2XU2A

Crystal structure of the hypothetical protein pa4511 from pseudomonas aeruginosa
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
241
structure length
241
Chain Sequence
RILLNCDMGESFGAWRMGDDVHSMPLVDQANLACGFHAGDPLTMRRAVELAVRHGVSIGAHPAYPDLSGFGRRSLACSAEEVHAMVLYQIGALDAFCRSLGTQVAYVKPHGALYNDLVGDDELLRAVLDACAAYRKGLPLMVLALADNGRELELADEADVPLLFEAFADRAYLPDGRLAPRRLGGAVHHDPQRIIEQALAIARGEAFPDYDGNPLRLTADSLCVHGDNPQSLAVLRRLRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords UPF0271 PROTEIN PA4511
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 86
structure length 241
sequence length 241
ec nomenclature ec 3.5.2.9: 5-oxoprolinase (ATP-hydrolyzing).
pdb deposition date 2010-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03746 LamB_YcsF LamB/YcsF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 2xu2A00
2XU2A 4L1GA 1W1B1 1W1A1 2E67A 4V33A 3CL7A 2Y8UA 4NZ3A 1W17A 4F9DA 4NYYA 4NYUA 4M1BA 3HFTA 2DFAA 2C71A 2VYOA 2C79A 2NLYA 2W3ZA 1V6TA 3WX7A 3S6OA 1XW8A 2I5IA 4NZ1A 4HD5A 3CL8A 1Z7AA 4OUIA 5JMUA 5BU6A 4F9JA 2C1IA 4WCJA 1NY1A 2C1GA 4NZ4A 3CL6A 2J13A 3RXZA 3VUSA 4U10A 2IW0A 2CC0A 2QV5A 4NY2A 4NZ5A 4LY4A 3QBUA
chains in the Genus database with same CATH superfamily
4UTLA 2G3NA 5EFDA 4ERAA 1JDCA 2EG6A 4B4FA 1OYBA 1DQXA 2GWGA 2VR4A 4I90A 3KOZA 4C1NB 5A94A 1EJ7L 2V38A 3WELA 1PZ2A 3CZLA 4D6JA 3CMJA 4DBUA 2FPVA 1D8CA 3P93A 3M0YA 4GO8A 3GM8A 3VFLA 3VGEA 2NXGA 4JFVA 2YCKX 4M1BA 4AD5A 5D2VA 4E8CA 1C93A 2FFIA 2ZDRA 5BOOA 1U5JA 3ZVIA 4ECLA 4GZEA 2EPNA 1YX1A 4QSHA 1QWGA 3PBMA 4IT1A 2VDGA 4PCNA 1V5XA 1Y5VA 3A12A 4EPKA 3E9AA 3OZMA 4JN7A 3VGBA 3B8WA 1HIZA 2NLYA 4K6AA 3LZ3A 3BGJA 2PGFA 1BSIA 6TIMA 3OA3A 2XVPA 1UKTA 3TV8A 1XICA 3PJWA 1QNOA 5AVNA 1ME8A 4S3EA 1OZQA 2VEIA 2GGIA 2E1DA 2J7EA 2J88A 2R1NA 5CC7A 4DUVA 4BCEA 1Z42A 2YCEA 2VCAA 2BHYA 3LBOA 5I09A 5LYRA 3W76A 4GUGA 3WY1A 3VKKA 1XG4A 2XIMA 3WUBA 1A5SA 4WR3A 3GVVA 5BOEA 1EHAA 4KRUA 2HPMA 1K6WA 3WLKX 3MKVA 4ORIA 3K1DA 2O0TA 2B0MA 3QFEA 3TQKA 2WPBA 2W61A 3LBMA 4CU7A 2ZRZA 4NNAA 4DJDC 1UWAA 4U2YA 2Y7DA 3HPAA 3LYEA 2X1RA 1AK5A 5AC4A 3AHZA 4B5VA 3VKJA 5HPOA 1UMYA 2OX1A 1XKYA 4NIRA 5D37A 1OZMA 4NYUA 1BGAA 4DM2A 3LXCA 1VH7A 3G1AA 1E73M 3AZSA 3A3XA 3NQVA 1KM4A 4IF2A 4POCA 5HNRA 2BVDA 3NTYA 3QRHA 3YPIA 3IIVA 4NJKA 1Z3NA 1KXVA 5M1TA 4GBUA 3XINA 2E28A 3WNMA 4DIAA 3ARPA 4LTSA 1IXQA 1ZBWA 2Q6ZA 1O68A 3BLFA 2IS7A 4CEUC 4Q7IA 3MKKA 3WD4A 5IFPA 4M7TA 5M3WA 4RNJA 3QPEA 2V82A 3KRZA 3W7LA 1HF6A 1J5TA 5K4ZA 4NX5A 3PULA 2PWHA 4AQLA 5A69A 3AYVA 2OOFA 2JALA 3E02A 4KS0A 3V0TA 5A8QA 2YW4A 4BY3A 3DG7A 4J1OA 4D6GA 3TEVA 3GC5A 1GJPA 3UG5A 3WK0A 1TR1A 2W79A 3QPZA 1X39A 1IZJA 1ZQ5A 4WCJA 4AIBA 1EYEA 3TYEA 4J7RA 1LQAA 1GTHA 2DUZA 4NAFB 1EHNA 3AMCA 4QQ3A 1DBTA 3A9IA 3CQHA 1I1XA 1M01A 3MHFA 3M0VA 1MXDA 2RDXA 1P0KA 2YDSA 4HSNA 1SSGA 4KRTA 1JXJA 4Q3MA 3G3MA 4JTFA 2P8CA 5D04C 3OGVA 4JKMA 4AMAA 2OKTA 1OCNA 3AWOA 4LF1A 2X41A 4RDVA 2DGAA 1TPC1 1H1YA 3V16A 2ZXDA 3ARUA 4HJWA 3SDOA 1TYGA 1BFNA 1I2QA 2NX3A 4UFMA 2RFGA 2J78A 5LKYA 3B3DA 5CAKA 1P6BA 3HF3A 2PZ0A 3CNYA 3QH2A 1VEMA 2B7QA 3B8DA 4LGXA 3MQTA 1YXCA 3NYZA 4QBXA 4HYRA 4JIQA 3W86A 3W1TA 1VRXA 3CWOX 1A3WA 1G69A 4Y7EA 3N3MA 4JTQA 1MW3A 3QR3A 3M64A 4M6QA 2ONEA 2H9AB 4PSRA 2REQA 2YLLA 5FJTA 1VRDA 4GE8A 2AGTA 1TWWA 2I9EA 3V5OA 5C9XA 1E9ZB 1R8LA 4JEQA 3S6DA 3DERA 3PUEA 1ME7A 3BTNA 1GVOA 4M19A 1EXBA 2RAGA 1UPPA 1FWSA 4LUYA 3WUFA 1QNQA 5CC5A 5TD4A 4JL2A 3BAWA 4UCGA 3ABXA 3GHTA 3SADA 1QAPA 1U1JA 1GQJA 4IGNA 2J9ZA 3M5YA 1OM0A 1VAHA 3C0QA 5CQ1A 1KXTA 3E0VA 5D9OA 3SCUA 3WJWA 3LTYA 1Q13A 1X1ZA 2KX9A 2VR5A 1E4LA 4JTJA 3BLOA 2QZRA 3QQWA 4DB7A 1EQCA 4BQ5A 1TJPA 3Q4DA 4O12A 2WHMA 1ZLPA 3USZA 3GTFA 4KCWA 2I1OA 1AFSA 3OBKA 2VVNA 4FR1A 5I77A 2X2GA 5D32A 2XM1A 4K68A 1A0DA 3J7HA 5CZKA 2NSOA 2F6UA 1A5CA 4NSBA 4UTHA 2IKIA 2G96A 1FRBA 4LAUA 3KXQA 1RALA 3CZKA 4FXSA 2XSBA 4L80A 3UCCA 4U3CA 5F2IA 1DJQA 3CZJA 4UTWC 4NT0A 3SY8A 4A2SA 3CUHA 2YL5A 1G6CA 1JCMP 4LYKA 3ZT6A 1T7LA 3M0ZA 1ICQA 3PZVA 5BRPA 4DJDA 2WNZA 3TMQA 4CD7A 5AVHA 1EP1A 3R0UA 4GFIA 3RCMA 3P6LA 4ZSTA 4ZO6A 1QNRA 4K1WA 3KEHA 3KRBA 3MWAA 1SR9A 4KH2A 2NX1A 5M2FX 3BLIA 8XIAA 1JAEA 3VNLA 4C1KA 4QDWA 3F5KA 4F2BA 3NQCA 3W7EA 4NP7A 1V79A 4J27A 1JDEA 3NDOA 3TC6A 5DELA 1JYNA 5DCDA 1ZP3A 4M82A 3GYEA 3NAVA 1FWWA 4X60A 4XV0A 1TO3A 4OBRA 1KM3A 3OB8A 4N9DA 3DHPA 3GNRA 4KERA 4HMDA 4EKJA 5AC6A 4GA8A 3M07A 1SYTA 1WOAA 2PD9A 3A5FA 4RE0A 1HUVA 1O60A 5LNRA 3PZ9A 3QC3A 1MEIA 1C8QA 4IQJA 3LI0A 3KOXA 2XM2A 1F8IA 2FH6A 5DRIA 5G4HC 1RJQA 5HAOA 5AHMA 1IR2A 2WV8A 1U33A 4C6LA 1NVMA 2O55A 3OQ8A 1NF0A 1E6QM 3D5HA 3ZT5A 4AG0A 2DSZA 8TIMA 1W1TA 3BW4A 2R8WA 4S39A 4L64A 3BZGA 3ZSTA 2ZCGA 3EWCA 5I2UA 3S8HA 2R14A 5HMEA 2A3LA 1PIGA 3MT1A 3AUOA 4MWAA 4B3LA 1M6JA 1U30A 1B3ZA 1GOMA 1VFTA 3UNTA 2B7NA 3LBCA 3RIKA 1KRAC 4L1WA 3KHDA 3N14A 4DO4A 2WM1A 3F2DA 2B7PA 1CYGA 3SY5A 3CQJA 2WW5A 1M7JA 2Z2AA 4R5EA 3K46A 3MYPA 1MZRA 1RXOB 3E2VA 4PCFA 3KP1A 3WLTA 3QKZA 1EQPA 1XGDA 3E1F1 3W24A 1Z7AA 4W86A 3H2AA 2BP1A 3SBFA 4GNJA 4NZ4A 1T40A 3L0KA 4FLQA 5T8GA 1GOQA 2YXOA 3LERA 1GOWA 1QHOA 3DFHA 4W93A 2R1LA 2J8FA 4NJJA 5D38A 1DJIA 1GW1A 