2XU2A

Crystal structure of the hypothetical protein pa4511 from pseudomonas aeruginosa
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
241
structure length
241
Chain Sequence
RILLNCDMGESFGAWRMGDDVHSMPLVDQANLACGFHAGDPLTMRRAVELAVRHGVSIGAHPAYPDLSGFGRRSLACSAEEVHAMVLYQIGALDAFCRSLGTQVAYVKPHGALYNDLVGDDELLRAVLDACAAYRKGLPLMVLALADNGRELELADEADVPLLFEAFADRAYLPDGRLAPRRLGGAVHHDPQRIIEQALAIARGEAFPDYDGNPLRLTADSLCVHGDNPQSLAVLRRLRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Unknown function
molecule keywords UPF0271 PROTEIN PA4511
total genus 86
structure length 241
sequence length 241
ec nomenclature ec 3.5.2.9: 5-oxoprolinase (ATP-hydrolyzing).
pdb deposition date 2010-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03746 LamB_YcsF LamB/YcsF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 2xu2A00
1W1A1 1W17A 4NZ5A 4L1GA 3HFTA 2C79A 2QV5A 2XU2A 1NY1A 2C1IA 1W1B1 2C71A 2CC0A 2I5IA 4HD5A 4F9JA 4WCJA 4LY4A 2E67A 3CL6A 3WX7A 1V6TA 4U10A 3VUSA 4F9DA 4OUIA 2J13A 3S6OA 4M1BA 4NY2A 3CL8A 2VYOA 3CL7A 4NZ4A 1Z7AA 5JMUA 3RXZA 4NYUA 1XW8A 3QBUA 4NYYA 2C1GA 2IW0A 5BU6A 2DFAA 2NLYA 2Y8UA 4NZ1A 4NZ3A 2W3ZA 4V33A
chains in the Genus database with same CATH superfamily
4JX6A 3U5UA 4E38A 5CZSA 2GL5A 4AWTA 1C90A 4O0KA 1B1YA 2VEGA 2V2HA 2X0HA 3N2TA 3E3HA 3SJNA 3WJYA 3WLMA 1K70A 2TYSA 3BH4A 4M6VA 4L4PA 1F07A 1K9TA 3S1VA 3BURA 3WSUA 2DSWA 3W2NA 1AG1O 1TV3A 3DYMA 4N2YA 1W8GA 2VUYA 3BL3A 4Q8QA 4KWVA 1QI2A 2AOSA 4H7ZA 3WJWA 2CHOA 3N3TA 4US6A 2HZGA 3HU7A 4WLCA 3HPZA 3TC6A 3W87A 2OEMA 1N8WA 1J0HA 2D0FA 3HGSA 3M07A 4H9UA 3OIHA 4NI8A 5I79A 2IKIA 3WH7A 2GFTA 4F0KA 3U7BA 2VD8A 3M1ZA 4LNCA 3FK4A 2UY2A 2W61A 2V81A 3EDJA 1TVNA 3IWPA 2CLKA 2NUXA 4PCSA 1BHGA 2QLYA 4DUVA 3NYDA 4A8IA 6CGTA 5BROA 3NTYA 5FCZA 3S8HA 2Q8XA 1IGSA 3GTIA 4OKDA 4AZCA 3V36A 2B4GA 3A4JA 3APTA 2C15A 3SIZA 1BGGA 1ZTVA 3W2MA 3WLNA 1W9XA 3VYLA 2PCEA 3U0HA 2Y8VA 1A0EA 6A3HA 4C6BA 3NURA 2D22A 3FXGA 4PMXA 3NSXA 1QATA 1W2PA 1R9ZA 1GQJA 1SJDA 2F6XA 2OOGA 5A6MA 1GVIA 1UD3A 4X61A 3TYUA 1SJCA 2ZUMA 1AODA 4O54A 4E2DA 3W2JA 3I6TA 3CWOX 1PZ1A 4RZ5A 1PYFA 3SCOA 4DZ5A 4J3VA 2WMJA 4DJED 3MWAA 4RV8A 3PWIA 1BYCA 1XDLA 4UOQA 1E3XA 3GG1A 4CNUA 2R1NA 1AL8A 1HO1A 3R8HA 3THQA 1ONRA 1UH2A 2DUZA 3H55A 1S2CA 4B4HA 3GHUA 4M81A 1XSJA 5LXXA 3E1F1 3AQUA 1QK0A 3WLIA 3WNOA 5I3DA 2GYIA 1EGMA 3D6NA 2R1KA 2OYMA 1XLGA 3R0DA 3APGA 2PU1A 2PD5A 2YYTA 5FAJA 3PULA 2ZZ5A 3QTPA 5HUPA 3CZGA 2C0AA 2Z1VA 2PTWA 4WSJA 2H3BA 5ABFB 5AYXA 4F79A 3IARA 1O1HA 1H41A 1XCWA 2VELA 3WMSA 4R34A 3V7PA 5C70A 3HQPA 4NJGA 3SR7A 4UTFA 1GKPA 1SO5A 3T0CA 1U33A 4GQQA 4DF0A 4JOMA 1W9DM 4DVOA 2PWVA 4K1GA 3CV7A 3SCWA 2ZADA 4IL2A 5LXEA 5I07A 3C61A 4J40A 1W1VA 3A3WA 1TMLA 3PP7A 4NIRA 1MDLA 4GI6A 4HN4A 1GWJA 4R3UA 5I3GA 4GX8A 2GDUA 3ANYA 3M5YA 3CQJA 3EX3A 5HJLA 5BXSA 4Y90A 4NAEA 1XICA 1A3XA 1HO4A 2HRWA 4WDWA 3UCDA 4AEOA 4R53A 4H7VA 2JIWA 2AMGA 2E9LA 3QW3A 3RM9A 3M43A 1HUVA 4O28A 2BHYA 2ZZ2A 3GR7A 3UGVA 1Z7AA 2DQWA 3AC0A 2AQWA 1PWLA 3WBAA 4IH3A 3J7HA 3Q94A 4A8NA 3TWAA 2OLAA 5HULA 4D6DA 3CC1A 1IEVA 4MWAC 3ZWTA 1RBOB 3LYEA 5DCEA 4MB1A 3DBPA 4CCDA 1OCJA 5KETA 2WVSA 2YX0A 2WKLA 4NYUA 3NJ3A 2CW6A 3P81A 5CCZA 2OR2A 4HVXA 4A2RA 3VI2A 4LNYA 4A2SA 3T0AA 1TA3B 4LEFA 1E55A 1LCOA 2HV5A 5AVHA 3K4WA 4F9DA 1V08A 3KXQA 2IPFA 2Y61A 3GU9A 4IP7A 3EWZA 1I2QA 4CD7A 2R9RA 3W70A 4HYVA 3QM3A 1HN1A 1XLHA 1RJRA 4FOJA 4M6QA 2RAGA 3UR7A 3MA8A 5AB3A 4Q8MA 1IXQA 4MPQA 2BVWA 3USZA 2XZ7A 5FSEC 4B5SA 4TTUA 1US2A 2E77A 3M0JA 3VZXA 2RJGA 3PTQA 3EX2A 3L2LA 1CI1A 5FEZA 5MKGA 4AY8A 1IEIA 3W2UA 1DWGM 1QU4A 1ZBCA 3H54A 6REQB 4Q4PA 2EPNA 7TIMA 1JPDX 2QEZA 2VOTA 3NXLA 1MW2A 1BYBA 2QQ6A 3PPGA 3EWWA 4YVXA 2ACUA 3FY1A 4LGXA 2XN2A 5FI8A 4TX9A 2OSYA 1GORA 1PZ2A 1XD0A 4ZEPA 1QNPA 1NJJA 1VFSA 4QAIA 1XYLA 4I9JA 5FJTA 3TK7A 3W1NA 1V3LA 1VFMA 3RPMA 3W7OA 5HJXA 2H90A 4L4MA 3P82A 2QS8A 3T2PA 4QCEA 4MNKA 3CM4A 2QNEA 1E15A 4M51A 6XIAA 3TKFA 4ZXLA 5F4WA 1BGAA 4H2CA 4FAMA 4N9BA 3B0XA 2VL4A 2G4FA 4GXMA 4HCLA 3GW3A 4W85A 4ERIA 1H7PA 2EG7A 4JAWA 1UD2A 3G22A 2CCRA 2XGBA 2JEPA 3F7JA 3MDWA 3PBMA 3PJWA 2P0OA 2C19A 3GIPA 1BYDA 1C9WA 2O9RA 3EOLA 2YDRA 1C8QA 3AMKA 3CQKA 3C2RA 4DJEA 3WFAA 3CH9A 1FTXA 5E6YA 5LNWA 1VRXA 4WKFA 1A4LA 1KGUA 1A5KC 1C9DA 4JTTA 3C2OA 4EOUA 3NAVA 3HG5A 2DVUA 2WC3A 1P1XA 1YW1A 1IV8A 5HR7A 4F0MA 3DESA 2ZZ4A 3NSMA 2E6DA 4NILA 4WVXA 3P6LA 4YLWA 4HP5A 3CHFA 2DT2A 1AJ2A 5BU9A 4WK9A 3WLHA 3GNDA 1FA2A 3L4WA 4DBDA 1D9EA 1UUMA 1EBHA 5MHBA 2NV9A 4UWMA 4CN6A 1OVDA 1E9LA 1GJPA 1WXZA 2NVDA 5CAKA 1ZNNA 4PC8A 1H7WA 1E9YB 3STEA 2R1PA 3KAOA 1G4PA 4ZB0A 4ERGA 3FX4A 1R7OA 2HTMA 3KVJA 3GXDA 4YCOA 3W0KA 3L9CA 3EOUA 5AYIA 4DUWA 3LN3A 4JTHA 1FWHC 4GY0A 1PCWA 3MP3A 3S42A 1I75A 1JIBA 4KGJA 4LU0A 1BLIA 4A3HA 1M6JA 4M56A 3O15A 2WJEA 4W7WA 2D2JA 2D3NA 1ZP4A 3BAWA 3ZYZA 1RAKA 4LAKA 3OQ8A 3VXGA 5AZ1A 3UR5A 3BJFA 8XIAA 3WQ5A 4KWOA 4H8VA 2OZTA 3BW3A 3VDHA 2QCDA 4JS3A 4FNSA 1WDPA 1GOKA 3L4TA 3K13A 2C14A 2A6LA 2PU0A 3BCFA 3H22A 3L67A 1P0KA 3SN4A 3WNPA 4DRSA 4QRNA 3ABXA 2GUUA 4AW7A 3A4XA 3UR2A 3M46A 3NXFA 2VFIA 2GSEA 2TAAA 3FKKA 5BRBA 1VEOA 3LI1A 3L4UA 5CZ0A 2VQUA 5HA7A 3MI6A 