA 4GGHA 1M03A 4TU1A 2VFGA 1EBGA 4B3ZA 4ZE4A 1VAHA 3KCJA 3U6WA 5G4EA 1YQ2A 6TIMA 1KM2A 1W5QA 2WJZA 1G4TA 6REQA 5A6JA 2YDQA 2PDHA 3MSRA 1JYNA 4S38A 4JL1A 5T26A 3K1GA 3U2OA 4XUYA 1UCWA 3A3HA 2G0WA 1MVYA 4DPQA 3OIXA 4Q8WA 3T4WA 5DXXA 4WRHA 4PUMA 1KA9F 1YTDA 3W70A 2CZEA 4O4VA 5BW6A 5HULA 3VD5A 3BWWA 2VQTA 2Z6IA 4FB7A 1QNQA 1IT8A 4XTDA 2ZADA 1NOWA 1XH1A 1PO9A 1RQEA 1PZ2A 3ELFA 4UQCA 3QC3A 3AHYA 2YJQA 4ROPA 2GQ8A 5FKYA 1E71M 3NR0A 4J3UA 2OMAA 2VHLA 2F6XA 1PX8A 2YLLA 3VOIA 3WJSA 1GUVA 3WJXA 4EPDC 3ZSTA 1CB7B 5CGQA 1JZ7A 3LTSA 3TLLA 4H6RA 2GJPA 1F73A 1TVNA 3DHDA 1M01A 1TCDA 3AZRA 1S2WA 3GDLA 2E0PA 2W91A 4EPBC 1Z9AA 1T6MA 1E51A 4KQNA 4DBEA 2OT1A 4INFA 1XD0A 3L67A 1E6QM 4FEZA 1J0JA 3O15A 1EUNA 4UMBA 2XN0A 4AZHA 1Z48A 5DBUA 4DELA 2KZHA 2X0YA 3G1VA 2G95A 1JUEA 1WZAA 3A3WA 4O0ZA 4MFEA 4I7WA 3W1TA 3WNNA 1H61A 3KOXA 2C14A 3PAOA 4XQ6A 3WBWA 1TVLA 4J5NA 1W37A 3EX6A 3GIYA 2J62A 4PRWA 1IV8A 4EWND 1F74A 4X0VA 4K3ZA 3DUGA 1QPQA 4HK6A 3SUWA 3W25A 5FACA 1SZFA 5AHLA 4HHPA 1ZUAX 4HPXA 1J79A 3HJZA 3UCCA 4LBRA 4JNYA 3LGGA 2ZKMX 1Q63A 2JEPA 3Q94A 4J3WA 4PODA 4JTHA 3ZSSA 1KRBC 4MUZA 4CLMA 4S3KA 4BF7A 1FWEC 2FZMA 5EPDA 3BVJA 1N8FA 1SMDA 2PDNA 2ZICA 2PODA 5K4ZA 1R86A 1JFHA 4HU0A 2A21A 1AQ0A 3MUAA 1NQKA 2QCNA 4GCXA 4LYPA 3NFUA 1EHNA 1FWFC 3GR8A 1G69A 4Y2WA 4IPLA 1R30A 4IGMA 1L6FA 1G4PA 1K4HA 2ZX5A 4Q4OA 2WMHA 3EWBX 3PG8A 3VDGA 3T40A 1UKTA 5BXTA 3TYCA 1XC4A 4B5NA 1RXOB 1H4PA 1FHLA 4U28A 4NXKA 1OZMA 4S3FA 3GTFA 3QC0A 2OEJA 3MUY1 3WNPA 4AZCB 4Y9OA 1KQZA 2DUZA 4GXMA 4XKYB 4B2DD 2VURA 2P10A 1AVAA 5LIWX 2VQUA 4NX0A 4HHHA 4HA1A 3FJ4A 1CNVA 3LCGA 1L6GA 3N34A 1BQGA 1JAKA 1OCJA 4G7EA 4D6HA 1JCNA 3H7RA 1DIEA 3P8IA 2OLSA 3U9IA 3CL7A 1QW9A 2EAWA 1LOQA 2ZA1A 3MTWA 4DWDA 3CYVA 2WMKA 5FA5A 1ITXA 3O8AA 1ITCA 5A6KA 1J4EA 2W61A 2XM1A 4PBEA 3B9NA 4N42A 5AC6A 2VX7A 4R53A 1CI1A 3BGJA 4KEMA 1F3TA 3HPAA 3IRSA 3NTYA 1VYPX 3NOYA 3O3RA 3CIVA 3RLUA 2F2HA 4JFVA 1HZYA 1OFRA 1LP6A 4N0RA 1CXIA 3GIQA 3TK7A 1BXNA 1XDLA 1F07A 3PTQA 1KCXA 3W85A 3SN1A 1R3VA 1ESWA 2V67A 4HKPA 4CD8A 2VYOA 4MZYA 1H63A 3GK0A 3GH4A 6ALDA 5CKSA 1UROA 1YIXA 3GDKA 1WZLA 1FX6A 4DM2A 4GQQA 4JL2A 2H8XA 2WPGA 2VEMA 3ME3A 1P6CA 2FJUB 2HWGA 4YNGA 1F6YA 1G7VA 4AEFA 1X1NA 3AIRA 5FI8A 2DZWA 3DDMA 3OBAA 5I3JA 1XYAA 3LCLA 5A2CA 1GOOA 1WDPA 3C0JA 3TQPA 1KRMA 2PWEA 2PURA 3CTLA 5FF2A 1E0VA 2C19A 1NY1A 3L2LA 3LK6A 1LROA 3MV11 1A5SA 4K39A 4YTQA 4U5KA 2VM8A 5E70A 4UUIA 1JZ8A 1TPB1 3RU8X 4KRZA 3UF9A 3NQAA 3TTQA 3VMPA 3LBOA 4KKXA 1TO3A 1VB9A 3MBFA 3UZXA 3N9RA 2J24A 2OGJA 2DZPA 1W3JA 2G3FA 3KBNA 1UZ1A 3T55A 2O4MA 2R94A 1B4KA 1IEWA 1F8MA 1IHIA 4J7RA 3TOPA 2NQ5A 4RUBA 4UTUA 3B0UX 1GVQA 3L21A 4BK9A 2XFYA 1K8CA 2PUZA 2CESA 1VLWA 2PBOA 2F2KA 2VEIA 1CLVA 2W0UA 4QTGA 1XIBA 2OU4A 4O54A 3EPNA 1UZDA 3S5OA 3T09A 1GVOA 1QMLA 4LPCA 2VL4A 3WDJA 1RQBA 3UWUA 3T1GA 3RO6A 1GOMA 1F8IA 3G1AA 4DWSB 1W31A 3GTNA 1J6OA 3L9CA 1F4HA 2ZA2A 2G50A 4M6VA 5JH1A 1L2UA 2INFA 3BURA 4DF2A 4UWMA 2OFJA 1O7AA 3IEBA 4IQDA 1ZBCA 2GGJA 2C6QA 3RILA 1XICA 1H51A 4H8HA 4GZJA 3N2MA 2J9ZA 3QY8A 3W75A 1JYWA 4CQAA 4C7DA 3A5VA 4ZQPA 2VDHA 2UBPC 5HWJA 5FF0A 1YW1A 3CAVA 3WUEA 1KFBA 4AIBA 5IHRA 4ASTA 1WYIA 3GG8A 3NQGA 4GK8A 4ROQA 4KGJA 3W7NA 1CXHA 1NFBA 3MP5A 3EXSA 2Q8ZA 4HYWA 3GHSA 4U2YA 4KFPA 3B8TA 3KLLA 1JPDX 1KFEA 3ARTA 4PL2A 3MQTA 2CLLA 3AHVA 4GYPA 3I6EA 4YTTA 3AFBA 1CEOA 1KXHA 1JD9A 3S2CA 3NOEA 5I00A 4MWAE 3DFQA 4HB7A 3GDBA 2NQZA 1HL2A 1CW2A 3GAYA 2REQA 1DXIA 1XKJA 1XPYA 2HK0A 4B5UA 5CJ5A 2OX1A 1XS2A 2AKMA 4Y90A 5I09A 1A5OC 4GY7A 1DE6A 4B92A 3KTSA 4DN1A 1KM3A 4IMFA 3VINA 4I7UA 4C6CA 2ZZ7A 1FWSA 1OIFA 2X0SA 4H8VA 4XD6A 4QQUA 3USZA 4ATWA 4D71A 4PMUA 4AC7C 5I3FA 5D32A 1B54A 3UT0A 1XSKA 2V5CA 2AL2B 4DZ5A 1X8CA 4G9PA 4PFMA 5AOUA 4B2DA 4MDOA 5GJPA 5HJYA 2YSWA 5IFTA 1QI4A 1ZHAA 2W27A 4Y9PA 3OYZA 5DCBA 3BSGA 3V0UA 4IIDA 3L4WA 3LPFA 1J11A 2XVPA 5C2XA 4K1GA 3WQOA 3WYZA 4MHBA 3DERA 3QTGA 5LXEA 5D37A 3UZZA 3DI1A 1QOXA 3QOMA 1S2AA 1KW1A 3UU0A 1EP3A 1XYCA 3S2MA 3AYTA 4HA3A 1EJTC 4MVAA 2J27A 1E9ZB 5K9CA 3KRBA 5D30A 1JYXA 2XJ7A 1X39A 5TQLA 3SR7A 4RXFA 3K2GA 1BRLA 1ONXA 3VMNA 3D6NA 1JDEA 2O0TA 3W02A 1QWGA 4DZAA 2OZ0A 7A3HA 4MUPA 3V36A 1W1IE 2DY3A 4AY1A 2CYGA 2J7HA 4FXSA 3VI2A 2ZBTA 4AZGA 4D6GA 2O4QA 3HIJA 2Y8VA 4ZL1A 2P0OA 3JVAA 3C56A 3CPRA 4Z2HA 2OG9A 2FMOA 5LSMA 4AYGA 1EA0A 1WKYA 4C6NA 3W7IA 2BODX 4UXDA 4TO8A 4LUJA 3XIMA 1W1A1 1ME7A 2YCLA 2I7GA 1XINA 5EA9A 2FTWA 3RX3A 1FUYA 1XCFA 4ZTYA 4ACZA 1F5ZA 