1ALDA 3VD3A 4AY7A 4XO6A 3PAJA 4O57A 1RJRA 4JXCA 4NJGA 2CC0A 3WEZA 4DZIA 5C70A 5A5WA 1MYRA 3CL7A 1WXYA 4LBRA 1SUXA 1ZZMA 1S1PA 3KVJA 4IPLA 5E93A 3W53A 5D2YA 4L61A 3KCOA 1K8ZA 3W7RA 1R0MA 3I68A 2QCHA 2G4FA 3W37A 4C6MA 3C52A 3ZJKA 2DY3A 1AJ2A 4JNYA 3H2OA 3TFXA 3G1DA 2C19A 2VC5A 3MHGA 3EOOA 1NQ6A 3GU1A 3BGGA 3C0JA 5I06A 3UR5A 2WO5A 4NUWA 3K2GA 1PKMA 3L4VA 1Z9AA 2OTDA 5BU6A 1TZ7A 3JVAA 2J8GA 3R12A 2OU4A 1AH4A 4FX7A 4O1AA 3DHDA 4NI3A 3UJ2A 3HZ3A 4IP7A 4M0XA 1UD2A 2JKEA 4IH3A 3A22A 2QDDA 3FKKA 3O9NA 3MHUA 4HU0A 3IJIA 4Z2GA 3W07A 3B0PA 2ZA1A 4L9XA 5HNNA 2BDQA 3T0AA 1LDCA 4UTWA 2J4GA 4LY4A 2FB3A 1HL9A 1FCVA 4YCOA 4IIEA 4H9XA 3NNTA 1R3SA 4F4RA 1PHWA 3M43A 2GJRA 3GY1A 3VCRA 4JTAA 2NQ5A 1JGMA 1REQA 5BCAA 2P0IA 3BW3A 1Q3NA 5A2AA 5C55A 1KXHA 2QULA 3MC5A 4G1KA 4KIRA 5PTDA 3ZT7A 1JJKA 2P53A 4FXRA 2P76A 1W1YA 3W7DA 1ZAHA 3VMOA 4IX2A 3W7KA 1PYMA 4MKSA 1RHCA 3NOEA 3VCCA 1F6KA 4JEJA 1ITQA 3EX1A 3B0VC 1NDZA 1QWKA 1BHGA 3W75A 4ICMA 1IR1A 1U83A 1H0GA 1QK2A 3KBJA 2DZBA 5CSRA 1F3TA 4LXFA 1TCDA 2A5HA 4QIUA 3VDBA 3ABOA 4G6CA 3GQYA 4LU0A 4BEQA 3IJ6A 3AU2A 4AZBA 5JXQA 4I9MA 3OEXA 4H7VA 4MY1A 3ZIZA 4WKFA 1YXDA 2V5CA 4O28A 1IWPA 3EDFA 1EO5A 3RRXA 3F2CA 4DXKA 2G95A 1XYLA 3ARQA 4GQ0A 3RR1A 3QQ0A 1ZL1A 4TU1A 3GHUA 3OW1A 4CD5A 2VL4A 4A05A 3PFRA 1YBQB 4RXFA 4US5D 4DJED 3QHNA 1KFBA 3EDDA 1LLZA 3IVUA 3T0CA 3VZXA 5C9WA 1DWJM 2OT0A 2NQHA 4X9YA 3WKZA 1WE5A 1QW9A 2YSWA 3GX9A 5CPOA 3GYCA 3QF0A 3N73A 1CXFA 5FOOA 1W3NA 1WX0A 2PD5A 2WMIB 3LNPA 1W1A1 1B3XA 1AODA 4QRNA 2FFCA 2KZHA 3EA1A 1GGOA 4ZOEA 2V6AA 3B0YA 3SN1A 2ISWA 3SCPA 4JTHA 2HQAA 1JDAA 4QG8A 1UR1A 1ADOA 4HCDA 4DI8A 2VP8A 1AZ1A 1JD9A 1JEZA 1S5MA 1ECQA 4S3BA 1Q4NX 1E6RA 3KVLA 3QGVA 4C5YA 5D8ZA 2A3AA 3QOKA 5JH2A 1NP0A 5HPCA 3VABA 4Z1DA 4B5SA 1W3LA 3HTWA 4CN1A 2ZUUA 4L56A 4OGZA 4JS3A 3L12A 1UD3A 1K7XA 5CSUA 2BHUA 3QY6A 1PIIA 4IIGA 1HO1A 2WJDA 4C6PA 3U0HA 5LA1A 1VFUA 3AXIA 3D46A 1WP6A 1VKFA 4JTGA 3M0IA 1TV3A 1KGWA 1SFLA 3LPGA 3U4FA 2ISFA 2VZUA 3Q58A 4XD4A 4GGHA 3UERA 1ZTVA 2HWGA 3IGHX 1KLYA 1XLLA 4UZSA 2WK2A 3W2JA 1XRTA 2FTWA 2GVGA 2DV0A 3WF2A 4PB3A 4NF7A 4YYFA 3V5FA 1GVQA 4X22A 1NQKA 4UFIA 3T2QA 1ONXA 3N2CA 3HQNA 3STGA 1GORA 1YDOA 5D9NA 2E7FA 1ISZA 3WYZA 4Z1YA 3LSCA 4HPJA 4FX8A 3VDAA 3ZOAA 2UWFA 3KZSA 1FDZA 2GJXA 4GKLA 3FOKA 3E0LA 3TSBA 3UY8A 3S42A 1EIXA 4AF0B 3OIXA 5HMDA 2YB1A 2DEPA 1YTKA 3W27A 4OHQA 2Y62A 3QR1A 2C14A 4XZ9A 3AISA 3A23A 4CNNA 4PTDA 4JIPA 2R82A 5IDIA 3SUSA 3N1AA 3UJEA 1ZY9A 2I56A 3AMLA 1YPIA 1L2QA 5G1YA 1W5OA 3T4WA 1JZ2A 4DHGA 1KLZA 4A8RA 4DJEC 4GJIA 2V5BA 2FZMA 5FF0A 5H8MA 1HFBA 3CYVA 2F8QA 2J25A 3DI1A 5F4WA 3ZVHB 4W7VA 5FAGA 1OSEA 3R4IA 1W6TA 1W9DM 3CHEA 3GFZA 2PGRA 4FLSA 4F0KA 3GH5A 2Z2UA 4W7UA 5A2CA 4DUOA 2XISA 1K4HA 2WQPA 1Y5WA 1PZ0A 2CHRA 2P1FA 4MDOA 3WDHA 5HQMA 2BX7A 3P67A 4K1GA 3ZR4A 1L6GA 1W5QA 1JZ7A 3WLPA 1XG3A 2ZZ6A 3WENA 2DSUA 4A8IA 1J18A 1BKSA 3MUCA 4NZ5A 4H6QA 1TPEA 1JCYA 1O95A 1XYAA 5GQBA 4JKKA 2GVEA 2PU0A 3DOPA 2QCEA 3CWHA 3QHMA 3HU7A 3GNNA 2BMBA 1UD6A 3W7PA 4QCFA 1TTPA 5A8OA 4OUEA 3UQNA 3W4RA 1HO4A 1BEUA 5G4WA 2BNJA 2GYIA 4B15A 4JYDA 2AL2A 3TKFA 3CPGA 1THFD 5CC3A 4O14A 5E1QA 1IE7C 4XVEA 3GXIA 2DORA 5CPTA 4CN6A 2FPYA 2ZWZA 5DO8A 1DQUA 1GOIA 4D6IA 4K8GA 3W7MA 1YNPA 1XH1A 4CQCA 1F6YA 4Q33A 3KVKA 1LWHA 3M4HA 3PP7A 2E40A 1UR2A 3DECA 1JFHA 4D71A 3OVRA 4LY8A 3MSYA 2F2HA 1W9XA 2WVTA 1G7UA 1Q8JA 3A47A 4ZCWA 3W1XA 1RLDA 2PS2A 5E70A 2FZ8A 4NG3A 1PZ1A 3VD4A 4Q6JA 1U5VA 1E4IA 1TX2A 3W7QA 4JTUA 4D6DA 2G50A 3T8QA 1FY6A 4GZJA 3UXIA 4KF1A 1RPXA 3GBDA 3CZEA 1O5XA 2EF9A 2H6RA 1IIGA 3M0KA 4JNZA 1DIEA 7PTDA 4E6MA 1PX3A 2WM0A 1DJHA 4X2PA 2AQVA 1GG1A 3ABRA 3HG5A 3CTLA 1D2KA 3RPMA 3W1PA 3WQDA 3H23A 5D2WA 1B3YA 4ACZB 5GJMA 3UWYA 3VIJA 4E8GA 4JTSA 1SW0A 3BLLA 3L4UA 4AY1A 2QCDA 1KRCC 2OO0A 1EB3A 4PZVA 1R9ZA 5TNVA 4UUIA 2BVTA 1WOBA 3BARA 4AVFA 3S2JA 1OYCA 2H8ZA 4GXMA 4INFA 1GQKA 2JKPA 1EC7A 1R2SA 2TODA 5JBEA 2OZ0A 4GGBA 3WH6A 1BYDA 2BOGX 3EAUA 3WG6A 3M7SA 1XRSA 3M44A 4IUGA 1WKYA 3FDGA 2C15A 1SZEA 1VR6A 4G1NA 3C2VA 4B5UA 4WDUA 3VM7A 3TONA 1DWGM 1ZENA 4C91A 3DEQA 2Z7GA 3MP3A 2TYSA 3I65A 3NO5A 1JPMA 3TYZA 3URQA 1RBLA 5G1TA 3LD5A 2ISVA 2Y24A 3W1NA 2VCBA 4W5UA 2HDJA 4AZIA 3KTXA 3W29A 2WPGA 4QAWA 1KKOA 1FWRA 4O10A 1BLIA 4D9PA 1AMYA 3APYA 2EXOA 1Q4WA 2ZTJA 4MG4A 1IT7A 2CLLA 3FSTA 4M1RA 4WGHA 4XSMA 3NQEA 5JU6A 2JKAA 5DMLA 4RLIA 2VHLA 5J5DA 3H54A 3LTPA 3QZEA 3M0MA 3I3EA 1EWDA 2NZLA 2XGZA 2VDIA 4H01A 4U3AA 4W88A 1G4SA 3RNDA 4DJEA 3NO3A 1FFQA 1OK6A 1H41A 3VKCA 2PTDA 1R7AA 4DM1A 5G5IA 2XN2A 4FIQA 1DYSA 1YE4A 4ICNA 3V7PA 1W9VA 3AC0A 1YQ2A 4AFYA 2VM8A 2P50A 3CO8A 7TIMA 4PSPA 2JGQA 3RJXA 3AS0A 3B97A 3W00A 3T09A 2YJQA 1C8YA 1JDFA 2BVYA 1FWAC 1KGXA 4ZO8A 1R2RA 2YKKA 1UZ4A 4DXVA 5LXEA 3CAWA 3MMWA 5LHFA 2F38A 2FHCA 3NM1A 4ALDA 5C9RA 1R2TA 1Q6EA 2PDUA 1EP2A 4U5KA 4GYPC 2ZUSA 1GOXA 2IUZA 2WSPA 4RDYA 2PTXA 4G7EA 3I6TA 2YL8A 1Z41A 3EMQA 3GFYA 3WUEA 3M5ZA 1H50A 4IG2B 3EBVA 1GVYA 1J0YA 1XLHA 4CCZA 1G1YA 3VIFA 4OWGA 3IIOA 7TAAA 2VDHA 3TC3A 4E2OA 4A21A 3E2QA 4IMEA 1E51A 3IJQA 3HMCA 4QP0A 3UG3A 3NQ6A 3NQDA 5B7YA 4KGJA 2O9RA 4DEFA 4PTMA 2PDBA 4IPJA 3C2FA 1O6IA 4HJFA 4TV5A 3HIJA 