4G7EA 3PZNA 4FNTA 1J8VA 1DWJM 1OADA 2PDIA 4J7RA 1E6NA 1QBAA 3H2OA 2REQB 1GVOA 3WY1A 1TV8A 1PDZA 5GNZA 3BXWA 1I1XA 3PTDA 1FCQA 3ZWSA 1ISWA 5CSUA 4C6MA 1JDAA 1VC4A 4HOWA 3TUUA 3MMTA 3G3MA 3NL2A 5LA0A 3VFLA 3GDTA 4JZ5A 3UXDA 3E0LA 2ZRWA 4G1KA 3I3EA 3FJNA 3R11A 4O4VA 3NZ1A 3A6OA 3A4WA 5FF7A 4QQ3A 4E2VA 2Z6JA 1VFLA 3TV8A 3WDPP 4WD0A 2R91A 1TPDA 3IJDA 2DEPA 4S3FA 4HA0A 3MPGA 1EO5A 2WNQA 1V0KA 3V16A 3VCNA 1NY1A 1AQFA 1G7UA 4DUXA 3CJPA 3W88A 2J47A 3EWCA 4AEFA 4MKSA 2GQAA 5CXPA 3AZSA 1ZUAX 4CCEA 2G3FA 2YLAA 4MWAD 2HPIA 4S3EA 1B4KA 1ZQ5A 1B3ZA 5H8PA 2ZTKA 3MYOA 4Z2JA 3PWGA 5BNKA 2QZRA 3R0UA 1O94A 3W23A 4AY1A 2DZSA 1OM0A 3WQDA 1XI3A 1GONA 4Z2KA 3Q4DA 5CLTA 2A7NA 1JYWA 1FCVA 1VJSA 3P62A 1TCMA 2C1IA 4GKLA 1TELA 3R25A 4RNIA 3UJSA 3QYSA 3K5XA 1XC4A 4EPBC 3MV11 1CGXA 3G1RA 1XGZA 2ZXBA 1FBAA 2WZTA 4AD2A 2PLJA 2V5DA 4KRZA 2YXXA 3LS9A 3MZ2A 3VC5A 4JDBA 1E40A 4HPXA 3QF0A 1AQ0A 1TVLA 3WG6A 3NZQA 1DOSA 2I7GA 1RR2A 2FLIA 5CSYA 1R6WA 4MGGA 1JG9A 4IGNA 4HJWA 4QJ4B 4K8HA 4DBWA 4I7WA 4DI9A 3RX4A 3EMZA 3T8LA 2HBVA 5RUBA 1EHAA 6REQA 3K4DA 1PX3A 2QUNA 4S38A 2P3EA 2IPGA 1DJHA 1JZ4A 1W0MA 2NLIA 1RCOB 5EYWA 1MRAA 4S3DA 1RALA 2E68A 3VCCA 2XSAA 2GK1B 1UZ1A 4LCSA 4MG4A 3EYPA 1OFRA 5CGMA 1XD1A 3TA6A 4YHEA 1L8NA 2XH2A 1Q4WA 2OFJA 4FALA 2DZBA 2GOKA 2DT1A 4B3ZA 3LM7A 1EL3A 3RFAA 2V2CA 4AF0A 3FYOA 4ZFMA 1QPNA 4IHCA 4J3WA 2Y5JA 2P8BA 1CNVA 2YCKX 1OZMA 4DN1A 3K8LA 4LAMA 1XDMA 3I10A 4R9XA 1DQXA 4FLSA 4AG0A 5JVLA 2B31A 4JFWA 4OBRA 4A05A 1E0UA 2FHBA 3S2MA 1QNRA 4RE2A 2OPJA 4O57A 1XG3A 1LQ2A 2WM1A 4H2HA 3S6OA 1A5UA 4J5NA 4Q4SA 3UJEA 2QCHA 2VEFA 3TTYA 1CXEA 3M0XA 4NNBA 1OCQA 4CVWA 3CMFA 3A5VA 1D8CA 3IJQA 1EDGA 1EDTA 2CETA 3NEVA 2I16A 3M9YA 3LGDA 4PRTA 3T1GA 3W02A 1IWBA 1DXFA 1FWWA 1XIDA 4AZIA 4O0ZA 4AVNA 3FA4A 5D38A 4RDYA 2BHZA 3QPYA 3QQ0A 1HVQA 3TYAA 3ATYA 1F4AA 1H7RA 1R87A 3CHVA 3INPA 3LMYA 3ZLFA 4ADTA 4WIWA 4JQ1A 1NELA 4NNAA 1UC5A 5CJ5A 4QNWA 4I9TA 3B4UA 4KPLA 2ALDA 5FOOA 3P14A 5HDRA 4HN8A 3G77A 1JRCA 3UVIA 3FVMA 4MYAA 1NDVA 1N82A 5FA5A 3QKEA 2IPJA 2CLFA 2FGLA 3GVQA 1DP0A 1S1RA 4YYCA 4JTGA 3KTXA 3SCPA 4LF2A 1V4YA 3HQ1A 5BW6A 2EBNA 2HK0A 4DAIA 3M7SA 2QXWA 2Z7GA 5FIPA 3GDMA 1HQTA 3JU2A 5HMEA 3VD7A 1WXJA 1G5AA 1ADDA 2VZUA 1CW2A 1DPMA 4KWWA 1OFOA 1PXGA 4LVBA 1ZHAA 3NL5A 4PMQA 1J5TA 4LUTA 1LQAA 1VIZA 4AIEA 1TQXA 1KCKA 3NQBA 5HPOA 1TA3A 1L6SA 4YU1A 3G1DA 4CD8A 3LCLA 2NZLA 2RDTA 3T08A 5IBXC 3GNRA 1FCBA 1JRBA 2E28A 1FWNA 1U1HA 5CH9A 5FEWA 1SVDA 2G4JA 1JXJA 4LF1A 2Z26A 2X0SA 1RPXA 3EKZA 4Q3MA 3GQYA 2ABBA 3U4AA 2CPUA 5AHIA 3ERPA 2P10A 3TJLA 3FA3A 2XJ7A 2C0HA 4O1FA 4Z1CA 3TYBA 5H6HA 1CPUA 4C91A 1MMFA 1IR1A 5I78A 3PSWA 2CZFA 1DQUA 2GJXA 2QJJA 1CB2A 1A5MC 4UFLA 4QBXA 1HKKA 2E7FA 2WNWA 2VOMA 4AISA 4IGHA 4U5KA 1E6RA 1IWPA 2VFDA 4OT7A 5CSSA 4HNOA 4L1WA 3TXZA 4WXYA 5HAOA 2C18A 3PPFA 3EMQA 2VEKA 3KS5A 1B0IA 3RR4A 3IIVA 4HB7A 3MJMA 4IJRA 3LV5A 3N25A 1R0MA 1EO7A 5F2LA 1EA9C 1EUNA 4XZNX 3VIOA 4WGXA 3RO8A 1V6TA 4PBFA 2FVLA 3UF9A 1NOWA 1DIEA 3F4DA 1QOQA 2BTMA 1QW7A 4UOJA 2E25A 5J5DA 1M7XA 2J75A 5KTLA 2CHNA 3WL1A 4I8YA 2QV5A 2WHMA 3B03A 3VCRA 5AHMA 4I90A 2FZ9A 3GFXA 2ZUVA 2VUNA 4LUSB 4M7SA 2X1SA 4EPEC 4TVUA 3G24A 4KBXA 3LA4A 3RX2A 3WBYA 4ZR8A 4W87A 2HS6A 2WHKA 3GBEA 3CH0A 3BTNA 2VI0A 2DZPA 3GHSA 1E1CA 4NUWA 1C91A 1LG1A 3W2LA 2AGKA 5I3FA 4JQ3A 1V6YA 3TW6A 3C2FA 2AQOA 2PMQA 5IHRA 2P0IA 3IJ9A 3LLFA 3LBCA 4L64A 4O19A 3GIQA 3HGOA 5A6SA 4IMGA 2R14A 4KFPA 2YYUA 3AS0A 4ROQA 5U7SA 1MUCA 5JU6A 4L4OA 2CEQA 1UWUA 3EWYA 3NPVA 4UMAA 1U5HA 1QAPA 4KKXA 1GGOA 3DFTA 4DIAA 1GT8A 1CXHA 4RPPA 3NA8A 4O16A 1KQZA 1QJWA 5D2VA 3FLUA 4L1XA 3L7RA 5D32A 7ENLA 1FRBA 1CX9A 2XDFA 3VNJA 2BY2A 3N73A 3PZUA 7REQA 2V69A 1W91A 4LB4A 3RM8A 4WOQA 3MY9A 1ZAIA 5HNUA 3BAIA 1BRLB 2E9MA 3MCMA 2E1WA 5G4HC 2ZRXA 4P7OA 4F0HA 3MC5A 4K36A 3GW0A 2WBKA 4WY0B 5DQPA 1F3XA 1B3YA 3ALGA 4IX0A 3UZJA 1YXYA 1XHGA 1AUSL 4XUYA 3VILA 4HHMA 2C1GA 2PWFA 3P84A 3PJXA 1DV7A 1HKVA 5KZEA 1GK8A 1OJXA 1XX1A 3TSMA 1H5YA 4I6KA 3KBWA 1ISVA 3OPSA 4FLOA 1LQ0A 3LPGA 1XLAA 4DPQA 2FVMA 3AS2A 4P7NA 5FD0A 1MRQA 3BQ6A 4UR7A 3E2RA 1GTEA 4PSPA 4K37A 3UJFA 2W3ZA 1KBLA 4H9TA 1O7AA 4MKNA 4V28A 1DL3A 4TU1A 3UWZA 1LG2A 2OT0A 2ISVA 3DDMA 4P7QA 2OEJA 2X1RA 2VR5A 4GFSA 3V3WA 4S39A 3WDIA 3PUDA 1O5KA 1TCDA 4AD4A 2DV0A 1SZGA 1V0MA 3WD2A 5CLWA 3U2EA 3B9AA 4O1DA 1WAUA 1S2TA 1BXCA 2JBMA 3OQEA 4ACZA 4ZL1A 2XGIA 3ZM8A 1A47A 3OVPA 4O1BA 4AFYA 2IS7A 3HFYA 3ABQA 1M7OA 4UR9A 3ES7A 3DOPA 3TYZA 3GNPA 1RY8A 5K7JA 3CLMA 2A7PA 1M65A 4IIHA 2CZDA 3WBEA 4DY1A 2PEVA 4LCQA 4WDUA 5AC7A 3EWDA 4J3XA 4FXSA 1EB3A 3OGRA 4LWWA 2CLLA 1HJWA 3KEHA 5C8BB 1TX2A 5HINA 4JIRA 1O5QA 4UB9A 4QR6A 1VGAA 3PY2A 4GX9A 4M7TA 1PTDA 1XYBA 5DY3A 3O06A 3W73A 4PMJA 1MQRA 3OBEA 5EMLA 3TMLA 1W1B1 5BXPA 2Y1HA 3N2MA 1M1BA 1KM3A 2Y63A 3QKZA 1I45A 2ASHA 4DLFA 1J01A 1K02A 3VD4A 2YFOA 2WBGA 2MUCA 2OXNA 3CU2A 1H7NA 4I5XA 3CGTA 1BG4A 4Y6GA 1ODZA 3IGHX 4HSOA 3GXFA 1HG3A 4JY9A 4CU8A 3ZT5A 4G1NA 4NASA 3DH7A 2J79A 3BLPX 3CBWA 4CUCA 5FESA 1DORA 3GH5A 2QGYA 2ZVRA 1SFLA 1CLVA 1UYQA 3WK1A 3UPWA 4R85A 4YTRA 4NZFA 4JIQA 4QNEA 2VC5A 3LQLA 1HJQA 1Q66A 4E4FA 3TYCA 4HK5A 4ENLA 2EEXA 1W2VA 