5HMFA 3TXVA 2J7DA 1WQ5A 5I3IA 3LMYA 4MKNA 4B90A 2NWRA 2VFIA 2V3FA 4MYXA 3WH9A 4N9EA 4C6KA 2GDQA 3IJ6A 4XV0A 4AUBA 1XQKA 3DKJA 3OHMB 3V7PA 1Y8BA 1KV8A 2OQLA 4RE0A 5FEXA 1XLAA 2BHYA 3LHVA 4MLJA 6REQB 4P8UA 4IPPA 2GDUA 5A95A 3M5VA 1E5JA 3NL2A 3RITA 1M1BA 1VYSX 1RV8A 1V0NA 1E15A 4ICCX 4MPQA 1ONRA 1AFSA 3CHFA 4FF7A 4UTMA 4AFYA 4H6EA 1IWAA 4LUSA 1A47A 3MS8A 2HPMA 3TTEA 3BAYA 4QSHA 3PJTA 1RJQA 1WUEA 2HROA 2J13A 3MO4A 3ZWTA 4KFOA 2XPKA 2VP8A 3UCDA 1ICQA 4JTTA 3H4WA 2X0HA 1TVPA 4IMGA 3P60A 2FFCA 3U2ZA 3LZ5A 4BZYA 4NILA 5D2VA 1H3GA 2D0HA 4UCGA 4GUGA 1REQB 1QATA 4IP7A 4ES4A 3PBMA 1CIUA 2PRHA 3HV9A 4M7SA 1PZ1A 4F0MA 5CLWA 1XLHA 4C5ZA 2P5NA 3SEPA 1J2WA 4GGBA 3LYEA 3VUPA 1PS9A 1O95A 1KXVA 2FDSA 5FAJA 1ITQA 2YIHA 4CVWA 4BKNA 4F4RA 2HVNA 2PWGA 3CGTA 3MANA 1QWKA 2HCVA 3KVLA 5D8ZA 5D2TA 2PDBA 3TFCA 1CGXA 4RKAA 2WSYA 1E1CA 3UPWA 2X2GA 3LXCA 5D2XA 2GGEA 3N6JA 1E0WA 3T9PA 1NQ6A 1BYDA 1WDDA 3ZJ6A 1N55A 2VX6A 4JCMA 2EO7A 4AYSA 1YXYA 4P7RA 1UR8A 5AVNA 1I2RA 3UYIA 4FA3A 1BGGA 5HWNA 2ZUMA 1UOZA 2WBGA 3RX4A 1ELSA 4BQ2A 2BLEA 3TX9A 1ZL1A 2FMNA 3VE7A 1SMAA 1SJAA 4QS5A 2VGIA 3KBSA 2PCQA 4FOKA 3VNZA 1J0IA 3NDYA 1V02E 4JTCA 2GVEA 1SJCA 3U4FA 4CGTA 1UR4A 4PE8A 4RZBA 4C1LA 1CXEA 1WP6A 3WEZA 3W1UA 1IWPA 3KZSA 1O94A 2VRQA 4ZOEA 4FAMA 1UH3A 4CD6A 3MBDA 4JN6A 4AMAA 2ZUUA 2VZSA 4N6EA 2V0TA 4C6EA 1VFMA 2EG8A 3TV8A 1JCJA 3JW7A 4PFHA 3AQUA 3W0KA 1E72M 3CHDA 1TTQA 1TPEA 1PZ3A 4NYYA 3H2MA 5HUOA 4JFUA 5C55A 4GRSA 3WDQA 1GONA 1ZAJA 1U5HA 2ZZ5A 3ABZA 1C92A 3TLQA 3LLXA 4EAYA 4DJEA 3ZFHA 4IH3A 5CBBA 3OODA 1EJWC 2W67A 1LLWA 1TIMA 3TTYA 1GT8A 2A79A 3I68A 1X98A 1MDLA 2ZVIA 4F9DA 2Y8UA 2BVWA 1DP0A 3SECA 4DLMA 3HA1A 3CJPA 1QT1A 4IMEA 1LG1A 3L7RA 2HSAA 2F84A 2O9PA 1K02A 5CZ0A 2B7NA 4C6DA 3L0GA 1LBLA 4W89A 3KHDA 4E2BA 4G7EB 2HK1A 2CZFA 1DJNA 4NYUA 2QCFA 3NPWA 4MPKA 5CSSA 1EBHA 1RJPA 4D2JA 2CPUA 1OC6A 5FOOA 4KCWA 5F4SA 2D69A 4H3DA 2WMIA 2E4TA 2Z1XA 4LU0A 4Z0SA 2E68A 2OWXA 4JTJA 3BDKA 4O57A 1V3HA 3EYPA 5CBJA 4M6PA 4EOUA 2YW3A 1YX1A 3WNOA 4BJHA 3FAWA 1PKLA 4Z1BA 4CNTA 1AODA 3LG3A 2BVDA 5CSUA 1X38A 5JBFA 4ZVJA 1OF8A 1R5YA 4C6IA 2R9RA 4WZHA 3CQJA 3B40A 3S5SA 3KL3A 2WXDM 1EF2A 1QNPA 1RCQA 3CHCA 1BHGA 4Y9MA 1CXKA 1EIBA 5B7ZA 1GJUA 2ZUWA 3UGVA 3JR2A 4RCXA 1GQJA 2VT0A 1J5SA 2PLCA 3EMQA 3W7QA 5LIXX 1FDJA 3CQ0A 2V38A 2BGSA 5D33A 1XGDA 4NIRA 2CETA 3J7HA 3VPLA 4IGNA 2VEPA 1ZAHA 3K30A 3ITTA 3AYSA 3SCQA 1OD8A 1Q6DA 4NP7A 1VBUA 1YLVA 4KH2A 1LWJA 3QZEA 3GVVA 3UJ2A 1KB3A 1Z42A 3VM7A 3S46A 3NYZA 3VGBA 1OEPA 1RPXA 1R46A 3IJ9A 5LGXA 3VE9A 3R25A 3UESA 4UFIA 5BXRA 3MC5A 2YLAA 3T81A 4O53A 1W2VA 2Y7DA 4O17A 1H7WA 2BZNA 3SURA 1XH0A 1HJUA 3TCEA 2YXGA 1H7NA 1FP9A 3OZPA 4PSRA 1GEQA 3ITOA 1XBYA 3S2LA 1V0LA 3KUMA 4DJFC 4ICNA 2BY0A 2I5GA 1W5PA 2ZXBA 4W84A 2QNEA 3ZO9A 3NIYA 4EE9A 9RUBA 1AMKA 6ENLA 3C0QA 4MGGA 4N6FA 3WD3A 2PBGA 2F8QA 2PA6A 4IQJA 4DYKA 1TWSA 4JX4A 1MW1A 3BQ6A 3T44A 2XH4A 2C91A 2B7OA 2F7FA 4HMDA 4S3CA 4HOWA 1H5VA 1JZ2A 1UD6A 4JOMA 4D1JA 2FPTA 3SIMA 3WDHA 4AXKA 2FH8A 3G1DA 5F1VA 1AQHA 1IGWA 3HPSA 3QGAC 1FWNA 5JH2A 1GOQA 2YL9A 3M46A 4FLQA 1FRBA 3SRHA 5F2MA 3TP4A 3T0BA 3F1QA 4XZBA 4L6HA 2QCHA 1ISWA 2C13A 3CWOX 2ABBA 1SO6A 2UY3A 1P4CA 3W37A 1OK4A 3QKZA 1OT1A 2OO6A 5EB8A 5C9UA 1JPIA 5LXXA 5A5WA 1DBTA 1WDQA 5KZEA 5A6TC 1IEVA 3EDFA 2XGZA 2X2YA 4IIFA 4YTRA 3HQ1A 1XH2A 3DN5A 4BI7A 3TROA 3TAOA 1DXEA 1MDRA 1WPCA 1TR1A 1IYXA 1BVWA 5XIAA 3H22A 4Y8EA 4FXRA 4MB1A 5G2HA 1I4NA 3TSBA 4I6VA 4MWAA 4ATDA 4IGHA 3DFSA 1YBQA 3N29A 4EX4A 4E0CA 4LEFA 1ENUA 1N8WA 2DW6A 5KMYA 3FSTA 4MY1A 4M7TA 1XLKA 3DKLA 3S2NA 1JDFA 4ZQNA 3ZS4A 2PEVA 5F4WA 3GXFA 1NDZA 2H8ZA 4CNNA 3PWIA 3U57A 1B90A 5AHFA 4GUHA 2HEJA 1PYFA 1EXBA 3T2QA 1XR2A 2PB1A 1BPLB 3MUCA 5A2AA 2FJKA 3TA9A 3F4DA 1X7FA 3PAJA 4C91A 5SWUA 4PTDA 1KM1A 2PP0A 4QP0A 2NX1A 4W5ZA 4BCEA 2AL1A 4AIUA 4GPNA 1EJVC 4R88A 3WQFA 1EOMA 1TB3A 3QHMA 5T8GA 2QCGA 1HF6A 5KZ6A 2IQDA 1HO4A 5G1YA 3ABQA 4QJ4B 1QHZA 1YKWA 3K4DA 1ZBWA 1LT8A 1FWTA 4UQAA 3GD6A 1O4UA 4YVPA 1A5UA 3A12A 3OZOA 1J0ZA 4RXGA 3D5HA 4PZVA 1A3HA 4FF5A 1FCBA 4GH3A 4LAOA 2QVHA 2EG7A 2VX5A 1YDVA 3HPFA 2DSKA 2XIQA 5A69A 3WBYA 4UOZA 4OBTA 4QEEA 4MOZA 4O1CA 4DHGA 3U7BA 4ERGA 3UY7A 4F0KA 4AMCA 1C91A 2BX7A 2HE8A 4RDWA 3NL6A 3NM1A 4U3AA 4Y7EA 3NQBA 4IMAA 5G1TA 2OX4A 3O05A 1W56A 1K9EA 1LQ2A 2RKXA 2WZTA 3EMZA 3WZ0E 3R8RA 3BICA 1CGYA 3DGBA 4L6DA 1LOLA 3INPA 1TTPA 3FKRA 1FKXA 3N04A 1Q7MA 1E4NA 1XL9A 3HZ3A 3W6LA 3A24A 4FOJA 1EJSC 1VEPA 