1UW9A 3TJLA 4D1IA 3DENA 1QW7A 3SUWA 4DN1A 3U4AA 1E5JA 7A3HA 2OX4A 1UASA 3DIPA 2TMDA 3K5XA 4F79A 1S5NA 2QLYA 4Q4QA 4I6KA 1OT1A 3UP8A 1XLGA 3CUIA 4PL2A 3P84A 3LLXA 3TWAA 3CMFA 3UZ5A 3SY1A 3VIKA 4RZ4A 1BKHA 2OG9A 4IFKB 3ZQ9A 1K4GA 1XYZA 3KBNA 1PCWA 4WRHA 1YNYA 3T78A 7ODCA 1OFDA 4QG6A 3PPHA 4JX6A 4FEZA 2CZVA 1KWGA 2G97A 1VLIA 4OIFA 1MQPA 3LNMA 2QPUA 5GVJA 3C5QA 3W2KA 3WN6A 2BLEA 3EKGA 1IQ8A 5A8PA 3JZUA 5EMMA 3VPLA 4WZHA 3CASA 4ZGYA 1P48A 1L6SA 1J79A 2G3MA 3UXKA 4P8XA 2V30A 3T42A 3ES8A 4WOZA 5DMMA 3JU2A 1RH9A 4N9EA 3RO8A 4LAOA 1JGIA 1PTGA 4IQDA 2HJPA 3VNMA 4ROPA 1X1OA 3ITYA 1IGWA 2X1SA 3M7WA 4H8HA 2VT0A 1ZAJA 2BY0A 3ERPA 2GQ9A 3BMXA 2PLJA 3S2MA 2VOMA 1EPVA 1XSJA 4ROQA 1XP3A 2Y5EA 3RF9A 1OF8A 1RSCA 2FZBA 1UUOA 5AHEA 1DJWA 1HJWA 1KWKA 2YBTA 3WQOA 2NVDA 2HSAA 5G1MA 4IJCA 1H7RA 1R9YA 4AEFA 2DUAA 2ZYFA 4FO4A 3MZ2A 1HL8A 3KVMA 4P7NA 3A9BA 1B4EA 2GUUA 3PBVA 5K7JA 4LRSA 4MAVA 5CG7A 3ZWTA 1SZRA 4F40A 2GSEA 1Q85A 3BL3A 3ORWA 2DSKA 3FNDA 4MJMA 4FXJA 4UWMA 1DWHM 4IL0A 3F5LA 1D7FA 2DFAA 1JIBA 3N4AA 3GR4A 5A95A 1JZ6A 4GOAA 3W25A 4CQBA 2NUXA 1EJXC 4IMDA 2J66A 2C1IA 1KCKA 3QLDA 4AIUA 4QNEA 5FCZA 3II1A 4HK6A 3B8TA 1F9CA 4CGTA 4PCPA 2GDUA 5I23A 1KO0A 1VFMA 4I9JA 1PCKA 3PZIA 2Y7GA 5ENLA 2GDQA 2W67A 3DFQA 3MSRA 2OGJA 2TRSA 1EX1A 3CQKA 3VZZA 4AAJA 4J28A 1GEQA 2INEA 2RHGA 1NOWA 2PP0A 3E38A 4BHYA 2W27A 2QHAA 4IGMA 2E5CA 4CU8A 3CUXA 2DT3A 1EL3A 5GNZA 1I2NA 4O0KA 3R8RA 2DPEA 2GGHA 1UR8A 4B5WA 1EH9A 3KBVA 2FTYA 3E0WA 3PBGA 3Q37A 2VZSA 3OTRA 4JY8A 4OBTA 2VR2A 1ONRA 4XZNX 4Z0JA 1GW9A 1D3HA 3GTHA 5LHEA 4GK8A 3WF3A 2HMCA 1YKWA 3GIYA 1R3RA 3W7NA 3CO4A 4XZMX 1HP4A 1QXLA 2CETA 3NQ7A 1ZU8A 3MDWA 4D72A 1J6PA 5JUVA 1P43A 4A3HA 3G2GA 4HGXA 3WSUA 4J3SA 1RUSA 2JF7A 3A64A 5FSDC 2YLAA 1QR7A 3KM8A 3DYOA 2XG9A 2PDQA 4S3JA 1UQYA 1BPLB 4Q6XA 4HNLA 5M03A 3E0IA 4AHPA 4UQBA 3WLMA 1AG1O 3M16A 4DJFA 3VNIA 1UUQA 1FWHC 2WWCA 4E2VA 4JIHA 4WUIA 4CQ8A 3LG3A 3QYQA 3JS3A 4XZHA 4C90A 3AMDA 3NJ3A 4Q8PA 4UOQA 1DE6A 4JDBA 5FEZA 2RGLA 1NAL1 2QUVA 4MSSA 4C6DA 1FWEC 3KBSA 5GJNA 4JX5A 2CHNA 1FHVA 1WB0A 2EG7A 6A3HA 3BPWA 3GB6A 2CLOA 3W2LA 3FN9A 1V3JA 1XLAA 4L6HA 3UNDA 3WH5A 4XBKA 1J0HA 6XIAA 5A8GA 3GIQA 2VO5A 3FA5A 3MI2A 3NOYA 4Z1AA 3H21A 3D3FA 4PBFA 4JX4A 1E0VA 4FALA 4WJ8A 1N8FA 4TIMA 3PZQA 1VPYA 3B9NA 1VEOA 4LVAA 3HBLA 2EAWA 2VEMA 3KTSA 4H9YA 4MY8A 2VJXA 3SQLA 1WKFA 2ZFAA 1BYAA 1JRBA 3JW7A 2XVKA 4A35A 2FJKA 1TVLA 4JBRA 1TUXA 4AIOA 1VQTA 1XLBA 5D09A 1N2VA 3L7RA 2Q02A 1W56A 4FP1A 1TV2A 3GVGA 3CT2A 3O05A 3FEMA 4MM1A 1P7TA 1T5AA 1VC4A 1QPNA 4ZFCA 5DCBA 1OX4B 1SPQA 3S5OA 5HWMA 2NT0A 2IPFA 2X0HA 3SM0A 1E6XM 3WBWA 1LL7A 5C71A 3NCOA 4BFAA 2ABAA 3P7YA 4AEOA 3UCDA 3NQFA 3IRSA 2DT0A 2VWTA 5I3IA 1YIXA 3WK2A 4YJ5A 2YBUA 5EGRA 1FWTA 1T6MA 1Q6CA 4XZWA 4C6NA 4H6RA 4RE2A 3KOWA 4IX0A 1UH2A 4NXSA 3PNZA 2WOQA 4GI9A 3CTTA 1N8IA 3NYDA 1OF6A 3CL8A 1FWDC 1FCUA 1H1ZA 1F76A 4G9PA 1XDLA 1UOKA 1R3QA 4KEVA 3SCQA 4IFOA 3LMYA 1A5LC 5FF2A 1G0CA 2HCVA 3LCGA 3SZ8A 3OO2A 1SQ7A 3MO7A 4UQ9A 1T99A 2ANUA 3D3AA 3WO8A 3BCFA 3IK4A 2VGGA 1TUFA 3C61A 4GYFA 1F05A 1NDWA 3DU0A 3NVTA 3ME3A 3LRKA 3CQ0A 3ITTA 3N9KA 4KPLA 1QNVA 2P88A 2FMOA 5TBOA 3DAQA 4FNTA 1P0NA 4Q8QA 5DFAA 3DFYA 3OBEA 1S5WA 1IXNA 1QW8A 3F2BA 2WSKA 2V5DA 1N7KA 2XTKA 3S1VA 1MW1A 4PUMA 4HA1A 3DFSA 1AH0A 4H8UA 1MW2A 3CH0A 4A29A 2YXXA 3MV01 5C9UA 3WK3A 4Q7NA 4JIRA 3SJ3A 3CM4A 2O9TA 3VNZA 1YYAA 3FDKA 3TJIA 3ZR6A 4AUBA 1ISYA 5C2XA 3GXDA 4XAYA 4E2BA 1JQVA 2OSWA 4PBEA 2AL1A 1Q6LA 4FSAA 4FR6A 2SFPA 2ICSA 4EIVA 4R7WA 1XYMA 4UR9A 4XD5A 4GUJA 2PWVA 3GDRA 5CXPA 4LEQA 4JDYA 3TOPA 3N4EA 4HNCA 3W7CA 2ZRXA 1X8FA 3B40A 1RP8A 4ZQNA 1TWSA 3B4YA 3WL0A 4W9TA 2AQOA 3FFSA 4NJIA 4PN2A 2X7WA 3CHDA 3W1AA 3P5ZA 4GX9A 4L1XA 1XUUA 3EGJA 5EMLA 3L66A 1W1ZA 1XD0A 3P82A 4M6VA 2VQTA 1PKYA 5HWJA 4P8WA 3PJXA 1E0TA 1F4AA 3N11A 4AZCB 2V3GA 4GNKB 4AVNA 5ABFA 1DKWA 1W91A 3AXXA 1SW7A 3UWZA 2Q09A 2CLIA 3Q94A 2NUWA 2GUYA 5CBJA 4WSJA 1LWJA 4URIA 3MI3A 2MNRA 5AC8A 2A3BA 3CV1A 4XO7A 3H24A 4KFPA 4GQRA 2F2KA 2GK1B 3PB0A 3IARA 2YL9A 3R6IA 5FF4A 1QPRA 1GVEA 1WDDA 1W3IA 3UFYA 3K4WA 3TN3A 3KWSA 4IUOA 3LI1A 2Y88A 5HANA 2A6NA 3OLIA 3VFCA 1U1UA 3N2BA 1OIFA 3S83A 3ZJ7A 1DIDA 3EDJA 5IHRA 3N2TA 3VVGA 1O1HA 2UY3A 2H90A 4ZXLA 5IBXC 3N9RA 5F4SA 4X61A 4AZ5A 3AI0A 4TQTA 3FHQA 3WH7A 4LAKA 1DP0A 5EBUA 4HMCA 1QT1A 3OU8A 3UXDA 3BJTA 2MUCA 3PSVA 4MWAE 4GVHA 3LHVA 5HOSA 3E3HA 1K9DA 2VYOA 3UT0A 2ZX6A 3QZ6A 3WQWA 1S2CA 1OC5A 2E3ZA 4HZMA 5REQA 4D6HA 1QI4A 1QATA 4MIMA 4JGDA 1XH2A 4RZ6A 3WD3A 3WJXA 4KETA 2XINA 3LPPA 4WY0F 3KL5A 4AC7C 1PSCA 3NPXA 4UMAA 1CLXA 5CZ0A 1UZHA 3TR2A 3H2EA 3BK0A 1CLVA 2XGBA 4RKAA 4KIEA 3V4BA 2W92A 4LOCA 5DEZA 4P7LA 2CZFA 4ZTXA 3H4WA 5DT7A 1QCWA 4IJRA 3MP5A 4M3PA 1MMFA 3UY7A 4K37A 2ATSA 5LNUA 3PFMA 2X0YA 2J7BA 1ZJIA 1I6NA 4HP5A 3V1HA 4Y90A 2L5HA 1DQWA 3HPZA 2ZXAA 1A5MC 3QN3A 2D2GA 5CPLA 3W2MA 3DN5A 3VINA 1U1HA 1OCJA 3LHYA 1FFRA 2E09A 2FZNA 2QCFA 4UNIA 4N6EA 1V93A 3Q45A 2V67A 1JYWA 1M68A 2QMKA 2NLIA 4XZLX 3TZNA 3AS1A 2ISSA 2BSLA 2VFIA 3QSRA 3GFXA 1XL9A 1KCXA 2XUCA 4FXFA 4FZIA 2ZWYA 1R38A 3ATZA 1W3JA 1XIGA 2E9MA 5KETA 2VC6A 3UG8A 1HL2A 1J8VA 2G4JA 1XLMA 3VGFA 4YTQA 