4W89A 4XBKA 1A5NC 1ZLPA 1BF6A 1BVNP 2GPTA 3EPNA 2Y89A 2FZNA 1Q63A 4GZEA 2X05A 4PGLA 3ZS4A 3IANA 2J8TA 4Q7BA 1LBMA 4NXSA 4J1OA 4UQ9A 1L2UA 3W2KA 4QJ3B 4LV9A 1GQNA 2C8NA 2GVYA 3IIXA 2ISFA 7A3HA 3WJXA 3KCOA 5LYRA 3JVAA 3RN6A 3C8NA 3VE7A 1SO3A 1V93A 1GJUA 1DE5A 4UFHA 2G37A 2PBGA 3LG3A 1YBQA 1I2RA 3ZJKA 3TYEA 4EACA 5K2ZA 4GZIA 4RKAA 1DVJA 2D69A 1SU5A 1CENA 4QAWA 4LVAA 1WXYA 4Q4MA 4S3GA 3THAA 2ZRZA 1X6LA 3LCHA 3S9IA 3UNDA 2DW6A 2PDWA 2WMIA 2Q8ZA 3W7HA 3UCQA 2E09A 1GPWA 3AYRA 1XIBA 3CL8A 2ZCGA 1F73A 2DZTA 1WDRA 1XH1A 3LOTA 2F7FA 3GM8A 2X1UA 3CV1A 3NGFA 1OGSA 3VOFA 4AD0A 4ACZB 1JZ6A 1Y7VA 1KB3A 4GOAA 1OK4A 3H21A 4TUFA 4ZZ9A 1NWUA 2P88A 5K3VA 3MBFA 6TAAA 3VIMA 1W1PA 4MMWA 1J0ZA 1X8FA 3CUHA 1KTBA 2ISSA 2WV8A 4JY8A 5D8ZA 3EA1A 2POTA 4CU6A 1KFWA 3KDOA 4A3RA 1EF2A 4JTDA 5H2ZA 3VKDA 4TV5A 1Z9AA 4J2MA 1FH8A 3POHA 4AXNA 2OWXA 5REQB 1R47A 3ITOA 3RITA 1KNWA 3WK3A 5J5RA 2C91A 3WDHA 1Z8AA 4O15A 1OFAA 3GYEA 3ZJ6A 2VX6A 4HZ6A 3F4WA 1EP2A 4UCFA 4AF0B 2BVYA 1U1JA 5F2GA 4LAOA 4GXWA 3BARA 1LROA 4HJFA 5TD4A 3RDKA 3GNXA 2GVEA 4GI4A 3FV9A 1MDRA 2I9UA 4Z1DA 3VGHA 4L6HA 3ISIX 3B9DA 4ZTYA 3BQ5A 2OWCA 1UR1A 3TZNA 2PDPA 3CMJA 1DHKA 4AH7A 3T8QA 2VRJA 2XVLA 5D03A 3WYZA 1NQKA 4KWSA 1PB0A 3S5NA 2RH9A 1ZAHA 1Y5VA 1QVBA 4JFSA 4KMQA 4KRTA 4LBRA 2AGTA 3V0TA 3WKZA 2WSKA 4DNMA 2PDNA 3B8WA 4NAEB 1TRDA 3GE7A 5F1UA 1A0CA 2ZFAA 4F4RA 4XD4A 2PTZA 4ICCX 4XTIA 3MZNA 3KVKA 1FP9A 3GG8A 3G0UA 1UASA 1QHZA 2Y24A 5A2BA 4S2BA 1QO5A 2IMRA 1CGVA 3IGXA 3AZRA 5IDZA 4DM2A 1ZJIA 1REQA 1UD4A 3UYCA 3DKLA 3ZR5A 2QIIA 3U4FA 1H5VA 4FXFA 2YPIA 4WF7A 1MO0A 4I9MA 1V0NA 4QFUA 3OGVA 4AWSA 1Y5XA 5LA2A 2HQAA 3NNTA 4YCPA 4V1XA 2XUCA 4BI6A 4JN7A 2NVCA 4PE8A 3E49A 4ZXOA 4KS0A 3UPMA 4YPJA 1LT7A 3W26A 5K9DA 2QF7A 3C3NA 3UESA 4GWEA 5EMYA 1UWTA 1OYBA 3CAVA 4CCZA 3H4WA 5LGXA 4L1GA 4AXKA 4H6QA 3VNYA 4JIHA 3SQMA 1T8QA 4KT2A 2BB0A 4G5DA 3MCOA 2A3AA 3A22A 3MBDA 4FO4A 1UR4A 2QAPA 3K4AA 4MIMA 3AICA 1I9CB 2AKZA 4IJCA 1PSCA 2JKPA 1NDZA 4L9ZA 1ME7A 3QHMA 3V1HA 2W0UA 3UR8A 4Q4RA 4DPPA 3V5CA 5ABGA 2XM1A 3NQFA 4H3DA 3V5FA 1WKEA 1VFOA 1KKOA 1K03A 3P61A 4X2PA 3UWYA 1U1UA 1VCVA 3VOHA 4C1NA 2TPSA 1UH4A 4LBUA 4MJ4A 4URIA 4H6EA 1OD0A 1TO3A 5I2UA 3H53A 2VXNA 1Q7QA 4DEFA 4K68A 2A3LA 1L0PA 3KWXA 4W9TA 3VNLA 2BVTA 3BOFA 3IAPA 2XYLA 3PK7A 2VRQA 3SO7A 2FMNA 4IIGA 3VGGA 2FZMA 3KL0A 2G3JA 4H6RA 4BI7A 3GO2A 4KIRA 4UNLA 3EZ4A 3VABA 3AMCA 1K8CA 2PDUA 2FDSA 1XFCA 4ZQNA 4MZ8A 4LX4A 2H9AB 5BOEA 1US0A 3WLQA 1ECQA 4LS2A 1ICQA 5DLCA 2JGYA 2WCGA 1OT2A 1UOZA 3B4YA 4Y9AA 3ITTA 3NQVA 2BZNA 3WLLA 2VD9A 2JF7A 1UR3M 3SUWA 5KMYA 4ALDA 3NPUA 2MNRA 4GCAA 1KW1A 3B8UA 1A50A 3VIGA 1MQQA 3FEMA 2YBTA 1MXSA 4QDPA 1BSLA 1B3XA 3N18A 2PDJA 1WUFA 4JYEA 1ZY9A 3VDAA 4LAZA 3W01A 1Q13A 1MZRA 3N9KA 2GQ3A 3RR1A 1NWTA 1KV8A 2VQTA 1GEHA 2PD9A 3GVVA 2ZQ0A 2CLHA 3ONBA 1E6SM 2IQTA 4JNZA 1HL2A 3W81A 3N9RA 3KHDA 2NW0A 4XK2A 2WJDA 3NO3A 4CEUC 3SCUA 2ZDSA 2Y7GA 4XZ9A 1GVEA 1Y0EA 3NM1A 1NTHA 1CGWA 4FF5A 4FNPA 4PMNA 2FFCA 4XKYB 1FFQA 4XO6A 2YW4A 3KLKA 1A5BA 4XAZA 4C1KA 4IT1A 3SQSA 1W5NA 1PX8A 2HWGA 1U2YA 1XLEA 2DVTA 1G4TA 4XAYA 4B5VA 3UEQA 5ABEA 1HGYA 4QLKA 1KR1A 3POCA 3FJLA 4DXVA 3H2AA 1CYGA 3HIJA 2Y7DA 3KP0A 1XRFA 1G1YA 2W27A 1WCGA 2EXOA 1JAKA 1TIMA 3W1UA 2GGHA 2ZDRA 1WZLA 3BWWA 1A5SA 5G2HA 3RF9A 3UT0A 2YGYA 1UBSA 1JR1A 1V03A 3KZSA 4NX0A 2ZC8A 3RUBL 1W5OA 2ZZ1A 3T0TA 5ENLA 3WH5A 3W7IA 1BKSA 4GE8A 2DJLA 1QR7A 1IHIA 1FWAC 4AMCA 5LGZA 1CBGA 1WKYA 3C56A 1V3MA 4B5TA 4EPDC 2NQHA 3D3AA 3NL3A 1MFUA 5D9PA 1EJTC 4PMOA 3UG5A 4PBEA 4W84A 3B8VA 1OFBA 5LIKX 1R3RA 3TN6A 4EAYA 4UMCA 1XQKA 1JZ5A 3F4NA 2DGAA 5LNRA 1H50A 1Q6EA 4RE4A 3RMEA 3G3DA 3P93A 3THUA 1RXOB 2WSPA 1TSIA 1MNSA 3HPFA 1A0DA 1C8XA 4IICA 3R5EA 3OHMB 3MKCA 3TAKA 3M0HA 4CN4A 3PJTA 3QQ1A 2D23A 3APYA 1VRDA 1XBZA 1ZP3A 3VINA 3TC3A 9XIMA 1LOSA 2V3EA 1ZB5A 4GABA 1XL9A 2A3EA 4IL0A 5FJOA 3O8AA 5CGQA 4JTEA 4UMBA 5DT5A 5HUOA 4CU7A 5D33A 2D20A 2PS2A 4J3UA 2QV4A 1ITUA 3S4TA 4JEJA 5PTDA 1H62A 1KV5A 2HE8A 3OZYA 1UKQA 1YIXA 2G3MA 1JGMA 3GU1A 1OGBA 2BOFX 4GC3A 3W1XA 4L65A 4DO5A 5JH2A 1FWCC 4NAFA 3QZEA 1GVRA 1WOBA 3WJSA 1X6NA 4P61A 4AVOA 4L6OA 2PWHA 4NI3A 3AYVA 3PF3A 3YPIA 5FSDC 3LSBA 2IXVA 1UC4A 4WKHA 1KC7A 3TQVA 2CKRA 4IJBA 3V5OA 2J9XA 5AC6A 3PZMA 4HPJA 3SAZA 5C9UA 2OGYA 4NP7A 2QPSA 3V18A 2FHCA 4PMRA 2QUUA 1S2AA 3AIWA 3QMSA 3LB0A 4QISA 3M4HA 3USBA 4HTYA 1MQPA 2GJNA 3CL7A 3KDNA 1AFSA 2RGMA 4G7FA 4B3KA 4PUEA 2OGJA 1RBLA 4JKMA 3P67A 4RE0A 1JZ2A 4IGSA 4DZHA 3OB8A 3LLDA 2YDSA 4X2RA 2HVMA 4E3TA 1H60A 2BS9A 3B9EA 1NH6A 5GQBA 1IE7C 2WW5A 4HHHA 5K4XA 4DBEA 2J77A 1M5WA 4IP4A 4GJ1A 3L4YA 3WF4A 2DFAA 4AB4A 1S3TC 3L2IA 4XUGA 3H23A 1KWKA 3PZTA 2JF6A 1R2TA 2KZHA 2PC4A 4IF2A 5HQLA 3N11A 2VRKA 4UQCA 4Y9NA 3UCCA 5DCBA 4EVZA 2J88A 1UWSA 4QE5A 2Z7KA 4MB5A 3NPWA 4ZB2A 5A8PA 3EBVA 1DJWA 2ZWZA 1NU5A 2V63A 3FVDA 3GC2A 3LUTA 2EHHA 2A4AA 3OYXA 1ZS2A 3O05A 4MB4A 1M68A 4OBSA 3UG3A 3L5LA 4RXGA 1WDDA 3NCOA 2SFPA 3U2ZA 2B7QA 2V5CA 4DELA 4LFYA 2VFFA 3V0SA 2OSXA 3WF0A 3C6CA 1I1WA 4MF4A 4F2TA 3UZWA 3DG7A 3VKKA 2OKOA 4Y9MA 2OWWA 4Q8TA 4JN6A 3HMCA 1G0CA 2WHJA 1J4EA 1C92A 1DIOA 3ARPA 1IZCA 4E0CA 4TIMA 1FHDA 1VZWA 2QCDB 