4LEQA 3WJWA 1DOSA 3PJXA 5EFFA 3EX2A 4D6FA 1F76A 3W71A 2JKAA 1MXSA 2I5IA 4Y6GA 4UZSA 3HG5A 5CPMA 3CT2A 5DY2A 1MI3A 4GZIA 4NY2A 1Z6KA 3CIXA 3DXIA 4UTWC 1LYXA 5U7SA 4F3HA 1DQUA 3BSHA 5L6UA 1ONEA 3IUHA 1TWIA 4AB4A 1UUOA 1RAKA 4KIRA 3BW4A 4TV5A 2YZRA 3CT7A 1OB0A 1DEDA 1YDYA 2BY1A 1GZGA 2BHZA 1BVNP 4OJYA 3UR7A 2KX9A 3SUTA 3LA4A 3MMUA 3CB3A 3WL0A 4TX8A 3B3DA 3N2XA 1VH7A 3M6DA 2WAGA 4MAVA 4PC8A 2BB0A 3ALGA 3PULA 3LNMA 2VD9A 1OGGA 3GNNA 4ZOCA 1U1HA 3BOXA 8RUCA 1DL3A 4N2YA 5G5IA 2DT3A 1B3XA 3CIWA 3STFA 1JCMP 5JBEA 5FEWA 2HVOA 3PZMA 1US2A 4N7QA 3S5NA 3CHVA 1T0OA 4GZEA 2NT0A 3BOLA 3VZYA 4WGXA 1EKOA 7REQB 4CCZA 3RM9A 1DJZA 3LXBA 3KL0A 1JIBA 2XTKA 4Z1DA 3I6RA 2V2HA 3NSMA 1XLIA 5AHMA 2GJRA 4WUIA 2GL5A 3VKAA 3BSMA 5FJTA 4I3GA 2OZ8A 1S2UA 1BQCA 2Q6ZA 2A0NA 2VFFA 4W4QA 5LIYX 1GVYA 4CU6A 3OGVA 3EOSA 3LI0A 4MJMA 4E4UA 3R8GA 1U5JA 1OFDA 3CZLA 5I3DA 2JEQA 3CUXA 1UWRA 1JZ3A 1W91A 5HNUA 4QLJA 1MNSA 4NZFA 3NSXA 2OEMA 1RUSA 2QUVA 3GNPA 3SIZA 2IQTA 4HHLA 3BARA 3UZJA 4B5XA 4ZQRA 4ZO6A 1EJXC 3WQWA 3EOOA 4NI3A 1A5NC 1CX9A 1V02A 4PMVA 4JQ3A 4RNHA 1SR9A 1FWJC 4M81A 1E4IA 5AC7A 3AUOA 1XYMA 1LRNA 3S1GA 4JTRA 5HJXA 4LYQA 3H2OA 4DJDC 1XDJA 2QJJA 4GI8A 4HMCA 1L8PA 2PI6A 4LTSA 2OYKA 4HT3A 3M16A 3M07A 1OZQA 2I5QA 3NO1A 1J0HA 3QOKA 1D8CA 1UQYA 2ZXAA 4LVFA 3HN3A 3CO4A 3TUUA 1B1YA 1W9BM 4BA0A 4WY0A 5D05A 2J8FA 3ZVHA 3WQDA 3LLFA 1E1FA 2ZIDA 2F6KA 1QK0A 1GHSA 3GB6A 3M0HA 3SO7A 1GOXA 1DWHM 3MV01 4BHYA 2ZUNA 4AIEA 1RY0A 1QNVA 1OABA 4C90A 3I4KA 3VOGA 2WVUA 4CD4A 3G1SA 5LYRA 5I03A 1R3TA 2PF8A 2PTYA 3SM0A 3W2KA 4FLSA 1OFQA 1MZRA 3G18A 3TR9A 4WOZA 4UFHA 3QW4B 3KTXA 3RMEA 5A6MA 3BOFA 1P7TA 1UKOA 4M8UA 2Z0IA 3F5JA 5JXQA 3EX4A 5LNSA 3LNPA 4OHQA 1V0KA 1LBFA 1HKKA 4X61A 1TA3A 1MQPA 1FBAA 5BRBA 4DX3A 2G96A 3FA5A 4FOUA 2QGHA 3SCNA 3WDRA 2CWXA 2DDXA 3LPOA 4JYFA 3FXYA 5CC7A 4DI9A 4C7FA 3EWWA 1SW0A 3EDKA 3TWAA 4X63A 4GX8A 1SZEA 2X41A 3OG2A 3QMSA 3LSBA 5DT5A 5CZSA 4H7VA 2H3BA 4XSMA 4UTIA 3W88A 5FJOA 4GYJA 4LAUA 2V69A 2VXNA 3DCPA 1NJJA 4QDMA 4YYFA 3C6CA 1XSIA 2NT1A 4JTFA 1K8YA 2XZ7A 3W7OA 3CHEA 1OQFA 1PUDA 2DZSA 1JG9A 3E96A 2HZGA 1XIJA 2R24A 2BMBA 4RDZA 2I1OA 5D38A 4HSOA 4UTKA 1VD6A 5DANA 4QM1A 1RA5A 3CMGA 3IJLA 3ANVA 4L64A 5C2CA 1XLLA 3R12A 2PTZA 3ZVIA 4HU4A 1NP0A 3RRAA 3EXTA 3CLMA 1NWSA 4JZ5A 2PDIA 1W54A 4X9SA 3WNKA 4NAFA 1BSLA 2CIPA 1FH8A 2QJGA 2CC0A 3P0WA 2PLMA 3B8IA 4PB4A 1RJRA 4IL2A 1K7XA 4HHMA 1ADSA 3TEVA 2VRJA 5D04C 4H9ZA 4L9YA 1XUUA 4XZMX 2E6DA 2PDCA 4UR7A 2A5HA 1W1PA 4B9ZA 4GC3A 5PTDA 4NAEB 1A3XA 2RDTA 3PZTA 3UD6A 3RG6A 3OEXA 3W7LA 1J9YA 1CGUA 2ZCGA 4PTNA 3P67A 3N13A 4LWWA 2X1TA 1TRDA 3EDJA 4LB4A 4UTTA 1L8NA 2CHOA 4WDXA 3VC5A 4QCEA 5AHNA 2YZ5A 2QKFA 1QFEA 2V6AA 3E0FA 1OG6A 2ZTJA 3IIPA 4I9TA 2C71A 3QLLA 5RUBA 5T9BG 3SCOA 2ALRA 5A94A 1B30A 1BTCA 1DJYA 4KCTA 3RMJA 4DZIA 3ID7A 3W7HA 3W83A 3R2GA 2EPMX 4JN7A 4M1BA 3ARUA 1QI5A 2D2OA 1X6NA 2A2IA 1PKYA 2DH2A 2G3MA 4M5PA 3G3DA 1GW1A 2P0IA 1OGBA 3B0YA 2CERA 3W86A 3LI1A 4WDTA 3WLKX 4MAZA 1J10A 3WF4A 1AJ2A 6TAAA 4OGZA 1W1B1 5CH9A 4H2CA 1NOUA 5BROA 3LV6A 2WB5A 2HPIA 4QG8A 1V03A 2O9RA 4IPNB 4FALA 1S1RA 2QXWA 3W6MA 4HTBA 4KS0A 1TQXA 2FGZA 3CTTA 1EL3A 4GUFA 3PPHA 5D9OA 2QVNA 4IICA 3PK7A 4XWUA 2PF0A 3PUOA 1SZRA 3HG3A 3HMJG 2VENA 1MXDA 5LKYA 3UCQA 2WLYA 3AAMA 1BG4A 1FKWA 4M0XA 5FJRA 1YDOA 3FDGA 3MVTA 2MANA 2VZUA 3CUIA 3HOJA 1KKRA 4MWAB 2NX3A 3VIOA 1KFWA 1Z8AA 1VLIA 3OIHA 2E3ZA 3KWSA 3C8NA 3SGGA 1JGIA 1P43A 1HN1A 3HURA 3OP2A 4V15A 4XX6A 2CITA 2WK2A 3MT1A 3IVSA 1TPFA 1VHCA 1M68A 3CZJA 3U48A 1H1YA 4NHVA 4EK7A 4Q4KA 1IE7C 1SO5A 2DJXA 4ZR8A 2VEFA 5LNUA 4GO9A 3JS3A 1FCUA 5FEPA 3QSRA 3MI6A 2XIJA 3KX6A 1B2YA 3HGOA 4IUOA 6CGTA 3SY1A 2ATSA 1P1MA 3AMGA 5FJJA 3W6YA 3FXGA 3BJTA 2QPSA 1RR2A 3NNTA 3AXKA 3SSZA 4ML9A 1KBJA 1O60A 1VRXA 2VEGA 1P6BA 2GVLA 2Y24A 3FDKA 4HNNA 4WKAA 1OFEA 1WAWA 1BAGA 2YXXA 1KWKA 1BYBA 2EPOA 3ARVA 3U8GA 5HDRA 4DUWA 1ZJIA 5DO8A 3W72A 5U4NA 3PF3A 5TAOA 2OZ3A 5A8MA 2IKJA 1DJIA 3C0SA 2GJXA 5A2BA 3U4AA 5BRPA 1UC5A 3WMCA 5KZMA 2QDHA 4F2BA 3BH4A 2C8NA 1XW8A 3TOYA 3NG3A 1KXQA 2PAJA 1WCGA 4UOJA 5CPOA 2WJDA 2VVSA 3HG4A 2FZ9A 2EEXA 1GQKA 1XLBA 1OBAA 1S2VA 3ECQA 5A6BD 3A5FA 1OHLA 3AJ7A 2QS8A 2G5WA 5B80A 1KQYA 3OVGA 1OIMA 5HQMA 6A3HA 1J0KA 1YYAA 3PZOA 3SFWA 4NJJA 2PLJA 3K1DA 4B5WA 2P50A 2HS6A 4LUTB 3ZT6A 4A21A 3FFSA 3G5EA 1GG0A 1GG1A 2PDFA 1WDRA 2Z6JA 4HCDA 5HA7A 1EFZA 3TZNA 3SFKA 4H9XA 2WZMA 3R0UA 1HJVA 3W26A 4H8UA 3FJNA 4M29A 2QJIA 4WJ8A 3PZQA 