4HNVA 4LAZA 3LXAA 1OCBA 2DVXA 1ISXA 1HGYA 4IIBA 5JVLA 4TMBA 2X8RA 2POZA 2PLCA 3L2MA 5HNUA 3VIIA 4GVFA 4HMEA 3L23A 3WDPP 4JTTA 4AU0A 3R11A 1XSKA 5EMYA 3H7VA 3DXIA 3A4XA 1L0PA 2D73A 4DY1A 1NFPA 1KKRA 5A6BA 4OV9A 1OFQA 1IWAA 3CV7A 3ES7A 1R87A 1H63A 1B5TA 3NVDA 3S6OA 4BF7A 3ISIX 1Q8AA 1OGBA 4PEEA 4BZYA 4DBWA 2CLEA 2ZC8A 3DESA 3NQGA 4BI5A 1NTHA 2B4GA 3AOFA 2C6QA 1BVWA 3PZNA 5HATA 3S1UA 4Q8UA 4YVVA 4QROA 1PZ3A 5FAJA 2CIPA 5HMFA 3WF4A 5LIYX 4ML9A 2V2HA 3R2GA 2HBVA 4JICA 3FGCB 1VPQA 3CXOA 3L0NA 3T55A 2IQTA 1OYAA 3TAKA 1QK0A 1ZBCA 3PY2A 2PLMA 1KGUA 2XYLA 3R58A 3BVJA 2QJMA 3W7JA 3OA5A 2GPTA 5AZ0A 4GH3A 4GC4A 4DBDA 1GOKA 4LCQA 3ARZA 3R0DA 2XHYA 3B9EA 4ICCX 4H9ZA 1XLFA 4R88A 5ABGA 2AQWA 2ZKMX 4Q8TA 2OLSA 3NXLA 4JTRA 4DVOA 1I2PA 1FH8A 4JKLA 3PWAA 4LUSB 4UTFA 1FP8A 6REQB 4GPNA 3RCYA 3GR8A 3WNPA 3RLUA 4QEEA 3HG2A 2WQDA 2AMGA 4GVIA 3KAOA 4NAFA 3WFLA 2C18A 2PA6A 1OFEA 3IGXA 1TWDA 1RQEA 1QNSA 3P8IA 5DN1A 1TKKA 3D6NA 3QVQA 4PB4A 5G2IA 3QW4B 2XN0A 5A6TC 2O9PA 1XCWA 4DRSA 2DZVA 4XBJA 3SCSA 1H7PA 2V5JA 4GY1A 4O15A 4IMGA 3W28A 5XIMA 2GOUA 2ADAA 3AHXA 2CW6A 4MNJA 4N02A 3GC2A 4MJ2A 2A3CA 4RDWA 3W9ZA 1VS1A 1V6XA 5H8UA 4DO6A 3VDHA 1SFTA 3HG3A 3I7SA 4KEUA 4HVXA 3DG3A 2ZDSA 4KCTA 1CT5A 2E8YA 4D6EA 2PTZA 3O6CA 1D3CA 1MEHA 1EEPA 4L6DA 1R3WA 1NWRA 2H9AA 4CEXC 1E40A 1KV5A 4DPPA 3VZYA 3SUUA 3S5NA 3TYAA 4OQVA 1JAKA 2CKRA 1DTNA 3NPUA 4TO8A 1UKOA 1TQJA 1LRQA 1LQ0A 5AN7A 5FI8A 1PTDA 1HJVA 2ZADA 3V36A 2RGMA 4JTIA 4LVDA 3NA8A 1WUFA 1I0BA 4U2ZA 1E0UA 1N55A 1VJIA 1ISWA 4GUIA 1CIUA 4OVXA 1E6ZA 4Q32A 3GIPA 2P0OA 3VOHA 3S4TA 3XISA 1I75A 3R25A 1J0JA 4LCSA 5A3HA 4J3UA 3AUJA 3BG9A 3CEUA 2A7RA 2XN1A 3MVIA 1PTAA 3TYDA 4UIOA 4PB5A 1NU5A 3GG0A 1K7FA 2Y8UA 4RW3A 3FHAA 3GDBA 3P2VA 3THDA 4F8XA 1L2UA 4Z2LA 2Y8VA 4MOZA 5E0KA 5TQLA 1VB9A 5EL1A 5FEXA 3UPBA 2FGLA 3LLDA 4N2YA 3UA3A 3G3DA 3DCPA 1XC6A 3RM4A 3VIHA 2YOCA 2BZNA 3GKAA 1C7SA 3UW6A 4EXAA 4I5RA 1K1DA 3TXVA 2VNCA 3ANYA 4JCLA 2FVMA 2BODX 3EKLA 4MJ4A 1KV8A 1B90A 3K30A 1UH4A 3KDOA 4O1EA 3S6TA 4CKQA 3SSZA 4AHQA 2YYUA 3VKDA 2Z1WA 2A79A 1HN1A 4CUCA 4F9DA 1R7OA 4HU3A 4JTKA 3PPCA 5DQPA 3U5UA 4JTCA 3WLOA 4CD6A 2VZTA 1A3HA 4RE3A 1BWKA 5HXMA 3ZJ6A 3BAYA 2A2IA 1XRVA 3G22A 4IP5A 2QDGA 3CLMA 3S9YA 4I9AA 4HSOA 3NDZA 3U2CA 3AYRA 3QXBA 4YU1A 4UFKA 3K8KA 3EWXA 1IXOA 1WZLA 2HVOA 4KW2A 1MQRA 4LX4A 1VPXA 2VRJA 3RPTA 3L67A 3V0SA 4H6EA 2I5GA 2XIJA 1V6YA 3LGDA 4DQWA 4OT7A 1FHUA 3T2PA 4ASTA 3WMBA 3ONBA 1K8CA 3DKJA 5I3KA 4MLRA 3BWWA 2WHJA 4K8HA 3R8HA 1UA3A 3DYMA 1R3YA 2WZHA 3OYZA 3W74A 2JBMA 5LSMA 2DZSA 3N2XA 2C8NA 1UZ1A 4XSLA 2J9XA 1EA9C 2ESCA 4K8EA 4QLLA 2CLHA 2PZNA 3CC1A 2VD9A 2J24A 1BXBA 2PAJA 2RDUA 3V1PA 1KNWA 3W72A 1JUEA 5BMWA 1IEIA 1CGUA 5AYIA 5LGZA 3HB9A 3CQIA 2D24A 1H2JA 1OABA 1RQBA 2QIIA 1GJUA 5CJNA 2UY5A 3WQ8A 2QUMA 2Y2WA 3DZ1A 2XSXA 4JYEA 2Q3OA 2ZOXA 2CLKA 3P81A 1UP2A 1UWSA 4IL2A 4PMVA 4Q8WA 2PWDA 1CXKA 3P61A 4FB7A 2G0WA 2XVNA 1GKRA 3BUVA 1ZAIA 4GISA 4MF4A 1I2OA 2FHFA 1QDSA 1Z89A 1EGMA 2DIEA 1MFUA 1ONEA 4YWSA 1PUDA 5AB3A 1JDDA 1QBAA 2FHBA 1MXSA 3NSNA 5HR6A 1KRMA 4OECA 3TSDA 4OKDA 1RA5A 1LCOA 3CGTA 2DSWA 2GVJA 2OZ8A 4KMQA 4HNTA 5DBTA 2OT1A 3LM3A 4ZVJA 1YHTA 3SIMA 1UBPC 1QI3A 1ZNNA 2IXUA 3LV6A 1W17A 2WMKA 4P2VA 2YR1A 5DF0A 4GMEA 1B9BA 3LQGA 4IIDA 1OG6A 4O54A 2TPSA 1PEZA 4LBSA 5LIWX 1KQYA 2Q71A 2QYGA 4LT9A 1BG9A 2GJXB 1P6WA 4C60A 2PRHA 4O53A 3ARRA 3QJAA 1B9ZA 1CXHA 1ZB5A 3G6MA 3W6MA 3NZRA 4CU6A 1VLWA 1JD7A 3USBA 5KZEA 3AS2A 1ZJHA 2GVYA 4D8LA 3MSGA 2EBNA 4K36A 3N3TA 3K8LA 4BF5A 3UGRA 2PRLA 1F61A 4GJJA 5I24A 3QR0A 3VNJA 3N9SA 3LCIA 3EB4A 3SCVA 3FAWA 2PDPA 3FYYA 3O0KA 5HA7A 3HGOA 3S2LA 3PN8A 4B9YA 4ADSA 2X16A 1QMLA 4Y9PA 3R94A 3G6LA 1S46A 2ZIDA 5IM51 3KTCA 2CZEA 4DWSB 4KWOA 5FJRA 3NFUA 2YPIA 2C3ZA 3QGAC 3PPGA 2DSVA 3L2IA 3WLHA 3FJ4A 1TA3B 3UVIA 2PB1A 2ZRUA 2OQLA 2PF0A 5JH1A 2A0NA 3F1QA 3N19B 2HTMA 1FQ0A 3G0UA 2J79A 5HBFA 3QZAA 1KXQA 2J7CA 4EX4A 3QW3A 5I02A 2R94A 4FLRA 3WEMA 3SIZA 1QPKA 2GVLA 3NGFA 4I5XA 4I9TA 1C92A 3E74A 2DVTA 4LS0A 5A6AA 3LENA 3PS7A 1W5MA 1KFKA 3MUXA 1A5AA 4QR6A 2XGIA 4DUXA 3DHUA 2DH2A 4A3RA 5HWNA 3DHFA 1XDJA 1JF5A 4XUYA 4WHBA 1NDVA 3C2EA 4P7RA 3L5LA 1OD0A 3GUGA 1ZBKA 1OADA 1O66A 1DXIA 1EEXA 1YDVA 4ATDA 1QI5A 1Q2SA 3K13A 2X42A 5LNSA 1VZWA 2FIQA 4TX9A 4CNSA 1QPOA 4FPSA 1TJ0A 3ARWA 5F7UA 1XW8A 3QTGA 1TJRA 3QMRA 1M7OA 1H1NA 4N4QA 5C6MA 3THAA 4GI4A 1JZ4A 1EBHA 2EPMX 2IKJA 1VBJA 1EWEA 1A4LA 4LUTB 5C5YA 2QVHA 3SFWA 4AEEA 4Z0SA 5EKYA 2CPUA 3H6OA 1NOUA 3FJNA 1Q66A 4NXKA 4ERGA 1UR3M 3AICA 2VQUA 4WJXA 2EEXA 2Z1XA 1YBQA 2BB0A 2XVGA 1CI1A 3TTYA 4BQ3A 4YLWA 3TLLA 3RJYA 3RM9A 3VAVA 5FESA 3SCNA 1UWIA 5H91A 3E2RA 1E6PA 4WDWA 2DH3A 3PF3A 2NWSA 3G18A 1V0NA 1O94A 3PHAA 3LUTA 4JYFA 8CGTA 2WMIA 8RUCA 4JFTA 1IEQA 1JI2A 5FJIA 3GTNA 2OZTA 1EPXA 1P0DA 1V6WA 1XUZA 4RNFA 4AZGA 3LCHA 1HG3A 3GG7A 4ZZ9A 1NF7A 1XV8A 3G8RA 3DC0A 1EDGA 1O4UA 3KX6A 4MZ8A 2YZ5A 4UNLA 1VYRA 4F9JA 4QE4A 3GVRA 3M0HA 3NQ2A 3ARXA 4ZOBA 4TOQA 1RPKA 2ZZ3A 5I3JA 2X40A 1UH3A 1YADA 3H70A 3ITVA 2D22A 1EZ2A 3U8GA 3TQPA 1I9CB 1JRCA 2DUXA 2VGIA 4B3KA 1LUCB 3BAIA 4AD4A 3PUDA 4WLCA 1C8VA 1M7XA 2WLZA 3BG3A 1YMYA 3UZXA 6CGTA 4UTMA 3CPUA 