3NQGA 5C2CA 3GNOA 1J11A 2EG8A 3W76A 4PFHA 5DCDA 4GIEA 4FMVA 4LT9A 3TN3A 1PZ3A 2XIOA 3ALFA 1TTPA 1N7KA 3H7RA 5CBBA 2GJPA 4WCJA 6XIMA 4A8RA 2X1IA 5BCAA 1KGWA 3V0UA 3ECQA 1A4MA 3VIFA 2ZBTA 5BMXA 1JCMP 4P8XA 1FDJA 3RCNA 3MSDA 3NR0A 5EU9A 1KM6A 1OGGA 4HA1A 1MXGA 3FIGA 4JL1A 4PTDA 1K77A 1CIUA 1QDSA 4IISA 3WIJA 4OE7A 3CYVA 5DO8A 2Z25A 4ECLA 1Q6RA 5CG7A 1NVMA 2XFYA 5HMDA 1VH7A 2WWDA 5HWMA 1O95A 3S2NA 1TMHA 3WUGA 4DXKA 4J35A 1ZBKA 2DZWA 3KP1A 1OX6A 1GTHA 3OOQA 1BPLB 1Q65A 3KS6A 4LYKA 5H91A 2JQXA 5A8QA 3MO7A 3CZJA 5CBIA 4BCEA 5I03A 2WMFA 1X8CA 3N14A 1GW9A 3O2LA 1C93A 3T05A 1MVYA 2ACRA 3OZMA 3VX0A 4DWSC 1VBRA 1TREA 3UWVA 4HOXA 2XH4A 2Q02A 4I6VA 3AISA 3DFPA 3MO4A 3BAYA 3U57A 1SR0A 2RKXA 4TO8A 5FJIA 2IXUA 1EP1A 1QRQA 3HPAA 1NFGA 5I0DA 5JMUA 4GQGA 4MPKA 1KGXA 3N6HA 4MAVA 3O0FA 4DAFA 1TJPA 2FJKA 1U5JA 3L4XA 2PC8A 2V68A 4B5UA 1K9EA 2XSXA 1NOUA 3AJ7A 1QWKA 4C6IA 2FTWA 2PZNA 3DERA 2VGGA 2OODA 5M5DA 1S38A 4N6EA 1K9FA 1OIMA 1ZPTA 3KZPA 4DF1A 4H1ZA 4Q4OA 3T81A 1P0BA 1E5NA 3S1GA 1KTCA 3HOJA 1GOQA 1PIGA 4GZ7A 1XFBA 2BP1A 4FR6A 4ORIA 1JD7A 2F61A 4AYGA 4HZ8A 4V33A 3HO8A 2OJPA 3RPTA 3I6RA 4QP0A 2BY0A 3KLLA 3BANA 3BVJA 3B40A 3BICA 1W5PA 3NFUA 5C2XA 2BOEX 4IIBA 1IT7A 3QMRA 1XBYA 1LLZA 2ABAA 5C9XA 4UNKA 5EFDA 1XWYA 2IUZA 1DXIA 3Q58A 1V7AA 1I6NA 1F61A 3GH4A 1OG0A 4HA3A 1W9PA 7PTDA 2X7VA 1XF0A 2X1TA 1TR9A 3LCGA 4D6IA 1ONXA 2TSYA 1YTKA 4DYEA 4GKTA 4JTIA 3CPUA 5G4EA 1LZOA 2G5WA 1UA3A 3XIMA 1W17A 4NZ5A 2GGEA 5HPCA 2V3FA 3SBFA 2DIEA 1QCWA 3ID7A 2YW3A 1ICSA 5JH1A 2PDCA 3VUSA 3IPWA 2QF8A 2QJNA 1OY0A 2XVPA 4B3LA 4FSAA 2YCIX 2YZ5A 3EOOA 1CGYA 5AHEA 4XIMA 1Q6DA 3WD1A 3K8MA 3SCSA 3B3DA 4MY1A 2VHLA 4R9OA 2XWEA 1S1PA 3LK6A 4BA0A 4UQAA 5A95A 4N4PA 5B7ZA 3UZ5A 3TNBA 2Q01A 2RDUA 4OBTA 3CYJA 1QOPA 4YYFA 5FL1A 2YZRA 5FAGA 9CGTA 1H49A 3CEUA 2R8WA 4ZO6A 4TOQA 2VEMA 1K7EA 1TTJA 4NRRA 3D3FA 1DXEA 1IIHA 3NUKA 4DYKA 1KWGA 2ZOXA 1IXNA 3BPWA 3C3UA 3UD6A 2ZX7A 3F2BA 4O1AA 1ZALA 2DSZA 1QUMA 4ZQPA 5FJJA 4HNTA 1XM3A 1T41A 3AU2A 1W56A 4OOUA 3SDOA 3C2EA 1PKMA 4N9EA 3REQB 4XO7A 3B97A 1TMQA 5D2WA 1UZDA 3HJEA 1MYRA 2E6FA 2J62A 4DQWA 3QXBA 4UFMA 4PUNA 1QNVA 1KQYA 3VUPA 1OK6A 3E9AA 2HNHA 3W1RA 4BR1A 1J79A 2YCLA 2O0TA 3EDKA 3D47A 1TZ9A 2WKJA 1XBXA 2Z4GA 1L6WA 5AKQA 1R46A 4GIAA 3C2VA 4R7JA 4N42A 2O56A 1WO2A 2BHUA 4L7ZA 2WJFA 4I7UA 3DGRA 1B9ZA 3NYZA 3QBUA 4QGCA 4V1YA 5M3WA 5LIUX 3UA3A 5XIAA 1CGUA 3IVSA 1VFHA 2Z27A 2I5GA 3OGSA 1GG1A 1PL9A 5D30A 5TAOA 4QJ5B 4JIEA 5BMWA 2VGBA 1KBKA 1QFEA 1VJZA 4X63A 4A35A 4C6OA 3FN9A 1JFXA 1TUFA 3TE9A 2XH0A 3P60A 4JTCA 5HNNA 2Q09A 4C90A 3W9ZA 1POKA 2XSBA 1L9WA 1PKLA 2XHYA 4GBUA 5DMMA 4K7VA 3TFCA 1D3GA 3LHZA 1I2NA 3LHYA 4KH2A 1ZJBA 1EQPA 4PL2A 3IIPA 3SY1A 2HVNA 4IQEA 1J5SA 3AU6A 5HR6A 3QYQA 4ML4A 4LC6A 1T99A 4BI5A 3W1LA 1AH0A 1VFUA 5IOBA 1GCYA 1T96A 3GB6A 3STFA 1AQMA 3JZUA 1Q2SA 1OFQA 2OQLA 5I3IA 1PKYA 3S2JA 1P6CA 1YHTA 1QNOA 2PGFA 3MUZ1 3ABSA 4BS0A 1XLBA 3ZXWA 1IGWA 1LWIA 5A6TC 2WO5A 4RXFA 2HK1A 4WQ6A 1E9ZB 3FSUA 4GI8A 1CXFA 1EXBA 4Q6XA 8RUCA 3QEZA 4QLJA 1EP3A 4Y7EA 3IK4A 1S2WA 1NWSA 4RK8A 2AL1A 3WCZA 4N4QA 3GHTA 3CTTA 1WOAA 3HF3A 3SFKA 3MUY1 1RP8A 1XRVA 1JJKA 2JALA 1TJ1A 4ZA0A 1FWDC 5E93A 2FFIA 2WHLA 1OG6A 3ABOA 4TMCA 1QMLA 1B3WA 4S3BA 4U4MA 2XIMA 2F6UA 3MP5A 4MYXA 5T9CE 3VU2A 4B2DA 3N34A 4H8HA 4H00A 2QUMA 5LNSA 3GR8A 6TIMA 4UFKA 1FWRA 3B05A 3W1TA 2VEIA 3BAXA 5AC8A 1E0WA 1C8YA 1OX4B 1R3VA 4XVDA 1IWAA 3ITLA 1WDSA 4Q33A 3W3OA 3MJYA 4RDVA 1IZKA 4M19A 4OU1A 1G9HA 1WNOA 1NFBA 5KZDA 3PPHA 4WJEA 3P5YA 1XQLA 1V8EA 1YPXA 2GOUA 3WELA 4DJDA 3S5ZA 5D4YA 2WMGA 1Q6FA 3PG8A 5CPQA 3MANA 4K7YA 4PRWA 4MFEA 1BQGA 1NF0A 2YA1A 3W6YA 2OYLA 3S9YA 2JK2A 1GKQA 5C0QA 2WANA 3ZMRA 5D9MA 3M0VA 3W4RA 4QQUA 1H51A 1XCFA 1H4PA 4S23A 1ADOA 2PAJA 4XV0A 4JXCA 3N2BA 3VKBA 1H2JA 3V75A 1RQEA 1XLCA 3HJZA 1YDNA 5H8MA 1IEQA 1GZ1A 3BW2A 3B0PA 3SM0A 3O6DA 4ZOAA 1VBHA 2FB2A 4EX4A 2VJXA 4MB3A 2GSHA 4HPHA 3O3RA 1SYTA 4UFIA 3M7WA 1J2WA 2G50A 3GRIA 1D2KA 1TTQA 2ZKMX 1JAEA 2PPGA 5CQ1A 3QOMA 4O13A 3PZQA 2PWUA 3GHRA 3DG6A 3UWUA 4MADA 4G7EB 3W7JA 2C3ZA 4MHBA 4N0RA 3T4WA 2DIKA 1JYXA 3BJSA 4XZBA 1TJ2A 3P7YA 3WH9A 3GAYA 1A49A 3OU8A 4LY8A 3EB3A 3SEPA 2OQYA 3FHQA 1UR2A 3VNKA 3WLJA 4IQLA 3NDZA 2OB3A 2C6QA 5F1VA 1PIIA 1XLDA 3CIXA 4WJXA 3UWEA 5EBAA 1W1IE 3PBGA 4ZO8A 3A64A 2CLIA 4JIIX 1QOXA 2VWTA 2WCAA 2XVNA 1JCXA 4PRRA 2G3NA 1JF5A 1X1OA 3KOXA 5FF4A 1PAMA 4KEZA 3N19B 4BF5A 1V51A 4P8WA 4PN2A 5BWFA 1E0VA 4FNQA 3O0KA 1Q45A 4AZ7A 2ZX8A 2NXIA 1SQ7A 4WDXA 4MUZA 1V02E 3NVTA 2V30A 1KXHA 5B80A 3DFSA 1VPQA 2BASA 2ZE3A 2GJXB 2YOCA 3W7CA 5C71A 1W1TA 1O1ZA 4QS6A 3BLOA 3UY8A 4O11A 4ROPA 3BLEA 3KM8A 1E4MM 3UXAA 2Y5EA 4GYJA 5EMKA 2W62A 2GGGA 5CZTA 4BQ5A 4LPCA 1G67A 4GYFA 1NARA 2VZTA 1VCGA 5HQEA 2CLOA 2J8GA 4XB3A 3RGTA 3QVQA 4OJYA 1RA5A 1B57A 1XV8A 3NGJA 2XFRA 1M03A 3CUGA 3F4VA 4LVGA 3ZSTA 4XAFA 2POZA 4FK9A 3T0DA 4HQVA 5U4NA 3CPRA 1FCUA 1KCZA 3OVGA 3PC0A 2PTXA 4DI8A 5GJPA 1MZHA 3CPGA 3E12A 4A21A 4HMNA 1EIBA 3PS7A 3L68A 5G1YA 3NDOA 2EPLX 3TN4A 4WR3A 1EH9A 1TWIA 3F5JA 2WPGA 3CMGA 3CUZA 2VDIA 2YKKA 3GFZA 2VC7A 2QCCA 2VP8A 2IKHA 3DC0A 1SZEA 3GXPA 4TTGA 1ITXA 2IPWA 3TLLA 5AECA 3ARRA 