1V6TA 1UD8A 1R3QA 2QPXA 2Z2UA 3PNZA 3URNA 3PVFA 1BLIA 3N6QA 4GI4A 4GACA 1J0YA 2HE5A 4IISA 2Y5EA 1C7SA 4CU8A 4F8XA 4OUIA 1NTHA 1FDZA 2VJXA 1UD4A 1H1ZA 3LHWA 4W7WA 1X96A 3BUVA 3W2NA 4HOZA 1H0GA 4EF9A 1C9DA 1EQPA 3P6LA 2FVMA 1FXPA 3NZGA 3CAWA 4XUGA 4BQ3A 5DMLA 3H26A 4KFNA 1XRSA 2QPUA 2GSHA 3VNIA 4NX5A 4L4MA 2V82A 4PCPA 1TZ9A 2WWCA 3OZYA 3ZXWA 1TMQA 1ICSA 4RNJA 3V75A 4QNWA 1WZMA 2O9OA 2DPEA 3UR8A 5CZKA 3QYSA 3VU2A 2D1ZA 1OCNA 7CGTA 1EGVA 3R0DA 1B0IA 1M7PA 1B9ZA 5HMSA 2Z7KA 3CB8A 4PA8A 1BEUA 4DO4A 2J4GA 1EYEA 1PKNA 5BMWA 5DQPA 3TJIA 1UIPA 2CW6A 2Z25A 4AW7A 4Z42C 3JZUA 3S9YA 2PGFA 1TWWA 4DWSC 1SUXA 1CGVA 4X2PA 4V33A 2Y7GA 3GW0A 4PUDA 4DRSA 1EOKA 1KBBA 1I6NA 5AFDA 3T8LA 5IM51 1S3HA 2WHLA 2H9AA 3E12A 4K2SA 4AZ7A 4QFUA 5GJNA 1MW0A 1PX3A 3G22A 4FLRA 1NM9A 2CXEA 1HL8A 2FFIA 3KLKA 1K1DA 3WSUA 2IQ0A 1SFTA 1M9HA 1A5MC 3TN6A 3ORWA 4YL2A 1OINA 3NZ1A 4QIUA 1Z41A 3MCNA 3MHFA 3LD5A 3ZR5A 3MSDA 3N73A 1JD7A 3F2BA 3Q2DA 3EA1A 1TMLA 1V3LA 1HL9A 2Y88A 4I90A 1TSIA 7XIMA 1UMLA 2E8YA 4RV3A 1JRCA 3ITYA 3AIUA 1XCWA 1QR7A 3KWXA 2C3ZA 2PDKA 3WLLA 4KF1A 3DG3A 3TN5A 3WQCA 1SZGA 3WDPP 1EA9C 3DOPA 1WKEA 1HJSA 1ZQ5A 3AO0A 2CBUA 3LS9A 1GPWA 1F6PA 5H8UA 5IBXA 3EKLA 4KMQA 3G6LA 1S3TC 4WY0B 4DYJA 4HZMA 1RLCL 3UWVA 1S5TA 1H0IA 1WOBA 4DNMA 2ZRXA 3G1FA 4L6OA 1QW8A 1HKVA 3PG9A 4HTYA 3SQLA 2VCCA 2WVVB 4OOZA 1FH9A 1DJQA 4YCPA 3BZGA 3HQPA 3PZ9A 3L2IA 2FTYA 4XAYA 4K8HA 4HOXA 2INZA 3CWHA 1K70A 4GI9A 3ZLHA 1H7RA 3F4VA 3V1PA 1VBGA 3GYCA 3M5ZA 1ZS2A 3QEZA 4Q7IA 1I0BA 5HMDA 1VPYA 2FTPA 4GYFA 1W17A 3SRKA 4HA0A 3R0KA 3ZJ8A 2BDQA 3GHRA 2E6FA 2G8ZA 3B8VA 4P8XA 4PMYA 5F2IA 3VD3A 1SJBA 5AYZA 2CU0A 3PZUA 4I9AA 4HVXA 1FXQA 2EHHA 2AQOA 3ABSA 1US0A 3F03K 5AYBA 3CPUA 1AH4A 5DMNA 2I17A 2FZ8A 4RX0A 4CU7A 1UOKA 4FNUA 2DSUA 2ISVA 3NAVA 3L12A 4P7NA 1E43A 2RDXA 5C2GA 3STEA 4ZEPA 1VHNA 3QV8A 1OC7A 1DIKA 4QXIA 1KM4A 6PTDA 3WQGA 3NQ6A 3GU9A 2Z24A 3V18A 3QH2A 1MUMA 3N2OA 4M1RA 4AD1A 3MMDA 4Q7BA 3RGTA 4DYEA 4WKHA 1LL4A 4G6CA 4KRUA 4K8EA 4ZXLA 3S1WA 2PWVA 1F7BA 2FYMA 2WOQA 3EWZA 1OX6A 1JRBA 1A5AA 5I6SA 4CCEA 1YXCA 1UZ4A 3PB0A 2NUWA 5FJUA 1VBJA 3WLJA 2D24A 4I6KA 1Q3NA 3GNDA 2CLKA 5D4YA 3PZIA 2NV9A 5A1AA 1XWYA 1E3XA 2HBVA 2IXVA 3RYSA 4J3VA 4JIHA 5T9CE 4A22A 2BNJA 3R43A 2GZXA 3UA3A 4CEXC 3WFZA 3ERPA 2OGYA 3BAIA 4GIRA 4JYEA 1Q6QA 2WSRA 3KEHA 5ABEA 4ZFMA 4WK9A 3FAXA 1UKPA 3QZAA 1IZKA 1CXLA 3IGHX 3KXQA 3EB2A 3VIMA 1E73M 4AWTA 1TV5A 2ZZ1A 4EPEC 1XIMA 1MW3A 4MFDA 2EJ1A 2QDDA 4UFKA 4DNHA 4R85A 1PSCA 3MYOA 2DORA 1GCYA 1VFOA 3UETA 4DF0A 2ZRYA 1RP9A 3KOZA 3MMWA 4Y8FA 2DT1A 4H9UA 1WNOA 3DFYA 1BWKA 1DHKA 1PB0A 2BP1A 2Z26A 4LVAA 5ENLA 4AWEA 2RUSA 4QISA 2BS9A 1A80A 1S2TA 4Q7NA 4YMZA 3M64A 3IAPA 2OWWA 4UZUA 2XN1A 4MJZA 1LT7A 4M51A 4JXCA 2HV5A 3QR1A 1TWDA 2X1UA 4JQ2A 3WELA 5I7GA 4KCVA 4AY7A 1E9YB 2W92A 3QV7A 3WLIA 2AAMA 4W5UA 4NRSA 3LENA 2P88A 1JF5A 1VCGA 1C7TA 2XIMA 4URIA 4RDVA 1V3JA 5A3HA 4CNSA 1OFOA 3NQEA 3CUGA 4JQ1A 5MF5A 4GBUA 5CCZA 2Y62A 1NEYA 1U2YA 2FPYA 2PDMA 2YBVA 2GGHA 3OJGA 2J9YA 2W6RA 4XVEA 3MZNA 3BK0A 3S47A 5BOOA 1PIIA 3HV8A 1W9UA 5J5DA 4OBSA 4GIAA 4QAIA 4PMRA 1A5CA 3DHPA 1TZZA 2QYGA 4YTUA 4P8VA 3WDIA 4MF4A 2OODA 1QUMA 5HAOA 4AWSA 1K9DA 3S42A 3VIKA 4XZNX 1I45A 5ABFA 3W76A 3OLDA 3QPZA 1EYWA 2OO0A 3HMCA 4NRRA 4A05A 1X7IA 4P61A 4JNZA 2XWEA 4C1KA 1VENA 3RCYA 1ADOA 2OLHA 3DYOA 3I7RA 3CEPA 3WMSA 4ZFCA 3TZFA 1B3ZA 2RJHA 3STPA 5REQA 1Q7ZA 3E1F1 5FF4A 4M82A 3CL6A 2X1IA 1E6PA 2UWFA 3QQWA 1ZBKA 3DYMA 4GQGA 1SQ7A 4AD0A 4MADA 4UB9A 1V6UA 1IT0A 4E4PA 4AHPA 2CZVA 5IDIA 1Q6CA 1EP1A 2A7RA 4FHAA 5F4XA 4AEEA 4UNLA 1HXJA 4MZ1A 2F61A 3TONA 1XGZA 3KVMA 1H2JA 3W1LA 1AQMA 2D2GA 3IANA 3H6OA 1EPVA 2VC7A 2D2HA 1OG0A 4A6GA 3MJYA 3TC7A 1K7FA 4TTGA 1DWJM 1J2BA 3OBKA 1XBXA 5FSDC 4E3TA 1JQXA 1YHTA 2ZC8A 3VNKA 2QZRA 3CH0A 3L4TA 2OKTA 1L6SA 3LCFA 3DBNA 3AHXA 3DEQA 3QPYA 2PWDA 3WL1A 4R27A 1R9YA 1C8VA 4J9JA 4PUNA 4C60A 5I07A 1CGTA 2YKKA 2Y70A 1WV2A 3GXMA 2NWSA 3PUDA 1B3OA 1KCZA 2YA2A 1LCOA 1CDGA 3T78A 2OWCA 1BSIA 4QX4A 3H2CA 2R8WA 4C1NA 2OEKA 2J78A 2VC6A 3V1HA 3FY1A 2HISA 1ML1A 1LWHA 3GBDA 4AX7A 1EDGA 4AX6A 2OXNA 3V5CA 1TELA 4Z2LA 3UBPC 3BW3A 3KM8A 1IT7A 3VGDA 1PIGA 4FLOA 3EOLA 3O07A 4MJ2A 1E70M 4DO7A 3QV6A 1Q13A 2R1KA 5A6LA 1EIXA 1U5VA 3NQFA 3AXMA 1DWAM 4FIRA 5FJPA 3UG4A 4GQRA 3AS2A 3W7JA 4R9OA 2H3DA 4P7LA 1ZJAA 1W3IA 3TYZA 1JGMA 1TV3A 4DIAA 1O5KA 2EXOA 3ONBA 3P0XA 3S1VA 3E9AA 3GG7A 1B3WA 2C79A 1H62A 3AXHA 3QY7A 4A8IA 3UXLA 3ITGA 3TVAA 