1W0MA 2ACUA 2A1YA 2CLPA 1WDWA 1RCXB 4J3TA 3BW2A 1YDYA 3NWRA 4DZ5A 5EMKA 4N4PA 4PH6A 3RM8A 1CXEA 2PP3A 2AKZA 4ADUA 2XSAA 1GQNA 2NWRA 3RGTA 2BTMA 1BGGA 3ALGA 1W31A 2BXYA 3TYCA 1V3KA 2VX4A 4LV9A 3WL1A 5CBBA 1UC4A 3IIZA 1VFFA 2PDHA 3DX5A 2PLKA 1E1FA 4V15A 2QJIA 3F4WA 5CSSA 1UMLA 3KL0A 4G7FA 1BWLA 2YA0A 2NX9A 4Y6GA 5K9CA 4AF0A 2I7GA 4NZ1A 4UQAA 1GK8A 4IFRA 1KA9F 4TVDA 3M9YA 3ITCA 4C6BA 3VOJA 2DJXA 1XIIA 3RDKA 2OMAA 3GWQA 3HQ1A 2PWGA 4KKXA 1I2RA 3H4XA 2CERA 4LVGA 3WX7A 4I7WA 3HQOA 4HPNA 3G1YA 4PMJA 4PC8A 4RNIA 4AXKA 1EXPA 4A22A 4F2UA 3VK5A 2JGYA 3ZVHA 2YCJA 3IJ9A 1I1WA 3M46A 2DVUA 4B91A 1S39A 4GUHA 4E5TA 1GVIA 1UIOA 3H26A 1NOFA 3CIVA 3ITLA 4XUGA 1TX0A 5EMJA 2V0TA 3BJSA 1KM6A 3W87A 2B81A 3GXTA 5DXYA 3E2SA 2HRWA 4MKVA 5CZTA 4YCPA 1EJSC 4AHOA 1DJZA 2Y7FA 4UXDA 3L21A 3HV9A 4Z1CA 2WANA 3FSUA 3NSMA 3PG9A 2ZA2A 3DFTA 1EC8A 1ZSXA 3CV6A 2EPOA 1MI3A 1KM1A 3RO6A 3VNYA 5I03A 4H8VA 3C0LA 3N34A 1FWFC 1UB3A 2YXGA 2NVCA 3ATYA 4XB3A 4AD0A 1GUVA 5BROA 4QE5A 5D2TA 4O0QA 1SJCA 2ZC1A 1EYWA 1NP2A 4TX6A 1TIMA 2J7GA 1J9YA 3HPFA 5AC5A 2VGBA 4ZSUA 4J3WA 4GIAA 4LYRA 3FXYA 1ME9A 4JPGA 3A6OA 1TSIA 4Y9MA 4IPIA 1BG4A 4AC1X 1DORA 5C54A 3R5EA 4HCLA 3O1NA 4PBGA 4NZJA 2GUBA 2V3DA 3BO9A 4ZB0A 4JHMA 2PDGA 1S2TA 4XD3A 3AWNA 4WX2A 3WJSA 2UBPC 3QLLA 4DYKA 2BY3A 3CBWA 3HO8A 1EJVC 1OGSA 4RCXA 1TE6A 3I7QA 4GCXA 4B5TA 3OVQA 4PR4A 4GBDA 3G8EA 1XI3A 1ODZA 3TW6A 4AWTA 1IT8A 1TTJA 1DEDA 4LRTA 2E5BA 1JYVA 4KQNA 1KM5A 5G2HA 1E15A 4M5PA 1GOOA 1SGJA 4CVWA 1FWJC 1WCGA 2LLEA 5AC7A 3W26A 2HK0A 4ACZA 4ZB2A 3RUBL 1VCGA 1XGZA 5F2MA 3THCA 3LGGA 1QUMA 1GPWA 3GD6A 3ANUA 3INPA 3QPYA 3TDFA 1TV4A 2VRKA 4E3VA 1GKQA 4YPJA 1GZJA 5T9BG 1XIEA 5AKQA 3LA4A 1XIBA 3TTQA 1IEXA 3EXSA 2PBGA 4AX6A 3B8VA 5BWFA 3O16A 4HPHA 3NQ8A 4EF9A 3L9CA 5CGQA 3W01A 2EHHA 3TCSA 2V8ZA 4C6QA 3PVFA 4BQ2A 3LMZA 2ALDA 3THUA 1RP9A 4S3AA 3BLKA 3SQSA 3TSMA 4HZ7A 4WVXA 1F8MA 2A7NA 3ANVA 3VKAA 3T0DA 2VURA 1KC7A 4C7DA 4YN5A 1P4CA 4PRRA 3WUGA 4Z1BA 3BZJA 1EC9A 4KFOA 4GIRA 1FWCC 3CHFA 5FA5A 4J3VA 2P8BA 4F0HA 4U28A 2Z26A 4WKAA 4YS1A 4NJHA 2WVUA 3VTRA 3P60A 5DBUA 5M17A 4MADA 5FSEC 4M80A 3ITOA 3A4JA 4QLKA 3S9ZA 1KCZA 1GZ1A 1TG7A 4IXHA 4PMXA 2X1TA 3I10A 3AIQA 4GVGA 2E8ZA 3VO0A 2PDFA 1A47A 1S2VA 3IWPA 1Y7VA 4CQDA 1DIOA 3FEQA 2X7VA 1JPDX 3O3RA 2WVVB 3O0FA 3NM3A 3KLLA 3P74A 3UCQA 2FZ9A 2R1PA 4J4KA 4RPPA 4M56A 2FPTA 1L8PA 2JE8A 5B7ZA 3TNBA 4TTUA 2QJNA 1AW1A 4DLFA 5EMUA 4YTRA 5JBFA 3PJUA 3NG3A 4JL1A 4ZQPA 1J11A 5E6ZA 3VX0A 3EPNA 4KESA 4V1XA 1V3IA 3EXRA 1BF2A 1UG6A 1FCQA 5E9AA 2DZWA 3G77A 4BKNA 1BVNP 3RLHA 5LXXA 2WJZA 4I6VA 1T96A 5IDZA 1YDNA 5FKYA 3DBNA 3VYLA 5BW6A 3S5ZA 4IG2A 5DY2A 4BJHA 1TMHA 3FYPA 4I7UA 1FHDA 4OV4A 3PB2A 2A3HA 3TJXA 1IXPA 4LSBA 4GI8A 3SRHA 4ERIA 1D8WA 2FLIA 2CWXA 2PWUA 1DV7A 1BWVA 2HE5A 3RFAA 4WDTA 4LB3A 4HMNA 2QXWA 2YA1A 1LQ2A 2YCLB 1F2JA 1OG0A 1YRRA 5F1UA 3WQPA 4A3YA 4WF7A 5T91A 1XBYA 1XDMA 2EKGA 2IPJA 1I45A 2X05A 1ZRQA 5I3GA 1SU5A 1HVXA 4H1ZA 4X0VA 5C7HA 4IOTA 1J10A 1PO9A 7XIMA 1W2PA 1HKJA 1PIFA 3PJTA 1NEYA 4LPCA 5BNKA 4PODA 1LJYA 4ZFMA 1KTBA 4MFEA 1DJXA 2CBUA 3B0XA 5D33A 1S1RA 2V63A 3H7UA 5G2WA 1RA0A 4IFKA 1WKDA 3T9PA 4A8LA 5L9FA 2Y70A 1OFPA 1Y5XA 1XQLA 3TX9A 3HM7A 4QDMA 1J6OA 5KZDA 1PJ9A 2I9UA 4G8TA 2Z1KA 4HNOA 3VOFA 2GZXA 4UOZA 1GQIA 2CWNA 1HTIA 2D0FA 3CLWA 3OQEA 5JIWA 2XDFA 3G1RA 4QLJA 4FLOA 1IGSA 5D2XA 1G01A 2YW3A 3FY1A 3H8AA 3LCLA 4O11A 1K9EA 4WK9A 2HROA 5HJXA 3NPWA 1AVAA 3LHUA 1WXJA 4G2DA 2Y1HA 5EPDA 4OUIA 2E0PA 1W9UA 1XR2A 4L4LA 1ESWA 4D8ZA 4CD4A 4XAZA 3DUGA 3CZGA 4B5NA 3FCPA 1AL7A 1L8NA 3BCJA 3TH6A 1AL8A 1WUEA 4MZ1A 1WZMA 1SW3A 1K70A 1BRLA 3WMLA 2YDAA 3LDVA 1MEWA 2C1HA 3N6JA 1EGZA 2G8ZA 3U2ZA 2F7FA 2A4AA 3GXPA 4R3UA 1N8WA 1VFSA 3K4DA 3C0SA 1E0XA 3PUGA 4X2RA 1KTNA 1QBBA 4PMRA 4GIEA 5C0QA 2PDNA 3L0GA 2WB5A 3HN3A 2G41A 1M65A 1G9HA 2JEQA 4ZXOA 2UY2A 1HW6A 3LX9A 1E1EA 3CB8A 4TUFA 1GYMA 3W7HA 1SR0A 2FMNA 3OPSA 4JQ4A 3OIHA 2WLYA 2UV8G 3SCWA 1MXGA 3HA1A 3MDUA 3WJZA 1K9TA 4WKHA 1GKPA 1Q5MA 3IGSA 3VGHA 1W1PA 1OC6A 3KBMA 4UTJA 4B5XA 1HJQA 4ZO9A 3Q2DA 3W6YA 4YYCA 4FF7A 3MMUA 1VBGA 1CNVA 5A6JA 4AY8A 1CENA 3B04A 2POTA 3MSDA 3NGJA 1V6TA 3UXAA 1Q2RA 2PDMA 5KTLA 4FOJA 3GG8A 1M53A 4W8BA 3IVTA 3W1RA 2ALRA 4O4VA 3PBWA 3DGRA 1W5NA 9XIAA 2ZZ7A 3SECA 2NSXA 5LNVA 1WA3A 2OJPA 1Q7ZA 1QTWA 1P6CA 2HXUA 3ITGA 4LVBA 3P5YA 1XLCA 2DW6A 2ZZ2A 4ZL1A 4GHRA 1BYBA 1XQKA 2EPKX 3LB0A 1H7OA 4WXZA 1ZBVA 4EWND 1O12A 4GQQA 2E77A 4AB4A 5ABHA 3RU6A 3DC8A 3RLGA 2DZUA 3GHSA 3PR2A 2J9YA 2PDYA 2B7OA 3DFNA 3CT7A 2OSXA 3UZYA 5I07A 3K8MA 3VMPA 3WNNA 4AIEA 1JXKA 1H60A 3M47A 3SGZA 1XLKA 2VFDA 4E4FA 2TAAA 1XXXA 2XIIA 4S2BA 5IXEA 2G37A 3STPA 1M04A 4ZO7A 4IM4A 4B2DD 4LANA 2DZPA 3B8IA 5TAOA 1VF8A 5MKGB 3PWIA 3W1QA 2WC7A 3UJRA 1V6UA 3FW6A 3IJ7A 4OOUA 1EFZA 2GLKA 4EE9A 1GEHA 3BSHA 1CWYA 3TTEA 1T41A 3STFA 5F2LA 4ZMGA 3TNOA 3C3UA 1UWQA 2Q3RA 3BH4A 1O5RA 4HQVA 2V2CA 3T0TA 3IPWA 2OEKA 2FQIA 2YFNA 4U5IA 4LVFA 3RN6A 2PDWA 3URNA 5A8NA 2QJJA 4X9SA 1CB2A 1J2WA 4XVDA 5SWUA 1R46A 1XF0A 1S5VA 7REQB 1NSJA 4L7ZA 2R24A 1VHNA 1M3UA 2WC3A 4ZBCA 2OWXA 1UKQA 4R9OA 2GJLA 4LYPA 3ZO9A 1OVDA 1TVPA 2OWCA 5DT5A 3CV2A 1DXEA 3KWXA 3VC6A 