5I23A 3CASA 5JIPA 1BVZA 2WVVB 3BDKA 3GG0A 3HG3A 3AMDA 2TODA 3WBXA 3WDJA 5GPRA 3BLDA 1LL6A 1GYMA 2X41A 4RL3A 3W00A 3VMPA 5LHFA 1W1ZA 2FH8A 4UTKA 1I0BA 3FNDA 3PVFA 4P5UA 4AHOA 3I4KA 4TX8A 2D2GA 1Q8JA 2YBVA 1YEYA 2Y8UA 1JUKA 3PZIA 1HKWA 5LA1A 3VAVA 1E1FA 4XD3A 1BVWA 3QOKA 4L5ZA 4FPSA 1BXBA 1YPIA 4QSFA 1XLMA 2EJAA 2P8CA 2GSJA 2G41A 4HYRA 1OEPA 4UBPC 3VM7A 3S2CA 1EJVC 4O4WA 3T42A 3STPA 4GNJA 1DWHM 4UTHA 5LIWX 1CT5A 3IJ7A 3IV8A 3L4VA 4PB4A 4QEHA 4CD6A 1WP6A 4H4IA 1UPPA 2GVGA 1Q5MA 4CQ8A 4JYFA 3VNDA 1MXDA 1RLDA 3M5XA 4PBGA 3WZ0E 3JS3A 3NO5A 4YVPA 1WBHA 3PTKA 2FYMA 4H9ZA 2QPUA 5LKYA 2VVSA 3URAA 2E8YA 3EA3A 4S3CA 2R24A 3LNPA 4QCFA 2YFNA 3JW7A 1SPQA 3PBWA 1UQZA 1V79A 3AI0A 3SCNA 3N4FA 4PMYA 3U3HA 1JCNA 1EWEA 1HJXA 3P2VA 4GVGA 3D46A 4DJDC 1B3OA 1E9IA 1EBGA 4HNLA 4L61A 5J8LA 1TE1A 2OX1A 5E0CA 2PZ0A 1PPIA 3GDLA 5BZAA 4D6JA 4E8CA 4EP8C 3OIXA 4DZAA 4JQ4A 4LBSA 4AQLA 4OHQA 3ZJ7A 1RZMA 2Z29A 3AHYA 4G6CA 4QG9A 2J13A 1XP3A 2XIIA 2WYSA 3GUWA 1EEXA 2VC6A 2CZVA 5EPDA 1LRQA 3IAQA 3ZIZA 5EMJA 3TLQA 5TNVA 3UZYA 2IQ0A 3AXHA 1E51A 5BRPA 1WDWA 3DECA 3VOIA 4JKKA 4TMBA 5DMLA 2ZA2A 1PVNA 2PDBA 1DQWA 3LZ3A 1ALDA 4IG2A 5LHEA 3DHPA 3KWSA 3S46A 1FWGC 4RNHA 4P7RA 5D37A 1MI3A 4CD4A 4ERAA 4I7VA 1B90A 1BF2A 2KAUC 1NSJA 3M16A 3VKJA 1PX4A 4U3AA 4E8DA 3EX6A 3P8IA 5LNUA 1RK6A 3B0VC 4HPNA 2E6YA 1BEUA 4CEXC 3FEQA 4OV4A 1A5AA 3H2NA 4JEQA 3TX9A 1VLIA 2UWFA 3S83A 4EXAA 3T09A 4B9YA 2CYGA 3S5SA 3F4CA 1OD8A 1J9YA 2Q6ZA 5EB8A 1HZYA 4REQB 1XW8A 5D2TA 3PAOA 1Y5WA 1YQ2A 1PTAA 4UZSA 4A8LA 3I6EA 1Q6LA 1TJ0A 2QKFA 3A3XA 1OC5A 7TAAA 4O10A 3BGJA 1SZNA 1FKWA 2IQDA 3LXCA 5A6AA 1P5BA 4GRSA 2QT3A 3GWQA 2W63A 1MEWA 5TF0A 3F2DA 3AOFA 4B5XA 2LLEA 2G97A 1EGVA 3NOYA 4H01A 4W8BA 1W3JA 1P4CA 3PUGA 3WQPA 4ICMA 4LANA 1XIHA 1UZHA 1BWVA 1TPVA 2Z24A 1WX0A 3IJIA 2DSVA 3NIYA 2PDHA 4R7OA 4DJFD 4W5UA 3U8GA 3SRKA 1DJIA 1XYCA 3VKCA 3GXIA 4GIRA 4NSBA 3WNMA 2HVOA 1M9HA 2CIPA 4Y96A 3QZAA 1Q6QA 2AL2B 1YTEA 3HBLA 1GYLA 2E67A 3W38A 1XIIA 4AAJA 1S5TA 5KZ6A 1HX0A 4RW3A 3URQA 3H8AA 3VNMA 3H7VA 3UY7A 3T44A 1KM0A 1AMKA 3ZO9A 1CCWB 4NJHA 4HT3A 3FDGA 3PBYA 1NWRA 2XVKA 1KCXA 3LNMA 4Z1BA 4YHGA 3KOWA 3GFYA 2Y6ZA 1J18A 2CBVA 3WNKA 3CS2A 3CUFA 4H9MA 4BQ2A 4TVCA 1ZSXA 3W7QA 5JBEA 1SSGA 2OVLA 3TSBA 4AC7C 4LS1A 5D9NA 4GYPC 2DY3A 2PRHA 4JPGA 1BWKA 4E2OA 1ML1A 1LBLA 2E4TA 2A1YA 3BC9A 3LHWA 1EPVA 1XRSA 1XSKA 4HU3A 3GC4A 4B2DD 4HMEA 1UIPA 1X98A 1M7PA 1J0KA 3CT2A 2Q3OA 1DWFM 1K9DA 3F1QA 5CC5A 4M80A 5AHLA 4WDTA 3RLGA 1XIGA 2I14A 4IQJA 3R8RA 4YL2A 1JDFA 4GQRA 4LXFA 4IZGA 5E0KA 3LRLA 4I5UA 3W7GA 1R3WA 5CKSA 3IV3A 4D6FA 1BTCA 4DF2A 4ZQOA 4B16A 2YL6A 3STGA 3DUGA 2DZUA 4BEQA 3P0XA 3BMWA 5AC4A 3DFHA 3IK2A 1VPXA 4XAGA 4GHRA 2R1MA 3CTLA 4AIBA 1HJSA 1H11A 2UV8G 1GKRA 3WK2A 5C7VA 5CPNA 2VFEA 3MW7A 1J96A 4WKAA 1YMYA 2F8QA 3W74A 2NUYA 1R30A 3KFTA 2WSQA 4ZBCA 3R10A 1VKFA 4EXQA 2H8XA 3SRFA 3GYCA 5JBDA 4W88A 3R79A 4ZO9A 3DKJA 4AZBA 4K3ZA 3M0LA 3ZT7A 1SFJA 4GO8A 4WSHA 3OA3A 2OZ3A 4ZCWA 1YXDA 3E38A 3FGCA 1KRBC 1SMAA 2W92A 3DXIA 4A6GA 4AD3A 4ZFCA 3QGVA 1F6YA 1DWIM 3DX5A 4KGLA 3BOLA 4GNKB 2FDMA 1RY0A 2AKMA 3W1QA 3TWBA 1H0IA 2CNCA 3NO1A 2QW5A 4HZMA 3W71A 1P0EA 4C5ZA 4B9ZA 3PPCA 3ES8A 4GVIA 1V7YA 4O12A 1RCXB 3WL0A 1JL8A 5AFDA 2VZVA 2W9MA 3N2CA 3Q37A 4EK7A 1ZJHA 4B5WA 5B7YA 3NQAA 1P0DA 5CSRA 1W3LA 3EB4A 1W5QA 1ZBVA 2QULA 3A4AA 4UTWC 3TTSA 1AZ1A 1QBBA 3WNNA 3W29A 2J7CA 4U10A 2VNCA 2W4XA 4AY7A 3O9NA 3LXBA 2NX9A 1B54A 2UY3A 4J4KA 3WENA 3GX9A 1IZJA 1Z32X 3WQWA 3KHJA 5G5IA 4IG2B 4WXZA 4QSHA 1PZ0A 4FNUA 4MSSA 5GNXA 2QIWA 1FWSA 1W5MA 4HCDA 3HZ3A 3PFRA 4K1WA 4PUUA 2XFFA 1FWTA 5CZKA 4JGDA 3TNOA 2WMKA 4UIOA 4XZMX 5DT7A 3THDA 3IJLA 4WOZA 4GQ0A 3MKVA 3B04A 3WUEA 5EMMA 2J7EA 2JGQA 3CLWA 3T2QA 2I1OA 3HURA 1EDQA 1HFBA 2QAFA 1UJQA 1RLCL 1VBJA 2O92A 4HYWA 5KITA 1DIKA 4R88A 4O17A 4YTQA 4CGTA 3RJXA 3CB3A 1Q3NA 1EZWA 4D71A 2VDHA 4W8AA 5HANA 4I8DA 1A53A 2PF8A 4IFKA 2QJIA 2ZIDA 7XIMA 2XVGA 4NYYA 3AUJA 2Y62A 1SSDA 3LEPA 1Z89A 2QJMA 5F2IA 1SFTA 1RP9A 2WNNA 5MKGB 2YBUA 3CQIA 2EQDA 1AJZA 3UG4A 1PKNA 4Z1YA 4C6KA 1YE6A 2DH3A 1TWDA 3GBDA 3KOYA 1S5WA 3AXKA 5CGTA 2A2IA 1VPYA 1HT6A 2QCLA 2FZBA 2J78A 3PZVA 1GW1A 1ME8A 1SM9A 5EMUA 5G2IA 5ABTA 5A8MA 4QG6A 4C6FA 3L12A 4MKVA 1RBAA 1E71M 1GEQA 4OIFA 1ONWA 1IR2A 1OC7A 3RIKA 2CFFA 4RX0A 4C6PA 2J7GA 1EYWA 3CK5A 1LRNA 3JRKA 3V1PA 1S3HA 5EKYA 3C5QA 2C7FA 3B06A 2Q3RA 1GQLA 2NQ9A 3VPLA 1XUUA 2Z6IA 1AMYA 2CLEA 2XGZA 3WQOA 3W85A 1LWHA 1RVKA 1KXVA 3KRBA 4WJ8A 3RK8A 3G1VA 1P7TA 1YTDA 4LRSA 4GYPA 2VZOA 5I3JA 2J25A 3WK0A 3WQCA 1KD0A 4KIEA 1AD1A 2Y5SA 1UMLA 4H04A 3HM7A 4J9JA 4PMZA 1OZQA 1DJYA 1XYAA 4J3SA 3OG3A 4Z2GA 4D2JA 4P8VA 1KR0A 3OLEA 3EWBX 1W9BM 1PYMA 3WJZA 5ECVA 3H7UA 3SUTA 4LY4A 4HNUA 4Z2HA 1KM5A 1EOKA 3UXLA 3NM3A 3W1MA 3CHEA 3TAOA 5I00A 2A85A 3MU7A 3N1AA 4PTVA 5T8GA 1M04A 3VDBA 3ZLGA 3U5YA 2XG9A 1YYAA 4EAMA 3TR2A 2J6XA 1OHLA 1V6UA 1XLKA 2NQLA 4XIAA 1EJ7L 4X22A 3TQKA 1UKOA 3BK0A 2BNJA 4Q8WA 3VOJA 4AD5A 3EAUA 1CXKA 1DTUA 2JKEA 1YBQB 3OA5A 1ESWA 1EA0A 1E73M 1OBAA 3NZPA 4CNNA 2C16A 4D6EA 1ZAJA 4UTUA 1D7KA 3VZZA 1DYSA 1F4HA 4IPNB 3BW4A 4JHOA 1K7XA 3HN3A 2KX9A 3CZKA 2DW7A 1W9UA 5K9XA 3Q65A 