4PMQA 3RLGA 3N25A 3EBVA 1S5MA 2G3JA 1AJZA 3LLDA 3S5ZA 4PMDA 3QQ0A 2EF9A 1SFSA 4XAGA 2GVGA 4LUYA 1KGUA 3HGJA 4UFMA 3UEQA 2J9XA 2NW0A 3OVPA 1E6XM 5BCAA 4Z2GA 4UOQA 1TZ7A 4B15A 4LC6A 3SY8A 2C1GA 2DIEA 3VCRA 3PN8A 1JZ4A 1DYSA 3TNOA 3GZAA 4NZ5A 5D8WA 3GVGA 1AH0A 1ISYA 3NO3A 1CYGA 3L68A 3NDOA 1UR9A 3IVUA 1EHAA 4HK7A 1XIGA 5EBUA 3W29A 1BG9A 2GJLA 3ABOA 3RUBL 2MUCA 3MU7A 3IUDA 4QJ1A 1QPOA 1HGYA 2SFPA 1F6KA 2C0HA 2Q01A 3SAZA 5BXPA 5KSWA 2YYTA 4AU0A 4GXWA 5HUPA 5KITA 4JD4A 3N6HA 3IARA 2QCMA 5I02A 3C0LA 3AALA 2E1DA 4CQ8A 5CGTA 4IQLA 1DWGM 4GNVA 1R3WA 5M1TA 3MP3A 4ZGYA 5CZJA 2WC7A 4WD0A 4NJIA 2JF6A 4YU1A 4G2DA 4DB7A 3M0XA 1JCTA 1P6WA 3U5UA 4ZO7A 4C7GA 4E8GA 1VS1A 2GVYA 1T8QA 2D0GA 4YTSA 4NL1A 2R1NA 4A35A 3VCCA 5A8NA 1EQCA 5IRPA 4B91A 3RLVA 3S1UA 4U5IA 4LS1A 4L9ZA 3SQMA 3KBWA 1ZCCA 4JTEA 1ME8A 3IUIA 4W93A 4PR4A 4GIEA 5CXPA 3VABA 1LLOA 2J8GA 4Q4MA 5I3KA 4PUEA 1B4EA 4FPSA 4Q4PA 4HD5A 5F1UA 3W7MA 2B4GA 3BJFA 1O6IA 2PRMA 4FXFA 3NURA 4O50A 1ZU8A 1ALDA 4L61A 1Q6LA 2PD5A 1G4SA 3BMXA 3HU7A 4I5XA 1MEWA 5CC5A 1VPQA 3UW6A 1HO1A 1OCQA 3W53A 1EJUC 1HJWA 2J66A 4LCRA 5DMYA 1NVMA 2E25A 2ISWA 3W7CA 3BLKA 4HNUA 1NH6A 5EMJA 2GLKA 1VJZA 3LY0A 1HW6A 4GYPC 3ATZA 4JFWA 4LAMA 4U33A 3URAA 4PYSA 4YS1A 1UR1A 5ECVA 3H70A 1CLKA 2DVTA 5HWMA 4DXXA 4HN8A 3EXRA 1V4YA 1R47A 3LRKA 3GVQA 4L1WA 3CV7A 2C16A 4LBUA 1XIIA 4H9VA 2XH2A 3QHOA 1BTMA 3DI0A 4IF2A 3WUBA 5LA0A 1DPMA 3I3BA 4L56A 4JTUA 2ASHA 2Q71A 3ARYA 4QCFA 4PTXA 1GTHA 4IQEA 1XHGA 3AIEA 1JL8A 1YNQA 4PTMA 4J3XA 2PDQA 4DBSA 2JIEA 3GKFA 4HA4A 2ISFA 2W9MA 3N4AA 3PPFA 3QSTA 3W01A 3A21A 3LCWA 3L4ZA 4ZA0A 2WM1A 1G4EA 4ZCWA 5C9WA 4GY1A 3E2RA 4GUJA 1LRTA 1RD6A 5H8PA 3STGA 4FK9A 4GC4A 5EYWA 3MY9A 3R11A 2WMJA 3N15A 3NPUA 1BF2A 4LALA 4N9DA 2Y89A 3C3NA 2QT3A 2PSNA 4JY8A 4YHEA 4IGSA 3SGUA 4GVGA 4JPGA 4GQBA 5DT7A 2TSYA 4WGHA 2QIIA 1EWEA 3I65A 2ZTKA 3G1YA 3IIZA 4IP5A 4WF7A 3PM6A 1IIHA 2B0MA 4A3QA 2NSXA 4ZTXA 2EKGA 5IDZA 4TIMA 1VC4A 1AW2A 4UBPC 5M2FX 3LERA 3UXKA 2WZHA 5E9XA 4I7VA 3H4XA 2IPJA 1R3RA 3NL3A 2CLFA 3M4HA 3WNLA 1OF6A 2C18A 3N2CA 1M3UA 3NM3A 3WFLA 1JDCA 4IJCA 3QYQA 1GYLA 1TJ2A 1J6PA 2LLEA 1PV8A 1A53A 2XGIA 3N2TA 4LVBA 1DWFM 5AHIA 1Q85A 3B0XA 5KEZA 2F9RA 1H7OA 1I1XA 1Q6EA 1XISA 3TJXA 2YL8A 3E0WA 1CB2A 3CUZA 1VYRA 3CNYA 4QJ3B 3OO2A 1TV7A 3CO8A 1B9BA 3P81A 3SCTA 4C6QA 5LGZA 4O4WA 3WF2A 5LZLA 2YPIA 2BHUA 5C7HA 3S9IA 4NNBA 2NUYA 3W3OA 3E74A 2EG6A 4JQ4A 1TIWA 2EKCA 5K9XA 5CSRA 5C0QA 3A3XA 2D3NA 1B31A 2WC4A 3S3GA 5TBOA 2QF7A 5C9RA 2VR2A 3ARZA 2BXYA 1GJWA 4B16A 2ACSA 3PHAA 4QAWA 1GGOA 2NXHA 3IJIA 5AYXA 4P7QA 2IPGA 1UWIA 3H8AA 4LC8A 4LS2A 4LSBA 3MSGA 2FH6A 3WD4A 5BXSA 1XBVA 3WLTA 4Y9AA 5CC6A 3G3MA 3V5OA 4Z1CA 1P5BA 1PYMA 3H23A 1XUZA 2AQWA 4WJEA 4HZ8A 2VVNA 3L66A 1W1VA 3IVTA 4CUCA 2DU2A 5C8BB 3DFPA 4FP1A 1U1UA 3N1AA 2BVYA 3AZSA 3BGAA 4IIEA 4IWWA 4KT2A 3UFYA 1AW5A 3BLFA 3PZNA 4S3GA 4XIMA 4DUVA 3R4IA 3N14A 1VKFA 3FHAA 2W4XA 5J04A 3ATYA 3W1MA 4CQCA 3AS0A 2VI0A 2HNEA 3UVAA 2P3EA 1ZP4A 4O28A 2P53A 5MHBA 2CZ5A 4REQB 3NEVA 4GO8A 3BMWA 4DLFA 4AH7A 3GHTA 5FCZA 3PWAA 4G8TA 4KEZA 2Y2WA 3C8FA 1UA3A 4DAIA 4H04A 1GOWA 1WBHA 3E02A 3HQOA 3SN0A 4C6PA 4NZJA 4Q32A 4A29A 3MMTA 4D6IA 3IK2A 4LW7A 2DGAA 3TDFA 2ZFAA 4DWSD 4F9JA 3TSMA 2D20A 3NEHA 2GK1B 3Q67A 4JS3A 4G5DA 3OQ8A 3SCWA 4W7UA 3HPZA 3QFWA 2V3DA 2XFWA 3K4WA 1CPUA 2DH3A 5FEZA 3VIJA 2FIQA 2D3LA 1YE4A 1Q6GA 3VK5A 4AG0A 3P62A 1UH2A 1J93A 3MUZ1 3TU9A 4GMEA 4OZOA 4H1ZA 1TREA 2GWGA 1HUVA 2QIWA 3CYJA 2I9UA 3M5YA 1LUCA 3TC6A 1OJXA 3MDWA 4QE4A 2ZUTA 3VC6A 2VMFA 3SN4A 1PE1A 3WF0A 2ZZ4A 1VFTA 3WK1A 5D9NA 3LEPA 1PZ0A 3CQKA 3PBGA 1RQHA 4JIPA 5F2LA 4H8NA 3U7VA 2YFNA 3LMZA 4WLCA 3GAKA 2W5FA 4DJEC 3CXOA 1UB3A 3RNDA 3AU6A 3VD9A 1A4MA 2JK2A 1LF1A 2QCDB 2WO5A 4PRTA 1ZBVA 5CPQA 3W27A 4MYAA 1TTJA 5DX7A 3U2CA 4DXKA 1DWIM 1I2NA 4XAZA 3CM4A 4DAFA 3QQ1A 3WEMA 3SCRA 5LNVA 3CWNA 1EO5A 2Y0FA 3Q37A 3S5YA 2ZZ2A 1TPWA 2F6UA 1K6WA 2C7FA 4XSLA 5H2ZA 3NUKA 3KTCA 2VGFA 1VBRA 1RBOB 4Z1YA 3NDZA 1YTEA 1TRIA 4R34A 3M6YA 4W8BA 4AZCA 3APYA 3UA4A 3GFXA 3WMLA 2YDSA 2FHFA 4WDUA 3P2VA 3EWXA 2VWTA 3GNOA 1EZWA 3EA3A 4CCDA 3VMOA 3VGGA 2ZVRA 1E9IA 4HQVA 4AWUA 1TYGA 1S5VA 1LTDA 4K7VA 1E55A 3E3HA 2IPWA 2BY3A 2Z1SA 4H9TA 1W9VA 4HPGA 3THUA 3RU6A 4OBRA 2GVJA 4JYDA 5GJMA 1M6JA 4E2VA 4RDYA 2WV8A 4TV6A 2EJAA 4WX2A 1A5LC 4UR9A 5H6HA 1QO5A 1UP3A 2KAUC 3AS1A 2CNCA 3VNJA 3QXBA 4MG4A 2IKIA 3KVJA 1R85A 2Y8KA 4H4IA 2Z1BA 1L2QA 1PIFA 3CZ8A 4FX6M 3WX7A 4BWLA 3VOJA 