4KEMA 2YBVA 3GLCA 3FYOA 2IKHA 1W32A 4JFWA 3WNOA 1C9DA 1VFOA 4TV6A 1A53A 3AYSA 3REQB 3V0UA 3D47A 3EMZA 4Q4RA 1W8GA 1LOSA 3H2MA 4WDXA 1ISVA 4ADTA 3E12A 3CK5A 1SO6A 3O63A 1JR1A 5D8WA 3FJLA 2XU2A 5DANA 1F73A 3AIUA 4QFUA 3CIXA 1VFLA 1OC7A 3ARVA 3IVSA 4HN8A 1X6UA 4TXEA 1LROA 3VU2A 1O5QA 1OX4A 3TC7A 1QPQA 2C0HA 4YVXA 3WBYA 3HMJG 3O07A 1X97A 1XIMA 4MNKA 1OFBA 4GH1A 3KZPA 2DQWA 3SAZA 1X7IA 4LB4A 1EKOA 1LOLA 4UBPC 4FS9A 1LT8A 3NZGA 3FAXA 4RV3A 1TPDA 4R53A 4W87A 3WNLA 1MW0A 4PULA 4GFSA 4J9JA 3GDMA 4K2SA 4Y9NA 2OYLA 3AS3A 4BK9A 3TWBA 5B80A 1DVJA 2QPSA 4JIEA 3CS2A 1S3TC 4ZE5A 3O06A 5K2ZA 4DYEA 1S2AA 4DNHA 4GO9A 3F4VA 3QV7A 4FNUA 5HMSA 2DZXA 4C1LA 1UC5A 3UWEA 4NRRA 3T40A 5JQ9A 2IQDA 3B0UX 1TWZA 2V69A 2D2HA 5CLTA 2HPIA 2PDLA 1G7VA 3ZMRA 1GWJA 3CWNA 4J2PA 3WCZA 4FNSA 4UNKA 4MWAD 5HQEA 3VI2A 1LF1A 4WIWA 1LORA 1W3TA 1LZOA 1YW1A 3M0XA 3KRUA 3IRDA 1UJPA 3R13A 2BWGA 3LHTA 1CGYA 3A3WA 1D7KA 4R85A 1QRQA 5H8PA 1ZGDA 3HJZA 3VA8A 3WMSA 4S38A 2ASHA 2WKJA 3AIBA 3OLDA 3TA9A 4E4PA 3H12A 4DWDA 1V4YA 4XKYB 2OODA 1AQ0A 2OQHA 3W7IA 1ICSA 3TQ0A 2CBJA 2WNNA 5A8MA 2QDEA 2WMHA 3WNKA 1VBHA 1ITUA 1P0BA 1QI0A 4LCRA 1PDYA 3GW3A 4M81A 3LHZA 4K39A 2E25A 2PTWA 1FUYA 3MJYA 4L4OA 4MZYA 4IQLA 2YIHA 3EYPA 4I3GA 2O9OA 4MMWA 4XK2A 3BAJA 1KB3A 4LS1A 5FJPA 2VD8A 2VX6A 3VNKA 1B4KA 3BQ5A 4US5A 3PK7A 1XX1A 4S3CA 4C6CA 2J75A 1JUKA 1CGWA 2IXVA 2PUZA 1E70M 2Y8KA 3UWVA 2J47A 4WY0B 3COTA 4NZ3A 1WPCA 3HG4A 4PMYA 4H6KA 3EMCA 4IGHA 4GC3A 5G4EA 2ZVRA 3QY7A 3VD9A 4IWWA 2CITA 2VGFA 3LU2A 4B9ZA 3KLKA 4J3XA 5DRCA 3POHA 3SO7A 4X63A 2CBVA 3C56A 4PGLA 2OWWA 2QDHA 1TR9A 3S1WA 1BXCA 5E9XA 2DP3A 2GJPA 2GQAA 2VMFA 4AZCA 4XG1A 2BHZA 4B90A 1QU4A 4FIRA 4CN4A 3UETA 4REQB 1OFRA 4Q4PA 4HU8A 1PKLA 3UXLA 1UD8A 3GNPA 2W62A 4F48A 3EWWA 2J74A 4MLJA 1TELA 2VC7A 2XFYA 1CXLA 1V6VA 4F3HA 3TVAA 1L6YA 3F5JA 3HJEA 4LUJA 2V68A 3B9OA 2CZ5A 3D0CA 4MB1A 2GK1A 4MHBA 3MU7A 3THQA 4NAEB 1SVDA 2X09A 3O6DA 2Y89A 1BAGA 1K77A 1KR0A 4PA8A 2ZZ5A 1DHKA 2EPLX 5CJ5A 4MWAC 2D0GA 1OT2A 1GQLA 1EIBA 1ZPTA 1Y8BA 3OGRA 4IGSA 4ZR8A 4DO5A 1H3GA 4DF0A 2QIWA 3QKEA 1B30A 3RX2A 1V8EA 1BQGA 3AHYA 2PI6A 2O7SA 3WBXA 4YTTA 2JIEA 3FVDA 3RLVA 3PTQA 1J0KA 4BI7A 4W5ZA 5MF5A 1P5BA 2VUNA 3G1VA 5D30A 3VE7A 1E9IA 1LBMA 2WAGA 3SQMA 1TPVA 3DFPA 1JVNA 4O52A 1WAWA 2VOTA 5BRQA 3IUHA 3IIXA 4B2DA 1XYCA 2UZ9A 1FWGC 4GXWA 2VI0A 5A6LA 1TPFA 3AALA 5A6SA 4QQUA 4O8AA 3GAYA 2BV9A 5CGMA 1POJA 1SJAA 5AFDA 3VOCA 1KTCA 1IT0A 1OFOA 3W3OA 1W1IE 3T81A 4YXGA 5A6KA 3WEOA 1SFSA 2P3EA 4DPQA 3IV3A 3C86A 1J12A 3ZM8A 2J7HA 2Z2BA 1QFEA 2V2DA 3SFKA 3T08A 2FDSA 3AQUA 3LOTA 1F7BA 2ZUVA 1I0DA 4HPXA 3W71A 1TVNA 4O4WA 4PFMA 2FKPA 2W4XA 1P0EA 1XH0A 4ATLA 4LS2A 4XTDA 3WLIA 2EJ1A 1ELSA 1J96A 1WDSA 1QHPA 4UOJA 4LW7A 5L6UA 4D6FA 3EDKA 4JY9A 3GDLA 1C7TA 2ZE3A 4V27A 5TF0A 1FWIC 1BQCA 2WKGA 3QFWA 4P8UA 2E6AA 4PMZA 3EOLA 1AJ0A 4EWJA 1Q6GA 3M0LA 4OOZA 4H19A 4YWIA 3LM7A 1RY0A 4EF8A 2BGNE 1H7WA 2OYMA 3L4YA 2WHKA 4Q8MA 3ZFHA 3CPRA 1RCQA 2F61A 1KBKA 2QUNA 5BXPA 2PCEA 4EAMA 1M41A 3C8NA 1XCXA 4GRSA 4LV4A 1UHVA 2CYGA 3BQ6A 4NHVA 2VRQA 3AIVA 1TZ9A 5CZJA 2XIOA 4O17A 1IIHA 4S3FA 4UR8A 2BOEX 2NQJA 1UWUA 2OYKA 1GTEA 4H8NA 2I5IA 3HURA 1PPIA 4O18A 3I4KA 3MANA 4PMQA 1IV8A 3BV4A 1L6FA 4NU7A 2RDTA 1DWIM 2J77A 2W91A 3SN0A 2YX0A 1KD0A 4QS6A 3W23A 2O7QA 4M6PA 3W1LA 1KBLA 3LCWA 2QVNA 3MS8A 1J0IA 4KWWA 3ARTA 3OLGA 3AXKA 4YHEA 2CHOA 3EB3A 1MUWA 3FGCA 1KW1A 3LCXA 1XINA 1NDYA 3R43A 4HIBA 3G5EA 3AZTA 3AU6A 3QYSA 4UR7A 3DKLA 3P0WA 3E5BA 2C79A 5FACA 3T05A 2OSYA 4ORMA 3EZ4A 5KZ6A 1Y65A 2PPGA 1JPIA 4LUIA 3AIEA 4PRWA 3URAA 3XIMA 1W37A 4JQ3A 1LRTA 1UR9A 3CZ8A 4GYPA 1CGVA 3QV8A 4WXYA 2QV5A 4Y9AA 4LFYA 1TFVA 4BI6A 1JI1A 3PBUA 2E67A 4CCCA 3TP4A 1DJGA 2Y5SA 2YYTA 3W6LA 4JN8A 3MBFA 4NZCA 4C6IA 2HISA 2AOSA 4Z08A 5MHBA 4DWSD 1OCQA 4M8UA 1BVZA 1W9BM 3AO0A 3IAQA 1K02A 4PTXA 1FKWA 4LUSA 1KM0A 6REQA 1KFJA 3S5YA 3VMNA 2E9BA 2FH8A 4HT3A 3BC9A 3H55A 2W6RA 1A50A 3BOXA 1J0ZA 2F6XA 4W8AA 1H62A 4TVUA 1E1CB 1MDLA 2IQ0A 3C4UA 1ZJBA 3KFTA 4N42A 2PU1A 5LA2A 3FLUA 1ADSA 2Z6JA 3HOJA 4XTIA 3EXTA 4FI4A 4Q8NA 4DZAA 3RX3A 4GCAA 1TV7A 4AXNA 1KR1A 1VENA 1WZAA 3LSBA 1SZGA 4HTBA 3EX3A 3BJFA 4ZQRA 3O2LA 2OVLA 2BGQA 5FF7A 5GNYA 4JTDA 2I14A 2XH4A 4DXXA 9CGTA 2WBKA 2YB4A 3Q65A 2Z25A 1E3XA 1Q6QA 1FOBA 3V3WA 3IS4A 4F0RA 5DXXA 4BWLC 1EDTA 3CB3A 2ON3A 4ZOAA 4EK7A 4I8DA 3S5SA 3WQ6A 2ZA3A 3URBA 4D6CA 3ARYA 3WQCA 2QJHA 3EEGA 4Q4SA 3HQPA 4PCSA 2J7FA 2GGGA 4P7QA 2EQDA 4NNBA 3T4CA 3S1GA 5BWAA 2QGHA 1TV8A 1C29A 4TR9A 4AD2A 1B3VA 2HNEA 2GQ8A 2RKXA 2NQZA 4UQDA 4A6GA 4MGGA 4H7ZA 3W85A 1LBLA 3IGUA 2AMXA 3SI9A 3MCOA 1TPUA 1IWBA 3O15A 2P10A 2QQ6A 1RV8A 2E9LA 5HINA 1XFBA 4NRSA 1GHSA 4HKPA 3CH9A 1W1B1 3UR7A 1HGWA 1YTEA 2PDCA 2RDWA 2PP1A 3PM6A 1UKPA 4NI8A 2VZOA 4C7FA 3FA4A 3ABQA 2JF6A 3BV7A 1EO7A 1H51A 4PUUA 1K3UA 2RJGA 5I7GA 5D4YA 1LYXA 5E5CA 4AD1A 1ITCA 2ZBTA 1PHQA 3N6HA 2QAFA 2BY1A 1HJSA 3WQ4A 3RX4A 3SB0A 2EO7A 2FGBA 1PV8A 5ABTA 2O4QA 1EA0A 3B8UA 4W89A 3APGA 1S5TA 4B4HA 4MY9A 3SCRA 3G1FA 2XFFA 4DWSC 2X2YA 2WCGA 1C91A 1NELA 4Z17A 1CPUA 5E0FA 2WSRA 3CAQA 1YTDA 1MSSA 3ARSA 4V33A 1W1VA 2ODOA 1HVQA 3TN6A 3OVGA 4Z2IA 2PDJA 1RD5A 