4DZIA 3THCA 4TR9A 3H4GA 1E1EA 4ZO7A 5ABHA 4RZ6A 4KCVA 5TIMA 5BWAA 2G95A 4G9PA 2YB4A 4F48A 4Z1AA 4KCUA 1VENA 3BGAA 3DHUA 2V3DA 1MUWA 5AYZA 1EEPA 3W72A 3AMLA 3LPOA 5HWNA 3G8RA 3MDUA 1NIUA 5A94A 4Q8VA 2V0TA 2O7QA 1F6PA 2HCVA 4IMFA 2JEQA 3LPFA 3MMDA 2L5HA 2NQ5A 3TONA 2VCAA 3E2SA 1EYEA 1C7SA 4EF9A 1CWYA 1GOMA 3RPDA 4LSBA 3D0CA 2GDVA 1XGEA 4QLLA 1YXCA 4QROA 3W1PA 4FF7A 5DN1A 2J7DA 3R94A 4F3HA 2QUTA 1VJIA 1G6CA 4GC4A 5HATA 3MMWA 2RFGA 3LV6A 2HISA 2BGNE 3KX6A 4LAUA 1IIGA 4O0QA 3VD9A 4RUBA 3AWNA 1O5XA 4KCTA 2BXYA 4JICA 2FGZA 4X3ZA 1UBPC 1YDVA 4NF7A 3PHAA 4LTSA 1OYAA 3KUMA 1H1NA 2OT1A 1V6VA 5CC7A 4J3ZA 2DZAA 3VIPA 3WDQA 1UWQA 3SCRA 3TJXA 4JTSA 3TOPA 4U3CA 4IIDA 2PRMA 1FXQA 3A24A 3W7PA 2O9PA 3EPOA 4DJEC 3BLIA 1AD4A 3UZXA 4PMDA 4R33A 5ABFA 1M3UA 3FJ6A 4AX7A 1KFEA 3LZ5A 1HGWA 2XN0A 2PI6A 3N12A 4GK8A 3H24A 1R3QA 1JZ3A 4UR8A 2OZ8A 3URBA 2AQVA 4FEZA 1B30A 1ITQA 3SSZA 2VTFA 4E4UA 3TQPA 4Z42C 2F9RA 3QPZA 4V2XA 1REQB 4M1BA 4P7LA 4FS9A 2FTPA 2WWCA 3LXAA 4BHYA 2Z2UA 5C9RA 1O60A 4LYQA 2A3HA 4ZODA 1LL7A 2PSNA 4UTMA 1GVYA 2FPVA 3EMCA 1EUAA 4Q7NA 4LRTA 1I2PA 4KFOA 3PR2A 2NV1A 4HK7A 4LJ3A 3LLXA 2YL5A 4OV9A 1YDYA 1CB7B 1OSEA 4MJ2A 3OZPA 1IT8A 3AUOA 3UWQA 2OX4A 4ZQMA 4YS1A 3BV7A 5I3KA 5CPMA 3VIKA 1GZGA 3AAMA 2XPKA 2A79A 4F40A 3GDRA 1JNEA 1L2QA 4WY0F 4Z08A 4RDZA 2HXTA 3NQ8A 3TXVA 1TVPA 4W93A 5CBJA 1A5LC 1V02A 4XD5A 4RR4A 1QK2A 3RJYA 3U2CA 4N9CA 3H2CA 3VK5A 4FOUA 4PCPA 3WH8A 1FXPA 2PB1A 4S3JA 2QPXA 4JTUA 3ZR4A 3Q67A 1IXPA 2J27A 3MWCA 1UP0A 1QHOA 4MZYA 2ZZ7A 3EX1A 3DBNA 4C7FA 4EPKA 4GMEA 3TTQA 3AS3A 3QN3A 4W5ZA 3N29A 4MM1A 1R3SA 3L5AA 1EX5A 3AHTA 4FA3A 4GUGA 3WFZA 3A21A 5IDIA 3IS4A 4BJHA 2OLSA 1F3EA 2FH6A 4YJ5A 4M6UA 3EKLA 4JNYA 2QDEA 4YN5A 4HU4A 3UZZA 3HV8A 3S5OA 3AIEA 3N2XA 4YNGA 2QGHA 4XTDA 4B5NA 3LHTA 1C3FA 3QFWA 1JCTA 5C54A 3N17A 3OZOA 4AC1X 1R9XA 5EBUA 1U5VA 3EXTA 2OYKA 1E1CB 1IT0A 9RUBA 1WDQA 2QCGA 2VENA 3PBUA 4YXGA 1BAGA 1K7FA 2H6RA 4Q6JA 3WO8A 3JZEA 4N02A 4RDWA 1AJ0A 3UVAA 3UFYA 3AIBA 4NG3A 1JULA 3PBVA 3G0XA 4GLEA 3G8EA 6PTDA 1KO0A 3W53A 4MZ1A 3WLTA 3BCJA 4CQCA 1ISXA 4E6MA 1BFNA 4FOKA 1THFD 5BXTA 4NJJA 4S1FA 5I09A 3S6DA 5EL1A 1H7OA 2VGFA 4RZ4A 4GCXA 2ZUSA 1TR1A 4IMDA 3IEBA 2QDGA 5FEXA 4IMEA 1H7XA 2ZRYA 3ZJ8A 4D8LA 4Z0JA 3NL6A 1BRLA 4UFJA 3LRKA 3LBOA 2ISDA 3IRDA 3FKRA 2GUYA 1LWJA 3FS2A 1RH9A 2WSYA 1W54A 4WX2A 1KRAC 2IW0A 3AXIA 3ARQA 4KETA 1V3IA 3GVGA 2GUBA 2J24A 5FJPA 5IM51 1Z42A 3GAKA 3GTNA 4F2UA 3W7EA 4LC8A 2E8ZA 1LRTA 1QT1A 1WYIA 3DAQA 1FWFC 3BV4A 1GQIA 2R6OA 1WBJA 1HF6A 3NVDA 4UTLA 2HMCA 2OTDA 3IIZA 4KWUA 4EWJA 4DUOA 2OOFA 1B5TA 2J7BA 4HK6A 4XBJA 2W67A 4FIRA 2HSAA 3UXKA 3ARZA 1A5OC 4M24A 4UTIA 1CEOA 4MOZA 1S46A 3C0QA 3UA4A 3H2MA 1A5CA 1GPFA 3TYDA 4IPJA 4UTJA 3CAKA 1FVPA 3R8GA 3NQEA 2DVXA 2DIJA 1YRRA 1OT1A 7CGTA 4HHLA 3TSDA 5HWJA 4FXJA 1M53A 3N13A 1NP0A 1FHLA 2R94A 3M0YA 3V35A 4UOZA 4F9JA 2Q71A 4Y8EA 1T7LA 3BUVA 3W7NA 1DWAM 1UR8A 2WVVA 2ZWYA 1SJBA 1F5ZA 3WLPA 3R89A 1IQ8A 1DJGA 1BXNA 2YCEA 4KEMA 3KW3A 4YMZA 1RQHA 1DHPA 5FEPA 3TROA 1WKFA 4FXRA 4MNLA 4WUIA 1ME9A 3RO6A 1QPRA 2QYGA 1VYSX 2C79A 4A3YA 3QV7A 2B0MA 2E5BA 3DFQA 3CQHA 4ZE4A 3CXOA 1T8XA 2OLHA 3CB8A 4V15A 4X9YA 2Q8LA 3LCIA 2QDDA 3QC3A 2CXGA 3W27A 3G1SA 2WMIB 1DEDA 2VMFA 1XS2A 4AMAA 4PTMA 1TPH1 2Z00A 3VO0A 5A6BA 3GXMA 2WVTA 4OECA 3WUBA 1CLXA 3UQNA 3WQ6A 1YE4A 2EPKX 2OKTA 5HMSA 5T91A 4CLMA 5CJMA 2YL9A 4X0NA 1ENUA 4CN1A 2DH2A 4RW5A 4GUFA 3PFMA 4F0RA 5A3HA 5E5CA 1K8XA 3I65A 3QQWA 3WD3A 5FF3A 4ASTA 4DJFC 4HNVA 1RSCA 3P74A 1LOQA 2QDHA 5DANA 1QPQA 2X2GA 3UXIA 5C9ZA 2EGZA 2ONEA 2VC9A 3KBMA 4S2CA 1QW9A 1RD6A 3BMVA 1NOFA 2DZXA 2Y8KA 1DJNA 3WH6A 4H19A 4FB7A 3W7MA 1XH2A 1IYXA 1J0IA 3MUIA 1YADA 3R43A 3FOKA 2MANA 3R0KA 4GNVA 4D72A 1E6PA 4LUTB 1TWSA 1VD6A 3L23A 2B7OA 1LJYA 2UBPC 4D1JA 3IIOA 1W1YA 4ONVA 3PZOA 4JTFA 3P0WA 2EPOA 1XUZA 1J0YA 3WQ4A 3L0GA 5HBFA 4PSRA 1VLWA 2A6NA 1SZRA 1UPMB 3EWXA 4HPGA 1G4SA 3W07A 3AYSA 1L6YA 1M7JA 4UC5A 4M8UA 3OBKA 2X30A 5CPOA 4EXBA 3COTA 2UY5A 3DC8A 4FLRA 3LCFA 4PTXA 1EHNA 5FACA 5SWUA 3RM4A 1P43A 4IFOA 3NDYA 3ZFHA 2CLMA 2ZRVA 1KXQA 1OQFA 1Z69A 5F4XA 1QW8A 4PL1A 4IGMA 1JNDA 2AMXA 2NX3A 3N6JA 1GZJA 3T6CA 3DI1A 3GY1A 3GU2A 3K1GA 4RNFA 4HIBA 4ATLA 3C0LA 3QR0A 2QR6A 4XAPA 1Q6CA 3S1XA 2XWDA 1SJAA 3CHCA 3M6DA 1FY6A 4NZJA 2REQA 1Z44A 2PODA 4P2VA 3BE7A 4XVEA 1J0JA 2GWNA 4LB3A 3WMLA 5HOSA 5KSWA 3KOZA 2FPTA 5LIYX 3RMJA 2VT0A 3UBPC 2OO6A 3W22A 4I5RA 1KFKA 3RLHA 3WLRA 3KTCA 2DDXA 3LHVA 4BKNA 2RHGA 2E1DA 5KZMA 1POJA 3H26A 4LUSA 4NX5A 1UP2A 4PMVA 2O9OA 4HA4A 1VFTA 3LMZA 3OJGA 3FW6A 2EF9A 1J6PA 1TPWA 3QH2A 4X60A 2CZ5A 3SURA 3ITXA 4C6DA 3GK0A 3N6QA 3LHUA 5L6UA 4F0LA 3AIUA 1T0OA 1QXLA 4C1NB 1E5JA 1VHNA 5IFTA 4HSNA 2HDJA 3LX9A 4L56A 4U5IA 3B8IA 1QI0A 1VIWA 3VZYA 3LQGA 3SRHA 3EX4A 4PYSA 1DJXA 4NVTA 5AOUA 5DFAA 1RK5A 3AALA 5F2MA 4ILSA 5C5YA 2CESA 1JCJA 3VA8A 1LUCB 1A80A 1HVXA 3MP4A 1GG0A 4FX8A 3DU0A 5EFFA 3B0UX 3MV01 5A6JA 3PWAA 2V5KA 2W91A 3AXXA 3WEMA 3L66A 4FHAA 2CBJA 4JBRA 4IFRA 5DY2A 2EG6A 2PWDA 3GDBA 1BQCA 8TIMA 4RCXA 4LUYA 1LL4A 2A21A 4QG8A 2INZA 3HPSA 4R7WA 3CO4A 4DX3A 1R3YA 3QR3A 2PDXA 4Q32A 4C5YA 1R7AA 2G3IA 3ZVIA 1EC7A 