5CJMA 1PBGA 3THQA 2DEPA 3GM8A 1KFCA 4Q8MA 4GISA 4B4HA 5CEWA 3SCUA 3Q45A 2PPGA 3M43A 4UQDA 2PCEA 2FZDA 1MRQA 2XH0A 2QMKA 3AJXA 3CUFA 3U2EA 4KGLA 1XXXA 1I8JA 5CGMA 5KINA 1DJXA 5BOFA 1YE6A 2XM2A 1M65A 3WH7A 5A8GA 2Z2BA 3M9YA 4Q8NA 2QCCA 4LH8A 4PCSA 1FWIC 2CLOA 4U10A 1C29A 3VNYA 1HJQA 3EX1A 5JIPA 4GI6A 1K9TA 2IXUA 3BANA 3CASA 4O1FA 1KLZA 3FV9A 3M7SA 2XFFA 3C2YA 1IGSA 3PSWA 2VWSA 1Y5WA 4KWSA 1P0KA 4X0NA 1RY8A 2E8ZA 5IFPA 5FD0A 4E4FA 3ARWA 4YWIA 2CWNA 3UNDA 5KZDA 3S6OA 2XGBA 4Q3MA 5DMMA 3TW7A 1FHDA 2YB1A 4JNMA 1OADA 4D8ZA 3E5BA 5C7VA 3T42A 4PMJA 3QTPA 4DM1A 5C6MA 1OYBA 5HK4A 4M80A 4LBSA 1ZNNA 1VCVA 3KDOA 3PUGA 2WKJA 4J40A 5BMXA 2NQLA 3GXTA 1UW9A 1XIHA 3Q65A 1YMYA 3W4RA 1GVIA 1PPIA 5A8PA 2R14A 3W1PA 2X7WA 4JX6A 1X1OA 3MO7A 5AB3A 1XLEA 3TN4A 3N12A 1NOFA 3S0CA 2PDGA 3LN3A 3CZKA 2ABAA 1FWAC 3B8UA 4W7VA 3VX0A 4R7OA 3PFRA 4XTIA 1G5AA 6XIMA 3S4TA 5G4HC 3VIPA 4Q8VA 1TV4A 1KO0A 4NZCA 3T2PA 3W00A 4UMCA 3FYPA 1MSSA 2V5KA 1TX2A 5E9AA 1FWGC 2AMGA 1G7UA 4A8RA 2R91A 1ME9A 3EEZA 1Y0EA 3EWUA 4PTVA 2RGMA 1YRRA 4WSJA 3NZQA 1I2QA 3LSCA 4GWEA 4NZ3A 1TPDA 1E6SM 1PDZA 2FDMA 4O19A 1H7PA 1XLMA 2WSKA 2YCIX 3HTWA 3RIKA 1F2JA 3M0KA 4LV9A 1WXZA 3LQGA 1B3YA 1NWUA 2OYLA 3B04A 1QNRA 2A3BA 5EMUA 1UHVA 3H2EA 4GFIA 3K8LA 4CN1A 3R13A 5E09A 3W23A 1HKIA 3ABRA 4QROA 5A8QA 4LXFA 5DEZA 5BYWA 4Q6XA 4O10A 1W0MA 4MWAC 1XLFA 1UR0A 1OCBA 3T07A 5HPOA 2VRKA 1MQRA 1LOSA 4S3AA 4H83A 4W8AA 3NQMA 5JU6A 5A6AA 2DT2A 3GW3A 2V63A 4HBKA 4H19A 1WOAA 2YOCA 3DC8A 1B57A 3UXDA 2VFEA 3RJXA 4W9TA 3HB9A 4PEEA 3N3TA 3QHNA 4WXZA 2E09A 1TJ1A 4ZB2A 3WK2A 3VVGA 4H2HA 3UXIA 2JGYA 4O18A 1DJGA 4PEKA 2Q02A 3HO8A 4L7ZA 4JIEA 1OD0A 4IPIA 4GD0A 4CCCA 3F4NA 4FNPA 3OG3A 2IKGA 2R1LA 1PWLA 3CAQA 3MW7A 4L5ZA 1NWTA 1Z69A 1KBKA 3OPSA 3PPGA 2AL2A 2V5LA 4KWVA 1NELA 3N19B 1DJHA 3GR7A 4H41A 3TYBA 3CUHA 4P8WA 2NUXA 3VTRA 3RM4A 3QM3A 4JTAA 1EXPA 2J7BA 2ZDRA 3WD1A 4AZ6A 1SSGA 1X6LA 5E6ZA 4OT7A 2V81A 1RPKA 3NJ3A 5KTLA 1EZ2A 2IW0A 1JPMA 4M3PA 4LANA 1EDTA 3AMLA 5D2WA 3QPEA 3AXXA 1WA3A 3PS7A 1VFFA 4TVUA 1W1YA 4H9YA 2HXUA 3EKGA 1SFLA 4QG9A 5EKYA 1FCQA 1YNPA 3VKKA 4QRNA 4M6QA 1PXGA 1VF8A 4NU7A 1A4LA 1PL9A 1SPQA 4HIBA 2Y6ZA 3AIWA 5AYIA 4C6MA 2HRWA 2ZA3A 3NZPA 2GQ3A 4PN2A 3O6DA 3ITLA 4E38A 4R7JA 4PUWA 3B03A 2NVCA 4G1KA 2YR1A 1RVKA 3TCSA 4BQ4A 3V3WA 2CKSA 4RZ5A 3HM7A 4UQBA 4EXQA 3ZQ9A 4X3ZA 2DSWA 1NIUA 1QHOA 3GQYA 3O0FA 4L80A 2ZC1A 1QJWA 4NUWA 4G1NA 4R5EA 1OY0A 5BWFA 1V3KA 4IX2A 2RAGA 2CLHA 2V2DA 1AUSL 3LGEA 3LBCA 2ISSA 3F2CA 5EY5A 4LUIA 3WQ8A 1UR3M 3QMRA 4DUXA 3WLRA 2VO5A 1QAPA 4CNOA 4PCNA 9XIAA 2WCAA 4AAJA 4S39A 5DLCA 3PSVA 4I9JA 4A3YA 4LYRA 3K46A 5TNVA 4TXEA 3U3HA 2B31A 3KOWA 4YPJA 1SSDA 2DUAA 2YA0A 1FWRA 3GO2A 2E40A 1MYRA 2VR4A 4FX8A 3M5XA 3S6TA 2J7FA 2OCZA 2ZZ3A 4UFLA 4DXVA 2ZRVA 2XUCA 1W8GA 4BQ5A 4IP4A 4YN5A 1EH9A 1DIDA 5M03A 1GYNA 2YX0A 3WLQA 1JUKA 2UY5A 3SRDA 1JR1A 5I5RA 2FLIA 1TE1A 3M41A 3VIGA 1WB0A 4HJFA 1KTCA 2BG5A 5I77A 3JZEA 2H6RA 4CN4A 2A3LA 4PRRA 5HJLA 4EXAA 4KERA 4PCFA 4PCTA 3BG9A 1REQA 1XG3A 3SADA 5BOEA 4S3BA 1YEYA 3G0UA 4FSAA 4LOCA 2E9LA 1TTIA 4NZ4A 1XFBA 3W07A 2E7FA 5GNZA 4GE8A 4IFKA 3E0IA 1AW1A 2O55A 3VOCA 3TMQA 4DI8A 3TR2A 1DV7A 3ZJ7A 1QASA 3QR0A 1FWDC 2VKZG 1R9ZA 1GW9A 2NLYA 2YB4A 1OFBA 4FMVA 4EWJA 4V1XA 1P0BA 1WDSA 2XSBA 2J75A 3TTOA 4GCAA 3UNTA 1EB3A 4L4PA 3D0CA 4V28A 1T5AA 4JIRA 3EPOA 4WIWA 2WJEA 1PHWA 3GC4A 2JFEX 3GFZA 1PKMA 3VZXA 2X40A 3L4VA 2ATMA 4QNEA 1ZCOA 2J8TA 4U2ZA 3VFLA 4ACYA 5BU6A 3QMTA 1Q5MA 2G97A 2GGIA 3CQIA 5GNXA 3WBAA 1UJQA 4DVOA 4B9YA 2PE4A 2REQB 5D2YA 3LDVA 1AQFA 4TX9A 3B4UA 4ECLA 1O66A 1UUMA 3SBFA 2PDJA 4C6FA 3W22A 1NWRA 1JEZA 4POCA 1LUCB 1R7OA 4NJHA 3URQA 3I6TA 2NV2A 3DFNA 1S38A 1TPVA 4UQ9A 4J4KA 3KRUA 2DT0A 1W5NA 4W87A 1BD0A 2NQ9A 4KBXA 2R82A 1AA1B 2TODA 1T41A 3M0MA 2CCRA 3WQ4A 3R1ZA 5E5CA 2PMQA 2OQHA 2NXIA 3OLGA 1QNOA 3UERA 4HJWA 3REQA 1XSJA 2DVXA 1C8QA 3N2BA 4XD4A 3UVIA 1M53A 2Z7GA 1QNSA 4XO6A 4LNCA 3HG2A 4X9YA 1WXJA 1HX0A 2OSXA 4ZMGA 3VNMA 4O13A 3GVWA 3QN3A 3ZWSA 1ZJBA 1Q4WA 2JKPA 3UZ5A 2Z1WA 3O6YX 3OBEA 1PAMA 2J7GA 1MUWA 4E2OA 2ZDSA 1MEHA 3R10A 3NO5A 4I8YA 1W3KA 4Z08A 1AH3A 2A3AA 5EBAA 2YDAA 2X1RA 3EGJA 1VFSA 3T2OA 4GLEA 5D9PA 1A5KC 4JBRA 1BRLB 4Q6JA 3IGXA 3FKKA 3BG5A 5BZAA 1IZJA 2EBNA 1BVZA 4FIQA 3WKZA 4IG2A 3ARSA 1VPXA 3FYYA 1DVJA 1MRAA 3MKVA 4IXHA 2YCEA 3UJRA 4M19A 3IK4A 3KW3A 2X42A 2G41A 5HPCA 3N11A 3OLIA 4ZOBA 3M0YA 3WENA 1O5RA 1XJBA 5C70A 2YCLB 1BKSA 4JTGA 4ACZB 1JXJA 1R3YA 