2PDIA 3FS2A 1UPMB 4LJ3A 4GYKA 6XIMA 3W84A 5BZAA 1B3WA 1IYXA 3TOYA 4ONVA 6ALDA 5CPNA 5AYYA 4FNQA 3IUDA 3NDYA 4R7OA 1WYIA 5AYZA 3L5AA 4JQ2A 3ZLFA 4CNTA 1WO2A 4O50A 3KOFA 1UKSA 4RXGA 5GNXA 3U57A 3IANA 4EOUA 1OD8A 3TMLA 4GI6A 4QTGA 1H7NA 1Z8AA 4IZGA 4LALA 3RXZA 5TIMA 3ZZ1A 3PANA 1LTDA 1BXNA 4MAZA 3WD0A 3M5XA 3VE9A 3GVQA 5KMYA 4Q22A 3WQ5A 4O8RA 3O6AA 5FEPA 3W83A 4I7VA 2OOGA 1FHLA 3DH7A 2WNQA 3LEPA 4AVOA 5AYBA 3CUGA 5D9MA 4JTEA 2W5FA 3MA8A 1A49A 2PDKA 1HJXA 1GT8A 2CLMA 2J27A 5K3VA 4O1CA 3POCA 1JCNA 2Z0IA 5CJMA 1CLKA 1NFBA 1AQFA 3GW0A 3MJMA 1B31A 2WVSA 1K03A 1ADDA 4IIHA 2O4MA 3AMGA 1RD6A 3P14A 4RR4A 1XIFA 3GVWA 2ACSA 4FX6M 5HUPA 3UG4A 2VENA 5AHFA 2E4TA 4Y9OA 1V0MA 1SMAA 4L9ZA 3BSGA 1E5NA 4XBSA 3PWGA 1WDPA 4C6OA 3LHWA 1J4EA 4JN6A 4Z42C 4PMDA 2OB3A 4YL2A 5DCEA 3VKBA 3OHIA 4MUZA 1CDGA 2OPJA 4DELA 5LIKX 5AHIA 4H9UA 3QTPA 3UF9A 4GXPA 4DZHA 4CCEA 4AD3A 3AXMA 1IF2A 2EG8A 4ZENA 5AOUA 1ZJAA 4PCTA 3SGUA 4NILA 2QF8A 3UYCA 2JEPA 5C9ZA 3A13A 1R86A 5GJPA 1XKJA 3EX2A 3MVTA 2YZRA 1XSIA 4E38A 3AFBA 3KP0A 4AWSA 3RG6A 2D2JA 4O19A 5EA9A 2E6DA 1P1XA 2QPXA 3MO4A 4Z2KA 4EVZA 4HSHA 4BWLA 1VYPX 2R91A 1GVSA 1VGAA 4L5ZA 4EXQA 3W38A 4J35A 2A21A 2PWFA 3CEPA 3ONCA 4NZFA 1ML1A 3QSTA 1X96A 1CEOA 3DGBA 1NM9A 3BAXA 3RILA 3GG1A 4OFCA 1F74A 5AZ1A 1NWUA 1T8QA 4GQGA 1W3KA 3MV11 3MUY1 2OLAA 1V0LA 1V3HA 1KFWA 4HB7A 1SJBA 2ZX7A 3VD5A 3WH9A 3LRLA 1UZDA 5BYWA 4GZ7A 3NO1A 4HHMA 3WLLA 2ZQ0A 1RK5A 1KBBA 5HQLA 2DT1A 1QVBA 3GNDA 5LIUX 4JZ5A 5CAHA 5LIXX 3HV8A 2QCMA 1VP5A 1VD6A 1JZ3A 4LQ1A 1MVYA 4GY7A 3KW3A 4DBSA 3MP4A 2E68A 2FVKA 3OBAA 2XPKA 3LQLA 3BDKA 3TE9A 1Q7QA 4RNHA 2XJ7A 3OOQA 2WNWA 1PBGA 4GKTA 5XINA 1Q6OA 3VIMA 3ID7A 4DWSA 2A85A 4PUNA 1OHLA 3N4FA 3I6RA 3AJXA 2REQB 1PX8A 1OK4A 1YPXA 1TA3A 3U9IA 3TW9A 1EGVA 2INFA 1BF6A 3GR7A 4F66A 3BE7A 1FTXA 2V3EA 3R7MA 3L4XA 5CC6A 2BGSA 4A3QA 1R30A 1A3XA 1IHIA 2CESA 2QKFA 3VD7A 2GQ3A 3BMWA 3FVMA 2PGWA 4JR5A 3M6DA 2PWEA 1WQ5A 4C1NA 2OZ3A 4IXXA 4QNWA 1XPYA 1R3VA 3DI0A 4UQEA 1GVRA 1QASA 4OTKA 3NL6A 1V02A 4D8AA 4CQ9A 3SRDA 2DT2A 3P62A 1NFGA 3MTWA 3WFAA 3U3HA 5I3FA 4MB5A 5EB8A 2Q01A 4GG9A 4F2TA 4LAMA 1S38A 2WZEA 2F9RA 5I0DA 4C5ZA 4HD5A 1MDRA 1M9HA 1OX6A 2RUSA 1LM1A 4HYWA 2PC4A 1XBXA 1Z44A 1QOXA 1CZ1A 4FNPA 1ICPA 3G0XA 4CNUA 4QAIA 1V51A 2CFFA 2RJHA 2E5DA 5KITA 5ECUA 1OFAA 2GGEA 3N18A 3T7VA 4AWUA 1MNSA 5FL1A 1ZFJA 1H0IA 4A3UA 1ZCOA 4LUTA 1Z32X 5DY3A 1W9PA 3E96A 1R47A 3AROA 3OJGA 3WJYA 3EB2A 1UIPA 4HHHA 2WMFA 1AA1B 1RCOB 1IZKA 5A2BA 3VOIA 1EJWC 1O1ZA 1QJWA 3LPOA 1U5HA 4AMCA 3GDKA 4LC8A 2ZX8A 4FNRA 4C6EA 3H53A 3I7RA 3M41A 3B9DA 3F4NA 2GWNA 5FEWA 2D20A 4E0CA 4NYYA 3T0BA 2E6YA 4O1DA 1RK6A 3CAVA 3W7OA 3AHTA 3GTXA 1EP3A 1HKMA 3O8AA 1F3XA 4Q8VA 1E6NA 1O5KA 2WKLA 3MWCA 3NR0A 4H9TA 3LZ5A 1EUNA 1HZYA 3N25A 3IJLA 2GSJA 1F3EA 1Q63A 1XM3A 1A5NC 2Z24A 4K38A 2EPHA 4E4UA 4LF2A 1TRIA 1TE1A 2X0SA 3FA3A 4WQ6A 3UA4A 4RW5A 1SZNA 2HNHA 3LS9A 1DWFM 3S46A 1LUCA 4X0NA 1WBHA 3C8FA 3WDJA 4Q7BA 4DJFD 3GDTA 4PUWA 3FJ6A 3C2RA 3KHJA 4MJZA 4H4IA 3IACA 3ZLGA 3L68A 1VCVA 1YLVA 4C6JA 3PZOA 3NEVA 4JD4A 3EOUA 1OBAA 1JQXA 1XISA 1SMDA 3GE7A 3IK2A 4IHCA 2PMQA 4KFNA 4PTNA 3P80A 4QISA 5FIPA 1BD0A 3BICA 3IEBA 4NL1A 4A4AA 1Q45A 5DLCA 4MWAB 3OYXA 1B2YA 3WH8A 4KWUA 1HKIA 1DJNA 5C8BB 3EA2A 2WCAA 3QV9A 5HNTA 1US3A 3SR7A 1S2WA 1D9EA 3NQMA 4C6FA 4W84A 3LV5A 3RHGA 1MO0A 1VHCA 3TFCA 5IBXA 3DDMA 4C65A 2QT3A 3MW7A 4NX0A 2NW0A 4CNOA 4H41A 4JQAA 5IHSA 1LL6A 2Z29A 1LBFA 4PFHA 2FZDA 2Z4GA 1AD1A 1E55A 2QAPA 3TA6A 1FKXA 2PE4A 3FXGA 3RAOA 4NY2A 3SN4A 3VILA 4HU4A 2QGYA 2G3IA 1Y0EA 1EF3A 4RDZA 2WYSA 4FOKA 2GFTA 2H8XA 4BS0A 1GHRA 1Q6FA 4KBXA 1X98A 3BXWA 2VKZG 3IV8A 3MUZ1 2PTYA 1B3OA 4YVPA 4ZODA 4EPBC 3CUFA 2QF7A 3EOEA 1RR2A 1JYXA 3QHOA 4IMAA 2BBFA 2A7PA 1TPH1 1BTCA 1UJQA 4TTGA 2OFJA 3MUIA 9RUBA 5KINA 1MRAA 1V03A 4MFDA 4UCFA 3VIOA 4U33A 2Y85A 1BYCA 2QNEA 1TV5A 1LG1A 4QX4A 5EU9A 3LK6A 5U4NA 3JR2A 2NVAA 4M24A 3KS6A 3TZFA 1RBAA 4KRZA 4QHRA 2HS6A 1EUAA 2VFEA 1FXPA 3VC5A 3CMGA 1AW2A 2W66A 3SSJA 3N2OA 2OO6A 3OP2A 1OWQA 1C8XA 4ES4A 3A24A 3BSMA 3SW6A 1K8XA 3VCNA 4HK7A 1GCYA 3N13A 3R89A 3ZXWA 4Y2WA 5FJJA 4KWSA 4DUWA 1XLIA 4FK9A 2X30A 5ABEA 3WDIA 4LBUA 1UWTA 2XFWA 4XZIA 4K7YA 1MRQA 3S47A 4DJFC 1RLCL 4ENLA 3LLFA 2C91A 1V08A 4RX0A 3RITA 3MMDA 3PAOA 1I4NA 4UB9A 4GD0A 4XKMA 2FGZA 1OGGA 4RK8A 1PWLA 1KFLA 3EWUA 4F0SA 4QG9A 3UR2A 1REQB 5D9PA 1M7PA 2Y61A 1LLWA 3PTKA 4Q4OA 3C3NA 5HR7A 4HOXA 5HULA 5LNWA 3WFZA 1Q6DA 3RK8A 4LC6A 2BXVA 2BFGA 2OELA 4GLEA 2X1UA 4GACA 2XH2A 4JIIX 1TPWA 2BY2A 1K8YA 2Q8ZA 1E72M 2FDMA 1XRFA 4GINA 3B4UA 2XH7A 2Z28A 2QEZA 1DWAM 4AZHA 2OCZA 3UJFA 1AJZA 1ZCCA 4MNMA 5BU9A 4TX8A 1KCLA 2ZUTA 3R0KA 5CPQA 3ENLA 3H7RA 3B06A 3EEZA 3CU2A 3F4CA 2ZZ4A 4EXBA 1OY0A 3MKCA 3IJDA 1XWYA 3N2MA 3KCJA 3SJNA 3CUZA 4HK5A 1ITXA 2YDQA 2ZE0A 1J01A 5BXSA 2R6OA 4O0ZA 2ZICA 1SO5A 1EDQA 1TB3A 5AHLA 1Z69A 4MYAA 3RMEA 1KBJA 3GRIA 2NXIA 2PDXA 4J3ZA 5CH9A 2PODA 4BQ4A 1C90A 3UD6A 1P1MA 3QGKC 4XISA 2WWDA 1EJTC 1BRLB 4CD8A 1E6SM 4RPQA 4W4QA 4S2CA 4OBSA 5KZMA 3DFOA 3WDQA 1L9WA 2CU0A 3MUAA 3U7VA 3SEPA 2NV2A 1JUBA 1KBIA 3OZOA 3M0JA 1D3GA 4KEZA 3V75A 2VFGA 4KGLA 1EZWA 4AYSA 1V0KA 4JOMA 