2CXEA 4LH8A 4ICNA 5LNVA 3FXYA 3WX7A 3CAWA 2B81A 3WFLA 3ENLA 3MQTA 5EGRA 4LEQA 3VD5A 1LORA 5AC5A 3RNDA 1RPKA 3A13A 3E5BA 1TJRA 4BQ3A 1E6ZA 1GUVA 3CIVA 1FWEC 3ZLHA 1TPFA 2ATSA 2QMKA 2V3GA 1BSIA 2R82A 1S39A 3TOYA 3HG4A 4ML9A 3DZ1A 1E6XM 3NG3A 4JL2A 2VCCA 1SO4A 2ISWA 3DG3A 3WEZA 4HZ7A 4C1LA 2PDKA 3A5FA 3NOEA 4ADSA 2C1HA 4R27A 3TN5A 3AMGA 3LSCA 2X09A 3AIQA 3KBJA 3G1HA 4JTAA 1OF8A 3NWRA 2PFHA 2FJUB 4LV4A 4XX6A 1JDCA 3DFNA 2GK1A 4GINA 2J74A 2V5BA 1VFFA 4G2DA 3M0KA 1TTIA 3SUUA 3VM5A 2CZEA 3SB0A 3DHFA 2FTYA 4ZOCA 1TPC1 2ODOA 2XM2A 2FVKA 3LGGA 4E3VA 2J9ZA 2XIBA 3S6TA 3A3HA 1D8WA 1KRCC 4HKPA 4MJZA 4QJ1A 3T7VA 3W6MA 1FKXA 3I7RA 3GKAA 4H41A 1WE5A 4GG9A 4WRHA 4JTRA 4MVAA 4M3PA 1UZ4A 3WN6A 1LTDA 4Y9PA 1Y8BA 2J7HA 4MUPA 3GS6A 1GHRA 3WDRA 3WQGA 5DF0A 4AZ6A 1K4GA 2PLCA 3GDKA 4QDMA 1TRIA 4FX6M 1VBUA 3VNIA 1HP4A 2F6KA 3RLUA 1EGZA 3GR4A 1OINA 1FX6A 3IJ6A 5REQA 1UR9A 5LIXX 3SADA 1XYMA 3QGAC 2Y4SA 4DYJA 3GG7A 1PCKA 2IKGA 3QZ6A 1GOWA 4DO4A 2VZSA 1JI2A 4LCRA 4J3TA 3WD4A 1HKMA 4TV6A 5HQMA 4D8ZA 1R86A 1VCFA 3AFBA 4IM4A 2Z1SA 3AIRA 2Y7EA 4KQNA 2XZ9A 2J9YA 4PTNA 3SW6A 2O9TA 5HJYA 3BJTA 3QFEA 4FLQA 3NPXA 3VDGA 1I0DA 4BF7A 1E70M 1OFDA 3MUCA 2A3CA 4JCMA 1FHVA 1QI4A 4DJFA 1JUEA 1KXTA 4XZWA 4PUKA 2X16A 1UD8A 3CUXA 1L6GA 1Q8AA 3OLDA 4UNIA 4GA8A 2UZ9A 1FUYA 2BY1A 2QUVA 3HV9A 1CXLA 1DIDA 3TQ0A 5G2WA 2QVNA 4DJDD 1WB0A 4K8GA 3OBAA 3W82A 1TPUA 5A6BD 3W7DA 3SSJA 3EXRA 1ONEA 3L65A 4D1IA 3TJIA 3U6WA 4AVFA 2PWGA 2E6AA 2VX7A 2OELA 3HFTA 4JFUA 5M17A 2V9DA 1MEHA 2C13A 3AWOA 5BOOA 2YSWA 5K4ZA 4GY1A 4JYDA 3ZQ9A 1LP6A 5E0FA 1HKIA 2YB1A 4YTSA 4HTBA 1ZRQA 5IRPA 3T40A 2V5JA 4L9XA 3WD0A 3ATZA 1BKHA 1B4EA 3BOXA 4GO9A 2PA6A 3SFWA 2NSXA 3VE9A 1QI5A 3S5YA 3RCMA 1NFPA 3IVTA 3PM6A 2GZXA 3CZEA 3KRSA 1I2OA 3LY0A 1NDWA 1UUOA 2DT0A 3EWUA 3NZRA 1OFEA 2GWGA 2VM8A 3VX1A 1JCYA 3ARXA 4AUBA 4PUMA 4PUWA 2XU2A 3GZAA 1FFRA 3TEVA 3HMJG 3RAOA 1EJRC 1RJQA 3DGBA 1UB3A 4DBSA 4HGXA 1FHUA 1ITCA 3RCYA 4QEEA 2ZTJA 3OLGA 4AZGA 2OSWA 2PDGA 1OWQA 4IFKB 7REQB 2Z2AA 3K1DA 3PSVA 1TKKA 2I57A 2DP3A 4K2SA 1TV5A 2BBFA 2CKSA 4HBKA 2V8ZA 2PURA 5C55A 3IGUA 3EPMA 5AHFA 3OG2A 1TX0A 4H6KA 3ARSA 1VAHA 4H9YA 3T78A 2CBUA 3FAXA 4MNMA 1XXXA 2XIJA 3E6EA 4JTJA 1R8LA 3GTHA 8XIMA 3OLIA 1N8FA 4FX7A 3HG2A 4GY7A 1OABA 3DYPA 1SUXA 2ON3A 4PB5A 2E40A 2YXGA 4GVHA 2QCFA 1OX5A 3ITGA 4UTWA 4V27A 2ZE0A 3WMBA 2ZX6A 1XIMA 2Z2BA 5I77A 1ZU8A 5TBOA 2XFWA 3TH6A 1FWJC 3DHDA 4W8LA 4M5PA 1F8MA 1AQHA 1W3HA 1P0NA 3C0JA 1P6BA 4HNNA 3TCEA 1FH9A 1IF2A 1Q6GA 3WEOA 3MSGA 3NQDA 2VX5A 2WB5A 3E2VA 3C8FA 4XSLA 4MWAE 3CUJA 3SECA 3A9IA 5H8UA 1YX1A 4MFDA 1JZ7A 2BMBA 4WSKA 1FDZA 1Q4NX 1V3KA 1GHSA 3MB9A 5BXRA 3CIWA 1GOIA 2XH7A 1JDDA 3WF1A 3QSTA 2PF0A 3VKAA 4XQ6A 2EKCA 4DXXA 4Z17A 3WMCA 3VMNA 5DBTA 4U2ZA 3SCTA 2FIQA 1EC9A 2B7NA 3O1NA 4Q8NA 2GGIA 1XKJA 4ZGYA 3R7MA 3O6AA 4Q8UA 4Q8PA 3PNZA 3LTSA 4JDYA 4NRSA 2X7WA 4CQAA 2BLEA 4N7QA 2EPMX 1H09A 1I8JA 3PNUA 3W7KA 1JZ8A 5TQLA 3BO9A 1TV4A 4JX4A 1UCWA 2D1ZA 4DNHA 3W28A 4E8GA 5FF0A 1FH7A 4IMCA 1AK5A 1C7TA 3HB9A 4IXHA 2VKZG 4NY2A 5HNTA 5A2CA 4DWDA 3KTSA 2AL2A 3AYTA 4RPQA 5E09A 3EDEA 3ARTA 3VTRA 3CWNA 4NJKA 3IGSA 4K8EA 2PGRA 4AWEA 5AYYA 1XBVA 3FAWA 4HMDA 2BV9A 3F03K 1EZ2A 2ZXDA 3VDCA 1K6AA 4LS0A 1PS9A 1XLIA 4QX4A 1H1ZA 3UG8A 1LT8A 2OEKA 3WNLA 2CLPA 2XISA 4AU0A 2ATMA 4PTWA 3W6LA 5JQ9A 2DUAA 3UWWA 4CNPA 4GFIA 3TR9A 4DBUA 3T4CA 3M64A 4NZ4A 4TVDA 5E1QA 2P1FA 3MHFA 1NDYA 1SO6A 2D24A 3B9OA 3GUGA 1UWIA 1F8IA 5DEZA 2J7FA 4JKLA 4LYPA 3PJUA 1W32A 2EO7A 4CVUA 1E4NA 4Y9OA 3RYSA 1W37A 3T9PA 1GOXA 3QTGA 2ZYFA 3DYOA 3PUOA 5M03A 3DFYA 3VIJA 3I7QA 1CDGA 4J27A 3AHXA 3BG9A 5DELA 4CCCA 4FNRA 1D3CA 2ZXQA 4EF8A 4OWGA 1W1A1 3BG5A 3BLKA 4O1EA 1G69A 1TB3A 2GJLA 5AN7A 1JXKA 4DWSA 3ITVA 1ZENA 3N4EA 4O1CA 3RHGA 1VEPA 1O6IA 3SGUA 3UP8A 1XSIA 5E70A 1JF6A 2XIQA 2AAAA 3R2GA 3EB2A 1D3HA 1V5XA 1G4EA 3AIVA 1ZBWA 1WZAA 1UWRA 3LI0A 3KCJA 4O53A 3PZGA 2ZX5A 3RRAA 3VIIA 2YDQA 2QJGA 2HROA 1XGDA 1HXJA 2QCEA 2GJRA 1ICPA 3FFSA 3MUXA 4Q8OA 4ZSTA 3CAQA 3QSRA 2CHRA 2FHFA 1M41A 8CGTA 4NZ3A 1O12A 1E6QM 2ZUWA 3EDFA 4LW7A 1JPIA 3M44A 2G96A 3DN5A 4WZHA 2Z0IA 3AHVA 1K3UA 1N8IA 3ARYA 2C71A 3QHOA 3S9ZA 1F7BA 2DJXA 3QR1A 1MSSA 3ZZ1A 2ZVIA 3VGBA 3MTWA 1XPGA 4ZB5A 4NQ1A 1QWGA 1BG9A 3TCSA 4IPLA 1X7IA 4JFTA 4EIVA 5I06A 1RVGA 4AIUA 3TP4A 4DHGA 3QV8A 1F74A 3FHAA 4C6QA 2WZIA 1JQXA 3OHIA 4JD4A 3OVQA 2HXUA 1MW1A 1FWBC 2ZX9A 4P8UA 3WBWA 1KM2A 2W66A 5XINA 3MVIA 1V6WA 3BG3A 4MDOA 4A4AA 1UMYA 2RJHA 2ACSA 3E96A 4RJEA 3M47A 4H8UA 1ZCOA 4LALA 2A7RA 1A3WA 3GKFA 1OCNA 2DSUA 2D3LA 1N55A 5FKYA 3SY5A 2GVLA 3K46A 2EPHA 3GIYA 5CC6A 4MTVA 4KW2A 1VS1A 2OQHA 1WKDA 3JR2A 4M6PA 1D7FA 4K38A 3S0CA 3CT7A 1AZ2A 2D73A 3ORWA 1LLOA 3TC7A 5I5RA 1J2BA 3AZTA 4NAFB 5BYWA 1TV7A 4O8RA 1K1DA 2RUSA 2V38A 4IIFA 5E9XA 1JEZA 1U30A 2OO0A 2PWEA 4QE1A 5CZJA 4D6HA 1XJBA 3GC5A 3SY8A 4DB7A 1R38A 2Y88A 3N9SA 3ME3A 3TFXA 1EFZA 3B8DA 3DENA 9XIAA 1EC8A 3SCQA 4W86A 1V3JA 4AHPA 2H8ZA 4YVVA 4GGBA 5A6LA 1MW0A 5EA9A 3DEQA 4XSMA 4C6JA 3I3DA 2FKPA 5D04C 3LD5A 4GJJA 4GQBA 2ZICA 3G1AA 5HMFA 4A22A 2NUWA 5AHNA 4HOZA 3AS1A 3ZVHB 3E2QA 1P48A 3KCLA 4H7CA 1KBBA 2PTYA 3U2OA 1WUEA 3ARWA 2GQ9A 