3QGVA 3R94A 4L65A 5EMMA 1QOPA 1UWTA 4JDYA 5CZTA 3O63A 5JMUA 1RD5A 3GXIA 3BE7A 1YADA 1L6YA 1QW7A 2ZWZA 2J47A 5FAGA 1KFJA 1R3SA 3Q4DA 1RCOB 2DP3A 2DIKA 2DUXA 3ZIZA 1PCWA 3WQEA 1UKQA 2JQXA 2OR2A 3THCA 3B9EA 3D46A 2Z2AA 3G77A 3GUWA 1EX5A 3UWQA 2Y7FA 2Z27A 4Z17A 4RE4A 3ZT7A 4AXNA 3BGGA 4LUSB 3TA6A 3GG0A 3DG7A 2DZVA 4ZSUA 4D6EA 5FSEC 4LAKA 3OVQA 4PB3A 3RO8A 4CN6A 3SW6A 3PC0A 1H09A 3WO8A 3TJ4A 3W2JA 1SFJA 3M0LA 1DXFA 2VNCA 4HNTA 4IL0A 2X7VA 1EJRC 2XIIA 2BXVA 1G67A 2DSZA 1QDSA 3A64A 4GKLA 4KWOA 4GNKB 3VKDA 1TMHA 2YBTA 2OKOA 1S1PA 4Q4QA 1LL7A 2DFAA 1V5XA 2VX4A 1Z7AA 1E6NA 4OUEA 1JULA 3WJZA 4UTTC 4Z2JA 4Y96A 3USBA 4OIFA 1K9FA 3E6EA 3TYAA 4K1WA 3W1AA 3FGCA 2OELA 2A3CA 5DN1A 4X60A 3MHUA 3L4YA 2I57A 3M1ZA 4ILSA 4QITA 2HVMA 1LRQA 4BY3A 2E5CA 3L4XA 4Z0JA 4GX9A 4EF8A 2J74A 3IS4A 1FH7A 4BEUA 1QRQA 4PMXA 2GUBA 1U30A 2CKRA 3WLPA 1W3HA 1QHPA 2QAFA 1E1CB 2BV9A 3GH7A 3PTDA 4S3JA 3UWYA 4Z1AA 4L1GA 1KTBA 2X05A 1HFBA 3PJWA 4OWGA 3H2NA 4WSKA 3W9ZA 4J1OA 1CECA 1XIDA 4I5RA 3GXNA 1JPHA 1FP8A 4K38A 5E93A 1JVNA 5DCEA 1I75A 2XVGA 2W62A 4QSFA 5FJIA 3GYEA 4H6KA 4GJIA 4CQDA 5K3VA 4LAZA 3CEUA 3NL5A 3TTSA 1E0UA 3WUGA 3D47A 3RPMA 3GDTA 1QPRA 1RLDA 2CBIA 3LOTA 3C2EA 4JY9A 4RPPA 1P48A 1RHCA 3DFTA 5AC4A 2PTXA 1Z44A 4W8LA 1TV2A 3B4YA 1ZALA 4WVXA 4O15A 1KM5A 1RALA 3ZMRA 4NNAA 3DU0A 3DECA 3W2LA 3CV6A 4ADSA 1WKDA 4JEJA 4A4AA 2J6XA 1C8YA 4YIWA 1R2RA 1C93A 3KFTA 1BWVA 3LTPA 1W5MA 1HNYA 3G0SA 1HVQA 2UZ9A 3THDA 4H00A 3ZR6A 4LNYA 4PL1A 1MMFA 3UR5A 1YXDA 2OSWA 5I06A 1GK8A 3K5XA 1TG7A 4HNCA 4NT0A 1QOQA 1E3ZA 1POKA 3CL8A 2PC8A 3S6DA 3W7DA 4PBFA 3NQDA 3RAOA 3BJSA 5EGRA 3RN6A 2XU2A 3R8HA 3ZLFA 1HKWA 4IJRA 1RVGA 1V6WA 4S2CA 1F3WA 3PBVA 2A6NA 2QV5A 3CV1A 3FEQA 1R9XA 3RK8A 3P7YA 3W87A 2XH7A 3AMKA 3UGRA 4LY8A 2PWFA 2OOFA 3AIQA 2ISDA 1OFPA 3XINA 4CNUA 4Q8PA 1ZENA 8XIAA 4KIEA 3BC9A 1W1TA 4XZ9A 3ZM8A 4DUOA 3LHUA 2WMIB 2CLPA 1FCVA 1HTIA 4DJED 2VD8A 3LCHA 5EFDA 3H12A 3LRMA 4OFCA 4H7ZA 3RJYA 3UQNA 3E5PA 3LRLA 3O06A 2QULA 4DQWA 2ZUVA 3NVDA 4HU8A 4N9CA 4UC5A 3K8KA 3FA3A 4F0SA 1ZGDA 2ACUA 4XD5A 4RK8A 2OZTA 1J12A 3DYPA 3G24A 3FS2A 4AD2A 3KS5A 1D2KA 1JI2A 1SZNA 4XAPA 4JDBA 3IJQA 4GABA 3WD2A 2QF8A 5G2IA 2Y4SA 1R2SA 3BCFA 3N9KA 4QG6A 4IIGA 4I8DA 1T40A 7TIMA 1DTUA 2VUYA 2ZRUA 4JHOA 3B9AA 3RX2A 4MIMA 4MY9A 4NKCA 5K7JA 2CBJA 3II1A 1XLGA 2J7EA 3W81A 3O7UA 3YPIA 1KTNA 4BS0A 5HNRA 3GDRA 2Q8XA 4LCSA 3WH6A 3TW9A 2GYIA 5E1QA 4QJ5B 3WQPA 1SM9A 3EPMA 2Y5JA 4NXSA 5CG7A 1Q2RA 1BYAA 4FNQA 4CVUA 4AIOA 2ZX6A 2CLEA 4ORMA 4EPKA 2XSAA 2E77A 3XISA 2XSXA 3D3AA 4LS0A 3I10A 4LRTA 1UASA 3TIMA 4V1YA 1UP2A 2WSPA 1KBLA 3GC2A 1NARA 3V0TA 2DZXA 1UKSA 5IHSA 4WSHA 2AMXA 3L2MA 2V5BA 2WNWA 2WANA 1G9HA 1AZ2A 4DBWA 2JALA 3DENA 3T08A 2NVAA 4IHCA 1UZHA 1MUCA 3FA4A 4K36A 2W63A 3NGJA 3DHFA 4LB3A 4RE2A 4D72A 4GHRA 4IFOA 2WVSA 2E28A 2UY4A 1JZ5A 2HTMA 1O5XA 3W7KA 4MY8A 1IZCA 4E5TA 3P61A 2A3HA 2A7NA 3EMCA 7REQA 1XG4A 3PUEA 3RLHA 2EPLX 4CQBA 1VIZA 1SW7A 1PVNA 1DIOA 2POTA 3U5YA 4RNFA 4Y9NA 4OE7A 4D6CA 4FR1A 3COTA 4GJJA 3T0AA 1U1JA 3BAXA 2Q3RA 1WE5A 4IFKB 1HIZA 1JFXA 1W3LA 4HPNA 2XHYA 1CGWA 5HMEA 1ADDA 3MWCA 1SJDA 2PTDA 3LUTA 2PU1A 2V5DA 4O0KA 1BYCA 2X30A 1VFHA 3NQCA 4ZENA 5C9XA 3IV3A 3E2SA 2VEKA 1DQXA 3IGSA 3SRFA 2YCJA 1XYZA 1F3XA 2FKPA 3CAKA 4X2RA 3I3EA 4W88A 5IXEA 1G01A 4GFSA 3VDCA 1GZJA 1WO2A 1F61A 2YL6A 2ANUA 1JCXA 1CENA 3G8EA 1YBQB 4E6MA 1GHRA 3LU2A 1VRDA 4MNJA 3AMCA 4K8GA 3GE7A 5BRQA 3QF0A 4XK2A 3C86A 4HU3A 3V16A 3DFHA 1JDAA 1O1ZA 1C3FA 3UG8A 1FWHC 1PWMA 3LBMA 2AKZA 3EWCA 3G1HA 3W84A 1E9LA 3VAVA 4GIYA 5IBXC 3FOKA 2QHAA 1VJSA 2FZNA 3O0KA 5C54A 5HATA 1P0EA 3BPWA 3OU8A 3VDBA 1NDVA 3AU2A 3W1XA 4IMCA 4L4LA 4N9BA 3WLSA 1QK2A 3ICJA 3TH6A 3ITXA 1TUFA 3G2GA 4ADTA 4HK5A 1J96A 4O16A 1LG2A 4DO5A 1KC7A 1VIWA 3NXLA 4QQ3A 3REQB 2E9MA 2I56A 1CTNA 4MWAD 2I14A 5JIWA 1MWOA 2PDYA 3VX1A 1PHQA 3GU1A 1ECEA 4OVXA 4Q8TA 1YPXA 1Y5VA 4NF7A 2VCAA 3RR1A 5E0CA 1KR1A 4K6AA 1W2PA 4QEHA 5CAKA 1EO7A 1VJIA 4O11A 3R5EA 4JHMA 1ZRQA 4GKTA 2Z1VA 2BFGA 4XO7A 2ZE0A 4PTWA 2XFRA 3EOEA 1Q66A 1EDQA 1IIGA 4UIOA 1PDYA 4AQLA 4PMNA 1ZAIA 1H11A 1GKRA 1KLYA 2PC4A 3GFYA 1F05A 1XD1A 4IG2B 2WVTA 3BCJA 1TR9A 4U31A 1UWUA 1L9WA 4J3ZA 3R89A 1O68A 3WK3A 1ODUA 2J88A 1QU4A 3VKCA 4MNMA 2ZE3A 3F4CA 1V79A 1MFUA 1QBAA 2XIBA 3BL3A 3RM8A 3GUGA 4IM4A 5FIPA 1OK6A 2E6AA 5DFAA 4LRSA 3ZR4A 1FDYA 3KRZA 5GVJA 3BO9A 2OT0A 4KEVA 3GU2A 4OECA 1QCWA 3KRSA 5DRIA 1OX5A 4RPQA 4H7CA 4P7OA 3SUUA 2E6YA 5EMYA 4A3HA 