1L6WA 4ZTYA 2KAUC 5J8LA 3RCNA 1AQMA 1F4HA 3W0KA 3K4AA 4EAYA 1G5AA 1A5UA 3JUGA 3ECQA 4U4MA 5LZLA 4U10A 1PE1A 1C3FA 2YFOA 2H3BA 2HXTA 4S3DA 4QITA 3UR8A 1A0EA 2PCQA 3GXNA 1RQHA 5FJUA 3RPDA 3T1GA 1UQZA 2PEVA 3UBPC 1DPMA 3S0CA 4H83A 1EJRC 2X1IA 3BG5A 5D02A 1F3WA 2ZRVA 3MCMA 1WBJA 4R27A 2IW0A 4CLMA 4XAFA 5DX7A 1XHGA 5CGTA 1OIMA 1KQZA 4UQCA 1XPGA 4HHLA 1XBZA 1LLOA 2VFFA 1CGXA 1HP5A 4DLMA 1QO2A 2OEJA 2VELA 4KCVA 2PSNA 2WVVA 3WQEA 4OU1A 1VJSA 3PSWA 3UZJA 3GNXA 2IMRA 4N6FA 5FL0A 3AAMA 1MQQA 1OX5A 2I17A 3GAKA 1CXIA 5IFTA 5M5DA 1H5VA 4PTVA 4PE8A 2WC4A 3NXFA 2BXZA 3WQGA 2DW7A 2PGEA 1KFCA 2VX5A 4O1BA 1U22A 4E8DA 2DIJA 2PURA 1PXGA 1E4MM 1JZ8A 3UPMA 2CKSA 1UR0A 3PZUA 3V35A 4Q4MA 5BXRA 1HXJA 4LEFA 1PX4A 1WKEA 2V5KA 1XS2A 3PNUA 3A21A 4UTTC 1ECEA 3TR9A 2ZRYA 2ZXQA 5IRPA 4RJEA 3B03A 2PRMA 2WXDM 1PKNA 3GTIA 3R1ZA 1NWSA 1M1BA 2ZXBA 4L4PA 3GSMA 2JFEX 1GONA 3W70A 3W2UA 2CXEA 3N04A 4H04A 2Y6ZA 1FXQA 3VUSA 4ACYA 1GYNA 5HDRA 4GNVA 1RVGA 3NPVA 4QSFA 1QO5A 1K6AA 3GZAA 3TUUA 1ZALA 2HS8A 2YCLA 3ITXA 2OEMA 1G4TA 4CCDA 1DXFA 1YNQA 3NURA 1I8JA 5D03A 1RBOB 1UOZA 4O16A 2RH9A 1SSDA 2ATMA 1J2BA 5FD0A 1G67A 1GNXA 2HZGA 4O13A 2C16A 4H9MA 5C2GA 1U2YA 3W02A 4E2DA 1VEPA 3WQVA 2QW5A 4A8NA 3LRMA 2D3LA 5BOFA 3R79A 3UEQA 2O92A 1JCXA 1FH7A 3TTSA 2JIWA 4UFJA 4HYVA 1NARA 4N9BA 3QM3A 1JCLA 7CGTA 5IOBA 1HJUA 4PUJA 1IEVA 3CJPA 2GL5A 1A5BA 3HGSA 3OGSA 5E0CA 3IJ8A 2AL2B 2OGYA 4H2CA 1VIZA 3PZTA 5I78A 3CL6A 4OZOA 4JCMA 1PS9A 1GG0A 4FHAA 1JCTA 1OQFA 1V3LA 3TW7A 4BF9A 5A6BD 3H4GA 5H1WA 1Z6KA 2Z1BA 4IISA 1R85A 3K1GA 4NQ1A 3ZR5A 3RRAA 3EOSA 1AD4A 4QJ1A 2WCSA 1KM2A 3NSXA 4MPQA 2Z1VA 2OQYA 2GSHA 2QUUA 1EF2A 1BTMA 3G1XA 3M5VA 2I16A 3RYSA 1X7FA 1ZHAA 2YDRA 2QCCA 3WLNA 3A4AA 3S9IA 3RR4A 4JFUA 2XFRA 3TN5A 3TLQA 5E6YA 1MZHA 1YPFA 2D23A 3ZS4A 2V3FA 4S1FA 3U5YA 4HOZA 4GYJA 4BEUA 1SJDA 4QJ5B 4I8YA 3NL2A 1TMQA 1ZS2A 1WDRA 3SRFA 1XFCA 4G56A 4FF5A 2F6KA 3E5PA 2W0UA 4HOWA 4PTWA 5HUOA 4DAIA 4HHPA 2D1ZA 3VUPA 1ENUA 1VBUA 3LTSA 2QCDB 2Y7EA 1TRDA 1V77A 4UFLA 3MCNA 4MVAA 2HK1A 4ZQOA 3TYBA 1G94A 3I3BA 1W3HA 2PF8A 1F07A 3NZ1A 3T6CA 2QJGA 3WD2A 3BGAA 2W63A 4ZEPA 3GNOA 3TJ4A 2PBOA 4MYXA 1QHZA 3UVAA 4IPPA 2WSYA 3DG6A 4GABA 1UD5A 3JRKA 1O7AA 4QCEA 5LGXA 2C0AA 1R9XA 3BOLA 3H2CA 3I4EA 3TQVA 3AIRA 5I6SA 4V2XA 1M5WA 1DL3A 1DE5A 3W73A 2NQ9A 3FV9A 5C7VA 3SUVA 3FX4A 3VDGA 4GWEA 3ZYZA 2XZ9A 2NT1A 3LGEA 5RUBA 2Z1SA 5JBDA 3ELFA 4WEVX 3O7UA 1FH9A 3QEZA 2W3ZA 3V18A 1UYQA 3ZJ8A 2PFHA 1WAUA 2WHLA 3A3HA 3G1SA 5K9XA 1T0OA 3EWYA 4EANA 4XIMA 2A3EA 3CIWA 4JHZA 3EX4A 1E71M 1EJUC 4HCHA 3NL5A 3UWUA 3BURA 5EY5A 1VCFA 3R8GA 3U7BA 1GVFA 1Q6RA 4UTTA 2VUYA 2J62A 1H11A 5HK4A 4B16A 4N0RA 3EPMA 1I60A 3UZZA 4R9XA 1LL4A 1OB0A 4XQ6A 1A80A 2XIQA 2D3NA 1TQXA 3QV6A 4ZQCA 3VM5A 1JNEA 3KRSA 4EPEC 2UY4A 4O1FA 4YNGA 6ENLA 1ZUAX 2WZTA 3ALFA 3A4WA 5HJLA 6TAAA 4QDPA 4QXIA 4EP8C 2CNCA 4R33A 4DF1A 3DYPA 4DBEA 2J7DA 4HNNA 2ISDA 1XYFA 4W85A 3EKZA 4RZBA 5MKGA 1XIHA 2Z00A 4BR1A 1N82A 5JMUA 4AYGA 1HX0A 1K7EA 3NUKA 4AWEA 1CX9A 1B57A 3GU2A 3VNDA 4EACA 3GC4A 3NQAA 1R3TA 1XIJA 2WJFA 2W9MA 2ZX5A 2WMGA 1US2A 4E3TA 1YXYA 2VX7A 9XIMA 5AY7A 3NZQA 2OXNA 3ABSA 4XWUA 5F2GA 1XGEA 5J5RA 4G7EB 2EJAA 3G1HA 2Y4SA 2OLHA 3TXZA 3S1XA 1VFHA 4GX8A 1DJYA 4UC5A 3Q67A 2FVLA 3P8JA 3WZ0E 1YE6A 3LPFA 1UR4A 2ZTKA 3H22A 3WD1A 7REQA 1CTNA 2D69A 2GOKA 1GJWA 4IP4A 3S3GA 3S2CA 4X3ZA 1JPHA 1NY1A 4H7CA 3SCOA 5HJYA 2ABBA 4LYQA 3HPXA 4DAFA 4UFHA 1J93A 3I3DA 3NQBA 3U6WA 1W2VA 3UGVA 5A6MA 4US6A 1BSLA 1MUCA 5DMYA 1VYSX 2AAAA 3QOMA 4K7VA 3TU9A 3T07A 4Q4KA 3REQA 3VIGA 2IPGA 3UESA 3TCEA 2VTFA 3PTDA 3GH4A 1HKWA 2DZAA 5EYWA 1FVPA 4PUDA 2QCGA 5E09A 4B92A 5CZSA 3T2OA 8XIMA 2VEFA 4JFSA 4HA3A 1CECA 4GUFA 2VZVA 2TSYA 1SFJA 1W54A 2J6XA 4TVCA 3WLSA 4M29A 1XLDA 3GKFA 1LRNA 3FIGA 1CBGA 2R9RA 1MNZA 3OLEA 4P7OA 4XAPA 3STEA 4UMBA 1A0CA 1PB0A 4MB3A 2QCLA 2ZUWA 1ONWA 4MTVA 4AW7A 4AISA 2XH0A 4RZ5A 4MUPA 1QOQA 2HBXA 1A5KC 4IJBA 4LNCA 4QS5A 3UWWA 1CGTA 1FWBC 3BOFA 1X6NA 4WJEA 4M7SA 4IIFA 1CW2A 4M6UA 4FAMA 3IUIA 1S2UA 3UJSA 5K9DA 3BLEA 1E9LA 3WF1A 5I00A 5CG0A 4BA0A 3PZMA 3STCA 3M6YA 4MPKA 3KL3A 2P3ZA 3VIPA 5JIPA 1TCMA 4CNPA 2VEPA 1MFVA 4NNCA 4IMFA 1NJJA 4HNUA 2VXNA 1E3ZA 5D05A 4WSHA 3C2YA 2OKOA 4JTLA 1K9FA 3ZSSA 3T44A 5KEZA 2A6LA 2NQLA 3PBYA 1H4PA 3VGDA 4U31A 4IICA 5F1VA 4MB4A 3O6YX 2Q8XA 2YGYA 1E43A 2D2OA 4S3GA 3EWDA 4CQAA 2EGZA 3WMCA 1XJBA 4DX3A 4XAGA 3GS6A 3KOYA 3KCLA 4KT2A 2VFHA 1IZCA 2HE8A 3TYUA 1V7YA 4YMZA 4R7JA 5I3DA 3C6CA 4P8VA 1RZMA 1TTIA 4QJ4B 2Z27A 3W2NA 1RAKA 4YIWA 3L4ZA 3B9AA 1J5SA 2BG5A 4XKYA 1AMKA 1GPFA 3JZEA 3L4WA 4ML4A 2JQXA 1PDZA 3QBUA 1EOKA 3N15A 5H6HA 3MPGA 1F5ZA 3SCTA 4GIYA 4PRTA 2R1MA 2VCCA 3MYOA 2J6VA 1XLJA 4Y8EA 3N12A 5H2ZA 1XD1A 2C7FA 2NUYA 3U2OA 2WJEA 1MUMA 1XC4A 3RMJA 2C71A 4MNLA 4QE1A 3B05A 4HTYA 4G5DA 4OJYA 4V28A 3KUMA 3WF0A 2Z6IA 1TJ1A 4S3KA 1R5YA 3GU9A 4KCUA 3KDNA 2F84A 5GPRA 1JF6A 2ACRA 3P3BA 4WY0A 1JULA 3WDRA 2YL6A 3W1MA 5BMXA 3TN4A 4M51A 3MZNA 1HKKA 4UTIA 1FWNA 1FCBA 3ABZA 2XVLA 4WD0A 1A5OC 4D1JA 1US0A 2JK2A 3FK4A 1X8CA 2VC9A 2INZA 4C7GA 1OJXA 2G3JA 2CEQA 4N7QA 2C1GA 5U7SA 3CHVA 3PG8A 3IIPA 2XIBA 1HKVA 4PMUA 2QR6A 2VEGA 4KWVA