3MYPA 1WPCA 3NQ6A 4M29A 3W75A 1Y65A 4IXXA 1OC6A 1HJUA 4TQTA 4UUIA 1OYCA 3MI2A 3EDDA 3G18A 2Y7FA 2E5CA 1R3TA 1R2RA 3CO8A 6ENLA 1WA3A 5FJRA 3I7SA 1NQ6A 2DSKA 1YNQA 2ESCA 3HGRA 4KCWA 1JPMA 4Y2WA 2NWSA 1HW6A 3CEPA 3RXZA 3VVGA 1RUSA 4UQDA 3BCDA 4JTQA 2CITA 4G56A 4C6EA 1UH3A 4JTLA 4W7VA 4PULA 4D6CA 4AZCB 4E4PA 1AH3A 4A3QA 3ZOAA 5A8NA 1XR2A 4OOZA 1EJXC 3QC0A 4U2YA 4PEEA 3O6YX 3KRUA 1YLVA 3CNYA 2BWGA 2D2HA 4OGZA 1AL7A 4XZIA 5K9CA 2O4MA 3WLKX 3L4ZA 1Z48A 4PH6A 3MMUA 4AX6A 2NT1A 4UQBA 2XN1A 2YDAA 3KBNA 2ANUA 3VGDA 3VOCA 2ZUNA 4ZTXA 3OVRA 4W7UA 2EAWA 3M0IA 1C8VA 1DJZA 4INFA 4M1RA 5AY7A 1VP5A 3KVMA 2DZVA 5AYBA 3MUAA 3HQOA 4DM1A 1XISA 2NVAA 2YCLB 4BY3A 2WPBA 4B15A 5D05A 4GVFA 1KBIA 4GD0A 4PEKA 1K8ZA 2X2YA 4ATDA 3L0KA 1TG7A 4HU8A 3LU2A 2R1LA 2OZ0A 4U31A 1V0LA 2OU4A 4O14A 3BAKA 1YNPA 4CQ9A 4EANA 3GH7A 4MDPA 4PUJA 1XYZA 5CJNA 4GJIA 3RU6A 2WVUA 1A3HA 5IXEA 1V77A 1UHVA 5AZ0A 5JUVA 3R4IA 5I02A 3GVRA 4H9VA 1IXOA 1KBJA 4Z2LA 4UQEA 2QCNA 4A3UA 1Q85A 1TUXA 1VBGA 4OQVA 2E0PA 4Z2IA 2ZUUA 3LERA 1YNYA 1KFJA 4Q4KA 4XKMA 2GQ8A 1DKWA 4MAZA 3GD6A 3K2GA 5D09A 3FDKA 2V2DA 3BSGA 5GJNA 4JTKA 1SMDA 4OUIA 3WF2A 4GACA 3UJRA 1MFVA 2QJHA 1X1NA 3CHDA 3G2GA 4DLMA 1OIFA 2PP1A 4AWUA 2D0GA 3UJ2A 5A8GA 4L6DA 1ELSA 5CPTA 1KRMA 3LM3A 1F3WA 3M0MA 4B91A 1PDYA 2INEA 2P50A 1K8YA 4JNMA 1AA1B 1JFHA 3W7RA 3NEHA 5A6KA 5C9WA 3D5HA 4OUEA 2E3ZA 2NT0A 3H2EA 5D2XA 2WC4A 4NT0A 3S3GA 3NQCA 4IPPA 4PA8A 4HHPA 5D8WA 3ZSSA 4LOCA 1Q6OA 3MHGA 2WC7A 1EXPA 2CERA 3KE0A 4Z0SA 1JDEA 1TFVA 1XLJA 4ZENA 5GVJA 2A0NA 5FJUA 4DO7A 3S1WA 4JHMA 1UD5A 4CNOA 3OW1A 5GNYA 1X96A 5HXMA 1CXIA 3DFOA 4IUGA 1XKYA 1I60A 4HU0A 4Q22A 1JCLA 3IACA 1SW7A 4MY8A 3W84A 1DJQA 3EGJA 1EPXA 1PUDA 2B7PA 3AXMA 3VIHA 4ZQRA 3ZVHA 3QV6A 3T07A 1OX4A 3E74A 3FJ4A 3H12A 3G1YA 5BOFA 2DU2A 1ZFJA 2YIHA 3PANA 2NQJA 3ABRA 3CV6A 1GOOA 3L5MA 3GLCA 4C65A 2Y2WA 4ZSUA 2D0HA 1MW3A 1RD5A 3ONCA 4LYRA 1SFSA 3N3MA 2OCZA 5IHSA 1TV2A 2W6RA 1Z3NA 2PGWA 3XINA 5C7HA 4IQDA 5CPSA 3R58A 4US5A 2ACQA 5J04A 2DORA 4ES4A 4JFVA 4BWLA 4B92A 3EEGA 3FCPA 4JQ2A 4I3GA 1UUQA 5EY5A 2WZMA 1ZCCA 5T26A 4HMCA 3GVWA 1ODUA 3EA2A 1B2YA 4AEEA 1E4LA 1QO2A 4NL1A 3PUEA 1UA7A 1T5AA 4C6CA 2IKJA 2FPYA 2I9EA 4U28A 3FGCB 4AZ5A 2A3BA 2OG9A 5CAHA 2X40A 1RJPA 4UCGA 2FMOA 4S3AA 5HK4A 2PDQA 5DX7A 3Q45A 3F5LA 1X97A 2PBOA 4NJIA 1FOBA 1PV8A 3CWHA 3LCWA 3GZ3A 1TWZA 1KA9F 1LLWA 2NXGA 4Y8FA 4NZCA 1M01A 1S2VA 1WQ5A 3ANVA 1QNSA 3CUIA 1JD9A 1LYXA 2VWSA 2YJQA 3QRHA 7ODCA 2WXDM 3BZJA 4PZVA 3LENA 2JIEA 2JKAA 1PTGA 1H61A 1JUBA 1Q7MA 2ZZ6A 1OFPA 4GBDA 4FI4A 4GUJA 1RA0A 3BLLA 1MNZA 4XZLX 4YWIA 1F76A 2H3DA 2VFHA 4XBSA 4O52A 2PP0A 1UOKA 1S2UA 2YCJA 1XCXA 1H0GA 3XISA 1KCLA 2V82A 4GUIA 4D8AA 1XG4A 2HPMA 3ITCA 1JPKA 4NKCA 3ARVA 1RHCA 1SW0A 3SUSA 4GXPA 1TE6A 3SRDA 1E0XA 3RLVA 4KEVA 2EKGA 2PLMA 1W3TA 3S1UA 3FSTA 5A69A 5CEWA 1O5RA 3SGGA 1P6WA 3WF3A 3N04A 2CC0A 4JHZA 1CZ1A 4X9SA 2I5QA 2XTKA 5IFPA 3A12A 4C7GA 3L0NA 3U48A 1VEMA 5A1AA 2RDWA 2HJPA 3NQ2A 4PB3A 1F05A 2WCSA 5L9FA 4XG1A 1MUMA 4GISA 4BWLC 1LF1A 3W7LA 3W83A 1UJPA 3G6LA 3QY8A 1B3VA 4BZYA 3WQFA 2WZEA 1PE1A 2WJZA 2YA2A 3GSMA 5DRIA 4BFAA 1U22A 1BYAA 4LVFA 4AHQA 3M5VA 3H6OA 3LRMA 4FP1A 1JQVA 3B0YA 3OODA 4E5TA 4CKQA 2JE8A 1KTNA 3KOFA 2Z1KA 5DRCA 3A47A 4MWAA 1GJWA 4JN8A 1AW2A 1E43A 2FQIA 5D2YA 3REQA 4G8TA 2VCBA 3Q2DA 4D9PA 2WOQA 1KFLA 4GH1A 2V67A 4NU7A 1EJSC 1TYGA 2RDXA 1SZFA 2BX7A 3ANUA 1WAWA 3S47A 3G1XA 2DQXA 2VDGA 3KBSA 3R13A 3IUHA 4XWUA 1PO9A 4ZVJA 3BSMA 4DWSB 1EWDA 1W31A 4ZOBA 3MHUA 4QIUA 4E2BA 1GVSA 3R12A 2Y0FA 4DO6A 3R6IA 1B31A 4L9YA 3OTRA 1O4UA 1ECEA 4D6GA 2PLKA 2BG5A 4ZMGA 4OVXA 3SGZA 3TW9A 4JIPA 2NXHA 3CQ0A 3AO0A 5E6ZA 2PDYA 3TDFA 3UGRA 2BVDA 3SI9A 1XYFA 3E0FA 3NZGA 3PN8A 1LUCA 3STCA 3B8SA 4U33A 1HTIA 1F9CA 1XIEA 3SIMA 3TZFA 3CZ8A 5M1TA 4J28A 2VGIA 4L80A 5C6MA 1VYPX 2PP3A 1IEXA 3IRSA 5FL0A 3LTPA 2RGLA 3KL3A 4GI9A 3T2OA 1FDYA 2ZA3A 3HTWA 2HNEA 1UKPA 2NX1A 2BGSA 4US5D 3T0BA 3PG9A 3QW4B 3U7VA 4WEVX 4M0XA 4PODA 5CPLA 5CG0A 1OB0A 1F6KA 1J93A 3IUIA 4N9DA 4MWAB 4ATWA 4RZBA 1U83A 1Q7ZA 4PUDA 2QHAA 1QHPA 2PGEA 4C6LA 1GNXA 2X0YA 2VFGA 3KBVA 4QTGA 4HSHA 4I9AA 1G01A 2G8ZA 2WZHA 1E72M 4LUIA 1HKJA 2ZXAA 1VF8A 2I56A 5A8OA 3KL5A 2YR1A 3N4AA 3B8TA 4C60A 3FYYA 4HD5A 5ECUA 3WQVA 3KVLA 1NP2A 4C6NA 3EOSA 3O07A 3QPEA 3AJXA 2GVJA 5I7GA 3FA5A 1FQ0A 2PRLA 1VQTA 4BQ4A 4H83A 2P3ZA 2Z28A 3GXNA 4QXIA 1LDCA 3EOEA 1QPKA 3TIMA 1SW3A 2J66A 3VFCA 4QE4A 1WZKA 3A9BA 1KFCA 3P5ZA 3V4BA 4NNCA 3SQLA 4AYSA 3LBMA 1UR0A 1UQYA 3T55A 3UPBA 3ZT6A 4F0SA 1JYNA 2J8FA 3OO2A 1UKSA 4QDWA 2P76A 3UETA 1TIWA 3QGKC 4CNSA 1OCBA 1UIOA 1K4HA 3P3BA 3O6CA 4YTUA 5BRQA 1OF6A 5JBFA 1TWWA 1G94A 2WNZA 3TTEA 5F4SA 2GLKA 2VURA 3WLSA 3S2LA 2WM0A 2Y70A 3F5KA 1TZ7A 1AW5A 1HIZA 2GGJA 1B9BA 3OEXA 1S5MA 4Q7IA 4UXDA 1US3A 4EWND 1TZZA 3W25A 1UD6A 3R1ZA 2O7SA 3TW7A 5D9OA 1PEZA 4C7DA 4MLJA 3ITYA 3ARUA 3PB2A 3IVUA 4TXEA 3SN1A 2F2HA 3IUDA 1T40A 3GTXA 3O16A 1Z41A 2HEJA 1JYVA 3BSHA 1KM4A 3WLOA 3C4UA 4RNJA 5LZLA 2YA0A 3MS8A 1G7VA 1EQCA 1HL9A 2I17A 1O68A 2BOGX 1GVQA 5JIWA 4OFCA 2BFGA 3LPPA 1UW9A 1E4IA 1VHCA 4B4FA 3L2MA 1H63A 4IIEA 3G1FA 4RLIA 2NWRA 5G1TA 1VYRA 2WSRA 3O63A 2W79A