3WNMA 1S46A 1M41A 1RA0A 1DE5A 1MNZA 4ALDA 5XIMA 3WMBA 1Z3NA 4UNIA 3HJEA 1D7FA 1Q6OA 4OV4A 3I3DA 2TYSA 5DY3A 2RDWA 1ISXA 2WJFA 4PUUA 4J28A 7ODCA 1OGSA 1HT6A 2GDVA 3APGA 1AZ1A 3KP1A 4WJXA 3B8WA 1EGZA 2WKLA 1OM0A 5DF0A 4RW5A 3E49A 1PTAA 4GG9A 4GQ0A 1ZY9A 5K2ZA 1UG6A 1XI3A 1Q8JA 2NQHA 1UWSA 4D8LA 3P74A 4YVXA 4LQ1A 4YCOA 5GPRA 3LQLA 1RBLA 2FGLA 2QDGA 1YNYA 3RPDA 2WHJA 5CBIA 4AZ5A 3UZWA 1BGAA 2INEA 3GS6A 1TJRA 3AIBA 5HQEA 5C5YA 2V68A 2WZIA 1KKOA 1TFVA 3AISA 4NZ1A 1X1ZA 4DBDA 3W38A 3WJYA 3MYPA 3QGKC 1FQ0A 4Q8QA 3HGRA 1ZPTA 3GY1A 3PP7A 4IUGA 4N4QA 2QAPA 5MKGA 4LT9A 3SJ3A 2VOMA 2AAAA 3CZGA 3H24A 4NAEA 3LTYA 1UWQA 1H5YA 3FGCB 4PSPA 2FB3A 2VTFA 3M7WA 3VGEA 3GH5A 3V35A 3WQVA 3Q58A 4L4OA 2YL5A 4ML4A 4KWUA 3WG6A 1Q2SA 2VOTA 1QPKA 3CV2A 3S8HA 1GOIA 3BW2A 2QUMA 2EQDA 1OC5A 3MZ2A 3EOUA 3KHJA 4DBUA 2VDIA 4DJFD 3JRKA 3QW3A 4XB3A 3H55A 4WKFA 2Z00A 4F40A 1DORA 3MDUA 1RCXB 2ZUSA 2YXOA 2L5HA 2PDXA 3RRXA 3RF9A 5CAHA 4J3TA 5HBFA 4P2VA 1GTEA 3BLDA 4MMWA 1R87A 2BY2A 3GXDA 3SZ8A 1TV8A 2P76A 1H1NA 3C2RA 3RHGA 2W79A 1UR2A 3TQKA 3ONCA 3NA8A 1WBJA 3EAUA 4XG1A 3LB0A 3T7VA 4JGDA 1US3A 2YYUA 4US6A 1CLXA 2QJHA 1FWBC 2X1SA 3VD7A 1X6UA 4AC1X 1AL8A 3LM3A 2ZXQA 2VGGA 2BOGX 3OGRA 2QW5A 1TPC1 3TXZA 4K37A 1ISZA 3CMJA 1GVEA 1E0TA 3BLPX 2XVLA 1FY6A 4XIAA 4JEQA 2YW4A 1CZ1A 4O1AA 5JBDA 1AG1O 4FNSA 3GC5A 1GQNA 1ITUA 3LHYA 3GTHA 5E0FA 3VCNA 3SQSA 2E1WA 5DRCA 5I78A 3ZVHB 4LJ3A 2HJPA 2PU0A 5C71A 5L9FA 5I2UA 1E40A 1X97A 8TIMA 4JFTA 4FZIA 3GG1A 4MLRA 4JHZA 1W6TA 4BF5A 1A50A 5DBTA 4AD4A 2PLKA 5AVHA 3ANUA 3OZMA 4DF1A 1GQIA 2V3GA 4UQEA 4C6JA 1HKMA 3BCDA 3OHIA 3VIIA 2WSQA 4US5D 3IAQA 2HDJA 2PFHA 1A49A 4NNCA 1N2VA 4ZE5A 4FI4A 4MB5A 1OFAA 1OYAA 3KS6A 5LA2A 4AF0A 3LPPA 5HOSA 4YWSA 1QVBA 3VDHA 2XZ9A 3G1RA 2JBMA 1GORA 1P7TB 1QO2A 4E2DA 3OQEA 1J01A 1TA3B 3TNBA 3WCZA 4NVTA 5DCDA 5HXMA 1V0MA 3SGZA 3BV7A 3W1QA 3FN9A 3MHGA 2AGTA 2P8BA 5A6BA 3N4EA 4IMDA 1JCYA 3UP8A 3WH8A 3KOYA 4DEFA 3DG6A 3BTNA 1H7XA 1UD2A 1GVRA 3NCOA 2CEQA 3DGRA 3MKCA 1T7LA 3WIJA 1LM1A 4QE5A 3IPWA 4O8RA 4HMNA 1GZ1A 2JGQA 1IEIA 3RCMA 1K6AA 2PZNA 1NF7A 2R6OA 2GSEA 3L4UA 2BOEX 4DZHA 1BF6A 3CS2A 4HZ7A 1SVDA 1GVFA 1KCLA 4AD5A 1U83A 3GNXA 3OLEA 3S2JA 4CQ9A 5B7YA 1PX4A 1EGMA 4GINA 3WLMA 1IXQA 4S2BA 3P82A 1SW3A 3H21A 3O16A 3C2OA 5CLTA 2XWDA 4WR3A 5FL1A 3AYVA 4JKMA 4F79A 4ZB0A 1E6RA 1VP5A 2CXGA 3POHA 5I0DA 1HQTA 1E4MM 1WXYA 3APTA 4GVHA 2YBUA 3M0VA 3TW6A 5HANA 3TSDA 4XBJA 3GBEA 3AHZA 3B8DA 1D3GA 3CBWA 2WLZA 2YCKX 3NQ8A 4ENLA 4WCJA 2E67A 4OQVA 4LUTA 5BNKA 4Q4RA 2ALDA 4EVZA 4NAFB 1PTGA 2WMFA 1I60A 4J35A 4TMBA 1JQVA 3QY6A 1XX1A 4PGLA 2FZBA 2GQAA 3GTIA 3LZ3A 4A3RA 3M47A 3UZYA 2FVLA 3VUSA 3A13A 2BOFX 1LZOA 3EKZA 1GYMA 4R7WA 5ABGA 2ON3A 4Q8UA 2CLMA 1SU5A 1Q4NX 2QLYA 4TR9A 1XLCA 2WNZA 3SCSA 4IX0A 3AROA 1W5OA 3DZ1A 3IRDA 4D9PA 3AZTA 1XRVA 3TFXA 3BG3A 4RZ6A 1PEZA 3POCA 1Y65A 3OB8A 5M3WA 2OOGA 3NQ7A 2ZOXA 1SR0A 3FVMA 3G0XA 4A2RA 3P5YA 3SUVA 1SO3A 3BAJA 5HR6A 4IT1A 2VC9A 4TUFA 1ZSXA 4AY8A 3FW6A 4WY0F 4RLIA 2PDWA 3A9IA 1JYVA 1I9CB 4PMOA 2VFHA 2IMRA 2CHNA 4JQAA 3MP4A 1C90A 5H1WA 3MI2A 3IV8A 4G7FA 3T05A 3CC1A 4O12A 3GXPA 2G3IA 2WCSA 5AC5A 4J2MA 4I9MA 2QJMA 4ONVA 3SCVA 5AN7A 4TQTA 4DJFA 1E4LA 4KPLA 1FWWA 4JIQA 1SGJA 2ZX7A 1RP8A 5JUVA 4TTUA 5CQ1A 1BXCA 3PB2A 1FTXA 3IACA 1D8WA 2HMCA 3VD4A 4TVDA 4XKMA 1E5NA 3HF3A 4A3UA 1FHUA 1VCFA 4RJEA 4B5SA 1M7JA 2RDUA 4BF9A 4CEUC 3MWAA 2FHBA 1Q65A 4JR5A 3P14A 2VUNA 3QLDA 2NZLA 3LHZA 3PBWA 2HBXA 3I7QA 1UJPA 1UPPA 3PNUA 5AHEA 2WHKA 3B9DA 2WQPA 1TCMA 1C8XA 2C1HA 1V51A 2WKGA 1WUFA 3AICA 4Z2KA 5ABHA 4WEVX 2J7CA 1ZLPA 4UTHA 5G1MA 2C1IA 1QI3A 3HPXA 5H91A 1N82A 3WBXA 3W74A 1FFRA 3OYXA 2ZRWA 3L23A 1VFUA 1XGEA 1V08A 4LYKA 3A4JA 3B05A 2OLAA 4YHGA 1C9WA 2E5BA 3AYRA 3TYUA 4HPHA 4LF2A 2Z1KA 2Y7EA 2Y5SA 5I24A 4UFJA 2A1YA 3ZT5A 3CPGA 1AK5A 1DQWA 3QRHA 4AEOA 3ITCA 2TRSA 2WWDA 5GNYA 4XD3A 4IZGA 3OA5A 2GQ9A 3B97A 2DIJA 2QUTA 2NV1A 3DC0A 3WF1A 1WX0A 3W1RA 3QVQA 2EGZA 2EPKX 3ALFA 4LV4A 2PP1A 4JIIX 5JQ9A 4GYKA 2ZZ6A 3C2FA 2WNQA 3W7EA 4US5A 2OTDA 3TAKA 1DKWA 4QS6A 3UG3A 3NGFA 4JCLA 3FJLA 3UWZA 4NQ1A 4LF1A 1ODZA 3SSJA 1A5BA 3C3UA 2ZRZA 4WHBA 3IJ8A 1BFNA 2V3EA 3A4AA 4DJDD 4XVDA 4GZ7A 3IJDA 4NJKA 4F0HA 4ZXOA 1V6YA 1KV5A 5K9DA 1Q6FA 4EXBA 2YGYA 1JUBA 1SYTA 1I0DA 3ENLA 2I9EA 5CPLA 1DJWA 2PWUA 1TKKA 1EJ7L 1QBBA 4PBGA 5M5DA 2RFGA 1FOBA 2WVVA 4Q33A 3UG5A 4GVIA 2D22A 1DHPA 1IQ8A 5J5RA 1GJPA 3EWYA 3LCXA 1CCWB 1H49A 4KRTA 3L65A 2RGLA 3GKAA 3TC3A